1FGBD

Toxin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B SUBUNIT PENTAMER
publication title The 2.4 A crystal structure of cholera toxin B subunit pentamer: choleragenoid.
pubmed doi rcsb
molecule tags Enterotoxin
total genus 21
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fgbD00
1PRTD 2IPKD 2WV6D 1LT5D 1S5DD 1ET6A 2AQ1B 1LT4D 1LTAD 1KTKA 1AN8A 5I4DA 4DXGA 4RCOA 3CHBD 1FNVA 1CHPD 1D5XC 1RDPD 1G8ZD 1HQRD 1XXGA 1BCPD 4RHSA 1EWCA 4ZYSA 2NTSA 1PZID 3OWEB 1LTRD 1V1PB 1XTCD 4RFBA 1I4HA 1TS2A 4L63B 1ET9A 1PTOD 1EEID 3BYYB 2RDHA 1S5ED 5D3DA 1KLUD 4RHRA 1ESFA 1SE3A 1I4XA 1CQVA 3EA6A 1JWUD 4K6LA 4OHJA 1UNSA 3R2IA 1LT6D 3TSSA 1HTLD 5ELBA 2XN9C 1STEA 1V1PA 1PRTC 1PRTF 1LT3D 3DWAA 3DWPA 4L6TB 2CHBD 2TSSA 3EFXD 5FK9C 1JWMD 1FNWA 1I4QA 1D5ZC 1S5BD 1LTBD 1MD2D 2RDGA 3MC0B 1PRTB 1B1ZA 1EU4A 1TY0A 1L0XB 1SE2A 1LLRD 1KLGD 1TS3A 1I4PA 3W2DA 3SEBA 1BCPC 1BCPF 4UDUC 1SJED 1PYWD 2SEBD 1TY2A 1UUPA 1V1OA 1AW7A 1SXTA 3V05A 1PZJD 1BCPB 1FGBD 5D3IB 1LTTD 5ELFA 1EEFD 1PTOC 1PTOF 1S5FD 1D6EC 1S5CD 5FKAC 1I4GA 1TS5A 5ELDA 1B44D 4DXFA 1JQYD 1RF2D 3BZDB 1T5XD 1DJRD 2XRQD 4RH6A 3GP7A 2QILA 1L0YB 1DYQA 3R2TA 1F77A 3R8BA 1EU3A 2XNAC 2R61A 1ENFA 1GOZA 2XRSD 3O13A 1CHQD 5ELEA 1JR0D 1SJHD 4RGNA 1FD7D 1SE4A 3BYTB 2Z8LA 1JWSD 2AQ2B 2IJ0A 3BVGA 2O2LD 3MFGA 4O1NA 1HXYD 1LTGD 1PTOH 1D5MC 4BWGB 2AQ3B 3BVMA 1RCVD 1PTOB 1HA5A 4TSSA 1BXTA 2G9HD 3KLSX 5ELCA 1LTSD 1JCKB 2J4XA 4C56C 2NTTA 3BVZA 1LO5D 1SBBB 1TS4A 1LTID 3DWQA 1EFID 1RD9D 1CK1A 2QEJC 4RGMA 3URYA 1M4VA 4Z9CB 4RGTA 1I4RA 1PZKD 1QILA 2ICIA 4RGOS 1SEBD 5TSSA 1FNUA 1CT1D
chains in the Genus database with same CATH superfamily
2JA5G 2IPKD 3T51B 2JA6B 3BDCA 1VQ9A 4M1UB 4MNOA 5IYCG 4O42A 1X32A 4X3TA 2VQEL 5JPMC 3Q23A 4UHVA 1YNXA 5DM73 2YV5A 2AWNA 1HNZL 2NZ1D 4WJ4A 2E2IH 3S1MB 3KF6B 3H6MA 1AE3A 1EEID 3OOCA 2LSSA 1PH4A 1XPOA 1EUJA 3MXPA 4DK1A 4V0BA 3NUCA 1IYVA 3VR4A 1WCMH 4OIKA 2EYMA 5CV4A 5ELBA 5IGFA 4YCUA 3A55A 4WJ3M 4IPGA 1XNRQ 3LWEA 1PRTC 3KF6A 3M4OH 2F0TA 2VQFL 4L5TA 1Y8NB 3J80L 1V1QA 2JK8A 4AH6A 5C3XA 2NB0A 3HOZG 1VQLA 4C1NK 4LAAA 3RUZA 1EYCA 3D4DA 3F2UA 4F8MA 4DV0Q 2E74C 1X9NA 1KABA 3D8GA 1WI5A 4KY7A 1I3QB 3OYYA 4DUZL 5D3IB 2R7ZB 2FHTA 2PQAA 1BR9A 2RCNA 3G7LA 3J7A5 5I9PA 5C4ZA 5ELDA 5C4JB 4JV5L 4DR6Q 2IX0A 1KHIA 3E9HA 4IUNA 1X55A 2QEXA 3SDZA 4AYBE 4O0AA 1C7YA 1E22A 2D62A 3RNUA 1PFSA 1XPRA 3I7FA 3W1BA 3T53B 1A2TA 2R61A 1IYUA 4JBJA 4MIUA 4A3KG 2PYKA 2NVQB 3MEFA 2IJ0A 2D2CC 2LFNA 5HGQA 4RWSC 1YNND 1LTLA 1NCVA 1XYIA 4LF7L 1PH3A 1PTOH 1TWAH 3PQIA 1TU2B 2AUKA 4N9TA 3TZUA 4QB4A 2PMZE 1WTHA 4PV1C 3C3LA 2BA1A 4A3DG 4GNXA 2VQFQ 2UXBL 4ZLTF 1LTID 2CWPA 5M3FH 3A5ZB 1HFNA 4C3JG 3NWSA 4AIMA 1M90C 1VQ8A 4DUZQ 1I6VC 1VQ7A 1EL0A 1TWHB 2WV6D 3VDYA 4LJZC 1B9MA 3P20A 1JORA 4OWWB 1TIID 1VQBA 4JI7L 2F0HA 3PUWA 1HQRD 5EJWA 4DR3L 4KJOA 4BA1I 4JI0L 4DU9A 1SR3A 3HOVG 1SLJA 3K5OA 5DLQE 2F0JA 1JWUD 3U58A 3DLLA 5IYBH 4DR7L 1E2ZA 3B6YA 3J81j 1UNSA 3IL8A 4GOPC 3A7AB 4G57A 4DFAA 5EBDA 3HOUG 4K8IA 3QWNA 3DWAA 3IAYA 1FNWA 1O7IA 1B2TA 1MD2D 5EQ0A 1B1ZA 2UUAQ 1Q1BA 4A3FH 1EIYB 2JJQA 1S3OA 1MJEA 3I91A 5IT9c 1A3TA 4ABNA 1PYSB 2R7ZH 2K6AA 4G4KA 2HT1A 4NXNL 1LTTD 2BCOA 4G7HC 1HNXL 1EWIA 5C4JH 1N9WA 4IURA 4J6HA 1D6EC 1HZAA 2B2YC 1KDCA 1SMXA 1E1OA 1N32L 3LWUA 3AFQA 4DV5Q 3HGBA 4DR3Q 1C9OA 1UWVA 3NXWA 2FMMA 3S15B 4UY8C 1Y1WG 2Q8RE 2GVBA 2GN5A 1QE6A 1XPUA 4YCWA 2B8FA 2XGTA 1CKMA 1N33L 2NVQH 2F0GA 4RMFA 1R9TB 4A3GB 4B3RL 5ELEA 2KHIA 4C3HG 4DV6L 4A3JG 4LF9L 1UEAB 4LF8Q 1X56A 2F0WA 3CU7A 1D5MC 3CRKC 2AQ3B 1K8MA 4B08A 4TSSA 4XXEA 2DY8A 2A5HA 4U673 2IY5B 3MHBA 2C35B 4DN4M 1TWHH 2IL8A 1PV4A 4LFCL 4NXNQ 4GN3B 2IW3A 2L11A 1GD7A 2IX3A 4NB3A 1AN8A 2B2VA 2E8GA 2K5NA 2MPMA 1N32Q 4U68A 3G4SA 3X3NA 5LL6X 1EY0A 3CCSA 1X3QA 3SHLA 4FO2A 5I9OA 3OWEB 5D65A 1QCBD 3D4WA 1UE5A 4X3SA 3S1RB 3CMEA 4OL7A 1WTXA 5FOBB 4B3RQ 1OXTA 2DUDA 4POFA 4HJAA 1CKNA 5I2YA 1EY5A 5LMNL 4HIOA 3I56A 3FKIG 2PI2E 2Z4HA 4WJWA 2ICEC 3I4LA 3ICEA 2D9UA 3MFYA 1OXXK 4DV1Q 1VDZA 1WD0A 1LT3D 1DONA 3VA7A 4J8QA 4JOIC 3P7JA 2E5LQ 4UDUC 2UUCQ 1XTDA 1U4PA 4CJ1B 2O5IC 1IXRA 1Y1VG 1PZJD 2UXDQ 1BBWA 2EJGC 4BBSB 1PTOC 4Q5VA 5JJLA 4XT3B 5FKAC 4DAMA 4A3BB 1L1OC 1JC7A 1EOTA 1B44D 3DXJC 3S15H 4A3EG 1JQYD 2VB2X 1BO0A 4BY1B 5GQOA 2R93B 1PH8A 4ILWA 2Y0SG 1U4LA 2JA7G 1R9TH 4A3GH 2I5LX 2J7ZA 5LMNQ 1YNJC 1NAPA 4KY6A 3H3VI 4R4OA 4KKUA 1GXDC 4YCVA 1EQVA 2EVBA 1HZ9A 4CKEA 1I6HB 1I50B 1QJOA 2DNEA 2G5DA 4OXPA 3X3MA 2IHEA 5LMNW 1BXTA 1VQDA 3BVZA 5IT9E 3OIQA 4OO1I 2RQXA 5KIXA 3A8JE 1EIFA 4FF4A 1X3EA 4DV2L 2OTJA 4G7ZC 4B3ML 4HSVA 1QUQB 1Z47A 4KD3A 4DNTB 1EQTA 4B3TL 4BY7H 4DK0A 4X66Q 3ER0A 1IKMA 3AEVA 4PQXA 4A93B 1Y8OB 1JJ2A 4KN4C 1HUNA 1H9RA 3PO3G 3MXGA 3PV0A 3CHBD 1C48A 2L1BA 4GKJL 1EWCA 2RVLA 4GN5A 1PZID 5FJ8H 1KQSA 1ESRA 3STBC 5JJKA 3PUYA 4JI3L 1YJNA 3GV6A 3NTIA 4XYOA 2X6LA 5M5YH 5IP9H 3T1YQ 2D5DA 3A0JA 3MXUA 2K14A 1G6ZA 2R92H 1CQVA 1K3BC 1TQOA 2KHSA 2BH2A 4LFBL 4PMCA 1ZEQX 1BBUA 4A3MG 2A69D 3S17B 3FRPB 1Q7YC 3GTMB 4FXDA 4H0LC 3I73A 1YJ9A 2DJFC 5GADC 3SXHA 1HTLD 5M9OA 2TMPA 1SMYD 2L12A 1I5FA 1Q46A 2ZM6L 3CC4A 3OIPA 2EY5A 1E3PA 1S5BD 3U4ZA 3MAQA 1D5ZC 4DV2Q 1W2BA 4LNQA 4NP5A 1GUTA 1KLGD 1I4PA 4B3TQ 3T1HL 2IX1A 3I4MG 4YY3L 2XVSA 3SK8A 1OXVA 1Q3LA 1B4OA 3RZOH 1JE5A 4MN3A 4BBSH 1T9HA 5A2QL 2PMZB 2NBFA 4A3BH 2RDFA 2K5DA 3SK4A 1S40A 3TP6A 4OX9L 1H9SB 2FINB 2LXJA 4GKJQ 3PF5A 2ZTEA 3M3YB 1T5XD 2R93H 1F2MA 3ERSX 1NTGA 4K5WA 2R7FA 3R93A 1J5EQ 2BE5D 2JP1A 4JI4L 4BBRB 2K33A 1IBKL 3N52A 1JOOA 4ME3A 2F4VQ 1V8QA 4JI2Q 4A3LH 4FF3A 3BYTB 4FVMA 1LM0A 5F2DA 1JWSD 4XIGS 1IBML 3S16B 1ZKOA 1I50H 5AFWA 3CCVA 4O1NA 1WOCA 1XMOL 1QVFA 4BXXG 1WTQA 2ZTDA 4FF2A 1WVLA 1JICA 3ULPA 2PO4A 3C1EA 1A8VA 1JOKA 4JBMA 1EFID 2DNCA 1M4VA 3KLRA 4HJ7A 2LMCB 3DHQA 3OSOA 3PUXA 1FNUA 3A5UA 4A93H 2NYZD 1K3RA 3Q24A 2OEOA 1BUVT 1S4ZA 1VMPA 2CW0C 3HRZC 1G2SA 4UP7A 3I4OA 1IYJB 3F1ZA 3I2ZA 2A68D 1KRSA 3EROA 2Q2TA 3J7ZC 4JI8Q 3ERQA 1RDPD 2F3VA 2C9OA 2JQOA 1EYAA 2AWOA 1HCZA 1L0WA 2NN6H 2WAQE 2WKDA 2RSNA 3S17H 2CQOA 3EA6A 3K7AB 1OTCA 4ZKBB 3V96A 1ZYRD 2F0EA 2CH4A 3R2IA 1VF5C 1YVCA 4Y7NB 5I2XA 2EYPA 1STEA 4E6IA 1TR5A 1UEBA 1B7YB 4LUVA 1JMCA 5C3EB 1I4QA 1Q90A 2EY2A 2BOSA 1F9PA 5LHY1 4P74A 3KDFB 2B63G 4K2LA 2KA7A 1TY2A 1FR3A 1H9KA 2K01A 4JYAQ 1TWCB 2JA8G 2K05A 4FXGC 2EYJA 1A62A 5ISRA 3RR5A 1SYGA 2YTYA 1JJCB 1NSNS 2EY1A 1CKOA 3M3YH 1EY7A 4KI0A 1RF2D 1R4PB 1MHWC 3MVVA 1VQMA 5M3MH 4BBRH 3NSWA 4IOCA 4A3IB 1EZ6A 1EU3A 5HGTA 1X6OA 3NENA 4YHHQ 3MXNA 3H0GG 2XNAC 5E1FA 1GOZA 4DGZA 1STNA 1TVXA 2A6ED 5JPNC 1V43A 2MFIA 1GHJA 3S16H 5CYUA 3UE0A 3U4VA 3GTGB 3BVGA 2OQKA 3GV3A 1E0BA 2WB1G 4BWGB 1K73C 3PIOA 1G2TA 3KLSX 1LTSD 2SDFA 1RTOA 2NTTA 1NE3A 3M85A 4IPCA 1SBBB 2UXCL 3EJIA 1DXMA 2PW5A 4Z9CB 3SE0A 3JAMi 1O78A 3K0XA 2R3ZA 2IWHA 5JEAG 4QGUA 4DV3Q 4CKCA 2JEAI 2I07B 5C44B 2B2UC 1E1TA 1S5DD 1ET6A 1WCMG 3T13A 1HFGA 5FO8B 4CJ2C 3D4RA 1BCPD 4PG3A 1TT2A 4DV4Q 4NXML 4NKLA 5CMDA 4DNRB 3PO2H 1VF7A 4OGQC 2RDHA 3PUVA 4IFDH 3K7AH 3PSIA 2OTLA 2DN8A 2V1CC 4IPHA 1E2VA 1HTPA 1MKHA 2E75C 3CCRA 5M5WB 4GZYC 1IBLL 5JEAJ 1K83B 5EBCA 3IFDA 5C3EH 2UXCQ 4Q0FA 2PW7A 3S9WA 1EZ8A 5IYDH 3MC0B 3UDFA 2RDGA 4ZUIA 1EY9A 1BCPF 3D6CA 1SJED 2D0PA 3E0EA 5FLXc 1TWCH 1AP0A 5KNBA 4KK7A 4JK1C 2HD3A 1S5CD 2WINB 3K80C 2PQAB 1HNWQ 1STHA 1DJRD 5FO7B 4A3IH 2E2JH 4L5SA 1PMRA 2L15A 2YU9H 1SNCA 3U50C 1PYBA 3VYSA 2B2WC 2IHFA 2HIVA 1A6XA 1AZQA 3J81i 5M3FG 2XRSD 4A3KB 2Z6BA 2EE1A 2ZT9C 1U4RA 1ONLA 2AQ2B 5T1IA 2KCCA 2ZXRA 2VXWA 5K36H 2VQEQ 3G6EA 3IKJA 3IRBA 5CV6A 4MTNA 3VR5A 2A19A 1HNZQ 1WTWA 3K58A 1TWFH 4A75A 2OWOA 4DR2L 3CCMA 3TS0A 1SAPA 4GNXB 2RF4A 4K5XA 1KL9A 4X65L 2UUBL 3EIVA 1I4RA 2SNMA 1CM9A 1QILA 3QJYA 3BDOA 4JW0A 5C44H 3VYUA 2RSOA 2JN4A 3TZDA 4A76A 1SYEA 3H94A 4KHPL 3K6OA 5JAVA 2KENA 1B53A 3CC7A 4HIDA 4KKSA 2C5CA 1G8ZD 3KBGA 3CCUA 4ZQ3A 5IGGA 3LNNA 1VQPA 5I6WA 5D3DA 1DGSA 1QZGA 5LL6S 4A3FG 1HH2P 4JG2A 2JA6H 5EKLA 2R7ZG 4OONA 1Y8PB 5M5WH 1KC8C 4EQPA 1VQJA 5IP7H 1PH1A 4JV5Q 4A3CH 2AUJD 1B50A 1J9OA 3MA2B 1JWMD 3S1MH 1W6JA 3K5MA 3Q0AA 2EPBA 2F0NA 3CF5A 2MJ8A 3J80i 2SEBD 1Z9FA 1V1OA 1BCPB 1FGBD 5ELFA 2RCFA 1P16A 1XNQL 2Q2UA 3CP0A 1HZBA 2WIIB 1K0RA 4LF7Q 5JOBA 2B8GA 2HIXA 3K59A 2UXBQ 2EDGA 2EOTA 3HOXB 1Y1WB 2Z6KA 1GO3E 1DYQA 3R2TA 4DKAC 4CJ0B 4MTKA 1YI2A 2AHOB 4FP5D 4ZK9B 4A3KH 4DR4L 3NP8A 1GUNA 5C5LA 1GVPA 4N8FA 2LXKA 4C3HB 2K4KA 1SJHD 2HDLA 1WJJA 2DGYA 4R8IA 4A3JB 1I3QH 2KBNA 4RCNA 2CFMA 3C46A 4IUQA 1UE6A 2BDOA 2O5JC 1HXYD 4JI7Q 5T1GA 1XJVA 1FL0A 2KHJA 1SYBA 5BR8L 5ELCA 4ODGA 1AZPA 4JI0Q 3I4NB 2WAQB 3J7AF 4LWCA 1W3SA 1WTPA 5FLXE 2F0DA 1F9QA 1YHAA 1D2BA 1UE7A 1BNZA 1II3A 3S2DB 3CAMA 3M9BA 4P75A 3FPPA 1HR0L 3K5LA 4TRDA 4DR7Q 4YWLA 1RTNA 1PRTD 2OCEA 3PIPA 2B2TA 1F2YA 1D8LA 3NQIA 1Q82C 4KHZA 4KV6A 1VQKA 5IODA 2F0IA 2Q2IA 1KXLA 4JI1L 4L5RC 3QG1A 5JVH3 3WDNA 4JC0A 3HOWB 1K8OA 1HNXQ 1CKNB 2H5XA 2E2HB 4RAUC 5C4HA 5C0XH 1WTRA 2PPBC 3FPUB 4XQNA 1EY4A 1HZCA 2LY7A 2A69C 5H1SE 2EJMA 1PRTF 2E76C 4B3SL 2YTVA 1SROA 3NHHA 4IPDA 1TS3A 1N33Q 5M5XB 2ALYB 1HR0Q 3K5NA 1GHKA 3E9IA 2BA0A 5CV7A 3CQZB 4IUTA 4M8AA 1Y1VB 4CGYB 4DV6Q 4LF9Q 1AFPA 4HAEA 4GN4B 3HOYG 2KCNA 5FLMH 1EEFD 3I72A 4EX5A 3FVQA 1TKWB 1B9NA 1HPCA 2ZJQA 2HCCA 1OXSC 1SFOB 4DK3C 4A3EB 5DNFA 3HOXH 1HR0W 1BQQT 1H9MA 4DXFA 3CMAA 4P71A 1PLFA 1L0YB 1EOVA 1E2WA 2Y0SB 2JA7B 1KAAA 2PZWA 4C3HH 1A3VA 3A74A 3M7GA 4N8X1 4DR5L 4LFCQ 2BE5C 1Q8IA 1D1IA 4BY7G 2YYZA 3OHXC 2BH8A 1EYGA 4LFAL 3MFGA 3M4YA 3LGJA 3WWVA 2PZUA 4P2CB 1F9RA 2K5VA 3F2BA 4K8JA 4KKTA 3I4NH 3VR2A 3J81c 4AQYL 5C4XB 1EQRA 1A0IA 4C1NI 3DEOA 5FJ8G 3S2DH 3M4QA 2FFKB 1I94L 3SK6A 1A2UA 2K1BA 5IP9G 5HY6A 1PHJA 5TSSA 1FYCA 2R92G 3G71A 3HKZG 4KMUC 3PO3B 1LTAD 2VUMB 3PCOB 4X3KA 1FNVA 3KF8A 3PIO3 2QF7A 3AU7A 1HHVA 2A74C 5BN4A 3CPFA 4X62L 1OXUA 1KD1C 2N3SA 1ENAA 3A56A 3MZ5A 4H44C 4H7BA 1Q81C 2CQAA 3FHWA 1X3FA 4L63B 3D6WA 1XX8A 3HOWH 1A15A 5E4XA 4JPBW 3QB3A 4KLKA 4DK6C 1HRJA 1SNDA 4A3MB 2VY3A 1JT8A 3PMFA 5GAGC 3UE1A 1Q12A 2E2HH 2N8NA 4X64L 2QCPX 3QIAA 4A3BG 4FYDA 1N36L 3RLOA 2R93G 3DEPA 4PNYA 3HZXA 3S1RH 1IW7D 4XTCS 1PRTB 3BZKA 4K0KL 5M5XH 1L0XB 1CFMA 2DJGC 1K8GA 1SE2A 2H4OA 1PYWD 2UU9L 2GVAA 3RZDB 1VMCA 2XIWA 4A3LG 1SXTA 4EQNA 1E24A 5JJZA 3V2TA 3VR3A 1BOSA 3JAME 1S5FD 1SFOH 3ZJYC 3ONAB 4ALPA 2VZAA 4EQ5A 4A3EH 2L9HA 1EFWA 3AB9A 4K14A 4R8NA 3JC66 4GNXC 4IQZA 1MSHA 3EBEA 2A1AA 3J80c 2A6HD 3PGZA 1VS0A 3K8AA 3SR1A 1SNMA 4RKBA 4B3MQ 2MQHA 1ENFA 4RG1A 3QO2A 1DM0B 4HJ9A 5EKIA 4QQBX 3NTHA 3AMUA 4A93G 2YTXA 4JI5L 2EYLA 2A6EC 4DR1L 3S2HB 2EZVA 1N36Q 3CRLC 5C4XH 3H15A 4BY1H 4YWMA 2G9HD 4ZKCB 4ULLA 1IL2A 2RBMA 4K0KQ 1TS4A 2PNHA 5J3BA 4JI3Q 3C2PA 3DWQA 3CD6A 2NN6G 3WOEA 2UU9Q 2EYHA 4RGTA 1N34L 1NY4A 4IO9A 2ICIA 3L0OA 4LFBQ 5IGDA 1ESFA 1U9RA 1EWHA 2VUMH 1VQHA 4HJ8A 1I6HH 1GUOA 1KTKA 4DAVA 3NPPA 4DXGA 3TP7A 1Y69U 4GLXA 4AYBG 5D14A 4ZYSA 3KBXA 2ZM6Q 4P73A 3BS1A 5CC4A 1LTRD 3OTOL 3N6RA 2ATWA 1I4HA 4BA2I 3Q22A 1F2LA 1PTOD 1PH7A 3T1HQ 4A3MH 4YY3Q 5IT9L 2R7DA 1KIXA 4JI5Q 4IN3A 4ME5A 4CHTB 3J81E 1LT6D 2NZOA 4OX9Q 1ICFB 1TXYA 2ZXOA 1VQGA 3OMGA 3KFUA 3FMCA 2F03A 3DWPA 3OW2A 1YNJD 3TP5A 3UDGA 3W1GA 5M3MG 4JI4Q 1TY0A 4BBRG 4DUYL 3GTOB 3EVQA 1N34Q 1VQFA 4CDCC 1IBKQ 2B63B 2EQSA 2M9VA 1CTMA 3HKSA 1B3AA 4JBKA 3HP3A 1DZ1A 3QOLA 3CCEA 1JB3A 3GTMH 2JA8B 2K32A 1IBMQ 2B2TC 5IGCA 1PTOF 1XMQL 4GOPA 1WFQA 5KEEA 3L3OC 1TS5A 2F0PA 2MO0A 1XMOQ 4YIJA 3K81C 1NBWA 1PA6A 2MGSA 2PQEA 1CI3M 1KAWA 1G51A 2KUMA 4QJFA 1X54A 4HSPA 4ZCKA 1O7YA 1UE1A 2I46A 1YJWA 1Q8KA 4F88A 1FGUA 1X65A 1KDAA 4XDXA 3FP9A 3RLFA 1QNUA 3O13A 3FDTA 1MGSA 2Z8LA 3GTJB 3MXNB 4EQOA 3ND8A 3F2DA 4RA8A 2B2VC 1SYFA 5IGEA 3S2HH 4BXXH 3STBD 1CUKA 1RODA 2WB1B 2B2YA 1Q1EA 2F0SA 4HJ5A 4LW1A 1K8AC 1CZGA 4GKKL 4C56C 2JEBI 3K57A 4LF4L 4DUYQ 4LUZA 5EKKA 2E2IB 1K9MC 2Z4IA 3F8TA 4OIJA 4QMGA 3PO2G 3KLSA 4IFDG 2ENBA 1STYA 4DNIA 4KY5A 3OPOA 1LT5D 1J8IA 3VYRA 1NMGA 3J80E 1PDQA 4X6AH 1L2FA 2XWJB 3I8ZA 1SDFA 3DM3A 3T4AC 3ULJA 4UAIA 3NWTA 1D5XC 5NUCA 4LUOA 4LMQD 3I3CA 1AH9A 5C5MA 4POGA 3E0JA 3A7LA 1YNNC 5C3EG 1NUCA 1QVCA 5LMUL 2JSOA 1ET9A 2EYOA 5IYDG 1S5ED 2QGQA 1KLUD 4RHRA 5HURA 1GKHA 4C3IB 4DV7L 2Y0SE 3PIP3 5IIFA 4OHJA 2JA5B 2JYOA 5J39A 1HUMA 2ID0A 1Z7TA 5GAHC 4KN7C 2I0QA 1G6PA 2XN9C 4IFDJ 1JJGA 4LF4Q 4CBVA 1NR4A 2CHBD 2TSSA 4LK1C 1SYCA 4A3IG 4K6DA 4OEMB 3H3VH 1LLRD 3C1FA 5IOCA 1K0SA 4V190 3F2CA 5J22A 1VQNA 2EXDA 1U4MA 3GTKB 4KTAA 2JA8H 1Y14B 2N49A 2WP8J 2QDBA 4UPAA 5IWAL 1YITA 4Y7NH 2K28A 2SNSA 2WFWA 2L4NA 4HIMA 4OO1H 1KNEA 2HDMA 1XNRL 5CGKA 5LMUQ 3BZCA 2RA4A 3GP7A 3GQBA 3GTLB 2HHHL 1EY6A 4QL5A 1MJCA 3BDLA 1BBXC 2Z9HA 3HOZB 5AJ3L 2A8VA 4QCLA 3ND9A 3GTJH 3K0YA 1JOQA 1SE4A 4KHVA 5DM63 4DV0L 2N88A 4TKOB 5C44G 4XQJA 3GTPB 2BDNA 2VW9A 1PH5A 2N78A 1Q86C 1L1OA 2K50A 3BVMA 4HN7A 1X3GA 4DR6L 4IJLA 1C0AA 5CORA 4NXMQ 5E3FA 1CZWA 3S24A 1RD9D 5JEAH 1CK1A 1PFBA 1B3QA 4RGOS 1SEBD 2KQ3A 2OXPA 3J7YW 5IWAQ 3GTGH 1J6QA 1TWGB 5EGTA 4ZAIA 2JA6G 1NR2A 1IBLQ 1U5KA 1DOMA 1OO9B 5KYLA 5IP7G 3IFTA 4A3DB 4A3CG 2HHHQ 2VS1A 4DPGA 1XTCD 2RHSB 2HUGA 4IUVA 1QVGA 4C3IH 5AJ3Q 4A3FB 4C3JB 4J1MA 1CQFA 2CCZA 3GTQB 1SE3A 1P8LA 4GLVB 2JA5H 3KLWA 1SE8A 2L5TA 4GS3A 5IYCH 3QOJA 4XQQA 3I90A 5IYBG 4CDEC 3CXCA 3KOJA 2B39A 1ILPA 1DOLA 4H02A 2B3GA 3G6JB 3HOVB 3PF4A 4L5QA 3GDEA 3GTKH 5L37A 2Z0SA 3RN5A 1YZ6A 5EPKA 2F0KA 3D3RA 1MSGA 5GROA 3V05A 2H1EA 3CCJA 3NTKA 1BDOA 3ULLA 2V4DA 3M7NA 1VQOA 1K83H 4HCEA 4APVA 2VL6A 3HOUB 4K2KA 3PUZA 3GTLH 5ELOA 3KYHC 1G91A 1O7ZA 2HQEA 4DR2Q 3NEMA 4KJNA 1EIHA 1QOHA 3HOZH 2N55A 4OELB 2UUAL 4X65Q 2UUBQ 2CKZB 4FNFA 4WFN3 3GTPH 1RL2A 4HIKA 2RKSA 3KUPA 4HR7B 3CPWA 4KHPQ 2MUYA 1RHPA 2AKWB 4DF7A 1CA6A 4DV5L 2DY7A 3P1HA 3KJPA 2KVMA 2HQLA 4QIWE 1NMFA 2MHVA 2ASBA 2NUCA 2MNAA 1VQ5A 5A35A 2QA4A 2JXMB 4YWKA 3L9AX 3D0FA 1TWGH 2KCTA 1WYDA 1LT4D 3EQLC 4TQUS 4LF5L 3RD4A 4LF8L 4EVOA 1V9PA 2ES2A 3ZYYX 3VA5A 4A3DH 5ELNA 5C0XG 3VYTA 3Q8DA 1AEXA 4KD4A 3UDXA 3H3VC 1WD1A 1V1PB 2EJFC 5KNCA 4RFBA 4IZ8A 1IL8A 1EIGA 4C3JH 3TN2A 3GTQH 2EYFA 1VQCA 2FMCA 1I4XA 1ML0D 1RJTA 2I5HA 5BN5A 2L55A 3I55A 1XNQQ 1LV9A 2F3WA 5FLMG 2FXQA 3S1QB 3TSSA 3HG9A 5J1ZA 4IUUA 3A8IE 1CA5A 1V1PA 4PZ7A 1AE2A 3AYHB 5G3LD 4HTHA 1GUWA 3HOXG 4JCVE 2CVRA 3EFXD 3HOVH 2WB1E 1C4QA 5CBAE 3JAMc 4S3SA 2JA9A 1YBYA 4DR4Q 2F0VA 5C0XJ 1S72A 5IY0A 2NN6I 5KNDA 1IW7C 3HOYB 3FKIB 2GA4B 4LF5Q 3I70A 5C6AA 2ZXPA 1W6KA 3HOUH 3DMUA 3A54A 5KGUA 5CBEE 5IGBA 3M4PA 2J0TD 4DV1L 1SNOA 5BR8Q 1STBA 3CCQA 1JE4A 2B29A 3EN2A 2F0QA 2WAQG 1B8AA 3I4NG 3TMEA 1F77A 1EY8A 5I6YA 3GO5A 1SMYC 2KJXA 1KNAA 2K5QA 2E5LL 5G3LF 4HCSA 1IZ6A 3MTSA 2F3IA 1KRTA 2UUCL 2A73B 4RGNA 1FD7D 3TS2A 2A6HC 3CCLA 4A3GG 4BY7B 2AMCB 3NQTA 3LX0A 3ITPA 3TDQA 3E5SA 2KCMA 2UXDL 4B9XA 2XWBB 2O2LD 3E3XA 1LTGD 1RCVD 1HA5A 1Y1WH 4Y52H 1VQAA 4JI1Q 3OMCA 1PXUA 2QEJC 4RGMA 1KDBA 1C8CA 5M5YB 4OWXB 1WTOA 3HOWG 1PZKD 4A3JH 4OWTB 2R92B 4UP9A 3HKZB 1YHBA 4HMJA 5IE8A 1FJGL 4H13C 5E7NA 4J15A 1DD2A 1CSPA 4X3UA 2XSCA 3S1NB 4CKBA 2KOLA 5K5PA 1NNXA 1EQQA 3RLNA 4B3SQ 2D0OA 1ILQA 4UP8A 2NTSA 2OT2A 2X6GA 3KF8B 3HFZB 1PFNA 5A2QE 2LS01 5CR3A 4MHEA 5GAEC 4PZ6A 3GD7A 4R4QA 1QNKA 1LUZA 5FLXL 1E7ZA 4X66L 2MO1A 3RZOB 2B2UA 3S1QH 1HQMC 2OF1A 3W5OA 4WRDA 1D7QA 1HA6A 4DAPA 2PCFB 4QUCA 2SOBA 4L6TB 2NVTB 2K7VA 1LTBD 1VQEA 1RKNA 1EU4A 2A68C 1H95A 2WACA 4EGVA 4NMZA 4QY7A 4PZ8A 3W2DA 3T1YL 3SEBA 4DR5Q 3MWYW 1JB7A 3HOYH 3QR8A 4XYQA 3NBHB 1UUPA 2NVYB 3FKIH 1ASYA 3HS0C 4BS9A 1N8RC 1FJGQ 1SSOA 4FF1A 3D31A 2MP1A 4IFDI 1RIPA 4LFAQ 3L2PA 2K52A 5BN3A 4BBSG 4NDXA 2I5MX 1I4GA 3UDIA 3S14B 2XRQD 4ID6A 4CDDC 4AQYQ 2CH4W 1ZYRC 4N9PA 3SGIA 5C4XG 4BY1G 5C3WA 3H91A 4PMBA 1GM5A 3T16A 3NBHA 2EIFA 1VQ4A 1I94Q 1EYDA 3CQZH 3I4MB 1Y1VH 2RHQB 2F1MA 1YHQA 4I65A 5DEHA 5FO9B 3SK5A 2VUMG 3OWFA 2G9DA 5JVG3 4L8JA 4FDBA 2JE6I 4X62Q 1QZHA 4IOAA 4R4TA 1DOKA 2X69A 4CDFC 1QUQA 1GJXA 2KEEA 1QG7A 2JA7H 1J5EL 2B2WA 2IT1A 2K5WA 3RN2A 1HJPA 1PFMA 4O2DA 5KRUA 1MIUA 4P72A 2F4VL 4JI2L 4IUPA 1H9JA 2K04A 1B70B 3TBIB 4X64Q 3S1NH 4I7AA 2NWGA 4RCOA 4AYBB 5CV5A 4ZUJA 4DAYB 1ENCA 4R4IA 4RHSA 5EAYA 3TRZA 5COYA 2QW7A 1SRUA 1VQIA 3BG3A 3RMHA 3SVMA 1Z6HA 4C2MB 2M2LA 5EPJA 4K6LA 4F7XA 3PO3H 4DAYA 3WOFA 4LF6L 2XTIA 2E2DC 5KYIA 4JI8L 3VR6A 2NVTH 5EPLA 1MI2A 2Z6KC 5M3MB 5FK9C 1D1KA 2F0LA 3CW2C 4JVZA 4G7OC 1VQ6A 5CV8A 1LACA 4ZRZA 1X3PA 1STAA 2NVYH 1BCPC 1MBYA 4IJHA 3FEWX 1H9SA 4GLAC 2VNUD 3W3AA 1FVIA 1LABA 4DR1Q 3S14H 2KEDA 4QIWB 3TP8A 4R1JA 3BZDB 3T56B 4GOPB 4RH6A 1GUSA 2VB3X 1U0LA 2EY6A 1CSQA 2QDLA 3K7UC 1LYLA 2ZJPA 1WTVA 3DM1A 2O4XA 3I4MH 1O7LA 3RZDH 1IHZA 1JR0D 2NVXB 4WORA 3P75A 4JYAL 1DCZA 4LF6Q 1QWYA 5DAUA 2P5ZX 2PZTA 3MEHA 4XT1B 1SNPA 4MZ9A 4IALA 3KJOA 3U9OA 2K03A 3R3OA 3CC2A 2PNRC 5JJIA 3OTOQ 3JAML 2WKCA 1YIJA 4NPSA 4YHHL 3H0GB 3UI2A 3URYA 3PO2B 3NE5B 3U9SA 1SYDA 4JBWA 4JI6L 1CT1D 3AQQA 1M8AA 2AQ1B 3OW7A 5I4DA 1A3UA 2ZJRA 1CHPD 1M1KC 1XXGA 1QB5D 2KECA 1YEZA 2ZTCA 4HMIA 3CKIB 1TS2A 1BKBA 1PH9A 1K28A 1A63A 3BYYB 3TREA 4C2MH 4QUFA 2F0MA 4DV3L 1SNQA 4F87A 1XMQQ 1UAPA 1BF4A 4A4IA 3E6ZX 1WCMB 4NW2A 4DA2A 1STGA 4I7ZC 1VCIA 4R4CA 4PMWA 4OO1G 3H09A 1PH6A 2F0FA 3AFPA 1R4QB 2K5HA 3KDFA 2E2JB 3M4OB 2YU9B 2OQ0A 4DV4L 3Q6SA 2F52A 2FJ2A 3NBIA 4JI6Q 1AW7A 2HCIA 2Q2HA 2K75A 2L0CA 3NELA 1BVSA 2F4IA 2M00A 3KK7A 3TQYA 3G48A 4B9WA 3DUZA 3BU2A 3HKZE 2NZHA 4GKKQ 2R6GA 2LKVA 2F0OA 3J81L 2QILA 5C0XI 1TWFB 1F9SA 3R8BA 1ICWA 1ASZA 1PVOA 3GTOH 3NK9A 1G291 2B63H 2EXZA 4FXKC 2CWAA 2Q8IB 1NJIC 1CHQD 4HEDA 2NVXH 3TEHB 1SN8A 5K36G 3HEJA 4QF4A 5CV9A 2Z1CA 1PTOB 1TWAB 1HNWL 3J7AV 1T5EA 1JCKB 1F2ZA 2J4XA 2QKIC 2PI2A 3BJUA 3L7ZC 1L1OB 1LO5D 1ZXTA 3H0GH 2F0UA 4RKLA 1O80A 2CW0D 4JOIA 5M3FB 1PH2A 3A8KE 4K5VA 4C3IG 1XWEA 4DV7Q 1GUGA 1IKLA 4R9WA 4TVAB 5E4WC 2Q8TA
chains in the Genus database with same CATH topology
2IPKD 3T51B 2JA6B 3BDCA 4M1UB 4O42A 1X32A 4X3TA 5JPMC 3Q23A 5DM73 2AWNA 2NZ1D 3S1MB 3H6MA 1EEID 3OOCA 3MXPA 4DK1A 4V0BA 3NUCA 1IYVA 3VR4A 4OIKA 2EYMA 5CV4A 5ELBA 5IGFA 3A55A 3LWEA 1PRTC 2F0TA 1Y8NB 3J80L 5C3XA 2NB0A 4C1NK 4LAAA 3RUZA 1EYCA 3D4DA 3F2UA 4F8MA 2E74C 1KABA 3D8GA 4KY7A 1I3QB 5D3IB 2R7ZB 2FHTA 1BR9A 3G7LA 5I9PA 5C4ZA 5ELDA 5C4JB 2IX0A 4IUNA 3SDZA 2D62A 3T53B 1A2TA 2R61A 1IYUA 4MIUA 2PYKA 2NVQB 2IJ0A 2D2CC 2LFNA 4RWSC 1YNND 1NCVA 1XYIA 1PTOH 3TZUA 1TU2B 2AUKA 4N9TA 4QB4A 4PV1C 3C3LA 2BA1A 4ZLTF 1LTID 1HFNA 4C3JG 3NWSA 1EL0A 1I6VC 1TWHB 2WV6D 4LJZC 1B9MA 3P20A 1JORA 1TIID 2F0HA 3PUWA 1HQRD 5EJWA 4KJOA 4BA1I 4DU9A 3K5OA 2F0JA 1JWUD 1E2ZA 1UNSA 3IL8A 3A7AB 4G57A 4DFAA 5EBDA 4K8IA 3QWNA 3DWAA 3IAYA 1FNWA 1B2TA 1MD2D 5EQ0A 1B1ZA 1Q1BA 3I91A 1A3TA 4ABNA 2K6AA 4G4KA 1LTTD 2BCOA 4G7HC 4IURA 4J6HA 1D6EC 2B2YC 1KDCA 3LWUA 3HGBA 3NXWA 2FMMA 3S15B 2Q8RE 1QE6A 2B8FA 2F0GA 1R9TB 4A3GB 5ELEA 4C3HG 1UEAB 2F0WA 3CU7A 1D5MC 3CRKC 2AQ3B 1K8MA 4B08A 4TSSA 4XXEA 2DY8A 2A5HA 4U673 3MHBA 4DN4M 2IL8A 2IW3A 2L11A 2IX3A 1AN8A 2B2VA 2MPMA 4U68A 3X3NA 5LL6X 1EY0A 1X3QA 3SHLA 4FO2A 5I9OA 3OWEB 5D65A 1QCBD 3D4WA 3S1RB 4X3SA 4OL7A 1WTXA 5FOBB 1OXTA 5I2YA 1EY5A 4WJWA 2Z4HA 2ICEC 3I4LA 2D9UA 3MFYA 1OXXK 1VDZA 1WD0A 1LT3D 1DONA 3VA7A 4J8QA 3P7JA 4UDUC 4CJ1B 1U4PA 2O5IC 1PZJD 2EJGC 4BBSB 1PTOC 4Q5VA 4XT3B 5FKAC 4A3BB 1JC7A 1EOTA 1B44D 3DXJC 1JQYD 2VB2X 1BO0A 4BY1B 2R93B 4ILWA 1U4LA 2J7ZA 1YNJC 1NAPA 4KY6A 4KKUA 1GXDC 1EQVA 2EVBA 4CKEA 1I6HB 1I50B 1QJOA 2DNEA 3X3MA 1BXTA 3BVZA 5IT9E 3OIQA 4OO1I 2RQXA 5KIXA 3A8JE 4FF4A 4G7ZC 4HSVA 1Z47A 4KD3A 4DNTB 1EQTA 4DK0A 1IKMA 4PQXA 4A93B 1Y8OB 4KN4C 1HUNA 1H9RA 3MXGA 3PV0A 3CHBD 1C48A 2L1BA 1EWCA 2RVLA 1PZID 1ESRA 3PUYA 3GV6A 3NTIA 4XYOA 2X6LA 2D5DA 3MXUA 1G6ZA 1CQVA 1TQOA 2KHSA 4PMCA 1ZEQX 2A69D 3S17B 3FRPB 3GTMB 4FXDA 4H0LC 3I73A 3SXHA 1HTLD 5M9OA 2TMPA 1SMYD 2L12A 3OIPA 2EY5A 1S5BD 3MAQA 1D5ZC 4NP5A 1GUTA 1KLGD 1I4PA 2IX1A 2XVSA 3SK8A 1OXVA 1Q3LA 1B4OA 4MN3A 5A2QL 2PMZB 2NBFA 2RDFA 2K5DA 3SK4A 3TP6A 1H9SB 2FINB 3M3YB 1T5XD 1F2MA 4K5WA 3R93A 2BE5D 2JP1A 4BBRB 2K33A 3N52A 1JOOA 1V8QA 4FF3A 3BYTB 4FVMA 5F2DA 1JWSD 4XIGS 3S16B 1ZKOA 5AFWA 4O1NA 1WTQA 4FF2A 1WVLA 1JICA 2PO4A 3C1EA 1JOKA 1EFID 2DNCA 1M4VA 3KLRA 2LMCB 3DHQA 3OSOA 3PUXA 1FNUA 2NYZD 3Q24A 2OEOA 1BUVT 1S4ZA 1VMPA 2CW0C 3HRZC 1G2SA 2A68D 3EROA 3ERQA 1RDPD 2F3VA 2C9OA 1EYAA 2AWOA 1HCZA 2NN6H 2WKDA 2RSNA 3EA6A 3K7AB 4ZKBB 3V96A 1ZYRD 2F0EA 3R2IA 1VF5C 4Y7NB 5I2XA 2EYPA 1STEA 4E6IA 1TR5A 5C3EB 1Q90A 1I4QA 2EY2A 2BOSA 1F9PA 5LHY1 4K2LA 2KA7A 1TY2A 1FR3A 1H9KA 2K01A 1TWCB 2K05A 4FXGC 2EYJA 5ISRA 1SYGA 2EY1A 1NSNS 1EY7A 4KI0A 1RF2D 1R4PB 3MVVA 3NSWA 4A3IB 1EZ6A 1EU3A 5HGTA 3MXNA 2XNAC 5E1FA 1GOZA 4DGZA 1STNA 1TVXA 2A6ED 5JPNC 1V43A 1GHJA 5CYUA 3GTGB 3BVGA 3GV3A 1E0BA 4BWGB 1G2TA 3KLSX 1LTSD 2SDFA 1RTOA 2NTTA 3M85A 1SBBB 3EJIA 1DXMA 2PW5A 4Z9CB 3SE0A 1O78A 2JEAI 2R3ZA 2IWHA 5JEAG 4CKCA 2I07B 5C44B 2B2UC 1S5DD 1ET6A 3T13A 1HFGA 5FO8B 4CJ2C 3D4RA 1BCPD 1TT2A 4NKLA 5CMDA 4DNRB 1VF7A 4OGQC 2RDHA 3PUVA 4IFDH 2DN8A 1E2VA 1HTPA 2E75C 5M5WB 4GZYC 5JEAJ 1K83B 5EBCA 3IFDA 4Q0FA 2PW7A 3S9WA 1EZ8A 3MC0B 2RDGA 4ZUIA 1EY9A 1BCPF 3D6CA 1SJED 1AP0A 5KNBA 4KK7A 4JK1C 1S5CD 2WINB 1STHA 1DJRD 5FO7B 1PMRA 1SNCA 3VYSA 2B2WC 1A6XA 1AZQA 2XRSD 4A3KB 2EE1A 2ZT9C 1U4RA 1ONLA 2AQ2B 5T1IA 2KCCA 2ZXRA 2VXWA 5K36H 3IKJA 5CV6A 3VR5A 1WTWA 3K58A 1SAPA 4K5XA 1I4RA 2SNMA 1CM9A 1QILA 3QJYA 3BDOA 3VYUA 2RSOA 3TZDA 1SYEA 3H94A 3K6OA 5JAVA 1B53A 4KKSA 2C5CA 1G8ZD 3KBGA 4ZQ3A 5IGGA 3LNNA 5I6WA 5D3DA 5LL6S 5EKLA 1Y8PB 4EQPA 2AUJD 1B50A 1J9OA 3MA2B 1JWMD 1W6JA 3K5MA 3Q0AA 2EPBA 2F0NA 2MJ8A 2SEBD 1V1OA 1BCPB 1FGBD 5ELFA 2WIIB 5JOBA 2B8GA 3K59A 2EDGA 2EOTA 3HOXB 1Y1WB 1DYQA 3R2TA 4CJ0B 4FP5D 4ZK9B 3NP8A 1GUNA 5C5LA 4C3HB 1SJHD 2HDLA 4A3JB 4R8IA 4RCNA 3C46A 4IUQA 2BDOA 2O5JC 1HXYD 5T1GA 1SYBA 5ELCA 4ODGA 1AZPA 3I4NB 2WAQB 3J7AF 1WTPA 5FLXE 2F0DA 1F9QA 1D2BA 1BNZA 1II3A 3S2DB 3FPPA 3K5LA 4TRDA 1RTNA 1PRTD 2B2TA 1F2YA 3NQIA 4KHZA 4KV6A 5IODA 2F0IA 3QG1A 5JVH3 3WDNA 3HOWB 1K8OA 2E2HB 4RAUC 5C4HA 5C0XH 1WTRA 2PPBC 3FPUB 4XQNA 1EY4A 2LY7A 2A69C 2EJMA 1PRTF 2E76C 3NHHA 1TS3A 5M5XB 3K5NA 1GHKA 2BA0A 4CGYB 5CV7A 4IUTA 4M8AA 3CQZB 1Y1VB 1AFPA 4HAEA 2KCNA 1EEFD 3I72A 3FVQA 1TKWB 1B9NA 1HPCA 2HCCA 1OXSC 1SFOB 4A3EB 5DNFA 1BQQT 1H9MA 4DXFA 1PLFA 1L0YB 1E2WA 2Y0SB 2JA7B 1KAAA 2PZWA 1A3VA 3M7GA 2BE5C 1Q8IA 1D1IA 2YYZA 3OHXC 3MFGA 3M4YA 2PZUA 4P2CB 1F9RA 4K8JA 4KKTA 3VR2A 5C4XB 4C1NI 3DEOA 2FFKB 3SK6A 1A2UA 2K1BA 5TSSA 1FYCA 4KMUC 3PO3B 1LTAD 2VUMB 4X3KA 1FNVA 3KF8A 3PIO3 2QF7A 3AU7A 1HHVA 2A74C 5BN4A 1OXUA 1ENAA 3A56A 3MZ5A 4H44C 4H7BA 2CQAA 4L63B 3D6WA 1XX8A 1A15A 5E4XA 3QB3A 1HRJA 1SNDA 4A3MB 3PMFA 1Q12A 2QCPX 3QIAA 4FYDA 3DEPA 4PNYA 3HZXA 1IW7D 4XTCS 1PRTB 1L0XB 1CFMA 1SE2A 2H4OA 1PYWD 3RZDB 1VMCA 2XIWA 1SXTA 4EQNA 5JJZA 3V2TA 3VR3A 1BOSA 3JAME 1S5FD 3ONAB 2L9HA 3AB9A 4K14A 4R8NA 4IQZA 1MSHA 2A6HD 3SR1A 1SNMA 4RKBA 1ENFA 3QO2A 1DM0B 5EKIA 3NTHA 3AMUA 2EYLA 2A6EC 3S2HB 2EZVA 3CRLC 2G9HD 4ZKCB 4ULLA 2RBMA 1TS4A 3C2PA 3DWQA 2NN6G 3WOEA 2EYHA 4RGTA 2ICIA 5IGDA 1ESFA 1U9RA 1EWHA 1GUOA 1KTKA 4DAVA 3NPPA 4DXGA 3TP7A 1Y69U 5D14A 4ZYSA 3KBXA 3BS1A 5CC4A 1LTRD 3N6RA 1I4HA 4BA2I 3Q22A 1F2LA 1PTOD 5IT9L 4IN3A 4ME5A 4CHTB 3J81E 1LT6D 2ZXOA 3OMGA 3FMCA 2F03A 3DWPA 1YNJD 3TP5A 1TY0A 3GTOB 3EVQA 2B63B 2M9VA 1CTMA 1B3AA 3HP3A 1DZ1A 3QOLA 1JB3A 2JA8B 2K32A 2B2TC 5IGCA 1PTOF 5KEEA 3L3OC 1TS5A 2F0PA 4YIJA 2MGSA 2PQEA 1CI3M 2KUMA 4HSPA 1O7YA 2I46A 4F88A 1KDAA 4XDXA 3RLFA 1QNUA 3O13A 3FDTA 1MGSA 2Z8LA 3GTJB 4EQOA 3ND8A 4RA8A 2B2VC 1SYFA 5IGEA 1RODA 2WB1B 2B2YA 1Q1EA 2F0SA 1CZGA 4C56C 2JEBI 3K57A 5EKKA 2E2IB 2Z4IA 4OIJA 4QMGA 3KLSA 4IFDG 2ENBA 1STYA 4KY5A 3OPOA 1LT5D 1J8IA 3VYRA 3J80E 1PDQA 2XWJB 3I8ZA 1SDFA 3T4AC 4UAIA 3NWTA 1D5XC 5NUCA 4LMQD 3I3CA 5C5MA 3E0JA 3A7LA 1YNNC 1NUCA 2JSOA 1ET9A 2EYOA 1S5ED 1KLUD 4RHRA 5HURA 4C3IB 3PIP3 5IIFA 4OHJA 2JA5B 2JYOA 5J39A 1HUMA 2ID0A 1Z7TA 4KN7C 2XN9C 4IFDJ 4CBVA 1NR4A 2CHBD 2TSSA 4LK1C 1SYCA 4K6DA 1LLRD 3C1FA 5IOCA 4V190 5J22A 1U4MA 3GTKB 4KTAA 2WP8J 2QDBA 2K28A 2SNSA 2L4NA 4OO1H 1KNEA 2HDMA 5CGKA 2RA4A 3GP7A 3GQBA 3GTLB 1EY6A 3BDLA 1BBXC 3HOZB 4QCLA 3ND9A 3K0YA 1JOQA 1SE4A 4KHVA 5DM63 2N88A 4TKOB 4XQJA 3GTPB 2BDNA 3BVMA 4HN7A 5CORA 5E3FA 1CZWA 1RD9D 5JEAH 1CK1A 1PFBA 4RGOS 1SEBD 2KQ3A 2OXPA 3J7YW 1TWGB 5EGTA 4ZAIA 1NR2A 1DOMA 1OO9B 5KYLA 3IFTA 4A3DB 1XTCD 2HUGA 4IUVA 4A3FB 4C3JB 4J1MA 1CQFA 3GTQB 1SE3A 2L5TA 3QOJA 4XQQA 3I90A 2B39A 1ILPA 1DOLA 3G6JB 3HOVB 5EPKA 2F0KA 3D3RA 1MSGA 3V05A 2H1EA 3NTKA 1BDOA 2V4DA 3M7NA 4HCEA 3HOUB 4K2KA 3PUZA 1G91A 1O7ZA 2HQEA 4KJNA 1EIHA 1QOHA 2N55A 4FNFA 4WFN3 2RKSA 3KUPA 4HR7B 2MUYA 1RHPA 4DF7A 1CA6A 2DY7A 3P1HA 2KVMA 2MHVA 2NUCA 5A35A 2JXMB 3L9AX 1LT4D 3EQLC 4TQUS 3RD4A 4EVOA 3ZYYX 3VA5A 5C0XG 3VYTA 1AEXA 4KD4A 3H3VC 1WD1A 1V1PB 2EJFC 5KNCA 4RFBA 4IZ8A 1IL8A 1EIGA 3TN2A 2EYFA 2FMCA 1I4XA 1ML0D 1RJTA 5BN5A 2L55A 1LV9A 2F3WA 3S1QB 3TSSA 3HG9A 5J1ZA 4IUUA 3A8IE 1CA5A 1V1PA 5G3LD 4HTHA 1GUWA 2CVRA 3EFXD 1C4QA 5CBAE 4S3SA 2F0VA 5C0XJ 2NN6I 5KNDA 1IW7C 3HOYB 3FKIB 2GA4B 3I70A 5C6AA 2ZXPA 1W6KA 3DMUA 3A54A 5KGUA 5CBEE 5IGBA 2J0TD 1SNOA 1STBA 1JE4A 2F0QA 3TMEA 1F77A 1EY8A 5I6YA 3GO5A 1SMYC 2KJXA 1KNAA 2K5QA 5G3LF 4HCSA 3MTSA 2A73B 4RGNA 1FD7D 2A6HC 4BY7B 3NQTA 3LX0A 3ITPA 3TDQA 3E5SA 4B9XA 2XWBB 2O2LD 1LTGD 1RCVD 1HA5A 3OMCA 1PXUA 2QEJC 4RGMA 1KDBA 1C8CA 5M5YB 1WTOA 1PZKD 2R92B 3HKZB 4HMJA 4H13C 1DD2A 4X3UA 2XSCA 3S1NB 4CKBA 2KOLA 5K5PA 1ILQA 2NTSA 2OT2A 2X6GA 1PFNA 5A2QE 2LS01 5CR3A 4MHEA 3GD7A 1QNKA 5FLXL 3RZOB 2B2UA 1HQMC 2OF1A 4WRDA 1HA6A 4DAPA 2PCFB 4QUCA 2SOBA 4L6TB 2NVTB 2K7VA 1LTBD 1RKNA 1EU4A 2A68C 2WACA 4EGVA 4NMZA 3W2DA 3SEBA 3MWYW 4XYQA 1UUPA 2NVYB 3HS0C 4BS9A 1SSOA 4FF1A 3D31A 2MP1A 4IFDI 5BN3A 4NDXA 1I4GA 3S14B 2XRQD 4ID6A 1ZYRC 4N9PA 5C3WA 3H91A 4PMBA 3T16A 3NBHA 1EYDA 3I4MB 2F1MA 4I65A 5DEHA 5FO9B 3SK5A 3OWFA 2G9DA 5JVG3 4L8JA 2JE6I 1DOKA 2X69A 1GJXA 2KEEA 1QG7A 2B2WA 2IT1A 2K5WA 1PFMA 5KRUA 4IUPA 1H9JA 2K04A 3TBIB 2NWGA 4RCOA 4AYBB 5CV5A 4ZUJA 1ENCA 4RHSA 5COYA 3BG3A 3RMHA 3SVMA 1Z6HA 4C2MB 2M2LA 5EPJA 4K6LA 4F7XA 4DAYA 3WOFA 2E2DC 5KYIA 3VR6A 5EPLA 1MI2A 5M3MB 5FK9C 1D1KA 2F0LA 4G7OC 5CV8A 1LACA 4ZRZA 1X3PA 1STAA 1BCPC 1MBYA 3FEWX 1H9SA 2VNUD 3W3AA 1LABA 2KEDA 4QIWB 3TP8A 3BZDB 3T56B 4RH6A 1GUSA 2VB3X 2EY6A 1WTVA 3DM1A 2O4XA 1O7LA 1IHZA 1JR0D 2NVXB 4WORA 3P75A 1DCZA 1QWYA 5DAUA 2PZTA 3MEHA 4XT1B 1SNPA 4IALA 3U9OA 2K03A 3R3OA 2PNRC 3JAML 2WKCA 3H0GB 3UI2A 3URYA 3PO2B 3NE5B 3U9SA 1SYDA 4JBWA 1CT1D 1M8AA 2AQ1B 3OW7A 5I4DA 1A3UA 1CHPD 1XXGA 1QB5D 2KECA 4HMIA 3CKIB 1TS2A 3BYYB 4QUFA 2F0MA 1SNQA 4F87A 1UAPA 1BF4A 3E6ZX 1WCMB 4NW2A 4DA2A 1STGA 4I7ZC 1VCIA 4PMWA 4OO1G 3H09A 2F0FA 1R4QB 2E2JB 3M4OB 2YU9B 3Q6SA 2FJ2A 3NBIA 1AW7A 2HCIA 2L0CA 2F4IA 2M00A 3KK7A 4B9WA 3DUZA 2R6GA 2LKVA 2F0OA 3J81L 2QILA 5C0XI 1TWFB 3R8BA 1F9SA 1ICWA 3NK9A 1G291 2EXZA 4FXKC 2Q8IB 1CHQD 4HEDA 5K36G 3HEJA 4QF4A 5CV9A 2Z1CA 1PTOB 1TWAB 3J7AV 1T5EA 1JCKB 1F2ZA 2J4XA 2QKIC 3L7ZC 1LO5D 1ZXTA 2F0UA 4RKLA 1O80A 2CW0D 5M3FB 3A8KE 4K5VA 4C3IG 1XWEA 1GUGA 1IKLA 4R9WA 2Q8TA 5E4WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT D;  2IPK D;  2WV6 D;  1LT5 D;  1S5D D;  1ET6 A;  2AQ1 B;  1LT4 D;  1LTA D;  1KTK A;  1AN8 A;  5I4D A;  4DXG A;  4RCO A;  3CHB D;  1FNV A;  1CHP D;  1D5X C;  1RDP D;  1G8Z D;  1HQR D;  1XXG A;  1BCP D;  4RHS A;  1EWC A;  4ZYS A;  2NTS A;  1PZI D;  3OWE B;  1LTR D;  1V1P B;  1XTC D;  4RFB A;  1I4H A;  1TS2 A;  4L63 B;  1ET9 A;  1PTO D;  1EEI D;  3BYY B;  2RDH A;  1S5E D;  5D3D A;  1KLU D;  4RHR A;  1ESF A;  1SE3 A;  1I4X A;  1CQV A;  3EA6 A;  1JWU D;  4K6L A;  4OHJ A;  1UNS A;  3R2I A;  1LT6 D;  3TSS A;  1HTL D;  5ELB A;  2XN9 C;  1STE A;  1V1P A;  1PRT C;  1PRT F;  1LT3 D;  3DWA A;  3DWP A;  4L6T B;  2CHB D;  2TSS A;  3EFX D;  5FK9 C;  1JWM D;  1FNW A;  1I4Q A;  1D5Z C;  1S5B D;  1LTB D;  1MD2 D;  2RDG A;  3MC0 B;  1PRT B;  1B1Z A;  1EU4 A;  1TY0 A;  1L0X B;  1SE2 A;  1LLR D;  1KLG D;  1TS3 A;  1I4P A;  3W2D A;  3SEB A;  1BCP C;  1BCP F;  4UDU C;  1SJE D;  1PYW D;  2SEB D;  1TY2 A;  1UUP A;  1V1O A;  1AW7 A;  1SXT A;  3V05 A;  1PZJ D;  1BCP B;  1FGB D;  5D3I B;  1LTT D;  5ELF A;  1EEF D;  1PTO C;  1PTO F;  1S5F D;  1D6E C;  1S5C D;  5FKA C;  1I4G A;  1TS5 A;  5ELD A;  1B44 D;  4DXF A;  1JQY D;  1RF2 D;  3BZD B;  1T5X D;  1DJR D;  2XRQ D;  4RH6 A;  3GP7 A;  2QIL A;  1L0Y B;  1DYQ A;  3R2T A;  1F77 A;  3R8B A;  1EU3 A;  2XNA C;  2R61 A;  1ENF A;  1GOZ A;  2XRS D;  3O13 A;  1CHQ D;  5ELE A;  1JR0 D;  1SJH D;  4RGN A;  1FD7 D;  1SE4 A;  3BYT B;  2Z8L A;  1JWS D;  2AQ2 B;  2IJ0 A;  3BVG A;  2O2L D;  3MFG A;  4O1N A;  1HXY D;  1LTG D;  1PTO H;  1D5M C;  4BWG B;  2AQ3 B;  3BVM A;  1RCV D;  1PTO B;  1HA5 A;  4TSS A;  1BXT A;  2G9H D;  3KLS X;  5ELC A;  1LTS D;  1JCK B;  2J4X A;  4C56 C;  2NTT A;  3BVZ A;  1LO5 D;  1SBB B;  1TS4 A;  1LTI D;  3DWQ A;  1EFI D;  1RD9 D;  1CK1 A;  2QEJ C;  4RGM A;  3URY A;  1M4V A;  4Z9C B;  4RGT A;  1I4R A;  1PZK D;  1QIL A;  2ICI A;  4RGO S;  1SEB D;  5TSS A;  1FNU A;  1CT1 D; 
#chains in the Genus database with same CATH topology
 2JA5 G;  2IPK D;  3T51 B;  2JA6 B;  3BDC A;  1VQ9 A;  4M1U B;  4MNO A;  5IYC G;  4O42 A;  1X32 A;  4X3T A;  2VQE L;  5JPM C;  3Q23 A;  4UHV A;  1YNX A;  5DM7 3;  2YV5 A;  2AWN A;  1HNZ L;  2NZ1 D;  4WJ4 A;  2E2I H;  3S1M B;  3KF6 B;  3H6M A;  1AE3 A;  1EEI D;  3OOC A;  2LSS A;  1PH4 A;  1XPO A;  1EUJ A;  3MXP A;  4DK1 A;  4V0B A;  3NUC A;  1IYV A;  3VR4 A;  1WCM H;  4OIK A;  2EYM A;  5CV4 A;  5ELB A;  5IGF A;  4YCU A;  3A55 A;  4WJ3 M;  4IPG A;  1XNR Q;  3LWE A;  1PRT C;  3KF6 A;  3M4O H;  2F0T A;  2VQF L;  4L5T A;  1Y8N B;  3J80 L;  1V1Q A;  2JK8 A;  4AH6 A;  5C3X A;  2NB0 A;  3HOZ G;  1VQL A;  4C1N K;  4LAA A;  3RUZ A;  1EYC A;  3D4D A;  3F2U A;  4F8M A;  4DV0 Q;  2E74 C;  1X9N A;  1KAB A;  3D8G A;  1WI5 A;  4KY7 A;  1I3Q B;  3OYY A;  4DUZ L;  5D3I B;  2R7Z B;  2FHT A;  2PQA A;  1BR9 A;  2RCN A;  3G7L A;  3J7A 5;  5I9P A;  5C4Z A;  5ELD A;  5C4J B;  4JV5 L;  4DR6 Q;  2IX0 A;  1KHI A;  3E9H A;  4IUN A;  1X55 A;  2QEX A;  3SDZ A;  4AYB E;  4O0A A;  1C7Y A;  1E22 A;  2D62 A;  3RNU A;  1PFS A;  1XPR A;  3I7F A;  3W1B A;  3T53 B;  1A2T A;  2R61 A;  1IYU A;  4JBJ A;  4MIU A;  4A3K G;  2PYK A;  2NVQ B;  3MEF A;  2IJ0 A;  2D2C C;  2LFN A;  5HGQ A;  4RWS C;  1YNN D;  1LTL A;  1NCV A;  1XYI A;  4LF7 L;  1PH3 A;  1PTO H;  1TWA H;  3PQI A;  1TU2 B;  2AUK A;  4N9T A;  3TZU A;  4QB4 A;  2PMZ E;  1WTH A;  4PV1 C;  3C3L A;  2BA1 A;  4A3D G;  4GNX A;  2VQF Q;  2UXB L;  4ZLT F;  1LTI D;  2CWP A;  5M3F H;  3A5Z B;  1HFN A;  4C3J G;  3NWS A;  4AIM A;  1M90 C;  1VQ8 A;  4DUZ Q;  1I6V C;  1VQ7 A;  1EL0 A;  1TWH B;  2WV6 D;  3VDY A;  4LJZ C;  1B9M A;  3P20 A;  1JOR A;  4OWW B;  1TII D;  1VQB A;  4JI7 L;  2F0H A;  3PUW A;  1HQR D;  5EJW A;  4DR3 L;  4KJO A;  4BA1 I;  4JI0 L;  4DU9 A;  1SR3 A;  3HOV G;  1SLJ A;  3K5O A;  5DLQ E;  2F0J A;  1JWU D;  3U58 A;  3DLL A;  5IYB H;  4DR7 L;  1E2Z A;  3B6Y A;  3J81 j;  1UNS A;  3IL8 A;  4GOP C;  3A7A B;  4G57 A;  4DFA A;  5EBD A;  3HOU G;  4K8I A;  3QWN A;  3DWA A;  3IAY A;  1FNW A;  1O7I A;  1B2T A;  1MD2 D;  5EQ0 A;  1B1Z A;  2UUA Q;  1Q1B A;  4A3F H;  1EIY B;  2JJQ A;  1S3O A;  1MJE A;  3I91 A;  5IT9 c;  1A3T A;  4ABN A;  1PYS B;  2R7Z H;  2K6A A;  4G4K A;  2HT1 A;  4NXN L;  1LTT D;  2BCO A;  4G7H C;  1HNX L;  1EWI A;  5C4J H;  1N9W A;  4IUR A;  4J6H A;  1D6E C;  1HZA A;  2B2Y C;  1KDC A;  1SMX A;  1E1O A;  1N32 L;  3LWU A;  3AFQ A;  4DV5 Q;  3HGB A;  4DR3 Q;  1C9O A;  1UWV A;  3NXW A;  2FMM A;  3S15 B;  4UY8 C;  1Y1W G;  2Q8R E;  2GVB A;  2GN5 A;  1QE6 A;  1XPU A;  4YCW A;  2B8F A;  2XGT A;  1CKM A;  1N33 L;  2NVQ H;  2F0G A;  4RMF A;  1R9T B;  4A3G B;  4B3R L;  5ELE A;  2KHI A;  4C3H G;  4DV6 L;  4A3J G;  4LF9 L;  1UEA B;  4LF8 Q;  1X56 A;  2F0W A;  3CU7 A;  1D5M C;  3CRK C;  2AQ3 B;  1K8M A;  4B08 A;  4TSS A;  4XXE A;  2DY8 A;  2A5H A;  4U67 3;  2IY5 B;  3MHB A;  2C35 B;  4DN4 M;  1TWH H;  2IL8 A;  1PV4 A;  4LFC L;  4NXN Q;  4GN3 B;  2IW3 A;  2L11 A;  1GD7 A;  2IX3 A;  4NB3 A;  1AN8 A;  2B2V A;  2E8G A;  2K5N A;  2MPM A;  1N32 Q;  4U68 A;  3G4S A;  3X3N A;  5LL6 X;  1EY0 A;  3CCS A;  1X3Q A;  3SHL A;  4FO2 A;  5I9O A;  3OWE B;  5D65 A;  1QCB D;  3D4W A;  1UE5 A;  4X3S A;  3S1R B;  3CME A;  4OL7 A;  1WTX A;  5FOB B;  4B3R Q;  1OXT A;  2DUD A;  4POF A;  4HJA A;  1CKN A;  5I2Y A;  1EY5 A;  5LMN L;  4HIO A;  3I56 A;  3FKI G;  2PI2 E;  2Z4H A;  4WJW A;  2ICE C;  3I4L A;  3ICE A;  2D9U A;  3MFY A;  1OXX K;  4DV1 Q;  1VDZ A;  1WD0 A;  1LT3 D;  1DON A;  3VA7 A;  4J8Q A;  4JOI C;  3P7J A;  2E5L Q;  4UDU C;  2UUC Q;  1XTD A;  1U4P A;  4CJ1 B;  2O5I C;  1IXR A;  1Y1V G;  1PZJ D;  2UXD Q;  1BBW A;  2EJG C;  4BBS B;  1PTO C;  4Q5V A;  5JJL A;  4XT3 B;  5FKA C;  4DAM A;  4A3B B;  1L1O C;  1JC7 A;  1EOT A;  1B44 D;  3DXJ C;  3S15 H;  4A3E G;  1JQY D;  2VB2 X;  1BO0 A;  4BY1 B;  5GQO A;  2R93 B;  1PH8 A;  4ILW A;  2Y0S G;  1U4L A;  2JA7 G;  1R9T H;  4A3G H;  2I5L X;  2J7Z A;  5LMN Q;  1YNJ C;  1NAP A;  4KY6 A;  3H3V I;  4R4O A;  4KKU A;  1GXD C;  4YCV A;  1EQV A;  2EVB A;  1HZ9 A;  4CKE A;  1I6H B;  1I50 B;  1QJO A;  2DNE A;  2G5D A;  4OXP A;  3X3M A;  2IHE A;  5LMN W;  1BXT A;  1VQD A;  3BVZ A;  5IT9 E;  3OIQ A;  4OO1 I;  2RQX A;  5KIX A;  3A8J E;  1EIF A;  4FF4 A;  1X3E A;  4DV2 L;  2OTJ A;  4G7Z C;  4B3M L;  4HSV A;  1QUQ B;  1Z47 A;  4KD3 A;  4DNT B;  1EQT A;  4B3T L;  4BY7 H;  4DK0 A;  4X66 Q;  3ER0 A;  1IKM A;  3AEV A;  4PQX A;  4A93 B;  1Y8O B;  1JJ2 A;  4KN4 C;  1HUN A;  1H9R A;  3PO3 G;  3MXG A;  3PV0 A;  3CHB D;  1C48 A;  2L1B A;  4GKJ L;  1EWC A;  2RVL A;  4GN5 A;  1PZI D;  5FJ8 H;  1KQS A;  1ESR A;  3STB C;  5JJK A;  3PUY A;  4JI3 L;  1YJN A;  3GV6 A;  3NTI A;  4XYO A;  2X6L A;  5M5Y H;  5IP9 H;  3T1Y Q;  2D5D A;  3A0J A;  3MXU A;  2K14 A;  1G6Z A;  2R92 H;  1CQV A;  1K3B C;  1TQO A;  2KHS A;  2BH2 A;  4LFB L;  4PMC A;  1ZEQ X;  1BBU A;  4A3M G;  2A69 D;  3S17 B;  3FRP B;  1Q7Y C;  3GTM B;  4FXD A;  4H0L C;  3I73 A;  1YJ9 A;  2DJF C;  5GAD C;  3SXH A;  1HTL D;  5M9O A;  2TMP A;  1SMY D;  2L12 A;  1I5F A;  1Q46 A;  2ZM6 L;  3CC4 A;  3OIP A;  2EY5 A;  1E3P A;  1S5B D;  3U4Z A;  3MAQ A;  1D5Z C;  4DV2 Q;  1W2B A;  4LNQ A;  4NP5 A;  1GUT A;  1KLG D;  1I4P A;  4B3T Q;  3T1H L;  2IX1 A;  3I4M G;  4YY3 L;  2XVS A;  3SK8 A;  1OXV A;  1Q3L A;  1B4O A;  3RZO H;  1JE5 A;  4MN3 A;  4BBS H;  1T9H A;  5A2Q L;  2PMZ B;  2NBF A;  4A3B H;  2RDF A;  2K5D A;  3SK4 A;  1S40 A;  3TP6 A;  4OX9 L;  1H9S B;  2FIN B;  2LXJ A;  4GKJ Q;  3PF5 A;  2ZTE A;  3M3Y B;  1T5X D;  2R93 H;  1F2M A;  3ERS X;  1NTG A;  4K5W A;  2R7F A;  3R93 A;  1J5E Q;  2BE5 D;  2JP1 A;  4JI4 L;  4BBR B;  2K33 A;  1IBK L;  3N52 A;  1JOO A;  4ME3 A;  2F4V Q;  1V8Q A;  4JI2 Q;  4A3L H;  4FF3 A;  3BYT B;  4FVM A;  1LM0 A;  5F2D A;  1JWS D;  4XIG S;  1IBM L;  3S16 B;  1ZKO A;  1I50 H;  5AFW A;  3CCV A;  4O1N A;  1WOC A;  1XMO L;  1QVF A;  4BXX G;  1WTQ A;  2ZTD A;  4FF2 A;  1WVL A;  1JIC A;  3ULP A;  2PO4 A;  3C1E A;  1A8V A;  1JOK A;  4JBM A;  1EFI D;  2DNC A;  1M4V A;  3KLR A;  4HJ7 A;  2LMC B;  3DHQ A;  3OSO A;  3PUX A;  1FNU A;  3A5U A;  4A93 H;  2NYZ D;  1K3R A;  3Q24 A;  2OEO A;  1BUV T;  1S4Z A;  1VMP A;  2CW0 C;  3HRZ C;  1G2S A;  4UP7 A;  3I4O A;  1IYJ B;  3F1Z A;  3I2Z A;  2A68 D;  1KRS A;  3ERO A;  2Q2T A;  3J7Z C;  4JI8 Q;  3ERQ A;  1RDP D;  2F3V A;  2C9O A;  2JQO A;  1EYA A;  2AWO A;  1HCZ A;  1L0W A;  2NN6 H;  2WAQ E;  2WKD A;  2RSN A;  3S17 H;  2CQO A;  3EA6 A;  3K7A B;  1OTC A;  4ZKB B;  3V96 A;  1ZYR D;  2F0E A;  2CH4 A;  3R2I A;  1VF5 C;  1YVC A;  4Y7N B;  5I2X A;  2EYP A;  1STE A;  4E6I A;  1TR5 A;  1UEB A;  1B7Y B;  4LUV A;  1JMC A;  5C3E B;  1I4Q A;  1Q90 A;  2EY2 A;  2BOS A;  1F9P A;  5LHY 1;  4P74 A;  3KDF B;  2B63 G;  4K2L A;  2KA7 A;  1TY2 A;  1FR3 A;  1H9K A;  2K01 A;  4JYA Q;  1TWC B;  2JA8 G;  2K05 A;  4FXG C;  2EYJ A;  1A62 A;  5ISR A;  3RR5 A;  1SYG A;  2YTY A;  1JJC B;  1NSN S;  2EY1 A;  1CKO A;  3M3Y H;  1EY7 A;  4KI0 A;  1RF2 D;  1R4P B;  1MHW C;  3MVV A;  1VQM A;  5M3M H;  4BBR H;  3NSW A;  4IOC A;  4A3I B;  1EZ6 A;  1EU3 A;  5HGT A;  1X6O A;  3NEN A;  4YHH Q;  3MXN A;  3H0G G;  2XNA C;  5E1F A;  1GOZ A;  4DGZ A;  1STN A;  1TVX A;  2A6E D;  5JPN C;  1V43 A;  2MFI A;  1GHJ A;  3S16 H;  5CYU A;  3UE0 A;  3U4V A;  3GTG B;  3BVG A;  2OQK A;  3GV3 A;  1E0B A;  2WB1 G;  4BWG B;  1K73 C;  3PIO A;  1G2T A;  3KLS X;  1LTS D;  2SDF A;  1RTO A;  2NTT A;  1NE3 A;  3M85 A;  4IPC A;  1SBB B;  2UXC L;  3EJI A;  1DXM A;  2PW5 A;  4Z9C B;  3SE0 A;  3JAM i;  1O78 A;  3K0X A;  2R3Z A;  2IWH A;  5JEA G;  4QGU A;  4DV3 Q;  4CKC A;  2JEA I;  2I07 B;  5C44 B;  2B2U C;  1E1T A;  1S5D D;  1ET6 A;  1WCM G;  3T13 A;  1HFG A;  5FO8 B;  4CJ2 C;  3D4R A;  1BCP D;  4PG3 A;  1TT2 A;  4DV4 Q;  4NXM L;  4NKL A;  5CMD A;  4DNR B;  3PO2 H;  1VF7 A;  4OGQ C;  2RDH A;  3PUV A;  4IFD H;  3K7A H;  3PSI A;  2OTL A;  2DN8 A;  2V1C C;  4IPH A;  1E2V A;  1HTP A;  1MKH A;  2E75 C;  3CCR A;  5M5W B;  4GZY C;  1IBL L;  5JEA J;  1K83 B;  5EBC A;  3IFD A;  5C3E H;  2UXC Q;  4Q0F A;  2PW7 A;  3S9W A;  1EZ8 A;  5IYD H;  3MC0 B;  3UDF A;  2RDG A;  4ZUI A;  1EY9 A;  1BCP F;  3D6C A;  1SJE D;  2D0P A;  3E0E A;  5FLX c;  1TWC H;  1AP0 A;  5KNB A;  4KK7 A;  4JK1 C;  2HD3 A;  1S5C D;  2WIN B;  3K80 C;  2PQA B;  1HNW Q;  1STH A;  1DJR D;  5FO7 B;  4A3I H;  2E2J H;  4L5S A;  1PMR A;  2L15 A;  2YU9 H;  1SNC A;  3U50 C;  1PYB A;  3VYS A;  2B2W C;  2IHF A;  2HIV A;  1A6X A;  1AZQ A;  3J81 i;  5M3F G;  2XRS D;  4A3K B;  2Z6B A;  2EE1 A;  2ZT9 C;  1U4R A;  1ONL A;  2AQ2 B;  5T1I A;  2KCC A;  2ZXR A;  2VXW A;  5K36 H;  2VQE Q;  3G6E A;  3IKJ A;  3IRB A;  5CV6 A;  4MTN A;  3VR5 A;  2A19 A;  1HNZ Q;  1WTW A;  3K58 A;  1TWF H;  4A75 A;  2OWO A;  4DR2 L;  3CCM A;  3TS0 A;  1SAP A;  4GNX B;  2RF4 A;  4K5X A;  1KL9 A;  4X65 L;  2UUB L;  3EIV A;  1I4R A;  2SNM A;  1CM9 A;  1QIL A;  3QJY A;  3BDO A;  4JW0 A;  5C44 H;  3VYU A;  2RSO A;  2JN4 A;  3TZD A;  4A76 A;  1SYE A;  3H94 A;  4KHP L;  3K6O A;  5JAV A;  2KEN A;  1B53 A;  3CC7 A;  4HID A;  4KKS A;  2C5C A;  1G8Z D;  3KBG A;  3CCU A;  4ZQ3 A;  5IGG A;  3LNN A;  1VQP A;  5I6W A;  5D3D A;  1DGS A;  1QZG A;  5LL6 S;  4A3F G;  1HH2 P;  4JG2 A;  2JA6 H;  5EKL A;  2R7Z G;  4OON A;  1Y8P B;  5M5W H;  1KC8 C;  4EQP A;  1VQJ A;  5IP7 H;  1PH1 A;  4JV5 Q;  4A3C H;  2AUJ D;  1B50 A;  1J9O A;  3MA2 B;  1JWM D;  3S1M H;  1W6J A;  3K5M A;  3Q0A A;  2EPB A;  2F0N A;  3CF5 A;  2MJ8 A;  3J80 i;  2SEB D;  1Z9F A;  1V1O A;  1BCP B;  1FGB D;  5ELF A;  2RCF A;  1P16 A;  1XNQ L;  2Q2U A;  3CP0 A;  1HZB A;  2WII B;  1K0R A;  4LF7 Q;  5JOB A;  2B8G A;  2HIX A;  3K59 A;  2UXB Q;  2EDG A;  2EOT A;  3HOX B;  1Y1W B;  2Z6K A;  1GO3 E;  1DYQ A;  3R2T A;  4DKA C;  4CJ0 B;  4MTK A;  1YI2 A;  2AHO B;  4FP5 D;  4ZK9 B;  4A3K H;  4DR4 L;  3NP8 A;  1GUN A;  5C5L A;  1GVP A;  4N8F A;  2LXK A;  4C3H B;  2K4K A;  1SJH D;  2HDL A;  1WJJ A;  2DGY A;  4R8I A;  4A3J B;  1I3Q H;  2KBN A;  4RCN A;  2CFM A;  3C46 A;  4IUQ A;  1UE6 A;  2BDO A;  2O5J C;  1HXY D;  4JI7 Q;  5T1G A;  1XJV A;  1FL0 A;  2KHJ A;  1SYB A;  5BR8 L;  5ELC A;  4ODG A;  1AZP A;  4JI0 Q;  3I4N B;  2WAQ B;  3J7A F;  4LWC A;  1W3S A;  1WTP A;  5FLX E;  2F0D A;  1F9Q A;  1YHA A;  1D2B A;  1UE7 A;  1BNZ A;  1II3 A;  3S2D B;  3CAM A;  3M9B A;  4P75 A;  3FPP A;  1HR0 L;  3K5L A;  4TRD A;  4DR7 Q;  4YWL A;  1RTN A;  1PRT D;  2OCE A;  3PIP A;  2B2T A;  1F2Y A;  1D8L A;  3NQI A;  1Q82 C;  4KHZ A;  4KV6 A;  1VQK A;  5IOD A;  2F0I A;  2Q2I A;  1KXL A;  4JI1 L;  4L5R C;  3QG1 A;  5JVH 3;  3WDN A;  4JC0 A;  3HOW B;  1K8O A;  1HNX Q;  1CKN B;  2H5X A;  2E2H B;  4RAU C;  5C4H A;  5C0X H;  1WTR A;  2PPB C;  3FPU B;  4XQN A;  1EY4 A;  1HZC A;  2LY7 A;  2A69 C;  5H1S E;  2EJM A;  1PRT F;  2E76 C;  4B3S L;  2YTV A;  1SRO A;  3NHH A;  4IPD A;  1TS3 A;  1N33 Q;  5M5X B;  2ALY B;  1HR0 Q;  3K5N A;  1GHK A;  3E9I A;  2BA0 A;  5CV7 A;  3CQZ B;  4IUT A;  4M8A A;  1Y1V B;  4CGY B;  4DV6 Q;  4LF9 Q;  1AFP A;  4HAE A;  4GN4 B;  3HOY G;  2KCN A;  5FLM H;  1EEF D;  3I72 A;  4EX5 A;  3FVQ A;  1TKW B;  1B9N A;  1HPC A;  2ZJQ A;  2HCC A;  1OXS C;  1SFO B;  4DK3 C;  4A3E B;  5DNF A;  3HOX H;  1HR0 W;  1BQQ T;  1H9M A;  4DXF A;  3CMA A;  4P71 A;  1PLF A;  1L0Y B;  1EOV A;  1E2W A;  2Y0S B;  2JA7 B;  1KAA A;  2PZW A;  4C3H H;  1A3V A;  3A74 A;  3M7G A;  4N8X 1;  4DR5 L;  4LFC Q;  2BE5 C;  1Q8I A;  1D1I A;  4BY7 G;  2YYZ A;  3OHX C;  2BH8 A;  1EYG A;  4LFA L;  3MFG A;  3M4Y A;  3LGJ A;  3WWV A;  2PZU A;  4P2C B;  1F9R A;  2K5V A;  3F2B A;  4K8J A;  4KKT A;  3I4N H;  3VR2 A;  3J81 c;  4AQY L;  5C4X B;  1EQR A;  1A0I A;  4C1N I;  3DEO A;  5FJ8 G;  3S2D H;  3M4Q A;  2FFK B;  1I94 L;  3SK6 A;  1A2U A;  2K1B A;  5IP9 G;  5HY6 A;  1PHJ A;  5TSS A;  1FYC A;  2R92 G;  3G71 A;  3HKZ G;  4KMU C;  3PO3 B;  1LTA D;  2VUM B;  3PCO B;  4X3K A;  1FNV A;  3KF8 A;  3PIO 3;  2QF7 A;  3AU7 A;  1HHV A;  2A74 C;  5BN4 A;  3CPF A;  4X62 L;  1OXU A;  1KD1 C;  2N3S A;  1ENA A;  3A56 A;  3MZ5 A;  4H44 C;  4H7B A;  1Q81 C;  2CQA A;  3FHW A;  1X3F A;  4L63 B;  3D6W A;  1XX8 A;  3HOW H;  1A15 A;  5E4X A;  4JPB W;  3QB3 A;  4KLK A;  4DK6 C;  1HRJ A;  1SND A;  4A3M B;  2VY3 A;  1JT8 A;  3PMF A;  5GAG C;  3UE1 A;  1Q12 A;  2E2H H;  2N8N A;  4X64 L;  2QCP X;  3QIA A;  4A3B G;  4FYD A;  1N36 L;  3RLO A;  2R93 G;  3DEP A;  4PNY A;  3HZX A;  3S1R H;  1IW7 D;  4XTC S;  1PRT B;  3BZK A;  4K0K L;  5M5X H;  1L0X B;  1CFM A;  2DJG C;  1K8G A;  1SE2 A;  2H4O A;  1PYW D;  2UU9 L;  2GVA A;  3RZD B;  1VMC A;  2XIW A;  4A3L G;  1SXT A;  4EQN A;  1E24 A;  5JJZ A;  3V2T A;  3VR3 A;  1BOS A;  3JAM E;  1S5F D;  1SFO H;  3ZJY C;  3ONA B;  4ALP A;  2VZA A;  4EQ5 A;  4A3E H;  2L9H A;  1EFW A;  3AB9 A;  4K14 A;  4R8N A;  3JC6 6;  4GNX C;  4IQZ A;  1MSH A;  3EBE A;  2A1A A;  3J80 c;  2A6H D;  3PGZ A;  1VS0 A;  3K8A A;  3SR1 A;  1SNM A;  4RKB A;  4B3M Q;  2MQH A;  1ENF A;  4RG1 A;  3QO2 A;  1DM0 B;  4HJ9 A;  5EKI A;  4QQB X;  3NTH A;  3AMU A;  4A93 G;  2YTX A;  4JI5 L;  2EYL A;  2A6E C;  4DR1 L;  3S2H B;  2EZV A;  1N36 Q;  3CRL C;  5C4X H;  3H15 A;  4BY1 H;  4YWM A;  2G9H D;  4ZKC B;  4ULL A;  1IL2 A;  2RBM A;  4K0K Q;  1TS4 A;  2PNH A;  5J3B A;  4JI3 Q;  3C2P A;  3DWQ A;  3CD6 A;  2NN6 G;  3WOE A;  2UU9 Q;  2EYH A;  4RGT A;  1N34 L;  1NY4 A;  4IO9 A;  2ICI A;  3L0O A;  4LFB Q;  5IGD A;  1ESF A;  1U9R A;  1EWH A;  2VUM H;  1VQH A;  4HJ8 A;  1I6H H;  1GUO A;  1KTK A;  4DAV A;  3NPP A;  4DXG A;  3TP7 A;  1Y69 U;  4GLX A;  4AYB G;  5D14 A;  4ZYS A;  3KBX A;  2ZM6 Q;  4P73 A;  3BS1 A;  5CC4 A;  1LTR D;  3OTO L;  3N6R A;  2ATW A;  1I4H A;  4BA2 I;  3Q22 A;  1F2L A;  1PTO D;  1PH7 A;  3T1H Q;  4A3M H;  4YY3 Q;  5IT9 L;  2R7D A;  1KIX A;  4JI5 Q;  4IN3 A;  4ME5 A;  4CHT B;  3J81 E;  1LT6 D;  2NZO A;  4OX9 Q;  1ICF B;  1TXY A;  2ZXO A;  1VQG A;  3OMG A;  3KFU A;  3FMC A;  2F03 A;  3DWP A;  3OW2 A;  1YNJ D;  3TP5 A;  3UDG A;  3W1G A;  5M3M G;  4JI4 Q;  1TY0 A;  4BBR G;  4DUY L;  3GTO B;  3EVQ A;  1N34 Q;  1VQF A;  4CDC C;  1IBK Q;  2B63 B;  2EQS A;  2M9V A;  1CTM A;  3HKS A;  1B3A A;  4JBK A;  3HP3 A;  1DZ1 A;  3QOL A;  3CCE A;  1JB3 A;  3GTM H;  2JA8 B;  2K32 A;  1IBM Q;  2B2T C;  5IGC A;  1PTO F;  1XMQ L;  4GOP A;  1WFQ A;  5KEE A;  3L3O C;  1TS5 A;  2F0P A;  2MO0 A;  1XMO Q;  4YIJ A;  3K81 C;  1NBW A;  1PA6 A;  2MGS A;  2PQE A;  1CI3 M;  1KAW A;  1G51 A;  2KUM A;  4QJF A;  1X54 A;  4HSP A;  4ZCK A;  1O7Y A;  1UE1 A;  2I46 A;  1YJW A;  1Q8K A;  4F88 A;  1FGU A;  1X65 A;  1KDA A;  4XDX A;  3FP9 A;  3RLF A;  1QNU A;  3O13 A;  3FDT A;  1MGS A;  2Z8L A;  3GTJ B;  3MXN B;  4EQO A;  3ND8 A;  3F2D A;  4RA8 A;  2B2V C;  1SYF A;  5IGE A;  3S2H H;  4BXX H;  3STB D;  1CUK A;  1ROD A;  2WB1 B;  2B2Y A;  1Q1E A;  2F0S A;  4HJ5 A;  4LW1 A;  1K8A C;  1CZG A;  4GKK L;  4C56 C;  2JEB I;  3K57 A;  4LF4 L;  4DUY Q;  4LUZ A;  5EKK A;  2E2I B;  1K9M C;  2Z4I A;  3F8T A;  4OIJ A;  4QMG A;  3PO2 G;  3KLS A;  4IFD G;  2ENB A;  1STY A;  4DNI A;  4KY5 A;  3OPO A;  1LT5 D;  1J8I A;  3VYR A;  1NMG A;  3J80 E;  1PDQ A;  4X6A H;  1L2F A;  2XWJ B;  3I8Z A;  1SDF A;  3DM3 A;  3T4A C;  3ULJ A;  4UAI A;  3NWT A;  1D5X C;  5NUC A;  4LUO A;  4LMQ D;  3I3C A;  1AH9 A;  5C5M A;  4POG A;  3E0J A;  3A7L A;  1YNN C;  5C3E G;  1NUC A;  1QVC A;  5LMU L;  2JSO A;  1ET9 A;  2EYO A;  5IYD G;  1S5E D;  2QGQ A;  1KLU D;  4RHR A;  5HUR A;  1GKH A;  4C3I B;  4DV7 L;  2Y0S E;  3PIP 3;  5IIF A;  4OHJ A;  2JA5 B;  2JYO A;  5J39 A;  1HUM A;  2ID0 A;  1Z7T A;  5GAH C;  4KN7 C;  2I0Q A;  1G6P A;  2XN9 C;  4IFD J;  1JJG A;  4LF4 Q;  4CBV A;  1NR4 A;  2CHB D;  2TSS A;  4LK1 C;  1SYC A;  4A3I G;  4K6D A;  4OEM B;  3H3V H;  1LLR D;  3C1F A;  5IOC A;  1K0S A;  4V19 0;  3F2C A;  5J22 A;  1VQN A;  2EXD A;  1U4M A;  3GTK B;  4KTA A;  2JA8 H;  1Y14 B;  2N49 A;  2WP8 J;  2QDB A;  4UPA A;  5IWA L;  1YIT A;  4Y7N H;  2K28 A;  2SNS A;  2WFW A;  2L4N A;  4HIM A;  4OO1 H;  1KNE A;  2HDM A;  1XNR L;  5CGK A;  5LMU Q;  3BZC A;  2RA4 A;  3GP7 A;  3GQB A;  3GTL B;  2HHH L;  1EY6 A;  4QL5 A;  1MJC A;  3BDL A;  1BBX C;  2Z9H A;  3HOZ B;  5AJ3 L;  2A8V A;  4QCL A;  3ND9 A;  3GTJ H;  3K0Y A;  1JOQ A;  1SE4 A;  4KHV A;  5DM6 3;  4DV0 L;  2N88 A;  4TKO B;  5C44 G;  4XQJ A;  3GTP B;  2BDN A;  2VW9 A;  1PH5 A;  2N78 A;  1Q86 C;  1L1O A;  2K50 A;  3BVM A;  4HN7 A;  1X3G A;  4DR6 L;  4IJL A;  1C0A A;  5COR A;  4NXM Q;  5E3F A;  1CZW A;  3S24 A;  1RD9 D;  5JEA H;  1CK1 A;  1PFB A;  1B3Q A;  4RGO S;  1SEB D;  2KQ3 A;  2OXP A;  3J7Y W;  5IWA Q;  3GTG H;  1J6Q A;  1TWG B;  5EGT A;  4ZAI A;  2JA6 G;  1NR2 A;  1IBL Q;  1U5K A;  1DOM A;  1OO9 B;  5KYL A;  5IP7 G;  3IFT A;  4A3D B;  4A3C G;  2HHH Q;  2VS1 A;  4DPG A;  1XTC D;  2RHS B;  2HUG A;  4IUV A;  1QVG A;  4C3I H;  5AJ3 Q;  4A3F B;  4C3J B;  4J1M A;  1CQF A;  2CCZ A;  3GTQ B;  1SE3 A;  1P8L A;  4GLV B;  2JA5 H;  3KLW A;  1SE8 A;  2L5T A;  4GS3 A;  5IYC H;  3QOJ A;  4XQQ A;  3I90 A;  5IYB G;  4CDE C;  3CXC A;  3KOJ A;  2B39 A;  1ILP A;  1DOL A;  4H02 A;  2B3G A;  3G6J B;  3HOV B;  3PF4 A;  4L5Q A;  3GDE A;  3GTK H;  5L37 A;  2Z0S A;  3RN5 A;  1YZ6 A;  5EPK A;  2F0K A;  3D3R A;  1MSG A;  5GRO A;  3V05 A;  2H1E A;  3CCJ A;  3NTK A;  1BDO A;  3ULL A;  2V4D A;  3M7N A;  1VQO A;  1K83 H;  4HCE A;  4APV A;  2VL6 A;  3HOU B;  4K2K A;  3PUZ A;  3GTL H;  5ELO A;  3KYH C;  1G91 A;  1O7Z A;  2HQE A;  4DR2 Q;  3NEM A;  4KJN A;  1EIH A;  1QOH A;  3HOZ H;  2N55 A;  4OEL B;  2UUA L;  4X65 Q;  2UUB Q;  2CKZ B;  4FNF A;  4WFN 3;  3GTP H;  1RL2 A;  4HIK A;  2RKS A;  3KUP A;  4HR7 B;  3CPW A;  4KHP Q;  2MUY A;  1RHP A;  2AKW B;  4DF7 A;  1CA6 A;  4DV5 L;  2DY7 A;  3P1H A;  3KJP A;  2KVM A;  2HQL A;  4QIW E;  1NMF A;  2MHV A;  2ASB A;  2NUC A;  2MNA A;  1VQ5 A;  5A35 A;  2QA4 A;  2JXM B;  4YWK A;  3L9A X;  3D0F A;  1TWG H;  2KCT A;  1WYD A;  1LT4 D;  3EQL C;  4TQU S;  4LF5 L;  3RD4 A;  4LF8 L;  4EVO A;  1V9P A;  2ES2 A;  3ZYY X;  3VA5 A;  4A3D H;  5ELN A;  5C0X G;  3VYT A;  3Q8D A;  1AEX A;  4KD4 A;  3UDX A;  3H3V C;  1WD1 A;  1V1P B;  2EJF C;  5KNC A;  4RFB A;  4IZ8 A;  1IL8 A;  1EIG A;  4C3J H;  3TN2 A;  3GTQ H;  2EYF A;  1VQC A;  2FMC A;  1I4X A;  1ML0 D;  1RJT A;  2I5H A;  5BN5 A;  2L55 A;  3I55 A;  1XNQ Q;  1LV9 A;  2F3W A;  5FLM G;  2FXQ A;  3S1Q B;  3TSS A;  3HG9 A;  5J1Z A;  4IUU A;  3A8I E;  1CA5 A;  1V1P A;  4PZ7 A;  1AE2 A;  3AYH B;  5G3L D;  4HTH A;  1GUW A;  3HOX G;  4JCV E;  2CVR A;  3EFX D;  3HOV H;  2WB1 E;  1C4Q A;  5CBA E;  3JAM c;  4S3S A;  2JA9 A;  1YBY A;  4DR4 Q;  2F0V A;  5C0X J;  1S72 A;  5IY0 A;  2NN6 I;  5KND A;  1IW7 C;  3HOY B;  3FKI B;  2GA4 B;  4LF5 Q;  3I70 A;  5C6A A;  2ZXP A;  1W6K A;  3HOU H;  3DMU A;  3A54 A;  5KGU A;  5CBE E;  5IGB A;  3M4P A;  2J0T D;  4DV1 L;  1SNO A;  5BR8 Q;  1STB A;  3CCQ A;  1JE4 A;  2B29 A;  3EN2 A;  2F0Q A;  2WAQ G;  1B8A A;  3I4N G;  3TME A;  1F77 A;  1EY8 A;  5I6Y A;  3GO5 A;  1SMY C;  2KJX A;  1KNA A;  2K5Q A;  2E5L L;  5G3L F;  4HCS A;  1IZ6 A;  3MTS A;  2F3I A;  1KRT A;  2UUC L;  2A73 B;  4RGN A;  1FD7 D;  3TS2 A;  2A6H C;  3CCL A;  4A3G G;  4BY7 B;  2AMC B;  3NQT A;  3LX0 A;  3ITP A;  3TDQ A;  3E5S A;  2KCM A;  2UXD L;  4B9X A;  2XWB B;  2O2L D;  3E3X A;  1LTG D;  1RCV D;  1HA5 A;  1Y1W H;  4Y52 H;  1VQA A;  4JI1 Q;  3OMC A;  1PXU A;  2QEJ C;  4RGM A;  1KDB A;  1C8C A;  5M5Y B;  4OWX B;  1WTO A;  3HOW G;  1PZK D;  4A3J H;  4OWT B;  2R92 B;  4UP9 A;  3HKZ B;  1YHB A;  4HMJ A;  5IE8 A;  1FJG L;  4H13 C;  5E7N A;  4J15 A;  1DD2 A;  1CSP A;  4X3U A;  2XSC A;  3S1N B;  4CKB A;  2KOL A;  5K5P A;  1NNX A;  1EQQ A;  3RLN A;  4B3S Q;  2D0O A;  1ILQ A;  4UP8 A;  2NTS A;  2OT2 A;  2X6G A;  3KF8 B;  3HFZ B;  1PFN A;  5A2Q E;  2LS0 1;  5CR3 A;  4MHE A;  5GAE C;  4PZ6 A;  3GD7 A;  4R4Q A;  1QNK A;  1LUZ A;  5FLX L;  1E7Z A;  4X66 L;  2MO1 A;  3RZO B;  2B2U A;  3S1Q H;  1HQM C;  2OF1 A;  3W5O A;  4WRD A;  1D7Q A;  1HA6 A;  4DAP A;  2PCF B;  4QUC A;  2SOB A;  4L6T B;  2NVT B;  2K7V A;  1LTB D;  1VQE A;  1RKN A;  1EU4 A;  2A68 C;  1H95 A;  2WAC A;  4EGV A;  4NMZ A;  4QY7 A;  4PZ8 A;  3W2D A;  3T1Y L;  3SEB A;  4DR5 Q;  3MWY W;  1JB7 A;  3HOY H;  3QR8 A;  4XYQ A;  3NBH B;  1UUP A;  2NVY B;  3FKI H;  1ASY A;  3HS0 C;  4BS9 A;  1N8R C;  1FJG Q;  1SSO A;  4FF1 A;  3D31 A;  2MP1 A;  4IFD I;  1RIP A;  4LFA Q;  3L2P A;  2K52 A;  5BN3 A;  4BBS G;  4NDX A;  2I5M X;  1I4G A;  3UDI A;  3S14 B;  2XRQ D;  4ID6 A;  4CDD C;  4AQY Q;  2CH4 W;  1ZYR C;  4N9P A;  3SGI A;  5C4X G;  4BY1 G;  5C3W A;  3H91 A;  4PMB A;  1GM5 A;  3T16 A;  3NBH A;  2EIF A;  1VQ4 A;  1I94 Q;  1EYD A;  3CQZ H;  3I4M B;  1Y1V H;  2RHQ B;  2F1M A;  1YHQ A;  4I65 A;  5DEH A;  5FO9 B;  3SK5 A;  2VUM G;  3OWF A;  2G9D A;  5JVG 3;  4L8J A;  4FDB A;  2JE6 I;  4X62 Q;  1QZH A;  4IOA A;  4R4T A;  1DOK A;  2X69 A;  4CDF C;  1QUQ A;  1GJX A;  2KEE A;  1QG7 A;  2JA7 H;  1J5E L;  2B2W A;  2IT1 A;  2K5W A;  3RN2 A;  1HJP A;  1PFM A;  4O2D A;  5KRU A;  1MIU A;  4P72 A;  2F4V L;  4JI2 L;  4IUP A;  1H9J A;  2K04 A;  1B70 B;  3TBI B;  4X64 Q;  3S1N H;  4I7A A;  2NWG A;  4RCO A;  4AYB B;  5CV5 A;  4ZUJ A;  4DAY B;  1ENC A;  4R4I A;  4RHS A;  5EAY A;  3TRZ A;  5COY A;  2QW7 A;  1SRU A;  1VQI A;  3BG3 A;  3RMH A;  3SVM A;  1Z6H A;  4C2M B;  2M2L A;  5EPJ A;  4K6L A;  4F7X A;  3PO3 H;  4DAY A;  3WOF A;  4LF6 L;  2XTI A;  2E2D C;  5KYI A;  4JI8 L;  3VR6 A;  2NVT H;  5EPL A;  1MI2 A;  2Z6K C;  5M3M B;  5FK9 C;  1D1K A;  2F0L A;  3CW2 C;  4JVZ A;  4G7O C;  1VQ6 A;  5CV8 A;  1LAC A;  4ZRZ A;  1X3P A;  1STA A;  2NVY H;  1BCP C;  1MBY A;  4IJH A;  3FEW X;  1H9S A;  4GLA C;  2VNU D;  3W3A A;  1FVI A;  1LAB A;  4DR1 Q;  3S14 H;  2KED A;  4QIW B;  3TP8 A;  4R1J A;  3BZD B;  3T56 B;  4GOP B;  4RH6 A;  1GUS A;  2VB3 X;  1U0L A;  2EY6 A;  1CSQ A;  2QDL A;  3K7U C;  1LYL A;  2ZJP A;  1WTV A;  3DM1 A;  2O4X A;  3I4M H;  1O7L A;  3RZD H;  1IHZ A;  1JR0 D;  2NVX B;  4WOR A;  3P75 A;  4JYA L;  1DCZ A;  4LF6 Q;  1QWY A;  5DAU A;  2P5Z X;  2PZT A;  3MEH A;  4XT1 B;  1SNP A;  4MZ9 A;  4IAL A;  3KJO A;  3U9O A;  2K03 A;  3R3O A;  3CC2 A;  2PNR C;  5JJI A;  3OTO Q;  3JAM L;  2WKC A;  1YIJ A;  4NPS A;  4YHH L;  3H0G B;  3UI2 A;  3URY A;  3PO2 B;  3NE5 B;  3U9S A;  1SYD A;  4JBW A;  4JI6 L;  1CT1 D;  3AQQ A;  1M8A A;  2AQ1 B;  3OW7 A;  5I4D A;  1A3U A;  2ZJR A;  1CHP D;  1M1K C;  1XXG A;  1QB5 D;  2KEC A;  1YEZ A;  2ZTC A;  4HMI A;  3CKI B;  1TS2 A;  1BKB A;  1PH9 A;  1K28 A;  1A63 A;  3BYY B;  3TRE A;  4C2M H;  4QUF A;  2F0M A;  4DV3 L;  1SNQ A;  4F87 A;  1XMQ Q;  1UAP A;  1BF4 A;  4A4I A;  3E6Z X;  1WCM B;  4NW2 A;  4DA2 A;  1STG A;  4I7Z C;  1VCI A;  4R4C A;  4PMW A;  4OO1 G;  3H09 A;  1PH6 A;  2F0F A;  3AFP A;  1R4Q B;  2K5H A;  3KDF A;  2E2J B;  3M4O B;  2YU9 B;  2OQ0 A;  4DV4 L;  3Q6S A;  2F52 A;  2FJ2 A;  3NBI A;  4JI6 Q;  1AW7 A;  2HCI A;  2Q2H A;  2K75 A;  2L0C A;  3NEL A;  1BVS A;  2F4I A;  2M00 A;  3KK7 A;  3TQY A;  3G48 A;  4B9W A;  3DUZ A;  3BU2 A;  3HKZ E;  2NZH A;  4GKK Q;  2R6G A;  2LKV A;  2F0O A;  3J81 L;  2QIL A;  5C0X I;  1TWF B;  1F9S A;  3R8B A;  1ICW A;  1ASZ A;  1PVO A;  3GTO H;  3NK9 A;  1G29 1;  2B63 H;  2EXZ A;  4FXK C;  2CWA A;  2Q8I B;  1NJI C;  1CHQ D;  4HED A;  2NVX H;  3TEH B;  1SN8 A;  5K36 G;  3HEJ A;  4QF4 A;  5CV9 A;  2Z1C A;  1PTO B;  1TWA B;  1HNW L;  3J7A V;  1T5E A;  1JCK B;  1F2Z A;  2J4X A;  2QKI C;  2PI2 A;  3BJU A;  3L7Z C;  1L1O B;  1LO5 D;  1ZXT A;  3H0G H;  2F0U A;  4RKL A;  1O80 A;  2CW0 D;  4JOI A;  5M3F B;  1PH2 A;  3A8K E;  4K5V A;  4C3I G;  1XWE A;  4DV7 Q;  1GUG A;  1IKL A;  4R9W A;  4TVA B;  5E4W C;  2Q8T A; 
#chains in the Genus database with same CATH homology
 2IPK D;  3T51 B;  2JA6 B;  3BDC A;  4M1U B;  4O42 A;  1X32 A;  4X3T A;  5JPM C;  3Q23 A;  5DM7 3;  2AWN A;  2NZ1 D;  3S1M B;  3H6M A;  1EEI D;  3OOC A;  3MXP A;  4DK1 A;  4V0B A;  3NUC A;  1IYV A;  3VR4 A;  4OIK A;  2EYM A;  5CV4 A;  5ELB A;  5IGF A;  3A55 A;  3LWE A;  1PRT C;  2F0T A;  1Y8N B;  3J80 L;  5C3X A;  2NB0 A;  4C1N K;  4LAA A;  3RUZ A;  1EYC A;  3D4D A;  3F2U A;  4F8M A;  2E74 C;  1KAB A;  3D8G A;  4KY7 A;  1I3Q B;  5D3I B;  2R7Z B;  2FHT A;  1BR9 A;  3G7L A;  5I9P A;  5C4Z A;  5ELD A;  5C4J B;  2IX0 A;  4IUN A;  3SDZ A;  2D62 A;  3T53 B;  1A2T A;  2R61 A;  1IYU A;  4MIU A;  2PYK A;  2NVQ B;  2IJ0 A;  2D2C C;  2LFN A;  4RWS C;  1YNN D;  1NCV A;  1XYI A;  1PTO H;  3TZU A;  1TU2 B;  2AUK A;  4N9T A;  4QB4 A;  4PV1 C;  3C3L A;  2BA1 A;  4ZLT F;  1LTI D;  1HFN A;  4C3J G;  3NWS A;  1EL0 A;  1I6V C;  1TWH B;  2WV6 D;  4LJZ C;  1B9M A;  3P20 A;  1JOR A;  1TII D;  2F0H A;  3PUW A;  1HQR D;  5EJW A;  4KJO A;  4BA1 I;  4DU9 A;  3K5O A;  2F0J A;  1JWU D;  1E2Z A;  1UNS A;  3IL8 A;  3A7A B;  4G57 A;  4DFA A;  5EBD A;  4K8I A;  3QWN A;  3DWA A;  3IAY A;  1FNW A;  1B2T A;  1MD2 D;  5EQ0 A;  1B1Z A;  1Q1B A;  3I91 A;  1A3T A;  4ABN A;  2K6A A;  4G4K A;  1LTT D;  2BCO A;  4G7H C;  4IUR A;  4J6H A;  1D6E C;  2B2Y C;  1KDC A;  3LWU A;  3HGB A;  3NXW A;  2FMM A;  3S15 B;  2Q8R E;  1QE6 A;  2B8F A;  2F0G A;  1R9T B;  4A3G B;  5ELE A;  4C3H G;  1UEA B;  2F0W A;  3CU7 A;  1D5M C;  3CRK C;  2AQ3 B;  1K8M A;  4B08 A;  4TSS A;  4XXE A;  2DY8 A;  2A5H A;  4U67 3;  3MHB A;  4DN4 M;  2IL8 A;  2IW3 A;  2L11 A;  2IX3 A;  1AN8 A;  2B2V A;  2MPM A;  4U68 A;  3X3N A;  5LL6 X;  1EY0 A;  1X3Q A;  3SHL A;  4FO2 A;  5I9O A;  3OWE B;  5D65 A;  1QCB D;  3D4W A;  3S1R B;  4X3S A;  4OL7 A;  1WTX A;  5FOB B;  1OXT A;  5I2Y A;  1EY5 A;  4WJW A;  2Z4H A;  2ICE C;  3I4L A;  2D9U A;  3MFY A;  1OXX K;  1VDZ A;  1WD0 A;  1LT3 D;  1DON A;  3VA7 A;  4J8Q A;  3P7J A;  4UDU C;  4CJ1 B;  1U4P A;  2O5I C;  1PZJ D;  2EJG C;  4BBS B;  1PTO C;  4Q5V A;  4XT3 B;  5FKA C;  4A3B B;  1JC7 A;  1EOT A;  1B44 D;  3DXJ C;  1JQY D;  2VB2 X;  1BO0 A;  4BY1 B;  2R93 B;  4ILW A;  1U4L A;  2J7Z A;  1YNJ C;  1NAP A;  4KY6 A;  4KKU A;  1GXD C;  1EQV A;  2EVB A;  4CKE A;  1I6H B;  1I50 B;  1QJO A;  2DNE A;  3X3M A;  1BXT A;  3BVZ A;  5IT9 E;  3OIQ A;  4OO1 I;  2RQX A;  5KIX A;  3A8J E;  4FF4 A;  4G7Z C;  4HSV A;  1Z47 A;  4KD3 A;  4DNT B;  1EQT A;  4DK0 A;  1IKM A;  4PQX A;  4A93 B;  1Y8O B;  4KN4 C;  1HUN A;  1H9R A;  3MXG A;  3PV0 A;  3CHB D;  1C48 A;  2L1B A;  1EWC A;  2RVL A;  1PZI D;  1ESR A;  3PUY A;  3GV6 A;  3NTI A;  4XYO A;  2X6L A;  2D5D A;  3MXU A;  1G6Z A;  1CQV A;  1TQO A;  2KHS A;  4PMC A;  1ZEQ X;  2A69 D;  3S17 B;  3FRP B;  3GTM B;  4FXD A;  4H0L C;  3I73 A;  3SXH A;  1HTL D;  5M9O A;  2TMP A;  1SMY D;  2L12 A;  3OIP A;  2EY5 A;  1S5B D;  3MAQ A;  1D5Z C;  4NP5 A;  1GUT A;  1KLG D;  1I4P A;  2IX1 A;  2XVS A;  3SK8 A;  1OXV A;  1Q3L A;  1B4O A;  4MN3 A;  5A2Q L;  2PMZ B;  2NBF A;  2RDF A;  2K5D A;  3SK4 A;  3TP6 A;  1H9S B;  2FIN B;  3M3Y B;  1T5X D;  1F2M A;  4K5W A;  3R93 A;  2BE5 D;  2JP1 A;  4BBR B;  2K33 A;  3N52 A;  1JOO A;  1V8Q A;  4FF3 A;  3BYT B;  4FVM A;  5F2D A;  1JWS D;  4XIG S;  3S16 B;  1ZKO A;  5AFW A;  4O1N A;  1WTQ A;  4FF2 A;  1WVL A;  1JIC A;  2PO4 A;  3C1E A;  1JOK A;  1EFI D;  2DNC A;  1M4V A;  3KLR A;  2LMC B;  3DHQ A;  3OSO A;  3PUX A;  1FNU A;  2NYZ D;  3Q24 A;  2OEO A;  1BUV T;  1S4Z A;  1VMP A;  2CW0 C;  3HRZ C;  1G2S A;  2A68 D;  3ERO A;  3ERQ A;  1RDP D;  2F3V A;  2C9O A;  1EYA A;  2AWO A;  1HCZ A;  2NN6 H;  2WKD A;  2RSN A;  3EA6 A;  3K7A B;  4ZKB B;  3V96 A;  1ZYR D;  2F0E A;  3R2I A;  1VF5 C;  4Y7N B;  5I2X A;  2EYP A;  1STE A;  4E6I A;  1TR5 A;  5C3E B;  1Q90 A;  1I4Q A;  2EY2 A;  2BOS A;  1F9P A;  5LHY 1;  4K2L A;  2KA7 A;  1TY2 A;  1FR3 A;  1H9K A;  2K01 A;  1TWC B;  2K05 A;  4FXG C;  2EYJ A;  5ISR A;  1SYG A;  2EY1 A;  1NSN S;  1EY7 A;  4KI0 A;  1RF2 D;  1R4P B;  3MVV A;  3NSW A;  4A3I B;  1EZ6 A;  1EU3 A;  5HGT A;  3MXN A;  2XNA C;  5E1F A;  1GOZ A;  4DGZ A;  1STN A;  1TVX A;  2A6E D;  5JPN C;  1V43 A;  1GHJ A;  5CYU A;  3GTG B;  3BVG A;  3GV3 A;  1E0B A;  4BWG B;  1G2T A;  3KLS X;  1LTS D;  2SDF A;  1RTO A;  2NTT A;  3M85 A;  1SBB B;  3EJI A;  1DXM A;  2PW5 A;  4Z9C B;  3SE0 A;  1O78 A;  2JEA I;  2R3Z A;  2IWH A;  5JEA G;  4CKC A;  2I07 B;  5C44 B;  2B2U C;  1S5D D;  1ET6 A;  3T13 A;  1HFG A;  5FO8 B;  4CJ2 C;  3D4R A;  1BCP D;  1TT2 A;  4NKL A;  5CMD A;  4DNR B;  1VF7 A;  4OGQ C;  2RDH A;  3PUV A;  4IFD H;  2DN8 A;  1E2V A;  1HTP A;  2E75 C;  5M5W B;  4GZY C;  5JEA J;  1K83 B;  5EBC A;  3IFD A;  4Q0F A;  2PW7 A;  3S9W A;  1EZ8 A;  3MC0 B;  2RDG A;  4ZUI A;  1EY9 A;  1BCP F;  3D6C A;  1SJE D;  1AP0 A;  5KNB A;  4KK7 A;  4JK1 C;  1S5C D;  2WIN B;  1STH A;  1DJR D;  5FO7 B;  1PMR A;  1SNC A;  3VYS A;  2B2W C;  1A6X A;  1AZQ A;  2XRS D;  4A3K B;  2EE1 A;  2ZT9 C;  1U4R A;  1ONL A;  2AQ2 B;  5T1I A;  2KCC A;  2ZXR A;  2VXW A;  5K36 H;  3IKJ A;  5CV6 A;  3VR5 A;  1WTW A;  3K58 A;  1SAP A;  4K5X A;  1I4R A;  2SNM A;  1CM9 A;  1QIL A;  3QJY A;  3BDO A;  3VYU A;  2RSO A;  3TZD A;  1SYE A;  3H94 A;  3K6O A;  5JAV A;  1B53 A;  4KKS A;  2C5C A;  1G8Z D;  3KBG A;  4ZQ3 A;  5IGG A;  3LNN A;  5I6W A;  5D3D A;  5LL6 S;  5EKL A;  1Y8P B;  4EQP A;  2AUJ D;  1B50 A;  1J9O A;  3MA2 B;  1JWM D;  1W6J A;  3K5M A;  3Q0A A;  2EPB A;  2F0N A;  2MJ8 A;  2SEB D;  1V1O A;  1BCP B;  1FGB D;  5ELF A;  2WII B;  5JOB A;  2B8G A;  3K59 A;  2EDG A;  2EOT A;  3HOX B;  1Y1W B;  1DYQ A;  3R2T A;  4CJ0 B;  4FP5 D;  4ZK9 B;  3NP8 A;  1GUN A;  5C5L A;  4C3H B;  1SJH D;  2HDL A;  4A3J B;  4R8I A;  4RCN A;  3C46 A;  4IUQ A;  2BDO A;  2O5J C;  1HXY D;  5T1G A;  1SYB A;  5ELC A;  4ODG A;  1AZP A;  3I4N B;  2WAQ B;  3J7A F;  1WTP A;  5FLX E;  2F0D A;  1F9Q A;  1D2B A;  1BNZ A;  1II3 A;  3S2D B;  3FPP A;  3K5L A;  4TRD A;  1RTN A;  1PRT D;  2B2T A;  1F2Y A;  3NQI A;  4KHZ A;  4KV6 A;  5IOD A;  2F0I A;  3QG1 A;  5JVH 3;  3WDN A;  3HOW B;  1K8O A;  2E2H B;  4RAU C;  5C4H A;  5C0X H;  1WTR A;  2PPB C;  3FPU B;  4XQN A;  1EY4 A;  2LY7 A;  2A69 C;  2EJM A;  1PRT F;  2E76 C;  3NHH A;  1TS3 A;  5M5X B;  3K5N A;  1GHK A;  2BA0 A;  4CGY B;  5CV7 A;  4IUT A;  4M8A A;  3CQZ B;  1Y1V B;  1AFP A;  4HAE A;  2KCN A;  1EEF D;  3I72 A;  3FVQ A;  1TKW B;  1B9N A;  1HPC A;  2HCC A;  1OXS C;  1SFO B;  4A3E B;  5DNF A;  1BQQ T;  1H9M A;  4DXF A;  1PLF A;  1L0Y B;  1E2W A;  2Y0S B;  2JA7 B;  1KAA A;  2PZW A;  1A3V A;  3M7G A;  2BE5 C;  1Q8I A;  1D1I A;  2YYZ A;  3OHX C;  3MFG A;  3M4Y A;  2PZU A;  4P2C B;  1F9R A;  4K8J A;  4KKT A;  3VR2 A;  5C4X B;  4C1N I;  3DEO A;  2FFK B;  3SK6 A;  1A2U A;  2K1B A;  5TSS A;  1FYC A;  4KMU C;  3PO3 B;  1LTA D;  2VUM B;  4X3K A;  1FNV A;  3KF8 A;  3PIO 3;  2QF7 A;  3AU7 A;  1HHV A;  2A74 C;  5BN4 A;  1OXU A;  1ENA A;  3A56 A;  3MZ5 A;  4H44 C;  4H7B A;  2CQA A;  4L63 B;  3D6W A;  1XX8 A;  1A15 A;  5E4X A;  3QB3 A;  1HRJ A;  1SND A;  4A3M B;  3PMF A;  1Q12 A;  2QCP X;  3QIA A;  4FYD A;  3DEP A;  4PNY A;  3HZX A;  1IW7 D;  4XTC S;  1PRT B;  1L0X B;  1CFM A;  1SE2 A;  2H4O A;  1PYW D;  3RZD B;  1VMC A;  2XIW A;  1SXT A;  4EQN A;  5JJZ A;  3V2T A;  3VR3 A;  1BOS A;  3JAM E;  1S5F D;  3ONA B;  2L9H A;  3AB9 A;  4K14 A;  4R8N A;  4IQZ A;  1MSH A;  2A6H D;  3SR1 A;  1SNM A;  4RKB A;  1ENF A;  3QO2 A;  1DM0 B;  5EKI A;  3NTH A;  3AMU A;  2EYL A;  2A6E C;  3S2H B;  2EZV A;  3CRL C;  2G9H D;  4ZKC B;  4ULL A;  2RBM A;  1TS4 A;  3C2P A;  3DWQ A;  2NN6 G;  3WOE A;  2EYH A;  4RGT A;  2ICI A;  5IGD A;  1ESF A;  1U9R A;  1EWH A;  1GUO A;  1KTK A;  4DAV A;  3NPP A;  4DXG A;  3TP7 A;  1Y69 U;  5D14 A;  4ZYS A;  3KBX A;  3BS1 A;  5CC4 A;  1LTR D;  3N6R A;  1I4H A;  4BA2 I;  3Q22 A;  1F2L A;  1PTO D;  5IT9 L;  4IN3 A;  4ME5 A;  4CHT B;  3J81 E;  1LT6 D;  2ZXO A;  3OMG A;  3FMC A;  2F03 A;  3DWP A;  1YNJ D;  3TP5 A;  1TY0 A;  3GTO B;  3EVQ A;  2B63 B;  2M9V A;  1CTM A;  1B3A A;  3HP3 A;  1DZ1 A;  3QOL A;  1JB3 A;  2JA8 B;  2K32 A;  2B2T C;  5IGC A;  1PTO F;  5KEE A;  3L3O C;  1TS5 A;  2F0P A;  4YIJ A;  2MGS A;  2PQE A;  1CI3 M;  2KUM A;  4HSP A;  1O7Y A;  2I46 A;  4F88 A;  1KDA A;  4XDX A;  3RLF A;  1QNU A;  3O13 A;  3FDT A;  1MGS A;  2Z8L A;  3GTJ B;  4EQO A;  3ND8 A;  4RA8 A;  2B2V C;  1SYF A;  5IGE A;  1ROD A;  2WB1 B;  2B2Y A;  1Q1E A;  2F0S A;  1CZG A;  4C56 C;  2JEB I;  3K57 A;  5EKK A;  2E2I B;  2Z4I A;  4OIJ A;  4QMG A;  3KLS A;  4IFD G;  2ENB A;  1STY A;  4KY5 A;  3OPO A;  1LT5 D;  1J8I A;  3VYR A;  3J80 E;  1PDQ A;  2XWJ B;  3I8Z A;  1SDF A;  3T4A C;  4UAI A;  3NWT A;  1D5X C;  5NUC A;  4LMQ D;  3I3C A;  5C5M A;  3E0J A;  3A7L A;  1YNN C;  1NUC A;  2JSO A;  1ET9 A;  2EYO A;  1S5E D;  1KLU D;  4RHR A;  5HUR A;  4C3I B;  3PIP 3;  5IIF A;  4OHJ A;  2JA5 B;  2JYO A;  5J39 A;  1HUM A;  2ID0 A;  1Z7T A;  4KN7 C;  2XN9 C;  4IFD J;  4CBV A;  1NR4 A;  2CHB D;  2TSS A;  4LK1 C;  1SYC A;  4K6D A;  1LLR D;  3C1F A;  5IOC A;  4V19 0;  5J22 A;  1U4M A;  3GTK B;  4KTA A;  2WP8 J;  2QDB A;  2K28 A;  2SNS A;  2L4N A;  4OO1 H;  1KNE A;  2HDM A;  5CGK A;  2RA4 A;  3GP7 A;  3GQB A;  3GTL B;  1EY6 A;  3BDL A;  1BBX C;  3HOZ B;  4QCL A;  3ND9 A;  3K0Y A;  1JOQ A;  1SE4 A;  4KHV A;  5DM6 3;  2N88 A;  4TKO B;  4XQJ A;  3GTP B;  2BDN A;  3BVM A;  4HN7 A;  5COR A;  5E3F A;  1CZW A;  1RD9 D;  5JEA H;  1CK1 A;  1PFB A;  4RGO S;  1SEB D;  2KQ3 A;  2OXP A;  3J7Y W;  1TWG B;  5EGT A;  4ZAI A;  1NR2 A;  1DOM A;  1OO9 B;  5KYL A;  3IFT A;  4A3D B;  1XTC D;  2HUG A;  4IUV A;  4A3F B;  4C3J B;  4J1M A;  1CQF A;  3GTQ B;  1SE3 A;  2L5T A;  3QOJ A;  4XQQ A;  3I90 A;  2B39 A;  1ILP A;  1DOL A;  3G6J B;  3HOV B;  5EPK A;  2F0K A;  3D3R A;  1MSG A;  3V05 A;  2H1E A;  3NTK A;  1BDO A;  2V4D A;  3M7N A;  4HCE A;  3HOU B;  4K2K A;  3PUZ A;  1G91 A;  1O7Z A;  2HQE A;  4KJN A;  1EIH A;  1QOH A;  2N55 A;  4FNF A;  4WFN 3;  2RKS A;  3KUP A;  4HR7 B;  2MUY A;  1RHP A;  4DF7 A;  1CA6 A;  2DY7 A;  3P1H A;  2KVM A;  2MHV A;  2NUC A;  5A35 A;  2JXM B;  3L9A X;  1LT4 D;  3EQL C;  4TQU S;  3RD4 A;  4EVO A;  3ZYY X;  3VA5 A;  5C0X G;  3VYT A;  1AEX A;  4KD4 A;  3H3V C;  1WD1 A;  1V1P B;  2EJF C;  5KNC A;  4RFB A;  4IZ8 A;  1IL8 A;  1EIG A;  3TN2 A;  2EYF A;  2FMC A;  1I4X A;  1ML0 D;  1RJT A;  5BN5 A;  2L55 A;  1LV9 A;  2F3W A;  3S1Q B;  3TSS A;  3HG9 A;  5J1Z A;  4IUU A;  3A8I E;  1CA5 A;  1V1P A;  5G3L D;  4HTH A;  1GUW A;  2CVR A;  3EFX D;  1C4Q A;  5CBA E;  4S3S A;  2F0V A;  5C0X J;  2NN6 I;  5KND A;  1IW7 C;  3HOY B;  3FKI B;  2GA4 B;  3I70 A;  5C6A A;  2ZXP A;  1W6K A;  3DMU A;  3A54 A;  5KGU A;  5CBE E;  5IGB A;  2J0T D;  1SNO A;  1STB A;  1JE4 A;  2F0Q A;  3TME A;  1F77 A;  1EY8 A;  5I6Y A;  3GO5 A;  1SMY C;  2KJX A;  1KNA A;  2K5Q A;  5G3L F;  4HCS A;  3MTS A;  2A73 B;  4RGN A;  1FD7 D;  2A6H C;  4BY7 B;  3NQT A;  3LX0 A;  3ITP A;  3TDQ A;  3E5S A;  4B9X A;  2XWB B;  2O2L D;  1LTG D;  1RCV D;  1HA5 A;  3OMC A;  1PXU A;  2QEJ C;  4RGM A;  1KDB A;  1C8C A;  5M5Y B;  1WTO A;  1PZK D;  2R92 B;  3HKZ B;  4HMJ A;  4H13 C;  1DD2 A;  4X3U A;  2XSC A;  3S1N B;  4CKB A;  2KOL A;  5K5P A;  1ILQ A;  2NTS A;  2OT2 A;  2X6G A;  1PFN A;  5A2Q E;  2LS0 1;  5CR3 A;  4MHE A;  3GD7 A;  1QNK A;  5FLX L;  3RZO B;  2B2U A;  1HQM C;  2OF1 A;  4WRD A;  1HA6 A;  4DAP A;  2PCF B;  4QUC A;  2SOB A;  4L6T B;  2NVT B;  2K7V A;  1LTB D;  1RKN A;  1EU4 A;  2A68 C;  2WAC A;  4EGV A;  4NMZ A;  3W2D A;  3SEB A;  3MWY W;  4XYQ A;  1UUP A;  2NVY B;  3HS0 C;  4BS9 A;  1SSO A;  4FF1 A;  3D31 A;  2MP1 A;  4IFD I;  5BN3 A;  4NDX A;  1I4G A;  3S14 B;  2XRQ D;  4ID6 A;  1ZYR C;  4N9P A;  5C3W A;  3H91 A;  4PMB A;  3T16 A;  3NBH A;  1EYD A;  3I4M B;  2F1M A;  4I65 A;  5DEH A;  5FO9 B;  3SK5 A;  3OWF A;  2G9D A;  5JVG 3;  4L8J A;  2JE6 I;  1DOK A;  2X69 A;  1GJX A;  2KEE A;  1QG7 A;  2B2W A;  2IT1 A;  2K5W A;  1PFM A;  5KRU A;  4IUP A;  1H9J A;  2K04 A;  3TBI B;  2NWG A;  4RCO A;  4AYB B;  5CV5 A;  4ZUJ A;  1ENC A;  4RHS A;  5COY A;  3BG3 A;  3RMH A;  3SVM A;  1Z6H A;  4C2M B;  2M2L A;  5EPJ A;  4K6L A;  4F7X A;  4DAY A;  3WOF A;  2E2D C;  5KYI A;  3VR6 A;  5EPL A;  1MI2 A;  5M3M B;  5FK9 C;  1D1K A;  2F0L A;  4G7O C;  5CV8 A;  1LAC A;  4ZRZ A;  1X3P A;  1STA A;  1BCP C;  1MBY A;  3FEW X;  1H9S A;  2VNU D;  3W3A A;  1LAB A;  2KED A;  4QIW B;  3TP8 A;  3BZD B;  3T56 B;  4RH6 A;  1GUS A;  2VB3 X;  2EY6 A;  1WTV A;  3DM1 A;  2O4X A;  1O7L A;  1IHZ A;  1JR0 D;  2NVX B;  4WOR A;  3P75 A;  1DCZ A;  1QWY A;  5DAU A;  2PZT A;  3MEH A;  4XT1 B;  1SNP A;  4IAL A;  3U9O A;  2K03 A;  3R3O A;  2PNR C;  3JAM L;  2WKC A;  3H0G B;  3UI2 A;  3URY A;  3PO2 B;  3NE5 B;  3U9S A;  1SYD A;  4JBW A;  1CT1 D;  1M8A A;  2AQ1 B;  3OW7 A;  5I4D A;  1A3U A;  1CHP D;  1XXG A;  1QB5 D;  2KEC A;  4HMI A;  3CKI B;  1TS2 A;  3BYY B;  4QUF A;  2F0M A;  1SNQ A;  4F87 A;  1UAP A;  1BF4 A;  3E6Z X;  1WCM B;  4NW2 A;  4DA2 A;  1STG A;  4I7Z C;  1VCI A;  4PMW A;  4OO1 G;  3H09 A;  2F0F A;  1R4Q B;  2E2J B;  3M4O B;  2YU9 B;  3Q6S A;  2FJ2 A;  3NBI A;  1AW7 A;  2HCI A;  2L0C A;  2F4I A;  2M00 A;  3KK7 A;  4B9W A;  3DUZ A;  2R6G A;  2LKV A;  2F0O A;  3J81 L;  2QIL A;  5C0X I;  1TWF B;  3R8B A;  1F9S A;  1ICW A;  3NK9 A;  1G29 1;  2EXZ A;  4FXK C;  2Q8I B;  1CHQ D;  4HED A;  5K36 G;  3HEJ A;  4QF4 A;  5CV9 A;  2Z1C A;  1PTO B;  1TWA B;  3J7A V;  1T5E A;  1JCK B;  1F2Z A;  2J4X A;  2QKI C;  3L7Z C;  1LO5 D;  1ZXT A;  2F0U A;  4RKL A;  1O80 A;  2CW0 D;  5M3F B;  3A8K E;  4K5V A;  4C3I G;  1XWE A;  1GUG A;  1IKL A;  4R9W A;  2Q8T A;  5E4W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...