4A76A

The lin28b cold shock domain in complex with heptathymidine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
PQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/dna
molecule keywords LIN28 COLD SHOCK DOMAIN
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
total genus 18
structure length 86
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a76A00
3CD6A 2D0PA 3J7ZC 2JA5G 4DR6Q 2K5HA 2UXDL 1Y1WG 1N36L 3J80i 1YBYA 4JI2Q 2KCMA 1S3OA 1XNRL 1OXUA 1Q81C 2E5LL 2K50A 5M3FG 4JI0Q 2QGQA 4MTNA 1WCMH 4IJHA 3FHWA 4DR5L 4JBWA 3L2PA 1B8AA 3CXCA 1R9TH 4DV5L 4LFCQ 3BZKA 4NXMQ 4A3KG 3NEMA 1N9WA 4X62Q 2NVXH 1QVFA 4IFDI 4A3EH 2IHEA 2K14A 4P74A 1I50H 1J6QA 4JI8L 1CKOA 2RHSB 4PMWA 3CP0A 3SGIA 4OO1I 3TEHB 1IBKL 4HIDA 4Y52H 1KD1C 2E2HH 1P16A 1X3FA 4DR1Q 4GN3B 2B63H 4JOIA 4QIWE 3NELA 3RLFA 1XPRA 4GNXC 1Q1BA 3ULLA 1HR0L 2Z6KC 4DR7Q 2OQ0A 4YY3Q 1JT8A 1UE7A 3CCSA 1KL9A 1WYDA 3UDGA 2ZJRA 1KIXA 1HNZL 3U58A 3CCJA 3EN2A 2QA4A 1QVGA 3GTKH 3KJPA 3HOXH 3H0GG 3PIPA 3K8AA 3I4MG 1L1OA 1G6PA 1YJWA 4JBJA 4GN4B 4ME3A 2VNUD 1EIYB 1TWFH 3CCMA 1IZ6A 1GKHA 3L7ZC 4LF6Q 4DUYQ 4LF8L 4DUZL 4JBMA 3KFUA 2JE6I 2JJQA 3Q8DA 4LF9Q 1IXRA 1YHAA 2WFWA 3CQZH 2RHQB 3K81C 3CCUA 2BH2A 2ZTDA 1FVIA 1VQJA 4GN5A 2WB1E 1FJGL 3HOZH 1K8AC 4A3DG 1IYJB 3PF4A 3F2BA 4LW1A 2OWOA 2I5MX 3W1BA 5C4JH 1A62A 2AHOB 2NN6G 3PGZA 3CCEA 3S2DH 4A3CH 2XGTA 2JA6H 3GTMH 4UPAA 2BH8A 3W1GA 4PZ7A 4DV2Q 1HNXQ 3PO3G 5GAHC 1SLJA 5BR8L 4JI4L 4PZ6A 3RNUA 4BBSH 2JA7G 4X66L 4DV3Q 2VUMG 4POGA 4NPSA 3ERSX 1SROA 4PZ8A 1PH3A 3S1QH 2LXJA 1TWGH 3M4OH 3GTGH 1QZHA 2JA8H 2N3SA 3CCRA 2CWPA 3J80c 4JI1Q 1NJIC 3I55A 1LUZA 1IBML 2WB1G 4TQUS 1HZCA 4X6AH 4AQYQ 2JA5H 1K73C 3GTLH 4NXNL 3K80C 1KXLA 3CW2C 1K8GA 2JQOA 2UUBL 2VQFL 1U0LA 4EQ5A 4RG1A 5GQOA 3JC66 1V1QA 4C3JH 1B7YB 1IBKQ 5C4XG 2FXQA 4A3FG 4L5RC 2IY5B 2H5XA 1NMGA 3G71A 4A3KH 2Q2UA 1UEBA 2PMZE 2NN6I 4C3HH 1KHIA 5AJ3L 1HR0Q 2WP8J 3GTQH 1EUJA 2R7ZG 3M3YH 1HZBA 3DLLA 2XTIA 4LF4L 1Z47A 2VL6A 2YTVA 3AEVA 2Q2IA 4IPCA 1HNZQ 1NBWA 3U4VA 1TXYA 3CMAA 1YJ9A 3HOUG 2KBNA 1UE5A 5J3BA 4GKKL 2A8VA 4DR4L 2ZM6L 1NE3A 5M5XH 2F3IA 4IPDA 4C3IH 4H02A 4GLXA 4GLAC 4LF7Q 4A93G 5IE8A 2OQKA 3RN5A 4LF8Q 4MNOA 4DUZQ 4JYAL 2F4VQ 1X56A 1E1OA 2PI2E 4KHPL 2UU9L 1PH5A 1CSPA 4DV6L 1SN8A 4BA2I 1D8LA 3E9IA 2ID0A 2NZHA 1PFSA 2VY3A 4DV0Q 1FJGQ 3H0GH 1VS0A 4GKJL 2CCZA 2HQLA 3VDYA 4B3MQ 3HOWG 3S15H 1VCIA 1I5FA 3KOJA 1X3GA 1N34L 1N33L 4YHHQ 1Z9FA 1VQIA 1SFOH 1XMQL 1VQ6A 4LNQA 5DLQE 4X65L 4A3JG 4BA1I 1A63A 1PVOA 1I94Q 5BR8Q 2I0QA 1L1OB 1EIFA 1WFQA 2B29A 2BA1A 2D0OA 4X66Q 1Q8KA 4IPGA 3F1ZA 3M85A 3T1YQ 4B3SL 2C35B 4DK6C 4A3DH 1VQBA 5FLMH 1AE2A 3BZCA 1UE1A 5IYDG 4HJ9A 2ZJPA 3AFPA 1WI5A 3G4SA 1VQOA 3H15A 2GN5A 4LF5L 3E0EA 2PQAB 4DV1Q 1VQDA 3ULPA 1VQAA 2B3GA 1CKMA 1G51A 2K4KA 2YTXA 4A3BH 1Y1VH 1IBMQ 2PNHA 1HR0W 1PH9A 4XIGS 4A3LG 3ZJYC 3S17H 3F8TA 4BY7H 2JA7H 1X54A 4HJ8A 3RLOA 4NXNQ 4BBRG 4R4QA 3ICEA 1KRSA 4DPGA 4K0KL 3T1HL 4DR3L 4A4IA 4YCUA 2VQFQ 4JI7L 1BVSA 2ATWA 3I4OA 1VQFA 1X55A 3CMEA 4P72A 5IYBG 5C44G 5K36G 3JAMi 1VQ9A 3FKIH 5IP9H 4A3IH 5HY6A 4LFBQ 5IP7H 5H1SE 2HHHQ 2NVQH 1I3QH 1HH2P 1XPOA 4DK3C 1AH9A 1JJCB 2N8NA 3CCQA 1Q1EA 1V9PA 4A3MG 1QVCA 3KJOA 4BY1H 3M4QA 2UXCL 4QQBX 1CSQA 2VQEL 1FL0A 1C9OA 3K0XA 2E8GA 1Y14B 3NBHB 4OWXB 4UP7A 4DV4L 1XMOL 1VQ7A 1YZ6A 5GAEC 4JI5Q 4AH6A 4A3FH 2HT1A 4WJ4A 4JI3L 5M5WH 2UUCL 2KENA 4JI6Q 1Q82C 3D0FA 2Z0SA 2PQAA 2CFMA 3U4ZA 3CF5A 4DV7L 4GOPB 5JJIA 4DR4Q 1CUKA 4GLVB 4UY8C 4B3RL 1HNWL 2R93G 1EWIA 3CC2A 2EIFA 1M90C 1FGUA 3CC4A 4JYAQ 1VQKA 2AWNA 1X3EA 1E1TA 4JV5L 2UXBQ 4JBKA 4POFA 1XNQL 4X64L 4OWTB 4B3TL 3A0JA 2R6GA 3UE0A 3S1RH 1NMFA 3A74A 3BU2A 3I7FA 1PH1A 1IBLL 2E2JH 3HOUH 5IWAL 2MFIA 4LFAL 1N32L 4P71A 5JJLA 1IL2A 1AE3A 1KRTA 3F2CA 5JJKA 2UXDQ 1PYSB 1E7ZA 3DM3A 1N36Q 3H3VI 1CKNB 1G291 1XNRQ 1X9NA 2NVTH 2E5LQ 1XJVA 3W5OA 3CC7A 4DR5Q 4OX9L 3S2HH 2R92G 1TWCH 1ASYA 2I5LX 4DV5Q 3BJUA 1Q46A 4YWKA 1Q12A 4A3EG 1J5EL 3HOVG 4JOIC 1YHQA 4UP9A 4MZ9A 1S72A 4GOPA 1Y1WH 4JI2L 4QY7A 4JI8Q 2JEAI 4J15A 1YNXA 3GTJH 4JI0L 2OCEA 4TVAB 5C0XG 3G48A 5M3FH 4LUZA 2GVAA 1UWVA 1GVPA 3PIOA 4LFCL 2GVBA 4GNXB 1MJEA 1VQPA 3GTPH 1JJ2A 4NXML 4K0KQ 1L1OC 4WJ3M 4X62L 5IYDH 4JI7Q 3HFZB 1PH7A 1OXXK 2KCTA 2Y0SE 3A5ZB 3TREA 1EQRA 1V43A 1EQQA 4R4CA 1YVCA 2K5VA 1CKNA 4QGUA 3MXNB 3HOXG 1A8VA 2ZTCA 1OXTA 2K75A 3JAMc 4XTCS 4DR1L 1PA6A 1JMCA 3OTOL 5JEAG 1VQEA 4BXXG 2UUAL 1H95A 1JB7A 5ELOA 2I5HA 2DGYA 4EX5A 4DR7L 3PSIA 5C44H 4PG3A 1K0RA 4JI3Q 1BBWA 3KDFB 3AFQA 3UDIA 3CPWA 1K9MC 2HIVA 4UP8A 1PHJA 1XPUA 3A5UA 2D62A 2N78A 1L2FA 2BA0A 3K7UC 1UE6A 3KF8B 4YWLA 2ZTEA 4GS3A 3KLWA 1OXVA 1EOVA 4A3MH 3I4MH 3PUYA 4JV5Q 1O7IA 4LUOA 3K7AH 4LUVA 2AWOA 4O0AA 4GNXA 5C0XI 1ASZA 2Z6KA 4X64Q 2VZAA 4DUYL 4LF6L 1XNQQ 5HGQA 3HOYG 4LF9L 4Y7NH 5IYCG 4BBSG 4HIOA 4LFAQ 4JI4Q 2MO0A 5GADC 4FDBA 3PF5A 1JJGA 3CPFA 5GAGC 1PH4A 1U5KA 2KHJA 2CQOA 4YCWA 5IT9c 4IO9A 4DR2L 1KAWA 5M3MG 3I4NG 1M1KC 2K52A 1HNXL 5LMUL 3RZOH 4L5QA 3PO3H 2YU9H 2L15A 1YI2A 1MKHA 1QZGA 1J5EQ 3KDFA 3NENA 5C3EG 2HIXA 4DV3L 2R7FA 1D7QA 5LMNL 1EYGA 2UUBQ 1MJCA 2VUMH 4IOAA 5ELNA 1NTGA 1YHBA 2RF4A 5FJ8G 2ALYB 3I56A 3PUWA 1A0IA 3S14H 2WAQE 4JI1L 4R4IA 1I6HH 2R92H 2DUDA 4JC0A 4KLKA 3RR5A 1LTLA 1VQLA 4P75A 4AQYL 1P8LA 3HOVH 2V1CC 5AJ3Q 2Q2HA 2AKWB 4HJAA 4AYBE 3CCLA 1YITA 4LF4Q 3ER0A 1DGSA 3KF6B 4DAYB 1TWAH 5C4XH 1KC8C 3ULJA 1VQ8A 2OTLA 1VQGA 1VQMA 2VW9A 1E22A 3OTOQ 5EAYA 3PCOB 4HIKA 3GDEA 4GKKQ 4A76A 2UUAQ 2ZM6Q 1KQSA 4QL5A 3IRBA 1PYBA 4A3GG 4JCVE 4AIMA 3HKZE 1Q7YC 3GTOH 3E9HA 3J81j 1XTDA 2WAQG 4OWWB 1B70B 2NVYH 2IX1A 2R7ZH 3AYHB 4KHPQ 4R4OA 2UU9Q 3S24A 4DV6Q 3RZDH 3J7A5 1RL2A 1WOCA 4YCVA 3RLNA 3PUZA 2R7DA 5M5YH 4GKJQ 2RCNA 4APVA 3PO2G 4A75A 1SE8A 2EXDA 4BXXH 3I2ZA 4AYBG 1T9HA 3OW2A 4LF7L 1N34Q 4QJFA 4YWMA 4LWCA 1N33Q 1YJNA 2ES2A 2ASBA 4DKAC 4ALPA 1PH8A 2F4VL 1XMQQ 4A93H 3J81i 4X65Q 1HZ9A 1C0AA 2KHIA 1L0WA 4HJ5A 1HZAA 4O2DA 1WCMG 1SRUA 2IHFA 2A1AA 4P73A 1TWHH 2IT1A 3GO5A 4DV0L 1PV4A 3S1MH 5FLMG 4B3SQ 4OXPA 4OONA 4B3ML 1VQ5A 3OYYA 1K83H 3KF6A 3HKZG 1BKBA 1PH2A 1OTCA 3HOWH 4JG2A 4NB3A 4DR2Q 4DR6L 4YHHL 4HIMA 2PI2A 4LF5Q 3STBD 3HOYH 4A3BG 1LM0A 3KYHC 2Q2TA 1Y1VG 5IY0A 4R4TA 5LMUQ 2N49A 2F52A 1I94L 2MQHA 4A3JH 1QUQB 1VQ4A 3MEFA 5IYCH 4BY7G 1SR3A 4DAMA 2K5NA 1Q86C 1E3PA 3T1YL 2E2IH 5C0XJ 2LSSA 5LMNQ 3T1HQ 3AQQA 4DR3Q 3TS0A 2B63G 3TS2A 3TRZA 4DV1L 5M3MH 3I4NH 1VQHA 4IOCA 3CCVA 2JK8A 3FKIG 5IP9G 4A3IG 5IP7G 2JA9A 3PV0A 2YYZA 2QEXA 4A3LH 1WJJA 1X65A 3FP9A 5C3EH 4BBRH 4BY1G 4R1JA 3PUVA 4L5TA 3TQYA 4L5SA 2UXCQ 5JEAJ 3G6EA 5FJ8H 4DNIA 2VQEQ 4HJ7A 1W2BA 3U50C 1XMOQ 4DV4Q 1N8RC 4YY3L 5IYBH 2MNAA 3H3VH 2UUCQ 1S40A 1YIJA 2YV5A 4LFBL 2EQSA 1LYLA 4C2MH 3F2DA 4DV7Q 2HHHL 2JEBI 1HNWQ 1VQNA 4B3RQ 3EBEA 1E24A 1QUQA 1RIPA 3EIVA 3LGJA 2Y0SG 3UE1A 3HOZG 3M7NA 1SMXA 4KI0A 1MIUA 1K3RA 5E7NA 4RMFA 1EFWA 2NZOA 4IFDG 2MO1A 1X6OA 4JI5L 4IFDJ 3UDXA 1BBUA 1C7YA 4A3CG 2A19A 2JA6G 3CAMA 3HKSA 4B3TQ 4JI6L 1IBLQ 2VS1A 3S1NH 3RN2A 3GD7A 3L0OA 3M9BA 5IWAQ 4OO1G 2OTJA 3UDFA 1N32Q 3D31A 3S16H 3M4PA 3B6YA 1W3SA 2R93H 2YTYA 2IX0A 4A3GH 1GM5A 4IJLA 4GOPC 1VQCA 1GO3E 3STBC 1JE5A 4IPHA 2LXKA 2ZJQA 5FLXc 2UXBL 3WWVA 1PH6A 1YEZA 1GD7A 1HJPA 1OXSC 2JA8G 5LMNW 4OX9Q 1NY4A 3PUXA 4DV2L 4KHZA 3J81c 2AMCB 3PO2H 5GROA 2CWAA 2CKZB
chains in the Genus database with same CATH superfamily
1PDQA 3CQZB 1H9SB 4JPBW 1HUNA 4C1NK 2KCMA 1XNRL 1OXUA 4QUCA 1I4HA 5M3FG 4MTNA 1WCMH 4IJHA 3FHWA 4DR5L 3L2PA 3CXCA 1R9TH 1KLGD 4A3KG 1Z6HA 4IFDI 4A3EH 2IHEA 2XWJB 1I50H 1J6QA 1D1IA 4JI8L 2FHTA 1XX8A 2PNRC 5D3DA 3BVMA 3SGIA 5JVH3 4OO1I 3TEHB 4XDXA 1SNCA 4Y52H 2E2HH 3S1QB 1CI3M 2JYOA 1QB5D 4DR1Q 5M3MB 3NTKA 3I90A 1Y8PB 4JOIA 3J80E 2MJ8A 1XPRA 4GNXC 1D6EC 1GHJA 3E5SA 5C5LA 1ESFA 5CV5A 1HNZL 1LACA 2PO4A 3EN2A 1FNVA 1KNAA 1YJWA 4JBJA 4ME3A 4N8FA 2VNUD 1IZ6A 3I3CA 4LF6Q 4DUYQ 4DUZL 3GTQB 3KFUA 2JJQA 4K6LA 4LF9Q 1YHAA 3M3YB 5EKLA 1BNZA 3O13A 3M7GA 2CH4W 3K81C 2IPKD 5G3LD 1FVIA 2WB1E 1B9MA 1M4VA 4FVMA 4LW1A 2F0JA 4IFDH 2K7VA 1A62A 3Q0AA 5CGKA 2XGTA 4A3CH 4UPAA 4IUQA 4CJ2C 1SLJA 4J1MA 5BR8L 4OO1H 4BBSH 1R4QB 4X66L 4UDUC 2L0CA 4DV3Q 4MIUA 3FVQA 1PH3A 3SEBA 1GHKA 2LXJA 1TWGH 2NTSA 2CWPA 3J80c 4JI1Q 2Z4IA 2AUJD 4P2CB 4X6AH 1K73C 2ICIA 3BVZA 1WCMB 4IQZA 5AFWA 4EQ5A 4RG1A 1R9TB 1V1QA 4C3JH 1GUOA 1SYGA 1RODA 1IBKQ 5C4XG 4L8JA 1J8IA 1I50B 2F03A 4L5RC 1TT2A 2MP1A 2H5XA 1NMGA 4A3KH 2Q2UA 1A15A 2WP8J 3Q6SA 1KNEA 2E2HB 1BCPB 1WVLA 5NUCA 3R2TA 2YTVA 2EDGA 3Q24A 3AEVA 1QE6A 1I4XA 1YJ9A 3K5LA 1CA5A 2ZM6L 1NE3A 4A3IB 2F3IA 4C3IH 2L12A 4GLXA 4DK0A 4KKTA 2OQKA 1FNUA 1A2UA 1X56A 2F0LA 4HN7A 4CHTB 1GOZA 1PTOH 2ID0A 1PFSA 1AZQA 1VS0A 4FF2A 4FXDA 1VCIA 1I5FA 2XN9C 1JR0D 4IUTA 2AQ3B 1K28A 1Z9FA 3NQIA 1XMQL 3H3VC 1TY2A 1UUPA 3P75A 4U68A 3T13A 4HSPA 1EIFA 3M85A 3LWUA 5C6AA 3F1ZA 4TKOB 5K5PA 2C35B 4DK6C 1VQBA 1AE2A 4HJ9A 5IYDG 1SJED 2IX3A 2ZJPA 1I4RA 3G4SA 1VQOA 2PPBC 3H15A 2GN5A 3E0EA 2E75C 4BBSB 2B3GA 1CKMA 3J80L 4A3BH 2YTXA 4M1UB 5KYLA 1IBMQ 1HR0W 1PH9A 2HDLA 1PRTD 3ZJYC 4KN4C 3RLOA 1PFBA 1TWGB 2BE5D 4K0KL 1ILPA 2VQFQ 3KF8A 3I4OA 1VQFA 3Q23A 4P72A 1TU2B 3NBIA 4ZKBB 1LTRD 1CM9A 4N8X1 2PQEA 1STAA 4K5XA 5H1SE 2SNSA 4RFBA 3J7AF 1NR4A 1AH9A 3C3LA 5IGFA 3CCQA 4C3JB 5M3FB 4A3MG 1QVCA 4XQJA 3M4QA 3R3OA 5A2QL 1CSQA 4MTKA 1FL0A 4DU9A 1VQ7A 4DV4L 4UP7A 2NVQH 4WJ4A 2K5DA 1VDZA 4AH6A 4A3KB 1XWEA 4JI3L 2PQAA 5JJIA 3R2IA 1BUVT 4GLVB 3OMCA 4UY8C 1EWIA 3CC2A 2TSSA 2G9DA 2RQXA 4ID6A 4CDEC 4JYAQ 1CFMA 2B2VA 1VQKA 1X3EA 2QEJC 2UXBQ 3JAME 4I7AA 1S5DD 1BCPC 5ELBA 3SHLA 3X3MA 3S1RH 1HA5A 1NMFA 4DK1A 1EY8A 2MFIA 1QNKA 3NTIA 2TMPA 1WTVA 2X6GA 5KIXA 1PTOB 3HP3A 2XWBB 2NVTH 4ZKCB 1SBBB 5JPNC 5ELFA 1O7ZA 1TWCH 4R8NA 3NBHA 2WIIB 3BJUA 3HOVG 5LL6S 1STNA 4QY7A 3NQTA 2OCEA 2NB0A 4X3KA 1UWVA 3IL8A 4DNRB 5IT9E 1MJEA 1VQPA 5IYDH 2XNAC 1PH7A 1OXXK 2Y0SE 3RZOB 3A5ZB 2E2DC 2PZUA 3HRZC 4R4CA 2K5VA 1CKNA 4QGUA 2ZT9C 1LT6D 4DR1L 3JAMc 2KECA 2B2WA 2CHBD 5C3WA 4XT3B 1VQEA 4BXXG 2J0TD 2UUAL 1RTOA 4HCEA 4K2KA 3D4RA 1EEFD 3AFQA 2HIVA 2A74C 3EROA 2N78A 1L2FA 1BDOA 2D2CC 2ZTEA 2F0NA 2NVQB 5C4XB 3KLWA 1OXVA 4TSSA 1GXDC 4A3MH 1AFPA 4JV5Q 1O7IA 5EKIA 4LF6L 3HOYG 4DUYL 4LF9L 4C56C 4HIOA 2MO0A 5GADC 1WD1A 3PF5A 2DJGC 5GAGC 4KJNA 2XRQD 1ZKOA 3DEOA 4HMJA 3MXNA 5IT9c 1BOSA 5DM73 1M1KC 1EY0A 2K52A 3LX0A 3SR1A 4L5QA 4H7BA 5C3EG 3FDTA 2HIXA 3A55A 4DV3L 2NVTB 1EYGA 2UUBQ 4IOAA 3VA7A 1NTGA 2ZXRA 1K83B 1PTOC 4JI1L 4R4IA 1I6HH 2K01A 3RR5A 2MUYA 1LTSD 4C3HG 3HOVH 2Q2HA 1YITA 3VR3A 3ER0A 4LF4Q 1STYA 4K2LA 4DAYB 1CT1D 1TWAH 1SNPA 3ULJA 3JAML 2VW9A 3OTOQ 1VF5C 4HIKA 3QJYA 1DM0B 3T56B 3IRBA 5FO8B 4LK1C 4A3GG 5IGBA 1EY9A 2DY7A 1Y69U 3A7LA 1VMCA 1NR2A 3BDOA 2UU9Q 4DV6Q 3RZDH 4IUUA 3J7A5 1WTQA 4YCVA 1OO9B 2VB3X 2R7DA 3RLNA 5LL6X 5M5YH 5L37A 2RCNA 3NWTA 3PO2G 4BXXH 1F9SA 3KBXA 2K04A 3BVGA 2XSCA 1N33Q 1YJNA 2PYKA 3QWNA 4OIJA 3OIPA 1PH8A 3KLSA 3J81i 1C0AA 1E2VA 4A3MB 1V1PB 2IHFA 1K8OA 1F9RA 1IYVA 3HKZG 5IT9L 1VF7A 4DR2Q 4DR6L 3S1NB 2PI2A 1NSNS 3HOYH 1LM0A 1LV9A 4F87A 2MQHA 3GP7A 1MI2A 4A3JH 1FD7D 4BY7G 1IYUA 2JXMB 2E2IH 1TQOA 2LSSA 5CYUA 5LMNQ 2Z6BA 1G2TA 2B63G 4DR3Q 1WD0A 1S5CD 3DEPA 2SNMA 1GUWA 4DXGA 1VQHA 2ZXOA 2JK8A 5IP9G 5IP7G 2JA9A 3PV0A 2K6AA 4O1NA 4DN4M 2YYZA 2QEXA 1X65A 3FP9A 5C3EH 2G9HD 3L3OC 4RH6A 4BY1G 5EPJA 3TQYA 2PW5A 4L5SA 1I6HB 1IHZA 3PIO3 4HJ7A 1W2BA 1XMOQ 1SJHD 3HOVB 2UUCQ 1YIJA 1LYLA 2EJGC 1SE4A 1VQNA 4KY6A 3EBEA 5FK9C 3HOZG 2Y0SG 2WACA 1TWAB 1K3RA 2A69D 4OHJA 4RMFA 5E7NA 3CU7A 1KDAA 5JAVA 4WFN3 4H13C 4IFDJ 2A19A 4B3TQ 4BWGB 3RN2A 5IWAQ 4CDFC 3S16H 3M4PA 3B6YA 1CA6A 5CBEE 2NZ1D 2RCFA 2RSNA 2YTYA 5C4HA 4A3GH 5JVG3 4GOPC 1VQCA 1CZWA 1GO3E 1JE5A 2LXKA 5M5YB 2UXBL 3WWVA 1YEZA 3V05A 1HJPA 4J8QA 3PUXA 5ISRA 2AMCB 3PO2H 2AQ1B 3CD6A 3EA6A 4ABNA 2K5HA 1Y1WG 3T51B 1IW7D 4JI2Q 2QDBA 2HD3A 1ML0D 2A5HA 1FNWA 5T1GA 1Q81C 3AMUA 1LTAD 1V1OA 2K50A 3GV6A 3K5OA 4JBWA 2X6LA 3MWYW 1I6VC 3QR8A 4LFCQ 3VR4A 1SMYC 5D65A 3HOYB 1N9WA 1QVFA 3NUCA 2K14A 4P74A 3HS0C 1LO5D 2RHSB 2E2IB 2F0GA 3KK7A 5E1FA 1KD1C 5C0XH 1X3FA 2EYOA 1KAAA 2PCFB 1DYQA 3QO2A 2B63H 2D9UA 1KTKA 3ULLA 1WTXA 2Z6KC 1E0BA 2OXPA 1SNMA 3CCSA 5JPMC 5C3EB 4YIJA 2B2YA 1SYEA 3VR5A 2B2TA 1R4PB 3CCJA 3KJPA 3HOXH 3K8AA 2L4NA 5JEAH 1TWFH 3CCMA 3L7ZC 4C3HB 2JE6I 1Z7TA 2WFWA 3CQZH 5BN3A 4KV6A 2XVSA 2ZTDA 1L0YB 1YNNC 3HOZH 1FJGL 1K8AC 1IYJB 3PF4A 3F2BA 3VR6A 2OWOA 1EEID 3W1BA 5C4JH 2NN6G 2AHOB 3CCEA 2EE1A 2OF1A 3KLRA 5M5XB 3GTMH 1HTPA 2OEOA 3W1GA 4DV2Q 1HNXQ 3PO3G 3M4YA 4A3GB 3RNUA 3DXJC 1JORA 1STHA 4EQNA 1EIHA 4PZ8A 4B9WA 2O4XA 3S1QH 4E6IA 3GTGH 3PO2B 4OEMB 4AQYQ 1TR5A 3GTLH 1BO0A 4KTAA 2UUBL 2JQOA 4FO2A 1U0LA 1S5ED 3JC66 3H94A 3SXHA 3DWAA 4RCNA 1B7YB 1AW7A 3HKZB 2FXQA 4A3FG 4U673 1YNJD 2HCCA 2XIWA 2H4OA 3G71A 1HHVA 2KJXA 1HR0Q 2NN6I 5CV6A 5EPLA 3GTQH 1X32A 4BY7B 2IWHA 2R7ZG 3M3YH 1HZBA 3DLLA 4LF4L 1W6KA 4KD4A 4DF7A 5CORA 1EY4A 1T5XD 1F2MA 2F0QA 4IPCA 2B63B 3U4VA 3HOUG 3LNNA 1UE5A 4DR4L 3E0JA 1G2SA 2VXWA 4H02A 4A93G 2F0KA 3A8IE 4LF8Q 2F4VQ 2UU9L 1CSPA 3D6CA 5CV4A 4DV6L 1PZJD 4BY1B 4FXGC 2BDOA 2HQLA 3VDYA 3S15H 5F2DA 1N33L 2F0FA 3CHBD 2FJ2A 4OL7A 4XYQA 4ME5A 3HOZB 3K6OA 3OHXC 1PVOA 2Y0SB 3ITPA 1L1OB 1WFQA 1XPUA 5C4JB 5FLMH 1UE1A 2CW0C 3K5MA 5CR3A 3GTMB 1KABA 2PQAB 2SOBA 1SNDA 1VQDA 2B2UC 1VQAA 5J39A 4KY5A 3TP8A 4K5WA 1JWMD 2WV6D 3F8TA 4HJ8A 4NXNQ 4BBRG 3GTGB 1KRSA 1G91A 4DR3L 4EGVA 1BVSA 2ATWA 3D4WA 1X55A 4GZYC 3CMEA 5IYBG 2QW7A 4HAEA 2RDHA 3K59A 3P1HA 3GTLB 1VQ9A 4A3IH 1Y1WB 5HY6A 1ZYRC 4LFBQ 2KEDA 5ELCA 1BR9A 4DK3C 1JJCB 2N8NA 4KY7A 1O78A 1Q1EA 3KJOA 4QQBX 1C9OA 2E8GA 1Y14B 3NBHB 4OWXB 3TZUA 1XMOL 2HT1A 3CKIB 4A3FH 4HR7B 2UUCL 4JI6Q 3D0FA 2XRSD 3BDCA 2R93G 5EBDA 2KHSA 2EJFC 1FGUA 2AWNA 4JBKA 4POFA 1XNQL 4X64L 4OWTB 4B3TL 3UE0A 2E2JH 2F1MA 3HOUH 5IWAL 4LFAL 5JJLA 1IL2A 2EY1A 1DOLA 5JJKA 2UXDQ 1PYSB 4RGMA 4XXEA 1CKNB 1G291 4FYDA 1DOKA 2E5LQ 3S15B 3SK8A 3CC7A 3K7AB 2R92G 2Z1CA 4NKLA 2A6HD 4DV5Q 2JN4A 1MD2D 4ZUJA 4Y7NB 4ZCKA 4H44C 3X3NA 4JI2L 2JEAI 3GQBA 5DEHA 2N88A 4TVAB 3G48A 5M3FH 1GVPA 4LFCL 4PMCA 1L1OC 5EGTA 4JI7Q 4H0LC 1ILQA 2KCTA 3PO3B 2YU9B 3TREA 1M8AA 2OT2A 3NK9A 4CJ0B 1O7LA 4DA2A 4V190 4CDDC 3MXNB 1PA6A 1ET9A 1W6JA 1DJRD 2SDFA 3P20A 4B08A 5IGCA 4K5VA 1PLFA 1BBWA 1EL0A 3CPWA 3UDIA 4NMZA 1PRTB 2MGSA 3A5UA 1UE6A 4GS3A 3J7YW 1Y8NB 4A3FB 3D4DA 1F2LA 2D5DA 1QILA 3BDLA 1D2BA 4GNXA 1WTHA 4LUVA 2J7ZA 2PZWA 1KDBA 1SYCA 1T5EA 3H6MA 5HGQA 2F0IA 5ELDA 4PMBA 4JI4Q 2R7ZB 2WKDA 5EKKA 1U5KA 2KHJA 2CQOA 4YCWA 2E2JB 2FFKB 4RGOS 3HOUB 3RUZA 1STBA 3I4NG 3QOJA 1HNXL 5LMUL 1V8QA 3RZOH 4A93B 2C9OA 4KD3A 1J5EQ 3KDFA 3NENA 2R7FA 1MJCA 3OWEB 1VMPA 1YHBA 2Q8RE 3K0YA 2R92H 4HSVA 1B3AA 1LTLA 1VQLA 4AQYL 2WINB 2V1CC 3NTHA 2EYFA 2F3WA 1EYAA 3CCLA 3GV3A 1DGSA 5C4XH 2OTLA 1K0SA 1JICA 5EAYA 2NWGA 3PCOB 4KJOA 4JCVE 4AIMA 3HKZE 3J81j 1B70B 2NVYH 3Q22A 4BBRB 1B3QA 3NWSA 4R4OA 3S24A 4KHPQ 4L6TB 1PXUA 5BN5A 2X69A 4GKJQ 2MHVA 4APVA 4A75A 3I2ZA 4AYBG 1T9HA 3OW2A 1N34Q 3DUZA 1I4QA 2Z9HA 4LWCA 2EYPA 3TBIB 3VYTA 4F88A 3K57A 2F4VL 4X65Q 1L0WA 2K1BA 2MPMA 1F2YA 2A1AA 1TWHH 2IT1A 1PV4A 3S1MH 1PRTC 4OXPA 4OONA 2R61A 1VQ5A 1K83H 3KF6A 3HEJA 5IGDA 1PH2A 4QCLA 2BE5C 4HIMA 1FR3A 1EU4A 2Q2TA 1Y1VG 5IY0A 4R4TA 2N49A 5KRUA 3MEFA 3MC0B 5J1ZA 2F0MA 4DAMA 2K5NA 1E3PA 3N52A 5C0XJ 2KCNA 5FLXE 4FXKC 1RCVD 1EZ8A 3KBGA 1UEAB 2HUGA 3AQQA 2KA7A 1G6ZA 1LABA 1PZID 3J81E 2A68D 3I4NH 4TRDA 3FKIG 3WOEA 1BQQT 1PMRA 3PUVA 2CQAA 3TDQA 2UXCQ 5JEAJ 2R92B 1AEXA 2VQEQ 4DNIA 2NVXB 1O7YA 1X3PA 2L55A 4LFBL 2YV5A 4C2MH 3F2DA 2K28A 4B3RQ 1E24A 1RIPA 3TP7A 3U9SA 1SMXA 1QWYA 4UHVA 3C46A 1EFWA 1SYBA 2NZOA 2MO1A 3LWEA 3UDXA 4DAPA 1RKNA 2JA6G 4JI6L 2VS1A 3S1NH 3A7AB 2B8GA 3UDFA 4QB4A 1I4GA 2NVYB 1W3SA 5FO7B 2IX0A 1BBXC 2ZJQA 5FLXc 1IL8A 2F0HA 2QILA 2JA8G 3J81c 2D0PA 2JA5G 4UAIA 2UXDL 1QG7A 5JJZA 4N9TA 1D5XC 1YBYA 1K8MA 4G7ZC 1TKWB 1TWHB 1S3OA 2F0WA 3S1MB 2E5LL 2EY5A 1SNOA 2QGQA 4C1NI 1LTTD 1B8AA 4ILWA 4DV5L 3S2DB 4NXMQ 3NEMA 4X62Q 3K5NA 4RHRA 1AZPA 4ZRZA 1EOTA 4PMWA 1II3A 1Q3LA 1IBKL 4HIDA 5FOBB 1Q90A 2DY8A 3D8GA 3I4NB 1QJOA 1ZEQX 4DAVA 1JT8A 2F3VA 2OQ0A 4YY3Q 1B4OA 1KL9A 3FMCA 5D14A 3BZDB 3CRLC 2RVLA 5COYA 2ZJRA 1KIXA 2KOLA 3U58A 1QVGA 3BG3A 2R3ZA 3PIPA 3I4MG 4DNTB 2QF7A 2JP1A 3VA5A 2L9HA 4GN4B 3TN2A 3V2TA 2DNEA 1PZKD 4MN3A 1F2ZA 3W3AA 4C2MB 3OOCA 4F8MA 4XYOA 1XTCD 1SAPA 1EWCA 1Y8OB 4Q0FA 5I9PA 5FLXL 2I5MX 4KKUA 4IURA 3EQLC 2BOSA 2NUCA 2JA6H 3J81L 2DNCA 5GAHC 4JI4L 3HGBA 4PZ6A 5CV9A 3H09A 1AP0A 5HURA 4M8AA 2EPBA 2VUMG 4NPSA 3ERSX 1XXGA 5IGEA 3M4OH 3NXWA 1QZHA 2JA8H 2N3SA 4AYBB 4IUPA 3I55A 2VB2X 1LUZA 1IBML 4TQUS 1HZCA 3J7AV 2M2LA 2JA5H 1KXLA 4NP5A 2VQFL 2F0PA 2E74C 4IUNA 4HEDA 3OPOA 1STEA 4XQQA 2IY5B 1Y1VB 1Q8IA 4C3HH 1KHIA 3S17B 1EUJA 1U9RA 2XTIA 2B8FA 1Z47A 4JK1C 1MBYA 2Q2IA 1HNZQ 1TXYA 3CMAA 3C1EA 2KBNA 2M00A 4K8JA 5J3BA 2A8VA 1HUMA 3VR2A 5M5XH 4IPDA 4LF7Q 4GLAC 1CTMA 4MNOA 4DUZQ 4JYAL 4FF1A 1CQFA 1C48A 2PI2E 4KHPL 2K03A 2NBFA 1D8LA 2NZHA 5IOCA 2VY3A 4GKJL 1EY5A 2CCZA 4B3MQ 3HOWG 1LT4D 5E4WC 1X3GA 1N34L 2BDNA 3SK5A 4EQPA 4YHHQ 1EFID 1VQIA 1SFOH 2DJFC 1LT5D 1VQ6A 4LNQA 5DLQE 4X65L 5BR8Q 2I0QA 3CCVA 2BA1A 4X66Q 4IPGA 3T1YQ 2V4DA 3BZCA 2JA6B 1EQVA 2A6ED 3AFPA 4CGYB 2K5QA 3ULPA 5IODA 2QDLA 3ND9A 1G51A 2K4KA 2O5JC 3H91A 4NW2A 2RKSA 4XIGS 4A3LG 3TP6A 4BY7H 1RF2D 4K14A 4R4QA 2ZXPA 3M4OB 4RKBA 4DPGA 2JA8B 4A4IA 4YCUA 1A3TA 2A69C 2JA5B 3IFDA 5IP9H 5IP7H 4NDXA 3GTJB 5G3LF 1XPOA 3ND8A 1V9PA 4BY1H 2UXCL 2VQEL 3K0XA 4JI5Q 4PNYA 3NPPA 1YZ6A 5GAEC 1HTLD 2KENA 1ICWA 2Z0SA 1CK1A 2CFMA 3U4ZA 3CF5A 3MEHA 4B3RL 1CZGA 1ET6A 4DFAA 4KN7C 1LTBD 2L5TA 3MXPA 4JV5L 1IW7C 2QCPX 2F4IA 5KNBA 1B1ZA 3A0JA 1SEBD 1SYDA 3BU2A 3I7FA 1J9OA 3EJIA 1AE3A 2EY6A 4N9PA 1KRTA 3G7LA 3F2CA 3DMUA 1N36Q 3H3VI 3K58A 3I4MB 5I4DA 1S4ZA 1EIGA 3S2HH 5DAUA 1ASYA 2I5LX 4LMQD 1SFOB 1LTID 1Q46A 2F0TA 4RGNA 3QB3A 4A3EG 3FPPA 4JOIC 4MZ9A 4GOPA 1Y1WH 1DCZA 2J4XA 4J15A 4QIWB 1EYCA 5M9OA 2RDGA 1H9RA 2GVBA 4GNXB 2EY2A 4K0KQ 2FMMA 4CKCA 1JJ2A 4NXML 4X62L 4HMIA 3HFZB 4XQNA 1L0XB 1EQRA 1EQQA 1E2ZA 2VUMB 1YVCA 2LY7A 1NUCA 1MGSA 2K75A 1JMCA 3OTOL 2Q8IB 3VYRA 3S14B 1H95A 3OW7A 2I5HA 1RDPD 2AQ2B 1U4PA 4EX5A 4PG3A 1K0RA 4JI3Q 3KDFB 3IKJA 1K9MC 1BCPF 4HTHA 2LFNA 3URYA 3K7UC 3KF8B 4YWLA 1CHQD 1ASZA 4LUOA 3K7AH 2F0EA 2SEBD 2Z6KA 1SYFA 2VZAA 1K3BC 1TS5A 4Y7NH 5IYCG 4BBSG 1PRTF 4FDBA 4I7ZC 2ENBA 4FNFA 3AU7A 3OMGA 4DR2L 1KAWA 1UNSA 4HCSA 2NN6H 2K5WA 4WRDA 3TSSA 1HRJA 3PO3H 2YU9H 3SK6A 2L15A 3F2UA 1YI2A 1YNJC 1MKHA 1O80A 2HCIA 5LMNL 3S2HB 2RF4A 2PMZB 4C3JG 3I56A 3PUWA 4OIKA 1A0IA 3HOWB 4PV1C 1G8ZD 2EOTA 2DUDA 4P75A 1B9NA 1P8LA 2PZTA 1HA6A 4R9WA 5AJ3Q 1SXTA 4HJAA 2AKWB 4AYBE 3E6ZX 3KF6B 1X3QA 1VQMA 3I4LA 4FP5D 1E22A 1KDCA 2KVMA 3GDEA 4C3IG 4GKKQ 4A76A 2UUAQ 1KQSA 1PYBA 3GTOH 3E9HA 2WAQG 1A3UA 2R7ZH 1MHWC 3AYHB 1DOMA 3I91A 1RD9D 1GUSA 5FO9B 1RHPA 3TMEA 2F0SA 4LF7L 4RGTA 4QJFA 4RKLA 5EPKA 4YWMA 2ASBA 2ES2A 1GUNA 4DKAC 4A93H 3OSOA 1HZ9A 2KHIA 4HJ5A 1H9MA 1RTNA 5A2QE 4B3SQ 2K32A 4B3ML 1H9JA 1OTCA 1DONA 1BKBA 4ULLA 4YHHL 4LF5Q 4IUVA 2H1EA 4A3BG 3S9WA 4I65A 1PTOF 2F52A 1HXYD 5IYCH 1HFGA 2BCOA 1SR3A 1Q86C 3E3XA 3T1YL 4OELB 5D3IB 3I8ZA 3T1HQ 3TS0A 1B50A 1JWSD 4DXFA 5EJWA 3SK4A 1WJJA 1BXTA 5J22A 4BBRH 1ESRA 1LTGD 5CBAE 3QOLA 4L5TA 2B2VC 2NYZD 1S5BD 3G6EA 5CV8A 2B2UA 1N8RC 5IYBH 4A3EB 2WKCA 1JOQA 1I4PA 1XYIA 1ZXTA 1JWUD 2EQSA 4DV7Q 1HNWQ 1QUQA 3UE1A 3M7NA 4KI0A 4JI5L 1BBUA 1TY0A 3FPUB 5DM63 1QNUA 3HKSA 2P5ZX 1IBLQ 5C3XA 1WTWA 2F0DA 3GD7A 3A54A 1NAPA 3A8KE 3GTOB 1N32Q 3D31A 4K8IA 1TS4A 2A6HC 2R93H 5IIFA 1GM5A 4IJLA 3IFTA 5I2XA 1EY6A 4LJZC 2K33A 1PH6A 1OXSC 5BN4A 2L11A 4OX9Q 1NY4A 4IZ8A 4DV2L 4KHZA 3RMHA 2CWAA 2CKZB 4DR6Q 3J7ZC 3VYSA 2O2LD 1SE3A 5I6WA 1HFNA 1N36L 3J80i 3UI2A 1HQMC 1BCPD 4CKBA 4JI0Q 2FMCA 3MVVA 1IKLA 3ONAB 4PQXA 4K6DA 3BZKA 2B2WC 4FF4A 2NVXH 2Z4HA 1CKOA 1TIID 3CP0A 4ZYSA 4J6HA 3NE5B 1JQYD 1P16A 2B39A 3MFYA 1EYDA 4GN3B 4QIWE 3NELA 4V0BA 3RLFA 1HR0L 1Q1BA 4CKEA 4DR7Q 1C4QA 1UE7A 1H9SA 1WYDA 1HQRD 3UDGA 3IAYA 2EYMA 3GTKH 2QA4A 3NP8A 3H0GG 1L1OA 1G6PA 4X3TA 1U4LA 1EIYB 2FINB 4EVOA 4LF8L 4JBMA 2JSOA 3Q8DA 1IXRA 2RHQB 3A56A 3CCUA 2BH2A 2HDMA 4G4KA 1VQJA 4GN5A 4A3DG 3C1FA 1STGA 4CDCC 1GUGA 3PGZA 3S2DH 4C3IB 2BH8A 4PZ7A 2R93B 3BYYB 4R8IA 4OGQC 2JA7G 3VYUA 2WAQB 4B9XA 1AN8A 4POGA 1SROA 1NNXA 3ERQA 3OWFA 2AUKA 3CCRA 1NJIC 1EWHA 4ZAIA 2WB1G 2EYHA 5KNDA 3AB9A 3I70A 4NXNL 3K80C 3CW2C 1K8GA 3QIAA 5GQOA 4LAAA 3DM1A 3EFXD 3D6WA 3I73A 3L9AX 2A73B 3MZ5A 3PMFA 4A3BB 4CJ1B 1UEBA 2PMZE 5AJ3L 2IL8A 4WJWA 5EQ0A 3T53B 1PTOD 4S3SA 1SDFA 2VL6A 2IW3A 1ICFB 1NBWA 2F0VA 3T4AC 1DXMA 2RA4A 4GKKL 1F9QA 2DN8A 5IE8A 3RN5A 3GTKB 1LT3D 1E1OA 1PH5A 1SN8A 4BA2I 3E9IA 5EBCA 2RDFA 4DV0Q 5IGGA 3H0GH 1FJGQ 1SE2A 3KOJA 3NSWA 3DWPA 4RA8A 2HQEA 4WORA 1BF4A 1EY7A 4A3JG 4BA1I 1WTPA 1A63A 2A68C 1I94Q 2D0OA 2B29A 1Q8KA 4B3SL 4KK7A 4A3DH 1PYWD 3S1RB 1WI5A 4LF5L 5KNCA 4DV1Q 1WTOA 3FEWX 1D5ZC 2KCCA 1Y1VH 4KKSA 2PNHA 4JW0A 5LHY1 1CHPD 3KLSX 4O42A 3S17H 2JA7H 1X54A 3PQIA 3ICEA 4CBVA 3T1HL 1HCZA 4JI7L 1TWCB 1A6XA 3MFGA 5C44G 5K36G 1JOKA 3JAMi 1GJXA 3FKIH 2CVRA 1B53A 3MXUA 1D1KA 1EZ6A 2HHHQ 4MHEA 1I3QH 1HH2P 2GA4B 2I46A 5A35A 2E76C 5KEEA 1JC7A 4G57A 1FGBD 1B2TA 5M5WH 4RAUC 1WTRA 1Q82C 4DV7L 2EYLA 4GOPB 4DR4Q 1CUKA 1HNWL 1S5FD 5E4XA 2EIFA 1M90C 3T16A 3CC4A 3N6RA 1E1TA 2N55A 3PIP3 2QKIC 3G6JB 1A2TA 2R6GA 3C2PA 3A74A 1PH1A 5FKAC 1IBLL 1ENAA 3WOFA 3TP5A 1F77A 4RHSA 1N32L 4P71A 1HPCA 3U9OA 3DM3A 1E7ZA 4QMGA 1XNRQ 1X9NA 3H0GB 4JVZA 1XJVA 3W5OA 5I2YA 4DR5Q 4OX9L 2M9VA 2RSOA 3NHHA 2ICEC 1A3VA 4YWKA 1QOHA 1MSGA 1Q12A 1J5EL 1YHQA 4UP9A 1S72A 5C4ZA 4JI8Q 1YNXA 3GTJH 4A3DB 4JI0L 2B2YC 5C0XG 4LUZA 2I07B 2B2TC 2GVAA 2LKVA 3PIOA 3GTPH 4WJ3M 2F0UA 4G7OC 2IJ0A 1V43A 2JA7B 4ODGA 3CRKC 1UAPA 3MA2B 1SMYD 3HOXG 4FF3A 1A8VA 2G5DA 2ZTCA 1OXTA 4XTCS 2EYJA 5JEAG 3P7JA 1JB7A 5ELEA 3FKIB 5ELOA 2DGYA 2WB1B 1C8CA 3R93A 4DR7L 3PSIA 5C44H 5K36H 1I3QB 3WDNA 4UP8A 1RJTA 1PHJA 2D62A 2BA0A 1MSHA 3I4MH 1EOVA 2L1BA 3PUYA 5M5WB 4O0AA 2AWOA 1XNQQ 5C0XI 4X64Q 4DGZA 4L63B 3BYTB 4LFAQ 5CV7A 1JJGA 3CPFA 3RZDB 1NCVA 1PH4A 4IN3A 4IO9A 1ENCA 1U4MA 5M3MG 1JCKB 3EVQA 4IALA 4BS9A 1YNND 3SDZA 2KEEA 1QZGA 2LS01 1D7QA 2VUMH 3MXGA 5ELNA 5FJ8G 2ALYB 3S14H 2RBMA 2WAQE 3I72A 4JC0A 4KLKA 2EXZA 3TZDA 4A3JB 1EQTA 1QCBD 4X3UA 2KUMA 4EQOA 3GTPB 5KGUA 1VQ8A 2C5CA 1KC8C 1VQGA 5CMDA 1TS3A 1SNQA 2PW7A 4F7XA 4ZLTF 3FRPB 2ZM6Q 4QL5A 1EU3A 1B44D 4KHVA 5I6YA 1Q7YC 2EVBA 1XTDA 4OWWB 1JOOA 1F9PA 2IX1A 3OIQA 1JB3A 3RD4A 2CH4A 3D3RA 4G7HC 1RL2A 1WOCA 4KMUC 3PUZA 3QG1A 5C44B 1SE8A 2EXDA 2Z8LA 2EJMA 5E3FA 1PFNA 2A6EC 5KYIA 4ALPA 3DHQA 1XMQQ 4RWSC 1E2WA 4ZQ3A 1HZAA 4O2DA 1WCMG 1SRUA 4P73A 3GO5A 4DV0L 5FLMG 3HG9A 3OYYA 4DAYA 3HOWH 2F0OA 4JG2A 4NB3A 5C5MA 3STBD 3S16B 3KYHC 2O5IC 4RCOA 4ZUIA 3HZXA 5T1IA 5LMUQ 1I94L 3V96A 1QUQB 3SVMA 1VQ4A 3A8JE 3BS1A 1IKMA 1KLUD 3TS2A 3TRZA 2KQ3A 4DV1L 5M3MH 4IOCA 1DZ1A 2EZVA 4A3IG 2Q8TA 1D5MC 3ZYYX 1SSOA 1U4RA 4A3LH 2LMCB 5TSSA 2CW0D 1H9KA 1V1PA 4R1JA 4XT1B 5FJ8H 1GUTA 5HGTA 3U50C 4Q5VA 4DV4Q 1PFMA 4YY3L 2MNAA 4QF4A 3H3VH 2K05A 1FYCA 1S40A 1TVXA 5I9OA 1JE4A 1ENFA 4Z9CB 5CC4A 2HHHL 1DD2A 2JEBI 3EIVA 3LGJA 3W2DA 5JOBA 3MAQA 1MIUA 4IFDG 1X6OA 3MTSA 3KUPA 2NTTA 1C7YA 4A3CG 1ZYRD 3CAMA 3DWQA 4QUFA 3L0OA 3M9BA 1TS2A 4OO1G 2OTJA 1LLRD 4X3SA 3STBC 4IPHA 3HOXB 1GD7A 1CQVA 3SE0A 4ZK9B 3MHBA 5LMNW 1TWFB 1ONLA 5DNFA 3R8BA 5GROA 1GKHA
chains in the Genus database with same CATH topology
3CD6A 2D0PA 3J7ZC 2JA5G 4DR6Q 2K5HA 2UXDL 1Y1WG 1N36L 3J80i 1YBYA 4JI2Q 2KCMA 1S3OA 1XNRL 1OXUA 1Q81C 2E5LL 2K50A 5M3FG 4JI0Q 2QGQA 4MTNA 1WCMH 4IJHA 3FHWA 4DR5L 4JBWA 3L2PA 1B8AA 3CXCA 1R9TH 4DV5L 4LFCQ 3BZKA 4NXMQ 4A3KG 3NEMA 1N9WA 4X62Q 2NVXH 1QVFA 4IFDI 4A3EH 2IHEA 2K14A 4P74A 1I50H 1J6QA 4JI8L 1CKOA 2RHSB 4PMWA 3CP0A 3SGIA 4OO1I 3TEHB 1IBKL 4HIDA 4Y52H 1KD1C 2E2HH 1P16A 1X3FA 4DR1Q 4GN3B 2B63H 4JOIA 4QIWE 3NELA 3RLFA 1XPRA 4GNXC 1Q1BA 3ULLA 1HR0L 2Z6KC 4DR7Q 2OQ0A 4YY3Q 1JT8A 1UE7A 3CCSA 1KL9A 1WYDA 3UDGA 2ZJRA 1KIXA 1HNZL 3U58A 3CCJA 3EN2A 2QA4A 1QVGA 3GTKH 3KJPA 3HOXH 3H0GG 3PIPA 3K8AA 3I4MG 1L1OA 1G6PA 1YJWA 4JBJA 4GN4B 4ME3A 2VNUD 1EIYB 1TWFH 3CCMA 1IZ6A 1GKHA 3L7ZC 4LF6Q 4DUYQ 4LF8L 4DUZL 4JBMA 3KFUA 2JE6I 2JJQA 3Q8DA 4LF9Q 1IXRA 1YHAA 2WFWA 3CQZH 2RHQB 3K81C 3CCUA 2BH2A 2ZTDA 1FVIA 1VQJA 4GN5A 2WB1E 1FJGL 3HOZH 1K8AC 4A3DG 1IYJB 3PF4A 3F2BA 4LW1A 2OWOA 2I5MX 3W1BA 5C4JH 1A62A 2AHOB 2NN6G 3PGZA 3CCEA 3S2DH 4A3CH 2XGTA 2JA6H 3GTMH 4UPAA 2BH8A 3W1GA 4PZ7A 4DV2Q 1HNXQ 3PO3G 5GAHC 1SLJA 5BR8L 4JI4L 4PZ6A 3RNUA 4BBSH 2JA7G 4X66L 4DV3Q 2VUMG 4POGA 4NPSA 3ERSX 1SROA 4PZ8A 1PH3A 3S1QH 2LXJA 1TWGH 3M4OH 3GTGH 1QZHA 2JA8H 2N3SA 3CCRA 2CWPA 3J80c 4JI1Q 1NJIC 3I55A 1LUZA 1IBML 2WB1G 4TQUS 1HZCA 4X6AH 4AQYQ 2JA5H 1K73C 3GTLH 4NXNL 3K80C 1KXLA 3CW2C 1K8GA 2JQOA 2UUBL 2VQFL 1U0LA 4EQ5A 4RG1A 5GQOA 3JC66 1V1QA 4C3JH 1B7YB 1IBKQ 5C4XG 2FXQA 4A3FG 4L5RC 2IY5B 2H5XA 1NMGA 3G71A 4A3KH 2Q2UA 1UEBA 2PMZE 2NN6I 4C3HH 1KHIA 5AJ3L 1HR0Q 2WP8J 3GTQH 1EUJA 2R7ZG 3M3YH 1HZBA 3DLLA 2XTIA 4LF4L 1Z47A 2VL6A 2YTVA 3AEVA 2Q2IA 4IPCA 1HNZQ 1NBWA 3U4VA 1TXYA 3CMAA 1YJ9A 3HOUG 2KBNA 1UE5A 5J3BA 4GKKL 2A8VA 4DR4L 2ZM6L 1NE3A 5M5XH 2F3IA 4IPDA 4C3IH 4H02A 4GLXA 4GLAC 4LF7Q 4A93G 5IE8A 2OQKA 3RN5A 4LF8Q 4MNOA 4DUZQ 4JYAL 2F4VQ 1X56A 1E1OA 2PI2E 4KHPL 2UU9L 1PH5A 1CSPA 4DV6L 1SN8A 4BA2I 1D8LA 3E9IA 2ID0A 2NZHA 1PFSA 2VY3A 4DV0Q 1FJGQ 3H0GH 1VS0A 4GKJL 2CCZA 2HQLA 3VDYA 4B3MQ 3HOWG 3S15H 1VCIA 1I5FA 3KOJA 1X3GA 1N34L 1N33L 4YHHQ 1Z9FA 1VQIA 1SFOH 1XMQL 1VQ6A 4LNQA 5DLQE 4X65L 4A3JG 4BA1I 1A63A 1PVOA 1I94Q 5BR8Q 2I0QA 1L1OB 1EIFA 1WFQA 2B29A 2BA1A 2D0OA 4X66Q 1Q8KA 4IPGA 3F1ZA 3M85A 3T1YQ 4B3SL 2C35B 4DK6C 4A3DH 1VQBA 5FLMH 1AE2A 3BZCA 1UE1A 5IYDG 4HJ9A 2ZJPA 3AFPA 1WI5A 3G4SA 1VQOA 3H15A 2GN5A 4LF5L 3E0EA 2PQAB 4DV1Q 1VQDA 3ULPA 1VQAA 2B3GA 1CKMA 1G51A 2K4KA 2YTXA 4A3BH 1Y1VH 1IBMQ 2PNHA 1HR0W 1PH9A 4XIGS 4A3LG 3ZJYC 3S17H 3F8TA 4BY7H 2JA7H 1X54A 4HJ8A 3RLOA 4NXNQ 4BBRG 4R4QA 3ICEA 1KRSA 4DPGA 4K0KL 3T1HL 4DR3L 4A4IA 4YCUA 2VQFQ 4JI7L 1BVSA 2ATWA 3I4OA 1VQFA 1X55A 3CMEA 4P72A 5IYBG 5C44G 5K36G 3JAMi 1VQ9A 3FKIH 5IP9H 4A3IH 5HY6A 4LFBQ 5IP7H 5H1SE 2HHHQ 2NVQH 1I3QH 1HH2P 1XPOA 4DK3C 1AH9A 1JJCB 2N8NA 3CCQA 1Q1EA 1V9PA 4A3MG 1QVCA 3KJOA 4BY1H 3M4QA 2UXCL 4QQBX 1CSQA 2VQEL 1FL0A 1C9OA 3K0XA 2E8GA 1Y14B 3NBHB 4OWXB 4UP7A 4DV4L 1XMOL 1VQ7A 1YZ6A 5GAEC 4JI5Q 4AH6A 4A3FH 2HT1A 4WJ4A 4JI3L 5M5WH 2UUCL 2KENA 4JI6Q 1Q82C 3D0FA 2Z0SA 2PQAA 2CFMA 3U4ZA 3CF5A 4DV7L 4GOPB 5JJIA 4DR4Q 1CUKA 4GLVB 4UY8C 4B3RL 1HNWL 2R93G 1EWIA 3CC2A 2EIFA 1M90C 1FGUA 3CC4A 4JYAQ 1VQKA 2AWNA 1X3EA 1E1TA 4JV5L 2UXBQ 4JBKA 4POFA 1XNQL 4X64L 4OWTB 4B3TL 3A0JA 2R6GA 3UE0A 3S1RH 1NMFA 3A74A 3BU2A 3I7FA 1PH1A 1IBLL 2E2JH 3HOUH 5IWAL 2MFIA 4LFAL 1N32L 4P71A 5JJLA 1IL2A 1AE3A 1KRTA 3F2CA 5JJKA 2UXDQ 1PYSB 1E7ZA 3DM3A 1N36Q 3H3VI 1CKNB 1G291 1XNRQ 1X9NA 2NVTH 2E5LQ 1XJVA 3W5OA 3CC7A 4DR5Q 4OX9L 3S2HH 2R92G 1TWCH 1ASYA 2I5LX 4DV5Q 3BJUA 1Q46A 4YWKA 1Q12A 4A3EG 1J5EL 3HOVG 4JOIC 1YHQA 4UP9A 4MZ9A 1S72A 4GOPA 1Y1WH 4JI2L 4QY7A 4JI8Q 2JEAI 4J15A 1YNXA 3GTJH 4JI0L 2OCEA 4TVAB 5C0XG 3G48A 5M3FH 4LUZA 2GVAA 1UWVA 1GVPA 3PIOA 4LFCL 2GVBA 4GNXB 1MJEA 1VQPA 3GTPH 1JJ2A 4NXML 4K0KQ 1L1OC 4WJ3M 4X62L 5IYDH 4JI7Q 3HFZB 1PH7A 1OXXK 2KCTA 2Y0SE 3A5ZB 3TREA 1EQRA 1V43A 1EQQA 4R4CA 1YVCA 2K5VA 1CKNA 4QGUA 3MXNB 3HOXG 1A8VA 2ZTCA 1OXTA 2K75A 3JAMc 4XTCS 4DR1L 1PA6A 1JMCA 3OTOL 5JEAG 1VQEA 4BXXG 2UUAL 1H95A 1JB7A 5ELOA 2I5HA 2DGYA 4EX5A 4DR7L 3PSIA 5C44H 4PG3A 1K0RA 4JI3Q 1BBWA 3KDFB 3AFQA 3UDIA 3CPWA 1K9MC 2HIVA 4UP8A 1PHJA 1XPUA 3A5UA 2D62A 2N78A 1L2FA 2BA0A 3K7UC 1UE6A 3KF8B 4YWLA 2ZTEA 4GS3A 3KLWA 1OXVA 1EOVA 4A3MH 3I4MH 3PUYA 4JV5Q 1O7IA 4LUOA 3K7AH 4LUVA 2AWOA 4O0AA 4GNXA 5C0XI 1ASZA 2Z6KA 4X64Q 2VZAA 4DUYL 4LF6L 1XNQQ 5HGQA 3HOYG 4LF9L 4Y7NH 5IYCG 4BBSG 4HIOA 4LFAQ 4JI4Q 2MO0A 5GADC 4FDBA 3PF5A 1JJGA 3CPFA 5GAGC 1PH4A 1U5KA 2KHJA 2CQOA 4YCWA 5IT9c 4IO9A 4DR2L 1KAWA 5M3MG 3I4NG 1M1KC 2K52A 1HNXL 5LMUL 3RZOH 4L5QA 3PO3H 2YU9H 2L15A 1YI2A 1MKHA 1QZGA 1J5EQ 3KDFA 3NENA 5C3EG 2HIXA 4DV3L 2R7FA 1D7QA 5LMNL 1EYGA 2UUBQ 1MJCA 2VUMH 4IOAA 5ELNA 1NTGA 1YHBA 2RF4A 5FJ8G 2ALYB 3I56A 3PUWA 1A0IA 3S14H 2WAQE 4JI1L 4R4IA 1I6HH 2R92H 2DUDA 4JC0A 4KLKA 3RR5A 1LTLA 1VQLA 4P75A 4AQYL 1P8LA 3HOVH 2V1CC 5AJ3Q 2Q2HA 2AKWB 4HJAA 4AYBE 3CCLA 1YITA 4LF4Q 3ER0A 1DGSA 3KF6B 4DAYB 1TWAH 5C4XH 1KC8C 3ULJA 1VQ8A 2OTLA 1VQGA 1VQMA 2VW9A 1E22A 3OTOQ 5EAYA 3PCOB 4HIKA 3GDEA 4GKKQ 4A76A 2UUAQ 2ZM6Q 1KQSA 4QL5A 3IRBA 1PYBA 4A3GG 4JCVE 4AIMA 3HKZE 1Q7YC 3GTOH 3E9HA 3J81j 1XTDA 2WAQG 4OWWB 1B70B 2NVYH 2IX1A 2R7ZH 3AYHB 4KHPQ 4R4OA 2UU9Q 3S24A 4DV6Q 3RZDH 3J7A5 1RL2A 1WOCA 4YCVA 3RLNA 3PUZA 2R7DA 5M5YH 4GKJQ 2RCNA 4APVA 3PO2G 4A75A 1SE8A 2EXDA 4BXXH 3I2ZA 4AYBG 1T9HA 3OW2A 4LF7L 1N34Q 4QJFA 4YWMA 4LWCA 1N33Q 1YJNA 2ES2A 2ASBA 4DKAC 4ALPA 1PH8A 2F4VL 1XMQQ 4A93H 3J81i 4X65Q 1HZ9A 1C0AA 2KHIA 1L0WA 4HJ5A 1HZAA 4O2DA 1WCMG 1SRUA 2IHFA 2A1AA 4P73A 1TWHH 2IT1A 3GO5A 4DV0L 1PV4A 3S1MH 5FLMG 4B3SQ 4OXPA 4OONA 4B3ML 1VQ5A 3OYYA 1K83H 3KF6A 3HKZG 1BKBA 1PH2A 1OTCA 3HOWH 4JG2A 4NB3A 4DR2Q 4DR6L 4YHHL 4HIMA 2PI2A 4LF5Q 3STBD 3HOYH 4A3BG 1LM0A 3KYHC 2Q2TA 1Y1VG 5IY0A 4R4TA 5LMUQ 2N49A 2F52A 1I94L 2MQHA 4A3JH 1QUQB 1VQ4A 3MEFA 5IYCH 4BY7G 1SR3A 4DAMA 2K5NA 1Q86C 1E3PA 3T1YL 2E2IH 5C0XJ 2LSSA 5LMNQ 3T1HQ 3AQQA 4DR3Q 3TS0A 2B63G 3TS2A 3TRZA 4DV1L 5M3MH 3I4NH 1VQHA 4IOCA 3CCVA 2JK8A 3FKIG 5IP9G 4A3IG 5IP7G 2JA9A 3PV0A 2YYZA 2QEXA 4A3LH 1WJJA 1X65A 3FP9A 5C3EH 4BBRH 4BY1G 4R1JA 3PUVA 4L5TA 3TQYA 4L5SA 2UXCQ 5JEAJ 3G6EA 5FJ8H 4DNIA 2VQEQ 4HJ7A 1W2BA 3U50C 1XMOQ 4DV4Q 1N8RC 4YY3L 5IYBH 2MNAA 3H3VH 2UUCQ 1S40A 1YIJA 2YV5A 4LFBL 2EQSA 1LYLA 4C2MH 3F2DA 4DV7Q 2HHHL 2JEBI 1HNWQ 1VQNA 4B3RQ 3EBEA 1E24A 1QUQA 1RIPA 3EIVA 3LGJA 2Y0SG 3UE1A 3HOZG 3M7NA 1SMXA 4KI0A 1MIUA 1K3RA 5E7NA 4RMFA 1EFWA 2NZOA 4IFDG 2MO1A 1X6OA 4JI5L 4IFDJ 3UDXA 1BBUA 1C7YA 4A3CG 2A19A 2JA6G 3CAMA 3HKSA 4B3TQ 4JI6L 1IBLQ 2VS1A 3S1NH 3RN2A 3GD7A 3L0OA 3M9BA 5IWAQ 4OO1G 2OTJA 3UDFA 1N32Q 3D31A 3S16H 3M4PA 3B6YA 1W3SA 2R93H 2YTYA 2IX0A 4A3GH 1GM5A 4IJLA 4GOPC 1VQCA 1GO3E 3STBC 1JE5A 4IPHA 2LXKA 2ZJQA 5FLXc 2UXBL 3WWVA 1PH6A 1YEZA 1GD7A 1HJPA 1OXSC 2JA8G 5LMNW 4OX9Q 1NY4A 3PUXA 4DV2L 4KHZA 3J81c 2AMCB 3PO2H 5GROA 2CWAA 2CKZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 A;  2D0P A;  3J7Z C;  2JA5 G;  4DR6 Q;  2K5H A;  2UXD L;  1Y1W G;  1N36 L;  3J80 i;  1YBY A;  4JI2 Q;  2KCM A;  1S3O A;  1XNR L;  1OXU A;  1Q81 C;  2E5L L;  2K50 A;  5M3F G;  4JI0 Q;  2QGQ A;  4MTN A;  1WCM H;  4IJH A;  3FHW A;  4DR5 L;  4JBW A;  3L2P A;  1B8A A;  3CXC A;  1R9T H;  4DV5 L;  4LFC Q;  3BZK A;  4NXM Q;  4A3K G;  3NEM A;  1N9W A;  4X62 Q;  2NVX H;  1QVF A;  4IFD I;  4A3E H;  2IHE A;  2K14 A;  4P74 A;  1I50 H;  1J6Q A;  4JI8 L;  1CKO A;  2RHS B;  4PMW A;  3CP0 A;  3SGI A;  4OO1 I;  3TEH B;  1IBK L;  4HID A;  4Y52 H;  1KD1 C;  2E2H H;  1P16 A;  1X3F A;  4DR1 Q;  4GN3 B;  2B63 H;  4JOI A;  4QIW E;  3NEL A;  3RLF A;  1XPR A;  4GNX C;  1Q1B A;  3ULL A;  1HR0 L;  2Z6K C;  4DR7 Q;  2OQ0 A;  4YY3 Q;  1JT8 A;  1UE7 A;  3CCS A;  1KL9 A;  1WYD A;  3UDG A;  2ZJR A;  1KIX A;  1HNZ L;  3U58 A;  3CCJ A;  3EN2 A;  2QA4 A;  1QVG A;  3GTK H;  3KJP A;  3HOX H;  3H0G G;  3PIP A;  3K8A A;  3I4M G;  1L1O A;  1G6P A;  1YJW A;  4JBJ A;  4GN4 B;  4ME3 A;  2VNU D;  1EIY B;  1TWF H;  3CCM A;  1IZ6 A;  1GKH A;  3L7Z C;  4LF6 Q;  4DUY Q;  4LF8 L;  4DUZ L;  4JBM A;  3KFU A;  2JE6 I;  2JJQ A;  3Q8D A;  4LF9 Q;  1IXR A;  1YHA A;  2WFW A;  3CQZ H;  2RHQ B;  3K81 C;  3CCU A;  2BH2 A;  2ZTD A;  1FVI A;  1VQJ A;  4GN5 A;  2WB1 E;  1FJG L;  3HOZ H;  1K8A C;  4A3D G;  1IYJ B;  3PF4 A;  3F2B A;  4LW1 A;  2OWO A;  2I5M X;  3W1B A;  5C4J H;  1A62 A;  2AHO B;  2NN6 G;  3PGZ A;  3CCE A;  3S2D H;  4A3C H;  2XGT A;  2JA6 H;  3GTM H;  4UPA A;  2BH8 A;  3W1G A;  4PZ7 A;  4DV2 Q;  1HNX Q;  3PO3 G;  5GAH C;  1SLJ A;  5BR8 L;  4JI4 L;  4PZ6 A;  3RNU A;  4BBS H;  2JA7 G;  4X66 L;  4DV3 Q;  2VUM G;  4POG A;  4NPS A;  3ERS X;  1SRO A;  4PZ8 A;  1PH3 A;  3S1Q H;  2LXJ A;  1TWG H;  3M4O H;  3GTG H;  1QZH A;  2JA8 H;  2N3S A;  3CCR A;  2CWP A;  3J80 c;  4JI1 Q;  1NJI C;  3I55 A;  1LUZ A;  1IBM L;  2WB1 G;  4TQU S;  1HZC A;  4X6A H;  4AQY Q;  2JA5 H;  1K73 C;  3GTL H;  4NXN L;  3K80 C;  1KXL A;  3CW2 C;  1K8G A;  2JQO A;  2UUB L;  2VQF L;  1U0L A;  4EQ5 A;  4RG1 A;  5GQO A;  3JC6 6;  1V1Q A;  4C3J H;  1B7Y B;  1IBK Q;  5C4X G;  2FXQ A;  4A3F G;  4L5R C;  2IY5 B;  2H5X A;  1NMG A;  3G71 A;  4A3K H;  2Q2U A;  1UEB A;  2PMZ E;  2NN6 I;  4C3H H;  1KHI A;  5AJ3 L;  1HR0 Q;  2WP8 J;  3GTQ H;  1EUJ A;  2R7Z G;  3M3Y H;  1HZB A;  3DLL A;  2XTI A;  4LF4 L;  1Z47 A;  2VL6 A;  2YTV A;  3AEV A;  2Q2I A;  4IPC A;  1HNZ Q;  1NBW A;  3U4V A;  1TXY A;  3CMA A;  1YJ9 A;  3HOU G;  2KBN A;  1UE5 A;  5J3B A;  4GKK L;  2A8V A;  4DR4 L;  2ZM6 L;  1NE3 A;  5M5X H;  2F3I A;  4IPD A;  4C3I H;  4H02 A;  4GLX A;  4GLA C;  4LF7 Q;  4A93 G;  5IE8 A;  2OQK A;  3RN5 A;  4LF8 Q;  4MNO A;  4DUZ Q;  4JYA L;  2F4V Q;  1X56 A;  1E1O A;  2PI2 E;  4KHP L;  2UU9 L;  1PH5 A;  1CSP A;  4DV6 L;  1SN8 A;  4BA2 I;  1D8L A;  3E9I A;  2ID0 A;  2NZH A;  1PFS A;  2VY3 A;  4DV0 Q;  1FJG Q;  3H0G H;  1VS0 A;  4GKJ L;  2CCZ A;  2HQL A;  3VDY A;  4B3M Q;  3HOW G;  3S15 H;  1VCI A;  1I5F A;  3KOJ A;  1X3G A;  1N34 L;  1N33 L;  4YHH Q;  1Z9F A;  1VQI A;  1SFO H;  1XMQ L;  1VQ6 A;  4LNQ A;  5DLQ E;  4X65 L;  4A3J G;  4BA1 I;  1A63 A;  1PVO A;  1I94 Q;  5BR8 Q;  2I0Q A;  1L1O B;  1EIF A;  1WFQ A;  2B29 A;  2BA1 A;  2D0O A;  4X66 Q;  1Q8K A;  4IPG A;  3F1Z A;  3M85 A;  3T1Y Q;  4B3S L;  2C35 B;  4DK6 C;  4A3D H;  1VQB A;  5FLM H;  1AE2 A;  3BZC A;  1UE1 A;  5IYD G;  4HJ9 A;  2ZJP A;  3AFP A;  1WI5 A;  3G4S A;  1VQO A;  3H15 A;  2GN5 A;  4LF5 L;  3E0E A;  2PQA B;  4DV1 Q;  1VQD A;  3ULP A;  1VQA A;  2B3G A;  1CKM A;  1G51 A;  2K4K A;  2YTX A;  4A3B H;  1Y1V H;  1IBM Q;  2PNH A;  1HR0 W;  1PH9 A;  4XIG S;  4A3L G;  3ZJY C;  3S17 H;  3F8T A;  4BY7 H;  2JA7 H;  1X54 A;  4HJ8 A;  3RLO A;  4NXN Q;  4BBR G;  4R4Q A;  3ICE A;  1KRS A;  4DPG A;  4K0K L;  3T1H L;  4DR3 L;  4A4I A;  4YCU A;  2VQF Q;  4JI7 L;  1BVS A;  2ATW A;  3I4O A;  1VQF A;  1X55 A;  3CME A;  4P72 A;  5IYB G;  5C44 G;  5K36 G;  3JAM i;  1VQ9 A;  3FKI H;  5IP9 H;  4A3I H;  5HY6 A;  4LFB Q;  5IP7 H;  5H1S E;  2HHH Q;  2NVQ H;  1I3Q H;  1HH2 P;  1XPO A;  4DK3 C;  1AH9 A;  1JJC B;  2N8N A;  3CCQ A;  1Q1E A;  1V9P A;  4A3M G;  1QVC A;  3KJO A;  4BY1 H;  3M4Q A;  2UXC L;  4QQB X;  1CSQ A;  2VQE L;  1FL0 A;  1C9O A;  3K0X A;  2E8G A;  1Y14 B;  3NBH B;  4OWX B;  4UP7 A;  4DV4 L;  1XMO L;  1VQ7 A;  1YZ6 A;  5GAE C;  4JI5 Q;  4AH6 A;  4A3F H;  2HT1 A;  4WJ4 A;  4JI3 L;  5M5W H;  2UUC L;  2KEN A;  4JI6 Q;  1Q82 C;  3D0F A;  2Z0S A;  2PQA A;  2CFM A;  3U4Z A;  3CF5 A;  4DV7 L;  4GOP B;  5JJI A;  4DR4 Q;  1CUK A;  4GLV B;  4UY8 C;  4B3R L;  1HNW L;  2R93 G;  1EWI A;  3CC2 A;  2EIF A;  1M90 C;  1FGU A;  3CC4 A;  4JYA Q;  1VQK A;  2AWN A;  1X3E A;  1E1T A;  4JV5 L;  2UXB Q;  4JBK A;  4POF A;  1XNQ L;  4X64 L;  4OWT B;  4B3T L;  3A0J A;  2R6G A;  3UE0 A;  3S1R H;  1NMF A;  3A74 A;  3BU2 A;  3I7F A;  1PH1 A;  1IBL L;  2E2J H;  3HOU H;  5IWA L;  2MFI A;  4LFA L;  1N32 L;  4P71 A;  5JJL A;  1IL2 A;  1AE3 A;  1KRT A;  3F2C A;  5JJK A;  2UXD Q;  1PYS B;  1E7Z A;  3DM3 A;  1N36 Q;  3H3V I;  1CKN B;  1G29 1;  1XNR Q;  1X9N A;  2NVT H;  2E5L Q;  1XJV A;  3W5O A;  3CC7 A;  4DR5 Q;  4OX9 L;  3S2H H;  2R92 G;  1TWC H;  1ASY A;  2I5L X;  4DV5 Q;  3BJU A;  1Q46 A;  4YWK A;  1Q12 A;  4A3E G;  1J5E L;  3HOV G;  4JOI C;  1YHQ A;  4UP9 A;  4MZ9 A;  1S72 A;  4GOP A;  1Y1W H;  4JI2 L;  4QY7 A;  4JI8 Q;  2JEA I;  4J15 A;  1YNX A;  3GTJ H;  4JI0 L;  2OCE A;  4TVA B;  5C0X G;  3G48 A;  5M3F H;  4LUZ A;  2GVA A;  1UWV A;  1GVP A;  3PIO A;  4LFC L;  2GVB A;  4GNX B;  1MJE A;  1VQP A;  3GTP H;  1JJ2 A;  4NXM L;  4K0K Q;  1L1O C;  4WJ3 M;  4X62 L;  5IYD H;  4JI7 Q;  3HFZ B;  1PH7 A;  1OXX K;  2KCT A;  2Y0S E;  3A5Z B;  3TRE A;  1EQR A;  1V43 A;  1EQQ A;  4R4C A;  1YVC A;  2K5V A;  1CKN A;  4QGU A;  3MXN B;  3HOX G;  1A8V A;  2ZTC A;  1OXT A;  2K75 A;  3JAM c;  4XTC S;  4DR1 L;  1PA6 A;  1JMC A;  3OTO L;  5JEA G;  1VQE A;  4BXX G;  2UUA L;  1H95 A;  1JB7 A;  5ELO A;  2I5H A;  2DGY A;  4EX5 A;  4DR7 L;  3PSI A;  5C44 H;  4PG3 A;  1K0R A;  4JI3 Q;  1BBW A;  3KDF B;  3AFQ A;  3UDI A;  3CPW A;  1K9M C;  2HIV A;  4UP8 A;  1PHJ A;  1XPU A;  3A5U A;  2D62 A;  2N78 A;  1L2F A;  2BA0 A;  3K7U C;  1UE6 A;  3KF8 B;  4YWL A;  2ZTE A;  4GS3 A;  3KLW A;  1OXV A;  1EOV A;  4A3M H;  3I4M H;  3PUY A;  4JV5 Q;  1O7I A;  4LUO A;  3K7A H;  4LUV A;  2AWO A;  4O0A A;  4GNX A;  5C0X I;  1ASZ A;  2Z6K A;  4X64 Q;  2VZA A;  4DUY L;  4LF6 L;  1XNQ Q;  5HGQ A;  3HOY G;  4LF9 L;  4Y7N H;  5IYC G;  4BBS G;  4HIO A;  4LFA Q;  4JI4 Q;  2MO0 A;  5GAD C;  4FDB A;  3PF5 A;  1JJG A;  3CPF A;  5GAG C;  1PH4 A;  1U5K A;  2KHJ A;  2CQO A;  4YCW A;  5IT9 c;  4IO9 A;  4DR2 L;  1KAW A;  5M3M G;  3I4N G;  1M1K C;  2K52 A;  1HNX L;  5LMU L;  3RZO H;  4L5Q A;  3PO3 H;  2YU9 H;  2L15 A;  1YI2 A;  1MKH A;  1QZG A;  1J5E Q;  3KDF A;  3NEN A;  5C3E G;  2HIX A;  4DV3 L;  2R7F A;  1D7Q A;  5LMN L;  1EYG A;  2UUB Q;  1MJC A;  2VUM H;  4IOA A;  5ELN A;  1NTG A;  1YHB A;  2RF4 A;  5FJ8 G;  2ALY B;  3I56 A;  3PUW A;  1A0I A;  3S14 H;  2WAQ E;  4JI1 L;  4R4I A;  1I6H H;  2R92 H;  2DUD A;  4JC0 A;  4KLK A;  3RR5 A;  1LTL A;  1VQL A;  4P75 A;  4AQY L;  1P8L A;  3HOV H;  2V1C C;  5AJ3 Q;  2Q2H A;  2AKW B;  4HJA A;  4AYB E;  3CCL A;  1YIT A;  4LF4 Q;  3ER0 A;  1DGS A;  3KF6 B;  4DAY B;  1TWA H;  5C4X H;  1KC8 C;  3ULJ A;  1VQ8 A;  2OTL A;  1VQG A;  1VQM A;  2VW9 A;  1E22 A;  3OTO Q;  5EAY A;  3PCO B;  4HIK A;  3GDE A;  4GKK Q;  4A76 A;  2UUA Q;  2ZM6 Q;  1KQS A;  4QL5 A;  3IRB A;  1PYB A;  4A3G G;  4JCV E;  4AIM A;  3HKZ E;  1Q7Y C;  3GTO H;  3E9H A;  3J81 j;  1XTD A;  2WAQ G;  4OWW B;  1B70 B;  2NVY H;  2IX1 A;  2R7Z H;  3AYH B;  4KHP Q;  4R4O A;  2UU9 Q;  3S24 A;  4DV6 Q;  3RZD H;  3J7A 5;  1RL2 A;  1WOC A;  4YCV A;  3RLN A;  3PUZ A;  2R7D A;  5M5Y H;  4GKJ Q;  2RCN A;  4APV A;  3PO2 G;  4A75 A;  1SE8 A;  2EXD A;  4BXX H;  3I2Z A;  4AYB G;  1T9H A;  3OW2 A;  4LF7 L;  1N34 Q;  4QJF A;  4YWM A;  4LWC A;  1N33 Q;  1YJN A;  2ES2 A;  2ASB A;  4DKA C;  4ALP A;  1PH8 A;  2F4V L;  1XMQ Q;  4A93 H;  3J81 i;  4X65 Q;  1HZ9 A;  1C0A A;  2KHI A;  1L0W A;  4HJ5 A;  1HZA A;  4O2D A;  1WCM G;  1SRU A;  2IHF A;  2A1A A;  4P73 A;  1TWH H;  2IT1 A;  3GO5 A;  4DV0 L;  1PV4 A;  3S1M H;  5FLM G;  4B3S Q;  4OXP A;  4OON A;  4B3M L;  1VQ5 A;  3OYY A;  1K83 H;  3KF6 A;  3HKZ G;  1BKB A;  1PH2 A;  1OTC A;  3HOW H;  4JG2 A;  4NB3 A;  4DR2 Q;  4DR6 L;  4YHH L;  4HIM A;  2PI2 A;  4LF5 Q;  3STB D;  3HOY H;  4A3B G;  1LM0 A;  3KYH C;  2Q2T A;  1Y1V G;  5IY0 A;  4R4T A;  5LMU Q;  2N49 A;  2F52 A;  1I94 L;  2MQH A;  4A3J H;  1QUQ B;  1VQ4 A;  3MEF A;  5IYC H;  4BY7 G;  1SR3 A;  4DAM A;  2K5N A;  1Q86 C;  1E3P A;  3T1Y L;  2E2I H;  5C0X J;  2LSS A;  5LMN Q;  3T1H Q;  3AQQ A;  4DR3 Q;  3TS0 A;  2B63 G;  3TS2 A;  3TRZ A;  4DV1 L;  5M3M H;  3I4N H;  1VQH A;  4IOC A;  3CCV A;  2JK8 A;  3FKI G;  5IP9 G;  4A3I G;  5IP7 G;  2JA9 A;  3PV0 A;  2YYZ A;  2QEX A;  4A3L H;  1WJJ A;  1X65 A;  3FP9 A;  5C3E H;  4BBR H;  4BY1 G;  4R1J A;  3PUV A;  4L5T A;  3TQY A;  4L5S A;  2UXC Q;  5JEA J;  3G6E A;  5FJ8 H;  4DNI A;  2VQE Q;  4HJ7 A;  1W2B A;  3U50 C;  1XMO Q;  4DV4 Q;  1N8R C;  4YY3 L;  5IYB H;  2MNA A;  3H3V H;  2UUC Q;  1S40 A;  1YIJ A;  2YV5 A;  4LFB L;  2EQS A;  1LYL A;  4C2M H;  3F2D A;  4DV7 Q;  2HHH L;  2JEB I;  1HNW Q;  1VQN A;  4B3R Q;  3EBE A;  1E24 A;  1QUQ A;  1RIP A;  3EIV A;  3LGJ A;  2Y0S G;  3UE1 A;  3HOZ G;  3M7N A;  1SMX A;  4KI0 A;  1MIU A;  1K3R A;  5E7N A;  4RMF A;  1EFW A;  2NZO A;  4IFD G;  2MO1 A;  1X6O A;  4JI5 L;  4IFD J;  3UDX A;  1BBU A;  1C7Y A;  4A3C G;  2A19 A;  2JA6 G;  3CAM A;  3HKS A;  4B3T Q;  4JI6 L;  1IBL Q;  2VS1 A;  3S1N H;  3RN2 A;  3GD7 A;  3L0O A;  3M9B A;  5IWA Q;  4OO1 G;  2OTJ A;  3UDF A;  1N32 Q;  3D31 A;  3S16 H;  3M4P A;  3B6Y A;  1W3S A;  2R93 H;  2YTY A;  2IX0 A;  4A3G H;  1GM5 A;  4IJL A;  4GOP C;  1VQC A;  1GO3 E;  3STB C;  1JE5 A;  4IPH A;  2LXK A;  2ZJQ A;  5FLX c;  2UXB L;  3WWV A;  1PH6 A;  1YEZ A;  1GD7 A;  1HJP A;  1OXS C;  2JA8 G;  5LMN W;  4OX9 Q;  1NY4 A;  3PUX A;  4DV2 L;  4KHZ A;  3J81 c;  2AMC B;  3PO2 H;  5GRO A;  2CWA A;  2CKZ B; 
#chains in the Genus database with same CATH topology
 1PDQ A;  3CQZ B;  1H9S B;  4JPB W;  1HUN A;  4C1N K;  2KCM A;  1XNR L;  1OXU A;  4QUC A;  1I4H A;  5M3F G;  4MTN A;  1WCM H;  4IJH A;  3FHW A;  4DR5 L;  3L2P A;  3CXC A;  1R9T H;  1KLG D;  4A3K G;  1Z6H A;  4IFD I;  4A3E H;  2IHE A;  2XWJ B;  1I50 H;  1J6Q A;  1D1I A;  4JI8 L;  2FHT A;  1XX8 A;  2PNR C;  5D3D A;  3BVM A;  3SGI A;  5JVH 3;  4OO1 I;  3TEH B;  4XDX A;  1SNC A;  4Y52 H;  2E2H H;  3S1Q B;  1CI3 M;  2JYO A;  1QB5 D;  4DR1 Q;  5M3M B;  3NTK A;  3I90 A;  1Y8P B;  4JOI A;  3J80 E;  2MJ8 A;  1XPR A;  4GNX C;  1D6E C;  1GHJ A;  3E5S A;  5C5L A;  1ESF A;  5CV5 A;  1HNZ L;  1LAC A;  2PO4 A;  3EN2 A;  1FNV A;  1KNA A;  1YJW A;  4JBJ A;  4ME3 A;  4N8F A;  2VNU D;  1IZ6 A;  3I3C A;  4LF6 Q;  4DUY Q;  4DUZ L;  3GTQ B;  3KFU A;  2JJQ A;  4K6L A;  4LF9 Q;  1YHA A;  3M3Y B;  5EKL A;  1BNZ A;  3O13 A;  3M7G A;  2CH4 W;  3K81 C;  2IPK D;  5G3L D;  1FVI A;  2WB1 E;  1B9M A;  1M4V A;  4FVM A;  4LW1 A;  2F0J A;  4IFD H;  2K7V A;  1A62 A;  3Q0A A;  5CGK A;  2XGT A;  4A3C H;  4UPA A;  4IUQ A;  4CJ2 C;  1SLJ A;  4J1M A;  5BR8 L;  4OO1 H;  4BBS H;  1R4Q B;  4X66 L;  4UDU C;  2L0C A;  4DV3 Q;  4MIU A;  3FVQ A;  1PH3 A;  3SEB A;  1GHK A;  2LXJ A;  1TWG H;  2NTS A;  2CWP A;  3J80 c;  4JI1 Q;  2Z4I A;  2AUJ D;  4P2C B;  4X6A H;  1K73 C;  2ICI A;  3BVZ A;  1WCM B;  4IQZ A;  5AFW A;  4EQ5 A;  4RG1 A;  1R9T B;  1V1Q A;  4C3J H;  1GUO A;  1SYG A;  1ROD A;  1IBK Q;  5C4X G;  4L8J A;  1J8I A;  1I50 B;  2F03 A;  4L5R C;  1TT2 A;  2MP1 A;  2H5X A;  1NMG A;  4A3K H;  2Q2U A;  1A15 A;  2WP8 J;  3Q6S A;  1KNE A;  2E2H B;  1BCP B;  1WVL A;  5NUC A;  3R2T A;  2YTV A;  2EDG A;  3Q24 A;  3AEV A;  1QE6 A;  1I4X A;  1YJ9 A;  3K5L A;  1CA5 A;  2ZM6 L;  1NE3 A;  4A3I B;  2F3I A;  4C3I H;  2L12 A;  4GLX A;  4DK0 A;  4KKT A;  2OQK A;  1FNU A;  1A2U A;  1X56 A;  2F0L A;  4HN7 A;  4CHT B;  1GOZ A;  1PTO H;  2ID0 A;  1PFS A;  1AZQ A;  1VS0 A;  4FF2 A;  4FXD A;  1VCI A;  1I5F A;  2XN9 C;  1JR0 D;  4IUT A;  2AQ3 B;  1K28 A;  1Z9F A;  3NQI A;  1XMQ L;  3H3V C;  1TY2 A;  1UUP A;  3P75 A;  4U68 A;  3T13 A;  4HSP A;  1EIF A;  3M85 A;  3LWU A;  5C6A A;  3F1Z A;  4TKO B;  5K5P A;  2C35 B;  4DK6 C;  1VQB A;  1AE2 A;  4HJ9 A;  5IYD G;  1SJE D;  2IX3 A;  2ZJP A;  1I4R A;  3G4S A;  1VQO A;  2PPB C;  3H15 A;  2GN5 A;  3E0E A;  2E75 C;  4BBS B;  2B3G A;  1CKM A;  3J80 L;  4A3B H;  2YTX A;  4M1U B;  5KYL A;  1IBM Q;  1HR0 W;  1PH9 A;  2HDL A;  1PRT D;  3ZJY C;  4KN4 C;  3RLO A;  1PFB A;  1TWG B;  2BE5 D;  4K0K L;  1ILP A;  2VQF Q;  3KF8 A;  3I4O A;  1VQF A;  3Q23 A;  4P72 A;  1TU2 B;  3NBI A;  4ZKB B;  1LTR D;  1CM9 A;  4N8X 1;  2PQE A;  1STA A;  4K5X A;  5H1S E;  2SNS A;  4RFB A;  3J7A F;  1NR4 A;  1AH9 A;  3C3L A;  5IGF A;  3CCQ A;  4C3J B;  5M3F B;  4A3M G;  1QVC A;  4XQJ A;  3M4Q A;  3R3O A;  5A2Q L;  1CSQ A;  4MTK A;  1FL0 A;  4DU9 A;  1VQ7 A;  4DV4 L;  4UP7 A;  2NVQ H;  4WJ4 A;  2K5D A;  1VDZ A;  4AH6 A;  4A3K B;  1XWE A;  4JI3 L;  2PQA A;  5JJI A;  3R2I A;  1BUV T;  4GLV B;  3OMC A;  4UY8 C;  1EWI A;  3CC2 A;  2TSS A;  2G9D A;  2RQX A;  4ID6 A;  4CDE C;  4JYA Q;  1CFM A;  2B2V A;  1VQK A;  1X3E A;  2QEJ C;  2UXB Q;  3JAM E;  4I7A A;  1S5D D;  1BCP C;  5ELB A;  3SHL A;  3X3M A;  3S1R H;  1HA5 A;  1NMF A;  4DK1 A;  1EY8 A;  2MFI A;  1QNK A;  3NTI A;  2TMP A;  1WTV A;  2X6G A;  5KIX A;  1PTO B;  3HP3 A;  2XWB B;  2NVT H;  4ZKC B;  1SBB B;  5JPN C;  5ELF A;  1O7Z A;  1TWC H;  4R8N A;  3NBH A;  2WII B;  3BJU A;  3HOV G;  5LL6 S;  1STN A;  4QY7 A;  3NQT A;  2OCE A;  2NB0 A;  4X3K A;  1UWV A;  3IL8 A;  4DNR B;  5IT9 E;  1MJE A;  1VQP A;  5IYD H;  2XNA C;  1PH7 A;  1OXX K;  2Y0S E;  3RZO B;  3A5Z B;  2E2D C;  2PZU A;  3HRZ C;  4R4C A;  2K5V A;  1CKN A;  4QGU A;  2ZT9 C;  1LT6 D;  4DR1 L;  3JAM c;  2KEC A;  2B2W A;  2CHB D;  5C3W A;  4XT3 B;  1VQE A;  4BXX G;  2J0T D;  2UUA L;  1RTO A;  4HCE A;  4K2K A;  3D4R A;  1EEF D;  3AFQ A;  2HIV A;  2A74 C;  3ERO A;  2N78 A;  1L2F A;  1BDO A;  2D2C C;  2ZTE A;  2F0N A;  2NVQ B;  5C4X B;  3KLW A;  1OXV A;  4TSS A;  1GXD C;  4A3M H;  1AFP A;  4JV5 Q;  1O7I A;  5EKI A;  4LF6 L;  3HOY G;  4DUY L;  4LF9 L;  4C56 C;  4HIO A;  2MO0 A;  5GAD C;  1WD1 A;  3PF5 A;  2DJG C;  5GAG C;  4KJN A;  2XRQ D;  1ZKO A;  3DEO A;  4HMJ A;  3MXN A;  5IT9 c;  1BOS A;  5DM7 3;  1M1K C;  1EY0 A;  2K52 A;  3LX0 A;  3SR1 A;  4L5Q A;  4H7B A;  5C3E G;  3FDT A;  2HIX A;  3A55 A;  4DV3 L;  2NVT B;  1EYG A;  2UUB Q;  4IOA A;  3VA7 A;  1NTG A;  2ZXR A;  1K83 B;  1PTO C;  4JI1 L;  4R4I A;  1I6H H;  2K01 A;  3RR5 A;  2MUY A;  1LTS D;  4C3H G;  3HOV H;  2Q2H A;  1YIT A;  3VR3 A;  3ER0 A;  4LF4 Q;  1STY A;  4K2L A;  4DAY B;  1CT1 D;  1TWA H;  1SNP A;  3ULJ A;  3JAM L;  2VW9 A;  3OTO Q;  1VF5 C;  4HIK A;  3QJY A;  1DM0 B;  3T56 B;  3IRB A;  5FO8 B;  4LK1 C;  4A3G G;  5IGB A;  1EY9 A;  2DY7 A;  1Y69 U;  3A7L A;  1VMC A;  1NR2 A;  3BDO A;  2UU9 Q;  4DV6 Q;  3RZD H;  4IUU A;  3J7A 5;  1WTQ A;  4YCV A;  1OO9 B;  2VB3 X;  2R7D A;  3RLN A;  5LL6 X;  5M5Y H;  5L37 A;  2RCN A;  3NWT A;  3PO2 G;  4BXX H;  1F9S A;  3KBX A;  2K04 A;  3BVG A;  2XSC A;  1N33 Q;  1YJN A;  2PYK A;  3QWN A;  4OIJ A;  3OIP A;  1PH8 A;  3KLS A;  3J81 i;  1C0A A;  1E2V A;  4A3M B;  1V1P B;  2IHF A;  1K8O A;  1F9R A;  1IYV A;  3HKZ G;  5IT9 L;  1VF7 A;  4DR2 Q;  4DR6 L;  3S1N B;  2PI2 A;  1NSN S;  3HOY H;  1LM0 A;  1LV9 A;  4F87 A;  2MQH A;  3GP7 A;  1MI2 A;  4A3J H;  1FD7 D;  4BY7 G;  1IYU A;  2JXM B;  2E2I H;  1TQO A;  2LSS A;  5CYU A;  5LMN Q;  2Z6B A;  1G2T A;  2B63 G;  4DR3 Q;  1WD0 A;  1S5C D;  3DEP A;  2SNM A;  1GUW A;  4DXG A;  1VQH A;  2ZXO A;  2JK8 A;  5IP9 G;  5IP7 G;  2JA9 A;  3PV0 A;  2K6A A;  4O1N A;  4DN4 M;  2YYZ A;  2QEX A;  1X65 A;  3FP9 A;  5C3E H;  2G9H D;  3L3O C;  4RH6 A;  4BY1 G;  5EPJ A;  3TQY A;  2PW5 A;  4L5S A;  1I6H B;  1IHZ A;  3PIO 3;  4HJ7 A;  1W2B A;  1XMO Q;  1SJH D;  3HOV B;  2UUC Q;  1YIJ A;  1LYL A;  2EJG C;  1SE4 A;  1VQN A;  4KY6 A;  3EBE A;  5FK9 C;  3HOZ G;  2Y0S G;  2WAC A;  1TWA B;  1K3R A;  2A69 D;  4OHJ A;  4RMF A;  5E7N A;  3CU7 A;  1KDA A;  5JAV A;  4WFN 3;  4H13 C;  4IFD J;  2A19 A;  4B3T Q;  4BWG B;  3RN2 A;  5IWA Q;  4CDF C;  3S16 H;  3M4P A;  3B6Y A;  1CA6 A;  5CBE E;  2NZ1 D;  2RCF A;  2RSN A;  2YTY A;  5C4H A;  4A3G H;  5JVG 3;  4GOP C;  1VQC A;  1CZW A;  1GO3 E;  1JE5 A;  2LXK A;  5M5Y B;  2UXB L;  3WWV A;  1YEZ A;  3V05 A;  1HJP A;  4J8Q A;  3PUX A;  5ISR A;  2AMC B;  3PO2 H;  2AQ1 B;  3CD6 A;  3EA6 A;  4ABN A;  2K5H A;  1Y1W G;  3T51 B;  1IW7 D;  4JI2 Q;  2QDB A;  2HD3 A;  1ML0 D;  2A5H A;  1FNW A;  5T1G A;  1Q81 C;  3AMU A;  1LTA D;  1V1O A;  2K50 A;  3GV6 A;  3K5O A;  4JBW A;  2X6L A;  3MWY W;  1I6V C;  3QR8 A;  4LFC Q;  3VR4 A;  1SMY C;  5D65 A;  3HOY B;  1N9W A;  1QVF A;  3NUC A;  2K14 A;  4P74 A;  3HS0 C;  1LO5 D;  2RHS B;  2E2I B;  2F0G A;  3KK7 A;  5E1F A;  1KD1 C;  5C0X H;  1X3F A;  2EYO A;  1KAA A;  2PCF B;  1DYQ A;  3QO2 A;  2B63 H;  2D9U A;  1KTK A;  3ULL A;  1WTX A;  2Z6K C;  1E0B A;  2OXP A;  1SNM A;  3CCS A;  5JPM C;  5C3E B;  4YIJ A;  2B2Y A;  1SYE A;  3VR5 A;  2B2T A;  1R4P B;  3CCJ A;  3KJP A;  3HOX H;  3K8A A;  2L4N A;  5JEA H;  1TWF H;  3CCM A;  3L7Z C;  4C3H B;  2JE6 I;  1Z7T A;  2WFW A;  3CQZ H;  5BN3 A;  4KV6 A;  2XVS A;  2ZTD A;  1L0Y B;  1YNN C;  3HOZ H;  1FJG L;  1K8A C;  1IYJ B;  3PF4 A;  3F2B A;  3VR6 A;  2OWO A;  1EEI D;  3W1B A;  5C4J H;  2NN6 G;  2AHO B;  3CCE A;  2EE1 A;  2OF1 A;  3KLR A;  5M5X B;  3GTM H;  1HTP A;  2OEO A;  3W1G A;  4DV2 Q;  1HNX Q;  3PO3 G;  3M4Y A;  4A3G B;  3RNU A;  3DXJ C;  1JOR A;  1STH A;  4EQN A;  1EIH A;  4PZ8 A;  4B9W A;  2O4X A;  3S1Q H;  4E6I A;  3GTG H;  3PO2 B;  4OEM B;  4AQY Q;  1TR5 A;  3GTL H;  1BO0 A;  4KTA A;  2UUB L;  2JQO A;  4FO2 A;  1U0L A;  1S5E D;  3JC6 6;  3H94 A;  3SXH A;  3DWA A;  4RCN A;  1B7Y B;  1AW7 A;  3HKZ B;  2FXQ A;  4A3F G;  4U67 3;  1YNJ D;  2HCC A;  2XIW A;  2H4O A;  3G71 A;  1HHV A;  2KJX A;  1HR0 Q;  2NN6 I;  5CV6 A;  5EPL A;  3GTQ H;  1X32 A;  4BY7 B;  2IWH A;  2R7Z G;  3M3Y H;  1HZB A;  3DLL A;  4LF4 L;  1W6K A;  4KD4 A;  4DF7 A;  5COR A;  1EY4 A;  1T5X D;  1F2M A;  2F0Q A;  4IPC A;  2B63 B;  3U4V A;  3HOU G;  3LNN A;  1UE5 A;  4DR4 L;  3E0J A;  1G2S A;  2VXW A;  4H02 A;  4A93 G;  2F0K A;  3A8I E;  4LF8 Q;  2F4V Q;  2UU9 L;  1CSP A;  3D6C A;  5CV4 A;  4DV6 L;  1PZJ D;  4BY1 B;  4FXG C;  2BDO A;  2HQL A;  3VDY A;  3S15 H;  5F2D A;  1N33 L;  2F0F A;  3CHB D;  2FJ2 A;  4OL7 A;  4XYQ A;  4ME5 A;  3HOZ B;  3K6O A;  3OHX C;  1PVO A;  2Y0S B;  3ITP A;  1L1O B;  1WFQ A;  1XPU A;  5C4J B;  5FLM H;  1UE1 A;  2CW0 C;  3K5M A;  5CR3 A;  3GTM B;  1KAB A;  2PQA B;  2SOB A;  1SND A;  1VQD A;  2B2U C;  1VQA A;  5J39 A;  4KY5 A;  3TP8 A;  4K5W A;  1JWM D;  2WV6 D;  3F8T A;  4HJ8 A;  4NXN Q;  4BBR G;  3GTG B;  1KRS A;  1G91 A;  4DR3 L;  4EGV A;  1BVS A;  2ATW A;  3D4W A;  1X55 A;  4GZY C;  3CME A;  5IYB G;  2QW7 A;  4HAE A;  2RDH A;  3K59 A;  3P1H A;  3GTL B;  1VQ9 A;  4A3I H;  1Y1W B;  5HY6 A;  1ZYR C;  4LFB Q;  2KED A;  5ELC A;  1BR9 A;  4DK3 C;  1JJC B;  2N8N A;  4KY7 A;  1O78 A;  1Q1E A;  3KJO A;  4QQB X;  1C9O A;  2E8G A;  1Y14 B;  3NBH B;  4OWX B;  3TZU A;  1XMO L;  2HT1 A;  3CKI B;  4A3F H;  4HR7 B;  2UUC L;  4JI6 Q;  3D0F A;  2XRS D;  3BDC A;  2R93 G;  5EBD A;  2KHS A;  2EJF C;  1FGU A;  2AWN A;  4JBK A;  4POF A;  1XNQ L;  4X64 L;  4OWT B;  4B3T L;  3UE0 A;  2E2J H;  2F1M A;  3HOU H;  5IWA L;  4LFA L;  5JJL A;  1IL2 A;  2EY1 A;  1DOL A;  5JJK A;  2UXD Q;  1PYS B;  4RGM A;  4XXE A;  1CKN B;  1G29 1;  4FYD A;  1DOK A;  2E5L Q;  3S15 B;  3SK8 A;  3CC7 A;  3K7A B;  2R92 G;  2Z1C A;  4NKL A;  2A6H D;  4DV5 Q;  2JN4 A;  1MD2 D;  4ZUJ A;  4Y7N B;  4ZCK A;  4H44 C;  3X3N A;  4JI2 L;  2JEA I;  3GQB A;  5DEH A;  2N88 A;  4TVA B;  3G48 A;  5M3F H;  1GVP A;  4LFC L;  4PMC A;  1L1O C;  5EGT A;  4JI7 Q;  4H0L C;  1ILQ A;  2KCT A;  3PO3 B;  2YU9 B;  3TRE A;  1M8A A;  2OT2 A;  3NK9 A;  4CJ0 B;  1O7L A;  4DA2 A;  4V19 0;  4CDD C;  3MXN B;  1PA6 A;  1ET9 A;  1W6J A;  1DJR D;  2SDF A;  3P20 A;  4B08 A;  5IGC A;  4K5V A;  1PLF A;  1BBW A;  1EL0 A;  3CPW A;  3UDI A;  4NMZ A;  1PRT B;  2MGS A;  3A5U A;  1UE6 A;  4GS3 A;  3J7Y W;  1Y8N B;  4A3F B;  3D4D A;  1F2L A;  2D5D A;  1QIL A;  3BDL A;  1D2B A;  4GNX A;  1WTH A;  4LUV A;  2J7Z A;  2PZW A;  1KDB A;  1SYC A;  1T5E A;  3H6M A;  5HGQ A;  2F0I A;  5ELD A;  4PMB A;  4JI4 Q;  2R7Z B;  2WKD A;  5EKK A;  1U5K A;  2KHJ A;  2CQO A;  4YCW A;  2E2J B;  2FFK B;  4RGO S;  3HOU B;  3RUZ A;  1STB A;  3I4N G;  3QOJ A;  1HNX L;  5LMU L;  1V8Q A;  3RZO H;  4A93 B;  2C9O A;  4KD3 A;  1J5E Q;  3KDF A;  3NEN A;  2R7F A;  1MJC A;  3OWE B;  1VMP A;  1YHB A;  2Q8R E;  3K0Y A;  2R92 H;  4HSV A;  1B3A A;  1LTL A;  1VQL A;  4AQY L;  2WIN B;  2V1C C;  3NTH A;  2EYF A;  2F3W A;  1EYA A;  3CCL A;  3GV3 A;  1DGS A;  5C4X H;  2OTL A;  1K0S A;  1JIC A;  5EAY A;  2NWG A;  3PCO B;  4KJO A;  4JCV E;  4AIM A;  3HKZ E;  3J81 j;  1B70 B;  2NVY H;  3Q22 A;  4BBR B;  1B3Q A;  3NWS A;  4R4O A;  3S24 A;  4KHP Q;  4L6T B;  1PXU A;  5BN5 A;  2X69 A;  4GKJ Q;  2MHV A;  4APV A;  4A75 A;  3I2Z A;  4AYB G;  1T9H A;  3OW2 A;  1N34 Q;  3DUZ A;  1I4Q A;  2Z9H A;  4LWC A;  2EYP A;  3TBI B;  3VYT A;  4F88 A;  3K57 A;  2F4V L;  4X65 Q;  1L0W A;  2K1B A;  2MPM A;  1F2Y A;  2A1A A;  1TWH H;  2IT1 A;  1PV4 A;  3S1M H;  1PRT C;  4OXP A;  4OON A;  2R61 A;  1VQ5 A;  1K83 H;  3KF6 A;  3HEJ A;  5IGD A;  1PH2 A;  4QCL A;  2BE5 C;  4HIM A;  1FR3 A;  1EU4 A;  2Q2T A;  1Y1V G;  5IY0 A;  4R4T A;  2N49 A;  5KRU A;  3MEF A;  3MC0 B;  5J1Z A;  2F0M A;  4DAM A;  2K5N A;  1E3P A;  3N52 A;  5C0X J;  2KCN A;  5FLX E;  4FXK C;  1RCV D;  1EZ8 A;  3KBG A;  1UEA B;  2HUG A;  3AQQ A;  2KA7 A;  1G6Z A;  1LAB A;  1PZI D;  3J81 E;  2A68 D;  3I4N H;  4TRD A;  3FKI G;  3WOE A;  1BQQ T;  1PMR A;  3PUV A;  2CQA A;  3TDQ A;  2UXC Q;  5JEA J;  2R92 B;  1AEX A;  2VQE Q;  4DNI A;  2NVX B;  1O7Y A;  1X3P A;  2L55 A;  4LFB L;  2YV5 A;  4C2M H;  3F2D A;  2K28 A;  4B3R Q;  1E24 A;  1RIP A;  3TP7 A;  3U9S A;  1SMX A;  1QWY A;  4UHV A;  3C46 A;  1EFW A;  1SYB A;  2NZO A;  2MO1 A;  3LWE A;  3UDX A;  4DAP A;  1RKN A;  2JA6 G;  4JI6 L;  2VS1 A;  3S1N H;  3A7A B;  2B8G A;  3UDF A;  4QB4 A;  1I4G A;  2NVY B;  1W3S A;  5FO7 B;  2IX0 A;  1BBX C;  2ZJQ A;  5FLX c;  1IL8 A;  2F0H A;  2QIL A;  2JA8 G;  3J81 c;  2D0P A;  2JA5 G;  4UAI A;  2UXD L;  1QG7 A;  5JJZ A;  4N9T A;  1D5X C;  1YBY A;  1K8M A;  4G7Z C;  1TKW B;  1TWH B;  1S3O A;  2F0W A;  3S1M B;  2E5L L;  2EY5 A;  1SNO A;  2QGQ A;  4C1N I;  1LTT D;  1B8A A;  4ILW A;  4DV5 L;  3S2D B;  4NXM Q;  3NEM A;  4X62 Q;  3K5N A;  4RHR A;  1AZP A;  4ZRZ A;  1EOT A;  4PMW A;  1II3 A;  1Q3L A;  1IBK L;  4HID A;  5FOB B;  1Q90 A;  2DY8 A;  3D8G A;  3I4N B;  1QJO A;  1ZEQ X;  4DAV A;  1JT8 A;  2F3V A;  2OQ0 A;  4YY3 Q;  1B4O A;  1KL9 A;  3FMC A;  5D14 A;  3BZD B;  3CRL C;  2RVL A;  5COY A;  2ZJR A;  1KIX A;  2KOL A;  3U58 A;  1QVG A;  3BG3 A;  2R3Z A;  3PIP A;  3I4M G;  4DNT B;  2QF7 A;  2JP1 A;  3VA5 A;  2L9H A;  4GN4 B;  3TN2 A;  3V2T A;  2DNE A;  1PZK D;  4MN3 A;  1F2Z A;  3W3A A;  4C2M B;  3OOC A;  4F8M A;  4XYO A;  1XTC D;  1SAP A;  1EWC A;  1Y8O B;  4Q0F A;  5I9P A;  5FLX L;  2I5M X;  4KKU A;  4IUR A;  3EQL C;  2BOS A;  2NUC A;  2JA6 H;  3J81 L;  2DNC A;  5GAH C;  4JI4 L;  3HGB A;  4PZ6 A;  5CV9 A;  3H09 A;  1AP0 A;  5HUR A;  4M8A A;  2EPB A;  2VUM G;  4NPS A;  3ERS X;  1XXG A;  5IGE A;  3M4O H;  3NXW A;  1QZH A;  2JA8 H;  2N3S A;  4AYB B;  4IUP A;  3I55 A;  2VB2 X;  1LUZ A;  1IBM L;  4TQU S;  1HZC A;  3J7A V;  2M2L A;  2JA5 H;  1KXL A;  4NP5 A;  2VQF L;  2F0P A;  2E74 C;  4IUN A;  4HED A;  3OPO A;  1STE A;  4XQQ A;  2IY5 B;  1Y1V B;  1Q8I A;  4C3H H;  1KHI A;  3S17 B;  1EUJ A;  1U9R A;  2XTI A;  2B8F A;  1Z47 A;  4JK1 C;  1MBY A;  2Q2I A;  1HNZ Q;  1TXY A;  3CMA A;  3C1E A;  2KBN A;  2M00 A;  4K8J A;  5J3B A;  2A8V A;  1HUM A;  3VR2 A;  5M5X H;  4IPD A;  4LF7 Q;  4GLA C;  1CTM A;  4MNO A;  4DUZ Q;  4JYA L;  4FF1 A;  1CQF A;  1C48 A;  2PI2 E;  4KHP L;  2K03 A;  2NBF A;  1D8L A;  2NZH A;  5IOC A;  2VY3 A;  4GKJ L;  1EY5 A;  2CCZ A;  4B3M Q;  3HOW G;  1LT4 D;  5E4W C;  1X3G A;  1N34 L;  2BDN A;  3SK5 A;  4EQP A;  4YHH Q;  1EFI D;  1VQI A;  1SFO H;  2DJF C;  1LT5 D;  1VQ6 A;  4LNQ A;  5DLQ E;  4X65 L;  5BR8 Q;  2I0Q A;  3CCV A;  2BA1 A;  4X66 Q;  4IPG A;  3T1Y Q;  2V4D A;  3BZC A;  2JA6 B;  1EQV A;  2A6E D;  3AFP A;  4CGY B;  2K5Q A;  3ULP A;  5IOD A;  2QDL A;  3ND9 A;  1G51 A;  2K4K A;  2O5J C;  3H91 A;  4NW2 A;  2RKS A;  4XIG S;  4A3L G;  3TP6 A;  4BY7 H;  1RF2 D;  4K14 A;  4R4Q A;  2ZXP A;  3M4O B;  4RKB A;  4DPG A;  2JA8 B;  4A4I A;  4YCU A;  1A3T A;  2A69 C;  2JA5 B;  3IFD A;  5IP9 H;  5IP7 H;  4NDX A;  3GTJ B;  5G3L F;  1XPO A;  3ND8 A;  1V9P A;  4BY1 H;  2UXC L;  2VQE L;  3K0X A;  4JI5 Q;  4PNY A;  3NPP A;  1YZ6 A;  5GAE C;  1HTL D;  2KEN A;  1ICW A;  2Z0S A;  1CK1 A;  2CFM A;  3U4Z A;  3CF5 A;  3MEH A;  4B3R L;  1CZG A;  1ET6 A;  4DFA A;  4KN7 C;  1LTB D;  2L5T A;  3MXP A;  4JV5 L;  1IW7 C;  2QCP X;  2F4I A;  5KNB A;  1B1Z A;  3A0J A;  1SEB D;  1SYD A;  3BU2 A;  3I7F A;  1J9O A;  3EJI A;  1AE3 A;  2EY6 A;  4N9P A;  1KRT A;  3G7L A;  3F2C A;  3DMU A;  1N36 Q;  3H3V I;  3K58 A;  3I4M B;  5I4D A;  1S4Z A;  1EIG A;  3S2H H;  5DAU A;  1ASY A;  2I5L X;  4LMQ D;  1SFO B;  1LTI D;  1Q46 A;  2F0T A;  4RGN A;  3QB3 A;  4A3E G;  3FPP A;  4JOI C;  4MZ9 A;  4GOP A;  1Y1W H;  1DCZ A;  2J4X A;  4J15 A;  4QIW B;  1EYC A;  5M9O A;  2RDG A;  1H9R A;  2GVB A;  4GNX B;  2EY2 A;  4K0K Q;  2FMM A;  4CKC A;  1JJ2 A;  4NXM L;  4X62 L;  4HMI A;  3HFZ B;  4XQN A;  1L0X B;  1EQR A;  1EQQ A;  1E2Z A;  2VUM B;  1YVC A;  2LY7 A;  1NUC A;  1MGS A;  2K75 A;  1JMC A;  3OTO L;  2Q8I B;  3VYR A;  3S14 B;  1H95 A;  3OW7 A;  2I5H A;  1RDP D;  2AQ2 B;  1U4P A;  4EX5 A;  4PG3 A;  1K0R A;  4JI3 Q;  3KDF B;  3IKJ A;  1K9M C;  1BCP F;  4HTH A;  2LFN A;  3URY A;  3K7U C;  3KF8 B;  4YWL A;  1CHQ D;  1ASZ A;  4LUO A;  3K7A H;  2F0E A;  2SEB D;  2Z6K A;  1SYF A;  2VZA A;  1K3B C;  1TS5 A;  4Y7N H;  5IYC G;  4BBS G;  1PRT F;  4FDB A;  4I7Z C;  2ENB A;  4FNF A;  3AU7 A;  3OMG A;  4DR2 L;  1KAW A;  1UNS A;  4HCS A;  2NN6 H;  2K5W A;  4WRD A;  3TSS A;  1HRJ A;  3PO3 H;  2YU9 H;  3SK6 A;  2L15 A;  3F2U A;  1YI2 A;  1YNJ C;  1MKH A;  1O80 A;  2HCI A;  5LMN L;  3S2H B;  2RF4 A;  2PMZ B;  4C3J G;  3I56 A;  3PUW A;  4OIK A;  1A0I A;  3HOW B;  4PV1 C;  1G8Z D;  2EOT A;  2DUD A;  4P75 A;  1B9N A;  1P8L A;  2PZT A;  1HA6 A;  4R9W A;  5AJ3 Q;  1SXT A;  4HJA A;  2AKW B;  4AYB E;  3E6Z X;  3KF6 B;  1X3Q A;  1VQM A;  3I4L A;  4FP5 D;  1E22 A;  1KDC A;  2KVM A;  3GDE A;  4C3I G;  4GKK Q;  4A76 A;  2UUA Q;  1KQS A;  1PYB A;  3GTO H;  3E9H A;  2WAQ G;  1A3U A;  2R7Z H;  1MHW C;  3AYH B;  1DOM A;  3I91 A;  1RD9 D;  1GUS A;  5FO9 B;  1RHP A;  3TME A;  2F0S A;  4LF7 L;  4RGT A;  4QJF A;  4RKL A;  5EPK A;  4YWM A;  2ASB A;  2ES2 A;  1GUN A;  4DKA C;  4A93 H;  3OSO A;  1HZ9 A;  2KHI A;  4HJ5 A;  1H9M A;  1RTN A;  5A2Q E;  4B3S Q;  2K32 A;  4B3M L;  1H9J A;  1OTC A;  1DON A;  1BKB A;  4ULL A;  4YHH L;  4LF5 Q;  4IUV A;  2H1E A;  4A3B G;  3S9W A;  4I65 A;  1PTO F;  2F52 A;  1HXY D;  5IYC H;  1HFG A;  2BCO A;  1SR3 A;  1Q86 C;  3E3X A;  3T1Y L;  4OEL B;  5D3I B;  3I8Z A;  3T1H Q;  3TS0 A;  1B50 A;  1JWS D;  4DXF A;  5EJW A;  3SK4 A;  1WJJ A;  1BXT A;  5J22 A;  4BBR H;  1ESR A;  1LTG D;  5CBA E;  3QOL A;  4L5T A;  2B2V C;  2NYZ D;  1S5B D;  3G6E A;  5CV8 A;  2B2U A;  1N8R C;  5IYB H;  4A3E B;  2WKC A;  1JOQ A;  1I4P A;  1XYI A;  1ZXT A;  1JWU D;  2EQS A;  4DV7 Q;  1HNW Q;  1QUQ A;  3UE1 A;  3M7N A;  4KI0 A;  4JI5 L;  1BBU A;  1TY0 A;  3FPU B;  5DM6 3;  1QNU A;  3HKS A;  2P5Z X;  1IBL Q;  5C3X A;  1WTW A;  2F0D A;  3GD7 A;  3A54 A;  1NAP A;  3A8K E;  3GTO B;  1N32 Q;  3D31 A;  4K8I A;  1TS4 A;  2A6H C;  2R93 H;  5IIF A;  1GM5 A;  4IJL A;  3IFT A;  5I2X A;  1EY6 A;  4LJZ C;  2K33 A;  1PH6 A;  1OXS C;  5BN4 A;  2L11 A;  4OX9 Q;  1NY4 A;  4IZ8 A;  4DV2 L;  4KHZ A;  3RMH A;  2CWA A;  2CKZ B;  4DR6 Q;  3J7Z C;  3VYS A;  2O2L D;  1SE3 A;  5I6W A;  1HFN A;  1N36 L;  3J80 i;  3UI2 A;  1HQM C;  1BCP D;  4CKB A;  4JI0 Q;  2FMC A;  3MVV A;  1IKL A;  3ONA B;  4PQX A;  4K6D A;  3BZK A;  2B2W C;  4FF4 A;  2NVX H;  2Z4H A;  1CKO A;  1TII D;  3CP0 A;  4ZYS A;  4J6H A;  3NE5 B;  1JQY D;  1P16 A;  2B39 A;  3MFY A;  1EYD A;  4GN3 B;  4QIW E;  3NEL A;  4V0B A;  3RLF A;  1HR0 L;  1Q1B A;  4CKE A;  4DR7 Q;  1C4Q A;  1UE7 A;  1H9S A;  1WYD A;  1HQR D;  3UDG A;  3IAY A;  2EYM A;  3GTK H;  2QA4 A;  3NP8 A;  3H0G G;  1L1O A;  1G6P A;  4X3T A;  1U4L A;  1EIY B;  2FIN B;  4EVO A;  4LF8 L;  4JBM A;  2JSO A;  3Q8D A;  1IXR A;  2RHQ B;  3A56 A;  3CCU A;  2BH2 A;  2HDM A;  4G4K A;  1VQJ A;  4GN5 A;  4A3D G;  3C1F A;  1STG A;  4CDC C;  1GUG A;  3PGZ A;  3S2D H;  4C3I B;  2BH8 A;  4PZ7 A;  2R93 B;  3BYY B;  4R8I A;  4OGQ C;  2JA7 G;  3VYU A;  2WAQ B;  4B9X A;  1AN8 A;  4POG A;  1SRO A;  1NNX A;  3ERQ A;  3OWF A;  2AUK A;  3CCR A;  1NJI C;  1EWH A;  4ZAI A;  2WB1 G;  2EYH A;  5KND A;  3AB9 A;  3I70 A;  4NXN L;  3K80 C;  3CW2 C;  1K8G A;  3QIA A;  5GQO A;  4LAA A;  3DM1 A;  3EFX D;  3D6W A;  3I73 A;  3L9A X;  2A73 B;  3MZ5 A;  3PMF A;  4A3B B;  4CJ1 B;  1UEB A;  2PMZ E;  5AJ3 L;  2IL8 A;  4WJW A;  5EQ0 A;  3T53 B;  1PTO D;  4S3S A;  1SDF A;  2VL6 A;  2IW3 A;  1ICF B;  1NBW A;  2F0V A;  3T4A C;  1DXM A;  2RA4 A;  4GKK L;  1F9Q A;  2DN8 A;  5IE8 A;  3RN5 A;  3GTK B;  1LT3 D;  1E1O A;  1PH5 A;  1SN8 A;  4BA2 I;  3E9I A;  5EBC A;  2RDF A;  4DV0 Q;  5IGG A;  3H0G H;  1FJG Q;  1SE2 A;  3KOJ A;  3NSW A;  3DWP A;  4RA8 A;  2HQE A;  4WOR A;  1BF4 A;  1EY7 A;  4A3J G;  4BA1 I;  1WTP A;  1A63 A;  2A68 C;  1I94 Q;  2D0O A;  2B29 A;  1Q8K A;  4B3S L;  4KK7 A;  4A3D H;  1PYW D;  3S1R B;  1WI5 A;  4LF5 L;  5KNC A;  4DV1 Q;  1WTO A;  3FEW X;  1D5Z C;  2KCC A;  1Y1V H;  4KKS A;  2PNH A;  4JW0 A;  5LHY 1;  1CHP D;  3KLS X;  4O42 A;  3S17 H;  2JA7 H;  1X54 A;  3PQI A;  3ICE A;  4CBV A;  3T1H L;  1HCZ A;  4JI7 L;  1TWC B;  1A6X A;  3MFG A;  5C44 G;  5K36 G;  1JOK A;  3JAM i;  1GJX A;  3FKI H;  2CVR A;  1B53 A;  3MXU A;  1D1K A;  1EZ6 A;  2HHH Q;  4MHE A;  1I3Q H;  1HH2 P;  2GA4 B;  2I46 A;  5A35 A;  2E76 C;  5KEE A;  1JC7 A;  4G57 A;  1FGB D;  1B2T A;  5M5W H;  4RAU C;  1WTR A;  1Q82 C;  4DV7 L;  2EYL A;  4GOP B;  4DR4 Q;  1CUK A;  1HNW L;  1S5F D;  5E4X A;  2EIF A;  1M90 C;  3T16 A;  3CC4 A;  3N6R A;  1E1T A;  2N55 A;  3PIP 3;  2QKI C;  3G6J B;  1A2T A;  2R6G A;  3C2P A;  3A74 A;  1PH1 A;  5FKA C;  1IBL L;  1ENA A;  3WOF A;  3TP5 A;  1F77 A;  4RHS A;  1N32 L;  4P71 A;  1HPC A;  3U9O A;  3DM3 A;  1E7Z A;  4QMG A;  1XNR Q;  1X9N A;  3H0G B;  4JVZ A;  1XJV A;  3W5O A;  5I2Y A;  4DR5 Q;  4OX9 L;  2M9V A;  2RSO A;  3NHH A;  2ICE C;  1A3V A;  4YWK A;  1QOH A;  1MSG A;  1Q12 A;  1J5E L;  1YHQ A;  4UP9 A;  1S72 A;  5C4Z A;  4JI8 Q;  1YNX A;  3GTJ H;  4A3D B;  4JI0 L;  2B2Y C;  5C0X G;  4LUZ A;  2I07 B;  2B2T C;  2GVA A;  2LKV A;  3PIO A;  3GTP H;  4WJ3 M;  2F0U A;  4G7O C;  2IJ0 A;  1V43 A;  2JA7 B;  4ODG A;  3CRK C;  1UAP A;  3MA2 B;  1SMY D;  3HOX G;  4FF3 A;  1A8V A;  2G5D A;  2ZTC A;  1OXT A;  4XTC S;  2EYJ A;  5JEA G;  3P7J A;  1JB7 A;  5ELE A;  3FKI B;  5ELO A;  2DGY A;  2WB1 B;  1C8C A;  3R93 A;  4DR7 L;  3PSI A;  5C44 H;  5K36 H;  1I3Q B;  3WDN A;  4UP8 A;  1RJT A;  1PHJ A;  2D62 A;  2BA0 A;  1MSH A;  3I4M H;  1EOV A;  2L1B A;  3PUY A;  5M5W B;  4O0A A;  2AWO A;  1XNQ Q;  5C0X I;  4X64 Q;  4DGZ A;  4L63 B;  3BYT B;  4LFA Q;  5CV7 A;  1JJG A;  3CPF A;  3RZD B;  1NCV A;  1PH4 A;  4IN3 A;  4IO9 A;  1ENC A;  1U4M A;  5M3M G;  1JCK B;  3EVQ A;  4IAL A;  4BS9 A;  1YNN D;  3SDZ A;  2KEE A;  1QZG A;  2LS0 1;  1D7Q A;  2VUM H;  3MXG A;  5ELN A;  5FJ8 G;  2ALY B;  3S14 H;  2RBM A;  2WAQ E;  3I72 A;  4JC0 A;  4KLK A;  2EXZ A;  3TZD A;  4A3J B;  1EQT A;  1QCB D;  4X3U A;  2KUM A;  4EQO A;  3GTP B;  5KGU A;  1VQ8 A;  2C5C A;  1KC8 C;  1VQG A;  5CMD A;  1TS3 A;  1SNQ A;  2PW7 A;  4F7X A;  4ZLT F;  3FRP B;  2ZM6 Q;  4QL5 A;  1EU3 A;  1B44 D;  4KHV A;  5I6Y A;  1Q7Y C;  2EVB A;  1XTD A;  4OWW B;  1JOO A;  1F9P A;  2IX1 A;  3OIQ A;  1JB3 A;  3RD4 A;  2CH4 A;  3D3R A;  4G7H C;  1RL2 A;  1WOC A;  4KMU C;  3PUZ A;  3QG1 A;  5C44 B;  1SE8 A;  2EXD A;  2Z8L A;  2EJM A;  5E3F A;  1PFN A;  2A6E C;  5KYI A;  4ALP A;  3DHQ A;  1XMQ Q;  4RWS C;  1E2W A;  4ZQ3 A;  1HZA A;  4O2D A;  1WCM G;  1SRU A;  4P73 A;  3GO5 A;  4DV0 L;  5FLM G;  3HG9 A;  3OYY A;  4DAY A;  3HOW H;  2F0O A;  4JG2 A;  4NB3 A;  5C5M A;  3STB D;  3S16 B;  3KYH C;  2O5I C;  4RCO A;  4ZUI A;  3HZX A;  5T1I A;  5LMU Q;  1I94 L;  3V96 A;  1QUQ B;  3SVM A;  1VQ4 A;  3A8J E;  3BS1 A;  1IKM A;  1KLU D;  3TS2 A;  3TRZ A;  2KQ3 A;  4DV1 L;  5M3M H;  4IOC A;  1DZ1 A;  2EZV A;  4A3I G;  2Q8T A;  1D5M C;  3ZYY X;  1SSO A;  1U4R A;  4A3L H;  2LMC B;  5TSS A;  2CW0 D;  1H9K A;  1V1P A;  4R1J A;  4XT1 B;  5FJ8 H;  1GUT A;  5HGT A;  3U50 C;  4Q5V A;  4DV4 Q;  1PFM A;  4YY3 L;  2MNA A;  4QF4 A;  3H3V H;  2K05 A;  1FYC A;  1S40 A;  1TVX A;  5I9O A;  1JE4 A;  1ENF A;  4Z9C B;  5CC4 A;  2HHH L;  1DD2 A;  2JEB I;  3EIV A;  3LGJ A;  3W2D A;  5JOB A;  3MAQ A;  1MIU A;  4IFD G;  1X6O A;  3MTS A;  3KUP A;  2NTT A;  1C7Y A;  4A3C G;  1ZYR D;  3CAM A;  3DWQ A;  4QUF A;  3L0O A;  3M9B A;  1TS2 A;  4OO1 G;  2OTJ A;  1LLR D;  4X3S A;  3STB C;  4IPH A;  3HOX B;  1GD7 A;  1CQV A;  3SE0 A;  4ZK9 B;  3MHB A;  5LMN W;  1TWF B;  1ONL A;  5DNF A;  3R8B A;  5GRO A;  1GKH A; 
#chains in the Genus database with same CATH homology
 3CD6 A;  2D0P A;  3J7Z C;  2JA5 G;  4DR6 Q;  2K5H A;  2UXD L;  1Y1W G;  1N36 L;  3J80 i;  1YBY A;  4JI2 Q;  2KCM A;  1S3O A;  1XNR L;  1OXU A;  1Q81 C;  2E5L L;  2K50 A;  5M3F G;  4JI0 Q;  2QGQ A;  4MTN A;  1WCM H;  4IJH A;  3FHW A;  4DR5 L;  4JBW A;  3L2P A;  1B8A A;  3CXC A;  1R9T H;  4DV5 L;  4LFC Q;  3BZK A;  4NXM Q;  4A3K G;  3NEM A;  1N9W A;  4X62 Q;  2NVX H;  1QVF A;  4IFD I;  4A3E H;  2IHE A;  2K14 A;  4P74 A;  1I50 H;  1J6Q A;  4JI8 L;  1CKO A;  2RHS B;  4PMW A;  3CP0 A;  3SGI A;  4OO1 I;  3TEH B;  1IBK L;  4HID A;  4Y52 H;  1KD1 C;  2E2H H;  1P16 A;  1X3F A;  4DR1 Q;  4GN3 B;  2B63 H;  4JOI A;  4QIW E;  3NEL A;  3RLF A;  1XPR A;  4GNX C;  1Q1B A;  3ULL A;  1HR0 L;  2Z6K C;  4DR7 Q;  2OQ0 A;  4YY3 Q;  1JT8 A;  1UE7 A;  3CCS A;  1KL9 A;  1WYD A;  3UDG A;  2ZJR A;  1KIX A;  1HNZ L;  3U58 A;  3CCJ A;  3EN2 A;  2QA4 A;  1QVG A;  3GTK H;  3KJP A;  3HOX H;  3H0G G;  3PIP A;  3K8A A;  3I4M G;  1L1O A;  1G6P A;  1YJW A;  4JBJ A;  4GN4 B;  4ME3 A;  2VNU D;  1EIY B;  1TWF H;  3CCM A;  1IZ6 A;  1GKH A;  3L7Z C;  4LF6 Q;  4DUY Q;  4LF8 L;  4DUZ L;  4JBM A;  3KFU A;  2JE6 I;  2JJQ A;  3Q8D A;  4LF9 Q;  1IXR A;  1YHA A;  2WFW A;  3CQZ H;  2RHQ B;  3K81 C;  3CCU A;  2BH2 A;  2ZTD A;  1FVI A;  1VQJ A;  4GN5 A;  2WB1 E;  1FJG L;  3HOZ H;  1K8A C;  4A3D G;  1IYJ B;  3PF4 A;  3F2B A;  4LW1 A;  2OWO A;  2I5M X;  3W1B A;  5C4J H;  1A62 A;  2AHO B;  2NN6 G;  3PGZ A;  3CCE A;  3S2D H;  4A3C H;  2XGT A;  2JA6 H;  3GTM H;  4UPA A;  2BH8 A;  3W1G A;  4PZ7 A;  4DV2 Q;  1HNX Q;  3PO3 G;  5GAH C;  1SLJ A;  5BR8 L;  4JI4 L;  4PZ6 A;  3RNU A;  4BBS H;  2JA7 G;  4X66 L;  4DV3 Q;  2VUM G;  4POG A;  4NPS A;  3ERS X;  1SRO A;  4PZ8 A;  1PH3 A;  3S1Q H;  2LXJ A;  1TWG H;  3M4O H;  3GTG H;  1QZH A;  2JA8 H;  2N3S A;  3CCR A;  2CWP A;  3J80 c;  4JI1 Q;  1NJI C;  3I55 A;  1LUZ A;  1IBM L;  2WB1 G;  4TQU S;  1HZC A;  4X6A H;  4AQY Q;  2JA5 H;  1K73 C;  3GTL H;  4NXN L;  3K80 C;  1KXL A;  3CW2 C;  1K8G A;  2JQO A;  2UUB L;  2VQF L;  1U0L A;  4EQ5 A;  4RG1 A;  5GQO A;  3JC6 6;  1V1Q A;  4C3J H;  1B7Y B;  1IBK Q;  5C4X G;  2FXQ A;  4A3F G;  4L5R C;  2IY5 B;  2H5X A;  1NMG A;  3G71 A;  4A3K H;  2Q2U A;  1UEB A;  2PMZ E;  2NN6 I;  4C3H H;  1KHI A;  5AJ3 L;  1HR0 Q;  2WP8 J;  3GTQ H;  1EUJ A;  2R7Z G;  3M3Y H;  1HZB A;  3DLL A;  2XTI A;  4LF4 L;  1Z47 A;  2VL6 A;  2YTV A;  3AEV A;  2Q2I A;  4IPC A;  1HNZ Q;  1NBW A;  3U4V A;  1TXY A;  3CMA A;  1YJ9 A;  3HOU G;  2KBN A;  1UE5 A;  5J3B A;  4GKK L;  2A8V A;  4DR4 L;  2ZM6 L;  1NE3 A;  5M5X H;  2F3I A;  4IPD A;  4C3I H;  4H02 A;  4GLX A;  4GLA C;  4LF7 Q;  4A93 G;  5IE8 A;  2OQK A;  3RN5 A;  4LF8 Q;  4MNO A;  4DUZ Q;  4JYA L;  2F4V Q;  1X56 A;  1E1O A;  2PI2 E;  4KHP L;  2UU9 L;  1PH5 A;  1CSP A;  4DV6 L;  1SN8 A;  4BA2 I;  1D8L A;  3E9I A;  2ID0 A;  2NZH A;  1PFS A;  2VY3 A;  4DV0 Q;  1FJG Q;  3H0G H;  1VS0 A;  4GKJ L;  2CCZ A;  2HQL A;  3VDY A;  4B3M Q;  3HOW G;  3S15 H;  1VCI A;  1I5F A;  3KOJ A;  1X3G A;  1N34 L;  1N33 L;  4YHH Q;  1Z9F A;  1VQI A;  1SFO H;  1XMQ L;  1VQ6 A;  4LNQ A;  5DLQ E;  4X65 L;  4A3J G;  4BA1 I;  1A63 A;  1PVO A;  1I94 Q;  5BR8 Q;  2I0Q A;  1L1O B;  1EIF A;  1WFQ A;  2B29 A;  2BA1 A;  2D0O A;  4X66 Q;  1Q8K A;  4IPG A;  3F1Z A;  3M85 A;  3T1Y Q;  4B3S L;  2C35 B;  4DK6 C;  4A3D H;  1VQB A;  5FLM H;  1AE2 A;  3BZC A;  1UE1 A;  5IYD G;  4HJ9 A;  2ZJP A;  3AFP A;  1WI5 A;  3G4S A;  1VQO A;  3H15 A;  2GN5 A;  4LF5 L;  3E0E A;  2PQA B;  4DV1 Q;  1VQD A;  3ULP A;  1VQA A;  2B3G A;  1CKM A;  1G51 A;  2K4K A;  2YTX A;  4A3B H;  1Y1V H;  1IBM Q;  2PNH A;  1HR0 W;  1PH9 A;  4XIG S;  4A3L G;  3ZJY C;  3S17 H;  3F8T A;  4BY7 H;  2JA7 H;  1X54 A;  4HJ8 A;  3RLO A;  4NXN Q;  4BBR G;  4R4Q A;  3ICE A;  1KRS A;  4DPG A;  4K0K L;  3T1H L;  4DR3 L;  4A4I A;  4YCU A;  2VQF Q;  4JI7 L;  1BVS A;  2ATW A;  3I4O A;  1VQF A;  1X55 A;  3CME A;  4P72 A;  5IYB G;  5C44 G;  5K36 G;  3JAM i;  1VQ9 A;  3FKI H;  5IP9 H;  4A3I H;  5HY6 A;  4LFB Q;  5IP7 H;  5H1S E;  2HHH Q;  2NVQ H;  1I3Q H;  1HH2 P;  1XPO A;  4DK3 C;  1AH9 A;  1JJC B;  2N8N A;  3CCQ A;  1Q1E A;  1V9P A;  4A3M G;  1QVC A;  3KJO A;  4BY1 H;  3M4Q A;  2UXC L;  4QQB X;  1CSQ A;  2VQE L;  1FL0 A;  1C9O A;  3K0X A;  2E8G A;  1Y14 B;  3NBH B;  4OWX B;  4UP7 A;  4DV4 L;  1XMO L;  1VQ7 A;  1YZ6 A;  5GAE C;  4JI5 Q;  4AH6 A;  4A3F H;  2HT1 A;  4WJ4 A;  4JI3 L;  5M5W H;  2UUC L;  2KEN A;  4JI6 Q;  1Q82 C;  3D0F A;  2Z0S A;  2PQA A;  2CFM A;  3U4Z A;  3CF5 A;  4DV7 L;  4GOP B;  5JJI A;  4DR4 Q;  1CUK A;  4GLV B;  4UY8 C;  4B3R L;  1HNW L;  2R93 G;  1EWI A;  3CC2 A;  2EIF A;  1M90 C;  1FGU A;  3CC4 A;  4JYA Q;  1VQK A;  2AWN A;  1X3E A;  1E1T A;  4JV5 L;  2UXB Q;  4JBK A;  4POF A;  1XNQ L;  4X64 L;  4OWT B;  4B3T L;  3A0J A;  2R6G A;  3UE0 A;  3S1R H;  1NMF A;  3A74 A;  3BU2 A;  3I7F A;  1PH1 A;  1IBL L;  2E2J H;  3HOU H;  5IWA L;  2MFI A;  4LFA L;  1N32 L;  4P71 A;  5JJL A;  1IL2 A;  1AE3 A;  1KRT A;  3F2C A;  5JJK A;  2UXD Q;  1PYS B;  1E7Z A;  3DM3 A;  1N36 Q;  3H3V I;  1CKN B;  1G29 1;  1XNR Q;  1X9N A;  2NVT H;  2E5L Q;  1XJV A;  3W5O A;  3CC7 A;  4DR5 Q;  4OX9 L;  3S2H H;  2R92 G;  1TWC H;  1ASY A;  2I5L X;  4DV5 Q;  3BJU A;  1Q46 A;  4YWK A;  1Q12 A;  4A3E G;  1J5E L;  3HOV G;  4JOI C;  1YHQ A;  4UP9 A;  4MZ9 A;  1S72 A;  4GOP A;  1Y1W H;  4JI2 L;  4QY7 A;  4JI8 Q;  2JEA I;  4J15 A;  1YNX A;  3GTJ H;  4JI0 L;  2OCE A;  4TVA B;  5C0X G;  3G48 A;  5M3F H;  4LUZ A;  2GVA A;  1UWV A;  1GVP A;  3PIO A;  4LFC L;  2GVB A;  4GNX B;  1MJE A;  1VQP A;  3GTP H;  1JJ2 A;  4NXM L;  4K0K Q;  1L1O C;  4WJ3 M;  4X62 L;  5IYD H;  4JI7 Q;  3HFZ B;  1PH7 A;  1OXX K;  2KCT A;  2Y0S E;  3A5Z B;  3TRE A;  1EQR A;  1V43 A;  1EQQ A;  4R4C A;  1YVC A;  2K5V A;  1CKN A;  4QGU A;  3MXN B;  3HOX G;  1A8V A;  2ZTC A;  1OXT A;  2K75 A;  3JAM c;  4XTC S;  4DR1 L;  1PA6 A;  1JMC A;  3OTO L;  5JEA G;  1VQE A;  4BXX G;  2UUA L;  1H95 A;  1JB7 A;  5ELO A;  2I5H A;  2DGY A;  4EX5 A;  4DR7 L;  3PSI A;  5C44 H;  4PG3 A;  1K0R A;  4JI3 Q;  1BBW A;  3KDF B;  3AFQ A;  3UDI A;  3CPW A;  1K9M C;  2HIV A;  4UP8 A;  1PHJ A;  1XPU A;  3A5U A;  2D62 A;  2N78 A;  1L2F A;  2BA0 A;  3K7U C;  1UE6 A;  3KF8 B;  4YWL A;  2ZTE A;  4GS3 A;  3KLW A;  1OXV A;  1EOV A;  4A3M H;  3I4M H;  3PUY A;  4JV5 Q;  1O7I A;  4LUO A;  3K7A H;  4LUV A;  2AWO A;  4O0A A;  4GNX A;  5C0X I;  1ASZ A;  2Z6K A;  4X64 Q;  2VZA A;  4DUY L;  4LF6 L;  1XNQ Q;  5HGQ A;  3HOY G;  4LF9 L;  4Y7N H;  5IYC G;  4BBS G;  4HIO A;  4LFA Q;  4JI4 Q;  2MO0 A;  5GAD C;  4FDB A;  3PF5 A;  1JJG A;  3CPF A;  5GAG C;  1PH4 A;  1U5K A;  2KHJ A;  2CQO A;  4YCW A;  5IT9 c;  4IO9 A;  4DR2 L;  1KAW A;  5M3M G;  3I4N G;  1M1K C;  2K52 A;  1HNX L;  5LMU L;  3RZO H;  4L5Q A;  3PO3 H;  2YU9 H;  2L15 A;  1YI2 A;  1MKH A;  1QZG A;  1J5E Q;  3KDF A;  3NEN A;  5C3E G;  2HIX A;  4DV3 L;  2R7F A;  1D7Q A;  5LMN L;  1EYG A;  2UUB Q;  1MJC A;  2VUM H;  4IOA A;  5ELN A;  1NTG A;  1YHB A;  2RF4 A;  5FJ8 G;  2ALY B;  3I56 A;  3PUW A;  1A0I A;  3S14 H;  2WAQ E;  4JI1 L;  4R4I A;  1I6H H;  2R92 H;  2DUD A;  4JC0 A;  4KLK A;  3RR5 A;  1LTL A;  1VQL A;  4P75 A;  4AQY L;  1P8L A;  3HOV H;  2V1C C;  5AJ3 Q;  2Q2H A;  2AKW B;  4HJA A;  4AYB E;  3CCL A;  1YIT A;  4LF4 Q;  3ER0 A;  1DGS A;  3KF6 B;  4DAY B;  1TWA H;  5C4X H;  1KC8 C;  3ULJ A;  1VQ8 A;  2OTL A;  1VQG A;  1VQM A;  2VW9 A;  1E22 A;  3OTO Q;  5EAY A;  3PCO B;  4HIK A;  3GDE A;  4GKK Q;  4A76 A;  2UUA Q;  2ZM6 Q;  1KQS A;  4QL5 A;  3IRB A;  1PYB A;  4A3G G;  4JCV E;  4AIM A;  3HKZ E;  1Q7Y C;  3GTO H;  3E9H A;  3J81 j;  1XTD A;  2WAQ G;  4OWW B;  1B70 B;  2NVY H;  2IX1 A;  2R7Z H;  3AYH B;  4KHP Q;  4R4O A;  2UU9 Q;  3S24 A;  4DV6 Q;  3RZD H;  3J7A 5;  1RL2 A;  1WOC A;  4YCV A;  3RLN A;  3PUZ A;  2R7D A;  5M5Y H;  4GKJ Q;  2RCN A;  4APV A;  3PO2 G;  4A75 A;  1SE8 A;  2EXD A;  4BXX H;  3I2Z A;  4AYB G;  1T9H A;  3OW2 A;  4LF7 L;  1N34 Q;  4QJF A;  4YWM A;  4LWC A;  1N33 Q;  1YJN A;  2ES2 A;  2ASB A;  4DKA C;  4ALP A;  1PH8 A;  2F4V L;  1XMQ Q;  4A93 H;  3J81 i;  4X65 Q;  1HZ9 A;  1C0A A;  2KHI A;  1L0W A;  4HJ5 A;  1HZA A;  4O2D A;  1WCM G;  1SRU A;  2IHF A;  2A1A A;  4P73 A;  1TWH H;  2IT1 A;  3GO5 A;  4DV0 L;  1PV4 A;  3S1M H;  5FLM G;  4B3S Q;  4OXP A;  4OON A;  4B3M L;  1VQ5 A;  3OYY A;  1K83 H;  3KF6 A;  3HKZ G;  1BKB A;  1PH2 A;  1OTC A;  3HOW H;  4JG2 A;  4NB3 A;  4DR2 Q;  4DR6 L;  4YHH L;  4HIM A;  2PI2 A;  4LF5 Q;  3STB D;  3HOY H;  4A3B G;  1LM0 A;  3KYH C;  2Q2T A;  1Y1V G;  5IY0 A;  4R4T A;  5LMU Q;  2N49 A;  2F52 A;  1I94 L;  2MQH A;  4A3J H;  1QUQ B;  1VQ4 A;  3MEF A;  5IYC H;  4BY7 G;  1SR3 A;  4DAM A;  2K5N A;  1Q86 C;  1E3P A;  3T1Y L;  2E2I H;  5C0X J;  2LSS A;  5LMN Q;  3T1H Q;  3AQQ A;  4DR3 Q;  3TS0 A;  2B63 G;  3TS2 A;  3TRZ A;  4DV1 L;  5M3M H;  3I4N H;  1VQH A;  4IOC A;  3CCV A;  2JK8 A;  3FKI G;  5IP9 G;  4A3I G;  5IP7 G;  2JA9 A;  3PV0 A;  2YYZ A;  2QEX A;  4A3L H;  1WJJ A;  1X65 A;  3FP9 A;  5C3E H;  4BBR H;  4BY1 G;  4R1J A;  3PUV A;  4L5T A;  3TQY A;  4L5S A;  2UXC Q;  5JEA J;  3G6E A;  5FJ8 H;  4DNI A;  2VQE Q;  4HJ7 A;  1W2B A;  3U50 C;  1XMO Q;  4DV4 Q;  1N8R C;  4YY3 L;  5IYB H;  2MNA A;  3H3V H;  2UUC Q;  1S40 A;  1YIJ A;  2YV5 A;  4LFB L;  2EQS A;  1LYL A;  4C2M H;  3F2D A;  4DV7 Q;  2HHH L;  2JEB I;  1HNW Q;  1VQN A;  4B3R Q;  3EBE A;  1E24 A;  1QUQ A;  1RIP A;  3EIV A;  3LGJ A;  2Y0S G;  3UE1 A;  3HOZ G;  3M7N A;  1SMX A;  4KI0 A;  1MIU A;  1K3R A;  5E7N A;  4RMF A;  1EFW A;  2NZO A;  4IFD G;  2MO1 A;  1X6O A;  4JI5 L;  4IFD J;  3UDX A;  1BBU A;  1C7Y A;  4A3C G;  2A19 A;  2JA6 G;  3CAM A;  3HKS A;  4B3T Q;  4JI6 L;  1IBL Q;  2VS1 A;  3S1N H;  3RN2 A;  3GD7 A;  3L0O A;  3M9B A;  5IWA Q;  4OO1 G;  2OTJ A;  3UDF A;  1N32 Q;  3D31 A;  3S16 H;  3M4P A;  3B6Y A;  1W3S A;  2R93 H;  2YTY A;  2IX0 A;  4A3G H;  1GM5 A;  4IJL A;  4GOP C;  1VQC A;  1GO3 E;  3STB C;  1JE5 A;  4IPH A;  2LXK A;  2ZJQ A;  5FLX c;  2UXB L;  3WWV A;  1PH6 A;  1YEZ A;  1GD7 A;  1HJP A;  1OXS C;  2JA8 G;  5LMN W;  4OX9 Q;  1NY4 A;  3PUX A;  4DV2 L;  4KHZ A;  3J81 c;  2AMC B;  3PO2 H;  5GRO A;  2CWA A;  2CKZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...