4GKKQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkkQ00
2VZAA 2JA9A 1WCMH 1M90C 4IPCA 4P73A 1QUQB 4DUZQ 5LMNL 1VQ6A 4DR5Q 4QJFA 2I5LX 3GTMH 4UY8C 4XTCS 3FKIH 2E2JH 4IJLA 4R4OA 4DUYQ 2MO1A 2BH8A 3D0FA 1OXXK 2PQAB 1VQ9A 1YI2A 5M5XH 1HR0Q 1MJCA 2WB1E 4GN4B 3CC2A 1IL2A 2JA7G 5GQOA 1YJWA 3S2DH 1KAWA 5M3MG 2E5LL 4AQYL 1I5FA 1N36Q 3JC66 3CCUA 1GD7A 4A3MH 3PUXA 3PV0A 1I50H 3J80i 4DV1L 2I5HA 1JJ2A 2ES2A 4A3GH 4YWKA 4AH6A 1CKNB 3I4NG 4JYAL 4ALPA 4KHZA 5IY0A 4GNXA 4B3TQ 4H02A 1VQDA 2XGTA 2RHSB 3HKZE 2RCNA 1IBML 1VQEA 5IYCG 1HH2P 1X55A 4B3RQ 2IY5B 3RZOH 1BBWA 3DLLA 4LUVA 2Y0SE 3EN2A 4LF8Q 1A62A 4GN5A 4C3HH 3B6YA 4GLXA 2AHOB 4NXNQ 1IBLQ 2AWNA 4AYBE 3E9HA 2OCEA 4L5QA 4LFCL 4DV2Q 3M9BA 1AE2A 1NBWA 1SROA 3GDEA 4AIMA 5IE8A 1UE7A 4B3ML 1Q8KA 4R4QA 2AMCB 5IYBG 2N8NA 2UUBQ 1Q82C 3J81i 2YU9H 4IOAA 3OTOL 2R7ZH 1I6HH 3GTJH 2F4VQ 4KHPQ 1PA6A 1PFSA 5J3BA 1PH2A 1YHBA 1JT8A 1OTCA 3H15A 3KF6B 2NN6I 2GVBA 4A3KH 5FLXc 1J6QA 1Q1EA 2ID0A 1UE6A 3ERSX 4YWMA 5IYDG 1SE8A 1U0LA 1VQFA 3PIOA 4C3IH 3ULPA 3AFQA 3CP0A 2VUMH 4DR6Q 3KJPA 4J15A 1MIUA 4YCWA 2MNAA 2HIXA 3E9IA 4QL5A 4X66L 4DK3C 4OO1G 3ULLA 4BXXG 2OTJA 1HNZQ 4DV6L 1FJGQ 4UP7A 2UU9L 4BBRH 1B8AA 4A3BH 1XMOQ 1GO3E 1TXYA 2ZJRA 4HJ9A 4X6AH 3PIPA 2HHHL 3H3VI 2AKWB 4GKJL 1S40A 3L7ZC 2YV5A 3HOZH 2EXDA 2VQFL 3KDFA 4JCVE 2JA7H 1SMXA 2WB1G 1PVOA 3W5OA 1N33L 1Q7YC 2H5XA 4DV7Q 1W3SA 4OWTB 5IP9H 2A8VA 2ZJPA 1X56A 2B3GA 2JA8G 1J5EQ 4JC0A 1LUZA 2R7FA 1I94Q 4RG1A 2IT1A 1HZ9A 3MEFA 4LF7L 1VQOA 4A3LG 1CSPA 3I4NH 3CAMA 4JI0Q 3ULJA 2IHFA 2DUDA 4YWLA 4LF5Q 1XNQL 1HNWQ 1N32L 3AYHB 3CMEA 1X3GA 2HIVA 4B3SQ 1VQJA 3HKZG 3OW2A 4JI7Q 1XNRQ 1LM0A 1K8GA 1L1OC 2JA5H 4BBSG 1OXUA 1VQMA 1WFQA 1O7IA 2OQKA 3LGJA 5C0XJ 3T1HQ 3FP9A 1NE3A 1EYGA 1NY4A 4O2DA 4TVAB 3HOYH 1JJCB 1WYDA 2Y0SG 4DV4Q 4IPGA 4DV5Q 4WJ4A 3RR5A 4JI6L 4MZ9A 2ZM6Q 1E24A 4JI4Q 4LF6Q 4AYBG 1YHQA 5FLMH 1PH6A 1U5KA 1Y1VG 2QA4A 4QQBX 2RHQB 1PYBA 4DR2L 3M85A 5BR8Q 4NXML 2QEXA 3TRZA 3K0XA 2NVYH 4JBJA 2NZOA 4LFBL 3S14H 2YTVA 5GROA 4DAYB 4DUZL 3PCOB 2RF4A 3S1NH 2R92G 3AQQA 3HFZB 4A3JH 1SN8A 1E1TA 4DR3Q 2WP8J 4LF9L 4UP9A 2VQEQ 3DM3A 5C0XG 4A3FH 4BY1G 4MNOA 3A5ZB 3A74A 3K8AA 5GADC 2ALYB 3PO3G 1EIFA 4DV3L 4DKAC 1YITA 1N9WA 4PG3A 4P75A 1A0IA 4BY7H 1QVGA 1PH8A 4HJ7A 1S72A 1XMQL 1WI5A 4Y7NH 4GNXB 1EWIA 4PZ6A 4A3DH 2A19A 4A75A 2I0QA 1SFOH 1GVPA 1JB7A 3HOUH 4B3TL 3W1GA 4DK6C 2YYZA 5GAHC 5LMUL 2UXDQ 4B3RL 3CCRA 4LUOA 4JI8L 1MJEA 3T1YQ 1X65A 2DGYA 4R4IA 2JA6G 4DR4Q 1KRSA 1IBKQ 1PV4A 1NMGA 2K5NA 4JI5Q 4LF8L 1MKHA 4JBWA 4HIMA 3PF4A 4GS3A 3GTOH 2UUAQ 4A3LH 1HZAA 4R1JA 4DV2L 4DR1Q 4A3CH 5ELOA 4A93G 3CW2C 4QGUA 1XPRA 4DR7L 1K3RA 3PSIA 2I5MX 1L1OA 4NPSA 1Z47A 3PUZA 4JI3Q 4A3EG 1AH9A 4JV5Q 4LUZA 4OWWB 1BBUA 4FDBA 2B63G 5FJ8G 3F2DA 3HOWH 4IPHA 5ELNA 2HQLA 3M4OH 4LF4L 4X62L 4LFAQ 2K50A 5C4XH 5IT9c 1TWFH 1ASYA 1E22A 3RNUA 1SRUA 4JI2Q 1YEZA 3GTGH 3H0GG 2OQ0A 2F52A 3CCSA 2K5HA 5M3FG 3PO2G 2D0PA 2R93G 1FL0A 1FJGL 2ZTEA 5LMNW 1UE1A 3KJOA 1XNRL 1HJPA 4HIKA 2KCMA 3I2ZA 1VQ7A 4HJ5A 2L15A 3K7UC 3KYHC 3KDFB 3HOXG 1CUKA 2UUCL 1P8LA 4GLAC 4AQYQ 3EIVA 5JJLA 5C44H 2Z6KC 1R9TH 2IX1A 2MFIA 1VQIA 1G51A 4DV1Q 4X65L 1YJNA 5M5YH 2K14A 1X9NA 2N49A 4DV0Q 1WJJA 2QGQA 5C3EG 1QZGA 1CKNA 4LWCA 1EOVA 3STBC 1YHAA 1IBMQ 1GKHA 1N34L 1C7YA 4GOPC 1L2FA 1JJGA 2V1CC 4LF5L 4JI0L 3STBD 1Y1WG 1WOCA 2PNHA 4B3SL 3PF5A 4K0KL 2VNUD 3CQZH 3NELA 2CCZA 1D8LA 4IFDJ 2LXJA 1JE5A 2YTYA 1LYLA 2JEBI 4OONA 2IHEA 2JK8A 1XPUA 3HOVG 3M7NA 2ZTDA 2R6GA 1VQPA 5M3MH 1ASZA 4LFCQ 3E0EA 1KL9A 4IOCA 4DV5L 4B3MQ 5C4JH 3F2BA 5M5WH 4POFA 4OO1I 3KLWA 3G48A 4YY3L 1K9MC 1WCMG 3OTOQ 4GN3B 4IPDA 3UDXA 1SR3A 2NZHA 2HT1A 4Y52H 3RN5A 5IYCH 3UE1A 1B70B 2PI2A 1PH3A 3FKIG 3U4VA 2CWPA 4A3EH 3J7A5 2JE6I 1A8VA 3M4QA 1PH7A 5E7NA 4ME3A 4P72A 1EQRA 5FJ8H 1IXRA 4IFDG 3UDFA 5AJ3Q 1VCIA 3NBHB 2UXCL 4X66Q 2KHJA 3KOJA 1FGUA 5IWAL 2GVAA 4A3MG 2ASBA 2VQEL 4DV6Q 1VQ5A 4QIWE 1PH9A 2UU9Q 3K80C 4A3GG 1CKOA 3AEVA 3ZJYC 4WJ3M 3H0GH 3GTPH 3PUYA 2ZTCA 3S24A 5JJIA 2VS1A 5IYBH 3GO5A 3CPFA 1QZHA 2HHHQ 1IYJB 4OX9L 4PMWA 4GKJQ 1X3EA 4IO9A 3GTKH 3KF8B 4GKKQ 3G6EA 1PH1A 4DR5L 3BJUA 5DLQE 1TWGH 1N33Q 1S3OA 2JJQA 2FXQA 3UDGA 4L5SA 2JEAI 2UXBQ 4GLVB 1K83H 4DUYL 1KC8C 2Z6KA 3F1ZA 1GM5A 3KFUA 2UXDL 3AFPA 4PZ8A 1HR0L 4UPAA 1XPOA 2YTXA 5IYDH 1VQCA 1YNXA 4YCVA 1KQSA 1E1OA 1XTDA 4DAMA 2AWOA 4KLKA 1N36L 1IBKL 2Q2HA 2KENA 4BXXH 1N32Q 1YJ9A 3S15H 3CMAA 1NTGA 4BA2I 4GOPA 1PYSB 3TQYA 1VQ4A 3W1BA 2Q2UA 3Q8DA 4YHHQ 1V43A 4RMFA 4DR1L 1L1OB 2XTIA 1Y1WH 1VQBA 4HJ8A 2R7ZG 3PUVA 1C9OA 4YCUA 1OXTA 1VQAA 1N8RC 1B7YB 3ER0A 4TQUS 1Q1BA 4BA1I 4EX5A 2VY3A 3RLNA 3CC7A 1EQQA 4A3KG 4JI6Q 4JV5L 4X64Q 1V1QA 5JEAJ 1V9PA 3I4OA 4HIDA 1EFWA 1Y14B 1Q86C 2VUMG 3K7AH 4DR2Q 2EQSA 1Z9FA 4MTNA 2JA8H 1UE5A 2KHIA 4EQ5A 1YVCA 2VL6A 3CPWA 4NXMQ 4POGA 1C0AA 2MO0A 4NXNL 1IBLL 3D31A 3UE0A 4LFBQ 5K36G 1Q46A 2CWAA 4JI2L 4BBRG 3CF5A 4A3BG 1G291 4JI1Q 1PH4A 1KHIA 1EUJA 1P16A 1OXVA 4NB3A 1PHJA 2UUBL 3F8TA 1HNXQ 3I4MG 4BBSH 1E3PA 3CCLA 4LF9Q 3HOZG 4DPGA 1FVIA 3RN2A 3S1QH 3CCEA 2F4VL 2Q2TA 4KHPL 1NMFA 3UDIA 2N3SA 4DV3Q 2B29A 2PMZE 3A0JA 5EAYA 2E2IH 5IP9G 2OWOA 1HR0W 3M3YH 5IP7G 1XMQQ 3CC4A 4OXPA 4C3JH 1K0RA 5JEAG 2ZJQA 1Y1VH 1E7ZA 2D62A 4JOIC 3HKSA 5LMNQ 3CD6A 4DR6L 1Q12A 3PUWA 2EIFA 3U50C 2K75A 3RLFA 3JAMc 4DV0L 3J81c 1HNZL 1QUQA 5LMUQ 1QVFA 3S17H 1XMOL 4L5RC 5GAGC 2JA5G 2R92H 4JI8Q 2VW9A 2E5LQ 2PQAA 3CCJA 2NN6G 3NENA 3HOYG 1K8AC 1G6PA 1QVCA 4BY1H 4IJHA 1RIPA 2OTLA 3FHWA 1K73C 1KRTA 1YZ6A 2K52A 3PO3H 4DV7L 2CQOA 1D7QA 2BA1A 5FLMG 4JYAQ 4C2MH 5H1SE 4A3IG 1J5EL 4DR7Q 1I94L 1OXSC 4O0AA 1BVSA 1JMCA 3JAMi 3L2PA 2BH2A 1HNWL 1RL2A 3OYYA 4KI0A 1CKMA 1SLJA 2F3IA 2KBNA 2WAQE 1X3FA 2Z0SA 1X6OA 3G71A 2MQHA 4A3JG 1M1KC 3A5UA 2JQOA 1AE3A 3BZCA 4LF4Q 4X62Q 1XJVA 1EIYB 2GN5A 3GD7A 3IRBA 1YBYA 1DGSA 2K5VA 3T1HL 4A3FG 2JA6H 2E8GA 3BU2A 4DV4L 1TWCH 3VDYA 4BY7G 5AJ3L 3CCMA 2ZM6L 1BKBA 4JI4L 4LF6L 4P74A 3I56A 1VQ8A 3CCQA 4HJAA 2PI2E 4A93H 2NVTH 4A3DG 5HGQA 4XIGS 3J7ZC 5BR8L 1CSQA 1UWVA 2BA0A 4QY7A 5GAEC 3F2CA 3HOUG 2UUCQ 3G4SA 3SGIA 3S16H 2WFWA 2NVXH 3I4MH 1LTLA 4GKKL 1VQNA 4DNIA 1KIXA 3TS0A 3M4PA 4X65Q 3KF6A 2B63H 2UXBL 3TREA 4DR3L 5IP7H 2D0OA 1W2BA 3GTLH 4LNQA 1UEBA 3MXNB 4JBMA 4JOIA 1N34Q 1HZCA 3I7FA 2R7DA 3NEMA 2CFMA 4A4IA 2LSSA 4GOPB 2N78A 4APVA 4A3CG 5M3FH 4GNXC 3PO2H 2R93H 4HIOA 3PGZA 4K0KQ 4PZ7A 2IX0A 3U4ZA 4LW1A 1VQLA 2VQFQ 1VQHA 3J81j 3BZKA 2A1AA 3I55A 4YHHL 1VS0A 2Q2IA 3EBEA 4OWXB 3HOXH 1TWHH 1A63A 3HOWG 2KCTA 1VQKA 3S1MH 4IFDI 1PH5A 2NVQH 3RLOA 1HZBA 4LF7Q 5C4XG 1I3QH 4X64L 4JBKA 4YY3Q 1T9HA 3T1YL 3K81C 3GTQH 4DR4L 2ATWA 2C35B 1XNQQ 3CCVA 4UP8A 4JI5L 5C3EH 4A3IH 3ICEA 1L0WA 2UUAL 4R4TA 5JJKA 4JI1L 3L0OA 3H3VH 2LXKA 3S2HH 2WAQG 4JG2A 3CXCA 1TWAH 3TEHB 3U58A 5HY6A 4JI3L 1Q81C 1HNXL 3WWVA 1H95A 1KD1C 2UXCQ 5C44G 5IWAQ 1X54A 3HOVH 4L5TA 5C0XI 2E2HH 4P71A 4A76A 3RZDH 1NJIC 1IZ6A 3S1RH 3J80c 1KXLA 4R4CA 1YIJA 2K4KA 2CKZB 4JI7L 1VQGA 4LFAL 4OX9Q 3TS2A
chains in the Genus database with same CATH superfamily
1GUWA 1Z7TA 1PTOD 3HRZC 4DR5Q 3HP3A 4L8JA 4DUYQ 4R4OA 1EY6A 3I3CA 2KUMA 3CC2A 4NP5A 1B2TA 3SDZA 3KLSX 1YJWA 2ENBA 5M3MG 4IFDH 4PQXA 4HEDA 3CCUA 5KEEA 4HMIA 5JPNC 2Z4IA 3J80i 3KBXA 2I5HA 3OWEB 1Q8IA 4C3JB 1Y1VB 1JWMD 1MBYA 4B3TQ 1D5MC 4H02A 3VR6A 3GQBA 3HKZE 2RHSB 3DXJC 4WORA 3T4AC 4B3RQ 1II3A 3BVGA 1CI3M 4J6HA 3MZ5A 3RZOH 3S17B 3PIP3 3DLLA 1SYCA 4GN5A 1JICA 3Q6SA 2RSOA 4C3HH 4NXNQ 5CR3A 2IW3A 5LL6S 5IE8A 4AIMA 4B3ML 5I6WA 1V1PA 4R4QA 3L9AX 1CT1D 2B2WC 1SE4A 1Q82C 2YU9H 4IOAA 2FFKB 2P5ZX 1NR4A 2F4VQ 1Q90A 1YHBA 1F9SA 4HCEA 4G7HC 2GVBA 4A3KH 5C3XA 4WFN3 2FJ2A 3H91A 4XT3B 5IYDG 1VQFA 3PIOA 2G9HD 2NB0A 2EYJA 3KJPA 1MIUA 4YCWA 4DK3C 3SK8A 4OO1G 3ULLA 1TWCB 2OTJA 4R8NA 2UU9L 1RCVD 4BBRH 1B8AA 2EYPA 1EU3A 1XMOQ 1TXYA 4HJ9A 2NVTB 3P7JA 3J7YW 3H3VI 3NTHA 1HPCA 1ET9A 5J39A 3HOZH 2EYOA 4OHJA 3W5OA 5CC4A 1N33L 5DM63 3DEOA 1UEAB 3SK5A 4TKOB 1J5EQ 1LUZA 1JOQA 2A6HC 4A3LG 3MEFA 1IKMA 1CSPA 4LF5Q 1SNMA 4YWLA 1XNQL 1DJRD 3H94A 1FNUA 5M3FB 4K5XA 1LM0A 1L1OC 1MSHA 1HXYD 1S4ZA 2JA5H 1Y8PB 3OW7A 1O7IA 2OQKA 2OXPA 3HOYH 1JJCB 4DV5Q 2Y0SG 4IPGA 4WJ4A 4XYQA 4MZ9A 4LF6Q 1QCBD 5CV5A 4QQBX 1UUPA 4DR2L 1EQTA 4K5WA 3K0XA 2NVYH 5C3EB 3T56B 3R3OA 5GROA 4DAYB 4DUZL 3S1NH 1VF5C 1TS5A 1E1TA 1MHWC 4UP9A 1STEA 2JYOA 2VQEQ 1HA6A 4MNOA 3PO3G 3NBHA 3HOVB 1YITA 3EQLC 1N9WA 4P75A 3RZDB 1QVGA 1CK1A 4E6IA 1XMQL 2L1BA 1EWHA 1QILA 2XWJB 2I0QA 1W6KA 3HOUH 4DK6C 2YYZA 3GTMB 5LMUL 3J7AF 3R8BA 2E2JB 3T1YQ 2DGYA 5M5XB 1I4PA 1PV4A 2K5NA 1MKHA 4JBWA 5IOCA 4GS3A 3DHQA 3GTOH 2ICIA 4A3MB 4R1JA 5FKAC 4DV2L 1SE3A 3EJIA 5ELOA 4A93G 3CW2C 1SYGA 1XPRA 1K3RA 3PUZA 4JI3Q 2L55A 1IW7C 3OPOA 4KN4C 1HTLD 4FDBA 3BZDB 5CBEE 2B63G 5KIXA 5ELNA 1XX8A 4DA2A 5IT9L 4LFAQ 5C4XH 1PTOB 1TWFH 2AUJD 1ASYA 1E22A 3RNUA 2PZUA 1SRUA 4JI2Q 1YEZA 1ZYRC 3ZYYX 2F52A 1H9SB 1U4RA 2PW5A 5LMNW 4DXGA 2N88A 2M00A 2KCMA 3F2UA 3I2ZA 3DWAA 3KYHC 3KDFB 3WOFA 4GLAC 3EIVA 1STGA 2Z6KC 4ZYSA 1JORA 2G5DA 4X65L 5E3FA 2VUMB 1YHAA 1N34L 1C7YA 1JB3A 3C2PA 4ZKBB 2K32A 5C5LA 4S3SA 3PF5A 1I4XA 2OEOA 3NELA 2CCZA 2LXJA 2YTYA 4OONA 2B2YA 1O7ZA 2ZTDA 1ASZA 1ET6A 4N9TA 4RH6A 4ABNA 1KL9A 4IOCA 4B3MQ 1EY0A 5C4JH 3F2BA 3KLWA 4J8QA 3G48A 4BS9A 2K05A 3BDOA 1RODA 4Y52H 3UE1A 1B70B 2PI2A 5EJWA 2RQXA 1NNXA 3U4VA 2CWPA 1PH3A 2F03A 1AZPA 3A55A 1VF7A 3NQTA 5FJ8H 2MP1A 1ZXTA 4GZYC 4IFDG 3QB3A 1VCIA 2KHJA 1LTBD 5KYIA 2ASBA 1WTHA 2Z8LA 4QIWE 4KKUA 1PH9A 2UU9Q 1KLUD 2CHBD 4WJ3M 3H0GH 3GTPH 2R61A 2B8FA 3PUYA 2XRQD 3GO5A 4OX9L 1X3EA 1QNKA 3KF8B 1A2UA 2K5WA 1BQQT 3G6EA 3S14B 1N33Q 2M2LA 2JJQA 4DN4M 1WTQA 4F88A 3KFUA 4A3JB 1HR0L 2AQ2B 4UPAA 4C3HG 1YNXA 3H09A 4A3FB 1KQSA 1E1OA 2GA4B 4KLKA 3MXNA 1N36L 2Q2HA 5EGTA 1NTGA 1EIHA 4XYOA 1PYSB 3W1BA 3Q8DA 4Y7NB 2XTIA 1DXMA 1VQBA 1SFOB 2A69C 2L4NA 2X69A 1TY2A 3ER0A 2SNSA 3RLNA 1ONLA 1YNJC 4A3KG 4C1NI 4HIDA 1GOZA 3I4OA 1Y14B 4DR2Q 1Z9FA 4MTNA 1UE5A 2KHIA 1YVCA 3CPWA 4KD3A 3KBGA 4CKEA 4BBRG 3CF5A 1OXVA 4I65A 4NB3A 1E3PA 1TQOA 3HOZG 1FVIA 3RN2A 3TZDA 4DK0A 1NMFA 3A0JA 4FNFA 2F0TA 5IP7G 1XMQQ 1PTOF 4FXGC 2ZJQA 1E7ZA 4DR6L 4NDXA 1QE6A 3PUWA 2EIFA 2K75A 4DV0L 2EJFC 3J81c 1QUQA 5LMUQ 2HUGA 2JA5G 2F0VA 3GV6A 3CCJA 1SE2A 2KHSA 5EKKA 1BUVT 3HOYG 4RGTA 1K8AC 5C0XH 1QVCA 4BY1H 2OTLA 1R9TB 3I4LA 3K0YA 1WTOA 5K5PA 4H7BA 4JYAQ 5HGTA 1U4LA 4G7ZC 1I94L 4RGOS 1BVSA 2L9HA 5ELBA 3JAMi 5CV4A 1QNUA 2OF1A 1RL2A 5E1FA 2Z0SA 2KBNA 1XNRL 2E76C 1X3FA 4TSSA 1IL8A 2JQOA 1XJVA 5A2QL 1R4QB 1STBA 5M3MB 2B2VA 5AJ3L 4QB4A 2RKSA 3EROA 4JI4L 1SNOA 3I56A 1VQ8A 1F2YA 3CCQA 2F0OA 2PI2E 4HJAA 5M5WB 3J7ZC 1B1ZA 1JCKB 1F2LA 4QY7A 3F2CA 3HOUG 1PRTD 4PMCA 3SGIA 5L37A 4L6TB 2WFWA 3NWSA 4GKKL 1K3BC 1BCPD 2JSOA 3CU7A 1KIXA 3TS0A 3H3VC 4X65Q 3KF6A 4F7XA 3SXHA 1FGBD 5ELCA 1W2BA 2CW0C 3GTLH 1I4QA 4JOIA 2IX3A 1N34Q 1HZCA 4QUCA 4IQZA 4HSPA 4RWSC 3NP8A 4GOPB 2N78A 3VR2A 5I6YA 3PO2H 2R93H 2IX0A 1CQFA 2VQFQ 3J81j 4YHHL 1VS0A 4MN3A 2F3WA 1ICFB 1TWHH 1HTPA 1A63A 1TWGB 1PH5A 1FD7D 4EQNA 3RLOA 1HZBA 1H9KA 4LF7Q 5C4XG 1B4OA 4JBKA 1T9HA 2E75C 4DR4L 2L11A 2ATWA 3CCVA 4UP8A 1STHA 2SEBD 2IPKD 3IFTA 3L0OA 4OL7A 3S2HH 2WAQG 3CXCA 4P2CB 1Y1WB 4KTAA 3U58A 2HCIA 1HNXL 3WWVA 2C9OA 4L5TA 2E2HH 3OIQA 4A76A 1NJIC 2KCCA 2MUYA 3J80c 4RCNA 1LTSD 1PTOC 4MTKA 1VMPA 2CH4A 1XYIA 4OX9Q 3TS2A 2F3VA 4HCSA 1WCMH 4L63B 4IPCA 4M1UB 1M90C 1VQ6A 5LMNL 5A35A 2I5LX 2JN4A 4UY8C 1IYVA 3FKIH 2KOLA 1EWCA 5C4ZA 5KGUA 1OXXK 2PQAB 1VQ9A 1HR0Q 2JA7G 1E2WA 1MJCA 2WB1E 2K04A 3P75A 3S2DH 1DOKA 3Q22A 3S1QB 4CDFC 4AQYL 1I5FA 1N36Q 2Y0SB 4O42A 4DV1L 3PIO3 1JJ2A 4A3GH 2WINB 4YWKA 1D1KA 4GNXA 1OO9B 1VQDA 1B9NA 1X55A 4OELB 4I7ZC 1SXTA 2QILA 4JVZA 2HDLA 3T16A 1A6XA 2AHOB 1EY9A 4AYBE 2M9VA 4L5QA 3PO3B 1NBWA 4R8IA 3LWEA 4C2MB 1Q8KA 1ZKOA 1JE4A 2N8NA 5I2YA 3J81i 5ISRA 3A8KE 1I6HH 1CM9A 1PA6A 3H15A 3NTKA 3CQZB 3MVVA 4UAIA 3TN2A 5FLXc 1J6QA 1Q1EA 3ULPA 4F8MA 4C3IH 3BVZA 3CP0A 4DR6Q 2MNAA 2PNRC 2BOSA 3NXWA 1FJGQ 4UP7A 2A73B 2XVSA 3TP7A 3URYA 4K8IA 2EXZA 3K59A 1O7LA 5IGGA 4A93B 4RKBA 2HHHL 4GKJL 3KLRA 2B2UC 3S16B 4RHSA 1PVOA 4X3UA 1F2MA 2H5XA 1W3SA 2DJGC 1J8IA 2B63B 4X3KA 2PW7A 3LX0A 2R7FA 4JC0A 1I94Q 1W6JA 5JEAH 1HZ9A 1LT5D 3I4NH 5KNDA 5C5MA 5IGBA 1N32L 3AYHB 3CMEA 1XNRQ 1VQJA 3HKZG 2HQEA 5J22A 1K8GA 2TMPA 1CHQD 1OXUA 1WFQA 3LGJA 4IALA 5C4HA 1NE3A 1EYGA 4O2DA 2XSCA 4TVAB 1WYDA 3SEBA 5CV6A 5JOBA 3S1MB 3D6WA 4JI4Q 5FLMH 5KNCA 1U5KA 2QA4A 2BCOA 2EOTA 2K5DA 1CA6A 4K5VA 1PRTB 3TRZA 2B2WA 2BDNA 2NZOA 1BCPB 2KJXA 1SYDA 2EYMA 3PCOB 3P1HA 3AQQA 1RDPD 1AEXA 5I4DA 1SN8A 1TWAB 4LF9L 2PO4A 3DM3A 5C0XG 4BY1G 2DY7A 3A5ZB 2ALYB 3EA6A 1A0IA 4BY7H 5D3IB 1S72A 1T5EA 3TZUA 1PZKD 1EWIA 2LKVA 4PZ6A 5JVH3 2A19A 3LWUA 1DONA 2NZ1D 5LL6X 3NQIA 1PFMA 3T53B 5KYLA 4CGYB 3J80E 4HR7B 3FPUB 4R9WA 4DGZA 4FF1A 4LUOA 2UXDQ 1JR0D 4DR4Q 4X3SA 1IBKQ 1EYAA 4LF8L 1NMGA 2F0IA 4HIMA 1MI2A 1RD9D 4DR1Q 2EYFA 4QGUA 2RSNA 4RA8A 1I4HA 4JW0A 5JJZA 1L1OA 3OWFA 5IGDA 1R4PB 3PMFA 4EQPA 3F2DA 3RZOB 4IPHA 1WTVA 3M4OH 1BXTA 4X62L 3QOLA 5IT9c 4C3HB 3GTGH 3CCSA 2K5HA 5CORA 5BN3A 3PO2G 2R93G 5IGFA 1UE1A 3KJOA 2B2TC 1HJPA 2KQ3A 4HJ5A 3K7UC 4CDDC 2YU9B 4RHRA 2UUCL 4AQYQ 1WTWA 5JJLA 2IX1A 1VQIA 4DV1Q 1YJNA 4A3KB 5E4WC 5M5YH 1RTOA 1STNA 5LHY1 1Y8NB 1X9NA 1WJJA 2Z6BA 4LWCA 3J7AV 3A56A 1GKHA 4GOPC 1GUGA 4JI0L 1Y1WG 4BBRB 5FLXE 4B3SL 4K0KL 3HG9A 1D8LA 1JE5A 1LYLA 2JEBI 2IHEA 2JK8A 3M7NA 3HOZB 3I72A 4ULLA 1VQPA 1E2ZA 3HEJA 3FDTA 3CKIB 5F2DA 1F9RA 2VXWA 5NUCA 1WCMG 4IUUA 4GN3B 4RGMA 3VR4A 2DN8A 4XQNA 3RN5A 5IYCH 3OSOA 3FKIG 1GUNA 3J7A5 4A3EH 1CZWA 3BYTB 3DEPA 5M9OA 5E7NA 4ME3A 3BDLA 2JA5B 3QWNA 3UDFA 4DNTB 2UXCL 3HOYB 5IWAL 1FGUA 2GVAA 3IAYA 1VQ5A 4A3GG 2QDLA 1PRTF 4NMZA 2VS1A 5IYBH 2HHHQ 4GKJQ 1BCPF 3GTKH 3Q23A 2NVYB 2H4OA 3BJUA 1AP0A 2UXBQ 2JEAI 3MC0B 3S1NB 4GLVB 1K83H 1KC8C 4JPBW 2Z6KA 1DYQA 2MJ8A 4PZ8A 2YTXA 1XTDA 3D4WA 2K03A 1N32Q 5I9OA 2KENA 4BXXH 5C3WA 1YJ9A 3CMAA 3S15H 1VQ4A 2Q2UA 3ND9A 3TQYA 5FOBB 1HRJA 1V43A 1C9OA 3QR8A 1EY5A 1VQAA 1N8RC 3HOUB 4EX5A 4TQUS 4BA1I 2VY3A 2QW7A 3CC7A 2O4XA 3WOEA 4JV5L 1V1QA 3K5OA 1C8CA 3MEHA 1EFWA 2NTSA 4C3IG 1TT2A 1Q86C 3K7AH 3R93A 2VL6A 3VYRA 3FRPB 1EYDA 1IBLL 1Z6HA 1I4RA 3K58A 1LLRD 3QO2A 3GTOB 1G291 1KHIA 4KY5A 1EUJA 1LT4D 3F8TA 1XWEA 2QEJC 4BBSH 4LF9Q 3CCEA 1HQMC 2E2IH 2B29A 2PMZE 1KLGD 1YNND 3M3YH 5JPMC 4ZUIA 3CC4A 3MXGA 2F0WA 3SE0A 4NW2A 5JEAG 1BDOA 2D62A 3OMGA 5C4XB 4KJOA 1TWFB 1KAAA 3U50C 3JAMc 1HNZL 1I4GA 2HDMA 1PZJD 3X3MA 4L5RC 3H6MA 3AU7A 5GAGC 2R92H 5FO7B 1U4PA 3G6JB 1HQRD 5IIFA 2WAQB 1J9OA 4DAVA 4IJHA 3FHWA 1K73C 4RFBA 1H9JA 2CQOA 4DV7L 2BA1A 5FLMG 1TY0A 3EVQA 5H1SE 3SVMA 1OXSC 2SDFA 1JMCA 3M4YA 4ID6A 3OYYA 2KCNA 4ZLTF 1SLJA 2F3IA 1X6OA 1JOKA 1ML0D 3BZCA 1AE3A 4X62Q 4U68A 1EIYB 2F0QA 3IRBA 3QJYA 2JA6H 2JA7B 3VDYA 3GP7A 4BY7G 2K01A 4FXKC 3CCMA 2ZM6L 5C4JB 4Q0FA 1PRTC 1S5FD 2Z4HA 5BR8L 1D6EC 1BCPC 2B39A 2R3ZA 2UUCQ 1X32A 4QCLA 2NVXH 3I4MH 1LTLA 3RMHA 3I8ZA 3IFDA 1EFID 2MPMA 3TREA 3R2IA 4ZKCB 2D0OA 1UEBA 4JBMA 4G7OC 3E0JA 1ESRA 2R7DA 2H1EA 3NEMA 2K5QA 1TS3A 4A4IA 5COYA 1ENFA 3H0GB 3GTPB 4K0KQ 4PZ7A 2QCPX 2LFNA 5T1GA 1VQLA 4CDEC 1VQHA 2TSSA 4CJ0B 3BZKA 2A1AA 2CVRA 4TRDA 5FO8B 5CYUA 2A6ED 5IGEA 2EY5A 5E4XA 3HOXH 1DZ1A 2KCTA 1VQKA 1BBXC 4QUFA 2NVQH 2Z1CA 2J4XA 1HFNA 1I3QH 2E2DC 4CKCA 4X64L 3GTQH 2NYZD 1XNQQ 4A3IH 5K36H 1E2VA 3ICEA 1L0WA 1E0BA 1FNWA 3WDNA 4JI1L 2EY1A 1TIID 1MSGA 3TEHB 1H95A 1KD1C 2UXCQ 2B8GA 3E3XA 1X54A 4N8X1 5IWAQ 5C0XI 4P71A 4IURA 1MD2D 3S1RH 1KXLA 4R4CA 1WD0A 2CKZB 3BYYB 1VQGA 4M8AA 2FINB 1AW7A 4DUZQ 1K0SA 4XTCS 4DAYA 3HKZB 4IJLA 3D0FA 3N52A 4DF7A 1YI2A 1DD2A 1PLFA 1XTCD 4GN4B 1PFBA 5GQOA 1KAWA 2E5LL 1JWUD 1LT6D 1GD7A 3PUXA 1I50H 3MXUA 4DAPA 2V4DA 3DWPA 1CKNB 1F77A 2F0PA 2CH4W 5J1ZA 2XGTA 1CHPD 1IBML 2RCNA 1VQEA 4XQQA 5IYCG 1HH2P 4OIJA 1BBWA 2IJ0A 2FHTA 1FR3A 1SNQA 4HAEA 4GLXA 1LTAD 3B6YA 3JAME 1IBLQ 3E9HA 2OCEA 4LFCL 5KRUA 4BY1B 4DV2Q 3M9BA 4DNRB 1SROA 3GDEA 1UE7A 4XXEA 2DJFC 5IYBG 4IUNA 1KNEA 2R7ZH 4IUTA 3GTJH 4OEMB 1PH2A 1JT8A 1OTCA 2F0FA 4V0BA 1FYCA 2ICEC 2K7VA 1KDBA 1SE8A 1U0LA 3HS0C 4MIUA 4XDXA 2HIXA 4X66L 4BXXG 1HNZQ 3OOCA 1H9SA 2EZVA 4A3BH 2A68D 1GO3E 4I7AA 1MGSA 5EPLA 5CMDA 4LAAA 4X6AH 3I91A 4B9XA 1K8MA 5A2QE 1A3VA 3BVMA 2NBFA 2YV5A 1RF2D 3KDFA 1M4VA 1SMXA 2WB1G 4DV7Q 5IP9H 2A8VA 2I07B 4V190 1X56A 4CHTB 4DU9A 4XT1B 4C1NK 1LTRD 5EQ0A 4RG1A 4N9PA 3GTLB 3CAMA 3NE5B 5T1IA 5JAVA 1X3GA 3OW2A 3PO2B 2R93B 3FMCA 4B08A 5IGCA 4BBSG 4ODGA 1QB5D 1NY4A 2KEEA 2XN9C 3CRLC 1TWHB 3RR5A 1EY7A 4JI6L 2ZM6Q 3MXPA 3NBIA 4AYBG 1YHQA 1PH6A 5D3DA 2RHQB 4IZ8A 5BR8Q 4NXML 2QEXA 4JBJA 1B9MA 3MFGA 3QOJA 1TVXA 2R92G 3HFZB 3S2HB 2WP8J 1BO0A 1STAA 3K8AA 3KUPA 5GADC 1EIFA 4DV3L 2E2HB 2PZTA 4PG3A 2EY6A 5IODA 4KY6A 5CBAE 1WI5A 4A3DH 4A75A 1WCMB 3N6RA 4LJZC 3KF8A 4B3TL 3C46A 5ELFA 4EVOA 5GAHC 1WD1A 2B2UA 4K2LA 1O78A 3FKIB 4B3RL 1MJEA 4HN7A 2JA6G 5EBCA 2NTTA 3BG3A 2WKDA 3S2DB 2EVBA 3PF4A 2ZXRA 4A3LH 2F0DA 1V1PB 4A3GB 1L0XB 1SMYD 2I5MX 1GUTA 4NPSA 2F4IA 1HFGA 3D4DA 4DFAA 5EBDA 5FJ8G 1WTXA 3HOWH 2HQLA 2PPBC 2SOBA 2K50A 4FF3A 3J81E 3V05A 2EJGC 2LS01 3DUZA 1KNAA 4H44C 3H0GG 1UAPA 2OQ0A 2C5CA 1B53A 1FL0A 4IUQA 4ZUJA 4HIKA 4MHEA 1VQ7A 2L15A 3HOXG 1CUKA 3BS1A 1I6HB 2HCCA 5C44H 1K28A 1G51A 2K14A 5EKIA 4C3IB 4DV0Q 2QGQA 5K36G 1QZGA 1CKNA 1IBMQ 3D3RA 2NUCA 1L2FA 2O5IC 3QG1A 1JJGA 2V1CC 3TP5A 2D2CC 4LF5L 3STBD 2WKCA 3TDQA 3D6CA 1C48A 1SNCA 1WOCA 2PNHA 2VNUD 3CQZH 4IFDJ 2J0TD 3DM1A 3W2DA 5CV8A 1DM0B 1G2SA 2XRSD 4LFCQ 4DV5L 2Q8RE 2F0SA 4WRDA 3C3LA 4POFA 1A2TA 4YY3L 1WTPA 4QIWB 1X3PA 3UDXA 2NZHA 3I4NB 4WJWA 2JE6I 4ILWA 1KDAA 3MA2B 4FVMA 2Q8IB 1IXRA 1B50A 1PXUA 5AJ3Q 3NBHB 4X66Q 3VYUA 4PNYA 2VQEL 3K80C 4RGNA 3AEVA 3ZJYC 1HCZA 2CW0D 3CPFA 1IYJB 4PMWA 4IO9A 1EY8A 2B2TA 4GKKQ 3NWTA 1PH1A 1LTTD 3FEWX 2ZXPA 1S3OA 2FXQA 4L5SA 1VDZA 1ICWA 3F1ZA 1GM5A 2ZT9C 3AFPA 1XPOA 3PQIA 1VQCA 3A7AB 2EYHA 4DAMA 1LABA 2L5TA 4BY7B 4GOPA 1Y8OB 1I6VC 4RKLA 4YHHQ 2R7ZG 2F0KA 4FXDA 3OHXC 4IUVA 2ZXOA 3I73A 4JI6Q 1V9PA 1IYUA 3J80L 1GXDC 2JA8H 3VYSA 2EQSA 4EQ5A 4NXMQ 4POGA 3D31A 1Q46A 2CWAA 1O80A 4JI2L 4A3BG 3KK7A 5TSSA 1SEBD 2IL8A 3OMCA 5DAUA 2UUBL 1EIGA 1D5ZC 1HNXQ 3W3AA 3CCLA 4DPGA 1TU2B 1ESFA 1YNNC 4KHPL 5EPJA 2Q2TA 4DV3Q 2OWOA 2HT1A 1RKNA 5IP9G 1HR0W 3VA5A 1SJHD 3M4OB 4C3JH 1Y1VH 3O13A 3HGBA 4F87A 5LMNQ 3CD6A 1Q12A 1EZ6A 1G91A 3GTGB 2RBMA 4QMGA 3RLFA 1NSNS 1QVFA 3S17H 1KABA 1AN8A 2VW9A 2PQAA 4EQOA 3NENA 3Q24A 2RA4A 3L3OC 1BNZA 4XQJA 1LTGD 1YZ6A 5M5YB 1LTID 2PCFB 1JOOA 2PZWA 3L2PA 2BH2A 1HNWL 4KI0A 1CKMA 5KNBA 4JI7L 4K2KA 1M1KC 2MQHA 3A5UA 4ZK9B 5G3LD 5FLXL 1Q3LA 3GD7A 3T1HL 2K5VA 3V2TA 4KKTA 4Z9CB 3EFXD 4DV4L 1TWCH 2O5JC 3SR1A 1BKBA 4P74A 2X6LA 2NVTH 4A3DG 4XIGS 3I70A 1UWVA 5GAEC 5ELEA 3G4SA 1PFNA 1EEID 1GHKA 4A3EB 3A7LA 5CGKA 3SHLA 4DR3L 5IP7H 3DMUA 3MXNB 1SJED 2CFMA 3KLSA 2LSSA 1SYFA 5M3FH 4HIOA 2A6EC 3U4ZA 4LW1A 3I55A 2FMCA 3GTKB 1M8AA 1SYEA 3G7LA 3EBEA 4C56C 3NSWA 5FK9C 2WV6D 3HOWG 1XXGA 1K83B 2PYKA 4G4KA 1HUMA 2LMCB 4YY3Q 3RUZA 3K81C 4X3TA 3OIPA 2C35B 4K14A 4BWGB 4G57A 4JI5L 5C3EH 4CJ1B 1BF4A 2F0UA 2UUAL 3I90A 3S15B 1Y69U 3H3VH 3NHHA 2RCFA 3D4RA 5HY6A 1Q81C 2K28A 2Q8TA 1RJTA 5C44G 3HOVH 2DNCA 2QDBA 2WB1B 3RZDH 1IZ6A 2BE5D 2SNMA 1YIJA 1BR9A 2K4KA 3K7AB 2VZAA 2JA9A 3VA7A 2VB2X 4P73A 3ND8A 1QUQB 2MHVA 4N8FA 3DWQA 4QJFA 5D65A 3GTMH 2F0MA 2E2JH 2MO1A 2BH8A 3TP6A 5M5XH 1IL2A 2PQEA 4BBSB 3TSSA 3NK9A 3NPPA 4KY7A 1WTRA 3JC66 2E2IB 4A3MH 3K5LA 4CBVA 3PV0A 4ZRZA 5FO9B 1O7YA 2ES2A 3M3YB 1KTKA 1JWSD 4AH6A 4AYBB 3I4NG 4JYAL 4ALPA 4KHZA 5IY0A 3VR5A 4OIKA 4K8JA 5I9PA 5D14A 2IY5B 2F0LA 2DY8A 5IT9E 5AFWA 1NCVA 4LUVA 2R92B 2Y0SE 3EN2A 1PTOH 1A62A 4LF8Q 2AWNA 1A3UA 2F0JA 1AE2A 4FYDA 1LACA 2AMCB 4DK1A 2UUBQ 5DNFA 3OTOL 1GUOA 4FO2A 4KHPQ 1PFSA 5J3BA 4CDCC 1BOSA 1TKWB 1U4MA 3KF6B 4NKLA 2NN6I 2ID0A 1UE6A 3ERSX 4YWMA 3SK4A 1D5XC 4Q5VA 3AFQA 2VUMH 2JA6B 4J15A 3E9IA 2A68C 4QL5A 3A54A 3BDCA 4B9WA 4DV6L 3MAQA 4LMQD 2ZJRA 4UHVA 3PIPA 2AKWB 1L0YB 1CZGA 1S40A 3L7ZC 2K6AA 2EXDA 3ERQA 2VQFL 4JCVE 2JA7H 1WVLA 3I4MB 4KHVA 2NVXB 1Q7YC 4OWTB 2OT2A 2ZJPA 4IUPA 2B3GA 2JA8G 5BN4A 4LF7L 1TR5A 2IT1A 4PMBA 1VQOA 1F9QA 4JI0Q 3ULJA 2IHFA 2DUDA 5DM73 1HNWQ 3P20A 2A6HD 1JQYD 2HIVA 4B3SQ 4JI7Q 2X6GA 1ILPA 1VQMA 3T1HQ 5C0XJ 1NR2A 2EY2A 3FP9A 3MHBA 4LK1C 2NN6H 4DV4Q 2LY7A 3HOXB 2D5DA 3S9WA 1KDCA 1E24A 4C3JG 2NVQB 1Y1VG 1I3QB 1PYBA 3GTQB 3M85A 1HHVA 3VYTA 1SDFA 5BN5A 3E6ZX 2KVMA 4KN7C 4A3IB 4LFBL 3S14H 1A3TA 3T13A 1EZ8A 2KA7A 2YTVA 2RF4A 1ENAA 4A3JH 2EDGA 3ONAB 3V96A 2AQ3B 4DR3Q 2XNAC 4A3FH 3A74A 3A8IE 1JC7A 4DKAC 2J7ZA 3K5NA 1PH8A 4HJ7A 4KJNA 2JXMB 3S1RB 4Y7NH 1G2TA 4GNXB 1QG7A 2G9DA 1SFOH 1GVPA 2EE1A 1JB7A 1D2BA 3K5MA 4HMJA 3W1GA 2O2LD 3IKJA 3AB9A 3CCRA 2B2YC 4JI8L 2A5HA 2XWBB 1X65A 4R4IA 1PDQA 1KRSA 1DOLA 4JI5Q 2F0HA 2UUAQ 1HZAA 4HTHA 4K6DA 1I50B 1SMYC 3A8JE 4ZAIA 4A3CH 1F9PA 4JK1C 1TS2A 4DR7L 4FP5D 3PSIA 3IL8A 5C6AA 1Z47A 4A3EG 1AH9A 4JV5Q 2EYLA 4LUZA 4OWWB 1BBUA 3TMEA 2JP1A 4DXFA 1RHPA 1IW7D 2F0GA 4LF4L 1CTMA 3C1EA 5JVG3 2QKIC 3FPPA 2K33A 2Z9HA 3X3NA 1SYBA 1S5DD 3JAML 5M3FG 2D0PA 2FMMA 1ZYRD 1FJGL 2ZTEA 1EL0A 2R7ZB 2HD3A 1P8LA 3GTJB 1H9RA 4OGQC 1G8ZD 3U9SA 1R9TH 3AMUA 2MFIA 3GV3A 1QJOA 2BDOA 3CHBD 3MFYA 1EOTA 2N49A 5C3EG 3K6OA 1SBBB 3STBC 1EOVA 3U9OA 2F0NA 2RVLA 1EEFD 4CKBA 4A3BB 4O1NA 1ILQA 1XPUA 1LV9A 3HOVG 2R6GA 5M3MH 3E0EA 5M5WH 4OO1I 4ZCKA 1K9MC 1F2ZA 3OTOQ 4IPDA 4FF2A 1SR3A 5G3LF 1HA5A 4HSVA 2CQAA 1VMCA 1A8VA 1S5ED 3M4QA 1PH7A 3E5SA 4P72A 1EQRA 1H9MA 3KOJA 4A3MG 4H13C 4DV6Q 1S5BD 1CKOA 1X3QA 3MTSA 1GUSA 1EYCA 1RTNA 2ZTCA 1DCZA 3S24A 5JJIA 1DOMA 1QZHA 5ELDA 3T51B 4UDUC 2K1BA 4DR5L 5DLQE 1TWGH 3UDGA 1ENCA 1AFPA 4DUYL 3MWYW 2UXDL 4IN3A 5IYDH 1B3QA 4KD4A 4YCVA 2AWOA 2RDFA 1IBKL 4OO1H 1LO5D 3R2TA 1QOHA 2KECA 4BA2I 2KEDA 4RMFA 4DR1L 1L1OB 1Y1WH 4HJ8A 4A3DB 1IKLA 3PUVA 4YCUA 1OXTA 1GHJA 1B7YB 1Q1BA 3LNNA 1EQQA 2A69D 3ITPA 4X64Q 1QWYA 3K57A 5JEAJ 5CV9A 4ZQ3A 2VUMG 1B3AA 1YNJD 2PMZB 2B2VC 1C0AA 2MO0A 4NXNL 3Q0AA 3UE0A 4LFBQ 4FF4A 2RDHA 2F0EA 1PH4A 4JI1Q 1ZEQX 1P16A 4KV6A 1PHJA 1STYA 1EY4A 4ME5A 3I4MG 3S1QH 2QF7A 2F4VL 2EJMA 2E74C 2EPBA 2N3SA 1TS4A 3UDIA 5EAYA 5EKLA 3HOWB 4OXPA 1K0RA 5CV7A 4JOIC 4RAUC 3HKSA 4QF4A 4U673 3J81L 1CFMA 1PZID 1XMOL 1A15A 3FVQA 4JI8Q 2AQ1B 1SSOA 1EQVA 2F1MA 3D8GA 2E5LQ 1V1OA 1T5XD 2NN6G 2L12A 1G6PA 1RIPA 5C44B 3PO3H 1KRTA 2K52A 1K8OA 1D7QA 1C4QA 2VB3X 4C2MH 4KMUC 1CA5A 4A3IG 2DNEA 1J5EL 1UNSA 3NUCA 4DR7Q 5HURA 1GJXA 4O0AA 1EU4A 1G6ZA 1U9RA 2WAQE 2IWHA 3G71A 4A3JG 4KK7A 2WIIB 4LF4Q 2GN5A 1YBYA 1DGSA 4A3FG 2WACA 2E8GA 1SAPA 3BU2A 4K6LA 4LF6L 3TP8A 1SNDA 4A93H 5HGQA 3SK6A 3NTIA 1CSQA 2BA0A 5DEHA 4YIJA 3S16H 4H0LC 4PV1C 1HUNA 1D1IA 1VQNA 4DNIA 3M4PA 1IHZA 2B63H 2UXBL 1NUCA 3VR3A 2AUKA 1S5CD 1FNVA 2MGSA 4LNQA 3TBIB 3I7FA 3QIAA 2XIWA 4A3CG 3HZXA 4APVA 4GNXC 1CQVA 3PGZA 1AZQA 2RDGA 4EGVA 2Q2IA 4OWXB 4RCOA 1V8QA 3S1MH 4J1MA 4IFDI 2NWGA 1LT3D 1NAPA 2A74C 3T1YL 3RD4A 3C1FA 2N55A 3UI2A 4R4TA 1SNPA 5JJKA 1PYWD 1PMRA 2LXKA 4JG2A 1TWAH 5EPKA 4JI3L 4KKSA 2I46A 2BE5C 2D9UA 4CJ2C 3CRKC 3M7GA 2L0CA 5I2XA 4LFAL 1B44D 2JA8B
chains in the Genus database with same CATH topology
2VZAA 2JA9A 1WCMH 1M90C 4IPCA 4P73A 1QUQB 4DUZQ 5LMNL 1VQ6A 4DR5Q 4QJFA 2I5LX 3GTMH 4UY8C 4XTCS 3FKIH 2E2JH 4IJLA 4R4OA 4DUYQ 2MO1A 2BH8A 3D0FA 1OXXK 2PQAB 1VQ9A 1YI2A 5M5XH 1HR0Q 1MJCA 2WB1E 4GN4B 3CC2A 1IL2A 2JA7G 5GQOA 1YJWA 3S2DH 1KAWA 5M3MG 2E5LL 4AQYL 1I5FA 1N36Q 3JC66 3CCUA 1GD7A 4A3MH 3PUXA 3PV0A 1I50H 3J80i 4DV1L 2I5HA 1JJ2A 2ES2A 4A3GH 4YWKA 4AH6A 1CKNB 3I4NG 4JYAL 4ALPA 4KHZA 5IY0A 4GNXA 4B3TQ 4H02A 1VQDA 2XGTA 2RHSB 3HKZE 2RCNA 1IBML 1VQEA 5IYCG 1HH2P 1X55A 4B3RQ 2IY5B 3RZOH 1BBWA 3DLLA 4LUVA 2Y0SE 3EN2A 4LF8Q 1A62A 4GN5A 4C3HH 3B6YA 4GLXA 2AHOB 4NXNQ 1IBLQ 2AWNA 4AYBE 3E9HA 2OCEA 4L5QA 4LFCL 4DV2Q 3M9BA 1AE2A 1NBWA 1SROA 3GDEA 4AIMA 5IE8A 1UE7A 4B3ML 1Q8KA 4R4QA 2AMCB 5IYBG 2N8NA 2UUBQ 1Q82C 3J81i 2YU9H 4IOAA 3OTOL 2R7ZH 1I6HH 3GTJH 2F4VQ 4KHPQ 1PA6A 1PFSA 5J3BA 1PH2A 1YHBA 1JT8A 1OTCA 3H15A 3KF6B 2NN6I 2GVBA 4A3KH 5FLXc 1J6QA 1Q1EA 2ID0A 1UE6A 3ERSX 4YWMA 5IYDG 1SE8A 1U0LA 1VQFA 3PIOA 4C3IH 3ULPA 3AFQA 3CP0A 2VUMH 4DR6Q 3KJPA 4J15A 1MIUA 4YCWA 2MNAA 2HIXA 3E9IA 4QL5A 4X66L 4DK3C 4OO1G 3ULLA 4BXXG 2OTJA 1HNZQ 4DV6L 1FJGQ 4UP7A 2UU9L 4BBRH 1B8AA 4A3BH 1XMOQ 1GO3E 1TXYA 2ZJRA 4HJ9A 4X6AH 3PIPA 2HHHL 3H3VI 2AKWB 4GKJL 1S40A 3L7ZC 2YV5A 3HOZH 2EXDA 2VQFL 3KDFA 4JCVE 2JA7H 1SMXA 2WB1G 1PVOA 3W5OA 1N33L 1Q7YC 2H5XA 4DV7Q 1W3SA 4OWTB 5IP9H 2A8VA 2ZJPA 1X56A 2B3GA 2JA8G 1J5EQ 4JC0A 1LUZA 2R7FA 1I94Q 4RG1A 2IT1A 1HZ9A 3MEFA 4LF7L 1VQOA 4A3LG 1CSPA 3I4NH 3CAMA 4JI0Q 3ULJA 2IHFA 2DUDA 4YWLA 4LF5Q 1XNQL 1HNWQ 1N32L 3AYHB 3CMEA 1X3GA 2HIVA 4B3SQ 1VQJA 3HKZG 3OW2A 4JI7Q 1XNRQ 1LM0A 1K8GA 1L1OC 2JA5H 4BBSG 1OXUA 1VQMA 1WFQA 1O7IA 2OQKA 3LGJA 5C0XJ 3T1HQ 3FP9A 1NE3A 1EYGA 1NY4A 4O2DA 4TVAB 3HOYH 1JJCB 1WYDA 2Y0SG 4DV4Q 4IPGA 4DV5Q 4WJ4A 3RR5A 4JI6L 4MZ9A 2ZM6Q 1E24A 4JI4Q 4LF6Q 4AYBG 1YHQA 5FLMH 1PH6A 1U5KA 1Y1VG 2QA4A 4QQBX 2RHQB 1PYBA 4DR2L 3M85A 5BR8Q 4NXML 2QEXA 3TRZA 3K0XA 2NVYH 4JBJA 2NZOA 4LFBL 3S14H 2YTVA 5GROA 4DAYB 4DUZL 3PCOB 2RF4A 3S1NH 2R92G 3AQQA 3HFZB 4A3JH 1SN8A 1E1TA 4DR3Q 2WP8J 4LF9L 4UP9A 2VQEQ 3DM3A 5C0XG 4A3FH 4BY1G 4MNOA 3A5ZB 3A74A 3K8AA 5GADC 2ALYB 3PO3G 1EIFA 4DV3L 4DKAC 1YITA 1N9WA 4PG3A 4P75A 1A0IA 4BY7H 1QVGA 1PH8A 4HJ7A 1S72A 1XMQL 1WI5A 4Y7NH 4GNXB 1EWIA 4PZ6A 4A3DH 2A19A 4A75A 2I0QA 1SFOH 1GVPA 1JB7A 3HOUH 4B3TL 3W1GA 4DK6C 2YYZA 5GAHC 5LMUL 2UXDQ 4B3RL 3CCRA 4LUOA 4JI8L 1MJEA 3T1YQ 1X65A 2DGYA 4R4IA 2JA6G 4DR4Q 1KRSA 1IBKQ 1PV4A 1NMGA 2K5NA 4JI5Q 4LF8L 1MKHA 4JBWA 4HIMA 3PF4A 4GS3A 3GTOH 2UUAQ 4A3LH 1HZAA 4R1JA 4DV2L 4DR1Q 4A3CH 5ELOA 4A93G 3CW2C 4QGUA 1XPRA 4DR7L 1K3RA 3PSIA 2I5MX 1L1OA 4NPSA 1Z47A 3PUZA 4JI3Q 4A3EG 1AH9A 4JV5Q 4LUZA 4OWWB 1BBUA 4FDBA 2B63G 5FJ8G 3F2DA 3HOWH 4IPHA 5ELNA 2HQLA 3M4OH 4LF4L 4X62L 4LFAQ 2K50A 5C4XH 5IT9c 1TWFH 1ASYA 1E22A 3RNUA 1SRUA 4JI2Q 1YEZA 3GTGH 3H0GG 2OQ0A 2F52A 3CCSA 2K5HA 5M3FG 3PO2G 2D0PA 2R93G 1FL0A 1FJGL 2ZTEA 5LMNW 1UE1A 3KJOA 1XNRL 1HJPA 4HIKA 2KCMA 3I2ZA 1VQ7A 4HJ5A 2L15A 3K7UC 3KYHC 3KDFB 3HOXG 1CUKA 2UUCL 1P8LA 4GLAC 4AQYQ 3EIVA 5JJLA 5C44H 2Z6KC 1R9TH 2IX1A 2MFIA 1VQIA 1G51A 4DV1Q 4X65L 1YJNA 5M5YH 2K14A 1X9NA 2N49A 4DV0Q 1WJJA 2QGQA 5C3EG 1QZGA 1CKNA 4LWCA 1EOVA 3STBC 1YHAA 1IBMQ 1GKHA 1N34L 1C7YA 4GOPC 1L2FA 1JJGA 2V1CC 4LF5L 4JI0L 3STBD 1Y1WG 1WOCA 2PNHA 4B3SL 3PF5A 4K0KL 2VNUD 3CQZH 3NELA 2CCZA 1D8LA 4IFDJ 2LXJA 1JE5A 2YTYA 1LYLA 2JEBI 4OONA 2IHEA 2JK8A 1XPUA 3HOVG 3M7NA 2ZTDA 2R6GA 1VQPA 5M3MH 1ASZA 4LFCQ 3E0EA 1KL9A 4IOCA 4DV5L 4B3MQ 5C4JH 3F2BA 5M5WH 4POFA 4OO1I 3KLWA 3G48A 4YY3L 1K9MC 1WCMG 3OTOQ 4GN3B 4IPDA 3UDXA 1SR3A 2NZHA 2HT1A 4Y52H 3RN5A 5IYCH 3UE1A 1B70B 2PI2A 1PH3A 3FKIG 3U4VA 2CWPA 4A3EH 3J7A5 2JE6I 1A8VA 3M4QA 1PH7A 5E7NA 4ME3A 4P72A 1EQRA 5FJ8H 1IXRA 4IFDG 3UDFA 5AJ3Q 1VCIA 3NBHB 2UXCL 4X66Q 2KHJA 3KOJA 1FGUA 5IWAL 2GVAA 4A3MG 2ASBA 2VQEL 4DV6Q 1VQ5A 4QIWE 1PH9A 2UU9Q 3K80C 4A3GG 1CKOA 3AEVA 3ZJYC 4WJ3M 3H0GH 3GTPH 3PUYA 2ZTCA 3S24A 5JJIA 2VS1A 5IYBH 3GO5A 3CPFA 1QZHA 2HHHQ 1IYJB 4OX9L 4PMWA 4GKJQ 1X3EA 4IO9A 3GTKH 3KF8B 4GKKQ 3G6EA 1PH1A 4DR5L 3BJUA 5DLQE 1TWGH 1N33Q 1S3OA 2JJQA 2FXQA 3UDGA 4L5SA 2JEAI 2UXBQ 4GLVB 1K83H 4DUYL 1KC8C 2Z6KA 3F1ZA 1GM5A 3KFUA 2UXDL 3AFPA 4PZ8A 1HR0L 4UPAA 1XPOA 2YTXA 5IYDH 1VQCA 1YNXA 4YCVA 1KQSA 1E1OA 1XTDA 4DAMA 2AWOA 4KLKA 1N36L 1IBKL 2Q2HA 2KENA 4BXXH 1N32Q 1YJ9A 3S15H 3CMAA 1NTGA 4BA2I 4GOPA 1PYSB 3TQYA 1VQ4A 3W1BA 2Q2UA 3Q8DA 4YHHQ 1V43A 4RMFA 4DR1L 1L1OB 2XTIA 1Y1WH 1VQBA 4HJ8A 2R7ZG 3PUVA 1C9OA 4YCUA 1OXTA 1VQAA 1N8RC 1B7YB 3ER0A 4TQUS 1Q1BA 4BA1I 4EX5A 2VY3A 3RLNA 3CC7A 1EQQA 4A3KG 4JI6Q 4JV5L 4X64Q 1V1QA 5JEAJ 1V9PA 3I4OA 4HIDA 1EFWA 1Y14B 1Q86C 2VUMG 3K7AH 4DR2Q 2EQSA 1Z9FA 4MTNA 2JA8H 1UE5A 2KHIA 4EQ5A 1YVCA 2VL6A 3CPWA 4NXMQ 4POGA 1C0AA 2MO0A 4NXNL 1IBLL 3D31A 3UE0A 4LFBQ 5K36G 1Q46A 2CWAA 4JI2L 4BBRG 3CF5A 4A3BG 1G291 4JI1Q 1PH4A 1KHIA 1EUJA 1P16A 1OXVA 4NB3A 1PHJA 2UUBL 3F8TA 1HNXQ 3I4MG 4BBSH 1E3PA 3CCLA 4LF9Q 3HOZG 4DPGA 1FVIA 3RN2A 3S1QH 3CCEA 2F4VL 2Q2TA 4KHPL 1NMFA 3UDIA 2N3SA 4DV3Q 2B29A 2PMZE 3A0JA 5EAYA 2E2IH 5IP9G 2OWOA 1HR0W 3M3YH 5IP7G 1XMQQ 3CC4A 4OXPA 4C3JH 1K0RA 5JEAG 2ZJQA 1Y1VH 1E7ZA 2D62A 4JOIC 3HKSA 5LMNQ 3CD6A 4DR6L 1Q12A 3PUWA 2EIFA 3U50C 2K75A 3RLFA 3JAMc 4DV0L 3J81c 1HNZL 1QUQA 5LMUQ 1QVFA 3S17H 1XMOL 4L5RC 5GAGC 2JA5G 2R92H 4JI8Q 2VW9A 2E5LQ 2PQAA 3CCJA 2NN6G 3NENA 3HOYG 1K8AC 1G6PA 1QVCA 4BY1H 4IJHA 1RIPA 2OTLA 3FHWA 1K73C 1KRTA 1YZ6A 2K52A 3PO3H 4DV7L 2CQOA 1D7QA 2BA1A 5FLMG 4JYAQ 4C2MH 5H1SE 4A3IG 1J5EL 4DR7Q 1I94L 1OXSC 4O0AA 1BVSA 1JMCA 3JAMi 3L2PA 2BH2A 1HNWL 1RL2A 3OYYA 4KI0A 1CKMA 1SLJA 2F3IA 2KBNA 2WAQE 1X3FA 2Z0SA 1X6OA 3G71A 2MQHA 4A3JG 1M1KC 3A5UA 2JQOA 1AE3A 3BZCA 4LF4Q 4X62Q 1XJVA 1EIYB 2GN5A 3GD7A 3IRBA 1YBYA 1DGSA 2K5VA 3T1HL 4A3FG 2JA6H 2E8GA 3BU2A 4DV4L 1TWCH 3VDYA 4BY7G 5AJ3L 3CCMA 2ZM6L 1BKBA 4JI4L 4LF6L 4P74A 3I56A 1VQ8A 3CCQA 4HJAA 2PI2E 4A93H 2NVTH 4A3DG 5HGQA 4XIGS 3J7ZC 5BR8L 1CSQA 1UWVA 2BA0A 4QY7A 5GAEC 3F2CA 3HOUG 2UUCQ 3G4SA 3SGIA 3S16H 2WFWA 2NVXH 3I4MH 1LTLA 4GKKL 1VQNA 4DNIA 1KIXA 3TS0A 3M4PA 4X65Q 3KF6A 2B63H 2UXBL 3TREA 4DR3L 5IP7H 2D0OA 1W2BA 3GTLH 4LNQA 1UEBA 3MXNB 4JBMA 4JOIA 1N34Q 1HZCA 3I7FA 2R7DA 3NEMA 2CFMA 4A4IA 2LSSA 4GOPB 2N78A 4APVA 4A3CG 5M3FH 4GNXC 3PO2H 2R93H 4HIOA 3PGZA 4K0KQ 4PZ7A 2IX0A 3U4ZA 4LW1A 1VQLA 2VQFQ 1VQHA 3J81j 3BZKA 2A1AA 3I55A 4YHHL 1VS0A 2Q2IA 3EBEA 4OWXB 3HOXH 1TWHH 1A63A 3HOWG 2KCTA 1VQKA 3S1MH 4IFDI 1PH5A 2NVQH 3RLOA 1HZBA 4LF7Q 5C4XG 1I3QH 4X64L 4JBKA 4YY3Q 1T9HA 3T1YL 3K81C 3GTQH 4DR4L 2ATWA 2C35B 1XNQQ 3CCVA 4UP8A 4JI5L 5C3EH 4A3IH 3ICEA 1L0WA 2UUAL 4R4TA 5JJKA 4JI1L 3L0OA 3H3VH 2LXKA 3S2HH 2WAQG 4JG2A 3CXCA 1TWAH 3TEHB 3U58A 5HY6A 4JI3L 1Q81C 1HNXL 3WWVA 1H95A 1KD1C 2UXCQ 5C44G 5IWAQ 1X54A 3HOVH 4L5TA 5C0XI 2E2HH 4P71A 4A76A 3RZDH 1NJIC 1IZ6A 3S1RH 3J80c 1KXLA 4R4CA 1YIJA 2K4KA 2CKZB 4JI7L 1VQGA 4LFAL 4OX9Q 3TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZA A;  2JA9 A;  1WCM H;  1M90 C;  4IPC A;  4P73 A;  1QUQ B;  4DUZ Q;  5LMN L;  1VQ6 A;  4DR5 Q;  4QJF A;  2I5L X;  3GTM H;  4UY8 C;  4XTC S;  3FKI H;  2E2J H;  4IJL A;  4R4O A;  4DUY Q;  2MO1 A;  2BH8 A;  3D0F A;  1OXX K;  2PQA B;  1VQ9 A;  1YI2 A;  5M5X H;  1HR0 Q;  1MJC A;  2WB1 E;  4GN4 B;  3CC2 A;  1IL2 A;  2JA7 G;  5GQO A;  1YJW A;  3S2D H;  1KAW A;  5M3M G;  2E5L L;  4AQY L;  1I5F A;  1N36 Q;  3JC6 6;  3CCU A;  1GD7 A;  4A3M H;  3PUX A;  3PV0 A;  1I50 H;  3J80 i;  4DV1 L;  2I5H A;  1JJ2 A;  2ES2 A;  4A3G H;  4YWK A;  4AH6 A;  1CKN B;  3I4N G;  4JYA L;  4ALP A;  4KHZ A;  5IY0 A;  4GNX A;  4B3T Q;  4H02 A;  1VQD A;  2XGT A;  2RHS B;  3HKZ E;  2RCN A;  1IBM L;  1VQE A;  5IYC G;  1HH2 P;  1X55 A;  4B3R Q;  2IY5 B;  3RZO H;  1BBW A;  3DLL A;  4LUV A;  2Y0S E;  3EN2 A;  4LF8 Q;  1A62 A;  4GN5 A;  4C3H H;  3B6Y A;  4GLX A;  2AHO B;  4NXN Q;  1IBL Q;  2AWN A;  4AYB E;  3E9H A;  2OCE A;  4L5Q A;  4LFC L;  4DV2 Q;  3M9B A;  1AE2 A;  1NBW A;  1SRO A;  3GDE A;  4AIM A;  5IE8 A;  1UE7 A;  4B3M L;  1Q8K A;  4R4Q A;  2AMC B;  5IYB G;  2N8N A;  2UUB Q;  1Q82 C;  3J81 i;  2YU9 H;  4IOA A;  3OTO L;  2R7Z H;  1I6H H;  3GTJ H;  2F4V Q;  4KHP Q;  1PA6 A;  1PFS A;  5J3B A;  1PH2 A;  1YHB A;  1JT8 A;  1OTC A;  3H15 A;  3KF6 B;  2NN6 I;  2GVB A;  4A3K H;  5FLX c;  1J6Q A;  1Q1E A;  2ID0 A;  1UE6 A;  3ERS X;  4YWM A;  5IYD G;  1SE8 A;  1U0L A;  1VQF A;  3PIO A;  4C3I H;  3ULP A;  3AFQ A;  3CP0 A;  2VUM H;  4DR6 Q;  3KJP A;  4J15 A;  1MIU A;  4YCW A;  2MNA A;  2HIX A;  3E9I A;  4QL5 A;  4X66 L;  4DK3 C;  4OO1 G;  3ULL A;  4BXX G;  2OTJ A;  1HNZ Q;  4DV6 L;  1FJG Q;  4UP7 A;  2UU9 L;  4BBR H;  1B8A A;  4A3B H;  1XMO Q;  1GO3 E;  1TXY A;  2ZJR A;  4HJ9 A;  4X6A H;  3PIP A;  2HHH L;  3H3V I;  2AKW B;  4GKJ L;  1S40 A;  3L7Z C;  2YV5 A;  3HOZ H;  2EXD A;  2VQF L;  3KDF A;  4JCV E;  2JA7 H;  1SMX A;  2WB1 G;  1PVO A;  3W5O A;  1N33 L;  1Q7Y C;  2H5X A;  4DV7 Q;  1W3S A;  4OWT B;  5IP9 H;  2A8V A;  2ZJP A;  1X56 A;  2B3G A;  2JA8 G;  1J5E Q;  4JC0 A;  1LUZ A;  2R7F A;  1I94 Q;  4RG1 A;  2IT1 A;  1HZ9 A;  3MEF A;  4LF7 L;  1VQO A;  4A3L G;  1CSP A;  3I4N H;  3CAM A;  4JI0 Q;  3ULJ A;  2IHF A;  2DUD A;  4YWL A;  4LF5 Q;  1XNQ L;  1HNW Q;  1N32 L;  3AYH B;  3CME A;  1X3G A;  2HIV A;  4B3S Q;  1VQJ A;  3HKZ G;  3OW2 A;  4JI7 Q;  1XNR Q;  1LM0 A;  1K8G A;  1L1O C;  2JA5 H;  4BBS G;  1OXU A;  1VQM A;  1WFQ A;  1O7I A;  2OQK A;  3LGJ A;  5C0X J;  3T1H Q;  3FP9 A;  1NE3 A;  1EYG A;  1NY4 A;  4O2D A;  4TVA B;  3HOY H;  1JJC B;  1WYD A;  2Y0S G;  4DV4 Q;  4IPG A;  4DV5 Q;  4WJ4 A;  3RR5 A;  4JI6 L;  4MZ9 A;  2ZM6 Q;  1E24 A;  4JI4 Q;  4LF6 Q;  4AYB G;  1YHQ A;  5FLM H;  1PH6 A;  1U5K A;  1Y1V G;  2QA4 A;  4QQB X;  2RHQ B;  1PYB A;  4DR2 L;  3M85 A;  5BR8 Q;  4NXM L;  2QEX A;  3TRZ A;  3K0X A;  2NVY H;  4JBJ A;  2NZO A;  4LFB L;  3S14 H;  2YTV A;  5GRO A;  4DAY B;  4DUZ L;  3PCO B;  2RF4 A;  3S1N H;  2R92 G;  3AQQ A;  3HFZ B;  4A3J H;  1SN8 A;  1E1T A;  4DR3 Q;  2WP8 J;  4LF9 L;  4UP9 A;  2VQE Q;  3DM3 A;  5C0X G;  4A3F H;  4BY1 G;  4MNO A;  3A5Z B;  3A74 A;  3K8A A;  5GAD C;  2ALY B;  3PO3 G;  1EIF A;  4DV3 L;  4DKA C;  1YIT A;  1N9W A;  4PG3 A;  4P75 A;  1A0I A;  4BY7 H;  1QVG A;  1PH8 A;  4HJ7 A;  1S72 A;  1XMQ L;  1WI5 A;  4Y7N H;  4GNX B;  1EWI A;  4PZ6 A;  4A3D H;  2A19 A;  4A75 A;  2I0Q A;  1SFO H;  1GVP A;  1JB7 A;  3HOU H;  4B3T L;  3W1G A;  4DK6 C;  2YYZ A;  5GAH C;  5LMU L;  2UXD Q;  4B3R L;  3CCR A;  4LUO A;  4JI8 L;  1MJE A;  3T1Y Q;  1X65 A;  2DGY A;  4R4I A;  2JA6 G;  4DR4 Q;  1KRS A;  1IBK Q;  1PV4 A;  1NMG A;  2K5N A;  4JI5 Q;  4LF8 L;  1MKH A;  4JBW A;  4HIM A;  3PF4 A;  4GS3 A;  3GTO H;  2UUA Q;  4A3L H;  1HZA A;  4R1J A;  4DV2 L;  4DR1 Q;  4A3C H;  5ELO A;  4A93 G;  3CW2 C;  4QGU A;  1XPR A;  4DR7 L;  1K3R A;  3PSI A;  2I5M X;  1L1O A;  4NPS A;  1Z47 A;  3PUZ A;  4JI3 Q;  4A3E G;  1AH9 A;  4JV5 Q;  4LUZ A;  4OWW B;  1BBU A;  4FDB A;  2B63 G;  5FJ8 G;  3F2D A;  3HOW H;  4IPH A;  5ELN A;  2HQL A;  3M4O H;  4LF4 L;  4X62 L;  4LFA Q;  2K50 A;  5C4X H;  5IT9 c;  1TWF H;  1ASY A;  1E22 A;  3RNU A;  1SRU A;  4JI2 Q;  1YEZ A;  3GTG H;  3H0G G;  2OQ0 A;  2F52 A;  3CCS A;  2K5H A;  5M3F G;  3PO2 G;  2D0P A;  2R93 G;  1FL0 A;  1FJG L;  2ZTE A;  5LMN W;  1UE1 A;  3KJO A;  1XNR L;  1HJP A;  4HIK A;  2KCM A;  3I2Z A;  1VQ7 A;  4HJ5 A;  2L15 A;  3K7U C;  3KYH C;  3KDF B;  3HOX G;  1CUK A;  2UUC L;  1P8L A;  4GLA C;  4AQY Q;  3EIV A;  5JJL A;  5C44 H;  2Z6K C;  1R9T H;  2IX1 A;  2MFI A;  1VQI A;  1G51 A;  4DV1 Q;  4X65 L;  1YJN A;  5M5Y H;  2K14 A;  1X9N A;  2N49 A;  4DV0 Q;  1WJJ A;  2QGQ A;  5C3E G;  1QZG A;  1CKN A;  4LWC A;  1EOV A;  3STB C;  1YHA A;  1IBM Q;  1GKH A;  1N34 L;  1C7Y A;  4GOP C;  1L2F A;  1JJG A;  2V1C C;  4LF5 L;  4JI0 L;  3STB D;  1Y1W G;  1WOC A;  2PNH A;  4B3S L;  3PF5 A;  4K0K L;  2VNU D;  3CQZ H;  3NEL A;  2CCZ A;  1D8L A;  4IFD J;  2LXJ A;  1JE5 A;  2YTY A;  1LYL A;  2JEB I;  4OON A;  2IHE A;  2JK8 A;  1XPU A;  3HOV G;  3M7N A;  2ZTD A;  2R6G A;  1VQP A;  5M3M H;  1ASZ A;  4LFC Q;  3E0E A;  1KL9 A;  4IOC A;  4DV5 L;  4B3M Q;  5C4J H;  3F2B A;  5M5W H;  4POF A;  4OO1 I;  3KLW A;  3G48 A;  4YY3 L;  1K9M C;  1WCM G;  3OTO Q;  4GN3 B;  4IPD A;  3UDX A;  1SR3 A;  2NZH A;  2HT1 A;  4Y52 H;  3RN5 A;  5IYC H;  3UE1 A;  1B70 B;  2PI2 A;  1PH3 A;  3FKI G;  3U4V A;  2CWP A;  4A3E H;  3J7A 5;  2JE6 I;  1A8V A;  3M4Q A;  1PH7 A;  5E7N A;  4ME3 A;  4P72 A;  1EQR A;  5FJ8 H;  1IXR A;  4IFD G;  3UDF A;  5AJ3 Q;  1VCI A;  3NBH B;  2UXC L;  4X66 Q;  2KHJ A;  3KOJ A;  1FGU A;  5IWA L;  2GVA A;  4A3M G;  2ASB A;  2VQE L;  4DV6 Q;  1VQ5 A;  4QIW E;  1PH9 A;  2UU9 Q;  3K80 C;  4A3G G;  1CKO A;  3AEV A;  3ZJY C;  4WJ3 M;  3H0G H;  3GTP H;  3PUY A;  2ZTC A;  3S24 A;  5JJI A;  2VS1 A;  5IYB H;  3GO5 A;  3CPF A;  1QZH A;  2HHH Q;  1IYJ B;  4OX9 L;  4PMW A;  4GKJ Q;  1X3E A;  4IO9 A;  3GTK H;  3KF8 B;  4GKK Q;  3G6E A;  1PH1 A;  4DR5 L;  3BJU A;  5DLQ E;  1TWG H;  1N33 Q;  1S3O A;  2JJQ A;  2FXQ A;  3UDG A;  4L5S A;  2JEA I;  2UXB Q;  4GLV B;  1K83 H;  4DUY L;  1KC8 C;  2Z6K A;  3F1Z A;  1GM5 A;  3KFU A;  2UXD L;  3AFP A;  4PZ8 A;  1HR0 L;  4UPA A;  1XPO A;  2YTX A;  5IYD H;  1VQC A;  1YNX A;  4YCV A;  1KQS A;  1E1O A;  1XTD A;  4DAM A;  2AWO A;  4KLK A;  1N36 L;  1IBK L;  2Q2H A;  2KEN A;  4BXX H;  1N32 Q;  1YJ9 A;  3S15 H;  3CMA A;  1NTG A;  4BA2 I;  4GOP A;  1PYS B;  3TQY A;  1VQ4 A;  3W1B A;  2Q2U A;  3Q8D A;  4YHH Q;  1V43 A;  4RMF A;  4DR1 L;  1L1O B;  2XTI A;  1Y1W H;  1VQB A;  4HJ8 A;  2R7Z G;  3PUV A;  1C9O A;  4YCU A;  1OXT A;  1VQA A;  1N8R C;  1B7Y B;  3ER0 A;  4TQU S;  1Q1B A;  4BA1 I;  4EX5 A;  2VY3 A;  3RLN A;  3CC7 A;  1EQQ A;  4A3K G;  4JI6 Q;  4JV5 L;  4X64 Q;  1V1Q A;  5JEA J;  1V9P A;  3I4O A;  4HID A;  1EFW A;  1Y14 B;  1Q86 C;  2VUM G;  3K7A H;  4DR2 Q;  2EQS A;  1Z9F A;  4MTN A;  2JA8 H;  1UE5 A;  2KHI A;  4EQ5 A;  1YVC A;  2VL6 A;  3CPW A;  4NXM Q;  4POG A;  1C0A A;  2MO0 A;  4NXN L;  1IBL L;  3D31 A;  3UE0 A;  4LFB Q;  5K36 G;  1Q46 A;  2CWA A;  4JI2 L;  4BBR G;  3CF5 A;  4A3B G;  1G29 1;  4JI1 Q;  1PH4 A;  1KHI A;  1EUJ A;  1P16 A;  1OXV A;  4NB3 A;  1PHJ A;  2UUB L;  3F8T A;  1HNX Q;  3I4M G;  4BBS H;  1E3P A;  3CCL A;  4LF9 Q;  3HOZ G;  4DPG A;  1FVI A;  3RN2 A;  3S1Q H;  3CCE A;  2F4V L;  2Q2T A;  4KHP L;  1NMF A;  3UDI A;  2N3S A;  4DV3 Q;  2B29 A;  2PMZ E;  3A0J A;  5EAY A;  2E2I H;  5IP9 G;  2OWO A;  1HR0 W;  3M3Y H;  5IP7 G;  1XMQ Q;  3CC4 A;  4OXP A;  4C3J H;  1K0R A;  5JEA G;  2ZJQ A;  1Y1V H;  1E7Z A;  2D62 A;  4JOI C;  3HKS A;  5LMN Q;  3CD6 A;  4DR6 L;  1Q12 A;  3PUW A;  2EIF A;  3U50 C;  2K75 A;  3RLF A;  3JAM c;  4DV0 L;  3J81 c;  1HNZ L;  1QUQ A;  5LMU Q;  1QVF A;  3S17 H;  1XMO L;  4L5R C;  5GAG C;  2JA5 G;  2R92 H;  4JI8 Q;  2VW9 A;  2E5L Q;  2PQA A;  3CCJ A;  2NN6 G;  3NEN A;  3HOY G;  1K8A C;  1G6P A;  1QVC A;  4BY1 H;  4IJH A;  1RIP A;  2OTL A;  3FHW A;  1K73 C;  1KRT A;  1YZ6 A;  2K52 A;  3PO3 H;  4DV7 L;  2CQO A;  1D7Q A;  2BA1 A;  5FLM G;  4JYA Q;  4C2M H;  5H1S E;  4A3I G;  1J5E L;  4DR7 Q;  1I94 L;  1OXS C;  4O0A A;  1BVS A;  1JMC A;  3JAM i;  3L2P A;  2BH2 A;  1HNW L;  1RL2 A;  3OYY A;  4KI0 A;  1CKM A;  1SLJ A;  2F3I A;  2KBN A;  2WAQ E;  1X3F A;  2Z0S A;  1X6O A;  3G71 A;  2MQH A;  4A3J G;  1M1K C;  3A5U A;  2JQO A;  1AE3 A;  3BZC A;  4LF4 Q;  4X62 Q;  1XJV A;  1EIY B;  2GN5 A;  3GD7 A;  3IRB A;  1YBY A;  1DGS A;  2K5V A;  3T1H L;  4A3F G;  2JA6 H;  2E8G A;  3BU2 A;  4DV4 L;  1TWC H;  3VDY A;  4BY7 G;  5AJ3 L;  3CCM A;  2ZM6 L;  1BKB A;  4JI4 L;  4LF6 L;  4P74 A;  3I56 A;  1VQ8 A;  3CCQ A;  4HJA A;  2PI2 E;  4A93 H;  2NVT H;  4A3D G;  5HGQ A;  4XIG S;  3J7Z C;  5BR8 L;  1CSQ A;  1UWV A;  2BA0 A;  4QY7 A;  5GAE C;  3F2C A;  3HOU G;  2UUC Q;  3G4S A;  3SGI A;  3S16 H;  2WFW A;  2NVX H;  3I4M H;  1LTL A;  4GKK L;  1VQN A;  4DNI A;  1KIX A;  3TS0 A;  3M4P A;  4X65 Q;  3KF6 A;  2B63 H;  2UXB L;  3TRE A;  4DR3 L;  5IP7 H;  2D0O A;  1W2B A;  3GTL H;  4LNQ A;  1UEB A;  3MXN B;  4JBM A;  4JOI A;  1N34 Q;  1HZC A;  3I7F A;  2R7D A;  3NEM A;  2CFM A;  4A4I A;  2LSS A;  4GOP B;  2N78 A;  4APV A;  4A3C G;  5M3F H;  4GNX C;  3PO2 H;  2R93 H;  4HIO A;  3PGZ A;  4K0K Q;  4PZ7 A;  2IX0 A;  3U4Z A;  4LW1 A;  1VQL A;  2VQF Q;  1VQH A;  3J81 j;  3BZK A;  2A1A A;  3I55 A;  4YHH L;  1VS0 A;  2Q2I A;  3EBE A;  4OWX B;  3HOX H;  1TWH H;  1A63 A;  3HOW G;  2KCT A;  1VQK A;  3S1M H;  4IFD I;  1PH5 A;  2NVQ H;  3RLO A;  1HZB A;  4LF7 Q;  5C4X G;  1I3Q H;  4X64 L;  4JBK A;  4YY3 Q;  1T9H A;  3T1Y L;  3K81 C;  3GTQ H;  4DR4 L;  2ATW A;  2C35 B;  1XNQ Q;  3CCV A;  4UP8 A;  4JI5 L;  5C3E H;  4A3I H;  3ICE A;  1L0W A;  2UUA L;  4R4T A;  5JJK A;  4JI1 L;  3L0O A;  3H3V H;  2LXK A;  3S2H H;  2WAQ G;  4JG2 A;  3CXC A;  1TWA H;  3TEH B;  3U58 A;  5HY6 A;  4JI3 L;  1Q81 C;  1HNX L;  3WWV A;  1H95 A;  1KD1 C;  2UXC Q;  5C44 G;  5IWA Q;  1X54 A;  3HOV H;  4L5T A;  5C0X I;  2E2H H;  4P71 A;  4A76 A;  3RZD H;  1NJI C;  1IZ6 A;  3S1R H;  3J80 c;  1KXL A;  4R4C A;  1YIJ A;  2K4K A;  2CKZ B;  4JI7 L;  1VQG A;  4LFA L;  4OX9 Q;  3TS2 A; 
#chains in the Genus database with same CATH topology
 1GUW A;  1Z7T A;  1PTO D;  3HRZ C;  4DR5 Q;  3HP3 A;  4L8J A;  4DUY Q;  4R4O A;  1EY6 A;  3I3C A;  2KUM A;  3CC2 A;  4NP5 A;  1B2T A;  3SDZ A;  3KLS X;  1YJW A;  2ENB A;  5M3M G;  4IFD H;  4PQX A;  4HED A;  3CCU A;  5KEE A;  4HMI A;  5JPN C;  2Z4I A;  3J80 i;  3KBX A;  2I5H A;  3OWE B;  1Q8I A;  4C3J B;  1Y1V B;  1JWM D;  1MBY A;  4B3T Q;  1D5M C;  4H02 A;  3VR6 A;  3GQB A;  3HKZ E;  2RHS B;  3DXJ C;  4WOR A;  3T4A C;  4B3R Q;  1II3 A;  3BVG A;  1CI3 M;  4J6H A;  3MZ5 A;  3RZO H;  3S17 B;  3PIP 3;  3DLL A;  1SYC A;  4GN5 A;  1JIC A;  3Q6S A;  2RSO A;  4C3H H;  4NXN Q;  5CR3 A;  2IW3 A;  5LL6 S;  5IE8 A;  4AIM A;  4B3M L;  5I6W A;  1V1P A;  4R4Q A;  3L9A X;  1CT1 D;  2B2W C;  1SE4 A;  1Q82 C;  2YU9 H;  4IOA A;  2FFK B;  2P5Z X;  1NR4 A;  2F4V Q;  1Q90 A;  1YHB A;  1F9S A;  4HCE A;  4G7H C;  2GVB A;  4A3K H;  5C3X A;  4WFN 3;  2FJ2 A;  3H91 A;  4XT3 B;  5IYD G;  1VQF A;  3PIO A;  2G9H D;  2NB0 A;  2EYJ A;  3KJP A;  1MIU A;  4YCW A;  4DK3 C;  3SK8 A;  4OO1 G;  3ULL A;  1TWC B;  2OTJ A;  4R8N A;  2UU9 L;  1RCV D;  4BBR H;  1B8A A;  2EYP A;  1EU3 A;  1XMO Q;  1TXY A;  4HJ9 A;  2NVT B;  3P7J A;  3J7Y W;  3H3V I;  3NTH A;  1HPC A;  1ET9 A;  5J39 A;  3HOZ H;  2EYO A;  4OHJ A;  3W5O A;  5CC4 A;  1N33 L;  5DM6 3;  3DEO A;  1UEA B;  3SK5 A;  4TKO B;  1J5E Q;  1LUZ A;  1JOQ A;  2A6H C;  4A3L G;  3MEF A;  1IKM A;  1CSP A;  4LF5 Q;  1SNM A;  4YWL A;  1XNQ L;  1DJR D;  3H94 A;  1FNU A;  5M3F B;  4K5X A;  1LM0 A;  1L1O C;  1MSH A;  1HXY D;  1S4Z A;  2JA5 H;  1Y8P B;  3OW7 A;  1O7I A;  2OQK A;  2OXP A;  3HOY H;  1JJC B;  4DV5 Q;  2Y0S G;  4IPG A;  4WJ4 A;  4XYQ A;  4MZ9 A;  4LF6 Q;  1QCB D;  5CV5 A;  4QQB X;  1UUP A;  4DR2 L;  1EQT A;  4K5W A;  3K0X A;  2NVY H;  5C3E B;  3T56 B;  3R3O A;  5GRO A;  4DAY B;  4DUZ L;  3S1N H;  1VF5 C;  1TS5 A;  1E1T A;  1MHW C;  4UP9 A;  1STE A;  2JYO A;  2VQE Q;  1HA6 A;  4MNO A;  3PO3 G;  3NBH A;  3HOV B;  1YIT A;  3EQL C;  1N9W A;  4P75 A;  3RZD B;  1QVG A;  1CK1 A;  4E6I A;  1XMQ L;  2L1B A;  1EWH A;  1QIL A;  2XWJ B;  2I0Q A;  1W6K A;  3HOU H;  4DK6 C;  2YYZ A;  3GTM B;  5LMU L;  3J7A F;  3R8B A;  2E2J B;  3T1Y Q;  2DGY A;  5M5X B;  1I4P A;  1PV4 A;  2K5N A;  1MKH A;  4JBW A;  5IOC A;  4GS3 A;  3DHQ A;  3GTO H;  2ICI A;  4A3M B;  4R1J A;  5FKA C;  4DV2 L;  1SE3 A;  3EJI A;  5ELO A;  4A93 G;  3CW2 C;  1SYG A;  1XPR A;  1K3R A;  3PUZ A;  4JI3 Q;  2L55 A;  1IW7 C;  3OPO A;  4KN4 C;  1HTL D;  4FDB A;  3BZD B;  5CBE E;  2B63 G;  5KIX A;  5ELN A;  1XX8 A;  4DA2 A;  5IT9 L;  4LFA Q;  5C4X H;  1PTO B;  1TWF H;  2AUJ D;  1ASY A;  1E22 A;  3RNU A;  2PZU A;  1SRU A;  4JI2 Q;  1YEZ A;  1ZYR C;  3ZYY X;  2F52 A;  1H9S B;  1U4R A;  2PW5 A;  5LMN W;  4DXG A;  2N88 A;  2M00 A;  2KCM A;  3F2U A;  3I2Z A;  3DWA A;  3KYH C;  3KDF B;  3WOF A;  4GLA C;  3EIV A;  1STG A;  2Z6K C;  4ZYS A;  1JOR A;  2G5D A;  4X65 L;  5E3F A;  2VUM B;  1YHA A;  1N34 L;  1C7Y A;  1JB3 A;  3C2P A;  4ZKB B;  2K32 A;  5C5L A;  4S3S A;  3PF5 A;  1I4X A;  2OEO A;  3NEL A;  2CCZ A;  2LXJ A;  2YTY A;  4OON A;  2B2Y A;  1O7Z A;  2ZTD A;  1ASZ A;  1ET6 A;  4N9T A;  4RH6 A;  4ABN A;  1KL9 A;  4IOC A;  4B3M Q;  1EY0 A;  5C4J H;  3F2B A;  3KLW A;  4J8Q A;  3G48 A;  4BS9 A;  2K05 A;  3BDO A;  1ROD A;  4Y52 H;  3UE1 A;  1B70 B;  2PI2 A;  5EJW A;  2RQX A;  1NNX A;  3U4V A;  2CWP A;  1PH3 A;  2F03 A;  1AZP A;  3A55 A;  1VF7 A;  3NQT A;  5FJ8 H;  2MP1 A;  1ZXT A;  4GZY C;  4IFD G;  3QB3 A;  1VCI A;  2KHJ A;  1LTB D;  5KYI A;  2ASB A;  1WTH A;  2Z8L A;  4QIW E;  4KKU A;  1PH9 A;  2UU9 Q;  1KLU D;  2CHB D;  4WJ3 M;  3H0G H;  3GTP H;  2R61 A;  2B8F A;  3PUY A;  2XRQ D;  3GO5 A;  4OX9 L;  1X3E A;  1QNK A;  3KF8 B;  1A2U A;  2K5W A;  1BQQ T;  3G6E A;  3S14 B;  1N33 Q;  2M2L A;  2JJQ A;  4DN4 M;  1WTQ A;  4F88 A;  3KFU A;  4A3J B;  1HR0 L;  2AQ2 B;  4UPA A;  4C3H G;  1YNX A;  3H09 A;  4A3F B;  1KQS A;  1E1O A;  2GA4 B;  4KLK A;  3MXN A;  1N36 L;  2Q2H A;  5EGT A;  1NTG A;  1EIH A;  4XYO A;  1PYS B;  3W1B A;  3Q8D A;  4Y7N B;  2XTI A;  1DXM A;  1VQB A;  1SFO B;  2A69 C;  2L4N A;  2X69 A;  1TY2 A;  3ER0 A;  2SNS A;  3RLN A;  1ONL A;  1YNJ C;  4A3K G;  4C1N I;  4HID A;  1GOZ A;  3I4O A;  1Y14 B;  4DR2 Q;  1Z9F A;  4MTN A;  1UE5 A;  2KHI A;  1YVC A;  3CPW A;  4KD3 A;  3KBG A;  4CKE A;  4BBR G;  3CF5 A;  1OXV A;  4I65 A;  4NB3 A;  1E3P A;  1TQO A;  3HOZ G;  1FVI A;  3RN2 A;  3TZD A;  4DK0 A;  1NMF A;  3A0J A;  4FNF A;  2F0T A;  5IP7 G;  1XMQ Q;  1PTO F;  4FXG C;  2ZJQ A;  1E7Z A;  4DR6 L;  4NDX A;  1QE6 A;  3PUW A;  2EIF A;  2K75 A;  4DV0 L;  2EJF C;  3J81 c;  1QUQ A;  5LMU Q;  2HUG A;  2JA5 G;  2F0V A;  3GV6 A;  3CCJ A;  1SE2 A;  2KHS A;  5EKK A;  1BUV T;  3HOY G;  4RGT A;  1K8A C;  5C0X H;  1QVC A;  4BY1 H;  2OTL A;  1R9T B;  3I4L A;  3K0Y A;  1WTO A;  5K5P A;  4H7B A;  4JYA Q;  5HGT A;  1U4L A;  4G7Z C;  1I94 L;  4RGO S;  1BVS A;  2L9H A;  5ELB A;  3JAM i;  5CV4 A;  1QNU A;  2OF1 A;  1RL2 A;  5E1F A;  2Z0S A;  2KBN A;  1XNR L;  2E76 C;  1X3F A;  4TSS A;  1IL8 A;  2JQO A;  1XJV A;  5A2Q L;  1R4Q B;  1STB A;  5M3M B;  2B2V A;  5AJ3 L;  4QB4 A;  2RKS A;  3ERO A;  4JI4 L;  1SNO A;  3I56 A;  1VQ8 A;  1F2Y A;  3CCQ A;  2F0O A;  2PI2 E;  4HJA A;  5M5W B;  3J7Z C;  1B1Z A;  1JCK B;  1F2L A;  4QY7 A;  3F2C A;  3HOU G;  1PRT D;  4PMC A;  3SGI A;  5L37 A;  4L6T B;  2WFW A;  3NWS A;  4GKK L;  1K3B C;  1BCP D;  2JSO A;  3CU7 A;  1KIX A;  3TS0 A;  3H3V C;  4X65 Q;  3KF6 A;  4F7X A;  3SXH A;  1FGB D;  5ELC A;  1W2B A;  2CW0 C;  3GTL H;  1I4Q A;  4JOI A;  2IX3 A;  1N34 Q;  1HZC A;  4QUC A;  4IQZ A;  4HSP A;  4RWS C;  3NP8 A;  4GOP B;  2N78 A;  3VR2 A;  5I6Y A;  3PO2 H;  2R93 H;  2IX0 A;  1CQF A;  2VQF Q;  3J81 j;  4YHH L;  1VS0 A;  4MN3 A;  2F3W A;  1ICF B;  1TWH H;  1HTP A;  1A63 A;  1TWG B;  1PH5 A;  1FD7 D;  4EQN A;  3RLO A;  1HZB A;  1H9K A;  4LF7 Q;  5C4X G;  1B4O A;  4JBK A;  1T9H A;  2E75 C;  4DR4 L;  2L11 A;  2ATW A;  3CCV A;  4UP8 A;  1STH A;  2SEB D;  2IPK D;  3IFT A;  3L0O A;  4OL7 A;  3S2H H;  2WAQ G;  3CXC A;  4P2C B;  1Y1W B;  4KTA A;  3U58 A;  2HCI A;  1HNX L;  3WWV A;  2C9O A;  4L5T A;  2E2H H;  3OIQ A;  4A76 A;  1NJI C;  2KCC A;  2MUY A;  3J80 c;  4RCN A;  1LTS D;  1PTO C;  4MTK A;  1VMP A;  2CH4 A;  1XYI A;  4OX9 Q;  3TS2 A;  2F3V A;  4HCS A;  1WCM H;  4L63 B;  4IPC A;  4M1U B;  1M90 C;  1VQ6 A;  5LMN L;  5A35 A;  2I5L X;  2JN4 A;  4UY8 C;  1IYV A;  3FKI H;  2KOL A;  1EWC A;  5C4Z A;  5KGU A;  1OXX K;  2PQA B;  1VQ9 A;  1HR0 Q;  2JA7 G;  1E2W A;  1MJC A;  2WB1 E;  2K04 A;  3P75 A;  3S2D H;  1DOK A;  3Q22 A;  3S1Q B;  4CDF C;  4AQY L;  1I5F A;  1N36 Q;  2Y0S B;  4O42 A;  4DV1 L;  3PIO 3;  1JJ2 A;  4A3G H;  2WIN B;  4YWK A;  1D1K A;  4GNX A;  1OO9 B;  1VQD A;  1B9N A;  1X55 A;  4OEL B;  4I7Z C;  1SXT A;  2QIL A;  4JVZ A;  2HDL A;  3T16 A;  1A6X A;  2AHO B;  1EY9 A;  4AYB E;  2M9V A;  4L5Q A;  3PO3 B;  1NBW A;  4R8I A;  3LWE A;  4C2M B;  1Q8K A;  1ZKO A;  1JE4 A;  2N8N A;  5I2Y A;  3J81 i;  5ISR A;  3A8K E;  1I6H H;  1CM9 A;  1PA6 A;  3H15 A;  3NTK A;  3CQZ B;  3MVV A;  4UAI A;  3TN2 A;  5FLX c;  1J6Q A;  1Q1E A;  3ULP A;  4F8M A;  4C3I H;  3BVZ A;  3CP0 A;  4DR6 Q;  2MNA A;  2PNR C;  2BOS A;  3NXW A;  1FJG Q;  4UP7 A;  2A73 B;  2XVS A;  3TP7 A;  3URY A;  4K8I A;  2EXZ A;  3K59 A;  1O7L A;  5IGG A;  4A93 B;  4RKB A;  2HHH L;  4GKJ L;  3KLR A;  2B2U C;  3S16 B;  4RHS A;  1PVO A;  4X3U A;  1F2M A;  2H5X A;  1W3S A;  2DJG C;  1J8I A;  2B63 B;  4X3K A;  2PW7 A;  3LX0 A;  2R7F A;  4JC0 A;  1I94 Q;  1W6J A;  5JEA H;  1HZ9 A;  1LT5 D;  3I4N H;  5KND A;  5C5M A;  5IGB A;  1N32 L;  3AYH B;  3CME A;  1XNR Q;  1VQJ A;  3HKZ G;  2HQE A;  5J22 A;  1K8G A;  2TMP A;  1CHQ D;  1OXU A;  1WFQ A;  3LGJ A;  4IAL A;  5C4H A;  1NE3 A;  1EYG A;  4O2D A;  2XSC A;  4TVA B;  1WYD A;  3SEB A;  5CV6 A;  5JOB A;  3S1M B;  3D6W A;  4JI4 Q;  5FLM H;  5KNC A;  1U5K A;  2QA4 A;  2BCO A;  2EOT A;  2K5D A;  1CA6 A;  4K5V A;  1PRT B;  3TRZ A;  2B2W A;  2BDN A;  2NZO A;  1BCP B;  2KJX A;  1SYD A;  2EYM A;  3PCO B;  3P1H A;  3AQQ A;  1RDP D;  1AEX A;  5I4D A;  1SN8 A;  1TWA B;  4LF9 L;  2PO4 A;  3DM3 A;  5C0X G;  4BY1 G;  2DY7 A;  3A5Z B;  2ALY B;  3EA6 A;  1A0I A;  4BY7 H;  5D3I B;  1S72 A;  1T5E A;  3TZU A;  1PZK D;  1EWI A;  2LKV A;  4PZ6 A;  5JVH 3;  2A19 A;  3LWU A;  1DON A;  2NZ1 D;  5LL6 X;  3NQI A;  1PFM A;  3T53 B;  5KYL A;  4CGY B;  3J80 E;  4HR7 B;  3FPU B;  4R9W A;  4DGZ A;  4FF1 A;  4LUO A;  2UXD Q;  1JR0 D;  4DR4 Q;  4X3S A;  1IBK Q;  1EYA A;  4LF8 L;  1NMG A;  2F0I A;  4HIM A;  1MI2 A;  1RD9 D;  4DR1 Q;  2EYF A;  4QGU A;  2RSN A;  4RA8 A;  1I4H A;  4JW0 A;  5JJZ A;  1L1O A;  3OWF A;  5IGD A;  1R4P B;  3PMF A;  4EQP A;  3F2D A;  3RZO B;  4IPH A;  1WTV A;  3M4O H;  1BXT A;  4X62 L;  3QOL A;  5IT9 c;  4C3H B;  3GTG H;  3CCS A;  2K5H A;  5COR A;  5BN3 A;  3PO2 G;  2R93 G;  5IGF A;  1UE1 A;  3KJO A;  2B2T C;  1HJP A;  2KQ3 A;  4HJ5 A;  3K7U C;  4CDD C;  2YU9 B;  4RHR A;  2UUC L;  4AQY Q;  1WTW A;  5JJL A;  2IX1 A;  1VQI A;  4DV1 Q;  1YJN A;  4A3K B;  5E4W C;  5M5Y H;  1RTO A;  1STN A;  5LHY 1;  1Y8N B;  1X9N A;  1WJJ A;  2Z6B A;  4LWC A;  3J7A V;  3A56 A;  1GKH A;  4GOP C;  1GUG A;  4JI0 L;  1Y1W G;  4BBR B;  5FLX E;  4B3S L;  4K0K L;  3HG9 A;  1D8L A;  1JE5 A;  1LYL A;  2JEB I;  2IHE A;  2JK8 A;  3M7N A;  3HOZ B;  3I72 A;  4ULL A;  1VQP A;  1E2Z A;  3HEJ A;  3FDT A;  3CKI B;  5F2D A;  1F9R A;  2VXW A;  5NUC A;  1WCM G;  4IUU A;  4GN3 B;  4RGM A;  3VR4 A;  2DN8 A;  4XQN A;  3RN5 A;  5IYC H;  3OSO A;  3FKI G;  1GUN A;  3J7A 5;  4A3E H;  1CZW A;  3BYT B;  3DEP A;  5M9O A;  5E7N A;  4ME3 A;  3BDL A;  2JA5 B;  3QWN A;  3UDF A;  4DNT B;  2UXC L;  3HOY B;  5IWA L;  1FGU A;  2GVA A;  3IAY A;  1VQ5 A;  4A3G G;  2QDL A;  1PRT F;  4NMZ A;  2VS1 A;  5IYB H;  2HHH Q;  4GKJ Q;  1BCP F;  3GTK H;  3Q23 A;  2NVY B;  2H4O A;  3BJU A;  1AP0 A;  2UXB Q;  2JEA I;  3MC0 B;  3S1N B;  4GLV B;  1K83 H;  1KC8 C;  4JPB W;  2Z6K A;  1DYQ A;  2MJ8 A;  4PZ8 A;  2YTX A;  1XTD A;  3D4W A;  2K03 A;  1N32 Q;  5I9O A;  2KEN A;  4BXX H;  5C3W A;  1YJ9 A;  3CMA A;  3S15 H;  1VQ4 A;  2Q2U A;  3ND9 A;  3TQY A;  5FOB B;  1HRJ A;  1V43 A;  1C9O A;  3QR8 A;  1EY5 A;  1VQA A;  1N8R C;  3HOU B;  4EX5 A;  4TQU S;  4BA1 I;  2VY3 A;  2QW7 A;  3CC7 A;  2O4X A;  3WOE A;  4JV5 L;  1V1Q A;  3K5O A;  1C8C A;  3MEH A;  1EFW A;  2NTS A;  4C3I G;  1TT2 A;  1Q86 C;  3K7A H;  3R93 A;  2VL6 A;  3VYR A;  3FRP B;  1EYD A;  1IBL L;  1Z6H A;  1I4R A;  3K58 A;  1LLR D;  3QO2 A;  3GTO B;  1G29 1;  1KHI A;  4KY5 A;  1EUJ A;  1LT4 D;  3F8T A;  1XWE A;  2QEJ C;  4BBS H;  4LF9 Q;  3CCE A;  1HQM C;  2E2I H;  2B29 A;  2PMZ E;  1KLG D;  1YNN D;  3M3Y H;  5JPM C;  4ZUI A;  3CC4 A;  3MXG A;  2F0W A;  3SE0 A;  4NW2 A;  5JEA G;  1BDO A;  2D62 A;  3OMG A;  5C4X B;  4KJO A;  1TWF B;  1KAA A;  3U50 C;  3JAM c;  1HNZ L;  1I4G A;  2HDM A;  1PZJ D;  3X3M A;  4L5R C;  3H6M A;  3AU7 A;  5GAG C;  2R92 H;  5FO7 B;  1U4P A;  3G6J B;  1HQR D;  5IIF A;  2WAQ B;  1J9O A;  4DAV A;  4IJH A;  3FHW A;  1K73 C;  4RFB A;  1H9J A;  2CQO A;  4DV7 L;  2BA1 A;  5FLM G;  1TY0 A;  3EVQ A;  5H1S E;  3SVM A;  1OXS C;  2SDF A;  1JMC A;  3M4Y A;  4ID6 A;  3OYY A;  2KCN A;  4ZLT F;  1SLJ A;  2F3I A;  1X6O A;  1JOK A;  1ML0 D;  3BZC A;  1AE3 A;  4X62 Q;  4U68 A;  1EIY B;  2F0Q A;  3IRB A;  3QJY A;  2JA6 H;  2JA7 B;  3VDY A;  3GP7 A;  4BY7 G;  2K01 A;  4FXK C;  3CCM A;  2ZM6 L;  5C4J B;  4Q0F A;  1PRT C;  1S5F D;  2Z4H A;  5BR8 L;  1D6E C;  1BCP C;  2B39 A;  2R3Z A;  2UUC Q;  1X32 A;  4QCL A;  2NVX H;  3I4M H;  1LTL A;  3RMH A;  3I8Z A;  3IFD A;  1EFI D;  2MPM A;  3TRE A;  3R2I A;  4ZKC B;  2D0O A;  1UEB A;  4JBM A;  4G7O C;  3E0J A;  1ESR A;  2R7D A;  2H1E A;  3NEM A;  2K5Q A;  1TS3 A;  4A4I A;  5COY A;  1ENF A;  3H0G B;  3GTP B;  4K0K Q;  4PZ7 A;  2QCP X;  2LFN A;  5T1G A;  1VQL A;  4CDE C;  1VQH A;  2TSS A;  4CJ0 B;  3BZK A;  2A1A A;  2CVR A;  4TRD A;  5FO8 B;  5CYU A;  2A6E D;  5IGE A;  2EY5 A;  5E4X A;  3HOX H;  1DZ1 A;  2KCT A;  1VQK A;  1BBX C;  4QUF A;  2NVQ H;  2Z1C A;  2J4X A;  1HFN A;  1I3Q H;  2E2D C;  4CKC A;  4X64 L;  3GTQ H;  2NYZ D;  1XNQ Q;  4A3I H;  5K36 H;  1E2V A;  3ICE A;  1L0W A;  1E0B A;  1FNW A;  3WDN A;  4JI1 L;  2EY1 A;  1TII D;  1MSG A;  3TEH B;  1H95 A;  1KD1 C;  2UXC Q;  2B8G A;  3E3X A;  1X54 A;  4N8X 1;  5IWA Q;  5C0X I;  4P71 A;  4IUR A;  1MD2 D;  3S1R H;  1KXL A;  4R4C A;  1WD0 A;  2CKZ B;  3BYY B;  1VQG A;  4M8A A;  2FIN B;  1AW7 A;  4DUZ Q;  1K0S A;  4XTC S;  4DAY A;  3HKZ B;  4IJL A;  3D0F A;  3N52 A;  4DF7 A;  1YI2 A;  1DD2 A;  1PLF A;  1XTC D;  4GN4 B;  1PFB A;  5GQO A;  1KAW A;  2E5L L;  1JWU D;  1LT6 D;  1GD7 A;  3PUX A;  1I50 H;  3MXU A;  4DAP A;  2V4D A;  3DWP A;  1CKN B;  1F77 A;  2F0P A;  2CH4 W;  5J1Z A;  2XGT A;  1CHP D;  1IBM L;  2RCN A;  1VQE A;  4XQQ A;  5IYC G;  1HH2 P;  4OIJ A;  1BBW A;  2IJ0 A;  2FHT A;  1FR3 A;  1SNQ A;  4HAE A;  4GLX A;  1LTA D;  3B6Y A;  3JAM E;  1IBL Q;  3E9H A;  2OCE A;  4LFC L;  5KRU A;  4BY1 B;  4DV2 Q;  3M9B A;  4DNR B;  1SRO A;  3GDE A;  1UE7 A;  4XXE A;  2DJF C;  5IYB G;  4IUN A;  1KNE A;  2R7Z H;  4IUT A;  3GTJ H;  4OEM B;  1PH2 A;  1JT8 A;  1OTC A;  2F0F A;  4V0B A;  1FYC A;  2ICE C;  2K7V A;  1KDB A;  1SE8 A;  1U0L A;  3HS0 C;  4MIU A;  4XDX A;  2HIX A;  4X66 L;  4BXX G;  1HNZ Q;  3OOC A;  1H9S A;  2EZV A;  4A3B H;  2A68 D;  1GO3 E;  4I7A A;  1MGS A;  5EPL A;  5CMD A;  4LAA A;  4X6A H;  3I91 A;  4B9X A;  1K8M A;  5A2Q E;  1A3V A;  3BVM A;  2NBF A;  2YV5 A;  1RF2 D;  3KDF A;  1M4V A;  1SMX A;  2WB1 G;  4DV7 Q;  5IP9 H;  2A8V A;  2I07 B;  4V19 0;  1X56 A;  4CHT B;  4DU9 A;  4XT1 B;  4C1N K;  1LTR D;  5EQ0 A;  4RG1 A;  4N9P A;  3GTL B;  3CAM A;  3NE5 B;  5T1I A;  5JAV A;  1X3G A;  3OW2 A;  3PO2 B;  2R93 B;  3FMC A;  4B08 A;  5IGC A;  4BBS G;  4ODG A;  1QB5 D;  1NY4 A;  2KEE A;  2XN9 C;  3CRL C;  1TWH B;  3RR5 A;  1EY7 A;  4JI6 L;  2ZM6 Q;  3MXP A;  3NBI A;  4AYB G;  1YHQ A;  1PH6 A;  5D3D A;  2RHQ B;  4IZ8 A;  5BR8 Q;  4NXM L;  2QEX A;  4JBJ A;  1B9M A;  3MFG A;  3QOJ A;  1TVX A;  2R92 G;  3HFZ B;  3S2H B;  2WP8 J;  1BO0 A;  1STA A;  3K8A A;  3KUP A;  5GAD C;  1EIF A;  4DV3 L;  2E2H B;  2PZT A;  4PG3 A;  2EY6 A;  5IOD A;  4KY6 A;  5CBA E;  1WI5 A;  4A3D H;  4A75 A;  1WCM B;  3N6R A;  4LJZ C;  3KF8 A;  4B3T L;  3C46 A;  5ELF A;  4EVO A;  5GAH C;  1WD1 A;  2B2U A;  4K2L A;  1O78 A;  3FKI B;  4B3R L;  1MJE A;  4HN7 A;  2JA6 G;  5EBC A;  2NTT A;  3BG3 A;  2WKD A;  3S2D B;  2EVB A;  3PF4 A;  2ZXR A;  4A3L H;  2F0D A;  1V1P B;  4A3G B;  1L0X B;  1SMY D;  2I5M X;  1GUT A;  4NPS A;  2F4I A;  1HFG A;  3D4D A;  4DFA A;  5EBD A;  5FJ8 G;  1WTX A;  3HOW H;  2HQL A;  2PPB C;  2SOB A;  2K50 A;  4FF3 A;  3J81 E;  3V05 A;  2EJG C;  2LS0 1;  3DUZ A;  1KNA A;  4H44 C;  3H0G G;  1UAP A;  2OQ0 A;  2C5C A;  1B53 A;  1FL0 A;  4IUQ A;  4ZUJ A;  4HIK A;  4MHE A;  1VQ7 A;  2L15 A;  3HOX G;  1CUK A;  3BS1 A;  1I6H B;  2HCC A;  5C44 H;  1K28 A;  1G51 A;  2K14 A;  5EKI A;  4C3I B;  4DV0 Q;  2QGQ A;  5K36 G;  1QZG A;  1CKN A;  1IBM Q;  3D3R A;  2NUC A;  1L2F A;  2O5I C;  3QG1 A;  1JJG A;  2V1C C;  3TP5 A;  2D2C C;  4LF5 L;  3STB D;  2WKC A;  3TDQ A;  3D6C A;  1C48 A;  1SNC A;  1WOC A;  2PNH A;  2VNU D;  3CQZ H;  4IFD J;  2J0T D;  3DM1 A;  3W2D A;  5CV8 A;  1DM0 B;  1G2S A;  2XRS D;  4LFC Q;  4DV5 L;  2Q8R E;  2F0S A;  4WRD A;  3C3L A;  4POF A;  1A2T A;  4YY3 L;  1WTP A;  4QIW B;  1X3P A;  3UDX A;  2NZH A;  3I4N B;  4WJW A;  2JE6 I;  4ILW A;  1KDA A;  3MA2 B;  4FVM A;  2Q8I B;  1IXR A;  1B50 A;  1PXU A;  5AJ3 Q;  3NBH B;  4X66 Q;  3VYU A;  4PNY A;  2VQE L;  3K80 C;  4RGN A;  3AEV A;  3ZJY C;  1HCZ A;  2CW0 D;  3CPF A;  1IYJ B;  4PMW A;  4IO9 A;  1EY8 A;  2B2T A;  4GKK Q;  3NWT A;  1PH1 A;  1LTT D;  3FEW X;  2ZXP A;  1S3O A;  2FXQ A;  4L5S A;  1VDZ A;  1ICW A;  3F1Z A;  1GM5 A;  2ZT9 C;  3AFP A;  1XPO A;  3PQI A;  1VQC A;  3A7A B;  2EYH A;  4DAM A;  1LAB A;  2L5T A;  4BY7 B;  4GOP A;  1Y8O B;  1I6V C;  4RKL A;  4YHH Q;  2R7Z G;  2F0K A;  4FXD A;  3OHX C;  4IUV A;  2ZXO A;  3I73 A;  4JI6 Q;  1V9P A;  1IYU A;  3J80 L;  1GXD C;  2JA8 H;  3VYS A;  2EQS A;  4EQ5 A;  4NXM Q;  4POG A;  3D31 A;  1Q46 A;  2CWA A;  1O80 A;  4JI2 L;  4A3B G;  3KK7 A;  5TSS A;  1SEB D;  2IL8 A;  3OMC A;  5DAU A;  2UUB L;  1EIG A;  1D5Z C;  1HNX Q;  3W3A A;  3CCL A;  4DPG A;  1TU2 B;  1ESF A;  1YNN C;  4KHP L;  5EPJ A;  2Q2T A;  4DV3 Q;  2OWO A;  2HT1 A;  1RKN A;  5IP9 G;  1HR0 W;  3VA5 A;  1SJH D;  3M4O B;  4C3J H;  1Y1V H;  3O13 A;  3HGB A;  4F87 A;  5LMN Q;  3CD6 A;  1Q12 A;  1EZ6 A;  1G91 A;  3GTG B;  2RBM A;  4QMG A;  3RLF A;  1NSN S;  1QVF A;  3S17 H;  1KAB A;  1AN8 A;  2VW9 A;  2PQA A;  4EQO A;  3NEN A;  3Q24 A;  2RA4 A;  3L3O C;  1BNZ A;  4XQJ A;  1LTG D;  1YZ6 A;  5M5Y B;  1LTI D;  2PCF B;  1JOO A;  2PZW A;  3L2P A;  2BH2 A;  1HNW L;  4KI0 A;  1CKM A;  5KNB A;  4JI7 L;  4K2K A;  1M1K C;  2MQH A;  3A5U A;  4ZK9 B;  5G3L D;  5FLX L;  1Q3L A;  3GD7 A;  3T1H L;  2K5V A;  3V2T A;  4KKT A;  4Z9C B;  3EFX D;  4DV4 L;  1TWC H;  2O5J C;  3SR1 A;  1BKB A;  4P74 A;  2X6L A;  2NVT H;  4A3D G;  4XIG S;  3I70 A;  1UWV A;  5GAE C;  5ELE A;  3G4S A;  1PFN A;  1EEI D;  1GHK A;  4A3E B;  3A7L A;  5CGK A;  3SHL A;  4DR3 L;  5IP7 H;  3DMU A;  3MXN B;  1SJE D;  2CFM A;  3KLS A;  2LSS A;  1SYF A;  5M3F H;  4HIO A;  2A6E C;  3U4Z A;  4LW1 A;  3I55 A;  2FMC A;  3GTK B;  1M8A A;  1SYE A;  3G7L A;  3EBE A;  4C56 C;  3NSW A;  5FK9 C;  2WV6 D;  3HOW G;  1XXG A;  1K83 B;  2PYK A;  4G4K A;  1HUM A;  2LMC B;  4YY3 Q;  3RUZ A;  3K81 C;  4X3T A;  3OIP A;  2C35 B;  4K14 A;  4BWG B;  4G57 A;  4JI5 L;  5C3E H;  4CJ1 B;  1BF4 A;  2F0U A;  2UUA L;  3I90 A;  3S15 B;  1Y69 U;  3H3V H;  3NHH A;  2RCF A;  3D4R A;  5HY6 A;  1Q81 C;  2K28 A;  2Q8T A;  1RJT A;  5C44 G;  3HOV H;  2DNC A;  2QDB A;  2WB1 B;  3RZD H;  1IZ6 A;  2BE5 D;  2SNM A;  1YIJ A;  1BR9 A;  2K4K A;  3K7A B;  2VZA A;  2JA9 A;  3VA7 A;  2VB2 X;  4P73 A;  3ND8 A;  1QUQ B;  2MHV A;  4N8F A;  3DWQ A;  4QJF A;  5D65 A;  3GTM H;  2F0M A;  2E2J H;  2MO1 A;  2BH8 A;  3TP6 A;  5M5X H;  1IL2 A;  2PQE A;  4BBS B;  3TSS A;  3NK9 A;  3NPP A;  4KY7 A;  1WTR A;  3JC6 6;  2E2I B;  4A3M H;  3K5L A;  4CBV A;  3PV0 A;  4ZRZ A;  5FO9 B;  1O7Y A;  2ES2 A;  3M3Y B;  1KTK A;  1JWS D;  4AH6 A;  4AYB B;  3I4N G;  4JYA L;  4ALP A;  4KHZ A;  5IY0 A;  3VR5 A;  4OIK A;  4K8J A;  5I9P A;  5D14 A;  2IY5 B;  2F0L A;  2DY8 A;  5IT9 E;  5AFW A;  1NCV A;  4LUV A;  2R92 B;  2Y0S E;  3EN2 A;  1PTO H;  1A62 A;  4LF8 Q;  2AWN A;  1A3U A;  2F0J A;  1AE2 A;  4FYD A;  1LAC A;  2AMC B;  4DK1 A;  2UUB Q;  5DNF A;  3OTO L;  1GUO A;  4FO2 A;  4KHP Q;  1PFS A;  5J3B A;  4CDC C;  1BOS A;  1TKW B;  1U4M A;  3KF6 B;  4NKL A;  2NN6 I;  2ID0 A;  1UE6 A;  3ERS X;  4YWM A;  3SK4 A;  1D5X C;  4Q5V A;  3AFQ A;  2VUM H;  2JA6 B;  4J15 A;  3E9I A;  2A68 C;  4QL5 A;  3A54 A;  3BDC A;  4B9W A;  4DV6 L;  3MAQ A;  4LMQ D;  2ZJR A;  4UHV A;  3PIP A;  2AKW B;  1L0Y B;  1CZG A;  1S40 A;  3L7Z C;  2K6A A;  2EXD A;  3ERQ A;  2VQF L;  4JCV E;  2JA7 H;  1WVL A;  3I4M B;  4KHV A;  2NVX B;  1Q7Y C;  4OWT B;  2OT2 A;  2ZJP A;  4IUP A;  2B3G A;  2JA8 G;  5BN4 A;  4LF7 L;  1TR5 A;  2IT1 A;  4PMB A;  1VQO A;  1F9Q A;  4JI0 Q;  3ULJ A;  2IHF A;  2DUD A;  5DM7 3;  1HNW Q;  3P20 A;  2A6H D;  1JQY D;  2HIV A;  4B3S Q;  4JI7 Q;  2X6G A;  1ILP A;  1VQM A;  3T1H Q;  5C0X J;  1NR2 A;  2EY2 A;  3FP9 A;  3MHB A;  4LK1 C;  2NN6 H;  4DV4 Q;  2LY7 A;  3HOX B;  2D5D A;  3S9W A;  1KDC A;  1E24 A;  4C3J G;  2NVQ B;  1Y1V G;  1I3Q B;  1PYB A;  3GTQ B;  3M85 A;  1HHV A;  3VYT A;  1SDF A;  5BN5 A;  3E6Z X;  2KVM A;  4KN7 C;  4A3I B;  4LFB L;  3S14 H;  1A3T A;  3T13 A;  1EZ8 A;  2KA7 A;  2YTV A;  2RF4 A;  1ENA A;  4A3J H;  2EDG A;  3ONA B;  3V96 A;  2AQ3 B;  4DR3 Q;  2XNA C;  4A3F H;  3A74 A;  3A8I E;  1JC7 A;  4DKA C;  2J7Z A;  3K5N A;  1PH8 A;  4HJ7 A;  4KJN A;  2JXM B;  3S1R B;  4Y7N H;  1G2T A;  4GNX B;  1QG7 A;  2G9D A;  1SFO H;  1GVP A;  2EE1 A;  1JB7 A;  1D2B A;  3K5M A;  4HMJ A;  3W1G A;  2O2L D;  3IKJ A;  3AB9 A;  3CCR A;  2B2Y C;  4JI8 L;  2A5H A;  2XWB B;  1X65 A;  4R4I A;  1PDQ A;  1KRS A;  1DOL A;  4JI5 Q;  2F0H A;  2UUA Q;  1HZA A;  4HTH A;  4K6D A;  1I50 B;  1SMY C;  3A8J E;  4ZAI A;  4A3C H;  1F9P A;  4JK1 C;  1TS2 A;  4DR7 L;  4FP5 D;  3PSI A;  3IL8 A;  5C6A A;  1Z47 A;  4A3E G;  1AH9 A;  4JV5 Q;  2EYL A;  4LUZ A;  4OWW B;  1BBU A;  3TME A;  2JP1 A;  4DXF A;  1RHP A;  1IW7 D;  2F0G A;  4LF4 L;  1CTM A;  3C1E A;  5JVG 3;  2QKI C;  3FPP A;  2K33 A;  2Z9H A;  3X3N A;  1SYB A;  1S5D D;  3JAM L;  5M3F G;  2D0P A;  2FMM A;  1ZYR D;  1FJG L;  2ZTE A;  1EL0 A;  2R7Z B;  2HD3 A;  1P8L A;  3GTJ B;  1H9R A;  4OGQ C;  1G8Z D;  3U9S A;  1R9T H;  3AMU A;  2MFI A;  3GV3 A;  1QJO A;  2BDO A;  3CHB D;  3MFY A;  1EOT A;  2N49 A;  5C3E G;  3K6O A;  1SBB B;  3STB C;  1EOV A;  3U9O A;  2F0N A;  2RVL A;  1EEF D;  4CKB A;  4A3B B;  4O1N A;  1ILQ A;  1XPU A;  1LV9 A;  3HOV G;  2R6G A;  5M3M H;  3E0E A;  5M5W H;  4OO1 I;  4ZCK A;  1K9M C;  1F2Z A;  3OTO Q;  4IPD A;  4FF2 A;  1SR3 A;  5G3L F;  1HA5 A;  4HSV A;  2CQA A;  1VMC A;  1A8V A;  1S5E D;  3M4Q A;  1PH7 A;  3E5S A;  4P72 A;  1EQR A;  1H9M A;  3KOJ A;  4A3M G;  4H13 C;  4DV6 Q;  1S5B D;  1CKO A;  1X3Q A;  3MTS A;  1GUS A;  1EYC A;  1RTN A;  2ZTC A;  1DCZ A;  3S24 A;  5JJI A;  1DOM A;  1QZH A;  5ELD A;  3T51 B;  4UDU C;  2K1B A;  4DR5 L;  5DLQ E;  1TWG H;  3UDG A;  1ENC A;  1AFP A;  4DUY L;  3MWY W;  2UXD L;  4IN3 A;  5IYD H;  1B3Q A;  4KD4 A;  4YCV A;  2AWO A;  2RDF A;  1IBK L;  4OO1 H;  1LO5 D;  3R2T A;  1QOH A;  2KEC A;  4BA2 I;  2KED A;  4RMF A;  4DR1 L;  1L1O B;  1Y1W H;  4HJ8 A;  4A3D B;  1IKL A;  3PUV A;  4YCU A;  1OXT A;  1GHJ A;  1B7Y B;  1Q1B A;  3LNN A;  1EQQ A;  2A69 D;  3ITP A;  4X64 Q;  1QWY A;  3K57 A;  5JEA J;  5CV9 A;  4ZQ3 A;  2VUM G;  1B3A A;  1YNJ D;  2PMZ B;  2B2V C;  1C0A A;  2MO0 A;  4NXN L;  3Q0A A;  3UE0 A;  4LFB Q;  4FF4 A;  2RDH A;  2F0E A;  1PH4 A;  4JI1 Q;  1ZEQ X;  1P16 A;  4KV6 A;  1PHJ A;  1STY A;  1EY4 A;  4ME5 A;  3I4M G;  3S1Q H;  2QF7 A;  2F4V L;  2EJM A;  2E74 C;  2EPB A;  2N3S A;  1TS4 A;  3UDI A;  5EAY A;  5EKL A;  3HOW B;  4OXP A;  1K0R A;  5CV7 A;  4JOI C;  4RAU C;  3HKS A;  4QF4 A;  4U67 3;  3J81 L;  1CFM A;  1PZI D;  1XMO L;  1A15 A;  3FVQ A;  4JI8 Q;  2AQ1 B;  1SSO A;  1EQV A;  2F1M A;  3D8G A;  2E5L Q;  1V1O A;  1T5X D;  2NN6 G;  2L12 A;  1G6P A;  1RIP A;  5C44 B;  3PO3 H;  1KRT A;  2K52 A;  1K8O A;  1D7Q A;  1C4Q A;  2VB3 X;  4C2M H;  4KMU C;  1CA5 A;  4A3I G;  2DNE A;  1J5E L;  1UNS A;  3NUC A;  4DR7 Q;  5HUR A;  1GJX A;  4O0A A;  1EU4 A;  1G6Z A;  1U9R A;  2WAQ E;  2IWH A;  3G71 A;  4A3J G;  4KK7 A;  2WII B;  4LF4 Q;  2GN5 A;  1YBY A;  1DGS A;  4A3F G;  2WAC A;  2E8G A;  1SAP A;  3BU2 A;  4K6L A;  4LF6 L;  3TP8 A;  1SND A;  4A93 H;  5HGQ A;  3SK6 A;  3NTI A;  1CSQ A;  2BA0 A;  5DEH A;  4YIJ A;  3S16 H;  4H0L C;  4PV1 C;  1HUN A;  1D1I A;  1VQN A;  4DNI A;  3M4P A;  1IHZ A;  2B63 H;  2UXB L;  1NUC A;  3VR3 A;  2AUK A;  1S5C D;  1FNV A;  2MGS A;  4LNQ A;  3TBI B;  3I7F A;  3QIA A;  2XIW A;  4A3C G;  3HZX A;  4APV A;  4GNX C;  1CQV A;  3PGZ A;  1AZQ A;  2RDG A;  4EGV A;  2Q2I A;  4OWX B;  4RCO A;  1V8Q A;  3S1M H;  4J1M A;  4IFD I;  2NWG A;  1LT3 D;  1NAP A;  2A74 C;  3T1Y L;  3RD4 A;  3C1F A;  2N55 A;  3UI2 A;  4R4T A;  1SNP A;  5JJK A;  1PYW D;  1PMR A;  2LXK A;  4JG2 A;  1TWA H;  5EPK A;  4JI3 L;  4KKS A;  2I46 A;  2BE5 C;  2D9U A;  4CJ2 C;  3CRK C;  3M7G A;  2L0C A;  5I2X A;  4LFA L;  1B44 D;  2JA8 B; 
#chains in the Genus database with same CATH homology
 2VZA A;  2JA9 A;  1WCM H;  1M90 C;  4IPC A;  4P73 A;  1QUQ B;  4DUZ Q;  5LMN L;  1VQ6 A;  4DR5 Q;  4QJF A;  2I5L X;  3GTM H;  4UY8 C;  4XTC S;  3FKI H;  2E2J H;  4IJL A;  4R4O A;  4DUY Q;  2MO1 A;  2BH8 A;  3D0F A;  1OXX K;  2PQA B;  1VQ9 A;  1YI2 A;  5M5X H;  1HR0 Q;  1MJC A;  2WB1 E;  4GN4 B;  3CC2 A;  1IL2 A;  2JA7 G;  5GQO A;  1YJW A;  3S2D H;  1KAW A;  5M3M G;  2E5L L;  4AQY L;  1I5F A;  1N36 Q;  3JC6 6;  3CCU A;  1GD7 A;  4A3M H;  3PUX A;  3PV0 A;  1I50 H;  3J80 i;  4DV1 L;  2I5H A;  1JJ2 A;  2ES2 A;  4A3G H;  4YWK A;  4AH6 A;  1CKN B;  3I4N G;  4JYA L;  4ALP A;  4KHZ A;  5IY0 A;  4GNX A;  4B3T Q;  4H02 A;  1VQD A;  2XGT A;  2RHS B;  3HKZ E;  2RCN A;  1IBM L;  1VQE A;  5IYC G;  1HH2 P;  1X55 A;  4B3R Q;  2IY5 B;  3RZO H;  1BBW A;  3DLL A;  4LUV A;  2Y0S E;  3EN2 A;  4LF8 Q;  1A62 A;  4GN5 A;  4C3H H;  3B6Y A;  4GLX A;  2AHO B;  4NXN Q;  1IBL Q;  2AWN A;  4AYB E;  3E9H A;  2OCE A;  4L5Q A;  4LFC L;  4DV2 Q;  3M9B A;  1AE2 A;  1NBW A;  1SRO A;  3GDE A;  4AIM A;  5IE8 A;  1UE7 A;  4B3M L;  1Q8K A;  4R4Q A;  2AMC B;  5IYB G;  2N8N A;  2UUB Q;  1Q82 C;  3J81 i;  2YU9 H;  4IOA A;  3OTO L;  2R7Z H;  1I6H H;  3GTJ H;  2F4V Q;  4KHP Q;  1PA6 A;  1PFS A;  5J3B A;  1PH2 A;  1YHB A;  1JT8 A;  1OTC A;  3H15 A;  3KF6 B;  2NN6 I;  2GVB A;  4A3K H;  5FLX c;  1J6Q A;  1Q1E A;  2ID0 A;  1UE6 A;  3ERS X;  4YWM A;  5IYD G;  1SE8 A;  1U0L A;  1VQF A;  3PIO A;  4C3I H;  3ULP A;  3AFQ A;  3CP0 A;  2VUM H;  4DR6 Q;  3KJP A;  4J15 A;  1MIU A;  4YCW A;  2MNA A;  2HIX A;  3E9I A;  4QL5 A;  4X66 L;  4DK3 C;  4OO1 G;  3ULL A;  4BXX G;  2OTJ A;  1HNZ Q;  4DV6 L;  1FJG Q;  4UP7 A;  2UU9 L;  4BBR H;  1B8A A;  4A3B H;  1XMO Q;  1GO3 E;  1TXY A;  2ZJR A;  4HJ9 A;  4X6A H;  3PIP A;  2HHH L;  3H3V I;  2AKW B;  4GKJ L;  1S40 A;  3L7Z C;  2YV5 A;  3HOZ H;  2EXD A;  2VQF L;  3KDF A;  4JCV E;  2JA7 H;  1SMX A;  2WB1 G;  1PVO A;  3W5O A;  1N33 L;  1Q7Y C;  2H5X A;  4DV7 Q;  1W3S A;  4OWT B;  5IP9 H;  2A8V A;  2ZJP A;  1X56 A;  2B3G A;  2JA8 G;  1J5E Q;  4JC0 A;  1LUZ A;  2R7F A;  1I94 Q;  4RG1 A;  2IT1 A;  1HZ9 A;  3MEF A;  4LF7 L;  1VQO A;  4A3L G;  1CSP A;  3I4N H;  3CAM A;  4JI0 Q;  3ULJ A;  2IHF A;  2DUD A;  4YWL A;  4LF5 Q;  1XNQ L;  1HNW Q;  1N32 L;  3AYH B;  3CME A;  1X3G A;  2HIV A;  4B3S Q;  1VQJ A;  3HKZ G;  3OW2 A;  4JI7 Q;  1XNR Q;  1LM0 A;  1K8G A;  1L1O C;  2JA5 H;  4BBS G;  1OXU A;  1VQM A;  1WFQ A;  1O7I A;  2OQK A;  3LGJ A;  5C0X J;  3T1H Q;  3FP9 A;  1NE3 A;  1EYG A;  1NY4 A;  4O2D A;  4TVA B;  3HOY H;  1JJC B;  1WYD A;  2Y0S G;  4DV4 Q;  4IPG A;  4DV5 Q;  4WJ4 A;  3RR5 A;  4JI6 L;  4MZ9 A;  2ZM6 Q;  1E24 A;  4JI4 Q;  4LF6 Q;  4AYB G;  1YHQ A;  5FLM H;  1PH6 A;  1U5K A;  1Y1V G;  2QA4 A;  4QQB X;  2RHQ B;  1PYB A;  4DR2 L;  3M85 A;  5BR8 Q;  4NXM L;  2QEX A;  3TRZ A;  3K0X A;  2NVY H;  4JBJ A;  2NZO A;  4LFB L;  3S14 H;  2YTV A;  5GRO A;  4DAY B;  4DUZ L;  3PCO B;  2RF4 A;  3S1N H;  2R92 G;  3AQQ A;  3HFZ B;  4A3J H;  1SN8 A;  1E1T A;  4DR3 Q;  2WP8 J;  4LF9 L;  4UP9 A;  2VQE Q;  3DM3 A;  5C0X G;  4A3F H;  4BY1 G;  4MNO A;  3A5Z B;  3A74 A;  3K8A A;  5GAD C;  2ALY B;  3PO3 G;  1EIF A;  4DV3 L;  4DKA C;  1YIT A;  1N9W A;  4PG3 A;  4P75 A;  1A0I A;  4BY7 H;  1QVG A;  1PH8 A;  4HJ7 A;  1S72 A;  1XMQ L;  1WI5 A;  4Y7N H;  4GNX B;  1EWI A;  4PZ6 A;  4A3D H;  2A19 A;  4A75 A;  2I0Q A;  1SFO H;  1GVP A;  1JB7 A;  3HOU H;  4B3T L;  3W1G A;  4DK6 C;  2YYZ A;  5GAH C;  5LMU L;  2UXD Q;  4B3R L;  3CCR A;  4LUO A;  4JI8 L;  1MJE A;  3T1Y Q;  1X65 A;  2DGY A;  4R4I A;  2JA6 G;  4DR4 Q;  1KRS A;  1IBK Q;  1PV4 A;  1NMG A;  2K5N A;  4JI5 Q;  4LF8 L;  1MKH A;  4JBW A;  4HIM A;  3PF4 A;  4GS3 A;  3GTO H;  2UUA Q;  4A3L H;  1HZA A;  4R1J A;  4DV2 L;  4DR1 Q;  4A3C H;  5ELO A;  4A93 G;  3CW2 C;  4QGU A;  1XPR A;  4DR7 L;  1K3R A;  3PSI A;  2I5M X;  1L1O A;  4NPS A;  1Z47 A;  3PUZ A;  4JI3 Q;  4A3E G;  1AH9 A;  4JV5 Q;  4LUZ A;  4OWW B;  1BBU A;  4FDB A;  2B63 G;  5FJ8 G;  3F2D A;  3HOW H;  4IPH A;  5ELN A;  2HQL A;  3M4O H;  4LF4 L;  4X62 L;  4LFA Q;  2K50 A;  5C4X H;  5IT9 c;  1TWF H;  1ASY A;  1E22 A;  3RNU A;  1SRU A;  4JI2 Q;  1YEZ A;  3GTG H;  3H0G G;  2OQ0 A;  2F52 A;  3CCS A;  2K5H A;  5M3F G;  3PO2 G;  2D0P A;  2R93 G;  1FL0 A;  1FJG L;  2ZTE A;  5LMN W;  1UE1 A;  3KJO A;  1XNR L;  1HJP A;  4HIK A;  2KCM A;  3I2Z A;  1VQ7 A;  4HJ5 A;  2L15 A;  3K7U C;  3KYH C;  3KDF B;  3HOX G;  1CUK A;  2UUC L;  1P8L A;  4GLA C;  4AQY Q;  3EIV A;  5JJL A;  5C44 H;  2Z6K C;  1R9T H;  2IX1 A;  2MFI A;  1VQI A;  1G51 A;  4DV1 Q;  4X65 L;  1YJN A;  5M5Y H;  2K14 A;  1X9N A;  2N49 A;  4DV0 Q;  1WJJ A;  2QGQ A;  5C3E G;  1QZG A;  1CKN A;  4LWC A;  1EOV A;  3STB C;  1YHA A;  1IBM Q;  1GKH A;  1N34 L;  1C7Y A;  4GOP C;  1L2F A;  1JJG A;  2V1C C;  4LF5 L;  4JI0 L;  3STB D;  1Y1W G;  1WOC A;  2PNH A;  4B3S L;  3PF5 A;  4K0K L;  2VNU D;  3CQZ H;  3NEL A;  2CCZ A;  1D8L A;  4IFD J;  2LXJ A;  1JE5 A;  2YTY A;  1LYL A;  2JEB I;  4OON A;  2IHE A;  2JK8 A;  1XPU A;  3HOV G;  3M7N A;  2ZTD A;  2R6G A;  1VQP A;  5M3M H;  1ASZ A;  4LFC Q;  3E0E A;  1KL9 A;  4IOC A;  4DV5 L;  4B3M Q;  5C4J H;  3F2B A;  5M5W H;  4POF A;  4OO1 I;  3KLW A;  3G48 A;  4YY3 L;  1K9M C;  1WCM G;  3OTO Q;  4GN3 B;  4IPD A;  3UDX A;  1SR3 A;  2NZH A;  2HT1 A;  4Y52 H;  3RN5 A;  5IYC H;  3UE1 A;  1B70 B;  2PI2 A;  1PH3 A;  3FKI G;  3U4V A;  2CWP A;  4A3E H;  3J7A 5;  2JE6 I;  1A8V A;  3M4Q A;  1PH7 A;  5E7N A;  4ME3 A;  4P72 A;  1EQR A;  5FJ8 H;  1IXR A;  4IFD G;  3UDF A;  5AJ3 Q;  1VCI A;  3NBH B;  2UXC L;  4X66 Q;  2KHJ A;  3KOJ A;  1FGU A;  5IWA L;  2GVA A;  4A3M G;  2ASB A;  2VQE L;  4DV6 Q;  1VQ5 A;  4QIW E;  1PH9 A;  2UU9 Q;  3K80 C;  4A3G G;  1CKO A;  3AEV A;  3ZJY C;  4WJ3 M;  3H0G H;  3GTP H;  3PUY A;  2ZTC A;  3S24 A;  5JJI A;  2VS1 A;  5IYB H;  3GO5 A;  3CPF A;  1QZH A;  2HHH Q;  1IYJ B;  4OX9 L;  4PMW A;  4GKJ Q;  1X3E A;  4IO9 A;  3GTK H;  3KF8 B;  4GKK Q;  3G6E A;  1PH1 A;  4DR5 L;  3BJU A;  5DLQ E;  1TWG H;  1N33 Q;  1S3O A;  2JJQ A;  2FXQ A;  3UDG A;  4L5S A;  2JEA I;  2UXB Q;  4GLV B;  1K83 H;  4DUY L;  1KC8 C;  2Z6K A;  3F1Z A;  1GM5 A;  3KFU A;  2UXD L;  3AFP A;  4PZ8 A;  1HR0 L;  4UPA A;  1XPO A;  2YTX A;  5IYD H;  1VQC A;  1YNX A;  4YCV A;  1KQS A;  1E1O A;  1XTD A;  4DAM A;  2AWO A;  4KLK A;  1N36 L;  1IBK L;  2Q2H A;  2KEN A;  4BXX H;  1N32 Q;  1YJ9 A;  3S15 H;  3CMA A;  1NTG A;  4BA2 I;  4GOP A;  1PYS B;  3TQY A;  1VQ4 A;  3W1B A;  2Q2U A;  3Q8D A;  4YHH Q;  1V43 A;  4RMF A;  4DR1 L;  1L1O B;  2XTI A;  1Y1W H;  1VQB A;  4HJ8 A;  2R7Z G;  3PUV A;  1C9O A;  4YCU A;  1OXT A;  1VQA A;  1N8R C;  1B7Y B;  3ER0 A;  4TQU S;  1Q1B A;  4BA1 I;  4EX5 A;  2VY3 A;  3RLN A;  3CC7 A;  1EQQ A;  4A3K G;  4JI6 Q;  4JV5 L;  4X64 Q;  1V1Q A;  5JEA J;  1V9P A;  3I4O A;  4HID A;  1EFW A;  1Y14 B;  1Q86 C;  2VUM G;  3K7A H;  4DR2 Q;  2EQS A;  1Z9F A;  4MTN A;  2JA8 H;  1UE5 A;  2KHI A;  4EQ5 A;  1YVC A;  2VL6 A;  3CPW A;  4NXM Q;  4POG A;  1C0A A;  2MO0 A;  4NXN L;  1IBL L;  3D31 A;  3UE0 A;  4LFB Q;  5K36 G;  1Q46 A;  2CWA A;  4JI2 L;  4BBR G;  3CF5 A;  4A3B G;  1G29 1;  4JI1 Q;  1PH4 A;  1KHI A;  1EUJ A;  1P16 A;  1OXV A;  4NB3 A;  1PHJ A;  2UUB L;  3F8T A;  1HNX Q;  3I4M G;  4BBS H;  1E3P A;  3CCL A;  4LF9 Q;  3HOZ G;  4DPG A;  1FVI A;  3RN2 A;  3S1Q H;  3CCE A;  2F4V L;  2Q2T A;  4KHP L;  1NMF A;  3UDI A;  2N3S A;  4DV3 Q;  2B29 A;  2PMZ E;  3A0J A;  5EAY A;  2E2I H;  5IP9 G;  2OWO A;  1HR0 W;  3M3Y H;  5IP7 G;  1XMQ Q;  3CC4 A;  4OXP A;  4C3J H;  1K0R A;  5JEA G;  2ZJQ A;  1Y1V H;  1E7Z A;  2D62 A;  4JOI C;  3HKS A;  5LMN Q;  3CD6 A;  4DR6 L;  1Q12 A;  3PUW A;  2EIF A;  3U50 C;  2K75 A;  3RLF A;  3JAM c;  4DV0 L;  3J81 c;  1HNZ L;  1QUQ A;  5LMU Q;  1QVF A;  3S17 H;  1XMO L;  4L5R C;  5GAG C;  2JA5 G;  2R92 H;  4JI8 Q;  2VW9 A;  2E5L Q;  2PQA A;  3CCJ A;  2NN6 G;  3NEN A;  3HOY G;  1K8A C;  1G6P A;  1QVC A;  4BY1 H;  4IJH A;  1RIP A;  2OTL A;  3FHW A;  1K73 C;  1KRT A;  1YZ6 A;  2K52 A;  3PO3 H;  4DV7 L;  2CQO A;  1D7Q A;  2BA1 A;  5FLM G;  4JYA Q;  4C2M H;  5H1S E;  4A3I G;  1J5E L;  4DR7 Q;  1I94 L;  1OXS C;  4O0A A;  1BVS A;  1JMC A;  3JAM i;  3L2P A;  2BH2 A;  1HNW L;  1RL2 A;  3OYY A;  4KI0 A;  1CKM A;  1SLJ A;  2F3I A;  2KBN A;  2WAQ E;  1X3F A;  2Z0S A;  1X6O A;  3G71 A;  2MQH A;  4A3J G;  1M1K C;  3A5U A;  2JQO A;  1AE3 A;  3BZC A;  4LF4 Q;  4X62 Q;  1XJV A;  1EIY B;  2GN5 A;  3GD7 A;  3IRB A;  1YBY A;  1DGS A;  2K5V A;  3T1H L;  4A3F G;  2JA6 H;  2E8G A;  3BU2 A;  4DV4 L;  1TWC H;  3VDY A;  4BY7 G;  5AJ3 L;  3CCM A;  2ZM6 L;  1BKB A;  4JI4 L;  4LF6 L;  4P74 A;  3I56 A;  1VQ8 A;  3CCQ A;  4HJA A;  2PI2 E;  4A93 H;  2NVT H;  4A3D G;  5HGQ A;  4XIG S;  3J7Z C;  5BR8 L;  1CSQ A;  1UWV A;  2BA0 A;  4QY7 A;  5GAE C;  3F2C A;  3HOU G;  2UUC Q;  3G4S A;  3SGI A;  3S16 H;  2WFW A;  2NVX H;  3I4M H;  1LTL A;  4GKK L;  1VQN A;  4DNI A;  1KIX A;  3TS0 A;  3M4P A;  4X65 Q;  3KF6 A;  2B63 H;  2UXB L;  3TRE A;  4DR3 L;  5IP7 H;  2D0O A;  1W2B A;  3GTL H;  4LNQ A;  1UEB A;  3MXN B;  4JBM A;  4JOI A;  1N34 Q;  1HZC A;  3I7F A;  2R7D A;  3NEM A;  2CFM A;  4A4I A;  2LSS A;  4GOP B;  2N78 A;  4APV A;  4A3C G;  5M3F H;  4GNX C;  3PO2 H;  2R93 H;  4HIO A;  3PGZ A;  4K0K Q;  4PZ7 A;  2IX0 A;  3U4Z A;  4LW1 A;  1VQL A;  2VQF Q;  1VQH A;  3J81 j;  3BZK A;  2A1A A;  3I55 A;  4YHH L;  1VS0 A;  2Q2I A;  3EBE A;  4OWX B;  3HOX H;  1TWH H;  1A63 A;  3HOW G;  2KCT A;  1VQK A;  3S1M H;  4IFD I;  1PH5 A;  2NVQ H;  3RLO A;  1HZB A;  4LF7 Q;  5C4X G;  1I3Q H;  4X64 L;  4JBK A;  4YY3 Q;  1T9H A;  3T1Y L;  3K81 C;  3GTQ H;  4DR4 L;  2ATW A;  2C35 B;  1XNQ Q;  3CCV A;  4UP8 A;  4JI5 L;  5C3E H;  4A3I H;  3ICE A;  1L0W A;  2UUA L;  4R4T A;  5JJK A;  4JI1 L;  3L0O A;  3H3V H;  2LXK A;  3S2H H;  2WAQ G;  4JG2 A;  3CXC A;  1TWA H;  3TEH B;  3U58 A;  5HY6 A;  4JI3 L;  1Q81 C;  1HNX L;  3WWV A;  1H95 A;  1KD1 C;  2UXC Q;  5C44 G;  5IWA Q;  1X54 A;  3HOV H;  4L5T A;  5C0X I;  2E2H H;  4P71 A;  4A76 A;  3RZD H;  1NJI C;  1IZ6 A;  3S1R H;  3J80 c;  1KXL A;  4R4C A;  1YIJ A;  2K4K A;  2CKZ B;  4JI7 L;  1VQG A;  4LFA L;  4OX9 Q;  3TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...