2SDFA

Solution nmr structure of stromal cell-derived factor-1 (sdf-1), 30 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
67
structure length
67
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords STROMAL CELL-DERIVED FACTOR-1
publication title Solution structure and basis for functional activity of stromal cell-derived factor-1; dissociation of CXCR4 activation from binding and inhibition of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1998-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sdfA00
5CORA 1F9SA 2EE1A 2HDLA 1O7ZA 1SDFA 1WTQA 1HUNA 1NR4A 5CBEE 2B2WA 1WTPA 1BNZA 2HCIA 4ZK9B 2EOTA 1QNKA 2K01A 1MSHA 3N52A 2JP1A 1AZQA 1X3QA 3DEOA 1XYIA 5T1IA 3I90A 1CM9A 1DOMA 2RSOA 2XIWA 3QO2A 1PFBA 1RTNA 4CJ1B 1DOKA 1PLFA 1LV9A 3GV6A 4CJ0B 2HDMA 1J8IA 3DEPA 1ILPA 2KOLA 3HP3A 4HSVA 4DN4M 1QE6A 2L1BA 2VXWA 3I8ZA 4ZAIA 4R8IA 2Q8RE 1RHPA 5T1GA 1TVXA 4QUFA 1VMPA 4O42A 2N55A 1G2TA 1WTRA 1M8AA 1NAPA 1PDQA 4MN3A 2B2WC 2X6LA 3I3CA 1WTWA 2X69A 4XT1B 4IUVA 1KNAA 1C8CA 1ICWA 4XDXA 1RJTA 2NYZD 5AFWA 5COYA 1B4OA 2MJ8A 1RTOA 3MTSA 1WTXA 1ZXTA 1MGSA 2L12A 2BDNA 4XT3B 5EPLA 1WVLA 2MGSA 1F9RA 4OIKA 4UAIA 1B2TA 1HHVA 2KEEA 1HUMA 5CBAE 5EKIA 2FFKB 3KBXA 4ZLTF 1U4MA 3IL8A 2KECA 1BO0A 4OIJA 4X3KA 2FMMA 5D14A 2HUGA 5EJWA 3UI2A 1MSGA 4IUTA 1WTOA 4X3TA 2JYOA 2K05A 2M2LA 1CA5A 2B2UA 1SSOA 4IURA 1O7YA 1CA6A 3G7LA 4HEDA 3IFDA 1PFNA 1AZPA 1KNEA 1SAPA 2B2TA 2NZ1D 4U68A 2FJ2A 2RA4A 4LMQD 1U4RA 1EOTA 2KVMA 1WD0A 1HRJA 1B53A 4RWSC 1MI2A 3TN2A 4NW2A 2J7ZA 5DNFA 2K1BA 3H91A 4MHEA 1ESRA 1X3PA 2K28A 1B50A 1Q3LA 3F2UA 4R9WA 2DY8A 1ML0D 2L4NA 2N88A 1G2SA 1EIHA 1EIGA 5CMDA 4QUCA 5EPJA 2EPBA 1F9QA 1JICA 2B2UC 2FHTA 4CJ2C 4HCSA 1B3AA 4IUQA 1WTVA 1IKMA 2KUMA 1EQTA 4IUUA 3TZDA 3Q6SA 1NCVA 3D6WA 1DZ1A 2B2VA 2D9UA 2KEDA 2B2TC 4X3UA 2Q8TA 1U4LA 1E0BA 1VMCA 1PFMA 3FPUB 1G6ZA 1HA6A 1NR2A 5JJZA 1RODA 2H1EA 1ILQA 4RAUC 1XX8A 3DM1A 4IUPA 4HAEA 1BBXC 1HFNA 2FINB 1J9OA 2B2YA 2RVLA 5D65A 1O80A 3R93A 2MP1A 2MPMA 3SVMA 1WD1A 4ZKBB 1U4PA 2HCCA 2L11A 1S4ZA 5E4XA 1EL0A 5EPKA 2IL8A 1DONA 4X3SA 1IKLA 2L9HA 1F2LA 3MWYW 2DY7A 2B2VC 5E4WC 2K03A 2K04A 2SDFA 2RSNA 1F9PA 5EQ0A 1IL8A 1AP0A 1G91A 1DOLA 1HFGA 3I91A 3P7JA 2NWGA 1QG7A 2R3ZA 3GV3A 2CVRA 3LWEA 1A15A 3ONAB 2B2YC 1BF4A 1X32A 1JE4A 4RA8A 3FDTA 4ZKCB 1GUWA 2X6GA 3KUPA
chains in the Genus database with same CATH superfamily
2EYJA 2MHVA 5IT9c 2HDLA 3QJYA 4L5TA 1SDFA 2FXQA 5FO7B 5BR8Q 4A3GH 2UXCL 1MBYA 2ES2A 1PRTC 4DNRB 1AFPA 3K7AH 4IQZA 1N36L 2ICEC 3K8AA 3BU2A 3T4AC 4ULLA 4A3KB 4N9TA 2DGYA 1A2UA 3HKSA 1DOKA 5C5LA 2NVTB 3RMHA 5KEEA 3CPWA 4DN4M 2VXWA 3NP8A 4G4KA 2JA5G 3K5OA 4DAYA 1SYCA 4H13C 1HR0W 3GTOB 4KY5A 4O42A 2IHFA 2Z6KC 4XT1B 5C3WA 3E0EA 3CRKC 4B3SQ 5EKKA 2EYHA 1ZXTA 5D3IB 2ZTDA 1VQLA 3HOZB 3U4VA 4EQ5A 4X65L 4TRDA 4WJ3M 3BDLA 3G4SA 4GS3A 1LACA 1STGA 5C5MA 5JVG3 1U4MA 4OL7A 4F87A 1TY0A 2UXDQ 4A3IB 3K6OA 2EIFA 2WAQB 2JA6H 1HNZL 4C3HH 4V190 5K36H 1HJPA 4B3ML 1N34L 4GN4B 2EVBA 2K28A 3KJOA 1Q3LA 2VUMB 1K0RA 3EBEA 1JC7A 4C1NI 3CKIB 4DAPA 2RCFA 4PZ8A 3HOWG 4HCSA 1XMOL 3KFUA 1SE3A 1CQVA 1QNUA 3HOVB 4DK6C 1K8AC 3BZDB 4L6TB 1SFOH 2DN8A 4HAEA 1AH9A 1SR3A 1TU2B 3S9WA 2MP1A 3B6YA 4BY1H 4RHSA 4JI4L 3MZ5A 3DHQA 2WACA 1L0WA 5EAYA 1S4ZA 1A3VA 2JN4A 3MXUA 2OEOA 3TQYA 1EY5A 1EYDA 1SRUA 1LLRD 3MWYW 4A3MB 3E3XA 1Q1EA 2B39A 2KQ3A 2PNHA 1TWAB 4DV6L 1N33Q 4RGNA 1SROA 1NMGA 3J80i 1YNND 5FLXc 2K5DA 3NSWA 5C4XB 1VS0A 1IYUA 1UE7A 4RG1A 4FVMA 4ZK9B 4QY7A 2JP1A 1M1KC 1VQBA 3CD6A 1RTNA 1Y1WB 2J0TD 2NTSA 1LABA 1STEA 4L5SA 4IPGA 2JQOA 1XMQQ 4DV0L 1V1PB 4KMUC 2NZHA 3CCSA 4LUVA 4CDFC 3HOXG 1C9OA 1VQJA 4IFDJ 4C3JG 3OMGA 1YHBA 3NTIA 1XTCD 1EY6A 1K83H 1CT1D 3DM3A 2MJ8A 5IYCH 4DFAA 4OELB 1GOZA 1F9RA 1A3TA 5LMUQ 1SE4A 5C44B 3M85A 1EUJA 3GTJH 2PO4A 5GADC 4OIJA 3CQZB 4A3LG 3P20A 3PIPA 2ZJQA 2ICIA 1QB5D 1O7IA 2B2UA 4DV5L 4BY7H 4GZYC 4DXFA 4JV5L 1VQOA 4JI3Q 1KDCA 5C0XH 4HJ7A 3MFGA 3FEWX 2IX0A 1S72A 1E22A 1HNWQ 5I9PA 2BA1A 1VDZA 2XSCA 4KKUA 3VYSA 2YU9B 1V43A 4BXXH 1YZ6A 1XXGA 4A3DH 2WKDA 5CMDA 5IYBG 5D3DA 5KGUA 1TWGB 4X64L 3DWAA 4JI5L 4X3UA 1VMCA 4JI0Q 1PFMA 2QDBA 1OTCA 4DAVA 1KQSA 3RZOB 4QCLA 1XX8A 5HGTA 2BA0A 4DXGA 3J81i 3OOCA 4LF6Q 3A55A 3PIO3 1S5DD 1QVGA 4OWXB 1WJJA 5A2QL 2E74C 5E4XA 4DV4L 3S14B 4O2DA 3HG9A 2B2VC 3NQIA 3K5NA 3MXGA 3HGBA 1RDPD 4XQJA 1CI3M 5EGTA 1Q81C 2MO1A 3P7JA 3R3OA 4GKKL 3HRZC 5EKLA 2LMCB 4K0KL 3A8JE 3URYA 1HNXL 5IODA 3D4WA 3TREA 3A74A 2RDGA 5JPNC 3K59A 1F9SA 1I4RA 1EU4A 1LTID 3W5OA 4DGZA 2F4VL 4H0LC 1IXRA 2B2WA 3T1HL 3VR5A 2HCIA 1PVOA 1VQIA 2ID0A 2Y0SG 3H94A 3M4QA 1ENCA 2XN9C 2CKZB 4KI0A 2QCPX 2XIWA 1TY2A 1T5XD 4JK1C 1WCMB 3D4RA 2Z8LA 1GD7A 2ATWA 2L1BA 1DGSA 3D4DA 3ERQA 3ICEA 1BCPC 5T1GA 2VQEL 1DXMA 1YHAA 4KHPL 1N32L 1JWUD 3F2BA 1JJ2A 2ASBA 1PDQA 3VYUA 4GN5A 4YWLA 4X62Q 5AFWA 2WAQE 1TS2A 3EIVA 5COYA 1QVFA 2CH4A 3HFZB 2BCOA 5ELFA 2BE5C 2MGSA 4H02A 5ELBA 4P72A 5JAVA 2RHQB 3I4NG 3ERSX 2CQAA 3T13A 3JC66 1YJ9A 2F0JA 4LF4Q 4BS9A 2VS1A 5I2YA 2F3WA 2RDHA 1SNPA 4DV2L 3VR4A 3STBC 1PTOB 1SAPA 4BBRG 4NXNL 4ZUJA 2DUDA 1GUNA 2RA4A 4TVAB 1PRTF 4RWSC 1PH5A 1OXTA 2OQKA 4JI6Q 4C3IB 3MEHA 1JICA 3KF6A 2R92G 1B3AA 1SYDA 4DR1Q 3NXWA 2JA8B 4LF7Q 2PQAA 3K7AB 4KV6A 5LMNQ 1B9NA 5HGQA 3FRPB 1XJVA 1ILQA 4N8FA 1X3FA 3OW2A 2PPBC 1ENAA 3KK7A 2O2LD 4EQNA 1WD1A 1K9MC 3UDGA 2V4DA 4UPAA 2NVTH 4YCVA 1QZGA 2A6EC 2HIXA 3ND8A 4XQQA 4FF2A 3H0GG 1PYBA 1IHZA 1EWIA 3GTOH 3UE1A 2RSNA 5IP7G 4EQPA 1HFGA 2TMPA 1JQYD 1HQRD 1V9PA 1ZYRD 2ZXOA 3ONAB 4RKLA 3HOZH 4RA8A 4DA2A 4LNQA 5IGEA 3LGJA 1NTGA 2EYPA 3S1NB 3OTOQ 1BNZA 1GUTA 2Z6KA 1NMFA 3OWFA 1CKNB 1X3QA 3DEOA 3IFTA 2E5LL 1CM9A 4LF9L 2QF7A 1LV9A 5M3FB 4A3IH 4JI1Q 4B3RQ 4JPBW 2PZWA 3J80E 2R93B 4Q0FA 1SYBA 1KHIA 2F0UA 1V1QA 1PH8A 5C4ZA 1YJWA 2VUMH 2VB2X 2X6LA 4LF8Q 5I6WA 5C4JB 1F77A 1B1ZA 2ZT9C 3T51B 2BDNA 1SFOB 3V2TA 1S5ED 3HOVH 4R4QA 2DNEA 1O7LA 3NK9A 2FFKB 3KBXA 2Z4HA 4KHVA 1VF7A 3GDEA 4K6LA 3OIPA 3RLOA 1IBML 4KJNA 2JA6G 2Z0SA 3GO5A 4UHVA 3TDQA 3PUZA 1ZEQX 3PCOB 1HXYD 1EOTA 1XPRA 2XWBB 2ZM6L 4A3MH 5DNFA 1FJGQ 1NE3A 2K1BA 3H91A 4MHEA 4AYBG 3T1YL 3QG1A 3R2IA 2NN6G 1PZKD 2Z1CA 3I2ZA 1G2SA 2CH4W 4JI7L 4UP8A 3ULLA 5DEHA 4ZUIA 1NCVA 3D6WA 2GN5A 1ET6A 4KKSA 1U4LA 1BBWA 4BY1G 4X66Q 1RCVD 1L1OC 4RAUC 4DUZL 2HQLA 2E2JB 4HMIA 2FINB 1VQKA 2EDGA 2Q2IA 1A62A 1EQRA 1Y1WH 2F0EA 4XTCS 3DMUA 4DV1L 5DM73 3SGIA 1U0LA 3OMCA 4U673 1IW7D 4OO1G 3RD4A 3GTGB 4RMFA 3S16B 2XRSD 1DOLA 1I4QA 5IT9L 3DUZA 4HMJA 2QKIC 4OONA 3HOYB 3JAMi 1PRTD 4QB4A 4BBSB 2F0PA 1TS5A 3J81E 1AEXA 3AMUA 4BY7B 1SBBB 5C44H 2F0NA 3CQZH 1GM5A 3PO3B 2E2DC 5G3LD 1ASZA 1YNJC 4OWTB 5ELNA 4HJAA 1XYIA 1MJEA 1D8LA 1BVSA 1KAAA 1OO9B 1IBKL 5J22A 4CJ0B 1HR0L 2UUBL 1IBLQ 4A3BH 4LFBQ 1QE6A 5CR3A 3KLRA 3D0FA 4K5VA 4DR3L 5K5PA 2I5HA 2PI2A 2PNRC 5IYCG 5FOBB 4R4CA 5KNCA 2F0KA 5JEAH 4C1NK 5LMNW 4G7ZC 3CCMA 1A3UA 3MC0B 1RTOA 2BH8A 1TWGH 3U4ZA 4AIMA 3GTKB 1XPUA 4IZ8A 1EU3A 2F0FA 2EY5A 4HJ5A 3PF4A 4N9PA 3CPFA 4KY6A 4DR2L 4Z9CB 2EY1A 4ZLTF 2KECA 4X3KA 5EJWA 3RZOH 2F0DA 1GXDC 4LK1C 1CKNA 2DJGC 3QB3A 4U68A 1PYSB 4QJFA 2K5WA 3S14H 1HRJA 3VR2A 1I50B 1V8QA 2BOSA 2PZUA 4GKJL 2K5NA 1EY8A 2LXJA 3VYTA 1QJOA 3O13A 2PI2E 3MXNB 4A3FB 1BCPF 2WFWA 4JC0A 4CDDC 5CYUA 2B2VA 2JA9A 1HA6A 4DR5L 1I94Q 3K0YA 1E1TA 2ZTCA 1EYAA 5KYIA 2UXBQ 4R8NA 1WCMH 2JK8A 4J6HA 2L11A 4LW1A 5EPKA 1IKLA 4K5XA 5J3BA 1HH2P 3WDNA 4M8AA 4J15A 1KL9A 2CW0C 4KHZA 3PO2G 4YHHL 1GVPA 1VQDA 1EQQA 3HEJA 1HTLD 3OPOA 4XYOA 3LWEA 2A73B 4POFA 3NEMA 3GTMB 3NTKA 2EE1A 1O7ZA 3CC2A 1Q46A 3PIP3 1Y1VG 4DR7Q 1W2BA 2JE6I 4CJ1B 1TKWB 3ND9A 1PTOH 2O5JC 1J8IA 2N3SA 3H3VH 1BUVT 3SE0A 3MVVA 3HS0C 4A4IA 3R2TA 4JBMA 3C3LA 1M8AA 4GNXB 1EY7A 1RL2A 2E2IH 4XDXA 4C3IH 5C3EB 2AWOA 1UUPA 2QW7A 5IYDH 2JA5B 5EPLA 3VYRA 2JA8H 1VQ7A 1Q12A 2I5LX 4NXMQ 3H3VI 1EFWA 1QUQA 5IIFA 3F1ZA 3IRBA 2YV5A 3KDFA 4LUZA 2K4KA 1STNA 3S15B 1WYDA 3A8KE 3BYYB 3R8BA 2JYOA 2K14A 1PYWD 5CV4A 4G7HC 2A5HA 1CA6A 5GAGC 2OWOA 3A8IE 2RHSB 4RCNA 1CK1A 2G5DA 4A3CH 5BR8L 1F2ZA 4NW2A 1A8VA 4X65Q 3SEBA 4O1NA 4IUNA 4OXPA 1BBUA 2CHBD 3IKJA 4IUQA 1UE5A 2R61A 3UDFA 3S1RH 3GTPB 5H1SE 2M9VA 4LF5Q 4ZQ3A 1HZ9A 4A3KG 3S1NH 3KF8B 3J7A5 3DM1A 3S2DB 1BBXC 3E6ZX 4APVA 2M00A 1VQPA 3AB9A 4M1UB 4B3SL 2YTYA 5NUCA 3SK6A 1M4VA 4JYAQ 1VQ5A 4L8JA 5M3FH 2HCCA 1MHWC 3PF5A 2R93H 1QOHA 4NP5A 1K8MA 3HKZE 2GA4B 2UXDL 5ELEA 5C4JH 1ZKOA 2CCZA 2B2YC 1BF4A 3QR8A 4KN4C 2X6GA 3VA5A 2UUCQ 4PG3A 3SK4A 4ZRZA 1TWFB 3ULJA 3H15A 1I4GA 3ZYYX 1Z6HA 3NBHA 4A75A 2I46A 5FK9C 4IO9A 2I0QA 2WAQG 1MKHA 1BCPD 2XVSA 1X65A 2A19A 4A3JB 3TEHB 4P2CB 2HDMA 4MTKA 1OXSC 3ULPA 1HA5A 1GUOA 4IJHA 1Z7TA 5IP9G 3JAME 2EY6A 2BE5D 1CZWA 3CCEA 1G2TA 5CV8A 3W1BA 1SNQA 1VQCA 1ICWA 5FKAC 1SNOA 5E3FA 4MZ9A 1MGSA 1PTOC 1EY9A 5IE8A 1WVLA 1BQQT 3H3VC 3STBD 2EYMA 2KHJA 2JSOA 3E9IA 1D5XC 2JA7B 2MQHA 4C3JB 4X6AH 2HUGA 2E2JH 3RN2A 1N33L 1SSOA 5CV9A 1YNXA 1V1OA 5KIXA 2MNAA 2F0SA 2V1CC 1EY0A 2D0OA 1HZAA 4PMBA 3CCLA 1L1OA 1L2FA 1UEAB 2KVMA 1HPCA 3HOUG 5FJ8G 3TN2A 2MO0A 1LTTD 1X3PA 3EROA 4F88A 4R9WA 1LT6D 3GTGH 3UDXA 1ML0D 3S16H 5C4XG 3I4MB 1GUSA 4OGQC 1G6ZA 1F9QA 4DR6L 3K7UC 3HOYH 1JOQA 4BBSH 1UE1A 2D9UA 4K6DA 1D5MC 1D1IA 4FDBA 2TSSA 2F4IA 1VQNA 4Y52H 2H1EA 1Y1WG 1PMRA 2R7FA 1EZ8A 2A6ED 3PO3H 4IUPA 4A3BB 3L9AX 5D65A 1X56A 3R93A 1TXYA 4DR4L 1N9WA 1XTDA 3CMEA 1GO3E 4JBWA 2KCCA 5FLMH 3AYHB 1EYCA 2PQEA 2PW5A 2C35B 3U50C 2K5QA 4DUYL 2L5TA 3GQBA 5C0XI 3I91A 1PH2A 3KLWA 3GV3A 5C44G 4KN7C 5M5YB 4NPSA 4JCVE 4A3EG 1JE4A 3GTKH 1XPOA 2F03A 4LFCQ 2VZAA 1HNWL 5CV7A 2BH2A 4HIMA 1WTPA 3G6JB 1QNKA 3C2PA 1MSHA 2FMCA 2K5VA 2IW3A 1PH7A 1Q86C 2KA7A 3NTHA 4HSVA 4FP5D 3I8ZA 5JEAG 4HR7B 1Q82C 3EA6A 2Q8RE 4JI0L 3Q8DA 2C5CA 5GAEC 1I50H 4JI8Q 5IGGA 4C56C 1WTRA 2AQ2B 2Q2TA 4Y7NB 2VW9A 1T5EA 4FNFA 1I5FA 1H9KA 1FD7D 2IWHA 2XRQD 4B3TQ 4LF6L 1SE8A 1WTXA 4A3FH 1G6PA 4AQYQ 1AE2A 2IX1A 1FVIA 3L0OA 2CWAA 4NKLA 5ELDA 1OXUA 3UI2A 1KC8C 1MSGA 4HTHA 4IOCA 1NJIC 3J7YW 1PH3A 2EYLA 4IURA 5M3MB 5TSSA 4HEDA 4DK0A 5M9OA 3NENA 4CGYB 5JJKA 3K5MA 3RZDB 2IHEA 2LS01 2YTXA 1Y69U 1II3A 1LT5D 2VQFQ 4DV3Q 3ZJYC 3EQLC 1LTBD 1B7YB 3AU7A 5JPMC 1QWYA 3FPPA 2QEXA 4BBRB 1EQVA 2HIVA 4E6IA 2HT1A 1WTVA 1IKMA 1JJCB 4ODGA 2G9HD 1LTRD 1DZ1A 4IJLA 3GTMH 5KRUA 3FPUB 4RFBA 5JJZA 2K32A 3LNNA 2ZJRA 2KJXA 2RVLA 4X62L 2ZTEA 1G51A 1EL0A 1AN8A 1I3QB 1V1PA 3EJIA 4ME5A 4FF1A 2E2IB 2XGTA 3HZXA 4UDUC 5G3LF 1SN8A 4R1JA 4GOPB 4LF4L 1H9SB 2A69C 3GP7A 1AP0A 2F0GA 1KAWA 2MFIA 5C3EH 2CVRA 3N6RA 1SYFA 4MIUA 3QOJA 1YNJD 2JA5H 4K2KA 1CHPD 1PZJD 1WOCA 3J80L 1O78A 3CRLC 3BDCA 3CF5A 3S15H 1XNRL 4NB3A 1LO5D 1FGUA 4CKCA 1TR5A 3SXHA 1X3GA 4BA1I 2HHHQ 4DR1L 5E7NA 3DEPA 1ILPA 3U9OA 4YCUA 4LF7L 4ZAIA 1VF5C 4RGTA 1S5BD 5LMNL 4C3IG 4DU9A 3QOLA 2UU9L 4A3GG 4G57A 3S1RB 3RLFA 1R9TB 2IPKD 4WJ4A 3BVMA 2N78A 2NZOA 3MTSA 4IPCA 4LFAQ 2SOBA 3K58A 3GTPH 4UY8C 1K8OA 3T53B 1RF2D 3VDYA 1CSPA 1F2YA 1HUMA 4YY3Q 5IY0A 3OHXC 2FMMA 4IUTA 3S2DH 2M2LA 3L2PA 1AW7A 1KLUD 1L0YB 1HZBA 1A63A 1D5ZC 3S1QB 3I56A 3CCUA 1S5CD 1BR9A 1PFSA 3MA2B 1K8GA 5I6YA 3E9HA 2NVQB 5IGFA 3VA7A 1EZ6A 2EJFC 3TP7A 4HIKA 4S3SA 1CFMA 3PMFA 1S40A 2E2HB 1DJRD 4DAMA 1IBMQ 4B3RL 5HURA 3EN2A 2KEDA 1LUZA 3M7GA 4ABNA 1X9NA 4OX9Q 2PW7A 4C3HG 1RODA 1TWFH 5K36G 1NNXA 3CP0A 1HZCA 4LF8L 2K50A 2B2YA 2F0OA 1Q7YC 3MAQA 2MPMA 2CW0D 4DKAC 4A3JH 4DNIA 2VL6A 3T1YQ 2UUAQ 4B9WA 3J81L 3FKIB 2PYKA 3EVQA 4R4OA 1IZ6A 1I4XA 5FO9B 4MTNA 3BZKA 1SYEA 3PIOA 1OXVA 3K81C 3RNUA 2AUKA 1G91A 3PUXA 2VY3A 2WP8J 1D7QA 1A15A 1I6HB 5LL6X 5IWAQ 2K6AA 3K57A 1GHKA 4ZKCB 1HQMC 3BZCA 1SNDA 3TS2A 3P75A 3HOXH 4Q5VA 1FJGL 1NR4A 2JA7H 3A5ZB 3AFQA 1EFID 2BDOA 4C3JH 5FO8B 1VQAA 2PMZB 1BXTA 3N52A 4GNXC 5C3XA 5EBCA 3GTLB 1Y8NB 2D2CC 1KRSA 4FXKC 4GLXA 5CV5A 2CFMA 2HQEA 2KOLA 3BDOA 1K28A 1TWHB 1G8ZD 4A3LH 5DAUA 4P75A 1VMPA 1LT4D 1JWSD 3FP9A 3A5UA 1CTMA 5AJ3Q 4MN3A 3V96A 1WTWA 4CKEA 2F52A 3I4MH 2F0TA 2PZTA 3Q0AA 4XT3B 4F8MA 1JJGA 1FL0A 2NVYH 4BWGB 2R7ZB 2QGQA 5CBAE 3QIAA 3VR3A 3J80c 5A35A 1CHQD 3WWVA 4UP9A 3U9SA 4HIOA 1JT8A 3AFPA 1J5EQ 5IYBH 2ZXPA 3RN5A 2G9DA 3BG3A 3PUWA 2OTLA 5ELOA 2FJ2A 1B53A 4QGUA 4F7XA 2A74C 2J7ZA 3A7LA 3HOYG 4DAYB 3UE0A 1JB7A 4BBSG 1SEBD 4DR2Q 1EIHA 2KCMA 5BN3A 4DV7Q 4BY7G 5EPJA 2EPBA 4CJ2C 1UEBA 5M5YH 2YTVA 1IBLL 5C0XG 2QEJC 4KD3A 3CW2C 3NPPA 3HKZG 4A93B 2I07B 4J8QA 4ME3A 2Q2HA 3UDIA 1LT3D 4QL5A 4BXXG 1JOKA 3RUZA 4A3DG 1ESFA 4XQNA 3BVGA 2E8GA 1PH1A 2GVAA 4JI2Q 2YYZA 3G6EA 2WKCA 4DK1A 2IL8A 3LX0A 3PUVA 1PXUA 5E4WC 2B63B 2RCNA 1RKNA 3C1EA 4P71A 4Y7NH 2ALYB 1C4QA 2IX3A 2EXZA 2RQXA 1PA6A 3FDTA 5CORA 3NHHA 5CBEE 4IFDH 4KY7A 1AZQA 1LTLA 5M3MH 2EXDA 2AWNA 1B8AA 1VQFA 1JWMD 3RZDH 3J81c 2J4XA 4JBJA 1SE2A 4HSPA 3J7AF 1PTOD 1Y1VB 2E76C 3J7AV 1I94L 1RIPA 2WB1B 1XNQQ 1TS4A 1UAPA 4IFDI 1A2TA 1DCZA 4BBRH 2UXBL 3J81j 1DYQA 1BOSA 3RLNA 4CHTB 3Q22A 3M3YB 3I55A 4EQOA 1HHVA 1FNVA 2IT1A 1STAA 5D14A 1KLGD 1P16A 3M4OB 3A0JA 5JOBA 4IOAA 2R92H 3IFDA 2CQOA 4TKOB 3PV0A 1I3QH 4OHJA 1EWCA 1STHA 4FF4A 2UXCQ 3OWEB 1KTKA 4I65A 3CCQA 1ESRA 4IPDA 2L55A 1N36Q 4V0BA 2IJ0A 3WOEA 1DONA 2CWPA 4R4TA 2KUMA 3TZDA 2F0WA 1K73C 5KNBA 2AQ3B 2KHSA 4N8X1 1LTGD 4P74A 3TRZA 5IP7H 3NQTA 1X3EA 2NUCA 1NBWA 1Q90A 1CKOA 1EOVA 2ENBA 3EFXD 5FLXE 1JCKB 4FXGC 4NXML 1PV4A 4QMGA 4C2MB 2PMZE 3CC4A 4K14A 5C3EG 2L15A 4QF4A 1GUGA 2A6HC 4QQBX 1R9TH 1SMYC 1TQOA 1X32A 4KTAA 5EBDA 3CMAA 4DPGA 3M9BA 1HNZQ 3HOWB 3NWSA 2A68C 4B3MQ 3JAML 2K5HA 1N34Q 2QA4A 5C4HA 5I4DA 4EGVA 4LJZC 1YHQA 2RSOA 1EIYB 2OF1A 1YJNA 1XMOQ 4XXEA 2RKSA 4ID6A 3AQQA 3A7AB 3DLLA 3HOZG 4BA2I 3S1QH 1E2VA 1SNCA 4LF5L 1KXLA 2DNCA 3NE5B 2NVQH 1EWHA 3TSSA 1NSNS 3MXNA 5J1ZA 4ZCKA 1VQGA 4JYAL 1B4OA 4XIGS 4JI4Q 5M5WB 2KENA 2OCEA 2E2HH 3QWNA 4A3IG 1E7ZA 1JOOA 4UAIA 5EKIA 3BJUA 1GKHA 2K7VA 5JEAJ 2NN6H 4DV6Q 1E24A 1Y14B 1STBA 2VUMG 2LXKA 5C6AA 3G7LA 4FYDA 1A6XA 5JJIA 4O0AA 1U5KA 2ZXRA 3G48A 2NZ1D 4OWWB 3TP8A 3FKIH 2UUCL 5ISRA 5HY6A 2F0HA 3HOVG 2B8GA 2DJFC 4P73A 1B50A 4GLVB 2JEBI 2NN6I 2OT2A 5IGCA 3HOXB 1T9HA 1HCZA 1QZHA 1I6HH 4IUUA 3V05A 3Q6SA 3H6MA 3HOUB 1TT2A 1LTSD 4DV0Q 3FHWA 2A8VA 3F2CA 4OO1H 4A3JG 4A3MG 4GOPC 1CZGA 3CC7A 1HFNA 2GVBA 3PUYA 3GTLH 2D5DA 2A69D 4ZKBB 1U4PA 4CKBA 1D1KA 5M5XB 4HN7A 1TWHH 4DR6Q 4CBVA 4GNXA 3I70A 4OO1I 1IL8A 1S5FD 2AKWB 3L3OC 4DV5Q 2NVYB 1XMQL 2NWGA 2R3ZA 4JV5Q 4ZYSA 2JA7G 5DM63 3TP5A 2O4XA 1ONLA 3KF6B 1KABA 4DR4Q 2WB1E 2PQAB 1HUNA 5J39A 2R7ZH 2QILA 2AMCB 3S1MB 2OQ0A 3T56B 4LUOA 5IOCA 1B70B 4L5RC 5T1IA 3Q24A 4XYQA 3D8GA 1YEZA 5LMUL 1KDAA 5I9OA 4A3EB 2EQSA 3E5SA 1E1OA 4WFN3 4X64Q 2XNAC 4DUYQ 4JI5Q 4RGMA 2K33A 1KIXA 1QCBD 3I4MG 3T16A 4JI3L 1EEFD 4KJOA 3SK8A 1FR3A 1Y8OB 2N55A 1PRTB 1J6QA 1JR0D 2SEBD 3LWUA 3X3MA 2NYZD 4PNYA 2Q2UA 2JEAI 4B08A 4LWCA 3MFYA 4DV4Q 1FGBD 1E2WA 4A3BG 1CUKA 3OW7A 3KF8A 4A93H 3IL8A 2NVXB 5E1FA 1WTOA 3JAMc 3P1HA 3NBIA 1AE3A 1EEID 2LY7A 4TQUS 4GKKQ 1O7YA 3D6CA 1C7YA 1DD2A 5ELCA 1ICFB 3OIQA 1PFNA 1Q1BA 1KNEA 1AZPA 4QIWB 4K0KQ 2Y0SB 1HNXQ 1OXXK 2XTIA 3SK5A 2AHOB 4CDEC 1EIFA 4HJ8A 4LFCL 4HCEA 3A56A 1MI2A 2F4VQ 3T1HQ 2B63H 1SMXA 3F2UA 2DY8A 2L4NA 2N88A 1TWCB 1SYGA 3S2HB 2KBNA 2B2TC 1E0BA 4RCOA 1GJXA 4EVOA 1W6JA 2VQEQ 3PO2H 1ENFA 4JI8L 4KHPQ 1N32Q 3DWPA 4KLKA 3K5LA 3VR6A 3I4NB 4B3TL 4PZ6A 4IALA 3I73A 1Q8IA 4AQYL 4JOIC 4UP7A 1I6VC 3SDZA 1VCIA 2A1AA 1Y1VH 1LYLA 2K03A 1FNUA 5KNDA 1F9PA 4YWMA 4DV2Q 3DWQA 4G7OC 1ET9A 3WOFA 3GD7A 3S17B 5A2QE 4NXNQ 2D0PA 1WCMG 2B8FA 2I5MX 3S24A 4DF7A 1YI2A 3M3YH 4IFDG 4WJWA 5M3MG 1E3PA 2VQFL 4DV3L 1WTQA 2R92B 3GTQH 3BS1A 1YNNC 3M4OH 2WIIB 3MXPA 1JB3A 2D62A 2QDLA 2H5XA 3QO2A 3KOJA 4RGOS 2EJMA 1B9MA 1NY4A 5KYLA 3F2DA 1TVXA 1MIUA 4JBKA 4KD4A 1EY4A 3I3CA 3H0GB 1XWEA 4IUVA 1KNAA 5CC4A 2PCFB 1XNRQ 1SJHD 1ASYA 4JI6L 4CDCC 3CAMA 1B2TA 4A3GB 4DK3C 5L37A 1VQEA 1TIID 3FVQA 1KRTA 1QILA 1JMCA 4RHRA 5BN5A 2UU9Q 3KBGA 1N8RC 1B3QA 1BKBA 5LL6S 3CCJA 2K52A 4KK7A 1FYCA 4PMWA 4LMQD 5IYDG 1I4PA 2JA8G 4A3KH 1WD0A 4I7ZC 4C2MH 3KLSA 3KJPA 2EZVA 3CCRA 1EYGA 4K8IA 1C48A 2JJQA 2LKVA 2E5LQ 4PV1C 2Z6BA 4LF9Q 1CKMA 1M90C 2HHHL 1EQTA 2E75C 4YIJA 1K3RA 3D3RA 3SHLA 1KDBA 3HOWH 4A3CG 1I4HA 4OEMB 4AH6A 4K8JA 3CXCA 2AUJD 1UNSA 1K0SA 4RH6A 1E2ZA 1U9RA 3OTOL 4LFAL 3C1FA 1VQ8A 2EYOA 2JA6B 4C3HB 3J7ZC 1CQFA 1F2LA 4YY3L 4K5WA 4YWKA 2SNMA 4I7AA 4NMZA 1G291 2SDFA 5C0XJ 1VQ4A 4JI1L 4GN3B 1QG7A 1YVCA 4HIDA 1JORA 4AYBB 5M5WH 1X55A 5M3FG 2NTTA 1WI5A 3KUPA 4H44C 1PTOF 2Q8IB 5JVH3 3C46A 5IP9H 1H95A 4R4IA 2ZM6Q 3L7ZC 4ALPA 2R93G 3BVZA 4B9XA 1W6KA 2B29A 3I90A 4BY1B 1DOMA 4HJ9A 1UE6A 4JI7Q 1SLJA 2KHIA 3OSOA 1PLFA 2L0CA 3GV6A 1A0IA 3F8TA 1D6EC 4K2LA 2NB0A 2WINB 2RDFA 3ER0A 4OX9L 4FO2A 4QUFA 1VQMA 4JVZA 3DXJC 4PZ7A 4DUZQ 1NAPA 5JJLA 3FMCA 1Q8KA 4LAAA 2X69A 4QIWE 4DNTB 3M4PA 3W2DA 1C8CA 2Y0SE 2EYFA 3CU7A 1L0XB 2UUAL 1HTPA 1TWAH 1SXTA 2MUYA 3HOUH 5FJ8H 1R4QB 1BCPB 4OIKA 4TSSA 4DV1Q 1C0AA 2KEEA 5IGDA 1BO0A 2R7DA 5C4XH 1CA5A 3FKIG 1TS3A 3D31A 4KKTA 4WORA 4PMCA 1X6OA 4X66L 5IGBA 2HD3A 5GROA 1F2MA 2H4OA 5IWAL 2O5IC 2F0VA 3TS0A 2F0QA 3W3AA 1U4RA 5M5XH 4JG2A 1STYA 3MHBA 4H7BA 4GOPA 4RKBA 1H9SA 1IYJB 3X3NA 2B3GA 5CV6A 3M7NA 1K83B 2F3IA 1EIGA 1KD1C 1IBKQ 1VQHA 2FHTA 2B2UC 1LTAD 3TBIB 1HR0Q 2UUBQ 1R4PB 3TP6A 1W3SA 3RR5A 3W1GA 3CHBD 2Q8TA 2Z9HA 3PGZA 4DR3Q 1D2BA 3GTJB 2NBFA 1IYVA 1X54A 1QUQB 2F3VA 3S1MH 3KDFB 1PZID 4NDXA 3TZUA 3PQIA 5AJ3L 2XWJB 1J9OA 3E0JA 5I2XA 3KLSX 2EJGC 4GLAC 2K75A 3SVMA 2A6HD 4IPHA 4L5QA 4A3EH 1GHJA 2OXPA 2ZJPA 3HKZB 3NUCA 1SMYD 1DM0B 2RF4A 2SNSA 1J5EL 3PO3G 4LFBL 4A3DB 2A68D 2Z4IA 2R7ZG 2R6GA 1WFQA 4A76A 4POGA 2YU9H 5GAHC 2JXMB 5FLMG 2F1MA 1JE5A 2LSSA 3MEFA 5GQOA 1VQ6A 1P8LA 1ZYRC 2NVXH 1CSQA 2EOTA 4GKJQ 2K01A 3A54A 1SNMA 5IT9E 2RBMA 3Q23A 4DV7L 1PFBA 3I7FA 1WTHA 2KCNA 3HP3A 3PSIA 1YIJA 4R8IA 1MJCA 1RHPA 2N8NA 4DR5Q 1YBYA 4MNOA 2AQ1B 2B2WC 1VQ9A 2F0IA 3M4YA 3SR1A 1RJTA 1TWCH 4PQXA 1RD9D 2P5ZX 3PO2B 4A93G 2L12A 2VB3X 3IAYA 4JI2L 3S2HH 1B44D 3H09A 2WV6D 4L63B 1PHJA 1MD2D 5F2DA 3U58A 3AEVA 4YHHQ 4X3TA 2K05A 3NBHB 1H9JA 1K3BC 1UWVA 3I4NH 2F0LA 3KYHC 3NWTA 2B2TA 1FNWA 2B63G 4A3FG 4JW0A 4WRDA 2LFNA 1H9RA 3I4OA 4IN3A 1S3OA 2KCTA 3TMEA 3I72A 4QUCA 3S17H 4JOIA 5FLXL 1PH6A 1QVCA 1H9MA 1LM0A 3GTQB 5BN4A 3BYTB 2VNUD 1Z9FA 1NR2A 1SJED 1XNQL 3G71A 5LHY1 1NUCA 3K80C 4AYBE 2IY5B 2N49A 1O80A 3K0XA 2OTJA 5CGKA 3ITPA 1PH9A 2WB1G 5DLQE 3I4LA 4X3SA 4DR7L 2L9HA 2DY7A 1L1OB 2F0MA 1BDOA 2K04A 1IL2A 2EY2A 4J1MA 5EQ0A 3CCVA 3H0GH 4FF3A 1Z47A 3OYYA 1PH4A 2C9OA 4FXDA 3NELA 1YITA 1IW7C 4ILWA 4YCWA 4EX5A 1GUWA 1Y8PB
chains in the Genus database with same CATH topology
2EYJA 2MHVA 2HDLA 3QJYA 1SDFA 5FO7B 1MBYA 1PRTC 4DNRB 1AFPA 4IQZA 2ICEC 3T4AC 4ULLA 4A3KB 4N9TA 1A2UA 1DOKA 5C5LA 2NVTB 3RMHA 5KEEA 4DN4M 2VXWA 3NP8A 4G4KA 3K5OA 4DAYA 1SYCA 4H13C 3GTOB 4KY5A 4O42A 4XT1B 5C3WA 3CRKC 5EKKA 2EYHA 1ZXTA 5D3IB 3HOZB 4TRDA 3BDLA 1LACA 1STGA 5C5MA 5JVG3 1U4MA 4OL7A 4F87A 1TY0A 4A3IB 3K6OA 2WAQB 4V190 5K36H 2EVBA 2K28A 2VUMB 1Q3LA 4C1NI 1JC7A 3CKIB 4DAPA 4HCSA 1SE3A 1CQVA 1QNUA 3HOVB 3BZDB 4L6TB 2DN8A 4HAEA 1TU2B 3S9WA 2MP1A 4RHSA 3MZ5A 3DHQA 2WACA 1S4ZA 1A3VA 3MXUA 2OEOA 1EY5A 1EYDA 3MWYW 1LLRD 4A3MB 1Q1EA 2B39A 2KQ3A 1TWAB 4RGNA 1YNND 2K5DA 3NSWA 5C4XB 1IYUA 4FVMA 4ZK9B 2JP1A 1RTNA 1Y1WB 2J0TD 2NTSA 1LABA 1STEA 1V1PB 4KMUC 4IFDJ 4C3JG 3OMGA 1XTCD 3NTIA 1EY6A 1CT1D 2MJ8A 4DFAA 1GOZA 1F9RA 1A3TA 1SE4A 5C44B 3M85A 2PO4A 4OIJA 3CQZB 3P20A 2ICIA 1QB5D 2B2UA 4DXFA 1KDCA 5C0XH 3MFGA 3FEWX 2IX0A 5I9PA 2BA1A 1VDZA 2XSCA 4KKUA 3VYSA 2YU9B 1V43A 1XXGA 2WKDA 5CMDA 5D3DA 5KGUA 1TWGB 3DWAA 4X3UA 1VMCA 1PFMA 2QDBA 4DAVA 3RZOB 4QCLA 1XX8A 5HGTA 2BA0A 4DXGA 3OOCA 3A55A 3PIO3 1S5DD 5A2QL 2E74C 5E4XA 3S14B 3HG9A 2B2VC 3NQIA 3K5NA 3MXGA 3HGBA 1RDPD 4XQJA 1CI3M 5EGTA 3P7JA 3R3OA 3HRZC 5EKLA 2LMCB 3A8JE 3URYA 5IODA 3D4WA 2RDGA 5JPNC 3K59A 1F9SA 1I4RA 1EU4A 1LTID 4DGZA 4H0LC 2B2WA 3VR5A 2HCIA 2ID0A 3H94A 1ENCA 2XN9C 4KI0A 2QCPX 2XIWA 1TY2A 1T5XD 4JK1C 1WCMB 3D4RA 2Z8LA 2L1BA 3D4DA 3ERQA 1BCPC 5T1GA 1DXMA 1JWUD 1PDQA 3VYUA 5AFWA 5COYA 1TS2A 2BCOA 5ELFA 2BE5C 2MGSA 5ELBA 5JAVA 2CQAA 3T13A 2F0JA 4BS9A 5I2YA 2F3WA 2RDHA 1SNPA 3VR4A 1PTOB 1SAPA 4ZUJA 1GUNA 2RA4A 1PRTF 4RWSC 1OXTA 4C3IB 3MEHA 1JICA 1B3AA 1SYDA 3NXWA 2JA8B 3K7AB 4KV6A 1B9NA 3FRPB 1ILQA 2PPBC 1ENAA 3KK7A 2O2LD 4EQNA 1WD1A 2V4DA 2A6EC 3ND8A 4XQQA 4FF2A 1IHZA 2RSNA 4EQPA 1HFGA 2TMPA 1JQYD 1HQRD 1ZYRD 2ZXOA 3ONAB 4RKLA 4RA8A 4DA2A 5IGEA 2EYPA 3S1NB 1BNZA 1GUTA 3OWFA 1X3QA 3DEOA 3IFTA 1CM9A 2QF7A 1LV9A 5M3FB 2R93B 2PZWA 3J80E 4Q0FA 1SYBA 2F0UA 5C4ZA 2VB2X 2X6LA 5I6WA 5C4JB 1F77A 1B1ZA 2ZT9C 3T51B 2BDNA 1SFOB 3V2TA 1S5ED 2DNEA 1O7LA 3NK9A 2FFKB 3KBXA 2Z4HA 4KHVA 1VF7A 4K6LA 3OIPA 4KJNA 3GO5A 3TDQA 3PUZA 1ZEQX 1HXYD 1EOTA 2XWBB 5DNFA 2K1BA 3H91A 4MHEA 3QG1A 3R2IA 2NN6G 1PZKD 2Z1CA 1G2SA 5DEHA 4ZUIA 1NCVA 3D6WA 1ET6A 4KKSA 1U4LA 1RCVD 4RAUC 2E2JB 4HMIA 2FINB 2EDGA 2F0EA 4XTCS 3DMUA 5DM73 3OMCA 4U673 1IW7D 4OO1G 3RD4A 3GTGB 3S16B 2XRSD 1DOLA 1I4QA 5IT9L 3DUZA 4HMJA 2QKIC 3HOYB 1PRTD 4QB4A 4BBSB 2F0PA 1TS5A 3J81E 1AEXA 3AMUA 4BY7B 1SBBB 2F0NA 3PO3B 2E2DC 5G3LD 1YNJC 1XYIA 1KAAA 1OO9B 5J22A 4CJ0B 1QE6A 5CR3A 3KLRA 4K5VA 5K5PA 2PNRC 5FOBB 5KNCA 2F0KA 5JEAH 4C1NK 4G7ZC 1A3UA 3MC0B 1RTOA 3GTKB 4IZ8A 1EU3A 2F0FA 2EY5A 4N9PA 4KY6A 4Z9CB 2EY1A 4ZLTF 2KECA 4X3KA 5EJWA 2F0DA 1GXDC 4LK1C 3QB3A 4U68A 2K5WA 1HRJA 3VR2A 1I50B 1V8QA 2BOSA 2PZUA 1EY8A 3VYTA 1QJOA 3O13A 4A3FB 1BCPF 5CYUA 2B2VA 1HA6A 3K0YA 1EYAA 5KYIA 4R8NA 4J6HA 2L11A 5EPKA 1IKLA 4K5XA 3WDNA 4M8AA 2CW0C 4KHZA 3HEJA 1HTLD 3OPOA 4XYOA 3LWEA 2A73B 3GTMB 3NTKA 2EE1A 1O7ZA 3PIP3 2JE6I 4CJ1B 1TKWB 3ND9A 1PTOH 2O5JC 1J8IA 1BUVT 3SE0A 3MVVA 3HS0C 3R2TA 3C3LA 1M8AA 1EY7A 4XDXA 5C3EB 2AWOA 1UUPA 2JA5B 5EPLA 3VYRA 1Q12A 5IIFA 1STNA 3S15B 3A8KE 3BYYB 3R8BA 2JYOA 5CV4A 1PYWD 4G7HC 2A5HA 1CA6A 3A8IE 4RCNA 1CK1A 1F2ZA 4NW2A 3SEBA 4O1NA 4IUNA 2CHBD 3IKJA 4IUQA 2R61A 3GTPB 2M9VA 4ZQ3A 3DM1A 3S2DB 1BBXC 3E6ZX 2M00A 3AB9A 4M1UB 5NUCA 3SK6A 1M4VA 4L8JA 2HCCA 1QOHA 4NP5A 1K8MA 2GA4B 5ELEA 1ZKOA 2B2YC 1BF4A 4KN4C 2X6GA 3VA5A 3SK4A 4ZRZA 1TWFB 1I4GA 3ZYYX 1Z6HA 3NBHA 2I46A 5FK9C 1BCPD 2XVSA 4A3JB 4P2CB 2HDMA 1OXSC 1HA5A 1GUOA 1Z7TA 3JAME 2EY6A 2BE5D 1CZWA 1G2TA 5CV8A 1SNQA 1ICWA 5FKAC 1SNOA 5E3FA 1MGSA 1PTOC 1EY9A 1WVLA 1BQQT 3H3VC 2EYMA 2JSOA 1D5XC 2JA7B 4C3JB 2HUGA 1SSOA 5CV9A 1V1OA 5KIXA 2F0SA 1EY0A 4PMBA 1UEAB 2KVMA 1HPCA 3TN2A 1LTTD 1X3PA 3EROA 4F88A 4R9WA 1LT6D 1ML0D 3I4MB 1GUSA 4OGQC 1G6ZA 1F9QA 1JOQA 2D9UA 4K6DA 1D5MC 1D1IA 2TSSA 2F4IA 2H1EA 1PMRA 1EZ8A 2A6ED 4IUPA 4A3BB 3L9AX 5D65A 3R93A 4JBWA 2KCCA 1EYCA 2PQEA 2PW5A 2K5QA 2L5TA 3GQBA 5C0XI 3I91A 3GV3A 4KN7C 5M5YB 1JE4A 2F03A 5CV7A 1WTPA 3G6JB 1QNKA 3C2PA 1MSHA 2FMCA 2IW3A 2KA7A 3NTHA 4HSVA 4FP5D 3I8ZA 5JEAG 4HR7B 3EA6A 2Q8RE 2C5CA 5IGGA 4C56C 1WTRA 2AQ2B 4Y7NB 1T5EA 4FNFA 1H9KA 1FD7D 2IWHA 2XRQD 1WTXA 2IX1A 4NKLA 5ELDA 1OXUA 3UI2A 1MSGA 4HTHA 3J7YW 2EYLA 4IURA 5M3MB 5TSSA 4HEDA 4DK0A 5M9OA 4CGYB 3K5MA 3RZDB 2LS01 1Y69U 1II3A 1LT5D 3EQLC 1LTBD 3AU7A 5JPMC 1QWYA 3FPPA 4BBRB 1EQVA 4E6IA 1IKMA 1WTVA 4ODGA 2G9HD 1LTRD 1DZ1A 5KRUA 3FPUB 4RFBA 5JJZA 2K32A 3LNNA 2KJXA 2RVLA 1EL0A 1AN8A 1I3QB 1V1PA 3EJIA 4ME5A 4FF1A 2E2IB 3HZXA 4UDUC 5G3LF 1H9SB 2A69C 3GP7A 1AP0A 2F0GA 2CVRA 3N6RA 1SYFA 4MIUA 3QOJA 1YNJD 4K2KA 1CHPD 1PZJD 3J80L 1O78A 3CRLC 3BDCA 1LO5D 4CKCA 1TR5A 3SXHA 4BA1I 3DEPA 1ILPA 3U9OA 4ZAIA 1VF5C 4RGTA 1S5BD 4C3IG 4DU9A 3QOLA 4G57A 3S1RB 3RLFA 1R9TB 2IPKD 3BVMA 3MTSA 2SOBA 3K58A 1K8OA 3T53B 1RF2D 1F2YA 1HUMA 3OHXC 2FMMA 4IUTA 2M2LA 1AW7A 1KLUD 1L0YB 1D5ZC 3S1QB 1S5CD 1BR9A 3MA2B 5I6YA 2NVQB 5IGFA 3VA7A 1EZ6A 2EJFC 3TP7A 4S3SA 1CFMA 3PMFA 2E2HB 1DJRD 5HURA 2KEDA 3M7GA 4ABNA 2PW7A 4C3HG 1RODA 5K36G 2B2YA 2F0OA 3MAQA 2MPMA 2CW0D 4B9WA 3J81L 3FKIB 2PYKA 3EVQA 1I4XA 5FO9B 1SYEA 1OXVA 2AUKA 1G91A 3PUXA 2WP8J 1A15A 1I6HB 5LL6X 2K6AA 3K57A 1GHKA 4ZKCB 1HQMC 1SNDA 3P75A 4Q5VA 1NR4A 4GZYC 1EFID 2BDOA 5FO8B 2PMZB 1BXTA 3N52A 5C3XA 5EBCA 3GTLB 1Y8NB 2D2CC 4FXKC 5CV5A 2HQEA 2KOLA 3BDOA 1TWHB 1G8ZD 5DAUA 1VMPA 1LT4D 1JWSD 1CTMA 4MN3A 3V96A 1WTWA 4CKEA 2F0TA 2PZTA 3Q0AA 4XT3B 4F8MA 4BWGB 2R7ZB 5CBAE 3QIAA 3VR3A 5A35A 1CHQD 3U9SA 2ZXPA 2G9DA 3BG3A 3PUWA 2FJ2A 1B53A 4F7XA 2A74C 2J7ZA 3A7LA 1SEBD 1EIHA 5BN3A 5EPJA 2EPBA 4CJ2C 5C0XG 2QEJC 4KD3A 3NPPA 4A93B 2I07B 4J8QA 1LT3D 1JOKA 3RUZA 1ESFA 4XQNA 3BVGA 2YYZA 2WKCA 4DK1A 2IL8A 3LX0A 3PUVA 1PXUA 5E4WC 2B63B 1RKNA 3C1EA 1C4QA 2IX3A 2EXZA 2RQXA 3FDTA 5CORA 3NHHA 5CBEE 4IFDH 4KY7A 1AZQA 2AWNA 1JWMD 2J4XA 1SE2A 4HSPA 3J7AF 1PTOD 1Y1VB 2E76C 3J7AV 2WB1B 1TS4A 1UAPA 4IFDI 1DCZA 1A2TA 1DYQA 1BOSA 3Q22A 4CHTB 3M3YB 4EQOA 1HHVA 1FNVA 2IT1A 1STAA 5D14A 1KLGD 3M4OB 5JOBA 3IFDA 4TKOB 3PV0A 4OHJA 1EWCA 1STHA 4FF4A 3OWEB 1KTKA 4I65A 1ESRA 2L55A 4V0BA 2IJ0A 3WOEA 1DONA 2KUMA 3TZDA 2F0WA 5KNBA 2AQ3B 2KHSA 1LTGD 3NQTA 2NUCA 1Q90A 2ENBA 3EFXD 5FLXE 1JCKB 4FXGC 4QMGA 4C2MB 4K14A 4QF4A 1GUGA 2A6HC 1SMYC 1TQOA 1X32A 4KTAA 5EBDA 3HOWB 3NWSA 2A68C 3JAML 5C4HA 5I4DA 4EGVA 4LJZC 2RSOA 2OF1A 4XXEA 2RKSA 4ID6A 3A7AB 4BA2I 1E2VA 1SNCA 2DNCA 3NE5B 3TSSA 1EWHA 1NSNS 3MXNA 5J1ZA 1B4OA 4XIGS 5M5WB 3QWNA 1JOOA 4UAIA 5EKIA 2K7VA 5JEAJ 2NN6H 1STBA 5C6AA 3G7LA 4FYDA 1A6XA 2ZXRA 2NZ1D 3TP8A 5ISRA 2F0HA 2B8GA 1B50A 2JEBI 2NN6I 2OT2A 5IGCA 3HOXB 1HCZA 4IUUA 3V05A 3Q6SA 3H6MA 3HOUB 1TT2A 1LTSD 4OO1H 1CZGA 1HFNA 3PUYA 2D5DA 2A69D 4ZKBB 1U4PA 4CKBA 1D1KA 5M5XB 4HN7A 4CBVA 3I70A 4OO1I 1IL8A 1S5FD 3L3OC 2NVYB 2NWGA 2R3ZA 4ZYSA 5DM63 3TP5A 2O4XA 1ONLA 1KABA 1HUNA 5J39A 2QILA 3S1MB 3T56B 5IOCA 5T1IA 3Q24A 4XYQA 3D8GA 1KDAA 5I9OA 4A3EB 3E5SA 4WFN3 2XNAC 4RGMA 2K33A 1QCBD 3T16A 1EEFD 4KJOA 3SK8A 1FR3A 1Y8OB 2N55A 1PRTB 1JR0D 2SEBD 3LWUA 3X3MA 2NYZD 4PNYA 2JEAI 4B08A 3MFYA 1FGBD 1E2WA 3OW7A 3KF8A 3IL8A 2NVXB 5E1FA 1WTOA 3P1HA 3NBIA 1EEID 2LY7A 4TQUS 1O7YA 3D6CA 1DD2A 5ELCA 3OIQA 1PFNA 1Q1BA 1KNEA 1AZPA 4QIWB 2Y0SB 1OXXK 3SK5A 4HCEA 3A56A 1MI2A 3F2UA 2DY8A 2L4NA 2N88A 1TWCB 1SYGA 3S2HB 2B2TC 1E0BA 4RCOA 1GJXA 4EVOA 1W6JA 1ENFA 3DWPA 3K5LA 3VR6A 3I4NB 4IALA 3I73A 1Q8IA 1I6VC 3SDZA 1VCIA 2K03A 1FNUA 5KNDA 1F9PA 3DWQA 4G7OC 1ET9A 3WOFA 3GD7A 3S17B 5A2QE 2B8FA 4DF7A 4IFDG 4WJWA 1WTQA 2R92B 3BS1A 1YNNC 2WIIB 3MXPA 1JB3A 2D62A 3QO2A 4RGOS 2EJMA 1B9MA 5KYLA 1TVXA 4KD4A 1EY4A 3I3CA 3H0GB 1XWEA 4IUVA 1KNAA 5CC4A 2PCFB 1SJHD 1B2TA 4A3GB 1TIID 3FVQA 1QILA 4RHRA 5BN5A 3KBGA 5LL6S 4KK7A 1FYCA 4PMWA 4LMQD 1I4PA 1WD0A 4I7ZC 3KLSA 2EZVA 4K8IA 1C48A 2LKVA 4PV1C 1EQTA 2E75C 4YIJA 3D3RA 3SHLA 1KDBA 1I4HA 4K8JA 2AUJD 1UNSA 4RH6A 1E2ZA 1U9RA 3C1FA 2EYOA 2JA6B 4C3HB 1CQFA 1F2LA 4K5WA 2SNMA 4NMZA 1G291 2SDFA 5C0XJ 1QG7A 1JORA 4AYBB 2NTTA 2Q8IB 3KUPA 4H44C 1PTOF 3C46A 5JVH3 3L7ZC 3BVZA 4B9XA 1W6KA 3I90A 4BY1B 1DOMA 3OSOA 1PLFA 2L0CA 3GV6A 1D6EC 4K2LA 2NB0A 2WINB 2RDFA 4FO2A 4QUFA 3DXJC 1NAPA 3FMCA 4LAAA 2X69A 4DNTB 3W2DA 1C8CA 2EYFA 3CU7A 1L0XB 1HTPA 1SXTA 2MUYA 1R4QB 1BCPB 4OIKA 4TSSA 2KEEA 5IGDA 1BO0A 1CA5A 1TS3A 3D31A 4KKTA 4WORA 4PMCA 5IGBA 1F2MA 2H4OA 2O5IC 2F0VA 2F0QA 3W3AA 1U4RA 1STYA 3MHBA 4H7BA 4RKBA 1H9SA 3X3NA 5CV6A 3M7NA 1K83B 1EIGA 2FHTA 2B2UC 1LTAD 3TBIB 1R4PB 3TP6A 3CHBD 2Q8TA 1D2BA 3GTJB 2NBFA 1IYVA 2F3VA 3TZUA 1PZID 4NDXA 2XWJB 1J9OA 3E0JA 5I2XA 3KLSX 2EJGC 3SVMA 2A6HD 1GHJA 2OXPA 3HKZB 3NUCA 1SMYD 1DM0B 2SNSA 4A3DB 2A68D 2Z4IA 2R6GA 2JXMB 2F1MA 1ZYRC 2EOTA 2K01A 3A54A 1SNMA 5IT9E 2RBMA 3Q23A 1PFBA 2KCNA 3HP3A 4R8IA 1RHPA 2AQ1B 2B2WC 2F0IA 3M4YA 3SR1A 1RJTA 4PQXA 1RD9D 3PO2B 2L12A 2VB3X 3IAYA 1B44D 3H09A 2WV6D 4L63B 1MD2D 5F2DA 4X3TA 2K05A 1H9JA 2F0LA 3NWTA 2B2TA 1FNWA 4WRDA 2LFNA 1H9RA 4IN3A 3TMEA 3I72A 4QUCA 5FLXL 1H9MA 3GTQB 5BN4A 3BYTB 2VNUD 1NR2A 1SJED 5LHY1 1NUCA 1O80A 5CGKA 3ITPA 3I4LA 4X3SA 2L9HA 2DY7A 2F0MA 1BDOA 2K04A 2EY2A 4J1MA 5EQ0A 4FF3A 1Z47A 2C9OA 4FXDA 1IW7C 4ILWA 1GUWA 1Y8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COR A;  1F9S A;  2EE1 A;  2HDL A;  1O7Z A;  1SDF A;  1WTQ A;  1HUN A;  1NR4 A;  5CBE E;  2B2W A;  1WTP A;  1BNZ A;  2HCI A;  4ZK9 B;  2EOT A;  1QNK A;  2K01 A;  1MSH A;  3N52 A;  2JP1 A;  1AZQ A;  1X3Q A;  3DEO A;  1XYI A;  5T1I A;  3I90 A;  1CM9 A;  1DOM A;  2RSO A;  2XIW A;  3QO2 A;  1PFB A;  1RTN A;  4CJ1 B;  1DOK A;  1PLF A;  1LV9 A;  3GV6 A;  4CJ0 B;  2HDM A;  1J8I A;  3DEP A;  1ILP A;  2KOL A;  3HP3 A;  4HSV A;  4DN4 M;  1QE6 A;  2L1B A;  2VXW A;  3I8Z A;  4ZAI A;  4R8I A;  2Q8R E;  1RHP A;  5T1G A;  1TVX A;  4QUF A;  1VMP A;  4O42 A;  2N55 A;  1G2T A;  1WTR A;  1M8A A;  1NAP A;  1PDQ A;  4MN3 A;  2B2W C;  2X6L A;  3I3C A;  1WTW A;  2X69 A;  4XT1 B;  4IUV A;  1KNA A;  1C8C A;  1ICW A;  4XDX A;  1RJT A;  2NYZ D;  5AFW A;  5COY A;  1B4O A;  2MJ8 A;  1RTO A;  3MTS A;  1WTX A;  1ZXT A;  1MGS A;  2L12 A;  2BDN A;  4XT3 B;  5EPL A;  1WVL A;  2MGS A;  1F9R A;  4OIK A;  4UAI A;  1B2T A;  1HHV A;  2KEE A;  1HUM A;  5CBA E;  5EKI A;  2FFK B;  3KBX A;  4ZLT F;  1U4M A;  3IL8 A;  2KEC A;  1BO0 A;  4OIJ A;  4X3K A;  2FMM A;  5D14 A;  2HUG A;  5EJW A;  3UI2 A;  1MSG A;  4IUT A;  1WTO A;  4X3T A;  2JYO A;  2K05 A;  2M2L A;  1CA5 A;  2B2U A;  1SSO A;  4IUR A;  1O7Y A;  1CA6 A;  3G7L A;  4HED A;  3IFD A;  1PFN A;  1AZP A;  1KNE A;  1SAP A;  2B2T A;  2NZ1 D;  4U68 A;  2FJ2 A;  2RA4 A;  4LMQ D;  1U4R A;  1EOT A;  2KVM A;  1WD0 A;  1HRJ A;  1B53 A;  4RWS C;  1MI2 A;  3TN2 A;  4NW2 A;  2J7Z A;  5DNF A;  2K1B A;  3H91 A;  4MHE A;  1ESR A;  1X3P A;  2K28 A;  1B50 A;  1Q3L A;  3F2U A;  4R9W A;  2DY8 A;  1ML0 D;  2L4N A;  2N88 A;  1G2S A;  1EIH A;  1EIG A;  5CMD A;  4QUC A;  5EPJ A;  2EPB A;  1F9Q A;  1JIC A;  2B2U C;  2FHT A;  4CJ2 C;  4HCS A;  1B3A A;  4IUQ A;  1WTV A;  1IKM A;  2KUM A;  1EQT A;  4IUU A;  3TZD A;  3Q6S A;  1NCV A;  3D6W A;  1DZ1 A;  2B2V A;  2D9U A;  2KED A;  2B2T C;  4X3U A;  2Q8T A;  1U4L A;  1E0B A;  1VMC A;  1PFM A;  3FPU B;  1G6Z A;  1HA6 A;  1NR2 A;  5JJZ A;  1ROD A;  2H1E A;  1ILQ A;  4RAU C;  1XX8 A;  3DM1 A;  4IUP A;  4HAE A;  1BBX C;  1HFN A;  2FIN B;  1J9O A;  2B2Y A;  2RVL A;  5D65 A;  1O80 A;  3R93 A;  2MP1 A;  2MPM A;  3SVM A;  1WD1 A;  4ZKB B;  1U4P A;  2HCC A;  2L11 A;  1S4Z A;  5E4X A;  1EL0 A;  5EPK A;  2IL8 A;  1DON A;  4X3S A;  1IKL A;  2L9H A;  1F2L A;  3MWY W;  2DY7 A;  2B2V C;  5E4W C;  2K03 A;  2K04 A;  2SDF A;  2RSN A;  1F9P A;  5EQ0 A;  1IL8 A;  1AP0 A;  1G91 A;  1DOL A;  1HFG A;  3I91 A;  3P7J A;  2NWG A;  1QG7 A;  2R3Z A;  3GV3 A;  2CVR A;  3LWE A;  1A15 A;  3ONA B;  2B2Y C;  1BF4 A;  1X32 A;  1JE4 A;  4RA8 A;  3FDT A;  4ZKC B;  1GUW A;  2X6G A;  3KUP A; 
#chains in the Genus database with same CATH topology
 2EYJ A;  2MHV A;  5IT9 c;  2HDL A;  3QJY A;  4L5T A;  1SDF A;  2FXQ A;  5FO7 B;  5BR8 Q;  4A3G H;  2UXC L;  1MBY A;  2ES2 A;  1PRT C;  4DNR B;  1AFP A;  3K7A H;  4IQZ A;  1N36 L;  2ICE C;  3K8A A;  3BU2 A;  3T4A C;  4ULL A;  4A3K B;  4N9T A;  2DGY A;  1A2U A;  3HKS A;  1DOK A;  5C5L A;  2NVT B;  3RMH A;  5KEE A;  3CPW A;  4DN4 M;  2VXW A;  3NP8 A;  4G4K A;  2JA5 G;  3K5O A;  4DAY A;  1SYC A;  4H13 C;  1HR0 W;  3GTO B;  4KY5 A;  4O42 A;  2IHF A;  2Z6K C;  4XT1 B;  5C3W A;  3E0E A;  3CRK C;  4B3S Q;  5EKK A;  2EYH A;  1ZXT A;  5D3I B;  2ZTD A;  1VQL A;  3HOZ B;  3U4V A;  4EQ5 A;  4X65 L;  4TRD A;  4WJ3 M;  3BDL A;  3G4S A;  4GS3 A;  1LAC A;  1STG A;  5C5M A;  5JVG 3;  1U4M A;  4OL7 A;  4F87 A;  1TY0 A;  2UXD Q;  4A3I B;  3K6O A;  2EIF A;  2WAQ B;  2JA6 H;  1HNZ L;  4C3H H;  4V19 0;  5K36 H;  1HJP A;  4B3M L;  1N34 L;  4GN4 B;  2EVB A;  2K28 A;  3KJO A;  1Q3L A;  2VUM B;  1K0R A;  3EBE A;  1JC7 A;  4C1N I;  3CKI B;  4DAP A;  2RCF A;  4PZ8 A;  3HOW G;  4HCS A;  1XMO L;  3KFU A;  1SE3 A;  1CQV A;  1QNU A;  3HOV B;  4DK6 C;  1K8A C;  3BZD B;  4L6T B;  1SFO H;  2DN8 A;  4HAE A;  1AH9 A;  1SR3 A;  1TU2 B;  3S9W A;  2MP1 A;  3B6Y A;  4BY1 H;  4RHS A;  4JI4 L;  3MZ5 A;  3DHQ A;  2WAC A;  1L0W A;  5EAY A;  1S4Z A;  1A3V A;  2JN4 A;  3MXU A;  2OEO A;  3TQY A;  1EY5 A;  1EYD A;  1SRU A;  1LLR D;  3MWY W;  4A3M B;  3E3X A;  1Q1E A;  2B39 A;  2KQ3 A;  2PNH A;  1TWA B;  4DV6 L;  1N33 Q;  4RGN A;  1SRO A;  1NMG A;  3J80 i;  1YNN D;  5FLX c;  2K5D A;  3NSW A;  5C4X B;  1VS0 A;  1IYU A;  1UE7 A;  4RG1 A;  4FVM A;  4ZK9 B;  4QY7 A;  2JP1 A;  1M1K C;  1VQB A;  3CD6 A;  1RTN A;  1Y1W B;  2J0T D;  2NTS A;  1LAB A;  1STE A;  4L5S A;  4IPG A;  2JQO A;  1XMQ Q;  4DV0 L;  1V1P B;  4KMU C;  2NZH A;  3CCS A;  4LUV A;  4CDF C;  3HOX G;  1C9O A;  1VQJ A;  4IFD J;  4C3J G;  3OMG A;  1YHB A;  3NTI A;  1XTC D;  1EY6 A;  1K83 H;  1CT1 D;  3DM3 A;  2MJ8 A;  5IYC H;  4DFA A;  4OEL B;  1GOZ A;  1F9R A;  1A3T A;  5LMU Q;  1SE4 A;  5C44 B;  3M85 A;  1EUJ A;  3GTJ H;  2PO4 A;  5GAD C;  4OIJ A;  3CQZ B;  4A3L G;  3P20 A;  3PIP A;  2ZJQ A;  2ICI A;  1QB5 D;  1O7I A;  2B2U A;  4DV5 L;  4BY7 H;  4GZY C;  4DXF A;  4JV5 L;  1VQO A;  4JI3 Q;  1KDC A;  5C0X H;  4HJ7 A;  3MFG A;  3FEW X;  2IX0 A;  1S72 A;  1E22 A;  1HNW Q;  5I9P A;  2BA1 A;  1VDZ A;  2XSC A;  4KKU A;  3VYS A;  2YU9 B;  1V43 A;  4BXX H;  1YZ6 A;  1XXG A;  4A3D H;  2WKD A;  5CMD A;  5IYB G;  5D3D A;  5KGU A;  1TWG B;  4X64 L;  3DWA A;  4JI5 L;  4X3U A;  1VMC A;  4JI0 Q;  1PFM A;  2QDB A;  1OTC A;  4DAV A;  1KQS A;  3RZO B;  4QCL A;  1XX8 A;  5HGT A;  2BA0 A;  4DXG A;  3J81 i;  3OOC A;  4LF6 Q;  3A55 A;  3PIO 3;  1S5D D;  1QVG A;  4OWX B;  1WJJ A;  5A2Q L;  2E74 C;  5E4X A;  4DV4 L;  3S14 B;  4O2D A;  3HG9 A;  2B2V C;  3NQI A;  3K5N A;  3MXG A;  3HGB A;  1RDP D;  4XQJ A;  1CI3 M;  5EGT A;  1Q81 C;  2MO1 A;  3P7J A;  3R3O A;  4GKK L;  3HRZ C;  5EKL A;  2LMC B;  4K0K L;  3A8J E;  3URY A;  1HNX L;  5IOD A;  3D4W A;  3TRE A;  3A74 A;  2RDG A;  5JPN C;  3K59 A;  1F9S A;  1I4R A;  1EU4 A;  1LTI D;  3W5O A;  4DGZ A;  2F4V L;  4H0L C;  1IXR A;  2B2W A;  3T1H L;  3VR5 A;  2HCI A;  1PVO A;  1VQI A;  2ID0 A;  2Y0S G;  3H94 A;  3M4Q A;  1ENC A;  2XN9 C;  2CKZ B;  4KI0 A;  2QCP X;  2XIW A;  1TY2 A;  1T5X D;  4JK1 C;  1WCM B;  3D4R A;  2Z8L A;  1GD7 A;  2ATW A;  2L1B A;  1DGS A;  3D4D A;  3ERQ A;  3ICE A;  1BCP C;  5T1G A;  2VQE L;  1DXM A;  1YHA A;  4KHP L;  1N32 L;  1JWU D;  3F2B A;  1JJ2 A;  2ASB A;  1PDQ A;  3VYU A;  4GN5 A;  4YWL A;  4X62 Q;  5AFW A;  2WAQ E;  1TS2 A;  3EIV A;  5COY A;  1QVF A;  2CH4 A;  3HFZ B;  2BCO A;  5ELF A;  2BE5 C;  2MGS A;  4H02 A;  5ELB A;  4P72 A;  5JAV A;  2RHQ B;  3I4N G;  3ERS X;  2CQA A;  3T13 A;  3JC6 6;  1YJ9 A;  2F0J A;  4LF4 Q;  4BS9 A;  2VS1 A;  5I2Y A;  2F3W A;  2RDH A;  1SNP A;  4DV2 L;  3VR4 A;  3STB C;  1PTO B;  1SAP A;  4BBR G;  4NXN L;  4ZUJ A;  2DUD A;  1GUN A;  2RA4 A;  4TVA B;  1PRT F;  4RWS C;  1PH5 A;  1OXT A;  2OQK A;  4JI6 Q;  4C3I B;  3MEH A;  1JIC A;  3KF6 A;  2R92 G;  1B3A A;  1SYD A;  4DR1 Q;  3NXW A;  2JA8 B;  4LF7 Q;  2PQA A;  3K7A B;  4KV6 A;  5LMN Q;  1B9N A;  5HGQ A;  3FRP B;  1XJV A;  1ILQ A;  4N8F A;  1X3F A;  3OW2 A;  2PPB C;  1ENA A;  3KK7 A;  2O2L D;  4EQN A;  1WD1 A;  1K9M C;  3UDG A;  2V4D A;  4UPA A;  2NVT H;  4YCV A;  1QZG A;  2A6E C;  2HIX A;  3ND8 A;  4XQQ A;  4FF2 A;  3H0G G;  1PYB A;  1IHZ A;  1EWI A;  3GTO H;  3UE1 A;  2RSN A;  5IP7 G;  4EQP A;  1HFG A;  2TMP A;  1JQY D;  1HQR D;  1V9P A;  1ZYR D;  2ZXO A;  3ONA B;  4RKL A;  3HOZ H;  4RA8 A;  4DA2 A;  4LNQ A;  5IGE A;  3LGJ A;  1NTG A;  2EYP A;  3S1N B;  3OTO Q;  1BNZ A;  1GUT A;  2Z6K A;  1NMF A;  3OWF A;  1CKN B;  1X3Q A;  3DEO A;  3IFT A;  2E5L L;  1CM9 A;  4LF9 L;  2QF7 A;  1LV9 A;  5M3F B;  4A3I H;  4JI1 Q;  4B3R Q;  4JPB W;  2PZW A;  3J80 E;  2R93 B;  4Q0F A;  1SYB A;  1KHI A;  2F0U A;  1V1Q A;  1PH8 A;  5C4Z A;  1YJW A;  2VUM H;  2VB2 X;  2X6L A;  4LF8 Q;  5I6W A;  5C4J B;  1F77 A;  1B1Z A;  2ZT9 C;  3T51 B;  2BDN A;  1SFO B;  3V2T A;  1S5E D;  3HOV H;  4R4Q A;  2DNE A;  1O7L A;  3NK9 A;  2FFK B;  3KBX A;  2Z4H A;  4KHV A;  1VF7 A;  3GDE A;  4K6L A;  3OIP A;  3RLO A;  1IBM L;  4KJN A;  2JA6 G;  2Z0S A;  3GO5 A;  4UHV A;  3TDQ A;  3PUZ A;  1ZEQ X;  3PCO B;  1HXY D;  1EOT A;  1XPR A;  2XWB B;  2ZM6 L;  4A3M H;  5DNF A;  1FJG Q;  1NE3 A;  2K1B A;  3H91 A;  4MHE A;  4AYB G;  3T1Y L;  3QG1 A;  3R2I A;  2NN6 G;  1PZK D;  2Z1C A;  3I2Z A;  1G2S A;  2CH4 W;  4JI7 L;  4UP8 A;  3ULL A;  5DEH A;  4ZUI A;  1NCV A;  3D6W A;  2GN5 A;  1ET6 A;  4KKS A;  1U4L A;  1BBW A;  4BY1 G;  4X66 Q;  1RCV D;  1L1O C;  4RAU C;  4DUZ L;  2HQL A;  2E2J B;  4HMI A;  2FIN B;  1VQK A;  2EDG A;  2Q2I A;  1A62 A;  1EQR A;  1Y1W H;  2F0E A;  4XTC S;  3DMU A;  4DV1 L;  5DM7 3;  3SGI A;  1U0L A;  3OMC A;  4U67 3;  1IW7 D;  4OO1 G;  3RD4 A;  3GTG B;  4RMF A;  3S16 B;  2XRS D;  1DOL A;  1I4Q A;  5IT9 L;  3DUZ A;  4HMJ A;  2QKI C;  4OON A;  3HOY B;  3JAM i;  1PRT D;  4QB4 A;  4BBS B;  2F0P A;  1TS5 A;  3J81 E;  1AEX A;  3AMU A;  4BY7 B;  1SBB B;  5C44 H;  2F0N A;  3CQZ H;  1GM5 A;  3PO3 B;  2E2D C;  5G3L D;  1ASZ A;  1YNJ C;  4OWT B;  5ELN A;  4HJA A;  1XYI A;  1MJE A;  1D8L A;  1BVS A;  1KAA A;  1OO9 B;  1IBK L;  5J22 A;  4CJ0 B;  1HR0 L;  2UUB L;  1IBL Q;  4A3B H;  4LFB Q;  1QE6 A;  5CR3 A;  3KLR A;  3D0F A;  4K5V A;  4DR3 L;  5K5P A;  2I5H A;  2PI2 A;  2PNR C;  5IYC G;  5FOB B;  4R4C A;  5KNC A;  2F0K A;  5JEA H;  4C1N K;  5LMN W;  4G7Z C;  3CCM A;  1A3U A;  3MC0 B;  1RTO A;  2BH8 A;  1TWG H;  3U4Z A;  4AIM A;  3GTK B;  1XPU A;  4IZ8 A;  1EU3 A;  2F0F A;  2EY5 A;  4HJ5 A;  3PF4 A;  4N9P A;  3CPF A;  4KY6 A;  4DR2 L;  4Z9C B;  2EY1 A;  4ZLT F;  2KEC A;  4X3K A;  5EJW A;  3RZO H;  2F0D A;  1GXD C;  4LK1 C;  1CKN A;  2DJG C;  3QB3 A;  4U68 A;  1PYS B;  4QJF A;  2K5W A;  3S14 H;  1HRJ A;  3VR2 A;  1I50 B;  1V8Q A;  2BOS A;  2PZU A;  4GKJ L;  2K5N A;  1EY8 A;  2LXJ A;  3VYT A;  1QJO A;  3O13 A;  2PI2 E;  3MXN B;  4A3F B;  1BCP F;  2WFW A;  4JC0 A;  4CDD C;  5CYU A;  2B2V A;  2JA9 A;  1HA6 A;  4DR5 L;  1I94 Q;  3K0Y A;  1E1T A;  2ZTC A;  1EYA A;  5KYI A;  2UXB Q;  4R8N A;  1WCM H;  2JK8 A;  4J6H A;  2L11 A;  4LW1 A;  5EPK A;  1IKL A;  4K5X A;  5J3B A;  1HH2 P;  3WDN A;  4M8A A;  4J15 A;  1KL9 A;  2CW0 C;  4KHZ A;  3PO2 G;  4YHH L;  1GVP A;  1VQD A;  1EQQ A;  3HEJ A;  1HTL D;  3OPO A;  4XYO A;  3LWE A;  2A73 B;  4POF A;  3NEM A;  3GTM B;  3NTK A;  2EE1 A;  1O7Z A;  3CC2 A;  1Q46 A;  3PIP 3;  1Y1V G;  4DR7 Q;  1W2B A;  2JE6 I;  4CJ1 B;  1TKW B;  3ND9 A;  1PTO H;  2O5J C;  1J8I A;  2N3S A;  3H3V H;  1BUV T;  3SE0 A;  3MVV A;  3HS0 C;  4A4I A;  3R2T A;  4JBM A;  3C3L A;  1M8A A;  4GNX B;  1EY7 A;  1RL2 A;  2E2I H;  4XDX A;  4C3I H;  5C3E B;  2AWO A;  1UUP A;  2QW7 A;  5IYD H;  2JA5 B;  5EPL A;  3VYR A;  2JA8 H;  1VQ7 A;  1Q12 A;  2I5L X;  4NXM Q;  3H3V I;  1EFW A;  1QUQ A;  5IIF A;  3F1Z A;  3IRB A;  2YV5 A;  3KDF A;  4LUZ A;  2K4K A;  1STN A;  3S15 B;  1WYD A;  3A8K E;  3BYY B;  3R8B A;  2JYO A;  2K14 A;  1PYW D;  5CV4 A;  4G7H C;  2A5H A;  1CA6 A;  5GAG C;  2OWO A;  3A8I E;  2RHS B;  4RCN A;  1CK1 A;  2G5D A;  4A3C H;  5BR8 L;  1F2Z A;  4NW2 A;  1A8V A;  4X65 Q;  3SEB A;  4O1N A;  4IUN A;  4OXP A;  1BBU A;  2CHB D;  3IKJ A;  4IUQ A;  1UE5 A;  2R61 A;  3UDF A;  3S1R H;  3GTP B;  5H1S E;  2M9V A;  4LF5 Q;  4ZQ3 A;  1HZ9 A;  4A3K G;  3S1N H;  3KF8 B;  3J7A 5;  3DM1 A;  3S2D B;  1BBX C;  3E6Z X;  4APV A;  2M00 A;  1VQP A;  3AB9 A;  4M1U B;  4B3S L;  2YTY A;  5NUC A;  3SK6 A;  1M4V A;  4JYA Q;  1VQ5 A;  4L8J A;  5M3F H;  2HCC A;  1MHW C;  3PF5 A;  2R93 H;  1QOH A;  4NP5 A;  1K8M A;  3HKZ E;  2GA4 B;  2UXD L;  5ELE A;  5C4J H;  1ZKO A;  2CCZ A;  2B2Y C;  1BF4 A;  3QR8 A;  4KN4 C;  2X6G A;  3VA5 A;  2UUC Q;  4PG3 A;  3SK4 A;  4ZRZ A;  1TWF B;  3ULJ A;  3H15 A;  1I4G A;  3ZYY X;  1Z6H A;  3NBH A;  4A75 A;  2I46 A;  5FK9 C;  4IO9 A;  2I0Q A;  2WAQ G;  1MKH A;  1BCP D;  2XVS A;  1X65 A;  2A19 A;  4A3J B;  3TEH B;  4P2C B;  2HDM A;  4MTK A;  1OXS C;  3ULP A;  1HA5 A;  1GUO A;  4IJH A;  1Z7T A;  5IP9 G;  3JAM E;  2EY6 A;  2BE5 D;  1CZW A;  3CCE A;  1G2T A;  5CV8 A;  3W1B A;  1SNQ A;  1VQC A;  1ICW A;  5FKA C;  1SNO A;  5E3F A;  4MZ9 A;  1MGS A;  1PTO C;  1EY9 A;  5IE8 A;  1WVL A;  1BQQ T;  3H3V C;  3STB D;  2EYM A;  2KHJ A;  2JSO A;  3E9I A;  1D5X C;  2JA7 B;  2MQH A;  4C3J B;  4X6A H;  2HUG A;  2E2J H;  3RN2 A;  1N33 L;  1SSO A;  5CV9 A;  1YNX A;  1V1O A;  5KIX A;  2MNA A;  2F0S A;  2V1C C;  1EY0 A;  2D0O A;  1HZA A;  4PMB A;  3CCL A;  1L1O A;  1L2F A;  1UEA B;  2KVM A;  1HPC A;  3HOU G;  5FJ8 G;  3TN2 A;  2MO0 A;  1LTT D;  1X3P A;  3ERO A;  4F88 A;  4R9W A;  1LT6 D;  3GTG H;  3UDX A;  1ML0 D;  3S16 H;  5C4X G;  3I4M B;  1GUS A;  4OGQ C;  1G6Z A;  1F9Q A;  4DR6 L;  3K7U C;  3HOY H;  1JOQ A;  4BBS H;  1UE1 A;  2D9U A;  4K6D A;  1D5M C;  1D1I A;  4FDB A;  2TSS A;  2F4I A;  1VQN A;  4Y52 H;  2H1E A;  1Y1W G;  1PMR A;  2R7F A;  1EZ8 A;  2A6E D;  3PO3 H;  4IUP A;  4A3B B;  3L9A X;  5D65 A;  1X56 A;  3R93 A;  1TXY A;  4DR4 L;  1N9W A;  1XTD A;  3CME A;  1GO3 E;  4JBW A;  2KCC A;  5FLM H;  3AYH B;  1EYC A;  2PQE A;  2PW5 A;  2C35 B;  3U50 C;  2K5Q A;  4DUY L;  2L5T A;  3GQB A;  5C0X I;  3I91 A;  1PH2 A;  3KLW A;  3GV3 A;  5C44 G;  4KN7 C;  5M5Y B;  4NPS A;  4JCV E;  4A3E G;  1JE4 A;  3GTK H;  1XPO A;  2F03 A;  4LFC Q;  2VZA A;  1HNW L;  5CV7 A;  2BH2 A;  4HIM A;  1WTP A;  3G6J B;  1QNK A;  3C2P A;  1MSH A;  2FMC A;  2K5V A;  2IW3 A;  1PH7 A;  1Q86 C;  2KA7 A;  3NTH A;  4HSV A;  4FP5 D;  3I8Z A;  5JEA G;  4HR7 B;  1Q82 C;  3EA6 A;  2Q8R E;  4JI0 L;  3Q8D A;  2C5C A;  5GAE C;  1I50 H;  4JI8 Q;  5IGG A;  4C56 C;  1WTR A;  2AQ2 B;  2Q2T A;  4Y7N B;  2VW9 A;  1T5E A;  4FNF A;  1I5F A;  1H9K A;  1FD7 D;  2IWH A;  2XRQ D;  4B3T Q;  4LF6 L;  1SE8 A;  1WTX A;  4A3F H;  1G6P A;  4AQY Q;  1AE2 A;  2IX1 A;  1FVI A;  3L0O A;  2CWA A;  4NKL A;  5ELD A;  1OXU A;  3UI2 A;  1KC8 C;  1MSG A;  4HTH A;  4IOC A;  1NJI C;  3J7Y W;  1PH3 A;  2EYL A;  4IUR A;  5M3M B;  5TSS A;  4HED A;  4DK0 A;  5M9O A;  3NEN A;  4CGY B;  5JJK A;  3K5M A;  3RZD B;  2IHE A;  2LS0 1;  2YTX A;  1Y69 U;  1II3 A;  1LT5 D;  2VQF Q;  4DV3 Q;  3ZJY C;  3EQL C;  1LTB D;  1B7Y B;  3AU7 A;  5JPM C;  1QWY A;  3FPP A;  2QEX A;  4BBR B;  1EQV A;  2HIV A;  4E6I A;  2HT1 A;  1WTV A;  1IKM A;  1JJC B;  4ODG A;  2G9H D;  1LTR D;  1DZ1 A;  4IJL A;  3GTM H;  5KRU A;  3FPU B;  4RFB A;  5JJZ A;  2K32 A;  3LNN A;  2ZJR A;  2KJX A;  2RVL A;  4X62 L;  2ZTE A;  1G51 A;  1EL0 A;  1AN8 A;  1I3Q B;  1V1P A;  3EJI A;  4ME5 A;  4FF1 A;  2E2I B;  2XGT A;  3HZX A;  4UDU C;  5G3L F;  1SN8 A;  4R1J A;  4GOP B;  4LF4 L;  1H9S B;  2A69 C;  3GP7 A;  1AP0 A;  2F0G A;  1KAW A;  2MFI A;  5C3E H;  2CVR A;  3N6R A;  1SYF A;  4MIU A;  3QOJ A;  1YNJ D;  2JA5 H;  4K2K A;  1CHP D;  1PZJ D;  1WOC A;  3J80 L;  1O78 A;  3CRL C;  3BDC A;  3CF5 A;  3S15 H;  1XNR L;  4NB3 A;  1LO5 D;  1FGU A;  4CKC A;  1TR5 A;  3SXH A;  1X3G A;  4BA1 I;  2HHH Q;  4DR1 L;  5E7N A;  3DEP A;  1ILP A;  3U9O A;  4YCU A;  4LF7 L;  4ZAI A;  1VF5 C;  4RGT A;  1S5B D;  5LMN L;  4C3I G;  4DU9 A;  3QOL A;  2UU9 L;  4A3G G;  4G57 A;  3S1R B;  3RLF A;  1R9T B;  2IPK D;  4WJ4 A;  3BVM A;  2N78 A;  2NZO A;  3MTS A;  4IPC A;  4LFA Q;  2SOB A;  3K58 A;  3GTP H;  4UY8 C;  1K8O A;  3T53 B;  1RF2 D;  3VDY A;  1CSP A;  1F2Y A;  1HUM A;  4YY3 Q;  5IY0 A;  3OHX C;  2FMM A;  4IUT A;  3S2D H;  2M2L A;  3L2P A;  1AW7 A;  1KLU D;  1L0Y B;  1HZB A;  1A63 A;  1D5Z C;  3S1Q B;  3I56 A;  3CCU A;  1S5C D;  1BR9 A;  1PFS A;  3MA2 B;  1K8G A;  5I6Y A;  3E9H A;  2NVQ B;  5IGF A;  3VA7 A;  1EZ6 A;  2EJF C;  3TP7 A;  4HIK A;  4S3S A;  1CFM A;  3PMF A;  1S40 A;  2E2H B;  1DJR D;  4DAM A;  1IBM Q;  4B3R L;  5HUR A;  3EN2 A;  2KED A;  1LUZ A;  3M7G A;  4ABN A;  1X9N A;  4OX9 Q;  2PW7 A;  4C3H G;  1ROD A;  1TWF H;  5K36 G;  1NNX A;  3CP0 A;  1HZC A;  4LF8 L;  2K50 A;  2B2Y A;  2F0O A;  1Q7Y C;  3MAQ A;  2MPM A;  2CW0 D;  4DKA C;  4A3J H;  4DNI A;  2VL6 A;  3T1Y Q;  2UUA Q;  4B9W A;  3J81 L;  3FKI B;  2PYK A;  3EVQ A;  4R4O A;  1IZ6 A;  1I4X A;  5FO9 B;  4MTN A;  3BZK A;  1SYE A;  3PIO A;  1OXV A;  3K81 C;  3RNU A;  2AUK A;  1G91 A;  3PUX A;  2VY3 A;  2WP8 J;  1D7Q A;  1A15 A;  1I6H B;  5LL6 X;  5IWA Q;  2K6A A;  3K57 A;  1GHK A;  4ZKC B;  1HQM C;  3BZC A;  1SND A;  3TS2 A;  3P75 A;  3HOX H;  4Q5V A;  1FJG L;  1NR4 A;  2JA7 H;  3A5Z B;  3AFQ A;  1EFI D;  2BDO A;  4C3J H;  5FO8 B;  1VQA A;  2PMZ B;  1BXT A;  3N52 A;  4GNX C;  5C3X A;  5EBC A;  3GTL B;  1Y8N B;  2D2C C;  1KRS A;  4FXK C;  4GLX A;  5CV5 A;  2CFM A;  2HQE A;  2KOL A;  3BDO A;  1K28 A;  1TWH B;  1G8Z D;  4A3L H;  5DAU A;  4P75 A;  1VMP A;  1LT4 D;  1JWS D;  3FP9 A;  3A5U A;  1CTM A;  5AJ3 Q;  4MN3 A;  3V96 A;  1WTW A;  4CKE A;  2F52 A;  3I4M H;  2F0T A;  2PZT A;  3Q0A A;  4XT3 B;  4F8M A;  1JJG A;  1FL0 A;  2NVY H;  4BWG B;  2R7Z B;  2QGQ A;  5CBA E;  3QIA A;  3VR3 A;  3J80 c;  5A35 A;  1CHQ D;  3WWV A;  4UP9 A;  3U9S A;  4HIO A;  1JT8 A;  3AFP A;  1J5E Q;  5IYB H;  2ZXP A;  3RN5 A;  2G9D A;  3BG3 A;  3PUW A;  2OTL A;  5ELO A;  2FJ2 A;  1B53 A;  4QGU A;  4F7X A;  2A74 C;  2J7Z A;  3A7L A;  3HOY G;  4DAY B;  3UE0 A;  1JB7 A;  4BBS G;  1SEB D;  4DR2 Q;  1EIH A;  2KCM A;  5BN3 A;  4DV7 Q;  4BY7 G;  5EPJ A;  2EPB A;  4CJ2 C;  1UEB A;  5M5Y H;  2YTV A;  1IBL L;  5C0X G;  2QEJ C;  4KD3 A;  3CW2 C;  3NPP A;  3HKZ G;  4A93 B;  2I07 B;  4J8Q A;  4ME3 A;  2Q2H A;  3UDI A;  1LT3 D;  4QL5 A;  4BXX G;  1JOK A;  3RUZ A;  4A3D G;  1ESF A;  4XQN A;  3BVG A;  2E8G A;  1PH1 A;  2GVA A;  4JI2 Q;  2YYZ A;  3G6E A;  2WKC A;  4DK1 A;  2IL8 A;  3LX0 A;  3PUV A;  1PXU A;  5E4W C;  2B63 B;  2RCN A;  1RKN A;  3C1E A;  4P71 A;  4Y7N H;  2ALY B;  1C4Q A;  2IX3 A;  2EXZ A;  2RQX A;  1PA6 A;  3FDT A;  5COR A;  3NHH A;  5CBE E;  4IFD H;  4KY7 A;  1AZQ A;  1LTL A;  5M3M H;  2EXD A;  2AWN A;  1B8A A;  1VQF A;  1JWM D;  3RZD H;  3J81 c;  2J4X A;  4JBJ A;  1SE2 A;  4HSP A;  3J7A F;  1PTO D;  1Y1V B;  2E76 C;  3J7A V;  1I94 L;  1RIP A;  2WB1 B;  1XNQ Q;  1TS4 A;  1UAP A;  4IFD I;  1A2T A;  1DCZ A;  4BBR H;  2UXB L;  3J81 j;  1DYQ A;  1BOS A;  3RLN A;  4CHT B;  3Q22 A;  3M3Y B;  3I55 A;  4EQO A;  1HHV A;  1FNV A;  2IT1 A;  1STA A;  5D14 A;  1KLG D;  1P16 A;  3M4O B;  3A0J A;  5JOB A;  4IOA A;  2R92 H;  3IFD A;  2CQO A;  4TKO B;  3PV0 A;  1I3Q H;  4OHJ A;  1EWC A;  1STH A;  4FF4 A;  2UXC Q;  3OWE B;  1KTK A;  4I65 A;  3CCQ A;  1ESR A;  4IPD A;  2L55 A;  1N36 Q;  4V0B A;  2IJ0 A;  3WOE A;  1DON A;  2CWP A;  4R4T A;  2KUM A;  3TZD A;  2F0W A;  1K73 C;  5KNB A;  2AQ3 B;  2KHS A;  4N8X 1;  1LTG D;  4P74 A;  3TRZ A;  5IP7 H;  3NQT A;  1X3E A;  2NUC A;  1NBW A;  1Q90 A;  1CKO A;  1EOV A;  2ENB A;  3EFX D;  5FLX E;  1JCK B;  4FXG C;  4NXM L;  1PV4 A;  4QMG A;  4C2M B;  2PMZ E;  3CC4 A;  4K14 A;  5C3E G;  2L15 A;  4QF4 A;  1GUG A;  2A6H C;  4QQB X;  1R9T H;  1SMY C;  1TQO A;  1X32 A;  4KTA A;  5EBD A;  3CMA A;  4DPG A;  3M9B A;  1HNZ Q;  3HOW B;  3NWS A;  2A68 C;  4B3M Q;  3JAM L;  2K5H A;  1N34 Q;  2QA4 A;  5C4H A;  5I4D A;  4EGV A;  4LJZ C;  1YHQ A;  2RSO A;  1EIY B;  2OF1 A;  1YJN A;  1XMO Q;  4XXE A;  2RKS A;  4ID6 A;  3AQQ A;  3A7A B;  3DLL A;  3HOZ G;  4BA2 I;  3S1Q H;  1E2V A;  1SNC A;  4LF5 L;  1KXL A;  2DNC A;  3NE5 B;  2NVQ H;  1EWH A;  3TSS A;  1NSN S;  3MXN A;  5J1Z A;  4ZCK A;  1VQG A;  4JYA L;  1B4O A;  4XIG S;  4JI4 Q;  5M5W B;  2KEN A;  2OCE A;  2E2H H;  3QWN A;  4A3I G;  1E7Z A;  1JOO A;  4UAI A;  5EKI A;  3BJU A;  1GKH A;  2K7V A;  5JEA J;  2NN6 H;  4DV6 Q;  1E24 A;  1Y14 B;  1STB A;  2VUM G;  2LXK A;  5C6A A;  3G7L A;  4FYD A;  1A6X A;  5JJI A;  4O0A A;  1U5K A;  2ZXR A;  3G48 A;  2NZ1 D;  4OWW B;  3TP8 A;  3FKI H;  2UUC L;  5ISR A;  5HY6 A;  2F0H A;  3HOV G;  2B8G A;  2DJF C;  4P73 A;  1B50 A;  4GLV B;  2JEB I;  2NN6 I;  2OT2 A;  5IGC A;  3HOX B;  1T9H A;  1HCZ A;  1QZH A;  1I6H H;  4IUU A;  3V05 A;  3Q6S A;  3H6M A;  3HOU B;  1TT2 A;  1LTS D;  4DV0 Q;  3FHW A;  2A8V A;  3F2C A;  4OO1 H;  4A3J G;  4A3M G;  4GOP C;  1CZG A;  3CC7 A;  1HFN A;  2GVB A;  3PUY A;  3GTL H;  2D5D A;  2A69 D;  4ZKB B;  1U4P A;  4CKB A;  1D1K A;  5M5X B;  4HN7 A;  1TWH H;  4DR6 Q;  4CBV A;  4GNX A;  3I70 A;  4OO1 I;  1IL8 A;  1S5F D;  2AKW B;  3L3O C;  4DV5 Q;  2NVY B;  1XMQ L;  2NWG A;  2R3Z A;  4JV5 Q;  4ZYS A;  2JA7 G;  5DM6 3;  3TP5 A;  2O4X A;  1ONL A;  3KF6 B;  1KAB A;  4DR4 Q;  2WB1 E;  2PQA B;  1HUN A;  5J39 A;  2R7Z H;  2QIL A;  2AMC B;  3S1M B;  2OQ0 A;  3T56 B;  4LUO A;  5IOC A;  1B70 B;  4L5R C;  5T1I A;  3Q24 A;  4XYQ A;  3D8G A;  1YEZ A;  5LMU L;  1KDA A;  5I9O A;  4A3E B;  2EQS A;  3E5S A;  1E1O A;  4WFN 3;  4X64 Q;  2XNA C;  4DUY Q;  4JI5 Q;  4RGM A;  2K33 A;  1KIX A;  1QCB D;  3I4M G;  3T16 A;  4JI3 L;  1EEF D;  4KJO A;  3SK8 A;  1FR3 A;  1Y8O B;  2N55 A;  1PRT B;  1J6Q A;  1JR0 D;  2SEB D;  3LWU A;  3X3M A;  2NYZ D;  4PNY A;  2Q2U A;  2JEA I;  4B08 A;  4LWC A;  3MFY A;  4DV4 Q;  1FGB D;  1E2W A;  4A3B G;  1CUK A;  3OW7 A;  3KF8 A;  4A93 H;  3IL8 A;  2NVX B;  5E1F A;  1WTO A;  3JAM c;  3P1H A;  3NBI A;  1AE3 A;  1EEI D;  2LY7 A;  4TQU S;  4GKK Q;  1O7Y A;  3D6C A;  1C7Y A;  1DD2 A;  5ELC A;  1ICF B;  3OIQ A;  1PFN A;  1Q1B A;  1KNE A;  1AZP A;  4QIW B;  4K0K Q;  2Y0S B;  1HNX Q;  1OXX K;  2XTI A;  3SK5 A;  2AHO B;  4CDE C;  1EIF A;  4HJ8 A;  4LFC L;  4HCE A;  3A56 A;  1MI2 A;  2F4V Q;  3T1H Q;  2B63 H;  1SMX A;  3F2U A;  2DY8 A;  2L4N A;  2N88 A;  1TWC B;  1SYG A;  3S2H B;  2KBN A;  2B2T C;  1E0B A;  4RCO A;  1GJX A;  4EVO A;  1W6J A;  2VQE Q;  3PO2 H;  1ENF A;  4JI8 L;  4KHP Q;  1N32 Q;  3DWP A;  4KLK A;  3K5L A;  3VR6 A;  3I4N B;  4B3T L;  4PZ6 A;  4IAL A;  3I73 A;  1Q8I A;  4AQY L;  4JOI C;  4UP7 A;  1I6V C;  3SDZ A;  1VCI A;  2A1A A;  1Y1V H;  1LYL A;  2K03 A;  1FNU A;  5KND A;  1F9P A;  4YWM A;  4DV2 Q;  3DWQ A;  4G7O C;  1ET9 A;  3WOF A;  3GD7 A;  3S17 B;  5A2Q E;  4NXN Q;  2D0P A;  1WCM G;  2B8F A;  2I5M X;  3S24 A;  4DF7 A;  1YI2 A;  3M3Y H;  4IFD G;  4WJW A;  5M3M G;  1E3P A;  2VQF L;  4DV3 L;  1WTQ A;  2R92 B;  3GTQ H;  3BS1 A;  1YNN C;  3M4O H;  2WII B;  3MXP A;  1JB3 A;  2D62 A;  2QDL A;  2H5X A;  3QO2 A;  3KOJ A;  4RGO S;  2EJM A;  1B9M A;  1NY4 A;  5KYL A;  3F2D A;  1TVX A;  1MIU A;  4JBK A;  4KD4 A;  1EY4 A;  3I3C A;  3H0G B;  1XWE A;  4IUV A;  1KNA A;  5CC4 A;  2PCF B;  1XNR Q;  1SJH D;  1ASY A;  4JI6 L;  4CDC C;  3CAM A;  1B2T A;  4A3G B;  4DK3 C;  5L37 A;  1VQE A;  1TII D;  3FVQ A;  1KRT A;  1QIL A;  1JMC A;  4RHR A;  5BN5 A;  2UU9 Q;  3KBG A;  1N8R C;  1B3Q A;  1BKB A;  5LL6 S;  3CCJ A;  2K52 A;  4KK7 A;  1FYC A;  4PMW A;  4LMQ D;  5IYD G;  1I4P A;  2JA8 G;  4A3K H;  1WD0 A;  4I7Z C;  4C2M H;  3KLS A;  3KJP A;  2EZV A;  3CCR A;  1EYG A;  4K8I A;  1C48 A;  2JJQ A;  2LKV A;  2E5L Q;  4PV1 C;  2Z6B A;  4LF9 Q;  1CKM A;  1M90 C;  2HHH L;  1EQT A;  2E75 C;  4YIJ A;  1K3R A;  3D3R A;  3SHL A;  1KDB A;  3HOW H;  4A3C G;  1I4H A;  4OEM B;  4AH6 A;  4K8J A;  3CXC A;  2AUJ D;  1UNS A;  1K0S A;  4RH6 A;  1E2Z A;  1U9R A;  3OTO L;  4LFA L;  3C1F A;  1VQ8 A;  2EYO A;  2JA6 B;  4C3H B;  3J7Z C;  1CQF A;  1F2L A;  4YY3 L;  4K5W A;  4YWK A;  2SNM A;  4I7A A;  4NMZ A;  1G29 1;  2SDF A;  5C0X J;  1VQ4 A;  4JI1 L;  4GN3 B;  1QG7 A;  1YVC A;  4HID A;  1JOR A;  4AYB B;  5M5W H;  1X55 A;  5M3F G;  2NTT A;  1WI5 A;  3KUP A;  4H44 C;  1PTO F;  2Q8I B;  5JVH 3;  3C46 A;  5IP9 H;  1H95 A;  4R4I A;  2ZM6 Q;  3L7Z C;  4ALP A;  2R93 G;  3BVZ A;  4B9X A;  1W6K A;  2B29 A;  3I90 A;  4BY1 B;  1DOM A;  4HJ9 A;  1UE6 A;  4JI7 Q;  1SLJ A;  2KHI A;  3OSO A;  1PLF A;  2L0C A;  3GV6 A;  1A0I A;  3F8T A;  1D6E C;  4K2L A;  2NB0 A;  2WIN B;  2RDF A;  3ER0 A;  4OX9 L;  4FO2 A;  4QUF A;  1VQM A;  4JVZ A;  3DXJ C;  4PZ7 A;  4DUZ Q;  1NAP A;  5JJL A;  3FMC A;  1Q8K A;  4LAA A;  2X69 A;  4QIW E;  4DNT B;  3M4P A;  3W2D A;  1C8C A;  2Y0S E;  2EYF A;  3CU7 A;  1L0X B;  2UUA L;  1HTP A;  1TWA H;  1SXT A;  2MUY A;  3HOU H;  5FJ8 H;  1R4Q B;  1BCP B;  4OIK A;  4TSS A;  4DV1 Q;  1C0A A;  2KEE A;  5IGD A;  1BO0 A;  2R7D A;  5C4X H;  1CA5 A;  3FKI G;  1TS3 A;  3D31 A;  4KKT A;  4WOR A;  4PMC A;  1X6O A;  4X66 L;  5IGB A;  2HD3 A;  5GRO A;  1F2M A;  2H4O A;  5IWA L;  2O5I C;  2F0V A;  3TS0 A;  2F0Q A;  3W3A A;  1U4R A;  5M5X H;  4JG2 A;  1STY A;  3MHB A;  4H7B A;  4GOP A;  4RKB A;  1H9S A;  1IYJ B;  3X3N A;  2B3G A;  5CV6 A;  3M7N A;  1K83 B;  2F3I A;  1EIG A;  1KD1 C;  1IBK Q;  1VQH A;  2FHT A;  2B2U C;  1LTA D;  3TBI B;  1HR0 Q;  2UUB Q;  1R4P B;  3TP6 A;  1W3S A;  3RR5 A;  3W1G A;  3CHB D;  2Q8T A;  2Z9H A;  3PGZ A;  4DR3 Q;  1D2B A;  3GTJ B;  2NBF A;  1IYV A;  1X54 A;  1QUQ B;  2F3V A;  3S1M H;  3KDF B;  1PZI D;  4NDX A;  3TZU A;  3PQI A;  5AJ3 L;  2XWJ B;  1J9O A;  3E0J A;  5I2X A;  3KLS X;  2EJG C;  4GLA C;  2K75 A;  3SVM A;  2A6H D;  4IPH A;  4L5Q A;  4A3E H;  1GHJ A;  2OXP A;  2ZJP A;  3HKZ B;  3NUC A;  1SMY D;  1DM0 B;  2RF4 A;  2SNS A;  1J5E L;  3PO3 G;  4LFB L;  4A3D B;  2A68 D;  2Z4I A;  2R7Z G;  2R6G A;  1WFQ A;  4A76 A;  4POG A;  2YU9 H;  5GAH C;  2JXM B;  5FLM G;  2F1M A;  1JE5 A;  2LSS A;  3MEF A;  5GQO A;  1VQ6 A;  1P8L A;  1ZYR C;  2NVX H;  1CSQ A;  2EOT A;  4GKJ Q;  2K01 A;  3A54 A;  1SNM A;  5IT9 E;  2RBM A;  3Q23 A;  4DV7 L;  1PFB A;  3I7F A;  1WTH A;  2KCN A;  3HP3 A;  3PSI A;  1YIJ A;  4R8I A;  1MJC A;  1RHP A;  2N8N A;  4DR5 Q;  1YBY A;  4MNO A;  2AQ1 B;  2B2W C;  1VQ9 A;  2F0I A;  3M4Y A;  3SR1 A;  1RJT A;  1TWC H;  4PQX A;  1RD9 D;  2P5Z X;  3PO2 B;  4A93 G;  2L12 A;  2VB3 X;  3IAY A;  4JI2 L;  3S2H H;  1B44 D;  3H09 A;  2WV6 D;  4L63 B;  1PHJ A;  1MD2 D;  5F2D A;  3U58 A;  3AEV A;  4YHH Q;  4X3T A;  2K05 A;  3NBH B;  1H9J A;  1K3B C;  1UWV A;  3I4N H;  2F0L A;  3KYH C;  3NWT A;  2B2T A;  1FNW A;  2B63 G;  4A3F G;  4JW0 A;  4WRD A;  2LFN A;  1H9R A;  3I4O A;  4IN3 A;  1S3O A;  2KCT A;  3TME A;  3I72 A;  4QUC A;  3S17 H;  4JOI A;  5FLX L;  1PH6 A;  1QVC A;  1H9M A;  1LM0 A;  3GTQ B;  5BN4 A;  3BYT B;  2VNU D;  1Z9F A;  1NR2 A;  1SJE D;  1XNQ L;  3G71 A;  5LHY 1;  1NUC A;  3K80 C;  4AYB E;  2IY5 B;  2N49 A;  1O80 A;  3K0X A;  2OTJ A;  5CGK A;  3ITP A;  1PH9 A;  2WB1 G;  5DLQ E;  3I4L A;  4X3S A;  4DR7 L;  2L9H A;  2DY7 A;  1L1O B;  2F0M A;  1BDO A;  2K04 A;  1IL2 A;  2EY2 A;  4J1M A;  5EQ0 A;  3CCV A;  3H0G H;  4FF3 A;  1Z47 A;  3OYY A;  1PH4 A;  2C9O A;  4FXD A;  3NEL A;  1YIT A;  1IW7 C;  4ILW A;  4YCW A;  4EX5 A;  1GUW A;  1Y8P B; 
#chains in the Genus database with same CATH homology
 2EYJ A;  2MHV A;  2HDL A;  3QJY A;  1SDF A;  5FO7 B;  1MBY A;  1PRT C;  4DNR B;  1AFP A;  4IQZ A;  2ICE C;  3T4A C;  4ULL A;  4A3K B;  4N9T A;  1A2U A;  1DOK A;  5C5L A;  2NVT B;  3RMH A;  5KEE A;  4DN4 M;  2VXW A;  3NP8 A;  4G4K A;  3K5O A;  4DAY A;  1SYC A;  4H13 C;  3GTO B;  4KY5 A;  4O42 A;  4XT1 B;  5C3W A;  3CRK C;  5EKK A;  2EYH A;  1ZXT A;  5D3I B;  3HOZ B;  4TRD A;  3BDL A;  1LAC A;  1STG A;  5C5M A;  5JVG 3;  1U4M A;  4OL7 A;  4F87 A;  1TY0 A;  4A3I B;  3K6O A;  2WAQ B;  4V19 0;  5K36 H;  2EVB A;  2K28 A;  2VUM B;  1Q3L A;  4C1N I;  1JC7 A;  3CKI B;  4DAP A;  4HCS A;  1SE3 A;  1CQV A;  1QNU A;  3HOV B;  3BZD B;  4L6T B;  2DN8 A;  4HAE A;  1TU2 B;  3S9W A;  2MP1 A;  4RHS A;  3MZ5 A;  3DHQ A;  2WAC A;  1S4Z A;  1A3V A;  3MXU A;  2OEO A;  1EY5 A;  1EYD A;  3MWY W;  1LLR D;  4A3M B;  1Q1E A;  2B39 A;  2KQ3 A;  1TWA B;  4RGN A;  1YNN D;  2K5D A;  3NSW A;  5C4X B;  1IYU A;  4FVM A;  4ZK9 B;  2JP1 A;  1RTN A;  1Y1W B;  2J0T D;  2NTS A;  1LAB A;  1STE A;  1V1P B;  4KMU C;  4IFD J;  4C3J G;  3OMG A;  1XTC D;  3NTI A;  1EY6 A;  1CT1 D;  2MJ8 A;  4DFA A;  1GOZ A;  1F9R A;  1A3T A;  1SE4 A;  5C44 B;  3M85 A;  2PO4 A;  4OIJ A;  3CQZ B;  3P20 A;  2ICI A;  1QB5 D;  2B2U A;  4DXF A;  1KDC A;  5C0X H;  3MFG A;  3FEW X;  2IX0 A;  5I9P A;  2BA1 A;  1VDZ A;  2XSC A;  4KKU A;  3VYS A;  2YU9 B;  1V43 A;  1XXG A;  2WKD A;  5CMD A;  5D3D A;  5KGU A;  1TWG B;  3DWA A;  4X3U A;  1VMC A;  1PFM A;  2QDB A;  4DAV A;  3RZO B;  4QCL A;  1XX8 A;  5HGT A;  2BA0 A;  4DXG A;  3OOC A;  3A55 A;  3PIO 3;  1S5D D;  5A2Q L;  2E74 C;  5E4X A;  3S14 B;  3HG9 A;  2B2V C;  3NQI A;  3K5N A;  3MXG A;  3HGB A;  1RDP D;  4XQJ A;  1CI3 M;  5EGT A;  3P7J A;  3R3O A;  3HRZ C;  5EKL A;  2LMC B;  3A8J E;  3URY A;  5IOD A;  3D4W A;  2RDG A;  5JPN C;  3K59 A;  1F9S A;  1I4R A;  1EU4 A;  1LTI D;  4DGZ A;  4H0L C;  2B2W A;  3VR5 A;  2HCI A;  2ID0 A;  3H94 A;  1ENC A;  2XN9 C;  4KI0 A;  2QCP X;  2XIW A;  1TY2 A;  1T5X D;  4JK1 C;  1WCM B;  3D4R A;  2Z8L A;  2L1B A;  3D4D A;  3ERQ A;  1BCP C;  5T1G A;  1DXM A;  1JWU D;  1PDQ A;  3VYU A;  5AFW A;  5COY A;  1TS2 A;  2BCO A;  5ELF A;  2BE5 C;  2MGS A;  5ELB A;  5JAV A;  2CQA A;  3T13 A;  2F0J A;  4BS9 A;  5I2Y A;  2F3W A;  2RDH A;  1SNP A;  3VR4 A;  1PTO B;  1SAP A;  4ZUJ A;  1GUN A;  2RA4 A;  1PRT F;  4RWS C;  1OXT A;  4C3I B;  3MEH A;  1JIC A;  1B3A A;  1SYD A;  3NXW A;  2JA8 B;  3K7A B;  4KV6 A;  1B9N A;  3FRP B;  1ILQ A;  2PPB C;  1ENA A;  3KK7 A;  2O2L D;  4EQN A;  1WD1 A;  2V4D A;  2A6E C;  3ND8 A;  4XQQ A;  4FF2 A;  1IHZ A;  2RSN A;  4EQP A;  1HFG A;  2TMP A;  1JQY D;  1HQR D;  1ZYR D;  2ZXO A;  3ONA B;  4RKL A;  4RA8 A;  4DA2 A;  5IGE A;  2EYP A;  3S1N B;  1BNZ A;  1GUT A;  3OWF A;  1X3Q A;  3DEO A;  3IFT A;  1CM9 A;  2QF7 A;  1LV9 A;  5M3F B;  2R93 B;  2PZW A;  3J80 E;  4Q0F A;  1SYB A;  2F0U A;  5C4Z A;  2VB2 X;  2X6L A;  5I6W A;  5C4J B;  1F77 A;  1B1Z A;  2ZT9 C;  3T51 B;  2BDN A;  1SFO B;  3V2T A;  1S5E D;  2DNE A;  1O7L A;  3NK9 A;  2FFK B;  3KBX A;  2Z4H A;  4KHV A;  1VF7 A;  4K6L A;  3OIP A;  4KJN A;  3GO5 A;  3TDQ A;  3PUZ A;  1ZEQ X;  1HXY D;  1EOT A;  2XWB B;  5DNF A;  2K1B A;  3H91 A;  4MHE A;  3QG1 A;  3R2I A;  2NN6 G;  1PZK D;  2Z1C A;  1G2S A;  5DEH A;  4ZUI A;  1NCV A;  3D6W A;  1ET6 A;  4KKS A;  1U4L A;  1RCV D;  4RAU C;  2E2J B;  4HMI A;  2FIN B;  2EDG A;  2F0E A;  4XTC S;  3DMU A;  5DM7 3;  3OMC A;  4U67 3;  1IW7 D;  4OO1 G;  3RD4 A;  3GTG B;  3S16 B;  2XRS D;  1DOL A;  1I4Q A;  5IT9 L;  3DUZ A;  4HMJ A;  2QKI C;  3HOY B;  1PRT D;  4QB4 A;  4BBS B;  2F0P A;  1TS5 A;  3J81 E;  1AEX A;  3AMU A;  4BY7 B;  1SBB B;  2F0N A;  3PO3 B;  2E2D C;  5G3L D;  1YNJ C;  1XYI A;  1KAA A;  1OO9 B;  5J22 A;  4CJ0 B;  1QE6 A;  5CR3 A;  3KLR A;  4K5V A;  5K5P A;  2PNR C;  5FOB B;  5KNC A;  2F0K A;  5JEA H;  4C1N K;  4G7Z C;  1A3U A;  3MC0 B;  1RTO A;  3GTK B;  4IZ8 A;  1EU3 A;  2F0F A;  2EY5 A;  4N9P A;  4KY6 A;  4Z9C B;  2EY1 A;  4ZLT F;  2KEC A;  4X3K A;  5EJW A;  2F0D A;  1GXD C;  4LK1 C;  3QB3 A;  4U68 A;  2K5W A;  1HRJ A;  3VR2 A;  1I50 B;  1V8Q A;  2BOS A;  2PZU A;  1EY8 A;  3VYT A;  1QJO A;  3O13 A;  4A3F B;  1BCP F;  5CYU A;  2B2V A;  1HA6 A;  3K0Y A;  1EYA A;  5KYI A;  4R8N A;  4J6H A;  2L11 A;  5EPK A;  1IKL A;  4K5X A;  3WDN A;  4M8A A;  2CW0 C;  4KHZ A;  3HEJ A;  1HTL D;  3OPO A;  4XYO A;  3LWE A;  2A73 B;  3GTM B;  3NTK A;  2EE1 A;  1O7Z A;  3PIP 3;  2JE6 I;  4CJ1 B;  1TKW B;  3ND9 A;  1PTO H;  2O5J C;  1J8I A;  1BUV T;  3SE0 A;  3MVV A;  3HS0 C;  3R2T A;  3C3L A;  1M8A A;  1EY7 A;  4XDX A;  5C3E B;  2AWO A;  1UUP A;  2JA5 B;  5EPL A;  3VYR A;  1Q12 A;  5IIF A;  1STN A;  3S15 B;  3A8K E;  3BYY B;  3R8B A;  2JYO A;  5CV4 A;  1PYW D;  4G7H C;  2A5H A;  1CA6 A;  3A8I E;  4RCN A;  1CK1 A;  1F2Z A;  4NW2 A;  3SEB A;  4O1N A;  4IUN A;  2CHB D;  3IKJ A;  4IUQ A;  2R61 A;  3GTP B;  2M9V A;  4ZQ3 A;  3DM1 A;  3S2D B;  1BBX C;  3E6Z X;  2M00 A;  3AB9 A;  4M1U B;  5NUC A;  3SK6 A;  1M4V A;  4L8J A;  2HCC A;  1QOH A;  4NP5 A;  1K8M A;  2GA4 B;  5ELE A;  1ZKO A;  2B2Y C;  1BF4 A;  4KN4 C;  2X6G A;  3VA5 A;  3SK4 A;  4ZRZ A;  1TWF B;  1I4G A;  3ZYY X;  1Z6H A;  3NBH A;  2I46 A;  5FK9 C;  1BCP D;  2XVS A;  4A3J B;  4P2C B;  2HDM A;  1OXS C;  1HA5 A;  1GUO A;  1Z7T A;  3JAM E;  2EY6 A;  2BE5 D;  1CZW A;  1G2T A;  5CV8 A;  1SNQ A;  1ICW A;  5FKA C;  1SNO A;  5E3F A;  1MGS A;  1PTO C;  1EY9 A;  1WVL A;  1BQQ T;  3H3V C;  2EYM A;  2JSO A;  1D5X C;  2JA7 B;  4C3J B;  2HUG A;  1SSO A;  5CV9 A;  1V1O A;  5KIX A;  2F0S A;  1EY0 A;  4PMB A;  1UEA B;  2KVM A;  1HPC A;  3TN2 A;  1LTT D;  1X3P A;  3ERO A;  4F88 A;  4R9W A;  1LT6 D;  1ML0 D;  3I4M B;  1GUS A;  4OGQ C;  1G6Z A;  1F9Q A;  1JOQ A;  2D9U A;  4K6D A;  1D5M C;  1D1I A;  2TSS A;  2F4I A;  2H1E A;  1PMR A;  1EZ8 A;  2A6E D;  4IUP A;  4A3B B;  3L9A X;  5D65 A;  3R93 A;  4JBW A;  2KCC A;  1EYC A;  2PQE A;  2PW5 A;  2K5Q A;  2L5T A;  3GQB A;  5C0X I;  3I91 A;  3GV3 A;  4KN7 C;  5M5Y B;  1JE4 A;  2F03 A;  5CV7 A;  1WTP A;  3G6J B;  1QNK A;  3C2P A;  1MSH A;  2FMC A;  2IW3 A;  2KA7 A;  3NTH A;  4HSV A;  4FP5 D;  3I8Z A;  5JEA G;  4HR7 B;  3EA6 A;  2Q8R E;  2C5C A;  5IGG A;  4C56 C;  1WTR A;  2AQ2 B;  4Y7N B;  1T5E A;  4FNF A;  1H9K A;  1FD7 D;  2IWH A;  2XRQ D;  1WTX A;  2IX1 A;  4NKL A;  5ELD A;  1OXU A;  3UI2 A;  1MSG A;  4HTH A;  3J7Y W;  2EYL A;  4IUR A;  5M3M B;  5TSS A;  4HED A;  4DK0 A;  5M9O A;  4CGY B;  3K5M A;  3RZD B;  2LS0 1;  1Y69 U;  1II3 A;  1LT5 D;  3EQL C;  1LTB D;  3AU7 A;  5JPM C;  1QWY A;  3FPP A;  4BBR B;  1EQV A;  4E6I A;  1IKM A;  1WTV A;  4ODG A;  2G9H D;  1LTR D;  1DZ1 A;  5KRU A;  3FPU B;  4RFB A;  5JJZ A;  2K32 A;  3LNN A;  2KJX A;  2RVL A;  1EL0 A;  1AN8 A;  1I3Q B;  1V1P A;  3EJI A;  4ME5 A;  4FF1 A;  2E2I B;  3HZX A;  4UDU C;  5G3L F;  1H9S B;  2A69 C;  3GP7 A;  1AP0 A;  2F0G A;  2CVR A;  3N6R A;  1SYF A;  4MIU A;  3QOJ A;  1YNJ D;  4K2K A;  1CHP D;  1PZJ D;  3J80 L;  1O78 A;  3CRL C;  3BDC A;  1LO5 D;  4CKC A;  1TR5 A;  3SXH A;  4BA1 I;  3DEP A;  1ILP A;  3U9O A;  4ZAI A;  1VF5 C;  4RGT A;  1S5B D;  4C3I G;  4DU9 A;  3QOL A;  4G57 A;  3S1R B;  3RLF A;  1R9T B;  2IPK D;  3BVM A;  3MTS A;  2SOB A;  3K58 A;  1K8O A;  3T53 B;  1RF2 D;  1F2Y A;  1HUM A;  3OHX C;  2FMM A;  4IUT A;  2M2L A;  1AW7 A;  1KLU D;  1L0Y B;  1D5Z C;  3S1Q B;  1S5C D;  1BR9 A;  3MA2 B;  5I6Y A;  2NVQ B;  5IGF A;  3VA7 A;  1EZ6 A;  2EJF C;  3TP7 A;  4S3S A;  1CFM A;  3PMF A;  2E2H B;  1DJR D;  5HUR A;  2KED A;  3M7G A;  4ABN A;  2PW7 A;  4C3H G;  1ROD A;  5K36 G;  2B2Y A;  2F0O A;  3MAQ A;  2MPM A;  2CW0 D;  4B9W A;  3J81 L;  3FKI B;  2PYK A;  3EVQ A;  1I4X A;  5FO9 B;  1SYE A;  1OXV A;  2AUK A;  1G91 A;  3PUX A;  2WP8 J;  1A15 A;  1I6H B;  5LL6 X;  2K6A A;  3K57 A;  1GHK A;  4ZKC B;  1HQM C;  1SND A;  3P75 A;  4Q5V A;  1NR4 A;  4GZY C;  1EFI D;  2BDO A;  5FO8 B;  2PMZ B;  1BXT A;  3N52 A;  5C3X A;  5EBC A;  3GTL B;  1Y8N B;  2D2C C;  4FXK C;  5CV5 A;  2HQE A;  2KOL A;  3BDO A;  1TWH B;  1G8Z D;  5DAU A;  1VMP A;  1LT4 D;  1JWS D;  1CTM A;  4MN3 A;  3V96 A;  1WTW A;  4CKE A;  2F0T A;  2PZT A;  3Q0A A;  4XT3 B;  4F8M A;  4BWG B;  2R7Z B;  5CBA E;  3QIA A;  3VR3 A;  5A35 A;  1CHQ D;  3U9S A;  2ZXP A;  2G9D A;  3BG3 A;  3PUW A;  2FJ2 A;  1B53 A;  4F7X A;  2A74 C;  2J7Z A;  3A7L A;  1SEB D;  1EIH A;  5BN3 A;  5EPJ A;  2EPB A;  4CJ2 C;  5C0X G;  2QEJ C;  4KD3 A;  3NPP A;  4A93 B;  2I07 B;  4J8Q A;  1LT3 D;  1JOK A;  3RUZ A;  1ESF A;  4XQN A;  3BVG A;  2YYZ A;  2WKC A;  4DK1 A;  2IL8 A;  3LX0 A;  3PUV A;  1PXU A;  5E4W C;  2B63 B;  1RKN A;  3C1E A;  1C4Q A;  2IX3 A;  2EXZ A;  2RQX A;  3FDT A;  5COR A;  3NHH A;  5CBE E;  4IFD H;  4KY7 A;  1AZQ A;  2AWN A;  1JWM D;  2J4X A;  1SE2 A;  4HSP A;  3J7A F;  1PTO D;  1Y1V B;  2E76 C;  3J7A V;  2WB1 B;  1TS4 A;  1UAP A;  4IFD I;  1DCZ A;  1A2T A;  1DYQ A;  1BOS A;  3Q22 A;  4CHT B;  3M3Y B;  4EQO A;  1HHV A;  1FNV A;  2IT1 A;  1STA A;  5D14 A;  1KLG D;  3M4O B;  5JOB A;  3IFD A;  4TKO B;  3PV0 A;  4OHJ A;  1EWC A;  1STH A;  4FF4 A;  3OWE B;  1KTK A;  4I65 A;  1ESR A;  2L55 A;  4V0B A;  2IJ0 A;  3WOE A;  1DON A;  2KUM A;  3TZD A;  2F0W A;  5KNB A;  2AQ3 B;  2KHS A;  1LTG D;  3NQT A;  2NUC A;  1Q90 A;  2ENB A;  3EFX D;  5FLX E;  1JCK B;  4FXG C;  4QMG A;  4C2M B;  4K14 A;  4QF4 A;  1GUG A;  2A6H C;  1SMY C;  1TQO A;  1X32 A;  4KTA A;  5EBD A;  3HOW B;  3NWS A;  2A68 C;  3JAM L;  5C4H A;  5I4D A;  4EGV A;  4LJZ C;  2RSO A;  2OF1 A;  4XXE A;  2RKS A;  4ID6 A;  3A7A B;  4BA2 I;  1E2V A;  1SNC A;  2DNC A;  3NE5 B;  3TSS A;  1EWH A;  1NSN S;  3MXN A;  5J1Z A;  1B4O A;  4XIG S;  5M5W B;  3QWN A;  1JOO A;  4UAI A;  5EKI A;  2K7V A;  5JEA J;  2NN6 H;  1STB A;  5C6A A;  3G7L A;  4FYD A;  1A6X A;  2ZXR A;  2NZ1 D;  3TP8 A;  5ISR A;  2F0H A;  2B8G A;  1B50 A;  2JEB I;  2NN6 I;  2OT2 A;  5IGC A;  3HOX B;  1HCZ A;  4IUU A;  3V05 A;  3Q6S A;  3H6M A;  3HOU B;  1TT2 A;  1LTS D;  4OO1 H;  1CZG A;  1HFN A;  3PUY A;  2D5D A;  2A69 D;  4ZKB B;  1U4P A;  4CKB A;  1D1K A;  5M5X B;  4HN7 A;  4CBV A;  3I70 A;  4OO1 I;  1IL8 A;  1S5F D;  3L3O C;  2NVY B;  2NWG A;  2R3Z A;  4ZYS A;  5DM6 3;  3TP5 A;  2O4X A;  1ONL A;  1KAB A;  1HUN A;  5J39 A;  2QIL A;  3S1M B;  3T56 B;  5IOC A;  5T1I A;  3Q24 A;  4XYQ A;  3D8G A;  1KDA A;  5I9O A;  4A3E B;  3E5S A;  4WFN 3;  2XNA C;  4RGM A;  2K33 A;  1QCB D;  3T16 A;  1EEF D;  4KJO A;  3SK8 A;  1FR3 A;  1Y8O B;  2N55 A;  1PRT B;  1JR0 D;  2SEB D;  3LWU A;  3X3M A;  2NYZ D;  4PNY A;  2JEA I;  4B08 A;  3MFY A;  1FGB D;  1E2W A;  3OW7 A;  3KF8 A;  3IL8 A;  2NVX B;  5E1F A;  1WTO A;  3P1H A;  3NBI A;  1EEI D;  2LY7 A;  4TQU S;  1O7Y A;  3D6C A;  1DD2 A;  5ELC A;  3OIQ A;  1PFN A;  1Q1B A;  1KNE A;  1AZP A;  4QIW B;  2Y0S B;  1OXX K;  3SK5 A;  4HCE A;  3A56 A;  1MI2 A;  3F2U A;  2DY8 A;  2L4N A;  2N88 A;  1TWC B;  1SYG A;  3S2H B;  2B2T C;  1E0B A;  4RCO A;  1GJX A;  4EVO A;  1W6J A;  1ENF A;  3DWP A;  3K5L A;  3VR6 A;  3I4N B;  4IAL A;  3I73 A;  1Q8I A;  1I6V C;  3SDZ A;  1VCI A;  2K03 A;  1FNU A;  5KND A;  1F9P A;  3DWQ A;  4G7O C;  1ET9 A;  3WOF A;  3GD7 A;  3S17 B;  5A2Q E;  2B8F A;  4DF7 A;  4IFD G;  4WJW A;  1WTQ A;  2R92 B;  3BS1 A;  1YNN C;  2WII B;  3MXP A;  1JB3 A;  2D62 A;  3QO2 A;  4RGO S;  2EJM A;  1B9M A;  5KYL A;  1TVX A;  4KD4 A;  1EY4 A;  3I3C A;  3H0G B;  1XWE A;  4IUV A;  1KNA A;  5CC4 A;  2PCF B;  1SJH D;  1B2T A;  4A3G B;  1TII D;  3FVQ A;  1QIL A;  4RHR A;  5BN5 A;  3KBG A;  5LL6 S;  4KK7 A;  1FYC A;  4PMW A;  4LMQ D;  1I4P A;  1WD0 A;  4I7Z C;  3KLS A;  2EZV A;  4K8I A;  1C48 A;  2LKV A;  4PV1 C;  1EQT A;  2E75 C;  4YIJ A;  3D3R A;  3SHL A;  1KDB A;  1I4H A;  4K8J A;  2AUJ D;  1UNS A;  4RH6 A;  1E2Z A;  1U9R A;  3C1F A;  2EYO A;  2JA6 B;  4C3H B;  1CQF A;  1F2L A;  4K5W A;  2SNM A;  4NMZ A;  1G29 1;  2SDF A;  5C0X J;  1QG7 A;  1JOR A;  4AYB B;  2NTT A;  2Q8I B;  3KUP A;  4H44 C;  1PTO F;  3C46 A;  5JVH 3;  3L7Z C;  3BVZ A;  4B9X A;  1W6K A;  3I90 A;  4BY1 B;  1DOM A;  3OSO A;  1PLF A;  2L0C A;  3GV6 A;  1D6E C;  4K2L A;  2NB0 A;  2WIN B;  2RDF A;  4FO2 A;  4QUF A;  3DXJ C;  1NAP A;  3FMC A;  4LAA A;  2X69 A;  4DNT B;  3W2D A;  1C8C A;  2EYF A;  3CU7 A;  1L0X B;  1HTP A;  1SXT A;  2MUY A;  1R4Q B;  1BCP B;  4OIK A;  4TSS A;  2KEE A;  5IGD A;  1BO0 A;  1CA5 A;  1TS3 A;  3D31 A;  4KKT A;  4WOR A;  4PMC A;  5IGB A;  1F2M A;  2H4O A;  2O5I C;  2F0V A;  2F0Q A;  3W3A A;  1U4R A;  1STY A;  3MHB A;  4H7B A;  4RKB A;  1H9S A;  3X3N A;  5CV6 A;  3M7N A;  1K83 B;  1EIG A;  2FHT A;  2B2U C;  1LTA D;  3TBI B;  1R4P B;  3TP6 A;  3CHB D;  2Q8T A;  1D2B A;  3GTJ B;  2NBF A;  1IYV A;  2F3V A;  3TZU A;  1PZI D;  4NDX A;  2XWJ B;  1J9O A;  3E0J A;  5I2X A;  3KLS X;  2EJG C;  3SVM A;  2A6H D;  1GHJ A;  2OXP A;  3HKZ B;  3NUC A;  1SMY D;  1DM0 B;  2SNS A;  4A3D B;  2A68 D;  2Z4I A;  2R6G A;  2JXM B;  2F1M A;  1ZYR C;  2EOT A;  2K01 A;  3A54 A;  1SNM A;  5IT9 E;  2RBM A;  3Q23 A;  1PFB A;  2KCN A;  3HP3 A;  4R8I A;  1RHP A;  2AQ1 B;  2B2W C;  2F0I A;  3M4Y A;  3SR1 A;  1RJT A;  4PQX A;  1RD9 D;  3PO2 B;  2L12 A;  2VB3 X;  3IAY A;  1B44 D;  3H09 A;  2WV6 D;  4L63 B;  1MD2 D;  5F2D A;  4X3T A;  2K05 A;  1H9J A;  2F0L A;  3NWT A;  2B2T A;  1FNW A;  4WRD A;  2LFN A;  1H9R A;  4IN3 A;  3TME A;  3I72 A;  4QUC A;  5FLX L;  1H9M A;  3GTQ B;  5BN4 A;  3BYT B;  2VNU D;  1NR2 A;  1SJE D;  5LHY 1;  1NUC A;  1O80 A;  5CGK A;  3ITP A;  3I4L A;  4X3S A;  2L9H A;  2DY7 A;  2F0M A;  1BDO A;  2K04 A;  2EY2 A;  4J1M A;  5EQ0 A;  4FF3 A;  1Z47 A;  2C9O A;  4FXD A;  1IW7 C;  4ILW A;  1GUW A;  1Y8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...