4A76A

The lin28b cold shock domain in complex with heptathymidine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
PQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
molecule keywords LIN28 COLD SHOCK DOMAIN
total genus 18
structure length 86
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a76A00
4JV5L 5C4JH 3NELA 1Q81C 2E2IH 3HOZH 1A63A 4OWXB 3RLFA 3L0OA 1FJGQ 3HOVH 1S72A 4JI5Q 3GD7A 2RHSB 4GN5A 3T1HQ 1ASZA 4A93G 1OTCA 3LGJA 4POFA 3K7AH 3KYHC 2AWOA 2VY3A 4OONA 2JA7H 5IWAL 2Q2IA 4JBMA 2JEAI 2AWNA 1L1OC 4YWMA 1Q46A 4HJ7A 4OO1I 4JOIA 4A4IA 4A93H 3PV0A 1VQLA 2MQHA 1P8LA 4JOIC 4DR6L 3MEFA 2WAQE 3H0GH 2Y0SE 4A3EH 3S1QH 3TS0A 1N34Q 3KDFA 3F1ZA 4A3BH 1HNWL 3HOXG 1B70B 4AYBG 4K0KL 4YCVA 3S16H 5GADC 1HNXQ 1C0AA 1PYBA 3H0GG 2HQLA 1M1KC 1VQBA 1I94L 4GOPB 4QQBX 5FJ8H 1XPOA 3HOUH 4UY8C 5AJ3Q 3S24A 1HZAA 4GS3A 3F2DA 2BH8A 1IBKL 3I4NG 3U4ZA 4JV5Q 3ERSX 2I0QA 1QVCA 3CF5A 1OXSC 1D8LA 1V1QA 4HJ5A 3CCJA 1YEZA 1XMOL 2KENA 1X54A 1L2FA 4DV1L 1UE6A 2ID0A 3GDEA 3CC7A 1P16A 3OW2A 3PUYA 4OX9Q 1PH9A 4UPAA 4DR2Q 2E5LL 2UXCQ 1C9OA 2JA5H 3RZOH 3IRBA 4IJHA 5C3EH 1Y14B 1BBWA 3RN5A 4NB3A 2PQAA 4A3KG 1OXVA 2ZTCA 2VS1A 4B3MQ 1YVCA 3JAMi 3CC4A 4R4TA 2UUBQ 2IX1A 2F4VL 1Q8KA 5IP9G 4X65L 3D0FA 4A3CH 1TWGH 2A8VA 3HOVG 1VQ7A 2D0PA 3OYYA 2LSSA 5GAEC 1G291 1PA6A 1AE2A 4R4QA 4JI2L 4A3IG 5M3MG 3KF8B 3A74A 2XGTA 2LXJA 4DUZL 1XNRL 2YTXA 4A3MG 1UE5A 2IT1A 2RF4A 5IYBG 2IX0A 1KIXA 1XNQL 4DV6Q 4DAMA 1I3QH 1L0WA 2D0OA 3UDXA 1HR0L 4GKKL 4A3LH 5M3FH 1HZBA 1BBUA 3H15A 3PO2H 4A3EG 3KF6A 5GQOA 4LFCQ 4DV1Q 4IFDJ 3PUWA 5JEAJ 4LF7L 5IYDH 1QUQB 1VQJA 1SR3A 4BY1H 3AQQA 1KD1C 3TQYA 4KHPQ 3BJUA 5IP7H 1N33Q 4L5QA 4X66Q 2JK8A 2UU9Q 1VQAA 4A3GG 4A3FH 1PH5A 2PNHA 1W3SA 2JQOA 1NTGA 3CCSA 1V43A 2N78A 5C3EG 1N9WA 4JI6L 2ALYB 4PMWA 2NVTH 1AE3A 4MNOA 3H3VI 5IYCH 1SROA 2K4KA 1YI2A 2VQFL 4DV0Q 4B3RL 3AYHB 4NXNQ 4GNXB 1L1OB 3RR5A 2PI2E 4DV4Q 2JA8H 4BBRH 4KHZA 2HHHQ 1GD7A 4LFBQ 2MNAA 3G6EA 3CCUA 2D62A 4IOCA 1LUZA 1IBML 4BY7G 1GKHA 4DR4L 1YJNA 3CC2A 3UDIA 3K80C 3GTPH 1VQHA 1SN8A 1L1OA 1XPRA 1TXYA 2A19A 4Y52H 2NVYH 5LMUQ 3HFZB 2UUCQ 1Z47A 2A1AA 2ZM6L 2KHJA 2PMZE 2ZTDA 3UE1A 1PH4A 4DR1Q 1PH1A 5JJLA 5GAHC 1N36Q 4GNXC 1GM5A 2E2JH 4DR7L 2WB1G 3HOYG 3J7A5 3U4VA 2ASBA 1BKBA 3AFQA 4GOPA 5IYDG 4AQYQ 1CKNA 4DR7Q 2JEBI 3E9HA 1J6QA 1G6PA 3K0XA 4DUYQ 3E0EA 1Q12A 3TEHB 4J15A 2QA4A 4X62L 1Z9FA 1IXRA 4DUYL 1QVFA 4A3LG 1I5FA 2UXBL 4JYAQ 2K75A 5HGQA 2UXBQ 4DV2Q 4AH6A 2MO1A 2B3GA 4JI4L 2F3IA 4IOAA 2XTIA 3GTJH 2Y0SG 4YY3Q 3GTOH 4BY1G 2JA8G 2N8NA 4JBKA 1EOVA 4C3JH 1LYLA 3S1RH 1XMOQ 3CXCA 3M4PA 4JI8Q 3ZJYC 1Q7YC 1FGUA 2HT1A 4B3SQ 2LXKA 4OO1G 1XMQL 2K5HA 5EAYA 1N36L 1S3OA 3I55A 3J81c 2GVAA 4P73A 1XJVA 2VUMH 3CCLA 1YNXA 3CCVA 1Q82C 5HY6A 5C4XG 1A8VA 3HOYH 1NBWA 4OWTB 3J81i 1A62A 1SLJA 2YTVA 3M7NA 2UXDQ 2IHFA 4NPSA 3PCOB 2CCZA 2VUMG 1KRSA 4LF9L 1M90C 3CAMA 2QEXA 1VQ5A 1XNQQ 3CCEA 2Z6KA 1IBKQ 2WAQG 4JI7Q 1MJCA 3KOJA 4YHHQ 4YCUA 4DUZQ 5JJIA 1I94Q 1KAWA 4LF7Q 2OQKA 4RG1A 4JI0L 3JC66 1N32Q 1E24A 5M5XH 3NBHB 4A75A 3T1YL 4YY3L 1RL2A 4P71A 4Y7NH 1CUKA 1NMFA 3BZCA 1Y1WG 2BA0A 1EQRA 4JI0Q 3AEVA 4A3JG 4JG2A 3CD6A 5LMNL 5IE8A 3KJOA 3ER0A 1XPUA 3D31A 2RHQB 4LFCL 3J80c 1VQKA 4A3BG 2OTJA 2Z0SA 1BVSA 1G51A 2K52A 1HZCA 4X64L 1XMQQ 1E1TA 2E8GA 3AFPA 1TWCH 4KLKA 1PVOA 5BR8Q 4B3TL 2E2HH 4DR3L 3GTLH 2KCMA 3G71A 5IP7G 2JA6G 2E5LQ 2BA1A 5FLMG 1JB7A 3ULPA 3M4OH 1TWAH 4FDBA 4JI1L 2ZJRA 4DR3Q 4A3FG 3VDYA 2EQSA 2F52A 3CPWA 4DR5L 3KJPA 2CWAA 4JC0A 4P74A 4LF5Q 4UP8A 5M5YH 1YIJA 1TWHH 4AYBE 4DR5Q 2IY5B 3ICEA 4DV4L 1Q86C 2WB1E 2UUCL 4DV3L 2ZM6Q 3W5OA 1EUJA 4UP7A 1SE8A 3GO5A 4MTNA 4DAYB 5C44H 2R7ZH 3S14H 5K36G 1D7QA 1UWVA 2MO0A 4BA1I 4A3KH 2VZAA 3WWVA 3CMEA 1WCMH 1VQEA 3M9BA 1CSPA 1OXXK 1XTDA 4L5RC 2NN6G 1PH2A 4LF4L 2WP8J 2JA7G 4LW1A 3I2ZA 2EIFA 3F8TA 1KRTA 3U58A 4C3HH 1VS0A 2K5NA 1KXLA 3STBD 5IT9c 4L5SA 3E9IA 4LUZA 1EFWA 2NVQH 4R4CA 2ES2A 1VQ9A 2K14A 3BZKA 2OWOA 4HIKA 2NZHA 3MXNB 3PF4A 5ELNA 1FJGL 4IPDA 1JE5A 2CWPA 5FLMH 3PO3H 3PUXA 2HHHL 2VNUD 4C3IH 1QUQA 5C0XG 4YWLA 2OCEA 4ALPA 3GTMH 1PH6A 4YWKA 1OXTA 4R1JA 1EIYB 4B3SL 3J7ZC 3I4NH 3UDGA 2K5VA 4PZ7A 1X3FA 1HNZQ 4R4OA 1CKNB 3M4QA 4WJ4A 2H5XA 1YITA 4GN3B 5IYBH 1JJ2A 1VQ6A 1YBYA 3DM3A 4BXXH 2F4VQ 3J81j 1C7YA 4A3DG 4RMFA 1R9TH 3Q8DA 1KC8C 4DV5L 4LF4Q 3UE0A 1WYDA 1Q1BA 1B7YB 5IYCG 2WFWA 1K83H 1YHAA 4JI3Q 4JI2Q 4LF9Q 2AHOB 3UDFA 2Q2HA 1PV4A 1VQOA 4DV7Q 3EN2A 3NEMA 1VQ4A 4DPGA 4DV6L 2Z6KC 1VQFA 5C0XI 1A0IA 2B63G 2VQEL 3ULJA 4IFDG 5LMNW 4JYAL 5C4XH 1J5EQ 1TWFH 1HZ9A 2CFMA 1PFSA 4JCVE 1QZHA 4R4IA 4HJAA 4JI7L 2B29A 1VCIA 5LMNQ 5AJ3L 3CCQA 4A3IH 1DGSA 1X65A 4LFAL 1OXUA 1U0LA 4GKJL 3CQZH 4P72A 4QY7A 2DGYA 1WFQA 3T1YQ 4OWWB 1HNZL 1KHIA 1VQCA 3M85A 4HIOA 4IO9A 4BY7H 5IP9H 2DUDA 5M3FG 1RIPA 4LWCA 4DNIA 1K0RA 4QJFA 5GROA 3I4MG 3S2DH 4DV5Q 4OX9L 4BXXG 2VQFQ 1EWIA 4X64Q 3KF6B 3EIVA 4DV0L 1PH8A 3TS2A 2UXCL 5M3MH 4IPGA 3RLOA 3M3YH 4ME3A 2JE6I 3PIPA 1NJIC 1K8AC 2KCTA 1LM0A 1PYSB 4GOPC 3GTGH 3CCMA 4DV7L 4DR4Q 3S15H 2N3SA 3CP0A 2VW9A 3G4SA 2I5LX 2MFIA 1HH2P 1UEBA 2L15A 4JI5L 1K3RA 4HIMA 1K9MC 2KHIA 4YCWA 1IZ6A 3W1BA 1Y1VH 2B63H 4DR6Q 1UE1A 1HR0W 3OTOL 3PGZA 3A0JA 4XTCS 1HNWQ 1KQSA 4K0KQ 3OTOQ 1WOCA 4YHHL 1HR0Q 3I4OA 4LUVA 1VQNA 3KFUA 3I7FA 3F2BA 4UP9A 1S40A 2NZOA 4LF6L 4X66L 4AIMA 3HKSA 2UU9L 3ULLA 4DKAC 4PZ8A 1N34L 3BU2A 1B8AA 1MIUA 4GN4B 2R7DA 2R93H 1IYJB 4QIWE 3PSIA 1EYGA 4LF8Q 1E1OA 5JEAG 4BBSH 1LTLA 4JI6Q 3SGIA 1HJPA 1HNXL 3STBC 3W1GA 5FLXc 3S1NH 1SMXA 4GLVB 4JI4Q 3CCRA 1CKOA 1EQQA 2Q2UA 4XIGS 1W2BA 1YJWA 5BR8L 4P75A 4B3TQ 4BBSG 1VQIA 4A3CG 5JJKA 4TVAB 1X3EA 2QGQA 4LF5L 3RN2A 1U5KA 3KLWA 1H95A 3A5ZB 5J3BA 4DR2L 4KI0A 4DV2L 2KBNA 1VQMA 4JI1Q 1I6HH 2C35B 1JMCA 5IWAQ 3H3VH 3S1MH 1VQDA 3I4MH 5LMUL 2CKZB 1QZGA 2AMCB 3JAMc 2ZJPA 1NY4A 1K8GA 3L2PA 3KDFB 3T1HL 3J80i 4X6AH 1IBMQ 2OTLA 1X55A 2HIXA 4DV3Q 1E22A 2Q2TA 3PO2G 4LF6Q 4EX5A 4AQYL 4HJ8A 1EIFA 1GO3E 2YYZA 3CPFA 2AKWB 3B6YA 5FJ8G 4DR1L 3HOUG 1X56A 4JBWA 2GN5A 2OQ0A 4LF8L 4IJLA 4PZ6A 1E3PA 4WJ3M 2IHEA 2R92H 1IL2A 3K81C 4BA2I 1Y1VG 3K7UC 3FP9A 2EXDA 1O7IA 1UE7A 2PI2A 4HJ9A 3DLLA 3RNUA 2UUAL 3CW2C 2JA6H 2R7ZG 2BH2A 3A5UA 4O2DA 2FXQA 4LNQA 2R92G 4PG3A 1YZ6A 2PQAB 2V1CC 2UUAQ 1WCMG 3EBEA 4TQUS 1FL0A 2GVBA 3HOWG 1KL9A 4GNXA 2JA5G 3F2CA 4IPCA 1JJGA 1NE3A 2ZTEA 3HKZG 5E7NA 4QGUA 2R93G 4MZ9A 2R7FA 5C0XJ 1X9NA 4KHPL 3L7ZC 2ATWA 1E7ZA 4C2MH 4B3ML 2JA9A 5IY0A 4O0AA 5C44G 3PIOA 1N33L 1PHJA 3PF5A 4EQ5A 3S2HH 4DK3C 4JI8L 2K50A 4NXNL 4POGA 1CSQA 1SRUA 1X3GA 3FKIG 1WJJA 2I5HA 4HIDA 3RLNA 2UXDL 3PO3G 2NVXH 4QL5A 3TREA 4A3MH 2HIVA 1QVGA 2UUBL 1MKHA 4X65Q 4OXPA 1XNRQ 1VQGA 3FKIH 4NXML 4JI3L 5M5WH 1MJEA 4JBJA 1NMGA 2YTYA 1V9PA 2CQOA 1J5EL 4GKKQ 4IFDI 1Y1WH 4LFBL 3FHWA 4A3JH 1Q1EA 5GAGC 4NXMQ 3GTKH 3GTQH 1FVIA 2NN6I 1YHQA 1PH3A 1X6OA 1VQPA 1VQ8A 3S17H 4GLXA 1SFOH 4LFAQ 2VQEQ 4GKJQ 1GVPA 2R6GA 3G48A 3I56A 1I50H 2VL6A 1YHBA 2I5MX 4A3GH 4H02A 3HOXH 3HOWH 1N32L 3NENA 1AH9A 1WI5A 2ZJQA 4GLAC 4IPHA 1JJCB 5ELOA 2JJQA 1T9HA 4LUOA 1K73C 3K8AA 5H1SE 4A76A 1ASYA 3TRZA 1N8RC 3CMAA 3U50C 3RZDH 1PH7A 4L5TA 5DLQE 1IBLL 3HOZG 4A3DH 1JT8A 2N49A 3PUVA 4B3RQ 2YU9H 4BBRG 4X62Q 3PUZA 4APVA 2RCNA 1YJ9A 1IBLQ 1CKMA 3HKZE 4DK6C 2YV5A
chains in the Genus database with same CATH superfamily
1WVLA 4JV5L 2A5HA 5C4JH 1A63A 1H9MA 2B2UA 1YNND 1FJGQ 1IL8A 4JI5Q 2K5DA 2RDFA 4GN5A 3LGJA 4DXFA 2AWOA 2VY3A 2Q2IA 1V1PB 2AWNA 1L1OC 4C3JB 5CORA 2QDLA 2Z4IA 3H0GH 4A3EH 2TSSA 3IFTA 2TMPA 3KDFA 1TS2A 4K6LA 1Z6HA 4AYBG 2RQXA 2ZXOA 1JOKA 1HNXQ 3S16H 2KHSA 3H6MA 4GOPB 4UY8C 2L1BA 1H9JA 1Y8NB 3I4NG 1ZEQX 4BBRB 4IUUA 4FO2A 4XYQA 1D8LA 4KY5A 4HJ5A 2M9VA 1QCBD 2OXPA 1YEZA 1U4RA 1UE6A 1QWYA 3CC7A 3W3AA 4U673 3DWAA 2MP1A 4DR2Q 1LLRD 2SNSA 1C9OA 2JA5H 3RZOH 5CV9A 3SK6A 1BBWA 3RN5A 4DK0A 1OXVA 3FDTA 2KEDA 2WACA 4EQPA 1SNDA 4X65L 2F4VL 1VDZA 4A3CH 1TWGH 3HOVG 1VQ7A 1F2YA 5EPJA 4KKTA 4R4QA 1BUVT 5G3LF 2JSOA 5M3MG 3KF8B 2F0DA 4A3IG 1HXYD 1UE5A 3EVQA 5IYBG 2Z6BA 2IX0A 3TP7A 1KIXA 1HUMA 5BN5A 5C3XA 3Q0AA 4CJ0B 3PO2H 3KF6A 3PUWA 2HD3A 1VQJA 1AFPA 4M1UB 1ESRA 3TQYA 2A6HC 3BJUA 4X66Q 1R4QB 4A3FH 3C46A 1JICA 1N9WA 2ALYB 4PMWA 3K59A 1J9OA 4MNOA 3H3VI 3R8BA 2K4KA 4DV0Q 1M4VA 4HMIA 4HCEA 2KVMA 4UDUC 5K36H 4XYOA 2HHHQ 1GD7A 3CCUA 4IOCA 1LUZA 4DR4L 4JK1C 3UDIA 3A7AB 1Y8OB 4Y52H 1Z47A 2A1AA 5L37A 1RODA 4GNXC 2E2JH 3J7A5 2MHVA 3U4VA 4AQYQ 1CKNA 3C1EA 1Q12A 1S5FD 2WINB 3TEHB 4CDFC 4X62L 4DUYL 1QVFA 1I5FA 5CV4A 4S3SA 4DF7A 2LY7A 4CBVA 5HGQA 5IGGA 4DV2Q 1V1PA 5C4HA 3TZUA 4IOAA 2XTIA 2B2TC 2JA8G 4JBKA 3PO2B 3S14B 3S1RH 1XMOQ 1AZQA 1DXMA 2K7VA 4ID6A 2LXKA 2K5HA 3D3RA 5G3LD 1TY2A 2GVAA 3KUPA 5HY6A 5C4XG 1A8VA 1NBWA 3OWFA 3M7NA 5EPKA 2Y0SB 4G7ZC 4HR7B 2VUMG 3DEPA 3CAMA 1CTMA 2QEXA 1DM0B 5F2DA 3K5NA 4JI7Q 1KDBA 2P5ZX 3GTJB 4KY6A 1IKMA 3T1YL 4YY3L 1RL2A 4P71A 1K8MA 3BG3A 1NMFA 1V1OA 4KTAA 1EQRA 1LABA 1CHQD 2DJFC 4JI0Q 5LMNL 3KJOA 3ONAB 1WCMB 1PDQA 1I50B 1G51A 1E1TA 1YNJC 2E8GA 1EOTA 3SVMA 4G57A 1HCZA 4DR3L 3MXPA 1FNUA 3VR5A 2E5LQ 1TWAH 4A3FG 2DY7A 4WRDA 2EQSA 1IYUA 2F52A 1BBXC 1HUNA 3NTKA 3S1NB 5IT9E 4P74A 1H9RA 3A7LA 4DV4L 1Q86C 2WB1E 3D6WA 1CFMA 3W5OA 2BDNA 2VXWA 1X32A 4DAYB 1FD7D 4ZAIA 2CH4W 3S14H 3S1MB 2PO4A 5KIXA 1UWVA 4BA1I 3WWVA 5ELEA 1DJRD 1SYFA 5I9OA 4L5RC 4LF4L 1PH2A 2WP8J 4LW1A 4EQNA 4F8MA 2EIFA 3ND8A 1HTLD 3U58A 3Q6SA 5BN4A 1VS0A 1MGSA 2K5NA 4Q5VA 2PW7A 3STBD 4L5SA 3S1QB 3E3XA 2K14A 2OWOA 4RHSA 2NZHA 3PF4A 4O42A 2L11A 1FJGL 3PO3H 4IN3A 1QUQA 1BNZA 4JW0A 2B63B 1BO0A 4OEMB 2M2LA 1RD9D 1C4QA 1JQYD 1ILQA 2K5VA 3PIO3 1X3FA 3SK8A 2GA4B 2F03A 2FMCA 1FR3A 1R9TH 3V05A 4C56C 5CR3A 2WFWA 1YHAA 1PFBA 2NTTA 2Q2HA 1PV4A 2LKVA 1DZ1A 2F0HA 1J8IA 3EN2A 1ENFA 4DPGA 4DV6L 5LMNW 1XWEA 4C3IB 1QZHA 4R4IA 1VCIA 5LMNQ 4A3JB 1DGSA 4GKJL 4P72A 4QY7A 2XWJB 1WFQA 3TP6A 5J1ZA 1NCVA 2K05A 4R8IA 1QILA 5IP9H 1SJHD 4LWCA 4DNIA 1K0RA 2VUMB 3I4MG 3S2DH 1EZ6A 4OX9L 4BXXG 3HOYB 1PH8A 3KF6B 3EIVA 2UXCL 1PZKD 3M3YH 2L0CA 1PYSB 4A3DB 4DV7L 1H9SA 5C3WA 2F0SA 2L15A 4JI5L 1BOSA 4XQQA 2R61A 2B63H 4ME5A 1PTOC 1GXDC 2Q8RE 3BZDB 3MXGA 1B44D 3OTOL 3I4MB 4XTCS 5FO9B 3KFUA 3I7FA 4UP9A 3SE0A 4LF6L 4X66L 3NXWA 1B8AA 5I2YA 2J0TD 1LTLA 3KK7A 1HNXL 1HJPA 3T4AC 3VYSA 5CV6A 1G91A 1F9RA 1SMXA 4GLVB 2Q2UA 4XIGS 4BBSG 5EPLA 1X3EA 2QGQA 4LF5L 3AB9A 3A5ZB 4O1NA 1UAPA 2KBNA 2IL8A 1JMCA 2D9UA 1EIHA 2N55A 1EY9A 1VQDA 1QZGA 1K8GA 1I4RA 3T1HL 2OTLA 1X55A 2JXMB 2A68D 4X3TA 1EQVA 4AQYL 4RGOS 2YYZA 4DR1L 4FYDA 2RDHA 2OQ0A 4DAVA 1Y1VG 3K7UC 1BCPC 1XXGA 1UE7A 3RNUA 3PMFA 2BH2A 3PIP3 2O5JC 2FXQA 1PZID 4LNQA 2J7ZA 1LT3D 3QJYA 2R92G 1ZXTA 2LFNA 3GTQB 1I4HA 1Y8PB 2GVBA 2F0KA 3OHXC 4MHEA 3HKZG 4QGUA 3I8ZA 2A6EC 1ENCA 2R7FA 2B2VA 2JA9A 5IY0A 1STGA 3CHBD 1JOQA 5I6WA 4EQ5A 3S2HH 3NK9A 4JI8L 4NXNL 3DM1A 1X3GA 1ZYRD 4A3FB 1ONLA 2R3ZA 1QNUA 3PO3G 4MN3A 4RCNA 2HIVA 1MKHA 3QG1A 3EROA 4V190 1KDAA 4RWSC 5M5WH 1MJEA 1J5EL 2Z4HA 4GKKQ 1EWHA 5GAGC 3GTKH 1FVIA 1PH3A 4KMUC 1PRTB 2VQEQ 1ESFA 1SYGA 3G48A 1PLFA 1EYAA 5EGTA 2A6HD 2AQ3B 4A3GH 3MXUA 1N32L 1WI5A 1NAPA 2ZJQA 1JJCB 3HS0C 5ELOA 1I6VC 5CV7A 1B53A 2V4DA 3K8AA 5H1SE 1ASYA 1PTOF 4OIKA 1JT8A 3PUVA 4X62Q 1AZPA 4R9WA 2YV5A 1DOLA 1PXUA 3HOZH 4HAEA 4OWXB 3RLFA 1HQMC 2JA6B 1Y1WB 3OMGA 1O7YA 2RHSB 5E3FA 3T1HQ 2IWHA 4MTKA 2K5QA 3K7AH 3KYHC 5CYUA 1NR2A 4OONA 5IWAL 3S1RB 4HJ7A 4A93H 3PV0A 2MQHA 4JOIC 5IGBA 2RA4A 1CZGA 3S1QH 3TS0A 1N34Q 3F1ZA 1D5XC 1R9TB 1JWUD 2K1BA 3RZDB 4BBSB 1EY6A 4K0KL 1BCPD 4YCVA 4QQBX 3IKJA 3SHLA 1EWCA 4DNTB 2BH8A 3BVMA 3U4ZA 5JVG3 3ERSX 1OXSC 5EBDA 1V1QA 3CCJA 1CA6A 3C1FA 2KENA 4C1NK 2JA7B 1SYCA 4ZQ3A 4FNFA 2XN9C 4UPAA 1G8ZD 1AP0A 1EQTA 4RCOA 1SMYD 3IRBA 4IJHA 4RA8A 2ZTCA 4CDCC 2D0PA 4RAUC 5GAEC 5C4XB 1AE2A 1EYCA 3E0JA 4JI2L 5KRUA 2XGTA 2LXJA 1SMYC 1TU2B 2QILA 2HCCA 3VYRA 1XNQL 1U4LA 1L0WA 1HR0L 1JE4A 3UDXA 4A3LH 4I7ZC 1HZBA 4ZKCB 4LFCQ 2D5DA 3P7JA 4DV1Q 4IFDJ 5JEAJ 4OELB 4LF7L 2XRSD 4A93B 3AQQA 4KHPQ 5IP7H 1UEAB 4FXGC 5M3MB 4A3GG 1PH5A 1W3SA 2HUGA 3P1HA 2N78A 5C3EG 4OO1H 2E76C 5IGFA 1CI3M 1AE3A 3KLRA 1DCZA 1SROA 4B3RL 2VQFL 4IUQA 2PI2E 1LTRD 4PMBA 2JA8H 3J80E 3TMEA 3RUZA 3HZXA 4BY7G 3J80L 3K80C 3GP7A 1F9PA 3HFZB 1NR4A 2PMZE 2ZTDA 3IAYA 5KYIA 1PH1A 3HRZC 3P20A 1SDFA 2BE5C 4DR7L 3TP8A 4KJOA 2WB1G 3A54A 1ICWA 1SBBB 5IYDG 2QF7A 5I2XA 1J6QA 3K0XA 2QA4A 3BS1A 1CHPD 2UXBL 1STAA 2R92B 5NUCA 2EYHA 4JI4L 4BY1G 2N8NA 2WB1B 1F9SA 1KNEA 3M4PA 3ZJYC 1LTGD 1Q7YC 2HT1A 3FPUB 1LTBD 3VR6A 1N36L 3I55A 2B8FA 3J81c 2VUMH 3CCLA 3NE5B 1Q82C 3I73A 4XXEA 3S2HB 4OWTB 1A62A 2YTVA 2UXDQ 5KNCA 2IHFA 5M9OA 2CCZA 3M3YB 2L5TA 1XNQQ 4C3HG 3CCEA 1BCPF 1S5DD 1BDOA 1IBKQ 1CA5A 1MJCA 5M5YB 3KOJA 4YHHQ 4DUZQ 2D2CC 1WTHA 1AEXA 4IUTA 4LF7Q 2F0TA 1E24A 4A75A 4J6HA 2EZVA 4LK1C 1Y1WG 3AEVA 3S17B 1Z7TA 2XIWA 2RHQB 1WTQA 1VQKA 4QIWB 2Z0SA 2K03A 2K52A 1HZCA 4X64L 5KNBA 1XMQQ 2EVBA 1TWCH 1JCKB 2CW0D 2E2HH 1K83B 2KCMA 2L9HA 5IP7G 3EJIA 2K32A 2BA1A 1B50A 2EY2A 3ULPA 4JI1L 4FDBA 2ZJRA 4DR3Q 3EQLC 3MZ5A 3KJPA 4DR5L 4QUCA 4HTHA 2CWAA 1LT5D 2KEEA 2A68C 4JC0A 1YIJA 4LF5Q 2FFKB 1TWHH 4CDEC 3ICEA 1LT6D 4TKOB 3TBIB 4H0LC 3N52A 1EUJA 1SE8A 3GO5A 2R7ZH 1I6HB 1MSHA 5K36G 4XQNA 2PYKA 2VZAA 1WCMH 3M9BA 3V2TA 3KBXA 2NN6G 2JA7G 3F8TA 2KA7A 4DNRB 3M4OB 3NTIA 3RD4A 4LUZA 1EFWA 5IIFA 3HOZB 4KKUA 3BZKA 2WKDA 1QG7A 4OGQC 3EFXD 4HIKA 2F0QA 3LNNA 3LWUA 4IPDA 4GZYC 1PTOB 2SNMA 4BS9A 4R1JA 4CKCA 1DONA 3J7ZC 4WORA 1SE4A 4ZUIA 4DK1A 1HNZQ 1JJ2A 3J7AV 4GN3B 5ELCA 2F4VQ 4BXXH 1JR0D 1C7YA 2J4XA 4A3DG 1O7LA 1TS5A 4DV5L 3D6CA 5IODA 2RSOA 1EU3A 1W6JA 1K83H 5J39A 1D1KA 3NSWA 1AW7A 3T13A 1CZWA 3NQIA 2PPBC 5C0XI 1A0IA 2B63G 4DAYA 3ULJA 2K5WA 5C4XH 1J5EQ 4JYAL 4DA2A 1TWFH 4QF4A 2CFMA 2LMCB 4JCVE 4FF4A 1RJTA 4ZRZA 4HJAA 5I6YA 3Q23A 5AJ3L 3CCQA 3NBIA 3CQZH 5C0XH 3A8KE 2QCPX 3GV6A 1IW7D 4OWWB 5D65A 5C3EB 3ND9A 3M85A 5CBAE 4H44C 2DUDA 4B9WA 5M3FG 4F87A 4A3GB 3OIPA 4QJFA 1PZJD 3VR2A 4DV0L 1CQVA 5M3MH 1GUOA 1T5XD 2F0FA 2NVQB 1RDPD 4C3IG 4CJ1B 1NJIC 1V8QA 1LM0A 2KCTA 4K6DA 4GOPC 3CCMA 4CKBA 2PCFB 4DR4Q 3S15H 2CHBD 2MFIA 1HH2P 3T56B 4HCSA 4ZUJA 1UEBA 2QW7A 5E4WC 4YCWA 3K5MA 4DR6Q 5ELBA 4IZ8A 4N9PA 4MIUA 3A0JA 1HNWQ 2NTSA 2F1MA 3OTOQ 1VQNA 5IOCA 3F2BA 4DKAC 1CM9A 1N34L 1WTVA 3RMHA 2LS01 2R93H 1IYJB 1QJOA 2A73B 5TSSA 1EYGA 4LF8Q 1E1OA 5JEAG 4BBSH 1KTKA 4XQJA 3STBC 4KY7A 4K14A 2NVXB 2B2YC 2SOBA 4I7AA 3CCRA 3KLSX 3J81E 1JC7A 3RN2A 1U5KA 1NSNS 3KLWA 1UUPA 4EVOA 3GTKB 3J7AF 5EKKA 3VYTA 4PNYA 1TS4A 2OEOA 1BR9A 3OOCA 1E2WA 3GTOB 4X6AH 3J80i 4IUNA 2EXZA 1IBMQ 3F2UA 2HIXA 5FLXL 1F2LA 1S5BD 1DYQA 1EIFA 1GO3E 3CPFA 1HFGA 5FJ8G 3HOUG 4DGZA 1FNVA 5C5LA 5ISRA 2GN5A 3SXHA 2F3WA 1E3PA 1O80A 2R92H 1B3AA 3K81C 2K6AA 4HN7A 3MC0B 3NWSA 3GV3A 3M7GA 4HJ9A 2UUAL 2R7ZG 2JA6H 4O2DA 3HG9A 3SK5A 4QCLA 4PG3A 3I4NB 1WCMG 3EBEA 1A2UA 4IPCA 1EL0A 1JJGA 1YNJD 5E7NA 5M5XB 4XT1B 2RVLA 1GHKA 1MI2A 1X9NA 4KHPL 3L7ZC 1R4PB 5C44G 4QB4A 3PF5A 4DK3C 2K50A 4H13C 2NZ1D 1CK1A 4HIDA 1SNQA 4X3UA 3RLNA 2UXDL 5DM73 2G9HD 1MD2D 2NVXH 3TREA 4A3MH 3LWEA 4FXKC 4NXML 4NP5A 2CQOA 4IFDI 2JYOA 2E75C 2JA8B 1SNMA 2E2DC 2KECA 1II3A 1X6OA 4U68A 1VQPA 5FLXE 2XNAC 3KF8A 4LFAQ 5BN3A 3S17H 2AQ1B 1GVPA 2O2LD 3TN2A 4ZKBB 3NENA 5K5PA 1S5CD 5D3DA 3T16A 2L12A 3H0GB 3FEWX 4HEDA 1DOMA 1T9HA 3BDLA 4LUOA 5JVH3 1QNKA 3DHQA 1PH7A 2HCIA 1IBLL 3HOZG 1LT4D 2DNEA 2RCNA 5FOBB 1YJ9A 3TS2A 2C5CA 1Q81C 3L0OA 3HOVH 5T1IA 3GD7A 4FXDA 4A93G 1OTCA 4POFA 2CQAA 3R2IA 1MSGA 3KBGA 3V96A 4YWMA 1Q46A 4OO1I 4JOIA 4A4IA 1VQLA 4M8AA 3MEFA 2Y0SE 2XWBB 3PQIA 2X6LA 3HOXG 2KCCA 2EDGA 5GADC 1PYBA 1GUNA 2HQLA 1JORA 2Z1CA 1I94L 5FJ8H 2F0GA 3L3OC 3CKIB 3HOUH 3TZDA 3SEBA 4C3JG 1IBKL 4JV5Q 3CF5A 3IL8A 4JVZA 1XMOL 1G6ZA 3H3VC 2ID0A 1SNCA 4OX9Q 2PZUA 2UXCQ 4A3EB 5C3EH 1Y14B 1S5ED 2PQAA 4B3MQ 3JAMi 1B9MA 3CC4A 2IX1A 3D0FA 3FVQA 5J22A 4G7HC 3OYYA 2LSSA 1TKWB 1PA6A 2XSCA 1E2ZA 5IGCA 3HOVB 1XNRL 3NQTA 4A3MG 4KD4A 2RF4A 4HSPA 1BBUA 3H15A 3W2DA 5GQOA 4A3EG 4LMQD 5IYDH 1QUQB 1SR3A 1STBA 1EU4A 2MPMA 1KD1C 3MXNA 1PYWD 1N33Q 4L5QA 3I3CA 3DWQA 1VQAA 3WDNA 2JQOA 1NTGA 2B39A 1L0XB 4DXGA 1EZ8A 4IURA 1LO5D 1STHA 1TVXA 3X3MA 5AFWA 4NXNQ 1L1OB 3R3OA 4DV4Q 4KHZA 1GUWA 2FMMA 4F88A 4LFBQ 2D62A 5KYLA 4QMGA 1YJNA 3CC2A 1VQHA 1G2TA 1L1OA 2F0LA 4CGYB 3HOWB 1PH4A 2CH4A 3HEJA 4DR1Q 3Q22A 5GAHC 2VB3X 3DMUA 1G2SA 2ASBA 3AFQA 3D4RA 4GOPA 4DR7Q 1F2MA 2EYOA 2JEBI 1G6PA 2F0VA 3E0EA 1ENAA 1WTPA 1NNXA 1IXRA 1YNNC 5C4JB 4LJZC 2K75A 4JYAQ 1B9NA 3SDZA 2UXBQ 5DM63 2B3GA 3GTJH 4YY3Q 1VMCA 3GTOH 4K8JA 3NBHA 2WIIB 1TT2A 1KNAA 4JI8Q 3VA5A 4B3SQ 3MA2B 3FMCA 3NHHA 3T53B 4CHTB 3D4WA 1YNXA 3CCVA 4R8NA 1EY5A 3G7LA 4X3KA 3HOYH 2I07B 4NPSA 3PCOB 5JJZA 2PNRC 4LF9L 1GUGA 5EQ0A 1E2VA 1HPCA 5IT9L 2Z6KA 4KV6A 5KEEA 1SEBD 3GTMB 3JC66 1N32Q 5M5XH 3NBHB 1CUKA 1TY0A 3CD6A 3BDOA 1STEA 4G7OC 4A3JG 2JA5B 1XPUA 3ER0A 3D31A 2A74C 2F0PA 1EEID 2OTJA 1BVSA 4DAPA 2ICIA 1EY0A 3VA7A 1ET6A 1PVOA 1T5EA 5BR8Q 4B3TL 1GUTA 4I65A 4C3HB 3G71A 4A3MB 2NYZD 4YIJA 1GOZA 1WTOA 5A2QE 3CPWA 3A8JE 3O13A 3MFYA 2FHTA 1TS3A 4FP5D 1PFMA 4UP8A 5M5YH 4AYBE 3PO3B 4DR5Q 4DFAA 2E2IB 4DV3L 3MAQA 2PW5A 4MTNA 3I70A 3CQZB 2K01A 3R2TA 3HGBA 3CMEA 4CKEA 1CSPA 5E1FA 1OXXK 1XTDA 3OW7A 1KAAA 3I2ZA 5ELDA 4K5XA 1SE3A 5ELFA 1EIGA 1KRTA 2KCNA 4FF2A 4OIJA 2O4XA 1KXLA 5IT9c 3QR8A 4A3BB 1VF5C 5DNFA 2NVQH 4K5WA 2ES2A 2F0OA 4RGMA 1JOOA 3MXNB 5ELNA 5FLMH 1JE5A 4IQZA 1U4PA 5C0XG 1QE6A 1GHJA 2K33A 4ALPA 3GTMH 1PH6A 4YWKA 1OXTA 1EIYB 4B3SL 2DNCA 2NVYB 5CC4A 3I4NH 4L8JA 5LL6S 1CKNB 3M4QA 3A56A 2H5XA 5DAUA 2G5DA 5IYBH 1VQ6A 5CMDA 1HTPA 3J81j 5HGTA 4EGVA 3M4YA 1CT1D 3Q8DA 1SYBA 4LF4Q 2DJGC 1U4MA 5C4ZA 4JI2Q 4JI3Q 3OMCA 4ULLA 2AHOB 2F0MA 4LF9Q 3LX0A 5LHY1 4DV7Q 1VQOA 2B2TA 3NEMA 3H94A 2Z6KC 1VQFA 4N8X1 3OWEB 5HURA 2G9DA 4BWGB 5FK9C 1HZ9A 4ABNA 1PFSA 1LACA 5M5WB 1ILPA 2OT2A 4JI7L 3VR3A 1BQQT 4A3IH 3R93A 4LFAL 2ICEC 5T1GA 3OPOA 1SSOA 4RGTA 1BCPB 3T1YQ 1VQCA 4IO9A 1RIPA 5GROA 2AQ2B 3P75A 2VQFQ 1DOKA 3RLOA 4ME3A 2F0NA 1K8AC 3GTGH 3WOEA 2F0JA 4LAAA 4EQOA 3E6ZX 3CP0A 3G4SA 5E4XA 4J1MA 2CVRA 1K3RA 4HIMA 2KHIA 4F7XA 1IZ6A 3W1BA 1Y1VH 1SE2A 1UE1A 2QKIC 4ZCKA 4X3SA 2MGSA 1WOCA 4YHHL 2EYJA 4FVMA 5CV8A 2DN8A 1S40A 2NZOA 4PZ8A 3BVGA 1IKLA 4GN4B 1I4GA 2R7DA 4QIWE 1K8OA 2KQ3A 2NUCA 3S1NH 4NDXA 1A3VA 5KNDA 4ZK9B 4JI4Q 5JJKA 1YJWA 3X3NA 4P75A 2OF1A 4RKLA 2DY8A 1NUCA 1H95A 4KK7A 3DWPA 5J3BA 4DR2L 1ET9A 1VQMA 4JI1Q 2C35B 5IWAQ 2A69C 3I4MH 2CKZB 3QWNA 2AMCB 2ZJPA 1H9SB 3L2PA 3KDFB 2AUKA 1OO9B 3DEOA 1WTXA 3E5SA 3C2PA 4LF6Q 4C2MB 4EX5A 4HJ8A 4RHRA 3B6YA 3U9SA 3G6JB 1X56A 4JBWA 2M00A 3GTGB 4CDDC 3L9AX 4WJ3M 1ML0D 2PMZB 4BA2I 2E74C 1EY4A 3FP9A 2PI2A 3DLLA 1Y1VB 4K5VA 1YZ6A 2IJ0A 2PQAB 2UUAQ 1L0YB 4RKBA 1FL0A 1KL9A 4GNXA 3F2CA 2WAQB 1RTOA 1NE3A 4WJWA 2WKCA 1HA6A 1SAPA 4MZ9A 5C0XJ 2F0IA 2ATWA 1E7ZA 1N33L 4O0AA 3PIOA 1RTNA 4OL7A 1PHJA 4POGA 4CJ2C 1E0BA 1SRUA 5KGUA 2I5HA 1WJJA 4K8IA 2BE5D 1IW7C 3MWYW 4QL5A 5JOBA 2UUBL 3I72A 3FKIH 4PV1C 4JBJA 1NMGA 2YTYA 3JAML 1Y1WH 4LFBL 1Q1EA 4NXMQ 3GTQH 2RCFA 1F2ZA 1YHQA 1KLGD 4GLXA 1SFOH 1K0SA 3I56A 1TQOA 1YHBA 4DU9A 2K28A 1Y69U 4H02A 3HOXH 3HOWH 2IW3A 1IHZA 2EYFA 1HRJA 1WD1A 4GLAC 1SYDA 1ZKOA 4UHVA 4A76A 3AU7A 3TRZA 1N8RC 3CMAA 3U50C 4L5TA 1KLUD 5DEHA 2N49A 1I4PA 4B3RQ 2YU9H 4BBRG 2RKSA 3PUZA 1B4OA 1PRTD 1IBLQ 3HKZE 4DK6C 2WV6D 1SJED 2KJXA 3NELA 2E2IH 1EFID 2IPKD 1S72A 1A15A 2KUMA 1ASZA 4A3KB 5FO7B 2JA7H 4JBMA 2JEAI 4P2CB 2X69A 5CV5A 1STYA 1P8LA 4DR6L 2WAQE 3BYYB 4A3BH 1SYEA 1HNWL 2JP1A 1W6KA 1B70B 3D4DA 3BVZA 3BDCA 1C0AA 2EYPA 2NWGA 3QB3A 3U9OA 3H0GG 1M1KC 2NVTB 1VQBA 3TSSA 1XPOA 1JWMD 5AJ3Q 5A2QL 3S24A 1HZAA 4GS3A 3F2DA 4TSSA 2I0QA 4PQXA 1QVCA 4KKSA 3CU7A 5I4DA 2PZWA 1M8AA 3K7AB 1LTAD 1X54A 1L2FA 3A8IE 4DV1L 2EPBA 3GDEA 1P16A 3OW2A 1HQRD 3PUYA 2SEBD 1PH9A 5IGEA 2E5LL 3HOXB 2CW0C 2QDBA 1KDCA 2AUJD 3NPPA 4NB3A 3TP5A 2BOSA 4A3KG 2VS1A 1HA5A 1YVCA 4R4TA 2UUBQ 3TDQA 1Q8KA 1CQFA 1TWCB 2B2UC 1O78A 1Q3LA 5IP9G 1IYVA 2B8GA 2A8VA 2YU9B 2Q8IB 1GJXA 5CBEE 3ERQA 4QUFA 5C5MA 1G291 3MTSA 3A55A 3N6RA 3A74A 2MUYA 4DUZL 2YTXA 2IT1A 1SNOA 2FINB 4GKKL 4DV6Q 4DAMA 1I3QH 4B9XA 2D0OA 4TRDA 5M3FH 1MBYA 2EJFC 1Q8IA 5D14A 1A3TA 4BY1H 2EJMA 2E2JB 2UU9Q 2JK8A 2EY5A 2PNHA 3EA6A 2PQEA 4V0BA 1V43A 3CCSA 4K2KA 4JI6L 1D2BA 2NVTH 5D3IB 5IYCH 2B2WA 1QB5D 2I46A 1YI2A 3AYHB 4IALA 1RF2D 4HSVA 4IUVA 2ZXPA 4KN7C 3RR5A 5JPNC 4GNXB 4BBRH 5EKIA 4PMCA 3URYA 2MNAA 3G6EA 1DD2A 1IBML 1GKHA 4K2LA 1PTOH 2RDGA 3GTPH 1WTWA 1SN8A 2Q8TA 1XPRA 1TXYA 2A19A 4Y7NB 2NVYH 5LMUQ 2UUCQ 1PFNA 1S4ZA 1B1ZA 2ZM6L 2KHJA 3UE1A 5JJLA 1N36Q 1GM5A 3K5LA 3HOYG 1ZYRC 1BKBA 1H9KA 3MHBA 3E9HA 1PRTC 4DUYQ 1D5MC 1LTID 4J15A 1Z9FA 3MFGA 1WTRA 4A3LG 3VR4A 4RFBA 3GQBA 3NP8A 4AH6A 2MO1A 2F3IA 2Y0SG 4JPBW 3AMUA 1EOVA 2X6GA 5C44B 4C3JH 1LYLA 3CXCA 4AYBB 1FGUA 1XTCD 1KABA 1D1IA 5JEAH 4OO1G 3NUCA 1XMQL 5EAYA 1S3OA 1JB3A 4P73A 1XJVA 3BYTB 2E2HB 3HOUB 2C9OA 4IFDH 3J81i 1SLJA 2HDMA 1K28A 3H91A 5FO8B 1XX8A 1KRSA 1M90C 1VQ5A 4NMZA 4ODGA 2WAQG 2RBMA 1K3BC 3QO2A 4YCUA 2SDFA 2KOLA 1I94Q 1KAWA 5JJIA 2OQKA 4RG1A 4JI0L 1B3QA 3S9WA 2FJ2A 4Y7NH 4KN4C 3BZCA 3H3VH 2BA0A 3S1MH 4JG2A 5IE8A 5JPMC 1SFOB 4A3BG 4LFCL 3J80c 3HKZB 3D8GA 4H7BA 3AFPA 4KLKA 4ZLTF 3GTLH 3DUZA 1RHPA 4L63B 3C3LA 2JA6G 1LV9A 5FLMG 1JB7A 3M4OH 3FKIB 3VDYA 1O7ZA 2O5IC 4UAIA 2IY5B 2UUCL 2ZM6Q 3MEHA 4UP7A 4A3IB 5C44H 2F4IA 1D7QA 2Z9HA 5COYA 2MO0A 4A3KH 4Z9CB 1VQEA 2MJ8A 3OSOA 1FGBD 4HMJA 4KJNA 2A69D 4C3HH 2H4OA 1TIID 1U9RA 3E9IA 4R4CA 3J81L 1VQ9A 1A2TA 2EY1A 2CWPA 1TWHB 3Q24A 3PUXA 2HHHL 2VNUD 4C3IH 1TWFB 4YWLA 2OCEA 2HQEA 3CRKC 3T51B 4FF3A 3K6OA 2EOTA 1HHVA 3WOFA 3UDGA 1SNPA 4PZ7A 4R4OA 4WJ4A 1YITA 1YBYA 3DM3A 4DN4M 4RMFA 3K58A 1KC8C 2EYMA 4C1NI 4IUPA 3HP3A 3UE0A 3RZOB 1WYDA 1Q1BA 1B7YB 1QOHA 5IYCG 3QOLA 1C8CA 3GTLB 2H1EA 5EKLA 3UDFA 4WFN3 3JAME 2IX3A 2Z8LA 1BF4A 1VQ4A 2VQEL 4IFDG 5EJWA 1VF7A 2F0WA 1I4XA 1TR5A 2B29A 2EYLA 1X65A 3SR1A 1OXUA 1U0LA 2F3VA 2JN4A 2ZT9C 2DGYA 1HNZL 1KHIA 4HIOA 4BY7H 3I91A 1JWSD 2ENBA 5LL6X 1VMPA 2K04A 4DV5Q 4ZYSA 1A6XA 1EWIA 4X64Q 2EE1A 2A6ED 3I4LA 4IPGA 1ICFB 2JE6I 3PIPA 2VB2X 2BDOA 3CRLC 2N3SA 2VW9A 2I5LX 3IFDA 1WD0A 2L4NA 2NB0A 1F9QA 5M3FB 1SXTA 1K9MC 1STNA 1HR0W 3PGZA 2NBFA 1EY7A 4XDXA 5EBCA 4BY1B 1PMRA 5IGDA 1KQSA 4K0KQ 5FKAC 1I4QA 1HR0Q 3I4OA 3VYUA 4LUVA 4AIMA 2UU9L 3HKSA 3ULLA 3BU2A 1MIUA 1PRTF 2ZXRA 3OIQA 3PSIA 4JI6Q 3SGIA 2EJGC 3W1GA 5FLXc 3K0YA 3S15B 2L55A 4KD3A 1EQQA 1CKOA 1Q90A 3QOJA 4XT3B 1HFNA 1EY8A 1W2BA 5BR8L 3H09A 4B3TQ 4A3CG 1VQIA 4TVAB 3I90A 4RGNA 3GTPB 4KI0A 4DV2L 1AN8A 1I6HH 2R7ZB 2N88A 5LMUL 3JAMc 1NY4A 3K57A 4BY7B 1D5ZC 4DV3Q 1E22A 1LTTD 2Q2TA 3PO2G 3S2DB 4Q0FA 4L6TB 2R93B 2XVSA 3KLSA 2AKWB 5C6AA 4OHJA 4LF8L 4IJLA 4PZ6A 2IHEA 2XRQD 1IL2A 2RSNA 3NWTA 1PTOD 2EXDA 4NKLA 1O7IA 3K5OA 2B2WC 3CW2C 3A5UA 3FPPA 4E6IA 2V1CC 4RH6A 1EYDA 4TQUS 1I3QB 3HOWG 5JAVA 2JA5G 2F0EA 1MHWC 1GUSA 2ZTEA 1C48A 1FYCA 2R93G 1FNWA 2B2VC 3MVVA 3SK4A 4C2MH 4B3ML 4NW2A 1X3QA 1CSQA 1F77A 5I9PA 3ITPA 3FKIG 1EEFD 3DXJC 3S16B 2NN6H 2PZTA 1BXTA 4FF1A 1XYIA 2HDLA 4ILWA 2BCOA 1QVGA 1B2TA 4X65Q 4G4KA 3NTHA 4OXPA 1XNRQ 1VQGA 2F0UA 1TWAB 4KHVA 4JI3L 1X3PA 1RKNA 1V9PA 3FHWA 4A3JH 4B08A 2NN6I 1A3UA 1VQ8A 4N8FA 1LTSD 4GKJQ 2QEJC 2R6GA 1I50H 2VL6A 2I5MX 1UNSA 4J8QA 5A35A 1AH9A 1RCVD 3J7YW 4IPHA 3ZYYX 4N9TA 2JJQA 1K73C 1D6EC 2EY6A 3RZDH 5DLQE 2B2YA 4A3DH 1TWGB 3FRPB 4APVA 5CGKA 1CKMA 3UI2A 3QIAA
chains in the Genus database with same CATH topology
4JV5L 5C4JH 3NELA 1Q81C 2E2IH 3HOZH 1A63A 4OWXB 3RLFA 3L0OA 1FJGQ 3HOVH 1S72A 4JI5Q 3GD7A 2RHSB 4GN5A 3T1HQ 1ASZA 4A93G 1OTCA 3LGJA 4POFA 3K7AH 3KYHC 2AWOA 2VY3A 4OONA 2JA7H 5IWAL 2Q2IA 4JBMA 2JEAI 2AWNA 1L1OC 4YWMA 1Q46A 4HJ7A 4OO1I 4JOIA 4A4IA 4A93H 3PV0A 1VQLA 2MQHA 1P8LA 4JOIC 4DR6L 3MEFA 2WAQE 3H0GH 2Y0SE 4A3EH 3S1QH 3TS0A 1N34Q 3KDFA 3F1ZA 4A3BH 1HNWL 3HOXG 1B70B 4AYBG 4K0KL 4YCVA 3S16H 5GADC 1HNXQ 1C0AA 1PYBA 3H0GG 2HQLA 1M1KC 1VQBA 1I94L 4GOPB 4QQBX 5FJ8H 1XPOA 3HOUH 4UY8C 5AJ3Q 3S24A 1HZAA 4GS3A 3F2DA 2BH8A 1IBKL 3I4NG 3U4ZA 4JV5Q 3ERSX 2I0QA 1QVCA 3CF5A 1OXSC 1D8LA 1V1QA 4HJ5A 3CCJA 1YEZA 1XMOL 2KENA 1X54A 1L2FA 4DV1L 1UE6A 2ID0A 3GDEA 3CC7A 1P16A 3OW2A 3PUYA 4OX9Q 1PH9A 4UPAA 4DR2Q 2E5LL 2UXCQ 1C9OA 2JA5H 3RZOH 3IRBA 4IJHA 5C3EH 1Y14B 1BBWA 3RN5A 4NB3A 2PQAA 4A3KG 1OXVA 2ZTCA 2VS1A 4B3MQ 1YVCA 3JAMi 3CC4A 4R4TA 2UUBQ 2IX1A 2F4VL 1Q8KA 5IP9G 4X65L 3D0FA 4A3CH 1TWGH 2A8VA 3HOVG 1VQ7A 2D0PA 3OYYA 2LSSA 5GAEC 1G291 1PA6A 1AE2A 4R4QA 4JI2L 4A3IG 5M3MG 3KF8B 3A74A 2XGTA 2LXJA 4DUZL 1XNRL 2YTXA 4A3MG 1UE5A 2IT1A 2RF4A 5IYBG 2IX0A 1KIXA 1XNQL 4DV6Q 4DAMA 1I3QH 1L0WA 2D0OA 3UDXA 1HR0L 4GKKL 4A3LH 5M3FH 1HZBA 1BBUA 3H15A 3PO2H 4A3EG 3KF6A 5GQOA 4LFCQ 4DV1Q 4IFDJ 3PUWA 5JEAJ 4LF7L 5IYDH 1QUQB 1VQJA 1SR3A 4BY1H 3AQQA 1KD1C 3TQYA 4KHPQ 3BJUA 5IP7H 1N33Q 4L5QA 4X66Q 2JK8A 2UU9Q 1VQAA 4A3GG 4A3FH 1PH5A 2PNHA 1W3SA 2JQOA 1NTGA 3CCSA 1V43A 2N78A 5C3EG 1N9WA 4JI6L 2ALYB 4PMWA 2NVTH 1AE3A 4MNOA 3H3VI 5IYCH 1SROA 2K4KA 1YI2A 2VQFL 4DV0Q 4B3RL 3AYHB 4NXNQ 4GNXB 1L1OB 3RR5A 2PI2E 4DV4Q 2JA8H 4BBRH 4KHZA 2HHHQ 1GD7A 4LFBQ 2MNAA 3G6EA 3CCUA 2D62A 4IOCA 1LUZA 1IBML 4BY7G 1GKHA 4DR4L 1YJNA 3CC2A 3UDIA 3K80C 3GTPH 1VQHA 1SN8A 1L1OA 1XPRA 1TXYA 2A19A 4Y52H 2NVYH 5LMUQ 3HFZB 2UUCQ 1Z47A 2A1AA 2ZM6L 2KHJA 2PMZE 2ZTDA 3UE1A 1PH4A 4DR1Q 1PH1A 5JJLA 5GAHC 1N36Q 4GNXC 1GM5A 2E2JH 4DR7L 2WB1G 3HOYG 3J7A5 3U4VA 2ASBA 1BKBA 3AFQA 4GOPA 5IYDG 4AQYQ 1CKNA 4DR7Q 2JEBI 3E9HA 1J6QA 1G6PA 3K0XA 4DUYQ 3E0EA 1Q12A 3TEHB 4J15A 2QA4A 4X62L 1Z9FA 1IXRA 4DUYL 1QVFA 4A3LG 1I5FA 2UXBL 4JYAQ 2K75A 5HGQA 2UXBQ 4DV2Q 4AH6A 2MO1A 2B3GA 4JI4L 2F3IA 4IOAA 2XTIA 3GTJH 2Y0SG 4YY3Q 3GTOH 4BY1G 2JA8G 2N8NA 4JBKA 1EOVA 4C3JH 1LYLA 3S1RH 1XMOQ 3CXCA 3M4PA 4JI8Q 3ZJYC 1Q7YC 1FGUA 2HT1A 4B3SQ 2LXKA 4OO1G 1XMQL 2K5HA 5EAYA 1N36L 1S3OA 3I55A 3J81c 2GVAA 4P73A 1XJVA 2VUMH 3CCLA 1YNXA 3CCVA 1Q82C 5HY6A 5C4XG 1A8VA 3HOYH 1NBWA 4OWTB 3J81i 1A62A 1SLJA 2YTVA 3M7NA 2UXDQ 2IHFA 4NPSA 3PCOB 2CCZA 2VUMG 1KRSA 4LF9L 1M90C 3CAMA 2QEXA 1VQ5A 1XNQQ 3CCEA 2Z6KA 1IBKQ 2WAQG 4JI7Q 1MJCA 3KOJA 4YHHQ 4YCUA 4DUZQ 5JJIA 1I94Q 1KAWA 4LF7Q 2OQKA 4RG1A 4JI0L 3JC66 1N32Q 1E24A 5M5XH 3NBHB 4A75A 3T1YL 4YY3L 1RL2A 4P71A 4Y7NH 1CUKA 1NMFA 3BZCA 1Y1WG 2BA0A 1EQRA 4JI0Q 3AEVA 4A3JG 4JG2A 3CD6A 5LMNL 5IE8A 3KJOA 3ER0A 1XPUA 3D31A 2RHQB 4LFCL 3J80c 1VQKA 4A3BG 2OTJA 2Z0SA 1BVSA 1G51A 2K52A 1HZCA 4X64L 1XMQQ 1E1TA 2E8GA 3AFPA 1TWCH 4KLKA 1PVOA 5BR8Q 4B3TL 2E2HH 4DR3L 3GTLH 2KCMA 3G71A 5IP7G 2JA6G 2E5LQ 2BA1A 5FLMG 1JB7A 3ULPA 3M4OH 1TWAH 4FDBA 4JI1L 2ZJRA 4DR3Q 4A3FG 3VDYA 2EQSA 2F52A 3CPWA 4DR5L 3KJPA 2CWAA 4JC0A 4P74A 4LF5Q 4UP8A 5M5YH 1YIJA 1TWHH 4AYBE 4DR5Q 2IY5B 3ICEA 4DV4L 1Q86C 2WB1E 2UUCL 4DV3L 2ZM6Q 3W5OA 1EUJA 4UP7A 1SE8A 3GO5A 4MTNA 4DAYB 5C44H 2R7ZH 3S14H 5K36G 1D7QA 1UWVA 2MO0A 4BA1I 4A3KH 2VZAA 3WWVA 3CMEA 1WCMH 1VQEA 3M9BA 1CSPA 1OXXK 1XTDA 4L5RC 2NN6G 1PH2A 4LF4L 2WP8J 2JA7G 4LW1A 3I2ZA 2EIFA 3F8TA 1KRTA 3U58A 4C3HH 1VS0A 2K5NA 1KXLA 3STBD 5IT9c 4L5SA 3E9IA 4LUZA 1EFWA 2NVQH 4R4CA 2ES2A 1VQ9A 2K14A 3BZKA 2OWOA 4HIKA 2NZHA 3MXNB 3PF4A 5ELNA 1FJGL 4IPDA 1JE5A 2CWPA 5FLMH 3PO3H 3PUXA 2HHHL 2VNUD 4C3IH 1QUQA 5C0XG 4YWLA 2OCEA 4ALPA 3GTMH 1PH6A 4YWKA 1OXTA 4R1JA 1EIYB 4B3SL 3J7ZC 3I4NH 3UDGA 2K5VA 4PZ7A 1X3FA 1HNZQ 4R4OA 1CKNB 3M4QA 4WJ4A 2H5XA 1YITA 4GN3B 5IYBH 1JJ2A 1VQ6A 1YBYA 3DM3A 4BXXH 2F4VQ 3J81j 1C7YA 4A3DG 4RMFA 1R9TH 3Q8DA 1KC8C 4DV5L 4LF4Q 3UE0A 1WYDA 1Q1BA 1B7YB 5IYCG 2WFWA 1K83H 1YHAA 4JI3Q 4JI2Q 4LF9Q 2AHOB 3UDFA 2Q2HA 1PV4A 1VQOA 4DV7Q 3EN2A 3NEMA 1VQ4A 4DPGA 4DV6L 2Z6KC 1VQFA 5C0XI 1A0IA 2B63G 2VQEL 3ULJA 4IFDG 5LMNW 4JYAL 5C4XH 1J5EQ 1TWFH 1HZ9A 2CFMA 1PFSA 4JCVE 1QZHA 4R4IA 4HJAA 4JI7L 2B29A 1VCIA 5LMNQ 5AJ3L 3CCQA 4A3IH 1DGSA 1X65A 4LFAL 1OXUA 1U0LA 4GKJL 3CQZH 4P72A 4QY7A 2DGYA 1WFQA 3T1YQ 4OWWB 1HNZL 1KHIA 1VQCA 3M85A 4HIOA 4IO9A 4BY7H 5IP9H 2DUDA 5M3FG 1RIPA 4LWCA 4DNIA 1K0RA 4QJFA 5GROA 3I4MG 3S2DH 4DV5Q 4OX9L 4BXXG 2VQFQ 1EWIA 4X64Q 3KF6B 3EIVA 4DV0L 1PH8A 3TS2A 2UXCL 5M3MH 4IPGA 3RLOA 3M3YH 4ME3A 2JE6I 3PIPA 1NJIC 1K8AC 2KCTA 1LM0A 1PYSB 4GOPC 3GTGH 3CCMA 4DV7L 4DR4Q 3S15H 2N3SA 3CP0A 2VW9A 3G4SA 2I5LX 2MFIA 1HH2P 1UEBA 2L15A 4JI5L 1K3RA 4HIMA 1K9MC 2KHIA 4YCWA 1IZ6A 3W1BA 1Y1VH 2B63H 4DR6Q 1UE1A 1HR0W 3OTOL 3PGZA 3A0JA 4XTCS 1HNWQ 1KQSA 4K0KQ 3OTOQ 1WOCA 4YHHL 1HR0Q 3I4OA 4LUVA 1VQNA 3KFUA 3I7FA 3F2BA 4UP9A 1S40A 2NZOA 4LF6L 4X66L 4AIMA 3HKSA 2UU9L 3ULLA 4DKAC 4PZ8A 1N34L 3BU2A 1B8AA 1MIUA 4GN4B 2R7DA 2R93H 1IYJB 4QIWE 3PSIA 1EYGA 4LF8Q 1E1OA 5JEAG 4BBSH 1LTLA 4JI6Q 3SGIA 1HJPA 1HNXL 3STBC 3W1GA 5FLXc 3S1NH 1SMXA 4GLVB 4JI4Q 3CCRA 1CKOA 1EQQA 2Q2UA 4XIGS 1W2BA 1YJWA 5BR8L 4P75A 4B3TQ 4BBSG 1VQIA 4A3CG 5JJKA 4TVAB 1X3EA 2QGQA 4LF5L 3RN2A 1U5KA 3KLWA 1H95A 3A5ZB 5J3BA 4DR2L 4KI0A 4DV2L 2KBNA 1VQMA 4JI1Q 1I6HH 2C35B 1JMCA 5IWAQ 3H3VH 3S1MH 1VQDA 3I4MH 5LMUL 2CKZB 1QZGA 2AMCB 3JAMc 2ZJPA 1NY4A 1K8GA 3L2PA 3KDFB 3T1HL 3J80i 4X6AH 1IBMQ 2OTLA 1X55A 2HIXA 4DV3Q 1E22A 2Q2TA 3PO2G 4LF6Q 4EX5A 4AQYL 4HJ8A 1EIFA 1GO3E 2YYZA 3CPFA 2AKWB 3B6YA 5FJ8G 4DR1L 3HOUG 1X56A 4JBWA 2GN5A 2OQ0A 4LF8L 4IJLA 4PZ6A 1E3PA 4WJ3M 2IHEA 2R92H 1IL2A 3K81C 4BA2I 1Y1VG 3K7UC 3FP9A 2EXDA 1O7IA 1UE7A 2PI2A 4HJ9A 3DLLA 3RNUA 2UUAL 3CW2C 2JA6H 2R7ZG 2BH2A 3A5UA 4O2DA 2FXQA 4LNQA 2R92G 4PG3A 1YZ6A 2PQAB 2V1CC 2UUAQ 1WCMG 3EBEA 4TQUS 1FL0A 2GVBA 3HOWG 1KL9A 4GNXA 2JA5G 3F2CA 4IPCA 1JJGA 1NE3A 2ZTEA 3HKZG 5E7NA 4QGUA 2R93G 4MZ9A 2R7FA 5C0XJ 1X9NA 4KHPL 3L7ZC 2ATWA 1E7ZA 4C2MH 4B3ML 2JA9A 5IY0A 4O0AA 5C44G 3PIOA 1N33L 1PHJA 3PF5A 4EQ5A 3S2HH 4DK3C 4JI8L 2K50A 4NXNL 4POGA 1CSQA 1SRUA 1X3GA 3FKIG 1WJJA 2I5HA 4HIDA 3RLNA 2UXDL 3PO3G 2NVXH 4QL5A 3TREA 4A3MH 2HIVA 1QVGA 2UUBL 1MKHA 4X65Q 4OXPA 1XNRQ 1VQGA 3FKIH 4NXML 4JI3L 5M5WH 1MJEA 4JBJA 1NMGA 2YTYA 1V9PA 2CQOA 1J5EL 4GKKQ 4IFDI 1Y1WH 4LFBL 3FHWA 4A3JH 1Q1EA 5GAGC 4NXMQ 3GTKH 3GTQH 1FVIA 2NN6I 1YHQA 1PH3A 1X6OA 1VQPA 1VQ8A 3S17H 4GLXA 1SFOH 4LFAQ 2VQEQ 4GKJQ 1GVPA 2R6GA 3G48A 3I56A 1I50H 2VL6A 1YHBA 2I5MX 4A3GH 4H02A 3HOXH 3HOWH 1N32L 3NENA 1AH9A 1WI5A 2ZJQA 4GLAC 4IPHA 1JJCB 5ELOA 2JJQA 1T9HA 4LUOA 1K73C 3K8AA 5H1SE 4A76A 1ASYA 3TRZA 1N8RC 3CMAA 3U50C 3RZDH 1PH7A 4L5TA 5DLQE 1IBLL 3HOZG 4A3DH 1JT8A 2N49A 3PUVA 4B3RQ 2YU9H 4BBRG 4X62Q 3PUZA 4APVA 2RCNA 1YJ9A 1IBLQ 1CKMA 3HKZE 4DK6C 2YV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 L;  5C4J H;  3NEL A;  1Q81 C;  2E2I H;  3HOZ H;  1A63 A;  4OWX B;  3RLF A;  3L0O A;  1FJG Q;  3HOV H;  1S72 A;  4JI5 Q;  3GD7 A;  2RHS B;  4GN5 A;  3T1H Q;  1ASZ A;  4A93 G;  1OTC A;  3LGJ A;  4POF A;  3K7A H;  3KYH C;  2AWO A;  2VY3 A;  4OON A;  2JA7 H;  5IWA L;  2Q2I A;  4JBM A;  2JEA I;  2AWN A;  1L1O C;  4YWM A;  1Q46 A;  4HJ7 A;  4OO1 I;  4JOI A;  4A4I A;  4A93 H;  3PV0 A;  1VQL A;  2MQH A;  1P8L A;  4JOI C;  4DR6 L;  3MEF A;  2WAQ E;  3H0G H;  2Y0S E;  4A3E H;  3S1Q H;  3TS0 A;  1N34 Q;  3KDF A;  3F1Z A;  4A3B H;  1HNW L;  3HOX G;  1B70 B;  4AYB G;  4K0K L;  4YCV A;  3S16 H;  5GAD C;  1HNX Q;  1C0A A;  1PYB A;  3H0G G;  2HQL A;  1M1K C;  1VQB A;  1I94 L;  4GOP B;  4QQB X;  5FJ8 H;  1XPO A;  3HOU H;  4UY8 C;  5AJ3 Q;  3S24 A;  1HZA A;  4GS3 A;  3F2D A;  2BH8 A;  1IBK L;  3I4N G;  3U4Z A;  4JV5 Q;  3ERS X;  2I0Q A;  1QVC A;  3CF5 A;  1OXS C;  1D8L A;  1V1Q A;  4HJ5 A;  3CCJ A;  1YEZ A;  1XMO L;  2KEN A;  1X54 A;  1L2F A;  4DV1 L;  1UE6 A;  2ID0 A;  3GDE A;  3CC7 A;  1P16 A;  3OW2 A;  3PUY A;  4OX9 Q;  1PH9 A;  4UPA A;  4DR2 Q;  2E5L L;  2UXC Q;  1C9O A;  2JA5 H;  3RZO H;  3IRB A;  4IJH A;  5C3E H;  1Y14 B;  1BBW A;  3RN5 A;  4NB3 A;  2PQA A;  4A3K G;  1OXV A;  2ZTC A;  2VS1 A;  4B3M Q;  1YVC A;  3JAM i;  3CC4 A;  4R4T A;  2UUB Q;  2IX1 A;  2F4V L;  1Q8K A;  5IP9 G;  4X65 L;  3D0F A;  4A3C H;  1TWG H;  2A8V A;  3HOV G;  1VQ7 A;  2D0P A;  3OYY A;  2LSS A;  5GAE C;  1G29 1;  1PA6 A;  1AE2 A;  4R4Q A;  4JI2 L;  4A3I G;  5M3M G;  3KF8 B;  3A74 A;  2XGT A;  2LXJ A;  4DUZ L;  1XNR L;  2YTX A;  4A3M G;  1UE5 A;  2IT1 A;  2RF4 A;  5IYB G;  2IX0 A;  1KIX A;  1XNQ L;  4DV6 Q;  4DAM A;  1I3Q H;  1L0W A;  2D0O A;  3UDX A;  1HR0 L;  4GKK L;  4A3L H;  5M3F H;  1HZB A;  1BBU A;  3H15 A;  3PO2 H;  4A3E G;  3KF6 A;  5GQO A;  4LFC Q;  4DV1 Q;  4IFD J;  3PUW A;  5JEA J;  4LF7 L;  5IYD H;  1QUQ B;  1VQJ A;  1SR3 A;  4BY1 H;  3AQQ A;  1KD1 C;  3TQY A;  4KHP Q;  3BJU A;  5IP7 H;  1N33 Q;  4L5Q A;  4X66 Q;  2JK8 A;  2UU9 Q;  1VQA A;  4A3G G;  4A3F H;  1PH5 A;  2PNH A;  1W3S A;  2JQO A;  1NTG A;  3CCS A;  1V43 A;  2N78 A;  5C3E G;  1N9W A;  4JI6 L;  2ALY B;  4PMW A;  2NVT H;  1AE3 A;  4MNO A;  3H3V I;  5IYC H;  1SRO A;  2K4K A;  1YI2 A;  2VQF L;  4DV0 Q;  4B3R L;  3AYH B;  4NXN Q;  4GNX B;  1L1O B;  3RR5 A;  2PI2 E;  4DV4 Q;  2JA8 H;  4BBR H;  4KHZ A;  2HHH Q;  1GD7 A;  4LFB Q;  2MNA A;  3G6E A;  3CCU A;  2D62 A;  4IOC A;  1LUZ A;  1IBM L;  4BY7 G;  1GKH A;  4DR4 L;  1YJN A;  3CC2 A;  3UDI A;  3K80 C;  3GTP H;  1VQH A;  1SN8 A;  1L1O A;  1XPR A;  1TXY A;  2A19 A;  4Y52 H;  2NVY H;  5LMU Q;  3HFZ B;  2UUC Q;  1Z47 A;  2A1A A;  2ZM6 L;  2KHJ A;  2PMZ E;  2ZTD A;  3UE1 A;  1PH4 A;  4DR1 Q;  1PH1 A;  5JJL A;  5GAH C;  1N36 Q;  4GNX C;  1GM5 A;  2E2J H;  4DR7 L;  2WB1 G;  3HOY G;  3J7A 5;  3U4V A;  2ASB A;  1BKB A;  3AFQ A;  4GOP A;  5IYD G;  4AQY Q;  1CKN A;  4DR7 Q;  2JEB I;  3E9H A;  1J6Q A;  1G6P A;  3K0X A;  4DUY Q;  3E0E A;  1Q12 A;  3TEH B;  4J15 A;  2QA4 A;  4X62 L;  1Z9F A;  1IXR A;  4DUY L;  1QVF A;  4A3L G;  1I5F A;  2UXB L;  4JYA Q;  2K75 A;  5HGQ A;  2UXB Q;  4DV2 Q;  4AH6 A;  2MO1 A;  2B3G A;  4JI4 L;  2F3I A;  4IOA A;  2XTI A;  3GTJ H;  2Y0S G;  4YY3 Q;  3GTO H;  4BY1 G;  2JA8 G;  2N8N A;  4JBK A;  1EOV A;  4C3J H;  1LYL A;  3S1R H;  1XMO Q;  3CXC A;  3M4P A;  4JI8 Q;  3ZJY C;  1Q7Y C;  1FGU A;  2HT1 A;  4B3S Q;  2LXK A;  4OO1 G;  1XMQ L;  2K5H A;  5EAY A;  1N36 L;  1S3O A;  3I55 A;  3J81 c;  2GVA A;  4P73 A;  1XJV A;  2VUM H;  3CCL A;  1YNX A;  3CCV A;  1Q82 C;  5HY6 A;  5C4X G;  1A8V A;  3HOY H;  1NBW A;  4OWT B;  3J81 i;  1A62 A;  1SLJ A;  2YTV A;  3M7N A;  2UXD Q;  2IHF A;  4NPS A;  3PCO B;  2CCZ A;  2VUM G;  1KRS A;  4LF9 L;  1M90 C;  3CAM A;  2QEX A;  1VQ5 A;  1XNQ Q;  3CCE A;  2Z6K A;  1IBK Q;  2WAQ G;  4JI7 Q;  1MJC A;  3KOJ A;  4YHH Q;  4YCU A;  4DUZ Q;  5JJI A;  1I94 Q;  1KAW A;  4LF7 Q;  2OQK A;  4RG1 A;  4JI0 L;  3JC6 6;  1N32 Q;  1E24 A;  5M5X H;  3NBH B;  4A75 A;  3T1Y L;  4YY3 L;  1RL2 A;  4P71 A;  4Y7N H;  1CUK A;  1NMF A;  3BZC A;  1Y1W G;  2BA0 A;  1EQR A;  4JI0 Q;  3AEV A;  4A3J G;  4JG2 A;  3CD6 A;  5LMN L;  5IE8 A;  3KJO A;  3ER0 A;  1XPU A;  3D31 A;  2RHQ B;  4LFC L;  3J80 c;  1VQK A;  4A3B G;  2OTJ A;  2Z0S A;  1BVS A;  1G51 A;  2K52 A;  1HZC A;  4X64 L;  1XMQ Q;  1E1T A;  2E8G A;  3AFP A;  1TWC H;  4KLK A;  1PVO A;  5BR8 Q;  4B3T L;  2E2H H;  4DR3 L;  3GTL H;  2KCM A;  3G71 A;  5IP7 G;  2JA6 G;  2E5L Q;  2BA1 A;  5FLM G;  1JB7 A;  3ULP A;  3M4O H;  1TWA H;  4FDB A;  4JI1 L;  2ZJR A;  4DR3 Q;  4A3F G;  3VDY A;  2EQS A;  2F52 A;  3CPW A;  4DR5 L;  3KJP A;  2CWA A;  4JC0 A;  4P74 A;  4LF5 Q;  4UP8 A;  5M5Y H;  1YIJ A;  1TWH H;  4AYB E;  4DR5 Q;  2IY5 B;  3ICE A;  4DV4 L;  1Q86 C;  2WB1 E;  2UUC L;  4DV3 L;  2ZM6 Q;  3W5O A;  1EUJ A;  4UP7 A;  1SE8 A;  3GO5 A;  4MTN A;  4DAY B;  5C44 H;  2R7Z H;  3S14 H;  5K36 G;  1D7Q A;  1UWV A;  2MO0 A;  4BA1 I;  4A3K H;  2VZA A;  3WWV A;  3CME A;  1WCM H;  1VQE A;  3M9B A;  1CSP A;  1OXX K;  1XTD A;  4L5R C;  2NN6 G;  1PH2 A;  4LF4 L;  2WP8 J;  2JA7 G;  4LW1 A;  3I2Z A;  2EIF A;  3F8T A;  1KRT A;  3U58 A;  4C3H H;  1VS0 A;  2K5N A;  1KXL A;  3STB D;  5IT9 c;  4L5S A;  3E9I A;  4LUZ A;  1EFW A;  2NVQ H;  4R4C A;  2ES2 A;  1VQ9 A;  2K14 A;  3BZK A;  2OWO A;  4HIK A;  2NZH A;  3MXN B;  3PF4 A;  5ELN A;  1FJG L;  4IPD A;  1JE5 A;  2CWP A;  5FLM H;  3PO3 H;  3PUX A;  2HHH L;  2VNU D;  4C3I H;  1QUQ A;  5C0X G;  4YWL A;  2OCE A;  4ALP A;  3GTM H;  1PH6 A;  4YWK A;  1OXT A;  4R1J A;  1EIY B;  4B3S L;  3J7Z C;  3I4N H;  3UDG A;  2K5V A;  4PZ7 A;  1X3F A;  1HNZ Q;  4R4O A;  1CKN B;  3M4Q A;  4WJ4 A;  2H5X A;  1YIT A;  4GN3 B;  5IYB H;  1JJ2 A;  1VQ6 A;  1YBY A;  3DM3 A;  4BXX H;  2F4V Q;  3J81 j;  1C7Y A;  4A3D G;  4RMF A;  1R9T H;  3Q8D A;  1KC8 C;  4DV5 L;  4LF4 Q;  3UE0 A;  1WYD A;  1Q1B A;  1B7Y B;  5IYC G;  2WFW A;  1K83 H;  1YHA A;  4JI3 Q;  4JI2 Q;  4LF9 Q;  2AHO B;  3UDF A;  2Q2H A;  1PV4 A;  1VQO A;  4DV7 Q;  3EN2 A;  3NEM A;  1VQ4 A;  4DPG A;  4DV6 L;  2Z6K C;  1VQF A;  5C0X I;  1A0I A;  2B63 G;  2VQE L;  3ULJ A;  4IFD G;  5LMN W;  4JYA L;  5C4X H;  1J5E Q;  1TWF H;  1HZ9 A;  2CFM A;  1PFS A;  4JCV E;  1QZH A;  4R4I A;  4HJA A;  4JI7 L;  2B29 A;  1VCI A;  5LMN Q;  5AJ3 L;  3CCQ A;  4A3I H;  1DGS A;  1X65 A;  4LFA L;  1OXU A;  1U0L A;  4GKJ L;  3CQZ H;  4P72 A;  4QY7 A;  2DGY A;  1WFQ A;  3T1Y Q;  4OWW B;  1HNZ L;  1KHI A;  1VQC A;  3M85 A;  4HIO A;  4IO9 A;  4BY7 H;  5IP9 H;  2DUD A;  5M3F G;  1RIP A;  4LWC A;  4DNI A;  1K0R A;  4QJF A;  5GRO A;  3I4M G;  3S2D H;  4DV5 Q;  4OX9 L;  4BXX G;  2VQF Q;  1EWI A;  4X64 Q;  3KF6 B;  3EIV A;  4DV0 L;  1PH8 A;  3TS2 A;  2UXC L;  5M3M H;  4IPG A;  3RLO A;  3M3Y H;  4ME3 A;  2JE6 I;  3PIP A;  1NJI C;  1K8A C;  2KCT A;  1LM0 A;  1PYS B;  4GOP C;  3GTG H;  3CCM A;  4DV7 L;  4DR4 Q;  3S15 H;  2N3S A;  3CP0 A;  2VW9 A;  3G4S A;  2I5L X;  2MFI A;  1HH2 P;  1UEB A;  2L15 A;  4JI5 L;  1K3R A;  4HIM A;  1K9M C;  2KHI A;  4YCW A;  1IZ6 A;  3W1B A;  1Y1V H;  2B63 H;  4DR6 Q;  1UE1 A;  1HR0 W;  3OTO L;  3PGZ A;  3A0J A;  4XTC S;  1HNW Q;  1KQS A;  4K0K Q;  3OTO Q;  1WOC A;  4YHH L;  1HR0 Q;  3I4O A;  4LUV A;  1VQN A;  3KFU A;  3I7F A;  3F2B A;  4UP9 A;  1S40 A;  2NZO A;  4LF6 L;  4X66 L;  4AIM A;  3HKS A;  2UU9 L;  3ULL A;  4DKA C;  4PZ8 A;  1N34 L;  3BU2 A;  1B8A A;  1MIU A;  4GN4 B;  2R7D A;  2R93 H;  1IYJ B;  4QIW E;  3PSI A;  1EYG A;  4LF8 Q;  1E1O A;  5JEA G;  4BBS H;  1LTL A;  4JI6 Q;  3SGI A;  1HJP A;  1HNX L;  3STB C;  3W1G A;  5FLX c;  3S1N H;  1SMX A;  4GLV B;  4JI4 Q;  3CCR A;  1CKO A;  1EQQ A;  2Q2U A;  4XIG S;  1W2B A;  1YJW A;  5BR8 L;  4P75 A;  4B3T Q;  4BBS G;  1VQI A;  4A3C G;  5JJK A;  4TVA B;  1X3E A;  2QGQ A;  4LF5 L;  3RN2 A;  1U5K A;  3KLW A;  1H95 A;  3A5Z B;  5J3B A;  4DR2 L;  4KI0 A;  4DV2 L;  2KBN A;  1VQM A;  4JI1 Q;  1I6H H;  2C35 B;  1JMC A;  5IWA Q;  3H3V H;  3S1M H;  1VQD A;  3I4M H;  5LMU L;  2CKZ B;  1QZG A;  2AMC B;  3JAM c;  2ZJP A;  1NY4 A;  1K8G A;  3L2P A;  3KDF B;  3T1H L;  3J80 i;  4X6A H;  1IBM Q;  2OTL A;  1X55 A;  2HIX A;  4DV3 Q;  1E22 A;  2Q2T A;  3PO2 G;  4LF6 Q;  4EX5 A;  4AQY L;  4HJ8 A;  1EIF A;  1GO3 E;  2YYZ A;  3CPF A;  2AKW B;  3B6Y A;  5FJ8 G;  4DR1 L;  3HOU G;  1X56 A;  4JBW A;  2GN5 A;  2OQ0 A;  4LF8 L;  4IJL A;  4PZ6 A;  1E3P A;  4WJ3 M;  2IHE A;  2R92 H;  1IL2 A;  3K81 C;  4BA2 I;  1Y1V G;  3K7U C;  3FP9 A;  2EXD A;  1O7I A;  1UE7 A;  2PI2 A;  4HJ9 A;  3DLL A;  3RNU A;  2UUA L;  3CW2 C;  2JA6 H;  2R7Z G;  2BH2 A;  3A5U A;  4O2D A;  2FXQ A;  4LNQ A;  2R92 G;  4PG3 A;  1YZ6 A;  2PQA B;  2V1C C;  2UUA Q;  1WCM G;  3EBE A;  4TQU S;  1FL0 A;  2GVB A;  3HOW G;  1KL9 A;  4GNX A;  2JA5 G;  3F2C A;  4IPC A;  1JJG A;  1NE3 A;  2ZTE A;  3HKZ G;  5E7N A;  4QGU A;  2R93 G;  4MZ9 A;  2R7F A;  5C0X J;  1X9N A;  4KHP L;  3L7Z C;  2ATW A;  1E7Z A;  4C2M H;  4B3M L;  2JA9 A;  5IY0 A;  4O0A A;  5C44 G;  3PIO A;  1N33 L;  1PHJ A;  3PF5 A;  4EQ5 A;  3S2H H;  4DK3 C;  4JI8 L;  2K50 A;  4NXN L;  4POG A;  1CSQ A;  1SRU A;  1X3G A;  3FKI G;  1WJJ A;  2I5H A;  4HID A;  3RLN A;  2UXD L;  3PO3 G;  2NVX H;  4QL5 A;  3TRE A;  4A3M H;  2HIV A;  1QVG A;  2UUB L;  1MKH A;  4X65 Q;  4OXP A;  1XNR Q;  1VQG A;  3FKI H;  4NXM L;  4JI3 L;  5M5W H;  1MJE A;  4JBJ A;  1NMG A;  2YTY A;  1V9P A;  2CQO A;  1J5E L;  4GKK Q;  4IFD I;  1Y1W H;  4LFB L;  3FHW A;  4A3J H;  1Q1E A;  5GAG C;  4NXM Q;  3GTK H;  3GTQ H;  1FVI A;  2NN6 I;  1YHQ A;  1PH3 A;  1X6O A;  1VQP A;  1VQ8 A;  3S17 H;  4GLX A;  1SFO H;  4LFA Q;  2VQE Q;  4GKJ Q;  1GVP A;  2R6G A;  3G48 A;  3I56 A;  1I50 H;  2VL6 A;  1YHB A;  2I5M X;  4A3G H;  4H02 A;  3HOX H;  3HOW H;  1N32 L;  3NEN A;  1AH9 A;  1WI5 A;  2ZJQ A;  4GLA C;  4IPH A;  1JJC B;  5ELO A;  2JJQ A;  1T9H A;  4LUO A;  1K73 C;  3K8A A;  5H1S E;  4A76 A;  1ASY A;  3TRZ A;  1N8R C;  3CMA A;  3U50 C;  3RZD H;  1PH7 A;  4L5T A;  5DLQ E;  1IBL L;  3HOZ G;  4A3D H;  1JT8 A;  2N49 A;  3PUV A;  4B3R Q;  2YU9 H;  4BBR G;  4X62 Q;  3PUZ A;  4APV A;  2RCN A;  1YJ9 A;  1IBL Q;  1CKM A;  3HKZ E;  4DK6 C;  2YV5 A; 
#chains in the Genus database with same CATH topology
 1WVL A;  4JV5 L;  2A5H A;  5C4J H;  1A63 A;  1H9M A;  2B2U A;  1YNN D;  1FJG Q;  1IL8 A;  4JI5 Q;  2K5D A;  2RDF A;  4GN5 A;  3LGJ A;  4DXF A;  2AWO A;  2VY3 A;  2Q2I A;  1V1P B;  2AWN A;  1L1O C;  4C3J B;  5COR A;  2QDL A;  2Z4I A;  3H0G H;  4A3E H;  2TSS A;  3IFT A;  2TMP A;  3KDF A;  1TS2 A;  4K6L A;  1Z6H A;  4AYB G;  2RQX A;  2ZXO A;  1JOK A;  1HNX Q;  3S16 H;  2KHS A;  3H6M A;  4GOP B;  4UY8 C;  2L1B A;  1H9J A;  1Y8N B;  3I4N G;  1ZEQ X;  4BBR B;  4IUU A;  4FO2 A;  4XYQ A;  1D8L A;  4KY5 A;  4HJ5 A;  2M9V A;  1QCB D;  2OXP A;  1YEZ A;  1U4R A;  1UE6 A;  1QWY A;  3CC7 A;  3W3A A;  4U67 3;  3DWA A;  2MP1 A;  4DR2 Q;  1LLR D;  2SNS A;  1C9O A;  2JA5 H;  3RZO H;  5CV9 A;  3SK6 A;  1BBW A;  3RN5 A;  4DK0 A;  1OXV A;  3FDT A;  2KED A;  2WAC A;  4EQP A;  1SND A;  4X65 L;  2F4V L;  1VDZ A;  4A3C H;  1TWG H;  3HOV G;  1VQ7 A;  1F2Y A;  5EPJ A;  4KKT A;  4R4Q A;  1BUV T;  5G3L F;  2JSO A;  5M3M G;  3KF8 B;  2F0D A;  4A3I G;  1HXY D;  1UE5 A;  3EVQ A;  5IYB G;  2Z6B A;  2IX0 A;  3TP7 A;  1KIX A;  1HUM A;  5BN5 A;  5C3X A;  3Q0A A;  4CJ0 B;  3PO2 H;  3KF6 A;  3PUW A;  2HD3 A;  1VQJ A;  1AFP A;  4M1U B;  1ESR A;  3TQY A;  2A6H C;  3BJU A;  4X66 Q;  1R4Q B;  4A3F H;  3C46 A;  1JIC A;  1N9W A;  2ALY B;  4PMW A;  3K59 A;  1J9O A;  4MNO A;  3H3V I;  3R8B A;  2K4K A;  4DV0 Q;  1M4V A;  4HMI A;  4HCE A;  2KVM A;  4UDU C;  5K36 H;  4XYO A;  2HHH Q;  1GD7 A;  3CCU A;  4IOC A;  1LUZ A;  4DR4 L;  4JK1 C;  3UDI A;  3A7A B;  1Y8O B;  4Y52 H;  1Z47 A;  2A1A A;  5L37 A;  1ROD A;  4GNX C;  2E2J H;  3J7A 5;  2MHV A;  3U4V A;  4AQY Q;  1CKN A;  3C1E A;  1Q12 A;  1S5F D;  2WIN B;  3TEH B;  4CDF C;  4X62 L;  4DUY L;  1QVF A;  1I5F A;  5CV4 A;  4S3S A;  4DF7 A;  2LY7 A;  4CBV A;  5HGQ A;  5IGG A;  4DV2 Q;  1V1P A;  5C4H A;  3TZU A;  4IOA A;  2XTI A;  2B2T C;  2JA8 G;  4JBK A;  3PO2 B;  3S14 B;  3S1R H;  1XMO Q;  1AZQ A;  1DXM A;  2K7V A;  4ID6 A;  2LXK A;  2K5H A;  3D3R A;  5G3L D;  1TY2 A;  2GVA A;  3KUP A;  5HY6 A;  5C4X G;  1A8V A;  1NBW A;  3OWF A;  3M7N A;  5EPK A;  2Y0S B;  4G7Z C;  4HR7 B;  2VUM G;  3DEP A;  3CAM A;  1CTM A;  2QEX A;  1DM0 B;  5F2D A;  3K5N A;  4JI7 Q;  1KDB A;  2P5Z X;  3GTJ B;  4KY6 A;  1IKM A;  3T1Y L;  4YY3 L;  1RL2 A;  4P71 A;  1K8M A;  3BG3 A;  1NMF A;  1V1O A;  4KTA A;  1EQR A;  1LAB A;  1CHQ D;  2DJF C;  4JI0 Q;  5LMN L;  3KJO A;  3ONA B;  1WCM B;  1PDQ A;  1I50 B;  1G51 A;  1E1T A;  1YNJ C;  2E8G A;  1EOT A;  3SVM A;  4G57 A;  1HCZ A;  4DR3 L;  3MXP A;  1FNU A;  3VR5 A;  2E5L Q;  1TWA H;  4A3F G;  2DY7 A;  4WRD A;  2EQS A;  1IYU A;  2F52 A;  1BBX C;  1HUN A;  3NTK A;  3S1N B;  5IT9 E;  4P74 A;  1H9R A;  3A7L A;  4DV4 L;  1Q86 C;  2WB1 E;  3D6W A;  1CFM A;  3W5O A;  2BDN A;  2VXW A;  1X32 A;  4DAY B;  1FD7 D;  4ZAI A;  2CH4 W;  3S14 H;  3S1M B;  2PO4 A;  5KIX A;  1UWV A;  4BA1 I;  3WWV A;  5ELE A;  1DJR D;  1SYF A;  5I9O A;  4L5R C;  4LF4 L;  1PH2 A;  2WP8 J;  4LW1 A;  4EQN A;  4F8M A;  2EIF A;  3ND8 A;  1HTL D;  3U58 A;  3Q6S A;  5BN4 A;  1VS0 A;  1MGS A;  2K5N A;  4Q5V A;  2PW7 A;  3STB D;  4L5S A;  3S1Q B;  3E3X A;  2K14 A;  2OWO A;  4RHS A;  2NZH A;  3PF4 A;  4O42 A;  2L11 A;  1FJG L;  3PO3 H;  4IN3 A;  1QUQ A;  1BNZ A;  4JW0 A;  2B63 B;  1BO0 A;  4OEM B;  2M2L A;  1RD9 D;  1C4Q A;  1JQY D;  1ILQ A;  2K5V A;  3PIO 3;  1X3F A;  3SK8 A;  2GA4 B;  2F03 A;  2FMC A;  1FR3 A;  1R9T H;  3V05 A;  4C56 C;  5CR3 A;  2WFW A;  1YHA A;  1PFB A;  2NTT A;  2Q2H A;  1PV4 A;  2LKV A;  1DZ1 A;  2F0H A;  1J8I A;  3EN2 A;  1ENF A;  4DPG A;  4DV6 L;  5LMN W;  1XWE A;  4C3I B;  1QZH A;  4R4I A;  1VCI A;  5LMN Q;  4A3J B;  1DGS A;  4GKJ L;  4P72 A;  4QY7 A;  2XWJ B;  1WFQ A;  3TP6 A;  5J1Z A;  1NCV A;  2K05 A;  4R8I A;  1QIL A;  5IP9 H;  1SJH D;  4LWC A;  4DNI A;  1K0R A;  2VUM B;  3I4M G;  3S2D H;  1EZ6 A;  4OX9 L;  4BXX G;  3HOY B;  1PH8 A;  3KF6 B;  3EIV A;  2UXC L;  1PZK D;  3M3Y H;  2L0C A;  1PYS B;  4A3D B;  4DV7 L;  1H9S A;  5C3W A;  2F0S A;  2L15 A;  4JI5 L;  1BOS A;  4XQQ A;  2R61 A;  2B63 H;  4ME5 A;  1PTO C;  1GXD C;  2Q8R E;  3BZD B;  3MXG A;  1B44 D;  3OTO L;  3I4M B;  4XTC S;  5FO9 B;  3KFU A;  3I7F A;  4UP9 A;  3SE0 A;  4LF6 L;  4X66 L;  3NXW A;  1B8A A;  5I2Y A;  2J0T D;  1LTL A;  3KK7 A;  1HNX L;  1HJP A;  3T4A C;  3VYS A;  5CV6 A;  1G91 A;  1F9R A;  1SMX A;  4GLV B;  2Q2U A;  4XIG S;  4BBS G;  5EPL A;  1X3E A;  2QGQ A;  4LF5 L;  3AB9 A;  3A5Z B;  4O1N A;  1UAP A;  2KBN A;  2IL8 A;  1JMC A;  2D9U A;  1EIH A;  2N55 A;  1EY9 A;  1VQD A;  1QZG A;  1K8G A;  1I4R A;  3T1H L;  2OTL A;  1X55 A;  2JXM B;  2A68 D;  4X3T A;  1EQV A;  4AQY L;  4RGO S;  2YYZ A;  4DR1 L;  4FYD A;  2RDH A;  2OQ0 A;  4DAV A;  1Y1V G;  3K7U C;  1BCP C;  1XXG A;  1UE7 A;  3RNU A;  3PMF A;  2BH2 A;  3PIP 3;  2O5J C;  2FXQ A;  1PZI D;  4LNQ A;  2J7Z A;  1LT3 D;  3QJY A;  2R92 G;  1ZXT A;  2LFN A;  3GTQ B;  1I4H A;  1Y8P B;  2GVB A;  2F0K A;  3OHX C;  4MHE A;  3HKZ G;  4QGU A;  3I8Z A;  2A6E C;  1ENC A;  2R7F A;  2B2V A;  2JA9 A;  5IY0 A;  1STG A;  3CHB D;  1JOQ A;  5I6W A;  4EQ5 A;  3S2H H;  3NK9 A;  4JI8 L;  4NXN L;  3DM1 A;  1X3G A;  1ZYR D;  4A3F B;  1ONL A;  2R3Z A;  1QNU A;  3PO3 G;  4MN3 A;  4RCN A;  2HIV A;  1MKH A;  3QG1 A;  3ERO A;  4V19 0;  1KDA A;  4RWS C;  5M5W H;  1MJE A;  1J5E L;  2Z4H A;  4GKK Q;  1EWH A;  5GAG C;  3GTK H;  1FVI A;  1PH3 A;  4KMU C;  1PRT B;  2VQE Q;  1ESF A;  1SYG A;  3G48 A;  1PLF A;  1EYA A;  5EGT A;  2A6H D;  2AQ3 B;  4A3G H;  3MXU A;  1N32 L;  1WI5 A;  1NAP A;  2ZJQ A;  1JJC B;  3HS0 C;  5ELO A;  1I6V C;  5CV7 A;  1B53 A;  2V4D A;  3K8A A;  5H1S E;  1ASY A;  1PTO F;  4OIK A;  1JT8 A;  3PUV A;  4X62 Q;  1AZP A;  4R9W A;  2YV5 A;  1DOL A;  1PXU A;  3HOZ H;  4HAE A;  4OWX B;  3RLF A;  1HQM C;  2JA6 B;  1Y1W B;  3OMG A;  1O7Y A;  2RHS B;  5E3F A;  3T1H Q;  2IWH A;  4MTK A;  2K5Q A;  3K7A H;  3KYH C;  5CYU A;  1NR2 A;  4OON A;  5IWA L;  3S1R B;  4HJ7 A;  4A93 H;  3PV0 A;  2MQH A;  4JOI C;  5IGB A;  2RA4 A;  1CZG A;  3S1Q H;  3TS0 A;  1N34 Q;  3F1Z A;  1D5X C;  1R9T B;  1JWU D;  2K1B A;  3RZD B;  4BBS B;  1EY6 A;  4K0K L;  1BCP D;  4YCV A;  4QQB X;  3IKJ A;  3SHL A;  1EWC A;  4DNT B;  2BH8 A;  3BVM A;  3U4Z A;  5JVG 3;  3ERS X;  1OXS C;  5EBD A;  1V1Q A;  3CCJ A;  1CA6 A;  3C1F A;  2KEN A;  4C1N K;  2JA7 B;  1SYC A;  4ZQ3 A;  4FNF A;  2XN9 C;  4UPA A;  1G8Z D;  1AP0 A;  1EQT A;  4RCO A;  1SMY D;  3IRB A;  4IJH A;  4RA8 A;  2ZTC A;  4CDC C;  2D0P A;  4RAU C;  5GAE C;  5C4X B;  1AE2 A;  1EYC A;  3E0J A;  4JI2 L;  5KRU A;  2XGT A;  2LXJ A;  1SMY C;  1TU2 B;  2QIL A;  2HCC A;  3VYR A;  1XNQ L;  1U4L A;  1L0W A;  1HR0 L;  1JE4 A;  3UDX A;  4A3L H;  4I7Z C;  1HZB A;  4ZKC B;  4LFC Q;  2D5D A;  3P7J A;  4DV1 Q;  4IFD J;  5JEA J;  4OEL B;  4LF7 L;  2XRS D;  4A93 B;  3AQQ A;  4KHP Q;  5IP7 H;  1UEA B;  4FXG C;  5M3M B;  4A3G G;  1PH5 A;  1W3S A;  2HUG A;  3P1H A;  2N78 A;  5C3E G;  4OO1 H;  2E76 C;  5IGF A;  1CI3 M;  1AE3 A;  3KLR A;  1DCZ A;  1SRO A;  4B3R L;  2VQF L;  4IUQ A;  2PI2 E;  1LTR D;  4PMB A;  2JA8 H;  3J80 E;  3TME A;  3RUZ A;  3HZX A;  4BY7 G;  3J80 L;  3K80 C;  3GP7 A;  1F9P A;  3HFZ B;  1NR4 A;  2PMZ E;  2ZTD A;  3IAY A;  5KYI A;  1PH1 A;  3HRZ C;  3P20 A;  1SDF A;  2BE5 C;  4DR7 L;  3TP8 A;  4KJO A;  2WB1 G;  3A54 A;  1ICW A;  1SBB B;  5IYD G;  2QF7 A;  5I2X A;  1J6Q A;  3K0X A;  2QA4 A;  3BS1 A;  1CHP D;  2UXB L;  1STA A;  2R92 B;  5NUC A;  2EYH A;  4JI4 L;  4BY1 G;  2N8N A;  2WB1 B;  1F9S A;  1KNE A;  3M4P A;  3ZJY C;  1LTG D;  1Q7Y C;  2HT1 A;  3FPU B;  1LTB D;  3VR6 A;  1N36 L;  3I55 A;  2B8F A;  3J81 c;  2VUM H;  3CCL A;  3NE5 B;  1Q82 C;  3I73 A;  4XXE A;  3S2H B;  4OWT B;  1A62 A;  2YTV A;  2UXD Q;  5KNC A;  2IHF A;  5M9O A;  2CCZ A;  3M3Y B;  2L5T A;  1XNQ Q;  4C3H G;  3CCE A;  1BCP F;  1S5D D;  1BDO A;  1IBK Q;  1CA5 A;  1MJC A;  5M5Y B;  3KOJ A;  4YHH Q;  4DUZ Q;  2D2C C;  1WTH A;  1AEX A;  4IUT A;  4LF7 Q;  2F0T A;  1E24 A;  4A75 A;  4J6H A;  2EZV A;  4LK1 C;  1Y1W G;  3AEV A;  3S17 B;  1Z7T A;  2XIW A;  2RHQ B;  1WTQ A;  1VQK A;  4QIW B;  2Z0S A;  2K03 A;  2K52 A;  1HZC A;  4X64 L;  5KNB A;  1XMQ Q;  2EVB A;  1TWC H;  1JCK B;  2CW0 D;  2E2H H;  1K83 B;  2KCM A;  2L9H A;  5IP7 G;  3EJI A;  2K32 A;  2BA1 A;  1B50 A;  2EY2 A;  3ULP A;  4JI1 L;  4FDB A;  2ZJR A;  4DR3 Q;  3EQL C;  3MZ5 A;  3KJP A;  4DR5 L;  4QUC A;  4HTH A;  2CWA A;  1LT5 D;  2KEE A;  2A68 C;  4JC0 A;  1YIJ A;  4LF5 Q;  2FFK B;  1TWH H;  4CDE C;  3ICE A;  1LT6 D;  4TKO B;  3TBI B;  4H0L C;  3N52 A;  1EUJ A;  1SE8 A;  3GO5 A;  2R7Z H;  1I6H B;  1MSH A;  5K36 G;  4XQN A;  2PYK A;  2VZA A;  1WCM H;  3M9B A;  3V2T A;  3KBX A;  2NN6 G;  2JA7 G;  3F8T A;  2KA7 A;  4DNR B;  3M4O B;  3NTI A;  3RD4 A;  4LUZ A;  1EFW A;  5IIF A;  3HOZ B;  4KKU A;  3BZK A;  2WKD A;  1QG7 A;  4OGQ C;  3EFX D;  4HIK A;  2F0Q A;  3LNN A;  3LWU A;  4IPD A;  4GZY C;  1PTO B;  2SNM A;  4BS9 A;  4R1J A;  4CKC A;  1DON A;  3J7Z C;  4WOR A;  1SE4 A;  4ZUI A;  4DK1 A;  1HNZ Q;  1JJ2 A;  3J7A V;  4GN3 B;  5ELC A;  2F4V Q;  4BXX H;  1JR0 D;  1C7Y A;  2J4X A;  4A3D G;  1O7L A;  1TS5 A;  4DV5 L;  3D6C A;  5IOD A;  2RSO A;  1EU3 A;  1W6J A;  1K83 H;  5J39 A;  1D1K A;  3NSW A;  1AW7 A;  3T13 A;  1CZW A;  3NQI A;  2PPB C;  5C0X I;  1A0I A;  2B63 G;  4DAY A;  3ULJ A;  2K5W A;  5C4X H;  1J5E Q;  4JYA L;  4DA2 A;  1TWF H;  4QF4 A;  2CFM A;  2LMC B;  4JCV E;  4FF4 A;  1RJT A;  4ZRZ A;  4HJA A;  5I6Y A;  3Q23 A;  5AJ3 L;  3CCQ A;  3NBI A;  3CQZ H;  5C0X H;  3A8K E;  2QCP X;  3GV6 A;  1IW7 D;  4OWW B;  5D65 A;  5C3E B;  3ND9 A;  3M85 A;  5CBA E;  4H44 C;  2DUD A;  4B9W A;  5M3F G;  4F87 A;  4A3G B;  3OIP A;  4QJF A;  1PZJ D;  3VR2 A;  4DV0 L;  1CQV A;  5M3M H;  1GUO A;  1T5X D;  2F0F A;  2NVQ B;  1RDP D;  4C3I G;  4CJ1 B;  1NJI C;  1V8Q A;  1LM0 A;  2KCT A;  4K6D A;  4GOP C;  3CCM A;  4CKB A;  2PCF B;  4DR4 Q;  3S15 H;  2CHB D;  2MFI A;  1HH2 P;  3T56 B;  4HCS A;  4ZUJ A;  1UEB A;  2QW7 A;  5E4W C;  4YCW A;  3K5M A;  4DR6 Q;  5ELB A;  4IZ8 A;  4N9P A;  4MIU A;  3A0J A;  1HNW Q;  2NTS A;  2F1M A;  3OTO Q;  1VQN A;  5IOC A;  3F2B A;  4DKA C;  1CM9 A;  1N34 L;  1WTV A;  3RMH A;  2LS0 1;  2R93 H;  1IYJ B;  1QJO A;  2A73 B;  5TSS A;  1EYG A;  4LF8 Q;  1E1O A;  5JEA G;  4BBS H;  1KTK A;  4XQJ A;  3STB C;  4KY7 A;  4K14 A;  2NVX B;  2B2Y C;  2SOB A;  4I7A A;  3CCR A;  3KLS X;  3J81 E;  1JC7 A;  3RN2 A;  1U5K A;  1NSN S;  3KLW A;  1UUP A;  4EVO A;  3GTK B;  3J7A F;  5EKK A;  3VYT A;  4PNY A;  1TS4 A;  2OEO A;  1BR9 A;  3OOC A;  1E2W A;  3GTO B;  4X6A H;  3J80 i;  4IUN A;  2EXZ A;  1IBM Q;  3F2U A;  2HIX A;  5FLX L;  1F2L A;  1S5B D;  1DYQ A;  1EIF A;  1GO3 E;  3CPF A;  1HFG A;  5FJ8 G;  3HOU G;  4DGZ A;  1FNV A;  5C5L A;  5ISR A;  2GN5 A;  3SXH A;  2F3W A;  1E3P A;  1O80 A;  2R92 H;  1B3A A;  3K81 C;  2K6A A;  4HN7 A;  3MC0 B;  3NWS A;  3GV3 A;  3M7G A;  4HJ9 A;  2UUA L;  2R7Z G;  2JA6 H;  4O2D A;  3HG9 A;  3SK5 A;  4QCL A;  4PG3 A;  3I4N B;  1WCM G;  3EBE A;  1A2U A;  4IPC A;  1EL0 A;  1JJG A;  1YNJ D;  5E7N A;  5M5X B;  4XT1 B;  2RVL A;  1GHK A;  1MI2 A;  1X9N A;  4KHP L;  3L7Z C;  1R4P B;  5C44 G;  4QB4 A;  3PF5 A;  4DK3 C;  2K50 A;  4H13 C;  2NZ1 D;  1CK1 A;  4HID A;  1SNQ A;  4X3U A;  3RLN A;  2UXD L;  5DM7 3;  2G9H D;  1MD2 D;  2NVX H;  3TRE A;  4A3M H;  3LWE A;  4FXK C;  4NXM L;  4NP5 A;  2CQO A;  4IFD I;  2JYO A;  2E75 C;  2JA8 B;  1SNM A;  2E2D C;  2KEC A;  1II3 A;  1X6O A;  4U68 A;  1VQP A;  5FLX E;  2XNA C;  3KF8 A;  4LFA Q;  5BN3 A;  3S17 H;  2AQ1 B;  1GVP A;  2O2L D;  3TN2 A;  4ZKB B;  3NEN A;  5K5P A;  1S5C D;  5D3D A;  3T16 A;  2L12 A;  3H0G B;  3FEW X;  4HED A;  1DOM A;  1T9H A;  3BDL A;  4LUO A;  5JVH 3;  1QNK A;  3DHQ A;  1PH7 A;  2HCI A;  1IBL L;  3HOZ G;  1LT4 D;  2DNE A;  2RCN A;  5FOB B;  1YJ9 A;  3TS2 A;  2C5C A;  1Q81 C;  3L0O A;  3HOV H;  5T1I A;  3GD7 A;  4FXD A;  4A93 G;  1OTC A;  4POF A;  2CQA A;  3R2I A;  1MSG A;  3KBG A;  3V96 A;  4YWM A;  1Q46 A;  4OO1 I;  4JOI A;  4A4I A;  1VQL A;  4M8A A;  3MEF A;  2Y0S E;  2XWB B;  3PQI A;  2X6L A;  3HOX G;  2KCC A;  2EDG A;  5GAD C;  1PYB A;  1GUN A;  2HQL A;  1JOR A;  2Z1C A;  1I94 L;  5FJ8 H;  2F0G A;  3L3O C;  3CKI B;  3HOU H;  3TZD A;  3SEB A;  4C3J G;  1IBK L;  4JV5 Q;  3CF5 A;  3IL8 A;  4JVZ A;  1XMO L;  1G6Z A;  3H3V C;  2ID0 A;  1SNC A;  4OX9 Q;  2PZU A;  2UXC Q;  4A3E B;  5C3E H;  1Y14 B;  1S5E D;  2PQA A;  4B3M Q;  3JAM i;  1B9M A;  3CC4 A;  2IX1 A;  3D0F A;  3FVQ A;  5J22 A;  4G7H C;  3OYY A;  2LSS A;  1TKW B;  1PA6 A;  2XSC A;  1E2Z A;  5IGC A;  3HOV B;  1XNR L;  3NQT A;  4A3M G;  4KD4 A;  2RF4 A;  4HSP A;  1BBU A;  3H15 A;  3W2D A;  5GQO A;  4A3E G;  4LMQ D;  5IYD H;  1QUQ B;  1SR3 A;  1STB A;  1EU4 A;  2MPM A;  1KD1 C;  3MXN A;  1PYW D;  1N33 Q;  4L5Q A;  3I3C A;  3DWQ A;  1VQA A;  3WDN A;  2JQO A;  1NTG A;  2B39 A;  1L0X B;  4DXG A;  1EZ8 A;  4IUR A;  1LO5 D;  1STH A;  1TVX A;  3X3M A;  5AFW A;  4NXN Q;  1L1O B;  3R3O A;  4DV4 Q;  4KHZ A;  1GUW A;  2FMM A;  4F88 A;  4LFB Q;  2D62 A;  5KYL A;  4QMG A;  1YJN A;  3CC2 A;  1VQH A;  1G2T A;  1L1O A;  2F0L A;  4CGY B;  3HOW B;  1PH4 A;  2CH4 A;  3HEJ A;  4DR1 Q;  3Q22 A;  5GAH C;  2VB3 X;  3DMU A;  1G2S A;  2ASB A;  3AFQ A;  3D4R A;  4GOP A;  4DR7 Q;  1F2M A;  2EYO A;  2JEB I;  1G6P A;  2F0V A;  3E0E A;  1ENA A;  1WTP A;  1NNX A;  1IXR A;  1YNN C;  5C4J B;  4LJZ C;  2K75 A;  4JYA Q;  1B9N A;  3SDZ A;  2UXB Q;  5DM6 3;  2B3G A;  3GTJ H;  4YY3 Q;  1VMC A;  3GTO H;  4K8J A;  3NBH A;  2WII B;  1TT2 A;  1KNA A;  4JI8 Q;  3VA5 A;  4B3S Q;  3MA2 B;  3FMC A;  3NHH A;  3T53 B;  4CHT B;  3D4W A;  1YNX A;  3CCV A;  4R8N A;  1EY5 A;  3G7L A;  4X3K A;  3HOY H;  2I07 B;  4NPS A;  3PCO B;  5JJZ A;  2PNR C;  4LF9 L;  1GUG A;  5EQ0 A;  1E2V A;  1HPC A;  5IT9 L;  2Z6K A;  4KV6 A;  5KEE A;  1SEB D;  3GTM B;  3JC6 6;  1N32 Q;  5M5X H;  3NBH B;  1CUK A;  1TY0 A;  3CD6 A;  3BDO A;  1STE A;  4G7O C;  4A3J G;  2JA5 B;  1XPU A;  3ER0 A;  3D31 A;  2A74 C;  2F0P A;  1EEI D;  2OTJ A;  1BVS A;  4DAP A;  2ICI A;  1EY0 A;  3VA7 A;  1ET6 A;  1PVO A;  1T5E A;  5BR8 Q;  4B3T L;  1GUT A;  4I65 A;  4C3H B;  3G71 A;  4A3M B;  2NYZ D;  4YIJ A;  1GOZ A;  1WTO A;  5A2Q E;  3CPW A;  3A8J E;  3O13 A;  3MFY A;  2FHT A;  1TS3 A;  4FP5 D;  1PFM A;  4UP8 A;  5M5Y H;  4AYB E;  3PO3 B;  4DR5 Q;  4DFA A;  2E2I B;  4DV3 L;  3MAQ A;  2PW5 A;  4MTN A;  3I70 A;  3CQZ B;  2K01 A;  3R2T A;  3HGB A;  3CME A;  4CKE A;  1CSP A;  5E1F A;  1OXX K;  1XTD A;  3OW7 A;  1KAA A;  3I2Z A;  5ELD A;  4K5X A;  1SE3 A;  5ELF A;  1EIG A;  1KRT A;  2KCN A;  4FF2 A;  4OIJ A;  2O4X A;  1KXL A;  5IT9 c;  3QR8 A;  4A3B B;  1VF5 C;  5DNF A;  2NVQ H;  4K5W A;  2ES2 A;  2F0O A;  4RGM A;  1JOO A;  3MXN B;  5ELN A;  5FLM H;  1JE5 A;  4IQZ A;  1U4P A;  5C0X G;  1QE6 A;  1GHJ A;  2K33 A;  4ALP A;  3GTM H;  1PH6 A;  4YWK A;  1OXT A;  1EIY B;  4B3S L;  2DNC A;  2NVY B;  5CC4 A;  3I4N H;  4L8J A;  5LL6 S;  1CKN B;  3M4Q A;  3A56 A;  2H5X A;  5DAU A;  2G5D A;  5IYB H;  1VQ6 A;  5CMD A;  1HTP A;  3J81 j;  5HGT A;  4EGV A;  3M4Y A;  1CT1 D;  3Q8D A;  1SYB A;  4LF4 Q;  2DJG C;  1U4M A;  5C4Z A;  4JI2 Q;  4JI3 Q;  3OMC A;  4ULL A;  2AHO B;  2F0M A;  4LF9 Q;  3LX0 A;  5LHY 1;  4DV7 Q;  1VQO A;  2B2T A;  3NEM A;  3H94 A;  2Z6K C;  1VQF A;  4N8X 1;  3OWE B;  5HUR A;  2G9D A;  4BWG B;  5FK9 C;  1HZ9 A;  4ABN A;  1PFS A;  1LAC A;  5M5W B;  1ILP A;  2OT2 A;  4JI7 L;  3VR3 A;  1BQQ T;  4A3I H;  3R93 A;  4LFA L;  2ICE C;  5T1G A;  3OPO A;  1SSO A;  4RGT A;  1BCP B;  3T1Y Q;  1VQC A;  4IO9 A;  1RIP A;  5GRO A;  2AQ2 B;  3P75 A;  2VQF Q;  1DOK A;  3RLO A;  4ME3 A;  2F0N A;  1K8A C;  3GTG H;  3WOE A;  2F0J A;  4LAA A;  4EQO A;  3E6Z X;  3CP0 A;  3G4S A;  5E4X A;  4J1M A;  2CVR A;  1K3R A;  4HIM A;  2KHI A;  4F7X A;  1IZ6 A;  3W1B A;  1Y1V H;  1SE2 A;  1UE1 A;  2QKI C;  4ZCK A;  4X3S A;  2MGS A;  1WOC A;  4YHH L;  2EYJ A;  4FVM A;  5CV8 A;  2DN8 A;  1S40 A;  2NZO A;  4PZ8 A;  3BVG A;  1IKL A;  4GN4 B;  1I4G A;  2R7D A;  4QIW E;  1K8O A;  2KQ3 A;  2NUC A;  3S1N H;  4NDX A;  1A3V A;  5KND A;  4ZK9 B;  4JI4 Q;  5JJK A;  1YJW A;  3X3N A;  4P75 A;  2OF1 A;  4RKL A;  2DY8 A;  1NUC A;  1H95 A;  4KK7 A;  3DWP A;  5J3B A;  4DR2 L;  1ET9 A;  1VQM A;  4JI1 Q;  2C35 B;  5IWA Q;  2A69 C;  3I4M H;  2CKZ B;  3QWN A;  2AMC B;  2ZJP A;  1H9S B;  3L2P A;  3KDF B;  2AUK A;  1OO9 B;  3DEO A;  1WTX A;  3E5S A;  3C2P A;  4LF6 Q;  4C2M B;  4EX5 A;  4HJ8 A;  4RHR A;  3B6Y A;  3U9S A;  3G6J B;  1X56 A;  4JBW A;  2M00 A;  3GTG B;  4CDD C;  3L9A X;  4WJ3 M;  1ML0 D;  2PMZ B;  4BA2 I;  2E74 C;  1EY4 A;  3FP9 A;  2PI2 A;  3DLL A;  1Y1V B;  4K5V A;  1YZ6 A;  2IJ0 A;  2PQA B;  2UUA Q;  1L0Y B;  4RKB A;  1FL0 A;  1KL9 A;  4GNX A;  3F2C A;  2WAQ B;  1RTO A;  1NE3 A;  4WJW A;  2WKC A;  1HA6 A;  1SAP A;  4MZ9 A;  5C0X J;  2F0I A;  2ATW A;  1E7Z A;  1N33 L;  4O0A A;  3PIO A;  1RTN A;  4OL7 A;  1PHJ A;  4POG A;  4CJ2 C;  1E0B A;  1SRU A;  5KGU A;  2I5H A;  1WJJ A;  4K8I A;  2BE5 D;  1IW7 C;  3MWY W;  4QL5 A;  5JOB A;  2UUB L;  3I72 A;  3FKI H;  4PV1 C;  4JBJ A;  1NMG A;  2YTY A;  3JAM L;  1Y1W H;  4LFB L;  1Q1E A;  4NXM Q;  3GTQ H;  2RCF A;  1F2Z A;  1YHQ A;  1KLG D;  4GLX A;  1SFO H;  1K0S A;  3I56 A;  1TQO A;  1YHB A;  4DU9 A;  2K28 A;  1Y69 U;  4H02 A;  3HOX H;  3HOW H;  2IW3 A;  1IHZ A;  2EYF A;  1HRJ A;  1WD1 A;  4GLA C;  1SYD A;  1ZKO A;  4UHV A;  4A76 A;  3AU7 A;  3TRZ A;  1N8R C;  3CMA A;  3U50 C;  4L5T A;  1KLU D;  5DEH A;  2N49 A;  1I4P A;  4B3R Q;  2YU9 H;  4BBR G;  2RKS A;  3PUZ A;  1B4O A;  1PRT D;  1IBL Q;  3HKZ E;  4DK6 C;  2WV6 D;  1SJE D;  2KJX A;  3NEL A;  2E2I H;  1EFI D;  2IPK D;  1S72 A;  1A15 A;  2KUM A;  1ASZ A;  4A3K B;  5FO7 B;  2JA7 H;  4JBM A;  2JEA I;  4P2C B;  2X69 A;  5CV5 A;  1STY A;  1P8L A;  4DR6 L;  2WAQ E;  3BYY B;  4A3B H;  1SYE A;  1HNW L;  2JP1 A;  1W6K A;  1B70 B;  3D4D A;  3BVZ A;  3BDC A;  1C0A A;  2EYP A;  2NWG A;  3QB3 A;  3U9O A;  3H0G G;  1M1K C;  2NVT B;  1VQB A;  3TSS A;  1XPO A;  1JWM D;  5AJ3 Q;  5A2Q L;  3S24 A;  1HZA A;  4GS3 A;  3F2D A;  4TSS A;  2I0Q A;  4PQX A;  1QVC A;  4KKS A;  3CU7 A;  5I4D A;  2PZW A;  1M8A A;  3K7A B;  1LTA D;  1X54 A;  1L2F A;  3A8I E;  4DV1 L;  2EPB A;  3GDE A;  1P16 A;  3OW2 A;  1HQR D;  3PUY A;  2SEB D;  1PH9 A;  5IGE A;  2E5L L;  3HOX B;  2CW0 C;  2QDB A;  1KDC A;  2AUJ D;  3NPP A;  4NB3 A;  3TP5 A;  2BOS A;  4A3K G;  2VS1 A;  1HA5 A;  1YVC A;  4R4T A;  2UUB Q;  3TDQ A;  1Q8K A;  1CQF A;  1TWC B;  2B2U C;  1O78 A;  1Q3L A;  5IP9 G;  1IYV A;  2B8G A;  2A8V A;  2YU9 B;  2Q8I B;  1GJX A;  5CBE E;  3ERQ A;  4QUF A;  5C5M A;  1G29 1;  3MTS A;  3A55 A;  3N6R A;  3A74 A;  2MUY A;  4DUZ L;  2YTX A;  2IT1 A;  1SNO A;  2FIN B;  4GKK L;  4DV6 Q;  4DAM A;  1I3Q H;  4B9X A;  2D0O A;  4TRD A;  5M3F H;  1MBY A;  2EJF C;  1Q8I A;  5D14 A;  1A3T A;  4BY1 H;  2EJM A;  2E2J B;  2UU9 Q;  2JK8 A;  2EY5 A;  2PNH A;  3EA6 A;  2PQE A;  4V0B A;  1V43 A;  3CCS A;  4K2K A;  4JI6 L;  1D2B A;  2NVT H;  5D3I B;  5IYC H;  2B2W A;  1QB5 D;  2I46 A;  1YI2 A;  3AYH B;  4IAL A;  1RF2 D;  4HSV A;  4IUV A;  2ZXP A;  4KN7 C;  3RR5 A;  5JPN C;  4GNX B;  4BBR H;  5EKI A;  4PMC A;  3URY A;  2MNA A;  3G6E A;  1DD2 A;  1IBM L;  1GKH A;  4K2L A;  1PTO H;  2RDG A;  3GTP H;  1WTW A;  1SN8 A;  2Q8T A;  1XPR A;  1TXY A;  2A19 A;  4Y7N B;  2NVY H;  5LMU Q;  2UUC Q;  1PFN A;  1S4Z A;  1B1Z A;  2ZM6 L;  2KHJ A;  3UE1 A;  5JJL A;  1N36 Q;  1GM5 A;  3K5L A;  3HOY G;  1ZYR C;  1BKB A;  1H9K A;  3MHB A;  3E9H A;  1PRT C;  4DUY Q;  1D5M C;  1LTI D;  4J15 A;  1Z9F A;  3MFG A;  1WTR A;  4A3L G;  3VR4 A;  4RFB A;  3GQB A;  3NP8 A;  4AH6 A;  2MO1 A;  2F3I A;  2Y0S G;  4JPB W;  3AMU A;  1EOV A;  2X6G A;  5C44 B;  4C3J H;  1LYL A;  3CXC A;  4AYB B;  1FGU A;  1XTC D;  1KAB A;  1D1I A;  5JEA H;  4OO1 G;  3NUC A;  1XMQ L;  5EAY A;  1S3O A;  1JB3 A;  4P73 A;  1XJV A;  3BYT B;  2E2H B;  3HOU B;  2C9O A;  4IFD H;  3J81 i;  1SLJ A;  2HDM A;  1K28 A;  3H91 A;  5FO8 B;  1XX8 A;  1KRS A;  1M90 C;  1VQ5 A;  4NMZ A;  4ODG A;  2WAQ G;  2RBM A;  1K3B C;  3QO2 A;  4YCU A;  2SDF A;  2KOL A;  1I94 Q;  1KAW A;  5JJI A;  2OQK A;  4RG1 A;  4JI0 L;  1B3Q A;  3S9W A;  2FJ2 A;  4Y7N H;  4KN4 C;  3BZC A;  3H3V H;  2BA0 A;  3S1M H;  4JG2 A;  5IE8 A;  5JPM C;  1SFO B;  4A3B G;  4LFC L;  3J80 c;  3HKZ B;  3D8G A;  4H7B A;  3AFP A;  4KLK A;  4ZLT F;  3GTL H;  3DUZ A;  1RHP A;  4L63 B;  3C3L A;  2JA6 G;  1LV9 A;  5FLM G;  1JB7 A;  3M4O H;  3FKI B;  3VDY A;  1O7Z A;  2O5I C;  4UAI A;  2IY5 B;  2UUC L;  2ZM6 Q;  3MEH A;  4UP7 A;  4A3I B;  5C44 H;  2F4I A;  1D7Q A;  2Z9H A;  5COY A;  2MO0 A;  4A3K H;  4Z9C B;  1VQE A;  2MJ8 A;  3OSO A;  1FGB D;  4HMJ A;  4KJN A;  2A69 D;  4C3H H;  2H4O A;  1TII D;  1U9R A;  3E9I A;  4R4C A;  3J81 L;  1VQ9 A;  1A2T A;  2EY1 A;  2CWP A;  1TWH B;  3Q24 A;  3PUX A;  2HHH L;  2VNU D;  4C3I H;  1TWF B;  4YWL A;  2OCE A;  2HQE A;  3CRK C;  3T51 B;  4FF3 A;  3K6O A;  2EOT A;  1HHV A;  3WOF A;  3UDG A;  1SNP A;  4PZ7 A;  4R4O A;  4WJ4 A;  1YIT A;  1YBY A;  3DM3 A;  4DN4 M;  4RMF A;  3K58 A;  1KC8 C;  2EYM A;  4C1N I;  4IUP A;  3HP3 A;  3UE0 A;  3RZO B;  1WYD A;  1Q1B A;  1B7Y B;  1QOH A;  5IYC G;  3QOL A;  1C8C A;  3GTL B;  2H1E A;  5EKL A;  3UDF A;  4WFN 3;  3JAM E;  2IX3 A;  2Z8L A;  1BF4 A;  1VQ4 A;  2VQE L;  4IFD G;  5EJW A;  1VF7 A;  2F0W A;  1I4X A;  1TR5 A;  2B29 A;  2EYL A;  1X65 A;  3SR1 A;  1OXU A;  1U0L A;  2F3V A;  2JN4 A;  2ZT9 C;  2DGY A;  1HNZ L;  1KHI A;  4HIO A;  4BY7 H;  3I91 A;  1JWS D;  2ENB A;  5LL6 X;  1VMP A;  2K04 A;  4DV5 Q;  4ZYS A;  1A6X A;  1EWI A;  4X64 Q;  2EE1 A;  2A6E D;  3I4L A;  4IPG A;  1ICF B;  2JE6 I;  3PIP A;  2VB2 X;  2BDO A;  3CRL C;  2N3S A;  2VW9 A;  2I5L X;  3IFD A;  1WD0 A;  2L4N A;  2NB0 A;  1F9Q A;  5M3F B;  1SXT A;  1K9M C;  1STN A;  1HR0 W;  3PGZ A;  2NBF A;  1EY7 A;  4XDX A;  5EBC A;  4BY1 B;  1PMR A;  5IGD A;  1KQS A;  4K0K Q;  5FKA C;  1I4Q A;  1HR0 Q;  3I4O A;  3VYU A;  4LUV A;  4AIM A;  2UU9 L;  3HKS A;  3ULL A;  3BU2 A;  1MIU A;  1PRT F;  2ZXR A;  3OIQ A;  3PSI A;  4JI6 Q;  3SGI A;  2EJG C;  3W1G A;  5FLX c;  3K0Y A;  3S15 B;  2L55 A;  4KD3 A;  1EQQ A;  1CKO A;  1Q90 A;  3QOJ A;  4XT3 B;  1HFN A;  1EY8 A;  1W2B A;  5BR8 L;  3H09 A;  4B3T Q;  4A3C G;  1VQI A;  4TVA B;  3I90 A;  4RGN A;  3GTP B;  4KI0 A;  4DV2 L;  1AN8 A;  1I6H H;  2R7Z B;  2N88 A;  5LMU L;  3JAM c;  1NY4 A;  3K57 A;  4BY7 B;  1D5Z C;  4DV3 Q;  1E22 A;  1LTT D;  2Q2T A;  3PO2 G;  3S2D B;  4Q0F A;  4L6T B;  2R93 B;  2XVS A;  3KLS A;  2AKW B;  5C6A A;  4OHJ A;  4LF8 L;  4IJL A;  4PZ6 A;  2IHE A;  2XRQ D;  1IL2 A;  2RSN A;  3NWT A;  1PTO D;  2EXD A;  4NKL A;  1O7I A;  3K5O A;  2B2W C;  3CW2 C;  3A5U A;  3FPP A;  4E6I A;  2V1C C;  4RH6 A;  1EYD A;  4TQU S;  1I3Q B;  3HOW G;  5JAV A;  2JA5 G;  2F0E A;  1MHW C;  1GUS A;  2ZTE A;  1C48 A;  1FYC A;  2R93 G;  1FNW A;  2B2V C;  3MVV A;  3SK4 A;  4C2M H;  4B3M L;  4NW2 A;  1X3Q A;  1CSQ A;  1F77 A;  5I9P A;  3ITP A;  3FKI G;  1EEF D;  3DXJ C;  3S16 B;  2NN6 H;  2PZT A;  1BXT A;  4FF1 A;  1XYI A;  2HDL A;  4ILW A;  2BCO A;  1QVG A;  1B2T A;  4X65 Q;  4G4K A;  3NTH A;  4OXP A;  1XNR Q;  1VQG A;  2F0U A;  1TWA B;  4KHV A;  4JI3 L;  1X3P A;  1RKN A;  1V9P A;  3FHW A;  4A3J H;  4B08 A;  2NN6 I;  1A3U A;  1VQ8 A;  4N8F A;  1LTS D;  4GKJ Q;  2QEJ C;  2R6G A;  1I50 H;  2VL6 A;  2I5M X;  1UNS A;  4J8Q A;  5A35 A;  1AH9 A;  1RCV D;  3J7Y W;  4IPH A;  3ZYY X;  4N9T A;  2JJQ A;  1K73 C;  1D6E C;  2EY6 A;  3RZD H;  5DLQ E;  2B2Y A;  4A3D H;  1TWG B;  3FRP B;  4APV A;  5CGK A;  1CKM A;  3UI2 A;  3QIA A; 
#chains in the Genus database with same CATH homology
 4JV5 L;  5C4J H;  3NEL A;  1Q81 C;  2E2I H;  3HOZ H;  1A63 A;  4OWX B;  3RLF A;  3L0O A;  1FJG Q;  3HOV H;  1S72 A;  4JI5 Q;  3GD7 A;  2RHS B;  4GN5 A;  3T1H Q;  1ASZ A;  4A93 G;  1OTC A;  3LGJ A;  4POF A;  3K7A H;  3KYH C;  2AWO A;  2VY3 A;  4OON A;  2JA7 H;  5IWA L;  2Q2I A;  4JBM A;  2JEA I;  2AWN A;  1L1O C;  4YWM A;  1Q46 A;  4HJ7 A;  4OO1 I;  4JOI A;  4A4I A;  4A93 H;  3PV0 A;  1VQL A;  2MQH A;  1P8L A;  4JOI C;  4DR6 L;  3MEF A;  2WAQ E;  3H0G H;  2Y0S E;  4A3E H;  3S1Q H;  3TS0 A;  1N34 Q;  3KDF A;  3F1Z A;  4A3B H;  1HNW L;  3HOX G;  1B70 B;  4AYB G;  4K0K L;  4YCV A;  3S16 H;  5GAD C;  1HNX Q;  1C0A A;  1PYB A;  3H0G G;  2HQL A;  1M1K C;  1VQB A;  1I94 L;  4GOP B;  4QQB X;  5FJ8 H;  1XPO A;  3HOU H;  4UY8 C;  5AJ3 Q;  3S24 A;  1HZA A;  4GS3 A;  3F2D A;  2BH8 A;  1IBK L;  3I4N G;  3U4Z A;  4JV5 Q;  3ERS X;  2I0Q A;  1QVC A;  3CF5 A;  1OXS C;  1D8L A;  1V1Q A;  4HJ5 A;  3CCJ A;  1YEZ A;  1XMO L;  2KEN A;  1X54 A;  1L2F A;  4DV1 L;  1UE6 A;  2ID0 A;  3GDE A;  3CC7 A;  1P16 A;  3OW2 A;  3PUY A;  4OX9 Q;  1PH9 A;  4UPA A;  4DR2 Q;  2E5L L;  2UXC Q;  1C9O A;  2JA5 H;  3RZO H;  3IRB A;  4IJH A;  5C3E H;  1Y14 B;  1BBW A;  3RN5 A;  4NB3 A;  2PQA A;  4A3K G;  1OXV A;  2ZTC A;  2VS1 A;  4B3M Q;  1YVC A;  3JAM i;  3CC4 A;  4R4T A;  2UUB Q;  2IX1 A;  2F4V L;  1Q8K A;  5IP9 G;  4X65 L;  3D0F A;  4A3C H;  1TWG H;  2A8V A;  3HOV G;  1VQ7 A;  2D0P A;  3OYY A;  2LSS A;  5GAE C;  1G29 1;  1PA6 A;  1AE2 A;  4R4Q A;  4JI2 L;  4A3I G;  5M3M G;  3KF8 B;  3A74 A;  2XGT A;  2LXJ A;  4DUZ L;  1XNR L;  2YTX A;  4A3M G;  1UE5 A;  2IT1 A;  2RF4 A;  5IYB G;  2IX0 A;  1KIX A;  1XNQ L;  4DV6 Q;  4DAM A;  1I3Q H;  1L0W A;  2D0O A;  3UDX A;  1HR0 L;  4GKK L;  4A3L H;  5M3F H;  1HZB A;  1BBU A;  3H15 A;  3PO2 H;  4A3E G;  3KF6 A;  5GQO A;  4LFC Q;  4DV1 Q;  4IFD J;  3PUW A;  5JEA J;  4LF7 L;  5IYD H;  1QUQ B;  1VQJ A;  1SR3 A;  4BY1 H;  3AQQ A;  1KD1 C;  3TQY A;  4KHP Q;  3BJU A;  5IP7 H;  1N33 Q;  4L5Q A;  4X66 Q;  2JK8 A;  2UU9 Q;  1VQA A;  4A3G G;  4A3F H;  1PH5 A;  2PNH A;  1W3S A;  2JQO A;  1NTG A;  3CCS A;  1V43 A;  2N78 A;  5C3E G;  1N9W A;  4JI6 L;  2ALY B;  4PMW A;  2NVT H;  1AE3 A;  4MNO A;  3H3V I;  5IYC H;  1SRO A;  2K4K A;  1YI2 A;  2VQF L;  4DV0 Q;  4B3R L;  3AYH B;  4NXN Q;  4GNX B;  1L1O B;  3RR5 A;  2PI2 E;  4DV4 Q;  2JA8 H;  4BBR H;  4KHZ A;  2HHH Q;  1GD7 A;  4LFB Q;  2MNA A;  3G6E A;  3CCU A;  2D62 A;  4IOC A;  1LUZ A;  1IBM L;  4BY7 G;  1GKH A;  4DR4 L;  1YJN A;  3CC2 A;  3UDI A;  3K80 C;  3GTP H;  1VQH A;  1SN8 A;  1L1O A;  1XPR A;  1TXY A;  2A19 A;  4Y52 H;  2NVY H;  5LMU Q;  3HFZ B;  2UUC Q;  1Z47 A;  2A1A A;  2ZM6 L;  2KHJ A;  2PMZ E;  2ZTD A;  3UE1 A;  1PH4 A;  4DR1 Q;  1PH1 A;  5JJL A;  5GAH C;  1N36 Q;  4GNX C;  1GM5 A;  2E2J H;  4DR7 L;  2WB1 G;  3HOY G;  3J7A 5;  3U4V A;  2ASB A;  1BKB A;  3AFQ A;  4GOP A;  5IYD G;  4AQY Q;  1CKN A;  4DR7 Q;  2JEB I;  3E9H A;  1J6Q A;  1G6P A;  3K0X A;  4DUY Q;  3E0E A;  1Q12 A;  3TEH B;  4J15 A;  2QA4 A;  4X62 L;  1Z9F A;  1IXR A;  4DUY L;  1QVF A;  4A3L G;  1I5F A;  2UXB L;  4JYA Q;  2K75 A;  5HGQ A;  2UXB Q;  4DV2 Q;  4AH6 A;  2MO1 A;  2B3G A;  4JI4 L;  2F3I A;  4IOA A;  2XTI A;  3GTJ H;  2Y0S G;  4YY3 Q;  3GTO H;  4BY1 G;  2JA8 G;  2N8N A;  4JBK A;  1EOV A;  4C3J H;  1LYL A;  3S1R H;  1XMO Q;  3CXC A;  3M4P A;  4JI8 Q;  3ZJY C;  1Q7Y C;  1FGU A;  2HT1 A;  4B3S Q;  2LXK A;  4OO1 G;  1XMQ L;  2K5H A;  5EAY A;  1N36 L;  1S3O A;  3I55 A;  3J81 c;  2GVA A;  4P73 A;  1XJV A;  2VUM H;  3CCL A;  1YNX A;  3CCV A;  1Q82 C;  5HY6 A;  5C4X G;  1A8V A;  3HOY H;  1NBW A;  4OWT B;  3J81 i;  1A62 A;  1SLJ A;  2YTV A;  3M7N A;  2UXD Q;  2IHF A;  4NPS A;  3PCO B;  2CCZ A;  2VUM G;  1KRS A;  4LF9 L;  1M90 C;  3CAM A;  2QEX A;  1VQ5 A;  1XNQ Q;  3CCE A;  2Z6K A;  1IBK Q;  2WAQ G;  4JI7 Q;  1MJC A;  3KOJ A;  4YHH Q;  4YCU A;  4DUZ Q;  5JJI A;  1I94 Q;  1KAW A;  4LF7 Q;  2OQK A;  4RG1 A;  4JI0 L;  3JC6 6;  1N32 Q;  1E24 A;  5M5X H;  3NBH B;  4A75 A;  3T1Y L;  4YY3 L;  1RL2 A;  4P71 A;  4Y7N H;  1CUK A;  1NMF A;  3BZC A;  1Y1W G;  2BA0 A;  1EQR A;  4JI0 Q;  3AEV A;  4A3J G;  4JG2 A;  3CD6 A;  5LMN L;  5IE8 A;  3KJO A;  3ER0 A;  1XPU A;  3D31 A;  2RHQ B;  4LFC L;  3J80 c;  1VQK A;  4A3B G;  2OTJ A;  2Z0S A;  1BVS A;  1G51 A;  2K52 A;  1HZC A;  4X64 L;  1XMQ Q;  1E1T A;  2E8G A;  3AFP A;  1TWC H;  4KLK A;  1PVO A;  5BR8 Q;  4B3T L;  2E2H H;  4DR3 L;  3GTL H;  2KCM A;  3G71 A;  5IP7 G;  2JA6 G;  2E5L Q;  2BA1 A;  5FLM G;  1JB7 A;  3ULP A;  3M4O H;  1TWA H;  4FDB A;  4JI1 L;  2ZJR A;  4DR3 Q;  4A3F G;  3VDY A;  2EQS A;  2F52 A;  3CPW A;  4DR5 L;  3KJP A;  2CWA A;  4JC0 A;  4P74 A;  4LF5 Q;  4UP8 A;  5M5Y H;  1YIJ A;  1TWH H;  4AYB E;  4DR5 Q;  2IY5 B;  3ICE A;  4DV4 L;  1Q86 C;  2WB1 E;  2UUC L;  4DV3 L;  2ZM6 Q;  3W5O A;  1EUJ A;  4UP7 A;  1SE8 A;  3GO5 A;  4MTN A;  4DAY B;  5C44 H;  2R7Z H;  3S14 H;  5K36 G;  1D7Q A;  1UWV A;  2MO0 A;  4BA1 I;  4A3K H;  2VZA A;  3WWV A;  3CME A;  1WCM H;  1VQE A;  3M9B A;  1CSP A;  1OXX K;  1XTD A;  4L5R C;  2NN6 G;  1PH2 A;  4LF4 L;  2WP8 J;  2JA7 G;  4LW1 A;  3I2Z A;  2EIF A;  3F8T A;  1KRT A;  3U58 A;  4C3H H;  1VS0 A;  2K5N A;  1KXL A;  3STB D;  5IT9 c;  4L5S A;  3E9I A;  4LUZ A;  1EFW A;  2NVQ H;  4R4C A;  2ES2 A;  1VQ9 A;  2K14 A;  3BZK A;  2OWO A;  4HIK A;  2NZH A;  3MXN B;  3PF4 A;  5ELN A;  1FJG L;  4IPD A;  1JE5 A;  2CWP A;  5FLM H;  3PO3 H;  3PUX A;  2HHH L;  2VNU D;  4C3I H;  1QUQ A;  5C0X G;  4YWL A;  2OCE A;  4ALP A;  3GTM H;  1PH6 A;  4YWK A;  1OXT A;  4R1J A;  1EIY B;  4B3S L;  3J7Z C;  3I4N H;  3UDG A;  2K5V A;  4PZ7 A;  1X3F A;  1HNZ Q;  4R4O A;  1CKN B;  3M4Q A;  4WJ4 A;  2H5X A;  1YIT A;  4GN3 B;  5IYB H;  1JJ2 A;  1VQ6 A;  1YBY A;  3DM3 A;  4BXX H;  2F4V Q;  3J81 j;  1C7Y A;  4A3D G;  4RMF A;  1R9T H;  3Q8D A;  1KC8 C;  4DV5 L;  4LF4 Q;  3UE0 A;  1WYD A;  1Q1B A;  1B7Y B;  5IYC G;  2WFW A;  1K83 H;  1YHA A;  4JI3 Q;  4JI2 Q;  4LF9 Q;  2AHO B;  3UDF A;  2Q2H A;  1PV4 A;  1VQO A;  4DV7 Q;  3EN2 A;  3NEM A;  1VQ4 A;  4DPG A;  4DV6 L;  2Z6K C;  1VQF A;  5C0X I;  1A0I A;  2B63 G;  2VQE L;  3ULJ A;  4IFD G;  5LMN W;  4JYA L;  5C4X H;  1J5E Q;  1TWF H;  1HZ9 A;  2CFM A;  1PFS A;  4JCV E;  1QZH A;  4R4I A;  4HJA A;  4JI7 L;  2B29 A;  1VCI A;  5LMN Q;  5AJ3 L;  3CCQ A;  4A3I H;  1DGS A;  1X65 A;  4LFA L;  1OXU A;  1U0L A;  4GKJ L;  3CQZ H;  4P72 A;  4QY7 A;  2DGY A;  1WFQ A;  3T1Y Q;  4OWW B;  1HNZ L;  1KHI A;  1VQC A;  3M85 A;  4HIO A;  4IO9 A;  4BY7 H;  5IP9 H;  2DUD A;  5M3F G;  1RIP A;  4LWC A;  4DNI A;  1K0R A;  4QJF A;  5GRO A;  3I4M G;  3S2D H;  4DV5 Q;  4OX9 L;  4BXX G;  2VQF Q;  1EWI A;  4X64 Q;  3KF6 B;  3EIV A;  4DV0 L;  1PH8 A;  3TS2 A;  2UXC L;  5M3M H;  4IPG A;  3RLO A;  3M3Y H;  4ME3 A;  2JE6 I;  3PIP A;  1NJI C;  1K8A C;  2KCT A;  1LM0 A;  1PYS B;  4GOP C;  3GTG H;  3CCM A;  4DV7 L;  4DR4 Q;  3S15 H;  2N3S A;  3CP0 A;  2VW9 A;  3G4S A;  2I5L X;  2MFI A;  1HH2 P;  1UEB A;  2L15 A;  4JI5 L;  1K3R A;  4HIM A;  1K9M C;  2KHI A;  4YCW A;  1IZ6 A;  3W1B A;  1Y1V H;  2B63 H;  4DR6 Q;  1UE1 A;  1HR0 W;  3OTO L;  3PGZ A;  3A0J A;  4XTC S;  1HNW Q;  1KQS A;  4K0K Q;  3OTO Q;  1WOC A;  4YHH L;  1HR0 Q;  3I4O A;  4LUV A;  1VQN A;  3KFU A;  3I7F A;  3F2B A;  4UP9 A;  1S40 A;  2NZO A;  4LF6 L;  4X66 L;  4AIM A;  3HKS A;  2UU9 L;  3ULL A;  4DKA C;  4PZ8 A;  1N34 L;  3BU2 A;  1B8A A;  1MIU A;  4GN4 B;  2R7D A;  2R93 H;  1IYJ B;  4QIW E;  3PSI A;  1EYG A;  4LF8 Q;  1E1O A;  5JEA G;  4BBS H;  1LTL A;  4JI6 Q;  3SGI A;  1HJP A;  1HNX L;  3STB C;  3W1G A;  5FLX c;  3S1N H;  1SMX A;  4GLV B;  4JI4 Q;  3CCR A;  1CKO A;  1EQQ A;  2Q2U A;  4XIG S;  1W2B A;  1YJW A;  5BR8 L;  4P75 A;  4B3T Q;  4BBS G;  1VQI A;  4A3C G;  5JJK A;  4TVA B;  1X3E A;  2QGQ A;  4LF5 L;  3RN2 A;  1U5K A;  3KLW A;  1H95 A;  3A5Z B;  5J3B A;  4DR2 L;  4KI0 A;  4DV2 L;  2KBN A;  1VQM A;  4JI1 Q;  1I6H H;  2C35 B;  1JMC A;  5IWA Q;  3H3V H;  3S1M H;  1VQD A;  3I4M H;  5LMU L;  2CKZ B;  1QZG A;  2AMC B;  3JAM c;  2ZJP A;  1NY4 A;  1K8G A;  3L2P A;  3KDF B;  3T1H L;  3J80 i;  4X6A H;  1IBM Q;  2OTL A;  1X55 A;  2HIX A;  4DV3 Q;  1E22 A;  2Q2T A;  3PO2 G;  4LF6 Q;  4EX5 A;  4AQY L;  4HJ8 A;  1EIF A;  1GO3 E;  2YYZ A;  3CPF A;  2AKW B;  3B6Y A;  5FJ8 G;  4DR1 L;  3HOU G;  1X56 A;  4JBW A;  2GN5 A;  2OQ0 A;  4LF8 L;  4IJL A;  4PZ6 A;  1E3P A;  4WJ3 M;  2IHE A;  2R92 H;  1IL2 A;  3K81 C;  4BA2 I;  1Y1V G;  3K7U C;  3FP9 A;  2EXD A;  1O7I A;  1UE7 A;  2PI2 A;  4HJ9 A;  3DLL A;  3RNU A;  2UUA L;  3CW2 C;  2JA6 H;  2R7Z G;  2BH2 A;  3A5U A;  4O2D A;  2FXQ A;  4LNQ A;  2R92 G;  4PG3 A;  1YZ6 A;  2PQA B;  2V1C C;  2UUA Q;  1WCM G;  3EBE A;  4TQU S;  1FL0 A;  2GVB A;  3HOW G;  1KL9 A;  4GNX A;  2JA5 G;  3F2C A;  4IPC A;  1JJG A;  1NE3 A;  2ZTE A;  3HKZ G;  5E7N A;  4QGU A;  2R93 G;  4MZ9 A;  2R7F A;  5C0X J;  1X9N A;  4KHP L;  3L7Z C;  2ATW A;  1E7Z A;  4C2M H;  4B3M L;  2JA9 A;  5IY0 A;  4O0A A;  5C44 G;  3PIO A;  1N33 L;  1PHJ A;  3PF5 A;  4EQ5 A;  3S2H H;  4DK3 C;  4JI8 L;  2K50 A;  4NXN L;  4POG A;  1CSQ A;  1SRU A;  1X3G A;  3FKI G;  1WJJ A;  2I5H A;  4HID A;  3RLN A;  2UXD L;  3PO3 G;  2NVX H;  4QL5 A;  3TRE A;  4A3M H;  2HIV A;  1QVG A;  2UUB L;  1MKH A;  4X65 Q;  4OXP A;  1XNR Q;  1VQG A;  3FKI H;  4NXM L;  4JI3 L;  5M5W H;  1MJE A;  4JBJ A;  1NMG A;  2YTY A;  1V9P A;  2CQO A;  1J5E L;  4GKK Q;  4IFD I;  1Y1W H;  4LFB L;  3FHW A;  4A3J H;  1Q1E A;  5GAG C;  4NXM Q;  3GTK H;  3GTQ H;  1FVI A;  2NN6 I;  1YHQ A;  1PH3 A;  1X6O A;  1VQP A;  1VQ8 A;  3S17 H;  4GLX A;  1SFO H;  4LFA Q;  2VQE Q;  4GKJ Q;  1GVP A;  2R6G A;  3G48 A;  3I56 A;  1I50 H;  2VL6 A;  1YHB A;  2I5M X;  4A3G H;  4H02 A;  3HOX H;  3HOW H;  1N32 L;  3NEN A;  1AH9 A;  1WI5 A;  2ZJQ A;  4GLA C;  4IPH A;  1JJC B;  5ELO A;  2JJQ A;  1T9H A;  4LUO A;  1K73 C;  3K8A A;  5H1S E;  4A76 A;  1ASY A;  3TRZ A;  1N8R C;  3CMA A;  3U50 C;  3RZD H;  1PH7 A;  4L5T A;  5DLQ E;  1IBL L;  3HOZ G;  4A3D H;  1JT8 A;  2N49 A;  3PUV A;  4B3R Q;  2YU9 H;  4BBR G;  4X62 Q;  3PUZ A;  4APV A;  2RCN A;  1YJ9 A;  1IBL Q;  1CKM A;  3HKZ E;  4DK6 C;  2YV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...