2SDFA

Solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
67
structure length
67
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL CELL-DERIVED FACTOR-1
publication title Solution structure and basis for functional activity of stromal cell-derived factor-1; dissociation of CXCR4 activation from binding and inhibition of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 7
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1998-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sdfA00
1F9QA 5EPKA 1CA6A 1NR4A 2K04A 1PFBA 5D65A 1EQTA 1MSGA 4HEDA 4OIKA 5CBEE 1GUWA 1VMCA 2L4NA 2K1BA 4CJ2C 1ICWA 2KECA 3QO2A 1Q3LA 2CVRA 2KEEA 3I91A 3R93A 1QG7A 2RSOA 3FPUB 5CMDA 3SVMA 1EOTA 4ZK9B 2DY7A 1TVXA 2L12A 1U4LA 2NWGA 2MJ8A 1WTQA 1BNZA 1RTNA 2RA4A 3I90A 5AFWA 3KBXA 1EL0A 1MI2A 1NCVA 2HCCA 1QNKA 2J7ZA 2EOTA 2N88A 3IFDA 4QUCA 4CJ0B 1J9OA 1LV9A 1B4OA 2EPBA 2Q8RE 3LWEA 2K01A 3P7JA 2KOLA 4UAIA 4QUFA 1XYIA 1IKLA 1JICA 1G2TA 1F9SA 2K28A 1O7ZA 2KVMA 3I3CA 1B53A 2B2YA 4X3SA 3KUPA 5E4WC 2BDNA 1BO0A 1M8AA 1U4PA 2B2TA 1KNEA 5D14A 1B50A 2RVLA 2FFKB 2FINB 4O42A 1O80A 5T1IA 2X6GA 4U68A 1WTOA 3TN2A 4HCSA 3MWYW 2JP1A 4IUVA 1HUMA 4LMQD 4MHEA 5EKIA 1SSOA 3IL8A 2FMMA 1HFGA 1F9RA 1DOLA 1VMPA 4ZKBB 1NAPA 2B2VA 5EJWA 1G2SA 5T1GA 1O7YA 2HDMA 1G91A 1RODA 1B3AA 1SDFA 2D9UA 1NR2A 1A15A 2B2YC 3DEPA 4IUUA 1F2LA 1WTXA 3UI2A 1WTPA 3H91A 1IL8A 4HAEA 2B2TC 1CM9A 4R8IA 1EIGA 4OIJA 4X3KA 1AZQA 1JE4A 2X69A 2FJ2A 2EE1A 4MN3A 2KEDA 2MGSA 5EPJA 2MP1A 1PFNA 4X3UA 4RA8A 1WVLA 1BBXC 2R3ZA 5DNFA 5EPLA 1X3PA 3GV3A 1AZPA 1B2TA 2B2VC 1MSHA 1MGSA 4X3TA 4ZLTF 1PLFA 3FDTA 5E4XA 3TZDA 1DONA 1X32A 2B2WA 4ZKCB 2FHTA 2H1EA 1F9PA 1ML0D 1U4MA 5CORA 1C8CA 4XDXA 2IL8A 2VXWA 4RWSC 1PFMA 3N52A 1SAPA 4CJ1B 2L11A 2X6LA 3ONAB 1EIHA 5CBAE 2M2LA 4IURA 5COYA 1ZXTA 3G7LA 1WTVA 1BF4A 5EQ0A 1X3QA 4IUQA 2JYOA 2SDFA 1S4ZA 2NYZD 2B2WC 1ESRA 2B2UA 2DY8A 1G6ZA 2K05A 4R9WA 3DEOA 1IKMA 1AP0A 1PDQA 1J8IA 2XIWA 1RJTA 1HHVA 1DOMA 2MPMA 1ILQA 3I8ZA 1E0BA 2NZ1D 2HCIA 4RAUC 1HUNA 2KUMA 1WD0A 1RHPA 3F2UA 1QE6A 1WTRA 1WTWA 3Q6SA 2HDLA 4IUPA 1CA5A 3D6WA 3MTSA 2B2UC 4XT1B 2L1BA 1DOKA 1ILPA 4ZAIA 1WD1A 3HP3A 1U4RA 2N55A 1HRJA 1HA6A 2RSNA 1RTOA 1XX8A 3DM1A 4DN4M 2HUGA 1DZ1A 3GV6A 4IUTA 4NW2A 4HSVA 4XT3B 2Q8TA 1HFNA 5JJZA 1KNAA 2K03A 2L9HA
chains in the Genus database with same CATH superfamily
4HIKA 3GTJB 2OXPA 3CMAA 2AQ3B 3VYTA 1BDOA 3KK7A 3IAYA 3UE0A 1V1PB 5C3WA 2AKWB 4YHHL 1KHIA 2LXKA 5KNDA 3JAMi 3JAMc 4Y52H 1W2BA 2HHHQ 4B3RQ 5AFWA 3IFDA 4A3MH 2EYHA 3SK8A 1JJ2A 4A3DG 1ONLA 3P7JA 3BVGA 2K5VA 3GTGH 1NBWA 2K28A 5ELDA 4KI0A 5C4XG 3PQIA 2A6ED 1VQ9A 1MBYA 2ZTDA 1M8AA 3LX0A 2CWPA 2VL6A 3A0JA 3GP7A 4O2DA 5GAEC 2GN5A 4JC0A 4OELB 2JA5B 3DLLA 1OTCA 4JI4Q 1H9JA 1STHA 3H94A 2HDMA 3EN2A 1YIJA 2Q2TA 1A15A 4J1MA 3ERSX 1VQ4A 3GTPH 3X3MA 3PCOB 4IQZA 5IT9L 3PO2H 1EZ6A 2K75A 4A3JH 1WVLA 1S5ED 3MXPA 2R92B 1BCPD 4JBJA 2E2HB 1D7QA 3FDTA 3NXWA 1PH3A 4LNQA 1SNQA 2H1EA 3H15A 1SROA 2EIFA 3MC0B 1JCKB 3N52A 4DXGA 4NPSA 4GKJL 2JEAI 1X65A 1I4QA 3KF6B 2Z4HA 3HOYG 5LHY1 2A8VA 3C1FA 2K5WA 4A3LH 5GAHC 3FKIG 1SNCA 3T53B 1EEFD 4BBRH 5J3BA 2QF7A 1HPCA 4PZ7A 5ELFA 3S15B 1XXGA 3VA5A 2ZXOA 4DUYQ 5IT9E 1Y1WG 4XXEA 1STBA 4DR2L 2XTIA 4CKCA 5I4DA 1ILPA 4A3KB 3T13A 2LS01 1EIFA 1J5EQ 3ICEA 4OO1I 1CA6A 2BCOA 4BBSH 4XTCS 4CGYB 1SE8A 5EKKA 1TWCB 1JWMD 4IPHA 2NZOA 2H5XA 4GOPC 5H1SE 5C0XI 1NJIC 4L5TA 3R93A 5KNBA 4DNTB 3DM3A 3LNNA 2DUDA 3NSWA 3P75A 2L12A 5M5XB 4JOIC 1SYFA 3VR3A 3PO3G 2HCCA 1QZGA 2EOTA 4HCEA 3D8GA 1HQRD 2RQXA 3ULLA 3TMEA 3I4OA 3VR5A 2PMZE 4QUFA 1VQ8A 1JJGA 1Y1VB 1TWFB 2F0KA 2JA8H 5E3FA 1BO0A 1U4PA 5L37A 1SNMA 2PI2A 4K6DA 3QOJA 1VQJA 2FFKB 3TQYA 2LY7A 2NBFA 4IUVA 5IGGA 3K0YA 5EKIA 1QVCA 1EYDA 4LUOA 4BXXG 3N6RA 3S17B 3W5OA 3A7AB 1PVOA 1G2SA 1UE6A 1JT8A 3VYSA 2RHQB 3J80c 2B2TC 1CM9A 3STBD 5IY0A 2AUKA 4DK0A 1B9MA 1PTOC 2F0MA 1HZBA 5IGEA 5CV6A 2CKZB 5ELNA 4LF9L 1XNRQ 3ULPA 1TS4A 1VQ6A 3UDIA 2ENBA 2NTSA 1XMOL 4L5SA 3HOWG 4MIUA 3A56A 4KHPQ 3NTKA 1L0XB 2JN4A 2QDBA 4M1UB 1EIHA 3Q23A 2M2LA 4ZYSA 1WTVA 3OMGA 1GJXA 3DMUA 2VQFL 1D1KA 1K0RA 1ET6A 4G7OC 4DV7L 3U50C 1SNOA 1PDQA 2CQOA 1RIPA 2XWJB 2VQEQ 3GTLB 4KV6A 1V43A 1X6OA 2K4KA 4JG2A 3EQLC 2A68D 3IKJA 1L0YB 1LTRD 3LGJA 3HP3A 2RSNA 3GV6A 4IUTA 1D5XC 5JJZA 1KNAA 1KLUD 2K03A 4JI8L 3HG9A 5G3LF 5ISRA 2PI2E 5D65A 1CUKA 1Q46A 2CH4A 5M3MH 4A3DB 2JA7H 1Z47A 4CBVA 5M3FH 3GTOH 2OCEA 4HN7A 1NNXA 3D4WA 2F0TA 4DR4L 3KDFA 1IBML 5IE8A 1PH1A 3CC7A 1KD1C 3FPUB 3UDXA 4FXDA 4G4KA 3NWTA 1PRTC 2F0SA 3BZDB 1GUNA 3KBXA 1EL0A 2BH2A 4IFDI 5JJKA 4JI2Q 2NVQH 1NUCA 4AIMA 2I07B 2KJXA 5K36H 3RZDH 4RGOS 4RCOA 5DEHA 3PIP3 2O4XA 2F1MA 1DYQA 4K5WA 3D4DA 3PO2G 3O13A 4A3JG 1I50H 2MQHA 4FP5D 1R9TB 1I3QH 5T1IA 2B29A 1X3EA 3G4SA 5IODA 1CT1D 1NAPA 1CQFA 4JPBW 3OMCA 1K28A 2FMCA 4TKOB 1PH2A 4N8X1 3BZCA 5C5MA 4UPAA 4F88A 1ZYRC 3TDQA 1VQPA 3NUCA 1AN8A 4TVAB 3HOYB 2F0JA 2MHVA 3JAML 4KK7A 4A3IH 5M9OA 1IZ6A 5EPLA 3CRLC 1S5BD 5JAVA 4OEMB 4OO1H 2ES2A 4ILWA 2B8GA 1STEA 5CORA 2ICEC 4MZ9A 2HHHL 4B3RL 3HOVG 4RKLA 1Y1WB 1XTDA 4X65Q 2HIXA 2NVXB 1S3OA 3OHXC 4HTHA 5C0XH 4NXMQ 4A93H 1I5FA 4DU9A 1J6QA 2HQLA 2AHOB 2NYZD 2B2WC 4JYAQ 1STGA 3S1QH 1A3UA 4NXNQ 1FGUA 4FDBA 2MPMA 1CKNB 5FJ8G 4BBSG 4B9XA 4DGZA 4JI4L 4DV4Q 3J7ZC 2WKDA 3E9HA 1DOKA 2JK8A 4YCUA 2BE5C 5J22A 2I5MX 3J7AF 1DZ1A 5AJ3L 3TRZA 3RD4A 1VQAA 3AB9A 4XT3B 4Q5VA 4DR6L 3PO3B 2H4OA 4PZ6A 2L55A 1VCIA 5JEAH 1K8AC 4RH6A 4C2MH 5FOBB 1GUWA 3C3LA 3HOZH 1SMYD 3SK5A 1K73C 1Q7YC 3HEJA 4WJ4A 1H9MA 2JA8G 1VQBA 4QCLA 4CKBA 1HNXL 2CW0C 2KBNA 2MO0A 2JA9A 1EQVA 2YU9B 1JOQA 3HRZC 2ZM6Q 4ZCKA 1KQSA 3U58A 2NVYH 2E2IB 3S1RB 4DPGA 1WCMG 2M9VA 2Z6KC 1HR0W 4KHVA 2KA7A 4DUYL 2PQEA 1YHQA 3RZOH 5JVG3 1EY4A 3Q24A 2RVLA 3A8JE 3E3XA 3J81j 3K59A 4B3SQ 2JEBI 3NWSA 4A3BB 3IL8A 3SR1A 3CXCA 4RGMA 3E5SA 4U673 4DAYB 3PMFA 3I4NB 1AZQA 2OTJA 1SNDA 2EE1A 1V1QA 2HIVA 4Y7NB 1D6EC 4A4IA 5DNFA 2XNAC 4KJOA 1ET9A 5CR3A 1LT6D 3H0GB 3CCVA 4DAVA 1G51A 1U4MA 5C4JB 4ULLA 4BY1B 1SAPA 3CCUA 4YCVA 4DR2Q 2RCNA 4H44C 3P20A 1TS5A 1MIUA 4IUQA 2MUYA 2QEXA 4E6IA 4L63B 1TR5A 2BA1A 2PMZB 4IFDH 2XIWA 2EZVA 1FD7D 1T5XD 4P71A 3T1YL 4A3GH 3PSIA 3J80L 1Y8NB 2JA7G 3I4MH 1B70B 1STNA 1DJRD 1STAA 1R4QB 4C3JB 1SFOB 2NTTA 5JOBA 1PZID 3CCQA 5I2YA 3ND9A 1TXYA 3MEHA 2QDLA 2D0PA 1K83H 3ER0A 4KJNA 2JA6H 1QNUA 3EROA 1A2TA 1KTKA 1Q8KA 3KF8A 3E6ZX 4KHPL 5FO8B 1PZJD 4XQJA 1XNQQ 2K5QA 4G57A 3OW7A 2EY1A 1KAAA 3J80E 2A74C 4BY7B 1SE3A 5M5YH 3K80C 2F0HA 1CZGA 4LJZC 4L6TB 2P5ZX 1OXXK 1N36Q 4ZQ3A 1I94L 2VQEL 3E0JA 2EYLA 2C35B 4G7ZC 3CMEA 1MD2D 1YNJC 2K5HA 5IP9H 2WB1E 3GDEA 1LTBD 2YTYA 3OYYA 1LACA 1Q81C 1VQMA 1XMOQ 1X3FA 3DEPA 3HOVB 1K8OA 3J7YW 5LMUL 4RGTA 3H3VC 2K7VA 5C0XG 4HAEA 1VF5C 1EIGA 1A8VA 4A93G 3HGBA 1KDAA 3CPFA 2MGSA 3FRPB 3PIOA 4P74A 3QOLA 1PYSB 3KJPA 2R3ZA 1H9RA 3NK9A 1X3PA 3MA2B 1MSHA 1MGSA 1E3PA 3K7AH 2F0FA 2AMCB 3TSSA 1C7YA 3S1NB 2L11A 2X6LA 3MZ5A 3RLFA 4IURA 4JI2L 2LMCB 1HR0Q 3G71A 1E1OA 3SHLA 4JI0Q 4S3SA 3WOFA 1AH9A 1LTLA 2Z1CA 4IALA 3S1MH 4DK1A 3FMCA 1EY5A 4JI8Q 2JXMB 1TY2A 5JEAG 1C48A 4FXKC 2KUMA 4JI5Q 1SYDA 3HOZG 4HJ8A 2A5HA 3NE5B 5ELBA 2KCMA 4A3CH 1CKOA 3A7LA 1A63A 2R6GA 4C3IH 5EKLA 4DV3Q 1Z9FA 4POFA 5GQOA 1MSGA 1EWIA 5CBEE 1WCMB 2PO4A 2A69D 3V96A 2WB1G 4ZUJA 1SJED 4BA2I 2F0GA 1HZCA 1N34Q 1CSPA 3L7ZC 2DY7A 3NPPA 3X3NA 4CJ0B 4QUCA 1IW7D 4JYAL 2TMPA 4JI7L 1B4OA 4NXNL 5C44B 1VQFA 4QB4A 3F2CA 4PG3A 4IO9A 2F0WA 4K2LA 3KDFB 4J6HA 2BA0A 2KHIA 1KNEA 3D31A 3HOXH 4DR3L 2N78A 1PTOD 3GD7A 4DV4L 1WTOA 4X64L 4DK6C 4HCSA 4MHEA 5GROA 2K32A 2XN9C 1VQLA 1I6VC 1F9RA 2M00A 1A3TA 1EFID 1Y69U 1YI2A 5EJWA 5T1GA 1O7YA 3VR4A 1D2BA 1WTPA 1WTXA 2ASBA 1ICFB 3I56A 4R8IA 1L2FA 5IYDH 1LT5D 3M4YA 5IGDA 4BA1I 4DAYA 2KEDA 4R8NA 4PV1C 2NVTH 4KD3A 2NZHA 4KD4A 3M3YH 1Y8OB 3GV3A 1B2TA 4IFDG 3QWNA 2EQSA 1GUGA 3BU2A 4FF1A 3OWEB 1MKHA 2Z8LA 3I4MG 4IOAA 1VQNA 3T1HL 3HZXA 2ZM6L 3OIQA 1T9HA 2F52A 1XPUA 1AFPA 2K5NA 5M5WH 1BQQT 2A6HC 5DM63 1PTOH 3Q0AA 2DN8A 1EWHA 5AJ3Q 3CC2A 4A76A 3GTKB 4DR6Q 3URYA 3CCJA 1K8MA 4B3SL 3A55A 4HJ5A 2N3SA 2NVQB 1BVSA 1QE6A 3QR8A 1TQOA 2B63G 2F4VL 5E1FA 3HOUH 3QIAA 3D6WA 3KJOA 3E0EA 1GVPA 3KLSA 1I50B 4ZAIA 2UXDQ 2N55A 5FKAC 1HNXQ 4IPGA 4OHJA 1V9PA 1P16A 4V190 4J15A 5K5PA 4GLAC 1SE4A 1F9QA 3EVQA 2GVBA 2DGYA 3M9BA 4HEDA 1UEAB 1FJGQ 3FPPA 3WDNA 5IYBH 2CVRA 3RR5A 1A62A 3I91A 4DAMA 4DF7A 1U4LA 1PH5A 2QILA 1MI2A 2E75C 1JE5A 1K0SA 3DHQA 5FLMG 4OGQC 1XJVA 1IKLA 2AUJD 1PH8A 1F9SA 4UHVA 1GHJA 3FHWA 2RBMA 2WFWA 3S2HB 3WOEA 2OQKA 2RCFA 3S16B 2SOBA 2R7DA 5LMNW 4K8IA 5C4HA 3CKIB 4U68A 2F0IA 4GZYC 1C0AA 1SSOA 1TWGH 4WRDA 3ULJA 4JI1L 1GOZA 1IL8A 1WJJA 4C3HG 2VUMG 4LWCA 1KDBA 5E7NA 1JE4A 1I4GA 2E2DC 1IXRA 1BBXC 3G6JB 2WIIB 2ZXRA 2JJQA 4DKAC 2R7ZB 4C1NI 3MXNB 3OPOA 2QGQA 3J81E 4POGA 1XNQL 1DONA 2FHTA 2I5HA 3T1YQ 1KRTA 4C2MB 2F0PA 2IL8A 1YNNC 4JCVE 4KLKA 3GTQH 1LABA 5IP7H 3Q22A 2K33A 1KC8C 3K5OA 4A3CG 3SE0A 4F7XA 1N36L 3J80i 1BBUA 2B2UA 1H9SA 1IKMA 1A3VA 3OOCA 1QWYA 1XPRA 4QF4A 3PV0A 2PNRC 1E0BA 4I7AA 1JWUD 2F0DA 1TWHB 5F2DA 3CCLA 1WTWA 4A3EB 2WB1B 4N9TA 1I4XA 3TP7A 5C5LA 4FF4A 2UXBL 1O78A 1VS0A 5CV9A 2IHEA 5J1ZA 4PMCA 4GKKL 2CW0D 1BBWA 1QOHA 5IYCH 5DAUA 2MNAA 1EU3A 3H6MA 3S14H 1KL9A 1EQTA 2BDOA 2D0OA 2VB2X 3CC4A 3GTMB 1VMCA 1HCZA 1TWAB 1I94Q 1H9KA 2R93H 3QO2A 4A3FH 3DWQA 1CSQA 1HZAA 4KKTA 3H3VI 3HOXG 1PZKD 3M4OB 1I4RA 3TZUA 1SNPA 1HR0L 2MO1A 1Q12A 3AU7A 3GTJH 1HA5A 1BNZA 1RTNA 4LW1A 3I90A 4JI0L 1QNKA 2A6EC 2ZTEA 1E2ZA 2PW7A 2XGTA 2WACA 1JR0D 3LWEA 4QL5A 2O5IC 5LMUQ 5I6YA 2E76C 4A3MG 2EY6A 5IYDG 1E1TA 2KVMA 3SGIA 4JI5L 4GS3A 3KF8B 2XSCA 5D14A 2G5DA 5C4XB 2SNMA 4R1JA 2FMMA 3R3OA 2F0NA 2B2VA 3U4ZA 4DV3L 2MFIA 4QGUA 2I5LX 2Y0SE 1WI5A 4QQBX 1I6HB 1RCVD 4X3KA 3RN5A 3TEHB 1L1OA 1MJCA 4P2CB 2JA5H 2EYOA 1SMXA 2UUAL 3OTOQ 3TS0A 2L5TA 4MTNA 1AE3A 1N34L 4ZKCB 1ENCA 2RHSB 1VQGA 4XDXA 2LKVA 1CZWA 4CJ1B 3HOUG 2B63B 2F0VA 2R92H 3NP8A 3CRKC 5COYA 3G7LA 3S2DB 2EJFC 2FXQA 5CV8A 2V4DA 4B9WA 2OTLA 5I9PA 4GNXB 2K05A 3DEOA 3W3AA 2SNSA 4A3LG 1LT4D 1WOCA 1SN8A 2GA4B 3FKIB 1M4VA 1QVFA 3F1ZA 1UE5A 4BBRG 3S9WA 2PYKA 5CYUA 2F4IA 4WORA 1YNXA 4P72A 3PUWA 1JMCA 3FEWX 3C2PA 4FF3A 1WD1A 2XWBB 3BG3A 1CKMA 2BH8A 2D62A 1K3BC 2YV5A 3UDGA 2EXDA 1DGSA 3HKZG 1LT3D 1SJHD 4JI7Q 4WFN3 4JI3Q 2L4NA 4JVZA 4A3KH 5C0XJ 4YCWA 1QUQB 5BN3A 1IYJB 1KDCA 2RSOA 1EOTA 4DR3Q 1TVXA 2Y0SG 4UP7A 4X64Q 1UNSA 3SEBA 2Q2HA 5KYIA 1EIYB 2NN6I 1S72A 2N88A 2RDFA 1TWCH 2UUBL 1FGBD 1J9OA 3NEMA 1YJWA 2Q8RE 2K01A 3T4AC 1C4QA 1G2TA 2UUCQ 4C3HB 1UWVA 3I72A 4CDFC 4H02A 2VUMB 1LLRD 2A73B 2QW7A 3I3CA 3QB3A 3F2BA 4L5RC 4XYQA 3OW2A 2B2YA 4X3SA 2GVAA 5E4WC 1EFWA 1SBBB 1EY6A 4PMWA 3KOJA 3CCRA 3EJIA 1IBKL 3STBC 2UXDL 4DV6Q 1EY0A 3UDFA 2IX3A 2HT1A 4HMIA 2OWOA 5JEAJ 1FNUA 3V2TA 1TWFH 3T1HQ 5IP7G 3V05A 2KQ3A 2C5CA 3PUXA 5DM73 4IPDA 4YWKA 4KHZA 3CF5A 4OWWB 1FJGL 1EWCA 4RA8A 3ND8A 2K5DA 3RN2A 1X55A 3I73A 3GO5A 4ZLTF 2IT1A 1S40A 3J7AV 1G291 2CFMA 3D6CA 3MXNA 3PIPA 3AEVA 1B44D 2F4VQ 3H3VH 4FF2A 1PH9A 1ENFA 3HOWB 3D3RA 1D5ZC 4HR7B 3A5UA 4WJ3M 4CDCC 5GAGC 1UE1A 1S4ZA 1Z6HA 4YIJA 1ESFA 2YYZA 4OWTB 5IYCG 4IOCA 1RJTA 1I4PA 4APVA 1BCPF 1C9OA 5JJIA 1VF7A 1HUNA 1WD0A 1RHPA 3F2UA 2PZWA 1SXTA 4J8QA 1PMRA 3VYUA 2R93G 3G6EA 3L0OA 1GXDC 4K5VA 4A3FG 5J39A 1U0LA 1LTSD 1QILA 2XRSD 2F0OA 4LFAQ 4LF4L 1VQEA 4DN4M 4TSSA 1EU4A 2HUGA 3GTLH 3CAMA 4B3TQ 1D8LA 4DUZL 3BVMA 3CCEA 4DA2A 5IGBA 2Z9HA 2Z6BA 2JQOA 4CJ2C 1LTAD 4A3MB 5M3MG 1K8GA 3CQZH 3GTGB 3J81i 5M3FG 3J81c 2QCPX 2MJ8A 1WTQA 4JW0A 4HMJA 4A3DH 4IFDJ 1NCVA 4RMFA 3QJYA 4OX9L 3G48A 3RNUA 2J0TD 2Z4IA 1B7YB 3BYYB 4QIWE 3U4VA 2CH4W 4JI1Q 1JICA 1YHBA 5D3IB 1EQQA 3SK4A 3A8KE 1U5KA 4PMBA 1NTGA 5K36G 3R2IA 1PTOB 1T5EA 3GTPB 2PZUA 4A3JB 3PO2B 4PQXA 1PFSA 1UAPA 4UP9A 1AEXA 4R4IA 4V0BA 4LF7Q 2EXZA 3F2DA 2KCNA 4HIOA 1N8RC 3F8TA 5ELEA 2Q2IA 1HJPA 2CHBD 1R9TH 1GD7A 2MP1A 4X3UA 2E74C 3RLNA 3AMUA 2EDGA 2F3VA 1V1OA 1G6PA 4I7ZC 1AZPA 2ATWA 4IPCA 4X3TA 1F2ZA 4LFBQ 1LYLA 4A3IG 5JVH3 4C1NK 1M1KC 3TP6A 2CWAA 3NQIA 4OO1G 1AE2A 1YHAA 4BBRB 3HOYH 4LFCQ 3EA6A 2G9HD 3VR2A 3S24A 4DR7L 3OIPA 4P73A 2UXBQ 5EQ0A 4JI6Q 2N49A 4M8AA 1X56A 4JBWA 2SDFA 3M4PA 4ZRZA 3K8AA 5G3LD 2AQ1B 3UE1A 4GKKQ 2NN6H 4LAAA 1E24A 3DWPA 1JORA 1DOMA 1EYCA 1GUOA 1BCPB 1Y1WH 2NVXH 4CDEC 4GNXA 2G9DA 5I9OA 1CK1A 5IWAQ 4X6AH 1UUPA 5FO9B 2EJMA 4ID6A 1CA5A 4O0AA 2D2CC 4BBSB 2L1BA 1MJEA 1N32L 1A2UA 1W6JA 1HRJA 2NUCA 1HA6A 1PV4A 1SLJA 2Y0SB 1H9SB 3HKSA 3K58A 2Q8TA 1SMYC 3NBIA 4NDXA 2RDHA 3K7UC 1NR4A 3OTOL 2VNUD 3ITPA 4OIKA 4C56C 2K1BA 5JPMC 2IX0A 4EVOA 2KECA 1SYEA 3AYHB 1Q90A 2KCTA 5CMDA 3LWUA 1QUQA 2KHSA 2JA8B 1EUJA 1TKWB 1Q82C 4DV1L 1N9WA 2OQ0A 4ME3A 4G7HC 1RD9D 4XQQA 3C46A 2PZTA 4K0KQ 2BDNA 2YU9H 2UUAQ 4K8JA 2X6GA 5FO7B 2E2IH 3S1RH 2E2JH 5BR8Q 4QY7A 2UU9L 1HNZQ 1B3AA 3DWAA 4IUUA 4K14A 1F2LA 1D5MC 1ZEQX 1YNND 1HTPA 4RHSA 3VDYA 1YITA 4DNIA 4JI3L 4F8MA 4LF6Q 3TS2A 3BDCA 2YTXA 3IFTA 2PCFB 5EBCA 2LFNA 4A3BH 5FLXE 3RMHA 2RKSA 3I4LA 2C9OA 1PXUA 2EY2A 4AQYQ 4GLVB 3U9SA 4R4CA 3NTIA 3KLRA 3I4NH 2N8NA 4OWXB 1W3SA 5IGFA 5CV5A 4Y7NH 5CBAE 4EGVA 5LL6X 1RDPD 4ABNA 4AYBE 1L1OB 3PF4A 1DCZA 2UUCL 2WV6D 3H0GH 3K6OA 4FXGC 1GUSA 1J8IA 5C4JH 4EQPA 4BY1H 1F77A 1AW7A 1BR9A 4NMZA 5DLQE 4HJ7A 4LF8L 3DXJC 4GN4B 3I7FA 4DV6L 1CI3M 4A3GG 1QZHA 2HDLA 4FO2A 1DXMA 5M3MB 4XT1B 2JA7B 2YTVA 5M3FB 3GTOB 4DK3C 1TU2B 2F0UA 1RTOA 1Q1BA 4GOPA 4X66Q 5JPNC 3BVZA 5JJLA 2UUBQ 1HQMC 1PFBA 3C1EA 4K6LA 1SR3A 4JOIA 4C3JH 1SFOH 1N33Q 1FNWA 4I65A 5C3EH 4NKLA 2TSSA 4X62Q 2JA6G 3IRBA 4RHRA 3RZDB 4UY8C 1A6XA 1EY7A 1U9RA 1RKNA 1IBKQ 4KKUA 1VQ5A 4EQNA 3KFUA 1YJNA 1I3QB 4KN4C 1LV9A 1W6KA 2ZJRA 3P1HA 1PRTD 4EQ5A 3BJUA 1PA6A 1H95A 4KTAA 3NELA 1EZ8A 3KUPA 1JC7A 1WYDA 2Q2UA 2B2TA 4BY7H 2DJFC 3CPWA 2I0QA 1LM0A 3NBHA 3MWYW 4LMQD 5EAYA 4LFAL 3TP5A 4A3IB 2K50A 1HFGA 1I4HA 1DOLA 5KNCA 4AYBG 5IP9G 4NB3A 1G91A 1PYBA 1RODA 2RF4A 1NR2A 4Q0FA 4B3TL 4RGNA 3K0XA 3UI2A 2JE6I 4F87A 4LK1C 4OIJA 1OO9B 2FJ2A 3J81L 1EY8A 5IIFA 1IYVA 4ZUIA 4A93B 3CU7A 4N9PA 3TBIB 2NN6G 1ZYRD 1YZ6A 3AFQA 3HOVH 2O5JC 4H0LC 3S1QB 3D0FA 1X9NA 2QA4A 1PYWD 3NQTA 4GLXA 1FNVA 1JQYD 2WINB 4YY3Q 1BF4A 5I2XA 1VQDA 2IWHA 4LF4Q 3BYTB 2BOSA 3W2DA 3K5NA 1F2MA 2PQAA 3D4RA 4QIWB 5FJ8H 1K9MC 2LSSA 4KY5A 3S1NH 4FVMA 4DUZQ 1CHQD 4DV0L 4GN3B 1QVGA 1CFMA 1SYCA 4KY6A 4XIGS 1BKBA 3W1GA 1F2YA 3Q6SA 1Q1EA 1KXLA 5CV4A 1II3A 5KYLA 4LF7L 3L9AX 3HOZB 3RUZA 1U4RA 4NP5A 3ZJYC 5BN4A 2WAQE 4TRDA 3WWVA 2VS1A 1LUZA 3K81C 2A69C 1G8ZD 3CD6A 4DNRB 5HY6A 4C3IG 4OX9Q 2BE5D 4DV2Q 1B3QA 2KCCA 1ZKOA 3I55A 4LFBL 1E2VA 4GN5A 1YVCA 3CCMA 2LXJA 5FK9C 2NVYB 1CQVA 2L0CA 4LFCL 5EGTA 1IW7C 1FVIA 1IBLQ 3A54A 2RDGA 4JI6L 1DD2A 2RA4A 3RZOB 4DR5L 1WCMH 3AFPA 3EIVA 5CV7A 1M90C 1OXSC 1RL2A 2E5LL 5TSSA 1B53A 2IJ0A 1UE7A 2WP8J 4DXFA 4DR1Q 1NMGA 1QJOA 5IWAL 4A3BG 1V8QA 1VQHA 2ZJPA 4MTKA 3M4QA 1ASZA 4LUVA 3T16A 1HNWL 2JP1A 5C44H 1D1IA 3MHBA 1JB7A 1VMPA 4ZKBB 3I4NG 2A19A 2ID0A 1Q86C 1SRUA 1QB5D 4DR7Q 3CP0A 5HGTA 4JV5L 1TS2A 2R7FA 5KIXA 1XPOA 3PF5A 2V1CC 3H0GG 4JBKA 3HKZE 4BY1G 1NY4A 1X32A 2B2WA 1JOOA 2K6AA 1KIXA 2QEJC 1STYA 1E22A 1NSNS 3ERQA 3VR6A 2WAQG 3M85A 5A35A 4A3GB 3SDZA 2E8GA 3I4MB 3CQZB 4IJLA 1N32Q 2IY5B 1BCPC 4JBMA 4K0KL 4B08A 1ASYA 1OXVA 1XMQL 2HCIA 3KBGA 4IN3A 1JWSD 2PW5A 3FVQA 4C3JG 1WTRA 3B6YA 2ZTCA 4ME5A 5C3EG 2B3GA 4P75A 4FYDA 1K83B 1V1PA 1XTCD 2B2UC 5BR8L 4KY7A 1HNZL 3OWFA 2JA6B 2PNHA 3GTKH 3CW2C 1HXYD 2UXCQ 3NENA 4LF6L 2E2HH 4HSVA 1S5DD 2WKCA 3BDOA 4DV5L 3MTSA 3MXGA 1YBYA 5LMNQ 5EPKA 2OF1A 4DV1Q 2K04A 4B3ML 1EQRA 1CTMA 1VQOA 3JC66 4DAPA 4UDUC 4LF5L 4AQYL 1GHKA 3VYRA 2AWNA 2D5DA 5FLXc 5M5YB 1GKHA 4IZ8A 3I2ZA 1XWEA 1QG7A 2Z6KA 3SVMA 1BOSA 4BY7G 5IYBG 4ZK9B 1LTID 5C4ZA 2NB0A 4L5QA 1VQCA 5CGKA 3T56B 5C3XA 4WJWA 3MFYA 3MXUA 4AYBB 1E7ZA 3S15H 2UU9Q 2EYMA 1VQ7A 2SEBD 2KOLA 4MNOA 2IPKD 4A75A 5IGCA 4ODGA 4O42A 3NTHA 4HJ9A 4N8FA 3TP8A 2IW3A 3K57A 4KMUC 5ELOA 4YWLA 5KEEA 4X66L 3SXHA 1YNJD 3SK6A 3S2HH 2CQAA 3K7AB 3Q8DA 3S16H 3KF6A 3KLWA 3U9OA 1PFNA 2F3IA 3FP9A 4UP8A 1N33L 4FNFA 2EVBA 4LUZA 2ZXPA 4X62L 2B2VC 5M5XH 1IL2A 1FL0A 3JAME 1PTOF 1YJ9A 3S1MB 4LF8Q 1ML0D 1C8CA 1L1OC 3BZKA 4YHHQ 5KGUA 3T51B 1Y1VH 1GM5A 2IX1A 2R7ZH 1HH2P 4BS9A 2K14A 2QKIC 2VB3X 4R4OA 1VQIA 2Q8IB 1WFQA 1TY0A 2DY8A 4K2KA 3PUYA 4R9WA 3MVVA 1AP0A 1IHZA 1HTLD 1PH6A 4C3IB 1Y8PB 3E9IA 3S17H 1S5CD 1MHWC 4HSPA 1L0WA 1SYGA 3BDLA 1E2WA 2VY3A 3J7A5 2XRQD 1O7IA 1TWHH 1EYAA 1UEBA 2E2JB 4A3EH 3M7GA 2F3WA 4R4QA 1BUVT 1YEZA 1ICWA 1R4PB 2A68C 1KAWA 4HIDA 1Q3LA 1X3GA 2L15A 5IT9c 2F0LA 3PIO3 4YY3L 1B8AA 2ICIA 2NWGA 1PH4A 4GOPB 5GADC 1B9NA 4RG1A 3GTMH 5A2QL 2EJGC 5LL6S 5C44G 3MAQA 1TWAH 3HOXB 1J5EL 3L3OC 1PHJA 4GKJQ 2F0QA 2Z0SA 4UAIA 1NMFA 1PRTF 1TIID 4XYOA 3M4OH 2O2LD 3A5ZB 4IJHA 1OXTA 3OSOA 2J4XA 3RLOA 4CDDC 4QJFA 1B50A 3R2TA 3TREA 1SYBA 4QMGA 1G6ZA 3TN2A 1TS3A 2NVTB 3HS0C 2PPBC 3M3YB 5D3DA 2DJGC 1SDFA 2B2YC 2WAQB 4Z9CB 3H91A 4EQOA 2HQEA 3AQQA 1K3RA 4DV2L 1WTHA 5C4XH 2X69A 1Z7TA 4MN3A 5HGQA 1CHPD 3NHHA 5EPJA 2B8FA 5A2QE 3CCSA 1JB3A 1PH7A 3NBHB 5M5WB 2JA5G 2B39A 3TZDA 4KN7C 4CKEA 1IBLL 5I6WA 1O7LA 1I6HH 4DV0Q 1F9PA 2A1AA 2VXWA 4RWSC 1PFMA 5C3EB 2ZJQA 4OONA 4RKBA 3K5LA 2IHFA 3KYHC 1X3QA 1GUTA 3HOUB 2R92G 1B1ZA 4DR1L 1XNRL 3I70A 1ENAA 2B63H 3I8ZA 2A6HD 4RAUC 3S2DH 2ALYB 1EYGA 3M7NA 1GO3E 4IUPA 3VA7A 3A8IE 2CCZA 3A74A 3PUZA 1QCBD 1XX8A 1DM0B 5BN5A 1NE3A 1S5FD 1SE2A 2PQAB 3FKIH 4DR5Q 2L9HA 3DM1A 3BS1A 2DNCA 1EOVA 5KRUA 4R4TA 4H13C 3H09A 2E5LQ 2R61A 3HKZB 4BWGB 1LTTD 1JOKA 1KRSA 1LO5D 2KENA 2KEEA 4LF9Q 1HZ9A 5EBDA 2HD3A 4A3KG 1EEID 2DNEA 4TQUS 4CHTB 1HNWQ 4PZ8A 1SEBD 5FLMH 2XVSA 2J7ZA 1Q8IA 2I46A 5IOCA 2F0EA 2JSOA 2EPBA 1PRTB 4PNYA 4HJAA 1OXUA 1VDZA 1TWGB 4IUNA 4KKSA 2VQFQ 1JJCB 1XYIA 1O7ZA 4DV7Q 4JV5Q 4H7BA 3HFZB 3ZYYX 4HIMA 1P8LA 3PGZA 1EY9A 2OT2A 2FINB 1VQKA 1O80A 2F03A 1HUMA 3PO3H 3EBEA 1RF2D 4C3HH 1KLGD 2VUMH 2UXCL 5ELCA 2D9UA 5FLXL 4RCNA 4YWMA 5LMNL 1Y14B 4OXPA 1Y1VG 3MFGA 2R7ZG 3GTQB 2EYPA 3KLSX 3GQBA 2OEOA 1PLFA 5E4XA 2VZAA 1CKNA 4BXXH 1XMQQ 4DR4Q 1IBMQ 2AWOA 3ONAB 2VW9A 4XQNA 1ZXTA 3W1BA 4AH6A 4ALPA 3QG1A 2JYOA 5HURA 1ESRA 3PUVA 5C6AA 4K5XA 1A0IA 1HHVA 3CHBD 2EYFA 4DV5Q 4JK1C 1ILQA 1X54A 2NZ1D 4A3EG 2AQ2B 3HOWH 1IYUA 1TT2A 4B3MQ 5CC4A 2EY5A 3EFXD 2KHJA 4L8JA 4X65L 4LF5Q 4RFBA 3S14B 4NXML 1LTGD 2EYJA 4OL7A 5NUCA 1FR3A 3R8BA 3MEFA 2R93B 2ZT9C 4GNXC 4A3FB 1BXTA 4NW2A 1HFNA 1KABA 4EX5A 3K5MA 4O1NA 3DUZA 1FYCA 4DFAA 2K52A 3L2PA
chains in the Genus database with same CATH topology
3GTJB 2OXPA 2AQ3B 3VYTA 1BDOA 3KK7A 3IAYA 1V1PB 5C3WA 5KNDA 5AFWA 3IFDA 2EYHA 3SK8A 1ONLA 3P7JA 3BVGA 2K28A 5ELDA 4KI0A 2A6ED 1MBYA 1M8AA 3LX0A 3GP7A 2JA5B 1H9JA 1STHA 3H94A 2HDMA 1A15A 4J1MA 3X3MA 4IQZA 5IT9L 1EZ6A 1WVLA 1S5ED 3MXPA 2R92B 1BCPD 2E2HB 3FDTA 3NXWA 1SNQA 2H1EA 3MC0B 1JCKB 3N52A 4DXGA 2JEAI 1I4QA 2Z4HA 5LHY1 3C1FA 2K5WA 1SNCA 3T53B 1EEFD 2QF7A 1HPCA 5ELFA 3S15B 1XXGA 3VA5A 2ZXOA 5IT9E 4XXEA 1STBA 4CKCA 5I4DA 1ILPA 4A3KB 3T13A 2LS01 4OO1I 1CA6A 2BCOA 4XTCS 4CGYB 5EKKA 1TWCB 1JWMD 5C0XI 3R93A 5KNBA 4DNTB 3LNNA 3NSWA 3P75A 2L12A 5M5XB 1SYFA 3VR3A 2HCCA 2EOTA 4HCEA 3D8GA 1HQRD 2RQXA 3TMEA 3VR5A 4QUFA 1Y1VB 1TWFB 2F0KA 5E3FA 1BO0A 1U4PA 1SNMA 4K6DA 3QOJA 2FFKB 2LY7A 2NBFA 4IUVA 5IGGA 3K0YA 5EKIA 1EYDA 3N6RA 3S17B 3A7AB 1G2SA 3VYSA 2B2TC 1CM9A 2AUKA 4DK0A 1B9MA 1PTOC 2F0MA 5IGEA 5CV6A 1TS4A 2ENBA 2NTSA 4MIUA 3A56A 3NTKA 1L0XB 2QDBA 4M1UB 1EIHA 3Q23A 2M2LA 4ZYSA 1WTVA 3OMGA 1GJXA 3DMUA 1D1KA 1ET6A 4G7OC 1SNOA 1PDQA 2XWJB 3GTLB 4KV6A 1V43A 3EQLC 2A68D 3IKJA 1L0YB 1LTRD 3HP3A 2RSNA 3GV6A 4IUTA 1D5XC 5JJZA 1KNAA 1KLUD 2K03A 3HG9A 5G3LF 5ISRA 5D65A 4A3DB 1Z47A 4CBVA 4HN7A 3D4WA 2F0TA 3FPUB 4FXDA 4G4KA 3NWTA 1PRTC 2F0SA 3BZDB 1GUNA 3KBXA 1EL0A 4IFDI 1NUCA 2I07B 2KJXA 5K36H 4RGOS 4RCOA 5DEHA 3PIP3 2O4XA 2F1MA 1DYQA 4K5WA 3D4DA 3O13A 4FP5D 1R9TB 5T1IA 5IODA 1CT1D 1NAPA 1CQFA 3OMCA 2FMCA 4TKOB 5C5MA 4F88A 1ZYRC 3TDQA 3NUCA 1AN8A 3HOYB 2F0JA 2MHVA 3JAML 4KK7A 5M9OA 5EPLA 3CRLC 1S5BD 5JAVA 4OO1H 4ILWA 2B8GA 1STEA 5CORA 2ICEC 4RKLA 1Y1WB 2NVXB 3OHXC 4HTHA 5C0XH 4DU9A 2NYZD 2B2WC 1STGA 1A3UA 2MPMA 4B9XA 4DGZA 2WKDA 1DOKA 2BE5C 5J22A 3J7AF 1DZ1A 3RD4A 3AB9A 4XT3B 4Q5VA 3PO3B 2H4OA 2L55A 1VCIA 5JEAH 4RH6A 5FOBB 1GUWA 3C3LA 1SMYD 3SK5A 3HEJA 1H9MA 4QCLA 4CKBA 2CW0C 1EQVA 2YU9B 1JOQA 3HRZC 2E2IB 3S1RB 2M9VA 4KHVA 2KA7A 2PQEA 5JVG3 1EY4A 3Q24A 2RVLA 3A8JE 3K59A 2JEBI 3NWSA 4A3BB 3IL8A 3SR1A 4RGMA 3E5SA 4U673 3PMFA 3I4NB 1AZQA 1SNDA 2EE1A 4Y7NB 1D6EC 5DNFA 2XNAC 4KJOA 1ET9A 5CR3A 1LT6D 3H0GB 4DAVA 1U4MA 5C4JB 4ULLA 4BY1B 1SAPA 4H44C 3P20A 1TS5A 4IUQA 2MUYA 4E6IA 4L63B 1TR5A 2BA1A 2PMZB 4IFDH 2XIWA 2EZVA 1FD7D 1T5XD 3J80L 1Y8NB 1STNA 1DJRD 1STAA 1R4QB 4C3JB 1SFOB 2NTTA 5JOBA 1PZID 5I2YA 3ND9A 3MEHA 4KJNA 1QNUA 3EROA 1A2TA 1KTKA 3KF8A 3E6ZX 5FO8B 1PZJD 4XQJA 2K5QA 4G57A 3OW7A 2EY1A 1KAAA 3J80E 2A74C 4BY7B 1SE3A 2F0HA 1CZGA 4LJZC 4L6TB 1OXXK 4ZQ3A 3E0JA 2EYLA 4G7ZC 1MD2D 1YNJC 1LTBD 1LACA 3DEPA 3HOVB 1K8OA 3J7YW 4RGTA 3H3VC 2K7VA 5C0XG 4HAEA 1VF5C 1EIGA 3HGBA 1KDAA 2MGSA 3FRPB 3QOLA 2R3ZA 1H9RA 3NK9A 1X3PA 3MA2B 1MSHA 1MGSA 2F0FA 3TSSA 3S1NB 2L11A 2X6LA 3MZ5A 3RLFA 4IURA 2LMCB 3SHLA 4S3SA 3WOFA 4IALA 2Z1CA 4DK1A 3FMCA 1EY5A 2JXMB 1TY2A 5JEAG 1C48A 4FXKC 2KUMA 1SYDA 2A5HA 3NE5B 5ELBA 3A7LA 2R6GA 5EKLA 1MSGA 5CBEE 1WCMB 2PO4A 2A69D 3V96A 4ZUJA 1SJED 4BA2I 2F0GA 3L7ZC 2DY7A 3NPPA 3X3NA 4CJ0B 4QUCA 1IW7D 2TMPA 1B4OA 5C44B 4QB4A 2F0WA 4K2LA 4J6HA 2BA0A 1KNEA 3D31A 1PTOD 3GD7A 1WTOA 4HCSA 4MHEA 2K32A 2XN9C 1I6VC 1F9RA 2M00A 1A3TA 1EFID 1Y69U 5EJWA 5T1GA 1O7YA 3VR4A 1D2BA 1WTPA 1WTXA 4R8IA 1LT5D 3M4YA 5IGDA 4BA1I 4DAYA 2KEDA 4R8NA 4PV1C 4KD3A 4KD4A 1Y8OB 3GV3A 1B2TA 4IFDG 3QWNA 1GUGA 4FF1A 3OWEB 2Z8LA 3HZXA 3OIQA 1AFPA 1BQQT 2A6HC 5DM63 1PTOH 3Q0AA 2DN8A 1EWHA 3GTKB 3URYA 1K8MA 3A55A 2NVQB 1QE6A 1TQOA 5E1FA 3QIAA 3D6WA 3KLSA 4ZAIA 1I50B 2N55A 5FKAC 4OHJA 4V190 5K5PA 1SE4A 1F9QA 3EVQA 4HEDA 1UEAB 3FPPA 3WDNA 2CVRA 3I91A 4DF7A 1U4LA 2QILA 1MI2A 2E75C 3DHQA 4OGQC 1IKLA 2AUJD 1F9SA 1GHJA 2RBMA 3S2HB 3WOEA 3S16B 2SOBA 4K8IA 5C4HA 3CKIB 4U68A 2F0IA 4GZYC 1SSOA 4WRDA 1GOZA 1IL8A 4C3HG 1KDBA 1JE4A 1I4GA 2E2DC 1BBXC 3G6JB 2WIIB 2ZXRA 2R7ZB 4C1NI 3J81E 3OPOA 1DONA 2FHTA 4C2MB 2F0PA 2IL8A 1YNNC 1LABA 3Q22A 2K33A 3K5OA 3SE0A 4F7XA 2B2UA 1H9SA 1IKMA 1A3VA 3OOCA 1QWYA 4QF4A 3PV0A 2PNRC 1E0BA 1JWUD 2F0DA 1TWHB 5F2DA 1WTWA 4A3EB 2WB1B 4N9TA 1I4XA 3TP7A 5C5LA 4FF4A 1O78A 5CV9A 5J1ZA 4PMCA 2CW0D 1QOHA 5DAUA 1EU3A 3H6MA 2VB2X 1EQTA 2BDOA 3GTMB 1VMCA 1HCZA 1TWAB 1H9KA 3QO2A 3DWQA 4KKTA 1PZKD 3M4OB 1I4RA 3TZUA 1SNPA 1Q12A 3AU7A 1HA5A 1BNZA 1RTNA 3I90A 1QNKA 2A6EC 1E2ZA 2PW7A 3LWEA 2WACA 1JR0D 2O5IC 5I6YA 2E76C 2EY6A 2KVMA 2XSCA 5D14A 5C4XB 2SNMA 2FMMA 3R3OA 2F0NA 2B2VA 1I6HB 1RCVD 4X3KA 4P2CB 2EYOA 2L5TA 4ZKCB 1ENCA 4XDXA 2LKVA 1CZWA 4CJ1B 2B63B 2F0VA 3NP8A 3CRKC 5COYA 3G7LA 3S2DB 2EJFC 5CV8A 2V4DA 4B9WA 5I9PA 2K05A 3DEOA 3W3AA 2SNSA 1LT4D 2GA4B 3FKIB 1M4VA 3S9WA 2PYKA 5CYUA 2F4IA 4WORA 3PUWA 3FEWX 3C2PA 4FF3A 1WD1A 2XWBB 3BG3A 2D62A 1LT3D 1SJHD 4WFN3 2L4NA 5C0XJ 5BN3A 1KDCA 2RSOA 1EOTA 1TVXA 1UNSA 3SEBA 5KYIA 2NN6I 2N88A 2RDFA 1FGBD 1J9OA 2Q8RE 2K01A 3T4AC 1C4QA 1G2TA 4C3HB 3I72A 2VUMB 1LLRD 2A73B 3I3CA 3QB3A 4XYQA 2B2YA 4X3SA 5E4WC 1SBBB 1EY6A 4PMWA 3EJIA 1EY0A 2IX3A 4HMIA 5JEAJ 1FNUA 3V2TA 3V05A 2KQ3A 2C5CA 3PUXA 5DM73 4KHZA 1EWCA 4RA8A 3ND8A 2K5DA 3I73A 3GO5A 4ZLTF 2IT1A 3J7AV 1G291 3D6CA 3MXNA 1B44D 4FF2A 1ENFA 3HOWB 3D3RA 1D5ZC 4HR7B 1S4ZA 1Z6HA 4YIJA 1ESFA 2YYZA 1RJTA 1I4PA 1BCPF 1VF7A 1HUNA 1WD0A 1RHPA 3F2UA 2PZWA 1SXTA 4J8QA 1PMRA 3VYUA 1GXDC 4K5VA 5J39A 2XRSD 1LTSD 1QILA 2F0OA 4DN4M 4TSSA 1EU4A 2HUGA 3BVMA 4DA2A 5IGBA 4CJ2C 1LTAD 4A3MB 3GTGB 2QCPX 2MJ8A 1WTQA 4HMJA 4IFDJ 1NCVA 3QJYA 2J0TD 2Z4IA 3BYYB 1JICA 5D3IB 3SK4A 3A8KE 4PMBA 5K36G 3R2IA 1PTOB 1T5EA 3GTPB 2PZUA 4A3JB 3PO2B 4PQXA 1UAPA 1AEXA 4V0BA 2EXZA 2KCNA 5ELEA 2CHBD 2MP1A 4X3UA 2E74C 3AMUA 2EDGA 2F3VA 1V1OA 4I7ZC 1AZPA 4X3TA 1F2ZA 5JVH3 4C1NK 3TP6A 3NQIA 4OO1G 4BBRB 3EA6A 2G9HD 3VR2A 3OIPA 5EQ0A 4M8AA 4JBWA 2SDFA 4ZRZA 5G3LD 2AQ1B 2NN6H 4LAAA 3DWPA 1JORA 1DOMA 1EYCA 1GUOA 1BCPB 2G9DA 5I9OA 1CK1A 1UUPA 5FO9B 2EJMA 4ID6A 1CA5A 2D2CC 4BBSB 2L1BA 1A2UA 1W6JA 1HRJA 2NUCA 1HA6A 2Y0SB 1H9SB 3K58A 2Q8TA 1SMYC 3NBIA 4NDXA 2RDHA 1NR4A 2VNUD 3ITPA 4OIKA 4C56C 2K1BA 5JPMC 2IX0A 4EVOA 2KECA 1SYEA 1Q90A 5CMDA 3LWUA 2KHSA 2JA8B 1TKWB 4G7HC 1RD9D 4XQQA 3C46A 2PZTA 2BDNA 4K8JA 2X6GA 5FO7B 1B3AA 3DWAA 4IUUA 4K14A 1F2LA 1D5MC 1ZEQX 1YNND 1HTPA 4F8MA 3BDCA 3IFTA 2PCFB 5EBCA 2LFNA 5FLXE 3RMHA 2RKSA 3I4LA 2C9OA 1PXUA 2EY2A 3U9SA 3NTIA 3KLRA 5IGFA 5CV5A 5CBAE 4EGVA 5LL6X 1RDPD 4ABNA 1DCZA 2WV6D 3K6OA 4FXGC 1GUSA 1J8IA 4EQPA 1F77A 1AW7A 1BR9A 4NMZA 3DXJC 1CI3M 2HDLA 4FO2A 1DXMA 5M3MB 4XT1B 2JA7B 5M3FB 3GTOB 1TU2B 2F0UA 1RTOA 1Q1BA 5JPNC 3BVZA 1HQMC 1PFBA 3C1EA 4K6LA 1FNWA 4I65A 4NKLA 2TSSA 4RHRA 3RZDB 1A6XA 1EY7A 1U9RA 1RKNA 4KKUA 4EQNA 1I3QB 4KN4C 1LV9A 1W6KA 3P1HA 1PRTD 4KTAA 1EZ8A 3KUPA 1JC7A 2B2TA 3NBHA 3MWYW 4LMQD 3TP5A 4A3IB 1HFGA 1I4HA 1DOLA 5KNCA 1G91A 1RODA 1NR2A 4Q0FA 4RGNA 3UI2A 2JE6I 4F87A 4LK1C 4OIJA 1OO9B 2FJ2A 3J81L 1EY8A 5IIFA 1IYVA 4ZUIA 4A93B 3CU7A 4N9PA 3TBIB 2NN6G 1ZYRD 2O5JC 4H0LC 3S1QB 1PYWD 3NQTA 1FNVA 1JQYD 2WINB 1BF4A 5I2XA 2IWHA 3BYTB 2BOSA 3W2DA 3K5NA 1F2MA 4QIWB 3D4RA 4KY5A 4FVMA 1CHQD 1SYCA 1CFMA 4KY6A 4XIGS 1F2YA 3Q6SA 1Q1EA 5CV4A 1II3A 5KYLA 3L9AX 3HOZB 3RUZA 1U4RA 4NP5A 5BN4A 4TRDA 2A69C 1G8ZD 4DNRB 4C3IG 2BE5D 2KCCA 1ZKOA 1E2VA 5FK9C 2NVYB 1CQVA 2L0CA 5EGTA 1IW7C 3A54A 2RDGA 1DD2A 2RA4A 3RZOB 5CV7A 1OXSC 5TSSA 1B53A 2IJ0A 2WP8J 4DXFA 1QJOA 1V8QA 3T16A 2JP1A 1D1IA 3MHBA 1VMPA 4ZKBB 2ID0A 1QB5D 5HGTA 1TS2A 5KIXA 1X32A 2B2WA 1JOOA 2K6AA 2QEJC 1STYA 1NSNS 3ERQA 3VR6A 3M85A 5A35A 4A3GB 3SDZA 3I4MB 3CQZB 1BCPC 4B08A 1OXVA 2HCIA 3KBGA 4IN3A 1JWSD 2PW5A 3FVQA 4C3JG 1WTRA 4ME5A 4FYDA 1K83B 1V1PA 1XTCD 2B2UC 4KY7A 3OWFA 2JA6B 1HXYD 4HSVA 1S5DD 2WKCA 3BDOA 3MTSA 3MXGA 5EPKA 2OF1A 2K04A 1CTMA 4DAPA 4UDUC 1GHKA 3VYRA 2AWNA 2D5DA 5M5YB 4IZ8A 1XWEA 1QG7A 3SVMA 1BOSA 4ZK9B 1LTID 5C4ZA 2NB0A 5CGKA 3T56B 5C3XA 4WJWA 3MFYA 3MXUA 4AYBB 2EYMA 2SEBD 2KOLA 2IPKD 5IGCA 4ODGA 4O42A 3NTHA 3TP8A 2IW3A 3K57A 4KMUC 5KEEA 3SXHA 1YNJD 3SK6A 2CQAA 3K7AB 3U9OA 1PFNA 4FNFA 2EVBA 2ZXPA 2B2VC 3JAME 1PTOF 3S1MB 1ML0D 1C8CA 5KGUA 3T51B 2IX1A 4BS9A 2QKIC 2VB3X 2Q8IB 1TY0A 2DY8A 4K2KA 3PUYA 4R9WA 3MVVA 1AP0A 1IHZA 1HTLD 4C3IB 1Y8PB 1S5CD 4HSPA 1SYGA 3BDLA 1E2WA 2XRQD 1EYAA 2E2JB 3M7GA 2F3WA 1BUVT 1ICWA 1R4PB 2A68C 1Q3LA 2F0LA 3PIO3 2ICIA 2NWGA 1B9NA 5A2QL 2EJGC 5LL6S 3MAQA 3HOXB 3L3OC 2F0QA 4UAIA 1PRTF 4XYOA 1TIID 2O2LD 1OXTA 3OSOA 2J4XA 1B50A 3R2TA 1SYBA 4QMGA 1G6ZA 3TN2A 1TS3A 2NVTB 3HS0C 2PPBC 3M3YB 5D3DA 1SDFA 2B2YC 2WAQB 4Z9CB 3H91A 4EQOA 2HQEA 2X69A 1Z7TA 4MN3A 1CHPD 5EPJA 3NHHA 2B8FA 5A2QE 1JB3A 5M5WB 2B39A 3TZDA 4KN7C 4CKEA 5I6WA 1O7LA 1F9PA 2VXWA 4RWSC 1PFMA 5C3EB 4RKBA 3K5LA 1X3QA 1GUTA 3HOUB 1B1ZA 3I70A 1ENAA 3I8ZA 2A6HD 4RAUC 3M7NA 4IUPA 3VA7A 3A8IE 3PUZA 1QCBD 1XX8A 1DM0B 5BN5A 1S5FD 1SE2A 2L9HA 3DM1A 3BS1A 2DNCA 5KRUA 4H13C 3H09A 2R61A 3HKZB 4BWGB 1LTTD 1JOKA 1LO5D 2KEEA 5EBDA 1EEID 2DNEA 4TQUS 4CHTB 1SEBD 2XVSA 2J7ZA 1Q8IA 2I46A 5IOCA 2F0EA 2JSOA 2EPBA 1PRTB 4PNYA 1OXUA 1VDZA 1TWGB 4IUNA 4KKSA 1XYIA 1O7ZA 4H7BA 3ZYYX 1EY9A 2OT2A 2FINB 1O80A 2F03A 1HUMA 1RF2D 1KLGD 5ELCA 2D9UA 5FLXL 4RCNA 3MFGA 3GTQB 2EYPA 3KLSX 3GQBA 2OEOA 1PLFA 5E4XA 2AWOA 3ONAB 4XQNA 1ZXTA 3QG1A 2JYOA 5HURA 1ESRA 3PUVA 5C6AA 4K5XA 1HHVA 3CHBD 2EYFA 4JK1C 1ILQA 2NZ1D 2AQ2B 1IYUA 1TT2A 5CC4A 2EY5A 3EFXD 4L8JA 4RFBA 3S14B 1LTGD 2EYJA 4OL7A 5NUCA 1FR3A 3R8BA 2R93B 2ZT9C 4A3FB 1BXTA 4NW2A 1HFNA 1KABA 3K5MA 4O1NA 3DUZA 1FYCA 4DFAA 4RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9Q A;  5EPK A;  1CA6 A;  1NR4 A;  2K04 A;  1PFB A;  5D65 A;  1EQT A;  1MSG A;  4HED A;  4OIK A;  5CBE E;  1GUW A;  1VMC A;  2L4N A;  2K1B A;  4CJ2 C;  1ICW A;  2KEC A;  3QO2 A;  1Q3L A;  2CVR A;  2KEE A;  3I91 A;  3R93 A;  1QG7 A;  2RSO A;  3FPU B;  5CMD A;  3SVM A;  1EOT A;  4ZK9 B;  2DY7 A;  1TVX A;  2L12 A;  1U4L A;  2NWG A;  2MJ8 A;  1WTQ A;  1BNZ A;  1RTN A;  2RA4 A;  3I90 A;  5AFW A;  3KBX A;  1EL0 A;  1MI2 A;  1NCV A;  2HCC A;  1QNK A;  2J7Z A;  2EOT A;  2N88 A;  3IFD A;  4QUC A;  4CJ0 B;  1J9O A;  1LV9 A;  1B4O A;  2EPB A;  2Q8R E;  3LWE A;  2K01 A;  3P7J A;  2KOL A;  4UAI A;  4QUF A;  1XYI A;  1IKL A;  1JIC A;  1G2T A;  1F9S A;  2K28 A;  1O7Z A;  2KVM A;  3I3C A;  1B53 A;  2B2Y A;  4X3S A;  3KUP A;  5E4W C;  2BDN A;  1BO0 A;  1M8A A;  1U4P A;  2B2T A;  1KNE A;  5D14 A;  1B50 A;  2RVL A;  2FFK B;  2FIN B;  4O42 A;  1O80 A;  5T1I A;  2X6G A;  4U68 A;  1WTO A;  3TN2 A;  4HCS A;  3MWY W;  2JP1 A;  4IUV A;  1HUM A;  4LMQ D;  4MHE A;  5EKI A;  1SSO A;  3IL8 A;  2FMM A;  1HFG A;  1F9R A;  1DOL A;  1VMP A;  4ZKB B;  1NAP A;  2B2V A;  5EJW A;  1G2S A;  5T1G A;  1O7Y A;  2HDM A;  1G91 A;  1ROD A;  1B3A A;  1SDF A;  2D9U A;  1NR2 A;  1A15 A;  2B2Y C;  3DEP A;  4IUU A;  1F2L A;  1WTX A;  3UI2 A;  1WTP A;  3H91 A;  1IL8 A;  4HAE A;  2B2T C;  1CM9 A;  4R8I A;  1EIG A;  4OIJ A;  4X3K A;  1AZQ A;  1JE4 A;  2X69 A;  2FJ2 A;  2EE1 A;  4MN3 A;  2KED A;  2MGS A;  5EPJ A;  2MP1 A;  1PFN A;  4X3U A;  4RA8 A;  1WVL A;  1BBX C;  2R3Z A;  5DNF A;  5EPL A;  1X3P A;  3GV3 A;  1AZP A;  1B2T A;  2B2V C;  1MSH A;  1MGS A;  4X3T A;  4ZLT F;  1PLF A;  3FDT A;  5E4X A;  3TZD A;  1DON A;  1X32 A;  2B2W A;  4ZKC B;  2FHT A;  2H1E A;  1F9P A;  1ML0 D;  1U4M A;  5COR A;  1C8C A;  4XDX A;  2IL8 A;  2VXW A;  4RWS C;  1PFM A;  3N52 A;  1SAP A;  4CJ1 B;  2L11 A;  2X6L A;  3ONA B;  1EIH A;  5CBA E;  2M2L A;  4IUR A;  5COY A;  1ZXT A;  3G7L A;  1WTV A;  1BF4 A;  5EQ0 A;  1X3Q A;  4IUQ A;  2JYO A;  2SDF A;  1S4Z A;  2NYZ D;  2B2W C;  1ESR A;  2B2U A;  2DY8 A;  1G6Z A;  2K05 A;  4R9W A;  3DEO A;  1IKM A;  1AP0 A;  1PDQ A;  1J8I A;  2XIW A;  1RJT A;  1HHV A;  1DOM A;  2MPM A;  1ILQ A;  3I8Z A;  1E0B A;  2NZ1 D;  2HCI A;  4RAU C;  1HUN A;  2KUM A;  1WD0 A;  1RHP A;  3F2U A;  1QE6 A;  1WTR A;  1WTW A;  3Q6S A;  2HDL A;  4IUP A;  1CA5 A;  3D6W A;  3MTS A;  2B2U C;  4XT1 B;  2L1B A;  1DOK A;  1ILP A;  4ZAI A;  1WD1 A;  3HP3 A;  1U4R A;  2N55 A;  1HRJ A;  1HA6 A;  2RSN A;  1RTO A;  1XX8 A;  3DM1 A;  4DN4 M;  2HUG A;  1DZ1 A;  3GV6 A;  4IUT A;  4NW2 A;  4HSV A;  4XT3 B;  2Q8T A;  1HFN A;  5JJZ A;  1KNA A;  2K03 A;  2L9H A; 
#chains in the Genus database with same CATH topology
 4HIK A;  3GTJ B;  2OXP A;  3CMA A;  2AQ3 B;  3VYT A;  1BDO A;  3KK7 A;  3IAY A;  3UE0 A;  1V1P B;  5C3W A;  2AKW B;  4YHH L;  1KHI A;  2LXK A;  5KND A;  3JAM i;  3JAM c;  4Y52 H;  1W2B A;  2HHH Q;  4B3R Q;  5AFW A;  3IFD A;  4A3M H;  2EYH A;  3SK8 A;  1JJ2 A;  4A3D G;  1ONL A;  3P7J A;  3BVG A;  2K5V A;  3GTG H;  1NBW A;  2K28 A;  5ELD A;  4KI0 A;  5C4X G;  3PQI A;  2A6E D;  1VQ9 A;  1MBY A;  2ZTD A;  1M8A A;  3LX0 A;  2CWP A;  2VL6 A;  3A0J A;  3GP7 A;  4O2D A;  5GAE C;  2GN5 A;  4JC0 A;  4OEL B;  2JA5 B;  3DLL A;  1OTC A;  4JI4 Q;  1H9J A;  1STH A;  3H94 A;  2HDM A;  3EN2 A;  1YIJ A;  2Q2T A;  1A15 A;  4J1M A;  3ERS X;  1VQ4 A;  3GTP H;  3X3M A;  3PCO B;  4IQZ A;  5IT9 L;  3PO2 H;  1EZ6 A;  2K75 A;  4A3J H;  1WVL A;  1S5E D;  3MXP A;  2R92 B;  1BCP D;  4JBJ A;  2E2H B;  1D7Q A;  3FDT A;  3NXW A;  1PH3 A;  4LNQ A;  1SNQ A;  2H1E A;  3H15 A;  1SRO A;  2EIF A;  3MC0 B;  1JCK B;  3N52 A;  4DXG A;  4NPS A;  4GKJ L;  2JEA I;  1X65 A;  1I4Q A;  3KF6 B;  2Z4H A;  3HOY G;  5LHY 1;  2A8V A;  3C1F A;  2K5W A;  4A3L H;  5GAH C;  3FKI G;  1SNC A;  3T53 B;  1EEF D;  4BBR H;  5J3B A;  2QF7 A;  1HPC A;  4PZ7 A;  5ELF A;  3S15 B;  1XXG A;  3VA5 A;  2ZXO A;  4DUY Q;  5IT9 E;  1Y1W G;  4XXE A;  1STB A;  4DR2 L;  2XTI A;  4CKC A;  5I4D A;  1ILP A;  4A3K B;  3T13 A;  2LS0 1;  1EIF A;  1J5E Q;  3ICE A;  4OO1 I;  1CA6 A;  2BCO A;  4BBS H;  4XTC S;  4CGY B;  1SE8 A;  5EKK A;  1TWC B;  1JWM D;  4IPH A;  2NZO A;  2H5X A;  4GOP C;  5H1S E;  5C0X I;  1NJI C;  4L5T A;  3R93 A;  5KNB A;  4DNT B;  3DM3 A;  3LNN A;  2DUD A;  3NSW A;  3P75 A;  2L12 A;  5M5X B;  4JOI C;  1SYF A;  3VR3 A;  3PO3 G;  2HCC A;  1QZG A;  2EOT A;  4HCE A;  3D8G A;  1HQR D;  2RQX A;  3ULL A;  3TME A;  3I4O A;  3VR5 A;  2PMZ E;  4QUF A;  1VQ8 A;  1JJG A;  1Y1V B;  1TWF B;  2F0K A;  2JA8 H;  5E3F A;  1BO0 A;  1U4P A;  5L37 A;  1SNM A;  2PI2 A;  4K6D A;  3QOJ A;  1VQJ A;  2FFK B;  3TQY A;  2LY7 A;  2NBF A;  4IUV A;  5IGG A;  3K0Y A;  5EKI A;  1QVC A;  1EYD A;  4LUO A;  4BXX G;  3N6R A;  3S17 B;  3W5O A;  3A7A B;  1PVO A;  1G2S A;  1UE6 A;  1JT8 A;  3VYS A;  2RHQ B;  3J80 c;  2B2T C;  1CM9 A;  3STB D;  5IY0 A;  2AUK A;  4DK0 A;  1B9M A;  1PTO C;  2F0M A;  1HZB A;  5IGE A;  5CV6 A;  2CKZ B;  5ELN A;  4LF9 L;  1XNR Q;  3ULP A;  1TS4 A;  1VQ6 A;  3UDI A;  2ENB A;  2NTS A;  1XMO L;  4L5S A;  3HOW G;  4MIU A;  3A56 A;  4KHP Q;  3NTK A;  1L0X B;  2JN4 A;  2QDB A;  4M1U B;  1EIH A;  3Q23 A;  2M2L A;  4ZYS A;  1WTV A;  3OMG A;  1GJX A;  3DMU A;  2VQF L;  1D1K A;  1K0R A;  1ET6 A;  4G7O C;  4DV7 L;  3U50 C;  1SNO A;  1PDQ A;  2CQO A;  1RIP A;  2XWJ B;  2VQE Q;  3GTL B;  4KV6 A;  1V43 A;  1X6O A;  2K4K A;  4JG2 A;  3EQL C;  2A68 D;  3IKJ A;  1L0Y B;  1LTR D;  3LGJ A;  3HP3 A;  2RSN A;  3GV6 A;  4IUT A;  1D5X C;  5JJZ A;  1KNA A;  1KLU D;  2K03 A;  4JI8 L;  3HG9 A;  5G3L F;  5ISR A;  2PI2 E;  5D65 A;  1CUK A;  1Q46 A;  2CH4 A;  5M3M H;  4A3D B;  2JA7 H;  1Z47 A;  4CBV A;  5M3F H;  3GTO H;  2OCE A;  4HN7 A;  1NNX A;  3D4W A;  2F0T A;  4DR4 L;  3KDF A;  1IBM L;  5IE8 A;  1PH1 A;  3CC7 A;  1KD1 C;  3FPU B;  3UDX A;  4FXD A;  4G4K A;  3NWT A;  1PRT C;  2F0S A;  3BZD B;  1GUN A;  3KBX A;  1EL0 A;  2BH2 A;  4IFD I;  5JJK A;  4JI2 Q;  2NVQ H;  1NUC A;  4AIM A;  2I07 B;  2KJX A;  5K36 H;  3RZD H;  4RGO S;  4RCO A;  5DEH A;  3PIP 3;  2O4X A;  2F1M A;  1DYQ A;  4K5W A;  3D4D A;  3PO2 G;  3O13 A;  4A3J G;  1I50 H;  2MQH A;  4FP5 D;  1R9T B;  1I3Q H;  5T1I A;  2B29 A;  1X3E A;  3G4S A;  5IOD A;  1CT1 D;  1NAP A;  1CQF A;  4JPB W;  3OMC A;  1K28 A;  2FMC A;  4TKO B;  1PH2 A;  4N8X 1;  3BZC A;  5C5M A;  4UPA A;  4F88 A;  1ZYR C;  3TDQ A;  1VQP A;  3NUC A;  1AN8 A;  4TVA B;  3HOY B;  2F0J A;  2MHV A;  3JAM L;  4KK7 A;  4A3I H;  5M9O A;  1IZ6 A;  5EPL A;  3CRL C;  1S5B D;  5JAV A;  4OEM B;  4OO1 H;  2ES2 A;  4ILW A;  2B8G A;  1STE A;  5COR A;  2ICE C;  4MZ9 A;  2HHH L;  4B3R L;  3HOV G;  4RKL A;  1Y1W B;  1XTD A;  4X65 Q;  2HIX A;  2NVX B;  1S3O A;  3OHX C;  4HTH A;  5C0X H;  4NXM Q;  4A93 H;  1I5F A;  4DU9 A;  1J6Q A;  2HQL A;  2AHO B;  2NYZ D;  2B2W C;  4JYA Q;  1STG A;  3S1Q H;  1A3U A;  4NXN Q;  1FGU A;  4FDB A;  2MPM A;  1CKN B;  5FJ8 G;  4BBS G;  4B9X A;  4DGZ A;  4JI4 L;  4DV4 Q;  3J7Z C;  2WKD A;  3E9H A;  1DOK A;  2JK8 A;  4YCU A;  2BE5 C;  5J22 A;  2I5M X;  3J7A F;  1DZ1 A;  5AJ3 L;  3TRZ A;  3RD4 A;  1VQA A;  3AB9 A;  4XT3 B;  4Q5V A;  4DR6 L;  3PO3 B;  2H4O A;  4PZ6 A;  2L55 A;  1VCI A;  5JEA H;  1K8A C;  4RH6 A;  4C2M H;  5FOB B;  1GUW A;  3C3L A;  3HOZ H;  1SMY D;  3SK5 A;  1K73 C;  1Q7Y C;  3HEJ A;  4WJ4 A;  1H9M A;  2JA8 G;  1VQB A;  4QCL A;  4CKB A;  1HNX L;  2CW0 C;  2KBN A;  2MO0 A;  2JA9 A;  1EQV A;  2YU9 B;  1JOQ A;  3HRZ C;  2ZM6 Q;  4ZCK A;  1KQS A;  3U58 A;  2NVY H;  2E2I B;  3S1R B;  4DPG A;  1WCM G;  2M9V A;  2Z6K C;  1HR0 W;  4KHV A;  2KA7 A;  4DUY L;  2PQE A;  1YHQ A;  3RZO H;  5JVG 3;  1EY4 A;  3Q24 A;  2RVL A;  3A8J E;  3E3X A;  3J81 j;  3K59 A;  4B3S Q;  2JEB I;  3NWS A;  4A3B B;  3IL8 A;  3SR1 A;  3CXC A;  4RGM A;  3E5S A;  4U67 3;  4DAY B;  3PMF A;  3I4N B;  1AZQ A;  2OTJ A;  1SND A;  2EE1 A;  1V1Q A;  2HIV A;  4Y7N B;  1D6E C;  4A4I A;  5DNF A;  2XNA C;  4KJO A;  1ET9 A;  5CR3 A;  1LT6 D;  3H0G B;  3CCV A;  4DAV A;  1G51 A;  1U4M A;  5C4J B;  4ULL A;  4BY1 B;  1SAP A;  3CCU A;  4YCV A;  4DR2 Q;  2RCN A;  4H44 C;  3P20 A;  1TS5 A;  1MIU A;  4IUQ A;  2MUY A;  2QEX A;  4E6I A;  4L63 B;  1TR5 A;  2BA1 A;  2PMZ B;  4IFD H;  2XIW A;  2EZV A;  1FD7 D;  1T5X D;  4P71 A;  3T1Y L;  4A3G H;  3PSI A;  3J80 L;  1Y8N B;  2JA7 G;  3I4M H;  1B70 B;  1STN A;  1DJR D;  1STA A;  1R4Q B;  4C3J B;  1SFO B;  2NTT A;  5JOB A;  1PZI D;  3CCQ A;  5I2Y A;  3ND9 A;  1TXY A;  3MEH A;  2QDL A;  2D0P A;  1K83 H;  3ER0 A;  4KJN A;  2JA6 H;  1QNU A;  3ERO A;  1A2T A;  1KTK A;  1Q8K A;  3KF8 A;  3E6Z X;  4KHP L;  5FO8 B;  1PZJ D;  4XQJ A;  1XNQ Q;  2K5Q A;  4G57 A;  3OW7 A;  2EY1 A;  1KAA A;  3J80 E;  2A74 C;  4BY7 B;  1SE3 A;  5M5Y H;  3K80 C;  2F0H A;  1CZG A;  4LJZ C;  4L6T B;  2P5Z X;  1OXX K;  1N36 Q;  4ZQ3 A;  1I94 L;  2VQE L;  3E0J A;  2EYL A;  2C35 B;  4G7Z C;  3CME A;  1MD2 D;  1YNJ C;  2K5H A;  5IP9 H;  2WB1 E;  3GDE A;  1LTB D;  2YTY A;  3OYY A;  1LAC A;  1Q81 C;  1VQM A;  1XMO Q;  1X3F A;  3DEP A;  3HOV B;  1K8O A;  3J7Y W;  5LMU L;  4RGT A;  3H3V C;  2K7V A;  5C0X G;  4HAE A;  1VF5 C;  1EIG A;  1A8V A;  4A93 G;  3HGB A;  1KDA A;  3CPF A;  2MGS A;  3FRP B;  3PIO A;  4P74 A;  3QOL A;  1PYS B;  3KJP A;  2R3Z A;  1H9R A;  3NK9 A;  1X3P A;  3MA2 B;  1MSH A;  1MGS A;  1E3P A;  3K7A H;  2F0F A;  2AMC B;  3TSS A;  1C7Y A;  3S1N B;  2L11 A;  2X6L A;  3MZ5 A;  3RLF A;  4IUR A;  4JI2 L;  2LMC B;  1HR0 Q;  3G71 A;  1E1O A;  3SHL A;  4JI0 Q;  4S3S A;  3WOF A;  1AH9 A;  1LTL A;  2Z1C A;  4IAL A;  3S1M H;  4DK1 A;  3FMC A;  1EY5 A;  4JI8 Q;  2JXM B;  1TY2 A;  5JEA G;  1C48 A;  4FXK C;  2KUM A;  4JI5 Q;  1SYD A;  3HOZ G;  4HJ8 A;  2A5H A;  3NE5 B;  5ELB A;  2KCM A;  4A3C H;  1CKO A;  3A7L A;  1A63 A;  2R6G A;  4C3I H;  5EKL A;  4DV3 Q;  1Z9F A;  4POF A;  5GQO A;  1MSG A;  1EWI A;  5CBE E;  1WCM B;  2PO4 A;  2A69 D;  3V96 A;  2WB1 G;  4ZUJ A;  1SJE D;  4BA2 I;  2F0G A;  1HZC A;  1N34 Q;  1CSP A;  3L7Z C;  2DY7 A;  3NPP A;  3X3N A;  4CJ0 B;  4QUC A;  1IW7 D;  4JYA L;  2TMP A;  4JI7 L;  1B4O A;  4NXN L;  5C44 B;  1VQF A;  4QB4 A;  3F2C A;  4PG3 A;  4IO9 A;  2F0W A;  4K2L A;  3KDF B;  4J6H A;  2BA0 A;  2KHI A;  1KNE A;  3D31 A;  3HOX H;  4DR3 L;  2N78 A;  1PTO D;  3GD7 A;  4DV4 L;  1WTO A;  4X64 L;  4DK6 C;  4HCS A;  4MHE A;  5GRO A;  2K32 A;  2XN9 C;  1VQL A;  1I6V C;  1F9R A;  2M00 A;  1A3T A;  1EFI D;  1Y69 U;  1YI2 A;  5EJW A;  5T1G A;  1O7Y A;  3VR4 A;  1D2B A;  1WTP A;  1WTX A;  2ASB A;  1ICF B;  3I56 A;  4R8I A;  1L2F A;  5IYD H;  1LT5 D;  3M4Y A;  5IGD A;  4BA1 I;  4DAY A;  2KED A;  4R8N A;  4PV1 C;  2NVT H;  4KD3 A;  2NZH A;  4KD4 A;  3M3Y H;  1Y8O B;  3GV3 A;  1B2T A;  4IFD G;  3QWN A;  2EQS A;  1GUG A;  3BU2 A;  4FF1 A;  3OWE B;  1MKH A;  2Z8L A;  3I4M G;  4IOA A;  1VQN A;  3T1H L;  3HZX A;  2ZM6 L;  3OIQ A;  1T9H A;  2F52 A;  1XPU A;  1AFP A;  2K5N A;  5M5W H;  1BQQ T;  2A6H C;  5DM6 3;  1PTO H;  3Q0A A;  2DN8 A;  1EWH A;  5AJ3 Q;  3CC2 A;  4A76 A;  3GTK B;  4DR6 Q;  3URY A;  3CCJ A;  1K8M A;  4B3S L;  3A55 A;  4HJ5 A;  2N3S A;  2NVQ B;  1BVS A;  1QE6 A;  3QR8 A;  1TQO A;  2B63 G;  2F4V L;  5E1F A;  3HOU H;  3QIA A;  3D6W A;  3KJO A;  3E0E A;  1GVP A;  3KLS A;  1I50 B;  4ZAI A;  2UXD Q;  2N55 A;  5FKA C;  1HNX Q;  4IPG A;  4OHJ A;  1V9P A;  1P16 A;  4V19 0;  4J15 A;  5K5P A;  4GLA C;  1SE4 A;  1F9Q A;  3EVQ A;  2GVB A;  2DGY A;  3M9B A;  4HED A;  1UEA B;  1FJG Q;  3FPP A;  3WDN A;  5IYB H;  2CVR A;  3RR5 A;  1A62 A;  3I91 A;  4DAM A;  4DF7 A;  1U4L A;  1PH5 A;  2QIL A;  1MI2 A;  2E75 C;  1JE5 A;  1K0S A;  3DHQ A;  5FLM G;  4OGQ C;  1XJV A;  1IKL A;  2AUJ D;  1PH8 A;  1F9S A;  4UHV A;  1GHJ A;  3FHW A;  2RBM A;  2WFW A;  3S2H B;  3WOE A;  2OQK A;  2RCF A;  3S16 B;  2SOB A;  2R7D A;  5LMN W;  4K8I A;  5C4H A;  3CKI B;  4U68 A;  2F0I A;  4GZY C;  1C0A A;  1SSO A;  1TWG H;  4WRD A;  3ULJ A;  4JI1 L;  1GOZ A;  1IL8 A;  1WJJ A;  4C3H G;  2VUM G;  4LWC A;  1KDB A;  5E7N A;  1JE4 A;  1I4G A;  2E2D C;  1IXR A;  1BBX C;  3G6J B;  2WII B;  2ZXR A;  2JJQ A;  4DKA C;  2R7Z B;  4C1N I;  3MXN B;  3OPO A;  2QGQ A;  3J81 E;  4POG A;  1XNQ L;  1DON A;  2FHT A;  2I5H A;  3T1Y Q;  1KRT A;  4C2M B;  2F0P A;  2IL8 A;  1YNN C;  4JCV E;  4KLK A;  3GTQ H;  1LAB A;  5IP7 H;  3Q22 A;  2K33 A;  1KC8 C;  3K5O A;  4A3C G;  3SE0 A;  4F7X A;  1N36 L;  3J80 i;  1BBU A;  2B2U A;  1H9S A;  1IKM A;  1A3V A;  3OOC A;  1QWY A;  1XPR A;  4QF4 A;  3PV0 A;  2PNR C;  1E0B A;  4I7A A;  1JWU D;  2F0D A;  1TWH B;  5F2D A;  3CCL A;  1WTW A;  4A3E B;  2WB1 B;  4N9T A;  1I4X A;  3TP7 A;  5C5L A;  4FF4 A;  2UXB L;  1O78 A;  1VS0 A;  5CV9 A;  2IHE A;  5J1Z A;  4PMC A;  4GKK L;  2CW0 D;  1BBW A;  1QOH A;  5IYC H;  5DAU A;  2MNA A;  1EU3 A;  3H6M A;  3S14 H;  1KL9 A;  1EQT A;  2BDO A;  2D0O A;  2VB2 X;  3CC4 A;  3GTM B;  1VMC A;  1HCZ A;  1TWA B;  1I94 Q;  1H9K A;  2R93 H;  3QO2 A;  4A3F H;  3DWQ A;  1CSQ A;  1HZA A;  4KKT A;  3H3V I;  3HOX G;  1PZK D;  3M4O B;  1I4R A;  3TZU A;  1SNP A;  1HR0 L;  2MO1 A;  1Q12 A;  3AU7 A;  3GTJ H;  1HA5 A;  1BNZ A;  1RTN A;  4LW1 A;  3I90 A;  4JI0 L;  1QNK A;  2A6E C;  2ZTE A;  1E2Z A;  2PW7 A;  2XGT A;  2WAC A;  1JR0 D;  3LWE A;  4QL5 A;  2O5I C;  5LMU Q;  5I6Y A;  2E76 C;  4A3M G;  2EY6 A;  5IYD G;  1E1T A;  2KVM A;  3SGI A;  4JI5 L;  4GS3 A;  3KF8 B;  2XSC A;  5D14 A;  2G5D A;  5C4X B;  2SNM A;  4R1J A;  2FMM A;  3R3O A;  2F0N A;  2B2V A;  3U4Z A;  4DV3 L;  2MFI A;  4QGU A;  2I5L X;  2Y0S E;  1WI5 A;  4QQB X;  1I6H B;  1RCV D;  4X3K A;  3RN5 A;  3TEH B;  1L1O A;  1MJC A;  4P2C B;  2JA5 H;  2EYO A;  1SMX A;  2UUA L;  3OTO Q;  3TS0 A;  2L5T A;  4MTN A;  1AE3 A;  1N34 L;  4ZKC B;  1ENC A;  2RHS B;  1VQG A;  4XDX A;  2LKV A;  1CZW A;  4CJ1 B;  3HOU G;  2B63 B;  2F0V A;  2R92 H;  3NP8 A;  3CRK C;  5COY A;  3G7L A;  3S2D B;  2EJF C;  2FXQ A;  5CV8 A;  2V4D A;  4B9W A;  2OTL A;  5I9P A;  4GNX B;  2K05 A;  3DEO A;  3W3A A;  2SNS A;  4A3L G;  1LT4 D;  1WOC A;  1SN8 A;  2GA4 B;  3FKI B;  1M4V A;  1QVF A;  3F1Z A;  1UE5 A;  4BBR G;  3S9W A;  2PYK A;  5CYU A;  2F4I A;  4WOR A;  1YNX A;  4P72 A;  3PUW A;  1JMC A;  3FEW X;  3C2P A;  4FF3 A;  1WD1 A;  2XWB B;  3BG3 A;  1CKM A;  2BH8 A;  2D62 A;  1K3B C;  2YV5 A;  3UDG A;  2EXD A;  1DGS A;  3HKZ G;  1LT3 D;  1SJH D;  4JI7 Q;  4WFN 3;  4JI3 Q;  2L4N A;  4JVZ A;  4A3K H;  5C0X J;  4YCW A;  1QUQ B;  5BN3 A;  1IYJ B;  1KDC A;  2RSO A;  1EOT A;  4DR3 Q;  1TVX A;  2Y0S G;  4UP7 A;  4X64 Q;  1UNS A;  3SEB A;  2Q2H A;  5KYI A;  1EIY B;  2NN6 I;  1S72 A;  2N88 A;  2RDF A;  1TWC H;  2UUB L;  1FGB D;  1J9O A;  3NEM A;  1YJW A;  2Q8R E;  2K01 A;  3T4A C;  1C4Q A;  1G2T A;  2UUC Q;  4C3H B;  1UWV A;  3I72 A;  4CDF C;  4H02 A;  2VUM B;  1LLR D;  2A73 B;  2QW7 A;  3I3C A;  3QB3 A;  3F2B A;  4L5R C;  4XYQ A;  3OW2 A;  2B2Y A;  4X3S A;  2GVA A;  5E4W C;  1EFW A;  1SBB B;  1EY6 A;  4PMW A;  3KOJ A;  3CCR A;  3EJI A;  1IBK L;  3STB C;  2UXD L;  4DV6 Q;  1EY0 A;  3UDF A;  2IX3 A;  2HT1 A;  4HMI A;  2OWO A;  5JEA J;  1FNU A;  3V2T A;  1TWF H;  3T1H Q;  5IP7 G;  3V05 A;  2KQ3 A;  2C5C A;  3PUX A;  5DM7 3;  4IPD A;  4YWK A;  4KHZ A;  3CF5 A;  4OWW B;  1FJG L;  1EWC A;  4RA8 A;  3ND8 A;  2K5D A;  3RN2 A;  1X55 A;  3I73 A;  3GO5 A;  4ZLT F;  2IT1 A;  1S40 A;  3J7A V;  1G29 1;  2CFM A;  3D6C A;  3MXN A;  3PIP A;  3AEV A;  1B44 D;  2F4V Q;  3H3V H;  4FF2 A;  1PH9 A;  1ENF A;  3HOW B;  3D3R A;  1D5Z C;  4HR7 B;  3A5U A;  4WJ3 M;  4CDC C;  5GAG C;  1UE1 A;  1S4Z A;  1Z6H A;  4YIJ A;  1ESF A;  2YYZ A;  4OWT B;  5IYC G;  4IOC A;  1RJT A;  1I4P A;  4APV A;  1BCP F;  1C9O A;  5JJI A;  1VF7 A;  1HUN A;  1WD0 A;  1RHP A;  3F2U A;  2PZW A;  1SXT A;  4J8Q A;  1PMR A;  3VYU A;  2R93 G;  3G6E A;  3L0O A;  1GXD C;  4K5V A;  4A3F G;  5J39 A;  1U0L A;  1LTS D;  1QIL A;  2XRS D;  2F0O A;  4LFA Q;  4LF4 L;  1VQE A;  4DN4 M;  4TSS A;  1EU4 A;  2HUG A;  3GTL H;  3CAM A;  4B3T Q;  1D8L A;  4DUZ L;  3BVM A;  3CCE A;  4DA2 A;  5IGB A;  2Z9H A;  2Z6B A;  2JQO A;  4CJ2 C;  1LTA D;  4A3M B;  5M3M G;  1K8G A;  3CQZ H;  3GTG B;  3J81 i;  5M3F G;  3J81 c;  2QCP X;  2MJ8 A;  1WTQ A;  4JW0 A;  4HMJ A;  4A3D H;  4IFD J;  1NCV A;  4RMF A;  3QJY A;  4OX9 L;  3G48 A;  3RNU A;  2J0T D;  2Z4I A;  1B7Y B;  3BYY B;  4QIW E;  3U4V A;  2CH4 W;  4JI1 Q;  1JIC A;  1YHB A;  5D3I B;  1EQQ A;  3SK4 A;  3A8K E;  1U5K A;  4PMB A;  1NTG A;  5K36 G;  3R2I A;  1PTO B;  1T5E A;  3GTP B;  2PZU A;  4A3J B;  3PO2 B;  4PQX A;  1PFS A;  1UAP A;  4UP9 A;  1AEX A;  4R4I A;  4V0B A;  4LF7 Q;  2EXZ A;  3F2D A;  2KCN A;  4HIO A;  1N8R C;  3F8T A;  5ELE A;  2Q2I A;  1HJP A;  2CHB D;  1R9T H;  1GD7 A;  2MP1 A;  4X3U A;  2E74 C;  3RLN A;  3AMU A;  2EDG A;  2F3V A;  1V1O A;  1G6P A;  4I7Z C;  1AZP A;  2ATW A;  4IPC A;  4X3T A;  1F2Z A;  4LFB Q;  1LYL A;  4A3I G;  5JVH 3;  4C1N K;  1M1K C;  3TP6 A;  2CWA A;  3NQI A;  4OO1 G;  1AE2 A;  1YHA A;  4BBR B;  3HOY H;  4LFC Q;  3EA6 A;  2G9H D;  3VR2 A;  3S24 A;  4DR7 L;  3OIP A;  4P73 A;  2UXB Q;  5EQ0 A;  4JI6 Q;  2N49 A;  4M8A A;  1X56 A;  4JBW A;  2SDF A;  3M4P A;  4ZRZ A;  3K8A A;  5G3L D;  2AQ1 B;  3UE1 A;  4GKK Q;  2NN6 H;  4LAA A;  1E24 A;  3DWP A;  1JOR A;  1DOM A;  1EYC A;  1GUO A;  1BCP B;  1Y1W H;  2NVX H;  4CDE C;  4GNX A;  2G9D A;  5I9O A;  1CK1 A;  5IWA Q;  4X6A H;  1UUP A;  5FO9 B;  2EJM A;  4ID6 A;  1CA5 A;  4O0A A;  2D2C C;  4BBS B;  2L1B A;  1MJE A;  1N32 L;  1A2U A;  1W6J A;  1HRJ A;  2NUC A;  1HA6 A;  1PV4 A;  1SLJ A;  2Y0S B;  1H9S B;  3HKS A;  3K58 A;  2Q8T A;  1SMY C;  3NBI A;  4NDX A;  2RDH A;  3K7U C;  1NR4 A;  3OTO L;  2VNU D;  3ITP A;  4OIK A;  4C56 C;  2K1B A;  5JPM C;  2IX0 A;  4EVO A;  2KEC A;  1SYE A;  3AYH B;  1Q90 A;  2KCT A;  5CMD A;  3LWU A;  1QUQ A;  2KHS A;  2JA8 B;  1EUJ A;  1TKW B;  1Q82 C;  4DV1 L;  1N9W A;  2OQ0 A;  4ME3 A;  4G7H C;  1RD9 D;  4XQQ A;  3C46 A;  2PZT A;  4K0K Q;  2BDN A;  2YU9 H;  2UUA Q;  4K8J A;  2X6G A;  5FO7 B;  2E2I H;  3S1R H;  2E2J H;  5BR8 Q;  4QY7 A;  2UU9 L;  1HNZ Q;  1B3A A;  3DWA A;  4IUU A;  4K14 A;  1F2L A;  1D5M C;  1ZEQ X;  1YNN D;  1HTP A;  4RHS A;  3VDY A;  1YIT A;  4DNI A;  4JI3 L;  4F8M A;  4LF6 Q;  3TS2 A;  3BDC A;  2YTX A;  3IFT A;  2PCF B;  5EBC A;  2LFN A;  4A3B H;  5FLX E;  3RMH A;  2RKS A;  3I4L A;  2C9O A;  1PXU A;  2EY2 A;  4AQY Q;  4GLV B;  3U9S A;  4R4C A;  3NTI A;  3KLR A;  3I4N H;  2N8N A;  4OWX B;  1W3S A;  5IGF A;  5CV5 A;  4Y7N H;  5CBA E;  4EGV A;  5LL6 X;  1RDP D;  4ABN A;  4AYB E;  1L1O B;  3PF4 A;  1DCZ A;  2UUC L;  2WV6 D;  3H0G H;  3K6O A;  4FXG C;  1GUS A;  1J8I A;  5C4J H;  4EQP A;  4BY1 H;  1F77 A;  1AW7 A;  1BR9 A;  4NMZ A;  5DLQ E;  4HJ7 A;  4LF8 L;  3DXJ C;  4GN4 B;  3I7F A;  4DV6 L;  1CI3 M;  4A3G G;  1QZH A;  2HDL A;  4FO2 A;  1DXM A;  5M3M B;  4XT1 B;  2JA7 B;  2YTV A;  5M3F B;  3GTO B;  4DK3 C;  1TU2 B;  2F0U A;  1RTO A;  1Q1B A;  4GOP A;  4X66 Q;  5JPN C;  3BVZ A;  5JJL A;  2UUB Q;  1HQM C;  1PFB A;  3C1E A;  4K6L A;  1SR3 A;  4JOI A;  4C3J H;  1SFO H;  1N33 Q;  1FNW A;  4I65 A;  5C3E H;  4NKL A;  2TSS A;  4X62 Q;  2JA6 G;  3IRB A;  4RHR A;  3RZD B;  4UY8 C;  1A6X A;  1EY7 A;  1U9R A;  1RKN A;  1IBK Q;  4KKU A;  1VQ5 A;  4EQN A;  3KFU A;  1YJN A;  1I3Q B;  4KN4 C;  1LV9 A;  1W6K A;  2ZJR A;  3P1H A;  1PRT D;  4EQ5 A;  3BJU A;  1PA6 A;  1H95 A;  4KTA A;  3NEL A;  1EZ8 A;  3KUP A;  1JC7 A;  1WYD A;  2Q2U A;  2B2T A;  4BY7 H;  2DJF C;  3CPW A;  2I0Q A;  1LM0 A;  3NBH A;  3MWY W;  4LMQ D;  5EAY A;  4LFA L;  3TP5 A;  4A3I B;  2K50 A;  1HFG A;  1I4H A;  1DOL A;  5KNC A;  4AYB G;  5IP9 G;  4NB3 A;  1G91 A;  1PYB A;  1ROD A;  2RF4 A;  1NR2 A;  4Q0F A;  4B3T L;  4RGN A;  3K0X A;  3UI2 A;  2JE6 I;  4F87 A;  4LK1 C;  4OIJ A;  1OO9 B;  2FJ2 A;  3J81 L;  1EY8 A;  5IIF A;  1IYV A;  4ZUI A;  4A93 B;  3CU7 A;  4N9P A;  3TBI B;  2NN6 G;  1ZYR D;  1YZ6 A;  3AFQ A;  3HOV H;  2O5J C;  4H0L C;  3S1Q B;  3D0F A;  1X9N A;  2QA4 A;  1PYW D;  3NQT A;  4GLX A;  1FNV A;  1JQY D;  2WIN B;  4YY3 Q;  1BF4 A;  5I2X A;  1VQD A;  2IWH A;  4LF4 Q;  3BYT B;  2BOS A;  3W2D A;  3K5N A;  1F2M A;  2PQA A;  3D4R A;  4QIW B;  5FJ8 H;  1K9M C;  2LSS A;  4KY5 A;  3S1N H;  4FVM A;  4DUZ Q;  1CHQ D;  4DV0 L;  4GN3 B;  1QVG A;  1CFM A;  1SYC A;  4KY6 A;  4XIG S;  1BKB A;  3W1G A;  1F2Y A;  3Q6S A;  1Q1E A;  1KXL A;  5CV4 A;  1II3 A;  5KYL A;  4LF7 L;  3L9A X;  3HOZ B;  3RUZ A;  1U4R A;  4NP5 A;  3ZJY C;  5BN4 A;  2WAQ E;  4TRD A;  3WWV A;  2VS1 A;  1LUZ A;  3K81 C;  2A69 C;  1G8Z D;  3CD6 A;  4DNR B;  5HY6 A;  4C3I G;  4OX9 Q;  2BE5 D;  4DV2 Q;  1B3Q A;  2KCC A;  1ZKO A;  3I55 A;  4LFB L;  1E2V A;  4GN5 A;  1YVC A;  3CCM A;  2LXJ A;  5FK9 C;  2NVY B;  1CQV A;  2L0C A;  4LFC L;  5EGT A;  1IW7 C;  1FVI A;  1IBL Q;  3A54 A;  2RDG A;  4JI6 L;  1DD2 A;  2RA4 A;  3RZO B;  4DR5 L;  1WCM H;  3AFP A;  3EIV A;  5CV7 A;  1M90 C;  1OXS C;  1RL2 A;  2E5L L;  5TSS A;  1B53 A;  2IJ0 A;  1UE7 A;  2WP8 J;  4DXF A;  4DR1 Q;  1NMG A;  1QJO A;  5IWA L;  4A3B G;  1V8Q A;  1VQH A;  2ZJP A;  4MTK A;  3M4Q A;  1ASZ A;  4LUV A;  3T16 A;  1HNW L;  2JP1 A;  5C44 H;  1D1I A;  3MHB A;  1JB7 A;  1VMP A;  4ZKB B;  3I4N G;  2A19 A;  2ID0 A;  1Q86 C;  1SRU A;  1QB5 D;  4DR7 Q;  3CP0 A;  5HGT A;  4JV5 L;  1TS2 A;  2R7F A;  5KIX A;  1XPO A;  3PF5 A;  2V1C C;  3H0G G;  4JBK A;  3HKZ E;  4BY1 G;  1NY4 A;  1X32 A;  2B2W A;  1JOO A;  2K6A A;  1KIX A;  2QEJ C;  1STY A;  1E22 A;  1NSN S;  3ERQ A;  3VR6 A;  2WAQ G;  3M85 A;  5A35 A;  4A3G B;  3SDZ A;  2E8G A;  3I4M B;  3CQZ B;  4IJL A;  1N32 Q;  2IY5 B;  1BCP C;  4JBM A;  4K0K L;  4B08 A;  1ASY A;  1OXV A;  1XMQ L;  2HCI A;  3KBG A;  4IN3 A;  1JWS D;  2PW5 A;  3FVQ A;  4C3J G;  1WTR A;  3B6Y A;  2ZTC A;  4ME5 A;  5C3E G;  2B3G A;  4P75 A;  4FYD A;  1K83 B;  1V1P A;  1XTC D;  2B2U C;  5BR8 L;  4KY7 A;  1HNZ L;  3OWF A;  2JA6 B;  2PNH A;  3GTK H;  3CW2 C;  1HXY D;  2UXC Q;  3NEN A;  4LF6 L;  2E2H H;  4HSV A;  1S5D D;  2WKC A;  3BDO A;  4DV5 L;  3MTS A;  3MXG A;  1YBY A;  5LMN Q;  5EPK A;  2OF1 A;  4DV1 Q;  2K04 A;  4B3M L;  1EQR A;  1CTM A;  1VQO A;  3JC6 6;  4DAP A;  4UDU C;  4LF5 L;  4AQY L;  1GHK A;  3VYR A;  2AWN A;  2D5D A;  5FLX c;  5M5Y B;  1GKH A;  4IZ8 A;  3I2Z A;  1XWE A;  1QG7 A;  2Z6K A;  3SVM A;  1BOS A;  4BY7 G;  5IYB G;  4ZK9 B;  1LTI D;  5C4Z A;  2NB0 A;  4L5Q A;  1VQC A;  5CGK A;  3T56 B;  5C3X A;  4WJW A;  3MFY A;  3MXU A;  4AYB B;  1E7Z A;  3S15 H;  2UU9 Q;  2EYM A;  1VQ7 A;  2SEB D;  2KOL A;  4MNO A;  2IPK D;  4A75 A;  5IGC A;  4ODG A;  4O42 A;  3NTH A;  4HJ9 A;  4N8F A;  3TP8 A;  2IW3 A;  3K57 A;  4KMU C;  5ELO A;  4YWL A;  5KEE A;  4X66 L;  3SXH A;  1YNJ D;  3SK6 A;  3S2H H;  2CQA A;  3K7A B;  3Q8D A;  3S16 H;  3KF6 A;  3KLW A;  3U9O A;  1PFN A;  2F3I A;  3FP9 A;  4UP8 A;  1N33 L;  4FNF A;  2EVB A;  4LUZ A;  2ZXP A;  4X62 L;  2B2V C;  5M5X H;  1IL2 A;  1FL0 A;  3JAM E;  1PTO F;  1YJ9 A;  3S1M B;  4LF8 Q;  1ML0 D;  1C8C A;  1L1O C;  3BZK A;  4YHH Q;  5KGU A;  3T51 B;  1Y1V H;  1GM5 A;  2IX1 A;  2R7Z H;  1HH2 P;  4BS9 A;  2K14 A;  2QKI C;  2VB3 X;  4R4O A;  1VQI A;  2Q8I B;  1WFQ A;  1TY0 A;  2DY8 A;  4K2K A;  3PUY A;  4R9W A;  3MVV A;  1AP0 A;  1IHZ A;  1HTL D;  1PH6 A;  4C3I B;  1Y8P B;  3E9I A;  3S17 H;  1S5C D;  1MHW C;  4HSP A;  1L0W A;  1SYG A;  3BDL A;  1E2W A;  2VY3 A;  3J7A 5;  2XRQ D;  1O7I A;  1TWH H;  1EYA A;  1UEB A;  2E2J B;  4A3E H;  3M7G A;  2F3W A;  4R4Q A;  1BUV T;  1YEZ A;  1ICW A;  1R4P B;  2A68 C;  1KAW A;  4HID A;  1Q3L A;  1X3G A;  2L15 A;  5IT9 c;  2F0L A;  3PIO 3;  4YY3 L;  1B8A A;  2ICI A;  2NWG A;  1PH4 A;  4GOP B;  5GAD C;  1B9N A;  4RG1 A;  3GTM H;  5A2Q L;  2EJG C;  5LL6 S;  5C44 G;  3MAQ A;  1TWA H;  3HOX B;  1J5E L;  3L3O C;  1PHJ A;  4GKJ Q;  2F0Q A;  2Z0S A;  4UAI A;  1NMF A;  1PRT F;  1TII D;  4XYO A;  3M4O H;  2O2L D;  3A5Z B;  4IJH A;  1OXT A;  3OSO A;  2J4X A;  3RLO A;  4CDD C;  4QJF A;  1B50 A;  3R2T A;  3TRE A;  1SYB A;  4QMG A;  1G6Z A;  3TN2 A;  1TS3 A;  2NVT B;  3HS0 C;  2PPB C;  3M3Y B;  5D3D A;  2DJG C;  1SDF A;  2B2Y C;  2WAQ B;  4Z9C B;  3H91 A;  4EQO A;  2HQE A;  3AQQ A;  1K3R A;  4DV2 L;  1WTH A;  5C4X H;  2X69 A;  1Z7T A;  4MN3 A;  5HGQ A;  1CHP D;  3NHH A;  5EPJ A;  2B8F A;  5A2Q E;  3CCS A;  1JB3 A;  1PH7 A;  3NBH B;  5M5W B;  2JA5 G;  2B39 A;  3TZD A;  4KN7 C;  4CKE A;  1IBL L;  5I6W A;  1O7L A;  1I6H H;  4DV0 Q;  1F9P A;  2A1A A;  2VXW A;  4RWS C;  1PFM A;  5C3E B;  2ZJQ A;  4OON A;  4RKB A;  3K5L A;  2IHF A;  3KYH C;  1X3Q A;  1GUT A;  3HOU B;  2R92 G;  1B1Z A;  4DR1 L;  1XNR L;  3I70 A;  1ENA A;  2B63 H;  3I8Z A;  2A6H D;  4RAU C;  3S2D H;  2ALY B;  1EYG A;  3M7N A;  1GO3 E;  4IUP A;  3VA7 A;  3A8I E;  2CCZ A;  3A74 A;  3PUZ A;  1QCB D;  1XX8 A;  1DM0 B;  5BN5 A;  1NE3 A;  1S5F D;  1SE2 A;  2PQA B;  3FKI H;  4DR5 Q;  2L9H A;  3DM1 A;  3BS1 A;  2DNC A;  1EOV A;  5KRU A;  4R4T A;  4H13 C;  3H09 A;  2E5L Q;  2R61 A;  3HKZ B;  4BWG B;  1LTT D;  1JOK A;  1KRS A;  1LO5 D;  2KEN A;  2KEE A;  4LF9 Q;  1HZ9 A;  5EBD A;  2HD3 A;  4A3K G;  1EEI D;  2DNE A;  4TQU S;  4CHT B;  1HNW Q;  4PZ8 A;  1SEB D;  5FLM H;  2XVS A;  2J7Z A;  1Q8I A;  2I46 A;  5IOC A;  2F0E A;  2JSO A;  2EPB A;  1PRT B;  4PNY A;  4HJA A;  1OXU A;  1VDZ A;  1TWG B;  4IUN A;  4KKS A;  2VQF Q;  1JJC B;  1XYI A;  1O7Z A;  4DV7 Q;  4JV5 Q;  4H7B A;  3HFZ B;  3ZYY X;  4HIM A;  1P8L A;  3PGZ A;  1EY9 A;  2OT2 A;  2FIN B;  1VQK A;  1O80 A;  2F03 A;  1HUM A;  3PO3 H;  3EBE A;  1RF2 D;  4C3H H;  1KLG D;  2VUM H;  2UXC L;  5ELC A;  2D9U A;  5FLX L;  4RCN A;  4YWM A;  5LMN L;  1Y14 B;  4OXP A;  1Y1V G;  3MFG A;  2R7Z G;  3GTQ B;  2EYP A;  3KLS X;  3GQB A;  2OEO A;  1PLF A;  5E4X A;  2VZA A;  1CKN A;  4BXX H;  1XMQ Q;  4DR4 Q;  1IBM Q;  2AWO A;  3ONA B;  2VW9 A;  4XQN A;  1ZXT A;  3W1B A;  4AH6 A;  4ALP A;  3QG1 A;  2JYO A;  5HUR A;  1ESR A;  3PUV A;  5C6A A;  4K5X A;  1A0I A;  1HHV A;  3CHB D;  2EYF A;  4DV5 Q;  4JK1 C;  1ILQ A;  1X54 A;  2NZ1 D;  4A3E G;  2AQ2 B;  3HOW H;  1IYU A;  1TT2 A;  4B3M Q;  5CC4 A;  2EY5 A;  3EFX D;  2KHJ A;  4L8J A;  4X65 L;  4LF5 Q;  4RFB A;  3S14 B;  4NXM L;  1LTG D;  2EYJ A;  4OL7 A;  5NUC A;  1FR3 A;  3R8B A;  3MEF A;  2R93 B;  2ZT9 C;  4GNX C;  4A3F B;  1BXT A;  4NW2 A;  1HFN A;  1KAB A;  4EX5 A;  3K5M A;  4O1N A;  3DUZ A;  1FYC A;  4DFA A;  2K52 A;  3L2P A; 
#chains in the Genus database with same CATH homology
 3GTJ B;  2OXP A;  2AQ3 B;  3VYT A;  1BDO A;  3KK7 A;  3IAY A;  1V1P B;  5C3W A;  5KND A;  5AFW A;  3IFD A;  2EYH A;  3SK8 A;  1ONL A;  3P7J A;  3BVG A;  2K28 A;  5ELD A;  4KI0 A;  2A6E D;  1MBY A;  1M8A A;  3LX0 A;  3GP7 A;  2JA5 B;  1H9J A;  1STH A;  3H94 A;  2HDM A;  1A15 A;  4J1M A;  3X3M A;  4IQZ A;  5IT9 L;  1EZ6 A;  1WVL A;  1S5E D;  3MXP A;  2R92 B;  1BCP D;  2E2H B;  3FDT A;  3NXW A;  1SNQ A;  2H1E A;  3MC0 B;  1JCK B;  3N52 A;  4DXG A;  2JEA I;  1I4Q A;  2Z4H A;  5LHY 1;  3C1F A;  2K5W A;  1SNC A;  3T53 B;  1EEF D;  2QF7 A;  1HPC A;  5ELF A;  3S15 B;  1XXG A;  3VA5 A;  2ZXO A;  5IT9 E;  4XXE A;  1STB A;  4CKC A;  5I4D A;  1ILP A;  4A3K B;  3T13 A;  2LS0 1;  4OO1 I;  1CA6 A;  2BCO A;  4XTC S;  4CGY B;  5EKK A;  1TWC B;  1JWM D;  5C0X I;  3R93 A;  5KNB A;  4DNT B;  3LNN A;  3NSW A;  3P75 A;  2L12 A;  5M5X B;  1SYF A;  3VR3 A;  2HCC A;  2EOT A;  4HCE A;  3D8G A;  1HQR D;  2RQX A;  3TME A;  3VR5 A;  4QUF A;  1Y1V B;  1TWF B;  2F0K A;  5E3F A;  1BO0 A;  1U4P A;  1SNM A;  4K6D A;  3QOJ A;  2FFK B;  2LY7 A;  2NBF A;  4IUV A;  5IGG A;  3K0Y A;  5EKI A;  1EYD A;  3N6R A;  3S17 B;  3A7A B;  1G2S A;  3VYS A;  2B2T C;  1CM9 A;  2AUK A;  4DK0 A;  1B9M A;  1PTO C;  2F0M A;  5IGE A;  5CV6 A;  1TS4 A;  2ENB A;  2NTS A;  4MIU A;  3A56 A;  3NTK A;  1L0X B;  2QDB A;  4M1U B;  1EIH A;  3Q23 A;  2M2L A;  4ZYS A;  1WTV A;  3OMG A;  1GJX A;  3DMU A;  1D1K A;  1ET6 A;  4G7O C;  1SNO A;  1PDQ A;  2XWJ B;  3GTL B;  4KV6 A;  1V43 A;  3EQL C;  2A68 D;  3IKJ A;  1L0Y B;  1LTR D;  3HP3 A;  2RSN A;  3GV6 A;  4IUT A;  1D5X C;  5JJZ A;  1KNA A;  1KLU D;  2K03 A;  3HG9 A;  5G3L F;  5ISR A;  5D65 A;  4A3D B;  1Z47 A;  4CBV A;  4HN7 A;  3D4W A;  2F0T A;  3FPU B;  4FXD A;  4G4K A;  3NWT A;  1PRT C;  2F0S A;  3BZD B;  1GUN A;  3KBX A;  1EL0 A;  4IFD I;  1NUC A;  2I07 B;  2KJX A;  5K36 H;  4RGO S;  4RCO A;  5DEH A;  3PIP 3;  2O4X A;  2F1M A;  1DYQ A;  4K5W A;  3D4D A;  3O13 A;  4FP5 D;  1R9T B;  5T1I A;  5IOD A;  1CT1 D;  1NAP A;  1CQF A;  3OMC A;  2FMC A;  4TKO B;  5C5M A;  4F88 A;  1ZYR C;  3TDQ A;  3NUC A;  1AN8 A;  3HOY B;  2F0J A;  2MHV A;  3JAM L;  4KK7 A;  5M9O A;  5EPL A;  3CRL C;  1S5B D;  5JAV A;  4OO1 H;  4ILW A;  2B8G A;  1STE A;  5COR A;  2ICE C;  4RKL A;  1Y1W B;  2NVX B;  3OHX C;  4HTH A;  5C0X H;  4DU9 A;  2NYZ D;  2B2W C;  1STG A;  1A3U A;  2MPM A;  4B9X A;  4DGZ A;  2WKD A;  1DOK A;  2BE5 C;  5J22 A;  3J7A F;  1DZ1 A;  3RD4 A;  3AB9 A;  4XT3 B;  4Q5V A;  3PO3 B;  2H4O A;  2L55 A;  1VCI A;  5JEA H;  4RH6 A;  5FOB B;  1GUW A;  3C3L A;  1SMY D;  3SK5 A;  3HEJ A;  1H9M A;  4QCL A;  4CKB A;  2CW0 C;  1EQV A;  2YU9 B;  1JOQ A;  3HRZ C;  2E2I B;  3S1R B;  2M9V A;  4KHV A;  2KA7 A;  2PQE A;  5JVG 3;  1EY4 A;  3Q24 A;  2RVL A;  3A8J E;  3K59 A;  2JEB I;  3NWS A;  4A3B B;  3IL8 A;  3SR1 A;  4RGM A;  3E5S A;  4U67 3;  3PMF A;  3I4N B;  1AZQ A;  1SND A;  2EE1 A;  4Y7N B;  1D6E C;  5DNF A;  2XNA C;  4KJO A;  1ET9 A;  5CR3 A;  1LT6 D;  3H0G B;  4DAV A;  1U4M A;  5C4J B;  4ULL A;  4BY1 B;  1SAP A;  4H44 C;  3P20 A;  1TS5 A;  4IUQ A;  2MUY A;  4E6I A;  4L63 B;  1TR5 A;  2BA1 A;  2PMZ B;  4IFD H;  2XIW A;  2EZV A;  1FD7 D;  1T5X D;  3J80 L;  1Y8N B;  1STN A;  1DJR D;  1STA A;  1R4Q B;  4C3J B;  1SFO B;  2NTT A;  5JOB A;  1PZI D;  5I2Y A;  3ND9 A;  3MEH A;  4KJN A;  1QNU A;  3ERO A;  1A2T A;  1KTK A;  3KF8 A;  3E6Z X;  5FO8 B;  1PZJ D;  4XQJ A;  2K5Q A;  4G57 A;  3OW7 A;  2EY1 A;  1KAA A;  3J80 E;  2A74 C;  4BY7 B;  1SE3 A;  2F0H A;  1CZG A;  4LJZ C;  4L6T B;  1OXX K;  4ZQ3 A;  3E0J A;  2EYL A;  4G7Z C;  1MD2 D;  1YNJ C;  1LTB D;  1LAC A;  3DEP A;  3HOV B;  1K8O A;  3J7Y W;  4RGT A;  3H3V C;  2K7V A;  5C0X G;  4HAE A;  1VF5 C;  1EIG A;  3HGB A;  1KDA A;  2MGS A;  3FRP B;  3QOL A;  2R3Z A;  1H9R A;  3NK9 A;  1X3P A;  3MA2 B;  1MSH A;  1MGS A;  2F0F A;  3TSS A;  3S1N B;  2L11 A;  2X6L A;  3MZ5 A;  3RLF A;  4IUR A;  2LMC B;  3SHL A;  4S3S A;  3WOF A;  4IAL A;  2Z1C A;  4DK1 A;  3FMC A;  1EY5 A;  2JXM B;  1TY2 A;  5JEA G;  1C48 A;  4FXK C;  2KUM A;  1SYD A;  2A5H A;  3NE5 B;  5ELB A;  3A7L A;  2R6G A;  5EKL A;  1MSG A;  5CBE E;  1WCM B;  2PO4 A;  2A69 D;  3V96 A;  4ZUJ A;  1SJE D;  4BA2 I;  2F0G A;  3L7Z C;  2DY7 A;  3NPP A;  3X3N A;  4CJ0 B;  4QUC A;  1IW7 D;  2TMP A;  1B4O A;  5C44 B;  4QB4 A;  2F0W A;  4K2L A;  4J6H A;  2BA0 A;  1KNE A;  3D31 A;  1PTO D;  3GD7 A;  1WTO A;  4HCS A;  4MHE A;  2K32 A;  2XN9 C;  1I6V C;  1F9R A;  2M00 A;  1A3T A;  1EFI D;  1Y69 U;  5EJW A;  5T1G A;  1O7Y A;  3VR4 A;  1D2B A;  1WTP A;  1WTX A;  4R8I A;  1LT5 D;  3M4Y A;  5IGD A;  4BA1 I;  4DAY A;  2KED A;  4R8N A;  4PV1 C;  4KD3 A;  4KD4 A;  1Y8O B;  3GV3 A;  1B2T A;  4IFD G;  3QWN A;  1GUG A;  4FF1 A;  3OWE B;  2Z8L A;  3HZX A;  3OIQ A;  1AFP A;  1BQQ T;  2A6H C;  5DM6 3;  1PTO H;  3Q0A A;  2DN8 A;  1EWH A;  3GTK B;  3URY A;  1K8M A;  3A55 A;  2NVQ B;  1QE6 A;  1TQO A;  5E1F A;  3QIA A;  3D6W A;  3KLS A;  4ZAI A;  1I50 B;  2N55 A;  5FKA C;  4OHJ A;  4V19 0;  5K5P A;  1SE4 A;  1F9Q A;  3EVQ A;  4HED A;  1UEA B;  3FPP A;  3WDN A;  2CVR A;  3I91 A;  4DF7 A;  1U4L A;  2QIL A;  1MI2 A;  2E75 C;  3DHQ A;  4OGQ C;  1IKL A;  2AUJ D;  1F9S A;  1GHJ A;  2RBM A;  3S2H B;  3WOE A;  3S16 B;  2SOB A;  4K8I A;  5C4H A;  3CKI B;  4U68 A;  2F0I A;  4GZY C;  1SSO A;  4WRD A;  1GOZ A;  1IL8 A;  4C3H G;  1KDB A;  1JE4 A;  1I4G A;  2E2D C;  1BBX C;  3G6J B;  2WII B;  2ZXR A;  2R7Z B;  4C1N I;  3J81 E;  3OPO A;  1DON A;  2FHT A;  4C2M B;  2F0P A;  2IL8 A;  1YNN C;  1LAB A;  3Q22 A;  2K33 A;  3K5O A;  3SE0 A;  4F7X A;  2B2U A;  1H9S A;  1IKM A;  1A3V A;  3OOC A;  1QWY A;  4QF4 A;  3PV0 A;  2PNR C;  1E0B A;  1JWU D;  2F0D A;  1TWH B;  5F2D A;  1WTW A;  4A3E B;  2WB1 B;  4N9T A;  1I4X A;  3TP7 A;  5C5L A;  4FF4 A;  1O78 A;  5CV9 A;  5J1Z A;  4PMC A;  2CW0 D;  1QOH A;  5DAU A;  1EU3 A;  3H6M A;  2VB2 X;  1EQT A;  2BDO A;  3GTM B;  1VMC A;  1HCZ A;  1TWA B;  1H9K A;  3QO2 A;  3DWQ A;  4KKT A;  1PZK D;  3M4O B;  1I4R A;  3TZU A;  1SNP A;  1Q12 A;  3AU7 A;  1HA5 A;  1BNZ A;  1RTN A;  3I90 A;  1QNK A;  2A6E C;  1E2Z A;  2PW7 A;  3LWE A;  2WAC A;  1JR0 D;  2O5I C;  5I6Y A;  2E76 C;  2EY6 A;  2KVM A;  2XSC A;  5D14 A;  5C4X B;  2SNM A;  2FMM A;  3R3O A;  2F0N A;  2B2V A;  1I6H B;  1RCV D;  4X3K A;  4P2C B;  2EYO A;  2L5T A;  4ZKC B;  1ENC A;  4XDX A;  2LKV A;  1CZW A;  4CJ1 B;  2B63 B;  2F0V A;  3NP8 A;  3CRK C;  5COY A;  3G7L A;  3S2D B;  2EJF C;  5CV8 A;  2V4D A;  4B9W A;  5I9P A;  2K05 A;  3DEO A;  3W3A A;  2SNS A;  1LT4 D;  2GA4 B;  3FKI B;  1M4V A;  3S9W A;  2PYK A;  5CYU A;  2F4I A;  4WOR A;  3PUW A;  3FEW X;  3C2P A;  4FF3 A;  1WD1 A;  2XWB B;  3BG3 A;  2D62 A;  1LT3 D;  1SJH D;  4WFN 3;  2L4N A;  5C0X J;  5BN3 A;  1KDC A;  2RSO A;  1EOT A;  1TVX A;  1UNS A;  3SEB A;  5KYI A;  2NN6 I;  2N88 A;  2RDF A;  1FGB D;  1J9O A;  2Q8R E;  2K01 A;  3T4A C;  1C4Q A;  1G2T A;  4C3H B;  3I72 A;  2VUM B;  1LLR D;  2A73 B;  3I3C A;  3QB3 A;  4XYQ A;  2B2Y A;  4X3S A;  5E4W C;  1SBB B;  1EY6 A;  4PMW A;  3EJI A;  1EY0 A;  2IX3 A;  4HMI A;  5JEA J;  1FNU A;  3V2T A;  3V05 A;  2KQ3 A;  2C5C A;  3PUX A;  5DM7 3;  4KHZ A;  1EWC A;  4RA8 A;  3ND8 A;  2K5D A;  3I73 A;  3GO5 A;  4ZLT F;  2IT1 A;  3J7A V;  1G29 1;  3D6C A;  3MXN A;  1B44 D;  4FF2 A;  1ENF A;  3HOW B;  3D3R A;  1D5Z C;  4HR7 B;  1S4Z A;  1Z6H A;  4YIJ A;  1ESF A;  2YYZ A;  1RJT A;  1I4P A;  1BCP F;  1VF7 A;  1HUN A;  1WD0 A;  1RHP A;  3F2U A;  2PZW A;  1SXT A;  4J8Q A;  1PMR A;  3VYU A;  1GXD C;  4K5V A;  5J39 A;  2XRS D;  1LTS D;  1QIL A;  2F0O A;  4DN4 M;  4TSS A;  1EU4 A;  2HUG A;  3BVM A;  4DA2 A;  5IGB A;  4CJ2 C;  1LTA D;  4A3M B;  3GTG B;  2QCP X;  2MJ8 A;  1WTQ A;  4HMJ A;  4IFD J;  1NCV A;  3QJY A;  2J0T D;  2Z4I A;  3BYY B;  1JIC A;  5D3I B;  3SK4 A;  3A8K E;  4PMB A;  5K36 G;  3R2I A;  1PTO B;  1T5E A;  3GTP B;  2PZU A;  4A3J B;  3PO2 B;  4PQX A;  1UAP A;  1AEX A;  4V0B A;  2EXZ A;  2KCN A;  5ELE A;  2CHB D;  2MP1 A;  4X3U A;  2E74 C;  3AMU A;  2EDG A;  2F3V A;  1V1O A;  4I7Z C;  1AZP A;  4X3T A;  1F2Z A;  5JVH 3;  4C1N K;  3TP6 A;  3NQI A;  4OO1 G;  4BBR B;  3EA6 A;  2G9H D;  3VR2 A;  3OIP A;  5EQ0 A;  4M8A A;  4JBW A;  2SDF A;  4ZRZ A;  5G3L D;  2AQ1 B;  2NN6 H;  4LAA A;  3DWP A;  1JOR A;  1DOM A;  1EYC A;  1GUO A;  1BCP B;  2G9D A;  5I9O A;  1CK1 A;  1UUP A;  5FO9 B;  2EJM A;  4ID6 A;  1CA5 A;  2D2C C;  4BBS B;  2L1B A;  1A2U A;  1W6J A;  1HRJ A;  2NUC A;  1HA6 A;  2Y0S B;  1H9S B;  3K58 A;  2Q8T A;  1SMY C;  3NBI A;  4NDX A;  2RDH A;  1NR4 A;  2VNU D;  3ITP A;  4OIK A;  4C56 C;  2K1B A;  5JPM C;  2IX0 A;  4EVO A;  2KEC A;  1SYE A;  1Q90 A;  5CMD A;  3LWU A;  2KHS A;  2JA8 B;  1TKW B;  4G7H C;  1RD9 D;  4XQQ A;  3C46 A;  2PZT A;  2BDN A;  4K8J A;  2X6G A;  5FO7 B;  1B3A A;  3DWA A;  4IUU A;  4K14 A;  1F2L A;  1D5M C;  1ZEQ X;  1YNN D;  1HTP A;  4F8M A;  3BDC A;  3IFT A;  2PCF B;  5EBC A;  2LFN A;  5FLX E;  3RMH A;  2RKS A;  3I4L A;  2C9O A;  1PXU A;  2EY2 A;  3U9S A;  3NTI A;  3KLR A;  5IGF A;  5CV5 A;  5CBA E;  4EGV A;  5LL6 X;  1RDP D;  4ABN A;  1DCZ A;  2WV6 D;  3K6O A;  4FXG C;  1GUS A;  1J8I A;  4EQP A;  1F77 A;  1AW7 A;  1BR9 A;  4NMZ A;  3DXJ C;  1CI3 M;  2HDL A;  4FO2 A;  1DXM A;  5M3M B;  4XT1 B;  2JA7 B;  5M3F B;  3GTO B;  1TU2 B;  2F0U A;  1RTO A;  1Q1B A;  5JPN C;  3BVZ A;  1HQM C;  1PFB A;  3C1E A;  4K6L A;  1FNW A;  4I65 A;  4NKL A;  2TSS A;  4RHR A;  3RZD B;  1A6X A;  1EY7 A;  1U9R A;  1RKN A;  4KKU A;  4EQN A;  1I3Q B;  4KN4 C;  1LV9 A;  1W6K A;  3P1H A;  1PRT D;  4KTA A;  1EZ8 A;  3KUP A;  1JC7 A;  2B2T A;  3NBH A;  3MWY W;  4LMQ D;  3TP5 A;  4A3I B;  1HFG A;  1I4H A;  1DOL A;  5KNC A;  1G91 A;  1ROD A;  1NR2 A;  4Q0F A;  4RGN A;  3UI2 A;  2JE6 I;  4F87 A;  4LK1 C;  4OIJ A;  1OO9 B;  2FJ2 A;  3J81 L;  1EY8 A;  5IIF A;  1IYV A;  4ZUI A;  4A93 B;  3CU7 A;  4N9P A;  3TBI B;  2NN6 G;  1ZYR D;  2O5J C;  4H0L C;  3S1Q B;  1PYW D;  3NQT A;  1FNV A;  1JQY D;  2WIN B;  1BF4 A;  5I2X A;  2IWH A;  3BYT B;  2BOS A;  3W2D A;  3K5N A;  1F2M A;  4QIW B;  3D4R A;  4KY5 A;  4FVM A;  1CHQ D;  1SYC A;  1CFM A;  4KY6 A;  4XIG S;  1F2Y A;  3Q6S A;  1Q1E A;  5CV4 A;  1II3 A;  5KYL A;  3L9A X;  3HOZ B;  3RUZ A;  1U4R A;  4NP5 A;  5BN4 A;  4TRD A;  2A69 C;  1G8Z D;  4DNR B;  4C3I G;  2BE5 D;  2KCC A;  1ZKO A;  1E2V A;  5FK9 C;  2NVY B;  1CQV A;  2L0C A;  5EGT A;  1IW7 C;  3A54 A;  2RDG A;  1DD2 A;  2RA4 A;  3RZO B;  5CV7 A;  1OXS C;  5TSS A;  1B53 A;  2IJ0 A;  2WP8 J;  4DXF A;  1QJO A;  1V8Q A;  3T16 A;  2JP1 A;  1D1I A;  3MHB A;  1VMP A;  4ZKB B;  2ID0 A;  1QB5 D;  5HGT A;  1TS2 A;  5KIX A;  1X32 A;  2B2W A;  1JOO A;  2K6A A;  2QEJ C;  1STY A;  1NSN S;  3ERQ A;  3VR6 A;  3M85 A;  5A35 A;  4A3G B;  3SDZ A;  3I4M B;  3CQZ B;  1BCP C;  4B08 A;  1OXV A;  2HCI A;  3KBG A;  4IN3 A;  1JWS D;  2PW5 A;  3FVQ A;  4C3J G;  1WTR A;  4ME5 A;  4FYD A;  1K83 B;  1V1P A;  1XTC D;  2B2U C;  4KY7 A;  3OWF A;  2JA6 B;  1HXY D;  4HSV A;  1S5D D;  2WKC A;  3BDO A;  3MTS A;  3MXG A;  5EPK A;  2OF1 A;  2K04 A;  1CTM A;  4DAP A;  4UDU C;  1GHK A;  3VYR A;  2AWN A;  2D5D A;  5M5Y B;  4IZ8 A;  1XWE A;  1QG7 A;  3SVM A;  1BOS A;  4ZK9 B;  1LTI D;  5C4Z A;  2NB0 A;  5CGK A;  3T56 B;  5C3X A;  4WJW A;  3MFY A;  3MXU A;  4AYB B;  2EYM A;  2SEB D;  2KOL A;  2IPK D;  5IGC A;  4ODG A;  4O42 A;  3NTH A;  3TP8 A;  2IW3 A;  3K57 A;  4KMU C;  5KEE A;  3SXH A;  1YNJ D;  3SK6 A;  2CQA A;  3K7A B;  3U9O A;  1PFN A;  4FNF A;  2EVB A;  2ZXP A;  2B2V C;  3JAM E;  1PTO F;  3S1M B;  1ML0 D;  1C8C A;  5KGU A;  3T51 B;  2IX1 A;  4BS9 A;  2QKI C;  2VB3 X;  2Q8I B;  1TY0 A;  2DY8 A;  4K2K A;  3PUY A;  4R9W A;  3MVV A;  1AP0 A;  1IHZ A;  1HTL D;  4C3I B;  1Y8P B;  1S5C D;  4HSP A;  1SYG A;  3BDL A;  1E2W A;  2XRQ D;  1EYA A;  2E2J B;  3M7G A;  2F3W A;  1BUV T;  1ICW A;  1R4P B;  2A68 C;  1Q3L A;  2F0L A;  3PIO 3;  2ICI A;  2NWG A;  1B9N A;  5A2Q L;  2EJG C;  5LL6 S;  3MAQ A;  3HOX B;  3L3O C;  2F0Q A;  4UAI A;  1PRT F;  4XYO A;  1TII D;  2O2L D;  1OXT A;  3OSO A;  2J4X A;  1B50 A;  3R2T A;  1SYB A;  4QMG A;  1G6Z A;  3TN2 A;  1TS3 A;  2NVT B;  3HS0 C;  2PPB C;  3M3Y B;  5D3D A;  1SDF A;  2B2Y C;  2WAQ B;  4Z9C B;  3H91 A;  4EQO A;  2HQE A;  2X69 A;  1Z7T A;  4MN3 A;  1CHP D;  5EPJ A;  3NHH A;  2B8F A;  5A2Q E;  1JB3 A;  5M5W B;  2B39 A;  3TZD A;  4KN7 C;  4CKE A;  5I6W A;  1O7L A;  1F9P A;  2VXW A;  4RWS C;  1PFM A;  5C3E B;  4RKB A;  3K5L A;  1X3Q A;  1GUT A;  3HOU B;  1B1Z A;  3I70 A;  1ENA A;  3I8Z A;  2A6H D;  4RAU C;  3M7N A;  4IUP A;  3VA7 A;  3A8I E;  3PUZ A;  1QCB D;  1XX8 A;  1DM0 B;  5BN5 A;  1S5F D;  1SE2 A;  2L9H A;  3DM1 A;  3BS1 A;  2DNC A;  5KRU A;  4H13 C;  3H09 A;  2R61 A;  3HKZ B;  4BWG B;  1LTT D;  1JOK A;  1LO5 D;  2KEE A;  5EBD A;  1EEI D;  2DNE A;  4TQU S;  4CHT B;  1SEB D;  2XVS A;  2J7Z A;  1Q8I A;  2I46 A;  5IOC A;  2F0E A;  2JSO A;  2EPB A;  1PRT B;  4PNY A;  1OXU A;  1VDZ A;  1TWG B;  4IUN A;  4KKS A;  1XYI A;  1O7Z A;  4H7B A;  3ZYY X;  1EY9 A;  2OT2 A;  2FIN B;  1O80 A;  2F03 A;  1HUM A;  1RF2 D;  1KLG D;  5ELC A;  2D9U A;  5FLX L;  4RCN A;  3MFG A;  3GTQ B;  2EYP A;  3KLS X;  3GQB A;  2OEO A;  1PLF A;  5E4X A;  2AWO A;  3ONA B;  4XQN A;  1ZXT A;  3QG1 A;  2JYO A;  5HUR A;  1ESR A;  3PUV A;  5C6A A;  4K5X A;  1HHV A;  3CHB D;  2EYF A;  4JK1 C;  1ILQ A;  2NZ1 D;  2AQ2 B;  1IYU A;  1TT2 A;  5CC4 A;  2EY5 A;  3EFX D;  4L8J A;  4RFB A;  3S14 B;  1LTG D;  2EYJ A;  4OL7 A;  5NUC A;  1FR3 A;  3R8B A;  2R93 B;  2ZT9 C;  4A3F B;  1BXT A;  4NW2 A;  1HFN A;  1KAB A;  3K5M A;  4O1N A;  3DUZ A;  1FYC A;  4DFA A;  4RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...