3KF6B

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
PLGSDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6B00
1PH1A 2RCNA 3KF8B 4R4IA 4GLVB 2R92H 1N34Q 1WJJA 5E7NA 2K50A 4PZ7A 1HR0W 2Q2UA 3A5ZB 4IFDG 4DR2L 3CCRA 2OQKA 4LF7L 4DV6Q 1A0IA 4GKJQ 4IPDA 3PO2G 4DUZL 4DV3L 1PH2A 2V1CC 1PYSB 1PA6A 3K7UC 4FDBA 2ZJPA 1S40A 4BA2I 2IY5B 2A19A 2BH8A 3U4VA 5IYDH 2K5VA 4DV7Q 1KAWA 1QZHA 1HZAA 2NN6G 2NN6I 4LF8Q 5M3FG 2JJQA 5M3MH 3S1QH 1CKOA 3CMAA 2JK8A 2YTYA 2JE6I 1L2FA 1AH9A 4IO9A 2N8NA 2WB1E 4JI2L 1VQLA 4DR2Q 5JJIA 4LF7Q 2JA8H 4KHPL 4LUVA 4HJ9A 1NMGA 4IPCA 4JOIC 4HJAA 4DUZQ 2Z0SA 4DV3Q 3SGIA 2IX1A 1K3RA 2ID0A 5LMUL 1VQ5A 3FKIG 4WJ3M 1CUKA 3PUZA 2ALYB 4X64Q 4HIMA 1SLJA 1TWHH 5IYBG 4DV5L 1VQGA 4YCVA 1SN8A 2QEXA 1LM0A 2VL6A 4C2MH 4B3RL 2RF4A 3K0XA 4GOPA 1X3GA 4QIWE 1L1OA 2YV5A 2XGTA 3S1MH 4BY1G 3S24A 4JI2Q 1XNRQ 3OW2A 4X62Q 4KHPQ 2F52A 3UDXA 1I50H 1VQ8A 1YHBA 1VQFA 3KYHC 1MKHA 4YCWA 1KQSA 1X6OA 4DV4L 1OXXK 2UUBL 1EIFA 1RL2A 5LMUQ 4JI6L 2JEAI 4LFBL 3CMEA 2EIFA 2KBNA 1Q8KA 4DV5Q 4LUOA 1PYBA 1C7YA 1X56A 2DGYA 2KHIA 2N49A 5K36G 4B3RQ 5M3FH 2E2HH 5IY0A 3F2DA 4LFAL 2Q2IA 2JA5H 2Q2TA 2UU9Q 4B3SL 4AQYL 1EQQA 1VQOA 2WAQE 1HZ9A 3BJUA 3S2DH 5JEAG 1PH8A 1IBML 2UUBQ 4DV4Q 3D0FA 4A3LH 1TWCH 3RLNA 3CP0A 4ME3A 4R4CA 4IJHA 2A8VA 3HOZG 4DK3C 3PO3G 1Q86C 1C0AA 1D8LA 3I55A 5C4JH 3RN5A 3ULJA 1KL9A 4GOPB 1K8GA 1L1OC 5IYBH 3HOWG 1TWFH 3RLOA 2UXBL 3F8TA 1L1OB 3A0JA 1B70B 4EQ5A 5FLXc 3UDFA 3GTJH 1D7QA 4IJLA 3EBEA 4BXXG 1VQPA 4JI4L 4HJ5A 2NVTH 4X6AH 1GVPA 1N32L 3NENA 1OXUA 3OTOL 1XJVA 4R4QA 4B3SQ 4JBMA 4POFA 4AQYQ 1Q7YC 4X65L 5C3EG 3ZJYC 2YU9H 4YY3L 4PZ8A 1IBMQ 4JI3L 1UE5A 2OTLA 3PUVA 2ZM6L 4A3MG 1VQNA 1UWVA 2K75A 2MO0A 1K9MC 3PIOA 1YITA 3TQYA 3HOYH 3I4NG 1BBUA 2ASBA 2UXBQ 3A5UA 4OONA 3J81i 3STBD 3KFUA 1V43A 2AWNA 4JI4Q 1KD1C 4A3DG 4AYBE 4JI5L 2K14A 2R7FA 4A3KG 1N32Q 4MNOA 4LF4L 3OTOQ 1CSQA 3AYHB 1CKNA 3HOXH 2ATWA 1A8VA 3KOJA 2OCEA 3ULLA 4X65Q 3ER0A 2CFMA 4YY3Q 4JI3Q 2K5NA 2AMCB 1X55A 4OX9L 3BU2A 3HOZH 1VQDA 1VQHA 3RZDH 3CD6A 1M1KC 2CQOA 3HOWH 4GLAC 1N34L 4LF5L 4DK6C 4L5SA 2R6GA 2F4VL 4A3GH 4WJ4A 4NXML 4GKKL 3K81C 4POGA 3AEVA 1A63A 2WB1G 1N9WA 3W5OA 3NEMA 3J81j 4BXXH 3GTGH 1YJ9A 4JI5Q 1WCMH 4LF4Q 1K83H 4A3CG 4IOCA 2MNAA 2FXQA 5M5XH 1YI2A 1YJWA 4JYAL 2IHFA 2BA1A 4JOIA 5IE8A 3U50C 3F2CA 3TS2A 5LMNL 1M90C 1EIYB 3J7A5 1P8LA 4L5QA 1ASZA 4BY7G 1E22A 3I4NH 3TS0A 2VQEL 4LF5Q 2F4VQ 5C44H 5C0XJ 2I5LX 4NXMQ 2YTVA 1L0WA 4GKKQ 1X54A 3PCOB 2AHOB 4IFDI 1CKNB 1UE6A 1GO3E 3WWVA 1KRTA 3EIVA 4A3KH 4JV5L 3CPFA 4X64L 4C3IH 2NZOA 4DR1L 4GLXA 3T1HL 1ASYA 1FJGL 4AIMA 1HR0L 4JYAQ 1VQ4A 3M4PA 2D62A 2B29A 1XPRA 3KDFA 5LMNQ 2R7DA 4YWMA 3RZOH 1XTDA 4H02A 4DAYB 3E9IA 1Q12A 2VQEQ 3CCQA 2JA7H 1HZBA 1N33L 4A3BH 1PFSA 3PV0A 1XNRL 3S2HH 3G48A 4X62L 1Q46A 2ZJRA 2A1AA 3TEHB 4C3HH 3CF5A 1LYLA 1WYDA 4DV1Q 2WAQG 3K8AA 1EYGA 4A93H 2ZTDA 4X66L 3G6EA 5M5YH 2QA4A 2E2JH 4JV5Q 4A3EG 3T1HQ 4DR1Q 1QVGA 3RLFA 1G6PA 1OXVA 1WFQA 1Z9FA 3LGJA 5IT9c 1HR0Q 3I7FA 1FJGQ 5C4XG 1VQIA 4OWXB 3CCSA 3J81c 3H0GH 3AQQA 1DGSA 4O0AA 1UE7A 2PNHA 3JC66 4KI0A 4QQBX 2YYZA 1PH4A 3KLWA 1GKHA 1KRSA 4K0KL 4P71A 1SMXA 1IBLL 3D31A 4NB3A 1N33Q 5IP7G 2AWOA 3GTQH 4Y52H 1HNZQ 2Y0SG 1Q1BA 1YZ6A 3FHWA 2UU9L 4JI7L 1YBYA 1OXSC 1Y14B 3PUYA 3PO2H 4GN5A 1V9PA 5HY6A 4GS3A 1MJCA 4X66Q 2BH2A 2BA0A 3E0EA 1G291 1GD7A 2LXJA 2WP8J 3AFPA 3KDFB 3KJOA 3AFQA 4UPAA 3GTLH 2CWAA 2VY3A 1UE1A 5J3BA 3GTKH 2RHSB 3A74A 2C35B 2Q2HA 3G71A 1FL0A 4A3FG 1WOCA 1IBLQ 4DNIA 4K0KQ 4GN4B 2OTJA 3U4ZA 2K5HA 5GADC 5IYCG 4JI7Q 4YWKA 1PH3A 1VQ7A 1VQ6A 2HHHL 4XIGS 1WI5A 1E24A 5GAGC 4BBRG 1NBWA 4L5TA 4GNXC 2YTXA 3FKIH 2EXDA 3L7ZC 4GNXB 4A4IA 4UP9A 4IPGA 4A3EH 2R7ZG 1CKMA 4A3JG 4DR6L 3CCUA 1JE5A 1SFOH 2DUDA 3HKSA 4KLKA 1XMQL 4PZ6A 1PH9A 4DV0L 3ULPA 3I4MG 4NXNL 1XNQL 4BY1H 3J80c 4R1JA 2IT1A 2HHHQ 3I2ZA 2MFIA 3RR5A 5FLMG 2CCZA 4B3ML 4R4OA 1X9NA 1XMOL 2GN5A 3CW2C 1O7IA 1K8AC 4DR6Q 2I0QA 2MQHA 2VS1A 4LWCA 1IXRA 3BZKA 4PG3A 2OWOA 3CC2A 1OTCA 3S16H 4P75A 3ERSX 1PHJA 3S1NH 2N3SA 4KHZA 2LSSA 4HJ8A 4DKAC 1XMQQ 1E7ZA 3S14H 2KHJA 1I6HH 3UE1A 1Y1VG 2Z6KA 4DV0Q 4HIDA 4NXNQ 1KXLA 3CCJA 1XNQQ 3F2BA 3CPWA 3T1YL 5GAEC 1YVCA 4OXPA 1K73C 3W1GA 4B3MQ 1VQEA 1QUQA 3M4QA 4BBRH 3TRZA 3PO3H 1XMOQ 3GO5A 1MIUA 3L0OA 3CCMA 2NVQH 2MO1A 3J7ZC 5GAHC 4A3JH 1G51A 3PF5A 1IYJB 1JT8A 5IWAL 1N8RC 1KHIA 3S15H 2NVXH 2H5XA 4JI0Q 4LNQA 1CSPA 4A75A 1BVSA 1J6QA 3I4MH 1B8AA 4HJ7A 3T1YQ 4PMWA 5IP9G 3JAMi 4LF6L 4TQUS 2RHQB 1X65A 5IYDG 5C3EH 4DR3L 1KC8C 2PI2A 1NMFA 4A3MH 2B3GA 1E1OA 3K80C 5ELNA 2K4KA 2I5HA 1I3QH 5M3MG 3DM3A 4MTNA 1S72A 2Z6KC 1JJCB 2NVYH 1X3FA 2F3IA 1K0RA 3M9BA 4C3JH 5IWAQ 1IBKQ 1EQRA 4B3TL 2JA8G 1VQBA 4A3DH 1TWAH 4DV1L 2LXKA 1NY4A 2R93H 3UDIA 2OQ0A 2ZTEA 1W3SA 3F1ZA 3PUXA 5JJLA 1QUQB 1VS0A 1NE3A 2GVAA 3J80i 3STBC 4LFCL 4Y7NH 4DV2L 4LF6Q 1BKBA 3I4OA 5FJ8G 2I5MX 4LUZA 5BR8Q 4DR5L 1HJPA 4DR3Q 2L15A 3HOVG 3I56A 1YNXA 3M3YH 3HKZE 3BZCA 4LW1A 3RN2A 3PIPA 1Y1WG 2B63G 4QL5A 1HNZL 1AE3A 4QJFA 1H95A 1SE8A 4B3TQ 2IHEA 2IX0A 1Q82C 3S1RH 2GVBA 1HNWQ 4JC0A 3KF6A 5JEAJ 1P16A 1Z47A 1YIJA 4DR4L 4A3CH 2HT1A 1PVOA 4DV2Q 2D0PA 1VQMA 3PF4A 5IP9H 4LFCQ 1NJIC 3CQZH 2JEBI 3GD7A 2ZTCA 4UP7A 4DR5Q 3NBHB 3EN2A 2ZJQA 4GNXA 1TXYA 2UXDQ 5GQOA 3PUWA 4OO1G 2VW9A 4OO1I 1HNXL 4BY7H 4APVA 4TVAB 2AKWB 5AJ3L 1UEBA 2VNUD 4BBSG 4QY7A 2JA5G 4DR7L 1IZ6A 1QVCA 3FP9A 1E1TA 1GM5A 3HFZB 1Q1EA 4A3LG 2PQAA 4DR4Q 3PGZA 1LTLA 1VQAA 2CKZB 3H3VI 4JG2A 5JJKA 2K52A 1U0LA 1HH2P 1IL2A 1V1QA 5FJ8H 3CCVA 3HOVH 1YJNA 2EQSA 4OWTB 3NELA 4BA1I 1HNXQ 4JBWA 4AYBG 4JCVE 5AJ3Q 3HOUG 5C0XG 5C0XI 2WFWA 3E9HA 3KF6B 3IRBA 1Y1WH 2B63H 3JAMc 3G4SA 1Q81C 1X3EA 5EAYA 2UUAL 4LF9L 4DR7Q 3GDEA 3S17H 2JA9A 3Q8DA 4DUYL 4UP8A 3UE0A 4HIKA 3RNUA 3M7NA 1I94L 4LFBQ 3HOYG 5C4XH 3H15A 4A76A 4DAMA 3U58A 2ES2A 1YHQA 3B6YA 1FGUA 3MEFA 1S3OA 2JA6G 1LUZA 2UXCL 3CCLA 1BBWA 5IP7H 4BBSH 3HOXG 3TREA 1C9OA 1I5FA 1YEZA 2PQAB 3MXNB 1W2BA 2UUAQ 4LF9Q 1XPUA 2N78A 1EUJA 1B7YB 4XTCS 1E3PA 4P73A 3K7AH 3M85A 4DUYQ 1QZGA 4R4TA 1TWGH 1AE2A 2NZHA 4A3IG 2D0OA 1I94Q 4AH6A 1A62A 4JI6Q 2HIXA 4YWLA 1VCIA 3L2PA 4GOPC 3H3VH 2R93G 4A3GG 4YCUA 4JBJA 4L5RC 1HZCA 4EX5A 2VUMG 4J15A 4IFDJ 1N36L 2UXCQ 4MZ9A 2HIVA 5DLQE 4JI0L 3KJPA 4A3FH 4LFAQ 1WCMG 3HOUH 3CCEA 3GTMH 1JJGA 1SROA 2Y0SE 5IYCH 3DLLA 2VQFL 1QVFA 1PH7A 1FVIA 3PSIA 2JQOA 4ALPA 4O2DA 4QGUA 3CC4A 1XPOA 3ICEA 4P72A 2PMZE 3HKZG 5H1SE 5M5WH 2R92G 2R7ZH 5HGQA 4DPGA 5C44G 1SRUA 1PV4A 1JJ2A 3CXCA 4RG1A 1KIXA 2E5LL 3GTOH 1IBKL 4HIOA 2QGQA 1U5KA 1N36Q 3CAMA 4UY8C 2E8GA 2KCMA 4JI1L 1MJEA 2E2IH 2UUCL 2JA6H 3VDYA 3GTPH 1J5EL 4NPSA 1VQCA 2VQFQ 1YHAA 4YHHL 3CC7A 3OYYA 5BR8L 1NTGA 5FLMH 4RMFA 1PH5A 2ZM6Q 1PH6A 1EWIA 4JI8L 1VQJA 4A3IH 1R9TH 3M4OH 1T9HA 2XTIA 2JA7G 1EFWA 4OWWB 2KCTA 4A3BG 4IOAA 3W1BA 2E5LQ 1OXTA 2VUMH 2KENA 2VZAA 4JBKA 4JI1Q 2UUCQ 4DV6L 5GROA 4GKJL 1HNWL 1SR3A 5ELOA 5LMNW 4A93G 1VQKA 1Y1VH 2HQLA 1J5EQ 1JMCA 1RIPA 4IPHA 2PI2E 1VQ9A 4YHHQ 1EOVA 4GN3B 4DV7L 4P74A 2CWPA 3H0GG 2UXDL 4JI8Q 3UDGA 1JB7A 4OX9Q 4LF8L
chains in the Genus database with same CATH superfamily
1PH1A 2O4XA 1NR4A 1N34Q 4PZ7A 1HR0W 2JA6B 3GTPB 3DHQA 4IPDA 4HEDA 3KLSX 2V1CC 1PYSB 1DOKA 1PA6A 4DXFA 1Z6HA 1S40A 1PZKD 5KGUA 2A19A 2BH8A 3QIAA 5CV4A 4DV7Q 4J1MA 2JN4A 2EJMA 5M3FG 2N88A 4A3GB 1CKOA 3CMAA 4IO9A 2N8NA 3X3MA 2I46A 4IUUA 2GA4B 5D65A 3BDCA 5JJIA 5LL6X 5D3DA 1DD2A 4JOIC 5L37A 4HJAA 2Z0SA 4WJ3M 3LWEA 2K32A 1MBYA 2QEXA 1LM0A 1SNOA 5JAVA 1CM9A 5CV6A 1X3GA 1L1OA 2YV5A 2XGTA 4BY1G 3S24A 1EY9A 3NWSA 4NMZA 1I50H 5EPKA 4G7HC 1MKHA 1HCZA 1OXXK 1EIFA 3K0YA 4JI6L 4IUTA 5JVH3 2EIFA 2F0IA 2KBNA 1Q8KA 1RKNA 1C7YA 1FD7D 3D4DA 4Z9CB 1EY7A 2NN6H 1SNMA 1SJED 3K58A 3F2DA 1XTCD 3Q24A 2JA8B 4OEMB 2JA5H 4B3SL 3GP7A 1VQOA 4A93B 3S2DH 3BJUA 5JEAG 2RDHA 2DY8A 3CP0A 1TWHB 4R4CA 4IJHA 2A8VA 1C0AA 3I55A 4RHSA 4CKEA 1S5ED 1XYIA 3T53B 3MHBA 1MGSA 1SAPA 4C2MB 1B70B 3GTJH 1SMYD 1S5DD 2F0FA 5DM63 1D7QA 4BXXG 3SK4A 2NVTH 5CV9A 1N32L 4WFN3 1OXUA 1XJVA 4B3SQ 1Q7YC 3WDNA 2A6EC 4PZ8A 4JI3L 2ZM6L 2MO0A 2MHVA 3AU7A 2VB3X 1QNKA 4K5XA 3STBD 3BYTB 3KFUA 2E2HB 2K14A 4A3KG 1N32Q 4LF4L 1CHPD 1CSQA 2FHTA 3HOXH 3FVQA 2ICEC 2CFMA 4H7BA 1NR2A 2B2TA 4JI3Q 1F2ZA 2AMCB 1QILA 3QOJA 1VQDA 2E75C 3P7JA 3CD6A 4LF5L 2F4VL 1IYUA 2NWGA 3LWUA 3K81C 2WB1G 3NQIA 1EY5A 4HCEA 4LF4Q 1RF2D 2FXQA 4JYAL 2BA1A 1WTVA 5IE8A 3FPUB 4ZYSA 4GZYC 1P8LA 4BY7G 1D5XC 3I4NH 2FMCA 4LF5Q 2F4VQ 2I5LX 5G3LF 1KDAA 5EPJA 1GO3E 4FF3A 4LAAA 2L5TA 2B2VA 3T1HL 1ASYA 1X32A 1FJGL 4JYAQ 1HR0L 5EBCA 3M4PA 2D62A 1RD9D 4K6DA 3HOZB 2E2DC 1XPRA 3KDFA 3HOWB 2G9DA 3RZOH 1XTDA 2A68D 3HRZC 5CMDA 3OIPA 3S2HH 1Q46A 3GTGB 2A1AA 3S15B 3ONAB 4H44C 1WYDA 2LY7A 2WAQG 5CC4A 3O13A 3G6EA 4A3EG 3T1HQ 2Z4HA 1F9RA 3RLFA 1OXVA 1WFQA 1Z9FA 1FJGQ 1HR0Q 4RAUC 1X3PA 1VQIA 3H0GH 4QQBX 5CBAE 1TR5A 1KRSA 4CJ0B 2NVYB 1DXMA 1SMXA 1IBLL 4UAIA 1SJHD 1I4RA 1EEFD 3DWAA 1Q1BA 3FHWA 2K7VA 2Z4IA 3P20A 4KN7C 1KDCA 2K6AA 4GN5A 1B3AA 1DM0B 5HY6A 1MJCA 2F3VA 1G291 1GD7A 3GTLH 3R2TA 3M3YB 1UE1A 2WINB 4CDFC 3A74A 2C35B 3BVMA 1IBLQ 3OMGA 1GJXA 3MZ5A 1SE4A 5IYCG 2HHHL 1WI5A 4BS9A 1ESRA 1NBWA 2JXMB 4F87A 3TDQA 3NTIA 2B2WC 4XQNA 2DUDA 5ELEA 4CDCC 2AQ1B 3I73A 1HTPA 4NXNL 1XNQL 2IT1A 2HHHQ 4DNRB 4F8MA 3I2ZA 2K5QA 4B3ML 4KHVA 3CW2C 5ELCA 1O7IA 4LWCA 3BZKA 5FKAC 2OWOA 1OTCA 3GTKB 4IALA 5K36H 2N3SA 2PW7A 2LSSA 3UE1A 1KXLA 2Z6KA 4NXNQ 1ENFA 1XNQQ 2ENBA 3T1YL 5GAEC 1PLFA 3FKIB 4B3MQ 1VQEA 4QMGA 2F0NA 1SFOB 5GAHC 1ML0D 1ONLA 3PF5A 2KOLA 4RFBA 4DAYA 1KHIA 3QOLA 5I2YA 1VDZA 4X3KA 5CV7A 1PFBA 4A75A 1J6QA 4CHTB 3SK5A 1SMYC 3HP3A 4L6TB 3T1YQ 4JK1C 1PYWD 1T5XD 1X65A 1JQYD 5C3EH 4DNTB 4DR3L 3L9AX 2X69A 4A3MH 2B3GA 1PTOH 3FMCA 4MTNA 3VYRA 3OOCA 1JJCB 5T1IA 3S14B 3E6ZX 1STYA 1I6HB 1TWAH 2R93H 3UDIA 2OQ0A 1SSOA 1WTPA 5JJLA 1QUQB 1VS0A 1STAA 2GVAA 3STBC 1BF4A 1GUSA 4LFCL 3I4OA 3PO3B 2QDBA 4K2KA 4DR5L 4DR3Q 1EY6A 2QF7A 2EYMA 1FYCA 5M5WB 3HKZE 4ZQ3A 3KLRA 4LW1A 3DWQA 3GTOB 1LTTD 1AE3A 4QJFA 2K03A 4NW2A 2NVXB 2IX0A 3I4MB 2B2YA 3KF6A 3NPPA 3OW7A 1G2TA 3PF4A 4LFCQ 4ID6A 4RGTA 5C6AA 3GD7A 1A15A 3ITPA 4DR5Q 2EY5A 3EJIA 3A7AB 3EN2A 1TXYA 1G2SA 4GNXA 3DMUA 1HNXL 4BBSG 2F0HA 2PQEA 2JA5G 4A3DB 1PTOF 2K05A 3VYUA 2KECA 2XSCA 1IZ6A 1QVCA 4G7OC 1EY0A 3HFZB 1AN8A 1TQOA 1HA5A 4Y7NB 1LTLA 1PMRA 4KJNA 1EYAA 4DN4M 1ET9A 1IL2A 1V1QA 1V1PB 4EQOA 4ZKBB 3K6OA 4I65A 2EQSA 4F7XA 1HNXQ 1W6KA 3HOUG 4ZRZA 1STNA 3NK9A 4IUNA 2D2CC 1Q81C 3KUPA 4B9WA 2A68C 2JA9A 2CH4A 3CQZB 5C4XH 4A76A 2JP1A 4KKUA 3U58A 1YHQA 1FGUA 1HQRD 5M3MB 3N52A 4HN7A 5DAUA 4OO1H 5IP7H 3HOXG 3TREA 1C9OA 1Z7TA 3MAQA 1W2BA 1B7YB 1BCPD 1TWGH 4A3IG 4RH6A 5ELDA 2HIXA 4YWLA 4GOPC 3H3VH 1GUNA 3HOVB 4YCUA 1TKWB 4ODGA 4MZ9A 4JI0L 1X3QA 3S1MB 4PMCA 2Z1CA 1ESFA 2V4DA 1QVFA 1TT2A 1F9SA 1GHJA 2BDOA 3VR5A 4QGUA 2KCCA 5KIXA 2K04A 1LT3D 4X3UA 1EIGA 2R92G 2R7ZH 2EOTA 2SOBA 1PV4A 1R4QB 4IZ8A 2E5LL 1PRTF 2QGQA 4TSSA 1RDPD 2E8GA 4JI1L 1MJEA 2JA6H 3GTPH 1J5EL 1U4PA 1O7YA 3K7AB 3A7LA 3WOFA 4DFAA 5BR8L 4RMFA 1TS2A 1PH6A 1EWIA 2JSOA 1F9PA 5TSSA 3OHXC 1SBBB 2E5LQ 2KENA 2VZAA 4AYBB 3J7YW 4XDXA 4JI1Q 4DV6L 5ELOA 1Y1VH 3TBIB 1J5EQ 1JMCA 4LMQD 3CKIB 5JPMC 1HUNA 1CFMA 4HSVA 4P74A 3H0GG 4FF4A 3TN2A 4Q0FA 2RCNA 2I07B 4GLVB 4G57A 2Q2UA 3A5ZB 2OQKA 4LF7L 4DV6Q 1AW7A 1WD0A 2WIIB 4DV3L 5LL6S 5EKLA 1ZEQX 2IY5B 3U4VA 5IYDH 2O2LD 2K5VA 1O7ZA 1SYCA 3RZDB 2NN6I 2JE6I 2VUMB 1QOHA 2F0UA 4XXEA 4LF7Q 2JA8H 4HJ9A 1NMGA 3EA6A 1YNND 2FMMA 3SGIA 1S5CD 1K3RA 4J6HA 2ID0A 4XT3B 4DV3Q 4HR7B 1I4HA 1VQ5A 1CUKA 2CQAA 2ALYB 2LFNA 2P5ZX 1SLJA 1TWHH 3I3CA 4X64Q 4HIMA 3HS0C 2EY2A 4XT1B 1S5BD 2D9UA 1D1IA 4C2MH 4B3RL 5K5PA 3K0XA 1EQTA 4QIWE 5C4HA 1EYCA 1U4RA 3OW2A 4X62Q 1RHPA 5I2XA 2EE1A 3EQLC 4CDDC 3R8BA 1YHBA 3A56A 4YCWA 1KQSA 2UUBL 4DV4L 2JEAI 3H6MA 3CMEA 3IKJA 4CDEC 2HCCA 1X56A 2DGYA 3S1QB 5K36G 4B3RQ 2JA7B 1PDQA 2E2HH 4LFAL 2Q2IA 3QO2A 5C3XA 1ZYRD 4C3HB 2Q2TA 5EKKA 1F2MA 1EQQA 1EQVA 2QEJC 1TY0A 2UUBQ 4DV4Q 3RLNA 4ME3A 1G8ZD 3IFTA 4DK3C 1Q86C 1D8LA 3RN5A 4GOPB 5IYBH 5C5MA 1ZXTA 4WJWA 2NB0A 4IJLA 5A35A 3EBEA 4JI4L 1UUPA 2HCIA 2MJ8A 1FNUA 2F0TA 3I70A 1LT5D 4POFA 3NSWA 5C3EG 1SE2A 4A3MG 3C46A 2QW7A 2A74C 1UWVA 2IWHA 1K9MC 1LV9A 3I72A 3DUZA 1NNXA 5CYUA 1HXYD 4OONA 5M3FB 4JI4Q 1KD1C 5FLXE 4AYBE 4FVMA 4JI5L 2PZWA 1BDOA 4FF2A 1A8VA 3KOJA 3ULLA 1TWCB 2XWBB 3I8ZA 1QE6A 2F03A 5C4JB 5C5LA 1UAPA 1EY8A 2M2LA 3HOZH 1A3TA 1TWFB 2CQOA 3HOWH 1N34L 1BCPC 4NXML 4POGA 3AEVA 3GTGH 3BVGA 4JI5Q 1WCMH 1NUCA 1K83H 4IOCA 2Q8TA 1DCZA 3MXPA 2MNAA 3SE0A 1YI2A 2IHFA 4TKOB 3F2CA 2B2UC 1M90C 1B9MA 1PZJD 4L5QA 4OELB 1SYGA 2VQEL 4KTAA 4NXMQ 1L0WA 2L55A 3PCOB 1CKNB 1UE6A 4FP5D 1B44D 2F0OA 5FK9C 4GLXA 1KNAA 1VQ4A 1F2LA 3I4LA 1XWEA 4XQQA 2R7DA 1MD2D 3ND8A 4FF1A 4H02A 4DAYB 1Q12A 1SNPA 2VQEQ 3CCQA 1N33L 1LTSD 1PFSA 3G48A 3TEHB 1SNDA 4DV1Q 4MN3A 3K8AA 2ZTDA 1D1KA 4RCOA 1AFPA 5FO9B 5C4XG 3AQQA 3JC66 1K28A 1GOZA 1E0BA 2KA7A 3KLWA 5C44B 5EJWA 3D31A 1N33Q 5IP7G 3GTQH 4Y52H 2PNRC 1HNZQ 1YZ6A 1FR3A 1JWUD 4IFDH 1YBYA 4A3KB 3PO2H 1XX8A 4C3IB 1ENAA 4C56C 4QF4A 2LXJA 3HG9A 2IX3A 1JOOA 2IL8A 1U9RA 1CHQD 2RCFA 4PQXA 5IT9E 2CWAA 1PXUA 1SNCA 5J3BA 3GTKH 3G71A 1RCVD 2OTJA 3U4ZA 4F88A 2K5HA 5GADC 1B2TA 2WB1B 1PH3A 1VQ7A 2E2JB 2HDLA 5GAGC 4BBRG 1IYVA 1PFNA 3FKIH 3L7ZC 4R8NA 4GNXB 3TP8A 1U4MA 2R7ZG 4A3JG 4DR6L 4IUVA 1SFOH 1YNNC 5BN4A 1LTGD 5D14A 4BY7B 4KLKA 3D4WA 3W3AA 1XMQL 4DV0L 1KTKA 4PV1C 5C4ZA 3J80c 4R1JA 4L8JA 3OWEB 5CBEE 4R4OA 1M4VA 4IURA 1XMOL 2GN5A 3MEHA 5JJZA 4DR6Q 2I0QA 1IXRA 2OT2A 1PHJA 3VA5A 5DEHA 4KHZA 1MI2A 1XMQQ 1IKLA 3S14H 1E7ZA 1I6HH 1D5MC 4DV0Q 1CT1D 1Y1VG 3K59A 1YVCA 2WAQB 4OXPA 3W1GA 3PMFA 5E4XA 4A3EB 3PO3H 1XMOQ 1ZYRC 2PPBC 4U673 5EQ0A 3CCMA 2F0QA 1B9NA 1E2VA 1G51A 1JOQA 4OIKA 3A55A 1BCPB 2EJFC 2VXWA 2PO4A 1N8RC 1TIID 2NVXH 2H5XA 2QKIC 4CKBA 1CSPA 1BVSA 3I4MH 4HJ7A 2WKCA 4PMWA 3JAMi 4LF6L 4FYDA 4TQUS 3RUZA 2RHQB 5IYDG 1J8IA 1KC8C 3URYA 1NMFA 1E1OA 3FDTA 5ELNA 2I5HA 4KY5A 3NBHA 4ZUIA 1X3FA 3S1NB 3M9BA 1K0RA 3T51B 4B3TL 2JA8G 4A3DH 1NY4A 2ZTEA 4KJOA 3J80i 4DV2L 4Y7NH 4LF6Q 1BKBA 1HJPA 3I56A 3A8KE 1SYFA 3NP8A 3BZCA 3BYYB 1Y1WG 4MHEA 2B63G 2F0KA 1H95A 2L11A 4B3TQ 3GV3A 1D2BA 2H4OA 1YIJA 4DR4L 3SK8A 4DV2Q 5IP9H 2PZTA 3CQZH 2JEBI 1C4QA 2F0DA 1GHKA 1DOMA 1E2ZA 3PUWA 4OO1I 3NE5B 1FNWA 4TVAB 4C3JB 1UEBA 1PZID 2F0VA 3AB9A 2KCNA 2K33A 2NBFA 4HAEA 1E1TA 1GM5A 2XRQD 4DR4Q 3PGZA 4DXGA 3H3VI 5JJKA 4PNYA 2ZXPA 1HH2P 5I9OA 1EYDA 5FJ8H 3HOVH 1JWSD 4K14A 1YJNA 3DEPA 4OWTB 1TS5A 3C2PA 2XN9C 5F2DA 2M9VA 2KQ3A 3HEJA 1PFMA 1LTAD 1KDBA 4LF9L 4DUYL 4JPBW 3UE0A 2H1EA 4HIKA 3M7NA 1QCBD 1I4QA 3H15A 1FGBD 5EGTA 1EU3A 1S3OA 1SXTA 4ZLTF 1DONA 4ABNA 3D8GA 2PQAB 4N9PA 3MXNB 3WOEA 4ZKCB 4ULLA 4LF9Q 1XPUA 2EYLA 2N78A 3JAME 3FEWX 3M85A 3K7AH 2AUJD 4DUYQ 2DNEA 3H09A 4OL7A 2NZHA 2D0OA 4L5RC 4JBJA 5HGTA 1HZCA 4EX5A 1N36L 1RJTA 3NHHA 2HIVA 1WCMG 3KK7A 5C0XH 4KKSA 2VQFL 1TVXA 3E3XA 1FVIA 3J80E 4EVOA 3PSIA 3K5MA 4ALPA 3MFGA 3HKZG 2HDMA 4DPGA 1EU4A 1E2WA 2ZXOA 3CXCA 4HIOA 1N36Q 3CAMA 2UUCL 4BBSB 4S3SA 1NCVA 2JA5B 4NPSA 2VQFQ 3AMUA 5EBDA 1EY4A 3QJYA 3CC7A 2Q8IB 1DZ1A 2SNMA 5CORA 1V8QA 1EFWA 1D6EC 2KCTA 1W6JA 1U4LA 2VUMH 4A3FB 2NVTB 3HOUB 2UUCQ 4GKJL 2J0TD 3TP5A 2HQLA 3NXWA 3TMEA 1RIPA 3OPOA 2PI2E 1T5EA 2CWPA 2BE5D 4OIJA 3UDGA 4KD4A 4OX9Q 3GV6A 2J7ZA 3KF8B 1LABA 4K6LA 2F0PA 1XXGA 4IFDG 4DR2L 3CCRA 4K5WA 1I4PA 4GKJQ 4OGQC 3PO2G 2B2TC 4DUZL 1IHZA 3HOXB 1PH2A 3K7UC 4FDBA 4BA2I 3VYSA 4A3IB 3M4OB 2HD3A 1DYQA 1KAWA 1QZHA 1AEXA 1HZAA 2NN6G 4FXGC 2O5IC 3S1QH 2EY6A 1EOTA 4UHVA 2YTYA 3D6WA 4JI2L 1VQLA 4DR2Q 4G4KA 4KHPL 4LUVA 4IPCA 3CU7A 4DUZQ 2J4XA 4HCSA 2IX1A 5A2QE 1WVLA 1C8CA 3FKIG 1H9JA 3KBGA 1L0YB 3EVQA 4YCVA 3S9WA 2R92B 3L3OC 2KUMA 5LHY1 3MA2B 3ZYYX 1XNRQ 4JI2Q 1EEID 5I9PA 2C9OA 4KHPQ 3UDXA 1VQ8A 1VQFA 1X6OA 2F0GA 1F2YA 2NTSA 5C3WA 2RDFA 2MGSA 2N49A 1TS3A 3RZOB 2F4IA 3NTHA 5M3FH 4J8QA 3S2HB 3GQBA 4DK0A 4KKTA 2UU9Q 4V0BA 1HZ9A 1TWCH 3PO3G 3ERQA 3MWYW 5C4JH 3ULJA 4MTKA 4TRDA 1TWFH 3F2UA 3IL8A 1L1OB 3A0JA 4EQ5A 5FLXc 3UDFA 4H0LC 5KNBA 3OWFA 1GVPA 2B8FA 3NENA 3OTOL 4EQPA 1A2UA 3A54A 3ZJYC 3EFXD 1WTRA 4JW0A 3PUVA 4CGYB 2OTLA 1VQNA 1STHA 3N6RA 2K75A 1K3BC 3HOYH 3I4NG 4KMUC 1BBUA 2ASBA 2IW3A 2OEOA 3X3NA 3J81i 4A3DG 2F3WA 2EXZA 3OTOQ 3AYHB 2ATWA 4B08A 5IGCA 2EYFA 3ER0A 2XNAC 2SEBD 2F0JA 3KBXA 1X55A 2L12A 3UI2A 3J7AV 1VQHA 4RKLA 3NQTA 1M1KC 4GLAC 4A3GH 1R4PB 2K28A 1JC7A 1N9WA 1KABA 3NEMA 4BXXH 1WTWA 1YJ9A 1CK1A 1SYDA 4FO2A 5KEEA 1KNEA 3M4YA 2YU9B 1YJWA 4JOIA 2IPKD 4ZCKA 5KNDA 1EIYB 2PMZB 4QUCA 1ASZA 5CGKA 4IN3A 3TS0A 1O80A 5C44H 3OIQA 3HZXA 2YTVA 1X54A 2AHOB 4IFDI 1ICWA 2F1MA 3Q6SA 4A3KH 4JV5L 4X64L 1I6VC 2NZOA 4C3IH 3T56B 2RBMA 2AQ3B 5FLXL 1NSNS 2B29A 1CQVA 4ZAIA 3E9IA 3M7GA 1HZBA 3PV0A 4X62L 2ZJRA 3C3LA 1JB3A 4A93H 2E2JH 5M5XB 4JV5Q 3DWPA 1QVGA 3LGJA 5IT9c 1HQMC 2TSSA 3CCSA 4A3MB 1EZ6A 1DGSA 4O0AA 1UE7A 1GKHA 2A6HD 4KN4C 3MFYA 2Z8LA 2AWOA 2BE5C 2Y0SG 1Y14B 3PUYA 3QWNA 3TSSA 3Q22A 4R8IA 3KDFB 2WP8J 3KJOA 3G6JB 2CHBD 1MSHA 2VY3A 1Y69U 5EKIA 2RHSB 5J39A 3J81E 4A3BB 2NTTA 5IGGA 2F0LA 1SDFA 5M5YB 1C48A 2CW0D 4K8IA 4GNXC 2YTXA 4A3EH 2CVRA 4A4IA 3BG3A 5COYA 1G91A 2HUGA 1H9MA 1JE5A 4N9TA 3HKSA 5KYLA 2DN8A 1PH9A 5JVG3 4CJ2C 3ULPA 5ELBA 1LTID 1VMPA 1STEA 3PIP3 2MFIA 4RWSC 2CCZA 1X9NA 1JOKA 1SYBA 2XIWA 2EDGA 5T1GA 3ERSX 3S1NH 2EYPA 2R93G 4DKAC 1Q90A 1Q8IA 1TU2B 2RKSA 3CPWA 5IT9L 1LT4D 2K01A 5EPLA 4KY7A 1JWMD 1QUQA 4FXDA 1HRJA 3GO5A 1MIUA 5C4XB 3K57A 4XQJA 1CQFA 4N8X1 3SDZA 3S15H 2RSOA 4BY1B 3R93A 1BCPF 5KRUA 3P1HA 2KEEA 1B1ZA 4HTHA 2MUYA 3P75A 1IW7D 1TWGB 1TY2A 3PQIA 2DJGC 2K4KA 3S16B 1WTOA 2OXPA 1OO9B 2NVYH 4C3JH 2F0EA 1IBKQ 1EQRA 1GXDC 4DV1L 2LXKA 1ILPA 5HURA 3F1ZA 3T4AC 5ISRA 3W2DA 4BBRB 4LUZA 2L15A 2NVQB 3IAYA 4RCNA 1YNXA 3M3YH 4A3JB 3PIPA 1V1PA 1HNZL 1IKMA 3D6CA 3SR1A 2IHEA 1Q82C 2R61A 2GVBA 1ILQA 2EJGC 1HNWQ 2NZ1D 1P16A 1Z47A 1PVOA 4A3CH 2D0PA 2Z6BA 4DAPA 1KAAA 3CRKC 2ZTCA 4X3SA 2UXDQ 1I3QB 4DAVA 5GQOA 4OO1G 2VW9A 2SDFA 3MVVA 4APVA 2AKWB 5AJ3L 3E5SA 2B2WA 3VYTA 1Y1VB 2EYOA 2DY7A 2AQ2B 2EVBA 2R3ZA 1MSGA 1A6XA 4JG2A 1U0LA 4HSPA 4JBWA 1BNZA 4JCVE 4X3TA 5AJ3Q 5C0XI 2WFWA 3E9HA 3KF6B 3JAMc 3G4SA 3S1RB 1X3EA 2NUCA 3RD4A 3G7LA 2UUAL 2WKDA 3GDEA 3Q8DA 4MIUA 1UNSA 3E0JA 3HOYG 1JICA 2E74C 5E1FA 5IIFA 3QB3A 4DAMA 2ES2A 3B6YA 3MEFA 4NKLA 1A3UA 2JA6G 1LUZA 5ELFA 1WTHA 1BBWA 2TMPA 4BBSH 1FNVA 1BR9A 2UUAQ 2A6HC 4XTCS 4P73A 1QZGA 5IGBA 4JI6Q 3K5NA 1VCIA 3L2PA 2MP1A 4A3GG 1IL8A 1ET6A 3J7AF 2X6GA 4NDXA 4IFDJ 4B9XA 5IGFA 3K5LA 5DLQE 1Y1WB 3KJPA 4A3FH 2B63B 3HOUH 2XWJB 3S17B 1PH7A 4RGMA 2JQOA 2L9HA 1WD1A 4O2DA 3CC4A 1GUWA 1K8OA 4FNFA 4P72A 1BBXC 3SXHA 5M5WH 5JPNC 1CA5A 5C44G 4RG1A 2CW0C 3GTOH 3VR2A 2KJXA 2KCMA 4UY8C 3VDYA 4C3IG 2K5WA 1YHAA 1A3VA 2HQEA 3D3RA 1Y8PB 5DNFA 1WTXA 3A8IE 2E76C 2G5DA 5FLMH 2FINB 2ZM6Q 1H9KA 1VQJA 4A3IH 3M4OH 2IJ0A 2PCFB 4IUPA 5J22A 3JAML 3ND9A 4I7ZC 3GTMB 5LMNW 4A93G 1AP0A 2FJ2A 1PTOD 2QILA 3Q0AA 4K2LA 4IPHA 5KNCA 1VQ9A 5JOBA 2B8GA 2BDNA 1JB7A 3D4RA 4LF8L 4ILWA 1HPCA 4R4IA 2OF1A 2R92H 1WJJA 5E7NA 3J80L 2K50A 2EZVA 3NBIA 1I4XA 2E2IB 1A0IA 4Q5VA 3TZUA 2ZJPA 2XVSA 1EL0A 1D5ZC 2DJFC 1I4GA 1EIHA 3IFDA 4RA8A 1AZPA 1R9TB 1VF7A 3R2IA 4LF8Q 2JJQA 5M3MH 2JK8A 1K0SA 1BUVT 1IW7C 1L2FA 3U9SA 1AH9A 1B53A 4HMIA 2WB1E 4KY6A 3PIO3 4KK7A 1WCMB 1K83B 3FRPB 5LMUL 1EZ8A 3PUZA 5D3IB 5IYBG 4DV5L 1VQGA 3NTKA 2NYZD 1SN8A 2VL6A 3HKZB 2RF4A 4GOPA 4DF7A 2LS01 5IOCA 3S1MH 2C5CA 2F52A 1BO0A 3KYHC 1QB5D 4R9WA 4LFBL 1RL2A 2KHSA 5LMUQ 3V2TA 4C1NK 4DV5Q 4LUOA 2DNCA 1PYBA 2BOSA 3V05A 2KHIA 1BQQT 1YNJD 1LT6D 1TS4A 4ZK9B 1Q3LA 5IY0A 1PRTD 2G9HD 4AQYL 2WAQE 1CI3M 3C1FA 4RGNA 1BXTA 1PH8A 3DM1A 1IBML 3D0FA 4A3LH 4LFBQ 1O7LA 4P2CB 3HOZG 4JVZA 1K8GA 1KL9A 3HOWG 1L1OC 3RLOA 2UXBL 2A69D 3F8TA 1L0XB 3OMCA 1H9SA 5A2QL 1VQPA 5I6WA 3GTQB 4HJ5A 4X6AH 2ZXRA 4R4QA 1I50B 4H13C 4AQYQ 4JBMA 4X65L 3PO2B 5IODA 2YU9H 4YY3L 1IBMQ 4I7AA 1UE5A 1B3QA 3PIOA 1YITA 3TQYA 2UXBQ 3A5UA 4C3JG 5J1ZA 1V43A 1Y8NB 2AWNA 1CTMA 2K1BA 1EWCA 1SEBD 2R7FA 4MNOA 1CKNA 3MC0B 4WORA 3S2DB 4X65Q 2OCEA 4YY3Q 2K5NA 1AZQA 4OX9L 3BU2A 3RZDH 2JYOA 3MXUA 1MHWC 3GTJB 1QWYA 4WJ4A 4DK6C 4L5SA 2R6GA 2LMCB 4GKKL 1A63A 3W5OA 3TP6A 1H9RA 3J81j 4UDUC 5CV5A 2L4NA 4A3CG 2VB2X 4CKCA 1LTBD 5M5XH 4EQNA 2D5DA 3U50C 3TS2A 4QCLA 1VF5C 5FOBB 5LMNL 3J7A5 1E22A 1STGA 5C0XJ 4GKKQ 3BVZA 3WWVA 4IQZA 3EIVA 1KRTA 3FPPA 1BOSA 3CPFA 1HFNA 4DR1L 1EFID 4AIMA 3HGBA 2L0CA 4PMBA 5LMNQ 4YWMA 3KLSA 2JA7H 1LACA 4A3BH 4K5VA 1XNRL 1JCKB 3A8JE 4C3HH 3CF5A 1LYLA 4DU9A 2QCPX 4DA2A 1SYEA 2EYHA 1EYGA 2F0MA 5I6YA 4X66L 2QA4A 5M5YH 1SE3A 4DR1Q 1G6PA 5NUCA 3LX0A 1LTRD 3BS1A 3I7FA 3MXGA 4KD3A 4OWXB 2Z9HA 3J81c 1PTOC 2PNHA 4KI0A 3I4NB 2YYZA 1PH4A 2ZT9C 4P71A 4K0KL 2B2VC 4NB3A 4WRDA 5BN3A 3Q23A 2EPBA 4NP5A 4DGZA 2ICIA 2UU9L 4JI7L 3SVMA 1QNUA 5E4WC 1OXSC 1STBA 4HMJA 1V9PA 4X66Q 4GS3A 1HTLD 2BH2A 3BZDB 2BA0A 3E0EA 3AFPA 1ENCA 3TZDA 2KEDA 3AFQA 1KLUD 4UPAA 4KV6A 1S5FD 3H91A 2B39A 2Q2HA 3C1EA 4A3FG 1FL0A 4K0KQ 1WOCA 4DNIA 4GN4B 1LO5D 3H94A 4JI7Q 4YWKA 5E3FA 1VQ6A 4XIGS 1E24A 1RTNA 4L5TA 1S4ZA 2AUKA 2EXDA 2KVMA 4IPGA 4UP9A 3VR3A 4XYOA 1CKMA 3H0GB 3CCUA 4O1NA 1RTOA 4CBVA 3SEBA 3OSOA 4QIWB 4PZ6A 2RDGA 3VR6A 3I4MG 4BY1H 4U68A 3RR5A 5FLMG 5IGDA 1VMCA 1JORA 1GUTA 4RKBA 3EROA 4C1NI 3GTLB 1K8AC 4M8AA 2MQHA 2VS1A 4PG3A 3S16H 2RQXA 1RODA 3CC2A 3BDOA 2B2UA 1QJOA 4P75A 1ZKOA 4QUFA 4HJ8A 2KHJA 4HIDA 3CCJA 3F2BA 1CZGA 4E6IA 5AFWA 1YNJC 4M1UB 1K73C 3J81L 5JEAH 1PRTC 4BBRH 3M4QA 2M00A 3TRZA 4ME5A 3L0OA 2BCOA 5M9OA 3DXJC 2NVQH 1O78A 2MO1A 3J7ZC 4QB4A 4A3JH 1B50A 2EY1A 3TP7A 3U9OA 1IYJB 1JT8A 5IWAL 4JI0Q 4LNQA 2Y0SB 2A69C 1B8AA 5IP9G 1QG7A 4EGVA 1II3A 1K8MA 3H3VC 2PI2A 3QR8A 3NWTA 4RGOS 3K80C 3RMHA 1I3QH 5M3MG 3DM3A 4LJZC 1S72A 2Z6KC 2F3IA 1J9OA 5IWAQ 4O42A 1WTQA 1VQBA 1G6ZA 4IUQA 1W3SA 3PUXA 3SHLA 5FO8B 1NE3A 1UEAB 5FJ8G 4K8JA 2I5MX 5BR8Q 3HOVG 4L63B 2O5JC 3I91A 1SNQA 1ICFB 1Y8OB 3RN2A 4QL5A 1DOLA 1SE8A 1V1OA 3R3OA 3S1RH 2RSNA 4JC0A 5JEAJ 4DK1A 2HT1A 2X6LA 2A73B 5C3EB 2EYJA 1VQMA 3QG1A 1NJIC 4UP7A 3NBHB 2ZJQA 2LKVA 4LK1C 1NAPA 1PTOB 5I4DA 4BY7H 1GUOA 1EWHA 2VNUD 3I90A 2RA4A 4QY7A 1CA6A 1TWAB 5IGEA 2R93B 2FFKB 4DR7L 3FP9A 1Q1EA 1F9QA 4A3LG 2PQAA 3MXNA 1M8AA 1VQAA 2CKZB 2QDLA 3LNNA 2K52A 2WACA 2F0WA 3CCVA 4BWGB 2L1BA 3NELA 4BA1I 4AYBG 3VA7A 2B2YC 2A6ED 5C0XG 1Y1WH 3NUCA 2B63H 2F0SA 2MPMA 3IRBA 5EAYA 4DR7Q 4ZUJA 3S17H 2N55A 1HA6A 4UP8A 2PZUA 3RNUA 1I94L 4YIJA 1HHVA 2UXCL 3CCLA 2Q8RE 2K5DA 1YEZA 1I5FA 1LLRD 2WV6D 5DM73 1HFGA 3CHBD 2PYKA 1EUJA 1E3PA 4R4TA 1AE2A 1A2TA 1I94Q 4AH6A 1A62A 2XRSD 4N8FA 1F77A 2VUMG 4FXKC 4J15A 2UXCQ 4G7ZC 3CRLC 5G3LD 4LFAQ 3CCEA 3GTMH 1JJGA 1SROA 2Y0SE 5IYCH 3DLLA 2A5HA 2SNSA 3DEOA 1PRTB 1XPOA 3ICEA 2PMZE 1CZWA 5H1SE 5HGQA 5CR3A 1HUMA 1JJ2A 1SRUA 1KIXA 1IBKL 1U5KA 3KF8A 2E2IH 3SK6A 1DJRD 2CH4W 1B4OA 5BN5A 1VQCA 1JE4A 5CV8A 3V96A 4YHHL 2RVLA 3OYYA 1NTGA 4CJ1B 1PH5A 2PW5A 3T13A 4JI8L 1R9TH 1H9SB 1T9HA 2XTIA 2JA7G 3K5OA 1GUGA 5FO7B 4OWWB 4A3BG 4OHJA 3W1BA 4IOAA 4RHRA 1OXTA 4JBKA 4C3HG 5GROA 1HNWL 1SR3A 1KLGD 1VQKA 5KYIA 4V190 3VR4A 4YHHQ 1EOVA 3MTSA 4GN3B 4DV7L 1JR0D 2UXDL 3HOYB 3T16A 4JI8Q 4XYQA 2R7ZB 3BDLA
chains in the Genus database with same CATH topology
1PH1A 2RCNA 3KF8B 4R4IA 4GLVB 2R92H 1N34Q 1WJJA 5E7NA 2K50A 4PZ7A 1HR0W 2Q2UA 3A5ZB 4IFDG 4DR2L 3CCRA 2OQKA 4LF7L 4DV6Q 1A0IA 4GKJQ 4IPDA 3PO2G 4DUZL 4DV3L 1PH2A 2V1CC 1PYSB 1PA6A 3K7UC 4FDBA 2ZJPA 1S40A 4BA2I 2IY5B 2A19A 2BH8A 3U4VA 5IYDH 2K5VA 4DV7Q 1KAWA 1QZHA 1HZAA 2NN6G 2NN6I 4LF8Q 5M3FG 2JJQA 5M3MH 3S1QH 1CKOA 3CMAA 2JK8A 2YTYA 2JE6I 1L2FA 1AH9A 4IO9A 2N8NA 2WB1E 4JI2L 1VQLA 4DR2Q 5JJIA 4LF7Q 2JA8H 4KHPL 4LUVA 4HJ9A 1NMGA 4IPCA 4JOIC 4HJAA 4DUZQ 2Z0SA 4DV3Q 3SGIA 2IX1A 1K3RA 2ID0A 5LMUL 1VQ5A 3FKIG 4WJ3M 1CUKA 3PUZA 2ALYB 4X64Q 4HIMA 1SLJA 1TWHH 5IYBG 4DV5L 1VQGA 4YCVA 1SN8A 2QEXA 1LM0A 2VL6A 4C2MH 4B3RL 2RF4A 3K0XA 4GOPA 1X3GA 4QIWE 1L1OA 2YV5A 2XGTA 3S1MH 4BY1G 3S24A 4JI2Q 1XNRQ 3OW2A 4X62Q 4KHPQ 2F52A 3UDXA 1I50H 1VQ8A 1YHBA 1VQFA 3KYHC 1MKHA 4YCWA 1KQSA 1X6OA 4DV4L 1OXXK 2UUBL 1EIFA 1RL2A 5LMUQ 4JI6L 2JEAI 4LFBL 3CMEA 2EIFA 2KBNA 1Q8KA 4DV5Q 4LUOA 1PYBA 1C7YA 1X56A 2DGYA 2KHIA 2N49A 5K36G 4B3RQ 5M3FH 2E2HH 5IY0A 3F2DA 4LFAL 2Q2IA 2JA5H 2Q2TA 2UU9Q 4B3SL 4AQYL 1EQQA 1VQOA 2WAQE 1HZ9A 3BJUA 3S2DH 5JEAG 1PH8A 1IBML 2UUBQ 4DV4Q 3D0FA 4A3LH 1TWCH 3RLNA 3CP0A 4ME3A 4R4CA 4IJHA 2A8VA 3HOZG 4DK3C 3PO3G 1Q86C 1C0AA 1D8LA 3I55A 5C4JH 3RN5A 3ULJA 1KL9A 4GOPB 1K8GA 1L1OC 5IYBH 3HOWG 1TWFH 3RLOA 2UXBL 3F8TA 1L1OB 3A0JA 1B70B 4EQ5A 5FLXc 3UDFA 3GTJH 1D7QA 4IJLA 3EBEA 4BXXG 1VQPA 4JI4L 4HJ5A 2NVTH 4X6AH 1GVPA 1N32L 3NENA 1OXUA 3OTOL 1XJVA 4R4QA 4B3SQ 4JBMA 4POFA 4AQYQ 1Q7YC 4X65L 5C3EG 3ZJYC 2YU9H 4YY3L 4PZ8A 1IBMQ 4JI3L 1UE5A 2OTLA 3PUVA 2ZM6L 4A3MG 1VQNA 1UWVA 2K75A 2MO0A 1K9MC 3PIOA 1YITA 3TQYA 3HOYH 3I4NG 1BBUA 2ASBA 2UXBQ 3A5UA 4OONA 3J81i 3STBD 3KFUA 1V43A 2AWNA 4JI4Q 1KD1C 4A3DG 4AYBE 4JI5L 2K14A 2R7FA 4A3KG 1N32Q 4MNOA 4LF4L 3OTOQ 1CSQA 3AYHB 1CKNA 3HOXH 2ATWA 1A8VA 3KOJA 2OCEA 3ULLA 4X65Q 3ER0A 2CFMA 4YY3Q 4JI3Q 2K5NA 2AMCB 1X55A 4OX9L 3BU2A 3HOZH 1VQDA 1VQHA 3RZDH 3CD6A 1M1KC 2CQOA 3HOWH 4GLAC 1N34L 4LF5L 4DK6C 4L5SA 2R6GA 2F4VL 4A3GH 4WJ4A 4NXML 4GKKL 3K81C 4POGA 3AEVA 1A63A 2WB1G 1N9WA 3W5OA 3NEMA 3J81j 4BXXH 3GTGH 1YJ9A 4JI5Q 1WCMH 4LF4Q 1K83H 4A3CG 4IOCA 2MNAA 2FXQA 5M5XH 1YI2A 1YJWA 4JYAL 2IHFA 2BA1A 4JOIA 5IE8A 3U50C 3F2CA 3TS2A 5LMNL 1M90C 1EIYB 3J7A5 1P8LA 4L5QA 1ASZA 4BY7G 1E22A 3I4NH 3TS0A 2VQEL 4LF5Q 2F4VQ 5C44H 5C0XJ 2I5LX 4NXMQ 2YTVA 1L0WA 4GKKQ 1X54A 3PCOB 2AHOB 4IFDI 1CKNB 1UE6A 1GO3E 3WWVA 1KRTA 3EIVA 4A3KH 4JV5L 3CPFA 4X64L 4C3IH 2NZOA 4DR1L 4GLXA 3T1HL 1ASYA 1FJGL 4AIMA 1HR0L 4JYAQ 1VQ4A 3M4PA 2D62A 2B29A 1XPRA 3KDFA 5LMNQ 2R7DA 4YWMA 3RZOH 1XTDA 4H02A 4DAYB 3E9IA 1Q12A 2VQEQ 3CCQA 2JA7H 1HZBA 1N33L 4A3BH 1PFSA 3PV0A 1XNRL 3S2HH 3G48A 4X62L 1Q46A 2ZJRA 2A1AA 3TEHB 4C3HH 3CF5A 1LYLA 1WYDA 4DV1Q 2WAQG 3K8AA 1EYGA 4A93H 2ZTDA 4X66L 3G6EA 5M5YH 2QA4A 2E2JH 4JV5Q 4A3EG 3T1HQ 4DR1Q 1QVGA 3RLFA 1G6PA 1OXVA 1WFQA 1Z9FA 3LGJA 5IT9c 1HR0Q 3I7FA 1FJGQ 5C4XG 1VQIA 4OWXB 3CCSA 3J81c 3H0GH 3AQQA 1DGSA 4O0AA 1UE7A 2PNHA 3JC66 4KI0A 4QQBX 2YYZA 1PH4A 3KLWA 1GKHA 1KRSA 4K0KL 4P71A 1SMXA 1IBLL 3D31A 4NB3A 1N33Q 5IP7G 2AWOA 3GTQH 4Y52H 1HNZQ 2Y0SG 1Q1BA 1YZ6A 3FHWA 2UU9L 4JI7L 1YBYA 1OXSC 1Y14B 3PUYA 3PO2H 4GN5A 1V9PA 5HY6A 4GS3A 1MJCA 4X66Q 2BH2A 2BA0A 3E0EA 1G291 1GD7A 2LXJA 2WP8J 3AFPA 3KDFB 3KJOA 3AFQA 4UPAA 3GTLH 2CWAA 2VY3A 1UE1A 5J3BA 3GTKH 2RHSB 3A74A 2C35B 2Q2HA 3G71A 1FL0A 4A3FG 1WOCA 1IBLQ 4DNIA 4K0KQ 4GN4B 2OTJA 3U4ZA 2K5HA 5GADC 5IYCG 4JI7Q 4YWKA 1PH3A 1VQ7A 1VQ6A 2HHHL 4XIGS 1WI5A 1E24A 5GAGC 4BBRG 1NBWA 4L5TA 4GNXC 2YTXA 3FKIH 2EXDA 3L7ZC 4GNXB 4A4IA 4UP9A 4IPGA 4A3EH 2R7ZG 1CKMA 4A3JG 4DR6L 3CCUA 1JE5A 1SFOH 2DUDA 3HKSA 4KLKA 1XMQL 4PZ6A 1PH9A 4DV0L 3ULPA 3I4MG 4NXNL 1XNQL 4BY1H 3J80c 4R1JA 2IT1A 2HHHQ 3I2ZA 2MFIA 3RR5A 5FLMG 2CCZA 4B3ML 4R4OA 1X9NA 1XMOL 2GN5A 3CW2C 1O7IA 1K8AC 4DR6Q 2I0QA 2MQHA 2VS1A 4LWCA 1IXRA 3BZKA 4PG3A 2OWOA 3CC2A 1OTCA 3S16H 4P75A 3ERSX 1PHJA 3S1NH 2N3SA 4KHZA 2LSSA 4HJ8A 4DKAC 1XMQQ 1E7ZA 3S14H 2KHJA 1I6HH 3UE1A 1Y1VG 2Z6KA 4DV0Q 4HIDA 4NXNQ 1KXLA 3CCJA 1XNQQ 3F2BA 3CPWA 3T1YL 5GAEC 1YVCA 4OXPA 1K73C 3W1GA 4B3MQ 1VQEA 1QUQA 3M4QA 4BBRH 3TRZA 3PO3H 1XMOQ 3GO5A 1MIUA 3L0OA 3CCMA 2NVQH 2MO1A 3J7ZC 5GAHC 4A3JH 1G51A 3PF5A 1IYJB 1JT8A 5IWAL 1N8RC 1KHIA 3S15H 2NVXH 2H5XA 4JI0Q 4LNQA 1CSPA 4A75A 1BVSA 1J6QA 3I4MH 1B8AA 4HJ7A 3T1YQ 4PMWA 5IP9G 3JAMi 4LF6L 4TQUS 2RHQB 1X65A 5IYDG 5C3EH 4DR3L 1KC8C 2PI2A 1NMFA 4A3MH 2B3GA 1E1OA 3K80C 5ELNA 2K4KA 2I5HA 1I3QH 5M3MG 3DM3A 4MTNA 1S72A 2Z6KC 1JJCB 2NVYH 1X3FA 2F3IA 1K0RA 3M9BA 4C3JH 5IWAQ 1IBKQ 1EQRA 4B3TL 2JA8G 1VQBA 4A3DH 1TWAH 4DV1L 2LXKA 1NY4A 2R93H 3UDIA 2OQ0A 2ZTEA 1W3SA 3F1ZA 3PUXA 5JJLA 1QUQB 1VS0A 1NE3A 2GVAA 3J80i 3STBC 4LFCL 4Y7NH 4DV2L 4LF6Q 1BKBA 3I4OA 5FJ8G 2I5MX 4LUZA 5BR8Q 4DR5L 1HJPA 4DR3Q 2L15A 3HOVG 3I56A 1YNXA 3M3YH 3HKZE 3BZCA 4LW1A 3RN2A 3PIPA 1Y1WG 2B63G 4QL5A 1HNZL 1AE3A 4QJFA 1H95A 1SE8A 4B3TQ 2IHEA 2IX0A 1Q82C 3S1RH 2GVBA 1HNWQ 4JC0A 3KF6A 5JEAJ 1P16A 1Z47A 1YIJA 4DR4L 4A3CH 2HT1A 1PVOA 4DV2Q 2D0PA 1VQMA 3PF4A 5IP9H 4LFCQ 1NJIC 3CQZH 2JEBI 3GD7A 2ZTCA 4UP7A 4DR5Q 3NBHB 3EN2A 2ZJQA 4GNXA 1TXYA 2UXDQ 5GQOA 3PUWA 4OO1G 2VW9A 4OO1I 1HNXL 4BY7H 4APVA 4TVAB 2AKWB 5AJ3L 1UEBA 2VNUD 4BBSG 4QY7A 2JA5G 4DR7L 1IZ6A 1QVCA 3FP9A 1E1TA 1GM5A 3HFZB 1Q1EA 4A3LG 2PQAA 4DR4Q 3PGZA 1LTLA 1VQAA 2CKZB 3H3VI 4JG2A 5JJKA 2K52A 1U0LA 1HH2P 1IL2A 1V1QA 5FJ8H 3CCVA 3HOVH 1YJNA 2EQSA 4OWTB 3NELA 4BA1I 1HNXQ 4JBWA 4AYBG 4JCVE 5AJ3Q 3HOUG 5C0XG 5C0XI 2WFWA 3E9HA 3KF6B 3IRBA 1Y1WH 2B63H 3JAMc 3G4SA 1Q81C 1X3EA 5EAYA 2UUAL 4LF9L 4DR7Q 3GDEA 3S17H 2JA9A 3Q8DA 4DUYL 4UP8A 3UE0A 4HIKA 3RNUA 3M7NA 1I94L 4LFBQ 3HOYG 5C4XH 3H15A 4A76A 4DAMA 3U58A 2ES2A 1YHQA 3B6YA 1FGUA 3MEFA 1S3OA 2JA6G 1LUZA 2UXCL 3CCLA 1BBWA 5IP7H 4BBSH 3HOXG 3TREA 1C9OA 1I5FA 1YEZA 2PQAB 3MXNB 1W2BA 2UUAQ 4LF9Q 1XPUA 2N78A 1EUJA 1B7YB 4XTCS 1E3PA 4P73A 3K7AH 3M85A 4DUYQ 1QZGA 4R4TA 1TWGH 1AE2A 2NZHA 4A3IG 2D0OA 1I94Q 4AH6A 1A62A 4JI6Q 2HIXA 4YWLA 1VCIA 3L2PA 4GOPC 3H3VH 2R93G 4A3GG 4YCUA 4JBJA 4L5RC 1HZCA 4EX5A 2VUMG 4J15A 4IFDJ 1N36L 2UXCQ 4MZ9A 2HIVA 5DLQE 4JI0L 3KJPA 4A3FH 4LFAQ 1WCMG 3HOUH 3CCEA 3GTMH 1JJGA 1SROA 2Y0SE 5IYCH 3DLLA 2VQFL 1QVFA 1PH7A 1FVIA 3PSIA 2JQOA 4ALPA 4O2DA 4QGUA 3CC4A 1XPOA 3ICEA 4P72A 2PMZE 3HKZG 5H1SE 5M5WH 2R92G 2R7ZH 5HGQA 4DPGA 5C44G 1SRUA 1PV4A 1JJ2A 3CXCA 4RG1A 1KIXA 2E5LL 3GTOH 1IBKL 4HIOA 2QGQA 1U5KA 1N36Q 3CAMA 4UY8C 2E8GA 2KCMA 4JI1L 1MJEA 2E2IH 2UUCL 2JA6H 3VDYA 3GTPH 1J5EL 4NPSA 1VQCA 2VQFQ 1YHAA 4YHHL 3CC7A 3OYYA 5BR8L 1NTGA 5FLMH 4RMFA 1PH5A 2ZM6Q 1PH6A 1EWIA 4JI8L 1VQJA 4A3IH 1R9TH 3M4OH 1T9HA 2XTIA 2JA7G 1EFWA 4OWWB 2KCTA 4A3BG 4IOAA 3W1BA 2E5LQ 1OXTA 2VUMH 2KENA 2VZAA 4JBKA 4JI1Q 2UUCQ 4DV6L 5GROA 4GKJL 1HNWL 1SR3A 5ELOA 5LMNW 4A93G 1VQKA 1Y1VH 2HQLA 1J5EQ 1JMCA 1RIPA 4IPHA 2PI2E 1VQ9A 4YHHQ 1EOVA 4GN3B 4DV7L 4P74A 2CWPA 3H0GG 2UXDL 4JI8Q 3UDGA 1JB7A 4OX9Q 4LF8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH1 A;  2RCN A;  3KF8 B;  4R4I A;  4GLV B;  2R92 H;  1N34 Q;  1WJJ A;  5E7N A;  2K50 A;  4PZ7 A;  1HR0 W;  2Q2U A;  3A5Z B;  4IFD G;  4DR2 L;  3CCR A;  2OQK A;  4LF7 L;  4DV6 Q;  1A0I A;  4GKJ Q;  4IPD A;  3PO2 G;  4DUZ L;  4DV3 L;  1PH2 A;  2V1C C;  1PYS B;  1PA6 A;  3K7U C;  4FDB A;  2ZJP A;  1S40 A;  4BA2 I;  2IY5 B;  2A19 A;  2BH8 A;  3U4V A;  5IYD H;  2K5V A;  4DV7 Q;  1KAW A;  1QZH A;  1HZA A;  2NN6 G;  2NN6 I;  4LF8 Q;  5M3F G;  2JJQ A;  5M3M H;  3S1Q H;  1CKO A;  3CMA A;  2JK8 A;  2YTY A;  2JE6 I;  1L2F A;  1AH9 A;  4IO9 A;  2N8N A;  2WB1 E;  4JI2 L;  1VQL A;  4DR2 Q;  5JJI A;  4LF7 Q;  2JA8 H;  4KHP L;  4LUV A;  4HJ9 A;  1NMG A;  4IPC A;  4JOI C;  4HJA A;  4DUZ Q;  2Z0S A;  4DV3 Q;  3SGI A;  2IX1 A;  1K3R A;  2ID0 A;  5LMU L;  1VQ5 A;  3FKI G;  4WJ3 M;  1CUK A;  3PUZ A;  2ALY B;  4X64 Q;  4HIM A;  1SLJ A;  1TWH H;  5IYB G;  4DV5 L;  1VQG A;  4YCV A;  1SN8 A;  2QEX A;  1LM0 A;  2VL6 A;  4C2M H;  4B3R L;  2RF4 A;  3K0X A;  4GOP A;  1X3G A;  4QIW E;  1L1O A;  2YV5 A;  2XGT A;  3S1M H;  4BY1 G;  3S24 A;  4JI2 Q;  1XNR Q;  3OW2 A;  4X62 Q;  4KHP Q;  2F52 A;  3UDX A;  1I50 H;  1VQ8 A;  1YHB A;  1VQF A;  3KYH C;  1MKH A;  4YCW A;  1KQS A;  1X6O A;  4DV4 L;  1OXX K;  2UUB L;  1EIF A;  1RL2 A;  5LMU Q;  4JI6 L;  2JEA I;  4LFB L;  3CME A;  2EIF A;  2KBN A;  1Q8K A;  4DV5 Q;  4LUO A;  1PYB A;  1C7Y A;  1X56 A;  2DGY A;  2KHI A;  2N49 A;  5K36 G;  4B3R Q;  5M3F H;  2E2H H;  5IY0 A;  3F2D A;  4LFA L;  2Q2I A;  2JA5 H;  2Q2T A;  2UU9 Q;  4B3S L;  4AQY L;  1EQQ A;  1VQO A;  2WAQ E;  1HZ9 A;  3BJU A;  3S2D H;  5JEA G;  1PH8 A;  1IBM L;  2UUB Q;  4DV4 Q;  3D0F A;  4A3L H;  1TWC H;  3RLN A;  3CP0 A;  4ME3 A;  4R4C A;  4IJH A;  2A8V A;  3HOZ G;  4DK3 C;  3PO3 G;  1Q86 C;  1C0A A;  1D8L A;  3I55 A;  5C4J H;  3RN5 A;  3ULJ A;  1KL9 A;  4GOP B;  1K8G A;  1L1O C;  5IYB H;  3HOW G;  1TWF H;  3RLO A;  2UXB L;  3F8T A;  1L1O B;  3A0J A;  1B70 B;  4EQ5 A;  5FLX c;  3UDF A;  3GTJ H;  1D7Q A;  4IJL A;  3EBE A;  4BXX G;  1VQP A;  4JI4 L;  4HJ5 A;  2NVT H;  4X6A H;  1GVP A;  1N32 L;  3NEN A;  1OXU A;  3OTO L;  1XJV A;  4R4Q A;  4B3S Q;  4JBM A;  4POF A;  4AQY Q;  1Q7Y C;  4X65 L;  5C3E G;  3ZJY C;  2YU9 H;  4YY3 L;  4PZ8 A;  1IBM Q;  4JI3 L;  1UE5 A;  2OTL A;  3PUV A;  2ZM6 L;  4A3M G;  1VQN A;  1UWV A;  2K75 A;  2MO0 A;  1K9M C;  3PIO A;  1YIT A;  3TQY A;  3HOY H;  3I4N G;  1BBU A;  2ASB A;  2UXB Q;  3A5U A;  4OON A;  3J81 i;  3STB D;  3KFU A;  1V43 A;  2AWN A;  4JI4 Q;  1KD1 C;  4A3D G;  4AYB E;  4JI5 L;  2K14 A;  2R7F A;  4A3K G;  1N32 Q;  4MNO A;  4LF4 L;  3OTO Q;  1CSQ A;  3AYH B;  1CKN A;  3HOX H;  2ATW A;  1A8V A;  3KOJ A;  2OCE A;  3ULL A;  4X65 Q;  3ER0 A;  2CFM A;  4YY3 Q;  4JI3 Q;  2K5N A;  2AMC B;  1X55 A;  4OX9 L;  3BU2 A;  3HOZ H;  1VQD A;  1VQH A;  3RZD H;  3CD6 A;  1M1K C;  2CQO A;  3HOW H;  4GLA C;  1N34 L;  4LF5 L;  4DK6 C;  4L5S A;  2R6G A;  2F4V L;  4A3G H;  4WJ4 A;  4NXM L;  4GKK L;  3K81 C;  4POG A;  3AEV A;  1A63 A;  2WB1 G;  1N9W A;  3W5O A;  3NEM A;  3J81 j;  4BXX H;  3GTG H;  1YJ9 A;  4JI5 Q;  1WCM H;  4LF4 Q;  1K83 H;  4A3C G;  4IOC A;  2MNA A;  2FXQ A;  5M5X H;  1YI2 A;  1YJW A;  4JYA L;  2IHF A;  2BA1 A;  4JOI A;  5IE8 A;  3U50 C;  3F2C A;  3TS2 A;  5LMN L;  1M90 C;  1EIY B;  3J7A 5;  1P8L A;  4L5Q A;  1ASZ A;  4BY7 G;  1E22 A;  3I4N H;  3TS0 A;  2VQE L;  4LF5 Q;  2F4V Q;  5C44 H;  5C0X J;  2I5L X;  4NXM Q;  2YTV A;  1L0W A;  4GKK Q;  1X54 A;  3PCO B;  2AHO B;  4IFD I;  1CKN B;  1UE6 A;  1GO3 E;  3WWV A;  1KRT A;  3EIV A;  4A3K H;  4JV5 L;  3CPF A;  4X64 L;  4C3I H;  2NZO A;  4DR1 L;  4GLX A;  3T1H L;  1ASY A;  1FJG L;  4AIM A;  1HR0 L;  4JYA Q;  1VQ4 A;  3M4P A;  2D62 A;  2B29 A;  1XPR A;  3KDF A;  5LMN Q;  2R7D A;  4YWM A;  3RZO H;  1XTD A;  4H02 A;  4DAY B;  3E9I A;  1Q12 A;  2VQE Q;  3CCQ A;  2JA7 H;  1HZB A;  1N33 L;  4A3B H;  1PFS A;  3PV0 A;  1XNR L;  3S2H H;  3G48 A;  4X62 L;  1Q46 A;  2ZJR A;  2A1A A;  3TEH B;  4C3H H;  3CF5 A;  1LYL A;  1WYD A;  4DV1 Q;  2WAQ G;  3K8A A;  1EYG A;  4A93 H;  2ZTD A;  4X66 L;  3G6E A;  5M5Y H;  2QA4 A;  2E2J H;  4JV5 Q;  4A3E G;  3T1H Q;  4DR1 Q;  1QVG A;  3RLF A;  1G6P A;  1OXV A;  1WFQ A;  1Z9F A;  3LGJ A;  5IT9 c;  1HR0 Q;  3I7F A;  1FJG Q;  5C4X G;  1VQI A;  4OWX B;  3CCS A;  3J81 c;  3H0G H;  3AQQ A;  1DGS A;  4O0A A;  1UE7 A;  2PNH A;  3JC6 6;  4KI0 A;  4QQB X;  2YYZ A;  1PH4 A;  3KLW A;  1GKH A;  1KRS A;  4K0K L;  4P71 A;  1SMX A;  1IBL L;  3D31 A;  4NB3 A;  1N33 Q;  5IP7 G;  2AWO A;  3GTQ H;  4Y52 H;  1HNZ Q;  2Y0S G;  1Q1B A;  1YZ6 A;  3FHW A;  2UU9 L;  4JI7 L;  1YBY A;  1OXS C;  1Y14 B;  3PUY A;  3PO2 H;  4GN5 A;  1V9P A;  5HY6 A;  4GS3 A;  1MJC A;  4X66 Q;  2BH2 A;  2BA0 A;  3E0E A;  1G29 1;  1GD7 A;  2LXJ A;  2WP8 J;  3AFP A;  3KDF B;  3KJO A;  3AFQ A;  4UPA A;  3GTL H;  2CWA A;  2VY3 A;  1UE1 A;  5J3B A;  3GTK H;  2RHS B;  3A74 A;  2C35 B;  2Q2H A;  3G71 A;  1FL0 A;  4A3F G;  1WOC A;  1IBL Q;  4DNI A;  4K0K Q;  4GN4 B;  2OTJ A;  3U4Z A;  2K5H A;  5GAD C;  5IYC G;  4JI7 Q;  4YWK A;  1PH3 A;  1VQ7 A;  1VQ6 A;  2HHH L;  4XIG S;  1WI5 A;  1E24 A;  5GAG C;  4BBR G;  1NBW A;  4L5T A;  4GNX C;  2YTX A;  3FKI H;  2EXD A;  3L7Z C;  4GNX B;  4A4I A;  4UP9 A;  4IPG A;  4A3E H;  2R7Z G;  1CKM A;  4A3J G;  4DR6 L;  3CCU A;  1JE5 A;  1SFO H;  2DUD A;  3HKS A;  4KLK A;  1XMQ L;  4PZ6 A;  1PH9 A;  4DV0 L;  3ULP A;  3I4M G;  4NXN L;  1XNQ L;  4BY1 H;  3J80 c;  4R1J A;  2IT1 A;  2HHH Q;  3I2Z A;  2MFI A;  3RR5 A;  5FLM G;  2CCZ A;  4B3M L;  4R4O A;  1X9N A;  1XMO L;  2GN5 A;  3CW2 C;  1O7I A;  1K8A C;  4DR6 Q;  2I0Q A;  2MQH A;  2VS1 A;  4LWC A;  1IXR A;  3BZK A;  4PG3 A;  2OWO A;  3CC2 A;  1OTC A;  3S16 H;  4P75 A;  3ERS X;  1PHJ A;  3S1N H;  2N3S A;  4KHZ A;  2LSS A;  4HJ8 A;  4DKA C;  1XMQ Q;  1E7Z A;  3S14 H;  2KHJ A;  1I6H H;  3UE1 A;  1Y1V G;  2Z6K A;  4DV0 Q;  4HID A;  4NXN Q;  1KXL A;  3CCJ A;  1XNQ Q;  3F2B A;  3CPW A;  3T1Y L;  5GAE C;  1YVC A;  4OXP A;  1K73 C;  3W1G A;  4B3M Q;  1VQE A;  1QUQ A;  3M4Q A;  4BBR H;  3TRZ A;  3PO3 H;  1XMO Q;  3GO5 A;  1MIU A;  3L0O A;  3CCM A;  2NVQ H;  2MO1 A;  3J7Z C;  5GAH C;  4A3J H;  1G51 A;  3PF5 A;  1IYJ B;  1JT8 A;  5IWA L;  1N8R C;  1KHI A;  3S15 H;  2NVX H;  2H5X A;  4JI0 Q;  4LNQ A;  1CSP A;  4A75 A;  1BVS A;  1J6Q A;  3I4M H;  1B8A A;  4HJ7 A;  3T1Y Q;  4PMW A;  5IP9 G;  3JAM i;  4LF6 L;  4TQU S;  2RHQ B;  1X65 A;  5IYD G;  5C3E H;  4DR3 L;  1KC8 C;  2PI2 A;  1NMF A;  4A3M H;  2B3G A;  1E1O A;  3K80 C;  5ELN A;  2K4K A;  2I5H A;  1I3Q H;  5M3M G;  3DM3 A;  4MTN A;  1S72 A;  2Z6K C;  1JJC B;  2NVY H;  1X3F A;  2F3I A;  1K0R A;  3M9B A;  4C3J H;  5IWA Q;  1IBK Q;  1EQR A;  4B3T L;  2JA8 G;  1VQB A;  4A3D H;  1TWA H;  4DV1 L;  2LXK A;  1NY4 A;  2R93 H;  3UDI A;  2OQ0 A;  2ZTE A;  1W3S A;  3F1Z A;  3PUX A;  5JJL A;  1QUQ B;  1VS0 A;  1NE3 A;  2GVA A;  3J80 i;  3STB C;  4LFC L;  4Y7N H;  4DV2 L;  4LF6 Q;  1BKB A;  3I4O A;  5FJ8 G;  2I5M X;  4LUZ A;  5BR8 Q;  4DR5 L;  1HJP A;  4DR3 Q;  2L15 A;  3HOV G;  3I56 A;  1YNX A;  3M3Y H;  3HKZ E;  3BZC A;  4LW1 A;  3RN2 A;  3PIP A;  1Y1W G;  2B63 G;  4QL5 A;  1HNZ L;  1AE3 A;  4QJF A;  1H95 A;  1SE8 A;  4B3T Q;  2IHE A;  2IX0 A;  1Q82 C;  3S1R H;  2GVB A;  1HNW Q;  4JC0 A;  3KF6 A;  5JEA J;  1P16 A;  1Z47 A;  1YIJ A;  4DR4 L;  4A3C H;  2HT1 A;  1PVO A;  4DV2 Q;  2D0P A;  1VQM A;  3PF4 A;  5IP9 H;  4LFC Q;  1NJI C;  3CQZ H;  2JEB I;  3GD7 A;  2ZTC A;  4UP7 A;  4DR5 Q;  3NBH B;  3EN2 A;  2ZJQ A;  4GNX A;  1TXY A;  2UXD Q;  5GQO A;  3PUW A;  4OO1 G;  2VW9 A;  4OO1 I;  1HNX L;  4BY7 H;  4APV A;  4TVA B;  2AKW B;  5AJ3 L;  1UEB A;  2VNU D;  4BBS G;  4QY7 A;  2JA5 G;  4DR7 L;  1IZ6 A;  1QVC A;  3FP9 A;  1E1T A;  1GM5 A;  3HFZ B;  1Q1E A;  4A3L G;  2PQA A;  4DR4 Q;  3PGZ A;  1LTL A;  1VQA A;  2CKZ B;  3H3V I;  4JG2 A;  5JJK A;  2K52 A;  1U0L A;  1HH2 P;  1IL2 A;  1V1Q A;  5FJ8 H;  3CCV A;  3HOV H;  1YJN A;  2EQS A;  4OWT B;  3NEL A;  4BA1 I;  1HNX Q;  4JBW A;  4AYB G;  4JCV E;  5AJ3 Q;  3HOU G;  5C0X G;  5C0X I;  2WFW A;  3E9H A;  3KF6 B;  3IRB A;  1Y1W H;  2B63 H;  3JAM c;  3G4S A;  1Q81 C;  1X3E A;  5EAY A;  2UUA L;  4LF9 L;  4DR7 Q;  3GDE A;  3S17 H;  2JA9 A;  3Q8D A;  4DUY L;  4UP8 A;  3UE0 A;  4HIK A;  3RNU A;  3M7N A;  1I94 L;  4LFB Q;  3HOY G;  5C4X H;  3H15 A;  4A76 A;  4DAM A;  3U58 A;  2ES2 A;  1YHQ A;  3B6Y A;  1FGU A;  3MEF A;  1S3O A;  2JA6 G;  1LUZ A;  2UXC L;  3CCL A;  1BBW A;  5IP7 H;  4BBS H;  3HOX G;  3TRE A;  1C9O A;  1I5F A;  1YEZ A;  2PQA B;  3MXN B;  1W2B A;  2UUA Q;  4LF9 Q;  1XPU A;  2N78 A;  1EUJ A;  1B7Y B;  4XTC S;  1E3P A;  4P73 A;  3K7A H;  3M85 A;  4DUY Q;  1QZG A;  4R4T A;  1TWG H;  1AE2 A;  2NZH A;  4A3I G;  2D0O A;  1I94 Q;  4AH6 A;  1A62 A;  4JI6 Q;  2HIX A;  4YWL A;  1VCI A;  3L2P A;  4GOP C;  3H3V H;  2R93 G;  4A3G G;  4YCU A;  4JBJ A;  4L5R C;  1HZC A;  4EX5 A;  2VUM G;  4J15 A;  4IFD J;  1N36 L;  2UXC Q;  4MZ9 A;  2HIV A;  5DLQ E;  4JI0 L;  3KJP A;  4A3F H;  4LFA Q;  1WCM G;  3HOU H;  3CCE A;  3GTM H;  1JJG A;  1SRO A;  2Y0S E;  5IYC H;  3DLL A;  2VQF L;  1QVF A;  1PH7 A;  1FVI A;  3PSI A;  2JQO A;  4ALP A;  4O2D A;  4QGU A;  3CC4 A;  1XPO A;  3ICE A;  4P72 A;  2PMZ E;  3HKZ G;  5H1S E;  5M5W H;  2R92 G;  2R7Z H;  5HGQ A;  4DPG A;  5C44 G;  1SRU A;  1PV4 A;  1JJ2 A;  3CXC A;  4RG1 A;  1KIX A;  2E5L L;  3GTO H;  1IBK L;  4HIO A;  2QGQ A;  1U5K A;  1N36 Q;  3CAM A;  4UY8 C;  2E8G A;  2KCM A;  4JI1 L;  1MJE A;  2E2I H;  2UUC L;  2JA6 H;  3VDY A;  3GTP H;  1J5E L;  4NPS A;  1VQC A;  2VQF Q;  1YHA A;  4YHH L;  3CC7 A;  3OYY A;  5BR8 L;  1NTG A;  5FLM H;  4RMF A;  1PH5 A;  2ZM6 Q;  1PH6 A;  1EWI A;  4JI8 L;  1VQJ A;  4A3I H;  1R9T H;  3M4O H;  1T9H A;  2XTI A;  2JA7 G;  1EFW A;  4OWW B;  2KCT A;  4A3B G;  4IOA A;  3W1B A;  2E5L Q;  1OXT A;  2VUM H;  2KEN A;  2VZA A;  4JBK A;  4JI1 Q;  2UUC Q;  4DV6 L;  5GRO A;  4GKJ L;  1HNW L;  1SR3 A;  5ELO A;  5LMN W;  4A93 G;  1VQK A;  1Y1V H;  2HQL A;  1J5E Q;  1JMC A;  1RIP A;  4IPH A;  2PI2 E;  1VQ9 A;  4YHH Q;  1EOV A;  4GN3 B;  4DV7 L;  4P74 A;  2CWP A;  3H0G G;  2UXD L;  4JI8 Q;  3UDG A;  1JB7 A;  4OX9 Q;  4LF8 L; 
#chains in the Genus database with same CATH topology
 1PH1 A;  2O4X A;  1NR4 A;  1N34 Q;  4PZ7 A;  1HR0 W;  2JA6 B;  3GTP B;  3DHQ A;  4IPD A;  4HED A;  3KLS X;  2V1C C;  1PYS B;  1DOK A;  1PA6 A;  4DXF A;  1Z6H A;  1S40 A;  1PZK D;  5KGU A;  2A19 A;  2BH8 A;  3QIA A;  5CV4 A;  4DV7 Q;  4J1M A;  2JN4 A;  2EJM A;  5M3F G;  2N88 A;  4A3G B;  1CKO A;  3CMA A;  4IO9 A;  2N8N A;  3X3M A;  2I46 A;  4IUU A;  2GA4 B;  5D65 A;  3BDC A;  5JJI A;  5LL6 X;  5D3D A;  1DD2 A;  4JOI C;  5L37 A;  4HJA A;  2Z0S A;  4WJ3 M;  3LWE A;  2K32 A;  1MBY A;  2QEX A;  1LM0 A;  1SNO A;  5JAV A;  1CM9 A;  5CV6 A;  1X3G A;  1L1O A;  2YV5 A;  2XGT A;  4BY1 G;  3S24 A;  1EY9 A;  3NWS A;  4NMZ A;  1I50 H;  5EPK A;  4G7H C;  1MKH A;  1HCZ A;  1OXX K;  1EIF A;  3K0Y A;  4JI6 L;  4IUT A;  5JVH 3;  2EIF A;  2F0I A;  2KBN A;  1Q8K A;  1RKN A;  1C7Y A;  1FD7 D;  3D4D A;  4Z9C B;  1EY7 A;  2NN6 H;  1SNM A;  1SJE D;  3K58 A;  3F2D A;  1XTC D;  3Q24 A;  2JA8 B;  4OEM B;  2JA5 H;  4B3S L;  3GP7 A;  1VQO A;  4A93 B;  3S2D H;  3BJU A;  5JEA G;  2RDH A;  2DY8 A;  3CP0 A;  1TWH B;  4R4C A;  4IJH A;  2A8V A;  1C0A A;  3I55 A;  4RHS A;  4CKE A;  1S5E D;  1XYI A;  3T53 B;  3MHB A;  1MGS A;  1SAP A;  4C2M B;  1B70 B;  3GTJ H;  1SMY D;  1S5D D;  2F0F A;  5DM6 3;  1D7Q A;  4BXX G;  3SK4 A;  2NVT H;  5CV9 A;  1N32 L;  4WFN 3;  1OXU A;  1XJV A;  4B3S Q;  1Q7Y C;  3WDN A;  2A6E C;  4PZ8 A;  4JI3 L;  2ZM6 L;  2MO0 A;  2MHV A;  3AU7 A;  2VB3 X;  1QNK A;  4K5X A;  3STB D;  3BYT B;  3KFU A;  2E2H B;  2K14 A;  4A3K G;  1N32 Q;  4LF4 L;  1CHP D;  1CSQ A;  2FHT A;  3HOX H;  3FVQ A;  2ICE C;  2CFM A;  4H7B A;  1NR2 A;  2B2T A;  4JI3 Q;  1F2Z A;  2AMC B;  1QIL A;  3QOJ A;  1VQD A;  2E75 C;  3P7J A;  3CD6 A;  4LF5 L;  2F4V L;  1IYU A;  2NWG A;  3LWU A;  3K81 C;  2WB1 G;  3NQI A;  1EY5 A;  4HCE A;  4LF4 Q;  1RF2 D;  2FXQ A;  4JYA L;  2BA1 A;  1WTV A;  5IE8 A;  3FPU B;  4ZYS A;  4GZY C;  1P8L A;  4BY7 G;  1D5X C;  3I4N H;  2FMC A;  4LF5 Q;  2F4V Q;  2I5L X;  5G3L F;  1KDA A;  5EPJ A;  1GO3 E;  4FF3 A;  4LAA A;  2L5T A;  2B2V A;  3T1H L;  1ASY A;  1X32 A;  1FJG L;  4JYA Q;  1HR0 L;  5EBC A;  3M4P A;  2D62 A;  1RD9 D;  4K6D A;  3HOZ B;  2E2D C;  1XPR A;  3KDF A;  3HOW B;  2G9D A;  3RZO H;  1XTD A;  2A68 D;  3HRZ C;  5CMD A;  3OIP A;  3S2H H;  1Q46 A;  3GTG B;  2A1A A;  3S15 B;  3ONA B;  4H44 C;  1WYD A;  2LY7 A;  2WAQ G;  5CC4 A;  3O13 A;  3G6E A;  4A3E G;  3T1H Q;  2Z4H A;  1F9R A;  3RLF A;  1OXV A;  1WFQ A;  1Z9F A;  1FJG Q;  1HR0 Q;  4RAU C;  1X3P A;  1VQI A;  3H0G H;  4QQB X;  5CBA E;  1TR5 A;  1KRS A;  4CJ0 B;  2NVY B;  1DXM A;  1SMX A;  1IBL L;  4UAI A;  1SJH D;  1I4R A;  1EEF D;  3DWA A;  1Q1B A;  3FHW A;  2K7V A;  2Z4I A;  3P20 A;  4KN7 C;  1KDC A;  2K6A A;  4GN5 A;  1B3A A;  1DM0 B;  5HY6 A;  1MJC A;  2F3V A;  1G29 1;  1GD7 A;  3GTL H;  3R2T A;  3M3Y B;  1UE1 A;  2WIN B;  4CDF C;  3A74 A;  2C35 B;  3BVM A;  1IBL Q;  3OMG A;  1GJX A;  3MZ5 A;  1SE4 A;  5IYC G;  2HHH L;  1WI5 A;  4BS9 A;  1ESR A;  1NBW A;  2JXM B;  4F87 A;  3TDQ A;  3NTI A;  2B2W C;  4XQN A;  2DUD A;  5ELE A;  4CDC C;  2AQ1 B;  3I73 A;  1HTP A;  4NXN L;  1XNQ L;  2IT1 A;  2HHH Q;  4DNR B;  4F8M A;  3I2Z A;  2K5Q A;  4B3M L;  4KHV A;  3CW2 C;  5ELC A;  1O7I A;  4LWC A;  3BZK A;  5FKA C;  2OWO A;  1OTC A;  3GTK B;  4IAL A;  5K36 H;  2N3S A;  2PW7 A;  2LSS A;  3UE1 A;  1KXL A;  2Z6K A;  4NXN Q;  1ENF A;  1XNQ Q;  2ENB A;  3T1Y L;  5GAE C;  1PLF A;  3FKI B;  4B3M Q;  1VQE A;  4QMG A;  2F0N A;  1SFO B;  5GAH C;  1ML0 D;  1ONL A;  3PF5 A;  2KOL A;  4RFB A;  4DAY A;  1KHI A;  3QOL A;  5I2Y A;  1VDZ A;  4X3K A;  5CV7 A;  1PFB A;  4A75 A;  1J6Q A;  4CHT B;  3SK5 A;  1SMY C;  3HP3 A;  4L6T B;  3T1Y Q;  4JK1 C;  1PYW D;  1T5X D;  1X65 A;  1JQY D;  5C3E H;  4DNT B;  4DR3 L;  3L9A X;  2X69 A;  4A3M H;  2B3G A;  1PTO H;  3FMC A;  4MTN A;  3VYR A;  3OOC A;  1JJC B;  5T1I A;  3S14 B;  3E6Z X;  1STY A;  1I6H B;  1TWA H;  2R93 H;  3UDI A;  2OQ0 A;  1SSO A;  1WTP A;  5JJL A;  1QUQ B;  1VS0 A;  1STA A;  2GVA A;  3STB C;  1BF4 A;  1GUS A;  4LFC L;  3I4O A;  3PO3 B;  2QDB A;  4K2K A;  4DR5 L;  4DR3 Q;  1EY6 A;  2QF7 A;  2EYM A;  1FYC A;  5M5W B;  3HKZ E;  4ZQ3 A;  3KLR A;  4LW1 A;  3DWQ A;  3GTO B;  1LTT D;  1AE3 A;  4QJF A;  2K03 A;  4NW2 A;  2NVX B;  2IX0 A;  3I4M B;  2B2Y A;  3KF6 A;  3NPP A;  3OW7 A;  1G2T A;  3PF4 A;  4LFC Q;  4ID6 A;  4RGT A;  5C6A A;  3GD7 A;  1A15 A;  3ITP A;  4DR5 Q;  2EY5 A;  3EJI A;  3A7A B;  3EN2 A;  1TXY A;  1G2S A;  4GNX A;  3DMU A;  1HNX L;  4BBS G;  2F0H A;  2PQE A;  2JA5 G;  4A3D B;  1PTO F;  2K05 A;  3VYU A;  2KEC A;  2XSC A;  1IZ6 A;  1QVC A;  4G7O C;  1EY0 A;  3HFZ B;  1AN8 A;  1TQO A;  1HA5 A;  4Y7N B;  1LTL A;  1PMR A;  4KJN A;  1EYA A;  4DN4 M;  1ET9 A;  1IL2 A;  1V1Q A;  1V1P B;  4EQO A;  4ZKB B;  3K6O A;  4I65 A;  2EQS A;  4F7X A;  1HNX Q;  1W6K A;  3HOU G;  4ZRZ A;  1STN A;  3NK9 A;  4IUN A;  2D2C C;  1Q81 C;  3KUP A;  4B9W A;  2A68 C;  2JA9 A;  2CH4 A;  3CQZ B;  5C4X H;  4A76 A;  2JP1 A;  4KKU A;  3U58 A;  1YHQ A;  1FGU A;  1HQR D;  5M3M B;  3N52 A;  4HN7 A;  5DAU A;  4OO1 H;  5IP7 H;  3HOX G;  3TRE A;  1C9O A;  1Z7T A;  3MAQ A;  1W2B A;  1B7Y B;  1BCP D;  1TWG H;  4A3I G;  4RH6 A;  5ELD A;  2HIX A;  4YWL A;  4GOP C;  3H3V H;  1GUN A;  3HOV B;  4YCU A;  1TKW B;  4ODG A;  4MZ9 A;  4JI0 L;  1X3Q A;  3S1M B;  4PMC A;  2Z1C A;  1ESF A;  2V4D A;  1QVF A;  1TT2 A;  1F9S A;  1GHJ A;  2BDO A;  3VR5 A;  4QGU A;  2KCC A;  5KIX A;  2K04 A;  1LT3 D;  4X3U A;  1EIG A;  2R92 G;  2R7Z H;  2EOT A;  2SOB A;  1PV4 A;  1R4Q B;  4IZ8 A;  2E5L L;  1PRT F;  2QGQ A;  4TSS A;  1RDP D;  2E8G A;  4JI1 L;  1MJE A;  2JA6 H;  3GTP H;  1J5E L;  1U4P A;  1O7Y A;  3K7A B;  3A7L A;  3WOF A;  4DFA A;  5BR8 L;  4RMF A;  1TS2 A;  1PH6 A;  1EWI A;  2JSO A;  1F9P A;  5TSS A;  3OHX C;  1SBB B;  2E5L Q;  2KEN A;  2VZA A;  4AYB B;  3J7Y W;  4XDX A;  4JI1 Q;  4DV6 L;  5ELO A;  1Y1V H;  3TBI B;  1J5E Q;  1JMC A;  4LMQ D;  3CKI B;  5JPM C;  1HUN A;  1CFM A;  4HSV A;  4P74 A;  3H0G G;  4FF4 A;  3TN2 A;  4Q0F A;  2RCN A;  2I07 B;  4GLV B;  4G57 A;  2Q2U A;  3A5Z B;  2OQK A;  4LF7 L;  4DV6 Q;  1AW7 A;  1WD0 A;  2WII B;  4DV3 L;  5LL6 S;  5EKL A;  1ZEQ X;  2IY5 B;  3U4V A;  5IYD H;  2O2L D;  2K5V A;  1O7Z A;  1SYC A;  3RZD B;  2NN6 I;  2JE6 I;  2VUM B;  1QOH A;  2F0U A;  4XXE A;  4LF7 Q;  2JA8 H;  4HJ9 A;  1NMG A;  3EA6 A;  1YNN D;  2FMM A;  3SGI A;  1S5C D;  1K3R A;  4J6H A;  2ID0 A;  4XT3 B;  4DV3 Q;  4HR7 B;  1I4H A;  1VQ5 A;  1CUK A;  2CQA A;  2ALY B;  2LFN A;  2P5Z X;  1SLJ A;  1TWH H;  3I3C A;  4X64 Q;  4HIM A;  3HS0 C;  2EY2 A;  4XT1 B;  1S5B D;  2D9U A;  1D1I A;  4C2M H;  4B3R L;  5K5P A;  3K0X A;  1EQT A;  4QIW E;  5C4H A;  1EYC A;  1U4R A;  3OW2 A;  4X62 Q;  1RHP A;  5I2X A;  2EE1 A;  3EQL C;  4CDD C;  3R8B A;  1YHB A;  3A56 A;  4YCW A;  1KQS A;  2UUB L;  4DV4 L;  2JEA I;  3H6M A;  3CME A;  3IKJ A;  4CDE C;  2HCC A;  1X56 A;  2DGY A;  3S1Q B;  5K36 G;  4B3R Q;  2JA7 B;  1PDQ A;  2E2H H;  4LFA L;  2Q2I A;  3QO2 A;  5C3X A;  1ZYR D;  4C3H B;  2Q2T A;  5EKK A;  1F2M A;  1EQQ A;  1EQV A;  2QEJ C;  1TY0 A;  2UUB Q;  4DV4 Q;  3RLN A;  4ME3 A;  1G8Z D;  3IFT A;  4DK3 C;  1Q86 C;  1D8L A;  3RN5 A;  4GOP B;  5IYB H;  5C5M A;  1ZXT A;  4WJW A;  2NB0 A;  4IJL A;  5A35 A;  3EBE A;  4JI4 L;  1UUP A;  2HCI A;  2MJ8 A;  1FNU A;  2F0T A;  3I70 A;  1LT5 D;  4POF A;  3NSW A;  5C3E G;  1SE2 A;  4A3M G;  3C46 A;  2QW7 A;  2A74 C;  1UWV A;  2IWH A;  1K9M C;  1LV9 A;  3I72 A;  3DUZ A;  1NNX A;  5CYU A;  1HXY D;  4OON A;  5M3F B;  4JI4 Q;  1KD1 C;  5FLX E;  4AYB E;  4FVM A;  4JI5 L;  2PZW A;  1BDO A;  4FF2 A;  1A8V A;  3KOJ A;  3ULL A;  1TWC B;  2XWB B;  3I8Z A;  1QE6 A;  2F03 A;  5C4J B;  5C5L A;  1UAP A;  1EY8 A;  2M2L A;  3HOZ H;  1A3T A;  1TWF B;  2CQO A;  3HOW H;  1N34 L;  1BCP C;  4NXM L;  4POG A;  3AEV A;  3GTG H;  3BVG A;  4JI5 Q;  1WCM H;  1NUC A;  1K83 H;  4IOC A;  2Q8T A;  1DCZ A;  3MXP A;  2MNA A;  3SE0 A;  1YI2 A;  2IHF A;  4TKO B;  3F2C A;  2B2U C;  1M90 C;  1B9M A;  1PZJ D;  4L5Q A;  4OEL B;  1SYG A;  2VQE L;  4KTA A;  4NXM Q;  1L0W A;  2L55 A;  3PCO B;  1CKN B;  1UE6 A;  4FP5 D;  1B44 D;  2F0O A;  5FK9 C;  4GLX A;  1KNA A;  1VQ4 A;  1F2L A;  3I4L A;  1XWE A;  4XQQ A;  2R7D A;  1MD2 D;  3ND8 A;  4FF1 A;  4H02 A;  4DAY B;  1Q12 A;  1SNP A;  2VQE Q;  3CCQ A;  1N33 L;  1LTS D;  1PFS A;  3G48 A;  3TEH B;  1SND A;  4DV1 Q;  4MN3 A;  3K8A A;  2ZTD A;  1D1K A;  4RCO A;  1AFP A;  5FO9 B;  5C4X G;  3AQQ A;  3JC6 6;  1K28 A;  1GOZ A;  1E0B A;  2KA7 A;  3KLW A;  5C44 B;  5EJW A;  3D31 A;  1N33 Q;  5IP7 G;  3GTQ H;  4Y52 H;  2PNR C;  1HNZ Q;  1YZ6 A;  1FR3 A;  1JWU D;  4IFD H;  1YBY A;  4A3K B;  3PO2 H;  1XX8 A;  4C3I B;  1ENA A;  4C56 C;  4QF4 A;  2LXJ A;  3HG9 A;  2IX3 A;  1JOO A;  2IL8 A;  1U9R A;  1CHQ D;  2RCF A;  4PQX A;  5IT9 E;  2CWA A;  1PXU A;  1SNC A;  5J3B A;  3GTK H;  3G71 A;  1RCV D;  2OTJ A;  3U4Z A;  4F88 A;  2K5H A;  5GAD C;  1B2T A;  2WB1 B;  1PH3 A;  1VQ7 A;  2E2J B;  2HDL A;  5GAG C;  4BBR G;  1IYV A;  1PFN A;  3FKI H;  3L7Z C;  4R8N A;  4GNX B;  3TP8 A;  1U4M A;  2R7Z G;  4A3J G;  4DR6 L;  4IUV A;  1SFO H;  1YNN C;  5BN4 A;  1LTG D;  5D14 A;  4BY7 B;  4KLK A;  3D4W A;  3W3A A;  1XMQ L;  4DV0 L;  1KTK A;  4PV1 C;  5C4Z A;  3J80 c;  4R1J A;  4L8J A;  3OWE B;  5CBE E;  4R4O A;  1M4V A;  4IUR A;  1XMO L;  2GN5 A;  3MEH A;  5JJZ A;  4DR6 Q;  2I0Q A;  1IXR A;  2OT2 A;  1PHJ A;  3VA5 A;  5DEH A;  4KHZ A;  1MI2 A;  1XMQ Q;  1IKL A;  3S14 H;  1E7Z A;  1I6H H;  1D5M C;  4DV0 Q;  1CT1 D;  1Y1V G;  3K59 A;  1YVC A;  2WAQ B;  4OXP A;  3W1G A;  3PMF A;  5E4X A;  4A3E B;  3PO3 H;  1XMO Q;  1ZYR C;  2PPB C;  4U67 3;  5EQ0 A;  3CCM A;  2F0Q A;  1B9N A;  1E2V A;  1G51 A;  1JOQ A;  4OIK A;  3A55 A;  1BCP B;  2EJF C;  2VXW A;  2PO4 A;  1N8R C;  1TII D;  2NVX H;  2H5X A;  2QKI C;  4CKB A;  1CSP A;  1BVS A;  3I4M H;  4HJ7 A;  2WKC A;  4PMW A;  3JAM i;  4LF6 L;  4FYD A;  4TQU S;  3RUZ A;  2RHQ B;  5IYD G;  1J8I A;  1KC8 C;  3URY A;  1NMF A;  1E1O A;  3FDT A;  5ELN A;  2I5H A;  4KY5 A;  3NBH A;  4ZUI A;  1X3F A;  3S1N B;  3M9B A;  1K0R A;  3T51 B;  4B3T L;  2JA8 G;  4A3D H;  1NY4 A;  2ZTE A;  4KJO A;  3J80 i;  4DV2 L;  4Y7N H;  4LF6 Q;  1BKB A;  1HJP A;  3I56 A;  3A8K E;  1SYF A;  3NP8 A;  3BZC A;  3BYY B;  1Y1W G;  4MHE A;  2B63 G;  2F0K A;  1H95 A;  2L11 A;  4B3T Q;  3GV3 A;  1D2B A;  2H4O A;  1YIJ A;  4DR4 L;  3SK8 A;  4DV2 Q;  5IP9 H;  2PZT A;  3CQZ H;  2JEB I;  1C4Q A;  2F0D A;  1GHK A;  1DOM A;  1E2Z A;  3PUW A;  4OO1 I;  3NE5 B;  1FNW A;  4TVA B;  4C3J B;  1UEB A;  1PZI D;  2F0V A;  3AB9 A;  2KCN A;  2K33 A;  2NBF A;  4HAE A;  1E1T A;  1GM5 A;  2XRQ D;  4DR4 Q;  3PGZ A;  4DXG A;  3H3V I;  5JJK A;  4PNY A;  2ZXP A;  1HH2 P;  5I9O A;  1EYD A;  5FJ8 H;  3HOV H;  1JWS D;  4K14 A;  1YJN A;  3DEP A;  4OWT B;  1TS5 A;  3C2P A;  2XN9 C;  5F2D A;  2M9V A;  2KQ3 A;  3HEJ A;  1PFM A;  1LTA D;  1KDB A;  4LF9 L;  4DUY L;  4JPB W;  3UE0 A;  2H1E A;  4HIK A;  3M7N A;  1QCB D;  1I4Q A;  3H15 A;  1FGB D;  5EGT A;  1EU3 A;  1S3O A;  1SXT A;  4ZLT F;  1DON A;  4ABN A;  3D8G A;  2PQA B;  4N9P A;  3MXN B;  3WOE A;  4ZKC B;  4ULL A;  4LF9 Q;  1XPU A;  2EYL A;  2N78 A;  3JAM E;  3FEW X;  3M85 A;  3K7A H;  2AUJ D;  4DUY Q;  2DNE A;  3H09 A;  4OL7 A;  2NZH A;  2D0O A;  4L5R C;  4JBJ A;  5HGT A;  1HZC A;  4EX5 A;  1N36 L;  1RJT A;  3NHH A;  2HIV A;  1WCM G;  3KK7 A;  5C0X H;  4KKS A;  2VQF L;  1TVX A;  3E3X A;  1FVI A;  3J80 E;  4EVO A;  3PSI A;  3K5M A;  4ALP A;  3MFG A;  3HKZ G;  2HDM A;  4DPG A;  1EU4 A;  1E2W A;  2ZXO A;  3CXC A;  4HIO A;  1N36 Q;  3CAM A;  2UUC L;  4BBS B;  4S3S A;  1NCV A;  2JA5 B;  4NPS A;  2VQF Q;  3AMU A;  5EBD A;  1EY4 A;  3QJY A;  3CC7 A;  2Q8I B;  1DZ1 A;  2SNM A;  5COR A;  1V8Q A;  1EFW A;  1D6E C;  2KCT A;  1W6J A;  1U4L A;  2VUM H;  4A3F B;  2NVT B;  3HOU B;  2UUC Q;  4GKJ L;  2J0T D;  3TP5 A;  2HQL A;  3NXW A;  3TME A;  1RIP A;  3OPO A;  2PI2 E;  1T5E A;  2CWP A;  2BE5 D;  4OIJ A;  3UDG A;  4KD4 A;  4OX9 Q;  3GV6 A;  2J7Z A;  3KF8 B;  1LAB A;  4K6L A;  2F0P A;  1XXG A;  4IFD G;  4DR2 L;  3CCR A;  4K5W A;  1I4P A;  4GKJ Q;  4OGQ C;  3PO2 G;  2B2T C;  4DUZ L;  1IHZ A;  3HOX B;  1PH2 A;  3K7U C;  4FDB A;  4BA2 I;  3VYS A;  4A3I B;  3M4O B;  2HD3 A;  1DYQ A;  1KAW A;  1QZH A;  1AEX A;  1HZA A;  2NN6 G;  4FXG C;  2O5I C;  3S1Q H;  2EY6 A;  1EOT A;  4UHV A;  2YTY A;  3D6W A;  4JI2 L;  1VQL A;  4DR2 Q;  4G4K A;  4KHP L;  4LUV A;  4IPC A;  3CU7 A;  4DUZ Q;  2J4X A;  4HCS A;  2IX1 A;  5A2Q E;  1WVL A;  1C8C A;  3FKI G;  1H9J A;  3KBG A;  1L0Y B;  3EVQ A;  4YCV A;  3S9W A;  2R92 B;  3L3O C;  2KUM A;  5LHY 1;  3MA2 B;  3ZYY X;  1XNR Q;  4JI2 Q;  1EEI D;  5I9P A;  2C9O A;  4KHP Q;  3UDX A;  1VQ8 A;  1VQF A;  1X6O A;  2F0G A;  1F2Y A;  2NTS A;  5C3W A;  2RDF A;  2MGS A;  2N49 A;  1TS3 A;  3RZO B;  2F4I A;  3NTH A;  5M3F H;  4J8Q A;  3S2H B;  3GQB A;  4DK0 A;  4KKT A;  2UU9 Q;  4V0B A;  1HZ9 A;  1TWC H;  3PO3 G;  3ERQ A;  3MWY W;  5C4J H;  3ULJ A;  4MTK A;  4TRD A;  1TWF H;  3F2U A;  3IL8 A;  1L1O B;  3A0J A;  4EQ5 A;  5FLX c;  3UDF A;  4H0L C;  5KNB A;  3OWF A;  1GVP A;  2B8F A;  3NEN A;  3OTO L;  4EQP A;  1A2U A;  3A54 A;  3ZJY C;  3EFX D;  1WTR A;  4JW0 A;  3PUV A;  4CGY B;  2OTL A;  1VQN A;  1STH A;  3N6R A;  2K75 A;  1K3B C;  3HOY H;  3I4N G;  4KMU C;  1BBU A;  2ASB A;  2IW3 A;  2OEO A;  3X3N A;  3J81 i;  4A3D G;  2F3W A;  2EXZ A;  3OTO Q;  3AYH B;  2ATW A;  4B08 A;  5IGC A;  2EYF A;  3ER0 A;  2XNA C;  2SEB D;  2F0J A;  3KBX A;  1X55 A;  2L12 A;  3UI2 A;  3J7A V;  1VQH A;  4RKL A;  3NQT A;  1M1K C;  4GLA C;  4A3G H;  1R4P B;  2K28 A;  1JC7 A;  1N9W A;  1KAB A;  3NEM A;  4BXX H;  1WTW A;  1YJ9 A;  1CK1 A;  1SYD A;  4FO2 A;  5KEE A;  1KNE A;  3M4Y A;  2YU9 B;  1YJW A;  4JOI A;  2IPK D;  4ZCK A;  5KND A;  1EIY B;  2PMZ B;  4QUC A;  1ASZ A;  5CGK A;  4IN3 A;  3TS0 A;  1O80 A;  5C44 H;  3OIQ A;  3HZX A;  2YTV A;  1X54 A;  2AHO B;  4IFD I;  1ICW A;  2F1M A;  3Q6S A;  4A3K H;  4JV5 L;  4X64 L;  1I6V C;  2NZO A;  4C3I H;  3T56 B;  2RBM A;  2AQ3 B;  5FLX L;  1NSN S;  2B29 A;  1CQV A;  4ZAI A;  3E9I A;  3M7G A;  1HZB A;  3PV0 A;  4X62 L;  2ZJR A;  3C3L A;  1JB3 A;  4A93 H;  2E2J H;  5M5X B;  4JV5 Q;  3DWP A;  1QVG A;  3LGJ A;  5IT9 c;  1HQM C;  2TSS A;  3CCS A;  4A3M B;  1EZ6 A;  1DGS A;  4O0A A;  1UE7 A;  1GKH A;  2A6H D;  4KN4 C;  3MFY A;  2Z8L A;  2AWO A;  2BE5 C;  2Y0S G;  1Y14 B;  3PUY A;  3QWN A;  3TSS A;  3Q22 A;  4R8I A;  3KDF B;  2WP8 J;  3KJO A;  3G6J B;  2CHB D;  1MSH A;  2VY3 A;  1Y69 U;  5EKI A;  2RHS B;  5J39 A;  3J81 E;  4A3B B;  2NTT A;  5IGG A;  2F0L A;  1SDF A;  5M5Y B;  1C48 A;  2CW0 D;  4K8I A;  4GNX C;  2YTX A;  4A3E H;  2CVR A;  4A4I A;  3BG3 A;  5COY A;  1G91 A;  2HUG A;  1H9M A;  1JE5 A;  4N9T A;  3HKS A;  5KYL A;  2DN8 A;  1PH9 A;  5JVG 3;  4CJ2 C;  3ULP A;  5ELB A;  1LTI D;  1VMP A;  1STE A;  3PIP 3;  2MFI A;  4RWS C;  2CCZ A;  1X9N A;  1JOK A;  1SYB A;  2XIW A;  2EDG A;  5T1G A;  3ERS X;  3S1N H;  2EYP A;  2R93 G;  4DKA C;  1Q90 A;  1Q8I A;  1TU2 B;  2RKS A;  3CPW A;  5IT9 L;  1LT4 D;  2K01 A;  5EPL A;  4KY7 A;  1JWM D;  1QUQ A;  4FXD A;  1HRJ A;  3GO5 A;  1MIU A;  5C4X B;  3K57 A;  4XQJ A;  1CQF A;  4N8X 1;  3SDZ A;  3S15 H;  2RSO A;  4BY1 B;  3R93 A;  1BCP F;  5KRU A;  3P1H A;  2KEE A;  1B1Z A;  4HTH A;  2MUY A;  3P75 A;  1IW7 D;  1TWG B;  1TY2 A;  3PQI A;  2DJG C;  2K4K A;  3S16 B;  1WTO A;  2OXP A;  1OO9 B;  2NVY H;  4C3J H;  2F0E A;  1IBK Q;  1EQR A;  1GXD C;  4DV1 L;  2LXK A;  1ILP A;  5HUR A;  3F1Z A;  3T4A C;  5ISR A;  3W2D A;  4BBR B;  4LUZ A;  2L15 A;  2NVQ B;  3IAY A;  4RCN A;  1YNX A;  3M3Y H;  4A3J B;  3PIP A;  1V1P A;  1HNZ L;  1IKM A;  3D6C A;  3SR1 A;  2IHE A;  1Q82 C;  2R61 A;  2GVB A;  1ILQ A;  2EJG C;  1HNW Q;  2NZ1 D;  1P16 A;  1Z47 A;  1PVO A;  4A3C H;  2D0P A;  2Z6B A;  4DAP A;  1KAA A;  3CRK C;  2ZTC A;  4X3S A;  2UXD Q;  1I3Q B;  4DAV A;  5GQO A;  4OO1 G;  2VW9 A;  2SDF A;  3MVV A;  4APV A;  2AKW B;  5AJ3 L;  3E5S A;  2B2W A;  3VYT A;  1Y1V B;  2EYO A;  2DY7 A;  2AQ2 B;  2EVB A;  2R3Z A;  1MSG A;  1A6X A;  4JG2 A;  1U0L A;  4HSP A;  4JBW A;  1BNZ A;  4JCV E;  4X3T A;  5AJ3 Q;  5C0X I;  2WFW A;  3E9H A;  3KF6 B;  3JAM c;  3G4S A;  3S1R B;  1X3E A;  2NUC A;  3RD4 A;  3G7L A;  2UUA L;  2WKD A;  3GDE A;  3Q8D A;  4MIU A;  1UNS A;  3E0J A;  3HOY G;  1JIC A;  2E74 C;  5E1F A;  5IIF A;  3QB3 A;  4DAM A;  2ES2 A;  3B6Y A;  3MEF A;  4NKL A;  1A3U A;  2JA6 G;  1LUZ A;  5ELF A;  1WTH A;  1BBW A;  2TMP A;  4BBS H;  1FNV A;  1BR9 A;  2UUA Q;  2A6H C;  4XTC S;  4P73 A;  1QZG A;  5IGB A;  4JI6 Q;  3K5N A;  1VCI A;  3L2P A;  2MP1 A;  4A3G G;  1IL8 A;  1ET6 A;  3J7A F;  2X6G A;  4NDX A;  4IFD J;  4B9X A;  5IGF A;  3K5L A;  5DLQ E;  1Y1W B;  3KJP A;  4A3F H;  2B63 B;  3HOU H;  2XWJ B;  3S17 B;  1PH7 A;  4RGM A;  2JQO A;  2L9H A;  1WD1 A;  4O2D A;  3CC4 A;  1GUW A;  1K8O A;  4FNF A;  4P72 A;  1BBX C;  3SXH A;  5M5W H;  5JPN C;  1CA5 A;  5C44 G;  4RG1 A;  2CW0 C;  3GTO H;  3VR2 A;  2KJX A;  2KCM A;  4UY8 C;  3VDY A;  4C3I G;  2K5W A;  1YHA A;  1A3V A;  2HQE A;  3D3R A;  1Y8P B;  5DNF A;  1WTX A;  3A8I E;  2E76 C;  2G5D A;  5FLM H;  2FIN B;  2ZM6 Q;  1H9K A;  1VQJ A;  4A3I H;  3M4O H;  2IJ0 A;  2PCF B;  4IUP A;  5J22 A;  3JAM L;  3ND9 A;  4I7Z C;  3GTM B;  5LMN W;  4A93 G;  1AP0 A;  2FJ2 A;  1PTO D;  2QIL A;  3Q0A A;  4K2L A;  4IPH A;  5KNC A;  1VQ9 A;  5JOB A;  2B8G A;  2BDN A;  1JB7 A;  3D4R A;  4LF8 L;  4ILW A;  1HPC A;  4R4I A;  2OF1 A;  2R92 H;  1WJJ A;  5E7N A;  3J80 L;  2K50 A;  2EZV A;  3NBI A;  1I4X A;  2E2I B;  1A0I A;  4Q5V A;  3TZU A;  2ZJP A;  2XVS A;  1EL0 A;  1D5Z C;  2DJF C;  1I4G A;  1EIH A;  3IFD A;  4RA8 A;  1AZP A;  1R9T B;  1VF7 A;  3R2I A;  4LF8 Q;  2JJQ A;  5M3M H;  2JK8 A;  1K0S A;  1BUV T;  1IW7 C;  1L2F A;  3U9S A;  1AH9 A;  1B53 A;  4HMI A;  2WB1 E;  4KY6 A;  3PIO 3;  4KK7 A;  1WCM B;  1K83 B;  3FRP B;  5LMU L;  1EZ8 A;  3PUZ A;  5D3I B;  5IYB G;  4DV5 L;  1VQG A;  3NTK A;  2NYZ D;  1SN8 A;  2VL6 A;  3HKZ B;  2RF4 A;  4GOP A;  4DF7 A;  2LS0 1;  5IOC A;  3S1M H;  2C5C A;  2F52 A;  1BO0 A;  3KYH C;  1QB5 D;  4R9W A;  4LFB L;  1RL2 A;  2KHS A;  5LMU Q;  3V2T A;  4C1N K;  4DV5 Q;  4LUO A;  2DNC A;  1PYB A;  2BOS A;  3V05 A;  2KHI A;  1BQQ T;  1YNJ D;  1LT6 D;  1TS4 A;  4ZK9 B;  1Q3L A;  5IY0 A;  1PRT D;  2G9H D;  4AQY L;  2WAQ E;  1CI3 M;  3C1F A;  4RGN A;  1BXT A;  1PH8 A;  3DM1 A;  1IBM L;  3D0F A;  4A3L H;  4LFB Q;  1O7L A;  4P2C B;  3HOZ G;  4JVZ A;  1K8G A;  1KL9 A;  3HOW G;  1L1O C;  3RLO A;  2UXB L;  2A69 D;  3F8T A;  1L0X B;  3OMC A;  1H9S A;  5A2Q L;  1VQP A;  5I6W A;  3GTQ B;  4HJ5 A;  4X6A H;  2ZXR A;  4R4Q A;  1I50 B;  4H13 C;  4AQY Q;  4JBM A;  4X65 L;  3PO2 B;  5IOD A;  2YU9 H;  4YY3 L;  1IBM Q;  4I7A A;  1UE5 A;  1B3Q A;  3PIO A;  1YIT A;  3TQY A;  2UXB Q;  3A5U A;  4C3J G;  5J1Z A;  1V43 A;  1Y8N B;  2AWN A;  1CTM A;  2K1B A;  1EWC A;  1SEB D;  2R7F A;  4MNO A;  1CKN A;  3MC0 B;  4WOR A;  3S2D B;  4X65 Q;  2OCE A;  4YY3 Q;  2K5N A;  1AZQ A;  4OX9 L;  3BU2 A;  3RZD H;  2JYO A;  3MXU A;  1MHW C;  3GTJ B;  1QWY A;  4WJ4 A;  4DK6 C;  4L5S A;  2R6G A;  2LMC B;  4GKK L;  1A63 A;  3W5O A;  3TP6 A;  1H9R A;  3J81 j;  4UDU C;  5CV5 A;  2L4N A;  4A3C G;  2VB2 X;  4CKC A;  1LTB D;  5M5X H;  4EQN A;  2D5D A;  3U50 C;  3TS2 A;  4QCL A;  1VF5 C;  5FOB B;  5LMN L;  3J7A 5;  1E22 A;  1STG A;  5C0X J;  4GKK Q;  3BVZ A;  3WWV A;  4IQZ A;  3EIV A;  1KRT A;  3FPP A;  1BOS A;  3CPF A;  1HFN A;  4DR1 L;  1EFI D;  4AIM A;  3HGB A;  2L0C A;  4PMB A;  5LMN Q;  4YWM A;  3KLS A;  2JA7 H;  1LAC A;  4A3B H;  4K5V A;  1XNR L;  1JCK B;  3A8J E;  4C3H H;  3CF5 A;  1LYL A;  4DU9 A;  2QCP X;  4DA2 A;  1SYE A;  2EYH A;  1EYG A;  2F0M A;  5I6Y A;  4X66 L;  2QA4 A;  5M5Y H;  1SE3 A;  4DR1 Q;  1G6P A;  5NUC A;  3LX0 A;  1LTR D;  3BS1 A;  3I7F A;  3MXG A;  4KD3 A;  4OWX B;  2Z9H A;  3J81 c;  1PTO C;  2PNH A;  4KI0 A;  3I4N B;  2YYZ A;  1PH4 A;  2ZT9 C;  4P71 A;  4K0K L;  2B2V C;  4NB3 A;  4WRD A;  5BN3 A;  3Q23 A;  2EPB A;  4NP5 A;  4DGZ A;  2ICI A;  2UU9 L;  4JI7 L;  3SVM A;  1QNU A;  5E4W C;  1OXS C;  1STB A;  4HMJ A;  1V9P A;  4X66 Q;  4GS3 A;  1HTL D;  2BH2 A;  3BZD B;  2BA0 A;  3E0E A;  3AFP A;  1ENC A;  3TZD A;  2KED A;  3AFQ A;  1KLU D;  4UPA A;  4KV6 A;  1S5F D;  3H91 A;  2B39 A;  2Q2H A;  3C1E A;  4A3F G;  1FL0 A;  4K0K Q;  1WOC A;  4DNI A;  4GN4 B;  1LO5 D;  3H94 A;  4JI7 Q;  4YWK A;  5E3F A;  1VQ6 A;  4XIG S;  1E24 A;  1RTN A;  4L5T A;  1S4Z A;  2AUK A;  2EXD A;  2KVM A;  4IPG A;  4UP9 A;  3VR3 A;  4XYO A;  1CKM A;  3H0G B;  3CCU A;  4O1N A;  1RTO A;  4CBV A;  3SEB A;  3OSO A;  4QIW B;  4PZ6 A;  2RDG A;  3VR6 A;  3I4M G;  4BY1 H;  4U68 A;  3RR5 A;  5FLM G;  5IGD A;  1VMC A;  1JOR A;  1GUT A;  4RKB A;  3ERO A;  4C1N I;  3GTL B;  1K8A C;  4M8A A;  2MQH A;  2VS1 A;  4PG3 A;  3S16 H;  2RQX A;  1ROD A;  3CC2 A;  3BDO A;  2B2U A;  1QJO A;  4P75 A;  1ZKO A;  4QUF A;  4HJ8 A;  2KHJ A;  4HID A;  3CCJ A;  3F2B A;  1CZG A;  4E6I A;  5AFW A;  1YNJ C;  4M1U B;  1K73 C;  3J81 L;  5JEA H;  1PRT C;  4BBR H;  3M4Q A;  2M00 A;  3TRZ A;  4ME5 A;  3L0O A;  2BCO A;  5M9O A;  3DXJ C;  2NVQ H;  1O78 A;  2MO1 A;  3J7Z C;  4QB4 A;  4A3J H;  1B50 A;  2EY1 A;  3TP7 A;  3U9O A;  1IYJ B;  1JT8 A;  5IWA L;  4JI0 Q;  4LNQ A;  2Y0S B;  2A69 C;  1B8A A;  5IP9 G;  1QG7 A;  4EGV A;  1II3 A;  1K8M A;  3H3V C;  2PI2 A;  3QR8 A;  3NWT A;  4RGO S;  3K80 C;  3RMH A;  1I3Q H;  5M3M G;  3DM3 A;  4LJZ C;  1S72 A;  2Z6K C;  2F3I A;  1J9O A;  5IWA Q;  4O42 A;  1WTQ A;  1VQB A;  1G6Z A;  4IUQ A;  1W3S A;  3PUX A;  3SHL A;  5FO8 B;  1NE3 A;  1UEA B;  5FJ8 G;  4K8J A;  2I5M X;  5BR8 Q;  3HOV G;  4L63 B;  2O5J C;  3I91 A;  1SNQ A;  1ICF B;  1Y8O B;  3RN2 A;  4QL5 A;  1DOL A;  1SE8 A;  1V1O A;  3R3O A;  3S1R H;  2RSN A;  4JC0 A;  5JEA J;  4DK1 A;  2HT1 A;  2X6L A;  2A73 B;  5C3E B;  2EYJ A;  1VQM A;  3QG1 A;  1NJI C;  4UP7 A;  3NBH B;  2ZJQ A;  2LKV A;  4LK1 C;  1NAP A;  1PTO B;  5I4D A;  4BY7 H;  1GUO A;  1EWH A;  2VNU D;  3I90 A;  2RA4 A;  4QY7 A;  1CA6 A;  1TWA B;  5IGE A;  2R93 B;  2FFK B;  4DR7 L;  3FP9 A;  1Q1E A;  1F9Q A;  4A3L G;  2PQA A;  3MXN A;  1M8A A;  1VQA A;  2CKZ B;  2QDL A;  3LNN A;  2K52 A;  2WAC A;  2F0W A;  3CCV A;  4BWG B;  2L1B A;  3NEL A;  4BA1 I;  4AYB G;  3VA7 A;  2B2Y C;  2A6E D;  5C0X G;  1Y1W H;  3NUC A;  2B63 H;  2F0S A;  2MPM A;  3IRB A;  5EAY A;  4DR7 Q;  4ZUJ A;  3S17 H;  2N55 A;  1HA6 A;  4UP8 A;  2PZU A;  3RNU A;  1I94 L;  4YIJ A;  1HHV A;  2UXC L;  3CCL A;  2Q8R E;  2K5D A;  1YEZ A;  1I5F A;  1LLR D;  2WV6 D;  5DM7 3;  1HFG A;  3CHB D;  2PYK A;  1EUJ A;  1E3P A;  4R4T A;  1AE2 A;  1A2T A;  1I94 Q;  4AH6 A;  1A62 A;  2XRS D;  4N8F A;  1F77 A;  2VUM G;  4FXK C;  4J15 A;  2UXC Q;  4G7Z C;  3CRL C;  5G3L D;  4LFA Q;  3CCE A;  3GTM H;  1JJG A;  1SRO A;  2Y0S E;  5IYC H;  3DLL A;  2A5H A;  2SNS A;  3DEO A;  1PRT B;  1XPO A;  3ICE A;  2PMZ E;  1CZW A;  5H1S E;  5HGQ A;  5CR3 A;  1HUM A;  1JJ2 A;  1SRU A;  1KIX A;  1IBK L;  1U5K A;  3KF8 A;  2E2I H;  3SK6 A;  1DJR D;  2CH4 W;  1B4O A;  5BN5 A;  1VQC A;  1JE4 A;  5CV8 A;  3V96 A;  4YHH L;  2RVL A;  3OYY A;  1NTG A;  4CJ1 B;  1PH5 A;  2PW5 A;  3T13 A;  4JI8 L;  1R9T H;  1H9S B;  1T9H A;  2XTI A;  2JA7 G;  3K5O A;  1GUG A;  5FO7 B;  4OWW B;  4A3B G;  4OHJ A;  3W1B A;  4IOA A;  4RHR A;  1OXT A;  4JBK A;  4C3H G;  5GRO A;  1HNW L;  1SR3 A;  1KLG D;  1VQK A;  5KYI A;  4V19 0;  3VR4 A;  4YHH Q;  1EOV A;  3MTS A;  4GN3 B;  4DV7 L;  1JR0 D;  2UXD L;  3HOY B;  3T16 A;  4JI8 Q;  4XYQ A;  2R7Z B;  3BDL A; 
#chains in the Genus database with same CATH homology
 1PH1 A;  2RCN A;  3KF8 B;  4R4I A;  4GLV B;  2R92 H;  1N34 Q;  1WJJ A;  5E7N A;  2K50 A;  4PZ7 A;  1HR0 W;  2Q2U A;  3A5Z B;  4IFD G;  4DR2 L;  3CCR A;  2OQK A;  4LF7 L;  4DV6 Q;  1A0I A;  4GKJ Q;  4IPD A;  3PO2 G;  4DUZ L;  4DV3 L;  1PH2 A;  2V1C C;  1PYS B;  1PA6 A;  3K7U C;  4FDB A;  2ZJP A;  1S40 A;  4BA2 I;  2IY5 B;  2A19 A;  2BH8 A;  3U4V A;  5IYD H;  2K5V A;  4DV7 Q;  1KAW A;  1QZH A;  1HZA A;  2NN6 G;  2NN6 I;  4LF8 Q;  5M3F G;  2JJQ A;  5M3M H;  3S1Q H;  1CKO A;  3CMA A;  2JK8 A;  2YTY A;  2JE6 I;  1L2F A;  1AH9 A;  4IO9 A;  2N8N A;  2WB1 E;  4JI2 L;  1VQL A;  4DR2 Q;  5JJI A;  4LF7 Q;  2JA8 H;  4KHP L;  4LUV A;  4HJ9 A;  1NMG A;  4IPC A;  4JOI C;  4HJA A;  4DUZ Q;  2Z0S A;  4DV3 Q;  3SGI A;  2IX1 A;  1K3R A;  2ID0 A;  5LMU L;  1VQ5 A;  3FKI G;  4WJ3 M;  1CUK A;  3PUZ A;  2ALY B;  4X64 Q;  4HIM A;  1SLJ A;  1TWH H;  5IYB G;  4DV5 L;  1VQG A;  4YCV A;  1SN8 A;  2QEX A;  1LM0 A;  2VL6 A;  4C2M H;  4B3R L;  2RF4 A;  3K0X A;  4GOP A;  1X3G A;  4QIW E;  1L1O A;  2YV5 A;  2XGT A;  3S1M H;  4BY1 G;  3S24 A;  4JI2 Q;  1XNR Q;  3OW2 A;  4X62 Q;  4KHP Q;  2F52 A;  3UDX A;  1I50 H;  1VQ8 A;  1YHB A;  1VQF A;  3KYH C;  1MKH A;  4YCW A;  1KQS A;  1X6O A;  4DV4 L;  1OXX K;  2UUB L;  1EIF A;  1RL2 A;  5LMU Q;  4JI6 L;  2JEA I;  4LFB L;  3CME A;  2EIF A;  2KBN A;  1Q8K A;  4DV5 Q;  4LUO A;  1PYB A;  1C7Y A;  1X56 A;  2DGY A;  2KHI A;  2N49 A;  5K36 G;  4B3R Q;  5M3F H;  2E2H H;  5IY0 A;  3F2D A;  4LFA L;  2Q2I A;  2JA5 H;  2Q2T A;  2UU9 Q;  4B3S L;  4AQY L;  1EQQ A;  1VQO A;  2WAQ E;  1HZ9 A;  3BJU A;  3S2D H;  5JEA G;  1PH8 A;  1IBM L;  2UUB Q;  4DV4 Q;  3D0F A;  4A3L H;  1TWC H;  3RLN A;  3CP0 A;  4ME3 A;  4R4C A;  4IJH A;  2A8V A;  3HOZ G;  4DK3 C;  3PO3 G;  1Q86 C;  1C0A A;  1D8L A;  3I55 A;  5C4J H;  3RN5 A;  3ULJ A;  1KL9 A;  4GOP B;  1K8G A;  1L1O C;  5IYB H;  3HOW G;  1TWF H;  3RLO A;  2UXB L;  3F8T A;  1L1O B;  3A0J A;  1B70 B;  4EQ5 A;  5FLX c;  3UDF A;  3GTJ H;  1D7Q A;  4IJL A;  3EBE A;  4BXX G;  1VQP A;  4JI4 L;  4HJ5 A;  2NVT H;  4X6A H;  1GVP A;  1N32 L;  3NEN A;  1OXU A;  3OTO L;  1XJV A;  4R4Q A;  4B3S Q;  4JBM A;  4POF A;  4AQY Q;  1Q7Y C;  4X65 L;  5C3E G;  3ZJY C;  2YU9 H;  4YY3 L;  4PZ8 A;  1IBM Q;  4JI3 L;  1UE5 A;  2OTL A;  3PUV A;  2ZM6 L;  4A3M G;  1VQN A;  1UWV A;  2K75 A;  2MO0 A;  1K9M C;  3PIO A;  1YIT A;  3TQY A;  3HOY H;  3I4N G;  1BBU A;  2ASB A;  2UXB Q;  3A5U A;  4OON A;  3J81 i;  3STB D;  3KFU A;  1V43 A;  2AWN A;  4JI4 Q;  1KD1 C;  4A3D G;  4AYB E;  4JI5 L;  2K14 A;  2R7F A;  4A3K G;  1N32 Q;  4MNO A;  4LF4 L;  3OTO Q;  1CSQ A;  3AYH B;  1CKN A;  3HOX H;  2ATW A;  1A8V A;  3KOJ A;  2OCE A;  3ULL A;  4X65 Q;  3ER0 A;  2CFM A;  4YY3 Q;  4JI3 Q;  2K5N A;  2AMC B;  1X55 A;  4OX9 L;  3BU2 A;  3HOZ H;  1VQD A;  1VQH A;  3RZD H;  3CD6 A;  1M1K C;  2CQO A;  3HOW H;  4GLA C;  1N34 L;  4LF5 L;  4DK6 C;  4L5S A;  2R6G A;  2F4V L;  4A3G H;  4WJ4 A;  4NXM L;  4GKK L;  3K81 C;  4POG A;  3AEV A;  1A63 A;  2WB1 G;  1N9W A;  3W5O A;  3NEM A;  3J81 j;  4BXX H;  3GTG H;  1YJ9 A;  4JI5 Q;  1WCM H;  4LF4 Q;  1K83 H;  4A3C G;  4IOC A;  2MNA A;  2FXQ A;  5M5X H;  1YI2 A;  1YJW A;  4JYA L;  2IHF A;  2BA1 A;  4JOI A;  5IE8 A;  3U50 C;  3F2C A;  3TS2 A;  5LMN L;  1M90 C;  1EIY B;  3J7A 5;  1P8L A;  4L5Q A;  1ASZ A;  4BY7 G;  1E22 A;  3I4N H;  3TS0 A;  2VQE L;  4LF5 Q;  2F4V Q;  5C44 H;  5C0X J;  2I5L X;  4NXM Q;  2YTV A;  1L0W A;  4GKK Q;  1X54 A;  3PCO B;  2AHO B;  4IFD I;  1CKN B;  1UE6 A;  1GO3 E;  3WWV A;  1KRT A;  3EIV A;  4A3K H;  4JV5 L;  3CPF A;  4X64 L;  4C3I H;  2NZO A;  4DR1 L;  4GLX A;  3T1H L;  1ASY A;  1FJG L;  4AIM A;  1HR0 L;  4JYA Q;  1VQ4 A;  3M4P A;  2D62 A;  2B29 A;  1XPR A;  3KDF A;  5LMN Q;  2R7D A;  4YWM A;  3RZO H;  1XTD A;  4H02 A;  4DAY B;  3E9I A;  1Q12 A;  2VQE Q;  3CCQ A;  2JA7 H;  1HZB A;  1N33 L;  4A3B H;  1PFS A;  3PV0 A;  1XNR L;  3S2H H;  3G48 A;  4X62 L;  1Q46 A;  2ZJR A;  2A1A A;  3TEH B;  4C3H H;  3CF5 A;  1LYL A;  1WYD A;  4DV1 Q;  2WAQ G;  3K8A A;  1EYG A;  4A93 H;  2ZTD A;  4X66 L;  3G6E A;  5M5Y H;  2QA4 A;  2E2J H;  4JV5 Q;  4A3E G;  3T1H Q;  4DR1 Q;  1QVG A;  3RLF A;  1G6P A;  1OXV A;  1WFQ A;  1Z9F A;  3LGJ A;  5IT9 c;  1HR0 Q;  3I7F A;  1FJG Q;  5C4X G;  1VQI A;  4OWX B;  3CCS A;  3J81 c;  3H0G H;  3AQQ A;  1DGS A;  4O0A A;  1UE7 A;  2PNH A;  3JC6 6;  4KI0 A;  4QQB X;  2YYZ A;  1PH4 A;  3KLW A;  1GKH A;  1KRS A;  4K0K L;  4P71 A;  1SMX A;  1IBL L;  3D31 A;  4NB3 A;  1N33 Q;  5IP7 G;  2AWO A;  3GTQ H;  4Y52 H;  1HNZ Q;  2Y0S G;  1Q1B A;  1YZ6 A;  3FHW A;  2UU9 L;  4JI7 L;  1YBY A;  1OXS C;  1Y14 B;  3PUY A;  3PO2 H;  4GN5 A;  1V9P A;  5HY6 A;  4GS3 A;  1MJC A;  4X66 Q;  2BH2 A;  2BA0 A;  3E0E A;  1G29 1;  1GD7 A;  2LXJ A;  2WP8 J;  3AFP A;  3KDF B;  3KJO A;  3AFQ A;  4UPA A;  3GTL H;  2CWA A;  2VY3 A;  1UE1 A;  5J3B A;  3GTK H;  2RHS B;  3A74 A;  2C35 B;  2Q2H A;  3G71 A;  1FL0 A;  4A3F G;  1WOC A;  1IBL Q;  4DNI A;  4K0K Q;  4GN4 B;  2OTJ A;  3U4Z A;  2K5H A;  5GAD C;  5IYC G;  4JI7 Q;  4YWK A;  1PH3 A;  1VQ7 A;  1VQ6 A;  2HHH L;  4XIG S;  1WI5 A;  1E24 A;  5GAG C;  4BBR G;  1NBW A;  4L5T A;  4GNX C;  2YTX A;  3FKI H;  2EXD A;  3L7Z C;  4GNX B;  4A4I A;  4UP9 A;  4IPG A;  4A3E H;  2R7Z G;  1CKM A;  4A3J G;  4DR6 L;  3CCU A;  1JE5 A;  1SFO H;  2DUD A;  3HKS A;  4KLK A;  1XMQ L;  4PZ6 A;  1PH9 A;  4DV0 L;  3ULP A;  3I4M G;  4NXN L;  1XNQ L;  4BY1 H;  3J80 c;  4R1J A;  2IT1 A;  2HHH Q;  3I2Z A;  2MFI A;  3RR5 A;  5FLM G;  2CCZ A;  4B3M L;  4R4O A;  1X9N A;  1XMO L;  2GN5 A;  3CW2 C;  1O7I A;  1K8A C;  4DR6 Q;  2I0Q A;  2MQH A;  2VS1 A;  4LWC A;  1IXR A;  3BZK A;  4PG3 A;  2OWO A;  3CC2 A;  1OTC A;  3S16 H;  4P75 A;  3ERS X;  1PHJ A;  3S1N H;  2N3S A;  4KHZ A;  2LSS A;  4HJ8 A;  4DKA C;  1XMQ Q;  1E7Z A;  3S14 H;  2KHJ A;  1I6H H;  3UE1 A;  1Y1V G;  2Z6K A;  4DV0 Q;  4HID A;  4NXN Q;  1KXL A;  3CCJ A;  1XNQ Q;  3F2B A;  3CPW A;  3T1Y L;  5GAE C;  1YVC A;  4OXP A;  1K73 C;  3W1G A;  4B3M Q;  1VQE A;  1QUQ A;  3M4Q A;  4BBR H;  3TRZ A;  3PO3 H;  1XMO Q;  3GO5 A;  1MIU A;  3L0O A;  3CCM A;  2NVQ H;  2MO1 A;  3J7Z C;  5GAH C;  4A3J H;  1G51 A;  3PF5 A;  1IYJ B;  1JT8 A;  5IWA L;  1N8R C;  1KHI A;  3S15 H;  2NVX H;  2H5X A;  4JI0 Q;  4LNQ A;  1CSP A;  4A75 A;  1BVS A;  1J6Q A;  3I4M H;  1B8A A;  4HJ7 A;  3T1Y Q;  4PMW A;  5IP9 G;  3JAM i;  4LF6 L;  4TQU S;  2RHQ B;  1X65 A;  5IYD G;  5C3E H;  4DR3 L;  1KC8 C;  2PI2 A;  1NMF A;  4A3M H;  2B3G A;  1E1O A;  3K80 C;  5ELN A;  2K4K A;  2I5H A;  1I3Q H;  5M3M G;  3DM3 A;  4MTN A;  1S72 A;  2Z6K C;  1JJC B;  2NVY H;  1X3F A;  2F3I A;  1K0R A;  3M9B A;  4C3J H;  5IWA Q;  1IBK Q;  1EQR A;  4B3T L;  2JA8 G;  1VQB A;  4A3D H;  1TWA H;  4DV1 L;  2LXK A;  1NY4 A;  2R93 H;  3UDI A;  2OQ0 A;  2ZTE A;  1W3S A;  3F1Z A;  3PUX A;  5JJL A;  1QUQ B;  1VS0 A;  1NE3 A;  2GVA A;  3J80 i;  3STB C;  4LFC L;  4Y7N H;  4DV2 L;  4LF6 Q;  1BKB A;  3I4O A;  5FJ8 G;  2I5M X;  4LUZ A;  5BR8 Q;  4DR5 L;  1HJP A;  4DR3 Q;  2L15 A;  3HOV G;  3I56 A;  1YNX A;  3M3Y H;  3HKZ E;  3BZC A;  4LW1 A;  3RN2 A;  3PIP A;  1Y1W G;  2B63 G;  4QL5 A;  1HNZ L;  1AE3 A;  4QJF A;  1H95 A;  1SE8 A;  4B3T Q;  2IHE A;  2IX0 A;  1Q82 C;  3S1R H;  2GVB A;  1HNW Q;  4JC0 A;  3KF6 A;  5JEA J;  1P16 A;  1Z47 A;  1YIJ A;  4DR4 L;  4A3C H;  2HT1 A;  1PVO A;  4DV2 Q;  2D0P A;  1VQM A;  3PF4 A;  5IP9 H;  4LFC Q;  1NJI C;  3CQZ H;  2JEB I;  3GD7 A;  2ZTC A;  4UP7 A;  4DR5 Q;  3NBH B;  3EN2 A;  2ZJQ A;  4GNX A;  1TXY A;  2UXD Q;  5GQO A;  3PUW A;  4OO1 G;  2VW9 A;  4OO1 I;  1HNX L;  4BY7 H;  4APV A;  4TVA B;  2AKW B;  5AJ3 L;  1UEB A;  2VNU D;  4BBS G;  4QY7 A;  2JA5 G;  4DR7 L;  1IZ6 A;  1QVC A;  3FP9 A;  1E1T A;  1GM5 A;  3HFZ B;  1Q1E A;  4A3L G;  2PQA A;  4DR4 Q;  3PGZ A;  1LTL A;  1VQA A;  2CKZ B;  3H3V I;  4JG2 A;  5JJK A;  2K52 A;  1U0L A;  1HH2 P;  1IL2 A;  1V1Q A;  5FJ8 H;  3CCV A;  3HOV H;  1YJN A;  2EQS A;  4OWT B;  3NEL A;  4BA1 I;  1HNX Q;  4JBW A;  4AYB G;  4JCV E;  5AJ3 Q;  3HOU G;  5C0X G;  5C0X I;  2WFW A;  3E9H A;  3KF6 B;  3IRB A;  1Y1W H;  2B63 H;  3JAM c;  3G4S A;  1Q81 C;  1X3E A;  5EAY A;  2UUA L;  4LF9 L;  4DR7 Q;  3GDE A;  3S17 H;  2JA9 A;  3Q8D A;  4DUY L;  4UP8 A;  3UE0 A;  4HIK A;  3RNU A;  3M7N A;  1I94 L;  4LFB Q;  3HOY G;  5C4X H;  3H15 A;  4A76 A;  4DAM A;  3U58 A;  2ES2 A;  1YHQ A;  3B6Y A;  1FGU A;  3MEF A;  1S3O A;  2JA6 G;  1LUZ A;  2UXC L;  3CCL A;  1BBW A;  5IP7 H;  4BBS H;  3HOX G;  3TRE A;  1C9O A;  1I5F A;  1YEZ A;  2PQA B;  3MXN B;  1W2B A;  2UUA Q;  4LF9 Q;  1XPU A;  2N78 A;  1EUJ A;  1B7Y B;  4XTC S;  1E3P A;  4P73 A;  3K7A H;  3M85 A;  4DUY Q;  1QZG A;  4R4T A;  1TWG H;  1AE2 A;  2NZH A;  4A3I G;  2D0O A;  1I94 Q;  4AH6 A;  1A62 A;  4JI6 Q;  2HIX A;  4YWL A;  1VCI A;  3L2P A;  4GOP C;  3H3V H;  2R93 G;  4A3G G;  4YCU A;  4JBJ A;  4L5R C;  1HZC A;  4EX5 A;  2VUM G;  4J15 A;  4IFD J;  1N36 L;  2UXC Q;  4MZ9 A;  2HIV A;  5DLQ E;  4JI0 L;  3KJP A;  4A3F H;  4LFA Q;  1WCM G;  3HOU H;  3CCE A;  3GTM H;  1JJG A;  1SRO A;  2Y0S E;  5IYC H;  3DLL A;  2VQF L;  1QVF A;  1PH7 A;  1FVI A;  3PSI A;  2JQO A;  4ALP A;  4O2D A;  4QGU A;  3CC4 A;  1XPO A;  3ICE A;  4P72 A;  2PMZ E;  3HKZ G;  5H1S E;  5M5W H;  2R92 G;  2R7Z H;  5HGQ A;  4DPG A;  5C44 G;  1SRU A;  1PV4 A;  1JJ2 A;  3CXC A;  4RG1 A;  1KIX A;  2E5L L;  3GTO H;  1IBK L;  4HIO A;  2QGQ A;  1U5K A;  1N36 Q;  3CAM A;  4UY8 C;  2E8G A;  2KCM A;  4JI1 L;  1MJE A;  2E2I H;  2UUC L;  2JA6 H;  3VDY A;  3GTP H;  1J5E L;  4NPS A;  1VQC A;  2VQF Q;  1YHA A;  4YHH L;  3CC7 A;  3OYY A;  5BR8 L;  1NTG A;  5FLM H;  4RMF A;  1PH5 A;  2ZM6 Q;  1PH6 A;  1EWI A;  4JI8 L;  1VQJ A;  4A3I H;  1R9T H;  3M4O H;  1T9H A;  2XTI A;  2JA7 G;  1EFW A;  4OWW B;  2KCT A;  4A3B G;  4IOA A;  3W1B A;  2E5L Q;  1OXT A;  2VUM H;  2KEN A;  2VZA A;  4JBK A;  4JI1 Q;  2UUC Q;  4DV6 L;  5GRO A;  4GKJ L;  1HNW L;  1SR3 A;  5ELO A;  5LMN W;  4A93 G;  1VQK A;  1Y1V H;  2HQL A;  1J5E Q;  1JMC A;  1RIP A;  4IPH A;  2PI2 E;  1VQ9 A;  4YHH Q;  1EOV A;  4GN3 B;  4DV7 L;  4P74 A;  2CWP A;  3H0G G;  2UXD L;  4JI8 Q;  3UDG A;  1JB7 A;  4OX9 Q;  4LF8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...