2SDFA

Solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
67
structure length
67
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL CELL-DERIVED FACTOR-1
publication title Solution structure and basis for functional activity of stromal cell-derived factor-1; dissociation of CXCR4 activation from binding and inhibition of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 7
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1998-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sdfA00
1SDFA 4IUUA 1O80A 2MPMA 2Q8RE 1G6ZA 1A15A 1IKLA 2K04A 2HDLA 4X3KA 3SVMA 1NR4A 5E4WC 4X3UA 2L1BA 3I8ZA 3G7LA 1KNEA 5CBAE 3R93A 4QUCA 4XT3B 3MWYW 5D14A 5T1GA 1PFNA 4DN4M 1SAPA 1GUWA 3LWEA 1EIGA 4RAUC 5AFWA 1J9OA 1MSHA 1QNKA 1S4ZA 1U4MA 1ESRA 1KNAA 2B2TC 2X6LA 4R9WA 3D6WA 1F9PA 1G2SA 1JE4A 1WTOA 2JYOA 4LMQD 1CA5A 2B2UA 4O42A 2HUGA 3HP3A 3I3CA 3F2UA 1ML0D 3IFDA 4XDXA 2HCCA 4MN3A 5EJWA 4OIJA 2RSNA 2L11A 2XIWA 4IUQA 1X3PA 1B4OA 4IUVA 5D65A 1X32A 1BF4A 2MJ8A 2D9UA 1JICA 1LV9A 1B3AA 1M8AA 1WTVA 1HUNA 2FJ2A 2FMMA 2NZ1D 4OIKA 3TZDA 5CMDA 1NR2A 1WTPA 3I90A 1PFBA 2RSOA 2X6GA 1NCVA 2B2WC 2X69A 2L4NA 3GV3A 3DEOA 2L9HA 1DOLA 1WD0A 1X3QA 1IL8A 4QUFA 1HA6A 2B2WA 1CM9A 2EPBA 2RA4A 5E4XA 4IURA 1ICWA 5COYA 1ILPA 1VMPA 5JJZA 1ILQA 2B2TA 2HCIA 2KEEA 3UI2A 1C8CA 2BDNA 1F9QA 3TN2A 1DOMA 1O7YA 3H91A 1WVLA 1XYIA 1HHVA 1AP0A 2CVRA 4RWSC 1EL0A 4UAIA 1F9RA 1VMCA 1HFGA 3DEPA 2KOLA 2NWGA 2MP1A 2K03A 1HUMA 1ZXTA 5EPLA 1MSGA 3Q6SA 2L12A 3KBXA 1G91A 1HRJA 1EQTA 1QE6A 4ZLTF 2KUMA 4IUTA 1HFNA 1BO0A 4RA8A 4ZKCB 2VXWA 1BNZA 2JP1A 1RHPA 2RVLA 5T1IA 1F2LA 3FDTA 2HDMA 1Q3LA 5CBEE 4CJ0B 1AZQA 3IL8A 1TVXA 1WTRA 1DONA 1PDQA 2EE1A 3KUPA 5EPJA 1CA6A 1E0BA 1G2TA 1MGSA 3ONAB 3FPUB 2B2VC 2M2LA 4X3TA 2KVMA 4CJ1B 2EOTA 2B2YC 1PFMA 1DZ1A 2H1EA 2NYZD 1U4RA 2FINB 1WTXA 1PLFA 2K05A 5EPKA 1O7ZA 1B50A 1F9SA 3I91A 1EOTA 4HCSA 1B2TA 4R8IA 1U4LA 3N52A 5EKIA 1WTQA 4HAEA 2KECA 1RODA 2FHTA 4ZKBB 4U68A 4HEDA 5CORA 1MI2A 2K01A 2N55A 4NW2A 3DM1A 1RTOA 5DNFA 2FFKB 2KEDA 4XT1B 2R3ZA 2Q8TA 1BBXC 1RJTA 1RTNA 1QG7A 4MHEA 2B2UC 2DY8A 2IL8A 4HSVA 4ZAIA 1WTWA 1B53A 3P7JA 1SSOA 2K28A 2MGSA 1WD1A 4CJ2C 1DOKA 2K1BA 3QO2A 1J8IA 5EQ0A 2DY7A 4X3SA 1EIHA 3GV6A 1AZPA 2SDFA 2N88A 1XX8A 2J7ZA 2B2VA 1U4PA 3MTSA 4IUPA 1NAPA 4ZK9B 1IKMA 2B2YA
chains in the Genus database with same CATH superfamily
4H7BA 1BQQT 4YWMA 3SVMA 1N33Q 4UDUC 3G7LA 4YWKA 4DXFA 1H9RA 1H9SA 1R4PB 3Q0AA 1EIGA 1SE3A 3LX0A 1KNAA 2LXKA 2KCNA 1HNXL 3T1YL 5EKKA 1ML0D 1EIFA 4HN7A 2RSNA 5J1ZA 4H44C 4JI3Q 2E2DC 4HMJA 2EYOA 3S14H 4GKJL 4DV2L 2B3GA 1WTPA 4KY5A 1SYDA 2MO0A 2I5LX 2K52A 2YV5A 3S1MH 1B70B 4IO9A 4Q5VA 1T5XD 1KABA 3MEFA 1KD1C 1MD2D 4R4OA 4G7HC 3UI2A 4JI0Q 2F0DA 1DOMA 2VW9A 1WVLA 3JAMi 3S2HB 3I4NG 3CQZB 2VUMB 3SR1A 1FJGQ 1ZXTA 1SMYC 2JA5H 4A3BG 2UUAQ 1ZYRC 1V1QA 5FJ8G 4BS9A 2KENA 2RF4A 3VR4A 2R7ZB 1EYGA 2JA7G 2OXPA 3S1QH 2XSCA 4IOCA 1XMQQ 4K8JA 5EPJA 3VDYA 4HTHA 2NB0A 2ZTDA 3OOCA 4K0KQ 2H1EA 2ATWA 2K7VA 1XMOQ 3HOVG 1J5EL 1M90C 1EWCA 1UE1A 1HNXQ 1PZJD 5JVG3 1UE7A 1HTLD 5CORA 2K01A 3J81i 1ZKOA 2RDGA 1PFSA 4IPCA 5IIFA 4YY3Q 3T51B 1VQJA 1NJIC 3K7AB 4KJNA 2RQXA 1AFPA 4FVMA 4LF5L 2WKCA 1NSNS 3FRPB 5IY0A 3W2DA 1X55A 4PZ6A 3S2HH 3HKZB 3BDOA 3CQZH 2VUMH 1FR3A 1UNSA 2B2YA 3U58A 3RN2A 1G6ZA 1TWHH 1VQKA 2Y0SG 3MXNA 4GS3A 4IFDJ 4I65A 3GTPB 1MSHA 2R7ZH 5I4DA 4LF7L 3IRBA 1HNZQ 4HIDA 1HJPA 1IBKQ 3I3CA 1VS0A 1ENAA 3HZXA 2G9HD 1XJVA 3S1RB 4IUVA 1I94L 1QUQB 2VB2X 2D0OA 2K14A 2TSSA 4RKBA 4DNTB 4POFA 1D5XC 4OEMB 5EGTA 1U5KA 3O13A 1ESFA 4POGA 1P16A 4CKBA 4OO1H 1ENCA 1Q90A 5K5PA 1GKHA 3K7AH 3ICEA 5C4ZA 3I56A 1ICWA 4O2DA 4RGTA 3FHWA 5JJZA 2CWAA 3CCJA 4DPGA 1STNA 2F0PA 3CCMA 2PNRC 4A3MH 4MZ9A 1PYBA 4UP9A 5CC4A 3NTIA 1CKNB 4A3IG 1UE5A 2EIFA 2UUBL 3KBXA 2BCOA 3GTPH 3J81c 3EROA 2SEBD 2DNCA 4XYQA 1PH8A 5M3FH 1A63A 2WV6D 4A3FB 1HZAA 5FLMH 5IODA 5ELBA 3FKIB 4CBVA 2GVBA 1KXLA 5C5LA 2ZXRA 2A5HA 2XRQD 4LWCA 2K05A 3MXUA 4KHZA 4OGQC 3TREA 3M7GA 4A4IA 4BXXH 1AH9A 4I7AA 4A3DG 3GTJB 3HOWG 3H3VC 4CDDC 4U68A 1RIPA 5C3EB 1DD2A 5DM73 1PZID 3DM1A 3BYTB 2A6HC 3CXCA 1EY5A 3ULJA 1UEAB 2DY8A 1HR0L 4UPAA 3P75A 3CCVA 2K4KA 4TQUS 1S72A 2JJQA 2J7ZA 4DUZL 3BS1A 1D7QA 1JR0D 4L5SA 2AUJD 3GDEA 2QF7A 5FLXE 4HMIA 4X3KA 4FF3A 1HPCA 3DM3A 2CH4A 1KNEA 4EX5A 4DUYL 2PYKA 2B2TC 5IP9G 4DV5L 1YVCA 1G2SA 1WTOA 3A54A 3E9HA 4FF2A 4DR4L 4KTAA 1TT2A 1V1OA 4IFDG 4XYOA 4S3SA 1X32A 1UAPA 2Z8LA 3GTJH 2KBNA 3BVZA 3GTGB 5I2YA 5C3EH 1Q1BA 2YTYA 3L2PA 5CV7A 3G71A 4MNOA 1LM0A 3EFXD 2Q2HA 1CM9A 3T53B 1VQBA 4KN4C 2C35B 1ILPA 1PH5A 3HOXG 2UXCL 3H0GG 5IYCH 1E2ZA 1H9SB 1O7YA 4ABNA 2R7DA 3UDFA 5ELFA 2WAQG 2JN4A 4BBRG 5ISRA 3EIVA 2I0QA 1EY4A 4C1NI 1FL0A 1E1TA 2ENBA 2R93G 2OWOA 3STBC 2F0OA 1QWYA 5G3LD 4CDEC 2E2HH 4DUZQ 3R3OA 1Z9FA 1L0YB 5M5WB 1CKOA 4M8AA 5DLQE 1G2TA 4ULLA 5GROA 3LGJA 3CMEA 2JA9A 4IFDI 2F0JA 3E9IA 4JI4L 4GZYC 4J8QA 1JCKB 3P20A 1WCMG 5KIXA 2F4VQ 4DV5Q 4ILWA 4DV3L 2NTSA 2Q2IA 4ZKBB 4V190 2F0MA 2L15A 3SEBA 2E75C 3S9WA 3EBEA 1YNJD 4MHEA 4ZAIA 3SDZA 1K73C 2F0KA 4C3HB 4BY1G 5CV4A 1PRTB 2K1BA 4X66L 1YBYA 5E7NA 4AQYL 1VQLA 4DR6L 2NZOA 4DR2L 1VQNA 1L2FA 5KEEA 1DGSA 4LW1A 4X3UA 2R92H 5I9PA 3H09A 4XT3B 3GTKH 1EYCA 3A5UA 5JJKA 1EZ6A 1EEID 1PFNA 4DN4M 1SAPA 3X3NA 1BUVT 3A5ZB 4DV6Q 5M5WH 2KCMA 3VA5A 4LAAA 5J22A 4MN3A 1IW7D 2BDOA 3HOYG 1JICA 1LV9A 2CQAA 2F0FA 1WTVA 4YIJA 4OIKA 5IYBG 4DV1L 2PQAA 1WFQA 2EY5A 2FXQA 3QOJA 1C9OA 2A68C 4DXGA 1NCVA 3CMAA 1GHKA 3GV3A 1HA6A 4N8FA 4C2MH 4JI4Q 1JOOA 1CI3M 5E4XA 4HCEA 2F52A 2EY2A 3CW2C 3MXNB 1G51A 1QZGA 1PYWD 3I4OA 3DMUA 1H9MA 3SE0A 1GUOA 2VUMG 3T4AC 3D0FA 4LNQA 1YJNA 3PUXA 4X66Q 1YNND 2JA8G 5FLXL 2I07B 1RKNA 4DKAC 1N32L 3FMCA 2ZM6Q 2QW7A 2PW5A 4NDXA 1BNZA 4LF6L 3DLLA 1PRTF 2EYJA 3ERQA 5I6WA 5IT9c 2F0IA 1H95A 1WTRA 1CQVA 2IW3A 3KUPA 5GAHC 1E0BA 1MGSA 4A3EB 3FPUB 1KRSA 2M2LA 4X3TA 1PA6A 1OXTA 1X54A 5LMUQ 1A3TA 1F9SA 3I91A 1DJRD 4P73A 5AJ3L 3K5NA 3U9OA 3GTQB 1WTQA 3S1NH 1HH2P 1VQ7A 2WB1B 5NUCA 1A8VA 4HEDA 1MI2A 4YHHQ 4YWLA 1BBWA 2Q2UA 1BBXC 1D6EC 3PUWA 3VYRA 1XTCD 1T5EA 4PZ7A 4DV1Q 4N9TA 4XQJA 5C44B 1LTBD 2V1CC 2J0TD 4WORA 1Q7YC 3HKZG 2EYHA 4KKUA 2MPMA 1I4QA 2Y0SE 2L1BA 4ZRZA 4NXNQ 1QVCA 1HCZA 3W1BA 2ZT9C 3LWEA 4G7OC 3G48A 2UXDQ 4JI1L 2EYFA 1XWEA 4YCWA 1KIXA 4LMQD 3NQIA 5C4XG 1TS5A 4A3EH 5EJWA 4IPHA 1N32Q 1CZGA 2MJ8A 4LF6Q 2SNSA 1S5FD 3GTQH 1VQGA 2SNMA 4A93B 3E6ZX 1SJED 4QJFA 2BE5C 2X6GA 4AYBB 5H1SE 3JC66 4OO1I 1K28A 1F2YA 2F0EA 4A75A 2AQ2B 2OCEA 4XQQA 1I4RA 5AJ3Q 2BH2A 3OMCA 3RN5A 3DUZA 5C44H 3AB9A 2EYMA 1KC8C 1GO3E 2MUYA 4RWSC 4B08A 2WFWA 3M4QA 2R7FA 2OQKA 5JOBA 1NNXA 2JEBI 3VYTA 4JI8L 5CV6A 3BDCA 4DV0L 3GTLH 4K5XA 1WOCA 3NENA 4LF9L 1T9HA 3TBIB 4IUTA 4DF7A 1NBWA 5T1IA 4LUOA 2HQEA 4JCVE 2F0NA 2IWHA 5C4HA 3RZDB 4A3FG 5CV8A 1PMRA 2WKDA 3FKIG 2MHVA 4R8NA 1MKHA 4HCSA 4BBSB 4JI1Q 1B2TA 2ZJQA 4A76A 1TWGB 3SK4A 5KRUA 4PV1C 1D8LA 1YJ9A 5DNFA 4PZ8A 4XT1B 3FVQA 4JBWA 1W2BA 5KNDA 3QWNA 3CRKC 3VYUA 1CFMA 3MHBA 1LT3D 3QO2A 1JT8A 3PIPA 1XNQQ 3GV6A 3W1GA 5IWAQ 5IYCG 5BR8Q 1V43A 1XX8A 1IKMA 1HR0W 3G6EA 1JJCB 3J7AF 5KYLA 3OSOA 1O80A 2Q8RE 1A3VA 2A19A 3S14B 2AKWB 2XTIA 3MAQA 4L6TB 1VF5C 4LF8Q 1GXDC 1PXUA 4XQNA 4K5VA 1OXXK 1IZ6A 2ALYB 4FP5D 2NZHA 4RAUC 2X6LA 5IOCA 2F3VA 4O42A 1G291 2KHSA 2KJXA 3OWEB 3F8TA 4L63B 4JI8Q 3NUCA 1NTGA 1U0LA 3J80E 5BN4A 1N36L 1I4XA 2JA6B 5FO9B 1M4VA 1LTAD 1BCPB 1B3AA 2JEAI 1HUNA 1FNVA 1TWGH 2NZ1D 3TZDA 4ZYSA 5IYDH 3DXJC 4RHSA 3ERSX 1YITA 1EU3A 2JA5B 1Y14B 3UDXA 3QOLA 5JEAH 1U9RA 3J7ZC 4KHPL 2RCNA 4Z9CB 3S1QB 2B2TA 4EQPA 3FPPA 2UXBQ 1CQFA 1ASZA 1F9QA 2KHJA 1H9JA 2WAQE 1A6XA 1C4QA 4K8IA 5C0XH 4DR3L 4A3JH 4WJWA 1VQ9A 1P8LA 3EJIA 3ZJYC 4OL7A 1Q1EA 3GP7A 2ID0A 3OYYA 4EQ5A 1G91A 2I46A 2B63G 4B3TQ 1RHPA 1F2LA 3F1ZA 3CHBD 1DXMA 3CU7A 1SNCA 2PQAB 3K58A 1SYEA 2F0TA 1J6QA 3OMGA 5EKLA 1DZ1A 4DV4L 3J7AV 2JA6H 1VDZA 1TWFB 5KNBA 3PIO3 2L55A 2YU9B 4PNYA 1GM5A 3IAYA 3BVMA 2K33A 2ZXOA 4C3IH 3TZUA 1O7IA 1B3QA 1L1OC 1TWHB 3CCSA 4NW2A 1VQ4A 4RGOS 1FNUA 3LNNA 2IJ0A 1FD7D 3P7JA 1Q12A 1MHWC 3M85A 4A3CH 2LKVA 4C3HG 2HHHL 1XNRL 2IT1A 1E22A 1B9NA 3D8GA 1Y8PB 2K6AA 1BCPF 2BOSA 4A3GB 1JOKA 3I4MB 3PCOB 1PTOC 2Z1CA 2F0GA 4KHPQ 1EQRA 3NXWA 3TS2A 1NMGA 3CP0A 1NR4A 4QL5A 3A7AB 1HNWL 4A3LG 1X3EA 3T1YQ 3B6YA 5D14A 1HQRD 2N78A 3CCQA 1Y1VH 3S2DB 1KDAA 1ZYRD 1NUCA 1U4MA 1WJJA 4DR3Q 2CW0C 5GAEC 1F9PA 3R2TA 3TRZA 4JBKA 2CQOA 4GKJQ 2IPKD 4BWGB 4DV2Q 3KDFA 1JWUD 2XIWA 1K9MC 1TWFH 2YU9H 4A3MB 5DAUA 1CHQD 2LS01 1AE3A 1IL2A 4TKOB 2EJMA 2RSOA 1Y1WG 2E74C 5HURA 2G5DA 2VNUD 1DOLA 1IL8A 1K8MA 4IPGA 1LUZA 3HOUB 2ZXPA 4JV5L 5COYA 4QMGA 2R6GA 1PTOB 5M3FB 2AQ1B 2BDNA 3CC2A 4A3GH 3I4MH 1VQOA 4B9XA 3JAMc 4DK3C 2EY6A 2BH8A 5IE8A 2HHHQ 1IYJB 4EQOA 1VQDA 4GLVB 1V9PA 4DFAA 3S2DH 3I2ZA 2ES2A 4IQZA 4CJ0B 2L5TA 5CBEE 4DNIA 1RCVD 3IL8A 4BY7G 3I73A 3UDGA 2Z6BA 1J5EQ 2JE6I 3GO5A 3TMEA 4RCOA 3ULPA 4DK0A 4QCLA 2F03A 1U4RA 1WTXA 3I70A 1SNOA 1B50A 4CDFC 3J80L 3SK8A 4UY8C 1GHJA 3PMFA 3QG1A 4HJAA 4JYAL 4LF5Q 2H4OA 4QGUA 3P1HA 1Z47A 2Q8TA 1RJTA 4IUNA 1SE8A 4G7ZC 1B53A 2F0VA 3HOUH 5A35A 3NELA 4ME5A 3W3AA 3KJOA 1K3BC 1PTOH 2GA4B 4L5QA 3KF8A 5JVH3 3A74A 3HKZE 1C7YA 3OIPA 1DM0B 4R4IA 2KCTA 3HEJA 2QCPX 3CC7A 4LF7Q 4I7ZC 2C9OA 4IALA 1UWVA 3BU2A 5IP7H 2OF1A 1J9OA 1VQPA 2F0UA 1LT6D 1I94Q 3IKJA 1PTOF 4UP7A 2A69D 5KGUA 3CCUA 4QY7A 4F87A 2E8GA 2NN6H 1LTRD 4YCVA 3K5MA 3F2BA 4OIJA 2XVSA 4BA2I 3KJPA 1G8ZD 1Q8IA 3U50C 3PO2H 1M8AA 4P72A 4KJOA 2F4IA 1BKBA 1CHPD 1VQEA 4KY7A 2LY7A 4A93G 2K5DA 2ZJRA 1KHIA 3D31A 4B3ML 2E2HB 1XTDA 1TS3A 1VMPA 1KLGD 1F2MA 5CYUA 3WWVA 2UUBQ 3K81C 4R4QA 2DNEA 5A2QE 1F9RA 1HFGA 2KOLA 5IGCA 1YNXA 4A3KH 5LHY1 1QB5D 3HOZB 1STBA 4MTNA 4RH6A 1PH2A 2KUMA 3L7ZC 4C3JH 1RF2D 3Q22A 4IJHA 1IYUA 3KFUA 1PDQA 5ELNA 1ET6A 2RCFA 2WACA 5LL6X 2DUDA 3PUYA 2A73B 2RBMA 5IGGA 5E3FA 1EOTA 5DM63 1LT5D 3MC0B 3NTKA 4BBSG 1HR0Q 5M3MB 3EVQA 2KECA 3VA7A 2WINB 3AFQA 5D3DA 2R92B 1S5ED 1S40A 1SXTA 2FFKB 4RGMA 3GTKB 1X3FA 4B3RL 1EFID 4ZQ3A 3PQIA 3UDIA 2EQSA 1W3SA 2XWBB 1ZEQX 1IBML 1V8QA 2GN5A 3H94A 3TP8A 4JC0A 1UEBA 3H3VH 4MTKA 4DUYQ 2IY5B 1WI5A 2N88A 2Z6KA 1NAPA 3J80i 4PMCA 1K3RA 1A15A 1PRTD 1I6VC 3E0JA 3HOZH 5CBAE 4FXKC 1GOZA 3A56A 3MWYW 3PO3B 4DR4Q 3NTHA 2K75A 5AFWA 1EY6A 4C2MB 5CR3A 1SBBB 4R1JA 1N8RC 1JE4A 1CA5A 2GVAA 4HJ8A 5HGQA 3IFDA 3I4NB 2A6ED 3CAMA 3T1HL 1XXGA 2N3SA 1B4OA 1PVOA 1G6PA 3CCLA 5ELCA 5M3MH 1RD9D 4A3BB 4Y7NB 1QVGA 2UXCQ 4JI6L 4J15A 4NP5A 5KNCA 2HT1A 1WD0A 2QGQA 2JA7B 1X3QA 2JA5G 2JQOA 4ME3A 3SHLA 4Y52H 4FDBA 4JG2A 5C5MA 4AIMA 4LFAL 4JPBW 2HCIA 3DHQA 4X62L 1IW7C 3J7YW 2OEOA 1STHA 5JJIA 1XYIA 1HHVA 1B7YB 1SRUA 4JK1C 2IX3A 1EZ8A 4P71A 3V96A 3RUZA 2NWGA 1HA5A 4JI2L 3N6RA 3PO3H 3KDFB 3S1NB 2D5DA 3NK9A 2ICEC 2LSSA 4GKKL 3CRLC 3E3XA 1YJWA 1B1ZA 3F2CA 3SK5A 1CZWA 5FK9C 3NEMA 3C46A 4RG1A 4DV3Q 3I4NH 1VQCA 4H13C 2RDFA 3E5SA 1E2VA 4G4KA 1VQAA 1ASYA 4KMUC 1OTCA 1X6OA 1O78A 1YNNC 3J81E 2Y0SB 4A3BH 2B29A 5FJ8H 4Y7NH 1FGBD 1GJXA 1K0SA 4DR7L 4AQYQ 3T1HQ 2F0QA 1W6JA 3QIAA 2JA7H 4DR6Q 4H02A 3K5OA 4DR2Q 1KAWA 4J6HA 5M5YB 2R7ZG 1XPUA 4QB4A 2UU9L 2L0CA 3NE5B 4L5TA 3TS0A 4XXEA 5EBDA 3HOVH 2Q8IB 1PZKD 4QIWE 3CD6A 3VR2A 3MTSA 1KRTA 3AMUA 2H5XA 1E7ZA 1LTID 5A2QL 2B8GA 1STAA 3GTOH 5TSSA 4LFCL 2TMPA 1ONLA 4KKTA 1L1OA 1D5ZC 2YTVA 4OO1G 4K5WA 4LUZA 3TEHB 5K36H 1GUGA 4O0AA 2VQEL 3OTOL 1EEFD 2CHBD 3HGBA 3L9AX 5F2DA 4OWWB 4GNXC 1A0IA 2AUKA 2KHIA 4OONA 3S15H 4KI0A 5ELDA 3S24A 3EQLC 4DAMA 4A3IB 3D6CA 4A3MG 5ELOA 2QEJC 2A8VA 3KLSX 3K8AA 2G9DA 3I90A 3KF8B 4HIMA 4DA2A 3GTLB 5M5YH 1K83B 4RCNA 2PMZE 1Y8OB 1S5BD 2K5HA 3A8IE 4WJ4A 5M3FG 4OX9L 4HJ5A 1AE2A 3DWAA 1JORA 3PUVA 2K50A 5FLMG 1TR5A 3X3MA 4IN3A 3HOWB 1YEZA 1Q46A 4NXML 3DEPA 2HIVA 3E0EA 4BXXG 1HUMA 2UU9Q 4R4TA 2PZTA 5L37A 1QUQA 2JSOA 3M7NA 3WDNA 2K5VA 1TU2B 3VYSA 4ZKCB 4DNRB 4GN4B 4BA1I 2DGYA 1M1KC 4ODGA 3ONAB 2PNHA 5HY6A 3FP9A 1I6HB 2Z9HA 4LFCQ 1O7ZA 1SNPA 1DCZA 4A3IH 3AYHB 3M4YA 3PF5A 3L0OA 3N52A 3D4DA 2VQEQ 5EKIA 1N34L 3OTOQ 4HR7B 4CKCA 1K8GA 1TY0A 1RTOA 4ZCKA 1K83H 1SNQA 1SR3A 2B2UC 4HSVA 2J4XA 3TSSA 4IPDA 1SYCA 1LT4D 4DR5L 3RNUA 2UUCL 1EIHA 2Z6KC 4A3DH 4K6LA 3HOWH 3J81j 1QILA 3OIQA 4FF1A 2OQ0A 1JOQA 1D2BA 1PH1A 1E24A 1MJEA 3NPPA 1EY8A 2F3IA 3D3RA 1GUWA 4HJ7A 2I5MX 5C3EG 3AU7A 2D62A 3MXPA 4JBMA 4P74A 4R9WA 2C5CA 3H0GB 4NXMQ 1VQFA 1KAAA 1SLJA 5CV9A 2NN6I 4XDXA 4ALPA 4GOPA 3CCEA 1I6HH 2L11A 2WAQB 1X3PA 3A0JA 1EYAA 4BBRB 1BF4A 3FEWX 3C3LA 1WTHA 4A3JB 3K57A 2O2LD 2E2IB 5ELEA 2R93B 1YHAA 3TP7A 1PFBA 1B8AA 3J81L 4K14A 2Z4IA 5IP9H 4FXDA 3DEOA 5KYIA 4HJ9A 1BCPD 2OT2A 3SGIA 2BA0A 2O4XA 5I6YA 5EAYA 3I7FA 2KEEA 4IFDH 2IX1A 1C8CA 2MFIA 2MO1A 1I50B 1A62A 1WCMB 3KF6A 4DV0Q 5FO8B 4AH6A 4LF9Q 1STGA 3DWQA 2B39A 2OTJA 1CT1D 3OPOA 2K03A 1YIJA 3EA6A 1GD7A 5EPLA 1MSGA 4C3IB 3HOZG 1EY9A 4ZLTF 2E76C 4L5RC 1JQYD 2NVXB 3H0GH 1AZQA 3KBGA 5GQOA 1LTSD 4WRDA 1HZ9A 3CF5A 4OWTB 2UUAL 4LUVA 2EOTA 2QEXA 2JXMB 4BBRH 2FINB 5JPNC 4IOAA 1EWIA 1I4GA 1XPRA 1XMQL 4R8IA 1EOVA 4UP8A 5C3XA 2E2IH 2R93H 3PIOA 1OXSC 5J39A 1RODA 5M3MG 4K0KL 1GUNA 4RFBA 1PH4A 1SYGA 5IT9E 2XRSD 2R92G 1XMOL 5FLXc 2O5JC 1Y1VB 2AWOA 2P5ZX 1SSOA 2K28A 2MGSA 4CJ2C 2NUCA 2F0LA 1BVSA 1AEXA 5I2XA 1I50H 1WCMH 5FO7B 4LJZC 1FYCA 4YY3L 3H3VI 3HOYB 4ZK9B 2I5HA 3Q23A 3MA2B 4P2CB 2EDGA 3H15A 1BR9A 4DR1L 2XWJB 3PO3G 4BY1H 1CUKA 1QNKA 1YZ6A 1S4ZA 4PMWA 3ZYYX 1N36Q 1EU4A 3NWTA 2NVXH 3V2TA 3U9SA 2EY1A 1Y69U 3W5OA 1SYFA 1X56A 3F2UA 1UE6A 5C4JB 1II3A 4LK1C 4J1MA 1HNZL 1QJOA 1TXYA 4X65L 3RMHA 1IBKL 3WOFA 2JA8B 5CMDA 4JI7L 2F3WA 1RDPD 1RL2A 2D2CC 3H6MA 1SMYD 3TDQA 1UUPA 4ZUIA 1S3OA 3VR6A 1CSPA 2F0WA 4DK1A 3OW7A 3PF4A 1SNDA 4IZ8A 3HOYH 2CVRA 1L1OB 1SNMA 1WYDA 5M5XB 5IYBH 3IFTA 1EL0A 4UAIA 1STYA 1VQMA 3AQQA 1PTOD 2ZTEA 2NTTA 3UE0A 3UE1A 2VQFL 1QVFA 3PSIA 5DEHA 3NWSA 2R61A 1IHZA 1N9WA 2A74C 4JW0A 1HRJA 1CTMA 1QE6A 4DK6C 1AN8A 4DV4Q 1Q3LA 1O7LA 5IGFA 1HZCA 4K2KA 2CW0D 5K36G 1E2WA 3MXGA 2LMCB 1BDOA 5C4JH 3A8JE 4X6AH 1MIUA 1IXRA 2CWPA 4PG3A 4DR1Q 2O5IC 2ZTCA 4KY6A 2V4DA 4FNFA 1ET9A 4K2LA 2EXZA 2FMCA 4FO2A 2JA8H 1XNRQ 3GQBA 1EFWA 3CKIB 4DAYA 3OW2A 1JWSD 4JVZA 4CGYB 3LWUA 3C1FA 1RTNA 2NBFA 3PV0A 1WTWA 5C4XB 4X65Q 1WD1A 3OHXC 2LXJA 4JI7Q 5C6AA 2E5LL 3QR8A 3G4SA 5IGEA 1HNWQ 4A3EG 3VR5A 3AFPA 5M5XH 1E1OA 4IUPA 5E1FA 1D5MC 3RZOB 2IHEA 4DV7L 1IKLA 1Z6HA 2HDLA 5JEAJ 3PO2B 4APVA 2WB1G 1XPOA 3DWPA 2Z4HA 3URYA 1JMCA 5C0XJ 4GOPC 1DYQA 2VQFQ 4LFBL 3HG9A 4X64L 1W6KA 1Q82C 1LTTD 5C44G 4IJLA 4JOIA 4FF4A 4TSSA 4U673 4JV5Q 4A3KB 1I5FA 4NB3A 5BN5A 1VQHA 2L4NA 3K0XA 1KLUD 1HZBA 2A69C 5IT9L 5C4XH 2B2WA 2RA4A 2QDBA 3NP8A 4C3JB 4IURA 4NKLA 4TVAB 2DJFC 2F0HA 1OXVA 3S17B 1PV4A 3S1RH 3K6OA 4EGVA 1SE4A 3KYHC 3U4VA 5LMNW 1ENFA 4GNXA 1A2TA 4OHJA 3RZOH 5JJLA 1GUSA 1QOHA 1IYVA 2E2JB 4LF4L 1JE5A 4GOPB 3MFYA 2E5LQ 1S5DD 4FXGC 4RA8A 2NVYB 4AYBG 2RVLA 2A6HD 3FDTA 2NVTB 2AWNA 3ND9A 2EE1A 4DV7Q 1CA6A 4GN3B 4P75A 5CV5A 1VQIA 2B2VC 3BJUA 1X65A 4KV6A 2ZJPA 4JYAQ 1NMFA 1IBLL 5HGTA 3K0YA 5FKAC 5FOBB 1L0XB 1LLRD 4OXPA 4QQBX 1HQMC 1KDBA 3BZCA 2OTLA 4F8MA 5D3IB 1BBUA 2QKIC 3KLRA 4LFBQ 4X64Q 3KF6B 1ICFB 2ICIA 2XNAC 2F4VL 2IL8A 1H9KA 3RD4A 5GAGC 2IHFA 4A3FH 3S17H 3MVVA 3U4ZA 3FKIH 5EQ0A 1JJ2A 1VQ6A 5I9OA 2PI2E 3ITPA 1SDFA 1TIID 4IUUA 4KN7C 4XIGS 2QDLA 5E4WC 3Q8DA 2WIIB 1EY7A 4JI5L 4C1NK 2DN8A 2E2JH 5IGDA 1YHBA 3R93A 3I4LA 5IYDG 1Z7TA 1LYLA 1FGUA 2NVYH 4O1NA 1ESRA 3GD7A 2NVTH 2VZAA 3A8KE 2B2UA 1VF7A 5JEAG 1EYDA 2HUGA 5LL6S 4HIKA 1V1PA 3TP6A 4K6DA 4LF4Q 1EQQA 4V0BA 4B3SL 4KD4A 4DV6L 1PRTC 3G6JB 5EBCA 3F2DA 4B3MQ 3CC4A 2FJ2A 5C3WA 5C0XG 4A3JG 4DAVA 4GN5A 3CCRA 4Q0FA 2B63B 4R4CA 1YNJC 2X69A 2L9HA 3T13A 1K8AC 3STBD 1IBLQ 3S16B 2D0PA 2A6EC 2M00A 5GADC 3J7A5 1VQ5A 4KKSA 2RHQB 1AP0A 1PH9A 4KHVA 2YTXA 3K80C 1PH7A 1TQOA 2WP8J 1EQVA 2JA6G 3GTGH 1HTPA 1NE3A 3NBHA 3HRZC 3ND8A 3CPFA 4G57A 1TWAB 2SOBA 1Q81C 1TY2A 3BZKA 2L12A 3Q6SA 2EVBA 4CHTB 1EQTA 4C3IG 2K5NA 4F88A 2AQ3B 2VXWA 2JP1A 3WOEA 1I3QB 1TVXA 4B9WA 2PZWA 1STEA 3JAME 4JI5Q 1TWCB 2ZM6L 4A3CG 2VS1A 1S5CD 4RMFA 2B2YC 1LTLA 4QIWB 3C2PA 3HOVB 2QILA 4HSPA 4ID6A 5EPKA 4DAPA 3AEVA 2NVQB 1A3UA 3HFZB 4B3RQ 1U4LA 5C0XI 1KL9A 3PUZA 5LMUL 1X3GA 1IBMQ 1Y8NB 2B63H 3GTOB 1JWMD 2R3ZA 4KK7A 3OWFA 4B3SQ 3S16H 1B44D 1Y1VG 3Q24A 3EN2A 2EJFC 1DOKA 4H0LC 3C1EA 1I4HA 4YHHL 1SROA 4OELB 4X3SA 3SK6A 4RHRA 3BYYB 2QA4A 2SDFA 4QUFA 1A2UA 3D4WA 3I55A 5BN3A 1B9MA 3PGZA 3S15B 2PPBC 3J80c 4EQNA 2K04A 1K0RA 5CGKA 1Y1WB 3I8ZA 1TWAH 2KQ3A 4QUCA 1C0AA 4CKEA 1SYBA 1GUTA 3HS0C 1YI2A 2A68D 1BOSA 3NHHA 4C3HH 4E6IA 3D6WA 2PMZB 2F0SA 1I3QH 4NXNL 1SE2A 2M9VA 4F7XA 2A1AA 3HP3A 1I4PA 1TWCH 1EIYB 4EVOA 5G3LF 4DAYB 5D65A 4IUQA 4KLKA 2UXDL 4JOIC 2PQEA 1AW7A 1QZHA 2PZUA 4JI6Q 3T16A 2NVQH 1JJGA 3RR5A 4C56C 1TKWB 3I4MG 4A3GG 4A3LH 2FMMA 2DJGC 1R9TB 1F77A 1NR2A 2VB3X 4LFAQ 3TQYA 4X62Q 4N8X1 2B2WC 4BY7B 1KQSA 1GVPA 3V05A 4M1UB 5J3BA 2AMCB 1PH3A 2XN9C 1TS2A 1ILQA 3NBIA 2K5QA 4RKLA 3ER0A 4JI2Q 3TN2A 1HXYD 4CDCC 3MEHA 1E3PA 4GKKQ 1QCBD 1Q8KA 4OWXB 4MIUA 1Y1WH 2YYZA 2MP1A 1SFOB 1K8OA 3A55A 3BG3A 1LABA 1X9NA 2EYLA 3BVGA 1HFNA 2EJGC 5LMNL 1EWHA 1LO5D 1JB7A 3HOUG 1PHJA 2EYPA 2BA1A 2IX0A 3KK7A 1OXUA 1F2ZA 3QJYA 4DR7Q 4WJ3M 3TP5A 2MNAA 4A3DB 3NQTA 1R4QB 3R2IA 1R9TH 4HAEA 4TRDA 2FHTA 2N55A 3CPWA 2KEDA 4BY7H 2PO4A 1KTKA 1QG7A 2KA7A 2AHOB 4GNXB 2ASBA 5IP7G 2Q2TA 3KOJA 3R8BA 1J8IA 2NN6G 4KD3A 1AZPA 4ZUJA 1VCIA 1D1IA 3RLFA 1XNQL 1SFOH 3NSWA 2WB1E 1FVIA 2CH4W 5IGBA 5IWAL 5BR8L 3PO2G 4NPSA 2XGTA 4GLAC 5T1GA 3MZ5A 2HD3A 2BE5D 3K5LA 1CKNA 1VQ8A 2JYOA 2K5WA 4LF8L 3M4PA 4DGZA 3QB3A 2HCCA 3JAML 2CCZA 1MJCA 3GTMB 2D9UA 3M4OB 2RKSA 5LMNQ 1FNWA 2RDHA 2B8FA 3T56B 4FYDA 2LFNA 4PMBA 2CKZB 3I72A 4A3KG 1Q86C 4YCUA 3MFGA 4OX9Q 2Z0SA 1LTGD 3M3YB 3K59A 2PI2A 2EPBA 3HOXB 4C3JG 2JK8A 4GLXA 1N33L 2HQLA 3SXHA 4NMZA 1C48A 1KDCA 1CK1A 2VY3A 3H91A 4HIOA 1LACA 2F1MA 2KCCA 1EY0A 1L0WA 1PH6A 1MBYA 1VMCA 3K7UC 3VR3A 1QNUA 3D4RA 1YHQA 1SMXA 4A93H 2UXBL 2RHSB 2K32A 1SJHD 3RLOA 3L3OC 3BDLA 1V1PB 4AYBE 1BCPC 4JI3L 4UHVA 3A7LA 1BO0A 3HKSA 2EZVA 2MQHA 2EXDA 2N49A 2HDMA 1EUJA 5JPMC 2N8NA 4PQXA 4XTCS 2VL6A 1DONA 1CSQA 1PYSB 1N34Q 4CJ1B 2KVMA 4WFN3 1PFMA 3KLSA 4B3TL 4RGNA 2CFMA 4JBJA 2NYZD 1PLFA 3GTMH 3M4OH 1NY4A 2PW7A 1JC7A 1D1KA 4JI0L 2HIXA 3KLWA 4DR5Q 3ULLA 2UUCQ 1BXTA 1JB3A 3M3YH 3S1MB 1FJGL 4BY1B 1CKMA 3HOXH 1SEBD 4N9PA 3RLNA 3PIP3 1TS4A 2PCFB 1OO9B 3NBHB 4QF4A 3BZDB 3RZDH 5M9OA 2DY7A 3M9BA 4L8JA 5JAVA 4DU9A 1SN8A 2B2VA 1U4PA 4BBSH
chains in the Genus database with same CATH topology
4H7BA 1BQQT 3SVMA 4UDUC 3G7LA 4DXFA 1H9RA 1H9SA 1R4PB 3Q0AA 1SE3A 1EIGA 3LX0A 1KNAA 2KCNA 5EKKA 1ML0D 4HN7A 2RSNA 5J1ZA 4H44C 2E2DC 4HMJA 2EYOA 1WTPA 4KY5A 1SYDA 4Q5VA 1T5XD 1KABA 1MD2D 4G7HC 3UI2A 2F0DA 1DOMA 1WVLA 3S2HB 3CQZB 2VUMB 3SR1A 1ZXTA 1SMYC 1ZYRC 4BS9A 3VR4A 2R7ZB 2OXPA 2XSCA 4K8JA 5EPJA 4HTHA 2NB0A 3OOCA 2H1EA 2K7VA 1EWCA 1PZJD 5JVG3 1HTLD 5CORA 2K01A 1ZKOA 2RDGA 5IIFA 3T51B 3K7AB 4KJNA 2RQXA 1AFPA 4FVMA 2WKCA 1NSNS 3FRPB 3W2DA 3HKZB 3BDOA 1FR3A 1UNSA 2B2YA 1G6ZA 3MXNA 4IFDJ 4I65A 3GTPB 1MSHA 5I4DA 3I3CA 3HZXA 1ENAA 2G9HD 3S1RB 4IUVA 2VB2X 2TSSA 4RKBA 4DNTB 1D5XC 5EGTA 3O13A 1ESFA 4CKBA 4OO1H 1ENCA 1Q90A 5K5PA 5C4ZA 1ICWA 4RGTA 5JJZA 1STNA 2F0PA 2PNRC 5CC4A 3NTIA 3KBXA 2BCOA 3EROA 2SEBD 2DNCA 4XYQA 2WV6D 4A3FB 5IODA 5ELBA 3FKIB 4CBVA 5C5LA 2ZXRA 2A5HA 2XRQD 2K05A 3MXUA 4KHZA 4OGQC 3M7GA 3GTJB 3H3VC 4U68A 5C3EB 1DD2A 5DM73 1PZID 3DM1A 3BYTB 2A6HC 1EY5A 1UEAB 2DY8A 3P75A 4TQUS 2J7ZA 3BS1A 1JR0D 2AUJD 2QF7A 5FLXE 4HMIA 4X3KA 4FF3A 1HPCA 1KNEA 2PYKA 2B2TC 1G2SA 1WTOA 3A54A 4FF2A 4KTAA 1TT2A 1V1OA 4IFDG 4XYOA 4S3SA 1X32A 1UAPA 2Z8LA 3BVZA 3GTGB 5I2YA 1Q1BA 5CV7A 3EFXD 1CM9A 3T53B 4KN4C 1ILPA 1E2ZA 1H9SB 1O7YA 4ABNA 5ELFA 5ISRA 1EY4A 4C1NI 2ENBA 2F0OA 1QWYA 5G3LD 3R3OA 1L0YB 5M5WB 1G2TA 4M8AA 4ULLA 4IFDI 2F0JA 4GZYC 4J8QA 1JCKB 3P20A 5KIXA 4ILWA 2NTSA 4ZKBB 4V190 2F0MA 3SEBA 2E75C 3S9WA 1YNJD 4MHEA 4ZAIA 3SDZA 2F0KA 4C3HB 5CV4A 1PRTB 2K1BA 5KEEA 4X3UA 5I9PA 3H09A 4XT3B 1EYCA 1EZ6A 1EEID 1PFNA 4DN4M 1SAPA 3X3NA 1BUVT 3VA5A 4LAAA 5J22A 4MN3A 1IW7D 2BDOA 1JICA 1LV9A 2CQAA 2F0FA 1WTVA 4YIJA 4OIKA 2EY5A 3QOJA 2A68C 4DXGA 1NCVA 1GHKA 3GV3A 1HA6A 1JOOA 1CI3M 5E4XA 4HCEA 2EY2A 1PYWD 3DMUA 1H9MA 3SE0A 1GUOA 3T4AC 3PUXA 1YNND 5FLXL 2I07B 1RKNA 3FMCA 4NDXA 2PW5A 1BNZA 1PRTF 2EYJA 3ERQA 5I6WA 2F0IA 1WTRA 1CQVA 2IW3A 3KUPA 1E0BA 1MGSA 4A3EB 3FPUB 2M2LA 4X3TA 1OXTA 1A3TA 1F9SA 3I91A 1DJRD 3K5NA 3U9OA 3GTQB 1WTQA 2WB1B 5NUCA 4HEDA 1MI2A 1BBXC 1D6EC 3PUWA 3VYRA 1XTCD 1T5EA 4N9TA 4XQJA 5C44B 1LTBD 4WORA 2J0TD 2EYHA 4KKUA 2MPMA 1I4QA 2L1BA 4ZRZA 1HCZA 2ZT9C 3LWEA 4G7OC 2EYFA 1XWEA 4LMQD 3NQIA 1TS5A 5EJWA 1CZGA 2MJ8A 2SNSA 1S5FD 2SNMA 4A93B 3E6ZX 1SJED 2BE5C 2X6GA 4AYBB 4OO1I 1F2YA 2F0EA 2AQ2B 4XQQA 1I4RA 3OMCA 3DUZA 3AB9A 2EYMA 4RWSC 2MUYA 4B08A 5JOBA 2JEBI 3VYTA 5CV6A 3BDCA 4K5XA 3TBIB 4IUTA 4DF7A 5T1IA 2HQEA 2F0NA 2IWHA 5C4HA 3RZDB 5CV8A 1PMRA 2WKDA 2MHVA 4R8NA 4HCSA 4BBSB 1B2TA 1TWGB 3SK4A 5KRUA 4PV1C 5DNFA 4XT1B 3FVQA 4JBWA 5KNDA 3QWNA 3CRKC 3VYUA 1CFMA 3MHBA 1LT3D 3QO2A 3GV6A 1V43A 1XX8A 1IKMA 3J7AF 5KYLA 3OSOA 1O80A 2Q8RE 1A3VA 3S14B 3MAQA 4L6TB 1VF5C 1GXDC 1PXUA 4XQNA 4K5VA 1OXXK 4FP5D 4RAUC 2X6LA 5IOCA 2F3VA 4O42A 1G291 2KHSA 2KJXA 3OWEB 4L63B 3NUCA 3J80E 5BN4A 1I4XA 2JA6B 5FO9B 1M4VA 1LTAD 1BCPB 1B3AA 2JEAI 1HUNA 1FNVA 2NZ1D 3TZDA 4ZYSA 3DXJC 4RHSA 1EU3A 2JA5B 3QOLA 5JEAH 1U9RA 4Z9CB 3S1QB 2B2TA 4EQPA 3FPPA 1CQFA 1F9QA 1H9JA 1A6XA 1C4QA 4K8IA 5C0XH 4WJWA 3EJIA 4OL7A 1Q1EA 3GP7A 2ID0A 1G91A 2I46A 1RHPA 1F2LA 3CHBD 1DXMA 3CU7A 1SNCA 3K58A 1SYEA 2F0TA 3OMGA 5EKLA 1DZ1A 3J7AV 1VDZA 1TWFB 5KNBA 3PIO3 2L55A 2YU9B 4PNYA 3IAYA 3BVMA 2K33A 2ZXOA 3TZUA 1TWHB 4NW2A 4RGOS 1FNUA 3LNNA 2IJ0A 1FD7D 3P7JA 1Q12A 3M85A 2LKVA 4C3HG 2IT1A 1B9NA 3D8GA 1Y8PB 2K6AA 1BCPF 2BOSA 4A3GB 1JOKA 3I4MB 1PTOC 2Z1CA 2F0GA 3NXWA 1NR4A 3A7AB 5D14A 1HQRD 3S2DB 1KDAA 1ZYRD 1NUCA 1U4MA 2CW0C 1F9PA 3R2TA 2IPKD 4BWGB 1JWUD 2XIWA 4A3MB 5DAUA 1CHQD 2LS01 4TKOB 2EJMA 2RSOA 2E74C 5HURA 2VNUD 1DOLA 1IL8A 1K8MA 3HOUB 2ZXPA 5COYA 4QMGA 2R6GA 1PTOB 5M3FB 2AQ1B 2BDNA 4B9XA 2EY6A 4EQOA 4DFAA 4IQZA 4CJ0B 2L5TA 5CBEE 1RCVD 3IL8A 3I73A 2JE6I 3GO5A 3TMEA 4RCOA 4DK0A 4QCLA 2F03A 1U4RA 1WTXA 3I70A 1SNOA 1B50A 3J80L 3SK8A 1GHJA 3PMFA 3QG1A 2H4OA 3P1HA 1Z47A 2Q8TA 1RJTA 4IUNA 4G7ZC 1B53A 2F0VA 5A35A 4ME5A 3W3AA 2GA4B 1PTOH 3KF8A 5JVH3 3OIPA 1DM0B 3HEJA 2QCPX 4I7ZC 2C9OA 4IALA 2OF1A 1J9OA 2F0UA 1LT6D 3IKJA 1PTOF 2A69D 5KGUA 4F87A 2NN6H 1LTRD 3K5MA 4OIJA 2XVSA 4BA2I 1G8ZD 1Q8IA 1M8AA 4KJOA 2F4IA 1CHPD 4KY7A 2LY7A 2K5DA 3D31A 2E2HB 1TS3A 1VMPA 1KLGD 1F2MA 5CYUA 2DNEA 5A2QE 1F9RA 1HFGA 2KOLA 5IGCA 5LHY1 1QB5D 3HOZB 1STBA 4RH6A 2KUMA 3L7ZC 1RF2D 3Q22A 1IYUA 1PDQA 1ET6A 2WACA 5LL6X 3PUYA 2A73B 2RBMA 5IGGA 5E3FA 1EOTA 5DM63 1LT5D 3MC0B 3NTKA 5M3MB 3EVQA 2KECA 3VA7A 2WINB 5D3DA 2R92B 1S5ED 1SXTA 2FFKB 4RGMA 3GTKB 1EFID 4ZQ3A 2XWBB 1ZEQX 1V8QA 3H94A 3TP8A 2N88A 1NAPA 4PMCA 1A15A 1PRTD 1I6VC 3E0JA 5CBAE 4FXKC 1GOZA 3A56A 3MWYW 3PO3B 3NTHA 5AFWA 1EY6A 4C2MB 5CR3A 1SBBB 1JE4A 1CA5A 3IFDA 3I4NB 2A6ED 1XXGA 1B4OA 5ELCA 1RD9D 4A3BB 4Y7NB 4NP5A 5KNCA 1WD0A 2JA7B 1X3QA 3SHLA 5C5MA 2HCIA 3DHQA 3J7YW 1IW7C 2OEOA 1STHA 1XYIA 1HHVA 4JK1C 2IX3A 1EZ8A 3V96A 3RUZA 2NWGA 1HA5A 3N6RA 3S1NB 2D5DA 3NK9A 2ICEC 3CRLC 1B1ZA 3SK5A 1CZWA 5FK9C 3C46A 4H13C 2RDFA 3E5SA 1E2VA 4G4KA 4KMUC 1O78A 1YNNC 3J81E 2Y0SB 1FGBD 1GJXA 2F0QA 1W6JA 3QIAA 5M5YB 3K5OA 4J6HA 4QB4A 2L0CA 3NE5B 4XXEA 5EBDA 2Q8IB 1PZKD 3VR2A 3MTSA 3AMUA 1LTID 5A2QL 2B8GA 1STAA 5TSSA 2TMPA 1ONLA 4KKTA 1D5ZC 4OO1G 4K5WA 5K36H 1GUGA 1EEFD 2CHBD 3HGBA 3L9AX 5F2DA 2AUKA 4KI0A 5ELDA 4A3IB 3EQLC 3D6CA 2QEJC 3KLSX 2G9DA 3I90A 4DA2A 3GTLB 1K83B 4RCNA 1Y8OB 1S5BD 3A8IE 3DWAA 1JORA 3PUVA 1TR5A 3X3MA 4IN3A 3HOWB 3DEPA 1HUMA 2PZTA 2JSOA 3M7NA 3WDNA 3VYSA 1TU2B 4ZKCB 4DNRB 4BA1I 4ODGA 3ONAB 1I6HB 1O7ZA 1SNPA 1DCZA 3M4YA 3N52A 3D4DA 5EKIA 4HR7B 4CKCA 1TY0A 1RTOA 1SNQA 2B2UC 4HSVA 2J4XA 3TSSA 1SYCA 1LT4D 1EIHA 4K6LA 1QILA 3OIQA 4FF1A 1JOQA 1D2BA 3NPPA 1EY8A 3D3RA 1GUWA 3AU7A 2D62A 3MXPA 4R9WA 2C5CA 3H0GB 1KAAA 5CV9A 2NN6I 4XDXA 2L11A 2WAQB 1X3PA 1EYAA 4BBRB 1BF4A 3FEWX 3C3LA 4A3JB 3K57A 2O2LD 2E2IB 5ELEA 2R93B 3TP7A 1PFBA 3J81L 4K14A 2Z4IA 4FXDA 3DEOA 5KYIA 1BCPD 2OT2A 2BA0A 2O4XA 5I6YA 2KEEA 4IFDH 2IX1A 1C8CA 1I50B 1WCMB 5FO8B 1STGA 3DWQA 2B39A 1CT1D 3OPOA 2K03A 3EA6A 5EPLA 4C3IB 1MSGA 1EY9A 4ZLTF 2E76C 1JQYD 2NVXB 1AZQA 3KBGA 1LTSD 4WRDA 2EOTA 2JXMB 2FINB 5JPNC 1I4GA 4R8IA 5C3XA 1OXSC 5J39A 1RODA 1GUNA 4RFBA 1SYGA 5IT9E 2XRSD 2O5JC 1Y1VB 2AWOA 1SSOA 2K28A 2MGSA 4CJ2C 2NUCA 2F0LA 1AEXA 5I2XA 5FO7B 4LJZC 1FYCA 3HOYB 4ZK9B 3Q23A 3MA2B 4P2CB 2EDGA 1BR9A 2XWJB 3ZYYX 1QNKA 4PMWA 1S4ZA 1EU4A 3NWTA 3V2TA 3U9SA 2EY1A 1Y69U 1SYFA 3F2UA 5C4JB 1II3A 4LK1C 4J1MA 1QJOA 3RMHA 3WOFA 2JA8B 5CMDA 2F3WA 1RDPD 2D2CC 3H6MA 1SMYD 3TDQA 1UUPA 4ZUIA 3VR6A 2F0WA 4DK1A 3OW7A 1SNDA 4IZ8A 2CVRA 1SNMA 5M5XB 3IFTA 1EL0A 4UAIA 1STYA 1PTOD 2NTTA 5DEHA 3NWSA 2R61A 1IHZA 2A74C 1HRJA 1CTMA 1QE6A 1AN8A 1Q3LA 1O7LA 5IGFA 4K2KA 2CW0D 5K36G 1E2WA 2LMCB 1BDOA 3MXGA 3A8JE 2O5IC 4KY6A 2V4DA 4FNFA 1ET9A 4K2LA 2EXZA 2FMCA 4FO2A 3GQBA 3CKIB 4DAYA 1JWSD 4CGYB 3LWUA 3C1FA 1RTNA 2NBFA 3PV0A 1WTWA 5C4XB 1WD1A 3OHXC 5C6AA 5IGEA 3VR5A 4IUPA 5E1FA 1D5MC 3RZOB 1IKLA 1Z6HA 2HDLA 5JEAJ 3PO2B 3DWPA 2Z4HA 3URYA 5C0XJ 1DYQA 3HG9A 1W6KA 1LTTD 4FF4A 4TSSA 4U673 4A3KB 5BN5A 2L4NA 1KLUD 2A69C 5IT9L 2B2WA 2RA4A 2QDBA 3NP8A 4C3JB 4IURA 4NKLA 2F0HA 1OXVA 3S17B 3K6OA 4EGVA 1SE4A 1ENFA 1A2TA 4OHJA 1GUSA 1QOHA 1IYVA 2E2JB 3MFYA 1S5DD 4FXGC 4RA8A 2NVYB 2RVLA 2A6HD 3FDTA 2NVTB 2AWNA 3ND9A 2EE1A 1CA6A 5CV5A 2B2VC 4KV6A 5HGTA 3K0YA 5FKAC 5FOBB 1L0XB 1LLRD 1HQMC 1KDBA 4F8MA 5D3IB 2QKIC 3KLRA 2ICIA 2XNAC 2IL8A 1H9KA 3RD4A 3MVVA 5EQ0A 5I9OA 3ITPA 1SDFA 1TIID 4IUUA 4KN7C 4XIGS 5E4WC 2WIIB 1EY7A 4C1NK 2DN8A 5IGDA 3R93A 3I4LA 1Z7TA 4O1NA 1ESRA 3GD7A 3A8KE 2B2UA 1VF7A 5JEAG 1EYDA 2HUGA 5LL6S 1V1PA 3TP6A 4K6DA 4V0BA 4KD4A 1PRTC 3G6JB 5EBCA 2FJ2A 5C3WA 5C0XG 4DAVA 4Q0FA 2B63B 1YNJC 2X69A 2L9HA 3T13A 3S16B 2A6EC 2M00A 4KKSA 1AP0A 4KHVA 1TQOA 2WP8J 1EQVA 1HTPA 3NBHA 3HRZC 3ND8A 4G57A 1TWAB 2SOBA 1TY2A 3Q6SA 2L12A 2EVBA 4CHTB 1EQTA 4C3IG 4F88A 2AQ3B 2VXWA 2JP1A 3WOEA 1I3QB 1TVXA 4B9WA 2PZWA 1STEA 3JAME 1TWCB 1S5CD 2B2YC 4QIWB 3C2PA 3HOVB 2QILA 5EPKA 4HSPA 4ID6A 4DAPA 2NVQB 1A3UA 1U4LA 5C0XI 3PUZA 1Y8NB 3GTOB 1JWMD 2R3ZA 4KK7A 3OWFA 1B44D 3Q24A 2EJFC 1DOKA 4H0LC 3C1EA 1I4HA 4X3SA 3SK6A 4RHRA 3BYYB 2SDFA 4QUFA 1A2UA 3D4WA 5BN3A 1B9MA 3S15B 2PPBC 4EQNA 2K04A 5CGKA 1Y1WB 3I8ZA 2KQ3A 4QUCA 4CKEA 1SYBA 1GUTA 3HS0C 2A68D 1BOSA 3NHHA 4E6IA 3D6WA 2PMZB 2F0SA 1SE2A 2M9VA 4F7XA 3HP3A 1I4PA 4EVOA 5G3LF 5D65A 4IUQA 2PQEA 1AW7A 2PZUA 3T16A 4C56C 1TKWB 2FMMA 1R9TB 1F77A 1NR2A 2VB3X 2B2WC 4BY7B 3V05A 4M1UB 2XN9C 1TS2A 1ILQA 3NBIA 2K5QA 4RKLA 3TN2A 1HXYD 3MEHA 1QCBD 4MIUA 2YYZA 2MP1A 1SFOB 1K8OA 3A55A 3BG3A 1LABA 2EYLA 3BVGA 1HFNA 2EJGC 1EWHA 1LO5D 2EYPA 2BA1A 2IX0A 3KK7A 1OXUA 1F2ZA 3QJYA 3TP5A 4A3DB 3NQTA 1R4QB 3R2IA 4HAEA 4TRDA 2FHTA 2N55A 2KEDA 2PO4A 1KTKA 1QG7A 2KA7A 3R8BA 1J8IA 2NN6G 4KD3A 1AZPA 4ZUJA 1VCIA 1D1IA 3RLFA 3NSWA 5IGBA 5T1GA 3MZ5A 2BE5D 3K5LA 2JYOA 2K5WA 4DGZA 3QB3A 2HCCA 3JAML 3GTMB 2D9UA 3M4OB 2RKSA 1FNWA 2RDHA 2B8FA 3T56B 4FYDA 2LFNA 4PMBA 3I72A 3MFGA 1LTGD 3M3YB 3K59A 2EPBA 3HOXB 4C3JG 3SXHA 4NMZA 1C48A 1KDCA 1CK1A 3H91A 1LACA 2F1MA 2KCCA 1EY0A 1MBYA 1VMCA 3VR3A 1QNUA 3D4RA 2K32A 1SJHD 3L3OC 3BDLA 1V1PB 1BCPC 3A7LA 1BO0A 2EZVA 2HDMA 5JPMC 4PQXA 4XTCS 1DONA 4CJ1B 2KVMA 4WFN3 1PFMA 3KLSA 4RGNA 2NYZD 1PLFA 2PW7A 1JC7A 1D1KA 1BXTA 1JB3A 3S1MB 4BY1B 1SEBD 4N9PA 3PIP3 1TS4A 2PCFB 1OO9B 4QF4A 3BZDB 5M9OA 2DY7A 4L8JA 5JAVA 4DU9A 2B2VA 1U4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDF A;  4IUU A;  1O80 A;  2MPM A;  2Q8R E;  1G6Z A;  1A15 A;  1IKL A;  2K04 A;  2HDL A;  4X3K A;  3SVM A;  1NR4 A;  5E4W C;  4X3U A;  2L1B A;  3I8Z A;  3G7L A;  1KNE A;  5CBA E;  3R93 A;  4QUC A;  4XT3 B;  3MWY W;  5D14 A;  5T1G A;  1PFN A;  4DN4 M;  1SAP A;  1GUW A;  3LWE A;  1EIG A;  4RAU C;  5AFW A;  1J9O A;  1MSH A;  1QNK A;  1S4Z A;  1U4M A;  1ESR A;  1KNA A;  2B2T C;  2X6L A;  4R9W A;  3D6W A;  1F9P A;  1G2S A;  1JE4 A;  1WTO A;  2JYO A;  4LMQ D;  1CA5 A;  2B2U A;  4O42 A;  2HUG A;  3HP3 A;  3I3C A;  3F2U A;  1ML0 D;  3IFD A;  4XDX A;  2HCC A;  4MN3 A;  5EJW A;  4OIJ A;  2RSN A;  2L11 A;  2XIW A;  4IUQ A;  1X3P A;  1B4O A;  4IUV A;  5D65 A;  1X32 A;  1BF4 A;  2MJ8 A;  2D9U A;  1JIC A;  1LV9 A;  1B3A A;  1M8A A;  1WTV A;  1HUN A;  2FJ2 A;  2FMM A;  2NZ1 D;  4OIK A;  3TZD A;  5CMD A;  1NR2 A;  1WTP A;  3I90 A;  1PFB A;  2RSO A;  2X6G A;  1NCV A;  2B2W C;  2X69 A;  2L4N A;  3GV3 A;  3DEO A;  2L9H A;  1DOL A;  1WD0 A;  1X3Q A;  1IL8 A;  4QUF A;  1HA6 A;  2B2W A;  1CM9 A;  2EPB A;  2RA4 A;  5E4X A;  4IUR A;  1ICW A;  5COY A;  1ILP A;  1VMP A;  5JJZ A;  1ILQ A;  2B2T A;  2HCI A;  2KEE A;  3UI2 A;  1C8C A;  2BDN A;  1F9Q A;  3TN2 A;  1DOM A;  1O7Y A;  3H91 A;  1WVL A;  1XYI A;  1HHV A;  1AP0 A;  2CVR A;  4RWS C;  1EL0 A;  4UAI A;  1F9R A;  1VMC A;  1HFG A;  3DEP A;  2KOL A;  2NWG A;  2MP1 A;  2K03 A;  1HUM A;  1ZXT A;  5EPL A;  1MSG A;  3Q6S A;  2L12 A;  3KBX A;  1G91 A;  1HRJ A;  1EQT A;  1QE6 A;  4ZLT F;  2KUM A;  4IUT A;  1HFN A;  1BO0 A;  4RA8 A;  4ZKC B;  2VXW A;  1BNZ A;  2JP1 A;  1RHP A;  2RVL A;  5T1I A;  1F2L A;  3FDT A;  2HDM A;  1Q3L A;  5CBE E;  4CJ0 B;  1AZQ A;  3IL8 A;  1TVX A;  1WTR A;  1DON A;  1PDQ A;  2EE1 A;  3KUP A;  5EPJ A;  1CA6 A;  1E0B A;  1G2T A;  1MGS A;  3ONA B;  3FPU B;  2B2V C;  2M2L A;  4X3T A;  2KVM A;  4CJ1 B;  2EOT A;  2B2Y C;  1PFM A;  1DZ1 A;  2H1E A;  2NYZ D;  1U4R A;  2FIN B;  1WTX A;  1PLF A;  2K05 A;  5EPK A;  1O7Z A;  1B50 A;  1F9S A;  3I91 A;  1EOT A;  4HCS A;  1B2T A;  4R8I A;  1U4L A;  3N52 A;  5EKI A;  1WTQ A;  4HAE A;  2KEC A;  1ROD A;  2FHT A;  4ZKB B;  4U68 A;  4HED A;  5COR A;  1MI2 A;  2K01 A;  2N55 A;  4NW2 A;  3DM1 A;  1RTO A;  5DNF A;  2FFK B;  2KED A;  4XT1 B;  2R3Z A;  2Q8T A;  1BBX C;  1RJT A;  1RTN A;  1QG7 A;  4MHE A;  2B2U C;  2DY8 A;  2IL8 A;  4HSV A;  4ZAI A;  1WTW A;  1B53 A;  3P7J A;  1SSO A;  2K28 A;  2MGS A;  1WD1 A;  4CJ2 C;  1DOK A;  2K1B A;  3QO2 A;  1J8I A;  5EQ0 A;  2DY7 A;  4X3S A;  1EIH A;  3GV6 A;  1AZP A;  2SDF A;  2N88 A;  1XX8 A;  2J7Z A;  2B2V A;  1U4P A;  3MTS A;  4IUP A;  1NAP A;  4ZK9 B;  1IKM A;  2B2Y A; 
#chains in the Genus database with same CATH topology
 4H7B A;  1BQQ T;  4YWM A;  3SVM A;  1N33 Q;  4UDU C;  3G7L A;  4YWK A;  4DXF A;  1H9R A;  1H9S A;  1R4P B;  3Q0A A;  1EIG A;  1SE3 A;  3LX0 A;  1KNA A;  2LXK A;  2KCN A;  1HNX L;  3T1Y L;  5EKK A;  1ML0 D;  1EIF A;  4HN7 A;  2RSN A;  5J1Z A;  4H44 C;  4JI3 Q;  2E2D C;  4HMJ A;  2EYO A;  3S14 H;  4GKJ L;  4DV2 L;  2B3G A;  1WTP A;  4KY5 A;  1SYD A;  2MO0 A;  2I5L X;  2K52 A;  2YV5 A;  3S1M H;  1B70 B;  4IO9 A;  4Q5V A;  1T5X D;  1KAB A;  3MEF A;  1KD1 C;  1MD2 D;  4R4O A;  4G7H C;  3UI2 A;  4JI0 Q;  2F0D A;  1DOM A;  2VW9 A;  1WVL A;  3JAM i;  3S2H B;  3I4N G;  3CQZ B;  2VUM B;  3SR1 A;  1FJG Q;  1ZXT A;  1SMY C;  2JA5 H;  4A3B G;  2UUA Q;  1ZYR C;  1V1Q A;  5FJ8 G;  4BS9 A;  2KEN A;  2RF4 A;  3VR4 A;  2R7Z B;  1EYG A;  2JA7 G;  2OXP A;  3S1Q H;  2XSC A;  4IOC A;  1XMQ Q;  4K8J A;  5EPJ A;  3VDY A;  4HTH A;  2NB0 A;  2ZTD A;  3OOC A;  4K0K Q;  2H1E A;  2ATW A;  2K7V A;  1XMO Q;  3HOV G;  1J5E L;  1M90 C;  1EWC A;  1UE1 A;  1HNX Q;  1PZJ D;  5JVG 3;  1UE7 A;  1HTL D;  5COR A;  2K01 A;  3J81 i;  1ZKO A;  2RDG A;  1PFS A;  4IPC A;  5IIF A;  4YY3 Q;  3T51 B;  1VQJ A;  1NJI C;  3K7A B;  4KJN A;  2RQX A;  1AFP A;  4FVM A;  4LF5 L;  2WKC A;  1NSN S;  3FRP B;  5IY0 A;  3W2D A;  1X55 A;  4PZ6 A;  3S2H H;  3HKZ B;  3BDO A;  3CQZ H;  2VUM H;  1FR3 A;  1UNS A;  2B2Y A;  3U58 A;  3RN2 A;  1G6Z A;  1TWH H;  1VQK A;  2Y0S G;  3MXN A;  4GS3 A;  4IFD J;  4I65 A;  3GTP B;  1MSH A;  2R7Z H;  5I4D A;  4LF7 L;  3IRB A;  1HNZ Q;  4HID A;  1HJP A;  1IBK Q;  3I3C A;  1VS0 A;  1ENA A;  3HZX A;  2G9H D;  1XJV A;  3S1R B;  4IUV A;  1I94 L;  1QUQ B;  2VB2 X;  2D0O A;  2K14 A;  2TSS A;  4RKB A;  4DNT B;  4POF A;  1D5X C;  4OEM B;  5EGT A;  1U5K A;  3O13 A;  1ESF A;  4POG A;  1P16 A;  4CKB A;  4OO1 H;  1ENC A;  1Q90 A;  5K5P A;  1GKH A;  3K7A H;  3ICE A;  5C4Z A;  3I56 A;  1ICW A;  4O2D A;  4RGT A;  3FHW A;  5JJZ A;  2CWA A;  3CCJ A;  4DPG A;  1STN A;  2F0P A;  3CCM A;  2PNR C;  4A3M H;  4MZ9 A;  1PYB A;  4UP9 A;  5CC4 A;  3NTI A;  1CKN B;  4A3I G;  1UE5 A;  2EIF A;  2UUB L;  3KBX A;  2BCO A;  3GTP H;  3J81 c;  3ERO A;  2SEB D;  2DNC A;  4XYQ A;  1PH8 A;  5M3F H;  1A63 A;  2WV6 D;  4A3F B;  1HZA A;  5FLM H;  5IOD A;  5ELB A;  3FKI B;  4CBV A;  2GVB A;  1KXL A;  5C5L A;  2ZXR A;  2A5H A;  2XRQ D;  4LWC A;  2K05 A;  3MXU A;  4KHZ A;  4OGQ C;  3TRE A;  3M7G A;  4A4I A;  4BXX H;  1AH9 A;  4I7A A;  4A3D G;  3GTJ B;  3HOW G;  3H3V C;  4CDD C;  4U68 A;  1RIP A;  5C3E B;  1DD2 A;  5DM7 3;  1PZI D;  3DM1 A;  3BYT B;  2A6H C;  3CXC A;  1EY5 A;  3ULJ A;  1UEA B;  2DY8 A;  1HR0 L;  4UPA A;  3P75 A;  3CCV A;  2K4K A;  4TQU S;  1S72 A;  2JJQ A;  2J7Z A;  4DUZ L;  3BS1 A;  1D7Q A;  1JR0 D;  4L5S A;  2AUJ D;  3GDE A;  2QF7 A;  5FLX E;  4HMI A;  4X3K A;  4FF3 A;  1HPC A;  3DM3 A;  2CH4 A;  1KNE A;  4EX5 A;  4DUY L;  2PYK A;  2B2T C;  5IP9 G;  4DV5 L;  1YVC A;  1G2S A;  1WTO A;  3A54 A;  3E9H A;  4FF2 A;  4DR4 L;  4KTA A;  1TT2 A;  1V1O A;  4IFD G;  4XYO A;  4S3S A;  1X32 A;  1UAP A;  2Z8L A;  3GTJ H;  2KBN A;  3BVZ A;  3GTG B;  5I2Y A;  5C3E H;  1Q1B A;  2YTY A;  3L2P A;  5CV7 A;  3G71 A;  4MNO A;  1LM0 A;  3EFX D;  2Q2H A;  1CM9 A;  3T53 B;  1VQB A;  4KN4 C;  2C35 B;  1ILP A;  1PH5 A;  3HOX G;  2UXC L;  3H0G G;  5IYC H;  1E2Z A;  1H9S B;  1O7Y A;  4ABN A;  2R7D A;  3UDF A;  5ELF A;  2WAQ G;  2JN4 A;  4BBR G;  5ISR A;  3EIV A;  2I0Q A;  1EY4 A;  4C1N I;  1FL0 A;  1E1T A;  2ENB A;  2R93 G;  2OWO A;  3STB C;  2F0O A;  1QWY A;  5G3L D;  4CDE C;  2E2H H;  4DUZ Q;  3R3O A;  1Z9F A;  1L0Y B;  5M5W B;  1CKO A;  4M8A A;  5DLQ E;  1G2T A;  4ULL A;  5GRO A;  3LGJ A;  3CME A;  2JA9 A;  4IFD I;  2F0J A;  3E9I A;  4JI4 L;  4GZY C;  4J8Q A;  1JCK B;  3P20 A;  1WCM G;  5KIX A;  2F4V Q;  4DV5 Q;  4ILW A;  4DV3 L;  2NTS A;  2Q2I A;  4ZKB B;  4V19 0;  2F0M A;  2L15 A;  3SEB A;  2E75 C;  3S9W A;  3EBE A;  1YNJ D;  4MHE A;  4ZAI A;  3SDZ A;  1K73 C;  2F0K A;  4C3H B;  4BY1 G;  5CV4 A;  1PRT B;  2K1B A;  4X66 L;  1YBY A;  5E7N A;  4AQY L;  1VQL A;  4DR6 L;  2NZO A;  4DR2 L;  1VQN A;  1L2F A;  5KEE A;  1DGS A;  4LW1 A;  4X3U A;  2R92 H;  5I9P A;  3H09 A;  4XT3 B;  3GTK H;  1EYC A;  3A5U A;  5JJK A;  1EZ6 A;  1EEI D;  1PFN A;  4DN4 M;  1SAP A;  3X3N A;  1BUV T;  3A5Z B;  4DV6 Q;  5M5W H;  2KCM A;  3VA5 A;  4LAA A;  5J22 A;  4MN3 A;  1IW7 D;  2BDO A;  3HOY G;  1JIC A;  1LV9 A;  2CQA A;  2F0F A;  1WTV A;  4YIJ A;  4OIK A;  5IYB G;  4DV1 L;  2PQA A;  1WFQ A;  2EY5 A;  2FXQ A;  3QOJ A;  1C9O A;  2A68 C;  4DXG A;  1NCV A;  3CMA A;  1GHK A;  3GV3 A;  1HA6 A;  4N8F A;  4C2M H;  4JI4 Q;  1JOO A;  1CI3 M;  5E4X A;  4HCE A;  2F52 A;  2EY2 A;  3CW2 C;  3MXN B;  1G51 A;  1QZG A;  1PYW D;  3I4O A;  3DMU A;  1H9M A;  3SE0 A;  1GUO A;  2VUM G;  3T4A C;  3D0F A;  4LNQ A;  1YJN A;  3PUX A;  4X66 Q;  1YNN D;  2JA8 G;  5FLX L;  2I07 B;  1RKN A;  4DKA C;  1N32 L;  3FMC A;  2ZM6 Q;  2QW7 A;  2PW5 A;  4NDX A;  1BNZ A;  4LF6 L;  3DLL A;  1PRT F;  2EYJ A;  3ERQ A;  5I6W A;  5IT9 c;  2F0I A;  1H95 A;  1WTR A;  1CQV A;  2IW3 A;  3KUP A;  5GAH C;  1E0B A;  1MGS A;  4A3E B;  3FPU B;  1KRS A;  2M2L A;  4X3T A;  1PA6 A;  1OXT A;  1X54 A;  5LMU Q;  1A3T A;  1F9S A;  3I91 A;  1DJR D;  4P73 A;  5AJ3 L;  3K5N A;  3U9O A;  3GTQ B;  1WTQ A;  3S1N H;  1HH2 P;  1VQ7 A;  2WB1 B;  5NUC A;  1A8V A;  4HED A;  1MI2 A;  4YHH Q;  4YWL A;  1BBW A;  2Q2U A;  1BBX C;  1D6E C;  3PUW A;  3VYR A;  1XTC D;  1T5E A;  4PZ7 A;  4DV1 Q;  4N9T A;  4XQJ A;  5C44 B;  1LTB D;  2V1C C;  2J0T D;  4WOR A;  1Q7Y C;  3HKZ G;  2EYH A;  4KKU A;  2MPM A;  1I4Q A;  2Y0S E;  2L1B A;  4ZRZ A;  4NXN Q;  1QVC A;  1HCZ A;  3W1B A;  2ZT9 C;  3LWE A;  4G7O C;  3G48 A;  2UXD Q;  4JI1 L;  2EYF A;  1XWE A;  4YCW A;  1KIX A;  4LMQ D;  3NQI A;  5C4X G;  1TS5 A;  4A3E H;  5EJW A;  4IPH A;  1N32 Q;  1CZG A;  2MJ8 A;  4LF6 Q;  2SNS A;  1S5F D;  3GTQ H;  1VQG A;  2SNM A;  4A93 B;  3E6Z X;  1SJE D;  4QJF A;  2BE5 C;  2X6G A;  4AYB B;  5H1S E;  3JC6 6;  4OO1 I;  1K28 A;  1F2Y A;  2F0E A;  4A75 A;  2AQ2 B;  2OCE A;  4XQQ A;  1I4R A;  5AJ3 Q;  2BH2 A;  3OMC A;  3RN5 A;  3DUZ A;  5C44 H;  3AB9 A;  2EYM A;  1KC8 C;  1GO3 E;  2MUY A;  4RWS C;  4B08 A;  2WFW A;  3M4Q A;  2R7F A;  2OQK A;  5JOB A;  1NNX A;  2JEB I;  3VYT A;  4JI8 L;  5CV6 A;  3BDC A;  4DV0 L;  3GTL H;  4K5X A;  1WOC A;  3NEN A;  4LF9 L;  1T9H A;  3TBI B;  4IUT A;  4DF7 A;  1NBW A;  5T1I A;  4LUO A;  2HQE A;  4JCV E;  2F0N A;  2IWH A;  5C4H A;  3RZD B;  4A3F G;  5CV8 A;  1PMR A;  2WKD A;  3FKI G;  2MHV A;  4R8N A;  1MKH A;  4HCS A;  4BBS B;  4JI1 Q;  1B2T A;  2ZJQ A;  4A76 A;  1TWG B;  3SK4 A;  5KRU A;  4PV1 C;  1D8L A;  1YJ9 A;  5DNF A;  4PZ8 A;  4XT1 B;  3FVQ A;  4JBW A;  1W2B A;  5KND A;  3QWN A;  3CRK C;  3VYU A;  1CFM A;  3MHB A;  1LT3 D;  3QO2 A;  1JT8 A;  3PIP A;  1XNQ Q;  3GV6 A;  3W1G A;  5IWA Q;  5IYC G;  5BR8 Q;  1V43 A;  1XX8 A;  1IKM A;  1HR0 W;  3G6E A;  1JJC B;  3J7A F;  5KYL A;  3OSO A;  1O80 A;  2Q8R E;  1A3V A;  2A19 A;  3S14 B;  2AKW B;  2XTI A;  3MAQ A;  4L6T B;  1VF5 C;  4LF8 Q;  1GXD C;  1PXU A;  4XQN A;  4K5V A;  1OXX K;  1IZ6 A;  2ALY B;  4FP5 D;  2NZH A;  4RAU C;  2X6L A;  5IOC A;  2F3V A;  4O42 A;  1G29 1;  2KHS A;  2KJX A;  3OWE B;  3F8T A;  4L63 B;  4JI8 Q;  3NUC A;  1NTG A;  1U0L A;  3J80 E;  5BN4 A;  1N36 L;  1I4X A;  2JA6 B;  5FO9 B;  1M4V A;  1LTA D;  1BCP B;  1B3A A;  2JEA I;  1HUN A;  1FNV A;  1TWG H;  2NZ1 D;  3TZD A;  4ZYS A;  5IYD H;  3DXJ C;  4RHS A;  3ERS X;  1YIT A;  1EU3 A;  2JA5 B;  1Y14 B;  3UDX A;  3QOL A;  5JEA H;  1U9R A;  3J7Z C;  4KHP L;  2RCN A;  4Z9C B;  3S1Q B;  2B2T A;  4EQP A;  3FPP A;  2UXB Q;  1CQF A;  1ASZ A;  1F9Q A;  2KHJ A;  1H9J A;  2WAQ E;  1A6X A;  1C4Q A;  4K8I A;  5C0X H;  4DR3 L;  4A3J H;  4WJW A;  1VQ9 A;  1P8L A;  3EJI A;  3ZJY C;  4OL7 A;  1Q1E A;  3GP7 A;  2ID0 A;  3OYY A;  4EQ5 A;  1G91 A;  2I46 A;  2B63 G;  4B3T Q;  1RHP A;  1F2L A;  3F1Z A;  3CHB D;  1DXM A;  3CU7 A;  1SNC A;  2PQA B;  3K58 A;  1SYE A;  2F0T A;  1J6Q A;  3OMG A;  5EKL A;  1DZ1 A;  4DV4 L;  3J7A V;  2JA6 H;  1VDZ A;  1TWF B;  5KNB A;  3PIO 3;  2L55 A;  2YU9 B;  4PNY A;  1GM5 A;  3IAY A;  3BVM A;  2K33 A;  2ZXO A;  4C3I H;  3TZU A;  1O7I A;  1B3Q A;  1L1O C;  1TWH B;  3CCS A;  4NW2 A;  1VQ4 A;  4RGO S;  1FNU A;  3LNN A;  2IJ0 A;  1FD7 D;  3P7J A;  1Q12 A;  1MHW C;  3M85 A;  4A3C H;  2LKV A;  4C3H G;  2HHH L;  1XNR L;  2IT1 A;  1E22 A;  1B9N A;  3D8G A;  1Y8P B;  2K6A A;  1BCP F;  2BOS A;  4A3G B;  1JOK A;  3I4M B;  3PCO B;  1PTO C;  2Z1C A;  2F0G A;  4KHP Q;  1EQR A;  3NXW A;  3TS2 A;  1NMG A;  3CP0 A;  1NR4 A;  4QL5 A;  3A7A B;  1HNW L;  4A3L G;  1X3E A;  3T1Y Q;  3B6Y A;  5D14 A;  1HQR D;  2N78 A;  3CCQ A;  1Y1V H;  3S2D B;  1KDA A;  1ZYR D;  1NUC A;  1U4M A;  1WJJ A;  4DR3 Q;  2CW0 C;  5GAE C;  1F9P A;  3R2T A;  3TRZ A;  4JBK A;  2CQO A;  4GKJ Q;  2IPK D;  4BWG B;  4DV2 Q;  3KDF A;  1JWU D;  2XIW A;  1K9M C;  1TWF H;  2YU9 H;  4A3M B;  5DAU A;  1CHQ D;  2LS0 1;  1AE3 A;  1IL2 A;  4TKO B;  2EJM A;  2RSO A;  1Y1W G;  2E74 C;  5HUR A;  2G5D A;  2VNU D;  1DOL A;  1IL8 A;  1K8M A;  4IPG A;  1LUZ A;  3HOU B;  2ZXP A;  4JV5 L;  5COY A;  4QMG A;  2R6G A;  1PTO B;  5M3F B;  2AQ1 B;  2BDN A;  3CC2 A;  4A3G H;  3I4M H;  1VQO A;  4B9X A;  3JAM c;  4DK3 C;  2EY6 A;  2BH8 A;  5IE8 A;  2HHH Q;  1IYJ B;  4EQO A;  1VQD A;  4GLV B;  1V9P A;  4DFA A;  3S2D H;  3I2Z A;  2ES2 A;  4IQZ A;  4CJ0 B;  2L5T A;  5CBE E;  4DNI A;  1RCV D;  3IL8 A;  4BY7 G;  3I73 A;  3UDG A;  2Z6B A;  1J5E Q;  2JE6 I;  3GO5 A;  3TME A;  4RCO A;  3ULP A;  4DK0 A;  4QCL A;  2F03 A;  1U4R A;  1WTX A;  3I70 A;  1SNO A;  1B50 A;  4CDF C;  3J80 L;  3SK8 A;  4UY8 C;  1GHJ A;  3PMF A;  3QG1 A;  4HJA A;  4JYA L;  4LF5 Q;  2H4O A;  4QGU A;  3P1H A;  1Z47 A;  2Q8T A;  1RJT A;  4IUN A;  1SE8 A;  4G7Z C;  1B53 A;  2F0V A;  3HOU H;  5A35 A;  3NEL A;  4ME5 A;  3W3A A;  3KJO A;  1K3B C;  1PTO H;  2GA4 B;  4L5Q A;  3KF8 A;  5JVH 3;  3A74 A;  3HKZ E;  1C7Y A;  3OIP A;  1DM0 B;  4R4I A;  2KCT A;  3HEJ A;  2QCP X;  3CC7 A;  4LF7 Q;  4I7Z C;  2C9O A;  4IAL A;  1UWV A;  3BU2 A;  5IP7 H;  2OF1 A;  1J9O A;  1VQP A;  2F0U A;  1LT6 D;  1I94 Q;  3IKJ A;  1PTO F;  4UP7 A;  2A69 D;  5KGU A;  3CCU A;  4QY7 A;  4F87 A;  2E8G A;  2NN6 H;  1LTR D;  4YCV A;  3K5M A;  3F2B A;  4OIJ A;  2XVS A;  4BA2 I;  3KJP A;  1G8Z D;  1Q8I A;  3U50 C;  3PO2 H;  1M8A A;  4P72 A;  4KJO A;  2F4I A;  1BKB A;  1CHP D;  1VQE A;  4KY7 A;  2LY7 A;  4A93 G;  2K5D A;  2ZJR A;  1KHI A;  3D31 A;  4B3M L;  2E2H B;  1XTD A;  1TS3 A;  1VMP A;  1KLG D;  1F2M A;  5CYU A;  3WWV A;  2UUB Q;  3K81 C;  4R4Q A;  2DNE A;  5A2Q E;  1F9R A;  1HFG A;  2KOL A;  5IGC A;  1YNX A;  4A3K H;  5LHY 1;  1QB5 D;  3HOZ B;  1STB A;  4MTN A;  4RH6 A;  1PH2 A;  2KUM A;  3L7Z C;  4C3J H;  1RF2 D;  3Q22 A;  4IJH A;  1IYU A;  3KFU A;  1PDQ A;  5ELN A;  1ET6 A;  2RCF A;  2WAC A;  5LL6 X;  2DUD A;  3PUY A;  2A73 B;  2RBM A;  5IGG A;  5E3F A;  1EOT A;  5DM6 3;  1LT5 D;  3MC0 B;  3NTK A;  4BBS G;  1HR0 Q;  5M3M B;  3EVQ A;  2KEC A;  3VA7 A;  2WIN B;  3AFQ A;  5D3D A;  2R92 B;  1S5E D;  1S40 A;  1SXT A;  2FFK B;  4RGM A;  3GTK B;  1X3F A;  4B3R L;  1EFI D;  4ZQ3 A;  3PQI A;  3UDI A;  2EQS A;  1W3S A;  2XWB B;  1ZEQ X;  1IBM L;  1V8Q A;  2GN5 A;  3H94 A;  3TP8 A;  4JC0 A;  1UEB A;  3H3V H;  4MTK A;  4DUY Q;  2IY5 B;  1WI5 A;  2N88 A;  2Z6K A;  1NAP A;  3J80 i;  4PMC A;  1K3R A;  1A15 A;  1PRT D;  1I6V C;  3E0J A;  3HOZ H;  5CBA E;  4FXK C;  1GOZ A;  3A56 A;  3MWY W;  3PO3 B;  4DR4 Q;  3NTH A;  2K75 A;  5AFW A;  1EY6 A;  4C2M B;  5CR3 A;  1SBB B;  4R1J A;  1N8R C;  1JE4 A;  1CA5 A;  2GVA A;  4HJ8 A;  5HGQ A;  3IFD A;  3I4N B;  2A6E D;  3CAM A;  3T1H L;  1XXG A;  2N3S A;  1B4O A;  1PVO A;  1G6P A;  3CCL A;  5ELC A;  5M3M H;  1RD9 D;  4A3B B;  4Y7N B;  1QVG A;  2UXC Q;  4JI6 L;  4J15 A;  4NP5 A;  5KNC A;  2HT1 A;  1WD0 A;  2QGQ A;  2JA7 B;  1X3Q A;  2JA5 G;  2JQO A;  4ME3 A;  3SHL A;  4Y52 H;  4FDB A;  4JG2 A;  5C5M A;  4AIM A;  4LFA L;  4JPB W;  2HCI A;  3DHQ A;  4X62 L;  1IW7 C;  3J7Y W;  2OEO A;  1STH A;  5JJI A;  1XYI A;  1HHV A;  1B7Y B;  1SRU A;  4JK1 C;  2IX3 A;  1EZ8 A;  4P71 A;  3V96 A;  3RUZ A;  2NWG A;  1HA5 A;  4JI2 L;  3N6R A;  3PO3 H;  3KDF B;  3S1N B;  2D5D A;  3NK9 A;  2ICE C;  2LSS A;  4GKK L;  3CRL C;  3E3X A;  1YJW A;  1B1Z A;  3F2C A;  3SK5 A;  1CZW A;  5FK9 C;  3NEM A;  3C46 A;  4RG1 A;  4DV3 Q;  3I4N H;  1VQC A;  4H13 C;  2RDF A;  3E5S A;  1E2V A;  4G4K A;  1VQA A;  1ASY A;  4KMU C;  1OTC A;  1X6O A;  1O78 A;  1YNN C;  3J81 E;  2Y0S B;  4A3B H;  2B29 A;  5FJ8 H;  4Y7N H;  1FGB D;  1GJX A;  1K0S A;  4DR7 L;  4AQY Q;  3T1H Q;  2F0Q A;  1W6J A;  3QIA A;  2JA7 H;  4DR6 Q;  4H02 A;  3K5O A;  4DR2 Q;  1KAW A;  4J6H A;  5M5Y B;  2R7Z G;  1XPU A;  4QB4 A;  2UU9 L;  2L0C A;  3NE5 B;  4L5T A;  3TS0 A;  4XXE A;  5EBD A;  3HOV H;  2Q8I B;  1PZK D;  4QIW E;  3CD6 A;  3VR2 A;  3MTS A;  1KRT A;  3AMU A;  2H5X A;  1E7Z A;  1LTI D;  5A2Q L;  2B8G A;  1STA A;  3GTO H;  5TSS A;  4LFC L;  2TMP A;  1ONL A;  4KKT A;  1L1O A;  1D5Z C;  2YTV A;  4OO1 G;  4K5W A;  4LUZ A;  3TEH B;  5K36 H;  1GUG A;  4O0A A;  2VQE L;  3OTO L;  1EEF D;  2CHB D;  3HGB A;  3L9A X;  5F2D A;  4OWW B;  4GNX C;  1A0I A;  2AUK A;  2KHI A;  4OON A;  3S15 H;  4KI0 A;  5ELD A;  3S24 A;  3EQL C;  4DAM A;  4A3I B;  3D6C A;  4A3M G;  5ELO A;  2QEJ C;  2A8V A;  3KLS X;  3K8A A;  2G9D A;  3I90 A;  3KF8 B;  4HIM A;  4DA2 A;  3GTL B;  5M5Y H;  1K83 B;  4RCN A;  2PMZ E;  1Y8O B;  1S5B D;  2K5H A;  3A8I E;  4WJ4 A;  5M3F G;  4OX9 L;  4HJ5 A;  1AE2 A;  3DWA A;  1JOR A;  3PUV A;  2K50 A;  5FLM G;  1TR5 A;  3X3M A;  4IN3 A;  3HOW B;  1YEZ A;  1Q46 A;  4NXM L;  3DEP A;  2HIV A;  3E0E A;  4BXX G;  1HUM A;  2UU9 Q;  4R4T A;  2PZT A;  5L37 A;  1QUQ A;  2JSO A;  3M7N A;  3WDN A;  2K5V A;  1TU2 B;  3VYS A;  4ZKC B;  4DNR B;  4GN4 B;  4BA1 I;  2DGY A;  1M1K C;  4ODG A;  3ONA B;  2PNH A;  5HY6 A;  3FP9 A;  1I6H B;  2Z9H A;  4LFC Q;  1O7Z A;  1SNP A;  1DCZ A;  4A3I H;  3AYH B;  3M4Y A;  3PF5 A;  3L0O A;  3N52 A;  3D4D A;  2VQE Q;  5EKI A;  1N34 L;  3OTO Q;  4HR7 B;  4CKC A;  1K8G A;  1TY0 A;  1RTO A;  4ZCK A;  1K83 H;  1SNQ A;  1SR3 A;  2B2U C;  4HSV A;  2J4X A;  3TSS A;  4IPD A;  1SYC A;  1LT4 D;  4DR5 L;  3RNU A;  2UUC L;  1EIH A;  2Z6K C;  4A3D H;  4K6L A;  3HOW H;  3J81 j;  1QIL A;  3OIQ A;  4FF1 A;  2OQ0 A;  1JOQ A;  1D2B A;  1PH1 A;  1E24 A;  1MJE A;  3NPP A;  1EY8 A;  2F3I A;  3D3R A;  1GUW A;  4HJ7 A;  2I5M X;  5C3E G;  3AU7 A;  2D62 A;  3MXP A;  4JBM A;  4P74 A;  4R9W A;  2C5C A;  3H0G B;  4NXM Q;  1VQF A;  1KAA A;  1SLJ A;  5CV9 A;  2NN6 I;  4XDX A;  4ALP A;  4GOP A;  3CCE A;  1I6H H;  2L11 A;  2WAQ B;  1X3P A;  3A0J A;  1EYA A;  4BBR B;  1BF4 A;  3FEW X;  3C3L A;  1WTH A;  4A3J B;  3K57 A;  2O2L D;  2E2I B;  5ELE A;  2R93 B;  1YHA A;  3TP7 A;  1PFB A;  1B8A A;  3J81 L;  4K14 A;  2Z4I A;  5IP9 H;  4FXD A;  3DEO A;  5KYI A;  4HJ9 A;  1BCP D;  2OT2 A;  3SGI A;  2BA0 A;  2O4X A;  5I6Y A;  5EAY A;  3I7F A;  2KEE A;  4IFD H;  2IX1 A;  1C8C A;  2MFI A;  2MO1 A;  1I50 B;  1A62 A;  1WCM B;  3KF6 A;  4DV0 Q;  5FO8 B;  4AH6 A;  4LF9 Q;  1STG A;  3DWQ A;  2B39 A;  2OTJ A;  1CT1 D;  3OPO A;  2K03 A;  1YIJ A;  3EA6 A;  1GD7 A;  5EPL A;  1MSG A;  4C3I B;  3HOZ G;  1EY9 A;  4ZLT F;  2E76 C;  4L5R C;  1JQY D;  2NVX B;  3H0G H;  1AZQ A;  3KBG A;  5GQO A;  1LTS D;  4WRD A;  1HZ9 A;  3CF5 A;  4OWT B;  2UUA L;  4LUV A;  2EOT A;  2QEX A;  2JXM B;  4BBR H;  2FIN B;  5JPN C;  4IOA A;  1EWI A;  1I4G A;  1XPR A;  1XMQ L;  4R8I A;  1EOV A;  4UP8 A;  5C3X A;  2E2I H;  2R93 H;  3PIO A;  1OXS C;  5J39 A;  1ROD A;  5M3M G;  4K0K L;  1GUN A;  4RFB A;  1PH4 A;  1SYG A;  5IT9 E;  2XRS D;  2R92 G;  1XMO L;  5FLX c;  2O5J C;  1Y1V B;  2AWO A;  2P5Z X;  1SSO A;  2K28 A;  2MGS A;  4CJ2 C;  2NUC A;  2F0L A;  1BVS A;  1AEX A;  5I2X A;  1I50 H;  1WCM H;  5FO7 B;  4LJZ C;  1FYC A;  4YY3 L;  3H3V I;  3HOY B;  4ZK9 B;  2I5H A;  3Q23 A;  3MA2 B;  4P2C B;  2EDG A;  3H15 A;  1BR9 A;  4DR1 L;  2XWJ B;  3PO3 G;  4BY1 H;  1CUK A;  1QNK A;  1YZ6 A;  1S4Z A;  4PMW A;  3ZYY X;  1N36 Q;  1EU4 A;  3NWT A;  2NVX H;  3V2T A;  3U9S A;  2EY1 A;  1Y69 U;  3W5O A;  1SYF A;  1X56 A;  3F2U A;  1UE6 A;  5C4J B;  1II3 A;  4LK1 C;  4J1M A;  1HNZ L;  1QJO A;  1TXY A;  4X65 L;  3RMH A;  1IBK L;  3WOF A;  2JA8 B;  5CMD A;  4JI7 L;  2F3W A;  1RDP D;  1RL2 A;  2D2C C;  3H6M A;  1SMY D;  3TDQ A;  1UUP A;  4ZUI A;  1S3O A;  3VR6 A;  1CSP A;  2F0W A;  4DK1 A;  3OW7 A;  3PF4 A;  1SND A;  4IZ8 A;  3HOY H;  2CVR A;  1L1O B;  1SNM A;  1WYD A;  5M5X B;  5IYB H;  3IFT A;  1EL0 A;  4UAI A;  1STY A;  1VQM A;  3AQQ A;  1PTO D;  2ZTE A;  2NTT A;  3UE0 A;  3UE1 A;  2VQF L;  1QVF A;  3PSI A;  5DEH A;  3NWS A;  2R61 A;  1IHZ A;  1N9W A;  2A74 C;  4JW0 A;  1HRJ A;  1CTM A;  1QE6 A;  4DK6 C;  1AN8 A;  4DV4 Q;  1Q3L A;  1O7L A;  5IGF A;  1HZC A;  4K2K A;  2CW0 D;  5K36 G;  1E2W A;  3MXG A;  2LMC B;  1BDO A;  5C4J H;  3A8J E;  4X6A H;  1MIU A;  1IXR A;  2CWP A;  4PG3 A;  4DR1 Q;  2O5I C;  2ZTC A;  4KY6 A;  2V4D A;  4FNF A;  1ET9 A;  4K2L A;  2EXZ A;  2FMC A;  4FO2 A;  2JA8 H;  1XNR Q;  3GQB A;  1EFW A;  3CKI B;  4DAY A;  3OW2 A;  1JWS D;  4JVZ A;  4CGY B;  3LWU A;  3C1F A;  1RTN A;  2NBF A;  3PV0 A;  1WTW A;  5C4X B;  4X65 Q;  1WD1 A;  3OHX C;  2LXJ A;  4JI7 Q;  5C6A A;  2E5L L;  3QR8 A;  3G4S A;  5IGE A;  1HNW Q;  4A3E G;  3VR5 A;  3AFP A;  5M5X H;  1E1O A;  4IUP A;  5E1F A;  1D5M C;  3RZO B;  2IHE A;  4DV7 L;  1IKL A;  1Z6H A;  2HDL A;  5JEA J;  3PO2 B;  4APV A;  2WB1 G;  1XPO A;  3DWP A;  2Z4H A;  3URY A;  1JMC A;  5C0X J;  4GOP C;  1DYQ A;  2VQF Q;  4LFB L;  3HG9 A;  4X64 L;  1W6K A;  1Q82 C;  1LTT D;  5C44 G;  4IJL A;  4JOI A;  4FF4 A;  4TSS A;  4U67 3;  4JV5 Q;  4A3K B;  1I5F A;  4NB3 A;  5BN5 A;  1VQH A;  2L4N A;  3K0X A;  1KLU D;  1HZB A;  2A69 C;  5IT9 L;  5C4X H;  2B2W A;  2RA4 A;  2QDB A;  3NP8 A;  4C3J B;  4IUR A;  4NKL A;  4TVA B;  2DJF C;  2F0H A;  1OXV A;  3S17 B;  1PV4 A;  3S1R H;  3K6O A;  4EGV A;  1SE4 A;  3KYH C;  3U4V A;  5LMN W;  1ENF A;  4GNX A;  1A2T A;  4OHJ A;  3RZO H;  5JJL A;  1GUS A;  1QOH A;  1IYV A;  2E2J B;  4LF4 L;  1JE5 A;  4GOP B;  3MFY A;  2E5L Q;  1S5D D;  4FXG C;  4RA8 A;  2NVY B;  4AYB G;  2RVL A;  2A6H D;  3FDT A;  2NVT B;  2AWN A;  3ND9 A;  2EE1 A;  4DV7 Q;  1CA6 A;  4GN3 B;  4P75 A;  5CV5 A;  1VQI A;  2B2V C;  3BJU A;  1X65 A;  4KV6 A;  2ZJP A;  4JYA Q;  1NMF A;  1IBL L;  5HGT A;  3K0Y A;  5FKA C;  5FOB B;  1L0X B;  1LLR D;  4OXP A;  4QQB X;  1HQM C;  1KDB A;  3BZC A;  2OTL A;  4F8M A;  5D3I B;  1BBU A;  2QKI C;  3KLR A;  4LFB Q;  4X64 Q;  3KF6 B;  1ICF B;  2ICI A;  2XNA C;  2F4V L;  2IL8 A;  1H9K A;  3RD4 A;  5GAG C;  2IHF A;  4A3F H;  3S17 H;  3MVV A;  3U4Z A;  3FKI H;  5EQ0 A;  1JJ2 A;  1VQ6 A;  5I9O A;  2PI2 E;  3ITP A;  1SDF A;  1TII D;  4IUU A;  4KN7 C;  4XIG S;  2QDL A;  5E4W C;  3Q8D A;  2WII B;  1EY7 A;  4JI5 L;  4C1N K;  2DN8 A;  2E2J H;  5IGD A;  1YHB A;  3R93 A;  3I4L A;  5IYD G;  1Z7T A;  1LYL A;  1FGU A;  2NVY H;  4O1N A;  1ESR A;  3GD7 A;  2NVT H;  2VZA A;  3A8K E;  2B2U A;  1VF7 A;  5JEA G;  1EYD A;  2HUG A;  5LL6 S;  4HIK A;  1V1P A;  3TP6 A;  4K6D A;  4LF4 Q;  1EQQ A;  4V0B A;  4B3S L;  4KD4 A;  4DV6 L;  1PRT C;  3G6J B;  5EBC A;  3F2D A;  4B3M Q;  3CC4 A;  2FJ2 A;  5C3W A;  5C0X G;  4A3J G;  4DAV A;  4GN5 A;  3CCR A;  4Q0F A;  2B63 B;  4R4C A;  1YNJ C;  2X69 A;  2L9H A;  3T13 A;  1K8A C;  3STB D;  1IBL Q;  3S16 B;  2D0P A;  2A6E C;  2M00 A;  5GAD C;  3J7A 5;  1VQ5 A;  4KKS A;  2RHQ B;  1AP0 A;  1PH9 A;  4KHV A;  2YTX A;  3K80 C;  1PH7 A;  1TQO A;  2WP8 J;  1EQV A;  2JA6 G;  3GTG H;  1HTP A;  1NE3 A;  3NBH A;  3HRZ C;  3ND8 A;  3CPF A;  4G57 A;  1TWA B;  2SOB A;  1Q81 C;  1TY2 A;  3BZK A;  2L12 A;  3Q6S A;  2EVB A;  4CHT B;  1EQT A;  4C3I G;  2K5N A;  4F88 A;  2AQ3 B;  2VXW A;  2JP1 A;  3WOE A;  1I3Q B;  1TVX A;  4B9W A;  2PZW A;  1STE A;  3JAM E;  4JI5 Q;  1TWC B;  2ZM6 L;  4A3C G;  2VS1 A;  1S5C D;  4RMF A;  2B2Y C;  1LTL A;  4QIW B;  3C2P A;  3HOV B;  2QIL A;  4HSP A;  4ID6 A;  5EPK A;  4DAP A;  3AEV A;  2NVQ B;  1A3U A;  3HFZ B;  4B3R Q;  1U4L A;  5C0X I;  1KL9 A;  3PUZ A;  5LMU L;  1X3G A;  1IBM Q;  1Y8N B;  2B63 H;  3GTO B;  1JWM D;  2R3Z A;  4KK7 A;  3OWF A;  4B3S Q;  3S16 H;  1B44 D;  1Y1V G;  3Q24 A;  3EN2 A;  2EJF C;  1DOK A;  4H0L C;  3C1E A;  1I4H A;  4YHH L;  1SRO A;  4OEL B;  4X3S A;  3SK6 A;  4RHR A;  3BYY B;  2QA4 A;  2SDF A;  4QUF A;  1A2U A;  3D4W A;  3I55 A;  5BN3 A;  1B9M A;  3PGZ A;  3S15 B;  2PPB C;  3J80 c;  4EQN A;  2K04 A;  1K0R A;  5CGK A;  1Y1W B;  3I8Z A;  1TWA H;  2KQ3 A;  4QUC A;  1C0A A;  4CKE A;  1SYB A;  1GUT A;  3HS0 C;  1YI2 A;  2A68 D;  1BOS A;  3NHH A;  4C3H H;  4E6I A;  3D6W A;  2PMZ B;  2F0S A;  1I3Q H;  4NXN L;  1SE2 A;  2M9V A;  4F7X A;  2A1A A;  3HP3 A;  1I4P A;  1TWC H;  1EIY B;  4EVO A;  5G3L F;  4DAY B;  5D65 A;  4IUQ A;  4KLK A;  2UXD L;  4JOI C;  2PQE A;  1AW7 A;  1QZH A;  2PZU A;  4JI6 Q;  3T16 A;  2NVQ H;  1JJG A;  3RR5 A;  4C56 C;  1TKW B;  3I4M G;  4A3G G;  4A3L H;  2FMM A;  2DJG C;  1R9T B;  1F77 A;  1NR2 A;  2VB3 X;  4LFA Q;  3TQY A;  4X62 Q;  4N8X 1;  2B2W C;  4BY7 B;  1KQS A;  1GVP A;  3V05 A;  4M1U B;  5J3B A;  2AMC B;  1PH3 A;  2XN9 C;  1TS2 A;  1ILQ A;  3NBI A;  2K5Q A;  4RKL A;  3ER0 A;  4JI2 Q;  3TN2 A;  1HXY D;  4CDC C;  3MEH A;  1E3P A;  4GKK Q;  1QCB D;  1Q8K A;  4OWX B;  4MIU A;  1Y1W H;  2YYZ A;  2MP1 A;  1SFO B;  1K8O A;  3A55 A;  3BG3 A;  1LAB A;  1X9N A;  2EYL A;  3BVG A;  1HFN A;  2EJG C;  5LMN L;  1EWH A;  1LO5 D;  1JB7 A;  3HOU G;  1PHJ A;  2EYP A;  2BA1 A;  2IX0 A;  3KK7 A;  1OXU A;  1F2Z A;  3QJY A;  4DR7 Q;  4WJ3 M;  3TP5 A;  2MNA A;  4A3D B;  3NQT A;  1R4Q B;  3R2I A;  1R9T H;  4HAE A;  4TRD A;  2FHT A;  2N55 A;  3CPW A;  2KED A;  4BY7 H;  2PO4 A;  1KTK A;  1QG7 A;  2KA7 A;  2AHO B;  4GNX B;  2ASB A;  5IP7 G;  2Q2T A;  3KOJ A;  3R8B A;  1J8I A;  2NN6 G;  4KD3 A;  1AZP A;  4ZUJ A;  1VCI A;  1D1I A;  3RLF A;  1XNQ L;  1SFO H;  3NSW A;  2WB1 E;  1FVI A;  2CH4 W;  5IGB A;  5IWA L;  5BR8 L;  3PO2 G;  4NPS A;  2XGT A;  4GLA C;  5T1G A;  3MZ5 A;  2HD3 A;  2BE5 D;  3K5L A;  1CKN A;  1VQ8 A;  2JYO A;  2K5W A;  4LF8 L;  3M4P A;  4DGZ A;  3QB3 A;  2HCC A;  3JAM L;  2CCZ A;  1MJC A;  3GTM B;  2D9U A;  3M4O B;  2RKS A;  5LMN Q;  1FNW A;  2RDH A;  2B8F A;  3T56 B;  4FYD A;  2LFN A;  4PMB A;  2CKZ B;  3I72 A;  4A3K G;  1Q86 C;  4YCU A;  3MFG A;  4OX9 Q;  2Z0S A;  1LTG D;  3M3Y B;  3K59 A;  2PI2 A;  2EPB A;  3HOX B;  4C3J G;  2JK8 A;  4GLX A;  1N33 L;  2HQL A;  3SXH A;  4NMZ A;  1C48 A;  1KDC A;  1CK1 A;  2VY3 A;  3H91 A;  4HIO A;  1LAC A;  2F1M A;  2KCC A;  1EY0 A;  1L0W A;  1PH6 A;  1MBY A;  1VMC A;  3K7U C;  3VR3 A;  1QNU A;  3D4R A;  1YHQ A;  1SMX A;  4A93 H;  2UXB L;  2RHS B;  2K32 A;  1SJH D;  3RLO A;  3L3O C;  3BDL A;  1V1P B;  4AYB E;  1BCP C;  4JI3 L;  4UHV A;  3A7L A;  1BO0 A;  3HKS A;  2EZV A;  2MQH A;  2EXD A;  2N49 A;  2HDM A;  1EUJ A;  5JPM C;  2N8N A;  4PQX A;  4XTC S;  2VL6 A;  1DON A;  1CSQ A;  1PYS B;  1N34 Q;  4CJ1 B;  2KVM A;  4WFN 3;  1PFM A;  3KLS A;  4B3T L;  4RGN A;  2CFM A;  4JBJ A;  2NYZ D;  1PLF A;  3GTM H;  3M4O H;  1NY4 A;  2PW7 A;  1JC7 A;  1D1K A;  4JI0 L;  2HIX A;  3KLW A;  4DR5 Q;  3ULL A;  2UUC Q;  1BXT A;  1JB3 A;  3M3Y H;  3S1M B;  1FJG L;  4BY1 B;  1CKM A;  3HOX H;  1SEB D;  4N9P A;  3RLN A;  3PIP 3;  1TS4 A;  2PCF B;  1OO9 B;  3NBH B;  4QF4 A;  3BZD B;  3RZD H;  5M9O A;  2DY7 A;  3M9B A;  4L8J A;  5JAV A;  4DU9 A;  1SN8 A;  2B2V A;  1U4P A;  4BBS H; 
#chains in the Genus database with same CATH homology
 4H7B A;  1BQQ T;  3SVM A;  4UDU C;  3G7L A;  4DXF A;  1H9R A;  1H9S A;  1R4P B;  3Q0A A;  1SE3 A;  1EIG A;  3LX0 A;  1KNA A;  2KCN A;  5EKK A;  1ML0 D;  4HN7 A;  2RSN A;  5J1Z A;  4H44 C;  2E2D C;  4HMJ A;  2EYO A;  1WTP A;  4KY5 A;  1SYD A;  4Q5V A;  1T5X D;  1KAB A;  1MD2 D;  4G7H C;  3UI2 A;  2F0D A;  1DOM A;  1WVL A;  3S2H B;  3CQZ B;  2VUM B;  3SR1 A;  1ZXT A;  1SMY C;  1ZYR C;  4BS9 A;  3VR4 A;  2R7Z B;  2OXP A;  2XSC A;  4K8J A;  5EPJ A;  4HTH A;  2NB0 A;  3OOC A;  2H1E A;  2K7V A;  1EWC A;  1PZJ D;  5JVG 3;  1HTL D;  5COR A;  2K01 A;  1ZKO A;  2RDG A;  5IIF A;  3T51 B;  3K7A B;  4KJN A;  2RQX A;  1AFP A;  4FVM A;  2WKC A;  1NSN S;  3FRP B;  3W2D A;  3HKZ B;  3BDO A;  1FR3 A;  1UNS A;  2B2Y A;  1G6Z A;  3MXN A;  4IFD J;  4I65 A;  3GTP B;  1MSH A;  5I4D A;  3I3C A;  3HZX A;  1ENA A;  2G9H D;  3S1R B;  4IUV A;  2VB2 X;  2TSS A;  4RKB A;  4DNT B;  1D5X C;  5EGT A;  3O13 A;  1ESF A;  4CKB A;  4OO1 H;  1ENC A;  1Q90 A;  5K5P A;  5C4Z A;  1ICW A;  4RGT A;  5JJZ A;  1STN A;  2F0P A;  2PNR C;  5CC4 A;  3NTI A;  3KBX A;  2BCO A;  3ERO A;  2SEB D;  2DNC A;  4XYQ A;  2WV6 D;  4A3F B;  5IOD A;  5ELB A;  3FKI B;  4CBV A;  5C5L A;  2ZXR A;  2A5H A;  2XRQ D;  2K05 A;  3MXU A;  4KHZ A;  4OGQ C;  3M7G A;  3GTJ B;  3H3V C;  4U68 A;  5C3E B;  1DD2 A;  5DM7 3;  1PZI D;  3DM1 A;  3BYT B;  2A6H C;  1EY5 A;  1UEA B;  2DY8 A;  3P75 A;  4TQU S;  2J7Z A;  3BS1 A;  1JR0 D;  2AUJ D;  2QF7 A;  5FLX E;  4HMI A;  4X3K A;  4FF3 A;  1HPC A;  1KNE A;  2PYK A;  2B2T C;  1G2S A;  1WTO A;  3A54 A;  4FF2 A;  4KTA A;  1TT2 A;  1V1O A;  4IFD G;  4XYO A;  4S3S A;  1X32 A;  1UAP A;  2Z8L A;  3BVZ A;  3GTG B;  5I2Y A;  1Q1B A;  5CV7 A;  3EFX D;  1CM9 A;  3T53 B;  4KN4 C;  1ILP A;  1E2Z A;  1H9S B;  1O7Y A;  4ABN A;  5ELF A;  5ISR A;  1EY4 A;  4C1N I;  2ENB A;  2F0O A;  1QWY A;  5G3L D;  3R3O A;  1L0Y B;  5M5W B;  1G2T A;  4M8A A;  4ULL A;  4IFD I;  2F0J A;  4GZY C;  4J8Q A;  1JCK B;  3P20 A;  5KIX A;  4ILW A;  2NTS A;  4ZKB B;  4V19 0;  2F0M A;  3SEB A;  2E75 C;  3S9W A;  1YNJ D;  4MHE A;  4ZAI A;  3SDZ A;  2F0K A;  4C3H B;  5CV4 A;  1PRT B;  2K1B A;  5KEE A;  4X3U A;  5I9P A;  3H09 A;  4XT3 B;  1EYC A;  1EZ6 A;  1EEI D;  1PFN A;  4DN4 M;  1SAP A;  3X3N A;  1BUV T;  3VA5 A;  4LAA A;  5J22 A;  4MN3 A;  1IW7 D;  2BDO A;  1JIC A;  1LV9 A;  2CQA A;  2F0F A;  1WTV A;  4YIJ A;  4OIK A;  2EY5 A;  3QOJ A;  2A68 C;  4DXG A;  1NCV A;  1GHK A;  3GV3 A;  1HA6 A;  1JOO A;  1CI3 M;  5E4X A;  4HCE A;  2EY2 A;  1PYW D;  3DMU A;  1H9M A;  3SE0 A;  1GUO A;  3T4A C;  3PUX A;  1YNN D;  5FLX L;  2I07 B;  1RKN A;  3FMC A;  4NDX A;  2PW5 A;  1BNZ A;  1PRT F;  2EYJ A;  3ERQ A;  5I6W A;  2F0I A;  1WTR A;  1CQV A;  2IW3 A;  3KUP A;  1E0B A;  1MGS A;  4A3E B;  3FPU B;  2M2L A;  4X3T A;  1OXT A;  1A3T A;  1F9S A;  3I91 A;  1DJR D;  3K5N A;  3U9O A;  3GTQ B;  1WTQ A;  2WB1 B;  5NUC A;  4HED A;  1MI2 A;  1BBX C;  1D6E C;  3PUW A;  3VYR A;  1XTC D;  1T5E A;  4N9T A;  4XQJ A;  5C44 B;  1LTB D;  4WOR A;  2J0T D;  2EYH A;  4KKU A;  2MPM A;  1I4Q A;  2L1B A;  4ZRZ A;  1HCZ A;  2ZT9 C;  3LWE A;  4G7O C;  2EYF A;  1XWE A;  4LMQ D;  3NQI A;  1TS5 A;  5EJW A;  1CZG A;  2MJ8 A;  2SNS A;  1S5F D;  2SNM A;  4A93 B;  3E6Z X;  1SJE D;  2BE5 C;  2X6G A;  4AYB B;  4OO1 I;  1F2Y A;  2F0E A;  2AQ2 B;  4XQQ A;  1I4R A;  3OMC A;  3DUZ A;  3AB9 A;  2EYM A;  4RWS C;  2MUY A;  4B08 A;  5JOB A;  2JEB I;  3VYT A;  5CV6 A;  3BDC A;  4K5X A;  3TBI B;  4IUT A;  4DF7 A;  5T1I A;  2HQE A;  2F0N A;  2IWH A;  5C4H A;  3RZD B;  5CV8 A;  1PMR A;  2WKD A;  2MHV A;  4R8N A;  4HCS A;  4BBS B;  1B2T A;  1TWG B;  3SK4 A;  5KRU A;  4PV1 C;  5DNF A;  4XT1 B;  3FVQ A;  4JBW A;  5KND A;  3QWN A;  3CRK C;  3VYU A;  1CFM A;  3MHB A;  1LT3 D;  3QO2 A;  3GV6 A;  1V43 A;  1XX8 A;  1IKM A;  3J7A F;  5KYL A;  3OSO A;  1O80 A;  2Q8R E;  1A3V A;  3S14 B;  3MAQ A;  4L6T B;  1VF5 C;  1GXD C;  1PXU A;  4XQN A;  4K5V A;  1OXX K;  4FP5 D;  4RAU C;  2X6L A;  5IOC A;  2F3V A;  4O42 A;  1G29 1;  2KHS A;  2KJX A;  3OWE B;  4L63 B;  3NUC A;  3J80 E;  5BN4 A;  1I4X A;  2JA6 B;  5FO9 B;  1M4V A;  1LTA D;  1BCP B;  1B3A A;  2JEA I;  1HUN A;  1FNV A;  2NZ1 D;  3TZD A;  4ZYS A;  3DXJ C;  4RHS A;  1EU3 A;  2JA5 B;  3QOL A;  5JEA H;  1U9R A;  4Z9C B;  3S1Q B;  2B2T A;  4EQP A;  3FPP A;  1CQF A;  1F9Q A;  1H9J A;  1A6X A;  1C4Q A;  4K8I A;  5C0X H;  4WJW A;  3EJI A;  4OL7 A;  1Q1E A;  3GP7 A;  2ID0 A;  1G91 A;  2I46 A;  1RHP A;  1F2L A;  3CHB D;  1DXM A;  3CU7 A;  1SNC A;  3K58 A;  1SYE A;  2F0T A;  3OMG A;  5EKL A;  1DZ1 A;  3J7A V;  1VDZ A;  1TWF B;  5KNB A;  3PIO 3;  2L55 A;  2YU9 B;  4PNY A;  3IAY A;  3BVM A;  2K33 A;  2ZXO A;  3TZU A;  1TWH B;  4NW2 A;  4RGO S;  1FNU A;  3LNN A;  2IJ0 A;  1FD7 D;  3P7J A;  1Q12 A;  3M85 A;  2LKV A;  4C3H G;  2IT1 A;  1B9N A;  3D8G A;  1Y8P B;  2K6A A;  1BCP F;  2BOS A;  4A3G B;  1JOK A;  3I4M B;  1PTO C;  2Z1C A;  2F0G A;  3NXW A;  1NR4 A;  3A7A B;  5D14 A;  1HQR D;  3S2D B;  1KDA A;  1ZYR D;  1NUC A;  1U4M A;  2CW0 C;  1F9P A;  3R2T A;  2IPK D;  4BWG B;  1JWU D;  2XIW A;  4A3M B;  5DAU A;  1CHQ D;  2LS0 1;  4TKO B;  2EJM A;  2RSO A;  2E74 C;  5HUR A;  2VNU D;  1DOL A;  1IL8 A;  1K8M A;  3HOU B;  2ZXP A;  5COY A;  4QMG A;  2R6G A;  1PTO B;  5M3F B;  2AQ1 B;  2BDN A;  4B9X A;  2EY6 A;  4EQO A;  4DFA A;  4IQZ A;  4CJ0 B;  2L5T A;  5CBE E;  1RCV D;  3IL8 A;  3I73 A;  2JE6 I;  3GO5 A;  3TME A;  4RCO A;  4DK0 A;  4QCL A;  2F03 A;  1U4R A;  1WTX A;  3I70 A;  1SNO A;  1B50 A;  3J80 L;  3SK8 A;  1GHJ A;  3PMF A;  3QG1 A;  2H4O A;  3P1H A;  1Z47 A;  2Q8T A;  1RJT A;  4IUN A;  4G7Z C;  1B53 A;  2F0V A;  5A35 A;  4ME5 A;  3W3A A;  2GA4 B;  1PTO H;  3KF8 A;  5JVH 3;  3OIP A;  1DM0 B;  3HEJ A;  2QCP X;  4I7Z C;  2C9O A;  4IAL A;  2OF1 A;  1J9O A;  2F0U A;  1LT6 D;  3IKJ A;  1PTO F;  2A69 D;  5KGU A;  4F87 A;  2NN6 H;  1LTR D;  3K5M A;  4OIJ A;  2XVS A;  4BA2 I;  1G8Z D;  1Q8I A;  1M8A A;  4KJO A;  2F4I A;  1CHP D;  4KY7 A;  2LY7 A;  2K5D A;  3D31 A;  2E2H B;  1TS3 A;  1VMP A;  1KLG D;  1F2M A;  5CYU A;  2DNE A;  5A2Q E;  1F9R A;  1HFG A;  2KOL A;  5IGC A;  5LHY 1;  1QB5 D;  3HOZ B;  1STB A;  4RH6 A;  2KUM A;  3L7Z C;  1RF2 D;  3Q22 A;  1IYU A;  1PDQ A;  1ET6 A;  2WAC A;  5LL6 X;  3PUY A;  2A73 B;  2RBM A;  5IGG A;  5E3F A;  1EOT A;  5DM6 3;  1LT5 D;  3MC0 B;  3NTK A;  5M3M B;  3EVQ A;  2KEC A;  3VA7 A;  2WIN B;  5D3D A;  2R92 B;  1S5E D;  1SXT A;  2FFK B;  4RGM A;  3GTK B;  1EFI D;  4ZQ3 A;  2XWB B;  1ZEQ X;  1V8Q A;  3H94 A;  3TP8 A;  2N88 A;  1NAP A;  4PMC A;  1A15 A;  1PRT D;  1I6V C;  3E0J A;  5CBA E;  4FXK C;  1GOZ A;  3A56 A;  3MWY W;  3PO3 B;  3NTH A;  5AFW A;  1EY6 A;  4C2M B;  5CR3 A;  1SBB B;  1JE4 A;  1CA5 A;  3IFD A;  3I4N B;  2A6E D;  1XXG A;  1B4O A;  5ELC A;  1RD9 D;  4A3B B;  4Y7N B;  4NP5 A;  5KNC A;  1WD0 A;  2JA7 B;  1X3Q A;  3SHL A;  5C5M A;  2HCI A;  3DHQ A;  3J7Y W;  1IW7 C;  2OEO A;  1STH A;  1XYI A;  1HHV A;  4JK1 C;  2IX3 A;  1EZ8 A;  3V96 A;  3RUZ A;  2NWG A;  1HA5 A;  3N6R A;  3S1N B;  2D5D A;  3NK9 A;  2ICE C;  3CRL C;  1B1Z A;  3SK5 A;  1CZW A;  5FK9 C;  3C46 A;  4H13 C;  2RDF A;  3E5S A;  1E2V A;  4G4K A;  4KMU C;  1O78 A;  1YNN C;  3J81 E;  2Y0S B;  1FGB D;  1GJX A;  2F0Q A;  1W6J A;  3QIA A;  5M5Y B;  3K5O A;  4J6H A;  4QB4 A;  2L0C A;  3NE5 B;  4XXE A;  5EBD A;  2Q8I B;  1PZK D;  3VR2 A;  3MTS A;  3AMU A;  1LTI D;  5A2Q L;  2B8G A;  1STA A;  5TSS A;  2TMP A;  1ONL A;  4KKT A;  1D5Z C;  4OO1 G;  4K5W A;  5K36 H;  1GUG A;  1EEF D;  2CHB D;  3HGB A;  3L9A X;  5F2D A;  2AUK A;  4KI0 A;  5ELD A;  4A3I B;  3EQL C;  3D6C A;  2QEJ C;  3KLS X;  2G9D A;  3I90 A;  4DA2 A;  3GTL B;  1K83 B;  4RCN A;  1Y8O B;  1S5B D;  3A8I E;  3DWA A;  1JOR A;  3PUV A;  1TR5 A;  3X3M A;  4IN3 A;  3HOW B;  3DEP A;  1HUM A;  2PZT A;  2JSO A;  3M7N A;  3WDN A;  3VYS A;  1TU2 B;  4ZKC B;  4DNR B;  4BA1 I;  4ODG A;  3ONA B;  1I6H B;  1O7Z A;  1SNP A;  1DCZ A;  3M4Y A;  3N52 A;  3D4D A;  5EKI A;  4HR7 B;  4CKC A;  1TY0 A;  1RTO A;  1SNQ A;  2B2U C;  4HSV A;  2J4X A;  3TSS A;  1SYC A;  1LT4 D;  1EIH A;  4K6L A;  1QIL A;  3OIQ A;  4FF1 A;  1JOQ A;  1D2B A;  3NPP A;  1EY8 A;  3D3R A;  1GUW A;  3AU7 A;  2D62 A;  3MXP A;  4R9W A;  2C5C A;  3H0G B;  1KAA A;  5CV9 A;  2NN6 I;  4XDX A;  2L11 A;  2WAQ B;  1X3P A;  1EYA A;  4BBR B;  1BF4 A;  3FEW X;  3C3L A;  4A3J B;  3K57 A;  2O2L D;  2E2I B;  5ELE A;  2R93 B;  3TP7 A;  1PFB A;  3J81 L;  4K14 A;  2Z4I A;  4FXD A;  3DEO A;  5KYI A;  1BCP D;  2OT2 A;  2BA0 A;  2O4X A;  5I6Y A;  2KEE A;  4IFD H;  2IX1 A;  1C8C A;  1I50 B;  1WCM B;  5FO8 B;  1STG A;  3DWQ A;  2B39 A;  1CT1 D;  3OPO A;  2K03 A;  3EA6 A;  5EPL A;  4C3I B;  1MSG A;  1EY9 A;  4ZLT F;  2E76 C;  1JQY D;  2NVX B;  1AZQ A;  3KBG A;  1LTS D;  4WRD A;  2EOT A;  2JXM B;  2FIN B;  5JPN C;  1I4G A;  4R8I A;  5C3X A;  1OXS C;  5J39 A;  1ROD A;  1GUN A;  4RFB A;  1SYG A;  5IT9 E;  2XRS D;  2O5J C;  1Y1V B;  2AWO A;  1SSO A;  2K28 A;  2MGS A;  4CJ2 C;  2NUC A;  2F0L A;  1AEX A;  5I2X A;  5FO7 B;  4LJZ C;  1FYC A;  3HOY B;  4ZK9 B;  3Q23 A;  3MA2 B;  4P2C B;  2EDG A;  1BR9 A;  2XWJ B;  3ZYY X;  1QNK A;  4PMW A;  1S4Z A;  1EU4 A;  3NWT A;  3V2T A;  3U9S A;  2EY1 A;  1Y69 U;  1SYF A;  3F2U A;  5C4J B;  1II3 A;  4LK1 C;  4J1M A;  1QJO A;  3RMH A;  3WOF A;  2JA8 B;  5CMD A;  2F3W A;  1RDP D;  2D2C C;  3H6M A;  1SMY D;  3TDQ A;  1UUP A;  4ZUI A;  3VR6 A;  2F0W A;  4DK1 A;  3OW7 A;  1SND A;  4IZ8 A;  2CVR A;  1SNM A;  5M5X B;  3IFT A;  1EL0 A;  4UAI A;  1STY A;  1PTO D;  2NTT A;  5DEH A;  3NWS A;  2R61 A;  1IHZ A;  2A74 C;  1HRJ A;  1CTM A;  1QE6 A;  1AN8 A;  1Q3L A;  1O7L A;  5IGF A;  4K2K A;  2CW0 D;  5K36 G;  1E2W A;  2LMC B;  1BDO A;  3MXG A;  3A8J E;  2O5I C;  4KY6 A;  2V4D A;  4FNF A;  1ET9 A;  4K2L A;  2EXZ A;  2FMC A;  4FO2 A;  3GQB A;  3CKI B;  4DAY A;  1JWS D;  4CGY B;  3LWU A;  3C1F A;  1RTN A;  2NBF A;  3PV0 A;  1WTW A;  5C4X B;  1WD1 A;  3OHX C;  5C6A A;  5IGE A;  3VR5 A;  4IUP A;  5E1F A;  1D5M C;  3RZO B;  1IKL A;  1Z6H A;  2HDL A;  5JEA J;  3PO2 B;  3DWP A;  2Z4H A;  3URY A;  5C0X J;  1DYQ A;  3HG9 A;  1W6K A;  1LTT D;  4FF4 A;  4TSS A;  4U67 3;  4A3K B;  5BN5 A;  2L4N A;  1KLU D;  2A69 C;  5IT9 L;  2B2W A;  2RA4 A;  2QDB A;  3NP8 A;  4C3J B;  4IUR A;  4NKL A;  2F0H A;  1OXV A;  3S17 B;  3K6O A;  4EGV A;  1SE4 A;  1ENF A;  1A2T A;  4OHJ A;  1GUS A;  1QOH A;  1IYV A;  2E2J B;  3MFY A;  1S5D D;  4FXG C;  4RA8 A;  2NVY B;  2RVL A;  2A6H D;  3FDT A;  2NVT B;  2AWN A;  3ND9 A;  2EE1 A;  1CA6 A;  5CV5 A;  2B2V C;  4KV6 A;  5HGT A;  3K0Y A;  5FKA C;  5FOB B;  1L0X B;  1LLR D;  1HQM C;  1KDB A;  4F8M A;  5D3I B;  2QKI C;  3KLR A;  2ICI A;  2XNA C;  2IL8 A;  1H9K A;  3RD4 A;  3MVV A;  5EQ0 A;  5I9O A;  3ITP A;  1SDF A;  1TII D;  4IUU A;  4KN7 C;  4XIG S;  5E4W C;  2WII B;  1EY7 A;  4C1N K;  2DN8 A;  5IGD A;  3R93 A;  3I4L A;  1Z7T A;  4O1N A;  1ESR A;  3GD7 A;  3A8K E;  2B2U A;  1VF7 A;  5JEA G;  1EYD A;  2HUG A;  5LL6 S;  1V1P A;  3TP6 A;  4K6D A;  4V0B A;  4KD4 A;  1PRT C;  3G6J B;  5EBC A;  2FJ2 A;  5C3W A;  5C0X G;  4DAV A;  4Q0F A;  2B63 B;  1YNJ C;  2X69 A;  2L9H A;  3T13 A;  3S16 B;  2A6E C;  2M00 A;  4KKS A;  1AP0 A;  4KHV A;  1TQO A;  2WP8 J;  1EQV A;  1HTP A;  3NBH A;  3HRZ C;  3ND8 A;  4G57 A;  1TWA B;  2SOB A;  1TY2 A;  3Q6S A;  2L12 A;  2EVB A;  4CHT B;  1EQT A;  4C3I G;  4F88 A;  2AQ3 B;  2VXW A;  2JP1 A;  3WOE A;  1I3Q B;  1TVX A;  4B9W A;  2PZW A;  1STE A;  3JAM E;  1TWC B;  1S5C D;  2B2Y C;  4QIW B;  3C2P A;  3HOV B;  2QIL A;  5EPK A;  4HSP A;  4ID6 A;  4DAP A;  2NVQ B;  1A3U A;  1U4L A;  5C0X I;  3PUZ A;  1Y8N B;  3GTO B;  1JWM D;  2R3Z A;  4KK7 A;  3OWF A;  1B44 D;  3Q24 A;  2EJF C;  1DOK A;  4H0L C;  3C1E A;  1I4H A;  4X3S A;  3SK6 A;  4RHR A;  3BYY B;  2SDF A;  4QUF A;  1A2U A;  3D4W A;  5BN3 A;  1B9M A;  3S15 B;  2PPB C;  4EQN A;  2K04 A;  5CGK A;  1Y1W B;  3I8Z A;  2KQ3 A;  4QUC A;  4CKE A;  1SYB A;  1GUT A;  3HS0 C;  2A68 D;  1BOS A;  3NHH A;  4E6I A;  3D6W A;  2PMZ B;  2F0S A;  1SE2 A;  2M9V A;  4F7X A;  3HP3 A;  1I4P A;  4EVO A;  5G3L F;  5D65 A;  4IUQ A;  2PQE A;  1AW7 A;  2PZU A;  3T16 A;  4C56 C;  1TKW B;  2FMM A;  1R9T B;  1F77 A;  1NR2 A;  2VB3 X;  2B2W C;  4BY7 B;  3V05 A;  4M1U B;  2XN9 C;  1TS2 A;  1ILQ A;  3NBI A;  2K5Q A;  4RKL A;  3TN2 A;  1HXY D;  3MEH A;  1QCB D;  4MIU A;  2YYZ A;  2MP1 A;  1SFO B;  1K8O A;  3A55 A;  3BG3 A;  1LAB A;  2EYL A;  3BVG A;  1HFN A;  2EJG C;  1EWH A;  1LO5 D;  2EYP A;  2BA1 A;  2IX0 A;  3KK7 A;  1OXU A;  1F2Z A;  3QJY A;  3TP5 A;  4A3D B;  3NQT A;  1R4Q B;  3R2I A;  4HAE A;  4TRD A;  2FHT A;  2N55 A;  2KED A;  2PO4 A;  1KTK A;  1QG7 A;  2KA7 A;  3R8B A;  1J8I A;  2NN6 G;  4KD3 A;  1AZP A;  4ZUJ A;  1VCI A;  1D1I A;  3RLF A;  3NSW A;  5IGB A;  5T1G A;  3MZ5 A;  2BE5 D;  3K5L A;  2JYO A;  2K5W A;  4DGZ A;  3QB3 A;  2HCC A;  3JAM L;  3GTM B;  2D9U A;  3M4O B;  2RKS A;  1FNW A;  2RDH A;  2B8F A;  3T56 B;  4FYD A;  2LFN A;  4PMB A;  3I72 A;  3MFG A;  1LTG D;  3M3Y B;  3K59 A;  2EPB A;  3HOX B;  4C3J G;  3SXH A;  4NMZ A;  1C48 A;  1KDC A;  1CK1 A;  3H91 A;  1LAC A;  2F1M A;  2KCC A;  1EY0 A;  1MBY A;  1VMC A;  3VR3 A;  1QNU A;  3D4R A;  2K32 A;  1SJH D;  3L3O C;  3BDL A;  1V1P B;  1BCP C;  3A7L A;  1BO0 A;  2EZV A;  2HDM A;  5JPM C;  4PQX A;  4XTC S;  1DON A;  4CJ1 B;  2KVM A;  4WFN 3;  1PFM A;  3KLS A;  4RGN A;  2NYZ D;  1PLF A;  2PW7 A;  1JC7 A;  1D1K A;  1BXT A;  1JB3 A;  3S1M B;  4BY1 B;  1SEB D;  4N9P A;  3PIP 3;  1TS4 A;  2PCF B;  1OO9 B;  4QF4 A;  3BZD B;  5M9O A;  2DY7 A;  4L8J A;  5JAV A;  4DU9 A;  2B2V A;  1U4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...