1EEID

Cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHOLERA TOXIN B)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eeiD00
1ET9A 5D3DA 1HA5A 1LTID 4DXFA 1KLGD 1I4RA 1S5CD 2XN9C 2J4XA 1JCKB 1FGBD 1B1ZA 1D5MC 2AQ1B 4Z9CB 1B44D 1PZKD 1KLUD 1S5FD 1DYQA 1V1OA 1LTAD 1CHQD 1LT4D 1TS3A 1FNVA 1SXTA 1EWCA 1SJHD 3O13A 1QILA 1D6EC 5ELCA 1BCPF 2CHBD 4RH6A 3MFGA 4K6LA 4RGNA 1V1PB 1HTLD 1FD7D 1SBBB 1L0XB 5ELBA 4RCOA 1JWMD 1LTGD 1S5ED 1SE2A 4RGOS 4ZYSA 1JWUD 5ELFA 4BWGB 1DJRD 3BVZA 1S5DD 1PTOF 3V05A 1PZJD 5ELEA 1ESFA 1F77A 1TS4A 3KLSX 4RGMA 1HXYD 3EFXD 1PTOD 2QEJC 3MC0B 1CK1A 1SEBD 2TSSA 1KTKA 5TSSA 2Z8LA 1LTSD 1GOZA 3BZDB 1EEFD 2R61A 1FNUA 4L6TB 1L0YB 3R8BA 1EU3A 2XRQD 1SE3A 1LLRD 2O2LD 1G8ZD 1STEA 3BYYB 1RDPD 1BCPD 2NTSA 3EA6A 1BCPC 1TS2A 1D5XC 4RFBA 4RHSA 1LTTD 1M4VA 3R2TA 1MD2D 1LT6D 5FKAC 1PRTF 3BVMA 1LTBD 2RDGA 1I4HA 4OHJA 1LT5D 1LO5D 1PRTD 1XXGA 1ENFA 1PRTC 1CQVA 1TY0A 1TS5A 5I4DA 4RHRA 1PTOC 4RGTA 2AQ2B 5FK9C 2QILA 1BXTA 4TSSA 1JQYD 3DWAA 1AW7A 1LTRD 3URYA 1SJED 1CHPD 1RD9D 1TY2A 2XNAC 1UUPA 3DWPA 1AN8A 1I4PA 1BCPB 1PZID 1PTOH 3BVGA 2ICIA 4DXGA 1EEID 2SEBD 4C56C 1JR0D 1D5ZC 1PYWD 2AQ3B 3R2IA 2NTTA 1FNWA 4L63B 1SE4A 2IJ0A 2IPKD 1XTCD 2WV6D 1PRTB 2G9HD 1HQRD 1RCVD 5ELDA 1PTOB 1LT3D 3SEBA 4UDUC 2RDHA 3TSSA 1CT1D 3BYTB 1ET6A 1RF2D 1T5XD 3GP7A 4O1NA 2XRSD 3DWQA 3W2DA 1I4GA 3OWEB 1I4XA 1I4QA 5D3IB 1UNSA 1EFID 1JWSD 1EU4A 3CHBD 1S5BD 1V1PA
chains in the Genus database with same CATH superfamily
4I65A 1O7YA 1ET9A 3A7LA 1HA5A 1CUKA 3PF5A 4HJ9A 1I6HH 5E7NA 2ZM6Q 1TWAB 3R93A 4LFBL 2JXMB 1B1ZA 3FKIB 4IPHA 4IJLA 1B44D 1KLUD 1S5FD 2ZTCA 3I91A 4DR3Q 3NTIA 4A3DH 4LF6L 1JE4A 3KK7A 3J7AF 3CAMA 4ZCKA 1E3PA 1RTOA 4DV3Q 3AFPA 3CMEA 3VR2A 2ZXPA 3MFGA 4ZK9B 1V1PB 2VUMG 3S1MB 3A8KE 3W1GA 4PMWA 1S5ED 1SE2A 2WB1B 4A76A 4HAEA 2JA6G 1GUSA 2OQKA 1I3QH 1EYAA 2A6ED 3OWFA 3RR5A 5HGTA 2L12A 3T1HL 3NELA 4LF5Q 3OMGA 2F0UA 4LF9L 3A56A 4KHVA 1TWHH 4IUPA 3VDYA 1DOKA 3A7AB 1OTCA 1UE7A 2UU9Q 4A3JB 3ITPA 4HR7B 4QUFA 3I3CA 5C4XH 4JPBW 2EYFA 3WOFA 1LLRD 1VQHA 2VQEQ 3PQIA 2N49A 3TS2A 1NMGA 1IBLQ 3D8GA 2ENBA 5LL6S 2KHJA 4OO1G 3RZDB 3KUPA 4C2MH 3PIOA 1D8LA 4ABNA 2I5HA 1HPCA 1VQ5A 1JOQA 4QMGA 4OHJA 1LT5D 2O5JC 2L55A 3HZXA 3MHBA 2F0OA 1C4QA 4IFDJ 4DR7L 4EQ5A 3AYHB 3LWUA 4A93H 3TZUA 3CQZB 2F0JA 5IYBG 3I70A 4O2DA 4C56C 3ERSX 1D5ZC 1E1TA 1PYWD 2OF1A 1BOSA 1GXDC 4A3BB 2EYLA 4LFAL 1EQQA 4OWXB 3TSSA 1LTLA 1SNQA 1VQDA 4QJFA 1X6OA 2F0FA 4LFCQ 4BXXH 3RZOB 1E2WA 4DR6L 5D3IB 3TP6A 5C44G 3ND9A 5IY0A 4DU9A 3IKJA 1VMCA 5BR8L 1MJCA 2Q2UA 2R3ZA 5CMDA 4M8AA 1JORA 1S40A 3E0JA 2RHQB 1CZGA 1BKBA 1VQ8A 1PVOA 2KCMA 1D7QA 1IYJB 2VL6A 2A19A 1U4RA 2NVQH 3I72A 4FXKC 1EOVA 2PMZB 3HOYB 2CQOA 4IALA 2Z0SA 2DJFC 2KEDA 3AB9A 1PH4A 2KA7A 3GV6A 4EQNA 1QG7A 1SMXA 5ELBA 1XPRA 2Q2HA 3NWTA 4NXNQ 1NE3A 3TZDA 3V05A 2NYZD 3S1NH 2B2VC 5FJ8H 5KNDA 1H9MA 1XPUA 4C3JG 4IFDH 2R61A 2KUMA 2NN6G 1FNUA 1BUVT 4G7ZC 1PA6A 2ASBA 4RG1A 2PO4A 4P73A 3EIVA 2K5DA 3J7AV 5JJIA 1D1KA 3F2BA 4WJ4A 1BCPD 4H0LC 5JOBA 1NNXA 3HOUB 3CW2C 3CCEA 4OONA 4DR5L 4ZUIA 4NMZA 3B6YA 3CCMA 4R4OA 3KLWA 1XXGA 1TY0A 5C3EB 1EQRA 2IX1A 5IE8A 4S3SA 3G4SA 1I50B 1AW7A 1TWFH 5K36G 1Z6HA 1I4PA 1BO0A 4DV7L 5IODA 4LNQA 2Q8TA 4FXDA 5JJZA 5J22A 4NXML 1SNMA 5EJWA 1R9TB 4B3RQ 4OX9Q 1HFNA 4IOAA 4IUTA 3VR3A 5G3LF 1A6XA 2NVYB 4BS9A 1WVLA 3HOVG 5M3MG 1CT1D 1F2MA 1RF2D 1DOLA 4O1NA 2BA1A 4DAMA 1XWEA 1ASZA 1IZ6A 2R92B 1YZ6A 2DY7A 1Q1BA 4XYQA 5K5PA 1HFGA 2NZHA 4K2LA 2QCPX 4J8QA 4A3MB 3QG1A 5FLXE 1HNXL 4FNFA 1L0WA 2E2HB 1E7ZA 1JCKB 4JYAL 4DUZL 1F2ZA 5CV6A 5BN5A 1SE8A 5C0XI 4M1UB 1FR3A 3MXPA 1W6KA 1I6HB 3PO3G 1VF5C 2MPMA 1XX8A 4AIMA 1SSOA 1GD7A 3ULJA 2MNAA 1KC8C 1EIYB 3A55A 1SBBB 2N88A 2WKCA 4F88A 2WB1E 2DN8A 3S16H 2K33A 1H9JA 3E0EA 5IYCH 4A3EH 3HOZH 3S2DH 2Z1CA 2NVXB 4DUYL 1Y1WH 3NQTA 3RMHA 2UXBL 5IT9L 4KI0A 4QY7A 1DONA 2A69C 3IAYA 3MC0B 1F9RA 1DOMA 4AQYL 2E2IH 1LTSD 4HIOA 1Q7YC 1I3QB 2L11A 4JV5L 1HTPA 5E3FA 3PO2H 4EQPA 4BY7B 5JJLA 1A15A 1STHA 1S3OA 5FLMH 3K7AH 2B2TA 1E1OA 2E8GA 4UPAA 4XQNA 2JA5H 5A2QE 2BH8A 1DZ1A 2R7FA 3ULPA 3GTJH 1KAAA 4FF4A 3I4NG 5FK9C 4IPCA 2LXKA 3MZ5A 4DK6C 2EE1A 5M9OA 3HOXH 5LMNW 4IURA 3F8TA 3SGIA 1PTOH 1EIHA 3EN2A 2QA4A 3J80i 4BY1H 2A74C 1SE4A 2C5CA 2EOTA 2JJQA 4A93B 4ZUJA 3CCRA 1IHZA 4JBWA 1PH1A 2WIIB 1BVSA 3L7ZC 3X3MA 4R8IA 5I6YA 2WP8J 3S17H 1HHVA 4CKCA 1O80A 2R6GA 3EVQA 1N32Q 2M2LA 1JWSD 5FLXc 1IBKL 4DR4L 1EU4A 1WCMH 3QWNA 2ZT9C 3T16A 4OXPA 5EGTA 4K14A 1STYA 2VQFQ 1GUNA 3OMCA 2B2UC 1XNQQ 1S5CD 1FGBD 1YNJC 2D62A 2GA4B 2K5WA 3PMFA 4RMFA 3I2ZA 1X3QA 4LF4L 1CQFA 3GTMB 2KJXA 3DLLA 3CCSA 3NPPA 5IWAL 4MHEA 1QB5D 2N78A 3SHLA 3F2CA 3DHQA 3FP9A 3RLOA 1TWAH 2VS1A 4C3HH 4DV1L 4K6LA 1FYCA 3S1RB 3PCOB 5C4ZA 3ZYYX 2NVQB 2NWGA 4P75A 1KDCA 2JP1A 1LTGD 4BBRG 4RGOS 4P72A 2RHSB 1A3UA 1EIGA 2K4KA 4X65L 1EYCA 1QUQA 1TKWB 1ESFA 1E22A 4JI6L 1Q3LA 4LF8L 4IUVA 4GKKQ 2CH4A 5C5MA 1MSGA 3S1MH 4ODGA 4DF7A 5JEAJ 3TP8A 3R8BA 1TXYA 5JEAG 5EKLA 2G5DA 3NBHA 3H94A 1VQ6A 3HOWB 5EAYA 1STEA 1K8AC 3IRBA 4H02A 2H1EA 1K83H 4RFBA 1Q12A 3MA2B 1G51A 2K5VA 3S1QH 4A3CH 1V1QA 3D3RA 1QUQB 1SYCA 4DV4L 4HJ5A 4A3JH 1L1OC 4XXEA 1FL0A 4HEDA 1OXUA 4CDDC 1PTOC 2EYOA 4LWCA 2EYJA 5C4HA 1K9MC 1ENAA 3NBHB 1BDOA 5A35A 3PUVA 2NTTA 1FNWA 5KEEA 4X66L 2UUBQ 2R93G 1YNJD 2HQEA 4EQOA 4F8MA 2RDFA 2QDBA 4OEMB 4RA8A 4CHTB 2JA7G 1PH2A 5LL6X 1PH3A 4APVA 1X3GA 3HP3A 1ESRA 3I56A 3L2PA 4A3BH 1H9RA 3DMUA 1JMCA 3PUXA 4DR1Q 3BDLA 1DM0B 4DV6L 3T1YQ 1EFID 1HZ9A 5JVH3 1NJIC 5D3DA 3M85A 1G2TA 1KLGD 1EIFA 1K28A 3E9HA 4KMUC 5AJ3L 4IUQA 1IXRA 2EJMA 3BG3A 2BDNA 2SNSA 1DYQA 3KDFB 5JAVA 1MSHA 2ZJQA 1CFMA 1I6VC 1OXVA 1ICFB 4K0KQ 3A5UA 1TQOA 2B63G 3M4QA 4ILWA 4IO9A 1FD7D 4KKUA 1W2BA 5JPNC 4FP5D 5LMUQ 1AE2A 1N33L 5CV7A 4DAYA 3HKZB 3SK6A 3CRLC 2VB3X 2JYOA 4IPGA 2VY3A 1STBA 1PTOD 4QF4A 3S16B 1HR0Q 1CKNA 1KTKA 3NENA 2AHOB 1I5FA 2YTXA 1EEFD 3U4VA 3NHHA 4KLKA 3S2DB 1Y1WB 2HUGA 3HKSA 2XRQD 1E2ZA 1EY4A 2RCNA 2YTVA 1YIJA 4POGA 3RD4A 1AP0A 2E2IB 2QKIC 4JI3Q 3UDIA 4DAYB 3DUZA 1D1IA 3I7FA 5HGQA 3J80L 2NB0A 5C3WA 3TMEA 1LO5D 2F0EA 1SNPA 2F4IA 1AFPA 1JQYD 1ML0D 1WOCA 2JA5B 3HOUH 4A3DG 4LK1C 5F2DA 3CF5A 2X69A 3GTJB 2UUCL 2WKDA 2GN5A 3PSIA 1L1OB 1TU2B 4KY7A 2EJFC 2IJ0A 2Y0SG 3MVVA 2QEXA 2WAQB 3WWVA 5C3EH 2E5LQ 3HOXB 2MFIA 2LSSA 5CV8A 2ZTDA 1PTOB 4AYBG 4A75A 5I9PA 1EYGA 1IL8A 2F0KA 2F0VA 4JI2Q 1U5KA 2BA0A 3AFQA 3BDOA 2N8NA 4JI5L 3JAMi 3QR8A 3K81C 4MZ9A 3W1BA 1R9TH 4ZKBB 4X6AH 3EQLC 3U9OA 4ZQ3A 1RKNA 2VXWA 2HDLA 2NVYH 4DAVA 5C4XG 3CHBD 1S5BD 4X62Q 4Y7NB 2ES2A 4L5RC 2CFMA 4NDXA 3S17B 5FO9B 3G6JB 2CWAA 4YY3L 3ND8A 3CU7A 2R92H 1CI3M 2SDFA 1PZKD 1WCMB 2F52A 5M5XH 4HN7A 1KNAA 1J6QA 2XTIA 1SNOA 4A3KG 3F1ZA 1V1OA 5C3XA 1CKOA 3KF6A 2O4XA 4CBVA 4A3LH 1BCPF 2CHBD 3OHXC 2PNHA 5JPMC 2E2HH 3KBXA 2UXCL 4LFBQ 4KKSA 1KRTA 3NXWA 4PQXA 5C5LA 1N34L 4QUCA 3V2TA 3H15A 1VMPA 3S14B 1MIUA 2ZJRA 4QQBX 4LF6Q 2CKZB 3C1FA 3STBC 3J7A5 4C3HB 1TS4A 3KLSX 1N36Q 1M90C 4XQQA 3SE0A 4KHPL 1WFQA 2LXJA 1C7YA 3HRZC 3L9AX 4JI8Q 4BXXG 1X55A 5DAUA 1B2TA 3CKIB 3CMAA 2NVXH 1K3BC 2O2LD 4JI7L 3S15H 3TBIB 2FXQA 1H9KA 3R2TA 4LF9Q 3BVMA 1K83B 4JOIA 4BY7H 4FXGC 3SR1A 3U50C 3M7GA 1BXTA 1MI2A 5DNFA 4ZLTF 3OW7A 4DA2A 3S1QB 1TY2A 3E9IA 3CXCA 3CP0A 5EKKA 2WINB 2A68C 2OEOA 3PV0A 2ICIA 4XT1B 4C1NK 1EEID 1FVIA 4FYDA 1QNKA 3PIPA 1YHQA 1JJCB 2XVSA 1JT8A 2IPKD 1AZQA 1M1KC 2G9HD 5ELDA 1IL2A 3MEFA 2B8FA 3SEBA 4DR7Q 4CJ1B 1MBYA 4KD4A 4XDXA 1SAPA 1B4OA 5FJ8G 3FPUB 4BBSB 1HUNA 3GTOH 1I4XA 3RUZA 4IFDG 1GUWA 3K59A 1OXTA 3IFTA 2MO0A 5I2XA 3NK9A 4OL7A 1N8RC 4J1MA 2FFKB 4JVZA 3CCJA 2KENA 5CV5A 1I4RA 1IW7C 3STBD 2LMCB 4PMBA 1NAPA 2UXDL 5CBEE 1QVGA 1BQQT 4DR6Q 4C3IB 2F0IA 2CW0C 3IFDA 1EL0A 5HURA 1YI2A 1LT4D 3V96A 4ME3A 5E4WC 2EIFA 1EWCA 1QILA 5ELCA 2H4OA 4ALPA 4HCEA 2F03A 5M3FG 4LF7Q 2AWOA 4YCUA 2PQAA 4G57A 1JWMD 4DV0Q 3OW2A 1C48A 3GTMH 2KCCA 4BWGB 1KABA 3HKZE 1B7YB 4JI4L 1K8GA 4G7OC 4UP7A 3I90A 1QWYA 2EQSA 5M5WB 2A8VA 1SROA 2FHTA 3S1RH 3J81i 3CCLA 4GN5A 2A68D 5C0XH 2C35B 1L0YB 1LACA 1KD1C 1YJ9A 4IN3A 4JCVE 4UP9A 2JA6H 1EY9A 2PQAB 5EBCA 3PGZA 3I4MG 4R4TA 2K5NA 2GVBA 2JK8A 1WTVA 1LUZA 1YNNC 2OCEA 5T1IA 2KCTA 1I4HA 4P74A 1ILQA 1ENFA 4A3FB 1VQMA 4P2CB 4GLVB 3HOWH 5I4DA 4RHRA 1BBWA 3G71A 1ZYRC 4GKJL 4NPSA 1SJED 4A3IB 1G6PA 3D4WA 1WJJA 3JAML 4DXGA 3L0OA 4FDBA 4HSPA 2VW9A 2QDLA 1EY5A 2A1AA 1J8IA 3A0JA 4Y52H 2WAQE 1CTMA 5DM73 3ERQA 1ILPA 4NB3A 5IYCG 4A3EG 3HOZG 2R7ZG 3BYTB 2OQ0A 3VYTA 1T5XD 1Y1VB 2F4VL 1JB3A 1E0BA 2B2TC 2Z9HA 3G6EA 1JC7A 4NXMQ 5IYBH 2BH2A 5IP9H 1G91A 4LAAA 2F0NA 4PMCA 1K8OA 1IBML 2JEBI 4OELB 2K01A 4RH6A 3P1HA 2F0MA 3PO2G 4LUOA 3F2DA 1DCZA 3EROA 5FLMG 1PH9A 1EQVA 1R4QB 3KFUA 2JA8G 1FNVA 2AUKA 1TIID 1HNXQ 3QOLA 4NW2A 4DPGA 5T1GA 5M5XB 1F2YA 1T5EA 2PI2A 3I55A 2MUYA 4RKBA 2G9DA 1YNND 4BY1G 4GNXA 4DV5L 1S5DD 4UY8C 1V43A 2FJ2A 5CORA 5E1FA 1EQTA 2QEJC 2EPBA 3F2UA 2TSSA 5M5YB 4EGVA 2JEAI 2NUCA 4Q0FA 3NP8A 3LNNA 3EBEA 4DK0A 5EPJA 5GAEC 3M7NA 1H9SA 4DUYQ 1WD0A 5GADC 1J9OA 1D5XC 2UXBQ 1QZGA 2X6GA 1HNWL 1M4VA 3X3NA 2E74C 1STGA 1QE6A 1PRTF 4AQYQ 4DNRB 3KJPA 3VYUA 2RDGA 3S15B 3H0GG 1CQVA 1BF4A 1TR5A 1KQSA 3ONAB 3DWAA 1NTGA 3T13A 1GHKA 2ID0A 4YWLA 3K0XA 4OIJA 1WTWA 2K75A 4KY6A 1MJEA 2EY2A 2AQ3B 2Q8IB 4LW1A 4R1JA 3FKIG 1TWCB 2WV6D 2KQ3A 4L8JA 4N9TA 1SN8A 1HNZL 1LT3D 1GKHA 3H09A 4X64Q 5CV9A 2PW7A 5IYDH 2RQXA 5K36H 2AMCB 5KGUA 3RN5A 1QCBD 1PFSA 2RCFA 4B08A 2EDGA 3A5ZB 1EOTA 1GO3E 2VNUD 2K1BA 1B50A 3R3OA 1X3EA 2WB1G 3BU2A 4N9PA 3GTOB 1LTID 1PFMA 5IGDA 5M3MH 3UE1A 2J4XA 1LV9A 3NWSA 4A3GB 1QVCA 5JVG3 1LM0A 1YEZA 4JBJA 1OXXK 3A8IE 4DR4Q 1IBKQ 2K04A 4Y7NH 4DK1A 2K03A 2M9VA 3J81L 4HMIA 2B2WA 4IZ8A 3M4YA 1SYFA 2XWBB 4LF4Q 1XNRL 3BVZA 4V190 1WTRA 2F3WA 1S72A 1HXYD 2A69D 4HSVA 4AH6A 2AWNA 2Q2IA 1HR0W 3D31A 4DV1Q 3EJIA 1HZAA 2K28A 2PMZE 3OIPA 2ICEC 2QF7A 4ID6A 3QO2A 2HIXA 3S14H 2OWOA 2B2YA 2NVTH 3C2PA 3CC2A 4A3BG 2PYKA 1A2UA 2JA9A 3EA6A 1KDAA 1RJTA 1EY8A 4JI6Q 4QL5A 3CC7A 4CDEC 1MD2D 5FKAC 2VUMB 3VYSA 3OTOL 2VQFL 1NSNS 2OTJA 1MKHA 1W3SA 3MXUA 4FVMA 2J0TD 2JA6B 2L5TA 5IT9E 4HJ7A 1PRTC 1MHWC 2HD3A 4RGTA 4ME5A 2MJ8A 4YHHQ 5I6WA 1LTRD 1TVXA 3BS1A 1PLFA 2XNAC 2IL8A 1PZID 1J5EL 3GTPB 2SEBD 2F0DA 3J7YW 4DV4Q 1SNDA 4B3TL 2RVLA 2BE5C 4CDCC 3L3OC 2L4NA 3I4NH 4K8IA 5G3LD 3E6ZX 3J7ZC 2K32A 3HOYG 1B53A 1RTNA 4LMQD 2EJGC 2SNMA 1RIPA 1I4QA 1ONLA 5EKIA 1CKMA 3J81j 2B39A 3LX0A 4L5QA 3T56B 1X3PA 1VQAA 4I7ZC 4P71A 4IPDA 3M4OH 4J15A 4BBSH 2MQHA 2CVRA 2F1MA 1X54A 2XN9C 1K0SA 1W6JA 2EY1A 1GVPA 3AQQA 4JI0L 2AKWB 2YU9H 3DM1A 1LTAD 3H6MA 1YHBA 1B3AA 1VQPA 3CRKC 1WTOA 4KTAA 3HOUG 1EFWA 2LFNA 4C3IH 5C44B 2F0WA 5LHY1 5BN3A 1VQJA 1WTHA 4OWWB 3D6WA 5J3BA 1UE1A 2JN4A 4HTHA 4MTNA 1PFBA 2E76C 5C3EG 3Q22A 1Y8NB 1VQGA 1GUTA 4CDFC 2CQAA 2EXDA 1AH9A 3M4PA 1A63A 1I94Q 2I0QA 4WORA 1JJGA 4JBMA 1Y8OB 1X9NA 1JJ2A 5EBDA 1EU3A 5J1ZA 1X32A 1GJXA 3AMUA 5LMNL 5JJKA 1TS2A 2MP1A 1ICWA 2BE5D 3K6OA 5M5WH 1IYVA 2N55A 4RCNA 1UWVA 1EZ6A 2IX0A 1E24A 1YJNA 5IT9c 2RSNA 4UAIA 3TEHB 4YIJA 4B3SL 2R92G 4FF3A 3VA7A 2ZXOA 1K3RA 1PYSB 1IKLA 1VQ9A 1UE6A 5BN4A 2RKSA 4A3MG 1KRSA 2D2CC 2BOSA 3FHWA 4C3JB 4DV2Q 1SLJA 2HHHL 4DR2Q 4A3LG 1Q82C 1XMQL 2UUAL 1PDQA 4H44C 4K5VA 4IOCA 1VQNA 3UDXA 4A3FH 3S2HB 3HEJA 2R7DA 2BCOA 1PRTB 1B8AA 1HA6A 4B3MQ 4A3IH 3GTGB 3WDNA 1KXLA 1ET6A 2RBMA 3IL8A 1CKNB 1IKMA 3P7JA 4K8JA 2UUCQ 2DNCA 1XPOA 1Z9FA 4JOIC 4R8NA 1RODA 5C6AA 1Y1VH 1NCVA 4Q5VA 4JI5Q 2A6HC 1VQCA 2JA7H 3A8JE 3MXNA 3W3AA 3BZKA 3MEHA 4QGUA 2IHFA 2EZVA 2MO1A 3HOVB 5M3MB 4H7BA 1TS3A 1F9PA 5DEHA 4BY7G 4MN3A 1D6EC 1YHAA 3HFZB 1JOKA 5DLQE 4JI1L 1V8QA 3PIO3 3W5OA 1SYEA 2ALYB 1VQIA 1Y8PB 1FJGQ 1HZCA 2A73B 4XT3B 3K5LA 1JB7A 3EFXD 2E5LL 5EPLA 1B9NA 4TVAB 4POFA 2KECA 2UXCQ 3HG9A 2B63H 3BZDB 3N52A 1VQOA 1QJOA 1O7ZA 4DNTB 3PO3B 1X65A 4JBKA 4GLAC 3UDFA 3KBGA 3NTHA 3FDTA 4X3SA 4A93G 2NTSA 1BBUA 1VQKA 2P5ZX 1YBYA 5GAGC 5M5YH 5DM63 2WFWA 2IWHA 1Y14B 4KHPQ 2NVTB 3HS0C 3KOJA 1A3VA 1M8AA 1XMOL 1SYDA 1TS5A 1Q8IA 5IP7H 4JI7Q 1RD9D 3KF6B 3DWPA 2L9HA 3QB3A 3D0FA 3NQIA 1EWIA 4GS3A 1GUOA 1KHIA 2J7ZA 1STAA 4UP8A 1VS0A 2AUJD 4V0BA 2A6HD 3T1HQ 4WJ3M 1ZEQX 2F0HA 2O5IC 1SRUA 3J80E 1Q90A 3TRZA 2WACA 2HDMA 3GTKB 4QB4A 2V1CC 1A0IA 1STNA 2ZM6L 4K6DA 1WTPA 3Q8DA 2Z4HA 3W2DA 1Q46A 1A3TA 1N36L 3Q6SA 1KDBA 4K2KA 4PV1C 1KAWA 5ISRA 3I4NB 1U0LA 1TWCH 5C0XJ 4DR3L 5C0XG 4EVOA 3AEVA 3ULLA 2DJGC 4JI8L 3GO5A 1BNZA 4DV3L 1UEAB 2OTLA 4U673 1XYIA 1SDFA 5I9OA 2E2DC 1OXSC 4Z9CB 3K7UC 3GQBA 5HY6A 3OYYA 4KKTA 1PH6A 3PF4A 3K57A 3M4OB 5KYIA 5EQ0A 1SXTA 3HOWG 3NUCA 4LF5L 1A8VA 3O13A 1K73C 2LY7A 3S9WA 3D4DA 2YU9B 3DEOA 5CV4A 4LFAQ 2HT1A 4A3GH 2UU9L 1HTLD 2UXDQ 4MIUA 1P16A 1JICA 4N8FA 3GTQH 4F7XA 2DNEA 4LUZA 4IUNA 4ZYSA 4XQJA 3H3VH 4A4IA 2VQEL 2EYMA 4HMJA 4FF2A 5KNCA 4A3KH 1IBLL 4HIMA 2ZXRA 5FO7B 1SFOB 1PYBA 3CC4A 2CCZA 1CK1A 3LGJA 4UHVA 5TSSA 4OIKA 1VQBA 4GN4B 5BR8Q 1TT2A 1VCIA 3I73A 3N6RA 3GTLB 1UAPA 3DM3A 1SE3A 3I4OA 5IP9G 2LKVA 4JI4Q 2PQEA 1O7IA 1BCPC 2K6AA 3K0YA 4RHSA 3RLFA 2KBNA 1ASYA 4K5WA 4BBRB 4NKLA 3UDGA 4ZAIA 1HZBA 2RF4A 4GNXC 1C9OA 5J39A 1O7LA 3E3XA 1CHPD 3VR5A 5GQOA 2VUMH 2KOLA 2H5XA 1KNEA 4LFCL 5CBAE 3G7LA 1ENCA 5IGFA 2I5MX 2D0PA 1UE5A 3PUWA 3R2IA 3RLNA 5FLXL 4L63B 4G4KA 1DD2A 1RL2A 1Z7TA 3KYHC 1XTCD 3J80c 1Y69U 4LF7L 2F3IA 4GKJQ 1YITA 4DV0L 2D5DA 2IW3A 4UDUC 1EYDA 5KYLA 3QOJA 3Q23A 1QNUA 3A74A 4HCSA 3GTPH 2PZTA 1B9MA 4G7HC 1HQMC 3D4RA 3NTKA 4WRDA 4F87A 3OWEB 3JC66 2F0GA 1UNSA 1UEBA 4DR5Q 4YWMA 4OO1H 3BJUA 3TN2A 3HKZG 2VZAA 2F4VQ 4B9XA 1IW7D 2DGYA 4ZKCB 3U58A 1PH7A 2D9UA 5H1SE 5IGCA 2CW0D 2R93B 4KJOA 4NXNL 4E6IA 5L37A 4MNOA 1MGSA 2JE6I 4DV7Q 2K05A 1Y1WG 1IBMQ 3K5NA 2OT2A 2JA7B 3Q24A 2L1BA 2PCFB 3AU7A 3H3VC 4YWKA 4LJZC 2OXPA 1L0XB 3H3VI 1G2SA 4QIWB 3FMCA 1C8CA 5IGBA 5A2QL 1PZJD 2IHEA 1F77A 3GD7A 4OGQC 1YVCA 2JA5G 2EYPA 2D0OA 2L15A 5IYDG 5C44H 5M3FH 2XGTA 4CKBA 4R9WA 1AZPA 4DV5Q 1IYUA 4H13C 1Z47A 3SDZA 2WAQG 3BYYB 3HOXG 4JYAQ 4DUZQ 4R4IA 2B63B 4O42A 4KN7C 1WI5A 4OWTB 2K5HA 3ICEA 1CSPA 2NZ1D 4XYOA 1LT6D 2XSCA 2B2WC 5D14A 4B3RL 3LWEA 2F0TA 4OX9L 2XWJB 1EWHA 2KEEA 2AQ2B 1ZYRD 2QILA 5IIFA 2KVMA 1UUPA 1AN8A 3I4MH 1BCPB 3TQYA 2PW5A 3Q0AA 1HNWQ 4XTCS 1G6ZA 4DN4M 2E2JH 3K58A 4DAPA 4TKOB 3UE0A 2B2YC 2QW7A 1WCMG 2V4DA 4GNXB 4L5TA 3VR4A 4DK3C 2VB2X 2MHVA 3M3YB 5C4JB 4C3JH 1RHPA 1F2LA 2K7VA 5E4XA 4JV5Q 1CZWA 2NN6H 3DWQA 1K0RA 2F0SA 3NSWA 5GROA 3MFYA 3GV3A 3T53B 3S2HH 5FOBB 4OO1I 3C1EA 1CA6A 4PZ7A 3JAME 3NE5B 1HNZQ 4PG3A 1JE5A 3GTGH 4K5XA 1H9SB 2PPBC 4A3DB 2B2VA 3A54A 3ZJYC 4C3HG 2R7ZH 4O0AA 1TWGH 2AQ1B 2Y0SB 4IFDI 1WD1A 1PH5A 2C9OA 4X3UA 3K8AA 3VA5A 4AYBB 1XTDA 4KV6A 4GOPC 1L2FA 3K5OA 4JG2A 2IX3A 3C46A 4GZYC 3NEMA 2K50A 4RGNA 1TWHB 1U9RA 1GHJA 2KCNA 4TRDA 3HOVH 5C4XB 1PTOF 2JA8H 2K52A 4WFN3 4A3CG 3GTQB 4A3JG 2EY6A 4JW0A 4C2MB 3P20A 1Q8KA 4CKEA 1PH8A 1GOZA 3U4ZA 3I4LA 4X64L 3TDQA 4A3KB 1YJWA 1XNRQ 2GVAA 3KLSA 3VR6A 5IOCA 3T4AC 1KIXA 2PNRC 2Z6KC 3TREA 3P75A 1LTTD 3FVQA 3U9SA 3FPPA 1NR4A 3CCVA 4BBSG 3SK8A 5IWAQ 5FO8B 3PO3H 1SMYC 2SOBA 3G48A 1PFNA 2Q8RE 4J6HA 4TSSA 3VYRA 3URYA 2I46A 4FO2A 3ER0A 2NBFA 3BVGA 3E5SA 2BDOA 3OTOQ 4X65Q 1JR0D 3QIAA 3SK5A 1LABA 3PUYA 2FINB 4LF8Q 2CH4W 3MTSA 4C3IG 1N32L 3H0GH 1VDZA 2HCIA 1C0AA 3DEPA 2YTYA 2IT1A 2RDHA 2NN6I 3GP7A 4KHZA 3KF8A 1B70B 1XNQL 1J5EQ 1V9PA 4CGYB 3CPWA 3FEWX 4X3TA 3JAMc 4ZRZA 4B3TQ 4BA2I 3FKIH 1Q1EA 3GTKH 4HJ8A 1Q86C 4HIKA 3HGBA 1S4ZA 2NZOA 1NMFA 4DXFA 1U4MA 2MGSA 4JK1C 1VF7A 4GOPA 1HCZA 1QVFA 1D5MC 1EUJA 3SVMA 2IY5B 5CR3A 3KF8B 4RKLA 5EPKA 1F9SA 5AFWA 3OSOA 1CHQD 5KNBA 1HUMA 3S1NB 1SJHD 3CD6A 3T51B 2I07B 4GKKL 3S24A 4LUVA 4YHHL 4X66Q 1VQFA 3SXHA 4IUUA 4QIWE 4JI0Q 3TP7A 1EY6A 4WJWA 1E2VA 1JWUD 5ELFA 2LS01 1DJRD 2ATWA 4A3FG 4GOPB 3MAQA 3TS0A 4PNYA 2KHSA 1SMYD 4A3IG 2QGQA 4DV6Q 2HQLA 1YNXA 2EYHA 1PMRA 3RZDH 2B3GA 5CYUA 4HIDA 2F0QA 3WOEA 1HH2P 2B8GA 2Z6KA 4MTKA 4DKAC 3J81E 3K5MA 2L0CA 1G8ZD 4XIGS 2F0PA 1RDPD 1SFOH 5AJ3Q 1TWFB 2EY5A 5M3FB 1EY7A 4CJ0B 1NBWA 4IJHA 4PZ8A 2PZWA 2FMCA 1Y1VG 4R4CA 5IGEA 4U68A 2YYZA 4L5SA 2ZTEA 4X3KA 1LTBD 3CQZH 5I2YA 1SNCA 3GTLH 1PRTD 2UUBL 3KDFA 4N8X1 1EZ8A 1VQLA 1VQ7A 1SR3A 1NUCA 4GLXA 2K14A 4KY5A 5IGGA 3M9BA 5LMNQ 2YV5A 1WTQA 2EXZA 3KJOA 2B29A 2B2UA 3BDCA 5COYA 4DGZA 1N33Q 2A5HA 1SYBA 4BA1I 2PI2E 4BBRH 1FGUA 1R4PB 1WYDA 1PV4A 4RAUC 4DR1L 2Z6BA 4B3SQ 3RZOH 1DGSA 4KN4C 3T1YL 3I4MB 1SYGA 4HJAA 1QZHA 1HQRD 2Q2TA 1AE3A 1KL9A 1N9WA 2E2JB 1CSQA 4DNIA 2XRSD 3MWYW 4I7AA 2HHHQ 4FF1A 1I4GA 5JEAH 1XMQQ 2I5LX 3FRPB 4IQZA 2UUAQ 1CM9A 3OIQA 3RNUA 1VQEA 1BR9A 1PXUA 1QOHA 1I94L 3CCUA 2K5QA 4L6TB 1PHJA 1A62A 1AEXA 1HJPA 5CGKA 3GDEA 4K0KL 3OPOA 4B9WA 3K80C 2RA4A 1BBXC 2Y0SE 3HOYH 4TQUS 1NR2A 1D2BA 3CPFA 5ELOA 5LMUL 1O78A 4AYBE 1GUGA 2TMPA 1EY0A 3UI2A 2FMMA 4A3EB 3HOZB 2R7ZB 2M00A 2DY8A 1K8MA 1TWGB 2E75C 2JQOA 5IP7G 2RSOA 1X56A 3MXGA 3NBIA 1HR0L 1OO9B 3BZCA 2R93H 4RCOA 4DV2L 1L1OA 2DUDA 2CWPA 4DR2L 1II3A 1VQ4A 3PO2B 3I8ZA 5GAHC 5ELEA 1X3FA 4JI3L 4RGMA 1GM5A 4JC0A 3DXJC 4PZ6A 1SEBD 3K7AB 4B3ML 4JI1Q 2Z8LA 1XJVA 3J81c 1H95A 3PUZA 2JA8B 1NY4A 3PIP3 4YY3Q 1LYLA 5KRUA 5CC4A 1A2TA 3SK4A 4CJ2C 2ZJPA 2JSOA 1T9HA 1I50H 4NP5A 4ULLA 1HRJA 2A6EC 4R4QA 2PZUA 3RN2A 3MXNB 4BY1B 1Q81C 1U4PA 5NUCA 4DFAA 2N3SA 1DXMA 1G291 5KIXA 3QJYA 4EX5A 4JI2L 1B3QA 4YCVA 2HIVA 1N34Q 4YCWA 4QCLA 5ELNA 4C1NI 3KLRA 2HCCA 2XIWA 4A3GG 1XMOQ 3TP5A 1P8LA 1RCVD 5D65A 3CCQA 1F9QA 3H91A 4X62L 1WTXA 1ZKOA 4KK7A 2EVBA 2KHIA 3D6CA 3C3LA 1ZXTA 4A3MH 1U4LA 3OOCA 4GN3B 1JOOA 1FJGL 4RWSC 2F3VA 2Z4IA 3H0GB 1CA5A 2X6LA 4KD3A 4KJNA 3M3YH 5C4JH 1V1PA 2F0LA
chains in the Genus database with same CATH topology
4I65A 1O7YA 1ET9A 3A7LA 1HA5A 1TWAB 3R93A 2JXMB 1B1ZA 3FKIB 1B44D 1KLUD 1S5FD 3I91A 3NTIA 1JE4A 3KK7A 3J7AF 1RTOA 3VR2A 2ZXPA 3MFGA 4ZK9B 1V1PB 3S1MB 3A8KE 4PMWA 1S5ED 1SE2A 2WB1B 4HAEA 1GUSA 1EYAA 2A6ED 3OWFA 5HGTA 2L12A 3OMGA 2F0UA 3A56A 4KHVA 4IUPA 1DOKA 3A7AB 4A3JB 3ITPA 4HR7B 4QUFA 3I3CA 2EYFA 3WOFA 1LLRD 3D8GA 2ENBA 5LL6S 4OO1G 3RZDB 3KUPA 4ABNA 1HPCA 1JOQA 4QMGA 4OHJA 1LT5D 2O5JC 2L55A 3HZXA 3MHBA 2F0OA 1C4QA 4IFDJ 3LWUA 3TZUA 3CQZB 2F0JA 3I70A 4C56C 1D5ZC 1PYWD 2OF1A 1BOSA 1GXDC 4A3BB 2EYLA 3TSSA 1SNQA 2F0FA 3RZOB 1E2WA 5D3IB 3TP6A 3ND9A 4DU9A 3IKJA 1VMCA 2R3ZA 5CMDA 4M8AA 1JORA 3E0JA 1CZGA 1U4RA 3I72A 4FXKC 2PMZB 3HOYB 4IALA 2KEDA 3AB9A 2KA7A 3GV6A 4EQNA 1QG7A 5ELBA 3NWTA 3TZDA 3V05A 2NYZD 2B2VC 5KNDA 1H9MA 4C3JG 4IFDH 2R61A 2KUMA 2NN6G 1FNUA 1BUVT 4G7ZC 2PO4A 2K5DA 3J7AV 1D1KA 1BCPD 4H0LC 5JOBA 3HOUB 4ZUIA 4NMZA 1XXGA 1TY0A 5C3EB 2IX1A 4S3SA 1I50B 1AW7A 5K36G 1Z6HA 1I4PA 1BO0A 5IODA 4FXDA 2Q8TA 5JJZA 5J22A 1SNMA 5EJWA 1R9TB 1HFNA 4IUTA 3VR3A 5G3LF 1A6XA 2NVYB 4BS9A 1WVLA 1CT1D 1F2MA 1RF2D 1DOLA 4O1NA 2BA1A 1XWEA 2R92B 2DY7A 1Q1BA 4XYQA 5K5PA 1HFGA 4K2LA 2QCPX 4J8QA 4A3MB 3QG1A 5FLXE 4FNFA 2E2HB 1JCKB 1F2ZA 5CV6A 5BN5A 5C0XI 4M1UB 1FR3A 3MXPA 1W6KA 1I6HB 1VF5C 2MPMA 1XX8A 1SSOA 3A55A 1SBBB 2N88A 2WKCA 4F88A 2DN8A 2K33A 1H9JA 2Z1CA 2NVXB 3NQTA 3RMHA 5IT9L 4KI0A 1DONA 2A69C 3IAYA 3MC0B 1F9RA 1DOMA 1LTSD 1I3QB 2L11A 1HTPA 5E3FA 4EQPA 4BY7B 1A15A 1STHA 2B2TA 4XQNA 5A2QE 1DZ1A 1KAAA 4FF4A 5FK9C 3MZ5A 2EE1A 5M9OA 4IURA 1PTOH 1EIHA 2A74C 1SE4A 2C5CA 2EOTA 4A93B 4ZUJA 1IHZA 4JBWA 2WIIB 3L7ZC 3X3MA 4R8IA 5I6YA 2WP8J 1HHVA 4CKCA 1O80A 2R6GA 3EVQA 2M2LA 1JWSD 1EU4A 3QWNA 3T16A 2ZT9C 5EGTA 4K14A 1STYA 1GUNA 3OMCA 2B2UC 1S5CD 1FGBD 1YNJC 2D62A 2GA4B 2K5WA 3PMFA 1X3QA 3GTMB 1CQFA 2KJXA 3NPPA 4MHEA 1QB5D 3SHLA 3DHQA 4K6LA 1FYCA 3S1RB 5C4ZA 3ZYYX 2NVQB 2NWGA 1KDCA 2JP1A 1LTGD 4RGOS 1A3UA 1EIGA 1EYCA 1TKWB 1ESFA 1Q3LA 4IUVA 5C5MA 1MSGA 4ODGA 4DF7A 5JEAJ 3TP8A 3R8BA 5JEAG 5EKLA 3NBHA 3H94A 3HOWB 1STEA 2H1EA 4RFBA 1Q12A 3MA2B 3D3RA 1SYCA 4XXEA 4HEDA 1OXUA 1PTOC 2EYOA 2EYJA 5C4HA 1ENAA 1BDOA 5A35A 3PUVA 2NTTA 1FNWA 5KEEA 1YNJD 2HQEA 4EQOA 4F8MA 2RDFA 2QDBA 4RA8A 4CHTB 5LL6X 3HP3A 1ESRA 1H9RA 3DMUA 3PUXA 3BDLA 1DM0B 1EFID 5JVH3 5D3DA 3M85A 1G2TA 1KLGD 4KMUC 4IUQA 2EJMA 3BG3A 2BDNA 2SNSA 1DYQA 5JAVA 1MSHA 1CFMA 1I6VC 1OXVA 1TQOA 4ILWA 1FD7D 4KKUA 5JPNC 4FP5D 5CV7A 4DAYA 3HKZB 3SK6A 3CRLC 2VB3X 2JYOA 1STBA 1PTOD 4QF4A 3S16B 1KTKA 1EEFD 3NHHA 3S2DB 1Y1WB 2HUGA 2XRQD 1E2ZA 1EY4A 3RD4A 1AP0A 2E2IB 2QKIC 3DUZA 1D1IA 3J80L 2NB0A 5C3WA 3TMEA 1LO5D 2F0EA 1SNPA 2F4IA 1AFPA 1JQYD 1ML0D 2JA5B 4LK1C 5F2DA 2X69A 3GTJB 2WKDA 1TU2B 4KY7A 2EJFC 2IJ0A 3MVVA 2WAQB 3HOXB 5CV8A 1PTOB 5I9PA 1IL8A 2F0KA 2F0VA 2BA0A 3BDOA 4ZKBB 3EQLC 3U9OA 4ZQ3A 1RKNA 2VXWA 2HDLA 4DAVA 3CHBD 1S5BD 4Y7NB 4NDXA 3S17B 5FO9B 3G6JB 3ND8A 3CU7A 1CI3M 2SDFA 1PZKD 1WCMB 4HN7A 1KNAA 1SNOA 1V1OA 5C3XA 2O4XA 4CBVA 1BCPF 2CHBD 3OHXC 5JPMC 3KBXA 4KKSA 3NXWA 4PQXA 5C5LA 4QUCA 3V2TA 1VMPA 3S14B 3C1FA 4C3HB 1TS4A 3KLSX 4XQQA 3SE0A 3HRZC 3L9AX 5DAUA 1B2TA 3CKIB 2O2LD 3TBIB 1H9KA 3R2TA 3BVMA 1K83B 4FXGC 3SR1A 3M7GA 4ZLTF 1BXTA 1MI2A 5DNFA 3OW7A 4DA2A 3S1QB 1TY2A 5EKKA 2WINB 2A68C 2OEOA 3PV0A 2ICIA 4XT1B 4C1NK 1EEID 4FYDA 1QNKA 2XVSA 2IPKD 1AZQA 2G9HD 5ELDA 2B8FA 3SEBA 4CJ1B 1MBYA 4KD4A 4XDXA 1SAPA 1B4OA 3FPUB 4BBSB 1HUNA 1I4XA 3RUZA 4IFDG 1GUWA 3K59A 1OXTA 3IFTA 5I2XA 3NK9A 4OL7A 4J1MA 2FFKB 5CV5A 1I4RA 1IW7C 2LMCB 4PMBA 1NAPA 5CBEE 1BQQT 4C3IB 2F0IA 2CW0C 3IFDA 1EL0A 5HURA 1LT4D 3V96A 5E4WC 1EWCA 1QILA 5ELCA 2H4OA 2F03A 4HCEA 2AWOA 4G57A 1JWMD 1C48A 2KCCA 4BWGB 1KABA 4G7OC 3I90A 1QWYA 5M5WB 2FHTA 2A68D 5C0XH 1L0YB 1LACA 4IN3A 1EY9A 5EBCA 1WTVA 1YNNC 5T1IA 1I4HA 4A3FB 1ILQA 1ENFA 4P2CB 5I4DA 4RHRA 1ZYRC 1SJED 4A3IB 3D4WA 3JAML 4DXGA 4HSPA 1EY5A 1J8IA 1CTMA 5DM73 3ERQA 1ILPA 3BYTB 3VYTA 1T5XD 1Y1VB 1JB3A 1E0BA 2B2TC 1JC7A 1G91A 4LAAA 2F0NA 4PMCA 1K8OA 2JEBI 2K01A 4RH6A 3P1HA 2F0MA 1DCZA 3EROA 1EQVA 1R4QB 1FNVA 2AUKA 1TIID 3QOLA 4NW2A 5M5XB 5T1GA 1F2YA 1T5EA 2MUYA 4RKBA 2G9DA 1YNND 1S5DD 1V43A 2FJ2A 5CORA 5E1FA 1EQTA 2QEJC 2EPBA 3F2UA 2TSSA 5M5YB 4EGVA 2JEAI 2NUCA 4Q0FA 3NP8A 3LNNA 4DK0A 5EPJA 3M7NA 1H9SA 1WD0A 1J9OA 1D5XC 2X6GA 1M4VA 3X3NA 2E74C 1STGA 1QE6A 1PRTF 4DNRB 3VYUA 2RDGA 3S15B 1CQVA 1BF4A 1TR5A 3ONAB 3DWAA 3T13A 1GHKA 2ID0A 1WTWA 4OIJA 4KY6A 2EY2A 2AQ3B 2Q8IB 1TWCB 2WV6D 2KQ3A 4L8JA 4N9TA 1LT3D 3H09A 5CV9A 2PW7A 2RQXA 5K36H 5KGUA 1QCBD 4B08A 2EDGA 1EOTA 2VNUD 1B50A 2K1BA 3R3OA 4N9PA 3GTOB 1LTID 1PFMA 5IGDA 2J4XA 1LV9A 3NWSA 4A3GB 5JVG3 1OXXK 3A8IE 2K04A 4DK1A 2K03A 2M9VA 3J81L 4HMIA 2B2WA 4IZ8A 3M4YA 1SYFA 2XWBB 3BVZA 4V190 1WTRA 2F3WA 1HXYD 2A69D 4HSVA 2AWNA 3D31A 3EJIA 2K28A 3OIPA 2ICEC 2QF7A 4ID6A 3QO2A 2B2YA 3C2PA 2PYKA 1A2UA 3EA6A 1KDAA 1RJTA 1EY8A 2VUMB 1MD2D 5FKAC 3VYSA 1NSNS 3MXUA 4FVMA 2J0TD 2JA6B 2L5TA 5IT9E 1PRTC 4RGTA 4ME5A 2MJ8A 5I6WA 1LTRD 1TVXA 3BS1A 1PLFA 2XNAC 2IL8A 1PZID 3GTPB 2SEBD 2F0DA 3J7YW 1SNDA 2RVLA 2BE5C 3L3OC 2L4NA 4K8IA 5G3LD 3E6ZX 2K32A 1B53A 1RTNA 4LMQD 2EJGC 2SNMA 1I4QA 1ONLA 5EKIA 2B39A 3LX0A 3T56B 1X3PA 4I7ZC 2CVRA 2F1MA 2XN9C 1W6JA 2EY1A 3DM1A 1LTAD 3H6MA 1B3AA 3CRKC 1WTOA 4KTAA 2LFNA 5C44B 2F0WA 5LHY1 5BN3A 3D6WA 4HTHA 1PFBA 2E76C 3Q22A 1Y8NB 1GUTA 2CQAA 4WORA 1Y8OB 5EBDA 1EU3A 5J1ZA 1X32A 1GJXA 3AMUA 1TS2A 2MP1A 1ICWA 2BE5D 3K6OA 1IYVA 2N55A 4RCNA 1EZ6A 2IX0A 2RSNA 4UAIA 4YIJA 4FF3A 3VA7A 2ZXOA 1IKLA 5BN4A 2RKSA 2D2CC 4C3JB 2BOSA 1PDQA 4H44C 4K5VA 3S2HB 3HEJA 2BCOA 1PRTB 1HA6A 3GTGB 3WDNA 1ET6A 2RBMA 3IL8A 1IKMA 3P7JA 4K8JA 2DNCA 4R8NA 1RODA 5C6AA 1NCVA 4Q5VA 2A6HC 3A8JE 3MXNA 3W3AA 3MEHA 2EZVA 3HOVB 5M3MB 4H7BA 1TS3A 1F9PA 5DEHA 4MN3A 1D6EC 1JOKA 1V8QA 3PIO3 1SYEA 1Y8PB 4XT3B 2A73B 3K5LA 3EFXD 5EPLA 1B9NA 2KECA 3HG9A 3BZDB 3N52A 1QJOA 1O7ZA 4DNTB 3PO3B 3KBGA 3NTHA 3FDTA 4X3SA 2NTSA 5DM63 2IWHA 2NVTB 3HS0C 1A3VA 1M8AA 1SYDA 1TS5A 1Q8IA 1RD9D 3DWPA 2L9HA 3QB3A 3NQIA 1GUOA 2J7ZA 1STAA 2AUJD 4V0BA 2A6HD 1ZEQX 2F0HA 2O5IC 3J80E 1Q90A 2WACA 2HDMA 3GTKB 4QB4A 1STNA 4K6DA 1WTPA 2Z4HA 3W2DA 1A3TA 3Q6SA 1KDBA 4K2KA 4PV1C 5ISRA 3I4NB 5C0XJ 5C0XG 4EVOA 3GO5A 1BNZA 1UEAB 4U673 1XYIA 1SDFA 5I9OA 2E2DC 1OXSC 4Z9CB 3GQBA 4KKTA 3K57A 3M4OB 5KYIA 5EQ0A 1SXTA 3NUCA 3O13A 2LY7A 3S9WA 3D4DA 2YU9B 3DEOA 5CV4A 1HTLD 4MIUA 1JICA 4F7XA 2DNEA 4IUNA 4ZYSA 4XQJA 2EYMA 4HMJA 4FF2A 5KNCA 2ZXRA 5FO7B 1SFOB 1CK1A 5TSSA 4OIKA 1TT2A 1VCIA 3I73A 3N6RA 3GTLB 1UAPA 1SE3A 2LKVA 2PQEA 1BCPC 2K6AA 3K0YA 4RHSA 3RLFA 4K5WA 4BBRB 4NKLA 4ZAIA 5J39A 1O7LA 3VR5A 1CHPD 2KOLA 1KNEA 5CBAE 3G7LA 1ENCA 5IGFA 3PUWA 5FLXL 3R2IA 4L63B 4G4KA 1DD2A 1Z7TA 1Y69U 1XTCD 2D5DA 2IW3A 4UDUC 1EYDA 5KYLA 3QOJA 3Q23A 1QNUA 4HCSA 2PZTA 1B9MA 4G7HC 1HQMC 3D4RA 3NTKA 4WRDA 4F87A 3OWEB 2F0GA 1UNSA 4OO1H 3TN2A 4B9XA 1IW7D 4ZKCB 2D9UA 5IGCA 2CW0D 2R93B 4KJOA 4E6IA 1MGSA 2JE6I 2K05A 3K5NA 2OT2A 2JA7B 3Q24A 2L1BA 2PCFB 3AU7A 3H3VC 4LJZC 2OXPA 1L0XB 1G2SA 4QIWB 3FMCA 1C8CA 5IGBA 5A2QL 1PZJD 1F77A 3GD7A 4OGQC 2EYPA 4CKBA 4R9WA 1AZPA 1IYUA 4H13C 1Z47A 3SDZA 3BYYB 2B63B 4O42A 4KN7C 2NZ1D 4XYOA 1LT6D 2XSCA 2B2WC 5D14A 3LWEA 2F0TA 2XWJB 1EWHA 2KEEA 2AQ2B 1ZYRD 2QILA 5IIFA 2KVMA 1UUPA 1AN8A 1BCPB 2PW5A 3Q0AA 4XTCS 1G6ZA 4DN4M 3K58A 4DAPA 4TKOB 2B2YC 2V4DA 3VR4A 2VB2X 2MHVA 3M3YB 5C4JB 1RHPA 1F2LA 2K7VA 5E4XA 1CZWA 2NN6H 3DWQA 2F0SA 3NSWA 3MFYA 3GV3A 3T53B 5FOBB 4OO1I 3C1EA 1CA6A 3JAME 3NE5B 4K5XA 1H9SB 2PPBC 4A3DB 2B2VA 3A54A 4C3HG 2AQ1B 2Y0SB 4IFDI 1WD1A 2C9OA 4X3UA 3VA5A 4AYBB 4KV6A 3K5OA 2IX3A 3C46A 4GZYC 4RGNA 1TWHB 1U9RA 1GHJA 2KCNA 4TRDA 5C4XB 1PTOF 4WFN3 3GTQB 2EY6A 4C2MB 3P20A 4CKEA 1GOZA 3I4LA 3TDQA 4A3KB 3KLSA 3VR6A 5IOCA 3T4AC 2PNRC 3P75A 1LTTD 3FVQA 3U9SA 3FPPA 1NR4A 3SK8A 5FO8B 1SMYC 2SOBA 1PFNA 2Q8RE 4J6HA 4TSSA 3VYRA 3URYA 2I46A 4FO2A 2NBFA 3BVGA 3E5SA 2BDOA 1JR0D 3QIAA 3SK5A 1LABA 3PUYA 2FINB 3MTSA 4C3IG 1VDZA 2HCIA 3DEPA 2IT1A 2RDHA 2NN6I 3GP7A 4KHZA 3KF8A 4CGYB 3FEWX 4X3TA 4ZRZA 4BA2I 1Q1EA 3HGBA 1S4ZA 4DXFA 1U4MA 2MGSA 4JK1C 1VF7A 1HCZA 1D5MC 3SVMA 5CR3A 4RKLA 5EPKA 1F9SA 5AFWA 3OSOA 1CHQD 5KNBA 1HUMA 3S1NB 1SJHD 3T51B 2I07B 3SXHA 4IUUA 3TP7A 1EY6A 4WJWA 1E2VA 1JWUD 5ELFA 2LS01 1DJRD 3MAQA 4PNYA 2KHSA 1SMYD 2EYHA 1PMRA 5CYUA 2F0QA 3WOEA 2B8GA 3J81E 3K5MA 2L0CA 1G8ZD 4XIGS 2F0PA 1RDPD 1TWFB 2EY5A 5M3FB 1EY7A 4CJ0B 2PZWA 2FMCA 5IGEA 4U68A 2YYZA 4X3KA 1LTBD 5I2YA 1SNCA 1PRTD 1EZ8A 1NUCA 4KY5A 5IGGA 1WTQA 2EXZA 2B2UA 3BDCA 5COYA 4DGZA 2A5HA 1SYBA 4BA1I 1R4PB 4RAUC 4KN4C 3I4MB 1SYGA 1HQRD 2E2JB 2XRSD 3MWYW 4FF1A 1I4GA 5JEAH 3FRPB 4IQZA 1CM9A 3OIQA 1BR9A 1PXUA 1QOHA 2K5QA 4L6TB 1AEXA 5CGKA 3OPOA 4B9WA 2RA4A 1BBXC 4TQUS 1NR2A 1D2BA 1O78A 1GUGA 2TMPA 1EY0A 3UI2A 2FMMA 4A3EB 3HOZB 2R7ZB 2M00A 2DY8A 1K8MA 1TWGB 2E75C 2RSOA 3MXGA 3NBIA 1OO9B 4RCOA 1II3A 3PO2B 3I8ZA 5ELEA 4RGMA 3DXJC 1SEBD 3K7AB 2Z8LA 3PUZA 2JA8B 3PIP3 5KRUA 5CC4A 1A2TA 3SK4A 4CJ2C 2JSOA 4NP5A 4ULLA 1HRJA 2A6EC 2PZUA 4BY1B 1U4PA 5NUCA 4DFAA 1DXMA 1G291 5KIXA 3QJYA 4QCLA 4C1NI 3KLRA 2HCCA 2XIWA 3TP5A 1RCVD 5D65A 1F9QA 3H91A 1WTXA 1ZKOA 4KK7A 2EVBA 3C3LA 3D6CA 1ZXTA 1U4LA 3OOCA 1JOOA 4RWSC 2F3VA 2Z4IA 3H0GB 1CA5A 2X6LA 4KD3A 4KJNA 1V1PA 2F0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ET9 A;  5D3D A;  1HA5 A;  1LTI D;  4DXF A;  1KLG D;  1I4R A;  1S5C D;  2XN9 C;  2J4X A;  1JCK B;  1FGB D;  1B1Z A;  1D5M C;  2AQ1 B;  4Z9C B;  1B44 D;  1PZK D;  1KLU D;  1S5F D;  1DYQ A;  1V1O A;  1LTA D;  1CHQ D;  1LT4 D;  1TS3 A;  1FNV A;  1SXT A;  1EWC A;  1SJH D;  3O13 A;  1QIL A;  1D6E C;  5ELC A;  1BCP F;  2CHB D;  4RH6 A;  3MFG A;  4K6L A;  4RGN A;  1V1P B;  1HTL D;  1FD7 D;  1SBB B;  1L0X B;  5ELB A;  4RCO A;  1JWM D;  1LTG D;  1S5E D;  1SE2 A;  4RGO S;  4ZYS A;  1JWU D;  5ELF A;  4BWG B;  1DJR D;  3BVZ A;  1S5D D;  1PTO F;  3V05 A;  1PZJ D;  5ELE A;  1ESF A;  1F77 A;  1TS4 A;  3KLS X;  4RGM A;  1HXY D;  3EFX D;  1PTO D;  2QEJ C;  3MC0 B;  1CK1 A;  1SEB D;  2TSS A;  1KTK A;  5TSS A;  2Z8L A;  1LTS D;  1GOZ A;  3BZD B;  1EEF D;  2R61 A;  1FNU A;  4L6T B;  1L0Y B;  3R8B A;  1EU3 A;  2XRQ D;  1SE3 A;  1LLR D;  2O2L D;  1G8Z D;  1STE A;  3BYY B;  1RDP D;  1BCP D;  2NTS A;  3EA6 A;  1BCP C;  1TS2 A;  1D5X C;  4RFB A;  4RHS A;  1LTT D;  1M4V A;  3R2T A;  1MD2 D;  1LT6 D;  5FKA C;  1PRT F;  3BVM A;  1LTB D;  2RDG A;  1I4H A;  4OHJ A;  1LT5 D;  1LO5 D;  1PRT D;  1XXG A;  1ENF A;  1PRT C;  1CQV A;  1TY0 A;  1TS5 A;  5I4D A;  4RHR A;  1PTO C;  4RGT A;  2AQ2 B;  5FK9 C;  2QIL A;  1BXT A;  4TSS A;  1JQY D;  3DWA A;  1AW7 A;  1LTR D;  3URY A;  1SJE D;  1CHP D;  1RD9 D;  1TY2 A;  2XNA C;  1UUP A;  3DWP A;  1AN8 A;  1I4P A;  1BCP B;  1PZI D;  1PTO H;  3BVG A;  2ICI A;  4DXG A;  1EEI D;  2SEB D;  4C56 C;  1JR0 D;  1D5Z C;  1PYW D;  2AQ3 B;  3R2I A;  2NTT A;  1FNW A;  4L63 B;  1SE4 A;  2IJ0 A;  2IPK D;  1XTC D;  2WV6 D;  1PRT B;  2G9H D;  1HQR D;  1RCV D;  5ELD A;  1PTO B;  1LT3 D;  3SEB A;  4UDU C;  2RDH A;  3TSS A;  1CT1 D;  3BYT B;  1ET6 A;  1RF2 D;  1T5X D;  3GP7 A;  4O1N A;  2XRS D;  3DWQ A;  3W2D A;  1I4G A;  3OWE B;  1I4X A;  1I4Q A;  5D3I B;  1UNS A;  1EFI D;  1JWS D;  1EU4 A;  3CHB D;  1S5B D;  1V1P A; 
#chains in the Genus database with same CATH topology
 4I65 A;  1O7Y A;  1ET9 A;  3A7L A;  1HA5 A;  1CUK A;  3PF5 A;  4HJ9 A;  1I6H H;  5E7N A;  2ZM6 Q;  1TWA B;  3R93 A;  4LFB L;  2JXM B;  1B1Z A;  3FKI B;  4IPH A;  4IJL A;  1B44 D;  1KLU D;  1S5F D;  2ZTC A;  3I91 A;  4DR3 Q;  3NTI A;  4A3D H;  4LF6 L;  1JE4 A;  3KK7 A;  3J7A F;  3CAM A;  4ZCK A;  1E3P A;  1RTO A;  4DV3 Q;  3AFP A;  3CME A;  3VR2 A;  2ZXP A;  3MFG A;  4ZK9 B;  1V1P B;  2VUM G;  3S1M B;  3A8K E;  3W1G A;  4PMW A;  1S5E D;  1SE2 A;  2WB1 B;  4A76 A;  4HAE A;  2JA6 G;  1GUS A;  2OQK A;  1I3Q H;  1EYA A;  2A6E D;  3OWF A;  3RR5 A;  5HGT A;  2L12 A;  3T1H L;  3NEL A;  4LF5 Q;  3OMG A;  2F0U A;  4LF9 L;  3A56 A;  4KHV A;  1TWH H;  4IUP A;  3VDY A;  1DOK A;  3A7A B;  1OTC A;  1UE7 A;  2UU9 Q;  4A3J B;  3ITP A;  4HR7 B;  4QUF A;  3I3C A;  5C4X H;  4JPB W;  2EYF A;  3WOF A;  1LLR D;  1VQH A;  2VQE Q;  3PQI A;  2N49 A;  3TS2 A;  1NMG A;  1IBL Q;  3D8G A;  2ENB A;  5LL6 S;  2KHJ A;  4OO1 G;  3RZD B;  3KUP A;  4C2M H;  3PIO A;  1D8L A;  4ABN A;  2I5H A;  1HPC A;  1VQ5 A;  1JOQ A;  4QMG A;  4OHJ A;  1LT5 D;  2O5J C;  2L55 A;  3HZX A;  3MHB A;  2F0O A;  1C4Q A;  4IFD J;  4DR7 L;  4EQ5 A;  3AYH B;  3LWU A;  4A93 H;  3TZU A;  3CQZ B;  2F0J A;  5IYB G;  3I70 A;  4O2D A;  4C56 C;  3ERS X;  1D5Z C;  1E1T A;  1PYW D;  2OF1 A;  1BOS A;  1GXD C;  4A3B B;  2EYL A;  4LFA L;  1EQQ A;  4OWX B;  3TSS A;  1LTL A;  1SNQ A;  1VQD A;  4QJF A;  1X6O A;  2F0F A;  4LFC Q;  4BXX H;  3RZO B;  1E2W A;  4DR6 L;  5D3I B;  3TP6 A;  5C44 G;  3ND9 A;  5IY0 A;  4DU9 A;  3IKJ A;  1VMC A;  5BR8 L;  1MJC A;  2Q2U A;  2R3Z A;  5CMD A;  4M8A A;  1JOR A;  1S40 A;  3E0J A;  2RHQ B;  1CZG A;  1BKB A;  1VQ8 A;  1PVO A;  2KCM A;  1D7Q A;  1IYJ B;  2VL6 A;  2A19 A;  1U4R A;  2NVQ H;  3I72 A;  4FXK C;  1EOV A;  2PMZ B;  3HOY B;  2CQO A;  4IAL A;  2Z0S A;  2DJF C;  2KED A;  3AB9 A;  1PH4 A;  2KA7 A;  3GV6 A;  4EQN A;  1QG7 A;  1SMX A;  5ELB A;  1XPR A;  2Q2H A;  3NWT A;  4NXN Q;  1NE3 A;  3TZD A;  3V05 A;  2NYZ D;  3S1N H;  2B2V C;  5FJ8 H;  5KND A;  1H9M A;  1XPU A;  4C3J G;  4IFD H;  2R61 A;  2KUM A;  2NN6 G;  1FNU A;  1BUV T;  4G7Z C;  1PA6 A;  2ASB A;  4RG1 A;  2PO4 A;  4P73 A;  3EIV A;  2K5D A;  3J7A V;  5JJI A;  1D1K A;  3F2B A;  4WJ4 A;  1BCP D;  4H0L C;  5JOB A;  1NNX A;  3HOU B;  3CW2 C;  3CCE A;  4OON A;  4DR5 L;  4ZUI A;  4NMZ A;  3B6Y A;  3CCM A;  4R4O A;  3KLW A;  1XXG A;  1TY0 A;  5C3E B;  1EQR A;  2IX1 A;  5IE8 A;  4S3S A;  3G4S A;  1I50 B;  1AW7 A;  1TWF H;  5K36 G;  1Z6H A;  1I4P A;  1BO0 A;  4DV7 L;  5IOD A;  4LNQ A;  2Q8T A;  4FXD A;  5JJZ A;  5J22 A;  4NXM L;  1SNM A;  5EJW A;  1R9T B;  4B3R Q;  4OX9 Q;  1HFN A;  4IOA A;  4IUT A;  3VR3 A;  5G3L F;  1A6X A;  2NVY B;  4BS9 A;  1WVL A;  3HOV G;  5M3M G;  1CT1 D;  1F2M A;  1RF2 D;  1DOL A;  4O1N A;  2BA1 A;  4DAM A;  1XWE A;  1ASZ A;  1IZ6 A;  2R92 B;  1YZ6 A;  2DY7 A;  1Q1B A;  4XYQ A;  5K5P A;  1HFG A;  2NZH A;  4K2L A;  2QCP X;  4J8Q A;  4A3M B;  3QG1 A;  5FLX E;  1HNX L;  4FNF A;  1L0W A;  2E2H B;  1E7Z A;  1JCK B;  4JYA L;  4DUZ L;  1F2Z A;  5CV6 A;  5BN5 A;  1SE8 A;  5C0X I;  4M1U B;  1FR3 A;  3MXP A;  1W6K A;  1I6H B;  3PO3 G;  1VF5 C;  2MPM A;  1XX8 A;  4AIM A;  1SSO A;  1GD7 A;  3ULJ A;  2MNA A;  1KC8 C;  1EIY B;  3A55 A;  1SBB B;  2N88 A;  2WKC A;  4F88 A;  2WB1 E;  2DN8 A;  3S16 H;  2K33 A;  1H9J A;  3E0E A;  5IYC H;  4A3E H;  3HOZ H;  3S2D H;  2Z1C A;  2NVX B;  4DUY L;  1Y1W H;  3NQT A;  3RMH A;  2UXB L;  5IT9 L;  4KI0 A;  4QY7 A;  1DON A;  2A69 C;  3IAY A;  3MC0 B;  1F9R A;  1DOM A;  4AQY L;  2E2I H;  1LTS D;  4HIO A;  1Q7Y C;  1I3Q B;  2L11 A;  4JV5 L;  1HTP A;  5E3F A;  3PO2 H;  4EQP A;  4BY7 B;  5JJL A;  1A15 A;  1STH A;  1S3O A;  5FLM H;  3K7A H;  2B2T A;  1E1O A;  2E8G A;  4UPA A;  4XQN A;  2JA5 H;  5A2Q E;  2BH8 A;  1DZ1 A;  2R7F A;  3ULP A;  3GTJ H;  1KAA A;  4FF4 A;  3I4N G;  5FK9 C;  4IPC A;  2LXK A;  3MZ5 A;  4DK6 C;  2EE1 A;  5M9O A;  3HOX H;  5LMN W;  4IUR A;  3F8T A;  3SGI A;  1PTO H;  1EIH A;  3EN2 A;  2QA4 A;  3J80 i;  4BY1 H;  2A74 C;  1SE4 A;  2C5C A;  2EOT A;  2JJQ A;  4A93 B;  4ZUJ A;  3CCR A;  1IHZ A;  4JBW A;  1PH1 A;  2WII B;  1BVS A;  3L7Z C;  3X3M A;  4R8I A;  5I6Y A;  2WP8 J;  3S17 H;  1HHV A;  4CKC A;  1O80 A;  2R6G A;  3EVQ A;  1N32 Q;  2M2L A;  1JWS D;  5FLX c;  1IBK L;  4DR4 L;  1EU4 A;  1WCM H;  3QWN A;  2ZT9 C;  3T16 A;  4OXP A;  5EGT A;  4K14 A;  1STY A;  2VQF Q;  1GUN A;  3OMC A;  2B2U C;  1XNQ Q;  1S5C D;  1FGB D;  1YNJ C;  2D62 A;  2GA4 B;  2K5W A;  3PMF A;  4RMF A;  3I2Z A;  1X3Q A;  4LF4 L;  1CQF A;  3GTM B;  2KJX A;  3DLL A;  3CCS A;  3NPP A;  5IWA L;  4MHE A;  1QB5 D;  2N78 A;  3SHL A;  3F2C A;  3DHQ A;  3FP9 A;  3RLO A;  1TWA H;  2VS1 A;  4C3H H;  4DV1 L;  4K6L A;  1FYC A;  3S1R B;  3PCO B;  5C4Z A;  3ZYY X;  2NVQ B;  2NWG A;  4P75 A;  1KDC A;  2JP1 A;  1LTG D;  4BBR G;  4RGO S;  4P72 A;  2RHS B;  1A3U A;  1EIG A;  2K4K A;  4X65 L;  1EYC A;  1QUQ A;  1TKW B;  1ESF A;  1E22 A;  4JI6 L;  1Q3L A;  4LF8 L;  4IUV A;  4GKK Q;  2CH4 A;  5C5M A;  1MSG A;  3S1M H;  4ODG A;  4DF7 A;  5JEA J;  3TP8 A;  3R8B A;  1TXY A;  5JEA G;  5EKL A;  2G5D A;  3NBH A;  3H94 A;  1VQ6 A;  3HOW B;  5EAY A;  1STE A;  1K8A C;  3IRB A;  4H02 A;  2H1E A;  1K83 H;  4RFB A;  1Q12 A;  3MA2 B;  1G51 A;  2K5V A;  3S1Q H;  4A3C H;  1V1Q A;  3D3R A;  1QUQ B;  1SYC A;  4DV4 L;  4HJ5 A;  4A3J H;  1L1O C;  4XXE A;  1FL0 A;  4HED A;  1OXU A;  4CDD C;  1PTO C;  2EYO A;  4LWC A;  2EYJ A;  5C4H A;  1K9M C;  1ENA A;  3NBH B;  1BDO A;  5A35 A;  3PUV A;  2NTT A;  1FNW A;  5KEE A;  4X66 L;  2UUB Q;  2R93 G;  1YNJ D;  2HQE A;  4EQO A;  4F8M A;  2RDF A;  2QDB A;  4OEM B;  4RA8 A;  4CHT B;  2JA7 G;  1PH2 A;  5LL6 X;  1PH3 A;  4APV A;  1X3G A;  3HP3 A;  1ESR A;  3I56 A;  3L2P A;  4A3B H;  1H9R A;  3DMU A;  1JMC A;  3PUX A;  4DR1 Q;  3BDL A;  1DM0 B;  4DV6 L;  3T1Y Q;  1EFI D;  1HZ9 A;  5JVH 3;  1NJI C;  5D3D A;  3M85 A;  1G2T A;  1KLG D;  1EIF A;  1K28 A;  3E9H A;  4KMU C;  5AJ3 L;  4IUQ A;  1IXR A;  2EJM A;  3BG3 A;  2BDN A;  2SNS A;  1DYQ A;  3KDF B;  5JAV A;  1MSH A;  2ZJQ A;  1CFM A;  1I6V C;  1OXV A;  1ICF B;  4K0K Q;  3A5U A;  1TQO A;  2B63 G;  3M4Q A;  4ILW A;  4IO9 A;  1FD7 D;  4KKU A;  1W2B A;  5JPN C;  4FP5 D;  5LMU Q;  1AE2 A;  1N33 L;  5CV7 A;  4DAY A;  3HKZ B;  3SK6 A;  3CRL C;  2VB3 X;  2JYO A;  4IPG A;  2VY3 A;  1STB A;  1PTO D;  4QF4 A;  3S16 B;  1HR0 Q;  1CKN A;  1KTK A;  3NEN A;  2AHO B;  1I5F A;  2YTX A;  1EEF D;  3U4V A;  3NHH A;  4KLK A;  3S2D B;  1Y1W B;  2HUG A;  3HKS A;  2XRQ D;  1E2Z A;  1EY4 A;  2RCN A;  2YTV A;  1YIJ A;  4POG A;  3RD4 A;  1AP0 A;  2E2I B;  2QKI C;  4JI3 Q;  3UDI A;  4DAY B;  3DUZ A;  1D1I A;  3I7F A;  5HGQ A;  3J80 L;  2NB0 A;  5C3W A;  3TME A;  1LO5 D;  2F0E A;  1SNP A;  2F4I A;  1AFP A;  1JQY D;  1ML0 D;  1WOC A;  2JA5 B;  3HOU H;  4A3D G;  4LK1 C;  5F2D A;  3CF5 A;  2X69 A;  3GTJ B;  2UUC L;  2WKD A;  2GN5 A;  3PSI A;  1L1O B;  1TU2 B;  4KY7 A;  2EJF C;  2IJ0 A;  2Y0S G;  3MVV A;  2QEX A;  2WAQ B;  3WWV A;  5C3E H;  2E5L Q;  3HOX B;  2MFI A;  2LSS A;  5CV8 A;  2ZTD A;  1PTO B;  4AYB G;  4A75 A;  5I9P A;  1EYG A;  1IL8 A;  2F0K A;  2F0V A;  4JI2 Q;  1U5K A;  2BA0 A;  3AFQ A;  3BDO A;  2N8N A;  4JI5 L;  3JAM i;  3QR8 A;  3K81 C;  4MZ9 A;  3W1B A;  1R9T H;  4ZKB B;  4X6A H;  3EQL C;  3U9O A;  4ZQ3 A;  1RKN A;  2VXW A;  2HDL A;  2NVY H;  4DAV A;  5C4X G;  3CHB D;  1S5B D;  4X62 Q;  4Y7N B;  2ES2 A;  4L5R C;  2CFM A;  4NDX A;  3S17 B;  5FO9 B;  3G6J B;  2CWA A;  4YY3 L;  3ND8 A;  3CU7 A;  2R92 H;  1CI3 M;  2SDF A;  1PZK D;  1WCM B;  2F52 A;  5M5X H;  4HN7 A;  1KNA A;  1J6Q A;  2XTI A;  1SNO A;  4A3K G;  3F1Z A;  1V1O A;  5C3X A;  1CKO A;  3KF6 A;  2O4X A;  4CBV A;  4A3L H;  1BCP F;  2CHB D;  3OHX C;  2PNH A;  5JPM C;  2E2H H;  3KBX A;  2UXC L;  4LFB Q;  4KKS A;  1KRT A;  3NXW A;  4PQX A;  5C5L A;  1N34 L;  4QUC A;  3V2T A;  3H15 A;  1VMP A;  3S14 B;  1MIU A;  2ZJR A;  4QQB X;  4LF6 Q;  2CKZ B;  3C1F A;  3STB C;  3J7A 5;  4C3H B;  1TS4 A;  3KLS X;  1N36 Q;  1M90 C;  4XQQ A;  3SE0 A;  4KHP L;  1WFQ A;  2LXJ A;  1C7Y A;  3HRZ C;  3L9A X;  4JI8 Q;  4BXX G;  1X55 A;  5DAU A;  1B2T A;  3CKI B;  3CMA A;  2NVX H;  1K3B C;  2O2L D;  4JI7 L;  3S15 H;  3TBI B;  2FXQ A;  1H9K A;  3R2T A;  4LF9 Q;  3BVM A;  1K83 B;  4JOI A;  4BY7 H;  4FXG C;  3SR1 A;  3U50 C;  3M7G A;  1BXT A;  1MI2 A;  5DNF A;  4ZLT F;  3OW7 A;  4DA2 A;  3S1Q B;  1TY2 A;  3E9I A;  3CXC A;  3CP0 A;  5EKK A;  2WIN B;  2A68 C;  2OEO A;  3PV0 A;  2ICI A;  4XT1 B;  4C1N K;  1EEI D;  1FVI A;  4FYD A;  1QNK A;  3PIP A;  1YHQ A;  1JJC B;  2XVS A;  1JT8 A;  2IPK D;  1AZQ A;  1M1K C;  2G9H D;  5ELD A;  1IL2 A;  3MEF A;  2B8F A;  3SEB A;  4DR7 Q;  4CJ1 B;  1MBY A;  4KD4 A;  4XDX A;  1SAP A;  1B4O A;  5FJ8 G;  3FPU B;  4BBS B;  1HUN A;  3GTO H;  1I4X A;  3RUZ A;  4IFD G;  1GUW A;  3K59 A;  1OXT A;  3IFT A;  2MO0 A;  5I2X A;  3NK9 A;  4OL7 A;  1N8R C;  4J1M A;  2FFK B;  4JVZ A;  3CCJ A;  2KEN A;  5CV5 A;  1I4R A;  1IW7 C;  3STB D;  2LMC B;  4PMB A;  1NAP A;  2UXD L;  5CBE E;  1QVG A;  1BQQ T;  4DR6 Q;  4C3I B;  2F0I A;  2CW0 C;  3IFD A;  1EL0 A;  5HUR A;  1YI2 A;  1LT4 D;  3V96 A;  4ME3 A;  5E4W C;  2EIF A;  1EWC A;  1QIL A;  5ELC A;  2H4O A;  4ALP A;  4HCE A;  2F03 A;  5M3F G;  4LF7 Q;  2AWO A;  4YCU A;  2PQA A;  4G57 A;  1JWM D;  4DV0 Q;  3OW2 A;  1C48 A;  3GTM H;  2KCC A;  4BWG B;  1KAB A;  3HKZ E;  1B7Y B;  4JI4 L;  1K8G A;  4G7O C;  4UP7 A;  3I90 A;  1QWY A;  2EQS A;  5M5W B;  2A8V A;  1SRO A;  2FHT A;  3S1R H;  3J81 i;  3CCL A;  4GN5 A;  2A68 D;  5C0X H;  2C35 B;  1L0Y B;  1LAC A;  1KD1 C;  1YJ9 A;  4IN3 A;  4JCV E;  4UP9 A;  2JA6 H;  1EY9 A;  2PQA B;  5EBC A;  3PGZ A;  3I4M G;  4R4T A;  2K5N A;  2GVB A;  2JK8 A;  1WTV A;  1LUZ A;  1YNN C;  2OCE A;  5T1I A;  2KCT A;  1I4H A;  4P74 A;  1ILQ A;  1ENF A;  4A3F B;  1VQM A;  4P2C B;  4GLV B;  3HOW H;  5I4D A;  4RHR A;  1BBW A;  3G71 A;  1ZYR C;  4GKJ L;  4NPS A;  1SJE D;  4A3I B;  1G6P A;  3D4W A;  1WJJ A;  3JAM L;  4DXG A;  3L0O A;  4FDB A;  4HSP A;  2VW9 A;  2QDL A;  1EY5 A;  2A1A A;  1J8I A;  3A0J A;  4Y52 H;  2WAQ E;  1CTM A;  5DM7 3;  3ERQ A;  1ILP A;  4NB3 A;  5IYC G;  4A3E G;  3HOZ G;  2R7Z G;  3BYT B;  2OQ0 A;  3VYT A;  1T5X D;  1Y1V B;  2F4V L;  1JB3 A;  1E0B A;  2B2T C;  2Z9H A;  3G6E A;  1JC7 A;  4NXM Q;  5IYB H;  2BH2 A;  5IP9 H;  1G91 A;  4LAA A;  2F0N A;  4PMC A;  1K8O A;  1IBM L;  2JEB I;  4OEL B;  2K01 A;  4RH6 A;  3P1H A;  2F0M A;  3PO2 G;  4LUO A;  3F2D A;  1DCZ A;  3ERO A;  5FLM G;  1PH9 A;  1EQV A;  1R4Q B;  3KFU A;  2JA8 G;  1FNV A;  2AUK A;  1TII D;  1HNX Q;  3QOL A;  4NW2 A;  4DPG A;  5T1G A;  5M5X B;  1F2Y A;  1T5E A;  2PI2 A;  3I55 A;  2MUY A;  4RKB A;  2G9D A;  1YNN D;  4BY1 G;  4GNX A;  4DV5 L;  1S5D D;  4UY8 C;  1V43 A;  2FJ2 A;  5COR A;  5E1F A;  1EQT A;  2QEJ C;  2EPB A;  3F2U A;  2TSS A;  5M5Y B;  4EGV A;  2JEA I;  2NUC A;  4Q0F A;  3NP8 A;  3LNN A;  3EBE A;  4DK0 A;  5EPJ A;  5GAE C;  3M7N A;  1H9S A;  4DUY Q;  1WD0 A;  5GAD C;  1J9O A;  1D5X C;  2UXB Q;  1QZG A;  2X6G A;  1HNW L;  1M4V A;  3X3N A;  2E74 C;  1STG A;  1QE6 A;  1PRT F;  4AQY Q;  4DNR B;  3KJP A;  3VYU A;  2RDG A;  3S15 B;  3H0G G;  1CQV A;  1BF4 A;  1TR5 A;  1KQS A;  3ONA B;  3DWA A;  1NTG A;  3T13 A;  1GHK A;  2ID0 A;  4YWL A;  3K0X A;  4OIJ A;  1WTW A;  2K75 A;  4KY6 A;  1MJE A;  2EY2 A;  2AQ3 B;  2Q8I B;  4LW1 A;  4R1J A;  3FKI G;  1TWC B;  2WV6 D;  2KQ3 A;  4L8J A;  4N9T A;  1SN8 A;  1HNZ L;  1LT3 D;  1GKH A;  3H09 A;  4X64 Q;  5CV9 A;  2PW7 A;  5IYD H;  2RQX A;  5K36 H;  2AMC B;  5KGU A;  3RN5 A;  1QCB D;  1PFS A;  2RCF A;  4B08 A;  2EDG A;  3A5Z B;  1EOT A;  1GO3 E;  2VNU D;  2K1B A;  1B50 A;  3R3O A;  1X3E A;  2WB1 G;  3BU2 A;  4N9P A;  3GTO B;  1LTI D;  1PFM A;  5IGD A;  5M3M H;  3UE1 A;  2J4X A;  1LV9 A;  3NWS A;  4A3G B;  1QVC A;  5JVG 3;  1LM0 A;  1YEZ A;  4JBJ A;  1OXX K;  3A8I E;  4DR4 Q;  1IBK Q;  2K04 A;  4Y7N H;  4DK1 A;  2K03 A;  2M9V A;  3J81 L;  4HMI A;  2B2W A;  4IZ8 A;  3M4Y A;  1SYF A;  2XWB B;  4LF4 Q;  1XNR L;  3BVZ A;  4V19 0;  1WTR A;  2F3W A;  1S72 A;  1HXY D;  2A69 D;  4HSV A;  4AH6 A;  2AWN A;  2Q2I A;  1HR0 W;  3D31 A;  4DV1 Q;  3EJI A;  1HZA A;  2K28 A;  2PMZ E;  3OIP A;  2ICE C;  2QF7 A;  4ID6 A;  3QO2 A;  2HIX A;  3S14 H;  2OWO A;  2B2Y A;  2NVT H;  3C2P A;  3CC2 A;  4A3B G;  2PYK A;  1A2U A;  2JA9 A;  3EA6 A;  1KDA A;  1RJT A;  1EY8 A;  4JI6 Q;  4QL5 A;  3CC7 A;  4CDE C;  1MD2 D;  5FKA C;  2VUM B;  3VYS A;  3OTO L;  2VQF L;  1NSN S;  2OTJ A;  1MKH A;  1W3S A;  3MXU A;  4FVM A;  2J0T D;  2JA6 B;  2L5T A;  5IT9 E;  4HJ7 A;  1PRT C;  1MHW C;  2HD3 A;  4RGT A;  4ME5 A;  2MJ8 A;  4YHH Q;  5I6W A;  1LTR D;  1TVX A;  3BS1 A;  1PLF A;  2XNA C;  2IL8 A;  1PZI D;  1J5E L;  3GTP B;  2SEB D;  2F0D A;  3J7Y W;  4DV4 Q;  1SND A;  4B3T L;  2RVL A;  2BE5 C;  4CDC C;  3L3O C;  2L4N A;  3I4N H;  4K8I A;  5G3L D;  3E6Z X;  3J7Z C;  2K32 A;  3HOY G;  1B53 A;  1RTN A;  4LMQ D;  2EJG C;  2SNM A;  1RIP A;  1I4Q A;  1ONL A;  5EKI A;  1CKM A;  3J81 j;  2B39 A;  3LX0 A;  4L5Q A;  3T56 B;  1X3P A;  1VQA A;  4I7Z C;  4P71 A;  4IPD A;  3M4O H;  4J15 A;  4BBS H;  2MQH A;  2CVR A;  2F1M A;  1X54 A;  2XN9 C;  1K0S A;  1W6J A;  2EY1 A;  1GVP A;  3AQQ A;  4JI0 L;  2AKW B;  2YU9 H;  3DM1 A;  1LTA D;  3H6M A;  1YHB A;  1B3A A;  1VQP A;  3CRK C;  1WTO A;  4KTA A;  3HOU G;  1EFW A;  2LFN A;  4C3I H;  5C44 B;  2F0W A;  5LHY 1;  5BN3 A;  1VQJ A;  1WTH A;  4OWW B;  3D6W A;  5J3B A;  1UE1 A;  2JN4 A;  4HTH A;  4MTN A;  1PFB A;  2E76 C;  5C3E G;  3Q22 A;  1Y8N B;  1VQG A;  1GUT A;  4CDF C;  2CQA A;  2EXD A;  1AH9 A;  3M4P A;  1A63 A;  1I94 Q;  2I0Q A;  4WOR A;  1JJG A;  4JBM A;  1Y8O B;  1X9N A;  1JJ2 A;  5EBD A;  1EU3 A;  5J1Z A;  1X32 A;  1GJX A;  3AMU A;  5LMN L;  5JJK A;  1TS2 A;  2MP1 A;  1ICW A;  2BE5 D;  3K6O A;  5M5W H;  1IYV A;  2N55 A;  4RCN A;  1UWV A;  1EZ6 A;  2IX0 A;  1E24 A;  1YJN A;  5IT9 c;  2RSN A;  4UAI A;  3TEH B;  4YIJ A;  4B3S L;  2R92 G;  4FF3 A;  3VA7 A;  2ZXO A;  1K3R A;  1PYS B;  1IKL A;  1VQ9 A;  1UE6 A;  5BN4 A;  2RKS A;  4A3M G;  1KRS A;  2D2C C;  2BOS A;  3FHW A;  4C3J B;  4DV2 Q;  1SLJ A;  2HHH L;  4DR2 Q;  4A3L G;  1Q82 C;  1XMQ L;  2UUA L;  1PDQ A;  4H44 C;  4K5V A;  4IOC A;  1VQN A;  3UDX A;  4A3F H;  3S2H B;  3HEJ A;  2R7D A;  2BCO A;  1PRT B;  1B8A A;  1HA6 A;  4B3M Q;  4A3I H;  3GTG B;  3WDN A;  1KXL A;  1ET6 A;  2RBM A;  3IL8 A;  1CKN B;  1IKM A;  3P7J A;  4K8J A;  2UUC Q;  2DNC A;  1XPO A;  1Z9F A;  4JOI C;  4R8N A;  1ROD A;  5C6A A;  1Y1V H;  1NCV A;  4Q5V A;  4JI5 Q;  2A6H C;  1VQC A;  2JA7 H;  3A8J E;  3MXN A;  3W3A A;  3BZK A;  3MEH A;  4QGU A;  2IHF A;  2EZV A;  2MO1 A;  3HOV B;  5M3M B;  4H7B A;  1TS3 A;  1F9P A;  5DEH A;  4BY7 G;  4MN3 A;  1D6E C;  1YHA A;  3HFZ B;  1JOK A;  5DLQ E;  4JI1 L;  1V8Q A;  3PIO 3;  3W5O A;  1SYE A;  2ALY B;  1VQI A;  1Y8P B;  1FJG Q;  1HZC A;  2A73 B;  4XT3 B;  3K5L A;  1JB7 A;  3EFX D;  2E5L L;  5EPL A;  1B9N A;  4TVA B;  4POF A;  2KEC A;  2UXC Q;  3HG9 A;  2B63 H;  3BZD B;  3N52 A;  1VQO A;  1QJO A;  1O7Z A;  4DNT B;  3PO3 B;  1X65 A;  4JBK A;  4GLA C;  3UDF A;  3KBG A;  3NTH A;  3FDT A;  4X3S A;  4A93 G;  2NTS A;  1BBU A;  1VQK A;  2P5Z X;  1YBY A;  5GAG C;  5M5Y H;  5DM6 3;  2WFW A;  2IWH A;  1Y14 B;  4KHP Q;  2NVT B;  3HS0 C;  3KOJ A;  1A3V A;  1M8A A;  1XMO L;  1SYD A;  1TS5 A;  1Q8I A;  5IP7 H;  4JI7 Q;  1RD9 D;  3KF6 B;  3DWP A;  2L9H A;  3QB3 A;  3D0F A;  3NQI A;  1EWI A;  4GS3 A;  1GUO A;  1KHI A;  2J7Z A;  1STA A;  4UP8 A;  1VS0 A;  2AUJ D;  4V0B A;  2A6H D;  3T1H Q;  4WJ3 M;  1ZEQ X;  2F0H A;  2O5I C;  1SRU A;  3J80 E;  1Q90 A;  3TRZ A;  2WAC A;  2HDM A;  3GTK B;  4QB4 A;  2V1C C;  1A0I A;  1STN A;  2ZM6 L;  4K6D A;  1WTP A;  3Q8D A;  2Z4H A;  3W2D A;  1Q46 A;  1A3T A;  1N36 L;  3Q6S A;  1KDB A;  4K2K A;  4PV1 C;  1KAW A;  5ISR A;  3I4N B;  1U0L A;  1TWC H;  5C0X J;  4DR3 L;  5C0X G;  4EVO A;  3AEV A;  3ULL A;  2DJG C;  4JI8 L;  3GO5 A;  1BNZ A;  4DV3 L;  1UEA B;  2OTL A;  4U67 3;  1XYI A;  1SDF A;  5I9O A;  2E2D C;  1OXS C;  4Z9C B;  3K7U C;  3GQB A;  5HY6 A;  3OYY A;  4KKT A;  1PH6 A;  3PF4 A;  3K57 A;  3M4O B;  5KYI A;  5EQ0 A;  1SXT A;  3HOW G;  3NUC A;  4LF5 L;  1A8V A;  3O13 A;  1K73 C;  2LY7 A;  3S9W A;  3D4D A;  2YU9 B;  3DEO A;  5CV4 A;  4LFA Q;  2HT1 A;  4A3G H;  2UU9 L;  1HTL D;  2UXD Q;  4MIU A;  1P16 A;  1JIC A;  4N8F A;  3GTQ H;  4F7X A;  2DNE A;  4LUZ A;  4IUN A;  4ZYS A;  4XQJ A;  3H3V H;  4A4I A;  2VQE L;  2EYM A;  4HMJ A;  4FF2 A;  5KNC A;  4A3K H;  1IBL L;  4HIM A;  2ZXR A;  5FO7 B;  1SFO B;  1PYB A;  3CC4 A;  2CCZ A;  1CK1 A;  3LGJ A;  4UHV A;  5TSS A;  4OIK A;  1VQB A;  4GN4 B;  5BR8 Q;  1TT2 A;  1VCI A;  3I73 A;  3N6R A;  3GTL B;  1UAP A;  3DM3 A;  1SE3 A;  3I4O A;  5IP9 G;  2LKV A;  4JI4 Q;  2PQE A;  1O7I A;  1BCP C;  2K6A A;  3K0Y A;  4RHS A;  3RLF A;  2KBN A;  1ASY A;  4K5W A;  4BBR B;  4NKL A;  3UDG A;  4ZAI A;  1HZB A;  2RF4 A;  4GNX C;  1C9O A;  5J39 A;  1O7L A;  3E3X A;  1CHP D;  3VR5 A;  5GQO A;  2VUM H;  2KOL A;  2H5X A;  1KNE A;  4LFC L;  5CBA E;  3G7L A;  1ENC A;  5IGF A;  2I5M X;  2D0P A;  1UE5 A;  3PUW A;  3R2I A;  3RLN A;  5FLX L;  4L63 B;  4G4K A;  1DD2 A;  1RL2 A;  1Z7T A;  3KYH C;  1XTC D;  3J80 c;  1Y69 U;  4LF7 L;  2F3I A;  4GKJ Q;  1YIT A;  4DV0 L;  2D5D A;  2IW3 A;  4UDU C;  1EYD A;  5KYL A;  3QOJ A;  3Q23 A;  1QNU A;  3A74 A;  4HCS A;  3GTP H;  2PZT A;  1B9M A;  4G7H C;  1HQM C;  3D4R A;  3NTK A;  4WRD A;  4F87 A;  3OWE B;  3JC6 6;  2F0G A;  1UNS A;  1UEB A;  4DR5 Q;  4YWM A;  4OO1 H;  3BJU A;  3TN2 A;  3HKZ G;  2VZA A;  2F4V Q;  4B9X A;  1IW7 D;  2DGY A;  4ZKC B;  3U58 A;  1PH7 A;  2D9U A;  5H1S E;  5IGC A;  2CW0 D;  2R93 B;  4KJO A;  4NXN L;  4E6I A;  5L37 A;  4MNO A;  1MGS A;  2JE6 I;  4DV7 Q;  2K05 A;  1Y1W G;  1IBM Q;  3K5N A;  2OT2 A;  2JA7 B;  3Q24 A;  2L1B A;  2PCF B;  3AU7 A;  3H3V C;  4YWK A;  4LJZ C;  2OXP A;  1L0X B;  3H3V I;  1G2S A;  4QIW B;  3FMC A;  1C8C A;  5IGB A;  5A2Q L;  1PZJ D;  2IHE A;  1F77 A;  3GD7 A;  4OGQ C;  1YVC A;  2JA5 G;  2EYP A;  2D0O A;  2L15 A;  5IYD G;  5C44 H;  5M3F H;  2XGT A;  4CKB A;  4R9W A;  1AZP A;  4DV5 Q;  1IYU A;  4H13 C;  1Z47 A;  3SDZ A;  2WAQ G;  3BYY B;  3HOX G;  4JYA Q;  4DUZ Q;  4R4I A;  2B63 B;  4O42 A;  4KN7 C;  1WI5 A;  4OWT B;  2K5H A;  3ICE A;  1CSP A;  2NZ1 D;  4XYO A;  1LT6 D;  2XSC A;  2B2W C;  5D14 A;  4B3R L;  3LWE A;  2F0T A;  4OX9 L;  2XWJ B;  1EWH A;  2KEE A;  2AQ2 B;  1ZYR D;  2QIL A;  5IIF A;  2KVM A;  1UUP A;  1AN8 A;  3I4M H;  1BCP B;  3TQY A;  2PW5 A;  3Q0A A;  1HNW Q;  4XTC S;  1G6Z A;  4DN4 M;  2E2J H;  3K58 A;  4DAP A;  4TKO B;  3UE0 A;  2B2Y C;  2QW7 A;  1WCM G;  2V4D A;  4GNX B;  4L5T A;  3VR4 A;  4DK3 C;  2VB2 X;  2MHV A;  3M3Y B;  5C4J B;  4C3J H;  1RHP A;  1F2L A;  2K7V A;  5E4X A;  4JV5 Q;  1CZW A;  2NN6 H;  3DWQ A;  1K0R A;  2F0S A;  3NSW A;  5GRO A;  3MFY A;  3GV3 A;  3T53 B;  3S2H H;  5FOB B;  4OO1 I;  3C1E A;  1CA6 A;  4PZ7 A;  3JAM E;  3NE5 B;  1HNZ Q;  4PG3 A;  1JE5 A;  3GTG H;  4K5X A;  1H9S B;  2PPB C;  4A3D B;  2B2V A;  3A54 A;  3ZJY C;  4C3H G;  2R7Z H;  4O0A A;  1TWG H;  2AQ1 B;  2Y0S B;  4IFD I;  1WD1 A;  1PH5 A;  2C9O A;  4X3U A;  3K8A A;  3VA5 A;  4AYB B;  1XTD A;  4KV6 A;  4GOP C;  1L2F A;  3K5O A;  4JG2 A;  2IX3 A;  3C46 A;  4GZY C;  3NEM A;  2K50 A;  4RGN A;  1TWH B;  1U9R A;  1GHJ A;  2KCN A;  4TRD A;  3HOV H;  5C4X B;  1PTO F;  2JA8 H;  2K52 A;  4WFN 3;  4A3C G;  3GTQ B;  4A3J G;  2EY6 A;  4JW0 A;  4C2M B;  3P20 A;  1Q8K A;  4CKE A;  1PH8 A;  1GOZ A;  3U4Z A;  3I4L A;  4X64 L;  3TDQ A;  4A3K B;  1YJW A;  1XNR Q;  2GVA A;  3KLS A;  3VR6 A;  5IOC A;  3T4A C;  1KIX A;  2PNR C;  2Z6K C;  3TRE A;  3P75 A;  1LTT D;  3FVQ A;  3U9S A;  3FPP A;  1NR4 A;  3CCV A;  4BBS G;  3SK8 A;  5IWA Q;  5FO8 B;  3PO3 H;  1SMY C;  2SOB A;  3G48 A;  1PFN A;  2Q8R E;  4J6H A;  4TSS A;  3VYR A;  3URY A;  2I46 A;  4FO2 A;  3ER0 A;  2NBF A;  3BVG A;  3E5S A;  2BDO A;  3OTO Q;  4X65 Q;  1JR0 D;  3QIA A;  3SK5 A;  1LAB A;  3PUY A;  2FIN B;  4LF8 Q;  2CH4 W;  3MTS A;  4C3I G;  1N32 L;  3H0G H;  1VDZ A;  2HCI A;  1C0A A;  3DEP A;  2YTY A;  2IT1 A;  2RDH A;  2NN6 I;  3GP7 A;  4KHZ A;  3KF8 A;  1B70 B;  1XNQ L;  1J5E Q;  1V9P A;  4CGY B;  3CPW A;  3FEW X;  4X3T A;  3JAM c;  4ZRZ A;  4B3T Q;  4BA2 I;  3FKI H;  1Q1E A;  3GTK H;  4HJ8 A;  1Q86 C;  4HIK A;  3HGB A;  1S4Z A;  2NZO A;  1NMF A;  4DXF A;  1U4M A;  2MGS A;  4JK1 C;  1VF7 A;  4GOP A;  1HCZ A;  1QVF A;  1D5M C;  1EUJ A;  3SVM A;  2IY5 B;  5CR3 A;  3KF8 B;  4RKL A;  5EPK A;  1F9S A;  5AFW A;  3OSO A;  1CHQ D;  5KNB A;  1HUM A;  3S1N B;  1SJH D;  3CD6 A;  3T51 B;  2I07 B;  4GKK L;  3S24 A;  4LUV A;  4YHH L;  4X66 Q;  1VQF A;  3SXH A;  4IUU A;  4QIW E;  4JI0 Q;  3TP7 A;  1EY6 A;  4WJW A;  1E2V A;  1JWU D;  5ELF A;  2LS0 1;  1DJR D;  2ATW A;  4A3F G;  4GOP B;  3MAQ A;  3TS0 A;  4PNY A;  2KHS A;  1SMY D;  4A3I G;  2QGQ A;  4DV6 Q;  2HQL A;  1YNX A;  2EYH A;  1PMR A;  3RZD H;  2B3G A;  5CYU A;  4HID A;  2F0Q A;  3WOE A;  1HH2 P;  2B8G A;  2Z6K A;  4MTK A;  4DKA C;  3J81 E;  3K5M A;  2L0C A;  1G8Z D;  4XIG S;  2F0P A;  1RDP D;  1SFO H;  5AJ3 Q;  1TWF B;  2EY5 A;  5M3F B;  1EY7 A;  4CJ0 B;  1NBW A;  4IJH A;  4PZ8 A;  2PZW A;  2FMC A;  1Y1V G;  4R4C A;  5IGE A;  4U68 A;  2YYZ A;  4L5S A;  2ZTE A;  4X3K A;  1LTB D;  3CQZ H;  5I2Y A;  1SNC A;  3GTL H;  1PRT D;  2UUB L;  3KDF A;  4N8X 1;  1EZ8 A;  1VQL A;  1VQ7 A;  1SR3 A;  1NUC A;  4GLX A;  2K14 A;  4KY5 A;  5IGG A;  3M9B A;  5LMN Q;  2YV5 A;  1WTQ A;  2EXZ A;  3KJO A;  2B29 A;  2B2U A;  3BDC A;  5COY A;  4DGZ A;  1N33 Q;  2A5H A;  1SYB A;  4BA1 I;  2PI2 E;  4BBR H;  1FGU A;  1R4P B;  1WYD A;  1PV4 A;  4RAU C;  4DR1 L;  2Z6B A;  4B3S Q;  3RZO H;  1DGS A;  4KN4 C;  3T1Y L;  3I4M B;  1SYG A;  4HJA A;  1QZH A;  1HQR D;  2Q2T A;  1AE3 A;  1KL9 A;  1N9W A;  2E2J B;  1CSQ A;  4DNI A;  2XRS D;  3MWY W;  4I7A A;  2HHH Q;  4FF1 A;  1I4G A;  5JEA H;  1XMQ Q;  2I5L X;  3FRP B;  4IQZ A;  2UUA Q;  1CM9 A;  3OIQ A;  3RNU A;  1VQE A;  1BR9 A;  1PXU A;  1QOH A;  1I94 L;  3CCU A;  2K5Q A;  4L6T B;  1PHJ A;  1A62 A;  1AEX A;  1HJP A;  5CGK A;  3GDE A;  4K0K L;  3OPO A;  4B9W A;  3K80 C;  2RA4 A;  1BBX C;  2Y0S E;  3HOY H;  4TQU S;  1NR2 A;  1D2B A;  3CPF A;  5ELO A;  5LMU L;  1O78 A;  4AYB E;  1GUG A;  2TMP A;  1EY0 A;  3UI2 A;  2FMM A;  4A3E B;  3HOZ B;  2R7Z B;  2M00 A;  2DY8 A;  1K8M A;  1TWG B;  2E75 C;  2JQO A;  5IP7 G;  2RSO A;  1X56 A;  3MXG A;  3NBI A;  1HR0 L;  1OO9 B;  3BZC A;  2R93 H;  4RCO A;  4DV2 L;  1L1O A;  2DUD A;  2CWP A;  4DR2 L;  1II3 A;  1VQ4 A;  3PO2 B;  3I8Z A;  5GAH C;  5ELE A;  1X3F A;  4JI3 L;  4RGM A;  1GM5 A;  4JC0 A;  3DXJ C;  4PZ6 A;  1SEB D;  3K7A B;  4B3M L;  4JI1 Q;  2Z8L A;  1XJV A;  3J81 c;  1H95 A;  3PUZ A;  2JA8 B;  1NY4 A;  3PIP 3;  4YY3 Q;  1LYL A;  5KRU A;  5CC4 A;  1A2T A;  3SK4 A;  4CJ2 C;  2ZJP A;  2JSO A;  1T9H A;  1I50 H;  4NP5 A;  4ULL A;  1HRJ A;  2A6E C;  4R4Q A;  2PZU A;  3RN2 A;  3MXN B;  4BY1 B;  1Q81 C;  1U4P A;  5NUC A;  4DFA A;  2N3S A;  1DXM A;  1G29 1;  5KIX A;  3QJY A;  4EX5 A;  4JI2 L;  1B3Q A;  4YCV A;  2HIV A;  1N34 Q;  4YCW A;  4QCL A;  5ELN A;  4C1N I;  3KLR A;  2HCC A;  2XIW A;  4A3G G;  1XMO Q;  3TP5 A;  1P8L A;  1RCV D;  5D65 A;  3CCQ A;  1F9Q A;  3H91 A;  4X62 L;  1WTX A;  1ZKO A;  4KK7 A;  2EVB A;  2KHI A;  3D6C A;  3C3L A;  1ZXT A;  4A3M H;  1U4L A;  3OOC A;  4GN3 B;  1JOO A;  1FJG L;  4RWS C;  2F3V A;  2Z4I A;  3H0G B;  1CA5 A;  2X6L A;  4KD3 A;  4KJN A;  3M3Y H;  5C4J H;  1V1P A;  2F0L A; 
#chains in the Genus database with same CATH homology
 4I65 A;  1O7Y A;  1ET9 A;  3A7L A;  1HA5 A;  1TWA B;  3R93 A;  2JXM B;  1B1Z A;  3FKI B;  1B44 D;  1KLU D;  1S5F D;  3I91 A;  3NTI A;  1JE4 A;  3KK7 A;  3J7A F;  1RTO A;  3VR2 A;  2ZXP A;  3MFG A;  4ZK9 B;  1V1P B;  3S1M B;  3A8K E;  4PMW A;  1S5E D;  1SE2 A;  2WB1 B;  4HAE A;  1GUS A;  1EYA A;  2A6E D;  3OWF A;  5HGT A;  2L12 A;  3OMG A;  2F0U A;  3A56 A;  4KHV A;  4IUP A;  1DOK A;  3A7A B;  4A3J B;  3ITP A;  4HR7 B;  4QUF A;  3I3C A;  2EYF A;  3WOF A;  1LLR D;  3D8G A;  2ENB A;  5LL6 S;  4OO1 G;  3RZD B;  3KUP A;  4ABN A;  1HPC A;  1JOQ A;  4QMG A;  4OHJ A;  1LT5 D;  2O5J C;  2L55 A;  3HZX A;  3MHB A;  2F0O A;  1C4Q A;  4IFD J;  3LWU A;  3TZU A;  3CQZ B;  2F0J A;  3I70 A;  4C56 C;  1D5Z C;  1PYW D;  2OF1 A;  1BOS A;  1GXD C;  4A3B B;  2EYL A;  3TSS A;  1SNQ A;  2F0F A;  3RZO B;  1E2W A;  5D3I B;  3TP6 A;  3ND9 A;  4DU9 A;  3IKJ A;  1VMC A;  2R3Z A;  5CMD A;  4M8A A;  1JOR A;  3E0J A;  1CZG A;  1U4R A;  3I72 A;  4FXK C;  2PMZ B;  3HOY B;  4IAL A;  2KED A;  3AB9 A;  2KA7 A;  3GV6 A;  4EQN A;  1QG7 A;  5ELB A;  3NWT A;  3TZD A;  3V05 A;  2NYZ D;  2B2V C;  5KND A;  1H9M A;  4C3J G;  4IFD H;  2R61 A;  2KUM A;  2NN6 G;  1FNU A;  1BUV T;  4G7Z C;  2PO4 A;  2K5D A;  3J7A V;  1D1K A;  1BCP D;  4H0L C;  5JOB A;  3HOU B;  4ZUI A;  4NMZ A;  1XXG A;  1TY0 A;  5C3E B;  2IX1 A;  4S3S A;  1I50 B;  1AW7 A;  5K36 G;  1Z6H A;  1I4P A;  1BO0 A;  5IOD A;  4FXD A;  2Q8T A;  5JJZ A;  5J22 A;  1SNM A;  5EJW A;  1R9T B;  1HFN A;  4IUT A;  3VR3 A;  5G3L F;  1A6X A;  2NVY B;  4BS9 A;  1WVL A;  1CT1 D;  1F2M A;  1RF2 D;  1DOL A;  4O1N A;  2BA1 A;  1XWE A;  2R92 B;  2DY7 A;  1Q1B A;  4XYQ A;  5K5P A;  1HFG A;  4K2L A;  2QCP X;  4J8Q A;  4A3M B;  3QG1 A;  5FLX E;  4FNF A;  2E2H B;  1JCK B;  1F2Z A;  5CV6 A;  5BN5 A;  5C0X I;  4M1U B;  1FR3 A;  3MXP A;  1W6K A;  1I6H B;  1VF5 C;  2MPM A;  1XX8 A;  1SSO A;  3A55 A;  1SBB B;  2N88 A;  2WKC A;  4F88 A;  2DN8 A;  2K33 A;  1H9J A;  2Z1C A;  2NVX B;  3NQT A;  3RMH A;  5IT9 L;  4KI0 A;  1DON A;  2A69 C;  3IAY A;  3MC0 B;  1F9R A;  1DOM A;  1LTS D;  1I3Q B;  2L11 A;  1HTP A;  5E3F A;  4EQP A;  4BY7 B;  1A15 A;  1STH A;  2B2T A;  4XQN A;  5A2Q E;  1DZ1 A;  1KAA A;  4FF4 A;  5FK9 C;  3MZ5 A;  2EE1 A;  5M9O A;  4IUR A;  1PTO H;  1EIH A;  2A74 C;  1SE4 A;  2C5C A;  2EOT A;  4A93 B;  4ZUJ A;  1IHZ A;  4JBW A;  2WII B;  3L7Z C;  3X3M A;  4R8I A;  5I6Y A;  2WP8 J;  1HHV A;  4CKC A;  1O80 A;  2R6G A;  3EVQ A;  2M2L A;  1JWS D;  1EU4 A;  3QWN A;  3T16 A;  2ZT9 C;  5EGT A;  4K14 A;  1STY A;  1GUN A;  3OMC A;  2B2U C;  1S5C D;  1FGB D;  1YNJ C;  2D62 A;  2GA4 B;  2K5W A;  3PMF A;  1X3Q A;  3GTM B;  1CQF A;  2KJX A;  3NPP A;  4MHE A;  1QB5 D;  3SHL A;  3DHQ A;  4K6L A;  1FYC A;  3S1R B;  5C4Z A;  3ZYY X;  2NVQ B;  2NWG A;  1KDC A;  2JP1 A;  1LTG D;  4RGO S;  1A3U A;  1EIG A;  1EYC A;  1TKW B;  1ESF A;  1Q3L A;  4IUV A;  5C5M A;  1MSG A;  4ODG A;  4DF7 A;  5JEA J;  3TP8 A;  3R8B A;  5JEA G;  5EKL A;  3NBH A;  3H94 A;  3HOW B;  1STE A;  2H1E A;  4RFB A;  1Q12 A;  3MA2 B;  3D3R A;  1SYC A;  4XXE A;  4HED A;  1OXU A;  1PTO C;  2EYO A;  2EYJ A;  5C4H A;  1ENA A;  1BDO A;  5A35 A;  3PUV A;  2NTT A;  1FNW A;  5KEE A;  1YNJ D;  2HQE A;  4EQO A;  4F8M A;  2RDF A;  2QDB A;  4RA8 A;  4CHT B;  5LL6 X;  3HP3 A;  1ESR A;  1H9R A;  3DMU A;  3PUX A;  3BDL A;  1DM0 B;  1EFI D;  5JVH 3;  5D3D A;  3M85 A;  1G2T A;  1KLG D;  4KMU C;  4IUQ A;  2EJM A;  3BG3 A;  2BDN A;  2SNS A;  1DYQ A;  5JAV A;  1MSH A;  1CFM A;  1I6V C;  1OXV A;  1TQO A;  4ILW A;  1FD7 D;  4KKU A;  5JPN C;  4FP5 D;  5CV7 A;  4DAY A;  3HKZ B;  3SK6 A;  3CRL C;  2VB3 X;  2JYO A;  1STB A;  1PTO D;  4QF4 A;  3S16 B;  1KTK A;  1EEF D;  3NHH A;  3S2D B;  1Y1W B;  2HUG A;  2XRQ D;  1E2Z A;  1EY4 A;  3RD4 A;  1AP0 A;  2E2I B;  2QKI C;  3DUZ A;  1D1I A;  3J80 L;  2NB0 A;  5C3W A;  3TME A;  1LO5 D;  2F0E A;  1SNP A;  2F4I A;  1AFP A;  1JQY D;  1ML0 D;  2JA5 B;  4LK1 C;  5F2D A;  2X69 A;  3GTJ B;  2WKD A;  1TU2 B;  4KY7 A;  2EJF C;  2IJ0 A;  3MVV A;  2WAQ B;  3HOX B;  5CV8 A;  1PTO B;  5I9P A;  1IL8 A;  2F0K A;  2F0V A;  2BA0 A;  3BDO A;  4ZKB B;  3EQL C;  3U9O A;  4ZQ3 A;  1RKN A;  2VXW A;  2HDL A;  4DAV A;  3CHB D;  1S5B D;  4Y7N B;  4NDX A;  3S17 B;  5FO9 B;  3G6J B;  3ND8 A;  3CU7 A;  1CI3 M;  2SDF A;  1PZK D;  1WCM B;  4HN7 A;  1KNA A;  1SNO A;  1V1O A;  5C3X A;  2O4X A;  4CBV A;  1BCP F;  2CHB D;  3OHX C;  5JPM C;  3KBX A;  4KKS A;  3NXW A;  4PQX A;  5C5L A;  4QUC A;  3V2T A;  1VMP A;  3S14 B;  3C1F A;  4C3H B;  1TS4 A;  3KLS X;  4XQQ A;  3SE0 A;  3HRZ C;  3L9A X;  5DAU A;  1B2T A;  3CKI B;  2O2L D;  3TBI B;  1H9K A;  3R2T A;  3BVM A;  1K83 B;  4FXG C;  3SR1 A;  3M7G A;  4ZLT F;  1BXT A;  1MI2 A;  5DNF A;  3OW7 A;  4DA2 A;  3S1Q B;  1TY2 A;  5EKK A;  2WIN B;  2A68 C;  2OEO A;  3PV0 A;  2ICI A;  4XT1 B;  4C1N K;  1EEI D;  4FYD A;  1QNK A;  2XVS A;  2IPK D;  1AZQ A;  2G9H D;  5ELD A;  2B8F A;  3SEB A;  4CJ1 B;  1MBY A;  4KD4 A;  4XDX A;  1SAP A;  1B4O A;  3FPU B;  4BBS B;  1HUN A;  1I4X A;  3RUZ A;  4IFD G;  1GUW A;  3K59 A;  1OXT A;  3IFT A;  5I2X A;  3NK9 A;  4OL7 A;  4J1M A;  2FFK B;  5CV5 A;  1I4R A;  1IW7 C;  2LMC B;  4PMB A;  1NAP A;  5CBE E;  1BQQ T;  4C3I B;  2F0I A;  2CW0 C;  3IFD A;  1EL0 A;  5HUR A;  1LT4 D;  3V96 A;  5E4W C;  1EWC A;  1QIL A;  5ELC A;  2H4O A;  2F03 A;  4HCE A;  2AWO A;  4G57 A;  1JWM D;  1C48 A;  2KCC A;  4BWG B;  1KAB A;  4G7O C;  3I90 A;  1QWY A;  5M5W B;  2FHT A;  2A68 D;  5C0X H;  1L0Y B;  1LAC A;  4IN3 A;  1EY9 A;  5EBC A;  1WTV A;  1YNN C;  5T1I A;  1I4H A;  4A3F B;  1ILQ A;  1ENF A;  4P2C B;  5I4D A;  4RHR A;  1ZYR C;  1SJE D;  4A3I B;  3D4W A;  3JAM L;  4DXG A;  4HSP A;  1EY5 A;  1J8I A;  1CTM A;  5DM7 3;  3ERQ A;  1ILP A;  3BYT B;  3VYT A;  1T5X D;  1Y1V B;  1JB3 A;  1E0B A;  2B2T C;  1JC7 A;  1G91 A;  4LAA A;  2F0N A;  4PMC A;  1K8O A;  2JEB I;  2K01 A;  4RH6 A;  3P1H A;  2F0M A;  1DCZ A;  3ERO A;  1EQV A;  1R4Q B;  1FNV A;  2AUK A;  1TII D;  3QOL A;  4NW2 A;  5M5X B;  5T1G A;  1F2Y A;  1T5E A;  2MUY A;  4RKB A;  2G9D A;  1YNN D;  1S5D D;  1V43 A;  2FJ2 A;  5COR A;  5E1F A;  1EQT A;  2QEJ C;  2EPB A;  3F2U A;  2TSS A;  5M5Y B;  4EGV A;  2JEA I;  2NUC A;  4Q0F A;  3NP8 A;  3LNN A;  4DK0 A;  5EPJ A;  3M7N A;  1H9S A;  1WD0 A;  1J9O A;  1D5X C;  2X6G A;  1M4V A;  3X3N A;  2E74 C;  1STG A;  1QE6 A;  1PRT F;  4DNR B;  3VYU A;  2RDG A;  3S15 B;  1CQV A;  1BF4 A;  1TR5 A;  3ONA B;  3DWA A;  3T13 A;  1GHK A;  2ID0 A;  1WTW A;  4OIJ A;  4KY6 A;  2EY2 A;  2AQ3 B;  2Q8I B;  1TWC B;  2WV6 D;  2KQ3 A;  4L8J A;  4N9T A;  1LT3 D;  3H09 A;  5CV9 A;  2PW7 A;  2RQX A;  5K36 H;  5KGU A;  1QCB D;  4B08 A;  2EDG A;  1EOT A;  2VNU D;  1B50 A;  2K1B A;  3R3O A;  4N9P A;  3GTO B;  1LTI D;  1PFM A;  5IGD A;  2J4X A;  1LV9 A;  3NWS A;  4A3G B;  5JVG 3;  1OXX K;  3A8I E;  2K04 A;  4DK1 A;  2K03 A;  2M9V A;  3J81 L;  4HMI A;  2B2W A;  4IZ8 A;  3M4Y A;  1SYF A;  2XWB B;  3BVZ A;  4V19 0;  1WTR A;  2F3W A;  1HXY D;  2A69 D;  4HSV A;  2AWN A;  3D31 A;  3EJI A;  2K28 A;  3OIP A;  2ICE C;  2QF7 A;  4ID6 A;  3QO2 A;  2B2Y A;  3C2P A;  2PYK A;  1A2U A;  3EA6 A;  1KDA A;  1RJT A;  1EY8 A;  2VUM B;  1MD2 D;  5FKA C;  3VYS A;  1NSN S;  3MXU A;  4FVM A;  2J0T D;  2JA6 B;  2L5T A;  5IT9 E;  1PRT C;  4RGT A;  4ME5 A;  2MJ8 A;  5I6W A;  1LTR D;  1TVX A;  3BS1 A;  1PLF A;  2XNA C;  2IL8 A;  1PZI D;  3GTP B;  2SEB D;  2F0D A;  3J7Y W;  1SND A;  2RVL A;  2BE5 C;  3L3O C;  2L4N A;  4K8I A;  5G3L D;  3E6Z X;  2K32 A;  1B53 A;  1RTN A;  4LMQ D;  2EJG C;  2SNM A;  1I4Q A;  1ONL A;  5EKI A;  2B39 A;  3LX0 A;  3T56 B;  1X3P A;  4I7Z C;  2CVR A;  2F1M A;  2XN9 C;  1W6J A;  2EY1 A;  3DM1 A;  1LTA D;  3H6M A;  1B3A A;  3CRK C;  1WTO A;  4KTA A;  2LFN A;  5C44 B;  2F0W A;  5LHY 1;  5BN3 A;  3D6W A;  4HTH A;  1PFB A;  2E76 C;  3Q22 A;  1Y8N B;  1GUT A;  2CQA A;  4WOR A;  1Y8O B;  5EBD A;  1EU3 A;  5J1Z A;  1X32 A;  1GJX A;  3AMU A;  1TS2 A;  2MP1 A;  1ICW A;  2BE5 D;  3K6O A;  1IYV A;  2N55 A;  4RCN A;  1EZ6 A;  2IX0 A;  2RSN A;  4UAI A;  4YIJ A;  4FF3 A;  3VA7 A;  2ZXO A;  1IKL A;  5BN4 A;  2RKS A;  2D2C C;  4C3J B;  2BOS A;  1PDQ A;  4H44 C;  4K5V A;  3S2H B;  3HEJ A;  2BCO A;  1PRT B;  1HA6 A;  3GTG B;  3WDN A;  1ET6 A;  2RBM A;  3IL8 A;  1IKM A;  3P7J A;  4K8J A;  2DNC A;  4R8N A;  1ROD A;  5C6A A;  1NCV A;  4Q5V A;  2A6H C;  3A8J E;  3MXN A;  3W3A A;  3MEH A;  2EZV A;  3HOV B;  5M3M B;  4H7B A;  1TS3 A;  1F9P A;  5DEH A;  4MN3 A;  1D6E C;  1JOK A;  1V8Q A;  3PIO 3;  1SYE A;  1Y8P B;  4XT3 B;  2A73 B;  3K5L A;  3EFX D;  5EPL A;  1B9N A;  2KEC A;  3HG9 A;  3BZD B;  3N52 A;  1QJO A;  1O7Z A;  4DNT B;  3PO3 B;  3KBG A;  3NTH A;  3FDT A;  4X3S A;  2NTS A;  5DM6 3;  2IWH A;  2NVT B;  3HS0 C;  1A3V A;  1M8A A;  1SYD A;  1TS5 A;  1Q8I A;  1RD9 D;  3DWP A;  2L9H A;  3QB3 A;  3NQI A;  1GUO A;  2J7Z A;  1STA A;  2AUJ D;  4V0B A;  2A6H D;  1ZEQ X;  2F0H A;  2O5I C;  3J80 E;  1Q90 A;  2WAC A;  2HDM A;  3GTK B;  4QB4 A;  1STN A;  4K6D A;  1WTP A;  2Z4H A;  3W2D A;  1A3T A;  3Q6S A;  1KDB A;  4K2K A;  4PV1 C;  5ISR A;  3I4N B;  5C0X J;  5C0X G;  4EVO A;  3GO5 A;  1BNZ A;  1UEA B;  4U67 3;  1XYI A;  1SDF A;  5I9O A;  2E2D C;  1OXS C;  4Z9C B;  3GQB A;  4KKT A;  3K57 A;  3M4O B;  5KYI A;  5EQ0 A;  1SXT A;  3NUC A;  3O13 A;  2LY7 A;  3S9W A;  3D4D A;  2YU9 B;  3DEO A;  5CV4 A;  1HTL D;  4MIU A;  1JIC A;  4F7X A;  2DNE A;  4IUN A;  4ZYS A;  4XQJ A;  2EYM A;  4HMJ A;  4FF2 A;  5KNC A;  2ZXR A;  5FO7 B;  1SFO B;  1CK1 A;  5TSS A;  4OIK A;  1TT2 A;  1VCI A;  3I73 A;  3N6R A;  3GTL B;  1UAP A;  1SE3 A;  2LKV A;  2PQE A;  1BCP C;  2K6A A;  3K0Y A;  4RHS A;  3RLF A;  4K5W A;  4BBR B;  4NKL A;  4ZAI A;  5J39 A;  1O7L A;  3VR5 A;  1CHP D;  2KOL A;  1KNE A;  5CBA E;  3G7L A;  1ENC A;  5IGF A;  3PUW A;  5FLX L;  3R2I A;  4L63 B;  4G4K A;  1DD2 A;  1Z7T A;  1Y69 U;  1XTC D;  2D5D A;  2IW3 A;  4UDU C;  1EYD A;  5KYL A;  3QOJ A;  3Q23 A;  1QNU A;  4HCS A;  2PZT A;  1B9M A;  4G7H C;  1HQM C;  3D4R A;  3NTK A;  4WRD A;  4F87 A;  3OWE B;  2F0G A;  1UNS A;  4OO1 H;  3TN2 A;  4B9X A;  1IW7 D;  4ZKC B;  2D9U A;  5IGC A;  2CW0 D;  2R93 B;  4KJO A;  4E6I A;  1MGS A;  2JE6 I;  2K05 A;  3K5N A;  2OT2 A;  2JA7 B;  3Q24 A;  2L1B A;  2PCF B;  3AU7 A;  3H3V C;  4LJZ C;  2OXP A;  1L0X B;  1G2S A;  4QIW B;  3FMC A;  1C8C A;  5IGB A;  5A2Q L;  1PZJ D;  1F77 A;  3GD7 A;  4OGQ C;  2EYP A;  4CKB A;  4R9W A;  1AZP A;  1IYU A;  4H13 C;  1Z47 A;  3SDZ A;  3BYY B;  2B63 B;  4O42 A;  4KN7 C;  2NZ1 D;  4XYO A;  1LT6 D;  2XSC A;  2B2W C;  5D14 A;  3LWE A;  2F0T A;  2XWJ B;  1EWH A;  2KEE A;  2AQ2 B;  1ZYR D;  2QIL A;  5IIF A;  2KVM A;  1UUP A;  1AN8 A;  1BCP B;  2PW5 A;  3Q0A A;  4XTC S;  1G6Z A;  4DN4 M;  3K58 A;  4DAP A;  4TKO B;  2B2Y C;  2V4D A;  3VR4 A;  2VB2 X;  2MHV A;  3M3Y B;  5C4J B;  1RHP A;  1F2L A;  2K7V A;  5E4X A;  1CZW A;  2NN6 H;  3DWQ A;  2F0S A;  3NSW A;  3MFY A;  3GV3 A;  3T53 B;  5FOB B;  4OO1 I;  3C1E A;  1CA6 A;  3JAM E;  3NE5 B;  4K5X A;  1H9S B;  2PPB C;  4A3D B;  2B2V A;  3A54 A;  4C3H G;  2AQ1 B;  2Y0S B;  4IFD I;  1WD1 A;  2C9O A;  4X3U A;  3VA5 A;  4AYB B;  4KV6 A;  3K5O A;  2IX3 A;  3C46 A;  4GZY C;  4RGN A;  1TWH B;  1U9R A;  1GHJ A;  2KCN A;  4TRD A;  5C4X B;  1PTO F;  4WFN 3;  3GTQ B;  2EY6 A;  4C2M B;  3P20 A;  4CKE A;  1GOZ A;  3I4L A;  3TDQ A;  4A3K B;  3KLS A;  3VR6 A;  5IOC A;  3T4A C;  2PNR C;  3P75 A;  1LTT D;  3FVQ A;  3U9S A;  3FPP A;  1NR4 A;  3SK8 A;  5FO8 B;  1SMY C;  2SOB A;  1PFN A;  2Q8R E;  4J6H A;  4TSS A;  3VYR A;  3URY A;  2I46 A;  4FO2 A;  2NBF A;  3BVG A;  3E5S A;  2BDO A;  1JR0 D;  3QIA A;  3SK5 A;  1LAB A;  3PUY A;  2FIN B;  3MTS A;  4C3I G;  1VDZ A;  2HCI A;  3DEP A;  2IT1 A;  2RDH A;  2NN6 I;  3GP7 A;  4KHZ A;  3KF8 A;  4CGY B;  3FEW X;  4X3T A;  4ZRZ A;  4BA2 I;  1Q1E A;  3HGB A;  1S4Z A;  4DXF A;  1U4M A;  2MGS A;  4JK1 C;  1VF7 A;  1HCZ A;  1D5M C;  3SVM A;  5CR3 A;  4RKL A;  5EPK A;  1F9S A;  5AFW A;  3OSO A;  1CHQ D;  5KNB A;  1HUM A;  3S1N B;  1SJH D;  3T51 B;  2I07 B;  3SXH A;  4IUU A;  3TP7 A;  1EY6 A;  4WJW A;  1E2V A;  1JWU D;  5ELF A;  2LS0 1;  1DJR D;  3MAQ A;  4PNY A;  2KHS A;  1SMY D;  2EYH A;  1PMR A;  5CYU A;  2F0Q A;  3WOE A;  2B8G A;  3J81 E;  3K5M A;  2L0C A;  1G8Z D;  4XIG S;  2F0P A;  1RDP D;  1TWF B;  2EY5 A;  5M3F B;  1EY7 A;  4CJ0 B;  2PZW A;  2FMC A;  5IGE A;  4U68 A;  2YYZ A;  4X3K A;  1LTB D;  5I2Y A;  1SNC A;  1PRT D;  1EZ8 A;  1NUC A;  4KY5 A;  5IGG A;  1WTQ A;  2EXZ A;  2B2U A;  3BDC A;  5COY A;  4DGZ A;  2A5H A;  1SYB A;  4BA1 I;  1R4P B;  4RAU C;  4KN4 C;  3I4M B;  1SYG A;  1HQR D;  2E2J B;  2XRS D;  3MWY W;  4FF1 A;  1I4G A;  5JEA H;  3FRP B;  4IQZ A;  1CM9 A;  3OIQ A;  1BR9 A;  1PXU A;  1QOH A;  2K5Q A;  4L6T B;  1AEX A;  5CGK A;  3OPO A;  4B9W A;  2RA4 A;  1BBX C;  4TQU S;  1NR2 A;  1D2B A;  1O78 A;  1GUG A;  2TMP A;  1EY0 A;  3UI2 A;  2FMM A;  4A3E B;  3HOZ B;  2R7Z B;  2M00 A;  2DY8 A;  1K8M A;  1TWG B;  2E75 C;  2RSO A;  3MXG A;  3NBI A;  1OO9 B;  4RCO A;  1II3 A;  3PO2 B;  3I8Z A;  5ELE A;  4RGM A;  3DXJ C;  1SEB D;  3K7A B;  2Z8L A;  3PUZ A;  2JA8 B;  3PIP 3;  5KRU A;  5CC4 A;  1A2T A;  3SK4 A;  4CJ2 C;  2JSO A;  4NP5 A;  4ULL A;  1HRJ A;  2A6E C;  2PZU A;  4BY1 B;  1U4P A;  5NUC A;  4DFA A;  1DXM A;  1G29 1;  5KIX A;  3QJY A;  4QCL A;  4C1N I;  3KLR A;  2HCC A;  2XIW A;  3TP5 A;  1RCV D;  5D65 A;  1F9Q A;  3H91 A;  1WTX A;  1ZKO A;  4KK7 A;  2EVB A;  3C3L A;  3D6C A;  1ZXT A;  1U4L A;  3OOC A;  1JOO A;  4RWS C;  2F3V A;  2Z4I A;  3H0G B;  1CA5 A;  2X6L A;  4KD3 A;  4KJN A;  1V1P A;  2F0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...