3KF6B

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
PLGSDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
molecule keywords Protein stn1
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6B00
1CSQA 1E3PA 5IWAQ 4A3KG 2VNUD 1WYDA 2XGTA 1FVIA 5IYBG 3PIPA 1PA6A 4A3LH 4OO1G 1C9OA 3CCVA 3GTGH 2K5VA 1K83H 3E0EA 2K75A 4DPGA 2R92G 2VL6A 1JT8A 3OTOL 2YTYA 2RHQB 1E1OA 1YITA 4GS3A 2RF4A 4JI6Q 4OWWB 3HOZG 3RN2A 1PH3A 4PG3A 1N32L 4Y52H 4DR5Q 4LNQA 3H0GG 3K7UC 3T1YQ 3PSIA 2KHIA 4BY1G 1VQLA 2R6GA 4A3GH 4IFDJ 1Y1WG 3U58A 1YI2A 4IFDG 1SR3A 1VQGA 1S3OA 2DGYA 3EIVA 2Q2UA 4JI3L 1VQCA 3GTKH 5IYCG 3M4OH 1I5FA 4QGUA 4JYAQ 1Z47A 4JI2L 1AH9A 2HT1A 4KLKA 1HR0L 3PO2H 4L5SA 1Q1BA 1X54A 2PQAA 2Y0SE 5M3MH 1KIXA 1SMXA 2VUMH 1B8AA 1HZ9A 2CKZB 4BBRG 1I94Q 2DUDA 2I5LX 2I5HA 4XIGS 2CWPA 2VQFL 1VQMA 4JI8L 5M5YH 3HKZG 3U4VA 1K8AC 4DV3Q 3IRBA 4B3RL 2QGQA 3PUYA 4JCVE 1UE1A 1MIUA 3I4OA 1IBMQ 1Q8KA 4DV5L 2Z0SA 3KF6B 3TEHB 4DR6L 3M9BA 1RL2A 2IHEA 4C2MH 4X65L 1WCMG 4MNOA 1QVGA 5C44H 5LMNW 4LF7Q 1YHAA 3PUXA 2ZJRA 2E2JH 4LFCQ 2F4VL 5K36G 2IT1A 4MZ9A 4DR1L 5HY6A 3GD7A 3KDFB 4DK6C 3NBHB 1Z9FA 5BR8Q 3KFUA 3S16H 1O7IA 4P72A 2Q2HA 4DV2L 3S1NH 4AYBE 4NB3A 1VQ6A 1SRUA 2NZHA 4DNIA 3GTLH 2R7DA 4DR7L 4K0KQ 3PUWA 4KHZA 2UUBQ 1D8LA 1KC8C 3HOVH 4BXXH 4JOIA 1EWIA 2LSSA 1PH7A 5GAGC 4DK3C 4AQYL 3HOUG 1EQQA 2OTJA 5J3BA 4DV7L 1YJ9A 3UDXA 3D31A 2K5NA 4C3HH 1QVCA 1HH2P 2AMCB 4DR5L 4KHPL 3HKZE 3E9IA 4JI7Q 3J80i 4X65Q 3CCJA 4UP8A 1SFOH 4TQUS 4HIMA 2PQAB 3I4NH 2ZM6L 1P8LA 1XMQQ 2WB1E 4DUYL 4DV4Q 3JAMc 3STBC 1MJEA 4LF6Q 2JQOA 4BBSH 3CF5A 1JJCB 3U50C 1A8VA 3PV0A 1G6PA 4BBSG 2VY3A 3KF6A 1WI5A 5LMUL 3TRZA 1PV4A 1HJPA 3TQYA 3CD6A 4HJ8A 1XTDA 1GVPA 4YWKA 3KJOA 1K9MC 3I4NG 1D7QA 2AHOB 2ALYB 2B63G 3RR5A 1UE7A 4AYBG 5M3FH 2NN6I 4OO1I 4L5RC 2LXKA 4IJHA 1NMFA 3KOJA 2ATWA 5C0XI 4JOIC 3CC2A 4X66L 4B3SL 1QZGA 4JBKA 4R4OA 3KYHC 1J5EQ 3HOUH 1EQRA 2N49A 2JA6H 1N36L 1NJIC 4QY7A 4JBJA 4X62Q 4BXXG 4IJLA 4DR3Q 2HHHL 3HOVG 2WB1G 4RMFA 2K52A 3NENA 4A76A 4B3MQ 4A3JH 5C0XJ 1PH5A 4B3TL 4IFDI 1NTGA 3M3YH 1VQHA 2V1CC 5EAYA 1YIJA 4JV5Q 1E7ZA 2MQHA 1W3SA 4GKKL 4JBWA 2JA8G 3J7A5 1QVFA 1ASYA 3M4QA 2L15A 5DLQE 2YTXA 5BR8L 1C7YA 3CMEA 1L0WA 3HOXH 1HZCA 1KAWA 1N34L 1I3QH 2MO1A 1RIPA 1WCMH 3M85A 1IYJB 2ZJQA 3PUZA 4JI1L 4MTNA 3U4ZA 1CKMA 5JJLA 2LXJA 2EXDA 3H15A 4A3IH 1W2BA 3STBD 1LYLA 2BH2A 1HZBA 1X65A 3AFQA 2NVYH 2YTVA 4PMWA 4DV3L 4BBRH 4EQ5A 4OXPA 3KJPA 5M3MG 1X56A 1FJGL 3K81C 1E1TA 4IPCA 2ZJPA 4QIWE 4DR6Q 5FJ8G 1CKNA 3B6YA 5E7NA 4X64Q 2B3GA 3J7ZC 2WP8J 3ULPA 2E5LQ 3GTJH 1UE5A 2JEBI 2N8NA 2XTIA 1VQOA 3AQQA 5IE8A 4LF5Q 3RN5A 3HOYG 3S1RH 3OW2A 1HNZL 3GTQH 4A3GG 3RNUA 4POFA 1XJVA 4GLXA 3AEVA 2MFIA 4LF9L 2KCMA 4HIDA 2PI2A 4K0KL 4YHHQ 2E2IH 3HOZH 2CQOA 3CP0A 2AWNA 2UUCL 1LUZA 1SROA 3UE1A 5M5WH 4OWXB 2R92H 4HIKA 4DR1Q 1BBUA 5IYDG 3OTOQ 5FLMG 3PUVA 4A3CH 1Q46A 2GVAA 2PNHA 2QEXA 1N36Q 3Q8DA 4NXMQ 1VQNA 2YU9H 1YVCA 3T1YL 2JA7H 3CPFA 3DLLA 1HR0W 4A3LG 4B3ML 5IYBH 5IP7H 4B3TQ 3FKIH 1XPRA 3G71A 2PI2E 3BJUA 3RZDH 3RLFA 3HFZB 2UUAQ 1HNXL 4AQYQ 2OQ0A 4IOAA 3BU2A 4JI2Q 3RLNA 1NE3A 4YY3Q 2BH8A 4A3MH 4JI5Q 3GTPH 3PO3G 4YWMA 1XNRL 2UXDL 3I4MG 2H5XA 3KDFA 1TWFH 1U5KA 1KRTA 1NY4A 1Q81C 4PZ8A 3L7ZC 5GADC 5IWAL 1X6OA 5IY0A 4LFBQ 4DR2Q 1GM5A 1PH1A 1P16A 1XMQL 4A93H 2VZAA 3PF5A 1K73C 4JI6L 5C0XG 4JBMA 1V9PA 1E24A 3HOWH 4WJ3M 4LF4L 3A5ZB 4IO9A 1K8GA 1YJWA 2R7FA 4JI0Q 4LF6L 1A0IA 1LTLA 3A74A 5JJIA 1LM0A 4QJFA 5HGQA 2UXBL 3G6EA 1HNWQ 3I4MH 4J15A 1TWAH 3S1MH 1FJGQ 4ME3A 5AJ3L 3T1HQ 4OX9L 4A3EG 1JE5A 3CCMA 1JB7A 2C35B 2EIFA 1X3FA 1J6QA 2JE6I 3F1ZA 4DV1L 2I0QA 2IX0A 2N3SA 2K50A 3NEMA 1VQKA 1SE8A 1IBLQ 2F3IA 2NZOA 4XTCS 1Q82C 3CQZH 4NXNL 2R7ZG 3FKIG 4GN3B 5IP7G 4DR4Q 2UUBL 4DR7Q 4EX5A 2B29A 1PYSB 1Y14B 4R4QA 1OXXK 4LF9Q 4A3BG 1AE2A 1M1KC 3J81j 2JA7G 1XNQL 1TWCH 4R4IA 2UXCQ 2UUCQ 5FLMH 1L1OB 1YNXA 4PZ6A 4KI0A 5IYDH 4IPGA 4AH6A 4P73A 5FLXc 3JAMi 1N34Q 4DV6Q 2WFWA 4LUOA 1XMOL 1V43A 2K5HA 3KF8B 3LGJA 1FGUA 2ZTEA 2ASBA 4GLAC 4JV5L 3CC7A 4GOPC 2OQKA 5GROA 4DUZL 1GO3E 1IBLL 4LWCA 2VW9A 2AWOA 4GKKQ 1R9TH 2JA9A 1EIFA 1CKOA 2ZM6Q 3DM3A 3HOYH 1VQ7A 1PH2A 1WJJA 2KCTA 1A63A 2N78A 3ULJA 2K14A 4P75A 1KL9A 1DGSA 3KLWA 5FJ8H 4LFAQ 4L5QA 3PGZA 1EOVA 1YJNA 4TVAB 1VQ8A 4DKAC 3HKSA 2PMZE 4LW1A 2OWOA 3BZCA 2KHJA 4C3IH 3E9HA 4X6AH 2WAQE 2UXCL 3OYYA 3F8TA 3H3VH 2UU9L 4A3DH 1PVOA 1L2FA 4A3IG 5IP9G 4P71A 4A3FH 1B70B 1HZAA 3GDEA 3PF4A 2AKWB 3I2ZA 2ES2A 1SN8A 1IBKQ 1NMGA 3S15H 3CXCA 3HOXG 3S2DH 1S40A 2VQEL 4DR3L 2HHHQ 4APVA 4BA2I 4LFAL 1VQIA 2D0OA 4LUVA 3UDIA 2I5MX 4DV0Q 2JA8H 4KHPQ 3J81i 2FXQA 4OONA 1Q86C 1Y1VG 2NN6G 1L1OC 3F2BA 3ICEA 3ERSX 5JJKA 2BA1A 2R93H 2KENA 4A3JG 3CCRA 1IBML 3A5UA 3T1HL 4OX9Q 1QUQB 3EN2A 4ALPA 2CFMA 1IBKL 1X9NA 3TS0A 2JA6G 1MKHA 4YCVA 4HJAA 1YZ6A 3TS2A 1PH4A 2A8VA 5IT9c 1N8RC 2UU9Q 3AYHB 1GKHA 3S14H 3CW2C 3RZOH 2GN5A 5M3FG 4HIOA 4IPDA 1WFQA 2B63H 2D62A 3VDYA 5C4XG 1G291 3K80C 3UDGA 1XNRQ 4GKJQ 3M7NA 1V1QA 3K0XA 2JA5G 5JEAJ 2QA4A 4P74A 1IXRA 3UE0A 2JA5H 3I7FA 1PHJA 3SGIA 2E5LL 2UXDQ 3K8AA 3CCSA 2A1AA 1PH9A 5C4XH 4JI7L 3A0JA 3M4PA 4POGA 4LF4Q 2HIXA 3FHWA 1BKBA 5GAEC 1VQ9A 4NPSA 4YHHL 3CCLA 4BA1I 4LF8Q 2MO0A 4JG2A 2NVXH 4UY8C 1YHQA 3JC66 1A62A 1EYGA 4JI4L 2UXBQ 1AE3A 2D0PA 1XNQQ 2ZTCA 1BVSA 4GKJL 2IY5B 4GN5A 1UWVA 1VQ5A 2Z6KA 4GOPA 1VQEA 2F52A 2ZTDA 1N33L 4O2DA 5M5XH 1MJCA 3CAMA 4OWTB 4YCUA 4JI5L 4C3JH 3GTMH 4NXNQ 4DR4L 2R93G 1CSPA 5GAHC 2NVTH 3CMAA 2E2HH 1WOCA 1Y1VH 1PH6A 4YCWA 1N32Q 2CWAA 5ELOA 1X3EA 3W5OA 4HJ5A 4LF7L 4LF8L 1TWHH 2ID0A 3NELA 4QL5A 4X66Q 2BA0A 1L1OA 4YY3L 2MNAA 1FL0A 1KQSA 2OTLA 1XPUA 4B3SQ 1OXSC 1E22A 4JC0A 3F2CA 1NBWA 5C44G 4DV0L 4JI0L 3FP9A 2Q2TA 1J5EL 4X62L 4DV7Q 1PFSA 1VQ4A 1HNWL 4GOPB 1S72A 1G51A 1U0LA 1YHBA 1B7YB 1VCIA 3MXNB 4UP9A 5IP9H 5AJ3Q 3ZJYC 4DR2L 1I94L 1BBWA 4HJ9A 4A3DG 2VQFQ 1JJGA 1VQAA 4UPAA 1C0AA 4NXML 5LMNL 4JI3Q 1Q1EA 3L0OA 3BZKA 4AIMA 4GN4B 3CCEA 2VUMG 1HR0Q 2IHFA 3S17H 4JYAL 3W1GA 1ASZA 2VS1A 2KBNA 4IPHA 1Q7YC 4PZ7A 2CCZA 2K4KA 4UP7A 1PH8A 3PO2G 1IZ6A 1XPOA 1KRSA 1HNXQ 1X3GA 5LMUQ 1KXLA 2F4VQ 5IYCH 3J80c 1TXYA 4FDBA 2RCNA 1OXUA 2JK8A 3I56A 4QQBX 1K3RA 4GNXA 3D0FA 4L5TA 3GTOH 1KD1C 1Y1WH 1QUQA 2E8GA 4DUYQ 4DV4L 2Q2IA 4BY1H 1I50H 1T9HA 2WAQG 4DV5Q 1UEBA 2UUAL 3H0GH 1N9WA 1VQPA 3S2HH 4H02A 2VQEQ 3CCQA 3S1QH 2GVBA 4O0AA 4JI1Q 1I6HH 2Y0SG 3UDFA 4DAYB 3TREA 1EFWA 1XMOQ 5JEAG 1YBYA 4DV6L 1OXTA 3F2DA 1OXVA 2NVQH 1UE6A 3EBEA 3G4SA 1GD7A 4DUZQ 2RHSB 4DV2Q 4LF5L 4A3FG 4IOCA 4A3BH 4LUZA 1HNZQ 4GNXB 4LFBL 4YWLA 3L2PA 3I55A 2R7ZH 4JI4Q 3H3VI 1EUJA 2EQSA 3CCUA 4A3KH 4Y7NH 2OCEA 4A4IA 5C3EG 4A3CG 1CKNB 1TWGH 2A19A 3WWVA 3K7AH 4X64L 4A75A 4DAMA 1N33Q 5C4JH 1X55A 3G48A 1KHIA 3CC4A 4A3EH 4BY7G 1M90C 1OTCA 4DV1Q 5GQOA 1JJ2A 4WJ4A 1YEZA 4R4TA 2YYZA 4JI8Q 2YV5A 4GNXC 4LFCL 1SLJA 3RLOA 1JMCA 3ULLA 4GLVB 4B3RQ 1Q12A 4R1JA 1EIYB 3HOWG 1H95A 4RG1A 4A93G 2JEAI 2Z6KC 3W1BA 3PIOA 3J81c 1QZHA 2HQLA 5ELNA 1CUKA 1VQFA 1PYBA 2HIVA 1IL2A 3S24A 3GO5A 1VQDA 2IX1A 1VQBA 1VQJA 1VS0A 4R4CA 4A3MG 3PO3H 1K0RA 4HJ7A 4BY7H 3CPWA 3MEFA 3ER0A 2JJQA 5H1SE 3AFPA 5LMNQ 3PCOB 5C3EH
chains in the Genus database with same CATH superfamily
1FVIA 1JWMD 3W3AA 3HOWB 3GTGH 2K5VA 3DWAA 1W6KA 2RSOA 3DHQA 4A93B 1SE3A 1B2TA 3J7YW 2R92G 2VL6A 3KLSX 1JT8A 2H4OA 2YTYA 4RHSA 5DNFA 1SXTA 4JI6Q 4OWWB 4QUFA 1SFOB 3T1YQ 5I6YA 4BY1G 3QG1A 1U4RA 2R6GA 3HG9A 1Y1WG 1YI2A 4IFDG 1D2BA 1SR3A 2Q2UA 3RZDB 1VMPA 2DNEA 4Y7NB 2K5QA 3M4OH 4K5VA 4RWSC 4JYAQ 1JOQA 4JI2L 1AH9A 4JVZA 1GXDC 1X3PA 3CKIB 3TP6A 4CGYB 2N55A 2Q8IB 2CKZB 2I5LX 3KBGA 1VQMA 4JI8L 3U4VA 4H44C 2QGQA 1YNJD 3I4OA 5FO7B 3S16B 1Q8KA 4DV5L 1S5ED 2OF1A 3FPUB 1RL2A 5C6AA 4G4KA 2PYKA 4BY1B 5I4DA 5C44H 4LF7Q 1QE6A 1PFMA 2ZJRA 4C2MB 5K36G 2IT1A 5T1IA 1TWAB 3GD7A 4XT1B 4DK6C 3KFUA 1EY0A 3S16H 2Q2HA 4JPBW 4NB3A 1VQ6A 5ELFA 2NZHA 3CU7A 5CV9A 1LT3D 1I4XA 3GTLH 2F0MA 3M4YA 2A74C 1D1KA 4JOIA 4DV7L 1NSNS 3IL8A 1VMCA 1GUOA 4JI7Q 2WAQB 3CCJA 1WVLA 1SFOH 4TQUS 4HIMA 1P8LA 2E75C 1D5ZC 4LF6Q 1O7LA 3CF5A 3U50C 4BBSG 4X3SA 2B2UC 1I6HB 1XTDA 1D7QA 4RGNA 4AYBG 2NN6I 2LXKA 3KOJA 2ZT9C 4JBKA 2RKSA 3HOUH 3EROA 5C3XA 3NBIA 4JBJA 4BXXG 5DM73 2H1EA 3OOCA 1AEXA 5M9OA 4H0LC 4EVOA 3M3YH 4JV5Q 1YIJA 1RD9D 4XQQA 2RCFA 1EQVA 1QVFA 3GTKB 4IN3A 3CMEA 1BNZA 1L0WA 3S14B 2AUJD 4ZYSA 1WCMH 4B08A 2WINB 1IYJB 3U4ZA 4QIWB 4A3KB 2EXDA 1W2BA 4ID6A 3AB9A 1CHPD 1HZBA 2F0OA 1X65A 1L0YB 4PMWA 3V2TA 1SMYC 1FJGL 4ZAIA 2ZJPA 2R92B 4KD4A 2E5LQ 1TQOA 2N8NA 1GOZA 2L11A 5IE8A 4LF5Q 3RN5A 2DNCA 1HNZL 4CKCA 3OW2A 3GTQH 1EU3A 3RNUA 4DNTB 3AEVA 2MFIA 4LF9L 2K1BA 4EQOA 5KEEA 4YHHQ 3HOZH 2F0VA 2CQOA 5JPNC 4ZUJA 1DONA 3UE1A 2LKVA 2R92H 1WD0A 4HIKA 3DM1A 5FLMG 2RVLA 3PUVA 2GVAA 2PNHA 1HFGA 1F2YA 1DM0B 3CPFA 1HR0W 4B3ML 3FKIH 3SXHA 4BS9A 3N52A 1Y8NB 2XRQD 1XTCD 1SYDA 5DM63 4AQYQ 3BU2A 2QW7A 4F87A 5CYUA 1A3TA 4DAVA 1TWGB 5KGUA 3AU7A 4A3MH 3PO3G 4CKEA 1XNRL 3I4MG 1KAAA 3JAML 5FK9C 1ENCA 3KDFA 1Q81C 4P2CB 1Q3LA 4LFBQ 5C0XH 1GM5A 4WJ3M 1H9KA 1V9PA 1UEAB 2QDBA 4IO9A 1K8GA 1LTLA 3I4MH 4J15A 2F0TA 1FJGQ 3EFXD 2F0EA 1PRTD 5KIXA 3VR6A 2EIFA 1J6QA 4RGTA 1IBLQ 2NZOA 1DZ1A 3NQTA 1EYDA 4GN3B 2UUBL 1Y14B 3NTHA 1OXXK 1TWCH 5JEAH 4IPGA 4KK7A 4P73A 1A3UA 3JAMi 5IGBA 1GUGA 2PZUA 3M7GA 1RKNA 5DAUA 1HXYD 1RTNA 2K5HA 3LGJA 4JV5L 2J4XA 2ASBA 4AYBB 4GLAC 5GROA 4LWCA 4ABNA 3RZOB 2AWOA 1R9TH 3DM3A 1XX8A 4K2KA 5ELEA 1SNPA 2K14A 1I4HA 2QF7A 1H9MA 5FJ8H 1I4QA 3H94A 1YJNA 4HR7B 4DKAC 1BO0A 3HEJA 4LW1A 1B1ZA 1EYAA 5CV8A 1DOMA 3OYYA 4DNRB 1PVOA 2A68C 3TDQA 3SVMA 1G91A 3D6WA 1SMYD 3I2ZA 2ZXPA 4FF4A 2VQEL 2F0NA 2A69D 1WTWA 3DEOA 3VYSA 1EY7A 2ENBA 1CTMA 3EJIA 4PV1C 4S3SA 4XYOA 1Y69U 2JA8H 4KHPQ 4OONA 1L0XB 2NN6G 1S5FD 4HN7A 3ERSX 5JJKA 3FMCA 2EYHA 3T1HL 2OT2A 3MFGA 3EN2A 4RH6A 1X9NA 2CW0D 1YZ6A 2Z4IA 4OGQC 2CQAA 3HS0C 2L4NA 1N8RC 3U9SA 3HOXB 3K7AB 1PTOC 1NCVA 3MTSA 4HIOA 4IPDA 1WFQA 2F03A 3VDYA 4M8AA 3K80C 1LTBD 4GKJQ 5E4XA 1V1QA 3K0XA 1SYEA 1IXRA 1II3A 3SGIA 3D4WA 1UUPA 3S1NB 2A1AA 1PH9A 3DEPA 1H9SB 1FD7D 3A0JA 1MGSA 1B53A 4DK1A 1BKBA 1PZKD 1O80A 2MO0A 3K57A 2F0JA 3S1RB 1VF5C 1BVSA 1QB5D 1UWVA 1VQEA 2ZTDA 1GHJA 2E2DC 4O2DA 1JQYD 3CAMA 2SEBD 3BS1A 4K2LA 4O1NA 2ZXRA 1TR5A 3IKJA 5KYIA 3FRPB 1CSPA 5KNDA 4XYQA 1WOCA 1JC7A 5ELOA 1AP0A 2SNMA 4HJ5A 1EIGA 1HA5A 3NELA 3A8JE 2OTLA 1QWYA 2A5HA 1XPUA 4B3SQ 1V1OA 1E22A 4DV0L 1NBWA 3N6RA 4HAEA 3FP9A 2Q2TA 1AZQA 4DV7Q 1PFSA 4OIJA 5IP9H 1B7YB 4UP9A 3ZJYC 4DR2L 1BBWA 4A3DG 1JJGA 3QIAA 4UPAA 1VDZA 1FNVA 2ICIA 3ITPA 1DYQA 1Q1EA 1NAPA 2L0CA 3EA6A 3L0OA 1ZYRC 3BZKA 5EPKA 3PIP3 3GTLB 1W6JA 2IHFA 2J7ZA 4RAUC 3W1GA 2VS1A 1Q7YC 1H9SA 4PZ7A 4G7HC 1KRSA 3NWTA 3J80c 3A55A 4FDBA 3I56A 2JK8A 3D0FA 4L5TA 1Y1WH 4IFDH 2E8GA 4BY1H 1I50H 1T9HA 1JCKB 2WAQG 3BG3A 3H0GH 1VQPA 3S2HH 2GVBA 4O0AA 2A69C 1F9PA 4C3IB 3TREA 1YBYA 3MXUA 4DV6L 1EEID 2NVQH 1UE6A 4DV2Q 4OO1H 1MSGA 2B8FA 3L9AX 5CBAE 1TWFB 3H3VI 2EYLA 1I4PA 1EUJA 5E1FA 4Y7NH 5C3EG 4A3CG 2R61A 1XWEA 5EBCA 4X64L 4DAMA 3T51B 4C56C 2CW0C 3TZDA 3CC4A 1M90C 2NWGA 3DUZA 4JK1C 5ISRA 4B3RQ 1PTOD 5AFWA 3P7JA 1HFNA 2HQLA 1HUMA 1S5BD 1LABA 3H3VC 1SNMA 1EEFD 1STEA 3S2HB 1VQJA 1VS0A 4FF3A 5KYLA 4BY7H 3MEFA 2RA4A 3AFPA 5LMNQ 5C3EH 3K0YA 5CMDA 4A3CH 1CSQA 5IWAQ 4A3KG 4DFAA 3K5MA 5BN4A 3T13A 4RGOS 1K83H 2DY8A 3A54A 4BBRB 1D5MC 3S9WA 4DPGA 1Z7TA 5IT9L 3J7AV 4E6IA 2RHQB 2RF4A 2D2CC 2HUGA 1N32L 2MGSA 3BZDB 3H0GG 1TT2A 2KHIA 3TP5A 4A3GH 5EJWA 1VQGA 3EIVA 1S3OA 2L12A 1NUCA 5IYCG 4L6TB 2I46A 4KN7C 2HT1A 1ZKOA 5ELCA 2X6LA 3PO2H 1X54A 4TRDA 2Y0SE 2VUMH 1SMXA 2E76C 4BBRG 1I94Q 1I4RA 1S4ZA 1JOKA 2I5HA 5M5YH 2EJGC 1LT6D 3HKZG 4DV3Q 4B3RL 1I6VC 1UE1A 2XWJB 1MIUA 4ILWA 1ZYRD 3TEHB 4QUCA 2Z4HA 2IHEA 4DAPA 1QVGA 5LMNW 3J80E 3GTOB 2E74C 3X3NA 4DR1L 3KDFB 5BR8Q 4J6HA 4CDDC 1O7IA 3S1NH 4AYBE 2KUMA 1Z6HA 3PUWA 2K03A 4KHZA 2UUBQ 1D8LA 2B2YC 1KC8C 4NW2A 1PH7A 4DK3C 2OTJA 2B63B 3UDXA 3D31A 5IGDA 1KLGD 3NE5B 2F0DA 1D1IA 1PTOB 4DN4M 1QVCA 3HKZE 3E9IA 2AUKA 1TY2A 4UP8A 2PQAB 1XMQQ 4M1UB 3JAMc 1MJEA 2JQOA 2NBFA 4FXKC 4BBSH 5A35A 1JJCB 1A8VA 3PV0A 2BCOA 2VY3A 1WI5A 4TKOB 3WOFA 4MTKA 3TQYA 4F7XA 4HJ8A 3T4AC 1GVPA 1STBA 2ALYB 2B63G 3MA2B 3RR5A 5M3FH 3UI2A 5IGEA 5C0XI 4XQJA 4X66L 4B3SL 3S1MB 4RKLA 1HTPA 1HHVA 4X62Q 1EOTA 4DR3Q 2HHHL 2WB1G 2K52A 3NENA 4A76A 1R4QB 4B3TL 2B2TC 1VQHA 5EAYA 1FR3A 3I73A 1W3SA 4GKKL 4JBWA 1G2SA 2JA8G 4H13C 5A2QL 3J7A5 5LHY1 1ASYA 1CHQD 3M4QA 1C7YA 3R93A 3Q6SA 1I3QB 1C48A 2LY7A 1HZCA 2RBMA 3HP3A 1I3QH 2MO1A 4U68A 1UNSA 2RDFA 1BF4A 3H6MA 4K14A 3PUZA 4JI1L 1CKMA 3I90A 4A3IH 2FINB 1LYLA 1H9RA 2B8GA 2HDLA 3PQIA 3VR3A 2L5TA 5M3MG 3K81C 3L3OC 2PCFB 1QOHA 3GV3A 3MVVA 1NR4A 2KEDA 3ULPA 4H7BA 2IL8A 2UXDL 1UE5A 3NXWA 3ERQA 2XTIA 2KEEA 4PMCA 2WIIB 1I50B 4KY7A 1KDBA 4POFA 5L37A 3RUZA 2E2IH 1SYGA 4HSVA 1LUZA 2PQEA 1O7ZA 1SROA 5CV4A 1B50A 1PRTF 1TS3A 3OTOQ 3VYTA 2MP1A 4UDUC 1G6ZA 5M3MB 2QEXA 4NXMQ 3Q8DA 2YU9H 1YVCA 2FMMA 3T1YL 1EWHA 5IYBH 5IP7H 1MD2D 5CV5A 3KLRA 4QF4A 3BJUA 3RLFA 1HTLD 1JB3A 2OQ0A 5LL6S 3NPPA 5FO9B 1HQRD 4YY3Q 5J22A 1A15A 3IAYA 3VR4A 3GTPH 2B2WA 4KTAA 3D6CA 3CRLC 3Q0AA 2NUCA 3R2IA 4PZ8A 5IWAL 1X6OA 3I70A 4WFN3 4DR2Q 2SNSA 3QR8A 3PF5A 2BDOA 5E4WC 3HOWH 4JBMA 3GTMB 3DWQA 2R7FA 1A0IA 1BQQT 1IW7C 3C1FA 1RCVD 3OSOA 5JJIA 5HGQA 1HNWQ 3T1HQ 2SDFA 3BVZA 4KY6A 2DY7A 3K6OA 4DV1L 1QNKA 3F1ZA 2IPKD 1SE8A 4XTCS 4FYDA 1Q82C 1EY8A 3CQZH 3NQIA 3FKIG 1EIHA 5IP7G 2B2YA 3DMUA 1PZJD 4A3DB 2PW5A 2B29A 1UAPA 4R4QA 3EQLC 2LS01 1XNQL 4R4IA 2UXCQ 2UUCQ 1WTVA 1L1OB 1SYCA 2EOTA 1QILA 1J8IA 1CI3M 4LUOA 5EGTA 1GO3E 1IBLL 1GHKA 5I6WA 2IJ0A 3J81E 4RHRA 1EIFA 1CKOA 5I9PA 2ZM6Q 3HOYH 4LJZC 4DGZA 1WJJA 2NZ1D 4IUQA 1F2LA 3H09A 3ULJA 4P75A 1V8QA 2K04A 1KL9A 1LACA 1GUWA 4L5QA 2ICEC 1ICWA 2YU9B 1EOVA 1VQ8A 1T5XD 2L1BA 3QJYA 1K83B 4XDXA 2PMZE 1XXGA 4A3JB 3BZCA 4B9WA 4RFBA 2JA6B 1TIID 4CDFC 1L2FA 2E2IB 2XIWA 4IUPA 1T5EA 5C3EB 2ES2A 1IBKQ 4IZ8A 3I72A 4L63B 3DWPA 2FXQA 1BCPC 3ONAB 5IGCA 2KENA 3CCRA 1IBML 4DF7A 4N8X1 1QUQB 1GJXA 1TS2A 2JA6G 3TS0A 3TS2A 1MKHA 4I7AA 1LT4D 2K7VA 5F2DA 5I2YA 3AYHB 1GKHA 1SDFA 3RZOH 1KNEA 3ZYYX 2DN8A 2PZTA 5NUCA 5M3FG 3D3RA 2BE5C 4F8MA 1KDCA 1G291 3OW7A 4KKUA 2F0UA 3TP7A 2KCNA 2M9VA 3M7NA 2Q8TA 2QA4A 4P74A 2K28A 3I7FA 4KN4C 3CCSA 4ZKCB 1AZPA 2O5JC 4JI7L 3H0GB 2HIXA 3J81L 2F3WA 5E3FA 2NVXH 4UY8C 1YHQA 3JC66 1AN8A 2IW3A 2UXBQ 1AE3A 2D0PA 1TY0A 2ZTCA 5M3FB 4GKJL 5C3WA 1VQ5A 2Z6KA 2A6ED 3BYTB 2F52A 3NHHA 1N33L 1ESFA 1JWSD 5M5XH 3H91A 4C3JH 3TBIB 5KNBA 5GAHC 2NN6H 2KVMA 1B44D 2PNRC 4HCEA 3W5OA 2VB2X 2BA0A 1L1OA 3F2UA 1KQSA 2VB3X 3D4DA 2K5DA 3F2CA 1CQVA 1B9NA 1O7YA 1PXUA 1HNWL 2XSCA 3MAQA 1S72A 1KABA 1YHBA 1EL0A 3MXNB 1VQAA 4JI3Q 1G2TA 2Z8LA 3GTGB 4IPHA 1LTRD 2K4KA 4UP7A 3NTIA 1IZ6A 3KK7A 1HRJA 3C1EA 2RCNA 2EXZA 5JAVA 1Q90A 2FFKB 1M8AA 4XT3B 4LK1C 2Q2IA 3ND8A 4DV5Q 1UEBA 1N9WA 4U673 4H02A 2HCIA 2F0SA 3WDNA 4JI1Q 4CJ2C 5EKIA 1XMOQ 3RD4A 2B2VC 3F2DA 3EBEA 3G4SA 1IYVA 1K8MA 1GD7A 2G5DA 2QDLA 4A3BH 4LF5L 1BCPD 4X3TA 1HNZQ 2KA7A 3HZXA 3KUPA 5C4HA 1ET6A 1CKNB 2A19A 2NB0A 4A75A 4DA2A 5C4JH 2OXPA 3ND9A 5JOBA 4A3EH 4BY7G 3TZUA 1ONLA 4QB4A 1YEZA 2CVRA 2XNAC 4R4TA 5J39A 3ULLA 4GLVB 1Q12A 3A7AB 4RG1A 2VXWA 1BOSA 3W1BA 2N88A 5CV7A 5CORA 1IL2A 2SOBA 1VQDA 3G7LA 1EY5A 4BY7B 3R8BA 3PCOB 2B2VA 4A4IA 3C3LA 1ILPA 5D65A 2VNUD 4O42A 1E2ZA 1DCZA 1KLUD 3PIPA 2F0PA 2C5CA 1TU2B 3MEHA 1C9OA 3CCVA 3V05A 2K75A 2A6EC 1WTHA 3OTOL 5EKLA 2KCCA 1E1OA 2C9OA 3HOZG 3RN2A 4PG3A 5C5LA 3GTPB 2KJXA 2CHBD 1LLRD 1WCMB 1QG7A 4IFDJ 1DXMA 4ODGA 4JI3L 3GTKH 1I5FA 4QGUA 1Z47A 4LAAA 3QWNA 4KLKA 1HR0L 4L5SA 2PQAA 3D8GA 5M3MH 1KIXA 2NVQB 2DUDA 3SK6A 3OPOA 1PZID 4XIGS 4C3JB 3PIO3 3J80L 3IRBA 4JCVE 1SNQA 4PQXA 1IBMQ 3HOUB 4NDXA 3OIPA 3M9BA 4CHTB 4C2MH 4X65L 4MNOA 1ZXTA 3I3CA 3I4LA 3G6JB 1YHAA 3PUXA 2E2JH 3GTJB 3NBHB 4P72A 4Z9CB 5EQ0A 2F0GA 2HQEA 1JICA 3HOVH 2TMPA 4BXXH 3HKZB 1EWIA 5GAGC 5FOBB 4AQYL 2K5NA 1DD2A 1BDOA 1HH2P 2AMCB 4ZQ3A 4DR5L 4KHPL 3J80i 4X65Q 2K05A 2B39A 1EWCA 2EDGA 3P75A 3BDLA 2ZM6L 4DV4Q 1LV9A 1QJOA 1STAA 4KMUC 2M00A 4IUUA 3HOVB 4MN3A 3MXNA 1G6PA 3KF6A 4F88A 1PV4A 1HJPA 3CD6A 5D3IB 3KJOA 1K9MC 1E2VA 2AHOB 2EY1A 1UE7A 4OO1I 1FNUA 2K6AA 1A2TA 3S2DB 2ATWA 4JOIC 4KY5A 3CC2A 2KOLA 2HDMA 2EZVA 1QZGA 4R4OA 1PRTB 3KYHC 1J5EQ 2JA6H 1MBYA 1N36L 1QCBD 4QY7A 1TS5A 1NJIC 4IJLA 4B3MQ 2X6GA 4HCSA 4A3JH 5C0XJ 4IFDI 1NTGA 2NVYB 2V1CC 2WV6D 1E7ZA 2MQHA 1DOLA 4FVMA 1IKMA 5ELBA 5LL6X 2L15A 5DLQE 5BR8L 1MSHA 4N8FA 3NSWA 1KAWA 3HOXH 1N34L 1PTOH 1RIPA 3M85A 4KKSA 4MTNA 1SSOA 2LXJA 3H15A 3STBD 2BH2A 1BR9A 2F0LA 2NVYH 2PZWA 2WB1B 4DV3L 3IFTA 4EQ5A 4OXPA 1X56A 1E1TA 5M5WB 4DXGA 4DR6Q 4I7ZC 5FJ8G 1WTXA 4R8IA 3B6YA 5E7NA 4X64Q 2JA8B 4HEDA 3J7ZC 1VQOA 2JEBI 1IW7D 3TSSA 4CJ1B 1LTSD 3D4RA 3S1RH 4A3GG 1XJVA 4GLXA 2EYOA 2KCMA 2WACA 4HIDA 4G7ZC 2PI2A 4RKBA 4OIKA 3CP0A 2UUCL 1AFPA 4KD3A 4NKLA 5M5WH 4OWXB 1BBUA 1Q46A 2JA7H 1PFNA 2OEOA 4B9XA 3DLLA 2QEJC 4B3TQ 1XPRA 3G71A 2PI2E 3A8KE 3VYRA 4A3EB 2UUAQ 4A3GB 4XQNA 1NE3A 4YWMA 5FLXE 2R7ZB 1RF2D 4MIUA 2NYZD 1F2ZA 2JN4A 3L7ZC 5GADC 2E2HB 1K0SA 4RGMA 1F9RA 1TWCB 1EQTA 5K5PA 1E24A 2EJMA 4LF6L 2FJ2A 3MXGA 1PTOF 3A74A 4QJFA 4V190 1J9OA 3E3XA 1TWAH 1RHPA 4ME3A 5AJ3L 4OX9L 4A3EG 2EY2A 3HGBA 3LWEA 4IURA 1JB7A 2C35B 2JE6I 3S15B 3TP8A 2NVXB 2N3SA 1VQKA 2F3IA 4DR7Q 1F9SA 4EX5A 1PYSB 4A3BG 1AE2A 3Q24A 5FLMH 1YNXA 4PZ6A 1BCPB 1PLFA 2EY5A 4N9TA 5J1ZA 1N34Q 4DU9A 3OMGA 1XMOL 4A3IB 3M4OB 5FO8B 2ZTEA 1PMRA 4YIJA 2VW9A 2JA9A 2MUYA 1TKWB 1VQ7A 1G8ZD 2KCTA 3SK8A 2N78A 2RDGA 2KHSA 3FKIB 3FDTA 1V1PA 4QCLA 2BE5D 3PGZA 3K5LA 4TVAB 3HKSA 3LNNA 2KHJA 4C3IH 3E9HA 4X6AH 2K32A 5M5XB 4ZKBB 3H3VH 4G7OC 1CFMA 4A3IG 5IP9G 4P71A 3PF4A 3SE0A 3C2PA 1EU4A 1NMGA 2RDHA 3S15H 3CXCA 2B2TA 1LTGD 4NP5A 1NNXA 4WJWA 4DR3L 4APVA 2HHHQ 4LFAL 1VQIA 4NMZA 4LUVA 2A6HC 3UDIA 2I5MX 2EYJA 1Q86C 1Y1VG 1L1OC 4CDEC 1GUTA 4A3JG 1HQMC 1A6XA 1WTPA 1BCPF 4ALPA 4ZRZA 1HPCA 4YCVA 4HJAA 1PH4A 3VA7A 4ULLA 1SNCA 2A8VA 5IT9c 4A3MB 3S14H 1U4LA 3CW2C 1FYCA 2GN5A 4KJNA 2B63H 4IUVA 3UDGA 1XNRQ 1FNWA 3OWFA 3K5NA 3E0JA 1EYCA 2EYMA 2BOSA 1D5XC 2R93B 1PHJA 1ET9A 4RCOA 1CA5A 4FP5D 3SDZA 2UXDQ 2WKDA 3K8AA 2PMZB 3CHBD 2IWHA 5C4XH 3M4PA 3BYYB 3FHWA 5GAEC 3EVQA 4PNYA 1VQ9A 4NPSA 2CH4A 3CCLA 4BA1I 4LF8Q 3R2TA 4JG2A 4C3HG 1A62A 3VR2A 4V0BA 1Y8PB 1EYGA 5CGKA 4DK0A 4GN5A 1JE4A 4Q0FA 4DXFA 3BVMA 4YCUA 3K58A 3TMEA 3GTMH 4N9PA 2R93G 2V4DA 2NVTH 3CMAA 2B2WC 1N32Q 2O4XA 1PH6A 2CWAA 1O78A 4IUNA 1CA6A 2ID0A 4QL5A 1RTOA 2J0TD 4FNFA 4X66Q 4YY3L 2MNAA 1X3QA 1STHA 4JC0A 5C44G 2QILA 1MHWC 5IGGA 4X62L 3A8IE 1G51A 1U0LA 3FVQA 5AJ3Q 1VCIA 3FPPA 1JOOA 4A3FG 1I94L 5EPJA 2XWBB 4HJ9A 1X32A 2VQFQ 2F0HA 1C0AA 2HD3A 4NXML 2Y0SB 3PMFA 1XYIA 4ZK9B 4GN4B 2VUMG 4EQNA 1HR0Q 3S17H 2PPBC 2KBNA 1SYBA 2CCZA 1PH8A 3PO2G 4ZLTF 1HNXQ 2F4VQ 5IYCH 1TXYA 1OXUA 1CZWA 1SYFA 2Z6BA 4GNXA 5C44B 1QUQA 1U4PA 4DUYQ 3KLSA 1D6EC 5CR3A 1IL8A 5CBEE 2UUAL 2L9HA 4X3KA 2VQEQ 1IHZA 2P5ZX 5JVH3 5ELDA 1I6HH 2Y0SG 3UDFA 1EFWA 1RDPD 1RJTA 2QCPX 1OXTA 2A6HD 1LT5D 4DUZQ 1MI2A 5IT9E 4GNXB 4LFBL 4YWLA 3L2PA 4JI4Q 1K8OA 2EQSA 2IX3A 4R9WA 1SJED 1TS4A 1HA6A 5T1GA 3Q23A 2F4IA 4DAYA 1N33Q 3G48A 1KHIA 4GZYC 1A2UA 1OTCA 1YNNC 5HURA 1JJ2A 5GQOA 4WJ4A 1LO5D 2YYZA 4GNXC 1SEBD 1JMCA 1SLJA 4R1JA 1H95A 3Q22A 5I9OA 4A93G 2RQXA 3P1HA 2EYPA 3PIOA 3J81c 4WRDA 5ELNA 1CUKA 1VQFA 3S24A 3GO5A 3KF8A 2IX1A 1VQBA 2TSSA 4A3MG 3PO3H 1K0RA 2K33A 3MFYA 1E3PA 4WORA 1WYDA 2XGTA 5IYBG 1PA6A 4A3LH 4OO1G 2NTSA 3RMHA 1HCZA 2EY6A 3E0EA 4OEMB 1F77A 1CZGA 3GV6A 2JYOA 1YITA 4GS3A 1FGBD 1PH3A 2EJFC 5IODA 4DR5Q 3VYUA 4LNQA 3K7UC 3PSIA 5JPMC 1VQLA 4C3HB 3U58A 2DGYA 3QB3A 1VQCA 4MHEA 2F0QA 1JWUD 1CT1D 3K5OA 4FF2A 1Q1BA 1RODA 2XVSA 1C4QA 2HCCA 1B8AA 1HZ9A 2F0FA 4Y52H 2VQFL 2CWPA 1K8AC 3PUYA 1LTTD 3LX0A 3CQZB 3QOLA 3HOZB 1SNDA 2QKIC 2Z0SA 3KF6B 3MXPA 3TN2A 4DR6L 2CH4W 5IGFA 1LTAD 1S5CD 1WCMG 3A56A 2RSNA 3GTQB 3SK5A 4LFCQ 4IQZA 2F4VL 2XRSD 4MZ9A 4EGVA 5HY6A 3R3OA 1A3VA 1Z9FA 4KHVA 4K8IA 2O2LD 4DV2L 4CJ0B 1SRUA 4DNIA 1WTOA 4DR7L 2R7DA 4IUTA 3AMUA 1DJRD 4K0KQ 2O5IC 4BBSB 3WOEA 2G9DA 4C3JG 3PO2B 2LSSA 3OIQA 3HOUG 3I4NB 1EQQA 3W2DA 5J3BA 1YJ9A 2EYFA 4JW0A 1SBBB 4TSSA 1K3BC 5C5MA 1CK1A 2AQ3B 4C3HH 1F2MA 1BUVT 2KQ3A 4ME5A 3I4NH 4HSPA 4IALA 2WB1E 4UHVA 4DUYL 4RA8A 2D9UA 4A3BB 5EPLA 3STBC 1YNND 1IKLA 5LMUL 1YNJC 1AW7A 1E2WA 4K6LA 3TRZA 3S1QB 4HTHA 1JORA 4YWKA 3I4NG 5G3LF 4J8QA 1ESRA 2JXMB 5C4ZA 4L5RC 4IJHA 1NMFA 5CV6A 1SE4A 1EQRA 2N49A 3HOVG 4RMFA 1PH5A 2FMCA 2FHTA 5COYA 4FXDA 1ICFB 2YTXA 1HUNA 5JVG3 5HGTA 1R9TB 2BDNA 2ZJQA 5JJLA 3C46A 1TWHB 3VR5A 1SJHD 1QNUA 2A73B 3AFQA 2YTVA 1R4PB 4BBRH 1GUNA 3KJPA 4IPCA 4QIWE 2Z1CA 1CKNA 2B3GA 4Q5VA 2WP8J 3GTJH 2JSOA 1U9RA 3AQQA 3QOJA 3HOYG 3URYA 1STGA 3I4MB 3P20A 4K0KL 2AWNA 4DR1Q 5IYDG 2JA5B 2MJ8A 5EBDA 2AQ1B 1N36Q 1VQNA 2MHVA 1EZ8A 4K6DA 1SE2A 2K5WA 4J1MA 3NWSA 4C1NK 4A3LG 5FLXL 2JP1A 5IIFA 1KTKA 2LFNA 3RZDH 5DEHA 3HFZB 4FF1A 1HNXL 3T56B 3HOYB 4IOAA 4FXGC 2Q8RE 4JI2Q 3RLNA 1KNAA 2F0WA 2K01A 1SNOA 2BH8A 2X69A 3T16A 3U9OA 3X3MA 4JI5Q 5FKAC 2H5XA 2EPBA 1TWFH 1U5KA 1KRTA 3J7AF 1NY4A 4BWGB 1STNA 5IY0A 3I8ZA 2JA7B 1BXTA 4OELB 1B3QA 2NVTB 1PH1A 1P16A 1Q8IA 2M2LA 1XMQL 1BBXC 2VZAA 4A93H 1K73C 4JI6L 5C0XG 3JAME 1EY9A 4LF4L 3A5ZB 2LMCB 1YJWA 4JI0Q 2DJFC 1H9JA 1LM0A 2UXBL 3G6EA 3S1MH 1JE5A 1TVXA 3CCMA 4RCNA 1SAPA 1X3FA 1GUSA 2I0QA 2IX0A 2K50A 3NEMA 1WTQA 2KECA 4A3FB 1B3AA 4NXNL 2R7ZG 4DR4Q 1I4GA 3MC0B 4LF9Q 2JA7G 4OHJA 3J81j 1M1KC 3S17B 3T53B 2G9HD 1U4MA 4X3UA 4KI0A 3OWEB 5IYDH 4AH6A 5FLXc 2EE1A 4DV6Q 1EZ6A 2WFWA 1EY4A 4R8NA 1WD1A 1V43A 3KF8B 1FGUA 3CC7A 4GOPC 2OQKA 4DUZL 1B4OA 5C4JB 4GKKQ 2MPMA 1PH2A 1A63A 5I2XA 4L8JA 5A2QE 1DGSA 3KLWA 3I91A 4LFAQ 4CBVA 2OWOA 1LTID 2WAQE 2Z9HA 2UXCL 5KRUA 3F8TA 2NTTA 2UU9L 4A3DH 1PRTC 1DOKA 3E5SA 4A3FH 1B70B 1HZAA 3MWYW 3GDEA 2AKWB 1SN8A 2GA4B 3V96A 2XN9C 3VA5A 3IFDA 3HOXG 1S40A 3S2DH 4BA2I 2D0OA 2DJGC 4CKBA 5C4XB 4DV0Q 3J81i 2F0IA 3F2BA 3NUCA 1S5DD 3ICEA 2BA1A 2R93H 3FEWX 3A5UA 1ZEQX 4OX9Q 5G3LD 1IBKL 2CFMA 3O13A 5JJZA 3GQBA 4KV6A 1WTRA 3NP8A 2UU9Q 2B2UA 4CDCC 1ENAA 5D3DA 2D62A 5C4XG 3A7LA 1Y1VB 2JA5G 5JEAJ 3UE0A 2JA5H 1KDAA 2A68D 2WKCA 2E5LL 2D5DA 1K28A 2PO4A 1PYWD 5KNCA 4POGA 2AQ2B 3BDOA 4LF4Q 1IYUA 4YHHL 2E2JB 3NK9A 4EQPA 1Y1WB 4JI4L 3PO3B 1C8CA 2IY5B 1XNQQ 3QO2A 4G57A 4GOPA 4K8JA 3GP7A 5EKKA 3MHBA 1MJCA 4OWTB 1EFID 1ML0D 4JI5L 4QMGA 4NXNQ 3SEBA 4FO2A 4DR4L 1CQFA 2E2HH 1Y1VH 4YCWA 2PW7A 1X3EA 4UAIA 1CM9A 1OO9B 4LF8L 4LF7L 1TWHH 1FL0A 5K36H 5D14A 1OXSC 4JI0L 4XXEA 1J5EL 1VQ4A 1E0BA 4GOPB 2R3ZA 4C1NI 5IOCA 2F1MA 5LMNL 4HMJA 5BN3A 3HRZC 4C3IG 5CC4A 4AIMA 3DXJC 3CCEA 4JYAL 2EVBA 3NTKA 2F3VA 1ASZA 2F0KA 4ZCKA 2I07B 3OHXC 4PMBA 1XPOA 1X3GA 5LMUQ 1KXLA 3KBXA 3E6ZX 4QQBX 2L55A 1K3RA 3GTOH 3LWUA 4K5XA 1KD1C 2ZXOA 1NR2A 4DV4L 4OL7A 3SR1A 4KKTA 5BN5A 1ENFA 3CRKC 3CCQA 3BDCA 3S1QH 3SHLA 5M5YB 4DAYB 3NBHA 5JEAG 2VUMB 1OXVA 4ZUIA 4I65A 2RHSB 3BVGA 4IOCA 4LUZA 3I55A 2R7ZH 3CCUA 4A3KH 4KJOA 2OCEA 1VF7A 1TWGH 3WWVA 3K7AH 1Y8OB 1X55A 3MZ5A 4HMIA 1PFBA 4DV1Q 1V1PB 4JI8Q 2YV5A 3SK4A 5TSSA 4LFCL 3RLOA 4LMQD 3M3YB 1EIYB 3HOWG 2JEAI 2Z6KC 1EY6A 1JR0D 3K59A 1QZHA 1B9MA 1PYBA 2HIVA 3OMCA 1STYA 1PDQA 4R4CA 4HJ7A 3CPWA 1F9QA 4K5WA 3ER0A 1ILQA 2JJQA 5H1SE 1M4VA
chains in the Genus database with same CATH topology
1CSQA 1E3PA 5IWAQ 4A3KG 2VNUD 1WYDA 2XGTA 1FVIA 5IYBG 3PIPA 1PA6A 4A3LH 4OO1G 1C9OA 3CCVA 3GTGH 2K5VA 1K83H 3E0EA 2K75A 4DPGA 2R92G 2VL6A 1JT8A 3OTOL 2YTYA 2RHQB 1E1OA 1YITA 4GS3A 2RF4A 4JI6Q 4OWWB 3HOZG 3RN2A 1PH3A 4PG3A 1N32L 4Y52H 4DR5Q 4LNQA 3H0GG 3K7UC 3T1YQ 3PSIA 2KHIA 4BY1G 1VQLA 2R6GA 4A3GH 4IFDJ 1Y1WG 3U58A 1YI2A 4IFDG 1SR3A 1VQGA 1S3OA 2DGYA 3EIVA 2Q2UA 4JI3L 1VQCA 3GTKH 5IYCG 3M4OH 1I5FA 4QGUA 4JYAQ 1Z47A 4JI2L 1AH9A 2HT1A 4KLKA 1HR0L 3PO2H 4L5SA 1Q1BA 1X54A 2PQAA 2Y0SE 5M3MH 1KIXA 1SMXA 2VUMH 1B8AA 1HZ9A 2CKZB 4BBRG 1I94Q 2DUDA 2I5LX 2I5HA 4XIGS 2CWPA 2VQFL 1VQMA 4JI8L 5M5YH 3HKZG 3U4VA 1K8AC 4DV3Q 3IRBA 4B3RL 2QGQA 3PUYA 4JCVE 1UE1A 1MIUA 3I4OA 1IBMQ 1Q8KA 4DV5L 2Z0SA 3KF6B 3TEHB 4DR6L 3M9BA 1RL2A 2IHEA 4C2MH 4X65L 1WCMG 4MNOA 1QVGA 5C44H 5LMNW 4LF7Q 1YHAA 3PUXA 2ZJRA 2E2JH 4LFCQ 2F4VL 5K36G 2IT1A 4MZ9A 4DR1L 5HY6A 3GD7A 3KDFB 4DK6C 3NBHB 1Z9FA 5BR8Q 3KFUA 3S16H 1O7IA 4P72A 2Q2HA 4DV2L 3S1NH 4AYBE 4NB3A 1VQ6A 1SRUA 2NZHA 4DNIA 3GTLH 2R7DA 4DR7L 4K0KQ 3PUWA 4KHZA 2UUBQ 1D8LA 1KC8C 3HOVH 4BXXH 4JOIA 1EWIA 2LSSA 1PH7A 5GAGC 4DK3C 4AQYL 3HOUG 1EQQA 2OTJA 5J3BA 4DV7L 1YJ9A 3UDXA 3D31A 2K5NA 4C3HH 1QVCA 1HH2P 2AMCB 4DR5L 4KHPL 3HKZE 3E9IA 4JI7Q 3J80i 4X65Q 3CCJA 4UP8A 1SFOH 4TQUS 4HIMA 2PQAB 3I4NH 2ZM6L 1P8LA 1XMQQ 2WB1E 4DUYL 4DV4Q 3JAMc 3STBC 1MJEA 4LF6Q 2JQOA 4BBSH 3CF5A 1JJCB 3U50C 1A8VA 3PV0A 1G6PA 4BBSG 2VY3A 3KF6A 1WI5A 5LMUL 3TRZA 1PV4A 1HJPA 3TQYA 3CD6A 4HJ8A 1XTDA 1GVPA 4YWKA 3KJOA 1K9MC 3I4NG 1D7QA 2AHOB 2ALYB 2B63G 3RR5A 1UE7A 4AYBG 5M3FH 2NN6I 4OO1I 4L5RC 2LXKA 4IJHA 1NMFA 3KOJA 2ATWA 5C0XI 4JOIC 3CC2A 4X66L 4B3SL 1QZGA 4JBKA 4R4OA 3KYHC 1J5EQ 3HOUH 1EQRA 2N49A 2JA6H 1N36L 1NJIC 4QY7A 4JBJA 4X62Q 4BXXG 4IJLA 4DR3Q 2HHHL 3HOVG 2WB1G 4RMFA 2K52A 3NENA 4A76A 4B3MQ 4A3JH 5C0XJ 1PH5A 4B3TL 4IFDI 1NTGA 3M3YH 1VQHA 2V1CC 5EAYA 1YIJA 4JV5Q 1E7ZA 2MQHA 1W3SA 4GKKL 4JBWA 2JA8G 3J7A5 1QVFA 1ASYA 3M4QA 2L15A 5DLQE 2YTXA 5BR8L 1C7YA 3CMEA 1L0WA 3HOXH 1HZCA 1KAWA 1N34L 1I3QH 2MO1A 1RIPA 1WCMH 3M85A 1IYJB 2ZJQA 3PUZA 4JI1L 4MTNA 3U4ZA 1CKMA 5JJLA 2LXJA 2EXDA 3H15A 4A3IH 1W2BA 3STBD 1LYLA 2BH2A 1HZBA 1X65A 3AFQA 2NVYH 2YTVA 4PMWA 4DV3L 4BBRH 4EQ5A 4OXPA 3KJPA 5M3MG 1X56A 1FJGL 3K81C 1E1TA 4IPCA 2ZJPA 4QIWE 4DR6Q 5FJ8G 1CKNA 3B6YA 5E7NA 4X64Q 2B3GA 3J7ZC 2WP8J 3ULPA 2E5LQ 3GTJH 1UE5A 2JEBI 2N8NA 2XTIA 1VQOA 3AQQA 5IE8A 4LF5Q 3RN5A 3HOYG 3S1RH 3OW2A 1HNZL 3GTQH 4A3GG 3RNUA 4POFA 1XJVA 4GLXA 3AEVA 2MFIA 4LF9L 2KCMA 4HIDA 2PI2A 4K0KL 4YHHQ 2E2IH 3HOZH 2CQOA 3CP0A 2AWNA 2UUCL 1LUZA 1SROA 3UE1A 5M5WH 4OWXB 2R92H 4HIKA 4DR1Q 1BBUA 5IYDG 3OTOQ 5FLMG 3PUVA 4A3CH 1Q46A 2GVAA 2PNHA 2QEXA 1N36Q 3Q8DA 4NXMQ 1VQNA 2YU9H 1YVCA 3T1YL 2JA7H 3CPFA 3DLLA 1HR0W 4A3LG 4B3ML 5IYBH 5IP7H 4B3TQ 3FKIH 1XPRA 3G71A 2PI2E 3BJUA 3RZDH 3RLFA 3HFZB 2UUAQ 1HNXL 4AQYQ 2OQ0A 4IOAA 3BU2A 4JI2Q 3RLNA 1NE3A 4YY3Q 2BH8A 4A3MH 4JI5Q 3GTPH 3PO3G 4YWMA 1XNRL 2UXDL 3I4MG 2H5XA 3KDFA 1TWFH 1U5KA 1KRTA 1NY4A 1Q81C 4PZ8A 3L7ZC 5GADC 5IWAL 1X6OA 5IY0A 4LFBQ 4DR2Q 1GM5A 1PH1A 1P16A 1XMQL 4A93H 2VZAA 3PF5A 1K73C 4JI6L 5C0XG 4JBMA 1V9PA 1E24A 3HOWH 4WJ3M 4LF4L 3A5ZB 4IO9A 1K8GA 1YJWA 2R7FA 4JI0Q 4LF6L 1A0IA 1LTLA 3A74A 5JJIA 1LM0A 4QJFA 5HGQA 2UXBL 3G6EA 1HNWQ 3I4MH 4J15A 1TWAH 3S1MH 1FJGQ 4ME3A 5AJ3L 3T1HQ 4OX9L 4A3EG 1JE5A 3CCMA 1JB7A 2C35B 2EIFA 1X3FA 1J6QA 2JE6I 3F1ZA 4DV1L 2I0QA 2IX0A 2N3SA 2K50A 3NEMA 1VQKA 1SE8A 1IBLQ 2F3IA 2NZOA 4XTCS 1Q82C 3CQZH 4NXNL 2R7ZG 3FKIG 4GN3B 5IP7G 4DR4Q 2UUBL 4DR7Q 4EX5A 2B29A 1PYSB 1Y14B 4R4QA 1OXXK 4LF9Q 4A3BG 1AE2A 1M1KC 3J81j 2JA7G 1XNQL 1TWCH 4R4IA 2UXCQ 2UUCQ 5FLMH 1L1OB 1YNXA 4PZ6A 4KI0A 5IYDH 4IPGA 4AH6A 4P73A 5FLXc 3JAMi 1N34Q 4DV6Q 2WFWA 4LUOA 1XMOL 1V43A 2K5HA 3KF8B 3LGJA 1FGUA 2ZTEA 2ASBA 4GLAC 4JV5L 3CC7A 4GOPC 2OQKA 5GROA 4DUZL 1GO3E 1IBLL 4LWCA 2VW9A 2AWOA 4GKKQ 1R9TH 2JA9A 1EIFA 1CKOA 2ZM6Q 3DM3A 3HOYH 1VQ7A 1PH2A 1WJJA 2KCTA 1A63A 2N78A 3ULJA 2K14A 4P75A 1KL9A 1DGSA 3KLWA 5FJ8H 4LFAQ 4L5QA 3PGZA 1EOVA 1YJNA 4TVAB 1VQ8A 4DKAC 3HKSA 2PMZE 4LW1A 2OWOA 3BZCA 2KHJA 4C3IH 3E9HA 4X6AH 2WAQE 2UXCL 3OYYA 3F8TA 3H3VH 2UU9L 4A3DH 1PVOA 1L2FA 4A3IG 5IP9G 4P71A 4A3FH 1B70B 1HZAA 3GDEA 3PF4A 2AKWB 3I2ZA 2ES2A 1SN8A 1IBKQ 1NMGA 3S15H 3CXCA 3HOXG 3S2DH 1S40A 2VQEL 4DR3L 2HHHQ 4APVA 4BA2I 4LFAL 1VQIA 2D0OA 4LUVA 3UDIA 2I5MX 4DV0Q 2JA8H 4KHPQ 3J81i 2FXQA 4OONA 1Q86C 1Y1VG 2NN6G 1L1OC 3F2BA 3ICEA 3ERSX 5JJKA 2BA1A 2R93H 2KENA 4A3JG 3CCRA 1IBML 3A5UA 3T1HL 4OX9Q 1QUQB 3EN2A 4ALPA 2CFMA 1IBKL 1X9NA 3TS0A 2JA6G 1MKHA 4YCVA 4HJAA 1YZ6A 3TS2A 1PH4A 2A8VA 5IT9c 1N8RC 2UU9Q 3AYHB 1GKHA 3S14H 3CW2C 3RZOH 2GN5A 5M3FG 4HIOA 4IPDA 1WFQA 2B63H 2D62A 3VDYA 5C4XG 1G291 3K80C 3UDGA 1XNRQ 4GKJQ 3M7NA 1V1QA 3K0XA 2JA5G 5JEAJ 2QA4A 4P74A 1IXRA 3UE0A 2JA5H 3I7FA 1PHJA 3SGIA 2E5LL 2UXDQ 3K8AA 3CCSA 2A1AA 1PH9A 5C4XH 4JI7L 3A0JA 3M4PA 4POGA 4LF4Q 2HIXA 3FHWA 1BKBA 5GAEC 1VQ9A 4NPSA 4YHHL 3CCLA 4BA1I 4LF8Q 2MO0A 4JG2A 2NVXH 4UY8C 1YHQA 3JC66 1A62A 1EYGA 4JI4L 2UXBQ 1AE3A 2D0PA 1XNQQ 2ZTCA 1BVSA 4GKJL 2IY5B 4GN5A 1UWVA 1VQ5A 2Z6KA 4GOPA 1VQEA 2F52A 2ZTDA 1N33L 4O2DA 5M5XH 1MJCA 3CAMA 4OWTB 4YCUA 4JI5L 4C3JH 3GTMH 4NXNQ 4DR4L 2R93G 1CSPA 5GAHC 2NVTH 3CMAA 2E2HH 1WOCA 1Y1VH 1PH6A 4YCWA 1N32Q 2CWAA 5ELOA 1X3EA 3W5OA 4HJ5A 4LF7L 4LF8L 1TWHH 2ID0A 3NELA 4QL5A 4X66Q 2BA0A 1L1OA 4YY3L 2MNAA 1FL0A 1KQSA 2OTLA 1XPUA 4B3SQ 1OXSC 1E22A 4JC0A 3F2CA 1NBWA 5C44G 4DV0L 4JI0L 3FP9A 2Q2TA 1J5EL 4X62L 4DV7Q 1PFSA 1VQ4A 1HNWL 4GOPB 1S72A 1G51A 1U0LA 1YHBA 1B7YB 1VCIA 3MXNB 4UP9A 5IP9H 5AJ3Q 3ZJYC 4DR2L 1I94L 1BBWA 4HJ9A 4A3DG 2VQFQ 1JJGA 1VQAA 4UPAA 1C0AA 4NXML 5LMNL 4JI3Q 1Q1EA 3L0OA 3BZKA 4AIMA 4GN4B 3CCEA 2VUMG 1HR0Q 2IHFA 3S17H 4JYAL 3W1GA 1ASZA 2VS1A 2KBNA 4IPHA 1Q7YC 4PZ7A 2CCZA 2K4KA 4UP7A 1PH8A 3PO2G 1IZ6A 1XPOA 1KRSA 1HNXQ 1X3GA 5LMUQ 1KXLA 2F4VQ 5IYCH 3J80c 1TXYA 4FDBA 2RCNA 1OXUA 2JK8A 3I56A 4QQBX 1K3RA 4GNXA 3D0FA 4L5TA 3GTOH 1KD1C 1Y1WH 1QUQA 2E8GA 4DUYQ 4DV4L 2Q2IA 4BY1H 1I50H 1T9HA 2WAQG 4DV5Q 1UEBA 2UUAL 3H0GH 1N9WA 1VQPA 3S2HH 4H02A 2VQEQ 3CCQA 3S1QH 2GVBA 4O0AA 4JI1Q 1I6HH 2Y0SG 3UDFA 4DAYB 3TREA 1EFWA 1XMOQ 5JEAG 1YBYA 4DV6L 1OXTA 3F2DA 1OXVA 2NVQH 1UE6A 3EBEA 3G4SA 1GD7A 4DUZQ 2RHSB 4DV2Q 4LF5L 4A3FG 4IOCA 4A3BH 4LUZA 1HNZQ 4GNXB 4LFBL 4YWLA 3L2PA 3I55A 2R7ZH 4JI4Q 3H3VI 1EUJA 2EQSA 3CCUA 4A3KH 4Y7NH 2OCEA 4A4IA 5C3EG 4A3CG 1CKNB 1TWGH 2A19A 3WWVA 3K7AH 4X64L 4A75A 4DAMA 1N33Q 5C4JH 1X55A 3G48A 1KHIA 3CC4A 4A3EH 4BY7G 1M90C 1OTCA 4DV1Q 5GQOA 1JJ2A 4WJ4A 1YEZA 4R4TA 2YYZA 4JI8Q 2YV5A 4GNXC 4LFCL 1SLJA 3RLOA 1JMCA 3ULLA 4GLVB 4B3RQ 1Q12A 4R1JA 1EIYB 3HOWG 1H95A 4RG1A 4A93G 2JEAI 2Z6KC 3W1BA 3PIOA 3J81c 1QZHA 2HQLA 5ELNA 1CUKA 1VQFA 1PYBA 2HIVA 1IL2A 3S24A 3GO5A 1VQDA 2IX1A 1VQBA 1VQJA 1VS0A 4R4CA 4A3MG 3PO3H 1K0RA 4HJ7A 4BY7H 3CPWA 3MEFA 3ER0A 2JJQA 5H1SE 3AFPA 5LMNQ 3PCOB 5C3EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSQ A;  1E3P A;  5IWA Q;  4A3K G;  2VNU D;  1WYD A;  2XGT A;  1FVI A;  5IYB G;  3PIP A;  1PA6 A;  4A3L H;  4OO1 G;  1C9O A;  3CCV A;  3GTG H;  2K5V A;  1K83 H;  3E0E A;  2K75 A;  4DPG A;  2R92 G;  2VL6 A;  1JT8 A;  3OTO L;  2YTY A;  2RHQ B;  1E1O A;  1YIT A;  4GS3 A;  2RF4 A;  4JI6 Q;  4OWW B;  3HOZ G;  3RN2 A;  1PH3 A;  4PG3 A;  1N32 L;  4Y52 H;  4DR5 Q;  4LNQ A;  3H0G G;  3K7U C;  3T1Y Q;  3PSI A;  2KHI A;  4BY1 G;  1VQL A;  2R6G A;  4A3G H;  4IFD J;  1Y1W G;  3U58 A;  1YI2 A;  4IFD G;  1SR3 A;  1VQG A;  1S3O A;  2DGY A;  3EIV A;  2Q2U A;  4JI3 L;  1VQC A;  3GTK H;  5IYC G;  3M4O H;  1I5F A;  4QGU A;  4JYA Q;  1Z47 A;  4JI2 L;  1AH9 A;  2HT1 A;  4KLK A;  1HR0 L;  3PO2 H;  4L5S A;  1Q1B A;  1X54 A;  2PQA A;  2Y0S E;  5M3M H;  1KIX A;  1SMX A;  2VUM H;  1B8A A;  1HZ9 A;  2CKZ B;  4BBR G;  1I94 Q;  2DUD A;  2I5L X;  2I5H A;  4XIG S;  2CWP A;  2VQF L;  1VQM A;  4JI8 L;  5M5Y H;  3HKZ G;  3U4V A;  1K8A C;  4DV3 Q;  3IRB A;  4B3R L;  2QGQ A;  3PUY A;  4JCV E;  1UE1 A;  1MIU A;  3I4O A;  1IBM Q;  1Q8K A;  4DV5 L;  2Z0S A;  3KF6 B;  3TEH B;  4DR6 L;  3M9B A;  1RL2 A;  2IHE A;  4C2M H;  4X65 L;  1WCM G;  4MNO A;  1QVG A;  5C44 H;  5LMN W;  4LF7 Q;  1YHA A;  3PUX A;  2ZJR A;  2E2J H;  4LFC Q;  2F4V L;  5K36 G;  2IT1 A;  4MZ9 A;  4DR1 L;  5HY6 A;  3GD7 A;  3KDF B;  4DK6 C;  3NBH B;  1Z9F A;  5BR8 Q;  3KFU A;  3S16 H;  1O7I A;  4P72 A;  2Q2H A;  4DV2 L;  3S1N H;  4AYB E;  4NB3 A;  1VQ6 A;  1SRU A;  2NZH A;  4DNI A;  3GTL H;  2R7D A;  4DR7 L;  4K0K Q;  3PUW A;  4KHZ A;  2UUB Q;  1D8L A;  1KC8 C;  3HOV H;  4BXX H;  4JOI A;  1EWI A;  2LSS A;  1PH7 A;  5GAG C;  4DK3 C;  4AQY L;  3HOU G;  1EQQ A;  2OTJ A;  5J3B A;  4DV7 L;  1YJ9 A;  3UDX A;  3D31 A;  2K5N A;  4C3H H;  1QVC A;  1HH2 P;  2AMC B;  4DR5 L;  4KHP L;  3HKZ E;  3E9I A;  4JI7 Q;  3J80 i;  4X65 Q;  3CCJ A;  4UP8 A;  1SFO H;  4TQU S;  4HIM A;  2PQA B;  3I4N H;  2ZM6 L;  1P8L A;  1XMQ Q;  2WB1 E;  4DUY L;  4DV4 Q;  3JAM c;  3STB C;  1MJE A;  4LF6 Q;  2JQO A;  4BBS H;  3CF5 A;  1JJC B;  3U50 C;  1A8V A;  3PV0 A;  1G6P A;  4BBS G;  2VY3 A;  3KF6 A;  1WI5 A;  5LMU L;  3TRZ A;  1PV4 A;  1HJP A;  3TQY A;  3CD6 A;  4HJ8 A;  1XTD A;  1GVP A;  4YWK A;  3KJO A;  1K9M C;  3I4N G;  1D7Q A;  2AHO B;  2ALY B;  2B63 G;  3RR5 A;  1UE7 A;  4AYB G;  5M3F H;  2NN6 I;  4OO1 I;  4L5R C;  2LXK A;  4IJH A;  1NMF A;  3KOJ A;  2ATW A;  5C0X I;  4JOI C;  3CC2 A;  4X66 L;  4B3S L;  1QZG A;  4JBK A;  4R4O A;  3KYH C;  1J5E Q;  3HOU H;  1EQR A;  2N49 A;  2JA6 H;  1N36 L;  1NJI C;  4QY7 A;  4JBJ A;  4X62 Q;  4BXX G;  4IJL A;  4DR3 Q;  2HHH L;  3HOV G;  2WB1 G;  4RMF A;  2K52 A;  3NEN A;  4A76 A;  4B3M Q;  4A3J H;  5C0X J;  1PH5 A;  4B3T L;  4IFD I;  1NTG A;  3M3Y H;  1VQH A;  2V1C C;  5EAY A;  1YIJ A;  4JV5 Q;  1E7Z A;  2MQH A;  1W3S A;  4GKK L;  4JBW A;  2JA8 G;  3J7A 5;  1QVF A;  1ASY A;  3M4Q A;  2L15 A;  5DLQ E;  2YTX A;  5BR8 L;  1C7Y A;  3CME A;  1L0W A;  3HOX H;  1HZC A;  1KAW A;  1N34 L;  1I3Q H;  2MO1 A;  1RIP A;  1WCM H;  3M85 A;  1IYJ B;  2ZJQ A;  3PUZ A;  4JI1 L;  4MTN A;  3U4Z A;  1CKM A;  5JJL A;  2LXJ A;  2EXD A;  3H15 A;  4A3I H;  1W2B A;  3STB D;  1LYL A;  2BH2 A;  1HZB A;  1X65 A;  3AFQ A;  2NVY H;  2YTV A;  4PMW A;  4DV3 L;  4BBR H;  4EQ5 A;  4OXP A;  3KJP A;  5M3M G;  1X56 A;  1FJG L;  3K81 C;  1E1T A;  4IPC A;  2ZJP A;  4QIW E;  4DR6 Q;  5FJ8 G;  1CKN A;  3B6Y A;  5E7N A;  4X64 Q;  2B3G A;  3J7Z C;  2WP8 J;  3ULP A;  2E5L Q;  3GTJ H;  1UE5 A;  2JEB I;  2N8N A;  2XTI A;  1VQO A;  3AQQ A;  5IE8 A;  4LF5 Q;  3RN5 A;  3HOY G;  3S1R H;  3OW2 A;  1HNZ L;  3GTQ H;  4A3G G;  3RNU A;  4POF A;  1XJV A;  4GLX A;  3AEV A;  2MFI A;  4LF9 L;  2KCM A;  4HID A;  2PI2 A;  4K0K L;  4YHH Q;  2E2I H;  3HOZ H;  2CQO A;  3CP0 A;  2AWN A;  2UUC L;  1LUZ A;  1SRO A;  3UE1 A;  5M5W H;  4OWX B;  2R92 H;  4HIK A;  4DR1 Q;  1BBU A;  5IYD G;  3OTO Q;  5FLM G;  3PUV A;  4A3C H;  1Q46 A;  2GVA A;  2PNH A;  2QEX A;  1N36 Q;  3Q8D A;  4NXM Q;  1VQN A;  2YU9 H;  1YVC A;  3T1Y L;  2JA7 H;  3CPF A;  3DLL A;  1HR0 W;  4A3L G;  4B3M L;  5IYB H;  5IP7 H;  4B3T Q;  3FKI H;  1XPR A;  3G71 A;  2PI2 E;  3BJU A;  3RZD H;  3RLF A;  3HFZ B;  2UUA Q;  1HNX L;  4AQY Q;  2OQ0 A;  4IOA A;  3BU2 A;  4JI2 Q;  3RLN A;  1NE3 A;  4YY3 Q;  2BH8 A;  4A3M H;  4JI5 Q;  3GTP H;  3PO3 G;  4YWM A;  1XNR L;  2UXD L;  3I4M G;  2H5X A;  3KDF A;  1TWF H;  1U5K A;  1KRT A;  1NY4 A;  1Q81 C;  4PZ8 A;  3L7Z C;  5GAD C;  5IWA L;  1X6O A;  5IY0 A;  4LFB Q;  4DR2 Q;  1GM5 A;  1PH1 A;  1P16 A;  1XMQ L;  4A93 H;  2VZA A;  3PF5 A;  1K73 C;  4JI6 L;  5C0X G;  4JBM A;  1V9P A;  1E24 A;  3HOW H;  4WJ3 M;  4LF4 L;  3A5Z B;  4IO9 A;  1K8G A;  1YJW A;  2R7F A;  4JI0 Q;  4LF6 L;  1A0I A;  1LTL A;  3A74 A;  5JJI A;  1LM0 A;  4QJF A;  5HGQ A;  2UXB L;  3G6E A;  1HNW Q;  3I4M H;  4J15 A;  1TWA H;  3S1M H;  1FJG Q;  4ME3 A;  5AJ3 L;  3T1H Q;  4OX9 L;  4A3E G;  1JE5 A;  3CCM A;  1JB7 A;  2C35 B;  2EIF A;  1X3F A;  1J6Q A;  2JE6 I;  3F1Z A;  4DV1 L;  2I0Q A;  2IX0 A;  2N3S A;  2K50 A;  3NEM A;  1VQK A;  1SE8 A;  1IBL Q;  2F3I A;  2NZO A;  4XTC S;  1Q82 C;  3CQZ H;  4NXN L;  2R7Z G;  3FKI G;  4GN3 B;  5IP7 G;  4DR4 Q;  2UUB L;  4DR7 Q;  4EX5 A;  2B29 A;  1PYS B;  1Y14 B;  4R4Q A;  1OXX K;  4LF9 Q;  4A3B G;  1AE2 A;  1M1K C;  3J81 j;  2JA7 G;  1XNQ L;  1TWC H;  4R4I A;  2UXC Q;  2UUC Q;  5FLM H;  1L1O B;  1YNX A;  4PZ6 A;  4KI0 A;  5IYD H;  4IPG A;  4AH6 A;  4P73 A;  5FLX c;  3JAM i;  1N34 Q;  4DV6 Q;  2WFW A;  4LUO A;  1XMO L;  1V43 A;  2K5H A;  3KF8 B;  3LGJ A;  1FGU A;  2ZTE A;  2ASB A;  4GLA C;  4JV5 L;  3CC7 A;  4GOP C;  2OQK A;  5GRO A;  4DUZ L;  1GO3 E;  1IBL L;  4LWC A;  2VW9 A;  2AWO A;  4GKK Q;  1R9T H;  2JA9 A;  1EIF A;  1CKO A;  2ZM6 Q;  3DM3 A;  3HOY H;  1VQ7 A;  1PH2 A;  1WJJ A;  2KCT A;  1A63 A;  2N78 A;  3ULJ A;  2K14 A;  4P75 A;  1KL9 A;  1DGS A;  3KLW A;  5FJ8 H;  4LFA Q;  4L5Q A;  3PGZ A;  1EOV A;  1YJN A;  4TVA B;  1VQ8 A;  4DKA C;  3HKS A;  2PMZ E;  4LW1 A;  2OWO A;  3BZC A;  2KHJ A;  4C3I H;  3E9H A;  4X6A H;  2WAQ E;  2UXC L;  3OYY A;  3F8T A;  3H3V H;  2UU9 L;  4A3D H;  1PVO A;  1L2F A;  4A3I G;  5IP9 G;  4P71 A;  4A3F H;  1B70 B;  1HZA A;  3GDE A;  3PF4 A;  2AKW B;  3I2Z A;  2ES2 A;  1SN8 A;  1IBK Q;  1NMG A;  3S15 H;  3CXC A;  3HOX G;  3S2D H;  1S40 A;  2VQE L;  4DR3 L;  2HHH Q;  4APV A;  4BA2 I;  4LFA L;  1VQI A;  2D0O A;  4LUV A;  3UDI A;  2I5M X;  4DV0 Q;  2JA8 H;  4KHP Q;  3J81 i;  2FXQ A;  4OON A;  1Q86 C;  1Y1V G;  2NN6 G;  1L1O C;  3F2B A;  3ICE A;  3ERS X;  5JJK A;  2BA1 A;  2R93 H;  2KEN A;  4A3J G;  3CCR A;  1IBM L;  3A5U A;  3T1H L;  4OX9 Q;  1QUQ B;  3EN2 A;  4ALP A;  2CFM A;  1IBK L;  1X9N A;  3TS0 A;  2JA6 G;  1MKH A;  4YCV A;  4HJA A;  1YZ6 A;  3TS2 A;  1PH4 A;  2A8V A;  5IT9 c;  1N8R C;  2UU9 Q;  3AYH B;  1GKH A;  3S14 H;  3CW2 C;  3RZO H;  2GN5 A;  5M3F G;  4HIO A;  4IPD A;  1WFQ A;  2B63 H;  2D62 A;  3VDY A;  5C4X G;  1G29 1;  3K80 C;  3UDG A;  1XNR Q;  4GKJ Q;  3M7N A;  1V1Q A;  3K0X A;  2JA5 G;  5JEA J;  2QA4 A;  4P74 A;  1IXR A;  3UE0 A;  2JA5 H;  3I7F A;  1PHJ A;  3SGI A;  2E5L L;  2UXD Q;  3K8A A;  3CCS A;  2A1A A;  1PH9 A;  5C4X H;  4JI7 L;  3A0J A;  3M4P A;  4POG A;  4LF4 Q;  2HIX A;  3FHW A;  1BKB A;  5GAE C;  1VQ9 A;  4NPS A;  4YHH L;  3CCL A;  4BA1 I;  4LF8 Q;  2MO0 A;  4JG2 A;  2NVX H;  4UY8 C;  1YHQ A;  3JC6 6;  1A62 A;  1EYG A;  4JI4 L;  2UXB Q;  1AE3 A;  2D0P A;  1XNQ Q;  2ZTC A;  1BVS A;  4GKJ L;  2IY5 B;  4GN5 A;  1UWV A;  1VQ5 A;  2Z6K A;  4GOP A;  1VQE A;  2F52 A;  2ZTD A;  1N33 L;  4O2D A;  5M5X H;  1MJC A;  3CAM A;  4OWT B;  4YCU A;  4JI5 L;  4C3J H;  3GTM H;  4NXN Q;  4DR4 L;  2R93 G;  1CSP A;  5GAH C;  2NVT H;  3CMA A;  2E2H H;  1WOC A;  1Y1V H;  1PH6 A;  4YCW A;  1N32 Q;  2CWA A;  5ELO A;  1X3E A;  3W5O A;  4HJ5 A;  4LF7 L;  4LF8 L;  1TWH H;  2ID0 A;  3NEL A;  4QL5 A;  4X66 Q;  2BA0 A;  1L1O A;  4YY3 L;  2MNA A;  1FL0 A;  1KQS A;  2OTL A;  1XPU A;  4B3S Q;  1OXS C;  1E22 A;  4JC0 A;  3F2C A;  1NBW A;  5C44 G;  4DV0 L;  4JI0 L;  3FP9 A;  2Q2T A;  1J5E L;  4X62 L;  4DV7 Q;  1PFS A;  1VQ4 A;  1HNW L;  4GOP B;  1S72 A;  1G51 A;  1U0L A;  1YHB A;  1B7Y B;  1VCI A;  3MXN B;  4UP9 A;  5IP9 H;  5AJ3 Q;  3ZJY C;  4DR2 L;  1I94 L;  1BBW A;  4HJ9 A;  4A3D G;  2VQF Q;  1JJG A;  1VQA A;  4UPA A;  1C0A A;  4NXM L;  5LMN L;  4JI3 Q;  1Q1E A;  3L0O A;  3BZK A;  4AIM A;  4GN4 B;  3CCE A;  2VUM G;  1HR0 Q;  2IHF A;  3S17 H;  4JYA L;  3W1G A;  1ASZ A;  2VS1 A;  2KBN A;  4IPH A;  1Q7Y C;  4PZ7 A;  2CCZ A;  2K4K A;  4UP7 A;  1PH8 A;  3PO2 G;  1IZ6 A;  1XPO A;  1KRS A;  1HNX Q;  1X3G A;  5LMU Q;  1KXL A;  2F4V Q;  5IYC H;  3J80 c;  1TXY A;  4FDB A;  2RCN A;  1OXU A;  2JK8 A;  3I56 A;  4QQB X;  1K3R A;  4GNX A;  3D0F A;  4L5T A;  3GTO H;  1KD1 C;  1Y1W H;  1QUQ A;  2E8G A;  4DUY Q;  4DV4 L;  2Q2I A;  4BY1 H;  1I50 H;  1T9H A;  2WAQ G;  4DV5 Q;  1UEB A;  2UUA L;  3H0G H;  1N9W A;  1VQP A;  3S2H H;  4H02 A;  2VQE Q;  3CCQ A;  3S1Q H;  2GVB A;  4O0A A;  4JI1 Q;  1I6H H;  2Y0S G;  3UDF A;  4DAY B;  3TRE A;  1EFW A;  1XMO Q;  5JEA G;  1YBY A;  4DV6 L;  1OXT A;  3F2D A;  1OXV A;  2NVQ H;  1UE6 A;  3EBE A;  3G4S A;  1GD7 A;  4DUZ Q;  2RHS B;  4DV2 Q;  4LF5 L;  4A3F G;  4IOC A;  4A3B H;  4LUZ A;  1HNZ Q;  4GNX B;  4LFB L;  4YWL A;  3L2P A;  3I55 A;  2R7Z H;  4JI4 Q;  3H3V I;  1EUJ A;  2EQS A;  3CCU A;  4A3K H;  4Y7N H;  2OCE A;  4A4I A;  5C3E G;  4A3C G;  1CKN B;  1TWG H;  2A19 A;  3WWV A;  3K7A H;  4X64 L;  4A75 A;  4DAM A;  1N33 Q;  5C4J H;  1X55 A;  3G48 A;  1KHI A;  3CC4 A;  4A3E H;  4BY7 G;  1M90 C;  1OTC A;  4DV1 Q;  5GQO A;  1JJ2 A;  4WJ4 A;  1YEZ A;  4R4T A;  2YYZ A;  4JI8 Q;  2YV5 A;  4GNX C;  4LFC L;  1SLJ A;  3RLO A;  1JMC A;  3ULL A;  4GLV B;  4B3R Q;  1Q12 A;  4R1J A;  1EIY B;  3HOW G;  1H95 A;  4RG1 A;  4A93 G;  2JEA I;  2Z6K C;  3W1B A;  3PIO A;  3J81 c;  1QZH A;  2HQL A;  5ELN A;  1CUK A;  1VQF A;  1PYB A;  2HIV A;  1IL2 A;  3S24 A;  3GO5 A;  1VQD A;  2IX1 A;  1VQB A;  1VQJ A;  1VS0 A;  4R4C A;  4A3M G;  3PO3 H;  1K0R A;  4HJ7 A;  4BY7 H;  3CPW A;  3MEF A;  3ER0 A;  2JJQ A;  5H1S E;  3AFP A;  5LMN Q;  3PCO B;  5C3E H; 
#chains in the Genus database with same CATH topology
 1FVI A;  1JWM D;  3W3A A;  3HOW B;  3GTG H;  2K5V A;  3DWA A;  1W6K A;  2RSO A;  3DHQ A;  4A93 B;  1SE3 A;  1B2T A;  3J7Y W;  2R92 G;  2VL6 A;  3KLS X;  1JT8 A;  2H4O A;  2YTY A;  4RHS A;  5DNF A;  1SXT A;  4JI6 Q;  4OWW B;  4QUF A;  1SFO B;  3T1Y Q;  5I6Y A;  4BY1 G;  3QG1 A;  1U4R A;  2R6G A;  3HG9 A;  1Y1W G;  1YI2 A;  4IFD G;  1D2B A;  1SR3 A;  2Q2U A;  3RZD B;  1VMP A;  2DNE A;  4Y7N B;  2K5Q A;  3M4O H;  4K5V A;  4RWS C;  4JYA Q;  1JOQ A;  4JI2 L;  1AH9 A;  4JVZ A;  1GXD C;  1X3P A;  3CKI B;  3TP6 A;  4CGY B;  2N55 A;  2Q8I B;  2CKZ B;  2I5L X;  3KBG A;  1VQM A;  4JI8 L;  3U4V A;  4H44 C;  2QGQ A;  1YNJ D;  3I4O A;  5FO7 B;  3S16 B;  1Q8K A;  4DV5 L;  1S5E D;  2OF1 A;  3FPU B;  1RL2 A;  5C6A A;  4G4K A;  2PYK A;  4BY1 B;  5I4D A;  5C44 H;  4LF7 Q;  1QE6 A;  1PFM A;  2ZJR A;  4C2M B;  5K36 G;  2IT1 A;  5T1I A;  1TWA B;  3GD7 A;  4XT1 B;  4DK6 C;  3KFU A;  1EY0 A;  3S16 H;  2Q2H A;  4JPB W;  4NB3 A;  1VQ6 A;  5ELF A;  2NZH A;  3CU7 A;  5CV9 A;  1LT3 D;  1I4X A;  3GTL H;  2F0M A;  3M4Y A;  2A74 C;  1D1K A;  4JOI A;  4DV7 L;  1NSN S;  3IL8 A;  1VMC A;  1GUO A;  4JI7 Q;  2WAQ B;  3CCJ A;  1WVL A;  1SFO H;  4TQU S;  4HIM A;  1P8L A;  2E75 C;  1D5Z C;  4LF6 Q;  1O7L A;  3CF5 A;  3U50 C;  4BBS G;  4X3S A;  2B2U C;  1I6H B;  1XTD A;  1D7Q A;  4RGN A;  4AYB G;  2NN6 I;  2LXK A;  3KOJ A;  2ZT9 C;  4JBK A;  2RKS A;  3HOU H;  3ERO A;  5C3X A;  3NBI A;  4JBJ A;  4BXX G;  5DM7 3;  2H1E A;  3OOC A;  1AEX A;  5M9O A;  4H0L C;  4EVO A;  3M3Y H;  4JV5 Q;  1YIJ A;  1RD9 D;  4XQQ A;  2RCF A;  1EQV A;  1QVF A;  3GTK B;  4IN3 A;  3CME A;  1BNZ A;  1L0W A;  3S14 B;  2AUJ D;  4ZYS A;  1WCM H;  4B08 A;  2WIN B;  1IYJ B;  3U4Z A;  4QIW B;  4A3K B;  2EXD A;  1W2B A;  4ID6 A;  3AB9 A;  1CHP D;  1HZB A;  2F0O A;  1X65 A;  1L0Y B;  4PMW A;  3V2T A;  1SMY C;  1FJG L;  4ZAI A;  2ZJP A;  2R92 B;  4KD4 A;  2E5L Q;  1TQO A;  2N8N A;  1GOZ A;  2L11 A;  5IE8 A;  4LF5 Q;  3RN5 A;  2DNC A;  1HNZ L;  4CKC A;  3OW2 A;  3GTQ H;  1EU3 A;  3RNU A;  4DNT B;  3AEV A;  2MFI A;  4LF9 L;  2K1B A;  4EQO A;  5KEE A;  4YHH Q;  3HOZ H;  2F0V A;  2CQO A;  5JPN C;  4ZUJ A;  1DON A;  3UE1 A;  2LKV A;  2R92 H;  1WD0 A;  4HIK A;  3DM1 A;  5FLM G;  2RVL A;  3PUV A;  2GVA A;  2PNH A;  1HFG A;  1F2Y A;  1DM0 B;  3CPF A;  1HR0 W;  4B3M L;  3FKI H;  3SXH A;  4BS9 A;  3N52 A;  1Y8N B;  2XRQ D;  1XTC D;  1SYD A;  5DM6 3;  4AQY Q;  3BU2 A;  2QW7 A;  4F87 A;  5CYU A;  1A3T A;  4DAV A;  1TWG B;  5KGU A;  3AU7 A;  4A3M H;  3PO3 G;  4CKE A;  1XNR L;  3I4M G;  1KAA A;  3JAM L;  5FK9 C;  1ENC A;  3KDF A;  1Q81 C;  4P2C B;  1Q3L A;  4LFB Q;  5C0X H;  1GM5 A;  4WJ3 M;  1H9K A;  1V9P A;  1UEA B;  2QDB A;  4IO9 A;  1K8G A;  1LTL A;  3I4M H;  4J15 A;  2F0T A;  1FJG Q;  3EFX D;  2F0E A;  1PRT D;  5KIX A;  3VR6 A;  2EIF A;  1J6Q A;  4RGT A;  1IBL Q;  2NZO A;  1DZ1 A;  3NQT A;  1EYD A;  4GN3 B;  2UUB L;  1Y14 B;  3NTH A;  1OXX K;  1TWC H;  5JEA H;  4IPG A;  4KK7 A;  4P73 A;  1A3U A;  3JAM i;  5IGB A;  1GUG A;  2PZU A;  3M7G A;  1RKN A;  5DAU A;  1HXY D;  1RTN A;  2K5H A;  3LGJ A;  4JV5 L;  2J4X A;  2ASB A;  4AYB B;  4GLA C;  5GRO A;  4LWC A;  4ABN A;  3RZO B;  2AWO A;  1R9T H;  3DM3 A;  1XX8 A;  4K2K A;  5ELE A;  1SNP A;  2K14 A;  1I4H A;  2QF7 A;  1H9M A;  5FJ8 H;  1I4Q A;  3H94 A;  1YJN A;  4HR7 B;  4DKA C;  1BO0 A;  3HEJ A;  4LW1 A;  1B1Z A;  1EYA A;  5CV8 A;  1DOM A;  3OYY A;  4DNR B;  1PVO A;  2A68 C;  3TDQ A;  3SVM A;  1G91 A;  3D6W A;  1SMY D;  3I2Z A;  2ZXP A;  4FF4 A;  2VQE L;  2F0N A;  2A69 D;  1WTW A;  3DEO A;  3VYS A;  1EY7 A;  2ENB A;  1CTM A;  3EJI A;  4PV1 C;  4S3S A;  4XYO A;  1Y69 U;  2JA8 H;  4KHP Q;  4OON A;  1L0X B;  2NN6 G;  1S5F D;  4HN7 A;  3ERS X;  5JJK A;  3FMC A;  2EYH A;  3T1H L;  2OT2 A;  3MFG A;  3EN2 A;  4RH6 A;  1X9N A;  2CW0 D;  1YZ6 A;  2Z4I A;  4OGQ C;  2CQA A;  3HS0 C;  2L4N A;  1N8R C;  3U9S A;  3HOX B;  3K7A B;  1PTO C;  1NCV A;  3MTS A;  4HIO A;  4IPD A;  1WFQ A;  2F03 A;  3VDY A;  4M8A A;  3K80 C;  1LTB D;  4GKJ Q;  5E4X A;  1V1Q A;  3K0X A;  1SYE A;  1IXR A;  1II3 A;  3SGI A;  3D4W A;  1UUP A;  3S1N B;  2A1A A;  1PH9 A;  3DEP A;  1H9S B;  1FD7 D;  3A0J A;  1MGS A;  1B53 A;  4DK1 A;  1BKB A;  1PZK D;  1O80 A;  2MO0 A;  3K57 A;  2F0J A;  3S1R B;  1VF5 C;  1BVS A;  1QB5 D;  1UWV A;  1VQE A;  2ZTD A;  1GHJ A;  2E2D C;  4O2D A;  1JQY D;  3CAM A;  2SEB D;  3BS1 A;  4K2L A;  4O1N A;  2ZXR A;  1TR5 A;  3IKJ A;  5KYI A;  3FRP B;  1CSP A;  5KND A;  4XYQ A;  1WOC A;  1JC7 A;  5ELO A;  1AP0 A;  2SNM A;  4HJ5 A;  1EIG A;  1HA5 A;  3NEL A;  3A8J E;  2OTL A;  1QWY A;  2A5H A;  1XPU A;  4B3S Q;  1V1O A;  1E22 A;  4DV0 L;  1NBW A;  3N6R A;  4HAE A;  3FP9 A;  2Q2T A;  1AZQ A;  4DV7 Q;  1PFS A;  4OIJ A;  5IP9 H;  1B7Y B;  4UP9 A;  3ZJY C;  4DR2 L;  1BBW A;  4A3D G;  1JJG A;  3QIA A;  4UPA A;  1VDZ A;  1FNV A;  2ICI A;  3ITP A;  1DYQ A;  1Q1E A;  1NAP A;  2L0C A;  3EA6 A;  3L0O A;  1ZYR C;  3BZK A;  5EPK A;  3PIP 3;  3GTL B;  1W6J A;  2IHF A;  2J7Z A;  4RAU C;  3W1G A;  2VS1 A;  1Q7Y C;  1H9S A;  4PZ7 A;  4G7H C;  1KRS A;  3NWT A;  3J80 c;  3A55 A;  4FDB A;  3I56 A;  2JK8 A;  3D0F A;  4L5T A;  1Y1W H;  4IFD H;  2E8G A;  4BY1 H;  1I50 H;  1T9H A;  1JCK B;  2WAQ G;  3BG3 A;  3H0G H;  1VQP A;  3S2H H;  2GVB A;  4O0A A;  2A69 C;  1F9P A;  4C3I B;  3TRE A;  1YBY A;  3MXU A;  4DV6 L;  1EEI D;  2NVQ H;  1UE6 A;  4DV2 Q;  4OO1 H;  1MSG A;  2B8F A;  3L9A X;  5CBA E;  1TWF B;  3H3V I;  2EYL A;  1I4P A;  1EUJ A;  5E1F A;  4Y7N H;  5C3E G;  4A3C G;  2R61 A;  1XWE A;  5EBC A;  4X64 L;  4DAM A;  3T51 B;  4C56 C;  2CW0 C;  3TZD A;  3CC4 A;  1M90 C;  2NWG A;  3DUZ A;  4JK1 C;  5ISR A;  4B3R Q;  1PTO D;  5AFW A;  3P7J A;  1HFN A;  2HQL A;  1HUM A;  1S5B D;  1LAB A;  3H3V C;  1SNM A;  1EEF D;  1STE A;  3S2H B;  1VQJ A;  1VS0 A;  4FF3 A;  5KYL A;  4BY7 H;  3MEF A;  2RA4 A;  3AFP A;  5LMN Q;  5C3E H;  3K0Y A;  5CMD A;  4A3C H;  1CSQ A;  5IWA Q;  4A3K G;  4DFA A;  3K5M A;  5BN4 A;  3T13 A;  4RGO S;  1K83 H;  2DY8 A;  3A54 A;  4BBR B;  1D5M C;  3S9W A;  4DPG A;  1Z7T A;  5IT9 L;  3J7A V;  4E6I A;  2RHQ B;  2RF4 A;  2D2C C;  2HUG A;  1N32 L;  2MGS A;  3BZD B;  3H0G G;  1TT2 A;  2KHI A;  3TP5 A;  4A3G H;  5EJW A;  1VQG A;  3EIV A;  1S3O A;  2L12 A;  1NUC A;  5IYC G;  4L6T B;  2I46 A;  4KN7 C;  2HT1 A;  1ZKO A;  5ELC A;  2X6L A;  3PO2 H;  1X54 A;  4TRD A;  2Y0S E;  2VUM H;  1SMX A;  2E76 C;  4BBR G;  1I94 Q;  1I4R A;  1S4Z A;  1JOK A;  2I5H A;  5M5Y H;  2EJG C;  1LT6 D;  3HKZ G;  4DV3 Q;  4B3R L;  1I6V C;  1UE1 A;  2XWJ B;  1MIU A;  4ILW A;  1ZYR D;  3TEH B;  4QUC A;  2Z4H A;  2IHE A;  4DAP A;  1QVG A;  5LMN W;  3J80 E;  3GTO B;  2E74 C;  3X3N A;  4DR1 L;  3KDF B;  5BR8 Q;  4J6H A;  4CDD C;  1O7I A;  3S1N H;  4AYB E;  2KUM A;  1Z6H A;  3PUW A;  2K03 A;  4KHZ A;  2UUB Q;  1D8L A;  2B2Y C;  1KC8 C;  4NW2 A;  1PH7 A;  4DK3 C;  2OTJ A;  2B63 B;  3UDX A;  3D31 A;  5IGD A;  1KLG D;  3NE5 B;  2F0D A;  1D1I A;  1PTO B;  4DN4 M;  1QVC A;  3HKZ E;  3E9I A;  2AUK A;  1TY2 A;  4UP8 A;  2PQA B;  1XMQ Q;  4M1U B;  3JAM c;  1MJE A;  2JQO A;  2NBF A;  4FXK C;  4BBS H;  5A35 A;  1JJC B;  1A8V A;  3PV0 A;  2BCO A;  2VY3 A;  1WI5 A;  4TKO B;  3WOF A;  4MTK A;  3TQY A;  4F7X A;  4HJ8 A;  3T4A C;  1GVP A;  1STB A;  2ALY B;  2B63 G;  3MA2 B;  3RR5 A;  5M3F H;  3UI2 A;  5IGE A;  5C0X I;  4XQJ A;  4X66 L;  4B3S L;  3S1M B;  4RKL A;  1HTP A;  1HHV A;  4X62 Q;  1EOT A;  4DR3 Q;  2HHH L;  2WB1 G;  2K52 A;  3NEN A;  4A76 A;  1R4Q B;  4B3T L;  2B2T C;  1VQH A;  5EAY A;  1FR3 A;  3I73 A;  1W3S A;  4GKK L;  4JBW A;  1G2S A;  2JA8 G;  4H13 C;  5A2Q L;  3J7A 5;  5LHY 1;  1ASY A;  1CHQ D;  3M4Q A;  1C7Y A;  3R93 A;  3Q6S A;  1I3Q B;  1C48 A;  2LY7 A;  1HZC A;  2RBM A;  3HP3 A;  1I3Q H;  2MO1 A;  4U68 A;  1UNS A;  2RDF A;  1BF4 A;  3H6M A;  4K14 A;  3PUZ A;  4JI1 L;  1CKM A;  3I90 A;  4A3I H;  2FIN B;  1LYL A;  1H9R A;  2B8G A;  2HDL A;  3PQI A;  3VR3 A;  2L5T A;  5M3M G;  3K81 C;  3L3O C;  2PCF B;  1QOH A;  3GV3 A;  3MVV A;  1NR4 A;  2KED A;  3ULP A;  4H7B A;  2IL8 A;  2UXD L;  1UE5 A;  3NXW A;  3ERQ A;  2XTI A;  2KEE A;  4PMC A;  2WII B;  1I50 B;  4KY7 A;  1KDB A;  4POF A;  5L37 A;  3RUZ A;  2E2I H;  1SYG A;  4HSV A;  1LUZ A;  2PQE A;  1O7Z A;  1SRO A;  5CV4 A;  1B50 A;  1PRT F;  1TS3 A;  3OTO Q;  3VYT A;  2MP1 A;  4UDU C;  1G6Z A;  5M3M B;  2QEX A;  4NXM Q;  3Q8D A;  2YU9 H;  1YVC A;  2FMM A;  3T1Y L;  1EWH A;  5IYB H;  5IP7 H;  1MD2 D;  5CV5 A;  3KLR A;  4QF4 A;  3BJU A;  3RLF A;  1HTL D;  1JB3 A;  2OQ0 A;  5LL6 S;  3NPP A;  5FO9 B;  1HQR D;  4YY3 Q;  5J22 A;  1A15 A;  3IAY A;  3VR4 A;  3GTP H;  2B2W A;  4KTA A;  3D6C A;  3CRL C;  3Q0A A;  2NUC A;  3R2I A;  4PZ8 A;  5IWA L;  1X6O A;  3I70 A;  4WFN 3;  4DR2 Q;  2SNS A;  3QR8 A;  3PF5 A;  2BDO A;  5E4W C;  3HOW H;  4JBM A;  3GTM B;  3DWQ A;  2R7F A;  1A0I A;  1BQQ T;  1IW7 C;  3C1F A;  1RCV D;  3OSO A;  5JJI A;  5HGQ A;  1HNW Q;  3T1H Q;  2SDF A;  3BVZ A;  4KY6 A;  2DY7 A;  3K6O A;  4DV1 L;  1QNK A;  3F1Z A;  2IPK D;  1SE8 A;  4XTC S;  4FYD A;  1Q82 C;  1EY8 A;  3CQZ H;  3NQI A;  3FKI G;  1EIH A;  5IP7 G;  2B2Y A;  3DMU A;  1PZJ D;  4A3D B;  2PW5 A;  2B29 A;  1UAP A;  4R4Q A;  3EQL C;  2LS0 1;  1XNQ L;  4R4I A;  2UXC Q;  2UUC Q;  1WTV A;  1L1O B;  1SYC A;  2EOT A;  1QIL A;  1J8I A;  1CI3 M;  4LUO A;  5EGT A;  1GO3 E;  1IBL L;  1GHK A;  5I6W A;  2IJ0 A;  3J81 E;  4RHR A;  1EIF A;  1CKO A;  5I9P A;  2ZM6 Q;  3HOY H;  4LJZ C;  4DGZ A;  1WJJ A;  2NZ1 D;  4IUQ A;  1F2L A;  3H09 A;  3ULJ A;  4P75 A;  1V8Q A;  2K04 A;  1KL9 A;  1LAC A;  1GUW A;  4L5Q A;  2ICE C;  1ICW A;  2YU9 B;  1EOV A;  1VQ8 A;  1T5X D;  2L1B A;  3QJY A;  1K83 B;  4XDX A;  2PMZ E;  1XXG A;  4A3J B;  3BZC A;  4B9W A;  4RFB A;  2JA6 B;  1TII D;  4CDF C;  1L2F A;  2E2I B;  2XIW A;  4IUP A;  1T5E A;  5C3E B;  2ES2 A;  1IBK Q;  4IZ8 A;  3I72 A;  4L63 B;  3DWP A;  2FXQ A;  1BCP C;  3ONA B;  5IGC A;  2KEN A;  3CCR A;  1IBM L;  4DF7 A;  4N8X 1;  1QUQ B;  1GJX A;  1TS2 A;  2JA6 G;  3TS0 A;  3TS2 A;  1MKH A;  4I7A A;  1LT4 D;  2K7V A;  5F2D A;  5I2Y A;  3AYH B;  1GKH A;  1SDF A;  3RZO H;  1KNE A;  3ZYY X;  2DN8 A;  2PZT A;  5NUC A;  5M3F G;  3D3R A;  2BE5 C;  4F8M A;  1KDC A;  1G29 1;  3OW7 A;  4KKU A;  2F0U A;  3TP7 A;  2KCN A;  2M9V A;  3M7N A;  2Q8T A;  2QA4 A;  4P74 A;  2K28 A;  3I7F A;  4KN4 C;  3CCS A;  4ZKC B;  1AZP A;  2O5J C;  4JI7 L;  3H0G B;  2HIX A;  3J81 L;  2F3W A;  5E3F A;  2NVX H;  4UY8 C;  1YHQ A;  3JC6 6;  1AN8 A;  2IW3 A;  2UXB Q;  1AE3 A;  2D0P A;  1TY0 A;  2ZTC A;  5M3F B;  4GKJ L;  5C3W A;  1VQ5 A;  2Z6K A;  2A6E D;  3BYT B;  2F52 A;  3NHH A;  1N33 L;  1ESF A;  1JWS D;  5M5X H;  3H91 A;  4C3J H;  3TBI B;  5KNB A;  5GAH C;  2NN6 H;  2KVM A;  1B44 D;  2PNR C;  4HCE A;  3W5O A;  2VB2 X;  2BA0 A;  1L1O A;  3F2U A;  1KQS A;  2VB3 X;  3D4D A;  2K5D A;  3F2C A;  1CQV A;  1B9N A;  1O7Y A;  1PXU A;  1HNW L;  2XSC A;  3MAQ A;  1S72 A;  1KAB A;  1YHB A;  1EL0 A;  3MXN B;  1VQA A;  4JI3 Q;  1G2T A;  2Z8L A;  3GTG B;  4IPH A;  1LTR D;  2K4K A;  4UP7 A;  3NTI A;  1IZ6 A;  3KK7 A;  1HRJ A;  3C1E A;  2RCN A;  2EXZ A;  5JAV A;  1Q90 A;  2FFK B;  1M8A A;  4XT3 B;  4LK1 C;  2Q2I A;  3ND8 A;  4DV5 Q;  1UEB A;  1N9W A;  4U67 3;  4H02 A;  2HCI A;  2F0S A;  3WDN A;  4JI1 Q;  4CJ2 C;  5EKI A;  1XMO Q;  3RD4 A;  2B2V C;  3F2D A;  3EBE A;  3G4S A;  1IYV A;  1K8M A;  1GD7 A;  2G5D A;  2QDL A;  4A3B H;  4LF5 L;  1BCP D;  4X3T A;  1HNZ Q;  2KA7 A;  3HZX A;  3KUP A;  5C4H A;  1ET6 A;  1CKN B;  2A19 A;  2NB0 A;  4A75 A;  4DA2 A;  5C4J H;  2OXP A;  3ND9 A;  5JOB A;  4A3E H;  4BY7 G;  3TZU A;  1ONL A;  4QB4 A;  1YEZ A;  2CVR A;  2XNA C;  4R4T A;  5J39 A;  3ULL A;  4GLV B;  1Q12 A;  3A7A B;  4RG1 A;  2VXW A;  1BOS A;  3W1B A;  2N88 A;  5CV7 A;  5COR A;  1IL2 A;  2SOB A;  1VQD A;  3G7L A;  1EY5 A;  4BY7 B;  3R8B A;  3PCO B;  2B2V A;  4A4I A;  3C3L A;  1ILP A;  5D65 A;  2VNU D;  4O42 A;  1E2Z A;  1DCZ A;  1KLU D;  3PIP A;  2F0P A;  2C5C A;  1TU2 B;  3MEH A;  1C9O A;  3CCV A;  3V05 A;  2K75 A;  2A6E C;  1WTH A;  3OTO L;  5EKL A;  2KCC A;  1E1O A;  2C9O A;  3HOZ G;  3RN2 A;  4PG3 A;  5C5L A;  3GTP B;  2KJX A;  2CHB D;  1LLR D;  1WCM B;  1QG7 A;  4IFD J;  1DXM A;  4ODG A;  4JI3 L;  3GTK H;  1I5F A;  4QGU A;  1Z47 A;  4LAA A;  3QWN A;  4KLK A;  1HR0 L;  4L5S A;  2PQA A;  3D8G A;  5M3M H;  1KIX A;  2NVQ B;  2DUD A;  3SK6 A;  3OPO A;  1PZI D;  4XIG S;  4C3J B;  3PIO 3;  3J80 L;  3IRB A;  4JCV E;  1SNQ A;  4PQX A;  1IBM Q;  3HOU B;  4NDX A;  3OIP A;  3M9B A;  4CHT B;  4C2M H;  4X65 L;  4MNO A;  1ZXT A;  3I3C A;  3I4L A;  3G6J B;  1YHA A;  3PUX A;  2E2J H;  3GTJ B;  3NBH B;  4P72 A;  4Z9C B;  5EQ0 A;  2F0G A;  2HQE A;  1JIC A;  3HOV H;  2TMP A;  4BXX H;  3HKZ B;  1EWI A;  5GAG C;  5FOB B;  4AQY L;  2K5N A;  1DD2 A;  1BDO A;  1HH2 P;  2AMC B;  4ZQ3 A;  4DR5 L;  4KHP L;  3J80 i;  4X65 Q;  2K05 A;  2B39 A;  1EWC A;  2EDG A;  3P75 A;  3BDL A;  2ZM6 L;  4DV4 Q;  1LV9 A;  1QJO A;  1STA A;  4KMU C;  2M00 A;  4IUU A;  3HOV B;  4MN3 A;  3MXN A;  1G6P A;  3KF6 A;  4F88 A;  1PV4 A;  1HJP A;  3CD6 A;  5D3I B;  3KJO A;  1K9M C;  1E2V A;  2AHO B;  2EY1 A;  1UE7 A;  4OO1 I;  1FNU A;  2K6A A;  1A2T A;  3S2D B;  2ATW A;  4JOI C;  4KY5 A;  3CC2 A;  2KOL A;  2HDM A;  2EZV A;  1QZG A;  4R4O A;  1PRT B;  3KYH C;  1J5E Q;  2JA6 H;  1MBY A;  1N36 L;  1QCB D;  4QY7 A;  1TS5 A;  1NJI C;  4IJL A;  4B3M Q;  2X6G A;  4HCS A;  4A3J H;  5C0X J;  4IFD I;  1NTG A;  2NVY B;  2V1C C;  2WV6 D;  1E7Z A;  2MQH A;  1DOL A;  4FVM A;  1IKM A;  5ELB A;  5LL6 X;  2L15 A;  5DLQ E;  5BR8 L;  1MSH A;  4N8F A;  3NSW A;  1KAW A;  3HOX H;  1N34 L;  1PTO H;  1RIP A;  3M85 A;  4KKS A;  4MTN A;  1SSO A;  2LXJ A;  3H15 A;  3STB D;  2BH2 A;  1BR9 A;  2F0L A;  2NVY H;  2PZW A;  2WB1 B;  4DV3 L;  3IFT A;  4EQ5 A;  4OXP A;  1X56 A;  1E1T A;  5M5W B;  4DXG A;  4DR6 Q;  4I7Z C;  5FJ8 G;  1WTX A;  4R8I A;  3B6Y A;  5E7N A;  4X64 Q;  2JA8 B;  4HED A;  3J7Z C;  1VQO A;  2JEB I;  1IW7 D;  3TSS A;  4CJ1 B;  1LTS D;  3D4R A;  3S1R H;  4A3G G;  1XJV A;  4GLX A;  2EYO A;  2KCM A;  2WAC A;  4HID A;  4G7Z C;  2PI2 A;  4RKB A;  4OIK A;  3CP0 A;  2UUC L;  1AFP A;  4KD3 A;  4NKL A;  5M5W H;  4OWX B;  1BBU A;  1Q46 A;  2JA7 H;  1PFN A;  2OEO A;  4B9X A;  3DLL A;  2QEJ C;  4B3T Q;  1XPR A;  3G71 A;  2PI2 E;  3A8K E;  3VYR A;  4A3E B;  2UUA Q;  4A3G B;  4XQN A;  1NE3 A;  4YWM A;  5FLX E;  2R7Z B;  1RF2 D;  4MIU A;  2NYZ D;  1F2Z A;  2JN4 A;  3L7Z C;  5GAD C;  2E2H B;  1K0S A;  4RGM A;  1F9R A;  1TWC B;  1EQT A;  5K5P A;  1E24 A;  2EJM A;  4LF6 L;  2FJ2 A;  3MXG A;  1PTO F;  3A74 A;  4QJF A;  4V19 0;  1J9O A;  3E3X A;  1TWA H;  1RHP A;  4ME3 A;  5AJ3 L;  4OX9 L;  4A3E G;  2EY2 A;  3HGB A;  3LWE A;  4IUR A;  1JB7 A;  2C35 B;  2JE6 I;  3S15 B;  3TP8 A;  2NVX B;  2N3S A;  1VQK A;  2F3I A;  4DR7 Q;  1F9S A;  4EX5 A;  1PYS B;  4A3B G;  1AE2 A;  3Q24 A;  5FLM H;  1YNX A;  4PZ6 A;  1BCP B;  1PLF A;  2EY5 A;  4N9T A;  5J1Z A;  1N34 Q;  4DU9 A;  3OMG A;  1XMO L;  4A3I B;  3M4O B;  5FO8 B;  2ZTE A;  1PMR A;  4YIJ A;  2VW9 A;  2JA9 A;  2MUY A;  1TKW B;  1VQ7 A;  1G8Z D;  2KCT A;  3SK8 A;  2N78 A;  2RDG A;  2KHS A;  3FKI B;  3FDT A;  1V1P A;  4QCL A;  2BE5 D;  3PGZ A;  3K5L A;  4TVA B;  3HKS A;  3LNN A;  2KHJ A;  4C3I H;  3E9H A;  4X6A H;  2K32 A;  5M5X B;  4ZKB B;  3H3V H;  4G7O C;  1CFM A;  4A3I G;  5IP9 G;  4P71 A;  3PF4 A;  3SE0 A;  3C2P A;  1EU4 A;  1NMG A;  2RDH A;  3S15 H;  3CXC A;  2B2T A;  1LTG D;  4NP5 A;  1NNX A;  4WJW A;  4DR3 L;  4APV A;  2HHH Q;  4LFA L;  1VQI A;  4NMZ A;  4LUV A;  2A6H C;  3UDI A;  2I5M X;  2EYJ A;  1Q86 C;  1Y1V G;  1L1O C;  4CDE C;  1GUT A;  4A3J G;  1HQM C;  1A6X A;  1WTP A;  1BCP F;  4ALP A;  4ZRZ A;  1HPC A;  4YCV A;  4HJA A;  1PH4 A;  3VA7 A;  4ULL A;  1SNC A;  2A8V A;  5IT9 c;  4A3M B;  3S14 H;  1U4L A;  3CW2 C;  1FYC A;  2GN5 A;  4KJN A;  2B63 H;  4IUV A;  3UDG A;  1XNR Q;  1FNW A;  3OWF A;  3K5N A;  3E0J A;  1EYC A;  2EYM A;  2BOS A;  1D5X C;  2R93 B;  1PHJ A;  1ET9 A;  4RCO A;  1CA5 A;  4FP5 D;  3SDZ A;  2UXD Q;  2WKD A;  3K8A A;  2PMZ B;  3CHB D;  2IWH A;  5C4X H;  3M4P A;  3BYY B;  3FHW A;  5GAE C;  3EVQ A;  4PNY A;  1VQ9 A;  4NPS A;  2CH4 A;  3CCL A;  4BA1 I;  4LF8 Q;  3R2T A;  4JG2 A;  4C3H G;  1A62 A;  3VR2 A;  4V0B A;  1Y8P B;  1EYG A;  5CGK A;  4DK0 A;  4GN5 A;  1JE4 A;  4Q0F A;  4DXF A;  3BVM A;  4YCU A;  3K58 A;  3TME A;  3GTM H;  4N9P A;  2R93 G;  2V4D A;  2NVT H;  3CMA A;  2B2W C;  1N32 Q;  2O4X A;  1PH6 A;  2CWA A;  1O78 A;  4IUN A;  1CA6 A;  2ID0 A;  4QL5 A;  1RTO A;  2J0T D;  4FNF A;  4X66 Q;  4YY3 L;  2MNA A;  1X3Q A;  1STH A;  4JC0 A;  5C44 G;  2QIL A;  1MHW C;  5IGG A;  4X62 L;  3A8I E;  1G51 A;  1U0L A;  3FVQ A;  5AJ3 Q;  1VCI A;  3FPP A;  1JOO A;  4A3F G;  1I94 L;  5EPJ A;  2XWB B;  4HJ9 A;  1X32 A;  2VQF Q;  2F0H A;  1C0A A;  2HD3 A;  4NXM L;  2Y0S B;  3PMF A;  1XYI A;  4ZK9 B;  4GN4 B;  2VUM G;  4EQN A;  1HR0 Q;  3S17 H;  2PPB C;  2KBN A;  1SYB A;  2CCZ A;  1PH8 A;  3PO2 G;  4ZLT F;  1HNX Q;  2F4V Q;  5IYC H;  1TXY A;  1OXU A;  1CZW A;  1SYF A;  2Z6B A;  4GNX A;  5C44 B;  1QUQ A;  1U4P A;  4DUY Q;  3KLS A;  1D6E C;  5CR3 A;  1IL8 A;  5CBE E;  2UUA L;  2L9H A;  4X3K A;  2VQE Q;  1IHZ A;  2P5Z X;  5JVH 3;  5ELD A;  1I6H H;  2Y0S G;  3UDF A;  1EFW A;  1RDP D;  1RJT A;  2QCP X;  1OXT A;  2A6H D;  1LT5 D;  4DUZ Q;  1MI2 A;  5IT9 E;  4GNX B;  4LFB L;  4YWL A;  3L2P A;  4JI4 Q;  1K8O A;  2EQS A;  2IX3 A;  4R9W A;  1SJE D;  1TS4 A;  1HA6 A;  5T1G A;  3Q23 A;  2F4I A;  4DAY A;  1N33 Q;  3G48 A;  1KHI A;  4GZY C;  1A2U A;  1OTC A;  1YNN C;  5HUR A;  1JJ2 A;  5GQO A;  4WJ4 A;  1LO5 D;  2YYZ A;  4GNX C;  1SEB D;  1JMC A;  1SLJ A;  4R1J A;  1H95 A;  3Q22 A;  5I9O A;  4A93 G;  2RQX A;  3P1H A;  2EYP A;  3PIO A;  3J81 c;  4WRD A;  5ELN A;  1CUK A;  1VQF A;  3S24 A;  3GO5 A;  3KF8 A;  2IX1 A;  1VQB A;  2TSS A;  4A3M G;  3PO3 H;  1K0R A;  2K33 A;  3MFY A;  1E3P A;  4WOR A;  1WYD A;  2XGT A;  5IYB G;  1PA6 A;  4A3L H;  4OO1 G;  2NTS A;  3RMH A;  1HCZ A;  2EY6 A;  3E0E A;  4OEM B;  1F77 A;  1CZG A;  3GV6 A;  2JYO A;  1YIT A;  4GS3 A;  1FGB D;  1PH3 A;  2EJF C;  5IOD A;  4DR5 Q;  3VYU A;  4LNQ A;  3K7U C;  3PSI A;  5JPM C;  1VQL A;  4C3H B;  3U58 A;  2DGY A;  3QB3 A;  1VQC A;  4MHE A;  2F0Q A;  1JWU D;  1CT1 D;  3K5O A;  4FF2 A;  1Q1B A;  1ROD A;  2XVS A;  1C4Q A;  2HCC A;  1B8A A;  1HZ9 A;  2F0F A;  4Y52 H;  2VQF L;  2CWP A;  1K8A C;  3PUY A;  1LTT D;  3LX0 A;  3CQZ B;  3QOL A;  3HOZ B;  1SND A;  2QKI C;  2Z0S A;  3KF6 B;  3MXP A;  3TN2 A;  4DR6 L;  2CH4 W;  5IGF A;  1LTA D;  1S5C D;  1WCM G;  3A56 A;  2RSN A;  3GTQ B;  3SK5 A;  4LFC Q;  4IQZ A;  2F4V L;  2XRS D;  4MZ9 A;  4EGV A;  5HY6 A;  3R3O A;  1A3V A;  1Z9F A;  4KHV A;  4K8I A;  2O2L D;  4DV2 L;  4CJ0 B;  1SRU A;  4DNI A;  1WTO A;  4DR7 L;  2R7D A;  4IUT A;  3AMU A;  1DJR D;  4K0K Q;  2O5I C;  4BBS B;  3WOE A;  2G9D A;  4C3J G;  3PO2 B;  2LSS A;  3OIQ A;  3HOU G;  3I4N B;  1EQQ A;  3W2D A;  5J3B A;  1YJ9 A;  2EYF A;  4JW0 A;  1SBB B;  4TSS A;  1K3B C;  5C5M A;  1CK1 A;  2AQ3 B;  4C3H H;  1F2M A;  1BUV T;  2KQ3 A;  4ME5 A;  3I4N H;  4HSP A;  4IAL A;  2WB1 E;  4UHV A;  4DUY L;  4RA8 A;  2D9U A;  4A3B B;  5EPL A;  3STB C;  1YNN D;  1IKL A;  5LMU L;  1YNJ C;  1AW7 A;  1E2W A;  4K6L A;  3TRZ A;  3S1Q B;  4HTH A;  1JOR A;  4YWK A;  3I4N G;  5G3L F;  4J8Q A;  1ESR A;  2JXM B;  5C4Z A;  4L5R C;  4IJH A;  1NMF A;  5CV6 A;  1SE4 A;  1EQR A;  2N49 A;  3HOV G;  4RMF A;  1PH5 A;  2FMC A;  2FHT A;  5COY A;  4FXD A;  1ICF B;  2YTX A;  1HUN A;  5JVG 3;  5HGT A;  1R9T B;  2BDN A;  2ZJQ A;  5JJL A;  3C46 A;  1TWH B;  3VR5 A;  1SJH D;  1QNU A;  2A73 B;  3AFQ A;  2YTV A;  1R4P B;  4BBR H;  1GUN A;  3KJP A;  4IPC A;  4QIW E;  2Z1C A;  1CKN A;  2B3G A;  4Q5V A;  2WP8 J;  3GTJ H;  2JSO A;  1U9R A;  3AQQ A;  3QOJ A;  3HOY G;  3URY A;  1STG A;  3I4M B;  3P20 A;  4K0K L;  2AWN A;  4DR1 Q;  5IYD G;  2JA5 B;  2MJ8 A;  5EBD A;  2AQ1 B;  1N36 Q;  1VQN A;  2MHV A;  1EZ8 A;  4K6D A;  1SE2 A;  2K5W A;  4J1M A;  3NWS A;  4C1N K;  4A3L G;  5FLX L;  2JP1 A;  5IIF A;  1KTK A;  2LFN A;  3RZD H;  5DEH A;  3HFZ B;  4FF1 A;  1HNX L;  3T56 B;  3HOY B;  4IOA A;  4FXG C;  2Q8R E;  4JI2 Q;  3RLN A;  1KNA A;  2F0W A;  2K01 A;  1SNO A;  2BH8 A;  2X69 A;  3T16 A;  3U9O A;  3X3M A;  4JI5 Q;  5FKA C;  2H5X A;  2EPB A;  1TWF H;  1U5K A;  1KRT A;  3J7A F;  1NY4 A;  4BWG B;  1STN A;  5IY0 A;  3I8Z A;  2JA7 B;  1BXT A;  4OEL B;  1B3Q A;  2NVT B;  1PH1 A;  1P16 A;  1Q8I A;  2M2L A;  1XMQ L;  1BBX C;  2VZA A;  4A93 H;  1K73 C;  4JI6 L;  5C0X G;  3JAM E;  1EY9 A;  4LF4 L;  3A5Z B;  2LMC B;  1YJW A;  4JI0 Q;  2DJF C;  1H9J A;  1LM0 A;  2UXB L;  3G6E A;  3S1M H;  1JE5 A;  1TVX A;  3CCM A;  4RCN A;  1SAP A;  1X3F A;  1GUS A;  2I0Q A;  2IX0 A;  2K50 A;  3NEM A;  1WTQ A;  2KEC A;  4A3F B;  1B3A A;  4NXN L;  2R7Z G;  4DR4 Q;  1I4G A;  3MC0 B;  4LF9 Q;  2JA7 G;  4OHJ A;  3J81 j;  1M1K C;  3S17 B;  3T53 B;  2G9H D;  1U4M A;  4X3U A;  4KI0 A;  3OWE B;  5IYD H;  4AH6 A;  5FLX c;  2EE1 A;  4DV6 Q;  1EZ6 A;  2WFW A;  1EY4 A;  4R8N A;  1WD1 A;  1V43 A;  3KF8 B;  1FGU A;  3CC7 A;  4GOP C;  2OQK A;  4DUZ L;  1B4O A;  5C4J B;  4GKK Q;  2MPM A;  1PH2 A;  1A63 A;  5I2X A;  4L8J A;  5A2Q E;  1DGS A;  3KLW A;  3I91 A;  4LFA Q;  4CBV A;  2OWO A;  1LTI D;  2WAQ E;  2Z9H A;  2UXC L;  5KRU A;  3F8T A;  2NTT A;  2UU9 L;  4A3D H;  1PRT C;  1DOK A;  3E5S A;  4A3F H;  1B70 B;  1HZA A;  3MWY W;  3GDE A;  2AKW B;  1SN8 A;  2GA4 B;  3V96 A;  2XN9 C;  3VA5 A;  3IFD A;  3HOX G;  1S40 A;  3S2D H;  4BA2 I;  2D0O A;  2DJG C;  4CKB A;  5C4X B;  4DV0 Q;  3J81 i;  2F0I A;  3F2B A;  3NUC A;  1S5D D;  3ICE A;  2BA1 A;  2R93 H;  3FEW X;  3A5U A;  1ZEQ X;  4OX9 Q;  5G3L D;  1IBK L;  2CFM A;  3O13 A;  5JJZ A;  3GQB A;  4KV6 A;  1WTR A;  3NP8 A;  2UU9 Q;  2B2U A;  4CDC C;  1ENA A;  5D3D A;  2D62 A;  5C4X G;  3A7L A;  1Y1V B;  2JA5 G;  5JEA J;  3UE0 A;  2JA5 H;  1KDA A;  2A68 D;  2WKC A;  2E5L L;  2D5D A;  1K28 A;  2PO4 A;  1PYW D;  5KNC A;  4POG A;  2AQ2 B;  3BDO A;  4LF4 Q;  1IYU A;  4YHH L;  2E2J B;  3NK9 A;  4EQP A;  1Y1W B;  4JI4 L;  3PO3 B;  1C8C A;  2IY5 B;  1XNQ Q;  3QO2 A;  4G57 A;  4GOP A;  4K8J A;  3GP7 A;  5EKK A;  3MHB A;  1MJC A;  4OWT B;  1EFI D;  1ML0 D;  4JI5 L;  4QMG A;  4NXN Q;  3SEB A;  4FO2 A;  4DR4 L;  1CQF A;  2E2H H;  1Y1V H;  4YCW A;  2PW7 A;  1X3E A;  4UAI A;  1CM9 A;  1OO9 B;  4LF8 L;  4LF7 L;  1TWH H;  1FL0 A;  5K36 H;  5D14 A;  1OXS C;  4JI0 L;  4XXE A;  1J5E L;  1VQ4 A;  1E0B A;  4GOP B;  2R3Z A;  4C1N I;  5IOC A;  2F1M A;  5LMN L;  4HMJ A;  5BN3 A;  3HRZ C;  4C3I G;  5CC4 A;  4AIM A;  3DXJ C;  3CCE A;  4JYA L;  2EVB A;  3NTK A;  2F3V A;  1ASZ A;  2F0K A;  4ZCK A;  2I07 B;  3OHX C;  4PMB A;  1XPO A;  1X3G A;  5LMU Q;  1KXL A;  3KBX A;  3E6Z X;  4QQB X;  2L55 A;  1K3R A;  3GTO H;  3LWU A;  4K5X A;  1KD1 C;  2ZXO A;  1NR2 A;  4DV4 L;  4OL7 A;  3SR1 A;  4KKT A;  5BN5 A;  1ENF A;  3CRK C;  3CCQ A;  3BDC A;  3S1Q H;  3SHL A;  5M5Y B;  4DAY B;  3NBH A;  5JEA G;  2VUM B;  1OXV A;  4ZUI A;  4I65 A;  2RHS B;  3BVG A;  4IOC A;  4LUZ A;  3I55 A;  2R7Z H;  3CCU A;  4A3K H;  4KJO A;  2OCE A;  1VF7 A;  1TWG H;  3WWV A;  3K7A H;  1Y8O B;  1X55 A;  3MZ5 A;  4HMI A;  1PFB A;  4DV1 Q;  1V1P B;  4JI8 Q;  2YV5 A;  3SK4 A;  5TSS A;  4LFC L;  3RLO A;  4LMQ D;  3M3Y B;  1EIY B;  3HOW G;  2JEA I;  2Z6K C;  1EY6 A;  1JR0 D;  3K59 A;  1QZH A;  1B9M A;  1PYB A;  2HIV A;  3OMC A;  1STY A;  1PDQ A;  4R4C A;  4HJ7 A;  3CPW A;  1F9Q A;  4K5W A;  3ER0 A;  1ILQ A;  2JJQ A;  5H1S E;  1M4V A; 
#chains in the Genus database with same CATH homology
 1CSQ A;  1E3P A;  5IWA Q;  4A3K G;  2VNU D;  1WYD A;  2XGT A;  1FVI A;  5IYB G;  3PIP A;  1PA6 A;  4A3L H;  4OO1 G;  1C9O A;  3CCV A;  3GTG H;  2K5V A;  1K83 H;  3E0E A;  2K75 A;  4DPG A;  2R92 G;  2VL6 A;  1JT8 A;  3OTO L;  2YTY A;  2RHQ B;  1E1O A;  1YIT A;  4GS3 A;  2RF4 A;  4JI6 Q;  4OWW B;  3HOZ G;  3RN2 A;  1PH3 A;  4PG3 A;  1N32 L;  4Y52 H;  4DR5 Q;  4LNQ A;  3H0G G;  3K7U C;  3T1Y Q;  3PSI A;  2KHI A;  4BY1 G;  1VQL A;  2R6G A;  4A3G H;  4IFD J;  1Y1W G;  3U58 A;  1YI2 A;  4IFD G;  1SR3 A;  1VQG A;  1S3O A;  2DGY A;  3EIV A;  2Q2U A;  4JI3 L;  1VQC A;  3GTK H;  5IYC G;  3M4O H;  1I5F A;  4QGU A;  4JYA Q;  1Z47 A;  4JI2 L;  1AH9 A;  2HT1 A;  4KLK A;  1HR0 L;  3PO2 H;  4L5S A;  1Q1B A;  1X54 A;  2PQA A;  2Y0S E;  5M3M H;  1KIX A;  1SMX A;  2VUM H;  1B8A A;  1HZ9 A;  2CKZ B;  4BBR G;  1I94 Q;  2DUD A;  2I5L X;  2I5H A;  4XIG S;  2CWP A;  2VQF L;  1VQM A;  4JI8 L;  5M5Y H;  3HKZ G;  3U4V A;  1K8A C;  4DV3 Q;  3IRB A;  4B3R L;  2QGQ A;  3PUY A;  4JCV E;  1UE1 A;  1MIU A;  3I4O A;  1IBM Q;  1Q8K A;  4DV5 L;  2Z0S A;  3KF6 B;  3TEH B;  4DR6 L;  3M9B A;  1RL2 A;  2IHE A;  4C2M H;  4X65 L;  1WCM G;  4MNO A;  1QVG A;  5C44 H;  5LMN W;  4LF7 Q;  1YHA A;  3PUX A;  2ZJR A;  2E2J H;  4LFC Q;  2F4V L;  5K36 G;  2IT1 A;  4MZ9 A;  4DR1 L;  5HY6 A;  3GD7 A;  3KDF B;  4DK6 C;  3NBH B;  1Z9F A;  5BR8 Q;  3KFU A;  3S16 H;  1O7I A;  4P72 A;  2Q2H A;  4DV2 L;  3S1N H;  4AYB E;  4NB3 A;  1VQ6 A;  1SRU A;  2NZH A;  4DNI A;  3GTL H;  2R7D A;  4DR7 L;  4K0K Q;  3PUW A;  4KHZ A;  2UUB Q;  1D8L A;  1KC8 C;  3HOV H;  4BXX H;  4JOI A;  1EWI A;  2LSS A;  1PH7 A;  5GAG C;  4DK3 C;  4AQY L;  3HOU G;  1EQQ A;  2OTJ A;  5J3B A;  4DV7 L;  1YJ9 A;  3UDX A;  3D31 A;  2K5N A;  4C3H H;  1QVC A;  1HH2 P;  2AMC B;  4DR5 L;  4KHP L;  3HKZ E;  3E9I A;  4JI7 Q;  3J80 i;  4X65 Q;  3CCJ A;  4UP8 A;  1SFO H;  4TQU S;  4HIM A;  2PQA B;  3I4N H;  2ZM6 L;  1P8L A;  1XMQ Q;  2WB1 E;  4DUY L;  4DV4 Q;  3JAM c;  3STB C;  1MJE A;  4LF6 Q;  2JQO A;  4BBS H;  3CF5 A;  1JJC B;  3U50 C;  1A8V A;  3PV0 A;  1G6P A;  4BBS G;  2VY3 A;  3KF6 A;  1WI5 A;  5LMU L;  3TRZ A;  1PV4 A;  1HJP A;  3TQY A;  3CD6 A;  4HJ8 A;  1XTD A;  1GVP A;  4YWK A;  3KJO A;  1K9M C;  3I4N G;  1D7Q A;  2AHO B;  2ALY B;  2B63 G;  3RR5 A;  1UE7 A;  4AYB G;  5M3F H;  2NN6 I;  4OO1 I;  4L5R C;  2LXK A;  4IJH A;  1NMF A;  3KOJ A;  2ATW A;  5C0X I;  4JOI C;  3CC2 A;  4X66 L;  4B3S L;  1QZG A;  4JBK A;  4R4O A;  3KYH C;  1J5E Q;  3HOU H;  1EQR A;  2N49 A;  2JA6 H;  1N36 L;  1NJI C;  4QY7 A;  4JBJ A;  4X62 Q;  4BXX G;  4IJL A;  4DR3 Q;  2HHH L;  3HOV G;  2WB1 G;  4RMF A;  2K52 A;  3NEN A;  4A76 A;  4B3M Q;  4A3J H;  5C0X J;  1PH5 A;  4B3T L;  4IFD I;  1NTG A;  3M3Y H;  1VQH A;  2V1C C;  5EAY A;  1YIJ A;  4JV5 Q;  1E7Z A;  2MQH A;  1W3S A;  4GKK L;  4JBW A;  2JA8 G;  3J7A 5;  1QVF A;  1ASY A;  3M4Q A;  2L15 A;  5DLQ E;  2YTX A;  5BR8 L;  1C7Y A;  3CME A;  1L0W A;  3HOX H;  1HZC A;  1KAW A;  1N34 L;  1I3Q H;  2MO1 A;  1RIP A;  1WCM H;  3M85 A;  1IYJ B;  2ZJQ A;  3PUZ A;  4JI1 L;  4MTN A;  3U4Z A;  1CKM A;  5JJL A;  2LXJ A;  2EXD A;  3H15 A;  4A3I H;  1W2B A;  3STB D;  1LYL A;  2BH2 A;  1HZB A;  1X65 A;  3AFQ A;  2NVY H;  2YTV A;  4PMW A;  4DV3 L;  4BBR H;  4EQ5 A;  4OXP A;  3KJP A;  5M3M G;  1X56 A;  1FJG L;  3K81 C;  1E1T A;  4IPC A;  2ZJP A;  4QIW E;  4DR6 Q;  5FJ8 G;  1CKN A;  3B6Y A;  5E7N A;  4X64 Q;  2B3G A;  3J7Z C;  2WP8 J;  3ULP A;  2E5L Q;  3GTJ H;  1UE5 A;  2JEB I;  2N8N A;  2XTI A;  1VQO A;  3AQQ A;  5IE8 A;  4LF5 Q;  3RN5 A;  3HOY G;  3S1R H;  3OW2 A;  1HNZ L;  3GTQ H;  4A3G G;  3RNU A;  4POF A;  1XJV A;  4GLX A;  3AEV A;  2MFI A;  4LF9 L;  2KCM A;  4HID A;  2PI2 A;  4K0K L;  4YHH Q;  2E2I H;  3HOZ H;  2CQO A;  3CP0 A;  2AWN A;  2UUC L;  1LUZ A;  1SRO A;  3UE1 A;  5M5W H;  4OWX B;  2R92 H;  4HIK A;  4DR1 Q;  1BBU A;  5IYD G;  3OTO Q;  5FLM G;  3PUV A;  4A3C H;  1Q46 A;  2GVA A;  2PNH A;  2QEX A;  1N36 Q;  3Q8D A;  4NXM Q;  1VQN A;  2YU9 H;  1YVC A;  3T1Y L;  2JA7 H;  3CPF A;  3DLL A;  1HR0 W;  4A3L G;  4B3M L;  5IYB H;  5IP7 H;  4B3T Q;  3FKI H;  1XPR A;  3G71 A;  2PI2 E;  3BJU A;  3RZD H;  3RLF A;  3HFZ B;  2UUA Q;  1HNX L;  4AQY Q;  2OQ0 A;  4IOA A;  3BU2 A;  4JI2 Q;  3RLN A;  1NE3 A;  4YY3 Q;  2BH8 A;  4A3M H;  4JI5 Q;  3GTP H;  3PO3 G;  4YWM A;  1XNR L;  2UXD L;  3I4M G;  2H5X A;  3KDF A;  1TWF H;  1U5K A;  1KRT A;  1NY4 A;  1Q81 C;  4PZ8 A;  3L7Z C;  5GAD C;  5IWA L;  1X6O A;  5IY0 A;  4LFB Q;  4DR2 Q;  1GM5 A;  1PH1 A;  1P16 A;  1XMQ L;  4A93 H;  2VZA A;  3PF5 A;  1K73 C;  4JI6 L;  5C0X G;  4JBM A;  1V9P A;  1E24 A;  3HOW H;  4WJ3 M;  4LF4 L;  3A5Z B;  4IO9 A;  1K8G A;  1YJW A;  2R7F A;  4JI0 Q;  4LF6 L;  1A0I A;  1LTL A;  3A74 A;  5JJI A;  1LM0 A;  4QJF A;  5HGQ A;  2UXB L;  3G6E A;  1HNW Q;  3I4M H;  4J15 A;  1TWA H;  3S1M H;  1FJG Q;  4ME3 A;  5AJ3 L;  3T1H Q;  4OX9 L;  4A3E G;  1JE5 A;  3CCM A;  1JB7 A;  2C35 B;  2EIF A;  1X3F A;  1J6Q A;  2JE6 I;  3F1Z A;  4DV1 L;  2I0Q A;  2IX0 A;  2N3S A;  2K50 A;  3NEM A;  1VQK A;  1SE8 A;  1IBL Q;  2F3I A;  2NZO A;  4XTC S;  1Q82 C;  3CQZ H;  4NXN L;  2R7Z G;  3FKI G;  4GN3 B;  5IP7 G;  4DR4 Q;  2UUB L;  4DR7 Q;  4EX5 A;  2B29 A;  1PYS B;  1Y14 B;  4R4Q A;  1OXX K;  4LF9 Q;  4A3B G;  1AE2 A;  1M1K C;  3J81 j;  2JA7 G;  1XNQ L;  1TWC H;  4R4I A;  2UXC Q;  2UUC Q;  5FLM H;  1L1O B;  1YNX A;  4PZ6 A;  4KI0 A;  5IYD H;  4IPG A;  4AH6 A;  4P73 A;  5FLX c;  3JAM i;  1N34 Q;  4DV6 Q;  2WFW A;  4LUO A;  1XMO L;  1V43 A;  2K5H A;  3KF8 B;  3LGJ A;  1FGU A;  2ZTE A;  2ASB A;  4GLA C;  4JV5 L;  3CC7 A;  4GOP C;  2OQK A;  5GRO A;  4DUZ L;  1GO3 E;  1IBL L;  4LWC A;  2VW9 A;  2AWO A;  4GKK Q;  1R9T H;  2JA9 A;  1EIF A;  1CKO A;  2ZM6 Q;  3DM3 A;  3HOY H;  1VQ7 A;  1PH2 A;  1WJJ A;  2KCT A;  1A63 A;  2N78 A;  3ULJ A;  2K14 A;  4P75 A;  1KL9 A;  1DGS A;  3KLW A;  5FJ8 H;  4LFA Q;  4L5Q A;  3PGZ A;  1EOV A;  1YJN A;  4TVA B;  1VQ8 A;  4DKA C;  3HKS A;  2PMZ E;  4LW1 A;  2OWO A;  3BZC A;  2KHJ A;  4C3I H;  3E9H A;  4X6A H;  2WAQ E;  2UXC L;  3OYY A;  3F8T A;  3H3V H;  2UU9 L;  4A3D H;  1PVO A;  1L2F A;  4A3I G;  5IP9 G;  4P71 A;  4A3F H;  1B70 B;  1HZA A;  3GDE A;  3PF4 A;  2AKW B;  3I2Z A;  2ES2 A;  1SN8 A;  1IBK Q;  1NMG A;  3S15 H;  3CXC A;  3HOX G;  3S2D H;  1S40 A;  2VQE L;  4DR3 L;  2HHH Q;  4APV A;  4BA2 I;  4LFA L;  1VQI A;  2D0O A;  4LUV A;  3UDI A;  2I5M X;  4DV0 Q;  2JA8 H;  4KHP Q;  3J81 i;  2FXQ A;  4OON A;  1Q86 C;  1Y1V G;  2NN6 G;  1L1O C;  3F2B A;  3ICE A;  3ERS X;  5JJK A;  2BA1 A;  2R93 H;  2KEN A;  4A3J G;  3CCR A;  1IBM L;  3A5U A;  3T1H L;  4OX9 Q;  1QUQ B;  3EN2 A;  4ALP A;  2CFM A;  1IBK L;  1X9N A;  3TS0 A;  2JA6 G;  1MKH A;  4YCV A;  4HJA A;  1YZ6 A;  3TS2 A;  1PH4 A;  2A8V A;  5IT9 c;  1N8R C;  2UU9 Q;  3AYH B;  1GKH A;  3S14 H;  3CW2 C;  3RZO H;  2GN5 A;  5M3F G;  4HIO A;  4IPD A;  1WFQ A;  2B63 H;  2D62 A;  3VDY A;  5C4X G;  1G29 1;  3K80 C;  3UDG A;  1XNR Q;  4GKJ Q;  3M7N A;  1V1Q A;  3K0X A;  2JA5 G;  5JEA J;  2QA4 A;  4P74 A;  1IXR A;  3UE0 A;  2JA5 H;  3I7F A;  1PHJ A;  3SGI A;  2E5L L;  2UXD Q;  3K8A A;  3CCS A;  2A1A A;  1PH9 A;  5C4X H;  4JI7 L;  3A0J A;  3M4P A;  4POG A;  4LF4 Q;  2HIX A;  3FHW A;  1BKB A;  5GAE C;  1VQ9 A;  4NPS A;  4YHH L;  3CCL A;  4BA1 I;  4LF8 Q;  2MO0 A;  4JG2 A;  2NVX H;  4UY8 C;  1YHQ A;  3JC6 6;  1A62 A;  1EYG A;  4JI4 L;  2UXB Q;  1AE3 A;  2D0P A;  1XNQ Q;  2ZTC A;  1BVS A;  4GKJ L;  2IY5 B;  4GN5 A;  1UWV A;  1VQ5 A;  2Z6K A;  4GOP A;  1VQE A;  2F52 A;  2ZTD A;  1N33 L;  4O2D A;  5M5X H;  1MJC A;  3CAM A;  4OWT B;  4YCU A;  4JI5 L;  4C3J H;  3GTM H;  4NXN Q;  4DR4 L;  2R93 G;  1CSP A;  5GAH C;  2NVT H;  3CMA A;  2E2H H;  1WOC A;  1Y1V H;  1PH6 A;  4YCW A;  1N32 Q;  2CWA A;  5ELO A;  1X3E A;  3W5O A;  4HJ5 A;  4LF7 L;  4LF8 L;  1TWH H;  2ID0 A;  3NEL A;  4QL5 A;  4X66 Q;  2BA0 A;  1L1O A;  4YY3 L;  2MNA A;  1FL0 A;  1KQS A;  2OTL A;  1XPU A;  4B3S Q;  1OXS C;  1E22 A;  4JC0 A;  3F2C A;  1NBW A;  5C44 G;  4DV0 L;  4JI0 L;  3FP9 A;  2Q2T A;  1J5E L;  4X62 L;  4DV7 Q;  1PFS A;  1VQ4 A;  1HNW L;  4GOP B;  1S72 A;  1G51 A;  1U0L A;  1YHB A;  1B7Y B;  1VCI A;  3MXN B;  4UP9 A;  5IP9 H;  5AJ3 Q;  3ZJY C;  4DR2 L;  1I94 L;  1BBW A;  4HJ9 A;  4A3D G;  2VQF Q;  1JJG A;  1VQA A;  4UPA A;  1C0A A;  4NXM L;  5LMN L;  4JI3 Q;  1Q1E A;  3L0O A;  3BZK A;  4AIM A;  4GN4 B;  3CCE A;  2VUM G;  1HR0 Q;  2IHF A;  3S17 H;  4JYA L;  3W1G A;  1ASZ A;  2VS1 A;  2KBN A;  4IPH A;  1Q7Y C;  4PZ7 A;  2CCZ A;  2K4K A;  4UP7 A;  1PH8 A;  3PO2 G;  1IZ6 A;  1XPO A;  1KRS A;  1HNX Q;  1X3G A;  5LMU Q;  1KXL A;  2F4V Q;  5IYC H;  3J80 c;  1TXY A;  4FDB A;  2RCN A;  1OXU A;  2JK8 A;  3I56 A;  4QQB X;  1K3R A;  4GNX A;  3D0F A;  4L5T A;  3GTO H;  1KD1 C;  1Y1W H;  1QUQ A;  2E8G A;  4DUY Q;  4DV4 L;  2Q2I A;  4BY1 H;  1I50 H;  1T9H A;  2WAQ G;  4DV5 Q;  1UEB A;  2UUA L;  3H0G H;  1N9W A;  1VQP A;  3S2H H;  4H02 A;  2VQE Q;  3CCQ A;  3S1Q H;  2GVB A;  4O0A A;  4JI1 Q;  1I6H H;  2Y0S G;  3UDF A;  4DAY B;  3TRE A;  1EFW A;  1XMO Q;  5JEA G;  1YBY A;  4DV6 L;  1OXT A;  3F2D A;  1OXV A;  2NVQ H;  1UE6 A;  3EBE A;  3G4S A;  1GD7 A;  4DUZ Q;  2RHS B;  4DV2 Q;  4LF5 L;  4A3F G;  4IOC A;  4A3B H;  4LUZ A;  1HNZ Q;  4GNX B;  4LFB L;  4YWL A;  3L2P A;  3I55 A;  2R7Z H;  4JI4 Q;  3H3V I;  1EUJ A;  2EQS A;  3CCU A;  4A3K H;  4Y7N H;  2OCE A;  4A4I A;  5C3E G;  4A3C G;  1CKN B;  1TWG H;  2A19 A;  3WWV A;  3K7A H;  4X64 L;  4A75 A;  4DAM A;  1N33 Q;  5C4J H;  1X55 A;  3G48 A;  1KHI A;  3CC4 A;  4A3E H;  4BY7 G;  1M90 C;  1OTC A;  4DV1 Q;  5GQO A;  1JJ2 A;  4WJ4 A;  1YEZ A;  4R4T A;  2YYZ A;  4JI8 Q;  2YV5 A;  4GNX C;  4LFC L;  1SLJ A;  3RLO A;  1JMC A;  3ULL A;  4GLV B;  4B3R Q;  1Q12 A;  4R1J A;  1EIY B;  3HOW G;  1H95 A;  4RG1 A;  4A93 G;  2JEA I;  2Z6K C;  3W1B A;  3PIO A;  3J81 c;  1QZH A;  2HQL A;  5ELN A;  1CUK A;  1VQF A;  1PYB A;  2HIV A;  1IL2 A;  3S24 A;  3GO5 A;  1VQD A;  2IX1 A;  1VQB A;  1VQJ A;  1VS0 A;  4R4C A;  4A3M G;  3PO3 H;  1K0R A;  4HJ7 A;  4BY7 H;  3CPW A;  3MEF A;  3ER0 A;  2JJQ A;  5H1S E;  3AFP A;  5LMN Q;  3PCO B;  5C3E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...