3KF6B

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
b'PLGSDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6B00
2ZJQA 3OTOL 1G51A 2VW9A 2JA6G 3PUWA 1JJCB 1W3SA 3LGJA 1CKNA 2GVAA 1XNQQ 1MKHA 1EWIA 1YITA 1I3QH 4UY8C 4A3BG 4OO1G 3KF6B 4YHHQ 4NXML 3CW2C 2E5LL 1PH7A 4DKAC 3S17H 1GKHA 4P73A 1NJIC 4LF6L 1BBWA 4GN3B 4BBSG 3PSIA 1C7YA 3RZOH 1PH5A 4QIWE 1X3EA 1VQAA 5ELOA 3HOZH 4AQYL 4AYBG 2ZJPA 5JEAJ 4DV2L 3CC4A 5DLQE 4LF8L 1PYSB 5IE8A 3CCQA 4DR3L 1TWAH 1Y1VH 3H3VI 3E9IA 3BZKA 4MNOA 3CMEA 5ELNA 1HZBA 3K81C 4DNIA 1VQDA 1LM0A 5FLMH 3JC66 4C3JH 1Z47A 1CUKA 3FP9A 3KDFB 4DUZL 2JA8H 2DGYA 1X3GA 1YHBA 5M5YH 3GTOH 2JJQA 1N33L 3HOYG 4B3TL 3ULJA 4C2MH 5C0XJ 1NTGA 2EQSA 4LF9L 2KHIA 1IBLL 1VQEA 3FKIH 1KD1C 4BXXH 2ZJRA 1E3PA 3W1BA 3S1RH 4B3TQ 3RLOA 4OO1I 4QL5A 4R4IA 1UE7A 4IOCA 4LF9Q 1IBLQ 1UE6A 1B70B 3S1QH 1H95A 3NELA 4JI6L 4PZ7A 4BY1G 1EUJA 1PH6A 4HJ9A 4LF5Q 4JI1L 2QGQA 5M5XH 2ZTEA 1K73C 3E9HA 4X66Q 1YZ6A 3CD6A 4OONA 5IT9c 4LF4Q 4A93H 1FJGL 1VQMA 2B63G 4KLKA 4HJ5A 1KC8C 3TRZA 2UU9L 2F52A 1PVOA 4H02A 2NZOA 4DV7L 2K52A 1S3OA 1JB7A 2V1CC 3AFPA 1V1QA 2VS1A 4DV4L 2JA5G 3T1HQ 2VQFL 4OX9L 2R7ZG 4JI0L 1HR0W 4DV7Q 3HOWG 5E7NA 4DAMA 3CQZH 1Q82C 4XTCS 2HIVA 2D62A 2YTYA 2ID0A 4IPHA 3BJUA 3HOXH 3TS2A 4BY7G 1NBWA 1A8VA 3JAMi 3CCUA 4A3KH 4JI0Q 5IP7H 1XMOQ 3I4MH 3PO2H 2Q2UA 3GD7A 4A3JG 2D0PA 2LXKA 4YY3L 4L5TA 1TWHH 2K5HA 1SR3A 3PCOB 5C3EH 1DGSA 3G4SA 4LF7L 4A3FH 2LSSA 1X65A 4BBRH 3HOUH 4MTNA 1X54A 3RN5A 4DV1L 1J5EL 3I4OA 1TWFH 2MFIA 4NPSA 4P74A 3OYYA 1PH2A 2K50A 4JBMA 1QZHA 2UXDL 1EFWA 1VQ8A 4JBWA 1T9HA 4EQ5A 1FVIA 2VY3A 2JE6I 4JI7L 1J6QA 1Q12A 1YIJA 4POFA 1FL0A 1CKNB 4K0KL 1CSPA 2ZTCA 4X64Q 5JJKA 2IX1A 1CKOA 4A4IA 3U50C 4GKJL 4DR7L 5M3FG 1I50H 1V9PA 4Y52H 1PH3A 3HKZE 1L0WA 1NE3A 5FLXc 4DR2L 1PHJA 1X56A 2YV5A 4O2DA 2WB1G 4A3CG 4DR7Q 1LTLA 2YTVA 1HNXL 3JAMc 3PO3H 5AJ3Q 4A3MH 1HJPA 4DR2Q 1Y1WH 4JI2L 4A3LG 3STBD 2HHHQ 5J3BA 3CCSA 4KHPL 1Q8KA 1D8LA 3UE1A 4IFDJ 1K9MC 3STBC 3PF5A 1HNXQ 1I6HH 1N32L 2I5HA 2R93G 2JA6H 3K7AH 3BU2A 3EIVA 4P72A 2JA7G 2R92H 1CSQA 4KHPQ 2UUBQ 1Z9FA 4A3BH 4NB3A 2VQEQ 1D7QA 2UXCL 1EIFA 2K75A 3GTGH 1JE5A 4B3SL 3KJOA 4DV3Q 4LFCL 3PUZA 4DR5L 1K8GA 1E24A 5LMNL 4BBSH 2AHOB 3I4NH 1XNRQ 1L1OA 4IPDA 4X65Q 1MJEA 4LFCQ 3H15A 2R7FA 3D0FA 3AFQA 3WWVA 1EOVA 4DR5Q 2UXBL 2IT1A 2PNHA 1N8RC 2HT1A 3G71A 3S16H 3OTOQ 1N36L 2CWAA 3CMAA 2NVYH 2Y0SG 1VQLA 1VQOA 4JI4L 4IOAA 3S2HH 2UXBQ 1UE5A 1WFQA 2Q2HA 3M4PA 4LUVA 1WCMG 4RG1A 4NXMQ 3HOYH 1HZAA 2QEXA 3UDGA 2KCTA 1FGUA 4R4QA 2E5LQ 3PUYA 3J7ZC 4JI4Q 4JI3L 2CKZB 3S14H 1K8AC 2RCNA 4LF6Q 5JEAG 2DUDA 3U4VA 1YNXA 1Q46A 2JEBI 2OQKA 5GAGC 2RF4A 4GOPA 3G48A 4AQYQ 2KCMA 4DV2Q 4GNXC 4JI3Q 1VQJA 3PF4A 4L5RC 5IYBG 1QVGA 4LFAL 4DR3Q 1AE2A 1E1OA 2UUCL 1HNWL 2L15A 2QA4A 1M90C 2LXJA 1KL9A 4BY1H 2VUMH 5GQOA 1O7IA 2ES2A 3CXCA 1IBML 4DV6L 3HOVH 4A3DG 4DUZQ 2Z6KA 1LYLA 1YJ9A 3RN2A 1KHIA 5C0XG 3HKSA 4WJ4A 3I7FA 2UUCQ 1HNWQ 2BH2A 3CCMA 5IY0A 1N33Q 3H0GH 3Q8DA 3PUXA 3ZJYC 1C9OA 4DV0L 1S40A 3KYHC 2B63H 5HGQA 3M7NA 1NY4A 3RZDH 1MIUA 4YCUA 5C4JH 4LWCA 3CP0A 4PZ8A 4OWXB 3K0XA 3PGZA 3GTMH 1L2FA 2VNUD 4DV0Q 3ICEA 4LW1A 1U0LA 2R7ZH 1VCIA 3D31A 1EQQA 2BH8A 5IP9G 4JI6Q 1OXUA 3TS0A 2N8NA 2I5MX 4UP7A 1HH2P 3I55A 1LUZA 2JQOA 5H1SE 4JI1Q 4JOIA 1SE8A 2AWOA 4A3JH 1PH9A 1E7ZA 3GO5A 4O0AA 1A62A 1KAWA 5FLMG 1KIXA 1FJGQ 2JA8G 4Y7NH 1VQBA 5C44G 2UU9Q 3GTKH 1KRSA 2C35B 4GN5A 2YU9H 2F4VL 2I5LX 1K3RA 3TQYA 5C0XI 1Q1BA 3I2ZA 4QY7A 2CQOA 4IO9A 1YJNA 2KBNA 4DV4Q 3K8AA 1GO3E 2VQFQ 4OX9Q 4GKKL 4OXPA 2F4VQ 1N34L 1C0AA 3RR5A 4GS3A 3ER0A 1MJCA 3T1YL 3CCEA 3CAMA 5GADC 3S15H 3L7ZC 4X6AH 2RHSB 1JMCA 4HJ8A 2N3SA 1AE3A 4JG2A 5M5WH 3CC2A 4DR1L 2HIXA 2K14A 4YY3Q 1NMFA 4OWWB 3T1YQ 5M3FH 2MO1A 2D0OA 4LF7Q 1OTCA 4PMWA 2R6GA 5BR8L 1XPOA 1A63A 3AEVA 1XMQL 4DV1Q 1X55A 4GNXA 1J5EQ 5IYCG 1L1OB 2WP8J 3NENA 1GM5A 3UE0A 2GN5A 1XTDA 4UPAA 5BR8Q 3DM3A 1JJ2A 3AQQA 3W5OA 1R9TH 1Q86C 1XMQQ 4R4TA 3TREA 5GAHC 2OQ0A 3KJPA 2NVQH 4GLVB 1VQNA 3RNUA 2UXDQ 3F2DA 4JI7Q 5FJ8H 1IZ6A 3PUVA 4A76A 4LFBL 2PMZE 4K0KQ 1JT8A 3A0JA 1B7YB 4JI8L 3ULPA 2IY5B 3H3VH 2GVBA 3MEFA 3PIOA 3U58A 1BKBA 2N78A 4GKJQ 1HZCA 1EYGA 5LMUL 4KHZA 4LFBQ 4APVA 4WJ3M 3GTPH 2EIFA 5M3MG 2VZAA 2MQHA 1G6PA 4P75A 2BA0A 2CCZA 3I4MG 3PO2G 1Y14B 5LMUQ 1RIPA 1OXVA 4IFDG 4TVAB 1X3FA 3AYHB 4GOPB 2E2JH 4A3FG 5IWAL 4JI2Q 1IXRA 1NMGA 2PQAA 3CCVA 1VQPA 4L5QA 4JCVE 1I5FA 1IBKL 4ALPA 3M4OH 1N32Q 1QUQA 4ME3A 4HIDA 4JBKA 2EXDA 2Q2TA 2UUAL 3HKZG 4UP9A 4QJFA 2YTXA 4YWLA 4P71A 1IBKQ 1VQKA 3CCLA 2WAQG 4HJAA 1YBYA 4BA1I 4DR6L 1WCMH 4JYAL 2UXCQ 4TQUS 2ZM6L 1VQ5A 4B3ML 4DV5L 4B3SQ 1IL2A 1BVSA 1U5KA 1YEZA 2OCEA 3NEMA 3J81i 2AKWB 4JYAQ 3GTQH 5LMNQ 1PH8A 4IPCA 1OXSC 2XTIA 4JV5L 5IYDG 5LMNW 1I94L 1QZGA 2F3IA 4A3EG 1OXXK 4NXNL 4A3GG 2JK8A 4X62L 5IYBH 3CC7A 1UE1A 3M9BA 1RL2A 3F2CA 1N36Q 2E2IH 1I94Q 4A3DH 3PO3G 1WYDA 2OWOA 4A3MG 1PH4A 4IFDI 1Y1WG 3E0EA 5C4XG 2Q2IA 4AH6A 4AYBE 2ALYB 1X6OA 3RLFA 1PA6A 4YHHL 2NN6G 2B29A 4IJHA 3A5UA 3K7UC 2R92G 2PI2A 3GTLH 3HFZB 3B6YA 3CPWA 4A3IG 3S24A 4PZ6A 4HIKA 2CFMA 1HZ9A 2H5XA 1XPRA 2K5NA 5HY6A 3PIPA 1E1TA 5IP9H 4LFAQ 1VQHA 2AWNA 2NVXH 2N49A 1SROA 4LF8Q 3F2BA 3I4NG 2CWPA 1YHQA 2MO0A 5JJLA 1YI2A 1X9NA 1IBMQ 1P8LA 4DPGA 3J81c 3MXNB 2AMCB 4DV6Q 2JA9A 3UDXA 2ATWA 5GAEC 2BA1A 2KENA 4IJLA 4JI5L 1EIYB 1VQ6A 4HJ7A 1OXTA 2R7DA 4R1JA 2E8GA 1VQCA 2JA5H 5C44H 4L5SA 4GNXB 1K0RA 4JI5Q 2MNAA 3HOWH 2OTLA 1B8AA 2A1AA 4BY7H 3HOZG 2NN6I 3EN2A 4DUYL 1VS0A 1ASZA 4PG3A 1Q7YC 3M4QA 1AH9A 3TEHB 2Z0SA 1Y1VG 3NBHB 4B3RL 3KOJA 4YCWA 1KXLA 4LF5L 3G6EA 4DUYQ 2K5VA 3DLLA 1S72A 1Q81C 1E22A 1HR0L 1VQ9A 4BA2I 4DR4L 4DK6C 4X66L 1VQ4A 4B3RQ 3BZCA 1JJGA 3A5ZB 3U4ZA 1BBUA 3KF6A 1PH1A 2A8VA 2VUMG 4YWMA 1N9WA 4LF4L 3HOVG 1CKMA 4JC0A 1HR0Q 3OW2A 3W1GA 4DR4Q 1SLJA 2VL6A 1V43A 3FKIG 4OWTB 4BXXG 3F1ZA 4RMFA 5IYCH 3SGIA 3IRBA 1VQGA 2IHEA 2XGTA 3H0GG 1XJVA 4EX5A 2PQAB 4UP8A 1ASYA 1VQ7A 2IHFA 5EAYA 1HNZL 5GROA 3I56A 1SRUA 3PV0A 3T1HL 4LNQA 4GKKQ 4R4CA 1QUQB 2OTJA 1YVCA 1N34Q 1EQRA 2HQLA 1QVFA 4XIGS 1HNZQ 3ULLA 3KLWA 3FHWA 4A3LH 3F8TA 1L1OC 3CPFA 3J81j 3KDFA 1XMOL 4QQBX 4DR1Q 4A3CH 3CF5A 3J7A5 4A75A 2E2HH 2K4KA 4LUZA 3J80i 4A93G 1SMXA 4YWKA 3RLNA 5M3MH 1K83H 1A0IA 1W2BA 3L2PA 1GVPA 1WI5A 1P16A 4J15A 3S1MH 1TWGH 4C3HH 2R93H 4GLXA 2JA7H 3A74A 1UWVA 1KQSA 1SN8A 1M1KC 2WB1E 1PFSA 2FXQA 4FDBA 4JBJA 4YCVA 3HOXG 4QGUA 3M3YH 4JI8Q 4X64L 4A3KG 5IP7G 2PI2E 4HIMA 4IPGA 3CCRA 4GOPC 1YJWA 3GDEA 1Q1EA 5C3EG 1UEBA 4BBRG 3HOUG 5JJIA 4KI0A 3UDIA 1TXYA 4R4OA 2Z6KC 4DAYB 5IYDH 3UDFA 5IWAQ 5AJ3L 1SFOH 4A3EH 4A3GH 3GTJH 2HHHL 3S2DH 3VDYA 2WAQE 2B3GA 1WOCA 2I0QA 3S1NH 1PYBA 3J80c 2UUAQ 1GD7A 2ASBA 3L0OA 3ERSX 4GN4B 2RHQB 5C4XH 2WFWA 1VQIA 2KHJA 2UUBL 4DR6Q 4AIMA 2VQEL 2ZM6Q 2IX0A 1KRTA 1QVCA 5FJ8G 4B3MQ 1G291 4DV5Q 4DV3L 1VQFA 4MZ9A 1YHAA 4C3IH 2Y0SE 4A3IH 1PV4A 1WJJA 1XPUA 4JOIC 3CCJA 2YYZA 2A19A 3M85A 1XNRL 4POGA 3KFUA 4JV5Q 3K80C 4DK3C 3KF8B 3EBEA 4LUOA 4X65L 4HIOA 2JEAI 4NXNQ 1XNQL 1TWCH 2NVTH 4X62Q 4GLAC 2NZHA 1IYJB 5K36G 2ZTDA
chains in the Genus database with same CATH superfamily
3OTOL 1TY0A 5T1IA 1WTHA 1YITA 4WJWA 4NKLA 5CV5A 2KQ3A 2E5LL 5JVG3 4DKAC 4A3IB 3S17H 4P73A 1EYCA 1BBWA 3ERQA 5A2QL 1PH5A 3K5MA 1VQAA 1TWCB 4AYBG 4DV2L 5JEAJ 2G9DA 1PYSB 5C4HA 1F9PA 2FJ2A 1TU2B 3H3VI 5ELNA 1LTAD 1HZBA 1MSHA 1CUKA 2KEEA 3MA2B 2O4XA 1X3GA 1YHBA 3TZUA 1EYDA 3ULJA 3S17B 1DOKA 1NTGA 5C0XJ 2O5IC 1VQEA 4BXXH 5FO8B 2ZJRA 4IUNA 1IYVA 5I9PA 3RLOA 4R4IA 1UE7A 4IOCA 4ID6A 1IL8A 1VF7A 3S1QH 2H4OA 3Q22A 1E0BA 4LF5Q 3TSSA 2ZTEA 1K73C 3R2IA 2I07B 1DONA 2FMCA 4A93H 1HHVA 2F0KA 2UU9L 1PVOA 4H02A 1A3UA 1B9NA 4FVMA 1AEXA 3AFPA 1V1QA 3S1QB 1XXGA 2VQFL 5I4DA 4OX9L 1TT2A 1FYCA 2D62A 3OIQA 2ID0A 3PQIA 4BY7G 1EEFD 4A3KH 1H9KA 1PTOD 2IWHA 3I4MH 3PO2H 2L0CA 1PTOC 2D0PA 1CHPD 4A93B 3G4SA 2Z4IA 3K59A 2LSSA 1X65A 3HOUH 5ELDA 3RN5A 2ZXRA 4JBWA 1FVIA 2JE6I 3OSOA 4JI7L 4QF4A 1Q12A 4ZK9B 4A3KB 3I4MB 3PO2B 2B39A 1JC7A 1CKOA 5KEEA 4FNFA 3E6ZX 5M3FG 3HOUB 1AW7A 1V1PB 2RA4A 1PXUA 3EVQA 5FLXc 1LT4D 1LTLA 3NTIA 3JAMc 3PO3H 5AJ3Q 4HCEA 3AB9A 4X3KA 3N52A 2HHHQ 5J3BA 2EY1A 2NN6H 3K7AH 3BU2A 4P72A 3HEJA 1PYWD 1HUMA 3GTGH 3R2TA 3KJOA 3NE5B 2XRSD 3PUZA 1SXTA 1E24A 5LMNL 4BBSH 1XNRQ 2BOSA 3PO3B 4IPDA 1RKNA 4X65Q 3AFQA 5KGUA 4BWGB 2HT1A 2KUMA 3K7AB 1N36L 4OL7A 2Y0SG 1VQOA 2FMMA 1EWCA 2F0UA 3GTGB 3CKIB 3HOYH 2QEXA 4R4QA 4LF6Q 4BBSB 1NNXA 5IGFA 3U4VA 1IW7D 2OQKA 5DM63 5IOCA 1X3PA 1IW7C 3URYA 3G48A 4ILWA 1LV9A 4L5RC 4ZUJA 3Q23A 1TS2A 1QVGA 4DR3Q 1AE2A 2F0HA 2UUCL 2PO4A 4LFAL 2L15A 2F0TA 1HNWL 1KL9A 4EQPA 1GUTA 5GQOA 2ES2A 1IBML 1EY5A 4DUZQ 5CC4A 3RN2A 2UUCQ 1HNWQ 1G8ZD 3HOYB 1B50A 5IY0A 4FF1A 3H0GH 5HGQA 3M7NA 4CDEC 2Z4HA 2CH4A 2XSCA 3PGZA 3GTMH 1L2FA 1FNWA 3M4YA 3ICEA 1HA6A 3D31A 3HRZC 2HDLA 1OXUA 3ITPA 3RD4A 2N8NA 5CR3A 4UP7A 4XQQA 4JI1Q 4JOIA 1SE8A 1PFNA 1D5MC 3H91A 2OF1A 4O1NA 3H0GB 1JWMD 5ELFA 2KA7A 1PH9A 3GO5A 1KIXA 2K04A 1JOOA 4Y7NH 5ELBA 1KRSA 2C35B 5NUCA 1K3RA 2EY5A 3TQYA 3GTMB 2CQOA 5BN5A 4X3SA 5LHY1 3EROA 1M4VA 4GKKL 3C2PA 4KKTA 5HGTA 3I90A 4X6AH 2PZTA 2L9HA 3D4DA 3OMGA 2CHBD 2EVBA 4Z9CB 5C5MA 3NTHA 3I72A 4YY3Q 2MO1A 4Y7NB 3AEVA 4DV1Q 2CW0C 2WP8J 2K32A 1QNUA 3UE0A 2GN5A 3TP6A 4UPAA 3J7AV 1JJ2A 2L5TA 3AQQA 3W5OA 2NVQH 4Q0FA 5FJ8H 2F4IA 1B7YB 2EDGA 3H3VH 2PMZB 2N78A 1S4ZA 5CGKA 4KHZA 4APVA 1KAAA 2EIFA 2XWBB 3I4MG 2CCZA 3PO2G 1OXVA 3AYHB 4CGYB 1EEID 1IXRA 5J1ZA 1VQPA 4JCVE 4XXEA 2EXDA 1V8QA 1QNKA 4QJFA 3MAQA 2F0DA 1VQKA 1EZ8A 3P1HA 1BVSA 2OCEA 3J81i 3D6WA 1A15A 4IPCA 2XTIA 4ZQ3A 2F0FA 1I94L 3R3OA 4IZ8A 2JK8A 3KBGA 3CC7A 1UE1A 1PFMA 3AU7A 4OGQC 2JXMB 1I94Q 3PO3G 1WYDA 4IN3A 3SK5A 2Q2IA 1RTOA 1I4GA 1X6OA 4K6LA 2NN6G 5G3LD 2B29A 3DXJC 3BG3A 3GTLH 1STHA 3BVMA 5FO7B 4C3IG 1IKLA 4IUTA 3NWSA 1I4QA 5D3DA 3O13A 3P75A 1MI2A 3LX0A 3A8IE 2IW3A 2K5NA 4IQZA 5HY6A 2R61A 3W3AA 1HQRD 2N49A 5JJLA 1Z6HA 3WOFA 1YI2A 2NZ1D 3MXNB 5A35A 3UDXA 1E2ZA 1IHZA 5GAEC 4JI5L 4HJ7A 3GTLB 3I4LA 4L5SA 1SNDA 4JI5Q 3HOWH 1GXDC 4LJZC 4B3RL 1Y1VG 3NBHB 1SNPA 1EQVA 3G6EA 4FP5D 1S72A 1VQ9A 2K5DA 1QE6A 4X66L 4B3RQ 2D5DA 3A5ZB 4R8IA 4H0LC 4KV6A 1N9WA 4LF4L 1LT5D 3W1GA 3HOWB 1TR5A 4CJ1B 5IYCH 3SGIA 3H0GG 3K58A 1X32A 5EAYA 1NSNS 3I56A 3T1HL 4P2CB 3VYUA 1O7YA 4R4CA 3ZYYX 3EA6A 2CVRA 4KD4A 1II3A 1QVFA 3PMFA 4XIGS 1GOZA 3F8TA 3CPFA 4A3CH 3J7A5 4A75A 3IFTA 3DHQA 4LUZA 4NP5A 1H9SB 4PV1C 5KYIA 2SOBA 3OIPA 1CTMA 3S1MH 1NR2A 4C3HH 4BS9A 3H09A 2Z6BA 1KQSA 2XIWA 4DAVA 1M1KC 2JP1A 3LWEA 4FDBA 4X64L 2TMPA 1S5CD 2PI2E 2MJ8A 4KY5A 1VF5C 2EY2A 3SE0A 5EBCA 4BBRG 1JQYD 1EWHA 1F2ZA 4QB4A 4R4OA 3S1MB 4C3HB 2DNCA 2EYMA 5IYDH 5IWAQ 2ZXOA 4IUUA 2B3GA 3X3NA 3TMEA 3J80c 2ASBA 1BQQT 3VR5A 2RHQB 4L6TB 1VQIA 3E3XA 1MBYA 5FJ8G 1SJHD 1G291 1HTPA 4DV5Q 3A8KE 4DV3L 1HFNA 4JOIC 3CCJA 2YYZA 1STNA 4CJ0B 4JV5Q 3KFUA 4HIOA 1QWYA 4DK3C 1AFPA 1L0XB 1XNQL 1IYJB 4IPGA 5LMNW 2ZJQA 5D3IB 2JA6G 1JJCB 2WKDA 3TN2A 4JVZA 1CKNA 5C3XA 1XNQQ 1CA5A 2XNAC 5ISRA 1I3QH 3KF6B 3D3RA 3UI2A 2IJ0A 3NUCA 3RZOH 3HOZH 2Q8TA 2ZJPA 4LF8L 4OELB 4HSVA 5BN3A 3NBIA 1FR3A 1PRTF 4LF8Q 1VQDA 2FINB 3JC66 1I3QB 5M5YH 3GTOH 1G2SA 3L9AX 3OWEB 1BCPB 3EFXD 1SBBB 1T5XD 1IBLL 1KD1C 3RZOB 2SDFA 1E3PA 4ZAIA 3W1BA 1HA5A 3HOZB 4OO1I 4F7XA 2MUYA 1IBLQ 1ESFA 2HQEA 4BY1G 3BDLA 4ZKBB 2QGQA 5M5XH 5M5YB 3E9HA 4C56C 3GTOB 1E2WA 4OONA 1HCZA 4CJ2C 3SHLA 4KLKA 4HJ5A 4LMQD 4KD3A 4DV7L 1TS4A 2V1CC 4DV4L 1KDBA 3NPPA 3SVMA 4DV7Q 3HOWG 5E7NA 4XTCS 2NTSA 2YTYA 5M5XB 5EPKA 3JAMi 3CCUA 1LTRD 2Q2UA 2K33A 3M7GA 2EY6A 2F0QA 3CRLC 4FF2A 5FOBB 2WINB 1JWUD 3I4OA 3CU7A 4NPSA 3SK4A 1A3VA 3OYYA 4EGVA 1PH2A 4RGMA 2UXDL 1EFWA 1T9HA 4EQ5A 1J6QA 1YIJA 1AP0A 1FL0A 5JJKA 2G5DA 4CKBA 2NYZD 3U50C 1EU4A 1RODA 4TRDA 2A73B 1EY9A 1BXTA 1PH3A 3CRKC 3HKZE 4DR2L 3DEPA 3T16A 1PHJA 1X56A 4KHVA 2YV5A 4O2DA 4F88A 5EKLA 3KBXA 4A3CG 1HNXL 4CDDC 4DR2Q 1Y1WH 4A3LG 3STBD 1Q8KA 1GUOA 5K36H 3STBC 1HNXQ 1N32L 2B8FA 2I5HA 4ODGA 2R92H 4ZUIA 4G4KA 1WTXA 1CSQA 4A3BH 2K75A 1GUGA 4F8MA 1JE5A 4XT1B 4LFCL 1K8GA 1DM0B 2AHOB 2EJMA 2DJFC 3R93A 1L1OA 1Y1WB 1MJEA 5IGDA 4LFCQ 3D0FA 1SNCA 1EOVA 5EJWA 2PNHA 2WACA 2VB3X 2F3VA 3G71A 1XTCD 3OTOQ 3GV6A 2R92B 5DM73 1VQLA 1CZGA 4IOAA 4A3BB 1WFQA 1EY4A 4KKSA 4RG1A 3UDGA 2E5LQ 3PUYA 3J7ZC 3VYTA 1SYBA 2CKZB 4G7ZC 2RCNA 1SAPA 4EQOA 4GOPA 4DV2Q 4GNXC 3IAYA 5IYBG 2HD3A 1Y69U 5C4ZA 1H9RA 2K5WA 1M90C 2X6LA 3QJYA 1NR4A 3CXCA 4DV6L 1LYLA 1FD7D 1K3BC 3NP8A 1YJ9A 2BH2A 5I6YA 1CA6A 2HDMA 2RVLA 2A68D 3HP3A 5FLXE 1WTRA 4DV0L 2B63H 2A68C 1T5EA 1E2VA 3RZDH 4KK7A 1MIUA 5C5LA 4PZ8A 4OWXB 3NWTA 2VNUD 1QB5D 4DV0Q 2R7ZH 5IP9G 3BZDB 1HH2P 2JQOA 4DNRB 2AWOA 3MC0B 4A3JH 4O0AA 2B63B 1A62A 2F0VA 3V05A 3RZDB 2UU9Q 1C8CA 2F4VL 3SEBA 5IODA 1QJOA 2RDHA 2R7ZB 3K8AA 2VQFQ 4OX9Q 2F4VQ 1N34L 4GS3A 1MJCA 3S15H 2RHSB 4A3JB 1JMCA 3C1EA 5J22A 4DR1L 3Q24A 3CC2A 4OWWB 4MTKA 3D4RA 2D0OA 1A63A 4H13C 4ABNA 4CKCA 3NENA 1JB3A 1Z7TA 4KJOA 3DM3A 1JICA 4R4TA 2OQ0A 3KJPA 1VQNA 1SYFA 1UNSA 4DXFA 4JI7Q 4CDFC 3S15B 4LFBL 1JT8A 3A0JA 2DJGC 5BN4A 1BKBA 1EYGA 5LMUL 4LFBQ 5M3MG 4FF3A 2MQHA 2ENBA 4Q5VA 5LMUQ 1RIPA 4TVAB 2E2JH 1F2YA 2PQAA 4LK1C 4N9PA 4WFN3 5C6AA 1I5FA 1STEA 4OO1H 3QO2A 5IT9E 4HIDA 2Q2TA 2UUAL 2H1EA 4RKLA 4P71A 2WAQG 1B53A 1YBYA 4DR6L 1WCMH 4WRDA 4TQUS 2ZM6L 3TP5A 4B3ML 1YEZA 2AKWB 1ENAA 2R3ZA 3GTQH 5LMNQ 1PH8A 3NQTA 1RD9D 1UUPA 2E2JB 3QG1A 1RF2D 3TZDA 4A3EG 4A3GG 4X62L 4DK0A 3M9BA 1RL2A 2MGSA 1N36Q 1DXMA 1R4PB 2RQXA 4A3DH 4IFDI 2OWOA 1PH4A 1Y1WG 3U9OA 1WCMB 1EIHA 2OT2A 4L63B 4YHHL 4I7ZC 2R92G 3GTQB 1SE2A 3HFZB 4RWSC 4A3IG 1U9RA 4PZ6A 4HIKA 2CFMA 2H5XA 4DAYA 3PIPA 1LO5D 4LFAQ 3F2BA 4A3DB 2CWPA 2DY8A 2MO0A 1ICWA 4C1NK 1YHQA 1IBMQ 1P8LA 4DPGA 2E76C 2JA9A 4K8JA 1I4RA 2QEJC 2BA1A 4IJLA 3FMCA 2R7DA 3NK9A 2E8GA 5C44H 4GNXB 4PMCA 1K0RA 5IGEA 2MNAA 1B8AA 4RCOA 1J8IA 2DY7A 5JVH3 1XWEA 3KF8A 1VS0A 1ASZA 4F87A 3TEHB 1D1KA 1BBXC 5E3FA 2K5VA 4NMZA 3DLLA 1E22A 5IT9L 4BA2I 3SXHA 3H6MA 3U4ZA 1PRTD 1PH1A 1PRTC 5C44B 1CKMA 3GP7A 1Q3LA 3OW2A 5FO9B 1Y8OB 4BXXG 1ILQA 1KLGD 3MFGA 2IHEA 2A74C 1B4OA 4UP8A 1ASYA 1PTOH 2IHFA 5C3WA 3FRPB 5GROA 1HNZL 4GKKQ 1W6KA 1BR9A 1LT6D 1QUQB 2NBFA 1JOKA 3VYRA 1MSGA 1EQRA 1TY2A 1WD1A 1HNZQ 5CYUA 3ULLA 1L1OC 3J81j 3OOCA 1XMOL 4QQBX 1SJED 1SYCA 3CF5A 1WTVA 2B2WA 2E2HH 3J80i 4A93G 1SMXA 3MHBA 3RUZA 1W2BA 2I46A 4HR7B 1GVPA 1WI5A 1P16A 5K5PA 3FEWX 1PTOB 4GLXA 1ENCA 1G91A 3BDOA 1F9RA 1STAA 3C1FA 1VMPA 1TVXA 2WB1E 2FXQA 1Q8IA 4B9WA 2MHVA 4A3KG 3CCRA 4GOPC 1YJWA 1PZID 3DWQA 2E2HB 1Q1EA 3HOUG 2EYLA 2NVQB 5JJIA 4KI0A 1WTQA 5I9OA 2KECA 2QKIC 1SFOH 2AQ2B 3GTJH 3VDYA 1LTGD 2PPBC 1HUNA 2I0QA 1SNQA 2ICIA 3GQBA 1GD7A 1MD2D 3L0OA 3ERSX 4GN4B 5C4XH 2WFWA 1K28A 2KHJA 2UUBL 1TQOA 3TP7A 2VQEL 4I7AA 1YNJD 1YNJC 2PZWA 5EPLA 1RCVD 3AMUA 4K5WA 1D6EC 5EQ0A 1SFOB 2JEAI 3GTJB 2NVTH 1ET6A 4GLAC 1ILPA 2NZHA 1V43A 1G51A 1SEBD 5C4XB 1W3SA 2EYOA 1MKHA 1EOTA 1BUVT 1JCKB 2LFNA 4UY8C 4OO1G 2A6HD 4NXML 1GJXA 2A6HC 1EQTA 3D6CA 1V1PA 1NJIC 2KCNA 4HEDA 2E2DC 1EU3A 4GN3B 4BBSG 1SYDA 3PSIA 4QIWE 1X3EA 5EBDA 2F0PA 5ELOA 2NVTB 4AQYL 5DLQE 2HCCA 1A2TA 2XWJB 5IE8A 1DOMA 3WOEA 3CCQA 1TWAH 3E9IA 4MNOA 3CMEA 2AUKA 1LM0A 4C3JH 3FP9A 1S5BD 3KDFB 2IX3A 2JJQA 1N33L 3HOYG 3MZ5A 1GUNA 2RKSA 5E4XA 4LF9L 2KHIA 3PIP3 3FKIH 4RHRA 4LAAA 4LF9Q 1TWAB 1H95A 3NELA 4JI6L 2F0LA 1TKWB 1PH6A 2SNMA 4C3JB 4HJ9A 2K6AA 1DOLA 4X66Q 1YZ6A 3SK6A 5KNDA 4LF4Q 1FJGL 3FKIB 3TRZA 4K14A 2F52A 1DJRD 1ESRA 3MFYA 1JB7A 3T1HQ 4HSPA 1HR0W 5JOBA 1I4HA 4N9TA 3CQZH 4DAMA 2HIVA 1QOHA 3HOXH 2IPKD 1NBWA 1A8VA 3KUPA 5IP7H 4I65A 3GD7A 2LXKA 4IFDH 1TWHH 2K5HA 1SR3A 5C3EH 4LF7L 1PDQA 1U4LA 2AQ3B 3I91A 1X54A 1WTWA 1J5EL 3J81E 1TWFH 5E4WC 3SR1A 1CI3M 3KLSX 3CQZB 2A69D 2VY3A 3HOXB 2A69C 4POFA 4HCSA 4K0KL 1CSPA 3D8GA 1LLRD 2ZTCA 4X64Q 4RHSA 3G7LA 5JPNC 1TWHB 4GKJL 4DR7L 1I50H 4JW0A 2F0IA 4Y52H 1L0WA 2Q8IB 5FK9C 1SMYD 4DR7Q 4JPBW 1TWFB 3HKZB 1SMYC 2XN9C 1HPCA 4A3MH 1HJPA 1EY6A 5HURA 4JI2L 2LS01 1M8AA 3CCSA 1D8LA 1WVLA 3BS1A 1KLUD 1B44D 4E6IA 1H9MA 1FGBD 1IKMA 3FVQA 1D7QA 1Z9FA 1RDPD 4NB3A 2UXCL 1I50B 2WKCA 1L0YB 4B3SL 2F0WA 4DV3Q 4UAIA 3I4NH 4A3MB 1F9SA 3H15A 3EJIA 3WWVA 2F0EA 4GZYC 2B2UA 2CWAA 1ZYRD 2QW7A 3CMAA 2NVYH 1ZYRC 3S2HH 2Q2HA 1ZXTA 3M4PA 3ONAB 4LUVA 4DK1A 3OMCA 1KABA 1HZAA 4RGTA 1FGUA 3U9SA 4JI3L 3S14H 4U673 3I4NB 2Z8LA 2EJFC 2X69A 2C9OA 2JEBI 3V2TA 4AYBB 1U4RA 2RF4A 2AQ1B 4JI3Q 2FHTA 3K5LA 2B2WC 3HG9A 4RGNA 5JJZA 4KY7A 3PF4A 1GHKA 1E1OA 1I4XA 3J81L 2NVYB 1SSOA 1O7IA 3HOVH 1KHIA 4HN7A 4WJ4A 3I7FA 2B2VA 3PUXA 1OO9B 1QG7A 1C9OA 3ND9A 3ZJYC 1HFGA 1UEAB 1PZJD 1S40A 2JSOA 1GHJA 3R8BA 1NY4A 4HAEA 2NB0A 4YCUA 5C4JH 3P20A 3CP0A 1CHQD 4CBVA 5CBEE 2F0NA 1KDCA 4LW1A 4M8AA 2EYPA 1J9OA 2BH8A 2JYOA 2I5MX 1DYQA 3I55A 1LUZA 3HOVB 1ENFA 4DFAA 1CFMA 2LMCB 1SYGA 1STGA 1KAWA 4C3JG 2EZVA 1VQBA 3IKJA 5C4JB 4ZCKA 2YU9H 2I5LX 5C0XI 1A6XA 1Q1BA 3I2ZA 4IO9A 1YJNA 4DV4Q 4KKUA 4OXPA 1C0AA 3RR5A 3EQLC 3ER0A 2CQAA 3CCEA 1RJTA 3CAMA 3L7ZC 2EYJA 3MXNA 4RA8A 3OWFA 3NTKA 4HJ8A 2N3SA 4JG2A 5M5WH 2HIXA 4J6HA 4YIJA 3NSWA 4ZKCB 5M3FH 1I4PA 2BDNA 1JOQA 1X3QA 1XMQL 2YU9B 1X55A 5IYCG 1SYEA 4X3TA 5A2QE 1XTDA 1R9TH 1I6VC 4KMUC 3FPPA 1XMQQ 5GAHC 1EY8A 3MEHA 5AFWA 5CV8A 2UXDQ 2N88A 3DEOA 4CKEA 3PUVA 4A76A 3NBHA 1A3TA 5L37A 4U68A 1ZEQX 4JI8L 5M5WB 3ULPA 2IY5B 2GVBA 3PIOA 3U58A 5M3FB 4WJ3M 3GTPH 2Z1CA 2M2LA 1G6PA 4P75A 3QR8A 2V4DA 4IFDG 4K2KA 1X3FA 4C3HG 3MWYW 1R9TB 4KN7C 1NMGA 1YNND 2C5CA 4L5QA 1IBKL 3M4OH 4ALPA 1YNNC 3DM1A 1N32Q 4ME3A 1Q90A 1U4MA 3HKZG 3MXUA 4K2LA 4UP9A 2YTXA 1PLFA 1CZWA 1IBKQ 1B3AA 2B2YA 1VQ5A 3GTPB 1IL2A 4G57A 3NEMA 1H9SA 1BCPF 2MP1A 1B2TA 1HTLD 1OXSC 3A56A 2PCFB 1UAPA 1BF4A 5IYDG 1SDFA 3VR3A 2EPBA 3M4OB 4NXNL 3C3LA 2E2IH 5DNFA 5IGBA 4A3MG 2EYFA 4QUCA 4AH6A 4AYBE 4XQNA 3A55A 2ALYB 4IALA 2O2LD 4IJHA 3OPOA 2L12A 2QILA 4UHVA 1HZ9A 3HZXA 1F77A 2NVXH 2E2IB 3I4NG 3VYSA 5F2DA 4FXGC 4DV6Q 3MXPA 2AMCB 5CV9A 1HRJA 2ATWA 1VQ6A 1EIYB 3J7AF 2MPMA 2KHSA 2K1BA 2PW5A 3JAME 1U4PA 4ME5A 4KJNA 1D5ZC 4R1JA 2JA5H 1VQCA 5I2YA 3K57A 1D5XC 1PZKD 4MN3A 1MHWC 1KDAA 2A1AA 2L1BA 3HOZG 3EN2A 2M00A 4HTHA 2NVXB 4PG3A 1AH9A 2BDOA 3M4QA 2Z0SA 3KOJA 4LF5L 3QB3A 1Q81C 3TBIB 1HR0L 3BVZA 4DK6C 1VQ4A 1JJGA 1WD0A 2A8VA 1LT3D 3KF6A 4YWMA 2JA5B 1F9QA 3HOVG 4KY6A 4JC0A 4G7OC 1HR0Q 3NXWA 1SLJA 4RCNA 4OWTB 2AUJD 4HMIA 2F0OA 3VA7A 4EX5A 3S9WA 2B2TA 1SRUA 3PV0A 4J1MA 4DXGA 1YVCA 1N34Q 2HQLA 1VMCA 3VR4A 3KLWA 3FHWA 4O42A 1SE4A 5IGGA 4DR1Q 2K05A 3QOJA 4NDXA 3RLNA 5CV4A 1K83H 2B2UC 3I70A 3L2PA 3H94A 2R93H 1TWGH 5COYA 2RDFA 4MHEA 2JA7H 1ONLA 1LTID 4MIUA 3DWAA 2Z9HA 3A74A 4JK1C 1SN8A 3D4WA 1DD2A 2KVMA 1PFSA 5E1FA 5KNBA 2M9VA 1CQFA 5D14A 4QGUA 3I8ZA 5EKKA 1EL0A 4WORA 2WB1B 4HIMA 2JN4A 2OXPA 3GDEA 5FLXL 1FNUA 4UDUC 1K83B 1S5ED 1UEBA 1XYIA 1TXYA 2B8GA 3W2DA 3JAML 5DAUA 1TWGB 2R93B 1K8MA 3H3VC 2JA7B 3V96A 3UDFA 5AJ3L 4EQNA 2B2VC 2HHHL 2WAQE 1WOCA 1LTTD 3PIO3 2UUAQ 1GUSA 4QUFA 3QOLA 5JEAH 4DR6Q 4AIMA 2ZM6Q 2IX0A 1KRTA 4B3MQ 1YHAA 3DMUA 2Y0SE 4C3IH 1PV4A 3BDCA 1WJJA 2VXWA 2A19A 1XNRL 3K80C 4X65L 2L55A 3EBEA 4LUOA 4X62Q 1SNOA 2EYHA 5C0XH 5K36G 1AZQA 2VW9A 3PUWA 5CORA 3LGJA 2GVAA 3BYTB 1EWIA 4N8X1 5FKAC 4IUPA 4A3BG 3K5OA 4K6DA 4YHHQ 3CW2C 1PH7A 4C3IB 1GKHA 2A6ED 4LF6L 5ELCA 1JORA 2A6EC 2WIIB 1C7YA 4G7HC 3C46A 3T51B 3CC4A 4QIWB 2KCCA 2F1MA 4DR3L 1Y1VH 2ZXPA 3BZKA 3K6OA 3TDQA 4H44C 3K81C 4XT3B 4DNIA 5FLMH 1Z47A 4DUZL 2JA8H 2DGYA 4XYOA 5CV6A 2PNRC 4RFBA 4B3TL 2GA4B 4C2MH 5M9OA 3A8JE 1DCZA 2EQSA 4R9WA 3S1RH 4B3TQ 1EIGA 4QL5A 3DUZA 1UE6A 1B70B 1Y1VB 4DN4M 4RAUC 4PZ7A 1EUJA 5LL6S 2JA8B 4JI1L 3VR6A 2J4XA 4K5VA 1Y8NB 1D2BA 4NW2A 3CD6A 2L4NA 4C2MB 5IT9c 4IUQA 4ZLTF 2RBMA 1VQMA 2B63G 1PFBA 1KC8C 1KTKA 2NZOA 3S1RB 2K52A 3T4AC 1S3OA 5KYLA 2VS1A 1ML0D 2B2YC 2JA5G 2R7ZG 2ZT9C 4JI0L 2KEDA 4C1NI 1Q82C 2KOLA 3L3OC 4IPHA 1QCBD 3BJUA 4TSSA 3TS2A 4JI0Q 2D2CC 1XMOQ 4A3JG 4YY3L 4L5TA 3PCOB 1DGSA 4A3FH 2G9HD 4BBRH 5LL6X 4MTNA 4DV1L 3K0YA 2MFIA 3DWPA 4RKBA 4P74A 2CW0D 5EPJA 2K50A 2LKVA 4JBMA 1QZHA 1VQ8A 1QILA 1ICFB 3LNNA 1CKNB 4K8IA 2E74C 2IX1A 4K5XA 4A4IA 2IL8A 5KRUA 4A3FB 4BBRB 1V9PA 1NE3A 4OHJA 2EOTA 1BOSA 1F2LA 1FNVA 2WB1G 2YTVA 4DGZA 2J0TD 1LABA 3RMHA 4KHPL 4IFDJ 3UE1A 2PW7A 3QWNA 1EYAA 3PF5A 1K9MC 1I6HH 1O7ZA 1WTOA 1HQMC 2JA6H 2R93G 1S5DD 2TSSA 3EIVA 2JA7G 2K28A 5I2XA 4KHPQ 2UUBQ 2VQEQ 4KTAA 4KN4C 1EIFA 2OEOA 4B08A 4DR5L 2SEBD 1STBA 1GUWA 5JAVA 3J7YW 1CT1D 3IL8A 5DEHA 2R7FA 4DR5Q 2UXBL 1I6HB 2IT1A 1NUCA 2NUCA 1N8RC 2JA6B 3S16H 1EY7A 2HCIA 1O78A 2UXBQ 4JI4L 1UE5A 1XX8A 1CM9A 1WCMG 2B2TC 4NXMQ 2KCTA 4XDXA 4JI4Q 1K8AC 1B9MA 5JEAG 1EFID 5KNCA 2DUDA 2HUGA 1YNXA 1Q46A 1W6JA 5GAGC 5T1GA 4AQYQ 2KCMA 1VQJA 5EGTA 1BCPD 3S16B 3GV3A 1BCPC 2QA4A 4BY1H 2LXJA 1BO0A 2VUMH 4A3DG 4V190 4DAPA 2Z6KA 5C0XG 3HKSA 3CCMA 1N33Q 4DA2A 1R4QB 3Q8DA 3G6JB 3F2UA 4M1UB 3I3CA 3KYHC 2L11A 2EJGC 1C4QA 3J80E 3T53B 4LWCA 2F0JA 3K0XA 1ET9A 1DZ1A 1U0LA 1VCIA 1EQQA 1PTOF 1SE3A 4JI6Q 2QCPX 4BY1B 4OEMB 3WDNA 3TS0A 2VUMB 5H1SE 1K0SA 2A5HA 4FF4A 3K5NA 1G6ZA 1HXYD 3MTSA 1E7ZA 5FLMG 1FJGQ 4R8NA 2JA8G 3A7AB 5C44G 3GTKH 4GN5A 5TSSA 4OIJA 4QY7A 2KBNA 3OHXC 1MGSA 1GO3E 1TS3A 1PRTB 1O7LA 2O5JC 4XQJA 3KK7A 3T1YL 4EVOA 2QF7A 5GADC 1G2TA 2E75C 1JWSD 1AE3A 2BE5D 4FXDA 2K14A 1NMFA 2BE5C 3T1YQ 4LF7Q 1OTCA 2K7VA 4PMWA 2R6GA 5BR8L 1XPOA 1RTNA 3GTKB 4N8FA 1B3QA 4GNXA 1J5EQ 1L1OB 4HMJA 4PMBA 1GM5A 3BVGA 3Q6SA 5KIXA 5BR8Q 1Q86C 3NQIA 4A3LH 3TREA 1WTPA 4GLVB 3RNUA 1BNZA 3F2DA 1IZ6A 1RHPA 2RSNA 3FDTA 5C3EB 2PMZE 4K0KQ 3CHBD 3MEFA 1KNAA 3SDZA 4GKJQ 1HZCA 1TIID 4V0BA 4PQXA 3ND8A 2VZAA 1BDOA 3LWUA 2BA0A 2PYKA 1Y14B 3IFDA 1NCVA 2F0MA 1CQVA 4GOPB 1C48A 1NAPA 2K01A 2VB2X 4A3FG 5IWAL 4JI2Q 4B9XA 3CCVA 3J80L 1QUQA 4JBKA 4ZRZA 1EZ6A 4YWLA 1SNMA 3CCLA 4HJAA 3T56B 4BA1I 4JYAL 2UXCQ 4DV5L 4B3SQ 1U5KA 4DNTB 2DN8A 2N55A 3E0JA 1EY0A 4DF7A 4JYAQ 2LY7A 1V1OA 4JV5L 2RSOA 1QZGA 2F3IA 1OXXK 4PNYA 1LACA 4CDCC 5IYBH 1LTSD 5CMDA 3F2CA 3E0EA 5C4XG 2F3WA 3NHHA 3N6RA 3HS0C 3RLFA 4XYQA 1PA6A 1Y8PB 3A5UA 3K7UC 2PI2A 3B6YA 3CPWA 3TP8A 2P5ZX 3S24A 3MVVA 2KJXA 3FPUB 1XPRA 3S2HB 1E1TA 1O80A 2F0SA 4IUVA 5IP9H 1VQHA 2AWNA 2XVSA 1SROA 5EKIA 4X3UA 1X9NA 3J81c 3S14B 2QDBA 5IIFA 3P7JA 3VR2A 4ULLA 2KENA 3QIAA 3E5SA 2PZUA 3MXGA 4RH6A 1OXTA 2XRQD 1AZPA 3SK8A 5J39A 2SNSA 2EE1A 4H7BA 2NWGA 3A7LA 2F03A 2OTLA 4BY7H 2NN6I 4DUYL 3HGBA 4FXKC 4FYDA 4L8JA 1Q7YC 4YCWA 2DNEA 1KXLA 3T13A 4DUYQ 1VDZA 4DR4L 1PMRA 3BZCA 1BBUA 2VUMG 1D1IA 3KLRA 2WV6D 2RDGA 1S5FD 4DR4Q 2VL6A 3FKIG 2F0GA 1H9JA 3F1ZA 4RMFA 5IGCA 2PQEA 3IRBA 1VQGA 2CH4W 2XGTA 4BY7B 1XJVA 2PQAB 1VQ7A 4J8QA 4LNQA 2OTJA 1JR0D 4QCLA 2K03A 2D9UA 3KDFA 5CBAE 5I6WA 2K4KA 4RGOS 4YWKA 5M3MH 2NTTA 1A0IA 3OW7A 4CHTB 4J15A 3Q0AA 1KNEA 1STYA 2ICEC 1UWVA 4YCVA 5CV7A 4JBJA 4FO2A 3HOXG 3M3YH 1F2MA 5ELEA 4JI8Q 5IP7G 3X3MA 3KLSA 1K8OA 1IYUA 2FFKB 5C3EG 1JE4A 1ZKOA 5M3MB 4ZYSA 4S3SA 3UDIA 1B1ZA 3BYYB 2Z6KC 4DAYB 4IURA 2QDLA 4A3EH 4A3GH 3S2DH 2BCOA 1A2UA 3S1NH 1PYBA 2X6GA 4TKOB 4QMGA 5G3LF 3M3YB 5D65A 2WAQB 3I73A 1AN8A 4OIKA 2K5QA 2J7ZA 1QVCA 1CK1A 1VQFA 2RCFA 4MZ9A 4A3IH 3VA5A 3A54A 1XPUA 2EXZA 2Q8RE 3M85A 1LTBD 4POGA 2Y0SB 4DU9A 4A3EB 1TS5A 3KF8B 4A3GB 3S2DB 4NXNQ 1TWCH 5JPMC 3S1NB 2ZTDA
chains in the Genus database with same CATH topology
2ZJQA 3OTOL 1G51A 2VW9A 2JA6G 3PUWA 1JJCB 1W3SA 3LGJA 1CKNA 2GVAA 1XNQQ 1MKHA 1EWIA 1YITA 1I3QH 4UY8C 4A3BG 4OO1G 3KF6B 4YHHQ 4NXML 3CW2C 2E5LL 1PH7A 4DKAC 3S17H 1GKHA 4P73A 1NJIC 4LF6L 1BBWA 4GN3B 4BBSG 3PSIA 1C7YA 3RZOH 1PH5A 4QIWE 1X3EA 1VQAA 5ELOA 3HOZH 4AQYL 4AYBG 2ZJPA 5JEAJ 4DV2L 3CC4A 5DLQE 4LF8L 1PYSB 5IE8A 3CCQA 4DR3L 1TWAH 1Y1VH 3H3VI 3E9IA 3BZKA 4MNOA 3CMEA 5ELNA 1HZBA 3K81C 4DNIA 1VQDA 1LM0A 5FLMH 3JC66 4C3JH 1Z47A 1CUKA 3FP9A 3KDFB 4DUZL 2JA8H 2DGYA 1X3GA 1YHBA 5M5YH 3GTOH 2JJQA 1N33L 3HOYG 4B3TL 3ULJA 4C2MH 5C0XJ 1NTGA 2EQSA 4LF9L 2KHIA 1IBLL 1VQEA 3FKIH 1KD1C 4BXXH 2ZJRA 1E3PA 3W1BA 3S1RH 4B3TQ 3RLOA 4OO1I 4QL5A 4R4IA 1UE7A 4IOCA 4LF9Q 1IBLQ 1UE6A 1B70B 3S1QH 1H95A 3NELA 4JI6L 4PZ7A 4BY1G 1EUJA 1PH6A 4HJ9A 4LF5Q 4JI1L 2QGQA 5M5XH 2ZTEA 1K73C 3E9HA 4X66Q 1YZ6A 3CD6A 4OONA 5IT9c 4LF4Q 4A93H 1FJGL 1VQMA 2B63G 4KLKA 4HJ5A 1KC8C 3TRZA 2UU9L 2F52A 1PVOA 4H02A 2NZOA 4DV7L 2K52A 1S3OA 1JB7A 2V1CC 3AFPA 1V1QA 2VS1A 4DV4L 2JA5G 3T1HQ 2VQFL 4OX9L 2R7ZG 4JI0L 1HR0W 4DV7Q 3HOWG 5E7NA 4DAMA 3CQZH 1Q82C 4XTCS 2HIVA 2D62A 2YTYA 2ID0A 4IPHA 3BJUA 3HOXH 3TS2A 4BY7G 1NBWA 1A8VA 3JAMi 3CCUA 4A3KH 4JI0Q 5IP7H 1XMOQ 3I4MH 3PO2H 2Q2UA 3GD7A 4A3JG 2D0PA 2LXKA 4YY3L 4L5TA 1TWHH 2K5HA 1SR3A 3PCOB 5C3EH 1DGSA 3G4SA 4LF7L 4A3FH 2LSSA 1X65A 4BBRH 3HOUH 4MTNA 1X54A 3RN5A 4DV1L 1J5EL 3I4OA 1TWFH 2MFIA 4NPSA 4P74A 3OYYA 1PH2A 2K50A 4JBMA 1QZHA 2UXDL 1EFWA 1VQ8A 4JBWA 1T9HA 4EQ5A 1FVIA 2VY3A 2JE6I 4JI7L 1J6QA 1Q12A 1YIJA 4POFA 1FL0A 1CKNB 4K0KL 1CSPA 2ZTCA 4X64Q 5JJKA 2IX1A 1CKOA 4A4IA 3U50C 4GKJL 4DR7L 5M3FG 1I50H 1V9PA 4Y52H 1PH3A 3HKZE 1L0WA 1NE3A 5FLXc 4DR2L 1PHJA 1X56A 2YV5A 4O2DA 2WB1G 4A3CG 4DR7Q 1LTLA 2YTVA 1HNXL 3JAMc 3PO3H 5AJ3Q 4A3MH 1HJPA 4DR2Q 1Y1WH 4JI2L 4A3LG 3STBD 2HHHQ 5J3BA 3CCSA 4KHPL 1Q8KA 1D8LA 3UE1A 4IFDJ 1K9MC 3STBC 3PF5A 1HNXQ 1I6HH 1N32L 2I5HA 2R93G 2JA6H 3K7AH 3BU2A 3EIVA 4P72A 2JA7G 2R92H 1CSQA 4KHPQ 2UUBQ 1Z9FA 4A3BH 4NB3A 2VQEQ 1D7QA 2UXCL 1EIFA 2K75A 3GTGH 1JE5A 4B3SL 3KJOA 4DV3Q 4LFCL 3PUZA 4DR5L 1K8GA 1E24A 5LMNL 4BBSH 2AHOB 3I4NH 1XNRQ 1L1OA 4IPDA 4X65Q 1MJEA 4LFCQ 3H15A 2R7FA 3D0FA 3AFQA 3WWVA 1EOVA 4DR5Q 2UXBL 2IT1A 2PNHA 1N8RC 2HT1A 3G71A 3S16H 3OTOQ 1N36L 2CWAA 3CMAA 2NVYH 2Y0SG 1VQLA 1VQOA 4JI4L 4IOAA 3S2HH 2UXBQ 1UE5A 1WFQA 2Q2HA 3M4PA 4LUVA 1WCMG 4RG1A 4NXMQ 3HOYH 1HZAA 2QEXA 3UDGA 2KCTA 1FGUA 4R4QA 2E5LQ 3PUYA 3J7ZC 4JI4Q 4JI3L 2CKZB 3S14H 1K8AC 2RCNA 4LF6Q 5JEAG 2DUDA 3U4VA 1YNXA 1Q46A 2JEBI 2OQKA 5GAGC 2RF4A 4GOPA 3G48A 4AQYQ 2KCMA 4DV2Q 4GNXC 4JI3Q 1VQJA 3PF4A 4L5RC 5IYBG 1QVGA 4LFAL 4DR3Q 1AE2A 1E1OA 2UUCL 1HNWL 2L15A 2QA4A 1M90C 2LXJA 1KL9A 4BY1H 2VUMH 5GQOA 1O7IA 2ES2A 3CXCA 1IBML 4DV6L 3HOVH 4A3DG 4DUZQ 2Z6KA 1LYLA 1YJ9A 3RN2A 1KHIA 5C0XG 3HKSA 4WJ4A 3I7FA 2UUCQ 1HNWQ 2BH2A 3CCMA 5IY0A 1N33Q 3H0GH 3Q8DA 3PUXA 3ZJYC 1C9OA 4DV0L 1S40A 3KYHC 2B63H 5HGQA 3M7NA 1NY4A 3RZDH 1MIUA 4YCUA 5C4JH 4LWCA 3CP0A 4PZ8A 4OWXB 3K0XA 3PGZA 3GTMH 1L2FA 2VNUD 4DV0Q 3ICEA 4LW1A 1U0LA 2R7ZH 1VCIA 3D31A 1EQQA 2BH8A 5IP9G 4JI6Q 1OXUA 3TS0A 2N8NA 2I5MX 4UP7A 1HH2P 3I55A 1LUZA 2JQOA 5H1SE 4JI1Q 4JOIA 1SE8A 2AWOA 4A3JH 1PH9A 1E7ZA 3GO5A 4O0AA 1A62A 1KAWA 5FLMG 1KIXA 1FJGQ 2JA8G 4Y7NH 1VQBA 5C44G 2UU9Q 3GTKH 1KRSA 2C35B 4GN5A 2YU9H 2F4VL 2I5LX 1K3RA 3TQYA 5C0XI 1Q1BA 3I2ZA 4QY7A 2CQOA 4IO9A 1YJNA 2KBNA 4DV4Q 3K8AA 1GO3E 2VQFQ 4OX9Q 4GKKL 4OXPA 2F4VQ 1N34L 1C0AA 3RR5A 4GS3A 3ER0A 1MJCA 3T1YL 3CCEA 3CAMA 5GADC 3S15H 3L7ZC 4X6AH 2RHSB 1JMCA 4HJ8A 2N3SA 1AE3A 4JG2A 5M5WH 3CC2A 4DR1L 2HIXA 2K14A 4YY3Q 1NMFA 4OWWB 3T1YQ 5M3FH 2MO1A 2D0OA 4LF7Q 1OTCA 4PMWA 2R6GA 5BR8L 1XPOA 1A63A 3AEVA 1XMQL 4DV1Q 1X55A 4GNXA 1J5EQ 5IYCG 1L1OB 2WP8J 3NENA 1GM5A 3UE0A 2GN5A 1XTDA 4UPAA 5BR8Q 3DM3A 1JJ2A 3AQQA 3W5OA 1R9TH 1Q86C 1XMQQ 4R4TA 3TREA 5GAHC 2OQ0A 3KJPA 2NVQH 4GLVB 1VQNA 3RNUA 2UXDQ 3F2DA 4JI7Q 5FJ8H 1IZ6A 3PUVA 4A76A 4LFBL 2PMZE 4K0KQ 1JT8A 3A0JA 1B7YB 4JI8L 3ULPA 2IY5B 3H3VH 2GVBA 3MEFA 3PIOA 3U58A 1BKBA 2N78A 4GKJQ 1HZCA 1EYGA 5LMUL 4KHZA 4LFBQ 4APVA 4WJ3M 3GTPH 2EIFA 5M3MG 2VZAA 2MQHA 1G6PA 4P75A 2BA0A 2CCZA 3I4MG 3PO2G 1Y14B 5LMUQ 1RIPA 1OXVA 4IFDG 4TVAB 1X3FA 3AYHB 4GOPB 2E2JH 4A3FG 5IWAL 4JI2Q 1IXRA 1NMGA 2PQAA 3CCVA 1VQPA 4L5QA 4JCVE 1I5FA 1IBKL 4ALPA 3M4OH 1N32Q 1QUQA 4ME3A 4HIDA 4JBKA 2EXDA 2Q2TA 2UUAL 3HKZG 4UP9A 4QJFA 2YTXA 4YWLA 4P71A 1IBKQ 1VQKA 3CCLA 2WAQG 4HJAA 1YBYA 4BA1I 4DR6L 1WCMH 4JYAL 2UXCQ 4TQUS 2ZM6L 1VQ5A 4B3ML 4DV5L 4B3SQ 1IL2A 1BVSA 1U5KA 1YEZA 2OCEA 3NEMA 3J81i 2AKWB 4JYAQ 3GTQH 5LMNQ 1PH8A 4IPCA 1OXSC 2XTIA 4JV5L 5IYDG 5LMNW 1I94L 1QZGA 2F3IA 4A3EG 1OXXK 4NXNL 4A3GG 2JK8A 4X62L 5IYBH 3CC7A 1UE1A 3M9BA 1RL2A 3F2CA 1N36Q 2E2IH 1I94Q 4A3DH 3PO3G 1WYDA 2OWOA 4A3MG 1PH4A 4IFDI 1Y1WG 3E0EA 5C4XG 2Q2IA 4AH6A 4AYBE 2ALYB 1X6OA 3RLFA 1PA6A 4YHHL 2NN6G 2B29A 4IJHA 3A5UA 3K7UC 2R92G 2PI2A 3GTLH 3HFZB 3B6YA 3CPWA 4A3IG 3S24A 4PZ6A 4HIKA 2CFMA 1HZ9A 2H5XA 1XPRA 2K5NA 5HY6A 3PIPA 1E1TA 5IP9H 4LFAQ 1VQHA 2AWNA 2NVXH 2N49A 1SROA 4LF8Q 3F2BA 3I4NG 2CWPA 1YHQA 2MO0A 5JJLA 1YI2A 1X9NA 1IBMQ 1P8LA 4DPGA 3J81c 3MXNB 2AMCB 4DV6Q 2JA9A 3UDXA 2ATWA 5GAEC 2BA1A 2KENA 4IJLA 4JI5L 1EIYB 1VQ6A 4HJ7A 1OXTA 2R7DA 4R1JA 2E8GA 1VQCA 2JA5H 5C44H 4L5SA 4GNXB 1K0RA 4JI5Q 2MNAA 3HOWH 2OTLA 1B8AA 2A1AA 4BY7H 3HOZG 2NN6I 3EN2A 4DUYL 1VS0A 1ASZA 4PG3A 1Q7YC 3M4QA 1AH9A 3TEHB 2Z0SA 1Y1VG 3NBHB 4B3RL 3KOJA 4YCWA 1KXLA 4LF5L 3G6EA 4DUYQ 2K5VA 3DLLA 1S72A 1Q81C 1E22A 1HR0L 1VQ9A 4BA2I 4DR4L 4DK6C 4X66L 1VQ4A 4B3RQ 3BZCA 1JJGA 3A5ZB 3U4ZA 1BBUA 3KF6A 1PH1A 2A8VA 2VUMG 4YWMA 1N9WA 4LF4L 3HOVG 1CKMA 4JC0A 1HR0Q 3OW2A 3W1GA 4DR4Q 1SLJA 2VL6A 1V43A 3FKIG 4OWTB 4BXXG 3F1ZA 4RMFA 5IYCH 3SGIA 3IRBA 1VQGA 2IHEA 2XGTA 3H0GG 1XJVA 4EX5A 2PQAB 4UP8A 1ASYA 1VQ7A 2IHFA 5EAYA 1HNZL 5GROA 3I56A 1SRUA 3PV0A 3T1HL 4LNQA 4GKKQ 4R4CA 1QUQB 2OTJA 1YVCA 1N34Q 1EQRA 2HQLA 1QVFA 4XIGS 1HNZQ 3ULLA 3KLWA 3FHWA 4A3LH 3F8TA 1L1OC 3CPFA 3J81j 3KDFA 1XMOL 4QQBX 4DR1Q 4A3CH 3CF5A 3J7A5 4A75A 2E2HH 2K4KA 4LUZA 3J80i 4A93G 1SMXA 4YWKA 3RLNA 5M3MH 1K83H 1A0IA 1W2BA 3L2PA 1GVPA 1WI5A 1P16A 4J15A 3S1MH 1TWGH 4C3HH 2R93H 4GLXA 2JA7H 3A74A 1UWVA 1KQSA 1SN8A 1M1KC 2WB1E 1PFSA 2FXQA 4FDBA 4JBJA 4YCVA 3HOXG 4QGUA 3M3YH 4JI8Q 4X64L 4A3KG 5IP7G 2PI2E 4HIMA 4IPGA 3CCRA 4GOPC 1YJWA 3GDEA 1Q1EA 5C3EG 1UEBA 4BBRG 3HOUG 5JJIA 4KI0A 3UDIA 1TXYA 4R4OA 2Z6KC 4DAYB 5IYDH 3UDFA 5IWAQ 5AJ3L 1SFOH 4A3EH 4A3GH 3GTJH 2HHHL 3S2DH 3VDYA 2WAQE 2B3GA 1WOCA 2I0QA 3S1NH 1PYBA 3J80c 2UUAQ 1GD7A 2ASBA 3L0OA 3ERSX 4GN4B 2RHQB 5C4XH 2WFWA 1VQIA 2KHJA 2UUBL 4DR6Q 4AIMA 2VQEL 2ZM6Q 2IX0A 1KRTA 1QVCA 5FJ8G 4B3MQ 1G291 4DV5Q 4DV3L 1VQFA 4MZ9A 1YHAA 4C3IH 2Y0SE 4A3IH 1PV4A 1WJJA 1XPUA 4JOIC 3CCJA 2YYZA 2A19A 3M85A 1XNRL 4POGA 3KFUA 4JV5Q 3K80C 4DK3C 3KF8B 3EBEA 4LUOA 4X65L 4HIOA 2JEAI 4NXNQ 1XNQL 1TWCH 2NVTH 4X62Q 4GLAC 2NZHA 1IYJB 5K36G 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJQ A;  3OTO L;  1G51 A;  2VW9 A;  2JA6 G;  3PUW A;  1JJC B;  1W3S A;  3LGJ A;  1CKN A;  2GVA A;  1XNQ Q;  1MKH A;  1EWI A;  1YIT A;  1I3Q H;  4UY8 C;  4A3B G;  4OO1 G;  3KF6 B;  4YHH Q;  4NXM L;  3CW2 C;  2E5L L;  1PH7 A;  4DKA C;  3S17 H;  1GKH A;  4P73 A;  1NJI C;  4LF6 L;  1BBW A;  4GN3 B;  4BBS G;  3PSI A;  1C7Y A;  3RZO H;  1PH5 A;  4QIW E;  1X3E A;  1VQA A;  5ELO A;  3HOZ H;  4AQY L;  4AYB G;  2ZJP A;  5JEA J;  4DV2 L;  3CC4 A;  5DLQ E;  4LF8 L;  1PYS B;  5IE8 A;  3CCQ A;  4DR3 L;  1TWA H;  1Y1V H;  3H3V I;  3E9I A;  3BZK A;  4MNO A;  3CME A;  5ELN A;  1HZB A;  3K81 C;  4DNI A;  1VQD A;  1LM0 A;  5FLM H;  3JC6 6;  4C3J H;  1Z47 A;  1CUK A;  3FP9 A;  3KDF B;  4DUZ L;  2JA8 H;  2DGY A;  1X3G A;  1YHB A;  5M5Y H;  3GTO H;  2JJQ A;  1N33 L;  3HOY G;  4B3T L;  3ULJ A;  4C2M H;  5C0X J;  1NTG A;  2EQS A;  4LF9 L;  2KHI A;  1IBL L;  1VQE A;  3FKI H;  1KD1 C;  4BXX H;  2ZJR A;  1E3P A;  3W1B A;  3S1R H;  4B3T Q;  3RLO A;  4OO1 I;  4QL5 A;  4R4I A;  1UE7 A;  4IOC A;  4LF9 Q;  1IBL Q;  1UE6 A;  1B70 B;  3S1Q H;  1H95 A;  3NEL A;  4JI6 L;  4PZ7 A;  4BY1 G;  1EUJ A;  1PH6 A;  4HJ9 A;  4LF5 Q;  4JI1 L;  2QGQ A;  5M5X H;  2ZTE A;  1K73 C;  3E9H A;  4X66 Q;  1YZ6 A;  3CD6 A;  4OON A;  5IT9 c;  4LF4 Q;  4A93 H;  1FJG L;  1VQM A;  2B63 G;  4KLK A;  4HJ5 A;  1KC8 C;  3TRZ A;  2UU9 L;  2F52 A;  1PVO A;  4H02 A;  2NZO A;  4DV7 L;  2K52 A;  1S3O A;  1JB7 A;  2V1C C;  3AFP A;  1V1Q A;  2VS1 A;  4DV4 L;  2JA5 G;  3T1H Q;  2VQF L;  4OX9 L;  2R7Z G;  4JI0 L;  1HR0 W;  4DV7 Q;  3HOW G;  5E7N A;  4DAM A;  3CQZ H;  1Q82 C;  4XTC S;  2HIV A;  2D62 A;  2YTY A;  2ID0 A;  4IPH A;  3BJU A;  3HOX H;  3TS2 A;  4BY7 G;  1NBW A;  1A8V A;  3JAM i;  3CCU A;  4A3K H;  4JI0 Q;  5IP7 H;  1XMO Q;  3I4M H;  3PO2 H;  2Q2U A;  3GD7 A;  4A3J G;  2D0P A;  2LXK A;  4YY3 L;  4L5T A;  1TWH H;  2K5H A;  1SR3 A;  3PCO B;  5C3E H;  1DGS A;  3G4S A;  4LF7 L;  4A3F H;  2LSS A;  1X65 A;  4BBR H;  3HOU H;  4MTN A;  1X54 A;  3RN5 A;  4DV1 L;  1J5E L;  3I4O A;  1TWF H;  2MFI A;  4NPS A;  4P74 A;  3OYY A;  1PH2 A;  2K50 A;  4JBM A;  1QZH A;  2UXD L;  1EFW A;  1VQ8 A;  4JBW A;  1T9H A;  4EQ5 A;  1FVI A;  2VY3 A;  2JE6 I;  4JI7 L;  1J6Q A;  1Q12 A;  1YIJ A;  4POF A;  1FL0 A;  1CKN B;  4K0K L;  1CSP A;  2ZTC A;  4X64 Q;  5JJK A;  2IX1 A;  1CKO A;  4A4I A;  3U50 C;  4GKJ L;  4DR7 L;  5M3F G;  1I50 H;  1V9P A;  4Y52 H;  1PH3 A;  3HKZ E;  1L0W A;  1NE3 A;  5FLX c;  4DR2 L;  1PHJ A;  1X56 A;  2YV5 A;  4O2D A;  2WB1 G;  4A3C G;  4DR7 Q;  1LTL A;  2YTV A;  1HNX L;  3JAM c;  3PO3 H;  5AJ3 Q;  4A3M H;  1HJP A;  4DR2 Q;  1Y1W H;  4JI2 L;  4A3L G;  3STB D;  2HHH Q;  5J3B A;  3CCS A;  4KHP L;  1Q8K A;  1D8L A;  3UE1 A;  4IFD J;  1K9M C;  3STB C;  3PF5 A;  1HNX Q;  1I6H H;  1N32 L;  2I5H A;  2R93 G;  2JA6 H;  3K7A H;  3BU2 A;  3EIV A;  4P72 A;  2JA7 G;  2R92 H;  1CSQ A;  4KHP Q;  2UUB Q;  1Z9F A;  4A3B H;  4NB3 A;  2VQE Q;  1D7Q A;  2UXC L;  1EIF A;  2K75 A;  3GTG H;  1JE5 A;  4B3S L;  3KJO A;  4DV3 Q;  4LFC L;  3PUZ A;  4DR5 L;  1K8G A;  1E24 A;  5LMN L;  4BBS H;  2AHO B;  3I4N H;  1XNR Q;  1L1O A;  4IPD A;  4X65 Q;  1MJE A;  4LFC Q;  3H15 A;  2R7F A;  3D0F A;  3AFQ A;  3WWV A;  1EOV A;  4DR5 Q;  2UXB L;  2IT1 A;  2PNH A;  1N8R C;  2HT1 A;  3G71 A;  3S16 H;  3OTO Q;  1N36 L;  2CWA A;  3CMA A;  2NVY H;  2Y0S G;  1VQL A;  1VQO A;  4JI4 L;  4IOA A;  3S2H H;  2UXB Q;  1UE5 A;  1WFQ A;  2Q2H A;  3M4P A;  4LUV A;  1WCM G;  4RG1 A;  4NXM Q;  3HOY H;  1HZA A;  2QEX A;  3UDG A;  2KCT A;  1FGU A;  4R4Q A;  2E5L Q;  3PUY A;  3J7Z C;  4JI4 Q;  4JI3 L;  2CKZ B;  3S14 H;  1K8A C;  2RCN A;  4LF6 Q;  5JEA G;  2DUD A;  3U4V A;  1YNX A;  1Q46 A;  2JEB I;  2OQK A;  5GAG C;  2RF4 A;  4GOP A;  3G48 A;  4AQY Q;  2KCM A;  4DV2 Q;  4GNX C;  4JI3 Q;  1VQJ A;  3PF4 A;  4L5R C;  5IYB G;  1QVG A;  4LFA L;  4DR3 Q;  1AE2 A;  1E1O A;  2UUC L;  1HNW L;  2L15 A;  2QA4 A;  1M90 C;  2LXJ A;  1KL9 A;  4BY1 H;  2VUM H;  5GQO A;  1O7I A;  2ES2 A;  3CXC A;  1IBM L;  4DV6 L;  3HOV H;  4A3D G;  4DUZ Q;  2Z6K A;  1LYL A;  1YJ9 A;  3RN2 A;  1KHI A;  5C0X G;  3HKS A;  4WJ4 A;  3I7F A;  2UUC Q;  1HNW Q;  2BH2 A;  3CCM A;  5IY0 A;  1N33 Q;  3H0G H;  3Q8D A;  3PUX A;  3ZJY C;  1C9O A;  4DV0 L;  1S40 A;  3KYH C;  2B63 H;  5HGQ A;  3M7N A;  1NY4 A;  3RZD H;  1MIU A;  4YCU A;  5C4J H;  4LWC A;  3CP0 A;  4PZ8 A;  4OWX B;  3K0X A;  3PGZ A;  3GTM H;  1L2F A;  2VNU D;  4DV0 Q;  3ICE A;  4LW1 A;  1U0L A;  2R7Z H;  1VCI A;  3D31 A;  1EQQ A;  2BH8 A;  5IP9 G;  4JI6 Q;  1OXU A;  3TS0 A;  2N8N A;  2I5M X;  4UP7 A;  1HH2 P;  3I55 A;  1LUZ A;  2JQO A;  5H1S E;  4JI1 Q;  4JOI A;  1SE8 A;  2AWO A;  4A3J H;  1PH9 A;  1E7Z A;  3GO5 A;  4O0A A;  1A62 A;  1KAW A;  5FLM G;  1KIX A;  1FJG Q;  2JA8 G;  4Y7N H;  1VQB A;  5C44 G;  2UU9 Q;  3GTK H;  1KRS A;  2C35 B;  4GN5 A;  2YU9 H;  2F4V L;  2I5L X;  1K3R A;  3TQY A;  5C0X I;  1Q1B A;  3I2Z A;  4QY7 A;  2CQO A;  4IO9 A;  1YJN A;  2KBN A;  4DV4 Q;  3K8A A;  1GO3 E;  2VQF Q;  4OX9 Q;  4GKK L;  4OXP A;  2F4V Q;  1N34 L;  1C0A A;  3RR5 A;  4GS3 A;  3ER0 A;  1MJC A;  3T1Y L;  3CCE A;  3CAM A;  5GAD C;  3S15 H;  3L7Z C;  4X6A H;  2RHS B;  1JMC A;  4HJ8 A;  2N3S A;  1AE3 A;  4JG2 A;  5M5W H;  3CC2 A;  4DR1 L;  2HIX A;  2K14 A;  4YY3 Q;  1NMF A;  4OWW B;  3T1Y Q;  5M3F H;  2MO1 A;  2D0O A;  4LF7 Q;  1OTC A;  4PMW A;  2R6G A;  5BR8 L;  1XPO A;  1A63 A;  3AEV A;  1XMQ L;  4DV1 Q;  1X55 A;  4GNX A;  1J5E Q;  5IYC G;  1L1O B;  2WP8 J;  3NEN A;  1GM5 A;  3UE0 A;  2GN5 A;  1XTD A;  4UPA A;  5BR8 Q;  3DM3 A;  1JJ2 A;  3AQQ A;  3W5O A;  1R9T H;  1Q86 C;  1XMQ Q;  4R4T A;  3TRE A;  5GAH C;  2OQ0 A;  3KJP A;  2NVQ H;  4GLV B;  1VQN A;  3RNU A;  2UXD Q;  3F2D A;  4JI7 Q;  5FJ8 H;  1IZ6 A;  3PUV A;  4A76 A;  4LFB L;  2PMZ E;  4K0K Q;  1JT8 A;  3A0J A;  1B7Y B;  4JI8 L;  3ULP A;  2IY5 B;  3H3V H;  2GVB A;  3MEF A;  3PIO A;  3U58 A;  1BKB A;  2N78 A;  4GKJ Q;  1HZC A;  1EYG A;  5LMU L;  4KHZ A;  4LFB Q;  4APV A;  4WJ3 M;  3GTP H;  2EIF A;  5M3M G;  2VZA A;  2MQH A;  1G6P A;  4P75 A;  2BA0 A;  2CCZ A;  3I4M G;  3PO2 G;  1Y14 B;  5LMU Q;  1RIP A;  1OXV A;  4IFD G;  4TVA B;  1X3F A;  3AYH B;  4GOP B;  2E2J H;  4A3F G;  5IWA L;  4JI2 Q;  1IXR A;  1NMG A;  2PQA A;  3CCV A;  1VQP A;  4L5Q A;  4JCV E;  1I5F A;  1IBK L;  4ALP A;  3M4O H;  1N32 Q;  1QUQ A;  4ME3 A;  4HID A;  4JBK A;  2EXD A;  2Q2T A;  2UUA L;  3HKZ G;  4UP9 A;  4QJF A;  2YTX A;  4YWL A;  4P71 A;  1IBK Q;  1VQK A;  3CCL A;  2WAQ G;  4HJA A;  1YBY A;  4BA1 I;  4DR6 L;  1WCM H;  4JYA L;  2UXC Q;  4TQU S;  2ZM6 L;  1VQ5 A;  4B3M L;  4DV5 L;  4B3S Q;  1IL2 A;  1BVS A;  1U5K A;  1YEZ A;  2OCE A;  3NEM A;  3J81 i;  2AKW B;  4JYA Q;  3GTQ H;  5LMN Q;  1PH8 A;  4IPC A;  1OXS C;  2XTI A;  4JV5 L;  5IYD G;  5LMN W;  1I94 L;  1QZG A;  2F3I A;  4A3E G;  1OXX K;  4NXN L;  4A3G G;  2JK8 A;  4X62 L;  5IYB H;  3CC7 A;  1UE1 A;  3M9B A;  1RL2 A;  3F2C A;  1N36 Q;  2E2I H;  1I94 Q;  4A3D H;  3PO3 G;  1WYD A;  2OWO A;  4A3M G;  1PH4 A;  4IFD I;  1Y1W G;  3E0E A;  5C4X G;  2Q2I A;  4AH6 A;  4AYB E;  2ALY B;  1X6O A;  3RLF A;  1PA6 A;  4YHH L;  2NN6 G;  2B29 A;  4IJH A;  3A5U A;  3K7U C;  2R92 G;  2PI2 A;  3GTL H;  3HFZ B;  3B6Y A;  3CPW A;  4A3I G;  3S24 A;  4PZ6 A;  4HIK A;  2CFM A;  1HZ9 A;  2H5X A;  1XPR A;  2K5N A;  5HY6 A;  3PIP A;  1E1T A;  5IP9 H;  4LFA Q;  1VQH A;  2AWN A;  2NVX H;  2N49 A;  1SRO A;  4LF8 Q;  3F2B A;  3I4N G;  2CWP A;  1YHQ A;  2MO0 A;  5JJL A;  1YI2 A;  1X9N A;  1IBM Q;  1P8L A;  4DPG A;  3J81 c;  3MXN B;  2AMC B;  4DV6 Q;  2JA9 A;  3UDX A;  2ATW A;  5GAE C;  2BA1 A;  2KEN A;  4IJL A;  4JI5 L;  1EIY B;  1VQ6 A;  4HJ7 A;  1OXT A;  2R7D A;  4R1J A;  2E8G A;  1VQC A;  2JA5 H;  5C44 H;  4L5S A;  4GNX B;  1K0R A;  4JI5 Q;  2MNA A;  3HOW H;  2OTL A;  1B8A A;  2A1A A;  4BY7 H;  3HOZ G;  2NN6 I;  3EN2 A;  4DUY L;  1VS0 A;  1ASZ A;  4PG3 A;  1Q7Y C;  3M4Q A;  1AH9 A;  3TEH B;  2Z0S A;  1Y1V G;  3NBH B;  4B3R L;  3KOJ A;  4YCW A;  1KXL A;  4LF5 L;  3G6E A;  4DUY Q;  2K5V A;  3DLL A;  1S72 A;  1Q81 C;  1E22 A;  1HR0 L;  1VQ9 A;  4BA2 I;  4DR4 L;  4DK6 C;  4X66 L;  1VQ4 A;  4B3R Q;  3BZC A;  1JJG A;  3A5Z B;  3U4Z A;  1BBU A;  3KF6 A;  1PH1 A;  2A8V A;  2VUM G;  4YWM A;  1N9W A;  4LF4 L;  3HOV G;  1CKM A;  4JC0 A;  1HR0 Q;  3OW2 A;  3W1G A;  4DR4 Q;  1SLJ A;  2VL6 A;  1V43 A;  3FKI G;  4OWT B;  4BXX G;  3F1Z A;  4RMF A;  5IYC H;  3SGI A;  3IRB A;  1VQG A;  2IHE A;  2XGT A;  3H0G G;  1XJV A;  4EX5 A;  2PQA B;  4UP8 A;  1ASY A;  1VQ7 A;  2IHF A;  5EAY A;  1HNZ L;  5GRO A;  3I56 A;  1SRU A;  3PV0 A;  3T1H L;  4LNQ A;  4GKK Q;  4R4C A;  1QUQ B;  2OTJ A;  1YVC A;  1N34 Q;  1EQR A;  2HQL A;  1QVF A;  4XIG S;  1HNZ Q;  3ULL A;  3KLW A;  3FHW A;  4A3L H;  3F8T A;  1L1O C;  3CPF A;  3J81 j;  3KDF A;  1XMO L;  4QQB X;  4DR1 Q;  4A3C H;  3CF5 A;  3J7A 5;  4A75 A;  2E2H H;  2K4K A;  4LUZ A;  3J80 i;  4A93 G;  1SMX A;  4YWK A;  3RLN A;  5M3M H;  1K83 H;  1A0I A;  1W2B A;  3L2P A;  1GVP A;  1WI5 A;  1P16 A;  4J15 A;  3S1M H;  1TWG H;  4C3H H;  2R93 H;  4GLX A;  2JA7 H;  3A74 A;  1UWV A;  1KQS A;  1SN8 A;  1M1K C;  2WB1 E;  1PFS A;  2FXQ A;  4FDB A;  4JBJ A;  4YCV A;  3HOX G;  4QGU A;  3M3Y H;  4JI8 Q;  4X64 L;  4A3K G;  5IP7 G;  2PI2 E;  4HIM A;  4IPG A;  3CCR A;  4GOP C;  1YJW A;  3GDE A;  1Q1E A;  5C3E G;  1UEB A;  4BBR G;  3HOU G;  5JJI A;  4KI0 A;  3UDI A;  1TXY A;  4R4O A;  2Z6K C;  4DAY B;  5IYD H;  3UDF A;  5IWA Q;  5AJ3 L;  1SFO H;  4A3E H;  4A3G H;  3GTJ H;  2HHH L;  3S2D H;  3VDY A;  2WAQ E;  2B3G A;  1WOC A;  2I0Q A;  3S1N H;  1PYB A;  3J80 c;  2UUA Q;  1GD7 A;  2ASB A;  3L0O A;  3ERS X;  4GN4 B;  2RHQ B;  5C4X H;  2WFW A;  1VQI A;  2KHJ A;  2UUB L;  4DR6 Q;  4AIM A;  2VQE L;  2ZM6 Q;  2IX0 A;  1KRT A;  1QVC A;  5FJ8 G;  4B3M Q;  1G29 1;  4DV5 Q;  4DV3 L;  1VQF A;  4MZ9 A;  1YHA A;  4C3I H;  2Y0S E;  4A3I H;  1PV4 A;  1WJJ A;  1XPU A;  4JOI C;  3CCJ A;  2YYZ A;  2A19 A;  3M85 A;  1XNR L;  4POG A;  3KFU A;  4JV5 Q;  3K80 C;  4DK3 C;  3KF8 B;  3EBE A;  4LUO A;  4X65 L;  4HIO A;  2JEA I;  4NXN Q;  1XNQ L;  1TWC H;  2NVT H;  4X62 Q;  4GLA C;  2NZH A;  1IYJ B;  5K36 G;  2ZTD A; 
#chains in the Genus database with same CATH topology
 3OTO L;  1TY0 A;  5T1I A;  1WTH A;  1YIT A;  4WJW A;  4NKL A;  5CV5 A;  2KQ3 A;  2E5L L;  5JVG 3;  4DKA C;  4A3I B;  3S17 H;  4P73 A;  1EYC A;  1BBW A;  3ERQ A;  5A2Q L;  1PH5 A;  3K5M A;  1VQA A;  1TWC B;  4AYB G;  4DV2 L;  5JEA J;  2G9D A;  1PYS B;  5C4H A;  1F9P A;  2FJ2 A;  1TU2 B;  3H3V I;  5ELN A;  1LTA D;  1HZB A;  1MSH A;  1CUK A;  2KEE A;  3MA2 B;  2O4X A;  1X3G A;  1YHB A;  3TZU A;  1EYD A;  3ULJ A;  3S17 B;  1DOK A;  1NTG A;  5C0X J;  2O5I C;  1VQE A;  4BXX H;  5FO8 B;  2ZJR A;  4IUN A;  1IYV A;  5I9P A;  3RLO A;  4R4I A;  1UE7 A;  4IOC A;  4ID6 A;  1IL8 A;  1VF7 A;  3S1Q H;  2H4O A;  3Q22 A;  1E0B A;  4LF5 Q;  3TSS A;  2ZTE A;  1K73 C;  3R2I A;  2I07 B;  1DON A;  2FMC A;  4A93 H;  1HHV A;  2F0K A;  2UU9 L;  1PVO A;  4H02 A;  1A3U A;  1B9N A;  4FVM A;  1AEX A;  3AFP A;  1V1Q A;  3S1Q B;  1XXG A;  2VQF L;  5I4D A;  4OX9 L;  1TT2 A;  1FYC A;  2D62 A;  3OIQ A;  2ID0 A;  3PQI A;  4BY7 G;  1EEF D;  4A3K H;  1H9K A;  1PTO D;  2IWH A;  3I4M H;  3PO2 H;  2L0C A;  1PTO C;  2D0P A;  1CHP D;  4A93 B;  3G4S A;  2Z4I A;  3K59 A;  2LSS A;  1X65 A;  3HOU H;  5ELD A;  3RN5 A;  2ZXR A;  4JBW A;  1FVI A;  2JE6 I;  3OSO A;  4JI7 L;  4QF4 A;  1Q12 A;  4ZK9 B;  4A3K B;  3I4M B;  3PO2 B;  2B39 A;  1JC7 A;  1CKO A;  5KEE A;  4FNF A;  3E6Z X;  5M3F G;  3HOU B;  1AW7 A;  1V1P B;  2RA4 A;  1PXU A;  3EVQ A;  5FLX c;  1LT4 D;  1LTL A;  3NTI A;  3JAM c;  3PO3 H;  5AJ3 Q;  4HCE A;  3AB9 A;  4X3K A;  3N52 A;  2HHH Q;  5J3B A;  2EY1 A;  2NN6 H;  3K7A H;  3BU2 A;  4P72 A;  3HEJ A;  1PYW D;  1HUM A;  3GTG H;  3R2T A;  3KJO A;  3NE5 B;  2XRS D;  3PUZ A;  1SXT A;  1E24 A;  5LMN L;  4BBS H;  1XNR Q;  2BOS A;  3PO3 B;  4IPD A;  1RKN A;  4X65 Q;  3AFQ A;  5KGU A;  4BWG B;  2HT1 A;  2KUM A;  3K7A B;  1N36 L;  4OL7 A;  2Y0S G;  1VQO A;  2FMM A;  1EWC A;  2F0U A;  3GTG B;  3CKI B;  3HOY H;  2QEX A;  4R4Q A;  4LF6 Q;  4BBS B;  1NNX A;  5IGF A;  3U4V A;  1IW7 D;  2OQK A;  5DM6 3;  5IOC A;  1X3P A;  1IW7 C;  3URY A;  3G48 A;  4ILW A;  1LV9 A;  4L5R C;  4ZUJ A;  3Q23 A;  1TS2 A;  1QVG A;  4DR3 Q;  1AE2 A;  2F0H A;  2UUC L;  2PO4 A;  4LFA L;  2L15 A;  2F0T A;  1HNW L;  1KL9 A;  4EQP A;  1GUT A;  5GQO A;  2ES2 A;  1IBM L;  1EY5 A;  4DUZ Q;  5CC4 A;  3RN2 A;  2UUC Q;  1HNW Q;  1G8Z D;  3HOY B;  1B50 A;  5IY0 A;  4FF1 A;  3H0G H;  5HGQ A;  3M7N A;  4CDE C;  2Z4H A;  2CH4 A;  2XSC A;  3PGZ A;  3GTM H;  1L2F A;  1FNW A;  3M4Y A;  3ICE A;  1HA6 A;  3D31 A;  3HRZ C;  2HDL A;  1OXU A;  3ITP A;  3RD4 A;  2N8N A;  5CR3 A;  4UP7 A;  4XQQ A;  4JI1 Q;  4JOI A;  1SE8 A;  1PFN A;  1D5M C;  3H91 A;  2OF1 A;  4O1N A;  3H0G B;  1JWM D;  5ELF A;  2KA7 A;  1PH9 A;  3GO5 A;  1KIX A;  2K04 A;  1JOO A;  4Y7N H;  5ELB A;  1KRS A;  2C35 B;  5NUC A;  1K3R A;  2EY5 A;  3TQY A;  3GTM B;  2CQO A;  5BN5 A;  4X3S A;  5LHY 1;  3ERO A;  1M4V A;  4GKK L;  3C2P A;  4KKT A;  5HGT A;  3I90 A;  4X6A H;  2PZT A;  2L9H A;  3D4D A;  3OMG A;  2CHB D;  2EVB A;  4Z9C B;  5C5M A;  3NTH A;  3I72 A;  4YY3 Q;  2MO1 A;  4Y7N B;  3AEV A;  4DV1 Q;  2CW0 C;  2WP8 J;  2K32 A;  1QNU A;  3UE0 A;  2GN5 A;  3TP6 A;  4UPA A;  3J7A V;  1JJ2 A;  2L5T A;  3AQQ A;  3W5O A;  2NVQ H;  4Q0F A;  5FJ8 H;  2F4I A;  1B7Y B;  2EDG A;  3H3V H;  2PMZ B;  2N78 A;  1S4Z A;  5CGK A;  4KHZ A;  4APV A;  1KAA A;  2EIF A;  2XWB B;  3I4M G;  2CCZ A;  3PO2 G;  1OXV A;  3AYH B;  4CGY B;  1EEI D;  1IXR A;  5J1Z A;  1VQP A;  4JCV E;  4XXE A;  2EXD A;  1V8Q A;  1QNK A;  4QJF A;  3MAQ A;  2F0D A;  1VQK A;  1EZ8 A;  3P1H A;  1BVS A;  2OCE A;  3J81 i;  3D6W A;  1A15 A;  4IPC A;  2XTI A;  4ZQ3 A;  2F0F A;  1I94 L;  3R3O A;  4IZ8 A;  2JK8 A;  3KBG A;  3CC7 A;  1UE1 A;  1PFM A;  3AU7 A;  4OGQ C;  2JXM B;  1I94 Q;  3PO3 G;  1WYD A;  4IN3 A;  3SK5 A;  2Q2I A;  1RTO A;  1I4G A;  1X6O A;  4K6L A;  2NN6 G;  5G3L D;  2B29 A;  3DXJ C;  3BG3 A;  3GTL H;  1STH A;  3BVM A;  5FO7 B;  4C3I G;  1IKL A;  4IUT A;  3NWS A;  1I4Q A;  5D3D A;  3O13 A;  3P75 A;  1MI2 A;  3LX0 A;  3A8I E;  2IW3 A;  2K5N A;  4IQZ A;  5HY6 A;  2R61 A;  3W3A A;  1HQR D;  2N49 A;  5JJL A;  1Z6H A;  3WOF A;  1YI2 A;  2NZ1 D;  3MXN B;  5A35 A;  3UDX A;  1E2Z A;  1IHZ A;  5GAE C;  4JI5 L;  4HJ7 A;  3GTL B;  3I4L A;  4L5S A;  1SND A;  4JI5 Q;  3HOW H;  1GXD C;  4LJZ C;  4B3R L;  1Y1V G;  3NBH B;  1SNP A;  1EQV A;  3G6E A;  4FP5 D;  1S72 A;  1VQ9 A;  2K5D A;  1QE6 A;  4X66 L;  4B3R Q;  2D5D A;  3A5Z B;  4R8I A;  4H0L C;  4KV6 A;  1N9W A;  4LF4 L;  1LT5 D;  3W1G A;  3HOW B;  1TR5 A;  4CJ1 B;  5IYC H;  3SGI A;  3H0G G;  3K58 A;  1X32 A;  5EAY A;  1NSN S;  3I56 A;  3T1H L;  4P2C B;  3VYU A;  1O7Y A;  4R4C A;  3ZYY X;  3EA6 A;  2CVR A;  4KD4 A;  1II3 A;  1QVF A;  3PMF A;  4XIG S;  1GOZ A;  3F8T A;  3CPF A;  4A3C H;  3J7A 5;  4A75 A;  3IFT A;  3DHQ A;  4LUZ A;  4NP5 A;  1H9S B;  4PV1 C;  5KYI A;  2SOB A;  3OIP A;  1CTM A;  3S1M H;  1NR2 A;  4C3H H;  4BS9 A;  3H09 A;  2Z6B A;  1KQS A;  2XIW A;  4DAV A;  1M1K C;  2JP1 A;  3LWE A;  4FDB A;  4X64 L;  2TMP A;  1S5C D;  2PI2 E;  2MJ8 A;  4KY5 A;  1VF5 C;  2EY2 A;  3SE0 A;  5EBC A;  4BBR G;  1JQY D;  1EWH A;  1F2Z A;  4QB4 A;  4R4O A;  3S1M B;  4C3H B;  2DNC A;  2EYM A;  5IYD H;  5IWA Q;  2ZXO A;  4IUU A;  2B3G A;  3X3N A;  3TME A;  3J80 c;  2ASB A;  1BQQ T;  3VR5 A;  2RHQ B;  4L6T B;  1VQI A;  3E3X A;  1MBY A;  5FJ8 G;  1SJH D;  1G29 1;  1HTP A;  4DV5 Q;  3A8K E;  4DV3 L;  1HFN A;  4JOI C;  3CCJ A;  2YYZ A;  1STN A;  4CJ0 B;  4JV5 Q;  3KFU A;  4HIO A;  1QWY A;  4DK3 C;  1AFP A;  1L0X B;  1XNQ L;  1IYJ B;  4IPG A;  5LMN W;  2ZJQ A;  5D3I B;  2JA6 G;  1JJC B;  2WKD A;  3TN2 A;  4JVZ A;  1CKN A;  5C3X A;  1XNQ Q;  1CA5 A;  2XNA C;  5ISR A;  1I3Q H;  3KF6 B;  3D3R A;  3UI2 A;  2IJ0 A;  3NUC A;  3RZO H;  3HOZ H;  2Q8T A;  2ZJP A;  4LF8 L;  4OEL B;  4HSV A;  5BN3 A;  3NBI A;  1FR3 A;  1PRT F;  4LF8 Q;  1VQD A;  2FIN B;  3JC6 6;  1I3Q B;  5M5Y H;  3GTO H;  1G2S A;  3L9A X;  3OWE B;  1BCP B;  3EFX D;  1SBB B;  1T5X D;  1IBL L;  1KD1 C;  3RZO B;  2SDF A;  1E3P A;  4ZAI A;  3W1B A;  1HA5 A;  3HOZ B;  4OO1 I;  4F7X A;  2MUY A;  1IBL Q;  1ESF A;  2HQE A;  4BY1 G;  3BDL A;  4ZKB B;  2QGQ A;  5M5X H;  5M5Y B;  3E9H A;  4C56 C;  3GTO B;  1E2W A;  4OON A;  1HCZ A;  4CJ2 C;  3SHL A;  4KLK A;  4HJ5 A;  4LMQ D;  4KD3 A;  4DV7 L;  1TS4 A;  2V1C C;  4DV4 L;  1KDB A;  3NPP A;  3SVM A;  4DV7 Q;  3HOW G;  5E7N A;  4XTC S;  2NTS A;  2YTY A;  5M5X B;  5EPK A;  3JAM i;  3CCU A;  1LTR D;  2Q2U A;  2K33 A;  3M7G A;  2EY6 A;  2F0Q A;  3CRL C;  4FF2 A;  5FOB B;  2WIN B;  1JWU D;  3I4O A;  3CU7 A;  4NPS A;  3SK4 A;  1A3V A;  3OYY A;  4EGV A;  1PH2 A;  4RGM A;  2UXD L;  1EFW A;  1T9H A;  4EQ5 A;  1J6Q A;  1YIJ A;  1AP0 A;  1FL0 A;  5JJK A;  2G5D A;  4CKB A;  2NYZ D;  3U50 C;  1EU4 A;  1ROD A;  4TRD A;  2A73 B;  1EY9 A;  1BXT A;  1PH3 A;  3CRK C;  3HKZ E;  4DR2 L;  3DEP A;  3T16 A;  1PHJ A;  1X56 A;  4KHV A;  2YV5 A;  4O2D A;  4F88 A;  5EKL A;  3KBX A;  4A3C G;  1HNX L;  4CDD C;  4DR2 Q;  1Y1W H;  4A3L G;  3STB D;  1Q8K A;  1GUO A;  5K36 H;  3STB C;  1HNX Q;  1N32 L;  2B8F A;  2I5H A;  4ODG A;  2R92 H;  4ZUI A;  4G4K A;  1WTX A;  1CSQ A;  4A3B H;  2K75 A;  1GUG A;  4F8M A;  1JE5 A;  4XT1 B;  4LFC L;  1K8G A;  1DM0 B;  2AHO B;  2EJM A;  2DJF C;  3R93 A;  1L1O A;  1Y1W B;  1MJE A;  5IGD A;  4LFC Q;  3D0F A;  1SNC A;  1EOV A;  5EJW A;  2PNH A;  2WAC A;  2VB3 X;  2F3V A;  3G71 A;  1XTC D;  3OTO Q;  3GV6 A;  2R92 B;  5DM7 3;  1VQL A;  1CZG A;  4IOA A;  4A3B B;  1WFQ A;  1EY4 A;  4KKS A;  4RG1 A;  3UDG A;  2E5L Q;  3PUY A;  3J7Z C;  3VYT A;  1SYB A;  2CKZ B;  4G7Z C;  2RCN A;  1SAP A;  4EQO A;  4GOP A;  4DV2 Q;  4GNX C;  3IAY A;  5IYB G;  2HD3 A;  1Y69 U;  5C4Z A;  1H9R A;  2K5W A;  1M90 C;  2X6L A;  3QJY A;  1NR4 A;  3CXC A;  4DV6 L;  1LYL A;  1FD7 D;  1K3B C;  3NP8 A;  1YJ9 A;  2BH2 A;  5I6Y A;  1CA6 A;  2HDM A;  2RVL A;  2A68 D;  3HP3 A;  5FLX E;  1WTR A;  4DV0 L;  2B63 H;  2A68 C;  1T5E A;  1E2V A;  3RZD H;  4KK7 A;  1MIU A;  5C5L A;  4PZ8 A;  4OWX B;  3NWT A;  2VNU D;  1QB5 D;  4DV0 Q;  2R7Z H;  5IP9 G;  3BZD B;  1HH2 P;  2JQO A;  4DNR B;  2AWO A;  3MC0 B;  4A3J H;  4O0A A;  2B63 B;  1A62 A;  2F0V A;  3V05 A;  3RZD B;  2UU9 Q;  1C8C A;  2F4V L;  3SEB A;  5IOD A;  1QJO A;  2RDH A;  2R7Z B;  3K8A A;  2VQF Q;  4OX9 Q;  2F4V Q;  1N34 L;  4GS3 A;  1MJC A;  3S15 H;  2RHS B;  4A3J B;  1JMC A;  3C1E A;  5J22 A;  4DR1 L;  3Q24 A;  3CC2 A;  4OWW B;  4MTK A;  3D4R A;  2D0O A;  1A63 A;  4H13 C;  4ABN A;  4CKC A;  3NEN A;  1JB3 A;  1Z7T A;  4KJO A;  3DM3 A;  1JIC A;  4R4T A;  2OQ0 A;  3KJP A;  1VQN A;  1SYF A;  1UNS A;  4DXF A;  4JI7 Q;  4CDF C;  3S15 B;  4LFB L;  1JT8 A;  3A0J A;  2DJG C;  5BN4 A;  1BKB A;  1EYG A;  5LMU L;  4LFB Q;  5M3M G;  4FF3 A;  2MQH A;  2ENB A;  4Q5V A;  5LMU Q;  1RIP A;  4TVA B;  2E2J H;  1F2Y A;  2PQA A;  4LK1 C;  4N9P A;  4WFN 3;  5C6A A;  1I5F A;  1STE A;  4OO1 H;  3QO2 A;  5IT9 E;  4HID A;  2Q2T A;  2UUA L;  2H1E A;  4RKL A;  4P71 A;  2WAQ G;  1B53 A;  1YBY A;  4DR6 L;  1WCM H;  4WRD A;  4TQU S;  2ZM6 L;  3TP5 A;  4B3M L;  1YEZ A;  2AKW B;  1ENA A;  2R3Z A;  3GTQ H;  5LMN Q;  1PH8 A;  3NQT A;  1RD9 D;  1UUP A;  2E2J B;  3QG1 A;  1RF2 D;  3TZD A;  4A3E G;  4A3G G;  4X62 L;  4DK0 A;  3M9B A;  1RL2 A;  2MGS A;  1N36 Q;  1DXM A;  1R4P B;  2RQX A;  4A3D H;  4IFD I;  2OWO A;  1PH4 A;  1Y1W G;  3U9O A;  1WCM B;  1EIH A;  2OT2 A;  4L63 B;  4YHH L;  4I7Z C;  2R92 G;  3GTQ B;  1SE2 A;  3HFZ B;  4RWS C;  4A3I G;  1U9R A;  4PZ6 A;  4HIK A;  2CFM A;  2H5X A;  4DAY A;  3PIP A;  1LO5 D;  4LFA Q;  3F2B A;  4A3D B;  2CWP A;  2DY8 A;  2MO0 A;  1ICW A;  4C1N K;  1YHQ A;  1IBM Q;  1P8L A;  4DPG A;  2E76 C;  2JA9 A;  4K8J A;  1I4R A;  2QEJ C;  2BA1 A;  4IJL A;  3FMC A;  2R7D A;  3NK9 A;  2E8G A;  5C44 H;  4GNX B;  4PMC A;  1K0R A;  5IGE A;  2MNA A;  1B8A A;  4RCO A;  1J8I A;  2DY7 A;  5JVH 3;  1XWE A;  3KF8 A;  1VS0 A;  1ASZ A;  4F87 A;  3TEH B;  1D1K A;  1BBX C;  5E3F A;  2K5V A;  4NMZ A;  3DLL A;  1E22 A;  5IT9 L;  4BA2 I;  3SXH A;  3H6M A;  3U4Z A;  1PRT D;  1PH1 A;  1PRT C;  5C44 B;  1CKM A;  3GP7 A;  1Q3L A;  3OW2 A;  5FO9 B;  1Y8O B;  4BXX G;  1ILQ A;  1KLG D;  3MFG A;  2IHE A;  2A74 C;  1B4O A;  4UP8 A;  1ASY A;  1PTO H;  2IHF A;  5C3W A;  3FRP B;  5GRO A;  1HNZ L;  4GKK Q;  1W6K A;  1BR9 A;  1LT6 D;  1QUQ B;  2NBF A;  1JOK A;  3VYR A;  1MSG A;  1EQR A;  1TY2 A;  1WD1 A;  1HNZ Q;  5CYU A;  3ULL A;  1L1O C;  3J81 j;  3OOC A;  1XMO L;  4QQB X;  1SJE D;  1SYC A;  3CF5 A;  1WTV A;  2B2W A;  2E2H H;  3J80 i;  4A93 G;  1SMX A;  3MHB A;  3RUZ A;  1W2B A;  2I46 A;  4HR7 B;  1GVP A;  1WI5 A;  1P16 A;  5K5P A;  3FEW X;  1PTO B;  4GLX A;  1ENC A;  1G91 A;  3BDO A;  1F9R A;  1STA A;  3C1F A;  1VMP A;  1TVX A;  2WB1 E;  2FXQ A;  1Q8I A;  4B9W A;  2MHV A;  4A3K G;  3CCR A;  4GOP C;  1YJW A;  1PZI D;  3DWQ A;  2E2H B;  1Q1E A;  3HOU G;  2EYL A;  2NVQ B;  5JJI A;  4KI0 A;  1WTQ A;  5I9O A;  2KEC A;  2QKI C;  1SFO H;  2AQ2 B;  3GTJ H;  3VDY A;  1LTG D;  2PPB C;  1HUN A;  2I0Q A;  1SNQ A;  2ICI A;  3GQB A;  1GD7 A;  1MD2 D;  3L0O A;  3ERS X;  4GN4 B;  5C4X H;  2WFW A;  1K28 A;  2KHJ A;  2UUB L;  1TQO A;  3TP7 A;  2VQE L;  4I7A A;  1YNJ D;  1YNJ C;  2PZW A;  5EPL A;  1RCV D;  3AMU A;  4K5W A;  1D6E C;  5EQ0 A;  1SFO B;  2JEA I;  3GTJ B;  2NVT H;  1ET6 A;  4GLA C;  1ILP A;  2NZH A;  1V43 A;  1G51 A;  1SEB D;  5C4X B;  1W3S A;  2EYO A;  1MKH A;  1EOT A;  1BUV T;  1JCK B;  2LFN A;  4UY8 C;  4OO1 G;  2A6H D;  4NXM L;  1GJX A;  2A6H C;  1EQT A;  3D6C A;  1V1P A;  1NJI C;  2KCN A;  4HED A;  2E2D C;  1EU3 A;  4GN3 B;  4BBS G;  1SYD A;  3PSI A;  4QIW E;  1X3E A;  5EBD A;  2F0P A;  5ELO A;  2NVT B;  4AQY L;  5DLQ E;  2HCC A;  1A2T A;  2XWJ B;  5IE8 A;  1DOM A;  3WOE A;  3CCQ A;  1TWA H;  3E9I A;  4MNO A;  3CME A;  2AUK A;  1LM0 A;  4C3J H;  3FP9 A;  1S5B D;  3KDF B;  2IX3 A;  2JJQ A;  1N33 L;  3HOY G;  3MZ5 A;  1GUN A;  2RKS A;  5E4X A;  4LF9 L;  2KHI A;  3PIP 3;  3FKI H;  4RHR A;  4LAA A;  4LF9 Q;  1TWA B;  1H95 A;  3NEL A;  4JI6 L;  2F0L A;  1TKW B;  1PH6 A;  2SNM A;  4C3J B;  4HJ9 A;  2K6A A;  1DOL A;  4X66 Q;  1YZ6 A;  3SK6 A;  5KND A;  4LF4 Q;  1FJG L;  3FKI B;  3TRZ A;  4K14 A;  2F52 A;  1DJR D;  1ESR A;  3MFY A;  1JB7 A;  3T1H Q;  4HSP A;  1HR0 W;  5JOB A;  1I4H A;  4N9T A;  3CQZ H;  4DAM A;  2HIV A;  1QOH A;  3HOX H;  2IPK D;  1NBW A;  1A8V A;  3KUP A;  5IP7 H;  4I65 A;  3GD7 A;  2LXK A;  4IFD H;  1TWH H;  2K5H A;  1SR3 A;  5C3E H;  4LF7 L;  1PDQ A;  1U4L A;  2AQ3 B;  3I91 A;  1X54 A;  1WTW A;  1J5E L;  3J81 E;  1TWF H;  5E4W C;  3SR1 A;  1CI3 M;  3KLS X;  3CQZ B;  2A69 D;  2VY3 A;  3HOX B;  2A69 C;  4POF A;  4HCS A;  4K0K L;  1CSP A;  3D8G A;  1LLR D;  2ZTC A;  4X64 Q;  4RHS A;  3G7L A;  5JPN C;  1TWH B;  4GKJ L;  4DR7 L;  1I50 H;  4JW0 A;  2F0I A;  4Y52 H;  1L0W A;  2Q8I B;  5FK9 C;  1SMY D;  4DR7 Q;  4JPB W;  1TWF B;  3HKZ B;  1SMY C;  2XN9 C;  1HPC A;  4A3M H;  1HJP A;  1EY6 A;  5HUR A;  4JI2 L;  2LS0 1;  1M8A A;  3CCS A;  1D8L A;  1WVL A;  3BS1 A;  1KLU D;  1B44 D;  4E6I A;  1H9M A;  1FGB D;  1IKM A;  3FVQ A;  1D7Q A;  1Z9F A;  1RDP D;  4NB3 A;  2UXC L;  1I50 B;  2WKC A;  1L0Y B;  4B3S L;  2F0W A;  4DV3 Q;  4UAI A;  3I4N H;  4A3M B;  1F9S A;  3H15 A;  3EJI A;  3WWV A;  2F0E A;  4GZY C;  2B2U A;  2CWA A;  1ZYR D;  2QW7 A;  3CMA A;  2NVY H;  1ZYR C;  3S2H H;  2Q2H A;  1ZXT A;  3M4P A;  3ONA B;  4LUV A;  4DK1 A;  3OMC A;  1KAB A;  1HZA A;  4RGT A;  1FGU A;  3U9S A;  4JI3 L;  3S14 H;  4U67 3;  3I4N B;  2Z8L A;  2EJF C;  2X69 A;  2C9O A;  2JEB I;  3V2T A;  4AYB B;  1U4R A;  2RF4 A;  2AQ1 B;  4JI3 Q;  2FHT A;  3K5L A;  2B2W C;  3HG9 A;  4RGN A;  5JJZ A;  4KY7 A;  3PF4 A;  1GHK A;  1E1O A;  1I4X A;  3J81 L;  2NVY B;  1SSO A;  1O7I A;  3HOV H;  1KHI A;  4HN7 A;  4WJ4 A;  3I7F A;  2B2V A;  3PUX A;  1OO9 B;  1QG7 A;  1C9O A;  3ND9 A;  3ZJY C;  1HFG A;  1UEA B;  1PZJ D;  1S40 A;  2JSO A;  1GHJ A;  3R8B A;  1NY4 A;  4HAE A;  2NB0 A;  4YCU A;  5C4J H;  3P20 A;  3CP0 A;  1CHQ D;  4CBV A;  5CBE E;  2F0N A;  1KDC A;  4LW1 A;  4M8A A;  2EYP A;  1J9O A;  2BH8 A;  2JYO A;  2I5M X;  1DYQ A;  3I55 A;  1LUZ A;  3HOV B;  1ENF A;  4DFA A;  1CFM A;  2LMC B;  1SYG A;  1STG A;  1KAW A;  4C3J G;  2EZV A;  1VQB A;  3IKJ A;  5C4J B;  4ZCK A;  2YU9 H;  2I5L X;  5C0X I;  1A6X A;  1Q1B A;  3I2Z A;  4IO9 A;  1YJN A;  4DV4 Q;  4KKU A;  4OXP A;  1C0A A;  3RR5 A;  3EQL C;  3ER0 A;  2CQA A;  3CCE A;  1RJT A;  3CAM A;  3L7Z C;  2EYJ A;  3MXN A;  4RA8 A;  3OWF A;  3NTK A;  4HJ8 A;  2N3S A;  4JG2 A;  5M5W H;  2HIX A;  4J6H A;  4YIJ A;  3NSW A;  4ZKC B;  5M3F H;  1I4P A;  2BDN A;  1JOQ A;  1X3Q A;  1XMQ L;  2YU9 B;  1X55 A;  5IYC G;  1SYE A;  4X3T A;  5A2Q E;  1XTD A;  1R9T H;  1I6V C;  4KMU C;  3FPP A;  1XMQ Q;  5GAH C;  1EY8 A;  3MEH A;  5AFW A;  5CV8 A;  2UXD Q;  2N88 A;  3DEO A;  4CKE A;  3PUV A;  4A76 A;  3NBH A;  1A3T A;  5L37 A;  4U68 A;  1ZEQ X;  4JI8 L;  5M5W B;  3ULP A;  2IY5 B;  2GVB A;  3PIO A;  3U58 A;  5M3F B;  4WJ3 M;  3GTP H;  2Z1C A;  2M2L A;  1G6P A;  4P75 A;  3QR8 A;  2V4D A;  4IFD G;  4K2K A;  1X3F A;  4C3H G;  3MWY W;  1R9T B;  4KN7 C;  1NMG A;  1YNN D;  2C5C A;  4L5Q A;  1IBK L;  3M4O H;  4ALP A;  1YNN C;  3DM1 A;  1N32 Q;  4ME3 A;  1Q90 A;  1U4M A;  3HKZ G;  3MXU A;  4K2L A;  4UP9 A;  2YTX A;  1PLF A;  1CZW A;  1IBK Q;  1B3A A;  2B2Y A;  1VQ5 A;  3GTP B;  1IL2 A;  4G57 A;  3NEM A;  1H9S A;  1BCP F;  2MP1 A;  1B2T A;  1HTL D;  1OXS C;  3A56 A;  2PCF B;  1UAP A;  1BF4 A;  5IYD G;  1SDF A;  3VR3 A;  2EPB A;  3M4O B;  4NXN L;  3C3L A;  2E2I H;  5DNF A;  5IGB A;  4A3M G;  2EYF A;  4QUC A;  4AH6 A;  4AYB E;  4XQN A;  3A55 A;  2ALY B;  4IAL A;  2O2L D;  4IJH A;  3OPO A;  2L12 A;  2QIL A;  4UHV A;  1HZ9 A;  3HZX A;  1F77 A;  2NVX H;  2E2I B;  3I4N G;  3VYS A;  5F2D A;  4FXG C;  4DV6 Q;  3MXP A;  2AMC B;  5CV9 A;  1HRJ A;  2ATW A;  1VQ6 A;  1EIY B;  3J7A F;  2MPM A;  2KHS A;  2K1B A;  2PW5 A;  3JAM E;  1U4P A;  4ME5 A;  4KJN A;  1D5Z C;  4R1J A;  2JA5 H;  1VQC A;  5I2Y A;  3K57 A;  1D5X C;  1PZK D;  4MN3 A;  1MHW C;  1KDA A;  2A1A A;  2L1B A;  3HOZ G;  3EN2 A;  2M00 A;  4HTH A;  2NVX B;  4PG3 A;  1AH9 A;  2BDO A;  3M4Q A;  2Z0S A;  3KOJ A;  4LF5 L;  3QB3 A;  1Q81 C;  3TBI B;  1HR0 L;  3BVZ A;  4DK6 C;  1VQ4 A;  1JJG A;  1WD0 A;  2A8V A;  1LT3 D;  3KF6 A;  4YWM A;  2JA5 B;  1F9Q A;  3HOV G;  4KY6 A;  4JC0 A;  4G7O C;  1HR0 Q;  3NXW A;  1SLJ A;  4RCN A;  4OWT B;  2AUJ D;  4HMI A;  2F0O A;  3VA7 A;  4EX5 A;  3S9W A;  2B2T A;  1SRU A;  3PV0 A;  4J1M A;  4DXG A;  1YVC A;  1N34 Q;  2HQL A;  1VMC A;  3VR4 A;  3KLW A;  3FHW A;  4O42 A;  1SE4 A;  5IGG A;  4DR1 Q;  2K05 A;  3QOJ A;  4NDX A;  3RLN A;  5CV4 A;  1K83 H;  2B2U C;  3I70 A;  3L2P A;  3H94 A;  2R93 H;  1TWG H;  5COY A;  2RDF A;  4MHE A;  2JA7 H;  1ONL A;  1LTI D;  4MIU A;  3DWA A;  2Z9H A;  3A74 A;  4JK1 C;  1SN8 A;  3D4W A;  1DD2 A;  2KVM A;  1PFS A;  5E1F A;  5KNB A;  2M9V A;  1CQF A;  5D14 A;  4QGU A;  3I8Z A;  5EKK A;  1EL0 A;  4WOR A;  2WB1 B;  4HIM A;  2JN4 A;  2OXP A;  3GDE A;  5FLX L;  1FNU A;  4UDU C;  1K83 B;  1S5E D;  1UEB A;  1XYI A;  1TXY A;  2B8G A;  3W2D A;  3JAM L;  5DAU A;  1TWG B;  2R93 B;  1K8M A;  3H3V C;  2JA7 B;  3V96 A;  3UDF A;  5AJ3 L;  4EQN A;  2B2V C;  2HHH L;  2WAQ E;  1WOC A;  1LTT D;  3PIO 3;  2UUA Q;  1GUS A;  4QUF A;  3QOL A;  5JEA H;  4DR6 Q;  4AIM A;  2ZM6 Q;  2IX0 A;  1KRT A;  4B3M Q;  1YHA A;  3DMU A;  2Y0S E;  4C3I H;  1PV4 A;  3BDC A;  1WJJ A;  2VXW A;  2A19 A;  1XNR L;  3K80 C;  4X65 L;  2L55 A;  3EBE A;  4LUO A;  4X62 Q;  1SNO A;  2EYH A;  5C0X H;  5K36 G;  1AZQ A;  2VW9 A;  3PUW A;  5COR A;  3LGJ A;  2GVA A;  3BYT B;  1EWI A;  4N8X 1;  5FKA C;  4IUP A;  4A3B G;  3K5O A;  4K6D A;  4YHH Q;  3CW2 C;  1PH7 A;  4C3I B;  1GKH A;  2A6E D;  4LF6 L;  5ELC A;  1JOR A;  2A6E C;  2WII B;  1C7Y A;  4G7H C;  3C46 A;  3T51 B;  3CC4 A;  4QIW B;  2KCC A;  2F1M A;  4DR3 L;  1Y1V H;  2ZXP A;  3BZK A;  3K6O A;  3TDQ A;  4H44 C;  3K81 C;  4XT3 B;  4DNI A;  5FLM H;  1Z47 A;  4DUZ L;  2JA8 H;  2DGY A;  4XYO A;  5CV6 A;  2PNR C;  4RFB A;  4B3T L;  2GA4 B;  4C2M H;  5M9O A;  3A8J E;  1DCZ A;  2EQS A;  4R9W A;  3S1R H;  4B3T Q;  1EIG A;  4QL5 A;  3DUZ A;  1UE6 A;  1B70 B;  1Y1V B;  4DN4 M;  4RAU C;  4PZ7 A;  1EUJ A;  5LL6 S;  2JA8 B;  4JI1 L;  3VR6 A;  2J4X A;  4K5V A;  1Y8N B;  1D2B A;  4NW2 A;  3CD6 A;  2L4N A;  4C2M B;  5IT9 c;  4IUQ A;  4ZLT F;  2RBM A;  1VQM A;  2B63 G;  1PFB A;  1KC8 C;  1KTK A;  2NZO A;  3S1R B;  2K52 A;  3T4A C;  1S3O A;  5KYL A;  2VS1 A;  1ML0 D;  2B2Y C;  2JA5 G;  2R7Z G;  2ZT9 C;  4JI0 L;  2KED A;  4C1N I;  1Q82 C;  2KOL A;  3L3O C;  4IPH A;  1QCB D;  3BJU A;  4TSS A;  3TS2 A;  4JI0 Q;  2D2C C;  1XMO Q;  4A3J G;  4YY3 L;  4L5T A;  3PCO B;  1DGS A;  4A3F H;  2G9H D;  4BBR H;  5LL6 X;  4MTN A;  4DV1 L;  3K0Y A;  2MFI A;  3DWP A;  4RKB A;  4P74 A;  2CW0 D;  5EPJ A;  2K50 A;  2LKV A;  4JBM A;  1QZH A;  1VQ8 A;  1QIL A;  1ICF B;  3LNN A;  1CKN B;  4K8I A;  2E74 C;  2IX1 A;  4K5X A;  4A4I A;  2IL8 A;  5KRU A;  4A3F B;  4BBR B;  1V9P A;  1NE3 A;  4OHJ A;  2EOT A;  1BOS A;  1F2L A;  1FNV A;  2WB1 G;  2YTV A;  4DGZ A;  2J0T D;  1LAB A;  3RMH A;  4KHP L;  4IFD J;  3UE1 A;  2PW7 A;  3QWN A;  1EYA A;  3PF5 A;  1K9M C;  1I6H H;  1O7Z A;  1WTO A;  1HQM C;  2JA6 H;  2R93 G;  1S5D D;  2TSS A;  3EIV A;  2JA7 G;  2K28 A;  5I2X A;  4KHP Q;  2UUB Q;  2VQE Q;  4KTA A;  4KN4 C;  1EIF A;  2OEO A;  4B08 A;  4DR5 L;  2SEB D;  1STB A;  1GUW A;  5JAV A;  3J7Y W;  1CT1 D;  3IL8 A;  5DEH A;  2R7F A;  4DR5 Q;  2UXB L;  1I6H B;  2IT1 A;  1NUC A;  2NUC A;  1N8R C;  2JA6 B;  3S16 H;  1EY7 A;  2HCI A;  1O78 A;  2UXB Q;  4JI4 L;  1UE5 A;  1XX8 A;  1CM9 A;  1WCM G;  2B2T C;  4NXM Q;  2KCT A;  4XDX A;  4JI4 Q;  1K8A C;  1B9M A;  5JEA G;  1EFI D;  5KNC A;  2DUD A;  2HUG A;  1YNX A;  1Q46 A;  1W6J A;  5GAG C;  5T1G A;  4AQY Q;  2KCM A;  1VQJ A;  5EGT A;  1BCP D;  3S16 B;  3GV3 A;  1BCP C;  2QA4 A;  4BY1 H;  2LXJ A;  1BO0 A;  2VUM H;  4A3D G;  4V19 0;  4DAP A;  2Z6K A;  5C0X G;  3HKS A;  3CCM A;  1N33 Q;  4DA2 A;  1R4Q B;  3Q8D A;  3G6J B;  3F2U A;  4M1U B;  3I3C A;  3KYH C;  2L11 A;  2EJG C;  1C4Q A;  3J80 E;  3T53 B;  4LWC A;  2F0J A;  3K0X A;  1ET9 A;  1DZ1 A;  1U0L A;  1VCI A;  1EQQ A;  1PTO F;  1SE3 A;  4JI6 Q;  2QCP X;  4BY1 B;  4OEM B;  3WDN A;  3TS0 A;  2VUM B;  5H1S E;  1K0S A;  2A5H A;  4FF4 A;  3K5N A;  1G6Z A;  1HXY D;  3MTS A;  1E7Z A;  5FLM G;  1FJG Q;  4R8N A;  2JA8 G;  3A7A B;  5C44 G;  3GTK H;  4GN5 A;  5TSS A;  4OIJ A;  4QY7 A;  2KBN A;  3OHX C;  1MGS A;  1GO3 E;  1TS3 A;  1PRT B;  1O7L A;  2O5J C;  4XQJ A;  3KK7 A;  3T1Y L;  4EVO A;  2QF7 A;  5GAD C;  1G2T A;  2E75 C;  1JWS D;  1AE3 A;  2BE5 D;  4FXD A;  2K14 A;  1NMF A;  2BE5 C;  3T1Y Q;  4LF7 Q;  1OTC A;  2K7V A;  4PMW A;  2R6G A;  5BR8 L;  1XPO A;  1RTN A;  3GTK B;  4N8F A;  1B3Q A;  4GNX A;  1J5E Q;  1L1O B;  4HMJ A;  4PMB A;  1GM5 A;  3BVG A;  3Q6S A;  5KIX A;  5BR8 Q;  1Q86 C;  3NQI A;  4A3L H;  3TRE A;  1WTP A;  4GLV B;  3RNU A;  1BNZ A;  3F2D A;  1IZ6 A;  1RHP A;  2RSN A;  3FDT A;  5C3E B;  2PMZ E;  4K0K Q;  3CHB D;  3MEF A;  1KNA A;  3SDZ A;  4GKJ Q;  1HZC A;  1TII D;  4V0B A;  4PQX A;  3ND8 A;  2VZA A;  1BDO A;  3LWU A;  2BA0 A;  2PYK A;  1Y14 B;  3IFD A;  1NCV A;  2F0M A;  1CQV A;  4GOP B;  1C48 A;  1NAP A;  2K01 A;  2VB2 X;  4A3F G;  5IWA L;  4JI2 Q;  4B9X A;  3CCV A;  3J80 L;  1QUQ A;  4JBK A;  4ZRZ A;  1EZ6 A;  4YWL A;  1SNM A;  3CCL A;  4HJA A;  3T56 B;  4BA1 I;  4JYA L;  2UXC Q;  4DV5 L;  4B3S Q;  1U5K A;  4DNT B;  2DN8 A;  2N55 A;  3E0J A;  1EY0 A;  4DF7 A;  4JYA Q;  2LY7 A;  1V1O A;  4JV5 L;  2RSO A;  1QZG A;  2F3I A;  1OXX K;  4PNY A;  1LAC A;  4CDC C;  5IYB H;  1LTS D;  5CMD A;  3F2C A;  3E0E A;  5C4X G;  2F3W A;  3NHH A;  3N6R A;  3HS0 C;  3RLF A;  4XYQ A;  1PA6 A;  1Y8P B;  3A5U A;  3K7U C;  2PI2 A;  3B6Y A;  3CPW A;  3TP8 A;  2P5Z X;  3S24 A;  3MVV A;  2KJX A;  3FPU B;  1XPR A;  3S2H B;  1E1T A;  1O80 A;  2F0S A;  4IUV A;  5IP9 H;  1VQH A;  2AWN A;  2XVS A;  1SRO A;  5EKI A;  4X3U A;  1X9N A;  3J81 c;  3S14 B;  2QDB A;  5IIF A;  3P7J A;  3VR2 A;  4ULL A;  2KEN A;  3QIA A;  3E5S A;  2PZU A;  3MXG A;  4RH6 A;  1OXT A;  2XRQ D;  1AZP A;  3SK8 A;  5J39 A;  2SNS A;  2EE1 A;  4H7B A;  2NWG A;  3A7L A;  2F03 A;  2OTL A;  4BY7 H;  2NN6 I;  4DUY L;  3HGB A;  4FXK C;  4FYD A;  4L8J A;  1Q7Y C;  4YCW A;  2DNE A;  1KXL A;  3T13 A;  4DUY Q;  1VDZ A;  4DR4 L;  1PMR A;  3BZC A;  1BBU A;  2VUM G;  1D1I A;  3KLR A;  2WV6 D;  2RDG A;  1S5F D;  4DR4 Q;  2VL6 A;  3FKI G;  2F0G A;  1H9J A;  3F1Z A;  4RMF A;  5IGC A;  2PQE A;  3IRB A;  1VQG A;  2CH4 W;  2XGT A;  4BY7 B;  1XJV A;  2PQA B;  1VQ7 A;  4J8Q A;  4LNQ A;  2OTJ A;  1JR0 D;  4QCL A;  2K03 A;  2D9U A;  3KDF A;  5CBA E;  5I6W A;  2K4K A;  4RGO S;  4YWK A;  5M3M H;  2NTT A;  1A0I A;  3OW7 A;  4CHT B;  4J15 A;  3Q0A A;  1KNE A;  1STY A;  2ICE C;  1UWV A;  4YCV A;  5CV7 A;  4JBJ A;  4FO2 A;  3HOX G;  3M3Y H;  1F2M A;  5ELE A;  4JI8 Q;  5IP7 G;  3X3M A;  3KLS A;  1K8O A;  1IYU A;  2FFK B;  5C3E G;  1JE4 A;  1ZKO A;  5M3M B;  4ZYS A;  4S3S A;  3UDI A;  1B1Z A;  3BYY B;  2Z6K C;  4DAY B;  4IUR A;  2QDL A;  4A3E H;  4A3G H;  3S2D H;  2BCO A;  1A2U A;  3S1N H;  1PYB A;  2X6G A;  4TKO B;  4QMG A;  5G3L F;  3M3Y B;  5D65 A;  2WAQ B;  3I73 A;  1AN8 A;  4OIK A;  2K5Q A;  2J7Z A;  1QVC A;  1CK1 A;  1VQF A;  2RCF A;  4MZ9 A;  4A3I H;  3VA5 A;  3A54 A;  1XPU A;  2EXZ A;  2Q8R E;  3M85 A;  1LTB D;  4POG A;  2Y0S B;  4DU9 A;  4A3E B;  1TS5 A;  3KF8 B;  4A3G B;  3S2D B;  4NXN Q;  1TWC H;  5JPM C;  3S1N B;  2ZTD A; 
#chains in the Genus database with same CATH homology
 2ZJQ A;  3OTO L;  1G51 A;  2VW9 A;  2JA6 G;  3PUW A;  1JJC B;  1W3S A;  3LGJ A;  1CKN A;  2GVA A;  1XNQ Q;  1MKH A;  1EWI A;  1YIT A;  1I3Q H;  4UY8 C;  4A3B G;  4OO1 G;  3KF6 B;  4YHH Q;  4NXM L;  3CW2 C;  2E5L L;  1PH7 A;  4DKA C;  3S17 H;  1GKH A;  4P73 A;  1NJI C;  4LF6 L;  1BBW A;  4GN3 B;  4BBS G;  3PSI A;  1C7Y A;  3RZO H;  1PH5 A;  4QIW E;  1X3E A;  1VQA A;  5ELO A;  3HOZ H;  4AQY L;  4AYB G;  2ZJP A;  5JEA J;  4DV2 L;  3CC4 A;  5DLQ E;  4LF8 L;  1PYS B;  5IE8 A;  3CCQ A;  4DR3 L;  1TWA H;  1Y1V H;  3H3V I;  3E9I A;  3BZK A;  4MNO A;  3CME A;  5ELN A;  1HZB A;  3K81 C;  4DNI A;  1VQD A;  1LM0 A;  5FLM H;  3JC6 6;  4C3J H;  1Z47 A;  1CUK A;  3FP9 A;  3KDF B;  4DUZ L;  2JA8 H;  2DGY A;  1X3G A;  1YHB A;  5M5Y H;  3GTO H;  2JJQ A;  1N33 L;  3HOY G;  4B3T L;  3ULJ A;  4C2M H;  5C0X J;  1NTG A;  2EQS A;  4LF9 L;  2KHI A;  1IBL L;  1VQE A;  3FKI H;  1KD1 C;  4BXX H;  2ZJR A;  1E3P A;  3W1B A;  3S1R H;  4B3T Q;  3RLO A;  4OO1 I;  4QL5 A;  4R4I A;  1UE7 A;  4IOC A;  4LF9 Q;  1IBL Q;  1UE6 A;  1B70 B;  3S1Q H;  1H95 A;  3NEL A;  4JI6 L;  4PZ7 A;  4BY1 G;  1EUJ A;  1PH6 A;  4HJ9 A;  4LF5 Q;  4JI1 L;  2QGQ A;  5M5X H;  2ZTE A;  1K73 C;  3E9H A;  4X66 Q;  1YZ6 A;  3CD6 A;  4OON A;  5IT9 c;  4LF4 Q;  4A93 H;  1FJG L;  1VQM A;  2B63 G;  4KLK A;  4HJ5 A;  1KC8 C;  3TRZ A;  2UU9 L;  2F52 A;  1PVO A;  4H02 A;  2NZO A;  4DV7 L;  2K52 A;  1S3O A;  1JB7 A;  2V1C C;  3AFP A;  1V1Q A;  2VS1 A;  4DV4 L;  2JA5 G;  3T1H Q;  2VQF L;  4OX9 L;  2R7Z G;  4JI0 L;  1HR0 W;  4DV7 Q;  3HOW G;  5E7N A;  4DAM A;  3CQZ H;  1Q82 C;  4XTC S;  2HIV A;  2D62 A;  2YTY A;  2ID0 A;  4IPH A;  3BJU A;  3HOX H;  3TS2 A;  4BY7 G;  1NBW A;  1A8V A;  3JAM i;  3CCU A;  4A3K H;  4JI0 Q;  5IP7 H;  1XMO Q;  3I4M H;  3PO2 H;  2Q2U A;  3GD7 A;  4A3J G;  2D0P A;  2LXK A;  4YY3 L;  4L5T A;  1TWH H;  2K5H A;  1SR3 A;  3PCO B;  5C3E H;  1DGS A;  3G4S A;  4LF7 L;  4A3F H;  2LSS A;  1X65 A;  4BBR H;  3HOU H;  4MTN A;  1X54 A;  3RN5 A;  4DV1 L;  1J5E L;  3I4O A;  1TWF H;  2MFI A;  4NPS A;  4P74 A;  3OYY A;  1PH2 A;  2K50 A;  4JBM A;  1QZH A;  2UXD L;  1EFW A;  1VQ8 A;  4JBW A;  1T9H A;  4EQ5 A;  1FVI A;  2VY3 A;  2JE6 I;  4JI7 L;  1J6Q A;  1Q12 A;  1YIJ A;  4POF A;  1FL0 A;  1CKN B;  4K0K L;  1CSP A;  2ZTC A;  4X64 Q;  5JJK A;  2IX1 A;  1CKO A;  4A4I A;  3U50 C;  4GKJ L;  4DR7 L;  5M3F G;  1I50 H;  1V9P A;  4Y52 H;  1PH3 A;  3HKZ E;  1L0W A;  1NE3 A;  5FLX c;  4DR2 L;  1PHJ A;  1X56 A;  2YV5 A;  4O2D A;  2WB1 G;  4A3C G;  4DR7 Q;  1LTL A;  2YTV A;  1HNX L;  3JAM c;  3PO3 H;  5AJ3 Q;  4A3M H;  1HJP A;  4DR2 Q;  1Y1W H;  4JI2 L;  4A3L G;  3STB D;  2HHH Q;  5J3B A;  3CCS A;  4KHP L;  1Q8K A;  1D8L A;  3UE1 A;  4IFD J;  1K9M C;  3STB C;  3PF5 A;  1HNX Q;  1I6H H;  1N32 L;  2I5H A;  2R93 G;  2JA6 H;  3K7A H;  3BU2 A;  3EIV A;  4P72 A;  2JA7 G;  2R92 H;  1CSQ A;  4KHP Q;  2UUB Q;  1Z9F A;  4A3B H;  4NB3 A;  2VQE Q;  1D7Q A;  2UXC L;  1EIF A;  2K75 A;  3GTG H;  1JE5 A;  4B3S L;  3KJO A;  4DV3 Q;  4LFC L;  3PUZ A;  4DR5 L;  1K8G A;  1E24 A;  5LMN L;  4BBS H;  2AHO B;  3I4N H;  1XNR Q;  1L1O A;  4IPD A;  4X65 Q;  1MJE A;  4LFC Q;  3H15 A;  2R7F A;  3D0F A;  3AFQ A;  3WWV A;  1EOV A;  4DR5 Q;  2UXB L;  2IT1 A;  2PNH A;  1N8R C;  2HT1 A;  3G71 A;  3S16 H;  3OTO Q;  1N36 L;  2CWA A;  3CMA A;  2NVY H;  2Y0S G;  1VQL A;  1VQO A;  4JI4 L;  4IOA A;  3S2H H;  2UXB Q;  1UE5 A;  1WFQ A;  2Q2H A;  3M4P A;  4LUV A;  1WCM G;  4RG1 A;  4NXM Q;  3HOY H;  1HZA A;  2QEX A;  3UDG A;  2KCT A;  1FGU A;  4R4Q A;  2E5L Q;  3PUY A;  3J7Z C;  4JI4 Q;  4JI3 L;  2CKZ B;  3S14 H;  1K8A C;  2RCN A;  4LF6 Q;  5JEA G;  2DUD A;  3U4V A;  1YNX A;  1Q46 A;  2JEB I;  2OQK A;  5GAG C;  2RF4 A;  4GOP A;  3G48 A;  4AQY Q;  2KCM A;  4DV2 Q;  4GNX C;  4JI3 Q;  1VQJ A;  3PF4 A;  4L5R C;  5IYB G;  1QVG A;  4LFA L;  4DR3 Q;  1AE2 A;  1E1O A;  2UUC L;  1HNW L;  2L15 A;  2QA4 A;  1M90 C;  2LXJ A;  1KL9 A;  4BY1 H;  2VUM H;  5GQO A;  1O7I A;  2ES2 A;  3CXC A;  1IBM L;  4DV6 L;  3HOV H;  4A3D G;  4DUZ Q;  2Z6K A;  1LYL A;  1YJ9 A;  3RN2 A;  1KHI A;  5C0X G;  3HKS A;  4WJ4 A;  3I7F A;  2UUC Q;  1HNW Q;  2BH2 A;  3CCM A;  5IY0 A;  1N33 Q;  3H0G H;  3Q8D A;  3PUX A;  3ZJY C;  1C9O A;  4DV0 L;  1S40 A;  3KYH C;  2B63 H;  5HGQ A;  3M7N A;  1NY4 A;  3RZD H;  1MIU A;  4YCU A;  5C4J H;  4LWC A;  3CP0 A;  4PZ8 A;  4OWX B;  3K0X A;  3PGZ A;  3GTM H;  1L2F A;  2VNU D;  4DV0 Q;  3ICE A;  4LW1 A;  1U0L A;  2R7Z H;  1VCI A;  3D31 A;  1EQQ A;  2BH8 A;  5IP9 G;  4JI6 Q;  1OXU A;  3TS0 A;  2N8N A;  2I5M X;  4UP7 A;  1HH2 P;  3I55 A;  1LUZ A;  2JQO A;  5H1S E;  4JI1 Q;  4JOI A;  1SE8 A;  2AWO A;  4A3J H;  1PH9 A;  1E7Z A;  3GO5 A;  4O0A A;  1A62 A;  1KAW A;  5FLM G;  1KIX A;  1FJG Q;  2JA8 G;  4Y7N H;  1VQB A;  5C44 G;  2UU9 Q;  3GTK H;  1KRS A;  2C35 B;  4GN5 A;  2YU9 H;  2F4V L;  2I5L X;  1K3R A;  3TQY A;  5C0X I;  1Q1B A;  3I2Z A;  4QY7 A;  2CQO A;  4IO9 A;  1YJN A;  2KBN A;  4DV4 Q;  3K8A A;  1GO3 E;  2VQF Q;  4OX9 Q;  4GKK L;  4OXP A;  2F4V Q;  1N34 L;  1C0A A;  3RR5 A;  4GS3 A;  3ER0 A;  1MJC A;  3T1Y L;  3CCE A;  3CAM A;  5GAD C;  3S15 H;  3L7Z C;  4X6A H;  2RHS B;  1JMC A;  4HJ8 A;  2N3S A;  1AE3 A;  4JG2 A;  5M5W H;  3CC2 A;  4DR1 L;  2HIX A;  2K14 A;  4YY3 Q;  1NMF A;  4OWW B;  3T1Y Q;  5M3F H;  2MO1 A;  2D0O A;  4LF7 Q;  1OTC A;  4PMW A;  2R6G A;  5BR8 L;  1XPO A;  1A63 A;  3AEV A;  1XMQ L;  4DV1 Q;  1X55 A;  4GNX A;  1J5E Q;  5IYC G;  1L1O B;  2WP8 J;  3NEN A;  1GM5 A;  3UE0 A;  2GN5 A;  1XTD A;  4UPA A;  5BR8 Q;  3DM3 A;  1JJ2 A;  3AQQ A;  3W5O A;  1R9T H;  1Q86 C;  1XMQ Q;  4R4T A;  3TRE A;  5GAH C;  2OQ0 A;  3KJP A;  2NVQ H;  4GLV B;  1VQN A;  3RNU A;  2UXD Q;  3F2D A;  4JI7 Q;  5FJ8 H;  1IZ6 A;  3PUV A;  4A76 A;  4LFB L;  2PMZ E;  4K0K Q;  1JT8 A;  3A0J A;  1B7Y B;  4JI8 L;  3ULP A;  2IY5 B;  3H3V H;  2GVB A;  3MEF A;  3PIO A;  3U58 A;  1BKB A;  2N78 A;  4GKJ Q;  1HZC A;  1EYG A;  5LMU L;  4KHZ A;  4LFB Q;  4APV A;  4WJ3 M;  3GTP H;  2EIF A;  5M3M G;  2VZA A;  2MQH A;  1G6P A;  4P75 A;  2BA0 A;  2CCZ A;  3I4M G;  3PO2 G;  1Y14 B;  5LMU Q;  1RIP A;  1OXV A;  4IFD G;  4TVA B;  1X3F A;  3AYH B;  4GOP B;  2E2J H;  4A3F G;  5IWA L;  4JI2 Q;  1IXR A;  1NMG A;  2PQA A;  3CCV A;  1VQP A;  4L5Q A;  4JCV E;  1I5F A;  1IBK L;  4ALP A;  3M4O H;  1N32 Q;  1QUQ A;  4ME3 A;  4HID A;  4JBK A;  2EXD A;  2Q2T A;  2UUA L;  3HKZ G;  4UP9 A;  4QJF A;  2YTX A;  4YWL A;  4P71 A;  1IBK Q;  1VQK A;  3CCL A;  2WAQ G;  4HJA A;  1YBY A;  4BA1 I;  4DR6 L;  1WCM H;  4JYA L;  2UXC Q;  4TQU S;  2ZM6 L;  1VQ5 A;  4B3M L;  4DV5 L;  4B3S Q;  1IL2 A;  1BVS A;  1U5K A;  1YEZ A;  2OCE A;  3NEM A;  3J81 i;  2AKW B;  4JYA Q;  3GTQ H;  5LMN Q;  1PH8 A;  4IPC A;  1OXS C;  2XTI A;  4JV5 L;  5IYD G;  5LMN W;  1I94 L;  1QZG A;  2F3I A;  4A3E G;  1OXX K;  4NXN L;  4A3G G;  2JK8 A;  4X62 L;  5IYB H;  3CC7 A;  1UE1 A;  3M9B A;  1RL2 A;  3F2C A;  1N36 Q;  2E2I H;  1I94 Q;  4A3D H;  3PO3 G;  1WYD A;  2OWO A;  4A3M G;  1PH4 A;  4IFD I;  1Y1W G;  3E0E A;  5C4X G;  2Q2I A;  4AH6 A;  4AYB E;  2ALY B;  1X6O A;  3RLF A;  1PA6 A;  4YHH L;  2NN6 G;  2B29 A;  4IJH A;  3A5U A;  3K7U C;  2R92 G;  2PI2 A;  3GTL H;  3HFZ B;  3B6Y A;  3CPW A;  4A3I G;  3S24 A;  4PZ6 A;  4HIK A;  2CFM A;  1HZ9 A;  2H5X A;  1XPR A;  2K5N A;  5HY6 A;  3PIP A;  1E1T A;  5IP9 H;  4LFA Q;  1VQH A;  2AWN A;  2NVX H;  2N49 A;  1SRO A;  4LF8 Q;  3F2B A;  3I4N G;  2CWP A;  1YHQ A;  2MO0 A;  5JJL A;  1YI2 A;  1X9N A;  1IBM Q;  1P8L A;  4DPG A;  3J81 c;  3MXN B;  2AMC B;  4DV6 Q;  2JA9 A;  3UDX A;  2ATW A;  5GAE C;  2BA1 A;  2KEN A;  4IJL A;  4JI5 L;  1EIY B;  1VQ6 A;  4HJ7 A;  1OXT A;  2R7D A;  4R1J A;  2E8G A;  1VQC A;  2JA5 H;  5C44 H;  4L5S A;  4GNX B;  1K0R A;  4JI5 Q;  2MNA A;  3HOW H;  2OTL A;  1B8A A;  2A1A A;  4BY7 H;  3HOZ G;  2NN6 I;  3EN2 A;  4DUY L;  1VS0 A;  1ASZ A;  4PG3 A;  1Q7Y C;  3M4Q A;  1AH9 A;  3TEH B;  2Z0S A;  1Y1V G;  3NBH B;  4B3R L;  3KOJ A;  4YCW A;  1KXL A;  4LF5 L;  3G6E A;  4DUY Q;  2K5V A;  3DLL A;  1S72 A;  1Q81 C;  1E22 A;  1HR0 L;  1VQ9 A;  4BA2 I;  4DR4 L;  4DK6 C;  4X66 L;  1VQ4 A;  4B3R Q;  3BZC A;  1JJG A;  3A5Z B;  3U4Z A;  1BBU A;  3KF6 A;  1PH1 A;  2A8V A;  2VUM G;  4YWM A;  1N9W A;  4LF4 L;  3HOV G;  1CKM A;  4JC0 A;  1HR0 Q;  3OW2 A;  3W1G A;  4DR4 Q;  1SLJ A;  2VL6 A;  1V43 A;  3FKI G;  4OWT B;  4BXX G;  3F1Z A;  4RMF A;  5IYC H;  3SGI A;  3IRB A;  1VQG A;  2IHE A;  2XGT A;  3H0G G;  1XJV A;  4EX5 A;  2PQA B;  4UP8 A;  1ASY A;  1VQ7 A;  2IHF A;  5EAY A;  1HNZ L;  5GRO A;  3I56 A;  1SRU A;  3PV0 A;  3T1H L;  4LNQ A;  4GKK Q;  4R4C A;  1QUQ B;  2OTJ A;  1YVC A;  1N34 Q;  1EQR A;  2HQL A;  1QVF A;  4XIG S;  1HNZ Q;  3ULL A;  3KLW A;  3FHW A;  4A3L H;  3F8T A;  1L1O C;  3CPF A;  3J81 j;  3KDF A;  1XMO L;  4QQB X;  4DR1 Q;  4A3C H;  3CF5 A;  3J7A 5;  4A75 A;  2E2H H;  2K4K A;  4LUZ A;  3J80 i;  4A93 G;  1SMX A;  4YWK A;  3RLN A;  5M3M H;  1K83 H;  1A0I A;  1W2B A;  3L2P A;  1GVP A;  1WI5 A;  1P16 A;  4J15 A;  3S1M H;  1TWG H;  4C3H H;  2R93 H;  4GLX A;  2JA7 H;  3A74 A;  1UWV A;  1KQS A;  1SN8 A;  1M1K C;  2WB1 E;  1PFS A;  2FXQ A;  4FDB A;  4JBJ A;  4YCV A;  3HOX G;  4QGU A;  3M3Y H;  4JI8 Q;  4X64 L;  4A3K G;  5IP7 G;  2PI2 E;  4HIM A;  4IPG A;  3CCR A;  4GOP C;  1YJW A;  3GDE A;  1Q1E A;  5C3E G;  1UEB A;  4BBR G;  3HOU G;  5JJI A;  4KI0 A;  3UDI A;  1TXY A;  4R4O A;  2Z6K C;  4DAY B;  5IYD H;  3UDF A;  5IWA Q;  5AJ3 L;  1SFO H;  4A3E H;  4A3G H;  3GTJ H;  2HHH L;  3S2D H;  3VDY A;  2WAQ E;  2B3G A;  1WOC A;  2I0Q A;  3S1N H;  1PYB A;  3J80 c;  2UUA Q;  1GD7 A;  2ASB A;  3L0O A;  3ERS X;  4GN4 B;  2RHQ B;  5C4X H;  2WFW A;  1VQI A;  2KHJ A;  2UUB L;  4DR6 Q;  4AIM A;  2VQE L;  2ZM6 Q;  2IX0 A;  1KRT A;  1QVC A;  5FJ8 G;  4B3M Q;  1G29 1;  4DV5 Q;  4DV3 L;  1VQF A;  4MZ9 A;  1YHA A;  4C3I H;  2Y0S E;  4A3I H;  1PV4 A;  1WJJ A;  1XPU A;  4JOI C;  3CCJ A;  2YYZ A;  2A19 A;  3M85 A;  1XNR L;  4POG A;  3KFU A;  4JV5 Q;  3K80 C;  4DK3 C;  3KF8 B;  3EBE A;  4LUO A;  4X65 L;  4HIO A;  2JEA I;  4NXN Q;  1XNQ L;  1TWC H;  2NVT H;  4X62 Q;  4GLA C;  2NZH A;  1IYJ B;  5K36 G;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...