4NW2A

Tandem chromodomains of human chd1 in complex with influenza virus ns1 c-terminal tail trimethylated at k229
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
173
structure length
173
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for histone mimicry and hijacking of host proteins by influenza virus protein NS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/viral protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 53
structure length 173
sequence length 173
chains with identical sequence C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nw2A02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nw2A01
2FFKB 5D65A 1AP0A 1ESRA 1U4MA 1HUNA 2FJ2A 4ZKCB 1B2TA 3I90A 2EOTA 1DONA 2HDLA 1E0BA 1RTNA 3DEPA 4IUUA 1C8CA 1O80A 2K03A 4XT1B 2IL8A 3UI2A 1HFNA 1NCVA 3I3CA 5E4WC 2MJ8A 3D6WA 5EPKA 2X6LA 1WTWA 1KNEA 3QO2A 4NW2A 1ML0D 5JJZA 4MHEA 2FHTA 1SSOA 1EOTA 3MTSA 1IKMA 1LV9A 2B2WA 1HA6A 4X3KA 1S4ZA 4DN4M 1XX8A 1G91A 3G7LA 2KUMA 3HP3A 3DEOA 1AZPA 3Q6SA 4X3SA 1HUMA 4U68A 3GV6A 2B2VC 2MP1A 1MSHA 1WTRA 3FDTA 1F9RA 5COYA 1EIHA 1EQTA 2L4NA 3KUPA 1MGSA 2BDNA 2KOLA 5CORA 1DOKA 4QUCA 2RA4A 1MI2A 3F2UA 3SVMA 1KNAA 4CJ2C 2KEDA 3N52A 2L12A 2MPMA 1ICWA 1IL8A 3TN2A 5CBAE 2K05A 1WTOA 1DOMA 2B2UA 4IUPA 1WTPA 1CA5A 2DY8A 2DY7A 4HEDA 4QUFA 2K28A 1B53A 2Q8TA 1HRJA 2NWGA 1X32A 4ZKBB 1CM9A 5D14A 1O7ZA 1VMCA 2J7ZA 1NR4A 1SDFA 1WD1A 1HFGA 2B2TC 4CJ0B 2H1EA 1RTOA 1B3AA 1TVXA 2X69A 4HCSA 1WVLA 1J8IA 1IKLA 1J9OA 2FMMA 1G2SA 1U4PA 2L9HA 4XDXA 5E4XA 3I8ZA 3KBXA 2EPBA 2X6GA 1BBXC 2NZ1D 1Q3LA 1U4RA 1QE6A 2KEEA 1RHPA 2D9UA 5CBEE 4X3UA 4MN3A 2B2YA 2JYOA 2XIWA 4RWSC 1F2LA 5T1GA 2VXWA 1F9PA 5DNFA 4ZLTF 1G2TA 3R93A 1AZQA 1PFMA 4IUTA 1F9QA 1NR2A 3IL8A 1BNZA 1PDQA 1PFNA 1DZ1A 2JP1A 1NAPA 2MGSA 1VMPA 2K01A 1MSGA 1O7YA 3H91A 3I91A 1HHVA 1DOLA 4LMQD 2HUGA 4IUVA 2B2UC 4ZAIA 1GUWA 2N55A 2KECA 2B2YC 1B50A 4HAEA 2KVMA 2R3ZA 2B2TA 4UAIA 2M2LA 4HSVA 4XT3B 1X3QA 4ZK9B 1U4LA 2RVLA 1PFBA 2HCCA 1X3PA 3P7JA 2CVRA 2NYZD 1ILQA 2K04A 3ONAB 4RAUC 5AFWA 1SAPA 4R8IA 1QG7A 2HDMA 3DM1A 4OIJA 1RJTA 1G6ZA 1BO0A 2K1BA 4IURA 4RA8A 5EPJA 3IFDA 1EIGA 1JE4A 4O42A 2L1BA 4IUQA 3FPUB 5EPLA 4CJ1B 1CA6A 5EQ0A 2N88A 3LWEA 2B2VA 1F9SA 1M8AA 2Q8RE 2RSNA 3TZDA 1WTVA 1BF4A 2L11A 4OIKA 1B4OA 1PLFA 2FINB 1JICA 1ZXTA 2EE1A 1ILPA 1WD0A 4X3TA 2SDFA 3MWYW 5T1IA 2B2WC 2RSOA 1WTQA 1WTXA 4R9WA 1EL0A 5EKIA 1QNKA 3GV3A 2HCIA 5EJWA 5CMDA 1RODA 1XYIA 1A15A
chains in the Genus database with same CATH superfamily
2KCNA 2LFNA 1YBYA 5J1ZA 4A3CH 1AP0A 2JA5H 1JOOA 1B2TA 3DEPA 4FVMA 2EJFC 1O80A 2Z4IA 2K6AA 4A3MG 2NVQH 2AUKA 4A93H 4A3DG 1TQOA 1CZGA 3EIVA 3UI2A 4LF7L 1Q81C 1KABA 3OTOQ 1F2MA 3D6WA 4CKEA 3QIAA 1ML0D 4H44C 1AE2A 1SSOA 2PNRC 4JI0L 1JJCB 1N32L 1IKMA 4C2MB 3CCRA 4X66Q 2KUMA 1T5EA 3BDLA 2Q2TA 2B2VC 1FL0A 4LFBL 3FRPB 3PO2B 4OO1G 1NJIC 4K2KA 3I4LA 3PUZA 1H9RA 1XNQQ 2B2UA 1JOKA 4HEDA 3NSWA 1XPOA 4IPCA 3STBD 1PMRA 1TS5A 4YCUA 4L5RC 4B3MQ 3J80L 3NQTA 2D0OA 2R6GA 2F0QA 5I2YA 4HIKA 5KEEA 3HOVH 1S40A 2NBFA 3Q24A 1IYJB 1FVIA 1ZEQX 2SOBA 3I8ZA 3KBXA 1L1OB 4KJNA 5E4XA 4OEMB 1E1TA 1Q3LA 1QILA 1VQAA 2D9UA 3S16B 1PH8A 2PQEA 2PI2E 1KAWA 1EUJA 1J6QA 3S9WA 1Q1EA 3A0JA 1X65A 1D6EC 1YJWA 2ALYB 3R8BA 3BS1A 3C1EA 5BN4A 1Y1WH 1EWIA 3MC0B 3ER0A 3QWNA 3ULJA 4G4KA 5C4ZA 1MIUA 4IFDJ 1STEA 1Y69U 2DJFC 3QOJA 4K0KQ 4GNXB 2IY5B 1I4XA 4FF1A 1R9TH 3M3YB 4DKAC 2Q2UA 5C5MA 3GQBA 1HNXQ 3VYSA 4GOPB 4OIJA 1PTOB 4KY7A 4UPAA 5E3FA 3T4AC 3EJIA 3NTIA 2EIFA 2KBNA 2B2VA 2B63G 3S15H 3HOVG 1J5EL 4JI1Q 4Q5VA 1D8LA 2B2WC 2RSOA 2HQEA 1PZJD 5C3EB 3MXPA 1TKWB 4Y7NH 3S1QH 5CV5A 3I4MH 3QOLA 2EXDA 2K7VA 2OCEA 5JEAH 1NY4A 2JN4A 2KCCA 2WKDA 1JORA 3TP7A 2MFIA 1PYWD 2HDLA 1EY6A 1PRTD 2BOSA 3UDFA 4ILWA 2PZWA 4C3HB 2F0VA 3WWVA 4GLXA 1CHQD 2G9HD 4Z9CB 4QIWE 2F0IA 3HOUG 5DEHA 1LTTD 1WCMH 2D62A 3KUPA 2BDNA 2VNUD 1OXXK 2I5HA 1MI2A 4BY1G 2OTJA 4DFAA 4OWXB 2EJGC 3N52A 2R7DA 1C4QA 5EKLA 1CA5A 1SNPA 5FLMG 1XXGA 2QDLA 5IOCA 1X6OA 3TP5A 1NMFA 1Q86C 2QILA 3S2HB 3C46A 4R4QA 2ASBA 1H9SB 1X55A 1F77A 1I4QA 1AE3A 1II3A 2L9HA 1G6PA 2LSSA 3EBEA 3KF8A 2LXKA 5CBEE 2XIWA 3CHBD 1STYA 4BXXG 2NTTA 3JC66 5H1SE 3H3VH 2C35B 2RKSA 3ICEA 3CKIB 1O7YA 1HHVA 2NVYH 4GLAC 4JI3Q 1CK1A 4K5XA 2XWBB 1JC7A 3EN2A 4HAEA 3CQZB 1SMXA 1Y8NB 2NZHA 5FK9C 2B2TA 3PGZA 3FHWA 4QQBX 2IX1A 4ZK9B 5GADC 1X3PA 3ONAB 1SAPA 1Y1WB 2N3SA 3DM1A 1CQVA 2K1BA 3RUZA 1CA6A 1RCVD 2B8GA 3K0YA 4B3RQ 2ICIA 4A3BG 1X3EA 4OL7A 1KDCA 3M7GA 2SDFA 4R9WA 2I0QA 1E3PA 2HQLA 1B7YB 4BBSB 4LFAQ 1HUNA 1S5ED 5I4DA 4F88A 1YJ9A 2UXCQ 3DWAA 3KJPA 1O78A 1HNZQ 5C0XH 2JA9A 4GZYC 4B9XA 3U4ZA 2XN9C 1N34L 3GTJB 2CW0D 3BJUA 4JCVE 5A2QL 4DR1L 3HP3A 3NEMA 1YNNC 4OHJA 4U68A 4F87A 1GJXA 2CQOA 5IT9c 2NTSA 2NVTB 3K7UC 3NELA 5ELBA 4QUCA 1SYFA 5IYCH 4EGVA 3HOVB 1EYDA 4R4TA 2AWOA 5LMNW 4DUYL 4A3EH 3FVQA 3TN2A 1LTSD 5CBAE 1HZCA 2OTLA 3NWSA 3K5NA 4KY5A 1B53A 2F4IA 3BZCA 3VDYA 3BG3A 2PMZE 2EQSA 3L0OA 2Q2HA 3PCOB 4JI8Q 3CCQA 2BA1A 1W6KA 3JAML 2R92H 5ELDA 2P5ZX 1XNRL 1XTDA 4DR5Q 4BA1I 2JA7G 2L0CA 2ZXOA 3D3RA 4RHRA 2EPBA 2YTXA 4LAAA 3NBIA 3TDQA 4A3MH 2Y0SB 3S16H 1TWGB 2NVQB 4A3KH 2B29A 2B2YA 3GTKH 3MEHA 1FJGQ 4DR3Q 3ZYYX 3KDFB 4DR6Q 3NTKA 1TT2A 4CDFC 1MBYA 3VYRA 1VQLA 2FMCA 2JP1A 1EZ6A 2DUDA 2F3VA 3VR4A 3S15B 4GN5A 1DOLA 4LF7Q 4XTCS 2KVMA 3J7A5 3OW7A 2CW0C 5J22A 4BBSG 2E2HB 2YYZA 3G48A 2O5JC 3R3OA 2K04A 1UE7A 4DR4L 5G3LF 2ZXPA 4ZUIA 2NVYB 1XJVA 5CC4A 2QW7A 4TSSA 1IHZA 3TS2A 5AJ3Q 4NXNQ 1IBKQ 1A2UA 4G7HC 1HNWQ 1VQ9A 1L1OC 2IX0A 2PZUA 4PZ8A 1CT1D 1NE3A 4XQNA 4A3FB 1Y1VH 5M5YB 4TKOB 1Z6HA 5BR8Q 3W3AA 5CMDA 3E0EA 2VS1A 4JV5Q 2F4VL 2B8FA 1AW7A 4IUUA 2Q8IB 5M3FH 1V1QA 2IL8A 5K36H 3S1RH 1VQEA 5IWAQ 3ITPA 1QWYA 3G6EA 3K8AA 3MTSA 1HA6A 1OXUA 3VA7A 1S4ZA 2NB0A 1K8OA 2QEXA 4R4CA 1VQBA 3DEOA 2PO4A 2F0HA 2HHHQ 2ZT9C 1MSHA 4DV2Q 2RCNA 4IJLA 4IOAA 2GVBA 1RIPA 3VR2A 1ICFB 2UUBL 2DN8A 3PUXA 1KRTA 2R7FA 1Q8KA 2K05A 2QF7A 2UUAQ 5IY0A 1VCIA 1HRJA 4OWWB 1O7ZA 1HFGA 1D7QA 1V1PB 1K0RA 4LUOA 1STNA 3I4MB 4A3JH 2JA6G 2FMMA 2ZXRA 1DJRD 2BH8A 5CV4A 1RL2A 2J0TD 3I4OA 4DK3C 1EIYB 4IPGA 4JI1L 1A62A 4LF6L 4POFA 4DAYA 5D3DA 5C44H 2AQ2B 4A3JB 5FLXE 4MIUA 3PIPA 1BCPF 3S1NH 4WFN3 1HZ9A 4AH6A 4EVOA 3VR5A 1N33L 2K52A 2SNMA 1HXYD 1QUQB 2OF1A 2F3IA 3WDNA 1HR0W 3GTQH 1UE1A 5IGDA 1KL9A 5IGFA 4X62Q 1S72A 1BOSA 3PF5A 1LTAD 3RZOB 1LACA 3E9HA 4L5TA 4RAUC 2PW5A 1I3QB 2AMCB 4JI4Q 4IFDG 2HDMA 1G6ZA 4R4IA 1GD7A 2B63B 3E3XA 1B44D 5EQ0A 4PZ7A 1D5ZC 1BF4A 1EOVA 2L11A 3QJYA 1JICA 3V96A 1ILPA 2JXMB 4AYBB 2CH4W 4X6AH 4RCOA 1QNKA 1HQRD 5JJLA 3PIP3 1PV4A 1RF2D 4CHTB 4PMCA 3RLFA 5I9OA 1LTRD 1YI2A 1V1OA 1QJOA 4JG2A 1C8CA 4KY6A 4A3EB 4NPSA 3NBHA 3M7NA 1Y1VB 3PIO3 2X6LA 5C0XJ 3K81C 1K28A 3G4SA 2OWOA 2EVBA 4ME3A 4JI2Q 5HURA 1LABA 3GO5A 2QDBA 4JI5L 5JOBA 3UDXA 2BE5C 3OHXC 3EQLC 2KCMA 1BDOA 1STGA 2A6ED 3FDTA 1NUCA 3F8TA 5COYA 1EQTA 4KHPL 5C4XG 2RHSB 1NNXA 4A3GB 3AU7A 1ICWA 4ABNA 4G7ZC 3FPPA 2Q2IA 3M4QA 1YHAA 4RKBA 4A3LG 4QGUA 1TWGH 5KNBA 4A3KB 4A3IB 3J81i 1SE3A 3CMAA 1V1PA 1KC8C 5C3WA 4A3GH 3SE0A 2PPBC 1D5MC 3BYYB 3BZKA 3A55A 3KJOA 4LF9L 1IBMQ 3KFUA 4ZUJA 2O2LD 3U9OA 2EJMA 1X9NA 2A1AA 3GTKB 2NN6G 1BXTA 4EQPA 1K3RA 4F7XA 3FKIB 3JAMi 4G57A 1VQ6A 2UXCL 4R1JA 4JI6L 1PFNA 4JYAQ 2OQKA 2Z4HA 1A63A 1PHJA 2VQEL 3KK7A 4GN4B 3MEFA 1CKNA 1N34Q 1OXTA 1TWAH 4HSVA 4XT3B 3STBC 3AQQA 4JW0A 3HG9A 1QZGA 1Z9FA 3P7JA 3DHQA 4RGTA 3HOUH 1H9MA 3M4PA 5CR3A 4DR1Q 5CV8A 1LUZA 5JAVA 4YY3L 4BY7H 5JEAG 1SROA 3L7ZC 1H9JA 5EPJA 4OXPA 4A93B 3GTGH 4APVA 2DNCA 3LWEA 2VB2X 3EVQA 1X3GA 5I6WA 5GQOA 3P1HA 1Z47A 1HA5A 3VYTA 4J15A 3J7AF 3CW2C 1WD0A 4N8X1 3AFQA 4IPDA 2PQAB 4K2LA 3H0GH 4B3TL 1A6XA 2JA5G 1K83B 1EWHA 3GV3A 3C2PA 2WAQE 4A3KG 4RGOS 5JPMC 2A6EC 2R7ZH 2WB1G 1DONA 1RTNA 4H13C 1A2TA 2K03A 1KTKA 1BVSA 2Z6KA 5A2QE 1W6JA 1SXTA 1U5KA 3CPWA 4KKTA 4KLKA 1N36L 1WTWA 5M3MH 1DXMA 1ENAA 3ERQA 1E1OA 1E24A 4N9PA 1FJGL 4DR7Q 1TWCH 3GV6A 3CCUA 4O0AA 2MO1A 1EIHA 3I73A 1MHWC 4AIMA 4DAMA 2VY3A 3A7AB 3H3VI 2JA8B 1CSPA 2PNHA 1FYCA 4RCNA 4OO1H 3AEVA 3KLWA 2PQAA 3QG1A 1TY2A 3S1MB 2LKVA 2D0PA 1EEID 2RDHA 4PMWA 4OX9L 5IODA 4DR4Q 1Z7TA 1RKNA 5D14A 1K0SA 1PH3A 4L5QA 2AWNA 1YEZA 4BBRG 1VQKA 2UU9Q 1E22A 4NXNL 2A74C 5C0XG 4J6HA 4BBRB 1U4PA 1S5FD 1STBA 2CHBD 3M85A 3TSSA 2F0KA 1WOCA 3I56A 3SK5A 1JJ2A 2R92B 1PZID 2E2JH 4NXMQ 5C4JH 5BR8L 1SLJA 4C1NK 1CZWA 1BCPC 2ZJRA 1JB3A 1PH2A 4DV5L 1ET6A 2V1CC 1GUGA 1L0WA 3K5LA 1HH2P 4DA2A 1BNZA 2A8VA 1VQJA 3TZUA 5IT9L 1A8VA 3SGIA 3H91A 1YHQA 1EQQA 3TP6A 2VZAA 1GO3E 2N55A 3U9SA 1PTOC 3ZJYC 1JJGA 4KI0A 2R3ZA 5LMUL 3GTOH 4IN3A 5KNDA 5DLQE 5IP9H 3J7AV 5E1FA 1K73C 2O5IC 1SMYD 3D6CA 3WOEA 4FXDA 4DV6L 2HIVA 1XMQQ 1BR9A 4HJ7A 4P75A 1H9KA 1M8AA 2UXDQ 3TZDA 3EROA 4DV4Q 3HGBA 1SNCA 2Z6KC 5T1IA 3MWYW 3UE0A 1I6HH 2IT1A 3H09A 1PYSB 3T13A 4CBVA 5D65A 2F3WA 1XTCD 2PI2A 2XWJB 2I5MX 2M00A 4S3SA 4P73A 1OXVA 1PZKD 3H0GB 5IE8A 1STAA 2OQ0A 1HR0L 4QCLA 5C4HA 2E74C 2E76C 1D2BA 5IGCA 4MHEA 2XRQD 3OWEB 2UXBQ 4A3IH 3IAYA 1AZPA 4JVZA 4JPBW 4EQOA 1MKHA 2MP1A 2I07B 1PRTF 4GKKQ 1N33Q 1DOKA 4DUZQ 3GTLH 4C3IB 1GM5A 4WJWA 1AEXA 3F1ZA 2MQHA 3K80C 1DOMA 3MXNA 3LGJA 5KRUA 2F03A 4R4OA 5IT9E 2DY7A 5J39A 1I94L 2QKIC 4JBKA 4WRDA 4JI4L 3DM3A 2F0MA 2WAQB 3KBGA 4LF4Q 3A5UA 1BBUA 3FKIH 2TMPA 2X69A 1J8IA 3D31A 4DNIA 4JI7L 5K36G 4KKUA 2K4KA 1D5XC 2CWPA 1V8QA 4DR2L 4X64L 5DAUA 4BY1B 1HPCA 4X3UA 5DM73 4GKJQ 1AN8A 1YJNA 3K59A 2VXWA 4KKSA 4QIWB 4HJ8A 1U9RA 1PFMA 3T1YQ 3HOUB 3J80i 5IYDH 1QZHA 1DZ1A 3UDIA 2E75C 3I91A 4ULLA 2EY5A 1E2ZA 3U4VA 2JA8G 2B2YC 2RDFA 4DNRB 5HGTA 1K3BC 3JAMc 2EYOA 2HCCA 2NYZD 3VA5A 1ENCA 2PCFB 3NTHA 2K5DA 1JR0D 3HOZB 3L3OC 4A3BH 1WTHA 4KHPQ 2LY7A 2N88A 4ID6A 4P71A 2F0LA 1M1KC 3KF6A 3DWQA 5IYBG 4X65L 1PA6A 4C2MH 4PG3A 1QVFA 4IPHA 4QMGA 1SYEA 3URYA 4UHVA 3KF8B 3S2HH 1ZKOA 3PMFA 5HY6A 1UEBA 1TIID 4UP9A 1HJPA 4P2CB 5CV9A 3S17B 4WJ3M 2JA7H 4GN3B 5LMNL 2K5WA 4DXFA 2JA8H 4OO1I 3OMCA 3NHHA 2FHTA 4NP5A 4K6LA 1KHIA 3HOWB 4GNXA 3MVVA 2LMCB 4A3MB 4CJ2C 2K5NA 3BVGA 4A3JG 3OTOL 3PUYA 2Z8LA 5C44B 5IGEA 3SEBA 1TS2A 5C4JB 2AHOB 2Q8TA 2MNAA 5FO7B 2A6HC 1S5BD 4YY3Q 3I4NH 1TWHB 1VQOA 3CAMA 3D4RA 4ME5A 3F2CA 1K83H 1TVXA 2K32A 3SR1A 4HCSA 1VQPA 1GKHA 4A3FG 1YNND 2NZ1D 3RNUA 1YIJA 2KEEA 1I50B 1PTOD 4B3TQ 4KN4C 1L0YB 3J80E 2JSOA 2K50A 4CDEC 4AQYL 1PTOH 4B3ML 2CH4A 2V4DA 3DLLA 1T5XD 1PH1A 4B3SL 3HKSA 2C5CA 5KIXA 3NPPA 2CFMA 5JVH3 3M3YH 5JEAJ 1SRUA 5K5PA 1N36Q 4A3DB 1Q82C 2Z6BA 2F0UA 4BWGB 3Q8DA 1PRTB 3ND9A 3IKJA 2E2DC 4UP8A 3T56B 2VUMH 3MA2B 2EYMA 1DD2A 1BO0A 3HOWG 2O4XA 2A68C 3RR5A 4XYQA 4DAPA 4YHHQ 1EZ8A 1CKMA 2RSNA 1WTVA 4K5WA 1EY9A 2L5TA 2A73B 4YIJA 3AFPA 1NTGA 1ZXTA 2Y0SG 2PW7A 4UDUC 1IZ6A 1Q46A 4DAYB 3KYHC 3DUZA 3CCJA 4K8JA 2B39A 4DK1A 2IX3A 3J7YW 1A15A 2FXQA 2YTVA 1HNXL 2K75A 4L8JA 2BA0A 4LF8L 3KLRA 1DGSA 1LM0A 1VF7A 3K58A 3K7AH 5C4XH 1VDZA 1IYVA 5E4WC 5ELFA 5M5WH 4JBJA 1SNMA 3X3MA 2KCTA 4C3IH 1O7LA 4NXML 2N78A 3T53B 1XX8A 4EQNA 2EY2A 3E5SA 4DV5Q 1S3OA 1SNDA 5KYIA 3RD4A 4R8NA 2WIIB 1G51A 1LO5D 5IYBH 5CORA 2KA7A 3NWTA 1G8ZD 1SNQA 5LMUQ 2F1MA 4FF4A 3SK6A 4IUPA 1SJED 1ET9A 3RN5A 1SBBB 2E5LQ 4FO2A 2OT2A 5FKAC 3HKZG 4ZYSA 2A68D 2J7ZA 4LJZC 1VQHA 4JK1C 5C3EG 1XMQL 2ES2A 3UE1A 3AYHB 1SEBD 4A76A 4CDDC 1AFPA 2H1EA 3I72A 1LTGD 1M4VA 3S24A 1GXDC 3MFYA 3DWPA 4DV4L 3RZOH 2ZTDA 4MN3A 3CP0A 2JYOA 1IYUA 5M5XB 1YNJC 1YZ6A 4DGZA 4RG1A 2JK8A 2F0NA 1C0AA 1PFSA 5I2XA 5C3XA 3HEJA 2E2JB 3HOZH 1MD2D 5EAYA 2M2LA 1H95A 2R92G 4HCEA 3GTLB 1ILQA 2EYPA 2GVAA 2MO0A 1RJTA 2E2HH 1GOZA 3ULPA 1JOQA 4ZRZA 2QCPX 4O42A 5EPLA 3HOYG 3CC7A 1I4PA 4JI3L 5JJKA 2CWAA 1VQNA 5CV6A 5M3FG 1WCMG 3V05A 1WTXA 1I94Q 5EJWA 3CF5A 1RODA 3HKZB 1ESRA 4LF4L 2KHJA 4LFBQ 1XMOL 4FDBA 1K8MA 1Y8PB 2EYLA 4XT1B 4GS3A 5DM63 2A19A 3PUWA 1CFMA 3R2IA 3VR6A 4X64Q 1XNQL 2KHSA 2F0EA 4J8QA 4NB3A 4F8MA 4E6IA 3HZXA 4TQUS 1TWHH 1G91A 3BVMA 2VUMG 5ELOA 4RHSA 2K5HA 1TS3A 1NMGA 4PZ6A 3BZDB 1IL2A 2NUCA 4ODGA 1YNJD 1C9OA 4CDCC 1QUQA 3S2DB 1KNAA 2L12A 4XIGS 1F2YA 4KD4A 1ASZA 4C3HG 4HIOA 4I65A 2DY8A 2EYHA 3HOXG 1PYBA 3CMEA 2D2CC 1I50H 4OGQC 4OWTB 2ENBA 1EEFD 1OXSC 3C1FA 4JOIC 5GAEC 2J4XA 2A6HD 1LT3D 2RDGA 4CKBA 1B1ZA 3PUVA 3GTPB 1U4RA 4LW1A 1JWUD 2WB1E 1KRSA 4CKCA 4RWSC 4RFBA 5DNFA 3MAQA 3L9AX 2R61A 4XYOA 4A3IG 4IUTA 1LTID 3GDEA 3H94A 1PDQA 1CKOA 3PF4A 2GN5A 2IHEA 3PQIA 1VMPA 1MSGA 3PIOA 1EU4A 1GUSA 1WI5A 1GUWA 2WAQG 4TRDA 5EBDA 1GVPA 5LMNQ 3RN2A 1G291 1PXUA 2F0DA 1VQMA 1LT4D 1QG7A 4DR6L 4HTHA 4LUVA 1VQ4A 1HTLD 1I5FA 1HQMC 1BUVT 1EIGA 3N6RA 1SR3A 1FGBD 3HRZC 4LF5Q 2TSSA 2VW9A 3GTMH 3MZ5A 1UAPA 1BCPD 2NZOA 1B4OA 1S5CD 3E6ZX 2NN6I 4L63B 1EL0A 2QA4A 3HOYH 5M3FB 1OO9B 3S1RB 4IFDH 3NQIA 3FP9A 3S14H 2EOTA 3A8IE 1GUOA 3LX0A 1EFWA 3H6MA 3W1BA 5M3MG 4Y7NB 3ND8A 2K33A 5EPKA 1Q8IA 2I5LX 2HD3A 3OIQA 1N9WA 3OPOA 1TWCB 5FJ8G 1TWAB 1EQRA 1SE2A 1LTLA 1UWVA 2R93B 2Z9HA 1WTRA 2EY6A 2WACA 1F9RA 1UE6A 1PH7A 2JA7B 1T9HA 1EY0A 2H5XA 3X3NA 4UP7A 1MGSA 2RA4A 3F2UA 2VQFQ 4EQ5A 1SJHD 1B9NA 5IWAL 1W3SA 4I7ZC 3NXWA 2K28A 4N8FA 4MNOA 2R7ZG 1TU2B 2F0SA 1QOHA 4FXKC 1WD1A 5FO8B 2DJGC 2HHHL 1XPRA 1GHJA 2N8NA 1IKLA 4YHHL 2RF4A 1C48A 2X6GA 1VQFA 2UUBQ 3BDCA 3K7AB 2C9OA 1PH4A 4TVAB 1FGUA 1TWFH 2G9DA 2AQ3B 2ZTEA 4ZLTF 5BN3A 2UUAL 2PZTA 2RHQB 3G6JB 1CKNB 2CKZB 2EY1A 5M5WB 4UY8C 3SHLA 2MGSA 1S5DD 1D1IA 1EU3A 3BVZA 2A69D 1I3QH 1V43A 1B50A 4RGMA 1K9MC 4UAIA 4A4IA 3I70A 1KD1C 4LF6Q 2HT1A 3A8JE 5AFWA 3PO2H 4KK7A 1BBWA 1TY0A 4A3LH 3CC4A 4RH6A 4O1NA 1Q12A 4I7AA 3Q23A 1GUTA 4IUQA 3FPUB 2ZM6Q 1HCZA 1F9SA 4YCWA 3U50C 1H9SA 2I46A 2CCZA 4C3JH 4OIKA 1B3QA 3P75A 4NKLA 3I2ZA 4M8AA 4X62L 2XSCA 4IFDI 2DNEA 3PO3H 5EKIA 3S1NB 1L1OA 1QVGA 2JJQA 4ZKCB 3GTMB 1CUKA 1WFQA 4XXEA 1VQGA 2F52A 1WYDA 4XQQA 2RQXA 5IP7G 3KOJA 5ELNA 4K6DA 4V0BA 3CCVA 4NW2A 4DV0Q 1EOTA 4QY7A 4K14A 2B2WA 1SN8A 1E2VA 5L37A 4JI8L 3GTOB 3O13A 4J1MA 4HMJA 3L2PA 5ELEA 2PYKA 2ZTCA 1QB5D 1ONLA 1SE4A 4DR5L 5TSSA 2L4NA 4DF7A 1DCZA 1B8AA 4DPGA 3S2DH 1HZBA 3HOZG 3RZDB 4GOPA 5IIFA 3MXNB 3W1GA 4HSPA 4U673 3GTPH 4GLVB 4PMBA 2XVSA 1RDPD 4DU9A 1L0XB 1VMCA 3KF6B 1NR4A 1QVCA 1EY4A 1PRTC 2ID0A 4IZ8A 5E7NA 3CC2A 1RTOA 1B3AA 1SMYC 4DV1Q 1G2SA 2NVXH 2D5DA 3S1QB 5NUCA 4KJOA 1EYCA 2NVTH 3K5MA 1A3TA 4BBRH 1D1KA 5LHY1 3UDGA 3SDZA 4HIMA 2IHFA 1KQSA 3GTGB 4KHZA 1VQDA 4A3BB 2L15A 4C3HH 5AJ3L 1XMOQ 3KLSX 5D3IB 1VF5C 3TBIB 2IPKD 2KENA 1IBKL 1HNWL 3NUCA 2YTYA 1VQCA 3A74A 3J81E 1TWFB 4LF9Q 1IBML 4HIDA 1E7ZA 1CTMA 1X3QA 2MHVA 2RVLA 1KIXA 1Y1WG 4L5SA 3TRZA 4JV5L 2F4VQ 1SFOH 3EFXD 4KMUC 4KV6A 1JE4A 1I4RA 2VQEQ 5FLXL 1BKBA 3OOCA 1JWMD 2K5VA 3HOXB 5GAHC 2F0JA 1NBWA 2FINB 2R7ZB 4LWCA 1BCPB 4LUZA 2NVXB 5C3EH 2HCIA 3E0JA 4CJ1B 2E2IH 1U4MA 2GA4B 5IGBA 1EWCA 4DV2L 2DGYA 3BDOA 3H0GG 2JA6H 3K0XA 4KTAA 2R93H 1HFNA 3F2BA 3I3CA 2ICEC 4ZCKA 2MJ8A 4FNFA 5IP7H 1TR5A 1KNEA 1K8GA 2XGTA 2YU9H 4FYDA 4A3CG 4BS9A 3P20A 1IW7C 3ULLA 4DN4M 2ZJQA 5GAGC 2EDGA 1HUMA 3CRLC 5HGQA 3A5ZB 1UNSA 4C3JG 3R2TA 3TEHB 1TS4A 1LT5D 3M9BA 1HTPA 1PH5A 3GP7A 4YCVA 3E9IA 5C5LA 3PV0A 2UUCQ 1JQYD 4QUFA 1A0IA 3I4NG 4Y52H 4ZKBB 2F0GA 4DR7L 1SDFA 4CJ0B 5IGGA 3IRBA 1I4HA 4LF5L 2E8GA 5EGTA 4IUNA 4JBMA 3OMGA 1LTBD 1P8LA 1QE6A 1RHPA 1ESFA 4DV3L 5CYUA 2EYJA 1IW7D 1HZAA 1A3VA 1SE8A 4HJAA 3DXJC 3M4OB 3IL8A 3GTJH 2UU9L 5M9OA 4XQJA 1F2ZA 1IBLL 3CCSA 3SK8A 4IALA 3H3VC 1AH9A 3M4OH 3VYUA 5FLXc 3J81L 4CGYB 2VUMB 1VQ5A 3CXCA 3OWFA 4ZQ3A 3FMCA 4A3FH 2KHIA 4GNXC 4RGNA 2LS01 3QR8A 5ISRA 2VQFL 4BA2I 4DV7L 1PLFA 2EE1A 1QNUA 4X3TA 1WTQA 1EY7A 3I55A 4JI2L 3CPFA 3LNNA 4JI5Q 3PO2G 1MJEA 3H15A 2FJ2A 1U0LA 1K8AC 1C7YA 3I4NB 1E0BA 4JBWA 4C1NI 2XRSD 2XNAC 2B63H 4PQXA 3TS0A 1NCVA 3AB9A 3LWUA 2Z1CA 2R93G 3QO2A 4ALPA 3SXHA 5F2DA 3D0FA 2WFWA 2RCFA 1KLUD 1E2WA 1KAAA 1FD7D 3S17H 3I4MG 2G5DA 4LFCL 3CU7A 5IYCG 3G71A 3F2DA 5J3BA 4FF2A 1ZYRD 4PNYA 4KHVA 1LLRD 4EX5A 2IWHA 2MPMA 1EY8A 1IL8A 1WTOA 1NSNS 1WTPA 1HR0Q 3W5OA 3IFTA 3T1HL 2UXBL 4KN7C 5C44G 1R4PB 1VQ7A 1FNWA 2F0PA 4B08A 1TXYA 4JI6Q 2WB1B 2KQ3A 4QF4A 2B2TC 4JYAL 2F0TA 2AKWB 2ZM6L 2F0WA 2BH2A 1J9OA 4Q0FA 2JEBI 3B6YA 4GKKL 1EY5A 4DUZL 4OONA 4QJFA 3TMEA 5FO9B 2M9VA 1SYBA 3FKIG 3U58A 4JI0Q 1N32Q 1WJJA 2H4OA 1P16A 2IJ0A 4X66L 5FJ8H 1EIFA 3R93A 5I9PA 1FNVA 2BE5D 4C56C 5KYLA 1A3UA 1BQQT 4ZAIA 3OW2A 4JI7Q 1V9PA 2F0FA 3QB3A 3D8GA 5M3MB 4DV0L 3TREA 4A75A 4GKJL 2CVRA 3D4DA 3RZDH 4MZ9A 4BXXH 5FLMH 2WINB 4N9TA 2ZJPA 3T1YL 4IURA 4RA8A 3RLNA 3IFDA 1QCBD 2L1BA 1Y14B 3W2DA 1RD9D 1SYDA 2Q8RE 4BY1H 5EBCA 5BN5A 3J81c 2Z0SA 4JOIA 2B3GA 2JA6B 1STHA 1XWEA 5JVG3 2KJXA 2PMZB 5KNCA 1PTOF 4QB4A 4HN7A 1R4QB 4IQZA 5M5YH 1EQVA 1XYIA 4V190 3DMUA 2FFKB 4NDXA 5LL6X 2CQAA 2K5QA 4DK6C 2JE6I 3I90A 5M5XH 2EZVA 2OEOA 1Y1VG 1FNUA 5ELCA 4DV1L 4KD3A 5A35A 3KDFA 4FXGC 1DYQA 1WCMB 3MXUA 2F0OA 3MFGA 4X65Q 3NK9A 3T16A 3HOWH 1O7IA 4A3GG 4K0KL 5EKKA 4G7OC 3MXGA 1LV9A 1MJCA 4OX9Q 3J7ZC 4X3KA 5C4XB 1CI3M 1X56A 3G7LA 3BU2A 4IOCA 3Q6SA 4X3SA 2IW3A 2JA5B 1JWSD 2KOLA 4YWMA 4JC0A 4HMIA 2QGQA 5GROA 2KEDA 3Q0AA 1J5EQ 3GD7A 4LNQA 2RBMA 1JMCA 1L2FA 3SK4A 4BY7G 1Q7YC 1CSQA 2NWGA 1CM9A 1PH9A 4DXGA 1EFID 4YWKA 1N8RC 3S1MH 1ENFA 4QL5A 3I7FA 2E2IB 1YNXA 3HS0C 1SNOA 4XDXA 1VS0A 3CCEA 5JPNC 1KXLA 1VQ8A 1ASYA 1VQIA 3NP8A 4AYBE 2A5HA 3K5OA 3TP8A 2AQ1B 4DV6Q 4LK1C 1AZQA 1IXRA 5C6AA 2YU9B 4M1UB 4OELB 5IP9G 1NAPA 1YVCA 4C3JB 4DAVA 2UXDL 3KLSA 4DK0A 2SEBD 3GTQB 1B9MA 1PVOA 4H0LC 3K57A 3BYTB 2MUYA 1X3FA 3VR3A 4O2DA 1SYGA 4AQYQ 1CHPD 4R8IA 4YWLA 1YHBA 4P72A 5KGUA 3Q22A 1FR3A 2AUJD 1GUNA 1EYAA 4HJ5A 4BBSH 4B3SQ 4K8IA 3HFZB 3NE5B 2BCOA 2ATWA 5IYDG 4H7BA 4DNTB 2UUCL 1UEAB 3HOYB 2EXZA 3A54A 4FF3A 3WOFA 1X54A 1KDAA 4FP5D 2VL6A 3RLOA 3OIPA 1R9TB 3C3LA 3S14B 2A69C 4P74A 1LYLA 1I4GA 1DM0B 4MTKA 3NENA 1UUPA 3CD6A 4A3DH 4A93G 2K14A 4DV3Q 1Q90A 1JB7A 2HIXA 5JJZA 4IJHA 1GHKA 1M90C 4BY7B 2VB3X 1Q1BA 2NN6H 4L6TB 3ERSX 3T51B 4LF8Q 4C3IG 1KDBA 1JE5A 4AYBG 1XPUA 2WKCA 1IBLQ 4B3RL 4K5VA 3A8KE 4HR7B 4DR2Q 3SVMA 2XTIA 2L55A 3TQYA 5CV7A 2BDOA 4RMFA 1ZYRC 4IO9A 1JT8A 1I6VC 3D4WA 2WV6D 1X32A 1YITA 4B9WA 4LFAL 3J81j 1PH6A 1HNZL 3AMUA 1WVLA 1JCKB 1OTCA 1BBXC 4DV7Q 2SNSA 3M4YA 3CCLA 1SFOB 3OSOA 5LL6S 1F2LA 5T1GA 3CCMA 1F9PA 5CGKA 5C0XI 1G2TA 3MHBA 2E5LL 1CQFA 5JJIA 2Y0SE 2JQOA 4NMZA 4GOPC 1EYGA 2JEAI 1F9QA 1B70B 1NR2A 3OYYA 2YV5A 5G3LD 3A56A 3HOXH 1Y8OB 2K01A 3FEWX 3K6OA 4LMQD 4IUVA 2HUGA 2B2UC 2KECA 3A7LA 4DUYQ 2WP8J 3V2TA 3EA6A 1U4LA 1PFBA 4MTNA 4H02A 4WJ4A 2OXPA 1SYCA 3J80c 3RMHA 4LFCQ 4RKLA 3CRKC 1W2BA 4HJ9A 1I6HB 3CQZH 1XNRQ 3PO3G 1UE5A 2LXJA 4PV1C 3HKZE 4WORA 4A3EG 3JAME 5I6YA 2EYFA 1KLGD 4POGA 1LT6D 2N49A 5FOBB 3PO3B 2QEJC 3T1HQ 4DR3L 3NBHB 3PSIA
chains in the Genus database with same CATH topology
2KCNA 2LFNA 5J1ZA 1AP0A 1JOOA 1B2TA 3DEPA 4FVMA 2EJFC 1O80A 2Z4IA 2K6AA 2AUKA 1TQOA 1CZGA 3UI2A 1KABA 1F2MA 3D6WA 4CKEA 3QIAA 1ML0D 4H44C 1SSOA 2PNRC 1IKMA 4C2MB 2KUMA 1T5EA 3BDLA 2B2VC 3FRPB 3PO2B 4OO1G 4K2KA 3I4LA 3PUZA 1H9RA 2B2UA 1JOKA 4HEDA 3NSWA 1PMRA 1TS5A 3J80L 3NQTA 2R6GA 2F0QA 5I2YA 5KEEA 2NBFA 3Q24A 1ZEQX 2SOBA 3I8ZA 4KJNA 3KBXA 5E4XA 2NVXB 1Q3LA 1QILA 3S16B 2D9UA 2PQEA 3S9WA 1Q1EA 1D6EC 3R8BA 3BS1A 3C1EA 5BN4A 3MC0B 3QWNA 4G4KA 5C4ZA 4IFDJ 1STEA 1Y69U 3QOJA 1I4XA 4FF1A 3M3YB 5C5MA 3GQBA 3VYSA 4OIJA 1PTOB 4KY7A 5E3FA 3T4AC 3EJIA 3NTIA 2B2VA 4Q5VA 2B2WC 2RSOA 2HQEA 1PZJD 5C3EB 3MXPA 1TKWB 5CV5A 3QOLA 2K7VA 5JEAH 2KCCA 2WKDA 1JORA 3TP7A 1PYWD 2HDLA 1EY6A 1PRTD 2BOSA 4ILWA 2PZWA 4C3HB 2F0VA 1CHQD 2G9HD 4Z9CB 2F0IA 5DEHA 1LTTD 2D62A 3KUPA 2BDNA 2VNUD 1OXXK 1MI2A 4DFAA 2EJGC 3N52A 1C4QA 5EKLA 1CA5A 1SNPA 1XXGA 5IOCA 3TP5A 2QILA 3S2HB 3C46A 1H9SB 1F77A 1I4QA 1II3A 2L9HA 3KF8A 5CBEE 2XIWA 3CHBD 1STYA 2NTTA 2RKSA 3CKIB 1O7YA 1HHVA 1CK1A 4K5XA 2XWBB 1JC7A 4HAEA 3CQZB 1Y8NB 5FK9C 2B2TA 2IX1A 4ZK9B 1X3PA 3ONAB 1SAPA 1Y1WB 3DM1A 1CQVA 2K1BA 3RUZA 1CA6A 1RCVD 2B8GA 3K0YA 2ICIA 4OL7A 1KDCA 3M7GA 2SDFA 4R9WA 4BBSB 1HUNA 1S5ED 5I4DA 4F88A 3DWAA 1O78A 5C0XH 4GZYC 4B9XA 2XN9C 3GTJB 2CW0D 5A2QL 3HP3A 1YNNC 4OHJA 4U68A 4F87A 1GJXA 2NTSA 2NVTB 5ELBA 4QUCA 1SYFA 4EGVA 3HOVB 1EYDA 2AWOA 3FVQA 3TN2A 1LTSD 5CBAE 3NWSA 3K5NA 4KY5A 1B53A 2F4IA 3BG3A 2BA1A 1W6KA 3JAML 5ELDA 4BA1I 2L0CA 2ZXOA 3D3RA 4RHRA 2EPBA 4LAAA 3NBIA 3TDQA 2Y0SB 1TWGB 2NVQB 2B2YA 3MEHA 3ZYYX 3NTKA 1TT2A 1MBYA 3VYRA 2FMCA 2JP1A 1EZ6A 2F3VA 3VR4A 3S15B 1DOLA 4XTCS 2KVMA 3OW7A 2CW0C 5J22A 2E2HB 2YYZA 2O5JC 3R3OA 2K04A 5G3LF 2ZXPA 4ZUIA 2NVYB 5CC4A 4TSSA 1IHZA 1A2UA 4G7HC 2PZUA 2IX0A 1CT1D 4XQNA 4A3FB 5M5YB 4TKOB 1Z6HA 3W3AA 5CMDA 2B8FA 1AW7A 4IUUA 2Q8IB 2IL8A 5K36H 3ITPA 1QWYA 3MTSA 1HA6A 1OXUA 3VA7A 1S4ZA 2NB0A 1K8OA 3DEOA 2PO4A 2F0HA 2ZT9C 1MSHA 3VR2A 2DN8A 3PUXA 2K05A 2QF7A 1VCIA 1HRJA 1O7ZA 1HFGA 1V1PB 1STNA 3I4MB 2FMMA 2ZXRA 1DJRD 5CV4A 2J0TD 4DAYA 5D3DA 2AQ2B 4A3JB 5FLXE 4MIUA 1BCPF 4WFN3 4EVOA 3VR5A 2SNMA 1HXYD 2OF1A 3WDNA 5IGDA 5IGFA 1BOSA 3RZOB 1LTAD 1LACA 4RAUC 2PW5A 1I3QB 4IFDG 2HDMA 1G6ZA 2B63B 1B44D 5EQ0A 1D5ZC 1BF4A 2L11A 3QJYA 1JICA 3V96A 1ILPA 2JXMB 4AYBB 4RCOA 1QNKA 1HQRD 3PIP3 1RF2D 4CHTB 4PMCA 3RLFA 5I9OA 1LTRD 1C8CA 1V1OA 1QJOA 4KY6A 4A3EB 3NBHA 3M7NA 1Y1VB 3PIO3 2X6LA 5C0XJ 2EVBA 5HURA 1LABA 3GO5A 2QDBA 5JOBA 2BE5C 3OHXC 3EQLC 1BDOA 1STGA 2A6ED 3FDTA 1NUCA 5COYA 1EQTA 4A3GB 3AU7A 1ICWA 4ABNA 4G7ZC 3FPPA 4RKBA 5KNBA 4A3KB 4A3IB 1SE3A 1V1PA 5C3WA 3SE0A 2PPBC 1D5MC 3BYYB 3A55A 4ZUJA 2O2LD 3U9OA 2EJMA 3GTKB 2NN6G 1BXTA 4EQPA 4F7XA 3FKIB 4G57A 1PFNA 2Z4HA 3KK7A 1OXTA 4HSVA 4XT3B 3HG9A 3P7JA 3DHQA 4RGTA 1H9MA 5CR3A 5CV8A 5JAVA 5JEAG 3L7ZC 1H9JA 5EPJA 4A93B 2DNCA 3LWEA 2VB2X 3EVQA 5I6WA 3P1HA 1Z47A 1HA5A 3VYTA 3J7AF 1WD0A 4K2LA 1A6XA 1K83B 1EWHA 3GV3A 3C2PA 4RGOS 5JPMC 2A6EC 1DONA 1RTNA 4H13C 1A2TA 2K03A 1KTKA 5A2QE 1W6JA 1SXTA 4KKTA 1WTWA 1DXMA 1ENAA 3ERQA 4N9PA 3GV6A 1EIHA 3I73A 3A7AB 2JA8B 1FYCA 4RCNA 4OO1H 1TY2A 3QG1A 3S1MB 2LKVA 1EEID 2RDHA 4PMWA 5IODA 1Z7TA 1RKNA 5D14A 2AWNA 2A74C 5C0XG 4J6HA 4BBRB 1U4PA 1S5FD 1STBA 2CHBD 3M85A 3TSSA 2F0KA 3SK5A 2R92B 1PZID 4C1NK 1CZWA 1BCPC 1JB3A 1ET6A 3K5LA 1GUGA 1BNZA 4DA2A 3TZUA 5IT9L 3H91A 3TP6A 2N55A 3U9SA 1PTOC 4KI0A 2R3ZA 4IN3A 5KNDA 3J7AV 5E1FA 2O5IC 1SMYD 3D6CA 3WOEA 4FXDA 1BR9A 1H9KA 1M8AA 3TZDA 3EROA 3HGBA 1SNCA 5T1IA 3MWYW 2IT1A 3H09A 3T13A 4CBVA 5D65A 2F3WA 1XTCD 2XWJB 2M00A 4S3SA 1OXVA 1PZKD 3H0GB 1STAA 4QCLA 5C4HA 2E74C 2E76C 1D2BA 5IGCA 4MHEA 2XRQD 3OWEB 3IAYA 1AZPA 4EQOA 2MP1A 2I07B 1PRTF 1DOKA 4C3IB 4WJWA 1AEXA 1DOMA 3MXNA 5KRUA 2F03A 5IT9E 2DY7A 5J39A 2QKIC 4WRDA 2F0MA 2WAQB 3KBGA 2TMPA 2X69A 1J8IA 3D31A 5K36G 4KKUA 1D5XC 1V8QA 5DAUA 4BY1B 1HPCA 4X3UA 5DM73 1AN8A 3K59A 2VXWA 4KKSA 4QIWB 1U9RA 1PFMA 3HOUB 1DZ1A 2E75C 3I91A 4ULLA 2EY5A 1E2ZA 2B2YC 2RDFA 5HGTA 4DNRB 2EYOA 2HCCA 2NYZD 3VA5A 1ENCA 2PCFB 3NTHA 2K5DA 1JR0D 3HOZB 3L3OC 2LY7A 2N88A 4ID6A 2F0LA 3DWQA 4QMGA 1SYEA 3URYA 1ZKOA 3PMFA 1TIID 3S17B 4P2CB 5CV9A 2K5WA 4DXFA 4OO1I 3OMCA 3NHHA 2FHTA 4NP5A 4K6LA 3HOWB 3MVVA 2LMCB 4A3MB 4CJ2C 3BVGA 3PUYA 2Z8LA 5C44B 5IGEA 3SEBA 1TS2A 5C4JB 2Q8TA 5FO7B 2A6HC 1S5BD 1TWHB 3D4RA 4ME5A 1TVXA 2K32A 3SR1A 4HCSA 1YNND 2NZ1D 2KEEA 1I50B 1PTOD 4KN4C 1L0YB 3J80E 2JSOA 1PTOH 2V4DA 1T5XD 2C5CA 5KIXA 3NPPA 5JVH3 5JEAJ 5K5PA 4A3DB 2F0UA 4BWGB 1PRTB 3ND9A 3IKJA 2E2DC 3T56B 3MA2B 2EYMA 1DD2A 1BO0A 2O4XA 2A68C 4XYQA 4DAPA 1EZ8A 2RSNA 1WTVA 4K5WA 1EY9A 2L5TA 2A73B 4YIJA 1ZXTA 2PW7A 4UDUC 3DUZA 4K8JA 2B39A 2IX3A 4DK1A 3J7YW 1A15A 4L8JA 2BA0A 3KLRA 1VF7A 3K58A 1VDZA 1IYVA 5E4WC 5ELFA 1SNMA 3X3MA 1O7LA 3T53B 1XX8A 4EQNA 2EY2A 3E5SA 5KYIA 1SNDA 3RD4A 4R8NA 2WIIB 1LO5D 5CORA 2KA7A 3NWTA 1G8ZD 1SNQA 2F1MA 4FF4A 3SK6A 4IUPA 1SJED 1ET9A 1SBBB 4FO2A 2OT2A 5FKAC 4ZYSA 2A68D 2J7ZA 4LJZC 4JK1C 1SEBD 1AFPA 2H1EA 3I72A 1LTGD 1M4VA 1GXDC 3MFYA 3DWPA 4MN3A 2JYOA 1IYUA 5M5XB 1YNJC 4DGZA 2F0NA 5I2XA 5C3XA 3HEJA 2E2JB 1MD2D 2M2LA 4HCEA 3GTLB 1ILQA 2EYPA 1RJTA 1GOZA 1JOQA 4ZRZA 2QCPX 4O42A 5EPLA 1I4PA 5CV6A 3V05A 1WTXA 5EJWA 1RODA 3HKZB 1ESRA 1K8MA 1Y8PB 2EYLA 4XT1B 5DM63 3R2IA 3PUWA 1CFMA 3VR6A 2KHSA 2F0EA 4J8QA 4F8MA 4E6IA 3HZXA 4TQUS 1G91A 3BVMA 4RHSA 1TS3A 3BZDB 2NUCA 4ODGA 1YNJD 3S2DB 1KNAA 2L12A 4XIGS 1F2YA 4KD4A 4C3HG 4I65A 2DY8A 2EYHA 2D2CC 4OGQC 2ENBA 1EEFD 1OXSC 3C1FA 2J4XA 2A6HD 1LT3D 2RDGA 4CKBA 1B1ZA 3PUVA 3GTPB 1U4RA 1JWUD 4CKCA 4RWSC 4RFBA 5DNFA 3MAQA 3L9AX 2R61A 4XYOA 4IUTA 1LTID 3H94A 1PDQA 1VMPA 1MSGA 1EU4A 1GUSA 1GUWA 4TRDA 5EBDA 1G291 1PXUA 2F0DA 1LT4D 1QG7A 4HTHA 1HTLD 1HQMC 1BUVT 1EIGA 3N6RA 1FGBD 3HRZC 2TSSA 3MZ5A 1UAPA 1BCPD 1B4OA 1S5CD 3E6ZX 2NN6I 4L63B 1EL0A 5M3FB 1OO9B 3S1RB 4IFDH 3NQIA 2EOTA 3A8IE 1GUOA 3LX0A 3H6MA 4Y7NB 3ND8A 2K33A 5EPKA 1Q8IA 3OIQA 3OPOA 1TWCB 1TWAB 1SE2A 2R93B 1WTRA 2EY6A 2WACA 1F9RA 2JA7B 1EY0A 3X3NA 1MGSA 2RA4A 3F2UA 1SJHD 1B9NA 4I7ZC 3NXWA 2K28A 1TU2B 2F0SA 1QOHA 4FXKC 1WD1A 5FO8B 1GHJA 1IKLA 1C48A 2X6GA 3BDCA 3K7AB 2C9OA 2G9DA 2AQ3B 4ZLTF 5BN3A 2PZTA 3G6JB 2EY1A 5M5WB 3SHLA 2MGSA 1S5DD 1D1IA 1EU3A 3BVZA 2A69D 1V43A 1B50A 4RGMA 4UAIA 3I70A 3A8JE 5AFWA 4KK7A 1TY0A 4RH6A 4O1NA 1Q12A 3Q23A 1GUTA 4IUQA 3FPUB 1HCZA 1F9SA 1H9SA 2I46A 4OIKA 3P75A 4NKLA 4M8AA 2XSCA 4IFDI 2DNEA 5EKIA 3S1NB 4ZKCB 3GTMB 4XXEA 4XQQA 2RQXA 4K6DA 4V0BA 4NW2A 1EOTA 4K14A 2B2WA 1E2VA 3GTOB 3O13A 4J1MA 4HMJA 5ELEA 2PYKA 1QB5D 1ONLA 1SE4A 5TSSA 2L4NA 4DF7A 1DCZA 3RZDB 5IIFA 4HSPA 4U673 4PMBA 2XVSA 1RDPD 4DU9A 1L0XB 1VMCA 1NR4A 1EY4A 1PRTC 2ID0A 4IZ8A 1RTOA 1B3AA 1SMYC 1G2SA 2D5DA 3S1QB 5NUCA 4KJOA 1EYCA 3K5MA 1A3TA 1D1KA 5LHY1 3SDZA 3GTGB 4KHZA 4A3BB 3KLSX 5D3IB 1VF5C 3TBIB 2IPKD 3NUCA 3J81E 1TWFB 1CTMA 1X3QA 2MHVA 2RVLA 3EFXD 4KMUC 4KV6A 1JE4A 1I4RA 5FLXL 3OOCA 1JWMD 3HOXB 2F0JA 2FINB 2R7ZB 1BCPB 2HCIA 3E0JA 4CJ1B 1U4MA 2GA4B 5IGBA 1EWCA 3BDOA 4KTAA 1HFNA 3I3CA 2ICEC 2MJ8A 4FNFA 1TR5A 1KNEA 4FYDA 4BS9A 3P20A 1IW7C 4DN4M 2EDGA 1HUMA 3CRLC 1UNSA 4C3JG 3R2TA 1TS4A 1LT5D 1HTPA 3GP7A 5C5LA 3PV0A 1JQYD 4QUFA 4ZKBB 2F0GA 1SDFA 4CJ0B 5IGGA 1I4HA 5EGTA 4IUNA 3OMGA 1LTBD 1QE6A 1RHPA 1ESFA 5CYUA 2EYJA 1IW7D 1A3VA 3DXJC 3M4OB 3IL8A 5M9OA 4XQJA 1F2ZA 3SK8A 4IALA 3H3VC 3VYUA 3J81L 4CGYB 2VUMB 3OWFA 4ZQ3A 3FMCA 4RGNA 2LS01 5ISRA 4BA2I 1PLFA 2EE1A 1QNUA 4X3TA 1WTQA 1EY7A 3LNNA 2FJ2A 3I4NB 1E0BA 4JBWA 4C1NI 2XRSD 2XNAC 4PQXA 1NCVA 3AB9A 3LWUA 2Z1CA 3QO2A 3SXHA 5F2DA 1KLUD 1E2WA 1KAAA 1FD7D 3CU7A 4FF2A 1ZYRD 4PNYA 4KHVA 1LLRD 2IWHA 2MPMA 1EY8A 1IL8A 1WTOA 1NSNS 1WTPA 3IFTA 4KN7C 1R4PB 1FNWA 2F0PA 4B08A 2WB1B 2KQ3A 4QF4A 2B2TC 2F0TA 2F0WA 1J9OA 4Q0FA 2JEBI 1EY5A 3TMEA 5FO9B 2M9VA 1SYBA 2H4OA 2IJ0A 3R93A 5I9PA 1FNVA 2BE5D 4C56C 5KYLA 1A3UA 1BQQT 4ZAIA 2F0FA 3QB3A 3D8GA 5M3MB 2CVRA 3D4DA 2WINB 4N9TA 4IURA 4RA8A 3IFDA 1QCBD 2L1BA 3W2DA 1RD9D 1SYDA 2Q8RE 5EBCA 5BN5A 2JA6B 1STHA 1XWEA 5JVG3 2KJXA 2PMZB 5KNCA 1PTOF 4QB4A 4HN7A 1R4QB 4IQZA 1EQVA 1XYIA 4V190 3DMUA 2FFKB 4NDXA 5LL6X 2CQAA 2K5QA 2JE6I 3I90A 2EZVA 2OEOA 1FNUA 5ELCA 4KD3A 5A35A 4FXGC 1DYQA 1WCMB 3MXUA 2F0OA 3MFGA 3NK9A 3T16A 4G7OC 5EKKA 3MXGA 1LV9A 4X3KA 5C4XB 1CI3M 3G7LA 3Q6SA 4X3SA 2IW3A 2JA5B 1JWSD 2KOLA 4HMIA 2KEDA 3Q0AA 3GD7A 2RBMA 3SK4A 2NWGA 1CM9A 4DXGA 1EFID 1ENFA 2E2IB 3HS0C 1SNOA 4XDXA 5JPNC 3NP8A 2A5HA 3K5OA 3TP8A 2AQ1B 4LK1C 1AZQA 5C6AA 2YU9B 4M1UB 1NAPA 4C3JB 4DAVA 3KLSA 4DK0A 2SEBD 3GTQB 1B9MA 4H0LC 3K57A 3BYTB 2MUYA 3VR3A 1SYGA 1CHPD 4R8IA 5KGUA 3Q22A 1FR3A 2AUJD 1GUNA 1EYAA 4K8IA 3NE5B 2BCOA 4H7BA 4DNTB 1UEAB 3HOYB 3A54A 4FF3A 3WOFA 1KDAA 4FP5D 1R9TB 3OIPA 3C3LA 3S14B 2A69C 1I4GA 1DM0B 1UUPA 1Q90A 5JJZA 1GHKA 4BY7B 2VB3X 1Q1BA 2NN6H 4L6TB 3T51B 4C3IG 1KDBA 2WKCA 4K5VA 3A8KE 4HR7B 3SVMA 2L55A 5CV7A 2BDOA 1ZYRC 1I6VC 3D4WA 2WV6D 1X32A 4B9WA 3AMUA 1WVLA 1JCKB 1BBXC 2SNSA 3M4YA 1SFOB 3OSOA 5LL6S 1F2LA 5T1GA 1F9PA 5CGKA 5C0XI 1G2TA 3MHBA 1CQFA 4NMZA 2JEAI 1F9QA 1NR2A 5G3LD 3A56A 1Y8OB 2K01A 3FEWX 3K6OA 4LMQD 2HUGA 4IUVA 2B2UC 2KECA 3A7LA 2WP8J 3V2TA 3EA6A 1U4LA 1PFBA 2OXPA 1SYCA 3RMHA 4RKLA 3CRKC 1I6HB 4PV1C 4WORA 3JAME 5I6YA 2EYFA 1KLGD 1LT6D 5FOBB 3PO3B 2QEJC 2EXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFK B;  5D65 A;  1AP0 A;  1ESR A;  1U4M A;  1HUN A;  2FJ2 A;  4ZKC B;  1B2T A;  3I90 A;  2EOT A;  1DON A;  2HDL A;  1E0B A;  1RTN A;  3DEP A;  4IUU A;  1C8C A;  1O80 A;  2K03 A;  4XT1 B;  2IL8 A;  3UI2 A;  1HFN A;  1NCV A;  3I3C A;  5E4W C;  2MJ8 A;  3D6W A;  5EPK A;  2X6L A;  1WTW A;  1KNE A;  3QO2 A;  4NW2 A;  1ML0 D;  5JJZ A;  4MHE A;  2FHT A;  1SSO A;  1EOT A;  3MTS A;  1IKM A;  1LV9 A;  2B2W A;  1HA6 A;  4X3K A;  1S4Z A;  4DN4 M;  1XX8 A;  1G91 A;  3G7L A;  2KUM A;  3HP3 A;  3DEO A;  1AZP A;  3Q6S A;  4X3S A;  1HUM A;  4U68 A;  3GV6 A;  2B2V C;  2MP1 A;  1MSH A;  1WTR A;  3FDT A;  1F9R A;  5COY A;  1EIH A;  1EQT A;  2L4N A;  3KUP A;  1MGS A;  2BDN A;  2KOL A;  5COR A;  1DOK A;  4QUC A;  2RA4 A;  1MI2 A;  3F2U A;  3SVM A;  1KNA A;  4CJ2 C;  2KED A;  3N52 A;  2L12 A;  2MPM A;  1ICW A;  1IL8 A;  3TN2 A;  5CBA E;  2K05 A;  1WTO A;  1DOM A;  2B2U A;  4IUP A;  1WTP A;  1CA5 A;  2DY8 A;  2DY7 A;  4HED A;  4QUF A;  2K28 A;  1B53 A;  2Q8T A;  1HRJ A;  2NWG A;  1X32 A;  4ZKB B;  1CM9 A;  5D14 A;  1O7Z A;  1VMC A;  2J7Z A;  1NR4 A;  1SDF A;  1WD1 A;  1HFG A;  2B2T C;  4CJ0 B;  2H1E A;  1RTO A;  1B3A A;  1TVX A;  2X69 A;  4HCS A;  1WVL A;  1J8I A;  1IKL A;  1J9O A;  2FMM A;  1G2S A;  1U4P A;  2L9H A;  4XDX A;  5E4X A;  3I8Z A;  3KBX A;  2EPB A;  2X6G A;  1BBX C;  2NZ1 D;  1Q3L A;  1U4R A;  1QE6 A;  2KEE A;  1RHP A;  2D9U A;  5CBE E;  4X3U A;  4MN3 A;  2B2Y A;  2JYO A;  2XIW A;  4RWS C;  1F2L A;  5T1G A;  2VXW A;  1F9P A;  5DNF A;  4ZLT F;  1G2T A;  3R93 A;  1AZQ A;  1PFM A;  4IUT A;  1F9Q A;  1NR2 A;  3IL8 A;  1BNZ A;  1PDQ A;  1PFN A;  1DZ1 A;  2JP1 A;  1NAP A;  2MGS A;  1VMP A;  2K01 A;  1MSG A;  1O7Y A;  3H91 A;  3I91 A;  1HHV A;  1DOL A;  4LMQ D;  2HUG A;  4IUV A;  2B2U C;  4ZAI A;  1GUW A;  2N55 A;  2KEC A;  2B2Y C;  1B50 A;  4HAE A;  2KVM A;  2R3Z A;  2B2T A;  4UAI A;  2M2L A;  4HSV A;  4XT3 B;  1X3Q A;  4ZK9 B;  1U4L A;  2RVL A;  1PFB A;  2HCC A;  1X3P A;  3P7J A;  2CVR A;  2NYZ D;  1ILQ A;  2K04 A;  3ONA B;  4RAU C;  5AFW A;  1SAP A;  4R8I A;  1QG7 A;  2HDM A;  3DM1 A;  4OIJ A;  1RJT A;  1G6Z A;  1BO0 A;  2K1B A;  4IUR A;  4RA8 A;  5EPJ A;  3IFD A;  1EIG A;  1JE4 A;  4O42 A;  2L1B A;  4IUQ A;  3FPU B;  5EPL A;  4CJ1 B;  1CA6 A;  5EQ0 A;  2N88 A;  3LWE A;  2B2V A;  1F9S A;  1M8A A;  2Q8R E;  2RSN A;  3TZD A;  1WTV A;  1BF4 A;  2L11 A;  4OIK A;  1B4O A;  1PLF A;  2FIN B;  1JIC A;  1ZXT A;  2EE1 A;  1ILP A;  1WD0 A;  4X3T A;  2SDF A;  3MWY W;  5T1I A;  2B2W C;  2RSO A;  1WTQ A;  1WTX A;  4R9W A;  1EL0 A;  5EKI A;  1QNK A;  3GV3 A;  2HCI A;  5EJW A;  5CMD A;  1ROD A;  1XYI A;  1A15 A; 
#chains in the Genus database with same CATH topology
 2KCN A;  2LFN A;  1YBY A;  5J1Z A;  4A3C H;  1AP0 A;  2JA5 H;  1JOO A;  1B2T A;  3DEP A;  4FVM A;  2EJF C;  1O80 A;  2Z4I A;  2K6A A;  4A3M G;  2NVQ H;  2AUK A;  4A93 H;  4A3D G;  1TQO A;  1CZG A;  3EIV A;  3UI2 A;  4LF7 L;  1Q81 C;  1KAB A;  3OTO Q;  1F2M A;  3D6W A;  4CKE A;  3QIA A;  1ML0 D;  4H44 C;  1AE2 A;  1SSO A;  2PNR C;  4JI0 L;  1JJC B;  1N32 L;  1IKM A;  4C2M B;  3CCR A;  4X66 Q;  2KUM A;  1T5E A;  3BDL A;  2Q2T A;  2B2V C;  1FL0 A;  4LFB L;  3FRP B;  3PO2 B;  4OO1 G;  1NJI C;  4K2K A;  3I4L A;  3PUZ A;  1H9R A;  1XNQ Q;  2B2U A;  1JOK A;  4HED A;  3NSW A;  1XPO A;  4IPC A;  3STB D;  1PMR A;  1TS5 A;  4YCU A;  4L5R C;  4B3M Q;  3J80 L;  3NQT A;  2D0O A;  2R6G A;  2F0Q A;  5I2Y A;  4HIK A;  5KEE A;  3HOV H;  1S40 A;  2NBF A;  3Q24 A;  1IYJ B;  1FVI A;  1ZEQ X;  2SOB A;  3I8Z A;  3KBX A;  1L1O B;  4KJN A;  5E4X A;  4OEM B;  1E1T A;  1Q3L A;  1QIL A;  1VQA A;  2D9U A;  3S16 B;  1PH8 A;  2PQE A;  2PI2 E;  1KAW A;  1EUJ A;  1J6Q A;  3S9W A;  1Q1E A;  3A0J A;  1X65 A;  1D6E C;  1YJW A;  2ALY B;  3R8B A;  3BS1 A;  3C1E A;  5BN4 A;  1Y1W H;  1EWI A;  3MC0 B;  3ER0 A;  3QWN A;  3ULJ A;  4G4K A;  5C4Z A;  1MIU A;  4IFD J;  1STE A;  1Y69 U;  2DJF C;  3QOJ A;  4K0K Q;  4GNX B;  2IY5 B;  1I4X A;  4FF1 A;  1R9T H;  3M3Y B;  4DKA C;  2Q2U A;  5C5M A;  3GQB A;  1HNX Q;  3VYS A;  4GOP B;  4OIJ A;  1PTO B;  4KY7 A;  4UPA A;  5E3F A;  3T4A C;  3EJI A;  3NTI A;  2EIF A;  2KBN A;  2B2V A;  2B63 G;  3S15 H;  3HOV G;  1J5E L;  4JI1 Q;  4Q5V A;  1D8L A;  2B2W C;  2RSO A;  2HQE A;  1PZJ D;  5C3E B;  3MXP A;  1TKW B;  4Y7N H;  3S1Q H;  5CV5 A;  3I4M H;  3QOL A;  2EXD A;  2K7V A;  2OCE A;  5JEA H;  1NY4 A;  2JN4 A;  2KCC A;  2WKD A;  1JOR A;  3TP7 A;  2MFI A;  1PYW D;  2HDL A;  1EY6 A;  1PRT D;  2BOS A;  3UDF A;  4ILW A;  2PZW A;  4C3H B;  2F0V A;  3WWV A;  4GLX A;  1CHQ D;  2G9H D;  4Z9C B;  4QIW E;  2F0I A;  3HOU G;  5DEH A;  1LTT D;  1WCM H;  2D62 A;  3KUP A;  2BDN A;  2VNU D;  1OXX K;  2I5H A;  1MI2 A;  4BY1 G;  2OTJ A;  4DFA A;  4OWX B;  2EJG C;  3N52 A;  2R7D A;  1C4Q A;  5EKL A;  1CA5 A;  1SNP A;  5FLM G;  1XXG A;  2QDL A;  5IOC A;  1X6O A;  3TP5 A;  1NMF A;  1Q86 C;  2QIL A;  3S2H B;  3C46 A;  4R4Q A;  2ASB A;  1H9S B;  1X55 A;  1F77 A;  1I4Q A;  1AE3 A;  1II3 A;  2L9H A;  1G6P A;  2LSS A;  3EBE A;  3KF8 A;  2LXK A;  5CBE E;  2XIW A;  3CHB D;  1STY A;  4BXX G;  2NTT A;  3JC6 6;  5H1S E;  3H3V H;  2C35 B;  2RKS A;  3ICE A;  3CKI B;  1O7Y A;  1HHV A;  2NVY H;  4GLA C;  4JI3 Q;  1CK1 A;  4K5X A;  2XWB B;  1JC7 A;  3EN2 A;  4HAE A;  3CQZ B;  1SMX A;  1Y8N B;  2NZH A;  5FK9 C;  2B2T A;  3PGZ A;  3FHW A;  4QQB X;  2IX1 A;  4ZK9 B;  5GAD C;  1X3P A;  3ONA B;  1SAP A;  1Y1W B;  2N3S A;  3DM1 A;  1CQV A;  2K1B A;  3RUZ A;  1CA6 A;  1RCV D;  2B8G A;  3K0Y A;  4B3R Q;  2ICI A;  4A3B G;  1X3E A;  4OL7 A;  1KDC A;  3M7G A;  2SDF A;  4R9W A;  2I0Q A;  1E3P A;  2HQL A;  1B7Y B;  4BBS B;  4LFA Q;  1HUN A;  1S5E D;  5I4D A;  4F88 A;  1YJ9 A;  2UXC Q;  3DWA A;  3KJP A;  1O78 A;  1HNZ Q;  5C0X H;  2JA9 A;  4GZY C;  4B9X A;  3U4Z A;  2XN9 C;  1N34 L;  3GTJ B;  2CW0 D;  3BJU A;  4JCV E;  5A2Q L;  4DR1 L;  3HP3 A;  3NEM A;  1YNN C;  4OHJ A;  4U68 A;  4F87 A;  1GJX A;  2CQO A;  5IT9 c;  2NTS A;  2NVT B;  3K7U C;  3NEL A;  5ELB A;  4QUC A;  1SYF A;  5IYC H;  4EGV A;  3HOV B;  1EYD A;  4R4T A;  2AWO A;  5LMN W;  4DUY L;  4A3E H;  3FVQ A;  3TN2 A;  1LTS D;  5CBA E;  1HZC A;  2OTL A;  3NWS A;  3K5N A;  4KY5 A;  1B53 A;  2F4I A;  3BZC A;  3VDY A;  3BG3 A;  2PMZ E;  2EQS A;  3L0O A;  2Q2H A;  3PCO B;  4JI8 Q;  3CCQ A;  2BA1 A;  1W6K A;  3JAM L;  2R92 H;  5ELD A;  2P5Z X;  1XNR L;  1XTD A;  4DR5 Q;  4BA1 I;  2JA7 G;  2L0C A;  2ZXO A;  3D3R A;  4RHR A;  2EPB A;  2YTX A;  4LAA A;  3NBI A;  3TDQ A;  4A3M H;  2Y0S B;  3S16 H;  1TWG B;  2NVQ B;  4A3K H;  2B29 A;  2B2Y A;  3GTK H;  3MEH A;  1FJG Q;  4DR3 Q;  3ZYY X;  3KDF B;  4DR6 Q;  3NTK A;  1TT2 A;  4CDF C;  1MBY A;  3VYR A;  1VQL A;  2FMC A;  2JP1 A;  1EZ6 A;  2DUD A;  2F3V A;  3VR4 A;  3S15 B;  4GN5 A;  1DOL A;  4LF7 Q;  4XTC S;  2KVM A;  3J7A 5;  3OW7 A;  2CW0 C;  5J22 A;  4BBS G;  2E2H B;  2YYZ A;  3G48 A;  2O5J C;  3R3O A;  2K04 A;  1UE7 A;  4DR4 L;  5G3L F;  2ZXP A;  4ZUI A;  2NVY B;  1XJV A;  5CC4 A;  2QW7 A;  4TSS A;  1IHZ A;  3TS2 A;  5AJ3 Q;  4NXN Q;  1IBK Q;  1A2U A;  4G7H C;  1HNW Q;  1VQ9 A;  1L1O C;  2IX0 A;  2PZU A;  4PZ8 A;  1CT1 D;  1NE3 A;  4XQN A;  4A3F B;  1Y1V H;  5M5Y B;  4TKO B;  1Z6H A;  5BR8 Q;  3W3A A;  5CMD A;  3E0E A;  2VS1 A;  4JV5 Q;  2F4V L;  2B8F A;  1AW7 A;  4IUU A;  2Q8I B;  5M3F H;  1V1Q A;  2IL8 A;  5K36 H;  3S1R H;  1VQE A;  5IWA Q;  3ITP A;  1QWY A;  3G6E A;  3K8A A;  3MTS A;  1HA6 A;  1OXU A;  3VA7 A;  1S4Z A;  2NB0 A;  1K8O A;  2QEX A;  4R4C A;  1VQB A;  3DEO A;  2PO4 A;  2F0H A;  2HHH Q;  2ZT9 C;  1MSH A;  4DV2 Q;  2RCN A;  4IJL A;  4IOA A;  2GVB A;  1RIP A;  3VR2 A;  1ICF B;  2UUB L;  2DN8 A;  3PUX A;  1KRT A;  2R7F A;  1Q8K A;  2K05 A;  2QF7 A;  2UUA Q;  5IY0 A;  1VCI A;  1HRJ A;  4OWW B;  1O7Z A;  1HFG A;  1D7Q A;  1V1P B;  1K0R A;  4LUO A;  1STN A;  3I4M B;  4A3J H;  2JA6 G;  2FMM A;  2ZXR A;  1DJR D;  2BH8 A;  5CV4 A;  1RL2 A;  2J0T D;  3I4O A;  4DK3 C;  1EIY B;  4IPG A;  4JI1 L;  1A62 A;  4LF6 L;  4POF A;  4DAY A;  5D3D A;  5C44 H;  2AQ2 B;  4A3J B;  5FLX E;  4MIU A;  3PIP A;  1BCP F;  3S1N H;  4WFN 3;  1HZ9 A;  4AH6 A;  4EVO A;  3VR5 A;  1N33 L;  2K52 A;  2SNM A;  1HXY D;  1QUQ B;  2OF1 A;  2F3I A;  3WDN A;  1HR0 W;  3GTQ H;  1UE1 A;  5IGD A;  1KL9 A;  5IGF A;  4X62 Q;  1S72 A;  1BOS A;  3PF5 A;  1LTA D;  3RZO B;  1LAC A;  3E9H A;  4L5T A;  4RAU C;  2PW5 A;  1I3Q B;  2AMC B;  4JI4 Q;  4IFD G;  2HDM A;  1G6Z A;  4R4I A;  1GD7 A;  2B63 B;  3E3X A;  1B44 D;  5EQ0 A;  4PZ7 A;  1D5Z C;  1BF4 A;  1EOV A;  2L11 A;  3QJY A;  1JIC A;  3V96 A;  1ILP A;  2JXM B;  4AYB B;  2CH4 W;  4X6A H;  4RCO A;  1QNK A;  1HQR D;  5JJL A;  3PIP 3;  1PV4 A;  1RF2 D;  4CHT B;  4PMC A;  3RLF A;  5I9O A;  1LTR D;  1YI2 A;  1V1O A;  1QJO A;  4JG2 A;  1C8C A;  4KY6 A;  4A3E B;  4NPS A;  3NBH A;  3M7N A;  1Y1V B;  3PIO 3;  2X6L A;  5C0X J;  3K81 C;  1K28 A;  3G4S A;  2OWO A;  2EVB A;  4ME3 A;  4JI2 Q;  5HUR A;  1LAB A;  3GO5 A;  2QDB A;  4JI5 L;  5JOB A;  3UDX A;  2BE5 C;  3OHX C;  3EQL C;  2KCM A;  1BDO A;  1STG A;  2A6E D;  3FDT A;  1NUC A;  3F8T A;  5COY A;  1EQT A;  4KHP L;  5C4X G;  2RHS B;  1NNX A;  4A3G B;  3AU7 A;  1ICW A;  4ABN A;  4G7Z C;  3FPP A;  2Q2I A;  3M4Q A;  1YHA A;  4RKB A;  4A3L G;  4QGU A;  1TWG H;  5KNB A;  4A3K B;  4A3I B;  3J81 i;  1SE3 A;  3CMA A;  1V1P A;  1KC8 C;  5C3W A;  4A3G H;  3SE0 A;  2PPB C;  1D5M C;  3BYY B;  3BZK A;  3A55 A;  3KJO A;  4LF9 L;  1IBM Q;  3KFU A;  4ZUJ A;  2O2L D;  3U9O A;  2EJM A;  1X9N A;  2A1A A;  3GTK B;  2NN6 G;  1BXT A;  4EQP A;  1K3R A;  4F7X A;  3FKI B;  3JAM i;  4G57 A;  1VQ6 A;  2UXC L;  4R1J A;  4JI6 L;  1PFN A;  4JYA Q;  2OQK A;  2Z4H A;  1A63 A;  1PHJ A;  2VQE L;  3KK7 A;  4GN4 B;  3MEF A;  1CKN A;  1N34 Q;  1OXT A;  1TWA H;  4HSV A;  4XT3 B;  3STB C;  3AQQ A;  4JW0 A;  3HG9 A;  1QZG A;  1Z9F A;  3P7J A;  3DHQ A;  4RGT A;  3HOU H;  1H9M A;  3M4P A;  5CR3 A;  4DR1 Q;  5CV8 A;  1LUZ A;  5JAV A;  4YY3 L;  4BY7 H;  5JEA G;  1SRO A;  3L7Z C;  1H9J A;  5EPJ A;  4OXP A;  4A93 B;  3GTG H;  4APV A;  2DNC A;  3LWE A;  2VB2 X;  3EVQ A;  1X3G A;  5I6W A;  5GQO A;  3P1H A;  1Z47 A;  1HA5 A;  3VYT A;  4J15 A;  3J7A F;  3CW2 C;  1WD0 A;  4N8X 1;  3AFQ A;  4IPD A;  2PQA B;  4K2L A;  3H0G H;  4B3T L;  1A6X A;  2JA5 G;  1K83 B;  1EWH A;  3GV3 A;  3C2P A;  2WAQ E;  4A3K G;  4RGO S;  5JPM C;  2A6E C;  2R7Z H;  2WB1 G;  1DON A;  1RTN A;  4H13 C;  1A2T A;  2K03 A;  1KTK A;  1BVS A;  2Z6K A;  5A2Q E;  1W6J A;  1SXT A;  1U5K A;  3CPW A;  4KKT A;  4KLK A;  1N36 L;  1WTW A;  5M3M H;  1DXM A;  1ENA A;  3ERQ A;  1E1O A;  1E24 A;  4N9P A;  1FJG L;  4DR7 Q;  1TWC H;  3GV6 A;  3CCU A;  4O0A A;  2MO1 A;  1EIH A;  3I73 A;  1MHW C;  4AIM A;  4DAM A;  2VY3 A;  3A7A B;  3H3V I;  2JA8 B;  1CSP A;  2PNH A;  1FYC A;  4RCN A;  4OO1 H;  3AEV A;  3KLW A;  2PQA A;  3QG1 A;  1TY2 A;  3S1M B;  2LKV A;  2D0P A;  1EEI D;  2RDH A;  4PMW A;  4OX9 L;  5IOD A;  4DR4 Q;  1Z7T A;  1RKN A;  5D14 A;  1K0S A;  1PH3 A;  4L5Q A;  2AWN A;  1YEZ A;  4BBR G;  1VQK A;  2UU9 Q;  1E22 A;  4NXN L;  2A74 C;  5C0X G;  4J6H A;  4BBR B;  1U4P A;  1S5F D;  1STB A;  2CHB D;  3M85 A;  3TSS A;  2F0K A;  1WOC A;  3I56 A;  3SK5 A;  1JJ2 A;  2R92 B;  1PZI D;  2E2J H;  4NXM Q;  5C4J H;  5BR8 L;  1SLJ A;  4C1N K;  1CZW A;  1BCP C;  2ZJR A;  1JB3 A;  1PH2 A;  4DV5 L;  1ET6 A;  2V1C C;  1GUG A;  1L0W A;  3K5L A;  1HH2 P;  4DA2 A;  1BNZ A;  2A8V A;  1VQJ A;  3TZU A;  5IT9 L;  1A8V A;  3SGI A;  3H91 A;  1YHQ A;  1EQQ A;  3TP6 A;  2VZA A;  1GO3 E;  2N55 A;  3U9S A;  1PTO C;  3ZJY C;  1JJG A;  4KI0 A;  2R3Z A;  5LMU L;  3GTO H;  4IN3 A;  5KND A;  5DLQ E;  5IP9 H;  3J7A V;  5E1F A;  1K73 C;  2O5I C;  1SMY D;  3D6C A;  3WOE A;  4FXD A;  4DV6 L;  2HIV A;  1XMQ Q;  1BR9 A;  4HJ7 A;  4P75 A;  1H9K A;  1M8A A;  2UXD Q;  3TZD A;  3ERO A;  4DV4 Q;  3HGB A;  1SNC A;  2Z6K C;  5T1I A;  3MWY W;  3UE0 A;  1I6H H;  2IT1 A;  3H09 A;  1PYS B;  3T13 A;  4CBV A;  5D65 A;  2F3W A;  1XTC D;  2PI2 A;  2XWJ B;  2I5M X;  2M00 A;  4S3S A;  4P73 A;  1OXV A;  1PZK D;  3H0G B;  5IE8 A;  1STA A;  2OQ0 A;  1HR0 L;  4QCL A;  5C4H A;  2E74 C;  2E76 C;  1D2B A;  5IGC A;  4MHE A;  2XRQ D;  3OWE B;  2UXB Q;  4A3I H;  3IAY A;  1AZP A;  4JVZ A;  4JPB W;  4EQO A;  1MKH A;  2MP1 A;  2I07 B;  1PRT F;  4GKK Q;  1N33 Q;  1DOK A;  4DUZ Q;  3GTL H;  4C3I B;  1GM5 A;  4WJW A;  1AEX A;  3F1Z A;  2MQH A;  3K80 C;  1DOM A;  3MXN A;  3LGJ A;  5KRU A;  2F03 A;  4R4O A;  5IT9 E;  2DY7 A;  5J39 A;  1I94 L;  2QKI C;  4JBK A;  4WRD A;  4JI4 L;  3DM3 A;  2F0M A;  2WAQ B;  3KBG A;  4LF4 Q;  3A5U A;  1BBU A;  3FKI H;  2TMP A;  2X69 A;  1J8I A;  3D31 A;  4DNI A;  4JI7 L;  5K36 G;  4KKU A;  2K4K A;  1D5X C;  2CWP A;  1V8Q A;  4DR2 L;  4X64 L;  5DAU A;  4BY1 B;  1HPC A;  4X3U A;  5DM7 3;  4GKJ Q;  1AN8 A;  1YJN A;  3K59 A;  2VXW A;  4KKS A;  4QIW B;  4HJ8 A;  1U9R A;  1PFM A;  3T1Y Q;  3HOU B;  3J80 i;  5IYD H;  1QZH A;  1DZ1 A;  3UDI A;  2E75 C;  3I91 A;  4ULL A;  2EY5 A;  1E2Z A;  3U4V A;  2JA8 G;  2B2Y C;  2RDF A;  4DNR B;  5HGT A;  1K3B C;  3JAM c;  2EYO A;  2HCC A;  2NYZ D;  3VA5 A;  1ENC A;  2PCF B;  3NTH A;  2K5D A;  1JR0 D;  3HOZ B;  3L3O C;  4A3B H;  1WTH A;  4KHP Q;  2LY7 A;  2N88 A;  4ID6 A;  4P71 A;  2F0L A;  1M1K C;  3KF6 A;  3DWQ A;  5IYB G;  4X65 L;  1PA6 A;  4C2M H;  4PG3 A;  1QVF A;  4IPH A;  4QMG A;  1SYE A;  3URY A;  4UHV A;  3KF8 B;  3S2H H;  1ZKO A;  3PMF A;  5HY6 A;  1UEB A;  1TII D;  4UP9 A;  1HJP A;  4P2C B;  5CV9 A;  3S17 B;  4WJ3 M;  2JA7 H;  4GN3 B;  5LMN L;  2K5W A;  4DXF A;  2JA8 H;  4OO1 I;  3OMC A;  3NHH A;  2FHT A;  4NP5 A;  4K6L A;  1KHI A;  3HOW B;  4GNX A;  3MVV A;  2LMC B;  4A3M B;  4CJ2 C;  2K5N A;  3BVG A;  4A3J G;  3OTO L;  3PUY A;  2Z8L A;  5C44 B;  5IGE A;  3SEB A;  1TS2 A;  5C4J B;  2AHO B;  2Q8T A;  2MNA A;  5FO7 B;  2A6H C;  1S5B D;  4YY3 Q;  3I4N H;  1TWH B;  1VQO A;  3CAM A;  3D4R A;  4ME5 A;  3F2C A;  1K83 H;  1TVX A;  2K32 A;  3SR1 A;  4HCS A;  1VQP A;  1GKH A;  4A3F G;  1YNN D;  2NZ1 D;  3RNU A;  1YIJ A;  2KEE A;  1I50 B;  1PTO D;  4B3T Q;  4KN4 C;  1L0Y B;  3J80 E;  2JSO A;  2K50 A;  4CDE C;  4AQY L;  1PTO H;  4B3M L;  2CH4 A;  2V4D A;  3DLL A;  1T5X D;  1PH1 A;  4B3S L;  3HKS A;  2C5C A;  5KIX A;  3NPP A;  2CFM A;  5JVH 3;  3M3Y H;  5JEA J;  1SRU A;  5K5P A;  1N36 Q;  4A3D B;  1Q82 C;  2Z6B A;  2F0U A;  4BWG B;  3Q8D A;  1PRT B;  3ND9 A;  3IKJ A;  2E2D C;  4UP8 A;  3T56 B;  2VUM H;  3MA2 B;  2EYM A;  1DD2 A;  1BO0 A;  3HOW G;  2O4X A;  2A68 C;  3RR5 A;  4XYQ A;  4DAP A;  4YHH Q;  1EZ8 A;  1CKM A;  2RSN A;  1WTV A;  4K5W A;  1EY9 A;  2L5T A;  2A73 B;  4YIJ A;  3AFP A;  1NTG A;  1ZXT A;  2Y0S G;  2PW7 A;  4UDU C;  1IZ6 A;  1Q46 A;  4DAY B;  3KYH C;  3DUZ A;  3CCJ A;  4K8J A;  2B39 A;  4DK1 A;  2IX3 A;  3J7Y W;  1A15 A;  2FXQ A;  2YTV A;  1HNX L;  2K75 A;  4L8J A;  2BA0 A;  4LF8 L;  3KLR A;  1DGS A;  1LM0 A;  1VF7 A;  3K58 A;  3K7A H;  5C4X H;  1VDZ A;  1IYV A;  5E4W C;  5ELF A;  5M5W H;  4JBJ A;  1SNM A;  3X3M A;  2KCT A;  4C3I H;  1O7L A;  4NXM L;  2N78 A;  3T53 B;  1XX8 A;  4EQN A;  2EY2 A;  3E5S A;  4DV5 Q;  1S3O A;  1SND A;  5KYI A;  3RD4 A;  4R8N A;  2WII B;  1G51 A;  1LO5 D;  5IYB H;  5COR A;  2KA7 A;  3NWT A;  1G8Z D;  1SNQ A;  5LMU Q;  2F1M A;  4FF4 A;  3SK6 A;  4IUP A;  1SJE D;  1ET9 A;  3RN5 A;  1SBB B;  2E5L Q;  4FO2 A;  2OT2 A;  5FKA C;  3HKZ G;  4ZYS A;  2A68 D;  2J7Z A;  4LJZ C;  1VQH A;  4JK1 C;  5C3E G;  1XMQ L;  2ES2 A;  3UE1 A;  3AYH B;  1SEB D;  4A76 A;  4CDD C;  1AFP A;  2H1E A;  3I72 A;  1LTG D;  1M4V A;  3S24 A;  1GXD C;  3MFY A;  3DWP A;  4DV4 L;  3RZO H;  2ZTD A;  4MN3 A;  3CP0 A;  2JYO A;  1IYU A;  5M5X B;  1YNJ C;  1YZ6 A;  4DGZ A;  4RG1 A;  2JK8 A;  2F0N A;  1C0A A;  1PFS A;  5I2X A;  5C3X A;  3HEJ A;  2E2J B;  3HOZ H;  1MD2 D;  5EAY A;  2M2L A;  1H95 A;  2R92 G;  4HCE A;  3GTL B;  1ILQ A;  2EYP A;  2GVA A;  2MO0 A;  1RJT A;  2E2H H;  1GOZ A;  3ULP A;  1JOQ A;  4ZRZ A;  2QCP X;  4O42 A;  5EPL A;  3HOY G;  3CC7 A;  1I4P A;  4JI3 L;  5JJK A;  2CWA A;  1VQN A;  5CV6 A;  5M3F G;  1WCM G;  3V05 A;  1WTX A;  1I94 Q;  5EJW A;  3CF5 A;  1ROD A;  3HKZ B;  1ESR A;  4LF4 L;  2KHJ A;  4LFB Q;  1XMO L;  4FDB A;  1K8M A;  1Y8P B;  2EYL A;  4XT1 B;  4GS3 A;  5DM6 3;  2A19 A;  3PUW A;  1CFM A;  3R2I A;  3VR6 A;  4X64 Q;  1XNQ L;  2KHS A;  2F0E A;  4J8Q A;  4NB3 A;  4F8M A;  4E6I A;  3HZX A;  4TQU S;  1TWH H;  1G91 A;  3BVM A;  2VUM G;  5ELO A;  4RHS A;  2K5H A;  1TS3 A;  1NMG A;  4PZ6 A;  3BZD B;  1IL2 A;  2NUC A;  4ODG A;  1YNJ D;  1C9O A;  4CDC C;  1QUQ A;  3S2D B;  1KNA A;  2L12 A;  4XIG S;  1F2Y A;  4KD4 A;  1ASZ A;  4C3H G;  4HIO A;  4I65 A;  2DY8 A;  2EYH A;  3HOX G;  1PYB A;  3CME A;  2D2C C;  1I50 H;  4OGQ C;  4OWT B;  2ENB A;  1EEF D;  1OXS C;  3C1F A;  4JOI C;  5GAE C;  2J4X A;  2A6H D;  1LT3 D;  2RDG A;  4CKB A;  1B1Z A;  3PUV A;  3GTP B;  1U4R A;  4LW1 A;  1JWU D;  2WB1 E;  1KRS A;  4CKC A;  4RWS C;  4RFB A;  5DNF A;  3MAQ A;  3L9A X;  2R61 A;  4XYO A;  4A3I G;  4IUT A;  1LTI D;  3GDE A;  3H94 A;  1PDQ A;  1CKO A;  3PF4 A;  2GN5 A;  2IHE A;  3PQI A;  1VMP A;  1MSG A;  3PIO A;  1EU4 A;  1GUS A;  1WI5 A;  1GUW A;  2WAQ G;  4TRD A;  5EBD A;  1GVP A;  5LMN Q;  3RN2 A;  1G29 1;  1PXU A;  2F0D A;  1VQM A;  1LT4 D;  1QG7 A;  4DR6 L;  4HTH A;  4LUV A;  1VQ4 A;  1HTL D;  1I5F A;  1HQM C;  1BUV T;  1EIG A;  3N6R A;  1SR3 A;  1FGB D;  3HRZ C;  4LF5 Q;  2TSS A;  2VW9 A;  3GTM H;  3MZ5 A;  1UAP A;  1BCP D;  2NZO A;  1B4O A;  1S5C D;  3E6Z X;  2NN6 I;  4L63 B;  1EL0 A;  2QA4 A;  3HOY H;  5M3F B;  1OO9 B;  3S1R B;  4IFD H;  3NQI A;  3FP9 A;  3S14 H;  2EOT A;  3A8I E;  1GUO A;  3LX0 A;  1EFW A;  3H6M A;  3W1B A;  5M3M G;  4Y7N B;  3ND8 A;  2K33 A;  5EPK A;  1Q8I A;  2I5L X;  2HD3 A;  3OIQ A;  1N9W A;  3OPO A;  1TWC B;  5FJ8 G;  1TWA B;  1EQR A;  1SE2 A;  1LTL A;  1UWV A;  2R93 B;  2Z9H A;  1WTR A;  2EY6 A;  2WAC A;  1F9R A;  1UE6 A;  1PH7 A;  2JA7 B;  1T9H A;  1EY0 A;  2H5X A;  3X3N A;  4UP7 A;  1MGS A;  2RA4 A;  3F2U A;  2VQF Q;  4EQ5 A;  1SJH D;  1B9N A;  5IWA L;  1W3S A;  4I7Z C;  3NXW A;  2K28 A;  4N8F A;  4MNO A;  2R7Z G;  1TU2 B;  2F0S A;  1QOH A;  4FXK C;  1WD1 A;  5FO8 B;  2DJG C;  2HHH L;  1XPR A;  1GHJ A;  2N8N A;  1IKL A;  4YHH L;  2RF4 A;  1C48 A;  2X6G A;  1VQF A;  2UUB Q;  3BDC A;  3K7A B;  2C9O A;  1PH4 A;  4TVA B;  1FGU A;  1TWF H;  2G9D A;  2AQ3 B;  2ZTE A;  4ZLT F;  5BN3 A;  2UUA L;  2PZT A;  2RHQ B;  3G6J B;  1CKN B;  2CKZ B;  2EY1 A;  5M5W B;  4UY8 C;  3SHL A;  2MGS A;  1S5D D;  1D1I A;  1EU3 A;  3BVZ A;  2A69 D;  1I3Q H;  1V43 A;  1B50 A;  4RGM A;  1K9M C;  4UAI A;  4A4I A;  3I70 A;  1KD1 C;  4LF6 Q;  2HT1 A;  3A8J E;  5AFW A;  3PO2 H;  4KK7 A;  1BBW A;  1TY0 A;  4A3L H;  3CC4 A;  4RH6 A;  4O1N A;  1Q12 A;  4I7A A;  3Q23 A;  1GUT A;  4IUQ A;  3FPU B;  2ZM6 Q;  1HCZ A;  1F9S A;  4YCW A;  3U50 C;  1H9S A;  2I46 A;  2CCZ A;  4C3J H;  4OIK A;  1B3Q A;  3P75 A;  4NKL A;  3I2Z A;  4M8A A;  4X62 L;  2XSC A;  4IFD I;  2DNE A;  3PO3 H;  5EKI A;  3S1N B;  1L1O A;  1QVG A;  2JJQ A;  4ZKC B;  3GTM B;  1CUK A;  1WFQ A;  4XXE A;  1VQG A;  2F52 A;  1WYD A;  4XQQ A;  2RQX A;  5IP7 G;  3KOJ A;  5ELN A;  4K6D A;  4V0B A;  3CCV A;  4NW2 A;  4DV0 Q;  1EOT A;  4QY7 A;  4K14 A;  2B2W A;  1SN8 A;  1E2V A;  5L37 A;  4JI8 L;  3GTO B;  3O13 A;  4J1M A;  4HMJ A;  3L2P A;  5ELE A;  2PYK A;  2ZTC A;  1QB5 D;  1ONL A;  1SE4 A;  4DR5 L;  5TSS A;  2L4N A;  4DF7 A;  1DCZ A;  1B8A A;  4DPG A;  3S2D H;  1HZB A;  3HOZ G;  3RZD B;  4GOP A;  5IIF A;  3MXN B;  3W1G A;  4HSP A;  4U67 3;  3GTP H;  4GLV B;  4PMB A;  2XVS A;  1RDP D;  4DU9 A;  1L0X B;  1VMC A;  3KF6 B;  1NR4 A;  1QVC A;  1EY4 A;  1PRT C;  2ID0 A;  4IZ8 A;  5E7N A;  3CC2 A;  1RTO A;  1B3A A;  1SMY C;  4DV1 Q;  1G2S A;  2NVX H;  2D5D A;  3S1Q B;  5NUC A;  4KJO A;  1EYC A;  2NVT H;  3K5M A;  1A3T A;  4BBR H;  1D1K A;  5LHY 1;  3UDG A;  3SDZ A;  4HIM A;  2IHF A;  1KQS A;  3GTG B;  4KHZ A;  1VQD A;  4A3B B;  2L15 A;  4C3H H;  5AJ3 L;  1XMO Q;  3KLS X;  5D3I B;  1VF5 C;  3TBI B;  2IPK D;  2KEN A;  1IBK L;  1HNW L;  3NUC A;  2YTY A;  1VQC A;  3A74 A;  3J81 E;  1TWF B;  4LF9 Q;  1IBM L;  4HID A;  1E7Z A;  1CTM A;  1X3Q A;  2MHV A;  2RVL A;  1KIX A;  1Y1W G;  4L5S A;  3TRZ A;  4JV5 L;  2F4V Q;  1SFO H;  3EFX D;  4KMU C;  4KV6 A;  1JE4 A;  1I4R A;  2VQE Q;  5FLX L;  1BKB A;  3OOC A;  1JWM D;  2K5V A;  3HOX B;  5GAH C;  2F0J A;  1NBW A;  2FIN B;  2R7Z B;  4LWC A;  1BCP B;  4LUZ A;  2NVX B;  5C3E H;  2HCI A;  3E0J A;  4CJ1 B;  2E2I H;  1U4M A;  2GA4 B;  5IGB A;  1EWC A;  4DV2 L;  2DGY A;  3BDO A;  3H0G G;  2JA6 H;  3K0X A;  4KTA A;  2R93 H;  1HFN A;  3F2B A;  3I3C A;  2ICE C;  4ZCK A;  2MJ8 A;  4FNF A;  5IP7 H;  1TR5 A;  1KNE A;  1K8G A;  2XGT A;  2YU9 H;  4FYD A;  4A3C G;  4BS9 A;  3P20 A;  1IW7 C;  3ULL A;  4DN4 M;  2ZJQ A;  5GAG C;  2EDG A;  1HUM A;  3CRL C;  5HGQ A;  3A5Z B;  1UNS A;  4C3J G;  3R2T A;  3TEH B;  1TS4 A;  1LT5 D;  3M9B A;  1HTP A;  1PH5 A;  3GP7 A;  4YCV A;  3E9I A;  5C5L A;  3PV0 A;  2UUC Q;  1JQY D;  4QUF A;  1A0I A;  3I4N G;  4Y52 H;  4ZKB B;  2F0G A;  4DR7 L;  1SDF A;  4CJ0 B;  5IGG A;  3IRB A;  1I4H A;  4LF5 L;  2E8G A;  5EGT A;  4IUN A;  4JBM A;  3OMG A;  1LTB D;  1P8L A;  1QE6 A;  1RHP A;  1ESF A;  4DV3 L;  5CYU A;  2EYJ A;  1IW7 D;  1HZA A;  1A3V A;  1SE8 A;  4HJA A;  3DXJ C;  3M4O B;  3IL8 A;  3GTJ H;  2UU9 L;  5M9O A;  4XQJ A;  1F2Z A;  1IBL L;  3CCS A;  3SK8 A;  4IAL A;  3H3V C;  1AH9 A;  3M4O H;  3VYU A;  5FLX c;  3J81 L;  4CGY B;  2VUM B;  1VQ5 A;  3CXC A;  3OWF A;  4ZQ3 A;  3FMC A;  4A3F H;  2KHI A;  4GNX C;  4RGN A;  2LS0 1;  3QR8 A;  5ISR A;  2VQF L;  4BA2 I;  4DV7 L;  1PLF A;  2EE1 A;  1QNU A;  4X3T A;  1WTQ A;  1EY7 A;  3I55 A;  4JI2 L;  3CPF A;  3LNN A;  4JI5 Q;  3PO2 G;  1MJE A;  3H15 A;  2FJ2 A;  1U0L A;  1K8A C;  1C7Y A;  3I4N B;  1E0B A;  4JBW A;  4C1N I;  2XRS D;  2XNA C;  2B63 H;  4PQX A;  3TS0 A;  1NCV A;  3AB9 A;  3LWU A;  2Z1C A;  2R93 G;  3QO2 A;  4ALP A;  3SXH A;  5F2D A;  3D0F A;  2WFW A;  2RCF A;  1KLU D;  1E2W A;  1KAA A;  1FD7 D;  3S17 H;  3I4M G;  2G5D A;  4LFC L;  3CU7 A;  5IYC G;  3G71 A;  3F2D A;  5J3B A;  4FF2 A;  1ZYR D;  4PNY A;  4KHV A;  1LLR D;  4EX5 A;  2IWH A;  2MPM A;  1EY8 A;  1IL8 A;  1WTO A;  1NSN S;  1WTP A;  1HR0 Q;  3W5O A;  3IFT A;  3T1H L;  2UXB L;  4KN7 C;  5C44 G;  1R4P B;  1VQ7 A;  1FNW A;  2F0P A;  4B08 A;  1TXY A;  4JI6 Q;  2WB1 B;  2KQ3 A;  4QF4 A;  2B2T C;  4JYA L;  2F0T A;  2AKW B;  2ZM6 L;  2F0W A;  2BH2 A;  1J9O A;  4Q0F A;  2JEB I;  3B6Y A;  4GKK L;  1EY5 A;  4DUZ L;  4OON A;  4QJF A;  3TME A;  5FO9 B;  2M9V A;  1SYB A;  3FKI G;  3U58 A;  4JI0 Q;  1N32 Q;  1WJJ A;  2H4O A;  1P16 A;  2IJ0 A;  4X66 L;  5FJ8 H;  1EIF A;  3R93 A;  5I9P A;  1FNV A;  2BE5 D;  4C56 C;  5KYL A;  1A3U A;  1BQQ T;  4ZAI A;  3OW2 A;  4JI7 Q;  1V9P A;  2F0F A;  3QB3 A;  3D8G A;  5M3M B;  4DV0 L;  3TRE A;  4A75 A;  4GKJ L;  2CVR A;  3D4D A;  3RZD H;  4MZ9 A;  4BXX H;  5FLM H;  2WIN B;  4N9T A;  2ZJP A;  3T1Y L;  4IUR A;  4RA8 A;  3RLN A;  3IFD A;  1QCB D;  2L1B A;  1Y14 B;  3W2D A;  1RD9 D;  1SYD A;  2Q8R E;  4BY1 H;  5EBC A;  5BN5 A;  3J81 c;  2Z0S A;  4JOI A;  2B3G A;  2JA6 B;  1STH A;  1XWE A;  5JVG 3;  2KJX A;  2PMZ B;  5KNC A;  1PTO F;  4QB4 A;  4HN7 A;  1R4Q B;  4IQZ A;  5M5Y H;  1EQV A;  1XYI A;  4V19 0;  3DMU A;  2FFK B;  4NDX A;  5LL6 X;  2CQA A;  2K5Q A;  4DK6 C;  2JE6 I;  3I90 A;  5M5X H;  2EZV A;  2OEO A;  1Y1V G;  1FNU A;  5ELC A;  4DV1 L;  4KD3 A;  5A35 A;  3KDF A;  4FXG C;  1DYQ A;  1WCM B;  3MXU A;  2F0O A;  3MFG A;  4X65 Q;  3NK9 A;  3T16 A;  3HOW H;  1O7I A;  4A3G G;  4K0K L;  5EKK A;  4G7O C;  3MXG A;  1LV9 A;  1MJC A;  4OX9 Q;  3J7Z C;  4X3K A;  5C4X B;  1CI3 M;  1X56 A;  3G7L A;  3BU2 A;  4IOC A;  3Q6S A;  4X3S A;  2IW3 A;  2JA5 B;  1JWS D;  2KOL A;  4YWM A;  4JC0 A;  4HMI A;  2QGQ A;  5GRO A;  2KED A;  3Q0A A;  1J5E Q;  3GD7 A;  4LNQ A;  2RBM A;  1JMC A;  1L2F A;  3SK4 A;  4BY7 G;  1Q7Y C;  1CSQ A;  2NWG A;  1CM9 A;  1PH9 A;  4DXG A;  1EFI D;  4YWK A;  1N8R C;  3S1M H;  1ENF A;  4QL5 A;  3I7F A;  2E2I B;  1YNX A;  3HS0 C;  1SNO A;  4XDX A;  1VS0 A;  3CCE A;  5JPN C;  1KXL A;  1VQ8 A;  1ASY A;  1VQI A;  3NP8 A;  4AYB E;  2A5H A;  3K5O A;  3TP8 A;  2AQ1 B;  4DV6 Q;  4LK1 C;  1AZQ A;  1IXR A;  5C6A A;  2YU9 B;  4M1U B;  4OEL B;  5IP9 G;  1NAP A;  1YVC A;  4C3J B;  4DAV A;  2UXD L;  3KLS A;  4DK0 A;  2SEB D;  3GTQ B;  1B9M A;  1PVO A;  4H0L C;  3K57 A;  3BYT B;  2MUY A;  1X3F A;  3VR3 A;  4O2D A;  1SYG A;  4AQY Q;  1CHP D;  4R8I A;  4YWL A;  1YHB A;  4P72 A;  5KGU A;  3Q22 A;  1FR3 A;  2AUJ D;  1GUN A;  1EYA A;  4HJ5 A;  4BBS H;  4B3S Q;  4K8I A;  3HFZ B;  3NE5 B;  2BCO A;  2ATW A;  5IYD G;  4H7B A;  4DNT B;  2UUC L;  1UEA B;  3HOY B;  2EXZ A;  3A54 A;  4FF3 A;  3WOF A;  1X54 A;  1KDA A;  4FP5 D;  2VL6 A;  3RLO A;  3OIP A;  1R9T B;  3C3L A;  3S14 B;  2A69 C;  4P74 A;  1LYL A;  1I4G A;  1DM0 B;  4MTK A;  3NEN A;  1UUP A;  3CD6 A;  4A3D H;  4A93 G;  2K14 A;  4DV3 Q;  1Q90 A;  1JB7 A;  2HIX A;  5JJZ A;  4IJH A;  1GHK A;  1M90 C;  4BY7 B;  2VB3 X;  1Q1B A;  2NN6 H;  4L6T B;  3ERS X;  3T51 B;  4LF8 Q;  4C3I G;  1KDB A;  1JE5 A;  4AYB G;  1XPU A;  2WKC A;  1IBL Q;  4B3R L;  4K5V A;  3A8K E;  4HR7 B;  4DR2 Q;  3SVM A;  2XTI A;  2L55 A;  3TQY A;  5CV7 A;  2BDO A;  4RMF A;  1ZYR C;  4IO9 A;  1JT8 A;  1I6V C;  3D4W A;  2WV6 D;  1X32 A;  1YIT A;  4B9W A;  4LFA L;  3J81 j;  1PH6 A;  1HNZ L;  3AMU A;  1WVL A;  1JCK B;  1OTC A;  1BBX C;  4DV7 Q;  2SNS A;  3M4Y A;  3CCL A;  1SFO B;  3OSO A;  5LL6 S;  1F2L A;  5T1G A;  3CCM A;  1F9P A;  5CGK A;  5C0X I;  1G2T A;  3MHB A;  2E5L L;  1CQF A;  5JJI A;  2Y0S E;  2JQO A;  4NMZ A;  4GOP C;  1EYG A;  2JEA I;  1F9Q A;  1B70 B;  1NR2 A;  3OYY A;  2YV5 A;  5G3L D;  3A56 A;  3HOX H;  1Y8O B;  2K01 A;  3FEW X;  3K6O A;  4LMQ D;  4IUV A;  2HUG A;  2B2U C;  2KEC A;  3A7L A;  4DUY Q;  2WP8 J;  3V2T A;  3EA6 A;  1U4L A;  1PFB A;  4MTN A;  4H02 A;  4WJ4 A;  2OXP A;  1SYC A;  3J80 c;  3RMH A;  4LFC Q;  4RKL A;  3CRK C;  1W2B A;  4HJ9 A;  1I6H B;  3CQZ H;  1XNR Q;  3PO3 G;  1UE5 A;  2LXJ A;  4PV1 C;  3HKZ E;  4WOR A;  4A3E G;  3JAM E;  5I6Y A;  2EYF A;  1KLG D;  4POG A;  1LT6 D;  2N49 A;  5FOB B;  3PO3 B;  2QEJ C;  3T1H Q;  4DR3 L;  3NBH B;  3PSI A; 
#chains in the Genus database with same CATH homology
 2KCN A;  2LFN A;  5J1Z A;  1AP0 A;  1JOO A;  1B2T A;  3DEP A;  4FVM A;  2EJF C;  1O80 A;  2Z4I A;  2K6A A;  2AUK A;  1TQO A;  1CZG A;  3UI2 A;  1KAB A;  1F2M A;  3D6W A;  4CKE A;  3QIA A;  1ML0 D;  4H44 C;  1SSO A;  2PNR C;  1IKM A;  4C2M B;  2KUM A;  1T5E A;  3BDL A;  2B2V C;  3FRP B;  3PO2 B;  4OO1 G;  4K2K A;  3I4L A;  3PUZ A;  1H9R A;  2B2U A;  1JOK A;  4HED A;  3NSW A;  1PMR A;  1TS5 A;  3J80 L;  3NQT A;  2R6G A;  2F0Q A;  5I2Y A;  5KEE A;  2NBF A;  3Q24 A;  1ZEQ X;  2SOB A;  3I8Z A;  4KJN A;  3KBX A;  5E4X A;  2NVX B;  1Q3L A;  1QIL A;  3S16 B;  2D9U A;  2PQE A;  3S9W A;  1Q1E A;  1D6E C;  3R8B A;  3BS1 A;  3C1E A;  5BN4 A;  3MC0 B;  3QWN A;  4G4K A;  5C4Z A;  4IFD J;  1STE A;  1Y69 U;  3QOJ A;  1I4X A;  4FF1 A;  3M3Y B;  5C5M A;  3GQB A;  3VYS A;  4OIJ A;  1PTO B;  4KY7 A;  5E3F A;  3T4A C;  3EJI A;  3NTI A;  2B2V A;  4Q5V A;  2B2W C;  2RSO A;  2HQE A;  1PZJ D;  5C3E B;  3MXP A;  1TKW B;  5CV5 A;  3QOL A;  2K7V A;  5JEA H;  2KCC A;  2WKD A;  1JOR A;  3TP7 A;  1PYW D;  2HDL A;  1EY6 A;  1PRT D;  2BOS A;  4ILW A;  2PZW A;  4C3H B;  2F0V A;  1CHQ D;  2G9H D;  4Z9C B;  2F0I A;  5DEH A;  1LTT D;  2D62 A;  3KUP A;  2BDN A;  2VNU D;  1OXX K;  1MI2 A;  4DFA A;  2EJG C;  3N52 A;  1C4Q A;  5EKL A;  1CA5 A;  1SNP A;  1XXG A;  5IOC A;  3TP5 A;  2QIL A;  3S2H B;  3C46 A;  1H9S B;  1F77 A;  1I4Q A;  1II3 A;  2L9H A;  3KF8 A;  5CBE E;  2XIW A;  3CHB D;  1STY A;  2NTT A;  2RKS A;  3CKI B;  1O7Y A;  1HHV A;  1CK1 A;  4K5X A;  2XWB B;  1JC7 A;  4HAE A;  3CQZ B;  1Y8N B;  5FK9 C;  2B2T A;  2IX1 A;  4ZK9 B;  1X3P A;  3ONA B;  1SAP A;  1Y1W B;  3DM1 A;  1CQV A;  2K1B A;  3RUZ A;  1CA6 A;  1RCV D;  2B8G A;  3K0Y A;  2ICI A;  4OL7 A;  1KDC A;  3M7G A;  2SDF A;  4R9W A;  4BBS B;  1HUN A;  1S5E D;  5I4D A;  4F88 A;  3DWA A;  1O78 A;  5C0X H;  4GZY C;  4B9X A;  2XN9 C;  3GTJ B;  2CW0 D;  5A2Q L;  3HP3 A;  1YNN C;  4OHJ A;  4U68 A;  4F87 A;  1GJX A;  2NTS A;  2NVT B;  5ELB A;  4QUC A;  1SYF A;  4EGV A;  3HOV B;  1EYD A;  2AWO A;  3FVQ A;  3TN2 A;  1LTS D;  5CBA E;  3NWS A;  3K5N A;  4KY5 A;  1B53 A;  2F4I A;  3BG3 A;  2BA1 A;  1W6K A;  3JAM L;  5ELD A;  4BA1 I;  2L0C A;  2ZXO A;  3D3R A;  4RHR A;  2EPB A;  4LAA A;  3NBI A;  3TDQ A;  2Y0S B;  1TWG B;  2NVQ B;  2B2Y A;  3MEH A;  3ZYY X;  3NTK A;  1TT2 A;  1MBY A;  3VYR A;  2FMC A;  2JP1 A;  1EZ6 A;  2F3V A;  3VR4 A;  3S15 B;  1DOL A;  4XTC S;  2KVM A;  3OW7 A;  2CW0 C;  5J22 A;  2E2H B;  2YYZ A;  2O5J C;  3R3O A;  2K04 A;  5G3L F;  2ZXP A;  4ZUI A;  2NVY B;  5CC4 A;  4TSS A;  1IHZ A;  1A2U A;  4G7H C;  2PZU A;  2IX0 A;  1CT1 D;  4XQN A;  4A3F B;  5M5Y B;  4TKO B;  1Z6H A;  3W3A A;  5CMD A;  2B8F A;  1AW7 A;  4IUU A;  2Q8I B;  2IL8 A;  5K36 H;  3ITP A;  1QWY A;  3MTS A;  1HA6 A;  1OXU A;  3VA7 A;  1S4Z A;  2NB0 A;  1K8O A;  3DEO A;  2PO4 A;  2F0H A;  2ZT9 C;  1MSH A;  3VR2 A;  2DN8 A;  3PUX A;  2K05 A;  2QF7 A;  1VCI A;  1HRJ A;  1O7Z A;  1HFG A;  1V1P B;  1STN A;  3I4M B;  2FMM A;  2ZXR A;  1DJR D;  5CV4 A;  2J0T D;  4DAY A;  5D3D A;  2AQ2 B;  4A3J B;  5FLX E;  4MIU A;  1BCP F;  4WFN 3;  4EVO A;  3VR5 A;  2SNM A;  1HXY D;  2OF1 A;  3WDN A;  5IGD A;  5IGF A;  1BOS A;  3RZO B;  1LTA D;  1LAC A;  4RAU C;  2PW5 A;  1I3Q B;  4IFD G;  2HDM A;  1G6Z A;  2B63 B;  1B44 D;  5EQ0 A;  1D5Z C;  1BF4 A;  2L11 A;  3QJY A;  1JIC A;  3V96 A;  1ILP A;  2JXM B;  4AYB B;  4RCO A;  1QNK A;  1HQR D;  3PIP 3;  1RF2 D;  4CHT B;  4PMC A;  3RLF A;  5I9O A;  1LTR D;  1C8C A;  1V1O A;  1QJO A;  4KY6 A;  4A3E B;  3NBH A;  3M7N A;  1Y1V B;  3PIO 3;  2X6L A;  5C0X J;  2EVB A;  5HUR A;  1LAB A;  3GO5 A;  2QDB A;  5JOB A;  2BE5 C;  3OHX C;  3EQL C;  1BDO A;  1STG A;  2A6E D;  3FDT A;  1NUC A;  5COY A;  1EQT A;  4A3G B;  3AU7 A;  1ICW A;  4ABN A;  4G7Z C;  3FPP A;  4RKB A;  5KNB A;  4A3K B;  4A3I B;  1SE3 A;  1V1P A;  5C3W A;  3SE0 A;  2PPB C;  1D5M C;  3BYY B;  3A55 A;  4ZUJ A;  2O2L D;  3U9O A;  2EJM A;  3GTK B;  2NN6 G;  1BXT A;  4EQP A;  4F7X A;  3FKI B;  4G57 A;  1PFN A;  2Z4H A;  3KK7 A;  1OXT A;  4HSV A;  4XT3 B;  3HG9 A;  3P7J A;  3DHQ A;  4RGT A;  1H9M A;  5CR3 A;  5CV8 A;  5JAV A;  5JEA G;  3L7Z C;  1H9J A;  5EPJ A;  4A93 B;  2DNC A;  3LWE A;  2VB2 X;  3EVQ A;  5I6W A;  3P1H A;  1Z47 A;  1HA5 A;  3VYT A;  3J7A F;  1WD0 A;  4K2L A;  1A6X A;  1K83 B;  1EWH A;  3GV3 A;  3C2P A;  4RGO S;  5JPM C;  2A6E C;  1DON A;  1RTN A;  4H13 C;  1A2T A;  2K03 A;  1KTK A;  5A2Q E;  1W6J A;  1SXT A;  4KKT A;  1WTW A;  1DXM A;  1ENA A;  3ERQ A;  4N9P A;  3GV6 A;  1EIH A;  3I73 A;  3A7A B;  2JA8 B;  1FYC A;  4RCN A;  4OO1 H;  1TY2 A;  3QG1 A;  3S1M B;  2LKV A;  1EEI D;  2RDH A;  4PMW A;  5IOD A;  1Z7T A;  1RKN A;  5D14 A;  2AWN A;  2A74 C;  5C0X G;  4J6H A;  4BBR B;  1U4P A;  1S5F D;  1STB A;  2CHB D;  3M85 A;  3TSS A;  2F0K A;  3SK5 A;  2R92 B;  1PZI D;  4C1N K;  1CZW A;  1BCP C;  1JB3 A;  1ET6 A;  3K5L A;  1GUG A;  1BNZ A;  4DA2 A;  3TZU A;  5IT9 L;  3H91 A;  3TP6 A;  2N55 A;  3U9S A;  1PTO C;  4KI0 A;  2R3Z A;  4IN3 A;  5KND A;  3J7A V;  5E1F A;  2O5I C;  1SMY D;  3D6C A;  3WOE A;  4FXD A;  1BR9 A;  1H9K A;  1M8A A;  3TZD A;  3ERO A;  3HGB A;  1SNC A;  5T1I A;  3MWY W;  2IT1 A;  3H09 A;  3T13 A;  4CBV A;  5D65 A;  2F3W A;  1XTC D;  2XWJ B;  2M00 A;  4S3S A;  1OXV A;  1PZK D;  3H0G B;  1STA A;  4QCL A;  5C4H A;  2E74 C;  2E76 C;  1D2B A;  5IGC A;  4MHE A;  2XRQ D;  3OWE B;  3IAY A;  1AZP A;  4EQO A;  2MP1 A;  2I07 B;  1PRT F;  1DOK A;  4C3I B;  4WJW A;  1AEX A;  1DOM A;  3MXN A;  5KRU A;  2F03 A;  5IT9 E;  2DY7 A;  5J39 A;  2QKI C;  4WRD A;  2F0M A;  2WAQ B;  3KBG A;  2TMP A;  2X69 A;  1J8I A;  3D31 A;  5K36 G;  4KKU A;  1D5X C;  1V8Q A;  5DAU A;  4BY1 B;  1HPC A;  4X3U A;  5DM7 3;  1AN8 A;  3K59 A;  2VXW A;  4KKS A;  4QIW B;  1U9R A;  1PFM A;  3HOU B;  1DZ1 A;  2E75 C;  3I91 A;  4ULL A;  2EY5 A;  1E2Z A;  2B2Y C;  2RDF A;  5HGT A;  4DNR B;  2EYO A;  2HCC A;  2NYZ D;  3VA5 A;  1ENC A;  2PCF B;  3NTH A;  2K5D A;  1JR0 D;  3HOZ B;  3L3O C;  2LY7 A;  2N88 A;  4ID6 A;  2F0L A;  3DWQ A;  4QMG A;  1SYE A;  3URY A;  1ZKO A;  3PMF A;  1TII D;  3S17 B;  4P2C B;  5CV9 A;  2K5W A;  4DXF A;  4OO1 I;  3OMC A;  3NHH A;  2FHT A;  4NP5 A;  4K6L A;  3HOW B;  3MVV A;  2LMC B;  4A3M B;  4CJ2 C;  3BVG A;  3PUY A;  2Z8L A;  5C44 B;  5IGE A;  3SEB A;  1TS2 A;  5C4J B;  2Q8T A;  5FO7 B;  2A6H C;  1S5B D;  1TWH B;  3D4R A;  4ME5 A;  1TVX A;  2K32 A;  3SR1 A;  4HCS A;  1YNN D;  2NZ1 D;  2KEE A;  1I50 B;  1PTO D;  4KN4 C;  1L0Y B;  3J80 E;  2JSO A;  1PTO H;  2V4D A;  1T5X D;  2C5C A;  5KIX A;  3NPP A;  5JVH 3;  5JEA J;  5K5P A;  4A3D B;  2F0U A;  4BWG B;  1PRT B;  3ND9 A;  3IKJ A;  2E2D C;  3T56 B;  3MA2 B;  2EYM A;  1DD2 A;  1BO0 A;  2O4X A;  2A68 C;  4XYQ A;  4DAP A;  1EZ8 A;  2RSN A;  1WTV A;  4K5W A;  1EY9 A;  2L5T A;  2A73 B;  4YIJ A;  1ZXT A;  2PW7 A;  4UDU C;  3DUZ A;  4K8J A;  2B39 A;  2IX3 A;  4DK1 A;  3J7Y W;  1A15 A;  4L8J A;  2BA0 A;  3KLR A;  1VF7 A;  3K58 A;  1VDZ A;  1IYV A;  5E4W C;  5ELF A;  1SNM A;  3X3M A;  1O7L A;  3T53 B;  1XX8 A;  4EQN A;  2EY2 A;  3E5S A;  5KYI A;  1SND A;  3RD4 A;  4R8N A;  2WII B;  1LO5 D;  5COR A;  2KA7 A;  3NWT A;  1G8Z D;  1SNQ A;  2F1M A;  4FF4 A;  3SK6 A;  4IUP A;  1SJE D;  1ET9 A;  1SBB B;  4FO2 A;  2OT2 A;  5FKA C;  4ZYS A;  2A68 D;  2J7Z A;  4LJZ C;  4JK1 C;  1SEB D;  1AFP A;  2H1E A;  3I72 A;  1LTG D;  1M4V A;  1GXD C;  3MFY A;  3DWP A;  4MN3 A;  2JYO A;  1IYU A;  5M5X B;  1YNJ C;  4DGZ A;  2F0N A;  5I2X A;  5C3X A;  3HEJ A;  2E2J B;  1MD2 D;  2M2L A;  4HCE A;  3GTL B;  1ILQ A;  2EYP A;  1RJT A;  1GOZ A;  1JOQ A;  4ZRZ A;  2QCP X;  4O42 A;  5EPL A;  1I4P A;  5CV6 A;  3V05 A;  1WTX A;  5EJW A;  1ROD A;  3HKZ B;  1ESR A;  1K8M A;  1Y8P B;  2EYL A;  4XT1 B;  5DM6 3;  3R2I A;  3PUW A;  1CFM A;  3VR6 A;  2KHS A;  2F0E A;  4J8Q A;  4F8M A;  4E6I A;  3HZX A;  4TQU S;  1G91 A;  3BVM A;  4RHS A;  1TS3 A;  3BZD B;  2NUC A;  4ODG A;  1YNJ D;  3S2D B;  1KNA A;  2L12 A;  4XIG S;  1F2Y A;  4KD4 A;  4C3H G;  4I65 A;  2DY8 A;  2EYH A;  2D2C C;  4OGQ C;  2ENB A;  1EEF D;  1OXS C;  3C1F A;  2J4X A;  2A6H D;  1LT3 D;  2RDG A;  4CKB A;  1B1Z A;  3PUV A;  3GTP B;  1U4R A;  1JWU D;  4CKC A;  4RWS C;  4RFB A;  5DNF A;  3MAQ A;  3L9A X;  2R61 A;  4XYO A;  4IUT A;  1LTI D;  3H94 A;  1PDQ A;  1VMP A;  1MSG A;  1EU4 A;  1GUS A;  1GUW A;  4TRD A;  5EBD A;  1G29 1;  1PXU A;  2F0D A;  1LT4 D;  1QG7 A;  4HTH A;  1HTL D;  1HQM C;  1BUV T;  1EIG A;  3N6R A;  1FGB D;  3HRZ C;  2TSS A;  3MZ5 A;  1UAP A;  1BCP D;  1B4O A;  1S5C D;  3E6Z X;  2NN6 I;  4L63 B;  1EL0 A;  5M3F B;  1OO9 B;  3S1R B;  4IFD H;  3NQI A;  2EOT A;  3A8I E;  1GUO A;  3LX0 A;  3H6M A;  4Y7N B;  3ND8 A;  2K33 A;  5EPK A;  1Q8I A;  3OIQ A;  3OPO A;  1TWC B;  1TWA B;  1SE2 A;  2R93 B;  1WTR A;  2EY6 A;  2WAC A;  1F9R A;  2JA7 B;  1EY0 A;  3X3N A;  1MGS A;  2RA4 A;  3F2U A;  1SJH D;  1B9N A;  4I7Z C;  3NXW A;  2K28 A;  1TU2 B;  2F0S A;  1QOH A;  4FXK C;  1WD1 A;  5FO8 B;  1GHJ A;  1IKL A;  1C48 A;  2X6G A;  3BDC A;  3K7A B;  2C9O A;  2G9D A;  2AQ3 B;  4ZLT F;  5BN3 A;  2PZT A;  3G6J B;  2EY1 A;  5M5W B;  3SHL A;  2MGS A;  1S5D D;  1D1I A;  1EU3 A;  3BVZ A;  2A69 D;  1V43 A;  1B50 A;  4RGM A;  4UAI A;  3I70 A;  3A8J E;  5AFW A;  4KK7 A;  1TY0 A;  4RH6 A;  4O1N A;  1Q12 A;  3Q23 A;  1GUT A;  4IUQ A;  3FPU B;  1HCZ A;  1F9S A;  1H9S A;  2I46 A;  4OIK A;  3P75 A;  4NKL A;  4M8A A;  2XSC A;  4IFD I;  2DNE A;  5EKI A;  3S1N B;  4ZKC B;  3GTM B;  4XXE A;  4XQQ A;  2RQX A;  4K6D A;  4V0B A;  4NW2 A;  1EOT A;  4K14 A;  2B2W A;  1E2V A;  3GTO B;  3O13 A;  4J1M A;  4HMJ A;  5ELE A;  2PYK A;  1QB5 D;  1ONL A;  1SE4 A;  5TSS A;  2L4N A;  4DF7 A;  1DCZ A;  3RZD B;  5IIF A;  4HSP A;  4U67 3;  4PMB A;  2XVS A;  1RDP D;  4DU9 A;  1L0X B;  1VMC A;  1NR4 A;  1EY4 A;  1PRT C;  2ID0 A;  4IZ8 A;  1RTO A;  1B3A A;  1SMY C;  1G2S A;  2D5D A;  3S1Q B;  5NUC A;  4KJO A;  1EYC A;  3K5M A;  1A3T A;  1D1K A;  5LHY 1;  3SDZ A;  3GTG B;  4KHZ A;  4A3B B;  3KLS X;  5D3I B;  1VF5 C;  3TBI B;  2IPK D;  3NUC A;  3J81 E;  1TWF B;  1CTM A;  1X3Q A;  2MHV A;  2RVL A;  3EFX D;  4KMU C;  4KV6 A;  1JE4 A;  1I4R A;  5FLX L;  3OOC A;  1JWM D;  3HOX B;  2F0J A;  2FIN B;  2R7Z B;  1BCP B;  2HCI A;  3E0J A;  4CJ1 B;  1U4M A;  2GA4 B;  5IGB A;  1EWC A;  3BDO A;  4KTA A;  1HFN A;  3I3C A;  2ICE C;  2MJ8 A;  4FNF A;  1TR5 A;  1KNE A;  4FYD A;  4BS9 A;  3P20 A;  1IW7 C;  4DN4 M;  2EDG A;  1HUM A;  3CRL C;  1UNS A;  4C3J G;  3R2T A;  1TS4 A;  1LT5 D;  1HTP A;  3GP7 A;  5C5L A;  3PV0 A;  1JQY D;  4QUF A;  4ZKB B;  2F0G A;  1SDF A;  4CJ0 B;  5IGG A;  1I4H A;  5EGT A;  4IUN A;  3OMG A;  1LTB D;  1QE6 A;  1RHP A;  1ESF A;  5CYU A;  2EYJ A;  1IW7 D;  1A3V A;  3DXJ C;  3M4O B;  3IL8 A;  5M9O A;  4XQJ A;  1F2Z A;  3SK8 A;  4IAL A;  3H3V C;  3VYU A;  3J81 L;  4CGY B;  2VUM B;  3OWF A;  4ZQ3 A;  3FMC A;  4RGN A;  2LS0 1;  5ISR A;  4BA2 I;  1PLF A;  2EE1 A;  1QNU A;  4X3T A;  1WTQ A;  1EY7 A;  3LNN A;  2FJ2 A;  3I4N B;  1E0B A;  4JBW A;  4C1N I;  2XRS D;  2XNA C;  4PQX A;  1NCV A;  3AB9 A;  3LWU A;  2Z1C A;  3QO2 A;  3SXH A;  5F2D A;  1KLU D;  1E2W A;  1KAA A;  1FD7 D;  3CU7 A;  4FF2 A;  1ZYR D;  4PNY A;  4KHV A;  1LLR D;  2IWH A;  2MPM A;  1EY8 A;  1IL8 A;  1WTO A;  1NSN S;  1WTP A;  3IFT A;  4KN7 C;  1R4P B;  1FNW A;  2F0P A;  4B08 A;  2WB1 B;  2KQ3 A;  4QF4 A;  2B2T C;  2F0T A;  2F0W A;  1J9O A;  4Q0F A;  2JEB I;  1EY5 A;  3TME A;  5FO9 B;  2M9V A;  1SYB A;  2H4O A;  2IJ0 A;  3R93 A;  5I9P A;  1FNV A;  2BE5 D;  4C56 C;  5KYL A;  1A3U A;  1BQQ T;  4ZAI A;  2F0F A;  3QB3 A;  3D8G A;  5M3M B;  2CVR A;  3D4D A;  2WIN B;  4N9T A;  4IUR A;  4RA8 A;  3IFD A;  1QCB D;  2L1B A;  3W2D A;  1RD9 D;  1SYD A;  2Q8R E;  5EBC A;  5BN5 A;  2JA6 B;  1STH A;  1XWE A;  5JVG 3;  2KJX A;  2PMZ B;  5KNC A;  1PTO F;  4QB4 A;  4HN7 A;  1R4Q B;  4IQZ A;  1EQV A;  1XYI A;  4V19 0;  3DMU A;  2FFK B;  4NDX A;  5LL6 X;  2CQA A;  2K5Q A;  2JE6 I;  3I90 A;  2EZV A;  2OEO A;  1FNU A;  5ELC A;  4KD3 A;  5A35 A;  4FXG C;  1DYQ A;  1WCM B;  3MXU A;  2F0O A;  3MFG A;  3NK9 A;  3T16 A;  4G7O C;  5EKK A;  3MXG A;  1LV9 A;  4X3K A;  5C4X B;  1CI3 M;  3G7L A;  3Q6S A;  4X3S A;  2IW3 A;  2JA5 B;  1JWS D;  2KOL A;  4HMI A;  2KED A;  3Q0A A;  3GD7 A;  2RBM A;  3SK4 A;  2NWG A;  1CM9 A;  4DXG A;  1EFI D;  1ENF A;  2E2I B;  3HS0 C;  1SNO A;  4XDX A;  5JPN C;  3NP8 A;  2A5H A;  3K5O A;  3TP8 A;  2AQ1 B;  4LK1 C;  1AZQ A;  5C6A A;  2YU9 B;  4M1U B;  1NAP A;  4C3J B;  4DAV A;  3KLS A;  4DK0 A;  2SEB D;  3GTQ B;  1B9M A;  4H0L C;  3K57 A;  3BYT B;  2MUY A;  3VR3 A;  1SYG A;  1CHP D;  4R8I A;  5KGU A;  3Q22 A;  1FR3 A;  2AUJ D;  1GUN A;  1EYA A;  4K8I A;  3NE5 B;  2BCO A;  4H7B A;  4DNT B;  1UEA B;  3HOY B;  3A54 A;  4FF3 A;  3WOF A;  1KDA A;  4FP5 D;  1R9T B;  3OIP A;  3C3L A;  3S14 B;  2A69 C;  1I4G A;  1DM0 B;  1UUP A;  1Q90 A;  5JJZ A;  1GHK A;  4BY7 B;  2VB3 X;  1Q1B A;  2NN6 H;  4L6T B;  3T51 B;  4C3I G;  1KDB A;  2WKC A;  4K5V A;  3A8K E;  4HR7 B;  3SVM A;  2L55 A;  5CV7 A;  2BDO A;  1ZYR C;  1I6V C;  3D4W A;  2WV6 D;  1X32 A;  4B9W A;  3AMU A;  1WVL A;  1JCK B;  1BBX C;  2SNS A;  3M4Y A;  1SFO B;  3OSO A;  5LL6 S;  1F2L A;  5T1G A;  1F9P A;  5CGK A;  5C0X I;  1G2T A;  3MHB A;  1CQF A;  4NMZ A;  2JEA I;  1F9Q A;  1NR2 A;  5G3L D;  3A56 A;  1Y8O B;  2K01 A;  3FEW X;  3K6O A;  4LMQ D;  2HUG A;  4IUV A;  2B2U C;  2KEC A;  3A7L A;  2WP8 J;  3V2T A;  3EA6 A;  1U4L A;  1PFB A;  2OXP A;  1SYC A;  3RMH A;  4RKL A;  3CRK C;  1I6H B;  4PV1 C;  4WOR A;  3JAM E;  5I6Y A;  2EYF A;  1KLG D;  1LT6 D;  5FOB B;  3PO3 B;  2QEJ C;  2EXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...