5EPKA

Crystal structure of chromodomain of cbx2 in complex with inhibitor unc3866
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 2
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5epkA00
1EL0A 5AFWA 2X69A 5EJWA 3I8ZA 2L4NA 2K05A 1HUNA 1G2SA 5CBAE 3DEOA 4MN3A 2L12A 2RVLA 1XX8A 2B2YA 1IKLA 3DEPA 5COYA 5E4XA 3LWEA 4MHEA 1S4ZA 3TN2A 1F9PA 1F9QA 1U4MA 1X3PA 2M2LA 1J9OA 4ZKBB 1WTPA 4ZKCB 5CORA 1QE6A 4XT3B 2FFKB 2K28A 2N88A 4QUCA 2B2VA 2B2WA 4ZAIA 5CBEE 1DZ1A 2MP1A 2X6LA 3HP3A 1B4OA 1DOMA 1WD0A 1DOKA 1CM9A 3I90A 2Q8TA 2RSNA 1O7YA 2J7ZA 1EOTA 1B53A 1VMCA 1JICA 1SAPA 2B2TC 2H1EA 1HFGA 2K03A 2KOLA 2L9HA 3FDTA 1QNKA 3QO2A 4UAIA 1M8AA 2HCCA 4R8IA 4NW2A 2B2UC 1WTVA 1BF4A 1MSGA 1HHVA 1PDQA 2DY7A 2EPBA 1ESRA 2CVRA 1RJTA 1QG7A 1WTOA 1KNAA 4ZK9B 2KECA 2KEDA 1HRJA 2FMMA 5CMDA 1IL8A 2SDFA 1KNEA 1NR4A 4X3SA 1AZQA 2MJ8A 2RA4A 1WD1A 1VMPA 2NWGA 2Q8RE 5T1IA 4CJ1B 1MSHA 3SVMA 1ML0D 1C8CA 2RSOA 4IUQA 2R3ZA 5EQ0A 4CJ0B 1BBXC 3TZDA 1TVXA 2DY8A 4IURA 1CA5A 2B2VC 3G7LA 4IUUA 1U4LA 1O80A 1DOLA 1RODA 1HFNA 2HCIA 1B50A 4RA8A 1HA6A 2MGSA 3N52A 2EE1A 4DN4M 1EQTA 4RAUC 1B2TA 2NYZD 1DONA 1G6ZA 1PLFA 2EOTA 1GUWA 4ZLTF 1RTOA 2L1BA 3GV6A 4IUVA 2K04A 1WTRA 1NAPA 1PFBA 2L11A 2X6GA 3Q6SA 4O42A 2MPMA 2VXWA 2XIWA 1JE4A 5EPJA 4U68A 1SSOA 4X3TA 2K1BA 2D9UA 4HEDA 1RTNA 5JJZA 3KUPA 3UI2A 3GV3A 2N55A 3MWYW 4XT1B 5D14A 2B2YC 1LV9A 2HUGA 4HSVA 1WTXA 2B2TA 1ICWA 4X3UA 5E4WC 5T1GA 4X3KA 3KBXA 1XYIA 5DNFA 1RHPA 4LMQD 2JP1A 3IFDA 1ZXTA 5EPLA 2B2UA 2FHTA 4OIKA 2KUMA 3IL8A 4RWSC 2B2WC 2FJ2A 1AZPA 1WTQA 1G2TA 2FINB 1F2LA 3R93A 2KEEA 1PFNA 3F2UA 2HDMA 5EPKA 1Q3LA 1B3AA 1HUMA 3FPUB 4HCSA 4OIJA 1EIGA 4R9WA 1CA6A 1J8IA 1WTWA 1A15A 1U4RA 1U4PA 1X3QA 1WVLA 1E0BA 1NR2A 2JYOA 4QUFA 1IKMA 3ONAB 2BDNA 2IL8A 2KVMA 4XDXA 1F9RA 5D65A 1ILPA 1O7ZA 2K01A 1PFMA 4HAEA 4IUTA 1NCVA 1AP0A 1EIHA 1BO0A 2NZ1D 3H91A 1BNZA 3D6WA 2HDLA 1ILQA 3P7JA 1G91A 1MI2A 3I91A 4IUPA 1SDFA 5EKIA 1X32A 3DM1A 3I3CA 4CJ2C 1MGSA 3MTSA 1F9SA
chains in the Genus database with same CATH superfamily
2ENBA 3NTHA 2F3IA 1VQDA 2NZHA 2NVXH 4BY1B 1Q86C 3H15A 4JI5L 3LWEA 4KMUC 3HOUG 1EEFD 5FLXE 3I73A 5FO7B 2AWOA 5C3XA 1SBBB 3J7AV 3RLNA 2F0HA 1EYCA 4DUYQ 3S1MH 4BS9A 1K28A 1VQKA 4DR1Q 3WOEA 3AQQA 2QEXA 1SLJA 3PO2H 4PQXA 1IZ6A 1QNKA 2A8VA 2LFNA 4DV6Q 2F1MA 4DR4Q 3E9HA 4NW2A 3TZUA 2AUKA 1L0XB 1EFID 1TS4A 4PMWA 5IGGA 5IP9G 4IO9A 3OHXC 1YJ9A 4KHPQ 5C4XG 2R7FA 1TWFB 3OMGA 3CCMA 4DGZA 4TKOB 2E2IB 4A3BG 2SDFA 1NR4A 4MIUA 1P16A 1QCBD 2KA7A 4B3RL 4OO1I 5CV8A 4LFAQ 1YNJD 1A3VA 4IUUA 1HFNA 3FPPA 4JI4Q 5FJ8G 4FF3A 4L5TA 1CKMA 5GAHC 4UHVA 4CDCC 5KNBA 3STBD 3FKIB 1QUQB 1SJED 1WTRA 4L8JA 3HOWH 4LW1A 2CHBD 3NPPA 2WP8J 1KXLA 3TDQA 4IFDJ 1NMGA 3K59A 4FP5D 1L0YB 5L37A 3CCLA 3M4OH 3J81E 2HQLA 4OIKA 1SMYD 3RN2A 1E22A 4P74A 2FINB 4DXFA 1ASZA 2JSOA 4LF6Q 1KLUD 2OTJA 3D4WA 4H02A 3TP5A 4G7ZC 1D5XC 2A19A 4X62L 1KIXA 4GKJL 1Z7TA 2Z1CA 3P75A 1K8OA 3L3OC 3MFYA 1VQ4A 2E2HB 2NTTA 4MZ9A 4N9PA 1WCMH 5GQOA 4JV5L 5IGBA 5ELDA 1BXTA 1F2ZA 1H9SA 2SOBA 3I4LA 5IOCA 1K0RA 5I9PA 1TY2A 2OT2A 2F0PA 3PUXA 3GTOB 4CHTB 2E5LL 2I5MX 1YI2A 4JI3Q 2L12A 2EYJA 5DLQE 4DK6C 3A8IE 1VQIA 3NENA 4JI7L 1EYAA 4GN5A 2F0SA 1LT5D 3MC0B 2MQHA 1Y14B 2X6LA 2JA7H 1GJXA 1GHKA 4POGA 1E1OA 4F88A 4A3CH 4WJWA 1H9SB 4A3KB 2Q2TA 3QWNA 2PQAA 1HFGA 3L0OA 2F0NA 1I4PA 3T13A 3RZDH 1JCKB 3W3AA 3R2IA 5IP7H 2Y0SB 4RGNA 3SXHA 2CVRA 1K8MA 4K2LA 1KNAA 1Z47A 5DAUA 1ASYA 1GVPA 4X65Q 1DGSA 3I70A 3AFPA 1JJ2A 1SE3A 1OXUA 2OF1A 5EQ0A 5ELBA 4GOPA 2B8GA 1A2TA 3DHQA 3JAML 2C5CA 4N8X1 1DOLA 4JI8L 3S14H 1YNJC 3NTKA 3BS1A 1A6XA 1TXYA 1PLFA 2F0UA 4CBVA 3UDXA 5IYDH 3OTOQ 1AEXA 1RTOA 2PO4A 3PUZA 3STBC 4DUZL 4HIMA 1RCVD 2IWHA 3FVQA 3OW7A 5LL6X 1HPCA 5IGEA 4GLXA 2A6HD 3GV3A 2BA1A 3VYSA 3MWYW 1Q1EA 4C56C 5A35A 3T1HQ 3ND8A 2JA5H 5T1GA 1YVCA 4ID6A 2CQAA 1R9TB 1BCPF 1YBYA 2NN6I 1IBKL 4LWCA 2HQEA 4BBRB 3W1GA 3ZYYX 4UY8C 1EU4A 5JPNC 4GZYC 2XTIA 1SMYC 4FYDA 4GLVB 3K6OA 4NXNL 3M3YB 1Q3LA 4JI6L 4DR6L 2CFMA 3QJYA 1RF2D 4ZRZA 3GTJH 1N36Q 4DR3L 2D5DA 2IL8A 3GO5A 4XDXA 3BDOA 4QIWB 5M9OA 2IW3A 3LWUA 3J7ZC 1AP0A 3C1EA 1KAAA 1OXTA 1EZ6A 4LF8L 3KLSA 4B3ML 5LMNQ 4JBJA 5CV9A 1RD9D 4DK3C 4DV2Q 4L5SA 1MD2D 3GTQB 4FO2A 4LFBL 3TREA 1EL0A 2L5TA 5EJWA 3PO2G 3PSIA 3DWAA 2NUCA 1C0AA 2N3SA 2EYLA 4IFDH 1F9PA 4ZKBB 4TQUS 4DAMA 1K0SA 3KDFB 2SEBD 4Q0FA 4KKUA 5DM73 1I94Q 1XTCD 5HGQA 1HR0Q 1AW7A 1DOMA 2KCNA 1NE3A 3OYYA 3I4MH 1CT1D 3I4OA 4DPGA 1Y8NB 1STGA 2L9HA 2UXBL 3BDLA 3GTLH 3MXPA 1KDBA 2AHOB 3QOJA 1ESRA 1S5BD 3TP6A 4A3GG 2VW9A 3GTMB 1YHQA 3TSSA 2R61A 3MEFA 4E6IA 3O13A 5K36G 1Y1VH 1JB7A 5HY6A 1VMPA 1NNXA 2F0GA 1C8CA 2F0QA 2IX1A 2B29A 2KHSA 1TWCB 1LYLA 1Q1BA 4S3SA 4IURA 2F03A 2PQAB 1CQFA 1HNWL 5C4HA 1SNMA 2MGSA 1JWSD 1F77A 3AEVA 1EQTA 2CWAA 4NXMQ 2QF7A 3H6MA 1EEID 1BR9A 1EYDA 4K6DA 1A63A 1GUWA 1N8RC 2K50A 2L1BA 3DXJC 1EY0A 1UE6A 4G7OC 2WAQE 2I07B 5C0XI 5IGDA 1VQFA 3EJIA 1SSOA 4LJZC 4X3TA 1T5XD 5JJZA 3PIP3 2IT1A 4X66L 2PW7A 2A6HC 1JR0D 2AKWB 3P20A 1WCMG 5EPLA 1ICFB 1II3A 2KUMA 1VQAA 5M5WH 4IN3A 2ZM6Q 5A2QE 4C2MH 3VR3A 5I6WA 2HDMA 1AH9A 5IE8A 2N8NA 2JA8B 5ELFA 5AJ3L 4AYBB 3AMUA 4XXEA 3IAYA 1X3QA 3C2PA 3JAME 1B9NA 2EY2A 2WB1B 2KVMA 4GNXA 3OW2A 2NVQH 2EDGA 1AFPA 4R4OA 1CHQD 1BOSA 3BJUA 1XNRL 1ILQA 5C0XJ 2E74C 5EKIA 3I3CA 3ZJYC 4A3JH 1PZID 2E2JB 4JW0A 3HS0C 3K8AA 4H44C 1X54A 2L4NA 3MVVA 3NP8A 1G51A 3TS2A 1C48A 1IKLA 5COYA 5IP7G 3J80L 5CC4A 2JXMB 1XPRA 5ELOA 2ID0A 1M90C 2K28A 3KF8A 4LF4Q 3U9OA 1B70B 4YHHL 3NEMA 5D3IB 2KQ3A 2RSNA 4HR7B 5KGUA 1YNXA 4PG3A 2A69D 4XQNA 2K4KA 3EN2A 4CKEA 1PDQA 3PIOA 2EPBA 5C4JH 5IYDG 3S16H 1SROA 1TS2A 1HRJA 3QIAA 3E9IA 4BXXG 5HURA 4BBSH 2I0QA 3I4NH 1QVCA 1VQMA 2ZTDA 3ERQA 1VQEA 2JA5G 3GTGB 2R7ZB 4A3IG 2NN6H 4A3FB 1S72A 1B50A 2K14A 1KD1C 2Z6BA 2NYZD 3F2CA 4DUYL 3GDEA 4HJ7A 3LGJA 4PV1C 3SEBA 5BR8Q 2I5HA 4DR1L 3SK6A 1PFBA 2E8GA 2K52A 2H4OA 2M00A 2MPMA 3G71A 2D9UA 2EY6A 5ELNA 1LV9A 1YNND 2CKZB 4HSVA 2B2TA 4DV6L 4C3IB 4DR4L 4OX9L 1IBLQ 4X3KA 3GTKB 1SYEA 4QF4A 1K83B 1GXDC 4KHPL 1D5ZC 1N33Q 2JA9A 2PNRC 4PZ6A 3FP9A 4YCWA 2DUDA 2KEEA 2ICEC 4YCUA 1Q81C 3H0GB 3NBHA 3NQIA 3SK5A 2JYOA 4LFAL 2G9HD 3L7ZC 2Q2HA 4WORA 4KY5A 4AQYQ 4JI4L 1F9RA 3K5LA 4HSPA 3UDIA 4IUTA 2K01A 4DNRB 2NVYB 2KHJA 2N49A 2ZT9C 2EYMA 4IPDA 4O2DA 4L6TB 2CW0D 3P7JA 4IUPA 2ICIA 5C3EH 3CCRA 2K5WA 4L63B 2DNEA 3I4MG 1UNSA 4DR5Q 2RQXA 3DWPA 3S2DB 1MIUA 4A3DB 3VR4A 3T56B 4B08A 5BN3A 4GKKQ 1HTPA 3HEJA 3NBIA 3C3LA 3NE5B 2OWOA 4GNXB 3S1QH 1PXUA 1U5KA 2F52A 1QE6A 3RMHA 4I7ZC 2MUYA 4LF6L 1Y1VG 3PV0A 1VCIA 4NP5A 1VQGA 4FXGC 4BY1H 2V4DA 3HKSA 2K5QA 1B53A 3BVZA 1LTGD 3CRKC 2Y0SE 3EA6A 4AH6A 4KY7A 1NTGA 2EY5A 2AQ2B 1EYGA 3A0JA 1BF4A 2A69C 4BA2I 1X3EA 3ND9A 2FMMA 3KF8B 4R4IA 5C0XH 5J3BA 1WJJA 3E0JA 4UP8A 1X55A 1H9KA 3SVMA 2ZXOA 5CYUA 3Q22A 4JI3L 2LKVA 3HG9A 1S40A 4XIGS 5IYCH 3J80E 4RG1A 1TWFH 2E2IH 1Q90A 4N8FA 4X6AH 1B2TA 1UE7A 2A74C 4ZLTF 1CKOA 2JA6B 4LUVA 3D0FA 1A0IA 4DKAC 3E6ZX 4C3HB 1OTCA 5M3MB 1EIYB 5IIFA 1L0WA 4GN4B 3HOXB 1WOCA 2YTXA 1F2YA 4G4KA 4EVOA 1J5EQ 4FF1A 4FF4A 1YNNC 2F0LA 3FKIH 3IFDA 3KJOA 2SNSA 4OL7A 4X65L 4KTAA 1A3UA 4A3JG 1SNCA 3PO3B 4IUNA 1QZHA 2EZVA 1PTOF 3CC7A 2UUAQ 3VR6A 3KK7A 2RHSB 4QIWE 1WTWA 2VUMB 1Q8KA 1PTOD 2C35B 1ILPA 5D65A 1TS5A 4A93G 2WFWA 2NZ1D 4QY7A 3H91A 1PH8A 3OTOL 1K9MC 4NPSA 2PMZB 2CW0C 2GA4B 3H3VC 1NBWA 4DV4Q 1FNVA 5AFWA 4DAYB 3EQLC 4YHHQ 5C44H 2EJFC 3T1HL 4P75A 1EQQA 4Q5VA 2E2HH 2E75C 2A73B 4EQPA 1KRTA 1K8GA 1J6QA 4KKSA 3CPFA 4OWXB 4JBMA 1PRTB 3EFXD 3OSOA 3KBGA 3AYHB 3I4NG 4OWWB 3GTOH 1SJHD 3PGZA 2YU9B 4K6LA 1EIFA 1N36L 4F8MA 1K8AC 2YTYA 2NN6G 3VDYA 1E2ZA 4JPBW 2A6ED 2B2UC 2EIFA 1WTVA 4A3MB 2GVAA 4WJ3M 5LMNL 4QJFA 4DV2L 3KLWA 5NUCA 2F0EA 4A3KH 1VQ9A 4DV0Q 2B63B 3BZCA 4NDXA 4IZ8A 5H1SE 3G7LA 1VQBA 2VB2X 1XXGA 4HN7A 5CV5A 1I94L 1E1TA 1HR0L 4OX9Q 4ODGA 3HOZB 2LXJA 4IFDI 1U0LA 2BDOA 2WAQG 3HOYB 1JWMD 3K58A 1QOHA 2OXPA 1FGUA 4B3TQ 3CMEA 2JQOA 5LL6S 2D62A 2JP1A 3CP0A 3I56A 1CSQA 5IY0A 2OQ0A 2PNHA 2PW5A 1F2LA 1GM5A 1UAPA 4AYBE 1CFMA 1SE8A 2OQKA 2WB1E 3A56A 5LMNW 1WVLA 1R9TH 1FNUA 3DMUA 1IKMA 4FXDA 1JJGA 2RCFA 1HNZQ 4BBRH 2KCMA 5F2DA 4K2KA 4C3JB 2VQFQ 1PTOC 4NXML 2R92B 3PUYA 1LT3D 2IJ0A 5M3FB 3M3YH 4OONA 1EQVA 3G6JB 3T51B 3MA2B 4BY1G 2F0JA 1HR0W 2Z0SA 2K5HA 3I7FA 4QB4A 4LF5Q 2ZTCA 1PVOA 1EOVA 4DAVA 3A55A 1I4GA 2EYPA 1J9OA 4A3LG 2F0DA 4XT3B 3GTQH 2ZM6L 5C44B 5C0XG 2KCCA 2MP1A 5EKLA 5M5YB 3KDFA 3U4ZA 1S5DD 1STYA 2ES2A 2HIVA 2J7ZA 4L5RC 1P8LA 1TR5A 3K7UC 3WDNA 3QO2A 3GQBA 2BCOA 3KLRA 5IYCG 4R8IA 1AE2A 3E5SA 3CCQA 3A8KE 1GKHA 1ZKOA 1LTBD 1NMFA 2A6EC 1HZCA 4KLKA 3S24A 5IT9L 2KECA 1CSPA 1E24A 3KYHC 1A3TA 3NWSA 1N9WA 4H0LC 5CR3A 3NWTA 1E2WA 3FKIG 2MFIA 3CQZB 1SEBD 1LTID 3GTMH 4DK1A 3QR8A 4RAUC 4LF4L 1Y8OB 1VQLA 1TT2A 1B44D 4KJNA 1TWCH 5EPJA 2XIWA 1V1PA 1V1QA 2OCEA 1S5FD 3AB9A 2R7DA 1OO9B 3HOVG 1B1ZA 4KI0A 1STEA 3PUVA 3M85A 4RGMA 1LTLA 2PYKA 2LMCB 4H7BA 4DV1Q 4K0KQ 1OXVA 3L9AX 4IJLA 2V1CC 1W2BA 3D8GA 5JPMC 5DEHA 4XYQA 1B7YB 3FPUB 2ZJRA 1XMQQ 5FLMH 4KN4C 5JJIA 4FXKC 3M7NA 1NCVA 1BO0A 2IHEA 1PH6A 3VYTA 1EZ8A 2L15A 4RKBA 1LACA 1SE2A 1Y1WB 3I91A 2JN4A 5BR8L 4KKTA 1Y8PB 1L1OC 2JA8H 1ZYRD 3KFUA 2JE6I 5D3DA 4WRDA 5EAYA 5JAVA 3NTIA 2TSSA 2F0VA 1BCPD 4I65A 5G3LF 5E3FA 1QZGA 2RCNA 1W6KA 3K81C 5CBAE 2UXCQ 1IBLL 1BBUA 1S4ZA 1X3PA 1WTPA 1N33L 3KF6A 5G3LD 2MO0A 3CAMA 4A3GB 4DFAA 1PH2A 3RZOB 1FD7D 1HTLD 2E2JH 1ET6A 3FEWX 4ALPA 1V8QA 1CM9A 1JC7A 2Q8TA 4YWMA 1O7YA 4CDFC 1ET9A 1VMCA 2H1EA 4AQYL 4LNQA 2XGTA 2QKIC 3K7AB 2F0WA 1HZAA 1I4HA 1XPUA 3SDZA 1V43A 2QGQA 4DR5L 2CWPA 3UDGA 1FGBD 4GKKL 3A7AB 4IJHA 1L2FA 2R6GA 4X64Q 5BN4A 4BY7B 3BU2A 2EE1A 3NUCA 3G4SA 4JG2A 2MNAA 4XTCS 2Q2UA 3EVQA 3GV6A 2OEOA 5J1ZA 3UDFA 1WYDA 5C3WA 3K5MA 1VQHA 1IBMQ 2L11A 2R7ZH 3GTGH 3RR5A 1E7ZA 4A3FH 2B2YC 2LXKA 3HOWG 4J6HA 5FO9B 4DV5Q 1VQ6A 4A3EB 1NUCA 4R8NA 1X3GA 5IT9E 4RWSC 1XNQL 2IPKD 3DWQA 3TRZA 1I50B 3RN5A 1IYVA 3MXUA 3EBEA 1PH1A 4ME5A 4JCVE 3T1YQ 3Q0AA 4C3IH 1V1PB 3GTKH 2Z4HA 1NR2A 2VQEQ 3BDCA 1K83H 2AWNA 2L0CA 4QUFA 3J81j 1IHZA 4GS3A 1CZWA 2PMZE 3BYTB 3D6CA 3N6RA 1PYBA 4QL5A 3U9SA 1FL0A 2HDLA 5FLXc 5BN5A 2R93B 4CJ2C 3MTSA 3H0GH 1EWHA 3HFZB 1ZYRC 4JI0Q 1KRSA 2UUCQ 3OIPA 2PQEA 2B39A 1TS3A 3IKJA 1KC8C 3GTPB 2XWBB 3DEOA 4MN3A 1BCPC 2NVYH 1XX8A 1J5EL 5LMUQ 4GN3B 4LK1C 2K6AA 3A5ZB 1H95A 2XSCA 2N88A 4QUCA 1HQRD 1JB3A 5KRUA 2WV6D 3S2DH 2EQSA 1B4OA 2BE5D 4CKBA 2PCFB 4A3DH 3ITPA 2ATWA 2UUAL 4J1MA 2JA7G 3W1BA 2KOLA 1E2VA 4A3CG 2F3WA 2NTSA 4A3IB 2HCCA 4K8IA 3KJPA 1M1KC 1SYBA 1O7LA 3C46A 3KF6B 2CH4W 2BH8A 1VQ7A 1AZQA 2JJQA 1KAWA 3D3RA 4DV4L 3CF5A 2NWGA 2DJFC 4LF7Q 2R3ZA 4PNYA 2BH2A 3BYYB 2K33A 1O80A 4RGOS 1BQQT 3U58A 1G8ZD 4DN4M 1KHIA 3J81c 1G6ZA 4JBKA 1D8LA 4B3SQ 2RBMA 5KYLA 2K04A 4KHVA 4KHZA 1N34Q 1NAPA 1Y69U 1LTAD 3Q6SA 1NSNS 2VXWA 1JE4A 4GLAC 4HMJA 4HTHA 5FLMG 2O2LD 4F87A 3OMCA 1I4RA 1TWGB 3K0XA 1ZXTA 2JA6H 4JI1L 5M5XB 1H9MA 2B2WC 4C3HH 5M3MH 3MXGA 1JOOA 1PFSA 3X3NA 4AYBG 4C1NK 2JA8G 1RIPA 2EJMA 2K5VA 4DV0L 3HOXH 2WB1G 1A15A 4PMBA 2AQ3B 2BDNA 2JEBI 4DV7L 1PV4A 1EU3A 3S17B 3PO3H 2VY3A 2QEJC 1MGSA 1I3QB 3P1HA 2RDGA 4NB3A 2VUMH 1YHBA 1HUNA 1G2SA 1Z9FA 2IX0A 4DAYA 4B3TL 5KNDA 1DD2A 1FR3A 3HKZB 2PZWA 2XWJB 2M2LA 1SMXA 1HJPA 4OXPA 1A2UA 1PRTF 4IFDG 2B2VA 2A68D 5C4ZA 2Z4IA 1WD0A 2BE5C 1TWHB 4RMFA 5IGCA 3CD6A 3ICEA 1HNZL 5IP9H 3J7YW 3CKIB 2VQFL 1DM0B 2EVBA 1PZJD 4P73A 2KEDA 5J22A 1K3RA 3M9BA 5CMDA 2J0TD 2DN8A 2YU9H 3VA7A 2R7ZG 1ENCA 4R4CA 3TMEA 1MSHA 1D7QA 1GHJA 4A3FG 3QB3A 4CJ0B 4LF5L 5ELEA 4KN7C 1CA5A 5IODA 2SNMA 1HXYD 4A3MH 2F0TA 1VQJA 4POFA 4RA8A 3J81i 3F8TA 3H3VH 2AUJD 4UDUC 2UXDQ 1B3QA 1PMRA 2EYFA 3T16A 2B63H 4IALA 4IOAA 2L55A 1XNQQ 4JBWA 1XWEA 3VR2A 2N55A 4XT1B 5D14A 4X3UA 1DJRD 1YIJA 2ZJPA 2WINB 4A93B 2H5XA 1PH4A 3HOZH 1XTDA 2B2UA 4DR2Q 2PZUA 5KIXA 5EGTA 1GD7A 1AZPA 1VF5C 1SR3A 1EFWA 1FJGQ 2XRSD 3H0GG 2RKSA 3HOYH 3F2UA 2DNCA 5JVG3 1H9RA 1X3FA 1BUVT 3J7AF 3VYRA 2F0IA 1IW7D 2EYOA 3PF4A 4HAEA 2C9OA 3R3OA 5JEAJ 1X6OA 1JE5A 4J15A 4RKLA 4A3DG 4XQQA 2QILA 3CRLC 1SNOA 1STBA 2QCPX 4RFBA 1R4PB 3ULJA 3DLLA 2MHVA 3CC4A 4C3JH 2GN5A 3KOJA 2R92H 3DEPA 4XYOA 2PPBC 1E3PA 5M3FH 1F9QA 4DV1L 3K5OA 4K0KL 4DXGA 3S1NB 3M4YA 5DM63 3FHWA 4EQNA 3HOUB 3H94A 1Q8IA 2ALYB 4JI2Q 1DOKA 1HNXQ 2A68C 2NVTB 3A74A 1XMQL 3PIPA 4CDEC 5IGFA 1SFOB 2J4XA 3K80C 1NY4A 2UU9L 1M8AA 3NELA 5GADC 3Q24A 4DR7Q 3S15B 4RCNA 4DA2A 4KV6A 3K0YA 4IOCA 4A4IA 4RHSA 1DCZA 5M5YH 2WIIB 4X3SA 2G9DA 5ELCA 2IX3A 5C4XB 2Q8RE 4A3BB 4BBSG 2UXCL 1CKNB 3SK4A 1FYCA 4P72A 1SNPA 3E3XA 4YY3Q 2JA6G 1PHJA 1ESFA 3AU7A 4C3HG 1LT4D 3W2DA 3V96A 3CW2C 2KHIA 4JI1Q 1KLGD 1SN8A 3HOXG 1V1OA 3G6EA 4LFCQ 1IXRA 1RL2A 3CQZH 4KJOA 1QNUA 2HUGA 4DU9A 4KY6A 1GUTA 1VQNA 4OGQC 3JAMc 1PH5A 3BZKA 4K14A 3PO3G 3IL8A 1G6PA 2FJ2A 4QGUA 1FVIA 4DV7Q 1JQYD 1PFNA 4OIJA 2VUMG 3ERSX 4PMCA 3V2TA 3T4AC 2O5JC 3SR1A 1E0BA 4X64L 4NKLA 4YWLA 1IW7C 2KBNA 1YJNA 1RKNA 4O1NA 3Q23A 1LTSD 1MKHA 1UEAB 1BNZA 1X56A 5C5LA 3V05A 3D4DA 4FNFA 4ZQ3A 2Z6KC 2K5DA 1IBML 1YJWA 5C3EG 5I2XA 2X69A 4Y52H 1TKWB 1CI3M 1U9RA 2WKDA 2EXZA 4DV5L 1EY7A 1U4MA 3OPOA 4FDBA 4FVMA 1EQRA 1Y1WH 1F2MA 1WFQA 1IYJB 4JOIC 3SGIA 4IPGA 1CTMA 2JK8A 2K7VA 3BVGA 3I90A 4APVA 5IWAQ 3T1YL 1CK1A 1HH2P 4MNOA 2VQEL 1R4QB 1LTTD 1SAPA 3FDTA 4YCVA 4A3MG 4A3GH 3RZOH 1HHVA 1LO5D 4ZK9B 5K36H 2NB0A 1S3OA 5JEAH 1T5EA 2B63G 5KEEA 3MXNB 3RLOA 2ZJQA 2MJ8A 1Q82C 1L1OA 4QQBX 4JI0L 4F7XA 2UUCL 3OOCA 3TBIB 4OWTB 3CMAA 5JJLA 3K7AH 2PI2E 3HOVB 2LS01 5LMUL 2HCIA 4L5QA 1XMOQ 3HOZG 3S1RB 1CQVA 1UUPA 3S2HB 1I6HB 1Q46A 1PTOB 4A75A 4IUVA 3HOYG 2BA0A 3MZ5A 5FO8B 4BWGB 2F4VQ 4PZ7A 4HJ5A 4BY7H 3KUPA 4HJAA 2UUBQ 2I5LX 4HCEA 3ER0A 1WI5A 3JAMi 4Y7NB 4A76A 3KBXA 1XYIA 1AE3A 3NXWA 5IYBH 2F0FA 2FHTA 4KD4A 3PIO3 1CZGA 3DM3A 3HRZC 1WTQA 1VF7A 3U4VA 5FOBB 1TWAB 1LABA 2EY1A 4EGVA 2PZTA 4LF7L 2FXQA 4M8AA 3VR5A 1W6JA 3R2TA 1CA6A 1U4PA 4A3EH 4C3JG 2R92G 1HCZA 4OHJA 5M3FG 2VZAA 1VS0A 1W3SA 2NVXB 1I50H 4DV3Q 3I72A 4AIMA 3M4QA 4TRDA 4G7HC 1SNDA 4B3SL 2Q8IB 1MI2A 1O7IA 1N34L 4RH6A 4MTKA 3TP8A 1OXSC 1PYSB 1ONLA 3S1MB 3HKZE 4K5WA 3GP7A 1CHPD 2RHQB 1HZ9A 1LT6D 2B2YA 3JC66 5C44G 3F2BA 1STAA 3PO2B 3UE1A 5A2QL 2M9VA 3I55A 4LF9L 1SXTA 2R93H 1QVGA 2UU9Q 1PH9A 2FFKB 1SNQA 1DZ1A 3CU7A 4ZYSA 1B8AA 5C6AA 1QWYA 4B9WA 1EY4A 1ENAA 3GTPH 1GUGA 1I4XA 4HJ8A 3RUZA 1DXMA 1JT8A 4O0AA 3I2ZA 4RGTA 1D5MC 1LLRD 3X3MA 4HJ9A 4ULLA 1VQ8A 4BXXH 3CCEA 3J80c 2Q2IA 2TMPA 1KNEA 3L2PA 3CXCA 4PZ8A 1PYWD 4A3IH 4YIJA 1C9OA 1VQPA 4IUQA 2O5IC 4A3KG 2HD3A 4BA1I 1TVXA 3HOWB 1EWIA 3R8BA 1K3BC 1D2BA 5JJKA 1N32Q 3F2DA 1BDOA 1H9JA 1I4QA 3N52A 2CCZA 2Y0SG 1SYDA 4OELB 3M4OB 2HT1A 2RDHA 1T9HA 2NZOA 4NMZA 2PI2A 5EBDA 4IPCA 1UE1A 3K5NA 2RDFA 1S5ED 1L1OB 4ABNA 1QB5D 3LX0A 3NQTA 1IYUA 4JI5Q 4N9TA 4UPAA 3T53B 4TSSA 1X9NA 1D1KA 1WCMB 4JK1C 1EY9A 3RLFA 1STNA 5EPKA 1B3AA 4HCSA 2VNUD 1Q12A 1TWGH 4R9WA 4I7AA 1M4VA 4P2CB 5E1FA 1ZEQX 3ONAB 5M5XH 5I4DA 2K5NA 1Y1WG 4CDDC 3NHHA 4HIOA 2O4XA 3A54A 2UXDL 4UP9A 4BBRG 4OO1H 2JEAI 2A5HA 1JOQA 4M1UB 2D0PA 2KENA 1UWVA 3EROA 4K5VA 3A8JE 4R4TA 3H3VI 2FMCA 2VS1A 2ZTEA 4GOPC 1LUZA 2VL6A 2JA7B 3I8ZA 4B3RQ 1MJCA 5E7NA 3S17H 4B9XA 4DR2L 3RZDB 4EQ5A 5CORA 5JEAG 2HHHL 1FJGL 4C1NI 1I3QH 1JWUD 2B2WA 4ZAIA 1PH3A 1MHWC 1KDAA 3HP3A 1SYGA 3TQYA 2ZXPA 1NJIC 2F4IA 5C5MA 2D0OA 1KQSA 1EOTA 1VQOA 3PQIA 4DK0A 2AMCB 1QVFA 3J80i 5J39A 1MSGA 1A62A 5GAGC 1WTOA 1QG7A 3MFGA 5GAEC 3S14B 3D31A 2HIXA 1TWHH 4R4QA 3WOFA 2VB3X 1WD1A 4GOPB 4CJ1B 2B8FA 4BY7G 1ML0D 2I46A 3UE0A 2F0KA 4X62Q 2KJXA 1BBXC 4GKJQ 3W5OA 1VQCA 4RHRA 4ZUJA 4ZUIA 2LSSA 2XRQD 5IYBG 2JA5B 1SYFA 1X65A 2EOTA 3MAQA 4JV5Q 5I9OA 4DNIA 1IL2A 3TEHB 4JI2L 4DNTB 1HNXL 2ZXRA 1BKBA 2EJGC 2G5DA 1EY8A 4IQZA 4U68A 1HA5A 3OWEB 4HEDA 3PUWA 4A3EG 5JVH3 2E5LQ 3BVMA 4DR7L 2K75A 4UP7A 3ULLA 3QOLA 3GTJB 1UEBA 4LUZA 5DNFA 5I6YA 1BCPB 2QDLA 4JI7Q 4QCLA 5EKKA 2EXDA 1G2TA 3D4RA 3FMCA 1HUMA 4K5XA 1EIGA 3FRPB 4JYAL 1J8IA 1GUSA 4LUOA 4P71A 2E2DC 4FF2A 4A93H 4K8JA 4YY3L 4TVAB 3F1ZA 2R93G 5ISRA 3D6WA 2OTLA 1TY0A 1AN8A 3G48A 3CCJA 1S5CD 1X32A 3NK9A 3PMFA 4LF9Q 1HQMC 3URYA 4LFCL 2F0MA 5I2YA 3EIVA 4KD3A 5GROA 3I4MB 4ILWA 2XNAC 2KCTA 5E4XA 4JI8Q 1BBWA 5HGTA 1RDPD 3GTLB 5CV7A 4ZKCB 1C4QA 2YYZA 1KDCA 1KTKA 4DUZQ 1SYCA 1PZKD 3OIQA 1EY5A 4G57A 1HZBA 3SE0A 4IPHA 3C1FA 3KLSX 1Y1VB 1JICA 4QMGA 4HIDA 2K03A 1WTXA 1YITA 3TP7A 3U50C 3S1NH 3CPWA 3HOUH 3AFQA 4J8QA 1RJTA 1IBKQ 4R1JA 2LY7A 1IL8A 2NVTH 2BOSA 1PH7A 4LAAA 4NXNQ 2RA4A 3CHBD 4ME3A 1SFOH 2DJGC 5JOBA 1Z6HA 4JC0A 5T1IA 4JI6Q 3HGBA 4DR6Q 1JJCB 3S15H 3NSWA 1EWCA 2DY8A 4GNXC 1XPOA 1PRTD 2F0OA 4DR3Q 1U4LA 4HMIA 4V190 4KK7A 1JOKA 3SK8A 1TU2B 5CGKA 1CKNA 4DF7A 3WWVA 3VYUA 1K73C 1DONA 1EY6A 1EUJA 2WKCA 5C4XH 1LTRD 4LF8Q 5K5PA 4B3MQ 4A3BH 5M5WB 2CQOA 5IWAL 2X6GA 1TQOA 1XJVA 1G91A 4CGYB 4LFBQ 1STHA 3OWFA 3IFTA 1D6EC 4C2MB 3DUZA 1MBYA 3K57A 5E4WC 3QG1A 1RHPA 2NBFA 5FJ8H 1PA6A 2IY5B 5FLXL 4OO1G 2WACA 3CCUA 1LM0A 2NVQB 2QA4A 1SRUA 5KYIA 2DGYA 2EYHA 3SHLA 4A3JB 1JMCA 1U4RA 5TSSA 3CCVA 2D2CC 4V0BA 3Q8DA 2UXBQ 1KL9A 2K32A 4C3IG 3MEHA 1XMOL 3PF5A 1GUNA 1WTHA 4U673 3CC2A 1SDFA 3DM1A 3BG3A 2F4VL 4OEMB 1B9MA 1KABA 1SE4A 2AQ1B 2GVBA 1G291 2HHHQ 3J7A5 1TIID 3HKZG 2YTVA 2K05A 1D1IA 2UUBL 4A3LH 2RVLA 1HNWQ 1VDZA 4MHEA 3B6YA 3TN2A 3CCSA 1YEZA 1I5FA 4WJ4A 2B3GA 2P5ZX 2QW7A 1VQ5A 5CV6A 1CUKA 1GO3E 1YZ6A 5CBEE 4XQJA 5C4JB 3S16B 1FNWA 3IRBA 4H13C 5LHY1 2E76C 1QJOA 1OXXK 3RD4A 2A1AA 4BBSB 2B2TC 3I4NB 4UAIA 1BVSA 4X66Q 1GOZA 3BZDB 3J81L 3MHBA 2DY7A 5CV4A 2Z9HA 4DV3L 1C7YA 1QUQA 4Z9CB 3HZXA 3H09A 4EQOA 3E0EA 2Z6KA 3MXNA 5FKAC 2RSOA 5AJ3Q 3TZDA 1DYQA 2B2VC 1RODA 1HA6A 1MJEA 1ENFA 1PRTC 5FK9C 2N78A 2IHFA 2QDBA 1UE5A 1XNRQ 4JOIA 4JVZA 5IT9c 3A5UA 4WFN3 4O42A 4EX5A 1V9PA 1YHAA 1JORA 2K1BA 3HOVH 1RTNA 2CH4A 2F3VA 3A7LA 4YWKA 3M7GA 1A8VA 3UI2A 4DAPA 5KNCA 2WAQB 3ULPA 1GUOA 3S1RH 1ICWA 4MTNA 3S2HH 2RF4A 3LNNA 3GD7A 4ZCKA 4JYAQ 1I6HH 1I6VC 4LMQD 1PTOH 2MO1A 5EBCA 3TS0A 1O78A 2Z8LA 3R93A 2YV5A 4CKCA 1Q7YC 5M3MG 3NBHB 1QILA 5C3EB 4Y7NH 2XN9C 1N32L 2XVSA 3M4PA 1O7ZA 3S9WA 1PFMA 1EIHA 2ASBA 1TWAH 3VA5A 3S1QB 3PCOB 3RNUA 4RCOA 4HIKA 1F9SA
chains in the Genus database with same CATH topology
2ENBA 3NTHA 4BY1B 3LWEA 4KMUC 1EEFD 5FLXE 3I73A 5FO7B 2AWOA 5C3XA 1SBBB 3J7AV 2F0HA 1EYCA 4BS9A 3WOEA 4PQXA 1QNKA 2LFNA 2F1MA 4NW2A 3TZUA 2AUKA 1L0XB 1EFID 1TS4A 4PMWA 5IGGA 3OHXC 1TWFB 3OMGA 4DGZA 4TKOB 2E2IB 2SDFA 1NR4A 4MIUA 1QCBD 2KA7A 4OO1I 5CV8A 1YNJD 1A3VA 4IUUA 1HFNA 3FPPA 4FF3A 5KNBA 3FKIB 1SJED 1WTRA 4L8JA 2CHBD 3NPPA 2WP8J 3TDQA 4IFDJ 3K59A 4FP5D 1L0YB 3J81E 4OIKA 1SMYD 2FINB 4DXFA 2JSOA 1KLUD 3D4WA 3TP5A 4G7ZC 1D5XC 1Z7TA 2Z1CA 3P75A 1K8OA 3L3OC 3MFYA 2E2HB 2NTTA 4N9PA 5IGBA 5ELDA 1BXTA 1F2ZA 1H9SA 2SOBA 3I4LA 5IOCA 5I9PA 1TY2A 2OT2A 2F0PA 3PUXA 3GTOB 4CHTB 2L12A 2EYJA 3A8IE 1EYAA 2F0SA 1LT5D 3MC0B 2X6LA 1GJXA 1GHKA 4F88A 4WJWA 1H9SB 4A3KB 3QWNA 1HFGA 3T13A 2F0NA 1I4PA 1JCKB 3W3AA 3R2IA 2Y0SB 4RGNA 3SXHA 2CVRA 1K8MA 4K2LA 1KNAA 1Z47A 5DAUA 3I70A 1SE3A 1OXUA 2OF1A 5EQ0A 5ELBA 2B8GA 1A2TA 3DHQA 3JAML 2C5CA 1DOLA 1YNJC 3NTKA 3BS1A 1A6XA 1PLFA 2F0UA 4CBVA 1AEXA 1RTOA 2PO4A 3PUZA 1RCVD 2IWHA 3FVQA 3OW7A 5LL6X 1HPCA 5IGEA 4C56C 2A6HD 3GV3A 2BA1A 3MWYW 1Q1EA 3VYSA 5A35A 3ND8A 5T1GA 4ID6A 2CQAA 1R9TB 1BCPF 2NN6I 2HQEA 4BBRB 3ZYYX 1EU4A 5JPNC 4GZYC 4FYDA 1SMYC 3K6OA 3M3YB 1Q3LA 3QJYA 1RF2D 4ZRZA 2D5DA 2IL8A 3GO5A 4XDXA 3BDOA 4QIWB 5M9OA 2IW3A 3LWUA 1AP0A 3C1EA 1KAAA 1OXTA 1EZ6A 3KLSA 5CV9A 1RD9D 1MD2D 3GTQB 4FO2A 1EL0A 2L5TA 5EJWA 3DWAA 2NUCA 2EYLA 4IFDH 1F9PA 4ZKBB 4TQUS 2SEBD 4Q0FA 4KKUA 5DM73 1XTCD 1AW7A 1DOMA 2KCNA 1CT1D 1Y8NB 1STGA 2L9HA 3BDLA 3MXPA 1KDBA 3QOJA 1ESRA 1S5BD 3TP6A 3GTMB 3TSSA 2R61A 4E6IA 3O13A 5K36G 1VMPA 2F0GA 1C8CA 2F0QA 2IX1A 2KHSA 1TWCB 2F03A 1Q1BA 4S3SA 4IURA 1CQFA 5C4HA 1SNMA 2MGSA 1JWSD 1F77A 1EQTA 2QF7A 3H6MA 1EEID 1BR9A 1EYDA 4K6DA 1GUWA 2L1BA 3DXJC 1EY0A 4G7OC 2I07B 5C0XI 5IGDA 4X3TA 3EJIA 1SSOA 4LJZC 1T5XD 5JJZA 3PIP3 2IT1A 2PW7A 2A6HC 1JR0D 3P20A 5EPLA 1II3A 2KUMA 4IN3A 5A2QE 3VR3A 5I6WA 2HDMA 2JA8B 5ELFA 4AYBB 3AMUA 4XXEA 3IAYA 1X3QA 3C2PA 3JAME 1B9NA 2EY2A 2WB1B 2KVMA 2EDGA 1AFPA 1CHQD 1BOSA 1ILQA 5C0XJ 2E74C 5EKIA 3I3CA 1PZID 2E2JB 3HS0C 4H44C 2L4NA 3MVVA 3NP8A 1C48A 1IKLA 5COYA 3J80L 5CC4A 2JXMB 2ID0A 2K28A 3KF8A 3U9OA 5D3IB 2KQ3A 2RSNA 4HR7B 5KGUA 2A69D 4XQNA 4CKEA 1PDQA 2EPBA 1TS2A 1HRJA 3QIAA 5HURA 3ERQA 3GTGB 2R7ZB 2NN6H 4A3FB 1B50A 2NYZD 4PV1C 3SEBA 3SK6A 1PFBA 2M00A 2H4OA 2MPMA 2D9UA 2EY6A 1LV9A 1YNND 4HSVA 2B2TA 4C3IB 4X3KA 3GTKB 1SYEA 4QF4A 1K83B 1GXDC 1D5ZC 2PNRC 2KEEA 2ICEC 3H0GB 3NBHA 3NQIA 3SK5A 2JYOA 2G9HD 3L7ZC 4WORA 4KY5A 1F9RA 3K5LA 4HSPA 4IUTA 2K01A 4DNRB 2NVYB 2ZT9C 2EYMA 4L6TB 2CW0D 3P7JA 4IUPA 2ICIA 2K5WA 4L63B 2DNEA 1UNSA 2RQXA 3DWPA 3S2DB 4A3DB 3VR4A 3T56B 4B08A 5BN3A 1HTPA 3HEJA 3NBIA 3C3LA 3NE5B 1PXUA 1QE6A 3RMHA 4I7ZC 2MUYA 3PV0A 1VCIA 4NP5A 4FXGC 2V4DA 2K5QA 1B53A 3BVZA 1LTGD 3CRKC 3EA6A 4KY7A 2EY5A 2AQ2B 1BF4A 2A69C 4BA2I 3ND9A 2FMMA 5C0XH 3E0JA 1H9KA 3SVMA 2ZXOA 5CYUA 3Q22A 2LKVA 3HG9A 4XIGS 3J80E 1Q90A 1B2TA 2A74C 4ZLTF 2JA6B 3E6ZX 4C3HB 5M3MB 5IIFA 3HOXB 1F2YA 4G4KA 4EVOA 4FF1A 4FF4A 1YNNC 2F0LA 3IFDA 2SNSA 4OL7A 4KTAA 1A3UA 1SNCA 3PO3B 4IUNA 2EZVA 1PTOF 3VR6A 3KK7A 1WTWA 2VUMB 1PTOD 1ILPA 5D65A 1TS5A 2NZ1D 3H91A 2PMZB 2CW0C 2GA4B 3H3VC 1FNVA 5AFWA 3EQLC 2EJFC 4Q5VA 2E75C 2A73B 4EQPA 4KKSA 1PRTB 3EFXD 3OSOA 3KBGA 1SJHD 2YU9B 4K6LA 4F8MA 2NN6G 1E2ZA 2A6ED 2B2UC 1WTVA 4A3MB 5NUCA 2F0EA 2B63B 4NDXA 4IZ8A 3G7LA 2VB2X 1XXGA 4HN7A 5CV5A 4ODGA 3HOZB 4IFDI 2BDOA 3HOYB 1JWMD 3K58A 1QOHA 2OXPA 5LL6S 2D62A 2JP1A 2PW5A 1F2LA 1UAPA 1CFMA 3A56A 1WVLA 1FNUA 3DMUA 1IKMA 4FXDA 5F2DA 4K2KA 4C3JB 1PTOC 2R92B 3PUYA 1LT3D 2IJ0A 5M3FB 1EQVA 3G6JB 3T51B 3MA2B 2F0JA 4QB4A 4DAVA 3A55A 1I4GA 2EYPA 1J9OA 2F0DA 4XT3B 5C44B 5C0XG 2KCCA 2MP1A 5EKLA 5M5YB 1S5DD 1STYA 2J7ZA 3WDNA 1TR5A 3QO2A 3GQBA 2BCOA 3KLRA 4R8IA 3E5SA 3A8KE 1ZKOA 1LTBD 2A6EC 5IT9L 2KECA 1A3TA 3NWSA 4H0LC 5CR3A 3NWTA 1E2WA 3CQZB 1SEBD 1LTID 4DK1A 4RAUC 1Y8OB 1TT2A 1B44D 4KJNA 5EPJA 2XIWA 1V1PA 1S5FD 3AB9A 1OO9B 1B1ZA 4KI0A 1STEA 3PUVA 3M85A 4RGMA 2PYKA 2LMCB 4H7BA 1OXVA 3L9AX 3D8GA 5JPMC 5DEHA 4XYQA 3FPUB 4KN4C 4FXKC 3M7NA 1NCVA 1BO0A 3VYTA 1EZ8A 4RKBA 1LACA 1SE2A 1Y1WB 3I91A 4KKTA 1Y8PB 1ZYRD 2JE6I 5D3DA 4WRDA 5JAVA 3NTIA 2TSSA 2F0VA 1BCPD 4I65A 5G3LF 5E3FA 5CBAE 1W6KA 1S4ZA 1X3PA 1WTPA 5G3LD 4A3GB 4DFAA 3RZOB 1FD7D 1HTLD 1ET6A 3FEWX 1V8QA 1CM9A 1JC7A 2Q8TA 1O7YA 1ET9A 1VMCA 2H1EA 2QKIC 3K7AB 2F0WA 1I4HA 3SDZA 1V43A 1FGBD 3A7AB 2R6GA 5BN4A 4BY7B 2EE1A 3NUCA 4XTCS 3EVQA 3GV6A 2OEOA 5J1ZA 5C3WA 3K5MA 2L11A 2B2YC 4J6HA 5FO9B 4A3EB 1NUCA 4R8NA 5IT9E 4RWSC 2IPKD 3DWQA 1I50B 1IYVA 3MXUA 4ME5A 3Q0AA 1V1PB 2Z4HA 1NR2A 3BDCA 4QUFA 2AWNA 2L0CA 1IHZA 1CZWA 3BYTB 3D6CA 3N6RA 3U9SA 2HDLA 5BN5A 2R93B 4CJ2C 3MTSA 1EWHA 1ZYRC 3OIPA 2PQEA 2B39A 1TS3A 3IKJA 3GTPB 2XWBB 3DEOA 4MN3A 1BCPC 1XX8A 4LK1C 2K6AA 2XSCA 2N88A 4QUCA 1HQRD 1JB3A 5KRUA 2WV6D 1B4OA 2BE5D 4CKBA 2PCFB 3ITPA 4J1MA 2KOLA 1E2VA 2F3WA 2NTSA 4A3IB 2HCCA 4K8IA 1SYBA 1O7LA 3C46A 1AZQA 3D3RA 2NWGA 2R3ZA 4PNYA 3BYYB 2K33A 1O80A 4RGOS 1BQQT 1G8ZD 4DN4M 1G6ZA 2RBMA 5KYLA 2K04A 4KHVA 4KHZA 1NAPA 1Y69U 1LTAD 3Q6SA 1NSNS 2VXWA 1JE4A 4HMJA 4HTHA 2O2LD 4F87A 3OMCA 1I4RA 1TWGB 1ZXTA 5M5XB 1H9MA 2B2WC 3MXGA 1JOOA 3X3NA 4C1NK 2EJMA 1A15A 4PMBA 2AQ3B 2BDNA 2JEBI 3S17B 1EU3A 2QEJC 1MGSA 1I3QB 3P1HA 2RDGA 1HUNA 1G2SA 2IX0A 4DAYA 5KNDA 1DD2A 1FR3A 3HKZB 2PZWA 2XWJB 2M2LA 1A2UA 1PRTF 4IFDG 2B2VA 2A68D 5C4ZA 2Z4IA 1WD0A 2BE5C 1TWHB 5IGCA 3J7YW 3CKIB 1DM0B 2EVBA 1PZJD 5J22A 2KEDA 5CMDA 2J0TD 2DN8A 3VA7A 1ENCA 3TMEA 1MSHA 1GHJA 3QB3A 4CJ0B 5ELEA 4KN7C 1CA5A 5IODA 2SNMA 1HXYD 2F0TA 4RA8A 2AUJD 4UDUC 1PMRA 2EYFA 3T16A 4IALA 2L55A 4JBWA 1XWEA 3VR2A 2N55A 4XT1B 5D14A 4X3UA 1DJRD 2WINB 4A93B 2B2UA 2PZUA 5KIXA 5EGTA 1AZPA 1VF5C 2XRSD 2RKSA 3F2UA 2DNCA 5JVG3 1H9RA 1BUVT 3J7AF 3VYRA 2F0IA 1IW7D 2EYOA 4HAEA 2C9OA 3R3OA 5JEAJ 4RKLA 4XQQA 2QILA 3CRLC 1SNOA 1STBA 2QCPX 4RFBA 1R4PB 2MHVA 3DEPA 4XYOA 2PPBC 1F9QA 3K5OA 4DXGA 3S1NB 3M4YA 5DM63 4EQNA 3HOUB 3H94A 1Q8IA 1DOKA 2A68C 2NVTB 5IGFA 1SFOB 2J4XA 1M8AA 3Q24A 3S15B 4RCNA 4DA2A 4KV6A 3K0YA 4RHSA 1DCZA 2WIIB 4X3SA 2G9DA 5ELCA 2IX3A 5C4XB 2Q8RE 4A3BB 3SK4A 1FYCA 1SNPA 1ESFA 3AU7A 4C3HG 3W2DA 1LT4D 3V96A 1KLGD 1V1OA 4KJOA 1QNUA 2HUGA 4DU9A 4KY6A 1GUTA 4OGQC 4K14A 3IL8A 2FJ2A 1JQYD 1PFNA 4OIJA 4PMCA 3V2TA 3T4AC 2O5JC 3SR1A 1E0BA 4NKLA 1IW7C 1RKNA 4O1NA 3Q23A 1LTSD 1UEAB 1BNZA 5C5LA 3V05A 3D4DA 4FNFA 4ZQ3A 2K5DA 5I2XA 2X69A 1TKWB 1CI3M 1U9RA 2WKDA 2EXZA 1EY7A 1U4MA 3OPOA 4FVMA 1F2MA 1CTMA 2K7VA 3BVGA 3I90A 1CK1A 1R4QB 1LTTD 1SAPA 3FDTA 1HHVA 1LO5D 4ZK9B 5K36H 2NB0A 5JEAH 1T5EA 5KEEA 2MJ8A 4F7XA 3OOCA 3TBIB 3HOVB 2LS01 2HCIA 3S1RB 1CQVA 1UUPA 3S2HB 1I6HB 1PTOB 4IUVA 2BA0A 3MZ5A 5FO8B 4BWGB 3KUPA 4HCEA 4Y7NB 3KBXA 1XYIA 3NXWA 2F0FA 2FHTA 4KD4A 3PIO3 1CZGA 3HRZC 1WTQA 1VF7A 5FOBB 1TWAB 1LABA 2EY1A 4EGVA 2PZTA 3VR5A 4M8AA 1W6JA 3R2TA 1CA6A 1U4PA 4C3JG 1HCZA 4OHJA 2NVXB 3I72A 4G7HC 4TRDA 1SNDA 2Q8IB 1MI2A 4RH6A 3TP8A 1OXSC 1ONLA 3S1MB 4K5WA 3GP7A 1CHPD 1LT6D 2B2YA 1STAA 3PO2B 5A2QL 2M9VA 1SXTA 2FFKB 1SNQA 1DZ1A 3CU7A 4ZYSA 5C6AA 1QWYA 4B9WA 1EY4A 1ENAA 1GUGA 1I4XA 3RUZA 1DXMA 4RGTA 1D5MC 1LLRD 3X3MA 4ULLA 2TMPA 1KNEA 1PYWD 4YIJA 4IUQA 2O5IC 4BA1I 1TVXA 3HOWB 3R8BA 1D2BA 1BDOA 1H9JA 1I4QA 3N52A 1SYDA 3M4OB 2RDHA 4NMZA 5EBDA 3K5NA 2RDFA 1S5ED 4ABNA 1QB5D 3LX0A 3NQTA 1IYUA 4N9TA 3T53B 4TSSA 1D1KA 1WCMB 4JK1C 1EY9A 3RLFA 1STNA 5EPKA 1B3AA 4HCSA 2VNUD 1Q12A 4R9WA 1M4VA 4P2CB 5E1FA 1ZEQX 3ONAB 5I4DA 3NHHA 2O4XA 3A54A 4OO1H 2JEAI 2A5HA 1JOQA 4M1UB 3EROA 4K5VA 3A8JE 2FMCA 2JA7B 3I8ZA 4B9XA 3RZDB 5CORA 5JEAG 4C1NI 1JWUD 2B2WA 4ZAIA 1KDAA 3HP3A 1SYGA 2ZXPA 2F4IA 5C5MA 1EOTA 4DK0A 5J39A 1MSGA 1WTOA 1QG7A 3MFGA 3S14B 3D31A 3WOFA 2VB3X 1WD1A 4CJ1B 2B8FA 1ML0D 2I46A 2F0KA 2KJXA 1BBXC 4RHRA 4ZUJA 4ZUIA 2XRQD 2JA5B 1SYFA 2EOTA 3MAQA 5I9OA 4DNTB 2ZXRA 2EJGC 1EY8A 4IQZA 4U68A 1HA5A 3OWEB 4HEDA 3PUWA 5JVH3 3BVMA 3QOLA 3GTJB 5DNFA 5I6YA 1BCPB 4QCLA 5EKKA 1G2TA 3D4RA 3FMCA 1HUMA 4K5XA 1EIGA 3FRPB 1J8IA 1GUSA 2E2DC 4FF2A 4K8JA 5ISRA 3D6WA 1TY0A 1AN8A 1S5CD 1X32A 3NK9A 3PMFA 1HQMC 3URYA 2F0MA 5I2YA 4KD3A 3I4MB 4ILWA 2XNAC 5E4XA 5HGTA 1RDPD 3GTLB 5CV7A 4ZKCB 1C4QA 2YYZA 1KDCA 1KTKA 1SYCA 1PZKD 3OIQA 1EY5A 4G57A 3SE0A 3KLSX 4QMGA 1Y1VB 1JICA 3C1FA 2K03A 1WTXA 3TP7A 4J8QA 1RJTA 2LY7A 1IL8A 2BOSA 4LAAA 2RA4A 3CHBD 5JOBA 1Z6HA 5T1IA 3HGBA 3NSWA 1EWCA 2DY8A 1PRTD 2F0OA 1U4LA 4HMIA 4V190 4KK7A 1JOKA 3SK8A 1TU2B 5CGKA 4DF7A 3VYUA 1DONA 1EY6A 2WKCA 1LTRD 5K5PA 5M5WB 2X6GA 1TQOA 1G91A 4CGYB 1STHA 3OWFA 3IFTA 1D6EC 4C2MB 3DUZA 1MBYA 3K57A 5E4WC 3QG1A 1RHPA 2NBFA 5FLXL 4OO1G 2WACA 2NVQB 5KYIA 2EYHA 3SHLA 4A3JB 1U4RA 5TSSA 2D2CC 4V0BA 2K32A 4C3IG 3MEHA 1GUNA 4U673 1SDFA 3DM1A 3BG3A 1B9MA 1KABA 1SE4A 2AQ1B 1G291 1TIID 2K05A 1D1IA 2RVLA 1VDZA 4MHEA 3TN2A 5CV6A 5CBEE 5C4JB 4XQJA 3S16B 1FNWA 4H13C 5LHY1 2E76C 1QJOA 1OXXK 3RD4A 4BBSB 2B2TC 3I4NB 4UAIA 1GOZA 3BZDB 3J81L 3MHBA 2DY7A 5CV4A 4Z9CB 3HZXA 3H09A 4EQOA 3MXNA 5FKAC 2RSOA 3TZDA 1DYQA 2B2VC 1RODA 1HA6A 1ENFA 1PRTC 5FK9C 2QDBA 4WFN3 4O42A 1JORA 2K1BA 1RTNA 2F3VA 5KNCA 3A7LA 3UI2A 3M7GA 4DAPA 2WAQB 1GUOA 1ICWA 3LNNA 3GD7A 1I6VC 4LMQD 1PTOH 5EBCA 1O78A 2Z8LA 3R93A 4CKCA 1QILA 5C3EB 2XN9C 2XVSA 1O7ZA 3S9WA 1PFMA 1EIHA 3VA5A 3S1QB 4RCOA 1F9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL0 A;  5AFW A;  2X69 A;  5EJW A;  3I8Z A;  2L4N A;  2K05 A;  1HUN A;  1G2S A;  5CBA E;  3DEO A;  4MN3 A;  2L12 A;  2RVL A;  1XX8 A;  2B2Y A;  1IKL A;  3DEP A;  5COY A;  5E4X A;  3LWE A;  4MHE A;  1S4Z A;  3TN2 A;  1F9P A;  1F9Q A;  1U4M A;  1X3P A;  2M2L A;  1J9O A;  4ZKB B;  1WTP A;  4ZKC B;  5COR A;  1QE6 A;  4XT3 B;  2FFK B;  2K28 A;  2N88 A;  4QUC A;  2B2V A;  2B2W A;  4ZAI A;  5CBE E;  1DZ1 A;  2MP1 A;  2X6L A;  3HP3 A;  1B4O A;  1DOM A;  1WD0 A;  1DOK A;  1CM9 A;  3I90 A;  2Q8T A;  2RSN A;  1O7Y A;  2J7Z A;  1EOT A;  1B53 A;  1VMC A;  1JIC A;  1SAP A;  2B2T C;  2H1E A;  1HFG A;  2K03 A;  2KOL A;  2L9H A;  3FDT A;  1QNK A;  3QO2 A;  4UAI A;  1M8A A;  2HCC A;  4R8I A;  4NW2 A;  2B2U C;  1WTV A;  1BF4 A;  1MSG A;  1HHV A;  1PDQ A;  2DY7 A;  2EPB A;  1ESR A;  2CVR A;  1RJT A;  1QG7 A;  1WTO A;  1KNA A;  4ZK9 B;  2KEC A;  2KED A;  1HRJ A;  2FMM A;  5CMD A;  1IL8 A;  2SDF A;  1KNE A;  1NR4 A;  4X3S A;  1AZQ A;  2MJ8 A;  2RA4 A;  1WD1 A;  1VMP A;  2NWG A;  2Q8R E;  5T1I A;  4CJ1 B;  1MSH A;  3SVM A;  1ML0 D;  1C8C A;  2RSO A;  4IUQ A;  2R3Z A;  5EQ0 A;  4CJ0 B;  1BBX C;  3TZD A;  1TVX A;  2DY8 A;  4IUR A;  1CA5 A;  2B2V C;  3G7L A;  4IUU A;  1U4L A;  1O80 A;  1DOL A;  1ROD A;  1HFN A;  2HCI A;  1B50 A;  4RA8 A;  1HA6 A;  2MGS A;  3N52 A;  2EE1 A;  4DN4 M;  1EQT A;  4RAU C;  1B2T A;  2NYZ D;  1DON A;  1G6Z A;  1PLF A;  2EOT A;  1GUW A;  4ZLT F;  1RTO A;  2L1B A;  3GV6 A;  4IUV A;  2K04 A;  1WTR A;  1NAP A;  1PFB A;  2L11 A;  2X6G A;  3Q6S A;  4O42 A;  2MPM A;  2VXW A;  2XIW A;  1JE4 A;  5EPJ A;  4U68 A;  1SSO A;  4X3T A;  2K1B A;  2D9U A;  4HED A;  1RTN A;  5JJZ A;  3KUP A;  3UI2 A;  3GV3 A;  2N55 A;  3MWY W;  4XT1 B;  5D14 A;  2B2Y C;  1LV9 A;  2HUG A;  4HSV A;  1WTX A;  2B2T A;  1ICW A;  4X3U A;  5E4W C;  5T1G A;  4X3K A;  3KBX A;  1XYI A;  5DNF A;  1RHP A;  4LMQ D;  2JP1 A;  3IFD A;  1ZXT A;  5EPL A;  2B2U A;  2FHT A;  4OIK A;  2KUM A;  3IL8 A;  4RWS C;  2B2W C;  2FJ2 A;  1AZP A;  1WTQ A;  1G2T A;  2FIN B;  1F2L A;  3R93 A;  2KEE A;  1PFN A;  3F2U A;  2HDM A;  5EPK A;  1Q3L A;  1B3A A;  1HUM A;  3FPU B;  4HCS A;  4OIJ A;  1EIG A;  4R9W A;  1CA6 A;  1J8I A;  1WTW A;  1A15 A;  1U4R A;  1U4P A;  1X3Q A;  1WVL A;  1E0B A;  1NR2 A;  2JYO A;  4QUF A;  1IKM A;  3ONA B;  2BDN A;  2IL8 A;  2KVM A;  4XDX A;  1F9R A;  5D65 A;  1ILP A;  1O7Z A;  2K01 A;  1PFM A;  4HAE A;  4IUT A;  1NCV A;  1AP0 A;  1EIH A;  1BO0 A;  2NZ1 D;  3H91 A;  1BNZ A;  3D6W A;  2HDL A;  1ILQ A;  3P7J A;  1G91 A;  1MI2 A;  3I91 A;  4IUP A;  1SDF A;  5EKI A;  1X32 A;  3DM1 A;  3I3C A;  4CJ2 C;  1MGS A;  3MTS A;  1F9S A; 
#chains in the Genus database with same CATH topology
 2ENB A;  3NTH A;  2F3I A;  1VQD A;  2NZH A;  2NVX H;  4BY1 B;  1Q86 C;  3H15 A;  4JI5 L;  3LWE A;  4KMU C;  3HOU G;  1EEF D;  5FLX E;  3I73 A;  5FO7 B;  2AWO A;  5C3X A;  1SBB B;  3J7A V;  3RLN A;  2F0H A;  1EYC A;  4DUY Q;  3S1M H;  4BS9 A;  1K28 A;  1VQK A;  4DR1 Q;  3WOE A;  3AQQ A;  2QEX A;  1SLJ A;  3PO2 H;  4PQX A;  1IZ6 A;  1QNK A;  2A8V A;  2LFN A;  4DV6 Q;  2F1M A;  4DR4 Q;  3E9H A;  4NW2 A;  3TZU A;  2AUK A;  1L0X B;  1EFI D;  1TS4 A;  4PMW A;  5IGG A;  5IP9 G;  4IO9 A;  3OHX C;  1YJ9 A;  4KHP Q;  5C4X G;  2R7F A;  1TWF B;  3OMG A;  3CCM A;  4DGZ A;  4TKO B;  2E2I B;  4A3B G;  2SDF A;  1NR4 A;  4MIU A;  1P16 A;  1QCB D;  2KA7 A;  4B3R L;  4OO1 I;  5CV8 A;  4LFA Q;  1YNJ D;  1A3V A;  4IUU A;  1HFN A;  3FPP A;  4JI4 Q;  5FJ8 G;  4FF3 A;  4L5T A;  1CKM A;  5GAH C;  4UHV A;  4CDC C;  5KNB A;  3STB D;  3FKI B;  1QUQ B;  1SJE D;  1WTR A;  4L8J A;  3HOW H;  4LW1 A;  2CHB D;  3NPP A;  2WP8 J;  1KXL A;  3TDQ A;  4IFD J;  1NMG A;  3K59 A;  4FP5 D;  1L0Y B;  5L37 A;  3CCL A;  3M4O H;  3J81 E;  2HQL A;  4OIK A;  1SMY D;  3RN2 A;  1E22 A;  4P74 A;  2FIN B;  4DXF A;  1ASZ A;  2JSO A;  4LF6 Q;  1KLU D;  2OTJ A;  3D4W A;  4H02 A;  3TP5 A;  4G7Z C;  1D5X C;  2A19 A;  4X62 L;  1KIX A;  4GKJ L;  1Z7T A;  2Z1C A;  3P75 A;  1K8O A;  3L3O C;  3MFY A;  1VQ4 A;  2E2H B;  2NTT A;  4MZ9 A;  4N9P A;  1WCM H;  5GQO A;  4JV5 L;  5IGB A;  5ELD A;  1BXT A;  1F2Z A;  1H9S A;  2SOB A;  3I4L A;  5IOC A;  1K0R A;  5I9P A;  1TY2 A;  2OT2 A;  2F0P A;  3PUX A;  3GTO B;  4CHT B;  2E5L L;  2I5M X;  1YI2 A;  4JI3 Q;  2L12 A;  2EYJ A;  5DLQ E;  4DK6 C;  3A8I E;  1VQI A;  3NEN A;  4JI7 L;  1EYA A;  4GN5 A;  2F0S A;  1LT5 D;  3MC0 B;  2MQH A;  1Y14 B;  2X6L A;  2JA7 H;  1GJX A;  1GHK A;  4POG A;  1E1O A;  4F88 A;  4A3C H;  4WJW A;  1H9S B;  4A3K B;  2Q2T A;  3QWN A;  2PQA A;  1HFG A;  3L0O A;  2F0N A;  1I4P A;  3T13 A;  3RZD H;  1JCK B;  3W3A A;  3R2I A;  5IP7 H;  2Y0S B;  4RGN A;  3SXH A;  2CVR A;  1K8M A;  4K2L A;  1KNA A;  1Z47 A;  5DAU A;  1ASY A;  1GVP A;  4X65 Q;  1DGS A;  3I70 A;  3AFP A;  1JJ2 A;  1SE3 A;  1OXU A;  2OF1 A;  5EQ0 A;  5ELB A;  4GOP A;  2B8G A;  1A2T A;  3DHQ A;  3JAM L;  2C5C A;  4N8X 1;  1DOL A;  4JI8 L;  3S14 H;  1YNJ C;  3NTK A;  3BS1 A;  1A6X A;  1TXY A;  1PLF A;  2F0U A;  4CBV A;  3UDX A;  5IYD H;  3OTO Q;  1AEX A;  1RTO A;  2PO4 A;  3PUZ A;  3STB C;  4DUZ L;  4HIM A;  1RCV D;  2IWH A;  3FVQ A;  3OW7 A;  5LL6 X;  1HPC A;  5IGE A;  4GLX A;  2A6H D;  3GV3 A;  2BA1 A;  3VYS A;  3MWY W;  1Q1E A;  4C56 C;  5A35 A;  3T1H Q;  3ND8 A;  2JA5 H;  5T1G A;  1YVC A;  4ID6 A;  2CQA A;  1R9T B;  1BCP F;  1YBY A;  2NN6 I;  1IBK L;  4LWC A;  2HQE A;  4BBR B;  3W1G A;  3ZYY X;  4UY8 C;  1EU4 A;  5JPN C;  4GZY C;  2XTI A;  1SMY C;  4FYD A;  4GLV B;  3K6O A;  4NXN L;  3M3Y B;  1Q3L A;  4JI6 L;  4DR6 L;  2CFM A;  3QJY A;  1RF2 D;  4ZRZ A;  3GTJ H;  1N36 Q;  4DR3 L;  2D5D A;  2IL8 A;  3GO5 A;  4XDX A;  3BDO A;  4QIW B;  5M9O A;  2IW3 A;  3LWU A;  3J7Z C;  1AP0 A;  3C1E A;  1KAA A;  1OXT A;  1EZ6 A;  4LF8 L;  3KLS A;  4B3M L;  5LMN Q;  4JBJ A;  5CV9 A;  1RD9 D;  4DK3 C;  4DV2 Q;  4L5S A;  1MD2 D;  3GTQ B;  4FO2 A;  4LFB L;  3TRE A;  1EL0 A;  2L5T A;  5EJW A;  3PO2 G;  3PSI A;  3DWA A;  2NUC A;  1C0A A;  2N3S A;  2EYL A;  4IFD H;  1F9P A;  4ZKB B;  4TQU S;  4DAM A;  1K0S A;  3KDF B;  2SEB D;  4Q0F A;  4KKU A;  5DM7 3;  1I94 Q;  1XTC D;  5HGQ A;  1HR0 Q;  1AW7 A;  1DOM A;  2KCN A;  1NE3 A;  3OYY A;  3I4M H;  1CT1 D;  3I4O A;  4DPG A;  1Y8N B;  1STG A;  2L9H A;  2UXB L;  3BDL A;  3GTL H;  3MXP A;  1KDB A;  2AHO B;  3QOJ A;  1ESR A;  1S5B D;  3TP6 A;  4A3G G;  2VW9 A;  3GTM B;  1YHQ A;  3TSS A;  2R61 A;  3MEF A;  4E6I A;  3O13 A;  5K36 G;  1Y1V H;  1JB7 A;  5HY6 A;  1VMP A;  1NNX A;  2F0G A;  1C8C A;  2F0Q A;  2IX1 A;  2B29 A;  2KHS A;  1TWC B;  1LYL A;  1Q1B A;  4S3S A;  4IUR A;  2F03 A;  2PQA B;  1CQF A;  1HNW L;  5C4H A;  1SNM A;  2MGS A;  1JWS D;  1F77 A;  3AEV A;  1EQT A;  2CWA A;  4NXM Q;  2QF7 A;  3H6M A;  1EEI D;  1BR9 A;  1EYD A;  4K6D A;  1A63 A;  1GUW A;  1N8R C;  2K50 A;  2L1B A;  3DXJ C;  1EY0 A;  1UE6 A;  4G7O C;  2WAQ E;  2I07 B;  5C0X I;  5IGD A;  1VQF A;  3EJI A;  1SSO A;  4LJZ C;  4X3T A;  1T5X D;  5JJZ A;  3PIP 3;  2IT1 A;  4X66 L;  2PW7 A;  2A6H C;  1JR0 D;  2AKW B;  3P20 A;  1WCM G;  5EPL A;  1ICF B;  1II3 A;  2KUM A;  1VQA A;  5M5W H;  4IN3 A;  2ZM6 Q;  5A2Q E;  4C2M H;  3VR3 A;  5I6W A;  2HDM A;  1AH9 A;  5IE8 A;  2N8N A;  2JA8 B;  5ELF A;  5AJ3 L;  4AYB B;  3AMU A;  4XXE A;  3IAY A;  1X3Q A;  3C2P A;  3JAM E;  1B9N A;  2EY2 A;  2WB1 B;  2KVM A;  4GNX A;  3OW2 A;  2NVQ H;  2EDG A;  1AFP A;  4R4O A;  1CHQ D;  1BOS A;  3BJU A;  1XNR L;  1ILQ A;  5C0X J;  2E74 C;  5EKI A;  3I3C A;  3ZJY C;  4A3J H;  1PZI D;  2E2J B;  4JW0 A;  3HS0 C;  3K8A A;  4H44 C;  1X54 A;  2L4N A;  3MVV A;  3NP8 A;  1G51 A;  3TS2 A;  1C48 A;  1IKL A;  5COY A;  5IP7 G;  3J80 L;  5CC4 A;  2JXM B;  1XPR A;  5ELO A;  2ID0 A;  1M90 C;  2K28 A;  3KF8 A;  4LF4 Q;  3U9O A;  1B70 B;  4YHH L;  3NEM A;  5D3I B;  2KQ3 A;  2RSN A;  4HR7 B;  5KGU A;  1YNX A;  4PG3 A;  2A69 D;  4XQN A;  2K4K A;  3EN2 A;  4CKE A;  1PDQ A;  3PIO A;  2EPB A;  5C4J H;  5IYD G;  3S16 H;  1SRO A;  1TS2 A;  1HRJ A;  3QIA A;  3E9I A;  4BXX G;  5HUR A;  4BBS H;  2I0Q A;  3I4N H;  1QVC A;  1VQM A;  2ZTD A;  3ERQ A;  1VQE A;  2JA5 G;  3GTG B;  2R7Z B;  4A3I G;  2NN6 H;  4A3F B;  1S72 A;  1B50 A;  2K14 A;  1KD1 C;  2Z6B A;  2NYZ D;  3F2C A;  4DUY L;  3GDE A;  4HJ7 A;  3LGJ A;  4PV1 C;  3SEB A;  5BR8 Q;  2I5H A;  4DR1 L;  3SK6 A;  1PFB A;  2E8G A;  2K52 A;  2H4O A;  2M00 A;  2MPM A;  3G71 A;  2D9U A;  2EY6 A;  5ELN A;  1LV9 A;  1YNN D;  2CKZ B;  4HSV A;  2B2T A;  4DV6 L;  4C3I B;  4DR4 L;  4OX9 L;  1IBL Q;  4X3K A;  3GTK B;  1SYE A;  4QF4 A;  1K83 B;  1GXD C;  4KHP L;  1D5Z C;  1N33 Q;  2JA9 A;  2PNR C;  4PZ6 A;  3FP9 A;  4YCW A;  2DUD A;  2KEE A;  2ICE C;  4YCU A;  1Q81 C;  3H0G B;  3NBH A;  3NQI A;  3SK5 A;  2JYO A;  4LFA L;  2G9H D;  3L7Z C;  2Q2H A;  4WOR A;  4KY5 A;  4AQY Q;  4JI4 L;  1F9R A;  3K5L A;  4HSP A;  3UDI A;  4IUT A;  2K01 A;  4DNR B;  2NVY B;  2KHJ A;  2N49 A;  2ZT9 C;  2EYM A;  4IPD A;  4O2D A;  4L6T B;  2CW0 D;  3P7J A;  4IUP A;  2ICI A;  5C3E H;  3CCR A;  2K5W A;  4L63 B;  2DNE A;  3I4M G;  1UNS A;  4DR5 Q;  2RQX A;  3DWP A;  3S2D B;  1MIU A;  4A3D B;  3VR4 A;  3T56 B;  4B08 A;  5BN3 A;  4GKK Q;  1HTP A;  3HEJ A;  3NBI A;  3C3L A;  3NE5 B;  2OWO A;  4GNX B;  3S1Q H;  1PXU A;  1U5K A;  2F52 A;  1QE6 A;  3RMH A;  4I7Z C;  2MUY A;  4LF6 L;  1Y1V G;  3PV0 A;  1VCI A;  4NP5 A;  1VQG A;  4FXG C;  4BY1 H;  2V4D A;  3HKS A;  2K5Q A;  1B53 A;  3BVZ A;  1LTG D;  3CRK C;  2Y0S E;  3EA6 A;  4AH6 A;  4KY7 A;  1NTG A;  2EY5 A;  2AQ2 B;  1EYG A;  3A0J A;  1BF4 A;  2A69 C;  4BA2 I;  1X3E A;  3ND9 A;  2FMM A;  3KF8 B;  4R4I A;  5C0X H;  5J3B A;  1WJJ A;  3E0J A;  4UP8 A;  1X55 A;  1H9K A;  3SVM A;  2ZXO A;  5CYU A;  3Q22 A;  4JI3 L;  2LKV A;  3HG9 A;  1S40 A;  4XIG S;  5IYC H;  3J80 E;  4RG1 A;  1TWF H;  2E2I H;  1Q90 A;  4N8F A;  4X6A H;  1B2T A;  1UE7 A;  2A74 C;  4ZLT F;  1CKO A;  2JA6 B;  4LUV A;  3D0F A;  1A0I A;  4DKA C;  3E6Z X;  4C3H B;  1OTC A;  5M3M B;  1EIY B;  5IIF A;  1L0W A;  4GN4 B;  3HOX B;  1WOC A;  2YTX A;  1F2Y A;  4G4K A;  4EVO A;  1J5E Q;  4FF1 A;  4FF4 A;  1YNN C;  2F0L A;  3FKI H;  3IFD A;  3KJO A;  2SNS A;  4OL7 A;  4X65 L;  4KTA A;  1A3U A;  4A3J G;  1SNC A;  3PO3 B;  4IUN A;  1QZH A;  2EZV A;  1PTO F;  3CC7 A;  2UUA Q;  3VR6 A;  3KK7 A;  2RHS B;  4QIW E;  1WTW A;  2VUM B;  1Q8K A;  1PTO D;  2C35 B;  1ILP A;  5D65 A;  1TS5 A;  4A93 G;  2WFW A;  2NZ1 D;  4QY7 A;  3H91 A;  1PH8 A;  3OTO L;  1K9M C;  4NPS A;  2PMZ B;  2CW0 C;  2GA4 B;  3H3V C;  1NBW A;  4DV4 Q;  1FNV A;  5AFW A;  4DAY B;  3EQL C;  4YHH Q;  5C44 H;  2EJF C;  3T1H L;  4P75 A;  1EQQ A;  4Q5V A;  2E2H H;  2E75 C;  2A73 B;  4EQP A;  1KRT A;  1K8G A;  1J6Q A;  4KKS A;  3CPF A;  4OWX B;  4JBM A;  1PRT B;  3EFX D;  3OSO A;  3KBG A;  3AYH B;  3I4N G;  4OWW B;  3GTO H;  1SJH D;  3PGZ A;  2YU9 B;  4K6L A;  1EIF A;  1N36 L;  4F8M A;  1K8A C;  2YTY A;  2NN6 G;  3VDY A;  1E2Z A;  4JPB W;  2A6E D;  2B2U C;  2EIF A;  1WTV A;  4A3M B;  2GVA A;  4WJ3 M;  5LMN L;  4QJF A;  4DV2 L;  3KLW A;  5NUC A;  2F0E A;  4A3K H;  1VQ9 A;  4DV0 Q;  2B63 B;  3BZC A;  4NDX A;  4IZ8 A;  5H1S E;  3G7L A;  1VQB A;  2VB2 X;  1XXG A;  4HN7 A;  5CV5 A;  1I94 L;  1E1T A;  1HR0 L;  4OX9 Q;  4ODG A;  3HOZ B;  2LXJ A;  4IFD I;  1U0L A;  2BDO A;  2WAQ G;  3HOY B;  1JWM D;  3K58 A;  1QOH A;  2OXP A;  1FGU A;  4B3T Q;  3CME A;  2JQO A;  5LL6 S;  2D62 A;  2JP1 A;  3CP0 A;  3I56 A;  1CSQ A;  5IY0 A;  2OQ0 A;  2PNH A;  2PW5 A;  1F2L A;  1GM5 A;  1UAP A;  4AYB E;  1CFM A;  1SE8 A;  2OQK A;  2WB1 E;  3A56 A;  5LMN W;  1WVL A;  1R9T H;  1FNU A;  3DMU A;  1IKM A;  4FXD A;  1JJG A;  2RCF A;  1HNZ Q;  4BBR H;  2KCM A;  5F2D A;  4K2K A;  4C3J B;  2VQF Q;  1PTO C;  4NXM L;  2R92 B;  3PUY A;  1LT3 D;  2IJ0 A;  5M3F B;  3M3Y H;  4OON A;  1EQV A;  3G6J B;  3T51 B;  3MA2 B;  4BY1 G;  2F0J A;  1HR0 W;  2Z0S A;  2K5H A;  3I7F A;  4QB4 A;  4LF5 Q;  2ZTC A;  1PVO A;  1EOV A;  4DAV A;  3A55 A;  1I4G A;  2EYP A;  1J9O A;  4A3L G;  2F0D A;  4XT3 B;  3GTQ H;  2ZM6 L;  5C44 B;  5C0X G;  2KCC A;  2MP1 A;  5EKL A;  5M5Y B;  3KDF A;  3U4Z A;  1S5D D;  1STY A;  2ES2 A;  2HIV A;  2J7Z A;  4L5R C;  1P8L A;  1TR5 A;  3K7U C;  3WDN A;  3QO2 A;  3GQB A;  2BCO A;  3KLR A;  5IYC G;  4R8I A;  1AE2 A;  3E5S A;  3CCQ A;  3A8K E;  1GKH A;  1ZKO A;  1LTB D;  1NMF A;  2A6E C;  1HZC A;  4KLK A;  3S24 A;  5IT9 L;  2KEC A;  1CSP A;  1E24 A;  3KYH C;  1A3T A;  3NWS A;  1N9W A;  4H0L C;  5CR3 A;  3NWT A;  1E2W A;  3FKI G;  2MFI A;  3CQZ B;  1SEB D;  1LTI D;  3GTM H;  4DK1 A;  3QR8 A;  4RAU C;  4LF4 L;  1Y8O B;  1VQL A;  1TT2 A;  1B44 D;  4KJN A;  1TWC H;  5EPJ A;  2XIW A;  1V1P A;  1V1Q A;  2OCE A;  1S5F D;  3AB9 A;  2R7D A;  1OO9 B;  3HOV G;  1B1Z A;  4KI0 A;  1STE A;  3PUV A;  3M85 A;  4RGM A;  1LTL A;  2PYK A;  2LMC B;  4H7B A;  4DV1 Q;  4K0K Q;  1OXV A;  3L9A X;  4IJL A;  2V1C C;  1W2B A;  3D8G A;  5JPM C;  5DEH A;  4XYQ A;  1B7Y B;  3FPU B;  2ZJR A;  1XMQ Q;  5FLM H;  4KN4 C;  5JJI A;  4FXK C;  3M7N A;  1NCV A;  1BO0 A;  2IHE A;  1PH6 A;  3VYT A;  1EZ8 A;  2L15 A;  4RKB A;  1LAC A;  1SE2 A;  1Y1W B;  3I91 A;  2JN4 A;  5BR8 L;  4KKT A;  1Y8P B;  1L1O C;  2JA8 H;  1ZYR D;  3KFU A;  2JE6 I;  5D3D A;  4WRD A;  5EAY A;  5JAV A;  3NTI A;  2TSS A;  2F0V A;  1BCP D;  4I65 A;  5G3L F;  5E3F A;  1QZG A;  2RCN A;  1W6K A;  3K81 C;  5CBA E;  2UXC Q;  1IBL L;  1BBU A;  1S4Z A;  1X3P A;  1WTP A;  1N33 L;  3KF6 A;  5G3L D;  2MO0 A;  3CAM A;  4A3G B;  4DFA A;  1PH2 A;  3RZO B;  1FD7 D;  1HTL D;  2E2J H;  1ET6 A;  3FEW X;  4ALP A;  1V8Q A;  1CM9 A;  1JC7 A;  2Q8T A;  4YWM A;  1O7Y A;  4CDF C;  1ET9 A;  1VMC A;  2H1E A;  4AQY L;  4LNQ A;  2XGT A;  2QKI C;  3K7A B;  2F0W A;  1HZA A;  1I4H A;  1XPU A;  3SDZ A;  1V43 A;  2QGQ A;  4DR5 L;  2CWP A;  3UDG A;  1FGB D;  4GKK L;  3A7A B;  4IJH A;  1L2F A;  2R6G A;  4X64 Q;  5BN4 A;  4BY7 B;  3BU2 A;  2EE1 A;  3NUC A;  3G4S A;  4JG2 A;  2MNA A;  4XTC S;  2Q2U A;  3EVQ A;  3GV6 A;  2OEO A;  5J1Z A;  3UDF A;  1WYD A;  5C3W A;  3K5M A;  1VQH A;  1IBM Q;  2L11 A;  2R7Z H;  3GTG H;  3RR5 A;  1E7Z A;  4A3F H;  2B2Y C;  2LXK A;  3HOW G;  4J6H A;  5FO9 B;  4DV5 Q;  1VQ6 A;  4A3E B;  1NUC A;  4R8N A;  1X3G A;  5IT9 E;  4RWS C;  1XNQ L;  2IPK D;  3DWQ A;  3TRZ A;  1I50 B;  3RN5 A;  1IYV A;  3MXU A;  3EBE A;  1PH1 A;  4ME5 A;  4JCV E;  3T1Y Q;  3Q0A A;  4C3I H;  1V1P B;  3GTK H;  2Z4H A;  1NR2 A;  2VQE Q;  3BDC A;  1K83 H;  2AWN A;  2L0C A;  4QUF A;  3J81 j;  1IHZ A;  4GS3 A;  1CZW A;  2PMZ E;  3BYT B;  3D6C A;  3N6R A;  1PYB A;  4QL5 A;  3U9S A;  1FL0 A;  2HDL A;  5FLX c;  5BN5 A;  2R93 B;  4CJ2 C;  3MTS A;  3H0G H;  1EWH A;  3HFZ B;  1ZYR C;  4JI0 Q;  1KRS A;  2UUC Q;  3OIP A;  2PQE A;  2B39 A;  1TS3 A;  3IKJ A;  1KC8 C;  3GTP B;  2XWB B;  3DEO A;  4MN3 A;  1BCP C;  2NVY H;  1XX8 A;  1J5E L;  5LMU Q;  4GN3 B;  4LK1 C;  2K6A A;  3A5Z B;  1H95 A;  2XSC A;  2N88 A;  4QUC A;  1HQR D;  1JB3 A;  5KRU A;  2WV6 D;  3S2D H;  2EQS A;  1B4O A;  2BE5 D;  4CKB A;  2PCF B;  4A3D H;  3ITP A;  2ATW A;  2UUA L;  4J1M A;  2JA7 G;  3W1B A;  2KOL A;  1E2V A;  4A3C G;  2F3W A;  2NTS A;  4A3I B;  2HCC A;  4K8I A;  3KJP A;  1M1K C;  1SYB A;  1O7L A;  3C46 A;  3KF6 B;  2CH4 W;  2BH8 A;  1VQ7 A;  1AZQ A;  2JJQ A;  1KAW A;  3D3R A;  4DV4 L;  3CF5 A;  2NWG A;  2DJF C;  4LF7 Q;  2R3Z A;  4PNY A;  2BH2 A;  3BYY B;  2K33 A;  1O80 A;  4RGO S;  1BQQ T;  3U58 A;  1G8Z D;  4DN4 M;  1KHI A;  3J81 c;  1G6Z A;  4JBK A;  1D8L A;  4B3S Q;  2RBM A;  5KYL A;  2K04 A;  4KHV A;  4KHZ A;  1N34 Q;  1NAP A;  1Y69 U;  1LTA D;  3Q6S A;  1NSN S;  2VXW A;  1JE4 A;  4GLA C;  4HMJ A;  4HTH A;  5FLM G;  2O2L D;  4F87 A;  3OMC A;  1I4R A;  1TWG B;  3K0X A;  1ZXT A;  2JA6 H;  4JI1 L;  5M5X B;  1H9M A;  2B2W C;  4C3H H;  5M3M H;  3MXG A;  1JOO A;  1PFS A;  3X3N A;  4AYB G;  4C1N K;  2JA8 G;  1RIP A;  2EJM A;  2K5V A;  4DV0 L;  3HOX H;  2WB1 G;  1A15 A;  4PMB A;  2AQ3 B;  2BDN A;  2JEB I;  4DV7 L;  1PV4 A;  1EU3 A;  3S17 B;  3PO3 H;  2VY3 A;  2QEJ C;  1MGS A;  1I3Q B;  3P1H A;  2RDG A;  4NB3 A;  2VUM H;  1YHB A;  1HUN A;  1G2S A;  1Z9F A;  2IX0 A;  4DAY A;  4B3T L;  5KND A;  1DD2 A;  1FR3 A;  3HKZ B;  2PZW A;  2XWJ B;  2M2L A;  1SMX A;  1HJP A;  4OXP A;  1A2U A;  1PRT F;  4IFD G;  2B2V A;  2A68 D;  5C4Z A;  2Z4I A;  1WD0 A;  2BE5 C;  1TWH B;  4RMF A;  5IGC A;  3CD6 A;  3ICE A;  1HNZ L;  5IP9 H;  3J7Y W;  3CKI B;  2VQF L;  1DM0 B;  2EVB A;  1PZJ D;  4P73 A;  2KED A;  5J22 A;  1K3R A;  3M9B A;  5CMD A;  2J0T D;  2DN8 A;  2YU9 H;  3VA7 A;  2R7Z G;  1ENC A;  4R4C A;  3TME A;  1MSH A;  1D7Q A;  1GHJ A;  4A3F G;  3QB3 A;  4CJ0 B;  4LF5 L;  5ELE A;  4KN7 C;  1CA5 A;  5IOD A;  2SNM A;  1HXY D;  4A3M H;  2F0T A;  1VQJ A;  4POF A;  4RA8 A;  3J81 i;  3F8T A;  3H3V H;  2AUJ D;  4UDU C;  2UXD Q;  1B3Q A;  1PMR A;  2EYF A;  3T16 A;  2B63 H;  4IAL A;  4IOA A;  2L55 A;  1XNQ Q;  4JBW A;  1XWE A;  3VR2 A;  2N55 A;  4XT1 B;  5D14 A;  4X3U A;  1DJR D;  1YIJ A;  2ZJP A;  2WIN B;  4A93 B;  2H5X A;  1PH4 A;  3HOZ H;  1XTD A;  2B2U A;  4DR2 Q;  2PZU A;  5KIX A;  5EGT A;  1GD7 A;  1AZP A;  1VF5 C;  1SR3 A;  1EFW A;  1FJG Q;  2XRS D;  3H0G G;  2RKS A;  3HOY H;  3F2U A;  2DNC A;  5JVG 3;  1H9R A;  1X3F A;  1BUV T;  3J7A F;  3VYR A;  2F0I A;  1IW7 D;  2EYO A;  3PF4 A;  4HAE A;  2C9O A;  3R3O A;  5JEA J;  1X6O A;  1JE5 A;  4J15 A;  4RKL A;  4A3D G;  4XQQ A;  2QIL A;  3CRL C;  1SNO A;  1STB A;  2QCP X;  4RFB A;  1R4P B;  3ULJ A;  3DLL A;  2MHV A;  3CC4 A;  4C3J H;  2GN5 A;  3KOJ A;  2R92 H;  3DEP A;  4XYO A;  2PPB C;  1E3P A;  5M3F H;  1F9Q A;  4DV1 L;  3K5O A;  4K0K L;  4DXG A;  3S1N B;  3M4Y A;  5DM6 3;  3FHW A;  4EQN A;  3HOU B;  3H94 A;  1Q8I A;  2ALY B;  4JI2 Q;  1DOK A;  1HNX Q;  2A68 C;  2NVT B;  3A74 A;  1XMQ L;  3PIP A;  4CDE C;  5IGF A;  1SFO B;  2J4X A;  3K80 C;  1NY4 A;  2UU9 L;  1M8A A;  3NEL A;  5GAD C;  3Q24 A;  4DR7 Q;  3S15 B;  4RCN A;  4DA2 A;  4KV6 A;  3K0Y A;  4IOC A;  4A4I A;  4RHS A;  1DCZ A;  5M5Y H;  2WII B;  4X3S A;  2G9D A;  5ELC A;  2IX3 A;  5C4X B;  2Q8R E;  4A3B B;  4BBS G;  2UXC L;  1CKN B;  3SK4 A;  1FYC A;  4P72 A;  1SNP A;  3E3X A;  4YY3 Q;  2JA6 G;  1PHJ A;  1ESF A;  3AU7 A;  4C3H G;  1LT4 D;  3W2D A;  3V96 A;  3CW2 C;  2KHI A;  4JI1 Q;  1KLG D;  1SN8 A;  3HOX G;  1V1O A;  3G6E A;  4LFC Q;  1IXR A;  1RL2 A;  3CQZ H;  4KJO A;  1QNU A;  2HUG A;  4DU9 A;  4KY6 A;  1GUT A;  1VQN A;  4OGQ C;  3JAM c;  1PH5 A;  3BZK A;  4K14 A;  3PO3 G;  3IL8 A;  1G6P A;  2FJ2 A;  4QGU A;  1FVI A;  4DV7 Q;  1JQY D;  1PFN A;  4OIJ A;  2VUM G;  3ERS X;  4PMC A;  3V2T A;  3T4A C;  2O5J C;  3SR1 A;  1E0B A;  4X64 L;  4NKL A;  4YWL A;  1IW7 C;  2KBN A;  1YJN A;  1RKN A;  4O1N A;  3Q23 A;  1LTS D;  1MKH A;  1UEA B;  1BNZ A;  1X56 A;  5C5L A;  3V05 A;  3D4D A;  4FNF A;  4ZQ3 A;  2Z6K C;  2K5D A;  1IBM L;  1YJW A;  5C3E G;  5I2X A;  2X69 A;  4Y52 H;  1TKW B;  1CI3 M;  1U9R A;  2WKD A;  2EXZ A;  4DV5 L;  1EY7 A;  1U4M A;  3OPO A;  4FDB A;  4FVM A;  1EQR A;  1Y1W H;  1F2M A;  1WFQ A;  1IYJ B;  4JOI C;  3SGI A;  4IPG A;  1CTM A;  2JK8 A;  2K7V A;  3BVG A;  3I90 A;  4APV A;  5IWA Q;  3T1Y L;  1CK1 A;  1HH2 P;  4MNO A;  2VQE L;  1R4Q B;  1LTT D;  1SAP A;  3FDT A;  4YCV A;  4A3M G;  4A3G H;  3RZO H;  1HHV A;  1LO5 D;  4ZK9 B;  5K36 H;  2NB0 A;  1S3O A;  5JEA H;  1T5E A;  2B63 G;  5KEE A;  3MXN B;  3RLO A;  2ZJQ A;  2MJ8 A;  1Q82 C;  1L1O A;  4QQB X;  4JI0 L;  4F7X A;  2UUC L;  3OOC A;  3TBI B;  4OWT B;  3CMA A;  5JJL A;  3K7A H;  2PI2 E;  3HOV B;  2LS0 1;  5LMU L;  2HCI A;  4L5Q A;  1XMO Q;  3HOZ G;  3S1R B;  1CQV A;  1UUP A;  3S2H B;  1I6H B;  1Q46 A;  1PTO B;  4A75 A;  4IUV A;  3HOY G;  2BA0 A;  3MZ5 A;  5FO8 B;  4BWG B;  2F4V Q;  4PZ7 A;  4HJ5 A;  4BY7 H;  3KUP A;  4HJA A;  2UUB Q;  2I5L X;  4HCE A;  3ER0 A;  1WI5 A;  3JAM i;  4Y7N B;  4A76 A;  3KBX A;  1XYI A;  1AE3 A;  3NXW A;  5IYB H;  2F0F A;  2FHT A;  4KD4 A;  3PIO 3;  1CZG A;  3DM3 A;  3HRZ C;  1WTQ A;  1VF7 A;  3U4V A;  5FOB B;  1TWA B;  1LAB A;  2EY1 A;  4EGV A;  2PZT A;  4LF7 L;  2FXQ A;  4M8A A;  3VR5 A;  1W6J A;  3R2T A;  1CA6 A;  1U4P A;  4A3E H;  4C3J G;  2R92 G;  1HCZ A;  4OHJ A;  5M3F G;  2VZA A;  1VS0 A;  1W3S A;  2NVX B;  1I50 H;  4DV3 Q;  3I72 A;  4AIM A;  3M4Q A;  4TRD A;  4G7H C;  1SND A;  4B3S L;  2Q8I B;  1MI2 A;  1O7I A;  1N34 L;  4RH6 A;  4MTK A;  3TP8 A;  1OXS C;  1PYS B;  1ONL A;  3S1M B;  3HKZ E;  4K5W A;  3GP7 A;  1CHP D;  2RHQ B;  1HZ9 A;  1LT6 D;  2B2Y A;  3JC6 6;  5C44 G;  3F2B A;  1STA A;  3PO2 B;  3UE1 A;  5A2Q L;  2M9V A;  3I55 A;  4LF9 L;  1SXT A;  2R93 H;  1QVG A;  2UU9 Q;  1PH9 A;  2FFK B;  1SNQ A;  1DZ1 A;  3CU7 A;  4ZYS A;  1B8A A;  5C6A A;  1QWY A;  4B9W A;  1EY4 A;  1ENA A;  3GTP H;  1GUG A;  1I4X A;  4HJ8 A;  3RUZ A;  1DXM A;  1JT8 A;  4O0A A;  3I2Z A;  4RGT A;  1D5M C;  1LLR D;  3X3M A;  4HJ9 A;  4ULL A;  1VQ8 A;  4BXX H;  3CCE A;  3J80 c;  2Q2I A;  2TMP A;  1KNE A;  3L2P A;  3CXC A;  4PZ8 A;  1PYW D;  4A3I H;  4YIJ A;  1C9O A;  1VQP A;  4IUQ A;  2O5I C;  4A3K G;  2HD3 A;  4BA1 I;  1TVX A;  3HOW B;  1EWI A;  3R8B A;  1K3B C;  1D2B A;  5JJK A;  1N32 Q;  3F2D A;  1BDO A;  1H9J A;  1I4Q A;  3N52 A;  2CCZ A;  2Y0S G;  1SYD A;  4OEL B;  3M4O B;  2HT1 A;  2RDH A;  1T9H A;  2NZO A;  4NMZ A;  2PI2 A;  5EBD A;  4IPC A;  1UE1 A;  3K5N A;  2RDF A;  1S5E D;  1L1O B;  4ABN A;  1QB5 D;  3LX0 A;  3NQT A;  1IYU A;  4JI5 Q;  4N9T A;  4UPA A;  3T53 B;  4TSS A;  1X9N A;  1D1K A;  1WCM B;  4JK1 C;  1EY9 A;  3RLF A;  1STN A;  5EPK A;  1B3A A;  4HCS A;  2VNU D;  1Q12 A;  1TWG H;  4R9W A;  4I7A A;  1M4V A;  4P2C B;  5E1F A;  1ZEQ X;  3ONA B;  5M5X H;  5I4D A;  2K5N A;  1Y1W G;  4CDD C;  3NHH A;  4HIO A;  2O4X A;  3A54 A;  2UXD L;  4UP9 A;  4BBR G;  4OO1 H;  2JEA I;  2A5H A;  1JOQ A;  4M1U B;  2D0P A;  2KEN A;  1UWV A;  3ERO A;  4K5V A;  3A8J E;  4R4T A;  3H3V I;  2FMC A;  2VS1 A;  2ZTE A;  4GOP C;  1LUZ A;  2VL6 A;  2JA7 B;  3I8Z A;  4B3R Q;  1MJC A;  5E7N A;  3S17 H;  4B9X A;  4DR2 L;  3RZD B;  4EQ5 A;  5COR A;  5JEA G;  2HHH L;  1FJG L;  4C1N I;  1I3Q H;  1JWU D;  2B2W A;  4ZAI A;  1PH3 A;  1MHW C;  1KDA A;  3HP3 A;  1SYG A;  3TQY A;  2ZXP A;  1NJI C;  2F4I A;  5C5M A;  2D0O A;  1KQS A;  1EOT A;  1VQO A;  3PQI A;  4DK0 A;  2AMC B;  1QVF A;  3J80 i;  5J39 A;  1MSG A;  1A62 A;  5GAG C;  1WTO A;  1QG7 A;  3MFG A;  5GAE C;  3S14 B;  3D31 A;  2HIX A;  1TWH H;  4R4Q A;  3WOF A;  2VB3 X;  1WD1 A;  4GOP B;  4CJ1 B;  2B8F A;  4BY7 G;  1ML0 D;  2I46 A;  3UE0 A;  2F0K A;  4X62 Q;  2KJX A;  1BBX C;  4GKJ Q;  3W5O A;  1VQC A;  4RHR A;  4ZUJ A;  4ZUI A;  2LSS A;  2XRQ D;  5IYB G;  2JA5 B;  1SYF A;  1X65 A;  2EOT A;  3MAQ A;  4JV5 Q;  5I9O A;  4DNI A;  1IL2 A;  3TEH B;  4JI2 L;  4DNT B;  1HNX L;  2ZXR A;  1BKB A;  2EJG C;  2G5D A;  1EY8 A;  4IQZ A;  4U68 A;  1HA5 A;  3OWE B;  4HED A;  3PUW A;  4A3E G;  5JVH 3;  2E5L Q;  3BVM A;  4DR7 L;  2K75 A;  4UP7 A;  3ULL A;  3QOL A;  3GTJ B;  1UEB A;  4LUZ A;  5DNF A;  5I6Y A;  1BCP B;  2QDL A;  4JI7 Q;  4QCL A;  5EKK A;  2EXD A;  1G2T A;  3D4R A;  3FMC A;  1HUM A;  4K5X A;  1EIG A;  3FRP B;  4JYA L;  1J8I A;  1GUS A;  4LUO A;  4P71 A;  2E2D C;  4FF2 A;  4A93 H;  4K8J A;  4YY3 L;  4TVA B;  3F1Z A;  2R93 G;  5ISR A;  3D6W A;  2OTL A;  1TY0 A;  1AN8 A;  3G48 A;  3CCJ A;  1S5C D;  1X32 A;  3NK9 A;  3PMF A;  4LF9 Q;  1HQM C;  3URY A;  4LFC L;  2F0M A;  5I2Y A;  3EIV A;  4KD3 A;  5GRO A;  3I4M B;  4ILW A;  2XNA C;  2KCT A;  5E4X A;  4JI8 Q;  1BBW A;  5HGT A;  1RDP D;  3GTL B;  5CV7 A;  4ZKC B;  1C4Q A;  2YYZ A;  1KDC A;  1KTK A;  4DUZ Q;  1SYC A;  1PZK D;  3OIQ A;  1EY5 A;  4G57 A;  1HZB A;  3SE0 A;  4IPH A;  3C1F A;  3KLS X;  1Y1V B;  1JIC A;  4QMG A;  4HID A;  2K03 A;  1WTX A;  1YIT A;  3TP7 A;  3U50 C;  3S1N H;  3CPW A;  3HOU H;  3AFQ A;  4J8Q A;  1RJT A;  1IBK Q;  4R1J A;  2LY7 A;  1IL8 A;  2NVT H;  2BOS A;  1PH7 A;  4LAA A;  4NXN Q;  2RA4 A;  3CHB D;  4ME3 A;  1SFO H;  2DJG C;  5JOB A;  1Z6H A;  4JC0 A;  5T1I A;  4JI6 Q;  3HGB A;  4DR6 Q;  1JJC B;  3S15 H;  3NSW A;  1EWC A;  2DY8 A;  4GNX C;  1XPO A;  1PRT D;  2F0O A;  4DR3 Q;  1U4L A;  4HMI A;  4V19 0;  4KK7 A;  1JOK A;  3SK8 A;  1TU2 B;  5CGK A;  1CKN A;  4DF7 A;  3WWV A;  3VYU A;  1K73 C;  1DON A;  1EY6 A;  1EUJ A;  2WKC A;  5C4X H;  1LTR D;  4LF8 Q;  5K5P A;  4B3M Q;  4A3B H;  5M5W B;  2CQO A;  5IWA L;  2X6G A;  1TQO A;  1XJV A;  1G91 A;  4CGY B;  4LFB Q;  1STH A;  3OWF A;  3IFT A;  1D6E C;  4C2M B;  3DUZ A;  1MBY A;  3K57 A;  5E4W C;  3QG1 A;  1RHP A;  2NBF A;  5FJ8 H;  1PA6 A;  2IY5 B;  5FLX L;  4OO1 G;  2WAC A;  3CCU A;  1LM0 A;  2NVQ B;  2QA4 A;  1SRU A;  5KYI A;  2DGY A;  2EYH A;  3SHL A;  4A3J B;  1JMC A;  1U4R A;  5TSS A;  3CCV A;  2D2C C;  4V0B A;  3Q8D A;  2UXB Q;  1KL9 A;  2K32 A;  4C3I G;  3MEH A;  1XMO L;  3PF5 A;  1GUN A;  1WTH A;  4U67 3;  3CC2 A;  1SDF A;  3DM1 A;  3BG3 A;  2F4V L;  4OEM B;  1B9M A;  1KAB A;  1SE4 A;  2AQ1 B;  2GVB A;  1G29 1;  2HHH Q;  3J7A 5;  1TII D;  3HKZ G;  2YTV A;  2K05 A;  1D1I A;  2UUB L;  4A3L H;  2RVL A;  1HNW Q;  1VDZ A;  4MHE A;  3B6Y A;  3TN2 A;  3CCS A;  1YEZ A;  1I5F A;  4WJ4 A;  2B3G A;  2P5Z X;  2QW7 A;  1VQ5 A;  5CV6 A;  1CUK A;  1GO3 E;  1YZ6 A;  5CBE E;  4XQJ A;  5C4J B;  3S16 B;  1FNW A;  3IRB A;  4H13 C;  5LHY 1;  2E76 C;  1QJO A;  1OXX K;  3RD4 A;  2A1A A;  4BBS B;  2B2T C;  3I4N B;  4UAI A;  1BVS A;  4X66 Q;  1GOZ A;  3BZD B;  3J81 L;  3MHB A;  2DY7 A;  5CV4 A;  2Z9H A;  4DV3 L;  1C7Y A;  1QUQ A;  4Z9C B;  3HZX A;  3H09 A;  4EQO A;  3E0E A;  2Z6K A;  3MXN A;  5FKA C;  2RSO A;  5AJ3 Q;  3TZD A;  1DYQ A;  2B2V C;  1ROD A;  1HA6 A;  1MJE A;  1ENF A;  1PRT C;  5FK9 C;  2N78 A;  2IHF A;  2QDB A;  1UE5 A;  1XNR Q;  4JOI A;  4JVZ A;  5IT9 c;  3A5U A;  4WFN 3;  4O42 A;  4EX5 A;  1V9P A;  1YHA A;  1JOR A;  2K1B A;  3HOV H;  1RTN A;  2CH4 A;  2F3V A;  3A7L A;  4YWK A;  3M7G A;  1A8V A;  3UI2 A;  4DAP A;  5KNC A;  2WAQ B;  3ULP A;  1GUO A;  3S1R H;  1ICW A;  4MTN A;  3S2H H;  2RF4 A;  3LNN A;  3GD7 A;  4ZCK A;  4JYA Q;  1I6H H;  1I6V C;  4LMQ D;  1PTO H;  2MO1 A;  5EBC A;  3TS0 A;  1O78 A;  2Z8L A;  3R93 A;  2YV5 A;  4CKC A;  1Q7Y C;  5M3M G;  3NBH B;  1QIL A;  5C3E B;  4Y7N H;  2XN9 C;  1N32 L;  2XVS A;  3M4P A;  1O7Z A;  3S9W A;  1PFM A;  1EIH A;  2ASB A;  1TWA H;  3VA5 A;  3S1Q B;  3PCO B;  3RNU A;  4RCO A;  4HIK A;  1F9S A; 
#chains in the Genus database with same CATH homology
 2ENB A;  3NTH A;  4BY1 B;  3LWE A;  4KMU C;  1EEF D;  5FLX E;  3I73 A;  5FO7 B;  2AWO A;  5C3X A;  1SBB B;  3J7A V;  2F0H A;  1EYC A;  4BS9 A;  3WOE A;  4PQX A;  1QNK A;  2LFN A;  2F1M A;  4NW2 A;  3TZU A;  2AUK A;  1L0X B;  1EFI D;  1TS4 A;  4PMW A;  5IGG A;  3OHX C;  1TWF B;  3OMG A;  4DGZ A;  4TKO B;  2E2I B;  2SDF A;  1NR4 A;  4MIU A;  1QCB D;  2KA7 A;  4OO1 I;  5CV8 A;  1YNJ D;  1A3V A;  4IUU A;  1HFN A;  3FPP A;  4FF3 A;  5KNB A;  3FKI B;  1SJE D;  1WTR A;  4L8J A;  2CHB D;  3NPP A;  2WP8 J;  3TDQ A;  4IFD J;  3K59 A;  4FP5 D;  1L0Y B;  3J81 E;  4OIK A;  1SMY D;  2FIN B;  4DXF A;  2JSO A;  1KLU D;  3D4W A;  3TP5 A;  4G7Z C;  1D5X C;  1Z7T A;  2Z1C A;  3P75 A;  1K8O A;  3L3O C;  3MFY A;  2E2H B;  2NTT A;  4N9P A;  5IGB A;  5ELD A;  1BXT A;  1F2Z A;  1H9S A;  2SOB A;  3I4L A;  5IOC A;  5I9P A;  1TY2 A;  2OT2 A;  2F0P A;  3PUX A;  3GTO B;  4CHT B;  2L12 A;  2EYJ A;  3A8I E;  1EYA A;  2F0S A;  1LT5 D;  3MC0 B;  2X6L A;  1GJX A;  1GHK A;  4F88 A;  4WJW A;  1H9S B;  4A3K B;  3QWN A;  1HFG A;  3T13 A;  2F0N A;  1I4P A;  1JCK B;  3W3A A;  3R2I A;  2Y0S B;  4RGN A;  3SXH A;  2CVR A;  1K8M A;  4K2L A;  1KNA A;  1Z47 A;  5DAU A;  3I70 A;  1SE3 A;  1OXU A;  2OF1 A;  5EQ0 A;  5ELB A;  2B8G A;  1A2T A;  3DHQ A;  3JAM L;  2C5C A;  1DOL A;  1YNJ C;  3NTK A;  3BS1 A;  1A6X A;  1PLF A;  2F0U A;  4CBV A;  1AEX A;  1RTO A;  2PO4 A;  3PUZ A;  1RCV D;  2IWH A;  3FVQ A;  3OW7 A;  5LL6 X;  1HPC A;  5IGE A;  4C56 C;  2A6H D;  3GV3 A;  2BA1 A;  3MWY W;  1Q1E A;  3VYS A;  5A35 A;  3ND8 A;  5T1G A;  4ID6 A;  2CQA A;  1R9T B;  1BCP F;  2NN6 I;  2HQE A;  4BBR B;  3ZYY X;  1EU4 A;  5JPN C;  4GZY C;  4FYD A;  1SMY C;  3K6O A;  3M3Y B;  1Q3L A;  3QJY A;  1RF2 D;  4ZRZ A;  2D5D A;  2IL8 A;  3GO5 A;  4XDX A;  3BDO A;  4QIW B;  5M9O A;  2IW3 A;  3LWU A;  1AP0 A;  3C1E A;  1KAA A;  1OXT A;  1EZ6 A;  3KLS A;  5CV9 A;  1RD9 D;  1MD2 D;  3GTQ B;  4FO2 A;  1EL0 A;  2L5T A;  5EJW A;  3DWA A;  2NUC A;  2EYL A;  4IFD H;  1F9P A;  4ZKB B;  4TQU S;  2SEB D;  4Q0F A;  4KKU A;  5DM7 3;  1XTC D;  1AW7 A;  1DOM A;  2KCN A;  1CT1 D;  1Y8N B;  1STG A;  2L9H A;  3BDL A;  3MXP A;  1KDB A;  3QOJ A;  1ESR A;  1S5B D;  3TP6 A;  3GTM B;  3TSS A;  2R61 A;  4E6I A;  3O13 A;  5K36 G;  1VMP A;  2F0G A;  1C8C A;  2F0Q A;  2IX1 A;  2KHS A;  1TWC B;  2F03 A;  1Q1B A;  4S3S A;  4IUR A;  1CQF A;  5C4H A;  1SNM A;  2MGS A;  1JWS D;  1F77 A;  1EQT A;  2QF7 A;  3H6M A;  1EEI D;  1BR9 A;  1EYD A;  4K6D A;  1GUW A;  2L1B A;  3DXJ C;  1EY0 A;  4G7O C;  2I07 B;  5C0X I;  5IGD A;  4X3T A;  3EJI A;  1SSO A;  4LJZ C;  1T5X D;  5JJZ A;  3PIP 3;  2IT1 A;  2PW7 A;  2A6H C;  1JR0 D;  3P20 A;  5EPL A;  1II3 A;  2KUM A;  4IN3 A;  5A2Q E;  3VR3 A;  5I6W A;  2HDM A;  2JA8 B;  5ELF A;  4AYB B;  3AMU A;  4XXE A;  3IAY A;  1X3Q A;  3C2P A;  3JAM E;  1B9N A;  2EY2 A;  2WB1 B;  2KVM A;  2EDG A;  1AFP A;  1CHQ D;  1BOS A;  1ILQ A;  5C0X J;  2E74 C;  5EKI A;  3I3C A;  1PZI D;  2E2J B;  3HS0 C;  4H44 C;  2L4N A;  3MVV A;  3NP8 A;  1C48 A;  1IKL A;  5COY A;  3J80 L;  5CC4 A;  2JXM B;  2ID0 A;  2K28 A;  3KF8 A;  3U9O A;  5D3I B;  2KQ3 A;  2RSN A;  4HR7 B;  5KGU A;  2A69 D;  4XQN A;  4CKE A;  1PDQ A;  2EPB A;  1TS2 A;  1HRJ A;  3QIA A;  5HUR A;  3ERQ A;  3GTG B;  2R7Z B;  2NN6 H;  4A3F B;  1B50 A;  2NYZ D;  4PV1 C;  3SEB A;  3SK6 A;  1PFB A;  2M00 A;  2H4O A;  2MPM A;  2D9U A;  2EY6 A;  1LV9 A;  1YNN D;  4HSV A;  2B2T A;  4C3I B;  4X3K A;  3GTK B;  1SYE A;  4QF4 A;  1K83 B;  1GXD C;  1D5Z C;  2PNR C;  2KEE A;  2ICE C;  3H0G B;  3NBH A;  3NQI A;  3SK5 A;  2JYO A;  2G9H D;  3L7Z C;  4WOR A;  4KY5 A;  1F9R A;  3K5L A;  4HSP A;  4IUT A;  2K01 A;  4DNR B;  2NVY B;  2ZT9 C;  2EYM A;  4L6T B;  2CW0 D;  3P7J A;  4IUP A;  2ICI A;  2K5W A;  4L63 B;  2DNE A;  1UNS A;  2RQX A;  3DWP A;  3S2D B;  4A3D B;  3VR4 A;  3T56 B;  4B08 A;  5BN3 A;  1HTP A;  3HEJ A;  3NBI A;  3C3L A;  3NE5 B;  1PXU A;  1QE6 A;  3RMH A;  4I7Z C;  2MUY A;  3PV0 A;  1VCI A;  4NP5 A;  4FXG C;  2V4D A;  2K5Q A;  1B53 A;  3BVZ A;  1LTG D;  3CRK C;  3EA6 A;  4KY7 A;  2EY5 A;  2AQ2 B;  1BF4 A;  2A69 C;  4BA2 I;  3ND9 A;  2FMM A;  5C0X H;  3E0J A;  1H9K A;  3SVM A;  2ZXO A;  5CYU A;  3Q22 A;  2LKV A;  3HG9 A;  4XIG S;  3J80 E;  1Q90 A;  1B2T A;  2A74 C;  4ZLT F;  2JA6 B;  3E6Z X;  4C3H B;  5M3M B;  5IIF A;  3HOX B;  1F2Y A;  4G4K A;  4EVO A;  4FF1 A;  4FF4 A;  1YNN C;  2F0L A;  3IFD A;  2SNS A;  4OL7 A;  4KTA A;  1A3U A;  1SNC A;  3PO3 B;  4IUN A;  2EZV A;  1PTO F;  3VR6 A;  3KK7 A;  1WTW A;  2VUM B;  1PTO D;  1ILP A;  5D65 A;  1TS5 A;  2NZ1 D;  3H91 A;  2PMZ B;  2CW0 C;  2GA4 B;  3H3V C;  1FNV A;  5AFW A;  3EQL C;  2EJF C;  4Q5V A;  2E75 C;  2A73 B;  4EQP A;  4KKS A;  1PRT B;  3EFX D;  3OSO A;  3KBG A;  1SJH D;  2YU9 B;  4K6L A;  4F8M A;  2NN6 G;  1E2Z A;  2A6E D;  2B2U C;  1WTV A;  4A3M B;  5NUC A;  2F0E A;  2B63 B;  4NDX A;  4IZ8 A;  3G7L A;  2VB2 X;  1XXG A;  4HN7 A;  5CV5 A;  4ODG A;  3HOZ B;  4IFD I;  2BDO A;  3HOY B;  1JWM D;  3K58 A;  1QOH A;  2OXP A;  5LL6 S;  2D62 A;  2JP1 A;  2PW5 A;  1F2L A;  1UAP A;  1CFM A;  3A56 A;  1WVL A;  1FNU A;  3DMU A;  1IKM A;  4FXD A;  5F2D A;  4K2K A;  4C3J B;  1PTO C;  2R92 B;  3PUY A;  1LT3 D;  2IJ0 A;  5M3F B;  1EQV A;  3G6J B;  3T51 B;  3MA2 B;  2F0J A;  4QB4 A;  4DAV A;  3A55 A;  1I4G A;  2EYP A;  1J9O A;  2F0D A;  4XT3 B;  5C44 B;  5C0X G;  2KCC A;  2MP1 A;  5EKL A;  5M5Y B;  1S5D D;  1STY A;  2J7Z A;  3WDN A;  1TR5 A;  3QO2 A;  3GQB A;  2BCO A;  3KLR A;  4R8I A;  3E5S A;  3A8K E;  1ZKO A;  1LTB D;  2A6E C;  5IT9 L;  2KEC A;  1A3T A;  3NWS A;  4H0L C;  5CR3 A;  3NWT A;  1E2W A;  3CQZ B;  1SEB D;  1LTI D;  4DK1 A;  4RAU C;  1Y8O B;  1TT2 A;  1B44 D;  4KJN A;  5EPJ A;  2XIW A;  1V1P A;  1S5F D;  3AB9 A;  1OO9 B;  1B1Z A;  4KI0 A;  1STE A;  3PUV A;  3M85 A;  4RGM A;  2PYK A;  2LMC B;  4H7B A;  1OXV A;  3L9A X;  3D8G A;  5JPM C;  5DEH A;  4XYQ A;  3FPU B;  4KN4 C;  4FXK C;  3M7N A;  1NCV A;  1BO0 A;  3VYT A;  1EZ8 A;  4RKB A;  1LAC A;  1SE2 A;  1Y1W B;  3I91 A;  4KKT A;  1Y8P B;  1ZYR D;  2JE6 I;  5D3D A;  4WRD A;  5JAV A;  3NTI A;  2TSS A;  2F0V A;  1BCP D;  4I65 A;  5G3L F;  5E3F A;  5CBA E;  1W6K A;  1S4Z A;  1X3P A;  1WTP A;  5G3L D;  4A3G B;  4DFA A;  3RZO B;  1FD7 D;  1HTL D;  1ET6 A;  3FEW X;  1V8Q A;  1CM9 A;  1JC7 A;  2Q8T A;  1O7Y A;  1ET9 A;  1VMC A;  2H1E A;  2QKI C;  3K7A B;  2F0W A;  1I4H A;  3SDZ A;  1V43 A;  1FGB D;  3A7A B;  2R6G A;  5BN4 A;  4BY7 B;  2EE1 A;  3NUC A;  4XTC S;  3EVQ A;  3GV6 A;  2OEO A;  5J1Z A;  5C3W A;  3K5M A;  2L11 A;  2B2Y C;  4J6H A;  5FO9 B;  4A3E B;  1NUC A;  4R8N A;  5IT9 E;  4RWS C;  2IPK D;  3DWQ A;  1I50 B;  1IYV A;  3MXU A;  4ME5 A;  3Q0A A;  1V1P B;  2Z4H A;  1NR2 A;  3BDC A;  4QUF A;  2AWN A;  2L0C A;  1IHZ A;  1CZW A;  3BYT B;  3D6C A;  3N6R A;  3U9S A;  2HDL A;  5BN5 A;  2R93 B;  4CJ2 C;  3MTS A;  1EWH A;  1ZYR C;  3OIP A;  2PQE A;  2B39 A;  1TS3 A;  3IKJ A;  3GTP B;  2XWB B;  3DEO A;  4MN3 A;  1BCP C;  1XX8 A;  4LK1 C;  2K6A A;  2XSC A;  2N88 A;  4QUC A;  1HQR D;  1JB3 A;  5KRU A;  2WV6 D;  1B4O A;  2BE5 D;  4CKB A;  2PCF B;  3ITP A;  4J1M A;  2KOL A;  1E2V A;  2F3W A;  2NTS A;  4A3I B;  2HCC A;  4K8I A;  1SYB A;  1O7L A;  3C46 A;  1AZQ A;  3D3R A;  2NWG A;  2R3Z A;  4PNY A;  3BYY B;  2K33 A;  1O80 A;  4RGO S;  1BQQ T;  1G8Z D;  4DN4 M;  1G6Z A;  2RBM A;  5KYL A;  2K04 A;  4KHV A;  4KHZ A;  1NAP A;  1Y69 U;  1LTA D;  3Q6S A;  1NSN S;  2VXW A;  1JE4 A;  4HMJ A;  4HTH A;  2O2L D;  4F87 A;  3OMC A;  1I4R A;  1TWG B;  1ZXT A;  5M5X B;  1H9M A;  2B2W C;  3MXG A;  1JOO A;  3X3N A;  4C1N K;  2EJM A;  1A15 A;  4PMB A;  2AQ3 B;  2BDN A;  2JEB I;  3S17 B;  1EU3 A;  2QEJ C;  1MGS A;  1I3Q B;  3P1H A;  2RDG A;  1HUN A;  1G2S A;  2IX0 A;  4DAY A;  5KND A;  1DD2 A;  1FR3 A;  3HKZ B;  2PZW A;  2XWJ B;  2M2L A;  1A2U A;  1PRT F;  4IFD G;  2B2V A;  2A68 D;  5C4Z A;  2Z4I A;  1WD0 A;  2BE5 C;  1TWH B;  5IGC A;  3J7Y W;  3CKI B;  1DM0 B;  2EVB A;  1PZJ D;  5J22 A;  2KED A;  5CMD A;  2J0T D;  2DN8 A;  3VA7 A;  1ENC A;  3TME A;  1MSH A;  1GHJ A;  3QB3 A;  4CJ0 B;  5ELE A;  4KN7 C;  1CA5 A;  5IOD A;  2SNM A;  1HXY D;  2F0T A;  4RA8 A;  2AUJ D;  4UDU C;  1PMR A;  2EYF A;  3T16 A;  4IAL A;  2L55 A;  4JBW A;  1XWE A;  3VR2 A;  2N55 A;  4XT1 B;  5D14 A;  4X3U A;  1DJR D;  2WIN B;  4A93 B;  2B2U A;  2PZU A;  5KIX A;  5EGT A;  1AZP A;  1VF5 C;  2XRS D;  2RKS A;  3F2U A;  2DNC A;  5JVG 3;  1H9R A;  1BUV T;  3J7A F;  3VYR A;  2F0I A;  1IW7 D;  2EYO A;  4HAE A;  2C9O A;  3R3O A;  5JEA J;  4RKL A;  4XQQ A;  2QIL A;  3CRL C;  1SNO A;  1STB A;  2QCP X;  4RFB A;  1R4P B;  2MHV A;  3DEP A;  4XYO A;  2PPB C;  1F9Q A;  3K5O A;  4DXG A;  3S1N B;  3M4Y A;  5DM6 3;  4EQN A;  3HOU B;  3H94 A;  1Q8I A;  1DOK A;  2A68 C;  2NVT B;  5IGF A;  1SFO B;  2J4X A;  1M8A A;  3Q24 A;  3S15 B;  4RCN A;  4DA2 A;  4KV6 A;  3K0Y A;  4RHS A;  1DCZ A;  2WII B;  4X3S A;  2G9D A;  5ELC A;  2IX3 A;  5C4X B;  2Q8R E;  4A3B B;  3SK4 A;  1FYC A;  1SNP A;  1ESF A;  3AU7 A;  4C3H G;  3W2D A;  1LT4 D;  3V96 A;  1KLG D;  1V1O A;  4KJO A;  1QNU A;  2HUG A;  4DU9 A;  4KY6 A;  1GUT A;  4OGQ C;  4K14 A;  3IL8 A;  2FJ2 A;  1JQY D;  1PFN A;  4OIJ A;  4PMC A;  3V2T A;  3T4A C;  2O5J C;  3SR1 A;  1E0B A;  4NKL A;  1IW7 C;  1RKN A;  4O1N A;  3Q23 A;  1LTS D;  1UEA B;  1BNZ A;  5C5L A;  3V05 A;  3D4D A;  4FNF A;  4ZQ3 A;  2K5D A;  5I2X A;  2X69 A;  1TKW B;  1CI3 M;  1U9R A;  2WKD A;  2EXZ A;  1EY7 A;  1U4M A;  3OPO A;  4FVM A;  1F2M A;  1CTM A;  2K7V A;  3BVG A;  3I90 A;  1CK1 A;  1R4Q B;  1LTT D;  1SAP A;  3FDT A;  1HHV A;  1LO5 D;  4ZK9 B;  5K36 H;  2NB0 A;  5JEA H;  1T5E A;  5KEE A;  2MJ8 A;  4F7X A;  3OOC A;  3TBI B;  3HOV B;  2LS0 1;  2HCI A;  3S1R B;  1CQV A;  1UUP A;  3S2H B;  1I6H B;  1PTO B;  4IUV A;  2BA0 A;  3MZ5 A;  5FO8 B;  4BWG B;  3KUP A;  4HCE A;  4Y7N B;  3KBX A;  1XYI A;  3NXW A;  2F0F A;  2FHT A;  4KD4 A;  3PIO 3;  1CZG A;  3HRZ C;  1WTQ A;  1VF7 A;  5FOB B;  1TWA B;  1LAB A;  2EY1 A;  4EGV A;  2PZT A;  3VR5 A;  4M8A A;  1W6J A;  3R2T A;  1CA6 A;  1U4P A;  4C3J G;  1HCZ A;  4OHJ A;  2NVX B;  3I72 A;  4G7H C;  4TRD A;  1SND A;  2Q8I B;  1MI2 A;  4RH6 A;  3TP8 A;  1OXS C;  1ONL A;  3S1M B;  4K5W A;  3GP7 A;  1CHP D;  1LT6 D;  2B2Y A;  1STA A;  3PO2 B;  5A2Q L;  2M9V A;  1SXT A;  2FFK B;  1SNQ A;  1DZ1 A;  3CU7 A;  4ZYS A;  5C6A A;  1QWY A;  4B9W A;  1EY4 A;  1ENA A;  1GUG A;  1I4X A;  3RUZ A;  1DXM A;  4RGT A;  1D5M C;  1LLR D;  3X3M A;  4ULL A;  2TMP A;  1KNE A;  1PYW D;  4YIJ A;  4IUQ A;  2O5I C;  4BA1 I;  1TVX A;  3HOW B;  3R8B A;  1D2B A;  1BDO A;  1H9J A;  1I4Q A;  3N52 A;  1SYD A;  3M4O B;  2RDH A;  4NMZ A;  5EBD A;  3K5N A;  2RDF A;  1S5E D;  4ABN A;  1QB5 D;  3LX0 A;  3NQT A;  1IYU A;  4N9T A;  3T53 B;  4TSS A;  1D1K A;  1WCM B;  4JK1 C;  1EY9 A;  3RLF A;  1STN A;  5EPK A;  1B3A A;  4HCS A;  2VNU D;  1Q12 A;  4R9W A;  1M4V A;  4P2C B;  5E1F A;  1ZEQ X;  3ONA B;  5I4D A;  3NHH A;  2O4X A;  3A54 A;  4OO1 H;  2JEA I;  2A5H A;  1JOQ A;  4M1U B;  3ERO A;  4K5V A;  3A8J E;  2FMC A;  2JA7 B;  3I8Z A;  4B9X A;  3RZD B;  5COR A;  5JEA G;  4C1N I;  1JWU D;  2B2W A;  4ZAI A;  1KDA A;  3HP3 A;  1SYG A;  2ZXP A;  2F4I A;  5C5M A;  1EOT A;  4DK0 A;  5J39 A;  1MSG A;  1WTO A;  1QG7 A;  3MFG A;  3S14 B;  3D31 A;  3WOF A;  2VB3 X;  1WD1 A;  4CJ1 B;  2B8F A;  1ML0 D;  2I46 A;  2F0K A;  2KJX A;  1BBX C;  4RHR A;  4ZUJ A;  4ZUI A;  2XRQ D;  2JA5 B;  1SYF A;  2EOT A;  3MAQ A;  5I9O A;  4DNT B;  2ZXR A;  2EJG C;  1EY8 A;  4IQZ A;  4U68 A;  1HA5 A;  3OWE B;  4HED A;  3PUW A;  5JVH 3;  3BVM A;  3QOL A;  3GTJ B;  5DNF A;  5I6Y A;  1BCP B;  4QCL A;  5EKK A;  1G2T A;  3D4R A;  3FMC A;  1HUM A;  4K5X A;  1EIG A;  3FRP B;  1J8I A;  1GUS A;  2E2D C;  4FF2 A;  4K8J A;  5ISR A;  3D6W A;  1TY0 A;  1AN8 A;  1S5C D;  1X32 A;  3NK9 A;  3PMF A;  1HQM C;  3URY A;  2F0M A;  5I2Y A;  4KD3 A;  3I4M B;  4ILW A;  2XNA C;  5E4X A;  5HGT A;  1RDP D;  3GTL B;  5CV7 A;  4ZKC B;  1C4Q A;  2YYZ A;  1KDC A;  1KTK A;  1SYC A;  1PZK D;  3OIQ A;  1EY5 A;  4G57 A;  3SE0 A;  3KLS X;  4QMG A;  1Y1V B;  1JIC A;  3C1F A;  2K03 A;  1WTX A;  3TP7 A;  4J8Q A;  1RJT A;  2LY7 A;  1IL8 A;  2BOS A;  4LAA A;  2RA4 A;  3CHB D;  5JOB A;  1Z6H A;  5T1I A;  3HGB A;  3NSW A;  1EWC A;  2DY8 A;  1PRT D;  2F0O A;  1U4L A;  4HMI A;  4V19 0;  4KK7 A;  1JOK A;  3SK8 A;  1TU2 B;  5CGK A;  4DF7 A;  3VYU A;  1DON A;  1EY6 A;  2WKC A;  1LTR D;  5K5P A;  5M5W B;  2X6G A;  1TQO A;  1G91 A;  4CGY B;  1STH A;  3OWF A;  3IFT A;  1D6E C;  4C2M B;  3DUZ A;  1MBY A;  3K57 A;  5E4W C;  3QG1 A;  1RHP A;  2NBF A;  5FLX L;  4OO1 G;  2WAC A;  2NVQ B;  5KYI A;  2EYH A;  3SHL A;  4A3J B;  1U4R A;  5TSS A;  2D2C C;  4V0B A;  2K32 A;  4C3I G;  3MEH A;  1GUN A;  4U67 3;  1SDF A;  3DM1 A;  3BG3 A;  1B9M A;  1KAB A;  1SE4 A;  2AQ1 B;  1G29 1;  1TII D;  2K05 A;  1D1I A;  2RVL A;  1VDZ A;  4MHE A;  3TN2 A;  5CV6 A;  5CBE E;  5C4J B;  4XQJ A;  3S16 B;  1FNW A;  4H13 C;  5LHY 1;  2E76 C;  1QJO A;  1OXX K;  3RD4 A;  4BBS B;  2B2T C;  3I4N B;  4UAI A;  1GOZ A;  3BZD B;  3J81 L;  3MHB A;  2DY7 A;  5CV4 A;  4Z9C B;  3HZX A;  3H09 A;  4EQO A;  3MXN A;  5FKA C;  2RSO A;  3TZD A;  1DYQ A;  2B2V C;  1ROD A;  1HA6 A;  1ENF A;  1PRT C;  5FK9 C;  2QDB A;  4WFN 3;  4O42 A;  1JOR A;  2K1B A;  1RTN A;  2F3V A;  5KNC A;  3A7L A;  3UI2 A;  3M7G A;  4DAP A;  2WAQ B;  1GUO A;  1ICW A;  3LNN A;  3GD7 A;  1I6V C;  4LMQ D;  1PTO H;  5EBC A;  1O78 A;  2Z8L A;  3R93 A;  4CKC A;  1QIL A;  5C3E B;  2XN9 C;  2XVS A;  1O7Z A;  3S9W A;  1PFM A;  1EIH A;  3VA5 A;  3S1Q B;  4RCO A;  1F9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...