4A76A

The lin28b cold shock domain in complex with heptathymidine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
PQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN28 COLD SHOCK DOMAIN
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
total genus 18
structure length 86
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a76A00
2HHHQ 2ATWA 1L0WA 1XMOL 4DR7L 3J7A5 2JEBI 1CKMA 1HJPA 3I2ZA 3I7FA 4C2MH 1VQ4A 4TVAB 1Y14B 2Q2UA 2YU9H 2IX1A 3TS2A 3JAMc 4HIOA 4A3EH 4JI0L 3HKZG 2VUMH 4JI6L 2NN6G 2K5HA 1S40A 4R4TA 4C3IH 2YTYA 2QGQA 2Y0SE 3Q8DA 1IBKL 2RCNA 5LMUQ 3ULJA 2NVQH 5JEAG 1WCMH 3F2DA 2WAQE 1VQ5A 3BU2A 2F4VL 1VQHA 1NY4A 4RG1A 1FJGQ 3RN2A 1PH9A 3CD6A 4OO1I 5ELOA 4YWMA 1VQIA 4BBSH 5LMNQ 3ULPA 4HIMA 4A3DH 4K0KL 1S3OA 1VQMA 1VCIA 1OXVA 2BH8A 2NN6I 1VQDA 1GKHA 3CC7A 1YJNA 5C0XG 3HOZH 1A62A 1WFQA 4DUYQ 5IP9H 4YHHL 3DLLA 4DV3Q 1K8AC 4LFBQ 1EYGA 4A3CH 3W5OA 5IYDH 1B7YB 4X66Q 4OWWB 2E2IH 1E1TA 4A3LG 2I5HA 4GLXA 1X9NA 1X55A 1UE7A 4HJ9A 1VQLA 4LF6L 3FKIG 1E7ZA 2D62A 3G71A 1XNRL 2Z6KC 3K7AH 2PI2E 3OYYA 3AFPA 3PF5A 4KHPQ 2VL6A 1KL9A 2UXBL 3I4MG 1PH2A 2WP8J 1HNZL 2E2JH 3AFQA 2B63H 1L1OC 3RR5A 4JI4Q 3RN5A 4JBJA 4LWCA 2N78A 4IFDJ 1PH3A 4A3EG 4R4CA 4BA1I 1SE8A 1K9MC 1MKHA 4LW1A 1KQSA 1BBWA 1Z47A 2K5VA 2VQEQ 3CPWA 1U0LA 1MIUA 3J7ZC 3BJUA 1M90C 3GTKH 1D7QA 4DAYB 4A3GH 4UPAA 3J81i 1YITA 2IT1A 1PA6A 1FVIA 1WCMG 3ZJYC 2NVXH 3EBEA 3PO3H 1P8LA 4JI7Q 1QVCA 2HQLA 2JA9A 3CCLA 2JA7H 2JA5H 1G291 4QQBX 5JJLA 3MEFA 4GOPA 4BBSG 4PZ8A 4A3DG 4JI3L 3K7UC 3L2PA 1IBLQ 3UDFA 1K0RA 4IPDA 4UP9A 5IP7H 1HZCA 5M5XH 3HOZG 2QA4A 4MTNA 5IP9G 1EWIA 3BZKA 2IY5B 1N36Q 4A3CG 4UP8A 5IYDG 2UUCL 4YCUA 5C4XH 4HJ7A 1YHQA 1M1KC 1Q46A 2K5NA 4P73A 2DGYA 4GKKQ 1PV4A 4NB3A 2MNAA 1Q86C 1N33Q 3KOJA 4LNQA 1EUJA 1HZ9A 3B6YA 4MNOA 3RLFA 4FDBA 4DR5Q 3J81j 1Y1WH 4DUZQ 1JJ2A 5M3FH 1C9OA 4JI8Q 1EQRA 2BA0A 1VQ9A 1AE2A 1OXUA 3FHWA 4J15A 3J81c 5IYCH 4A3BH 1BBUA 2MO0A 2QEXA 4JI2Q 1MJCA 1UE5A 4O0AA 4BY1H 2B63G 4DR3L 4DV4L 1PYBA 4GN4B 4L5TA 3T1HL 4OXPA 4LF7Q 3VDYA 2ES2A 3KJOA 1W2BA 3KF6B 5ELNA 4AQYQ 3HKZE 4DR7Q 1XMOQ 1AE3A 2KBNA 4KLKA 2NVTH 3GTGH 4A3GG 1E3PA 1X54A 4JI0Q 4DV7L 3M7NA 1T9HA 1IZ6A 4QGUA 4OX9L 3PO3G 4JI6Q 2JA7G 2ZJPA 3PSIA 2JA5G 3A0JA 1IBKQ 5M5YH 4KHZA 2LSSA 4IFDI 1XTDA 4IJHA 3A5UA 2AWNA 1PHJA 3G4SA 1QUQB 1YHAA 3PUVA 1BVSA 5IP7G 5H1SE 3CC2A 1EIYB 1XPOA 4EQ5A 1QZGA 2JEAI 5C0XJ 3M4PA 1OXXK 2LXKA 3HOXH 4K0KQ 1AH9A 2FXQA 4POFA 1VQAA 1TWFH 1EIFA 1VQFA 3F1ZA 4UP7A 2R93H 1PVOA 5FLXc 4YHHQ 4B3TL 3OTOL 3GTMH 2AKWB 3H3VH 2UXDL 1I50H 1WI5A 3KLWA 1NE3A 3DM3A 1L1OB 4GS3A 4GLAC 4L5QA 4DK3C 3PIOA 1Y1WG 5M3FG 4GKJL 4DV1Q 1VQ7A 2A8VA 2UUAL 4O2DA 2F52A 5IYCG 4A3BG 4LF6Q 3RZOH 2H5XA 2JK8A 4BY1G 4DV2L 1KIXA 4GNXB 1XNRQ 3H15A 4IOCA 2B29A 4DPGA 4X65L 2UXBQ 1YHBA 3UDXA 5GAHC 3S14H 1HNZQ 3S24A 4BXXH 3S17H 4X62L 1A63A 1YEZA 1HNWL 1I94L 4DR2L 1E22A 1RIPA 4OONA 5JJIA 1L2FA 3CCRA 2VZAA 3HKSA 4DKAC 3PCOB 1GD7A 1VQ8A 1VS0A 1ASYA 1KAWA 1K3RA 2CWPA 4P75A 4R4QA 2K4KA 2L15A 4JG2A 3S15H 2JQOA 1B70B 2CKZB 4LFCL 3HOXG 2UXCL 4L5RC 4JI3Q 4LUVA 3CW2C 1E1OA 2VQFL 2NZHA 3J80i 2R93G 3CCJA 2CCZA 4HJ8A 1S72A 1Y1VH 4YY3L 1P16A 5HY6A 4DK6C 3U50C 1X65A 2VS1A 1YZ6A 4DV1L 2KCTA 4HJ5A 1NJIC 2UUCQ 1XNQQ 2B3GA 3GTJH 1CSPA 4LF8L 3PUXA 1HR0L 2GVBA 3L7ZC 2PQAB 3S2DH 3S1RH 2BH2A 5C0XI 1KD1C 1W3SA 1JB7A 1Q7YC 2EQSA 1ASZA 1WYDA 1IBML 3HOWH 2ALYB 1CKOA 1TWHH 2EIFA 2GN5A 2KHIA 4DR4Q 1FL0A 3H3VI 3ICEA 5GAGC 3RZDH 4B3ML 1FGUA 1X56A 2CQOA 3NENA 2HIXA 3HFZB 3E9IA 1LUZA 3PUYA 2VUMG 1G51A 4IJLA 5C44H 3TQYA 4DV4Q 4DR3Q 3T1HQ 4LUOA 4B3SL 4LF5L 1H95A 4DR1Q 3UDGA 1CKNB 3KF6A 3HOYH 1YBYA 3TRZA 4NXNQ 1N32L 4BA2I 1JJCB 3M4QA 4YWLA 2JE6I 4IOAA 3LGJA 4LF4L 1Q8KA 1UE1A 3CQZH 1Q1EA 3SGIA 1XPUA 1G6PA 4DV7Q 4OX9Q 5GAEC 2R6GA 1PH7A 3L0OA 4QY7A 1UEBA 1J5EQ 4LF9L 4A4IA 3HOVH 3I4OA 3ULLA 1QUQA 4C3JH 1XMQL 2YTVA 1NTGA 4ME3A 5K36G 5GROA 3F2CA 3G48A 1XNQL 1JE5A 1Y1VG 3S2HH 3A5ZB 2RHQB 3I56A 1XJVA 4HIDA 5EAYA 4JV5L 3CCQA 2MO1A 4KI0A 4JBKA 4APVA 3CCEA 4B3TQ 2PMZE 3OTOQ 3GTLH 4A93H 2UXDQ 1L1OA 2GVAA 1SROA 1QVGA 3HOWG 5IYBH 2K14A 1R9TH 5C4JH 3CCMA 4GN3B 1HNXL 1HR0W 4LFAL 5IWAL 2Q2TA 4GKJQ 2OTJA 3ERSX 1A8VA 2UUAQ 3S16H 1Q1BA 3CPFA 4R4OA 1N9WA 2K52A 3A74A 2Q2IA 4DR1L 4C3HH 2RF4A 4GNXA 3GDEA 4DV2Q 4BXXG 4NXNL 5C44G 4A3FH 1LTLA 2A19A 2KENA 3HOYG 4X65Q 3I4NH 4WJ3M 2K50A 3PV0A 4X62Q 2ZM6L 1OXSC 1SFOH 1HNWQ 1J5EL 1I94Q 1VQPA 2IHEA 2JJQA 4DR2Q 4AIMA 1GM5A 2R92H 4XTCS 1VQ6A 1QZHA 3HOVG 1DGSA 3NELA 4JCVE 2OTLA 1UE6A 1B8AA 5M3MH 3S1NH 3RLOA 3M4OH 4DV5L 4AYBG 4B3RL 4AH6A 5C4XG 4R1JA 4LFCQ 1PYSB 1VQCA 2UXCQ 2D0OA 2ZTEA 3H0GH 2VQFQ 2R7ZH 2K75A 1GO3E 2A1AA 4DNIA 4YY3Q 4YCVA 4BBRH 5LMNW 4A93G 1YVCA 2LXJA 2PQAA 5E7NA 4LF8Q 1HR0Q 4DR6L 1VQBA 3PF4A 4QIWE 3JAMi 3TS0A 3KDFB 4YCWA 3GTPH 1YNXA 2F3IA 3PUZA 4JI5L 2I5MX 1IBMQ 2HT1A 4A3FG 4POGA 4PZ7A 2WB1G 4NXML 4JC0A 5AJ3Q 3I4NG 5GADC 1KRSA 4B3MQ 1NBWA 4JBMA 1TWCH 5FLMH 1VQNA 1E24A 5JJKA 1KXLA 1GVPA 3UE0A 2E8GA 4B3SQ 1CKNA 2EXDA 2WFWA 1EOVA 3ER0A 1XPRA 4LF5Q 3E9HA 2PI2A 3KFUA 1N8RC 3S1MH 1N32Q 2IX0A 4DV6L 4A3KH 2R92G 1V43A 5BR8L 4LF4Q 2I5LX 1I5FA 2XTIA 2Q2HA 1QVFA 2R7DA 3KJPA 5GQOA 3U58A 1IL2A 2Z0SA 5M3MG 4WJ4A 4OO1G 4DV0L 1I6HH 2XGTA 4LF9Q 1LYLA 5FJ8H 3CC4A 2VNUD 4PG3A 3F2BA 2YTXA 4JOIA 3HOUH 3CXCA 5C3EH 3BZCA 1XMQQ 3H0GG 2R7ZG 1U5KA 4XIGS 3S1QH 1NMFA 1X3EA 3CMEA 1J6QA 2MQHA 4BBRG 1N34L 2PNHA 4JYAL 4JV5Q 2I0QA 1KRTA 2UUBL 3D0FA 2YV5A 4JI1L 3CCUA 2ZTDA 3KYHC 1K83H 4YWKA 3STBC 5DLQE 1SLJA 3M9BA 2UU9L 1YJWA 3T1YL 1K8GA 4UY8C 5AJ3L 1VQOA 3E0EA 4ALPA 4GOPC 2MFIA 4JBWA 3GTOH 1HNXQ 4LFAQ 2RHSB 5IWAQ 4DR4L 2VW9A 3NEMA 1YIJA 5FLMG 4PZ6A 2ASBA 1SRUA 1Q82C 3W1BA 2R7FA 1SMXA 1OTCA 2E5LL 2ID0A 3RLNA 3TEHB 1HH2P 2AHOB 4IPCA 3CP0A 3J80c 4A3JH 1Q12A 1TXYA 2HIVA 4A3MH 3PO2H 4IO9A 2CWAA 4A3KG 1X3FA 2OQKA 5IY0A 2ZM6Q 2OCEA 1HZAA 3F8TA 2HHHL 4LUZA 3RNUA 4GLVB 2OQ0A 4EX5A 1PH4A 2JA8H 4GN5A 4Y52H 1MJEA 3MXNB 2E2HH 4L5SA 5FJ8G 4A75A 3JC66 4AYBE 3W1GA 3HOUG 4TQUS 3UDIA 5C3EG 5LMUL 2ZTCA 4X6AH 1UWVA 3U4VA 1PH8A 1D8LA 1C0AA 4H02A 4DV5Q 4B3RQ 4GNXC 1FJGL 2Y0SG 2Z6KA 1JMCA 4A3IH 2N3SA 4R4IA 4A76A 1PH5A 2N8NA 5LMNL 1JJGA 2NVYH 2WAQG 3UE1A 1PH6A 4P74A 1I3QH 1VQKA 2IHFA 4DUYL 1CSQA 1Z9FA 4DV3L 4X64Q 4LFBL 5IT9c 4DR6Q 3KDFA 4X66L 4Y7NH 2JA6H 1NMGA 4RMFA 2WB1E 3GTQH 2ZJQA 4JI5Q 3PUWA 4P71A 1YJ9A 4OWXB 1TWGH 3KF8B 4QL5A 2OWOA 1V9PA 3NBHB 3CF5A 4NXMQ 4A3MG 4A3JG 2YYZA 1K73C 3CAMA 3PO2G 3IRBA 4KHPL 2D0PA 2CFMA 1HZBA 2V1CC 3D31A 3FP9A 4JI4L 4BY7H 1CUKA 1RL2A 2JA8G 1PFSA 1BKBA 3K0XA 3U4ZA 4DV6Q 1O7IA 2AMCB 2VQEL 5BR8Q 3AQQA 4HJAA 2N49A 4IFDG 3PGZA 3CMAA 5J3BA 1IYJB 4IPGA 4P72A 1JT8A 5M5WH 4DV0Q 4JI7L 1VQJA 2ZJRA 1OXTA 4PMWA 1PH1A 3EN2A 4A3IG 2KCMA 1SR3A 5JEAJ 4GOPB 2KHJA 3M3YH 1V1QA 3WWVA 3G6EA 3CCVA 1TWAH 1IBLL 1EFWA 4MZ9A 3I55A 1KHIA 1LM0A 5IYBG 4X64L 5IE8A 1X6OA 1WJJA 1N34Q 4DAMA 1EQQA 1KC8C 1N36L 2F4VQ 3AEVA 4JYAQ 2UUBQ 3EIVA 1YI2A 4JI1Q 4HIKA 1C7YA 4OWTB 2UU9Q 2JA6G 1SN8A 1Q81C 3T1YQ 1VQGA 2AWOA 4GKKL 3K8AA 1N33L 4QJFA 3GO5A 3AYHB 4DR5L 3TREA 1WOCA 2VY3A 4DUZL 4JI8L 3STBD 2DUDA 4A3LH 2NZOA 1VQEA 4JOIC 2E5LQ 5HGQA 3K81C 3GD7A 4NPSA 4JI2L 3FKIH 4IPHA 2BA1A 3CCSA 4BY7G 3PIPA 3OW2A 2C35B 1IXRA 4LF7L 3K80C 3M85A 1X3GA 3I4MH 1A0IA 4AQYL
chains in the Genus database with same CATH superfamily
2K7VA 1STEA 1L0WA 2ATWA 1VQ4A 3TS2A 1JE4A 4KN7C 1K3BC 1SDFA 2K33A 3DWAA 2A68C 4IALA 1IBKL 3MFYA 3TN2A 3WOEA 2NVQH 5JEAG 3I72A 2WAQE 1I6HB 1VQ5A 1NY4A 4L8JA 3RN2A 1M8AA 3NK9A 2EYOA 4A3DH 4K0KL 4X3TA 1OXVA 3S1QB 4KD4A 3WDNA 1YJNA 1SEBD 2Y0SB 3HOZH 3DLLA 2NB0A 4DV3Q 1EYGA 1Y8OB 2EY2A 1K83B 3HOWB 1AEXA 2E74C 4A3LG 2I5HA 4GLXA 4G4KA 3KF8A 1X9NA 2D62A 1LV9A 5CBAE 1D5ZC 2WIIB 3MFGA 3OMCA 1PH2A 4O1NA 1CA5A 2E2JH 2BE5C 5E4XA 5A2QE 4QB4A 1SE8A 3CQZB 4LW1A 1SE3A 1GHKA 2PCFB 1EFID 1MIUA 4N8X1 3GTKH 1RHPA 4DU9A 1D7QA 4UPAA 2DJGC 3I91A 3ZJYC 3EBEA 2NVXH 1QVCA 2HQLA 3D6CA 3CCLA 2JA5H 4FXKC 5FK9C 4JI3L 3KBXA 4KJOA 4ZKBB 3R8BA 1HZCA 2QA4A 3BZKA 1CZGA 1BBXC 3GTLB 1PDQA 3Q24A 4HJ7A 1R4PB 1Q46A 2K5NA 5A35A 1R9TB 1E2WA 5J1ZA 1II3A 1X3PA 3HRZC 1PV4A 3KOJA 4RCNA 4CHTB 3KLSX 3R2TA 2AQ1B 2EOTA 3KUPA 3NTHA 4C3HB 4DUZQ 1C9OA 3GQBA 2BA0A 1JJ2A 1HA6A 2EY6A 3SDZA 3MXGA 1STBA 1UNSA 4L5TA 4GN4B 1WTQA 4ZLTF 4OXPA 2KJXA 1SFOB 3DEOA 5ELNA 2F4IA 1XMOQ 1AE3A 3ITPA 2R92B 1X54A 1I6VC 2A6HC 4QGUA 3PO3G 4JI6Q 4RKLA 1TIID 5CYUA 4IN3A 2XIWA 5M5YH 4KHZA 5CR3A 4DXFA 2PQEA 4IFDI 1XTDA 1B9NA 1YHAA 3PUVA 1BVSA 3CC2A 5H1SE 1XPOA 2NWGA 3NBIA 3E0JA 1ILPA 1MSHA 4MHEA 5KIXA 4POFA 1VQFA 4UP7A 4YHHQ 3GTMH 3OTOL 1WTWA 4J1MA 4FYDA 4GS3A 1Y1WG 1SSOA 4C1NI 5M3FG 4GKJL 1KDCA 2UUAL 4A3BG 5EKLA 3RMHA 2H5XA 1STYA 4DV2L 4GNXB 1CHQD 3H15A 3FDTA 1YHBA 3UDXA 1HNZQ 4GZYC 2CW0C 3ERQA 3FKIB 1A63A 1S5CD 1HNWL 2K1BA 4K5WA 2B39A 5JJIA 3BVMA 1L2FA 2ZT9C 3CCRA 5ISRA 3PCOB 2B2YC 3FVQA 5L37A 1VQ8A 1VS0A 1ASYA 1KAWA 4P75A 2CWPA 2K4KA 2L15A 4JG2A 1LT3D 1NNXA 3HOXG 1WCMB 3CW2C 3QIAA 2CCZA 1LO5D 3O13A 4BBSB 1UEAB 2VS1A 3TP6A 2K5WA 1L0YB 1CSPA 2GVBA 3L7ZC 1PXUA 2PQAB 4OELB 4WFN3 1Q90A 1SE2A 1WYDA 3HOWH 4XYQA 5FLXL 1BCPC 3ICEA 3P1HA 3NXWA 1WTHA 2VUMG 4IJLA 3T1HQ 1DM0B 4LF5L 3UDGA 3MXPA 1N32L 4BA2I 2QDLA 4YWLA 4LF4L 1VMPA 1Q8KA 1RJTA 2Z4HA 3CQZH 2L12A 4RA8A 1ENCA 3NSWA 1JCKB 1JQYD 4A3GB 1F2ZA 3E6ZX 2YTVA 4E6IA 3K59A 2NVYB 2N88A 1CT1D 1Y1VG 3I4LA 4HIDA 4Z9CB 1TS2A 5M9OA 1B9MA 3NE5B 1C48A 3CCEA 2VB3X 2PMZE 1Q3LA 3GTLH 3DXJC 2GVAA 4PMCA 1MSGA 1R9TH 1Y8PB 1HNXL 2Q2TA 1WVLA 2F0IA 1N9WA 2K52A 4C3HH 3GDEA 2F0LA 4NXNL 5C44G 1LTSD 2XVSA 1LTLA 2A19A 3OIQA 4XXEA 1H9KA 4X65Q 3HOYG 3I4NH 4WJ3M 1QCBD 2KEEA 2OT2A 4BY1B 4TSSA 1SFOH 1J5EL 3Q6SA 1GM5A 2R92H 1VQ6A 3GTGB 1ICFB 2A74C 1ESRA 2OTLA 4C3JG 1UE6A 4PNYA 3S1NH 4OL7A 2UXCQ 4OIJA 3H09A 1FYCA 1E2ZA 3J7AV 2R7ZH 1B2TA 3MZ5A 2DY7A 2EYJA 4YY3Q 4YCVA 4BBRH 2RCFA 1EY7A 2EY5A 2PZUA 1HR0Q 2F0FA 4S3SA 4YCWA 1AFPA 1YNXA 4JI5L 2B2WC 3A7LA 2I5MX 3T16A 3VYRA 4PZ7A 2WB1G 2KOLA 5GADC 2RSOA 4B3MQ 2IPKD 1VQNA 2E8GA 3SE0A 3L3OC 1N8RC 2E2DC 4DV6L 3S17B 4A3EB 4QUCA 1XTCD 2F0JA 5I9PA 4C3IB 4WJ4A 2L9HA 2F0NA 2XGTA 1K28A 1LYLA 1SJED 5D65A 3F2BA 3H0GG 2M00A 4HSVA 1NMFA 1G6ZA 4DNTB 2MQHA 4QF4A 3M4YA 4JV5Q 1PYWD 1KRTA 4JI1L 1ZKOA 1YJWA 1K8GA 4UY8C 2ICEC 4ALPA 4WRDA 4LFAQ 1KAAA 5FOBB 2VW9A 2RKSA 1SYCA 5FLMG 4PZ6A 2ASBA 4BWGB 2EYLA 1Q82C 2PYKA 3K5MA 4KKTA 3J80c 4A3KG 1X3FA 2OQKA 4F87A 2EYPA 4EX5A 1C8CA 2GA4B 2JA8H 1O80A 1O7YA 1A2UA 1QWYA 4RGMA 3EFXD 4ZCKA 1F2LA 5FJ8G 1Y69U 3JC66 3W1GA 4TQUS 3UDIA 5LMUL 1C0AA 1TR5A 1NR4A 4DV5Q 1WD0A 1FJGL 2N3SA 3EROA 2N8NA 1TS5A 2NVYH 2QW7A 1PH6A 4P74A 2IHFA 1U4LA 1QILA 1CSQA 1Z9FA 4LFBL 2F0UA 3H91A 2WB1E 3K57A 3GTQH 1YJ9A 1XX8A 2J7ZA 3NBHB 1GOZA 1MGSA 1SXTA 4A3MG 1SMYD 3PO2G 4KHPL 1PRTC 5LL6S 1SJHD 1PTOC 4JI4L 1CUKA 1RL2A 3SK4A 1PZKD 1H9RA 1O7IA 1ONLA 2N49A 4IFDG 3CMAA 4HSPA 5J3BA 4P72A 4PMBA 4JI7L 1VQJA 2F3VA 4A3IG 3PMFA 2MUYA 3T51B 1V1QA 3G6EA 3I55A 1KHIA 5IYBG 4X64L 1X6OA 2ZXOA 3P20A 1W6JA 4JYAQ 1N36L 2UUBQ 1VF5C 1NR2A 2L11A 5BN3A 3HEJA 5G3LD 1Q81C 5C0XH 1VQGA 2AWOA 2O5IC 3K8AA 1N33L 3OPOA 4ZK9B 3FMCA 2F0VA 1AZPA 3TREA 5AFWA 1Y8NB 2VY3A 1JB3A 4JI8L 3STBD 4QIWB 2DN8A 3MXUA 1IKMA 1LT6D 2F0TA 3VA7A 1KNAA 5COYA 3E5SA 3CCSA 1IW7C 5CMDA 1K0SA 2HHHQ 3KK7A 3J7A5 4EGVA 4Q0FA 1E0BA 1X32A 2IX1A 1ESFA 3MXNA 3JAMc 1HFGA 2RVLA 4A3EH 2EJMA 2PPBC 2NN6G 4HMIA 4C3IH 2YTYA 2QGQA 1SAPA 3PQIA 1GUWA 3CD6A 4RG1A 4LMQD 1PTOH 3ND8A 5DAUA 3HOUB 4HIMA 5C3EB 1PFMA 1S3OA 1EZ6A 1WFQA 4DUYQ 1STNA 1ZYRC 3SR1A 3W2DA 1BUVT 2WAQB 4A3CH 4HCEA 4X66Q 3OOCA 4OWWB 2B2YA 1SNCA 1TKWB 1TWHB 3TBIB 1X55A 2WINB 5LHY1 1VQLA 4LF6L 3SXHA 2EYFA 1E7ZA 5JAVA 3G71A 1XNRL 3K7AH 3NP8A 3OYYA 2VL6A 2UXBL 3I4MG 3A8JE 3CHBD 1D1KA 4DNRB 2B63H 1JWSD 3RR5A 4A3JB 1SNMA 2N78A 1PH3A 1U4RA 1MKHA 1GUNA 2PO4A 4DAYB 3VR6A 3HOVB 2EYMA 1FVIA 2JA7H 1LACA 1G291 2NZ1D 4GOPA 2IJ0A 4A3DG 1V1PA 3K7UC 3L2PA 1IBLQ 4IPDA 1HXYD 5M5XH 3HOZG 1LTAD 4ID6A 3S9WA 2IY5B 1KDBA 3BYYB 4A93B 2UUCL 3BVGA 3IL8A 1YHQA 3BDCA 3A54A 1GHJA 4P73A 4ZKCB 4NB3A 1Q86C 3VYTA 4LNQA 3S16B 4DAPA 4MNOA 1YNJC 4DR4L 2JA6B 4A3FB 1H9SA 1OXUA 3J81c 2P5ZX 1TWGB 2R61A 5C5MA 4O0AA 2TSSA 4DR3L 4DV4L 1AP0A 1STAA 4LF7Q 1SNDA 3KJOA 1VMCA 4AQYQ 4DR7Q 4DK1A 2KBNA 1DOLA 2EXZA 4JW0A 3C1EA 1BQQT 4JVZA 4BY7B 4JI0Q 1R4QB 2QKIC 3T56B 2ZJPA 3PSIA 2JA5G 1RD9D 3M4OB 3KLRA 4FF4A 2LSSA 3LWEA 4IJHA 2AWNA 3G4SA 3A8KE 2F3WA 1QZGA 3M4PA 2LXKA 1AH9A 3M3YB 4H44C 4ZUIA 1O7LA 1VQAA 1TWFH 4G57A 4B3TL 3D3RA 2UXDL 2NTTA 4DK3C 3DM3A 3VYUA 3PIOA 4GLAC 1B50A 3TP5A 5CV4A 1A15A 4F88A 3HGBA 1RKNA 2I46A 4NDXA 3I70A 1H9JA 2B29A 2CQAA 4RAUC 2HCCA 4IUNA 3R93A 4DR2L 1F9RA 1RIPA 4OONA 2SEBD 2EE1A 3HKSA 2BE5D 5C5LA 2B2WA 2F0QA 1C4QA 1K3RA 4HAEA 4CJ1B 1CZWA 2VXWA 2JQOA 3KBGA 1B70B 1CTMA 4LUVA 1I4PA 1E1OA 2NZHA 3J80i 5K36H 1S72A 1EEID 1P16A 3QR8A 5HY6A 1X65A 4DV1L 4M8AA 4CBVA 2Q8RE 2HDLA 2XRSD 4N9PA 5A2QL 5KYIA 5C0XI 1ASZA 1Q7YC 1TWHH 2EIFA 1S5DD 2JP1A 2KHIA 2Z6BA 4KKUA 3SK6A 4QCLA 1T5EA 1IHZA 4BXXH 1A6XA 3PUYA 1QE6A 4B3SL 3KF6A 1YBYA 2BOSA 3TRZA 4NXNQ 1JJCB 3SEBA 1B53A 3LGJA 2E2HB 5I6WA 1G6PA 4DV7Q 4OX9Q 5GAEC 1J5EQ 4LF9L 3HOVH 3I4OA 1QUQA 5CV5A 3IKJA 1XMQL 1NTGA 3AMUA 2A6HD 3K5LA 1XNQL 3A5ZB 1I3QB 2RHQB 3I56A 2HQEA 1TQOA 2Z9HA 5BN5A 5FO9B 5K5PA 3VR4A 1KNEA 4A93H 1LTGD 1L1OA 3U9SA 1QVGA 3HOWG 4IUPA 3CCMA 1Z6HA 5IWAL 3S16H 3OMGA 1ZXTA 1JOQA 3DUZA 3A74A 3NWSA 2RF4A 5D3IB 1WTOA 4A3FH 1NAPA 2KENA 2O5JC 2PMZB 1QNUA 4KKSA 2K50A 4A3BB 4X62Q 1ICWA 2QDBA 4TKOB 2ZM6L 2KECA 2Z1CA 1I94Q 2IHEA 1G2SA 3P75A 4CGYB 1HUNA 1GUGA 5NUCA 4MIUA 2WV6D 1JOKA 4DF7A 5IGBA 2LFNA 5M3MH 3RLOA 3M4OH 4OO1H 4B3RL 4LJZC 3ZYYX 4AH6A 5C4XG 4LFCQ 2D0OA 2F0EA 4L6TB 2ZTEA 1D1IA 2PZWA 2VQFQ 2KQ3A 3I73A 1GO3E 5FO8B 3HOXB 1YVCA 2LXJA 3WOFA 4LF8Q 4DR6L 3JAMi 2AQ3B 2F3IA 3OSOA 1CQFA 1I50B 4C3HG 1IBMQ 2HT1A 3BYTB 4POGA 4NXML 3I4NG 3SHLA 1NBWA 4JBMA 1TWCH 3RZOB 3HZXA 2A6EC 3PIP3 1E24A 5JJKA 1KXLA 1CKNA 2EXDA 1XPRA 3E9HA 3KFUA 1BCPD 4CKBA 2R92G 1DJRD 2VUMB 5BR8L 1BDOA 1B3AA 2I5LX 1X3QA 2XTIA 1QVFA 2R7DA 4NMZA 2AUKA 4QMGA 2RDFA 2M2LA 1I6HH 2CVRA 1G91A 1LT5D 2XWJB 2VNUD 3VYSA 1DZ1A 2L55A 4X3SA 3CXCA 3BZCA 3CRLC 2TMPA 2R7ZG 4IUUA 3S1QH 4KMUC 3S15B 3CMEA 1CFMA 1J6QA 2L1BA 4BBRG 2PNHA 1D5XC 3KLSA 2D5DA 4OIKA 4PV1C 1EU4A 3DWPA 1K83H 5IGCA 5DLQE 3M9BA 1Y1VB 1SYDA 4ILWA 2XRQD 5AJ3L 5I2YA 1VQOA 3E0EA 4GOPC 4DA2A 3QB3A 3NEMA 1SRUA 5EKKA 3W1BA 5KNDA 1OTCA 2E5LL 1G2TA 1HH2P 2L0CA 1TXYA 2SOBA 3RZDB 1JORA 4IO9A 2F0OA 1HFNA 5C44B 1KABA 1F77A 4LUZA 1PH4A 4TRDA 5CV7A 1EY0A 5DEHA 2F0WA 2PW5A 2E2HH 1DONA 4FXGC 2K05A 3A55A 1H9MA 2ZTCA 1UWVA 3OW7A 1PH8A 1EYCA 1JR0D 4GNXC 1A3VA 3EVQA 1BR9A 4K6LA 3UE1A 3VA5A 4XQJA 1WD1A 1I3QH 1NSNS 2RA4A 3K5OA 1EZ8A 3S2HB 4DV3L 1LLRD 4HN7A 4X64Q 3HS0C 2MP1A 3KDFA 2ZJQA 4IURA 1S5ED 4OWXB 3KF8B 2OWOA 3C3LA 1J9OA 2A69D 3IRBA 3DWQA 4H13C 2WB1B 1IKLA 2NVTB 2JA8G 1YNNC 1DYQA 3K0XA 3U4ZA 2IW3A 1F2YA 2B8FA 2RSNA 1EU3A 3J80L 1TU2B 4IUVA 1TY2A 3H94A 4HMJA 4IPGA 1JT8A 4DV0Q 1PH1A 1M4VA 2RBMA 3J80E 2D2CC 5EPKA 3CCVA 1LM0A 3W3AA 4NP5A 1WJJA 5HURA 1N34Q 2R93B 2ENBA 2MPMA 1EYAA 3AEVA 3FPUB 2UU9Q 4ZUJA 5ELCA 3T1YQ 2O4XA 4QJFA 1DOMA 1SYGA 4DUZL 4F8MA 5HGQA 3S14B 3FKIH 2C35B 1IXRA 3K80C 4O42A 1B44D 1XMOL 1HCZA 2JSOA 2JEBI 1CKMA 1HJPA 2EVBA 3I7FA 4TVAB 1Y14B 3S1MB 1HRJA 1EOTA 3HKZG 2VUMH 4JI6L 3ND9A 3LWUA 4HCSA 4XQNA 2FINB 3Q8DA 2RCNA 2SNSA 3ULJA 4MN3A 2J0TD 1WCMH 3F2DA 3R3OA 2DJFC 2KCNA 4OO1I 5ELOA 4YWMA 4BBSH 5LMNQ 1QB5D 1VQMA 1VQDA 1GKHA 5JPNC 5KGUA 4LAAA 5C0XG 3GTJB 1HA5A 1PRTB 3SVMA 4DAVA 5IP9H 4YHHL 1RF2D 2K03A 2EYHA 3W5OA 5IYDH 1B7YB 3DMUA 2B2TC 1PLFA 5G3LF 3T53B 4V190 2Z6KC 2WP8J 1HNZL 4EQPA 5CV6A 1L1OC 2J4XA 3RN5A 2HDMA 4JBJA 4DN4M 4A3MB 3PO2B 4IFDJ 4KV6A 4A3EG 4BA1I 1K9MC 1KQSA 1PRTD 1Z47A 2VQEQ 4PQXA 3D4DA 3J7ZC 3BJUA 4C3IG 4A3GH 1YITA 2IT1A 1A2TA 1WTVA 2CH4A 2JA9A 4HTHA 1S5BD 1TY0A 3JAML 3CKIB 4PZ8A 3GV3A 1K0RA 4UP9A 5IP7H 4A3IB 1DOKA 1F9PA 4ABNA 3NUCA 4A3CG 3JAME 4R8NA 1EIGA 2SDFA 1U9RA 3OWFA 1XYIA 1M1KC 5C4JB 2DGYA 4GKKQ 1HZ9A 4DR5Q 1HR0W 4FDBA 3J81j 5ELFA 5J39A 5IYCH 2QEXA 4JI2Q 1MJCA 4BY1H 2B63G 2OEOA 1PYBA 2HD3A 3T1HL 2ES2A 4R9WA 5EBDA 1W2BA 2F0GA 3HKZE 4K6DA 2NVTH 3GTGH 1IW7D 1IZ6A 1TVXA 1CA6A 1RDPD 2JA7G 1W6KA 2G5DA 1IBKQ 2OF1A 4K5XA 1UUPA 3VR2A 4DK0A 5T1IA 1EIYB 4EQ5A 5KNCA 2JEAI 1OXXK 4K0KQ 1MI2A 1TWAB 2R93H 3MTSA 4WORA 4CDDC 2NYZD 4N8FA 3GTPB 2AKWB 1WI5A 3KLWA 1NE3A 4CJ0B 3I8ZA 2FHTA 4DV1Q 1VQ7A 1PZJD 2BCOA 5C3WA 2XWBB 3MAQA 2KA7A 1SMYC 5EBCA 1KIXA 3IAYA 4X65L 3NWTA 3URYA 5GAHC 1EEFD 3S14H 3S24A 3S17H 1Q8IA 1DD2A 1YEZA 1FNUA 1RTOA 3I4MB 1E22A 2VZAA 3LNNA 1GD7A 3J81E 4XYOA 1DCZA 1ET9A 2WKDA 4XT3B 2CKZB 5HGTA 2UXCL 5EPLA 4JI3Q 2NVQB 4N9TA 3LX0A 1BOSA 3CCJA 1ENAA 4YY3L 4A3DB 3U50C 5D3DA 1YZ6A 4HJ5A 2KCTA 1RCVD 1XNQQ 3GTJH 1HR0L 2PNRC 3C2PA 1JWUD 1KD1C 1JB7A 1TS3A 2EQSA 2GN5A 1O7ZA 3H3VI 1STHA 3DHQA 4B3ML 4M1UB 1X56A 3NENA 2HIXA 4I7AA 3E9IA 4KY6A 1G51A 2NTSA 3TQYA 1LTBD 3QOJA 4I7ZC 2E2JB 3EJIA 3M4QA 4IOAA 2Q8TA 1UE1A 2Z8LA 3SGIA 1NUCA 1TS4A 2LKVA 4UHVA 4ZAIA 3GTKB 5C3XA 2N55A 2FFKB 2ZXPA 5CV9A 3QO2A 4ME3A 2NVXB 5K36G 3I3CA 2WACA 3H6MA 1I4RA 2IWHA 2JA5B 4ZYSA 1XJVA 4CDEC 4JV5L 3CCQA 1F2MA 4KI0A 4APVA 1KTKA 1SE4A 3OTOQ 3TMEA 1SROA 2LMCB 5C6AA 5IYBH 3SK5A 5C4JH 4LFAL 2F0HA 4GKJQ 2UUAQ 3CPFA 4R4OA 1WTPA 1LTRD 4DR1L 4GNXA 4BXXG 4DV2Q 4RGTA 3NPPA 4IQZA 1QG7A 2F0SA 3PV0A 1BO0A 5FO7B 3FEWX 2L5TA 2K6AA 1HNWQ 3NTKA 2JJQA 3Q0AA 5I2XA 4AIMA 3K58A 1EY9A 4XTCS 3HOVG 3NELA 2DNCA 5C4HA 2KHSA 2A68D 2C9OA 3MA2B 4AYBG 4DV5L 4R1JA 3F2UA 1EYDA 4K5VA 1VQCA 3MWYW 4NKLA 5LL6X 2K75A 1SBBB 1NCVA 4A93G 2JN4A 2PQAA 1VQBA 3PF4A 1SNOA 4QIWE 1EQVA 2QEJC 4ULLA 3TS0A 3GTPH 3PUZA 3AB9A 1EY6A 2ZXRA 3RD4A 1FNVA 4A3FG 1SNPA 4JC0A 5AJ3Q 1ENFA 3VR5A 1AW7A 2B8GA 2Q8IB 2CH4W 5JPMC 3UE0A 3V96A 2VB2X 3ER0A 1EOVA 4LF5Q 3OIPA 4C2MB 3RUZA 1N32Q 2YU9B 1V43A 4LF4Q 2FJ2A 1I5FA 2Q2HA 4B9WA 1IL2A 4H0LC 5M3MG 5IT9E 4OO1G 3G6JB 3MHBA 4EQNA 5EQ0A 2G9HD 1HTPA 2X6LA 4J8QA 1FNWA 4PG3A 3HOUH 3A8IE 5C3EH 4KJNA 4U68A 4XIGS 3X3NA 5IGGA 1B3QA 1I4GA 4JYAL 2UUBL 3D0FA 3CCUA 1EIHA 5I9OA 2ZTDA 3KYHC 4G7OC 1MBYA 1SLJA 2E2IB 1JC7A 1UAPA 1HNXQ 1E2VA 1EWHA 2RHSB 4HR7B 1LT4D 3R2IA 5I4DA 2R7FA 1SMXA 3TEHB 4IPCA 3CP0A 4A3JH 1Q12A 2I07B 2KVMA 5IY0A 2OCEA 2HHHL 4FP5D 3RNUA 1ZEQX 4GLVB 3DEPA 4GN5A 1BCPF 3D6WA 3MXNB 1HQMC 2B2TA 3PO3B 3TDQA 4AYBE 2QILA 2R3ZA 3U4VA 1S5FD 5BN4A 2Y0SG 2Z6KA 1PH5A 1JJGA 4IUQA 1MHWC 4JPBW 3D4WA 5C4XB 4DUYL 4Q5VA 5ELDA 5TSSA 5IT9c 4X66L 4KK7A 5DM73 2JA6H 4LK1C 4RMFA 2KEDA 5CGKA 1Y1WB 4JI5Q 2B2UA 3PUWA 4B08A 5M3FB 4P71A 1TWGH 2K5QA 3CU7A 2D9UA 3CF5A 2LS01 2YYZA 3CAMA 2D0PA 4L63B 3QJYA 3NTIA 5KRUA 4BY7H 3I4NB 2CW0D 1VDZA 1PFSA 1BKBA 4DV6Q 2BDNA 2X6GA 2AMCB 2F0DA 2A6ED 1FD7D 1IL8A 3PGZA 1U4PA 1OXTA 3EN2A 4FO2A 1BCPB 4GOPB 3TP7A 3M3YH 3WWVA 5JEAH 3S1NB 1IBLL 2FMMA 1V1PB 4MZ9A 5IE8A 1SYBA 3ONAB 2A73B 1EQQA 3EIVA 2XN9C 4JI1Q 4HIKA 1C7YA 2R7ZB 4UAIA 5CBEE 1SN8A 2AUJD 4BBRB 3Q22A 4QUFA 3GO5A 4RWSC 4C56C 1WOCA 4A3LH 4RH6A 3TZUA 2NZOA 4FF1A 1H9SB 4JOIC 4IPHA 3NHHA 1EY4A 2DNEA 3PIPA 4LF7L 1X3GA 2SNMA 4AQYL 4DR7L 1LTTD 4C2MH 3I2ZA 4DXGA 4F7XA 2Q2UA 2YU9H 2A5HA 4HIOA 4JI0L 2K5HA 1S40A 3C46A 4R4TA 3VR3A 2Y0SE 5LMUQ 3Q23A 1IYVA 3IFTA 2F0MA 2F4VL 3BU2A 1VQHA 5DNFA 4X3UA 4ZRZA 1PH9A 1FJGQ 1KLUD 1HUMA 1EY8A 1STGA 1VQIA 3FRPB 3ULPA 4B9XA 3EA6A 4YIJA 5J22A 1VCIA 1D6EC 2BH8A 3CC7A 2NN6I 5EGTA 4XQQA 1A62A 2NUCA 3TZDA 1K8AC 4LFBQ 3S2DB 3S1RB 3CRKC 5IOCA 2K5DA 2E2IH 1PFBA 5E1FA 1E1TA 2MHVA 3NBHA 3OHXC 1J8IA 1UE7A 4HJ9A 1F9SA 3FKIG 3T4AC 4KHPQ 2PI2E 3PF5A 3AFPA 1KL9A 3QG1A 3HOYB 3AFQA 4JI4Q 4OHJA 4LWCA 2E75C 4ZQ3A 4R4CA 2RDGA 3OWEB 1BBWA 2K5VA 2B2VC 1U0LA 3CPWA 1WTXA 1M90C 5FLXE 1PFNA 3H3VC 3J81i 1PA6A 2JA8B 1WCMG 1YNND 3PO3H 1P8LA 4JI7Q 4C3JB 3TSSA 4K8JA 1XXGA 3DM1A 4QQBX 5JJLA 3MEFA 4BBSG 3V05A 4XDXA 3A56A 1ET6A 3UDFA 2OXPA 2M9VA 1QJOA 1EWIA 4MTNA 5IP9G 1N36Q 4UP8A 5IYDG 2LY7A 4YCUA 5C4XH 1TT2A 3QOLA 2MNAA 1N33Q 1RODA 1EUJA 1ML0D 3B6YA 5D14A 3RLFA 4R8IA 1Y1WH 3AU7A 1VQ9A 5M3FH 4JI8Q 1EQRA 3GTQB 4C1NK 1AE2A 3FHWA 4J15A 4WJWA 4JK1C 4A3BH 1BBUA 2ICIA 2MO0A 1XWEA 4KN4C 1UE5A 3GV6A 1JICA 3TP8A 3VDYA 1SNQA 1A3TA 3KF6B 2IX3A 4KLKA 2EZVA 4A3GG 3N6RA 1E3PA 2QCPX 3C1FA 4DV7L 3M7NA 1T9HA 4OX9L 4K2LA 1PRTF 2EDGA 3A0JA 3L9AX 3MVVA 3NQIA 4XT1B 1PZID 4CKCA 5CC4A 1B4OA 1PTOF 3A5UA 1PHJA 2EY1A 3HKZB 1QUQB 5IP7G 2K01A 3H0GB 1CI3M 5C0XJ 3HOXH 3BVZA 3I90A 3J7YW 2FXQA 1IYUA 4EQOA 1EIFA 1GJXA 3F1ZA 1PVOA 5FLXc 5IGEA 3H3VH 5JVG3 1I50H 4KD3A 1L1OB 4L5QA 5C4ZA 5ELBA 3NQTA 4FVMA 2A8VA 4O2DA 2F52A 5IYCG 5DM63 4FXDA 2A69C 5IODA 4LF6Q 3RZOH 2RDHA 2JK8A 4BY1G 2PZTA 1XNRQ 4IOCA 1K8MA 4DPGA 2UXBQ 4IZ8A 3HP3A 4X62L 2F0KA 3SK8A 4A3KB 1G8ZD 1I94L 2K28A 4DAYA 1OO9B 4DKAC 1KLGD 4R4QA 5CORA 3S15H 4LFCL 3HG9A 4L5RC 1DXMA 2VQFL 4OGQC 2R93G 1PTOB 3MC0B 1GUTA 4HJ8A 1Y1VH 4MTKA 4DK6C 2XNAC 1B1ZA 1NJIC 2UUCQ 1FR3A 2B3GA 4LF8L 3N52A 3PUXA 2F0PA 3GTOB 1A3UA 4RHSA 3S2DH 3S1RH 2BH2A 2JXMB 1W3SA 1JOOA 1IBML 2ALYB 1CKOA 4DR4Q 1FL0A 4X3KA 5GAGC 5JVH3 3RZDH 1FGUA 2H4OA 3V2TA 2CQOA 4KHVA 3HFZB 1LUZA 4DR3Q 5C44H 4DV4Q 5IGFA 4EVOA 4HEDA 4LUOA 5JOBA 1H95A 3K7AB 2C5CA 1CKNB 4DR1Q 2JYOA 3HOYH 5EKIA 1PTOD 2H1EA 5KEEA 1S4ZA 2B2UC 2JE6I 2B63B 1Z7TA 4UDUC 2L4NA 2MJ8A 1Q1EA 1XPUA 1BF4A 2R6GA 1PH7A 3L0OA 5I6YA 4QY7A 1CK1A 1UEBA 3FPPA 4A4IA 3ULLA 4KTAA 3X3MA 4C3JH 1JWMD 2X69A 4U673 5GROA 2JA7B 3F2CA 3G48A 1JE5A 3S2HH 5EAYA 5IGDA 3EQLC 2MO1A 4JBKA 5M5XB 4Y7NB 4B3TQ 4ME5A 2UXDQ 1HPCA 2QF7A 2K14A 4G7HC 4GN3B 2OTJA 3QWNA 3ERSX 1A8VA 1BXTA 1Q1BA 2Q2IA 4RKBA 1I4HA 3J7AF 4NW2A 5JJZA 4P2CB 4ODGA 1OXSC 4FNFA 5KNBA 1VQPA 1CHPD 4DR2Q 3BZDB 1ILQA 5M5WB 1QZHA 1DGSA 4JCVE 3UI2A 1PMRA 4J6HA 1B8AA 1D2BA 1D5MC 4RGOS 1PYSB 4KY5A 2WKCA 1QNKA 4RCOA 1HHVA 3H0GH 1RTNA 2A1AA 1EY5A 4DNIA 5LMNW 2BDOA 2E76C 4K8IA 4FF2A 5E7NA 1ZYRD 1TWFB 3KDFB 2NBFA 1LABA 5CV8A 3T13A 1KRSA 3J81L 5FLMH 1GVPA 2EJFC 2EPBA 3BS1A 2WFWA 4B3SQ 2PI2A 1AZQA 3S1MH 2IX0A 2RQXA 4A3KH 4CDCC 3GP7A 1GUOA 3KJPA 5GQOA 3U58A 5KYLA 2Z0SA 4BS9A 4DV0L 4LF9Q 5FJ8H 1GXDC 3CC4A 1WTRA 1EWCA 2YTXA 4JOIA 1XMQQ 1U5KA 1X3EA 4KY7A 5F2DA 1N34L 1K8OA 3BDLA 2PW7A 3HOZB 4DFAA 2I0QA 2KUMA 2YV5A 5EJWA 2UU9L 4YWKA 3STBC 3T1YL 1EL0A 1HQRD 1BNZA 3K6OA 3IFDA 4CKEA 3GTOH 2MFIA 3A7AB 4JBWA 1CM9A 5IWAQ 1YIJA 1YNJD 4IUTA 4H7BA 2ID0A 3D4RA 3RLNA 2AHOB 2EJGC 2G9DA 4A3MH 2AQ2B 2HIVA 3PO2H 2KCCA 2XSCA 5E4WC 2CWAA 2V4DA 2F03A 2ZM6Q 1HZAA 3F8TA 3P7JA 2MGSA 2OQ0A 2F1MA 4Y52H 1MJEA 5EPJA 4L5SA 2CHBD 4A75A 4CJ2C 4IFDH 1V1OA 3HOUG 3BG3A 1F9QA 5C3EG 4X6AH 3M7GA 5E3FA 1D8LA 4H02A 4B3RQ 3U9OA 2IL8A 1JMCA 4A3IH 4R4IA 4A76A 1KDAA 5LMNL 2WAQG 4AYBB 1VQKA 2B2VA 1I4XA 2DY8A 5IIFA 4I65A 1EQTA 4Y7NH 4DR6Q 1GUSA 1NMGA 1U4MA 3D8GA 3K5NA 1SYEA 2Z4IA 3MEHA 3G7LA 4QL5A 1V9PA 1V8QA 4NXMQ 1K73C 1QOHA 1LTID 4A3JG 4CDFC 4FF3A 2CFMA 4OEMB 1VF7A 4K14A 1HZBA 1HTLD 2V1CC 3D31A 3FP9A 5ELEA 1CQVA 4DGZA 2K04A 2VQEL 5BR8Q 3AQQA 4HJAA 5T1GA 1IYJB 1MD2D 5M5YB 5M5WH 2ZJRA 2NN6H 4PMWA 2KCMA 4RHRA 1SR3A 5JEAJ 2KHJA 2FMCA 4RFBA 4V0BA 1AN8A 5M3MB 3K0YA 1TWAH 1EFWA 1T5XD 5FKAC 3E3XA 2O2LD 1L0XB 4DAMA 1KC8C 2F4VQ 3GTMB 1YI2A 4OWTB 2JA6G 1FGBD 4G7ZC 3PIO3 4GKKL 3BDOA 3AYHB 4DR5L 2DUDA 1VQEA 5IT9L 1I4QA 1O78A 2HCIA 2E5LQ 3K81C 3GD7A 4NPSA 4JI2L 2BA1A 4BY7G 4K2KA 1SYFA 3OW2A 2K32A 2HUGA 3M85A 1TWCB 3I4MH 1A0IA 4RGNA
chains in the Genus database with same CATH topology
2HHHQ 2ATWA 1L0WA 1XMOL 4DR7L 3J7A5 2JEBI 1CKMA 1HJPA 3I2ZA 3I7FA 4C2MH 1VQ4A 4TVAB 1Y14B 2Q2UA 2YU9H 2IX1A 3TS2A 3JAMc 4HIOA 4A3EH 4JI0L 3HKZG 2VUMH 4JI6L 2NN6G 2K5HA 1S40A 4R4TA 4C3IH 2YTYA 2QGQA 2Y0SE 3Q8DA 1IBKL 2RCNA 5LMUQ 3ULJA 2NVQH 5JEAG 1WCMH 3F2DA 2WAQE 1VQ5A 3BU2A 2F4VL 1VQHA 1NY4A 4RG1A 1FJGQ 3RN2A 1PH9A 3CD6A 4OO1I 5ELOA 4YWMA 1VQIA 4BBSH 5LMNQ 3ULPA 4HIMA 4A3DH 4K0KL 1S3OA 1VQMA 1VCIA 1OXVA 2BH8A 2NN6I 1VQDA 1GKHA 3CC7A 1YJNA 5C0XG 3HOZH 1A62A 1WFQA 4DUYQ 5IP9H 4YHHL 3DLLA 4DV3Q 1K8AC 4LFBQ 1EYGA 4A3CH 3W5OA 5IYDH 1B7YB 4X66Q 4OWWB 2E2IH 1E1TA 4A3LG 2I5HA 4GLXA 1X9NA 1X55A 1UE7A 4HJ9A 1VQLA 4LF6L 3FKIG 1E7ZA 2D62A 3G71A 1XNRL 2Z6KC 3K7AH 2PI2E 3OYYA 3AFPA 3PF5A 4KHPQ 2VL6A 1KL9A 2UXBL 3I4MG 1PH2A 2WP8J 1HNZL 2E2JH 3AFQA 2B63H 1L1OC 3RR5A 4JI4Q 3RN5A 4JBJA 4LWCA 2N78A 4IFDJ 1PH3A 4A3EG 4R4CA 4BA1I 1SE8A 1K9MC 1MKHA 4LW1A 1KQSA 1BBWA 1Z47A 2K5VA 2VQEQ 3CPWA 1U0LA 1MIUA 3J7ZC 3BJUA 1M90C 3GTKH 1D7QA 4DAYB 4A3GH 4UPAA 3J81i 1YITA 2IT1A 1PA6A 1FVIA 1WCMG 3ZJYC 2NVXH 3EBEA 3PO3H 1P8LA 4JI7Q 1QVCA 2HQLA 2JA9A 3CCLA 2JA7H 2JA5H 1G291 4QQBX 5JJLA 3MEFA 4GOPA 4BBSG 4PZ8A 4A3DG 4JI3L 3K7UC 3L2PA 1IBLQ 3UDFA 1K0RA 4IPDA 4UP9A 5IP7H 1HZCA 5M5XH 3HOZG 2QA4A 4MTNA 5IP9G 1EWIA 3BZKA 2IY5B 1N36Q 4A3CG 4UP8A 5IYDG 2UUCL 4YCUA 5C4XH 4HJ7A 1YHQA 1M1KC 1Q46A 2K5NA 4P73A 2DGYA 4GKKQ 1PV4A 4NB3A 2MNAA 1Q86C 1N33Q 3KOJA 4LNQA 1EUJA 1HZ9A 3B6YA 4MNOA 3RLFA 4FDBA 4DR5Q 3J81j 1Y1WH 4DUZQ 1JJ2A 5M3FH 1C9OA 4JI8Q 1EQRA 2BA0A 1VQ9A 1AE2A 1OXUA 3FHWA 4J15A 3J81c 5IYCH 4A3BH 1BBUA 2MO0A 2QEXA 4JI2Q 1MJCA 1UE5A 4O0AA 4BY1H 2B63G 4DR3L 4DV4L 1PYBA 4GN4B 4L5TA 3T1HL 4OXPA 4LF7Q 3VDYA 2ES2A 3KJOA 1W2BA 3KF6B 5ELNA 4AQYQ 3HKZE 4DR7Q 1XMOQ 1AE3A 2KBNA 4KLKA 2NVTH 3GTGH 4A3GG 1E3PA 1X54A 4JI0Q 4DV7L 3M7NA 1T9HA 1IZ6A 4QGUA 4OX9L 3PO3G 4JI6Q 2JA7G 2ZJPA 3PSIA 2JA5G 3A0JA 1IBKQ 5M5YH 4KHZA 2LSSA 4IFDI 1XTDA 4IJHA 3A5UA 2AWNA 1PHJA 3G4SA 1QUQB 1YHAA 3PUVA 1BVSA 5IP7G 5H1SE 3CC2A 1EIYB 1XPOA 4EQ5A 1QZGA 2JEAI 5C0XJ 3M4PA 1OXXK 2LXKA 3HOXH 4K0KQ 1AH9A 2FXQA 4POFA 1VQAA 1TWFH 1EIFA 1VQFA 3F1ZA 4UP7A 2R93H 1PVOA 5FLXc 4YHHQ 4B3TL 3OTOL 3GTMH 2AKWB 3H3VH 2UXDL 1I50H 1WI5A 3KLWA 1NE3A 3DM3A 1L1OB 4GS3A 4GLAC 4L5QA 4DK3C 3PIOA 1Y1WG 5M3FG 4GKJL 4DV1Q 1VQ7A 2A8VA 2UUAL 4O2DA 2F52A 5IYCG 4A3BG 4LF6Q 3RZOH 2H5XA 2JK8A 4BY1G 4DV2L 1KIXA 4GNXB 1XNRQ 3H15A 4IOCA 2B29A 4DPGA 4X65L 2UXBQ 1YHBA 3UDXA 5GAHC 3S14H 1HNZQ 3S24A 4BXXH 3S17H 4X62L 1A63A 1YEZA 1HNWL 1I94L 4DR2L 1E22A 1RIPA 4OONA 5JJIA 1L2FA 3CCRA 2VZAA 3HKSA 4DKAC 3PCOB 1GD7A 1VQ8A 1VS0A 1ASYA 1KAWA 1K3RA 2CWPA 4P75A 4R4QA 2K4KA 2L15A 4JG2A 3S15H 2JQOA 1B70B 2CKZB 4LFCL 3HOXG 2UXCL 4L5RC 4JI3Q 4LUVA 3CW2C 1E1OA 2VQFL 2NZHA 3J80i 2R93G 3CCJA 2CCZA 4HJ8A 1S72A 1Y1VH 4YY3L 1P16A 5HY6A 4DK6C 3U50C 1X65A 2VS1A 1YZ6A 4DV1L 2KCTA 4HJ5A 1NJIC 2UUCQ 1XNQQ 2B3GA 3GTJH 1CSPA 4LF8L 3PUXA 1HR0L 2GVBA 3L7ZC 2PQAB 3S2DH 3S1RH 2BH2A 5C0XI 1KD1C 1W3SA 1JB7A 1Q7YC 2EQSA 1ASZA 1WYDA 1IBML 3HOWH 2ALYB 1CKOA 1TWHH 2EIFA 2GN5A 2KHIA 4DR4Q 1FL0A 3H3VI 3ICEA 5GAGC 3RZDH 4B3ML 1FGUA 1X56A 2CQOA 3NENA 2HIXA 3HFZB 3E9IA 1LUZA 3PUYA 2VUMG 1G51A 4IJLA 5C44H 3TQYA 4DV4Q 4DR3Q 3T1HQ 4LUOA 4B3SL 4LF5L 1H95A 4DR1Q 3UDGA 1CKNB 3KF6A 3HOYH 1YBYA 3TRZA 4NXNQ 1N32L 4BA2I 1JJCB 3M4QA 4YWLA 2JE6I 4IOAA 3LGJA 4LF4L 1Q8KA 1UE1A 3CQZH 1Q1EA 3SGIA 1XPUA 1G6PA 4DV7Q 4OX9Q 5GAEC 2R6GA 1PH7A 3L0OA 4QY7A 1UEBA 1J5EQ 4LF9L 4A4IA 3HOVH 3I4OA 3ULLA 1QUQA 4C3JH 1XMQL 2YTVA 1NTGA 4ME3A 5K36G 5GROA 3F2CA 3G48A 1XNQL 1JE5A 1Y1VG 3S2HH 3A5ZB 2RHQB 3I56A 1XJVA 4HIDA 5EAYA 4JV5L 3CCQA 2MO1A 4KI0A 4JBKA 4APVA 3CCEA 4B3TQ 2PMZE 3OTOQ 3GTLH 4A93H 2UXDQ 1L1OA 2GVAA 1SROA 1QVGA 3HOWG 5IYBH 2K14A 1R9TH 5C4JH 3CCMA 4GN3B 1HNXL 1HR0W 4LFAL 5IWAL 2Q2TA 4GKJQ 2OTJA 3ERSX 1A8VA 2UUAQ 3S16H 1Q1BA 3CPFA 4R4OA 1N9WA 2K52A 3A74A 2Q2IA 4DR1L 4C3HH 2RF4A 4GNXA 3GDEA 4DV2Q 4BXXG 4NXNL 5C44G 4A3FH 1LTLA 2A19A 2KENA 3HOYG 4X65Q 3I4NH 4WJ3M 2K50A 3PV0A 4X62Q 2ZM6L 1OXSC 1SFOH 1HNWQ 1J5EL 1I94Q 1VQPA 2IHEA 2JJQA 4DR2Q 4AIMA 1GM5A 2R92H 4XTCS 1VQ6A 1QZHA 3HOVG 1DGSA 3NELA 4JCVE 2OTLA 1UE6A 1B8AA 5M3MH 3S1NH 3RLOA 3M4OH 4DV5L 4AYBG 4B3RL 4AH6A 5C4XG 4R1JA 4LFCQ 1PYSB 1VQCA 2UXCQ 2D0OA 2ZTEA 3H0GH 2VQFQ 2R7ZH 2K75A 1GO3E 2A1AA 4DNIA 4YY3Q 4YCVA 4BBRH 5LMNW 4A93G 1YVCA 2LXJA 2PQAA 5E7NA 4LF8Q 1HR0Q 4DR6L 1VQBA 3PF4A 4QIWE 3JAMi 3TS0A 3KDFB 4YCWA 3GTPH 1YNXA 2F3IA 3PUZA 4JI5L 2I5MX 1IBMQ 2HT1A 4A3FG 4POGA 4PZ7A 2WB1G 4NXML 4JC0A 5AJ3Q 3I4NG 5GADC 1KRSA 4B3MQ 1NBWA 4JBMA 1TWCH 5FLMH 1VQNA 1E24A 5JJKA 1KXLA 1GVPA 3UE0A 2E8GA 4B3SQ 1CKNA 2EXDA 2WFWA 1EOVA 3ER0A 1XPRA 4LF5Q 3E9HA 2PI2A 3KFUA 1N8RC 3S1MH 1N32Q 2IX0A 4DV6L 4A3KH 2R92G 1V43A 5BR8L 4LF4Q 2I5LX 1I5FA 2XTIA 2Q2HA 1QVFA 2R7DA 3KJPA 5GQOA 3U58A 1IL2A 2Z0SA 5M3MG 4WJ4A 4OO1G 4DV0L 1I6HH 2XGTA 4LF9Q 1LYLA 5FJ8H 3CC4A 2VNUD 4PG3A 3F2BA 2YTXA 4JOIA 3HOUH 3CXCA 5C3EH 3BZCA 1XMQQ 3H0GG 2R7ZG 1U5KA 4XIGS 3S1QH 1NMFA 1X3EA 3CMEA 1J6QA 2MQHA 4BBRG 1N34L 2PNHA 4JYAL 4JV5Q 2I0QA 1KRTA 2UUBL 3D0FA 2YV5A 4JI1L 3CCUA 2ZTDA 3KYHC 1K83H 4YWKA 3STBC 5DLQE 1SLJA 3M9BA 2UU9L 1YJWA 3T1YL 1K8GA 4UY8C 5AJ3L 1VQOA 3E0EA 4ALPA 4GOPC 2MFIA 4JBWA 3GTOH 1HNXQ 4LFAQ 2RHSB 5IWAQ 4DR4L 2VW9A 3NEMA 1YIJA 5FLMG 4PZ6A 2ASBA 1SRUA 1Q82C 3W1BA 2R7FA 1SMXA 1OTCA 2E5LL 2ID0A 3RLNA 3TEHB 1HH2P 2AHOB 4IPCA 3CP0A 3J80c 4A3JH 1Q12A 1TXYA 2HIVA 4A3MH 3PO2H 4IO9A 2CWAA 4A3KG 1X3FA 2OQKA 5IY0A 2ZM6Q 2OCEA 1HZAA 3F8TA 2HHHL 4LUZA 3RNUA 4GLVB 2OQ0A 4EX5A 1PH4A 2JA8H 4GN5A 4Y52H 1MJEA 3MXNB 2E2HH 4L5SA 5FJ8G 4A75A 3JC66 4AYBE 3W1GA 3HOUG 4TQUS 3UDIA 5C3EG 5LMUL 2ZTCA 4X6AH 1UWVA 3U4VA 1PH8A 1D8LA 1C0AA 4H02A 4DV5Q 4B3RQ 4GNXC 1FJGL 2Y0SG 2Z6KA 1JMCA 4A3IH 2N3SA 4R4IA 4A76A 1PH5A 2N8NA 5LMNL 1JJGA 2NVYH 2WAQG 3UE1A 1PH6A 4P74A 1I3QH 1VQKA 2IHFA 4DUYL 1CSQA 1Z9FA 4DV3L 4X64Q 4LFBL 5IT9c 4DR6Q 3KDFA 4X66L 4Y7NH 2JA6H 1NMGA 4RMFA 2WB1E 3GTQH 2ZJQA 4JI5Q 3PUWA 4P71A 1YJ9A 4OWXB 1TWGH 3KF8B 4QL5A 2OWOA 1V9PA 3NBHB 3CF5A 4NXMQ 4A3MG 4A3JG 2YYZA 1K73C 3CAMA 3PO2G 3IRBA 4KHPL 2D0PA 2CFMA 1HZBA 2V1CC 3D31A 3FP9A 4JI4L 4BY7H 1CUKA 1RL2A 2JA8G 1PFSA 1BKBA 3K0XA 3U4ZA 4DV6Q 1O7IA 2AMCB 2VQEL 5BR8Q 3AQQA 4HJAA 2N49A 4IFDG 3PGZA 3CMAA 5J3BA 1IYJB 4IPGA 4P72A 1JT8A 5M5WH 4DV0Q 4JI7L 1VQJA 2ZJRA 1OXTA 4PMWA 1PH1A 3EN2A 4A3IG 2KCMA 1SR3A 5JEAJ 4GOPB 2KHJA 3M3YH 1V1QA 3WWVA 3G6EA 3CCVA 1TWAH 1IBLL 1EFWA 4MZ9A 3I55A 1KHIA 1LM0A 5IYBG 4X64L 5IE8A 1X6OA 1WJJA 1N34Q 4DAMA 1EQQA 1KC8C 1N36L 2F4VQ 3AEVA 4JYAQ 2UUBQ 3EIVA 1YI2A 4JI1Q 4HIKA 1C7YA 4OWTB 2UU9Q 2JA6G 1SN8A 1Q81C 3T1YQ 1VQGA 2AWOA 4GKKL 3K8AA 1N33L 4QJFA 3GO5A 3AYHB 4DR5L 3TREA 1WOCA 2VY3A 4DUZL 4JI8L 3STBD 2DUDA 4A3LH 2NZOA 1VQEA 4JOIC 2E5LQ 5HGQA 3K81C 3GD7A 4NPSA 4JI2L 3FKIH 4IPHA 2BA1A 3CCSA 4BY7G 3PIPA 3OW2A 2C35B 1IXRA 4LF7L 3K80C 3M85A 1X3GA 3I4MH 1A0IA 4AQYL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH Q;  2ATW A;  1L0W A;  1XMO L;  4DR7 L;  3J7A 5;  2JEB I;  1CKM A;  1HJP A;  3I2Z A;  3I7F A;  4C2M H;  1VQ4 A;  4TVA B;  1Y14 B;  2Q2U A;  2YU9 H;  2IX1 A;  3TS2 A;  3JAM c;  4HIO A;  4A3E H;  4JI0 L;  3HKZ G;  2VUM H;  4JI6 L;  2NN6 G;  2K5H A;  1S40 A;  4R4T A;  4C3I H;  2YTY A;  2QGQ A;  2Y0S E;  3Q8D A;  1IBK L;  2RCN A;  5LMU Q;  3ULJ A;  2NVQ H;  5JEA G;  1WCM H;  3F2D A;  2WAQ E;  1VQ5 A;  3BU2 A;  2F4V L;  1VQH A;  1NY4 A;  4RG1 A;  1FJG Q;  3RN2 A;  1PH9 A;  3CD6 A;  4OO1 I;  5ELO A;  4YWM A;  1VQI A;  4BBS H;  5LMN Q;  3ULP A;  4HIM A;  4A3D H;  4K0K L;  1S3O A;  1VQM A;  1VCI A;  1OXV A;  2BH8 A;  2NN6 I;  1VQD A;  1GKH A;  3CC7 A;  1YJN A;  5C0X G;  3HOZ H;  1A62 A;  1WFQ A;  4DUY Q;  5IP9 H;  4YHH L;  3DLL A;  4DV3 Q;  1K8A C;  4LFB Q;  1EYG A;  4A3C H;  3W5O A;  5IYD H;  1B7Y B;  4X66 Q;  4OWW B;  2E2I H;  1E1T A;  4A3L G;  2I5H A;  4GLX A;  1X9N A;  1X55 A;  1UE7 A;  4HJ9 A;  1VQL A;  4LF6 L;  3FKI G;  1E7Z A;  2D62 A;  3G71 A;  1XNR L;  2Z6K C;  3K7A H;  2PI2 E;  3OYY A;  3AFP A;  3PF5 A;  4KHP Q;  2VL6 A;  1KL9 A;  2UXB L;  3I4M G;  1PH2 A;  2WP8 J;  1HNZ L;  2E2J H;  3AFQ A;  2B63 H;  1L1O C;  3RR5 A;  4JI4 Q;  3RN5 A;  4JBJ A;  4LWC A;  2N78 A;  4IFD J;  1PH3 A;  4A3E G;  4R4C A;  4BA1 I;  1SE8 A;  1K9M C;  1MKH A;  4LW1 A;  1KQS A;  1BBW A;  1Z47 A;  2K5V A;  2VQE Q;  3CPW A;  1U0L A;  1MIU A;  3J7Z C;  3BJU A;  1M90 C;  3GTK H;  1D7Q A;  4DAY B;  4A3G H;  4UPA A;  3J81 i;  1YIT A;  2IT1 A;  1PA6 A;  1FVI A;  1WCM G;  3ZJY C;  2NVX H;  3EBE A;  3PO3 H;  1P8L A;  4JI7 Q;  1QVC A;  2HQL A;  2JA9 A;  3CCL A;  2JA7 H;  2JA5 H;  1G29 1;  4QQB X;  5JJL A;  3MEF A;  4GOP A;  4BBS G;  4PZ8 A;  4A3D G;  4JI3 L;  3K7U C;  3L2P A;  1IBL Q;  3UDF A;  1K0R A;  4IPD A;  4UP9 A;  5IP7 H;  1HZC A;  5M5X H;  3HOZ G;  2QA4 A;  4MTN A;  5IP9 G;  1EWI A;  3BZK A;  2IY5 B;  1N36 Q;  4A3C G;  4UP8 A;  5IYD G;  2UUC L;  4YCU A;  5C4X H;  4HJ7 A;  1YHQ A;  1M1K C;  1Q46 A;  2K5N A;  4P73 A;  2DGY A;  4GKK Q;  1PV4 A;  4NB3 A;  2MNA A;  1Q86 C;  1N33 Q;  3KOJ A;  4LNQ A;  1EUJ A;  1HZ9 A;  3B6Y A;  4MNO A;  3RLF A;  4FDB A;  4DR5 Q;  3J81 j;  1Y1W H;  4DUZ Q;  1JJ2 A;  5M3F H;  1C9O A;  4JI8 Q;  1EQR A;  2BA0 A;  1VQ9 A;  1AE2 A;  1OXU A;  3FHW A;  4J15 A;  3J81 c;  5IYC H;  4A3B H;  1BBU A;  2MO0 A;  2QEX A;  4JI2 Q;  1MJC A;  1UE5 A;  4O0A A;  4BY1 H;  2B63 G;  4DR3 L;  4DV4 L;  1PYB A;  4GN4 B;  4L5T A;  3T1H L;  4OXP A;  4LF7 Q;  3VDY A;  2ES2 A;  3KJO A;  1W2B A;  3KF6 B;  5ELN A;  4AQY Q;  3HKZ E;  4DR7 Q;  1XMO Q;  1AE3 A;  2KBN A;  4KLK A;  2NVT H;  3GTG H;  4A3G G;  1E3P A;  1X54 A;  4JI0 Q;  4DV7 L;  3M7N A;  1T9H A;  1IZ6 A;  4QGU A;  4OX9 L;  3PO3 G;  4JI6 Q;  2JA7 G;  2ZJP A;  3PSI A;  2JA5 G;  3A0J A;  1IBK Q;  5M5Y H;  4KHZ A;  2LSS A;  4IFD I;  1XTD A;  4IJH A;  3A5U A;  2AWN A;  1PHJ A;  3G4S A;  1QUQ B;  1YHA A;  3PUV A;  1BVS A;  5IP7 G;  5H1S E;  3CC2 A;  1EIY B;  1XPO A;  4EQ5 A;  1QZG A;  2JEA I;  5C0X J;  3M4P A;  1OXX K;  2LXK A;  3HOX H;  4K0K Q;  1AH9 A;  2FXQ A;  4POF A;  1VQA A;  1TWF H;  1EIF A;  1VQF A;  3F1Z A;  4UP7 A;  2R93 H;  1PVO A;  5FLX c;  4YHH Q;  4B3T L;  3OTO L;  3GTM H;  2AKW B;  3H3V H;  2UXD L;  1I50 H;  1WI5 A;  3KLW A;  1NE3 A;  3DM3 A;  1L1O B;  4GS3 A;  4GLA C;  4L5Q A;  4DK3 C;  3PIO A;  1Y1W G;  5M3F G;  4GKJ L;  4DV1 Q;  1VQ7 A;  2A8V A;  2UUA L;  4O2D A;  2F52 A;  5IYC G;  4A3B G;  4LF6 Q;  3RZO H;  2H5X A;  2JK8 A;  4BY1 G;  4DV2 L;  1KIX A;  4GNX B;  1XNR Q;  3H15 A;  4IOC A;  2B29 A;  4DPG A;  4X65 L;  2UXB Q;  1YHB A;  3UDX A;  5GAH C;  3S14 H;  1HNZ Q;  3S24 A;  4BXX H;  3S17 H;  4X62 L;  1A63 A;  1YEZ A;  1HNW L;  1I94 L;  4DR2 L;  1E22 A;  1RIP A;  4OON A;  5JJI A;  1L2F A;  3CCR A;  2VZA A;  3HKS A;  4DKA C;  3PCO B;  1GD7 A;  1VQ8 A;  1VS0 A;  1ASY A;  1KAW A;  1K3R A;  2CWP A;  4P75 A;  4R4Q A;  2K4K A;  2L15 A;  4JG2 A;  3S15 H;  2JQO A;  1B70 B;  2CKZ B;  4LFC L;  3HOX G;  2UXC L;  4L5R C;  4JI3 Q;  4LUV A;  3CW2 C;  1E1O A;  2VQF L;  2NZH A;  3J80 i;  2R93 G;  3CCJ A;  2CCZ A;  4HJ8 A;  1S72 A;  1Y1V H;  4YY3 L;  1P16 A;  5HY6 A;  4DK6 C;  3U50 C;  1X65 A;  2VS1 A;  1YZ6 A;  4DV1 L;  2KCT A;  4HJ5 A;  1NJI C;  2UUC Q;  1XNQ Q;  2B3G A;  3GTJ H;  1CSP A;  4LF8 L;  3PUX A;  1HR0 L;  2GVB A;  3L7Z C;  2PQA B;  3S2D H;  3S1R H;  2BH2 A;  5C0X I;  1KD1 C;  1W3S A;  1JB7 A;  1Q7Y C;  2EQS A;  1ASZ A;  1WYD A;  1IBM L;  3HOW H;  2ALY B;  1CKO A;  1TWH H;  2EIF A;  2GN5 A;  2KHI A;  4DR4 Q;  1FL0 A;  3H3V I;  3ICE A;  5GAG C;  3RZD H;  4B3M L;  1FGU A;  1X56 A;  2CQO A;  3NEN A;  2HIX A;  3HFZ B;  3E9I A;  1LUZ A;  3PUY A;  2VUM G;  1G51 A;  4IJL A;  5C44 H;  3TQY A;  4DV4 Q;  4DR3 Q;  3T1H Q;  4LUO A;  4B3S L;  4LF5 L;  1H95 A;  4DR1 Q;  3UDG A;  1CKN B;  3KF6 A;  3HOY H;  1YBY A;  3TRZ A;  4NXN Q;  1N32 L;  4BA2 I;  1JJC B;  3M4Q A;  4YWL A;  2JE6 I;  4IOA A;  3LGJ A;  4LF4 L;  1Q8K A;  1UE1 A;  3CQZ H;  1Q1E A;  3SGI A;  1XPU A;  1G6P A;  4DV7 Q;  4OX9 Q;  5GAE C;  2R6G A;  1PH7 A;  3L0O A;  4QY7 A;  1UEB A;  1J5E Q;  4LF9 L;  4A4I A;  3HOV H;  3I4O A;  3ULL A;  1QUQ A;  4C3J H;  1XMQ L;  2YTV A;  1NTG A;  4ME3 A;  5K36 G;  5GRO A;  3F2C A;  3G48 A;  1XNQ L;  1JE5 A;  1Y1V G;  3S2H H;  3A5Z B;  2RHQ B;  3I56 A;  1XJV A;  4HID A;  5EAY A;  4JV5 L;  3CCQ A;  2MO1 A;  4KI0 A;  4JBK A;  4APV A;  3CCE A;  4B3T Q;  2PMZ E;  3OTO Q;  3GTL H;  4A93 H;  2UXD Q;  1L1O A;  2GVA A;  1SRO A;  1QVG A;  3HOW G;  5IYB H;  2K14 A;  1R9T H;  5C4J H;  3CCM A;  4GN3 B;  1HNX L;  1HR0 W;  4LFA L;  5IWA L;  2Q2T A;  4GKJ Q;  2OTJ A;  3ERS X;  1A8V A;  2UUA Q;  3S16 H;  1Q1B A;  3CPF A;  4R4O A;  1N9W A;  2K52 A;  3A74 A;  2Q2I A;  4DR1 L;  4C3H H;  2RF4 A;  4GNX A;  3GDE A;  4DV2 Q;  4BXX G;  4NXN L;  5C44 G;  4A3F H;  1LTL A;  2A19 A;  2KEN A;  3HOY G;  4X65 Q;  3I4N H;  4WJ3 M;  2K50 A;  3PV0 A;  4X62 Q;  2ZM6 L;  1OXS C;  1SFO H;  1HNW Q;  1J5E L;  1I94 Q;  1VQP A;  2IHE A;  2JJQ A;  4DR2 Q;  4AIM A;  1GM5 A;  2R92 H;  4XTC S;  1VQ6 A;  1QZH A;  3HOV G;  1DGS A;  3NEL A;  4JCV E;  2OTL A;  1UE6 A;  1B8A A;  5M3M H;  3S1N H;  3RLO A;  3M4O H;  4DV5 L;  4AYB G;  4B3R L;  4AH6 A;  5C4X G;  4R1J A;  4LFC Q;  1PYS B;  1VQC A;  2UXC Q;  2D0O A;  2ZTE A;  3H0G H;  2VQF Q;  2R7Z H;  2K75 A;  1GO3 E;  2A1A A;  4DNI A;  4YY3 Q;  4YCV A;  4BBR H;  5LMN W;  4A93 G;  1YVC A;  2LXJ A;  2PQA A;  5E7N A;  4LF8 Q;  1HR0 Q;  4DR6 L;  1VQB A;  3PF4 A;  4QIW E;  3JAM i;  3TS0 A;  3KDF B;  4YCW A;  3GTP H;  1YNX A;  2F3I A;  3PUZ A;  4JI5 L;  2I5M X;  1IBM Q;  2HT1 A;  4A3F G;  4POG A;  4PZ7 A;  2WB1 G;  4NXM L;  4JC0 A;  5AJ3 Q;  3I4N G;  5GAD C;  1KRS A;  4B3M Q;  1NBW A;  4JBM A;  1TWC H;  5FLM H;  1VQN A;  1E24 A;  5JJK A;  1KXL A;  1GVP A;  3UE0 A;  2E8G A;  4B3S Q;  1CKN A;  2EXD A;  2WFW A;  1EOV A;  3ER0 A;  1XPR A;  4LF5 Q;  3E9H A;  2PI2 A;  3KFU A;  1N8R C;  3S1M H;  1N32 Q;  2IX0 A;  4DV6 L;  4A3K H;  2R92 G;  1V43 A;  5BR8 L;  4LF4 Q;  2I5L X;  1I5F A;  2XTI A;  2Q2H A;  1QVF A;  2R7D A;  3KJP A;  5GQO A;  3U58 A;  1IL2 A;  2Z0S A;  5M3M G;  4WJ4 A;  4OO1 G;  4DV0 L;  1I6H H;  2XGT A;  4LF9 Q;  1LYL A;  5FJ8 H;  3CC4 A;  2VNU D;  4PG3 A;  3F2B A;  2YTX A;  4JOI A;  3HOU H;  3CXC A;  5C3E H;  3BZC A;  1XMQ Q;  3H0G G;  2R7Z G;  1U5K A;  4XIG S;  3S1Q H;  1NMF A;  1X3E A;  3CME A;  1J6Q A;  2MQH A;  4BBR G;  1N34 L;  2PNH A;  4JYA L;  4JV5 Q;  2I0Q A;  1KRT A;  2UUB L;  3D0F A;  2YV5 A;  4JI1 L;  3CCU A;  2ZTD A;  3KYH C;  1K83 H;  4YWK A;  3STB C;  5DLQ E;  1SLJ A;  3M9B A;  2UU9 L;  1YJW A;  3T1Y L;  1K8G A;  4UY8 C;  5AJ3 L;  1VQO A;  3E0E A;  4ALP A;  4GOP C;  2MFI A;  4JBW A;  3GTO H;  1HNX Q;  4LFA Q;  2RHS B;  5IWA Q;  4DR4 L;  2VW9 A;  3NEM A;  1YIJ A;  5FLM G;  4PZ6 A;  2ASB A;  1SRU A;  1Q82 C;  3W1B A;  2R7F A;  1SMX A;  1OTC A;  2E5L L;  2ID0 A;  3RLN A;  3TEH B;  1HH2 P;  2AHO B;  4IPC A;  3CP0 A;  3J80 c;  4A3J H;  1Q12 A;  1TXY A;  2HIV A;  4A3M H;  3PO2 H;  4IO9 A;  2CWA A;  4A3K G;  1X3F A;  2OQK A;  5IY0 A;  2ZM6 Q;  2OCE A;  1HZA A;  3F8T A;  2HHH L;  4LUZ A;  3RNU A;  4GLV B;  2OQ0 A;  4EX5 A;  1PH4 A;  2JA8 H;  4GN5 A;  4Y52 H;  1MJE A;  3MXN B;  2E2H H;  4L5S A;  5FJ8 G;  4A75 A;  3JC6 6;  4AYB E;  3W1G A;  3HOU G;  4TQU S;  3UDI A;  5C3E G;  5LMU L;  2ZTC A;  4X6A H;  1UWV A;  3U4V A;  1PH8 A;  1D8L A;  1C0A A;  4H02 A;  4DV5 Q;  4B3R Q;  4GNX C;  1FJG L;  2Y0S G;  2Z6K A;  1JMC A;  4A3I H;  2N3S A;  4R4I A;  4A76 A;  1PH5 A;  2N8N A;  5LMN L;  1JJG A;  2NVY H;  2WAQ G;  3UE1 A;  1PH6 A;  4P74 A;  1I3Q H;  1VQK A;  2IHF A;  4DUY L;  1CSQ A;  1Z9F A;  4DV3 L;  4X64 Q;  4LFB L;  5IT9 c;  4DR6 Q;  3KDF A;  4X66 L;  4Y7N H;  2JA6 H;  1NMG A;  4RMF A;  2WB1 E;  3GTQ H;  2ZJQ A;  4JI5 Q;  3PUW A;  4P71 A;  1YJ9 A;  4OWX B;  1TWG H;  3KF8 B;  4QL5 A;  2OWO A;  1V9P A;  3NBH B;  3CF5 A;  4NXM Q;  4A3M G;  4A3J G;  2YYZ A;  1K73 C;  3CAM A;  3PO2 G;  3IRB A;  4KHP L;  2D0P A;  2CFM A;  1HZB A;  2V1C C;  3D31 A;  3FP9 A;  4JI4 L;  4BY7 H;  1CUK A;  1RL2 A;  2JA8 G;  1PFS A;  1BKB A;  3K0X A;  3U4Z A;  4DV6 Q;  1O7I A;  2AMC B;  2VQE L;  5BR8 Q;  3AQQ A;  4HJA A;  2N49 A;  4IFD G;  3PGZ A;  3CMA A;  5J3B A;  1IYJ B;  4IPG A;  4P72 A;  1JT8 A;  5M5W H;  4DV0 Q;  4JI7 L;  1VQJ A;  2ZJR A;  1OXT A;  4PMW A;  1PH1 A;  3EN2 A;  4A3I G;  2KCM A;  1SR3 A;  5JEA J;  4GOP B;  2KHJ A;  3M3Y H;  1V1Q A;  3WWV A;  3G6E A;  3CCV A;  1TWA H;  1IBL L;  1EFW A;  4MZ9 A;  3I55 A;  1KHI A;  1LM0 A;  5IYB G;  4X64 L;  5IE8 A;  1X6O A;  1WJJ A;  1N34 Q;  4DAM A;  1EQQ A;  1KC8 C;  1N36 L;  2F4V Q;  3AEV A;  4JYA Q;  2UUB Q;  3EIV A;  1YI2 A;  4JI1 Q;  4HIK A;  1C7Y A;  4OWT B;  2UU9 Q;  2JA6 G;  1SN8 A;  1Q81 C;  3T1Y Q;  1VQG A;  2AWO A;  4GKK L;  3K8A A;  1N33 L;  4QJF A;  3GO5 A;  3AYH B;  4DR5 L;  3TRE A;  1WOC A;  2VY3 A;  4DUZ L;  4JI8 L;  3STB D;  2DUD A;  4A3L H;  2NZO A;  1VQE A;  4JOI C;  2E5L Q;  5HGQ A;  3K81 C;  3GD7 A;  4NPS A;  4JI2 L;  3FKI H;  4IPH A;  2BA1 A;  3CCS A;  4BY7 G;  3PIP A;  3OW2 A;  2C35 B;  1IXR A;  4LF7 L;  3K80 C;  3M85 A;  1X3G A;  3I4M H;  1A0I A;  4AQY L; 
#chains in the Genus database with same CATH topology
 2K7V A;  1STE A;  1L0W A;  2ATW A;  1VQ4 A;  3TS2 A;  1JE4 A;  4KN7 C;  1K3B C;  1SDF A;  2K33 A;  3DWA A;  2A68 C;  4IAL A;  1IBK L;  3MFY A;  3TN2 A;  3WOE A;  2NVQ H;  5JEA G;  3I72 A;  2WAQ E;  1I6H B;  1VQ5 A;  1NY4 A;  4L8J A;  3RN2 A;  1M8A A;  3NK9 A;  2EYO A;  4A3D H;  4K0K L;  4X3T A;  1OXV A;  3S1Q B;  4KD4 A;  3WDN A;  1YJN A;  1SEB D;  2Y0S B;  3HOZ H;  3DLL A;  2NB0 A;  4DV3 Q;  1EYG A;  1Y8O B;  2EY2 A;  1K83 B;  3HOW B;  1AEX A;  2E74 C;  4A3L G;  2I5H A;  4GLX A;  4G4K A;  3KF8 A;  1X9N A;  2D62 A;  1LV9 A;  5CBA E;  1D5Z C;  2WII B;  3MFG A;  3OMC A;  1PH2 A;  4O1N A;  1CA5 A;  2E2J H;  2BE5 C;  5E4X A;  5A2Q E;  4QB4 A;  1SE8 A;  3CQZ B;  4LW1 A;  1SE3 A;  1GHK A;  2PCF B;  1EFI D;  1MIU A;  4N8X 1;  3GTK H;  1RHP A;  4DU9 A;  1D7Q A;  4UPA A;  2DJG C;  3I91 A;  3ZJY C;  3EBE A;  2NVX H;  1QVC A;  2HQL A;  3D6C A;  3CCL A;  2JA5 H;  4FXK C;  5FK9 C;  4JI3 L;  3KBX A;  4KJO A;  4ZKB B;  3R8B A;  1HZC A;  2QA4 A;  3BZK A;  1CZG A;  1BBX C;  3GTL B;  1PDQ A;  3Q24 A;  4HJ7 A;  1R4P B;  1Q46 A;  2K5N A;  5A35 A;  1R9T B;  1E2W A;  5J1Z A;  1II3 A;  1X3P A;  3HRZ C;  1PV4 A;  3KOJ A;  4RCN A;  4CHT B;  3KLS X;  3R2T A;  2AQ1 B;  2EOT A;  3KUP A;  3NTH A;  4C3H B;  4DUZ Q;  1C9O A;  3GQB A;  2BA0 A;  1JJ2 A;  1HA6 A;  2EY6 A;  3SDZ A;  3MXG A;  1STB A;  1UNS A;  4L5T A;  4GN4 B;  1WTQ A;  4ZLT F;  4OXP A;  2KJX A;  1SFO B;  3DEO A;  5ELN A;  2F4I A;  1XMO Q;  1AE3 A;  3ITP A;  2R92 B;  1X54 A;  1I6V C;  2A6H C;  4QGU A;  3PO3 G;  4JI6 Q;  4RKL A;  1TII D;  5CYU A;  4IN3 A;  2XIW A;  5M5Y H;  4KHZ A;  5CR3 A;  4DXF A;  2PQE A;  4IFD I;  1XTD A;  1B9N A;  1YHA A;  3PUV A;  1BVS A;  3CC2 A;  5H1S E;  1XPO A;  2NWG A;  3NBI A;  3E0J A;  1ILP A;  1MSH A;  4MHE A;  5KIX A;  4POF A;  1VQF A;  4UP7 A;  4YHH Q;  3GTM H;  3OTO L;  1WTW A;  4J1M A;  4FYD A;  4GS3 A;  1Y1W G;  1SSO A;  4C1N I;  5M3F G;  4GKJ L;  1KDC A;  2UUA L;  4A3B G;  5EKL A;  3RMH A;  2H5X A;  1STY A;  4DV2 L;  4GNX B;  1CHQ D;  3H15 A;  3FDT A;  1YHB A;  3UDX A;  1HNZ Q;  4GZY C;  2CW0 C;  3ERQ A;  3FKI B;  1A63 A;  1S5C D;  1HNW L;  2K1B A;  4K5W A;  2B39 A;  5JJI A;  3BVM A;  1L2F A;  2ZT9 C;  3CCR A;  5ISR A;  3PCO B;  2B2Y C;  3FVQ A;  5L37 A;  1VQ8 A;  1VS0 A;  1ASY A;  1KAW A;  4P75 A;  2CWP A;  2K4K A;  2L15 A;  4JG2 A;  1LT3 D;  1NNX A;  3HOX G;  1WCM B;  3CW2 C;  3QIA A;  2CCZ A;  1LO5 D;  3O13 A;  4BBS B;  1UEA B;  2VS1 A;  3TP6 A;  2K5W A;  1L0Y B;  1CSP A;  2GVB A;  3L7Z C;  1PXU A;  2PQA B;  4OEL B;  4WFN 3;  1Q90 A;  1SE2 A;  1WYD A;  3HOW H;  4XYQ A;  5FLX L;  1BCP C;  3ICE A;  3P1H A;  3NXW A;  1WTH A;  2VUM G;  4IJL A;  3T1H Q;  1DM0 B;  4LF5 L;  3UDG A;  3MXP A;  1N32 L;  4BA2 I;  2QDL A;  4YWL A;  4LF4 L;  1VMP A;  1Q8K A;  1RJT A;  2Z4H A;  3CQZ H;  2L12 A;  4RA8 A;  1ENC A;  3NSW A;  1JCK B;  1JQY D;  4A3G B;  1F2Z A;  3E6Z X;  2YTV A;  4E6I A;  3K59 A;  2NVY B;  2N88 A;  1CT1 D;  1Y1V G;  3I4L A;  4HID A;  4Z9C B;  1TS2 A;  5M9O A;  1B9M A;  3NE5 B;  1C48 A;  3CCE A;  2VB3 X;  2PMZ E;  1Q3L A;  3GTL H;  3DXJ C;  2GVA A;  4PMC A;  1MSG A;  1R9T H;  1Y8P B;  1HNX L;  2Q2T A;  1WVL A;  2F0I A;  1N9W A;  2K52 A;  4C3H H;  3GDE A;  2F0L A;  4NXN L;  5C44 G;  1LTS D;  2XVS A;  1LTL A;  2A19 A;  3OIQ A;  4XXE A;  1H9K A;  4X65 Q;  3HOY G;  3I4N H;  4WJ3 M;  1QCB D;  2KEE A;  2OT2 A;  4BY1 B;  4TSS A;  1SFO H;  1J5E L;  3Q6S A;  1GM5 A;  2R92 H;  1VQ6 A;  3GTG B;  1ICF B;  2A74 C;  1ESR A;  2OTL A;  4C3J G;  1UE6 A;  4PNY A;  3S1N H;  4OL7 A;  2UXC Q;  4OIJ A;  3H09 A;  1FYC A;  1E2Z A;  3J7A V;  2R7Z H;  1B2T A;  3MZ5 A;  2DY7 A;  2EYJ A;  4YY3 Q;  4YCV A;  4BBR H;  2RCF A;  1EY7 A;  2EY5 A;  2PZU A;  1HR0 Q;  2F0F A;  4S3S A;  4YCW A;  1AFP A;  1YNX A;  4JI5 L;  2B2W C;  3A7L A;  2I5M X;  3T16 A;  3VYR A;  4PZ7 A;  2WB1 G;  2KOL A;  5GAD C;  2RSO A;  4B3M Q;  2IPK D;  1VQN A;  2E8G A;  3SE0 A;  3L3O C;  1N8R C;  2E2D C;  4DV6 L;  3S17 B;  4A3E B;  4QUC A;  1XTC D;  2F0J A;  5I9P A;  4C3I B;  4WJ4 A;  2L9H A;  2F0N A;  2XGT A;  1K28 A;  1LYL A;  1SJE D;  5D65 A;  3F2B A;  3H0G G;  2M00 A;  4HSV A;  1NMF A;  1G6Z A;  4DNT B;  2MQH A;  4QF4 A;  3M4Y A;  4JV5 Q;  1PYW D;  1KRT A;  4JI1 L;  1ZKO A;  1YJW A;  1K8G A;  4UY8 C;  2ICE C;  4ALP A;  4WRD A;  4LFA Q;  1KAA A;  5FOB B;  2VW9 A;  2RKS A;  1SYC A;  5FLM G;  4PZ6 A;  2ASB A;  4BWG B;  2EYL A;  1Q82 C;  2PYK A;  3K5M A;  4KKT A;  3J80 c;  4A3K G;  1X3F A;  2OQK A;  4F87 A;  2EYP A;  4EX5 A;  1C8C A;  2GA4 B;  2JA8 H;  1O80 A;  1O7Y A;  1A2U A;  1QWY A;  4RGM A;  3EFX D;  4ZCK A;  1F2L A;  5FJ8 G;  1Y69 U;  3JC6 6;  3W1G A;  4TQU S;  3UDI A;  5LMU L;  1C0A A;  1TR5 A;  1NR4 A;  4DV5 Q;  1WD0 A;  1FJG L;  2N3S A;  3ERO A;  2N8N A;  1TS5 A;  2NVY H;  2QW7 A;  1PH6 A;  4P74 A;  2IHF A;  1U4L A;  1QIL A;  1CSQ A;  1Z9F A;  4LFB L;  2F0U A;  3H91 A;  2WB1 E;  3K57 A;  3GTQ H;  1YJ9 A;  1XX8 A;  2J7Z A;  3NBH B;  1GOZ A;  1MGS A;  1SXT A;  4A3M G;  1SMY D;  3PO2 G;  4KHP L;  1PRT C;  5LL6 S;  1SJH D;  1PTO C;  4JI4 L;  1CUK A;  1RL2 A;  3SK4 A;  1PZK D;  1H9R A;  1O7I A;  1ONL A;  2N49 A;  4IFD G;  3CMA A;  4HSP A;  5J3B A;  4P72 A;  4PMB A;  4JI7 L;  1VQJ A;  2F3V A;  4A3I G;  3PMF A;  2MUY A;  3T51 B;  1V1Q A;  3G6E A;  3I55 A;  1KHI A;  5IYB G;  4X64 L;  1X6O A;  2ZXO A;  3P20 A;  1W6J A;  4JYA Q;  1N36 L;  2UUB Q;  1VF5 C;  1NR2 A;  2L11 A;  5BN3 A;  3HEJ A;  5G3L D;  1Q81 C;  5C0X H;  1VQG A;  2AWO A;  2O5I C;  3K8A A;  1N33 L;  3OPO A;  4ZK9 B;  3FMC A;  2F0V A;  1AZP A;  3TRE A;  5AFW A;  1Y8N B;  2VY3 A;  1JB3 A;  4JI8 L;  3STB D;  4QIW B;  2DN8 A;  3MXU A;  1IKM A;  1LT6 D;  2F0T A;  3VA7 A;  1KNA A;  5COY A;  3E5S A;  3CCS A;  1IW7 C;  5CMD A;  1K0S A;  2HHH Q;  3KK7 A;  3J7A 5;  4EGV A;  4Q0F A;  1E0B A;  1X32 A;  2IX1 A;  1ESF A;  3MXN A;  3JAM c;  1HFG A;  2RVL A;  4A3E H;  2EJM A;  2PPB C;  2NN6 G;  4HMI A;  4C3I H;  2YTY A;  2QGQ A;  1SAP A;  3PQI A;  1GUW A;  3CD6 A;  4RG1 A;  4LMQ D;  1PTO H;  3ND8 A;  5DAU A;  3HOU B;  4HIM A;  5C3E B;  1PFM A;  1S3O A;  1EZ6 A;  1WFQ A;  4DUY Q;  1STN A;  1ZYR C;  3SR1 A;  3W2D A;  1BUV T;  2WAQ B;  4A3C H;  4HCE A;  4X66 Q;  3OOC A;  4OWW B;  2B2Y A;  1SNC A;  1TKW B;  1TWH B;  3TBI B;  1X55 A;  2WIN B;  5LHY 1;  1VQL A;  4LF6 L;  3SXH A;  2EYF A;  1E7Z A;  5JAV A;  3G71 A;  1XNR L;  3K7A H;  3NP8 A;  3OYY A;  2VL6 A;  2UXB L;  3I4M G;  3A8J E;  3CHB D;  1D1K A;  4DNR B;  2B63 H;  1JWS D;  3RR5 A;  4A3J B;  1SNM A;  2N78 A;  1PH3 A;  1U4R A;  1MKH A;  1GUN A;  2PO4 A;  4DAY B;  3VR6 A;  3HOV B;  2EYM A;  1FVI A;  2JA7 H;  1LAC A;  1G29 1;  2NZ1 D;  4GOP A;  2IJ0 A;  4A3D G;  1V1P A;  3K7U C;  3L2P A;  1IBL Q;  4IPD A;  1HXY D;  5M5X H;  3HOZ G;  1LTA D;  4ID6 A;  3S9W A;  2IY5 B;  1KDB A;  3BYY B;  4A93 B;  2UUC L;  3BVG A;  3IL8 A;  1YHQ A;  3BDC A;  3A54 A;  1GHJ A;  4P73 A;  4ZKC B;  4NB3 A;  1Q86 C;  3VYT A;  4LNQ A;  3S16 B;  4DAP A;  4MNO A;  1YNJ C;  4DR4 L;  2JA6 B;  4A3F B;  1H9S A;  1OXU A;  3J81 c;  2P5Z X;  1TWG B;  2R61 A;  5C5M A;  4O0A A;  2TSS A;  4DR3 L;  4DV4 L;  1AP0 A;  1STA A;  4LF7 Q;  1SND A;  3KJO A;  1VMC A;  4AQY Q;  4DR7 Q;  4DK1 A;  2KBN A;  1DOL A;  2EXZ A;  4JW0 A;  3C1E A;  1BQQ T;  4JVZ A;  4BY7 B;  4JI0 Q;  1R4Q B;  2QKI C;  3T56 B;  2ZJP A;  3PSI A;  2JA5 G;  1RD9 D;  3M4O B;  3KLR A;  4FF4 A;  2LSS A;  3LWE A;  4IJH A;  2AWN A;  3G4S A;  3A8K E;  2F3W A;  1QZG A;  3M4P A;  2LXK A;  1AH9 A;  3M3Y B;  4H44 C;  4ZUI A;  1O7L A;  1VQA A;  1TWF H;  4G57 A;  4B3T L;  3D3R A;  2UXD L;  2NTT A;  4DK3 C;  3DM3 A;  3VYU A;  3PIO A;  4GLA C;  1B50 A;  3TP5 A;  5CV4 A;  1A15 A;  4F88 A;  3HGB A;  1RKN A;  2I46 A;  4NDX A;  3I70 A;  1H9J A;  2B29 A;  2CQA A;  4RAU C;  2HCC A;  4IUN A;  3R93 A;  4DR2 L;  1F9R A;  1RIP A;  4OON A;  2SEB D;  2EE1 A;  3HKS A;  2BE5 D;  5C5L A;  2B2W A;  2F0Q A;  1C4Q A;  1K3R A;  4HAE A;  4CJ1 B;  1CZW A;  2VXW A;  2JQO A;  3KBG A;  1B70 B;  1CTM A;  4LUV A;  1I4P A;  1E1O A;  2NZH A;  3J80 i;  5K36 H;  1S72 A;  1EEI D;  1P16 A;  3QR8 A;  5HY6 A;  1X65 A;  4DV1 L;  4M8A A;  4CBV A;  2Q8R E;  2HDL A;  2XRS D;  4N9P A;  5A2Q L;  5KYI A;  5C0X I;  1ASZ A;  1Q7Y C;  1TWH H;  2EIF A;  1S5D D;  2JP1 A;  2KHI A;  2Z6B A;  4KKU A;  3SK6 A;  4QCL A;  1T5E A;  1IHZ A;  4BXX H;  1A6X A;  3PUY A;  1QE6 A;  4B3S L;  3KF6 A;  1YBY A;  2BOS A;  3TRZ A;  4NXN Q;  1JJC B;  3SEB A;  1B53 A;  3LGJ A;  2E2H B;  5I6W A;  1G6P A;  4DV7 Q;  4OX9 Q;  5GAE C;  1J5E Q;  4LF9 L;  3HOV H;  3I4O A;  1QUQ A;  5CV5 A;  3IKJ A;  1XMQ L;  1NTG A;  3AMU A;  2A6H D;  3K5L A;  1XNQ L;  3A5Z B;  1I3Q B;  2RHQ B;  3I56 A;  2HQE A;  1TQO A;  2Z9H A;  5BN5 A;  5FO9 B;  5K5P A;  3VR4 A;  1KNE A;  4A93 H;  1LTG D;  1L1O A;  3U9S A;  1QVG A;  3HOW G;  4IUP A;  3CCM A;  1Z6H A;  5IWA L;  3S16 H;  3OMG A;  1ZXT A;  1JOQ A;  3DUZ A;  3A74 A;  3NWS A;  2RF4 A;  5D3I B;  1WTO A;  4A3F H;  1NAP A;  2KEN A;  2O5J C;  2PMZ B;  1QNU A;  4KKS A;  2K50 A;  4A3B B;  4X62 Q;  1ICW A;  2QDB A;  4TKO B;  2ZM6 L;  2KEC A;  2Z1C A;  1I94 Q;  2IHE A;  1G2S A;  3P75 A;  4CGY B;  1HUN A;  1GUG A;  5NUC A;  4MIU A;  2WV6 D;  1JOK A;  4DF7 A;  5IGB A;  2LFN A;  5M3M H;  3RLO A;  3M4O H;  4OO1 H;  4B3R L;  4LJZ C;  3ZYY X;  4AH6 A;  5C4X G;  4LFC Q;  2D0O A;  2F0E A;  4L6T B;  2ZTE A;  1D1I A;  2PZW A;  2VQF Q;  2KQ3 A;  3I73 A;  1GO3 E;  5FO8 B;  3HOX B;  1YVC A;  2LXJ A;  3WOF A;  4LF8 Q;  4DR6 L;  3JAM i;  2AQ3 B;  2F3I A;  3OSO A;  1CQF A;  1I50 B;  4C3H G;  1IBM Q;  2HT1 A;  3BYT B;  4POG A;  4NXM L;  3I4N G;  3SHL A;  1NBW A;  4JBM A;  1TWC H;  3RZO B;  3HZX A;  2A6E C;  3PIP 3;  1E24 A;  5JJK A;  1KXL A;  1CKN A;  2EXD A;  1XPR A;  3E9H A;  3KFU A;  1BCP D;  4CKB A;  2R92 G;  1DJR D;  2VUM B;  5BR8 L;  1BDO A;  1B3A A;  2I5L X;  1X3Q A;  2XTI A;  1QVF A;  2R7D A;  4NMZ A;  2AUK A;  4QMG A;  2RDF A;  2M2L A;  1I6H H;  2CVR A;  1G91 A;  1LT5 D;  2XWJ B;  2VNU D;  3VYS A;  1DZ1 A;  2L55 A;  4X3S A;  3CXC A;  3BZC A;  3CRL C;  2TMP A;  2R7Z G;  4IUU A;  3S1Q H;  4KMU C;  3S15 B;  3CME A;  1CFM A;  1J6Q A;  2L1B A;  4BBR G;  2PNH A;  1D5X C;  3KLS A;  2D5D A;  4OIK A;  4PV1 C;  1EU4 A;  3DWP A;  1K83 H;  5IGC A;  5DLQ E;  3M9B A;  1Y1V B;  1SYD A;  4ILW A;  2XRQ D;  5AJ3 L;  5I2Y A;  1VQO A;  3E0E A;  4GOP C;  4DA2 A;  3QB3 A;  3NEM A;  1SRU A;  5EKK A;  3W1B A;  5KND A;  1OTC A;  2E5L L;  1G2T A;  1HH2 P;  2L0C A;  1TXY A;  2SOB A;  3RZD B;  1JOR A;  4IO9 A;  2F0O A;  1HFN A;  5C44 B;  1KAB A;  1F77 A;  4LUZ A;  1PH4 A;  4TRD A;  5CV7 A;  1EY0 A;  5DEH A;  2F0W A;  2PW5 A;  2E2H H;  1DON A;  4FXG C;  2K05 A;  3A55 A;  1H9M A;  2ZTC A;  1UWV A;  3OW7 A;  1PH8 A;  1EYC A;  1JR0 D;  4GNX C;  1A3V A;  3EVQ A;  1BR9 A;  4K6L A;  3UE1 A;  3VA5 A;  4XQJ A;  1WD1 A;  1I3Q H;  1NSN S;  2RA4 A;  3K5O A;  1EZ8 A;  3S2H B;  4DV3 L;  1LLR D;  4HN7 A;  4X64 Q;  3HS0 C;  2MP1 A;  3KDF A;  2ZJQ A;  4IUR A;  1S5E D;  4OWX B;  3KF8 B;  2OWO A;  3C3L A;  1J9O A;  2A69 D;  3IRB A;  3DWQ A;  4H13 C;  2WB1 B;  1IKL A;  2NVT B;  2JA8 G;  1YNN C;  1DYQ A;  3K0X A;  3U4Z A;  2IW3 A;  1F2Y A;  2B8F A;  2RSN A;  1EU3 A;  3J80 L;  1TU2 B;  4IUV A;  1TY2 A;  3H94 A;  4HMJ A;  4IPG A;  1JT8 A;  4DV0 Q;  1PH1 A;  1M4V A;  2RBM A;  3J80 E;  2D2C C;  5EPK A;  3CCV A;  1LM0 A;  3W3A A;  4NP5 A;  1WJJ A;  5HUR A;  1N34 Q;  2R93 B;  2ENB A;  2MPM A;  1EYA A;  3AEV A;  3FPU B;  2UU9 Q;  4ZUJ A;  5ELC A;  3T1Y Q;  2O4X A;  4QJF A;  1DOM A;  1SYG A;  4DUZ L;  4F8M A;  5HGQ A;  3S14 B;  3FKI H;  2C35 B;  1IXR A;  3K80 C;  4O42 A;  1B44 D;  1XMO L;  1HCZ A;  2JSO A;  2JEB I;  1CKM A;  1HJP A;  2EVB A;  3I7F A;  4TVA B;  1Y14 B;  3S1M B;  1HRJ A;  1EOT A;  3HKZ G;  2VUM H;  4JI6 L;  3ND9 A;  3LWU A;  4HCS A;  4XQN A;  2FIN B;  3Q8D A;  2RCN A;  2SNS A;  3ULJ A;  4MN3 A;  2J0T D;  1WCM H;  3F2D A;  3R3O A;  2DJF C;  2KCN A;  4OO1 I;  5ELO A;  4YWM A;  4BBS H;  5LMN Q;  1QB5 D;  1VQM A;  1VQD A;  1GKH A;  5JPN C;  5KGU A;  4LAA A;  5C0X G;  3GTJ B;  1HA5 A;  1PRT B;  3SVM A;  4DAV A;  5IP9 H;  4YHH L;  1RF2 D;  2K03 A;  2EYH A;  3W5O A;  5IYD H;  1B7Y B;  3DMU A;  2B2T C;  1PLF A;  5G3L F;  3T53 B;  4V19 0;  2Z6K C;  2WP8 J;  1HNZ L;  4EQP A;  5CV6 A;  1L1O C;  2J4X A;  3RN5 A;  2HDM A;  4JBJ A;  4DN4 M;  4A3M B;  3PO2 B;  4IFD J;  4KV6 A;  4A3E G;  4BA1 I;  1K9M C;  1KQS A;  1PRT D;  1Z47 A;  2VQE Q;  4PQX A;  3D4D A;  3J7Z C;  3BJU A;  4C3I G;  4A3G H;  1YIT A;  2IT1 A;  1A2T A;  1WTV A;  2CH4 A;  2JA9 A;  4HTH A;  1S5B D;  1TY0 A;  3JAM L;  3CKI B;  4PZ8 A;  3GV3 A;  1K0R A;  4UP9 A;  5IP7 H;  4A3I B;  1DOK A;  1F9P A;  4ABN A;  3NUC A;  4A3C G;  3JAM E;  4R8N A;  1EIG A;  2SDF A;  1U9R A;  3OWF A;  1XYI A;  1M1K C;  5C4J B;  2DGY A;  4GKK Q;  1HZ9 A;  4DR5 Q;  1HR0 W;  4FDB A;  3J81 j;  5ELF A;  5J39 A;  5IYC H;  2QEX A;  4JI2 Q;  1MJC A;  4BY1 H;  2B63 G;  2OEO A;  1PYB A;  2HD3 A;  3T1H L;  2ES2 A;  4R9W A;  5EBD A;  1W2B A;  2F0G A;  3HKZ E;  4K6D A;  2NVT H;  3GTG H;  1IW7 D;  1IZ6 A;  1TVX A;  1CA6 A;  1RDP D;  2JA7 G;  1W6K A;  2G5D A;  1IBK Q;  2OF1 A;  4K5X A;  1UUP A;  3VR2 A;  4DK0 A;  5T1I A;  1EIY B;  4EQ5 A;  5KNC A;  2JEA I;  1OXX K;  4K0K Q;  1MI2 A;  1TWA B;  2R93 H;  3MTS A;  4WOR A;  4CDD C;  2NYZ D;  4N8F A;  3GTP B;  2AKW B;  1WI5 A;  3KLW A;  1NE3 A;  4CJ0 B;  3I8Z A;  2FHT A;  4DV1 Q;  1VQ7 A;  1PZJ D;  2BCO A;  5C3W A;  2XWB B;  3MAQ A;  2KA7 A;  1SMY C;  5EBC A;  1KIX A;  3IAY A;  4X65 L;  3NWT A;  3URY A;  5GAH C;  1EEF D;  3S14 H;  3S24 A;  3S17 H;  1Q8I A;  1DD2 A;  1YEZ A;  1FNU A;  1RTO A;  3I4M B;  1E22 A;  2VZA A;  3LNN A;  1GD7 A;  3J81 E;  4XYO A;  1DCZ A;  1ET9 A;  2WKD A;  4XT3 B;  2CKZ B;  5HGT A;  2UXC L;  5EPL A;  4JI3 Q;  2NVQ B;  4N9T A;  3LX0 A;  1BOS A;  3CCJ A;  1ENA A;  4YY3 L;  4A3D B;  3U50 C;  5D3D A;  1YZ6 A;  4HJ5 A;  2KCT A;  1RCV D;  1XNQ Q;  3GTJ H;  1HR0 L;  2PNR C;  3C2P A;  1JWU D;  1KD1 C;  1JB7 A;  1TS3 A;  2EQS A;  2GN5 A;  1O7Z A;  3H3V I;  1STH A;  3DHQ A;  4B3M L;  4M1U B;  1X56 A;  3NEN A;  2HIX A;  4I7A A;  3E9I A;  4KY6 A;  1G51 A;  2NTS A;  3TQY A;  1LTB D;  3QOJ A;  4I7Z C;  2E2J B;  3EJI A;  3M4Q A;  4IOA A;  2Q8T A;  1UE1 A;  2Z8L A;  3SGI A;  1NUC A;  1TS4 A;  2LKV A;  4UHV A;  4ZAI A;  3GTK B;  5C3X A;  2N55 A;  2FFK B;  2ZXP A;  5CV9 A;  3QO2 A;  4ME3 A;  2NVX B;  5K36 G;  3I3C A;  2WAC A;  3H6M A;  1I4R A;  2IWH A;  2JA5 B;  4ZYS A;  1XJV A;  4CDE C;  4JV5 L;  3CCQ A;  1F2M A;  4KI0 A;  4APV A;  1KTK A;  1SE4 A;  3OTO Q;  3TME A;  1SRO A;  2LMC B;  5C6A A;  5IYB H;  3SK5 A;  5C4J H;  4LFA L;  2F0H A;  4GKJ Q;  2UUA Q;  3CPF A;  4R4O A;  1WTP A;  1LTR D;  4DR1 L;  4GNX A;  4BXX G;  4DV2 Q;  4RGT A;  3NPP A;  4IQZ A;  1QG7 A;  2F0S A;  3PV0 A;  1BO0 A;  5FO7 B;  3FEW X;  2L5T A;  2K6A A;  1HNW Q;  3NTK A;  2JJQ A;  3Q0A A;  5I2X A;  4AIM A;  3K58 A;  1EY9 A;  4XTC S;  3HOV G;  3NEL A;  2DNC A;  5C4H A;  2KHS A;  2A68 D;  2C9O A;  3MA2 B;  4AYB G;  4DV5 L;  4R1J A;  3F2U A;  1EYD A;  4K5V A;  1VQC A;  3MWY W;  4NKL A;  5LL6 X;  2K75 A;  1SBB B;  1NCV A;  4A93 G;  2JN4 A;  2PQA A;  1VQB A;  3PF4 A;  1SNO A;  4QIW E;  1EQV A;  2QEJ C;  4ULL A;  3TS0 A;  3GTP H;  3PUZ A;  3AB9 A;  1EY6 A;  2ZXR A;  3RD4 A;  1FNV A;  4A3F G;  1SNP A;  4JC0 A;  5AJ3 Q;  1ENF A;  3VR5 A;  1AW7 A;  2B8G A;  2Q8I B;  2CH4 W;  5JPM C;  3UE0 A;  3V96 A;  2VB2 X;  3ER0 A;  1EOV A;  4LF5 Q;  3OIP A;  4C2M B;  3RUZ A;  1N32 Q;  2YU9 B;  1V43 A;  4LF4 Q;  2FJ2 A;  1I5F A;  2Q2H A;  4B9W A;  1IL2 A;  4H0L C;  5M3M G;  5IT9 E;  4OO1 G;  3G6J B;  3MHB A;  4EQN A;  5EQ0 A;  2G9H D;  1HTP A;  2X6L A;  4J8Q A;  1FNW A;  4PG3 A;  3HOU H;  3A8I E;  5C3E H;  4KJN A;  4U68 A;  4XIG S;  3X3N A;  5IGG A;  1B3Q A;  1I4G A;  4JYA L;  2UUB L;  3D0F A;  3CCU A;  1EIH A;  5I9O A;  2ZTD A;  3KYH C;  4G7O C;  1MBY A;  1SLJ A;  2E2I B;  1JC7 A;  1UAP A;  1HNX Q;  1E2V A;  1EWH A;  2RHS B;  4HR7 B;  1LT4 D;  3R2I A;  5I4D A;  2R7F A;  1SMX A;  3TEH B;  4IPC A;  3CP0 A;  4A3J H;  1Q12 A;  2I07 B;  2KVM A;  5IY0 A;  2OCE A;  2HHH L;  4FP5 D;  3RNU A;  1ZEQ X;  4GLV B;  3DEP A;  4GN5 A;  1BCP F;  3D6W A;  3MXN B;  1HQM C;  2B2T A;  3PO3 B;  3TDQ A;  4AYB E;  2QIL A;  2R3Z A;  3U4V A;  1S5F D;  5BN4 A;  2Y0S G;  2Z6K A;  1PH5 A;  1JJG A;  4IUQ A;  1MHW C;  4JPB W;  3D4W A;  5C4X B;  4DUY L;  4Q5V A;  5ELD A;  5TSS A;  5IT9 c;  4X66 L;  4KK7 A;  5DM7 3;  2JA6 H;  4LK1 C;  4RMF A;  2KED A;  5CGK A;  1Y1W B;  4JI5 Q;  2B2U A;  3PUW A;  4B08 A;  5M3F B;  4P71 A;  1TWG H;  2K5Q A;  3CU7 A;  2D9U A;  3CF5 A;  2LS0 1;  2YYZ A;  3CAM A;  2D0P A;  4L63 B;  3QJY A;  3NTI A;  5KRU A;  4BY7 H;  3I4N B;  2CW0 D;  1VDZ A;  1PFS A;  1BKB A;  4DV6 Q;  2BDN A;  2X6G A;  2AMC B;  2F0D A;  2A6E D;  1FD7 D;  1IL8 A;  3PGZ A;  1U4P A;  1OXT A;  3EN2 A;  4FO2 A;  1BCP B;  4GOP B;  3TP7 A;  3M3Y H;  3WWV A;  5JEA H;  3S1N B;  1IBL L;  2FMM A;  1V1P B;  4MZ9 A;  5IE8 A;  1SYB A;  3ONA B;  2A73 B;  1EQQ A;  3EIV A;  2XN9 C;  4JI1 Q;  4HIK A;  1C7Y A;  2R7Z B;  4UAI A;  5CBE E;  1SN8 A;  2AUJ D;  4BBR B;  3Q22 A;  4QUF A;  3GO5 A;  4RWS C;  4C56 C;  1WOC A;  4A3L H;  4RH6 A;  3TZU A;  2NZO A;  4FF1 A;  1H9S B;  4JOI C;  4IPH A;  3NHH A;  1EY4 A;  2DNE A;  3PIP A;  4LF7 L;  1X3G A;  2SNM A;  4AQY L;  4DR7 L;  1LTT D;  4C2M H;  3I2Z A;  4DXG A;  4F7X A;  2Q2U A;  2YU9 H;  2A5H A;  4HIO A;  4JI0 L;  2K5H A;  1S40 A;  3C46 A;  4R4T A;  3VR3 A;  2Y0S E;  5LMU Q;  3Q23 A;  1IYV A;  3IFT A;  2F0M A;  2F4V L;  3BU2 A;  1VQH A;  5DNF A;  4X3U A;  4ZRZ A;  1PH9 A;  1FJG Q;  1KLU D;  1HUM A;  1EY8 A;  1STG A;  1VQI A;  3FRP B;  3ULP A;  4B9X A;  3EA6 A;  4YIJ A;  5J22 A;  1VCI A;  1D6E C;  2BH8 A;  3CC7 A;  2NN6 I;  5EGT A;  4XQQ A;  1A62 A;  2NUC A;  3TZD A;  1K8A C;  4LFB Q;  3S2D B;  3S1R B;  3CRK C;  5IOC A;  2K5D A;  2E2I H;  1PFB A;  5E1F A;  1E1T A;  2MHV A;  3NBH A;  3OHX C;  1J8I A;  1UE7 A;  4HJ9 A;  1F9S A;  3FKI G;  3T4A C;  4KHP Q;  2PI2 E;  3PF5 A;  3AFP A;  1KL9 A;  3QG1 A;  3HOY B;  3AFQ A;  4JI4 Q;  4OHJ A;  4LWC A;  2E75 C;  4ZQ3 A;  4R4C A;  2RDG A;  3OWE B;  1BBW A;  2K5V A;  2B2V C;  1U0L A;  3CPW A;  1WTX A;  1M90 C;  5FLX E;  1PFN A;  3H3V C;  3J81 i;  1PA6 A;  2JA8 B;  1WCM G;  1YNN D;  3PO3 H;  1P8L A;  4JI7 Q;  4C3J B;  3TSS A;  4K8J A;  1XXG A;  3DM1 A;  4QQB X;  5JJL A;  3MEF A;  4BBS G;  3V05 A;  4XDX A;  3A56 A;  1ET6 A;  3UDF A;  2OXP A;  2M9V A;  1QJO A;  1EWI A;  4MTN A;  5IP9 G;  1N36 Q;  4UP8 A;  5IYD G;  2LY7 A;  4YCU A;  5C4X H;  1TT2 A;  3QOL A;  2MNA A;  1N33 Q;  1ROD A;  1EUJ A;  1ML0 D;  3B6Y A;  5D14 A;  3RLF A;  4R8I A;  1Y1W H;  3AU7 A;  1VQ9 A;  5M3F H;  4JI8 Q;  1EQR A;  3GTQ B;  4C1N K;  1AE2 A;  3FHW A;  4J15 A;  4WJW A;  4JK1 C;  4A3B H;  1BBU A;  2ICI A;  2MO0 A;  1XWE A;  4KN4 C;  1UE5 A;  3GV6 A;  1JIC A;  3TP8 A;  3VDY A;  1SNQ A;  1A3T A;  3KF6 B;  2IX3 A;  4KLK A;  2EZV A;  4A3G G;  3N6R A;  1E3P A;  2QCP X;  3C1F A;  4DV7 L;  3M7N A;  1T9H A;  4OX9 L;  4K2L A;  1PRT F;  2EDG A;  3A0J A;  3L9A X;  3MVV A;  3NQI A;  4XT1 B;  1PZI D;  4CKC A;  5CC4 A;  1B4O A;  1PTO F;  3A5U A;  1PHJ A;  2EY1 A;  3HKZ B;  1QUQ B;  5IP7 G;  2K01 A;  3H0G B;  1CI3 M;  5C0X J;  3HOX H;  3BVZ A;  3I90 A;  3J7Y W;  2FXQ A;  1IYU A;  4EQO A;  1EIF A;  1GJX A;  3F1Z A;  1PVO A;  5FLX c;  5IGE A;  3H3V H;  5JVG 3;  1I50 H;  4KD3 A;  1L1O B;  4L5Q A;  5C4Z A;  5ELB A;  3NQT A;  4FVM A;  2A8V A;  4O2D A;  2F52 A;  5IYC G;  5DM6 3;  4FXD A;  2A69 C;  5IOD A;  4LF6 Q;  3RZO H;  2RDH A;  2JK8 A;  4BY1 G;  2PZT A;  1XNR Q;  4IOC A;  1K8M A;  4DPG A;  2UXB Q;  4IZ8 A;  3HP3 A;  4X62 L;  2F0K A;  3SK8 A;  4A3K B;  1G8Z D;  1I94 L;  2K28 A;  4DAY A;  1OO9 B;  4DKA C;  1KLG D;  4R4Q A;  5COR A;  3S15 H;  4LFC L;  3HG9 A;  4L5R C;  1DXM A;  2VQF L;  4OGQ C;  2R93 G;  1PTO B;  3MC0 B;  1GUT A;  4HJ8 A;  1Y1V H;  4MTK A;  4DK6 C;  2XNA C;  1B1Z A;  1NJI C;  2UUC Q;  1FR3 A;  2B3G A;  4LF8 L;  3N52 A;  3PUX A;  2F0P A;  3GTO B;  1A3U A;  4RHS A;  3S2D H;  3S1R H;  2BH2 A;  2JXM B;  1W3S A;  1JOO A;  1IBM L;  2ALY B;  1CKO A;  4DR4 Q;  1FL0 A;  4X3K A;  5GAG C;  5JVH 3;  3RZD H;  1FGU A;  2H4O A;  3V2T A;  2CQO A;  4KHV A;  3HFZ B;  1LUZ A;  4DR3 Q;  5C44 H;  4DV4 Q;  5IGF A;  4EVO A;  4HED A;  4LUO A;  5JOB A;  1H95 A;  3K7A B;  2C5C A;  1CKN B;  4DR1 Q;  2JYO A;  3HOY H;  5EKI A;  1PTO D;  2H1E A;  5KEE A;  1S4Z A;  2B2U C;  2JE6 I;  2B63 B;  1Z7T A;  4UDU C;  2L4N A;  2MJ8 A;  1Q1E A;  1XPU A;  1BF4 A;  2R6G A;  1PH7 A;  3L0O A;  5I6Y A;  4QY7 A;  1CK1 A;  1UEB A;  3FPP A;  4A4I A;  3ULL A;  4KTA A;  3X3M A;  4C3J H;  1JWM D;  2X69 A;  4U67 3;  5GRO A;  2JA7 B;  3F2C A;  3G48 A;  1JE5 A;  3S2H H;  5EAY A;  5IGD A;  3EQL C;  2MO1 A;  4JBK A;  5M5X B;  4Y7N B;  4B3T Q;  4ME5 A;  2UXD Q;  1HPC A;  2QF7 A;  2K14 A;  4G7H C;  4GN3 B;  2OTJ A;  3QWN A;  3ERS X;  1A8V A;  1BXT A;  1Q1B A;  2Q2I A;  4RKB A;  1I4H A;  3J7A F;  4NW2 A;  5JJZ A;  4P2C B;  4ODG A;  1OXS C;  4FNF A;  5KNB A;  1VQP A;  1CHP D;  4DR2 Q;  3BZD B;  1ILQ A;  5M5W B;  1QZH A;  1DGS A;  4JCV E;  3UI2 A;  1PMR A;  4J6H A;  1B8A A;  1D2B A;  1D5M C;  4RGO S;  1PYS B;  4KY5 A;  2WKC A;  1QNK A;  4RCO A;  1HHV A;  3H0G H;  1RTN A;  2A1A A;  1EY5 A;  4DNI A;  5LMN W;  2BDO A;  2E76 C;  4K8I A;  4FF2 A;  5E7N A;  1ZYR D;  1TWF B;  3KDF B;  2NBF A;  1LAB A;  5CV8 A;  3T13 A;  1KRS A;  3J81 L;  5FLM H;  1GVP A;  2EJF C;  2EPB A;  3BS1 A;  2WFW A;  4B3S Q;  2PI2 A;  1AZQ A;  3S1M H;  2IX0 A;  2RQX A;  4A3K H;  4CDC C;  3GP7 A;  1GUO A;  3KJP A;  5GQO A;  3U58 A;  5KYL A;  2Z0S A;  4BS9 A;  4DV0 L;  4LF9 Q;  5FJ8 H;  1GXD C;  3CC4 A;  1WTR A;  1EWC A;  2YTX A;  4JOI A;  1XMQ Q;  1U5K A;  1X3E A;  4KY7 A;  5F2D A;  1N34 L;  1K8O A;  3BDL A;  2PW7 A;  3HOZ B;  4DFA A;  2I0Q A;  2KUM A;  2YV5 A;  5EJW A;  2UU9 L;  4YWK A;  3STB C;  3T1Y L;  1EL0 A;  1HQR D;  1BNZ A;  3K6O A;  3IFD A;  4CKE A;  3GTO H;  2MFI A;  3A7A B;  4JBW A;  1CM9 A;  5IWA Q;  1YIJ A;  1YNJ D;  4IUT A;  4H7B A;  2ID0 A;  3D4R A;  3RLN A;  2AHO B;  2EJG C;  2G9D A;  4A3M H;  2AQ2 B;  2HIV A;  3PO2 H;  2KCC A;  2XSC A;  5E4W C;  2CWA A;  2V4D A;  2F03 A;  2ZM6 Q;  1HZA A;  3F8T A;  3P7J A;  2MGS A;  2OQ0 A;  2F1M A;  4Y52 H;  1MJE A;  5EPJ A;  4L5S A;  2CHB D;  4A75 A;  4CJ2 C;  4IFD H;  1V1O A;  3HOU G;  3BG3 A;  1F9Q A;  5C3E G;  4X6A H;  3M7G A;  5E3F A;  1D8L A;  4H02 A;  4B3R Q;  3U9O A;  2IL8 A;  1JMC A;  4A3I H;  4R4I A;  4A76 A;  1KDA A;  5LMN L;  2WAQ G;  4AYB B;  1VQK A;  2B2V A;  1I4X A;  2DY8 A;  5IIF A;  4I65 A;  1EQT A;  4Y7N H;  4DR6 Q;  1GUS A;  1NMG A;  1U4M A;  3D8G A;  3K5N A;  1SYE A;  2Z4I A;  3MEH A;  3G7L A;  4QL5 A;  1V9P A;  1V8Q A;  4NXM Q;  1K73 C;  1QOH A;  1LTI D;  4A3J G;  4CDF C;  4FF3 A;  2CFM A;  4OEM B;  1VF7 A;  4K14 A;  1HZB A;  1HTL D;  2V1C C;  3D31 A;  3FP9 A;  5ELE A;  1CQV A;  4DGZ A;  2K04 A;  2VQE L;  5BR8 Q;  3AQQ A;  4HJA A;  5T1G A;  1IYJ B;  1MD2 D;  5M5Y B;  5M5W H;  2ZJR A;  2NN6 H;  4PMW A;  2KCM A;  4RHR A;  1SR3 A;  5JEA J;  2KHJ A;  2FMC A;  4RFB A;  4V0B A;  1AN8 A;  5M3M B;  3K0Y A;  1TWA H;  1EFW A;  1T5X D;  5FKA C;  3E3X A;  2O2L D;  1L0X B;  4DAM A;  1KC8 C;  2F4V Q;  3GTM B;  1YI2 A;  4OWT B;  2JA6 G;  1FGB D;  4G7Z C;  3PIO 3;  4GKK L;  3BDO A;  3AYH B;  4DR5 L;  2DUD A;  1VQE A;  5IT9 L;  1I4Q A;  1O78 A;  2HCI A;  2E5L Q;  3K81 C;  3GD7 A;  4NPS A;  4JI2 L;  2BA1 A;  4BY7 G;  4K2K A;  1SYF A;  3OW2 A;  2K32 A;  2HUG A;  3M85 A;  1TWC B;  3I4M H;  1A0I A;  4RGN A; 
#chains in the Genus database with same CATH homology
 2HHH Q;  2ATW A;  1L0W A;  1XMO L;  4DR7 L;  3J7A 5;  2JEB I;  1CKM A;  1HJP A;  3I2Z A;  3I7F A;  4C2M H;  1VQ4 A;  4TVA B;  1Y14 B;  2Q2U A;  2YU9 H;  2IX1 A;  3TS2 A;  3JAM c;  4HIO A;  4A3E H;  4JI0 L;  3HKZ G;  2VUM H;  4JI6 L;  2NN6 G;  2K5H A;  1S40 A;  4R4T A;  4C3I H;  2YTY A;  2QGQ A;  2Y0S E;  3Q8D A;  1IBK L;  2RCN A;  5LMU Q;  3ULJ A;  2NVQ H;  5JEA G;  1WCM H;  3F2D A;  2WAQ E;  1VQ5 A;  3BU2 A;  2F4V L;  1VQH A;  1NY4 A;  4RG1 A;  1FJG Q;  3RN2 A;  1PH9 A;  3CD6 A;  4OO1 I;  5ELO A;  4YWM A;  1VQI A;  4BBS H;  5LMN Q;  3ULP A;  4HIM A;  4A3D H;  4K0K L;  1S3O A;  1VQM A;  1VCI A;  1OXV A;  2BH8 A;  2NN6 I;  1VQD A;  1GKH A;  3CC7 A;  1YJN A;  5C0X G;  3HOZ H;  1A62 A;  1WFQ A;  4DUY Q;  5IP9 H;  4YHH L;  3DLL A;  4DV3 Q;  1K8A C;  4LFB Q;  1EYG A;  4A3C H;  3W5O A;  5IYD H;  1B7Y B;  4X66 Q;  4OWW B;  2E2I H;  1E1T A;  4A3L G;  2I5H A;  4GLX A;  1X9N A;  1X55 A;  1UE7 A;  4HJ9 A;  1VQL A;  4LF6 L;  3FKI G;  1E7Z A;  2D62 A;  3G71 A;  1XNR L;  2Z6K C;  3K7A H;  2PI2 E;  3OYY A;  3AFP A;  3PF5 A;  4KHP Q;  2VL6 A;  1KL9 A;  2UXB L;  3I4M G;  1PH2 A;  2WP8 J;  1HNZ L;  2E2J H;  3AFQ A;  2B63 H;  1L1O C;  3RR5 A;  4JI4 Q;  3RN5 A;  4JBJ A;  4LWC A;  2N78 A;  4IFD J;  1PH3 A;  4A3E G;  4R4C A;  4BA1 I;  1SE8 A;  1K9M C;  1MKH A;  4LW1 A;  1KQS A;  1BBW A;  1Z47 A;  2K5V A;  2VQE Q;  3CPW A;  1U0L A;  1MIU A;  3J7Z C;  3BJU A;  1M90 C;  3GTK H;  1D7Q A;  4DAY B;  4A3G H;  4UPA A;  3J81 i;  1YIT A;  2IT1 A;  1PA6 A;  1FVI A;  1WCM G;  3ZJY C;  2NVX H;  3EBE A;  3PO3 H;  1P8L A;  4JI7 Q;  1QVC A;  2HQL A;  2JA9 A;  3CCL A;  2JA7 H;  2JA5 H;  1G29 1;  4QQB X;  5JJL A;  3MEF A;  4GOP A;  4BBS G;  4PZ8 A;  4A3D G;  4JI3 L;  3K7U C;  3L2P A;  1IBL Q;  3UDF A;  1K0R A;  4IPD A;  4UP9 A;  5IP7 H;  1HZC A;  5M5X H;  3HOZ G;  2QA4 A;  4MTN A;  5IP9 G;  1EWI A;  3BZK A;  2IY5 B;  1N36 Q;  4A3C G;  4UP8 A;  5IYD G;  2UUC L;  4YCU A;  5C4X H;  4HJ7 A;  1YHQ A;  1M1K C;  1Q46 A;  2K5N A;  4P73 A;  2DGY A;  4GKK Q;  1PV4 A;  4NB3 A;  2MNA A;  1Q86 C;  1N33 Q;  3KOJ A;  4LNQ A;  1EUJ A;  1HZ9 A;  3B6Y A;  4MNO A;  3RLF A;  4FDB A;  4DR5 Q;  3J81 j;  1Y1W H;  4DUZ Q;  1JJ2 A;  5M3F H;  1C9O A;  4JI8 Q;  1EQR A;  2BA0 A;  1VQ9 A;  1AE2 A;  1OXU A;  3FHW A;  4J15 A;  3J81 c;  5IYC H;  4A3B H;  1BBU A;  2MO0 A;  2QEX A;  4JI2 Q;  1MJC A;  1UE5 A;  4O0A A;  4BY1 H;  2B63 G;  4DR3 L;  4DV4 L;  1PYB A;  4GN4 B;  4L5T A;  3T1H L;  4OXP A;  4LF7 Q;  3VDY A;  2ES2 A;  3KJO A;  1W2B A;  3KF6 B;  5ELN A;  4AQY Q;  3HKZ E;  4DR7 Q;  1XMO Q;  1AE3 A;  2KBN A;  4KLK A;  2NVT H;  3GTG H;  4A3G G;  1E3P A;  1X54 A;  4JI0 Q;  4DV7 L;  3M7N A;  1T9H A;  1IZ6 A;  4QGU A;  4OX9 L;  3PO3 G;  4JI6 Q;  2JA7 G;  2ZJP A;  3PSI A;  2JA5 G;  3A0J A;  1IBK Q;  5M5Y H;  4KHZ A;  2LSS A;  4IFD I;  1XTD A;  4IJH A;  3A5U A;  2AWN A;  1PHJ A;  3G4S A;  1QUQ B;  1YHA A;  3PUV A;  1BVS A;  5IP7 G;  5H1S E;  3CC2 A;  1EIY B;  1XPO A;  4EQ5 A;  1QZG A;  2JEA I;  5C0X J;  3M4P A;  1OXX K;  2LXK A;  3HOX H;  4K0K Q;  1AH9 A;  2FXQ A;  4POF A;  1VQA A;  1TWF H;  1EIF A;  1VQF A;  3F1Z A;  4UP7 A;  2R93 H;  1PVO A;  5FLX c;  4YHH Q;  4B3T L;  3OTO L;  3GTM H;  2AKW B;  3H3V H;  2UXD L;  1I50 H;  1WI5 A;  3KLW A;  1NE3 A;  3DM3 A;  1L1O B;  4GS3 A;  4GLA C;  4L5Q A;  4DK3 C;  3PIO A;  1Y1W G;  5M3F G;  4GKJ L;  4DV1 Q;  1VQ7 A;  2A8V A;  2UUA L;  4O2D A;  2F52 A;  5IYC G;  4A3B G;  4LF6 Q;  3RZO H;  2H5X A;  2JK8 A;  4BY1 G;  4DV2 L;  1KIX A;  4GNX B;  1XNR Q;  3H15 A;  4IOC A;  2B29 A;  4DPG A;  4X65 L;  2UXB Q;  1YHB A;  3UDX A;  5GAH C;  3S14 H;  1HNZ Q;  3S24 A;  4BXX H;  3S17 H;  4X62 L;  1A63 A;  1YEZ A;  1HNW L;  1I94 L;  4DR2 L;  1E22 A;  1RIP A;  4OON A;  5JJI A;  1L2F A;  3CCR A;  2VZA A;  3HKS A;  4DKA C;  3PCO B;  1GD7 A;  1VQ8 A;  1VS0 A;  1ASY A;  1KAW A;  1K3R A;  2CWP A;  4P75 A;  4R4Q A;  2K4K A;  2L15 A;  4JG2 A;  3S15 H;  2JQO A;  1B70 B;  2CKZ B;  4LFC L;  3HOX G;  2UXC L;  4L5R C;  4JI3 Q;  4LUV A;  3CW2 C;  1E1O A;  2VQF L;  2NZH A;  3J80 i;  2R93 G;  3CCJ A;  2CCZ A;  4HJ8 A;  1S72 A;  1Y1V H;  4YY3 L;  1P16 A;  5HY6 A;  4DK6 C;  3U50 C;  1X65 A;  2VS1 A;  1YZ6 A;  4DV1 L;  2KCT A;  4HJ5 A;  1NJI C;  2UUC Q;  1XNQ Q;  2B3G A;  3GTJ H;  1CSP A;  4LF8 L;  3PUX A;  1HR0 L;  2GVB A;  3L7Z C;  2PQA B;  3S2D H;  3S1R H;  2BH2 A;  5C0X I;  1KD1 C;  1W3S A;  1JB7 A;  1Q7Y C;  2EQS A;  1ASZ A;  1WYD A;  1IBM L;  3HOW H;  2ALY B;  1CKO A;  1TWH H;  2EIF A;  2GN5 A;  2KHI A;  4DR4 Q;  1FL0 A;  3H3V I;  3ICE A;  5GAG C;  3RZD H;  4B3M L;  1FGU A;  1X56 A;  2CQO A;  3NEN A;  2HIX A;  3HFZ B;  3E9I A;  1LUZ A;  3PUY A;  2VUM G;  1G51 A;  4IJL A;  5C44 H;  3TQY A;  4DV4 Q;  4DR3 Q;  3T1H Q;  4LUO A;  4B3S L;  4LF5 L;  1H95 A;  4DR1 Q;  3UDG A;  1CKN B;  3KF6 A;  3HOY H;  1YBY A;  3TRZ A;  4NXN Q;  1N32 L;  4BA2 I;  1JJC B;  3M4Q A;  4YWL A;  2JE6 I;  4IOA A;  3LGJ A;  4LF4 L;  1Q8K A;  1UE1 A;  3CQZ H;  1Q1E A;  3SGI A;  1XPU A;  1G6P A;  4DV7 Q;  4OX9 Q;  5GAE C;  2R6G A;  1PH7 A;  3L0O A;  4QY7 A;  1UEB A;  1J5E Q;  4LF9 L;  4A4I A;  3HOV H;  3I4O A;  3ULL A;  1QUQ A;  4C3J H;  1XMQ L;  2YTV A;  1NTG A;  4ME3 A;  5K36 G;  5GRO A;  3F2C A;  3G48 A;  1XNQ L;  1JE5 A;  1Y1V G;  3S2H H;  3A5Z B;  2RHQ B;  3I56 A;  1XJV A;  4HID A;  5EAY A;  4JV5 L;  3CCQ A;  2MO1 A;  4KI0 A;  4JBK A;  4APV A;  3CCE A;  4B3T Q;  2PMZ E;  3OTO Q;  3GTL H;  4A93 H;  2UXD Q;  1L1O A;  2GVA A;  1SRO A;  1QVG A;  3HOW G;  5IYB H;  2K14 A;  1R9T H;  5C4J H;  3CCM A;  4GN3 B;  1HNX L;  1HR0 W;  4LFA L;  5IWA L;  2Q2T A;  4GKJ Q;  2OTJ A;  3ERS X;  1A8V A;  2UUA Q;  3S16 H;  1Q1B A;  3CPF A;  4R4O A;  1N9W A;  2K52 A;  3A74 A;  2Q2I A;  4DR1 L;  4C3H H;  2RF4 A;  4GNX A;  3GDE A;  4DV2 Q;  4BXX G;  4NXN L;  5C44 G;  4A3F H;  1LTL A;  2A19 A;  2KEN A;  3HOY G;  4X65 Q;  3I4N H;  4WJ3 M;  2K50 A;  3PV0 A;  4X62 Q;  2ZM6 L;  1OXS C;  1SFO H;  1HNW Q;  1J5E L;  1I94 Q;  1VQP A;  2IHE A;  2JJQ A;  4DR2 Q;  4AIM A;  1GM5 A;  2R92 H;  4XTC S;  1VQ6 A;  1QZH A;  3HOV G;  1DGS A;  3NEL A;  4JCV E;  2OTL A;  1UE6 A;  1B8A A;  5M3M H;  3S1N H;  3RLO A;  3M4O H;  4DV5 L;  4AYB G;  4B3R L;  4AH6 A;  5C4X G;  4R1J A;  4LFC Q;  1PYS B;  1VQC A;  2UXC Q;  2D0O A;  2ZTE A;  3H0G H;  2VQF Q;  2R7Z H;  2K75 A;  1GO3 E;  2A1A A;  4DNI A;  4YY3 Q;  4YCV A;  4BBR H;  5LMN W;  4A93 G;  1YVC A;  2LXJ A;  2PQA A;  5E7N A;  4LF8 Q;  1HR0 Q;  4DR6 L;  1VQB A;  3PF4 A;  4QIW E;  3JAM i;  3TS0 A;  3KDF B;  4YCW A;  3GTP H;  1YNX A;  2F3I A;  3PUZ A;  4JI5 L;  2I5M X;  1IBM Q;  2HT1 A;  4A3F G;  4POG A;  4PZ7 A;  2WB1 G;  4NXM L;  4JC0 A;  5AJ3 Q;  3I4N G;  5GAD C;  1KRS A;  4B3M Q;  1NBW A;  4JBM A;  1TWC H;  5FLM H;  1VQN A;  1E24 A;  5JJK A;  1KXL A;  1GVP A;  3UE0 A;  2E8G A;  4B3S Q;  1CKN A;  2EXD A;  2WFW A;  1EOV A;  3ER0 A;  1XPR A;  4LF5 Q;  3E9H A;  2PI2 A;  3KFU A;  1N8R C;  3S1M H;  1N32 Q;  2IX0 A;  4DV6 L;  4A3K H;  2R92 G;  1V43 A;  5BR8 L;  4LF4 Q;  2I5L X;  1I5F A;  2XTI A;  2Q2H A;  1QVF A;  2R7D A;  3KJP A;  5GQO A;  3U58 A;  1IL2 A;  2Z0S A;  5M3M G;  4WJ4 A;  4OO1 G;  4DV0 L;  1I6H H;  2XGT A;  4LF9 Q;  1LYL A;  5FJ8 H;  3CC4 A;  2VNU D;  4PG3 A;  3F2B A;  2YTX A;  4JOI A;  3HOU H;  3CXC A;  5C3E H;  3BZC A;  1XMQ Q;  3H0G G;  2R7Z G;  1U5K A;  4XIG S;  3S1Q H;  1NMF A;  1X3E A;  3CME A;  1J6Q A;  2MQH A;  4BBR G;  1N34 L;  2PNH A;  4JYA L;  4JV5 Q;  2I0Q A;  1KRT A;  2UUB L;  3D0F A;  2YV5 A;  4JI1 L;  3CCU A;  2ZTD A;  3KYH C;  1K83 H;  4YWK A;  3STB C;  5DLQ E;  1SLJ A;  3M9B A;  2UU9 L;  1YJW A;  3T1Y L;  1K8G A;  4UY8 C;  5AJ3 L;  1VQO A;  3E0E A;  4ALP A;  4GOP C;  2MFI A;  4JBW A;  3GTO H;  1HNX Q;  4LFA Q;  2RHS B;  5IWA Q;  4DR4 L;  2VW9 A;  3NEM A;  1YIJ A;  5FLM G;  4PZ6 A;  2ASB A;  1SRU A;  1Q82 C;  3W1B A;  2R7F A;  1SMX A;  1OTC A;  2E5L L;  2ID0 A;  3RLN A;  3TEH B;  1HH2 P;  2AHO B;  4IPC A;  3CP0 A;  3J80 c;  4A3J H;  1Q12 A;  1TXY A;  2HIV A;  4A3M H;  3PO2 H;  4IO9 A;  2CWA A;  4A3K G;  1X3F A;  2OQK A;  5IY0 A;  2ZM6 Q;  2OCE A;  1HZA A;  3F8T A;  2HHH L;  4LUZ A;  3RNU A;  4GLV B;  2OQ0 A;  4EX5 A;  1PH4 A;  2JA8 H;  4GN5 A;  4Y52 H;  1MJE A;  3MXN B;  2E2H H;  4L5S A;  5FJ8 G;  4A75 A;  3JC6 6;  4AYB E;  3W1G A;  3HOU G;  4TQU S;  3UDI A;  5C3E G;  5LMU L;  2ZTC A;  4X6A H;  1UWV A;  3U4V A;  1PH8 A;  1D8L A;  1C0A A;  4H02 A;  4DV5 Q;  4B3R Q;  4GNX C;  1FJG L;  2Y0S G;  2Z6K A;  1JMC A;  4A3I H;  2N3S A;  4R4I A;  4A76 A;  1PH5 A;  2N8N A;  5LMN L;  1JJG A;  2NVY H;  2WAQ G;  3UE1 A;  1PH6 A;  4P74 A;  1I3Q H;  1VQK A;  2IHF A;  4DUY L;  1CSQ A;  1Z9F A;  4DV3 L;  4X64 Q;  4LFB L;  5IT9 c;  4DR6 Q;  3KDF A;  4X66 L;  4Y7N H;  2JA6 H;  1NMG A;  4RMF A;  2WB1 E;  3GTQ H;  2ZJQ A;  4JI5 Q;  3PUW A;  4P71 A;  1YJ9 A;  4OWX B;  1TWG H;  3KF8 B;  4QL5 A;  2OWO A;  1V9P A;  3NBH B;  3CF5 A;  4NXM Q;  4A3M G;  4A3J G;  2YYZ A;  1K73 C;  3CAM A;  3PO2 G;  3IRB A;  4KHP L;  2D0P A;  2CFM A;  1HZB A;  2V1C C;  3D31 A;  3FP9 A;  4JI4 L;  4BY7 H;  1CUK A;  1RL2 A;  2JA8 G;  1PFS A;  1BKB A;  3K0X A;  3U4Z A;  4DV6 Q;  1O7I A;  2AMC B;  2VQE L;  5BR8 Q;  3AQQ A;  4HJA A;  2N49 A;  4IFD G;  3PGZ A;  3CMA A;  5J3B A;  1IYJ B;  4IPG A;  4P72 A;  1JT8 A;  5M5W H;  4DV0 Q;  4JI7 L;  1VQJ A;  2ZJR A;  1OXT A;  4PMW A;  1PH1 A;  3EN2 A;  4A3I G;  2KCM A;  1SR3 A;  5JEA J;  4GOP B;  2KHJ A;  3M3Y H;  1V1Q A;  3WWV A;  3G6E A;  3CCV A;  1TWA H;  1IBL L;  1EFW A;  4MZ9 A;  3I55 A;  1KHI A;  1LM0 A;  5IYB G;  4X64 L;  5IE8 A;  1X6O A;  1WJJ A;  1N34 Q;  4DAM A;  1EQQ A;  1KC8 C;  1N36 L;  2F4V Q;  3AEV A;  4JYA Q;  2UUB Q;  3EIV A;  1YI2 A;  4JI1 Q;  4HIK A;  1C7Y A;  4OWT B;  2UU9 Q;  2JA6 G;  1SN8 A;  1Q81 C;  3T1Y Q;  1VQG A;  2AWO A;  4GKK L;  3K8A A;  1N33 L;  4QJF A;  3GO5 A;  3AYH B;  4DR5 L;  3TRE A;  1WOC A;  2VY3 A;  4DUZ L;  4JI8 L;  3STB D;  2DUD A;  4A3L H;  2NZO A;  1VQE A;  4JOI C;  2E5L Q;  5HGQ A;  3K81 C;  3GD7 A;  4NPS A;  4JI2 L;  3FKI H;  4IPH A;  2BA1 A;  3CCS A;  4BY7 G;  3PIP A;  3OW2 A;  2C35 B;  1IXR A;  4LF7 L;  3K80 C;  3M85 A;  1X3G A;  3I4M H;  1A0I A;  4AQY L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...