4A76A

The lin28b cold shock domain in complex with heptathymidine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
PQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN28 COLD SHOCK DOMAIN
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Chaperone/dna
total genus 18
structure length 86
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a76A00
2HT1A 1CSPA 1QZHA 4BBSH 1Y14B 2BA1A 4DR2L 4OO1G 1EIYB 5IYCG 4DV1Q 1N33Q 1VQJA 3OTOL 3KJOA 1KQSA 3PUVA 3UE1A 4A3JG 4DR4L 4JYAL 1X3FA 1V1QA 3K81C 1EQRA 5JEAG 2F4VL 1UE6A 4GLVB 4DR3L 3J81c 4X65Q 3RR5A 5C4XG 2VW9A 1XNQL 4KHPL 2MO0A 2IX0A 3UE0A 4DV6Q 4A3CG 3I55A 3HOWG 4DV7L 1NJIC 3PO3H 5C3EG 4HJ7A 4JOIC 2B63G 4JC0A 2UUBQ 2D0PA 5BR8Q 1X65A 3A5ZB 1L0WA 2NVQH 1J5EL 1WCMG 1UE1A 5IP7G 3J80c 1EUJA 1MIUA 3S1QH 1E22A 3J81j 4LF4L 4IPDA 4DR5L 3L2PA 2A1AA 5IWAL 1PH4A 1G6PA 2GVBA 1Y1VH 3CCUA 4DUZQ 3NEMA 2WAQG 3L7ZC 4JI2Q 4UP9A 4DPGA 1GKHA 3RLFA 4B3SL 4GNXB 2UUCL 5IT9c 3PV0A 1HZCA 1KHIA 1NMGA 1SMXA 2QGQA 3K80C 3T1HL 3CCJA 1Y1WH 1YHQA 1PH5A 2RHSB 5LMUL 4X66Q 2ASBA 4B3RQ 1VCIA 1Z9FA 4EX5A 1N36L 4LF8L 4L5SA 4LF9Q 1R9TH 1L1OC 1VQ8A 2ZJQA 3JAMc 3HKZE 1YJ9A 1JE5A 1WOCA 3BU2A 4KHZA 4YWLA 1EFWA 3GTQH 1YBYA 2VQFL 1Z47A 2LSSA 2KCTA 4R1JA 5C0XG 4IFDI 5E7NA 1XMOQ 4OONA 1M90C 4C3HH 5FLMH 2CCZA 4L5QA 4P75A 1PYBA 2OTLA 2CKZB 2RCNA 1UEBA 5M5YH 1GM5A 3AEVA 5DLQE 1RIPA 1A8VA 1VQ4A 1N32Q 3PF4A 2ZTEA 2Q2UA 4JI3Q 1XPRA 1W3SA 3PSIA 4JI7L 2NN6G 3CCVA 1HNZQ 4H02A 1A0IA 1FVIA 3BJUA 3J80i 1Q81C 4POGA 4AQYL 4GLXA 2R92G 3RNUA 3G6EA 5GAHC 2UUAL 1VQFA 3F1ZA 4GKKQ 1XNRL 1CUKA 4GLAC 2VL6A 1SE8A 1VQ6A 4A3KH 1A63A 3M7NA 3CD6A 4JCVE 5J3BA 1RL2A 3CMEA 1PYSB 3HOVH 5M5WH 3RN2A 1E3PA 4RG1A 1YJNA 4GKJL 4DV4Q 4WJ3M 3KDFB 4LF5Q 4RMFA 5IYBG 2PI2A 4A3DH 2NVTH 4K0KL 1GD7A 1I50H 1XTDA 2F3IA 3CQZH 4IPCA 5GADC 1HNXQ 3CC2A 3CAMA 3I56A 3GTKH 4JI0L 3JAMi 1OTCA 1XPUA 1B7YB 4R4IA 1VQ5A 1UWVA 5JJLA 1PH7A 2R7ZG 1SLJA 4IJLA 5LMNQ 2I0QA 3S1NH 2JA7H 1FL0A 5JJIA 1KL9A 1HJPA 1B8AA 1N34L 5IYDG 3AFPA 3HKZG 4MNOA 3PUYA 4PZ8A 3UDFA 4OXPA 3U4ZA 3S17H 1I94L 4GOPA 1VQPA 4GOPB 5JEAJ 4GNXC 3EN2A 3KF6A 3FP9A 3KF6B 1K8GA 2BH2A 3HOUH 1FJGL 3M3YH 3CF5A 4YY3Q 1G291 2GN5A 1JB7A 1YHAA 2K5NA 2KCMA 5IE8A 1OXUA 3PUWA 1HR0Q 4MTNA 4IOCA 3CP0A 4XTCS 3S24A 3M85A 2K5VA 2N78A 3ULPA 2UXDQ 3FKIG 1IBLL 1TWFH 2YYZA 1VQ9A 3S1RH 1VQOA 4KLKA 1C9OA 5M3FH 3ULLA 4C3JH 4A3EH 1QVFA 2CWPA 2CWAA 4JI6Q 4B3ML 3GTLH 1WI5A 1HZBA 3H15A 1EWIA 1U5KA 4JI4Q 4LF6L 3PGZA 4NB3A 4DR2Q 2ID0A 2NZHA 2WB1E 4NXML 2UXCL 4IPHA 2IT1A 1K83H 4B3TL 5AJ3L 3E0EA 3OTOQ 1H95A 1SROA 2R7FA 1Q1EA 4LNQA 4JYAQ 1C7YA 2F4VQ 3U50C 3GD7A 1JJ2A 4DV0L 2YTXA 2I5LX 4A3BH 3T1YL 4KHPQ 3H0GG 1XNQQ 2D62A 3A5UA 1IBKL 4NXNL 3W5OA 1X3GA 2ZM6Q 3DLLA 2ES2A 4DV7Q 3GTPH 4HJ5A 4QY7A 4Y7NH 2RHQB 4BBRH 2UXBQ 4OX9L 4A3GH 2K4KA 4L5RC 2EIFA 1JJGA 4A3IG 1J5EQ 2E8GA 2K50A 5M3MH 3RZDH 1G51A 2PI2E 3K7UC 4DK3C 5IP9H 5C0XJ 2N8NA 3PO2G 4JI5L 1E1OA 4P72A 4LF4Q 1QUQA 2BH8A 1QUQB 4DR5Q 3BZCA 3W1GA 5IWAQ 2ZJPA 4BBSG 1U0LA 2OCEA 3KLWA 1PHJA 3GTOH 4LUZA 4BBRG 4R4OA 4A3GG 4B3SQ 4BA2I 2UUCQ 3CCLA 3STBD 1CKNA 3G4SA 4LFCL 1K3RA 1HZ9A 1LM0A 3GO5A 3Q8DA 3CCQA 3T1HQ 5LMUQ 4IOAA 2JJQA 4LUOA 1N36Q 4LF8Q 3M9BA 1W2BA 4AH6A 3J7ZC 2Q2HA 3W1BA 2BA0A 1HNWL 1V9PA 2AWOA 3AYHB 3PO3G 1E24A 2JK8A 3HOZH 2QEXA 1SRUA 2KBNA 4JBWA 2VS1A 1EYGA 5C0XI 5M5XH 4GOPC 1WYDA 3KF8B 2VQEL 2B29A 4DV1L 3CC4A 4TQUS 1N33L 4BY7H 3U58A 2AWNA 4A93H 3GTJH 2JA5H 1OXVA 4DV5L 4JI8L 2RF4A 4DR1Q 3I4MH 1Q12A 1IZ6A 1X55A 1Y1VG 2WB1G 2H5XA 4X64Q 2LXJA 4QIWE 3PIPA 4UP8A 4LFBL 1S3OA 4JI7Q 4OWXB 2KHIA 5GAEC 1Y1WG 1PH2A 4A3MH 2IHFA 3RLOA 5BR8L 3D0FA 4AQYQ 3K0XA 2JA6H 3J81i 1FGUA 1KRSA 1VQLA 4AYBE 2JA5G 2V1CC 3F8TA 5K36G 3M4OH 2UU9L 4IO9A 2UUAQ 3PCOB 2MQHA 2HHHQ 1OXSC 2JA8H 3CCMA 2AKWB 3S1MH 4UP7A 1PH6A 1M1KC 1VQAA 5FLXc 1HZAA 5GAGC 2EQSA 1D8LA 1PV4A 3IRBA 4GKJQ 5ELOA 4A75A 1K73C 1EOVA 3S2HH 5FLMG 4A3MG 4TVAB 2Q2TA 4BY1H 4LFAQ 2IX1A 4K0KQ 4DV3L 1YNXA 3VDYA 1WFQA 2MO1A 2Z6KA 4JI0Q 2VUMH 3HOYH 4YHHL 3CCSA 1OXXK 1LYLA 1P8LA 4JI1L 2HIVA 1S72A 4BXXH 5C44H 3I4OA 4APVA 3I2ZA 4LW1A 4OWTB 3SGIA 1VQHA 3STBC 3K7AH 1N34Q 1AE2A 4DR7L 3JC66 4IFDG 3S16H 3TREA 2VY3A 4HIMA 1PFSA 2NVXH 1YZ6A 2Z0SA 4KI0A 1I94Q 3TRZA 4DR6L 5EAYA 3CXCA 5FJ8H 1QZGA 4A3KG 4QGUA 4PG3A 4JG2A 1VQCA 3HOVG 1MJEA 1YIJA 2ATWA 3CMAA 3U4VA 2A8VA 1TXYA 2R7DA 1VQMA 3EBEA 1XMQL 5C44G 4JI3L 1YJWA 4A3DG 1KXLA 2E5LL 4LUVA 2K14A 3A74A 4LWCA 5JJKA 1IBLQ 1JJCB 4PZ6A 2ALYB 2R93H 4JOIA 3HKSA 1YHBA 4AIMA 4B3MQ 4IJHA 2K5HA 4A3FH 1VQDA 4LF6Q 1X9NA 4X62Q 2JA7G 2UXCQ 4DKAC 4NXMQ 2CFMA 4AYBG 4B3TQ 1X56A 5AJ3Q 2JA9A 4HIOA 4A3LH 2KHJA 3F2CA 2YTVA 4DV2Q 1VQIA 2ZTCA 3HOUG 2ZTDA 4DV0Q 4LF7L 2AMCB 2E2IH 1YI2A 4OO1I 4NXNQ 1PH1A 1K8AC 3CPFA 1GVPA 4YCWA 3KJPA 2IY5B 2VZAA 4OX9Q 1TWGH 1PH3A 1TWAH 1K9MC 1KC8C 4DR4Q 2E2JH 4ALPA 4DK6C 2JEBI 4DR3Q 4UPAA 5ELNA 5M3FG 4JI5Q 3PIOA 4A3EG 1Q1BA 1P16A 3I4NH 3GDEA 4R4CA 1O7IA 4PMWA 3E9IA 4QJFA 1KRTA 3UDIA 3S2DH 4JBKA 4O2DA 4YY3L 3S15H 2CQOA 2OQKA 2Z6KC 5IYCH 1BKBA 1X54A 1N9WA 1MKHA 1SN8A 2LXKA 4LFCQ 2I5MX 3D31A 2R6GA 1CKMA 3S14H 4A3JH 1X6OA 4DNIA 1DGSA 1XPOA 4A3BG 3TS2A 3F2BA 1OXTA 2B3GA 4WJ4A 2WP8J 4XIGS 3PUZA 4DAYB 1HNWQ 5C4XH 3RN5A 2K75A 4X6AH 4A3CH 2HQLA 3HOWH 4JI4L 5C3EH 4JV5L 4DUYL 2B63H 1PVOA 1CKNB 1NBWA 5M3MG 1PH8A 2VQEQ 5IP9G 2JE6I 1J6QA 1IBML 3G71A 1WCMH 5GQOA 3TS0A 3EIVA 5IP7H 2OWOA 1WJJA 4DV5Q 4JI8Q 3CW2C 1I3QH 1LUZA 2OQ0A 3GTMH 2WFWA 1NTGA 2VQFQ 1VQGA 1VS0A 2Y0SE 2A19A 2GVAA 2I5HA 4YWMA 2ZM6L 4JBJA 4LFBQ 3I7FA 4HJ8A 2UXBL 2VNUD 3KOJA 2IHEA 4MZ9A 1KIXA 3AQQA 1Q82C 3CCRA 1XJVA 3ER0A 2NVYH 1EIFA 3AFQA 2XGTA 2UU9Q 1Q7YC 3NBHB 4P71A 4X65L 4IFDJ 1MJCA 3F2DA 4ME3A 3TQYA 4HJAA 1CSQA 4A76A 1L2FA 4DV6L 1N8RC 3UDXA 3A0JA 1IXRA 5LMNW 2NN6I 3M4PA 3H3VI 3HOZG 3ICEA 2UUBL 2JQOA 2N49A 1VQKA 1AH9A 4P74A 4BY7G 4GNXA 2D0OA 4A93G 1BBWA 4PZ7A 1B70B 1BVSA 2KENA 2QA4A 4HIDA 1NY4A 1YITA 3PF5A 3I4MG 4P73A 4DV3Q 1XNRQ 1UE7A 5IY0A 5C4JH 2FXQA 4YHHQ 3CCEA 1ASYA 3RZOH 2NZOA 1IYJB 1YVCA 1K0RA 4DUZL 5H1SE 1I6HH 3E9HA 3ERSX 3L0OA 3NELA 4JI1Q 1HR0W 4JI2L 2PQAA 2PQAB 1IL2A 3HOXH 2YV5A 2JA6G 1Q46A 2L15A 3H3VH 1JT8A 1HH2P 1KD1C 4QQBX 4FDBA 1TWCH 4YCUA 4X66L 2R92H 4DR7Q 4B3RL 4LF9L 2JA8G 1SFOH 3WWVA 1AE3A 4DR6Q 4DR1L 2PNHA 4GN5A 4YWKA 3UDGA 1PA6A 4IPGA 1Q86C 4L5TA 1VQBA 2AHOB 3ULJA 4X64L 4DV2L 3LGJA 2PMZE 4R4TA 1XMQQ 5GROA 4HJ9A 1EQQA 3HOXG 1GO3E 2E5LQ 4BY1G 1XMOL 1UE5A 5HY6A 5IYBH 3KYHC 1I5FA 4YCVA 3DM3A 3HOYG 2Y0SG 2VUMG 1FJGQ 3ZJYC 2K52A 1N32L 2HHHL 4BXXG 3NENA 2MFIA 2MNAA 2JEAI 5HGQA 4EQ5A 1C0AA 1CKOA 2R7ZH 1TWHH 1HNZL 1A62A 2OTJA 1NE3A 2DGYA 1QVCA 3KDFA 1T9HA 2E2HH 3FHWA 2C35B 2YTYA 4JBMA 3J7A5 1PH9A 4LFAL 5IYDH 3MEFA 5FJ8G 4GKKL 4A4IA 4LF7Q 3G48A 1E7ZA 2ZJRA 1E1TA 3MXNB 4QL5A 4DV4L 4LF5L 2HIXA 3TEHB 1SR3A 4C2MH 1KAWA 2YU9H 1S40A 1Q8KA 3K8AA 2R93G 1HNXL 3FKIH 4HIKA 3T1YQ 1LTLA 1IBKQ 4POFA 4A3FG 3BZKA 2N3SA 3OYYA 3CPWA 3PUXA 5LMNL 1QVGA 2F52A 1D7QA 1L1OA 1L1OB 1X3EA 4NPSA 4A3LG 4GS3A 4GN4B 2WAQE 4R4QA 4GN3B 3KFUA 3OW2A 1NMFA 3M4QA 3HFZB 1VQNA 1VQ7A 2DUDA 1ASZA 3H0GH 4UY8C 1HR0L 4BA1I 1BBUA 4DUYQ 1VQEA 2EXDA 1JMCA 4X62L 4JV5Q 3RLNA 4Y52H 1YEZA 4DAMA 4OWWB 2UXDL 4J15A 4A3IH 1IBMQ 4O0AA 3GTGH 3CC7A 4C3IH 3I4NG 3PO2H 3B6YA 1V43A 2XTIA 2Q2IA 4JI6L
chains in the Genus database with same CATH superfamily
2HT1A 3PIO3 4BBSH 2CH4A 3HOUB 1D1IA 1N33Q 1VQJA 5K5PA 3OTOL 1KQSA 1EYAA 4DR4L 3C1EA 2A6HD 2B2TA 5JEAG 1B53A 5C4XG 2A5HA 2VW9A 3V96A 3VR2A 2CH4W 4QUCA 1NJIC 3KBGA 2A6ED 1BCPC 4XQNA 4C3JB 5BR8Q 1X65A 2O5IC 1L0WA 3J80c 3AB9A 2H4OA 1D6EC 1SE4A 3J81j 5BN5A 4IPDA 2E76C 4DR5L 2RSOA 1HUNA 1PH4A 2PO4A 4C3IB 1Y1VH 1G6PA 5FO7B 3RMHA 1BQQT 1HZCA 2QGQA 1R4QB 2RHSB 1SJHD 2EJMA 4X66Q 4B3RQ 3MTSA 1Z9FA 4LF8L 1LABA 2ZJQA 1YJ9A 1JWUD 3BU2A 4YWLA 1EFWA 3GTQH 3NP8A 2B2WA 3FPPA 1WTVA 2IX3A 2KCTA 2PZUA 4IFDI 5EBCA 5E7NA 1WD0A 1M90C 2KOLA 3MXUA 5F2DA 2NVQB 1DZ1A 3MVVA 1EU3A 2F0UA 4CDDC 4M1UB 1YNND 5DLQE 1A8VA 3PF4A 2EY6A 1W3SA 3FRPB 1Q81C 1CHQD 4AQYL 2MP1A 1STNA 3RNUA 1QB5D 2J0TD 1Y1WB 4KV6A 3OWFA 3F1ZA 4ID6A 4GLAC 4A93B 5IT9E 3S9WA 2JA5B 1VQ6A 1TT2A 2O4XA 1QNUA 4F87A 5J3BA 1PYSB 5M5WH 3RN2A 1E3PA 4RG1A 4R8IA 4DXGA 1JQYD 1LLRD 1I50H 1XTDA 1LTGD 2WKCA 4A3MB 3I56A 1LT5D 1LT6D 1SNMA 1OTCA 4PV1C 1B7YB 1BCPD 1UWVA 2ZXRA 3BZDB 1SLJA 1ENCA 3S1NH 4I7AA 5KEEA 4EQPA 5JJIA 1KL9A 1N34L 2MPMA 3PUYA 3I3CA 3U4ZA 2EDGA 1I94L 5E1FA 3VYRA 4G4KA 5I9OA 3HOUH 1ZKOA 3ND8A 1FJGL 3CF5A 1O7YA 2IL8A 5IGBA 4HAEA 1OXUA 1HR0Q 1TKWB 2N78A 2UXDQ 4I65A 3H6MA 1QG7A 2NVTB 2NWGA 3EQLC 1VQOA 4EGVA 1JCKB 3X3MA 4C3JH 4JI6Q 2HDLA 2D2CC 4QIWB 1EY8A 2RCFA 4NB3A 1SAPA 2ID0A 2NZHA 2IT1A 1NR4A 1H95A 4WORA 1Q1EA 5CR3A 3GD7A 1EEFD 4ZUIA 3MFYA 5EKIA 3A5UA 2ZM6Q 4QY7A 3M3YB 2UXBQ 5IGEA 1RTNA 1EL0A 4FXGC 5M3MH 3MA2B 3PO2G 1CQVA 1TWFB 4LF4Q 3TBIB 3BZCA 4K6DA 2ZJPA 5M3FB 4K14A 3HG9A 1PTOH 4LUZA 4DFAA 5IGCA 4HCSA 4BA2I 1ET6A 3RD4A 5JVH3 3PQIA 3KK7A 1U4PA 1TWGB 2JJQA 4AH6A 3W1BA 1HNWL 1V9PA 2AWOA 3DEPA 1EYGA 4B08A 3GTPB 4GOPC 1WYDA 2AUJD 1N33L 3U58A 2AWNA 4A93H 2JA5H 2RF4A 2M9VA 4J8QA 1X55A 3QO2A 1QJOA 4JI7Q 3QOLA 4A3MH 5BR8L 1GUSA 1DOLA 1FGUA 1LO5D 2V1CC 3F8TA 1WCMB 2BE5C 1RCVD 5GAGC 2FMCA 3Q0AA 3A56A 3HOZB 5ELOA 4C3HG 1FNWA 2FHTA 4LFAQ 2G9HD 1HQMC 4DV3L 1YNXA 3VDYA 5I2YA 2Z6KA 2MO1A 3NPPA 3HOYH 3CCSA 2B2VC 4H7BA 2NVYB 1OXXK 1S72A 3WOEA 1PFNA 2P5ZX 3I2ZA 2OXPA 4OWTB 3SGIA 4FF3A 1AEXA 5EPLA 2VY3A 4HIMA 2JA6B 2XVSA 4L63B 3DMUA 4A3KG 1VQCA 3OW7A 3HOVG 5A35A 1YIJA 3OWEB 3CMAA 3ITPA 1TXYA 4OELB 3EBEA 2XNAC 4LUVA 5J22A 3ERQA 2H1EA 4LWCA 3S2HB 4BY1B 1AN8A 3SDZA 2F0WA 2CVRA 4B3MQ 2Y0SB 2K5HA 3T51B 1VQDA 2JA7G 2UXCQ 4B3TQ 4KN7C 3F2CA 2F0VA 2ZTCA 2IWHA 3KLSX 2AMCB 2NVXB 1C48A 1PH1A 1K8AC 1U4RA 3KJPA 5D65A 4OX9Q 1TWGH 1PH3A 1K9MC 2E2JH 1TVXA 3FPUB 1L0YB 4RGTA 4H44C 5ELNA 3PIOA 4A3EG 2BE5D 1Q1BA 1P16A 2LFNA 4QJFA 3UDIA 1Y8OB 1L0XB 4CDFC 4O2DA 3K57A 4OO1H 5FO8B 2DJFC 1X54A 1N9WA 2F0TA 1SN8A 2I5MX 2R6GA 3EA6A 4K6LA 1DD2A 4A3BG 4LMQD 3RUZA 4DAYA 2WP8J 4DAYB 3BVGA 4DNRB 2K75A 3RN5A 2FJ2A 1JR0D 1KLUD 5C3EH 4JV5L 4DUYL 1CKNB 1PH8A 3NQIA 5IP9G 3TMEA 2EJFC 1J6QA 2JE6I 1WCMH 5IP7H 3D6WA 4DV5Q 2DY8A 1I3QH 1LUZA 3GTMH 1O7LA 3URYA 5E3FA 2M2LA 2VQFQ 1VQGA 1HUMA 2I5HA 2ZM6L 2UXBL 1EYCA 1JICA 3NWTA 2XRQD 1JWSD 1KIXA 1ET9A 1T5XD 3TZDA 1Q82C 2K6AA 4P2CB 2NVYH 1EIFA 2UU9Q 4P71A 4HEDA 1MJCA 4ME3A 4PMCA 1EZ6A 3A54A 1L2FA 4CDCC 2NN6I 3ICEA 3D6CA 1SJED 1E2ZA 5T1IA 2JQOA 1AH9A 1VQKA 4P74A 3HOWB 1CQFA 1GHJA 4KTAA 5LHY1 1BBWA 4PZ7A 2B63B 2KENA 3I4MG 3VA7A 4RH6A 1PRTC 1XNRQ 1DXMA 2FXQA 4H0LC 1YVCA 1K0RA 3AU7A 1I6HH 1LTTD 4JI1Q 4JI2L 1LTBD 5HGTA 2WAQB 1Q46A 1STAA 1Q90A 1HH2P 4QF4A 4FDBA 3TP6A 2R92H 4DR7Q 3P1HA 2JSOA 4CJ2C 4QQBX 1FGBD 4LF9L 5D3DA 2JA8G 1O7ZA 1AE3A 4DR6Q 4YWKA 5ELCA 1Q86C 2AHOB 1XMQQ 4ODGA 2E5LQ 4ILWA 1UE5A 3NSWA 1I5FA 3OIPA 3R3OA 3A8KE 3MFGA 1K0SA 2K52A 4J1MA 3NENA 2MFIA 2MNAA 3RZOB 5HGQA 3QG1A 1U9RA 1KDBA 5E4WC 5A2QE 1NE3A 5CV4A 1IKMA 2JXMB 4NMZA 3KLSA 5J39A 4K5VA 1GOZA 1PH9A 1U4LA 4LFAL 2X69A 1LTAD 3K0YA 1LACA 1MSGA 2ZJRA 5IIFA 3N6RA 1ICWA 3QOJA 4DV4L 4LF5L 1SR3A 1A6XA 4RWSC 1Q8KA 1F2YA 4HIKA 1LTSD 4CJ1B 1X32A 4A3FG 5IT9L 3BZKA 3OYYA 5E4XA 5LMNL 1QVGA 1D7QA 2GA4B 1X3EA 5CMDA 3Q22A 4NPSA 2R7ZB 1PRTD 3TSSA 4MTKA 4PQXA 2KVMA 3HFZB 2F0LA 2NBFA 2DUDA 3HKZB 5AFWA 1HFNA 2V4DA 4UY8C 4BA1I 1BBUA 1VQEA 1RODA 3RLNA 1ENFA 4A3IH 1BF4A 4C2MB 3I4NG 2Q2IA 1QZHA 2L4NA 4F7XA 4DR2L 1ZYRC 4NDXA 1CM9A 3KJOA 4A3JG 4GZYC 3KUPA 3K81C 2Z4IA 5BN3A 1G2SA 4KY7A 4X65Q 4KHPL 1XNQL 3QJYA 1KNAA 3EFXD 4A3CG 4DV6Q 4X3UA 3I55A 3PO3H 1HXYD 3H3VC 3H0GB 4JC0A 2UUBQ 3E3XA 1J5EL 2XRSD 2F0IA 2MHVA 1MIUA 1Q8IA 3L2PA 5KGUA 5IWAL 2G9DA 4BBSB 4GNXB 5CV5A 2UUCL 2PZWA 4BBRB 4A3GB 5LMUL 2ASBA 5EPJA 4EX5A 1N36L 5K36H 2F03A 2J4XA 2PZTA 3JAMc 4DU9A 1WOCA 2KCNA 1YBYA 1H9JA 2VQFL 2NUCA 1Z47A 5FOBB 2MJ8A 3J81E 1XMOQ 4OONA 2CCZA 5FLMH 3GTOB 5KNBA 3MZ5A 1STHA 2VXWA 1PYBA 3NUCA 4L5QA 4P75A 2CKZB 2RCNA 1B1ZA 1VQ4A 1N32Q 3T56B 2ZTEA 1XPRA 1Y1VB 2WB1B 1EFID 3K5NA 1HNZQ 3J80i 1A0IA 1LT3D 2A6HC 4Z9CB 4XQJA 5C4HA 1XNRL 2VL6A 2K7VA 3CD6A 3D8GA 1EQVA 2A6EC 3OHXC 3GTQB 3KDFB 2QKIC 3NQTA 1D1KA 2PI2A 4A3DH 4K0KL 5T1GA 2F3IA 3CQZH 4IPCA 5GADC 3CAMA 4JI0L 1ZXTA 4XT3B 5D14A 2R3ZA 5JJLA 1PH7A 1PTOF 3S1MB 1DOMA 4IUVA 1HJPA 1B8AA 4MNOA 4DA2A 2XSCA 5JEAJ 3LWUA 3KF6A 3KF6B 2X6LA 1K3BC 4ZYSA 4F88A 2CHBD 2GN5A 1YHAA 2K5NA 5IE8A 1E2VA 2QF7A 2K5VA 5M5WB 5G3LF 3FKIG 5C44B 3WDNA 2L12A 2YYZA 1I50B 3S1RH 4WJ3M 1G2TA 3ULLA 2CWAA 2NTTA 4JPBW 1HZBA 2SOBA 1EWIA 3I73A 5DM73 4S3SA 3C46A 4TRDA 2O5JC 5CV6A 2K5WA 4NXML 3NXWA 1TIID 1UAPA 3E0EA 3S1NB 2K32A 4JYAQ 2F4VQ 4AYBB 1EYDA 1STBA 4DV0L 3VR6A 1A2TA 2D62A 4NXNL 1X3GA 3T13A 2R93B 4DV7Q 4RGNA 2RHQB 4BBRH 2B2UC 1EEID 2K4KA 3BS1A 4A3GH 2EVBA 1NUCA 4FVMA 1JJGA 1PFBA 1LTID 3RZDH 1G51A 4DK3C 2FINB 5I6WA 1EU4A 2N8NA 4C3IG 4JI5L 3AMUA 1E1OA 3D4RA 4G7HC 2JYOA 2OCEA 1PHJA 4UAIA 3GTOH 1UNSA 4B3SQ 5DNFA 2N55A 4LAAA 3G4SA 1K3RA 3CCQA 5EPKA 3T1HQ 3OSOA 3G6JB 1SMYD 2AQ1B 4LUOA 1W2BA 2Q2HA 5EKKA 2ZXOA 2JK8A 1DOKA 1EY9A 2F0QA 2QEXA 3DM1A 1EIGA 2EYMA 2HD3A 2Q8RE 3CC4A 2KJXA 4TQUS 2EE1A 4BY7H 3J7AV 1LV9A 3GTJH 1DJRD 1OO9B 1G91A 5M3MB 4JI8L 2SNSA 1IZ6A 2F0DA 4DGZA 4G57A 2LXJA 3ZYYX 4QIWE 4H13C 4UP8A 4LFBL 1Y1WG 1PTOB 3RLOA 1X3PA 1EY5A 1XWEA 5HURA 3J81i 3CHBD 2JA5G 2NYZD 3HEJA 4IO9A 2UUAQ 2MQHA 2HHHQ 3S1MH 3M7GA 4UP7A 3A8IE 3BDOA 1M1KC 3J7AF 1VQAA 4HR7B 5C4ZA 1PV4A 4GKJQ 1K73C 2E74C 2F4IA 4A3MG 4K5XA 4IUQA 4F8MA 1WFQA 2D5DA 4CGYB 2VUMH 1II3A 2L0CA 4BXXH 5I6YA 2EYLA 5C44H 3DWQA 2KCCA 5LL6X 3D4WA 4KD4A 3MEHA 1A3VA 3K7AH 1AE2A 4IFDG 3JC66 3TREA 1PFSA 2NB0A 2Z0SA 4KI0A 4KN4C 3TRZA 5FJ8H 1CZGA 4QGUA 4JG2A 4K5WA 2ATWA 3U4VA 2A8VA 5ELEA 2K14A 1SSOA 3A74A 3A7AB 1IBLQ 5FLXE 1ML0D 2ALYB 3HOXB 2R93H 2G5DA 2JP1A 3HKSA 3KBXA 1PZID 3HOYB 4IJHA 1TU2B 2LY7A 4OEMB 3W2DA 1V1PA 1SFOB 4LF6Q 4XDXA 4X62Q 1SYFA 4DKAC 4FF2A 4UDUC 2CFMA 3BDCA 4BS9A 5AJ3Q 2KHJA 2YTVA 1B50A 1EIHA 3H91A 4LF7L 2EYPA 4OO1I 5JOBA 2MGSA 1B3AA 2Q8TA 3R8BA 1GVPA 4DXFA 1HQRD 1I4QA 2Z4HA 4ZAIA 1HCZA 1TWAH 2LMCB 4KHVA 5A2QL 1F9RA 1BDOA 4B9XA 4DK6C 4ALPA 2JEBI 1X3QA 5M3FG 1PXUA 1O7IA 4PMWA 1KRTA 2FMMA 3S15H 2KECA 1BKBA 1BCPF 4LFCQ 3SK4A 5D3IB 1DGSA 5JEAH 1O78A 3F2BA 2B3GA 5EBDA 1WD1A 5C4XH 5CC4A 1CFMA 1NBWA 2VQEQ 1IBML 5GQOA 3TS0A 3EIVA 4DNTB 2E2JB 4X3TA 1WJJA 3CW2C 1G8ZD 4C1NK 5IODA 2Y0SE 3FMCA 3DHQA 4JBJA 1C4QA 2IHEA 3T53B 5JPNC 4ZLTF 4XT1B 1WTOA 3NTHA 3F2DA 3HOZG 1N8RC 3UDXA 5LMNW 1HPCA 1TY0A 3L9AX 3QB3A 2N49A 2D0OA 5C3EB 1B70B 1NY4A 4P73A 2L11A 5C4JH 3CCEA 4YHHQ 3OMGA 4X3SA 3LNNA 1IYJB 1I3QB 2ENBA 3GTMB 3L0OA 3U9SA 3TP5A 2PQAA 2PQAB 3PMFA 3HOXH 1E2WA 2YV5A 3TP8A 3T4AC 2JA6G 3WOFA 2IPKD 3H3VH 1JT8A 1KD1C 1TWCH 4X66L 3BDLA 3EROA 1F77A 4B3RL 3MC0B 1SFOH 1STGA 1Z7TA 3EJIA 4GN5A 3UDGA 1S5ED 4L5TA 1EY6A 3ULJA 3R93A 3LGJA 2EPBA 4R4TA 4HCEA 2B8FA 5EQ0A 4HJ9A 3R2TA 4BY1G 4YCVA 3BG3A 3DM3A 2Y0SG 3CRLC 3E5SA 2HHHL 1R9TB 1GUWA 1CKOA 4XXEA 1STEA 1I6HB 4KMUC 2DGYA 1QVCA 4PMBA 3MXPA 2C35B 3UI2A 4I7ZC 1BUVT 1BCPB 5EJWA 2R92B 1XYIA 1KLGD 5L37A 4ZK9B 3N52A 2KHSA 4CJ0B 4QL5A 4IURA 1F9QA 4O1NA 3TEHB 3I4LA 4RCNA 3VYSA 2AUKA 1KAWA 2YU9H 1S40A 3K8AA 5KIXA 3T1YQ 3K5MA 1IBKQ 4XYQA 3BVMA 1B9MA 1SE2A 3VYUA 2KA7A 4A3LG 4R4QA 2WAQE 3KFUA 3M4QA 2RBMA 1VQNA 1FD7D 1VQ7A 2EOTA 1HR0L 2EXDA 2JN4A 5KNDA 4X62L 3D4DA 3I8ZA 2UXDL 5C6AA 3TZUA 4DF7A 1NSNS 3LWEA 3CC7A 5DAUA 3PO2H 1U4MA 3B6YA 2EJGC 4JI6L 1FNUA 1CSPA 2XIWA 1Y14B 1EIYB 2RVLA 5IYCG 5CGKA 3BVZA 4CHTB 3PUVA 3UE1A 1X3FA 1EQRA 2WACA 4GLVB 2K5QA 5EKLA 3RR5A 1SYCA 3IKJA 2MO0A 2IX0A 3UE0A 2C5CA 4KY5A 3HOWG 4MN3A 2A74C 4HJ7A 4JOIC 2B63G 2PW5A 1UE1A 4Q0FA 1IW7C 2F0KA 1EQTA 1K83B 4A3IB 4LF4L 2A1AA 1K28A 4DUZQ 1HFGA 1MD2D 2WAQG 4IALA 4UP9A 4DPGA 4A3BB 3RLFA 5IT9c 3PV0A 1SMXA 1KHIA 1NMGA 3C1FA 1BO0A 1VCIA 2OEOA 4K8IA 4RKLA 1R9TH 1L1OC 1VQ8A 4MHEA 3HKZE 1SYBA 5KYLA 1JE5A 3K5LA 2A68C 3PO3B 4BWGB 2LSSA 4R1JA 3Q23A 5C0XG 1KDCA 2CW0D 1H9KA 3C3LA 4C3HH 1QWYA 2OTLA 5JJZA 1Y8NB 1UEBA 3L3OC 5M5YH 3AEVA 2QDBA 3J80E 4RGOS 5FK9C 4JI3Q 2Z1CA 4TKOB 1KABA 4JI7L 1EY0A 2DNEA 2NN6G 1XTCD 1GUNA 3BJUA 4POGA 5IGFA 3G6EA 2B2YC 5GAHC 4GKKQ 1BR9A 1SE8A 4A3KH 2BOSA 2WKDA 3M7NA 3I4MB 1A63A 4JCVE 3CMEA 3HOVH 2B2TC 1I4RA 2EY1A 3A8JE 1YJNA 2J7ZA 2F0FA 4RMFA 5IYBG 1CTMA 3QIAA 1HNXQ 1DM0B 3E0JA 3GTKH 3JAMi 1XPUA 1F2ZA 4R4IA 1VQ5A 1RJTA 2F1MA 2R7ZG 4LK1C 3NTKA 4FXDA 1K8MA 2Q8IB 4JVZA 2JA7H 1IW7D 2L55A 1FL0A 1PZJD 5CBAE 3AFPA 3HKZG 3UDFA 5IYDG 3S17H 4OXPA 4GOPA 1VQPA 1MBYA 4GOPB 2PQEA 2BH2A 1K8GA 4L6TB 3NK9A 1HA5A 4YY3Q 1G291 3MAQA 1JB7A 3PUWA 3OMCA 3M85A 3SK8A 1UUPA 3SR1A 4A3DB 2B2WC 1VQ9A 3CQZB 4KLKA 4A3EH 3A7LA 1S5DD 2CWPA 3GTLH 4B3ML 1WI5A 3H15A 2A68D 4KJNA 4KK7A 2BCOA 5KNCA 2WB1E 2UXCL 1SYDA 4IPHA 1K83H 4B3TL 3OTOQ 1SROA 4RAUC 5FLXL 3A55A 4A3BH 3T1YL 3H0GG 1B4OA 1IBKL 2ES2A 3W5OA 4Y7NH 4OX9L 2EYHA 2HUGA 2B2VA 2E8GA 2K50A 1B9NA 1QOHA 2F0SA 2PI2E 5IP9H 1HHVA 4K2KA 4P72A 3P20A 4IUUA 1QUQA 1QUQB 4DR5Q 3W1GA 3IAYA 4BBSG 3S1RB 3KLWA 4IN3A 3DWAA 1AFPA 4BBRG 4R4OA 5C5MA 1WTWA 1PFMA 4A3GG 2ICIA 3CCLA 1QILA 3STBD 1HZ9A 1A3UA 3GO5A 3Q8DA 2VB2X 2F3WA 3K59A 4LF8Q 1R4PB 3M9BA 1ESRA 2BA0A 3AYHB 1E24A 1PRTF 1IYUA 4RHSA 3KF8A 3KF8B 3R2IA 3KLRA 2B29A 4DV5L 3RZDB 2K33A 4DR1Q 3I4MH 1GHKA 3IFTA 1Q12A 2K5DA 1Y1VG 2WB1G 3VR4A 4X64Q 1I4HA 4DK0A 4HSPA 1S3OA 2LKVA 4OWXB 1PH2A 2AQ3B 3SK5A 3K0XA 4AQYQ 1VQLA 4QUFA 4AYBE 2A69C 3M4OH 2UU9L 1XX8A 3PCOB 2JA8H 1PTOD 3H94A 1ZEQX 2AKWB 1PH6A 4XQQA 1HZAA 1W6JA 4QCLA 2EQSA 1E0BA 1D8LA 1EZ8A 2DY7A 3IRBA 4A75A 1V8QA 1EOVA 4OL7A 2IX1A 4BY7B 3GTJB 1ICFB 2QEJC 4K2LA 1P8LA 4JI1L 2HIVA 5G3LD 1TS2A 2SDFA 3I4OA 4APVA 4LW1A 4CDEC 2TMPA 1S4ZA 2HQEA 1IYVA 1VQHA 1N34Q 1TR5A 4DR7L 1JWMD 4QB4A 2F0HA 3S16H 3K58A 1SMYC 1YZ6A 3SEBA 1I94Q 2DNCA 4DR6L 5EAYA 2AQ2B 1A15A 4OGQC 1MJEA 3IL8A 2R7DA 1VQMA 5CBEE 1XMQL 5C44G 4JI3L 1YJWA 2E5LL 5CV7A 2K04A 3SK6A 1JOQA 4PZ6A 1MGSA 4JOIA 3VA5A 1YHBA 4AIMA 4WJWA 2VUMB 1T5EA 5FO9B 4A3FH 4AYBG 2R61A 1I4GA 5CORA 4UHVA 2RKSA 3K7AB 4DV2Q 1VQIA 3HOUG 3DXJC 2ZTDA 4RKBA 2K03A 3I90A 2E2IH 1YI2A 1SYEA 1GUOA 5JPMC 2HCCA 1PRTB 3D3RA 1JE4A 2WIIB 4HMIA 4G7ZC 2A69D 4N8X1 4DR3Q 1B2TA 4UPAA 3DEOA 4C3JG 1SNPA 3I4NH 4ZKCB 3GDEA 4R4CA 2VB3X 3TDQA 3S2DH 1RDPD 4YY3L 3HS0C 2CQOA 2OQKA 2Z6KC 3OIQA 1MKHA 4NKLA 3D31A 1QNKA 1CKMA 1H9RA 3S14H 4A3JH 4DNIA 1XPOA 3HRZC 3TS2A 1OXTA 4XIGS 1HNWQ 4X6AH 4DK1A 4A3CH 1SE3A 4O42A 1JB3A 2PMZB 4HN7A 2B2YA 1XXGA 1PVOA 5M3MG 3K6OA 1TWAB 3G71A 3BYTB 4KKTA 4CKCA 4EQNA 2F0EA 3I7FA 1SNDA 2K1BA 3HGBA 3S15B 2BDOA 3J7YW 3CCRA 1JC7A 3AFQA 3NBHA 4L8JA 4EQOA 3NBHB 4X65L 4IFDJ 2EZVA 4N8FA 4HJAA 1CSQA 4DV6L 4IUPA 4X3KA 3M4PA 3H3VI 5C4XB 2UUBL 1NR2A 4RGMA 2Z8LA 4A93G 3I91A 1BVSA 1YITA 3H09A 4DV3Q 1UE7A 1ASYA 2NZOA 4FF1A 1FYCA 5H1SE 2N88A 1HR0W 3NELA 1AP0A 1IL2A 4LJZC 1GUTA 3PIP3 2L15A 4YCUA 1JOOA 3NBIA 5COYA 4V190 1VMCA 4DR1L 1D5XC 1PA6A 4M8AA 4IPGA 3S1QB 1VQBA 2Z6BA 4X64L 2ICEC 1EQQA 3HOXG 1GO3E 1XMOL 1BXTA 1GJXA 5HY6A 3KYHC 1STYA 2RDGA 3HOYG 1O80A 3ZJYC 1N32L 4IUTA 5C4JB 2JEAI 4WRDA 4EQ5A 1C0AA 1TWHH 1HNZL 4CKBA 2OTJA 2E2HH 2RA4A 2YTYA 4JBMA 3J7A5 2RSNA 4MIUA 4N9TA 3MEFA 1TWCB 3DWPA 4A4IA 4TSSA 4JW0A 2E2DC 1E7ZA 1V1PB 2OF1A 5I2XA 3J80L 5CV8A 2CQAA 5DEHA 3FKIH 4ZCKA 2RQXA 1SXTA 1B3QA 5J1ZA 4JK1C 4POFA 2KEDA 4FF4A 1F9PA 1I4PA 5IOCA 2LS01 3CPWA 4RCOA 2F52A 1VDZA 1A2UA 4GN4B 4GN3B 4KD3A 1NMFA 1TQOA 1GXDC 1Q3LA 5ELDA 1ASZA 3G7LA 4JV5Q 1H9SA 1PDQA 4E6IA 1H9SB 4DUYQ 4Y52H 1UEAB 1YEZA 4DAMA 4RA8A 5TSSA 1WTXA 4O0AA 3X3NA 2Z9HA 3MXGA 2YU9B 3GV6A 4C3IH 1V43A 1DYQA 1LTRD 4DV2L 4OIJA 2NZ1D 2BA1A 5C3XA 4IUNA 1MI2A 4OO1G 1JORA 2NTSA 5ISRA 4DV1Q 2DJGC 4JYAL 2F4VL 1QCBD 1H9MA 1V1QA 1UE6A 5C5LA 4DR3L 2O2LD 3J81c 5DM63 1FR3A 1D5MC 1TS3A 4HSVA 4DV7L 5C3EG 2SNMA 2D0PA 3A5ZB 2NVQH 2ZXPA 2PCFB 3C2PA 1WCMG 5IP7G 1JOKA 1EUJA 3S1QH 3IFDA 1E22A 2EYFA 3FVQA 1RTOA 2GVBA 5ELBA 3CCUA 3PO2B 5CYUA 4C56C 3NEMA 3L7ZC 4JI2Q 1GKHA 4B3SL 1Y1WH 3K80C 1I4XA 4K8JA 3CCJA 3T1HL 1YHQA 1PH5A 1M4VA 3HP3A 4LF9Q 4L5SA 1C8CA 4FYDA 2EY5A 4KHZA 4NW2A 4ABNA 4C1NI 1Z6HA 1NCVA 1S5BD 1BBXC 1GM5A 1RIPA 2L1BA 3VR5A 4CBVA 2Q2UA 3FEWX 2XWJB 3PSIA 3CCVA 5C3WA 4H02A 1FVIA 4GLXA 2R92G 1A3TA 2B2UA 5M5XB 4IFDH 1NNXA 1VQFA 4ZQ3A 2UUAL 1CUKA 3OOCA 1ESFA 5JVG3 1SNQA 1TY2A 1VF7A 3OPOA 1TS4A 1RL2A 3J81L 4GKJL 1CK1A 4DV4Q 4R9WA 4CKEA 4ULLA 4LF5Q 3JAME 2NVTH 1GD7A 3SVMA 3CC2A 3ONAB 3DUZA 4C3HB 3T16A 2KQ3A 3CU7A 1BOSA 5CV9A 5M5YB 4IJLA 5LMNQ 2E75C 2I0QA 4NP5A 4PZ8A 4GNXC 3EN2A 3FP9A 3M3YH 4ZKBB 4XYOA 1EY7A 2HDMA 3CRKC 2KCMA 4A3KB 1SNCA 4MTNA 3CP0A 4XTCS 3S24A 4IOCA 1ONLA 2CW0C 3HOVB 3ULPA 3CKIB 3I70A 1IBLL 1TWFH 1HTLD 3M4YA 2F0JA 1SEBD 1Y69U 5M3FH 1C9OA 1QVFA 3GTKB 3W3AA 1J9OA 1U5KA 4JI4Q 4LF6L 3PGZA 4DR2Q 2HCIA 2IW3A 3VR3A 4ZUJA 5AJ3L 2R7FA 2JA7B 4LNQA 4HMJA 1C7YA 3U50C 3QR8A 1PLFA 1JJ2A 3S17B 2YTXA 2I5LX 4KHPQ 1XNQQ 3DLLA 4FXKC 3GTPH 4HJ5A 4L5RC 2EIFA 4A3IG 1J5EQ 1KAAA 3K7UC 1MHWC 5C0XJ 3NE5B 1PYWD 4DN4M 2C9OA 2BH8A 1SBBB 5IWAQ 1U0LA 1TS5A 3NHHA 4A3EB 3GTLB 2X6GA 5IGGA 1F9SA 1CI3M 1CHPD 2EY2A 2UUCQ 1D2BA 1CKNA 1VMPA 4LFCL 1LM0A 5LMUQ 4IOAA 1I6VC 2KEEA 1N36Q 3J7ZC 2QDLA 3PO3G 3E6ZX 1CZWA 3HOZH 1SRUA 2KBNA 4JBWA 2VS1A 3P7JA 5I4DA 5C0XI 5M5XH 4Y7NB 4R8NA 2VQEL 4DV1L 3K5OA 2BDNA 1OXVA 4RFBA 4U673 2H5XA 2QILA 1YNJC 4KKSA 1W6KA 3PIPA 1SNOA 4B9WA 3SHLA 2KHIA 5GAEC 2IHFA 1FNVA 1KTKA 3D0FA 3TN2A 2JA6H 1KRSA 4DAVA 5K36G 1OXSC 3CCMA 1CA6A 1G6ZA 5FLXc 3S2HH 5FLMG 4TVAB 2Q2TA 4BY1H 4K0KQ 4G7OC 1MSHA 1K8OA 2SEBD 2KUMA 4JI0Q 4YHHL 2MUYA 1ILQA 4OHJA 1LYLA 4YIJA 4RHRA 2RDHA 1KNEA 3STBC 1D5ZC 1WTHA 2NVXH 1WTRA 1J8IA 2F0NA 3CXCA 1QZGA 1GUGA 3M4OB 4IZ8A 4PG3A 1ENAA 2JA8B 2I46A 4KY6A 2K01A 4A3DG 1KXLA 1DCZA 1Y8PB 5JJKA 1AZPA 1JJCB 3F2UA 5FKAC 3V2TA 4HTHA 2XN9C 3V05A 2F0OA 3P75A 5JAVA 5KRUA 1X9NA 1CT1D 1HRJA 4NXMQ 2F0GA 1X56A 2JA9A 4HIOA 1IKLA 4A3LH 4FNFA 2EYOA 2IJ0A 3HZXA 1YNJD 1RKNA 4DV0Q 3S16B 1PTOC 1S5CD 2QCPX 4NXNQ 3CPFA 3I72A 4YCWA 5IGDA 2IY5B 2VZAA 3GV3A 1KC8C 4DR4Q 2EXZA 4ME5A 1EOTA 1PMRA 1IL8A 4JI5Q 4J6HA 3Q6SA 2F0MA 2L5TA 3E9IA 4OIKA 4QMGA 4JBKA 4A3FB 1F2LA 5IYCH 5BN4A 3EVQA 1LT4D 2LXKA 1X6OA 2RDFA 4U68A 2I07B 2D9UA 4WJ4A 1DONA 1F2MA 3PUZA 2DN8A 2PW7A 3QWNA 2HQLA 3HOWH 2E2IB 4JI4L 1ILPA 1WTQA 2B63H 2K28A 1PZKD 2OWOA 1RF2D 4JI8Q 3MHBA 2OQ0A 2WFWA 1NTGA 1HA6A 1VS0A 3I4NB 2A19A 2GVAA 4YWMA 5NUCA 4LFBQ 4HJ8A 2VNUD 3KOJA 3S2DB 2ZT9C 4MZ9A 3AQQA 1XJVA 4V0BA 4EVOA 3ER0A 1S5FD 1BNZA 2XGTA 1Q7YC 4A3JB 3S14B 3TQYA 2PNRC 4A76A 3GTGB 3A0JA 1IXRA 4Q5VA 4KJOA 2PPBC 4BY7G 3Q24A 4GNXA 5C0XH 2QA4A 4HIDA 3PF5A 1RD9D 2PYKA 2TSSA 3NWSA 5IY0A 3RZOH 4DUZL 2L9HA 1AZQA 3E9HA 3ERSX 2XWBB 5ELFA 1SYGA 4FP5D 2NN6H 4PNYA 4IQZA 5EGTA 3O13A 1RHPA 3BYYB 1QE6A 1KDAA 3WWVA 2PNHA 2M00A 1VF5C 5I9PA 3ND9A 4DAPA 5M9OA 2PMZE 3MWYW 5GROA 1SDFA 1V1OA 5IYBH 4KKUA 5KYIA 2K05A 2F3VA 2VUMG 1FJGQ 4BXXG 3SE0A 2R7ZH 1CA5A 1ZYRD 1A62A 2B39A 3KDFA 1EWHA 1T9HA 3FHWA 4N9PA 3VYTA 5IYDH 2OT2A 1B44D 5FJ8G 4GKKL 4LF7Q 3G48A 3SXHA 1EY4A 1E1TA 3GP7A 3MXNA 3MXNB 3FDTA 2HIXA 4WFN3 3U9OA 4C2MH 2R93G 1HNXL 2F0PA 1LTLA 2WINB 2WV6D 3TP7A 2N3SA 1AW7A 3PUXA 1L1OA 1L1OB 1EWCA 4GS3A 1TWHB 2FFKB 3JAML 1NAPA 3LX0A 3OW2A 2E2HB 2B8GA 2EYJA 1M8AA 5LL6S 3GQBA 1IHZA 3H0GH 4ZRZA 1WVLA 4FO2A 1YNNC 2QW7A 1WTPA 1JMCA 4OWWB 2A73B 4J15A 1IBMQ 3NTIA 3GTGH 3FKIB 2XTIA 1HTPA
chains in the Genus database with same CATH topology
2HT1A 1CSPA 1QZHA 4BBSH 1Y14B 2BA1A 4DR2L 4OO1G 1EIYB 5IYCG 4DV1Q 1N33Q 1VQJA 3OTOL 3KJOA 1KQSA 3PUVA 3UE1A 4A3JG 4DR4L 4JYAL 1X3FA 1V1QA 3K81C 1EQRA 5JEAG 2F4VL 1UE6A 4GLVB 4DR3L 3J81c 4X65Q 3RR5A 5C4XG 2VW9A 1XNQL 4KHPL 2MO0A 2IX0A 3UE0A 4DV6Q 4A3CG 3I55A 3HOWG 4DV7L 1NJIC 3PO3H 5C3EG 4HJ7A 4JOIC 2B63G 4JC0A 2UUBQ 2D0PA 5BR8Q 1X65A 3A5ZB 1L0WA 2NVQH 1J5EL 1WCMG 1UE1A 5IP7G 3J80c 1EUJA 1MIUA 3S1QH 1E22A 3J81j 4LF4L 4IPDA 4DR5L 3L2PA 2A1AA 5IWAL 1PH4A 1G6PA 2GVBA 1Y1VH 3CCUA 4DUZQ 3NEMA 2WAQG 3L7ZC 4JI2Q 4UP9A 4DPGA 1GKHA 3RLFA 4B3SL 4GNXB 2UUCL 5IT9c 3PV0A 1HZCA 1KHIA 1NMGA 1SMXA 2QGQA 3K80C 3T1HL 3CCJA 1Y1WH 1YHQA 1PH5A 2RHSB 5LMUL 4X66Q 2ASBA 4B3RQ 1VCIA 1Z9FA 4EX5A 1N36L 4LF8L 4L5SA 4LF9Q 1R9TH 1L1OC 1VQ8A 2ZJQA 3JAMc 3HKZE 1YJ9A 1JE5A 1WOCA 3BU2A 4KHZA 4YWLA 1EFWA 3GTQH 1YBYA 2VQFL 1Z47A 2LSSA 2KCTA 4R1JA 5C0XG 4IFDI 5E7NA 1XMOQ 4OONA 1M90C 4C3HH 5FLMH 2CCZA 4L5QA 4P75A 1PYBA 2OTLA 2CKZB 2RCNA 1UEBA 5M5YH 1GM5A 3AEVA 5DLQE 1RIPA 1A8VA 1VQ4A 1N32Q 3PF4A 2ZTEA 2Q2UA 4JI3Q 1XPRA 1W3SA 3PSIA 4JI7L 2NN6G 3CCVA 1HNZQ 4H02A 1A0IA 1FVIA 3BJUA 3J80i 1Q81C 4POGA 4AQYL 4GLXA 2R92G 3RNUA 3G6EA 5GAHC 2UUAL 1VQFA 3F1ZA 4GKKQ 1XNRL 1CUKA 4GLAC 2VL6A 1SE8A 1VQ6A 4A3KH 1A63A 3M7NA 3CD6A 4JCVE 5J3BA 1RL2A 3CMEA 1PYSB 3HOVH 5M5WH 3RN2A 1E3PA 4RG1A 1YJNA 4GKJL 4DV4Q 4WJ3M 3KDFB 4LF5Q 4RMFA 5IYBG 2PI2A 4A3DH 2NVTH 4K0KL 1GD7A 1I50H 1XTDA 2F3IA 3CQZH 4IPCA 5GADC 1HNXQ 3CC2A 3CAMA 3I56A 3GTKH 4JI0L 3JAMi 1OTCA 1XPUA 1B7YB 4R4IA 1VQ5A 1UWVA 5JJLA 1PH7A 2R7ZG 1SLJA 4IJLA 5LMNQ 2I0QA 3S1NH 2JA7H 1FL0A 5JJIA 1KL9A 1HJPA 1B8AA 1N34L 5IYDG 3AFPA 3HKZG 4MNOA 3PUYA 4PZ8A 3UDFA 4OXPA 3U4ZA 3S17H 1I94L 4GOPA 1VQPA 4GOPB 5JEAJ 4GNXC 3EN2A 3KF6A 3FP9A 3KF6B 1K8GA 2BH2A 3HOUH 1FJGL 3M3YH 3CF5A 4YY3Q 1G291 2GN5A 1JB7A 1YHAA 2K5NA 2KCMA 5IE8A 1OXUA 3PUWA 1HR0Q 4MTNA 4IOCA 3CP0A 4XTCS 3S24A 3M85A 2K5VA 2N78A 3ULPA 2UXDQ 3FKIG 1IBLL 1TWFH 2YYZA 1VQ9A 3S1RH 1VQOA 4KLKA 1C9OA 5M3FH 3ULLA 4C3JH 4A3EH 1QVFA 2CWPA 2CWAA 4JI6Q 4B3ML 3GTLH 1WI5A 1HZBA 3H15A 1EWIA 1U5KA 4JI4Q 4LF6L 3PGZA 4NB3A 4DR2Q 2ID0A 2NZHA 2WB1E 4NXML 2UXCL 4IPHA 2IT1A 1K83H 4B3TL 5AJ3L 3E0EA 3OTOQ 1H95A 1SROA 2R7FA 1Q1EA 4LNQA 4JYAQ 1C7YA 2F4VQ 3U50C 3GD7A 1JJ2A 4DV0L 2YTXA 2I5LX 4A3BH 3T1YL 4KHPQ 3H0GG 1XNQQ 2D62A 3A5UA 1IBKL 4NXNL 3W5OA 1X3GA 2ZM6Q 3DLLA 2ES2A 4DV7Q 3GTPH 4HJ5A 4QY7A 4Y7NH 2RHQB 4BBRH 2UXBQ 4OX9L 4A3GH 2K4KA 4L5RC 2EIFA 1JJGA 4A3IG 1J5EQ 2E8GA 2K50A 5M3MH 3RZDH 1G51A 2PI2E 3K7UC 4DK3C 5IP9H 5C0XJ 2N8NA 3PO2G 4JI5L 1E1OA 4P72A 4LF4Q 1QUQA 2BH8A 1QUQB 4DR5Q 3BZCA 3W1GA 5IWAQ 2ZJPA 4BBSG 1U0LA 2OCEA 3KLWA 1PHJA 3GTOH 4LUZA 4BBRG 4R4OA 4A3GG 4B3SQ 4BA2I 2UUCQ 3CCLA 3STBD 1CKNA 3G4SA 4LFCL 1K3RA 1HZ9A 1LM0A 3GO5A 3Q8DA 3CCQA 3T1HQ 5LMUQ 4IOAA 2JJQA 4LUOA 1N36Q 4LF8Q 3M9BA 1W2BA 4AH6A 3J7ZC 2Q2HA 3W1BA 2BA0A 1HNWL 1V9PA 2AWOA 3AYHB 3PO3G 1E24A 2JK8A 3HOZH 2QEXA 1SRUA 2KBNA 4JBWA 2VS1A 1EYGA 5C0XI 5M5XH 4GOPC 1WYDA 3KF8B 2VQEL 2B29A 4DV1L 3CC4A 4TQUS 1N33L 4BY7H 3U58A 2AWNA 4A93H 3GTJH 2JA5H 1OXVA 4DV5L 4JI8L 2RF4A 4DR1Q 3I4MH 1Q12A 1IZ6A 1X55A 1Y1VG 2WB1G 2H5XA 4X64Q 2LXJA 4QIWE 3PIPA 4UP8A 4LFBL 1S3OA 4JI7Q 4OWXB 2KHIA 5GAEC 1Y1WG 1PH2A 4A3MH 2IHFA 3RLOA 5BR8L 3D0FA 4AQYQ 3K0XA 2JA6H 3J81i 1FGUA 1KRSA 1VQLA 4AYBE 2JA5G 2V1CC 3F8TA 5K36G 3M4OH 2UU9L 4IO9A 2UUAQ 3PCOB 2MQHA 2HHHQ 1OXSC 2JA8H 3CCMA 2AKWB 3S1MH 4UP7A 1PH6A 1M1KC 1VQAA 5FLXc 1HZAA 5GAGC 2EQSA 1D8LA 1PV4A 3IRBA 4GKJQ 5ELOA 4A75A 1K73C 1EOVA 3S2HH 5FLMG 4A3MG 4TVAB 2Q2TA 4BY1H 4LFAQ 2IX1A 4K0KQ 4DV3L 1YNXA 3VDYA 1WFQA 2MO1A 2Z6KA 4JI0Q 2VUMH 3HOYH 4YHHL 3CCSA 1OXXK 1LYLA 1P8LA 4JI1L 2HIVA 1S72A 4BXXH 5C44H 3I4OA 4APVA 3I2ZA 4LW1A 4OWTB 3SGIA 1VQHA 3STBC 3K7AH 1N34Q 1AE2A 4DR7L 3JC66 4IFDG 3S16H 3TREA 2VY3A 4HIMA 1PFSA 2NVXH 1YZ6A 2Z0SA 4KI0A 1I94Q 3TRZA 4DR6L 5EAYA 3CXCA 5FJ8H 1QZGA 4A3KG 4QGUA 4PG3A 4JG2A 1VQCA 3HOVG 1MJEA 1YIJA 2ATWA 3CMAA 3U4VA 2A8VA 1TXYA 2R7DA 1VQMA 3EBEA 1XMQL 5C44G 4JI3L 1YJWA 4A3DG 1KXLA 2E5LL 4LUVA 2K14A 3A74A 4LWCA 5JJKA 1IBLQ 1JJCB 4PZ6A 2ALYB 2R93H 4JOIA 3HKSA 1YHBA 4AIMA 4B3MQ 4IJHA 2K5HA 4A3FH 1VQDA 4LF6Q 1X9NA 4X62Q 2JA7G 2UXCQ 4DKAC 4NXMQ 2CFMA 4AYBG 4B3TQ 1X56A 5AJ3Q 2JA9A 4HIOA 4A3LH 2KHJA 3F2CA 2YTVA 4DV2Q 1VQIA 2ZTCA 3HOUG 2ZTDA 4DV0Q 4LF7L 2AMCB 2E2IH 1YI2A 4OO1I 4NXNQ 1PH1A 1K8AC 3CPFA 1GVPA 4YCWA 3KJPA 2IY5B 2VZAA 4OX9Q 1TWGH 1PH3A 1TWAH 1K9MC 1KC8C 4DR4Q 2E2JH 4ALPA 4DK6C 2JEBI 4DR3Q 4UPAA 5ELNA 5M3FG 4JI5Q 3PIOA 4A3EG 1Q1BA 1P16A 3I4NH 3GDEA 4R4CA 1O7IA 4PMWA 3E9IA 4QJFA 1KRTA 3UDIA 3S2DH 4JBKA 4O2DA 4YY3L 3S15H 2CQOA 2OQKA 2Z6KC 5IYCH 1BKBA 1X54A 1N9WA 1MKHA 1SN8A 2LXKA 4LFCQ 2I5MX 3D31A 2R6GA 1CKMA 3S14H 4A3JH 1X6OA 4DNIA 1DGSA 1XPOA 4A3BG 3TS2A 3F2BA 1OXTA 2B3GA 4WJ4A 2WP8J 4XIGS 3PUZA 4DAYB 1HNWQ 5C4XH 3RN5A 2K75A 4X6AH 4A3CH 2HQLA 3HOWH 4JI4L 5C3EH 4JV5L 4DUYL 2B63H 1PVOA 1CKNB 1NBWA 5M3MG 1PH8A 2VQEQ 5IP9G 2JE6I 1J6QA 1IBML 3G71A 1WCMH 5GQOA 3TS0A 3EIVA 5IP7H 2OWOA 1WJJA 4DV5Q 4JI8Q 3CW2C 1I3QH 1LUZA 2OQ0A 3GTMH 2WFWA 1NTGA 2VQFQ 1VQGA 1VS0A 2Y0SE 2A19A 2GVAA 2I5HA 4YWMA 2ZM6L 4JBJA 4LFBQ 3I7FA 4HJ8A 2UXBL 2VNUD 3KOJA 2IHEA 4MZ9A 1KIXA 3AQQA 1Q82C 3CCRA 1XJVA 3ER0A 2NVYH 1EIFA 3AFQA 2XGTA 2UU9Q 1Q7YC 3NBHB 4P71A 4X65L 4IFDJ 1MJCA 3F2DA 4ME3A 3TQYA 4HJAA 1CSQA 4A76A 1L2FA 4DV6L 1N8RC 3UDXA 3A0JA 1IXRA 5LMNW 2NN6I 3M4PA 3H3VI 3HOZG 3ICEA 2UUBL 2JQOA 2N49A 1VQKA 1AH9A 4P74A 4BY7G 4GNXA 2D0OA 4A93G 1BBWA 4PZ7A 1B70B 1BVSA 2KENA 2QA4A 4HIDA 1NY4A 1YITA 3PF5A 3I4MG 4P73A 4DV3Q 1XNRQ 1UE7A 5IY0A 5C4JH 2FXQA 4YHHQ 3CCEA 1ASYA 3RZOH 2NZOA 1IYJB 1YVCA 1K0RA 4DUZL 5H1SE 1I6HH 3E9HA 3ERSX 3L0OA 3NELA 4JI1Q 1HR0W 4JI2L 2PQAA 2PQAB 1IL2A 3HOXH 2YV5A 2JA6G 1Q46A 2L15A 3H3VH 1JT8A 1HH2P 1KD1C 4QQBX 4FDBA 1TWCH 4YCUA 4X66L 2R92H 4DR7Q 4B3RL 4LF9L 2JA8G 1SFOH 3WWVA 1AE3A 4DR6Q 4DR1L 2PNHA 4GN5A 4YWKA 3UDGA 1PA6A 4IPGA 1Q86C 4L5TA 1VQBA 2AHOB 3ULJA 4X64L 4DV2L 3LGJA 2PMZE 4R4TA 1XMQQ 5GROA 4HJ9A 1EQQA 3HOXG 1GO3E 2E5LQ 4BY1G 1XMOL 1UE5A 5HY6A 5IYBH 3KYHC 1I5FA 4YCVA 3DM3A 3HOYG 2Y0SG 2VUMG 1FJGQ 3ZJYC 2K52A 1N32L 2HHHL 4BXXG 3NENA 2MFIA 2MNAA 2JEAI 5HGQA 4EQ5A 1C0AA 1CKOA 2R7ZH 1TWHH 1HNZL 1A62A 2OTJA 1NE3A 2DGYA 1QVCA 3KDFA 1T9HA 2E2HH 3FHWA 2C35B 2YTYA 4JBMA 3J7A5 1PH9A 4LFAL 5IYDH 3MEFA 5FJ8G 4GKKL 4A4IA 4LF7Q 3G48A 1E7ZA 2ZJRA 1E1TA 3MXNB 4QL5A 4DV4L 4LF5L 2HIXA 3TEHB 1SR3A 4C2MH 1KAWA 2YU9H 1S40A 1Q8KA 3K8AA 2R93G 1HNXL 3FKIH 4HIKA 3T1YQ 1LTLA 1IBKQ 4POFA 4A3FG 3BZKA 2N3SA 3OYYA 3CPWA 3PUXA 5LMNL 1QVGA 2F52A 1D7QA 1L1OA 1L1OB 1X3EA 4NPSA 4A3LG 4GS3A 4GN4B 2WAQE 4R4QA 4GN3B 3KFUA 3OW2A 1NMFA 3M4QA 3HFZB 1VQNA 1VQ7A 2DUDA 1ASZA 3H0GH 4UY8C 1HR0L 4BA1I 1BBUA 4DUYQ 1VQEA 2EXDA 1JMCA 4X62L 4JV5Q 3RLNA 4Y52H 1YEZA 4DAMA 4OWWB 2UXDL 4J15A 4A3IH 1IBMQ 4O0AA 3GTGH 3CC7A 4C3IH 3I4NG 3PO2H 3B6YA 1V43A 2XTIA 2Q2IA 4JI6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HT1 A;  1CSP A;  1QZH A;  4BBS H;  1Y14 B;  2BA1 A;  4DR2 L;  4OO1 G;  1EIY B;  5IYC G;  4DV1 Q;  1N33 Q;  1VQJ A;  3OTO L;  3KJO A;  1KQS A;  3PUV A;  3UE1 A;  4A3J G;  4DR4 L;  4JYA L;  1X3F A;  1V1Q A;  3K81 C;  1EQR A;  5JEA G;  2F4V L;  1UE6 A;  4GLV B;  4DR3 L;  3J81 c;  4X65 Q;  3RR5 A;  5C4X G;  2VW9 A;  1XNQ L;  4KHP L;  2MO0 A;  2IX0 A;  3UE0 A;  4DV6 Q;  4A3C G;  3I55 A;  3HOW G;  4DV7 L;  1NJI C;  3PO3 H;  5C3E G;  4HJ7 A;  4JOI C;  2B63 G;  4JC0 A;  2UUB Q;  2D0P A;  5BR8 Q;  1X65 A;  3A5Z B;  1L0W A;  2NVQ H;  1J5E L;  1WCM G;  1UE1 A;  5IP7 G;  3J80 c;  1EUJ A;  1MIU A;  3S1Q H;  1E22 A;  3J81 j;  4LF4 L;  4IPD A;  4DR5 L;  3L2P A;  2A1A A;  5IWA L;  1PH4 A;  1G6P A;  2GVB A;  1Y1V H;  3CCU A;  4DUZ Q;  3NEM A;  2WAQ G;  3L7Z C;  4JI2 Q;  4UP9 A;  4DPG A;  1GKH A;  3RLF A;  4B3S L;  4GNX B;  2UUC L;  5IT9 c;  3PV0 A;  1HZC A;  1KHI A;  1NMG A;  1SMX A;  2QGQ A;  3K80 C;  3T1H L;  3CCJ A;  1Y1W H;  1YHQ A;  1PH5 A;  2RHS B;  5LMU L;  4X66 Q;  2ASB A;  4B3R Q;  1VCI A;  1Z9F A;  4EX5 A;  1N36 L;  4LF8 L;  4L5S A;  4LF9 Q;  1R9T H;  1L1O C;  1VQ8 A;  2ZJQ A;  3JAM c;  3HKZ E;  1YJ9 A;  1JE5 A;  1WOC A;  3BU2 A;  4KHZ A;  4YWL A;  1EFW A;  3GTQ H;  1YBY A;  2VQF L;  1Z47 A;  2LSS A;  2KCT A;  4R1J A;  5C0X G;  4IFD I;  5E7N A;  1XMO Q;  4OON A;  1M90 C;  4C3H H;  5FLM H;  2CCZ A;  4L5Q A;  4P75 A;  1PYB A;  2OTL A;  2CKZ B;  2RCN A;  1UEB A;  5M5Y H;  1GM5 A;  3AEV A;  5DLQ E;  1RIP A;  1A8V A;  1VQ4 A;  1N32 Q;  3PF4 A;  2ZTE A;  2Q2U A;  4JI3 Q;  1XPR A;  1W3S A;  3PSI A;  4JI7 L;  2NN6 G;  3CCV A;  1HNZ Q;  4H02 A;  1A0I A;  1FVI A;  3BJU A;  3J80 i;  1Q81 C;  4POG A;  4AQY L;  4GLX A;  2R92 G;  3RNU A;  3G6E A;  5GAH C;  2UUA L;  1VQF A;  3F1Z A;  4GKK Q;  1XNR L;  1CUK A;  4GLA C;  2VL6 A;  1SE8 A;  1VQ6 A;  4A3K H;  1A63 A;  3M7N A;  3CD6 A;  4JCV E;  5J3B A;  1RL2 A;  3CME A;  1PYS B;  3HOV H;  5M5W H;  3RN2 A;  1E3P A;  4RG1 A;  1YJN A;  4GKJ L;  4DV4 Q;  4WJ3 M;  3KDF B;  4LF5 Q;  4RMF A;  5IYB G;  2PI2 A;  4A3D H;  2NVT H;  4K0K L;  1GD7 A;  1I50 H;  1XTD A;  2F3I A;  3CQZ H;  4IPC A;  5GAD C;  1HNX Q;  3CC2 A;  3CAM A;  3I56 A;  3GTK H;  4JI0 L;  3JAM i;  1OTC A;  1XPU A;  1B7Y B;  4R4I A;  1VQ5 A;  1UWV A;  5JJL A;  1PH7 A;  2R7Z G;  1SLJ A;  4IJL A;  5LMN Q;  2I0Q A;  3S1N H;  2JA7 H;  1FL0 A;  5JJI A;  1KL9 A;  1HJP A;  1B8A A;  1N34 L;  5IYD G;  3AFP A;  3HKZ G;  4MNO A;  3PUY A;  4PZ8 A;  3UDF A;  4OXP A;  3U4Z A;  3S17 H;  1I94 L;  4GOP A;  1VQP A;  4GOP B;  5JEA J;  4GNX C;  3EN2 A;  3KF6 A;  3FP9 A;  3KF6 B;  1K8G A;  2BH2 A;  3HOU H;  1FJG L;  3M3Y H;  3CF5 A;  4YY3 Q;  1G29 1;  2GN5 A;  1JB7 A;  1YHA A;  2K5N A;  2KCM A;  5IE8 A;  1OXU A;  3PUW A;  1HR0 Q;  4MTN A;  4IOC A;  3CP0 A;  4XTC S;  3S24 A;  3M85 A;  2K5V A;  2N78 A;  3ULP A;  2UXD Q;  3FKI G;  1IBL L;  1TWF H;  2YYZ A;  1VQ9 A;  3S1R H;  1VQO A;  4KLK A;  1C9O A;  5M3F H;  3ULL A;  4C3J H;  4A3E H;  1QVF A;  2CWP A;  2CWA A;  4JI6 Q;  4B3M L;  3GTL H;  1WI5 A;  1HZB A;  3H15 A;  1EWI A;  1U5K A;  4JI4 Q;  4LF6 L;  3PGZ A;  4NB3 A;  4DR2 Q;  2ID0 A;  2NZH A;  2WB1 E;  4NXM L;  2UXC L;  4IPH A;  2IT1 A;  1K83 H;  4B3T L;  5AJ3 L;  3E0E A;  3OTO Q;  1H95 A;  1SRO A;  2R7F A;  1Q1E A;  4LNQ A;  4JYA Q;  1C7Y A;  2F4V Q;  3U50 C;  3GD7 A;  1JJ2 A;  4DV0 L;  2YTX A;  2I5L X;  4A3B H;  3T1Y L;  4KHP Q;  3H0G G;  1XNQ Q;  2D62 A;  3A5U A;  1IBK L;  4NXN L;  3W5O A;  1X3G A;  2ZM6 Q;  3DLL A;  2ES2 A;  4DV7 Q;  3GTP H;  4HJ5 A;  4QY7 A;  4Y7N H;  2RHQ B;  4BBR H;  2UXB Q;  4OX9 L;  4A3G H;  2K4K A;  4L5R C;  2EIF A;  1JJG A;  4A3I G;  1J5E Q;  2E8G A;  2K50 A;  5M3M H;  3RZD H;  1G51 A;  2PI2 E;  3K7U C;  4DK3 C;  5IP9 H;  5C0X J;  2N8N A;  3PO2 G;  4JI5 L;  1E1O A;  4P72 A;  4LF4 Q;  1QUQ A;  2BH8 A;  1QUQ B;  4DR5 Q;  3BZC A;  3W1G A;  5IWA Q;  2ZJP A;  4BBS G;  1U0L A;  2OCE A;  3KLW A;  1PHJ A;  3GTO H;  4LUZ A;  4BBR G;  4R4O A;  4A3G G;  4B3S Q;  4BA2 I;  2UUC Q;  3CCL A;  3STB D;  1CKN A;  3G4S A;  4LFC L;  1K3R A;  1HZ9 A;  1LM0 A;  3GO5 A;  3Q8D A;  3CCQ A;  3T1H Q;  5LMU Q;  4IOA A;  2JJQ A;  4LUO A;  1N36 Q;  4LF8 Q;  3M9B A;  1W2B A;  4AH6 A;  3J7Z C;  2Q2H A;  3W1B A;  2BA0 A;  1HNW L;  1V9P A;  2AWO A;  3AYH B;  3PO3 G;  1E24 A;  2JK8 A;  3HOZ H;  2QEX A;  1SRU A;  2KBN A;  4JBW A;  2VS1 A;  1EYG A;  5C0X I;  5M5X H;  4GOP C;  1WYD A;  3KF8 B;  2VQE L;  2B29 A;  4DV1 L;  3CC4 A;  4TQU S;  1N33 L;  4BY7 H;  3U58 A;  2AWN A;  4A93 H;  3GTJ H;  2JA5 H;  1OXV A;  4DV5 L;  4JI8 L;  2RF4 A;  4DR1 Q;  3I4M H;  1Q12 A;  1IZ6 A;  1X55 A;  1Y1V G;  2WB1 G;  2H5X A;  4X64 Q;  2LXJ A;  4QIW E;  3PIP A;  4UP8 A;  4LFB L;  1S3O A;  4JI7 Q;  4OWX B;  2KHI A;  5GAE C;  1Y1W G;  1PH2 A;  4A3M H;  2IHF A;  3RLO A;  5BR8 L;  3D0F A;  4AQY Q;  3K0X A;  2JA6 H;  3J81 i;  1FGU A;  1KRS A;  1VQL A;  4AYB E;  2JA5 G;  2V1C C;  3F8T A;  5K36 G;  3M4O H;  2UU9 L;  4IO9 A;  2UUA Q;  3PCO B;  2MQH A;  2HHH Q;  1OXS C;  2JA8 H;  3CCM A;  2AKW B;  3S1M H;  4UP7 A;  1PH6 A;  1M1K C;  1VQA A;  5FLX c;  1HZA A;  5GAG C;  2EQS A;  1D8L A;  1PV4 A;  3IRB A;  4GKJ Q;  5ELO A;  4A75 A;  1K73 C;  1EOV A;  3S2H H;  5FLM G;  4A3M G;  4TVA B;  2Q2T A;  4BY1 H;  4LFA Q;  2IX1 A;  4K0K Q;  4DV3 L;  1YNX A;  3VDY A;  1WFQ A;  2MO1 A;  2Z6K A;  4JI0 Q;  2VUM H;  3HOY H;  4YHH L;  3CCS A;  1OXX K;  1LYL A;  1P8L A;  4JI1 L;  2HIV A;  1S72 A;  4BXX H;  5C44 H;  3I4O A;  4APV A;  3I2Z A;  4LW1 A;  4OWT B;  3SGI A;  1VQH A;  3STB C;  3K7A H;  1N34 Q;  1AE2 A;  4DR7 L;  3JC6 6;  4IFD G;  3S16 H;  3TRE A;  2VY3 A;  4HIM A;  1PFS A;  2NVX H;  1YZ6 A;  2Z0S A;  4KI0 A;  1I94 Q;  3TRZ A;  4DR6 L;  5EAY A;  3CXC A;  5FJ8 H;  1QZG A;  4A3K G;  4QGU A;  4PG3 A;  4JG2 A;  1VQC A;  3HOV G;  1MJE A;  1YIJ A;  2ATW A;  3CMA A;  3U4V A;  2A8V A;  1TXY A;  2R7D A;  1VQM A;  3EBE A;  1XMQ L;  5C44 G;  4JI3 L;  1YJW A;  4A3D G;  1KXL A;  2E5L L;  4LUV A;  2K14 A;  3A74 A;  4LWC A;  5JJK A;  1IBL Q;  1JJC B;  4PZ6 A;  2ALY B;  2R93 H;  4JOI A;  3HKS A;  1YHB A;  4AIM A;  4B3M Q;  4IJH A;  2K5H A;  4A3F H;  1VQD A;  4LF6 Q;  1X9N A;  4X62 Q;  2JA7 G;  2UXC Q;  4DKA C;  4NXM Q;  2CFM A;  4AYB G;  4B3T Q;  1X56 A;  5AJ3 Q;  2JA9 A;  4HIO A;  4A3L H;  2KHJ A;  3F2C A;  2YTV A;  4DV2 Q;  1VQI A;  2ZTC A;  3HOU G;  2ZTD A;  4DV0 Q;  4LF7 L;  2AMC B;  2E2I H;  1YI2 A;  4OO1 I;  4NXN Q;  1PH1 A;  1K8A C;  3CPF A;  1GVP A;  4YCW A;  3KJP A;  2IY5 B;  2VZA A;  4OX9 Q;  1TWG H;  1PH3 A;  1TWA H;  1K9M C;  1KC8 C;  4DR4 Q;  2E2J H;  4ALP A;  4DK6 C;  2JEB I;  4DR3 Q;  4UPA A;  5ELN A;  5M3F G;  4JI5 Q;  3PIO A;  4A3E G;  1Q1B A;  1P16 A;  3I4N H;  3GDE A;  4R4C A;  1O7I A;  4PMW A;  3E9I A;  4QJF A;  1KRT A;  3UDI A;  3S2D H;  4JBK A;  4O2D A;  4YY3 L;  3S15 H;  2CQO A;  2OQK A;  2Z6K C;  5IYC H;  1BKB A;  1X54 A;  1N9W A;  1MKH A;  1SN8 A;  2LXK A;  4LFC Q;  2I5M X;  3D31 A;  2R6G A;  1CKM A;  3S14 H;  4A3J H;  1X6O A;  4DNI A;  1DGS A;  1XPO A;  4A3B G;  3TS2 A;  3F2B A;  1OXT A;  2B3G A;  4WJ4 A;  2WP8 J;  4XIG S;  3PUZ A;  4DAY B;  1HNW Q;  5C4X H;  3RN5 A;  2K75 A;  4X6A H;  4A3C H;  2HQL A;  3HOW H;  4JI4 L;  5C3E H;  4JV5 L;  4DUY L;  2B63 H;  1PVO A;  1CKN B;  1NBW A;  5M3M G;  1PH8 A;  2VQE Q;  5IP9 G;  2JE6 I;  1J6Q A;  1IBM L;  3G71 A;  1WCM H;  5GQO A;  3TS0 A;  3EIV A;  5IP7 H;  2OWO A;  1WJJ A;  4DV5 Q;  4JI8 Q;  3CW2 C;  1I3Q H;  1LUZ A;  2OQ0 A;  3GTM H;  2WFW A;  1NTG A;  2VQF Q;  1VQG A;  1VS0 A;  2Y0S E;  2A19 A;  2GVA A;  2I5H A;  4YWM A;  2ZM6 L;  4JBJ A;  4LFB Q;  3I7F A;  4HJ8 A;  2UXB L;  2VNU D;  3KOJ A;  2IHE A;  4MZ9 A;  1KIX A;  3AQQ A;  1Q82 C;  3CCR A;  1XJV A;  3ER0 A;  2NVY H;  1EIF A;  3AFQ A;  2XGT A;  2UU9 Q;  1Q7Y C;  3NBH B;  4P71 A;  4X65 L;  4IFD J;  1MJC A;  3F2D A;  4ME3 A;  3TQY A;  4HJA A;  1CSQ A;  4A76 A;  1L2F A;  4DV6 L;  1N8R C;  3UDX A;  3A0J A;  1IXR A;  5LMN W;  2NN6 I;  3M4P A;  3H3V I;  3HOZ G;  3ICE A;  2UUB L;  2JQO A;  2N49 A;  1VQK A;  1AH9 A;  4P74 A;  4BY7 G;  4GNX A;  2D0O A;  4A93 G;  1BBW A;  4PZ7 A;  1B70 B;  1BVS A;  2KEN A;  2QA4 A;  4HID A;  1NY4 A;  1YIT A;  3PF5 A;  3I4M G;  4P73 A;  4DV3 Q;  1XNR Q;  1UE7 A;  5IY0 A;  5C4J H;  2FXQ A;  4YHH Q;  3CCE A;  1ASY A;  3RZO H;  2NZO A;  1IYJ B;  1YVC A;  1K0R A;  4DUZ L;  5H1S E;  1I6H H;  3E9H A;  3ERS X;  3L0O A;  3NEL A;  4JI1 Q;  1HR0 W;  4JI2 L;  2PQA A;  2PQA B;  1IL2 A;  3HOX H;  2YV5 A;  2JA6 G;  1Q46 A;  2L15 A;  3H3V H;  1JT8 A;  1HH2 P;  1KD1 C;  4QQB X;  4FDB A;  1TWC H;  4YCU A;  4X66 L;  2R92 H;  4DR7 Q;  4B3R L;  4LF9 L;  2JA8 G;  1SFO H;  3WWV A;  1AE3 A;  4DR6 Q;  4DR1 L;  2PNH A;  4GN5 A;  4YWK A;  3UDG A;  1PA6 A;  4IPG A;  1Q86 C;  4L5T A;  1VQB A;  2AHO B;  3ULJ A;  4X64 L;  4DV2 L;  3LGJ A;  2PMZ E;  4R4T A;  1XMQ Q;  5GRO A;  4HJ9 A;  1EQQ A;  3HOX G;  1GO3 E;  2E5L Q;  4BY1 G;  1XMO L;  1UE5 A;  5HY6 A;  5IYB H;  3KYH C;  1I5F A;  4YCV A;  3DM3 A;  3HOY G;  2Y0S G;  2VUM G;  1FJG Q;  3ZJY C;  2K52 A;  1N32 L;  2HHH L;  4BXX G;  3NEN A;  2MFI A;  2MNA A;  2JEA I;  5HGQ A;  4EQ5 A;  1C0A A;  1CKO A;  2R7Z H;  1TWH H;  1HNZ L;  1A62 A;  2OTJ A;  1NE3 A;  2DGY A;  1QVC A;  3KDF A;  1T9H A;  2E2H H;  3FHW A;  2C35 B;  2YTY A;  4JBM A;  3J7A 5;  1PH9 A;  4LFA L;  5IYD H;  3MEF A;  5FJ8 G;  4GKK L;  4A4I A;  4LF7 Q;  3G48 A;  1E7Z A;  2ZJR A;  1E1T A;  3MXN B;  4QL5 A;  4DV4 L;  4LF5 L;  2HIX A;  3TEH B;  1SR3 A;  4C2M H;  1KAW A;  2YU9 H;  1S40 A;  1Q8K A;  3K8A A;  2R93 G;  1HNX L;  3FKI H;  4HIK A;  3T1Y Q;  1LTL A;  1IBK Q;  4POF A;  4A3F G;  3BZK A;  2N3S A;  3OYY A;  3CPW A;  3PUX A;  5LMN L;  1QVG A;  2F52 A;  1D7Q A;  1L1O A;  1L1O B;  1X3E A;  4NPS A;  4A3L G;  4GS3 A;  4GN4 B;  2WAQ E;  4R4Q A;  4GN3 B;  3KFU A;  3OW2 A;  1NMF A;  3M4Q A;  3HFZ B;  1VQN A;  1VQ7 A;  2DUD A;  1ASZ A;  3H0G H;  4UY8 C;  1HR0 L;  4BA1 I;  1BBU A;  4DUY Q;  1VQE A;  2EXD A;  1JMC A;  4X62 L;  4JV5 Q;  3RLN A;  4Y52 H;  1YEZ A;  4DAM A;  4OWW B;  2UXD L;  4J15 A;  4A3I H;  1IBM Q;  4O0A A;  3GTG H;  3CC7 A;  4C3I H;  3I4N G;  3PO2 H;  3B6Y A;  1V43 A;  2XTI A;  2Q2I A;  4JI6 L; 
#chains in the Genus database with same CATH topology
 2HT1 A;  3PIO 3;  4BBS H;  2CH4 A;  3HOU B;  1D1I A;  1N33 Q;  1VQJ A;  5K5P A;  3OTO L;  1KQS A;  1EYA A;  4DR4 L;  3C1E A;  2A6H D;  2B2T A;  5JEA G;  1B53 A;  5C4X G;  2A5H A;  2VW9 A;  3V96 A;  3VR2 A;  2CH4 W;  4QUC A;  1NJI C;  3KBG A;  2A6E D;  1BCP C;  4XQN A;  4C3J B;  5BR8 Q;  1X65 A;  2O5I C;  1L0W A;  3J80 c;  3AB9 A;  2H4O A;  1D6E C;  1SE4 A;  3J81 j;  5BN5 A;  4IPD A;  2E76 C;  4DR5 L;  2RSO A;  1HUN A;  1PH4 A;  2PO4 A;  4C3I B;  1Y1V H;  1G6P A;  5FO7 B;  3RMH A;  1BQQ T;  1HZC A;  2QGQ A;  1R4Q B;  2RHS B;  1SJH D;  2EJM A;  4X66 Q;  4B3R Q;  3MTS A;  1Z9F A;  4LF8 L;  1LAB A;  2ZJQ A;  1YJ9 A;  1JWU D;  3BU2 A;  4YWL A;  1EFW A;  3GTQ H;  3NP8 A;  2B2W A;  3FPP A;  1WTV A;  2IX3 A;  2KCT A;  2PZU A;  4IFD I;  5EBC A;  5E7N A;  1WD0 A;  1M90 C;  2KOL A;  3MXU A;  5F2D A;  2NVQ B;  1DZ1 A;  3MVV A;  1EU3 A;  2F0U A;  4CDD C;  4M1U B;  1YNN D;  5DLQ E;  1A8V A;  3PF4 A;  2EY6 A;  1W3S A;  3FRP B;  1Q81 C;  1CHQ D;  4AQY L;  2MP1 A;  1STN A;  3RNU A;  1QB5 D;  2J0T D;  1Y1W B;  4KV6 A;  3OWF A;  3F1Z A;  4ID6 A;  4GLA C;  4A93 B;  5IT9 E;  3S9W A;  2JA5 B;  1VQ6 A;  1TT2 A;  2O4X A;  1QNU A;  4F87 A;  5J3B A;  1PYS B;  5M5W H;  3RN2 A;  1E3P A;  4RG1 A;  4R8I A;  4DXG A;  1JQY D;  1LLR D;  1I50 H;  1XTD A;  1LTG D;  2WKC A;  4A3M B;  3I56 A;  1LT5 D;  1LT6 D;  1SNM A;  1OTC A;  4PV1 C;  1B7Y B;  1BCP D;  1UWV A;  2ZXR A;  3BZD B;  1SLJ A;  1ENC A;  3S1N H;  4I7A A;  5KEE A;  4EQP A;  5JJI A;  1KL9 A;  1N34 L;  2MPM A;  3PUY A;  3I3C A;  3U4Z A;  2EDG A;  1I94 L;  5E1F A;  3VYR A;  4G4K A;  5I9O A;  3HOU H;  1ZKO A;  3ND8 A;  1FJG L;  3CF5 A;  1O7Y A;  2IL8 A;  5IGB A;  4HAE A;  1OXU A;  1HR0 Q;  1TKW B;  2N78 A;  2UXD Q;  4I65 A;  3H6M A;  1QG7 A;  2NVT B;  2NWG A;  3EQL C;  1VQO A;  4EGV A;  1JCK B;  3X3M A;  4C3J H;  4JI6 Q;  2HDL A;  2D2C C;  4QIW B;  1EY8 A;  2RCF A;  4NB3 A;  1SAP A;  2ID0 A;  2NZH A;  2IT1 A;  1NR4 A;  1H95 A;  4WOR A;  1Q1E A;  5CR3 A;  3GD7 A;  1EEF D;  4ZUI A;  3MFY A;  5EKI A;  3A5U A;  2ZM6 Q;  4QY7 A;  3M3Y B;  2UXB Q;  5IGE A;  1RTN A;  1EL0 A;  4FXG C;  5M3M H;  3MA2 B;  3PO2 G;  1CQV A;  1TWF B;  4LF4 Q;  3TBI B;  3BZC A;  4K6D A;  2ZJP A;  5M3F B;  4K14 A;  3HG9 A;  1PTO H;  4LUZ A;  4DFA A;  5IGC A;  4HCS A;  4BA2 I;  1ET6 A;  3RD4 A;  5JVH 3;  3PQI A;  3KK7 A;  1U4P A;  1TWG B;  2JJQ A;  4AH6 A;  3W1B A;  1HNW L;  1V9P A;  2AWO A;  3DEP A;  1EYG A;  4B08 A;  3GTP B;  4GOP C;  1WYD A;  2AUJ D;  1N33 L;  3U58 A;  2AWN A;  4A93 H;  2JA5 H;  2RF4 A;  2M9V A;  4J8Q A;  1X55 A;  3QO2 A;  1QJO A;  4JI7 Q;  3QOL A;  4A3M H;  5BR8 L;  1GUS A;  1DOL A;  1FGU A;  1LO5 D;  2V1C C;  3F8T A;  1WCM B;  2BE5 C;  1RCV D;  5GAG C;  2FMC A;  3Q0A A;  3A56 A;  3HOZ B;  5ELO A;  4C3H G;  1FNW A;  2FHT A;  4LFA Q;  2G9H D;  1HQM C;  4DV3 L;  1YNX A;  3VDY A;  5I2Y A;  2Z6K A;  2MO1 A;  3NPP A;  3HOY H;  3CCS A;  2B2V C;  4H7B A;  2NVY B;  1OXX K;  1S72 A;  3WOE A;  1PFN A;  2P5Z X;  3I2Z A;  2OXP A;  4OWT B;  3SGI A;  4FF3 A;  1AEX A;  5EPL A;  2VY3 A;  4HIM A;  2JA6 B;  2XVS A;  4L63 B;  3DMU A;  4A3K G;  1VQC A;  3OW7 A;  3HOV G;  5A35 A;  1YIJ A;  3OWE B;  3CMA A;  3ITP A;  1TXY A;  4OEL B;  3EBE A;  2XNA C;  4LUV A;  5J22 A;  3ERQ A;  2H1E A;  4LWC A;  3S2H B;  4BY1 B;  1AN8 A;  3SDZ A;  2F0W A;  2CVR A;  4B3M Q;  2Y0S B;  2K5H A;  3T51 B;  1VQD A;  2JA7 G;  2UXC Q;  4B3T Q;  4KN7 C;  3F2C A;  2F0V A;  2ZTC A;  2IWH A;  3KLS X;  2AMC B;  2NVX B;  1C48 A;  1PH1 A;  1K8A C;  1U4R A;  3KJP A;  5D65 A;  4OX9 Q;  1TWG H;  1PH3 A;  1K9M C;  2E2J H;  1TVX A;  3FPU B;  1L0Y B;  4RGT A;  4H44 C;  5ELN A;  3PIO A;  4A3E G;  2BE5 D;  1Q1B A;  1P16 A;  2LFN A;  4QJF A;  3UDI A;  1Y8O B;  1L0X B;  4CDF C;  4O2D A;  3K57 A;  4OO1 H;  5FO8 B;  2DJF C;  1X54 A;  1N9W A;  2F0T A;  1SN8 A;  2I5M X;  2R6G A;  3EA6 A;  4K6L A;  1DD2 A;  4A3B G;  4LMQ D;  3RUZ A;  4DAY A;  2WP8 J;  4DAY B;  3BVG A;  4DNR B;  2K75 A;  3RN5 A;  2FJ2 A;  1JR0 D;  1KLU D;  5C3E H;  4JV5 L;  4DUY L;  1CKN B;  1PH8 A;  3NQI A;  5IP9 G;  3TME A;  2EJF C;  1J6Q A;  2JE6 I;  1WCM H;  5IP7 H;  3D6W A;  4DV5 Q;  2DY8 A;  1I3Q H;  1LUZ A;  3GTM H;  1O7L A;  3URY A;  5E3F A;  2M2L A;  2VQF Q;  1VQG A;  1HUM A;  2I5H A;  2ZM6 L;  2UXB L;  1EYC A;  1JIC A;  3NWT A;  2XRQ D;  1JWS D;  1KIX A;  1ET9 A;  1T5X D;  3TZD A;  1Q82 C;  2K6A A;  4P2C B;  2NVY H;  1EIF A;  2UU9 Q;  4P71 A;  4HED A;  1MJC A;  4ME3 A;  4PMC A;  1EZ6 A;  3A54 A;  1L2F A;  4CDC C;  2NN6 I;  3ICE A;  3D6C A;  1SJE D;  1E2Z A;  5T1I A;  2JQO A;  1AH9 A;  1VQK A;  4P74 A;  3HOW B;  1CQF A;  1GHJ A;  4KTA A;  5LHY 1;  1BBW A;  4PZ7 A;  2B63 B;  2KEN A;  3I4M G;  3VA7 A;  4RH6 A;  1PRT C;  1XNR Q;  1DXM A;  2FXQ A;  4H0L C;  1YVC A;  1K0R A;  3AU7 A;  1I6H H;  1LTT D;  4JI1 Q;  4JI2 L;  1LTB D;  5HGT A;  2WAQ B;  1Q46 A;  1STA A;  1Q90 A;  1HH2 P;  4QF4 A;  4FDB A;  3TP6 A;  2R92 H;  4DR7 Q;  3P1H A;  2JSO A;  4CJ2 C;  4QQB X;  1FGB D;  4LF9 L;  5D3D A;  2JA8 G;  1O7Z A;  1AE3 A;  4DR6 Q;  4YWK A;  5ELC A;  1Q86 C;  2AHO B;  1XMQ Q;  4ODG A;  2E5L Q;  4ILW A;  1UE5 A;  3NSW A;  1I5F A;  3OIP A;  3R3O A;  3A8K E;  3MFG A;  1K0S A;  2K52 A;  4J1M A;  3NEN A;  2MFI A;  2MNA A;  3RZO B;  5HGQ A;  3QG1 A;  1U9R A;  1KDB A;  5E4W C;  5A2Q E;  1NE3 A;  5CV4 A;  1IKM A;  2JXM B;  4NMZ A;  3KLS A;  5J39 A;  4K5V A;  1GOZ A;  1PH9 A;  1U4L A;  4LFA L;  2X69 A;  1LTA D;  3K0Y A;  1LAC A;  1MSG A;  2ZJR A;  5IIF A;  3N6R A;  1ICW A;  3QOJ A;  4DV4 L;  4LF5 L;  1SR3 A;  1A6X A;  4RWS C;  1Q8K A;  1F2Y A;  4HIK A;  1LTS D;  4CJ1 B;  1X32 A;  4A3F G;  5IT9 L;  3BZK A;  3OYY A;  5E4X A;  5LMN L;  1QVG A;  1D7Q A;  2GA4 B;  1X3E A;  5CMD A;  3Q22 A;  4NPS A;  2R7Z B;  1PRT D;  3TSS A;  4MTK A;  4PQX A;  2KVM A;  3HFZ B;  2F0L A;  2NBF A;  2DUD A;  3HKZ B;  5AFW A;  1HFN A;  2V4D A;  4UY8 C;  4BA1 I;  1BBU A;  1VQE A;  1ROD A;  3RLN A;  1ENF A;  4A3I H;  1BF4 A;  4C2M B;  3I4N G;  2Q2I A;  1QZH A;  2L4N A;  4F7X A;  4DR2 L;  1ZYR C;  4NDX A;  1CM9 A;  3KJO A;  4A3J G;  4GZY C;  3KUP A;  3K81 C;  2Z4I A;  5BN3 A;  1G2S A;  4KY7 A;  4X65 Q;  4KHP L;  1XNQ L;  3QJY A;  1KNA A;  3EFX D;  4A3C G;  4DV6 Q;  4X3U A;  3I55 A;  3PO3 H;  1HXY D;  3H3V C;  3H0G B;  4JC0 A;  2UUB Q;  3E3X A;  1J5E L;  2XRS D;  2F0I A;  2MHV A;  1MIU A;  1Q8I A;  3L2P A;  5KGU A;  5IWA L;  2G9D A;  4BBS B;  4GNX B;  5CV5 A;  2UUC L;  2PZW A;  4BBR B;  4A3G B;  5LMU L;  2ASB A;  5EPJ A;  4EX5 A;  1N36 L;  5K36 H;  2F03 A;  2J4X A;  2PZT A;  3JAM c;  4DU9 A;  1WOC A;  2KCN A;  1YBY A;  1H9J A;  2VQF L;  2NUC A;  1Z47 A;  5FOB B;  2MJ8 A;  3J81 E;  1XMO Q;  4OON A;  2CCZ A;  5FLM H;  3GTO B;  5KNB A;  3MZ5 A;  1STH A;  2VXW A;  1PYB A;  3NUC A;  4L5Q A;  4P75 A;  2CKZ B;  2RCN A;  1B1Z A;  1VQ4 A;  1N32 Q;  3T56 B;  2ZTE A;  1XPR A;  1Y1V B;  2WB1 B;  1EFI D;  3K5N A;  1HNZ Q;  3J80 i;  1A0I A;  1LT3 D;  2A6H C;  4Z9C B;  4XQJ A;  5C4H A;  1XNR L;  2VL6 A;  2K7V A;  3CD6 A;  3D8G A;  1EQV A;  2A6E C;  3OHX C;  3GTQ B;  3KDF B;  2QKI C;  3NQT A;  1D1K A;  2PI2 A;  4A3D H;  4K0K L;  5T1G A;  2F3I A;  3CQZ H;  4IPC A;  5GAD C;  3CAM A;  4JI0 L;  1ZXT A;  4XT3 B;  5D14 A;  2R3Z A;  5JJL A;  1PH7 A;  1PTO F;  3S1M B;  1DOM A;  4IUV A;  1HJP A;  1B8A A;  4MNO A;  4DA2 A;  2XSC A;  5JEA J;  3LWU A;  3KF6 A;  3KF6 B;  2X6L A;  1K3B C;  4ZYS A;  4F88 A;  2CHB D;  2GN5 A;  1YHA A;  2K5N A;  5IE8 A;  1E2V A;  2QF7 A;  2K5V A;  5M5W B;  5G3L F;  3FKI G;  5C44 B;  3WDN A;  2L12 A;  2YYZ A;  1I50 B;  3S1R H;  4WJ3 M;  1G2T A;  3ULL A;  2CWA A;  2NTT A;  4JPB W;  1HZB A;  2SOB A;  1EWI A;  3I73 A;  5DM7 3;  4S3S A;  3C46 A;  4TRD A;  2O5J C;  5CV6 A;  2K5W A;  4NXM L;  3NXW A;  1TII D;  1UAP A;  3E0E A;  3S1N B;  2K32 A;  4JYA Q;  2F4V Q;  4AYB B;  1EYD A;  1STB A;  4DV0 L;  3VR6 A;  1A2T A;  2D62 A;  4NXN L;  1X3G A;  3T13 A;  2R93 B;  4DV7 Q;  4RGN A;  2RHQ B;  4BBR H;  2B2U C;  1EEI D;  2K4K A;  3BS1 A;  4A3G H;  2EVB A;  1NUC A;  4FVM A;  1JJG A;  1PFB A;  1LTI D;  3RZD H;  1G51 A;  4DK3 C;  2FIN B;  5I6W A;  1EU4 A;  2N8N A;  4C3I G;  4JI5 L;  3AMU A;  1E1O A;  3D4R A;  4G7H C;  2JYO A;  2OCE A;  1PHJ A;  4UAI A;  3GTO H;  1UNS A;  4B3S Q;  5DNF A;  2N55 A;  4LAA A;  3G4S A;  1K3R A;  3CCQ A;  5EPK A;  3T1H Q;  3OSO A;  3G6J B;  1SMY D;  2AQ1 B;  4LUO A;  1W2B A;  2Q2H A;  5EKK A;  2ZXO A;  2JK8 A;  1DOK A;  1EY9 A;  2F0Q A;  2QEX A;  3DM1 A;  1EIG A;  2EYM A;  2HD3 A;  2Q8R E;  3CC4 A;  2KJX A;  4TQU S;  2EE1 A;  4BY7 H;  3J7A V;  1LV9 A;  3GTJ H;  1DJR D;  1OO9 B;  1G91 A;  5M3M B;  4JI8 L;  2SNS A;  1IZ6 A;  2F0D A;  4DGZ A;  4G57 A;  2LXJ A;  3ZYY X;  4QIW E;  4H13 C;  4UP8 A;  4LFB L;  1Y1W G;  1PTO B;  3RLO A;  1X3P A;  1EY5 A;  1XWE A;  5HUR A;  3J81 i;  3CHB D;  2JA5 G;  2NYZ D;  3HEJ A;  4IO9 A;  2UUA Q;  2MQH A;  2HHH Q;  3S1M H;  3M7G A;  4UP7 A;  3A8I E;  3BDO A;  1M1K C;  3J7A F;  1VQA A;  4HR7 B;  5C4Z A;  1PV4 A;  4GKJ Q;  1K73 C;  2E74 C;  2F4I A;  4A3M G;  4K5X A;  4IUQ A;  4F8M A;  1WFQ A;  2D5D A;  4CGY B;  2VUM H;  1II3 A;  2L0C A;  4BXX H;  5I6Y A;  2EYL A;  5C44 H;  3DWQ A;  2KCC A;  5LL6 X;  3D4W A;  4KD4 A;  3MEH A;  1A3V A;  3K7A H;  1AE2 A;  4IFD G;  3JC6 6;  3TRE A;  1PFS A;  2NB0 A;  2Z0S A;  4KI0 A;  4KN4 C;  3TRZ A;  5FJ8 H;  1CZG A;  4QGU A;  4JG2 A;  4K5W A;  2ATW A;  3U4V A;  2A8V A;  5ELE A;  2K14 A;  1SSO A;  3A74 A;  3A7A B;  1IBL Q;  5FLX E;  1ML0 D;  2ALY B;  3HOX B;  2R93 H;  2G5D A;  2JP1 A;  3HKS A;  3KBX A;  1PZI D;  3HOY B;  4IJH A;  1TU2 B;  2LY7 A;  4OEM B;  3W2D A;  1V1P A;  1SFO B;  4LF6 Q;  4XDX A;  4X62 Q;  1SYF A;  4DKA C;  4FF2 A;  4UDU C;  2CFM A;  3BDC A;  4BS9 A;  5AJ3 Q;  2KHJ A;  2YTV A;  1B50 A;  1EIH A;  3H91 A;  4LF7 L;  2EYP A;  4OO1 I;  5JOB A;  2MGS A;  1B3A A;  2Q8T A;  3R8B A;  1GVP A;  4DXF A;  1HQR D;  1I4Q A;  2Z4H A;  4ZAI A;  1HCZ A;  1TWA H;  2LMC B;  4KHV A;  5A2Q L;  1F9R A;  1BDO A;  4B9X A;  4DK6 C;  4ALP A;  2JEB I;  1X3Q A;  5M3F G;  1PXU A;  1O7I A;  4PMW A;  1KRT A;  2FMM A;  3S15 H;  2KEC A;  1BKB A;  1BCP F;  4LFC Q;  3SK4 A;  5D3I B;  1DGS A;  5JEA H;  1O78 A;  3F2B A;  2B3G A;  5EBD A;  1WD1 A;  5C4X H;  5CC4 A;  1CFM A;  1NBW A;  2VQE Q;  1IBM L;  5GQO A;  3TS0 A;  3EIV A;  4DNT B;  2E2J B;  4X3T A;  1WJJ A;  3CW2 C;  1G8Z D;  4C1N K;  5IOD A;  2Y0S E;  3FMC A;  3DHQ A;  4JBJ A;  1C4Q A;  2IHE A;  3T53 B;  5JPN C;  4ZLT F;  4XT1 B;  1WTO A;  3NTH A;  3F2D A;  3HOZ G;  1N8R C;  3UDX A;  5LMN W;  1HPC A;  1TY0 A;  3L9A X;  3QB3 A;  2N49 A;  2D0O A;  5C3E B;  1B70 B;  1NY4 A;  4P73 A;  2L11 A;  5C4J H;  3CCE A;  4YHH Q;  3OMG A;  4X3S A;  3LNN A;  1IYJ B;  1I3Q B;  2ENB A;  3GTM B;  3L0O A;  3U9S A;  3TP5 A;  2PQA A;  2PQA B;  3PMF A;  3HOX H;  1E2W A;  2YV5 A;  3TP8 A;  3T4A C;  2JA6 G;  3WOF A;  2IPK D;  3H3V H;  1JT8 A;  1KD1 C;  1TWC H;  4X66 L;  3BDL A;  3ERO A;  1F77 A;  4B3R L;  3MC0 B;  1SFO H;  1STG A;  1Z7T A;  3EJI A;  4GN5 A;  3UDG A;  1S5E D;  4L5T A;  1EY6 A;  3ULJ A;  3R93 A;  3LGJ A;  2EPB A;  4R4T A;  4HCE A;  2B8F A;  5EQ0 A;  4HJ9 A;  3R2T A;  4BY1 G;  4YCV A;  3BG3 A;  3DM3 A;  2Y0S G;  3CRL C;  3E5S A;  2HHH L;  1R9T B;  1GUW A;  1CKO A;  4XXE A;  1STE A;  1I6H B;  4KMU C;  2DGY A;  1QVC A;  4PMB A;  3MXP A;  2C35 B;  3UI2 A;  4I7Z C;  1BUV T;  1BCP B;  5EJW A;  2R92 B;  1XYI A;  1KLG D;  5L37 A;  4ZK9 B;  3N52 A;  2KHS A;  4CJ0 B;  4QL5 A;  4IUR A;  1F9Q A;  4O1N A;  3TEH B;  3I4L A;  4RCN A;  3VYS A;  2AUK A;  1KAW A;  2YU9 H;  1S40 A;  3K8A A;  5KIX A;  3T1Y Q;  3K5M A;  1IBK Q;  4XYQ A;  3BVM A;  1B9M A;  1SE2 A;  3VYU A;  2KA7 A;  4A3L G;  4R4Q A;  2WAQ E;  3KFU A;  3M4Q A;  2RBM A;  1VQN A;  1FD7 D;  1VQ7 A;  2EOT A;  1HR0 L;  2EXD A;  2JN4 A;  5KND A;  4X62 L;  3D4D A;  3I8Z A;  2UXD L;  5C6A A;  3TZU A;  4DF7 A;  1NSN S;  3LWE A;  3CC7 A;  5DAU A;  3PO2 H;  1U4M A;  3B6Y A;  2EJG C;  4JI6 L;  1FNU A;  1CSP A;  2XIW A;  1Y14 B;  1EIY B;  2RVL A;  5IYC G;  5CGK A;  3BVZ A;  4CHT B;  3PUV A;  3UE1 A;  1X3F A;  1EQR A;  2WAC A;  4GLV B;  2K5Q A;  5EKL A;  3RR5 A;  1SYC A;  3IKJ A;  2MO0 A;  2IX0 A;  3UE0 A;  2C5C A;  4KY5 A;  3HOW G;  4MN3 A;  2A74 C;  4HJ7 A;  4JOI C;  2B63 G;  2PW5 A;  1UE1 A;  4Q0F A;  1IW7 C;  2F0K A;  1EQT A;  1K83 B;  4A3I B;  4LF4 L;  2A1A A;  1K28 A;  4DUZ Q;  1HFG A;  1MD2 D;  2WAQ G;  4IAL A;  4UP9 A;  4DPG A;  4A3B B;  3RLF A;  5IT9 c;  3PV0 A;  1SMX A;  1KHI A;  1NMG A;  3C1F A;  1BO0 A;  1VCI A;  2OEO A;  4K8I A;  4RKL A;  1R9T H;  1L1O C;  1VQ8 A;  4MHE A;  3HKZ E;  1SYB A;  5KYL A;  1JE5 A;  3K5L A;  2A68 C;  3PO3 B;  4BWG B;  2LSS A;  4R1J A;  3Q23 A;  5C0X G;  1KDC A;  2CW0 D;  1H9K A;  3C3L A;  4C3H H;  1QWY A;  2OTL A;  5JJZ A;  1Y8N B;  1UEB A;  3L3O C;  5M5Y H;  3AEV A;  2QDB A;  3J80 E;  4RGO S;  5FK9 C;  4JI3 Q;  2Z1C A;  4TKO B;  1KAB A;  4JI7 L;  1EY0 A;  2DNE A;  2NN6 G;  1XTC D;  1GUN A;  3BJU A;  4POG A;  5IGF A;  3G6E A;  2B2Y C;  5GAH C;  4GKK Q;  1BR9 A;  1SE8 A;  4A3K H;  2BOS A;  2WKD A;  3M7N A;  3I4M B;  1A63 A;  4JCV E;  3CME A;  3HOV H;  2B2T C;  1I4R A;  2EY1 A;  3A8J E;  1YJN A;  2J7Z A;  2F0F A;  4RMF A;  5IYB G;  1CTM A;  3QIA A;  1HNX Q;  1DM0 B;  3E0J A;  3GTK H;  3JAM i;  1XPU A;  1F2Z A;  4R4I A;  1VQ5 A;  1RJT A;  2F1M A;  2R7Z G;  4LK1 C;  3NTK A;  4FXD A;  1K8M A;  2Q8I B;  4JVZ A;  2JA7 H;  1IW7 D;  2L55 A;  1FL0 A;  1PZJ D;  5CBA E;  3AFP A;  3HKZ G;  3UDF A;  5IYD G;  3S17 H;  4OXP A;  4GOP A;  1VQP A;  1MBY A;  4GOP B;  2PQE A;  2BH2 A;  1K8G A;  4L6T B;  3NK9 A;  1HA5 A;  4YY3 Q;  1G29 1;  3MAQ A;  1JB7 A;  3PUW A;  3OMC A;  3M85 A;  3SK8 A;  1UUP A;  3SR1 A;  4A3D B;  2B2W C;  1VQ9 A;  3CQZ B;  4KLK A;  4A3E H;  3A7L A;  1S5D D;  2CWP A;  3GTL H;  4B3M L;  1WI5 A;  3H15 A;  2A68 D;  4KJN A;  4KK7 A;  2BCO A;  5KNC A;  2WB1 E;  2UXC L;  1SYD A;  4IPH A;  1K83 H;  4B3T L;  3OTO Q;  1SRO A;  4RAU C;  5FLX L;  3A55 A;  4A3B H;  3T1Y L;  3H0G G;  1B4O A;  1IBK L;  2ES2 A;  3W5O A;  4Y7N H;  4OX9 L;  2EYH A;  2HUG A;  2B2V A;  2E8G A;  2K50 A;  1B9N A;  1QOH A;  2F0S A;  2PI2 E;  5IP9 H;  1HHV A;  4K2K A;  4P72 A;  3P20 A;  4IUU A;  1QUQ A;  1QUQ B;  4DR5 Q;  3W1G A;  3IAY A;  4BBS G;  3S1R B;  3KLW A;  4IN3 A;  3DWA A;  1AFP A;  4BBR G;  4R4O A;  5C5M A;  1WTW A;  1PFM A;  4A3G G;  2ICI A;  3CCL A;  1QIL A;  3STB D;  1HZ9 A;  1A3U A;  3GO5 A;  3Q8D A;  2VB2 X;  2F3W A;  3K59 A;  4LF8 Q;  1R4P B;  3M9B A;  1ESR A;  2BA0 A;  3AYH B;  1E24 A;  1PRT F;  1IYU A;  4RHS A;  3KF8 A;  3KF8 B;  3R2I A;  3KLR A;  2B29 A;  4DV5 L;  3RZD B;  2K33 A;  4DR1 Q;  3I4M H;  1GHK A;  3IFT A;  1Q12 A;  2K5D A;  1Y1V G;  2WB1 G;  3VR4 A;  4X64 Q;  1I4H A;  4DK0 A;  4HSP A;  1S3O A;  2LKV A;  4OWX B;  1PH2 A;  2AQ3 B;  3SK5 A;  3K0X A;  4AQY Q;  1VQL A;  4QUF A;  4AYB E;  2A69 C;  3M4O H;  2UU9 L;  1XX8 A;  3PCO B;  2JA8 H;  1PTO D;  3H94 A;  1ZEQ X;  2AKW B;  1PH6 A;  4XQQ A;  1HZA A;  1W6J A;  4QCL A;  2EQS A;  1E0B A;  1D8L A;  1EZ8 A;  2DY7 A;  3IRB A;  4A75 A;  1V8Q A;  1EOV A;  4OL7 A;  2IX1 A;  4BY7 B;  3GTJ B;  1ICF B;  2QEJ C;  4K2L A;  1P8L A;  4JI1 L;  2HIV A;  5G3L D;  1TS2 A;  2SDF A;  3I4O A;  4APV A;  4LW1 A;  4CDE C;  2TMP A;  1S4Z A;  2HQE A;  1IYV A;  1VQH A;  1N34 Q;  1TR5 A;  4DR7 L;  1JWM D;  4QB4 A;  2F0H A;  3S16 H;  3K58 A;  1SMY C;  1YZ6 A;  3SEB A;  1I94 Q;  2DNC A;  4DR6 L;  5EAY A;  2AQ2 B;  1A15 A;  4OGQ C;  1MJE A;  3IL8 A;  2R7D A;  1VQM A;  5CBE E;  1XMQ L;  5C44 G;  4JI3 L;  1YJW A;  2E5L L;  5CV7 A;  2K04 A;  3SK6 A;  1JOQ A;  4PZ6 A;  1MGS A;  4JOI A;  3VA5 A;  1YHB A;  4AIM A;  4WJW A;  2VUM B;  1T5E A;  5FO9 B;  4A3F H;  4AYB G;  2R61 A;  1I4G A;  5COR A;  4UHV A;  2RKS A;  3K7A B;  4DV2 Q;  1VQI A;  3HOU G;  3DXJ C;  2ZTD A;  4RKB A;  2K03 A;  3I90 A;  2E2I H;  1YI2 A;  1SYE A;  1GUO A;  5JPM C;  2HCC A;  1PRT B;  3D3R A;  1JE4 A;  2WII B;  4HMI A;  4G7Z C;  2A69 D;  4N8X 1;  4DR3 Q;  1B2T A;  4UPA A;  3DEO A;  4C3J G;  1SNP A;  3I4N H;  4ZKC B;  3GDE A;  4R4C A;  2VB3 X;  3TDQ A;  3S2D H;  1RDP D;  4YY3 L;  3HS0 C;  2CQO A;  2OQK A;  2Z6K C;  3OIQ A;  1MKH A;  4NKL A;  3D31 A;  1QNK A;  1CKM A;  1H9R A;  3S14 H;  4A3J H;  4DNI A;  1XPO A;  3HRZ C;  3TS2 A;  1OXT A;  4XIG S;  1HNW Q;  4X6A H;  4DK1 A;  4A3C H;  1SE3 A;  4O42 A;  1JB3 A;  2PMZ B;  4HN7 A;  2B2Y A;  1XXG A;  1PVO A;  5M3M G;  3K6O A;  1TWA B;  3G71 A;  3BYT B;  4KKT A;  4CKC A;  4EQN A;  2F0E A;  3I7F A;  1SND A;  2K1B A;  3HGB A;  3S15 B;  2BDO A;  3J7Y W;  3CCR A;  1JC7 A;  3AFQ A;  3NBH A;  4L8J A;  4EQO A;  3NBH B;  4X65 L;  4IFD J;  2EZV A;  4N8F A;  4HJA A;  1CSQ A;  4DV6 L;  4IUP A;  4X3K A;  3M4P A;  3H3V I;  5C4X B;  2UUB L;  1NR2 A;  4RGM A;  2Z8L A;  4A93 G;  3I91 A;  1BVS A;  1YIT A;  3H09 A;  4DV3 Q;  1UE7 A;  1ASY A;  2NZO A;  4FF1 A;  1FYC A;  5H1S E;  2N88 A;  1HR0 W;  3NEL A;  1AP0 A;  1IL2 A;  4LJZ C;  1GUT A;  3PIP 3;  2L15 A;  4YCU A;  1JOO A;  3NBI A;  5COY A;  4V19 0;  1VMC A;  4DR1 L;  1D5X C;  1PA6 A;  4M8A A;  4IPG A;  3S1Q B;  1VQB A;  2Z6B A;  4X64 L;  2ICE C;  1EQQ A;  3HOX G;  1GO3 E;  1XMO L;  1BXT A;  1GJX A;  5HY6 A;  3KYH C;  1STY A;  2RDG A;  3HOY G;  1O80 A;  3ZJY C;  1N32 L;  4IUT A;  5C4J B;  2JEA I;  4WRD A;  4EQ5 A;  1C0A A;  1TWH H;  1HNZ L;  4CKB A;  2OTJ A;  2E2H H;  2RA4 A;  2YTY A;  4JBM A;  3J7A 5;  2RSN A;  4MIU A;  4N9T A;  3MEF A;  1TWC B;  3DWP A;  4A4I A;  4TSS A;  4JW0 A;  2E2D C;  1E7Z A;  1V1P B;  2OF1 A;  5I2X A;  3J80 L;  5CV8 A;  2CQA A;  5DEH A;  3FKI H;  4ZCK A;  2RQX A;  1SXT A;  1B3Q A;  5J1Z A;  4JK1 C;  4POF A;  2KED A;  4FF4 A;  1F9P A;  1I4P A;  5IOC A;  2LS0 1;  3CPW A;  4RCO A;  2F52 A;  1VDZ A;  1A2U A;  4GN4 B;  4GN3 B;  4KD3 A;  1NMF A;  1TQO A;  1GXD C;  1Q3L A;  5ELD A;  1ASZ A;  3G7L A;  4JV5 Q;  1H9S A;  1PDQ A;  4E6I A;  1H9S B;  4DUY Q;  4Y52 H;  1UEA B;  1YEZ A;  4DAM A;  4RA8 A;  5TSS A;  1WTX A;  4O0A A;  3X3N A;  2Z9H A;  3MXG A;  2YU9 B;  3GV6 A;  4C3I H;  1V43 A;  1DYQ A;  1LTR D;  4DV2 L;  4OIJ A;  2NZ1 D;  2BA1 A;  5C3X A;  4IUN A;  1MI2 A;  4OO1 G;  1JOR A;  2NTS A;  5ISR A;  4DV1 Q;  2DJG C;  4JYA L;  2F4V L;  1QCB D;  1H9M A;  1V1Q A;  1UE6 A;  5C5L A;  4DR3 L;  2O2L D;  3J81 c;  5DM6 3;  1FR3 A;  1D5M C;  1TS3 A;  4HSV A;  4DV7 L;  5C3E G;  2SNM A;  2D0P A;  3A5Z B;  2NVQ H;  2ZXP A;  2PCF B;  3C2P A;  1WCM G;  5IP7 G;  1JOK A;  1EUJ A;  3S1Q H;  3IFD A;  1E22 A;  2EYF A;  3FVQ A;  1RTO A;  2GVB A;  5ELB A;  3CCU A;  3PO2 B;  5CYU A;  4C56 C;  3NEM A;  3L7Z C;  4JI2 Q;  1GKH A;  4B3S L;  1Y1W H;  3K80 C;  1I4X A;  4K8J A;  3CCJ A;  3T1H L;  1YHQ A;  1PH5 A;  1M4V A;  3HP3 A;  4LF9 Q;  4L5S A;  1C8C A;  4FYD A;  2EY5 A;  4KHZ A;  4NW2 A;  4ABN A;  4C1N I;  1Z6H A;  1NCV A;  1S5B D;  1BBX C;  1GM5 A;  1RIP A;  2L1B A;  3VR5 A;  4CBV A;  2Q2U A;  3FEW X;  2XWJ B;  3PSI A;  3CCV A;  5C3W A;  4H02 A;  1FVI A;  4GLX A;  2R92 G;  1A3T A;  2B2U A;  5M5X B;  4IFD H;  1NNX A;  1VQF A;  4ZQ3 A;  2UUA L;  1CUK A;  3OOC A;  1ESF A;  5JVG 3;  1SNQ A;  1TY2 A;  1VF7 A;  3OPO A;  1TS4 A;  1RL2 A;  3J81 L;  4GKJ L;  1CK1 A;  4DV4 Q;  4R9W A;  4CKE A;  4ULL A;  4LF5 Q;  3JAM E;  2NVT H;  1GD7 A;  3SVM A;  3CC2 A;  3ONA B;  3DUZ A;  4C3H B;  3T16 A;  2KQ3 A;  3CU7 A;  1BOS A;  5CV9 A;  5M5Y B;  4IJL A;  5LMN Q;  2E75 C;  2I0Q A;  4NP5 A;  4PZ8 A;  4GNX C;  3EN2 A;  3FP9 A;  3M3Y H;  4ZKB B;  4XYO A;  1EY7 A;  2HDM A;  3CRK C;  2KCM A;  4A3K B;  1SNC A;  4MTN A;  3CP0 A;  4XTC S;  3S24 A;  4IOC A;  1ONL A;  2CW0 C;  3HOV B;  3ULP A;  3CKI B;  3I70 A;  1IBL L;  1TWF H;  1HTL D;  3M4Y A;  2F0J A;  1SEB D;  1Y69 U;  5M3F H;  1C9O A;  1QVF A;  3GTK B;  3W3A A;  1J9O A;  1U5K A;  4JI4 Q;  4LF6 L;  3PGZ A;  4DR2 Q;  2HCI A;  2IW3 A;  3VR3 A;  4ZUJ A;  5AJ3 L;  2R7F A;  2JA7 B;  4LNQ A;  4HMJ A;  1C7Y A;  3U50 C;  3QR8 A;  1PLF A;  1JJ2 A;  3S17 B;  2YTX A;  2I5L X;  4KHP Q;  1XNQ Q;  3DLL A;  4FXK C;  3GTP H;  4HJ5 A;  4L5R C;  2EIF A;  4A3I G;  1J5E Q;  1KAA A;  3K7U C;  1MHW C;  5C0X J;  3NE5 B;  1PYW D;  4DN4 M;  2C9O A;  2BH8 A;  1SBB B;  5IWA Q;  1U0L A;  1TS5 A;  3NHH A;  4A3E B;  3GTL B;  2X6G A;  5IGG A;  1F9S A;  1CI3 M;  1CHP D;  2EY2 A;  2UUC Q;  1D2B A;  1CKN A;  1VMP A;  4LFC L;  1LM0 A;  5LMU Q;  4IOA A;  1I6V C;  2KEE A;  1N36 Q;  3J7Z C;  2QDL A;  3PO3 G;  3E6Z X;  1CZW A;  3HOZ H;  1SRU A;  2KBN A;  4JBW A;  2VS1 A;  3P7J A;  5I4D A;  5C0X I;  5M5X H;  4Y7N B;  4R8N A;  2VQE L;  4DV1 L;  3K5O A;  2BDN A;  1OXV A;  4RFB A;  4U67 3;  2H5X A;  2QIL A;  1YNJ C;  4KKS A;  1W6K A;  3PIP A;  1SNO A;  4B9W A;  3SHL A;  2KHI A;  5GAE C;  2IHF A;  1FNV A;  1KTK A;  3D0F A;  3TN2 A;  2JA6 H;  1KRS A;  4DAV A;  5K36 G;  1OXS C;  3CCM A;  1CA6 A;  1G6Z A;  5FLX c;  3S2H H;  5FLM G;  4TVA B;  2Q2T A;  4BY1 H;  4K0K Q;  4G7O C;  1MSH A;  1K8O A;  2SEB D;  2KUM A;  4JI0 Q;  4YHH L;  2MUY A;  1ILQ A;  4OHJ A;  1LYL A;  4YIJ A;  4RHR A;  2RDH A;  1KNE A;  3STB C;  1D5Z C;  1WTH A;  2NVX H;  1WTR A;  1J8I A;  2F0N A;  3CXC A;  1QZG A;  1GUG A;  3M4O B;  4IZ8 A;  4PG3 A;  1ENA A;  2JA8 B;  2I46 A;  4KY6 A;  2K01 A;  4A3D G;  1KXL A;  1DCZ A;  1Y8P B;  5JJK A;  1AZP A;  1JJC B;  3F2U A;  5FKA C;  3V2T A;  4HTH A;  2XN9 C;  3V05 A;  2F0O A;  3P75 A;  5JAV A;  5KRU A;  1X9N A;  1CT1 D;  1HRJ A;  4NXM Q;  2F0G A;  1X56 A;  2JA9 A;  4HIO A;  1IKL A;  4A3L H;  4FNF A;  2EYO A;  2IJ0 A;  3HZX A;  1YNJ D;  1RKN A;  4DV0 Q;  3S16 B;  1PTO C;  1S5C D;  2QCP X;  4NXN Q;  3CPF A;  3I72 A;  4YCW A;  5IGD A;  2IY5 B;  2VZA A;  3GV3 A;  1KC8 C;  4DR4 Q;  2EXZ A;  4ME5 A;  1EOT A;  1PMR A;  1IL8 A;  4JI5 Q;  4J6H A;  3Q6S A;  2F0M A;  2L5T A;  3E9I A;  4OIK A;  4QMG A;  4JBK A;  4A3F B;  1F2L A;  5IYC H;  5BN4 A;  3EVQ A;  1LT4 D;  2LXK A;  1X6O A;  2RDF A;  4U68 A;  2I07 B;  2D9U A;  4WJ4 A;  1DON A;  1F2M A;  3PUZ A;  2DN8 A;  2PW7 A;  3QWN A;  2HQL A;  3HOW H;  2E2I B;  4JI4 L;  1ILP A;  1WTQ A;  2B63 H;  2K28 A;  1PZK D;  2OWO A;  1RF2 D;  4JI8 Q;  3MHB A;  2OQ0 A;  2WFW A;  1NTG A;  1HA6 A;  1VS0 A;  3I4N B;  2A19 A;  2GVA A;  4YWM A;  5NUC A;  4LFB Q;  4HJ8 A;  2VNU D;  3KOJ A;  3S2D B;  2ZT9 C;  4MZ9 A;  3AQQ A;  1XJV A;  4V0B A;  4EVO A;  3ER0 A;  1S5F D;  1BNZ A;  2XGT A;  1Q7Y C;  4A3J B;  3S14 B;  3TQY A;  2PNR C;  4A76 A;  3GTG B;  3A0J A;  1IXR A;  4Q5V A;  4KJO A;  2PPB C;  4BY7 G;  3Q24 A;  4GNX A;  5C0X H;  2QA4 A;  4HID A;  3PF5 A;  1RD9 D;  2PYK A;  2TSS A;  3NWS A;  5IY0 A;  3RZO H;  4DUZ L;  2L9H A;  1AZQ A;  3E9H A;  3ERS X;  2XWB B;  5ELF A;  1SYG A;  4FP5 D;  2NN6 H;  4PNY A;  4IQZ A;  5EGT A;  3O13 A;  1RHP A;  3BYY B;  1QE6 A;  1KDA A;  3WWV A;  2PNH A;  2M00 A;  1VF5 C;  5I9P A;  3ND9 A;  4DAP A;  5M9O A;  2PMZ E;  3MWY W;  5GRO A;  1SDF A;  1V1O A;  5IYB H;  4KKU A;  5KYI A;  2K05 A;  2F3V A;  2VUM G;  1FJG Q;  4BXX G;  3SE0 A;  2R7Z H;  1CA5 A;  1ZYR D;  1A62 A;  2B39 A;  3KDF A;  1EWH A;  1T9H A;  3FHW A;  4N9P A;  3VYT A;  5IYD H;  2OT2 A;  1B44 D;  5FJ8 G;  4GKK L;  4LF7 Q;  3G48 A;  3SXH A;  1EY4 A;  1E1T A;  3GP7 A;  3MXN A;  3MXN B;  3FDT A;  2HIX A;  4WFN 3;  3U9O A;  4C2M H;  2R93 G;  1HNX L;  2F0P A;  1LTL A;  2WIN B;  2WV6 D;  3TP7 A;  2N3S A;  1AW7 A;  3PUX A;  1L1O A;  1L1O B;  1EWC A;  4GS3 A;  1TWH B;  2FFK B;  3JAM L;  1NAP A;  3LX0 A;  3OW2 A;  2E2H B;  2B8G A;  2EYJ A;  1M8A A;  5LL6 S;  3GQB A;  1IHZ A;  3H0G H;  4ZRZ A;  1WVL A;  4FO2 A;  1YNN C;  2QW7 A;  1WTP A;  1JMC A;  4OWW B;  2A73 B;  4J15 A;  1IBM Q;  3NTI A;  3GTG H;  3FKI B;  2XTI A;  1HTP A; 
#chains in the Genus database with same CATH homology
 2HT1 A;  1CSP A;  1QZH A;  4BBS H;  1Y14 B;  2BA1 A;  4DR2 L;  4OO1 G;  1EIY B;  5IYC G;  4DV1 Q;  1N33 Q;  1VQJ A;  3OTO L;  3KJO A;  1KQS A;  3PUV A;  3UE1 A;  4A3J G;  4DR4 L;  4JYA L;  1X3F A;  1V1Q A;  3K81 C;  1EQR A;  5JEA G;  2F4V L;  1UE6 A;  4GLV B;  4DR3 L;  3J81 c;  4X65 Q;  3RR5 A;  5C4X G;  2VW9 A;  1XNQ L;  4KHP L;  2MO0 A;  2IX0 A;  3UE0 A;  4DV6 Q;  4A3C G;  3I55 A;  3HOW G;  4DV7 L;  1NJI C;  3PO3 H;  5C3E G;  4HJ7 A;  4JOI C;  2B63 G;  4JC0 A;  2UUB Q;  2D0P A;  5BR8 Q;  1X65 A;  3A5Z B;  1L0W A;  2NVQ H;  1J5E L;  1WCM G;  1UE1 A;  5IP7 G;  3J80 c;  1EUJ A;  1MIU A;  3S1Q H;  1E22 A;  3J81 j;  4LF4 L;  4IPD A;  4DR5 L;  3L2P A;  2A1A A;  5IWA L;  1PH4 A;  1G6P A;  2GVB A;  1Y1V H;  3CCU A;  4DUZ Q;  3NEM A;  2WAQ G;  3L7Z C;  4JI2 Q;  4UP9 A;  4DPG A;  1GKH A;  3RLF A;  4B3S L;  4GNX B;  2UUC L;  5IT9 c;  3PV0 A;  1HZC A;  1KHI A;  1NMG A;  1SMX A;  2QGQ A;  3K80 C;  3T1H L;  3CCJ A;  1Y1W H;  1YHQ A;  1PH5 A;  2RHS B;  5LMU L;  4X66 Q;  2ASB A;  4B3R Q;  1VCI A;  1Z9F A;  4EX5 A;  1N36 L;  4LF8 L;  4L5S A;  4LF9 Q;  1R9T H;  1L1O C;  1VQ8 A;  2ZJQ A;  3JAM c;  3HKZ E;  1YJ9 A;  1JE5 A;  1WOC A;  3BU2 A;  4KHZ A;  4YWL A;  1EFW A;  3GTQ H;  1YBY A;  2VQF L;  1Z47 A;  2LSS A;  2KCT A;  4R1J A;  5C0X G;  4IFD I;  5E7N A;  1XMO Q;  4OON A;  1M90 C;  4C3H H;  5FLM H;  2CCZ A;  4L5Q A;  4P75 A;  1PYB A;  2OTL A;  2CKZ B;  2RCN A;  1UEB A;  5M5Y H;  1GM5 A;  3AEV A;  5DLQ E;  1RIP A;  1A8V A;  1VQ4 A;  1N32 Q;  3PF4 A;  2ZTE A;  2Q2U A;  4JI3 Q;  1XPR A;  1W3S A;  3PSI A;  4JI7 L;  2NN6 G;  3CCV A;  1HNZ Q;  4H02 A;  1A0I A;  1FVI A;  3BJU A;  3J80 i;  1Q81 C;  4POG A;  4AQY L;  4GLX A;  2R92 G;  3RNU A;  3G6E A;  5GAH C;  2UUA L;  1VQF A;  3F1Z A;  4GKK Q;  1XNR L;  1CUK A;  4GLA C;  2VL6 A;  1SE8 A;  1VQ6 A;  4A3K H;  1A63 A;  3M7N A;  3CD6 A;  4JCV E;  5J3B A;  1RL2 A;  3CME A;  1PYS B;  3HOV H;  5M5W H;  3RN2 A;  1E3P A;  4RG1 A;  1YJN A;  4GKJ L;  4DV4 Q;  4WJ3 M;  3KDF B;  4LF5 Q;  4RMF A;  5IYB G;  2PI2 A;  4A3D H;  2NVT H;  4K0K L;  1GD7 A;  1I50 H;  1XTD A;  2F3I A;  3CQZ H;  4IPC A;  5GAD C;  1HNX Q;  3CC2 A;  3CAM A;  3I56 A;  3GTK H;  4JI0 L;  3JAM i;  1OTC A;  1XPU A;  1B7Y B;  4R4I A;  1VQ5 A;  1UWV A;  5JJL A;  1PH7 A;  2R7Z G;  1SLJ A;  4IJL A;  5LMN Q;  2I0Q A;  3S1N H;  2JA7 H;  1FL0 A;  5JJI A;  1KL9 A;  1HJP A;  1B8A A;  1N34 L;  5IYD G;  3AFP A;  3HKZ G;  4MNO A;  3PUY A;  4PZ8 A;  3UDF A;  4OXP A;  3U4Z A;  3S17 H;  1I94 L;  4GOP A;  1VQP A;  4GOP B;  5JEA J;  4GNX C;  3EN2 A;  3KF6 A;  3FP9 A;  3KF6 B;  1K8G A;  2BH2 A;  3HOU H;  1FJG L;  3M3Y H;  3CF5 A;  4YY3 Q;  1G29 1;  2GN5 A;  1JB7 A;  1YHA A;  2K5N A;  2KCM A;  5IE8 A;  1OXU A;  3PUW A;  1HR0 Q;  4MTN A;  4IOC A;  3CP0 A;  4XTC S;  3S24 A;  3M85 A;  2K5V A;  2N78 A;  3ULP A;  2UXD Q;  3FKI G;  1IBL L;  1TWF H;  2YYZ A;  1VQ9 A;  3S1R H;  1VQO A;  4KLK A;  1C9O A;  5M3F H;  3ULL A;  4C3J H;  4A3E H;  1QVF A;  2CWP A;  2CWA A;  4JI6 Q;  4B3M L;  3GTL H;  1WI5 A;  1HZB A;  3H15 A;  1EWI A;  1U5K A;  4JI4 Q;  4LF6 L;  3PGZ A;  4NB3 A;  4DR2 Q;  2ID0 A;  2NZH A;  2WB1 E;  4NXM L;  2UXC L;  4IPH A;  2IT1 A;  1K83 H;  4B3T L;  5AJ3 L;  3E0E A;  3OTO Q;  1H95 A;  1SRO A;  2R7F A;  1Q1E A;  4LNQ A;  4JYA Q;  1C7Y A;  2F4V Q;  3U50 C;  3GD7 A;  1JJ2 A;  4DV0 L;  2YTX A;  2I5L X;  4A3B H;  3T1Y L;  4KHP Q;  3H0G G;  1XNQ Q;  2D62 A;  3A5U A;  1IBK L;  4NXN L;  3W5O A;  1X3G A;  2ZM6 Q;  3DLL A;  2ES2 A;  4DV7 Q;  3GTP H;  4HJ5 A;  4QY7 A;  4Y7N H;  2RHQ B;  4BBR H;  2UXB Q;  4OX9 L;  4A3G H;  2K4K A;  4L5R C;  2EIF A;  1JJG A;  4A3I G;  1J5E Q;  2E8G A;  2K50 A;  5M3M H;  3RZD H;  1G51 A;  2PI2 E;  3K7U C;  4DK3 C;  5IP9 H;  5C0X J;  2N8N A;  3PO2 G;  4JI5 L;  1E1O A;  4P72 A;  4LF4 Q;  1QUQ A;  2BH8 A;  1QUQ B;  4DR5 Q;  3BZC A;  3W1G A;  5IWA Q;  2ZJP A;  4BBS G;  1U0L A;  2OCE A;  3KLW A;  1PHJ A;  3GTO H;  4LUZ A;  4BBR G;  4R4O A;  4A3G G;  4B3S Q;  4BA2 I;  2UUC Q;  3CCL A;  3STB D;  1CKN A;  3G4S A;  4LFC L;  1K3R A;  1HZ9 A;  1LM0 A;  3GO5 A;  3Q8D A;  3CCQ A;  3T1H Q;  5LMU Q;  4IOA A;  2JJQ A;  4LUO A;  1N36 Q;  4LF8 Q;  3M9B A;  1W2B A;  4AH6 A;  3J7Z C;  2Q2H A;  3W1B A;  2BA0 A;  1HNW L;  1V9P A;  2AWO A;  3AYH B;  3PO3 G;  1E24 A;  2JK8 A;  3HOZ H;  2QEX A;  1SRU A;  2KBN A;  4JBW A;  2VS1 A;  1EYG A;  5C0X I;  5M5X H;  4GOP C;  1WYD A;  3KF8 B;  2VQE L;  2B29 A;  4DV1 L;  3CC4 A;  4TQU S;  1N33 L;  4BY7 H;  3U58 A;  2AWN A;  4A93 H;  3GTJ H;  2JA5 H;  1OXV A;  4DV5 L;  4JI8 L;  2RF4 A;  4DR1 Q;  3I4M H;  1Q12 A;  1IZ6 A;  1X55 A;  1Y1V G;  2WB1 G;  2H5X A;  4X64 Q;  2LXJ A;  4QIW E;  3PIP A;  4UP8 A;  4LFB L;  1S3O A;  4JI7 Q;  4OWX B;  2KHI A;  5GAE C;  1Y1W G;  1PH2 A;  4A3M H;  2IHF A;  3RLO A;  5BR8 L;  3D0F A;  4AQY Q;  3K0X A;  2JA6 H;  3J81 i;  1FGU A;  1KRS A;  1VQL A;  4AYB E;  2JA5 G;  2V1C C;  3F8T A;  5K36 G;  3M4O H;  2UU9 L;  4IO9 A;  2UUA Q;  3PCO B;  2MQH A;  2HHH Q;  1OXS C;  2JA8 H;  3CCM A;  2AKW B;  3S1M H;  4UP7 A;  1PH6 A;  1M1K C;  1VQA A;  5FLX c;  1HZA A;  5GAG C;  2EQS A;  1D8L A;  1PV4 A;  3IRB A;  4GKJ Q;  5ELO A;  4A75 A;  1K73 C;  1EOV A;  3S2H H;  5FLM G;  4A3M G;  4TVA B;  2Q2T A;  4BY1 H;  4LFA Q;  2IX1 A;  4K0K Q;  4DV3 L;  1YNX A;  3VDY A;  1WFQ A;  2MO1 A;  2Z6K A;  4JI0 Q;  2VUM H;  3HOY H;  4YHH L;  3CCS A;  1OXX K;  1LYL A;  1P8L A;  4JI1 L;  2HIV A;  1S72 A;  4BXX H;  5C44 H;  3I4O A;  4APV A;  3I2Z A;  4LW1 A;  4OWT B;  3SGI A;  1VQH A;  3STB C;  3K7A H;  1N34 Q;  1AE2 A;  4DR7 L;  3JC6 6;  4IFD G;  3S16 H;  3TRE A;  2VY3 A;  4HIM A;  1PFS A;  2NVX H;  1YZ6 A;  2Z0S A;  4KI0 A;  1I94 Q;  3TRZ A;  4DR6 L;  5EAY A;  3CXC A;  5FJ8 H;  1QZG A;  4A3K G;  4QGU A;  4PG3 A;  4JG2 A;  1VQC A;  3HOV G;  1MJE A;  1YIJ A;  2ATW A;  3CMA A;  3U4V A;  2A8V A;  1TXY A;  2R7D A;  1VQM A;  3EBE A;  1XMQ L;  5C44 G;  4JI3 L;  1YJW A;  4A3D G;  1KXL A;  2E5L L;  4LUV A;  2K14 A;  3A74 A;  4LWC A;  5JJK A;  1IBL Q;  1JJC B;  4PZ6 A;  2ALY B;  2R93 H;  4JOI A;  3HKS A;  1YHB A;  4AIM A;  4B3M Q;  4IJH A;  2K5H A;  4A3F H;  1VQD A;  4LF6 Q;  1X9N A;  4X62 Q;  2JA7 G;  2UXC Q;  4DKA C;  4NXM Q;  2CFM A;  4AYB G;  4B3T Q;  1X56 A;  5AJ3 Q;  2JA9 A;  4HIO A;  4A3L H;  2KHJ A;  3F2C A;  2YTV A;  4DV2 Q;  1VQI A;  2ZTC A;  3HOU G;  2ZTD A;  4DV0 Q;  4LF7 L;  2AMC B;  2E2I H;  1YI2 A;  4OO1 I;  4NXN Q;  1PH1 A;  1K8A C;  3CPF A;  1GVP A;  4YCW A;  3KJP A;  2IY5 B;  2VZA A;  4OX9 Q;  1TWG H;  1PH3 A;  1TWA H;  1K9M C;  1KC8 C;  4DR4 Q;  2E2J H;  4ALP A;  4DK6 C;  2JEB I;  4DR3 Q;  4UPA A;  5ELN A;  5M3F G;  4JI5 Q;  3PIO A;  4A3E G;  1Q1B A;  1P16 A;  3I4N H;  3GDE A;  4R4C A;  1O7I A;  4PMW A;  3E9I A;  4QJF A;  1KRT A;  3UDI A;  3S2D H;  4JBK A;  4O2D A;  4YY3 L;  3S15 H;  2CQO A;  2OQK A;  2Z6K C;  5IYC H;  1BKB A;  1X54 A;  1N9W A;  1MKH A;  1SN8 A;  2LXK A;  4LFC Q;  2I5M X;  3D31 A;  2R6G A;  1CKM A;  3S14 H;  4A3J H;  1X6O A;  4DNI A;  1DGS A;  1XPO A;  4A3B G;  3TS2 A;  3F2B A;  1OXT A;  2B3G A;  4WJ4 A;  2WP8 J;  4XIG S;  3PUZ A;  4DAY B;  1HNW Q;  5C4X H;  3RN5 A;  2K75 A;  4X6A H;  4A3C H;  2HQL A;  3HOW H;  4JI4 L;  5C3E H;  4JV5 L;  4DUY L;  2B63 H;  1PVO A;  1CKN B;  1NBW A;  5M3M G;  1PH8 A;  2VQE Q;  5IP9 G;  2JE6 I;  1J6Q A;  1IBM L;  3G71 A;  1WCM H;  5GQO A;  3TS0 A;  3EIV A;  5IP7 H;  2OWO A;  1WJJ A;  4DV5 Q;  4JI8 Q;  3CW2 C;  1I3Q H;  1LUZ A;  2OQ0 A;  3GTM H;  2WFW A;  1NTG A;  2VQF Q;  1VQG A;  1VS0 A;  2Y0S E;  2A19 A;  2GVA A;  2I5H A;  4YWM A;  2ZM6 L;  4JBJ A;  4LFB Q;  3I7F A;  4HJ8 A;  2UXB L;  2VNU D;  3KOJ A;  2IHE A;  4MZ9 A;  1KIX A;  3AQQ A;  1Q82 C;  3CCR A;  1XJV A;  3ER0 A;  2NVY H;  1EIF A;  3AFQ A;  2XGT A;  2UU9 Q;  1Q7Y C;  3NBH B;  4P71 A;  4X65 L;  4IFD J;  1MJC A;  3F2D A;  4ME3 A;  3TQY A;  4HJA A;  1CSQ A;  4A76 A;  1L2F A;  4DV6 L;  1N8R C;  3UDX A;  3A0J A;  1IXR A;  5LMN W;  2NN6 I;  3M4P A;  3H3V I;  3HOZ G;  3ICE A;  2UUB L;  2JQO A;  2N49 A;  1VQK A;  1AH9 A;  4P74 A;  4BY7 G;  4GNX A;  2D0O A;  4A93 G;  1BBW A;  4PZ7 A;  1B70 B;  1BVS A;  2KEN A;  2QA4 A;  4HID A;  1NY4 A;  1YIT A;  3PF5 A;  3I4M G;  4P73 A;  4DV3 Q;  1XNR Q;  1UE7 A;  5IY0 A;  5C4J H;  2FXQ A;  4YHH Q;  3CCE A;  1ASY A;  3RZO H;  2NZO A;  1IYJ B;  1YVC A;  1K0R A;  4DUZ L;  5H1S E;  1I6H H;  3E9H A;  3ERS X;  3L0O A;  3NEL A;  4JI1 Q;  1HR0 W;  4JI2 L;  2PQA A;  2PQA B;  1IL2 A;  3HOX H;  2YV5 A;  2JA6 G;  1Q46 A;  2L15 A;  3H3V H;  1JT8 A;  1HH2 P;  1KD1 C;  4QQB X;  4FDB A;  1TWC H;  4YCU A;  4X66 L;  2R92 H;  4DR7 Q;  4B3R L;  4LF9 L;  2JA8 G;  1SFO H;  3WWV A;  1AE3 A;  4DR6 Q;  4DR1 L;  2PNH A;  4GN5 A;  4YWK A;  3UDG A;  1PA6 A;  4IPG A;  1Q86 C;  4L5T A;  1VQB A;  2AHO B;  3ULJ A;  4X64 L;  4DV2 L;  3LGJ A;  2PMZ E;  4R4T A;  1XMQ Q;  5GRO A;  4HJ9 A;  1EQQ A;  3HOX G;  1GO3 E;  2E5L Q;  4BY1 G;  1XMO L;  1UE5 A;  5HY6 A;  5IYB H;  3KYH C;  1I5F A;  4YCV A;  3DM3 A;  3HOY G;  2Y0S G;  2VUM G;  1FJG Q;  3ZJY C;  2K52 A;  1N32 L;  2HHH L;  4BXX G;  3NEN A;  2MFI A;  2MNA A;  2JEA I;  5HGQ A;  4EQ5 A;  1C0A A;  1CKO A;  2R7Z H;  1TWH H;  1HNZ L;  1A62 A;  2OTJ A;  1NE3 A;  2DGY A;  1QVC A;  3KDF A;  1T9H A;  2E2H H;  3FHW A;  2C35 B;  2YTY A;  4JBM A;  3J7A 5;  1PH9 A;  4LFA L;  5IYD H;  3MEF A;  5FJ8 G;  4GKK L;  4A4I A;  4LF7 Q;  3G48 A;  1E7Z A;  2ZJR A;  1E1T A;  3MXN B;  4QL5 A;  4DV4 L;  4LF5 L;  2HIX A;  3TEH B;  1SR3 A;  4C2M H;  1KAW A;  2YU9 H;  1S40 A;  1Q8K A;  3K8A A;  2R93 G;  1HNX L;  3FKI H;  4HIK A;  3T1Y Q;  1LTL A;  1IBK Q;  4POF A;  4A3F G;  3BZK A;  2N3S A;  3OYY A;  3CPW A;  3PUX A;  5LMN L;  1QVG A;  2F52 A;  1D7Q A;  1L1O A;  1L1O B;  1X3E A;  4NPS A;  4A3L G;  4GS3 A;  4GN4 B;  2WAQ E;  4R4Q A;  4GN3 B;  3KFU A;  3OW2 A;  1NMF A;  3M4Q A;  3HFZ B;  1VQN A;  1VQ7 A;  2DUD A;  1ASZ A;  3H0G H;  4UY8 C;  1HR0 L;  4BA1 I;  1BBU A;  4DUY Q;  1VQE A;  2EXD A;  1JMC A;  4X62 L;  4JV5 Q;  3RLN A;  4Y52 H;  1YEZ A;  4DAM A;  4OWW B;  2UXD L;  4J15 A;  4A3I H;  1IBM Q;  4O0A A;  3GTG H;  3CC7 A;  4C3I H;  3I4N G;  3PO2 H;  3B6Y A;  1V43 A;  2XTI A;  2Q2I A;  4JI6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...