4GKKQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkkQ00
1GVPA 4O2DA 2R92H 3U50C 4LF4Q 4POFA 2RF4A 1KL9A 4GNXA 2K75A 4HJAA 5IE8A 2VY3A 1I5FA 5EAYA 1C0AA 4QY7A 4IPDA 1T9HA 4YHHQ 1Y1WH 1C7YA 2JA5H 5HY6A 1RL2A 3M9BA 3CC7A 2EXDA 4AYBE 3RR5A 3ULJA 1YJ9A 3KDFA 4WJ3M 3KLWA 1BKBA 4P74A 1VCIA 2WB1E 2CFMA 2VW9A 4JI8L 2YTXA 1HNWQ 2KBNA 1E1OA 3GTKH 3B6YA 4DR1Q 4OXPA 3PF5A 3CCSA 1YI2A 4DV0Q 4YY3L 1VQ8A 4XIGS 2L15A 4DR1L 2UUAQ 2NVTH 3GDEA 4DR6Q 1JMCA 2KHIA 4DAYB 5IP7G 3I55A 2Q2IA 3S24A 5IP9H 3BZKA 4X62L 2CKZB 4GLAC 2OQ0A 4GOPC 2UUBQ 1JJGA 4OWTB 1PH2A 3U58A 2NVQH 3GTQH 3NENA 3K7UC 3HOXH 2GVAA 4HIMA 4R1JA 3RZOH 1IL2A 3ERSX 4R4CA 5IYCG 1MJEA 1EQQA 3CCUA 2E5LL 2YTVA 4QIWE 4LFAL 3HOWH 5GQOA 3PCOB 2E2IH 4AQYQ 4UPAA 2B3GA 4A75A 2UXBL 4GOPA 2JA8G 3PUWA 5C4JH 2VQFL 1NMFA 1EYGA 2R93H 2WAQE 2Q2HA 1N9WA 4JOIA 1EUJA 1N8RC 4J15A 4A3EG 1BBUA 2K4KA 1J6QA 4GS3A 4DR2L 4DKAC 1E1TA 2I5LX 2D0OA 2B63G 5FJ8H 4X65Q 2JA7G 1KAWA 4DR2Q 1E3PA 3CAMA 4JI6L 2NZOA 1A0IA 4PZ6A 4X66Q 1PH8A 1SRUA 4A3MG 3F2CA 4BY7H 4JG2A 3TQYA 3CCQA 1CKNB 2OWOA 4TVAB 2MQHA 2LXJA 1IBMQ 1N32L 4OX9L 1CKOA 1G291 4A93H 1VQBA 1PH1A 4BBSH 2YV5A 1KXLA 3PGZA 1Y1VG 2R6GA 4C3HH 5HGQA 3M7NA 3J81j 3TS2A 1HR0L 1N36L 3TS0A 1OXXK 1LM0A 2ID0A 4AIMA 2K14A 1U0LA 2F52A 2N3SA 5C4XH 3T1HQ 1YJNA 1HR0Q 3HOWG 4IFDI 3CCLA 2UUBL 1KRSA 2QEXA 4DV3L 2WP8J 3TREA 2IX1A 2BA0A 5GAGC 3RN2A 3E9HA 1XPUA 4GKJQ 1I6HH 2EIFA 4HJ9A 1EWIA 2AHOB 1G6PA 5FLMH 3STBC 3CPWA 1P16A 1EQRA 2CWAA 2VUMG 1SLJA 2IHEA 4JCVE 4DV5Q 1VQNA 2VS1A 3STBD 4DV6Q 3CC2A 4A3BH 3K8AA 2PI2E 2V1CC 3E9IA 5M5XH 4A3FG 1ASZA 5IT9c 3J81c 4DV6L 2UXDQ 1OXUA 1EFWA 1NJIC 3GTOH 4IFDJ 4JI6Q 2VZAA 1QZGA 1I50H 1B7YB 4PZ7A 1VQ7A 1VQ5A 5J3BA 3G71A 1V9PA 1GKHA 1L0WA 1HNXL 1EIYB 1IBML 1UE5A 1VQEA 1N32Q 4LUOA 2F4VL 4JV5L 1Q12A 1VS0A 4KI0A 3UE1A 5C44G 2UU9L 1KIXA 2F4VQ 4A3GG 4DUYL 3EIVA 1PYBA 3GD7A 5LMNW 4HIKA 3PF4A 5BR8L 2IY5B 3UDFA 1YHQA 5GADC 4A3LH 5C0XI 3PO2H 4KHPQ 1FVIA 2XGTA 1CKNA 1YHBA 4FDBA 3G4SA 1UE1A 4HIDA 1ASYA 1X65A 4OONA 1WI5A 4DR7Q 3K81C 3I2ZA 3CC4A 4OWXB 1OXSC 1YHAA 1PH9A 4OO1I 3DLLA 5JJLA 1YZ6A 3RN5A 1VQ6A 3FHWA 2R93G 3BJUA 3PUXA 1K3RA 4O0AA 1X3EA 2KHJA 1XJVA 1QVFA 4P72A 4A3GH 4BXXG 1WCMG 4LFBL 2R7FA 3AEVA 2UUCL 3JAMc 5M5WH 4DV1L 3W1GA 4LF4L 2PMZE 2AMCB 1Q46A 4MZ9A 5AJ3L 2QA4A 2OTJA 2KCMA 4BA2I 2B29A 3CMAA 4K0KQ 3HOXG 4NXNQ 1FL0A 4A3IG 1Q81C 1HNZQ 1L1OC 3HOUG 4A3CG 4B3RQ 2KCTA 2RHSB 3F8TA 1KHIA 2BH8A 1WFQA 5JJIA 4LF7L 5C4XG 2QGQA 3PIPA 1KD1C 1N33L 2OQKA 1CKMA 3H3VI 4LF6Q 3J80i 1XNQL 3CCEA 4H02A 2R7ZG 1HNXQ 2I0QA 4A4IA 5C3EH 3CMEA 4IPHA 1HZCA 2VL6A 5C0XG 2ZJRA 2JA6H 5FLMG 4A3IH 4YCUA 2Y0SE 4MNOA 4LFCQ 3OTOQ 4LF9Q 1YNXA 5M3MH 1PHJA 3HOVG 3L7ZC 1TWAH 3H0GG 3CQZH 4LF8L 3RNUA 4DV7Q 2JE6I 2NN6I 1CSPA 4QL5A 2C35B 4KHPL 4RG1A 3I4NH 1L1OA 1M90C 4LF8Q 2JQOA 1PYSB 4JI2Q 4DUZL 1IBKL 3PO3H 4ME3A 2LSSA 4IOCA 1VQFA 2OCEA 1PH4A 2CCZA 2R92G 1YEZA 1NTGA 4JOIC 4EX5A 3CCRA 3HOZG 2CQOA 4DK3C 4BBSG 2XTIA 4BY1H 2ZM6Q 2VQEQ 3MEFA 3S1RH 1H95A 2I5HA 5IWAQ 1GD7A 1XMOQ 1K83H 1V1QA 4IJLA 1XTDA 4EQ5A 3CCMA 4GOPB 3TRZA 5ELOA 4MTNA 4DK6C 5M5YH 5IWAL 1XMOL 1HNZL 4B3RL 4JI1Q 3CD6A 3RLOA 2DUDA 3RLFA 3J7ZC 2MO1A 2GVBA 1VQMA 1XPRA 4RMFA 4LF7Q 2PQAA 4JBJA 1CSQA 3JAMi 2JA7H 1OTCA 2A19A 3S2HH 3D0FA 3A5UA 3KF8B 4LUVA 3J81i 1S72A 4LF6L 5IYBG 4AH6A 4L5RC 4JV5Q 3WWVA 4JBKA 4B3ML 4JI4L 3Q8DA 5IP9G 1XMQL 2R7DA 4TQUS 5IP7H 4BY1G 4GN3B 4A3DG 5BR8Q 4QQBX 4R4TA 3CP0A 1Q82C 2UXCL 1M1KC 1X3FA 4C2MH 3CXCA 2K5NA 3HKSA 3ZJYC 5IYCH 3G6EA 3F2BA 2N49A 3LGJA 1HH2P 1OXVA 1TWFH 4P71A 3SGIA 4A3FH 3KOJA 4LFCL 2E2HH 2A1AA 3G48A 1QUQA 3BZCA 1TWHH 1HJPA 1VQJA 4Y52H 3KDFB 1SE8A 4JYAL 1HNWL 3H15A 4HJ5A 3W5OA 4DV7L 1EIFA 1V43A 4X66L 3GTJH 2ATWA 2MFIA 1LYLA 4DV0L 2WAQG 2ZTEA 3FKIG 1JJCB 4WJ4A 1XNRL 3BU2A 4DV2Q 2YU9H 3I4OA 1TWGH 5JEAG 1K8GA 1VQ9A 4JI8Q 2JJQA 1IYJB 2UU9Q 2UUCQ 1X6OA 1HZAA 3HKZE 4DV2L 3A74A 4DV1Q 4DR3Q 1SMXA 1OXTA 1PV4A 1JE5A 1N34Q 2ZTCA 3A5ZB 1N36Q 2KENA 1L1OB 1HR0W 2NVXH 4JC0A 1SR3A 3UDIA 4A3JG 1PFSA 3PUYA 1LUZA 2JA9A 2LXKA 2PI2A 2K50A 3ULPA 1E24A 3M4PA 1AH9A 2ZJPA 1U5KA 1WCMH 1Z47A 3T1HL 3S17H 4JI7Q 1C9OA 5M3FH 1X55A 5IY0A 2ZTDA 4HIOA 1XMQQ 4DV3Q 4UY8C 3AYHB 4JI7L 3NBHB 4LWCA 4R4OA 4BA1I 4DV5L 1R9TH 4DNIA 4GKJL 3KYHC 4LNQA 4KHZA 1VQ4A 4LUZA 1KQSA 2B63H 2PNHA 4A3KG 2EQSA 4JI5Q 4JI3Q 3K80C 3J80c 5LMNL 3PUZA 1QVCA 3HOZH 4YHHL 4A3CH 4AYBG 2OTLA 2NVYH 4DAMA 2AKWB 3U4ZA 3KF6B 1O7IA 4JYAQ 3S14H 1IXRA 1MIUA 1FGUA 1YVCA 4YCVA 4DUZQ 1IBKQ 4JI2L 3M4OH 3PSIA 3NELA 4BBRH 4X65L 2HT1A 1VQOA 1VQLA 3F1ZA 2HQLA 4X64Q 2Q2UA 4DR3L 4R4QA 3AFPA 1N34L 4QJFA 2CWPA 3L0OA 1FJGL 2ZJQA 2PQAB 5E7NA 1I3QH 5GAHC 4OO1G 5LMUL 1VQKA 4GKKQ 3M4QA 4IPCA 1KC8C 4L5QA 4YY3Q 1A63A 1HZ9A 4JI1L 3UDXA 1FJGQ 3U4VA 1UE6A 5LMUQ 4LF9L 4GKKL 2RCNA 4UP9A 4C3IH 4DR6L 4NPSA 2JA8H 4GNXC 1EOVA 1VQPA 3L2PA 4YWMA 3CCVA 4DV4Q 1MKHA 3H0GH 2Z6KC 4JBMA 2VUMH 1PH6A 4JI0Q 1PVOA 4B3MQ 4JI4Q 3HOUH 2RHQB 1NBWA 2BA1A 4YWKA 3T1YQ 3PIOA 1X9NA 5GROA 4NXMQ 5GAEC 1NY4A 2VQFQ 1TXYA 1UEBA 4IOAA 3PV0A 4HJ7A 2E5LQ 5C3EG 3ICEA 3D31A 1RIPA 1VQDA 4PMWA 4AQYL 4BY7G 4A3MH 1PH3A 2DGYA 2BH2A 2IHFA 2UXBQ 1Q86C 4LFBQ 5IYDG 3KJPA 5ELNA 2E8GA 2K52A 5AJ3Q 3NEMA 4DR5L 3VDYA 4GNXB 1W2BA 3GTLH 2JK8A 1K9MC 1PA6A 1K8AC 4IJHA 4A3DH 1E22A 1W3SA 2IX0A 1YIJA 2ALYB 3KJOA 3K7AH 4K0KL 4LW1A 4UP7A 1D8LA 2Y0SG 2IT1A 3ULLA 4X64L 3UE0A 2N8NA 3H3VH 1D7QA 1BBWA 1XNRQ 3MXNB 2NN6G 1E7ZA 3KFUA 1QVGA 3PO2G 3J7A5 1Y1WG 1WYDA 4A3LG 1VQAA 2HHHQ 4LF5Q 4BXXH 1XNQQ 2UUAL 2ES2A 4C3JH 4B3SQ 5M3FG 2AWOA 2YTYA 4DUYQ 3DM3A 4X62Q 3A0JA 1X54A 5C44H 1AE3A 2YYZA 4PG3A 5H1SE 3OTOL 4IFDG 4IO9A 4X6AH 4DR7L 3OW2A 4R4IA 3IRBA 1PH7A 1UWVA 1VQGA 4ALPA 3W1BA 1QZHA 3CF5A 4DPGA 1B8AA 4A76A 2VNUD 1A62A 1G51A 3KF6A 3T1YL 3S2DH 3M85A 5IYBH 4NXML 1MJCA 1JT8A 1NE3A 2HIVA 3HKZG 2HIXA 2H5XA 4NB3A 4A3KH 4L5TA 1A8VA 1YBYA 4YWLA 4JI0L 1XPOA 3I56A 3CPFA 1VQCA 3GTGH 5IYDH 3HOYG 5JJKA 4UP8A 4HJ8A 1VQIA 4BBRG 2F3IA 5LMNQ 3M3YH 1AE2A 3AQQA 2K5HA 3AFQA 3HOVH 5FJ8G 2A8VA 4DR4L 2JEAI 3JC66 2MO0A 3ER0A 1K0RA 1Q7YC 3CCJA 2Z6KA 1SN8A 4B3TL 4DR4Q 1S3OA 1K73C 1X3GA 4NXNL 4DR5Q 2R7ZH 1I94L 1CUKA 3K0XA 1Y14B 3EBEA 4GN5A 2ASBA 3I4MG 2GN5A 1PH5A 4YCWA 5DLQE 3S15H 4A3BG 3S16H 2UXCQ 1Q1BA 3GTPH 1Y1VH 2K5VA 4Y7NH 3FKIH 3OYYA 4GN4B 3F2DA 2HHHL 4LF5L 4POGA 4A93G 4IPGA 1X56A 3PUVA 4GLVB 4JI3L 2FXQA 1IZ6A 3TEHB 1J5EQ 3S1MH 2JEBI 1Z9FA 4GLXA 1WOCA 2D62A 2JA5G 1J5EL 4XTCS 4APVA 1JB7A 3HFZB 3EN2A 2MNAA 1UE7A 4OWWB 3I4MH 4P73A 1GM5A 1LTLA 1P8LA 1QUQB 4JBWA 1YITA 1DGSA 5C0XJ 5JEAJ 2ZM6L 2VQEL 1B70B 1L2FA 2I5MX 1SFOH 1TWCH 2AWNA 2D0PA 2WB1G 5FLXc 1JJ2A 4KLKA 4OX9Q 1S40A 3I7FA 3GTMH 1Q1EA 3FP9A 1KRTA 3UDGA 5K36G 2WFWA 1GO3E 2UXDL 4P75A 2N78A 3RLNA 3S1QH 4QGUA 4B3TQ 1YJWA 1IBLQ 3E0EA 3RZDH 3HOYH 3CW2C 1Q8KA 1IBLL 5M3MG 1N33Q 2NZHA 4L5SA 2Z0SA 4DV4L 1SROA 1BVSA 2Q2TA 3GO5A 2JA6G 3S1NH 4A3EH 2E2JH 1WJJA 3I4NG 4A3JH 1NMGA 1I94Q 4LFAQ 4JI5L 3PO3G 1VQHA 1HZBA 4B3SL 4PZ8A
chains in the Genus database with same CATH superfamily
3TZUA 2HCIA 1RKNA 2VY3A 1I5FA 2K04A 4QY7A 2VB3X 4IPDA 3S2DB 4P74A 1LTSD 1PZID 2CFMA 4QF4A 1HRJA 4JI8L 3GTKH 2KOLA 4ILWA 3PF5A 1YI2A 4YIJA 1VQ8A 3DEOA 4XIGS 2L15A 1DYQA 1J9OA 5IIFA 2I07B 3CRLC 2KHIA 4DAYB 1STNA 4DXGA 3U58A 3BS1A 3HOZB 3ERSX 2K1BA 1GUOA 2CW0D 1MJEA 3GTOB 4QIWE 1SEBD 3I8ZA 3HG9A 5GQOA 4A75A 4DNRB 2UXBL 1A15A 1B2TA 3A55A 2F0FA 1RTNA 2VQFL 1NMFA 2BOSA 2R93H 2Q2HA 4E6IA 4K2KA 4J15A 1CZWA 1I4QA 2A69C 4A3EG 1E1TA 3CKIB 2I5LX 2NB0A 4A3BB 1F9QA 5FJ8H 3TSSA 4PZ6A 1T5XD 1SRUA 2OWOA 2D2CC 2K32A 1Y8PB 1VMCA 1PTOD 1VQBA 5C44B 3MXGA 4BBSH 2YV5A 1KXLA 1F77A 1EY6A 3J81j 2M00A 1H9SB 4UAIA 3A8IE 2KECA 5NUCA 3URYA 1YJNA 1HR0Q 3QG1A 1I4XA 3LX0A 1S5BD 2C5CA 2IX3A 4XQNA 4GKJQ 3KLSX 5FLMH 3STBC 3CPWA 1KABA 1SLJA 1VQNA 4DV6Q 3D6WA 3K8AA 3E9IA 2V1CC 5IT9c 2UXDQ 1EQTA 1PRTF 1HQRD 3SEBA 1KNAA 2DY8A 1CHQD 4PZ7A 3HOUB 5J3BA 3G71A 1GKHA 2K7VA 4JV5L 4XT3B 5C44G 4U673 4K8JA 2B2UC 1UEAB 4RWSC 4A3GG 4DUYL 3HGBA 1PYBA 5LMNW 3PF4A 4CKEA 5GADC 4A3LH 3PO2H 4KHPQ 1FVIA 1NR4A 3Q23A 5K36H 1E2ZA 2NVTB 4K14A 3FPUB 3Q22A 3CC4A 1OXSC 1PYWD 1PH9A 2EYPA 3BDLA 1VQ6A 5KIXA 2NVYB 4O0AA 4BS9A 4QCLA 1QVFA 1KLUD 1F9PA 1MGSA 2A68C 2NN6H 3OHXC 4HR7B 4LF4L 3QJYA 2A6HC 3F2UA 2OTJA 5ELEA 1FL0A 1HNZQ 4PQXA 3HOUG 4B3RQ 3GV3A 2I46A 5T1IA 1WFQA 1WTWA 2HD3A 2K01A 1TS4A 2OQKA 5JEAH 2E2JB 1CKMA 2YU9B 4LF6Q 1B9MA 4H02A 2R7ZG 1HNXQ 1EWHA 2B8GA 5C3EH 3CMEA 5FLMG 4YCUA 1GHJA 3OTOQ 2DJFC 2EDGA 1HXYD 5AFWA 2FMCA 4DA2A 3L7ZC 4X3SA 4IQZA 4DV7Q 2NN6I 3NPPA 4KHPL 3CU7A 4OHJA 1EY5A 2PNRC 3MZ5A 1PYSB 1ZXTA 2L12A 2CCZA 2FJ2A 1NTGA 2XTIA 4BY1H 3S1RH 1GD7A 1LT3D 4RAUC 3FVQA 1XMOL 4DK6C 4O42A 1HNZL 4B3RL 4JI1Q 3J81L 1MD2D 2DUDA 3RLFA 2RSOA 4LF7Q 1CSQA 3WOEA 3TZDA 4KKUA 2F0PA 5TSSA 1D5XC 3Q0AA 4DK1A 5IYBG 4AH6A 4JBKA 2F0GA 3Q8DA 1QJOA 3OOCA 3CQZB 2H1EA 3OW7A 4TQUS 5IP7H 3MEHA 1Q82C 5LHY1 2A69D 1D5MC 1TWFH 1ESFA 5CV7A 4FO2A 3MTSA 3BZCA 1TWHH 1HJPA 4IZ8A 3SXHA 3KDFB 1SE8A 3D3RA 4ZUIA 3W5OA 3GTJH 3QB3A 4DV0L 5IGEA 4H0LC 4DV2Q 5JEAG 1O80A 1JICA 3V05A 1N36Q 3MVVA 5C4JB 1HR0W 1I4RA 3UDIA 4KJNA 1PZKD 4C2MB 1AH9A 4OL7A 1E24A 3T1HL 3P75A 3UI2A 5M3FH 3S17H 1X55A 5IY0A 1LLRD 1XMQQ 4UY8C 4R4OA 1LTBD 5LL6S 4GKJL 1SNCA 4KHZA 1VQ4A 2EOTA 2PNHA 2L11A 2E76C 1B1ZA 3BVMA 4EQPA 3NTIA 2KA7A 1WD1A 2NYZD 1H9MA 3I70A 1GXDC 3EFXD 3WDNA 3U4ZA 3G7LA 2EJMA 1YVCA 3PSIA 1KAAA 3NELA 4H44C 3MHBA 3E5SA 1VQLA 4X64Q 2Q2UA 1U4LA 4R4QA 3AFPA 5FO9B 1R9TB 2WB1B 1I3QH 3BG3A 4OO1G 3M4QA 3QIAA 1WTVA 1QILA 1WTRA 4K6DA 1BCPB 4J8QA 3RMHA 2L0CA 1BCPC 4H7BA 1SYCA 4BBSB 1V8QA 3DWQA 5CR3A 2VUMH 4JBMA 4F7XA 3SK8A 1O78A 4B9WA 2EYMA 4HSVA 3NTHA 3PIOA 1SMYC 4NXMQ 1NY4A 2VQFQ 1UEBA 3ERQA 2A5HA 1RIPA 1VQDA 4PMWA 4BY7G 4A3MH 2DGYA 2IHFA 4U68A 1TWFB 1FYCA 5EQ0A 2RDFA 4KD4A 4DK0A 3GTLH 1ML0D 1TR5A 1W3SA 2IX0A 2ALYB 4JW0A 4UP7A 5EBCA 3ULLA 1D1KA 2A6ED 1HA5A 2KQ3A 2NN6G 1GUSA 1QVGA 4KK7A 3M3YB 1NR2A 1WYDA 1SNQA 1VQAA 3N6RA 1WTXA 3KK7A 3MFGA 4B3SQ 4IUPA 2AWOA 4KV6A 4X62Q 4IUNA 4PG3A 3OTOL 1IHZA 1X32A 2J0TD 4Y7NB 4IO9A 4A3MB 1EOTA 4DR7L 4X6AH 2Z9HA 4R4IA 3W1BA 1LTID 3KF6A 3T1YL 2JA5B 1GJXA 2BDOA 3M85A 4O1NA 1JT8A 1JOKA 1NE3A 3HKZG 4NB3A 1YBYA 1HHVA 1G91A 3HZXA 2PPBC 4ULLA 3TP6A 3TP8A 2K5HA 4CGYB 3HOVH 4G7HC 3JC66 1Q7YC 1SN8A 1ENFA 5M3MB 3KBGA 1Y14B 1EIHA 3I4MG 3P7JA 2CVRA 1PH5A 3ZYYX 3VR4A 2IPKD 5I9PA 2E2DC 2D5DA 2HHHL 4POGA 4CKCA 1X56A 3C46A 2R61A 3GTLB 4XYOA 1Z9FA 1PTOB 1WOCA 2D62A 3H0GB 4FP5D 3EN2A 2CH4A 3T51B 4OWWB 2O4XA 3I4MH 5BN4A 1QUQB 4JBWA 2QCPX 1JWUD 2WINB 2ZM6L 5IGDA 1KDBA 2I5MX 1SFOH 1JJ2A 1DOLA 1M8AA 1F2MA 1KRTA 1BXTA 5K36G 2UXDL 2VB2X 2JP1A 3NTKA 2HCCA 1L0XB 1SYEA 4QGUA 4B3TQ 3EQLC 3MXPA 1W6KA 1YJWA 1C48A 4FYDA 2EXZA 3HOYH 4C3JG 1IBLL 2EJGC 3KF8A 1I4PA 2XN9C 2Q2TA 4QUCA 2JA6G 4DNTB 5IGCA 4A3EH 1PRTC 1NMGA 3K7AB 4NKLA 2TMPA 1BQQT 3PIP3 3A7AB 2R3ZA 4O2DA 5F2DA 2J7ZA 2XIWA 3U50C 3DWAA 4PMBA 2RSNA 4HJAA 1C0AA 1B4OA 4FXKC 1X3QA 2KHSA 2RVLA 3CC7A 1YJ9A 4IURA 4WJ3M 3KLWA 5JPMC 1VCIA 1DXMA 2YTXA 4TRDA 4HTHA 1ONLA 4OXPA 4QIWB 3RUZA 3PIO3 4DV0Q 1LT5D 4DR1L 1K0SA 5M3FB 2CH4W 3GDEA 1SYFA 3FKIB 2PZTA 5IP7G 3I55A 2Q2IA 3S24A 4X62L 5KNCA 4GLAC 2ZXOA 4I7ZC 3K0YA 1PH2A 3K5OA 1TWCB 2GVAA 1IL2A 5EBDA 2A6HD 3CCUA 2E5LL 2YTVA 4JVZA 3PCOB 4GOPA 3E3XA 3GV6A 1N9WA 4JOIA 1BBUA 5BN3A 1PFMA 3TP5A 4DKAC 2B63G 4X65Q 2JA7G 3A54A 2F0NA 4DR2Q 1ILPA 3CAMA 5EPKA 4JI6L 1SMYD 4BY7H 4JG2A 3TQYA 5FO8B 4TVAB 1N32L 1K8OA 4OX9L 1CKOA 5T1GA 1G291 2K5QA 5FOBB 1PH1A 1K8MA 3SDZA 3VYTA 2R6GA 4C3HH 5HGQA 3KBXA 3KLRA 1TY0A 3AB9A 3M7NA 3I4LA 4KN4C 2RCFA 1OXXK 1LM0A 2JXMB 1DCZA 2EYFA 4RHSA 1B3AA 2UUBL 1GOZA 2BA0A 4RHRA 2EIFA 1U4MA 2EPBA 4C1NI 2AHOB 4HJ9A 1V1OA 3VYSA 1RDPD 5JAVA 4H13C 2VS1A 3CC2A 3LWEA 1BBXC 5M5XH 4A3FG 3NHHA 1MSHA 1OXUA 3GTOH 4CDFC 4K5WA 1CK1A 5D3DA 2AQ3B 2VXWA 3MAQA 4G7ZC 1VQ7A 1V1PA 5DAUA 1V9PA 3HP3A 1L0WA 2E2IB 3S14B 2XVSA 1VQEA 2F3VA 2BE5C 2F4VL 1LTGD 1ENCA 2F0WA 3UE1A 2UU9L 1Q90A 4NP5A 5C5LA 1TS3A 3GD7A 2EVBA 3GTGB 5BR8L 3UDFA 2AQ1B 2B2YA 4OIKA 1SYGA 4K6LA 1F2ZA 1CKNA 1YHBA 2Q8TA 3K81C 4QB4A 4OO1I 1TS2A 3D4DA 3RN5A 5J39A 3BJUA 3T13A 1SNDA 1X3EA 3D4WA 1WTOA 4LFBL 1RTOA 4DV1L 3W1GA 4N9TA 1Q46A 4MZ9A 2CW0C 3PO3B 4BA2I 1CT1D 2B29A 4K0KQ 2PYKA 1BUVT 4A3IG 1L1OC 1JE4A 3F8TA 1KHIA 4LF7L 5C4XG 4IALA 3PIPA 1EY7A 2ZXPA 1NCVA 5IGGA 2AUKA 4ME5A 3H3VI 1EYDA 1UUPA 4CDCC 4CJ1B 1HZCA 2VL6A 3DXJC 5C0XG 1DZ1A 4MNOA 3T4AC 5IOCA 3U9OA 1SYBA 1SNOA 1LT4D 1PZJD 1TWAH 3H0GG 3R8BA 3I91A 1AP0A 2EY2A 3RD4A 4RG1A 3I4NB 1ENAA 1ET9A 3MC0B 2JQOA 1IBKL 3BDOA 3H09A 1GUTA 2F0VA 1PH4A 3ITPA 2KCCA 1YEZA 4JOIC 3HOZG 3S1MB 2CQOA 4BBSG 3S1NB 1A3TA 2ZM6Q 1AW7A 5M5XB 4A3JB 1H95A 1FR3A 1K83H 4IJLA 3V96A 1SDFA 2MGSA 4EQ5A 3TRZA 5IWAL 2LMCB 3RLOA 1TVXA 5KYIA 2IL8A 4QMGA 4BWGB 2A19A 3A5UA 2PW5A 3J81i 1S72A 2F0QA 4LF6L 2RDHA 3WWVA 5KNBA 2B2YC 5IP9G 1XMQL 1PXUA 4GN3B 3S17B 2UXCL 2QDLA 4C2MH 3G6EA 2N49A 4P71A 3I4NG 4A3FH 3KOJA 4LFCL 4L63B 1TIID 2Q8IB 2L5TA 3VA7A 1SSOA 4BY7B 2ZXRA 5FLXE 1JOOA 1VF7A 1VQJA 2AUJD 5I2YA 3LNNA 4JYAL 1R4QB 2NTTA 5I9OA 4DV7L 1EIFA 2MFIA 2WAQG 3I90A 1JJCB 2YU9H 1ICFB 1OO9B 1TWGH 2JSOA 1VQ9A 4JI8Q 1A2UA 1AFPA 1IYJB 1EZ8A 3I3CA 1X6OA 4LMQD 3HKZE 2D9UA 3A74A 1VMPA 1SMXA 1OXTA 1Y8OB 2ZTCA 2EY5A 2KENA 1L1OB 1MBYA 1SR3A 3P20A 3PUYA 3S16B 1LUZA 1SE3A 4L6TB 3H6MA 3ULPA 2ZJPA 2F0OA 1WCMB 4JI7Q 1IW7C 2ZTDA 4MN3A 4ZAIA 3AYHB 4LWCA 3KYHC 2WKCA 5C6AA 2XWBB 4CJ0B 1PTOC 3BYYB 3HKZB 4JI3Q 3K80C 3OSOA 3DHQA 1QVCA 3PUZA 1AZPA 4YHHL 1SYDA 2AKWB 1EU4A 2RDGA 3R2IA 3SK4A 1IXRA 3DUZA 1E2WA 4DUZQ 4JI2L 4BBRH 5IODA 2LFNA 1VQOA 3F1ZA 4DAPA 3PMFA 4JPBW 4DR3L 5G3LD 3L0OA 2ZT9C 2EYOA 5E7NA 5GAHC 1DOMA 1VQKA 2RA4A 1KC8C 1A63A 1HZ9A 3UDXA 2EYLA 1STYA 4LF9L 1HPCA 4RKBA 3H91A 3FPPA 4PNYA 5I6WA 2O5IC 4GNXC 1VQPA 4YWMA 4C1NK 3H0GH 4XDXA 2Z6KC 3VR2A 2VUMB 4B3MQ 3S15B 3T1YQ 2O2LD 4WJWA 4V0BA 2LS01 5FLXL 1ZYRD 5C3EG 3ICEA 3C1FA 4AQYL 4RA8A 3A7LA 1PH3A 2UXBQ 2PQEA 1Q86C 3E6ZX 1B9NA 3SK6A 5ELNA 3C2PA 3R3OA 1Y69U 3OIPA 5CGKA 4GNXB 3NE5B 2JK8A 1UAPA 5EGTA 4PMCA 4K0KL 3K7AH 3IFDA 2K03A 1BBWA 1U9RA 1XNRQ 3MXNB 1G2TA 3DMUA 3KFUA 3K6OA 3PO2G 4F87A 4C56C 1XNQQ 2DN8A 2ES2A 2PCFB 2YTYA 4BBRB 1QCBD 1X54A 5E4XA 5A2QE 4IFDG 2F0IA 3OW2A 1UWVA 1QZHA 4DPGA 1B8AA 4K2LA 1A62A 5IYBH 1FNWA 2HIVA 2HIXA 4A3KH 4YWLA 3I56A 1VQCA 5JJKA 5IYDH 3HOYG 4R8IA 1EQVA 1VQIA 4KJOA 3M3YH 4XYQA 3J80L 2JEAI 4NDXA 4A3GB 2Z6KA 4DR4Q 1TWAB 1K73C 4NXNL 2MP1A 1I94L 1CUKA 1E0BA 2ASBA 4FVMA 1TKWB 1HUMA 2UXCQ 1Q1BA 1Y1VH 2DNEA 4Y7NH 3FKIH 5K5PA 4GN4B 1KDCA 3CHBD 4IPGA 1K3BC 4GLVB 4JI3L 4P2CB 1TT2A 2JEBI 2G9DA 1J5EL 3SK5A 3HFZB 1UE7A 2B8FA 3EJIA 4P73A 1EZ6A 1YITA 4K5VA 1U4PA 2EYJA 1L2FA 2NUCA 1RF2D 2AWNA 1WTHA 4OX9Q 3I7FA 3GTMH 3GTKB 2Z4HA 2WFWA 5JOBA 2NBFA 1EIGA 2XWJB 2Z0SA 3GO5A 1WJJA 1LO5D 4A3JH 1RD9D 5CV5A 3DEPA 1VQHA 1HZBA 2E2HB 5M5YB 3SE0A 1GVPA 2F0MA 2R92H 5IT9L 3EVQA 2RF4A 1KL9A 1MHWC 4GNXA 2M9VA 5IE8A 3W2DA 2CQAA 2NVXB 5EAYA 3IAYA 2X69A 1RL2A 3M9BA 2EXDA 3ULJA 1HTLD 1IW7D 1I6HB 5D14A 2HDLA 5JVG3 3EROA 2VW9A 1HNWQ 4DR1Q 1WVLA 2A73B 1LT6D 2Z4IA 2HQEA 1JMCA 2WACA 2NZ1D 1LTRD 2J4XA 2N88A 3BZKA 2CKZB 4K8IA 2OQ0A 1JJGA 4OWTB 2NVQH 3NENA 2KVMA 3D8GA 2BE5D 3J7YW 4HIMA 4R1JA 3RZOB 1H9RA 2F0DA 4S3SA 3TBIB 1EQQA 1QOHA 4RGOS 4LFAL 3OWEB 1UNSA 2E2IH 2B3GA 5DNFA 4R8NA 3U9SA 5C4JH 4LK1C 2EJFC 3NSWA 1EYGA 1S5FD 2AQ2B 4WORA 1EL0A 5CC4A 4Z9CB 2EYHA 1J6QA 4QUFA 4DR2L 2XSCA 2JN4A 2B2VA 3FRPB 3F2CA 4KHVA 1D6EC 1CKNB 4M1UB 1WTPA 1IBMQ 5KEEA 4A93H 1EY0A 3P1HA 3BYTB 1B44D 3PGZA 1PFBA 1Y1VG 1ZEQX 2R92B 3J7AV 4RCNA 1N36L 1ET6A 1A3UA 4IFDI 1U0LA 2F52A 2N3SA 5C4XH 1DM0B 3HOWG 3CCLA 2QEXA 4DV3L 3RN2A 5KYLA 1TY2A 2FINB 2K05A 4ID6A 1P16A 5C0XH 1EQRA 2CWAA 1I4HA 4DV5Q 3STBD 4RGTA 1ASZA 2PI2E 3AMUA 1EY8A 4EVOA 2JA8B 3VYUA 3J81c 1EYAA 4DV6L 1EFWA 1NJIC 4IFDJ 5C5MA 4JI6Q 2VZAA 1I50B 5M5WB 1I50H 3GQBA 1O7LA 2QW7A 3HOXB 4LAAA 4TSSA 1CM9A 3ND9A 1IBML 1ICWA 4LUOA 1VS0A 3MFYA 1SJHD 2KEDA 3EIVA 1RHPA 1A6XA 2IY5B 2JYOA 3NXWA 3NUCA 1YHQA 3T56B 5CV8A 2KEEA 4OELB 5C0XI 5C3EB 4FDBA 3G4SA 1UE1A 4OONA 5ELDA 1WI5A 4DR7Q 1EEID 2F3WA 4RGMA 1LABA 5JJLA 1YZ6A 2OF1A 1B3QA 1K3RA 4A3GH 1KTKA 4BXXG 3AEVA 2XRSD 3JAMc 5M5WH 2RBMA 4MIUA 2PMZE 2AMCB 3KLSA 2KCMA 3CMAA 5CORA 3HOXG 2F1MA 3FMCA 2KCTA 3VR5A 5JJIA 1KD1C 1A2TA 3I72A 1XNQL 3CCEA 2O5JC 2I0QA 4A4IA 4IPHA 2F0EA 2JA6H 2JA7B 4A3IH 2Y0SE 1HQMC 5M3MH 1PHJA 4FF3A 4LF8L 3RNUA 2JE6I 1ESRA 1CSPA 1RCVD 3I4NH 1L1OA 4KY5A 3VA5A 4JI2Q 4DUZL 5FO7B 3TDQA 2R92G 1VQFA 2OCEA 1EWCA 5EKLA 5LL6X 4EX5A 4CDDC 2CHBD 1LACA 1S5CD 3MEFA 2MUYA 2I5HA 5IWAQ 1BNZA 5E3FA 3TP7A 2SNMA 2V4DA 2EE1A 4N8X1 4I7AA 5ELOA 4MTNA 5IT9E 1JWSD 3CD6A 5BN5A 1VQMA 2QKIC 2EY1A 2MO1A 3J7ZC 1XPRA 2IJ0A 4JBJA 3JAMi 2JA7H 3S2HH 1G6ZA 2F0TA 2XRQD 4LUVA 4JV5Q 4X3KA 4JI4L 5E4WC 4XQQA 2R7DA 4FF4A 1JC7A 1I6VC 4BY1G 2GA4B 5BR8Q 4A3DG 1NNXA 3S1QB 5EPLA 3N52A 4R4TA 4MTKA 1FNUA 4EQNA 1M1KC 1X3FA 3CXCA 3ZJYC 5EJWA 5IYCH 3F2BA 3C1EA 1OXVA 4KY6A 2A1AA 1QE6A 1QUQA 4C3IB 1H9JA 1S4ZA 3MWYW 3H15A 1X3PA 4X66L 2ZTEA 2F4IA 2HUGA 5DEHA 1PDQA 4WJ4A 3BU2A 1IYVA 1K8GA 3HOWB 2PMZB 3K5NA 1HZAA 4DV2L 1N34Q 1PV4A 4DV1Q 3A8JE 1JE5A 1MSGA 3WOFA 3JAML 2NVXH 2L9HA 4A3JG 1AEXA 1DD2A 2JA9A 2LXKA 1U5KA 1KDAA 1XXGA 1Z47A 5M9OA 3NQIA 4HIOA 4DV3Q 4MHEA 4DV5L 3OMGA 1R9TH 2K6AA 1Q3LA 4DNIA 3GTJB 1KQSA 4CDEC 4A3KG 2B63H 4JI5Q 4Q0FA 2KUMA 3E0JA 4F8MA 5C3XA 1TWHB 5LMNL 2LY7A 1I4GA 4A3CH 1SNMA 3KUPA 2OTLA 4FF2A 2NVYH 3K57A 4JYAQ 3S14H 1MIUA 1IBKQ 3M4OH 4X65L 2K28A 2HQLA 2R7ZB 2L1BA 3L3OC 1N34L 2CWPA 3PO2B 1FJGL 3ONAB 2ZJQA 2PQAB 4DU9A 1STGA 5LMUL 2NWGA 4IPCA 5L37A 3U4VA 1UE6A 4GKKL 1SBBB 2RCNA 4UP9A 4NPSA 2G9HD 2WKDA 4ZRZA 3L2PA 3CCVA 2B39A 4NW2A 5C4ZA 1MKHA 4IUTA 1VDZA 4EQOA 4JI4Q 3HOUH 4L8JA 1NBWA 2BA1A 4YWKA 1S5ED 3HEJA 5GROA 5GAEC 3PV0A 5A35A 4C3HB 4V190 4GZYC 4LFBQ 3NWTA 5IYDG 3DWPA 2E8GA 1F9SA 1YNNC 5AJ3Q 1EU3A 1W2BA 2IW3A 1K8AC 4A3DH 1YIJA 3KJOA 4LW1A 4X64L 1D8LA 2Y0SG 2IT1A 2N8NA 1D7QA 1I3QB 2PW7A 1STEA 2M2LA 1R4PB 2EZVA 1FGBD 1YNJC 1Y1WG 4A3LG 1D1IA 2HHHQ 4LJZC 4C3JH 4A3IB 1KNEA 5M3FG 2SEBD 1JOQA 3AU7A 3DM3A 5CV6A 5C44H 1AE3A 5FK9C 1IKLA 3IRBA 1VQGA 4RCOA 3CF5A 4A76A 1G51A 1G8ZD 4NXML 3M4OB 2A6EC 2H5XA 4L5TA 3CRKC 3HRZC 3CPFA 4RGNA 3GTGH 4WFN3 5KGUA 4BBRG 3VYRA 1AE2A 3AQQA 1T5EA 3AFQA 2B2WC 2A8VA 4DR4L 3X3MA 1PLFA 3ER0A 3H94A 5ELCA 3CCJA 2JA6B 1S3OA 1HUNA 2DJGC 3SR1A 5IGFA 4DR5Q 4ZKCB 2FFKB 2R7ZH 3K0XA 4C3JB 3EBEA 2GN5A 2Y0SB 1HFNA 4YCWA 3S15H 3GTPH 2K5VA 3FDTA 3OYYA 1D2BA 2WIIB 1J5EQ 3TEHB 4A3FB 1IZ6A 1AZQA 1ZYRC 2JA5G 1IL8A 4XTCS 1JB7A 5I6YA 1Q8IA 3SHLA 5J1ZA 4BY1B 1DONA 3V2TA 1GM5A 1LTLA 4FXGC 3J80E 2ENBA 1H9KA 5EKIA 5JEAJ 4UHVA 5C0XJ 1B70B 2VQEL 4OO1H 1TWCH 5J22A 1HTPA 1BCPF 1SAPA 4HN7A 4KLKA 4F88A 5KRUA 4ZUJA 3G6JB 1Q1EA 3FP9A 3UDGA 1QG7A 4P75A 2N78A 5ELBA 1K28A 3RLNA 3S9WA 3S1QH 1CTMA 1GHKA 3W3AA 1RJTA 1Q8KA 4OGQC 5M3MG 1B50A 1N33Q 2NZHA 1EEFD 1EFID 2E74C 1BVSA 4HEDA 5CMDA 1QNKA 1EYCA 3S1NH 2E2JH 1PTOH 4KKSA 3S1RB 3H3VC 4B3SL 4PZ8A 3M7GA 1JCKB 1CA6A 1SJED 4POFA 2K75A 2SOBA 3GP7A 3OMCA 1T9HA 4YHHQ 1Y1WH 1C7YA 2JA5H 5HY6A 1BR9A 4AYBE 1CZGA 3RR5A 2MPMA 3KDFA 2F0HA 1BKBA 2WB1E 1TS5A 1PFNA 1E1OA 1SNPA 2KBNA 3B6YA 3VR3A 1Y1VB 3CCSA 4YY3L 2F0JA 2X6LA 2UUAQ 5EKKA 2NVTH 4DR6Q 1GUGA 2WAQB 2K5WA 5IP9H 1JB3A 3J7AF 2WV6D 4GOPC 4KKTA 2UUBQ 3GTQH 3K7UC 4FNFA 3HOXH 3RZOH 2HDMA 2Z1CA 4RFBA 4CHTB 4R4CA 3VR6A 5IYCG 3HOWH 4AQYQ 3MXUA 4UPAA 4K5XA 2E75C 2JA8G 2L55A 3PUWA 2WAQE 1N8RC 1EUJA 3J81E 1O7ZA 2K4KA 3IFTA 3BZDB 5KNDA 4GS3A 4RKLA 1RODA 3NQTA 2K33A 2D0OA 1KAWA 1E3PA 1FNVA 1K83B 4I65A 2NZOA 1A0IA 4X66Q 1LTTD 4R9WA 1TQOA 1PH8A 4A3MG 1CQFA 5JVH3 3CCQA 4XT1B 2MQHA 2LXJA 4KMUC 2A68D 5CYUA 3OIQA 1JWMD 4G7OC 1O7YA 3EA6A 3TS2A 1HR0L 3TS0A 3DM1A 3LWUA 2ID0A 4AIMA 2K14A 3T1HQ 3NK9A 4ZCKA 1KRSA 2IX1A 2WP8J 3TREA 5GAGC 4DFAA 2EY6A 4B9XA 3E9HA 1XPUA 3Q24A 3TMEA 1I6HH 1EWIA 3TN2A 1G6PA 2VUMG 1QNUA 2IHEA 4JCVE 5COYA 4A3BH 2PZWA 1E2VA 3I73A 5HGTA 1TU2B 1QZGA 1B7YB 1VQ5A 1XX8A 2K5DA 3A56A 1HNXL 1EIYB 5C4XB 1N32Q 1UE5A 3BVGA 5CV9A 1Q12A 4KI0A 1KIXA 2F4VQ 5G3LF 4DAVA 5ISRA 4HIKA 3NWSA 1NUCA 5EPJA 1LTAD 2XGTA 2QDBA 4CBVA 4HIDA 1ASYA 1X65A 3I2ZA 4OWXB 1TWGB 1XTCD 1YHAA 4EGVA 1F2LA 4DXFA 2H4OA 3DLLA 4JK1C 1CHPD 3FHWA 3K5MA 3PUXA 2R93G 4OEMB 1XJVA 5D65A 2KHJA 2B2WA 2PZUA 4RH6A 1JORA 4P72A 4PV1C 1AN8A 1WCMG 2R7FA 3HS0C 2UUCL 2QA4A 5AJ3L 2XNAC 3IKJA 5CBEE 2FMMA 4NXNQ 1VF5C 3QOJA 1Q81C 4A3CG 3ND8A 1B53A 2RHSB 2F0SA 4ZKBB 2BH8A 2DY7A 1ILQA 2QGQA 1N33L 1STBA 2KCNA 3C3LA 3J80i 4N8FA 1BO0A 5IGBA 4TKOB 1PRTB 2SDFA 2C9OA 2ZJRA 1F2YA 2LKVA 4LFCQ 1BOSA 4LF9Q 1YNXA 3HOVG 1IYUA 3T16A 3CQZH 3NBIA 4QL5A 2C35B 5ELFA 1M90C 4LF8Q 3PO3H 4ME3A 2LSSA 1WD0A 4IOCA 4XXEA 3CCRA 4DK3C 4FXDA 2NTSA 2VQEQ 1SXTA 1XMOQ 1V1QA 4KD3A 1XTDA 1Y8NB 3QOLA 2F0LA 1SE2A 3CCMA 4GOPB 5M5YH 4CJ2C 2X6GA 4KN7C 2GVBA 4IUVA 4RMFA 1M4VA 2PQAA 2Z6BA 3OPOA 1OTCA 3D0FA 3KF8B 4OIJA 4L5RC 3D6CA 5CBAE 4B3ML 5JJZA 2MJ8A 1CQVA 4HCSA 4QQBX 1NAPA 4XQJA 3OWFA 2B2UA 3CP0A 2PO4A 1BDOA 1F9RA 2K5NA 3HKSA 4A3KB 3LGJA 3SGIA 1HH2P 2E2HH 3G48A 4ABNA 4IN3A 2L4NA 4Y52H 3GTQB 1HNWL 4HJ5A 1V43A 2ATWA 5FKAC 1LYLA 3FKIG 1XNRL 3I4OA 2JJQA 2UU9Q 2UUCQ 4DR3Q 4LF4Q 1STHA 1SFOB 3A5ZB 2TSSA 1CFMA 3MA2B 4JC0A 4ZQ3A 5C4HA 1PFSA 3GTMB 1GUWA 2OT2A 2PI2A 2K50A 3M4PA 4IUQA 4B08A 1WCMH 1C9OA 2R93B 5DM63 3R2TA 4HSPA 4M8AA 4JI7L 3NBHB 4A3EB 4BA1I 4KTAA 4LNQA 4LUZA 5CV4A 1QB5D 2EQSA 4N9PA 1Z6HA 4HMJA 3S2HB 3J80c 4HCEA 3HOZH 1J8IA 4AYBG 4DAMA 4DF7A 3KF6B 1O7IA 2A74C 1FGUA 4YCVA 3FEWX 2HT1A 3M4YA 1Y1WB 3NBHA 4ZYSA 1C8CA 1II3A 1XWEA 1V1PB 4G57A 5E1FA 1FD7D 4J6HA 3NP8A 4QJFA 5JPNC 1Z7TA 3QO2A 4GKKQ 4L5QA 3R93A 4YY3Q 3K59A 1EY9A 4JI1L 1FJGQ 5LMUQ 4C3IH 4DR6L 2JA8H 1EOVA 4DAYA 4DV4Q 1XYIA 4C3HG 1HA6A 3SVMA 1CI3M 4G4KA 1PVOA 1PH6A 4JI0Q 5HURA 2RHQB 5I4DA 1X9NA 4UDUC 1TXYA 4IOAA 2N55A 4HJ7A 2E5LQ 3D31A 3GTPB 1A3VA 4HMIA 2BH2A 3PQIA 3K58A 3T53B 2SNSA 3KJPA 1NSNS 2Q8RE 4ODGA 2K52A 3Q6SA 3NEMA 4DR5L 3VDYA 1K9MC 1PA6A 4IJHA 5C3WA 1JQYD 1E22A 2OXPA 3H3VH 3UE0A 1H9SA 1D5ZC 5A2QL 1E7ZA 3J7A5 4LF5Q 4BXXH 2UUAL 1KLGD 4IUUA 3QWNA 3BVZA 2B63B 4DUYQ 2G5DA 3A0JA 2YYZA 3MXNA 5H1SE 1U4RA 1GUNA 3K5LA 1HFGA 4C3IG 4HAEA 1PH7A 4DN4M 2RQXA 4ALPA 3HOYB 3L9AX 2VNUD 4J1MA 3S2DH 4IFDH 1MJCA 2B2VC 1IKMA 1A8VA 4JI0L 4CKBA 2IWHA 2ICEC 1XPOA 1QWYA 1W6JA 4UP8A 4HJ8A 4X3TA 2B2TC 2BCOA 2F3IA 5LMNQ 2QILA 1JR0D 2F0UA 5FJ8G 1PMRA 2MO0A 3QR8A 3I4MB 1K0RA 4X3UA 5D3IB 4B3TL 1X3GA 1S5DD 1PRTD 1HCZA 2OEOA 2F03A 2MHVA 1PTOF 1WTQA 2KJXA 4FF1A 3RZDB 4GN5A 5DLQE 4A3BG 1G2SA 3S16H 3X3NA 2QEJC 1YNJD 1MI2A 4WRDA 3F2DA 4LF5L 4A93G 1DOKA 1STAA 4AYBB 3S1MH 2DNCA 3PUVA 5DM73 2FXQA 3IL8A 4GLXA 2F0KA 4APVA 2MNAA 2NVQB 4A3DB 4A93B 1P8LA 3JAME 3HOVB 1DGSA 4KY7A 2ICIA 1YNND 1L0YB 4NMZA 1DJRD 2D0PA 1BCPD 1C4QA 2WB1G 5FLXc 2RKSA 4ZLTF 4Q5VA 1S40A 1LV9A 2QF7A 1BF4A 1GO3E 1ZKOA 3O13A 3BDCA 1IBLQ 3E0EA 4DGZA 3RZDH 3A8KE 2B2TA 3CW2C 2P5ZX 5I2XA 4L5SA 3D4RA 4DV4L 1SROA 1EY4A 2BDNA 1SE4A 1I94Q 4LFAQ 4JI5L 3PO3G 4ZK9B 2FHTA 1CA5A 2Z8LA
chains in the Genus database with same CATH topology
1GVPA 4O2DA 2R92H 3U50C 4LF4Q 4POFA 2RF4A 1KL9A 4GNXA 2K75A 4HJAA 5IE8A 2VY3A 1I5FA 5EAYA 1C0AA 4QY7A 4IPDA 1T9HA 4YHHQ 1Y1WH 1C7YA 2JA5H 5HY6A 1RL2A 3M9BA 3CC7A 2EXDA 4AYBE 3RR5A 3ULJA 1YJ9A 3KDFA 4WJ3M 3KLWA 1BKBA 4P74A 1VCIA 2WB1E 2CFMA 2VW9A 4JI8L 2YTXA 1HNWQ 2KBNA 1E1OA 3GTKH 3B6YA 4DR1Q 4OXPA 3PF5A 3CCSA 1YI2A 4DV0Q 4YY3L 1VQ8A 4XIGS 2L15A 4DR1L 2UUAQ 2NVTH 3GDEA 4DR6Q 1JMCA 2KHIA 4DAYB 5IP7G 3I55A 2Q2IA 3S24A 5IP9H 3BZKA 4X62L 2CKZB 4GLAC 2OQ0A 4GOPC 2UUBQ 1JJGA 4OWTB 1PH2A 3U58A 2NVQH 3GTQH 3NENA 3K7UC 3HOXH 2GVAA 4HIMA 4R1JA 3RZOH 1IL2A 3ERSX 4R4CA 5IYCG 1MJEA 1EQQA 3CCUA 2E5LL 2YTVA 4QIWE 4LFAL 3HOWH 5GQOA 3PCOB 2E2IH 4AQYQ 4UPAA 2B3GA 4A75A 2UXBL 4GOPA 2JA8G 3PUWA 5C4JH 2VQFL 1NMFA 1EYGA 2R93H 2WAQE 2Q2HA 1N9WA 4JOIA 1EUJA 1N8RC 4J15A 4A3EG 1BBUA 2K4KA 1J6QA 4GS3A 4DR2L 4DKAC 1E1TA 2I5LX 2D0OA 2B63G 5FJ8H 4X65Q 2JA7G 1KAWA 4DR2Q 1E3PA 3CAMA 4JI6L 2NZOA 1A0IA 4PZ6A 4X66Q 1PH8A 1SRUA 4A3MG 3F2CA 4BY7H 4JG2A 3TQYA 3CCQA 1CKNB 2OWOA 4TVAB 2MQHA 2LXJA 1IBMQ 1N32L 4OX9L 1CKOA 1G291 4A93H 1VQBA 1PH1A 4BBSH 2YV5A 1KXLA 3PGZA 1Y1VG 2R6GA 4C3HH 5HGQA 3M7NA 3J81j 3TS2A 1HR0L 1N36L 3TS0A 1OXXK 1LM0A 2ID0A 4AIMA 2K14A 1U0LA 2F52A 2N3SA 5C4XH 3T1HQ 1YJNA 1HR0Q 3HOWG 4IFDI 3CCLA 2UUBL 1KRSA 2QEXA 4DV3L 2WP8J 3TREA 2IX1A 2BA0A 5GAGC 3RN2A 3E9HA 1XPUA 4GKJQ 1I6HH 2EIFA 4HJ9A 1EWIA 2AHOB 1G6PA 5FLMH 3STBC 3CPWA 1P16A 1EQRA 2CWAA 2VUMG 1SLJA 2IHEA 4JCVE 4DV5Q 1VQNA 2VS1A 3STBD 4DV6Q 3CC2A 4A3BH 3K8AA 2PI2E 2V1CC 3E9IA 5M5XH 4A3FG 1ASZA 5IT9c 3J81c 4DV6L 2UXDQ 1OXUA 1EFWA 1NJIC 3GTOH 4IFDJ 4JI6Q 2VZAA 1QZGA 1I50H 1B7YB 4PZ7A 1VQ7A 1VQ5A 5J3BA 3G71A 1V9PA 1GKHA 1L0WA 1HNXL 1EIYB 1IBML 1UE5A 1VQEA 1N32Q 4LUOA 2F4VL 4JV5L 1Q12A 1VS0A 4KI0A 3UE1A 5C44G 2UU9L 1KIXA 2F4VQ 4A3GG 4DUYL 3EIVA 1PYBA 3GD7A 5LMNW 4HIKA 3PF4A 5BR8L 2IY5B 3UDFA 1YHQA 5GADC 4A3LH 5C0XI 3PO2H 4KHPQ 1FVIA 2XGTA 1CKNA 1YHBA 4FDBA 3G4SA 1UE1A 4HIDA 1ASYA 1X65A 4OONA 1WI5A 4DR7Q 3K81C 3I2ZA 3CC4A 4OWXB 1OXSC 1YHAA 1PH9A 4OO1I 3DLLA 5JJLA 1YZ6A 3RN5A 1VQ6A 3FHWA 2R93G 3BJUA 3PUXA 1K3RA 4O0AA 1X3EA 2KHJA 1XJVA 1QVFA 4P72A 4A3GH 4BXXG 1WCMG 4LFBL 2R7FA 3AEVA 2UUCL 3JAMc 5M5WH 4DV1L 3W1GA 4LF4L 2PMZE 2AMCB 1Q46A 4MZ9A 5AJ3L 2QA4A 2OTJA 2KCMA 4BA2I 2B29A 3CMAA 4K0KQ 3HOXG 4NXNQ 1FL0A 4A3IG 1Q81C 1HNZQ 1L1OC 3HOUG 4A3CG 4B3RQ 2KCTA 2RHSB 3F8TA 1KHIA 2BH8A 1WFQA 5JJIA 4LF7L 5C4XG 2QGQA 3PIPA 1KD1C 1N33L 2OQKA 1CKMA 3H3VI 4LF6Q 3J80i 1XNQL 3CCEA 4H02A 2R7ZG 1HNXQ 2I0QA 4A4IA 5C3EH 3CMEA 4IPHA 1HZCA 2VL6A 5C0XG 2ZJRA 2JA6H 5FLMG 4A3IH 4YCUA 2Y0SE 4MNOA 4LFCQ 3OTOQ 4LF9Q 1YNXA 5M3MH 1PHJA 3HOVG 3L7ZC 1TWAH 3H0GG 3CQZH 4LF8L 3RNUA 4DV7Q 2JE6I 2NN6I 1CSPA 4QL5A 2C35B 4KHPL 4RG1A 3I4NH 1L1OA 1M90C 4LF8Q 2JQOA 1PYSB 4JI2Q 4DUZL 1IBKL 3PO3H 4ME3A 2LSSA 4IOCA 1VQFA 2OCEA 1PH4A 2CCZA 2R92G 1YEZA 1NTGA 4JOIC 4EX5A 3CCRA 3HOZG 2CQOA 4DK3C 4BBSG 2XTIA 4BY1H 2ZM6Q 2VQEQ 3MEFA 3S1RH 1H95A 2I5HA 5IWAQ 1GD7A 1XMOQ 1K83H 1V1QA 4IJLA 1XTDA 4EQ5A 3CCMA 4GOPB 3TRZA 5ELOA 4MTNA 4DK6C 5M5YH 5IWAL 1XMOL 1HNZL 4B3RL 4JI1Q 3CD6A 3RLOA 2DUDA 3RLFA 3J7ZC 2MO1A 2GVBA 1VQMA 1XPRA 4RMFA 4LF7Q 2PQAA 4JBJA 1CSQA 3JAMi 2JA7H 1OTCA 2A19A 3S2HH 3D0FA 3A5UA 3KF8B 4LUVA 3J81i 1S72A 4LF6L 5IYBG 4AH6A 4L5RC 4JV5Q 3WWVA 4JBKA 4B3ML 4JI4L 3Q8DA 5IP9G 1XMQL 2R7DA 4TQUS 5IP7H 4BY1G 4GN3B 4A3DG 5BR8Q 4QQBX 4R4TA 3CP0A 1Q82C 2UXCL 1M1KC 1X3FA 4C2MH 3CXCA 2K5NA 3HKSA 3ZJYC 5IYCH 3G6EA 3F2BA 2N49A 3LGJA 1HH2P 1OXVA 1TWFH 4P71A 3SGIA 4A3FH 3KOJA 4LFCL 2E2HH 2A1AA 3G48A 1QUQA 3BZCA 1TWHH 1HJPA 1VQJA 4Y52H 3KDFB 1SE8A 4JYAL 1HNWL 3H15A 4HJ5A 3W5OA 4DV7L 1EIFA 1V43A 4X66L 3GTJH 2ATWA 2MFIA 1LYLA 4DV0L 2WAQG 2ZTEA 3FKIG 1JJCB 4WJ4A 1XNRL 3BU2A 4DV2Q 2YU9H 3I4OA 1TWGH 5JEAG 1K8GA 1VQ9A 4JI8Q 2JJQA 1IYJB 2UU9Q 2UUCQ 1X6OA 1HZAA 3HKZE 4DV2L 3A74A 4DV1Q 4DR3Q 1SMXA 1OXTA 1PV4A 1JE5A 1N34Q 2ZTCA 3A5ZB 1N36Q 2KENA 1L1OB 1HR0W 2NVXH 4JC0A 1SR3A 3UDIA 4A3JG 1PFSA 3PUYA 1LUZA 2JA9A 2LXKA 2PI2A 2K50A 3ULPA 1E24A 3M4PA 1AH9A 2ZJPA 1U5KA 1WCMH 1Z47A 3T1HL 3S17H 4JI7Q 1C9OA 5M3FH 1X55A 5IY0A 2ZTDA 4HIOA 1XMQQ 4DV3Q 4UY8C 3AYHB 4JI7L 3NBHB 4LWCA 4R4OA 4BA1I 4DV5L 1R9TH 4DNIA 4GKJL 3KYHC 4LNQA 4KHZA 1VQ4A 4LUZA 1KQSA 2B63H 2PNHA 4A3KG 2EQSA 4JI5Q 4JI3Q 3K80C 3J80c 5LMNL 3PUZA 1QVCA 3HOZH 4YHHL 4A3CH 4AYBG 2OTLA 2NVYH 4DAMA 2AKWB 3U4ZA 3KF6B 1O7IA 4JYAQ 3S14H 1IXRA 1MIUA 1FGUA 1YVCA 4YCVA 4DUZQ 1IBKQ 4JI2L 3M4OH 3PSIA 3NELA 4BBRH 4X65L 2HT1A 1VQOA 1VQLA 3F1ZA 2HQLA 4X64Q 2Q2UA 4DR3L 4R4QA 3AFPA 1N34L 4QJFA 2CWPA 3L0OA 1FJGL 2ZJQA 2PQAB 5E7NA 1I3QH 5GAHC 4OO1G 5LMUL 1VQKA 4GKKQ 3M4QA 4IPCA 1KC8C 4L5QA 4YY3Q 1A63A 1HZ9A 4JI1L 3UDXA 1FJGQ 3U4VA 1UE6A 5LMUQ 4LF9L 4GKKL 2RCNA 4UP9A 4C3IH 4DR6L 4NPSA 2JA8H 4GNXC 1EOVA 1VQPA 3L2PA 4YWMA 3CCVA 4DV4Q 1MKHA 3H0GH 2Z6KC 4JBMA 2VUMH 1PH6A 4JI0Q 1PVOA 4B3MQ 4JI4Q 3HOUH 2RHQB 1NBWA 2BA1A 4YWKA 3T1YQ 3PIOA 1X9NA 5GROA 4NXMQ 5GAEC 1NY4A 2VQFQ 1TXYA 1UEBA 4IOAA 3PV0A 4HJ7A 2E5LQ 5C3EG 3ICEA 3D31A 1RIPA 1VQDA 4PMWA 4AQYL 4BY7G 4A3MH 1PH3A 2DGYA 2BH2A 2IHFA 2UXBQ 1Q86C 4LFBQ 5IYDG 3KJPA 5ELNA 2E8GA 2K52A 5AJ3Q 3NEMA 4DR5L 3VDYA 4GNXB 1W2BA 3GTLH 2JK8A 1K9MC 1PA6A 1K8AC 4IJHA 4A3DH 1E22A 1W3SA 2IX0A 1YIJA 2ALYB 3KJOA 3K7AH 4K0KL 4LW1A 4UP7A 1D8LA 2Y0SG 2IT1A 3ULLA 4X64L 3UE0A 2N8NA 3H3VH 1D7QA 1BBWA 1XNRQ 3MXNB 2NN6G 1E7ZA 3KFUA 1QVGA 3PO2G 3J7A5 1Y1WG 1WYDA 4A3LG 1VQAA 2HHHQ 4LF5Q 4BXXH 1XNQQ 2UUAL 2ES2A 4C3JH 4B3SQ 5M3FG 2AWOA 2YTYA 4DUYQ 3DM3A 4X62Q 3A0JA 1X54A 5C44H 1AE3A 2YYZA 4PG3A 5H1SE 3OTOL 4IFDG 4IO9A 4X6AH 4DR7L 3OW2A 4R4IA 3IRBA 1PH7A 1UWVA 1VQGA 4ALPA 3W1BA 1QZHA 3CF5A 4DPGA 1B8AA 4A76A 2VNUD 1A62A 1G51A 3KF6A 3T1YL 3S2DH 3M85A 5IYBH 4NXML 1MJCA 1JT8A 1NE3A 2HIVA 3HKZG 2HIXA 2H5XA 4NB3A 4A3KH 4L5TA 1A8VA 1YBYA 4YWLA 4JI0L 1XPOA 3I56A 3CPFA 1VQCA 3GTGH 5IYDH 3HOYG 5JJKA 4UP8A 4HJ8A 1VQIA 4BBRG 2F3IA 5LMNQ 3M3YH 1AE2A 3AQQA 2K5HA 3AFQA 3HOVH 5FJ8G 2A8VA 4DR4L 2JEAI 3JC66 2MO0A 3ER0A 1K0RA 1Q7YC 3CCJA 2Z6KA 1SN8A 4B3TL 4DR4Q 1S3OA 1K73C 1X3GA 4NXNL 4DR5Q 2R7ZH 1I94L 1CUKA 3K0XA 1Y14B 3EBEA 4GN5A 2ASBA 3I4MG 2GN5A 1PH5A 4YCWA 5DLQE 3S15H 4A3BG 3S16H 2UXCQ 1Q1BA 3GTPH 1Y1VH 2K5VA 4Y7NH 3FKIH 3OYYA 4GN4B 3F2DA 2HHHL 4LF5L 4POGA 4A93G 4IPGA 1X56A 3PUVA 4GLVB 4JI3L 2FXQA 1IZ6A 3TEHB 1J5EQ 3S1MH 2JEBI 1Z9FA 4GLXA 1WOCA 2D62A 2JA5G 1J5EL 4XTCS 4APVA 1JB7A 3HFZB 3EN2A 2MNAA 1UE7A 4OWWB 3I4MH 4P73A 1GM5A 1LTLA 1P8LA 1QUQB 4JBWA 1YITA 1DGSA 5C0XJ 5JEAJ 2ZM6L 2VQEL 1B70B 1L2FA 2I5MX 1SFOH 1TWCH 2AWNA 2D0PA 2WB1G 5FLXc 1JJ2A 4KLKA 4OX9Q 1S40A 3I7FA 3GTMH 1Q1EA 3FP9A 1KRTA 3UDGA 5K36G 2WFWA 1GO3E 2UXDL 4P75A 2N78A 3RLNA 3S1QH 4QGUA 4B3TQ 1YJWA 1IBLQ 3E0EA 3RZDH 3HOYH 3CW2C 1Q8KA 1IBLL 5M3MG 1N33Q 2NZHA 4L5SA 2Z0SA 4DV4L 1SROA 1BVSA 2Q2TA 3GO5A 2JA6G 3S1NH 4A3EH 2E2JH 1WJJA 3I4NG 4A3JH 1NMGA 1I94Q 4LFAQ 4JI5L 3PO3G 1VQHA 1HZBA 4B3SL 4PZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVP A;  4O2D A;  2R92 H;  3U50 C;  4LF4 Q;  4POF A;  2RF4 A;  1KL9 A;  4GNX A;  2K75 A;  4HJA A;  5IE8 A;  2VY3 A;  1I5F A;  5EAY A;  1C0A A;  4QY7 A;  4IPD A;  1T9H A;  4YHH Q;  1Y1W H;  1C7Y A;  2JA5 H;  5HY6 A;  1RL2 A;  3M9B A;  3CC7 A;  2EXD A;  4AYB E;  3RR5 A;  3ULJ A;  1YJ9 A;  3KDF A;  4WJ3 M;  3KLW A;  1BKB A;  4P74 A;  1VCI A;  2WB1 E;  2CFM A;  2VW9 A;  4JI8 L;  2YTX A;  1HNW Q;  2KBN A;  1E1O A;  3GTK H;  3B6Y A;  4DR1 Q;  4OXP A;  3PF5 A;  3CCS A;  1YI2 A;  4DV0 Q;  4YY3 L;  1VQ8 A;  4XIG S;  2L15 A;  4DR1 L;  2UUA Q;  2NVT H;  3GDE A;  4DR6 Q;  1JMC A;  2KHI A;  4DAY B;  5IP7 G;  3I55 A;  2Q2I A;  3S24 A;  5IP9 H;  3BZK A;  4X62 L;  2CKZ B;  4GLA C;  2OQ0 A;  4GOP C;  2UUB Q;  1JJG A;  4OWT B;  1PH2 A;  3U58 A;  2NVQ H;  3GTQ H;  3NEN A;  3K7U C;  3HOX H;  2GVA A;  4HIM A;  4R1J A;  3RZO H;  1IL2 A;  3ERS X;  4R4C A;  5IYC G;  1MJE A;  1EQQ A;  3CCU A;  2E5L L;  2YTV A;  4QIW E;  4LFA L;  3HOW H;  5GQO A;  3PCO B;  2E2I H;  4AQY Q;  4UPA A;  2B3G A;  4A75 A;  2UXB L;  4GOP A;  2JA8 G;  3PUW A;  5C4J H;  2VQF L;  1NMF A;  1EYG A;  2R93 H;  2WAQ E;  2Q2H A;  1N9W A;  4JOI A;  1EUJ A;  1N8R C;  4J15 A;  4A3E G;  1BBU A;  2K4K A;  1J6Q A;  4GS3 A;  4DR2 L;  4DKA C;  1E1T A;  2I5L X;  2D0O A;  2B63 G;  5FJ8 H;  4X65 Q;  2JA7 G;  1KAW A;  4DR2 Q;  1E3P A;  3CAM A;  4JI6 L;  2NZO A;  1A0I A;  4PZ6 A;  4X66 Q;  1PH8 A;  1SRU A;  4A3M G;  3F2C A;  4BY7 H;  4JG2 A;  3TQY A;  3CCQ A;  1CKN B;  2OWO A;  4TVA B;  2MQH A;  2LXJ A;  1IBM Q;  1N32 L;  4OX9 L;  1CKO A;  1G29 1;  4A93 H;  1VQB A;  1PH1 A;  4BBS H;  2YV5 A;  1KXL A;  3PGZ A;  1Y1V G;  2R6G A;  4C3H H;  5HGQ A;  3M7N A;  3J81 j;  3TS2 A;  1HR0 L;  1N36 L;  3TS0 A;  1OXX K;  1LM0 A;  2ID0 A;  4AIM A;  2K14 A;  1U0L A;  2F52 A;  2N3S A;  5C4X H;  3T1H Q;  1YJN A;  1HR0 Q;  3HOW G;  4IFD I;  3CCL A;  2UUB L;  1KRS A;  2QEX A;  4DV3 L;  2WP8 J;  3TRE A;  2IX1 A;  2BA0 A;  5GAG C;  3RN2 A;  3E9H A;  1XPU A;  4GKJ Q;  1I6H H;  2EIF A;  4HJ9 A;  1EWI A;  2AHO B;  1G6P A;  5FLM H;  3STB C;  3CPW A;  1P16 A;  1EQR A;  2CWA A;  2VUM G;  1SLJ A;  2IHE A;  4JCV E;  4DV5 Q;  1VQN A;  2VS1 A;  3STB D;  4DV6 Q;  3CC2 A;  4A3B H;  3K8A A;  2PI2 E;  2V1C C;  3E9I A;  5M5X H;  4A3F G;  1ASZ A;  5IT9 c;  3J81 c;  4DV6 L;  2UXD Q;  1OXU A;  1EFW A;  1NJI C;  3GTO H;  4IFD J;  4JI6 Q;  2VZA A;  1QZG A;  1I50 H;  1B7Y B;  4PZ7 A;  1VQ7 A;  1VQ5 A;  5J3B A;  3G71 A;  1V9P A;  1GKH A;  1L0W A;  1HNX L;  1EIY B;  1IBM L;  1UE5 A;  1VQE A;  1N32 Q;  4LUO A;  2F4V L;  4JV5 L;  1Q12 A;  1VS0 A;  4KI0 A;  3UE1 A;  5C44 G;  2UU9 L;  1KIX A;  2F4V Q;  4A3G G;  4DUY L;  3EIV A;  1PYB A;  3GD7 A;  5LMN W;  4HIK A;  3PF4 A;  5BR8 L;  2IY5 B;  3UDF A;  1YHQ A;  5GAD C;  4A3L H;  5C0X I;  3PO2 H;  4KHP Q;  1FVI A;  2XGT A;  1CKN A;  1YHB A;  4FDB A;  3G4S A;  1UE1 A;  4HID A;  1ASY A;  1X65 A;  4OON A;  1WI5 A;  4DR7 Q;  3K81 C;  3I2Z A;  3CC4 A;  4OWX B;  1OXS C;  1YHA A;  1PH9 A;  4OO1 I;  3DLL A;  5JJL A;  1YZ6 A;  3RN5 A;  1VQ6 A;  3FHW A;  2R93 G;  3BJU A;  3PUX A;  1K3R A;  4O0A A;  1X3E A;  2KHJ A;  1XJV A;  1QVF A;  4P72 A;  4A3G H;  4BXX G;  1WCM G;  4LFB L;  2R7F A;  3AEV A;  2UUC L;  3JAM c;  5M5W H;  4DV1 L;  3W1G A;  4LF4 L;  2PMZ E;  2AMC B;  1Q46 A;  4MZ9 A;  5AJ3 L;  2QA4 A;  2OTJ A;  2KCM A;  4BA2 I;  2B29 A;  3CMA A;  4K0K Q;  3HOX G;  4NXN Q;  1FL0 A;  4A3I G;  1Q81 C;  1HNZ Q;  1L1O C;  3HOU G;  4A3C G;  4B3R Q;  2KCT A;  2RHS B;  3F8T A;  1KHI A;  2BH8 A;  1WFQ A;  5JJI A;  4LF7 L;  5C4X G;  2QGQ A;  3PIP A;  1KD1 C;  1N33 L;  2OQK A;  1CKM A;  3H3V I;  4LF6 Q;  3J80 i;  1XNQ L;  3CCE A;  4H02 A;  2R7Z G;  1HNX Q;  2I0Q A;  4A4I A;  5C3E H;  3CME A;  4IPH A;  1HZC A;  2VL6 A;  5C0X G;  2ZJR A;  2JA6 H;  5FLM G;  4A3I H;  4YCU A;  2Y0S E;  4MNO A;  4LFC Q;  3OTO Q;  4LF9 Q;  1YNX A;  5M3M H;  1PHJ A;  3HOV G;  3L7Z C;  1TWA H;  3H0G G;  3CQZ H;  4LF8 L;  3RNU A;  4DV7 Q;  2JE6 I;  2NN6 I;  1CSP A;  4QL5 A;  2C35 B;  4KHP L;  4RG1 A;  3I4N H;  1L1O A;  1M90 C;  4LF8 Q;  2JQO A;  1PYS B;  4JI2 Q;  4DUZ L;  1IBK L;  3PO3 H;  4ME3 A;  2LSS A;  4IOC A;  1VQF A;  2OCE A;  1PH4 A;  2CCZ A;  2R92 G;  1YEZ A;  1NTG A;  4JOI C;  4EX5 A;  3CCR A;  3HOZ G;  2CQO A;  4DK3 C;  4BBS G;  2XTI A;  4BY1 H;  2ZM6 Q;  2VQE Q;  3MEF A;  3S1R H;  1H95 A;  2I5H A;  5IWA Q;  1GD7 A;  1XMO Q;  1K83 H;  1V1Q A;  4IJL A;  1XTD A;  4EQ5 A;  3CCM A;  4GOP B;  3TRZ A;  5ELO A;  4MTN A;  4DK6 C;  5M5Y H;  5IWA L;  1XMO L;  1HNZ L;  4B3R L;  4JI1 Q;  3CD6 A;  3RLO A;  2DUD A;  3RLF A;  3J7Z C;  2MO1 A;  2GVB A;  1VQM A;  1XPR A;  4RMF A;  4LF7 Q;  2PQA A;  4JBJ A;  1CSQ A;  3JAM i;  2JA7 H;  1OTC A;  2A19 A;  3S2H H;  3D0F A;  3A5U A;  3KF8 B;  4LUV A;  3J81 i;  1S72 A;  4LF6 L;  5IYB G;  4AH6 A;  4L5R C;  4JV5 Q;  3WWV A;  4JBK A;  4B3M L;  4JI4 L;  3Q8D A;  5IP9 G;  1XMQ L;  2R7D A;  4TQU S;  5IP7 H;  4BY1 G;  4GN3 B;  4A3D G;  5BR8 Q;  4QQB X;  4R4T A;  3CP0 A;  1Q82 C;  2UXC L;  1M1K C;  1X3F A;  4C2M H;  3CXC A;  2K5N A;  3HKS A;  3ZJY C;  5IYC H;  3G6E A;  3F2B A;  2N49 A;  3LGJ A;  1HH2 P;  1OXV A;  1TWF H;  4P71 A;  3SGI A;  4A3F H;  3KOJ A;  4LFC L;  2E2H H;  2A1A A;  3G48 A;  1QUQ A;  3BZC A;  1TWH H;  1HJP A;  1VQJ A;  4Y52 H;  3KDF B;  1SE8 A;  4JYA L;  1HNW L;  3H15 A;  4HJ5 A;  3W5O A;  4DV7 L;  1EIF A;  1V43 A;  4X66 L;  3GTJ H;  2ATW A;  2MFI A;  1LYL A;  4DV0 L;  2WAQ G;  2ZTE A;  3FKI G;  1JJC B;  4WJ4 A;  1XNR L;  3BU2 A;  4DV2 Q;  2YU9 H;  3I4O A;  1TWG H;  5JEA G;  1K8G A;  1VQ9 A;  4JI8 Q;  2JJQ A;  1IYJ B;  2UU9 Q;  2UUC Q;  1X6O A;  1HZA A;  3HKZ E;  4DV2 L;  3A74 A;  4DV1 Q;  4DR3 Q;  1SMX A;  1OXT A;  1PV4 A;  1JE5 A;  1N34 Q;  2ZTC A;  3A5Z B;  1N36 Q;  2KEN A;  1L1O B;  1HR0 W;  2NVX H;  4JC0 A;  1SR3 A;  3UDI A;  4A3J G;  1PFS A;  3PUY A;  1LUZ A;  2JA9 A;  2LXK A;  2PI2 A;  2K50 A;  3ULP A;  1E24 A;  3M4P A;  1AH9 A;  2ZJP A;  1U5K A;  1WCM H;  1Z47 A;  3T1H L;  3S17 H;  4JI7 Q;  1C9O A;  5M3F H;  1X55 A;  5IY0 A;  2ZTD A;  4HIO A;  1XMQ Q;  4DV3 Q;  4UY8 C;  3AYH B;  4JI7 L;  3NBH B;  4LWC A;  4R4O A;  4BA1 I;  4DV5 L;  1R9T H;  4DNI A;  4GKJ L;  3KYH C;  4LNQ A;  4KHZ A;  1VQ4 A;  4LUZ A;  1KQS A;  2B63 H;  2PNH A;  4A3K G;  2EQS A;  4JI5 Q;  4JI3 Q;  3K80 C;  3J80 c;  5LMN L;  3PUZ A;  1QVC A;  3HOZ H;  4YHH L;  4A3C H;  4AYB G;  2OTL A;  2NVY H;  4DAM A;  2AKW B;  3U4Z A;  3KF6 B;  1O7I A;  4JYA Q;  3S14 H;  1IXR A;  1MIU A;  1FGU A;  1YVC A;  4YCV A;  4DUZ Q;  1IBK Q;  4JI2 L;  3M4O H;  3PSI A;  3NEL A;  4BBR H;  4X65 L;  2HT1 A;  1VQO A;  1VQL A;  3F1Z A;  2HQL A;  4X64 Q;  2Q2U A;  4DR3 L;  4R4Q A;  3AFP A;  1N34 L;  4QJF A;  2CWP A;  3L0O A;  1FJG L;  2ZJQ A;  2PQA B;  5E7N A;  1I3Q H;  5GAH C;  4OO1 G;  5LMU L;  1VQK A;  4GKK Q;  3M4Q A;  4IPC A;  1KC8 C;  4L5Q A;  4YY3 Q;  1A63 A;  1HZ9 A;  4JI1 L;  3UDX A;  1FJG Q;  3U4V A;  1UE6 A;  5LMU Q;  4LF9 L;  4GKK L;  2RCN A;  4UP9 A;  4C3I H;  4DR6 L;  4NPS A;  2JA8 H;  4GNX C;  1EOV A;  1VQP A;  3L2P A;  4YWM A;  3CCV A;  4DV4 Q;  1MKH A;  3H0G H;  2Z6K C;  4JBM A;  2VUM H;  1PH6 A;  4JI0 Q;  1PVO A;  4B3M Q;  4JI4 Q;  3HOU H;  2RHQ B;  1NBW A;  2BA1 A;  4YWK A;  3T1Y Q;  3PIO A;  1X9N A;  5GRO A;  4NXM Q;  5GAE C;  1NY4 A;  2VQF Q;  1TXY A;  1UEB A;  4IOA A;  3PV0 A;  4HJ7 A;  2E5L Q;  5C3E G;  3ICE A;  3D31 A;  1RIP A;  1VQD A;  4PMW A;  4AQY L;  4BY7 G;  4A3M H;  1PH3 A;  2DGY A;  2BH2 A;  2IHF A;  2UXB Q;  1Q86 C;  4LFB Q;  5IYD G;  3KJP A;  5ELN A;  2E8G A;  2K52 A;  5AJ3 Q;  3NEM A;  4DR5 L;  3VDY A;  4GNX B;  1W2B A;  3GTL H;  2JK8 A;  1K9M C;  1PA6 A;  1K8A C;  4IJH A;  4A3D H;  1E22 A;  1W3S A;  2IX0 A;  1YIJ A;  2ALY B;  3KJO A;  3K7A H;  4K0K L;  4LW1 A;  4UP7 A;  1D8L A;  2Y0S G;  2IT1 A;  3ULL A;  4X64 L;  3UE0 A;  2N8N A;  3H3V H;  1D7Q A;  1BBW A;  1XNR Q;  3MXN B;  2NN6 G;  1E7Z A;  3KFU A;  1QVG A;  3PO2 G;  3J7A 5;  1Y1W G;  1WYD A;  4A3L G;  1VQA A;  2HHH Q;  4LF5 Q;  4BXX H;  1XNQ Q;  2UUA L;  2ES2 A;  4C3J H;  4B3S Q;  5M3F G;  2AWO A;  2YTY A;  4DUY Q;  3DM3 A;  4X62 Q;  3A0J A;  1X54 A;  5C44 H;  1AE3 A;  2YYZ A;  4PG3 A;  5H1S E;  3OTO L;  4IFD G;  4IO9 A;  4X6A H;  4DR7 L;  3OW2 A;  4R4I A;  3IRB A;  1PH7 A;  1UWV A;  1VQG A;  4ALP A;  3W1B A;  1QZH A;  3CF5 A;  4DPG A;  1B8A A;  4A76 A;  2VNU D;  1A62 A;  1G51 A;  3KF6 A;  3T1Y L;  3S2D H;  3M85 A;  5IYB H;  4NXM L;  1MJC A;  1JT8 A;  1NE3 A;  2HIV A;  3HKZ G;  2HIX A;  2H5X A;  4NB3 A;  4A3K H;  4L5T A;  1A8V A;  1YBY A;  4YWL A;  4JI0 L;  1XPO A;  3I56 A;  3CPF A;  1VQC A;  3GTG H;  5IYD H;  3HOY G;  5JJK A;  4UP8 A;  4HJ8 A;  1VQI A;  4BBR G;  2F3I A;  5LMN Q;  3M3Y H;  1AE2 A;  3AQQ A;  2K5H A;  3AFQ A;  3HOV H;  5FJ8 G;  2A8V A;  4DR4 L;  2JEA I;  3JC6 6;  2MO0 A;  3ER0 A;  1K0R A;  1Q7Y C;  3CCJ A;  2Z6K A;  1SN8 A;  4B3T L;  4DR4 Q;  1S3O A;  1K73 C;  1X3G A;  4NXN L;  4DR5 Q;  2R7Z H;  1I94 L;  1CUK A;  3K0X A;  1Y14 B;  3EBE A;  4GN5 A;  2ASB A;  3I4M G;  2GN5 A;  1PH5 A;  4YCW A;  5DLQ E;  3S15 H;  4A3B G;  3S16 H;  2UXC Q;  1Q1B A;  3GTP H;  1Y1V H;  2K5V A;  4Y7N H;  3FKI H;  3OYY A;  4GN4 B;  3F2D A;  2HHH L;  4LF5 L;  4POG A;  4A93 G;  4IPG A;  1X56 A;  3PUV A;  4GLV B;  4JI3 L;  2FXQ A;  1IZ6 A;  3TEH B;  1J5E Q;  3S1M H;  2JEB I;  1Z9F A;  4GLX A;  1WOC A;  2D62 A;  2JA5 G;  1J5E L;  4XTC S;  4APV A;  1JB7 A;  3HFZ B;  3EN2 A;  2MNA A;  1UE7 A;  4OWW B;  3I4M H;  4P73 A;  1GM5 A;  1LTL A;  1P8L A;  1QUQ B;  4JBW A;  1YIT A;  1DGS A;  5C0X J;  5JEA J;  2ZM6 L;  2VQE L;  1B70 B;  1L2F A;  2I5M X;  1SFO H;  1TWC H;  2AWN A;  2D0P A;  2WB1 G;  5FLX c;  1JJ2 A;  4KLK A;  4OX9 Q;  1S40 A;  3I7F A;  3GTM H;  1Q1E A;  3FP9 A;  1KRT A;  3UDG A;  5K36 G;  2WFW A;  1GO3 E;  2UXD L;  4P75 A;  2N78 A;  3RLN A;  3S1Q H;  4QGU A;  4B3T Q;  1YJW A;  1IBL Q;  3E0E A;  3RZD H;  3HOY H;  3CW2 C;  1Q8K A;  1IBL L;  5M3M G;  1N33 Q;  2NZH A;  4L5S A;  2Z0S A;  4DV4 L;  1SRO A;  1BVS A;  2Q2T A;  3GO5 A;  2JA6 G;  3S1N H;  4A3E H;  2E2J H;  1WJJ A;  3I4N G;  4A3J H;  1NMG A;  1I94 Q;  4LFA Q;  4JI5 L;  3PO3 G;  1VQH A;  1HZB A;  4B3S L;  4PZ8 A; 
#chains in the Genus database with same CATH topology
 3TZU A;  2HCI A;  1RKN A;  2VY3 A;  1I5F A;  2K04 A;  4QY7 A;  2VB3 X;  4IPD A;  3S2D B;  4P74 A;  1LTS D;  1PZI D;  2CFM A;  4QF4 A;  1HRJ A;  4JI8 L;  3GTK H;  2KOL A;  4ILW A;  3PF5 A;  1YI2 A;  4YIJ A;  1VQ8 A;  3DEO A;  4XIG S;  2L15 A;  1DYQ A;  1J9O A;  5IIF A;  2I07 B;  3CRL C;  2KHI A;  4DAY B;  1STN A;  4DXG A;  3U58 A;  3BS1 A;  3HOZ B;  3ERS X;  2K1B A;  1GUO A;  2CW0 D;  1MJE A;  3GTO B;  4QIW E;  1SEB D;  3I8Z A;  3HG9 A;  5GQO A;  4A75 A;  4DNR B;  2UXB L;  1A15 A;  1B2T A;  3A55 A;  2F0F A;  1RTN A;  2VQF L;  1NMF A;  2BOS A;  2R93 H;  2Q2H A;  4E6I A;  4K2K A;  4J15 A;  1CZW A;  1I4Q A;  2A69 C;  4A3E G;  1E1T A;  3CKI B;  2I5L X;  2NB0 A;  4A3B B;  1F9Q A;  5FJ8 H;  3TSS A;  4PZ6 A;  1T5X D;  1SRU A;  2OWO A;  2D2C C;  2K32 A;  1Y8P B;  1VMC A;  1PTO D;  1VQB A;  5C44 B;  3MXG A;  4BBS H;  2YV5 A;  1KXL A;  1F77 A;  1EY6 A;  3J81 j;  2M00 A;  1H9S B;  4UAI A;  3A8I E;  2KEC A;  5NUC A;  3URY A;  1YJN A;  1HR0 Q;  3QG1 A;  1I4X A;  3LX0 A;  1S5B D;  2C5C A;  2IX3 A;  4XQN A;  4GKJ Q;  3KLS X;  5FLM H;  3STB C;  3CPW A;  1KAB A;  1SLJ A;  1VQN A;  4DV6 Q;  3D6W A;  3K8A A;  3E9I A;  2V1C C;  5IT9 c;  2UXD Q;  1EQT A;  1PRT F;  1HQR D;  3SEB A;  1KNA A;  2DY8 A;  1CHQ D;  4PZ7 A;  3HOU B;  5J3B A;  3G71 A;  1GKH A;  2K7V A;  4JV5 L;  4XT3 B;  5C44 G;  4U67 3;  4K8J A;  2B2U C;  1UEA B;  4RWS C;  4A3G G;  4DUY L;  3HGB A;  1PYB A;  5LMN W;  3PF4 A;  4CKE A;  5GAD C;  4A3L H;  3PO2 H;  4KHP Q;  1FVI A;  1NR4 A;  3Q23 A;  5K36 H;  1E2Z A;  2NVT B;  4K14 A;  3FPU B;  3Q22 A;  3CC4 A;  1OXS C;  1PYW D;  1PH9 A;  2EYP A;  3BDL A;  1VQ6 A;  5KIX A;  2NVY B;  4O0A A;  4BS9 A;  4QCL A;  1QVF A;  1KLU D;  1F9P A;  1MGS A;  2A68 C;  2NN6 H;  3OHX C;  4HR7 B;  4LF4 L;  3QJY A;  2A6H C;  3F2U A;  2OTJ A;  5ELE A;  1FL0 A;  1HNZ Q;  4PQX A;  3HOU G;  4B3R Q;  3GV3 A;  2I46 A;  5T1I A;  1WFQ A;  1WTW A;  2HD3 A;  2K01 A;  1TS4 A;  2OQK A;  5JEA H;  2E2J B;  1CKM A;  2YU9 B;  4LF6 Q;  1B9M A;  4H02 A;  2R7Z G;  1HNX Q;  1EWH A;  2B8G A;  5C3E H;  3CME A;  5FLM G;  4YCU A;  1GHJ A;  3OTO Q;  2DJF C;  2EDG A;  1HXY D;  5AFW A;  2FMC A;  4DA2 A;  3L7Z C;  4X3S A;  4IQZ A;  4DV7 Q;  2NN6 I;  3NPP A;  4KHP L;  3CU7 A;  4OHJ A;  1EY5 A;  2PNR C;  3MZ5 A;  1PYS B;  1ZXT A;  2L12 A;  2CCZ A;  2FJ2 A;  1NTG A;  2XTI A;  4BY1 H;  3S1R H;  1GD7 A;  1LT3 D;  4RAU C;  3FVQ A;  1XMO L;  4DK6 C;  4O42 A;  1HNZ L;  4B3R L;  4JI1 Q;  3J81 L;  1MD2 D;  2DUD A;  3RLF A;  2RSO A;  4LF7 Q;  1CSQ A;  3WOE A;  3TZD A;  4KKU A;  2F0P A;  5TSS A;  1D5X C;  3Q0A A;  4DK1 A;  5IYB G;  4AH6 A;  4JBK A;  2F0G A;  3Q8D A;  1QJO A;  3OOC A;  3CQZ B;  2H1E A;  3OW7 A;  4TQU S;  5IP7 H;  3MEH A;  1Q82 C;  5LHY 1;  2A69 D;  1D5M C;  1TWF H;  1ESF A;  5CV7 A;  4FO2 A;  3MTS A;  3BZC A;  1TWH H;  1HJP A;  4IZ8 A;  3SXH A;  3KDF B;  1SE8 A;  3D3R A;  4ZUI A;  3W5O A;  3GTJ H;  3QB3 A;  4DV0 L;  5IGE A;  4H0L C;  4DV2 Q;  5JEA G;  1O80 A;  1JIC A;  3V05 A;  1N36 Q;  3MVV A;  5C4J B;  1HR0 W;  1I4R A;  3UDI A;  4KJN A;  1PZK D;  4C2M B;  1AH9 A;  4OL7 A;  1E24 A;  3T1H L;  3P75 A;  3UI2 A;  5M3F H;  3S17 H;  1X55 A;  5IY0 A;  1LLR D;  1XMQ Q;  4UY8 C;  4R4O A;  1LTB D;  5LL6 S;  4GKJ L;  1SNC A;  4KHZ A;  1VQ4 A;  2EOT A;  2PNH A;  2L11 A;  2E76 C;  1B1Z A;  3BVM A;  4EQP A;  3NTI A;  2KA7 A;  1WD1 A;  2NYZ D;  1H9M A;  3I70 A;  1GXD C;  3EFX D;  3WDN A;  3U4Z A;  3G7L A;  2EJM A;  1YVC A;  3PSI A;  1KAA A;  3NEL A;  4H44 C;  3MHB A;  3E5S A;  1VQL A;  4X64 Q;  2Q2U A;  1U4L A;  4R4Q A;  3AFP A;  5FO9 B;  1R9T B;  2WB1 B;  1I3Q H;  3BG3 A;  4OO1 G;  3M4Q A;  3QIA A;  1WTV A;  1QIL A;  1WTR A;  4K6D A;  1BCP B;  4J8Q A;  3RMH A;  2L0C A;  1BCP C;  4H7B A;  1SYC A;  4BBS B;  1V8Q A;  3DWQ A;  5CR3 A;  2VUM H;  4JBM A;  4F7X A;  3SK8 A;  1O78 A;  4B9W A;  2EYM A;  4HSV A;  3NTH A;  3PIO A;  1SMY C;  4NXM Q;  1NY4 A;  2VQF Q;  1UEB A;  3ERQ A;  2A5H A;  1RIP A;  1VQD A;  4PMW A;  4BY7 G;  4A3M H;  2DGY A;  2IHF A;  4U68 A;  1TWF B;  1FYC A;  5EQ0 A;  2RDF A;  4KD4 A;  4DK0 A;  3GTL H;  1ML0 D;  1TR5 A;  1W3S A;  2IX0 A;  2ALY B;  4JW0 A;  4UP7 A;  5EBC A;  3ULL A;  1D1K A;  2A6E D;  1HA5 A;  2KQ3 A;  2NN6 G;  1GUS A;  1QVG A;  4KK7 A;  3M3Y B;  1NR2 A;  1WYD A;  1SNQ A;  1VQA A;  3N6R A;  1WTX A;  3KK7 A;  3MFG A;  4B3S Q;  4IUP A;  2AWO A;  4KV6 A;  4X62 Q;  4IUN A;  4PG3 A;  3OTO L;  1IHZ A;  1X32 A;  2J0T D;  4Y7N B;  4IO9 A;  4A3M B;  1EOT A;  4DR7 L;  4X6A H;  2Z9H A;  4R4I A;  3W1B A;  1LTI D;  3KF6 A;  3T1Y L;  2JA5 B;  1GJX A;  2BDO A;  3M85 A;  4O1N A;  1JT8 A;  1JOK A;  1NE3 A;  3HKZ G;  4NB3 A;  1YBY A;  1HHV A;  1G91 A;  3HZX A;  2PPB C;  4ULL A;  3TP6 A;  3TP8 A;  2K5H A;  4CGY B;  3HOV H;  4G7H C;  3JC6 6;  1Q7Y C;  1SN8 A;  1ENF A;  5M3M B;  3KBG A;  1Y14 B;  1EIH A;  3I4M G;  3P7J A;  2CVR A;  1PH5 A;  3ZYY X;  3VR4 A;  2IPK D;  5I9P A;  2E2D C;  2D5D A;  2HHH L;  4POG A;  4CKC A;  1X56 A;  3C46 A;  2R61 A;  3GTL B;  4XYO A;  1Z9F A;  1PTO B;  1WOC A;  2D62 A;  3H0G B;  4FP5 D;  3EN2 A;  2CH4 A;  3T51 B;  4OWW B;  2O4X A;  3I4M H;  5BN4 A;  1QUQ B;  4JBW A;  2QCP X;  1JWU D;  2WIN B;  2ZM6 L;  5IGD A;  1KDB A;  2I5M X;  1SFO H;  1JJ2 A;  1DOL A;  1M8A A;  1F2M A;  1KRT A;  1BXT A;  5K36 G;  2UXD L;  2VB2 X;  2JP1 A;  3NTK A;  2HCC A;  1L0X B;  1SYE A;  4QGU A;  4B3T Q;  3EQL C;  3MXP A;  1W6K A;  1YJW A;  1C48 A;  4FYD A;  2EXZ A;  3HOY H;  4C3J G;  1IBL L;  2EJG C;  3KF8 A;  1I4P A;  2XN9 C;  2Q2T A;  4QUC A;  2JA6 G;  4DNT B;  5IGC A;  4A3E H;  1PRT C;  1NMG A;  3K7A B;  4NKL A;  2TMP A;  1BQQ T;  3PIP 3;  3A7A B;  2R3Z A;  4O2D A;  5F2D A;  2J7Z A;  2XIW A;  3U50 C;  3DWA A;  4PMB A;  2RSN A;  4HJA A;  1C0A A;  1B4O A;  4FXK C;  1X3Q A;  2KHS A;  2RVL A;  3CC7 A;  1YJ9 A;  4IUR A;  4WJ3 M;  3KLW A;  5JPM C;  1VCI A;  1DXM A;  2YTX A;  4TRD A;  4HTH A;  1ONL A;  4OXP A;  4QIW B;  3RUZ A;  3PIO 3;  4DV0 Q;  1LT5 D;  4DR1 L;  1K0S A;  5M3F B;  2CH4 W;  3GDE A;  1SYF A;  3FKI B;  2PZT A;  5IP7 G;  3I55 A;  2Q2I A;  3S24 A;  4X62 L;  5KNC A;  4GLA C;  2ZXO A;  4I7Z C;  3K0Y A;  1PH2 A;  3K5O A;  1TWC B;  2GVA A;  1IL2 A;  5EBD A;  2A6H D;  3CCU A;  2E5L L;  2YTV A;  4JVZ A;  3PCO B;  4GOP A;  3E3X A;  3GV6 A;  1N9W A;  4JOI A;  1BBU A;  5BN3 A;  1PFM A;  3TP5 A;  4DKA C;  2B63 G;  4X65 Q;  2JA7 G;  3A54 A;  2F0N A;  4DR2 Q;  1ILP A;  3CAM A;  5EPK A;  4JI6 L;  1SMY D;  4BY7 H;  4JG2 A;  3TQY A;  5FO8 B;  4TVA B;  1N32 L;  1K8O A;  4OX9 L;  1CKO A;  5T1G A;  1G29 1;  2K5Q A;  5FOB B;  1PH1 A;  1K8M A;  3SDZ A;  3VYT A;  2R6G A;  4C3H H;  5HGQ A;  3KBX A;  3KLR A;  1TY0 A;  3AB9 A;  3M7N A;  3I4L A;  4KN4 C;  2RCF A;  1OXX K;  1LM0 A;  2JXM B;  1DCZ A;  2EYF A;  4RHS A;  1B3A A;  2UUB L;  1GOZ A;  2BA0 A;  4RHR A;  2EIF A;  1U4M A;  2EPB A;  4C1N I;  2AHO B;  4HJ9 A;  1V1O A;  3VYS A;  1RDP D;  5JAV A;  4H13 C;  2VS1 A;  3CC2 A;  3LWE A;  1BBX C;  5M5X H;  4A3F G;  3NHH A;  1MSH A;  1OXU A;  3GTO H;  4CDF C;  4K5W A;  1CK1 A;  5D3D A;  2AQ3 B;  2VXW A;  3MAQ A;  4G7Z C;  1VQ7 A;  1V1P A;  5DAU A;  1V9P A;  3HP3 A;  1L0W A;  2E2I B;  3S14 B;  2XVS A;  1VQE A;  2F3V A;  2BE5 C;  2F4V L;  1LTG D;  1ENC A;  2F0W A;  3UE1 A;  2UU9 L;  1Q90 A;  4NP5 A;  5C5L A;  1TS3 A;  3GD7 A;  2EVB A;  3GTG B;  5BR8 L;  3UDF A;  2AQ1 B;  2B2Y A;  4OIK A;  1SYG A;  4K6L A;  1F2Z A;  1CKN A;  1YHB A;  2Q8T A;  3K81 C;  4QB4 A;  4OO1 I;  1TS2 A;  3D4D A;  3RN5 A;  5J39 A;  3BJU A;  3T13 A;  1SND A;  1X3E A;  3D4W A;  1WTO A;  4LFB L;  1RTO A;  4DV1 L;  3W1G A;  4N9T A;  1Q46 A;  4MZ9 A;  2CW0 C;  3PO3 B;  4BA2 I;  1CT1 D;  2B29 A;  4K0K Q;  2PYK A;  1BUV T;  4A3I G;  1L1O C;  1JE4 A;  3F8T A;  1KHI A;  4LF7 L;  5C4X G;  4IAL A;  3PIP A;  1EY7 A;  2ZXP A;  1NCV A;  5IGG A;  2AUK A;  4ME5 A;  3H3V I;  1EYD A;  1UUP A;  4CDC C;  4CJ1 B;  1HZC A;  2VL6 A;  3DXJ C;  5C0X G;  1DZ1 A;  4MNO A;  3T4A C;  5IOC A;  3U9O A;  1SYB A;  1SNO A;  1LT4 D;  1PZJ D;  1TWA H;  3H0G G;  3R8B A;  3I91 A;  1AP0 A;  2EY2 A;  3RD4 A;  4RG1 A;  3I4N B;  1ENA A;  1ET9 A;  3MC0 B;  2JQO A;  1IBK L;  3BDO A;  3H09 A;  1GUT A;  2F0V A;  1PH4 A;  3ITP A;  2KCC A;  1YEZ A;  4JOI C;  3HOZ G;  3S1M B;  2CQO A;  4BBS G;  3S1N B;  1A3T A;  2ZM6 Q;  1AW7 A;  5M5X B;  4A3J B;  1H95 A;  1FR3 A;  1K83 H;  4IJL A;  3V96 A;  1SDF A;  2MGS A;  4EQ5 A;  3TRZ A;  5IWA L;  2LMC B;  3RLO A;  1TVX A;  5KYI A;  2IL8 A;  4QMG A;  4BWG B;  2A19 A;  3A5U A;  2PW5 A;  3J81 i;  1S72 A;  2F0Q A;  4LF6 L;  2RDH A;  3WWV A;  5KNB A;  2B2Y C;  5IP9 G;  1XMQ L;  1PXU A;  4GN3 B;  3S17 B;  2UXC L;  2QDL A;  4C2M H;  3G6E A;  2N49 A;  4P71 A;  3I4N G;  4A3F H;  3KOJ A;  4LFC L;  4L63 B;  1TII D;  2Q8I B;  2L5T A;  3VA7 A;  1SSO A;  4BY7 B;  2ZXR A;  5FLX E;  1JOO A;  1VF7 A;  1VQJ A;  2AUJ D;  5I2Y A;  3LNN A;  4JYA L;  1R4Q B;  2NTT A;  5I9O A;  4DV7 L;  1EIF A;  2MFI A;  2WAQ G;  3I90 A;  1JJC B;  2YU9 H;  1ICF B;  1OO9 B;  1TWG H;  2JSO A;  1VQ9 A;  4JI8 Q;  1A2U A;  1AFP A;  1IYJ B;  1EZ8 A;  3I3C A;  1X6O A;  4LMQ D;  3HKZ E;  2D9U A;  3A74 A;  1VMP A;  1SMX A;  1OXT A;  1Y8O B;  2ZTC A;  2EY5 A;  2KEN A;  1L1O B;  1MBY A;  1SR3 A;  3P20 A;  3PUY A;  3S16 B;  1LUZ A;  1SE3 A;  4L6T B;  3H6M A;  3ULP A;  2ZJP A;  2F0O A;  1WCM B;  4JI7 Q;  1IW7 C;  2ZTD A;  4MN3 A;  4ZAI A;  3AYH B;  4LWC A;  3KYH C;  2WKC A;  5C6A A;  2XWB B;  4CJ0 B;  1PTO C;  3BYY B;  3HKZ B;  4JI3 Q;  3K80 C;  3OSO A;  3DHQ A;  1QVC A;  3PUZ A;  1AZP A;  4YHH L;  1SYD A;  2AKW B;  1EU4 A;  2RDG A;  3R2I A;  3SK4 A;  1IXR A;  3DUZ A;  1E2W A;  4DUZ Q;  4JI2 L;  4BBR H;  5IOD A;  2LFN A;  1VQO A;  3F1Z A;  4DAP A;  3PMF A;  4JPB W;  4DR3 L;  5G3L D;  3L0O A;  2ZT9 C;  2EYO A;  5E7N A;  5GAH C;  1DOM A;  1VQK A;  2RA4 A;  1KC8 C;  1A63 A;  1HZ9 A;  3UDX A;  2EYL A;  1STY A;  4LF9 L;  1HPC A;  4RKB A;  3H91 A;  3FPP A;  4PNY A;  5I6W A;  2O5I C;  4GNX C;  1VQP A;  4YWM A;  4C1N K;  3H0G H;  4XDX A;  2Z6K C;  3VR2 A;  2VUM B;  4B3M Q;  3S15 B;  3T1Y Q;  2O2L D;  4WJW A;  4V0B A;  2LS0 1;  5FLX L;  1ZYR D;  5C3E G;  3ICE A;  3C1F A;  4AQY L;  4RA8 A;  3A7L A;  1PH3 A;  2UXB Q;  2PQE A;  1Q86 C;  3E6Z X;  1B9N A;  3SK6 A;  5ELN A;  3C2P A;  3R3O A;  1Y69 U;  3OIP A;  5CGK A;  4GNX B;  3NE5 B;  2JK8 A;  1UAP A;  5EGT A;  4PMC A;  4K0K L;  3K7A H;  3IFD A;  2K03 A;  1BBW A;  1U9R A;  1XNR Q;  3MXN B;  1G2T A;  3DMU A;  3KFU A;  3K6O A;  3PO2 G;  4F87 A;  4C56 C;  1XNQ Q;  2DN8 A;  2ES2 A;  2PCF B;  2YTY A;  4BBR B;  1QCB D;  1X54 A;  5E4X A;  5A2Q E;  4IFD G;  2F0I A;  3OW2 A;  1UWV A;  1QZH A;  4DPG A;  1B8A A;  4K2L A;  1A62 A;  5IYB H;  1FNW A;  2HIV A;  2HIX A;  4A3K H;  4YWL A;  3I56 A;  1VQC A;  5JJK A;  5IYD H;  3HOY G;  4R8I A;  1EQV A;  1VQI A;  4KJO A;  3M3Y H;  4XYQ A;  3J80 L;  2JEA I;  4NDX A;  4A3G B;  2Z6K A;  4DR4 Q;  1TWA B;  1K73 C;  4NXN L;  2MP1 A;  1I94 L;  1CUK A;  1E0B A;  2ASB A;  4FVM A;  1TKW B;  1HUM A;  2UXC Q;  1Q1B A;  1Y1V H;  2DNE A;  4Y7N H;  3FKI H;  5K5P A;  4GN4 B;  1KDC A;  3CHB D;  4IPG A;  1K3B C;  4GLV B;  4JI3 L;  4P2C B;  1TT2 A;  2JEB I;  2G9D A;  1J5E L;  3SK5 A;  3HFZ B;  1UE7 A;  2B8F A;  3EJI A;  4P73 A;  1EZ6 A;  1YIT A;  4K5V A;  1U4P A;  2EYJ A;  1L2F A;  2NUC A;  1RF2 D;  2AWN A;  1WTH A;  4OX9 Q;  3I7F A;  3GTM H;  3GTK B;  2Z4H A;  2WFW A;  5JOB A;  2NBF A;  1EIG A;  2XWJ B;  2Z0S A;  3GO5 A;  1WJJ A;  1LO5 D;  4A3J H;  1RD9 D;  5CV5 A;  3DEP A;  1VQH A;  1HZB A;  2E2H B;  5M5Y B;  3SE0 A;  1GVP A;  2F0M A;  2R92 H;  5IT9 L;  3EVQ A;  2RF4 A;  1KL9 A;  1MHW C;  4GNX A;  2M9V A;  5IE8 A;  3W2D A;  2CQA A;  2NVX B;  5EAY A;  3IAY A;  2X69 A;  1RL2 A;  3M9B A;  2EXD A;  3ULJ A;  1HTL D;  1IW7 D;  1I6H B;  5D14 A;  2HDL A;  5JVG 3;  3ERO A;  2VW9 A;  1HNW Q;  4DR1 Q;  1WVL A;  2A73 B;  1LT6 D;  2Z4I A;  2HQE A;  1JMC A;  2WAC A;  2NZ1 D;  1LTR D;  2J4X A;  2N88 A;  3BZK A;  2CKZ B;  4K8I A;  2OQ0 A;  1JJG A;  4OWT B;  2NVQ H;  3NEN A;  2KVM A;  3D8G A;  2BE5 D;  3J7Y W;  4HIM A;  4R1J A;  3RZO B;  1H9R A;  2F0D A;  4S3S A;  3TBI B;  1EQQ A;  1QOH A;  4RGO S;  4LFA L;  3OWE B;  1UNS A;  2E2I H;  2B3G A;  5DNF A;  4R8N A;  3U9S A;  5C4J H;  4LK1 C;  2EJF C;  3NSW A;  1EYG A;  1S5F D;  2AQ2 B;  4WOR A;  1EL0 A;  5CC4 A;  4Z9C B;  2EYH A;  1J6Q A;  4QUF A;  4DR2 L;  2XSC A;  2JN4 A;  2B2V A;  3FRP B;  3F2C A;  4KHV A;  1D6E C;  1CKN B;  4M1U B;  1WTP A;  1IBM Q;  5KEE A;  4A93 H;  1EY0 A;  3P1H A;  3BYT B;  1B44 D;  3PGZ A;  1PFB A;  1Y1V G;  1ZEQ X;  2R92 B;  3J7A V;  4RCN A;  1N36 L;  1ET6 A;  1A3U A;  4IFD I;  1U0L A;  2F52 A;  2N3S A;  5C4X H;  1DM0 B;  3HOW G;  3CCL A;  2QEX A;  4DV3 L;  3RN2 A;  5KYL A;  1TY2 A;  2FIN B;  2K05 A;  4ID6 A;  1P16 A;  5C0X H;  1EQR A;  2CWA A;  1I4H A;  4DV5 Q;  3STB D;  4RGT A;  1ASZ A;  2PI2 E;  3AMU A;  1EY8 A;  4EVO A;  2JA8 B;  3VYU A;  3J81 c;  1EYA A;  4DV6 L;  1EFW A;  1NJI C;  4IFD J;  5C5M A;  4JI6 Q;  2VZA A;  1I50 B;  5M5W B;  1I50 H;  3GQB A;  1O7L A;  2QW7 A;  3HOX B;  4LAA A;  4TSS A;  1CM9 A;  3ND9 A;  1IBM L;  1ICW A;  4LUO A;  1VS0 A;  3MFY A;  1SJH D;  2KED A;  3EIV A;  1RHP A;  1A6X A;  2IY5 B;  2JYO A;  3NXW A;  3NUC A;  1YHQ A;  3T56 B;  5CV8 A;  2KEE A;  4OEL B;  5C0X I;  5C3E B;  4FDB A;  3G4S A;  1UE1 A;  4OON A;  5ELD A;  1WI5 A;  4DR7 Q;  1EEI D;  2F3W A;  4RGM A;  1LAB A;  5JJL A;  1YZ6 A;  2OF1 A;  1B3Q A;  1K3R A;  4A3G H;  1KTK A;  4BXX G;  3AEV A;  2XRS D;  3JAM c;  5M5W H;  2RBM A;  4MIU A;  2PMZ E;  2AMC B;  3KLS A;  2KCM A;  3CMA A;  5COR A;  3HOX G;  2F1M A;  3FMC A;  2KCT A;  3VR5 A;  5JJI A;  1KD1 C;  1A2T A;  3I72 A;  1XNQ L;  3CCE A;  2O5J C;  2I0Q A;  4A4I A;  4IPH A;  2F0E A;  2JA6 H;  2JA7 B;  4A3I H;  2Y0S E;  1HQM C;  5M3M H;  1PHJ A;  4FF3 A;  4LF8 L;  3RNU A;  2JE6 I;  1ESR A;  1CSP A;  1RCV D;  3I4N H;  1L1O A;  4KY5 A;  3VA5 A;  4JI2 Q;  4DUZ L;  5FO7 B;  3TDQ A;  2R92 G;  1VQF A;  2OCE A;  1EWC A;  5EKL A;  5LL6 X;  4EX5 A;  4CDD C;  2CHB D;  1LAC A;  1S5C D;  3MEF A;  2MUY A;  2I5H A;  5IWA Q;  1BNZ A;  5E3F A;  3TP7 A;  2SNM A;  2V4D A;  2EE1 A;  4N8X 1;  4I7A A;  5ELO A;  4MTN A;  5IT9 E;  1JWS D;  3CD6 A;  5BN5 A;  1VQM A;  2QKI C;  2EY1 A;  2MO1 A;  3J7Z C;  1XPR A;  2IJ0 A;  4JBJ A;  3JAM i;  2JA7 H;  3S2H H;  1G6Z A;  2F0T A;  2XRQ D;  4LUV A;  4JV5 Q;  4X3K A;  4JI4 L;  5E4W C;  4XQQ A;  2R7D A;  4FF4 A;  1JC7 A;  1I6V C;  4BY1 G;  2GA4 B;  5BR8 Q;  4A3D G;  1NNX A;  3S1Q B;  5EPL A;  3N52 A;  4R4T A;  4MTK A;  1FNU A;  4EQN A;  1M1K C;  1X3F A;  3CXC A;  3ZJY C;  5EJW A;  5IYC H;  3F2B A;  3C1E A;  1OXV A;  4KY6 A;  2A1A A;  1QE6 A;  1QUQ A;  4C3I B;  1H9J A;  1S4Z A;  3MWY W;  3H15 A;  1X3P A;  4X66 L;  2ZTE A;  2F4I A;  2HUG A;  5DEH A;  1PDQ A;  4WJ4 A;  3BU2 A;  1IYV A;  1K8G A;  3HOW B;  2PMZ B;  3K5N A;  1HZA A;  4DV2 L;  1N34 Q;  1PV4 A;  4DV1 Q;  3A8J E;  1JE5 A;  1MSG A;  3WOF A;  3JAM L;  2NVX H;  2L9H A;  4A3J G;  1AEX A;  1DD2 A;  2JA9 A;  2LXK A;  1U5K A;  1KDA A;  1XXG A;  1Z47 A;  5M9O A;  3NQI A;  4HIO A;  4DV3 Q;  4MHE A;  4DV5 L;  3OMG A;  1R9T H;  2K6A A;  1Q3L A;  4DNI A;  3GTJ B;  1KQS A;  4CDE C;  4A3K G;  2B63 H;  4JI5 Q;  4Q0F A;  2KUM A;  3E0J A;  4F8M A;  5C3X A;  1TWH B;  5LMN L;  2LY7 A;  1I4G A;  4A3C H;  1SNM A;  3KUP A;  2OTL A;  4FF2 A;  2NVY H;  3K57 A;  4JYA Q;  3S14 H;  1MIU A;  1IBK Q;  3M4O H;  4X65 L;  2K28 A;  2HQL A;  2R7Z B;  2L1B A;  3L3O C;  1N34 L;  2CWP A;  3PO2 B;  1FJG L;  3ONA B;  2ZJQ A;  2PQA B;  4DU9 A;  1STG A;  5LMU L;  2NWG A;  4IPC A;  5L37 A;  3U4V A;  1UE6 A;  4GKK L;  1SBB B;  2RCN A;  4UP9 A;  4NPS A;  2G9H D;  2WKD A;  4ZRZ A;  3L2P A;  3CCV A;  2B39 A;  4NW2 A;  5C4Z A;  1MKH A;  4IUT A;  1VDZ A;  4EQO A;  4JI4 Q;  3HOU H;  4L8J A;  1NBW A;  2BA1 A;  4YWK A;  1S5E D;  3HEJ A;  5GRO A;  5GAE C;  3PV0 A;  5A35 A;  4C3H B;  4V19 0;  4GZY C;  4LFB Q;  3NWT A;  5IYD G;  3DWP A;  2E8G A;  1F9S A;  1YNN C;  5AJ3 Q;  1EU3 A;  1W2B A;  2IW3 A;  1K8A C;  4A3D H;  1YIJ A;  3KJO A;  4LW1 A;  4X64 L;  1D8L A;  2Y0S G;  2IT1 A;  2N8N A;  1D7Q A;  1I3Q B;  2PW7 A;  1STE A;  2M2L A;  1R4P B;  2EZV A;  1FGB D;  1YNJ C;  1Y1W G;  4A3L G;  1D1I A;  2HHH Q;  4LJZ C;  4C3J H;  4A3I B;  1KNE A;  5M3F G;  2SEB D;  1JOQ A;  3AU7 A;  3DM3 A;  5CV6 A;  5C44 H;  1AE3 A;  5FK9 C;  1IKL A;  3IRB A;  1VQG A;  4RCO A;  3CF5 A;  4A76 A;  1G51 A;  1G8Z D;  4NXM L;  3M4O B;  2A6E C;  2H5X A;  4L5T A;  3CRK C;  3HRZ C;  3CPF A;  4RGN A;  3GTG H;  4WFN 3;  5KGU A;  4BBR G;  3VYR A;  1AE2 A;  3AQQ A;  1T5E A;  3AFQ A;  2B2W C;  2A8V A;  4DR4 L;  3X3M A;  1PLF A;  3ER0 A;  3H94 A;  5ELC A;  3CCJ A;  2JA6 B;  1S3O A;  1HUN A;  2DJG C;  3SR1 A;  5IGF A;  4DR5 Q;  4ZKC B;  2FFK B;  2R7Z H;  3K0X A;  4C3J B;  3EBE A;  2GN5 A;  2Y0S B;  1HFN A;  4YCW A;  3S15 H;  3GTP H;  2K5V A;  3FDT A;  3OYY A;  1D2B A;  2WII B;  1J5E Q;  3TEH B;  4A3F B;  1IZ6 A;  1AZQ A;  1ZYR C;  2JA5 G;  1IL8 A;  4XTC S;  1JB7 A;  5I6Y A;  1Q8I A;  3SHL A;  5J1Z A;  4BY1 B;  1DON A;  3V2T A;  1GM5 A;  1LTL A;  4FXG C;  3J80 E;  2ENB A;  1H9K A;  5EKI A;  5JEA J;  4UHV A;  5C0X J;  1B70 B;  2VQE L;  4OO1 H;  1TWC H;  5J22 A;  1HTP A;  1BCP F;  1SAP A;  4HN7 A;  4KLK A;  4F88 A;  5KRU A;  4ZUJ A;  3G6J B;  1Q1E A;  3FP9 A;  3UDG A;  1QG7 A;  4P75 A;  2N78 A;  5ELB A;  1K28 A;  3RLN A;  3S9W A;  3S1Q H;  1CTM A;  1GHK A;  3W3A A;  1RJT A;  1Q8K A;  4OGQ C;  5M3M G;  1B50 A;  1N33 Q;  2NZH A;  1EEF D;  1EFI D;  2E74 C;  1BVS A;  4HED A;  5CMD A;  1QNK A;  1EYC A;  3S1N H;  2E2J H;  1PTO H;  4KKS A;  3S1R B;  3H3V C;  4B3S L;  4PZ8 A;  3M7G A;  1JCK B;  1CA6 A;  1SJE D;  4POF A;  2K75 A;  2SOB A;  3GP7 A;  3OMC A;  1T9H A;  4YHH Q;  1Y1W H;  1C7Y A;  2JA5 H;  5HY6 A;  1BR9 A;  4AYB E;  1CZG A;  3RR5 A;  2MPM A;  3KDF A;  2F0H A;  1BKB A;  2WB1 E;  1TS5 A;  1PFN A;  1E1O A;  1SNP A;  2KBN A;  3B6Y A;  3VR3 A;  1Y1V B;  3CCS A;  4YY3 L;  2F0J A;  2X6L A;  2UUA Q;  5EKK A;  2NVT H;  4DR6 Q;  1GUG A;  2WAQ B;  2K5W A;  5IP9 H;  1JB3 A;  3J7A F;  2WV6 D;  4GOP C;  4KKT A;  2UUB Q;  3GTQ H;  3K7U C;  4FNF A;  3HOX H;  3RZO H;  2HDM A;  2Z1C A;  4RFB A;  4CHT B;  4R4C A;  3VR6 A;  5IYC G;  3HOW H;  4AQY Q;  3MXU A;  4UPA A;  4K5X A;  2E75 C;  2JA8 G;  2L55 A;  3PUW A;  2WAQ E;  1N8R C;  1EUJ A;  3J81 E;  1O7Z A;  2K4K A;  3IFT A;  3BZD B;  5KND A;  4GS3 A;  4RKL A;  1ROD A;  3NQT A;  2K33 A;  2D0O A;  1KAW A;  1E3P A;  1FNV A;  1K83 B;  4I65 A;  2NZO A;  1A0I A;  4X66 Q;  1LTT D;  4R9W A;  1TQO A;  1PH8 A;  4A3M G;  1CQF A;  5JVH 3;  3CCQ A;  4XT1 B;  2MQH A;  2LXJ A;  4KMU C;  2A68 D;  5CYU A;  3OIQ A;  1JWM D;  4G7O C;  1O7Y A;  3EA6 A;  3TS2 A;  1HR0 L;  3TS0 A;  3DM1 A;  3LWU A;  2ID0 A;  4AIM A;  2K14 A;  3T1H Q;  3NK9 A;  4ZCK A;  1KRS A;  2IX1 A;  2WP8 J;  3TRE A;  5GAG C;  4DFA A;  2EY6 A;  4B9X A;  3E9H A;  1XPU A;  3Q24 A;  3TME A;  1I6H H;  1EWI A;  3TN2 A;  1G6P A;  2VUM G;  1QNU A;  2IHE A;  4JCV E;  5COY A;  4A3B H;  2PZW A;  1E2V A;  3I73 A;  5HGT A;  1TU2 B;  1QZG A;  1B7Y B;  1VQ5 A;  1XX8 A;  2K5D A;  3A56 A;  1HNX L;  1EIY B;  5C4X B;  1N32 Q;  1UE5 A;  3BVG A;  5CV9 A;  1Q12 A;  4KI0 A;  1KIX A;  2F4V Q;  5G3L F;  4DAV A;  5ISR A;  4HIK A;  3NWS A;  1NUC A;  5EPJ A;  1LTA D;  2XGT A;  2QDB A;  4CBV A;  4HID A;  1ASY A;  1X65 A;  3I2Z A;  4OWX B;  1TWG B;  1XTC D;  1YHA A;  4EGV A;  1F2L A;  4DXF A;  2H4O A;  3DLL A;  4JK1 C;  1CHP D;  3FHW A;  3K5M A;  3PUX A;  2R93 G;  4OEM B;  1XJV A;  5D65 A;  2KHJ A;  2B2W A;  2PZU A;  4RH6 A;  1JOR A;  4P72 A;  4PV1 C;  1AN8 A;  1WCM G;  2R7F A;  3HS0 C;  2UUC L;  2QA4 A;  5AJ3 L;  2XNA C;  3IKJ A;  5CBE E;  2FMM A;  4NXN Q;  1VF5 C;  3QOJ A;  1Q81 C;  4A3C G;  3ND8 A;  1B53 A;  2RHS B;  2F0S A;  4ZKB B;  2BH8 A;  2DY7 A;  1ILQ A;  2QGQ A;  1N33 L;  1STB A;  2KCN A;  3C3L A;  3J80 i;  4N8F A;  1BO0 A;  5IGB A;  4TKO B;  1PRT B;  2SDF A;  2C9O A;  2ZJR A;  1F2Y A;  2LKV A;  4LFC Q;  1BOS A;  4LF9 Q;  1YNX A;  3HOV G;  1IYU A;  3T16 A;  3CQZ H;  3NBI A;  4QL5 A;  2C35 B;  5ELF A;  1M90 C;  4LF8 Q;  3PO3 H;  4ME3 A;  2LSS A;  1WD0 A;  4IOC A;  4XXE A;  3CCR A;  4DK3 C;  4FXD A;  2NTS A;  2VQE Q;  1SXT A;  1XMO Q;  1V1Q A;  4KD3 A;  1XTD A;  1Y8N B;  3QOL A;  2F0L A;  1SE2 A;  3CCM A;  4GOP B;  5M5Y H;  4CJ2 C;  2X6G A;  4KN7 C;  2GVB A;  4IUV A;  4RMF A;  1M4V A;  2PQA A;  2Z6B A;  3OPO A;  1OTC A;  3D0F A;  3KF8 B;  4OIJ A;  4L5R C;  3D6C A;  5CBA E;  4B3M L;  5JJZ A;  2MJ8 A;  1CQV A;  4HCS A;  4QQB X;  1NAP A;  4XQJ A;  3OWF A;  2B2U A;  3CP0 A;  2PO4 A;  1BDO A;  1F9R A;  2K5N A;  3HKS A;  4A3K B;  3LGJ A;  3SGI A;  1HH2 P;  2E2H H;  3G48 A;  4ABN A;  4IN3 A;  2L4N A;  4Y52 H;  3GTQ B;  1HNW L;  4HJ5 A;  1V43 A;  2ATW A;  5FKA C;  1LYL A;  3FKI G;  1XNR L;  3I4O A;  2JJQ A;  2UU9 Q;  2UUC Q;  4DR3 Q;  4LF4 Q;  1STH A;  1SFO B;  3A5Z B;  2TSS A;  1CFM A;  3MA2 B;  4JC0 A;  4ZQ3 A;  5C4H A;  1PFS A;  3GTM B;  1GUW A;  2OT2 A;  2PI2 A;  2K50 A;  3M4P A;  4IUQ A;  4B08 A;  1WCM H;  1C9O A;  2R93 B;  5DM6 3;  3R2T A;  4HSP A;  4M8A A;  4JI7 L;  3NBH B;  4A3E B;  4BA1 I;  4KTA A;  4LNQ A;  4LUZ A;  5CV4 A;  1QB5 D;  2EQS A;  4N9P A;  1Z6H A;  4HMJ A;  3S2H B;  3J80 c;  4HCE A;  3HOZ H;  1J8I A;  4AYB G;  4DAM A;  4DF7 A;  3KF6 B;  1O7I A;  2A74 C;  1FGU A;  4YCV A;  3FEW X;  2HT1 A;  3M4Y A;  1Y1W B;  3NBH A;  4ZYS A;  1C8C A;  1II3 A;  1XWE A;  1V1P B;  4G57 A;  5E1F A;  1FD7 D;  4J6H A;  3NP8 A;  4QJF A;  5JPN C;  1Z7T A;  3QO2 A;  4GKK Q;  4L5Q A;  3R93 A;  4YY3 Q;  3K59 A;  1EY9 A;  4JI1 L;  1FJG Q;  5LMU Q;  4C3I H;  4DR6 L;  2JA8 H;  1EOV A;  4DAY A;  4DV4 Q;  1XYI A;  4C3H G;  1HA6 A;  3SVM A;  1CI3 M;  4G4K A;  1PVO A;  1PH6 A;  4JI0 Q;  5HUR A;  2RHQ B;  5I4D A;  1X9N A;  4UDU C;  1TXY A;  4IOA A;  2N55 A;  4HJ7 A;  2E5L Q;  3D31 A;  3GTP B;  1A3V A;  4HMI A;  2BH2 A;  3PQI A;  3K58 A;  3T53 B;  2SNS A;  3KJP A;  1NSN S;  2Q8R E;  4ODG A;  2K52 A;  3Q6S A;  3NEM A;  4DR5 L;  3VDY A;  1K9M C;  1PA6 A;  4IJH A;  5C3W A;  1JQY D;  1E22 A;  2OXP A;  3H3V H;  3UE0 A;  1H9S A;  1D5Z C;  5A2Q L;  1E7Z A;  3J7A 5;  4LF5 Q;  4BXX H;  2UUA L;  1KLG D;  4IUU A;  3QWN A;  3BVZ A;  2B63 B;  4DUY Q;  2G5D A;  3A0J A;  2YYZ A;  3MXN A;  5H1S E;  1U4R A;  1GUN A;  3K5L A;  1HFG A;  4C3I G;  4HAE A;  1PH7 A;  4DN4 M;  2RQX A;  4ALP A;  3HOY B;  3L9A X;  2VNU D;  4J1M A;  3S2D H;  4IFD H;  1MJC A;  2B2V C;  1IKM A;  1A8V A;  4JI0 L;  4CKB A;  2IWH A;  2ICE C;  1XPO A;  1QWY A;  1W6J A;  4UP8 A;  4HJ8 A;  4X3T A;  2B2T C;  2BCO A;  2F3I A;  5LMN Q;  2QIL A;  1JR0 D;  2F0U A;  5FJ8 G;  1PMR A;  2MO0 A;  3QR8 A;  3I4M B;  1K0R A;  4X3U A;  5D3I B;  4B3T L;  1X3G A;  1S5D D;  1PRT D;  1HCZ A;  2OEO A;  2F03 A;  2MHV A;  1PTO F;  1WTQ A;  2KJX A;  4FF1 A;  3RZD B;  4GN5 A;  5DLQ E;  4A3B G;  1G2S A;  3S16 H;  3X3N A;  2QEJ C;  1YNJ D;  1MI2 A;  4WRD A;  3F2D A;  4LF5 L;  4A93 G;  1DOK A;  1STA A;  4AYB B;  3S1M H;  2DNC A;  3PUV A;  5DM7 3;  2FXQ A;  3IL8 A;  4GLX A;  2F0K A;  4APV A;  2MNA A;  2NVQ B;  4A3D B;  4A93 B;  1P8L A;  3JAM E;  3HOV B;  1DGS A;  4KY7 A;  2ICI A;  1YNN D;  1L0Y B;  4NMZ A;  1DJR D;  2D0P A;  1BCP D;  1C4Q A;  2WB1 G;  5FLX c;  2RKS A;  4ZLT F;  4Q5V A;  1S40 A;  1LV9 A;  2QF7 A;  1BF4 A;  1GO3 E;  1ZKO A;  3O13 A;  3BDC A;  1IBL Q;  3E0E A;  4DGZ A;  3RZD H;  3A8K E;  2B2T A;  3CW2 C;  2P5Z X;  5I2X A;  4L5S A;  3D4R A;  4DV4 L;  1SRO A;  1EY4 A;  2BDN A;  1SE4 A;  1I94 Q;  4LFA Q;  4JI5 L;  3PO3 G;  4ZK9 B;  2FHT A;  1CA5 A;  2Z8L A; 
#chains in the Genus database with same CATH homology
 1GVP A;  4O2D A;  2R92 H;  3U50 C;  4LF4 Q;  4POF A;  2RF4 A;  1KL9 A;  4GNX A;  2K75 A;  4HJA A;  5IE8 A;  2VY3 A;  1I5F A;  5EAY A;  1C0A A;  4QY7 A;  4IPD A;  1T9H A;  4YHH Q;  1Y1W H;  1C7Y A;  2JA5 H;  5HY6 A;  1RL2 A;  3M9B A;  3CC7 A;  2EXD A;  4AYB E;  3RR5 A;  3ULJ A;  1YJ9 A;  3KDF A;  4WJ3 M;  3KLW A;  1BKB A;  4P74 A;  1VCI A;  2WB1 E;  2CFM A;  2VW9 A;  4JI8 L;  2YTX A;  1HNW Q;  2KBN A;  1E1O A;  3GTK H;  3B6Y A;  4DR1 Q;  4OXP A;  3PF5 A;  3CCS A;  1YI2 A;  4DV0 Q;  4YY3 L;  1VQ8 A;  4XIG S;  2L15 A;  4DR1 L;  2UUA Q;  2NVT H;  3GDE A;  4DR6 Q;  1JMC A;  2KHI A;  4DAY B;  5IP7 G;  3I55 A;  2Q2I A;  3S24 A;  5IP9 H;  3BZK A;  4X62 L;  2CKZ B;  4GLA C;  2OQ0 A;  4GOP C;  2UUB Q;  1JJG A;  4OWT B;  1PH2 A;  3U58 A;  2NVQ H;  3GTQ H;  3NEN A;  3K7U C;  3HOX H;  2GVA A;  4HIM A;  4R1J A;  3RZO H;  1IL2 A;  3ERS X;  4R4C A;  5IYC G;  1MJE A;  1EQQ A;  3CCU A;  2E5L L;  2YTV A;  4QIW E;  4LFA L;  3HOW H;  5GQO A;  3PCO B;  2E2I H;  4AQY Q;  4UPA A;  2B3G A;  4A75 A;  2UXB L;  4GOP A;  2JA8 G;  3PUW A;  5C4J H;  2VQF L;  1NMF A;  1EYG A;  2R93 H;  2WAQ E;  2Q2H A;  1N9W A;  4JOI A;  1EUJ A;  1N8R C;  4J15 A;  4A3E G;  1BBU A;  2K4K A;  1J6Q A;  4GS3 A;  4DR2 L;  4DKA C;  1E1T A;  2I5L X;  2D0O A;  2B63 G;  5FJ8 H;  4X65 Q;  2JA7 G;  1KAW A;  4DR2 Q;  1E3P A;  3CAM A;  4JI6 L;  2NZO A;  1A0I A;  4PZ6 A;  4X66 Q;  1PH8 A;  1SRU A;  4A3M G;  3F2C A;  4BY7 H;  4JG2 A;  3TQY A;  3CCQ A;  1CKN B;  2OWO A;  4TVA B;  2MQH A;  2LXJ A;  1IBM Q;  1N32 L;  4OX9 L;  1CKO A;  1G29 1;  4A93 H;  1VQB A;  1PH1 A;  4BBS H;  2YV5 A;  1KXL A;  3PGZ A;  1Y1V G;  2R6G A;  4C3H H;  5HGQ A;  3M7N A;  3J81 j;  3TS2 A;  1HR0 L;  1N36 L;  3TS0 A;  1OXX K;  1LM0 A;  2ID0 A;  4AIM A;  2K14 A;  1U0L A;  2F52 A;  2N3S A;  5C4X H;  3T1H Q;  1YJN A;  1HR0 Q;  3HOW G;  4IFD I;  3CCL A;  2UUB L;  1KRS A;  2QEX A;  4DV3 L;  2WP8 J;  3TRE A;  2IX1 A;  2BA0 A;  5GAG C;  3RN2 A;  3E9H A;  1XPU A;  4GKJ Q;  1I6H H;  2EIF A;  4HJ9 A;  1EWI A;  2AHO B;  1G6P A;  5FLM H;  3STB C;  3CPW A;  1P16 A;  1EQR A;  2CWA A;  2VUM G;  1SLJ A;  2IHE A;  4JCV E;  4DV5 Q;  1VQN A;  2VS1 A;  3STB D;  4DV6 Q;  3CC2 A;  4A3B H;  3K8A A;  2PI2 E;  2V1C C;  3E9I A;  5M5X H;  4A3F G;  1ASZ A;  5IT9 c;  3J81 c;  4DV6 L;  2UXD Q;  1OXU A;  1EFW A;  1NJI C;  3GTO H;  4IFD J;  4JI6 Q;  2VZA A;  1QZG A;  1I50 H;  1B7Y B;  4PZ7 A;  1VQ7 A;  1VQ5 A;  5J3B A;  3G71 A;  1V9P A;  1GKH A;  1L0W A;  1HNX L;  1EIY B;  1IBM L;  1UE5 A;  1VQE A;  1N32 Q;  4LUO A;  2F4V L;  4JV5 L;  1Q12 A;  1VS0 A;  4KI0 A;  3UE1 A;  5C44 G;  2UU9 L;  1KIX A;  2F4V Q;  4A3G G;  4DUY L;  3EIV A;  1PYB A;  3GD7 A;  5LMN W;  4HIK A;  3PF4 A;  5BR8 L;  2IY5 B;  3UDF A;  1YHQ A;  5GAD C;  4A3L H;  5C0X I;  3PO2 H;  4KHP Q;  1FVI A;  2XGT A;  1CKN A;  1YHB A;  4FDB A;  3G4S A;  1UE1 A;  4HID A;  1ASY A;  1X65 A;  4OON A;  1WI5 A;  4DR7 Q;  3K81 C;  3I2Z A;  3CC4 A;  4OWX B;  1OXS C;  1YHA A;  1PH9 A;  4OO1 I;  3DLL A;  5JJL A;  1YZ6 A;  3RN5 A;  1VQ6 A;  3FHW A;  2R93 G;  3BJU A;  3PUX A;  1K3R A;  4O0A A;  1X3E A;  2KHJ A;  1XJV A;  1QVF A;  4P72 A;  4A3G H;  4BXX G;  1WCM G;  4LFB L;  2R7F A;  3AEV A;  2UUC L;  3JAM c;  5M5W H;  4DV1 L;  3W1G A;  4LF4 L;  2PMZ E;  2AMC B;  1Q46 A;  4MZ9 A;  5AJ3 L;  2QA4 A;  2OTJ A;  2KCM A;  4BA2 I;  2B29 A;  3CMA A;  4K0K Q;  3HOX G;  4NXN Q;  1FL0 A;  4A3I G;  1Q81 C;  1HNZ Q;  1L1O C;  3HOU G;  4A3C G;  4B3R Q;  2KCT A;  2RHS B;  3F8T A;  1KHI A;  2BH8 A;  1WFQ A;  5JJI A;  4LF7 L;  5C4X G;  2QGQ A;  3PIP A;  1KD1 C;  1N33 L;  2OQK A;  1CKM A;  3H3V I;  4LF6 Q;  3J80 i;  1XNQ L;  3CCE A;  4H02 A;  2R7Z G;  1HNX Q;  2I0Q A;  4A4I A;  5C3E H;  3CME A;  4IPH A;  1HZC A;  2VL6 A;  5C0X G;  2ZJR A;  2JA6 H;  5FLM G;  4A3I H;  4YCU A;  2Y0S E;  4MNO A;  4LFC Q;  3OTO Q;  4LF9 Q;  1YNX A;  5M3M H;  1PHJ A;  3HOV G;  3L7Z C;  1TWA H;  3H0G G;  3CQZ H;  4LF8 L;  3RNU A;  4DV7 Q;  2JE6 I;  2NN6 I;  1CSP A;  4QL5 A;  2C35 B;  4KHP L;  4RG1 A;  3I4N H;  1L1O A;  1M90 C;  4LF8 Q;  2JQO A;  1PYS B;  4JI2 Q;  4DUZ L;  1IBK L;  3PO3 H;  4ME3 A;  2LSS A;  4IOC A;  1VQF A;  2OCE A;  1PH4 A;  2CCZ A;  2R92 G;  1YEZ A;  1NTG A;  4JOI C;  4EX5 A;  3CCR A;  3HOZ G;  2CQO A;  4DK3 C;  4BBS G;  2XTI A;  4BY1 H;  2ZM6 Q;  2VQE Q;  3MEF A;  3S1R H;  1H95 A;  2I5H A;  5IWA Q;  1GD7 A;  1XMO Q;  1K83 H;  1V1Q A;  4IJL A;  1XTD A;  4EQ5 A;  3CCM A;  4GOP B;  3TRZ A;  5ELO A;  4MTN A;  4DK6 C;  5M5Y H;  5IWA L;  1XMO L;  1HNZ L;  4B3R L;  4JI1 Q;  3CD6 A;  3RLO A;  2DUD A;  3RLF A;  3J7Z C;  2MO1 A;  2GVB A;  1VQM A;  1XPR A;  4RMF A;  4LF7 Q;  2PQA A;  4JBJ A;  1CSQ A;  3JAM i;  2JA7 H;  1OTC A;  2A19 A;  3S2H H;  3D0F A;  3A5U A;  3KF8 B;  4LUV A;  3J81 i;  1S72 A;  4LF6 L;  5IYB G;  4AH6 A;  4L5R C;  4JV5 Q;  3WWV A;  4JBK A;  4B3M L;  4JI4 L;  3Q8D A;  5IP9 G;  1XMQ L;  2R7D A;  4TQU S;  5IP7 H;  4BY1 G;  4GN3 B;  4A3D G;  5BR8 Q;  4QQB X;  4R4T A;  3CP0 A;  1Q82 C;  2UXC L;  1M1K C;  1X3F A;  4C2M H;  3CXC A;  2K5N A;  3HKS A;  3ZJY C;  5IYC H;  3G6E A;  3F2B A;  2N49 A;  3LGJ A;  1HH2 P;  1OXV A;  1TWF H;  4P71 A;  3SGI A;  4A3F H;  3KOJ A;  4LFC L;  2E2H H;  2A1A A;  3G48 A;  1QUQ A;  3BZC A;  1TWH H;  1HJP A;  1VQJ A;  4Y52 H;  3KDF B;  1SE8 A;  4JYA L;  1HNW L;  3H15 A;  4HJ5 A;  3W5O A;  4DV7 L;  1EIF A;  1V43 A;  4X66 L;  3GTJ H;  2ATW A;  2MFI A;  1LYL A;  4DV0 L;  2WAQ G;  2ZTE A;  3FKI G;  1JJC B;  4WJ4 A;  1XNR L;  3BU2 A;  4DV2 Q;  2YU9 H;  3I4O A;  1TWG H;  5JEA G;  1K8G A;  1VQ9 A;  4JI8 Q;  2JJQ A;  1IYJ B;  2UU9 Q;  2UUC Q;  1X6O A;  1HZA A;  3HKZ E;  4DV2 L;  3A74 A;  4DV1 Q;  4DR3 Q;  1SMX A;  1OXT A;  1PV4 A;  1JE5 A;  1N34 Q;  2ZTC A;  3A5Z B;  1N36 Q;  2KEN A;  1L1O B;  1HR0 W;  2NVX H;  4JC0 A;  1SR3 A;  3UDI A;  4A3J G;  1PFS A;  3PUY A;  1LUZ A;  2JA9 A;  2LXK A;  2PI2 A;  2K50 A;  3ULP A;  1E24 A;  3M4P A;  1AH9 A;  2ZJP A;  1U5K A;  1WCM H;  1Z47 A;  3T1H L;  3S17 H;  4JI7 Q;  1C9O A;  5M3F H;  1X55 A;  5IY0 A;  2ZTD A;  4HIO A;  1XMQ Q;  4DV3 Q;  4UY8 C;  3AYH B;  4JI7 L;  3NBH B;  4LWC A;  4R4O A;  4BA1 I;  4DV5 L;  1R9T H;  4DNI A;  4GKJ L;  3KYH C;  4LNQ A;  4KHZ A;  1VQ4 A;  4LUZ A;  1KQS A;  2B63 H;  2PNH A;  4A3K G;  2EQS A;  4JI5 Q;  4JI3 Q;  3K80 C;  3J80 c;  5LMN L;  3PUZ A;  1QVC A;  3HOZ H;  4YHH L;  4A3C H;  4AYB G;  2OTL A;  2NVY H;  4DAM A;  2AKW B;  3U4Z A;  3KF6 B;  1O7I A;  4JYA Q;  3S14 H;  1IXR A;  1MIU A;  1FGU A;  1YVC A;  4YCV A;  4DUZ Q;  1IBK Q;  4JI2 L;  3M4O H;  3PSI A;  3NEL A;  4BBR H;  4X65 L;  2HT1 A;  1VQO A;  1VQL A;  3F1Z A;  2HQL A;  4X64 Q;  2Q2U A;  4DR3 L;  4R4Q A;  3AFP A;  1N34 L;  4QJF A;  2CWP A;  3L0O A;  1FJG L;  2ZJQ A;  2PQA B;  5E7N A;  1I3Q H;  5GAH C;  4OO1 G;  5LMU L;  1VQK A;  4GKK Q;  3M4Q A;  4IPC A;  1KC8 C;  4L5Q A;  4YY3 Q;  1A63 A;  1HZ9 A;  4JI1 L;  3UDX A;  1FJG Q;  3U4V A;  1UE6 A;  5LMU Q;  4LF9 L;  4GKK L;  2RCN A;  4UP9 A;  4C3I H;  4DR6 L;  4NPS A;  2JA8 H;  4GNX C;  1EOV A;  1VQP A;  3L2P A;  4YWM A;  3CCV A;  4DV4 Q;  1MKH A;  3H0G H;  2Z6K C;  4JBM A;  2VUM H;  1PH6 A;  4JI0 Q;  1PVO A;  4B3M Q;  4JI4 Q;  3HOU H;  2RHQ B;  1NBW A;  2BA1 A;  4YWK A;  3T1Y Q;  3PIO A;  1X9N A;  5GRO A;  4NXM Q;  5GAE C;  1NY4 A;  2VQF Q;  1TXY A;  1UEB A;  4IOA A;  3PV0 A;  4HJ7 A;  2E5L Q;  5C3E G;  3ICE A;  3D31 A;  1RIP A;  1VQD A;  4PMW A;  4AQY L;  4BY7 G;  4A3M H;  1PH3 A;  2DGY A;  2BH2 A;  2IHF A;  2UXB Q;  1Q86 C;  4LFB Q;  5IYD G;  3KJP A;  5ELN A;  2E8G A;  2K52 A;  5AJ3 Q;  3NEM A;  4DR5 L;  3VDY A;  4GNX B;  1W2B A;  3GTL H;  2JK8 A;  1K9M C;  1PA6 A;  1K8A C;  4IJH A;  4A3D H;  1E22 A;  1W3S A;  2IX0 A;  1YIJ A;  2ALY B;  3KJO A;  3K7A H;  4K0K L;  4LW1 A;  4UP7 A;  1D8L A;  2Y0S G;  2IT1 A;  3ULL A;  4X64 L;  3UE0 A;  2N8N A;  3H3V H;  1D7Q A;  1BBW A;  1XNR Q;  3MXN B;  2NN6 G;  1E7Z A;  3KFU A;  1QVG A;  3PO2 G;  3J7A 5;  1Y1W G;  1WYD A;  4A3L G;  1VQA A;  2HHH Q;  4LF5 Q;  4BXX H;  1XNQ Q;  2UUA L;  2ES2 A;  4C3J H;  4B3S Q;  5M3F G;  2AWO A;  2YTY A;  4DUY Q;  3DM3 A;  4X62 Q;  3A0J A;  1X54 A;  5C44 H;  1AE3 A;  2YYZ A;  4PG3 A;  5H1S E;  3OTO L;  4IFD G;  4IO9 A;  4X6A H;  4DR7 L;  3OW2 A;  4R4I A;  3IRB A;  1PH7 A;  1UWV A;  1VQG A;  4ALP A;  3W1B A;  1QZH A;  3CF5 A;  4DPG A;  1B8A A;  4A76 A;  2VNU D;  1A62 A;  1G51 A;  3KF6 A;  3T1Y L;  3S2D H;  3M85 A;  5IYB H;  4NXM L;  1MJC A;  1JT8 A;  1NE3 A;  2HIV A;  3HKZ G;  2HIX A;  2H5X A;  4NB3 A;  4A3K H;  4L5T A;  1A8V A;  1YBY A;  4YWL A;  4JI0 L;  1XPO A;  3I56 A;  3CPF A;  1VQC A;  3GTG H;  5IYD H;  3HOY G;  5JJK A;  4UP8 A;  4HJ8 A;  1VQI A;  4BBR G;  2F3I A;  5LMN Q;  3M3Y H;  1AE2 A;  3AQQ A;  2K5H A;  3AFQ A;  3HOV H;  5FJ8 G;  2A8V A;  4DR4 L;  2JEA I;  3JC6 6;  2MO0 A;  3ER0 A;  1K0R A;  1Q7Y C;  3CCJ A;  2Z6K A;  1SN8 A;  4B3T L;  4DR4 Q;  1S3O A;  1K73 C;  1X3G A;  4NXN L;  4DR5 Q;  2R7Z H;  1I94 L;  1CUK A;  3K0X A;  1Y14 B;  3EBE A;  4GN5 A;  2ASB A;  3I4M G;  2GN5 A;  1PH5 A;  4YCW A;  5DLQ E;  3S15 H;  4A3B G;  3S16 H;  2UXC Q;  1Q1B A;  3GTP H;  1Y1V H;  2K5V A;  4Y7N H;  3FKI H;  3OYY A;  4GN4 B;  3F2D A;  2HHH L;  4LF5 L;  4POG A;  4A93 G;  4IPG A;  1X56 A;  3PUV A;  4GLV B;  4JI3 L;  2FXQ A;  1IZ6 A;  3TEH B;  1J5E Q;  3S1M H;  2JEB I;  1Z9F A;  4GLX A;  1WOC A;  2D62 A;  2JA5 G;  1J5E L;  4XTC S;  4APV A;  1JB7 A;  3HFZ B;  3EN2 A;  2MNA A;  1UE7 A;  4OWW B;  3I4M H;  4P73 A;  1GM5 A;  1LTL A;  1P8L A;  1QUQ B;  4JBW A;  1YIT A;  1DGS A;  5C0X J;  5JEA J;  2ZM6 L;  2VQE L;  1B70 B;  1L2F A;  2I5M X;  1SFO H;  1TWC H;  2AWN A;  2D0P A;  2WB1 G;  5FLX c;  1JJ2 A;  4KLK A;  4OX9 Q;  1S40 A;  3I7F A;  3GTM H;  1Q1E A;  3FP9 A;  1KRT A;  3UDG A;  5K36 G;  2WFW A;  1GO3 E;  2UXD L;  4P75 A;  2N78 A;  3RLN A;  3S1Q H;  4QGU A;  4B3T Q;  1YJW A;  1IBL Q;  3E0E A;  3RZD H;  3HOY H;  3CW2 C;  1Q8K A;  1IBL L;  5M3M G;  1N33 Q;  2NZH A;  4L5S A;  2Z0S A;  4DV4 L;  1SRO A;  1BVS A;  2Q2T A;  3GO5 A;  2JA6 G;  3S1N H;  4A3E H;  2E2J H;  1WJJ A;  3I4N G;  4A3J H;  1NMG A;  1I94 Q;  4LFA Q;  4JI5 L;  3PO3 G;  1VQH A;  1HZB A;  4B3S L;  4PZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...