3KF6B

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
PLGSDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 31
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6B00
4YCUA 4DR5L 1DGSA 2XTIA 3OW2A 3KJOA 2E8GA 1VQMA 4DV4L 1YHQA 1TWGH 1C9OA 1YBYA 5C3EG 3W1GA 3M9BA 3RN2A 5LMNL 4LF9Q 2R6GA 3CCMA 2ALYB 1OTCA 3S16H 3ER0A 4A3MH 1EFWA 1WCMG 1RIPA 3GTJH 2E5LQ 2D0PA 2HIXA 4XTCS 1J5EQ 2JA7H 4B3RQ 1B70B 1I50H 3F8TA 2R93H 1VQ4A 3HOXH 3K7AH 4DUZQ 2R7ZG 3B6YA 2QEXA 2KHIA 4YHHQ 2JA8G 1YIJA 3HOWG 2WP8J 3OYYA 2H5XA 1QUQA 3CCEA 1XMOQ 1XNRL 1QZHA 1EIYB 4ALPA 3CMEA 4JI8L 1XJVA 4DR2L 1XNQL 1QUQB 2ES2A 3MXNB 4JYAQ 3GD7A 4IPDA 4X66L 2UU9L 1V1QA 4A3FH 2UUBL 3NENA 4GLXA 1VQAA 1Q82C 3H0GH 4LF5Q 1VQ8A 3HFZB 5JJKA 1I3QH 5IP9H 1NJIC 1GD7A 2NN6I 2KHJA 3K81C 4P72A 4RG1A 1SFOH 1GVPA 4X64Q 4L5RC 2F3IA 3CAMA 4DV5Q 2E2IH 2ID0A 1YZ6A 3A5UA 5M5YH 1KL9A 5C0XI 3BZCA 2JJQA 2FXQA 2MO1A 1EOVA 4QGUA 2QGQA 1PYSB 4DV1Q 3VDYA 1N36Q 4AYBG 3PSIA 2CFMA 5JEAJ 1UE1A 4X62L 1KAWA 1IBML 4GKKQ 2RF4A 4O2DA 1EWIA 2DGYA 1KD1C 3HOVH 3F2DA 3PGZA 4JCVE 4B3ML 2K5NA 2F52A 3AFPA 3AYHB 1YEZA 2K5HA 3CMAA 1GO3E 3STBD 1A8VA 2IY5B 2UXDL 4DV0L 2YYZA 4P75A 1OXSC 1X3GA 4JI1Q 2DUDA 4PMWA 4PZ7A 3JAMi 4AH6A 4DV7Q 4A93H 1BBUA 4JI6Q 3LGJA 3AEVA 1X54A 2IHFA 3S2DH 1E1TA 3TQYA 2RHSB 4A3KG 1N33L 1HZBA 4JI5Q 1PH6A 4HJ8A 4JI3Q 1N34L 4H02A 5J3BA 3PO3G 3M7NA 4TQUS 4A4IA 3U4VA 1VQBA 4DR6Q 1SRUA 1G51A 2JA5G 2A8VA 3M3YH 4JI7Q 2OTLA 2EIFA 3BJUA 1FJGL 3EIVA 4YY3Q 4IFDG 4A3DH 1L1OA 5FJ8H 1IBKQ 4YCWA 2A1AA 3FKIH 3HKSA 5HY6A 4DV2L 1JB7A 1EYGA 1VQ5A 2ZTCA 4DUYL 4HIMA 3ULPA 3GTPH 3HOYG 2UXCL 5IYBG 3S14H 1L1OB 4P73A 1G6PA 2JEAI 1A62A 2HQLA 4UP9A 2EXDA 4LF8L 4A3JH 1XPUA 1T9HA 2IX0A 5JEAG 5IYCH 2JQOA 4UY8C 1E7ZA 4JI2Q 1VQ7A 4IO9A 2AMCB 3KDFA 4NXNQ 2PQAA 4JI0L 3GTQH 3M4PA 5C3EH 2C35B 3M85A 1L1OC 1UE6A 2K50A 3KDFB 2PQAB 1WOCA 4AQYQ 4KHPL 3GTOH 4GLVB 1WCMH 3NELA 1CUKA 3UDFA 1IL2A 4HIKA 2I0QA 4MTNA 1K9MC 4JI2L 4L5QA 4R4QA 5GAGC 1XMQQ 2BA1A 2JA8H 3KF8B 3HOWH 2BH8A 5M5WH 3E9IA 4TVAB 4A76A 1YHBA 2VL6A 5C44H 1HNZL 1BVSA 4IPGA 4X65Q 4BXXG 5IE8A 2KENA 5HGQA 5C4JH 4JI4L 4LF6L 3PIOA 1VQDA 1YVCA 3W1BA 4HJ5A 5K36G 3PUXA 1NY4A 1YNXA 2Q2IA 2R7FA 5FLXc 2HT1A 4A3GG 4K0KL 1CKOA 3A0JA 5GROA 2IHEA 2L15A 2HHHQ 4LFBL 2K52A 1Q1BA 2K5VA 3J80c 3F2BA 2PI2A 4OWXB 1TWFH 3A5ZB 4LUZA 4ME3A 2K4KA 2UUAL 1PVOA 1BBWA 2R7DA 1IBLL 4LF4Q 3K0XA 3JC66 4LUVA 4LFAQ 4DR1L 1AE3A 1I94L 5GQOA 1VQPA 3M4QA 1PYBA 4GNXA 5IP7G 4LFCQ 4XIGS 3J80i 4DKAC 2VQFL 2Y0SG 4JV5L 1AE2A 4GNXB 1L2FA 1G291 3TS0A 3TREA 1EQQA 2MFIA 3FP9A 3CD6A 4OX9Q 2K14A 5M3MG 4C3IH 4IPCA 4A3IH 4MZ9A 3GTKH 1MKHA 4OO1I 4QIWE 4LF9L 3J81j 4WJ4A 2D0OA 1X9NA 4GNXC 5EAYA 1Q7YC 1SROA 3D0FA 2VW9A 1J5EL 3KOJA 2E5LL 4B3RL 3KFUA 1YI2A 3AFQA 4DUZL 5ELNA 2I5HA 2NVTH 4O0AA 1VQ6A 4APVA 4EQ5A 4B3TQ 4YHHL 4A3KH 3S1MH 3STBC 4POFA 2LSSA 4IOCA 1XMOL 2UXBQ 4BA2I 3U50C 2VQEQ 2YTVA 3U4ZA 1GM5A 3CP0A 5BR8Q 3UDIA 1Q8KA 4IFDJ 2JA5H 1X6OA 3KJPA 1VS0A 2GVBA 4KHZA 4QJFA 4C2MH 4DR7Q 1N9WA 3KLWA 4JYAL 3J7A5 1FL0A 3AQQA 2B63H 3OTOQ 2AKWB 1B7YB 4LF5L 3CCRA 4POGA 2AWNA 2NZOA 1XPRA 3PIPA 1N8RC 1OXVA 1M90C 1E24A 3GTLH 3BU2A 1KC8C 3CXCA 1HNXL 2CWPA 1TWHH 2JA6G 4YWLA 4X64L 1FGUA 1KHIA 1S40A 4DV5L 2BA0A 1Y14B 3JAMc 2I5MX 5FLMG 3RNUA 3PO2G 2IX1A 4GLAC 3CCQA 3RZDH 1JT8A 1JJ2A 4DR3Q 4R4IA 2Y0SE 5M5XH 4A3CG 1S3OA 3E9HA 1VQGA 4EX5A 5IWAQ 4DV1L 3CCVA 1N36L 4BA1I 1PH3A 3KYHC 5JJLA 2JE6I 1SE8A 4X6AH 1M1KC 2YU9H 5DLQE 2YTYA 1YJWA 3T1HQ 1C7YA 2E2HH 1U0LA 4GKKL 2N78A 4B3SQ 1YHAA 1PH1A 3K8AA 1EQRA 2ZJRA 4BY1G 3S17H 3G48A 1Y1WG 2N49A 1HZ9A 1VQLA 3CC2A 2F4VQ 1IZ6A 3I4NG 3I2ZA 4Y52H 4J15A 4IPHA 3HOXG 4R4OA 1X56A 4JI1L 2NVXH 1Q46A 2MNAA 4BXXH 4LF7Q 4KLKA 4YWKA 4DV7L 1SLJA 3PF4A 1JE5A 4GS3A 4JI6L 1S72A 1UE5A 1IYJB 2VZAA 4A3GH 1Z9FA 5JJIA 2NZHA 4JI5L 1MIUA 4JI3L 5M3FG 4DR4Q 3ERSX 4A3EG 5IYDG 1HZAA 1E3PA 4A3FG 2Z6KC 4DR6L 5LMUQ 4BBRG 1ASYA 4JI7L 1RL2A 3CW2C 2Q2TA 2OQKA 4AYBE 4YY3L 2WFWA 1UEBA 1IBKL 1N32Q 2IT1A 3BZKA 2B29A 1O7IA 1VQCA 2ZM6Q 1KRTA 4A75A 1WYDA 1HR0W 5IP7H 5AJ3Q 2UUCQ 4FDBA 1QVGA 4GKJQ 3F1ZA 2OCEA 3CCUA 3I4OA 1K73C 4LWCA 1HR0Q 1Q1EA 2I5LX 3PV0A 1PH9A 3S1NH 2OTJA 5C4XG 2AWOA 1HNWQ 1LUZA 4NXNL 3S1RH 1EUJA 2R7ZH 4LUOA 1PV4A 5M3MH 4HJAA 3A74A 4JBWA 3ZJYC 2JK8A 4JG2A 2NN6G 1V43A 4AQYL 3RLNA 2PNHA 1HZCA 1P8LA 1K3RA 2LXJA 4WJ3M 4P71A 4A3BG 1XPOA 1VQEA 1YITA 1H95A 1Y1VG 4DV6Q 3TEHB 1XMQL 2VS1A 4NB3A 4IJHA 1BKBA 4GN4B 1J6QA 4JBJA 5ELOA 3SGIA 1D8LA 2B3GA 1NBWA 1V9PA 3I56A 2CWAA 3E0EA 4DK6C 4DV3Q 1ASZA 3H15A 3G4SA 4DPGA 4JC0A 4X65L 1MJEA 4JBKA 4HIOA 3J7ZC 2GN5A 3T1YQ 3CPFA 3I7FA 4DNIA 1KQSA 4Y7NH 1PH5A 2VNUD 2JEBI 4DR5Q 2D62A 3K80C 3L7ZC 2HHHL 4BY7G 4DV4Q 1XTDA 3PUVA 4DV3L 5LMNW 3FKIG 1NMGA 5LMNQ 1LM0A 4NXMQ 3PO2H 1PA6A 2YTXA 2Z0SA 4A3JG 4NPSA 3DLLA 5E7NA 4A3CH 4LF4L 1QVFA 2VUMG 4GN5A 4LFAL 4GOPC 5IYCG 2V1CC 3NBHB 1QVCA 1SN8A 3IRBA 3S15H 3GDEA 4R4CA 3RR5A 3ULJA 4LFCL 3WWVA 1TXYA 2CQOA 4IFDI 2KCMA 2PI2E 3UDXA 2GVAA 3RLOA 4A3LG 4NXML 4OX9L 1XNRQ 3PCOB 1A63A 3CC4A 4BY1H 1YJ9A 1Y1WH 2NVQH 1I6HH 4JI8Q 4DR2Q 1XNQQ 2RHQB 2BH2A 4DAYB 3I4NH 2R92G 3PO3H 3DM3A 2CKZB 3MEFA 4RMFA 4X66Q 2UU9Q 4QL5A 2ATWA 2UUBQ 4C3JH 1VQKA 1K8AC 3PUWA 2NVYH 2RCNA 4P74A 3I4MG 2N8NA 1IXRA 4UPAA 5C44G 3L2PA 3S1QH 3D31A 3K7UC 4B3TL 1HNXQ 1X65A 1VQNA 1PH8A 3HOYH 4BBSG 3UE0A 1B8AA 3CQZH 4L5SA 2UXBL 1U5KA 5M3FH 1Q12A 4GN3B 5IYBH 4A3EH 2VQEL 2Q2UA 3M4OH 5IYDH 5GAEC 1HH2P 5BR8L 2OQ0A 1PH7A 3KF6A 4BBRH 1NMFA 1AH9A 1VQFA 2PMZE 1UWVA 4MNOA 4DAMA 1JMCA 3HOUG 4DR7L 3RLFA 3I55A 1VQIA 4OWTB 5GAHC 3HOZG 1K83H 3KF6B 4X62Q 2HIVA 1IBMQ 3EBEA 3OTOL 1MJCA 1PFSA 4L5TA 4DK3C 1OXTA 4IOAA 2YV5A 4B3MQ 4HJ9A 3UDGA 3CCLA 3S2HH 3HKZG 3ULLA 4HIDA 1K8GA 3J81c 3G71A 1CKMA 1Q81C 2UXDQ 4DV0Q 5C4XH 2K75A 4A3MG 1E1OA 1TWCH 3NEMA 3PUZA 1X3FA 4DR3L 2JA7G 2QA4A 3PUYA 5IWAL 2E2JH 2Z6KA 2R93G 1HJPA 3TRZA 1D7QA 4LW1A 2ZTEA 1SR3A 3FHWA 3J81i 1WJJA 2AHOB 5C0XJ 4A3IG 1W2BA 3T1HL 1UE7A 1N33Q 4QQBX 1A0IA 1N34Q 4B3SL 4A3BH 4OWWB 1PH2A 3RN5A 1Y1VH 1CSQA 2F4VL 3CPWA 2ASBA 1KXLA 1WFQA 2OWOA 2KBNA 1P16A 1SMXA 1FJGQ 1X55A 3PF5A 3H3VI 1K0RA 4DV2Q 2VY3A 4LF7L 3H0GG 4DUYQ 2UXCQ 2WB1G 1LTLA 1VCIA 4PG3A 1Z47A 4OO1G 5IP9G 1W3SA 2WAQG 3CCSA 4LF8Q 4KI0A 2JA9A 4PZ8A 4QY7A 3CC7A 1CKNA 4LNQA 4DR4L 4JBMA 4UP7A 4AIMA 4C3HH 1EIFA 4BY7H 1Q86C 2ZTDA 2MQHA 1I5FA 2XGTA 4JI0Q 5LMUL 2B63G 1CKNB 3W5OA 1GKHA 2ZJQA 3H3VH 3HKZE 1KRSA 1LYLA 3L0OA 4KHPQ 1JJGA 1N32L 3HOVG 2VUMH 2ZM6L 3G6EA 2UUCL 5AJ3L 4GKJL 3U58A 4OONA 3GTMH 3S24A 1PH4A 1OXUA 1FVIA 4YWMA 1YJNA 1HR0L 3F2CA 1JJCB 5C0XG 3ICEA 1HNWL 2CCZA 4A3LH 1HNZQ 1OXXK 4JOIA 3CCJA 2EQSA 3EN2A 5IY0A 1VQJA 4A93G 5H1SE 1VQOA 4JI4Q 4LF6Q 2ZJPA 2R92H 4OXPA 2N3SA 2A19A 3GO5A 4UP8A 4K0KQ 4HJ7A 2LXKA 1TWAH 1VQHA 5IT9c 3I4MH 1NE3A 4DV6L 4LFBQ 4GOPA 1X3EA 3UE1A 4IJLA 3GTGH 5GADC 1WI5A 4BBSH 4JOIC 2Q2HA 2WB1E 3CF5A 4GOPB 1L0WA 3TS2A 4A3DG 5FJ8G 4R4TA 2UUAQ 3Q8DA 1PHJA 3RZOH 1NTGA 1C0AA 2WAQE 1R9TH 1KIXA 1IBLQ 1E22A 2JA6H 1I94Q 4DR1Q 3T1YL 4PZ6A 1QZGA 5FLMH 3HOUH 4R1JA 2MO0A 3HOZH 4YCVA 1CSPA 1VQ9A 2VQFQ 2KCTA 4JV5Q
chains in the Genus database with same CATH superfamily
5DM73 2E8GA 3S17B 1BR9A 3MC0B 1DZ1A 5EKKA 2E2JB 4EQNA 2MPMA 4LF9Q 1MD2D 5C5LA 3ER0A 4A3MH 1EFWA 2E5LQ 2HIXA 3SR1A 1SMYD 3SDZA 4A3GB 2KHIA 5LL6S 2WP8J 4N8X1 4KD4A 1TY2A 4PMBA 4JI8L 3RD4A 1B44D 1QUQB 3VR2A 3MXNB 2BOSA 4IPDA 4X66L 2UU9L 3NENA 5BN5A 4LF5Q 3RUZA 4ZUJA 4OO1H 4RG1A 2NN6I 4P72A 1SFOH 3S1NB 1GVPA 2F0TA 4K6LA 4L5RC 2E2IH 3K59A 4XT3B 3SXHA 2FXQA 2MO1A 2IW3A 1EOVA 2B2YC 4DV1Q 4ZYSA 2HD3A 4KMUC 4X62L 2K03A 1IBML 4O2DA 1SYBA 3PGZA 4JCVE 3BZDB 3QR8A 2F52A 2XN9C 2IY5B 2UXDL 4DV0L 2PW7A 4P75A 1OXSC 3PMFA 5D14A 3SK8A 5CV6A 1T5EA 4DV7Q 4K6DA 1TU2B 4ZK9B 1N33L 1MSGA 1HZBA 2DY8A 3CKIB 4JI3Q 5J3BA 3M7NA 2SDFA 3MTSA 1VQBA 1ILPA 4C3JG 4JI7Q 3I3CA 3HOUB 4YY3Q 5EJWA 4A3DH 1L1OA 5FJ8H 4YCWA 3FKIH 3HOYG 4HR7B 3S15B 3GTPH 1DYQA 3BYTB 5CV5A 3W2DA 2UXCL 2QW7A 2XRSD 1A62A 4UP9A 3T53B 1XPUA 2IX0A 5JEAG 3NTKA 4JI2Q 2NTSA 1VQ7A 1O80A 4IO9A 5JJZA 4BY1B 5I9OA 1ICFB 4CKCA 5C3EH 2C35B 1BDOA 2AQ1B 4BWGB 3K7AB 1ONLA 4KHPL 2KEDA 4GLVB 3K5MA 4CJ0B 2FINB 2I0QA 3K0YA 2F0WA 1NAPA 5GAGC 2B39A 3GP7A 5FO7B 3HOWH 1X3PA 3E9IA 2N55A 1BVSA 1BO0A 5IE8A 1KDBA 3BDCA 5K36G 1YVCA 3W1BA 3A7AB 1YNXA 4K0KL 3AMUA 2HT1A 1F2ZA 5CBAE 2K52A 4FF4A 2A69D 3DWAA 4CBVA 2NZ1D 5C4XB 1EU3A 3HS0C 1OO9B 4KN7C 4OWXB 1TWFH 3A5ZB 2C5CA 2K4KA 1A3UA 5CV7A 1I94L 1LACA 4IUPA 3M4QA 1WD0A 2R61A 4DF7A 3J80i 2Y0SG 5DNFA 1AE2A 3TMEA 1QG7A 5M3MG 4ZAIA 3GTKH 1MKHA 4OO1I 4QIWE 1ZXTA 5KEEA 4IUVA 2A6HD 3CHBD 2EE1A 1Q7YC 4B3RL 5ELDA 2EZVA 2GA4B 1YI2A 3PQIA 3AFQA 1JOOA 4RA8A 4APVA 4EQ5A 1F2MA 2TMPA 1F9PA 2PMZB 4C3HB 1XMOL 2UXBQ 3U50C 4H0LC 3T13A 5BR8Q 2ICIA 2JA5H 1C4QA 1QNUA 1X6OA 4UAIA 1CFMA 2JYOA 2M2LA 3KLWA 3J7A5 5CBEE 3R2TA 2B63H 4OIKA 2AKWB 4L6TB 2HDMA 1N8RC 1XYIA 1M90C 3BU2A 1HNXL 3CXCA 1FYCA 2G9HD 1SYGA 4YWLA 4X64L 1HTPA 2BA0A 5T1GA 2B8GA 2D2CC 3PO2G 3D8GA 4GLAC 1JJ2A 2K33A 5FKAC 2Z4IA 3CCVA 1N36L 3NTHA 5JJLA 2J0TD 4X6AH 3T1HQ 4NDXA 2L4NA 2PYKA 1C7YA 1S5ED 2N78A 1YHAA 5C44B 3K8AA 3S17H 3G48A 1VQLA 1TT2A 2F4VQ 3GTGB 1JWUD 3I4NG 1SXTA 4C1NK 2XRQD 4J15A 3HOXG 3RZOB 2HUGA 5E4XA 5I4DA 1R9TB 2MNAA 4BXXH 4LF7Q 3PF4A 4JI6L 4F87A 1HUMA 4A3GH 1Y8PB 1Z9FA 5JJIA 4FXKC 2NZHA 4IALA 4JI5L 5M3FG 3ERSX 1G2TA 1RD9D 1EL0A 4DR6L 2PPBC 2LY7A 3M4YA 4UDUC 1K0SA 4O1NA 3I90A 3QOLA 1N32Q 1ESRA 1VQCA 2ZM6Q 1G91A 1KRTA 4A75A 1WYDA 1KAAA 2WIIB 5IP7H 4FDBA 4A3IB 1K28A 2A69C 2E74C 4DK0A 1Y8NB 1S5CD 4LWCA 3S1NH 1Q1EA 3PV0A 2OTJA 1HNWQ 4XXEA 1HXYD 4HJAA 3A74A 1E2VA 4JBWA 4TKOB 2DJFC 5CV8A 4KJNA 5M9OA 5K5PA 3RLNA 3RMHA 1K3RA 3OOCA 2LXJA 4A3BG 1SDFA 1F77A 2WAQB 2VS1A 3V05A 4JBJA 1J6QA 3URYA 5M5YB 1NBWA 3I56A 3E0EA 3H15A 1S5DD 4DPGA 3CPFA 4XYQA 5T1IA 4DFAA 3HOVB 4Y7NH 2JEBI 3K80C 2HHHL 1UAPA 3I91A 4Z9CB 5G3LF 1II3A 3V96A 4KKUA 1NMGA 1LTAD 2X69A 1E0BA 2YTXA 2Z0SA 4HSPA 3DLLA 5E7NA 2QEJC 4LF4L 5A2QL 4A3CH 4GOPC 3S15H 4R4CA 2JXMB 1TXYA 5CR3A 2KCMA 4IUUA 3RLOA 1A63A 2NVXB 4BY1H 2MUYA 5JVG3 3M3YB 4JI8Q 2EYHA 2RHQB 2BH2A 2B2WC 4FVMA 2BCOA 2CKZB 2ATWA 4X66Q 1RTNA 2LKVA 4K5WA 4QL5A 2UU9Q 3EJIA 1B50A 1V8QA 3I4MG 4Q5VA 4UPAA 4F8MA 3L2PA 3D31A 3K7UC 4B3TL 1X65A 2RBMA 2A6EC 1PH8A 5A2QE 4ID6A 1D5ZC 3GTQB 5GAEC 3Q23A 5C4HA 4NKLA 1PH7A 3T51B 1NMFA 1WVLA 2I07B 1VQFA 1H9SA 1UWVA 3HOUG 3RLFA 3VYRA 3I55A 4OWTB 5GAHC 2CH4A 3KF6B 3H09A 4X62Q 2HIVA 1IBMQ 1PFSA 2EXZA 3ZYYX 2F0FA 3G71A 2UXDQ 4DV0Q 5C4XH 2K75A 1TWCH 3NP8A 2R93G 2DNEA 1F9RA 1EFID 4LW1A 2AHOB 5C0XJ 5FO9B 1W2BA 1N33Q 3TP8A 1A0IA 1PDQA 2I46A 5L37A 2EY1A 1LTGD 3C2PA 3CPWA 2Z4HA 2MP1A 1BCPD 1WFQA 3HRZC 1P16A 1QWYA 3QO2A 1X55A 1K0RA 1A3TA 1LT5D 2KJXA 2UXCQ 4JW0A 2KHSA 1CQVA 5IP9G 3R3OA 1PFNA 4QY7A 4ODGA 4JK1C 4DR4L 1SYDA 4JBMA 4AIMA 4C3HH 1Q86C 2XGTA 5LMUL 1AEXA 1GKHA 3HGBA 3HKZE 4KHPQ 5KGUA 4RKLA 2Q8TA 1B4OA 5AJ3L 3U58A 3NTIA 3A8KE 1W6JA 1HR0L 2TSSA 2PW5A 2V4DA 1G6ZA 4C3JB 3O13A 5IIFA 3SHLA 5H1SE 2EPBA 4OXPA 5LL6X 3P7JA 5FLXE 4K0KQ 3ONAB 4HJ7A 3HOYB 1H9JA 3CQZB 5IT9c 4KJOA 4DV6L 2CHBD 1X32A 4GOPA 2QKIC 2VB3X 4BBRB 5GADC 1WI5A 3GTGH 2WB1E 3TS2A 3RZOH 3Q8DA 1R9TH 1I94Q 4P2CB 3S2HB 3QG1A 1HTLD 2B2WA 1KRSA 5EKIA 3PIP3 1DGSA 3OW2A 1VQMA 4HTHA 1TWGH 1AW7A 3W1GA 1SYFA 1A15A 2R6GA 2PNRC 3SEBA 3K5OA 3GTJH 4B3RQ 1B70B 1CQFA 1VQ4A 1PTOF 2R7ZG 3B6YA 5IGCA 2JA8G 1YIJA 3E3XA 2H5XA 1SNQA 1XMOQ 1EWHA 3LNNA 1QZHA 1WTXA 3D6CA 3NUCA 1XJVA 2ES2A 3J81L 3MWYW 1HA5A 3GD7A 1CT1D 4A3FH 4GLXA 1VQAA 1Q82C 1ML0D 3HFZB 1HNXQ 2Y0SB 1NJIC 1BCPC 4X3UA 4X64Q 2B2TA 2J4XA 1STBA 1YZ6A 3A5UA 5M5YH 1KL9A 4IURA 5M3MB 4F7XA 1EZ6A 2JJQA 1WTPA 2XWBB 4QUCA 1N36Q 2CFMA 5CORA 1UE1A 1KAWA 4YIJA 2RF4A 3CRLC 2RCFA 1KD1C 3HOVH 3H3VC 2F0LA 2K5NA 1LT3D 2IL8A 1WTRA 2PZTA 3AFPA 3AYHB 2OT2A 1YEZA 2K5HA 4HCSA 1A8VA 2L55A 3QB3A 4FF2A 1X3GA 1LTRD 4PMWA 1LTID 2RKSA 1HUNA 4JI6Q 3S2DH 2RHSB 4ABNA 4JI5Q 1PH6A 1N34L 4H02A 1F2YA 3U4VA 4DR6Q 1SBBB 3M3YH 3QJYA 4OGQC 5ELCA 4WFN3 1C8CA 3PO2B 1PTOH 1SEBD 1PYWD 3LX0A 5HY6A 1JB7A 1DOLA 2ZTCA 4DUYL 3ULPA 1XTCD 3ITPA 2F0IA 5IYBG 1L1OB 4P73A 2JEAI 2L9HA 2EXDA 1WTQA 1T9HA 2B2UA 4KN4C 2JQOA 5IYCH 1BF4A 1HA6A 2Q8RE 3KDFA 2PQAA 3GTQH 3I4NB 4XQQA 1SAPA 2EOTA 5BN4A 1L1OC 2F03A 3BVMA 3HOXB 3P1HA 1B3QA 5AFWA 3VA7A 4J1MA 2K5DA 3NELA 4MTNA 4L5QA 1YNJD 1EZ8A 3L3OC 3M4OB 4A76A 2VL6A 1HNZL 1A3VA 3TZDA 3H0GB 4KTAA 4X3TA 2KQ3A 1H9KA 1VQDA 3PIOA 4HJ5A 4M8AA 3PUXA 1I3QB 2Q2IA 2R7FA 5I9PA 4B9WA 5GROA 3WOFA 5A35A 2HHHQ 5LHY1 2JP1A 1NR2A 3J80c 4LUZA 1R4PB 3H91A 1BBWA 1IBLL 4LF4Q 3K0XA 3JC66 1CK1A 4DR1L 1AE3A 4GNXA 1MHWC 3VR3A 4XIGS 1QJOA 3NE5B 4A3BB 3TS0A 3CD6A 2MFIA 2AUKA 3IFDA 1CA6A 4IPCA 4MZ9A 4A93B 3NBIA 4CDFC 2K05A 4WJ4A 1X9NA 3T56B 1LT4D 5EKLA 2VW9A 1J5EL 1CA5A 1X3QA 2MGSA 3NQTA 1CHQD 4DUZL 5ELNA 1Q3LA 1Z6HA 4B3TQ 3S1MH 2RSNA 4IOCA 4OIJA 4KKTA 2QDLA 3U4ZA 3CP0A 3GTOB 4U673 3SK5A 3BVZA 1DJRD 1VS0A 2GVBA 1MBYA 2IWHA 4K5XA 5JPNC 1FL0A 1PRTD 4ZKBB 1B7YB 2NZOA 3PIPA 1OXVA 2Z9HA 2PCFB 1E24A 2JA6G 1S40A 5JPMC 5JEAH 4Q0FA 3JAMc 2I5MX 3F2UA 3TN2A 1JT8A 1A2TA 5IGEA 1WCMB 5ELEA 2JE6I 5DLQE 1YJWA 4GKJQ 2E2HH 2EY6A 5IGDA 3V2TA 3I4MB 1PH1A 1LV9A 3A54A 5G3LD 1HZ9A 1D1KA 1TS4A 1EY7A 3C1FA 3GV6A 1VF7A 1MSHA 2BE5D 2F0SA 4WORA 4GS3A 2NB0A 1S72A 5BN3A 5K36H 1YNJC 4DR4Q 4A3EG 5E1FA 4LJZC 3LWUA 2Z6KC 2KVMA 5LMUQ 4BBRG 1PFBA 3SK6A 2Q2TA 5IGGA 1B2TA 4AYBE 1O7LA 1UEBA 1RJTA 2SNMA 1I50B 2R93B 5JVH3 3TP6A 4G7HC 1HPCA 4C3IB 5AJ3Q 4PNYA 3F1ZA 3CCUA 3I4OA 1HR0Q 2I5LX 4J8QA 2ICEC 2A5HA 4NXNL 4LUOA 5M3MH 3ZJYC 2JK8A 4MN3A 1KNAA 1V43A 2PNHA 1P8LA 1TS5A 4P71A 1SNCA 1H95A 1SMYC 4DV6Q 3TEHB 1XMQL 2D5DA 1XX8A 4IJHA 2FHTA 3K5NA 1D8LA 4MTKA 2G9DA 1V9PA 1NSNS 2CWAA 4DV3Q 5CYUA 3CU7A 3G4SA 2K6AA 1U4MA 4X65L 1MJEA 4HIOA 3TP7A 5EPJA 3DM1A 1BUVT 3J7AF 1O7ZA 3TDQA 1STYA 4XT1B 3I7FA 2ENBA 4ZKCB 2D62A 4BY7G 1XTDA 2F0VA 3FKIG 3NBHA 1XWEA 3PO2H 3H94A 1AFPA 4NPSA 3A8IE 1PRTC 4QIWB 2VUMG 3KLSA 1C0AA 1SN8A 3MXGA 5ELFA 3BYYB 3GDEA 3RR5A 4LFCL 1O7YA 1ENFA 2PI2E 3BDLA 2GVAA 4DAYA 4A3LG 4NXML 3PCOB 1I6HH 3C46A 4FF3A 3I4NH 1D1IA 3PO3H 4RMFA 5CC4A 1I4XA 3Q22A 4ZUIA 2NVYH 4P74A 5E4WC 2N8NA 3S14B 2CW0D 4J6HA 3X3NA 3MXUA 1U5KA 5M3FH 4GN3B 3M4OH 1E2WA 1AH9A 2PMZE 1JMCA 4DAMA 4ZQ3A 1VQIA 3Q24A 2DY7A 1H9SB 4L5TA 1OXTA 3FVQA 5TSSA 3UDGA 2R7ZB 3NSWA 3EFXD 3NWSA 3ULLA 2JA8B 5M5WB 1B53A 4RGOS 1Q81C 1E1OA 5E3FA 3PUZA 1X3FA 4R8IA 2JA7G 5C4JB 2E2JH 2Z6KA 1HJPA 4OL7A 1C48A 2ZTEA 1SR3A 3FHWA 4U68A 2E76C 4KY7A 4B3SL 1N34Q 4A3BH 1EY0A 1GUGA 1QE6A 3OW7A 1A6XA 2OEOA 2QILA 2KBNA 2SOBA 1IL8A 1SMXA 2IPKD 1Y8OB 2CQAA 4DGZA 3PF5A 3H3VI 4LMQD 3H0GG 1PTOD 4DUYQ 2B2VC 4PG3A 2XVSA 3CCSA 4HN7A 5EQ0A 2JA9A 1SNMA 2KA7A 4PZ8A 1FD7D 1PXUA 4LNQA 2O5JC 1LT6D 4QMGA 2ZTDA 2MQHA 1IKLA 1I5FA 3KBGA 2B63G 2XSCA 2NYZD 2FJ2A 3DWQA 1V1OA 4F88A 3DXJC 3TBIB 3OWEB 1BQQT 1LYLA 3L0OA 2LS01 4QUFA 4DXFA 3G6EA 3Q0AA 1ZKOA 1OXUA 1YJNA 2X6LA 3F2CA 5C0XG 1I4PA 2CCZA 1HNZQ 3EN2A 5IY0A 1VQJA 4CGYB 4A93G 3D6WA 4DAVA 2A6HC 2JN4A 2AQ2B 2N3SA 3D4DA 4UP8A 4PV1C 1VQHA 3I4MH 3FRPB 1TWHB 1X3EA 3UE1A 1GUOA 1NR4A 3CF5A 1DXMA 4GOPB 3NQIA 1L0WA 2G5DA 4R4TA 1PHJA 1NTGA 1CI3M 2WAQE 2XIWA 1IBLQ 4QCLA 1E22A 4DR1Q 4CKBA 2KOLA 1RTOA 4PZ6A 5FLMH 3HOUH 2CW0C 1T5XD 3HP3A 2MO0A 3S9WA 1GUSA 4A3JG 1B3AA 3DWPA 4N9PA 4DR5L 1UUPA 3OSOA 4ULLA 4OELB 4NW2A 3HEJA 3RN2A 5LMNL 3CCMA 4XYOA 1OTCA 1WTOA 2NTTA 2Z8LA 4EGVA 1WCMG 1J5EQ 2F0JA 4K8IA 1I50H 2RQXA 3F8TA 2R93H 1UNSA 4XQNA 3K7AH 4DUZQ 5I6YA 3P75A 1RODA 1EY5A 2CH4W 1E2ZA 3K57A 3VYTA 1RDPD 1EIYB 4ALPA 2J7ZA 1XNQL 3D3RA 2R3ZA 3L9AX 1V1QA 2AUJD 1U4RA 4V190 4QB4A 1ILQA 5IP9H 4G7OC 2D9UA 1GD7A 2LMCB 2F3IA 3CAMA 2ID0A 4CHTB 5C0XI 2K28A 4FXGC 4QGUA 2QGQA 3W3AA 4AYBG 3PSIA 2RA4A 1EWIA 4B3ML 4K2LA 2B2TC 4C3IG 3NWTA 2B2VA 1GO3E 3OMCA 3STBD 3EROA 3LWEA 3FMCA 4I7AA 2MHVA 4ZLTF 4HSVA 4PZ7A 4AH6A 1WD1A 3LGJA 2IHFA 5D3DA 3TQYA 2O4XA 3KUPA 4RFBA 3K6OA 4A3KG 4HJ8A 1VF5C 3A55A 4TQUS 1SRUA 2JA6B 3MFYA 2EIFA 1KDCA 3BJUA 1G2SA 2MJ8A 4IFDG 3HOZB 1MI2A 2A1AA 4DV2L 1VQ5A 4HIMA 2L5TA 1SNDA 3S14H 4EVOA 4K5VA 5DM63 4LF8L 1CHPD 3MHBA 1NUCA 4H44C 4WRDA 4ILWA 3MZ5A 5C5MA 1E7ZA 5IT9L 4NXNQ 2AMCB 4JI0L 1HCZA 2IX3A 2BDNA 1D5XC 3M85A 1UE6A 2K50A 3T16A 3KDFB 2PQAB 1JWSD 1IW7D 2EY5A 1K8MA 2K01A 1IL2A 3KF8A 3TZUA 2B2UC 4JI2L 4R4QA 1K8OA 1XMQQ 2JA8H 3BDOA 2H1EA 5M5WH 4TVAB 4A3EB 1YHBA 1LLRD 5C44H 2RDGA 1MGSA 4KK7A 1HHVA 1DM0B 4X65Q 1TS3A 2KENA 1V1PA 5C4JH 3I8ZA 4JI4L 1K83B 1NY4A 5FLXc 4FP5D 3A0JA 2E2IB 1RKNA 2IHEA 2L15A 4LFBL 2KEEA 1PZKD 1NCVA 1Q1BA 2K5VA 3AU7A 3F2BA 1SNOA 1GJXA 2UUAL 1PVOA 1STGA 2R7DA 4K8JA 1G8ZD 3N52A 4LFCQ 4CDDC 4DKAC 2VQFL 1IYVA 4JV5L 2FMMA 4GNXB 4GZYC 1L2FA 3FP9A 2K14A 2QF7A 1S4ZA 1KTKA 4A3IH 4CDCC 3BG3A 2RDFA 2A73B 1CZGA 1B9MA 4GNXC 5EAYA 1SROA 1YNND 3KOJA 1KLGD 1RF2D 1BCPB 2EDGA 1VQ6A 1NNXA 4YHHL 3STBC 2EJMA 4BY7B 5NUCA 4BA2I 2YTVA 3KLRA 1WTHA 3DHQA 3FKIB 4IFDJ 5ISRA 3GTPB 1SE3A 4JYAL 4FNFA 4KHZA 4X3SA 4ME5A 5C3WA 2VUMB 1HFNA 4R8NA 2AWNA 1XPRA 1ET9A 3QOJA 4IUTA 3U9OA 3GTMB 1EY9A 1TWHH 3J81E 1FGUA 1KHIA 5J22A 4DV5L 2F3WA 3RNUA 4IUQA 3CCQA 2K7VA 2JSOA 4R4IA 2Y0SE 4IN3A 4RWSC 1S3OA 4EX5A 4BA1I 1S5FD 1GOZA 2WKDA 1I4HA 4GKKL 2M9VA 1U0LA 1Y69U 4B3SQ 3I73A 3I72A 1J9OA 1EQRA 1Y1WG 2N49A 2K5QA 3KLSX 1I4QA 4LAAA 4Y52H 4IPHA 1X56A 5I6WA 4JI1L 2NVXH 3ERQA 4KLKA 4YWKA 3T4AC 1JE5A 1UE5A 1BXTA 4KHVA 1EWCA 1STAA 1MIUA 3DEOA 4RAUC 5IYDG 1HZAA 4A3FG 2Q8IB 3HG9A 1RL2A 3S16B 4KV6A 2OQKA 2VB2X 5FK9C 1IBKL 2IT1A 2JA7B 2B29A 3VYUA 1JWMD 1BOSA 1HR0W 5CV9A 1K73C 2OCEA 2WINB 4HCEA 3OPOA 1EY6A 4JG2A 3J80L 3OMGA 2NN6G 4AQYL 1LTBD 1RHPA 1Y1VG 1TS2A 2HCIA 2XWJB 4V0BA 1Q8IA 2JA5B 2KECA 5ELOA 4GN4B 5F2DA 2B3GA 1EYCA 2B8FA 5C6AA 3TSSA 3VR4A 3C1EA 2B63B 1YNNC 4JBKA 1I6VC 2KUMA 3AB9A 3N6RA 1Q90A 1PH5A 2VNUD 4DR5Q 3WDNA 3L7ZC 4RCNA 2C9OA 2F0DA 3PUVA 1J8IA 1EQTA 1SNPA 1EQVA 1WTVA 5LMNQ 1LM0A 1DOKA 3FDTA 2SEBD 4DXGA 1QVFA 4LFAL 2HDLA 1GHJA 2EJGC 5IYCG 2V1CC 3NBHB 3IRBA 2F0HA 2CQOA 2DJGC 3Q6SA 3UDXA 3MFGA 1BCPF 4OX9L 1YJ9A 1XNQQ 4DN4M 4DAYB 2R92G 3MEFA 3JAML 4ZRZA 3A56A 4RGMA 4C3JH 3SK4A 3P20A 3PUWA 2RCNA 2O2LD 3VA5A 4A3JB 1VQNA 1I4GA 3HOYH 4BBSG 3UE0A 1B8AA 3CQZH 1FR3A 1TY0A 1Q12A 2Q2UA 4A3EH 3NPPA 1KABA 2VQEL 1HH2P 2OQ0A 1EEFD 4BBRH 1TKWB 4MNOA 1S5BD 4DR7L 4UHVA 3HOZG 1K83H 3TP5A 3EBEA 3OTOL 1MJCA 1ICWA 2OF1A 2YV5A 1VDZA 3KK7A 5COYA 3JAME 3HKZG 4B3MQ 3S2HH 1M8AA 3H6MA 4HIDA 1JCKB 4ZCKA 2OXPA 4A3MG 3NEMA 1JR0D 4DR3L 2RSOA 1U9RA 2QA4A 2PZUA 3HZXA 5IWAL 1D7QA 3MVVA 3J81i 1WJJA 3IL8A 4QQBX 5HURA 3C3LA 3A7LA 2ASBA 1KXLA 2OWOA 5J1ZA 2F0GA 4TRDA 5EBDA 4KY6A 4C56C 1LTTD 4B08A 4Y7NB 4DV2Q 2VY3A 5KNDA 2PZWA 2WB1G 1LTLA 4AYBB 3R2IA 4OO1G 2F0QA 4LF8Q 4KI0A 2SNSA 2EYPA 2A74C 1IYUA 1CKNA 5D65A 4BY7H 4JI0Q 2EYOA 4CJ2C 3W5OA 5ELBA 2ZJQA 2K5WA 3H3VH 5IODA 1QOHA 1JJGA 4B9XA 2VUMH 1FNWA 2DNCA 3FPUB 3MAQA 2NVTB 4FF1A 4A3KB 4FYDA 3GTMH 3S24A 2F0KA 3R93A 1FVIA 3OIPA 3QIAA 1JJCB 2F0PA 4RHSA 2BDOA 4A3LH 2RVLA 4HAEA 1OXXK 4JOIA 4C2MB 4JI4Q 2ZJPA 4RGNA 2K1BA 2A19A 4PQXA 1I4RA 2LXKA 2CVRA 3J7AV 2WACA 1NE3A 3GTLB 4LFBQ 3KBXA 1JOKA 4IJLA 1PRTB 4DNTB 5IOCA 3RZDB 2PO4A 4A3DG 2RDHA 5FJ8G 5M5XB 2UUAQ 1KIXA 1IKMA 4HMJA 2L12A 5CGKA 3T1YL 2F0MA 2YU9B 4YCVA 1VQ9A 2VQFQ 4HEDA 4JV5Q 4RH6A 4YCUA 2XTIA 3KJOA 3VR5A 1TWCB 4DV4L 1YHQA 1EY4A 1C9OA 1YBYA 3ND8A 5C3EG 4RGTA 3M9BA 1D6EC 2F4IA 5KYIA 4WJWA 5JOBA 2ALYB 3S16H 2EJFC 1XXGA 1RIPA 2D0PA 4XTCS 2F0EA 4DU9A 2JA7H 3HOXH 2L1BA 2QEXA 4DK1A 4YHHQ 1SJHD 3HOWG 1SJED 3OYYA 4LK1C 1QUQA 3CCEA 3MXNA 1XNRL 3CMEA 1CZWA 2EYMA 2K32A 3DEPA 4DR2L 5DEHA 3K58A 4JYAQ 2A68D 1AP0A 1SSOA 2UUBL 3E0JA 2B2YA 1GHKA 2BE5C 1QB5D 3H0GH 1VQ8A 3EA6A 4H7BA 4R9WA 5IGFA 5JJKA 1I3QH 3EQLC 2KHJA 3K81C 4G57A 3K5LA 4DV5Q 1L0YB 1GUTA 3S1RB 1TR5A 2KCNA 3SVMA 3BZCA 2E75C 2F0NA 1PYSB 3VDYA 5JEAJ 4GKKQ 2DGYA 3F2DA 3IKJA 3D4WA 1SE4A 1SYEA 1VMPA 3CMAA 1TVXA 5C0XH 2YYZA 3X3MA 4JI1Q 2DUDA 2N88A 3JAMi 4A93H 1BBUA 3AEVA 1X54A 1E1TA 1JQYD 1RCVD 2EY2A 2IJ0A 2A6ED 4MHEA 3PO3G 1DCZA 4A4IA 1G51A 2JA5G 2A8VA 1EEID 1KNEA 2OTLA 1FJGL 3EIVA 2VXWA 1LTSD 3IAYA 5FO8B 1IBKQ 5DAUA 1EYGA 3GTOH 3HKSA 1TQOA 1UEAB 2KCCA 3FPPA 1G6PA 4BS9A 1TWGB 2QDBA 2HQLA 5I2XA 4A3JH 2K04A 4UY8C 4N9TA 3D4RA 1STHA 1Y1WB 2NVQB 3G7LA 3M4PA 3GTJB 2L11A 2F0OA 1HQMC 1WOCA 4AQYQ 1AN8A 1WCMH 2ZXRA 2EYJA 1CUKA 3QWNA 4L8JA 3UDFA 4EQPA 4HIKA 3S1QB 1K9MC 2XNAC 2BA1A 4IUNA 3KF8B 2BH8A 2Z6BA 3E6ZX 3ND9A 4A3FB 4IPGA 4BXXG 5C4ZA 5HGQA 4LF6L 1PRTF 1ZYRD 1B1ZA 4A3GG 1D5MC 1PZJD 1V1PB 1CKOA 1JOQA 4FO2A 1PZID 1Z7TA 1ESFA 1BBXC 4CJ1B 2PI2A 2A68C 4FXDA 4ME3A 2F1MA 1HRJA 4LUVA 4LFAQ 5KNCA 5GQOA 1VQPA 4KKSA 1PYBA 5IP7G 1G291 3TREA 1EQQA 1Y1VB 4OX9Q 1FNUA 4C3IH 4NMZA 2P5ZX 2FFKB 2ZXOA 1O78A 1U4PA 4LF9L 3J81j 2D0OA 3S2DB 3R8BA 2E5LL 3D0FA 1B9NA 3KFUA 4E6IA 2I5HA 2NVTH 4O0AA 4I65A 4A3KH 1EU4A 4POFA 2LSSA 4S3SA 1PTOB 2VQEQ 4RCOA 1GM5A 3MEHA 3UDIA 1Q8KA 4XDXA 1DOMA 4K14A 2ZXPA 2HQEA 4G7ZC 1PMRA 3KJPA 4DR7Q 4QJFA 4C2MH 1N9WA 4IFDH 1GUNA 2LFNA 3AQQA 3I70A 3J7YW 3OTOQ 3M7GA 5CV4A 1PTOC 4LF5L 3CCRA 4POGA 1LO5D 1STNA 4JVZA 3VYSA 3GTLH 1KC8C 2CWPA 3A8JE 1EIHA 4G4KA 5CMDA 1Y14B 4MIUA 5FLMG 2IX1A 1KLUD 3RZDH 4DR3Q 4XQJA 4A3CG 5M5XH 3IFTA 3E9HA 1VQGA 5IWAQ 2R92B 3UI2A 4DV1L 1PH3A 3KYHC 1SE8A 1M1KC 2YU9H 2YTYA 1GXDC 1TWAB 3GV3A 2ZJRA 1H9MA 4BY1G 3DMUA 1HFGA 4CDEC 3CC2A 1IZ6A 4BBSB 3I2ZA 1PLFA 4OEMB 4R4OA 1ENCA 1Q46A 2EYFA 1PFMA 4QF4A 4DV7L 1SLJA 3OWFA 1IYJB 2VZAA 1GUWA 4RHRA 4JI3L 3G6JB 3E5SA 3HKZB 1E3PA 2QCPX 2WKCA 5I2YA 1ASYA 4JI7L 3PIO3 3CW2C 3CRKC 1ZYRC 4YY3L 2WFWA 4A3MB 5EPKA 3BZKA 1O7IA 1ET6A 1CTMA 4DA2A 3NK9A 1QVGA 4NP5A 5FLXL 2O5IC 1PH9A 5C4XG 2Z1CA 1L0XB 2AWOA 1LUZA 3S1RH 2R7ZH 1EUJA 1DD2A 1PV4A 1VMCA 1LABA 1M4VA 3GQBA 4JPBW 2PQEA 3EVQA 1EYAA 1HZCA 2M00A 3S1MB 1JE4A 4WJ3M 2H4OA 3SE0A 1VQEA 2WB1B 5IT9E 2E2DC 1YITA 3OHXC 1XPOA 4DNRB 1SFOB 1F9QA 4NB3A 3SGIA 1BKBA 4DK6C 1ASZA 1U4LA 4JC0A 1FGBD 3VR6A 1SE2A 3J7ZC 2GN5A 3T1YQ 4DNIA 1KQSA 4HMIA 1EIGA 4C3HG 1ENAA 4DV4Q 4DV3L 5LMNW 1W6KA 1K3BC 4NXMQ 1PA6A 4IZ8A 3WOEA 4RKBA 2E2HB 4GN5A 1QVCA 4K2KA 5HGTA 2WV6D 3ULJA 3WWVA 4L63B 1D2BA 4IFDI 4X3KA 1EYDA 4M1UB 1HQRD 2EVBA 1XNRQ 3CC4A 1Y1WH 2NVQH 2L0CA 4DR2Q 4KY5A 3DM3A 2HCCA 4A3DB 2UUBQ 5EPLA 1F2LA 1QNKA 1K8AC 1VQKA 4IQZA 1BNZA 1SYCA 1IXRA 5C44G 3S1QH 1H9RA 4CKEA 2EYLA 4L5SA 2UXBL 1KDAA 5IYBH 5IYDH 3FEWX 5BR8L 5C3EB 3KF6A 2NUCA 4DK3C 4IOAA 4HJ9A 3CCLA 3U9SA 4KD3A 5C3XA 1K8GA 3HOWB 3J81c 1CKMA 1R4QB 1JB3A 1F9SA 1AZPA 2AQ3B 3PUYA 3NXWA 1A2UA 2X6GA 3TRZA 1IHZA 2NN6H 1IW7C 4TSSA 4A3IG 3T1HL 1UE7A 5KRUA 3DUZA 2FMCA 1QILA 1JORA 4OWWB 1PH2A 3RN5A 3OIQA 1Y1VH 2NWGA 1CSQA 4EQOA 4O42A 2F4VL 1JC7A 1FNVA 4OHJA 1TWFB 1FJGQ 1ZEQX 5KNBA 4LF7L 1VCIA 1Z47A 1JICA 1W3SA 2WAQG 3MA2B 1EY8A 4I7ZC 5EBCA 3CC7A 4UP7A 1EIFA 3BVGA 4C1NI 3GTKB 1CKNB 2F3VA 4PMCA 3MXPA 5JAVA 1N32L 3HOVG 5KIXA 2ZM6L 2F0UA 1TIID 2UUCL 4GKJL 1I6HB 4OONA 1AZQA 1PH4A 4YWMA 1CM9A 3ICEA 3PO3B 2ZT9C 1HNWL 3CCJA 2EQSA 2NVYB 1DONA 1QCBD 1VQOA 4LF6Q 2R92H 3NHHA 2NBFA 3GO5A 5J39A 5D3IB 4N8FA 1EOTA 3BS1A 1TWAH 5M3FB 5FOBB 2DN8A 5EGTA 4BBSH 3J80E 1WTWA 4JOIC 2Q2HA 2UUCQ 5IGBA 4H13C 2JA6H 3I4LA 1STEA 4R1JA 4DAPA 5KYLA 3HOZH 1CSPA 1QZGA 2KCTA
chains in the Genus database with same CATH topology
4YCUA 4DR5L 1DGSA 2XTIA 3OW2A 3KJOA 2E8GA 1VQMA 4DV4L 1YHQA 1TWGH 1C9OA 1YBYA 5C3EG 3W1GA 3M9BA 3RN2A 5LMNL 4LF9Q 2R6GA 3CCMA 2ALYB 1OTCA 3S16H 3ER0A 4A3MH 1EFWA 1WCMG 1RIPA 3GTJH 2E5LQ 2D0PA 2HIXA 4XTCS 1J5EQ 2JA7H 4B3RQ 1B70B 1I50H 3F8TA 2R93H 1VQ4A 3HOXH 3K7AH 4DUZQ 2R7ZG 3B6YA 2QEXA 2KHIA 4YHHQ 2JA8G 1YIJA 3HOWG 2WP8J 3OYYA 2H5XA 1QUQA 3CCEA 1XMOQ 1XNRL 1QZHA 1EIYB 4ALPA 3CMEA 4JI8L 1XJVA 4DR2L 1XNQL 1QUQB 2ES2A 3MXNB 4JYAQ 3GD7A 4IPDA 4X66L 2UU9L 1V1QA 4A3FH 2UUBL 3NENA 4GLXA 1VQAA 1Q82C 3H0GH 4LF5Q 1VQ8A 3HFZB 5JJKA 1I3QH 5IP9H 1NJIC 1GD7A 2NN6I 2KHJA 3K81C 4P72A 4RG1A 1SFOH 1GVPA 4X64Q 4L5RC 2F3IA 3CAMA 4DV5Q 2E2IH 2ID0A 1YZ6A 3A5UA 5M5YH 1KL9A 5C0XI 3BZCA 2JJQA 2FXQA 2MO1A 1EOVA 4QGUA 2QGQA 1PYSB 4DV1Q 3VDYA 1N36Q 4AYBG 3PSIA 2CFMA 5JEAJ 1UE1A 4X62L 1KAWA 1IBML 4GKKQ 2RF4A 4O2DA 1EWIA 2DGYA 1KD1C 3HOVH 3F2DA 3PGZA 4JCVE 4B3ML 2K5NA 2F52A 3AFPA 3AYHB 1YEZA 2K5HA 3CMAA 1GO3E 3STBD 1A8VA 2IY5B 2UXDL 4DV0L 2YYZA 4P75A 1OXSC 1X3GA 4JI1Q 2DUDA 4PMWA 4PZ7A 3JAMi 4AH6A 4DV7Q 4A93H 1BBUA 4JI6Q 3LGJA 3AEVA 1X54A 2IHFA 3S2DH 1E1TA 3TQYA 2RHSB 4A3KG 1N33L 1HZBA 4JI5Q 1PH6A 4HJ8A 4JI3Q 1N34L 4H02A 5J3BA 3PO3G 3M7NA 4TQUS 4A4IA 3U4VA 1VQBA 4DR6Q 1SRUA 1G51A 2JA5G 2A8VA 3M3YH 4JI7Q 2OTLA 2EIFA 3BJUA 1FJGL 3EIVA 4YY3Q 4IFDG 4A3DH 1L1OA 5FJ8H 1IBKQ 4YCWA 2A1AA 3FKIH 3HKSA 5HY6A 4DV2L 1JB7A 1EYGA 1VQ5A 2ZTCA 4DUYL 4HIMA 3ULPA 3GTPH 3HOYG 2UXCL 5IYBG 3S14H 1L1OB 4P73A 1G6PA 2JEAI 1A62A 2HQLA 4UP9A 2EXDA 4LF8L 4A3JH 1XPUA 1T9HA 2IX0A 5JEAG 5IYCH 2JQOA 4UY8C 1E7ZA 4JI2Q 1VQ7A 4IO9A 2AMCB 3KDFA 4NXNQ 2PQAA 4JI0L 3GTQH 3M4PA 5C3EH 2C35B 3M85A 1L1OC 1UE6A 2K50A 3KDFB 2PQAB 1WOCA 4AQYQ 4KHPL 3GTOH 4GLVB 1WCMH 3NELA 1CUKA 3UDFA 1IL2A 4HIKA 2I0QA 4MTNA 1K9MC 4JI2L 4L5QA 4R4QA 5GAGC 1XMQQ 2BA1A 2JA8H 3KF8B 3HOWH 2BH8A 5M5WH 3E9IA 4TVAB 4A76A 1YHBA 2VL6A 5C44H 1HNZL 1BVSA 4IPGA 4X65Q 4BXXG 5IE8A 2KENA 5HGQA 5C4JH 4JI4L 4LF6L 3PIOA 1VQDA 1YVCA 3W1BA 4HJ5A 5K36G 3PUXA 1NY4A 1YNXA 2Q2IA 2R7FA 5FLXc 2HT1A 4A3GG 4K0KL 1CKOA 3A0JA 5GROA 2IHEA 2L15A 2HHHQ 4LFBL 2K52A 1Q1BA 2K5VA 3J80c 3F2BA 2PI2A 4OWXB 1TWFH 3A5ZB 4LUZA 4ME3A 2K4KA 2UUAL 1PVOA 1BBWA 2R7DA 1IBLL 4LF4Q 3K0XA 3JC66 4LUVA 4LFAQ 4DR1L 1AE3A 1I94L 5GQOA 1VQPA 3M4QA 1PYBA 4GNXA 5IP7G 4LFCQ 4XIGS 3J80i 4DKAC 2VQFL 2Y0SG 4JV5L 1AE2A 4GNXB 1L2FA 1G291 3TS0A 3TREA 1EQQA 2MFIA 3FP9A 3CD6A 4OX9Q 2K14A 5M3MG 4C3IH 4IPCA 4A3IH 4MZ9A 3GTKH 1MKHA 4OO1I 4QIWE 4LF9L 3J81j 4WJ4A 2D0OA 1X9NA 4GNXC 5EAYA 1Q7YC 1SROA 3D0FA 2VW9A 1J5EL 3KOJA 2E5LL 4B3RL 3KFUA 1YI2A 3AFQA 4DUZL 5ELNA 2I5HA 2NVTH 4O0AA 1VQ6A 4APVA 4EQ5A 4B3TQ 4YHHL 4A3KH 3S1MH 3STBC 4POFA 2LSSA 4IOCA 1XMOL 2UXBQ 4BA2I 3U50C 2VQEQ 2YTVA 3U4ZA 1GM5A 3CP0A 5BR8Q 3UDIA 1Q8KA 4IFDJ 2JA5H 1X6OA 3KJPA 1VS0A 2GVBA 4KHZA 4QJFA 4C2MH 4DR7Q 1N9WA 3KLWA 4JYAL 3J7A5 1FL0A 3AQQA 2B63H 3OTOQ 2AKWB 1B7YB 4LF5L 3CCRA 4POGA 2AWNA 2NZOA 1XPRA 3PIPA 1N8RC 1OXVA 1M90C 1E24A 3GTLH 3BU2A 1KC8C 3CXCA 1HNXL 2CWPA 1TWHH 2JA6G 4YWLA 4X64L 1FGUA 1KHIA 1S40A 4DV5L 2BA0A 1Y14B 3JAMc 2I5MX 5FLMG 3RNUA 3PO2G 2IX1A 4GLAC 3CCQA 3RZDH 1JT8A 1JJ2A 4DR3Q 4R4IA 2Y0SE 5M5XH 4A3CG 1S3OA 3E9HA 1VQGA 4EX5A 5IWAQ 4DV1L 3CCVA 1N36L 4BA1I 1PH3A 3KYHC 5JJLA 2JE6I 1SE8A 4X6AH 1M1KC 2YU9H 5DLQE 2YTYA 1YJWA 3T1HQ 1C7YA 2E2HH 1U0LA 4GKKL 2N78A 4B3SQ 1YHAA 1PH1A 3K8AA 1EQRA 2ZJRA 4BY1G 3S17H 3G48A 1Y1WG 2N49A 1HZ9A 1VQLA 3CC2A 2F4VQ 1IZ6A 3I4NG 3I2ZA 4Y52H 4J15A 4IPHA 3HOXG 4R4OA 1X56A 4JI1L 2NVXH 1Q46A 2MNAA 4BXXH 4LF7Q 4KLKA 4YWKA 4DV7L 1SLJA 3PF4A 1JE5A 4GS3A 4JI6L 1S72A 1UE5A 1IYJB 2VZAA 4A3GH 1Z9FA 5JJIA 2NZHA 4JI5L 1MIUA 4JI3L 5M3FG 4DR4Q 3ERSX 4A3EG 5IYDG 1HZAA 1E3PA 4A3FG 2Z6KC 4DR6L 5LMUQ 4BBRG 1ASYA 4JI7L 1RL2A 3CW2C 2Q2TA 2OQKA 4AYBE 4YY3L 2WFWA 1UEBA 1IBKL 1N32Q 2IT1A 3BZKA 2B29A 1O7IA 1VQCA 2ZM6Q 1KRTA 4A75A 1WYDA 1HR0W 5IP7H 5AJ3Q 2UUCQ 4FDBA 1QVGA 4GKJQ 3F1ZA 2OCEA 3CCUA 3I4OA 1K73C 4LWCA 1HR0Q 1Q1EA 2I5LX 3PV0A 1PH9A 3S1NH 2OTJA 5C4XG 2AWOA 1HNWQ 1LUZA 4NXNL 3S1RH 1EUJA 2R7ZH 4LUOA 1PV4A 5M3MH 4HJAA 3A74A 4JBWA 3ZJYC 2JK8A 4JG2A 2NN6G 1V43A 4AQYL 3RLNA 2PNHA 1HZCA 1P8LA 1K3RA 2LXJA 4WJ3M 4P71A 4A3BG 1XPOA 1VQEA 1YITA 1H95A 1Y1VG 4DV6Q 3TEHB 1XMQL 2VS1A 4NB3A 4IJHA 1BKBA 4GN4B 1J6QA 4JBJA 5ELOA 3SGIA 1D8LA 2B3GA 1NBWA 1V9PA 3I56A 2CWAA 3E0EA 4DK6C 4DV3Q 1ASZA 3H15A 3G4SA 4DPGA 4JC0A 4X65L 1MJEA 4JBKA 4HIOA 3J7ZC 2GN5A 3T1YQ 3CPFA 3I7FA 4DNIA 1KQSA 4Y7NH 1PH5A 2VNUD 2JEBI 4DR5Q 2D62A 3K80C 3L7ZC 2HHHL 4BY7G 4DV4Q 1XTDA 3PUVA 4DV3L 5LMNW 3FKIG 1NMGA 5LMNQ 1LM0A 4NXMQ 3PO2H 1PA6A 2YTXA 2Z0SA 4A3JG 4NPSA 3DLLA 5E7NA 4A3CH 4LF4L 1QVFA 2VUMG 4GN5A 4LFAL 4GOPC 5IYCG 2V1CC 3NBHB 1QVCA 1SN8A 3IRBA 3S15H 3GDEA 4R4CA 3RR5A 3ULJA 4LFCL 3WWVA 1TXYA 2CQOA 4IFDI 2KCMA 2PI2E 3UDXA 2GVAA 3RLOA 4A3LG 4NXML 4OX9L 1XNRQ 3PCOB 1A63A 3CC4A 4BY1H 1YJ9A 1Y1WH 2NVQH 1I6HH 4JI8Q 4DR2Q 1XNQQ 2RHQB 2BH2A 4DAYB 3I4NH 2R92G 3PO3H 3DM3A 2CKZB 3MEFA 4RMFA 4X66Q 2UU9Q 4QL5A 2ATWA 2UUBQ 4C3JH 1VQKA 1K8AC 3PUWA 2NVYH 2RCNA 4P74A 3I4MG 2N8NA 1IXRA 4UPAA 5C44G 3L2PA 3S1QH 3D31A 3K7UC 4B3TL 1HNXQ 1X65A 1VQNA 1PH8A 3HOYH 4BBSG 3UE0A 1B8AA 3CQZH 4L5SA 2UXBL 1U5KA 5M3FH 1Q12A 4GN3B 5IYBH 4A3EH 2VQEL 2Q2UA 3M4OH 5IYDH 5GAEC 1HH2P 5BR8L 2OQ0A 1PH7A 3KF6A 4BBRH 1NMFA 1AH9A 1VQFA 2PMZE 1UWVA 4MNOA 4DAMA 1JMCA 3HOUG 4DR7L 3RLFA 3I55A 1VQIA 4OWTB 5GAHC 3HOZG 1K83H 3KF6B 4X62Q 2HIVA 1IBMQ 3EBEA 3OTOL 1MJCA 1PFSA 4L5TA 4DK3C 1OXTA 4IOAA 2YV5A 4B3MQ 4HJ9A 3UDGA 3CCLA 3S2HH 3HKZG 3ULLA 4HIDA 1K8GA 3J81c 3G71A 1CKMA 1Q81C 2UXDQ 4DV0Q 5C4XH 2K75A 4A3MG 1E1OA 1TWCH 3NEMA 3PUZA 1X3FA 4DR3L 2JA7G 2QA4A 3PUYA 5IWAL 2E2JH 2Z6KA 2R93G 1HJPA 3TRZA 1D7QA 4LW1A 2ZTEA 1SR3A 3FHWA 3J81i 1WJJA 2AHOB 5C0XJ 4A3IG 1W2BA 3T1HL 1UE7A 1N33Q 4QQBX 1A0IA 1N34Q 4B3SL 4A3BH 4OWWB 1PH2A 3RN5A 1Y1VH 1CSQA 2F4VL 3CPWA 2ASBA 1KXLA 1WFQA 2OWOA 2KBNA 1P16A 1SMXA 1FJGQ 1X55A 3PF5A 3H3VI 1K0RA 4DV2Q 2VY3A 4LF7L 3H0GG 4DUYQ 2UXCQ 2WB1G 1LTLA 1VCIA 4PG3A 1Z47A 4OO1G 5IP9G 1W3SA 2WAQG 3CCSA 4LF8Q 4KI0A 2JA9A 4PZ8A 4QY7A 3CC7A 1CKNA 4LNQA 4DR4L 4JBMA 4UP7A 4AIMA 4C3HH 1EIFA 4BY7H 1Q86C 2ZTDA 2MQHA 1I5FA 2XGTA 4JI0Q 5LMUL 2B63G 1CKNB 3W5OA 1GKHA 2ZJQA 3H3VH 3HKZE 1KRSA 1LYLA 3L0OA 4KHPQ 1JJGA 1N32L 3HOVG 2VUMH 2ZM6L 3G6EA 2UUCL 5AJ3L 4GKJL 3U58A 4OONA 3GTMH 3S24A 1PH4A 1OXUA 1FVIA 4YWMA 1YJNA 1HR0L 3F2CA 1JJCB 5C0XG 3ICEA 1HNWL 2CCZA 4A3LH 1HNZQ 1OXXK 4JOIA 3CCJA 2EQSA 3EN2A 5IY0A 1VQJA 4A93G 5H1SE 1VQOA 4JI4Q 4LF6Q 2ZJPA 2R92H 4OXPA 2N3SA 2A19A 3GO5A 4UP8A 4K0KQ 4HJ7A 2LXKA 1TWAH 1VQHA 5IT9c 3I4MH 1NE3A 4DV6L 4LFBQ 4GOPA 1X3EA 3UE1A 4IJLA 3GTGH 5GADC 1WI5A 4BBSH 4JOIC 2Q2HA 2WB1E 3CF5A 4GOPB 1L0WA 3TS2A 4A3DG 5FJ8G 4R4TA 2UUAQ 3Q8DA 1PHJA 3RZOH 1NTGA 1C0AA 2WAQE 1R9TH 1KIXA 1IBLQ 1E22A 2JA6H 1I94Q 4DR1Q 3T1YL 4PZ6A 1QZGA 5FLMH 3HOUH 4R1JA 2MO0A 3HOZH 4YCVA 1CSPA 1VQ9A 2VQFQ 2KCTA 4JV5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCU A;  4DR5 L;  1DGS A;  2XTI A;  3OW2 A;  3KJO A;  2E8G A;  1VQM A;  4DV4 L;  1YHQ A;  1TWG H;  1C9O A;  1YBY A;  5C3E G;  3W1G A;  3M9B A;  3RN2 A;  5LMN L;  4LF9 Q;  2R6G A;  3CCM A;  2ALY B;  1OTC A;  3S16 H;  3ER0 A;  4A3M H;  1EFW A;  1WCM G;  1RIP A;  3GTJ H;  2E5L Q;  2D0P A;  2HIX A;  4XTC S;  1J5E Q;  2JA7 H;  4B3R Q;  1B70 B;  1I50 H;  3F8T A;  2R93 H;  1VQ4 A;  3HOX H;  3K7A H;  4DUZ Q;  2R7Z G;  3B6Y A;  2QEX A;  2KHI A;  4YHH Q;  2JA8 G;  1YIJ A;  3HOW G;  2WP8 J;  3OYY A;  2H5X A;  1QUQ A;  3CCE A;  1XMO Q;  1XNR L;  1QZH A;  1EIY B;  4ALP A;  3CME A;  4JI8 L;  1XJV A;  4DR2 L;  1XNQ L;  1QUQ B;  2ES2 A;  3MXN B;  4JYA Q;  3GD7 A;  4IPD A;  4X66 L;  2UU9 L;  1V1Q A;  4A3F H;  2UUB L;  3NEN A;  4GLX A;  1VQA A;  1Q82 C;  3H0G H;  4LF5 Q;  1VQ8 A;  3HFZ B;  5JJK A;  1I3Q H;  5IP9 H;  1NJI C;  1GD7 A;  2NN6 I;  2KHJ A;  3K81 C;  4P72 A;  4RG1 A;  1SFO H;  1GVP A;  4X64 Q;  4L5R C;  2F3I A;  3CAM A;  4DV5 Q;  2E2I H;  2ID0 A;  1YZ6 A;  3A5U A;  5M5Y H;  1KL9 A;  5C0X I;  3BZC A;  2JJQ A;  2FXQ A;  2MO1 A;  1EOV A;  4QGU A;  2QGQ A;  1PYS B;  4DV1 Q;  3VDY A;  1N36 Q;  4AYB G;  3PSI A;  2CFM A;  5JEA J;  1UE1 A;  4X62 L;  1KAW A;  1IBM L;  4GKK Q;  2RF4 A;  4O2D A;  1EWI A;  2DGY A;  1KD1 C;  3HOV H;  3F2D A;  3PGZ A;  4JCV E;  4B3M L;  2K5N A;  2F52 A;  3AFP A;  3AYH B;  1YEZ A;  2K5H A;  3CMA A;  1GO3 E;  3STB D;  1A8V A;  2IY5 B;  2UXD L;  4DV0 L;  2YYZ A;  4P75 A;  1OXS C;  1X3G A;  4JI1 Q;  2DUD A;  4PMW A;  4PZ7 A;  3JAM i;  4AH6 A;  4DV7 Q;  4A93 H;  1BBU A;  4JI6 Q;  3LGJ A;  3AEV A;  1X54 A;  2IHF A;  3S2D H;  1E1T A;  3TQY A;  2RHS B;  4A3K G;  1N33 L;  1HZB A;  4JI5 Q;  1PH6 A;  4HJ8 A;  4JI3 Q;  1N34 L;  4H02 A;  5J3B A;  3PO3 G;  3M7N A;  4TQU S;  4A4I A;  3U4V A;  1VQB A;  4DR6 Q;  1SRU A;  1G51 A;  2JA5 G;  2A8V A;  3M3Y H;  4JI7 Q;  2OTL A;  2EIF A;  3BJU A;  1FJG L;  3EIV A;  4YY3 Q;  4IFD G;  4A3D H;  1L1O A;  5FJ8 H;  1IBK Q;  4YCW A;  2A1A A;  3FKI H;  3HKS A;  5HY6 A;  4DV2 L;  1JB7 A;  1EYG A;  1VQ5 A;  2ZTC A;  4DUY L;  4HIM A;  3ULP A;  3GTP H;  3HOY G;  2UXC L;  5IYB G;  3S14 H;  1L1O B;  4P73 A;  1G6P A;  2JEA I;  1A62 A;  2HQL A;  4UP9 A;  2EXD A;  4LF8 L;  4A3J H;  1XPU A;  1T9H A;  2IX0 A;  5JEA G;  5IYC H;  2JQO A;  4UY8 C;  1E7Z A;  4JI2 Q;  1VQ7 A;  4IO9 A;  2AMC B;  3KDF A;  4NXN Q;  2PQA A;  4JI0 L;  3GTQ H;  3M4P A;  5C3E H;  2C35 B;  3M85 A;  1L1O C;  1UE6 A;  2K50 A;  3KDF B;  2PQA B;  1WOC A;  4AQY Q;  4KHP L;  3GTO H;  4GLV B;  1WCM H;  3NEL A;  1CUK A;  3UDF A;  1IL2 A;  4HIK A;  2I0Q A;  4MTN A;  1K9M C;  4JI2 L;  4L5Q A;  4R4Q A;  5GAG C;  1XMQ Q;  2BA1 A;  2JA8 H;  3KF8 B;  3HOW H;  2BH8 A;  5M5W H;  3E9I A;  4TVA B;  4A76 A;  1YHB A;  2VL6 A;  5C44 H;  1HNZ L;  1BVS A;  4IPG A;  4X65 Q;  4BXX G;  5IE8 A;  2KEN A;  5HGQ A;  5C4J H;  4JI4 L;  4LF6 L;  3PIO A;  1VQD A;  1YVC A;  3W1B A;  4HJ5 A;  5K36 G;  3PUX A;  1NY4 A;  1YNX A;  2Q2I A;  2R7F A;  5FLX c;  2HT1 A;  4A3G G;  4K0K L;  1CKO A;  3A0J A;  5GRO A;  2IHE A;  2L15 A;  2HHH Q;  4LFB L;  2K52 A;  1Q1B A;  2K5V A;  3J80 c;  3F2B A;  2PI2 A;  4OWX B;  1TWF H;  3A5Z B;  4LUZ A;  4ME3 A;  2K4K A;  2UUA L;  1PVO A;  1BBW A;  2R7D A;  1IBL L;  4LF4 Q;  3K0X A;  3JC6 6;  4LUV A;  4LFA Q;  4DR1 L;  1AE3 A;  1I94 L;  5GQO A;  1VQP A;  3M4Q A;  1PYB A;  4GNX A;  5IP7 G;  4LFC Q;  4XIG S;  3J80 i;  4DKA C;  2VQF L;  2Y0S G;  4JV5 L;  1AE2 A;  4GNX B;  1L2F A;  1G29 1;  3TS0 A;  3TRE A;  1EQQ A;  2MFI A;  3FP9 A;  3CD6 A;  4OX9 Q;  2K14 A;  5M3M G;  4C3I H;  4IPC A;  4A3I H;  4MZ9 A;  3GTK H;  1MKH A;  4OO1 I;  4QIW E;  4LF9 L;  3J81 j;  4WJ4 A;  2D0O A;  1X9N A;  4GNX C;  5EAY A;  1Q7Y C;  1SRO A;  3D0F A;  2VW9 A;  1J5E L;  3KOJ A;  2E5L L;  4B3R L;  3KFU A;  1YI2 A;  3AFQ A;  4DUZ L;  5ELN A;  2I5H A;  2NVT H;  4O0A A;  1VQ6 A;  4APV A;  4EQ5 A;  4B3T Q;  4YHH L;  4A3K H;  3S1M H;  3STB C;  4POF A;  2LSS A;  4IOC A;  1XMO L;  2UXB Q;  4BA2 I;  3U50 C;  2VQE Q;  2YTV A;  3U4Z A;  1GM5 A;  3CP0 A;  5BR8 Q;  3UDI A;  1Q8K A;  4IFD J;  2JA5 H;  1X6O A;  3KJP A;  1VS0 A;  2GVB A;  4KHZ A;  4QJF A;  4C2M H;  4DR7 Q;  1N9W A;  3KLW A;  4JYA L;  3J7A 5;  1FL0 A;  3AQQ A;  2B63 H;  3OTO Q;  2AKW B;  1B7Y B;  4LF5 L;  3CCR A;  4POG A;  2AWN A;  2NZO A;  1XPR A;  3PIP A;  1N8R C;  1OXV A;  1M90 C;  1E24 A;  3GTL H;  3BU2 A;  1KC8 C;  3CXC A;  1HNX L;  2CWP A;  1TWH H;  2JA6 G;  4YWL A;  4X64 L;  1FGU A;  1KHI A;  1S40 A;  4DV5 L;  2BA0 A;  1Y14 B;  3JAM c;  2I5M X;  5FLM G;  3RNU A;  3PO2 G;  2IX1 A;  4GLA C;  3CCQ A;  3RZD H;  1JT8 A;  1JJ2 A;  4DR3 Q;  4R4I A;  2Y0S E;  5M5X H;  4A3C G;  1S3O A;  3E9H A;  1VQG A;  4EX5 A;  5IWA Q;  4DV1 L;  3CCV A;  1N36 L;  4BA1 I;  1PH3 A;  3KYH C;  5JJL A;  2JE6 I;  1SE8 A;  4X6A H;  1M1K C;  2YU9 H;  5DLQ E;  2YTY A;  1YJW A;  3T1H Q;  1C7Y A;  2E2H H;  1U0L A;  4GKK L;  2N78 A;  4B3S Q;  1YHA A;  1PH1 A;  3K8A A;  1EQR A;  2ZJR A;  4BY1 G;  3S17 H;  3G48 A;  1Y1W G;  2N49 A;  1HZ9 A;  1VQL A;  3CC2 A;  2F4V Q;  1IZ6 A;  3I4N G;  3I2Z A;  4Y52 H;  4J15 A;  4IPH A;  3HOX G;  4R4O A;  1X56 A;  4JI1 L;  2NVX H;  1Q46 A;  2MNA A;  4BXX H;  4LF7 Q;  4KLK A;  4YWK A;  4DV7 L;  1SLJ A;  3PF4 A;  1JE5 A;  4GS3 A;  4JI6 L;  1S72 A;  1UE5 A;  1IYJ B;  2VZA A;  4A3G H;  1Z9F A;  5JJI A;  2NZH A;  4JI5 L;  1MIU A;  4JI3 L;  5M3F G;  4DR4 Q;  3ERS X;  4A3E G;  5IYD G;  1HZA A;  1E3P A;  4A3F G;  2Z6K C;  4DR6 L;  5LMU Q;  4BBR G;  1ASY A;  4JI7 L;  1RL2 A;  3CW2 C;  2Q2T A;  2OQK A;  4AYB E;  4YY3 L;  2WFW A;  1UEB A;  1IBK L;  1N32 Q;  2IT1 A;  3BZK A;  2B29 A;  1O7I A;  1VQC A;  2ZM6 Q;  1KRT A;  4A75 A;  1WYD A;  1HR0 W;  5IP7 H;  5AJ3 Q;  2UUC Q;  4FDB A;  1QVG A;  4GKJ Q;  3F1Z A;  2OCE A;  3CCU A;  3I4O A;  1K73 C;  4LWC A;  1HR0 Q;  1Q1E A;  2I5L X;  3PV0 A;  1PH9 A;  3S1N H;  2OTJ A;  5C4X G;  2AWO A;  1HNW Q;  1LUZ A;  4NXN L;  3S1R H;  1EUJ A;  2R7Z H;  4LUO A;  1PV4 A;  5M3M H;  4HJA A;  3A74 A;  4JBW A;  3ZJY C;  2JK8 A;  4JG2 A;  2NN6 G;  1V43 A;  4AQY L;  3RLN A;  2PNH A;  1HZC A;  1P8L A;  1K3R A;  2LXJ A;  4WJ3 M;  4P71 A;  4A3B G;  1XPO A;  1VQE A;  1YIT A;  1H95 A;  1Y1V G;  4DV6 Q;  3TEH B;  1XMQ L;  2VS1 A;  4NB3 A;  4IJH A;  1BKB A;  4GN4 B;  1J6Q A;  4JBJ A;  5ELO A;  3SGI A;  1D8L A;  2B3G A;  1NBW A;  1V9P A;  3I56 A;  2CWA A;  3E0E A;  4DK6 C;  4DV3 Q;  1ASZ A;  3H15 A;  3G4S A;  4DPG A;  4JC0 A;  4X65 L;  1MJE A;  4JBK A;  4HIO A;  3J7Z C;  2GN5 A;  3T1Y Q;  3CPF A;  3I7F A;  4DNI A;  1KQS A;  4Y7N H;  1PH5 A;  2VNU D;  2JEB I;  4DR5 Q;  2D62 A;  3K80 C;  3L7Z C;  2HHH L;  4BY7 G;  4DV4 Q;  1XTD A;  3PUV A;  4DV3 L;  5LMN W;  3FKI G;  1NMG A;  5LMN Q;  1LM0 A;  4NXM Q;  3PO2 H;  1PA6 A;  2YTX A;  2Z0S A;  4A3J G;  4NPS A;  3DLL A;  5E7N A;  4A3C H;  4LF4 L;  1QVF A;  2VUM G;  4GN5 A;  4LFA L;  4GOP C;  5IYC G;  2V1C C;  3NBH B;  1QVC A;  1SN8 A;  3IRB A;  3S15 H;  3GDE A;  4R4C A;  3RR5 A;  3ULJ A;  4LFC L;  3WWV A;  1TXY A;  2CQO A;  4IFD I;  2KCM A;  2PI2 E;  3UDX A;  2GVA A;  3RLO A;  4A3L G;  4NXM L;  4OX9 L;  1XNR Q;  3PCO B;  1A63 A;  3CC4 A;  4BY1 H;  1YJ9 A;  1Y1W H;  2NVQ H;  1I6H H;  4JI8 Q;  4DR2 Q;  1XNQ Q;  2RHQ B;  2BH2 A;  4DAY B;  3I4N H;  2R92 G;  3PO3 H;  3DM3 A;  2CKZ B;  3MEF A;  4RMF A;  4X66 Q;  2UU9 Q;  4QL5 A;  2ATW A;  2UUB Q;  4C3J H;  1VQK A;  1K8A C;  3PUW A;  2NVY H;  2RCN A;  4P74 A;  3I4M G;  2N8N A;  1IXR A;  4UPA A;  5C44 G;  3L2P A;  3S1Q H;  3D31 A;  3K7U C;  4B3T L;  1HNX Q;  1X65 A;  1VQN A;  1PH8 A;  3HOY H;  4BBS G;  3UE0 A;  1B8A A;  3CQZ H;  4L5S A;  2UXB L;  1U5K A;  5M3F H;  1Q12 A;  4GN3 B;  5IYB H;  4A3E H;  2VQE L;  2Q2U A;  3M4O H;  5IYD H;  5GAE C;  1HH2 P;  5BR8 L;  2OQ0 A;  1PH7 A;  3KF6 A;  4BBR H;  1NMF A;  1AH9 A;  1VQF A;  2PMZ E;  1UWV A;  4MNO A;  4DAM A;  1JMC A;  3HOU G;  4DR7 L;  3RLF A;  3I55 A;  1VQI A;  4OWT B;  5GAH C;  3HOZ G;  1K83 H;  3KF6 B;  4X62 Q;  2HIV A;  1IBM Q;  3EBE A;  3OTO L;  1MJC A;  1PFS A;  4L5T A;  4DK3 C;  1OXT A;  4IOA A;  2YV5 A;  4B3M Q;  4HJ9 A;  3UDG A;  3CCL A;  3S2H H;  3HKZ G;  3ULL A;  4HID A;  1K8G A;  3J81 c;  3G71 A;  1CKM A;  1Q81 C;  2UXD Q;  4DV0 Q;  5C4X H;  2K75 A;  4A3M G;  1E1O A;  1TWC H;  3NEM A;  3PUZ A;  1X3F A;  4DR3 L;  2JA7 G;  2QA4 A;  3PUY A;  5IWA L;  2E2J H;  2Z6K A;  2R93 G;  1HJP A;  3TRZ A;  1D7Q A;  4LW1 A;  2ZTE A;  1SR3 A;  3FHW A;  3J81 i;  1WJJ A;  2AHO B;  5C0X J;  4A3I G;  1W2B A;  3T1H L;  1UE7 A;  1N33 Q;  4QQB X;  1A0I A;  1N34 Q;  4B3S L;  4A3B H;  4OWW B;  1PH2 A;  3RN5 A;  1Y1V H;  1CSQ A;  2F4V L;  3CPW A;  2ASB A;  1KXL A;  1WFQ A;  2OWO A;  2KBN A;  1P16 A;  1SMX A;  1FJG Q;  1X55 A;  3PF5 A;  3H3V I;  1K0R A;  4DV2 Q;  2VY3 A;  4LF7 L;  3H0G G;  4DUY Q;  2UXC Q;  2WB1 G;  1LTL A;  1VCI A;  4PG3 A;  1Z47 A;  4OO1 G;  5IP9 G;  1W3S A;  2WAQ G;  3CCS A;  4LF8 Q;  4KI0 A;  2JA9 A;  4PZ8 A;  4QY7 A;  3CC7 A;  1CKN A;  4LNQ A;  4DR4 L;  4JBM A;  4UP7 A;  4AIM A;  4C3H H;  1EIF A;  4BY7 H;  1Q86 C;  2ZTD A;  2MQH A;  1I5F A;  2XGT A;  4JI0 Q;  5LMU L;  2B63 G;  1CKN B;  3W5O A;  1GKH A;  2ZJQ A;  3H3V H;  3HKZ E;  1KRS A;  1LYL A;  3L0O A;  4KHP Q;  1JJG A;  1N32 L;  3HOV G;  2VUM H;  2ZM6 L;  3G6E A;  2UUC L;  5AJ3 L;  4GKJ L;  3U58 A;  4OON A;  3GTM H;  3S24 A;  1PH4 A;  1OXU A;  1FVI A;  4YWM A;  1YJN A;  1HR0 L;  3F2C A;  1JJC B;  5C0X G;  3ICE A;  1HNW L;  2CCZ A;  4A3L H;  1HNZ Q;  1OXX K;  4JOI A;  3CCJ A;  2EQS A;  3EN2 A;  5IY0 A;  1VQJ A;  4A93 G;  5H1S E;  1VQO A;  4JI4 Q;  4LF6 Q;  2ZJP A;  2R92 H;  4OXP A;  2N3S A;  2A19 A;  3GO5 A;  4UP8 A;  4K0K Q;  4HJ7 A;  2LXK A;  1TWA H;  1VQH A;  5IT9 c;  3I4M H;  1NE3 A;  4DV6 L;  4LFB Q;  4GOP A;  1X3E A;  3UE1 A;  4IJL A;  3GTG H;  5GAD C;  1WI5 A;  4BBS H;  4JOI C;  2Q2H A;  2WB1 E;  3CF5 A;  4GOP B;  1L0W A;  3TS2 A;  4A3D G;  5FJ8 G;  4R4T A;  2UUA Q;  3Q8D A;  1PHJ A;  3RZO H;  1NTG A;  1C0A A;  2WAQ E;  1R9T H;  1KIX A;  1IBL Q;  1E22 A;  2JA6 H;  1I94 Q;  4DR1 Q;  3T1Y L;  4PZ6 A;  1QZG A;  5FLM H;  3HOU H;  4R1J A;  2MO0 A;  3HOZ H;  4YCV A;  1CSP A;  1VQ9 A;  2VQF Q;  2KCT A;  4JV5 Q; 
#chains in the Genus database with same CATH topology
 5DM7 3;  2E8G A;  3S17 B;  1BR9 A;  3MC0 B;  1DZ1 A;  5EKK A;  2E2J B;  4EQN A;  2MPM A;  4LF9 Q;  1MD2 D;  5C5L A;  3ER0 A;  4A3M H;  1EFW A;  2E5L Q;  2HIX A;  3SR1 A;  1SMY D;  3SDZ A;  4A3G B;  2KHI A;  5LL6 S;  2WP8 J;  4N8X 1;  4KD4 A;  1TY2 A;  4PMB A;  4JI8 L;  3RD4 A;  1B44 D;  1QUQ B;  3VR2 A;  3MXN B;  2BOS A;  4IPD A;  4X66 L;  2UU9 L;  3NEN A;  5BN5 A;  4LF5 Q;  3RUZ A;  4ZUJ A;  4OO1 H;  4RG1 A;  2NN6 I;  4P72 A;  1SFO H;  3S1N B;  1GVP A;  2F0T A;  4K6L A;  4L5R C;  2E2I H;  3K59 A;  4XT3 B;  3SXH A;  2FXQ A;  2MO1 A;  2IW3 A;  1EOV A;  2B2Y C;  4DV1 Q;  4ZYS A;  2HD3 A;  4KMU C;  4X62 L;  2K03 A;  1IBM L;  4O2D A;  1SYB A;  3PGZ A;  4JCV E;  3BZD B;  3QR8 A;  2F52 A;  2XN9 C;  2IY5 B;  2UXD L;  4DV0 L;  2PW7 A;  4P75 A;  1OXS C;  3PMF A;  5D14 A;  3SK8 A;  5CV6 A;  1T5E A;  4DV7 Q;  4K6D A;  1TU2 B;  4ZK9 B;  1N33 L;  1MSG A;  1HZB A;  2DY8 A;  3CKI B;  4JI3 Q;  5J3B A;  3M7N A;  2SDF A;  3MTS A;  1VQB A;  1ILP A;  4C3J G;  4JI7 Q;  3I3C A;  3HOU B;  4YY3 Q;  5EJW A;  4A3D H;  1L1O A;  5FJ8 H;  4YCW A;  3FKI H;  3HOY G;  4HR7 B;  3S15 B;  3GTP H;  1DYQ A;  3BYT B;  5CV5 A;  3W2D A;  2UXC L;  2QW7 A;  2XRS D;  1A62 A;  4UP9 A;  3T53 B;  1XPU A;  2IX0 A;  5JEA G;  3NTK A;  4JI2 Q;  2NTS A;  1VQ7 A;  1O80 A;  4IO9 A;  5JJZ A;  4BY1 B;  5I9O A;  1ICF B;  4CKC A;  5C3E H;  2C35 B;  1BDO A;  2AQ1 B;  4BWG B;  3K7A B;  1ONL A;  4KHP L;  2KED A;  4GLV B;  3K5M A;  4CJ0 B;  2FIN B;  2I0Q A;  3K0Y A;  2F0W A;  1NAP A;  5GAG C;  2B39 A;  3GP7 A;  5FO7 B;  3HOW H;  1X3P A;  3E9I A;  2N55 A;  1BVS A;  1BO0 A;  5IE8 A;  1KDB A;  3BDC A;  5K36 G;  1YVC A;  3W1B A;  3A7A B;  1YNX A;  4K0K L;  3AMU A;  2HT1 A;  1F2Z A;  5CBA E;  2K52 A;  4FF4 A;  2A69 D;  3DWA A;  4CBV A;  2NZ1 D;  5C4X B;  1EU3 A;  3HS0 C;  1OO9 B;  4KN7 C;  4OWX B;  1TWF H;  3A5Z B;  2C5C A;  2K4K A;  1A3U A;  5CV7 A;  1I94 L;  1LAC A;  4IUP A;  3M4Q A;  1WD0 A;  2R61 A;  4DF7 A;  3J80 i;  2Y0S G;  5DNF A;  1AE2 A;  3TME A;  1QG7 A;  5M3M G;  4ZAI A;  3GTK H;  1MKH A;  4OO1 I;  4QIW E;  1ZXT A;  5KEE A;  4IUV A;  2A6H D;  3CHB D;  2EE1 A;  1Q7Y C;  4B3R L;  5ELD A;  2EZV A;  2GA4 B;  1YI2 A;  3PQI A;  3AFQ A;  1JOO A;  4RA8 A;  4APV A;  4EQ5 A;  1F2M A;  2TMP A;  1F9P A;  2PMZ B;  4C3H B;  1XMO L;  2UXB Q;  3U50 C;  4H0L C;  3T13 A;  5BR8 Q;  2ICI A;  2JA5 H;  1C4Q A;  1QNU A;  1X6O A;  4UAI A;  1CFM A;  2JYO A;  2M2L A;  3KLW A;  3J7A 5;  5CBE E;  3R2T A;  2B63 H;  4OIK A;  2AKW B;  4L6T B;  2HDM A;  1N8R C;  1XYI A;  1M90 C;  3BU2 A;  1HNX L;  3CXC A;  1FYC A;  2G9H D;  1SYG A;  4YWL A;  4X64 L;  1HTP A;  2BA0 A;  5T1G A;  2B8G A;  2D2C C;  3PO2 G;  3D8G A;  4GLA C;  1JJ2 A;  2K33 A;  5FKA C;  2Z4I A;  3CCV A;  1N36 L;  3NTH A;  5JJL A;  2J0T D;  4X6A H;  3T1H Q;  4NDX A;  2L4N A;  2PYK A;  1C7Y A;  1S5E D;  2N78 A;  1YHA A;  5C44 B;  3K8A A;  3S17 H;  3G48 A;  1VQL A;  1TT2 A;  2F4V Q;  3GTG B;  1JWU D;  3I4N G;  1SXT A;  4C1N K;  2XRQ D;  4J15 A;  3HOX G;  3RZO B;  2HUG A;  5E4X A;  5I4D A;  1R9T B;  2MNA A;  4BXX H;  4LF7 Q;  3PF4 A;  4JI6 L;  4F87 A;  1HUM A;  4A3G H;  1Y8P B;  1Z9F A;  5JJI A;  4FXK C;  2NZH A;  4IAL A;  4JI5 L;  5M3F G;  3ERS X;  1G2T A;  1RD9 D;  1EL0 A;  4DR6 L;  2PPB C;  2LY7 A;  3M4Y A;  4UDU C;  1K0S A;  4O1N A;  3I90 A;  3QOL A;  1N32 Q;  1ESR A;  1VQC A;  2ZM6 Q;  1G91 A;  1KRT A;  4A75 A;  1WYD A;  1KAA A;  2WII B;  5IP7 H;  4FDB A;  4A3I B;  1K28 A;  2A69 C;  2E74 C;  4DK0 A;  1Y8N B;  1S5C D;  4LWC A;  3S1N H;  1Q1E A;  3PV0 A;  2OTJ A;  1HNW Q;  4XXE A;  1HXY D;  4HJA A;  3A74 A;  1E2V A;  4JBW A;  4TKO B;  2DJF C;  5CV8 A;  4KJN A;  5M9O A;  5K5P A;  3RLN A;  3RMH A;  1K3R A;  3OOC A;  2LXJ A;  4A3B G;  1SDF A;  1F77 A;  2WAQ B;  2VS1 A;  3V05 A;  4JBJ A;  1J6Q A;  3URY A;  5M5Y B;  1NBW A;  3I56 A;  3E0E A;  3H15 A;  1S5D D;  4DPG A;  3CPF A;  4XYQ A;  5T1I A;  4DFA A;  3HOV B;  4Y7N H;  2JEB I;  3K80 C;  2HHH L;  1UAP A;  3I91 A;  4Z9C B;  5G3L F;  1II3 A;  3V96 A;  4KKU A;  1NMG A;  1LTA D;  2X69 A;  1E0B A;  2YTX A;  2Z0S A;  4HSP A;  3DLL A;  5E7N A;  2QEJ C;  4LF4 L;  5A2Q L;  4A3C H;  4GOP C;  3S15 H;  4R4C A;  2JXM B;  1TXY A;  5CR3 A;  2KCM A;  4IUU A;  3RLO A;  1A63 A;  2NVX B;  4BY1 H;  2MUY A;  5JVG 3;  3M3Y B;  4JI8 Q;  2EYH A;  2RHQ B;  2BH2 A;  2B2W C;  4FVM A;  2BCO A;  2CKZ B;  2ATW A;  4X66 Q;  1RTN A;  2LKV A;  4K5W A;  4QL5 A;  2UU9 Q;  3EJI A;  1B50 A;  1V8Q A;  3I4M G;  4Q5V A;  4UPA A;  4F8M A;  3L2P A;  3D31 A;  3K7U C;  4B3T L;  1X65 A;  2RBM A;  2A6E C;  1PH8 A;  5A2Q E;  4ID6 A;  1D5Z C;  3GTQ B;  5GAE C;  3Q23 A;  5C4H A;  4NKL A;  1PH7 A;  3T51 B;  1NMF A;  1WVL A;  2I07 B;  1VQF A;  1H9S A;  1UWV A;  3HOU G;  3RLF A;  3VYR A;  3I55 A;  4OWT B;  5GAH C;  2CH4 A;  3KF6 B;  3H09 A;  4X62 Q;  2HIV A;  1IBM Q;  1PFS A;  2EXZ A;  3ZYY X;  2F0F A;  3G71 A;  2UXD Q;  4DV0 Q;  5C4X H;  2K75 A;  1TWC H;  3NP8 A;  2R93 G;  2DNE A;  1F9R A;  1EFI D;  4LW1 A;  2AHO B;  5C0X J;  5FO9 B;  1W2B A;  1N33 Q;  3TP8 A;  1A0I A;  1PDQ A;  2I46 A;  5L37 A;  2EY1 A;  1LTG D;  3C2P A;  3CPW A;  2Z4H A;  2MP1 A;  1BCP D;  1WFQ A;  3HRZ C;  1P16 A;  1QWY A;  3QO2 A;  1X55 A;  1K0R A;  1A3T A;  1LT5 D;  2KJX A;  2UXC Q;  4JW0 A;  2KHS A;  1CQV A;  5IP9 G;  3R3O A;  1PFN A;  4QY7 A;  4ODG A;  4JK1 C;  4DR4 L;  1SYD A;  4JBM A;  4AIM A;  4C3H H;  1Q86 C;  2XGT A;  5LMU L;  1AEX A;  1GKH A;  3HGB A;  3HKZ E;  4KHP Q;  5KGU A;  4RKL A;  2Q8T A;  1B4O A;  5AJ3 L;  3U58 A;  3NTI A;  3A8K E;  1W6J A;  1HR0 L;  2TSS A;  2PW5 A;  2V4D A;  1G6Z A;  4C3J B;  3O13 A;  5IIF A;  3SHL A;  5H1S E;  2EPB A;  4OXP A;  5LL6 X;  3P7J A;  5FLX E;  4K0K Q;  3ONA B;  4HJ7 A;  3HOY B;  1H9J A;  3CQZ B;  5IT9 c;  4KJO A;  4DV6 L;  2CHB D;  1X32 A;  4GOP A;  2QKI C;  2VB3 X;  4BBR B;  5GAD C;  1WI5 A;  3GTG H;  2WB1 E;  3TS2 A;  3RZO H;  3Q8D A;  1R9T H;  1I94 Q;  4P2C B;  3S2H B;  3QG1 A;  1HTL D;  2B2W A;  1KRS A;  5EKI A;  3PIP 3;  1DGS A;  3OW2 A;  1VQM A;  4HTH A;  1TWG H;  1AW7 A;  3W1G A;  1SYF A;  1A15 A;  2R6G A;  2PNR C;  3SEB A;  3K5O A;  3GTJ H;  4B3R Q;  1B70 B;  1CQF A;  1VQ4 A;  1PTO F;  2R7Z G;  3B6Y A;  5IGC A;  2JA8 G;  1YIJ A;  3E3X A;  2H5X A;  1SNQ A;  1XMO Q;  1EWH A;  3LNN A;  1QZH A;  1WTX A;  3D6C A;  3NUC A;  1XJV A;  2ES2 A;  3J81 L;  3MWY W;  1HA5 A;  3GD7 A;  1CT1 D;  4A3F H;  4GLX A;  1VQA A;  1Q82 C;  1ML0 D;  3HFZ B;  1HNX Q;  2Y0S B;  1NJI C;  1BCP C;  4X3U A;  4X64 Q;  2B2T A;  2J4X A;  1STB A;  1YZ6 A;  3A5U A;  5M5Y H;  1KL9 A;  4IUR A;  5M3M B;  4F7X A;  1EZ6 A;  2JJQ A;  1WTP A;  2XWB B;  4QUC A;  1N36 Q;  2CFM A;  5COR A;  1UE1 A;  1KAW A;  4YIJ A;  2RF4 A;  3CRL C;  2RCF A;  1KD1 C;  3HOV H;  3H3V C;  2F0L A;  2K5N A;  1LT3 D;  2IL8 A;  1WTR A;  2PZT A;  3AFP A;  3AYH B;  2OT2 A;  1YEZ A;  2K5H A;  4HCS A;  1A8V A;  2L55 A;  3QB3 A;  4FF2 A;  1X3G A;  1LTR D;  4PMW A;  1LTI D;  2RKS A;  1HUN A;  4JI6 Q;  3S2D H;  2RHS B;  4ABN A;  4JI5 Q;  1PH6 A;  1N34 L;  4H02 A;  1F2Y A;  3U4V A;  4DR6 Q;  1SBB B;  3M3Y H;  3QJY A;  4OGQ C;  5ELC A;  4WFN 3;  1C8C A;  3PO2 B;  1PTO H;  1SEB D;  1PYW D;  3LX0 A;  5HY6 A;  1JB7 A;  1DOL A;  2ZTC A;  4DUY L;  3ULP A;  1XTC D;  3ITP A;  2F0I A;  5IYB G;  1L1O B;  4P73 A;  2JEA I;  2L9H A;  2EXD A;  1WTQ A;  1T9H A;  2B2U A;  4KN4 C;  2JQO A;  5IYC H;  1BF4 A;  1HA6 A;  2Q8R E;  3KDF A;  2PQA A;  3GTQ H;  3I4N B;  4XQQ A;  1SAP A;  2EOT A;  5BN4 A;  1L1O C;  2F03 A;  3BVM A;  3HOX B;  3P1H A;  1B3Q A;  5AFW A;  3VA7 A;  4J1M A;  2K5D A;  3NEL A;  4MTN A;  4L5Q A;  1YNJ D;  1EZ8 A;  3L3O C;  3M4O B;  4A76 A;  2VL6 A;  1HNZ L;  1A3V A;  3TZD A;  3H0G B;  4KTA A;  4X3T A;  2KQ3 A;  1H9K A;  1VQD A;  3PIO A;  4HJ5 A;  4M8A A;  3PUX A;  1I3Q B;  2Q2I A;  2R7F A;  5I9P A;  4B9W A;  5GRO A;  3WOF A;  5A35 A;  2HHH Q;  5LHY 1;  2JP1 A;  1NR2 A;  3J80 c;  4LUZ A;  1R4P B;  3H91 A;  1BBW A;  1IBL L;  4LF4 Q;  3K0X A;  3JC6 6;  1CK1 A;  4DR1 L;  1AE3 A;  4GNX A;  1MHW C;  3VR3 A;  4XIG S;  1QJO A;  3NE5 B;  4A3B B;  3TS0 A;  3CD6 A;  2MFI A;  2AUK A;  3IFD A;  1CA6 A;  4IPC A;  4MZ9 A;  4A93 B;  3NBI A;  4CDF C;  2K05 A;  4WJ4 A;  1X9N A;  3T56 B;  1LT4 D;  5EKL A;  2VW9 A;  1J5E L;  1CA5 A;  1X3Q A;  2MGS A;  3NQT A;  1CHQ D;  4DUZ L;  5ELN A;  1Q3L A;  1Z6H A;  4B3T Q;  3S1M H;  2RSN A;  4IOC A;  4OIJ A;  4KKT A;  2QDL A;  3U4Z A;  3CP0 A;  3GTO B;  4U67 3;  3SK5 A;  3BVZ A;  1DJR D;  1VS0 A;  2GVB A;  1MBY A;  2IWH A;  4K5X A;  5JPN C;  1FL0 A;  1PRT D;  4ZKB B;  1B7Y B;  2NZO A;  3PIP A;  1OXV A;  2Z9H A;  2PCF B;  1E24 A;  2JA6 G;  1S40 A;  5JPM C;  5JEA H;  4Q0F A;  3JAM c;  2I5M X;  3F2U A;  3TN2 A;  1JT8 A;  1A2T A;  5IGE A;  1WCM B;  5ELE A;  2JE6 I;  5DLQ E;  1YJW A;  4GKJ Q;  2E2H H;  2EY6 A;  5IGD A;  3V2T A;  3I4M B;  1PH1 A;  1LV9 A;  3A54 A;  5G3L D;  1HZ9 A;  1D1K A;  1TS4 A;  1EY7 A;  3C1F A;  3GV6 A;  1VF7 A;  1MSH A;  2BE5 D;  2F0S A;  4WOR A;  4GS3 A;  2NB0 A;  1S72 A;  5BN3 A;  5K36 H;  1YNJ C;  4DR4 Q;  4A3E G;  5E1F A;  4LJZ C;  3LWU A;  2Z6K C;  2KVM A;  5LMU Q;  4BBR G;  1PFB A;  3SK6 A;  2Q2T A;  5IGG A;  1B2T A;  4AYB E;  1O7L A;  1UEB A;  1RJT A;  2SNM A;  1I50 B;  2R93 B;  5JVH 3;  3TP6 A;  4G7H C;  1HPC A;  4C3I B;  5AJ3 Q;  4PNY A;  3F1Z A;  3CCU A;  3I4O A;  1HR0 Q;  2I5L X;  4J8Q A;  2ICE C;  2A5H A;  4NXN L;  4LUO A;  5M3M H;  3ZJY C;  2JK8 A;  4MN3 A;  1KNA A;  1V43 A;  2PNH A;  1P8L A;  1TS5 A;  4P71 A;  1SNC A;  1H95 A;  1SMY C;  4DV6 Q;  3TEH B;  1XMQ L;  2D5D A;  1XX8 A;  4IJH A;  2FHT A;  3K5N A;  1D8L A;  4MTK A;  2G9D A;  1V9P A;  1NSN S;  2CWA A;  4DV3 Q;  5CYU A;  3CU7 A;  3G4S A;  2K6A A;  1U4M A;  4X65 L;  1MJE A;  4HIO A;  3TP7 A;  5EPJ A;  3DM1 A;  1BUV T;  3J7A F;  1O7Z A;  3TDQ A;  1STY A;  4XT1 B;  3I7F A;  2ENB A;  4ZKC B;  2D62 A;  4BY7 G;  1XTD A;  2F0V A;  3FKI G;  3NBH A;  1XWE A;  3PO2 H;  3H94 A;  1AFP A;  4NPS A;  3A8I E;  1PRT C;  4QIW B;  2VUM G;  3KLS A;  1C0A A;  1SN8 A;  3MXG A;  5ELF A;  3BYY B;  3GDE A;  3RR5 A;  4LFC L;  1O7Y A;  1ENF A;  2PI2 E;  3BDL A;  2GVA A;  4DAY A;  4A3L G;  4NXM L;  3PCO B;  1I6H H;  3C46 A;  4FF3 A;  3I4N H;  1D1I A;  3PO3 H;  4RMF A;  5CC4 A;  1I4X A;  3Q22 A;  4ZUI A;  2NVY H;  4P74 A;  5E4W C;  2N8N A;  3S14 B;  2CW0 D;  4J6H A;  3X3N A;  3MXU A;  1U5K A;  5M3F H;  4GN3 B;  3M4O H;  1E2W A;  1AH9 A;  2PMZ E;  1JMC A;  4DAM A;  4ZQ3 A;  1VQI A;  3Q24 A;  2DY7 A;  1H9S B;  4L5T A;  1OXT A;  3FVQ A;  5TSS A;  3UDG A;  2R7Z B;  3NSW A;  3EFX D;  3NWS A;  3ULL A;  2JA8 B;  5M5W B;  1B53 A;  4RGO S;  1Q81 C;  1E1O A;  5E3F A;  3PUZ A;  1X3F A;  4R8I A;  2JA7 G;  5C4J B;  2E2J H;  2Z6K A;  1HJP A;  4OL7 A;  1C48 A;  2ZTE A;  1SR3 A;  3FHW A;  4U68 A;  2E76 C;  4KY7 A;  4B3S L;  1N34 Q;  4A3B H;  1EY0 A;  1GUG A;  1QE6 A;  3OW7 A;  1A6X A;  2OEO A;  2QIL A;  2KBN A;  2SOB A;  1IL8 A;  1SMX A;  2IPK D;  1Y8O B;  2CQA A;  4DGZ A;  3PF5 A;  3H3V I;  4LMQ D;  3H0G G;  1PTO D;  4DUY Q;  2B2V C;  4PG3 A;  2XVS A;  3CCS A;  4HN7 A;  5EQ0 A;  2JA9 A;  1SNM A;  2KA7 A;  4PZ8 A;  1FD7 D;  1PXU A;  4LNQ A;  2O5J C;  1LT6 D;  4QMG A;  2ZTD A;  2MQH A;  1IKL A;  1I5F A;  3KBG A;  2B63 G;  2XSC A;  2NYZ D;  2FJ2 A;  3DWQ A;  1V1O A;  4F88 A;  3DXJ C;  3TBI B;  3OWE B;  1BQQ T;  1LYL A;  3L0O A;  2LS0 1;  4QUF A;  4DXF A;  3G6E A;  3Q0A A;  1ZKO A;  1OXU A;  1YJN A;  2X6L A;  3F2C A;  5C0X G;  1I4P A;  2CCZ A;  1HNZ Q;  3EN2 A;  5IY0 A;  1VQJ A;  4CGY B;  4A93 G;  3D6W A;  4DAV A;  2A6H C;  2JN4 A;  2AQ2 B;  2N3S A;  3D4D A;  4UP8 A;  4PV1 C;  1VQH A;  3I4M H;  3FRP B;  1TWH B;  1X3E A;  3UE1 A;  1GUO A;  1NR4 A;  3CF5 A;  1DXM A;  4GOP B;  3NQI A;  1L0W A;  2G5D A;  4R4T A;  1PHJ A;  1NTG A;  1CI3 M;  2WAQ E;  2XIW A;  1IBL Q;  4QCL A;  1E22 A;  4DR1 Q;  4CKB A;  2KOL A;  1RTO A;  4PZ6 A;  5FLM H;  3HOU H;  2CW0 C;  1T5X D;  3HP3 A;  2MO0 A;  3S9W A;  1GUS A;  4A3J G;  1B3A A;  3DWP A;  4N9P A;  4DR5 L;  1UUP A;  3OSO A;  4ULL A;  4OEL B;  4NW2 A;  3HEJ A;  3RN2 A;  5LMN L;  3CCM A;  4XYO A;  1OTC A;  1WTO A;  2NTT A;  2Z8L A;  4EGV A;  1WCM G;  1J5E Q;  2F0J A;  4K8I A;  1I50 H;  2RQX A;  3F8T A;  2R93 H;  1UNS A;  4XQN A;  3K7A H;  4DUZ Q;  5I6Y A;  3P75 A;  1ROD A;  1EY5 A;  2CH4 W;  1E2Z A;  3K57 A;  3VYT A;  1RDP D;  1EIY B;  4ALP A;  2J7Z A;  1XNQ L;  3D3R A;  2R3Z A;  3L9A X;  1V1Q A;  2AUJ D;  1U4R A;  4V19 0;  4QB4 A;  1ILQ A;  5IP9 H;  4G7O C;  2D9U A;  1GD7 A;  2LMC B;  2F3I A;  3CAM A;  2ID0 A;  4CHT B;  5C0X I;  2K28 A;  4FXG C;  4QGU A;  2QGQ A;  3W3A A;  4AYB G;  3PSI A;  2RA4 A;  1EWI A;  4B3M L;  4K2L A;  2B2T C;  4C3I G;  3NWT A;  2B2V A;  1GO3 E;  3OMC A;  3STB D;  3ERO A;  3LWE A;  3FMC A;  4I7A A;  2MHV A;  4ZLT F;  4HSV A;  4PZ7 A;  4AH6 A;  1WD1 A;  3LGJ A;  2IHF A;  5D3D A;  3TQY A;  2O4X A;  3KUP A;  4RFB A;  3K6O A;  4A3K G;  4HJ8 A;  1VF5 C;  3A55 A;  4TQU S;  1SRU A;  2JA6 B;  3MFY A;  2EIF A;  1KDC A;  3BJU A;  1G2S A;  2MJ8 A;  4IFD G;  3HOZ B;  1MI2 A;  2A1A A;  4DV2 L;  1VQ5 A;  4HIM A;  2L5T A;  1SND A;  3S14 H;  4EVO A;  4K5V A;  5DM6 3;  4LF8 L;  1CHP D;  3MHB A;  1NUC A;  4H44 C;  4WRD A;  4ILW A;  3MZ5 A;  5C5M A;  1E7Z A;  5IT9 L;  4NXN Q;  2AMC B;  4JI0 L;  1HCZ A;  2IX3 A;  2BDN A;  1D5X C;  3M85 A;  1UE6 A;  2K50 A;  3T16 A;  3KDF B;  2PQA B;  1JWS D;  1IW7 D;  2EY5 A;  1K8M A;  2K01 A;  1IL2 A;  3KF8 A;  3TZU A;  2B2U C;  4JI2 L;  4R4Q A;  1K8O A;  1XMQ Q;  2JA8 H;  3BDO A;  2H1E A;  5M5W H;  4TVA B;  4A3E B;  1YHB A;  1LLR D;  5C44 H;  2RDG A;  1MGS A;  4KK7 A;  1HHV A;  1DM0 B;  4X65 Q;  1TS3 A;  2KEN A;  1V1P A;  5C4J H;  3I8Z A;  4JI4 L;  1K83 B;  1NY4 A;  5FLX c;  4FP5 D;  3A0J A;  2E2I B;  1RKN A;  2IHE A;  2L15 A;  4LFB L;  2KEE A;  1PZK D;  1NCV A;  1Q1B A;  2K5V A;  3AU7 A;  3F2B A;  1SNO A;  1GJX A;  2UUA L;  1PVO A;  1STG A;  2R7D A;  4K8J A;  1G8Z D;  3N52 A;  4LFC Q;  4CDD C;  4DKA C;  2VQF L;  1IYV A;  4JV5 L;  2FMM A;  4GNX B;  4GZY C;  1L2F A;  3FP9 A;  2K14 A;  2QF7 A;  1S4Z A;  1KTK A;  4A3I H;  4CDC C;  3BG3 A;  2RDF A;  2A73 B;  1CZG A;  1B9M A;  4GNX C;  5EAY A;  1SRO A;  1YNN D;  3KOJ A;  1KLG D;  1RF2 D;  1BCP B;  2EDG A;  1VQ6 A;  1NNX A;  4YHH L;  3STB C;  2EJM A;  4BY7 B;  5NUC A;  4BA2 I;  2YTV A;  3KLR A;  1WTH A;  3DHQ A;  3FKI B;  4IFD J;  5ISR A;  3GTP B;  1SE3 A;  4JYA L;  4FNF A;  4KHZ A;  4X3S A;  4ME5 A;  5C3W A;  2VUM B;  1HFN A;  4R8N A;  2AWN A;  1XPR A;  1ET9 A;  3QOJ A;  4IUT A;  3U9O A;  3GTM B;  1EY9 A;  1TWH H;  3J81 E;  1FGU A;  1KHI A;  5J22 A;  4DV5 L;  2F3W A;  3RNU A;  4IUQ A;  3CCQ A;  2K7V A;  2JSO A;  4R4I A;  2Y0S E;  4IN3 A;  4RWS C;  1S3O A;  4EX5 A;  4BA1 I;  1S5F D;  1GOZ A;  2WKD A;  1I4H A;  4GKK L;  2M9V A;  1U0L A;  1Y69 U;  4B3S Q;  3I73 A;  3I72 A;  1J9O A;  1EQR A;  1Y1W G;  2N49 A;  2K5Q A;  3KLS X;  1I4Q A;  4LAA A;  4Y52 H;  4IPH A;  1X56 A;  5I6W A;  4JI1 L;  2NVX H;  3ERQ A;  4KLK A;  4YWK A;  3T4A C;  1JE5 A;  1UE5 A;  1BXT A;  4KHV A;  1EWC A;  1STA A;  1MIU A;  3DEO A;  4RAU C;  5IYD G;  1HZA A;  4A3F G;  2Q8I B;  3HG9 A;  1RL2 A;  3S16 B;  4KV6 A;  2OQK A;  2VB2 X;  5FK9 C;  1IBK L;  2IT1 A;  2JA7 B;  2B29 A;  3VYU A;  1JWM D;  1BOS A;  1HR0 W;  5CV9 A;  1K73 C;  2OCE A;  2WIN B;  4HCE A;  3OPO A;  1EY6 A;  4JG2 A;  3J80 L;  3OMG A;  2NN6 G;  4AQY L;  1LTB D;  1RHP A;  1Y1V G;  1TS2 A;  2HCI A;  2XWJ B;  4V0B A;  1Q8I A;  2JA5 B;  2KEC A;  5ELO A;  4GN4 B;  5F2D A;  2B3G A;  1EYC A;  2B8F A;  5C6A A;  3TSS A;  3VR4 A;  3C1E A;  2B63 B;  1YNN C;  4JBK A;  1I6V C;  2KUM A;  3AB9 A;  3N6R A;  1Q90 A;  1PH5 A;  2VNU D;  4DR5 Q;  3WDN A;  3L7Z C;  4RCN A;  2C9O A;  2F0D A;  3PUV A;  1J8I A;  1EQT A;  1SNP A;  1EQV A;  1WTV A;  5LMN Q;  1LM0 A;  1DOK A;  3FDT A;  2SEB D;  4DXG A;  1QVF A;  4LFA L;  2HDL A;  1GHJ A;  2EJG C;  5IYC G;  2V1C C;  3NBH B;  3IRB A;  2F0H A;  2CQO A;  2DJG C;  3Q6S A;  3UDX A;  3MFG A;  1BCP F;  4OX9 L;  1YJ9 A;  1XNQ Q;  4DN4 M;  4DAY B;  2R92 G;  3MEF A;  3JAM L;  4ZRZ A;  3A56 A;  4RGM A;  4C3J H;  3SK4 A;  3P20 A;  3PUW A;  2RCN A;  2O2L D;  3VA5 A;  4A3J B;  1VQN A;  1I4G A;  3HOY H;  4BBS G;  3UE0 A;  1B8A A;  3CQZ H;  1FR3 A;  1TY0 A;  1Q12 A;  2Q2U A;  4A3E H;  3NPP A;  1KAB A;  2VQE L;  1HH2 P;  2OQ0 A;  1EEF D;  4BBR H;  1TKW B;  4MNO A;  1S5B D;  4DR7 L;  4UHV A;  3HOZ G;  1K83 H;  3TP5 A;  3EBE A;  3OTO L;  1MJC A;  1ICW A;  2OF1 A;  2YV5 A;  1VDZ A;  3KK7 A;  5COY A;  3JAM E;  3HKZ G;  4B3M Q;  3S2H H;  1M8A A;  3H6M A;  4HID A;  1JCK B;  4ZCK A;  2OXP A;  4A3M G;  3NEM A;  1JR0 D;  4DR3 L;  2RSO A;  1U9R A;  2QA4 A;  2PZU A;  3HZX A;  5IWA L;  1D7Q A;  3MVV A;  3J81 i;  1WJJ A;  3IL8 A;  4QQB X;  5HUR A;  3C3L A;  3A7L A;  2ASB A;  1KXL A;  2OWO A;  5J1Z A;  2F0G A;  4TRD A;  5EBD A;  4KY6 A;  4C56 C;  1LTT D;  4B08 A;  4Y7N B;  4DV2 Q;  2VY3 A;  5KND A;  2PZW A;  2WB1 G;  1LTL A;  4AYB B;  3R2I A;  4OO1 G;  2F0Q A;  4LF8 Q;  4KI0 A;  2SNS A;  2EYP A;  2A74 C;  1IYU A;  1CKN A;  5D65 A;  4BY7 H;  4JI0 Q;  2EYO A;  4CJ2 C;  3W5O A;  5ELB A;  2ZJQ A;  2K5W A;  3H3V H;  5IOD A;  1QOH A;  1JJG A;  4B9X A;  2VUM H;  1FNW A;  2DNC A;  3FPU B;  3MAQ A;  2NVT B;  4FF1 A;  4A3K B;  4FYD A;  3GTM H;  3S24 A;  2F0K A;  3R93 A;  1FVI A;  3OIP A;  3QIA A;  1JJC B;  2F0P A;  4RHS A;  2BDO A;  4A3L H;  2RVL A;  4HAE A;  1OXX K;  4JOI A;  4C2M B;  4JI4 Q;  2ZJP A;  4RGN A;  2K1B A;  2A19 A;  4PQX A;  1I4R A;  2LXK A;  2CVR A;  3J7A V;  2WAC A;  1NE3 A;  3GTL B;  4LFB Q;  3KBX A;  1JOK A;  4IJL A;  1PRT B;  4DNT B;  5IOC A;  3RZD B;  2PO4 A;  4A3D G;  2RDH A;  5FJ8 G;  5M5X B;  2UUA Q;  1KIX A;  1IKM A;  4HMJ A;  2L12 A;  5CGK A;  3T1Y L;  2F0M A;  2YU9 B;  4YCV A;  1VQ9 A;  2VQF Q;  4HED A;  4JV5 Q;  4RH6 A;  4YCU A;  2XTI A;  3KJO A;  3VR5 A;  1TWC B;  4DV4 L;  1YHQ A;  1EY4 A;  1C9O A;  1YBY A;  3ND8 A;  5C3E G;  4RGT A;  3M9B A;  1D6E C;  2F4I A;  5KYI A;  4WJW A;  5JOB A;  2ALY B;  3S16 H;  2EJF C;  1XXG A;  1RIP A;  2D0P A;  4XTC S;  2F0E A;  4DU9 A;  2JA7 H;  3HOX H;  2L1B A;  2QEX A;  4DK1 A;  4YHH Q;  1SJH D;  3HOW G;  1SJE D;  3OYY A;  4LK1 C;  1QUQ A;  3CCE A;  3MXN A;  1XNR L;  3CME A;  1CZW A;  2EYM A;  2K32 A;  3DEP A;  4DR2 L;  5DEH A;  3K58 A;  4JYA Q;  2A68 D;  1AP0 A;  1SSO A;  2UUB L;  3E0J A;  2B2Y A;  1GHK A;  2BE5 C;  1QB5 D;  3H0G H;  1VQ8 A;  3EA6 A;  4H7B A;  4R9W A;  5IGF A;  5JJK A;  1I3Q H;  3EQL C;  2KHJ A;  3K81 C;  4G57 A;  3K5L A;  4DV5 Q;  1L0Y B;  1GUT A;  3S1R B;  1TR5 A;  2KCN A;  3SVM A;  3BZC A;  2E75 C;  2F0N A;  1PYS B;  3VDY A;  5JEA J;  4GKK Q;  2DGY A;  3F2D A;  3IKJ A;  3D4W A;  1SE4 A;  1SYE A;  1VMP A;  3CMA A;  1TVX A;  5C0X H;  2YYZ A;  3X3M A;  4JI1 Q;  2DUD A;  2N88 A;  3JAM i;  4A93 H;  1BBU A;  3AEV A;  1X54 A;  1E1T A;  1JQY D;  1RCV D;  2EY2 A;  2IJ0 A;  2A6E D;  4MHE A;  3PO3 G;  1DCZ A;  4A4I A;  1G51 A;  2JA5 G;  2A8V A;  1EEI D;  1KNE A;  2OTL A;  1FJG L;  3EIV A;  2VXW A;  1LTS D;  3IAY A;  5FO8 B;  1IBK Q;  5DAU A;  1EYG A;  3GTO H;  3HKS A;  1TQO A;  1UEA B;  2KCC A;  3FPP A;  1G6P A;  4BS9 A;  1TWG B;  2QDB A;  2HQL A;  5I2X A;  4A3J H;  2K04 A;  4UY8 C;  4N9T A;  3D4R A;  1STH A;  1Y1W B;  2NVQ B;  3G7L A;  3M4P A;  3GTJ B;  2L11 A;  2F0O A;  1HQM C;  1WOC A;  4AQY Q;  1AN8 A;  1WCM H;  2ZXR A;  2EYJ A;  1CUK A;  3QWN A;  4L8J A;  3UDF A;  4EQP A;  4HIK A;  3S1Q B;  1K9M C;  2XNA C;  2BA1 A;  4IUN A;  3KF8 B;  2BH8 A;  2Z6B A;  3E6Z X;  3ND9 A;  4A3F B;  4IPG A;  4BXX G;  5C4Z A;  5HGQ A;  4LF6 L;  1PRT F;  1ZYR D;  1B1Z A;  4A3G G;  1D5M C;  1PZJ D;  1V1P B;  1CKO A;  1JOQ A;  4FO2 A;  1PZI D;  1Z7T A;  1ESF A;  1BBX C;  4CJ1 B;  2PI2 A;  2A68 C;  4FXD A;  4ME3 A;  2F1M A;  1HRJ A;  4LUV A;  4LFA Q;  5KNC A;  5GQO A;  1VQP A;  4KKS A;  1PYB A;  5IP7 G;  1G29 1;  3TRE A;  1EQQ A;  1Y1V B;  4OX9 Q;  1FNU A;  4C3I H;  4NMZ A;  2P5Z X;  2FFK B;  2ZXO A;  1O78 A;  1U4P A;  4LF9 L;  3J81 j;  2D0O A;  3S2D B;  3R8B A;  2E5L L;  3D0F A;  1B9N A;  3KFU A;  4E6I A;  2I5H A;  2NVT H;  4O0A A;  4I65 A;  4A3K H;  1EU4 A;  4POF A;  2LSS A;  4S3S A;  1PTO B;  2VQE Q;  4RCO A;  1GM5 A;  3MEH A;  3UDI A;  1Q8K A;  4XDX A;  1DOM A;  4K14 A;  2ZXP A;  2HQE A;  4G7Z C;  1PMR A;  3KJP A;  4DR7 Q;  4QJF A;  4C2M H;  1N9W A;  4IFD H;  1GUN A;  2LFN A;  3AQQ A;  3I70 A;  3J7Y W;  3OTO Q;  3M7G A;  5CV4 A;  1PTO C;  4LF5 L;  3CCR A;  4POG A;  1LO5 D;  1STN A;  4JVZ A;  3VYS A;  3GTL H;  1KC8 C;  2CWP A;  3A8J E;  1EIH A;  4G4K A;  5CMD A;  1Y14 B;  4MIU A;  5FLM G;  2IX1 A;  1KLU D;  3RZD H;  4DR3 Q;  4XQJ A;  4A3C G;  5M5X H;  3IFT A;  3E9H A;  1VQG A;  5IWA Q;  2R92 B;  3UI2 A;  4DV1 L;  1PH3 A;  3KYH C;  1SE8 A;  1M1K C;  2YU9 H;  2YTY A;  1GXD C;  1TWA B;  3GV3 A;  2ZJR A;  1H9M A;  4BY1 G;  3DMU A;  1HFG A;  4CDE C;  3CC2 A;  1IZ6 A;  4BBS B;  3I2Z A;  1PLF A;  4OEM B;  4R4O A;  1ENC A;  1Q46 A;  2EYF A;  1PFM A;  4QF4 A;  4DV7 L;  1SLJ A;  3OWF A;  1IYJ B;  2VZA A;  1GUW A;  4RHR A;  4JI3 L;  3G6J B;  3E5S A;  3HKZ B;  1E3P A;  2QCP X;  2WKC A;  5I2Y A;  1ASY A;  4JI7 L;  3PIO 3;  3CW2 C;  3CRK C;  1ZYR C;  4YY3 L;  2WFW A;  4A3M B;  5EPK A;  3BZK A;  1O7I A;  1ET6 A;  1CTM A;  4DA2 A;  3NK9 A;  1QVG A;  4NP5 A;  5FLX L;  2O5I C;  1PH9 A;  5C4X G;  2Z1C A;  1L0X B;  2AWO A;  1LUZ A;  3S1R H;  2R7Z H;  1EUJ A;  1DD2 A;  1PV4 A;  1VMC A;  1LAB A;  1M4V A;  3GQB A;  4JPB W;  2PQE A;  3EVQ A;  1EYA A;  1HZC A;  2M00 A;  3S1M B;  1JE4 A;  4WJ3 M;  2H4O A;  3SE0 A;  1VQE A;  2WB1 B;  5IT9 E;  2E2D C;  1YIT A;  3OHX C;  1XPO A;  4DNR B;  1SFO B;  1F9Q A;  4NB3 A;  3SGI A;  1BKB A;  4DK6 C;  1ASZ A;  1U4L A;  4JC0 A;  1FGB D;  3VR6 A;  1SE2 A;  3J7Z C;  2GN5 A;  3T1Y Q;  4DNI A;  1KQS A;  4HMI A;  1EIG A;  4C3H G;  1ENA A;  4DV4 Q;  4DV3 L;  5LMN W;  1W6K A;  1K3B C;  4NXM Q;  1PA6 A;  4IZ8 A;  3WOE A;  4RKB A;  2E2H B;  4GN5 A;  1QVC A;  4K2K A;  5HGT A;  2WV6 D;  3ULJ A;  3WWV A;  4L63 B;  1D2B A;  4IFD I;  4X3K A;  1EYD A;  4M1U B;  1HQR D;  2EVB A;  1XNR Q;  3CC4 A;  1Y1W H;  2NVQ H;  2L0C A;  4DR2 Q;  4KY5 A;  3DM3 A;  2HCC A;  4A3D B;  2UUB Q;  5EPL A;  1F2L A;  1QNK A;  1K8A C;  1VQK A;  4IQZ A;  1BNZ A;  1SYC A;  1IXR A;  5C44 G;  3S1Q H;  1H9R A;  4CKE A;  2EYL A;  4L5S A;  2UXB L;  1KDA A;  5IYB H;  5IYD H;  3FEW X;  5BR8 L;  5C3E B;  3KF6 A;  2NUC A;  4DK3 C;  4IOA A;  4HJ9 A;  3CCL A;  3U9S A;  4KD3 A;  5C3X A;  1K8G A;  3HOW B;  3J81 c;  1CKM A;  1R4Q B;  1JB3 A;  1F9S A;  1AZP A;  2AQ3 B;  3PUY A;  3NXW A;  1A2U A;  2X6G A;  3TRZ A;  1IHZ A;  2NN6 H;  1IW7 C;  4TSS A;  4A3I G;  3T1H L;  1UE7 A;  5KRU A;  3DUZ A;  2FMC A;  1QIL A;  1JOR A;  4OWW B;  1PH2 A;  3RN5 A;  3OIQ A;  1Y1V H;  2NWG A;  1CSQ A;  4EQO A;  4O42 A;  2F4V L;  1JC7 A;  1FNV A;  4OHJ A;  1TWF B;  1FJG Q;  1ZEQ X;  5KNB A;  4LF7 L;  1VCI A;  1Z47 A;  1JIC A;  1W3S A;  2WAQ G;  3MA2 B;  1EY8 A;  4I7Z C;  5EBC A;  3CC7 A;  4UP7 A;  1EIF A;  3BVG A;  4C1N I;  3GTK B;  1CKN B;  2F3V A;  4PMC A;  3MXP A;  5JAV A;  1N32 L;  3HOV G;  5KIX A;  2ZM6 L;  2F0U A;  1TII D;  2UUC L;  4GKJ L;  1I6H B;  4OON A;  1AZQ A;  1PH4 A;  4YWM A;  1CM9 A;  3ICE A;  3PO3 B;  2ZT9 C;  1HNW L;  3CCJ A;  2EQS A;  2NVY B;  1DON A;  1QCB D;  1VQO A;  4LF6 Q;  2R92 H;  3NHH A;  2NBF A;  3GO5 A;  5J39 A;  5D3I B;  4N8F A;  1EOT A;  3BS1 A;  1TWA H;  5M3F B;  5FOB B;  2DN8 A;  5EGT A;  4BBS H;  3J80 E;  1WTW A;  4JOI C;  2Q2H A;  2UUC Q;  5IGB A;  4H13 C;  2JA6 H;  3I4L A;  1STE A;  4R1J A;  4DAP A;  5KYL A;  3HOZ H;  1CSP A;  1QZG A;  2KCT A; 
#chains in the Genus database with same CATH homology
 4YCU A;  4DR5 L;  1DGS A;  2XTI A;  3OW2 A;  3KJO A;  2E8G A;  1VQM A;  4DV4 L;  1YHQ A;  1TWG H;  1C9O A;  1YBY A;  5C3E G;  3W1G A;  3M9B A;  3RN2 A;  5LMN L;  4LF9 Q;  2R6G A;  3CCM A;  2ALY B;  1OTC A;  3S16 H;  3ER0 A;  4A3M H;  1EFW A;  1WCM G;  1RIP A;  3GTJ H;  2E5L Q;  2D0P A;  2HIX A;  4XTC S;  1J5E Q;  2JA7 H;  4B3R Q;  1B70 B;  1I50 H;  3F8T A;  2R93 H;  1VQ4 A;  3HOX H;  3K7A H;  4DUZ Q;  2R7Z G;  3B6Y A;  2QEX A;  2KHI A;  4YHH Q;  2JA8 G;  1YIJ A;  3HOW G;  2WP8 J;  3OYY A;  2H5X A;  1QUQ A;  3CCE A;  1XMO Q;  1XNR L;  1QZH A;  1EIY B;  4ALP A;  3CME A;  4JI8 L;  1XJV A;  4DR2 L;  1XNQ L;  1QUQ B;  2ES2 A;  3MXN B;  4JYA Q;  3GD7 A;  4IPD A;  4X66 L;  2UU9 L;  1V1Q A;  4A3F H;  2UUB L;  3NEN A;  4GLX A;  1VQA A;  1Q82 C;  3H0G H;  4LF5 Q;  1VQ8 A;  3HFZ B;  5JJK A;  1I3Q H;  5IP9 H;  1NJI C;  1GD7 A;  2NN6 I;  2KHJ A;  3K81 C;  4P72 A;  4RG1 A;  1SFO H;  1GVP A;  4X64 Q;  4L5R C;  2F3I A;  3CAM A;  4DV5 Q;  2E2I H;  2ID0 A;  1YZ6 A;  3A5U A;  5M5Y H;  1KL9 A;  5C0X I;  3BZC A;  2JJQ A;  2FXQ A;  2MO1 A;  1EOV A;  4QGU A;  2QGQ A;  1PYS B;  4DV1 Q;  3VDY A;  1N36 Q;  4AYB G;  3PSI A;  2CFM A;  5JEA J;  1UE1 A;  4X62 L;  1KAW A;  1IBM L;  4GKK Q;  2RF4 A;  4O2D A;  1EWI A;  2DGY A;  1KD1 C;  3HOV H;  3F2D A;  3PGZ A;  4JCV E;  4B3M L;  2K5N A;  2F52 A;  3AFP A;  3AYH B;  1YEZ A;  2K5H A;  3CMA A;  1GO3 E;  3STB D;  1A8V A;  2IY5 B;  2UXD L;  4DV0 L;  2YYZ A;  4P75 A;  1OXS C;  1X3G A;  4JI1 Q;  2DUD A;  4PMW A;  4PZ7 A;  3JAM i;  4AH6 A;  4DV7 Q;  4A93 H;  1BBU A;  4JI6 Q;  3LGJ A;  3AEV A;  1X54 A;  2IHF A;  3S2D H;  1E1T A;  3TQY A;  2RHS B;  4A3K G;  1N33 L;  1HZB A;  4JI5 Q;  1PH6 A;  4HJ8 A;  4JI3 Q;  1N34 L;  4H02 A;  5J3B A;  3PO3 G;  3M7N A;  4TQU S;  4A4I A;  3U4V A;  1VQB A;  4DR6 Q;  1SRU A;  1G51 A;  2JA5 G;  2A8V A;  3M3Y H;  4JI7 Q;  2OTL A;  2EIF A;  3BJU A;  1FJG L;  3EIV A;  4YY3 Q;  4IFD G;  4A3D H;  1L1O A;  5FJ8 H;  1IBK Q;  4YCW A;  2A1A A;  3FKI H;  3HKS A;  5HY6 A;  4DV2 L;  1JB7 A;  1EYG A;  1VQ5 A;  2ZTC A;  4DUY L;  4HIM A;  3ULP A;  3GTP H;  3HOY G;  2UXC L;  5IYB G;  3S14 H;  1L1O B;  4P73 A;  1G6P A;  2JEA I;  1A62 A;  2HQL A;  4UP9 A;  2EXD A;  4LF8 L;  4A3J H;  1XPU A;  1T9H A;  2IX0 A;  5JEA G;  5IYC H;  2JQO A;  4UY8 C;  1E7Z A;  4JI2 Q;  1VQ7 A;  4IO9 A;  2AMC B;  3KDF A;  4NXN Q;  2PQA A;  4JI0 L;  3GTQ H;  3M4P A;  5C3E H;  2C35 B;  3M85 A;  1L1O C;  1UE6 A;  2K50 A;  3KDF B;  2PQA B;  1WOC A;  4AQY Q;  4KHP L;  3GTO H;  4GLV B;  1WCM H;  3NEL A;  1CUK A;  3UDF A;  1IL2 A;  4HIK A;  2I0Q A;  4MTN A;  1K9M C;  4JI2 L;  4L5Q A;  4R4Q A;  5GAG C;  1XMQ Q;  2BA1 A;  2JA8 H;  3KF8 B;  3HOW H;  2BH8 A;  5M5W H;  3E9I A;  4TVA B;  4A76 A;  1YHB A;  2VL6 A;  5C44 H;  1HNZ L;  1BVS A;  4IPG A;  4X65 Q;  4BXX G;  5IE8 A;  2KEN A;  5HGQ A;  5C4J H;  4JI4 L;  4LF6 L;  3PIO A;  1VQD A;  1YVC A;  3W1B A;  4HJ5 A;  5K36 G;  3PUX A;  1NY4 A;  1YNX A;  2Q2I A;  2R7F A;  5FLX c;  2HT1 A;  4A3G G;  4K0K L;  1CKO A;  3A0J A;  5GRO A;  2IHE A;  2L15 A;  2HHH Q;  4LFB L;  2K52 A;  1Q1B A;  2K5V A;  3J80 c;  3F2B A;  2PI2 A;  4OWX B;  1TWF H;  3A5Z B;  4LUZ A;  4ME3 A;  2K4K A;  2UUA L;  1PVO A;  1BBW A;  2R7D A;  1IBL L;  4LF4 Q;  3K0X A;  3JC6 6;  4LUV A;  4LFA Q;  4DR1 L;  1AE3 A;  1I94 L;  5GQO A;  1VQP A;  3M4Q A;  1PYB A;  4GNX A;  5IP7 G;  4LFC Q;  4XIG S;  3J80 i;  4DKA C;  2VQF L;  2Y0S G;  4JV5 L;  1AE2 A;  4GNX B;  1L2F A;  1G29 1;  3TS0 A;  3TRE A;  1EQQ A;  2MFI A;  3FP9 A;  3CD6 A;  4OX9 Q;  2K14 A;  5M3M G;  4C3I H;  4IPC A;  4A3I H;  4MZ9 A;  3GTK H;  1MKH A;  4OO1 I;  4QIW E;  4LF9 L;  3J81 j;  4WJ4 A;  2D0O A;  1X9N A;  4GNX C;  5EAY A;  1Q7Y C;  1SRO A;  3D0F A;  2VW9 A;  1J5E L;  3KOJ A;  2E5L L;  4B3R L;  3KFU A;  1YI2 A;  3AFQ A;  4DUZ L;  5ELN A;  2I5H A;  2NVT H;  4O0A A;  1VQ6 A;  4APV A;  4EQ5 A;  4B3T Q;  4YHH L;  4A3K H;  3S1M H;  3STB C;  4POF A;  2LSS A;  4IOC A;  1XMO L;  2UXB Q;  4BA2 I;  3U50 C;  2VQE Q;  2YTV A;  3U4Z A;  1GM5 A;  3CP0 A;  5BR8 Q;  3UDI A;  1Q8K A;  4IFD J;  2JA5 H;  1X6O A;  3KJP A;  1VS0 A;  2GVB A;  4KHZ A;  4QJF A;  4C2M H;  4DR7 Q;  1N9W A;  3KLW A;  4JYA L;  3J7A 5;  1FL0 A;  3AQQ A;  2B63 H;  3OTO Q;  2AKW B;  1B7Y B;  4LF5 L;  3CCR A;  4POG A;  2AWN A;  2NZO A;  1XPR A;  3PIP A;  1N8R C;  1OXV A;  1M90 C;  1E24 A;  3GTL H;  3BU2 A;  1KC8 C;  3CXC A;  1HNX L;  2CWP A;  1TWH H;  2JA6 G;  4YWL A;  4X64 L;  1FGU A;  1KHI A;  1S40 A;  4DV5 L;  2BA0 A;  1Y14 B;  3JAM c;  2I5M X;  5FLM G;  3RNU A;  3PO2 G;  2IX1 A;  4GLA C;  3CCQ A;  3RZD H;  1JT8 A;  1JJ2 A;  4DR3 Q;  4R4I A;  2Y0S E;  5M5X H;  4A3C G;  1S3O A;  3E9H A;  1VQG A;  4EX5 A;  5IWA Q;  4DV1 L;  3CCV A;  1N36 L;  4BA1 I;  1PH3 A;  3KYH C;  5JJL A;  2JE6 I;  1SE8 A;  4X6A H;  1M1K C;  2YU9 H;  5DLQ E;  2YTY A;  1YJW A;  3T1H Q;  1C7Y A;  2E2H H;  1U0L A;  4GKK L;  2N78 A;  4B3S Q;  1YHA A;  1PH1 A;  3K8A A;  1EQR A;  2ZJR A;  4BY1 G;  3S17 H;  3G48 A;  1Y1W G;  2N49 A;  1HZ9 A;  1VQL A;  3CC2 A;  2F4V Q;  1IZ6 A;  3I4N G;  3I2Z A;  4Y52 H;  4J15 A;  4IPH A;  3HOX G;  4R4O A;  1X56 A;  4JI1 L;  2NVX H;  1Q46 A;  2MNA A;  4BXX H;  4LF7 Q;  4KLK A;  4YWK A;  4DV7 L;  1SLJ A;  3PF4 A;  1JE5 A;  4GS3 A;  4JI6 L;  1S72 A;  1UE5 A;  1IYJ B;  2VZA A;  4A3G H;  1Z9F A;  5JJI A;  2NZH A;  4JI5 L;  1MIU A;  4JI3 L;  5M3F G;  4DR4 Q;  3ERS X;  4A3E G;  5IYD G;  1HZA A;  1E3P A;  4A3F G;  2Z6K C;  4DR6 L;  5LMU Q;  4BBR G;  1ASY A;  4JI7 L;  1RL2 A;  3CW2 C;  2Q2T A;  2OQK A;  4AYB E;  4YY3 L;  2WFW A;  1UEB A;  1IBK L;  1N32 Q;  2IT1 A;  3BZK A;  2B29 A;  1O7I A;  1VQC A;  2ZM6 Q;  1KRT A;  4A75 A;  1WYD A;  1HR0 W;  5IP7 H;  5AJ3 Q;  2UUC Q;  4FDB A;  1QVG A;  4GKJ Q;  3F1Z A;  2OCE A;  3CCU A;  3I4O A;  1K73 C;  4LWC A;  1HR0 Q;  1Q1E A;  2I5L X;  3PV0 A;  1PH9 A;  3S1N H;  2OTJ A;  5C4X G;  2AWO A;  1HNW Q;  1LUZ A;  4NXN L;  3S1R H;  1EUJ A;  2R7Z H;  4LUO A;  1PV4 A;  5M3M H;  4HJA A;  3A74 A;  4JBW A;  3ZJY C;  2JK8 A;  4JG2 A;  2NN6 G;  1V43 A;  4AQY L;  3RLN A;  2PNH A;  1HZC A;  1P8L A;  1K3R A;  2LXJ A;  4WJ3 M;  4P71 A;  4A3B G;  1XPO A;  1VQE A;  1YIT A;  1H95 A;  1Y1V G;  4DV6 Q;  3TEH B;  1XMQ L;  2VS1 A;  4NB3 A;  4IJH A;  1BKB A;  4GN4 B;  1J6Q A;  4JBJ A;  5ELO A;  3SGI A;  1D8L A;  2B3G A;  1NBW A;  1V9P A;  3I56 A;  2CWA A;  3E0E A;  4DK6 C;  4DV3 Q;  1ASZ A;  3H15 A;  3G4S A;  4DPG A;  4JC0 A;  4X65 L;  1MJE A;  4JBK A;  4HIO A;  3J7Z C;  2GN5 A;  3T1Y Q;  3CPF A;  3I7F A;  4DNI A;  1KQS A;  4Y7N H;  1PH5 A;  2VNU D;  2JEB I;  4DR5 Q;  2D62 A;  3K80 C;  3L7Z C;  2HHH L;  4BY7 G;  4DV4 Q;  1XTD A;  3PUV A;  4DV3 L;  5LMN W;  3FKI G;  1NMG A;  5LMN Q;  1LM0 A;  4NXM Q;  3PO2 H;  1PA6 A;  2YTX A;  2Z0S A;  4A3J G;  4NPS A;  3DLL A;  5E7N A;  4A3C H;  4LF4 L;  1QVF A;  2VUM G;  4GN5 A;  4LFA L;  4GOP C;  5IYC G;  2V1C C;  3NBH B;  1QVC A;  1SN8 A;  3IRB A;  3S15 H;  3GDE A;  4R4C A;  3RR5 A;  3ULJ A;  4LFC L;  3WWV A;  1TXY A;  2CQO A;  4IFD I;  2KCM A;  2PI2 E;  3UDX A;  2GVA A;  3RLO A;  4A3L G;  4NXM L;  4OX9 L;  1XNR Q;  3PCO B;  1A63 A;  3CC4 A;  4BY1 H;  1YJ9 A;  1Y1W H;  2NVQ H;  1I6H H;  4JI8 Q;  4DR2 Q;  1XNQ Q;  2RHQ B;  2BH2 A;  4DAY B;  3I4N H;  2R92 G;  3PO3 H;  3DM3 A;  2CKZ B;  3MEF A;  4RMF A;  4X66 Q;  2UU9 Q;  4QL5 A;  2ATW A;  2UUB Q;  4C3J H;  1VQK A;  1K8A C;  3PUW A;  2NVY H;  2RCN A;  4P74 A;  3I4M G;  2N8N A;  1IXR A;  4UPA A;  5C44 G;  3L2P A;  3S1Q H;  3D31 A;  3K7U C;  4B3T L;  1HNX Q;  1X65 A;  1VQN A;  1PH8 A;  3HOY H;  4BBS G;  3UE0 A;  1B8A A;  3CQZ H;  4L5S A;  2UXB L;  1U5K A;  5M3F H;  1Q12 A;  4GN3 B;  5IYB H;  4A3E H;  2VQE L;  2Q2U A;  3M4O H;  5IYD H;  5GAE C;  1HH2 P;  5BR8 L;  2OQ0 A;  1PH7 A;  3KF6 A;  4BBR H;  1NMF A;  1AH9 A;  1VQF A;  2PMZ E;  1UWV A;  4MNO A;  4DAM A;  1JMC A;  3HOU G;  4DR7 L;  3RLF A;  3I55 A;  1VQI A;  4OWT B;  5GAH C;  3HOZ G;  1K83 H;  3KF6 B;  4X62 Q;  2HIV A;  1IBM Q;  3EBE A;  3OTO L;  1MJC A;  1PFS A;  4L5T A;  4DK3 C;  1OXT A;  4IOA A;  2YV5 A;  4B3M Q;  4HJ9 A;  3UDG A;  3CCL A;  3S2H H;  3HKZ G;  3ULL A;  4HID A;  1K8G A;  3J81 c;  3G71 A;  1CKM A;  1Q81 C;  2UXD Q;  4DV0 Q;  5C4X H;  2K75 A;  4A3M G;  1E1O A;  1TWC H;  3NEM A;  3PUZ A;  1X3F A;  4DR3 L;  2JA7 G;  2QA4 A;  3PUY A;  5IWA L;  2E2J H;  2Z6K A;  2R93 G;  1HJP A;  3TRZ A;  1D7Q A;  4LW1 A;  2ZTE A;  1SR3 A;  3FHW A;  3J81 i;  1WJJ A;  2AHO B;  5C0X J;  4A3I G;  1W2B A;  3T1H L;  1UE7 A;  1N33 Q;  4QQB X;  1A0I A;  1N34 Q;  4B3S L;  4A3B H;  4OWW B;  1PH2 A;  3RN5 A;  1Y1V H;  1CSQ A;  2F4V L;  3CPW A;  2ASB A;  1KXL A;  1WFQ A;  2OWO A;  2KBN A;  1P16 A;  1SMX A;  1FJG Q;  1X55 A;  3PF5 A;  3H3V I;  1K0R A;  4DV2 Q;  2VY3 A;  4LF7 L;  3H0G G;  4DUY Q;  2UXC Q;  2WB1 G;  1LTL A;  1VCI A;  4PG3 A;  1Z47 A;  4OO1 G;  5IP9 G;  1W3S A;  2WAQ G;  3CCS A;  4LF8 Q;  4KI0 A;  2JA9 A;  4PZ8 A;  4QY7 A;  3CC7 A;  1CKN A;  4LNQ A;  4DR4 L;  4JBM A;  4UP7 A;  4AIM A;  4C3H H;  1EIF A;  4BY7 H;  1Q86 C;  2ZTD A;  2MQH A;  1I5F A;  2XGT A;  4JI0 Q;  5LMU L;  2B63 G;  1CKN B;  3W5O A;  1GKH A;  2ZJQ A;  3H3V H;  3HKZ E;  1KRS A;  1LYL A;  3L0O A;  4KHP Q;  1JJG A;  1N32 L;  3HOV G;  2VUM H;  2ZM6 L;  3G6E A;  2UUC L;  5AJ3 L;  4GKJ L;  3U58 A;  4OON A;  3GTM H;  3S24 A;  1PH4 A;  1OXU A;  1FVI A;  4YWM A;  1YJN A;  1HR0 L;  3F2C A;  1JJC B;  5C0X G;  3ICE A;  1HNW L;  2CCZ A;  4A3L H;  1HNZ Q;  1OXX K;  4JOI A;  3CCJ A;  2EQS A;  3EN2 A;  5IY0 A;  1VQJ A;  4A93 G;  5H1S E;  1VQO A;  4JI4 Q;  4LF6 Q;  2ZJP A;  2R92 H;  4OXP A;  2N3S A;  2A19 A;  3GO5 A;  4UP8 A;  4K0K Q;  4HJ7 A;  2LXK A;  1TWA H;  1VQH A;  5IT9 c;  3I4M H;  1NE3 A;  4DV6 L;  4LFB Q;  4GOP A;  1X3E A;  3UE1 A;  4IJL A;  3GTG H;  5GAD C;  1WI5 A;  4BBS H;  4JOI C;  2Q2H A;  2WB1 E;  3CF5 A;  4GOP B;  1L0W A;  3TS2 A;  4A3D G;  5FJ8 G;  4R4T A;  2UUA Q;  3Q8D A;  1PHJ A;  3RZO H;  1NTG A;  1C0A A;  2WAQ E;  1R9T H;  1KIX A;  1IBL Q;  1E22 A;  2JA6 H;  1I94 Q;  4DR1 Q;  3T1Y L;  4PZ6 A;  1QZG A;  5FLM H;  3HOU H;  4R1J A;  2MO0 A;  3HOZ H;  4YCV A;  1CSP A;  1VQ9 A;  2VQF Q;  2KCT A;  4JV5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...