5EPKA

Crystal structure of chromodomain of cbx2 in complex with inhibitor unc3866
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords Chromobox protein homolog 2
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5epkA00
2L4NA 1X3QA 5CBEE 1JICA 4QUCA 1ZXTA 3DEOA 1WD0A 4MHEA 5EPKA 1SDFA 3TN2A 2X6LA 4ZLTF 1B4OA 2NYZD 3GV3A 4NW2A 4LMQD 2FFKB 1QNKA 1IKLA 2B2UA 2HCCA 2Q8RE 3SVMA 5E4XA 4QUFA 2L11A 4O42A 4XT3B 5EPLA 3P7JA 2B2TA 1U4LA 5CORA 1CA6A 3I91A 2B2VA 3MTSA 1EL0A 1MGSA 4U68A 1PDQA 1X32A 2VXWA 5DNFA 3GV6A 2BDNA 1G91A 3QO2A 1QE6A 2KEDA 1DOMA 5EQ0A 3KUPA 5CBAE 2HDLA 1F9SA 5EKIA 1PFBA 1DOKA 1AZQA 3MWYW 4RWSC 3R93A 4ZAIA 2R3ZA 2NZ1D 5T1GA 1TVXA 2B2UC 1BBXC 1VMPA 1CM9A 1EIHA 1F9PA 4CJ1B 1A15A 1WTRA 2B2TC 1WTQA 1DZ1A 1DOLA 1ILPA 1U4MA 2B2VC 2NWGA 3FDTA 1B2TA 2HCIA 1C8CA 1KNAA 3I90A 3IL8A 1NCVA 1WTPA 1ILQA 3HP3A 2MGSA 2IL8A 3LWEA 1M8AA 1MI2A 4ZKCB 2DY8A 2HUGA 2K03A 4HAEA 2CVRA 2B2YA 2L12A 2B2WA 3DM1A 1GUWA 1O7YA 1U4RA 1SSOA 1G2TA 4IURA 5T1IA 4XT1B 3IFDA 1X3PA 2HDMA 1PFNA 4RAUC 3TZDA 1HA6A 1ICWA 2K1BA 1LV9A 2KECA 4IUPA 1RTOA 3I3CA 4OIKA 2FJ2A 2FINB 5D14A 2KEEA 1XYIA 5AFWA 5EJWA 1O80A 2M2LA 1DONA 1HFNA 2EOTA 1XX8A 3Q6SA 3F2UA 2JP1A 1HFGA 4X3SA 1Q3LA 4MN3A 5EPJA 1U4PA 2B2YC 2MPMA 1WTOA 2B2WC 1WTVA 5COYA 2XIWA 2KUMA 2K28A 2RSNA 4CJ0B 2L1BA 1BF4A 1O7ZA 1BO0A 1B50A 1EQTA 1ML0D 3D6WA 1MSHA 1RJTA 1G6ZA 1EIGA 2EE1A 1RTNA 2EPBA 4R8IA 1CA5A 2X6GA 2N88A 1NAPA 4HSVA 1EOTA 1QG7A 2H1EA 3DEPA 1WVLA 2MJ8A 2Q8TA 5CMDA 1AZPA 2K05A 1NR4A 1E0BA 1SAPA 2DY7A 4HEDA 4HCSA 2KVMA 3G7LA 1HRJA 2RA4A 2RVLA 1WD1A 1S4ZA 1G2SA 2RSOA 4IUUA 1PLFA 1PFMA 1J8IA 4X3UA 1NR2A 1B53A 2X69A 1F9RA 1VMCA 5D65A 4OIJA 4ZK9B 4IUTA 1BNZA 4UAIA 1WTWA 2KOLA 1HUMA 5E4WC 3UI2A 1RODA 1JE4A 1MSGA 1RHPA 2K04A 1F9QA 2FHTA 1KNEA 1HUNA 4DN4M 4X3KA 3H91A 1WTXA 4IUQA 1IL8A 4CJ2C 2L9HA 1J9OA 4X3TA 2JYOA 2SDFA 4ZKBB 1AP0A 1B3AA 3KBXA 3ONAB 5JJZA 1ESRA 1HHVA 4XDXA 4IUVA 2MP1A 4R9WA 2J7ZA 2N55A 2K01A 3N52A 4RA8A 3I8ZA 3FPUB 2FMMA 1IKMA 1F2LA 2D9UA
chains in the Genus database with same CATH superfamily
4LUVA 4M1UB 5ELCA 1EWIA 1I50B 3T53B 3HOUB 2PCFB 5FO8B 1SE4A 3ERQA 3TBIB 2F0EA 5L37A 1EYGA 1JB3A 2ZXPA 3RN2A 4FO2A 1EQRA 4BXXG 1T5XD 1JR0D 1U4LA 1MGSA 2VUMB 4LJZC 3NHHA 3CXCA 1G91A 3A7AB 3SK8A 1E22A 5C0XJ 5M5XB 2K32A 1FNWA 1AZQA 2F0OA 4RWSC 4ZAIA 2CFMA 3H09A 1CM9A 4BY7H 1C7YA 3P1HA 1STBA 2K14A 3DMUA 4C3HB 5FOBB 3HOZG 2A68D 1VQHA 3FP9A 4O1NA 2LXJA 1XMQQ 1D5ZC 1A3VA 1TWCB 1H9RA 3JAME 3BZDB 4A3EG 1J5EQ 3GO5A 4JK1C 1HTLD 2HHHQ 2SNMA 2CHBD 4FDBA 3CRKC 4IUPA 3J81L 1EY7A 2G9HD 1GUGA 1PTOH 4LF5L 1NSNS 1K9MC 4BWGB 4CBVA 1U4PA 4A3CG 4GKKL 1OXVA 2K28A 3HOXB 2PYKA 5DLQE 5LMNW 4QQBX 4IFDH 1XPUA 3CMAA 3CPFA 2QEJC 2Z0SA 1AZPA 2MJ8A 1QILA 3RD4A 3UDFA 2DY7A 1U9RA 4HCEA 1GUTA 1G2SA 1FJGQ 2R7DA 2ASBA 1I4GA 2R92G 2GVAA 2WAQE 4LFAQ 3I56A 3RZOB 5D65A 4OIJA 2M00A 5LHY1 2Z4IA 1IL8A 4GKJL 1K0RA 1VQCA 2JA5G 5CV4A 1WCMB 2VS1A 4JW0A 5CV8A 5C4HA 5IWAQ 3A55A 2D9UA 3FRPB 3UDGA 1U0LA 3PUWA 3Q8DA 4UY8C 1CT1D 1F2MA 4YY3Q 4MHEA 4IFDJ 1BBUA 1STGA 2UUCQ 1OTCA 4KHVA 3FMCA 3SK4A 4DV3L 2OCEA 3K5OA 5C44G 4DAVA 2BH8A 3MFGA 4TSSA 2H5XA 5IYCH 4UP7A 1I50H 3HOUH 4GZYC 3S16B 4B3MQ 4JYAQ 4L63B 5CBAE 1YNND 3CP0A 4BBRB 1PFBA 4QIWB 3R93A 4OO1H 5T1GA 3KJOA 1VMPA 1DYQA 1Y1VG 1CKNB 4K6DA 1K8AC 2VUMH 1TWFB 4K6LA 3H94A 1PMRA 2C35B 3M4PA 1IBKQ 1ILQA 5M5XH 5IOCA 2XGTA 2EIFA 4GLVB 2L12A 2B2WA 4IJHA 1G2TA 1SSOA 3MEFA 5IYDG 3QIAA 5C4ZA 2FMCA 4RMFA 4RKLA 3CMEA 4DR1L 1BCPF 1N9WA 4C3HH 3I4OA 4JG2A 2ZTEA 1S72A 2F0WA 3NELA 1VF5C 1XNRL 1O80A 1S40A 5JPNC 4AQYL 1S5DD 1SXTA 1TWCH 2D2CC 1WJJA 4NXNL 5M5YB 5I9OA 4KKUA 1I4HA 1STNA 2B2YC 3S1MB 3WWVA 2ZT9C 4CJ0B 3J81i 4AYBG 3PO3B 1JOQA 1KC8C 1D5XC 2X6GA 5IGFA 5C4JB 5M3FH 5DEHA 2YU9B 4R4QA 1PH9A 3KLRA 1ZKOA 2KVMA 4JI8Q 2VB2X 1PYBA 1HRJA 2RVLA 3EVQA 3MAQA 2E8GA 2IHFA 1A6XA 3HOXH 3P75A 3W5OA 1Q1BA 3SR1A 3KF8A 4DPGA 1YHAA 4A3JB 3W1BA 3G71A 2NN6H 4L5QA 2A1AA 2L9HA 4JC0A 3CRLC 1PH1A 1Y1WB 1X3FA 2I5HA 1D2BA 4K5XA 1LUZA 1JQYD 2E74C 2CWAA 3B6YA 4A3DH 2UXCL 1GVPA 2MP1A 4YHHQ 3GP7A 4MTKA 2N55A 2KHIA 5C3WA 2Q8IB 1WD0A 2QF7A 1NBWA 1QVGA 2AQ3B 5NUCA 4XTCS 3VA5A 3GTMH 4ZLTF 2A69C 1R9TB 3BS1A 2HCCA 4CDFC 5H1SE 4O42A 1WCMH 2B2TA 3CHBD 4AIMA 3GTPB 4U68A 3GTLB 3TRZA 4QIWE 1Q12A 3ERSX 4XQJA 1FL0A 1P16A 3G48A 3KYHC 3GTGB 4YCVA 1PRTC 3VR4A 1JJCB 3PV0A 2B39A 4IZ8A 2R3ZA 3SGIA 5IT9L 1E7ZA 5IGBA 1LYLA 1YJ9A 2UUAQ 4IO9A 1EIHA 2AKWB 1PA6A 5C3EH 2A69D 1EY8A 1TU2B 4DK0A 1WTQA 4H44C 2B2VC 2BA1A 2IL8A 2M9VA 3S17B 4KLKA 2K03A 4BBRH 1C4QA 4LW1A 2N78A 4FP5D 1I3QB 3GD7A 3QOJA 1GUWA 2CH4W 1UNSA 3MZ5A 1TR5A 5TSSA 2UXBL 3TP8A 1SROA 1HTPA 3IFDA 2NVQH 1A63A 5ISRA 1I4RA 4RGOS 1TWFH 1VF7A 3OYYA 3H0GH 4LF4L 1BVSA 1V1QA 1D8LA 4Q0FA 3M4YA 5GROA 2UUBQ 3DUZA 4JVZA 5G3LF 3K7AB 4PMBA 2F52A 1E1OA 1EZ6A 1UEBA 5KYLA 1NMGA 3RN5A 4A3KB 2RSNA 1VQOA 2QA4A 2CQAA 2IWHA 4L5RC 1G6ZA 1CA5A 3AB9A 3TS2A 4LFCL 2F3WA 4C1NK 1G8ZD 3S1MH 1S4ZA 3MXNA 2Q2IA 1NR2A 5FLXc 3AEVA 3PO3H 4A93G 1CQFA 2YU9H 1JC7A 1I94Q 3ULLA 4DXGA 1EQQA 3V2TA 1J9OA 4I7ZC 2Q2UA 1PRTB 4NB3A 1TS5A 1JMCA 5JVG3 2VL6A 4P74A 1EQVA 4OX9L 2I46A 2KENA 2F0GA 5EAYA 1X3QA 3KFUA 3F2DA 2WIIB 1BUVT 3PUVA 1Y1WH 2ZM6L 4JI1Q 2Z6BA 1OXXK 2B2UA 2Z6KC 5E4XA 1QJOA 2ICIA 1KIXA 4WJWA 5CORA 3EN2A 1VDZA 4DR4Q 2JN4A 3QR8A 2ICEC 4EQNA 1YITA 4L5SA 1MJCA 3R3OA 3L0OA 1F9SA 1R9TH 3MXGA 4BY7G 1KAWA 5C5LA 1BCPC 3I55A 1LACA 4Z9CB 1BBXC 2B8FA 2ZTCA 5C3XA 5JEAH 3GTPH 5CV7A 5DM63 4KHPL 2CW0D 1C8CA 1KNAA 4C2MB 1X9NA 3NE5B 1PZJD 2BH2A 2L0CA 2PZTA 2BA0A 3E3XA 3BVMA 1GJXA 1AFPA 4RCNA 3FKIB 4UP9A 2JP1A 3E9HA 2KHSA 2R7ZH 1EU3A 3HKZB 1I3QH 1XWEA 1PH2A 1WTOA 4JI4L 4JI3Q 4BA1I 1CSPA 3HOYH 3M7GA 1QCBD 2K5HA 3NQTA 5HGQA 1XMQL 4KD3A 4XIGS 2N8NA 3H15A 3EBEA 4DV0Q 5KNCA 1YVCA 3DEPA 1CHPD 2Q8TA 1J5EL 4RH6A 4X62Q 3CU7A 3K7AH 4IPCA 5HGTA 2O4XA 2K5WA 2HHHL 4FF2A 2JA6B 5C5MA 1VQLA 3VYUA 5DAUA 4A3KH 1J8IA 2UXDQ 2XTIA 3HEJA 2KCNA 2C9OA 1HNXQ 3PO2B 5J22A 1PZKD 1EY9A 4P71A 4PNYA 1N36L 5I2XA 4JV5Q 4JI5Q 3V96A 2E75C 1N34L 1VQEA 3I4MB 2MQHA 2P5ZX 3T1HQ 1N33L 2R93B 2YTVA 2WAQG 2I5MX 1F2LA 1ZYRC 1JICA 2A6EC 1UUPA 1TWHB 3TS0A 1IL2A 3ULJA 2F4VL 3TN2A 4Q5VA 2AQ1B 4RGNA 4NW2A 4LFAL 1H9KA 3J81E 4H02A 2WV6D 5EPLA 2N3SA 1FGUA 4WORA 2PNRC 3MXUA 3ER0A 1HR0Q 5LL6X 2R61A 3UDIA 4DAMA 3J7AF 2K52A 1WI5A 1FVIA 5EQ0A 4DK6C 2PMZE 2RQXA 3GTOB 1DJRD 2KQ3A 4YWLA 2PI2E 1EYDA 1NJIC 4ZUIA 1B2TA 3WDNA 4DV1Q 5E1FA 4L5TA 2JA7B 2EYJA 2RF4A 1TKWB 3BDOA 1CUKA 3PF5A 4NKLA 3D0FA 4KY6A 4FXGC 1PH7A 4K14A 3TZDA 4HIMA 1D5MC 3JAMc 3S2HH 5HY6A 1ENCA 4C2MH 1ET6A 2XWJB 4DV2Q 4QCLA 1SE3A 1EY0A 4B08A 2E2DC 3RR5A 3S1NH 4EQPA 5M3FG 1ONLA 1VQFA 4JI7Q 1UE6A 3NENA 4N9TA 3J80L 4F87A 5D3DA 2F0JA 2L5TA 2I5LX 5M9OA 4L6TB 2EYLA 4R4IA 4P72A 2PQAA 1KLUD 1L1OA 1SMYC 3LWUA 4RG1A 1HA5A 4IUTA 2OTLA 2NN6G 4XQQA 4N9PA 4BBSG 3AMUA 1RODA 1RHPA 2F0MA 3GTQB 1AW7A 4KMUC 4HJ8A 1ICFB 2F4IA 5A35A 4A3DG 1W2BA 4EQOA 5ELNA 3KBXA 2EJGC 3SK5A 1I4PA 3T16A 5C6AA 1EWCA 5FJ8G 5LMUL 4A3IG 2F0LA 2J7ZA 2XWBB 3PO2H 2LXKA 4DR5L 1EU4A 3I72A 2EQSA 2EXDA 2Z8LA 4LK1C 4NXMQ 2DUDA 3NTHA 1GXDC 2AQ2B 3CCEA 1VQAA 2RHQB 3I4MH 4HIDA 2R93H 2IT1A 4LF6L 1V1OA 1PZID 4KKTA 1TWHH 3UDXA 4BY1H 3RMHA 5C3EG 4GOPB 1E2VA 4ODGA 2K6AA 4UPAA 1F9PA 3TP5A 3EFXD 2F1MA 4ZRZA 5M5WB 1MJEA 5IIFA 1D7QA 1HZAA 1N8RC 1JJ2A 1LABA 3GTOH 1U4RA 2UU9L 1NMFA 1IW7C 1LT3D 1EEFD 5T1IA 1EWHA 1QUQB 2OEOA 2WB1B 3H0GG 1FNUA 1PYSB 2YV5A 4A3BG 1RTOA 3C46A 4OIKA 2FJ2A 2FINB 4DV7Q 1IXRA 1EY5A 1PHJA 4X6AH 5IGEA 4F7XA 2JA7H 1DONA 4F8MA 2RBMA 2V1CC 1JJGA 2MO1A 4LFBQ 2F0TA 4LNQA 1PH3A 5KYIA 5IGGA 2D0OA 1WFQA 4B3RL 4A3MB 1ML0D 4G7ZC 2G5DA 4R8NA 3U58A 2Y0SE 3K7UC 4A3LH 1A2UA 2K05A 1E0BA 1RL2A 4JPBW 1WD1A 1TWGB 1SFOH 3J80i 3KOJA 1BNZA 4UAIA 1FYCA 1WTWA 2DN8A 5IT9E 2AHOB 1MHWC 3EROA 4DR3L 2E5LL 3CCUA 1K28A 1ESRA 1KTKA 3NQIA 1IYJB 2QDLA 3A8IE 3CCJA 3A8KE 4HJ5A 4J15A 1VQMA 2JEAI 4N8FA 3M3YB 4A76A 2EJFC 1M4VA 2L1BA 1K83B 3GTJB 4RHSA 1TS4A 4A3GG 2K4KA 3T1YQ 1CHQD 2E2IB 4TQUS 5BR8Q 1JWMD 2Q8RE 1E2ZA 3H3VI 4ZUJA 5AJ3Q 1OXTA 2O5IC 1EL0A 4HR7B 1PDQA 3BVGA 2B63B 3H6MA 1JCKB 2BDNA 1MD2D 3VR3A 3D4WA 5C4XG 1I4QA 2K75A 5JEAG 1FR3A 1QB5D 1BOSA 4CJ1B 4AH6A 3BZCA 4CDDC 1QNUA 2JA8H 4C3JB 3HP3A 4L8JA 1D1KA 1LT5D 2WB1E 4TRDA 3KLSX 4C3IB 3PUXA 3CCLA 2EYFA 4ZQ3A 1C0AA 4KHZA 4OWXB 3M4OB 2NUCA 1X3PA 3I4NB 3ND8A 1SMXA 1HA6A 2VQEQ 4IALA 2R7ZG 1V43A 3LNNA 3D4DA 3HOYG 1FGBD 1HFGA 3HFZB 4LUZA 1EOVA 2B2WC 4PG3A 4F88A 4A3FB 1VS0A 2V4DA 3UE0A 3PMFA 4YWMA 1SNDA 4DUZL 1MSHA 1RJTA 3MC0B 4R8IA 1EFWA 1QZHA 2E76C 2K5DA 4PV1C 5IGDA 1G6PA 5KRUA 4I65A 1CSQA 4JI0L 2B8GA 3G7LA 4LF9L 4IUUA 2VNUD 1PXUA 3OWEB 2OWOA 4A3MH 4K0KQ 1I4XA 5CC4A 1RKNA 2EDGA 3D4RA 2I0QA 1MSGA 3NBIA 1L0WA 2YYZA 2OF1A 3H91A 3E0EA 4Y52H 1VQ6A 4X65Q 1LTBD 1L2FA 1TWGH 1HCZA 5JJZA 5M3MG 3HOZB 1SYDA 3HOVB 4DV6L 2QILA 3K5MA 5IP7G 3FPPA 2IW3A 3HG9A 3C1FA 3I8ZA 5I2YA 1IBLQ 4FF1A 3MEHA 3OTOQ 3F2BA 4A3EB 3VR2A 2AWNA 2X6LA 3NBHB 2NYZD 3J7A5 4IPDA 2WKCA 4WFN3 1H9SA 1HNXL 5LMNQ 2L11A 2IY5B 5EBDA 3ITPA 2KBNA 3I91A 1JB7A 3MTSA 1R4PB 3GTJH 1K83H 3D8GA 3PF4A 1GHJA 1E2WA 3OMCA 2XNAC 3QO2A 2KEDA 1M90C 3KUPA 3DXJC 1X6OA 3CCSA 1XMOL 1DOKA 3RZOH 2EVBA 3NXWA 4DV5Q 5K36G 4B3SQ 4X64Q 2F03A 3V05A 1Y8NB 2IX0A 1CZWA 4DR6L 2B2TC 5C0XI 3CCRA 2HCIA 2ZXOA 1WTPA 1QVFA 2RDHA 4GLXA 2EY2A 4O0AA 1NUCA 2K7VA 2DY8A 3OIQA 4HAEA 4JI2Q 1XNQL 2R92B 3OMGA 4X66Q 4DV4Q 3S14B 1JORA 1Q81C 1W6JA 4XT1B 3K81C 3FVQA 2VZAA 4J6HA 5FKAC 2FXQA 4A75A 5ELBA 4XYOA 4LF7L 1LTSD 1V1PA 1WYDA 4IPHA 3SHLA 3CW2C 1L0YB 1VQIA 3PIP3 1E1TA 4NDXA 3DM3A 2JJQA 4UDUC 2JA5B 3K58A 1SLJA 2LMCB 2F0PA 3X3NA 2O2LD 3PIO3 5EPJA 2R7FA 1N32L 4YCUA 1HNZL 3M4OH 3S16H 1B44D 2EYHA 1KDAA 1PTOF 1AN8A 2BE5C 4CKCA 3ZJYC 4QGUA 1S5ED 1WVLA 1PRTD 1Q82C 1SNMA 3K0XA 1VCIA 4RHRA 2RA4A 1HZ9A 4PMCA 5C44B 1F2YA 4JBJA 4X3UA 4IQZA 4FXKC 4IJLA 4JCVE 1SYEA 3D3RA 1YNJC 4B3TL 2K33A 4FF3A 4GN4B 4BS9A 1Y69U 4LF8L 2CQOA 4X3KA 3DWQA 2BE5D 3J81j 4X3TA 4DR2L 1XTDA 1K8GA 3FHWA 4DF7A 2OQKA 4ME3A 4RA8A 3J7ZC 1JWSD 2KCCA 5M5YH 5C0XG 2OQ0A 3KDFB 4QUCA 4DGZA 3SEBA 4DR7L 4K8JA 4G4KA 3I4MG 4GKKQ 2R93G 1A3TA 2RDGA 4GNXA 3K0YA 4H7BA 2EY1A 1Y8PB 2CWPA 5C4JH 1PH6A 3HOVH 2F0HA 4IFDI 1SR3A 1XTCD 3GV6A 4GLAC 4PZ6A 4BY1G 3J81c 1C9OA 2QCPX 1HNWL 4FNFA 1UE7A 2KCMA 5IE8A 2PI2A 1M1KC 1SYFA 3MWYW 3T51B 1HJPA 1KRTA 4AYBB 3M9BA 1NTGA 2B2UC 2B3GA 3C1EA 3J80E 4A3JH 3I4LA 4J8QA 4HIKA 1U4MA 1Y14B 4GKJQ 1Q8IA 4A3CH 1EIYB 5BN3A 1K0SA 5ELDA 3DM1A 2A6HC 3HS0C 1C48A 2LS01 4IURA 4HMIA 3PUZA 1I6VC 1LV9A 4RGMA 2KEEA 3OWFA 2ZXRA 2M2LA 3OSOA 1VQNA 3I7FA 3CCQA 1B70B 2IHEA 2R92H 1I5FA 1Q3LA 3KF6B 2EZVA 3GTLH 3S14H 2MPMA 4HMJA 5I4DA 1CTMA 1GUOA 3GTGH 1XPOA 4EVOA 1GD7A 2RHSB 4IOCA 3GQBA 3NTKA 1B9MA 2AUKA 4HSVA 1NAPA 1EOTA 2K5NA 4KN4C 5JPMC 1QOHA 2E2JB 3F1ZA 2DNCA 3CC4A 1SNPA 1BCPD 3BDCA 1NNXA 1IBMQ 1IHZA 5A2QL 4OO1I 3S17H 4P75A 4YWKA 1SN8A 2J0TD 3U4VA 1LTRD 4G57A 3UI2A 4DAYA 1H9JA 4IFDG 4R4CA 2KCTA 1CKOA 2Y0SG 4ZYSA 1TS2A 1SNQA 3J7AV 3A0JA 4LAAA 5C44H 4DR1Q 3KLSA 5JJLA 4ID6A 1GKHA 2CH4A 2XRSD 3S9WA 4RCOA 1XNRQ 1HPCA 4FYDA 1Z7TA 4AQYQ 4NXNQ 2F0NA 3TZUA 5I9PA 1HH2P 3PQIA 1IZ6A 2NTTA 1Q86C 3SVMA 1T9HA 3TSSA 2L55A 3E5SA 3TDQA 3VYSA 2KHJA 1PH8A 1X3EA 5FLMH 3KBGA 3VR6A 1LTAD 1BCPB 1B9NA 5IYDH 4YCWA 5CV6A 3OHXC 1YIJA 4KK7A 4PZ8A 2JA8G 1YHBA 1FD7D 1X55A 3T1YL 1FJGL 1ILPA 1STEA 1Y8OB 4Y7NB 3IL8A 4APVA 5IYCG 2UXCQ 2NN6I 5AJ3L 1GUSA 3HOUG 1O7YA 1PTOC 3RZDB 2GN5A 4POFA 1CI3M 4OO1G 1SYCA 1ICWA 1II3A 2C5CA 2WACA 5DM73 1ZYRD 2DJGC 1JWUD 2A6ED 5EJWA 1VQ4A 3F2CA 3PGZA 5IWAL 2VUMG 1EEID 2I07B 3BVZA 3T56B 1K8OA 4IN3A 2WB1G 1W3SA 4MIUA 4YY3L 1NY4A 3T4AC 4POGA 2UUCL 1NE3A 1YEZA 2Z1CA 3NWSA 4JOIA 1PH5A 4DUYQ 1J6QA 2EPBA 3K5NA 1KQSA 3S2DB 4C3HG 3BU2A 2ES2A 1B1ZA 1NR4A 3A74A 4HCSA 2WFWA 4B3ML 3MXPA 4JYAL 3HKZE 3W1GA 3A5ZB 1LT4D 3CC7A 2KOLA 5G3LD 4R4TA 1EYCA 3BZKA 1VQKA 1WTXA 4IUQA 5KNDA 2E2JH 4CJ2C 5GAHC 3URYA 1IBKL 4QJFA 2UXBQ 2JYOA 2NB0A 2PW7A 3QB3A 1AP0A 1TS3A 4KY5A 2KJXA 3STBC 4JI6Q 5IT9c 2O5JC 3FKIH 2CCZA 2K5VA 5FO9B 1L1OC 1KD1C 4LF4Q 1RDPD 2FMMA 3EQLC 3HOXG 4JBWA 3NP8A 2QKIC 4ULLA 1STHA 1B4OA 3JC66 4LMQD 2FFKB 4K0KL 1QNKA 1YJNA 5GQOA 4GOPA 1PV4A 1F2ZA 1YBYA 1PTOB 5GADC 3SXHA 2IX1A 1VQ5A 4LFCQ 2AWOA 4HIOA 1QE6A 2JA6H 2WKDA 3OW7A 1DM0B 4RKBA 4NP5A 4GN5A 2IX3A 1TXYA 5J39A 4OL7A 2YTYA 4FF4A 1OO9B 4C1NI 1YJWA 1SMYD 4JI8L 1UE5A 4H0LC 2R6GA 3D31A 4ALPA 1QUQA 1QWYA 1WCMG 4RGTA 1NCVA 3LWEA 5IGCA 4C56C 3DWPA 3K59A 5LMNL 2D5DA 3LX0A 1A2TA 2N49A 4OX9Q 1JOOA 1YNXA 4KV6A 2NBFA 1ASZA 1CK1A 4HJAA 4KN7C 2Q2HA 4Y7NH 4YHHL 3CAMA 2ZM6Q 2AUJD 3F2UA 3I73A 2F3IA 3VR5A 2ZTDA 2XN9C 4MN3A 5E7NA 5F2DA 2VW9A 2WAQB 3K6OA 5COYA 4XYQA 2MO0A 4BBRG 5IODA 3RZDH 2JXMB 1U5KA 3TMEA 4P2CB 5ELFA 1CQVA 2PQAB 1KHIA 1CKMA 3D6WA 3CCMA 2QDBA 1EIGA 1ENFA 1V8QA 4X66L 3G6EA 3S15B 2K50A 1STAA 1S3OA 1ESFA 2A8VA 1SE2A 1PLFA 3NTIA 1YI2A 4KHPQ 2X69A 1VMCA 2UUAL 4ZK9B 2F0KA 2OT2A 3M85A 2IJ0A 4YIJA 3S2DH 2A68C 3L2PA 2CKZB 5LL6S 5EKKA 4EGVA 3AFQA 1FNVA 4OXPA 2DGYA 1T5EA 4ZKBB 4J1MA 5CYUA 2EYPA 1IW7D 1HHVA 2GA4B 4R9WA 3FPUB 3CF5A 1K73C 1R4QB 5CBEE 1GUNA 1YZ6A 3KJPA 4TKOB 5KEEA 3DEOA 3PO3G 4JI4Q 1Z47A 3GV3A 4KI0A 3HOVG 1JT8A 3L7ZC 2UUBL 4QUFA 5FLXL 1O78A 4G7HC 3K80C 1K3RA 3WOFA 3VA7A 1PRTF 5DNFA 1RD9D 1MBYA 5EGTA 3R2TA 1TT2A 1LLRD 4A3JG 1XJVA 5M3FB 3N6RA 2EY5A 3GTQH 1Y1WG 4QF4A 1DZ1A 3PIPA 4DAPA 1WOCA 3J7YW 1N36Q 1A8VA 4CKEA 3U4ZA 2F0DA 1RF2D 1V9PA 3HOWB 3PIOA 1N34Q 1N33Q 1CKNA 1I94L 4QMGA 1UAPA 4EX5A 3BG3A 1PH4A 2RCNA 5IP9H 4BBSB 2F4VQ 1VQBA 2LKVA 4DKAC 1S5FD 4A3DB 1EFID 1HFNA 2H4OA 2PPBC 3Q6SA 1Q46A 3QG1A 4A3IB 4CGYB 2KUMA 4JI1L 3UE1A 3GTMB 1B50A 5IY0A 2VQFQ 4V190 4PMWA 4DR4L 3BJUA 1DCZA 5CGKA 3BDLA 1YNNC 4HEDA 5M5WH 2OXPA 1EUJA 4I7AA 1LTLA 1GOZA 1JE4A 4KKSA 2XSCA 1IYUA 3S15H 2XRQD 5C3EB 1HUNA 1SNCA 3PSIA 1XPRA 1VQPA 4M8AA 3PCOB 3NBHA 1IYVA 3ONAB 3L3OC 5IYBH 4KD4A 1MIUA 3F8TA 3N52A 3S1QB 4RFBA 5CV9A 4A3KG 3R8BA 2NVQB 5I6WA 1SDFA 2ID0A 1IBML 2PZWA 4B9WA 2PW5A 2NVYB 2AMCB 3H0GB 4OONA 4A3BB 5J3BA 3P7JA 2B29A 1LTTD 5FLMG 4JI3L 2WINB 3AYHB 5KIXA 3RUZA 5KGUA 3ICEA 3E9IA 1DOMA 4DV0L 4ZCKA 2HDLA 5EKIA 3WOEA 3RLNA 2WP8J 1SJHD 1TY2A 4X62L 1PVOA 1DOLA 1D6EC 1O7IA 3FDTA 2JSOA 2UXDL 1TIID 2VB3X 1LTID 1X56A 1Z6HA 3J80c 1KXLA 1LT6D 1M8AA 1SJED 5A2QE 2HUGA 2B2YA 2RDFA 3P20A 3M3YH 3S24A 1TQOA 2D62A 2DNEA 5LMUQ 4JV5L 4JI5L 4DR5Q 5JOBA 5BN4A 4OEMB 2E2IH 4K5VA 4RAUC 3GTKB 1A3UA 3T1HL 3K5LA 3M4QA 3ULPA 4S3SA 3HOWH 4P73A 3G4SA 5JAVA 4X3SA 1WTVA 2B63H 4LF6Q 2XIWA 3AFPA 4WJ3M 4JBKA 1HZBA 4BBSH 4A3GB 1O7ZA 3LGJA 3TP7A 1BR9A 1CFMA 1O7LA 4IPGA 2EE1A 1HR0L 1VQ8A 1Q90A 3H3VC 3CPWA 5FJ8H 1W6KA 3EJIA 4A3IH 4HJ9A 2RSOA 4C3JH 5JVH3 3DLLA 4N8X1 3JAML 1UE1A 4C3IH 1BQQT 4A4IA 5C4XB 1KRSA 1VQGA 1OXUA 2DJFC 3KDFA 4KTAA 4DN4M 4ABNA 2UU9Q 5EKLA 5GAGC 4DV1L 3I4NH 3HGBA 3FKIG 5ELEA 3U50C 3OW2A 1B3AA 2G9DA 4DUYL 4ILWA 3HKZG 4IUVA 4KJOA 1H9SB 3KF8B 1WTHA 1BXTA 1EIFA 4H13C 5E4WC 3A5UA 2E2HB 4HN7A 4U673 1SEBD 2RCFA 5JJKA 1BKBA 4A3FH 2XVSA 1B7YB 5FO7B 1E24A 1KDBA 4B3RQ 1IKLA 1P8LA 2Z9HA 4DV2L 4XT3B 5EBCA 1KABA 1CA6A 1BBWA 2JA6G 2NVXB 2B2VA 2R7ZB 2SOBA 3S1QH 4DU9A 4BXXH 1X32A 2VXWA 4DNRB 1Y1VB 3TQYA 3HOYB 4OELB 4CDEC 3PO2G 4JI7L 1CZGA 5GAEC 3RNUA 1ENAA 4JI6L 4ME5A 3C2PA 2NVYH 1SRUA 1TVXA 4E6IA 3R2IA 4LF5Q 4GNXC 4A3BH 3MFYA 1A15A 4PZ7A 1YNJD 1LTGD 3HRZC 3S1RB 3MHBA 5ELOA 3DHQA 1G291 4DR3Q 2E5LQ 1V1PB 3CCVA 5E3FA 3MA2B 3OPOA 4ZKCB 1LO5D 3Q23A 3HOZH 2MHVA 4R4OA 4DXFA 2PQEA 1L0XB 3KF6A 5I6YA 2TSSA 4A3EH 2F0IA 5BN5A 3I3CA 4K2LA 4UP8A 1AEXA 1PYWD 1ZEQX 3U9OA 1XYIA 1STYA 3A7LA 1XX8A 2MNAA 3NPPA 2BDOA 5M3MB 3VDYA 4NXML 1UEAB 2BOSA 2BCOA 2QW7A 4KY7A 2F3VA 1BF4A 2PZUA 1I6HB 1BO0A 3IAYA 3GTKH 1HR0W 1B8AA 3X3MA 3CQZB 4MTNA 1SBBB 1RTNA 2N88A 2JQOA 5J1ZA 1QG7A 2NVTB 2ZJQA 4K8IA 2L15A 5CMDA 1TWAB 1QZGA 3D6CA 2KA7A 4K2KA 2TMPA 4JBMA 3SDZA 2K5QA 2JA7G 4BA2I 3AQQA 4DFAA 4A3GH 1B53A 1F9RA 4DV3Q 2JK8A 2Z4HA 1HZCA 2CW0C 1RCVD 1F9QA 1HQRD 3TREA 2QEXA 1X54A 2F0QA 1K8MA 3U9SA 4FXDA 2JA9A 2SDFA 3MXNB 1AH9A 2A6HD 2Z6KA 3NUCA 4A3LG 4HJ7A 3JAMi 3QWNA 1DXMA 4XDXA 5CR3A 2JA5H 4GNXB 2VY3A 5CV5A 1OXSC 3MVVA 1VQ9A 4NPSA 1H95A 5C4XH 1X3GA 2PMZB 1DD2A 4DV7L 1S5CD 4NMZA 3S2HB 3A8JE 3BYTB 1GO3E 4DUZQ 2GVBA 4LFBL 1PFSA 3I70A 2YTXA 2PO4A 2NZHA 1TY0A 4V0BA 4HSPA 2NZOA 2E2HH 2HIXA 1S5BD 3A56A 2HT1A 3VYRA 3S1NB 4EQ5A 4JI0Q 1Z9FA 4LF9Q 1UWVA 4MNOA 1MKHA 3OOCA 3G6JB 4KJNA 2NZ1D 2MFIA 4WRDA 1A62A 2F0VA 2ZJRA 1WTRA 1JOKA 4XQNA 1YHQA 2NVXH 1ET9A 1SYGA 1Y1VH 2JE6I 2ATWA 3W2DA 4TVAB 4OHJA 1MI2A 1GHKA 4CDCC 2CVRA 5IP9G 4K5WA 4DV6Q 5HURA 4B9XA 4CKBA 5JEAJ 3NK9A 1G51A 4AYBE 1PFNA 2JEBI 4CHTB 3AU7A 3S1RH 2ZJPA 3IKJA 5AFWA 3RLOA 2EOTA 4XXEA 2SNSA 4DK3C 3H3VH 3QOLA 2MUYA 2F0SA 4HTHA 4MZ9A 5BR8L 3C3LA 3T13A 3L9AX 2PNHA 2A73B 5D3IB 1E3PA 1EQTA 2A19A 3CKIB 3CC2A 4QB4A 1XMOQ 3NEMA 2A74C 3TP6A 5FLXE 4A93B 4DAYB 1HQMC 1VQDA 2EJMA 4QY7A 5M3MH 2NTSA 5IP7H 1KDCA 1DGSA 4DR6Q 3HZXA 1EY6A 3GDEA 4BY1B 1I6HH 2ENBA 1EY4A 2F0FA 1KAAA 5KNBA 2Q2TA 1KL9A 3CQZH 4JOIC 1HUMA 3OIPA 2QGQA 3I2ZA 2NVTH 2FHTA 3ZYYX 4UHVA 3E6ZX 1HXYD 1XNQQ 1TWAH 2LSSA 2EY6A 5IYBG 2OTJA 1PTOD 3FEWX 3NWTA 4LF7Q 2VQFL 2HIVA 1VQJA 5FK9C 2A5HA 3TEHB 2HD3A 2HQLA 4IOAA 1IKMA 3CD6A 2L4NA 3QJYA 4A3MG 1GM5A 5K36H 3O13A 1ZXTA 4DK1A 1Q8KA 5EPKA 2VQEL 1JE5A 1N32Q 3E0JA 1HNZQ 2D0PA 1SYBA 1A0IA 2J4XA 1AE2A 2RKSA 4BY7B 1RIPA 4FVMA 3Q24A 1K3BC 3BYYB 2EYMA 3NSWA 4O2DA 2F0UA 2LY7A 1Q7YC 4OGQC 3RLFA 1Q1EA 2SEBD 4GOPC 4B3TQ 4WJ4A 4DNTB 4LF8Q 2NWGA 3I90A 1SFOB 3PUYA 3M7NA 2EYOA 2MGSA 4DR2Q 1LM0A 3ND9A 1ASYA 3A54A 1SNOA 3STBD 5K5PA 4G7OC 3VYTA 2EXZA 4X65L 3KLWA 2HDMA 3Q0AA 4LWCA 3HKSA 2K1BA 2KECA 2Y0SB 2IPKD 3HOWG 4DR7Q 5D14A 1EYAA 3W3AA 1IBLL 1SE8A 2B63G 2LFNA 3IFTA 3OTOL 4R1JA 1D1IA 5JJIA 1F77A 3KK7A 1KLGD 1HNWQ 1B3QA 4QL5A 2ALYB 2H1EA 4DA2A 1AE3A 1X65A 1BDOA 4C3JG 1SAPA 1XXGA 4C3IG 3Q22A 5C0XH 4DV5L 1PFMA 4IUNA 4B3SL 4X64L 4DNIA 4OWTB 3DWAA 4LUOA 2HQEA 3I4NG 3SE0A 2K04A 4GS3A 1KNEA 4GN3B 4OWWB 4A93H 1VQ7A 1H9MA 1EZ8A 2JA8B 1L1OB 3EIVA 4JI2L 3SK6A 3K57A 4DV4L 3EA6A 3IRBA 2K01A 1QVCA 4PQXA 4A3FG 3K8AA
chains in the Genus database with same CATH topology
4M1UB 5ELCA 1I50B 3T53B 3HOUB 2PCFB 5FO8B 1SE4A 3ERQA 3TBIB 2F0EA 1JB3A 2ZXPA 4FO2A 1T5XD 1JR0D 1U4LA 1MGSA 2VUMB 4LJZC 3NHHA 1G91A 3A7AB 3SK8A 5C0XJ 5M5XB 2K32A 1FNWA 1AZQA 2F0OA 4RWSC 4ZAIA 3H09A 1CM9A 3P1HA 1STBA 3DMUA 4C3HB 5FOBB 2A68D 4O1NA 1D5ZC 1A3VA 1TWCB 1H9RA 3JAME 3BZDB 3GO5A 4JK1C 1HTLD 2SNMA 2CHBD 3CRKC 4IUPA 3J81L 1EY7A 2G9HD 1GUGA 1PTOH 1NSNS 4BWGB 4CBVA 1U4PA 1OXVA 2K28A 3HOXB 2PYKA 4IFDH 2QEJC 1AZPA 2MJ8A 1QILA 3RD4A 2DY7A 1U9RA 4HCEA 1GUTA 1G2SA 1I4GA 3RZOB 5D65A 4OIJA 2M00A 5LHY1 2Z4IA 1IL8A 5CV4A 1WCMB 5CV8A 5C4HA 3A55A 2D9UA 3FRPB 3PUWA 1CT1D 1F2MA 4MHEA 4IFDJ 1STGA 4KHVA 3FMCA 3SK4A 3K5OA 4DAVA 3MFGA 4TSSA 4GZYC 3S16B 4L63B 5CBAE 1YNND 4BBRB 1PFBA 4QIWB 3R93A 4OO1H 5T1GA 1VMPA 1DYQA 4K6DA 1TWFB 4K6LA 3H94A 1PMRA 1ILQA 5IOCA 2L12A 2B2WA 1G2TA 1SSOA 3QIAA 5C4ZA 2FMCA 4RKLA 1BCPF 2F0WA 1VF5C 1O80A 5JPNC 1S5DD 1SXTA 2D2CC 5M5YB 5I9OA 4KKUA 1I4HA 1STNA 2B2YC 3S1MB 2ZT9C 4CJ0B 3PO3B 1JOQA 1D5XC 2X6GA 5IGFA 5C4JB 2YU9B 5DEHA 3KLRA 1ZKOA 2KVMA 1HRJA 2VB2X 2RVLA 3EVQA 3MAQA 1A6XA 3P75A 1Q1BA 3SR1A 3KF8A 4A3JB 2NN6H 2L9HA 3CRLC 1Y1WB 1D2BA 4K5XA 1JQYD 2E74C 2MP1A 3GP7A 2N55A 5C3WA 2Q8IB 1WD0A 2QF7A 2AQ3B 5NUCA 4XTCS 3VA5A 4ZLTF 2A69C 1R9TB 3BS1A 2HCCA 4O42A 2B2TA 3CHBD 3GTPB 4U68A 3GTLB 1Q12A 4XQJA 3GTGB 1PRTC 3VR4A 3PV0A 2B39A 4IZ8A 2R3ZA 5IT9L 5IGBA 1EIHA 2A69D 1EY8A 1TU2B 4DK0A 1WTQA 4H44C 2B2VC 2BA1A 2IL8A 2M9VA 3S17B 2K03A 1C4QA 4FP5D 1I3QB 3GD7A 3QOJA 1GUWA 1UNSA 3MZ5A 1TR5A 5TSSA 3TP8A 3IFDA 1HTPA 5ISRA 1I4RA 4RGOS 1VF7A 4Q0FA 3M4YA 3DUZA 5G3LF 3K7AB 4PMBA 1EZ6A 5KYLA 4A3KB 2RSNA 2CQAA 2IWHA 1G6ZA 1CA5A 3AB9A 2F3WA 4C1NK 1G8ZD 1S4ZA 3MXNA 1NR2A 1CQFA 1JC7A 4DXGA 3V2TA 1J9OA 4I7ZC 1PRTB 1TS5A 5JVG3 1EQVA 2I46A 2F0GA 1X3QA 2WIIB 1BUVT 3PUVA 1OXXK 2B2UA 5E4XA 1QJOA 2ICIA 4WJWA 5CORA 1VDZA 2ICEC 4EQNA 3R3OA 1F9SA 3MXGA 5C5LA 1BCPC 1LACA 4Z9CB 1BBXC 2B8FA 5C3XA 5JEAH 5CV7A 5DM63 2CW0D 1C8CA 1KNAA 4C2MB 3NE5B 1PZJD 2L0CA 2PZTA 2BA0A 3BVMA 1GJXA 1AFPA 4RCNA 3FKIB 2JP1A 2KHSA 1EU3A 3HKZB 1XWEA 1WTOA 4BA1I 3M7GA 1QCBD 3NQTA 4KD3A 4XIGS 5KNCA 3DEPA 1CHPD 2Q8TA 4RH6A 3CU7A 5HGTA 2O4XA 2K5WA 4FF2A 2JA6B 5C5MA 3VYUA 5DAUA 1J8IA 3HEJA 2KCNA 2C9OA 3PO2B 5J22A 1PZKD 1EY9A 4PNYA 5I2XA 3V96A 2E75C 3I4MB 2R93B 1F2LA 1ZYRC 1JICA 2A6EC 1UUPA 1TWHB 3TN2A 4Q5VA 2AQ1B 4RGNA 4NW2A 1H9KA 3J81E 2WV6D 5EPLA 4WORA 2PNRC 3MXUA 5LL6X 2R61A 3J7AF 5EQ0A 2RQXA 3GTOB 1DJRD 2KQ3A 1EYDA 4ZUIA 1B2TA 3WDNA 5E1FA 2JA7B 2EYJA 1TKWB 3BDOA 4NKLA 4KY6A 4FXGC 4K14A 3TZDA 1D5MC 1ENCA 1ET6A 2XWJB 4QCLA 1SE3A 1EY0A 4B08A 2E2DC 4EQPA 1ONLA 3J80L 4N9TA 4F87A 5D3DA 2F0JA 2L5TA 5M9OA 4L6TB 2EYLA 1KLUD 1SMYC 3LWUA 1HA5A 4IUTA 2NN6G 4XQQA 4N9PA 3AMUA 1RODA 1RHPA 2F0MA 3GTQB 1AW7A 4KMUC 2F4IA 5A35A 4EQOA 3KBXA 2EJGC 3SK5A 1I4PA 3T16A 5C6AA 1EWCA 2F0LA 2J7ZA 2XWBB 1EU4A 3I72A 2Z8LA 4LK1C 3NTHA 1GXDC 2AQ2B 2IT1A 1V1OA 1PZID 4KKTA 3RMHA 1E2VA 4ODGA 2K6AA 1F9PA 3TP5A 3EFXD 2F1MA 4ZRZA 5M5WB 5IIFA 1LABA 1U4RA 1IW7C 1LT3D 1EEFD 5T1IA 1EWHA 2OEOA 2WB1B 1FNUA 1RTOA 3C46A 4OIKA 2FJ2A 2FINB 1EY5A 5IGEA 4F7XA 1DONA 4F8MA 2RBMA 2F0TA 5KYIA 5IGGA 4A3MB 1ML0D 4G7ZC 4R8NA 1A2UA 2K05A 1E0BA 1WD1A 1TWGB 1BNZA 4UAIA 1FYCA 1WTWA 2DN8A 5IT9E 3EROA 1ESRA 1KTKA 3A8IE 3NQIA 2JEAI 3A8KE 3M3YB 2EJFC 1M4VA 2L1BA 1K83B 3GTJB 4RHSA 1TS4A 1CHQD 2E2IB 4TQUS 1JWMD 2Q8RE 1E2ZA 4ZUJA 1OXTA 2O5IC 1EL0A 4HR7B 1PDQA 3BVGA 2B63B 3H6MA 1JCKB 2BDNA 1MD2D 3VR3A 3D4WA 1I4QA 5JEAG 1FR3A 1QB5D 1BOSA 4CJ1B 1QNUA 4C3JB 3HP3A 4L8JA 1D1KA 1LT5D 4TRDA 4C3IB 3KLSX 3PUXA 2EYFA 4ZQ3A 4KHZA 3M4OB 2NUCA 1X3PA 3I4NB 3ND8A 1HA6A 4IALA 1V43A 3LNNA 3D4DA 1FGBD 1HFGA 2B2WC 4F88A 4A3FB 2V4DA 3PMFA 1SNDA 1MSHA 1RJTA 3MC0B 4R8IA 2E76C 2K5DA 4PV1C 5IGDA 5KRUA 4I65A 2B8GA 3G7LA 4IUUA 2VNUD 1PXUA 3OWEB 1I4XA 5CC4A 1RKNA 2EDGA 3D4RA 1MSGA 3NBIA 2YYZA 2OF1A 3H91A 1LTBD 1HCZA 5JJZA 3HOZB 1SYDA 3HOVB 2QILA 3K5MA 3FPPA 2IW3A 3HG9A 3C1FA 3I8ZA 5I2YA 4FF1A 3MEHA 4A3EB 3VR2A 2AWNA 2X6LA 2NYZD 2WKCA 4WFN3 1H9SA 2L11A 5EBDA 3ITPA 3I91A 3MTSA 1R4PB 3D8GA 1GHJA 1E2WA 3OMCA 2XNAC 3QO2A 2KEDA 3KUPA 3DXJC 1DOKA 2EVBA 3NXWA 5K36G 2F03A 3V05A 1Y8NB 2IX0A 1CZWA 2B2TC 5C0XI 2HCIA 2ZXOA 1WTPA 2RDHA 2EY2A 1NUCA 2K7VA 2DY8A 3OIQA 4HAEA 2R92B 3OMGA 3S14B 1JORA 1W6JA 4XT1B 3FVQA 5FKAC 4J6HA 5ELBA 4XYOA 1LTSD 1V1PA 3SHLA 3PIP3 1L0YB 4NDXA 4UDUC 2JA5B 3K58A 2LMCB 2F0PA 3X3NA 2O2LD 3PIO3 5EPJA 1B44D 2EYHA 1KDAA 1PTOF 1AN8A 2BE5C 4CKCA 1S5ED 1WVLA 1PRTD 1SNMA 1VCIA 4RHRA 2RA4A 5C44B 4PMCA 1F2YA 4X3UA 4IQZA 4FXKC 1SYEA 3D3RA 1YNJC 2K33A 4FF3A 4BS9A 1Y69U 4X3KA 3DWQA 2BE5D 4X3TA 4DF7A 4RA8A 1JWSD 2KCCA 5C0XG 4QUCA 4DGZA 3SEBA 4K8JA 4G4KA 1A3TA 2RDGA 3K0YA 4H7BA 2EY1A 1Y8PB 2F0HA 4IFDI 1XTCD 3GV6A 2QCPX 4FNFA 1SYFA 3MWYW 3T51B 4AYBB 3J80E 3C1EA 2B2UC 3I4LA 4J8QA 1U4MA 1Q8IA 5BN3A 5ELDA 3DM1A 2A6HC 3HS0C 1C48A 2LS01 4IURA 4HMIA 3PUZA 1I6VC 1LV9A 4RGMA 2KEEA 3OWFA 2ZXRA 2M2LA 3OSOA 1Q3LA 2EZVA 2MPMA 4HMJA 5I4DA 1CTMA 1GUOA 4EVOA 3GQBA 3NTKA 1B9MA 2AUKA 4HSVA 1NAPA 1EOTA 4KN4C 5JPMC 1QOHA 2E2JB 2DNCA 1SNPA 1BCPD 3BDCA 1IHZA 5A2QL 4OO1I 2J0TD 1LTRD 4G57A 3UI2A 4DAYA 1H9JA 4IFDG 4ZYSA 1TS2A 1SNQA 3J7AV 4LAAA 3KLSA 4ID6A 2XRSD 3S9WA 4RCOA 1HPCA 4FYDA 1Z7TA 2F0NA 3TZUA 5I9PA 2NTTA 3SVMA 3TSSA 2L55A 3E5SA 3TDQA 3VYSA 3KBGA 3VR6A 1LTAD 1BCPB 1B9NA 5CV6A 3OHXC 4KK7A 1FD7D 1ILPA 1STEA 1Y8OB 4Y7NB 3IL8A 2NN6I 1GUSA 1O7YA 1PTOC 3RZDB 1CI3M 4OO1G 1SYCA 1ICWA 1II3A 2C5CA 2WACA 5DM73 1ZYRD 1JWUD 2A6ED 5EJWA 1EEID 2I07B 3BVZA 3T56B 1K8OA 4IN3A 4MIUA 3T4AC 2Z1CA 3NWSA 2EPBA 3K5NA 3S2DB 4C3HG 1B1ZA 1NR4A 4HCSA 3MXPA 1LT4D 2KOLA 5G3LD 1EYCA 1WTXA 4IUQA 5KNDA 4CJ2C 3URYA 2JYOA 2NB0A 2PW7A 3QB3A 1AP0A 1TS3A 4KY5A 2KJXA 2O5JC 5FO9B 1RDPD 2FMMA 3EQLC 4JBWA 3NP8A 2QKIC 4ULLA 1STHA 1B4OA 4LMQD 2FFKB 1QNKA 1F2ZA 1PTOB 3SXHA 2IX1A 2AWOA 1QE6A 2WKDA 3OW7A 1DM0B 4RKBA 4NP5A 2IX3A 5J39A 4OL7A 4FF4A 1OO9B 4C1NI 1SMYD 4H0LC 2R6GA 3D31A 1QWYA 4RGTA 1NCVA 3LWEA 5IGCA 4C56C 3DWPA 3K59A 2D5DA 3LX0A 1A2TA 1JOOA 4KV6A 2NBFA 1CK1A 4KN7C 2AUJD 3F2UA 3I73A 3VR5A 2XN9C 4MN3A 5F2DA 2WAQB 3K6OA 5COYA 4XYQA 5IODA 2JXMB 3TMEA 4P2CB 5ELFA 1CQVA 3D6WA 2QDBA 1EIGA 1ENFA 1V8QA 3S15B 1STAA 1ESFA 1SE2A 1PLFA 3NTIA 2X69A 1VMCA 4ZK9B 2F0KA 2OT2A 3M85A 2IJ0A 4YIJA 2A68C 5LL6S 5EKKA 4EGVA 1FNVA 1T5EA 4ZKBB 4J1MA 5CYUA 2EYPA 1IW7D 1HHVA 2GA4B 4R9WA 3FPUB 1R4QB 5CBEE 1GUNA 4TKOB 5KEEA 3DEOA 1Z47A 3GV3A 4KI0A 3L7ZC 4QUFA 5FLXL 1O78A 4G7HC 3WOFA 3VA7A 1PRTF 5DNFA 1RD9D 1MBYA 5EGTA 3R2TA 1TT2A 1LLRD 5M3FB 3N6RA 2EY5A 4QF4A 1DZ1A 4DAPA 3J7YW 4CKEA 2F0DA 1RF2D 3HOWB 4QMGA 1UAPA 3BG3A 4BBSB 2LKVA 1S5FD 4A3DB 1EFID 1HFNA 2H4OA 2PPBC 3Q6SA 3QG1A 4A3IB 4CGYB 2KUMA 3GTMB 1B50A 4V190 4PMWA 1DCZA 5CGKA 3BDLA 1YNNC 4HEDA 2OXPA 1GOZA 1JE4A 4KKSA 2XSCA 1IYUA 2XRQD 5C3EB 1HUNA 1SNCA 4M8AA 3NBHA 1IYVA 3ONAB 3L3OC 4KD4A 3N52A 3S1QB 5CV9A 4RFBA 3R8BA 2NVQB 5I6WA 1SDFA 2ID0A 2PZWA 4B9WA 2PW5A 2NVYB 3H0GB 4A3BB 3P7JA 1LTTD 2WINB 5KIXA 3RUZA 5KGUA 1DOMA 2HDLA 5EKIA 3WOEA 2WP8J 1SJHD 1TY2A 1DOLA 1D6EC 3FDTA 2JSOA 1TIID 2VB3X 1LTID 1Z6HA 1LT6D 1M8AA 1SJED 5A2QE 2HUGA 2B2YA 2RDFA 3P20A 1TQOA 2D62A 2DNEA 5JOBA 5BN4A 4K5VA 4RAUC 3GTKB 1A3UA 3K5LA 4S3SA 5JAVA 4X3SA 1WTVA 2XIWA 4A3GB 1O7ZA 3TP7A 1BR9A 1CFMA 1O7LA 2EE1A 1Q90A 3H3VC 1W6KA 3EJIA 2RSOA 5JVH3 3JAML 1BQQT 5C4XB 1OXUA 4DN4M 4KTAA 4ABNA 5EKLA 3HGBA 5ELEA 1B3AA 2G9DA 4ILWA 4IUVA 4KJOA 1H9SB 1BXTA 4H13C 5E4WC 2E2HB 4HN7A 4U673 1SEBD 2XVSA 5FO7B 1KDBA 1IKLA 4XT3B 5EBCA 1KABA 1CA6A 2NVXB 2B2VA 2R7ZB 2SOBA 4DU9A 1X32A 2VXWA 4DNRB 1Y1VB 3HOYB 1CZGA 1ENAA 4ME5A 3C2PA 1TVXA 4E6IA 3R2IA 3MFYA 1A15A 1YNJD 1LTGD 3HRZC 3S1RB 3MHBA 3DHQA 1G291 1V1PB 5E3FA 3MA2B 3OPOA 4ZKCB 1LO5D 3Q23A 2MHVA 4DXFA 2PQEA 1L0XB 5I6YA 2TSSA 2F0IA 5BN5A 3I3CA 4K2LA 1XYIA 1AEXA 1PYWD 1ZEQX 3U9OA 1STYA 3A7LA 1XX8A 3NPPA 2BDOA 5M3MB 1UEAB 2BOSA 2BCOA 4KY7A 2F3VA 1BF4A 2PZUA 1I6HB 1BO0A 3IAYA 3X3MA 3CQZB 1SBBB 1RTNA 2N88A 5J1ZA 2NVTB 1QG7A 4K8IA 5CMDA 1TWAB 3D6CA 2KA7A 4K2KA 2TMPA 3SDZA 2K5QA 4BA2I 4DFAA 1B53A 1F9RA 2Z4HA 2CW0C 1RCVD 1F9QA 1HQRD 2F0QA 1K8MA 3U9SA 4FXDA 2SDFA 2A6HD 3NUCA 3QWNA 1DXMA 4XDXA 5CR3A 5CV5A 1OXSC 3MVVA 2PMZB 1DD2A 1S5CD 4NMZA 3S2HB 3A8JE 3BYTB 3I70A 2PO4A 1TY0A 4V0BA 4HSPA 1S5BD 3A56A 3VYRA 3S1NB 3OOCA 3G6JB 4KJNA 2NZ1D 4WRDA 2F0VA 1WTRA 1JOKA 4XQNA 1ET9A 1SYGA 2JE6I 3W2DA 4OHJA 1MI2A 1GHKA 2CVRA 4K5WA 5HURA 4B9XA 4CKBA 5JEAJ 3NK9A 1PFNA 2JEBI 4CHTB 3AU7A 3IKJA 5AFWA 2EOTA 4XXEA 2SNSA 3QOLA 2MUYA 2F0SA 4HTHA 3C3LA 3T13A 3L9AX 2A73B 5D3IB 1EQTA 3CKIB 4QB4A 2A74C 3TP6A 5FLXE 4A93B 1HQMC 2EJMA 2NTSA 1KDCA 3HZXA 1EY6A 4BY1B 2ENBA 1EY4A 2F0FA 1KAAA 5KNBA 1HUMA 3OIPA 2FHTA 3ZYYX 3E6ZX 1HXYD 2EY6A 1PTOD 3FEWX 3NWTA 5FK9C 2A5HA 1IKMA 2L4NA 3QJYA 5K36H 3O13A 1ZXTA 4DK1A 5EPKA 3E0JA 1SYBA 2J4XA 2RKSA 4BY7B 4FVMA 3Q24A 3BYYB 2EYMA 3NSWA 2F0UA 2LY7A 4OGQC 3RLFA 1Q1EA 2SEBD 4DNTB 2NWGA 3I90A 1SFOB 3PUYA 3M7NA 2EYOA 2MGSA 3ND9A 3A54A 1SNOA 5K5PA 4G7OC 3VYTA 2EXZA 2HDMA 3Q0AA 2K1BA 2KECA 2Y0SB 2IPKD 5D14A 1EYAA 3W3AA 2LFNA 3IFTA 1D1IA 1F77A 3KK7A 1KLGD 2H1EA 4DA2A 1BDOA 4C3JG 1SAPA 1XXGA 4C3IG 3Q22A 5C0XH 1PFMA 4IUNA 3DWAA 2HQEA 3SE0A 2K04A 1KNEA 1H9MA 1EZ8A 2JA8B 3SK6A 3K57A 3EA6A 2K01A 4PQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4N A;  1X3Q A;  5CBE E;  1JIC A;  4QUC A;  1ZXT A;  3DEO A;  1WD0 A;  4MHE A;  5EPK A;  1SDF A;  3TN2 A;  2X6L A;  4ZLT F;  1B4O A;  2NYZ D;  3GV3 A;  4NW2 A;  4LMQ D;  2FFK B;  1QNK A;  1IKL A;  2B2U A;  2HCC A;  2Q8R E;  3SVM A;  5E4X A;  4QUF A;  2L11 A;  4O42 A;  4XT3 B;  5EPL A;  3P7J A;  2B2T A;  1U4L A;  5COR A;  1CA6 A;  3I91 A;  2B2V A;  3MTS A;  1EL0 A;  1MGS A;  4U68 A;  1PDQ A;  1X32 A;  2VXW A;  5DNF A;  3GV6 A;  2BDN A;  1G91 A;  3QO2 A;  1QE6 A;  2KED A;  1DOM A;  5EQ0 A;  3KUP A;  5CBA E;  2HDL A;  1F9S A;  5EKI A;  1PFB A;  1DOK A;  1AZQ A;  3MWY W;  4RWS C;  3R93 A;  4ZAI A;  2R3Z A;  2NZ1 D;  5T1G A;  1TVX A;  2B2U C;  1BBX C;  1VMP A;  1CM9 A;  1EIH A;  1F9P A;  4CJ1 B;  1A15 A;  1WTR A;  2B2T C;  1WTQ A;  1DZ1 A;  1DOL A;  1ILP A;  1U4M A;  2B2V C;  2NWG A;  3FDT A;  1B2T A;  2HCI A;  1C8C A;  1KNA A;  3I90 A;  3IL8 A;  1NCV A;  1WTP A;  1ILQ A;  3HP3 A;  2MGS A;  2IL8 A;  3LWE A;  1M8A A;  1MI2 A;  4ZKC B;  2DY8 A;  2HUG A;  2K03 A;  4HAE A;  2CVR A;  2B2Y A;  2L12 A;  2B2W A;  3DM1 A;  1GUW A;  1O7Y A;  1U4R A;  1SSO A;  1G2T A;  4IUR A;  5T1I A;  4XT1 B;  3IFD A;  1X3P A;  2HDM A;  1PFN A;  4RAU C;  3TZD A;  1HA6 A;  1ICW A;  2K1B A;  1LV9 A;  2KEC A;  4IUP A;  1RTO A;  3I3C A;  4OIK A;  2FJ2 A;  2FIN B;  5D14 A;  2KEE A;  1XYI A;  5AFW A;  5EJW A;  1O80 A;  2M2L A;  1DON A;  1HFN A;  2EOT A;  1XX8 A;  3Q6S A;  3F2U A;  2JP1 A;  1HFG A;  4X3S A;  1Q3L A;  4MN3 A;  5EPJ A;  1U4P A;  2B2Y C;  2MPM A;  1WTO A;  2B2W C;  1WTV A;  5COY A;  2XIW A;  2KUM A;  2K28 A;  2RSN A;  4CJ0 B;  2L1B A;  1BF4 A;  1O7Z A;  1BO0 A;  1B50 A;  1EQT A;  1ML0 D;  3D6W A;  1MSH A;  1RJT A;  1G6Z A;  1EIG A;  2EE1 A;  1RTN A;  2EPB A;  4R8I A;  1CA5 A;  2X6G A;  2N88 A;  1NAP A;  4HSV A;  1EOT A;  1QG7 A;  2H1E A;  3DEP A;  1WVL A;  2MJ8 A;  2Q8T A;  5CMD A;  1AZP A;  2K05 A;  1NR4 A;  1E0B A;  1SAP A;  2DY7 A;  4HED A;  4HCS A;  2KVM A;  3G7L A;  1HRJ A;  2RA4 A;  2RVL A;  1WD1 A;  1S4Z A;  1G2S A;  2RSO A;  4IUU A;  1PLF A;  1PFM A;  1J8I A;  4X3U A;  1NR2 A;  1B53 A;  2X69 A;  1F9R A;  1VMC A;  5D65 A;  4OIJ A;  4ZK9 B;  4IUT A;  1BNZ A;  4UAI A;  1WTW A;  2KOL A;  1HUM A;  5E4W C;  3UI2 A;  1ROD A;  1JE4 A;  1MSG A;  1RHP A;  2K04 A;  1F9Q A;  2FHT A;  1KNE A;  1HUN A;  4DN4 M;  4X3K A;  3H91 A;  1WTX A;  4IUQ A;  1IL8 A;  4CJ2 C;  2L9H A;  1J9O A;  4X3T A;  2JYO A;  2SDF A;  4ZKB B;  1AP0 A;  1B3A A;  3KBX A;  3ONA B;  5JJZ A;  1ESR A;  1HHV A;  4XDX A;  4IUV A;  2MP1 A;  4R9W A;  2J7Z A;  2N55 A;  2K01 A;  3N52 A;  4RA8 A;  3I8Z A;  3FPU B;  2FMM A;  1IKM A;  1F2L A;  2D9U A; 
#chains in the Genus database with same CATH topology
 4LUV A;  4M1U B;  5ELC A;  1EWI A;  1I50 B;  3T53 B;  3HOU B;  2PCF B;  5FO8 B;  1SE4 A;  3ERQ A;  3TBI B;  2F0E A;  5L37 A;  1EYG A;  1JB3 A;  2ZXP A;  3RN2 A;  4FO2 A;  1EQR A;  4BXX G;  1T5X D;  1JR0 D;  1U4L A;  1MGS A;  2VUM B;  4LJZ C;  3NHH A;  3CXC A;  1G91 A;  3A7A B;  3SK8 A;  1E22 A;  5C0X J;  5M5X B;  2K32 A;  1FNW A;  1AZQ A;  2F0O A;  4RWS C;  4ZAI A;  2CFM A;  3H09 A;  1CM9 A;  4BY7 H;  1C7Y A;  3P1H A;  1STB A;  2K14 A;  3DMU A;  4C3H B;  5FOB B;  3HOZ G;  2A68 D;  1VQH A;  3FP9 A;  4O1N A;  2LXJ A;  1XMQ Q;  1D5Z C;  1A3V A;  1TWC B;  1H9R A;  3JAM E;  3BZD B;  4A3E G;  1J5E Q;  3GO5 A;  4JK1 C;  1HTL D;  2HHH Q;  2SNM A;  2CHB D;  4FDB A;  3CRK C;  4IUP A;  3J81 L;  1EY7 A;  2G9H D;  1GUG A;  1PTO H;  4LF5 L;  1NSN S;  1K9M C;  4BWG B;  4CBV A;  1U4P A;  4A3C G;  4GKK L;  1OXV A;  2K28 A;  3HOX B;  2PYK A;  5DLQ E;  5LMN W;  4QQB X;  4IFD H;  1XPU A;  3CMA A;  3CPF A;  2QEJ C;  2Z0S A;  1AZP A;  2MJ8 A;  1QIL A;  3RD4 A;  3UDF A;  2DY7 A;  1U9R A;  4HCE A;  1GUT A;  1G2S A;  1FJG Q;  2R7D A;  2ASB A;  1I4G A;  2R92 G;  2GVA A;  2WAQ E;  4LFA Q;  3I56 A;  3RZO B;  5D65 A;  4OIJ A;  2M00 A;  5LHY 1;  2Z4I A;  1IL8 A;  4GKJ L;  1K0R A;  1VQC A;  2JA5 G;  5CV4 A;  1WCM B;  2VS1 A;  4JW0 A;  5CV8 A;  5C4H A;  5IWA Q;  3A55 A;  2D9U A;  3FRP B;  3UDG A;  1U0L A;  3PUW A;  3Q8D A;  4UY8 C;  1CT1 D;  1F2M A;  4YY3 Q;  4MHE A;  4IFD J;  1BBU A;  1STG A;  2UUC Q;  1OTC A;  4KHV A;  3FMC A;  3SK4 A;  4DV3 L;  2OCE A;  3K5O A;  5C44 G;  4DAV A;  2BH8 A;  3MFG A;  4TSS A;  2H5X A;  5IYC H;  4UP7 A;  1I50 H;  3HOU H;  4GZY C;  3S16 B;  4B3M Q;  4JYA Q;  4L63 B;  5CBA E;  1YNN D;  3CP0 A;  4BBR B;  1PFB A;  4QIW B;  3R93 A;  4OO1 H;  5T1G A;  3KJO A;  1VMP A;  1DYQ A;  1Y1V G;  1CKN B;  4K6D A;  1K8A C;  2VUM H;  1TWF B;  4K6L A;  3H94 A;  1PMR A;  2C35 B;  3M4P A;  1IBK Q;  1ILQ A;  5M5X H;  5IOC A;  2XGT A;  2EIF A;  4GLV B;  2L12 A;  2B2W A;  4IJH A;  1G2T A;  1SSO A;  3MEF A;  5IYD G;  3QIA A;  5C4Z A;  2FMC A;  4RMF A;  4RKL A;  3CME A;  4DR1 L;  1BCP F;  1N9W A;  4C3H H;  3I4O A;  4JG2 A;  2ZTE A;  1S72 A;  2F0W A;  3NEL A;  1VF5 C;  1XNR L;  1O80 A;  1S40 A;  5JPN C;  4AQY L;  1S5D D;  1SXT A;  1TWC H;  2D2C C;  1WJJ A;  4NXN L;  5M5Y B;  5I9O A;  4KKU A;  1I4H A;  1STN A;  2B2Y C;  3S1M B;  3WWV A;  2ZT9 C;  4CJ0 B;  3J81 i;  4AYB G;  3PO3 B;  1JOQ A;  1KC8 C;  1D5X C;  2X6G A;  5IGF A;  5C4J B;  5M3F H;  5DEH A;  2YU9 B;  4R4Q A;  1PH9 A;  3KLR A;  1ZKO A;  2KVM A;  4JI8 Q;  2VB2 X;  1PYB A;  1HRJ A;  2RVL A;  3EVQ A;  3MAQ A;  2E8G A;  2IHF A;  1A6X A;  3HOX H;  3P75 A;  3W5O A;  1Q1B A;  3SR1 A;  3KF8 A;  4DPG A;  1YHA A;  4A3J B;  3W1B A;  3G71 A;  2NN6 H;  4L5Q A;  2A1A A;  2L9H A;  4JC0 A;  3CRL C;  1PH1 A;  1Y1W B;  1X3F A;  2I5H A;  1D2B A;  4K5X A;  1LUZ A;  1JQY D;  2E74 C;  2CWA A;  3B6Y A;  4A3D H;  2UXC L;  1GVP A;  2MP1 A;  4YHH Q;  3GP7 A;  4MTK A;  2N55 A;  2KHI A;  5C3W A;  2Q8I B;  1WD0 A;  2QF7 A;  1NBW A;  1QVG A;  2AQ3 B;  5NUC A;  4XTC S;  3VA5 A;  3GTM H;  4ZLT F;  2A69 C;  1R9T B;  3BS1 A;  2HCC A;  4CDF C;  5H1S E;  4O42 A;  1WCM H;  2B2T A;  3CHB D;  4AIM A;  3GTP B;  4U68 A;  3GTL B;  3TRZ A;  4QIW E;  1Q12 A;  3ERS X;  4XQJ A;  1FL0 A;  1P16 A;  3G48 A;  3KYH C;  3GTG B;  4YCV A;  1PRT C;  3VR4 A;  1JJC B;  3PV0 A;  2B39 A;  4IZ8 A;  2R3Z A;  3SGI A;  5IT9 L;  1E7Z A;  5IGB A;  1LYL A;  1YJ9 A;  2UUA Q;  4IO9 A;  1EIH A;  2AKW B;  1PA6 A;  5C3E H;  2A69 D;  1EY8 A;  1TU2 B;  4DK0 A;  1WTQ A;  4H44 C;  2B2V C;  2BA1 A;  2IL8 A;  2M9V A;  3S17 B;  4KLK A;  2K03 A;  4BBR H;  1C4Q A;  4LW1 A;  2N78 A;  4FP5 D;  1I3Q B;  3GD7 A;  3QOJ A;  1GUW A;  2CH4 W;  1UNS A;  3MZ5 A;  1TR5 A;  5TSS A;  2UXB L;  3TP8 A;  1SRO A;  1HTP A;  3IFD A;  2NVQ H;  1A63 A;  5ISR A;  1I4R A;  4RGO S;  1TWF H;  1VF7 A;  3OYY A;  3H0G H;  4LF4 L;  1BVS A;  1V1Q A;  1D8L A;  4Q0F A;  3M4Y A;  5GRO A;  2UUB Q;  3DUZ A;  4JVZ A;  5G3L F;  3K7A B;  4PMB A;  2F52 A;  1E1O A;  1EZ6 A;  1UEB A;  5KYL A;  1NMG A;  3RN5 A;  4A3K B;  2RSN A;  1VQO A;  2QA4 A;  2CQA A;  2IWH A;  4L5R C;  1G6Z A;  1CA5 A;  3AB9 A;  3TS2 A;  4LFC L;  2F3W A;  4C1N K;  1G8Z D;  3S1M H;  1S4Z A;  3MXN A;  2Q2I A;  1NR2 A;  5FLX c;  3AEV A;  3PO3 H;  4A93 G;  1CQF A;  2YU9 H;  1JC7 A;  1I94 Q;  3ULL A;  4DXG A;  1EQQ A;  3V2T A;  1J9O A;  4I7Z C;  2Q2U A;  1PRT B;  4NB3 A;  1TS5 A;  1JMC A;  5JVG 3;  2VL6 A;  4P74 A;  1EQV A;  4OX9 L;  2I46 A;  2KEN A;  2F0G A;  5EAY A;  1X3Q A;  3KFU A;  3F2D A;  2WII B;  1BUV T;  3PUV A;  1Y1W H;  2ZM6 L;  4JI1 Q;  2Z6B A;  1OXX K;  2B2U A;  2Z6K C;  5E4X A;  1QJO A;  2ICI A;  1KIX A;  4WJW A;  5COR A;  3EN2 A;  1VDZ A;  4DR4 Q;  2JN4 A;  3QR8 A;  2ICE C;  4EQN A;  1YIT A;  4L5S A;  1MJC A;  3R3O A;  3L0O A;  1F9S A;  1R9T H;  3MXG A;  4BY7 G;  1KAW A;  5C5L A;  1BCP C;  3I55 A;  1LAC A;  4Z9C B;  1BBX C;  2B8F A;  2ZTC A;  5C3X A;  5JEA H;  3GTP H;  5CV7 A;  5DM6 3;  4KHP L;  2CW0 D;  1C8C A;  1KNA A;  4C2M B;  1X9N A;  3NE5 B;  1PZJ D;  2BH2 A;  2L0C A;  2PZT A;  2BA0 A;  3E3X A;  3BVM A;  1GJX A;  1AFP A;  4RCN A;  3FKI B;  4UP9 A;  2JP1 A;  3E9H A;  2KHS A;  2R7Z H;  1EU3 A;  3HKZ B;  1I3Q H;  1XWE A;  1PH2 A;  1WTO A;  4JI4 L;  4JI3 Q;  4BA1 I;  1CSP A;  3HOY H;  3M7G A;  1QCB D;  2K5H A;  3NQT A;  5HGQ A;  1XMQ L;  4KD3 A;  4XIG S;  2N8N A;  3H15 A;  3EBE A;  4DV0 Q;  5KNC A;  1YVC A;  3DEP A;  1CHP D;  2Q8T A;  1J5E L;  4RH6 A;  4X62 Q;  3CU7 A;  3K7A H;  4IPC A;  5HGT A;  2O4X A;  2K5W A;  2HHH L;  4FF2 A;  2JA6 B;  5C5M A;  1VQL A;  3VYU A;  5DAU A;  4A3K H;  1J8I A;  2UXD Q;  2XTI A;  3HEJ A;  2KCN A;  2C9O A;  1HNX Q;  3PO2 B;  5J22 A;  1PZK D;  1EY9 A;  4P71 A;  4PNY A;  1N36 L;  5I2X A;  4JV5 Q;  4JI5 Q;  3V96 A;  2E75 C;  1N34 L;  1VQE A;  3I4M B;  2MQH A;  2P5Z X;  3T1H Q;  1N33 L;  2R93 B;  2YTV A;  2WAQ G;  2I5M X;  1F2L A;  1ZYR C;  1JIC A;  2A6E C;  1UUP A;  1TWH B;  3TS0 A;  1IL2 A;  3ULJ A;  2F4V L;  3TN2 A;  4Q5V A;  2AQ1 B;  4RGN A;  4NW2 A;  4LFA L;  1H9K A;  3J81 E;  4H02 A;  2WV6 D;  5EPL A;  2N3S A;  1FGU A;  4WOR A;  2PNR C;  3MXU A;  3ER0 A;  1HR0 Q;  5LL6 X;  2R61 A;  3UDI A;  4DAM A;  3J7A F;  2K52 A;  1WI5 A;  1FVI A;  5EQ0 A;  4DK6 C;  2PMZ E;  2RQX A;  3GTO B;  1DJR D;  2KQ3 A;  4YWL A;  2PI2 E;  1EYD A;  1NJI C;  4ZUI A;  1B2T A;  3WDN A;  4DV1 Q;  5E1F A;  4L5T A;  2JA7 B;  2EYJ A;  2RF4 A;  1TKW B;  3BDO A;  1CUK A;  3PF5 A;  4NKL A;  3D0F A;  4KY6 A;  4FXG C;  1PH7 A;  4K14 A;  3TZD A;  4HIM A;  1D5M C;  3JAM c;  3S2H H;  5HY6 A;  1ENC A;  4C2M H;  1ET6 A;  2XWJ B;  4DV2 Q;  4QCL A;  1SE3 A;  1EY0 A;  4B08 A;  2E2D C;  3RR5 A;  3S1N H;  4EQP A;  5M3F G;  1ONL A;  1VQF A;  4JI7 Q;  1UE6 A;  3NEN A;  4N9T A;  3J80 L;  4F87 A;  5D3D A;  2F0J A;  2L5T A;  2I5L X;  5M9O A;  4L6T B;  2EYL A;  4R4I A;  4P72 A;  2PQA A;  1KLU D;  1L1O A;  1SMY C;  3LWU A;  4RG1 A;  1HA5 A;  4IUT A;  2OTL A;  2NN6 G;  4XQQ A;  4N9P A;  4BBS G;  3AMU A;  1ROD A;  1RHP A;  2F0M A;  3GTQ B;  1AW7 A;  4KMU C;  4HJ8 A;  1ICF B;  2F4I A;  5A35 A;  4A3D G;  1W2B A;  4EQO A;  5ELN A;  3KBX A;  2EJG C;  3SK5 A;  1I4P A;  3T16 A;  5C6A A;  1EWC A;  5FJ8 G;  5LMU L;  4A3I G;  2F0L A;  2J7Z A;  2XWB B;  3PO2 H;  2LXK A;  4DR5 L;  1EU4 A;  3I72 A;  2EQS A;  2EXD A;  2Z8L A;  4LK1 C;  4NXM Q;  2DUD A;  3NTH A;  1GXD C;  2AQ2 B;  3CCE A;  1VQA A;  2RHQ B;  3I4M H;  4HID A;  2R93 H;  2IT1 A;  4LF6 L;  1V1O A;  1PZI D;  4KKT A;  1TWH H;  3UDX A;  4BY1 H;  3RMH A;  5C3E G;  4GOP B;  1E2V A;  4ODG A;  2K6A A;  4UPA A;  1F9P A;  3TP5 A;  3EFX D;  2F1M A;  4ZRZ A;  5M5W B;  1MJE A;  5IIF A;  1D7Q A;  1HZA A;  1N8R C;  1JJ2 A;  1LAB A;  3GTO H;  1U4R A;  2UU9 L;  1NMF A;  1IW7 C;  1LT3 D;  1EEF D;  5T1I A;  1EWH A;  1QUQ B;  2OEO A;  2WB1 B;  3H0G G;  1FNU A;  1PYS B;  2YV5 A;  4A3B G;  1RTO A;  3C46 A;  4OIK A;  2FJ2 A;  2FIN B;  4DV7 Q;  1IXR A;  1EY5 A;  1PHJ A;  4X6A H;  5IGE A;  4F7X A;  2JA7 H;  1DON A;  4F8M A;  2RBM A;  2V1C C;  1JJG A;  2MO1 A;  4LFB Q;  2F0T A;  4LNQ A;  1PH3 A;  5KYI A;  5IGG A;  2D0O A;  1WFQ A;  4B3R L;  4A3M B;  1ML0 D;  4G7Z C;  2G5D A;  4R8N A;  3U58 A;  2Y0S E;  3K7U C;  4A3L H;  1A2U A;  2K05 A;  1E0B A;  1RL2 A;  4JPB W;  1WD1 A;  1TWG B;  1SFO H;  3J80 i;  3KOJ A;  1BNZ A;  4UAI A;  1FYC A;  1WTW A;  2DN8 A;  5IT9 E;  2AHO B;  1MHW C;  3ERO A;  4DR3 L;  2E5L L;  3CCU A;  1K28 A;  1ESR A;  1KTK A;  3NQI A;  1IYJ B;  2QDL A;  3A8I E;  3CCJ A;  3A8K E;  4HJ5 A;  4J15 A;  1VQM A;  2JEA I;  4N8F A;  3M3Y B;  4A76 A;  2EJF C;  1M4V A;  2L1B A;  1K83 B;  3GTJ B;  4RHS A;  1TS4 A;  4A3G G;  2K4K A;  3T1Y Q;  1CHQ D;  2E2I B;  4TQU S;  5BR8 Q;  1JWM D;  2Q8R E;  1E2Z A;  3H3V I;  4ZUJ A;  5AJ3 Q;  1OXT A;  2O5I C;  1EL0 A;  4HR7 B;  1PDQ A;  3BVG A;  2B63 B;  3H6M A;  1JCK B;  2BDN A;  1MD2 D;  3VR3 A;  3D4W A;  5C4X G;  1I4Q A;  2K75 A;  5JEA G;  1FR3 A;  1QB5 D;  1BOS A;  4CJ1 B;  4AH6 A;  3BZC A;  4CDD C;  1QNU A;  2JA8 H;  4C3J B;  3HP3 A;  4L8J A;  1D1K A;  1LT5 D;  2WB1 E;  4TRD A;  3KLS X;  4C3I B;  3PUX A;  3CCL A;  2EYF A;  4ZQ3 A;  1C0A A;  4KHZ A;  4OWX B;  3M4O B;  2NUC A;  1X3P A;  3I4N B;  3ND8 A;  1SMX A;  1HA6 A;  2VQE Q;  4IAL A;  2R7Z G;  1V43 A;  3LNN A;  3D4D A;  3HOY G;  1FGB D;  1HFG A;  3HFZ B;  4LUZ A;  1EOV A;  2B2W C;  4PG3 A;  4F88 A;  4A3F B;  1VS0 A;  2V4D A;  3UE0 A;  3PMF A;  4YWM A;  1SND A;  4DUZ L;  1MSH A;  1RJT A;  3MC0 B;  4R8I A;  1EFW A;  1QZH A;  2E76 C;  2K5D A;  4PV1 C;  5IGD A;  1G6P A;  5KRU A;  4I65 A;  1CSQ A;  4JI0 L;  2B8G A;  3G7L A;  4LF9 L;  4IUU A;  2VNU D;  1PXU A;  3OWE B;  2OWO A;  4A3M H;  4K0K Q;  1I4X A;  5CC4 A;  1RKN A;  2EDG A;  3D4R A;  2I0Q A;  1MSG A;  3NBI A;  1L0W A;  2YYZ A;  2OF1 A;  3H91 A;  3E0E A;  4Y52 H;  1VQ6 A;  4X65 Q;  1LTB D;  1L2F A;  1TWG H;  1HCZ A;  5JJZ A;  5M3M G;  3HOZ B;  1SYD A;  3HOV B;  4DV6 L;  2QIL A;  3K5M A;  5IP7 G;  3FPP A;  2IW3 A;  3HG9 A;  3C1F A;  3I8Z A;  5I2Y A;  1IBL Q;  4FF1 A;  3MEH A;  3OTO Q;  3F2B A;  4A3E B;  3VR2 A;  2AWN A;  2X6L A;  3NBH B;  2NYZ D;  3J7A 5;  4IPD A;  2WKC A;  4WFN 3;  1H9S A;  1HNX L;  5LMN Q;  2L11 A;  2IY5 B;  5EBD A;  3ITP A;  2KBN A;  3I91 A;  1JB7 A;  3MTS A;  1R4P B;  3GTJ H;  1K83 H;  3D8G A;  3PF4 A;  1GHJ A;  1E2W A;  3OMC A;  2XNA C;  3QO2 A;  2KED A;  1M90 C;  3KUP A;  3DXJ C;  1X6O A;  3CCS A;  1XMO L;  1DOK A;  3RZO H;  2EVB A;  3NXW A;  4DV5 Q;  5K36 G;  4B3S Q;  4X64 Q;  2F03 A;  3V05 A;  1Y8N B;  2IX0 A;  1CZW A;  4DR6 L;  2B2T C;  5C0X I;  3CCR A;  2HCI A;  2ZXO A;  1WTP A;  1QVF A;  2RDH A;  4GLX A;  2EY2 A;  4O0A A;  1NUC A;  2K7V A;  2DY8 A;  3OIQ A;  4HAE A;  4JI2 Q;  1XNQ L;  2R92 B;  3OMG A;  4X66 Q;  4DV4 Q;  3S14 B;  1JOR A;  1Q81 C;  1W6J A;  4XT1 B;  3K81 C;  3FVQ A;  2VZA A;  4J6H A;  5FKA C;  2FXQ A;  4A75 A;  5ELB A;  4XYO A;  4LF7 L;  1LTS D;  1V1P A;  1WYD A;  4IPH A;  3SHL A;  3CW2 C;  1L0Y B;  1VQI A;  3PIP 3;  1E1T A;  4NDX A;  3DM3 A;  2JJQ A;  4UDU C;  2JA5 B;  3K58 A;  1SLJ A;  2LMC B;  2F0P A;  3X3N A;  2O2L D;  3PIO 3;  5EPJ A;  2R7F A;  1N32 L;  4YCU A;  1HNZ L;  3M4O H;  3S16 H;  1B44 D;  2EYH A;  1KDA A;  1PTO F;  1AN8 A;  2BE5 C;  4CKC A;  3ZJY C;  4QGU A;  1S5E D;  1WVL A;  1PRT D;  1Q82 C;  1SNM A;  3K0X A;  1VCI A;  4RHR A;  2RA4 A;  1HZ9 A;  4PMC A;  5C44 B;  1F2Y A;  4JBJ A;  4X3U A;  4IQZ A;  4FXK C;  4IJL A;  4JCV E;  1SYE A;  3D3R A;  1YNJ C;  4B3T L;  2K33 A;  4FF3 A;  4GN4 B;  4BS9 A;  1Y69 U;  4LF8 L;  2CQO A;  4X3K A;  3DWQ A;  2BE5 D;  3J81 j;  4X3T A;  4DR2 L;  1XTD A;  1K8G A;  3FHW A;  4DF7 A;  2OQK A;  4ME3 A;  4RA8 A;  3J7Z C;  1JWS D;  2KCC A;  5M5Y H;  5C0X G;  2OQ0 A;  3KDF B;  4QUC A;  4DGZ A;  3SEB A;  4DR7 L;  4K8J A;  4G4K A;  3I4M G;  4GKK Q;  2R93 G;  1A3T A;  2RDG A;  4GNX A;  3K0Y A;  4H7B A;  2EY1 A;  1Y8P B;  2CWP A;  5C4J H;  1PH6 A;  3HOV H;  2F0H A;  4IFD I;  1SR3 A;  1XTC D;  3GV6 A;  4GLA C;  4PZ6 A;  4BY1 G;  3J81 c;  1C9O A;  2QCP X;  1HNW L;  4FNF A;  1UE7 A;  2KCM A;  5IE8 A;  2PI2 A;  1M1K C;  1SYF A;  3MWY W;  3T51 B;  1HJP A;  1KRT A;  4AYB B;  3M9B A;  1NTG A;  2B2U C;  2B3G A;  3C1E A;  3J80 E;  4A3J H;  3I4L A;  4J8Q A;  4HIK A;  1U4M A;  1Y14 B;  4GKJ Q;  1Q8I A;  4A3C H;  1EIY B;  5BN3 A;  1K0S A;  5ELD A;  3DM1 A;  2A6H C;  3HS0 C;  1C48 A;  2LS0 1;  4IUR A;  4HMI A;  3PUZ A;  1I6V C;  1LV9 A;  4RGM A;  2KEE A;  3OWF A;  2ZXR A;  2M2L A;  3OSO A;  1VQN A;  3I7F A;  3CCQ A;  1B70 B;  2IHE A;  2R92 H;  1I5F A;  1Q3L A;  3KF6 B;  2EZV A;  3GTL H;  3S14 H;  2MPM A;  4HMJ A;  5I4D A;  1CTM A;  1GUO A;  3GTG H;  1XPO A;  4EVO A;  1GD7 A;  2RHS B;  4IOC A;  3GQB A;  3NTK A;  1B9M A;  2AUK A;  4HSV A;  1NAP A;  1EOT A;  2K5N A;  4KN4 C;  5JPM C;  1QOH A;  2E2J B;  3F1Z A;  2DNC A;  3CC4 A;  1SNP A;  1BCP D;  3BDC A;  1NNX A;  1IBM Q;  1IHZ A;  5A2Q L;  4OO1 I;  3S17 H;  4P75 A;  4YWK A;  1SN8 A;  2J0T D;  3U4V A;  1LTR D;  4G57 A;  3UI2 A;  4DAY A;  1H9J A;  4IFD G;  4R4C A;  2KCT A;  1CKO A;  2Y0S G;  4ZYS A;  1TS2 A;  1SNQ A;  3J7A V;  3A0J A;  4LAA A;  5C44 H;  4DR1 Q;  3KLS A;  5JJL A;  4ID6 A;  1GKH A;  2CH4 A;  2XRS D;  3S9W A;  4RCO A;  1XNR Q;  1HPC A;  4FYD A;  1Z7T A;  4AQY Q;  4NXN Q;  2F0N A;  3TZU A;  5I9P A;  1HH2 P;  3PQI A;  1IZ6 A;  2NTT A;  1Q86 C;  3SVM A;  1T9H A;  3TSS A;  2L55 A;  3E5S A;  3TDQ A;  3VYS A;  2KHJ A;  1PH8 A;  1X3E A;  5FLM H;  3KBG A;  3VR6 A;  1LTA D;  1BCP B;  1B9N A;  5IYD H;  4YCW A;  5CV6 A;  3OHX C;  1YIJ A;  4KK7 A;  4PZ8 A;  2JA8 G;  1YHB A;  1FD7 D;  1X55 A;  3T1Y L;  1FJG L;  1ILP A;  1STE A;  1Y8O B;  4Y7N B;  3IL8 A;  4APV A;  5IYC G;  2UXC Q;  2NN6 I;  5AJ3 L;  1GUS A;  3HOU G;  1O7Y A;  1PTO C;  3RZD B;  2GN5 A;  4POF A;  1CI3 M;  4OO1 G;  1SYC A;  1ICW A;  1II3 A;  2C5C A;  2WAC A;  5DM7 3;  1ZYR D;  2DJG C;  1JWU D;  2A6E D;  5EJW A;  1VQ4 A;  3F2C A;  3PGZ A;  5IWA L;  2VUM G;  1EEI D;  2I07 B;  3BVZ A;  3T56 B;  1K8O A;  4IN3 A;  2WB1 G;  1W3S A;  4MIU A;  4YY3 L;  1NY4 A;  3T4A C;  4POG A;  2UUC L;  1NE3 A;  1YEZ A;  2Z1C A;  3NWS A;  4JOI A;  1PH5 A;  4DUY Q;  1J6Q A;  2EPB A;  3K5N A;  1KQS A;  3S2D B;  4C3H G;  3BU2 A;  2ES2 A;  1B1Z A;  1NR4 A;  3A74 A;  4HCS A;  2WFW A;  4B3M L;  3MXP A;  4JYA L;  3HKZ E;  3W1G A;  3A5Z B;  1LT4 D;  3CC7 A;  2KOL A;  5G3L D;  4R4T A;  1EYC A;  3BZK A;  1VQK A;  1WTX A;  4IUQ A;  5KND A;  2E2J H;  4CJ2 C;  5GAH C;  3URY A;  1IBK L;  4QJF A;  2UXB Q;  2JYO A;  2NB0 A;  2PW7 A;  3QB3 A;  1AP0 A;  1TS3 A;  4KY5 A;  2KJX A;  3STB C;  4JI6 Q;  5IT9 c;  2O5J C;  3FKI H;  2CCZ A;  2K5V A;  5FO9 B;  1L1O C;  1KD1 C;  4LF4 Q;  1RDP D;  2FMM A;  3EQL C;  3HOX G;  4JBW A;  3NP8 A;  2QKI C;  4ULL A;  1STH A;  1B4O A;  3JC6 6;  4LMQ D;  2FFK B;  4K0K L;  1QNK A;  1YJN A;  5GQO A;  4GOP A;  1PV4 A;  1F2Z A;  1YBY A;  1PTO B;  5GAD C;  3SXH A;  2IX1 A;  1VQ5 A;  4LFC Q;  2AWO A;  4HIO A;  1QE6 A;  2JA6 H;  2WKD A;  3OW7 A;  1DM0 B;  4RKB A;  4NP5 A;  4GN5 A;  2IX3 A;  1TXY A;  5J39 A;  4OL7 A;  2YTY A;  4FF4 A;  1OO9 B;  4C1N I;  1YJW A;  1SMY D;  4JI8 L;  1UE5 A;  4H0L C;  2R6G A;  3D31 A;  4ALP A;  1QUQ A;  1QWY A;  1WCM G;  4RGT A;  1NCV A;  3LWE A;  5IGC A;  4C56 C;  3DWP A;  3K59 A;  5LMN L;  2D5D A;  3LX0 A;  1A2T A;  2N49 A;  4OX9 Q;  1JOO A;  1YNX A;  4KV6 A;  2NBF A;  1ASZ A;  1CK1 A;  4HJA A;  4KN7 C;  2Q2H A;  4Y7N H;  4YHH L;  3CAM A;  2ZM6 Q;  2AUJ D;  3F2U A;  3I73 A;  2F3I A;  3VR5 A;  2ZTD A;  2XN9 C;  4MN3 A;  5E7N A;  5F2D A;  2VW9 A;  2WAQ B;  3K6O A;  5COY A;  4XYQ A;  2MO0 A;  4BBR G;  5IOD A;  3RZD H;  2JXM B;  1U5K A;  3TME A;  4P2C B;  5ELF A;  1CQV A;  2PQA B;  1KHI A;  1CKM A;  3D6W A;  3CCM A;  2QDB A;  1EIG A;  1ENF A;  1V8Q A;  4X66 L;  3G6E A;  3S15 B;  2K50 A;  1STA A;  1S3O A;  1ESF A;  2A8V A;  1SE2 A;  1PLF A;  3NTI A;  1YI2 A;  4KHP Q;  2X69 A;  1VMC A;  2UUA L;  4ZK9 B;  2F0K A;  2OT2 A;  3M85 A;  2IJ0 A;  4YIJ A;  3S2D H;  2A68 C;  3L2P A;  2CKZ B;  5LL6 S;  5EKK A;  4EGV A;  3AFQ A;  1FNV A;  4OXP A;  2DGY A;  1T5E A;  4ZKB B;  4J1M A;  5CYU A;  2EYP A;  1IW7 D;  1HHV A;  2GA4 B;  4R9W A;  3FPU B;  3CF5 A;  1K73 C;  1R4Q B;  5CBE E;  1GUN A;  1YZ6 A;  3KJP A;  4TKO B;  5KEE A;  3DEO A;  3PO3 G;  4JI4 Q;  1Z47 A;  3GV3 A;  4KI0 A;  3HOV G;  1JT8 A;  3L7Z C;  2UUB L;  4QUF A;  5FLX L;  1O78 A;  4G7H C;  3K80 C;  1K3R A;  3WOF A;  3VA7 A;  1PRT F;  5DNF A;  1RD9 D;  1MBY A;  5EGT A;  3R2T A;  1TT2 A;  1LLR D;  4A3J G;  1XJV A;  5M3F B;  3N6R A;  2EY5 A;  3GTQ H;  1Y1W G;  4QF4 A;  1DZ1 A;  3PIP A;  4DAP A;  1WOC A;  3J7Y W;  1N36 Q;  1A8V A;  4CKE A;  3U4Z A;  2F0D A;  1RF2 D;  1V9P A;  3HOW B;  3PIO A;  1N34 Q;  1N33 Q;  1CKN A;  1I94 L;  4QMG A;  1UAP A;  4EX5 A;  3BG3 A;  1PH4 A;  2RCN A;  5IP9 H;  4BBS B;  2F4V Q;  1VQB A;  2LKV A;  4DKA C;  1S5F D;  4A3D B;  1EFI D;  1HFN A;  2H4O A;  2PPB C;  3Q6S A;  1Q46 A;  3QG1 A;  4A3I B;  4CGY B;  2KUM A;  4JI1 L;  3UE1 A;  3GTM B;  1B50 A;  5IY0 A;  2VQF Q;  4V19 0;  4PMW A;  4DR4 L;  3BJU A;  1DCZ A;  5CGK A;  3BDL A;  1YNN C;  4HED A;  5M5W H;  2OXP A;  1EUJ A;  4I7A A;  1LTL A;  1GOZ A;  1JE4 A;  4KKS A;  2XSC A;  1IYU A;  3S15 H;  2XRQ D;  5C3E B;  1HUN A;  1SNC A;  3PSI A;  1XPR A;  1VQP A;  4M8A A;  3PCO B;  3NBH A;  1IYV A;  3ONA B;  3L3O C;  5IYB H;  4KD4 A;  1MIU A;  3F8T A;  3N52 A;  3S1Q B;  4RFB A;  5CV9 A;  4A3K G;  3R8B A;  2NVQ B;  5I6W A;  1SDF A;  2ID0 A;  1IBM L;  2PZW A;  4B9W A;  2PW5 A;  2NVY B;  2AMC B;  3H0G B;  4OON A;  4A3B B;  5J3B A;  3P7J A;  2B29 A;  1LTT D;  5FLM G;  4JI3 L;  2WIN B;  3AYH B;  5KIX A;  3RUZ A;  5KGU A;  3ICE A;  3E9I A;  1DOM A;  4DV0 L;  4ZCK A;  2HDL A;  5EKI A;  3WOE A;  3RLN A;  2WP8 J;  1SJH D;  1TY2 A;  4X62 L;  1PVO A;  1DOL A;  1D6E C;  1O7I A;  3FDT A;  2JSO A;  2UXD L;  1TII D;  2VB3 X;  1LTI D;  1X56 A;  1Z6H A;  3J80 c;  1KXL A;  1LT6 D;  1M8A A;  1SJE D;  5A2Q E;  2HUG A;  2B2Y A;  2RDF A;  3P20 A;  3M3Y H;  3S24 A;  1TQO A;  2D62 A;  2DNE A;  5LMU Q;  4JV5 L;  4JI5 L;  4DR5 Q;  5JOB A;  5BN4 A;  4OEM B;  2E2I H;  4K5V A;  4RAU C;  3GTK B;  1A3U A;  3T1H L;  3K5L A;  3M4Q A;  3ULP A;  4S3S A;  3HOW H;  4P73 A;  3G4S A;  5JAV A;  4X3S A;  1WTV A;  2B63 H;  4LF6 Q;  2XIW A;  3AFP A;  4WJ3 M;  4JBK A;  1HZB A;  4BBS H;  4A3G B;  1O7Z A;  3LGJ A;  3TP7 A;  1BR9 A;  1CFM A;  1O7L A;  4IPG A;  2EE1 A;  1HR0 L;  1VQ8 A;  1Q90 A;  3H3V C;  3CPW A;  5FJ8 H;  1W6K A;  3EJI A;  4A3I H;  4HJ9 A;  2RSO A;  4C3J H;  5JVH 3;  3DLL A;  4N8X 1;  3JAM L;  1UE1 A;  4C3I H;  1BQQ T;  4A4I A;  5C4X B;  1KRS A;  1VQG A;  1OXU A;  2DJF C;  3KDF A;  4KTA A;  4DN4 M;  4ABN A;  2UU9 Q;  5EKL A;  5GAG C;  4DV1 L;  3I4N H;  3HGB A;  3FKI G;  5ELE A;  3U50 C;  3OW2 A;  1B3A A;  2G9D A;  4DUY L;  4ILW A;  3HKZ G;  4IUV A;  4KJO A;  1H9S B;  3KF8 B;  1WTH A;  1BXT A;  1EIF A;  4H13 C;  5E4W C;  3A5U A;  2E2H B;  4HN7 A;  4U67 3;  1SEB D;  2RCF A;  5JJK A;  1BKB A;  4A3F H;  2XVS A;  1B7Y B;  5FO7 B;  1E24 A;  1KDB A;  4B3R Q;  1IKL A;  1P8L A;  2Z9H A;  4DV2 L;  4XT3 B;  5EBC A;  1KAB A;  1CA6 A;  1BBW A;  2JA6 G;  2NVX B;  2B2V A;  2R7Z B;  2SOB A;  3S1Q H;  4DU9 A;  4BXX H;  1X32 A;  2VXW A;  4DNR B;  1Y1V B;  3TQY A;  3HOY B;  4OEL B;  4CDE C;  3PO2 G;  4JI7 L;  1CZG A;  5GAE C;  3RNU A;  1ENA A;  4JI6 L;  4ME5 A;  3C2P A;  2NVY H;  1SRU A;  1TVX A;  4E6I A;  3R2I A;  4LF5 Q;  4GNX C;  4A3B H;  3MFY A;  1A15 A;  4PZ7 A;  1YNJ D;  1LTG D;  3HRZ C;  3S1R B;  3MHB A;  5ELO A;  3DHQ A;  1G29 1;  4DR3 Q;  2E5L Q;  1V1P B;  3CCV A;  5E3F A;  3MA2 B;  3OPO A;  4ZKC B;  1LO5 D;  3Q23 A;  3HOZ H;  2MHV A;  4R4O A;  4DXF A;  2PQE A;  1L0X B;  3KF6 A;  5I6Y A;  2TSS A;  4A3E H;  2F0I A;  5BN5 A;  3I3C A;  4K2L A;  4UP8 A;  1AEX A;  1PYW D;  1ZEQ X;  3U9O A;  1XYI A;  1STY A;  3A7L A;  1XX8 A;  2MNA A;  3NPP A;  2BDO A;  5M3M B;  3VDY A;  4NXM L;  1UEA B;  2BOS A;  2BCO A;  2QW7 A;  4KY7 A;  2F3V A;  1BF4 A;  2PZU A;  1I6H B;  1BO0 A;  3IAY A;  3GTK H;  1HR0 W;  1B8A A;  3X3M A;  3CQZ B;  4MTN A;  1SBB B;  1RTN A;  2N88 A;  2JQO A;  5J1Z A;  1QG7 A;  2NVT B;  2ZJQ A;  4K8I A;  2L15 A;  5CMD A;  1TWA B;  1QZG A;  3D6C A;  2KA7 A;  4K2K A;  2TMP A;  4JBM A;  3SDZ A;  2K5Q A;  2JA7 G;  4BA2 I;  3AQQ A;  4DFA A;  4A3G H;  1B53 A;  1F9R A;  4DV3 Q;  2JK8 A;  2Z4H A;  1HZC A;  2CW0 C;  1RCV D;  1F9Q A;  1HQR D;  3TRE A;  2QEX A;  1X54 A;  2F0Q A;  1K8M A;  3U9S A;  4FXD A;  2JA9 A;  2SDF A;  3MXN B;  1AH9 A;  2A6H D;  2Z6K A;  3NUC A;  4A3L G;  4HJ7 A;  3JAM i;  3QWN A;  1DXM A;  4XDX A;  5CR3 A;  2JA5 H;  4GNX B;  2VY3 A;  5CV5 A;  1OXS C;  3MVV A;  1VQ9 A;  4NPS A;  1H95 A;  5C4X H;  1X3G A;  2PMZ B;  1DD2 A;  4DV7 L;  1S5C D;  4NMZ A;  3S2H B;  3A8J E;  3BYT B;  1GO3 E;  4DUZ Q;  2GVB A;  4LFB L;  1PFS A;  3I70 A;  2YTX A;  2PO4 A;  2NZH A;  1TY0 A;  4V0B A;  4HSP A;  2NZO A;  2E2H H;  2HIX A;  1S5B D;  3A56 A;  2HT1 A;  3VYR A;  3S1N B;  4EQ5 A;  4JI0 Q;  1Z9F A;  4LF9 Q;  1UWV A;  4MNO A;  1MKH A;  3OOC A;  3G6J B;  4KJN A;  2NZ1 D;  2MFI A;  4WRD A;  1A62 A;  2F0V A;  2ZJR A;  1WTR A;  1JOK A;  4XQN A;  1YHQ A;  2NVX H;  1ET9 A;  1SYG A;  1Y1V H;  2JE6 I;  2ATW A;  3W2D A;  4TVA B;  4OHJ A;  1MI2 A;  1GHK A;  4CDC C;  2CVR A;  5IP9 G;  4K5W A;  4DV6 Q;  5HUR A;  4B9X A;  4CKB A;  5JEA J;  3NK9 A;  1G51 A;  4AYB E;  1PFN A;  2JEB I;  4CHT B;  3AU7 A;  3S1R H;  2ZJP A;  3IKJ A;  5AFW A;  3RLO A;  2EOT A;  4XXE A;  2SNS A;  4DK3 C;  3H3V H;  3QOL A;  2MUY A;  2F0S A;  4HTH A;  4MZ9 A;  5BR8 L;  3C3L A;  3T13 A;  3L9A X;  2PNH A;  2A73 B;  5D3I B;  1E3P A;  1EQT A;  2A19 A;  3CKI B;  3CC2 A;  4QB4 A;  1XMO Q;  3NEM A;  2A74 C;  3TP6 A;  5FLX E;  4A93 B;  4DAY B;  1HQM C;  1VQD A;  2EJM A;  4QY7 A;  5M3M H;  2NTS A;  5IP7 H;  1KDC A;  1DGS A;  4DR6 Q;  3HZX A;  1EY6 A;  3GDE A;  4BY1 B;  1I6H H;  2ENB A;  1EY4 A;  2F0F A;  1KAA A;  5KNB A;  2Q2T A;  1KL9 A;  3CQZ H;  4JOI C;  1HUM A;  3OIP A;  2QGQ A;  3I2Z A;  2NVT H;  2FHT A;  3ZYY X;  4UHV A;  3E6Z X;  1HXY D;  1XNQ Q;  1TWA H;  2LSS A;  2EY6 A;  5IYB G;  2OTJ A;  1PTO D;  3FEW X;  3NWT A;  4LF7 Q;  2VQF L;  2HIV A;  1VQJ A;  5FK9 C;  2A5H A;  3TEH B;  2HD3 A;  2HQL A;  4IOA A;  1IKM A;  3CD6 A;  2L4N A;  3QJY A;  4A3M G;  1GM5 A;  5K36 H;  3O13 A;  1ZXT A;  4DK1 A;  1Q8K A;  5EPK A;  2VQE L;  1JE5 A;  1N32 Q;  3E0J A;  1HNZ Q;  2D0P A;  1SYB A;  1A0I A;  2J4X A;  1AE2 A;  2RKS A;  4BY7 B;  1RIP A;  4FVM A;  3Q24 A;  1K3B C;  3BYY B;  2EYM A;  3NSW A;  4O2D A;  2F0U A;  2LY7 A;  1Q7Y C;  4OGQ C;  3RLF A;  1Q1E A;  2SEB D;  4GOP C;  4B3T Q;  4WJ4 A;  4DNT B;  4LF8 Q;  2NWG A;  3I90 A;  1SFO B;  3PUY A;  3M7N A;  2EYO A;  2MGS A;  4DR2 Q;  1LM0 A;  3ND9 A;  1ASY A;  3A54 A;  1SNO A;  3STB D;  5K5P A;  4G7O C;  3VYT A;  2EXZ A;  4X65 L;  3KLW A;  2HDM A;  3Q0A A;  4LWC A;  3HKS A;  2K1B A;  2KEC A;  2Y0S B;  2IPK D;  3HOW G;  4DR7 Q;  5D14 A;  1EYA A;  3W3A A;  1IBL L;  1SE8 A;  2B63 G;  2LFN A;  3IFT A;  3OTO L;  4R1J A;  1D1I A;  5JJI A;  1F77 A;  3KK7 A;  1KLG D;  1HNW Q;  1B3Q A;  4QL5 A;  2ALY B;  2H1E A;  4DA2 A;  1AE3 A;  1X65 A;  1BDO A;  4C3J G;  1SAP A;  1XXG A;  4C3I G;  3Q22 A;  5C0X H;  4DV5 L;  1PFM A;  4IUN A;  4B3S L;  4X64 L;  4DNI A;  4OWT B;  3DWA A;  4LUO A;  2HQE A;  3I4N G;  3SE0 A;  2K04 A;  4GS3 A;  1KNE A;  4GN3 B;  4OWW B;  4A93 H;  1VQ7 A;  1H9M A;  1EZ8 A;  2JA8 B;  1L1O B;  3EIV A;  4JI2 L;  3SK6 A;  3K57 A;  4DV4 L;  3EA6 A;  3IRB A;  2K01 A;  1QVC A;  4PQX A;  4A3F G;  3K8A A; 
#chains in the Genus database with same CATH homology
 4M1U B;  5ELC A;  1I50 B;  3T53 B;  3HOU B;  2PCF B;  5FO8 B;  1SE4 A;  3ERQ A;  3TBI B;  2F0E A;  1JB3 A;  2ZXP A;  4FO2 A;  1T5X D;  1JR0 D;  1U4L A;  1MGS A;  2VUM B;  4LJZ C;  3NHH A;  1G91 A;  3A7A B;  3SK8 A;  5C0X J;  5M5X B;  2K32 A;  1FNW A;  1AZQ A;  2F0O A;  4RWS C;  4ZAI A;  3H09 A;  1CM9 A;  3P1H A;  1STB A;  3DMU A;  4C3H B;  5FOB B;  2A68 D;  4O1N A;  1D5Z C;  1A3V A;  1TWC B;  1H9R A;  3JAM E;  3BZD B;  3GO5 A;  4JK1 C;  1HTL D;  2SNM A;  2CHB D;  3CRK C;  4IUP A;  3J81 L;  1EY7 A;  2G9H D;  1GUG A;  1PTO H;  1NSN S;  4BWG B;  4CBV A;  1U4P A;  1OXV A;  2K28 A;  3HOX B;  2PYK A;  4IFD H;  2QEJ C;  1AZP A;  2MJ8 A;  1QIL A;  3RD4 A;  2DY7 A;  1U9R A;  4HCE A;  1GUT A;  1G2S A;  1I4G A;  3RZO B;  5D65 A;  4OIJ A;  2M00 A;  5LHY 1;  2Z4I A;  1IL8 A;  5CV4 A;  1WCM B;  5CV8 A;  5C4H A;  3A55 A;  2D9U A;  3FRP B;  3PUW A;  1CT1 D;  1F2M A;  4MHE A;  4IFD J;  1STG A;  4KHV A;  3FMC A;  3SK4 A;  3K5O A;  4DAV A;  3MFG A;  4TSS A;  4GZY C;  3S16 B;  4L63 B;  5CBA E;  1YNN D;  4BBR B;  1PFB A;  4QIW B;  3R93 A;  4OO1 H;  5T1G A;  1VMP A;  1DYQ A;  4K6D A;  1TWF B;  4K6L A;  3H94 A;  1PMR A;  1ILQ A;  5IOC A;  2L12 A;  2B2W A;  1G2T A;  1SSO A;  3QIA A;  5C4Z A;  2FMC A;  4RKL A;  1BCP F;  2F0W A;  1VF5 C;  1O80 A;  5JPN C;  1S5D D;  1SXT A;  2D2C C;  5M5Y B;  5I9O A;  4KKU A;  1I4H A;  1STN A;  2B2Y C;  3S1M B;  2ZT9 C;  4CJ0 B;  3PO3 B;  1JOQ A;  1D5X C;  2X6G A;  5IGF A;  5C4J B;  2YU9 B;  5DEH A;  3KLR A;  1ZKO A;  2KVM A;  1HRJ A;  2VB2 X;  2RVL A;  3EVQ A;  3MAQ A;  1A6X A;  3P75 A;  1Q1B A;  3SR1 A;  3KF8 A;  4A3J B;  2NN6 H;  2L9H A;  3CRL C;  1Y1W B;  1D2B A;  4K5X A;  1JQY D;  2E74 C;  2MP1 A;  3GP7 A;  2N55 A;  5C3W A;  2Q8I B;  1WD0 A;  2QF7 A;  2AQ3 B;  5NUC A;  4XTC S;  3VA5 A;  4ZLT F;  2A69 C;  1R9T B;  3BS1 A;  2HCC A;  4O42 A;  2B2T A;  3CHB D;  3GTP B;  4U68 A;  3GTL B;  1Q12 A;  4XQJ A;  3GTG B;  1PRT C;  3VR4 A;  3PV0 A;  2B39 A;  4IZ8 A;  2R3Z A;  5IT9 L;  5IGB A;  1EIH A;  2A69 D;  1EY8 A;  1TU2 B;  4DK0 A;  1WTQ A;  4H44 C;  2B2V C;  2BA1 A;  2IL8 A;  2M9V A;  3S17 B;  2K03 A;  1C4Q A;  4FP5 D;  1I3Q B;  3GD7 A;  3QOJ A;  1GUW A;  1UNS A;  3MZ5 A;  1TR5 A;  5TSS A;  3TP8 A;  3IFD A;  1HTP A;  5ISR A;  1I4R A;  4RGO S;  1VF7 A;  4Q0F A;  3M4Y A;  3DUZ A;  5G3L F;  3K7A B;  4PMB A;  1EZ6 A;  5KYL A;  4A3K B;  2RSN A;  2CQA A;  2IWH A;  1G6Z A;  1CA5 A;  3AB9 A;  2F3W A;  4C1N K;  1G8Z D;  1S4Z A;  3MXN A;  1NR2 A;  1CQF A;  1JC7 A;  4DXG A;  3V2T A;  1J9O A;  4I7Z C;  1PRT B;  1TS5 A;  5JVG 3;  1EQV A;  2I46 A;  2F0G A;  1X3Q A;  2WII B;  1BUV T;  3PUV A;  1OXX K;  2B2U A;  5E4X A;  1QJO A;  2ICI A;  4WJW A;  5COR A;  1VDZ A;  2ICE C;  4EQN A;  3R3O A;  1F9S A;  3MXG A;  5C5L A;  1BCP C;  1LAC A;  4Z9C B;  1BBX C;  2B8F A;  5C3X A;  5JEA H;  5CV7 A;  5DM6 3;  2CW0 D;  1C8C A;  1KNA A;  4C2M B;  3NE5 B;  1PZJ D;  2L0C A;  2PZT A;  2BA0 A;  3BVM A;  1GJX A;  1AFP A;  4RCN A;  3FKI B;  2JP1 A;  2KHS A;  1EU3 A;  3HKZ B;  1XWE A;  1WTO A;  4BA1 I;  3M7G A;  1QCB D;  3NQT A;  4KD3 A;  4XIG S;  5KNC A;  3DEP A;  1CHP D;  2Q8T A;  4RH6 A;  3CU7 A;  5HGT A;  2O4X A;  2K5W A;  4FF2 A;  2JA6 B;  5C5M A;  3VYU A;  5DAU A;  1J8I A;  3HEJ A;  2KCN A;  2C9O A;  3PO2 B;  5J22 A;  1PZK D;  1EY9 A;  4PNY A;  5I2X A;  3V96 A;  2E75 C;  3I4M B;  2R93 B;  1F2L A;  1ZYR C;  1JIC A;  2A6E C;  1UUP A;  1TWH B;  3TN2 A;  4Q5V A;  2AQ1 B;  4RGN A;  4NW2 A;  1H9K A;  3J81 E;  2WV6 D;  5EPL A;  4WOR A;  2PNR C;  3MXU A;  5LL6 X;  2R61 A;  3J7A F;  5EQ0 A;  2RQX A;  3GTO B;  1DJR D;  2KQ3 A;  1EYD A;  4ZUI A;  1B2T A;  3WDN A;  5E1F A;  2JA7 B;  2EYJ A;  1TKW B;  3BDO A;  4NKL A;  4KY6 A;  4FXG C;  4K14 A;  3TZD A;  1D5M C;  1ENC A;  1ET6 A;  2XWJ B;  4QCL A;  1SE3 A;  1EY0 A;  4B08 A;  2E2D C;  4EQP A;  1ONL A;  3J80 L;  4N9T A;  4F87 A;  5D3D A;  2F0J A;  2L5T A;  5M9O A;  4L6T B;  2EYL A;  1KLU D;  1SMY C;  3LWU A;  1HA5 A;  4IUT A;  2NN6 G;  4XQQ A;  4N9P A;  3AMU A;  1ROD A;  1RHP A;  2F0M A;  3GTQ B;  1AW7 A;  4KMU C;  2F4I A;  5A35 A;  4EQO A;  3KBX A;  2EJG C;  3SK5 A;  1I4P A;  3T16 A;  5C6A A;  1EWC A;  2F0L A;  2J7Z A;  2XWB B;  1EU4 A;  3I72 A;  2Z8L A;  4LK1 C;  3NTH A;  1GXD C;  2AQ2 B;  2IT1 A;  1V1O A;  1PZI D;  4KKT A;  3RMH A;  1E2V A;  4ODG A;  2K6A A;  1F9P A;  3TP5 A;  3EFX D;  2F1M A;  4ZRZ A;  5M5W B;  5IIF A;  1LAB A;  1U4R A;  1IW7 C;  1LT3 D;  1EEF D;  5T1I A;  1EWH A;  2OEO A;  2WB1 B;  1FNU A;  1RTO A;  3C46 A;  4OIK A;  2FJ2 A;  2FIN B;  1EY5 A;  5IGE A;  4F7X A;  1DON A;  4F8M A;  2RBM A;  2F0T A;  5KYI A;  5IGG A;  4A3M B;  1ML0 D;  4G7Z C;  4R8N A;  1A2U A;  2K05 A;  1E0B A;  1WD1 A;  1TWG B;  1BNZ A;  4UAI A;  1FYC A;  1WTW A;  2DN8 A;  5IT9 E;  3ERO A;  1ESR A;  1KTK A;  3A8I E;  3NQI A;  2JEA I;  3A8K E;  3M3Y B;  2EJF C;  1M4V A;  2L1B A;  1K83 B;  3GTJ B;  4RHS A;  1TS4 A;  1CHQ D;  2E2I B;  4TQU S;  1JWM D;  2Q8R E;  1E2Z A;  4ZUJ A;  1OXT A;  2O5I C;  1EL0 A;  4HR7 B;  1PDQ A;  3BVG A;  2B63 B;  3H6M A;  1JCK B;  2BDN A;  1MD2 D;  3VR3 A;  3D4W A;  1I4Q A;  5JEA G;  1FR3 A;  1QB5 D;  1BOS A;  4CJ1 B;  1QNU A;  4C3J B;  3HP3 A;  4L8J A;  1D1K A;  1LT5 D;  4TRD A;  4C3I B;  3KLS X;  3PUX A;  2EYF A;  4ZQ3 A;  4KHZ A;  3M4O B;  2NUC A;  1X3P A;  3I4N B;  3ND8 A;  1HA6 A;  4IAL A;  1V43 A;  3LNN A;  3D4D A;  1FGB D;  1HFG A;  2B2W C;  4F88 A;  4A3F B;  2V4D A;  3PMF A;  1SND A;  1MSH A;  1RJT A;  3MC0 B;  4R8I A;  2E76 C;  2K5D A;  4PV1 C;  5IGD A;  5KRU A;  4I65 A;  2B8G A;  3G7L A;  4IUU A;  2VNU D;  1PXU A;  3OWE B;  1I4X A;  5CC4 A;  1RKN A;  2EDG A;  3D4R A;  1MSG A;  3NBI A;  2YYZ A;  2OF1 A;  3H91 A;  1LTB D;  1HCZ A;  5JJZ A;  3HOZ B;  1SYD A;  3HOV B;  2QIL A;  3K5M A;  3FPP A;  2IW3 A;  3HG9 A;  3C1F A;  3I8Z A;  5I2Y A;  4FF1 A;  3MEH A;  4A3E B;  3VR2 A;  2AWN A;  2X6L A;  2NYZ D;  2WKC A;  4WFN 3;  1H9S A;  2L11 A;  5EBD A;  3ITP A;  3I91 A;  3MTS A;  1R4P B;  3D8G A;  1GHJ A;  1E2W A;  3OMC A;  2XNA C;  3QO2 A;  2KED A;  3KUP A;  3DXJ C;  1DOK A;  2EVB A;  3NXW A;  5K36 G;  2F03 A;  3V05 A;  1Y8N B;  2IX0 A;  1CZW A;  2B2T C;  5C0X I;  2HCI A;  2ZXO A;  1WTP A;  2RDH A;  2EY2 A;  1NUC A;  2K7V A;  2DY8 A;  3OIQ A;  4HAE A;  2R92 B;  3OMG A;  3S14 B;  1JOR A;  1W6J A;  4XT1 B;  3FVQ A;  5FKA C;  4J6H A;  5ELB A;  4XYO A;  1LTS D;  1V1P A;  3SHL A;  3PIP 3;  1L0Y B;  4NDX A;  4UDU C;  2JA5 B;  3K58 A;  2LMC B;  2F0P A;  3X3N A;  2O2L D;  3PIO 3;  5EPJ A;  1B44 D;  2EYH A;  1KDA A;  1PTO F;  1AN8 A;  2BE5 C;  4CKC A;  1S5E D;  1WVL A;  1PRT D;  1SNM A;  1VCI A;  4RHR A;  2RA4 A;  5C44 B;  4PMC A;  1F2Y A;  4X3U A;  4IQZ A;  4FXK C;  1SYE A;  3D3R A;  1YNJ C;  2K33 A;  4FF3 A;  4BS9 A;  1Y69 U;  4X3K A;  3DWQ A;  2BE5 D;  4X3T A;  4DF7 A;  4RA8 A;  1JWS D;  2KCC A;  5C0X G;  4QUC A;  4DGZ A;  3SEB A;  4K8J A;  4G4K A;  1A3T A;  2RDG A;  3K0Y A;  4H7B A;  2EY1 A;  1Y8P B;  2F0H A;  4IFD I;  1XTC D;  3GV6 A;  2QCP X;  4FNF A;  1SYF A;  3MWY W;  3T51 B;  4AYB B;  3J80 E;  3C1E A;  2B2U C;  3I4L A;  4J8Q A;  1U4M A;  1Q8I A;  5BN3 A;  5ELD A;  3DM1 A;  2A6H C;  3HS0 C;  1C48 A;  2LS0 1;  4IUR A;  4HMI A;  3PUZ A;  1I6V C;  1LV9 A;  4RGM A;  2KEE A;  3OWF A;  2ZXR A;  2M2L A;  3OSO A;  1Q3L A;  2EZV A;  2MPM A;  4HMJ A;  5I4D A;  1CTM A;  1GUO A;  4EVO A;  3GQB A;  3NTK A;  1B9M A;  2AUK A;  4HSV A;  1NAP A;  1EOT A;  4KN4 C;  5JPM C;  1QOH A;  2E2J B;  2DNC A;  1SNP A;  1BCP D;  3BDC A;  1IHZ A;  5A2Q L;  4OO1 I;  2J0T D;  1LTR D;  4G57 A;  3UI2 A;  4DAY A;  1H9J A;  4IFD G;  4ZYS A;  1TS2 A;  1SNQ A;  3J7A V;  4LAA A;  3KLS A;  4ID6 A;  2XRS D;  3S9W A;  4RCO A;  1HPC A;  4FYD A;  1Z7T A;  2F0N A;  3TZU A;  5I9P A;  2NTT A;  3SVM A;  3TSS A;  2L55 A;  3E5S A;  3TDQ A;  3VYS A;  3KBG A;  3VR6 A;  1LTA D;  1BCP B;  1B9N A;  5CV6 A;  3OHX C;  4KK7 A;  1FD7 D;  1ILP A;  1STE A;  1Y8O B;  4Y7N B;  3IL8 A;  2NN6 I;  1GUS A;  1O7Y A;  1PTO C;  3RZD B;  1CI3 M;  4OO1 G;  1SYC A;  1ICW A;  1II3 A;  2C5C A;  2WAC A;  5DM7 3;  1ZYR D;  1JWU D;  2A6E D;  5EJW A;  1EEI D;  2I07 B;  3BVZ A;  3T56 B;  1K8O A;  4IN3 A;  4MIU A;  3T4A C;  2Z1C A;  3NWS A;  2EPB A;  3K5N A;  3S2D B;  4C3H G;  1B1Z A;  1NR4 A;  4HCS A;  3MXP A;  1LT4 D;  2KOL A;  5G3L D;  1EYC A;  1WTX A;  4IUQ A;  5KND A;  4CJ2 C;  3URY A;  2JYO A;  2NB0 A;  2PW7 A;  3QB3 A;  1AP0 A;  1TS3 A;  4KY5 A;  2KJX A;  2O5J C;  5FO9 B;  1RDP D;  2FMM A;  3EQL C;  4JBW A;  3NP8 A;  2QKI C;  4ULL A;  1STH A;  1B4O A;  4LMQ D;  2FFK B;  1QNK A;  1F2Z A;  1PTO B;  3SXH A;  2IX1 A;  2AWO A;  1QE6 A;  2WKD A;  3OW7 A;  1DM0 B;  4RKB A;  4NP5 A;  2IX3 A;  5J39 A;  4OL7 A;  4FF4 A;  1OO9 B;  4C1N I;  1SMY D;  4H0L C;  2R6G A;  3D31 A;  1QWY A;  4RGT A;  1NCV A;  3LWE A;  5IGC A;  4C56 C;  3DWP A;  3K59 A;  2D5D A;  3LX0 A;  1A2T A;  1JOO A;  4KV6 A;  2NBF A;  1CK1 A;  4KN7 C;  2AUJ D;  3F2U A;  3I73 A;  3VR5 A;  2XN9 C;  4MN3 A;  5F2D A;  2WAQ B;  3K6O A;  5COY A;  4XYQ A;  5IOD A;  2JXM B;  3TME A;  4P2C B;  5ELF A;  1CQV A;  3D6W A;  2QDB A;  1EIG A;  1ENF A;  1V8Q A;  3S15 B;  1STA A;  1ESF A;  1SE2 A;  1PLF A;  3NTI A;  2X69 A;  1VMC A;  4ZK9 B;  2F0K A;  2OT2 A;  3M85 A;  2IJ0 A;  4YIJ A;  2A68 C;  5LL6 S;  5EKK A;  4EGV A;  1FNV A;  1T5E A;  4ZKB B;  4J1M A;  5CYU A;  2EYP A;  1IW7 D;  1HHV A;  2GA4 B;  4R9W A;  3FPU B;  1R4Q B;  5CBE E;  1GUN A;  4TKO B;  5KEE A;  3DEO A;  1Z47 A;  3GV3 A;  4KI0 A;  3L7Z C;  4QUF A;  5FLX L;  1O78 A;  4G7H C;  3WOF A;  3VA7 A;  1PRT F;  5DNF A;  1RD9 D;  1MBY A;  5EGT A;  3R2T A;  1TT2 A;  1LLR D;  5M3F B;  3N6R A;  2EY5 A;  4QF4 A;  1DZ1 A;  4DAP A;  3J7Y W;  4CKE A;  2F0D A;  1RF2 D;  3HOW B;  4QMG A;  1UAP A;  3BG3 A;  4BBS B;  2LKV A;  1S5F D;  4A3D B;  1EFI D;  1HFN A;  2H4O A;  2PPB C;  3Q6S A;  3QG1 A;  4A3I B;  4CGY B;  2KUM A;  3GTM B;  1B50 A;  4V19 0;  4PMW A;  1DCZ A;  5CGK A;  3BDL A;  1YNN C;  4HED A;  2OXP A;  1GOZ A;  1JE4 A;  4KKS A;  2XSC A;  1IYU A;  2XRQ D;  5C3E B;  1HUN A;  1SNC A;  4M8A A;  3NBH A;  1IYV A;  3ONA B;  3L3O C;  4KD4 A;  3N52 A;  3S1Q B;  5CV9 A;  4RFB A;  3R8B A;  2NVQ B;  5I6W A;  1SDF A;  2ID0 A;  2PZW A;  4B9W A;  2PW5 A;  2NVY B;  3H0G B;  4A3B B;  3P7J A;  1LTT D;  2WIN B;  5KIX A;  3RUZ A;  5KGU A;  1DOM A;  2HDL A;  5EKI A;  3WOE A;  2WP8 J;  1SJH D;  1TY2 A;  1DOL A;  1D6E C;  3FDT A;  2JSO A;  1TII D;  2VB3 X;  1LTI D;  1Z6H A;  1LT6 D;  1M8A A;  1SJE D;  5A2Q E;  2HUG A;  2B2Y A;  2RDF A;  3P20 A;  1TQO A;  2D62 A;  2DNE A;  5JOB A;  5BN4 A;  4K5V A;  4RAU C;  3GTK B;  1A3U A;  3K5L A;  4S3S A;  5JAV A;  4X3S A;  1WTV A;  2XIW A;  4A3G B;  1O7Z A;  3TP7 A;  1BR9 A;  1CFM A;  1O7L A;  2EE1 A;  1Q90 A;  3H3V C;  1W6K A;  3EJI A;  2RSO A;  5JVH 3;  3JAM L;  1BQQ T;  5C4X B;  1OXU A;  4DN4 M;  4KTA A;  4ABN A;  5EKL A;  3HGB A;  5ELE A;  1B3A A;  2G9D A;  4ILW A;  4IUV A;  4KJO A;  1H9S B;  1BXT A;  4H13 C;  5E4W C;  2E2H B;  4HN7 A;  4U67 3;  1SEB D;  2XVS A;  5FO7 B;  1KDB A;  1IKL A;  4XT3 B;  5EBC A;  1KAB A;  1CA6 A;  2NVX B;  2B2V A;  2R7Z B;  2SOB A;  4DU9 A;  1X32 A;  2VXW A;  4DNR B;  1Y1V B;  3HOY B;  1CZG A;  1ENA A;  4ME5 A;  3C2P A;  1TVX A;  4E6I A;  3R2I A;  3MFY A;  1A15 A;  1YNJ D;  1LTG D;  3HRZ C;  3S1R B;  3MHB A;  3DHQ A;  1G29 1;  1V1P B;  5E3F A;  3MA2 B;  3OPO A;  4ZKC B;  1LO5 D;  3Q23 A;  2MHV A;  4DXF A;  2PQE A;  1L0X B;  5I6Y A;  2TSS A;  2F0I A;  5BN5 A;  3I3C A;  4K2L A;  1XYI A;  1AEX A;  1PYW D;  1ZEQ X;  3U9O A;  1STY A;  3A7L A;  1XX8 A;  3NPP A;  2BDO A;  5M3M B;  1UEA B;  2BOS A;  2BCO A;  4KY7 A;  2F3V A;  1BF4 A;  2PZU A;  1I6H B;  1BO0 A;  3IAY A;  3X3M A;  3CQZ B;  1SBB B;  1RTN A;  2N88 A;  5J1Z A;  2NVT B;  1QG7 A;  4K8I A;  5CMD A;  1TWA B;  3D6C A;  2KA7 A;  4K2K A;  2TMP A;  3SDZ A;  2K5Q A;  4BA2 I;  4DFA A;  1B53 A;  1F9R A;  2Z4H A;  2CW0 C;  1RCV D;  1F9Q A;  1HQR D;  2F0Q A;  1K8M A;  3U9S A;  4FXD A;  2SDF A;  2A6H D;  3NUC A;  3QWN A;  1DXM A;  4XDX A;  5CR3 A;  5CV5 A;  1OXS C;  3MVV A;  2PMZ B;  1DD2 A;  1S5C D;  4NMZ A;  3S2H B;  3A8J E;  3BYT B;  3I70 A;  2PO4 A;  1TY0 A;  4V0B A;  4HSP A;  1S5B D;  3A56 A;  3VYR A;  3S1N B;  3OOC A;  3G6J B;  4KJN A;  2NZ1 D;  4WRD A;  2F0V A;  1WTR A;  1JOK A;  4XQN A;  1ET9 A;  1SYG A;  2JE6 I;  3W2D A;  4OHJ A;  1MI2 A;  1GHK A;  2CVR A;  4K5W A;  5HUR A;  4B9X A;  4CKB A;  5JEA J;  3NK9 A;  1PFN A;  2JEB I;  4CHT B;  3AU7 A;  3IKJ A;  5AFW A;  2EOT A;  4XXE A;  2SNS A;  3QOL A;  2MUY A;  2F0S A;  4HTH A;  3C3L A;  3T13 A;  3L9A X;  2A73 B;  5D3I B;  1EQT A;  3CKI B;  4QB4 A;  2A74 C;  3TP6 A;  5FLX E;  4A93 B;  1HQM C;  2EJM A;  2NTS A;  1KDC A;  3HZX A;  1EY6 A;  4BY1 B;  2ENB A;  1EY4 A;  2F0F A;  1KAA A;  5KNB A;  1HUM A;  3OIP A;  2FHT A;  3ZYY X;  3E6Z X;  1HXY D;  2EY6 A;  1PTO D;  3FEW X;  3NWT A;  5FK9 C;  2A5H A;  1IKM A;  2L4N A;  3QJY A;  5K36 H;  3O13 A;  1ZXT A;  4DK1 A;  5EPK A;  3E0J A;  1SYB A;  2J4X A;  2RKS A;  4BY7 B;  4FVM A;  3Q24 A;  3BYY B;  2EYM A;  3NSW A;  2F0U A;  2LY7 A;  4OGQ C;  3RLF A;  1Q1E A;  2SEB D;  4DNT B;  2NWG A;  3I90 A;  1SFO B;  3PUY A;  3M7N A;  2EYO A;  2MGS A;  3ND9 A;  3A54 A;  1SNO A;  5K5P A;  4G7O C;  3VYT A;  2EXZ A;  2HDM A;  3Q0A A;  2K1B A;  2KEC A;  2Y0S B;  2IPK D;  5D14 A;  1EYA A;  3W3A A;  2LFN A;  3IFT A;  1D1I A;  1F77 A;  3KK7 A;  1KLG D;  2H1E A;  4DA2 A;  1BDO A;  4C3J G;  1SAP A;  1XXG A;  4C3I G;  3Q22 A;  5C0X H;  1PFM A;  4IUN A;  3DWA A;  2HQE A;  3SE0 A;  2K04 A;  1KNE A;  1H9M A;  1EZ8 A;  2JA8 B;  3SK6 A;  3K57 A;  3EA6 A;  2K01 A;  4PQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...