2B2TC

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and phosphothreonine 3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 86
sequence length 86
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2tC00
1J8IA 5T1IA 2SDFA 4ZK9B 3MWYW 1KNAA 1KNEA 1VMCA 1ZXTA 2FFKB 3H91A 2KVMA 5COYA 1LV9A 3I8ZA 2VXWA 1QE6A 2CVRA 4MHEA 5EPJA 3Q6SA 2L12A 2RVLA 1WTXA 1NCVA 1SSOA 2K1BA 3I3CA 2M2LA 1NR4A 5EJWA 1WD0A 4CJ0B 5EKIA 2B2UC 4X3SA 2Q8TA 2RSOA 4ZKBB 3IL8A 2N55A 4O42A 1WTPA 3GV6A 5D14A 3DEOA 4HEDA 1EIHA 3FPUB 5DNFA 1B53A 1HFGA 4U68A 4IUQA 1DONA 1VMPA 2KECA 3DEPA 2N88A 1E0BA 1B4OA 1A15A 5AFWA 5EQ0A 3TN2A 2H1EA 2MPMA 1WD1A 1IKLA 2X69A 1BNZA 2K01A 4ZLTF 2DY8A 1RJTA 1RODA 2B2YC 1ICWA 2B2VC 1G2SA 1WTRA 1IKMA 1NAPA 2KOLA 3GV3A 2B2WC 2K28A 2XIWA 4ZAIA 1B2TA 4X3KA 1MSHA 1AZPA 1HUNA 2L4NA 3KUPA 1TVXA 5CBAE 1PLFA 1ILPA 1G91A 4DN4M 1BF4A 2KEEA 1U4PA 1MSGA 1HUMA 2HDMA 1WTWA 2B2TC 4RAUC 1QNKA 1F9PA 2BDNA 3I91A 4LMQD 4OIJA 4XT1B 2FINB 5T1GA 1WTQA 1PFMA 2KUMA 3QO2A 4CJ2C 1O7ZA 1CA5A 1PFBA 1B50A 1DZ1A 1MI2A 4MN3A 1F2LA 5D65A 4IUPA 4QUCA 1F9QA 1Q3LA 1JICA 1ESRA 1RHPA 4XT3B 1EOTA 1PDQA 2MP1A 1B3AA 1HA6A 2X6LA 5CBEE 4CJ1B 3UI2A 1X3PA 2K04A 2MGSA 3G7LA 1U4LA 2JP1A 2B2UA 2MJ8A 1DOKA 2EE1A 2KEDA 4RA8A 5CORA 1F9RA 1PFNA 1QG7A 5EPLA 4XDXA 1C8CA 2NYZD 1XYIA 2X6GA 1EQTA 1BO0A 1XX8A 2HUGA 3FDTA 1G2TA 2HCIA 1SDFA 4NW2A 1JE4A 4ZKCB 2K05A 1X32A 1ML0D 4IUTA 1WTOA 2RA4A 1SAPA 2FHTA 1M8AA 2L1BA 3DM1A 2HDLA 2EOTA 4X3TA 4UAIA 4QUFA 2B2YA 2B2VA 4IUUA 2J7ZA 2Q8RE 1X3QA 5E4WC 3I90A 1HFNA 2NWGA 1IL8A 4HSVA 1G6ZA 4IURA 2L9HA 1MGSA 5EPKA 5JJZA 4RWSC 2NZ1D 1NR2A 3D6WA 1ILQA 3KBXA 3N52A 1WVLA 1CM9A 2FJ2A 1EL0A 4HAEA 1U4MA 2B2TA 2DY7A 1J9OA 4HCSA 1WTVA 1AZQA 2HCCA 2K03A 1BBXC 1HRJA 2L11A 4R9WA 2R3ZA 3ONAB 4IUVA 2FMMA 1HHVA 1GUWA 4X3UA 2RSNA 1U4RA 1DOLA 1EIGA 3R93A 2D9UA 3TZDA 2IL8A 1DOMA 3SVMA 1AP0A 1O80A 4R8IA 1CA6A 3LWEA 3HP3A 3MTSA 4OIKA 5CMDA 1S4ZA 3P7JA 3F2UA 2JYOA 1O7YA 1RTNA 1F9SA 5E4XA 2EPBA 1RTOA 3IFDA 2B2WA
chains in the Genus database with same CATH superfamily
3KLRA 4MZ9A 1J8IA 2OQKA 3H94A 1BUVT 1LO5D 1VMCA 2JA7H 4GOPB 3J7YW 2F3VA 1S5DD 2IW3A 5IP7G 3BU2A 4YIJA 3CCUA 1SNPA 1EEID 3M7GA 1UAPA 5IYCH 3URYA 2R7DA 2UXBQ 3CC4A 1EIYB 4DR1Q 2B63G 4HEDA 2R61A 5IYDG 4LUVA 1G6PA 1L0WA 2E2JH 2WIIB 2VQFL 4A3BH 1I4PA 4DAMA 2KHJA 2QA4A 4LF9L 4LK1C 1XMQQ 4QF4A 3I4NH 1JJCB 1ICWA 4YCVA 3VA7A 4X3KA 3SK8A 4JI8Q 2PW7A 2ZTCA 1BF4A 4Y7NB 1U4PA 1CSPA 3PV0A 1F9PA 5T1GA 1K8GA 2F4VQ 1QWYA 1QJOA 3W5OA 1N33L 2F0VA 4BBRH 3GTJB 4FDBA 3I73A 2MO0A 5C3XA 4IUPA 4BY7H 3PQIA 2PQAB 4L6TB 1VQLA 2XRSD 3G7LA 1TIID 4GN3B 2M9VA 1PHJA 3DXJC 4DPGA 3CCVA 2XSCA 2A68D 3GQBA 3S2HH 1Q82C 3PUYA 3E0EA 3GTKH 3GTLB 1A63A 2KCTA 2RF4A 2AHOB 2PMZB 5KEEA 2NB0A 2E2DC 2DUDA 3AMUA 2MUYA 4LUOA 2ZXPA 4YWLA 3TBIB 3HOVH 4JYAL 1W3SA 4JBMA 1LTLA 4PQXA 1KLGD 2BCOA 3I55A 1EY5A 1SE8A 2EJFC 2QKIC 4N8X1 1ASYA 4I7AA 3CRKC 4PZ7A 2HQLA 3W3AA 5M5XB 2AUJD 4QIWE 2JN4A 1TS2A 1MJCA 5CMDA 1RKNA 2JYOA 4B08A 4DR3Q 3PIO3 1SJHD 4O2DA 5IGBA 4DR4L 3A8JE 3S15B 3KJPA 4LF6L 2NVQH 4EQ5A 3O13A 5LMUQ 1GKHA 3FKIB 2CVRA 1E22A 3FKIG 4JI2L 2RVLA 3Q0AA 1XTCD 2A6EC 4CJ0B 4LF7L 2XNAC 5C44B 5C44G 4A3MB 1WCMB 5C4JB 4A3MG 1STAA 4A3CG 5KNDA 1CKOA 5M3FG 1D1IA 1O7IA 4X64L 4RHRA 3TP5A 3STBD 4L63B 3BVMA 4FYDA 5HY6A 1GXDC 3RNUA 2HIVA 1RJTA 2B2VC 2F0TA 1YJ9A 4JVZA 5FKAC 3PIPA 1K3BC 1Y8OB 2XTIA 3S1NB 2HIXA 1GM5A 1G91A 2NBFA 1WTWA 5DEHA 3ERSX 4ILWA 2RDFA 1PH6A 4EQOA 5M9OA 3TS0A 1MJEA 5D65A 2VZAA 2WB1B 1JICA 3C3LA 2WB1G 2JA7G 1B3AA 5EGTA 1V1PB 1WFQA 2IPKD 1ESFA 1NSNS 4CJ1B 3IFTA 1I4XA 2VUMB 2QGQA 2X6GA 1UNSA 2HUGA 5TSSA 2OCEA 1I3QB 1ONLA 3AFPA 1NMGA 3OMCA 2DGYA 3SE0A 3I4MH 1LTGD 2B2VA 1TKWB 3MC0B 2NWGA 3VYUA 1K73C 1XNQL 1FNUA 2O5JC 1ILQA 2SEBD 5I2XA 1X54A 5J1ZA 1PH8A 3VYTA 2A8VA 1QZGA 1H9SA 3MFGA 4UPAA 2F0UA 4B3RQ 1T5XD 1A62A 1HH2P 2R7ZH 4LFCL 1DOLA 1LT5D 4JI6Q 4QCLA 1QUQB 2A69D 3H0GG 3Q8DA 1CA6A 3KF8B 5ELNA 3E3XA 5E4XA 3GTMB 3LX0A 4KJNA 1QNUA 3FPPA 1A0IA 1BBUA 4OO1H 1SYGA 5M5WH 4DA2A 3HOWG 3KLSX 4BA2I 2IX0A 1DCZA 4B3MQ 3I4LA 4A3IH 1VCIA 4L5SA 4X3SA 4ZKBB 1BQQT 4K5XA 1E24A 1JWSD 2BOSA 5J3BA 4DU9A 4DAYA 4BBSB 4BBSG 3HOUH 1EY0A 2PI2E 1VQHA 4LW1A 5ELEA 3HOVG 2O5IC 1YI2A 3S1QB 5K36G 5C4XB 2K01A 3HOZH 1OXSC 4DV0Q 3NQIA 2A6HD 4DV6L 5LL6S 1A3VA 1D5ZC 3U50C 4K2KA 4OELB 3J81E 1Y69U 1QVCA 3KK7A 1RF2D 1LYLA 3JAML 3VR4A 4CJ2C 2VB3X 1JT8A 4X66L 1VQ8A 3CRLC 4XYOA 4HN7A 2Z8LA 1Y8NB 4XT3B 1J5EQ 3HEJA 1KL9A 1H95A 4XIGS 4NXNL 2JP1A 3G4SA 2UUBL 2CH4W 1BBWA 1KXLA 1Q1EA 4ZRZA 4S3SA 1VQOA 1PFSA 2Z4IA 1HR0W 2JSOA 3FHWA 3SR1A 5DM63 3A5ZB 1XTDA 3NXWA 3ULLA 3SK5A 1SR3A 2Z0SA 2EXDA 2RA4A 2KCNA 4JYAQ 2R93B 2F3WA 4KI0A 5IODA 4QUFA 1UWVA 1QZHA 1G6ZA 2XN9C 5AJ3Q 2ICEC 3NSWA 1VQ9A 1EY7A 1N9WA 1EYDA 2RKSA 1VF5C 4Q5VA 3MFYA 5CGKA 5IP9G 1PYWD 4LF8L 4HCEA 3GTOB 1GHKA 2NVYB 3KLWA 4DV2L 2OXPA 3D4DA 1VQDA 2RSNA 3HGBA 4ID6A 3K7AH 3M85A 4FO2A 2KCCA 3MTSA 3CC2A 3P7JA 1KRTA 2F0NA 4JI2Q 3VR3A 4YY3L 1I94L 1SE2A 3HS0C 1M90C 1LTID 1CKNA 1QOHA 3H91A 3MWYW 4OWTB 4HJ7A 5C4ZA 3LWUA 1OXXK 4BY1B 2VXWA 2ATWA 5IOCA 2SOBA 4A3JB 1BR9A 2B8GA 1SSOA 2Z6BA 1IYVA 3NWTA 1N36Q 4JCVE 4LFAQ 4X64Q 3I4MG 3FP9A 4YHHL 4OONA 5IYBH 5JVG3 1FD7D 4FNFA 3GTQH 3DWQA 1LACA 1DONA 2EDGA 1WYDA 1HNWL 2F0WA 3PF5A 4LF4Q 4ZLTF 1YJWA 1YHAA 4K8IA 2K5VA 1PXUA 1CK1A 1JWMD 4ZCKA 2JA6H 2QCPX 2R7FA 1XWEA 3FMCA 1TU2B 3SEBA 3M4OB 1PMRA 2I0QA 1S5FD 4XT1B 2PCFB 1AE2A 3FRPB 1CA5A 1TY2A 2PYKA 1Q3LA 4KN4C 2OWOA 4OO1G 1EZ8A 1EOTA 3I2ZA 3HG9A 3S14B 1U4LA 5GADC 3I56A 2NTSA 3ULJA 1DD2A 3OWFA 1CHQD 1FR3A 2WKDA 4A3IG 3HKZB 4QL5A 3HKZG 2PZTA 1IHZA 1XNQQ 1TWCH 1E1TA 5M5YH 3CU7A 5IT9E 3CCMA 1SMYD 2PNRC 1LT4D 3RLFA 2UU9L 1WI5A 2V1CC 2C9OA 2L9HA 1SYDA 3VA5A 4LFCQ 2EY2A 2AWOA 1X55A 2F03A 3D3RA 4K6DA 2QILA 3MXPA 4A3EB 1VQFA 4A3EG 1B1ZA 3UDFA 1DOMA 2R92H 2BH8A 4GKJL 3HP3A 2NVXB 1CSQA 4NPSA 1RTNA 4NP5A 3GO5A 4EQNA 2CWAA 3GTPH 1BCPD 1VQ6A 4KHPL 1AFPA 1J6QA 1G291 1IXRA 1ZXTA 3J7ZC 4TKOB 4IALA 2NVTH 1YEZA 2UUAQ 2O2LD 1X3EA 5A35A 5JAVA 3NUCA 4IN3A 3CPFA 5EKIA 1D5XC 2VY3A 2RSOA 3CCQA 2VL6A 5D14A 5FJ8G 3T1YL 1Z7TA 3CCLA 5D3IB 1L0XB 1WTHA 2FMCA 3EA6A 4WFN3 4RMFA 2B3GA 2B8FA 1LTBD 4IJHA 1YNJC 1L1OB 1IKMA 3U9OA 4ZAIA 1GUSA 1CFMA 2L4NA 4G7HC 4JI3Q 2K32A 2IX1A 4JI7Q 3K5LA 1FJGL 1E2VA 4A3LG 5C4HA 2QW7A 3ND9A 4LMQD 4KKTA 2KHIA 4WJWA 1HQMC 3MZ5A 1JQYD 2EYPA 1F2LA 2EIFA 3FVQA 4XXEA 5I9OA 2MP1A 5ELCA 4DK6C 4JV5L 5CORA 4LNQA 4I65A 1H9JA 5EPLA 4CHTB 2EQSA 4XDXA 5FLXE 3NWSA 1ET9A 3AQQA 5C3EB 5C3EG 4ZUJA 3AFQA 3R8BA 1IZ6A 3OYYA 2N3SA 1PZID 4GOPA 4IUNA 1UE6A 1L2FA 1MHWC 2VQEL 3LGJA 1EY6A 4DV3L 5M3MH 1JB7A 2J7ZA 1IW7C 4EQPA 1IL8A 4DV2Q 4P75A 3OWEB 3D6WA 2D2CC 3SDZA 4YWKA 1GUOA 3UDIA 4WORA 3CCRA 2JA6G 3D4WA 1I4HA 1SNQA 5JEAG 4G4KA 2EY1A 2XWBB 2K03A 4R9WA 2FMMA 3T56B 1IL2A 4YY3Q 2VW9A 4OGQC 2XVSA 1O80A 4DK0A 4JK1C 3E6ZX 4LFBQ 4DNIA 4I7ZC 4GLXA 1T5EA 2ALYB 4OL7A 4UP7A 4YHHQ 3CXCA 3GTGB 1I6HH 3IKJA 2PNHA 3I72A 1VQ5A 2PQAA 5EPJA 4RG1A 1WTXA 1JWUD 2DN8A 3I3CA 4P73A 1PH4A 1HNWQ 3NQTA 1YIJA 1VDZA 2E2HB 2KBNA 2WP8J 3OOCA 4ULLA 5C0XI 2HQEA 4A3DB 1D8LA 4A3DG 3ULPA 4YWMA 3KBGA 1FVIA 2CFMA 1E0BA 5KRUA 4LF5L 5AFWA 3F2DA 2BA0A 1LTRD 1SE4A 3PIP3 3HOXB 1I4GA 3HOXG 3JAMc 3H09A 3RZDB 4RH6A 1HNZQ 1AZPA 3PO3B 1VQNA 3PO3G 4N9PA 3JAMi 4R8NA 2HDMA 1VQEA 5HURA 1SFOB 3S17B 2B2TC 4RAUC 1HZBA 1MD2D 4R1JA 2B63B 2FINB 4GLAC 5EAYA 1Y8PB 2RDGA 4X62L 2F0EA 2DNCA 4DUYQ 5DM73 3N6RA 4DNRB 4QIWB 3L7ZC 2X6LA 1VQMA 1KDBA 1X3PA 2MGSA 3K7UC 5GAEC 1EQRA 1ZEQX 3BZDB 2UUCL 4H02A 2J4XA 5BN5A 2UU9Q 1EQTA 5EBCA 3FDTA 3C2PA 5EBDA 1W2BA 4BXXH 2YTVA 3K81C 2RHSB 1UEAB 3F2CA 3QB3A 1ZKOA 4P2CB 1K8AC 2Z6KC 3V96A 4IOCA 4J1MA 2E5LL 4C3IB 4C3IG 5BN3A 3S1RB 1XJVA 2MNAA 3OIPA 1QB5D 1VQGA 1M1KC 1XPUA 2EJMA 5CYUA 2B2TA 1D6EC 2K6AA 4HCSA 1HZCA 1BBXC 5CV9A 1R4PB 2GVAA 5C3WA 2C5CA 1GVPA 4X65Q 2ASBA 3DM3A 1IBLL 4KHPQ 2YU9B 5BR8L 5ELOA 2DNEA 4CDFC 3J80E 2IT1A 4OIKA 1U5KA 3EBEA 4CDCC 5IGFA 4MTNA 4DR2L 1PH7A 3A7AB 5I6YA 1EOVA 3VR6A 2A6ED 3TZUA 5J39A 1LLRD 3HOYB 3HOYG 4A93H 4APVA 3S24A 3HRZC 3SGIA 3X3NA 2Z6KA 2YV5A 1V1PA 5LMNL 2PI2A 4B9WA 3BZKA 1KIXA 3GV6A 1QCBD 4K2LA 1PZJD 3DEOA 4CKCA 3QG1A 3K80C 1B53A 4AQYQ 4KHZA 1PVOA 1TWAB 3NBHB 5FK9C 2AQ3B 1PRTB 1E3PA 2F4IA 3H3VC 3M3YH 4ME5A 5EQ0A 1FJGQ 1SE3A 4A3KH 3A56A 2UXCQ 2DY8A 4DF7A 3K5OA 4EX5A 4OXPA 4R4IA 4XQNA 2E75C 4GNXC 4C3JH 4ALPA 4JI5L 3CQZB 1TXYA 3VR5A 3OHXC 1XMOL 1JJGA 1VQ4A 3K8AA 3TP6A 4CDDC 2OEOA 1Z9FA 3MXNA 3R2TA 1PTOB 1WTQA 1JOQA 2WKCA 4DAPA 4RCNA 1QUQA 1ESRA 5M3FB 2A68C 2ZTEA 4A3GB 4A3GG 2G9HD 1KDAA 3KF8A 4OX9Q 5D3DA 5IT9L 2VQEQ 2N49A 4L5TA 4Y52H 1IYUA 4DV3Q 5CV6A 2JEAI 3RZOB 1CKMA 3NBIA 4N9TA 3K5MA 4ZKCB 4HTHA 5C5MA 1FYCA 2FHTA 2RHQB 1LTSD 2VS1A 2C35B 3TMEA 4A3FH 3A5UA 4GNXA 1KD1C 4F88A 2JA7B 1UE5A 2F0MA 4PNYA 4POFA 2EYHA 4GS3A 4E6IA 2M00A 2LS01 1VQJA 5IYCG 2R3ZA 2Z4HA 4O0AA 1UEBA 4HR7B 1G2TA 2D9UA 3CPWA 2E2JB 4F7XA 2K52A 1EFWA 4A3BB 1H9KA 4J8QA 4K5VA 4A3BG 2D5DA 5CC4A 4B3TL 4DV7L 5IGCA 3I4NB 3I4NG 1KABA 4C56C 2FFKB 3ZYYX 2KENA 2KVMA 5COYA 4C1NI 3MXNB 3GDEA 2R6GA 3U4ZA 4LF5Q 5EJWA 4K8JA 1WD0A 2PPBC 2Q8TA 4G57A 1GOZA 3H0GB 4N8FA 4BBRB 4BBRG 4P72A 3E0JA 4BY7B 4BY7G 1I50B 3J7AF 2E2IH 5CV5A 3DWAA 4KTAA 1KAAA 4HJ5A 1D5MC 3K6OA 2F1MA 4JI0L 1W6KA 1WTRA 4KMUC 4EGVA 2KOLA 2B2WC 1R9TH 1EEFD 1NBWA 3HOWB 3I70A 3S2HB 2LFNA 2VQFQ 3GTKB 5E7NA 1CTMA 4LF9Q 4GNXB 1N34L 3SK6A 4YCUA 1KQSA 1PFBA 2NZHA 4C3HH 1MI2A 4JW0A 4KY6A 3RUZA 3HOVB 4IPDA 1FL0A 1TWGH 5CBEE 1S3OA 1B9MA 1VQKA 1SXTA 1DOKA 3WWVA 2KEDA 4JI4L 1N33Q 2JA8H 2ZJPA 4CBVA 1SDFA 2K05A 4KKUA 4IOAA 3CD6A 5C0XJ 3I7FA 1XNRL 4F87A 2L55A 1CT1D 1HFNA 4HSVA 4KD3A 1EZ6A 4G7OC 3KBXA 1IBKL 2NVQB 3M4YA 5BR8Q 3WDNA 3PSIA 4PMWA 2EYLA 4DR2Q 4KJOA 3T1HL 2TMPA 1YHQA 4C2MH 4M1UB 1EIGA 4AYBB 4IQZA 4AYBG 3I4OA 3KFUA 1N32L 3EROA 2JE6I 2DJFC 4MIUA 1TY0A 1DJRD 1NUCA 3L0OA 2JQOA 2CW0C 1K28A 1EYGA 2IX3A 5LMNQ 1HTPA 3P75A 4H13C 4HJ9A 3QOLA 2ZXRA 4ABNA 4WJ4A 4JPBW 2XGTA 1P16A 1I4RA 3OW2A 1SYFA 1JMCA 2OF1A 4DV1L 4O42A 1NJIC 1C4QA 1KLUD 2K5DA 5J22A 4DR4Q 4A3FG 4DV5L 5EKLA 2D0PA 4KY7A 3W1GA 4LF6Q 1EYAA 3S2DH 1VMPA 4JI5Q 1XMOQ 1EIFA 2FXQA 1Q1BA 2WFWA 2ZXOA 4K5WA 1CQVA 2B2YC 2NN6H 4UP9A 4IJLA 4LF7Q 4QQBX 1G51A 3PUVA 3GD7A 2MQHA 4QY7A 3KUPA 5C6AA 3M4PA 3TS2A 1NMFA 3I4MB 1V43A 4KN7C 5KYIA 2BDNA 2AUKA 1PFMA 1K83H 1SMXA 1GD7A 3A55A 2BE5C 4GN4B 4JG2A 5K5PA 3DMUA 1L1OC 1KRSA 4DK3C 3BJUA 1Y1WH 2MJ8A 4AYBE 5HGQA 4IO9A 3CW2C 1C8CA 2NYZD 2R7ZG 1SYCA 1X3GA 4DR6L 1X32A 1ASZA 2YTXA 4X3TA 4NDXA 2B2YA 1Y14B 4L5RC 2KJXA 2Q8RE 3D8GA 5FO9B 4JC0A 4O1NA 3CF5A 5M5WB 3L2PA 3CHBD 3J80L 2PZUA 1ICFB 1Z47A 1HZ9A 2NN6I 4DV4L 3ONAB 4A3IB 2QF7A 1Y1VH 2EJGC 2NTTA 1VQPA 1NY4A 1L1OA 1YVCA 1I4QA 3PUWA 2F0DA 3HOUG 3S1MH 3LNNA 4IFDI 3PO2H 3QOJA 4K14A 4DR7L 3H15A 1TWHH 2OT2A 5KGUA 2WAQE 2EPBA 2UXBL 3HOZB 2WINB 3HOZG 5T1IA 4DR1L 2SDFA 2JA5H 4K0KL 1EYCA 1KNEA 1HNXL 2L0CA 4PMBA 2K5HA 5JJKA 3RLOA 2MFIA 4H7BA 1B3QA 2ENBA 1QE6A 4MHEA 2WACA 2K1BA 3EN2A 2F0SA 2D0OA 3OMGA 2ZJRA 1XMQL 2I07B 2B2UC 3ND8A 1TWFB 2E2HH 4JI0Q 4LWCA 5LHY1 1K3RA 4KLKA 4JI8L 1HFGA 3NK9A 4IZ8A 1C48A 4U68A 2N88A 1B4OA 4A4IA 3CCEA 2VB2X 1B9NA 2H1EA 3TN2A 1IKLA 4FXDA 2LMCB 2BH2A 2B39A 1O7LA 2F4VL 4DXGA 3CMAA 4RKLA 4FF2A 2RQXA 2XRQD 3TP8A 2XIWA 1B2TA 1M4VA 1PYSB 1A2TA 3RZDH 5IP7H 2A73B 2G9DA 3PMFA 5I6WA 1HQRD 1HUMA 1U0LA 4FF4A 3B6YA 5IT9c 1JR0D 1H9MA 3M7NA 1DZ1A 4KKSA 4DV6Q 5IYDH 3MEFA 3T13A 4XTCS 1PDQA 1HA6A 4TRDA 1BVSA 4A75A 3G6EA 1Q7YC 1TS5A 1XNRQ 2B2UA 2BDOA 1F9RA 1XXGA 1IW7D 2KA7A 2K5WA 4R4QA 4G7ZC 1BO0A 1O78A 4X66Q 3K7AB 1JE4A 2HHHL 1HA5A 1PRTF 4Y7NH 1AE3A 2EOTA 4NXNQ 2UUBQ 4BS9A 4AH6A 3PUXA 3OTOL 1GUNA 1X56A 2Q2IA 3GTJH 2LY7A 4B9XA 3NEMA 2PZWA 4DR3L 3BVZA 5BN4A 1UE1A 1N32Q 3S9WA 4RGNA 5C0XH 4NMZA 1PTOF 1GUWA 3TZDA 1VQCA 5IYBG 3GTQB 2F0IA 2Y0SG 5LMUL 2E74C 2J0TD 3GTLH 4LF8Q 4FF1A 1Z6HA 1YITA 4JBWA 3AYHB 5I9PA 1LUZA 1VF7A 5JJIA 1NTGA 4ZK9B 1PYBA 3F1ZA 2JA6B 3I8ZA 5G3LF 4RGOS 2F0QA 3Q6SA 1NR4A 1I94Q 2CQAA 3IL8A 5M5XH 4FXKC 1RD9D 1HZAA 1C0AA 2K7VA 2KECA 3WOFA 3R2IA 4A76A 4RCOA 5CV4A 4Q0FA 1BNZA 1CI3M 1JE5A 4LJZC 2HT1A 1FNVA 4ODGA 3JAME 3VYSA 3CC7A 1Y1VG 3S15H 2EXZA 1TWCB 5M5YB 3FKIH 2KEEA 3RN2A 1PRTC 1LT6D 1II3A 3KYHC 2B29A 3BYTB 1ZYRC 5C44H 3Q23A 2KHSA 4A3MH 1WCMH 5C4JH 3UE0A 4A3CH 1EFID 3J81L 5M3FH 2JK8A 1GUGA 2Y0SE 4XQJA 2Z9HA 4PV1C 1XX8A 1HR0L 1PTOC 4MNOA 2R92G 2R92B 5FLMH 3SHLA 1VS0A 1A3UA 3S1NH 1ML0D 3J81j 1SAPA 4GKKL 5CV7A 1SBBB 1S5ED 2HDLA 1X6OA 1EU3A 3EQLC 2E76C 5JPMC 4B3RL 1T9HA 4DV4Q 5IWAL 4IURA 1F2YA 4JI6L 1MGSA 3SK4A 1CZWA 3N52A 1WVLA 2NVTB 4IPHA 3KJOA 4KV6A 3NBHA 2DY7A 1K8OA 1DYQA 5JOBA 1SNCA 4DR7Q 3A74A 3DHQA 4XQQA 2VUMH 1HHVA 2F52A 3Q24A 1SNDA 2I5MX 1LM0A 3DLLA 1C9OA 1CQFA 2AKWB 4K0KQ 1HNXQ 1I3QH 1BOSA 1YJNA 3R3OA 1BCPB 3PGZA 5ISRA 4QGUA 4B3ML 3G48A 3IFDA 3KDFB 4ZYSA 1KC8C 4HIOA 4NKLA 3PUZA 5IGDA 4GKJQ 1KAWA 3C1EA 5IGEA 1YNNC 5FOBB 3MXGA 4UHVA 2JEBI 4KK7A 4DV0L 1JC7A 1HJPA 2N55A 1STHA 1RIPA 3H0GH 4FP5D 1AH9A 2F0GA 1DGSA 3CP0A 3S16B 1I50H 1FGUA 4ZQ3A 1WD1A 2MPMA 1CZGA 1D2BA 1PA6A 3GTMH 5A2QE 1G2SA 5KNBA 2QDLA 2KCMA 1NAPA 3MVVA 3G6JB 5C0XG 1HUNA 3T1YQ 3ITPA 1UUPA 3H3VH 1J5EL 4HMIA 5CBAE 3VDYA 1ILPA 3HOWH 3RN5A 4OHJA 1QVGA 2F0PA 5M3MB 5M3MG 2O4XA 3I91A 4OIJA 1PH9A 5ELBA 4IFDJ 2KUMA 3QO2A 2ID0A 4BBSH 1FNWA 1IBML 3RD4A 2K33A 2RDHA 3NTHA 1OXUA 5EKKA 1EQQA 5CV8A 3E9HA 2HHHQ 5K36H 3S1QH 5C4XH 4RHSA 1LTTD 1PFNA 4DKAC 4H0LC 4CDEC 5IIFA 1B70B 5AJ3L 2GN5A 3AB9A 3OTOQ 2YTYA 2CH4A 4IUTA 3J80c 1WTOA 1K0RA 3HZXA 4JV5Q 4GLVB 2L1BA 3NE5B 1JB3A 3D6CA 3J80i 4PMCA 3A54A 3TDQA 1P8LA 1IYJB 3TEHB 5H1SE 2CQOA 1OO9B 1I6HB 3W2DA 1SLJA 3BVGA 3BZCA 3UDXA 4CKBA 1JORA 2ZM6L 4DFAA 3SVMA 3H3VI 1Q86C 5JEAJ 1EQVA 3K58A 3HKSA 1PH2A 1JCKB 2R93H 1WCMG 3EFXD 4JI1L 1N36L 1PZKD 4LFAL 3M9BA 1EY9A 1K8MA 5JJLA 1F2ZA 3D0FA 4HJAA 5FLMG 3BDLA 4DR5L 2PMZE 5IP9H 3T16A 2QEJC 2F0LA 1NCVA 5ELFA 2CCZA 2M2LA 4LF4L 3GTOH 1SNOA 2NVYH 1PH3A 4EVOA 3E9IA 4NB3A 3CMEA 3FPUB 3TREA 3IAYA 3K57A 2I46A 3ICEA 1Q46A 1OXVA 2EYOA 1MIUA 3GP7A 1F2MA 3AEVA 1OXTA 3QR8A 3D4RA 2JJQA 4R4CA 1RODA 2LXKA 1S40A 2PW5A 1XPRA 3C1FA 2VUMG 1K0SA 2K28A 1LABA 1Q81C 3U4VA 4BXXG 4BA1I 4BY1H 4DN4M 5F2DA 3IRBA 4OWWB 2PO4A 4A3JH 1UE7A 4R4OA 3STBC 2V4DA 1YBYA 1MBYA 2SNMA 4FF3A 3MHBA 2EY5A 4J6HA 2EYFA 4PZ8A 4U673 4QUCA 1F9QA 3EVQA 2QEXA 1HR0Q 1V1OA 2GVBA 2N78A 1KDCA 3QWNA 3UI2A 2L5TA 4J15A 4GKKQ 2EE1A 4RA8A 1D1KA 1V9PA 1S72A 1QG7A 4H44C 3F8TA 1STYA 3P20A 4X62Q 5IWAQ 2ZT9C 2F3IA 3QJYA 1VQ7A 1SRUA 2KQ3A 3M4OH 2LKVA 4GZYC 2NZOA 4UAIA 5L37A 4HJ8A 5FLXL 1X3QA 2AMCB 5E4WC 2UUCQ 4RGMA 4B3SL 1NR2A 4A93B 4A93G 1LT3D 1B7YB 1STBA 4HAEA 2IJ0A 4RKBA 1EWCA 1U4MA 2K4KA 4F8MA 3S14H 1X3FA 2L11A 4KD4A 5CR3A 5HGTA 3CCSA 2E5LQ 2CW0D 3R93A 2WB1E 2Q8IB 1ENFA 2G5DA 3NELA 3L9AX 1EWHA 2UUAL 3M3YB 2A19A 3F2UA 4HIMA 4P71A 4A3KB 4UY8C 3DUZA 4A3KG 1RTOA 2B2WA 3QIAA 2UXDL 5C4XG 3BS1A 3RR5A 2XWJB 3PIOA 2A69C 1IBLQ 1A3TA 4C3JB 4C3JG 1S5CD 4DAVA 2I5HA 2I5LX 1YZ6A 2P5ZX 3OSOA 3EIVA 2L12A 1GJXA 1AN8A 2AQ1B 4M8AA 3WOEA 5IY0A 3NENA 1SYBA 2EYMA 4A3EH 1EIHA 1TWFH 3T51B 4JI3L 4XYQA 2IHEA 2F0FA 4OWXB 4JI7L 2NVXH 3RMHA 2EY6A 1Q90A 1AW7A 1H9SB 1QILA 3MEHA 4L5QA 3J7A5 2YYZA 4HIKA 3MAQA 1E2ZA 4L8JA 4OO1I 2BE5D 1MSHA 3EJIA 1TVXA 3NTIA 3NTKA 3FEWX 1IBMQ 2VNUD 1MSGA 4QB4A 3J81c 3K59A 1CHPD 3H6MA 2R93G 2OQ0A 1QNKA 4DNTB 3TQYA 5FO8B 4A3FB 2E8GA 2A6HC 3J81i 1O7ZA 5FJ8H 4NXML 2K5NA 4KHVA 1B50A 4RGTA 3CAMA 2MO1A 3F2BA 5IE8A 3M4QA 4HSPA 3PF4A 1YNXA 2A1AA 2K04A 2OTLA 3K0XA 4WJ3M 2WAQB 2WAQG 4DAYB 4WRDA 2N8NA 3K5NA 2K50A 3VR2A 4IFDH 2L15A 3KLSA 3VYRA 2EZVA 1TT2A 2GA4B 4A3LH 1M8AA 2ICIA 4IUUA 1RDPD 5EPKA 5JJZA 3TP7A 4RWSC 2ZTDA 2ZM6Q 4POGA 2QDBA 1EL0A 2FJ2A 2AWNA 4BY1G 4LFBL 2CHBD 1AZQA 2EYJA 4A3JG 1AEXA 2F0HA 1GO3E 5E1FA 4JI1Q 2R7ZB 3CCJA 3MXUA 1U4RA 5C3EH 1AP0A 3HFZB 3KF6A 4DUZL 1SJED 3J7AV 3LWEA 2E2IB 1S4ZA 1EU4A 2AQ2B 2TSSA 1O7YA 1TR5A 1F9SA 4QMGA 1RCVD 4MTKA 4DR5Q 2K75A 1E7ZA 4ME3A 1STEA 3T53B 1JOOA 3Q22A 1R9TB 4FVMA 4CKEA 3BDCA 1LV9A 1A2UA 2Z1CA 2H4OA 2BA1A 1S5BD 5JEAH 1L0YB 1NNXA 2ES2A 5LMNW 4B3TQ 4DV7Q 2H5XA 4QJFA 4AIMA 3PCOB 5A2QL 1WTPA 3HOUB 1HNZL 5FO7B 4C3HB 5LL6X 4C3HG 1STNA 5DNFA 4IUQA 1TWGB 4UDUC 1R4QB 2PQEA 3E5SA 3U58A 1EY4A 1A8VA 1V1QA 2JA8B 4OEMB 2JA8G 3GV3A 3GTGH 5KIXA 4DUYL 2MHVA 3A0JA 4C1NK 4FXGC 3V2TA 2CKZB 1BCPF 2IWHA 5JVH3 1MKHA 1RL2A 3A8KE 2F0OA 1YNJD 2EVBA 1WOCA 1CKNB 2K14A 3X3MA 4A3DH 1W6JA 4TVAB 4MN3A 2Q2HA 5I2YA 4PZ6A 3CKIB 1PH5A 4K6LA 1K9MC 1H9RA 3UDGA 3HOXH 4C2MB 3ERQA 1E2WA 1N34Q 1N8RC 3KF6B 1X9NA 1ENAA 3ZJYC 3BYYB 2HCIA 3PO3H 4B3SQ 2ZJQA 3DM1A 1SFOH 3S17H 1NE3A 1ET6A 2JA9A 1X65A 3JC66 2B63H 1DM0B 3I90A 4V190 4X65L 5DAUA 4JI4Q 1G8ZD 4CGYB 1CM9A 1HTLD 1YHBA 2NUCA 1HRJA 1SMYC 1WTVA 1TS4A 4IUVA 1HCZA 1CUKA 4JBJA 2Q2UA 1E1OA 3P1HA 3OPOA 4HMJA 4TSSA 3TSSA 2UXDQ 2LXJA 1IBKQ 3BDOA 3S2DB 1ENCA 3SXHA 3G71A 1OTCA 1SNMA 1B44D 1BXTA 2A5HA 2SNSA 4Z9CB 5I4DA 4GOPC 3T1HQ 1I6VC 3HKZE 5KNCA 4BWGB 2NN6G 4C3IH 3D31A 3S1RH 4PG3A 1KNAA 5NUCA 2A74C 4JBKA 4AQYL 1STGA 3MA2B 4IFDG 5E3FA 3TRZA 4DK1A 5GQOA 2UXCL 3UE1A 3NP8A 4ZUIA 1SEBD 1LTAD 1BCPC 1HXYD 1V8QA 3W1BA 1K83B 1BDOA 2Y0SB 2YU9H 1XPOA 1Q12A 5DLQE 3DEPA 2F0KA 2IHFA 1A15A 3S16H 4JOIC 4TQUS 1Y1WB 1VQAA 2X69A 1Y1WG 3A8IE 1PV4A 4X6AH 1PRTD 3L3OC 4DGZA 1KHIA 5KYLA 3HOYH 4LUZA 4DV1Q 2WV6D 4RFBA 1Q8IA 1D7QA 4DV5Q 2LSSA 4V0BA 4NXMQ 1EUJA 1TS3A 1ZYRD 1SYEA 5GAHC 1DXMA 1PLFA 3OW7A 4R4TA 3C46A 1B8AA 1Q8KA 4OX9L 3V05A 4IPCA 3AU7A 1EY8A 3NPPA 4IPGA 4DXFA 1JOKA 1EWIA 1PTOD 2OTJA 1RHPA 1TWAH 1A6XA 4P74A 4LAAA 2RCFA 2F0JA 2IY5B 1BKBA 3NHHA 1Y1VB 3KDFA 5FLXc 1GHJA 2D62A 1XYIA 3T4AC 3S1MB 1I5FA 1WJJA 4NW2A 3CQZH 3PO2B 1SROA 1F77A 5GROA 3PO2G 1SN8A 4JOIA 1TWHB 5G3LD 2JXMB 5C5LA 1U9RA 2RCNA 4GN5A 1HPCA 1PTOH 5ELDA 2JA5B 3RLNA 2JA5G 3BG3A 4HIDA 4UP8A 3OIQA 2NZ1D 4KY5A 2CWPA 4DR6Q 4DUZQ 3ER0A 2Q2TA 2DJGC 3KOJA 5GAGC 4A3GH 1J9OA 2HCCA 1QVFA 3DWPA 3K0YA 4X3UA 1FGBD 1GUTA 3RZOH 2HD3A 3U9SA 2IL8A 3A7LA 1KTKA 1JJ2A 2K5QA 4YCWA 4R8IA 1PH1A 5IGGA 1C7YA 5JPNC 1VQBA 3GTPB 2RBMA 1YNND 1VQIA 1TQOA
chains in the Genus database with same CATH topology
3KLRA 1J8IA 3H94A 1BUVT 1LO5D 1VMCA 3J7YW 2F3VA 1S5DD 2IW3A 4YIJA 1SNPA 1EEID 3M7GA 1UAPA 3URYA 4HEDA 2R61A 2WIIB 1I4PA 4LK1C 4QF4A 1ICWA 3VA7A 4X3KA 3SK8A 2PW7A 1BF4A 4Y7NB 1U4PA 3PV0A 1F9PA 5T1GA 1QWYA 1QJOA 2F0VA 3GTJB 3I73A 5C3XA 4IUPA 4L6TB 2XRSD 3G7LA 1TIID 2M9VA 3DXJC 2XSCA 2A68D 3GQBA 3PUYA 3GTLB 5KEEA 2PMZB 2NB0A 2E2DC 3AMUA 2MUYA 2ZXPA 3TBIB 4PQXA 1KLGD 2BCOA 1EY5A 2EJFC 2QKIC 3CRKC 5M5XB 3W3AA 2AUJD 1TS2A 5CMDA 1RKNA 2JYOA 4B08A 3PIO3 1SJHD 5IGBA 3A8JE 3S15B 3O13A 3FKIB 2CVRA 2RVLA 3Q0AA 1XTCD 2A6EC 4CJ0B 2XNAC 5C44B 4A3MB 1WCMB 5C4JB 1STAA 5KNDA 1D1IA 4RHRA 3TP5A 4L63B 3BVMA 4FYDA 1GXDC 1RJTA 2B2VC 2F0TA 5FKAC 1Y8OB 3S1NB 1G91A 2NBFA 1WTWA 5DEHA 4ILWA 2RDFA 4EQOA 5M9OA 5D65A 2WB1B 1JICA 3C3LA 1B3AA 5EGTA 1V1PB 2IPKD 1ESFA 1NSNS 4CJ1B 3IFTA 1I4XA 2VUMB 2X6GA 1UNSA 2HUGA 5TSSA 1I3QB 1ONLA 3OMCA 3SE0A 1LTGD 2B2VA 1TKWB 3MC0B 2NWGA 3VYUA 1FNUA 2O5JC 1ILQA 2SEBD 5I2XA 5J1ZA 3VYTA 1H9SA 3MFGA 2F0UA 1T5XD 1DOLA 1LT5D 4QCLA 2A69D 1CA6A 5E4XA 3GTMB 3LX0A 4KJNA 1QNUA 3FPPA 4OO1H 1SYGA 4DA2A 3KLSX 4BA2I 2IX0A 1DCZA 3I4LA 1VCIA 4X3SA 4ZKBB 1BQQT 4K5XA 1JWSD 2BOSA 4DU9A 4DAYA 4BBSB 1EY0A 5ELEA 2O5IC 3S1QB 5K36G 5C4XB 2K01A 1OXSC 3NQIA 2A6HD 5LL6S 1A3VA 1D5ZC 4K2KA 3J81E 1Y69U 3KK7A 1RF2D 3JAML 3VR4A 4CJ2C 2VB3X 3CRLC 4XYOA 4HN7A 2Z8LA 1Y8NB 4XT3B 3HEJA 4XIGS 2JP1A 1Q1EA 4ZRZA 4S3SA 2Z4IA 2JSOA 3SR1A 5DM63 3NXWA 3SK5A 2RA4A 2KCNA 2R93B 2F3WA 4KI0A 5IODA 4QUFA 1G6ZA 2XN9C 2ICEC 3NSWA 1EY7A 1EYDA 2RKSA 1VF5C 4Q5VA 3MFYA 5CGKA 1PYWD 4HCEA 3GTOB 1GHKA 2NVYB 2OXPA 3D4DA 2RSNA 3HGBA 4ID6A 3M85A 4FO2A 2KCCA 3MTSA 3P7JA 2F0NA 3VR3A 1SE2A 3HS0C 1LTID 1QOHA 3H91A 3MWYW 5C4ZA 3LWUA 1OXXK 4BY1B 2VXWA 5IOCA 2SOBA 4A3JB 1BR9A 2B8GA 1SSOA 1IYVA 3NWTA 5JVG3 1FD7D 4FNFA 3DWQA 1LACA 1DONA 2EDGA 2F0WA 4ZLTF 4K8IA 1PXUA 1CK1A 1JWMD 2QCPX 1XWEA 3FMCA 1TU2B 3SEBA 3M4OB 1PMRA 1S5FD 4XT1B 2PCFB 3FRPB 1CA5A 1TY2A 2PYKA 1Q3LA 4KN4C 4OO1G 1EZ8A 1EOTA 3HG9A 3S14B 1U4LA 2NTSA 1DD2A 3OWFA 1CHQD 1FR3A 2WKDA 3HKZB 2PZTA 1IHZA 3CU7A 5IT9E 1SMYD 2PNRC 1LT4D 3RLFA 2C9OA 2L9HA 1SYDA 3VA5A 2EY2A 2AWOA 2F03A 3D3RA 4K6DA 2QILA 3MXPA 4A3EB 1B1ZA 1DOMA 3HP3A 2NVXB 1RTNA 4NP5A 3GO5A 4EQNA 1BCPD 1AFPA 1G291 1ZXTA 4TKOB 4IALA 2O2LD 5A35A 5JAVA 3NUCA 4IN3A 5EKIA 1D5XC 2RSOA 5D14A 1Z7TA 5D3IB 1L0XB 2FMCA 3EA6A 4WFN3 2B8FA 1LTBD 1YNJC 1IKMA 3U9OA 4ZAIA 1GUSA 1CFMA 2L4NA 4G7HC 2IX1A 2K32A 3K5LA 1E2VA 5C4HA 3ND9A 4LMQD 4KKTA 4WJWA 1HQMC 3MZ5A 1JQYD 2EYPA 1F2LA 3FVQA 4XXEA 5I9OA 2MP1A 5ELCA 5CORA 4I65A 1H9JA 5EPLA 4CHTB 4XDXA 5FLXE 3NWSA 1ET9A 5C3EB 4ZUJA 3R8BA 1PZID 4IUNA 1EY6A 2J7ZA 1IW7C 4EQPA 1IL8A 3OWEB 3D6WA 2D2CC 3SDZA 1GUOA 4WORA 1I4HA 3D4WA 1SNQA 5JEAG 4G4KA 2EY1A 2XWBB 2K03A 4R9WA 2FMMA 3T56B 4OGQC 2XVSA 1O80A 4DK0A 4JK1C 3E6ZX 4I7ZC 1T5EA 4OL7A 3GTGB 3IKJA 3I72A 5EPJA 1WTXA 1JWUD 2DN8A 3I3CA 3NQTA 1VDZA 2E2HB 3OOCA 2WP8J 4ULLA 5C0XI 2HQEA 4A3DB 3KBGA 1E0BA 5KRUA 5AFWA 2BA0A 1LTRD 1SE4A 3PIP3 3HOXB 1I4GA 3H09A 3RZDB 4RH6A 1AZPA 3PO3B 4N9PA 4R8NA 2HDMA 5HURA 1SFOB 3S17B 2B2TC 4RAUC 1MD2D 2B63B 2FINB 1Y8PB 2RDGA 2F0EA 2DNCA 4DNRB 3N6RA 5DM73 4QIWB 3L7ZC 2X6LA 1KDBA 1X3PA 2MGSA 1ZEQX 3BZDB 2J4XA 5BN5A 1EQTA 5EBCA 3FDTA 3C2PA 5EBDA 1UEAB 3QB3A 1ZKOA 4P2CB 3V96A 4J1MA 4C3IB 4C3IG 5BN3A 3S1RB 3OIPA 1QB5D 2EJMA 5CYUA 2B2TA 1D6EC 2K6AA 4HCSA 1BBXC 5CV9A 1R4PB 5C3WA 2C5CA 2YU9B 2DNEA 3J80E 2IT1A 4OIKA 5IGFA 3A7AB 5I6YA 3VR6A 2A6ED 3TZUA 5J39A 1LLRD 3HOYB 3HRZC 3X3NA 1V1PA 4B9WA 3GV6A 1QCBD 4K2LA 1PZJD 3DEOA 4CKCA 3QG1A 1B53A 4KHZA 1TWAB 5FK9C 2AQ3B 1PRTB 2F4IA 3H3VC 4ME5A 5EQ0A 1SE3A 3A56A 2DY8A 4DF7A 3K5OA 4XQNA 2E75C 3CQZB 3VR5A 3OHXC 3TP6A 2OEOA 3MXNA 1PTOB 3R2TA 1WTQA 1JOQA 2WKCA 4DAPA 4RCNA 1ESRA 5M3FB 2A68C 4A3GB 2G9HD 1KDAA 3KF8A 5D3DA 5IT9L 1IYUA 5CV6A 2JEAI 3RZOB 3NBIA 4N9TA 3K5MA 4ZKCB 4HTHA 5C5MA 1FYCA 2FHTA 1LTSD 3TMEA 4F88A 2JA7B 2F0MA 4PNYA 2EYHA 4E6IA 2M00A 2LS01 2R3ZA 2Z4HA 4HR7B 1G2TA 2D9UA 2E2JB 4F7XA 4A3BB 1H9KA 4J8QA 4K5VA 2D5DA 5CC4A 5IGCA 3I4NB 1KABA 4C56C 2FFKB 3ZYYX 2KVMA 5COYA 4C1NI 2R6GA 5EJWA 4K8JA 1WD0A 2PPBC 2Q8TA 4G57A 1GOZA 3H0GB 4BBRB 3E0JA 4BY7B 1I50B 3J7AF 5CV5A 3DWAA 4KTAA 1KAAA 1D5MC 3K6OA 2F1MA 1W6KA 1WTRA 4KMUC 4EGVA 2KOLA 2B2WC 1EEFD 3HOWB 3I70A 3S2HB 2LFNA 3GTKB 1CTMA 3SK6A 1PFBA 1MI2A 4KY6A 3RUZA 3HOVB 5CBEE 1B9MA 1SXTA 1DOKA 2KEDA 4CBVA 1SDFA 2K05A 4KKUA 5C0XJ 4F87A 2L55A 1CT1D 1HFNA 4HSVA 4KD3A 1EZ6A 4G7OC 3KBXA 2NVQB 3M4YA 3WDNA 4PMWA 2EYLA 4KJOA 2TMPA 4M1UB 1EIGA 4AYBB 4IQZA 3EROA 2JE6I 4MIUA 1TY0A 1DJRD 1NUCA 2CW0C 2IX3A 1HTPA 3P75A 4H13C 3QOLA 2ZXRA 4ABNA 1I4RA 1SYFA 2OF1A 4O42A 1C4QA 1KLUD 2K5DA 5J22A 5EKLA 4KY7A 1EYAA 1VMPA 1Q1BA 2ZXOA 4K5WA 1CQVA 2B2YC 2NN6H 3PUVA 3GD7A 3KUPA 5C6AA 3I4MB 1V43A 4KN7C 5KYIA 2BDNA 2AUKA 1PFMA 3A55A 2BE5C 5K5PA 3DMUA 2MJ8A 1C8CA 2NYZD 1SYCA 1X32A 4X3TA 4NDXA 2B2YA 2KJXA 2Q8RE 3D8GA 5FO9B 4O1NA 5M5WB 3CHBD 3J80L 2PZUA 1Z47A 2NN6I 3ONAB 4A3IB 2QF7A 2EJGC 2NTTA 3PUWA 1I4QA 2F0DA 3LNNA 4IFDI 3QOJA 4K14A 2OT2A 5KGUA 2EPBA 3HOZB 2WINB 5T1IA 2SDFA 1EYCA 1KNEA 2L0CA 4PMBA 4H7BA 2ENBA 1QE6A 4MHEA 2WACA 2K1BA 2F0SA 3OMGA 2I07B 2B2UC 3ND8A 1TWFB 5LHY1 1HFGA 3NK9A 4IZ8A 1C48A 4U68A 2N88A 1B4OA 3TN2A 1B9NA 2H1EA 2VB2X 1IKLA 4FXDA 2LMCB 2B39A 1O7LA 4DXGA 4RKLA 4FF2A 2RQXA 2XRQD 3TP8A 2XIWA 1B2TA 1M4VA 1A2TA 2A73B 2G9DA 3PMFA 5I6WA 1HQRD 1HUMA 4FF4A 1JR0D 1H9MA 3M7NA 1DZ1A 4KKSA 3T13A 4XTCS 1PDQA 1HA6A 4TRDA 1TS5A 2B2UA 2BDOA 1F9RA 1XXGA 1IW7D 2KA7A 2K5WA 4G7ZC 1BO0A 1O78A 3K7AB 1JE4A 1HA5A 1PRTF 2EOTA 4BS9A 3PUXA 1GUNA 2LY7A 4B9XA 2PZWA 3BVZA 5BN4A 3S9WA 4RGNA 5C0XH 4NMZA 1PTOF 1GUWA 3TZDA 3GTQB 2F0IA 2E74C 2J0TD 4FF1A 1Z6HA 4JBWA 5I9PA 1VF7A 4ZK9B 2JA6B 3I8ZA 5G3LF 4RGOS 2F0QA 3Q6SA 1NR4A 2CQAA 3IL8A 4FXKC 1RD9D 2K7VA 2KECA 3WOFA 3R2IA 4RCOA 5CV4A 4Q0FA 1BNZA 1CI3M 4LJZC 1FNVA 4ODGA 3JAME 3VYSA 2EXZA 1TWCB 5M5YB 2KEEA 1PRTC 1LT6D 1II3A 3BYTB 1ZYRC 3Q23A 2KHSA 1EFID 3J81L 1GUGA 4XQJA 4PV1C 1XX8A 2R92B 1PTOC 3SHLA 1A3UA 1ML0D 1SAPA 5CV7A 1SBBB 1S5ED 2HDLA 1EU3A 3EQLC 2E76C 5JPMC 4IURA 1F2YA 1MGSA 3SK4A 1CZWA 3N52A 1WVLA 2NVTB 4KV6A 3NBHA 2DY7A 1K8OA 1DYQA 5JOBA 1SNCA 3DHQA 4XQQA 1HHVA 3Q24A 1SNDA 1CQFA 1BOSA 3R3OA 1BCPB 5ISRA 3IFDA 4ZYSA 4NKLA 3PUZA 5IGDA 5IGEA 3C1EA 1YNNC 5FOBB 3MXGA 2JEBI 4KK7A 1JC7A 2N55A 1STHA 4FP5D 2F0GA 3S16B 4ZQ3A 1WD1A 2MPMA 1CZGA 1D2BA 5A2QE 1G2SA 5KNBA 5C0XG 1NAPA 3MVVA 3G6JB 1HUNA 3ITPA 1UUPA 4HMIA 5CBAE 1ILPA 4OHJA 2F0PA 5M3MB 2O4XA 3I91A 4OIJA 5ELBA 4IFDJ 2KUMA 3QO2A 2ID0A 1FNWA 3RD4A 2K33A 2RDHA 3NTHA 1OXUA 5EKKA 5CV8A 5K36H 4RHSA 1LTTD 1PFNA 4H0LC 5IIFA 3AB9A 4IUTA 1WTOA 3HZXA 2L1BA 3NE5B 1JB3A 3D6CA 4PMCA 3A54A 3TDQA 1OO9B 1I6HB 3W2DA 3BVGA 4CKBA 1JORA 4DFAA 3SVMA 5JEAJ 1EQVA 3K58A 1JCKB 3EFXD 1PZKD 1EY9A 1K8MA 1F2ZA 3BDLA 3T16A 2QEJC 2F0LA 1NCVA 5ELFA 2M2LA 1SNOA 4EVOA 3FPUB 3IAYA 3K57A 2I46A 2EYOA 1OXVA 3GP7A 1F2MA 1OXTA 3D4RA 1RODA 2PW5A 3C1FA 2K28A 1LABA 4BA1I 4DN4M 5F2DA 2PO4A 2V4DA 1MBYA 2SNMA 4FF3A 3MHBA 2EY5A 4J6HA 2EYFA 4U673 4QUCA 1F9QA 3EVQA 1V1OA 1KDCA 3QWNA 3UI2A 2L5TA 2EE1A 4RA8A 1D1KA 1QG7A 4H44C 1STYA 3P20A 2ZT9C 3QJYA 2KQ3A 2LKVA 4GZYC 4UAIA 5FLXL 1X3QA 5E4WC 4RGMA 1NR2A 4A93B 1LT3D 1STBA 4HAEA 2IJ0A 4RKBA 1EWCA 1U4MA 4F8MA 2L11A 4KD4A 5CR3A 5HGTA 2CW0D 3R93A 2Q8IB 1ENFA 3L9AX 1EWHA 3M3YB 3F2UA 4A3KB 3DUZA 1RTOA 2B2WA 3QIAA 3BS1A 2XWJB 2A69C 1A3TA 4C3JB 4C3JG 1S5CD 4DAVA 3OSOA 2L12A 1GJXA 1AN8A 2AQ1B 4M8AA 3WOEA 1SYBA 2EYMA 1EIHA 3T51B 4XYQA 2F0FA 3RMHA 2EY6A 1Q90A 1AW7A 1H9SB 1QILA 3MEHA 2YYZA 3MAQA 1E2ZA 4L8JA 4OO1I 2BE5D 1MSHA 3EJIA 1TVXA 3NTIA 3NTKA 3FEWX 2VNUD 1MSGA 4QB4A 3K59A 1CHPD 3H6MA 1QNKA 4DNTB 5FO8B 4A3FB 2A6HC 1O7ZA 1B50A 4KHVA 4RGTA 4HSPA 2K04A 2WAQB 4WRDA 3K5NA 3VR2A 4IFDH 3KLSA 3VYRA 2EZVA 1TT2A 2GA4B 1M8AA 2ICIA 4IUUA 1RDPD 5EPKA 5JJZA 3TP7A 4RWSC 2QDBA 1EL0A 2FJ2A 2AWNA 2CHBD 1AZQA 2EYJA 1AEXA 2F0HA 5E1FA 2R7ZB 3MXUA 1U4RA 1AP0A 3J7AV 1SJED 3LWEA 2E2IB 1S4ZA 1EU4A 2AQ2B 2TSSA 1O7YA 1TR5A 1F9SA 4QMGA 1RCVD 1STEA 3T53B 1JOOA 3Q22A 1R9TB 4FVMA 4CKEA 3BDCA 1LV9A 1A2UA 2Z1CA 2H4OA 2BA1A 1S5BD 5JEAH 1L0YB 5A2QL 1WTPA 3HOUB 5FO7B 4C3HB 5LL6X 4C3HG 1STNA 5DNFA 4IUQA 1TWGB 4UDUC 1R4QB 2PQEA 3E5SA 1EY4A 2JA8B 3GV3A 5KIXA 2MHVA 4C1NK 4FXGC 3V2TA 1BCPF 2IWHA 5JVH3 3A8KE 2F0OA 1YNJD 2EVBA 3X3MA 1W6JA 4MN3A 5I2YA 3CKIB 4K6LA 1H9RA 4C2MB 3ERQA 1E2WA 1ENAA 3BYYB 2HCIA 3DM1A 1ET6A 1DM0B 3I90A 4V190 5DAUA 1G8ZD 4CGYB 1CM9A 1HTLD 2NUCA 1HRJA 1SMYC 1WTVA 1TS4A 4IUVA 1HCZA 3P1HA 3OPOA 4HMJA 4TSSA 3TSSA 3BDOA 3S2DB 1ENCA 3SXHA 1SNMA 1B44D 1BXTA 2A5HA 2SNSA 4Z9CB 5I4DA 1I6VC 5KNCA 4BWGB 2NN6G 3D31A 5NUCA 1KNAA 2A74C 1STGA 3MA2B 4IFDG 5E3FA 4DK1A 3NP8A 4ZUIA 1SEBD 1LTAD 1BCPC 1HXYD 1V8QA 1K83B 1BDOA 2Y0SB 1Q12A 3DEPA 2F0KA 1A15A 4TQUS 1Y1WB 2X69A 3A8IE 1PRTD 3L3OC 4DGZA 5KYLA 2WV6D 4RFBA 1Q8IA 4V0BA 1TS3A 1ZYRD 1SYEA 1DXMA 1PLFA 3OW7A 3C46A 3V05A 3AU7A 1EY8A 3NPPA 4DXFA 1JOKA 1PTOD 1RHPA 1A6XA 4LAAA 2F0JA 3NHHA 1Y1VB 1XYIA 1GHJA 2D62A 3T4AC 3S1MB 4NW2A 3PO2B 1F77A 1TWHB 5G3LD 2JXMB 5C5LA 1U9RA 1HPCA 1PTOH 5ELDA 2JA5B 3BG3A 3OIQA 2NZ1D 4KY5A 1J9OA 2HCCA 3DWPA 3K0YA 4X3UA 1FGBD 1GUTA 3U9SA 2IL8A 3A7LA 1KTKA 2K5QA 4R8IA 5IGGA 5JPNC 3GTPB 2RBMA 1YNND 1TQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J8I A;  5T1I A;  2SDF A;  4ZK9 B;  3MWY W;  1KNA A;  1KNE A;  1VMC A;  1ZXT A;  2FFK B;  3H91 A;  2KVM A;  5COY A;  1LV9 A;  3I8Z A;  2VXW A;  1QE6 A;  2CVR A;  4MHE A;  5EPJ A;  3Q6S A;  2L12 A;  2RVL A;  1WTX A;  1NCV A;  1SSO A;  2K1B A;  3I3C A;  2M2L A;  1NR4 A;  5EJW A;  1WD0 A;  4CJ0 B;  5EKI A;  2B2U C;  4X3S A;  2Q8T A;  2RSO A;  4ZKB B;  3IL8 A;  2N55 A;  4O42 A;  1WTP A;  3GV6 A;  5D14 A;  3DEO A;  4HED A;  1EIH A;  3FPU B;  5DNF A;  1B53 A;  1HFG A;  4U68 A;  4IUQ A;  1DON A;  1VMP A;  2KEC A;  3DEP A;  2N88 A;  1E0B A;  1B4O A;  1A15 A;  5AFW A;  5EQ0 A;  3TN2 A;  2H1E A;  2MPM A;  1WD1 A;  1IKL A;  2X69 A;  1BNZ A;  2K01 A;  4ZLT F;  2DY8 A;  1RJT A;  1ROD A;  2B2Y C;  1ICW A;  2B2V C;  1G2S A;  1WTR A;  1IKM A;  1NAP A;  2KOL A;  3GV3 A;  2B2W C;  2K28 A;  2XIW A;  4ZAI A;  1B2T A;  4X3K A;  1MSH A;  1AZP A;  1HUN A;  2L4N A;  3KUP A;  1TVX A;  5CBA E;  1PLF A;  1ILP A;  1G91 A;  4DN4 M;  1BF4 A;  2KEE A;  1U4P A;  1MSG A;  1HUM A;  2HDM A;  1WTW A;  2B2T C;  4RAU C;  1QNK A;  1F9P A;  2BDN A;  3I91 A;  4LMQ D;  4OIJ A;  4XT1 B;  2FIN B;  5T1G A;  1WTQ A;  1PFM A;  2KUM A;  3QO2 A;  4CJ2 C;  1O7Z A;  1CA5 A;  1PFB A;  1B50 A;  1DZ1 A;  1MI2 A;  4MN3 A;  1F2L A;  5D65 A;  4IUP A;  4QUC A;  1F9Q A;  1Q3L A;  1JIC A;  1ESR A;  1RHP A;  4XT3 B;  1EOT A;  1PDQ A;  2MP1 A;  1B3A A;  1HA6 A;  2X6L A;  5CBE E;  4CJ1 B;  3UI2 A;  1X3P A;  2K04 A;  2MGS A;  3G7L A;  1U4L A;  2JP1 A;  2B2U A;  2MJ8 A;  1DOK A;  2EE1 A;  2KED A;  4RA8 A;  5COR A;  1F9R A;  1PFN A;  1QG7 A;  5EPL A;  4XDX A;  1C8C A;  2NYZ D;  1XYI A;  2X6G A;  1EQT A;  1BO0 A;  1XX8 A;  2HUG A;  3FDT A;  1G2T A;  2HCI A;  1SDF A;  4NW2 A;  1JE4 A;  4ZKC B;  2K05 A;  1X32 A;  1ML0 D;  4IUT A;  1WTO A;  2RA4 A;  1SAP A;  2FHT A;  1M8A A;  2L1B A;  3DM1 A;  2HDL A;  2EOT A;  4X3T A;  4UAI A;  4QUF A;  2B2Y A;  2B2V A;  4IUU A;  2J7Z A;  2Q8R E;  1X3Q A;  5E4W C;  3I90 A;  1HFN A;  2NWG A;  1IL8 A;  4HSV A;  1G6Z A;  4IUR A;  2L9H A;  1MGS A;  5EPK A;  5JJZ A;  4RWS C;  2NZ1 D;  1NR2 A;  3D6W A;  1ILQ A;  3KBX A;  3N52 A;  1WVL A;  1CM9 A;  2FJ2 A;  1EL0 A;  4HAE A;  1U4M A;  2B2T A;  2DY7 A;  1J9O A;  4HCS A;  1WTV A;  1AZQ A;  2HCC A;  2K03 A;  1BBX C;  1HRJ A;  2L11 A;  4R9W A;  2R3Z A;  3ONA B;  4IUV A;  2FMM A;  1HHV A;  1GUW A;  4X3U A;  2RSN A;  1U4R A;  1DOL A;  1EIG A;  3R93 A;  2D9U A;  3TZD A;  2IL8 A;  1DOM A;  3SVM A;  1AP0 A;  1O80 A;  4R8I A;  1CA6 A;  3LWE A;  3HP3 A;  3MTS A;  4OIK A;  5CMD A;  1S4Z A;  3P7J A;  3F2U A;  2JYO A;  1O7Y A;  1RTN A;  1F9S A;  5E4X A;  2EPB A;  1RTO A;  3IFD A;  2B2W A; 
#chains in the Genus database with same CATH topology
 3KLR A;  4MZ9 A;  1J8I A;  2OQK A;  3H94 A;  1BUV T;  1LO5 D;  1VMC A;  2JA7 H;  4GOP B;  3J7Y W;  2F3V A;  1S5D D;  2IW3 A;  5IP7 G;  3BU2 A;  4YIJ A;  3CCU A;  1SNP A;  1EEI D;  3M7G A;  1UAP A;  5IYC H;  3URY A;  2R7D A;  2UXB Q;  3CC4 A;  1EIY B;  4DR1 Q;  2B63 G;  4HED A;  2R61 A;  5IYD G;  4LUV A;  1G6P A;  1L0W A;  2E2J H;  2WII B;  2VQF L;  4A3B H;  1I4P A;  4DAM A;  2KHJ A;  2QA4 A;  4LF9 L;  4LK1 C;  1XMQ Q;  4QF4 A;  3I4N H;  1JJC B;  1ICW A;  4YCV A;  3VA7 A;  4X3K A;  3SK8 A;  4JI8 Q;  2PW7 A;  2ZTC A;  1BF4 A;  4Y7N B;  1U4P A;  1CSP A;  3PV0 A;  1F9P A;  5T1G A;  1K8G A;  2F4V Q;  1QWY A;  1QJO A;  3W5O A;  1N33 L;  2F0V A;  4BBR H;  3GTJ B;  4FDB A;  3I73 A;  2MO0 A;  5C3X A;  4IUP A;  4BY7 H;  3PQI A;  2PQA B;  4L6T B;  1VQL A;  2XRS D;  3G7L A;  1TII D;  4GN3 B;  2M9V A;  1PHJ A;  3DXJ C;  4DPG A;  3CCV A;  2XSC A;  2A68 D;  3GQB A;  3S2H H;  1Q82 C;  3PUY A;  3E0E A;  3GTK H;  3GTL B;  1A63 A;  2KCT A;  2RF4 A;  2AHO B;  2PMZ B;  5KEE A;  2NB0 A;  2E2D C;  2DUD A;  3AMU A;  2MUY A;  4LUO A;  2ZXP A;  4YWL A;  3TBI B;  3HOV H;  4JYA L;  1W3S A;  4JBM A;  1LTL A;  4PQX A;  1KLG D;  2BCO A;  3I55 A;  1EY5 A;  1SE8 A;  2EJF C;  2QKI C;  4N8X 1;  1ASY A;  4I7A A;  3CRK C;  4PZ7 A;  2HQL A;  3W3A A;  5M5X B;  2AUJ D;  4QIW E;  2JN4 A;  1TS2 A;  1MJC A;  5CMD A;  1RKN A;  2JYO A;  4B08 A;  4DR3 Q;  3PIO 3;  1SJH D;  4O2D A;  5IGB A;  4DR4 L;  3A8J E;  3S15 B;  3KJP A;  4LF6 L;  2NVQ H;  4EQ5 A;  3O13 A;  5LMU Q;  1GKH A;  3FKI B;  2CVR A;  1E22 A;  3FKI G;  4JI2 L;  2RVL A;  3Q0A A;  1XTC D;  2A6E C;  4CJ0 B;  4LF7 L;  2XNA C;  5C44 B;  5C44 G;  4A3M B;  1WCM B;  5C4J B;  4A3M G;  1STA A;  4A3C G;  5KND A;  1CKO A;  5M3F G;  1D1I A;  1O7I A;  4X64 L;  4RHR A;  3TP5 A;  3STB D;  4L63 B;  3BVM A;  4FYD A;  5HY6 A;  1GXD C;  3RNU A;  2HIV A;  1RJT A;  2B2V C;  2F0T A;  1YJ9 A;  4JVZ A;  5FKA C;  3PIP A;  1K3B C;  1Y8O B;  2XTI A;  3S1N B;  2HIX A;  1GM5 A;  1G91 A;  2NBF A;  1WTW A;  5DEH A;  3ERS X;  4ILW A;  2RDF A;  1PH6 A;  4EQO A;  5M9O A;  3TS0 A;  1MJE A;  5D65 A;  2VZA A;  2WB1 B;  1JIC A;  3C3L A;  2WB1 G;  2JA7 G;  1B3A A;  5EGT A;  1V1P B;  1WFQ A;  2IPK D;  1ESF A;  1NSN S;  4CJ1 B;  3IFT A;  1I4X A;  2VUM B;  2QGQ A;  2X6G A;  1UNS A;  2HUG A;  5TSS A;  2OCE A;  1I3Q B;  1ONL A;  3AFP A;  1NMG A;  3OMC A;  2DGY A;  3SE0 A;  3I4M H;  1LTG D;  2B2V A;  1TKW B;  3MC0 B;  2NWG A;  3VYU A;  1K73 C;  1XNQ L;  1FNU A;  2O5J C;  1ILQ A;  2SEB D;  5I2X A;  1X54 A;  5J1Z A;  1PH8 A;  3VYT A;  2A8V A;  1QZG A;  1H9S A;  3MFG A;  4UPA A;  2F0U A;  4B3R Q;  1T5X D;  1A62 A;  1HH2 P;  2R7Z H;  4LFC L;  1DOL A;  1LT5 D;  4JI6 Q;  4QCL A;  1QUQ B;  2A69 D;  3H0G G;  3Q8D A;  1CA6 A;  3KF8 B;  5ELN A;  3E3X A;  5E4X A;  3GTM B;  3LX0 A;  4KJN A;  1QNU A;  3FPP A;  1A0I A;  1BBU A;  4OO1 H;  1SYG A;  5M5W H;  4DA2 A;  3HOW G;  3KLS X;  4BA2 I;  2IX0 A;  1DCZ A;  4B3M Q;  3I4L A;  4A3I H;  1VCI A;  4L5S A;  4X3S A;  4ZKB B;  1BQQ T;  4K5X A;  1E24 A;  1JWS D;  2BOS A;  5J3B A;  4DU9 A;  4DAY A;  4BBS B;  4BBS G;  3HOU H;  1EY0 A;  2PI2 E;  1VQH A;  4LW1 A;  5ELE A;  3HOV G;  2O5I C;  1YI2 A;  3S1Q B;  5K36 G;  5C4X B;  2K01 A;  3HOZ H;  1OXS C;  4DV0 Q;  3NQI A;  2A6H D;  4DV6 L;  5LL6 S;  1A3V A;  1D5Z C;  3U50 C;  4K2K A;  4OEL B;  3J81 E;  1Y69 U;  1QVC A;  3KK7 A;  1RF2 D;  1LYL A;  3JAM L;  3VR4 A;  4CJ2 C;  2VB3 X;  1JT8 A;  4X66 L;  1VQ8 A;  3CRL C;  4XYO A;  4HN7 A;  2Z8L A;  1Y8N B;  4XT3 B;  1J5E Q;  3HEJ A;  1KL9 A;  1H95 A;  4XIG S;  4NXN L;  2JP1 A;  3G4S A;  2UUB L;  2CH4 W;  1BBW A;  1KXL A;  1Q1E A;  4ZRZ A;  4S3S A;  1VQO A;  1PFS A;  2Z4I A;  1HR0 W;  2JSO A;  3FHW A;  3SR1 A;  5DM6 3;  3A5Z B;  1XTD A;  3NXW A;  3ULL A;  3SK5 A;  1SR3 A;  2Z0S A;  2EXD A;  2RA4 A;  2KCN A;  4JYA Q;  2R93 B;  2F3W A;  4KI0 A;  5IOD A;  4QUF A;  1UWV A;  1QZH A;  1G6Z A;  2XN9 C;  5AJ3 Q;  2ICE C;  3NSW A;  1VQ9 A;  1EY7 A;  1N9W A;  1EYD A;  2RKS A;  1VF5 C;  4Q5V A;  3MFY A;  5CGK A;  5IP9 G;  1PYW D;  4LF8 L;  4HCE A;  3GTO B;  1GHK A;  2NVY B;  3KLW A;  4DV2 L;  2OXP A;  3D4D A;  1VQD A;  2RSN A;  3HGB A;  4ID6 A;  3K7A H;  3M85 A;  4FO2 A;  2KCC A;  3MTS A;  3CC2 A;  3P7J A;  1KRT A;  2F0N A;  4JI2 Q;  3VR3 A;  4YY3 L;  1I94 L;  1SE2 A;  3HS0 C;  1M90 C;  1LTI D;  1CKN A;  1QOH A;  3H91 A;  3MWY W;  4OWT B;  4HJ7 A;  5C4Z A;  3LWU A;  1OXX K;  4BY1 B;  2VXW A;  2ATW A;  5IOC A;  2SOB A;  4A3J B;  1BR9 A;  2B8G A;  1SSO A;  2Z6B A;  1IYV A;  3NWT A;  1N36 Q;  4JCV E;  4LFA Q;  4X64 Q;  3I4M G;  3FP9 A;  4YHH L;  4OON A;  5IYB H;  5JVG 3;  1FD7 D;  4FNF A;  3GTQ H;  3DWQ A;  1LAC A;  1DON A;  2EDG A;  1WYD A;  1HNW L;  2F0W A;  3PF5 A;  4LF4 Q;  4ZLT F;  1YJW A;  1YHA A;  4K8I A;  2K5V A;  1PXU A;  1CK1 A;  1JWM D;  4ZCK A;  2JA6 H;  2QCP X;  2R7F A;  1XWE A;  3FMC A;  1TU2 B;  3SEB A;  3M4O B;  1PMR A;  2I0Q A;  1S5F D;  4XT1 B;  2PCF B;  1AE2 A;  3FRP B;  1CA5 A;  1TY2 A;  2PYK A;  1Q3L A;  4KN4 C;  2OWO A;  4OO1 G;  1EZ8 A;  1EOT A;  3I2Z A;  3HG9 A;  3S14 B;  1U4L A;  5GAD C;  3I56 A;  2NTS A;  3ULJ A;  1DD2 A;  3OWF A;  1CHQ D;  1FR3 A;  2WKD A;  4A3I G;  3HKZ B;  4QL5 A;  3HKZ G;  2PZT A;  1IHZ A;  1XNQ Q;  1TWC H;  1E1T A;  5M5Y H;  3CU7 A;  5IT9 E;  3CCM A;  1SMY D;  2PNR C;  1LT4 D;  3RLF A;  2UU9 L;  1WI5 A;  2V1C C;  2C9O A;  2L9H A;  1SYD A;  3VA5 A;  4LFC Q;  2EY2 A;  2AWO A;  1X55 A;  2F03 A;  3D3R A;  4K6D A;  2QIL A;  3MXP A;  4A3E B;  1VQF A;  4A3E G;  1B1Z A;  3UDF A;  1DOM A;  2R92 H;  2BH8 A;  4GKJ L;  3HP3 A;  2NVX B;  1CSQ A;  4NPS A;  1RTN A;  4NP5 A;  3GO5 A;  4EQN A;  2CWA A;  3GTP H;  1BCP D;  1VQ6 A;  4KHP L;  1AFP A;  1J6Q A;  1G29 1;  1IXR A;  1ZXT A;  3J7Z C;  4TKO B;  4IAL A;  2NVT H;  1YEZ A;  2UUA Q;  2O2L D;  1X3E A;  5A35 A;  5JAV A;  3NUC A;  4IN3 A;  3CPF A;  5EKI A;  1D5X C;  2VY3 A;  2RSO A;  3CCQ A;  2VL6 A;  5D14 A;  5FJ8 G;  3T1Y L;  1Z7T A;  3CCL A;  5D3I B;  1L0X B;  1WTH A;  2FMC A;  3EA6 A;  4WFN 3;  4RMF A;  2B3G A;  2B8F A;  1LTB D;  4IJH A;  1YNJ C;  1L1O B;  1IKM A;  3U9O A;  4ZAI A;  1GUS A;  1CFM A;  2L4N A;  4G7H C;  4JI3 Q;  2K32 A;  2IX1 A;  4JI7 Q;  3K5L A;  1FJG L;  1E2V A;  4A3L G;  5C4H A;  2QW7 A;  3ND9 A;  4LMQ D;  4KKT A;  2KHI A;  4WJW A;  1HQM C;  3MZ5 A;  1JQY D;  2EYP A;  1F2L A;  2EIF A;  3FVQ A;  4XXE A;  5I9O A;  2MP1 A;  5ELC A;  4DK6 C;  4JV5 L;  5COR A;  4LNQ A;  4I65 A;  1H9J A;  5EPL A;  4CHT B;  2EQS A;  4XDX A;  5FLX E;  3NWS A;  1ET9 A;  3AQQ A;  5C3E B;  5C3E G;  4ZUJ A;  3AFQ A;  3R8B A;  1IZ6 A;  3OYY A;  2N3S A;  1PZI D;  4GOP A;  4IUN A;  1UE6 A;  1L2F A;  1MHW C;  2VQE L;  3LGJ A;  1EY6 A;  4DV3 L;  5M3M H;  1JB7 A;  2J7Z A;  1IW7 C;  4EQP A;  1IL8 A;  4DV2 Q;  4P75 A;  3OWE B;  3D6W A;  2D2C C;  3SDZ A;  4YWK A;  1GUO A;  3UDI A;  4WOR A;  3CCR A;  2JA6 G;  3D4W A;  1I4H A;  1SNQ A;  5JEA G;  4G4K A;  2EY1 A;  2XWB B;  2K03 A;  4R9W A;  2FMM A;  3T56 B;  1IL2 A;  4YY3 Q;  2VW9 A;  4OGQ C;  2XVS A;  1O80 A;  4DK0 A;  4JK1 C;  3E6Z X;  4LFB Q;  4DNI A;  4I7Z C;  4GLX A;  1T5E A;  2ALY B;  4OL7 A;  4UP7 A;  4YHH Q;  3CXC A;  3GTG B;  1I6H H;  3IKJ A;  2PNH A;  3I72 A;  1VQ5 A;  2PQA A;  5EPJ A;  4RG1 A;  1WTX A;  1JWU D;  2DN8 A;  3I3C A;  4P73 A;  1PH4 A;  1HNW Q;  3NQT A;  1YIJ A;  1VDZ A;  2E2H B;  2KBN A;  2WP8 J;  3OOC A;  4ULL A;  5C0X I;  2HQE A;  4A3D B;  1D8L A;  4A3D G;  3ULP A;  4YWM A;  3KBG A;  1FVI A;  2CFM A;  1E0B A;  5KRU A;  4LF5 L;  5AFW A;  3F2D A;  2BA0 A;  1LTR D;  1SE4 A;  3PIP 3;  3HOX B;  1I4G A;  3HOX G;  3JAM c;  3H09 A;  3RZD B;  4RH6 A;  1HNZ Q;  1AZP A;  3PO3 B;  1VQN A;  3PO3 G;  4N9P A;  3JAM i;  4R8N A;  2HDM A;  1VQE A;  5HUR A;  1SFO B;  3S17 B;  2B2T C;  4RAU C;  1HZB A;  1MD2 D;  4R1J A;  2B63 B;  2FIN B;  4GLA C;  5EAY A;  1Y8P B;  2RDG A;  4X62 L;  2F0E A;  2DNC A;  4DUY Q;  5DM7 3;  3N6R A;  4DNR B;  4QIW B;  3L7Z C;  2X6L A;  1VQM A;  1KDB A;  1X3P A;  2MGS A;  3K7U C;  5GAE C;  1EQR A;  1ZEQ X;  3BZD B;  2UUC L;  4H02 A;  2J4X A;  5BN5 A;  2UU9 Q;  1EQT A;  5EBC A;  3FDT A;  3C2P A;  5EBD A;  1W2B A;  4BXX H;  2YTV A;  3K81 C;  2RHS B;  1UEA B;  3F2C A;  3QB3 A;  1ZKO A;  4P2C B;  1K8A C;  2Z6K C;  3V96 A;  4IOC A;  4J1M A;  2E5L L;  4C3I B;  4C3I G;  5BN3 A;  3S1R B;  1XJV A;  2MNA A;  3OIP A;  1QB5 D;  1VQG A;  1M1K C;  1XPU A;  2EJM A;  5CYU A;  2B2T A;  1D6E C;  2K6A A;  4HCS A;  1HZC A;  1BBX C;  5CV9 A;  1R4P B;  2GVA A;  5C3W A;  2C5C A;  1GVP A;  4X65 Q;  2ASB A;  3DM3 A;  1IBL L;  4KHP Q;  2YU9 B;  5BR8 L;  5ELO A;  2DNE A;  4CDF C;  3J80 E;  2IT1 A;  4OIK A;  1U5K A;  3EBE A;  4CDC C;  5IGF A;  4MTN A;  4DR2 L;  1PH7 A;  3A7A B;  5I6Y A;  1EOV A;  3VR6 A;  2A6E D;  3TZU A;  5J39 A;  1LLR D;  3HOY B;  3HOY G;  4A93 H;  4APV A;  3S24 A;  3HRZ C;  3SGI A;  3X3N A;  2Z6K A;  2YV5 A;  1V1P A;  5LMN L;  2PI2 A;  4B9W A;  3BZK A;  1KIX A;  3GV6 A;  1QCB D;  4K2L A;  1PZJ D;  3DEO A;  4CKC A;  3QG1 A;  3K80 C;  1B53 A;  4AQY Q;  4KHZ A;  1PVO A;  1TWA B;  3NBH B;  5FK9 C;  2AQ3 B;  1PRT B;  1E3P A;  2F4I A;  3H3V C;  3M3Y H;  4ME5 A;  5EQ0 A;  1FJG Q;  1SE3 A;  4A3K H;  3A56 A;  2UXC Q;  2DY8 A;  4DF7 A;  3K5O A;  4EX5 A;  4OXP A;  4R4I A;  4XQN A;  2E75 C;  4GNX C;  4C3J H;  4ALP A;  4JI5 L;  3CQZ B;  1TXY A;  3VR5 A;  3OHX C;  1XMO L;  1JJG A;  1VQ4 A;  3K8A A;  3TP6 A;  4CDD C;  2OEO A;  1Z9F A;  3MXN A;  3R2T A;  1PTO B;  1WTQ A;  1JOQ A;  2WKC A;  4DAP A;  4RCN A;  1QUQ A;  1ESR A;  5M3F B;  2A68 C;  2ZTE A;  4A3G B;  4A3G G;  2G9H D;  1KDA A;  3KF8 A;  4OX9 Q;  5D3D A;  5IT9 L;  2VQE Q;  2N49 A;  4L5T A;  4Y52 H;  1IYU A;  4DV3 Q;  5CV6 A;  2JEA I;  3RZO B;  1CKM A;  3NBI A;  4N9T A;  3K5M A;  4ZKC B;  4HTH A;  5C5M A;  1FYC A;  2FHT A;  2RHQ B;  1LTS D;  2VS1 A;  2C35 B;  3TME A;  4A3F H;  3A5U A;  4GNX A;  1KD1 C;  4F88 A;  2JA7 B;  1UE5 A;  2F0M A;  4PNY A;  4POF A;  2EYH A;  4GS3 A;  4E6I A;  2M00 A;  2LS0 1;  1VQJ A;  5IYC G;  2R3Z A;  2Z4H A;  4O0A A;  1UEB A;  4HR7 B;  1G2T A;  2D9U A;  3CPW A;  2E2J B;  4F7X A;  2K52 A;  1EFW A;  4A3B B;  1H9K A;  4J8Q A;  4K5V A;  4A3B G;  2D5D A;  5CC4 A;  4B3T L;  4DV7 L;  5IGC A;  3I4N B;  3I4N G;  1KAB A;  4C56 C;  2FFK B;  3ZYY X;  2KEN A;  2KVM A;  5COY A;  4C1N I;  3MXN B;  3GDE A;  2R6G A;  3U4Z A;  4LF5 Q;  5EJW A;  4K8J A;  1WD0 A;  2PPB C;  2Q8T A;  4G57 A;  1GOZ A;  3H0G B;  4N8F A;  4BBR B;  4BBR G;  4P72 A;  3E0J A;  4BY7 B;  4BY7 G;  1I50 B;  3J7A F;  2E2I H;  5CV5 A;  3DWA A;  4KTA A;  1KAA A;  4HJ5 A;  1D5M C;  3K6O A;  2F1M A;  4JI0 L;  1W6K A;  1WTR A;  4KMU C;  4EGV A;  2KOL A;  2B2W C;  1R9T H;  1EEF D;  1NBW A;  3HOW B;  3I70 A;  3S2H B;  2LFN A;  2VQF Q;  3GTK B;  5E7N A;  1CTM A;  4LF9 Q;  4GNX B;  1N34 L;  3SK6 A;  4YCU A;  1KQS A;  1PFB A;  2NZH A;  4C3H H;  1MI2 A;  4JW0 A;  4KY6 A;  3RUZ A;  3HOV B;  4IPD A;  1FL0 A;  1TWG H;  5CBE E;  1S3O A;  1B9M A;  1VQK A;  1SXT A;  1DOK A;  3WWV A;  2KED A;  4JI4 L;  1N33 Q;  2JA8 H;  2ZJP A;  4CBV A;  1SDF A;  2K05 A;  4KKU A;  4IOA A;  3CD6 A;  5C0X J;  3I7F A;  1XNR L;  4F87 A;  2L55 A;  1CT1 D;  1HFN A;  4HSV A;  4KD3 A;  1EZ6 A;  4G7O C;  3KBX A;  1IBK L;  2NVQ B;  3M4Y A;  5BR8 Q;  3WDN A;  3PSI A;  4PMW A;  2EYL A;  4DR2 Q;  4KJO A;  3T1H L;  2TMP A;  1YHQ A;  4C2M H;  4M1U B;  1EIG A;  4AYB B;  4IQZ A;  4AYB G;  3I4O A;  3KFU A;  1N32 L;  3ERO A;  2JE6 I;  2DJF C;  4MIU A;  1TY0 A;  1DJR D;  1NUC A;  3L0O A;  2JQO A;  2CW0 C;  1K28 A;  1EYG A;  2IX3 A;  5LMN Q;  1HTP A;  3P75 A;  4H13 C;  4HJ9 A;  3QOL A;  2ZXR A;  4ABN A;  4WJ4 A;  4JPB W;  2XGT A;  1P16 A;  1I4R A;  3OW2 A;  1SYF A;  1JMC A;  2OF1 A;  4DV1 L;  4O42 A;  1NJI C;  1C4Q A;  1KLU D;  2K5D A;  5J22 A;  4DR4 Q;  4A3F G;  4DV5 L;  5EKL A;  2D0P A;  4KY7 A;  3W1G A;  4LF6 Q;  1EYA A;  3S2D H;  1VMP A;  4JI5 Q;  1XMO Q;  1EIF A;  2FXQ A;  1Q1B A;  2WFW A;  2ZXO A;  4K5W A;  1CQV A;  2B2Y C;  2NN6 H;  4UP9 A;  4IJL A;  4LF7 Q;  4QQB X;  1G51 A;  3PUV A;  3GD7 A;  2MQH A;  4QY7 A;  3KUP A;  5C6A A;  3M4P A;  3TS2 A;  1NMF A;  3I4M B;  1V43 A;  4KN7 C;  5KYI A;  2BDN A;  2AUK A;  1PFM A;  1K83 H;  1SMX A;  1GD7 A;  3A55 A;  2BE5 C;  4GN4 B;  4JG2 A;  5K5P A;  3DMU A;  1L1O C;  1KRS A;  4DK3 C;  3BJU A;  1Y1W H;  2MJ8 A;  4AYB E;  5HGQ A;  4IO9 A;  3CW2 C;  1C8C A;  2NYZ D;  2R7Z G;  1SYC A;  1X3G A;  4DR6 L;  1X32 A;  1ASZ A;  2YTX A;  4X3T A;  4NDX A;  2B2Y A;  1Y14 B;  4L5R C;  2KJX A;  2Q8R E;  3D8G A;  5FO9 B;  4JC0 A;  4O1N A;  3CF5 A;  5M5W B;  3L2P A;  3CHB D;  3J80 L;  2PZU A;  1ICF B;  1Z47 A;  1HZ9 A;  2NN6 I;  4DV4 L;  3ONA B;  4A3I B;  2QF7 A;  1Y1V H;  2EJG C;  2NTT A;  1VQP A;  1NY4 A;  1L1O A;  1YVC A;  1I4Q A;  3PUW A;  2F0D A;  3HOU G;  3S1M H;  3LNN A;  4IFD I;  3PO2 H;  3QOJ A;  4K14 A;  4DR7 L;  3H15 A;  1TWH H;  2OT2 A;  5KGU A;  2WAQ E;  2EPB A;  2UXB L;  3HOZ B;  2WIN B;  3HOZ G;  5T1I A;  4DR1 L;  2SDF A;  2JA5 H;  4K0K L;  1EYC A;  1KNE A;  1HNX L;  2L0C A;  4PMB A;  2K5H A;  5JJK A;  3RLO A;  2MFI A;  4H7B A;  1B3Q A;  2ENB A;  1QE6 A;  4MHE A;  2WAC A;  2K1B A;  3EN2 A;  2F0S A;  2D0O A;  3OMG A;  2ZJR A;  1XMQ L;  2I07 B;  2B2U C;  3ND8 A;  1TWF B;  2E2H H;  4JI0 Q;  4LWC A;  5LHY 1;  1K3R A;  4KLK A;  4JI8 L;  1HFG A;  3NK9 A;  4IZ8 A;  1C48 A;  4U68 A;  2N88 A;  1B4O A;  4A4I A;  3CCE A;  2VB2 X;  1B9N A;  2H1E A;  3TN2 A;  1IKL A;  4FXD A;  2LMC B;  2BH2 A;  2B39 A;  1O7L A;  2F4V L;  4DXG A;  3CMA A;  4RKL A;  4FF2 A;  2RQX A;  2XRQ D;  3TP8 A;  2XIW A;  1B2T A;  1M4V A;  1PYS B;  1A2T A;  3RZD H;  5IP7 H;  2A73 B;  2G9D A;  3PMF A;  5I6W A;  1HQR D;  1HUM A;  1U0L A;  4FF4 A;  3B6Y A;  5IT9 c;  1JR0 D;  1H9M A;  3M7N A;  1DZ1 A;  4KKS A;  4DV6 Q;  5IYD H;  3MEF A;  3T13 A;  4XTC S;  1PDQ A;  1HA6 A;  4TRD A;  1BVS A;  4A75 A;  3G6E A;  1Q7Y C;  1TS5 A;  1XNR Q;  2B2U A;  2BDO A;  1F9R A;  1XXG A;  1IW7 D;  2KA7 A;  2K5W A;  4R4Q A;  4G7Z C;  1BO0 A;  1O78 A;  4X66 Q;  3K7A B;  1JE4 A;  2HHH L;  1HA5 A;  1PRT F;  4Y7N H;  1AE3 A;  2EOT A;  4NXN Q;  2UUB Q;  4BS9 A;  4AH6 A;  3PUX A;  3OTO L;  1GUN A;  1X56 A;  2Q2I A;  3GTJ H;  2LY7 A;  4B9X A;  3NEM A;  2PZW A;  4DR3 L;  3BVZ A;  5BN4 A;  1UE1 A;  1N32 Q;  3S9W A;  4RGN A;  5C0X H;  4NMZ A;  1PTO F;  1GUW A;  3TZD A;  1VQC A;  5IYB G;  3GTQ B;  2F0I A;  2Y0S G;  5LMU L;  2E74 C;  2J0T D;  3GTL H;  4LF8 Q;  4FF1 A;  1Z6H A;  1YIT A;  4JBW A;  3AYH B;  5I9P A;  1LUZ A;  1VF7 A;  5JJI A;  1NTG A;  4ZK9 B;  1PYB A;  3F1Z A;  2JA6 B;  3I8Z A;  5G3L F;  4RGO S;  2F0Q A;  3Q6S A;  1NR4 A;  1I94 Q;  2CQA A;  3IL8 A;  5M5X H;  4FXK C;  1RD9 D;  1HZA A;  1C0A A;  2K7V A;  2KEC A;  3WOF A;  3R2I A;  4A76 A;  4RCO A;  5CV4 A;  4Q0F A;  1BNZ A;  1CI3 M;  1JE5 A;  4LJZ C;  2HT1 A;  1FNV A;  4ODG A;  3JAM E;  3VYS A;  3CC7 A;  1Y1V G;  3S15 H;  2EXZ A;  1TWC B;  5M5Y B;  3FKI H;  2KEE A;  3RN2 A;  1PRT C;  1LT6 D;  1II3 A;  3KYH C;  2B29 A;  3BYT B;  1ZYR C;  5C44 H;  3Q23 A;  2KHS A;  4A3M H;  1WCM H;  5C4J H;  3UE0 A;  4A3C H;  1EFI D;  3J81 L;  5M3F H;  2JK8 A;  1GUG A;  2Y0S E;  4XQJ A;  2Z9H A;  4PV1 C;  1XX8 A;  1HR0 L;  1PTO C;  4MNO A;  2R92 G;  2R92 B;  5FLM H;  3SHL A;  1VS0 A;  1A3U A;  3S1N H;  1ML0 D;  3J81 j;  1SAP A;  4GKK L;  5CV7 A;  1SBB B;  1S5E D;  2HDL A;  1X6O A;  1EU3 A;  3EQL C;  2E76 C;  5JPM C;  4B3R L;  1T9H A;  4DV4 Q;  5IWA L;  4IUR A;  1F2Y A;  4JI6 L;  1MGS A;  3SK4 A;  1CZW A;  3N52 A;  1WVL A;  2NVT B;  4IPH A;  3KJO A;  4KV6 A;  3NBH A;  2DY7 A;  1K8O A;  1DYQ A;  5JOB A;  1SNC A;  4DR7 Q;  3A74 A;  3DHQ A;  4XQQ A;  2VUM H;  1HHV A;  2F52 A;  3Q24 A;  1SND A;  2I5M X;  1LM0 A;  3DLL A;  1C9O A;  1CQF A;  2AKW B;  4K0K Q;  1HNX Q;  1I3Q H;  1BOS A;  1YJN A;  3R3O A;  1BCP B;  3PGZ A;  5ISR A;  4QGU A;  4B3M L;  3G48 A;  3IFD A;  3KDF B;  4ZYS A;  1KC8 C;  4HIO A;  4NKL A;  3PUZ A;  5IGD A;  4GKJ Q;  1KAW A;  3C1E A;  5IGE A;  1YNN C;  5FOB B;  3MXG A;  4UHV A;  2JEB I;  4KK7 A;  4DV0 L;  1JC7 A;  1HJP A;  2N55 A;  1STH A;  1RIP A;  3H0G H;  4FP5 D;  1AH9 A;  2F0G A;  1DGS A;  3CP0 A;  3S16 B;  1I50 H;  1FGU A;  4ZQ3 A;  1WD1 A;  2MPM A;  1CZG A;  1D2B A;  1PA6 A;  3GTM H;  5A2Q E;  1G2S A;  5KNB A;  2QDL A;  2KCM A;  1NAP A;  3MVV A;  3G6J B;  5C0X G;  1HUN A;  3T1Y Q;  3ITP A;  1UUP A;  3H3V H;  1J5E L;  4HMI A;  5CBA E;  3VDY A;  1ILP A;  3HOW H;  3RN5 A;  4OHJ A;  1QVG A;  2F0P A;  5M3M B;  5M3M G;  2O4X A;  3I91 A;  4OIJ A;  1PH9 A;  5ELB A;  4IFD J;  2KUM A;  3QO2 A;  2ID0 A;  4BBS H;  1FNW A;  1IBM L;  3RD4 A;  2K33 A;  2RDH A;  3NTH A;  1OXU A;  5EKK A;  1EQQ A;  5CV8 A;  3E9H A;  2HHH Q;  5K36 H;  3S1Q H;  5C4X H;  4RHS A;  1LTT D;  1PFN A;  4DKA C;  4H0L C;  4CDE C;  5IIF A;  1B70 B;  5AJ3 L;  2GN5 A;  3AB9 A;  3OTO Q;  2YTY A;  2CH4 A;  4IUT A;  3J80 c;  1WTO A;  1K0R A;  3HZX A;  4JV5 Q;  4GLV B;  2L1B A;  3NE5 B;  1JB3 A;  3D6C A;  3J80 i;  4PMC A;  3A54 A;  3TDQ A;  1P8L A;  1IYJ B;  3TEH B;  5H1S E;  2CQO A;  1OO9 B;  1I6H B;  3W2D A;  1SLJ A;  3BVG A;  3BZC A;  3UDX A;  4CKB A;  1JOR A;  2ZM6 L;  4DFA A;  3SVM A;  3H3V I;  1Q86 C;  5JEA J;  1EQV A;  3K58 A;  3HKS A;  1PH2 A;  1JCK B;  2R93 H;  1WCM G;  3EFX D;  4JI1 L;  1N36 L;  1PZK D;  4LFA L;  3M9B A;  1EY9 A;  1K8M A;  5JJL A;  1F2Z A;  3D0F A;  4HJA A;  5FLM G;  3BDL A;  4DR5 L;  2PMZ E;  5IP9 H;  3T16 A;  2QEJ C;  2F0L A;  1NCV A;  5ELF A;  2CCZ A;  2M2L A;  4LF4 L;  3GTO H;  1SNO A;  2NVY H;  1PH3 A;  4EVO A;  3E9I A;  4NB3 A;  3CME A;  3FPU B;  3TRE A;  3IAY A;  3K57 A;  2I46 A;  3ICE A;  1Q46 A;  1OXV A;  2EYO A;  1MIU A;  3GP7 A;  1F2M A;  3AEV A;  1OXT A;  3QR8 A;  3D4R A;  2JJQ A;  4R4C A;  1ROD A;  2LXK A;  1S40 A;  2PW5 A;  1XPR A;  3C1F A;  2VUM G;  1K0S A;  2K28 A;  1LAB A;  1Q81 C;  3U4V A;  4BXX G;  4BA1 I;  4BY1 H;  4DN4 M;  5F2D A;  3IRB A;  4OWW B;  2PO4 A;  4A3J H;  1UE7 A;  4R4O A;  3STB C;  2V4D A;  1YBY A;  1MBY A;  2SNM A;  4FF3 A;  3MHB A;  2EY5 A;  4J6H A;  2EYF A;  4PZ8 A;  4U67 3;  4QUC A;  1F9Q A;  3EVQ A;  2QEX A;  1HR0 Q;  1V1O A;  2GVB A;  2N78 A;  1KDC A;  3QWN A;  3UI2 A;  2L5T A;  4J15 A;  4GKK Q;  2EE1 A;  4RA8 A;  1D1K A;  1V9P A;  1S72 A;  1QG7 A;  4H44 C;  3F8T A;  1STY A;  3P20 A;  4X62 Q;  5IWA Q;  2ZT9 C;  2F3I A;  3QJY A;  1VQ7 A;  1SRU A;  2KQ3 A;  3M4O H;  2LKV A;  4GZY C;  2NZO A;  4UAI A;  5L37 A;  4HJ8 A;  5FLX L;  1X3Q A;  2AMC B;  5E4W C;  2UUC Q;  4RGM A;  4B3S L;  1NR2 A;  4A93 B;  4A93 G;  1LT3 D;  1B7Y B;  1STB A;  4HAE A;  2IJ0 A;  4RKB A;  1EWC A;  1U4M A;  2K4K A;  4F8M A;  3S14 H;  1X3F A;  2L11 A;  4KD4 A;  5CR3 A;  5HGT A;  3CCS A;  2E5L Q;  2CW0 D;  3R93 A;  2WB1 E;  2Q8I B;  1ENF A;  2G5D A;  3NEL A;  3L9A X;  1EWH A;  2UUA L;  3M3Y B;  2A19 A;  3F2U A;  4HIM A;  4P71 A;  4A3K B;  4UY8 C;  3DUZ A;  4A3K G;  1RTO A;  2B2W A;  3QIA A;  2UXD L;  5C4X G;  3BS1 A;  3RR5 A;  2XWJ B;  3PIO A;  2A69 C;  1IBL Q;  1A3T A;  4C3J B;  4C3J G;  1S5C D;  4DAV A;  2I5H A;  2I5L X;  1YZ6 A;  2P5Z X;  3OSO A;  3EIV A;  2L12 A;  1GJX A;  1AN8 A;  2AQ1 B;  4M8A A;  3WOE A;  5IY0 A;  3NEN A;  1SYB A;  2EYM A;  4A3E H;  1EIH A;  1TWF H;  3T51 B;  4JI3 L;  4XYQ A;  2IHE A;  2F0F A;  4OWX B;  4JI7 L;  2NVX H;  3RMH A;  2EY6 A;  1Q90 A;  1AW7 A;  1H9S B;  1QIL A;  3MEH A;  4L5Q A;  3J7A 5;  2YYZ A;  4HIK A;  3MAQ A;  1E2Z A;  4L8J A;  4OO1 I;  2BE5 D;  1MSH A;  3EJI A;  1TVX A;  3NTI A;  3NTK A;  3FEW X;  1IBM Q;  2VNU D;  1MSG A;  4QB4 A;  3J81 c;  3K59 A;  1CHP D;  3H6M A;  2R93 G;  2OQ0 A;  1QNK A;  4DNT B;  3TQY A;  5FO8 B;  4A3F B;  2E8G A;  2A6H C;  3J81 i;  1O7Z A;  5FJ8 H;  4NXM L;  2K5N A;  4KHV A;  1B50 A;  4RGT A;  3CAM A;  2MO1 A;  3F2B A;  5IE8 A;  3M4Q A;  4HSP A;  3PF4 A;  1YNX A;  2A1A A;  2K04 A;  2OTL A;  3K0X A;  4WJ3 M;  2WAQ B;  2WAQ G;  4DAY B;  4WRD A;  2N8N A;  3K5N A;  2K50 A;  3VR2 A;  4IFD H;  2L15 A;  3KLS A;  3VYR A;  2EZV A;  1TT2 A;  2GA4 B;  4A3L H;  1M8A A;  2ICI A;  4IUU A;  1RDP D;  5EPK A;  5JJZ A;  3TP7 A;  4RWS C;  2ZTD A;  2ZM6 Q;  4POG A;  2QDB A;  1EL0 A;  2FJ2 A;  2AWN A;  4BY1 G;  4LFB L;  2CHB D;  1AZQ A;  2EYJ A;  4A3J G;  1AEX A;  2F0H A;  1GO3 E;  5E1F A;  4JI1 Q;  2R7Z B;  3CCJ A;  3MXU A;  1U4R A;  5C3E H;  1AP0 A;  3HFZ B;  3KF6 A;  4DUZ L;  1SJE D;  3J7A V;  3LWE A;  2E2I B;  1S4Z A;  1EU4 A;  2AQ2 B;  2TSS A;  1O7Y A;  1TR5 A;  1F9S A;  4QMG A;  1RCV D;  4MTK A;  4DR5 Q;  2K75 A;  1E7Z A;  4ME3 A;  1STE A;  3T53 B;  1JOO A;  3Q22 A;  1R9T B;  4FVM A;  4CKE A;  3BDC A;  1LV9 A;  1A2U A;  2Z1C A;  2H4O A;  2BA1 A;  1S5B D;  5JEA H;  1L0Y B;  1NNX A;  2ES2 A;  5LMN W;  4B3T Q;  4DV7 Q;  2H5X A;  4QJF A;  4AIM A;  3PCO B;  5A2Q L;  1WTP A;  3HOU B;  1HNZ L;  5FO7 B;  4C3H B;  5LL6 X;  4C3H G;  1STN A;  5DNF A;  4IUQ A;  1TWG B;  4UDU C;  1R4Q B;  2PQE A;  3E5S A;  3U58 A;  1EY4 A;  1A8V A;  1V1Q A;  2JA8 B;  4OEM B;  2JA8 G;  3GV3 A;  3GTG H;  5KIX A;  4DUY L;  2MHV A;  3A0J A;  4C1N K;  4FXG C;  3V2T A;  2CKZ B;  1BCP F;  2IWH A;  5JVH 3;  1MKH A;  1RL2 A;  3A8K E;  2F0O A;  1YNJ D;  2EVB A;  1WOC A;  1CKN B;  2K14 A;  3X3M A;  4A3D H;  1W6J A;  4TVA B;  4MN3 A;  2Q2H A;  5I2Y A;  4PZ6 A;  3CKI B;  1PH5 A;  4K6L A;  1K9M C;  1H9R A;  3UDG A;  3HOX H;  4C2M B;  3ERQ A;  1E2W A;  1N34 Q;  1N8R C;  3KF6 B;  1X9N A;  1ENA A;  3ZJY C;  3BYY B;  2HCI A;  3PO3 H;  4B3S Q;  2ZJQ A;  3DM1 A;  1SFO H;  3S17 H;  1NE3 A;  1ET6 A;  2JA9 A;  1X65 A;  3JC6 6;  2B63 H;  1DM0 B;  3I90 A;  4V19 0;  4X65 L;  5DAU A;  4JI4 Q;  1G8Z D;  4CGY B;  1CM9 A;  1HTL D;  1YHB A;  2NUC A;  1HRJ A;  1SMY C;  1WTV A;  1TS4 A;  4IUV A;  1HCZ A;  1CUK A;  4JBJ A;  2Q2U A;  1E1O A;  3P1H A;  3OPO A;  4HMJ A;  4TSS A;  3TSS A;  2UXD Q;  2LXJ A;  1IBK Q;  3BDO A;  3S2D B;  1ENC A;  3SXH A;  3G71 A;  1OTC A;  1SNM A;  1B44 D;  1BXT A;  2A5H A;  2SNS A;  4Z9C B;  5I4D A;  4GOP C;  3T1H Q;  1I6V C;  3HKZ E;  5KNC A;  4BWG B;  2NN6 G;  4C3I H;  3D31 A;  3S1R H;  4PG3 A;  1KNA A;  5NUC A;  2A74 C;  4JBK A;  4AQY L;  1STG A;  3MA2 B;  4IFD G;  5E3F A;  3TRZ A;  4DK1 A;  5GQO A;  2UXC L;  3UE1 A;  3NP8 A;  4ZUI A;  1SEB D;  1LTA D;  1BCP C;  1HXY D;  1V8Q A;  3W1B A;  1K83 B;  1BDO A;  2Y0S B;  2YU9 H;  1XPO A;  1Q12 A;  5DLQ E;  3DEP A;  2F0K A;  2IHF A;  1A15 A;  3S16 H;  4JOI C;  4TQU S;  1Y1W B;  1VQA A;  2X69 A;  1Y1W G;  3A8I E;  1PV4 A;  4X6A H;  1PRT D;  3L3O C;  4DGZ A;  1KHI A;  5KYL A;  3HOY H;  4LUZ A;  4DV1 Q;  2WV6 D;  4RFB A;  1Q8I A;  1D7Q A;  4DV5 Q;  2LSS A;  4V0B A;  4NXM Q;  1EUJ A;  1TS3 A;  1ZYR D;  1SYE A;  5GAH C;  1DXM A;  1PLF A;  3OW7 A;  4R4T A;  3C46 A;  1B8A A;  1Q8K A;  4OX9 L;  3V05 A;  4IPC A;  3AU7 A;  1EY8 A;  3NPP A;  4IPG A;  4DXF A;  1JOK A;  1EWI A;  1PTO D;  2OTJ A;  1RHP A;  1TWA H;  1A6X A;  4P74 A;  4LAA A;  2RCF A;  2F0J A;  2IY5 B;  1BKB A;  3NHH A;  1Y1V B;  3KDF A;  5FLX c;  1GHJ A;  2D62 A;  1XYI A;  3T4A C;  3S1M B;  1I5F A;  1WJJ A;  4NW2 A;  3CQZ H;  3PO2 B;  1SRO A;  1F77 A;  5GRO A;  3PO2 G;  1SN8 A;  4JOI A;  1TWH B;  5G3L D;  2JXM B;  5C5L A;  1U9R A;  2RCN A;  4GN5 A;  1HPC A;  1PTO H;  5ELD A;  2JA5 B;  3RLN A;  2JA5 G;  3BG3 A;  4HID A;  4UP8 A;  3OIQ A;  2NZ1 D;  4KY5 A;  2CWP A;  4DR6 Q;  4DUZ Q;  3ER0 A;  2Q2T A;  2DJG C;  3KOJ A;  5GAG C;  4A3G H;  1J9O A;  2HCC A;  1QVF A;  3DWP A;  3K0Y A;  4X3U A;  1FGB D;  1GUT A;  3RZO H;  2HD3 A;  3U9S A;  2IL8 A;  3A7L A;  1KTK A;  1JJ2 A;  2K5Q A;  4YCW A;  4R8I A;  1PH1 A;  5IGG A;  1C7Y A;  5JPN C;  1VQB A;  3GTP B;  2RBM A;  1YNN D;  1VQI A;  1TQO A; 
#chains in the Genus database with same CATH homology
 3KLR A;  1J8I A;  3H94 A;  1BUV T;  1LO5 D;  1VMC A;  3J7Y W;  2F3V A;  1S5D D;  2IW3 A;  4YIJ A;  1SNP A;  1EEI D;  3M7G A;  1UAP A;  3URY A;  4HED A;  2R61 A;  2WII B;  1I4P A;  4LK1 C;  4QF4 A;  1ICW A;  3VA7 A;  4X3K A;  3SK8 A;  2PW7 A;  1BF4 A;  4Y7N B;  1U4P A;  3PV0 A;  1F9P A;  5T1G A;  1QWY A;  1QJO A;  2F0V A;  3GTJ B;  3I73 A;  5C3X A;  4IUP A;  4L6T B;  2XRS D;  3G7L A;  1TII D;  2M9V A;  3DXJ C;  2XSC A;  2A68 D;  3GQB A;  3PUY A;  3GTL B;  5KEE A;  2PMZ B;  2NB0 A;  2E2D C;  3AMU A;  2MUY A;  2ZXP A;  3TBI B;  4PQX A;  1KLG D;  2BCO A;  1EY5 A;  2EJF C;  2QKI C;  3CRK C;  5M5X B;  3W3A A;  2AUJ D;  1TS2 A;  5CMD A;  1RKN A;  2JYO A;  4B08 A;  3PIO 3;  1SJH D;  5IGB A;  3A8J E;  3S15 B;  3O13 A;  3FKI B;  2CVR A;  2RVL A;  3Q0A A;  1XTC D;  2A6E C;  4CJ0 B;  2XNA C;  5C44 B;  4A3M B;  1WCM B;  5C4J B;  1STA A;  5KND A;  1D1I A;  4RHR A;  3TP5 A;  4L63 B;  3BVM A;  4FYD A;  1GXD C;  1RJT A;  2B2V C;  2F0T A;  5FKA C;  1Y8O B;  3S1N B;  1G91 A;  2NBF A;  1WTW A;  5DEH A;  4ILW A;  2RDF A;  4EQO A;  5M9O A;  5D65 A;  2WB1 B;  1JIC A;  3C3L A;  1B3A A;  5EGT A;  1V1P B;  2IPK D;  1ESF A;  1NSN S;  4CJ1 B;  3IFT A;  1I4X A;  2VUM B;  2X6G A;  1UNS A;  2HUG A;  5TSS A;  1I3Q B;  1ONL A;  3OMC A;  3SE0 A;  1LTG D;  2B2V A;  1TKW B;  3MC0 B;  2NWG A;  3VYU A;  1FNU A;  2O5J C;  1ILQ A;  2SEB D;  5I2X A;  5J1Z A;  3VYT A;  1H9S A;  3MFG A;  2F0U A;  1T5X D;  1DOL A;  1LT5 D;  4QCL A;  2A69 D;  1CA6 A;  5E4X A;  3GTM B;  3LX0 A;  4KJN A;  1QNU A;  3FPP A;  4OO1 H;  1SYG A;  4DA2 A;  3KLS X;  4BA2 I;  2IX0 A;  1DCZ A;  3I4L A;  1VCI A;  4X3S A;  4ZKB B;  1BQQ T;  4K5X A;  1JWS D;  2BOS A;  4DU9 A;  4DAY A;  4BBS B;  1EY0 A;  5ELE A;  2O5I C;  3S1Q B;  5K36 G;  5C4X B;  2K01 A;  1OXS C;  3NQI A;  2A6H D;  5LL6 S;  1A3V A;  1D5Z C;  4K2K A;  3J81 E;  1Y69 U;  3KK7 A;  1RF2 D;  3JAM L;  3VR4 A;  4CJ2 C;  2VB3 X;  3CRL C;  4XYO A;  4HN7 A;  2Z8L A;  1Y8N B;  4XT3 B;  3HEJ A;  4XIG S;  2JP1 A;  1Q1E A;  4ZRZ A;  4S3S A;  2Z4I A;  2JSO A;  3SR1 A;  5DM6 3;  3NXW A;  3SK5 A;  2RA4 A;  2KCN A;  2R93 B;  2F3W A;  4KI0 A;  5IOD A;  4QUF A;  1G6Z A;  2XN9 C;  2ICE C;  3NSW A;  1EY7 A;  1EYD A;  2RKS A;  1VF5 C;  4Q5V A;  3MFY A;  5CGK A;  1PYW D;  4HCE A;  3GTO B;  1GHK A;  2NVY B;  2OXP A;  3D4D A;  2RSN A;  3HGB A;  4ID6 A;  3M85 A;  4FO2 A;  2KCC A;  3MTS A;  3P7J A;  2F0N A;  3VR3 A;  1SE2 A;  3HS0 C;  1LTI D;  1QOH A;  3H91 A;  3MWY W;  5C4Z A;  3LWU A;  1OXX K;  4BY1 B;  2VXW A;  5IOC A;  2SOB A;  4A3J B;  1BR9 A;  2B8G A;  1SSO A;  1IYV A;  3NWT A;  5JVG 3;  1FD7 D;  4FNF A;  3DWQ A;  1LAC A;  1DON A;  2EDG A;  2F0W A;  4ZLT F;  4K8I A;  1PXU A;  1CK1 A;  1JWM D;  2QCP X;  1XWE A;  3FMC A;  1TU2 B;  3SEB A;  3M4O B;  1PMR A;  1S5F D;  4XT1 B;  2PCF B;  3FRP B;  1CA5 A;  1TY2 A;  2PYK A;  1Q3L A;  4KN4 C;  4OO1 G;  1EZ8 A;  1EOT A;  3HG9 A;  3S14 B;  1U4L A;  2NTS A;  1DD2 A;  3OWF A;  1CHQ D;  1FR3 A;  2WKD A;  3HKZ B;  2PZT A;  1IHZ A;  3CU7 A;  5IT9 E;  1SMY D;  2PNR C;  1LT4 D;  3RLF A;  2C9O A;  2L9H A;  1SYD A;  3VA5 A;  2EY2 A;  2AWO A;  2F03 A;  3D3R A;  4K6D A;  2QIL A;  3MXP A;  4A3E B;  1B1Z A;  1DOM A;  3HP3 A;  2NVX B;  1RTN A;  4NP5 A;  3GO5 A;  4EQN A;  1BCP D;  1AFP A;  1G29 1;  1ZXT A;  4TKO B;  4IAL A;  2O2L D;  5A35 A;  5JAV A;  3NUC A;  4IN3 A;  5EKI A;  1D5X C;  2RSO A;  5D14 A;  1Z7T A;  5D3I B;  1L0X B;  2FMC A;  3EA6 A;  4WFN 3;  2B8F A;  1LTB D;  1YNJ C;  1IKM A;  3U9O A;  4ZAI A;  1GUS A;  1CFM A;  2L4N A;  4G7H C;  2IX1 A;  2K32 A;  3K5L A;  1E2V A;  5C4H A;  3ND9 A;  4LMQ D;  4KKT A;  4WJW A;  1HQM C;  3MZ5 A;  1JQY D;  2EYP A;  1F2L A;  3FVQ A;  4XXE A;  5I9O A;  2MP1 A;  5ELC A;  5COR A;  4I65 A;  1H9J A;  5EPL A;  4CHT B;  4XDX A;  5FLX E;  3NWS A;  1ET9 A;  5C3E B;  4ZUJ A;  3R8B A;  1PZI D;  4IUN A;  1EY6 A;  2J7Z A;  1IW7 C;  4EQP A;  1IL8 A;  3OWE B;  3D6W A;  2D2C C;  3SDZ A;  1GUO A;  4WOR A;  1I4H A;  3D4W A;  1SNQ A;  5JEA G;  4G4K A;  2EY1 A;  2XWB B;  2K03 A;  4R9W A;  2FMM A;  3T56 B;  4OGQ C;  2XVS A;  1O80 A;  4DK0 A;  4JK1 C;  3E6Z X;  4I7Z C;  1T5E A;  4OL7 A;  3GTG B;  3IKJ A;  3I72 A;  5EPJ A;  1WTX A;  1JWU D;  2DN8 A;  3I3C A;  3NQT A;  1VDZ A;  2E2H B;  3OOC A;  2WP8 J;  4ULL A;  5C0X I;  2HQE A;  4A3D B;  3KBG A;  1E0B A;  5KRU A;  5AFW A;  2BA0 A;  1LTR D;  1SE4 A;  3PIP 3;  3HOX B;  1I4G A;  3H09 A;  3RZD B;  4RH6 A;  1AZP A;  3PO3 B;  4N9P A;  4R8N A;  2HDM A;  5HUR A;  1SFO B;  3S17 B;  2B2T C;  4RAU C;  1MD2 D;  2B63 B;  2FIN B;  1Y8P B;  2RDG A;  2F0E A;  2DNC A;  4DNR B;  3N6R A;  5DM7 3;  4QIW B;  3L7Z C;  2X6L A;  1KDB A;  1X3P A;  2MGS A;  1ZEQ X;  3BZD B;  2J4X A;  5BN5 A;  1EQT A;  5EBC A;  3FDT A;  3C2P A;  5EBD A;  1UEA B;  3QB3 A;  1ZKO A;  4P2C B;  3V96 A;  4J1M A;  4C3I B;  4C3I G;  5BN3 A;  3S1R B;  3OIP A;  1QB5 D;  2EJM A;  5CYU A;  2B2T A;  1D6E C;  2K6A A;  4HCS A;  1BBX C;  5CV9 A;  1R4P B;  5C3W A;  2C5C A;  2YU9 B;  2DNE A;  3J80 E;  2IT1 A;  4OIK A;  5IGF A;  3A7A B;  5I6Y A;  3VR6 A;  2A6E D;  3TZU A;  5J39 A;  1LLR D;  3HOY B;  3HRZ C;  3X3N A;  1V1P A;  4B9W A;  3GV6 A;  1QCB D;  4K2L A;  1PZJ D;  3DEO A;  4CKC A;  3QG1 A;  1B53 A;  4KHZ A;  1TWA B;  5FK9 C;  2AQ3 B;  1PRT B;  2F4I A;  3H3V C;  4ME5 A;  5EQ0 A;  1SE3 A;  3A56 A;  2DY8 A;  4DF7 A;  3K5O A;  4XQN A;  2E75 C;  3CQZ B;  3VR5 A;  3OHX C;  3TP6 A;  2OEO A;  3MXN A;  1PTO B;  3R2T A;  1WTQ A;  1JOQ A;  2WKC A;  4DAP A;  4RCN A;  1ESR A;  5M3F B;  2A68 C;  4A3G B;  2G9H D;  1KDA A;  3KF8 A;  5D3D A;  5IT9 L;  1IYU A;  5CV6 A;  2JEA I;  3RZO B;  3NBI A;  4N9T A;  3K5M A;  4ZKC B;  4HTH A;  5C5M A;  1FYC A;  2FHT A;  1LTS D;  3TME A;  4F88 A;  2JA7 B;  2F0M A;  4PNY A;  2EYH A;  4E6I A;  2M00 A;  2LS0 1;  2R3Z A;  2Z4H A;  4HR7 B;  1G2T A;  2D9U A;  2E2J B;  4F7X A;  4A3B B;  1H9K A;  4J8Q A;  4K5V A;  2D5D A;  5CC4 A;  5IGC A;  3I4N B;  1KAB A;  4C56 C;  2FFK B;  3ZYY X;  2KVM A;  5COY A;  4C1N I;  2R6G A;  5EJW A;  4K8J A;  1WD0 A;  2PPB C;  2Q8T A;  4G57 A;  1GOZ A;  3H0G B;  4BBR B;  3E0J A;  4BY7 B;  1I50 B;  3J7A F;  5CV5 A;  3DWA A;  4KTA A;  1KAA A;  1D5M C;  3K6O A;  2F1M A;  1W6K A;  1WTR A;  4KMU C;  4EGV A;  2KOL A;  2B2W C;  1EEF D;  3HOW B;  3I70 A;  3S2H B;  2LFN A;  3GTK B;  1CTM A;  3SK6 A;  1PFB A;  1MI2 A;  4KY6 A;  3RUZ A;  3HOV B;  5CBE E;  1B9M A;  1SXT A;  1DOK A;  2KED A;  4CBV A;  1SDF A;  2K05 A;  4KKU A;  5C0X J;  4F87 A;  2L55 A;  1CT1 D;  1HFN A;  4HSV A;  4KD3 A;  1EZ6 A;  4G7O C;  3KBX A;  2NVQ B;  3M4Y A;  3WDN A;  4PMW A;  2EYL A;  4KJO A;  2TMP A;  4M1U B;  1EIG A;  4AYB B;  4IQZ A;  3ERO A;  2JE6 I;  4MIU A;  1TY0 A;  1DJR D;  1NUC A;  2CW0 C;  2IX3 A;  1HTP A;  3P75 A;  4H13 C;  3QOL A;  2ZXR A;  4ABN A;  1I4R A;  1SYF A;  2OF1 A;  4O42 A;  1C4Q A;  1KLU D;  2K5D A;  5J22 A;  5EKL A;  4KY7 A;  1EYA A;  1VMP A;  1Q1B A;  2ZXO A;  4K5W A;  1CQV A;  2B2Y C;  2NN6 H;  3PUV A;  3GD7 A;  3KUP A;  5C6A A;  3I4M B;  1V43 A;  4KN7 C;  5KYI A;  2BDN A;  2AUK A;  1PFM A;  3A55 A;  2BE5 C;  5K5P A;  3DMU A;  2MJ8 A;  1C8C A;  2NYZ D;  1SYC A;  1X32 A;  4X3T A;  4NDX A;  2B2Y A;  2KJX A;  2Q8R E;  3D8G A;  5FO9 B;  4O1N A;  5M5W B;  3CHB D;  3J80 L;  2PZU A;  1Z47 A;  2NN6 I;  3ONA B;  4A3I B;  2QF7 A;  2EJG C;  2NTT A;  3PUW A;  1I4Q A;  2F0D A;  3LNN A;  4IFD I;  3QOJ A;  4K14 A;  2OT2 A;  5KGU A;  2EPB A;  3HOZ B;  2WIN B;  5T1I A;  2SDF A;  1EYC A;  1KNE A;  2L0C A;  4PMB A;  4H7B A;  2ENB A;  1QE6 A;  4MHE A;  2WAC A;  2K1B A;  2F0S A;  3OMG A;  2I07 B;  2B2U C;  3ND8 A;  1TWF B;  5LHY 1;  1HFG A;  3NK9 A;  4IZ8 A;  1C48 A;  4U68 A;  2N88 A;  1B4O A;  3TN2 A;  1B9N A;  2H1E A;  2VB2 X;  1IKL A;  4FXD A;  2LMC B;  2B39 A;  1O7L A;  4DXG A;  4RKL A;  4FF2 A;  2RQX A;  2XRQ D;  3TP8 A;  2XIW A;  1B2T A;  1M4V A;  1A2T A;  2A73 B;  2G9D A;  3PMF A;  5I6W A;  1HQR D;  1HUM A;  4FF4 A;  1JR0 D;  1H9M A;  3M7N A;  1DZ1 A;  4KKS A;  3T13 A;  4XTC S;  1PDQ A;  1HA6 A;  4TRD A;  1TS5 A;  2B2U A;  2BDO A;  1F9R A;  1XXG A;  1IW7 D;  2KA7 A;  2K5W A;  4G7Z C;  1BO0 A;  1O78 A;  3K7A B;  1JE4 A;  1HA5 A;  1PRT F;  2EOT A;  4BS9 A;  3PUX A;  1GUN A;  2LY7 A;  4B9X A;  2PZW A;  3BVZ A;  5BN4 A;  3S9W A;  4RGN A;  5C0X H;  4NMZ A;  1PTO F;  1GUW A;  3TZD A;  3GTQ B;  2F0I A;  2E74 C;  2J0T D;  4FF1 A;  1Z6H A;  4JBW A;  5I9P A;  1VF7 A;  4ZK9 B;  2JA6 B;  3I8Z A;  5G3L F;  4RGO S;  2F0Q A;  3Q6S A;  1NR4 A;  2CQA A;  3IL8 A;  4FXK C;  1RD9 D;  2K7V A;  2KEC A;  3WOF A;  3R2I A;  4RCO A;  5CV4 A;  4Q0F A;  1BNZ A;  1CI3 M;  4LJZ C;  1FNV A;  4ODG A;  3JAM E;  3VYS A;  2EXZ A;  1TWC B;  5M5Y B;  2KEE A;  1PRT C;  1LT6 D;  1II3 A;  3BYT B;  1ZYR C;  3Q23 A;  2KHS A;  1EFI D;  3J81 L;  1GUG A;  4XQJ A;  4PV1 C;  1XX8 A;  2R92 B;  1PTO C;  3SHL A;  1A3U A;  1ML0 D;  1SAP A;  5CV7 A;  1SBB B;  1S5E D;  2HDL A;  1EU3 A;  3EQL C;  2E76 C;  5JPM C;  4IUR A;  1F2Y A;  1MGS A;  3SK4 A;  1CZW A;  3N52 A;  1WVL A;  2NVT B;  4KV6 A;  3NBH A;  2DY7 A;  1K8O A;  1DYQ A;  5JOB A;  1SNC A;  3DHQ A;  4XQQ A;  1HHV A;  3Q24 A;  1SND A;  1CQF A;  1BOS A;  3R3O A;  1BCP B;  5ISR A;  3IFD A;  4ZYS A;  4NKL A;  3PUZ A;  5IGD A;  5IGE A;  3C1E A;  1YNN C;  5FOB B;  3MXG A;  2JEB I;  4KK7 A;  1JC7 A;  2N55 A;  1STH A;  4FP5 D;  2F0G A;  3S16 B;  4ZQ3 A;  1WD1 A;  2MPM A;  1CZG A;  1D2B A;  5A2Q E;  1G2S A;  5KNB A;  5C0X G;  1NAP A;  3MVV A;  3G6J B;  1HUN A;  3ITP A;  1UUP A;  4HMI A;  5CBA E;  1ILP A;  4OHJ A;  2F0P A;  5M3M B;  2O4X A;  3I91 A;  4OIJ A;  5ELB A;  4IFD J;  2KUM A;  3QO2 A;  2ID0 A;  1FNW A;  3RD4 A;  2K33 A;  2RDH A;  3NTH A;  1OXU A;  5EKK A;  5CV8 A;  5K36 H;  4RHS A;  1LTT D;  1PFN A;  4H0L C;  5IIF A;  3AB9 A;  4IUT A;  1WTO A;  3HZX A;  2L1B A;  3NE5 B;  1JB3 A;  3D6C A;  4PMC A;  3A54 A;  3TDQ A;  1OO9 B;  1I6H B;  3W2D A;  3BVG A;  4CKB A;  1JOR A;  4DFA A;  3SVM A;  5JEA J;  1EQV A;  3K58 A;  1JCK B;  3EFX D;  1PZK D;  1EY9 A;  1K8M A;  1F2Z A;  3BDL A;  3T16 A;  2QEJ C;  2F0L A;  1NCV A;  5ELF A;  2M2L A;  1SNO A;  4EVO A;  3FPU B;  3IAY A;  3K57 A;  2I46 A;  2EYO A;  1OXV A;  3GP7 A;  1F2M A;  1OXT A;  3D4R A;  1ROD A;  2PW5 A;  3C1F A;  2K28 A;  1LAB A;  4BA1 I;  4DN4 M;  5F2D A;  2PO4 A;  2V4D A;  1MBY A;  2SNM A;  4FF3 A;  3MHB A;  2EY5 A;  4J6H A;  2EYF A;  4U67 3;  4QUC A;  1F9Q A;  3EVQ A;  1V1O A;  1KDC A;  3QWN A;  3UI2 A;  2L5T A;  2EE1 A;  4RA8 A;  1D1K A;  1QG7 A;  4H44 C;  1STY A;  3P20 A;  2ZT9 C;  3QJY A;  2KQ3 A;  2LKV A;  4GZY C;  4UAI A;  5FLX L;  1X3Q A;  5E4W C;  4RGM A;  1NR2 A;  4A93 B;  1LT3 D;  1STB A;  4HAE A;  2IJ0 A;  4RKB A;  1EWC A;  1U4M A;  4F8M A;  2L11 A;  4KD4 A;  5CR3 A;  5HGT A;  2CW0 D;  3R93 A;  2Q8I B;  1ENF A;  3L9A X;  1EWH A;  3M3Y B;  3F2U A;  4A3K B;  3DUZ A;  1RTO A;  2B2W A;  3QIA A;  3BS1 A;  2XWJ B;  2A69 C;  1A3T A;  4C3J B;  4C3J G;  1S5C D;  4DAV A;  3OSO A;  2L12 A;  1GJX A;  1AN8 A;  2AQ1 B;  4M8A A;  3WOE A;  1SYB A;  2EYM A;  1EIH A;  3T51 B;  4XYQ A;  2F0F A;  3RMH A;  2EY6 A;  1Q90 A;  1AW7 A;  1H9S B;  1QIL A;  3MEH A;  2YYZ A;  3MAQ A;  1E2Z A;  4L8J A;  4OO1 I;  2BE5 D;  1MSH A;  3EJI A;  1TVX A;  3NTI A;  3NTK A;  3FEW X;  2VNU D;  1MSG A;  4QB4 A;  3K59 A;  1CHP D;  3H6M A;  1QNK A;  4DNT B;  5FO8 B;  4A3F B;  2A6H C;  1O7Z A;  1B50 A;  4KHV A;  4RGT A;  4HSP A;  2K04 A;  2WAQ B;  4WRD A;  3K5N A;  3VR2 A;  4IFD H;  3KLS A;  3VYR A;  2EZV A;  1TT2 A;  2GA4 B;  1M8A A;  2ICI A;  4IUU A;  1RDP D;  5EPK A;  5JJZ A;  3TP7 A;  4RWS C;  2QDB A;  1EL0 A;  2FJ2 A;  2AWN A;  2CHB D;  1AZQ A;  2EYJ A;  1AEX A;  2F0H A;  5E1F A;  2R7Z B;  3MXU A;  1U4R A;  1AP0 A;  3J7A V;  1SJE D;  3LWE A;  2E2I B;  1S4Z A;  1EU4 A;  2AQ2 B;  2TSS A;  1O7Y A;  1TR5 A;  1F9S A;  4QMG A;  1RCV D;  1STE A;  3T53 B;  1JOO A;  3Q22 A;  1R9T B;  4FVM A;  4CKE A;  3BDC A;  1LV9 A;  1A2U A;  2Z1C A;  2H4O A;  2BA1 A;  1S5B D;  5JEA H;  1L0Y B;  5A2Q L;  1WTP A;  3HOU B;  5FO7 B;  4C3H B;  5LL6 X;  4C3H G;  1STN A;  5DNF A;  4IUQ A;  1TWG B;  4UDU C;  1R4Q B;  2PQE A;  3E5S A;  1EY4 A;  2JA8 B;  3GV3 A;  5KIX A;  2MHV A;  4C1N K;  4FXG C;  3V2T A;  1BCP F;  2IWH A;  5JVH 3;  3A8K E;  2F0O A;  1YNJ D;  2EVB A;  3X3M A;  1W6J A;  4MN3 A;  5I2Y A;  3CKI B;  4K6L A;  1H9R A;  4C2M B;  3ERQ A;  1E2W A;  1ENA A;  3BYY B;  2HCI A;  3DM1 A;  1ET6 A;  1DM0 B;  3I90 A;  4V19 0;  5DAU A;  1G8Z D;  4CGY B;  1CM9 A;  1HTL D;  2NUC A;  1HRJ A;  1SMY C;  1WTV A;  1TS4 A;  4IUV A;  1HCZ A;  3P1H A;  3OPO A;  4HMJ A;  4TSS A;  3TSS A;  3BDO A;  3S2D B;  1ENC A;  3SXH A;  1SNM A;  1B44 D;  1BXT A;  2A5H A;  2SNS A;  4Z9C B;  5I4D A;  1I6V C;  5KNC A;  4BWG B;  2NN6 G;  3D31 A;  5NUC A;  1KNA A;  2A74 C;  1STG A;  3MA2 B;  4IFD G;  5E3F A;  4DK1 A;  3NP8 A;  4ZUI A;  1SEB D;  1LTA D;  1BCP C;  1HXY D;  1V8Q A;  1K83 B;  1BDO A;  2Y0S B;  1Q12 A;  3DEP A;  2F0K A;  1A15 A;  4TQU S;  1Y1W B;  2X69 A;  3A8I E;  1PRT D;  3L3O C;  4DGZ A;  5KYL A;  2WV6 D;  4RFB A;  1Q8I A;  4V0B A;  1TS3 A;  1ZYR D;  1SYE A;  1DXM A;  1PLF A;  3OW7 A;  3C46 A;  3V05 A;  3AU7 A;  1EY8 A;  3NPP A;  4DXF A;  1JOK A;  1PTO D;  1RHP A;  1A6X A;  4LAA A;  2F0J A;  3NHH A;  1Y1V B;  1XYI A;  1GHJ A;  2D62 A;  3T4A C;  3S1M B;  4NW2 A;  3PO2 B;  1F77 A;  1TWH B;  5G3L D;  2JXM B;  5C5L A;  1U9R A;  1HPC A;  1PTO H;  5ELD A;  2JA5 B;  3BG3 A;  3OIQ A;  2NZ1 D;  4KY5 A;  1J9O A;  2HCC A;  3DWP A;  3K0Y A;  4X3U A;  1FGB D;  1GUT A;  3U9S A;  2IL8 A;  3A7L A;  1KTK A;  2K5Q A;  4R8I A;  5IGG A;  5JPN C;  3GTP B;  2RBM A;  1YNN D;  1TQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...