4NW2A

Tandem chromodomains of human chd1 in complex with influenza virus ns1 c-terminal tail trimethylated at k229
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/viral protein
total genus 53
structure length 173
sequence length 173
chains with identical sequence C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nw2A02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nw2A01
1B4OA 2X6GA 1EL0A 2JYOA 1G6ZA 1B53A 5EPJA 1A15A 2B2TA 1ZXTA 4CJ2C 4R8IA 3MTSA 4ZKBB 4X3KA 2MJ8A 1LV9A 2K05A 4U68A 4ZKCB 3KUPA 2FJ2A 1BO0A 2N55A 1SDFA 1PFMA 5E4XA 1X3PA 4HEDA 2RSNA 1ML0D 5EKIA 1SAPA 1U4MA 5T1GA 3MWYW 2KEDA 4LMQD 3KBXA 3IL8A 1HUNA 1M8AA 1PFBA 1Q3LA 1S4ZA 1B50A 3I91A 2B2VC 2CVRA 4HAEA 4IUQA 1QE6A 3LWEA 4XT3B 5COYA 1B3AA 1NCVA 2IL8A 4QUFA 4RWSC 1AZQA 1DOLA 2B2WA 1PFNA 1JICA 2HCIA 1EIHA 2MPMA 4IUTA 4MN3A 5AFWA 4RAUC 1PLFA 1PDQA 1O80A 1IL8A 2X69A 4IUUA 3DM1A 1ESRA 1HUMA 5JJZA 2K1BA 2L9HA 3GV3A 1RJTA 4CJ1B 2B2YC 2HDMA 2DY7A 1RODA 1BNZA 1KNAA 3FDTA 1AP0A 2L11A 5CBAE 2KOLA 2KUMA 1WTOA 5CBEE 1X3QA 2SDFA 5T1IA 1MGSA 4OIKA 5D65A 1F9SA 2K03A 2NWGA 3FPUB 4ZAIA 5CMDA 1WTVA 1WTXA 4X3UA 1WTPA 1HFGA 5E4WC 4NW2A 1O7YA 2XIWA 1C8CA 1G2TA 2L12A 1DOMA 2VXWA 3D6WA 2B2UC 1RTNA 3IFDA 1U4PA 2L4NA 3QO2A 1HA6A 3UI2A 4QUCA 1KNEA 1DZ1A 1BBXC 5EJWA 1ILPA 3SVMA 2RA4A 1SSOA 2R3ZA 1WTQA 4XT1B 1EOTA 1MSHA 1HHVA 4XDXA 2KECA 1WD1A 2B2VA 1HRJA 1RHPA 1CA5A 1IKLA 1TVXA 3I3CA 2L1BA 3HP3A 1MI2A 4CJ0B 1JE4A 1RTOA 3DEPA 2B2TC 3ONAB 1G2SA 2Q8RE 1CM9A 1J9OA 1NR4A 2N88A 2Q8TA 1B2TA 4IUPA 1XX8A 2HDLA 2BDNA 1EQTA 3F2UA 2JP1A 1ILQA 4O42A 1F2LA 1WVLA 2MGSA 4HCSA 4R9WA 1ICWA 4RA8A 1CA6A 2FHTA 1J8IA 2HUGA 5DNFA 2B2YA 2EOTA 3G7LA 2RVLA 1DOKA 4IURA 4X3TA 2D9UA 1EIGA 2FINB 1WTRA 1X32A 1F9RA 1QNKA 3I90A 2K01A 5EPKA 1U4LA 4DN4M 1HFNA 2K04A 1GUWA 5D14A 3N52A 1WTWA 2DY8A 1U4RA 2HCCA 4HSVA 4ZK9B 5EQ0A 1AZPA 1IKMA 1E0BA 1F9PA 1BF4A 1DONA 4OIJA 5EPLA 2KVMA 2MP1A 2KEEA 1QG7A 3R93A 1NAPA 2B2WC 5CORA 3GV6A 3I8ZA 2B2UA 4UAIA 2FFKB 2RSOA 4MHEA 2M2LA 4X3SA 1G91A 1NR2A 1VMCA 3Q6SA 3DEOA 4IUVA 4ZLTF 1F9QA 1O7ZA 2K28A 2NYZD 3TN2A 2FMMA 2H1EA 2X6LA 3H91A 1MSGA 2EPBA 3P7JA 1XYIA 1VMPA 2NZ1D 2EE1A 2J7ZA 3TZDA 1WD0A
chains in the Genus database with same CATH superfamily
2IT1A 3JC66 1RL2A 3HOXH 2B8GA 4XQJA 4DV1L 4AQYQ 3MXPA 4N9PA 2BH8A 1JB3A 4DAVA 2AWNA 2RSNA 3K57A 5EKIA 1U4MA 2AQ1B 5T1GA 4DKAC 4DV5Q 2KCMA 4PQXA 3PF5A 1WCMB 3JAMi 1AE3A 1IW7D 2F0OA 4A3MH 3A8KE 2XRSD 1A0IA 3KLSA 4A3KH 4A4IA 3V2TA 4Y52H 4RKLA 4K5WA 1K8GA 4RWSC 3G71A 1VQ6A 1PTOH 1LTBD 3BVMA 1N36Q 3PCOB 3M9BA 1HR0W 3HKZG 2HHHL 2H4OA 2JA6H 4CJ1B 1SFOH 4BBSH 1VQ9A 2F0MA 4YWKA 2WACA 1KRSA 1ET6A 1TWFB 1O7IA 2KOLA 4POGA 1CQFA 3PO2H 3PO3H 4A3BH 3S1QH 5KNBA 1HCZA 3GTKH 1E2ZA 1X9NA 3D0FA 1JR0D 5D65A 3T53B 5BR8Q 4UY8C 5A2QL 2F0FA 3AFPA 1PXUA 1JT8A 4B3RQ 2XWJB 4QUCA 2NVYH 4C3HH 2IJ0A 2KHIA 1SJHD 2VY3A 4HR7B 3R3OA 3E9HA 1SRUA 4WJWA 5KYIA 1WOCA 4DV0L 1EY9A 3S24A 3HOYH 1EQTA 5C44H 4LFCQ 4A3GH 2B3GA 5BN5A 4KTAA 3D4RA 1OXTA 2R92H 2O5JC 5CR3A 2YV5A 4CDDC 3OIPA 1K73C 1J6QA 2HCCA 4KY6A 1P16A 2OEOA 4XQQA 1TS5A 3S15B 3HOWB 2MP1A 2NN6G 1Y1VG 3RZOB 3OYYA 4JI2L 2JA5G 1LO5D 3PGZA 3KJOA 1K3BC 1SYBA 3CCUA 2XN9C 4DV2Q 4K0KQ 2YTVA 1VMPA 5IT9L 3VR3A 4JCVE 1FYCA 3GTPH 2OQKA 3TMEA 5C4XH 2JEAI 2EJFC 1UE6A 1XPRA 4N8X1 1VQ5A 1TWHH 1PFMA 5IGCA 3K5MA 1NJIC 4DXGA 1HR0L 3Q8DA 2NVXB 4X65Q 4LF7Q 1K8MA 4JVZA 1IBMQ 3IL8A 1STHA 1D1KA 4DK1A 1B50A 5C4HA 3A7AB 1NNXA 1AEXA 4IFDI 1IBKQ 1DXMA 2A5HA 3OW7A 1DOLA 3RZDH 1EIHA 5HURA 5ELDA 3NQIA 1LUZA 2IW3A 3KF8A 3U4VA 4JI3L 3PUVA 1TT2A 3VR5A 3BYYB 2QKIC 1XNQQ 2QEJC 2F03A 3LGJA 4HMIA 5IYBH 5I6YA 2N8NA 2I46A 1ONLA 3NXWA 1STYA 2PNHA 2VQEL 2KHJA 4LAAA 1A63A 5F2DA 4C1NI 4C1NK 2YTYA 4O1NA 2R93H 4OWWB 1OO9B 1U4PA 1XPUA 4AQYL 4QB4A 1JWSD 4B3ML 5J1ZA 5EJWA 1E1TA 1VQHA 3D4DA 2RA4A 2IHEA 1FD7D 1GD7A 3E6ZX 4QJFA 5C3EH 5D3DA 4DV5L 3K0XA 2F0VA 3E5SA 1JE4A 4DV6Q 1EYCA 1G2SA 2WKCA 4V190 1SE3A 3LWUA 3M4QA 1HNXQ 3OOCA 2VNUD 2WKDA 1J8IA 4FXDA 4ZCKA 1HTLD 5M3FH 1H95A 3H0GG 4PV1C 1N36L 4LF5L 3FRPB 3A5UA 5E1FA 2KJXA 2R7ZG 2EYFA 4OO1G 1CZGA 2WINB 4ZK9B 4KV6A 3GQBA 3KLRA 5CORA 3K5NA 4CBVA 1I50H 2M2LA 1QUQA 4GN3B 2NBFA 2CW0C 4CKCA 1ENCA 4YY3L 1EEID 3MEFA 4CDEC 1S5ED 3X3NA 4B3RL 3HOVG 3AFQA 3BJUA 1WD0A 3I4MH 3ND9A 1B53A 4FDBA 3Q24A 2K5QA 2HIXA 4NP5A 3S1MB 1TWCB 3ULJA 2NZHA 3H3VC 4IFDH 5IGEA 4A3FH 1GUGA 4LFCL 2KEDA 4K8JA 2PI2A 5M5YB 2FXQA 3IKJA 1STBA 1M8AA 1PFBA 3HKZB 3A55A 2F3IA 4EQOA 4IO9A 2B29A 4RGOS 1QWYA 4YCWA 2EXDA 4DAMA 1O80A 1M1KC 4JW0A 2M00A 2VUMG 4JI1Q 3VYTA 3LX0A 1EY5A 4OX9Q 5CBAE 1SE4A 1WTOA 1I6HB 1EY0A 3K81C 1FNVA 4DV2L 1VQMA 4DR4Q 1PZKD 4BY7H 1LTID 2KHSA 4JBWA 1YNJD 5CV7A 4A93G 1RTNA 4UDUC 2TSSA 4B3TQ 1D5XC 1BBXC 5I2YA 1STNA 2R3ZA 1EOTA 1JORA 4K14A 1IBML 2K5DA 4Y7NH 3GD7A 3I3CA 2L1BA 2B2TC 3TSSA 1TU2B 2UXBQ 2JJQA 4KY5A 5FK9C 2HDLA 1UE5A 4ZUIA 1ILQA 1D8LA 2E2HB 3DWPA 5CV4A 3S1RB 3G48A 4A3JG 3A54A 1PZID 3GO5A 1VQ7A 1X32A 3I90A 5EPKA 1HFNA 1U4LA 1PH9A 1X3GA 1MHWC 5I9PA 1YVCA 1EU3A 3M4PA 2DY8A 3DMUA 2F4VQ 4FNFA 1M4VA 1TWGH 2YU9H 2PZWA 5EPLA 1JCKB 3R93A 1NAPA 1LACA 4X6AH 1JWMD 1K3RA 2SEBD 4ZLTF 3PMFA 1H9JA 2K28A 1U5KA 2E8GA 1KLUD 4WJ3M 3V96A 2EYMA 5TSSA 2V1CC 4HTHA 4KKSA 1QCBD 4CJ2C 1X3EA 3K7AH 1HZCA 1NMGA 4DV6L 1B70B 2G9DA 4GLVB 4GNXC 4KJNA 1HNXL 1BBUA 1WTHA 3OW2A 4ZYSA 3PIP3 4APVA 2Q2TA 3P20A 4P2CB 5C3XA 2R93G 2NVTH 4RH6A 4BBRG 4NXMQ 5LMNW 1PDQA 1ESRA 3T4AC 4RGMA 3WOFA 4DV7Q 5IGFA 3EIVA 3ZYYX 1DGSA 2B2YC 2CHBD 1RODA 1UUPA 1KNAA 1ZYRC 4CKEA 1B9NA 1X3QA 1BVSA 4GNXB 5K36H 5GAEC 5DEHA 3MFGA 1WTVA 3FPPA 2L12A 4EGVA 3P1HA 2SNSA 1E2VA 2N78A 3TDQA 1EY8A 3T56B 3KBGA 2R7DA 4ME3A 4C2MH 2E2IH 1A6XA 1L1OC 5IYDH 4JOIA 2B2VA 4IPGA 2BOSA 1TQOA 3HOXB 1CSQA 2A69D 1EQQA 2PO4A 3KLWA 2R7ZB 1R9TH 3CQZB 2QA4A 3UE0A 2DJFC 1HQMC 2RF4A 1D5ZC 4R9WA 1K83H 3MXNA 4JBJA 1NMFA 1CHQD 1I4RA 4IURA 2F0QA 2NN6I 3S1NH 4JI1L 1QNKA 2O5IC 1O78A 1W3SA 2RDGA 2UXDQ 1IW7C 4HSVA 4BXXH 1JQYD 3CRKC 1XMQL 1L1OB 3TRZA 4RGTA 4UAIA 1DJRD 4PG3A 1JJ2A 4NPSA 3CMAA 2EYHA 4LW1A 2NYZD 1EFID 4GLXA 3PO3B 2X6LA 3MAQA 1YIJA 3E3XA 3DM3A 1Y8NB 2NZ1D 4B3TL 2EE1A 3S17B 5IT9c 5FJ8H 3TZUA 1DM0B 4A3EH 4X66L 4K8IA 4MZ9A 1YI2A 1KAWA 3T1YL 2MJ8A 2UUAQ 5C6AA 4U68A 5LMNL 3PIPA 1FL0A 1IHZA 1ESFA 3J80i 2UXBL 2QGQA 4JC0A 4C3HB 4DR3Q 3DHQA 4QCLA 1VQJA 1I5FA 4KHVA 3NQTA 4BY7G 2JSOA 2CH4A 2PPBC 1LT3D 1NBWA 3HZXA 4HN7A 4IUQA 4C3IH 3HOYB 1NY4A 3EJIA 2I5HA 3GTJH 1JICA 4MN3A 2F4VL 2A73B 5C4ZA 5J39A 3NBHB 4JK1C 4RG1A 4R4TA 5A2QE 1SROA 2WFWA 5JVH3 1E7ZA 1UAPA 2ICEC 3TEHB 2LSSA 2RDHA 3C2PA 5JAVA 3NUCA 1H9SB 2B2UC 3K80C 2LXKA 1CKNB 3QO2A 1JOKA 1JB7A 2E5LQ 4DXFA 1RIPA 1QJOA 1MSHA 1KQSA 3GTPB 2YTXA 4DAYB 1HNZL 1KDCA 4C3JH 3QOLA 1TWHB 5JEAG 1BCPF 3HOZG 2Q8RE 1A3VA 1SEBD 2DN8A 2K52A 4G4KA 1YZ6A 2QEXA 4LJZC 3J81i 3I2ZA 3MVVA 4NXNQ 3ITPA 1MBYA 4WORA 2F0NA 3CW2C 1Y8OB 3D4WA 3X3MA 4LUVA 1Q81C 2QF7A 1UEAB 5IP9H 2Z0SA 3Q23A 1V1PB 3CU7A 3J81j 3H94A 1R4PB 2KEEA 1EY7A 2FFKB 4KN7C 2E2JH 4DR6L 4N9TA 3NHHA 1NR2A 1I4QA 1LT5D 5EGTA 1Y69U 3EA6A 3G6EA 3HFZB 1I94Q 4IOAA 2J7ZA 4FXKC 4QGUA 1N34Q 1VQPA 3H09A 1PH2A 2AQ2B 5EPJA 2E76C 3OMGA 4KHZA 1LV9A 3I72A 1XNRQ 2R93B 1BO0A 3W2DA 1B3QA 5E4XA 4L8JA 4BBRB 1L0WA 1BDOA 4MNOA 3MWYW 1E22A 4KI0A 1Y1WG 3KBXA 2L15A 4R4IA 3K5OA 4I7ZC 4X64Q 4YWLA 4I7AA 4ABNA 3I91A 1PTOD 3GTOH 5E7NA 5M5XB 4QL5A 2D0OA 3E0EA 3NWSA 1BUVT 4G7ZC 1L2FA 4LFAQ 3EFXD 2UXDL 1NCVA 3UDIA 4UPAA 5FLMG 5ELNA 5J3BA 4KHPQ 1AE2A 4DR7L 3NPPA 1SE8A 2JK8A 2ZM6Q 1UE7A 4DV3Q 2ENBA 4G7OC 3F2BA 5FO9B 1Z47A 4CGYB 1SNOA 5NUCA 2Z6KC 2GN5A 1DD2A 2G9HD 3CMEA 3TP6A 2IX0A 3L9AX 4XTCS 5CMDA 1VQKA 4K2LA 5ELFA 2Q2HA 4X3UA 1I50B 5IIFA 1G2TA 5M9OA 2UUAL 5LL6X 3CCVA 3CHBD 1KNEA 1PRTF 3BG3A 1STGA 1SYGA 3QB3A 3I4MB 1HZ9A 3H15A 1WD1A 2CKZB 1KTKA 3CD6A 2BA0A 3F8TA 5G3LF 1XPOA 1B2TA 2J0TD 4OWXB 3FHWA 3OWFA 1V1QA 1WVLA 4HCSA 2OTLA 1SNMA 3CXCA 2A6ED 4IJLA 1Z6HA 2G5DA 3M4OB 4DK0A 3BZKA 1GUWA 3GTGH 1WTWA 1YJWA 4EQPA 1C48A 2HIVA 2NVQH 1IZ6A 3JAML 3HOUH 2B2WC 4KY7A 2ASBA 3VA7A 3C46A 2IY5B 2P5ZX 2HD3A 3Q6SA 4B9WA 3ULPA 4A3DH 2ZXOA 4J6HA 1MSGA 2JQOA 3I70A 3KYHC 1XMOQ 1HH2P 1BOSA 4BY7B 2NZOA 3OHXC 3PUZA 4R8IA 3MTSA 2GVBA 4FP5D 3SXHA 4K2KA 1I4PA 4QQBX 1TIID 1NE3A 4DNIA 4OGQC 1BQQT 1YNJC 4CDCC 3NTHA 4HIMA 2QW7A 3FMCA 3OPOA 2B63H 3ICEA 1DCZA 5C4JB 1AW7A 1Q1BA 5M3MH 2CWAA 1AFPA 4B9XA 3VYRA 3S2HB 3L3OC 5CV5A 3F1ZA 2UU9L 3PQIA 1B3AA 1X55A 1GJXA 3W1BA 1W6KA 1IL8A 3VYUA 1HUMA 2L9HA 3CP0A 4DR1Q 4JBMA 4UP7A 5KEEA 2HQLA 3FKIG 3SE0A 3EVQA 3STBD 2UUBQ 2F0UA 4GOPA 5BN4A 3T1HQ 1Z9FA 3ULLA 1RF2D 2EXZA 2K03A 1GO3E 4IQZA 4LF9Q 2I5LX 4BY1G 1N34L 1K8AC 1BBWA 1HZAA 2M9VA 4QMGA 4RFBA 4L5RC 1TS3A 3AB9A 3HOZB 1GM5A 4UP8A 1UEBA 3UI2A 1TKWB 2KECA 4X64L 1RHPA 5AJ3L 1CA5A 3GTLB 5C0XG 4YIJA 1VQ8A 3K7AB 2XSCA 2Y0SE 3QR8A 5ELEA 1BR9A 4DUYQ 2EY2A 1OXXK 4LFAL 2HT1A 1X56A 4TKOB 4RA8A 3A74A 3SR1A 4KHPL 2B39A 3L0OA 2JA8H 1K28A 4DV3L 1PA6A 1F9RA 2CFMA 3GTMB 1VQOA 4L5TA 4DV4Q 3SDZA 3K59A 2OTJA 2A6HD 4OIJA 1I3QB 3S16H 5IY0A 1CKOA 3MXUA 3EN2A 4A3LH 5CV6A 4X3SA 1UNSA 1HNWQ 4F87A 3S14H 3ND8A 3TN2A 1KC8C 5C0XJ 1GUOA 2MO1A 2Q2UA 1STAA 1Y1WB 3RN5A 1T5EA 1EL0A 3KLSX 3HOXG 3K8AA 2RCFA 3N6RA 4GS3A 4J15A 5ELBA 3KF6A 3KUPA 3NTKA 4L6TB 2KENA 1L0YB 1SE2A 3CCRA 2N49A 4P74A 3NK9A 4CDFC 1BCPD 4CKBA 4C2MB 4OHJA 5BR8L 1VQDA 4A3MG 3J7AV 4J1MA 3GTQH 4A3KG 3HEJA 3BVGA 4HAEA 1M90C 1YNNC 4Z9CB 4P71A 4QIWE 5ELCA 2DUDA 4LFBQ 4BA2I 2TMPA 1EUJA 4ALPA 1ENAA 4IUTA 3U9SA 5I2XA 5LMUQ 2JA6G 5BN3A 1WCMH 4BBSG 2F3WA 4IZ8A 4ZRZA 3S1NB 1OXUA 4U673 1GKHA 1CKNA 5IGGA 3PO3G 3PO2G 4A3BG 2L11A 1A3UA 1EYDA 5T1IA 3MXGA 2F3VA 4RMFA 4IN3A 4DAYA 1GUNA 1XMOL 2LFNA 5H1SE 2AHOB 1YNXA 3A0JA 3RLFA 2AMCB 1DOMA 3D6WA 1WFQA 4DR5Q 2A68D 3I4LA 3DXJC 3CC7A 1PVOA 1DZ1A 4C3HG 1TWFH 5FO7B 4JPBW 4PZ6A 3O13A 1TY0A 1CQVA 1EFWA 2Z1CA 3A56A 2I07B 1KIXA 4RHSA 3TQYA 3R2IA 4H02A 2F0KA 2K14A 2N88A 3HOYG 5C44G 1S40A 4IUPA 4K0KL 4A3GG 1JC7A 2EYPA 1V1PA 2ZJQA 3PF4A 1N8RC 4JV5Q 5E3FA 1F2MA 2R92G 1Q90A 4B3SQ 3Q0AA 1W6JA 1EIGA 1SYFA 1LLRD 2CH4W 2EY6A 3HRZC 4C3IB 3S2DB 4OL7A 1K9MC 2FMCA 2WAQB 4X65L 3GTJB 1GXDC 4LF7L 1BF4A 4JYAQ 1CUKA 1GHKA 4KK7A 1EU4A 3I8ZA 4LF9L 4R1JA 2F0JA 2VS1A 2QDBA 1O7ZA 2PQEA 1J5EQ 1IBKL 2WV6D 2BA1A 2MUYA 1B7YB 2OWOA 1K0RA 5CC4A 5C4XG 4A3IH 3HOWH 1PRTD 1LTGD 2YYZA 5CYUA 1XNQL 2JA9A 3J7AF 1X3PA 4EX5A 4H13C 2RKSA 4WRDA 4H7BA 4DUYL 2Q2IA 3NENA 5G3LD 3KFUA 1MJCA 2ATWA 3KDFB 2GVAA 4A3CH 2EDGA 2WAQE 3FKIB 4R4QA 4FYDA 3EROA 5JVG3 1AZQA 3V05A 1QB5D 1SNPA 4DV4L 1G8ZD 1GOZA 2NVXH 1D5MC 2K50A 2KCNA 1AN8A 3DM1A 4BY1B 2ZXPA 1CI3M 5C5MA 4JI5Q 3TP8A 5DAUA 3KOJA 5GROA 5IYBG 2KUMA 1MIUA 2K6AA 5KYLA 2SDFA 4GN4B 2V4DA 4OIKA 1CTMA 2D2CC 3FPUB 3IAYA 3I56A 1C8CA 2E2JB 4IUNA 4KN4C 2L4NA 1CSPA 4JG2A 4DUZQ 3ERQA 4MTKA 5EAYA 5KRUA 2ZT9C 4DR2Q 5C3EG 1YJ9A 5JJIA 5IP7H 3SGIA 4H0LC 3URYA 3K7UC 1IKLA 4HJ5A 4MIUA 3ONAB 2MNAA 2RHQB 1J9OA 4PMCA 2QCPX 1QILA 3K6OA 3H3VI 4B08A 4NDXA 4DK6C 2WB1B 4TRDA 2Q8IB 2B8FA 1YJNA 2F0WA 4OEMB 5M3FG 5I4DA 1Q46A 1UE1A 1S5DD 1SMXA 2JA7H 3GTOB 4GLAC 4OELB 4DN4M 2K7VA 1Q8KA 1EYAA 5A35A 1PTOC 3TP5A 3JAMc 1RKNA 1CT1D 2JXMB 1ZKOA 2MHVA 3VR6A 1CFMA 2E2DC 3MC0B 1QVFA 2RSOA 4K5XA 3E9IA 2F0DA 1TXYA 2AQ3B 4PNYA 5JOBA 1S72A 2PZUA 3H91A 4DR5L 3P7JA 3VA5A 1JOOA 2VB2X 3I4MG 3PV0A 3I4NH 1QNUA 1B4OA 2X6GA 4V0BA 3UDFA 4A3MB 1A15A 3VR2A 4A3KB 2K05A 2XRQD 2N55A 2WB1E 5M5WH 4IFDG 5JPMC 1ZEQX 3F2DA 2OT2A 4OX9L 1PMRA 4A3FG 4LF4Q 1PTOB 2L55A 2EYOA 4LMQD 2LY7A 3K5LA 4DR4L 3DWAA 2JA6B 4RCOA 1SFOB 4BBSB 3S1MH 3PO2B 5KNDA 3S1QB 4A3BB 3GTKB 1RDPD 1D1IA 1JWUD 1C4QA 4KMUC 1OXSC 4LF6Q 1N32Q 1N33Q 3HS0C 4S3SA 4KD3A 5LL6S 5JJZA 1S5CD 5M5YH 1SYEA 1E3PA 3NELA 3RNUA 4DV1Q 1X3FA 5I9OA 1BNZA 3VYSA 5EKKA 2PW7A 1B9MA 2NVYB 4A75A 2NVQB 1J5EL 2A8VA 4C56C 4IFDJ 3QIAA 2Z9HA 3VDYA 5DM63 1WTXA 3MEHA 3MZ5A 4NW2A 1FR3A 2OF1A 5C44B 1HA6A 3CCLA 4A3DB 4KJOA 3M7NA 1D7QA 4A3GB 1AH9A 2R61A 4NB3A 1YITA 1ILPA 3BDOA 5IYCH 3CPWA 3SHLA 1VQEA 1EEFD 2R92B 4JI8Q 1KDAA 4L5QA 2HHHQ 2J4XA 4QF4A 4F7XA 1EWHA 1D2BA 2Y0SG 4RCNA 2B63B 1IYVA 3W1GA 2E74C 3JAME 1DOKA 1EOVA 1WTRA 4LUZA 2F0TA 4JI5L 5JJKA 1LM0A 3W3AA 3J80L 3U9OA 1QUQB 1S5FD 2CQOA 2RHSB 2IX3A 4LF8Q 3SK5A 3OTOQ 5C4XB 3GV6A 2NN6H 4Q5VA 4XIGS 1Y1VH 1Q82C 2EY1A 2NTSA 2JA5H 2EJGC 4DV0Q 4JI7Q 1K0SA 3PUWA 2FMMA 4OO1I 3I55A 1WYDA 3L2PA 4HJ7A 2UUCQ 4KKUA 4NXML 1VS0A 1G6ZA 3STBC 5IGDA 4X3KA 4DV7L 3HGBA 4ZKCB 1SDFA 2ALYB 1JJCB 4HEDA 3RZDB 3U4ZA 1X54A 1XJVA 4G7HC 4LWCA 4AYBE 5IT9E 4RGNA 2QDLA 1Q3LA 1SMYD 1FJGQ 3QJYA 3A8IE 2CVRA 1VQGA 5CGKA 2LKVA 2MFIA 2DJGC 3ZJYC 1P8LA 5AFWA 4WFN3 4RAUC 5I6WA 4FF2A 2VQFQ 2L5TA 4F8MA 4DNRB 3R2TA 3LNNA 1L0XB 1SNCA 2Z8LA 1U9RA 3BVZA 1B44D 4QY7A 3J81L 4RHRA 5K36G 2PI2E 4GZYC 5C3EB 1KRTA 3NEMA 1STEA 4IPHA 3U58A 1OXVA 2IX1A 2DNEA 2D5DA 2A6HC 1Q86C 1A3TA 2AKWB 3S14B 2ZTDA 4DF7A 4P72A 1QZGA 5FO8B 4PMWA 1H9KA 1PH3A 3SVMA 1EIYB 4LF4L 3RLOA 1H9MA 3M7GA 5IYDG 1HHVA 4JI3Q 5M3FB 1HJPA 1HRJA 3VR4A 4XXEA 4BS9A 1TVXA 3SEBA 2BE5D 5GQOA 1RTOA 1CM9A 1JJGA 3FP9A 1SYDA 4LF6L 1N32L 2HUGA 2ZXRA 2VQEQ 5JJLA 1N33L 1BCPC 3GTQB 3H0GH 4EQNA 1MJEA 4Q0FA 4DNTB 2R7ZH 4B3MQ 3CQZH 4OO1H 4BXXG 1PH1A 3NP8A 3R8BA 4DR3L 1T9HA 4YWMA 2F52A 3UDXA 4EVOA 4UHVA 4DPGA 2EY5A 2KA7A 1LT6D 2K5HA 4IUVA 1VQFA 4A3FB 2H1EA 1EYGA 1HXYD 5FJ8G 3HOVH 4A3EG 3KDFA 2NUCA 2ZTEA 2B2TA 1R4QB 1BCPB 2R6GA 4JI8L 3SK8A 4LF5Q 4GKJQ 1C9OA 2PYKA 2VZAA 3WDNA 3WWVA 3M3YH 1FNWA 2VB3X 1PH6A 2A68C 1F2YA 3S17H 4XYOA 4DK3C 4JOIC 2B2VC 4C3IG 3G6JB 4YY3Q 3LWEA 2WAQG 2E5LL 4LK1C 2HCIA 5IYCG 1PYWD 4LF8L 1YHBA 3NWTA 4FVMA 3OTOL 3PUXA 2QILA 1G291 2VUMH 2WIIB 3MA2B 5J22A 3Q22A 2C9OA 2PNRC 3PIO3 3FDTA 5GAHC 3TS2A 4JI7L 1CHPD 3K58A 1E2WA 4Y7NB 2UUCL 3L7ZC 3BZDB 4ZAIA 3SK6A 4I65A 4NXNL 4AH6A 5E4WC 4O0AA 4P75A 1C7YA 1PZJD 2ICIA 4GNXA 3BDLA 4A93H 4NMZA 3QG1A 2K5WA 2Y0SB 3CC4A 1EZ8A 2LMCB 3BU2A 2RDFA 1TR5A 3RN2A 1O7LA 5GAGC 4C3JG 4A3IB 3MXNB 1IBLQ 3AEVA 5IODA 1FJGL 3DEPA 3EBEA 3T51B 1PRTC 3CCSA 1TWGB 2YU9B 1I94L 4L63B 3RLNA 3CCEA 2FHTA 2XGTA 4POFA 1B1ZA 2B2YA 3D31A 4X3TA 2D9UA 2VQFL 1PFSA 4A3JH 4O2DA 1XNRL 1X6OA 4FO2A 1A2UA 5HGTA 5FLXL 4PZ8A 2ZJPA 3N52A 1TWAH 1U4RA 5IP9G 5EQ0A 4ILWA 4OWTB 3TS0A 1Z7TA 2KVMA 5EKLA 4WJ4A 3KK7A 2D0PA 4LNQA 1SN8A 2C35B 3EQLC 4IALA 1VMCA 2A19A 4N8FA 3C1FA 1PRTB 3I7FA 1HTPA 1L1OA 2K04A 2BH2A 3TZDA 3NSWA 2ZM6L 3UE1A 2F0PA 4NKLA 3J7YW 1ASYA 2NVTB 5HGQA 5KNCA 1A62A 5DLQE 3CCJA 2WB1G 4QIWB 2DGYA 1TS2A 3A5ZB 2PQAB 1QVGA 4FF3A 2F0GA 2AUKA 3CCQA 2F0IA 2ZTCA 3D8GA 1ICFB 4QUFA 1LYLA 3PIOA 4BBRH 3RD4A 4JI6Q 1PLFA 1RCVD 1V8QA 2JN4A 4P73A 2JA7B 1Q7YC 1QZHA 4K5VA 4G57A 5JPNC 1B8AA 5M5XH 3M85A 1S5BD 2XWBB 5EBCA 2E2IB 1SXTA 4MTNA 4K6DA 1HA5A 2RQXA 3NTIA 2F0SA 1ENFA 3NBHA 1PYSB 4BA1I 1CZWA 1Q1EA 1O7YA 2BCOA 1R9TB 2PW5A 5HY6A 1PV4A 3IFDA 3BYTB 4GKJL 2A69C 4PZ7A 2IPKD 5EBDA 1KXLA 1K83B 5KGUA 1VF7A 4HJ8A 3I4NB 1VQ4A 4M8AA 1FVIA 1H9SA 3D3RA 2NTTA 1MI2A 3J7ZC 2Q8TA 5M5WB 4E6IA 3F2UA 2VW9A 1ICWA 1QVCA 1TY2A 2A74C 4IPDA 5DNFA 1U0LA 3S9WA 1Y8PB 2FINB 3PUYA 2JE6I 3J80c 3DWQA 5ISRA 1YEZA 2PMZB 3TREA 2UXCQ 1VQAA 1D6EC 4YCVA 4A3EB 3HOUG 4KKTA 2B2UA 1MKHA 4A3DG 3M4OH 1I4XA 1PH4A 1SYCA 1LTLA 1XYIA 3B6YA 1VQNA 1Q12A 4OONA 2WP8J 3ER0A 2JYOA 3NE5B 4HJ9A 3GP7A 3M4YA 4DR1L 2K32A 2PZTA 1IBLL 3T16A 1SLJA 2UUBL 3T1HL 1ET9A 1XMQQ 1W2BA 2B63G 2KBNA 4JI4Q 3WOEA 4ME5A 5M3MG 1DYQA 1HUNA 2EIFA 1KD1C 2PMZE 3BZCA 4FXGC 4AYBG 1BKBA 1LABA 4XT3B 4LUOA 1F2ZA 1I4HA 2PCFB 1KAAA 5KIXA 2ES2A 2EJMA 3S15H 3HKZE 1QOHA 5C3WA 4CHTB 4DGZA 4X66Q 5D3IB 3RZOH 3GV3A 3T1YQ 3QOJA 5C4JH 1IYJB 5LMNQ 5LHY1 4A76A 1KABA 3S2HH 4YHHQ 4X62Q 3J81c 1SJED 2Z4IA 4J8QA 4IOCA 1F9SA 1PTOF 1EY6A 3IRBA 4C3JB 1A8VA 1Y1VB 2ID0A 2JA5B 2H5XA 1YBYA 1JOQA 4YCUA 5FKAC 4UP9A 3PSIA 1IL2A 2CQAA 1HQRD 2SNMA 1VQCA 3K0YA 3OSOA 2K75A 2AUJD 1IYUA 1HNWL 5JEAH 4FF4A 2O2LD 3HOZH 1SNQA 1VCIA 3J80E 4O42A 2MGSA 1EQRA 1GHJA 1XWEA 4JI6L 2EOTA 1SR3A 2JA8G 3D6CA 2IHFA 2K4KA 3CF5A 3OIQA 2VL6A 1ASZA 2F0LA 2Z6KA 3GTLH 4DA2A 5FOBB 1KHIA 3P75A 1EY4A 1SMYC 1I4GA 1IKMA 3I73A 1N9WA 4HJAA 3I4OA 3SK4A 1XXGA 4A3LG 1HNZQ 2C5CA 5DM73 1EQVA 1NTGA 4H44C 1F9QA 1G51A 4TQUS 1K8OA 4ID6A 2Z6BA 2F0EA 4F88A 1V43A 1MD2D 1VQLA 3GTMH 4LFBL 2L0CA 4R4CA 2KCCA 4GOPC 1I3QH 5LMUL 2K33A 3A7LA 5IWAQ 3AYHB 2JEBI 1C0AA 2I0QA 3GDEA 1ML0D 1WI5A 1SAPA 1EIFA 1LTTD 1X65A 3A8JE 1VQBA 2K5NA 1Y1WH 5K5PA 3C3LA 2CWPA 2RCNA 1S4ZA 4DR6Q 1YHQA 1LTRD 2EYJA 4JBKA 1TS4A 2IL8A 1IXRA 2BE5C 3BDCA 2B2WA 2MPMA 2UXCL 1HZBA 2CW0D 5FLMH 3J81E 3CC2A 2X69A 4IUUA 4GOPB 2DNCA 2K1BA 1WCMG 4R4OA 1YNND 3CRLC 1RJTA 3H0GB 4DU9A 3TBIB 2MQHA 1AP0A 1FGUA 1H9RA 3HKSA 4AIMA 5CBEE 4PMBA 3RR5A 3QWNA 1LT4D 2NWGA 5C5LA 1SBBB 4K6LA 1V9PA 1FNUA 2A1AA 3KF8B 3J7A5 4JV5L 1HFGA 4B3SL 3MFYA 2IWHA 3CAMA 2Z4HA 2VXWA 3UDGA 1T5XD 1EZ6A 1TWCH 4GKKQ 4JI0Q 1GUSA 2MO0A 4TVAB 3HOVB 3DUZA 4XT1B 4JYAL 4DR7Q 1PH8A 2SOBA 3CCMA 4ZQ3A 5CV8A 4JI4L 5IOCA 4HIOA 4CJ0B 3AMUA 1KDBA 3GTGB 2A6EC 1CK1A 1NR4A 1YHAA 2LXJA 4EQ5A 2JP1A 2OCEA 2EZVA 3HOUB 1CA6A 3M3YB 2F4IA 1VQIA 1XTDA 5C0XI 4BWGB 5FLXc 1HPCA 2K01A 2LS01 1WJJA 3H3VH 5D14A 5CV9A 2K5VA 1I6HH 1EWIA 5L37A 4YHHL 4X62L 1DONA 4XYQA 1PHJA 2E75C 1II3A 5IGBA 4MHEA 2VUMB 4HSPA 1G91A 5IE8A 1PH7A 3DEOA 3KF6B 4ULLA 2N3SA 1CKMA 2EPBA 3AU7A 3S2DH 4OXPA 4L5SA 3W5OA 5M3MB 4A3IG 3DLLA 2PQAA 3HOWG 1G6PA 3FEWX 1ZXTA 4IPCA 4ZKBB 1NUCA 4AYBB 2FJ2A 3C1EA 3IFTA 3AQQA 1XTCD 2EQSA 4A93B 4M1UB 4HCEA 1E24A 3OWEB 3HG9A 3U50C 2CCZA 2E2HH 1KLGD 2EYLA 3S1RH 1PYBA 4A3CG 3MHBA 2AWOA 1QE6A 2D62A 1GUTA 5COYA 3NBIA 3RMHA 4DUZL 4HIDA 3ERSX 4XQNA 3H6MA 1PFNA 4DR2L 2GA4B 4ODGA 4A3JB 1Y14B 1UWVA 4HIKA 5GADC 4DAPA 2HDMA 2DY7A 3FKIH 3FVQA 1TWAB 3E0JA 1MGSA 1Q8IA 3T13A 4KD4A 4IJHA 2BDOA 1S3OA 2HQEA 4JI2Q 3F2CA 1WTPA 4BY1H 1LTSD 2XIWA 2ZJRA 1V1OA 5IWAL 2KQ3A 2UU9Q 1SSOA 3RUZA 1WTQA 3TP7A 5IP7G 2KCTA 1NSNS 1LTAD 4XDXA 3KJPA 1F77A 2XVSA 2JA8B 3G4SA 1OTCA 1RD9D 3HP3A 3CPFA 5C0XH 1HR0Q 2XTIA 1XX8A 1A2TA 2BDNA 2OQ0A 5FLXE 1F2LA 5JEAJ 3S16B 1E1OA 3BS1A 1PH5A 1VDZA 1ZYRD 1VF5C 3G7LA 2RVLA 4R8NA 2O4XA 1JMCA 2JA7G 2F0HA 1EWCA 4KLKA 1JE5A 2OXPA 4ZUJA 4HMJA 2EVBA 4FF1A 1I6VC 2RBMA 1AZPA 1E0BA 1F9PA 2R7FA 4GN5A 1QG7A 4DFAA 1FGBD 5ELOA 5AJ3Q 2I5MX 4TSSA 3OMCA 3CKIB 2NB0A 2F1MA 1KL9A 2XNAC 4GKKL 1GVPA 4JI0L 4RKBA 3I4NG 1SNDA 1BXTA
chains in the Genus database with same CATH topology
2IT1A 2B8GA 4XQJA 3MXPA 4N9PA 1JB3A 4DAVA 2AWNA 2RSNA 3K57A 5EKIA 1U4MA 2AQ1B 5T1GA 4PQXA 1WCMB 1IW7D 2F0OA 3A8KE 2XRSD 3KLSA 3V2TA 4RKLA 4K5WA 4RWSC 1PTOH 1LTBD 3BVMA 2H4OA 4CJ1B 2F0MA 2WACA 1ET6A 1TWFB 2KOLA 1CQFA 5KNBA 1HCZA 1E2ZA 5D65A 1JR0D 3T53B 5A2QL 2F0FA 1PXUA 2XWJB 4QUCA 2IJ0A 1SJHD 4HR7B 3R3OA 4WJWA 5KYIA 1EY9A 1EQTA 5BN5A 4KTAA 3D4RA 1OXTA 2O5JC 5CR3A 3OIPA 4KY6A 2HCCA 2OEOA 4XQQA 1TS5A 3S15B 3HOWB 2MP1A 2NN6G 3RZOB 1LO5D 1SYBA 2XN9C 1VMPA 5IT9L 3VR3A 1FYCA 3TMEA 2JEAI 2EJFC 1PFMA 5IGCA 3K5MA 4DXGA 2NVXB 1K8MA 3IL8A 1STHA 1D1KA 4DK1A 1B50A 5C4HA 3A7AB 1AEXA 4IFDI 1DXMA 2A5HA 3OW7A 1DOLA 1EIHA 5HURA 5ELDA 3NQIA 2IW3A 3KF8A 3PUVA 1TT2A 3VR5A 3BYYB 2QKIC 2QEJC 2F03A 4HMIA 5I6YA 2I46A 1ONLA 3NXWA 1STYA 4LAAA 5F2DA 4C1NI 4C1NK 4O1NA 1OO9B 1U4PA 4QB4A 1JWSD 5J1ZA 5EJWA 3D4DA 2RA4A 1FD7D 3E6ZX 5D3DA 2F0VA 3E5SA 1JE4A 1EYCA 1G2SA 2WKCA 4V190 1SE3A 3LWUA 3OOCA 2VNUD 2WKDA 1J8IA 4FXDA 1HTLD 4PV1C 3FRPB 5E1FA 2KJXA 2EYFA 4OO1G 1CZGA 2WINB 4ZK9B 4KV6A 3GQBA 3KLRA 5CORA 3K5NA 4CBVA 2M2LA 2NBFA 2CW0C 4CKCA 1ENCA 1EEID 1S5ED 3X3NA 1WD0A 3ND9A 1B53A 3Q24A 2K5QA 4NP5A 3S1MB 1TWCB 3H3VC 4IFDH 5IGEA 1GUGA 2KEDA 4K8JA 5M5YB 3IKJA 1STBA 1M8AA 1PFBA 3HKZB 3A55A 4EQOA 4RGOS 1QWYA 1O80A 2M00A 3VYTA 3LX0A 1EY5A 5CBAE 1SE4A 1WTOA 1I6HB 1EY0A 1FNVA 1PZKD 1LTID 2KHSA 4JBWA 1YNJD 5CV7A 1RTNA 4UDUC 2TSSA 1D5XC 1BBXC 5I2YA 1STNA 2R3ZA 1EOTA 1JORA 4K14A 2K5DA 3GD7A 3I3CA 2L1BA 2B2TC 3TSSA 1TU2B 4KY5A 5FK9C 2HDLA 4ZUIA 1ILQA 2E2HB 3DWPA 5CV4A 3S1RB 3A54A 1PZID 3GO5A 1X32A 3I90A 5EPKA 1HFNA 1U4LA 5I9PA 1EU3A 2DY8A 3DMUA 4FNFA 1M4VA 2PZWA 5EPLA 1JCKB 3R93A 1NAPA 1LACA 1JWMD 2SEBD 4ZLTF 3PMFA 1H9JA 2K28A 1KLUD 3V96A 2EYMA 5TSSA 4HTHA 4KKSA 1QCBD 4CJ2C 2G9DA 4KJNA 4ZYSA 3PIP3 3P20A 5C3XA 4P2CB 4RH6A 1PDQA 1ESRA 3T4AC 4RGMA 3WOFA 5IGFA 3ZYYX 2B2YC 2CHBD 1RODA 1UUPA 1KNAA 1ZYRC 4CKEA 1B9NA 1X3QA 5K36H 5DEHA 3MFGA 1WTVA 3FPPA 2L12A 4EGVA 3P1HA 2SNSA 1E2VA 3TDQA 1EY8A 3T56B 3KBGA 1A6XA 2B2VA 2BOSA 1TQOA 3HOXB 2A69D 2PO4A 2R7ZB 3CQZB 1HQMC 1D5ZC 4R9WA 3MXNA 1CHQD 1I4RA 4IURA 2F0QA 2NN6I 2O5IC 1QNKA 1O78A 2RDGA 1IW7C 4HSVA 1JQYD 3CRKC 4RGTA 4UAIA 1DJRD 2EYHA 2NYZD 1EFID 3PO3B 2X6LA 3MAQA 1Y8NB 2NZ1D 2EE1A 3S17B 3TZUA 1DM0B 4K8IA 2MJ8A 5C6AA 4U68A 1IHZA 1ESFA 4C3HB 3DHQA 4QCLA 4KHVA 3NQTA 2JSOA 2PPBC 1LT3D 3HZXA 4HN7A 4IUQA 3HOYB 3EJIA 1JICA 4MN3A 2A73B 5C4ZA 5J39A 4JK1C 5A2QE 5JVH3 1UAPA 2ICEC 2RDHA 3C2PA 5JAVA 3NUCA 1H9SB 2B2UC 3QO2A 1JOKA 4DXFA 1QJOA 1MSHA 3GTPB 1KDCA 3QOLA 1TWHB 5JEAG 1BCPF 2Q8RE 1A3VA 1SEBD 2DN8A 4G4KA 4LJZC 3MVVA 3ITPA 1MBYA 4WORA 2F0NA 1Y8OB 3D4WA 3X3MA 2QF7A 1UEAB 3Q23A 1V1PB 3CU7A 3H94A 1R4PB 2KEEA 1EY7A 2FFKB 4KN7C 4N9TA 3NHHA 1NR2A 1I4QA 1LT5D 5EGTA 1Y69U 3EA6A 2J7ZA 4FXKC 3H09A 2AQ2B 5EPJA 2E76C 3OMGA 4KHZA 1LV9A 3I72A 2R93B 1BO0A 3W2DA 5E4XA 4L8JA 4BBRB 1BDOA 3MWYW 4KI0A 3KBXA 3K5OA 4I7ZC 4ABNA 3I91A 1PTOD 5M5XB 3NWSA 1BUVT 4G7ZC 3EFXD 1NCVA 3NPPA 2ENBA 4G7OC 5FO9B 1Z47A 4CGYB 1SNOA 5NUCA 1DD2A 2G9HD 3TP6A 2IX0A 3L9AX 4XTCS 5CMDA 4K2LA 5ELFA 4X3UA 1I50B 5IIFA 1G2TA 5M9OA 5LL6X 3CHBD 1KNEA 1PRTF 3BG3A 1STGA 1SYGA 3QB3A 3I4MB 1WD1A 1KTKA 2BA0A 5G3LF 1B2TA 2J0TD 3OWFA 1WVLA 4HCSA 1SNMA 2A6ED 1Z6HA 3M4OB 4DK0A 1GUWA 1WTWA 4EQPA 1C48A 3JAML 2B2WC 4KY7A 3VA7A 3C46A 3Q6SA 4B9WA 2ZXOA 4J6HA 1MSGA 3I70A 1BOSA 4BY7B 3OHXC 3PUZA 4R8IA 3MTSA 4FP5D 3SXHA 4K2KA 1I4PA 1TIID 4OGQC 1BQQT 1YNJC 3NTHA 3FMCA 3OPOA 1DCZA 5C4JB 1AW7A 1Q1BA 1AFPA 4B9XA 3VYRA 3S2HB 3L3OC 5CV5A 1B3AA 1GJXA 1W6KA 1IL8A 3VYUA 1HUMA 2L9HA 5KEEA 3SE0A 3EVQA 2F0UA 5BN4A 1RF2D 2EXZA 2K03A 4IQZA 2M9VA 4QMGA 4RFBA 1TS3A 3AB9A 3HOZB 3UI2A 1TKWB 2KECA 1RHPA 1CA5A 3GTLB 5C0XG 4YIJA 3K7AB 2XSCA 5ELEA 1BR9A 2EY2A 1OXXK 4TKOB 4RA8A 3SR1A 2B39A 1F9RA 3GTMB 3SDZA 3K59A 2A6HD 4OIJA 1I3QB 3MXUA 5CV6A 4X3SA 1UNSA 4F87A 3ND8A 3TN2A 5C0XJ 1GUOA 1STAA 1Y1WB 1T5EA 1EL0A 3KLSX 3N6RA 5ELBA 3KUPA 3NTKA 4L6TB 1L0YB 1SE2A 3NK9A 1BCPD 4CKBA 4C2MB 4OHJA 3J7AV 4J1MA 3HEJA 3BVGA 4HAEA 1YNNC 4Z9CB 5ELCA 4BA2I 2TMPA 1ENAA 4IUTA 3U9SA 5I2XA 5BN3A 2F3WA 4IZ8A 4ZRZA 3S1NB 1OXUA 4U673 5IGGA 2L11A 1A3UA 1EYDA 5T1IA 3MXGA 2F3VA 4IN3A 4DAYA 1GUNA 2LFNA 3RLFA 1DOMA 3D6WA 2A68D 3I4LA 3DXJC 1DZ1A 4C3HG 5FO7B 3O13A 1TY0A 1CQVA 2Z1CA 3A56A 2I07B 4RHSA 3R2IA 2F0KA 2N88A 4IUPA 1JC7A 2EYPA 1V1PA 5E3FA 1F2MA 1Q90A 3Q0AA 1W6JA 1EIGA 1SYFA 1LLRD 2EY6A 3HRZC 4C3IB 3S2DB 4OL7A 2FMCA 2WAQB 3GTJB 1GXDC 1BF4A 1GHKA 4KK7A 1EU4A 3I8ZA 2F0JA 2QDBA 1O7ZA 2PQEA 2WV6D 2BA1A 2MUYA 5CC4A 1PRTD 1LTGD 2YYZA 5CYUA 3J7AF 1X3PA 4H13C 2RKSA 4WRDA 4H7BA 5G3LD 2EDGA 3FKIB 4FYDA 3EROA 5JVG3 1AZQA 3V05A 1QB5D 1SNPA 1G8ZD 1GOZA 1D5MC 2KCNA 1AN8A 3DM1A 4BY1B 2ZXPA 1CI3M 5C5MA 3TP8A 5DAUA 2KUMA 2K6AA 5KYLA 2SDFA 2V4DA 4OIKA 1CTMA 2D2CC 3FPUB 3IAYA 1C8CA 2E2JB 4IUNA 4KN4C 2L4NA 3ERQA 5KRUA 2ZT9C 4H0LC 3URYA 1IKLA 4MIUA 3ONAB 1J9OA 4PMCA 2QCPX 1QILA 3K6OA 4B08A 4NDXA 2WB1B 4TRDA 2Q8IB 2B8FA 2F0WA 5I4DA 1S5DD 3GTOB 4DN4M 2K7VA 1EYAA 5A35A 1PTOC 3TP5A 1RKNA 1CT1D 2JXMB 1ZKOA 2MHVA 3VR6A 1CFMA 2E2DC 3MC0B 2RSOA 4K5XA 4PNYA 2F0DA 2AQ3B 5JOBA 2PZUA 3H91A 3P7JA 3VA5A 1JOOA 2VB2X 3PV0A 1QNUA 1B4OA 2X6GA 4V0BA 4A3MB 1A15A 3VR2A 4A3KB 2K05A 2XRQD 2N55A 4IFDG 5JPMC 1ZEQX 2OT2A 1PMRA 1PTOB 2L55A 2EYOA 4LMQD 2LY7A 3K5LA 3DWAA 2JA6B 4RCOA 1SFOB 4BBSB 3PO2B 5KNDA 3S1QB 4A3BB 3GTKB 1RDPD 1D1IA 1JWUD 1C4QA 4KMUC 1OXSC 3HS0C 4S3SA 4KD3A 5LL6S 5JJZA 1S5CD 1SYEA 5I9OA 1BNZA 3VYSA 5EKKA 2PW7A 1B9MA 2NVYB 2NVQB 4C56C 4IFDJ 3QIAA 5DM63 1WTXA 3MEHA 3MZ5A 4NW2A 1FR3A 2OF1A 5C44B 1HA6A 4A3DB 4KJOA 3M7NA 4A3GB 2R61A 1ILPA 3BDOA 3SHLA 1EEFD 2R92B 1KDAA 2J4XA 4QF4A 4F7XA 1EWHA 1D2BA 4RCNA 2B63B 1IYVA 2E74C 3JAME 1DOKA 1WTRA 2F0TA 3W3AA 3J80L 3U9OA 1S5FD 2IX3A 3SK5A 5C4XB 3GV6A 2NN6H 4Q5VA 4XIGS 2EY1A 2NTSA 2EJGC 3PUWA 2FMMA 4OO1I 4KKUA 1G6ZA 5IGDA 4X3KA 3HGBA 4ZKCB 1SDFA 4HEDA 3RZDB 4G7HC 5IT9E 4RGNA 1Q3LA 1SMYD 3QJYA 3A8IE 2CVRA 5CGKA 2LKVA 5AFWA 4WFN3 4FF2A 4RAUC 5I6WA 2L5TA 4F8MA 4DNRB 3R2TA 3LNNA 1L0XB 1SNCA 2Z8LA 1U9RA 3BVZA 1B44D 3J81L 4RHRA 5K36G 4GZYC 5C3EB 1STEA 1OXVA 2IX1A 2DNEA 2D5DA 2A6HC 1A3TA 3S14B 4DF7A 5FO8B 4PMWA 1H9KA 3SVMA 1H9MA 3M7GA 1HHVA 5M3FB 1HRJA 3VR4A 4XXEA 4BS9A 1TVXA 3SEBA 2BE5D 1RTOA 1CM9A 1SYDA 2HUGA 2ZXRA 1BCPC 3GTQB 4EQNA 4Q0FA 4DNTB 4OO1H 3NP8A 3R8BA 4EVOA 2EY5A 2KA7A 1LT6D 4IUVA 4A3FB 2H1EA 1HXYD 2NUCA 2B2TA 1R4QB 1BCPB 2R6GA 3SK8A 2PYKA 3WDNA 1FNWA 2VB3X 2A68C 1F2YA 4XYOA 2B2VC 4C3IG 3G6JB 3LWEA 4LK1C 2HCIA 1PYWD 3NWTA 4FVMA 3PUXA 2QILA 1G291 2WIIB 3MA2B 5J22A 3Q22A 2C9OA 2PNRC 3PIO3 3FDTA 1CHPD 3K58A 1E2WA 4Y7NB 3L7ZC 3BZDB 4ZAIA 3SK6A 4I65A 5E4WC 1PZJD 2ICIA 3BDLA 4NMZA 3QG1A 2K5WA 2Y0SB 1EZ8A 2LMCB 2RDFA 1TR5A 1O7LA 4C3JG 4A3IB 5IODA 3DEPA 3T51B 1PRTC 1TWGB 2YU9B 4L63B 2FHTA 1B1ZA 2B2YA 3D31A 4X3TA 2D9UA 4FO2A 1A2UA 5HGTA 5FLXL 3N52A 1U4RA 5EQ0A 4ILWA 1Z7TA 2KVMA 5EKLA 3KK7A 3EQLC 4IALA 1VMCA 3C1FA 1PRTB 1HTPA 2K04A 3TZDA 3NSWA 2F0PA 4NKLA 3J7YW 2NVTB 5KNCA 4QIWB 1TS2A 4FF3A 2F0GA 2AUKA 2F0IA 3D8GA 4QUFA 3RD4A 1PLFA 1RCVD 1V8QA 2JA7B 4K5VA 4G57A 5JPNC 3M85A 1S5BD 2XWBB 5EBCA 2E2IB 1SXTA 4K6DA 1HA5A 2RQXA 3NTIA 2F0SA 1ENFA 3NBHA 4BA1I 1CZWA 1Q1EA 1O7YA 2BCOA 1R9TB 2PW5A 3IFDA 3BYTB 2A69C 2IPKD 5EBDA 1K83B 5KGUA 1VF7A 3I4NB 4M8AA 1H9SA 3D3RA 2NTTA 1MI2A 2Q8TA 5M5WB 4E6IA 3F2UA 1ICWA 1TY2A 2A74C 5DNFA 3S9WA 1Y8PB 2FINB 3PUYA 2JE6I 3DWQA 5ISRA 2PMZB 1D6EC 4A3EB 4KKTA 2B2UA 1I4XA 1SYCA 1XYIA 1Q12A 2WP8J 3NE5B 2JYOA 3GP7A 3M4YA 2K32A 2PZTA 3T16A 1ET9A 3WOEA 4ME5A 1DYQA 1HUNA 4FXGC 1LABA 4XT3B 1F2ZA 1I4HA 2PCFB 1KAAA 5KIXA 2EJMA 1QOHA 5C3WA 4CHTB 4DGZA 5D3IB 3GV3A 3QOJA 5LHY1 1KABA 1SJED 2Z4IA 4J8QA 1F9SA 1PTOF 1EY6A 4C3JB 1Y1VB 2ID0A 2JA5B 1JOQA 5FKAC 2CQAA 1HQRD 2SNMA 3K0YA 3OSOA 2AUJD 1IYUA 5JEAH 4FF4A 2O2LD 1SNQA 1VCIA 3J80E 4O42A 2MGSA 1GHJA 1XWEA 2EOTA 3D6CA 3OIQA 2F0LA 4DA2A 5FOBB 3P75A 1EY4A 1SMYC 1I4GA 1IKMA 3I73A 3SK4A 1XXGA 2C5CA 5DM73 1EQVA 4H44C 1F9QA 4TQUS 1K8OA 4ID6A 2F0EA 4F88A 1V43A 1MD2D 2L0CA 2KCCA 2K33A 3A7LA 2JEBI 1ML0D 1SAPA 1LTTD 3A8JE 5K5PA 3C3LA 1S4ZA 1LTRD 2EYJA 1TS4A 2IL8A 2BE5C 3BDCA 2B2WA 2MPMA 3J81E 2CW0D 2X69A 4IUUA 2DNCA 2K1BA 1YNND 3CRLC 1RJTA 3H0GB 4DU9A 3TBIB 1AP0A 1H9RA 5CBEE 4PMBA 3QWNA 1LT4D 2NWGA 5C5LA 1SBBB 4K6LA 1FNUA 1HFGA 3MFYA 2IWHA 2Z4HA 2VXWA 1T5XD 1EZ6A 1GUSA 3HOVB 3DUZA 4XT1B 2SOBA 4ZQ3A 5CV8A 5IOCA 4CJ0B 3AMUA 1KDBA 3GTGB 2A6EC 1CK1A 1NR4A 2JP1A 2EZVA 3HOUB 1CA6A 3M3YB 2F4IA 5C0XI 4BWGB 1HPCA 2K01A 2LS01 5D14A 5CV9A 1DONA 4XYQA 2E75C 1II3A 5IGBA 4MHEA 2VUMB 4HSPA 1G91A 3DEOA 4ULLA 2EPBA 3AU7A 5M3MB 3FEWX 1ZXTA 4ZKBB 1NUCA 4AYBB 2FJ2A 3C1EA 3IFTA 1XTCD 4A93B 4M1UB 4HCEA 3OWEB 3HG9A 1KLGD 2EYLA 3MHBA 2AWOA 1QE6A 2D62A 1GUTA 5COYA 3NBIA 3RMHA 4XQNA 3H6MA 1PFNA 2GA4B 4ODGA 4A3JB 4DAPA 2HDMA 2DY7A 3FVQA 1TWAB 3E0JA 1MGSA 1Q8IA 3T13A 4KD4A 2BDOA 2HQEA 1WTPA 1LTSD 2XIWA 1V1OA 2KQ3A 1SSOA 3RUZA 1WTQA 3TP7A 1NSNS 1LTAD 4XDXA 1F77A 2XVSA 2JA8B 1RD9D 3HP3A 5C0XH 1XX8A 1A2TA 2BDNA 5FLXE 1F2LA 5JEAJ 3S16B 3BS1A 1VDZA 1ZYRD 1VF5C 3G7LA 4R8NA 2RVLA 2O4XA 2F0HA 1EWCA 2OXPA 4ZUJA 4HMJA 2EVBA 4FF1A 1I6VC 2RBMA 1AZPA 1E0BA 1F9PA 1QG7A 4DFAA 1FGBD 4TSSA 3OMCA 3CKIB 2NB0A 2F1MA 2XNAC 4RKBA 1SNDA 1BXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4O A;  2X6G A;  1EL0 A;  2JYO A;  1G6Z A;  1B53 A;  5EPJ A;  1A15 A;  2B2T A;  1ZXT A;  4CJ2 C;  4R8I A;  3MTS A;  4ZKB B;  4X3K A;  2MJ8 A;  1LV9 A;  2K05 A;  4U68 A;  4ZKC B;  3KUP A;  2FJ2 A;  1BO0 A;  2N55 A;  1SDF A;  1PFM A;  5E4X A;  1X3P A;  4HED A;  2RSN A;  1ML0 D;  5EKI A;  1SAP A;  1U4M A;  5T1G A;  3MWY W;  2KED A;  4LMQ D;  3KBX A;  3IL8 A;  1HUN A;  1M8A A;  1PFB A;  1Q3L A;  1S4Z A;  1B50 A;  3I91 A;  2B2V C;  2CVR A;  4HAE A;  4IUQ A;  1QE6 A;  3LWE A;  4XT3 B;  5COY A;  1B3A A;  1NCV A;  2IL8 A;  4QUF A;  4RWS C;  1AZQ A;  1DOL A;  2B2W A;  1PFN A;  1JIC A;  2HCI A;  1EIH A;  2MPM A;  4IUT A;  4MN3 A;  5AFW A;  4RAU C;  1PLF A;  1PDQ A;  1O80 A;  1IL8 A;  2X69 A;  4IUU A;  3DM1 A;  1ESR A;  1HUM A;  5JJZ A;  2K1B A;  2L9H A;  3GV3 A;  1RJT A;  4CJ1 B;  2B2Y C;  2HDM A;  2DY7 A;  1ROD A;  1BNZ A;  1KNA A;  3FDT A;  1AP0 A;  2L11 A;  5CBA E;  2KOL A;  2KUM A;  1WTO A;  5CBE E;  1X3Q A;  2SDF A;  5T1I A;  1MGS A;  4OIK A;  5D65 A;  1F9S A;  2K03 A;  2NWG A;  3FPU B;  4ZAI A;  5CMD A;  1WTV A;  1WTX A;  4X3U A;  1WTP A;  1HFG A;  5E4W C;  4NW2 A;  1O7Y A;  2XIW A;  1C8C A;  1G2T A;  2L12 A;  1DOM A;  2VXW A;  3D6W A;  2B2U C;  1RTN A;  3IFD A;  1U4P A;  2L4N A;  3QO2 A;  1HA6 A;  3UI2 A;  4QUC A;  1KNE A;  1DZ1 A;  1BBX C;  5EJW A;  1ILP A;  3SVM A;  2RA4 A;  1SSO A;  2R3Z A;  1WTQ A;  4XT1 B;  1EOT A;  1MSH A;  1HHV A;  4XDX A;  2KEC A;  1WD1 A;  2B2V A;  1HRJ A;  1RHP A;  1CA5 A;  1IKL A;  1TVX A;  3I3C A;  2L1B A;  3HP3 A;  1MI2 A;  4CJ0 B;  1JE4 A;  1RTO A;  3DEP A;  2B2T C;  3ONA B;  1G2S A;  2Q8R E;  1CM9 A;  1J9O A;  1NR4 A;  2N88 A;  2Q8T A;  1B2T A;  4IUP A;  1XX8 A;  2HDL A;  2BDN A;  1EQT A;  3F2U A;  2JP1 A;  1ILQ A;  4O42 A;  1F2L A;  1WVL A;  2MGS A;  4HCS A;  4R9W A;  1ICW A;  4RA8 A;  1CA6 A;  2FHT A;  1J8I A;  2HUG A;  5DNF A;  2B2Y A;  2EOT A;  3G7L A;  2RVL A;  1DOK A;  4IUR A;  4X3T A;  2D9U A;  1EIG A;  2FIN B;  1WTR A;  1X32 A;  1F9R A;  1QNK A;  3I90 A;  2K01 A;  5EPK A;  1U4L A;  4DN4 M;  1HFN A;  2K04 A;  1GUW A;  5D14 A;  3N52 A;  1WTW A;  2DY8 A;  1U4R A;  2HCC A;  4HSV A;  4ZK9 B;  5EQ0 A;  1AZP A;  1IKM A;  1E0B A;  1F9P A;  1BF4 A;  1DON A;  4OIJ A;  5EPL A;  2KVM A;  2MP1 A;  2KEE A;  1QG7 A;  3R93 A;  1NAP A;  2B2W C;  5COR A;  3GV6 A;  3I8Z A;  2B2U A;  4UAI A;  2FFK B;  2RSO A;  4MHE A;  2M2L A;  4X3S A;  1G91 A;  1NR2 A;  1VMC A;  3Q6S A;  3DEO A;  4IUV A;  4ZLT F;  1F9Q A;  1O7Z A;  2K28 A;  2NYZ D;  3TN2 A;  2FMM A;  2H1E A;  2X6L A;  3H91 A;  1MSG A;  2EPB A;  3P7J A;  1XYI A;  1VMP A;  2NZ1 D;  2EE1 A;  2J7Z A;  3TZD A;  1WD0 A; 
#chains in the Genus database with same CATH topology
 2IT1 A;  3JC6 6;  1RL2 A;  3HOX H;  2B8G A;  4XQJ A;  4DV1 L;  4AQY Q;  3MXP A;  4N9P A;  2BH8 A;  1JB3 A;  4DAV A;  2AWN A;  2RSN A;  3K57 A;  5EKI A;  1U4M A;  2AQ1 B;  5T1G A;  4DKA C;  4DV5 Q;  2KCM A;  4PQX A;  3PF5 A;  1WCM B;  3JAM i;  1AE3 A;  1IW7 D;  2F0O A;  4A3M H;  3A8K E;  2XRS D;  1A0I A;  3KLS A;  4A3K H;  4A4I A;  3V2T A;  4Y52 H;  4RKL A;  4K5W A;  1K8G A;  4RWS C;  3G71 A;  1VQ6 A;  1PTO H;  1LTB D;  3BVM A;  1N36 Q;  3PCO B;  3M9B A;  1HR0 W;  3HKZ G;  2HHH L;  2H4O A;  2JA6 H;  4CJ1 B;  1SFO H;  4BBS H;  1VQ9 A;  2F0M A;  4YWK A;  2WAC A;  1KRS A;  1ET6 A;  1TWF B;  1O7I A;  2KOL A;  4POG A;  1CQF A;  3PO2 H;  3PO3 H;  4A3B H;  3S1Q H;  5KNB A;  1HCZ A;  3GTK H;  1E2Z A;  1X9N A;  3D0F A;  1JR0 D;  5D65 A;  3T53 B;  5BR8 Q;  4UY8 C;  5A2Q L;  2F0F A;  3AFP A;  1PXU A;  1JT8 A;  4B3R Q;  2XWJ B;  4QUC A;  2NVY H;  4C3H H;  2IJ0 A;  2KHI A;  1SJH D;  2VY3 A;  4HR7 B;  3R3O A;  3E9H A;  1SRU A;  4WJW A;  5KYI A;  1WOC A;  4DV0 L;  1EY9 A;  3S24 A;  3HOY H;  1EQT A;  5C44 H;  4LFC Q;  4A3G H;  2B3G A;  5BN5 A;  4KTA A;  3D4R A;  1OXT A;  2R92 H;  2O5J C;  5CR3 A;  2YV5 A;  4CDD C;  3OIP A;  1K73 C;  1J6Q A;  2HCC A;  4KY6 A;  1P16 A;  2OEO A;  4XQQ A;  1TS5 A;  3S15 B;  3HOW B;  2MP1 A;  2NN6 G;  1Y1V G;  3RZO B;  3OYY A;  4JI2 L;  2JA5 G;  1LO5 D;  3PGZ A;  3KJO A;  1K3B C;  1SYB A;  3CCU A;  2XN9 C;  4DV2 Q;  4K0K Q;  2YTV A;  1VMP A;  5IT9 L;  3VR3 A;  4JCV E;  1FYC A;  3GTP H;  2OQK A;  3TME A;  5C4X H;  2JEA I;  2EJF C;  1UE6 A;  1XPR A;  4N8X 1;  1VQ5 A;  1TWH H;  1PFM A;  5IGC A;  3K5M A;  1NJI C;  4DXG A;  1HR0 L;  3Q8D A;  2NVX B;  4X65 Q;  4LF7 Q;  1K8M A;  4JVZ A;  1IBM Q;  3IL8 A;  1STH A;  1D1K A;  4DK1 A;  1B50 A;  5C4H A;  3A7A B;  1NNX A;  1AEX A;  4IFD I;  1IBK Q;  1DXM A;  2A5H A;  3OW7 A;  1DOL A;  3RZD H;  1EIH A;  5HUR A;  5ELD A;  3NQI A;  1LUZ A;  2IW3 A;  3KF8 A;  3U4V A;  4JI3 L;  3PUV A;  1TT2 A;  3VR5 A;  3BYY B;  2QKI C;  1XNQ Q;  2QEJ C;  2F03 A;  3LGJ A;  4HMI A;  5IYB H;  5I6Y A;  2N8N A;  2I46 A;  1ONL A;  3NXW A;  1STY A;  2PNH A;  2VQE L;  2KHJ A;  4LAA A;  1A63 A;  5F2D A;  4C1N I;  4C1N K;  2YTY A;  4O1N A;  2R93 H;  4OWW B;  1OO9 B;  1U4P A;  1XPU A;  4AQY L;  4QB4 A;  1JWS D;  4B3M L;  5J1Z A;  5EJW A;  1E1T A;  1VQH A;  3D4D A;  2RA4 A;  2IHE A;  1FD7 D;  1GD7 A;  3E6Z X;  4QJF A;  5C3E H;  5D3D A;  4DV5 L;  3K0X A;  2F0V A;  3E5S A;  1JE4 A;  4DV6 Q;  1EYC A;  1G2S A;  2WKC A;  4V19 0;  1SE3 A;  3LWU A;  3M4Q A;  1HNX Q;  3OOC A;  2VNU D;  2WKD A;  1J8I A;  4FXD A;  4ZCK A;  1HTL D;  5M3F H;  1H95 A;  3H0G G;  4PV1 C;  1N36 L;  4LF5 L;  3FRP B;  3A5U A;  5E1F A;  2KJX A;  2R7Z G;  2EYF A;  4OO1 G;  1CZG A;  2WIN B;  4ZK9 B;  4KV6 A;  3GQB A;  3KLR A;  5COR A;  3K5N A;  4CBV A;  1I50 H;  2M2L A;  1QUQ A;  4GN3 B;  2NBF A;  2CW0 C;  4CKC A;  1ENC A;  4YY3 L;  1EEI D;  3MEF A;  4CDE C;  1S5E D;  3X3N A;  4B3R L;  3HOV G;  3AFQ A;  3BJU A;  1WD0 A;  3I4M H;  3ND9 A;  1B53 A;  4FDB A;  3Q24 A;  2K5Q A;  2HIX A;  4NP5 A;  3S1M B;  1TWC B;  3ULJ A;  2NZH A;  3H3V C;  4IFD H;  5IGE A;  4A3F H;  1GUG A;  4LFC L;  2KED A;  4K8J A;  2PI2 A;  5M5Y B;  2FXQ A;  3IKJ A;  1STB A;  1M8A A;  1PFB A;  3HKZ B;  3A55 A;  2F3I A;  4EQO A;  4IO9 A;  2B29 A;  4RGO S;  1QWY A;  4YCW A;  2EXD A;  4DAM A;  1O80 A;  1M1K C;  4JW0 A;  2M00 A;  2VUM G;  4JI1 Q;  3VYT A;  3LX0 A;  1EY5 A;  4OX9 Q;  5CBA E;  1SE4 A;  1WTO A;  1I6H B;  1EY0 A;  3K81 C;  1FNV A;  4DV2 L;  1VQM A;  4DR4 Q;  1PZK D;  4BY7 H;  1LTI D;  2KHS A;  4JBW A;  1YNJ D;  5CV7 A;  4A93 G;  1RTN A;  4UDU C;  2TSS A;  4B3T Q;  1D5X C;  1BBX C;  5I2Y A;  1STN A;  2R3Z A;  1EOT A;  1JOR A;  4K14 A;  1IBM L;  2K5D A;  4Y7N H;  3GD7 A;  3I3C A;  2L1B A;  2B2T C;  3TSS A;  1TU2 B;  2UXB Q;  2JJQ A;  4KY5 A;  5FK9 C;  2HDL A;  1UE5 A;  4ZUI A;  1ILQ A;  1D8L A;  2E2H B;  3DWP A;  5CV4 A;  3S1R B;  3G48 A;  4A3J G;  3A54 A;  1PZI D;  3GO5 A;  1VQ7 A;  1X32 A;  3I90 A;  5EPK A;  1HFN A;  1U4L A;  1PH9 A;  1X3G A;  1MHW C;  5I9P A;  1YVC A;  1EU3 A;  3M4P A;  2DY8 A;  3DMU A;  2F4V Q;  4FNF A;  1M4V A;  1TWG H;  2YU9 H;  2PZW A;  5EPL A;  1JCK B;  3R93 A;  1NAP A;  1LAC A;  4X6A H;  1JWM D;  1K3R A;  2SEB D;  4ZLT F;  3PMF A;  1H9J A;  2K28 A;  1U5K A;  2E8G A;  1KLU D;  4WJ3 M;  3V96 A;  2EYM A;  5TSS A;  2V1C C;  4HTH A;  4KKS A;  1QCB D;  4CJ2 C;  1X3E A;  3K7A H;  1HZC A;  1NMG A;  4DV6 L;  1B70 B;  2G9D A;  4GLV B;  4GNX C;  4KJN A;  1HNX L;  1BBU A;  1WTH A;  3OW2 A;  4ZYS A;  3PIP 3;  4APV A;  2Q2T A;  3P20 A;  4P2C B;  5C3X A;  2R93 G;  2NVT H;  4RH6 A;  4BBR G;  4NXM Q;  5LMN W;  1PDQ A;  1ESR A;  3T4A C;  4RGM A;  3WOF A;  4DV7 Q;  5IGF A;  3EIV A;  3ZYY X;  1DGS A;  2B2Y C;  2CHB D;  1ROD A;  1UUP A;  1KNA A;  1ZYR C;  4CKE A;  1B9N A;  1X3Q A;  1BVS A;  4GNX B;  5K36 H;  5GAE C;  5DEH A;  3MFG A;  1WTV A;  3FPP A;  2L12 A;  4EGV A;  3P1H A;  2SNS A;  1E2V A;  2N78 A;  3TDQ A;  1EY8 A;  3T56 B;  3KBG A;  2R7D A;  4ME3 A;  4C2M H;  2E2I H;  1A6X A;  1L1O C;  5IYD H;  4JOI A;  2B2V A;  4IPG A;  2BOS A;  1TQO A;  3HOX B;  1CSQ A;  2A69 D;  1EQQ A;  2PO4 A;  3KLW A;  2R7Z B;  1R9T H;  3CQZ B;  2QA4 A;  3UE0 A;  2DJF C;  1HQM C;  2RF4 A;  1D5Z C;  4R9W A;  1K83 H;  3MXN A;  4JBJ A;  1NMF A;  1CHQ D;  1I4R A;  4IUR A;  2F0Q A;  2NN6 I;  3S1N H;  4JI1 L;  1QNK A;  2O5I C;  1O78 A;  1W3S A;  2RDG A;  2UXD Q;  1IW7 C;  4HSV A;  4BXX H;  1JQY D;  3CRK C;  1XMQ L;  1L1O B;  3TRZ A;  4RGT A;  4UAI A;  1DJR D;  4PG3 A;  1JJ2 A;  4NPS A;  3CMA A;  2EYH A;  4LW1 A;  2NYZ D;  1EFI D;  4GLX A;  3PO3 B;  2X6L A;  3MAQ A;  1YIJ A;  3E3X A;  3DM3 A;  1Y8N B;  2NZ1 D;  4B3T L;  2EE1 A;  3S17 B;  5IT9 c;  5FJ8 H;  3TZU A;  1DM0 B;  4A3E H;  4X66 L;  4K8I A;  4MZ9 A;  1YI2 A;  1KAW A;  3T1Y L;  2MJ8 A;  2UUA Q;  5C6A A;  4U68 A;  5LMN L;  3PIP A;  1FL0 A;  1IHZ A;  1ESF A;  3J80 i;  2UXB L;  2QGQ A;  4JC0 A;  4C3H B;  4DR3 Q;  3DHQ A;  4QCL A;  1VQJ A;  1I5F A;  4KHV A;  3NQT A;  4BY7 G;  2JSO A;  2CH4 A;  2PPB C;  1LT3 D;  1NBW A;  3HZX A;  4HN7 A;  4IUQ A;  4C3I H;  3HOY B;  1NY4 A;  3EJI A;  2I5H A;  3GTJ H;  1JIC A;  4MN3 A;  2F4V L;  2A73 B;  5C4Z A;  5J39 A;  3NBH B;  4JK1 C;  4RG1 A;  4R4T A;  5A2Q E;  1SRO A;  2WFW A;  5JVH 3;  1E7Z A;  1UAP A;  2ICE C;  3TEH B;  2LSS A;  2RDH A;  3C2P A;  5JAV A;  3NUC A;  1H9S B;  2B2U C;  3K80 C;  2LXK A;  1CKN B;  3QO2 A;  1JOK A;  1JB7 A;  2E5L Q;  4DXF A;  1RIP A;  1QJO A;  1MSH A;  1KQS A;  3GTP B;  2YTX A;  4DAY B;  1HNZ L;  1KDC A;  4C3J H;  3QOL A;  1TWH B;  5JEA G;  1BCP F;  3HOZ G;  2Q8R E;  1A3V A;  1SEB D;  2DN8 A;  2K52 A;  4G4K A;  1YZ6 A;  2QEX A;  4LJZ C;  3J81 i;  3I2Z A;  3MVV A;  4NXN Q;  3ITP A;  1MBY A;  4WOR A;  2F0N A;  3CW2 C;  1Y8O B;  3D4W A;  3X3M A;  4LUV A;  1Q81 C;  2QF7 A;  1UEA B;  5IP9 H;  2Z0S A;  3Q23 A;  1V1P B;  3CU7 A;  3J81 j;  3H94 A;  1R4P B;  2KEE A;  1EY7 A;  2FFK B;  4KN7 C;  2E2J H;  4DR6 L;  4N9T A;  3NHH A;  1NR2 A;  1I4Q A;  1LT5 D;  5EGT A;  1Y69 U;  3EA6 A;  3G6E A;  3HFZ B;  1I94 Q;  4IOA A;  2J7Z A;  4FXK C;  4QGU A;  1N34 Q;  1VQP A;  3H09 A;  1PH2 A;  2AQ2 B;  5EPJ A;  2E76 C;  3OMG A;  4KHZ A;  1LV9 A;  3I72 A;  1XNR Q;  2R93 B;  1BO0 A;  3W2D A;  1B3Q A;  5E4X A;  4L8J A;  4BBR B;  1L0W A;  1BDO A;  4MNO A;  3MWY W;  1E22 A;  4KI0 A;  1Y1W G;  3KBX A;  2L15 A;  4R4I A;  3K5O A;  4I7Z C;  4X64 Q;  4YWL A;  4I7A A;  4ABN A;  3I91 A;  1PTO D;  3GTO H;  5E7N A;  5M5X B;  4QL5 A;  2D0O A;  3E0E A;  3NWS A;  1BUV T;  4G7Z C;  1L2F A;  4LFA Q;  3EFX D;  2UXD L;  1NCV A;  3UDI A;  4UPA A;  5FLM G;  5ELN A;  5J3B A;  4KHP Q;  1AE2 A;  4DR7 L;  3NPP A;  1SE8 A;  2JK8 A;  2ZM6 Q;  1UE7 A;  4DV3 Q;  2ENB A;  4G7O C;  3F2B A;  5FO9 B;  1Z47 A;  4CGY B;  1SNO A;  5NUC A;  2Z6K C;  2GN5 A;  1DD2 A;  2G9H D;  3CME A;  3TP6 A;  2IX0 A;  3L9A X;  4XTC S;  5CMD A;  1VQK A;  4K2L A;  5ELF A;  2Q2H A;  4X3U A;  1I50 B;  5IIF A;  1G2T A;  5M9O A;  2UUA L;  5LL6 X;  3CCV A;  3CHB D;  1KNE A;  1PRT F;  3BG3 A;  1STG A;  1SYG A;  3QB3 A;  3I4M B;  1HZ9 A;  3H15 A;  1WD1 A;  2CKZ B;  1KTK A;  3CD6 A;  2BA0 A;  3F8T A;  5G3L F;  1XPO A;  1B2T A;  2J0T D;  4OWX B;  3FHW A;  3OWF A;  1V1Q A;  1WVL A;  4HCS A;  2OTL A;  1SNM A;  3CXC A;  2A6E D;  4IJL A;  1Z6H A;  2G5D A;  3M4O B;  4DK0 A;  3BZK A;  1GUW A;  3GTG H;  1WTW A;  1YJW A;  4EQP A;  1C48 A;  2HIV A;  2NVQ H;  1IZ6 A;  3JAM L;  3HOU H;  2B2W C;  4KY7 A;  2ASB A;  3VA7 A;  3C46 A;  2IY5 B;  2P5Z X;  2HD3 A;  3Q6S A;  4B9W A;  3ULP A;  4A3D H;  2ZXO A;  4J6H A;  1MSG A;  2JQO A;  3I70 A;  3KYH C;  1XMO Q;  1HH2 P;  1BOS A;  4BY7 B;  2NZO A;  3OHX C;  3PUZ A;  4R8I A;  3MTS A;  2GVB A;  4FP5 D;  3SXH A;  4K2K A;  1I4P A;  4QQB X;  1TII D;  1NE3 A;  4DNI A;  4OGQ C;  1BQQ T;  1YNJ C;  4CDC C;  3NTH A;  4HIM A;  2QW7 A;  3FMC A;  3OPO A;  2B63 H;  3ICE A;  1DCZ A;  5C4J B;  1AW7 A;  1Q1B A;  5M3M H;  2CWA A;  1AFP A;  4B9X A;  3VYR A;  3S2H B;  3L3O C;  5CV5 A;  3F1Z A;  2UU9 L;  3PQI A;  1B3A A;  1X55 A;  1GJX A;  3W1B A;  1W6K A;  1IL8 A;  3VYU A;  1HUM A;  2L9H A;  3CP0 A;  4DR1 Q;  4JBM A;  4UP7 A;  5KEE A;  2HQL A;  3FKI G;  3SE0 A;  3EVQ A;  3STB D;  2UUB Q;  2F0U A;  4GOP A;  5BN4 A;  3T1H Q;  1Z9F A;  3ULL A;  1RF2 D;  2EXZ A;  2K03 A;  1GO3 E;  4IQZ A;  4LF9 Q;  2I5L X;  4BY1 G;  1N34 L;  1K8A C;  1BBW A;  1HZA A;  2M9V A;  4QMG A;  4RFB A;  4L5R C;  1TS3 A;  3AB9 A;  3HOZ B;  1GM5 A;  4UP8 A;  1UEB A;  3UI2 A;  1TKW B;  2KEC A;  4X64 L;  1RHP A;  5AJ3 L;  1CA5 A;  3GTL B;  5C0X G;  4YIJ A;  1VQ8 A;  3K7A B;  2XSC A;  2Y0S E;  3QR8 A;  5ELE A;  1BR9 A;  4DUY Q;  2EY2 A;  1OXX K;  4LFA L;  2HT1 A;  1X56 A;  4TKO B;  4RA8 A;  3A74 A;  3SR1 A;  4KHP L;  2B39 A;  3L0O A;  2JA8 H;  1K28 A;  4DV3 L;  1PA6 A;  1F9R A;  2CFM A;  3GTM B;  1VQO A;  4L5T A;  4DV4 Q;  3SDZ A;  3K59 A;  2OTJ A;  2A6H D;  4OIJ A;  1I3Q B;  3S16 H;  5IY0 A;  1CKO A;  3MXU A;  3EN2 A;  4A3L H;  5CV6 A;  4X3S A;  1UNS A;  1HNW Q;  4F87 A;  3S14 H;  3ND8 A;  3TN2 A;  1KC8 C;  5C0X J;  1GUO A;  2MO1 A;  2Q2U A;  1STA A;  1Y1W B;  3RN5 A;  1T5E A;  1EL0 A;  3KLS X;  3HOX G;  3K8A A;  2RCF A;  3N6R A;  4GS3 A;  4J15 A;  5ELB A;  3KF6 A;  3KUP A;  3NTK A;  4L6T B;  2KEN A;  1L0Y B;  1SE2 A;  3CCR A;  2N49 A;  4P74 A;  3NK9 A;  4CDF C;  1BCP D;  4CKB A;  4C2M B;  4OHJ A;  5BR8 L;  1VQD A;  4A3M G;  3J7A V;  4J1M A;  3GTQ H;  4A3K G;  3HEJ A;  3BVG A;  4HAE A;  1M90 C;  1YNN C;  4Z9C B;  4P71 A;  4QIW E;  5ELC A;  2DUD A;  4LFB Q;  4BA2 I;  2TMP A;  1EUJ A;  4ALP A;  1ENA A;  4IUT A;  3U9S A;  5I2X A;  5LMU Q;  2JA6 G;  5BN3 A;  1WCM H;  4BBS G;  2F3W A;  4IZ8 A;  4ZRZ A;  3S1N B;  1OXU A;  4U67 3;  1GKH A;  1CKN A;  5IGG A;  3PO3 G;  3PO2 G;  4A3B G;  2L11 A;  1A3U A;  1EYD A;  5T1I A;  3MXG A;  2F3V A;  4RMF A;  4IN3 A;  4DAY A;  1GUN A;  1XMO L;  2LFN A;  5H1S E;  2AHO B;  1YNX A;  3A0J A;  3RLF A;  2AMC B;  1DOM A;  3D6W A;  1WFQ A;  4DR5 Q;  2A68 D;  3I4L A;  3DXJ C;  3CC7 A;  1PVO A;  1DZ1 A;  4C3H G;  1TWF H;  5FO7 B;  4JPB W;  4PZ6 A;  3O13 A;  1TY0 A;  1CQV A;  1EFW A;  2Z1C A;  3A56 A;  2I07 B;  1KIX A;  4RHS A;  3TQY A;  3R2I A;  4H02 A;  2F0K A;  2K14 A;  2N88 A;  3HOY G;  5C44 G;  1S40 A;  4IUP A;  4K0K L;  4A3G G;  1JC7 A;  2EYP A;  1V1P A;  2ZJQ A;  3PF4 A;  1N8R C;  4JV5 Q;  5E3F A;  1F2M A;  2R92 G;  1Q90 A;  4B3S Q;  3Q0A A;  1W6J A;  1EIG A;  1SYF A;  1LLR D;  2CH4 W;  2EY6 A;  3HRZ C;  4C3I B;  3S2D B;  4OL7 A;  1K9M C;  2FMC A;  2WAQ B;  4X65 L;  3GTJ B;  1GXD C;  4LF7 L;  1BF4 A;  4JYA Q;  1CUK A;  1GHK A;  4KK7 A;  1EU4 A;  3I8Z A;  4LF9 L;  4R1J A;  2F0J A;  2VS1 A;  2QDB A;  1O7Z A;  2PQE A;  1J5E Q;  1IBK L;  2WV6 D;  2BA1 A;  2MUY A;  1B7Y B;  2OWO A;  1K0R A;  5CC4 A;  5C4X G;  4A3I H;  3HOW H;  1PRT D;  1LTG D;  2YYZ A;  5CYU A;  1XNQ L;  2JA9 A;  3J7A F;  1X3P A;  4EX5 A;  4H13 C;  2RKS A;  4WRD A;  4H7B A;  4DUY L;  2Q2I A;  3NEN A;  5G3L D;  3KFU A;  1MJC A;  2ATW A;  3KDF B;  2GVA A;  4A3C H;  2EDG A;  2WAQ E;  3FKI B;  4R4Q A;  4FYD A;  3ERO A;  5JVG 3;  1AZQ A;  3V05 A;  1QB5 D;  1SNP A;  4DV4 L;  1G8Z D;  1GOZ A;  2NVX H;  1D5M C;  2K50 A;  2KCN A;  1AN8 A;  3DM1 A;  4BY1 B;  2ZXP A;  1CI3 M;  5C5M A;  4JI5 Q;  3TP8 A;  5DAU A;  3KOJ A;  5GRO A;  5IYB G;  2KUM A;  1MIU A;  2K6A A;  5KYL A;  2SDF A;  4GN4 B;  2V4D A;  4OIK A;  1CTM A;  2D2C C;  3FPU B;  3IAY A;  3I56 A;  1C8C A;  2E2J B;  4IUN A;  4KN4 C;  2L4N A;  1CSP A;  4JG2 A;  4DUZ Q;  3ERQ A;  4MTK A;  5EAY A;  5KRU A;  2ZT9 C;  4DR2 Q;  5C3E G;  1YJ9 A;  5JJI A;  5IP7 H;  3SGI A;  4H0L C;  3URY A;  3K7U C;  1IKL A;  4HJ5 A;  4MIU A;  3ONA B;  2MNA A;  2RHQ B;  1J9O A;  4PMC A;  2QCP X;  1QIL A;  3K6O A;  3H3V I;  4B08 A;  4NDX A;  4DK6 C;  2WB1 B;  4TRD A;  2Q8I B;  2B8F A;  1YJN A;  2F0W A;  4OEM B;  5M3F G;  5I4D A;  1Q46 A;  1UE1 A;  1S5D D;  1SMX A;  2JA7 H;  3GTO B;  4GLA C;  4OEL B;  4DN4 M;  2K7V A;  1Q8K A;  1EYA A;  5A35 A;  1PTO C;  3TP5 A;  3JAM c;  1RKN A;  1CT1 D;  2JXM B;  1ZKO A;  2MHV A;  3VR6 A;  1CFM A;  2E2D C;  3MC0 B;  1QVF A;  2RSO A;  4K5X A;  3E9I A;  2F0D A;  1TXY A;  2AQ3 B;  4PNY A;  5JOB A;  1S72 A;  2PZU A;  3H91 A;  4DR5 L;  3P7J A;  3VA5 A;  1JOO A;  2VB2 X;  3I4M G;  3PV0 A;  3I4N H;  1QNU A;  1B4O A;  2X6G A;  4V0B A;  3UDF A;  4A3M B;  1A15 A;  3VR2 A;  4A3K B;  2K05 A;  2XRQ D;  2N55 A;  2WB1 E;  5M5W H;  4IFD G;  5JPM C;  1ZEQ X;  3F2D A;  2OT2 A;  4OX9 L;  1PMR A;  4A3F G;  4LF4 Q;  1PTO B;  2L55 A;  2EYO A;  4LMQ D;  2LY7 A;  3K5L A;  4DR4 L;  3DWA A;  2JA6 B;  4RCO A;  1SFO B;  4BBS B;  3S1M H;  3PO2 B;  5KND A;  3S1Q B;  4A3B B;  3GTK B;  1RDP D;  1D1I A;  1JWU D;  1C4Q A;  4KMU C;  1OXS C;  4LF6 Q;  1N32 Q;  1N33 Q;  3HS0 C;  4S3S A;  4KD3 A;  5LL6 S;  5JJZ A;  1S5C D;  5M5Y H;  1SYE A;  1E3P A;  3NEL A;  3RNU A;  4DV1 Q;  1X3F A;  5I9O A;  1BNZ A;  3VYS A;  5EKK A;  2PW7 A;  1B9M A;  2NVY B;  4A75 A;  2NVQ B;  1J5E L;  2A8V A;  4C56 C;  4IFD J;  3QIA A;  2Z9H A;  3VDY A;  5DM6 3;  1WTX A;  3MEH A;  3MZ5 A;  4NW2 A;  1FR3 A;  2OF1 A;  5C44 B;  1HA6 A;  3CCL A;  4A3D B;  4KJO A;  3M7N A;  1D7Q A;  4A3G B;  1AH9 A;  2R61 A;  4NB3 A;  1YIT A;  1ILP A;  3BDO A;  5IYC H;  3CPW A;  3SHL A;  1VQE A;  1EEF D;  2R92 B;  4JI8 Q;  1KDA A;  4L5Q A;  2HHH Q;  2J4X A;  4QF4 A;  4F7X A;  1EWH A;  1D2B A;  2Y0S G;  4RCN A;  2B63 B;  1IYV A;  3W1G A;  2E74 C;  3JAM E;  1DOK A;  1EOV A;  1WTR A;  4LUZ A;  2F0T A;  4JI5 L;  5JJK A;  1LM0 A;  3W3A A;  3J80 L;  3U9O A;  1QUQ B;  1S5F D;  2CQO A;  2RHS B;  2IX3 A;  4LF8 Q;  3SK5 A;  3OTO Q;  5C4X B;  3GV6 A;  2NN6 H;  4Q5V A;  4XIG S;  1Y1V H;  1Q82 C;  2EY1 A;  2NTS A;  2JA5 H;  2EJG C;  4DV0 Q;  4JI7 Q;  1K0S A;  3PUW A;  2FMM A;  4OO1 I;  3I55 A;  1WYD A;  3L2P A;  4HJ7 A;  2UUC Q;  4KKU A;  4NXM L;  1VS0 A;  1G6Z A;  3STB C;  5IGD A;  4X3K A;  4DV7 L;  3HGB A;  4ZKC B;  1SDF A;  2ALY B;  1JJC B;  4HED A;  3RZD B;  3U4Z A;  1X54 A;  1XJV A;  4G7H C;  4LWC A;  4AYB E;  5IT9 E;  4RGN A;  2QDL A;  1Q3L A;  1SMY D;  1FJG Q;  3QJY A;  3A8I E;  2CVR A;  1VQG A;  5CGK A;  2LKV A;  2MFI A;  2DJG C;  3ZJY C;  1P8L A;  5AFW A;  4WFN 3;  4RAU C;  5I6W A;  4FF2 A;  2VQF Q;  2L5T A;  4F8M A;  4DNR B;  3R2T A;  3LNN A;  1L0X B;  1SNC A;  2Z8L A;  1U9R A;  3BVZ A;  1B44 D;  4QY7 A;  3J81 L;  4RHR A;  5K36 G;  2PI2 E;  4GZY C;  5C3E B;  1KRT A;  3NEM A;  1STE A;  4IPH A;  3U58 A;  1OXV A;  2IX1 A;  2DNE A;  2D5D A;  2A6H C;  1Q86 C;  1A3T A;  2AKW B;  3S14 B;  2ZTD A;  4DF7 A;  4P72 A;  1QZG A;  5FO8 B;  4PMW A;  1H9K A;  1PH3 A;  3SVM A;  1EIY B;  4LF4 L;  3RLO A;  1H9M A;  3M7G A;  5IYD G;  1HHV A;  4JI3 Q;  5M3F B;  1HJP A;  1HRJ A;  3VR4 A;  4XXE A;  4BS9 A;  1TVX A;  3SEB A;  2BE5 D;  5GQO A;  1RTO A;  1CM9 A;  1JJG A;  3FP9 A;  1SYD A;  4LF6 L;  1N32 L;  2HUG A;  2ZXR A;  2VQE Q;  5JJL A;  1N33 L;  1BCP C;  3GTQ B;  3H0G H;  4EQN A;  1MJE A;  4Q0F A;  4DNT B;  2R7Z H;  4B3M Q;  3CQZ H;  4OO1 H;  4BXX G;  1PH1 A;  3NP8 A;  3R8B A;  4DR3 L;  1T9H A;  4YWM A;  2F52 A;  3UDX A;  4EVO A;  4UHV A;  4DPG A;  2EY5 A;  2KA7 A;  1LT6 D;  2K5H A;  4IUV A;  1VQF A;  4A3F B;  2H1E A;  1EYG A;  1HXY D;  5FJ8 G;  3HOV H;  4A3E G;  3KDF A;  2NUC A;  2ZTE A;  2B2T A;  1R4Q B;  1BCP B;  2R6G A;  4JI8 L;  3SK8 A;  4LF5 Q;  4GKJ Q;  1C9O A;  2PYK A;  2VZA A;  3WDN A;  3WWV A;  3M3Y H;  1FNW A;  2VB3 X;  1PH6 A;  2A68 C;  1F2Y A;  3S17 H;  4XYO A;  4DK3 C;  4JOI C;  2B2V C;  4C3I G;  3G6J B;  4YY3 Q;  3LWE A;  2WAQ G;  2E5L L;  4LK1 C;  2HCI A;  5IYC G;  1PYW D;  4LF8 L;  1YHB A;  3NWT A;  4FVM A;  3OTO L;  3PUX A;  2QIL A;  1G29 1;  2VUM H;  2WII B;  3MA2 B;  5J22 A;  3Q22 A;  2C9O A;  2PNR C;  3PIO 3;  3FDT A;  5GAH C;  3TS2 A;  4JI7 L;  1CHP D;  3K58 A;  1E2W A;  4Y7N B;  2UUC L;  3L7Z C;  3BZD B;  4ZAI A;  3SK6 A;  4I65 A;  4NXN L;  4AH6 A;  5E4W C;  4O0A A;  4P75 A;  1C7Y A;  1PZJ D;  2ICI A;  4GNX A;  3BDL A;  4A93 H;  4NMZ A;  3QG1 A;  2K5W A;  2Y0S B;  3CC4 A;  1EZ8 A;  2LMC B;  3BU2 A;  2RDF A;  1TR5 A;  3RN2 A;  1O7L A;  5GAG C;  4C3J G;  4A3I B;  3MXN B;  1IBL Q;  3AEV A;  5IOD A;  1FJG L;  3DEP A;  3EBE A;  3T51 B;  1PRT C;  3CCS A;  1TWG B;  2YU9 B;  1I94 L;  4L63 B;  3RLN A;  3CCE A;  2FHT A;  2XGT A;  4POF A;  1B1Z A;  2B2Y A;  3D31 A;  4X3T A;  2D9U A;  2VQF L;  1PFS A;  4A3J H;  4O2D A;  1XNR L;  1X6O A;  4FO2 A;  1A2U A;  5HGT A;  5FLX L;  4PZ8 A;  2ZJP A;  3N52 A;  1TWA H;  1U4R A;  5IP9 G;  5EQ0 A;  4ILW A;  4OWT B;  3TS0 A;  1Z7T A;  2KVM A;  5EKL A;  4WJ4 A;  3KK7 A;  2D0P A;  4LNQ A;  1SN8 A;  2C35 B;  3EQL C;  4IAL A;  1VMC A;  2A19 A;  4N8F A;  3C1F A;  1PRT B;  3I7F A;  1HTP A;  1L1O A;  2K04 A;  2BH2 A;  3TZD A;  3NSW A;  2ZM6 L;  3UE1 A;  2F0P A;  4NKL A;  3J7Y W;  1ASY A;  2NVT B;  5HGQ A;  5KNC A;  1A62 A;  5DLQ E;  3CCJ A;  2WB1 G;  4QIW B;  2DGY A;  1TS2 A;  3A5Z B;  2PQA B;  1QVG A;  4FF3 A;  2F0G A;  2AUK A;  3CCQ A;  2F0I A;  2ZTC A;  3D8G A;  1ICF B;  4QUF A;  1LYL A;  3PIO A;  4BBR H;  3RD4 A;  4JI6 Q;  1PLF A;  1RCV D;  1V8Q A;  2JN4 A;  4P73 A;  2JA7 B;  1Q7Y C;  1QZH A;  4K5V A;  4G57 A;  5JPN C;  1B8A A;  5M5X H;  3M85 A;  1S5B D;  2XWB B;  5EBC A;  2E2I B;  1SXT A;  4MTN A;  4K6D A;  1HA5 A;  2RQX A;  3NTI A;  2F0S A;  1ENF A;  3NBH A;  1PYS B;  4BA1 I;  1CZW A;  1Q1E A;  1O7Y A;  2BCO A;  1R9T B;  2PW5 A;  5HY6 A;  1PV4 A;  3IFD A;  3BYT B;  4GKJ L;  2A69 C;  4PZ7 A;  2IPK D;  5EBD A;  1KXL A;  1K83 B;  5KGU A;  1VF7 A;  4HJ8 A;  3I4N B;  1VQ4 A;  4M8A A;  1FVI A;  1H9S A;  3D3R A;  2NTT A;  1MI2 A;  3J7Z C;  2Q8T A;  5M5W B;  4E6I A;  3F2U A;  2VW9 A;  1ICW A;  1QVC A;  1TY2 A;  2A74 C;  4IPD A;  5DNF A;  1U0L A;  3S9W A;  1Y8P B;  2FIN B;  3PUY A;  2JE6 I;  3J80 c;  3DWQ A;  5ISR A;  1YEZ A;  2PMZ B;  3TRE A;  2UXC Q;  1VQA A;  1D6E C;  4YCV A;  4A3E B;  3HOU G;  4KKT A;  2B2U A;  1MKH A;  4A3D G;  3M4O H;  1I4X A;  1PH4 A;  1SYC A;  1LTL A;  1XYI A;  3B6Y A;  1VQN A;  1Q12 A;  4OON A;  2WP8 J;  3ER0 A;  2JYO A;  3NE5 B;  4HJ9 A;  3GP7 A;  3M4Y A;  4DR1 L;  2K32 A;  2PZT A;  1IBL L;  3T16 A;  1SLJ A;  2UUB L;  3T1H L;  1ET9 A;  1XMQ Q;  1W2B A;  2B63 G;  2KBN A;  4JI4 Q;  3WOE A;  4ME5 A;  5M3M G;  1DYQ A;  1HUN A;  2EIF A;  1KD1 C;  2PMZ E;  3BZC A;  4FXG C;  4AYB G;  1BKB A;  1LAB A;  4XT3 B;  4LUO A;  1F2Z A;  1I4H A;  2PCF B;  1KAA A;  5KIX A;  2ES2 A;  2EJM A;  3S15 H;  3HKZ E;  1QOH A;  5C3W A;  4CHT B;  4DGZ A;  4X66 Q;  5D3I B;  3RZO H;  3GV3 A;  3T1Y Q;  3QOJ A;  5C4J H;  1IYJ B;  5LMN Q;  5LHY 1;  4A76 A;  1KAB A;  3S2H H;  4YHH Q;  4X62 Q;  3J81 c;  1SJE D;  2Z4I A;  4J8Q A;  4IOC A;  1F9S A;  1PTO F;  1EY6 A;  3IRB A;  4C3J B;  1A8V A;  1Y1V B;  2ID0 A;  2JA5 B;  2H5X A;  1YBY A;  1JOQ A;  4YCU A;  5FKA C;  4UP9 A;  3PSI A;  1IL2 A;  2CQA A;  1HQR D;  2SNM A;  1VQC A;  3K0Y A;  3OSO A;  2K75 A;  2AUJ D;  1IYU A;  1HNW L;  5JEA H;  4FF4 A;  2O2L D;  3HOZ H;  1SNQ A;  1VCI A;  3J80 E;  4O42 A;  2MGS A;  1EQR A;  1GHJ A;  1XWE A;  4JI6 L;  2EOT A;  1SR3 A;  2JA8 G;  3D6C A;  2IHF A;  2K4K A;  3CF5 A;  3OIQ A;  2VL6 A;  1ASZ A;  2F0L A;  2Z6K A;  3GTL H;  4DA2 A;  5FOB B;  1KHI A;  3P75 A;  1EY4 A;  1SMY C;  1I4G A;  1IKM A;  3I73 A;  1N9W A;  4HJA A;  3I4O A;  3SK4 A;  1XXG A;  4A3L G;  1HNZ Q;  2C5C A;  5DM7 3;  1EQV A;  1NTG A;  4H44 C;  1F9Q A;  1G51 A;  4TQU S;  1K8O A;  4ID6 A;  2Z6B A;  2F0E A;  4F88 A;  1V43 A;  1MD2 D;  1VQL A;  3GTM H;  4LFB L;  2L0C A;  4R4C A;  2KCC A;  4GOP C;  1I3Q H;  5LMU L;  2K33 A;  3A7L A;  5IWA Q;  3AYH B;  2JEB I;  1C0A A;  2I0Q A;  3GDE A;  1ML0 D;  1WI5 A;  1SAP A;  1EIF A;  1LTT D;  1X65 A;  3A8J E;  1VQB A;  2K5N A;  1Y1W H;  5K5P A;  3C3L A;  2CWP A;  2RCN A;  1S4Z A;  4DR6 Q;  1YHQ A;  1LTR D;  2EYJ A;  4JBK A;  1TS4 A;  2IL8 A;  1IXR A;  2BE5 C;  3BDC A;  2B2W A;  2MPM A;  2UXC L;  1HZB A;  2CW0 D;  5FLM H;  3J81 E;  3CC2 A;  2X69 A;  4IUU A;  4GOP B;  2DNC A;  2K1B A;  1WCM G;  4R4O A;  1YNN D;  3CRL C;  1RJT A;  3H0G B;  4DU9 A;  3TBI B;  2MQH A;  1AP0 A;  1FGU A;  1H9R A;  3HKS A;  4AIM A;  5CBE E;  4PMB A;  3RR5 A;  3QWN A;  1LT4 D;  2NWG A;  5C5L A;  1SBB B;  4K6L A;  1V9P A;  1FNU A;  2A1A A;  3KF8 B;  3J7A 5;  4JV5 L;  1HFG A;  4B3S L;  3MFY A;  2IWH A;  3CAM A;  2Z4H A;  2VXW A;  3UDG A;  1T5X D;  1EZ6 A;  1TWC H;  4GKK Q;  4JI0 Q;  1GUS A;  2MO0 A;  4TVA B;  3HOV B;  3DUZ A;  4XT1 B;  4JYA L;  4DR7 Q;  1PH8 A;  2SOB A;  3CCM A;  4ZQ3 A;  5CV8 A;  4JI4 L;  5IOC A;  4HIO A;  4CJ0 B;  3AMU A;  1KDB A;  3GTG B;  2A6E C;  1CK1 A;  1NR4 A;  1YHA A;  2LXJ A;  4EQ5 A;  2JP1 A;  2OCE A;  2EZV A;  3HOU B;  1CA6 A;  3M3Y B;  2F4I A;  1VQI A;  1XTD A;  5C0X I;  4BWG B;  5FLX c;  1HPC A;  2K01 A;  2LS0 1;  1WJJ A;  3H3V H;  5D14 A;  5CV9 A;  2K5V A;  1I6H H;  1EWI A;  5L37 A;  4YHH L;  4X62 L;  1DON A;  4XYQ A;  1PHJ A;  2E75 C;  1II3 A;  5IGB A;  4MHE A;  2VUM B;  4HSP A;  1G91 A;  5IE8 A;  1PH7 A;  3DEO A;  3KF6 B;  4ULL A;  2N3S A;  1CKM A;  2EPB A;  3AU7 A;  3S2D H;  4OXP A;  4L5S A;  3W5O A;  5M3M B;  4A3I G;  3DLL A;  2PQA A;  3HOW G;  1G6P A;  3FEW X;  1ZXT A;  4IPC A;  4ZKB B;  1NUC A;  4AYB B;  2FJ2 A;  3C1E A;  3IFT A;  3AQQ A;  1XTC D;  2EQS A;  4A93 B;  4M1U B;  4HCE A;  1E24 A;  3OWE B;  3HG9 A;  3U50 C;  2CCZ A;  2E2H H;  1KLG D;  2EYL A;  3S1R H;  1PYB A;  4A3C G;  3MHB A;  2AWO A;  1QE6 A;  2D62 A;  1GUT A;  5COY A;  3NBI A;  3RMH A;  4DUZ L;  4HID A;  3ERS X;  4XQN A;  3H6M A;  1PFN A;  4DR2 L;  2GA4 B;  4ODG A;  4A3J B;  1Y14 B;  1UWV A;  4HIK A;  5GAD C;  4DAP A;  2HDM A;  2DY7 A;  3FKI H;  3FVQ A;  1TWA B;  3E0J A;  1MGS A;  1Q8I A;  3T13 A;  4KD4 A;  4IJH A;  2BDO A;  1S3O A;  2HQE A;  4JI2 Q;  3F2C A;  1WTP A;  4BY1 H;  1LTS D;  2XIW A;  2ZJR A;  1V1O A;  5IWA L;  2KQ3 A;  2UU9 Q;  1SSO A;  3RUZ A;  1WTQ A;  3TP7 A;  5IP7 G;  2KCT A;  1NSN S;  1LTA D;  4XDX A;  3KJP A;  1F77 A;  2XVS A;  2JA8 B;  3G4S A;  1OTC A;  1RD9 D;  3HP3 A;  3CPF A;  5C0X H;  1HR0 Q;  2XTI A;  1XX8 A;  1A2T A;  2BDN A;  2OQ0 A;  5FLX E;  1F2L A;  5JEA J;  3S16 B;  1E1O A;  3BS1 A;  1PH5 A;  1VDZ A;  1ZYR D;  1VF5 C;  3G7L A;  2RVL A;  4R8N A;  2O4X A;  1JMC A;  2JA7 G;  2F0H A;  1EWC A;  4KLK A;  1JE5 A;  2OXP A;  4ZUJ A;  4HMJ A;  2EVB A;  4FF1 A;  1I6V C;  2RBM A;  1AZP A;  1E0B A;  1F9P A;  2R7F A;  4GN5 A;  1QG7 A;  4DFA A;  1FGB D;  5ELO A;  5AJ3 Q;  2I5M X;  4TSS A;  3OMC A;  3CKI B;  2NB0 A;  2F1M A;  1KL9 A;  2XNA C;  4GKK L;  1GVP A;  4JI0 L;  4RKB A;  3I4N G;  1SND A;  1BXT A; 
#chains in the Genus database with same CATH homology
 2IT1 A;  2B8G A;  4XQJ A;  3MXP A;  4N9P A;  1JB3 A;  4DAV A;  2AWN A;  2RSN A;  3K57 A;  5EKI A;  1U4M A;  2AQ1 B;  5T1G A;  4PQX A;  1WCM B;  1IW7 D;  2F0O A;  3A8K E;  2XRS D;  3KLS A;  3V2T A;  4RKL A;  4K5W A;  4RWS C;  1PTO H;  1LTB D;  3BVM A;  2H4O A;  4CJ1 B;  2F0M A;  2WAC A;  1ET6 A;  1TWF B;  2KOL A;  1CQF A;  5KNB A;  1HCZ A;  1E2Z A;  5D65 A;  1JR0 D;  3T53 B;  5A2Q L;  2F0F A;  1PXU A;  2XWJ B;  4QUC A;  2IJ0 A;  1SJH D;  4HR7 B;  3R3O A;  4WJW A;  5KYI A;  1EY9 A;  1EQT A;  5BN5 A;  4KTA A;  3D4R A;  1OXT A;  2O5J C;  5CR3 A;  3OIP A;  4KY6 A;  2HCC A;  2OEO A;  4XQQ A;  1TS5 A;  3S15 B;  3HOW B;  2MP1 A;  2NN6 G;  3RZO B;  1LO5 D;  1SYB A;  2XN9 C;  1VMP A;  5IT9 L;  3VR3 A;  1FYC A;  3TME A;  2JEA I;  2EJF C;  1PFM A;  5IGC A;  3K5M A;  4DXG A;  2NVX B;  1K8M A;  3IL8 A;  1STH A;  1D1K A;  4DK1 A;  1B50 A;  5C4H A;  3A7A B;  1AEX A;  4IFD I;  1DXM A;  2A5H A;  3OW7 A;  1DOL A;  1EIH A;  5HUR A;  5ELD A;  3NQI A;  2IW3 A;  3KF8 A;  3PUV A;  1TT2 A;  3VR5 A;  3BYY B;  2QKI C;  2QEJ C;  2F03 A;  4HMI A;  5I6Y A;  2I46 A;  1ONL A;  3NXW A;  1STY A;  4LAA A;  5F2D A;  4C1N I;  4C1N K;  4O1N A;  1OO9 B;  1U4P A;  4QB4 A;  1JWS D;  5J1Z A;  5EJW A;  3D4D A;  2RA4 A;  1FD7 D;  3E6Z X;  5D3D A;  2F0V A;  3E5S A;  1JE4 A;  1EYC A;  1G2S A;  2WKC A;  4V19 0;  1SE3 A;  3LWU A;  3OOC A;  2VNU D;  2WKD A;  1J8I A;  4FXD A;  1HTL D;  4PV1 C;  3FRP B;  5E1F A;  2KJX A;  2EYF A;  4OO1 G;  1CZG A;  2WIN B;  4ZK9 B;  4KV6 A;  3GQB A;  3KLR A;  5COR A;  3K5N A;  4CBV A;  2M2L A;  2NBF A;  2CW0 C;  4CKC A;  1ENC A;  1EEI D;  1S5E D;  3X3N A;  1WD0 A;  3ND9 A;  1B53 A;  3Q24 A;  2K5Q A;  4NP5 A;  3S1M B;  1TWC B;  3H3V C;  4IFD H;  5IGE A;  1GUG A;  2KED A;  4K8J A;  5M5Y B;  3IKJ A;  1STB A;  1M8A A;  1PFB A;  3HKZ B;  3A55 A;  4EQO A;  4RGO S;  1QWY A;  1O80 A;  2M00 A;  3VYT A;  3LX0 A;  1EY5 A;  5CBA E;  1SE4 A;  1WTO A;  1I6H B;  1EY0 A;  1FNV A;  1PZK D;  1LTI D;  2KHS A;  4JBW A;  1YNJ D;  5CV7 A;  1RTN A;  4UDU C;  2TSS A;  1D5X C;  1BBX C;  5I2Y A;  1STN A;  2R3Z A;  1EOT A;  1JOR A;  4K14 A;  2K5D A;  3GD7 A;  3I3C A;  2L1B A;  2B2T C;  3TSS A;  1TU2 B;  4KY5 A;  5FK9 C;  2HDL A;  4ZUI A;  1ILQ A;  2E2H B;  3DWP A;  5CV4 A;  3S1R B;  3A54 A;  1PZI D;  3GO5 A;  1X32 A;  3I90 A;  5EPK A;  1HFN A;  1U4L A;  5I9P A;  1EU3 A;  2DY8 A;  3DMU A;  4FNF A;  1M4V A;  2PZW A;  5EPL A;  1JCK B;  3R93 A;  1NAP A;  1LAC A;  1JWM D;  2SEB D;  4ZLT F;  3PMF A;  1H9J A;  2K28 A;  1KLU D;  3V96 A;  2EYM A;  5TSS A;  4HTH A;  4KKS A;  1QCB D;  4CJ2 C;  2G9D A;  4KJN A;  4ZYS A;  3PIP 3;  3P20 A;  5C3X A;  4P2C B;  4RH6 A;  1PDQ A;  1ESR A;  3T4A C;  4RGM A;  3WOF A;  5IGF A;  3ZYY X;  2B2Y C;  2CHB D;  1ROD A;  1UUP A;  1KNA A;  1ZYR C;  4CKE A;  1B9N A;  1X3Q A;  5K36 H;  5DEH A;  3MFG A;  1WTV A;  3FPP A;  2L12 A;  4EGV A;  3P1H A;  2SNS A;  1E2V A;  3TDQ A;  1EY8 A;  3T56 B;  3KBG A;  1A6X A;  2B2V A;  2BOS A;  1TQO A;  3HOX B;  2A69 D;  2PO4 A;  2R7Z B;  3CQZ B;  1HQM C;  1D5Z C;  4R9W A;  3MXN A;  1CHQ D;  1I4R A;  4IUR A;  2F0Q A;  2NN6 I;  2O5I C;  1QNK A;  1O78 A;  2RDG A;  1IW7 C;  4HSV A;  1JQY D;  3CRK C;  4RGT A;  4UAI A;  1DJR D;  2EYH A;  2NYZ D;  1EFI D;  3PO3 B;  2X6L A;  3MAQ A;  1Y8N B;  2NZ1 D;  2EE1 A;  3S17 B;  3TZU A;  1DM0 B;  4K8I A;  2MJ8 A;  5C6A A;  4U68 A;  1IHZ A;  1ESF A;  4C3H B;  3DHQ A;  4QCL A;  4KHV A;  3NQT A;  2JSO A;  2PPB C;  1LT3 D;  3HZX A;  4HN7 A;  4IUQ A;  3HOY B;  3EJI A;  1JIC A;  4MN3 A;  2A73 B;  5C4Z A;  5J39 A;  4JK1 C;  5A2Q E;  5JVH 3;  1UAP A;  2ICE C;  2RDH A;  3C2P A;  5JAV A;  3NUC A;  1H9S B;  2B2U C;  3QO2 A;  1JOK A;  4DXF A;  1QJO A;  1MSH A;  3GTP B;  1KDC A;  3QOL A;  1TWH B;  5JEA G;  1BCP F;  2Q8R E;  1A3V A;  1SEB D;  2DN8 A;  4G4K A;  4LJZ C;  3MVV A;  3ITP A;  1MBY A;  4WOR A;  2F0N A;  1Y8O B;  3D4W A;  3X3M A;  2QF7 A;  1UEA B;  3Q23 A;  1V1P B;  3CU7 A;  3H94 A;  1R4P B;  2KEE A;  1EY7 A;  2FFK B;  4KN7 C;  4N9T A;  3NHH A;  1NR2 A;  1I4Q A;  1LT5 D;  5EGT A;  1Y69 U;  3EA6 A;  2J7Z A;  4FXK C;  3H09 A;  2AQ2 B;  5EPJ A;  2E76 C;  3OMG A;  4KHZ A;  1LV9 A;  3I72 A;  2R93 B;  1BO0 A;  3W2D A;  5E4X A;  4L8J A;  4BBR B;  1BDO A;  3MWY W;  4KI0 A;  3KBX A;  3K5O A;  4I7Z C;  4ABN A;  3I91 A;  1PTO D;  5M5X B;  3NWS A;  1BUV T;  4G7Z C;  3EFX D;  1NCV A;  3NPP A;  2ENB A;  4G7O C;  5FO9 B;  1Z47 A;  4CGY B;  1SNO A;  5NUC A;  1DD2 A;  2G9H D;  3TP6 A;  2IX0 A;  3L9A X;  4XTC S;  5CMD A;  4K2L A;  5ELF A;  4X3U A;  1I50 B;  5IIF A;  1G2T A;  5M9O A;  5LL6 X;  3CHB D;  1KNE A;  1PRT F;  3BG3 A;  1STG A;  1SYG A;  3QB3 A;  3I4M B;  1WD1 A;  1KTK A;  2BA0 A;  5G3L F;  1B2T A;  2J0T D;  3OWF A;  1WVL A;  4HCS A;  1SNM A;  2A6E D;  1Z6H A;  3M4O B;  4DK0 A;  1GUW A;  1WTW A;  4EQP A;  1C48 A;  3JAM L;  2B2W C;  4KY7 A;  3VA7 A;  3C46 A;  3Q6S A;  4B9W A;  2ZXO A;  4J6H A;  1MSG A;  3I70 A;  1BOS A;  4BY7 B;  3OHX C;  3PUZ A;  4R8I A;  3MTS A;  4FP5 D;  3SXH A;  4K2K A;  1I4P A;  1TII D;  4OGQ C;  1BQQ T;  1YNJ C;  3NTH A;  3FMC A;  3OPO A;  1DCZ A;  5C4J B;  1AW7 A;  1Q1B A;  1AFP A;  4B9X A;  3VYR A;  3S2H B;  3L3O C;  5CV5 A;  1B3A A;  1GJX A;  1W6K A;  1IL8 A;  3VYU A;  1HUM A;  2L9H A;  5KEE A;  3SE0 A;  3EVQ A;  2F0U A;  5BN4 A;  1RF2 D;  2EXZ A;  2K03 A;  4IQZ A;  2M9V A;  4QMG A;  4RFB A;  1TS3 A;  3AB9 A;  3HOZ B;  3UI2 A;  1TKW B;  2KEC A;  1RHP A;  1CA5 A;  3GTL B;  5C0X G;  4YIJ A;  3K7A B;  2XSC A;  5ELE A;  1BR9 A;  2EY2 A;  1OXX K;  4TKO B;  4RA8 A;  3SR1 A;  2B39 A;  1F9R A;  3GTM B;  3SDZ A;  3K59 A;  2A6H D;  4OIJ A;  1I3Q B;  3MXU A;  5CV6 A;  4X3S A;  1UNS A;  4F87 A;  3ND8 A;  3TN2 A;  5C0X J;  1GUO A;  1STA A;  1Y1W B;  1T5E A;  1EL0 A;  3KLS X;  3N6R A;  5ELB A;  3KUP A;  3NTK A;  4L6T B;  1L0Y B;  1SE2 A;  3NK9 A;  1BCP D;  4CKB A;  4C2M B;  4OHJ A;  3J7A V;  4J1M A;  3HEJ A;  3BVG A;  4HAE A;  1YNN C;  4Z9C B;  5ELC A;  4BA2 I;  2TMP A;  1ENA A;  4IUT A;  3U9S A;  5I2X A;  5BN3 A;  2F3W A;  4IZ8 A;  4ZRZ A;  3S1N B;  1OXU A;  4U67 3;  5IGG A;  2L11 A;  1A3U A;  1EYD A;  5T1I A;  3MXG A;  2F3V A;  4IN3 A;  4DAY A;  1GUN A;  2LFN A;  3RLF A;  1DOM A;  3D6W A;  2A68 D;  3I4L A;  3DXJ C;  1DZ1 A;  4C3H G;  5FO7 B;  3O13 A;  1TY0 A;  1CQV A;  2Z1C A;  3A56 A;  2I07 B;  4RHS A;  3R2I A;  2F0K A;  2N88 A;  4IUP A;  1JC7 A;  2EYP A;  1V1P A;  5E3F A;  1F2M A;  1Q90 A;  3Q0A A;  1W6J A;  1EIG A;  1SYF A;  1LLR D;  2EY6 A;  3HRZ C;  4C3I B;  3S2D B;  4OL7 A;  2FMC A;  2WAQ B;  3GTJ B;  1GXD C;  1BF4 A;  1GHK A;  4KK7 A;  1EU4 A;  3I8Z A;  2F0J A;  2QDB A;  1O7Z A;  2PQE A;  2WV6 D;  2BA1 A;  2MUY A;  5CC4 A;  1PRT D;  1LTG D;  2YYZ A;  5CYU A;  3J7A F;  1X3P A;  4H13 C;  2RKS A;  4WRD A;  4H7B A;  5G3L D;  2EDG A;  3FKI B;  4FYD A;  3ERO A;  5JVG 3;  1AZQ A;  3V05 A;  1QB5 D;  1SNP A;  1G8Z D;  1GOZ A;  1D5M C;  2KCN A;  1AN8 A;  3DM1 A;  4BY1 B;  2ZXP A;  1CI3 M;  5C5M A;  3TP8 A;  5DAU A;  2KUM A;  2K6A A;  5KYL A;  2SDF A;  2V4D A;  4OIK A;  1CTM A;  2D2C C;  3FPU B;  3IAY A;  1C8C A;  2E2J B;  4IUN A;  4KN4 C;  2L4N A;  3ERQ A;  5KRU A;  2ZT9 C;  4H0L C;  3URY A;  1IKL A;  4MIU A;  3ONA B;  1J9O A;  4PMC A;  2QCP X;  1QIL A;  3K6O A;  4B08 A;  4NDX A;  2WB1 B;  4TRD A;  2Q8I B;  2B8F A;  2F0W A;  5I4D A;  1S5D D;  3GTO B;  4DN4 M;  2K7V A;  1EYA A;  5A35 A;  1PTO C;  3TP5 A;  1RKN A;  1CT1 D;  2JXM B;  1ZKO A;  2MHV A;  3VR6 A;  1CFM A;  2E2D C;  3MC0 B;  2RSO A;  4K5X A;  4PNY A;  2F0D A;  2AQ3 B;  5JOB A;  2PZU A;  3H91 A;  3P7J A;  3VA5 A;  1JOO A;  2VB2 X;  3PV0 A;  1QNU A;  1B4O A;  2X6G A;  4V0B A;  4A3M B;  1A15 A;  3VR2 A;  4A3K B;  2K05 A;  2XRQ D;  2N55 A;  4IFD G;  5JPM C;  1ZEQ X;  2OT2 A;  1PMR A;  1PTO B;  2L55 A;  2EYO A;  4LMQ D;  2LY7 A;  3K5L A;  3DWA A;  2JA6 B;  4RCO A;  1SFO B;  4BBS B;  3PO2 B;  5KND A;  3S1Q B;  4A3B B;  3GTK B;  1RDP D;  1D1I A;  1JWU D;  1C4Q A;  4KMU C;  1OXS C;  3HS0 C;  4S3S A;  4KD3 A;  5LL6 S;  5JJZ A;  1S5C D;  1SYE A;  5I9O A;  1BNZ A;  3VYS A;  5EKK A;  2PW7 A;  1B9M A;  2NVY B;  2NVQ B;  4C56 C;  4IFD J;  3QIA A;  5DM6 3;  1WTX A;  3MEH A;  3MZ5 A;  4NW2 A;  1FR3 A;  2OF1 A;  5C44 B;  1HA6 A;  4A3D B;  4KJO A;  3M7N A;  4A3G B;  2R61 A;  1ILP A;  3BDO A;  3SHL A;  1EEF D;  2R92 B;  1KDA A;  2J4X A;  4QF4 A;  4F7X A;  1EWH A;  1D2B A;  4RCN A;  2B63 B;  1IYV A;  2E74 C;  3JAM E;  1DOK A;  1WTR A;  2F0T A;  3W3A A;  3J80 L;  3U9O A;  1S5F D;  2IX3 A;  3SK5 A;  5C4X B;  3GV6 A;  2NN6 H;  4Q5V A;  4XIG S;  2EY1 A;  2NTS A;  2EJG C;  3PUW A;  2FMM A;  4OO1 I;  4KKU A;  1G6Z A;  5IGD A;  4X3K A;  3HGB A;  4ZKC B;  1SDF A;  4HED A;  3RZD B;  4G7H C;  5IT9 E;  4RGN A;  1Q3L A;  1SMY D;  3QJY A;  3A8I E;  2CVR A;  5CGK A;  2LKV A;  5AFW A;  4WFN 3;  4FF2 A;  4RAU C;  5I6W A;  2L5T A;  4F8M A;  4DNR B;  3R2T A;  3LNN A;  1L0X B;  1SNC A;  2Z8L A;  1U9R A;  3BVZ A;  1B44 D;  3J81 L;  4RHR A;  5K36 G;  4GZY C;  5C3E B;  1STE A;  1OXV A;  2IX1 A;  2DNE A;  2D5D A;  2A6H C;  1A3T A;  3S14 B;  4DF7 A;  5FO8 B;  4PMW A;  1H9K A;  3SVM A;  1H9M A;  3M7G A;  1HHV A;  5M3F B;  1HRJ A;  3VR4 A;  4XXE A;  4BS9 A;  1TVX A;  3SEB A;  2BE5 D;  1RTO A;  1CM9 A;  1SYD A;  2HUG A;  2ZXR A;  1BCP C;  3GTQ B;  4EQN A;  4Q0F A;  4DNT B;  4OO1 H;  3NP8 A;  3R8B A;  4EVO A;  2EY5 A;  2KA7 A;  1LT6 D;  4IUV A;  4A3F B;  2H1E A;  1HXY D;  2NUC A;  2B2T A;  1R4Q B;  1BCP B;  2R6G A;  3SK8 A;  2PYK A;  3WDN A;  1FNW A;  2VB3 X;  2A68 C;  1F2Y A;  4XYO A;  2B2V C;  4C3I G;  3G6J B;  3LWE A;  4LK1 C;  2HCI A;  1PYW D;  3NWT A;  4FVM A;  3PUX A;  2QIL A;  1G29 1;  2WII B;  3MA2 B;  5J22 A;  3Q22 A;  2C9O A;  2PNR C;  3PIO 3;  3FDT A;  1CHP D;  3K58 A;  1E2W A;  4Y7N B;  3L7Z C;  3BZD B;  4ZAI A;  3SK6 A;  4I65 A;  5E4W C;  1PZJ D;  2ICI A;  3BDL A;  4NMZ A;  3QG1 A;  2K5W A;  2Y0S B;  1EZ8 A;  2LMC B;  2RDF A;  1TR5 A;  1O7L A;  4C3J G;  4A3I B;  5IOD A;  3DEP A;  3T51 B;  1PRT C;  1TWG B;  2YU9 B;  4L63 B;  2FHT A;  1B1Z A;  2B2Y A;  3D31 A;  4X3T A;  2D9U A;  4FO2 A;  1A2U A;  5HGT A;  5FLX L;  3N52 A;  1U4R A;  5EQ0 A;  4ILW A;  1Z7T A;  2KVM A;  5EKL A;  3KK7 A;  3EQL C;  4IAL A;  1VMC A;  3C1F A;  1PRT B;  1HTP A;  2K04 A;  3TZD A;  3NSW A;  2F0P A;  4NKL A;  3J7Y W;  2NVT B;  5KNC A;  4QIW B;  1TS2 A;  4FF3 A;  2F0G A;  2AUK A;  2F0I A;  3D8G A;  4QUF A;  3RD4 A;  1PLF A;  1RCV D;  1V8Q A;  2JA7 B;  4K5V A;  4G57 A;  5JPN C;  3M85 A;  1S5B D;  2XWB B;  5EBC A;  2E2I B;  1SXT A;  4K6D A;  1HA5 A;  2RQX A;  3NTI A;  2F0S A;  1ENF A;  3NBH A;  4BA1 I;  1CZW A;  1Q1E A;  1O7Y A;  2BCO A;  1R9T B;  2PW5 A;  3IFD A;  3BYT B;  2A69 C;  2IPK D;  5EBD A;  1K83 B;  5KGU A;  1VF7 A;  3I4N B;  4M8A A;  1H9S A;  3D3R A;  2NTT A;  1MI2 A;  2Q8T A;  5M5W B;  4E6I A;  3F2U A;  1ICW A;  1TY2 A;  2A74 C;  5DNF A;  3S9W A;  1Y8P B;  2FIN B;  3PUY A;  2JE6 I;  3DWQ A;  5ISR A;  2PMZ B;  1D6E C;  4A3E B;  4KKT A;  2B2U A;  1I4X A;  1SYC A;  1XYI A;  1Q12 A;  2WP8 J;  3NE5 B;  2JYO A;  3GP7 A;  3M4Y A;  2K32 A;  2PZT A;  3T16 A;  1ET9 A;  3WOE A;  4ME5 A;  1DYQ A;  1HUN A;  4FXG C;  1LAB A;  4XT3 B;  1F2Z A;  1I4H A;  2PCF B;  1KAA A;  5KIX A;  2EJM A;  1QOH A;  5C3W A;  4CHT B;  4DGZ A;  5D3I B;  3GV3 A;  3QOJ A;  5LHY 1;  1KAB A;  1SJE D;  2Z4I A;  4J8Q A;  1F9S A;  1PTO F;  1EY6 A;  4C3J B;  1Y1V B;  2ID0 A;  2JA5 B;  1JOQ A;  5FKA C;  2CQA A;  1HQR D;  2SNM A;  3K0Y A;  3OSO A;  2AUJ D;  1IYU A;  5JEA H;  4FF4 A;  2O2L D;  1SNQ A;  1VCI A;  3J80 E;  4O42 A;  2MGS A;  1GHJ A;  1XWE A;  2EOT A;  3D6C A;  3OIQ A;  2F0L A;  4DA2 A;  5FOB B;  3P75 A;  1EY4 A;  1SMY C;  1I4G A;  1IKM A;  3I73 A;  3SK4 A;  1XXG A;  2C5C A;  5DM7 3;  1EQV A;  4H44 C;  1F9Q A;  4TQU S;  1K8O A;  4ID6 A;  2F0E A;  4F88 A;  1V43 A;  1MD2 D;  2L0C A;  2KCC A;  2K33 A;  3A7L A;  2JEB I;  1ML0 D;  1SAP A;  1LTT D;  3A8J E;  5K5P A;  3C3L A;  1S4Z A;  1LTR D;  2EYJ A;  1TS4 A;  2IL8 A;  2BE5 C;  3BDC A;  2B2W A;  2MPM A;  3J81 E;  2CW0 D;  2X69 A;  4IUU A;  2DNC A;  2K1B A;  1YNN D;  3CRL C;  1RJT A;  3H0G B;  4DU9 A;  3TBI B;  1AP0 A;  1H9R A;  5CBE E;  4PMB A;  3QWN A;  1LT4 D;  2NWG A;  5C5L A;  1SBB B;  4K6L A;  1FNU A;  1HFG A;  3MFY A;  2IWH A;  2Z4H A;  2VXW A;  1T5X D;  1EZ6 A;  1GUS A;  3HOV B;  3DUZ A;  4XT1 B;  2SOB A;  4ZQ3 A;  5CV8 A;  5IOC A;  4CJ0 B;  3AMU A;  1KDB A;  3GTG B;  2A6E C;  1CK1 A;  1NR4 A;  2JP1 A;  2EZV A;  3HOU B;  1CA6 A;  3M3Y B;  2F4I A;  5C0X I;  4BWG B;  1HPC A;  2K01 A;  2LS0 1;  5D14 A;  5CV9 A;  1DON A;  4XYQ A;  2E75 C;  1II3 A;  5IGB A;  4MHE A;  2VUM B;  4HSP A;  1G91 A;  3DEO A;  4ULL A;  2EPB A;  3AU7 A;  5M3M B;  3FEW X;  1ZXT A;  4ZKB B;  1NUC A;  4AYB B;  2FJ2 A;  3C1E A;  3IFT A;  1XTC D;  4A93 B;  4M1U B;  4HCE A;  3OWE B;  3HG9 A;  1KLG D;  2EYL A;  3MHB A;  2AWO A;  1QE6 A;  2D62 A;  1GUT A;  5COY A;  3NBI A;  3RMH A;  4XQN A;  3H6M A;  1PFN A;  2GA4 B;  4ODG A;  4A3J B;  4DAP A;  2HDM A;  2DY7 A;  3FVQ A;  1TWA B;  3E0J A;  1MGS A;  1Q8I A;  3T13 A;  4KD4 A;  2BDO A;  2HQE A;  1WTP A;  1LTS D;  2XIW A;  1V1O A;  2KQ3 A;  1SSO A;  3RUZ A;  1WTQ A;  3TP7 A;  1NSN S;  1LTA D;  4XDX A;  1F77 A;  2XVS A;  2JA8 B;  1RD9 D;  3HP3 A;  5C0X H;  1XX8 A;  1A2T A;  2BDN A;  5FLX E;  1F2L A;  5JEA J;  3S16 B;  3BS1 A;  1VDZ A;  1ZYR D;  1VF5 C;  3G7L A;  4R8N A;  2RVL A;  2O4X A;  2F0H A;  1EWC A;  2OXP A;  4ZUJ A;  4HMJ A;  2EVB A;  4FF1 A;  1I6V C;  2RBM A;  1AZP A;  1E0B A;  1F9P A;  1QG7 A;  4DFA A;  1FGB D;  4TSS A;  3OMC A;  3CKI B;  2NB0 A;  2F1M A;  2XNA C;  4RKB A;  1SND A;  1BXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...