3KF6B

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
PLGSDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
molecule keywords Protein stn1
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6B00
3DLLA 4BBRG 1N36L 1HR0W 2UXDL 3GTGH 5C4XH 3CCSA 2BH8A 4DUYL 1HZCA 4A3KG 1ASZA 1OTCA 4JI1L 4A3DG 1EIYB 4GNXB 1MJEA 4JI3Q 4IPHA 1CUKA 1HNZQ 5IP7G 4HIMA 1HZ9A 1IBMQ 4C3JH 1PH1A 1VQJA 3BZKA 1Y1VG 5IY0A 4GKJL 3CAMA 1X6OA 3GD7A 1IBLQ 2F4VL 3GTKH 3JAMc 2RF4A 2CKZB 3K8AA 3F2CA 4JV5L 2N78A 4LF6L 4X65L 1PFSA 4X62L 4KHPL 4IJHA 1A8VA 3KYHC 4P72A 3STBD 1CKOA 2ID0A 4A3IH 2Z6KC 4ALPA 1L1OB 1FGUA 1K0RA 1WFQA 2MO0A 4DUZL 4X66L 4HJ8A 4B3SQ 4HIKA 3L7ZC 4JV5Q 5C0XI 2E8GA 5LMNW 4A3EH 1D7QA 3PSIA 4XIGS 5JJLA 3HOUG 2VZAA 4ME3A 4YWMA 4DK6C 2VW9A 1OXSC 3CCJA 2F52A 3H15A 1O7IA 3KOJA 4MNOA 4JI5L 3W5OA 1JMCA 3KLWA 2VQFL 4LFBQ 2KHJA 1Q1EA 1HR0Q 1IBKQ 3ULLA 1K9MC 1N36Q 4KHZA 1WCMH 5IYDG 1K8AC 3D0FA 1VQFA 3I4NH 1N34Q 4O0AA 4FDBA 2JJQA 2KHIA 1VQCA 2YV5A 4YCWA 3S2DH 3M4QA 1YJNA 2AHOB 2JA8G 3RNUA 2R92G 2YTYA 4GNXC 4A3BG 1R9TH 3I4NG 1XNQQ 4DR2Q 5M5YH 4GLAC 1NE3A 4JI2L 3M3YH 2VUMG 1L1OA 4Y52H 2I5HA 4P73A 2ZJPA 2DUDA 4AIMA 2WB1G 2JA8H 4DR4Q 4LFBL 1HNWQ 1V9PA 3UDGA 2JA7H 5IYBG 2E2HH 2Y0SE 1S3OA 1KRTA 4HJAA 4LF7L 1TWFH 4GKKQ 4LF4L 2IHEA 2L15A 4PMWA 4PZ8A 4NXNL 3EIVA 1X65A 4Y7NH 1XNRL 2NVQH 3HOYG 1LYLA 1IXRA 4GNXA 4A3EG 2I0QA 3FHWA 3VDYA 5H1SE 3STBC 1PH8A 3CMEA 1VQNA 1J6QA 5IWAQ 3J81i 1KRSA 1EFWA 3AEVA 4X64Q 3U50C 4UP9A 3GTMH 1VQ5A 1A0IA 4DR3Q 5IYCH 1EYGA 3A5ZB 5IP9G 1HR0L 2CCZA 5M3FG 1PA6A 1N8RC 2JA6H 2Q2TA 1JT8A 1S40A 3I2ZA 1VQEA 2K5VA 3TREA 3S1NH 2PQAB 4DV2Q 2F3IA 1SMXA 3OW2A 4A3KH 1XMOQ 2R7FA 1CKMA 4JI2Q 4LFAQ 2K4KA 5C0XJ 3PF5A 1EWIA 4A3LG 3G48A 1PVOA 5HY6A 5LMUQ 2LSSA 2XGTA 3S16H 2H5XA 1YHBA 3ICEA 1HNWL 1KAWA 2OCEA 5C4JH 3I4MH 1DGSA 3G71A 3RLNA 1Z9FA 4KLKA 1GD7A 3PV0A 1BVSA 1NMGA 2ZJQA 1PH5A 2UUAQ 4YY3L 4R1JA 4YWKA 4IFDG 1E3PA 3CPFA 4IO9A 3T1YL 2NVXH 3PUYA 1FVIA 4BBSG 1X56A 4YCUA 1SRUA 3NENA 1Q12A 4JI8Q 2HT1A 1D8LA 1NTGA 4POGA 3GTQH 4OXPA 2CWAA 4IPCA 4LF5L 1UEBA 1Z47A 1VQ9A 2R6GA 3FKIG 1QZGA 4GS3A 5E7NA 1VS0A 1N33L 4R4QA 3PIOA 2ZM6L 4LF7Q 2Q2UA 3S1MH 5GAEC 2MFIA 3CPWA 4QL5A 4AH6A 5HGQA 1X55A 3S24A 1PH2A 2UXBQ 3RZOH 3HOVG 5AJ3Q 3U4VA 3G6EA 3RLOA 1HNXQ 2V1CC 3TQYA 4A3GH 1YI2A 1N34L 1Q8KA 3GTLH 2ALYB 4AYBE 5GQOA 2PNHA 2VS1A 1I3QH 5ELOA 4RG1A 4K0KQ 3D31A 2B29A 4DV4Q 3M7NA 3ULPA 4YHHQ 3HOYH 2IX1A 4EX5A 4HIOA 4X6AH 5DLQE 4K0KL 3BZCA 4GOPC 1IL2A 5M3MH 1Q7YC 4DKAC 4JI4L 5IYBH 4DR6Q 2K5HA 1Q81C 3S1QH 1VQ6A 3K80C 2NVTH 1E1TA 1HNXL 3KDFB 2WAQG 3GTJH 2UXCL 4DR1L 2WFWA 2VQEQ 3U4ZA 2VY3A 1T9HA 4EQ5A 1S72A 1NMFA 2KBNA 3H3VI 2Z6KA 4JI7Q 1PYBA 1E1OA 1XTDA 2ZTCA 2RCNA 4A3FG 4X64L 3K81C 2JEAI 4PG3A 3HOWH 1TWCH 4APVA 5IYDH 3TEHB 1VQ4A 1K3RA 5AJ3L 3KF6B 3J80i 5IP9H 5GADC 4DV7Q 3PUVA 2OWOA 4GN3B 3HOXH 2Y0SG 1L2FA 2C35B 2WAQE 2XTIA 1FL0A 1OXTA 3OYYA 1HZBA 2WB1E 2HHHQ 3L0OA 2B3GA 4X66Q 3HOZG 2AMCB 4OX9L 1YJWA 4JI0Q 3S2HH 2R93H 1AH9A 4UP7A 2VQEL 1BBWA 1CSPA 4C3HH 4DV6Q 2BH2A 4DR1Q 5C0XG 1XPUA 4GN4B 3CF5A 2HQLA 1M1KC 4BY1H 4IFDI 2ZM6Q 1L0WA 4LF9L 3H0GG 3J7ZC 4NB3A 1EQQA 2R93G 1V1QA 4JYAL 1X54A 4OWWB 3CQZH 3TS0A 4DR6L 3I4MG 5JJIA 2N8NA 4GOPB 3K7UC 1GVPA 1OXXK 2JA5G 1W2BA 3T1HL 1IZ6A 1RL2A 3AFPA 3W1BA 3JAMi 3CP0A 1TWGH 1VQDA 1JE5A 2FXQA 4A3CG 1Y1WH 4MZ9A 4TQUS 2RHSB 5GAHC 1K73C 4TVAB 2YU9H 1P16A 3MXNB 3PGZA 1P8LA 5GROA 3U58A 4R4IA 3RZDH 2K75A 2ASBA 3J7A5 1TXYA 3S1RH 1KD1C 1E7ZA 4JI5Q 2ZJRA 3M85A 3BU2A 2E2JH 3F1ZA 4DV7L 1QUQA 3KJOA 3I4OA 2QA4A 2NN6G 1JB7A 4A3MG 4JI1Q 5FLMH 4YY3Q 4O2DA 1XJVA 4LUZA 2K14A 3A74A 3HKZG 2UUAL 4UP8A 3CD6A 1YHAA 3GTPH 1XMOL 1VQIA 3J81c 4BY7G 1G291 4GN5A 4IPDA 2UUCQ 3HOZH 1EQRA 1B7YB 3KFUA 1U5KA 4A3LH 4IJLA 3NBHB 4BBRH 1K83H 5LMUL 4DV6L 1CSQA 1G6PA 1JJGA 4DV3L 1FJGQ 1X9NA 2DGYA 1KQSA 1YJ9A 3NELA 2GVAA 2JK8A 1XPOA 1QVGA 1KIXA 3CC4A 4BXXH 4A3DH 4R4CA 4R4TA 1RIPA 3EBEA 4JBKA 4GKJQ 1GM5A 1IYJB 4WJ4A 1V43A 3RR5A 1B8AA 4WJ3M 2ES2A 4DAMA 1YZ6A 1UE1A 3A0JA 1NY4A 4IPGA 2AWOA 5M3MG 1Y1VH 2WP8J 4GOPA 1TWAH 2JA9A 4A3FH 1WI5A 1VQMA 4OONA 4X62Q 3S14H 1ASYA 4KHPQ 3UE1A 2PI2A 4BXXG 4DPGA 4LW1A 1PH3A 2UXDQ 5GAGC 4B3TL 3S17H 1K8GA 3J81j 2IT1A 3I7FA 4H02A 3CCVA 3HKSA 2IHFA 1EOVA 4YHHL 3PO3G 1VQAA 5IWAL 1PV4A 1UWVA 4DR4L 4JI3L 2A19A 2NZHA 1AE2A 2D0OA 4POFA 1KC8C 2UXBL 1EIFA 2KCMA 2UU9L 3M9BA 4NXNQ 4JBWA 4JBMA 4GKKL 5FLMG 1YVCA 1JJCB 4QJFA 5BR8L 1JJ2A 2IY5B 4YCVA 1G51A 3RN2A 3FKIH 4DUZQ 4B3SL 3M4OH 1PHJA 2UUCL 4IFDJ 3CW2C 3W1GA 4QQBX 4OX9Q 4JI7L 1IBLL 2F4VQ 2NN6I 1I94Q 2CQOA 1OXUA 4LWCA 4PZ7A 4OWXB 3UDIA 2ZTDA 2JQOA 1VQPA 4A3JG 2E2IH 1XMQQ 2EXDA 2R7DA 5FLXc 3CMAA 4DR2L 1C7YA 1KXLA 1VQ7A 3ULJA 4GLVB 3FP9A 4JC0A 4P71A 1X3FA 1YNXA 4JBJA 5M5WH 5C44H 3E9IA 1QUQB 3GTOH 2HIXA 4DK3C 5FJ8H 4MTNA 4IOCA 4BBSH 4A93G 4DR5Q 2AWNA 4B3TQ 3AYHB 3PUZA 2CFMA 4B3MQ 1SE8A 1Y14B 4A75A 2A1AA 5C4XG 1UE6A 2D0PA 4C2MH 1YIJA 4IOAA 2I5MX 2GN5A 1HJPA 4JCVE 2E5LL 1XMQL 4AQYQ 4JG2A 1EUJA 4UY8C 4C3IH 3L2PA 4DR3L 1MIUA 2YTVA 1LM0A 1E24A 5K36G 3F8TA 3PIPA 5IYCG 2GVBA 5J3BA 1OXVA 2LXJA 2ZTEA 1X3EA 2MNAA 4DV5Q 2UUBQ 3RN5A 2R92H 1A63A 3F2DA 4A3BH 2ATWA 4L5RC 4LF5Q 3H3VH 4DV0L 1Q82C 3EN2A 2VQFQ 1YHQA 4RMFA 1NBWA 4P75A 1IBML 1GKHA 3DM3A 2QGQA 1M90C 1VCIA 2IX0A 2BA0A 1PH7A 1CKNA 5LMNQ 3B6YA 4HIDA 4LF6Q 4AQYL 1XNRQ 2N3SA 2KENA 1VQOA 2CWPA 4A3IG 2OQKA 3UDXA 3I56A 4LFCL 3F2BA 4LF8Q 4NXMQ 2OTLA 2B63G 3IRBA 3NEMA 1XNQL 4JOIC 4A93H 1L1OC 4DV2L 1PH6A 4DV4L 4PZ6A 3CCEA 4B3ML 3KF8B 3LGJA 1H95A 1YBYA 2K50A 2I5LX 2PMZE 3K0XA 5JEAJ 4NPSA 4LFAL 4JI6Q 3KF6A 4JI4Q 1B70B 1VQHA 3JC66 3I55A 1Y1WG 2Q2HA 4LF4Q 4LF9Q 3S15H 1HZAA 4BA1I 5M3FH 3ZJYC 1YITA 2JA6G 1WCMG 3AFQA 1HH2P 1W3SA 2VUMH 1WOCA 4LFCQ 4BA2I 4XTCS 4LF8L 1QVFA 3TS2A 4DV1L 2HHHL 1XPRA 1VQKA 2OTJA 4DV5L 2UUBL 1X3GA 4HJ5A 1BBUA 1QVCA 1QZHA 2PI2E 5C44G 4HJ9A 3PUXA 1Q46A 1YEZA 3CCQA 4L5QA 3J80c 4JI8L 4B3RL 1J5EL 3UDFA 3E0EA 3CC2A 3PF4A 2VL6A 1NJIC 4A3JH 1VQ8A 4BY7H 2JA5H 5IT9c 3MEFA 3UE0A 4JYAQ 3ER0A 3K7AH 2UU9Q 2NZOA 4NXML 4A4IA 3BJUA 2KCTA 3PUWA 2AKWB 1I5FA 5IP7H 3TRZA 1SR3A 1N9WA 1Q1BA 1C9OA 5C3EG 1A62A 3CC7A 2A8VA 4DAYB 3HKZE 2OQ0A 2JE6I 3HOUH 4JI0L 1BKBA 2EQSA 3HFZB 3PCOB 3ERSX 5JEAG 2EIFA 3HOWG 3RLFA 2NVYH 1E22A 1UE7A 4L5SA 1N32Q 1I50H 3M4PA 2MQHA 2D62A 5M5XH 3AQQA 3GDEA 1WJJA 2Z0SA 5C3EH 1I94L 3HOXG 3Q8DA 5LMNL 4JI6L 1IBKL 1N32L 4HJ7A 4DV3Q 1FJGL 2R7ZH 2QEXA 1CKNB 2Q2IA 1PYSB 2N49A 4OWTB 3A5UA 1GO3E 4DR7Q 3T1HQ 1PH9A 2JEBI 3CCUA 2LXKA 4X65Q 5EAYA 4BY1G 1SN8A 4DV1Q 3CCRA 2MO1A 4YWLA 4QIWE 4LUOA 4DR5L 4A3GG 2YTXA 1KL9A 1VQLA 4OO1I 2UXCQ 2HIVA 3SGIA 1SROA 4B3RQ 1SLJA 1LTLA 4LUVA 1HNZL 4LNQA 2B63H 4OO1G 2K5NA 1J5EQ 5IE8A 3CCMA 4DV0Q 1U0LA 1C0AA 2BA1A 3PO2G 4A3CH 1MJCA 1VQBA 2E5LQ 4QGUA 1TWHH 1Q86C 2JA7G 1MKHA 2YYZA 3OTOL 4J15A 4GLXA 2RHQB 2K52A 1SFOH 3G4SA 4UPAA 1I6HH 1UE5A 3H0GH 4AYBG 3KJPA 4A76A 3PO2H 4QY7A 3WWVA 3OTOQ 4L5TA 5BR8Q 3E9HA 4R4OA 3HOVH 1VQGA 3KDFA 4KI0A 3T1YQ 2PQAA 4JOIA 4P74A 3CXCA 4A3MH 3PO3H 1KHIA 1PH4A 1WYDA 1AE3A 4DNIA 3CCLA 5ELNA 5JJKA 5FJ8G 2VNUD 4DR7L 1LUZA 2R7ZG 4DUYQ 1N33Q 3GO5A
chains in the Genus database with same CATH superfamily
2XWJB 3OIPA 2QDLA 1KTKA 2UXDL 5K5PA 3MTSA 4N9PA 1KDCA 3FMCA 4JI1L 1JC7A 1EY9A 1YNJD 2MUYA 1HZ9A 2ZT9C 2A69C 3BZKA 3FRPB 5IY0A 1PH1A 1G2TA 2J4XA 4QUFA 2CKZB 2WKCA 2N78A 2ENBA 1A8VA 3KYHC 1CKOA 2ID0A 2DN8A 1L1OB 1K0RA 1WFQA 1ZYRD 4HMJA 3ITPA 3NWSA 4FO2A 4DUZL 3ZYYX 5C0XI 5LMNW 4H44C 4I7ZC 5T1GA 1D7QA 2A6HD 2V4DA 1F9RA 1H9SA 2VZAA 2VW9A 5IT9E 1H9SB 1QILA 1O7IA 3KOJA 4JI5L 2Z4IA 4LFBQ 3NBIA 1Q1EA 2EY1A 4KHZA 1WCMH 1GUGA 1E2WA 3A8KE 1VQCA 2R92G 2JA8G 4A3BG 2YTYA 1R9TH 2L55A 2OT2A 2PW7A 2VUMG 4ZKBB 1L1OA 2I46A 4QIWB 3OWFA 2DUDA 2G9DA 2N88A 4AIMA 2JA8H 2K04A 4LFBL 1V9PA 3HOZB 4K5XA 2Y0SE 4HMIA 1KRTA 3MZ5A 1RHPA 1TWFH 2IHEA 5IIFA 1X65A 3TP7A 2QKIC 1CT1D 5M3MB 2NB0A 1IXRA 4GNXA 4A3EG 2F03A 3STBC 1STBA 2JA7B 2B2UC 1VQNA 3AEVA 2EOTA 5CBEE 4UP9A 1A0IA 4HTHA 5IYCH 1EYGA 5IP9G 4ULLA 2BOSA 3GV6A 3MWYW 1HR0L 2JA6H 1ICFB 3I73A 1L0XB 4RGMA 5EKKA 1S40A 1HTLD 2L1BA 3I2ZA 1KDBA 1LT6D 2F4IA 1M4VA 2PQAB 3DUZA 2H4OA 4C3HG 4LFAQ 2K4KA 2NUCA 3GTKB 4A3LG 3G6JB 3A54A 5HY6A 4C3JB 5LMUQ 4IFDH 1HNWL 1KAWA 2OCEA 3I4MH 3G71A 2VUMB 3NQTA 3RLNA 1Z9FA 5C6AA 1UUPA 1BVSA 4YY3L 4R1JA 4IFDG 5C0XH 3K7AB 3CPFA 3T1YL 2NVXH 5JAVA 2HT1A 1KLGD 2PZWA 2HDMA 5I9OA 3GTQH 1PFNA 1UEBA 1VQ9A 4GS3A 5E7NA 2ZM6L 2MFIA 4DA2A 5BN4A 1A3VA 1ONLA 3G6EA 2VB2X 1HNXQ 1F9QA 3TQYA 1XTCD 3GTLH 2ALYB 1D5XC 2PNHA 1SNCA 5ELOA 1E0BA 4K0KQ 2B29A 4DV4Q 4HIOA 1STEA 4XT1B 3D6CA 1IL2A 2R92B 3R3OA 4JI4L 4A3BB 4G7HC 3S1QH 1VQ6A 2F0NA 5CYUA 1E1TA 1HNXL 2WAQG 3I90A 2WFWA 1S72A 3UI2A 1GUWA 2RCNA 1K83B 1I4RA 4IN3A 5IYDH 1H9MA 1K3RA 4DFAA 4MHEA 2K01A 4KKUA 1L2FA 2C35B 1S5BD 1HZBA 2WB1E 4LJZC 1DYQA 3S2HH 1YJWA 4UP7A 5JVH3 5C4JB 4DV6Q 2BE5C 1XPUA 1KNAA 4IFDI 2ZM6Q 1F9PA 4QF4A 3J7ZC 4NB3A 1B4OA 3TS0A 1EY5A 4DR6L 2JA5G 4JW0A 4CHTB 3T1HL 1Y1WB 3JAMi 3W1BA 1GUSA 3AFPA 2EYJA 1RDPD 1ENFA 1QNUA 1O7ZA 1V8QA 1X3QA 2PQEA 4B08A 4HN7A 1Y1WH 4MZ9A 4TVAB 3URYA 5GROA 3X3MA 4A3JB 3RZDH 4RKBA 3J7A5 3QO2A 4JI5Q 2E2JH 1DJRD 3I4OA 2QA4A 2XSCA 1JB7A 2E76C 3NUCA 4A3MG 4JI1Q 5FLXL 1XJVA 1K8OA 1A3UA 4BY7G 2B2TA 2G9HD 1SYEA 2F0JA 1V1OA 3T13A 1U5KA 1RCVD 5IOCA 1SYGA 4DV3L 4XYQA 1E2VA 3VYSA 3CC4A 3VA7A 4A3DH 3M3YB 4R4TA 4JBKA 2AQ3B 4G57A 1IYJB 1V43A 4WJ3M 1B8AA 2RDHA 4DAMA 1YZ6A 3PO2B 3A0JA 1NY4A 2AWOA 1F2LA 1SFOB 4OONA 4X62Q 3S14H 1B44D 4LW1A 2UXDQ 5GAGC 2B2UA 4U673 4K6LA 1LTBD 3PO3G 1VQAA 2Q8RE 5IWAL 2EY6A 4HAEA 1AE2A 1KC8C 2UXBL 1EIFA 3VR6A 2VXWA 3M9BA 1RJTA 3BYTB 4NXNQ 4JBMA 1A15A 3A56A 3HG9A 4GKKL 1TIID 5D3IB 1JJ2A 3S1NB 4A3FB 2F0OA 5ELCA 4DUZQ 2UUCL 1OXUA 4OWXB 1VQPA 5I4DA 1O80A 1G2SA 2R7DA 4HCSA 1C7YA 4H13C 1VQ7A 2XNAC 1U9RA 3V96A 4B9WA 1CI3M 4JBJA 4MN3A 3E9IA 1B3AA 2HIXA 1NR2A 4IUQA 1TKWB 5FO8B 4IOCA 1GXDC 1BXTA 3AYHB 1ZXTA 2LKVA 2A1AA 1UE6A 2I5MX 5IGFA 2GN5A 3NP8A 2KQ3A 3NTKA 3R93A 2F0VA 4DR3L 2YTVA 2PPBC 2F1MA 1CHQD 2GVBA 3TN2A 3S1QB 5IGGA 2R7ZB 2ATWA 2F0SA 2VQFQ 4EGVA 4RMFA 1NBWA 4P75A 5ELFA 4NKLA 1ENAA 2QGQA 1M90C 4ZUIA 1ILPA 2JYOA 3T56B 3MHBA 3J80E 2PMZB 2RCFA 1I3QB 1W6KA 4AQYL 1XNRQ 2KENA 2CWPA 4KMUC 3K57A 3F2BA 2OTLA 2HD3A 3IRBA 3IFTA 3EROA 4A93H 5J39A 1SNMA 1VF5C 4PZ6A 2K50A 1CZWA 4NW2A 5EKIA 3KF6A 3NK9A 1F9SA 1PZJD 2KEDA 1B70B 3JC66 1EQTA 2Q2HA 4LF9Q 4C3HB 3PMFA 4BA1I 5NUCA 4FF4A 2RDFA 4XTCS 4M8AA 3TS2A 4DV1L 2PW5A 2FHTA 1R4PB 4DV5L 1BBUA 1STYA 1QZHA 2PI2E 1AZQA 4DF7A 4LK1C 5CMDA 1NJIC 4A3JH 2EY5A 1VQ8A 2JA5H 1LLRD 4TSSA 4JYAQ 3DXJC 2RA4A 3DMUA 4NXML 4FVMA 3BJUA 2KCTA 2KJXA 2QF7A 1Q1BA 1C9OA 3CC7A 1PDQA 4DAYB 1G91A 2OQ0A 3HOUH 3I4MB 2CH4A 3HOWG 1HUMA 4R9WA 1E22A 1UE7A 3RMHA 4L5SA 1I50H 4RGOS 5KNBA 3AQQA 3K5LA 1MI2A 4HJ7A 4DV3Q 1EEID 2QEXA 3T1HQ 1IL8A 1PH9A 1DD2A 2LXKA 1CM9A 4X65Q 2KCNA 3GTPB 4DV1Q 1ENCA 4DR5L 4QIWE 4A3GG 1KL9A 4CJ2C 2UXCQ 3RUZA 5D14A 4H7BA 1LTLA 4LUVA 2B2VC 4LMQD 5ELEA 1X32A 2IPKD 4KD4A 1C0AA 3KLSA 1VQBA 1I4XA 2QILA 1EZ6A 4J15A 3OTOL 4A3GB 4J6HA 1PTOC 5KNDA 1LTGD 3PO3H 1KHIA 1AE3A 4DNIA 3CCLA 2PZUA 4CDCC 1VMCA 4DUYQ 3GO5A 3DLLA 3SEBA 1EY7A 1N36L 3SK6A 5C4XH 3GTGH 2BH8A 1HZCA 4A3KG 3K5MA 4IURA 4GNXB 1MJEA 4JI3Q 4OIKA 4HIMA 1IBMQ 1VQJA 2WACA 3HOVB 1EEFD 1OO9B 3CAMA 1X6OA 2F4VL 4K14A 4AYBB 3K8AA 3KBXA 4X65L 1PFSA 1UAPA 2EJFC 2OXPA 4IJHA 2EDGA 5M9OA 1XYIA 4KHPL 4A3IH 2Z6KC 4B3SQ 4HJ8A 4HIKA 1WTHA 4DNTB 2E8GA 2B8FA 1HFNA 1PTOB 3C3LA 4ME3A 1LACA 4B9XA 3CCJA 3W5OA 1WTPA 2K1BA 4LAAA 3HP3A 5IGBA 1N36Q 1JCKB 3D0FA 1VQFA 3JAML 3I4NH 4IALA 3MVVA 1EL0A 3Q6SA 4NDXA 4FDBA 2JJQA 4HSPA 1ML0D 2YV5A 3RZOB 1YJNA 2AHOB 5DEHA 1O7LA 4TKOB 3I4NG 4Q0FA 4DR2Q 5M5YH 2SNSA 1BCPF 4Y52H 3M4YA 3R8BA 2JA7H 4HJAA 1S3OA 2A6HC 3MC0B 1EU3A 1H9RA 2L15A 1S5ED 5E4XA 3FHWA 1R4QB 2FINB 2HCCA 4Q5VA 1J6QA 2DY7A 2LFNA 4DNRB 5I9PA 4OEMB 2K05A 3U50C 4KJOA 1VQ5A 1EU4A 4DR3Q 4R8IA 3K59A 3MXGA 2XWBB 4X3SA 1N8RC 1PA6A 2IJ0A 3FKIB 4QB4A 4RHRA 3M4OB 3ERQA 3S1NH 2L12A 2NVXB 1HTPA 3S9WA 2F3IA 3OW2A 2B2WC 4JI2Q 3FPPA 1HQRD 1I4HA 1PVOA 4ZK9B 2XGTA 3S16H 2WKDA 2FJ2A 2WV6D 3T4AC 1DGSA 1PXUA 3VR4A 3QR8A 2ZJQA 3R2TA 1PH5A 2UUAQ 1RKNA 2CW0D 3SHLA 3GTGB 1E3PA 2RDGA 1SE4A 3DEOA 1NNXA 3NENA 4POGA 2CWAA 3NXWA 3FKIG 4N9TA 1JWUD 1VS0A 1N33L 1JORA 3Q23A 4LF7Q 3I3CA 5LHY1 3K5OA 1CA6A 4QL5A 5HGQA 2UXBQ 1X55A 5FOBB 1L0YB 1Y1VB 5AJ3Q 5I2XA 4DXFA 2V1CC 4A3GH 4CDEC 1I3QH 2F0PA 3LWEA 2RSNA 3HOYH 1E2ZA 1EQVA 4K0KL 4GOPC 5M3MH 1F2YA 1Q81C 3VA5A 1U4LA 2NVTH 3KDFB 3GTJH 2VQEQ 1F2ZA 3U4ZA 3A7LA 2VY3A 4EQ5A 2KBNA 2X69A 2Z6KA 1PYBA 2TSSA 2ZTCA 3K81C 5IGEA 2JEAI 3OPOA 5BN3A 5AJ3L 3KF6B 5IP9H 4DV7Q 2F3VA 1Z6HA 2OWOA 2R93B 1STNA 1G8ZD 4GN3B 3HOXH 4ZCKA 3OYYA 4NP5A 2HHHQ 2JA5B 2R93H 3P7JA 2VQEL 1BBWA 1CSPA 4C3HH 2BH2A 1JWSD 3TBIB 2VUMH 3CF5A 2F0TA 4KN7C 5J22A 1EQQA 2R93G 1V1QA 3CQZH 3I4MG 1V1PA 3K7UC 4RWSC 3BVMA 3H6MA 4GOPB 2X6GA 4I65A 2TMPA 1TY2A 2C5CA 3BG3A 1SE2A 1JE5A 3A8JE 3HGBA 5GAHC 2XRQD 1XXGA 5CV9A 3TP8A 4R8NA 1HUNA 5DM73 1P8LA 5JVG3 1DXMA 4X3TA 3U58A 2ASBA 1KD1C 2XVSA 5KYIA 4IUNA 4IUVA 3GTQB 2XIWA 1TT2A 2QCPX 3KJOA 3HOUB 5KRUA 1GUOA 5FLMH 5EPKA 2K14A 3HKZG 2UUAL 3C2PA 4UP8A 2EJGC 1YHAA 1CA5A 3CD6A 3GTPH 3BDCA 4V0BA 1J9OA 3SK5A 1EQRA 2Q8IB 4A3LH 3TMEA 4F87A 4BBRH 4DV6L 4OL7A 2NBFA 3VR3A 1JJGA 3PQIA 1C8CA 3VYUA 1ZKOA 3NELA 1QVGA 1B50A 4R4CA 1RIPA 1GM5A 1EOTA 1BO0A 5CORA 1BOSA 1SNPA 1V1PB 4GOPA 1Y1VH 4A3FH 3KF8A 2AUJD 1ASYA 4B3TL 1A3TA 1K8GA 2IT1A 1YNNC 3I7FA 3HKSA 4K6DA 2IHFA 1DOMA 1QB5D 4YHHL 1FR3A 2SDFA 4JVZA 1UEAB 2D0OA 1STAA 2KCMA 2N55A 4CKCA 4JBWA 2NVQB 1Y69U 3I8ZA 1JJCB 4QJFA 4F88A 5G3LD 3RN2A 3CW2C 3W1GA 1JE4A 2VB3X 2NN6I 1I94Q 2F0LA 4PZ7A 3UDIA 2BCOA 3HOVH 5G3LF 3W2DA 3OIQA 1KXLA 4DAPA 3CMAA 3KLSX 3ULJA 1PYWD 4GLVB 3FP9A 4PMBA 4P71A 1EFID 2EYMA 2HDLA 3GTOH 3H3VC 2QDBA 4X3UA 4HEDA 5FJ8H 4MTNA 3EA6A 4DR5Q 2J0TD 3PUZA 3GTOB 2EVBA 1QG7A 1VDZA 1KNEA 4A75A 1TR5A 2BDOA 5FK9C 4IOAA 3S1RB 1PRTB 3VYTA 4EVOA 2E5LL 1HXYD 3MXPA 4JK1C 2KOLA 3E0JA 1NAPA 4JG2A 1GHJA 5KIXA 4KV6A 1LM0A 5K36G 3H0GB 4KY6A 2ZTEA 1X3EA 4DV5Q 3FVQA 3G7LA 4OO1H 4DAVA 4L5RC 5K36H 3MFYA 4DV0L 1NUCA 1YHQA 4RAUC 4KHVA 2E74C 4RH6A 3DM3A 1LTSD 1VCIA 2BA0A 1CKNA 5LMNQ 3B6YA 4C56C 4HIDA 1NSNS 1BNZA 4LF8Q 2OQKA 3I56A 4LFCL 1K3BC 1M8AA 3NEMA 2M9VA 4JOIC 1D1KA 4DV2L 1JR0D 1C48A 4DV4L 4B3ML 2B2TC 3KF8B 4DAYA 2I5LX 3K0XA 4NPSA 4G7OC 4F8MA 4IZ8A 5COYA 3I55A 2BE5D 3J7AV 3S15H 1YITA 1W3SA 2IL8A 2C9OA 4IUTA 1WOCA 4BA2I 2ZXOA 1QVFA 2HHHL 3CU7A 4HJ5A 5C44G 3BS1A 2EYOA 3PUXA 2NN6H 1QOHA 1YEZA 3TP6A 3CCQA 3J80c 4HJ9A 4JI8L 4RCNA 2Y0SB 2EYPA 1ET9A 4BWGB 3UDFA 3E0EA 3PF4A 2VL6A 3EQLC 4PNYA 1EIGA 3K7AH 4A4IA 4A3KB 1JICA 2AKWB 2QW7A 1RODA 2HQEA 1TWGB 1A62A 1RD9D 3OMGA 5JEAG 2KEEA 2LMCB 5C3XA 3M4PA 2MQHA 3GQBA 3Q8DA 4JI6L 2K5DA 1SYBA 1IBKL 1N32L 1JOOA 1FJGL 3QB3A 4IQZA 2F0HA 5FLXE 1PYSB 3I70A 2JEBI 5EAYA 3CCRA 2F0KA 2MO1A 3Q22A 1VQLA 4OO1I 4F7XA 4LNQA 3K5NA 1EYDA 2FMMA 1J5EQ 3HOYB 1Y8OB 1TS5A 4UDUC 2D5DA 1MJCA 1Q86C 1R9TB 1CQVA 3AMUA 4U68A 1TWFB 1JOKA 2K52A 4UPAA 2SEBD 1UE5A 1LTRD 3H0GH 2NVTB 2L11A 3WWVA 3OTOQ 1Q90A 3I4NB 5C4ZA 4A3MH 4BY7B 1PH4A 5ELNA 2ICIA 1DM0B 2VNUD 4DR7L 2F0IA 3DWPA 1N33Q 1SJHD 1FNWA 1HR0W 1FD7D 5KYLA 1ESRA 2ZXRA 4C3JG 4DUYL 3E3XA 2A68C 1ASZA 1OTCA 5JPNC 3HS0C 4A3DG 3DM1A 4RGTA 1CUKA 5HURA 2F0DA 2IX3A 2EJMA 4C3JH 2L0CA 2E2IB 1IBLQ 1PTOH 3X3NA 4V190 3IL8A 2KVMA 4IUPA 3J7AF 3STBD 4ALPA 2MO0A 1HA5A 5AFWA 4JV5Q 2HUGA 4XIGS 5JJLA 3HOUG 1TY0A 1OXSC 4FF2A 2E2JB 2F52A 4MNOA 3KLWA 3J7YW 3BDOA 3PIO3 1T5XD 1I4GA 4FP5D 4CJ1B 3WOEA 4O0AA 5EBCA 5TSSA 3FEWX 1BCPD 2KHIA 3M4QA 3RNUA 4GNXC 1PZKD 1CTMA 4FF1A 4GLAC 3M3YH 2X6LA 4A3DB 1VMPA 2I5HA 4P73A 5CBAE 2PCFB 1I4PA 2ZJPA 2WB1G 1H9KA 1YNJC 1HNWQ 5IYBG 1STGA 5JPMC 5FO7B 4GKKQ 4X3KA 1XNRL 3HOYG 1KAAA 1TQOA 3DWQA 3VDYA 5H1SE 3CMEA 1PTOF 1EFWA 1SYCA 4BY1B 1ICWA 1Z7TA 4X64Q 1GJXA 5J1ZA 4EQPA 3EJIA 3PO3B 3AB9A 1PFMA 5EPLA 1JT8A 4Z9CB 2KUMA 1BDOA 2K5VA 1A2TA 1SBBB 1SMYD 4DV2Q 4A3KH 1XMOQ 1SMXA 5C0XJ 1LTID 1IKLA 2M2LA 3MXUA 1EWIA 5A2QE 3SR1A 2LSSA 1Q8IA 3U9OA 3ICEA 1YHBA 1BCPB 1X3PA 1D5MC 1TS3A 4YWKA 1T5EA 4J8QA 4IO9A 2DNEA 3PUYA 4ZQ3A 4BBSG 1LT4D 1X56A 1SRUA 1Q12A 4PV1C 5CV7A 5KNCA 1NTGA 3EFXD 3VR5A 1MGSA 4IPCA 4KY5A 1A6XA 5C3EB 2R6GA 1QZGA 2AQ1B 4R4QA 2MJ8A 4P2CB 5GAEC 4WRDA 3OHXC 3QJYA 3S24A 3T53B 3N6RA 3RZOH 4IUUA 5IODA 1D2BA 3U4VA 1GHKA 3RLOA 1PZID 4RGNA 1YI2A 1N34L 1Q8KA 4G4KA 4AYBE 5LL6X 1ET6A 1JWMD 2VS1A 3D31A 5CV8A 3M7NA 2A5HA 4YHHQ 2IX1A 4EX5A 4X6AH 4OELB 5DLQE 4DR6Q 2K5HA 3HOXB 3K80C 3L9AX 2L5TA 4DK1A 2K33A 1AFPA 3S15B 2FFKB 5A35A 3H3VI 5CGKA 4JI7Q 2D9UA 1E1OA 1PTOD 1XTDA 2O2LD 4A3FG 1TU2B 4K5VA 4PG3A 1TWCH 2Z1CA 3TEHB 1VQ4A 1WD1A 1PRTC 4KK7A 2CHBD 1RTOA 1S5CD 2Y0SG 3P1HA 2WAQE 2XTIA 1FL0A 5EQ0A 3HOZG 3K0YA 1AH9A 2AMCB 4OX9L 2Z9HA 1B9NA 3D6WA 3V2TA 2DJGC 1WTRA 1DOLA 2Z8LA 4DR1Q 2HQLA 4BY1H 2SOBA 3J81L 4LF9L 4ODGA 1JB3A 2K6AA 4OWWB 3K58A 2OEOA 1OXXK 1UNSA 1HHVA 3KUPA 1H9JA 3LX0A 1TWGH 4A3CG 3BDLA 4FXKC 2RHSB 3D8GA 2YU9H 1MBYA 3MXNB 3PGZA 4CBVA 4M1UB 1F2MA 3QG1A 4R4IA 2DY8A 1TXYA 1E7ZA 5CV4A 3S2DB 3F1ZA 4EQOA 2G5DA 4O2DA 3BVGA 3J81c 1G291 2L9HA 4GN5A 2EXZA 1B9MA 2MGSA 3NBHB 1II3A 3HOWB 1CSQA 1LTTD 5JJZA 1HA6A 2D2CC 2F0UA 1KLUD 3E6ZX 2K5WA 1SYDA 2JK8A 4FNFA 4BXXH 3BVZA 4WJ4A 5IGCA 4GKJQ 1LT5D 3RR5A 3GTJB 5M3MG 2JA9A 1WI5A 4KHPQ 1HRJA 2J7ZA 2PI2A 3UE1A 4DPGA 4BXXG 1PH3A 5C4XB 3AU7A 3S17H 5E4WC 1BQQT 4H02A 3Q0AA 2E2HB 4DR4L 1TS4A 2NZHA 4HSVA 1K0SA 5I6YA 3S2HB 3H09A 3FDTA 5ELBA 5LL6S 5FLMG 1LT3D 1YVCA 5BR8L 2RKSA 2IY5B 3BZDB 2MP1A 2AQ2B 1F77A 4YCVA 1G51A 1PHJA 4OHJA 2A68D 5DNFA 4IFDJ 1AW7A 5ISRA 2A73B 2CW0C 1IBLL 5I2YA 2CQOA 4LWCA 1CFMA 2E2IH 1U4PA 4FYDA 4YIJA 1S5DD 2EXDA 1A2UA 4DR2L 5ELDA 4L6TB 1IYUA 1X3FA 5M5WH 5C44H 1VF7A 3OWEB 4BBSH 5C44B 4B3TQ 1SNDA 1MD2D 4KN4C 4B3MQ 3C1EA 4K8IA 1SE8A 3RD4A 1Y14B 5C4XG 4JCVE 4DGZA 1LTAD 1EYAA 1ESFA 3CRLC 5IT9L 1AZPA 4UY8C 4C3IH 4A3EB 1E24A 3F8TA 3PIPA 1B1ZA 4PMCA 4XYOA 1EIHA 5IYCG 5JOBA 2LXJA 3CKIB 3SVMA 2UUBQ 2JP1A 1WTVA 3S1MB 3F2DA 2RSOA 4FXGC 5DM63 3NQIA 5IGDA 3QOJA 4UAIA 3UDXA 4NXMQ 2ZXPA 4CDDC 4QMGA 3S14B 4O42A 1HPCA 4WORA 4GZYC 1XNQL 1WTXA 1L1OC 1PH6A 1EY8A 1H95A 4XQJA 1YBYA 2PMZE 3OSOA 2WAQB 3NTHA 3WOFA 4LFAL 4JI6Q 3KLRA 2F0FA 2E2DC 1Y1WG 3LNNA 4LF4Q 1B3QA 2WIIB 1HZAA 5M3FH 3ZJYC 2EY2A 1WCMG 2Z4HA 3AFQA 3I91A 3IAYA 1LO5D 1SYFA 4LF8L 1AEXA 1XPRA 4XDXA 1AN8A 2Q8TA 4MTKA 1J5EL 2B2YC 3CC2A 5KGUA 2B39A 4I7AA 5FO9B 4A3MB 4BY7H 3SK4A 5IT9c 3MFGA 1RF2D 3UE0A 2PYKA 1JOQA 3R2IA 3D4RA 1I5FA 3TRZA 1N9WA 5C3EG 2A8VA 5E3FA 3HKZE 1BKBA 3MEHA 3HFZB 1SXTA 3ERSX 4UHVA 2EIFA 2LS01 1SJED 1FGBD 1U4MA 3RLFA 2NVYH 3W3AA 1N32Q 2D62A 1QJOA 5M5XH 3GDEA 1WJJA 2Z0SA 5C3EH 2K7VA 3HOXG 2NVYB 2R7ZH 5C4HA 2ICEC 3NPPA 1HQMC 1CKNB 4OWTB 1EWCA 4ZYSA 1GO3E 3TZDA 1SAPA 3QWNA 1IW7C 2EYHA 3V05A 1SN8A 1PMRA 1QE6A 4YWLA 1WCMB 4LUOA 2YTXA 4OO1G 2B63H 2K5NA 4DV0Q 2BA1A 3PO2G 2P5ZX 1TWHH 2F0GA 1MKHA 1S4ZA 4K8JA 2PO4A 4GLXA 4ABNA 1I6HH 2EPBA 4AYBG 1S5FD 3PO2H 4QY7A 4FXDA 5BR8Q 1TWCB 4R4OA 1EWHA 1SEBD 3KDFA 3T1YQ 4JOIA 3MAQA 4P74A 2L4NA 1WYDA 3MXNA 5DAUA 4C1NI 2NTSA 2XRSD 5JJKA 2Z6BA 1LUZA 3NTIA 4OGQC 1SDFA 2F3WA 1CK1A 4MIUA 4BBRG 5EGTA 5A2QL 3CCSA 5CC4A 1EIYB 1O78A 4IPHA 1HNZQ 5IP7G 2O5IC 1J8IA 1I6VC 3CQZB 3S16B 4GKJL 1Y1VG 3IKJA 3GD7A 2A6ED 3GTKH 3JAMc 2RF4A 1B2TA 3F2CA 2YU9B 1EY0A 4LF6L 4JV5L 4JPBW 4X62L 4L8JA 4P72A 5F2DA 1FGUA 4H0LC 4X66L 3L7ZC 1DOKA 3OOCA 2NTTA 4A3EH 3PSIA 4ZUJA 1HCZA 2CH4W 4YWMA 4DK6C 3D4WA 5JEAH 3H15A 3OMCA 4C2MB 4BBRB 1JMCA 5L37A 2VQFL 4BS9A 2KHJA 1HR0Q 2MPMA 1IBKQ 2EYLA 3ULLA 1K9MC 5IYDG 1K8AC 3GTLB 1QNKA 1U4RA 3SK8A 3JAME 1N34Q 2O5JC 4YCWA 3S2DH 3TZUA 3HZXA 1XNQQ 1NE3A 4JI2L 2RVLA 2KCCA 2A69D 4DR4Q 2RQXA 3UDGA 2E2HH 4LF7L 4XQQA 4LF4L 4PMWA 4PZ8A 4NXNL 4ILWA 3EIVA 4Y7NH 2NVQH 4XXEA 4J1MA 4HCEA 1LYLA 2I0QA 1PH8A 3QIAA 5IWAQ 3J81i 1KRSA 1WTQA 2B63B 1BF4A 3GTMH 3NWTA 1B53A 2QEJC 4ZKCB 3A5ZB 2CCZA 2LY7A 1DONA 2FMCA 5M3FG 4KKTA 2Q2TA 2KECA 1FYCA 1VQEA 2M00A 1MHWC 3I4LA 3MA2B 3TREA 3DHQA 2R7FA 1CKMA 2JA6B 3PF5A 2NZ1D 2A6EC 3G48A 2H5XA 1GUNA 4OIJA 5C4JH 4KTAA 4KLKA 3PV0A 4KJNA 1NMGA 1LV9A 1SNOA 4RFBA 1YNND 3KBGA 1FVIA 1NCVA 4YCUA 4JI8Q 1D8LA 2JA8B 4OXPA 4LF5L 1Z47A 3D3RA 2AUKA 1PRTD 3PIOA 3S1MH 2Q2UA 3CPWA 4AH6A 1PH2A 2K03A 4EQNA 4CGYB 3HOVG 2CVRA 2K32A 3P20A 5EJWA 3P75A 5GQOA 4DXGA 4RG1A 4KY7A 3DWAA 3ULPA 2EE1A 1G6ZA 3H94A 3BZCA 4XT3B 1Q7YC 4DKAC 5IYBH 4KKSA 3F2UA 3J80L 3C46A 1IKMA 2UXCL 4DR1L 1KDAA 4QCLA 1T9HA 4CKEA 1LABA 1MSHA 1NMFA 3A55A 4K2KA 3T16A 2DNCA 1Y8PB 4RKLA 4ZAIA 4X64L 3HOWH 4APVA 3NSWA 5GADC 3J80i 1CZGA 3PUVA 3GP7A 4ZRZA 1HFGA 4Y7NB 1OXTA 2OF1A 3L0OA 2B3GA 1SSOA 2WINB 4X66Q 4JI0Q 3TDQA 2KHSA 5M3FB 5C0XG 3N52A 3NHHA 4GN4B 5C3WA 1M1KC 3BYYB 1L0WA 3H0GG 4JYAL 1X54A 2GA4B 5JJIA 2N8NA 3KK7A 1GVPA 1EY6A 3FPUB 4PQXA 1W2BA 1IYVA 1IZ6A 1RL2A 2R3ZA 3CP0A 1VQDA 2FXQA 2K5QA 4L63B 4TQUS 1K73C 3HRZC 1P16A 4WJWA 4C1NK 1Q3LA 2I07B 5C5LA 5M5XB 2K75A 3S1RH 3O13A 2ZJRA 3M85A 3BU2A 1WTWA 4RHSA 4DV7L 1C4QA 1QUQA 2NN6G 1PRTF 3T51B 4YY3Q 4LUZA 3A74A 3SXHA 3NE5B 3PIP3 1VQIA 1XMOL 5EKLA 1GOZA 5M5WB 5KEEA 4IPDA 2B2WA 2UUCQ 3KFUA 1B7YB 3HOZH 3J81E 5CR3A 4IJLA 1K83H 5LMUL 1G6PA 4C3IG 1EYCA 4ID6A 1BCPC 1FJGQ 1CHPD 3RZDB 1X9NA 2DGYA 1KQSA 1YJ9A 4XQNA 2GVAA 1XPOA 1KIXA 4ME5A 3EBEA 3VYRA 4G7ZC 3GTMB 1XWEA 2ES2A 1UE1A 4IPGA 4A93B 2WP8J 1TWAH 1I6HB 2H1EA 1VQMA 1STHA 4DK0A 2DJFC 3TSSA 4C3IB 3J81j 1TWHB 3CCVA 2JN4A 4WFN3 1EOVA 1TS2A 3HKZB 1PV4A 1UWVA 4JI3L 1ILQA 2A19A 1I4QA 1BUVT 4POFA 5C5MA 2UU9L 3A8IE 2IWHA 2B2YA 1QWYA 3SDZA 1SNQA 3FKIH 3WDNA 4B3SL 1K28A 3M4OH 1NR4A 4QQBX 1WD0A 4OX9Q 4JI7L 2F4VQ 2F0EA 2IW3A 2ZTDA 2JQOA 1XX8A 4K5WA 4K2LA 4A3JG 1I50B 1XMQQ 5FLXc 1KABA 1BBXC 3E5SA 4JC0A 1YNXA 4O1NA 2NYZD 1PFBA 1QUQB 3IFDA 3TP5A 5CV5A 4DK3C 1W6JA 2B2VA 2AWNA 4A93G 4TRDA 2CFMA 4RA8A 2D0PA 3QOLA 4C2MH 3SE0A 1YIJA 1HJPA 4FF3A 1XMQL 4AQYQ 1EUJA 3L2PA 2F0WA 4S3SA 1MIUA 3A7AB 1QCBD 4DN4M 4E6IA 2MHVA 4ZLTF 1MSGA 3M7GA 1WVLA 5J3BA 1OXVA 1A63A 2MNAA 3RN5A 2R92H 4A3BH 2A74C 2WB1B 4LF5Q 1ZEQX 1Q82C 3H3VH 3EN2A 2PNRC 4RCOA 2JSOA 1IBML 1GKHA 3I72A 2IX0A 3ONAB 4CDFC 1PH7A 2JXMB 4LF6Q 3K6OA 2R61A 1GUTA 3S17B 2N3SA 1VQOA 4HR7B 3H91A 4A3IG 2B63G 1AP0A 3GV3A 5EPJA 1BR9A 3LWUA 3U9SA 4N8X1 2EZVA 1CQFA 2F0QA 3CCEA 1FNUA 1TVXA 3LGJA 5JEAJ 2B8GA 5D3DA 4JI4Q 5EBDA 3L3OC 1RTNA 1VQHA 1IW7D 1DZ1A 2JA6G 2SNMA 3ND8A 3D4DA 2BDNA 1HH2P 1D5ZC 3NBHA 4LFCQ 5D65A 2OTJA 1VQKA 2UUBL 1X3GA 1QVCA 1SE3A 1Q46A 4L5QA 4B3RL 1WTOA 2K28A 3MEFA 2O4XA 3CRKC 3ER0A 2UU9Q 4BBSB 2NZOA 3HEJA 3PUWA 5IP7H 1SR3A 2E75C 3VR2A 2HCIA 5I6WA 2JE6I 4A3IB 4JI0L 1ZYRC 1D6EC 3PCOB 2EQSA 4N8FA 2EYFA 5HGTA 3DEPA 1I94L 5LMNL 5M5YB 1O7YA 3A5UA 1D1IA 2N49A 2Q2IA 3CHBD 4QUCA 4DR7Q 1SMYC 1Y8NB 1DCZA 3CCUA 5T1IA 5E1FA 4BY1G 3ND9A 2XN9C 5FKAC 1EZ8A 2F0MA 1TWAB 3C1FA 1JQYD 2HIVA 3SGIA 1SROA 4DU9A 1SLJA 1HNZL 4B3RQ 3EVQA 2KA7A 1EY4A 5IE8A 3CCMA 5BN5A 1U0LA 3OW7A 4A3CH 2E5LQ 2JA7G 4QGUA 2YYZA 4NMZA 1K8MA 2CQAA 4CJ0B 2RHQB 1SFOH 3G4SA 4CKBA 4A76A 3KJPA 4L5TA 3E9HA 1PLFA 1VQGA 4KI0A 2PQAA 3CXCA 3Q24A 4KD3A 2PZTA 1IHZA 1FNVA 5FJ8G 2RBMA 5CV6A 2R7ZG 2NWGA 1GD7A
chains in the Genus database with same CATH topology
3DLLA 4BBRG 1N36L 1HR0W 2UXDL 3GTGH 5C4XH 3CCSA 2BH8A 4DUYL 1HZCA 4A3KG 1ASZA 1OTCA 4JI1L 4A3DG 1EIYB 4GNXB 1MJEA 4JI3Q 4IPHA 1CUKA 1HNZQ 5IP7G 4HIMA 1HZ9A 1IBMQ 4C3JH 1PH1A 1VQJA 3BZKA 1Y1VG 5IY0A 4GKJL 3CAMA 1X6OA 3GD7A 1IBLQ 2F4VL 3GTKH 3JAMc 2RF4A 2CKZB 3K8AA 3F2CA 4JV5L 2N78A 4LF6L 4X65L 1PFSA 4X62L 4KHPL 4IJHA 1A8VA 3KYHC 4P72A 3STBD 1CKOA 2ID0A 4A3IH 2Z6KC 4ALPA 1L1OB 1FGUA 1K0RA 1WFQA 2MO0A 4DUZL 4X66L 4HJ8A 4B3SQ 4HIKA 3L7ZC 4JV5Q 5C0XI 2E8GA 5LMNW 4A3EH 1D7QA 3PSIA 4XIGS 5JJLA 3HOUG 2VZAA 4ME3A 4YWMA 4DK6C 2VW9A 1OXSC 3CCJA 2F52A 3H15A 1O7IA 3KOJA 4MNOA 4JI5L 3W5OA 1JMCA 3KLWA 2VQFL 4LFBQ 2KHJA 1Q1EA 1HR0Q 1IBKQ 3ULLA 1K9MC 1N36Q 4KHZA 1WCMH 5IYDG 1K8AC 3D0FA 1VQFA 3I4NH 1N34Q 4O0AA 4FDBA 2JJQA 2KHIA 1VQCA 2YV5A 4YCWA 3S2DH 3M4QA 1YJNA 2AHOB 2JA8G 3RNUA 2R92G 2YTYA 4GNXC 4A3BG 1R9TH 3I4NG 1XNQQ 4DR2Q 5M5YH 4GLAC 1NE3A 4JI2L 3M3YH 2VUMG 1L1OA 4Y52H 2I5HA 4P73A 2ZJPA 2DUDA 4AIMA 2WB1G 2JA8H 4DR4Q 4LFBL 1HNWQ 1V9PA 3UDGA 2JA7H 5IYBG 2E2HH 2Y0SE 1S3OA 1KRTA 4HJAA 4LF7L 1TWFH 4GKKQ 4LF4L 2IHEA 2L15A 4PMWA 4PZ8A 4NXNL 3EIVA 1X65A 4Y7NH 1XNRL 2NVQH 3HOYG 1LYLA 1IXRA 4GNXA 4A3EG 2I0QA 3FHWA 3VDYA 5H1SE 3STBC 1PH8A 3CMEA 1VQNA 1J6QA 5IWAQ 3J81i 1KRSA 1EFWA 3AEVA 4X64Q 3U50C 4UP9A 3GTMH 1VQ5A 1A0IA 4DR3Q 5IYCH 1EYGA 3A5ZB 5IP9G 1HR0L 2CCZA 5M3FG 1PA6A 1N8RC 2JA6H 2Q2TA 1JT8A 1S40A 3I2ZA 1VQEA 2K5VA 3TREA 3S1NH 2PQAB 4DV2Q 2F3IA 1SMXA 3OW2A 4A3KH 1XMOQ 2R7FA 1CKMA 4JI2Q 4LFAQ 2K4KA 5C0XJ 3PF5A 1EWIA 4A3LG 3G48A 1PVOA 5HY6A 5LMUQ 2LSSA 2XGTA 3S16H 2H5XA 1YHBA 3ICEA 1HNWL 1KAWA 2OCEA 5C4JH 3I4MH 1DGSA 3G71A 3RLNA 1Z9FA 4KLKA 1GD7A 3PV0A 1BVSA 1NMGA 2ZJQA 1PH5A 2UUAQ 4YY3L 4R1JA 4YWKA 4IFDG 1E3PA 3CPFA 4IO9A 3T1YL 2NVXH 3PUYA 1FVIA 4BBSG 1X56A 4YCUA 1SRUA 3NENA 1Q12A 4JI8Q 2HT1A 1D8LA 1NTGA 4POGA 3GTQH 4OXPA 2CWAA 4IPCA 4LF5L 1UEBA 1Z47A 1VQ9A 2R6GA 3FKIG 1QZGA 4GS3A 5E7NA 1VS0A 1N33L 4R4QA 3PIOA 2ZM6L 4LF7Q 2Q2UA 3S1MH 5GAEC 2MFIA 3CPWA 4QL5A 4AH6A 5HGQA 1X55A 3S24A 1PH2A 2UXBQ 3RZOH 3HOVG 5AJ3Q 3U4VA 3G6EA 3RLOA 1HNXQ 2V1CC 3TQYA 4A3GH 1YI2A 1N34L 1Q8KA 3GTLH 2ALYB 4AYBE 5GQOA 2PNHA 2VS1A 1I3QH 5ELOA 4RG1A 4K0KQ 3D31A 2B29A 4DV4Q 3M7NA 3ULPA 4YHHQ 3HOYH 2IX1A 4EX5A 4HIOA 4X6AH 5DLQE 4K0KL 3BZCA 4GOPC 1IL2A 5M3MH 1Q7YC 4DKAC 4JI4L 5IYBH 4DR6Q 2K5HA 1Q81C 3S1QH 1VQ6A 3K80C 2NVTH 1E1TA 1HNXL 3KDFB 2WAQG 3GTJH 2UXCL 4DR1L 2WFWA 2VQEQ 3U4ZA 2VY3A 1T9HA 4EQ5A 1S72A 1NMFA 2KBNA 3H3VI 2Z6KA 4JI7Q 1PYBA 1E1OA 1XTDA 2ZTCA 2RCNA 4A3FG 4X64L 3K81C 2JEAI 4PG3A 3HOWH 1TWCH 4APVA 5IYDH 3TEHB 1VQ4A 1K3RA 5AJ3L 3KF6B 3J80i 5IP9H 5GADC 4DV7Q 3PUVA 2OWOA 4GN3B 3HOXH 2Y0SG 1L2FA 2C35B 2WAQE 2XTIA 1FL0A 1OXTA 3OYYA 1HZBA 2WB1E 2HHHQ 3L0OA 2B3GA 4X66Q 3HOZG 2AMCB 4OX9L 1YJWA 4JI0Q 3S2HH 2R93H 1AH9A 4UP7A 2VQEL 1BBWA 1CSPA 4C3HH 4DV6Q 2BH2A 4DR1Q 5C0XG 1XPUA 4GN4B 3CF5A 2HQLA 1M1KC 4BY1H 4IFDI 2ZM6Q 1L0WA 4LF9L 3H0GG 3J7ZC 4NB3A 1EQQA 2R93G 1V1QA 4JYAL 1X54A 4OWWB 3CQZH 3TS0A 4DR6L 3I4MG 5JJIA 2N8NA 4GOPB 3K7UC 1GVPA 1OXXK 2JA5G 1W2BA 3T1HL 1IZ6A 1RL2A 3AFPA 3W1BA 3JAMi 3CP0A 1TWGH 1VQDA 1JE5A 2FXQA 4A3CG 1Y1WH 4MZ9A 4TQUS 2RHSB 5GAHC 1K73C 4TVAB 2YU9H 1P16A 3MXNB 3PGZA 1P8LA 5GROA 3U58A 4R4IA 3RZDH 2K75A 2ASBA 3J7A5 1TXYA 3S1RH 1KD1C 1E7ZA 4JI5Q 2ZJRA 3M85A 3BU2A 2E2JH 3F1ZA 4DV7L 1QUQA 3KJOA 3I4OA 2QA4A 2NN6G 1JB7A 4A3MG 4JI1Q 5FLMH 4YY3Q 4O2DA 1XJVA 4LUZA 2K14A 3A74A 3HKZG 2UUAL 4UP8A 3CD6A 1YHAA 3GTPH 1XMOL 1VQIA 3J81c 4BY7G 1G291 4GN5A 4IPDA 2UUCQ 3HOZH 1EQRA 1B7YB 3KFUA 1U5KA 4A3LH 4IJLA 3NBHB 4BBRH 1K83H 5LMUL 4DV6L 1CSQA 1G6PA 1JJGA 4DV3L 1FJGQ 1X9NA 2DGYA 1KQSA 1YJ9A 3NELA 2GVAA 2JK8A 1XPOA 1QVGA 1KIXA 3CC4A 4BXXH 4A3DH 4R4CA 4R4TA 1RIPA 3EBEA 4JBKA 4GKJQ 1GM5A 1IYJB 4WJ4A 1V43A 3RR5A 1B8AA 4WJ3M 2ES2A 4DAMA 1YZ6A 1UE1A 3A0JA 1NY4A 4IPGA 2AWOA 5M3MG 1Y1VH 2WP8J 4GOPA 1TWAH 2JA9A 4A3FH 1WI5A 1VQMA 4OONA 4X62Q 3S14H 1ASYA 4KHPQ 3UE1A 2PI2A 4BXXG 4DPGA 4LW1A 1PH3A 2UXDQ 5GAGC 4B3TL 3S17H 1K8GA 3J81j 2IT1A 3I7FA 4H02A 3CCVA 3HKSA 2IHFA 1EOVA 4YHHL 3PO3G 1VQAA 5IWAL 1PV4A 1UWVA 4DR4L 4JI3L 2A19A 2NZHA 1AE2A 2D0OA 4POFA 1KC8C 2UXBL 1EIFA 2KCMA 2UU9L 3M9BA 4NXNQ 4JBWA 4JBMA 4GKKL 5FLMG 1YVCA 1JJCB 4QJFA 5BR8L 1JJ2A 2IY5B 4YCVA 1G51A 3RN2A 3FKIH 4DUZQ 4B3SL 3M4OH 1PHJA 2UUCL 4IFDJ 3CW2C 3W1GA 4QQBX 4OX9Q 4JI7L 1IBLL 2F4VQ 2NN6I 1I94Q 2CQOA 1OXUA 4LWCA 4PZ7A 4OWXB 3UDIA 2ZTDA 2JQOA 1VQPA 4A3JG 2E2IH 1XMQQ 2EXDA 2R7DA 5FLXc 3CMAA 4DR2L 1C7YA 1KXLA 1VQ7A 3ULJA 4GLVB 3FP9A 4JC0A 4P71A 1X3FA 1YNXA 4JBJA 5M5WH 5C44H 3E9IA 1QUQB 3GTOH 2HIXA 4DK3C 5FJ8H 4MTNA 4IOCA 4BBSH 4A93G 4DR5Q 2AWNA 4B3TQ 3AYHB 3PUZA 2CFMA 4B3MQ 1SE8A 1Y14B 4A75A 2A1AA 5C4XG 1UE6A 2D0PA 4C2MH 1YIJA 4IOAA 2I5MX 2GN5A 1HJPA 4JCVE 2E5LL 1XMQL 4AQYQ 4JG2A 1EUJA 4UY8C 4C3IH 3L2PA 4DR3L 1MIUA 2YTVA 1LM0A 1E24A 5K36G 3F8TA 3PIPA 5IYCG 2GVBA 5J3BA 1OXVA 2LXJA 2ZTEA 1X3EA 2MNAA 4DV5Q 2UUBQ 3RN5A 2R92H 1A63A 3F2DA 4A3BH 2ATWA 4L5RC 4LF5Q 3H3VH 4DV0L 1Q82C 3EN2A 2VQFQ 1YHQA 4RMFA 1NBWA 4P75A 1IBML 1GKHA 3DM3A 2QGQA 1M90C 1VCIA 2IX0A 2BA0A 1PH7A 1CKNA 5LMNQ 3B6YA 4HIDA 4LF6Q 4AQYL 1XNRQ 2N3SA 2KENA 1VQOA 2CWPA 4A3IG 2OQKA 3UDXA 3I56A 4LFCL 3F2BA 4LF8Q 4NXMQ 2OTLA 2B63G 3IRBA 3NEMA 1XNQL 4JOIC 4A93H 1L1OC 4DV2L 1PH6A 4DV4L 4PZ6A 3CCEA 4B3ML 3KF8B 3LGJA 1H95A 1YBYA 2K50A 2I5LX 2PMZE 3K0XA 5JEAJ 4NPSA 4LFAL 4JI6Q 3KF6A 4JI4Q 1B70B 1VQHA 3JC66 3I55A 1Y1WG 2Q2HA 4LF4Q 4LF9Q 3S15H 1HZAA 4BA1I 5M3FH 3ZJYC 1YITA 2JA6G 1WCMG 3AFQA 1HH2P 1W3SA 2VUMH 1WOCA 4LFCQ 4BA2I 4XTCS 4LF8L 1QVFA 3TS2A 4DV1L 2HHHL 1XPRA 1VQKA 2OTJA 4DV5L 2UUBL 1X3GA 4HJ5A 1BBUA 1QVCA 1QZHA 2PI2E 5C44G 4HJ9A 3PUXA 1Q46A 1YEZA 3CCQA 4L5QA 3J80c 4JI8L 4B3RL 1J5EL 3UDFA 3E0EA 3CC2A 3PF4A 2VL6A 1NJIC 4A3JH 1VQ8A 4BY7H 2JA5H 5IT9c 3MEFA 3UE0A 4JYAQ 3ER0A 3K7AH 2UU9Q 2NZOA 4NXML 4A4IA 3BJUA 2KCTA 3PUWA 2AKWB 1I5FA 5IP7H 3TRZA 1SR3A 1N9WA 1Q1BA 1C9OA 5C3EG 1A62A 3CC7A 2A8VA 4DAYB 3HKZE 2OQ0A 2JE6I 3HOUH 4JI0L 1BKBA 2EQSA 3HFZB 3PCOB 3ERSX 5JEAG 2EIFA 3HOWG 3RLFA 2NVYH 1E22A 1UE7A 4L5SA 1N32Q 1I50H 3M4PA 2MQHA 2D62A 5M5XH 3AQQA 3GDEA 1WJJA 2Z0SA 5C3EH 1I94L 3HOXG 3Q8DA 5LMNL 4JI6L 1IBKL 1N32L 4HJ7A 4DV3Q 1FJGL 2R7ZH 2QEXA 1CKNB 2Q2IA 1PYSB 2N49A 4OWTB 3A5UA 1GO3E 4DR7Q 3T1HQ 1PH9A 2JEBI 3CCUA 2LXKA 4X65Q 5EAYA 4BY1G 1SN8A 4DV1Q 3CCRA 2MO1A 4YWLA 4QIWE 4LUOA 4DR5L 4A3GG 2YTXA 1KL9A 1VQLA 4OO1I 2UXCQ 2HIVA 3SGIA 1SROA 4B3RQ 1SLJA 1LTLA 4LUVA 1HNZL 4LNQA 2B63H 4OO1G 2K5NA 1J5EQ 5IE8A 3CCMA 4DV0Q 1U0LA 1C0AA 2BA1A 3PO2G 4A3CH 1MJCA 1VQBA 2E5LQ 4QGUA 1TWHH 1Q86C 2JA7G 1MKHA 2YYZA 3OTOL 4J15A 4GLXA 2RHQB 2K52A 1SFOH 3G4SA 4UPAA 1I6HH 1UE5A 3H0GH 4AYBG 3KJPA 4A76A 3PO2H 4QY7A 3WWVA 3OTOQ 4L5TA 5BR8Q 3E9HA 4R4OA 3HOVH 1VQGA 3KDFA 4KI0A 3T1YQ 2PQAA 4JOIA 4P74A 3CXCA 4A3MH 3PO3H 1KHIA 1PH4A 1WYDA 1AE3A 4DNIA 3CCLA 5ELNA 5JJKA 5FJ8G 2VNUD 4DR7L 1LUZA 2R7ZG 4DUYQ 1N33Q 3GO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL A;  4BBR G;  1N36 L;  1HR0 W;  2UXD L;  3GTG H;  5C4X H;  3CCS A;  2BH8 A;  4DUY L;  1HZC A;  4A3K G;  1ASZ A;  1OTC A;  4JI1 L;  4A3D G;  1EIY B;  4GNX B;  1MJE A;  4JI3 Q;  4IPH A;  1CUK A;  1HNZ Q;  5IP7 G;  4HIM A;  1HZ9 A;  1IBM Q;  4C3J H;  1PH1 A;  1VQJ A;  3BZK A;  1Y1V G;  5IY0 A;  4GKJ L;  3CAM A;  1X6O A;  3GD7 A;  1IBL Q;  2F4V L;  3GTK H;  3JAM c;  2RF4 A;  2CKZ B;  3K8A A;  3F2C A;  4JV5 L;  2N78 A;  4LF6 L;  4X65 L;  1PFS A;  4X62 L;  4KHP L;  4IJH A;  1A8V A;  3KYH C;  4P72 A;  3STB D;  1CKO A;  2ID0 A;  4A3I H;  2Z6K C;  4ALP A;  1L1O B;  1FGU A;  1K0R A;  1WFQ A;  2MO0 A;  4DUZ L;  4X66 L;  4HJ8 A;  4B3S Q;  4HIK A;  3L7Z C;  4JV5 Q;  5C0X I;  2E8G A;  5LMN W;  4A3E H;  1D7Q A;  3PSI A;  4XIG S;  5JJL A;  3HOU G;  2VZA A;  4ME3 A;  4YWM A;  4DK6 C;  2VW9 A;  1OXS C;  3CCJ A;  2F52 A;  3H15 A;  1O7I A;  3KOJ A;  4MNO A;  4JI5 L;  3W5O A;  1JMC A;  3KLW A;  2VQF L;  4LFB Q;  2KHJ A;  1Q1E A;  1HR0 Q;  1IBK Q;  3ULL A;  1K9M C;  1N36 Q;  4KHZ A;  1WCM H;  5IYD G;  1K8A C;  3D0F A;  1VQF A;  3I4N H;  1N34 Q;  4O0A A;  4FDB A;  2JJQ A;  2KHI A;  1VQC A;  2YV5 A;  4YCW A;  3S2D H;  3M4Q A;  1YJN A;  2AHO B;  2JA8 G;  3RNU A;  2R92 G;  2YTY A;  4GNX C;  4A3B G;  1R9T H;  3I4N G;  1XNQ Q;  4DR2 Q;  5M5Y H;  4GLA C;  1NE3 A;  4JI2 L;  3M3Y H;  2VUM G;  1L1O A;  4Y52 H;  2I5H A;  4P73 A;  2ZJP A;  2DUD A;  4AIM A;  2WB1 G;  2JA8 H;  4DR4 Q;  4LFB L;  1HNW Q;  1V9P A;  3UDG A;  2JA7 H;  5IYB G;  2E2H H;  2Y0S E;  1S3O A;  1KRT A;  4HJA A;  4LF7 L;  1TWF H;  4GKK Q;  4LF4 L;  2IHE A;  2L15 A;  4PMW A;  4PZ8 A;  4NXN L;  3EIV A;  1X65 A;  4Y7N H;  1XNR L;  2NVQ H;  3HOY G;  1LYL A;  1IXR A;  4GNX A;  4A3E G;  2I0Q A;  3FHW A;  3VDY A;  5H1S E;  3STB C;  1PH8 A;  3CME A;  1VQN A;  1J6Q A;  5IWA Q;  3J81 i;  1KRS A;  1EFW A;  3AEV A;  4X64 Q;  3U50 C;  4UP9 A;  3GTM H;  1VQ5 A;  1A0I A;  4DR3 Q;  5IYC H;  1EYG A;  3A5Z B;  5IP9 G;  1HR0 L;  2CCZ A;  5M3F G;  1PA6 A;  1N8R C;  2JA6 H;  2Q2T A;  1JT8 A;  1S40 A;  3I2Z A;  1VQE A;  2K5V A;  3TRE A;  3S1N H;  2PQA B;  4DV2 Q;  2F3I A;  1SMX A;  3OW2 A;  4A3K H;  1XMO Q;  2R7F A;  1CKM A;  4JI2 Q;  4LFA Q;  2K4K A;  5C0X J;  3PF5 A;  1EWI A;  4A3L G;  3G48 A;  1PVO A;  5HY6 A;  5LMU Q;  2LSS A;  2XGT A;  3S16 H;  2H5X A;  1YHB A;  3ICE A;  1HNW L;  1KAW A;  2OCE A;  5C4J H;  3I4M H;  1DGS A;  3G71 A;  3RLN A;  1Z9F A;  4KLK A;  1GD7 A;  3PV0 A;  1BVS A;  1NMG A;  2ZJQ A;  1PH5 A;  2UUA Q;  4YY3 L;  4R1J A;  4YWK A;  4IFD G;  1E3P A;  3CPF A;  4IO9 A;  3T1Y L;  2NVX H;  3PUY A;  1FVI A;  4BBS G;  1X56 A;  4YCU A;  1SRU A;  3NEN A;  1Q12 A;  4JI8 Q;  2HT1 A;  1D8L A;  1NTG A;  4POG A;  3GTQ H;  4OXP A;  2CWA A;  4IPC A;  4LF5 L;  1UEB A;  1Z47 A;  1VQ9 A;  2R6G A;  3FKI G;  1QZG A;  4GS3 A;  5E7N A;  1VS0 A;  1N33 L;  4R4Q A;  3PIO A;  2ZM6 L;  4LF7 Q;  2Q2U A;  3S1M H;  5GAE C;  2MFI A;  3CPW A;  4QL5 A;  4AH6 A;  5HGQ A;  1X55 A;  3S24 A;  1PH2 A;  2UXB Q;  3RZO H;  3HOV G;  5AJ3 Q;  3U4V A;  3G6E A;  3RLO A;  1HNX Q;  2V1C C;  3TQY A;  4A3G H;  1YI2 A;  1N34 L;  1Q8K A;  3GTL H;  2ALY B;  4AYB E;  5GQO A;  2PNH A;  2VS1 A;  1I3Q H;  5ELO A;  4RG1 A;  4K0K Q;  3D31 A;  2B29 A;  4DV4 Q;  3M7N A;  3ULP A;  4YHH Q;  3HOY H;  2IX1 A;  4EX5 A;  4HIO A;  4X6A H;  5DLQ E;  4K0K L;  3BZC A;  4GOP C;  1IL2 A;  5M3M H;  1Q7Y C;  4DKA C;  4JI4 L;  5IYB H;  4DR6 Q;  2K5H A;  1Q81 C;  3S1Q H;  1VQ6 A;  3K80 C;  2NVT H;  1E1T A;  1HNX L;  3KDF B;  2WAQ G;  3GTJ H;  2UXC L;  4DR1 L;  2WFW A;  2VQE Q;  3U4Z A;  2VY3 A;  1T9H A;  4EQ5 A;  1S72 A;  1NMF A;  2KBN A;  3H3V I;  2Z6K A;  4JI7 Q;  1PYB A;  1E1O A;  1XTD A;  2ZTC A;  2RCN A;  4A3F G;  4X64 L;  3K81 C;  2JEA I;  4PG3 A;  3HOW H;  1TWC H;  4APV A;  5IYD H;  3TEH B;  1VQ4 A;  1K3R A;  5AJ3 L;  3KF6 B;  3J80 i;  5IP9 H;  5GAD C;  4DV7 Q;  3PUV A;  2OWO A;  4GN3 B;  3HOX H;  2Y0S G;  1L2F A;  2C35 B;  2WAQ E;  2XTI A;  1FL0 A;  1OXT A;  3OYY A;  1HZB A;  2WB1 E;  2HHH Q;  3L0O A;  2B3G A;  4X66 Q;  3HOZ G;  2AMC B;  4OX9 L;  1YJW A;  4JI0 Q;  3S2H H;  2R93 H;  1AH9 A;  4UP7 A;  2VQE L;  1BBW A;  1CSP A;  4C3H H;  4DV6 Q;  2BH2 A;  4DR1 Q;  5C0X G;  1XPU A;  4GN4 B;  3CF5 A;  2HQL A;  1M1K C;  4BY1 H;  4IFD I;  2ZM6 Q;  1L0W A;  4LF9 L;  3H0G G;  3J7Z C;  4NB3 A;  1EQQ A;  2R93 G;  1V1Q A;  4JYA L;  1X54 A;  4OWW B;  3CQZ H;  3TS0 A;  4DR6 L;  3I4M G;  5JJI A;  2N8N A;  4GOP B;  3K7U C;  1GVP A;  1OXX K;  2JA5 G;  1W2B A;  3T1H L;  1IZ6 A;  1RL2 A;  3AFP A;  3W1B A;  3JAM i;  3CP0 A;  1TWG H;  1VQD A;  1JE5 A;  2FXQ A;  4A3C G;  1Y1W H;  4MZ9 A;  4TQU S;  2RHS B;  5GAH C;  1K73 C;  4TVA B;  2YU9 H;  1P16 A;  3MXN B;  3PGZ A;  1P8L A;  5GRO A;  3U58 A;  4R4I A;  3RZD H;  2K75 A;  2ASB A;  3J7A 5;  1TXY A;  3S1R H;  1KD1 C;  1E7Z A;  4JI5 Q;  2ZJR A;  3M85 A;  3BU2 A;  2E2J H;  3F1Z A;  4DV7 L;  1QUQ A;  3KJO A;  3I4O A;  2QA4 A;  2NN6 G;  1JB7 A;  4A3M G;  4JI1 Q;  5FLM H;  4YY3 Q;  4O2D A;  1XJV A;  4LUZ A;  2K14 A;  3A74 A;  3HKZ G;  2UUA L;  4UP8 A;  3CD6 A;  1YHA A;  3GTP H;  1XMO L;  1VQI A;  3J81 c;  4BY7 G;  1G29 1;  4GN5 A;  4IPD A;  2UUC Q;  3HOZ H;  1EQR A;  1B7Y B;  3KFU A;  1U5K A;  4A3L H;  4IJL A;  3NBH B;  4BBR H;  1K83 H;  5LMU L;  4DV6 L;  1CSQ A;  1G6P A;  1JJG A;  4DV3 L;  1FJG Q;  1X9N A;  2DGY A;  1KQS A;  1YJ9 A;  3NEL A;  2GVA A;  2JK8 A;  1XPO A;  1QVG A;  1KIX A;  3CC4 A;  4BXX H;  4A3D H;  4R4C A;  4R4T A;  1RIP A;  3EBE A;  4JBK A;  4GKJ Q;  1GM5 A;  1IYJ B;  4WJ4 A;  1V43 A;  3RR5 A;  1B8A A;  4WJ3 M;  2ES2 A;  4DAM A;  1YZ6 A;  1UE1 A;  3A0J A;  1NY4 A;  4IPG A;  2AWO A;  5M3M G;  1Y1V H;  2WP8 J;  4GOP A;  1TWA H;  2JA9 A;  4A3F H;  1WI5 A;  1VQM A;  4OON A;  4X62 Q;  3S14 H;  1ASY A;  4KHP Q;  3UE1 A;  2PI2 A;  4BXX G;  4DPG A;  4LW1 A;  1PH3 A;  2UXD Q;  5GAG C;  4B3T L;  3S17 H;  1K8G A;  3J81 j;  2IT1 A;  3I7F A;  4H02 A;  3CCV A;  3HKS A;  2IHF A;  1EOV A;  4YHH L;  3PO3 G;  1VQA A;  5IWA L;  1PV4 A;  1UWV A;  4DR4 L;  4JI3 L;  2A19 A;  2NZH A;  1AE2 A;  2D0O A;  4POF A;  1KC8 C;  2UXB L;  1EIF A;  2KCM A;  2UU9 L;  3M9B A;  4NXN Q;  4JBW A;  4JBM A;  4GKK L;  5FLM G;  1YVC A;  1JJC B;  4QJF A;  5BR8 L;  1JJ2 A;  2IY5 B;  4YCV A;  1G51 A;  3RN2 A;  3FKI H;  4DUZ Q;  4B3S L;  3M4O H;  1PHJ A;  2UUC L;  4IFD J;  3CW2 C;  3W1G A;  4QQB X;  4OX9 Q;  4JI7 L;  1IBL L;  2F4V Q;  2NN6 I;  1I94 Q;  2CQO A;  1OXU A;  4LWC A;  4PZ7 A;  4OWX B;  3UDI A;  2ZTD A;  2JQO A;  1VQP A;  4A3J G;  2E2I H;  1XMQ Q;  2EXD A;  2R7D A;  5FLX c;  3CMA A;  4DR2 L;  1C7Y A;  1KXL A;  1VQ7 A;  3ULJ A;  4GLV B;  3FP9 A;  4JC0 A;  4P71 A;  1X3F A;  1YNX A;  4JBJ A;  5M5W H;  5C44 H;  3E9I A;  1QUQ B;  3GTO H;  2HIX A;  4DK3 C;  5FJ8 H;  4MTN A;  4IOC A;  4BBS H;  4A93 G;  4DR5 Q;  2AWN A;  4B3T Q;  3AYH B;  3PUZ A;  2CFM A;  4B3M Q;  1SE8 A;  1Y14 B;  4A75 A;  2A1A A;  5C4X G;  1UE6 A;  2D0P A;  4C2M H;  1YIJ A;  4IOA A;  2I5M X;  2GN5 A;  1HJP A;  4JCV E;  2E5L L;  1XMQ L;  4AQY Q;  4JG2 A;  1EUJ A;  4UY8 C;  4C3I H;  3L2P A;  4DR3 L;  1MIU A;  2YTV A;  1LM0 A;  1E24 A;  5K36 G;  3F8T A;  3PIP A;  5IYC G;  2GVB A;  5J3B A;  1OXV A;  2LXJ A;  2ZTE A;  1X3E A;  2MNA A;  4DV5 Q;  2UUB Q;  3RN5 A;  2R92 H;  1A63 A;  3F2D A;  4A3B H;  2ATW A;  4L5R C;  4LF5 Q;  3H3V H;  4DV0 L;  1Q82 C;  3EN2 A;  2VQF Q;  1YHQ A;  4RMF A;  1NBW A;  4P75 A;  1IBM L;  1GKH A;  3DM3 A;  2QGQ A;  1M90 C;  1VCI A;  2IX0 A;  2BA0 A;  1PH7 A;  1CKN A;  5LMN Q;  3B6Y A;  4HID A;  4LF6 Q;  4AQY L;  1XNR Q;  2N3S A;  2KEN A;  1VQO A;  2CWP A;  4A3I G;  2OQK A;  3UDX A;  3I56 A;  4LFC L;  3F2B A;  4LF8 Q;  4NXM Q;  2OTL A;  2B63 G;  3IRB A;  3NEM A;  1XNQ L;  4JOI C;  4A93 H;  1L1O C;  4DV2 L;  1PH6 A;  4DV4 L;  4PZ6 A;  3CCE A;  4B3M L;  3KF8 B;  3LGJ A;  1H95 A;  1YBY A;  2K50 A;  2I5L X;  2PMZ E;  3K0X A;  5JEA J;  4NPS A;  4LFA L;  4JI6 Q;  3KF6 A;  4JI4 Q;  1B70 B;  1VQH A;  3JC6 6;  3I55 A;  1Y1W G;  2Q2H A;  4LF4 Q;  4LF9 Q;  3S15 H;  1HZA A;  4BA1 I;  5M3F H;  3ZJY C;  1YIT A;  2JA6 G;  1WCM G;  3AFQ A;  1HH2 P;  1W3S A;  2VUM H;  1WOC A;  4LFC Q;  4BA2 I;  4XTC S;  4LF8 L;  1QVF A;  3TS2 A;  4DV1 L;  2HHH L;  1XPR A;  1VQK A;  2OTJ A;  4DV5 L;  2UUB L;  1X3G A;  4HJ5 A;  1BBU A;  1QVC A;  1QZH A;  2PI2 E;  5C44 G;  4HJ9 A;  3PUX A;  1Q46 A;  1YEZ A;  3CCQ A;  4L5Q A;  3J80 c;  4JI8 L;  4B3R L;  1J5E L;  3UDF A;  3E0E A;  3CC2 A;  3PF4 A;  2VL6 A;  1NJI C;  4A3J H;  1VQ8 A;  4BY7 H;  2JA5 H;  5IT9 c;  3MEF A;  3UE0 A;  4JYA Q;  3ER0 A;  3K7A H;  2UU9 Q;  2NZO A;  4NXM L;  4A4I A;  3BJU A;  2KCT A;  3PUW A;  2AKW B;  1I5F A;  5IP7 H;  3TRZ A;  1SR3 A;  1N9W A;  1Q1B A;  1C9O A;  5C3E G;  1A62 A;  3CC7 A;  2A8V A;  4DAY B;  3HKZ E;  2OQ0 A;  2JE6 I;  3HOU H;  4JI0 L;  1BKB A;  2EQS A;  3HFZ B;  3PCO B;  3ERS X;  5JEA G;  2EIF A;  3HOW G;  3RLF A;  2NVY H;  1E22 A;  1UE7 A;  4L5S A;  1N32 Q;  1I50 H;  3M4P A;  2MQH A;  2D62 A;  5M5X H;  3AQQ A;  3GDE A;  1WJJ A;  2Z0S A;  5C3E H;  1I94 L;  3HOX G;  3Q8D A;  5LMN L;  4JI6 L;  1IBK L;  1N32 L;  4HJ7 A;  4DV3 Q;  1FJG L;  2R7Z H;  2QEX A;  1CKN B;  2Q2I A;  1PYS B;  2N49 A;  4OWT B;  3A5U A;  1GO3 E;  4DR7 Q;  3T1H Q;  1PH9 A;  2JEB I;  3CCU A;  2LXK A;  4X65 Q;  5EAY A;  4BY1 G;  1SN8 A;  4DV1 Q;  3CCR A;  2MO1 A;  4YWL A;  4QIW E;  4LUO A;  4DR5 L;  4A3G G;  2YTX A;  1KL9 A;  1VQL A;  4OO1 I;  2UXC Q;  2HIV A;  3SGI A;  1SRO A;  4B3R Q;  1SLJ A;  1LTL A;  4LUV A;  1HNZ L;  4LNQ A;  2B63 H;  4OO1 G;  2K5N A;  1J5E Q;  5IE8 A;  3CCM A;  4DV0 Q;  1U0L A;  1C0A A;  2BA1 A;  3PO2 G;  4A3C H;  1MJC A;  1VQB A;  2E5L Q;  4QGU A;  1TWH H;  1Q86 C;  2JA7 G;  1MKH A;  2YYZ A;  3OTO L;  4J15 A;  4GLX A;  2RHQ B;  2K52 A;  1SFO H;  3G4S A;  4UPA A;  1I6H H;  1UE5 A;  3H0G H;  4AYB G;  3KJP A;  4A76 A;  3PO2 H;  4QY7 A;  3WWV A;  3OTO Q;  4L5T A;  5BR8 Q;  3E9H A;  4R4O A;  3HOV H;  1VQG A;  3KDF A;  4KI0 A;  3T1Y Q;  2PQA A;  4JOI A;  4P74 A;  3CXC A;  4A3M H;  3PO3 H;  1KHI A;  1PH4 A;  1WYD A;  1AE3 A;  4DNI A;  3CCL A;  5ELN A;  5JJK A;  5FJ8 G;  2VNU D;  4DR7 L;  1LUZ A;  2R7Z G;  4DUY Q;  1N33 Q;  3GO5 A; 
#chains in the Genus database with same CATH topology
 2XWJ B;  3OIP A;  2QDL A;  1KTK A;  2UXD L;  5K5P A;  3MTS A;  4N9P A;  1KDC A;  3FMC A;  4JI1 L;  1JC7 A;  1EY9 A;  1YNJ D;  2MUY A;  1HZ9 A;  2ZT9 C;  2A69 C;  3BZK A;  3FRP B;  5IY0 A;  1PH1 A;  1G2T A;  2J4X A;  4QUF A;  2CKZ B;  2WKC A;  2N78 A;  2ENB A;  1A8V A;  3KYH C;  1CKO A;  2ID0 A;  2DN8 A;  1L1O B;  1K0R A;  1WFQ A;  1ZYR D;  4HMJ A;  3ITP A;  3NWS A;  4FO2 A;  4DUZ L;  3ZYY X;  5C0X I;  5LMN W;  4H44 C;  4I7Z C;  5T1G A;  1D7Q A;  2A6H D;  2V4D A;  1F9R A;  1H9S A;  2VZA A;  2VW9 A;  5IT9 E;  1H9S B;  1QIL A;  1O7I A;  3KOJ A;  4JI5 L;  2Z4I A;  4LFB Q;  3NBI A;  1Q1E A;  2EY1 A;  4KHZ A;  1WCM H;  1GUG A;  1E2W A;  3A8K E;  1VQC A;  2R92 G;  2JA8 G;  4A3B G;  2YTY A;  1R9T H;  2L55 A;  2OT2 A;  2PW7 A;  2VUM G;  4ZKB B;  1L1O A;  2I46 A;  4QIW B;  3OWF A;  2DUD A;  2G9D A;  2N88 A;  4AIM A;  2JA8 H;  2K04 A;  4LFB L;  1V9P A;  3HOZ B;  4K5X A;  2Y0S E;  4HMI A;  1KRT A;  3MZ5 A;  1RHP A;  1TWF H;  2IHE A;  5IIF A;  1X65 A;  3TP7 A;  2QKI C;  1CT1 D;  5M3M B;  2NB0 A;  1IXR A;  4GNX A;  4A3E G;  2F03 A;  3STB C;  1STB A;  2JA7 B;  2B2U C;  1VQN A;  3AEV A;  2EOT A;  5CBE E;  4UP9 A;  1A0I A;  4HTH A;  5IYC H;  1EYG A;  5IP9 G;  4ULL A;  2BOS A;  3GV6 A;  3MWY W;  1HR0 L;  2JA6 H;  1ICF B;  3I73 A;  1L0X B;  4RGM A;  5EKK A;  1S40 A;  1HTL D;  2L1B A;  3I2Z A;  1KDB A;  1LT6 D;  2F4I A;  1M4V A;  2PQA B;  3DUZ A;  2H4O A;  4C3H G;  4LFA Q;  2K4K A;  2NUC A;  3GTK B;  4A3L G;  3G6J B;  3A54 A;  5HY6 A;  4C3J B;  5LMU Q;  4IFD H;  1HNW L;  1KAW A;  2OCE A;  3I4M H;  3G71 A;  2VUM B;  3NQT A;  3RLN A;  1Z9F A;  5C6A A;  1UUP A;  1BVS A;  4YY3 L;  4R1J A;  4IFD G;  5C0X H;  3K7A B;  3CPF A;  3T1Y L;  2NVX H;  5JAV A;  2HT1 A;  1KLG D;  2PZW A;  2HDM A;  5I9O A;  3GTQ H;  1PFN A;  1UEB A;  1VQ9 A;  4GS3 A;  5E7N A;  2ZM6 L;  2MFI A;  4DA2 A;  5BN4 A;  1A3V A;  1ONL A;  3G6E A;  2VB2 X;  1HNX Q;  1F9Q A;  3TQY A;  1XTC D;  3GTL H;  2ALY B;  1D5X C;  2PNH A;  1SNC A;  5ELO A;  1E0B A;  4K0K Q;  2B29 A;  4DV4 Q;  4HIO A;  1STE A;  4XT1 B;  3D6C A;  1IL2 A;  2R92 B;  3R3O A;  4JI4 L;  4A3B B;  4G7H C;  3S1Q H;  1VQ6 A;  2F0N A;  5CYU A;  1E1T A;  1HNX L;  2WAQ G;  3I90 A;  2WFW A;  1S72 A;  3UI2 A;  1GUW A;  2RCN A;  1K83 B;  1I4R A;  4IN3 A;  5IYD H;  1H9M A;  1K3R A;  4DFA A;  4MHE A;  2K01 A;  4KKU A;  1L2F A;  2C35 B;  1S5B D;  1HZB A;  2WB1 E;  4LJZ C;  1DYQ A;  3S2H H;  1YJW A;  4UP7 A;  5JVH 3;  5C4J B;  4DV6 Q;  2BE5 C;  1XPU A;  1KNA A;  4IFD I;  2ZM6 Q;  1F9P A;  4QF4 A;  3J7Z C;  4NB3 A;  1B4O A;  3TS0 A;  1EY5 A;  4DR6 L;  2JA5 G;  4JW0 A;  4CHT B;  3T1H L;  1Y1W B;  3JAM i;  3W1B A;  1GUS A;  3AFP A;  2EYJ A;  1RDP D;  1ENF A;  1QNU A;  1O7Z A;  1V8Q A;  1X3Q A;  2PQE A;  4B08 A;  4HN7 A;  1Y1W H;  4MZ9 A;  4TVA B;  3URY A;  5GRO A;  3X3M A;  4A3J B;  3RZD H;  4RKB A;  3J7A 5;  3QO2 A;  4JI5 Q;  2E2J H;  1DJR D;  3I4O A;  2QA4 A;  2XSC A;  1JB7 A;  2E76 C;  3NUC A;  4A3M G;  4JI1 Q;  5FLX L;  1XJV A;  1K8O A;  1A3U A;  4BY7 G;  2B2T A;  2G9H D;  1SYE A;  2F0J A;  1V1O A;  3T13 A;  1U5K A;  1RCV D;  5IOC A;  1SYG A;  4DV3 L;  4XYQ A;  1E2V A;  3VYS A;  3CC4 A;  3VA7 A;  4A3D H;  3M3Y B;  4R4T A;  4JBK A;  2AQ3 B;  4G57 A;  1IYJ B;  1V43 A;  4WJ3 M;  1B8A A;  2RDH A;  4DAM A;  1YZ6 A;  3PO2 B;  3A0J A;  1NY4 A;  2AWO A;  1F2L A;  1SFO B;  4OON A;  4X62 Q;  3S14 H;  1B44 D;  4LW1 A;  2UXD Q;  5GAG C;  2B2U A;  4U67 3;  4K6L A;  1LTB D;  3PO3 G;  1VQA A;  2Q8R E;  5IWA L;  2EY6 A;  4HAE A;  1AE2 A;  1KC8 C;  2UXB L;  1EIF A;  3VR6 A;  2VXW A;  3M9B A;  1RJT A;  3BYT B;  4NXN Q;  4JBM A;  1A15 A;  3A56 A;  3HG9 A;  4GKK L;  1TII D;  5D3I B;  1JJ2 A;  3S1N B;  4A3F B;  2F0O A;  5ELC A;  4DUZ Q;  2UUC L;  1OXU A;  4OWX B;  1VQP A;  5I4D A;  1O80 A;  1G2S A;  2R7D A;  4HCS A;  1C7Y A;  4H13 C;  1VQ7 A;  2XNA C;  1U9R A;  3V96 A;  4B9W A;  1CI3 M;  4JBJ A;  4MN3 A;  3E9I A;  1B3A A;  2HIX A;  1NR2 A;  4IUQ A;  1TKW B;  5FO8 B;  4IOC A;  1GXD C;  1BXT A;  3AYH B;  1ZXT A;  2LKV A;  2A1A A;  1UE6 A;  2I5M X;  5IGF A;  2GN5 A;  3NP8 A;  2KQ3 A;  3NTK A;  3R93 A;  2F0V A;  4DR3 L;  2YTV A;  2PPB C;  2F1M A;  1CHQ D;  2GVB A;  3TN2 A;  3S1Q B;  5IGG A;  2R7Z B;  2ATW A;  2F0S A;  2VQF Q;  4EGV A;  4RMF A;  1NBW A;  4P75 A;  5ELF A;  4NKL A;  1ENA A;  2QGQ A;  1M90 C;  4ZUI A;  1ILP A;  2JYO A;  3T56 B;  3MHB A;  3J80 E;  2PMZ B;  2RCF A;  1I3Q B;  1W6K A;  4AQY L;  1XNR Q;  2KEN A;  2CWP A;  4KMU C;  3K57 A;  3F2B A;  2OTL A;  2HD3 A;  3IRB A;  3IFT A;  3ERO A;  4A93 H;  5J39 A;  1SNM A;  1VF5 C;  4PZ6 A;  2K50 A;  1CZW A;  4NW2 A;  5EKI A;  3KF6 A;  3NK9 A;  1F9S A;  1PZJ D;  2KED A;  1B70 B;  3JC6 6;  1EQT A;  2Q2H A;  4LF9 Q;  4C3H B;  3PMF A;  4BA1 I;  5NUC A;  4FF4 A;  2RDF A;  4XTC S;  4M8A A;  3TS2 A;  4DV1 L;  2PW5 A;  2FHT A;  1R4P B;  4DV5 L;  1BBU A;  1STY A;  1QZH A;  2PI2 E;  1AZQ A;  4DF7 A;  4LK1 C;  5CMD A;  1NJI C;  4A3J H;  2EY5 A;  1VQ8 A;  2JA5 H;  1LLR D;  4TSS A;  4JYA Q;  3DXJ C;  2RA4 A;  3DMU A;  4NXM L;  4FVM A;  3BJU A;  2KCT A;  2KJX A;  2QF7 A;  1Q1B A;  1C9O A;  3CC7 A;  1PDQ A;  4DAY B;  1G91 A;  2OQ0 A;  3HOU H;  3I4M B;  2CH4 A;  3HOW G;  1HUM A;  4R9W A;  1E22 A;  1UE7 A;  3RMH A;  4L5S A;  1I50 H;  4RGO S;  5KNB A;  3AQQ A;  3K5L A;  1MI2 A;  4HJ7 A;  4DV3 Q;  1EEI D;  2QEX A;  3T1H Q;  1IL8 A;  1PH9 A;  1DD2 A;  2LXK A;  1CM9 A;  4X65 Q;  2KCN A;  3GTP B;  4DV1 Q;  1ENC A;  4DR5 L;  4QIW E;  4A3G G;  1KL9 A;  4CJ2 C;  2UXC Q;  3RUZ A;  5D14 A;  4H7B A;  1LTL A;  4LUV A;  2B2V C;  4LMQ D;  5ELE A;  1X32 A;  2IPK D;  4KD4 A;  1C0A A;  3KLS A;  1VQB A;  1I4X A;  2QIL A;  1EZ6 A;  4J15 A;  3OTO L;  4A3G B;  4J6H A;  1PTO C;  5KND A;  1LTG D;  3PO3 H;  1KHI A;  1AE3 A;  4DNI A;  3CCL A;  2PZU A;  4CDC C;  1VMC A;  4DUY Q;  3GO5 A;  3DLL A;  3SEB A;  1EY7 A;  1N36 L;  3SK6 A;  5C4X H;  3GTG H;  2BH8 A;  1HZC A;  4A3K G;  3K5M A;  4IUR A;  4GNX B;  1MJE A;  4JI3 Q;  4OIK A;  4HIM A;  1IBM Q;  1VQJ A;  2WAC A;  3HOV B;  1EEF D;  1OO9 B;  3CAM A;  1X6O A;  2F4V L;  4K14 A;  4AYB B;  3K8A A;  3KBX A;  4X65 L;  1PFS A;  1UAP A;  2EJF C;  2OXP A;  4IJH A;  2EDG A;  5M9O A;  1XYI A;  4KHP L;  4A3I H;  2Z6K C;  4B3S Q;  4HJ8 A;  4HIK A;  1WTH A;  4DNT B;  2E8G A;  2B8F A;  1HFN A;  1PTO B;  3C3L A;  4ME3 A;  1LAC A;  4B9X A;  3CCJ A;  3W5O A;  1WTP A;  2K1B A;  4LAA A;  3HP3 A;  5IGB A;  1N36 Q;  1JCK B;  3D0F A;  1VQF A;  3JAM L;  3I4N H;  4IAL A;  3MVV A;  1EL0 A;  3Q6S A;  4NDX A;  4FDB A;  2JJQ A;  4HSP A;  1ML0 D;  2YV5 A;  3RZO B;  1YJN A;  2AHO B;  5DEH A;  1O7L A;  4TKO B;  3I4N G;  4Q0F A;  4DR2 Q;  5M5Y H;  2SNS A;  1BCP F;  4Y52 H;  3M4Y A;  3R8B A;  2JA7 H;  4HJA A;  1S3O A;  2A6H C;  3MC0 B;  1EU3 A;  1H9R A;  2L15 A;  1S5E D;  5E4X A;  3FHW A;  1R4Q B;  2FIN B;  2HCC A;  4Q5V A;  1J6Q A;  2DY7 A;  2LFN A;  4DNR B;  5I9P A;  4OEM B;  2K05 A;  3U50 C;  4KJO A;  1VQ5 A;  1EU4 A;  4DR3 Q;  4R8I A;  3K59 A;  3MXG A;  2XWB B;  4X3S A;  1N8R C;  1PA6 A;  2IJ0 A;  3FKI B;  4QB4 A;  4RHR A;  3M4O B;  3ERQ A;  3S1N H;  2L12 A;  2NVX B;  1HTP A;  3S9W A;  2F3I A;  3OW2 A;  2B2W C;  4JI2 Q;  3FPP A;  1HQR D;  1I4H A;  1PVO A;  4ZK9 B;  2XGT A;  3S16 H;  2WKD A;  2FJ2 A;  2WV6 D;  3T4A C;  1DGS A;  1PXU A;  3VR4 A;  3QR8 A;  2ZJQ A;  3R2T A;  1PH5 A;  2UUA Q;  1RKN A;  2CW0 D;  3SHL A;  3GTG B;  1E3P A;  2RDG A;  1SE4 A;  3DEO A;  1NNX A;  3NEN A;  4POG A;  2CWA A;  3NXW A;  3FKI G;  4N9T A;  1JWU D;  1VS0 A;  1N33 L;  1JOR A;  3Q23 A;  4LF7 Q;  3I3C A;  5LHY 1;  3K5O A;  1CA6 A;  4QL5 A;  5HGQ A;  2UXB Q;  1X55 A;  5FOB B;  1L0Y B;  1Y1V B;  5AJ3 Q;  5I2X A;  4DXF A;  2V1C C;  4A3G H;  4CDE C;  1I3Q H;  2F0P A;  3LWE A;  2RSN A;  3HOY H;  1E2Z A;  1EQV A;  4K0K L;  4GOP C;  5M3M H;  1F2Y A;  1Q81 C;  3VA5 A;  1U4L A;  2NVT H;  3KDF B;  3GTJ H;  2VQE Q;  1F2Z A;  3U4Z A;  3A7L A;  2VY3 A;  4EQ5 A;  2KBN A;  2X69 A;  2Z6K A;  1PYB A;  2TSS A;  2ZTC A;  3K81 C;  5IGE A;  2JEA I;  3OPO A;  5BN3 A;  5AJ3 L;  3KF6 B;  5IP9 H;  4DV7 Q;  2F3V A;  1Z6H A;  2OWO A;  2R93 B;  1STN A;  1G8Z D;  4GN3 B;  3HOX H;  4ZCK A;  3OYY A;  4NP5 A;  2HHH Q;  2JA5 B;  2R93 H;  3P7J A;  2VQE L;  1BBW A;  1CSP A;  4C3H H;  2BH2 A;  1JWS D;  3TBI B;  2VUM H;  3CF5 A;  2F0T A;  4KN7 C;  5J22 A;  1EQQ A;  2R93 G;  1V1Q A;  3CQZ H;  3I4M G;  1V1P A;  3K7U C;  4RWS C;  3BVM A;  3H6M A;  4GOP B;  2X6G A;  4I65 A;  2TMP A;  1TY2 A;  2C5C A;  3BG3 A;  1SE2 A;  1JE5 A;  3A8J E;  3HGB A;  5GAH C;  2XRQ D;  1XXG A;  5CV9 A;  3TP8 A;  4R8N A;  1HUN A;  5DM7 3;  1P8L A;  5JVG 3;  1DXM A;  4X3T A;  3U58 A;  2ASB A;  1KD1 C;  2XVS A;  5KYI A;  4IUN A;  4IUV A;  3GTQ B;  2XIW A;  1TT2 A;  2QCP X;  3KJO A;  3HOU B;  5KRU A;  1GUO A;  5FLM H;  5EPK A;  2K14 A;  3HKZ G;  2UUA L;  3C2P A;  4UP8 A;  2EJG C;  1YHA A;  1CA5 A;  3CD6 A;  3GTP H;  3BDC A;  4V0B A;  1J9O A;  3SK5 A;  1EQR A;  2Q8I B;  4A3L H;  3TME A;  4F87 A;  4BBR H;  4DV6 L;  4OL7 A;  2NBF A;  3VR3 A;  1JJG A;  3PQI A;  1C8C A;  3VYU A;  1ZKO A;  3NEL A;  1QVG A;  1B50 A;  4R4C A;  1RIP A;  1GM5 A;  1EOT A;  1BO0 A;  5COR A;  1BOS A;  1SNP A;  1V1P B;  4GOP A;  1Y1V H;  4A3F H;  3KF8 A;  2AUJ D;  1ASY A;  4B3T L;  1A3T A;  1K8G A;  2IT1 A;  1YNN C;  3I7F A;  3HKS A;  4K6D A;  2IHF A;  1DOM A;  1QB5 D;  4YHH L;  1FR3 A;  2SDF A;  4JVZ A;  1UEA B;  2D0O A;  1STA A;  2KCM A;  2N55 A;  4CKC A;  4JBW A;  2NVQ B;  1Y69 U;  3I8Z A;  1JJC B;  4QJF A;  4F88 A;  5G3L D;  3RN2 A;  3CW2 C;  3W1G A;  1JE4 A;  2VB3 X;  2NN6 I;  1I94 Q;  2F0L A;  4PZ7 A;  3UDI A;  2BCO A;  3HOV H;  5G3L F;  3W2D A;  3OIQ A;  1KXL A;  4DAP A;  3CMA A;  3KLS X;  3ULJ A;  1PYW D;  4GLV B;  3FP9 A;  4PMB A;  4P71 A;  1EFI D;  2EYM A;  2HDL A;  3GTO H;  3H3V C;  2QDB A;  4X3U A;  4HED A;  5FJ8 H;  4MTN A;  3EA6 A;  4DR5 Q;  2J0T D;  3PUZ A;  3GTO B;  2EVB A;  1QG7 A;  1VDZ A;  1KNE A;  4A75 A;  1TR5 A;  2BDO A;  5FK9 C;  4IOA A;  3S1R B;  1PRT B;  3VYT A;  4EVO A;  2E5L L;  1HXY D;  3MXP A;  4JK1 C;  2KOL A;  3E0J A;  1NAP A;  4JG2 A;  1GHJ A;  5KIX A;  4KV6 A;  1LM0 A;  5K36 G;  3H0G B;  4KY6 A;  2ZTE A;  1X3E A;  4DV5 Q;  3FVQ A;  3G7L A;  4OO1 H;  4DAV A;  4L5R C;  5K36 H;  3MFY A;  4DV0 L;  1NUC A;  1YHQ A;  4RAU C;  4KHV A;  2E74 C;  4RH6 A;  3DM3 A;  1LTS D;  1VCI A;  2BA0 A;  1CKN A;  5LMN Q;  3B6Y A;  4C56 C;  4HID A;  1NSN S;  1BNZ A;  4LF8 Q;  2OQK A;  3I56 A;  4LFC L;  1K3B C;  1M8A A;  3NEM A;  2M9V A;  4JOI C;  1D1K A;  4DV2 L;  1JR0 D;  1C48 A;  4DV4 L;  4B3M L;  2B2T C;  3KF8 B;  4DAY A;  2I5L X;  3K0X A;  4NPS A;  4G7O C;  4F8M A;  4IZ8 A;  5COY A;  3I55 A;  2BE5 D;  3J7A V;  3S15 H;  1YIT A;  1W3S A;  2IL8 A;  2C9O A;  4IUT A;  1WOC A;  4BA2 I;  2ZXO A;  1QVF A;  2HHH L;  3CU7 A;  4HJ5 A;  5C44 G;  3BS1 A;  2EYO A;  3PUX A;  2NN6 H;  1QOH A;  1YEZ A;  3TP6 A;  3CCQ A;  3J80 c;  4HJ9 A;  4JI8 L;  4RCN A;  2Y0S B;  2EYP A;  1ET9 A;  4BWG B;  3UDF A;  3E0E A;  3PF4 A;  2VL6 A;  3EQL C;  4PNY A;  1EIG A;  3K7A H;  4A4I A;  4A3K B;  1JIC A;  2AKW B;  2QW7 A;  1ROD A;  2HQE A;  1TWG B;  1A62 A;  1RD9 D;  3OMG A;  5JEA G;  2KEE A;  2LMC B;  5C3X A;  3M4P A;  2MQH A;  3GQB A;  3Q8D A;  4JI6 L;  2K5D A;  1SYB A;  1IBK L;  1N32 L;  1JOO A;  1FJG L;  3QB3 A;  4IQZ A;  2F0H A;  5FLX E;  1PYS B;  3I70 A;  2JEB I;  5EAY A;  3CCR A;  2F0K A;  2MO1 A;  3Q22 A;  1VQL A;  4OO1 I;  4F7X A;  4LNQ A;  3K5N A;  1EYD A;  2FMM A;  1J5E Q;  3HOY B;  1Y8O B;  1TS5 A;  4UDU C;  2D5D A;  1MJC A;  1Q86 C;  1R9T B;  1CQV A;  3AMU A;  4U68 A;  1TWF B;  1JOK A;  2K52 A;  4UPA A;  2SEB D;  1UE5 A;  1LTR D;  3H0G H;  2NVT B;  2L11 A;  3WWV A;  3OTO Q;  1Q90 A;  3I4N B;  5C4Z A;  4A3M H;  4BY7 B;  1PH4 A;  5ELN A;  2ICI A;  1DM0 B;  2VNU D;  4DR7 L;  2F0I A;  3DWP A;  1N33 Q;  1SJH D;  1FNW A;  1HR0 W;  1FD7 D;  5KYL A;  1ESR A;  2ZXR A;  4C3J G;  4DUY L;  3E3X A;  2A68 C;  1ASZ A;  1OTC A;  5JPN C;  3HS0 C;  4A3D G;  3DM1 A;  4RGT A;  1CUK A;  5HUR A;  2F0D A;  2IX3 A;  2EJM A;  4C3J H;  2L0C A;  2E2I B;  1IBL Q;  1PTO H;  3X3N A;  4V19 0;  3IL8 A;  2KVM A;  4IUP A;  3J7A F;  3STB D;  4ALP A;  2MO0 A;  1HA5 A;  5AFW A;  4JV5 Q;  2HUG A;  4XIG S;  5JJL A;  3HOU G;  1TY0 A;  1OXS C;  4FF2 A;  2E2J B;  2F52 A;  4MNO A;  3KLW A;  3J7Y W;  3BDO A;  3PIO 3;  1T5X D;  1I4G A;  4FP5 D;  4CJ1 B;  3WOE A;  4O0A A;  5EBC A;  5TSS A;  3FEW X;  1BCP D;  2KHI A;  3M4Q A;  3RNU A;  4GNX C;  1PZK D;  1CTM A;  4FF1 A;  4GLA C;  3M3Y H;  2X6L A;  4A3D B;  1VMP A;  2I5H A;  4P73 A;  5CBA E;  2PCF B;  1I4P A;  2ZJP A;  2WB1 G;  1H9K A;  1YNJ C;  1HNW Q;  5IYB G;  1STG A;  5JPM C;  5FO7 B;  4GKK Q;  4X3K A;  1XNR L;  3HOY G;  1KAA A;  1TQO A;  3DWQ A;  3VDY A;  5H1S E;  3CME A;  1PTO F;  1EFW A;  1SYC A;  4BY1 B;  1ICW A;  1Z7T A;  4X64 Q;  1GJX A;  5J1Z A;  4EQP A;  3EJI A;  3PO3 B;  3AB9 A;  1PFM A;  5EPL A;  1JT8 A;  4Z9C B;  2KUM A;  1BDO A;  2K5V A;  1A2T A;  1SBB B;  1SMY D;  4DV2 Q;  4A3K H;  1XMO Q;  1SMX A;  5C0X J;  1LTI D;  1IKL A;  2M2L A;  3MXU A;  1EWI A;  5A2Q E;  3SR1 A;  2LSS A;  1Q8I A;  3U9O A;  3ICE A;  1YHB A;  1BCP B;  1X3P A;  1D5M C;  1TS3 A;  4YWK A;  1T5E A;  4J8Q A;  4IO9 A;  2DNE A;  3PUY A;  4ZQ3 A;  4BBS G;  1LT4 D;  1X56 A;  1SRU A;  1Q12 A;  4PV1 C;  5CV7 A;  5KNC A;  1NTG A;  3EFX D;  3VR5 A;  1MGS A;  4IPC A;  4KY5 A;  1A6X A;  5C3E B;  2R6G A;  1QZG A;  2AQ1 B;  4R4Q A;  2MJ8 A;  4P2C B;  5GAE C;  4WRD A;  3OHX C;  3QJY A;  3S24 A;  3T53 B;  3N6R A;  3RZO H;  4IUU A;  5IOD A;  1D2B A;  3U4V A;  1GHK A;  3RLO A;  1PZI D;  4RGN A;  1YI2 A;  1N34 L;  1Q8K A;  4G4K A;  4AYB E;  5LL6 X;  1ET6 A;  1JWM D;  2VS1 A;  3D31 A;  5CV8 A;  3M7N A;  2A5H A;  4YHH Q;  2IX1 A;  4EX5 A;  4X6A H;  4OEL B;  5DLQ E;  4DR6 Q;  2K5H A;  3HOX B;  3K80 C;  3L9A X;  2L5T A;  4DK1 A;  2K33 A;  1AFP A;  3S15 B;  2FFK B;  5A35 A;  3H3V I;  5CGK A;  4JI7 Q;  2D9U A;  1E1O A;  1PTO D;  1XTD A;  2O2L D;  4A3F G;  1TU2 B;  4K5V A;  4PG3 A;  1TWC H;  2Z1C A;  3TEH B;  1VQ4 A;  1WD1 A;  1PRT C;  4KK7 A;  2CHB D;  1RTO A;  1S5C D;  2Y0S G;  3P1H A;  2WAQ E;  2XTI A;  1FL0 A;  5EQ0 A;  3HOZ G;  3K0Y A;  1AH9 A;  2AMC B;  4OX9 L;  2Z9H A;  1B9N A;  3D6W A;  3V2T A;  2DJG C;  1WTR A;  1DOL A;  2Z8L A;  4DR1 Q;  2HQL A;  4BY1 H;  2SOB A;  3J81 L;  4LF9 L;  4ODG A;  1JB3 A;  2K6A A;  4OWW B;  3K58 A;  2OEO A;  1OXX K;  1UNS A;  1HHV A;  3KUP A;  1H9J A;  3LX0 A;  1TWG H;  4A3C G;  3BDL A;  4FXK C;  2RHS B;  3D8G A;  2YU9 H;  1MBY A;  3MXN B;  3PGZ A;  4CBV A;  4M1U B;  1F2M A;  3QG1 A;  4R4I A;  2DY8 A;  1TXY A;  1E7Z A;  5CV4 A;  3S2D B;  3F1Z A;  4EQO A;  2G5D A;  4O2D A;  3BVG A;  3J81 c;  1G29 1;  2L9H A;  4GN5 A;  2EXZ A;  1B9M A;  2MGS A;  3NBH B;  1II3 A;  3HOW B;  1CSQ A;  1LTT D;  5JJZ A;  1HA6 A;  2D2C C;  2F0U A;  1KLU D;  3E6Z X;  2K5W A;  1SYD A;  2JK8 A;  4FNF A;  4BXX H;  3BVZ A;  4WJ4 A;  5IGC A;  4GKJ Q;  1LT5 D;  3RR5 A;  3GTJ B;  5M3M G;  2JA9 A;  1WI5 A;  4KHP Q;  1HRJ A;  2J7Z A;  2PI2 A;  3UE1 A;  4DPG A;  4BXX G;  1PH3 A;  5C4X B;  3AU7 A;  3S17 H;  5E4W C;  1BQQ T;  4H02 A;  3Q0A A;  2E2H B;  4DR4 L;  1TS4 A;  2NZH A;  4HSV A;  1K0S A;  5I6Y A;  3S2H B;  3H09 A;  3FDT A;  5ELB A;  5LL6 S;  5FLM G;  1LT3 D;  1YVC A;  5BR8 L;  2RKS A;  2IY5 B;  3BZD B;  2MP1 A;  2AQ2 B;  1F77 A;  4YCV A;  1G51 A;  1PHJ A;  4OHJ A;  2A68 D;  5DNF A;  4IFD J;  1AW7 A;  5ISR A;  2A73 B;  2CW0 C;  1IBL L;  5I2Y A;  2CQO A;  4LWC A;  1CFM A;  2E2I H;  1U4P A;  4FYD A;  4YIJ A;  1S5D D;  2EXD A;  1A2U A;  4DR2 L;  5ELD A;  4L6T B;  1IYU A;  1X3F A;  5M5W H;  5C44 H;  1VF7 A;  3OWE B;  4BBS H;  5C44 B;  4B3T Q;  1SND A;  1MD2 D;  4KN4 C;  4B3M Q;  3C1E A;  4K8I A;  1SE8 A;  3RD4 A;  1Y14 B;  5C4X G;  4JCV E;  4DGZ A;  1LTA D;  1EYA A;  1ESF A;  3CRL C;  5IT9 L;  1AZP A;  4UY8 C;  4C3I H;  4A3E B;  1E24 A;  3F8T A;  3PIP A;  1B1Z A;  4PMC A;  4XYO A;  1EIH A;  5IYC G;  5JOB A;  2LXJ A;  3CKI B;  3SVM A;  2UUB Q;  2JP1 A;  1WTV A;  3S1M B;  3F2D A;  2RSO A;  4FXG C;  5DM6 3;  3NQI A;  5IGD A;  3QOJ A;  4UAI A;  3UDX A;  4NXM Q;  2ZXP A;  4CDD C;  4QMG A;  3S14 B;  4O42 A;  1HPC A;  4WOR A;  4GZY C;  1XNQ L;  1WTX A;  1L1O C;  1PH6 A;  1EY8 A;  1H95 A;  4XQJ A;  1YBY A;  2PMZ E;  3OSO A;  2WAQ B;  3NTH A;  3WOF A;  4LFA L;  4JI6 Q;  3KLR A;  2F0F A;  2E2D C;  1Y1W G;  3LNN A;  4LF4 Q;  1B3Q A;  2WII B;  1HZA A;  5M3F H;  3ZJY C;  2EY2 A;  1WCM G;  2Z4H A;  3AFQ A;  3I91 A;  3IAY A;  1LO5 D;  1SYF A;  4LF8 L;  1AEX A;  1XPR A;  4XDX A;  1AN8 A;  2Q8T A;  4MTK A;  1J5E L;  2B2Y C;  3CC2 A;  5KGU A;  2B39 A;  4I7A A;  5FO9 B;  4A3M B;  4BY7 H;  3SK4 A;  5IT9 c;  3MFG A;  1RF2 D;  3UE0 A;  2PYK A;  1JOQ A;  3R2I A;  3D4R A;  1I5F A;  3TRZ A;  1N9W A;  5C3E G;  2A8V A;  5E3F A;  3HKZ E;  1BKB A;  3MEH A;  3HFZ B;  1SXT A;  3ERS X;  4UHV A;  2EIF A;  2LS0 1;  1SJE D;  1FGB D;  1U4M A;  3RLF A;  2NVY H;  3W3A A;  1N32 Q;  2D62 A;  1QJO A;  5M5X H;  3GDE A;  1WJJ A;  2Z0S A;  5C3E H;  2K7V A;  3HOX G;  2NVY B;  2R7Z H;  5C4H A;  2ICE C;  3NPP A;  1HQM C;  1CKN B;  4OWT B;  1EWC A;  4ZYS A;  1GO3 E;  3TZD A;  1SAP A;  3QWN A;  1IW7 C;  2EYH A;  3V05 A;  1SN8 A;  1PMR A;  1QE6 A;  4YWL A;  1WCM B;  4LUO A;  2YTX A;  4OO1 G;  2B63 H;  2K5N A;  4DV0 Q;  2BA1 A;  3PO2 G;  2P5Z X;  1TWH H;  2F0G A;  1MKH A;  1S4Z A;  4K8J A;  2PO4 A;  4GLX A;  4ABN A;  1I6H H;  2EPB A;  4AYB G;  1S5F D;  3PO2 H;  4QY7 A;  4FXD A;  5BR8 Q;  1TWC B;  4R4O A;  1EWH A;  1SEB D;  3KDF A;  3T1Y Q;  4JOI A;  3MAQ A;  4P74 A;  2L4N A;  1WYD A;  3MXN A;  5DAU A;  4C1N I;  2NTS A;  2XRS D;  5JJK A;  2Z6B A;  1LUZ A;  3NTI A;  4OGQ C;  1SDF A;  2F3W A;  1CK1 A;  4MIU A;  4BBR G;  5EGT A;  5A2Q L;  3CCS A;  5CC4 A;  1EIY B;  1O78 A;  4IPH A;  1HNZ Q;  5IP7 G;  2O5I C;  1J8I A;  1I6V C;  3CQZ B;  3S16 B;  4GKJ L;  1Y1V G;  3IKJ A;  3GD7 A;  2A6E D;  3GTK H;  3JAM c;  2RF4 A;  1B2T A;  3F2C A;  2YU9 B;  1EY0 A;  4LF6 L;  4JV5 L;  4JPB W;  4X62 L;  4L8J A;  4P72 A;  5F2D A;  1FGU A;  4H0L C;  4X66 L;  3L7Z C;  1DOK A;  3OOC A;  2NTT A;  4A3E H;  3PSI A;  4ZUJ A;  1HCZ A;  2CH4 W;  4YWM A;  4DK6 C;  3D4W A;  5JEA H;  3H15 A;  3OMC A;  4C2M B;  4BBR B;  1JMC A;  5L37 A;  2VQF L;  4BS9 A;  2KHJ A;  1HR0 Q;  2MPM A;  1IBK Q;  2EYL A;  3ULL A;  1K9M C;  5IYD G;  1K8A C;  3GTL B;  1QNK A;  1U4R A;  3SK8 A;  3JAM E;  1N34 Q;  2O5J C;  4YCW A;  3S2D H;  3TZU A;  3HZX A;  1XNQ Q;  1NE3 A;  4JI2 L;  2RVL A;  2KCC A;  2A69 D;  4DR4 Q;  2RQX A;  3UDG A;  2E2H H;  4LF7 L;  4XQQ A;  4LF4 L;  4PMW A;  4PZ8 A;  4NXN L;  4ILW A;  3EIV A;  4Y7N H;  2NVQ H;  4XXE A;  4J1M A;  4HCE A;  1LYL A;  2I0Q A;  1PH8 A;  3QIA A;  5IWA Q;  3J81 i;  1KRS A;  1WTQ A;  2B63 B;  1BF4 A;  3GTM H;  3NWT A;  1B53 A;  2QEJ C;  4ZKC B;  3A5Z B;  2CCZ A;  2LY7 A;  1DON A;  2FMC A;  5M3F G;  4KKT A;  2Q2T A;  2KEC A;  1FYC A;  1VQE A;  2M00 A;  1MHW C;  3I4L A;  3MA2 B;  3TRE A;  3DHQ A;  2R7F A;  1CKM A;  2JA6 B;  3PF5 A;  2NZ1 D;  2A6E C;  3G48 A;  2H5X A;  1GUN A;  4OIJ A;  5C4J H;  4KTA A;  4KLK A;  3PV0 A;  4KJN A;  1NMG A;  1LV9 A;  1SNO A;  4RFB A;  1YNN D;  3KBG A;  1FVI A;  1NCV A;  4YCU A;  4JI8 Q;  1D8L A;  2JA8 B;  4OXP A;  4LF5 L;  1Z47 A;  3D3R A;  2AUK A;  1PRT D;  3PIO A;  3S1M H;  2Q2U A;  3CPW A;  4AH6 A;  1PH2 A;  2K03 A;  4EQN A;  4CGY B;  3HOV G;  2CVR A;  2K32 A;  3P20 A;  5EJW A;  3P75 A;  5GQO A;  4DXG A;  4RG1 A;  4KY7 A;  3DWA A;  3ULP A;  2EE1 A;  1G6Z A;  3H94 A;  3BZC A;  4XT3 B;  1Q7Y C;  4DKA C;  5IYB H;  4KKS A;  3F2U A;  3J80 L;  3C46 A;  1IKM A;  2UXC L;  4DR1 L;  1KDA A;  4QCL A;  1T9H A;  4CKE A;  1LAB A;  1MSH A;  1NMF A;  3A55 A;  4K2K A;  3T16 A;  2DNC A;  1Y8P B;  4RKL A;  4ZAI A;  4X64 L;  3HOW H;  4APV A;  3NSW A;  5GAD C;  3J80 i;  1CZG A;  3PUV A;  3GP7 A;  4ZRZ A;  1HFG A;  4Y7N B;  1OXT A;  2OF1 A;  3L0O A;  2B3G A;  1SSO A;  2WIN B;  4X66 Q;  4JI0 Q;  3TDQ A;  2KHS A;  5M3F B;  5C0X G;  3N52 A;  3NHH A;  4GN4 B;  5C3W A;  1M1K C;  3BYY B;  1L0W A;  3H0G G;  4JYA L;  1X54 A;  2GA4 B;  5JJI A;  2N8N A;  3KK7 A;  1GVP A;  1EY6 A;  3FPU B;  4PQX A;  1W2B A;  1IYV A;  1IZ6 A;  1RL2 A;  2R3Z A;  3CP0 A;  1VQD A;  2FXQ A;  2K5Q A;  4L63 B;  4TQU S;  1K73 C;  3HRZ C;  1P16 A;  4WJW A;  4C1N K;  1Q3L A;  2I07 B;  5C5L A;  5M5X B;  2K75 A;  3S1R H;  3O13 A;  2ZJR A;  3M85 A;  3BU2 A;  1WTW A;  4RHS A;  4DV7 L;  1C4Q A;  1QUQ A;  2NN6 G;  1PRT F;  3T51 B;  4YY3 Q;  4LUZ A;  3A74 A;  3SXH A;  3NE5 B;  3PIP 3;  1VQI A;  1XMO L;  5EKL A;  1GOZ A;  5M5W B;  5KEE A;  4IPD A;  2B2W A;  2UUC Q;  3KFU A;  1B7Y B;  3HOZ H;  3J81 E;  5CR3 A;  4IJL A;  1K83 H;  5LMU L;  1G6P A;  4C3I G;  1EYC A;  4ID6 A;  1BCP C;  1FJG Q;  1CHP D;  3RZD B;  1X9N A;  2DGY A;  1KQS A;  1YJ9 A;  4XQN A;  2GVA A;  1XPO A;  1KIX A;  4ME5 A;  3EBE A;  3VYR A;  4G7Z C;  3GTM B;  1XWE A;  2ES2 A;  1UE1 A;  4IPG A;  4A93 B;  2WP8 J;  1TWA H;  1I6H B;  2H1E A;  1VQM A;  1STH A;  4DK0 A;  2DJF C;  3TSS A;  4C3I B;  3J81 j;  1TWH B;  3CCV A;  2JN4 A;  4WFN 3;  1EOV A;  1TS2 A;  3HKZ B;  1PV4 A;  1UWV A;  4JI3 L;  1ILQ A;  2A19 A;  1I4Q A;  1BUV T;  4POF A;  5C5M A;  2UU9 L;  3A8I E;  2IWH A;  2B2Y A;  1QWY A;  3SDZ A;  1SNQ A;  3FKI H;  3WDN A;  4B3S L;  1K28 A;  3M4O H;  1NR4 A;  4QQB X;  1WD0 A;  4OX9 Q;  4JI7 L;  2F4V Q;  2F0E A;  2IW3 A;  2ZTD A;  2JQO A;  1XX8 A;  4K5W A;  4K2L A;  4A3J G;  1I50 B;  1XMQ Q;  5FLX c;  1KAB A;  1BBX C;  3E5S A;  4JC0 A;  1YNX A;  4O1N A;  2NYZ D;  1PFB A;  1QUQ B;  3IFD A;  3TP5 A;  5CV5 A;  4DK3 C;  1W6J A;  2B2V A;  2AWN A;  4A93 G;  4TRD A;  2CFM A;  4RA8 A;  2D0P A;  3QOL A;  4C2M H;  3SE0 A;  1YIJ A;  1HJP A;  4FF3 A;  1XMQ L;  4AQY Q;  1EUJ A;  3L2P A;  2F0W A;  4S3S A;  1MIU A;  3A7A B;  1QCB D;  4DN4 M;  4E6I A;  2MHV A;  4ZLT F;  1MSG A;  3M7G A;  1WVL A;  5J3B A;  1OXV A;  1A63 A;  2MNA A;  3RN5 A;  2R92 H;  4A3B H;  2A74 C;  2WB1 B;  4LF5 Q;  1ZEQ X;  1Q82 C;  3H3V H;  3EN2 A;  2PNR C;  4RCO A;  2JSO A;  1IBM L;  1GKH A;  3I72 A;  2IX0 A;  3ONA B;  4CDF C;  1PH7 A;  2JXM B;  4LF6 Q;  3K6O A;  2R61 A;  1GUT A;  3S17 B;  2N3S A;  1VQO A;  4HR7 B;  3H91 A;  4A3I G;  2B63 G;  1AP0 A;  3GV3 A;  5EPJ A;  1BR9 A;  3LWU A;  3U9S A;  4N8X 1;  2EZV A;  1CQF A;  2F0Q A;  3CCE A;  1FNU A;  1TVX A;  3LGJ A;  5JEA J;  2B8G A;  5D3D A;  4JI4 Q;  5EBD A;  3L3O C;  1RTN A;  1VQH A;  1IW7 D;  1DZ1 A;  2JA6 G;  2SNM A;  3ND8 A;  3D4D A;  2BDN A;  1HH2 P;  1D5Z C;  3NBH A;  4LFC Q;  5D65 A;  2OTJ A;  1VQK A;  2UUB L;  1X3G A;  1QVC A;  1SE3 A;  1Q46 A;  4L5Q A;  4B3R L;  1WTO A;  2K28 A;  3MEF A;  2O4X A;  3CRK C;  3ER0 A;  2UU9 Q;  4BBS B;  2NZO A;  3HEJ A;  3PUW A;  5IP7 H;  1SR3 A;  2E75 C;  3VR2 A;  2HCI A;  5I6W A;  2JE6 I;  4A3I B;  4JI0 L;  1ZYR C;  1D6E C;  3PCO B;  2EQS A;  4N8F A;  2EYF A;  5HGT A;  3DEP A;  1I94 L;  5LMN L;  5M5Y B;  1O7Y A;  3A5U A;  1D1I A;  2N49 A;  2Q2I A;  3CHB D;  4QUC A;  4DR7 Q;  1SMY C;  1Y8N B;  1DCZ A;  3CCU A;  5T1I A;  5E1F A;  4BY1 G;  3ND9 A;  2XN9 C;  5FKA C;  1EZ8 A;  2F0M A;  1TWA B;  3C1F A;  1JQY D;  2HIV A;  3SGI A;  1SRO A;  4DU9 A;  1SLJ A;  1HNZ L;  4B3R Q;  3EVQ A;  2KA7 A;  1EY4 A;  5IE8 A;  3CCM A;  5BN5 A;  1U0L A;  3OW7 A;  4A3C H;  2E5L Q;  2JA7 G;  4QGU A;  2YYZ A;  4NMZ A;  1K8M A;  2CQA A;  4CJ0 B;  2RHQ B;  1SFO H;  3G4S A;  4CKB A;  4A76 A;  3KJP A;  4L5T A;  3E9H A;  1PLF A;  1VQG A;  4KI0 A;  2PQA A;  3CXC A;  3Q24 A;  4KD3 A;  2PZT A;  1IHZ A;  1FNV A;  5FJ8 G;  2RBM A;  5CV6 A;  2R7Z G;  2NWG A;  1GD7 A; 
#chains in the Genus database with same CATH homology
 3DLL A;  4BBR G;  1N36 L;  1HR0 W;  2UXD L;  3GTG H;  5C4X H;  3CCS A;  2BH8 A;  4DUY L;  1HZC A;  4A3K G;  1ASZ A;  1OTC A;  4JI1 L;  4A3D G;  1EIY B;  4GNX B;  1MJE A;  4JI3 Q;  4IPH A;  1CUK A;  1HNZ Q;  5IP7 G;  4HIM A;  1HZ9 A;  1IBM Q;  4C3J H;  1PH1 A;  1VQJ A;  3BZK A;  1Y1V G;  5IY0 A;  4GKJ L;  3CAM A;  1X6O A;  3GD7 A;  1IBL Q;  2F4V L;  3GTK H;  3JAM c;  2RF4 A;  2CKZ B;  3K8A A;  3F2C A;  4JV5 L;  2N78 A;  4LF6 L;  4X65 L;  1PFS A;  4X62 L;  4KHP L;  4IJH A;  1A8V A;  3KYH C;  4P72 A;  3STB D;  1CKO A;  2ID0 A;  4A3I H;  2Z6K C;  4ALP A;  1L1O B;  1FGU A;  1K0R A;  1WFQ A;  2MO0 A;  4DUZ L;  4X66 L;  4HJ8 A;  4B3S Q;  4HIK A;  3L7Z C;  4JV5 Q;  5C0X I;  2E8G A;  5LMN W;  4A3E H;  1D7Q A;  3PSI A;  4XIG S;  5JJL A;  3HOU G;  2VZA A;  4ME3 A;  4YWM A;  4DK6 C;  2VW9 A;  1OXS C;  3CCJ A;  2F52 A;  3H15 A;  1O7I A;  3KOJ A;  4MNO A;  4JI5 L;  3W5O A;  1JMC A;  3KLW A;  2VQF L;  4LFB Q;  2KHJ A;  1Q1E A;  1HR0 Q;  1IBK Q;  3ULL A;  1K9M C;  1N36 Q;  4KHZ A;  1WCM H;  5IYD G;  1K8A C;  3D0F A;  1VQF A;  3I4N H;  1N34 Q;  4O0A A;  4FDB A;  2JJQ A;  2KHI A;  1VQC A;  2YV5 A;  4YCW A;  3S2D H;  3M4Q A;  1YJN A;  2AHO B;  2JA8 G;  3RNU A;  2R92 G;  2YTY A;  4GNX C;  4A3B G;  1R9T H;  3I4N G;  1XNQ Q;  4DR2 Q;  5M5Y H;  4GLA C;  1NE3 A;  4JI2 L;  3M3Y H;  2VUM G;  1L1O A;  4Y52 H;  2I5H A;  4P73 A;  2ZJP A;  2DUD A;  4AIM A;  2WB1 G;  2JA8 H;  4DR4 Q;  4LFB L;  1HNW Q;  1V9P A;  3UDG A;  2JA7 H;  5IYB G;  2E2H H;  2Y0S E;  1S3O A;  1KRT A;  4HJA A;  4LF7 L;  1TWF H;  4GKK Q;  4LF4 L;  2IHE A;  2L15 A;  4PMW A;  4PZ8 A;  4NXN L;  3EIV A;  1X65 A;  4Y7N H;  1XNR L;  2NVQ H;  3HOY G;  1LYL A;  1IXR A;  4GNX A;  4A3E G;  2I0Q A;  3FHW A;  3VDY A;  5H1S E;  3STB C;  1PH8 A;  3CME A;  1VQN A;  1J6Q A;  5IWA Q;  3J81 i;  1KRS A;  1EFW A;  3AEV A;  4X64 Q;  3U50 C;  4UP9 A;  3GTM H;  1VQ5 A;  1A0I A;  4DR3 Q;  5IYC H;  1EYG A;  3A5Z B;  5IP9 G;  1HR0 L;  2CCZ A;  5M3F G;  1PA6 A;  1N8R C;  2JA6 H;  2Q2T A;  1JT8 A;  1S40 A;  3I2Z A;  1VQE A;  2K5V A;  3TRE A;  3S1N H;  2PQA B;  4DV2 Q;  2F3I A;  1SMX A;  3OW2 A;  4A3K H;  1XMO Q;  2R7F A;  1CKM A;  4JI2 Q;  4LFA Q;  2K4K A;  5C0X J;  3PF5 A;  1EWI A;  4A3L G;  3G48 A;  1PVO A;  5HY6 A;  5LMU Q;  2LSS A;  2XGT A;  3S16 H;  2H5X A;  1YHB A;  3ICE A;  1HNW L;  1KAW A;  2OCE A;  5C4J H;  3I4M H;  1DGS A;  3G71 A;  3RLN A;  1Z9F A;  4KLK A;  1GD7 A;  3PV0 A;  1BVS A;  1NMG A;  2ZJQ A;  1PH5 A;  2UUA Q;  4YY3 L;  4R1J A;  4YWK A;  4IFD G;  1E3P A;  3CPF A;  4IO9 A;  3T1Y L;  2NVX H;  3PUY A;  1FVI A;  4BBS G;  1X56 A;  4YCU A;  1SRU A;  3NEN A;  1Q12 A;  4JI8 Q;  2HT1 A;  1D8L A;  1NTG A;  4POG A;  3GTQ H;  4OXP A;  2CWA A;  4IPC A;  4LF5 L;  1UEB A;  1Z47 A;  1VQ9 A;  2R6G A;  3FKI G;  1QZG A;  4GS3 A;  5E7N A;  1VS0 A;  1N33 L;  4R4Q A;  3PIO A;  2ZM6 L;  4LF7 Q;  2Q2U A;  3S1M H;  5GAE C;  2MFI A;  3CPW A;  4QL5 A;  4AH6 A;  5HGQ A;  1X55 A;  3S24 A;  1PH2 A;  2UXB Q;  3RZO H;  3HOV G;  5AJ3 Q;  3U4V A;  3G6E A;  3RLO A;  1HNX Q;  2V1C C;  3TQY A;  4A3G H;  1YI2 A;  1N34 L;  1Q8K A;  3GTL H;  2ALY B;  4AYB E;  5GQO A;  2PNH A;  2VS1 A;  1I3Q H;  5ELO A;  4RG1 A;  4K0K Q;  3D31 A;  2B29 A;  4DV4 Q;  3M7N A;  3ULP A;  4YHH Q;  3HOY H;  2IX1 A;  4EX5 A;  4HIO A;  4X6A H;  5DLQ E;  4K0K L;  3BZC A;  4GOP C;  1IL2 A;  5M3M H;  1Q7Y C;  4DKA C;  4JI4 L;  5IYB H;  4DR6 Q;  2K5H A;  1Q81 C;  3S1Q H;  1VQ6 A;  3K80 C;  2NVT H;  1E1T A;  1HNX L;  3KDF B;  2WAQ G;  3GTJ H;  2UXC L;  4DR1 L;  2WFW A;  2VQE Q;  3U4Z A;  2VY3 A;  1T9H A;  4EQ5 A;  1S72 A;  1NMF A;  2KBN A;  3H3V I;  2Z6K A;  4JI7 Q;  1PYB A;  1E1O A;  1XTD A;  2ZTC A;  2RCN A;  4A3F G;  4X64 L;  3K81 C;  2JEA I;  4PG3 A;  3HOW H;  1TWC H;  4APV A;  5IYD H;  3TEH B;  1VQ4 A;  1K3R A;  5AJ3 L;  3KF6 B;  3J80 i;  5IP9 H;  5GAD C;  4DV7 Q;  3PUV A;  2OWO A;  4GN3 B;  3HOX H;  2Y0S G;  1L2F A;  2C35 B;  2WAQ E;  2XTI A;  1FL0 A;  1OXT A;  3OYY A;  1HZB A;  2WB1 E;  2HHH Q;  3L0O A;  2B3G A;  4X66 Q;  3HOZ G;  2AMC B;  4OX9 L;  1YJW A;  4JI0 Q;  3S2H H;  2R93 H;  1AH9 A;  4UP7 A;  2VQE L;  1BBW A;  1CSP A;  4C3H H;  4DV6 Q;  2BH2 A;  4DR1 Q;  5C0X G;  1XPU A;  4GN4 B;  3CF5 A;  2HQL A;  1M1K C;  4BY1 H;  4IFD I;  2ZM6 Q;  1L0W A;  4LF9 L;  3H0G G;  3J7Z C;  4NB3 A;  1EQQ A;  2R93 G;  1V1Q A;  4JYA L;  1X54 A;  4OWW B;  3CQZ H;  3TS0 A;  4DR6 L;  3I4M G;  5JJI A;  2N8N A;  4GOP B;  3K7U C;  1GVP A;  1OXX K;  2JA5 G;  1W2B A;  3T1H L;  1IZ6 A;  1RL2 A;  3AFP A;  3W1B A;  3JAM i;  3CP0 A;  1TWG H;  1VQD A;  1JE5 A;  2FXQ A;  4A3C G;  1Y1W H;  4MZ9 A;  4TQU S;  2RHS B;  5GAH C;  1K73 C;  4TVA B;  2YU9 H;  1P16 A;  3MXN B;  3PGZ A;  1P8L A;  5GRO A;  3U58 A;  4R4I A;  3RZD H;  2K75 A;  2ASB A;  3J7A 5;  1TXY A;  3S1R H;  1KD1 C;  1E7Z A;  4JI5 Q;  2ZJR A;  3M85 A;  3BU2 A;  2E2J H;  3F1Z A;  4DV7 L;  1QUQ A;  3KJO A;  3I4O A;  2QA4 A;  2NN6 G;  1JB7 A;  4A3M G;  4JI1 Q;  5FLM H;  4YY3 Q;  4O2D A;  1XJV A;  4LUZ A;  2K14 A;  3A74 A;  3HKZ G;  2UUA L;  4UP8 A;  3CD6 A;  1YHA A;  3GTP H;  1XMO L;  1VQI A;  3J81 c;  4BY7 G;  1G29 1;  4GN5 A;  4IPD A;  2UUC Q;  3HOZ H;  1EQR A;  1B7Y B;  3KFU A;  1U5K A;  4A3L H;  4IJL A;  3NBH B;  4BBR H;  1K83 H;  5LMU L;  4DV6 L;  1CSQ A;  1G6P A;  1JJG A;  4DV3 L;  1FJG Q;  1X9N A;  2DGY A;  1KQS A;  1YJ9 A;  3NEL A;  2GVA A;  2JK8 A;  1XPO A;  1QVG A;  1KIX A;  3CC4 A;  4BXX H;  4A3D H;  4R4C A;  4R4T A;  1RIP A;  3EBE A;  4JBK A;  4GKJ Q;  1GM5 A;  1IYJ B;  4WJ4 A;  1V43 A;  3RR5 A;  1B8A A;  4WJ3 M;  2ES2 A;  4DAM A;  1YZ6 A;  1UE1 A;  3A0J A;  1NY4 A;  4IPG A;  2AWO A;  5M3M G;  1Y1V H;  2WP8 J;  4GOP A;  1TWA H;  2JA9 A;  4A3F H;  1WI5 A;  1VQM A;  4OON A;  4X62 Q;  3S14 H;  1ASY A;  4KHP Q;  3UE1 A;  2PI2 A;  4BXX G;  4DPG A;  4LW1 A;  1PH3 A;  2UXD Q;  5GAG C;  4B3T L;  3S17 H;  1K8G A;  3J81 j;  2IT1 A;  3I7F A;  4H02 A;  3CCV A;  3HKS A;  2IHF A;  1EOV A;  4YHH L;  3PO3 G;  1VQA A;  5IWA L;  1PV4 A;  1UWV A;  4DR4 L;  4JI3 L;  2A19 A;  2NZH A;  1AE2 A;  2D0O A;  4POF A;  1KC8 C;  2UXB L;  1EIF A;  2KCM A;  2UU9 L;  3M9B A;  4NXN Q;  4JBW A;  4JBM A;  4GKK L;  5FLM G;  1YVC A;  1JJC B;  4QJF A;  5BR8 L;  1JJ2 A;  2IY5 B;  4YCV A;  1G51 A;  3RN2 A;  3FKI H;  4DUZ Q;  4B3S L;  3M4O H;  1PHJ A;  2UUC L;  4IFD J;  3CW2 C;  3W1G A;  4QQB X;  4OX9 Q;  4JI7 L;  1IBL L;  2F4V Q;  2NN6 I;  1I94 Q;  2CQO A;  1OXU A;  4LWC A;  4PZ7 A;  4OWX B;  3UDI A;  2ZTD A;  2JQO A;  1VQP A;  4A3J G;  2E2I H;  1XMQ Q;  2EXD A;  2R7D A;  5FLX c;  3CMA A;  4DR2 L;  1C7Y A;  1KXL A;  1VQ7 A;  3ULJ A;  4GLV B;  3FP9 A;  4JC0 A;  4P71 A;  1X3F A;  1YNX A;  4JBJ A;  5M5W H;  5C44 H;  3E9I A;  1QUQ B;  3GTO H;  2HIX A;  4DK3 C;  5FJ8 H;  4MTN A;  4IOC A;  4BBS H;  4A93 G;  4DR5 Q;  2AWN A;  4B3T Q;  3AYH B;  3PUZ A;  2CFM A;  4B3M Q;  1SE8 A;  1Y14 B;  4A75 A;  2A1A A;  5C4X G;  1UE6 A;  2D0P A;  4C2M H;  1YIJ A;  4IOA A;  2I5M X;  2GN5 A;  1HJP A;  4JCV E;  2E5L L;  1XMQ L;  4AQY Q;  4JG2 A;  1EUJ A;  4UY8 C;  4C3I H;  3L2P A;  4DR3 L;  1MIU A;  2YTV A;  1LM0 A;  1E24 A;  5K36 G;  3F8T A;  3PIP A;  5IYC G;  2GVB A;  5J3B A;  1OXV A;  2LXJ A;  2ZTE A;  1X3E A;  2MNA A;  4DV5 Q;  2UUB Q;  3RN5 A;  2R92 H;  1A63 A;  3F2D A;  4A3B H;  2ATW A;  4L5R C;  4LF5 Q;  3H3V H;  4DV0 L;  1Q82 C;  3EN2 A;  2VQF Q;  1YHQ A;  4RMF A;  1NBW A;  4P75 A;  1IBM L;  1GKH A;  3DM3 A;  2QGQ A;  1M90 C;  1VCI A;  2IX0 A;  2BA0 A;  1PH7 A;  1CKN A;  5LMN Q;  3B6Y A;  4HID A;  4LF6 Q;  4AQY L;  1XNR Q;  2N3S A;  2KEN A;  1VQO A;  2CWP A;  4A3I G;  2OQK A;  3UDX A;  3I56 A;  4LFC L;  3F2B A;  4LF8 Q;  4NXM Q;  2OTL A;  2B63 G;  3IRB A;  3NEM A;  1XNQ L;  4JOI C;  4A93 H;  1L1O C;  4DV2 L;  1PH6 A;  4DV4 L;  4PZ6 A;  3CCE A;  4B3M L;  3KF8 B;  3LGJ A;  1H95 A;  1YBY A;  2K50 A;  2I5L X;  2PMZ E;  3K0X A;  5JEA J;  4NPS A;  4LFA L;  4JI6 Q;  3KF6 A;  4JI4 Q;  1B70 B;  1VQH A;  3JC6 6;  3I55 A;  1Y1W G;  2Q2H A;  4LF4 Q;  4LF9 Q;  3S15 H;  1HZA A;  4BA1 I;  5M3F H;  3ZJY C;  1YIT A;  2JA6 G;  1WCM G;  3AFQ A;  1HH2 P;  1W3S A;  2VUM H;  1WOC A;  4LFC Q;  4BA2 I;  4XTC S;  4LF8 L;  1QVF A;  3TS2 A;  4DV1 L;  2HHH L;  1XPR A;  1VQK A;  2OTJ A;  4DV5 L;  2UUB L;  1X3G A;  4HJ5 A;  1BBU A;  1QVC A;  1QZH A;  2PI2 E;  5C44 G;  4HJ9 A;  3PUX A;  1Q46 A;  1YEZ A;  3CCQ A;  4L5Q A;  3J80 c;  4JI8 L;  4B3R L;  1J5E L;  3UDF A;  3E0E A;  3CC2 A;  3PF4 A;  2VL6 A;  1NJI C;  4A3J H;  1VQ8 A;  4BY7 H;  2JA5 H;  5IT9 c;  3MEF A;  3UE0 A;  4JYA Q;  3ER0 A;  3K7A H;  2UU9 Q;  2NZO A;  4NXM L;  4A4I A;  3BJU A;  2KCT A;  3PUW A;  2AKW B;  1I5F A;  5IP7 H;  3TRZ A;  1SR3 A;  1N9W A;  1Q1B A;  1C9O A;  5C3E G;  1A62 A;  3CC7 A;  2A8V A;  4DAY B;  3HKZ E;  2OQ0 A;  2JE6 I;  3HOU H;  4JI0 L;  1BKB A;  2EQS A;  3HFZ B;  3PCO B;  3ERS X;  5JEA G;  2EIF A;  3HOW G;  3RLF A;  2NVY H;  1E22 A;  1UE7 A;  4L5S A;  1N32 Q;  1I50 H;  3M4P A;  2MQH A;  2D62 A;  5M5X H;  3AQQ A;  3GDE A;  1WJJ A;  2Z0S A;  5C3E H;  1I94 L;  3HOX G;  3Q8D A;  5LMN L;  4JI6 L;  1IBK L;  1N32 L;  4HJ7 A;  4DV3 Q;  1FJG L;  2R7Z H;  2QEX A;  1CKN B;  2Q2I A;  1PYS B;  2N49 A;  4OWT B;  3A5U A;  1GO3 E;  4DR7 Q;  3T1H Q;  1PH9 A;  2JEB I;  3CCU A;  2LXK A;  4X65 Q;  5EAY A;  4BY1 G;  1SN8 A;  4DV1 Q;  3CCR A;  2MO1 A;  4YWL A;  4QIW E;  4LUO A;  4DR5 L;  4A3G G;  2YTX A;  1KL9 A;  1VQL A;  4OO1 I;  2UXC Q;  2HIV A;  3SGI A;  1SRO A;  4B3R Q;  1SLJ A;  1LTL A;  4LUV A;  1HNZ L;  4LNQ A;  2B63 H;  4OO1 G;  2K5N A;  1J5E Q;  5IE8 A;  3CCM A;  4DV0 Q;  1U0L A;  1C0A A;  2BA1 A;  3PO2 G;  4A3C H;  1MJC A;  1VQB A;  2E5L Q;  4QGU A;  1TWH H;  1Q86 C;  2JA7 G;  1MKH A;  2YYZ A;  3OTO L;  4J15 A;  4GLX A;  2RHQ B;  2K52 A;  1SFO H;  3G4S A;  4UPA A;  1I6H H;  1UE5 A;  3H0G H;  4AYB G;  3KJP A;  4A76 A;  3PO2 H;  4QY7 A;  3WWV A;  3OTO Q;  4L5T A;  5BR8 Q;  3E9H A;  4R4O A;  3HOV H;  1VQG A;  3KDF A;  4KI0 A;  3T1Y Q;  2PQA A;  4JOI A;  4P74 A;  3CXC A;  4A3M H;  3PO3 H;  1KHI A;  1PH4 A;  1WYD A;  1AE3 A;  4DNI A;  3CCL A;  5ELN A;  5JJK A;  5FJ8 G;  2VNU D;  4DR7 L;  1LUZ A;  2R7Z G;  4DUY Q;  1N33 Q;  3GO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...