5EPKA

Crystal structure of chromodomain of cbx2 in complex with inhibitor unc3866
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
b'EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 2
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5epkA00
3DEOA 1ILPA 2B2TC 3I90A 2KVMA 2H1EA 2K28A 4IUQA 5E4WC 3HP3A 1BF4A 1WTWA 4CJ0B 1WTPA 1SDFA 1WTQA 2SDFA 1IL8A 4ZLTF 3GV6A 5DNFA 2B2VA 5CBEE 4O42A 2HUGA 4X3TA 1J9OA 1DZ1A 3KUPA 4DN4M 2IL8A 3G7LA 3SVMA 2HDLA 3F2UA 1B4OA 1RTOA 4QUFA 1MSHA 1BBXC 1CA5A 1X3PA 1E0BA 1NR4A 1NCVA 3ONAB 5T1GA 2KECA 4X3SA 2J7ZA 1WTOA 5EKIA 1WTVA 1IKMA 2EE1A 2B2YC 2RSOA 3MTSA 4ZKCB 1JE4A 5D14A 2B2UC 2JYOA 1F9SA 2KUMA 2DY7A 1Q3LA 4ZAIA 1HFGA 3TZDA 4CJ1B 4MHEA 1G91A 1CM9A 3DM1A 4LMQD 5D65A 1WVLA 3GV3A 1ILQA 1F9RA 1QE6A 1WTXA 1B2TA 1QG7A 3P7JA 2BDNA 4QUCA 2FFKB 3I91A 2DY8A 1NAPA 4XDXA 4HAEA 1F9QA 1O7ZA 1U4LA 2HCIA 1EQTA 2K1BA 2MGSA 2CVRA 4RA8A 1HRJA 1F9PA 4X3UA 2RSNA 4R9WA 1B3AA 1MSGA 1AP0A 1SSOA 5T1IA 1PDQA 5EPJA 1J8IA 2FINB 1DOMA 4XT1B 1S4ZA 1CA6A 1EIHA 1WTRA 1HHVA 1HUMA 2MP1A 5E4XA 1BNZA 1GUWA 3IFDA 4CJ2C 1M8AA 1PLFA 2B2WA 2K01A 3I8ZA 1XYIA 2X69A 2Q8TA 1RHPA 2FHTA 2L12A 2RA4A 1ICWA 2L1BA 1G6ZA 4ZK9B 2K05A 3D6WA 2KOLA 1NR2A 1ZXTA 3H91A 4UAIA 4IUUA 1C8CA 4IUVA 3I3CA 1U4PA 2HDMA 1WD1A 1LV9A 1TVXA 1G2TA 4XT3B 1ML0D 2KEEA 2NZ1D 1DONA 5EJWA 1EIGA 1KNAA 1SAPA 1O7YA 2B2TA 3R93A 1AZPA 1MI2A 3KBXA 1O80A 1RODA 4IURA 4ZKBB 5CMDA 2K03A 1IKLA 1HUNA 1KNEA 4NW2A 2MJ8A 1JICA 5CBAE 2EPBA 1B50A 2M2LA 4OIJA 5EPLA 3QO2A 2RVLA 3Q6SA 4X3KA 2X6GA 2MPMA 2B2VC 4R8IA 2JP1A 4IUPA 1XX8A 1RTNA 2FJ2A 1EL0A 2K04A 5JJZA 2B2YA 1RJTA 2L9HA 1X32A 5CORA 1A15A 1F2LA 2B2UA 2EOTA 2L11A 3FDTA 1U4RA 1EOTA 3IL8A 1DOLA 1DOKA 4OIKA 2XIWA 1PFMA 1VMCA 2X6LA 1QNKA 2HCCA 2B2WC 2D9UA 4HCSA 4RAUC 4U68A 1BO0A 1MGSA 2KEDA 4RWSC 3DEPA 5EQ0A 5EPKA 1X3QA 3N52A 4HSVA 1AZQA 5COYA 2NYZD 2N88A 2L4NA 2Q8RE 3MWYW 4HEDA 3TN2A 1U4MA 4MN3A 1VMPA 1B53A 1PFBA 2FMMA 3FPUB 2NWGA 2R3ZA 1PFNA 5AFWA 1ESRA 1WD0A 1HA6A 1HFNA 4IUTA 3UI2A 1G2SA 2VXWA 3LWEA 2N55A
chains in the Genus database with same CATH superfamily
5KNCA 3J81i 1PH1A 2EVBA 1Q81C 5FO8B 5DM73 1VQ8A 2R61A 1OXVA 4GOPA 5C0XI 1IYUA 4JCVE 1NY4A 1CHPD 1BBXC 1NJIC 3PQIA 5FLXc 4DGZA 1SJHD 2B3GA 2F0UA 1FGUA 3HEJA 3NENA 4A93H 1A3UA 2HIXA 3RLOA 4CKBA 5I2XA 5LL6S 2VQEL 4L6TB 1IZ6A 3M3YH 4B3ML 3TP8A 4DK1A 1WVLA 2NZOA 2IX1A 2ATWA 1WFQA 2BDNA 2EYFA 2FFKB 5J3BA 1V1PB 4X3UA 1BQQT 3PUVA 3BDCA 1DOMA 3AFQA 3RZDH 3VR4A 2PQEA 4JI1L 3J81E 3M85A 3M4QA 1ENAA 1M8AA 3I8ZA 4OO1H 5KEEA 4JC0A 2NVYB 1C9OA 4IFDH 3H91A 4GN3B 3OYYA 4BY7G 2XWJB 3CCLA 2K52A 3S2HH 3I7FA 5DEHA 3MAQA 2KCNA 5LMNL 4KN4C 3EN2A 3PO3G 3GTQH 3R93A 2JEAI 1TWHH 2CW0C 3OTOL 3OW7A 3FPPA 4L8JA 2K14A 3KF6B 3DM3A 2VUMB 4GN4B 3MXPA 2GN5A 4X3KA 3NSWA 3BZCA 1K8OA 1SNCA 2UU9L 2K5DA 2J4XA 2XIWA 4PZ8A 4L5QA 2D0OA 4JI6L 4YIJA 4RWSC 4BBSB 1E2VA 1PHJA 4DR1Q 5L37A 4KMUC 2DN8A 3H09A 3G6JB 1W2BA 1OXTA 2VXWA 3LWEA 3HOUG 4H02A 1HNXQ 4IJHA 1PXUA 4JI4L 1X6OA 1SYBA 2UUCQ 3PF4A 4LF8L 2WAQE 1B9NA 4O42A 1PV4A 3A7AB 4K2LA 1IL2A 4DN4M 4JV5Q 2WB1B 2AKWB 1Y14B 1CKOA 1NTGA 2ES2A 1I6VC 4F87A 3I55A 1L0YB 4A3LH 4Q0FA 2QGQA 5D14A 3I4NH 1BCPF 1HNWQ 2DY7A 1W6JA 4DNIA 4LF4Q 4A3MB 1SMYD 2NN6H 3DM1A 1C48A 2F0OA 3I91A 1CHQD 4RGOS 4IJLA 4DF7A 3WWVA 4A3BG 4IUNA 3JAMi 1SSOA 5T1IA 1EYDA 5GAGC 5IGFA 4A93B 5KYIA 4K8IA 2GA4B 1CSQA 4A3IG 1JQYD 4Z9CB 4C3IB 1BVSA 2B39A 1NMGA 5IOCA 3MZ5A 2MFIA 2PNHA 1QWYA 2A6HD 1G2TA 1AFPA 3GP7A 1ML0D 4NMZA 1Q82C 1TY2A 1HH2P 5E3FA 1DONA 2KENA 4DK0A 4LFCL 3VA5A 3W2DA 4YY3L 5AJ3L 1B8AA 4J8QA 3KBXA 2QCPX 2XGTA 4OEMB 1JOKA 1SN8A 4R4CA 2IJ0A 1D5XC 3R2TA 3VR3A 4NP5A 1N33L 2LFNA 4KY6A 2VL6A 1XPRA 2VB2X 4DK3C 4HJ9A 3NP8A 3ULJA 5JAVA 1SNDA 3EFXD 4RKLA 1X32A 4DXGA 3JAME 3OWEB 1HZCA 1TWHB 1EIFA 1WCMB 3CW2C 4FNFA 4DU9A 5IE8A 2Q2UA 2ZXPA 2HHHL 3VR6A 1F2MA 4K14A 3OWFA 3MVVA 4KV6A 2VQEQ 4K6LA 1PZKD 3TN2A 4B3MQ 3GD7A 5JVG3 2PQAA 1U4MA 4G7OC 4MN3A 1HTPA 3U58A 4ZUJA 1T9HA 2A6EC 4A3DB 4ZQ3A 1GD7A 2OTJA 3DEOA 4J1MA 3J81c 3KYHC 2K28A 3T16A 3CAMA 4YCUA 4JI1Q 2CWAA 5IODA 2JA9A 4A3GG 3PUWA 4X3TA 1C7YA 2WFWA 2V1CC 4N8FA 3J7AV 1I4XA 3HKZB 4R4OA 5C4XB 1U5KA 3S1QH 2KHSA 1ENFA 2AWOA 4R4TA 2ALYB 3E9IA 1EY4A 3OTOQ 2YV5A 5F2DA 2NB0A 4UHVA 4B9XA 4KTAA 3F8TA 4ZUIA 1TWGB 2PMZB 4HAEA 4GKJL 1RDPD 2JA7B 3H3VI 2CVRA 4LW1A 3L7ZC 1STBA 3I4NB 1KL9A 1Q46A 3D4DA 1LM0A 2JEBI 2PZTA 4LF6Q 2RDFA 4KHPL 1PRTC 1X54A 1PLFA 2K75A 3WOEA 2X69A 4K5VA 3PGZA 3JC66 2KOLA 1A8VA 3S2DB 3A8KE 3HOYG 1LV9A 1Q8IA 2R6GA 2I0QA 1YBYA 2N78A 4IPCA 4NPSA 3PO2B 5I9OA 5D3IB 3HOVB 1Y8NB 4JW0A 4DV7L 1VQ7A 2GVBA 2CH4W 1WYDA 5I4DA 4QCLA 2F0VA 4JI4Q 1HUNA 1V1QA 5FOBB 3GTJH 4HIKA 1Y1VH 2AWNA 2E76C 2X6GA 2B2VC 2F3IA 1TWFB 1RTNA 1XXGA 1LT6D 1QVCA 1U4RA 1LTAD 5M5WB 3TP7A 2QILA 1ET6A 4GS3A 3URYA 2IHEA 3SK6A 5FK9C 2EY2A 1GUGA 4HCSA 2KEDA 5CGKA 4EQ5A 4LF7L 1KLUD 2IW3A 4JG2A 2B63H 5GAHC 1HFNA 2XNAC 1N34L 1TKWB 3I90A 1IBML 3HP3A 5LMNW 3SHLA 1XPUA 1EFID 4GNXC 3J7A5 1KXLA 3A8JE 5KRUA 3CCUA 1LTSD 4ID6A 3GTPH 1V43A 4RFBA 4G57A 4GOPB 1GVPA 1X9NA 4BBRH 5LMUQ 4WJ4A 2F0HA 2F3VA 3MTSA 4M8AA 4LFCQ 4LUZA 2Z4IA 2C9OA 3P75A 5JJKA 4YY3Q 1LO5D 4JBJA 1Q3LA 1LTGD 5IGEA 5AJ3Q 1GHKA 1QVGA 2R7ZB 1G91A 2QA4A 1PTOD 1JORA 1CZGA 1YI2A 1SYEA 4DV4L 2WKDA 1N33Q 3CQZB 1O7ZA 1UEBA 2HCIA 3CCQA 1VDZA 1C0AA 2JA6G 5IP7G 4FF1A 3JAMc 3S1QB 4A75A 3G48A 3CCRA 4X64L 1HUMA 5BN4A 3I56A 1DXMA 2OTLA 1VQBA 1ZXTA 1FNVA 5CV9A 2AUKA 5J39A 4DR2Q 1IXRA 4NXML 1LTLA 4F88A 1BCPC 4A3EH 1ZYRD 4DAVA 2WAQB 4GNXA 2WACA 2D0PA 3CC7A 3BZDB 4OIJA 5EPLA 5C6AA 2LXJA 4A3FB 2RVLA 5FLXL 3J80L 1CKMA 1J5EL 1CSPA 1QB5D 1XX8A 4F7XA 4RKBA 5ELEA 1F2LA 3A74A 2LY7A 5M3FG 3FDTA 3BYTB 5FLXE 4DUZQ 2VB3X 2A1AA 3G71A 4C3JH 1YNND 2F1MA 1SJED 1Y1VB 2N88A 4RMFA 2B63G 2JK8A 1PTOH 1VCIA 3E9HA 3I4MB 4GLVB 2NTSA 4GKJQ 3W1GA 1HTLD 1M90C 4A76A 1Q8KA 2H1EA 1L2FA 4CJ0B 2BE5D 2ZT9C 2SDFA 3WDNA 3HFZB 3F2BA 3ITPA 5CBEE 1TIID 2IX0A 3NEMA 4PZ7A 4BWGB 5CV6A 1GM5A 2HDLA 2EQSA 1YNJD 3K6OA 3MXNA 4LUVA 1TS4A 1X65A 1J6QA 3FKIB 3HOXG 1L0WA 1S72A 4KHZA 4QMGA 1WTVA 3ULLA 5JVH3 4RCOA 4XQNA 4L5SA 1D1IA 2B2UC 4AYBE 3PSIA 2KUMA 4MZ9A 2L0CA 2Y0SG 4HMIA 4XYQA 1KLGD 3T1HL 4LK1C 4P73A 2N49A 4KY7A 1S5ED 2CHBD 1EIHA 1RCVD 3BVGA 5NUCA 4PV1C 4OWTB 4NXNL 1JMCA 4GN5A 3STBC 1SNMA 1T5EA 1CTMA 1KABA 4DV2L 4JBKA 2ZJPA 2MUYA 1YHQA 5M3MB 1Y69U 3I72A 4TSSA 3AQQA 4TVAB 2PZWA 2JA5G 2N8NA 2Z4HA 4N8X1 1TS5A 1HZ9A 4C56C 4EX5A 3TBIB 3CCMA 2R93H 1N34Q 1JCKB 1E24A 1O80A 1IBMQ 4IALA 2JQOA 3QJYA 2BA1A 2KCCA 5IGGA 1H95A 1HZAA 4YWLA 3SXHA 1EIYB 4JV5L 1YZ6A 3PIO3 2F0LA 4JVZA 4EGVA 2VUMH 2B2UA 4Y52H 5E7NA 1YHAA 2A19A 4TKOB 1ET9A 2RCNA 4RAUC 1HNWL 1MGSA 2WIIB 4OL7A 3KBGA 1AZQA 4A3CH 2R92B 3HS0C 3PIP3 3S1MH 2QF7A 1B53A 4C2MB 2GVAA 5AFWA 1N36Q 4BBSH 2R7DA 1DZ1A 4YHHL 1Y1WH 2PQAB 4C3JB 4HSPA 4X64Q 3U50C 2PPBC 1SMXA 2KBNA 3S9WA 1K0SA 2KCTA 5EAYA 2E2IH 5G3LF 4CKEA 4DV1Q 1DD2A 1WOCA 2NBFA 1V8QA 5CYUA 4N9TA 4DR6L 4NXMQ 2RSOA 4G7ZC 4HMJA 1DYQA 1TXYA 3OMGA 1EU3A 3KLWA 3K5LA 4RHSA 4V0BA 2TMPA 5BN5A 1Z9FA 4RCNA 3NBHA 3PF5A 1V9PA 4QUCA 1E2WA 2A68C 3PV0A 4A3MH 2K1BA 1PRTF 4XXEA 1J5EQ 4A3KB 1N9WA 3MEFA 1D8LA 1WTRA 3CP0A 1Q7YC 2F4VQ 4U673 3D4WA 1ASYA 2ASBA 4K5WA 1STAA 4OELB 2IY5B 1EZ8A 3UDFA 3I4OA 3D0FA 3I70A 4YCWA 3E5SA 2EIFA 4C3IH 1VQOA 4CDEC 4LJZC 1P8LA 1SEBD 2C5CA 3K0XA 3J81L 2O5IC 4OGQC 3KDFB 1PH2A 1EEID 3K81C 2Q8IB 4UPAA 1UE1A 1TU2B 3LX0A 2K5HA 1FNWA 1X3FA 1LT4D 2AHOB 2XVSA 4RH6A 3T56B 3T53B 5HGTA 2RF4A 4UDUC 2QEXA 3NBIA 2K7VA 4ME3A 4JI7L 2XWBB 3KLRA 3B6YA 3H3VC 1FR3A 2F3WA 1IBKL 2R93B 1XTDA 4DV0L 1GUTA 3IL8A 1I4RA 5FLMH 3BS1A 1EQQA 2B2WC 2D9UA 1CFMA 5IP9H 4DPGA 1WCMH 3A8IE 1PH4A 5CC4A 1E1TA 4BBSG 3BDOA 2SNSA 1I50H 4KY5A 4H44C 3T1HQ 1YJ9A 3UI2A 5C0XH 2P5ZX 3H0GB 1V1OA 3O13A 4B3TQ 1CQVA 1WTQA 3C1EA 4A3DH 1GUOA 4ZLTF 4NXNQ 4LF6L 3S1MB 1VQDA 2K4KA 3SGIA 4DV2Q 1PRTB 1CA5A 2WB1G 2SEBD 2ENBA 4DFAA 1Y1WB 1E3PA 2VS1A 4WJ3M 1F9SA 3Q23A 1I6HH 1EY0A 4ZAIA 1HFGA 3M7GA 3K7UC 3TZDA 5IYBH 5JJLA 4R1JA 2E2IB 3J7YW 5C4XH 5K5PA 2E2DC 4A3MG 1FVIA 3C1FA 3D3RA 3KFUA 4XIGS 3BVZA 1JC7A 1JOOA 1KDCA 1SXTA 5HURA 1KD1C 3GTKB 1HRJA 1RD9D 2K5QA 2DNCA 3NQIA 3K5NA 4PMWA 3FRPB 5DM63 1TWGH 2JA7H 4QL5A 4A93G 1GUWA 3IFDA 2BH8A 1EYAA 2B2WA 1RL2A 4DKAC 3E6ZX 1K9MC 1MJEA 2L12A 5IIFA 3TRZA 2EDGA 2K05A 4C3IG 5ELBA 2QDBA 1VQJA 2F0IA 4POFA 1DJRD 2KEEA 1IW7D 5J1ZA 5M9OA 3S2DH 4YHHQ 5I2YA 4JI5L 3N6RA 3UDXA 3MEHA 2RQXA 3PUXA 3PO2H 3TSSA 3HOVH 4OO1G 4I7ZC 1QOHA 2XRSD 4IFDG 4GNXB 5IT9c 1XTCD 3TREA 4EQNA 4DR6Q 4AYBB 2EOTA 4HN7A 3ZYYX 5LMUL 1A2TA 1DOLA 5IP9G 1JWSD 1TWFH 1WCMG 2QEJC 4JI3L 3HOZB 5C44H 3SK8A 2NVQB 5EQ0A 1YJWA 3GTMH 4DV6L 2L4NA 2D5DA 5M5WH 3J7AF 4LF5L 3JAML 5M5YH 3I73A 4IUTA 2XSCA 3P1HA 1ILPA 2ZTDA 2JA8B 4A3DG 5E4WC 3BJUA 4ZRZA 5GQOA 3RNUA 3X3NA 4A3BB 3GV6A 3S14H 2HD3A 4P2CB 1J9OA 3KUPA 3F1ZA 2NTTA 2O2LD 1KQSA 4K8JA 2RCFA 1I50B 4EQOA 3IAYA 2YYZA 4IQZA 5KGUA 5I6YA 1MHWC 3PCOB 1A3VA 1FYCA 4DR2L 1II3A 3HKZG 2F03A 5IYBG 4RG1A 2CFMA 3MXNB 3T4AC 5C4XG 5TSSA 1VQHA 2KQ3A 1BCPB 2VY3A 3M7NA 3H94A 2CQAA 5KNBA 1Z7TA 2EZVA 1L1OC 3CCVA 4RGNA 2R7ZH 3QR8A 1KAAA 4JI8Q 4JI7Q 1KRTA 2Y0SE 3LNNA 2RSNA 2JA7G 4A3LG 2LSSA 4BA1I 4DAPA 3CQZH 1IBKQ 3EJIA 1I6HB 3AU7A 4PQXA 4DV0Q 3I4NG 2F0SA 4IPGA 2RKSA 2F4IA 4HJ7A 2R7FA 4DUZL 4BY1H 2NN6G 2I5LX 1DCZA 4UAIA 5C3XA 5ISRA 2ZJRA 2HT1A 1KAWA 1IHZA 2AQ2B 4EVOA 3L3OC 1KIXA 3PO2G 3K7AB 2A69C 3HOVG 3CHBD 4K6DA 3HZXA 3Q8DA 4DR5L 4NW2A 1JICA 1X3GA 4C3HH 5CBAE 2M2LA 1VF5C 1EOVA 3CC2A 3QO2A 4YWKA 1R9TB 4JBWA 1PA6A 2DJGC 2CW0D 4X66L 3CMAA 2ZJQA 2L9HA 1Y8OB 4A3FH 1VQCA 1TWCB 2LS01 1VQ9A 5FJ8H 3K59A 3DMUA 4U68A 2EYMA 3CCJA 1TT2A 4OHJA 5GADC 3TEHB 1L1OA 4XQJA 2OQKA 4ZYSA 1KHIA 1D2BA 1SE8A 2NWGA 3C2PA 3C3LA 1WD0A 1JWUD 3E0JA 1E2ZA 1HR0L 5ELFA 3RLNA 4A3JH 5KNDA 5C44B 1JWMD 3I4MH 2JN4A 1HCZA 4IN3A 1LLRD 2RHQB 3GTMB 1UE5A 3CCSA 4QB4A 3OPOA 5EBDA 3DHQA 3CC4A 2PO4A 4FF3A 3FHWA 4FXKC 4DAYA 1E0BA 1NCVA 3QWNA 5M5YB 4FO2A 3C46A 4X3SA 2J7ZA 1BUVT 1JJCB 4YCVA 5EKIA 4PMBA 4OX9L 1JE4A 5JPMC 3FKIH 3H3VH 3S14B 4JI5Q 2MQHA 3HGBA 5C4ZA 3NTHA 2LMCB 2NZHA 3EIVA 4WORA 1Q1BA 1QE6A 4RGMA 3RR5A 2R7ZG 2XTIA 1ENCA 4B3SL 3M4OH 5GROA 4RA8A 1SYGA 2K5VA 3NBHB 4NB3A 3OIQA 1CA6A 1NBWA 3HKSA 2HIVA 4LUOA 4QIWE 4JI3Q 1H9SA 4ZK9B 1SRUA 3G6EA 1SROA 2Z6KC 1C8CA 1KTKA 4IUVA 4DV6Q 3W3AA 1TVXA 4IFDJ 4RGTA 4J6HA 1OO9B 4LF5Q 4GKKL 3EBEA 3ERQA 1N36L 3AYHB 5A2QL 3M9BA 5M3MH 1Y8PB 1LT3D 1IKLA 4APVA 3IKJA 3RMHA 4BY1B 3RD4A 1I4QA 3MA2B 4KD3A 2WAQG 2F0PA 2VNUD 5A2QE 1EWIA 1MBYA 2EY5A 1PYBA 1E7ZA 2A74C 1G51A 4P75A 2MPMA 4O1NA 2PNRC 3TZUA 4A3FG 4DV1L 1FNUA 5HY6A 5FJ8G 3WOFA 3TP6A 5D3DA 1QNKA 1B3QA 4C3HB 5JPNC 1YJNA 2BCOA 2F0EA 2YU9B 3S1NB 1SE2A 3H15A 3U4ZA 1Y1VG 2Q2HA 3VR5A 2A5HA 1B70B 1QUQA 3DWPA 4Y7NB 2R92H 3X3MA 4L63B 2ZXOA 1SYFA 2N55A 3I4MG 2YTXA 4C2MH 1H9KA 1VF7A 3T1YL 1WTPA 2G9HD 4YWMA 1HNZL 2F52A 2A6ED 2F4VL 2Z1CA 2Z6KA 1ZKOA 2EYLA 1W6KA 2PCFB 1MSHA 1DM0B 3ONAB 4PNYA 2KECA 1LACA 1PVOA 2B2YC 4A3JB 3FKIG 1BR9A 4ZKCB 3FMCA 1LTRD 4CJ1B 3S15H 1CM9A 4LMQD 1Z47A 2RDGA 3GV3A 1HA5A 5IGBA 4DR5Q 5G3LD 2JJQA 2DY8A 4I65A 1JJ2A 2EXZA 3I2ZA 1F9QA 1U4LA 2F0QA 2MGSA 1XWEA 5K36H 5BN3A 4X65Q 1WTHA 3OOCA 4X66Q 2Z0SA 1J8IA 4BBRG 1PYSB 3T13A 5JOBA 4IOCA 4HCEA 3DXJC 1YVCA 1TS3A 5C3EH 4A3KH 3CRLC 4FYDA 4TQUS 4DR3L 3M4OB 4DNTB 2NVTH 1PRTD 5M3MG 3VR2A 2KHIA 4DR7L 1PH5A 3CF5A 2UUAL 3R3OA 1FL0A 3J81j 1MI2A 1HR0Q 1K8MA 3UE1A 2BDOA 2I07B 1XJVA 4B3TL 2MJ8A 2RBMA 1CK1A 2ZXRA 2AMCB 3Q6SA 3RN5A 1I4HA 1ONLA 1HXYD 3DUZA 1BDOA 2B2YA 2EXDA 1A15A 3K0YA 4A3EG 4GLXA 4OX9Q 3UE0A 1QZHA 1YEZA 1TS2A 4CBVA 4A4IA 3HOXB 1M1KC 1BO0A 1Q12A 3CRKC 5EBCA 3KJOA 4S3SA 2FMMA 4NKLA 2R92G 3HOWB 2Y0SB 2R3ZA 4B3SQ 2PW7A 1GHJA 1PZJD 4HTHA 4G7HC 1BF4A 2K32A 2ICIA 4DNRB 1SDFA 3A7LA 3KF8A 4ILWA 1VQGA 2HUGA 2I5HA 4C3JG 5BR8L 2IT1A 3HRZC 2IX3A 3H0GH 2VQFL 2E2JH 3R2IA 1SMYC 1WTOA 1GJXA 1EYCA 1D7QA 1IBLL 4GKKQ 4B08A 1VQFA 1H9JA 2DUDA 3SK4A 1PH7A 3H6MA 1H9RA 1EY6A 3W1BA 1EQVA 2F0DA 2QKIC 4C1NK 4P72A 4KJOA 1ICFB 5IT9L 1X55A 4FP5D 1VQKA 1UNSA 2UXDL 4R9WA 1AP0A 1PH8A 1AH9A 2A6HC 1FJGL 3UDGA 2TSSA 4UP9A 3SR1A 1TR5A 4GZYC 4A3KG 3S15B 5IT9E 3GTKH 1O78A 2JXMB 5KIXA 1HR0W 3PIOA 1BKBA 2L1BA 1VQMA 2ZM6L 1CKNA 1O7IA 2BH2A 2E75C 2E5LL 1A3TA 1PZID 1K73C 2K5NA 4IZ8A 1VQ6A 4OO1I 4BXXH 2L5TA 1IYJB 5IGDA 1EYGA 1O7YA 4IFDI 3PIPA 2OCEA 4UP7A 2CCZA 2VW9A 4IURA 2I5MX 3MC0B 3GTOB 4BA2I 5C3EB 1TQOA 3T1YQ 4V190 5C4HA 1KNEA 1HNZQ 4QGUA 4CDFC 2DJFC 1RIPA 2B29A 2A73B 1BCPD 4JOIC 5DLQE 4KD4A 3TQYA 1E22A 2H4OA 4FXDA 2NVTB 2JP1A 4K0KQ 1I4GA 1EUJA 1SNPA 3HOUH 2IHFA 2WP8J 3L0OA 4KKTA 1XNQQ 1EOTA 2G5DA 2I46A 2R93G 3S16B 1VMCA 3NQTA 3VA7A 2HCCA 2QDLA 3J80c 1OTCA 1VQIA 4N9PA 4IPDA 3OMCA 1CZWA 3CPFA 3FPUB 1VQ4A 3NTKA 1XMQL 3HOZH 1NE3A 2NVQH 4HR7B 1PMRA 3CU7A 3BYYB 3P7JA 4JI8L 1L1OB 1B1ZA 2SOBA 2VUMG 5EGTA 1WTWA 3K57A 4WFN3 4B3RL 3H0GG 4QIWB 4KN7C 5ELNA 1D6EC 1VQAA 4AQYL 1PH6A 3F2CA 2JA8H 3VYRA 2PYKA 4A3CG 1B4OA 3ND8A 4DR3Q 3GTGB 2KCMA 1NR4A 1Z6HA 4LNQA 1I5FA 4A3BH 2Z9HA 5M5XH 2EE1A 1EWHA 1IYVA 2VZAA 1F2ZA 3FVQA 4DR7Q 1Y1WG 2ZTEA 4ZCKA 4DAYB 4A3IH 2UUAQ 3S17H 4X6AH 3V2TA 5JEAH 2EY6A 2E2JB 5CV7A 1RKNA 1ILQA 4JOIA 4H13C 4IPHA 4XQQA 2OWOA 4DUYL 3Q0AA 3NPPA 4LF9Q 5FKAC 1EQTA 4LWCA 3D8GA 1K0RA 4XTCS 2NN6I 1VQ5A 5IWAL 1PDQA 2FINB 5E4XA 3BDLA 4HIOA 4QQBX 1U9RA 1XMOL 2UXCQ 3SE0A 1RHPA 3TS2A 4BY7B 1G6ZA 1CQFA 1ICWA 3DWAA 2OEOA 2WKCA 1PH9A 1K83B 4WRDA 5KYLA 3I3CA 1U4PA 3VYUA 4DK6C 4BXXG 3MFYA 1ESFA 3PO3B 1Q90A 5EJWA 1H9SB 4ALPA 3STBD 2DGYA 4CGYB 4KK7A 1DGSA 1EZ6A 1GUNA 1QZGA 1RODA 5EKKA 3KLSA 4MTKA 2F0KA 2EPBA 2BA0A 5BR8Q 3K7AH 4DAMA 2AQ1B 2VQFQ 1YIJA 2F0WA 3VDYA 1MKHA 2OQ0A 4IUPA 1EL0A 5JJZA 4Q5VA 1R9TH 2G9DA 4OIKA 1IBLQ 2LKVA 2Z8LA 4GLAC 1AW7A 3PUYA 4AYBG 4A3GH 2L55A 3DEPA 3M4YA 2ID0A 3RUZA 2JSOA 4HEDA 4K2KA 3HOZG 1A0IA 4LFBL 1TWCH 1VMPA 2LXKA 2UUBL 2K5WA 3HOUB 1ESRA 2UXDQ 3G4SA 1G2SA 4XDXA 2N3SA 1FJGQ 1LTBD 3SDZA 1HJPA 1VQLA 5FLMG 3AEVA 1QUQB 2JA8G 1MD2D 4OWWB 3IRBA 2EYJA 4HJ8A 4CDCC 1SBBB 2SNMA 3G7LA 2UXBL 1R4PB 4QUFA 4ABNA 2ZM6Q 2HQLA 2E5LQ 1PTOC 4LFAQ 3AFPA 3GTLH 3M3YB 2V4DA 5JEAG 4OWXB 5C0XG 4AIMA 3S1RH 1BOSA 1CUKA 2QW7A 1JB3A 1A2UA 4JI0L 1N32L 1F9RA 2B8GA 1QILA 1SLJA 4OONA 2MO1A 3HOYH 1NSNS 5EKLA 3RZDB 1UE6A 5M5XB 2CKZB 3S24A 5CR3A 1MSGA 1A63A 3RLFA 2RHSB 3S17B 4A3IB 1S4ZA 4EQPA 4BS9A 2WV6D 1STNA 1EY5A 4PMCA 2A68D 5A35A 3TMEA 3S2HB 3QIAA 2Q8TA 1ZYRC 2NVXH 1I3QH 3NXWA 1UEAB 3D6WA 3GTQB 1I94L 4DR4L 5H1SE 1WD1A 4XT3B 1LT5D 1HQMC 3NELA 5IGCA 1XMQQ 1NMFA 3ULPA 1KNAA 1B44D 1AZPA 1BBWA 2E8GA 4P71A 1AN8A 5CV5A 3VYSA 5I6WA 4JBMA 4E6IA 3AMUA 2K03A 3QG1A 2EJFC 4FF2A 3A54A 4B3RQ 1SFOH 2XRQD 2WINB 3NTIA 2MO0A 3NUCA 4AQYQ 5IYDH 5IY0A 1YNNC 1H9MA 2EYPA 2FJ2A 2PW5A 2F0FA 3GDEA 4JYAL 4KLKA 3D4RA 1DOKA 1STGA 4HIDA 2X6LA 1HZBA 3OIPA 3V96A 1JT8A 1VQNA 3ER0A 1S3OA 1N8RC 5EPKA 3N52A 1KC8C 5COYA 2Q8RE 3MXGA 2OT2A 2BE5C 3U9SA 3ND9A 3K8AA 2RDHA 4DUYQ 2M9VA 5LMNQ 3ICEA 1PFNA 1CT1D 5I9PA 1Q86C 1I4PA 5E1FA 3J7ZC 2YU9H 2ICEC 3S1NH 1QCBD 3PUZA 3M4PA 2B2TC 1YNJC 1A62A 2KVMA 5IWAQ 4X65L 4A3GB 1Q1EA 1JE5A 4Y7NH 4B9WA 1X3EA 1IL8A 3A5ZB 3EA6A 4UY8C 5C44G 1QJOA 1XMOQ 3OSOA 4WJWA 3SVMA 1RTOA 4JI2L 1G6PA 1X3PA 5T1GA 1KDAA 3QOJA 2PI2A 2JA6H 5IP7H 1VQEA 2UU9Q 4L5RC 2EY1A 3KF8B 3RN2A 3TP5A 3R8BA 3KK7A 1SE3A 1XPOA 4DA2A 2D62A 4JI6Q 2YTYA 1GO3E 1XNRL 1L0XB 1LUZA 3KDFA 3QB3A 1EY9A 1LTTD 1EFWA 1V1PA 3NE5B 4TRDA 5D65A 1WTXA 2F0GA 1QG7A 1NNXA 1NAPA 1ZEQX 4DXFA 1R4QB 3GTLB 1YNXA 2K6AA 1WI5A 1S40A 5IYCH 1B3AA 4H7BA 5EPJA 3U9OA 1G291 3S1RB 2E2HH 3AB9A 2Q2TA 4LF8Q 1AE3A 2MP1A 2ZTCA 4CJ2C 2K01A 1XYIA 1KRSA 4J15A 4R4IA 3CPWA 3HOYB 4K5XA 5GAEC 1JJGA 4IUUA 2HDMA 4ME5A 3SEBA 4HJAA 4LFBQ 5C5MA 5J22A 1O7LA 4QF4A 2NZ1D 3ZJYC 3EQLC 2UUBQ 3TDQA 5C4JH 5M3FH 2B2TA 1CKNB 3EROA 4FDBA 3KF6A 3HG9A 2J0TD 4DV3L 4ZKBB 4PZ6A 2PI2E 4QY7A 2NVXB 1I3QB 5IYDG 1QNUA 1YITA 4FXGC 1P16A 3TS0A 4BY1G 4X62L 1HPCA 2UXBQ 3DWQA 1UUPA 4R8IA 1GUSA 1G8ZD 1SE4A 4CDDC 2PZUA 1PFSA 3IFTA 2L11A 3T51B 1BXTA 5CV4A 2AUJD 5C3WA 3I4LA 4FVMA 5ELOA 1SFOB 2F0NA 3U4VA 4CKCA 2K33A 1EEFD 2JE6I 4JI0Q 2NYZD 3MXUA 1OXSC 4C3HG 1N32Q 4PG3A 1YHBA 1FGBD 3HOXH 3Q22A 1EU4A 2A8VA 4OXPA 1SYDA 1S5CD 5FO7B 1NUCA 2F0TA 1TWAH 2OXPA 2B8FA 4R8NA 5JEAJ 5C0XJ 4IO9A 1F2YA 3NWTA 4XYOA 3HOWH 1D5ZC 1GXDC 1SNOA 3GQBA 2KA7A 4KKSA 5DNFA 2B2VA 3CXCA 3K58A 3E0EA 2IL8A 3BZKA 1K8AC 3NWSA 4HJ5A 3F2UA 1D5MC 3CKIB 4ODGA 3J80i 1I94Q 4DR4Q 3NK9A 5HGQA 1EQRA 4JPBW 2HHHQ 1T5XD 3LWUA 2JYOA 4DV5L 3V05A 2O4XA 1K8GA 2M00A 4AH6A 4A3JG 4O2DA 1MJCA 3W5OA 1QVFA 1FD7D 2FXQA 2JA6B 2JA5H 5IYCG 2OF1A 1X56A 1PYWD 1F9PA 3A55A 4CHTB 3Q24A 3NHHA 4K0KL 1C4QA 4M1UB 3UDIA 4JYAQ 4QJFA 4F8MA 4KI0A 4ULLA 1BNZA 1XNQL 1MIUA 1E1OA 2C35B 3CD6A 2CQOA 2Q2IA 2FHTA 2RA4A 3CMEA 1TY0A 2FMCA 2WB1E 1B9MA 3MHBA 1GOZA 4KHVA 1UE7A 3J80E 1EIGA 2E2HB 3RZOH 1S5DD 5C5LA 3SK5A 3GTJB 1F77A 1SR3A 1HQRD 1STYA 2D2CC 2DNEA 2MNAA 1LABA 3OHXC 1K3BC 2F0MA 1SYCA 2HQEA 2IWHA 3GTOH 4L5TA 3F2DA 4JI2Q 2A69D 3E3XA 5M3FB 5C4JB 5LL6X 1PH3A 2K04A 2NUCA 1RJTA 1JB7A 5DAUA 3KOJA 3PMFA 4KHPQ 1VS0A 2BOSA 2Z6BA 4H0LC 1XNRQ 1EY7A 1AE2A 2B63B 4NDXA 1X3QA 2KJXA 4MTNA 4I7AA 2XN9C 1K3RA 1W3SA 3BG3A 1GKHA 3S16H 4POGA 1D1KA 4DV7Q 1JR0D 2MHVA 4LF9L 3HOWG 3A56A 1VQPA 1U0LA 1JOQA 3A0JA 4IUQA 3GTPB 2E74C 1EWCA 2O5JC 1A6XA 5ELDA 1PTOF 1UWVA 3FEWX 4BBRB 3VYTA 1ASZA 2UXCL 3CCEA 3K5MA 1SNQA 4R4QA 1STHA 1AEXA 2L15A 1TWAB 4KJNA 3A5UA 1IKMA 2K50A 4O0AA 5LHY1 3GTGH 4MIUA 3FP9A 4LF7Q 4MNOA 3P20A 4MHEA 4DV3Q 4DR1L 1OXUA 1B2TA 4HIMA 4JK1C 2EYOA 4LAAA 2NVYH 4IOAA 2F0JA 3ERSX 3QOLA 4X62Q 1K28A 5ELCA 1M4VA 2AQ3B 3DLLA 1HNXL 1BBUA 4XT1B 1LYLA 2KHJA 3EVQA 5FO9B 2UUCL 1HHVA 1IW7C 3BU2A 1CI3M 4GOPC 3D31A 3L9AX 2JA5B 4A3EB 1NR2A 1UAPA 3LGJA 5CV8A 1WJJA 3GO5A 1STEA 4RHRA 4BY7H 3D6CA 5JJIA 3HKZE 1KDBA 5K36G 1SAPA 3K5OA 1K83H 1S5BD 2CWPA 4LF4L 2H5XA 4C1NI 3PO3H 5CMDA 1LTID 2EJGC 4DV4Q 1EY8A 1B7YB 5C3EG 1B50A 2EJMA 2IPKD 3OW2A 4FF4A 2PMZE 3MFGA 1S5FD 2CH4A 3RZOB 4P74A 5CORA 4LFAL 4G4KA 2YTVA 3K80C 4KKUA 1PTOB 1PFMA 4DV5Q 1RF2D 3KLSX 3KJPA 2EYHA 3BVMA 4HSVA 4UP8A 3MWYW 3L2PA 1PFBA 1OXXK 1HA6A
chains in the Genus database with same CATH topology
5KNCA 2EVBA 5FO8B 5DM73 2R61A 1OXVA 5C0XI 1IYUA 1CHPD 1BBXC 4DGZA 1SJHD 2F0UA 3HEJA 1A3UA 4CKBA 5I2XA 5LL6S 4L6TB 3TP8A 4DK1A 1WVLA 2IX1A 2BDNA 2EYFA 2FFKB 1V1PB 4X3UA 1BQQT 3PUVA 3BDCA 1DOMA 3VR4A 2PQEA 3J81E 3M85A 1ENAA 1M8AA 3I8ZA 4OO1H 5KEEA 2NVYB 4IFDH 3H91A 2XWJB 5DEHA 3MAQA 2KCNA 4KN4C 3R93A 2JEAI 2CW0C 3OW7A 3FPPA 4L8JA 2VUMB 3MXPA 4X3KA 3NSWA 1K8OA 1SNCA 2K5DA 2J4XA 2XIWA 4YIJA 4RWSC 4BBSB 1E2VA 4KMUC 2DN8A 3H09A 3G6JB 1OXTA 2VXWA 3LWEA 1PXUA 1SYBA 1B9NA 4O42A 3A7AB 4K2LA 4DN4M 2WB1B 1I6VC 4F87A 1L0YB 4Q0FA 5D14A 1BCPF 2DY7A 1W6JA 4A3MB 1SMYD 2NN6H 3DM1A 1C48A 2F0OA 3I91A 1CHQD 4RGOS 4DF7A 4IUNA 1SSOA 5T1IA 1EYDA 5IGFA 4A93B 5KYIA 4K8IA 2GA4B 1JQYD 4Z9CB 4C3IB 2B39A 5IOCA 3MZ5A 1QWYA 2A6HD 1G2TA 1AFPA 3GP7A 1ML0D 4NMZA 1TY2A 5E3FA 1DONA 4DK0A 3VA5A 3W2DA 4J8QA 3KBXA 2QCPX 1JOKA 2IJ0A 1D5XC 3R2TA 3VR3A 4NP5A 2LFNA 4KY6A 2VB2X 3NP8A 5JAVA 1SNDA 3EFXD 4RKLA 1X32A 4DXGA 3JAME 3OWEB 4DU9A 1TWHB 1WCMB 4FNFA 2ZXPA 3VR6A 1F2MA 4K14A 3OWFA 3MVVA 4KV6A 4K6LA 1PZKD 3TN2A 3GD7A 5JVG3 1U4MA 4G7OC 4MN3A 1HTPA 4ZUJA 2A6EC 4A3DB 4ZQ3A 3DEOA 4J1MA 2K28A 3T16A 5IODA 3PUWA 4X3TA 3J7AV 1I4XA 3HKZB 5C4XB 2KHSA 1ENFA 2AWOA 1EY4A 5F2DA 2NB0A 4B9XA 4KTAA 4ZUIA 1TWGB 2PMZB 4HAEA 2JA7B 1RDPD 2CVRA 3L7ZC 1STBA 3I4NB 3D4DA 2JEBI 2PZTA 2RDFA 1PRTC 1PLFA 3WOEA 2X69A 4K5VA 2KOLA 3S2DB 3A8KE 1LV9A 1Q8IA 2R6GA 3PO2B 5I9OA 5D3IB 3HOVB 1Y8NB 5I4DA 4QCLA 2F0VA 1HUNA 5FOBB 2AWNA 2E76C 2X6GA 2B2VC 1TWFB 1RTNA 1XXGA 1LT6D 1U4RA 1LTAD 5M5WB 3TP7A 2QILA 1ET6A 3URYA 3SK6A 5FK9C 2EY2A 1GUGA 4HCSA 2KEDA 5CGKA 1KLUD 2IW3A 1HFNA 2XNAC 1TKWB 3I90A 3HP3A 3SHLA 1EFID 3A8JE 5KRUA 1LTSD 4ID6A 1V43A 4RFBA 4G57A 2F0HA 2F3VA 3MTSA 4M8AA 2Z4IA 2C9OA 3P75A 1LO5D 1Q3LA 1LTGD 5IGEA 1GHKA 2R7ZB 1G91A 1PTOD 1JORA 1CZGA 1SYEA 2WKDA 3CQZB 1O7ZA 2HCIA 1VDZA 4FF1A 3S1QB 1HUMA 5BN4A 1DXMA 1ZXTA 1FNVA 5CV9A 2AUKA 5J39A 4F88A 1BCPC 1ZYRD 4DAVA 2WAQB 2WACA 3BZDB 4OIJA 5EPLA 5C6AA 4A3FB 2RVLA 5FLXL 3J80L 1QB5D 1XX8A 4F7XA 4RKBA 5ELEA 1F2LA 2LY7A 3FDTA 3BYTB 5FLXE 2VB3X 1YNND 2F1MA 1SJED 1Y1VB 2N88A 1PTOH 1VCIA 3I4MB 2NTSA 1HTLD 2H1EA 4CJ0B 2BE5D 2ZT9C 2SDFA 3WDNA 3ITPA 5CBEE 1TIID 2IX0A 4BWGB 5CV6A 2HDLA 1YNJD 3K6OA 3MXNA 1TS4A 3FKIB 4KHZA 4QMGA 1WTVA 5JVH3 4RCOA 4XQNA 1D1IA 2B2UC 2KUMA 2L0CA 4HMIA 4XYQA 1KLGD 4LK1C 4KY7A 1S5ED 2CHBD 1EIHA 1RCVD 3BVGA 5NUCA 4PV1C 1SNMA 1T5EA 1CTMA 1KABA 2MUYA 5M3MB 1Y69U 3I72A 4TSSA 2PZWA 2Z4HA 1TS5A 4C56C 3TBIB 1JCKB 1O80A 4IALA 3QJYA 2BA1A 2KCCA 5IGGA 3SXHA 3PIO3 2F0LA 4EGVA 2B2UA 4TKOB 1ET9A 4RAUC 1MGSA 2WIIB 4OL7A 3KBGA 1AZQA 2R92B 3HS0C 3PIP3 2QF7A 1B53A 4C2MB 5AFWA 1DZ1A 4C3JB 4HSPA 2PPBC 3S9WA 5G3LF 4CKEA 1DD2A 2NBFA 1V8QA 5CYUA 4N9TA 2RSOA 4G7ZC 4HMJA 1DYQA 3OMGA 1EU3A 3K5LA 4RHSA 4V0BA 2TMPA 5BN5A 4RCNA 3NBHA 4QUCA 1E2WA 2A68C 3PV0A 2K1BA 1PRTF 4XXEA 4A3KB 1WTRA 4U673 3D4WA 4K5WA 1STAA 1EZ8A 3I70A 3E5SA 4LJZC 1SEBD 2C5CA 3J81L 2O5IC 4OGQC 1EEID 2Q8IB 1TU2B 3LX0A 1FNWA 1LT4D 2XVSA 4RH6A 3T56B 3T53B 5HGTA 4UDUC 3NBIA 2K7VA 2XWBB 3KLRA 3H3VC 1FR3A 2F3WA 2R93B 1GUTA 3IL8A 1I4RA 3BS1A 2B2WC 2D9UA 1CFMA 3A8IE 5CC4A 3BDOA 2SNSA 4KY5A 4H44C 3UI2A 5C0XH 3H0GB 1V1OA 3O13A 1CQVA 1WTQA 3C1EA 4ZLTF 1GUOA 3S1MB 1CA5A 1PRTB 2SEBD 2ENBA 4DFAA 1Y1WB 1F9SA 3Q23A 1EY0A 4ZAIA 1HFGA 3M7GA 3TZDA 2E2IB 3J7YW 5K5PA 2E2DC 3C1FA 3D3RA 4XIGS 3BVZA 1JC7A 1JOOA 1KDCA 1SXTA 5HURA 3GTKB 1HRJA 1RD9D 2K5QA 2DNCA 3NQIA 3K5NA 4PMWA 3FRPB 5DM63 1GUWA 3IFDA 1EYAA 2B2WA 3E6ZX 2L12A 5IIFA 2EDGA 2K05A 4C3IG 5ELBA 2QDBA 2F0IA 1DJRD 2KEEA 1IW7D 5J1ZA 5M9OA 5I2YA 3N6RA 3MEHA 2RQXA 3PUXA 3TSSA 4OO1G 4I7ZC 1QOHA 2XRSD 4IFDG 1XTCD 4EQNA 4AYBB 2EOTA 4HN7A 3ZYYX 1A2TA 1DOLA 1JWSD 2QEJC 3HOZB 3SK8A 2NVQB 5EQ0A 2L4NA 2D5DA 3J7AF 3JAML 3I73A 4IUTA 2XSCA 3P1HA 1ILPA 2JA8B 5E4WC 4ZRZA 3X3NA 4A3BB 3GV6A 4P2CB 1J9OA 3KUPA 2NTTA 2O2LD 4K8JA 1I50B 4EQOA 3IAYA 2YYZA 4IQZA 5KGUA 5I6YA 1A3VA 1FYCA 1II3A 2F03A 3T4AC 5TSSA 3M7NA 2KQ3A 1BCPB 3H94A 2CQAA 5KNBA 1Z7TA 2EZVA 4RGNA 1KAAA 3LNNA 2RSNA 4BA1I 4DAPA 1I6HB 3EJIA 3AU7A 4PQXA 2F0SA 2RKSA 2F4IA 2NN6G 1DCZA 4UAIA 5C3XA 5ISRA 1IHZA 2AQ2B 4EVOA 3L3OC 3K7AB 2A69C 3CHBD 4K6DA 3HZXA 4NW2A 1JICA 5CBAE 2M2LA 1VF5C 3QO2A 1R9TB 4JBWA 2CW0D 2L9HA 1Y8OB 1TWCB 2LS01 3K59A 3DMUA 4U68A 2EYMA 1TT2A 4OHJA 4XQJA 4ZYSA 1D2BA 2NWGA 3C2PA 3C3LA 1WD0A 1JWUD 3E0JA 1E2ZA 5ELFA 5KNDA 5C44B 1JWMD 4IN3A 1HCZA 1LLRD 3GTMB 4QB4A 3OPOA 5EBDA 3DHQA 2PO4A 4FF3A 4FXKC 4DAYA 1E0BA 1NCVA 3QWNA 5M5YB 4FO2A 3C46A 4X3SA 2J7ZA 1BUVT 5EKIA 4PMBA 1JE4A 5JPMC 3S14B 3HGBA 5C4ZA 3NTHA 2LMCB 4WORA 1Q1BA 1QE6A 4RGMA 1ENCA 4RA8A 1SYGA 3OIQA 1CA6A 1H9SA 4ZK9B 1C8CA 1KTKA 4IUVA 3W3AA 1TVXA 4IFDJ 4RGTA 4J6HA 1OO9B 3ERQA 5A2QL 1Y8PB 1LT3D 1IKLA 3IKJA 3RMHA 4BY1B 3RD4A 1I4QA 3MA2B 4KD3A 2F0PA 2VNUD 5A2QE 1MBYA 2EY5A 2A74C 2MPMA 4O1NA 2PNRC 3TZUA 1FNUA 3WOFA 3TP6A 5D3DA 1QNKA 4C3HB 5JPNC 2BCOA 2F0EA 2YU9B 3S1NB 1SE2A 3VR5A 2A5HA 3DWPA 4Y7NB 3X3MA 4L63B 2ZXOA 1SYFA 2N55A 1H9KA 1VF7A 1WTPA 2G9HD 2A6ED 2Z1CA 1ZKOA 2EYLA 1W6KA 2PCFB 1MSHA 1DM0B 3ONAB 4PNYA 2KECA 1LACA 2B2YC 4A3JB 4ZKCB 1BR9A 3FMCA 1LTRD 4CJ1B 1CM9A 4LMQD 1Z47A 2RDGA 3GV3A 1HA5A 5IGBA 5G3LD 2DY8A 4I65A 2EXZA 1F9QA 1U4LA 2F0QA 2MGSA 1XWEA 5K36H 5BN3A 3OOCA 1J8IA 3T13A 5JOBA 4HCEA 3DXJC 1TS3A 3CRLC 4FYDA 4TQUS 3M4OB 4DNTB 1PRTD 3VR2A 3R3OA 1MI2A 1K8MA 2BDOA 2I07B 2MJ8A 2RBMA 1CK1A 2ZXRA 3Q6SA 1I4HA 1ONLA 1HXYD 3DUZA 1BDOA 2B2YA 1A15A 3K0YA 4CBVA 1TS2A 3HOXB 1BO0A 1Q12A 3CRKC 5EBCA 4S3SA 2FMMA 4NKLA 3HOWB 2Y0SB 2R3ZA 2PW7A 1GHJA 1PZJD 4HTHA 4G7HC 1BF4A 2K32A 2ICIA 4DNRB 1SDFA 3A7LA 3KF8A 4ILWA 2HUGA 4C3JG 2IT1A 3HRZC 2IX3A 3R2IA 1SMYC 1WTOA 1GJXA 1EYCA 4B08A 1H9JA 3SK4A 3H6MA 1H9RA 1EY6A 1EQVA 2F0DA 2QKIC 4C1NK 4KJOA 5IT9L 4FP5D 1UNSA 4R9WA 1AP0A 2A6HC 2TSSA 3SR1A 1TR5A 4GZYC 3S15B 5IT9E 1O78A 2JXMB 5KIXA 2L1BA 2E75C 1A3TA 1PZID 4IZ8A 4OO1I 2L5TA 5IGDA 1O7YA 4IFDI 4BA2I 4IURA 3MC0B 3GTOB 5C3EB 1TQOA 4V190 5C4HA 1KNEA 2A73B 1BCPD 4KD4A 2H4OA 4FXDA 2NVTB 2JP1A 1I4GA 1SNPA 2WP8J 4KKTA 1EOTA 2I46A 3S16B 1VMCA 3NQTA 3VA7A 2HCCA 4N9PA 3OMCA 1CZWA 3FPUB 3NTKA 4HR7B 1PMRA 3CU7A 3BYYB 3P7JA 1B1ZA 2SOBA 5EGTA 1WTWA 3K57A 4WFN3 4QIWB 4KN7C 1D6EC 3VYRA 2PYKA 1B4OA 3ND8A 3GTGB 1NR4A 1Z6HA 2EE1A 1EWHA 1IYVA 1F2ZA 3FVQA 3V2TA 5JEAH 2EY6A 2E2JB 5CV7A 1RKNA 1ILQA 4H13C 4XQQA 3Q0AA 3NPPA 5FKAC 1EQTA 3D8GA 4XTCS 2NN6I 1PDQA 2FINB 5E4XA 3BDLA 1U9RA 3SE0A 1RHPA 4BY7B 1G6ZA 1CQFA 1ICWA 3DWAA 2OEOA 2WKCA 1K83B 4WRDA 5KYLA 3I3CA 1U4PA 3VYUA 3MFYA 1ESFA 3PO3B 1Q90A 5EJWA 1H9SB 4CGYB 4KK7A 1EZ6A 1GUNA 1RODA 5EKKA 3KLSA 2F0KA 2EPBA 2BA0A 2AQ1B 2F0WA 4IUPA 1EL0A 5JJZA 4Q5VA 2G9DA 4OIKA 2LKVA 2Z8LA 1AW7A 3PUYA 2L55A 3DEPA 3M4YA 2ID0A 3RUZA 2JSOA 4HEDA 4K2KA 1VMPA 3HOUB 2K5WA 1ESRA 1G2SA 4XDXA 1LTBD 3SDZA 1MD2D 2EYJA 1SBBB 2SNMA 3G7LA 1R4PB 4QUFA 4ABNA 1PTOC 3M3YB 2V4DA 5JEAG 5C0XG 1BOSA 1JB3A 1A2UA 1F9RA 2B8GA 1QILA 1NSNS 5EKLA 3RZDB 5M5XB 5CR3A 1MSGA 3RLFA 3S17B 4A3IB 1S4ZA 4EQPA 4BS9A 2WV6D 1STNA 1EY5A 4PMCA 2A68D 5A35A 3TMEA 3S2HB 3QIAA 2Q8TA 1ZYRC 3NXWA 1UEAB 3D6WA 3GTQB 1WD1A 4XT3B 1LT5D 1HQMC 5IGCA 1KNAA 1B44D 1AZPA 1AN8A 5CV5A 3VYSA 5I6WA 4E6IA 3AMUA 2K03A 3QG1A 2EJFC 4FF2A 3A54A 2XRQD 2WINB 3NTIA 3NUCA 1YNNC 1H9MA 2EYPA 2FJ2A 2PW5A 2F0FA 3D4RA 1DOKA 1STGA 2X6LA 3OIPA 3V96A 5EPKA 3N52A 5COYA 2Q8RE 3MXGA 2OT2A 2BE5C 3U9SA 3ND9A 2RDHA 2M9VA 1PFNA 1CT1D 5I9PA 1I4PA 5E1FA 2ICEC 1QCBD 3PUZA 2B2TC 1YNJC 2KVMA 4A3GB 1Q1EA 4B9WA 1IL8A 3EA6A 1QJOA 3OSOA 4WJWA 3SVMA 1RTOA 1X3PA 5T1GA 1KDAA 3QOJA 2EY1A 3TP5A 3R8BA 3KK7A 1SE3A 4DA2A 2D62A 1L0XB 3QB3A 1EY9A 1LTTD 1V1PA 3NE5B 4TRDA 5D65A 1WTXA 2F0GA 1QG7A 1NAPA 1ZEQX 4DXFA 1R4QB 3GTLB 2K6AA 1B3AA 4H7BA 5EPJA 3U9OA 1G291 3S1RB 3AB9A 2MP1A 4CJ2C 1XYIA 2K01A 3HOYB 4K5XA 4IUUA 2HDMA 4ME5A 3SEBA 5C5MA 5J22A 1O7LA 4QF4A 2NZ1D 3EQLC 3TDQA 2B2TA 3EROA 3HG9A 2J0TD 4ZKBB 2NVXB 1I3QB 1QNUA 4FXGC 1HPCA 3DWQA 1UUPA 4R8IA 1GUSA 1G8ZD 1SE4A 2PZUA 3IFTA 2L11A 3T51B 1BXTA 5CV4A 2AUJD 5C3WA 3I4LA 4FVMA 1SFOB 2F0NA 4CKCA 2K33A 1EEFD 2JE6I 2NYZD 3MXUA 1OXSC 4C3HG 1FGBD 3Q22A 1EU4A 1SYDA 1S5CD 5FO7B 1NUCA 2F0TA 2OXPA 2B8FA 4R8NA 5JEAJ 5C0XJ 1F2YA 3NWTA 4XYOA 1D5ZC 1GXDC 1SNOA 3GQBA 2KA7A 4KKSA 5DNFA 2B2VA 3K58A 2IL8A 3NWSA 3F2UA 1D5MC 3CKIB 4ODGA 3NK9A 1T5XD 3LWUA 2JYOA 3V05A 2O4XA 2M00A 1FD7D 2JA6B 2OF1A 1PYWD 1F9PA 3A55A 4CHTB 3Q24A 3NHHA 1C4QA 4M1UB 4F8MA 4KI0A 4ULLA 1BNZA 2FHTA 2RA4A 1TY0A 2FMCA 3MHBA 1B9MA 1GOZA 4KHVA 3J80E 1EIGA 2E2HB 1S5DD 5C5LA 3SK5A 3GTJB 1F77A 1HQRD 1STYA 2D2CC 2DNEA 1LABA 3OHXC 2F0MA 1SYCA 2HQEA 2IWHA 2A69D 5M3FB 5C4JB 5LL6X 2K04A 2NUCA 1RJTA 5DAUA 3PMFA 2BOSA 4H0LC 1EY7A 2B63B 4NDXA 1X3QA 2KJXA 2XN9C 3BG3A 1D1KA 1JR0D 2MHVA 3A56A 1JOQA 4IUQA 3GTPB 2E74C 1EWCA 2O5JC 1A6XA 5ELDA 1PTOF 3FEWX 4BBRB 3VYTA 3K5MA 1SNQA 1STHA 1AEXA 4KJNA 1TWAB 1IKMA 5LHY1 4MIUA 3P20A 4MHEA 1OXUA 1B2TA 4JK1C 2EYOA 4LAAA 2F0JA 3QOLA 5ELCA 1M4VA 2AQ3B 4XT1B 3EVQA 5FO9B 1HHVA 1IW7C 1CI3M 3D31A 3L9AX 2JA5B 4A3EB 1NR2A 1UAPA 5CV8A 3GO5A 1STEA 4RHRA 3D6CA 1KDBA 5K36G 1SAPA 3K5OA 1S5BD 4C1NI 5CMDA 1LTID 2EJGC 1EY8A 1B50A 2EJMA 2IPKD 4FF4A 3MFGA 1S5FD 3RZOB 5CORA 4G4KA 4KKUA 1PTOB 1PFMA 1RF2D 3KLSX 2EYHA 3BVMA 4HSVA 3MWYW 1PFBA 1OXXK 1HA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEO A;  1ILP A;  2B2T C;  3I90 A;  2KVM A;  2H1E A;  2K28 A;  4IUQ A;  5E4W C;  3HP3 A;  1BF4 A;  1WTW A;  4CJ0 B;  1WTP A;  1SDF A;  1WTQ A;  2SDF A;  1IL8 A;  4ZLT F;  3GV6 A;  5DNF A;  2B2V A;  5CBE E;  4O42 A;  2HUG A;  4X3T A;  1J9O A;  1DZ1 A;  3KUP A;  4DN4 M;  2IL8 A;  3G7L A;  3SVM A;  2HDL A;  3F2U A;  1B4O A;  1RTO A;  4QUF A;  1MSH A;  1BBX C;  1CA5 A;  1X3P A;  1E0B A;  1NR4 A;  1NCV A;  3ONA B;  5T1G A;  2KEC A;  4X3S A;  2J7Z A;  1WTO A;  5EKI A;  1WTV A;  1IKM A;  2EE1 A;  2B2Y C;  2RSO A;  3MTS A;  4ZKC B;  1JE4 A;  5D14 A;  2B2U C;  2JYO A;  1F9S A;  2KUM A;  2DY7 A;  1Q3L A;  4ZAI A;  1HFG A;  3TZD A;  4CJ1 B;  4MHE A;  1G91 A;  1CM9 A;  3DM1 A;  4LMQ D;  5D65 A;  1WVL A;  3GV3 A;  1ILQ A;  1F9R A;  1QE6 A;  1WTX A;  1B2T A;  1QG7 A;  3P7J A;  2BDN A;  4QUC A;  2FFK B;  3I91 A;  2DY8 A;  1NAP A;  4XDX A;  4HAE A;  1F9Q A;  1O7Z A;  1U4L A;  2HCI A;  1EQT A;  2K1B A;  2MGS A;  2CVR A;  4RA8 A;  1HRJ A;  1F9P A;  4X3U A;  2RSN A;  4R9W A;  1B3A A;  1MSG A;  1AP0 A;  1SSO A;  5T1I A;  1PDQ A;  5EPJ A;  1J8I A;  2FIN B;  1DOM A;  4XT1 B;  1S4Z A;  1CA6 A;  1EIH A;  1WTR A;  1HHV A;  1HUM A;  2MP1 A;  5E4X A;  1BNZ A;  1GUW A;  3IFD A;  4CJ2 C;  1M8A A;  1PLF A;  2B2W A;  2K01 A;  3I8Z A;  1XYI A;  2X69 A;  2Q8T A;  1RHP A;  2FHT A;  2L12 A;  2RA4 A;  1ICW A;  2L1B A;  1G6Z A;  4ZK9 B;  2K05 A;  3D6W A;  2KOL A;  1NR2 A;  1ZXT A;  3H91 A;  4UAI A;  4IUU A;  1C8C A;  4IUV A;  3I3C A;  1U4P A;  2HDM A;  1WD1 A;  1LV9 A;  1TVX A;  1G2T A;  4XT3 B;  1ML0 D;  2KEE A;  2NZ1 D;  1DON A;  5EJW A;  1EIG A;  1KNA A;  1SAP A;  1O7Y A;  2B2T A;  3R93 A;  1AZP A;  1MI2 A;  3KBX A;  1O80 A;  1ROD A;  4IUR A;  4ZKB B;  5CMD A;  2K03 A;  1IKL A;  1HUN A;  1KNE A;  4NW2 A;  2MJ8 A;  1JIC A;  5CBA E;  2EPB A;  1B50 A;  2M2L A;  4OIJ A;  5EPL A;  3QO2 A;  2RVL A;  3Q6S A;  4X3K A;  2X6G A;  2MPM A;  2B2V C;  4R8I A;  2JP1 A;  4IUP A;  1XX8 A;  1RTN A;  2FJ2 A;  1EL0 A;  2K04 A;  5JJZ A;  2B2Y A;  1RJT A;  2L9H A;  1X32 A;  5COR A;  1A15 A;  1F2L A;  2B2U A;  2EOT A;  2L11 A;  3FDT A;  1U4R A;  1EOT A;  3IL8 A;  1DOL A;  1DOK A;  4OIK A;  2XIW A;  1PFM A;  1VMC A;  2X6L A;  1QNK A;  2HCC A;  2B2W C;  2D9U A;  4HCS A;  4RAU C;  4U68 A;  1BO0 A;  1MGS A;  2KED A;  4RWS C;  3DEP A;  5EQ0 A;  5EPK A;  1X3Q A;  3N52 A;  4HSV A;  1AZQ A;  5COY A;  2NYZ D;  2N88 A;  2L4N A;  2Q8R E;  3MWY W;  4HED A;  3TN2 A;  1U4M A;  4MN3 A;  1VMP A;  1B53 A;  1PFB A;  2FMM A;  3FPU B;  2NWG A;  2R3Z A;  1PFN A;  5AFW A;  1ESR A;  1WD0 A;  1HA6 A;  1HFN A;  4IUT A;  3UI2 A;  1G2S A;  2VXW A;  3LWE A;  2N55 A; 
#chains in the Genus database with same CATH topology
 5KNC A;  3J81 i;  1PH1 A;  2EVB A;  1Q81 C;  5FO8 B;  5DM7 3;  1VQ8 A;  2R61 A;  1OXV A;  4GOP A;  5C0X I;  1IYU A;  4JCV E;  1NY4 A;  1CHP D;  1BBX C;  1NJI C;  3PQI A;  5FLX c;  4DGZ A;  1SJH D;  2B3G A;  2F0U A;  1FGU A;  3HEJ A;  3NEN A;  4A93 H;  1A3U A;  2HIX A;  3RLO A;  4CKB A;  5I2X A;  5LL6 S;  2VQE L;  4L6T B;  1IZ6 A;  3M3Y H;  4B3M L;  3TP8 A;  4DK1 A;  1WVL A;  2NZO A;  2IX1 A;  2ATW A;  1WFQ A;  2BDN A;  2EYF A;  2FFK B;  5J3B A;  1V1P B;  4X3U A;  1BQQ T;  3PUV A;  3BDC A;  1DOM A;  3AFQ A;  3RZD H;  3VR4 A;  2PQE A;  4JI1 L;  3J81 E;  3M85 A;  3M4Q A;  1ENA A;  1M8A A;  3I8Z A;  4OO1 H;  5KEE A;  4JC0 A;  2NVY B;  1C9O A;  4IFD H;  3H91 A;  4GN3 B;  3OYY A;  4BY7 G;  2XWJ B;  3CCL A;  2K52 A;  3S2H H;  3I7F A;  5DEH A;  3MAQ A;  2KCN A;  5LMN L;  4KN4 C;  3EN2 A;  3PO3 G;  3GTQ H;  3R93 A;  2JEA I;  1TWH H;  2CW0 C;  3OTO L;  3OW7 A;  3FPP A;  4L8J A;  2K14 A;  3KF6 B;  3DM3 A;  2VUM B;  4GN4 B;  3MXP A;  2GN5 A;  4X3K A;  3NSW A;  3BZC A;  1K8O A;  1SNC A;  2UU9 L;  2K5D A;  2J4X A;  2XIW A;  4PZ8 A;  4L5Q A;  2D0O A;  4JI6 L;  4YIJ A;  4RWS C;  4BBS B;  1E2V A;  1PHJ A;  4DR1 Q;  5L37 A;  4KMU C;  2DN8 A;  3H09 A;  3G6J B;  1W2B A;  1OXT A;  2VXW A;  3LWE A;  3HOU G;  4H02 A;  1HNX Q;  4IJH A;  1PXU A;  4JI4 L;  1X6O A;  1SYB A;  2UUC Q;  3PF4 A;  4LF8 L;  2WAQ E;  1B9N A;  4O42 A;  1PV4 A;  3A7A B;  4K2L A;  1IL2 A;  4DN4 M;  4JV5 Q;  2WB1 B;  2AKW B;  1Y14 B;  1CKO A;  1NTG A;  2ES2 A;  1I6V C;  4F87 A;  3I55 A;  1L0Y B;  4A3L H;  4Q0F A;  2QGQ A;  5D14 A;  3I4N H;  1BCP F;  1HNW Q;  2DY7 A;  1W6J A;  4DNI A;  4LF4 Q;  4A3M B;  1SMY D;  2NN6 H;  3DM1 A;  1C48 A;  2F0O A;  3I91 A;  1CHQ D;  4RGO S;  4IJL A;  4DF7 A;  3WWV A;  4A3B G;  4IUN A;  3JAM i;  1SSO A;  5T1I A;  1EYD A;  5GAG C;  5IGF A;  4A93 B;  5KYI A;  4K8I A;  2GA4 B;  1CSQ A;  4A3I G;  1JQY D;  4Z9C B;  4C3I B;  1BVS A;  2B39 A;  1NMG A;  5IOC A;  3MZ5 A;  2MFI A;  2PNH A;  1QWY A;  2A6H D;  1G2T A;  1AFP A;  3GP7 A;  1ML0 D;  4NMZ A;  1Q82 C;  1TY2 A;  1HH2 P;  5E3F A;  1DON A;  2KEN A;  4DK0 A;  4LFC L;  3VA5 A;  3W2D A;  4YY3 L;  5AJ3 L;  1B8A A;  4J8Q A;  3KBX A;  2QCP X;  2XGT A;  4OEM B;  1JOK A;  1SN8 A;  4R4C A;  2IJ0 A;  1D5X C;  3R2T A;  3VR3 A;  4NP5 A;  1N33 L;  2LFN A;  4KY6 A;  2VL6 A;  1XPR A;  2VB2 X;  4DK3 C;  4HJ9 A;  3NP8 A;  3ULJ A;  5JAV A;  1SND A;  3EFX D;  4RKL A;  1X32 A;  4DXG A;  3JAM E;  3OWE B;  1HZC A;  1TWH B;  1EIF A;  1WCM B;  3CW2 C;  4FNF A;  4DU9 A;  5IE8 A;  2Q2U A;  2ZXP A;  2HHH L;  3VR6 A;  1F2M A;  4K14 A;  3OWF A;  3MVV A;  4KV6 A;  2VQE Q;  4K6L A;  1PZK D;  3TN2 A;  4B3M Q;  3GD7 A;  5JVG 3;  2PQA A;  1U4M A;  4G7O C;  4MN3 A;  1HTP A;  3U58 A;  4ZUJ A;  1T9H A;  2A6E C;  4A3D B;  4ZQ3 A;  1GD7 A;  2OTJ A;  3DEO A;  4J1M A;  3J81 c;  3KYH C;  2K28 A;  3T16 A;  3CAM A;  4YCU A;  4JI1 Q;  2CWA A;  5IOD A;  2JA9 A;  4A3G G;  3PUW A;  4X3T A;  1C7Y A;  2WFW A;  2V1C C;  4N8F A;  3J7A V;  1I4X A;  3HKZ B;  4R4O A;  5C4X B;  1U5K A;  3S1Q H;  2KHS A;  1ENF A;  2AWO A;  4R4T A;  2ALY B;  3E9I A;  1EY4 A;  3OTO Q;  2YV5 A;  5F2D A;  2NB0 A;  4UHV A;  4B9X A;  4KTA A;  3F8T A;  4ZUI A;  1TWG B;  2PMZ B;  4HAE A;  4GKJ L;  1RDP D;  2JA7 B;  3H3V I;  2CVR A;  4LW1 A;  3L7Z C;  1STB A;  3I4N B;  1KL9 A;  1Q46 A;  3D4D A;  1LM0 A;  2JEB I;  2PZT A;  4LF6 Q;  2RDF A;  4KHP L;  1PRT C;  1X54 A;  1PLF A;  2K75 A;  3WOE A;  2X69 A;  4K5V A;  3PGZ A;  3JC6 6;  2KOL A;  1A8V A;  3S2D B;  3A8K E;  3HOY G;  1LV9 A;  1Q8I A;  2R6G A;  2I0Q A;  1YBY A;  2N78 A;  4IPC A;  4NPS A;  3PO2 B;  5I9O A;  5D3I B;  3HOV B;  1Y8N B;  4JW0 A;  4DV7 L;  1VQ7 A;  2GVB A;  2CH4 W;  1WYD A;  5I4D A;  4QCL A;  2F0V A;  4JI4 Q;  1HUN A;  1V1Q A;  5FOB B;  3GTJ H;  4HIK A;  1Y1V H;  2AWN A;  2E76 C;  2X6G A;  2B2V C;  2F3I A;  1TWF B;  1RTN A;  1XXG A;  1LT6 D;  1QVC A;  1U4R A;  1LTA D;  5M5W B;  3TP7 A;  2QIL A;  1ET6 A;  4GS3 A;  3URY A;  2IHE A;  3SK6 A;  5FK9 C;  2EY2 A;  1GUG A;  4HCS A;  2KED A;  5CGK A;  4EQ5 A;  4LF7 L;  1KLU D;  2IW3 A;  4JG2 A;  2B63 H;  5GAH C;  1HFN A;  2XNA C;  1N34 L;  1TKW B;  3I90 A;  1IBM L;  3HP3 A;  5LMN W;  3SHL A;  1XPU A;  1EFI D;  4GNX C;  3J7A 5;  1KXL A;  3A8J E;  5KRU A;  3CCU A;  1LTS D;  4ID6 A;  3GTP H;  1V43 A;  4RFB A;  4G57 A;  4GOP B;  1GVP A;  1X9N A;  4BBR H;  5LMU Q;  4WJ4 A;  2F0H A;  2F3V A;  3MTS A;  4M8A A;  4LFC Q;  4LUZ A;  2Z4I A;  2C9O A;  3P75 A;  5JJK A;  4YY3 Q;  1LO5 D;  4JBJ A;  1Q3L A;  1LTG D;  5IGE A;  5AJ3 Q;  1GHK A;  1QVG A;  2R7Z B;  1G91 A;  2QA4 A;  1PTO D;  1JOR A;  1CZG A;  1YI2 A;  1SYE A;  4DV4 L;  2WKD A;  1N33 Q;  3CQZ B;  1O7Z A;  1UEB A;  2HCI A;  3CCQ A;  1VDZ A;  1C0A A;  2JA6 G;  5IP7 G;  4FF1 A;  3JAM c;  3S1Q B;  4A75 A;  3G48 A;  3CCR A;  4X64 L;  1HUM A;  5BN4 A;  3I56 A;  1DXM A;  2OTL A;  1VQB A;  1ZXT A;  1FNV A;  5CV9 A;  2AUK A;  5J39 A;  4DR2 Q;  1IXR A;  4NXM L;  1LTL A;  4F88 A;  1BCP C;  4A3E H;  1ZYR D;  4DAV A;  2WAQ B;  4GNX A;  2WAC A;  2D0P A;  3CC7 A;  3BZD B;  4OIJ A;  5EPL A;  5C6A A;  2LXJ A;  4A3F B;  2RVL A;  5FLX L;  3J80 L;  1CKM A;  1J5E L;  1CSP A;  1QB5 D;  1XX8 A;  4F7X A;  4RKB A;  5ELE A;  1F2L A;  3A74 A;  2LY7 A;  5M3F G;  3FDT A;  3BYT B;  5FLX E;  4DUZ Q;  2VB3 X;  2A1A A;  3G71 A;  4C3J H;  1YNN D;  2F1M A;  1SJE D;  1Y1V B;  2N88 A;  4RMF A;  2B63 G;  2JK8 A;  1PTO H;  1VCI A;  3E9H A;  3I4M B;  4GLV B;  2NTS A;  4GKJ Q;  3W1G A;  1HTL D;  1M90 C;  4A76 A;  1Q8K A;  2H1E A;  1L2F A;  4CJ0 B;  2BE5 D;  2ZT9 C;  2SDF A;  3WDN A;  3HFZ B;  3F2B A;  3ITP A;  5CBE E;  1TII D;  2IX0 A;  3NEM A;  4PZ7 A;  4BWG B;  5CV6 A;  1GM5 A;  2HDL A;  2EQS A;  1YNJ D;  3K6O A;  3MXN A;  4LUV A;  1TS4 A;  1X65 A;  1J6Q A;  3FKI B;  3HOX G;  1L0W A;  1S72 A;  4KHZ A;  4QMG A;  1WTV A;  3ULL A;  5JVH 3;  4RCO A;  4XQN A;  4L5S A;  1D1I A;  2B2U C;  4AYB E;  3PSI A;  2KUM A;  4MZ9 A;  2L0C A;  2Y0S G;  4HMI A;  4XYQ A;  1KLG D;  3T1H L;  4LK1 C;  4P73 A;  2N49 A;  4KY7 A;  1S5E D;  2CHB D;  1EIH A;  1RCV D;  3BVG A;  5NUC A;  4PV1 C;  4OWT B;  4NXN L;  1JMC A;  4GN5 A;  3STB C;  1SNM A;  1T5E A;  1CTM A;  1KAB A;  4DV2 L;  4JBK A;  2ZJP A;  2MUY A;  1YHQ A;  5M3M B;  1Y69 U;  3I72 A;  4TSS A;  3AQQ A;  4TVA B;  2PZW A;  2JA5 G;  2N8N A;  2Z4H A;  4N8X 1;  1TS5 A;  1HZ9 A;  4C56 C;  4EX5 A;  3TBI B;  3CCM A;  2R93 H;  1N34 Q;  1JCK B;  1E24 A;  1O80 A;  1IBM Q;  4IAL A;  2JQO A;  3QJY A;  2BA1 A;  2KCC A;  5IGG A;  1H95 A;  1HZA A;  4YWL A;  3SXH A;  1EIY B;  4JV5 L;  1YZ6 A;  3PIO 3;  2F0L A;  4JVZ A;  4EGV A;  2VUM H;  2B2U A;  4Y52 H;  5E7N A;  1YHA A;  2A19 A;  4TKO B;  1ET9 A;  2RCN A;  4RAU C;  1HNW L;  1MGS A;  2WII B;  4OL7 A;  3KBG A;  1AZQ A;  4A3C H;  2R92 B;  3HS0 C;  3PIP 3;  3S1M H;  2QF7 A;  1B53 A;  4C2M B;  2GVA A;  5AFW A;  1N36 Q;  4BBS H;  2R7D A;  1DZ1 A;  4YHH L;  1Y1W H;  2PQA B;  4C3J B;  4HSP A;  4X64 Q;  3U50 C;  2PPB C;  1SMX A;  2KBN A;  3S9W A;  1K0S A;  2KCT A;  5EAY A;  2E2I H;  5G3L F;  4CKE A;  4DV1 Q;  1DD2 A;  1WOC A;  2NBF A;  1V8Q A;  5CYU A;  4N9T A;  4DR6 L;  4NXM Q;  2RSO A;  4G7Z C;  4HMJ A;  1DYQ A;  1TXY A;  3OMG A;  1EU3 A;  3KLW A;  3K5L A;  4RHS A;  4V0B A;  2TMP A;  5BN5 A;  1Z9F A;  4RCN A;  3NBH A;  3PF5 A;  1V9P A;  4QUC A;  1E2W A;  2A68 C;  3PV0 A;  4A3M H;  2K1B A;  1PRT F;  4XXE A;  1J5E Q;  4A3K B;  1N9W A;  3MEF A;  1D8L A;  1WTR A;  3CP0 A;  1Q7Y C;  2F4V Q;  4U67 3;  3D4W A;  1ASY A;  2ASB A;  4K5W A;  1STA A;  4OEL B;  2IY5 B;  1EZ8 A;  3UDF A;  3I4O A;  3D0F A;  3I70 A;  4YCW A;  3E5S A;  2EIF A;  4C3I H;  1VQO A;  4CDE C;  4LJZ C;  1P8L A;  1SEB D;  2C5C A;  3K0X A;  3J81 L;  2O5I C;  4OGQ C;  3KDF B;  1PH2 A;  1EEI D;  3K81 C;  2Q8I B;  4UPA A;  1UE1 A;  1TU2 B;  3LX0 A;  2K5H A;  1FNW A;  1X3F A;  1LT4 D;  2AHO B;  2XVS A;  4RH6 A;  3T56 B;  3T53 B;  5HGT A;  2RF4 A;  4UDU C;  2QEX A;  3NBI A;  2K7V A;  4ME3 A;  4JI7 L;  2XWB B;  3KLR A;  3B6Y A;  3H3V C;  1FR3 A;  2F3W A;  1IBK L;  2R93 B;  1XTD A;  4DV0 L;  1GUT A;  3IL8 A;  1I4R A;  5FLM H;  3BS1 A;  1EQQ A;  2B2W C;  2D9U A;  1CFM A;  5IP9 H;  4DPG A;  1WCM H;  3A8I E;  1PH4 A;  5CC4 A;  1E1T A;  4BBS G;  3BDO A;  2SNS A;  1I50 H;  4KY5 A;  4H44 C;  3T1H Q;  1YJ9 A;  3UI2 A;  5C0X H;  2P5Z X;  3H0G B;  1V1O A;  3O13 A;  4B3T Q;  1CQV A;  1WTQ A;  3C1E A;  4A3D H;  1GUO A;  4ZLT F;  4NXN Q;  4LF6 L;  3S1M B;  1VQD A;  2K4K A;  3SGI A;  4DV2 Q;  1PRT B;  1CA5 A;  2WB1 G;  2SEB D;  2ENB A;  4DFA A;  1Y1W B;  1E3P A;  2VS1 A;  4WJ3 M;  1F9S A;  3Q23 A;  1I6H H;  1EY0 A;  4ZAI A;  1HFG A;  3M7G A;  3K7U C;  3TZD A;  5IYB H;  5JJL A;  4R1J A;  2E2I B;  3J7Y W;  5C4X H;  5K5P A;  2E2D C;  4A3M G;  1FVI A;  3C1F A;  3D3R A;  3KFU A;  4XIG S;  3BVZ A;  1JC7 A;  1JOO A;  1KDC A;  1SXT A;  5HUR A;  1KD1 C;  3GTK B;  1HRJ A;  1RD9 D;  2K5Q A;  2DNC A;  3NQI A;  3K5N A;  4PMW A;  3FRP B;  5DM6 3;  1TWG H;  2JA7 H;  4QL5 A;  4A93 G;  1GUW A;  3IFD A;  2BH8 A;  1EYA A;  2B2W A;  1RL2 A;  4DKA C;  3E6Z X;  1K9M C;  1MJE A;  2L12 A;  5IIF A;  3TRZ A;  2EDG A;  2K05 A;  4C3I G;  5ELB A;  2QDB A;  1VQJ A;  2F0I A;  4POF A;  1DJR D;  2KEE A;  1IW7 D;  5J1Z A;  5M9O A;  3S2D H;  4YHH Q;  5I2Y A;  4JI5 L;  3N6R A;  3UDX A;  3MEH A;  2RQX A;  3PUX A;  3PO2 H;  3TSS A;  3HOV H;  4OO1 G;  4I7Z C;  1QOH A;  2XRS D;  4IFD G;  4GNX B;  5IT9 c;  1XTC D;  3TRE A;  4EQN A;  4DR6 Q;  4AYB B;  2EOT A;  4HN7 A;  3ZYY X;  5LMU L;  1A2T A;  1DOL A;  5IP9 G;  1JWS D;  1TWF H;  1WCM G;  2QEJ C;  4JI3 L;  3HOZ B;  5C44 H;  3SK8 A;  2NVQ B;  5EQ0 A;  1YJW A;  3GTM H;  4DV6 L;  2L4N A;  2D5D A;  5M5W H;  3J7A F;  4LF5 L;  3JAM L;  5M5Y H;  3I73 A;  4IUT A;  2XSC A;  3P1H A;  1ILP A;  2ZTD A;  2JA8 B;  4A3D G;  5E4W C;  3BJU A;  4ZRZ A;  5GQO A;  3RNU A;  3X3N A;  4A3B B;  3GV6 A;  3S14 H;  2HD3 A;  4P2C B;  1J9O A;  3KUP A;  3F1Z A;  2NTT A;  2O2L D;  1KQS A;  4K8J A;  2RCF A;  1I50 B;  4EQO A;  3IAY A;  2YYZ A;  4IQZ A;  5KGU A;  5I6Y A;  1MHW C;  3PCO B;  1A3V A;  1FYC A;  4DR2 L;  1II3 A;  3HKZ G;  2F03 A;  5IYB G;  4RG1 A;  2CFM A;  3MXN B;  3T4A C;  5C4X G;  5TSS A;  1VQH A;  2KQ3 A;  1BCP B;  2VY3 A;  3M7N A;  3H94 A;  2CQA A;  5KNB A;  1Z7T A;  2EZV A;  1L1O C;  3CCV A;  4RGN A;  2R7Z H;  3QR8 A;  1KAA A;  4JI8 Q;  4JI7 Q;  1KRT A;  2Y0S E;  3LNN A;  2RSN A;  2JA7 G;  4A3L G;  2LSS A;  4BA1 I;  4DAP A;  3CQZ H;  1IBK Q;  3EJI A;  1I6H B;  3AU7 A;  4PQX A;  4DV0 Q;  3I4N G;  2F0S A;  4IPG A;  2RKS A;  2F4I A;  4HJ7 A;  2R7F A;  4DUZ L;  4BY1 H;  2NN6 G;  2I5L X;  1DCZ A;  4UAI A;  5C3X A;  5ISR A;  2ZJR A;  2HT1 A;  1KAW A;  1IHZ A;  2AQ2 B;  4EVO A;  3L3O C;  1KIX A;  3PO2 G;  3K7A B;  2A69 C;  3HOV G;  3CHB D;  4K6D A;  3HZX A;  3Q8D A;  4DR5 L;  4NW2 A;  1JIC A;  1X3G A;  4C3H H;  5CBA E;  2M2L A;  1VF5 C;  1EOV A;  3CC2 A;  3QO2 A;  4YWK A;  1R9T B;  4JBW A;  1PA6 A;  2DJG C;  2CW0 D;  4X66 L;  3CMA A;  2ZJQ A;  2L9H A;  1Y8O B;  4A3F H;  1VQC A;  1TWC B;  2LS0 1;  1VQ9 A;  5FJ8 H;  3K59 A;  3DMU A;  4U68 A;  2EYM A;  3CCJ A;  1TT2 A;  4OHJ A;  5GAD C;  3TEH B;  1L1O A;  4XQJ A;  2OQK A;  4ZYS A;  1KHI A;  1D2B A;  1SE8 A;  2NWG A;  3C2P A;  3C3L A;  1WD0 A;  1JWU D;  3E0J A;  1E2Z A;  1HR0 L;  5ELF A;  3RLN A;  4A3J H;  5KND A;  5C44 B;  1JWM D;  3I4M H;  2JN4 A;  1HCZ A;  4IN3 A;  1LLR D;  2RHQ B;  3GTM B;  1UE5 A;  3CCS A;  4QB4 A;  3OPO A;  5EBD A;  3DHQ A;  3CC4 A;  2PO4 A;  4FF3 A;  3FHW A;  4FXK C;  4DAY A;  1E0B A;  1NCV A;  3QWN A;  5M5Y B;  4FO2 A;  3C46 A;  4X3S A;  2J7Z A;  1BUV T;  1JJC B;  4YCV A;  5EKI A;  4PMB A;  4OX9 L;  1JE4 A;  5JPM C;  3FKI H;  3H3V H;  3S14 B;  4JI5 Q;  2MQH A;  3HGB A;  5C4Z A;  3NTH A;  2LMC B;  2NZH A;  3EIV A;  4WOR A;  1Q1B A;  1QE6 A;  4RGM A;  3RR5 A;  2R7Z G;  2XTI A;  1ENC A;  4B3S L;  3M4O H;  5GRO A;  4RA8 A;  1SYG A;  2K5V A;  3NBH B;  4NB3 A;  3OIQ A;  1CA6 A;  1NBW A;  3HKS A;  2HIV A;  4LUO A;  4QIW E;  4JI3 Q;  1H9S A;  4ZK9 B;  1SRU A;  3G6E A;  1SRO A;  2Z6K C;  1C8C A;  1KTK A;  4IUV A;  4DV6 Q;  3W3A A;  1TVX A;  4IFD J;  4RGT A;  4J6H A;  1OO9 B;  4LF5 Q;  4GKK L;  3EBE A;  3ERQ A;  1N36 L;  3AYH B;  5A2Q L;  3M9B A;  5M3M H;  1Y8P B;  1LT3 D;  1IKL A;  4APV A;  3IKJ A;  3RMH A;  4BY1 B;  3RD4 A;  1I4Q A;  3MA2 B;  4KD3 A;  2WAQ G;  2F0P A;  2VNU D;  5A2Q E;  1EWI A;  1MBY A;  2EY5 A;  1PYB A;  1E7Z A;  2A74 C;  1G51 A;  4P75 A;  2MPM A;  4O1N A;  2PNR C;  3TZU A;  4A3F G;  4DV1 L;  1FNU A;  5HY6 A;  5FJ8 G;  3WOF A;  3TP6 A;  5D3D A;  1QNK A;  1B3Q A;  4C3H B;  5JPN C;  1YJN A;  2BCO A;  2F0E A;  2YU9 B;  3S1N B;  1SE2 A;  3H15 A;  3U4Z A;  1Y1V G;  2Q2H A;  3VR5 A;  2A5H A;  1B70 B;  1QUQ A;  3DWP A;  4Y7N B;  2R92 H;  3X3M A;  4L63 B;  2ZXO A;  1SYF A;  2N55 A;  3I4M G;  2YTX A;  4C2M H;  1H9K A;  1VF7 A;  3T1Y L;  1WTP A;  2G9H D;  4YWM A;  1HNZ L;  2F52 A;  2A6E D;  2F4V L;  2Z1C A;  2Z6K A;  1ZKO A;  2EYL A;  1W6K A;  2PCF B;  1MSH A;  1DM0 B;  3ONA B;  4PNY A;  2KEC A;  1LAC A;  1PVO A;  2B2Y C;  4A3J B;  3FKI G;  1BR9 A;  4ZKC B;  3FMC A;  1LTR D;  4CJ1 B;  3S15 H;  1CM9 A;  4LMQ D;  1Z47 A;  2RDG A;  3GV3 A;  1HA5 A;  5IGB A;  4DR5 Q;  5G3L D;  2JJQ A;  2DY8 A;  4I65 A;  1JJ2 A;  2EXZ A;  3I2Z A;  1F9Q A;  1U4L A;  2F0Q A;  2MGS A;  1XWE A;  5K36 H;  5BN3 A;  4X65 Q;  1WTH A;  3OOC A;  4X66 Q;  2Z0S A;  1J8I A;  4BBR G;  1PYS B;  3T13 A;  5JOB A;  4IOC A;  4HCE A;  3DXJ C;  1YVC A;  1TS3 A;  5C3E H;  4A3K H;  3CRL C;  4FYD A;  4TQU S;  4DR3 L;  3M4O B;  4DNT B;  2NVT H;  1PRT D;  5M3M G;  3VR2 A;  2KHI A;  4DR7 L;  1PH5 A;  3CF5 A;  2UUA L;  3R3O A;  1FL0 A;  3J81 j;  1MI2 A;  1HR0 Q;  1K8M A;  3UE1 A;  2BDO A;  2I07 B;  1XJV A;  4B3T L;  2MJ8 A;  2RBM A;  1CK1 A;  2ZXR A;  2AMC B;  3Q6S A;  3RN5 A;  1I4H A;  1ONL A;  1HXY D;  3DUZ A;  1BDO A;  2B2Y A;  2EXD A;  1A15 A;  3K0Y A;  4A3E G;  4GLX A;  4OX9 Q;  3UE0 A;  1QZH A;  1YEZ A;  1TS2 A;  4CBV A;  4A4I A;  3HOX B;  1M1K C;  1BO0 A;  1Q12 A;  3CRK C;  5EBC A;  3KJO A;  4S3S A;  2FMM A;  4NKL A;  2R92 G;  3HOW B;  2Y0S B;  2R3Z A;  4B3S Q;  2PW7 A;  1GHJ A;  1PZJ D;  4HTH A;  4G7H C;  1BF4 A;  2K32 A;  2ICI A;  4DNR B;  1SDF A;  3A7L A;  3KF8 A;  4ILW A;  1VQG A;  2HUG A;  2I5H A;  4C3J G;  5BR8 L;  2IT1 A;  3HRZ C;  2IX3 A;  3H0G H;  2VQF L;  2E2J H;  3R2I A;  1SMY C;  1WTO A;  1GJX A;  1EYC A;  1D7Q A;  1IBL L;  4GKK Q;  4B08 A;  1VQF A;  1H9J A;  2DUD A;  3SK4 A;  1PH7 A;  3H6M A;  1H9R A;  1EY6 A;  3W1B A;  1EQV A;  2F0D A;  2QKI C;  4C1N K;  4P72 A;  4KJO A;  1ICF B;  5IT9 L;  1X55 A;  4FP5 D;  1VQK A;  1UNS A;  2UXD L;  4R9W A;  1AP0 A;  1PH8 A;  1AH9 A;  2A6H C;  1FJG L;  3UDG A;  2TSS A;  4UP9 A;  3SR1 A;  1TR5 A;  4GZY C;  4A3K G;  3S15 B;  5IT9 E;  3GTK H;  1O78 A;  2JXM B;  5KIX A;  1HR0 W;  3PIO A;  1BKB A;  2L1B A;  1VQM A;  2ZM6 L;  1CKN A;  1O7I A;  2BH2 A;  2E75 C;  2E5L L;  1A3T A;  1PZI D;  1K73 C;  2K5N A;  4IZ8 A;  1VQ6 A;  4OO1 I;  4BXX H;  2L5T A;  1IYJ B;  5IGD A;  1EYG A;  1O7Y A;  4IFD I;  3PIP A;  2OCE A;  4UP7 A;  2CCZ A;  2VW9 A;  4IUR A;  2I5M X;  3MC0 B;  3GTO B;  4BA2 I;  5C3E B;  1TQO A;  3T1Y Q;  4V19 0;  5C4H A;  1KNE A;  1HNZ Q;  4QGU A;  4CDF C;  2DJF C;  1RIP A;  2B29 A;  2A73 B;  1BCP D;  4JOI C;  5DLQ E;  4KD4 A;  3TQY A;  1E22 A;  2H4O A;  4FXD A;  2NVT B;  2JP1 A;  4K0K Q;  1I4G A;  1EUJ A;  1SNP A;  3HOU H;  2IHF A;  2WP8 J;  3L0O A;  4KKT A;  1XNQ Q;  1EOT A;  2G5D A;  2I46 A;  2R93 G;  3S16 B;  1VMC A;  3NQT A;  3VA7 A;  2HCC A;  2QDL A;  3J80 c;  1OTC A;  1VQI A;  4N9P A;  4IPD A;  3OMC A;  1CZW A;  3CPF A;  3FPU B;  1VQ4 A;  3NTK A;  1XMQ L;  3HOZ H;  1NE3 A;  2NVQ H;  4HR7 B;  1PMR A;  3CU7 A;  3BYY B;  3P7J A;  4JI8 L;  1L1O B;  1B1Z A;  2SOB A;  2VUM G;  5EGT A;  1WTW A;  3K57 A;  4WFN 3;  4B3R L;  3H0G G;  4QIW B;  4KN7 C;  5ELN A;  1D6E C;  1VQA A;  4AQY L;  1PH6 A;  3F2C A;  2JA8 H;  3VYR A;  2PYK A;  4A3C G;  1B4O A;  3ND8 A;  4DR3 Q;  3GTG B;  2KCM A;  1NR4 A;  1Z6H A;  4LNQ A;  1I5F A;  4A3B H;  2Z9H A;  5M5X H;  2EE1 A;  1EWH A;  1IYV A;  2VZA A;  1F2Z A;  3FVQ A;  4DR7 Q;  1Y1W G;  2ZTE A;  4ZCK A;  4DAY B;  4A3I H;  2UUA Q;  3S17 H;  4X6A H;  3V2T A;  5JEA H;  2EY6 A;  2E2J B;  5CV7 A;  1RKN A;  1ILQ A;  4JOI A;  4H13 C;  4IPH A;  4XQQ A;  2OWO A;  4DUY L;  3Q0A A;  3NPP A;  4LF9 Q;  5FKA C;  1EQT A;  4LWC A;  3D8G A;  1K0R A;  4XTC S;  2NN6 I;  1VQ5 A;  5IWA L;  1PDQ A;  2FIN B;  5E4X A;  3BDL A;  4HIO A;  4QQB X;  1U9R A;  1XMO L;  2UXC Q;  3SE0 A;  1RHP A;  3TS2 A;  4BY7 B;  1G6Z A;  1CQF A;  1ICW A;  3DWA A;  2OEO A;  2WKC A;  1PH9 A;  1K83 B;  4WRD A;  5KYL A;  3I3C A;  1U4P A;  3VYU A;  4DK6 C;  4BXX G;  3MFY A;  1ESF A;  3PO3 B;  1Q90 A;  5EJW A;  1H9S B;  4ALP A;  3STB D;  2DGY A;  4CGY B;  4KK7 A;  1DGS A;  1EZ6 A;  1GUN A;  1QZG A;  1ROD A;  5EKK A;  3KLS A;  4MTK A;  2F0K A;  2EPB A;  2BA0 A;  5BR8 Q;  3K7A H;  4DAM A;  2AQ1 B;  2VQF Q;  1YIJ A;  2F0W A;  3VDY A;  1MKH A;  2OQ0 A;  4IUP A;  1EL0 A;  5JJZ A;  4Q5V A;  1R9T H;  2G9D A;  4OIK A;  1IBL Q;  2LKV A;  2Z8L A;  4GLA C;  1AW7 A;  3PUY A;  4AYB G;  4A3G H;  2L55 A;  3DEP A;  3M4Y A;  2ID0 A;  3RUZ A;  2JSO A;  4HED A;  4K2K A;  3HOZ G;  1A0I A;  4LFB L;  1TWC H;  1VMP A;  2LXK A;  2UUB L;  2K5W A;  3HOU B;  1ESR A;  2UXD Q;  3G4S A;  1G2S A;  4XDX A;  2N3S A;  1FJG Q;  1LTB D;  3SDZ A;  1HJP A;  1VQL A;  5FLM G;  3AEV A;  1QUQ B;  2JA8 G;  1MD2 D;  4OWW B;  3IRB A;  2EYJ A;  4HJ8 A;  4CDC C;  1SBB B;  2SNM A;  3G7L A;  2UXB L;  1R4P B;  4QUF A;  4ABN A;  2ZM6 Q;  2HQL A;  2E5L Q;  1PTO C;  4LFA Q;  3AFP A;  3GTL H;  3M3Y B;  2V4D A;  5JEA G;  4OWX B;  5C0X G;  4AIM A;  3S1R H;  1BOS A;  1CUK A;  2QW7 A;  1JB3 A;  1A2U A;  4JI0 L;  1N32 L;  1F9R A;  2B8G A;  1QIL A;  1SLJ A;  4OON A;  2MO1 A;  3HOY H;  1NSN S;  5EKL A;  3RZD B;  1UE6 A;  5M5X B;  2CKZ B;  3S24 A;  5CR3 A;  1MSG A;  1A63 A;  3RLF A;  2RHS B;  3S17 B;  4A3I B;  1S4Z A;  4EQP A;  4BS9 A;  2WV6 D;  1STN A;  1EY5 A;  4PMC A;  2A68 D;  5A35 A;  3TME A;  3S2H B;  3QIA A;  2Q8T A;  1ZYR C;  2NVX H;  1I3Q H;  3NXW A;  1UEA B;  3D6W A;  3GTQ B;  1I94 L;  4DR4 L;  5H1S E;  1WD1 A;  4XT3 B;  1LT5 D;  1HQM C;  3NEL A;  5IGC A;  1XMQ Q;  1NMF A;  3ULP A;  1KNA A;  1B44 D;  1AZP A;  1BBW A;  2E8G A;  4P71 A;  1AN8 A;  5CV5 A;  3VYS A;  5I6W A;  4JBM A;  4E6I A;  3AMU A;  2K03 A;  3QG1 A;  2EJF C;  4FF2 A;  3A54 A;  4B3R Q;  1SFO H;  2XRQ D;  2WIN B;  3NTI A;  2MO0 A;  3NUC A;  4AQY Q;  5IYD H;  5IY0 A;  1YNN C;  1H9M A;  2EYP A;  2FJ2 A;  2PW5 A;  2F0F A;  3GDE A;  4JYA L;  4KLK A;  3D4R A;  1DOK A;  1STG A;  4HID A;  2X6L A;  1HZB A;  3OIP A;  3V96 A;  1JT8 A;  1VQN A;  3ER0 A;  1S3O A;  1N8R C;  5EPK A;  3N52 A;  1KC8 C;  5COY A;  2Q8R E;  3MXG A;  2OT2 A;  2BE5 C;  3U9S A;  3ND9 A;  3K8A A;  2RDH A;  4DUY Q;  2M9V A;  5LMN Q;  3ICE A;  1PFN A;  1CT1 D;  5I9P A;  1Q86 C;  1I4P A;  5E1F A;  3J7Z C;  2YU9 H;  2ICE C;  3S1N H;  1QCB D;  3PUZ A;  3M4P A;  2B2T C;  1YNJ C;  1A62 A;  2KVM A;  5IWA Q;  4X65 L;  4A3G B;  1Q1E A;  1JE5 A;  4Y7N H;  4B9W A;  1X3E A;  1IL8 A;  3A5Z B;  3EA6 A;  4UY8 C;  5C44 G;  1QJO A;  1XMO Q;  3OSO A;  4WJW A;  3SVM A;  1RTO A;  4JI2 L;  1G6P A;  1X3P A;  5T1G A;  1KDA A;  3QOJ A;  2PI2 A;  2JA6 H;  5IP7 H;  1VQE A;  2UU9 Q;  4L5R C;  2EY1 A;  3KF8 B;  3RN2 A;  3TP5 A;  3R8B A;  3KK7 A;  1SE3 A;  1XPO A;  4DA2 A;  2D62 A;  4JI6 Q;  2YTY A;  1GO3 E;  1XNR L;  1L0X B;  1LUZ A;  3KDF A;  3QB3 A;  1EY9 A;  1LTT D;  1EFW A;  1V1P A;  3NE5 B;  4TRD A;  5D65 A;  1WTX A;  2F0G A;  1QG7 A;  1NNX A;  1NAP A;  1ZEQ X;  4DXF A;  1R4Q B;  3GTL B;  1YNX A;  2K6A A;  1WI5 A;  1S40 A;  5IYC H;  1B3A A;  4H7B A;  5EPJ A;  3U9O A;  1G29 1;  3S1R B;  2E2H H;  3AB9 A;  2Q2T A;  4LF8 Q;  1AE3 A;  2MP1 A;  2ZTC A;  4CJ2 C;  2K01 A;  1XYI A;  1KRS A;  4J15 A;  4R4I A;  3CPW A;  3HOY B;  4K5X A;  5GAE C;  1JJG A;  4IUU A;  2HDM A;  4ME5 A;  3SEB A;  4HJA A;  4LFB Q;  5C5M A;  5J22 A;  1O7L A;  4QF4 A;  2NZ1 D;  3ZJY C;  3EQL C;  2UUB Q;  3TDQ A;  5C4J H;  5M3F H;  2B2T A;  1CKN B;  3ERO A;  4FDB A;  3KF6 A;  3HG9 A;  2J0T D;  4DV3 L;  4ZKB B;  4PZ6 A;  2PI2 E;  4QY7 A;  2NVX B;  1I3Q B;  5IYD G;  1QNU A;  1YIT A;  4FXG C;  1P16 A;  3TS0 A;  4BY1 G;  4X62 L;  1HPC A;  2UXB Q;  3DWQ A;  1UUP A;  4R8I A;  1GUS A;  1G8Z D;  1SE4 A;  4CDD C;  2PZU A;  1PFS A;  3IFT A;  2L11 A;  3T51 B;  1BXT A;  5CV4 A;  2AUJ D;  5C3W A;  3I4L A;  4FVM A;  5ELO A;  1SFO B;  2F0N A;  3U4V A;  4CKC A;  2K33 A;  1EEF D;  2JE6 I;  4JI0 Q;  2NYZ D;  3MXU A;  1OXS C;  4C3H G;  1N32 Q;  4PG3 A;  1YHB A;  1FGB D;  3HOX H;  3Q22 A;  1EU4 A;  2A8V A;  4OXP A;  1SYD A;  1S5C D;  5FO7 B;  1NUC A;  2F0T A;  1TWA H;  2OXP A;  2B8F A;  4R8N A;  5JEA J;  5C0X J;  4IO9 A;  1F2Y A;  3NWT A;  4XYO A;  3HOW H;  1D5Z C;  1GXD C;  1SNO A;  3GQB A;  2KA7 A;  4KKS A;  5DNF A;  2B2V A;  3CXC A;  3K58 A;  3E0E A;  2IL8 A;  3BZK A;  1K8A C;  3NWS A;  4HJ5 A;  3F2U A;  1D5M C;  3CKI B;  4ODG A;  3J80 i;  1I94 Q;  4DR4 Q;  3NK9 A;  5HGQ A;  1EQR A;  4JPB W;  2HHH Q;  1T5X D;  3LWU A;  2JYO A;  4DV5 L;  3V05 A;  2O4X A;  1K8G A;  2M00 A;  4AH6 A;  4A3J G;  4O2D A;  1MJC A;  3W5O A;  1QVF A;  1FD7 D;  2FXQ A;  2JA6 B;  2JA5 H;  5IYC G;  2OF1 A;  1X56 A;  1PYW D;  1F9P A;  3A55 A;  4CHT B;  3Q24 A;  3NHH A;  4K0K L;  1C4Q A;  4M1U B;  3UDI A;  4JYA Q;  4QJF A;  4F8M A;  4KI0 A;  4ULL A;  1BNZ A;  1XNQ L;  1MIU A;  1E1O A;  2C35 B;  3CD6 A;  2CQO A;  2Q2I A;  2FHT A;  2RA4 A;  3CME A;  1TY0 A;  2FMC A;  2WB1 E;  1B9M A;  3MHB A;  1GOZ A;  4KHV A;  1UE7 A;  3J80 E;  1EIG A;  2E2H B;  3RZO H;  1S5D D;  5C5L A;  3SK5 A;  3GTJ B;  1F77 A;  1SR3 A;  1HQR D;  1STY A;  2D2C C;  2DNE A;  2MNA A;  1LAB A;  3OHX C;  1K3B C;  2F0M A;  1SYC A;  2HQE A;  2IWH A;  3GTO H;  4L5T A;  3F2D A;  4JI2 Q;  2A69 D;  3E3X A;  5M3F B;  5C4J B;  5LL6 X;  1PH3 A;  2K04 A;  2NUC A;  1RJT A;  1JB7 A;  5DAU A;  3KOJ A;  3PMF A;  4KHP Q;  1VS0 A;  2BOS A;  2Z6B A;  4H0L C;  1XNR Q;  1EY7 A;  1AE2 A;  2B63 B;  4NDX A;  1X3Q A;  2KJX A;  4MTN A;  4I7A A;  2XN9 C;  1K3R A;  1W3S A;  3BG3 A;  1GKH A;  3S16 H;  4POG A;  1D1K A;  4DV7 Q;  1JR0 D;  2MHV A;  4LF9 L;  3HOW G;  3A56 A;  1VQP A;  1U0L A;  1JOQ A;  3A0J A;  4IUQ A;  3GTP B;  2E74 C;  1EWC A;  2O5J C;  1A6X A;  5ELD A;  1PTO F;  1UWV A;  3FEW X;  4BBR B;  3VYT A;  1ASZ A;  2UXC L;  3CCE A;  3K5M A;  1SNQ A;  4R4Q A;  1STH A;  1AEX A;  2L15 A;  1TWA B;  4KJN A;  3A5U A;  1IKM A;  2K50 A;  4O0A A;  5LHY 1;  3GTG H;  4MIU A;  3FP9 A;  4LF7 Q;  4MNO A;  3P20 A;  4MHE A;  4DV3 Q;  4DR1 L;  1OXU A;  1B2T A;  4HIM A;  4JK1 C;  2EYO A;  4LAA A;  2NVY H;  4IOA A;  2F0J A;  3ERS X;  3QOL A;  4X62 Q;  1K28 A;  5ELC A;  1M4V A;  2AQ3 B;  3DLL A;  1HNX L;  1BBU A;  4XT1 B;  1LYL A;  2KHJ A;  3EVQ A;  5FO9 B;  2UUC L;  1HHV A;  1IW7 C;  3BU2 A;  1CI3 M;  4GOP C;  3D31 A;  3L9A X;  2JA5 B;  4A3E B;  1NR2 A;  1UAP A;  3LGJ A;  5CV8 A;  1WJJ A;  3GO5 A;  1STE A;  4RHR A;  4BY7 H;  3D6C A;  5JJI A;  3HKZ E;  1KDB A;  5K36 G;  1SAP A;  3K5O A;  1K83 H;  1S5B D;  2CWP A;  4LF4 L;  2H5X A;  4C1N I;  3PO3 H;  5CMD A;  1LTI D;  2EJG C;  4DV4 Q;  1EY8 A;  1B7Y B;  5C3E G;  1B50 A;  2EJM A;  2IPK D;  3OW2 A;  4FF4 A;  2PMZ E;  3MFG A;  1S5F D;  2CH4 A;  3RZO B;  4P74 A;  5COR A;  4LFA L;  4G4K A;  2YTV A;  3K80 C;  4KKU A;  1PTO B;  1PFM A;  4DV5 Q;  1RF2 D;  3KLS X;  3KJP A;  2EYH A;  3BVM A;  4HSV A;  4UP8 A;  3MWY W;  3L2P A;  1PFB A;  1OXX K;  1HA6 A; 
#chains in the Genus database with same CATH homology
 5KNC A;  2EVB A;  5FO8 B;  5DM7 3;  2R61 A;  1OXV A;  5C0X I;  1IYU A;  1CHP D;  1BBX C;  4DGZ A;  1SJH D;  2F0U A;  3HEJ A;  1A3U A;  4CKB A;  5I2X A;  5LL6 S;  4L6T B;  3TP8 A;  4DK1 A;  1WVL A;  2IX1 A;  2BDN A;  2EYF A;  2FFK B;  1V1P B;  4X3U A;  1BQQ T;  3PUV A;  3BDC A;  1DOM A;  3VR4 A;  2PQE A;  3J81 E;  3M85 A;  1ENA A;  1M8A A;  3I8Z A;  4OO1 H;  5KEE A;  2NVY B;  4IFD H;  3H91 A;  2XWJ B;  5DEH A;  3MAQ A;  2KCN A;  4KN4 C;  3R93 A;  2JEA I;  2CW0 C;  3OW7 A;  3FPP A;  4L8J A;  2VUM B;  3MXP A;  4X3K A;  3NSW A;  1K8O A;  1SNC A;  2K5D A;  2J4X A;  2XIW A;  4YIJ A;  4RWS C;  4BBS B;  1E2V A;  4KMU C;  2DN8 A;  3H09 A;  3G6J B;  1OXT A;  2VXW A;  3LWE A;  1PXU A;  1SYB A;  1B9N A;  4O42 A;  3A7A B;  4K2L A;  4DN4 M;  2WB1 B;  1I6V C;  4F87 A;  1L0Y B;  4Q0F A;  5D14 A;  1BCP F;  2DY7 A;  1W6J A;  4A3M B;  1SMY D;  2NN6 H;  3DM1 A;  1C48 A;  2F0O A;  3I91 A;  1CHQ D;  4RGO S;  4DF7 A;  4IUN A;  1SSO A;  5T1I A;  1EYD A;  5IGF A;  4A93 B;  5KYI A;  4K8I A;  2GA4 B;  1JQY D;  4Z9C B;  4C3I B;  2B39 A;  5IOC A;  3MZ5 A;  1QWY A;  2A6H D;  1G2T A;  1AFP A;  3GP7 A;  1ML0 D;  4NMZ A;  1TY2 A;  5E3F A;  1DON A;  4DK0 A;  3VA5 A;  3W2D A;  4J8Q A;  3KBX A;  2QCP X;  1JOK A;  2IJ0 A;  1D5X C;  3R2T A;  3VR3 A;  4NP5 A;  2LFN A;  4KY6 A;  2VB2 X;  3NP8 A;  5JAV A;  1SND A;  3EFX D;  4RKL A;  1X32 A;  4DXG A;  3JAM E;  3OWE B;  4DU9 A;  1TWH B;  1WCM B;  4FNF A;  2ZXP A;  3VR6 A;  1F2M A;  4K14 A;  3OWF A;  3MVV A;  4KV6 A;  4K6L A;  1PZK D;  3TN2 A;  3GD7 A;  5JVG 3;  1U4M A;  4G7O C;  4MN3 A;  1HTP A;  4ZUJ A;  2A6E C;  4A3D B;  4ZQ3 A;  3DEO A;  4J1M A;  2K28 A;  3T16 A;  5IOD A;  3PUW A;  4X3T A;  3J7A V;  1I4X A;  3HKZ B;  5C4X B;  2KHS A;  1ENF A;  2AWO A;  1EY4 A;  5F2D A;  2NB0 A;  4B9X A;  4KTA A;  4ZUI A;  1TWG B;  2PMZ B;  4HAE A;  2JA7 B;  1RDP D;  2CVR A;  3L7Z C;  1STB A;  3I4N B;  3D4D A;  2JEB I;  2PZT A;  2RDF A;  1PRT C;  1PLF A;  3WOE A;  2X69 A;  4K5V A;  2KOL A;  3S2D B;  3A8K E;  1LV9 A;  1Q8I A;  2R6G A;  3PO2 B;  5I9O A;  5D3I B;  3HOV B;  1Y8N B;  5I4D A;  4QCL A;  2F0V A;  1HUN A;  5FOB B;  2AWN A;  2E76 C;  2X6G A;  2B2V C;  1TWF B;  1RTN A;  1XXG A;  1LT6 D;  1U4R A;  1LTA D;  5M5W B;  3TP7 A;  2QIL A;  1ET6 A;  3URY A;  3SK6 A;  5FK9 C;  2EY2 A;  1GUG A;  4HCS A;  2KED A;  5CGK A;  1KLU D;  2IW3 A;  1HFN A;  2XNA C;  1TKW B;  3I90 A;  3HP3 A;  3SHL A;  1EFI D;  3A8J E;  5KRU A;  1LTS D;  4ID6 A;  1V43 A;  4RFB A;  4G57 A;  2F0H A;  2F3V A;  3MTS A;  4M8A A;  2Z4I A;  2C9O A;  3P75 A;  1LO5 D;  1Q3L A;  1LTG D;  5IGE A;  1GHK A;  2R7Z B;  1G91 A;  1PTO D;  1JOR A;  1CZG A;  1SYE A;  2WKD A;  3CQZ B;  1O7Z A;  2HCI A;  1VDZ A;  4FF1 A;  3S1Q B;  1HUM A;  5BN4 A;  1DXM A;  1ZXT A;  1FNV A;  5CV9 A;  2AUK A;  5J39 A;  4F88 A;  1BCP C;  1ZYR D;  4DAV A;  2WAQ B;  2WAC A;  3BZD B;  4OIJ A;  5EPL A;  5C6A A;  4A3F B;  2RVL A;  5FLX L;  3J80 L;  1QB5 D;  1XX8 A;  4F7X A;  4RKB A;  5ELE A;  1F2L A;  2LY7 A;  3FDT A;  3BYT B;  5FLX E;  2VB3 X;  1YNN D;  2F1M A;  1SJE D;  1Y1V B;  2N88 A;  1PTO H;  1VCI A;  3I4M B;  2NTS A;  1HTL D;  2H1E A;  4CJ0 B;  2BE5 D;  2ZT9 C;  2SDF A;  3WDN A;  3ITP A;  5CBE E;  1TII D;  2IX0 A;  4BWG B;  5CV6 A;  2HDL A;  1YNJ D;  3K6O A;  3MXN A;  1TS4 A;  3FKI B;  4KHZ A;  4QMG A;  1WTV A;  5JVH 3;  4RCO A;  4XQN A;  1D1I A;  2B2U C;  2KUM A;  2L0C A;  4HMI A;  4XYQ A;  1KLG D;  4LK1 C;  4KY7 A;  1S5E D;  2CHB D;  1EIH A;  1RCV D;  3BVG A;  5NUC A;  4PV1 C;  1SNM A;  1T5E A;  1CTM A;  1KAB A;  2MUY A;  5M3M B;  1Y69 U;  3I72 A;  4TSS A;  2PZW A;  2Z4H A;  1TS5 A;  4C56 C;  3TBI B;  1JCK B;  1O80 A;  4IAL A;  3QJY A;  2BA1 A;  2KCC A;  5IGG A;  3SXH A;  3PIO 3;  2F0L A;  4EGV A;  2B2U A;  4TKO B;  1ET9 A;  4RAU C;  1MGS A;  2WII B;  4OL7 A;  3KBG A;  1AZQ A;  2R92 B;  3HS0 C;  3PIP 3;  2QF7 A;  1B53 A;  4C2M B;  5AFW A;  1DZ1 A;  4C3J B;  4HSP A;  2PPB C;  3S9W A;  5G3L F;  4CKE A;  1DD2 A;  2NBF A;  1V8Q A;  5CYU A;  4N9T A;  2RSO A;  4G7Z C;  4HMJ A;  1DYQ A;  3OMG A;  1EU3 A;  3K5L A;  4RHS A;  4V0B A;  2TMP A;  5BN5 A;  4RCN A;  3NBH A;  4QUC A;  1E2W A;  2A68 C;  3PV0 A;  2K1B A;  1PRT F;  4XXE A;  4A3K B;  1WTR A;  4U67 3;  3D4W A;  4K5W A;  1STA A;  1EZ8 A;  3I70 A;  3E5S A;  4LJZ C;  1SEB D;  2C5C A;  3J81 L;  2O5I C;  4OGQ C;  1EEI D;  2Q8I B;  1TU2 B;  3LX0 A;  1FNW A;  1LT4 D;  2XVS A;  4RH6 A;  3T56 B;  3T53 B;  5HGT A;  4UDU C;  3NBI A;  2K7V A;  2XWB B;  3KLR A;  3H3V C;  1FR3 A;  2F3W A;  2R93 B;  1GUT A;  3IL8 A;  1I4R A;  3BS1 A;  2B2W C;  2D9U A;  1CFM A;  3A8I E;  5CC4 A;  3BDO A;  2SNS A;  4KY5 A;  4H44 C;  3UI2 A;  5C0X H;  3H0G B;  1V1O A;  3O13 A;  1CQV A;  1WTQ A;  3C1E A;  4ZLT F;  1GUO A;  3S1M B;  1CA5 A;  1PRT B;  2SEB D;  2ENB A;  4DFA A;  1Y1W B;  1F9S A;  3Q23 A;  1EY0 A;  4ZAI A;  1HFG A;  3M7G A;  3TZD A;  2E2I B;  3J7Y W;  5K5P A;  2E2D C;  3C1F A;  3D3R A;  4XIG S;  3BVZ A;  1JC7 A;  1JOO A;  1KDC A;  1SXT A;  5HUR A;  3GTK B;  1HRJ A;  1RD9 D;  2K5Q A;  2DNC A;  3NQI A;  3K5N A;  4PMW A;  3FRP B;  5DM6 3;  1GUW A;  3IFD A;  1EYA A;  2B2W A;  3E6Z X;  2L12 A;  5IIF A;  2EDG A;  2K05 A;  4C3I G;  5ELB A;  2QDB A;  2F0I A;  1DJR D;  2KEE A;  1IW7 D;  5J1Z A;  5M9O A;  5I2Y A;  3N6R A;  3MEH A;  2RQX A;  3PUX A;  3TSS A;  4OO1 G;  4I7Z C;  1QOH A;  2XRS D;  4IFD G;  1XTC D;  4EQN A;  4AYB B;  2EOT A;  4HN7 A;  3ZYY X;  1A2T A;  1DOL A;  1JWS D;  2QEJ C;  3HOZ B;  3SK8 A;  2NVQ B;  5EQ0 A;  2L4N A;  2D5D A;  3J7A F;  3JAM L;  3I73 A;  4IUT A;  2XSC A;  3P1H A;  1ILP A;  2JA8 B;  5E4W C;  4ZRZ A;  3X3N A;  4A3B B;  3GV6 A;  4P2C B;  1J9O A;  3KUP A;  2NTT A;  2O2L D;  4K8J A;  1I50 B;  4EQO A;  3IAY A;  2YYZ A;  4IQZ A;  5KGU A;  5I6Y A;  1A3V A;  1FYC A;  1II3 A;  2F03 A;  3T4A C;  5TSS A;  3M7N A;  2KQ3 A;  1BCP B;  3H94 A;  2CQA A;  5KNB A;  1Z7T A;  2EZV A;  4RGN A;  1KAA A;  3LNN A;  2RSN A;  4BA1 I;  4DAP A;  1I6H B;  3EJI A;  3AU7 A;  4PQX A;  2F0S A;  2RKS A;  2F4I A;  2NN6 G;  1DCZ A;  4UAI A;  5C3X A;  5ISR A;  1IHZ A;  2AQ2 B;  4EVO A;  3L3O C;  3K7A B;  2A69 C;  3CHB D;  4K6D A;  3HZX A;  4NW2 A;  1JIC A;  5CBA E;  2M2L A;  1VF5 C;  3QO2 A;  1R9T B;  4JBW A;  2CW0 D;  2L9H A;  1Y8O B;  1TWC B;  2LS0 1;  3K59 A;  3DMU A;  4U68 A;  2EYM A;  1TT2 A;  4OHJ A;  4XQJ A;  4ZYS A;  1D2B A;  2NWG A;  3C2P A;  3C3L A;  1WD0 A;  1JWU D;  3E0J A;  1E2Z A;  5ELF A;  5KND A;  5C44 B;  1JWM D;  4IN3 A;  1HCZ A;  1LLR D;  3GTM B;  4QB4 A;  3OPO A;  5EBD A;  3DHQ A;  2PO4 A;  4FF3 A;  4FXK C;  4DAY A;  1E0B A;  1NCV A;  3QWN A;  5M5Y B;  4FO2 A;  3C46 A;  4X3S A;  2J7Z A;  1BUV T;  5EKI A;  4PMB A;  1JE4 A;  5JPM C;  3S14 B;  3HGB A;  5C4Z A;  3NTH A;  2LMC B;  4WOR A;  1Q1B A;  1QE6 A;  4RGM A;  1ENC A;  4RA8 A;  1SYG A;  3OIQ A;  1CA6 A;  1H9S A;  4ZK9 B;  1C8C A;  1KTK A;  4IUV A;  3W3A A;  1TVX A;  4IFD J;  4RGT A;  4J6H A;  1OO9 B;  3ERQ A;  5A2Q L;  1Y8P B;  1LT3 D;  1IKL A;  3IKJ A;  3RMH A;  4BY1 B;  3RD4 A;  1I4Q A;  3MA2 B;  4KD3 A;  2F0P A;  2VNU D;  5A2Q E;  1MBY A;  2EY5 A;  2A74 C;  2MPM A;  4O1N A;  2PNR C;  3TZU A;  1FNU A;  3WOF A;  3TP6 A;  5D3D A;  1QNK A;  4C3H B;  5JPN C;  2BCO A;  2F0E A;  2YU9 B;  3S1N B;  1SE2 A;  3VR5 A;  2A5H A;  3DWP A;  4Y7N B;  3X3M A;  4L63 B;  2ZXO A;  1SYF A;  2N55 A;  1H9K A;  1VF7 A;  1WTP A;  2G9H D;  2A6E D;  2Z1C A;  1ZKO A;  2EYL A;  1W6K A;  2PCF B;  1MSH A;  1DM0 B;  3ONA B;  4PNY A;  2KEC A;  1LAC A;  2B2Y C;  4A3J B;  4ZKC B;  1BR9 A;  3FMC A;  1LTR D;  4CJ1 B;  1CM9 A;  4LMQ D;  1Z47 A;  2RDG A;  3GV3 A;  1HA5 A;  5IGB A;  5G3L D;  2DY8 A;  4I65 A;  2EXZ A;  1F9Q A;  1U4L A;  2F0Q A;  2MGS A;  1XWE A;  5K36 H;  5BN3 A;  3OOC A;  1J8I A;  3T13 A;  5JOB A;  4HCE A;  3DXJ C;  1TS3 A;  3CRL C;  4FYD A;  4TQU S;  3M4O B;  4DNT B;  1PRT D;  3VR2 A;  3R3O A;  1MI2 A;  1K8M A;  2BDO A;  2I07 B;  2MJ8 A;  2RBM A;  1CK1 A;  2ZXR A;  3Q6S A;  1I4H A;  1ONL A;  1HXY D;  3DUZ A;  1BDO A;  2B2Y A;  1A15 A;  3K0Y A;  4CBV A;  1TS2 A;  3HOX B;  1BO0 A;  1Q12 A;  3CRK C;  5EBC A;  4S3S A;  2FMM A;  4NKL A;  3HOW B;  2Y0S B;  2R3Z A;  2PW7 A;  1GHJ A;  1PZJ D;  4HTH A;  4G7H C;  1BF4 A;  2K32 A;  2ICI A;  4DNR B;  1SDF A;  3A7L A;  3KF8 A;  4ILW A;  2HUG A;  4C3J G;  2IT1 A;  3HRZ C;  2IX3 A;  3R2I A;  1SMY C;  1WTO A;  1GJX A;  1EYC A;  4B08 A;  1H9J A;  3SK4 A;  3H6M A;  1H9R A;  1EY6 A;  1EQV A;  2F0D A;  2QKI C;  4C1N K;  4KJO A;  5IT9 L;  4FP5 D;  1UNS A;  4R9W A;  1AP0 A;  2A6H C;  2TSS A;  3SR1 A;  1TR5 A;  4GZY C;  3S15 B;  5IT9 E;  1O78 A;  2JXM B;  5KIX A;  2L1B A;  2E75 C;  1A3T A;  1PZI D;  4IZ8 A;  4OO1 I;  2L5T A;  5IGD A;  1O7Y A;  4IFD I;  4BA2 I;  4IUR A;  3MC0 B;  3GTO B;  5C3E B;  1TQO A;  4V19 0;  5C4H A;  1KNE A;  2A73 B;  1BCP D;  4KD4 A;  2H4O A;  4FXD A;  2NVT B;  2JP1 A;  1I4G A;  1SNP A;  2WP8 J;  4KKT A;  1EOT A;  2I46 A;  3S16 B;  1VMC A;  3NQT A;  3VA7 A;  2HCC A;  4N9P A;  3OMC A;  1CZW A;  3FPU B;  3NTK A;  4HR7 B;  1PMR A;  3CU7 A;  3BYY B;  3P7J A;  1B1Z A;  2SOB A;  5EGT A;  1WTW A;  3K57 A;  4WFN 3;  4QIW B;  4KN7 C;  1D6E C;  3VYR A;  2PYK A;  1B4O A;  3ND8 A;  3GTG B;  1NR4 A;  1Z6H A;  2EE1 A;  1EWH A;  1IYV A;  1F2Z A;  3FVQ A;  3V2T A;  5JEA H;  2EY6 A;  2E2J B;  5CV7 A;  1RKN A;  1ILQ A;  4H13 C;  4XQQ A;  3Q0A A;  3NPP A;  5FKA C;  1EQT A;  3D8G A;  4XTC S;  2NN6 I;  1PDQ A;  2FIN B;  5E4X A;  3BDL A;  1U9R A;  3SE0 A;  1RHP A;  4BY7 B;  1G6Z A;  1CQF A;  1ICW A;  3DWA A;  2OEO A;  2WKC A;  1K83 B;  4WRD A;  5KYL A;  3I3C A;  1U4P A;  3VYU A;  3MFY A;  1ESF A;  3PO3 B;  1Q90 A;  5EJW A;  1H9S B;  4CGY B;  4KK7 A;  1EZ6 A;  1GUN A;  1ROD A;  5EKK A;  3KLS A;  2F0K A;  2EPB A;  2BA0 A;  2AQ1 B;  2F0W A;  4IUP A;  1EL0 A;  5JJZ A;  4Q5V A;  2G9D A;  4OIK A;  2LKV A;  2Z8L A;  1AW7 A;  3PUY A;  2L55 A;  3DEP A;  3M4Y A;  2ID0 A;  3RUZ A;  2JSO A;  4HED A;  4K2K A;  1VMP A;  3HOU B;  2K5W A;  1ESR A;  1G2S A;  4XDX A;  1LTB D;  3SDZ A;  1MD2 D;  2EYJ A;  1SBB B;  2SNM A;  3G7L A;  1R4P B;  4QUF A;  4ABN A;  1PTO C;  3M3Y B;  2V4D A;  5JEA G;  5C0X G;  1BOS A;  1JB3 A;  1A2U A;  1F9R A;  2B8G A;  1QIL A;  1NSN S;  5EKL A;  3RZD B;  5M5X B;  5CR3 A;  1MSG A;  3RLF A;  3S17 B;  4A3I B;  1S4Z A;  4EQP A;  4BS9 A;  2WV6 D;  1STN A;  1EY5 A;  4PMC A;  2A68 D;  5A35 A;  3TME A;  3S2H B;  3QIA A;  2Q8T A;  1ZYR C;  3NXW A;  1UEA B;  3D6W A;  3GTQ B;  1WD1 A;  4XT3 B;  1LT5 D;  1HQM C;  5IGC A;  1KNA A;  1B44 D;  1AZP A;  1AN8 A;  5CV5 A;  3VYS A;  5I6W A;  4E6I A;  3AMU A;  2K03 A;  3QG1 A;  2EJF C;  4FF2 A;  3A54 A;  2XRQ D;  2WIN B;  3NTI A;  3NUC A;  1YNN C;  1H9M A;  2EYP A;  2FJ2 A;  2PW5 A;  2F0F A;  3D4R A;  1DOK A;  1STG A;  2X6L A;  3OIP A;  3V96 A;  5EPK A;  3N52 A;  5COY A;  2Q8R E;  3MXG A;  2OT2 A;  2BE5 C;  3U9S A;  3ND9 A;  2RDH A;  2M9V A;  1PFN A;  1CT1 D;  5I9P A;  1I4P A;  5E1F A;  2ICE C;  1QCB D;  3PUZ A;  2B2T C;  1YNJ C;  2KVM A;  4A3G B;  1Q1E A;  4B9W A;  1IL8 A;  3EA6 A;  1QJO A;  3OSO A;  4WJW A;  3SVM A;  1RTO A;  1X3P A;  5T1G A;  1KDA A;  3QOJ A;  2EY1 A;  3TP5 A;  3R8B A;  3KK7 A;  1SE3 A;  4DA2 A;  2D62 A;  1L0X B;  3QB3 A;  1EY9 A;  1LTT D;  1V1P A;  3NE5 B;  4TRD A;  5D65 A;  1WTX A;  2F0G A;  1QG7 A;  1NAP A;  1ZEQ X;  4DXF A;  1R4Q B;  3GTL B;  2K6A A;  1B3A A;  4H7B A;  5EPJ A;  3U9O A;  1G29 1;  3S1R B;  3AB9 A;  2MP1 A;  4CJ2 C;  1XYI A;  2K01 A;  3HOY B;  4K5X A;  4IUU A;  2HDM A;  4ME5 A;  3SEB A;  5C5M A;  5J22 A;  1O7L A;  4QF4 A;  2NZ1 D;  3EQL C;  3TDQ A;  2B2T A;  3ERO A;  3HG9 A;  2J0T D;  4ZKB B;  2NVX B;  1I3Q B;  1QNU A;  4FXG C;  1HPC A;  3DWQ A;  1UUP A;  4R8I A;  1GUS A;  1G8Z D;  1SE4 A;  2PZU A;  3IFT A;  2L11 A;  3T51 B;  1BXT A;  5CV4 A;  2AUJ D;  5C3W A;  3I4L A;  4FVM A;  1SFO B;  2F0N A;  4CKC A;  2K33 A;  1EEF D;  2JE6 I;  2NYZ D;  3MXU A;  1OXS C;  4C3H G;  1FGB D;  3Q22 A;  1EU4 A;  1SYD A;  1S5C D;  5FO7 B;  1NUC A;  2F0T A;  2OXP A;  2B8F A;  4R8N A;  5JEA J;  5C0X J;  1F2Y A;  3NWT A;  4XYO A;  1D5Z C;  1GXD C;  1SNO A;  3GQB A;  2KA7 A;  4KKS A;  5DNF A;  2B2V A;  3K58 A;  2IL8 A;  3NWS A;  3F2U A;  1D5M C;  3CKI B;  4ODG A;  3NK9 A;  1T5X D;  3LWU A;  2JYO A;  3V05 A;  2O4X A;  2M00 A;  1FD7 D;  2JA6 B;  2OF1 A;  1PYW D;  1F9P A;  3A55 A;  4CHT B;  3Q24 A;  3NHH A;  1C4Q A;  4M1U B;  4F8M A;  4KI0 A;  4ULL A;  1BNZ A;  2FHT A;  2RA4 A;  1TY0 A;  2FMC A;  3MHB A;  1B9M A;  1GOZ A;  4KHV A;  3J80 E;  1EIG A;  2E2H B;  1S5D D;  5C5L A;  3SK5 A;  3GTJ B;  1F77 A;  1HQR D;  1STY A;  2D2C C;  2DNE A;  1LAB A;  3OHX C;  2F0M A;  1SYC A;  2HQE A;  2IWH A;  2A69 D;  5M3F B;  5C4J B;  5LL6 X;  2K04 A;  2NUC A;  1RJT A;  5DAU A;  3PMF A;  2BOS A;  4H0L C;  1EY7 A;  2B63 B;  4NDX A;  1X3Q A;  2KJX A;  2XN9 C;  3BG3 A;  1D1K A;  1JR0 D;  2MHV A;  3A56 A;  1JOQ A;  4IUQ A;  3GTP B;  2E74 C;  1EWC A;  2O5J C;  1A6X A;  5ELD A;  1PTO F;  3FEW X;  4BBR B;  3VYT A;  3K5M A;  1SNQ A;  1STH A;  1AEX A;  4KJN A;  1TWA B;  1IKM A;  5LHY 1;  4MIU A;  3P20 A;  4MHE A;  1OXU A;  1B2T A;  4JK1 C;  2EYO A;  4LAA A;  2F0J A;  3QOL A;  5ELC A;  1M4V A;  2AQ3 B;  4XT1 B;  3EVQ A;  5FO9 B;  1HHV A;  1IW7 C;  1CI3 M;  3D31 A;  3L9A X;  2JA5 B;  4A3E B;  1NR2 A;  1UAP A;  5CV8 A;  3GO5 A;  1STE A;  4RHR A;  3D6C A;  1KDB A;  5K36 G;  1SAP A;  3K5O A;  1S5B D;  4C1N I;  5CMD A;  1LTI D;  2EJG C;  1EY8 A;  1B50 A;  2EJM A;  2IPK D;  4FF4 A;  3MFG A;  1S5F D;  3RZO B;  5COR A;  4G4K A;  4KKU A;  1PTO B;  1PFM A;  1RF2 D;  3KLS X;  2EYH A;  3BVM A;  4HSV A;  3MWY W;  1PFB A;  1OXX K;  1HA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...