3KF6B

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
PLGSDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6B00
3HOVH 1VQPA 4L5TA 3I55A 4DPGA 2E5LL 1AE3A 1EIFA 1MJCA 2I5MX 4DUYL 1FVIA 2WAQE 4DV5L 3J80i 1XNQQ 5LMNQ 3CP0A 1VQCA 3KF8B 3SGIA 3KOJA 3HOXH 1NMFA 1SROA 4J15A 4TVAB 3TQYA 3HOVG 4DV1L 1FGUA 5M5YH 1TWGH 4GN4B 4YCWA 4LF9L 5FJ8H 1UE1A 4JYAQ 1OXXK 3BZKA 5ELNA 3HOXG 1Q7YC 4IOCA 1JB7A 2ES2A 3CPFA 5C44H 2OTJA 1VQHA 5BR8Q 2UUBL 3S24A 4EX5A 5IYBH 1XPRA 2DUDA 5FLMH 1WJJA 2I0QA 4HJAA 3AQQA 4LUVA 3U50C 5FJ8G 4JI7L 3CCUA 2N49A 1X3EA 2HIXA 4JC0A 4A3CH 1CKOA 4KHZA 3KJOA 4X66L 5C44G 1IBMQ 4LF8L 1E3PA 4JI3Q 2BH8A 1SE8A 2JA6H 5IYBG 5FLMG 3KFUA 1E24A 2PNHA 3W1GA 3CCLA 5GAHC 4NXML 1L1OA 1NTGA 5IP7H 2UXBL 3CXCA 5K36G 2Z6KA 4P73A 5GROA 4AYBG 3CCRA 4A3CG 2IY5B 1U0LA 2UXCQ 2AKWB 3ERSX 4L5QA 1HNZQ 2E2JH 2JA6G 5FLXc 1Q81C 2K50A 4A93H 2UUAL 3UE1A 2ZJQA 2YYZA 2OWOA 4A3JH 5IP7G 1C0AA 3T1HL 1KIXA 3NENA 1Y14B 1VQ9A 1KHIA 4O2DA 3MEFA 2ATWA 4IPHA 3GO5A 1L1OB 1E22A 1YBYA 2WAQG 1LYLA 1L1OC 4R4OA 1NJIC 2R92H 3RR5A 3WWVA 3GTJH 4IPCA 2ASBA 1PFSA 2Z6KC 4A3JG 1YNXA 4JCVE 4GKKQ 2NVXH 3M4QA 1XPUA 2XGTA 1UE7A 2YTYA 2CKZB 4XTCS 3W5OA 2E8GA 3S14H 2R92G 1BVSA 3B6YA 1B7YB 1N9WA 4X64L 1XTDA 5AJ3L 2JQOA 4HIKA 4H02A 4JI1Q 4JI5L 2YV5A 3H3VI 5JJIA 4A3KH 3HFZB 4LFCL 2IT1A 1UE5A 1PHJA 2VUMG 1QVCA 1Y1WH 4DAMA 1Z9FA 1VQIA 3AYHB 4PMWA 4R4TA 3PSIA 1HNXQ 4DR5Q 1EIYB 2EXDA 1N36Q 1SLJA 3STBC 4A3KG 4BXXH 5IWAL 1N34L 3PF5A 1Y1WG 4DR1Q 1XMOQ 4OWWB 1XJVA 1LUZA 3GD7A 5IP9G 2RHSB 4YHHQ 3PO2H 4JG2A 3PIPA 4DV2L 2WP8J 4YWKA 2RHQB 4BXXG 3BU2A 3UDFA 4JBJA 4DR6L 3RNUA 2ZJRA 1YI2A 1A0IA 2WB1E 3S1QH 3PO2G 4LF6Q 4GKJQ 4ALPA 2QGQA 4DNIA 1YHAA 1A63A 3M7NA 2NVYH 4R1JA 1V9PA 3HKZG 1PH6A 4JI4L 1N33Q 2KHJA 4DUZL 3S2HH 4DV3Q 1JJCB 4DV0L 4DV5Q 3G6EA 4GOPA 2NVQH 1TWAH 1GVPA 5GQOA 1SFOH 5M5XH 1WCMH 1SMXA 4DR7L 3HKSA 3RLNA 3W1BA 4O0AA 2RCNA 1OXVA 3BZCA 3S17H 3CCVA 5IT9c 4A75A 4LF9Q 1SN8A 5GAEC 1Y1VH 3KJPA 3I4OA 3H15A 5EAYA 1PA6A 4XIGS 1GM5A 1WCMG 4GS3A 4JI8Q 4AQYL 3CMEA 4NXNL 1PVOA 4LUZA 4GOPC 4UP8A 4UP9A 2AMCB 4DV7Q 3GTMH 1Y1VG 3DM3A 4LF8Q 4OO1G 4X66Q 5GAGC 1J5EQ 1KQSA 4OX9Q 1I5FA 4LF5L 3ER0A 3L2PA 3I56A 1IBKL 4A3DH 2HIVA 1X54A 3AEVA 1HZ9A 2F4VL 3ULPA 1EUJA 2R6GA 3RLFA 1U5KA 4BA2I 1SR3A 1I94L 1QVGA 4JI6L 2K5NA 3E9IA 3CPWA 2KENA 4PG3A 1QUQA 3D0FA 2K75A 4UPAA 4PZ7A 4HJ8A 3GTGH 4HJ5A 3KF6A 2ZJPA 4A3DG 1X56A 1VQFA 2DGYA 2K5HA 4DAYB 4IJHA 1A8VA 3KLWA 4X62L 4QJFA 2VQEQ 1HR0L 2CWPA 2Z0SA 2LSSA 4KI0A 4DR3L 4A3MH 1NMGA 2E2HH 2EIFA 1NE3A 3L0OA 4X65L 4HJ7A 4P75A 1ASYA 3I4NH 2R7ZG 3K8AA 3PUXA 4MNOA 1IBLL 4IPGA 1XNRL 2YTVA 4DV6Q 1QUQB 4FDBA 2ZM6L 3DLLA 3KF6B 4OWXB 4B3SQ 4GLVB 2Y0SE 5M3FG 1YJNA 5M3MG 4X64Q 5AJ3Q 1I3QH 4A3MG 1O7IA 1EQRA 3M9BA 3I4NG 2UXDL 3JAMc 3PIOA 1B70B 2NN6G 1BKBA 2Q2TA 3CCSA 2K52A 4TQUS 1K8GA 2JJQA 1J6QA 4R4CA 3TEHB 1YITA 1OXTA 4K0KL 3GTPH 2D62A 4DK3C 5IYCH 5C0XG 3CC2A 2K14A 3F1ZA 3KYHC 4LFAL 4YWLA 2E2IH 2HQLA 1I6HH 3PUVA 1N32Q 2JA5G 2NVTH 2OTLA 5IYCG 5C3EH 1FJGL 3PGZA 1EYGA 4JI2Q 1QVFA 3S15H 3EN2A 1K83H 4DKAC 5LMUQ 5JJLA 1EOVA 1RL2A 1X55A 1VQAA 2XTIA 2PQAA 3F2BA 1S40A 4DR4L 2PI2A 1YHBA 1YHQA 1PV4A 1CUKA 1KRSA 5C3EG 2VUMH 2LXJA 2V1CC 2MFIA 1S72A 3GTLH 1K3RA 4GNXA 3K7AH 1M90C 4P72A 4B3TQ 4BY1H 3HOYH 5H1SE 3U4ZA 3UDIA 3D31A 3U58A 1Q12A 1XNQL 5LMNL 2AWNA 3T1YQ 2YTXA 3GTOH 1V43A 4LWCA 2JEBI 3J81j 2UUCL 1X6OA 3E0EA 1PH1A 4IFDG 2PQAB 4AIMA 3HOYG 4LFBL 1IYJB 4MZ9A 4BY1G 3PUWA 1PH5A 1IXRA 3K0XA 3S2DH 2IHFA 4LF4L 1VQNA 5IP9H 1ASZA 4KHPL 3HOUH 1YEZA 4GNXB 2MO0A 4GNXC 4JBWA 5BR8L 2A8VA 1QZGA 4WJ3M 3E9HA 4YWMA 2Q2UA 3PUYA 1WI5A 2ZTDA 3CD6A 3I7FA 5HY6A 4JBMA 1BBUA 1HZCA 3CCEA 4A3FH 4OO1I 2OQ0A 4RMFA 4UY8C 1X9NA 3HOUG 1WYDA 2ID0A 4P71A 4A3IG 1IBML 4JI3L 1PYBA 3NELA 4LW1A 4APVA 3STBD 3TS0A 1KL9A 3L7ZC 3ZJYC 1VQMA 4A3FG 4KLKA 3CW2C 1T9HA 1VQ5A 2B63H 1HNWQ 4R4QA 1HNZL 4JI0L 1Q46A 2JA9A 3A0JA 1AE2A 2AWOA 3PUZA 1KAWA 1LM0A 1YZ6A 2E5LQ 1CSPA 3J7A5 3K7UC 2QEXA 2KCTA 1W3SA 2K5VA 4DUYQ 4DV4L 4B3MQ 2F52A 4JI6Q 4L5RC 1OXUA 2B63G 4LFBQ 2IX0A 1K73C 4HIDA 1JJ2A 1G291 4IPDA 1N8RC 1IL2A 1TWFH 3OYYA 1BBWA 4DV1Q 1Q82C 4JBKA 1GD7A 4B3RL 1TWCH 3JC66 4QL5A 1XPOA 4POGA 4X6AH 1YIJA 4POFA 1WOCA 2EQSA 4HJ9A 2VY3A 3AFQA 2MO1A 4DR3Q 3S1NH 1P16A 5IE8A 2NN6I 2UUBQ 1L0WA 4JI1L 4GOPB 2VQFL 3VDYA 3TREA 1XNRQ 3J81c 4JI7Q 4WJ4A 4LF7Q 2NZHA 3J7ZC 2D0OA 2LXKA 1VQGA 4A4IA 2D0PA 1OXSC 3CMAA 3G4SA 2ZTCA 1HNXL 3OTOL 4DR5L 1WFQA 5DLQE 1N36L 1G51A 2VW9A 1PH7A 1MJEA 1Q8KA 2VL6A 5IY0A 4YY3L 2B29A 2N78A 2C35B 4NXMQ 2WB1G 1XMOL 4GLXA 2UXBQ 4QIWE 3CAMA 4A3GH 5GADC 3G71A 4JV5L 2MQHA 3A5ZB 3FKIH 2K4KA 2UUAQ 4C2MH 4OWTB 2R7ZH 2Q2HA 2IX1A 3T1HQ 3GTKH 2HHHL 3S1RH 1EQQA 3JAMi 1KD1C 1A62A 4IJLA 4AYBE 3A5UA 1X3FA 1C7YA 2CFMA 4A3GG 1G6PA 2N3SA 3FKIG 1P8LA 5M3MH 5M3FH 3CCMA 3MXNB 4GKJL 1AH9A 4BBRH 2OCEA 2PI2E 3ULJA 1HZAA 1Z47A 1VS0A 3CCJA 4IFDJ 4Y52H 4IFDI 1XMQL 3ULLA 1N33L 3EIVA 4DV3L 2FXQA 2I5HA 4BBRG 3F2CA 2QA4A 1D7QA 1UEBA 2A19A 4JI5Q 4IO9A 4LFCQ 2YU9H 1CKMA 2CCZA 2UUCQ 2VNUD 3NEMA 2A1AA 2JA5H 4A3LH 3RZOH 1JE5A 4R4IA 1Q1BA 2PMZE 4LF4Q 4KHPQ 2VS1A 2HT1A 5JEAG 1JJGA 4GLAC 5IWAQ 4JOIA 1N34Q 1EFWA 3PV0A 4JI8L 3UDGA 1JMCA 4ME3A 3J80c 1VQEA 2N8NA 3CCQA 4A3LG 4DV7L 4MTNA 1IZ6A 1E1TA 4Y7NH 2UU9L 3A74A 2BA0A 5C4JH 4A3EH 1K0RA 1SRUA 4DV2Q 4DR2L 4PZ6A 1Q1EA 3GDEA 4P74A 1J5EL 1HR0W 4OX9L 4LF7L 4DR6Q 1PH4A 5J3BA 1MIUA 1E1OA 4A93G 3Q8DA 1M1KC 4A3BH 4JOIC 4A3EG 2H5XA 2I5LX 3IRBA 1Q86C 1B8AA 1L2FA 2IHEA 4JI0Q 5E7NA 1R9TH 1UE6A 2GN5A 3TRZA 4JI4Q 1K9MC 5IYDH 1GO3E 1RIPA 4DUZQ 4DV4Q 4A3BG 3PO3H 1W2BA 4DV0Q 2R7FA 2Y0SG 2VQEL 4GN5A 1CKNA 1YJ9A 4C3IH 1QZHA 4JYAL 1PH2A 1CSQA 3PCOB 4DR7Q 1NY4A 1HJPA 4BA1I 4B3RQ 4A3IH 4C3HH 5IYDG 4NPSA 3HKZE 3ICEA 4QY7A 2CWAA 3PO3G 2VZAA 4RG1A 4DV6L 1VQBA 4B3ML 2KHIA 3CQZH 4B3SL 1PH3A 1VQLA 4QQBX 3CF5A 3M3YH 1PYSB 4LUOA 3S1MH 4AQYQ 4A76A 1KC8C 1OTCA 4NXNQ 4BBSH 2VQFQ 1CKNB 4GN3B 1YJWA 1VQDA 2OQKA 2Q2IA 2L15A 1JT8A 3H0GH 3I2ZA 1VQ7A 1VQJA 3K80C 4HIOA 4UP7A 1C9OA 4OONA 1E7ZA 3OTOQ 4LF5Q 1IBKQ 4BBSG 2UXCL 2WFWA 4AH6A 2JA7H 3LGJA 4YY3Q 3H0GG 5LMNW 2F4VQ 1N32L 3M85A 1X3GA 5ELOA 3UE0A 1PH9A 3F8TA 3I4MH 1I94Q 4JV5Q 1VQ8A 3J81i 4JI2L 2JA7G 3KDFA 5LMUL 3OW2A 3UDXA 1VCIA 2KBNA 2GVBA 2HHHQ 3GTQH 4GKKL 3G48A 2GVAA 4X62Q 1K8AC 4LNQA 1MKHA 1HR0Q 2JEAI 3I4MG 1VQKA 2R7DA 2BH2A 1VQ4A 3CC4A 3FP9A 3AFPA 1UWVA 3RZDH 4B3TL 2JE6I 1KXLA 3S16H 2ZTEA 1KRTA 4X65Q 3F2DA 2KCMA 4YCUA 1HZBA 3T1YL 1IBLQ 1VQ6A 1H95A 3H3VH 1XMQQ 3KDFB 2ZM6Q 1LTLA 4YCVA 4QGUA 4PZ8A 4IOAA 5C4XH 5C0XJ 3TS2A 4NB3A 1X65A 3BJUA 2JK8A 5JEAJ 3U4VA 5C0XI 5HGQA 2UXDQ 2BA1A 1GKHA 4OXPA 3M4OH 1TXYA 2AHOB 1EWIA 5M5WH 1DGSA 2R93H 4EQ5A 4C3JH 4L5SA 3HOWH 2RF4A 3K81C 4HIMA 4K0KQ 1FL0A 4DR1L 3PF4A 5C4XG 1HH2P 1I50H 3NBHB 2JA8H 4DK6C 3M4PA 4YHHL 4LFAQ 2R93G 2NZOA 3HOZH 3HOWG 1V1QA 2CQOA 3RN5A 3FHWA 1NBWA 1S3OA 3CC7A 2MNAA 1TWHH 1YVCA 4BY7H 2B3GA 2UU9Q 1FJGQ 2JA8G 4DR2Q 3RN2A 1PH8A 4LF6L 2ALYB 3EBEA 3HOZG 3RLOA 2F3IA 1D8LA 4DR4Q 1HNWL 1VQOA 5JJKA 4BY7G
chains in the Genus database with same CATH superfamily
3LX0A 1VQPA 3I55A 2E5LL 3MFYA 1CT1D 4K8JA 4DV5L 3KOJA 1NMFA 1SROA 1QOHA 1TWGH 5FJ8H 3VYUA 2XWBB 3IKJA 3MWYW 1SJHD 4CJ2C 2ES2A 5D14A 1JE4A 1YNNC 4FF4A 4EX5A 1K8MA 3DWPA 3AQQA 4HJAA 1F2MA 1ET9A 2N49A 1X3EA 1II3A 4IUVA 1PYWD 3HRZC 4RA8A 2ZXRA 4K6DA 5LL6S 5C44G 4JI3Q 2F0QA 4PQXA 2DJGC 1SBBB 5IYBG 2JA6H 1JOKA 5TSSA 1BQQT 4JPBW 5FLMG 5M3FB 4A3MB 3CCLA 3M4YA 3I4NB 3DUZA 2Z6KA 1ZYRD 4RAUC 3C1EA 2UXCQ 3ERSX 1Q81C 2IX3A 4KN7C 2OWOA 5JAVA 1KIXA 3NENA 1KDCA 1SE4A 3MEFA 2ATWA 4RGTA 1E22A 4N9TA 4R4OA 2JA5B 3WWVA 3GTJH 4IPCA 4DNRB 5C4HA 4GKKQ 1YNXA 2X6LA 4R8IA 1ONLA 2HD3A 1UE7A 1B7YB 1N9WA 2NVTB 3J81L 2WV6D 4H02A 4JI1Q 5JJIA 2IT1A 5D65A 1NR2A 1B44D 3ND8A 4TSSA 3PSIA 2JSOA 2EXDA 4QF4A 5IWAL 4BY1B 4DR1Q 1FNUA 1EYAA 2RHSB 4BXXG 4DV2L 5CGKA 2RHQB 3BU2A 3RNUA 4CJ0B 1RTOA 1U4RA 3S1QH 1BXTA 1T5XD 4C3HB 4FVMA 5HGTA 1PTOB 4ALPA 1MD2D 1PTOC 1D2BA 1BCPB 1BCPC 4DF7A 4B9WA 3NXWA 1JJCB 2CVRA 4DV0L 1AFPA 1C8CA 1GVPA 3ZYYX 1SFOH 1WCMH 1RF2D 2RCNA 3VR2A 4I65A 2RA4A 3CCVA 1TR5A 3QR8A 5GAEC 1Y1VH 2OF1A 4P2CB 2EYPA 4AQYL 3SK6A 3OHXC 1PVOA 1F9PA 4GOPC 2AMCB 1D6EC 4CGYB 4DV7Q 3GTMH 5JPMC 3DM3A 1DXMA 1TIID 1RD9D 2BDOA 4X66Q 1J5EQ 3NSWA 1LLRD 3G7LA 1DOLA 3ER0A 4LF5L 2OT2A 1WD0A 2F3VA 3S1NB 4OHJA 3AEVA 2HCCA 3RLFA 4BA2I 5EJWA 1QVGA 2K5NA 4JI6L 2KENA 4PG3A 2XSCA 2K75A 4HJ8A 4A3DG 2JP1A 4HJ5A 1X56A 1VQFA 1W6JA 2K5HA 4DAYB 3KLWA 2VQEQ 1PMRA 2LSSA 2X69A 3N6RA 5C5LA 1PRTF 4X65L 1A15A 4C1NI 4MNOA 1IBLL 1QUQB 3I91A 3DLLA 4WFN3 3KF6B 4LF7L 1YJNA 5M3FG 2B2VC 4A3MG 1TWHB 3W2DA 3NPPA 1EQRA 3M9BA 3I4NG 1B70B 2FHTA 1ET6A 2K52A 3MC0B 4TQUS 2JJQA 4R4CA 3TEHB 1YITA 1K8GA 1D5ZC 1VF7A 1S5ED 4XXEA 1O7ZA 2K14A 3F1ZA 3HOVB 5CC4A 4YWLA 1QNUA 1E2ZA 1STBA 2CH4A 4MHEA 1JQYD 2JA5G 2OTLA 1EYGA 1QVFA 4IUQA 3S15H 5LMUQ 1EOVA 2PYKA 1X55A 1JWMD 1VQAA 2XTIA 4OELB 2PPBC 3RZOB 3Q24A 4ZUJA 5EKKA 1F77A 4ZKCB 3VA7A 1CUKA 5C3EG 2V1CC 2B8GA 3ITPA 5I9OA 1K3RA 4GNXA 4P72A 2F0GA 2FMMA 1S4ZA 3U4ZA 3U58A 2AWNA 5C4JB 3GTOH 2ZXPA 2EZVA 3H6MA 3E0EA 4TKOB 4BY1G 3R8BA 3VYSA 3K0XA 4ILWA 3D4RA 5IP9H 3HOUH 1YEZA 2DY8A 4A3BB 2RDGA 1MHWC 3E5SA 2Y0SB 1QZGA 4NMZA 1U4LA 1WI5A 1V1OA 2A5HA 5HY6A 1Q8IA 3ERQA 4CJ1B 1BBUA 2OQ0A 4UY8C 1WYDA 3HS0C 4YIJA 2B2UC 4C3IB 1GUGA 3TS0A 2TSSA 4RCNA 4H7BA 4ZQ3A 3WDNA 2D9UA 2Z9HA 1CFMA 5J22A 1VQ5A 1HNWQ 3F2UA 1SMYC 2LFNA 1HNZL 1WTHA 2EE1A 2GA4B 3A0JA 2JA9A 1AE2A 3VYTA 1KAWA 1YZ6A 3J7A5 3K7UC 4DV4L 1W3SA 2K5VA 3E3XA 5FOBB 3D6CA 4A3KB 3K6OA 2H1EA 4B3RL 2FMCA 3VR6A 3A55A 2C9OA 4POGA 1D1IA 4POFA 1GHKA 1PRTB 2EQSA 4HJ9A 3AFQA 1PRTC 3I8ZA 4DR3Q 2NN6I 3D4DA 1PZJD 1XNRQ 3KUPA 3P7JA 4JI7Q 2NZHA 2XRSD 4CKBA 3J7ZC 4A4IA 2D0PA 4UHVA 1NUCA 2QDBA 5DLQE 2F0LA 2QILA 4V0BA 1N36L 1PH7A 1LTID 2VL6A 1HXYD 4IUNA 1XMOL 2X6GA 2NVYB 4FF2A 1EQTA 5KGUA 3SK5A 1D5MC 2UUAQ 1B50A 2QKIC 3S1RH 5FLXE 2E2DC 5M5XB 1KD1C 4N8X1 4NW2A 5M3MH 3OMCA 3CCMA 2OCEA 1W6KA 4X3UA 3KLSX 2F0JA 2L5TA 3GV3A 1RCVD 3HP3A 3R2IA 4HMIA 1KAAA 3EIVA 4GZYC 1SDFA 5EQ0A 1EY5A 2K32A 4JI5Q 2L4NA 4HCEA 2UUCQ 2A1AA 1YNND 1QILA 3MA2B 4K6LA 4R4IA 5I6YA 4KKSA 4LF4Q 3OPOA 4KHPQ 5JEAG 1EFWA 1EQVA 2J0TD 1A6XA 1XYIA 1VQEA 2EY1A 2N8NA 3HOXB 3NWTA 2AQ2B 4MTNA 1IZ6A 1E1TA 2BA0A 4A3EH 1NCVA 1NR4A 1K0RA 1HR0W 2KOLA 3GQBA 5IGCA 4QUCA 4DFAA 1PH4A 4XYOA 1E1OA 3Q8DA 3EVQA 4FXKC 2AUKA 1L2FA 1Q3LA 2PZUA 2IHEA 4JI0Q 5E7NA 1BR9A 2K01A 1UE6A 1U4MA 5JJZA 1GO3E 4A3BG 3FMCA 3NWSA 2N55A 5IGEA 3PO3H 2R7FA 2Y0SG 1CKNA 3A8KE 2B39A 3V2TA 1CSQA 3I3CA 3PCOB 2NB0A 3S9WA 5IYDG 4NPSA 3ICEA 3MHBA 2WAQB 4RG1A 4DV6L 4A93B 1VQBA 2E2IB 2KHIA 4C3IG 4G7HC 2EOTA 2ENBA 2VQFQ 3IFTA 2K1BA 2R92B 1JT8A 3I2ZA 1VQJA 3K80C 1I4QA 4OONA 4K2LA 3DM1A 5ELDA 2VUMB 1CK1A 3LGJA 2F0NA 4XQJA 3HOYB 1JCKB 4XQQA 2F4VQ 4QB4A 2K5WA 5ELOA 3UE0A 2CHBD 1A2UA 1EY9A 1PH9A 3I4MH 4JI2L 1HTPA 1A3VA 5A2QE 5EBCA 2N88A 3UDXA 1PTOD 1VCIA 4BS9A 3I72A 2HHHQ 2H4OA 4LNQA 2JEAI 2A6EC 1ENCA 1H9MA 4FP5D 2BH2A 3CC4A 3FP9A 3QWNA 3RZDH 4B3TL 3S16H 3F2DA 2C5CA 3T1YL 3PO2B 3NBHA 2ZM6Q 1AN8A 2L1BA 2BA1A 1GKHA 2MJ8A 3M4OH 2F0OA 1EWIA 1RKNA 2P5ZX 4C3JH 4EQ5A 4L5SA 1A2TA 2RF4A 5C4XG 4K0KQ 1F2YA 4FO2A 4DK6C 1L0XB 4YHHL 4LFAQ 3L3OC 2FFKB 3S2HB 3VA5A 1V1QA 3RN5A 1NBWA 2NVQB 1TWAB 2MNAA 4LJZC 4KKTA 5KNBA 3S17B 3EBEA 4NDXA 2F3IA 3DWAA 2SOBA 1F2ZA 1H9RA 4ZAIA 4JW0A 2I5MX 3DWQA 2WAQE 1XNQQ 2G5DA 5LMNQ 2CW0C 3CP0A 3KF8B 3J7YW 4Q5VA 4J15A 3TDQA 3TQYA 4DV1L 1ENAA 5M5YH 1LT5D 1UE1A 4JYAQ 1OXXK 3BZKA 5ELNA 3HOXG 1Q7YC 2A68D 5C44H 2OTJA 3FEWX 1NAPA 2UUBL 2I0QA 5IYBH 2DUDA 5FLMH 2HIXA 2R7ZB 4KHZA 1LV9A 5EPKA 3NUCA 2LMCB 2EYOA 2KEDA 1SE8A 1E24A 2PNHA 3P1HA 3W1GA 2F0WA 2SNMA 3HEJA 2PW7A 3QB3A 1NTGA 3FRPB 2UXBL 4AYBG 4P73A 4ME5A 2G9HD 4ABNA 1U0LA 1EEFD 2XN9C 2EDGA 4OIKA 2E2JH 1UEAB 1QB5D 1JR0D 2EPBA 2IPKD 5IP7G 3T1HL 4RCOA 4IN3A 2YU9B 2WIIB 1LACA 3KBGA 1L1OB 2WAQG 1LYLA 1L1OC 4A93G 3RR5A 3K5NA 4OGQC 2DY7A 4JCVE 5BN4A 2NVXH 4M8AA 1HFGA 2XGTA 2YTYA 4XTCS 3S14H 4Z9CB 2R92G 4X64L 2F0EA 1XTDA 5IT9E 1TY0A 1EFID 2VUMG 1QVCA 3MVVA 5JVH3 4PMWA 1S5FD 1HNXQ 1SLJA 4BXXH 5EGTA 1ZEQX 1Y1WG 3U9SA 4ZYSA 2F0TA 2R61A 1KTKA 4DK0A 4YWKA 1VF5C 1A3UA 1DONA 4JBJA 1EZ8A 1YI2A 1SMYD 3PO2G 1LABA 1B2TA 2QGQA 3Q0AA 3QIAA 4A3FB 1V9PA 3HKZG 4JI4L 4DUZL 4DV3Q 2M2LA 2O2LD 4J1MA 4DV5Q 3G6EA 4GOPA 2RBMA 4IALA 2JXMB 3H0GB 5GQOA 1LT6D 1SE3A 1SMXA 2XVSA 3RLNA 3BVMA 1EY4A 5IGDA 1AP0A 4O0AA 1BUVT 1DJRD 2Q8RE 5IT9c 4A75A 5FK9C 2JA7B 3K58A 5KEEA 3DEOA 3I4OA 3H15A 1PA6A 4XIGS 1GM5A 4JI8Q 2SDFA 2HUGA 4NXNL 4UP8A 4UP9A 5KNDA 4RKBA 1F9SA 3J80E 4OO1G 1KNEA 1I5FA 4DAYA 3I56A 4A3DH 5LHY1 1X54A 3NQIA 1SNQA 2A69D 2RVLA 2R6GA 1U5KA 1K28A 1I94L 3DXJC 3KLSA 5BN3A 3GTGH 1QUQA 3KBXA 3KF6A 2B2VA 2L9HA 1K8OA 1DD2A 4IJHA 4X62L 4QJFA 1HR0L 2R93B 2CWPA 2Z0SA 4A3MH 2WACA 3Q22A 2EIFA 1NE3A 3L0OA 3I4NH 2R7ZG 3K8AA 4IPGA 2DJFC 2QCPX 1E2WA 5C4ZA 2XIWA 3HOZB 4FDBA 2HCIA 4LMQD 2UXDL 3PIOA 1K0SA 4N9PA 4IUTA 4BBRB 1OXTA 5C5MA 3SEBA 1MI2A 3GTPH 4DXFA 4DK3C 1WVLA 3A7AB 3CC2A 3KYHC 3NTIA 3MXPA 3K5LA 1I6HH 4Q0FA 1CQFA 2NVTH 5IYCG 5C3EH 5IGBA 1DOMA 1FJGL 3VR3A 4DKAC 1EWCA 1M8AA 5I9PA 1YHBA 3NTHA 2K7VA 1RJTA 1S72A 2MFIA 1M90C 4BY1H 2VB2X 1B9MA 1DOKA 3J81j 4C56C 1X6OA 3V96A 4IFDG 4AIMA 1IYJB 4MZ9A 5CMDA 2B2UA 3PUWA 5DNFA 1TU2B 1VQNA 2FJ2A 2MO0A 2PQEA 1C4QA 4JBWA 3E9HA 4CDDC 4CBVA 4RMFA 2DN8A 4PMBA 2F1MA 4P71A 4JI3L 3NELA 1KLUD 1G2TA 3STBD 3L7ZC 5D3DA 5D3IB 3GTJB 3ZJYC 4A3FG 1L0YB 1LT3D 3I73A 5A2QL 1Z7TA 2AWOA 3PUZA 3BDCA 1LM0A 3D4WA 1CSPA 1V8QA 5JPNC 2QEXA 4DUYQ 4BBSB 3HGBA 2F52A 4JI6Q 2A6ED 1OXUA 2QW7A 1K73C 4RKLA 1IL2A 5CV9A 4JBKA 1TWCH 1XPOA 4X6AH 1WOCA 3SR1A 2MO1A 4CDCC 3S1NH 4X3SA 4JI1L 4GOPB 3VDYA 3A8JE 4WJ4A 1H9KA 4LF7Q 5ELFA 1OXSC 1B9NA 2ZTCA 4K2KA 3OTOL 1I4PA 4NXMQ 4YY3L 4QIWE 3CHBD 3G71A 4JV5L 2MQHA 1GXDC 4C2MH 4OWTB 3T4AC 1SFOB 1A62A 4OIJA 5CYUA 2N3SA 1O78A 1P8LA 2DNCA 3ULJA 3TP5A 5K5PA 1R4PB 2JA8B 1LT4D 3CCJA 2CW0D 1J8IA 3ULLA 3MXUA 2KEEA 2VB3X 2A68C 4BBRG 4BY7B 1UEBA 2MUYA 5C0XH 5JEAH 4IO9A 4LFCQ 1KABA 1QE6A 5J1ZA 4XQNA 1WTRA 3RZOH 1JE5A 1IW7C 4K5VA 2ICIA 1VMCA 1IKMA 1EY0A 2G9DA 2VS1A 2HT1A 1N34Q 1SYDA 3PV0A 4HSPA 2EYMA 1JMCA 1TQOA 2O5JC 4A3LG 4DV7L 4R8NA 4Y7NH 1T5EA 5C4JH 1SRUA 1LO5D 4DR2L 4PZ6A 1Q1EA 3GDEA 4P74A 1J5EL 4DR6Q 1HFNA 3T16A 1M1KC 4A3BH 4JOIC 1EY6A 1FR3A 1B8AA 2LKVA 5C3WA 3TZUA 1GUOA 3EQLC 3VR4A 1HQRD 2GN5A 3MEHA 3J7AV 5IYDH 1RIPA 4DV4Q 1W2BA 4XDXA 1A3TA 2VQEL 5DAUA 4GN5A 2NTSA 1JOQA 1RODA 4C3IH 1QZHA 3D3RA 1ZXTA 1NY4A 4DR7Q 1HJPA 4BA1I 3W3AA 5IT9L 2NUCA 4A3IH 2A74C 4B3RQ 4QY7A 1AEXA 3IL8A 1IHZA 4B08A 3CF5A 4A3JB 1PYSB 1AZQA 3S1MH 4C3HG 4GN3B 1VQDA 2OQKA 2Q2IA 1TS2A 4ZCKA 4FXDA 1PZKD 4DA2A 1E7ZA 3AU7A 1IBKQ 4BBSG 4AH6A 4KMUC 3T53B 5LMNW 4E6IA 3M85A 1VQ8A 2NWGA 1WTWA 4UAIA 1F9RA 2NBFA 5E4XA 2RDFA 2Z8LA 5LMUL 5I2XA 3OW2A 2GVBA 3EA6A 2GVAA 5KYIA 1MKHA 2F3WA 3HOUB 4JK1C 5IGFA 1VDZA 3AFPA 1UWVA 3TZDA 1IYUA 1KRTA 1MSGA 2F0DA 4TRDA 1ICWA 3H3VH 1STEA 4QGUA 2F4IA 5C4XH 3TS2A 4NB3A 1AZPA 3BJUA 4KJNA 1DM0B 4OXPA 4QCLA 5M5WH 3FPUB 3EROA 3K81C 3JAME 1HH2P 5T1GA 1I50H 2Q8TA 2AQ3B 1B4OA 1KLGD 1QWYA 2A69C 4IZ8A 4KD3A 3CC7A 3AMUA 2WINB 1QJOA 3KF8A 2JA8G 3RN2A 1PH8A 4LF6L 3EJIA 2WKCA 2B2WC 4DR4Q 1HNWL 1WTXA 4BY7G 4RGOS 4HMJA 4DXGA 1TT2A 1PFBA 4L5TA 4DPGA 1AE3A 2AUJD 4XT1B 1FVIA 4L6TB 3J80i 3IFDA 3HOXH 3SGIA 1NSNS 3V05A 4DAVA 4TVAB 1FYCA 3HOVG 5CV5A 2KVMA 1WTPA 4GN4B 5KIXA 4LF9L 1GOZA 3CPFA 4KY6A 1VQHA 5BR8Q 1WJJA 4LUVA 5CV8A 4JI7L 3CCUA 4JC0A 4LF8L 1IBMQ 1QCBD 1EU3A 1HUNA 1EU4A 3KFUA 1TKWB 5M3MB 1JWSD 1L1OA 5IP7H 2EJFC 5K36G 2IJ0A 4A3CG 2IY5B 2KQ3A 3RD4A 2EJMA 4A93H 5FLXc 2UUAL 3UE1A 2PZWA 1SYEA 2YYZA 1I6VC 3N52A 3Q23A 4IPHA 4DGZA 3GO5A 3ONAB 1YBYA 5EKLA 2R92H 4A3JG 3H94A 1HA5A 2M00A 2XNAC 3M4QA 1U9RA 2K33A 3W5OA 3L9AX 4EQPA 3B6YA 5AJ3L 4HIKA 4JI5L 2YV5A 4A3EB 5F2DA 1PHJA 1UE5A 1K83B 3K5MA 2K05A 4ULLA 4DAMA 1Z9FA 1Y1WH 1VQIA 3AYHB 4R4TA 4DR5Q 1EIYB 3BG3A 3STBC 3CKIB 4A3KG 4MTKA 4OWWB 2RCFA 1XJVA 1LTTD 4OEMB 1SNCA 1F2LA 1LUZA 3GD7A 5IP9G 4YHHQ 5L37A 3PO2H 4L63B 2EY2A 3PIPA 2WP8J 3BS1A 1XX8A 4IQZA 3S2DB 1A0IA 2WB1E 2HDLA 2PW5A 1XTCD 4GKJQ 2F0FA 1PFNA 3M7NA 1CQVA 1FD7D 4R1JA 1PH6A 1N33Q 1MBYA 2KHJA 3S2HH 2NVQH 1ILQA 1TWAH 2ZT9C 3KK7A 1JB3A 3I70A 3BZCA 1OXVA 1STYA 4K5WA 2B63B 3S17H 4XT3B 4IURA 5EAYA 1R4QB 5G3LF 4OO1H 3M7GA 4GS3A 3CMEA 2EY5A 4DK1A 2IL8A 2RSOA 2B2YC 3A8IE 4H0LC 4OX9Q 3L2PA 3QO2A 2EY6A 4ZRZA 2HIVA 1HTLD 3RZDB 3S16B 2F4VL 3SDZA 3MAQA 1IL8A 1IYVA 5I2YA 3E9IA 3CPWA 4LFBL 4PZ7A 1CM9A 2ZJPA 2DGYA 3LWEA 2EYLA 3M4OB 1X32A 3PQIA 1S5BD 4RGMA 1CHQD 1ESFA 2E2HH 3MXGA 4O42A 4HJ7A 4P75A 1ASYA 4A3GB 2YTVA 3FKIB 5IGGA 2ZM6L 4B3MQ 4OWXB 4B3SQ 4GLVB 4LK1C 5M3MG 4X64Q 1I3QH 1O7IA 4RFBA 3GTKB 3D6WA 1IW7D 2NN6G 1STAA 1CZGA 4UDUC 5KYLA 1SAPA 4K0KL 1GUNA 4N8FA 3CRLC 5IYCH 5CR3A 2QF7A 4LFAL 1PZID 2O5IC 2HQLA 3QJYA 2KECA 3PUVA 1SNMA 1N32Q 1EIHA 3NQTA 5CORA 4L8JA 3EN2A 1RL2A 1S40A 2PCFB 2B2TC 1YHQA 1PV4A 4FF3A 3TP6A 2MHVA 1B1ZA 2LXJA 3GTLH 4ODGA 4IFDH 3K7AH 2ZXOA 3T13A 1Y8PB 3OMGA 2KUMA 3UDIA 5ELEA 1Q12A 1XNQL 2BE5D 5LMNL 2YTXA 5IODA 4I7ZC 4LWCA 4DAPA 1PH1A 2PQAB 3HOYG 1CHPD 4G57A 1PH5A 1IXRA 1GUSA 1ASZA 4HCSA 3A56A 2Q2UA 3PUYA 2ZTDA 3CD6A 1R9TB 1HZCA 4A3FH 3CCEA 1GUWA 1SNOA 1X9NA 5CV4A 4IUUA 4LW1A 5J39A 4APVA 2PMZB 1H9SB 1KL9A 2QEJC 3TBIB 1B53A 2NVXB 1SYGA 3CW2C 2LS01 3S14B 3CQZB 2E75C 3H09A 3M3YB 1Q46A 2E5LQ 3R3OA 2KCTA 3URYA 1C48A 5C3XA 2B63G 2IX0A 2Z6BA 1G291 4IPDA 1N8RC 4KJOA 1TWFH 1BBWA 5ELCA 1Q82C 1GD7A 3JC66 2B8FA 4QL5A 3PIO3 5KRUA 2DNEA 1YIJA 2VY3A 1SXTA 2E76C 4DU9A 2E74C 5IE8A 4G7OC 3OW7A 1L0WA 1G2SA 2XWJB 2LXKA 1VQGA 3DEPA 3JAML 3GTQB 4C1NK 2EVBA 2OEOA 3CMAA 3G4SA 4KTAA 1HNXL 1WFQA 2NTTA 2OXPA 1G51A 2F0MA 2SNSA 5IY0A 2N78A 4I7AA 2RQXA 5DEHA 4GLXA 3CAMA 4J6HA 5FLXL 5GADC 4CKEA 5LL6X 3FVQA 2Q2HA 5CBEE 3JAMi 4A3GG 4IJLA 3A5UA 1C7YA 1DZ1A 1KDBA 3HOWB 3FKIG 5M3FH 1AH9A 3MXNB 3I4LA 4BBRH 2PI2E 1BNZA 1HZAA 1XMQL 2TMPA 1TY2A 4DV3L 1HHVA 1D7QA 1LTSD 4ZKBB 3EFXD 2I07B 2JA5H 1V1PB 4ZUIA 4A3LH 4A3DB 1JICA 1Q1BA 2PMZE 1O7YA 1GJXA 3RMHA 5FKAC 1JJGA 1UNSA 3ND9A 4GLAC 4JOIA 5IWAQ 4JI8L 3UI2A 4ME3A 1TS3A 5CV6A 1FNVA 3J80c 3GTGB 2BOSA 2UU9L 3A74A 4DV2Q 1TWGB 4RHRA 1Y8NB 1ICFB 4K8IA 4QIWB 2LY7A 2KA7A 1WTOA 2RKSA 2H5XA 2I5LX 3IRBA 3OIPA 4R9WA 3K57A 3TRZA 3X3MA 2EJGC 5AFWA 2EYHA 2JA6B 4DV0Q 2V4DA 3VR5A 4FNFA 2XRQD 3GTPB 4C3HH 3Q6SA 1PTOH 2CWAA 1I4XA 4O1NA 4HSVA 1I4GA 2A6HD 1HPCA 1I6HB 4QQBX 1OO9B 2BCOA 4AQYQ 3LWUA 4A76A 5C3EB 4G4KA 4BBSH 5EKIA 2EYFA 3A54A 2F03A 1VQ7A 1SJED 2WKDA 4K14A 1IKLA 3OTOQ 4LF5Q 4KKUA 2UXCL 1LTRD 3T51B 4YY3Q 3TSSA 1EIGA 3H0GG 1X3GA 5E3FA 1BO0A 3TN2A 2MGSA 4JV5Q 3D8GA 3J81i 2JA7G 2KBNA 1EEID 2J4XA 3QG1A 4GKKL 1K8AC 3OOCA 4F8MA 1UAPA 1VQ4A 2K04A 4X65Q 4DNTB 1EY8A 1IBLQ 1HZBA 4FYDA 2R3ZA 5DM73 3U9OA 3KDFB 1LTLA 4YCVA 4IOAA 5C0XJ 2KCCA 2PNRC 2MP1A 1X65A 5ELBA 2JK8A 5JEAJ 3U4VA 5C0XI 3O13A 3S1QB 1TXYA 2AHOB 1DGSA 2AQ1B 4RHSA 4HIMA 1LTAD 1FL0A 2B2WA 2MPMA 4DR1L 2JA8H 3TMEA 2ICEC 5C6AA 2R93G 2NZOA 2EXZA 2L11A 4FXGC 3HOWG 2CQOA 1EL0A 3FHWA 3FPPA 3GP7A 1TWHH 4IUPA 4BY7H 2B3GA 2L0CA 4QMGA 1WCMB 2RDHA 4DR2Q 1Y8OB 4NP5A 1TWCB 4EVOA 3HOZG 3RLOA 3BDLA 1BBXC 3BVZA 1Y1VB 5JJKA 3BVGA 3X3NA 2KJXA 3HOVH 4PNYA 1EIFA 1MJCA 4DUYL 3GTMB 4V190 1DCZA 1VQCA 1BOSA 1FGUA 1X3QA 4YCWA 4H44C 3A7LA 4K5XA 1YNJD 3BZDB 4IOCA 1JB7A 1CA5A 1ENFA 3S24A 1XPRA 1QNKA 2J7ZA 2K03A 3U50C 5FJ8G 4C2MB 1HCZA 5K36H 4A3CH 1RDPD 1CKOA 3KJOA 3R93A 4X66L 1E3PA 2BH8A 2SEBD 3KLRA 5GAHC 2F0KA 1ML0D 4NXML 3CXCA 5GROA 3CCRA 5FO8B 1E2VA 3MZ5A 2AKWB 5EPLA 4L5QA 1HNZQ 2JA6G 2K50A 5E1FA 2ZJQA 4KK7A 4WORA 4A3JH 1C0AA 1Y14B 1VQ9A 1KHIA 2BE5C 4O2DA 3CRKC 1NJIC 3BDOA 1SE2A 2BDNA 2ASBA 1PFSA 2Z6KC 5HURA 3OSOA 1XPUA 1QG7A 1I4RA 3T56B 2CKZB 2E8GA 1BVSA 3K0YA 2JQOA 2I46A 4ID6A 4Y7NB 3WOEA 3H3VI 4A3KH 3HFZB 4LFCL 3S15B 3E6ZX 2JYOA 2FINB 5I6WA 1N36Q 5G3LD 1N34L 2O4XA 3PF5A 1CA6A 1XMOQ 4CKCA 3GTOB 1D1KA 4JG2A 3VYRA 4EGVA 2RSNA 3QOJA 3UDFA 2F0UA 4DR6L 4RH6A 2ZJRA 4HAEA 1Z6HA 4A3IB 4BWGB 4LF6Q 4DNIA 1YHAA 5KNCA 1A63A 2NVYH 3NTKA 3S1MB 1STNA 3SK8A 3HZXA 1KDAA 5M5XH 4X3KA 4DR7L 3HKSA 2B2YA 3W1BA 3K59A 3K5OA 4LF9Q 1SN8A 5T1IA 3KJPA 2EYJA 1WCMG 3J80L 1GHJA 4LUZA 1BDOA 4KHVA 1ILPA 1Y1VG 4LF8Q 5GAGC 1KQSA 1CTMA 3SK4A 1IBKL 1GUTA 5IOCA 3HG9A 1HZ9A 4QUFA 4DN4M 3ULPA 1EUJA 1O80A 2NYZD 1SR3A 5FO7B 3H3VC 5C4XB 3D0FA 4UPAA 2WB1B 1A8VA 1TS4A 5M5WB 5A35A 1RHPA 3MTSA 2KCNA 4KI0A 4DR3L 1NMGA 4WJWA 1I50B 1WTQA 3PUXA 1XWEA 2NN6H 1XNRL 4DV6Q 1FNWA 2F0PA 2NZ1D 2Y0SE 2VXWA 5AJ3Q 3S1RB 3JAMc 3AB9A 2D5DA 1BKBA 2Q2TA 1DYQA 1O7LA 3CCSA 1J6QA 3PIP3 2F0HA 3TP8A 1PDQA 2D62A 2B2TA 4X3TA 5C0XG 1Q90A 5JOBA 1EWHA 1K3BC 2E2IH 2HDMA 1ZYRC 1LTGD 1G6ZA 1S5DD 3PGZA 3C3LA 4JI2Q 1K83H 2K5QA 5JJLA 1RTNA 2F0SA 5ISRA 3F2BA 2PQAA 5NUCA 4DR4L 1JWUD 2JN4A 2PI2A 1KRSA 2VUMH 3HOYH 4B3TQ 5H1SE 3D31A 3E0JA 3T1YQ 2A6HC 4XYQA 3FDTA 4AYBB 1V43A 2JEBI 2UUCL 4MIUA 1EZ6A 3QOLA 3BYYB 3SXHA 3J81E 3S2DH 2IHFA 4LF4L 4KHPL 1H9SA 4GNXB 4GNXC 5BR8L 2A8VA 2CQAA 4WJ3M 4YWMA 3GV6A 1I4HA 3I7FA 4JBMA 3LNNA 4OO1I 4B9XA 4S3SA 3HOUG 2ID0A 3PO3B 5M9OA 4A3IG 1IBML 1PYBA 2IW3A 3TP7A 1VQMA 4KLKA 4H13C 5COYA 1PFMA 1T9HA 1H9JA 2B63H 4R4QA 4JI0L 1EYDA 4HR7B 1E0BA 5CV7A 4L5RC 4LFBQ 1Y1WB 4HIDA 5JVG3 1JJ2A 4ZK9B 4DV1Q 3OYYA 4CDFC 2Q8IB 3NP8A 1BCPD 3I90A 1JOOA 2PZTA 1B3QA 4M1UB 1PLFA 1Y69U 1P16A 4KY5A 3C46A 3I4MB 2UUBQ 2VQFL 3TREA 3J81c 2D0OA 2L12A 1LTBD 1SYCA 2HQEA 3HKZB 3SVMA 4DR5L 3IAYA 2VW9A 1MJEA 1Q8KA 1B3AA 2B29A 3NHHA 2C35B 3RUZA 3MXNA 2WB1G 2UXBQ 4A3GH 4G7ZC 3A5ZB 3FKIH 4KN4C 2K4KA 5EPJA 4EQOA 2R7ZH 2IX1A 1ZKOA 3T1HQ 3GTKH 2HHHL 1HQMC 1EQQA 1STGA 1G6PA 1X3PA 2Z1CA 4AYBE 1X3FA 4MN3A 2CFMA 4C3JB 1BF4A 4KY7A 4GKJL 3WOFA 4CDEC 1G91A 4HN7A 1V1PA 1AW7A 1Z47A 1VS0A 4IFDJ 4Y52H 1WTVA 4IFDI 1N33L 1CZWA 1YNJC 2K28A 5IIFA 4WRDA 3NE5B 1SNDA 2FXQA 2I5HA 4J8QA 3NBIA 1MSHA 4JVZA 3F2CA 2QA4A 2A19A 2YU9H 1CKMA 2CCZA 2VNUD 3NEMA 4U68A 4LAAA 2CH4W 3P75A 1U4PA 4KV6A 4RWSC 1KNAA 3P20A 1EY7A 1FGBD 3UDGA 4PV1C 1HUMA 3CCQA 3R2TA 3OWEB 1HRJA 5M5YB 4OX9L 5BN5A 5J3BA 1WD1A 1MIUA 2E2HB 2Z4HA 5C44B 4A3EG 3SE0A 1G8ZD 3DMUA 1Q86C 1MGSA 3C1FA 1R9TH 1I3QB 4JI4Q 2F0VA 1K9MC 2Z4IA 4DUZQ 1SNPA 1F9QA 4OL7A 1M4VA 3DHQA 3G6JB 1YJ9A 4JYAL 1PH2A 1CI3M 3HKZE 4EQNA 5FO9B 3PO3G 2VZAA 2E2JB 4B3ML 3CQZH 4B3SL 1PH3A 1VQLA 3M3YH 4F87A 2KHSA 4LUOA 5CBAE 1J9OA 1KC8C 1OTCA 1VMPA 4NXNQ 3CU7A 1CKNB 4F7XA 1YJWA 1PXUA 2L15A 3H0GH 1SYFA 1XXGA 5I4DA 1SSOA 4HIOA 4UP7A 1C9OA 3GTLB 2WFWA 2JA7H 3K7AB 5E4WC 1JC7A 1JORA 1N32L 3BYTB 1UUPA 1S5CD 3F8TA 4ZLTF 1I94Q 2L55A 1EYCA 2K5DA 1D5XC 3KDFA 1SEBD 3OIQA 3GTQH 3G48A 3NK9A 4X62Q 1HR0Q 3I4MG 1VQKA 2R7DA 3C2PA 1TVXA 3PMFA 1KXLA 2JE6I 3J7AF 2ZTEA 4CHTB 4HEDA 4RGNA 5EBDA 3SHLA 2F0IA 1STHA 2KCMA 4YCUA 1VQ6A 5DM63 1H95A 1XMQQ 1ESRA 4PZ8A 2PO4A 3OWFA 5HGQA 2UXDQ 2A73B 1PRTD 2QDLA 2R93H 3HOWH 4HTHA 3PF4A 1HA6A 1SYBA 4KD4A 3NBHB 2IWHA 3M4PA 1EOTA 3HOZH 4C3JG 2D2CC 4NKLA 1S3OA 1YVCA 4FF1A 2UU9Q 1FJGQ 2M9VA 1TWFB 4U673 4F88A 2K6AA 1NNXA 2ALYB 1TS5A 3H91A 4PMCA 1PTOF 1D8LA 1VQOA 3MFGA 1BCPF
chains in the Genus database with same CATH topology
3HOVH 1VQPA 4L5TA 3I55A 4DPGA 2E5LL 1AE3A 1EIFA 1MJCA 2I5MX 4DUYL 1FVIA 2WAQE 4DV5L 3J80i 1XNQQ 5LMNQ 3CP0A 1VQCA 3KF8B 3SGIA 3KOJA 3HOXH 1NMFA 1SROA 4J15A 4TVAB 3TQYA 3HOVG 4DV1L 1FGUA 5M5YH 1TWGH 4GN4B 4YCWA 4LF9L 5FJ8H 1UE1A 4JYAQ 1OXXK 3BZKA 5ELNA 3HOXG 1Q7YC 4IOCA 1JB7A 2ES2A 3CPFA 5C44H 2OTJA 1VQHA 5BR8Q 2UUBL 3S24A 4EX5A 5IYBH 1XPRA 2DUDA 5FLMH 1WJJA 2I0QA 4HJAA 3AQQA 4LUVA 3U50C 5FJ8G 4JI7L 3CCUA 2N49A 1X3EA 2HIXA 4JC0A 4A3CH 1CKOA 4KHZA 3KJOA 4X66L 5C44G 1IBMQ 4LF8L 1E3PA 4JI3Q 2BH8A 1SE8A 2JA6H 5IYBG 5FLMG 3KFUA 1E24A 2PNHA 3W1GA 3CCLA 5GAHC 4NXML 1L1OA 1NTGA 5IP7H 2UXBL 3CXCA 5K36G 2Z6KA 4P73A 5GROA 4AYBG 3CCRA 4A3CG 2IY5B 1U0LA 2UXCQ 2AKWB 3ERSX 4L5QA 1HNZQ 2E2JH 2JA6G 5FLXc 1Q81C 2K50A 4A93H 2UUAL 3UE1A 2ZJQA 2YYZA 2OWOA 4A3JH 5IP7G 1C0AA 3T1HL 1KIXA 3NENA 1Y14B 1VQ9A 1KHIA 4O2DA 3MEFA 2ATWA 4IPHA 3GO5A 1L1OB 1E22A 1YBYA 2WAQG 1LYLA 1L1OC 4R4OA 1NJIC 2R92H 3RR5A 3WWVA 3GTJH 4IPCA 2ASBA 1PFSA 2Z6KC 4A3JG 1YNXA 4JCVE 4GKKQ 2NVXH 3M4QA 1XPUA 2XGTA 1UE7A 2YTYA 2CKZB 4XTCS 3W5OA 2E8GA 3S14H 2R92G 1BVSA 3B6YA 1B7YB 1N9WA 4X64L 1XTDA 5AJ3L 2JQOA 4HIKA 4H02A 4JI1Q 4JI5L 2YV5A 3H3VI 5JJIA 4A3KH 3HFZB 4LFCL 2IT1A 1UE5A 1PHJA 2VUMG 1QVCA 1Y1WH 4DAMA 1Z9FA 1VQIA 3AYHB 4PMWA 4R4TA 3PSIA 1HNXQ 4DR5Q 1EIYB 2EXDA 1N36Q 1SLJA 3STBC 4A3KG 4BXXH 5IWAL 1N34L 3PF5A 1Y1WG 4DR1Q 1XMOQ 4OWWB 1XJVA 1LUZA 3GD7A 5IP9G 2RHSB 4YHHQ 3PO2H 4JG2A 3PIPA 4DV2L 2WP8J 4YWKA 2RHQB 4BXXG 3BU2A 3UDFA 4JBJA 4DR6L 3RNUA 2ZJRA 1YI2A 1A0IA 2WB1E 3S1QH 3PO2G 4LF6Q 4GKJQ 4ALPA 2QGQA 4DNIA 1YHAA 1A63A 3M7NA 2NVYH 4R1JA 1V9PA 3HKZG 1PH6A 4JI4L 1N33Q 2KHJA 4DUZL 3S2HH 4DV3Q 1JJCB 4DV0L 4DV5Q 3G6EA 4GOPA 2NVQH 1TWAH 1GVPA 5GQOA 1SFOH 5M5XH 1WCMH 1SMXA 4DR7L 3HKSA 3RLNA 3W1BA 4O0AA 2RCNA 1OXVA 3BZCA 3S17H 3CCVA 5IT9c 4A75A 4LF9Q 1SN8A 5GAEC 1Y1VH 3KJPA 3I4OA 3H15A 5EAYA 1PA6A 4XIGS 1GM5A 1WCMG 4GS3A 4JI8Q 4AQYL 3CMEA 4NXNL 1PVOA 4LUZA 4GOPC 4UP8A 4UP9A 2AMCB 4DV7Q 3GTMH 1Y1VG 3DM3A 4LF8Q 4OO1G 4X66Q 5GAGC 1J5EQ 1KQSA 4OX9Q 1I5FA 4LF5L 3ER0A 3L2PA 3I56A 1IBKL 4A3DH 2HIVA 1X54A 3AEVA 1HZ9A 2F4VL 3ULPA 1EUJA 2R6GA 3RLFA 1U5KA 4BA2I 1SR3A 1I94L 1QVGA 4JI6L 2K5NA 3E9IA 3CPWA 2KENA 4PG3A 1QUQA 3D0FA 2K75A 4UPAA 4PZ7A 4HJ8A 3GTGH 4HJ5A 3KF6A 2ZJPA 4A3DG 1X56A 1VQFA 2DGYA 2K5HA 4DAYB 4IJHA 1A8VA 3KLWA 4X62L 4QJFA 2VQEQ 1HR0L 2CWPA 2Z0SA 2LSSA 4KI0A 4DR3L 4A3MH 1NMGA 2E2HH 2EIFA 1NE3A 3L0OA 4X65L 4HJ7A 4P75A 1ASYA 3I4NH 2R7ZG 3K8AA 3PUXA 4MNOA 1IBLL 4IPGA 1XNRL 2YTVA 4DV6Q 1QUQB 4FDBA 2ZM6L 3DLLA 3KF6B 4OWXB 4B3SQ 4GLVB 2Y0SE 5M3FG 1YJNA 5M3MG 4X64Q 5AJ3Q 1I3QH 4A3MG 1O7IA 1EQRA 3M9BA 3I4NG 2UXDL 3JAMc 3PIOA 1B70B 2NN6G 1BKBA 2Q2TA 3CCSA 2K52A 4TQUS 1K8GA 2JJQA 1J6QA 4R4CA 3TEHB 1YITA 1OXTA 4K0KL 3GTPH 2D62A 4DK3C 5IYCH 5C0XG 3CC2A 2K14A 3F1ZA 3KYHC 4LFAL 4YWLA 2E2IH 2HQLA 1I6HH 3PUVA 1N32Q 2JA5G 2NVTH 2OTLA 5IYCG 5C3EH 1FJGL 3PGZA 1EYGA 4JI2Q 1QVFA 3S15H 3EN2A 1K83H 4DKAC 5LMUQ 5JJLA 1EOVA 1RL2A 1X55A 1VQAA 2XTIA 2PQAA 3F2BA 1S40A 4DR4L 2PI2A 1YHBA 1YHQA 1PV4A 1CUKA 1KRSA 5C3EG 2VUMH 2LXJA 2V1CC 2MFIA 1S72A 3GTLH 1K3RA 4GNXA 3K7AH 1M90C 4P72A 4B3TQ 4BY1H 3HOYH 5H1SE 3U4ZA 3UDIA 3D31A 3U58A 1Q12A 1XNQL 5LMNL 2AWNA 3T1YQ 2YTXA 3GTOH 1V43A 4LWCA 2JEBI 3J81j 2UUCL 1X6OA 3E0EA 1PH1A 4IFDG 2PQAB 4AIMA 3HOYG 4LFBL 1IYJB 4MZ9A 4BY1G 3PUWA 1PH5A 1IXRA 3K0XA 3S2DH 2IHFA 4LF4L 1VQNA 5IP9H 1ASZA 4KHPL 3HOUH 1YEZA 4GNXB 2MO0A 4GNXC 4JBWA 5BR8L 2A8VA 1QZGA 4WJ3M 3E9HA 4YWMA 2Q2UA 3PUYA 1WI5A 2ZTDA 3CD6A 3I7FA 5HY6A 4JBMA 1BBUA 1HZCA 3CCEA 4A3FH 4OO1I 2OQ0A 4RMFA 4UY8C 1X9NA 3HOUG 1WYDA 2ID0A 4P71A 4A3IG 1IBML 4JI3L 1PYBA 3NELA 4LW1A 4APVA 3STBD 3TS0A 1KL9A 3L7ZC 3ZJYC 1VQMA 4A3FG 4KLKA 3CW2C 1T9HA 1VQ5A 2B63H 1HNWQ 4R4QA 1HNZL 4JI0L 1Q46A 2JA9A 3A0JA 1AE2A 2AWOA 3PUZA 1KAWA 1LM0A 1YZ6A 2E5LQ 1CSPA 3J7A5 3K7UC 2QEXA 2KCTA 1W3SA 2K5VA 4DUYQ 4DV4L 4B3MQ 2F52A 4JI6Q 4L5RC 1OXUA 2B63G 4LFBQ 2IX0A 1K73C 4HIDA 1JJ2A 1G291 4IPDA 1N8RC 1IL2A 1TWFH 3OYYA 1BBWA 4DV1Q 1Q82C 4JBKA 1GD7A 4B3RL 1TWCH 3JC66 4QL5A 1XPOA 4POGA 4X6AH 1YIJA 4POFA 1WOCA 2EQSA 4HJ9A 2VY3A 3AFQA 2MO1A 4DR3Q 3S1NH 1P16A 5IE8A 2NN6I 2UUBQ 1L0WA 4JI1L 4GOPB 2VQFL 3VDYA 3TREA 1XNRQ 3J81c 4JI7Q 4WJ4A 4LF7Q 2NZHA 3J7ZC 2D0OA 2LXKA 1VQGA 4A4IA 2D0PA 1OXSC 3CMAA 3G4SA 2ZTCA 1HNXL 3OTOL 4DR5L 1WFQA 5DLQE 1N36L 1G51A 2VW9A 1PH7A 1MJEA 1Q8KA 2VL6A 5IY0A 4YY3L 2B29A 2N78A 2C35B 4NXMQ 2WB1G 1XMOL 4GLXA 2UXBQ 4QIWE 3CAMA 4A3GH 5GADC 3G71A 4JV5L 2MQHA 3A5ZB 3FKIH 2K4KA 2UUAQ 4C2MH 4OWTB 2R7ZH 2Q2HA 2IX1A 3T1HQ 3GTKH 2HHHL 3S1RH 1EQQA 3JAMi 1KD1C 1A62A 4IJLA 4AYBE 3A5UA 1X3FA 1C7YA 2CFMA 4A3GG 1G6PA 2N3SA 3FKIG 1P8LA 5M3MH 5M3FH 3CCMA 3MXNB 4GKJL 1AH9A 4BBRH 2OCEA 2PI2E 3ULJA 1HZAA 1Z47A 1VS0A 3CCJA 4IFDJ 4Y52H 4IFDI 1XMQL 3ULLA 1N33L 3EIVA 4DV3L 2FXQA 2I5HA 4BBRG 3F2CA 2QA4A 1D7QA 1UEBA 2A19A 4JI5Q 4IO9A 4LFCQ 2YU9H 1CKMA 2CCZA 2UUCQ 2VNUD 3NEMA 2A1AA 2JA5H 4A3LH 3RZOH 1JE5A 4R4IA 1Q1BA 2PMZE 4LF4Q 4KHPQ 2VS1A 2HT1A 5JEAG 1JJGA 4GLAC 5IWAQ 4JOIA 1N34Q 1EFWA 3PV0A 4JI8L 3UDGA 1JMCA 4ME3A 3J80c 1VQEA 2N8NA 3CCQA 4A3LG 4DV7L 4MTNA 1IZ6A 1E1TA 4Y7NH 2UU9L 3A74A 2BA0A 5C4JH 4A3EH 1K0RA 1SRUA 4DV2Q 4DR2L 4PZ6A 1Q1EA 3GDEA 4P74A 1J5EL 1HR0W 4OX9L 4LF7L 4DR6Q 1PH4A 5J3BA 1MIUA 1E1OA 4A93G 3Q8DA 1M1KC 4A3BH 4JOIC 4A3EG 2H5XA 2I5LX 3IRBA 1Q86C 1B8AA 1L2FA 2IHEA 4JI0Q 5E7NA 1R9TH 1UE6A 2GN5A 3TRZA 4JI4Q 1K9MC 5IYDH 1GO3E 1RIPA 4DUZQ 4DV4Q 4A3BG 3PO3H 1W2BA 4DV0Q 2R7FA 2Y0SG 2VQEL 4GN5A 1CKNA 1YJ9A 4C3IH 1QZHA 4JYAL 1PH2A 1CSQA 3PCOB 4DR7Q 1NY4A 1HJPA 4BA1I 4B3RQ 4A3IH 4C3HH 5IYDG 4NPSA 3HKZE 3ICEA 4QY7A 2CWAA 3PO3G 2VZAA 4RG1A 4DV6L 1VQBA 4B3ML 2KHIA 3CQZH 4B3SL 1PH3A 1VQLA 4QQBX 3CF5A 3M3YH 1PYSB 4LUOA 3S1MH 4AQYQ 4A76A 1KC8C 1OTCA 4NXNQ 4BBSH 2VQFQ 1CKNB 4GN3B 1YJWA 1VQDA 2OQKA 2Q2IA 2L15A 1JT8A 3H0GH 3I2ZA 1VQ7A 1VQJA 3K80C 4HIOA 4UP7A 1C9OA 4OONA 1E7ZA 3OTOQ 4LF5Q 1IBKQ 4BBSG 2UXCL 2WFWA 4AH6A 2JA7H 3LGJA 4YY3Q 3H0GG 5LMNW 2F4VQ 1N32L 3M85A 1X3GA 5ELOA 3UE0A 1PH9A 3F8TA 3I4MH 1I94Q 4JV5Q 1VQ8A 3J81i 4JI2L 2JA7G 3KDFA 5LMUL 3OW2A 3UDXA 1VCIA 2KBNA 2GVBA 2HHHQ 3GTQH 4GKKL 3G48A 2GVAA 4X62Q 1K8AC 4LNQA 1MKHA 1HR0Q 2JEAI 3I4MG 1VQKA 2R7DA 2BH2A 1VQ4A 3CC4A 3FP9A 3AFPA 1UWVA 3RZDH 4B3TL 2JE6I 1KXLA 3S16H 2ZTEA 1KRTA 4X65Q 3F2DA 2KCMA 4YCUA 1HZBA 3T1YL 1IBLQ 1VQ6A 1H95A 3H3VH 1XMQQ 3KDFB 2ZM6Q 1LTLA 4YCVA 4QGUA 4PZ8A 4IOAA 5C4XH 5C0XJ 3TS2A 4NB3A 1X65A 3BJUA 2JK8A 5JEAJ 3U4VA 5C0XI 5HGQA 2UXDQ 2BA1A 1GKHA 4OXPA 3M4OH 1TXYA 2AHOB 1EWIA 5M5WH 1DGSA 2R93H 4EQ5A 4C3JH 4L5SA 3HOWH 2RF4A 3K81C 4HIMA 4K0KQ 1FL0A 4DR1L 3PF4A 5C4XG 1HH2P 1I50H 3NBHB 2JA8H 4DK6C 3M4PA 4YHHL 4LFAQ 2R93G 2NZOA 3HOZH 3HOWG 1V1QA 2CQOA 3RN5A 3FHWA 1NBWA 1S3OA 3CC7A 2MNAA 1TWHH 1YVCA 4BY7H 2B3GA 2UU9Q 1FJGQ 2JA8G 4DR2Q 3RN2A 1PH8A 4LF6L 2ALYB 3EBEA 3HOZG 3RLOA 2F3IA 1D8LA 4DR4Q 1HNWL 1VQOA 5JJKA 4BY7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV H;  1VQP A;  4L5T A;  3I55 A;  4DPG A;  2E5L L;  1AE3 A;  1EIF A;  1MJC A;  2I5M X;  4DUY L;  1FVI A;  2WAQ E;  4DV5 L;  3J80 i;  1XNQ Q;  5LMN Q;  3CP0 A;  1VQC A;  3KF8 B;  3SGI A;  3KOJ A;  3HOX H;  1NMF A;  1SRO A;  4J15 A;  4TVA B;  3TQY A;  3HOV G;  4DV1 L;  1FGU A;  5M5Y H;  1TWG H;  4GN4 B;  4YCW A;  4LF9 L;  5FJ8 H;  1UE1 A;  4JYA Q;  1OXX K;  3BZK A;  5ELN A;  3HOX G;  1Q7Y C;  4IOC A;  1JB7 A;  2ES2 A;  3CPF A;  5C44 H;  2OTJ A;  1VQH A;  5BR8 Q;  2UUB L;  3S24 A;  4EX5 A;  5IYB H;  1XPR A;  2DUD A;  5FLM H;  1WJJ A;  2I0Q A;  4HJA A;  3AQQ A;  4LUV A;  3U50 C;  5FJ8 G;  4JI7 L;  3CCU A;  2N49 A;  1X3E A;  2HIX A;  4JC0 A;  4A3C H;  1CKO A;  4KHZ A;  3KJO A;  4X66 L;  5C44 G;  1IBM Q;  4LF8 L;  1E3P A;  4JI3 Q;  2BH8 A;  1SE8 A;  2JA6 H;  5IYB G;  5FLM G;  3KFU A;  1E24 A;  2PNH A;  3W1G A;  3CCL A;  5GAH C;  4NXM L;  1L1O A;  1NTG A;  5IP7 H;  2UXB L;  3CXC A;  5K36 G;  2Z6K A;  4P73 A;  5GRO A;  4AYB G;  3CCR A;  4A3C G;  2IY5 B;  1U0L A;  2UXC Q;  2AKW B;  3ERS X;  4L5Q A;  1HNZ Q;  2E2J H;  2JA6 G;  5FLX c;  1Q81 C;  2K50 A;  4A93 H;  2UUA L;  3UE1 A;  2ZJQ A;  2YYZ A;  2OWO A;  4A3J H;  5IP7 G;  1C0A A;  3T1H L;  1KIX A;  3NEN A;  1Y14 B;  1VQ9 A;  1KHI A;  4O2D A;  3MEF A;  2ATW A;  4IPH A;  3GO5 A;  1L1O B;  1E22 A;  1YBY A;  2WAQ G;  1LYL A;  1L1O C;  4R4O A;  1NJI C;  2R92 H;  3RR5 A;  3WWV A;  3GTJ H;  4IPC A;  2ASB A;  1PFS A;  2Z6K C;  4A3J G;  1YNX A;  4JCV E;  4GKK Q;  2NVX H;  3M4Q A;  1XPU A;  2XGT A;  1UE7 A;  2YTY A;  2CKZ B;  4XTC S;  3W5O A;  2E8G A;  3S14 H;  2R92 G;  1BVS A;  3B6Y A;  1B7Y B;  1N9W A;  4X64 L;  1XTD A;  5AJ3 L;  2JQO A;  4HIK A;  4H02 A;  4JI1 Q;  4JI5 L;  2YV5 A;  3H3V I;  5JJI A;  4A3K H;  3HFZ B;  4LFC L;  2IT1 A;  1UE5 A;  1PHJ A;  2VUM G;  1QVC A;  1Y1W H;  4DAM A;  1Z9F A;  1VQI A;  3AYH B;  4PMW A;  4R4T A;  3PSI A;  1HNX Q;  4DR5 Q;  1EIY B;  2EXD A;  1N36 Q;  1SLJ A;  3STB C;  4A3K G;  4BXX H;  5IWA L;  1N34 L;  3PF5 A;  1Y1W G;  4DR1 Q;  1XMO Q;  4OWW B;  1XJV A;  1LUZ A;  3GD7 A;  5IP9 G;  2RHS B;  4YHH Q;  3PO2 H;  4JG2 A;  3PIP A;  4DV2 L;  2WP8 J;  4YWK A;  2RHQ B;  4BXX G;  3BU2 A;  3UDF A;  4JBJ A;  4DR6 L;  3RNU A;  2ZJR A;  1YI2 A;  1A0I A;  2WB1 E;  3S1Q H;  3PO2 G;  4LF6 Q;  4GKJ Q;  4ALP A;  2QGQ A;  4DNI A;  1YHA A;  1A63 A;  3M7N A;  2NVY H;  4R1J A;  1V9P A;  3HKZ G;  1PH6 A;  4JI4 L;  1N33 Q;  2KHJ A;  4DUZ L;  3S2H H;  4DV3 Q;  1JJC B;  4DV0 L;  4DV5 Q;  3G6E A;  4GOP A;  2NVQ H;  1TWA H;  1GVP A;  5GQO A;  1SFO H;  5M5X H;  1WCM H;  1SMX A;  4DR7 L;  3HKS A;  3RLN A;  3W1B A;  4O0A A;  2RCN A;  1OXV A;  3BZC A;  3S17 H;  3CCV A;  5IT9 c;  4A75 A;  4LF9 Q;  1SN8 A;  5GAE C;  1Y1V H;  3KJP A;  3I4O A;  3H15 A;  5EAY A;  1PA6 A;  4XIG S;  1GM5 A;  1WCM G;  4GS3 A;  4JI8 Q;  4AQY L;  3CME A;  4NXN L;  1PVO A;  4LUZ A;  4GOP C;  4UP8 A;  4UP9 A;  2AMC B;  4DV7 Q;  3GTM H;  1Y1V G;  3DM3 A;  4LF8 Q;  4OO1 G;  4X66 Q;  5GAG C;  1J5E Q;  1KQS A;  4OX9 Q;  1I5F A;  4LF5 L;  3ER0 A;  3L2P A;  3I56 A;  1IBK L;  4A3D H;  2HIV A;  1X54 A;  3AEV A;  1HZ9 A;  2F4V L;  3ULP A;  1EUJ A;  2R6G A;  3RLF A;  1U5K A;  4BA2 I;  1SR3 A;  1I94 L;  1QVG A;  4JI6 L;  2K5N A;  3E9I A;  3CPW A;  2KEN A;  4PG3 A;  1QUQ A;  3D0F A;  2K75 A;  4UPA A;  4PZ7 A;  4HJ8 A;  3GTG H;  4HJ5 A;  3KF6 A;  2ZJP A;  4A3D G;  1X56 A;  1VQF A;  2DGY A;  2K5H A;  4DAY B;  4IJH A;  1A8V A;  3KLW A;  4X62 L;  4QJF A;  2VQE Q;  1HR0 L;  2CWP A;  2Z0S A;  2LSS A;  4KI0 A;  4DR3 L;  4A3M H;  1NMG A;  2E2H H;  2EIF A;  1NE3 A;  3L0O A;  4X65 L;  4HJ7 A;  4P75 A;  1ASY A;  3I4N H;  2R7Z G;  3K8A A;  3PUX A;  4MNO A;  1IBL L;  4IPG A;  1XNR L;  2YTV A;  4DV6 Q;  1QUQ B;  4FDB A;  2ZM6 L;  3DLL A;  3KF6 B;  4OWX B;  4B3S Q;  4GLV B;  2Y0S E;  5M3F G;  1YJN A;  5M3M G;  4X64 Q;  5AJ3 Q;  1I3Q H;  4A3M G;  1O7I A;  1EQR A;  3M9B A;  3I4N G;  2UXD L;  3JAM c;  3PIO A;  1B70 B;  2NN6 G;  1BKB A;  2Q2T A;  3CCS A;  2K52 A;  4TQU S;  1K8G A;  2JJQ A;  1J6Q A;  4R4C A;  3TEH B;  1YIT A;  1OXT A;  4K0K L;  3GTP H;  2D62 A;  4DK3 C;  5IYC H;  5C0X G;  3CC2 A;  2K14 A;  3F1Z A;  3KYH C;  4LFA L;  4YWL A;  2E2I H;  2HQL A;  1I6H H;  3PUV A;  1N32 Q;  2JA5 G;  2NVT H;  2OTL A;  5IYC G;  5C3E H;  1FJG L;  3PGZ A;  1EYG A;  4JI2 Q;  1QVF A;  3S15 H;  3EN2 A;  1K83 H;  4DKA C;  5LMU Q;  5JJL A;  1EOV A;  1RL2 A;  1X55 A;  1VQA A;  2XTI A;  2PQA A;  3F2B A;  1S40 A;  4DR4 L;  2PI2 A;  1YHB A;  1YHQ A;  1PV4 A;  1CUK A;  1KRS A;  5C3E G;  2VUM H;  2LXJ A;  2V1C C;  2MFI A;  1S72 A;  3GTL H;  1K3R A;  4GNX A;  3K7A H;  1M90 C;  4P72 A;  4B3T Q;  4BY1 H;  3HOY H;  5H1S E;  3U4Z A;  3UDI A;  3D31 A;  3U58 A;  1Q12 A;  1XNQ L;  5LMN L;  2AWN A;  3T1Y Q;  2YTX A;  3GTO H;  1V43 A;  4LWC A;  2JEB I;  3J81 j;  2UUC L;  1X6O A;  3E0E A;  1PH1 A;  4IFD G;  2PQA B;  4AIM A;  3HOY G;  4LFB L;  1IYJ B;  4MZ9 A;  4BY1 G;  3PUW A;  1PH5 A;  1IXR A;  3K0X A;  3S2D H;  2IHF A;  4LF4 L;  1VQN A;  5IP9 H;  1ASZ A;  4KHP L;  3HOU H;  1YEZ A;  4GNX B;  2MO0 A;  4GNX C;  4JBW A;  5BR8 L;  2A8V A;  1QZG A;  4WJ3 M;  3E9H A;  4YWM A;  2Q2U A;  3PUY A;  1WI5 A;  2ZTD A;  3CD6 A;  3I7F A;  5HY6 A;  4JBM A;  1BBU A;  1HZC A;  3CCE A;  4A3F H;  4OO1 I;  2OQ0 A;  4RMF A;  4UY8 C;  1X9N A;  3HOU G;  1WYD A;  2ID0 A;  4P71 A;  4A3I G;  1IBM L;  4JI3 L;  1PYB A;  3NEL A;  4LW1 A;  4APV A;  3STB D;  3TS0 A;  1KL9 A;  3L7Z C;  3ZJY C;  1VQM A;  4A3F G;  4KLK A;  3CW2 C;  1T9H A;  1VQ5 A;  2B63 H;  1HNW Q;  4R4Q A;  1HNZ L;  4JI0 L;  1Q46 A;  2JA9 A;  3A0J A;  1AE2 A;  2AWO A;  3PUZ A;  1KAW A;  1LM0 A;  1YZ6 A;  2E5L Q;  1CSP A;  3J7A 5;  3K7U C;  2QEX A;  2KCT A;  1W3S A;  2K5V A;  4DUY Q;  4DV4 L;  4B3M Q;  2F52 A;  4JI6 Q;  4L5R C;  1OXU A;  2B63 G;  4LFB Q;  2IX0 A;  1K73 C;  4HID A;  1JJ2 A;  1G29 1;  4IPD A;  1N8R C;  1IL2 A;  1TWF H;  3OYY A;  1BBW A;  4DV1 Q;  1Q82 C;  4JBK A;  1GD7 A;  4B3R L;  1TWC H;  3JC6 6;  4QL5 A;  1XPO A;  4POG A;  4X6A H;  1YIJ A;  4POF A;  1WOC A;  2EQS A;  4HJ9 A;  2VY3 A;  3AFQ A;  2MO1 A;  4DR3 Q;  3S1N H;  1P16 A;  5IE8 A;  2NN6 I;  2UUB Q;  1L0W A;  4JI1 L;  4GOP B;  2VQF L;  3VDY A;  3TRE A;  1XNR Q;  3J81 c;  4JI7 Q;  4WJ4 A;  4LF7 Q;  2NZH A;  3J7Z C;  2D0O A;  2LXK A;  1VQG A;  4A4I A;  2D0P A;  1OXS C;  3CMA A;  3G4S A;  2ZTC A;  1HNX L;  3OTO L;  4DR5 L;  1WFQ A;  5DLQ E;  1N36 L;  1G51 A;  2VW9 A;  1PH7 A;  1MJE A;  1Q8K A;  2VL6 A;  5IY0 A;  4YY3 L;  2B29 A;  2N78 A;  2C35 B;  4NXM Q;  2WB1 G;  1XMO L;  4GLX A;  2UXB Q;  4QIW E;  3CAM A;  4A3G H;  5GAD C;  3G71 A;  4JV5 L;  2MQH A;  3A5Z B;  3FKI H;  2K4K A;  2UUA Q;  4C2M H;  4OWT B;  2R7Z H;  2Q2H A;  2IX1 A;  3T1H Q;  3GTK H;  2HHH L;  3S1R H;  1EQQ A;  3JAM i;  1KD1 C;  1A62 A;  4IJL A;  4AYB E;  3A5U A;  1X3F A;  1C7Y A;  2CFM A;  4A3G G;  1G6P A;  2N3S A;  3FKI G;  1P8L A;  5M3M H;  5M3F H;  3CCM A;  3MXN B;  4GKJ L;  1AH9 A;  4BBR H;  2OCE A;  2PI2 E;  3ULJ A;  1HZA A;  1Z47 A;  1VS0 A;  3CCJ A;  4IFD J;  4Y52 H;  4IFD I;  1XMQ L;  3ULL A;  1N33 L;  3EIV A;  4DV3 L;  2FXQ A;  2I5H A;  4BBR G;  3F2C A;  2QA4 A;  1D7Q A;  1UEB A;  2A19 A;  4JI5 Q;  4IO9 A;  4LFC Q;  2YU9 H;  1CKM A;  2CCZ A;  2UUC Q;  2VNU D;  3NEM A;  2A1A A;  2JA5 H;  4A3L H;  3RZO H;  1JE5 A;  4R4I A;  1Q1B A;  2PMZ E;  4LF4 Q;  4KHP Q;  2VS1 A;  2HT1 A;  5JEA G;  1JJG A;  4GLA C;  5IWA Q;  4JOI A;  1N34 Q;  1EFW A;  3PV0 A;  4JI8 L;  3UDG A;  1JMC A;  4ME3 A;  3J80 c;  1VQE A;  2N8N A;  3CCQ A;  4A3L G;  4DV7 L;  4MTN A;  1IZ6 A;  1E1T A;  4Y7N H;  2UU9 L;  3A74 A;  2BA0 A;  5C4J H;  4A3E H;  1K0R A;  1SRU A;  4DV2 Q;  4DR2 L;  4PZ6 A;  1Q1E A;  3GDE A;  4P74 A;  1J5E L;  1HR0 W;  4OX9 L;  4LF7 L;  4DR6 Q;  1PH4 A;  5J3B A;  1MIU A;  1E1O A;  4A93 G;  3Q8D A;  1M1K C;  4A3B H;  4JOI C;  4A3E G;  2H5X A;  2I5L X;  3IRB A;  1Q86 C;  1B8A A;  1L2F A;  2IHE A;  4JI0 Q;  5E7N A;  1R9T H;  1UE6 A;  2GN5 A;  3TRZ A;  4JI4 Q;  1K9M C;  5IYD H;  1GO3 E;  1RIP A;  4DUZ Q;  4DV4 Q;  4A3B G;  3PO3 H;  1W2B A;  4DV0 Q;  2R7F A;  2Y0S G;  2VQE L;  4GN5 A;  1CKN A;  1YJ9 A;  4C3I H;  1QZH A;  4JYA L;  1PH2 A;  1CSQ A;  3PCO B;  4DR7 Q;  1NY4 A;  1HJP A;  4BA1 I;  4B3R Q;  4A3I H;  4C3H H;  5IYD G;  4NPS A;  3HKZ E;  3ICE A;  4QY7 A;  2CWA A;  3PO3 G;  2VZA A;  4RG1 A;  4DV6 L;  1VQB A;  4B3M L;  2KHI A;  3CQZ H;  4B3S L;  1PH3 A;  1VQL A;  4QQB X;  3CF5 A;  3M3Y H;  1PYS B;  4LUO A;  3S1M H;  4AQY Q;  4A76 A;  1KC8 C;  1OTC A;  4NXN Q;  4BBS H;  2VQF Q;  1CKN B;  4GN3 B;  1YJW A;  1VQD A;  2OQK A;  2Q2I A;  2L15 A;  1JT8 A;  3H0G H;  3I2Z A;  1VQ7 A;  1VQJ A;  3K80 C;  4HIO A;  4UP7 A;  1C9O A;  4OON A;  1E7Z A;  3OTO Q;  4LF5 Q;  1IBK Q;  4BBS G;  2UXC L;  2WFW A;  4AH6 A;  2JA7 H;  3LGJ A;  4YY3 Q;  3H0G G;  5LMN W;  2F4V Q;  1N32 L;  3M85 A;  1X3G A;  5ELO A;  3UE0 A;  1PH9 A;  3F8T A;  3I4M H;  1I94 Q;  4JV5 Q;  1VQ8 A;  3J81 i;  4JI2 L;  2JA7 G;  3KDF A;  5LMU L;  3OW2 A;  3UDX A;  1VCI A;  2KBN A;  2GVB A;  2HHH Q;  3GTQ H;  4GKK L;  3G48 A;  2GVA A;  4X62 Q;  1K8A C;  4LNQ A;  1MKH A;  1HR0 Q;  2JEA I;  3I4M G;  1VQK A;  2R7D A;  2BH2 A;  1VQ4 A;  3CC4 A;  3FP9 A;  3AFP A;  1UWV A;  3RZD H;  4B3T L;  2JE6 I;  1KXL A;  3S16 H;  2ZTE A;  1KRT A;  4X65 Q;  3F2D A;  2KCM A;  4YCU A;  1HZB A;  3T1Y L;  1IBL Q;  1VQ6 A;  1H95 A;  3H3V H;  1XMQ Q;  3KDF B;  2ZM6 Q;  1LTL A;  4YCV A;  4QGU A;  4PZ8 A;  4IOA A;  5C4X H;  5C0X J;  3TS2 A;  4NB3 A;  1X65 A;  3BJU A;  2JK8 A;  5JEA J;  3U4V A;  5C0X I;  5HGQ A;  2UXD Q;  2BA1 A;  1GKH A;  4OXP A;  3M4O H;  1TXY A;  2AHO B;  1EWI A;  5M5W H;  1DGS A;  2R93 H;  4EQ5 A;  4C3J H;  4L5S A;  3HOW H;  2RF4 A;  3K81 C;  4HIM A;  4K0K Q;  1FL0 A;  4DR1 L;  3PF4 A;  5C4X G;  1HH2 P;  1I50 H;  3NBH B;  2JA8 H;  4DK6 C;  3M4P A;  4YHH L;  4LFA Q;  2R93 G;  2NZO A;  3HOZ H;  3HOW G;  1V1Q A;  2CQO A;  3RN5 A;  3FHW A;  1NBW A;  1S3O A;  3CC7 A;  2MNA A;  1TWH H;  1YVC A;  4BY7 H;  2B3G A;  2UU9 Q;  1FJG Q;  2JA8 G;  4DR2 Q;  3RN2 A;  1PH8 A;  4LF6 L;  2ALY B;  3EBE A;  3HOZ G;  3RLO A;  2F3I A;  1D8L A;  4DR4 Q;  1HNW L;  1VQO A;  5JJK A;  4BY7 G; 
#chains in the Genus database with same CATH topology
 3LX0 A;  1VQP A;  3I55 A;  2E5L L;  3MFY A;  1CT1 D;  4K8J A;  4DV5 L;  3KOJ A;  1NMF A;  1SRO A;  1QOH A;  1TWG H;  5FJ8 H;  3VYU A;  2XWB B;  3IKJ A;  3MWY W;  1SJH D;  4CJ2 C;  2ES2 A;  5D14 A;  1JE4 A;  1YNN C;  4FF4 A;  4EX5 A;  1K8M A;  3DWP A;  3AQQ A;  4HJA A;  1F2M A;  1ET9 A;  2N49 A;  1X3E A;  1II3 A;  4IUV A;  1PYW D;  3HRZ C;  4RA8 A;  2ZXR A;  4K6D A;  5LL6 S;  5C44 G;  4JI3 Q;  2F0Q A;  4PQX A;  2DJG C;  1SBB B;  5IYB G;  2JA6 H;  1JOK A;  5TSS A;  1BQQ T;  4JPB W;  5FLM G;  5M3F B;  4A3M B;  3CCL A;  3M4Y A;  3I4N B;  3DUZ A;  2Z6K A;  1ZYR D;  4RAU C;  3C1E A;  2UXC Q;  3ERS X;  1Q81 C;  2IX3 A;  4KN7 C;  2OWO A;  5JAV A;  1KIX A;  3NEN A;  1KDC A;  1SE4 A;  3MEF A;  2ATW A;  4RGT A;  1E22 A;  4N9T A;  4R4O A;  2JA5 B;  3WWV A;  3GTJ H;  4IPC A;  4DNR B;  5C4H A;  4GKK Q;  1YNX A;  2X6L A;  4R8I A;  1ONL A;  2HD3 A;  1UE7 A;  1B7Y B;  1N9W A;  2NVT B;  3J81 L;  2WV6 D;  4H02 A;  4JI1 Q;  5JJI A;  2IT1 A;  5D65 A;  1NR2 A;  1B44 D;  3ND8 A;  4TSS A;  3PSI A;  2JSO A;  2EXD A;  4QF4 A;  5IWA L;  4BY1 B;  4DR1 Q;  1FNU A;  1EYA A;  2RHS B;  4BXX G;  4DV2 L;  5CGK A;  2RHQ B;  3BU2 A;  3RNU A;  4CJ0 B;  1RTO A;  1U4R A;  3S1Q H;  1BXT A;  1T5X D;  4C3H B;  4FVM A;  5HGT A;  1PTO B;  4ALP A;  1MD2 D;  1PTO C;  1D2B A;  1BCP B;  1BCP C;  4DF7 A;  4B9W A;  3NXW A;  1JJC B;  2CVR A;  4DV0 L;  1AFP A;  1C8C A;  1GVP A;  3ZYY X;  1SFO H;  1WCM H;  1RF2 D;  2RCN A;  3VR2 A;  4I65 A;  2RA4 A;  3CCV A;  1TR5 A;  3QR8 A;  5GAE C;  1Y1V H;  2OF1 A;  4P2C B;  2EYP A;  4AQY L;  3SK6 A;  3OHX C;  1PVO A;  1F9P A;  4GOP C;  2AMC B;  1D6E C;  4CGY B;  4DV7 Q;  3GTM H;  5JPM C;  3DM3 A;  1DXM A;  1TII D;  1RD9 D;  2BDO A;  4X66 Q;  1J5E Q;  3NSW A;  1LLR D;  3G7L A;  1DOL A;  3ER0 A;  4LF5 L;  2OT2 A;  1WD0 A;  2F3V A;  3S1N B;  4OHJ A;  3AEV A;  2HCC A;  3RLF A;  4BA2 I;  5EJW A;  1QVG A;  2K5N A;  4JI6 L;  2KEN A;  4PG3 A;  2XSC A;  2K75 A;  4HJ8 A;  4A3D G;  2JP1 A;  4HJ5 A;  1X56 A;  1VQF A;  1W6J A;  2K5H A;  4DAY B;  3KLW A;  2VQE Q;  1PMR A;  2LSS A;  2X69 A;  3N6R A;  5C5L A;  1PRT F;  4X65 L;  1A15 A;  4C1N I;  4MNO A;  1IBL L;  1QUQ B;  3I91 A;  3DLL A;  4WFN 3;  3KF6 B;  4LF7 L;  1YJN A;  5M3F G;  2B2V C;  4A3M G;  1TWH B;  3W2D A;  3NPP A;  1EQR A;  3M9B A;  3I4N G;  1B70 B;  2FHT A;  1ET6 A;  2K52 A;  3MC0 B;  4TQU S;  2JJQ A;  4R4C A;  3TEH B;  1YIT A;  1K8G A;  1D5Z C;  1VF7 A;  1S5E D;  4XXE A;  1O7Z A;  2K14 A;  3F1Z A;  3HOV B;  5CC4 A;  4YWL A;  1QNU A;  1E2Z A;  1STB A;  2CH4 A;  4MHE A;  1JQY D;  2JA5 G;  2OTL A;  1EYG A;  1QVF A;  4IUQ A;  3S15 H;  5LMU Q;  1EOV A;  2PYK A;  1X55 A;  1JWM D;  1VQA A;  2XTI A;  4OEL B;  2PPB C;  3RZO B;  3Q24 A;  4ZUJ A;  5EKK A;  1F77 A;  4ZKC B;  3VA7 A;  1CUK A;  5C3E G;  2V1C C;  2B8G A;  3ITP A;  5I9O A;  1K3R A;  4GNX A;  4P72 A;  2F0G A;  2FMM A;  1S4Z A;  3U4Z A;  3U58 A;  2AWN A;  5C4J B;  3GTO H;  2ZXP A;  2EZV A;  3H6M A;  3E0E A;  4TKO B;  4BY1 G;  3R8B A;  3VYS A;  3K0X A;  4ILW A;  3D4R A;  5IP9 H;  3HOU H;  1YEZ A;  2DY8 A;  4A3B B;  2RDG A;  1MHW C;  3E5S A;  2Y0S B;  1QZG A;  4NMZ A;  1U4L A;  1WI5 A;  1V1O A;  2A5H A;  5HY6 A;  1Q8I A;  3ERQ A;  4CJ1 B;  1BBU A;  2OQ0 A;  4UY8 C;  1WYD A;  3HS0 C;  4YIJ A;  2B2U C;  4C3I B;  1GUG A;  3TS0 A;  2TSS A;  4RCN A;  4H7B A;  4ZQ3 A;  3WDN A;  2D9U A;  2Z9H A;  1CFM A;  5J22 A;  1VQ5 A;  1HNW Q;  3F2U A;  1SMY C;  2LFN A;  1HNZ L;  1WTH A;  2EE1 A;  2GA4 B;  3A0J A;  2JA9 A;  1AE2 A;  3VYT A;  1KAW A;  1YZ6 A;  3J7A 5;  3K7U C;  4DV4 L;  1W3S A;  2K5V A;  3E3X A;  5FOB B;  3D6C A;  4A3K B;  3K6O A;  2H1E A;  4B3R L;  2FMC A;  3VR6 A;  3A55 A;  2C9O A;  4POG A;  1D1I A;  4POF A;  1GHK A;  1PRT B;  2EQS A;  4HJ9 A;  3AFQ A;  1PRT C;  3I8Z A;  4DR3 Q;  2NN6 I;  3D4D A;  1PZJ D;  1XNR Q;  3KUP A;  3P7J A;  4JI7 Q;  2NZH A;  2XRS D;  4CKB A;  3J7Z C;  4A4I A;  2D0P A;  4UHV A;  1NUC A;  2QDB A;  5DLQ E;  2F0L A;  2QIL A;  4V0B A;  1N36 L;  1PH7 A;  1LTI D;  2VL6 A;  1HXY D;  4IUN A;  1XMO L;  2X6G A;  2NVY B;  4FF2 A;  1EQT A;  5KGU A;  3SK5 A;  1D5M C;  2UUA Q;  1B50 A;  2QKI C;  3S1R H;  5FLX E;  2E2D C;  5M5X B;  1KD1 C;  4N8X 1;  4NW2 A;  5M3M H;  3OMC A;  3CCM A;  2OCE A;  1W6K A;  4X3U A;  3KLS X;  2F0J A;  2L5T A;  3GV3 A;  1RCV D;  3HP3 A;  3R2I A;  4HMI A;  1KAA A;  3EIV A;  4GZY C;  1SDF A;  5EQ0 A;  1EY5 A;  2K32 A;  4JI5 Q;  2L4N A;  4HCE A;  2UUC Q;  2A1A A;  1YNN D;  1QIL A;  3MA2 B;  4K6L A;  4R4I A;  5I6Y A;  4KKS A;  4LF4 Q;  3OPO A;  4KHP Q;  5JEA G;  1EFW A;  1EQV A;  2J0T D;  1A6X A;  1XYI A;  1VQE A;  2EY1 A;  2N8N A;  3HOX B;  3NWT A;  2AQ2 B;  4MTN A;  1IZ6 A;  1E1T A;  2BA0 A;  4A3E H;  1NCV A;  1NR4 A;  1K0R A;  1HR0 W;  2KOL A;  3GQB A;  5IGC A;  4QUC A;  4DFA A;  1PH4 A;  4XYO A;  1E1O A;  3Q8D A;  3EVQ A;  4FXK C;  2AUK A;  1L2F A;  1Q3L A;  2PZU A;  2IHE A;  4JI0 Q;  5E7N A;  1BR9 A;  2K01 A;  1UE6 A;  1U4M A;  5JJZ A;  1GO3 E;  4A3B G;  3FMC A;  3NWS A;  2N55 A;  5IGE A;  3PO3 H;  2R7F A;  2Y0S G;  1CKN A;  3A8K E;  2B39 A;  3V2T A;  1CSQ A;  3I3C A;  3PCO B;  2NB0 A;  3S9W A;  5IYD G;  4NPS A;  3ICE A;  3MHB A;  2WAQ B;  4RG1 A;  4DV6 L;  4A93 B;  1VQB A;  2E2I B;  2KHI A;  4C3I G;  4G7H C;  2EOT A;  2ENB A;  2VQF Q;  3IFT A;  2K1B A;  2R92 B;  1JT8 A;  3I2Z A;  1VQJ A;  3K80 C;  1I4Q A;  4OON A;  4K2L A;  3DM1 A;  5ELD A;  2VUM B;  1CK1 A;  3LGJ A;  2F0N A;  4XQJ A;  3HOY B;  1JCK B;  4XQQ A;  2F4V Q;  4QB4 A;  2K5W A;  5ELO A;  3UE0 A;  2CHB D;  1A2U A;  1EY9 A;  1PH9 A;  3I4M H;  4JI2 L;  1HTP A;  1A3V A;  5A2Q E;  5EBC A;  2N88 A;  3UDX A;  1PTO D;  1VCI A;  4BS9 A;  3I72 A;  2HHH Q;  2H4O A;  4LNQ A;  2JEA I;  2A6E C;  1ENC A;  1H9M A;  4FP5 D;  2BH2 A;  3CC4 A;  3FP9 A;  3QWN A;  3RZD H;  4B3T L;  3S16 H;  3F2D A;  2C5C A;  3T1Y L;  3PO2 B;  3NBH A;  2ZM6 Q;  1AN8 A;  2L1B A;  2BA1 A;  1GKH A;  2MJ8 A;  3M4O H;  2F0O A;  1EWI A;  1RKN A;  2P5Z X;  4C3J H;  4EQ5 A;  4L5S A;  1A2T A;  2RF4 A;  5C4X G;  4K0K Q;  1F2Y A;  4FO2 A;  4DK6 C;  1L0X B;  4YHH L;  4LFA Q;  3L3O C;  2FFK B;  3S2H B;  3VA5 A;  1V1Q A;  3RN5 A;  1NBW A;  2NVQ B;  1TWA B;  2MNA A;  4LJZ C;  4KKT A;  5KNB A;  3S17 B;  3EBE A;  4NDX A;  2F3I A;  3DWA A;  2SOB A;  1F2Z A;  1H9R A;  4ZAI A;  4JW0 A;  2I5M X;  3DWQ A;  2WAQ E;  1XNQ Q;  2G5D A;  5LMN Q;  2CW0 C;  3CP0 A;  3KF8 B;  3J7Y W;  4Q5V A;  4J15 A;  3TDQ A;  3TQY A;  4DV1 L;  1ENA A;  5M5Y H;  1LT5 D;  1UE1 A;  4JYA Q;  1OXX K;  3BZK A;  5ELN A;  3HOX G;  1Q7Y C;  2A68 D;  5C44 H;  2OTJ A;  3FEW X;  1NAP A;  2UUB L;  2I0Q A;  5IYB H;  2DUD A;  5FLM H;  2HIX A;  2R7Z B;  4KHZ A;  1LV9 A;  5EPK A;  3NUC A;  2LMC B;  2EYO A;  2KED A;  1SE8 A;  1E24 A;  2PNH A;  3P1H A;  3W1G A;  2F0W A;  2SNM A;  3HEJ A;  2PW7 A;  3QB3 A;  1NTG A;  3FRP B;  2UXB L;  4AYB G;  4P73 A;  4ME5 A;  2G9H D;  4ABN A;  1U0L A;  1EEF D;  2XN9 C;  2EDG A;  4OIK A;  2E2J H;  1UEA B;  1QB5 D;  1JR0 D;  2EPB A;  2IPK D;  5IP7 G;  3T1H L;  4RCO A;  4IN3 A;  2YU9 B;  2WII B;  1LAC A;  3KBG A;  1L1O B;  2WAQ G;  1LYL A;  1L1O C;  4A93 G;  3RR5 A;  3K5N A;  4OGQ C;  2DY7 A;  4JCV E;  5BN4 A;  2NVX H;  4M8A A;  1HFG A;  2XGT A;  2YTY A;  4XTC S;  3S14 H;  4Z9C B;  2R92 G;  4X64 L;  2F0E A;  1XTD A;  5IT9 E;  1TY0 A;  1EFI D;  2VUM G;  1QVC A;  3MVV A;  5JVH 3;  4PMW A;  1S5F D;  1HNX Q;  1SLJ A;  4BXX H;  5EGT A;  1ZEQ X;  1Y1W G;  3U9S A;  4ZYS A;  2F0T A;  2R61 A;  1KTK A;  4DK0 A;  4YWK A;  1VF5 C;  1A3U A;  1DON A;  4JBJ A;  1EZ8 A;  1YI2 A;  1SMY D;  3PO2 G;  1LAB A;  1B2T A;  2QGQ A;  3Q0A A;  3QIA A;  4A3F B;  1V9P A;  3HKZ G;  4JI4 L;  4DUZ L;  4DV3 Q;  2M2L A;  2O2L D;  4J1M A;  4DV5 Q;  3G6E A;  4GOP A;  2RBM A;  4IAL A;  2JXM B;  3H0G B;  5GQO A;  1LT6 D;  1SE3 A;  1SMX A;  2XVS A;  3RLN A;  3BVM A;  1EY4 A;  5IGD A;  1AP0 A;  4O0A A;  1BUV T;  1DJR D;  2Q8R E;  5IT9 c;  4A75 A;  5FK9 C;  2JA7 B;  3K58 A;  5KEE A;  3DEO A;  3I4O A;  3H15 A;  1PA6 A;  4XIG S;  1GM5 A;  4JI8 Q;  2SDF A;  2HUG A;  4NXN L;  4UP8 A;  4UP9 A;  5KND A;  4RKB A;  1F9S A;  3J80 E;  4OO1 G;  1KNE A;  1I5F A;  4DAY A;  3I56 A;  4A3D H;  5LHY 1;  1X54 A;  3NQI A;  1SNQ A;  2A69 D;  2RVL A;  2R6G A;  1U5K A;  1K28 A;  1I94 L;  3DXJ C;  3KLS A;  5BN3 A;  3GTG H;  1QUQ A;  3KBX A;  3KF6 A;  2B2V A;  2L9H A;  1K8O A;  1DD2 A;  4IJH A;  4X62 L;  4QJF A;  1HR0 L;  2R93 B;  2CWP A;  2Z0S A;  4A3M H;  2WAC A;  3Q22 A;  2EIF A;  1NE3 A;  3L0O A;  3I4N H;  2R7Z G;  3K8A A;  4IPG A;  2DJF C;  2QCP X;  1E2W A;  5C4Z A;  2XIW A;  3HOZ B;  4FDB A;  2HCI A;  4LMQ D;  2UXD L;  3PIO A;  1K0S A;  4N9P A;  4IUT A;  4BBR B;  1OXT A;  5C5M A;  3SEB A;  1MI2 A;  3GTP H;  4DXF A;  4DK3 C;  1WVL A;  3A7A B;  3CC2 A;  3KYH C;  3NTI A;  3MXP A;  3K5L A;  1I6H H;  4Q0F A;  1CQF A;  2NVT H;  5IYC G;  5C3E H;  5IGB A;  1DOM A;  1FJG L;  3VR3 A;  4DKA C;  1EWC A;  1M8A A;  5I9P A;  1YHB A;  3NTH A;  2K7V A;  1RJT A;  1S72 A;  2MFI A;  1M90 C;  4BY1 H;  2VB2 X;  1B9M A;  1DOK A;  3J81 j;  4C56 C;  1X6O A;  3V96 A;  4IFD G;  4AIM A;  1IYJ B;  4MZ9 A;  5CMD A;  2B2U A;  3PUW A;  5DNF A;  1TU2 B;  1VQN A;  2FJ2 A;  2MO0 A;  2PQE A;  1C4Q A;  4JBW A;  3E9H A;  4CDD C;  4CBV A;  4RMF A;  2DN8 A;  4PMB A;  2F1M A;  4P71 A;  4JI3 L;  3NEL A;  1KLU D;  1G2T A;  3STB D;  3L7Z C;  5D3D A;  5D3I B;  3GTJ B;  3ZJY C;  4A3F G;  1L0Y B;  1LT3 D;  3I73 A;  5A2Q L;  1Z7T A;  2AWO A;  3PUZ A;  3BDC A;  1LM0 A;  3D4W A;  1CSP A;  1V8Q A;  5JPN C;  2QEX A;  4DUY Q;  4BBS B;  3HGB A;  2F52 A;  4JI6 Q;  2A6E D;  1OXU A;  2QW7 A;  1K73 C;  4RKL A;  1IL2 A;  5CV9 A;  4JBK A;  1TWC H;  1XPO A;  4X6A H;  1WOC A;  3SR1 A;  2MO1 A;  4CDC C;  3S1N H;  4X3S A;  4JI1 L;  4GOP B;  3VDY A;  3A8J E;  4WJ4 A;  1H9K A;  4LF7 Q;  5ELF A;  1OXS C;  1B9N A;  2ZTC A;  4K2K A;  3OTO L;  1I4P A;  4NXM Q;  4YY3 L;  4QIW E;  3CHB D;  3G71 A;  4JV5 L;  2MQH A;  1GXD C;  4C2M H;  4OWT B;  3T4A C;  1SFO B;  1A62 A;  4OIJ A;  5CYU A;  2N3S A;  1O78 A;  1P8L A;  2DNC A;  3ULJ A;  3TP5 A;  5K5P A;  1R4P B;  2JA8 B;  1LT4 D;  3CCJ A;  2CW0 D;  1J8I A;  3ULL A;  3MXU A;  2KEE A;  2VB3 X;  2A68 C;  4BBR G;  4BY7 B;  1UEB A;  2MUY A;  5C0X H;  5JEA H;  4IO9 A;  4LFC Q;  1KAB A;  1QE6 A;  5J1Z A;  4XQN A;  1WTR A;  3RZO H;  1JE5 A;  1IW7 C;  4K5V A;  2ICI A;  1VMC A;  1IKM A;  1EY0 A;  2G9D A;  2VS1 A;  2HT1 A;  1N34 Q;  1SYD A;  3PV0 A;  4HSP A;  2EYM A;  1JMC A;  1TQO A;  2O5J C;  4A3L G;  4DV7 L;  4R8N A;  4Y7N H;  1T5E A;  5C4J H;  1SRU A;  1LO5 D;  4DR2 L;  4PZ6 A;  1Q1E A;  3GDE A;  4P74 A;  1J5E L;  4DR6 Q;  1HFN A;  3T16 A;  1M1K C;  4A3B H;  4JOI C;  1EY6 A;  1FR3 A;  1B8A A;  2LKV A;  5C3W A;  3TZU A;  1GUO A;  3EQL C;  3VR4 A;  1HQR D;  2GN5 A;  3MEH A;  3J7A V;  5IYD H;  1RIP A;  4DV4 Q;  1W2B A;  4XDX A;  1A3T A;  2VQE L;  5DAU A;  4GN5 A;  2NTS A;  1JOQ A;  1ROD A;  4C3I H;  1QZH A;  3D3R A;  1ZXT A;  1NY4 A;  4DR7 Q;  1HJP A;  4BA1 I;  3W3A A;  5IT9 L;  2NUC A;  4A3I H;  2A74 C;  4B3R Q;  4QY7 A;  1AEX A;  3IL8 A;  1IHZ A;  4B08 A;  3CF5 A;  4A3J B;  1PYS B;  1AZQ A;  3S1M H;  4C3H G;  4GN3 B;  1VQD A;  2OQK A;  2Q2I A;  1TS2 A;  4ZCK A;  4FXD A;  1PZK D;  4DA2 A;  1E7Z A;  3AU7 A;  1IBK Q;  4BBS G;  4AH6 A;  4KMU C;  3T53 B;  5LMN W;  4E6I A;  3M85 A;  1VQ8 A;  2NWG A;  1WTW A;  4UAI A;  1F9R A;  2NBF A;  5E4X A;  2RDF A;  2Z8L A;  5LMU L;  5I2X A;  3OW2 A;  2GVB A;  3EA6 A;  2GVA A;  5KYI A;  1MKH A;  2F3W A;  3HOU B;  4JK1 C;  5IGF A;  1VDZ A;  3AFP A;  1UWV A;  3TZD A;  1IYU A;  1KRT A;  1MSG A;  2F0D A;  4TRD A;  1ICW A;  3H3V H;  1STE A;  4QGU A;  2F4I A;  5C4X H;  3TS2 A;  4NB3 A;  1AZP A;  3BJU A;  4KJN A;  1DM0 B;  4OXP A;  4QCL A;  5M5W H;  3FPU B;  3ERO A;  3K81 C;  3JAM E;  1HH2 P;  5T1G A;  1I50 H;  2Q8T A;  2AQ3 B;  1B4O A;  1KLG D;  1QWY A;  2A69 C;  4IZ8 A;  4KD3 A;  3CC7 A;  3AMU A;  2WIN B;  1QJO A;  3KF8 A;  2JA8 G;  3RN2 A;  1PH8 A;  4LF6 L;  3EJI A;  2WKC A;  2B2W C;  4DR4 Q;  1HNW L;  1WTX A;  4BY7 G;  4RGO S;  4HMJ A;  4DXG A;  1TT2 A;  1PFB A;  4L5T A;  4DPG A;  1AE3 A;  2AUJ D;  4XT1 B;  1FVI A;  4L6T B;  3J80 i;  3IFD A;  3HOX H;  3SGI A;  1NSN S;  3V05 A;  4DAV A;  4TVA B;  1FYC A;  3HOV G;  5CV5 A;  2KVM A;  1WTP A;  4GN4 B;  5KIX A;  4LF9 L;  1GOZ A;  3CPF A;  4KY6 A;  1VQH A;  5BR8 Q;  1WJJ A;  4LUV A;  5CV8 A;  4JI7 L;  3CCU A;  4JC0 A;  4LF8 L;  1IBM Q;  1QCB D;  1EU3 A;  1HUN A;  1EU4 A;  3KFU A;  1TKW B;  5M3M B;  1JWS D;  1L1O A;  5IP7 H;  2EJF C;  5K36 G;  2IJ0 A;  4A3C G;  2IY5 B;  2KQ3 A;  3RD4 A;  2EJM A;  4A93 H;  5FLX c;  2UUA L;  3UE1 A;  2PZW A;  1SYE A;  2YYZ A;  1I6V C;  3N52 A;  3Q23 A;  4IPH A;  4DGZ A;  3GO5 A;  3ONA B;  1YBY A;  5EKL A;  2R92 H;  4A3J G;  3H94 A;  1HA5 A;  2M00 A;  2XNA C;  3M4Q A;  1U9R A;  2K33 A;  3W5O A;  3L9A X;  4EQP A;  3B6Y A;  5AJ3 L;  4HIK A;  4JI5 L;  2YV5 A;  4A3E B;  5F2D A;  1PHJ A;  1UE5 A;  1K83 B;  3K5M A;  2K05 A;  4ULL A;  4DAM A;  1Z9F A;  1Y1W H;  1VQI A;  3AYH B;  4R4T A;  4DR5 Q;  1EIY B;  3BG3 A;  3STB C;  3CKI B;  4A3K G;  4MTK A;  4OWW B;  2RCF A;  1XJV A;  1LTT D;  4OEM B;  1SNC A;  1F2L A;  1LUZ A;  3GD7 A;  5IP9 G;  4YHH Q;  5L37 A;  3PO2 H;  4L63 B;  2EY2 A;  3PIP A;  2WP8 J;  3BS1 A;  1XX8 A;  4IQZ A;  3S2D B;  1A0I A;  2WB1 E;  2HDL A;  2PW5 A;  1XTC D;  4GKJ Q;  2F0F A;  1PFN A;  3M7N A;  1CQV A;  1FD7 D;  4R1J A;  1PH6 A;  1N33 Q;  1MBY A;  2KHJ A;  3S2H H;  2NVQ H;  1ILQ A;  1TWA H;  2ZT9 C;  3KK7 A;  1JB3 A;  3I70 A;  3BZC A;  1OXV A;  1STY A;  4K5W A;  2B63 B;  3S17 H;  4XT3 B;  4IUR A;  5EAY A;  1R4Q B;  5G3L F;  4OO1 H;  3M7G A;  4GS3 A;  3CME A;  2EY5 A;  4DK1 A;  2IL8 A;  2RSO A;  2B2Y C;  3A8I E;  4H0L C;  4OX9 Q;  3L2P A;  3QO2 A;  2EY6 A;  4ZRZ A;  2HIV A;  1HTL D;  3RZD B;  3S16 B;  2F4V L;  3SDZ A;  3MAQ A;  1IL8 A;  1IYV A;  5I2Y A;  3E9I A;  3CPW A;  4LFB L;  4PZ7 A;  1CM9 A;  2ZJP A;  2DGY A;  3LWE A;  2EYL A;  3M4O B;  1X32 A;  3PQI A;  1S5B D;  4RGM A;  1CHQ D;  1ESF A;  2E2H H;  3MXG A;  4O42 A;  4HJ7 A;  4P75 A;  1ASY A;  4A3G B;  2YTV A;  3FKI B;  5IGG A;  2ZM6 L;  4B3M Q;  4OWX B;  4B3S Q;  4GLV B;  4LK1 C;  5M3M G;  4X64 Q;  1I3Q H;  1O7I A;  4RFB A;  3GTK B;  3D6W A;  1IW7 D;  2NN6 G;  1STA A;  1CZG A;  4UDU C;  5KYL A;  1SAP A;  4K0K L;  1GUN A;  4N8F A;  3CRL C;  5IYC H;  5CR3 A;  2QF7 A;  4LFA L;  1PZI D;  2O5I C;  2HQL A;  3QJY A;  2KEC A;  3PUV A;  1SNM A;  1N32 Q;  1EIH A;  3NQT A;  5COR A;  4L8J A;  3EN2 A;  1RL2 A;  1S40 A;  2PCF B;  2B2T C;  1YHQ A;  1PV4 A;  4FF3 A;  3TP6 A;  2MHV A;  1B1Z A;  2LXJ A;  3GTL H;  4ODG A;  4IFD H;  3K7A H;  2ZXO A;  3T13 A;  1Y8P B;  3OMG A;  2KUM A;  3UDI A;  5ELE A;  1Q12 A;  1XNQ L;  2BE5 D;  5LMN L;  2YTX A;  5IOD A;  4I7Z C;  4LWC A;  4DAP A;  1PH1 A;  2PQA B;  3HOY G;  1CHP D;  4G57 A;  1PH5 A;  1IXR A;  1GUS A;  1ASZ A;  4HCS A;  3A56 A;  2Q2U A;  3PUY A;  2ZTD A;  3CD6 A;  1R9T B;  1HZC A;  4A3F H;  3CCE A;  1GUW A;  1SNO A;  1X9N A;  5CV4 A;  4IUU A;  4LW1 A;  5J39 A;  4APV A;  2PMZ B;  1H9S B;  1KL9 A;  2QEJ C;  3TBI B;  1B53 A;  2NVX B;  1SYG A;  3CW2 C;  2LS0 1;  3S14 B;  3CQZ B;  2E75 C;  3H09 A;  3M3Y B;  1Q46 A;  2E5L Q;  3R3O A;  2KCT A;  3URY A;  1C48 A;  5C3X A;  2B63 G;  2IX0 A;  2Z6B A;  1G29 1;  4IPD A;  1N8R C;  4KJO A;  1TWF H;  1BBW A;  5ELC A;  1Q82 C;  1GD7 A;  3JC6 6;  2B8F A;  4QL5 A;  3PIO 3;  5KRU A;  2DNE A;  1YIJ A;  2VY3 A;  1SXT A;  2E76 C;  4DU9 A;  2E74 C;  5IE8 A;  4G7O C;  3OW7 A;  1L0W A;  1G2S A;  2XWJ B;  2LXK A;  1VQG A;  3DEP A;  3JAM L;  3GTQ B;  4C1N K;  2EVB A;  2OEO A;  3CMA A;  3G4S A;  4KTA A;  1HNX L;  1WFQ A;  2NTT A;  2OXP A;  1G51 A;  2F0M A;  2SNS A;  5IY0 A;  2N78 A;  4I7A A;  2RQX A;  5DEH A;  4GLX A;  3CAM A;  4J6H A;  5FLX L;  5GAD C;  4CKE A;  5LL6 X;  3FVQ A;  2Q2H A;  5CBE E;  3JAM i;  4A3G G;  4IJL A;  3A5U A;  1C7Y A;  1DZ1 A;  1KDB A;  3HOW B;  3FKI G;  5M3F H;  1AH9 A;  3MXN B;  3I4L A;  4BBR H;  2PI2 E;  1BNZ A;  1HZA A;  1XMQ L;  2TMP A;  1TY2 A;  4DV3 L;  1HHV A;  1D7Q A;  1LTS D;  4ZKB B;  3EFX D;  2I07 B;  2JA5 H;  1V1P B;  4ZUI A;  4A3L H;  4A3D B;  1JIC A;  1Q1B A;  2PMZ E;  1O7Y A;  1GJX A;  3RMH A;  5FKA C;  1JJG A;  1UNS A;  3ND9 A;  4GLA C;  4JOI A;  5IWA Q;  4JI8 L;  3UI2 A;  4ME3 A;  1TS3 A;  5CV6 A;  1FNV A;  3J80 c;  3GTG B;  2BOS A;  2UU9 L;  3A74 A;  4DV2 Q;  1TWG B;  4RHR A;  1Y8N B;  1ICF B;  4K8I A;  4QIW B;  2LY7 A;  2KA7 A;  1WTO A;  2RKS A;  2H5X A;  2I5L X;  3IRB A;  3OIP A;  4R9W A;  3K57 A;  3TRZ A;  3X3M A;  2EJG C;  5AFW A;  2EYH A;  2JA6 B;  4DV0 Q;  2V4D A;  3VR5 A;  4FNF A;  2XRQ D;  3GTP B;  4C3H H;  3Q6S A;  1PTO H;  2CWA A;  1I4X A;  4O1N A;  4HSV A;  1I4G A;  2A6H D;  1HPC A;  1I6H B;  4QQB X;  1OO9 B;  2BCO A;  4AQY Q;  3LWU A;  4A76 A;  5C3E B;  4G4K A;  4BBS H;  5EKI A;  2EYF A;  3A54 A;  2F03 A;  1VQ7 A;  1SJE D;  2WKD A;  4K14 A;  1IKL A;  3OTO Q;  4LF5 Q;  4KKU A;  2UXC L;  1LTR D;  3T51 B;  4YY3 Q;  3TSS A;  1EIG A;  3H0G G;  1X3G A;  5E3F A;  1BO0 A;  3TN2 A;  2MGS A;  4JV5 Q;  3D8G A;  3J81 i;  2JA7 G;  2KBN A;  1EEI D;  2J4X A;  3QG1 A;  4GKK L;  1K8A C;  3OOC A;  4F8M A;  1UAP A;  1VQ4 A;  2K04 A;  4X65 Q;  4DNT B;  1EY8 A;  1IBL Q;  1HZB A;  4FYD A;  2R3Z A;  5DM7 3;  3U9O A;  3KDF B;  1LTL A;  4YCV A;  4IOA A;  5C0X J;  2KCC A;  2PNR C;  2MP1 A;  1X65 A;  5ELB A;  2JK8 A;  5JEA J;  3U4V A;  5C0X I;  3O13 A;  3S1Q B;  1TXY A;  2AHO B;  1DGS A;  2AQ1 B;  4RHS A;  4HIM A;  1LTA D;  1FL0 A;  2B2W A;  2MPM A;  4DR1 L;  2JA8 H;  3TME A;  2ICE C;  5C6A A;  2R93 G;  2NZO A;  2EXZ A;  2L11 A;  4FXG C;  3HOW G;  2CQO A;  1EL0 A;  3FHW A;  3FPP A;  3GP7 A;  1TWH H;  4IUP A;  4BY7 H;  2B3G A;  2L0C A;  4QMG A;  1WCM B;  2RDH A;  4DR2 Q;  1Y8O B;  4NP5 A;  1TWC B;  4EVO A;  3HOZ G;  3RLO A;  3BDL A;  1BBX C;  3BVZ A;  1Y1V B;  5JJK A;  3BVG A;  3X3N A;  2KJX A;  3HOV H;  4PNY A;  1EIF A;  1MJC A;  4DUY L;  3GTM B;  4V19 0;  1DCZ A;  1VQC A;  1BOS A;  1FGU A;  1X3Q A;  4YCW A;  4H44 C;  3A7L A;  4K5X A;  1YNJ D;  3BZD B;  4IOC A;  1JB7 A;  1CA5 A;  1ENF A;  3S24 A;  1XPR A;  1QNK A;  2J7Z A;  2K03 A;  3U50 C;  5FJ8 G;  4C2M B;  1HCZ A;  5K36 H;  4A3C H;  1RDP D;  1CKO A;  3KJO A;  3R93 A;  4X66 L;  1E3P A;  2BH8 A;  2SEB D;  3KLR A;  5GAH C;  2F0K A;  1ML0 D;  4NXM L;  3CXC A;  5GRO A;  3CCR A;  5FO8 B;  1E2V A;  3MZ5 A;  2AKW B;  5EPL A;  4L5Q A;  1HNZ Q;  2JA6 G;  2K50 A;  5E1F A;  2ZJQ A;  4KK7 A;  4WOR A;  4A3J H;  1C0A A;  1Y14 B;  1VQ9 A;  1KHI A;  2BE5 C;  4O2D A;  3CRK C;  1NJI C;  3BDO A;  1SE2 A;  2BDN A;  2ASB A;  1PFS A;  2Z6K C;  5HUR A;  3OSO A;  1XPU A;  1QG7 A;  1I4R A;  3T56 B;  2CKZ B;  2E8G A;  1BVS A;  3K0Y A;  2JQO A;  2I46 A;  4ID6 A;  4Y7N B;  3WOE A;  3H3V I;  4A3K H;  3HFZ B;  4LFC L;  3S15 B;  3E6Z X;  2JYO A;  2FIN B;  5I6W A;  1N36 Q;  5G3L D;  1N34 L;  2O4X A;  3PF5 A;  1CA6 A;  1XMO Q;  4CKC A;  3GTO B;  1D1K A;  4JG2 A;  3VYR A;  4EGV A;  2RSN A;  3QOJ A;  3UDF A;  2F0U A;  4DR6 L;  4RH6 A;  2ZJR A;  4HAE A;  1Z6H A;  4A3I B;  4BWG B;  4LF6 Q;  4DNI A;  1YHA A;  5KNC A;  1A63 A;  2NVY H;  3NTK A;  3S1M B;  1STN A;  3SK8 A;  3HZX A;  1KDA A;  5M5X H;  4X3K A;  4DR7 L;  3HKS A;  2B2Y A;  3W1B A;  3K59 A;  3K5O A;  4LF9 Q;  1SN8 A;  5T1I A;  3KJP A;  2EYJ A;  1WCM G;  3J80 L;  1GHJ A;  4LUZ A;  1BDO A;  4KHV A;  1ILP A;  1Y1V G;  4LF8 Q;  5GAG C;  1KQS A;  1CTM A;  3SK4 A;  1IBK L;  1GUT A;  5IOC A;  3HG9 A;  1HZ9 A;  4QUF A;  4DN4 M;  3ULP A;  1EUJ A;  1O80 A;  2NYZ D;  1SR3 A;  5FO7 B;  3H3V C;  5C4X B;  3D0F A;  4UPA A;  2WB1 B;  1A8V A;  1TS4 A;  5M5W B;  5A35 A;  1RHP A;  3MTS A;  2KCN A;  4KI0 A;  4DR3 L;  1NMG A;  4WJW A;  1I50 B;  1WTQ A;  3PUX A;  1XWE A;  2NN6 H;  1XNR L;  4DV6 Q;  1FNW A;  2F0P A;  2NZ1 D;  2Y0S E;  2VXW A;  5AJ3 Q;  3S1R B;  3JAM c;  3AB9 A;  2D5D A;  1BKB A;  2Q2T A;  1DYQ A;  1O7L A;  3CCS A;  1J6Q A;  3PIP 3;  2F0H A;  3TP8 A;  1PDQ A;  2D62 A;  2B2T A;  4X3T A;  5C0X G;  1Q90 A;  5JOB A;  1EWH A;  1K3B C;  2E2I H;  2HDM A;  1ZYR C;  1LTG D;  1G6Z A;  1S5D D;  3PGZ A;  3C3L A;  4JI2 Q;  1K83 H;  2K5Q A;  5JJL A;  1RTN A;  2F0S A;  5ISR A;  3F2B A;  2PQA A;  5NUC A;  4DR4 L;  1JWU D;  2JN4 A;  2PI2 A;  1KRS A;  2VUM H;  3HOY H;  4B3T Q;  5H1S E;  3D31 A;  3E0J A;  3T1Y Q;  2A6H C;  4XYQ A;  3FDT A;  4AYB B;  1V43 A;  2JEB I;  2UUC L;  4MIU A;  1EZ6 A;  3QOL A;  3BYY B;  3SXH A;  3J81 E;  3S2D H;  2IHF A;  4LF4 L;  4KHP L;  1H9S A;  4GNX B;  4GNX C;  5BR8 L;  2A8V A;  2CQA A;  4WJ3 M;  4YWM A;  3GV6 A;  1I4H A;  3I7F A;  4JBM A;  3LNN A;  4OO1 I;  4B9X A;  4S3S A;  3HOU G;  2ID0 A;  3PO3 B;  5M9O A;  4A3I G;  1IBM L;  1PYB A;  2IW3 A;  3TP7 A;  1VQM A;  4KLK A;  4H13 C;  5COY A;  1PFM A;  1T9H A;  1H9J A;  2B63 H;  4R4Q A;  4JI0 L;  1EYD A;  4HR7 B;  1E0B A;  5CV7 A;  4L5R C;  4LFB Q;  1Y1W B;  4HID A;  5JVG 3;  1JJ2 A;  4ZK9 B;  4DV1 Q;  3OYY A;  4CDF C;  2Q8I B;  3NP8 A;  1BCP D;  3I90 A;  1JOO A;  2PZT A;  1B3Q A;  4M1U B;  1PLF A;  1Y69 U;  1P16 A;  4KY5 A;  3C46 A;  3I4M B;  2UUB Q;  2VQF L;  3TRE A;  3J81 c;  2D0O A;  2L12 A;  1LTB D;  1SYC A;  2HQE A;  3HKZ B;  3SVM A;  4DR5 L;  3IAY A;  2VW9 A;  1MJE A;  1Q8K A;  1B3A A;  2B29 A;  3NHH A;  2C35 B;  3RUZ A;  3MXN A;  2WB1 G;  2UXB Q;  4A3G H;  4G7Z C;  3A5Z B;  3FKI H;  4KN4 C;  2K4K A;  5EPJ A;  4EQO A;  2R7Z H;  2IX1 A;  1ZKO A;  3T1H Q;  3GTK H;  2HHH L;  1HQM C;  1EQQ A;  1STG A;  1G6P A;  1X3P A;  2Z1C A;  4AYB E;  1X3F A;  4MN3 A;  2CFM A;  4C3J B;  1BF4 A;  4KY7 A;  4GKJ L;  3WOF A;  4CDE C;  1G91 A;  4HN7 A;  1V1P A;  1AW7 A;  1Z47 A;  1VS0 A;  4IFD J;  4Y52 H;  1WTV A;  4IFD I;  1N33 L;  1CZW A;  1YNJ C;  2K28 A;  5IIF A;  4WRD A;  3NE5 B;  1SND A;  2FXQ A;  2I5H A;  4J8Q A;  3NBI A;  1MSH A;  4JVZ A;  3F2C A;  2QA4 A;  2A19 A;  2YU9 H;  1CKM A;  2CCZ A;  2VNU D;  3NEM A;  4U68 A;  4LAA A;  2CH4 W;  3P75 A;  1U4P A;  4KV6 A;  4RWS C;  1KNA A;  3P20 A;  1EY7 A;  1FGB D;  3UDG A;  4PV1 C;  1HUM A;  3CCQ A;  3R2T A;  3OWE B;  1HRJ A;  5M5Y B;  4OX9 L;  5BN5 A;  5J3B A;  1WD1 A;  1MIU A;  2E2H B;  2Z4H A;  5C44 B;  4A3E G;  3SE0 A;  1G8Z D;  3DMU A;  1Q86 C;  1MGS A;  3C1F A;  1R9T H;  1I3Q B;  4JI4 Q;  2F0V A;  1K9M C;  2Z4I A;  4DUZ Q;  1SNP A;  1F9Q A;  4OL7 A;  1M4V A;  3DHQ A;  3G6J B;  1YJ9 A;  4JYA L;  1PH2 A;  1CI3 M;  3HKZ E;  4EQN A;  5FO9 B;  3PO3 G;  2VZA A;  2E2J B;  4B3M L;  3CQZ H;  4B3S L;  1PH3 A;  1VQL A;  3M3Y H;  4F87 A;  2KHS A;  4LUO A;  5CBA E;  1J9O A;  1KC8 C;  1OTC A;  1VMP A;  4NXN Q;  3CU7 A;  1CKN B;  4F7X A;  1YJW A;  1PXU A;  2L15 A;  3H0G H;  1SYF A;  1XXG A;  5I4D A;  1SSO A;  4HIO A;  4UP7 A;  1C9O A;  3GTL B;  2WFW A;  2JA7 H;  3K7A B;  5E4W C;  1JC7 A;  1JOR A;  1N32 L;  3BYT B;  1UUP A;  1S5C D;  3F8T A;  4ZLT F;  1I94 Q;  2L55 A;  1EYC A;  2K5D A;  1D5X C;  3KDF A;  1SEB D;  3OIQ A;  3GTQ H;  3G48 A;  3NK9 A;  4X62 Q;  1HR0 Q;  3I4M G;  1VQK A;  2R7D A;  3C2P A;  1TVX A;  3PMF A;  1KXL A;  2JE6 I;  3J7A F;  2ZTE A;  4CHT B;  4HED A;  4RGN A;  5EBD A;  3SHL A;  2F0I A;  1STH A;  2KCM A;  4YCU A;  1VQ6 A;  5DM6 3;  1H95 A;  1XMQ Q;  1ESR A;  4PZ8 A;  2PO4 A;  3OWF A;  5HGQ A;  2UXD Q;  2A73 B;  1PRT D;  2QDL A;  2R93 H;  3HOW H;  4HTH A;  3PF4 A;  1HA6 A;  1SYB A;  4KD4 A;  3NBH B;  2IWH A;  3M4P A;  1EOT A;  3HOZ H;  4C3J G;  2D2C C;  4NKL A;  1S3O A;  1YVC A;  4FF1 A;  2UU9 Q;  1FJG Q;  2M9V A;  1TWF B;  4U67 3;  4F88 A;  2K6A A;  1NNX A;  2ALY B;  1TS5 A;  3H91 A;  4PMC A;  1PTO F;  1D8L A;  1VQO A;  3MFG A;  1BCP F; 
#chains in the Genus database with same CATH homology
 3HOV H;  1VQP A;  4L5T A;  3I55 A;  4DPG A;  2E5L L;  1AE3 A;  1EIF A;  1MJC A;  2I5M X;  4DUY L;  1FVI A;  2WAQ E;  4DV5 L;  3J80 i;  1XNQ Q;  5LMN Q;  3CP0 A;  1VQC A;  3KF8 B;  3SGI A;  3KOJ A;  3HOX H;  1NMF A;  1SRO A;  4J15 A;  4TVA B;  3TQY A;  3HOV G;  4DV1 L;  1FGU A;  5M5Y H;  1TWG H;  4GN4 B;  4YCW A;  4LF9 L;  5FJ8 H;  1UE1 A;  4JYA Q;  1OXX K;  3BZK A;  5ELN A;  3HOX G;  1Q7Y C;  4IOC A;  1JB7 A;  2ES2 A;  3CPF A;  5C44 H;  2OTJ A;  1VQH A;  5BR8 Q;  2UUB L;  3S24 A;  4EX5 A;  5IYB H;  1XPR A;  2DUD A;  5FLM H;  1WJJ A;  2I0Q A;  4HJA A;  3AQQ A;  4LUV A;  3U50 C;  5FJ8 G;  4JI7 L;  3CCU A;  2N49 A;  1X3E A;  2HIX A;  4JC0 A;  4A3C H;  1CKO A;  4KHZ A;  3KJO A;  4X66 L;  5C44 G;  1IBM Q;  4LF8 L;  1E3P A;  4JI3 Q;  2BH8 A;  1SE8 A;  2JA6 H;  5IYB G;  5FLM G;  3KFU A;  1E24 A;  2PNH A;  3W1G A;  3CCL A;  5GAH C;  4NXM L;  1L1O A;  1NTG A;  5IP7 H;  2UXB L;  3CXC A;  5K36 G;  2Z6K A;  4P73 A;  5GRO A;  4AYB G;  3CCR A;  4A3C G;  2IY5 B;  1U0L A;  2UXC Q;  2AKW B;  3ERS X;  4L5Q A;  1HNZ Q;  2E2J H;  2JA6 G;  5FLX c;  1Q81 C;  2K50 A;  4A93 H;  2UUA L;  3UE1 A;  2ZJQ A;  2YYZ A;  2OWO A;  4A3J H;  5IP7 G;  1C0A A;  3T1H L;  1KIX A;  3NEN A;  1Y14 B;  1VQ9 A;  1KHI A;  4O2D A;  3MEF A;  2ATW A;  4IPH A;  3GO5 A;  1L1O B;  1E22 A;  1YBY A;  2WAQ G;  1LYL A;  1L1O C;  4R4O A;  1NJI C;  2R92 H;  3RR5 A;  3WWV A;  3GTJ H;  4IPC A;  2ASB A;  1PFS A;  2Z6K C;  4A3J G;  1YNX A;  4JCV E;  4GKK Q;  2NVX H;  3M4Q A;  1XPU A;  2XGT A;  1UE7 A;  2YTY A;  2CKZ B;  4XTC S;  3W5O A;  2E8G A;  3S14 H;  2R92 G;  1BVS A;  3B6Y A;  1B7Y B;  1N9W A;  4X64 L;  1XTD A;  5AJ3 L;  2JQO A;  4HIK A;  4H02 A;  4JI1 Q;  4JI5 L;  2YV5 A;  3H3V I;  5JJI A;  4A3K H;  3HFZ B;  4LFC L;  2IT1 A;  1UE5 A;  1PHJ A;  2VUM G;  1QVC A;  1Y1W H;  4DAM A;  1Z9F A;  1VQI A;  3AYH B;  4PMW A;  4R4T A;  3PSI A;  1HNX Q;  4DR5 Q;  1EIY B;  2EXD A;  1N36 Q;  1SLJ A;  3STB C;  4A3K G;  4BXX H;  5IWA L;  1N34 L;  3PF5 A;  1Y1W G;  4DR1 Q;  1XMO Q;  4OWW B;  1XJV A;  1LUZ A;  3GD7 A;  5IP9 G;  2RHS B;  4YHH Q;  3PO2 H;  4JG2 A;  3PIP A;  4DV2 L;  2WP8 J;  4YWK A;  2RHQ B;  4BXX G;  3BU2 A;  3UDF A;  4JBJ A;  4DR6 L;  3RNU A;  2ZJR A;  1YI2 A;  1A0I A;  2WB1 E;  3S1Q H;  3PO2 G;  4LF6 Q;  4GKJ Q;  4ALP A;  2QGQ A;  4DNI A;  1YHA A;  1A63 A;  3M7N A;  2NVY H;  4R1J A;  1V9P A;  3HKZ G;  1PH6 A;  4JI4 L;  1N33 Q;  2KHJ A;  4DUZ L;  3S2H H;  4DV3 Q;  1JJC B;  4DV0 L;  4DV5 Q;  3G6E A;  4GOP A;  2NVQ H;  1TWA H;  1GVP A;  5GQO A;  1SFO H;  5M5X H;  1WCM H;  1SMX A;  4DR7 L;  3HKS A;  3RLN A;  3W1B A;  4O0A A;  2RCN A;  1OXV A;  3BZC A;  3S17 H;  3CCV A;  5IT9 c;  4A75 A;  4LF9 Q;  1SN8 A;  5GAE C;  1Y1V H;  3KJP A;  3I4O A;  3H15 A;  5EAY A;  1PA6 A;  4XIG S;  1GM5 A;  1WCM G;  4GS3 A;  4JI8 Q;  4AQY L;  3CME A;  4NXN L;  1PVO A;  4LUZ A;  4GOP C;  4UP8 A;  4UP9 A;  2AMC B;  4DV7 Q;  3GTM H;  1Y1V G;  3DM3 A;  4LF8 Q;  4OO1 G;  4X66 Q;  5GAG C;  1J5E Q;  1KQS A;  4OX9 Q;  1I5F A;  4LF5 L;  3ER0 A;  3L2P A;  3I56 A;  1IBK L;  4A3D H;  2HIV A;  1X54 A;  3AEV A;  1HZ9 A;  2F4V L;  3ULP A;  1EUJ A;  2R6G A;  3RLF A;  1U5K A;  4BA2 I;  1SR3 A;  1I94 L;  1QVG A;  4JI6 L;  2K5N A;  3E9I A;  3CPW A;  2KEN A;  4PG3 A;  1QUQ A;  3D0F A;  2K75 A;  4UPA A;  4PZ7 A;  4HJ8 A;  3GTG H;  4HJ5 A;  3KF6 A;  2ZJP A;  4A3D G;  1X56 A;  1VQF A;  2DGY A;  2K5H A;  4DAY B;  4IJH A;  1A8V A;  3KLW A;  4X62 L;  4QJF A;  2VQE Q;  1HR0 L;  2CWP A;  2Z0S A;  2LSS A;  4KI0 A;  4DR3 L;  4A3M H;  1NMG A;  2E2H H;  2EIF A;  1NE3 A;  3L0O A;  4X65 L;  4HJ7 A;  4P75 A;  1ASY A;  3I4N H;  2R7Z G;  3K8A A;  3PUX A;  4MNO A;  1IBL L;  4IPG A;  1XNR L;  2YTV A;  4DV6 Q;  1QUQ B;  4FDB A;  2ZM6 L;  3DLL A;  3KF6 B;  4OWX B;  4B3S Q;  4GLV B;  2Y0S E;  5M3F G;  1YJN A;  5M3M G;  4X64 Q;  5AJ3 Q;  1I3Q H;  4A3M G;  1O7I A;  1EQR A;  3M9B A;  3I4N G;  2UXD L;  3JAM c;  3PIO A;  1B70 B;  2NN6 G;  1BKB A;  2Q2T A;  3CCS A;  2K52 A;  4TQU S;  1K8G A;  2JJQ A;  1J6Q A;  4R4C A;  3TEH B;  1YIT A;  1OXT A;  4K0K L;  3GTP H;  2D62 A;  4DK3 C;  5IYC H;  5C0X G;  3CC2 A;  2K14 A;  3F1Z A;  3KYH C;  4LFA L;  4YWL A;  2E2I H;  2HQL A;  1I6H H;  3PUV A;  1N32 Q;  2JA5 G;  2NVT H;  2OTL A;  5IYC G;  5C3E H;  1FJG L;  3PGZ A;  1EYG A;  4JI2 Q;  1QVF A;  3S15 H;  3EN2 A;  1K83 H;  4DKA C;  5LMU Q;  5JJL A;  1EOV A;  1RL2 A;  1X55 A;  1VQA A;  2XTI A;  2PQA A;  3F2B A;  1S40 A;  4DR4 L;  2PI2 A;  1YHB A;  1YHQ A;  1PV4 A;  1CUK A;  1KRS A;  5C3E G;  2VUM H;  2LXJ A;  2V1C C;  2MFI A;  1S72 A;  3GTL H;  1K3R A;  4GNX A;  3K7A H;  1M90 C;  4P72 A;  4B3T Q;  4BY1 H;  3HOY H;  5H1S E;  3U4Z A;  3UDI A;  3D31 A;  3U58 A;  1Q12 A;  1XNQ L;  5LMN L;  2AWN A;  3T1Y Q;  2YTX A;  3GTO H;  1V43 A;  4LWC A;  2JEB I;  3J81 j;  2UUC L;  1X6O A;  3E0E A;  1PH1 A;  4IFD G;  2PQA B;  4AIM A;  3HOY G;  4LFB L;  1IYJ B;  4MZ9 A;  4BY1 G;  3PUW A;  1PH5 A;  1IXR A;  3K0X A;  3S2D H;  2IHF A;  4LF4 L;  1VQN A;  5IP9 H;  1ASZ A;  4KHP L;  3HOU H;  1YEZ A;  4GNX B;  2MO0 A;  4GNX C;  4JBW A;  5BR8 L;  2A8V A;  1QZG A;  4WJ3 M;  3E9H A;  4YWM A;  2Q2U A;  3PUY A;  1WI5 A;  2ZTD A;  3CD6 A;  3I7F A;  5HY6 A;  4JBM A;  1BBU A;  1HZC A;  3CCE A;  4A3F H;  4OO1 I;  2OQ0 A;  4RMF A;  4UY8 C;  1X9N A;  3HOU G;  1WYD A;  2ID0 A;  4P71 A;  4A3I G;  1IBM L;  4JI3 L;  1PYB A;  3NEL A;  4LW1 A;  4APV A;  3STB D;  3TS0 A;  1KL9 A;  3L7Z C;  3ZJY C;  1VQM A;  4A3F G;  4KLK A;  3CW2 C;  1T9H A;  1VQ5 A;  2B63 H;  1HNW Q;  4R4Q A;  1HNZ L;  4JI0 L;  1Q46 A;  2JA9 A;  3A0J A;  1AE2 A;  2AWO A;  3PUZ A;  1KAW A;  1LM0 A;  1YZ6 A;  2E5L Q;  1CSP A;  3J7A 5;  3K7U C;  2QEX A;  2KCT A;  1W3S A;  2K5V A;  4DUY Q;  4DV4 L;  4B3M Q;  2F52 A;  4JI6 Q;  4L5R C;  1OXU A;  2B63 G;  4LFB Q;  2IX0 A;  1K73 C;  4HID A;  1JJ2 A;  1G29 1;  4IPD A;  1N8R C;  1IL2 A;  1TWF H;  3OYY A;  1BBW A;  4DV1 Q;  1Q82 C;  4JBK A;  1GD7 A;  4B3R L;  1TWC H;  3JC6 6;  4QL5 A;  1XPO A;  4POG A;  4X6A H;  1YIJ A;  4POF A;  1WOC A;  2EQS A;  4HJ9 A;  2VY3 A;  3AFQ A;  2MO1 A;  4DR3 Q;  3S1N H;  1P16 A;  5IE8 A;  2NN6 I;  2UUB Q;  1L0W A;  4JI1 L;  4GOP B;  2VQF L;  3VDY A;  3TRE A;  1XNR Q;  3J81 c;  4JI7 Q;  4WJ4 A;  4LF7 Q;  2NZH A;  3J7Z C;  2D0O A;  2LXK A;  1VQG A;  4A4I A;  2D0P A;  1OXS C;  3CMA A;  3G4S A;  2ZTC A;  1HNX L;  3OTO L;  4DR5 L;  1WFQ A;  5DLQ E;  1N36 L;  1G51 A;  2VW9 A;  1PH7 A;  1MJE A;  1Q8K A;  2VL6 A;  5IY0 A;  4YY3 L;  2B29 A;  2N78 A;  2C35 B;  4NXM Q;  2WB1 G;  1XMO L;  4GLX A;  2UXB Q;  4QIW E;  3CAM A;  4A3G H;  5GAD C;  3G71 A;  4JV5 L;  2MQH A;  3A5Z B;  3FKI H;  2K4K A;  2UUA Q;  4C2M H;  4OWT B;  2R7Z H;  2Q2H A;  2IX1 A;  3T1H Q;  3GTK H;  2HHH L;  3S1R H;  1EQQ A;  3JAM i;  1KD1 C;  1A62 A;  4IJL A;  4AYB E;  3A5U A;  1X3F A;  1C7Y A;  2CFM A;  4A3G G;  1G6P A;  2N3S A;  3FKI G;  1P8L A;  5M3M H;  5M3F H;  3CCM A;  3MXN B;  4GKJ L;  1AH9 A;  4BBR H;  2OCE A;  2PI2 E;  3ULJ A;  1HZA A;  1Z47 A;  1VS0 A;  3CCJ A;  4IFD J;  4Y52 H;  4IFD I;  1XMQ L;  3ULL A;  1N33 L;  3EIV A;  4DV3 L;  2FXQ A;  2I5H A;  4BBR G;  3F2C A;  2QA4 A;  1D7Q A;  1UEB A;  2A19 A;  4JI5 Q;  4IO9 A;  4LFC Q;  2YU9 H;  1CKM A;  2CCZ A;  2UUC Q;  2VNU D;  3NEM A;  2A1A A;  2JA5 H;  4A3L H;  3RZO H;  1JE5 A;  4R4I A;  1Q1B A;  2PMZ E;  4LF4 Q;  4KHP Q;  2VS1 A;  2HT1 A;  5JEA G;  1JJG A;  4GLA C;  5IWA Q;  4JOI A;  1N34 Q;  1EFW A;  3PV0 A;  4JI8 L;  3UDG A;  1JMC A;  4ME3 A;  3J80 c;  1VQE A;  2N8N A;  3CCQ A;  4A3L G;  4DV7 L;  4MTN A;  1IZ6 A;  1E1T A;  4Y7N H;  2UU9 L;  3A74 A;  2BA0 A;  5C4J H;  4A3E H;  1K0R A;  1SRU A;  4DV2 Q;  4DR2 L;  4PZ6 A;  1Q1E A;  3GDE A;  4P74 A;  1J5E L;  1HR0 W;  4OX9 L;  4LF7 L;  4DR6 Q;  1PH4 A;  5J3B A;  1MIU A;  1E1O A;  4A93 G;  3Q8D A;  1M1K C;  4A3B H;  4JOI C;  4A3E G;  2H5X A;  2I5L X;  3IRB A;  1Q86 C;  1B8A A;  1L2F A;  2IHE A;  4JI0 Q;  5E7N A;  1R9T H;  1UE6 A;  2GN5 A;  3TRZ A;  4JI4 Q;  1K9M C;  5IYD H;  1GO3 E;  1RIP A;  4DUZ Q;  4DV4 Q;  4A3B G;  3PO3 H;  1W2B A;  4DV0 Q;  2R7F A;  2Y0S G;  2VQE L;  4GN5 A;  1CKN A;  1YJ9 A;  4C3I H;  1QZH A;  4JYA L;  1PH2 A;  1CSQ A;  3PCO B;  4DR7 Q;  1NY4 A;  1HJP A;  4BA1 I;  4B3R Q;  4A3I H;  4C3H H;  5IYD G;  4NPS A;  3HKZ E;  3ICE A;  4QY7 A;  2CWA A;  3PO3 G;  2VZA A;  4RG1 A;  4DV6 L;  1VQB A;  4B3M L;  2KHI A;  3CQZ H;  4B3S L;  1PH3 A;  1VQL A;  4QQB X;  3CF5 A;  3M3Y H;  1PYS B;  4LUO A;  3S1M H;  4AQY Q;  4A76 A;  1KC8 C;  1OTC A;  4NXN Q;  4BBS H;  2VQF Q;  1CKN B;  4GN3 B;  1YJW A;  1VQD A;  2OQK A;  2Q2I A;  2L15 A;  1JT8 A;  3H0G H;  3I2Z A;  1VQ7 A;  1VQJ A;  3K80 C;  4HIO A;  4UP7 A;  1C9O A;  4OON A;  1E7Z A;  3OTO Q;  4LF5 Q;  1IBK Q;  4BBS G;  2UXC L;  2WFW A;  4AH6 A;  2JA7 H;  3LGJ A;  4YY3 Q;  3H0G G;  5LMN W;  2F4V Q;  1N32 L;  3M85 A;  1X3G A;  5ELO A;  3UE0 A;  1PH9 A;  3F8T A;  3I4M H;  1I94 Q;  4JV5 Q;  1VQ8 A;  3J81 i;  4JI2 L;  2JA7 G;  3KDF A;  5LMU L;  3OW2 A;  3UDX A;  1VCI A;  2KBN A;  2GVB A;  2HHH Q;  3GTQ H;  4GKK L;  3G48 A;  2GVA A;  4X62 Q;  1K8A C;  4LNQ A;  1MKH A;  1HR0 Q;  2JEA I;  3I4M G;  1VQK A;  2R7D A;  2BH2 A;  1VQ4 A;  3CC4 A;  3FP9 A;  3AFP A;  1UWV A;  3RZD H;  4B3T L;  2JE6 I;  1KXL A;  3S16 H;  2ZTE A;  1KRT A;  4X65 Q;  3F2D A;  2KCM A;  4YCU A;  1HZB A;  3T1Y L;  1IBL Q;  1VQ6 A;  1H95 A;  3H3V H;  1XMQ Q;  3KDF B;  2ZM6 Q;  1LTL A;  4YCV A;  4QGU A;  4PZ8 A;  4IOA A;  5C4X H;  5C0X J;  3TS2 A;  4NB3 A;  1X65 A;  3BJU A;  2JK8 A;  5JEA J;  3U4V A;  5C0X I;  5HGQ A;  2UXD Q;  2BA1 A;  1GKH A;  4OXP A;  3M4O H;  1TXY A;  2AHO B;  1EWI A;  5M5W H;  1DGS A;  2R93 H;  4EQ5 A;  4C3J H;  4L5S A;  3HOW H;  2RF4 A;  3K81 C;  4HIM A;  4K0K Q;  1FL0 A;  4DR1 L;  3PF4 A;  5C4X G;  1HH2 P;  1I50 H;  3NBH B;  2JA8 H;  4DK6 C;  3M4P A;  4YHH L;  4LFA Q;  2R93 G;  2NZO A;  3HOZ H;  3HOW G;  1V1Q A;  2CQO A;  3RN5 A;  3FHW A;  1NBW A;  1S3O A;  3CC7 A;  2MNA A;  1TWH H;  1YVC A;  4BY7 H;  2B3G A;  2UU9 Q;  1FJG Q;  2JA8 G;  4DR2 Q;  3RN2 A;  1PH8 A;  4LF6 L;  2ALY B;  3EBE A;  3HOZ G;  3RLO A;  2F3I A;  1D8L A;  4DR4 Q;  1HNW L;  1VQO A;  5JJK A;  4BY7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...