1EEID

Cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords PROTEIN (CHOLERA TOXIN B)
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eeiD00
4C56C 3CHBD 1UNSA 1MD2D 1TY0A 2NTSA 1SE3A 1PTOC 1B44D 5ELFA 1I4HA 1PTOF 1PZJD 1RDPD 1CHQD 1PRTC 1EFID 1ENFA 1LT6D 1KTKA 1F77A 1DYQA 3SEBA 4RFBA 1PZID 5D3IB 1I4XA 1LO5D 1FNWA 1LT4D 1SE4A 1S5FD 2TSSA 4RHSA 1V1PA 2WV6D 4L6TB 4RH6A 2O2LD 2IPKD 1XXGA 1TS5A 4OHJA 3TSSA 4DXFA 4ZYSA 1FGBD 2XRSD 1XTCD 1FNVA 1B1ZA 1QILA 1D6EC 1LTBD 1ET9A 4O1NA 1CT1D 2IJ0A 2J4XA 3BYYB 3R2IA 1BXTA 1JR0D 1JWSD 2Z8LA 4K6LA 1S5BD 1STEA 1BCPD 2G9HD 1EU3A 1FD7D 1LLRD 1TY2A 2SEBD 2AQ1B 1LTTD 3MFGA 1I4PA 1RF2D 1G8ZD 1L0XB 1LTGD 1S5ED 3BVMA 2R61A 4L63B 5FK9C 3W2DA 1HXYD 1LT3D 4UDUC 1PRTD 1CQVA 1SBBB 3BYTB 3DWQA 5ELCA 2QILA 4TSSA 1LT5D 1HTLD 1AW7A 3OWEB 1LTRD 3BZDB 5FKAC 1SJED 1BCPC 1LTSD 3BVZA 3BVGA 1BCPF 1I4GA 2AQ2B 1JQYD 1EWCA 1I4QA 1T5XD 3URYA 1L0YB 1TS3A 1DJRD 1I4RA 1V1OA 1GOZA 5D3DA 1PYWD 3EFXD 1RCVD 1JCKB 1PZKD 3DWAA 2XNAC 2RDGA 1M4VA 1S5DD 4RGMA 1SEBD 1CK1A 1EEID 1PRTB 1SE2A 1KLUD 4Z9CB 1FNUA 1D5MC 1UUPA 1TS2A 1KLGD 2RDHA 1TS4A 5I4DA 1EEFD 1SXTA 2CHBD 5ELBA 1RD9D 2XRQD 3KLSX 1HA5A 1SJHD 1JWMD 1V1PB 2NTTA 4RGTA 1PTOB 1D5ZC 1PRTF 1PTOD 3MC0B 3GP7A 1JWUD 4RCOA 5TSSA 1BCPB 1ET6A 2AQ3B 4RGNA 1D5XC 1CHPD 1EU4A 3EA6A 3V05A 1LTID 3DWPA 3R2TA 1LTAD 1PTOH 4DXGA 1HQRD 4RGOS 1S5CD 2ICIA 3O13A 4RHRA 4BWGB 5ELDA 1ESFA 5ELEA 3R8BA 1AN8A 2QEJC 2XN9C
chains in the Genus database with same CATH superfamily
1S40A 5JEAJ 3HOWH 3KBGA 5C4XG 5HGQA 3K80C 3J7AF 1KXLA 4X65L 1EQTA 1CHQD 1PRTC 1S3OA 2JA6G 1I94L 2FHTA 1WJJA 3DUZA 2PZWA 1LT4D 1I5FA 4JYAQ 4RH6A 4YCUA 4LK1C 3K7AB 1RTOA 1B4OA 2CWPA 2KCCA 1G51A 2Q8RE 2LS01 1B1ZA 4JBWA 3OW2A 3DMUA 1KDAA 3MEHA 4DR4Q 1HR0W 1IHZA 5KGUA 2O5JC 5COYA 3C1EA 1YNNC 2YTVA 1STEA 3FMCA 1ZKOA 3RZOB 4KKUA 1K3BC 2HIXA 3GTLB 2VL6A 2LY7A 4ME5A 3L2PA 4TKOB 1QWYA 4LF4Q 4HMIA 2MO0A 4DNIA 2Q8IB 2JK8A 1XPRA 5M3FH 4LW1A 3BZCA 2B2UC 2MQHA 1SBBB 3FPPA 1KAWA 3S1NH 2QILA 2K05A 1LABA 3PSIA 2A73B 3H3VC 2ZT9C 1D1IA 1R4QB 4JI2L 2CVRA 4AH6A 2Y0SB 5LL6X 2O5IC 2VUMG 4JI5L 2WACA 2Z6KA 1HJPA 4IURA 1XNRL 4V190 3D6WA 3HOYG 4ME3A 1K8GA 2F03A 3M4OB 3JAMc 1PYWD 2CQOA 4LF8L 2XNAC 5C44B 4RGMA 2JA7G 5IWAL 1N34L 1VQDA 1C4QA 5IYDH 4CKEA 4NXNL 4HN7A 1DOLA 1WD1A 4KY7A 3CMAA 2K03A 1SNDA 4IUQA 1W2BA 4B3ML 1Q7YC 5C3EB 1BCPB 3Q6SA 1WCMB 3L3OC 1EY0A 4KHPQ 2NVTB 1D5XC 4R8IA 4U68A 1U4RA 1JOOA 3DWPA 4ZLTF 1V43A 2ENBA 1EZ6A 3K5OA 4A3KG 4FNFA 1K73C 3TS2A 3F2DA 1WTPA 3PUZA 3CPFA 3W1GA 4OIKA 2D62A 1GXDC 2ALYB 4HTHA 4QUFA 1N36Q 1PXUA 3HZXA 1UAPA 4BA2I 2EJFC 4RFBA 1I4XA 4NP5A 4RHSA 2V4DA 2IPKD 4NKLA 1MBYA 1MIUA 4X62Q 3OYYA 4A3MB 1PFBA 4LF8Q 3MWYW 1HZCA 4O1NA 3J7YW 1ZYRD 4CJ1B 4JV5L 3MA2B 1EY9A 2L12A 1TY2A 2XSCA 3EIVA 1X54A 3CQZH 1DONA 4LUVA 4GLAC 1HA6A 3CCEA 3HOUB 4C2MB 1SRUA 5CMDA 3J7AV 2G5DA 2F0QA 2I07B 1HFGA 4GLVB 3S1MB 1CSQA 1AZPA 1VQKA 3GTJB 2I46A 1GM5A 3D8GA 1Y1WH 3TP5A 2JA6H 2R92B 5LMNL 2CW0C 2NB0A 2B2TA 5A35A 2I5MX 2JE6I 3UDIA 1RJTA 3Q0AA 2JP1A 2KEDA 3SXHA 3H0GB 1N34Q 4WJ4A 1GOZA 4DR3L 4BBSG 2PQEA 1HR0L 1KRTA 2UU9L 1B3QA 4G57A 4DPGA 4FO2A 2B2VA 3NP8A 1D1KA 4DR2L 5DAUA 1EEID 1Z9FA 3A8JE 1OXUA 1A3UA 3OMGA 4IPGA 2RDHA 1FJGL 1GD7A 3OIPA 4C3HH 4R4QA 1CFMA 2CHBD 3J81E 4IUUA 1K83B 3HEJA 2CQAA 2ZJPA 1WI5A 3WDNA 4X66L 1G291 2XIWA 2NN6I 1F9SA 1XJVA 3QR8A 1S5CD 5JJKA 5EKKA 4RHRA 1G91A 4DV7L 4GKKQ 1HNWL 3PIO3 4AYBE 3R3OA 3U50C 5C4XH 1Q86C 5CV8A 4GOPA 3HOWG 4ZUJA 2RVLA 4K14A 1ENFA 3FEWX 1YHAA 1BBXC 2UUBQ 3SK4A 2BE5D 1H9MA 1X3GA 4JOIC 1PFSA 2L1BA 4PNYA 1KIXA 1BXTA 3GTPB 1VQ8A 3J80c 1O7YA 1BCPD 4CKCA 5C4JH 1LACA 1WCMH 3PUYA 2AQ1B 1LTTD 3C2PA 4JOIA 5CR3A 5LL6S 3M4YA 4JI5Q 4ZRZA 1KQSA 4BBRB 4L63B 1VQFA 2NZHA 1IYJB 4DAYA 4UDUC 4I65A 1EIFA 1YBYA 3RUZA 2NVYH 1A2UA 2KUMA 4J6HA 2MNAA 3Q23A 2KQ3A 4O0AA 4DV0L 1NAPA 3NXWA 2R3ZA 1JJGA 2K04A 2L15A 1PYBA 2RQXA 1CA5A 4OWXB 4RAUC 4K6DA 5DM73 4KV6A 5C3XA 1N33L 3ONAB 3T1HQ 3FRPB 3T1HL 1AZQA 2NVXH 1QVCA 1M4VA 1W6JA 4JI1Q 4Z9CB 1K8OA 2RF4A 2C5CA 1JJCB 4JBKA 5M3MG 2K5NA 1E1TA 2HDMA 3GD7A 3IKJA 4NW2A 3AFQA 5DLQE 1WTOA 4H0LC 1WCMG 4NPSA 1EEFD 5C3EG 3VR5A 3SDZA 1SAPA 3KLSX 3HS0C 2B8FA 4FVMA 4IOCA 1VMCA 4DK6C 4CJ0B 1GJXA 2A74C 2OTLA 4C3IH 3PUXA 3VR4A 1EY6A 4YWLA 4KKSA 4P75A 1B53A 2ASBA 1DZ1A 1TWFH 2VB2X 4HSPA 4YHHQ 2MO1A 2JA7B 5C0XI 4X3SA 4BA1I 1U4PA 1EFWA 3MVVA 4MTNA 3VA5A 4P73A 4XXEA 1PFMA 2AKWB 1AFPA 1HFNA 3VR2A 4KI0A 4R8NA 2OQKA 1WTQA 1J8IA 4DV2L 2VUMB 3J80E 2XWBB 3CP0A 4JI4L 3F1ZA 4KJNA 5A2QL 3PO2G 3K5LA 1U9RA 4KD3A 5EBCA 4XT3B 3CC2A 3E3XA 2UXCL 1E22A 2O2LD 4DKAC 2CH4W 4LWCA 3TREA 5IE8A 2XRSD 5CV6A 2K28A 3WWVA 1QILA 1LUZA 2UUAQ 2WB1E 1YITA 2HD3A 2G9HD 3KF8A 2QDLA 4CKBA 1O78A 4HIDA 2JYOA 4DUZQ 4IUNA 1EYGA 2KECA 1SYDA 1LTGD 4BBRG 5HGTA 1K28A 2BDNA 2WAQE 2K7VA 4K5XA 1PH6A 3VYRA 1XNQQ 1A15A 2WAQB 2F0WA 1SYBA 2PZTA 1BBWA 1VQHA 5BR8L 3M3YH 3UDFA 1Q8KA 1NTGA 1JE5A 4DAYB 1Q90A 2EDGA 3HKZG 1NY4A 1EIGA 4R4IA 5C4XB 1EYCA 1IBLL 2RCFA 4BY1B 1EQVA 3VYTA 1RCVD 4XIGS 1QZHA 3PUWA 1WD0A 2AHOB 3AMUA 1Y1VH 1GHJA 2D0PA 5IYBH 4GOPC 1ICWA 5LMNQ 2Z6BA 3GTOB 2BCOA 3ULJA 3TP6A 3KLRA 3E0JA 5C4ZA 4A3CG 2NTTA 3J80L 1PTOD 2AQ3B 3D31A 4MZ9A 2L0CA 4AQYL 4OELB 2QCPX 1TKWB 3HOXH 4B3MQ 2EE1A 1N33Q 4A3DB 2NBFA 2K6AA 1PTOH 4DXGA 4LFAL 4DFAA 5JJIA 3BZKA 4B3RL 4JV5Q 4DV0Q 3HOVG 1AN8A 4A3IH 4A4IA 4QIWB 5CV7A 1B7YB 3OSOA 2EY5A 1BO0A 4IALA 3I4MG 5KNCA 4A3LH 3HOVH 5BN5A 4JI0L 2Q2IA 5IT9c 1JT8A 4LF7L 2EYJA 1F2ZA 3HKSA 3D4RA 3QO2A 4PV1C 4C3JH 4QUCA 3PCOB 4KHVA 3UE0A 3OTOQ 3NBIA 4DXFA 2JXMB 1XTCD 5L37A 1XWEA 3W5OA 3F2BA 4OIJA 2E5LQ 1IBML 3CKIB 1EWIA 1KL9A 2K4KA 2Z8LA 4DR1Q 1FD7D 2B39A 4LJZC 3RZOH 3DEOA 4R4CA 1KNEA 3TQYA 4Y7NB 1SFOH 3MFGA 3KLSA 3S2HH 1G8ZD 2B3GA 1HNZQ 4O2DA 2F0JA 4HEDA 4L8JA 1S5ED 1E2WA 3D6CA 2K32A 4DR7L 4IFDJ 5D65A 5KYLA 3N6RA 2YV5A 4OO1I 1JICA 3S1RH 2CW0D 3OWEB 4IUPA 2XWJB 3HOZG 4JI8L 4RCNA 1E24A 5IGCA 3I4OA 1WTHA 4JPBW 1SNMA 1YEZA 2EJGC 3A7AB 3S24A 4QY7A 3PF5A 1L0YB 4TVAB 1MSHA 3CMEA 4PZ7A 1CKNA 2RDGA 4QL5A 5IYBG 4DV1Q 2JA8G 4YY3L 2OEOA 2MP1A 4QGUA 4LNQA 4QQBX 4ZKCB 2E2IH 5GAHC 1ZEQX 4J15A 1HA5A 4CDCC 4IZ8A 1PTOB 1D5ZC 5H1SE 1Y1WB 2BOSA 4A3GH 1ET6A 4LUZA 3W3AA 3PO3H 4A3KB 1O7IA 3EA6A 1EQRA 4K0KL 2NVQB 4JG2A 1I3QB 4ILWA 2EY2A 3JAML 1KRSA 5C5MA 3G48A 4HJ8A 3BU2A 5M9OA 4BWGB 2LMCB 1XPUA 2NZOA 5ELDA 2PMZB 3M4OH 1ESFA 3R8BA 1VQ5A 4G7OC 4JI0Q 2FXQA 3NSWA 2CH4A 1CZGA 4NB3A 4LFCQ 4F7XA 1GUNA 1HUNA 4OX9Q 5ISRA 1VF5C 4ZCKA 1I50B 5KYIA 5E1FA 3GTMB 1NMGA 5IGFA 3OWFA 1HQMC 3F8TA 1VF7A 4DNRB 2VZAA 2EYOA 4GN3B 1VQEA 4L5TA 4L6TB 3GTMH 4A3JB 5IY0A 4BBSH 4A3MG 3GDEA 1QG7A 5J39A 3G71A 2A69C 2F4IA 3RZDH 4TRDA 2BA1A 2Y0SG 3Q8DA 3M3YB 1VQPA 2LSSA 2E74C 1QVGA 3I91A 3EJIA 2K5QA 4PMCA 1CSPA 2SEBD 2K1BA 5C4HA 4IPDA 3RR5A 1L0XB 4N8FA 1G6PA 1LM0A 4A3KH 2Z6KC 1F2LA 4OGQC 1HXYD 1TWGH 2OCEA 1TXYA 4LF9Q 4FP5D 2NUCA 1NR2A 5BN3A 3CU7A 5EKLA 2EXZA 3SK5A 5C3WA 5FOBB 2UUBL 1TU2B 3RNUA 1NBWA 1A0IA 3UE1A 4EQNA 1Z47A 4LF6L 4OX9L 1B70B 3KF8B 2B63B 2MHVA 5CYUA 3OTOL 5CV9A 3BDCA 1SEBD 1PRTB 1SE2A 3DLLA 2Z4HA 2N55A 2WKCA 2TMPA 2ZXPA 5E7NA 5GROA 1SNOA 3PV0A 5JPNC 2QF7A 3NWTA 1SMXA 2I5LX 5JAVA 5IYCG 3G6JB 5E4XA 4JI4Q 1TWFB 3V05A 1QB5D 5GAGC 2F0OA 5IT9E 2VB3X 2E2JB 1JE4A 1NNXA 5KNBA 2IX1A 4YY3Q 2AUJD 3PUVA 3TZUA 2D2CC 4R4TA 4N9PA 3AFPA 5LHY1 2QEJC 4IN3A 3K0YA 3KK7A 4CDDC 3E5SA 3GTGB 2IY5B 1ENAA 3HRZC 1PZJD 5BN4A 3RN5A 1IW7D 1BUVT 4B3SL 3A56A 2F0UA 5JVG3 5D3IB 1EY8A 4EQ5A 3K59A 5JEAH 3KUPA 1S5FD 2JEAI 3C46A 2SDFA 2UXBQ 4C2MH 2XTIA 3SR1A 4GN4B 3HFZB 1FGBD 3MTSA 1ILPA 1F9PA 3J80i 1QE6A 4X3TA 1B3AA 4A3EH 1TWCH 1JJ2A 4RKLA 2ZXRA 1MI2A 4K6LA 2JA6B 3P1HA 2HCCA 3GO5A 1A63A 2B8GA 3KYHC 1RHPA 2KCNA 4F88A 1XMOL 4APVA 3IFDA 1MJEA 3NUCA 4JI6L 1VQ7A 5FJ8G 1PH4A 3ND9A 3OPOA 4B3SQ 4H44C 4AIMA 1SROA 4MTKA 3RLNA 5IGEA 5T1GA 4A76A 3HOZB 4A3DG 1J5EL 2R93B 4HJAA 2B2VC 4IPCA 2JA9A 3GV3A 1KC8C 1I4QA 4LUOA 3ULPA 4NXMQ 4RWSC 2E2DC 2JN4A 3NTHA 5LMUL 3T4AC 2PZUA 3CCUA 1JCKB 3NK9A 3S2DH 1TT2A 1VQAA 2BH8A 2NVTH 1YJWA 1WOCA 3S14H 3LWUA 4HIOA 2GVAA 2ZJRA 3BDLA 1PH1A 3OW7A 3TMEA 1Q12A 2EYHA 4DV2Q 2BE5C 2A6EC 1EYAA 4LFBL 3AU7A 5JPMC 2VQFL 2L4NA 2UXDQ 1PRTF 1Y8PB 1QUQA 3HKZB 4LF6Q 3T1YQ 1GUOA 3T1YL 3ERQA 5CV5A 3ZJYC 2L5TA 2EIFA 1Q82C 2KBNA 3A8IE 2N3SA 4IQZA 3O13A 5KIXA 1L1OA 1DCZA 3SE0A 4NMZA 4L5QA 2K5WA 1LYLA 3CHBD 2G9DA 3J81j 5I9PA 4X3UA 3CRLC 1VQNA 3ICEA 3H09A 3PIOA 1VQGA 3CPWA 2B2UA 1H9KA 1KTKA 5JOBA 4B3TL 1XTDA 2RBMA 2Z1CA 4UP7A 4Y7NH 1SFOB 2DGYA 3ERSX 2Z0SA 4UP8A 1PFNA 2L9HA 3EN2A 4DR2Q 3V2TA 2MUYA 2ICEC 3VR6A 4LF7Q 2PQAA 1Q3LA 4GNXA 5J22A 2XGTA 1TWGB 1D6EC 2SNSA 1X3EA 5FLXc 4IUTA 3CCMA 1CT1D 4YHHL 1GVPA 3BYYB 2EXDA 3K5NA 1CKNB 3PMFA 1ONLA 3ER0A 1ENCA 1X6OA 1DGSA 1EL0A 1HH2P 3NELA 1SYFA 1HZBA 2F0GA 2PCFB 5DEHA 3K6OA 1I6HH 3IL8A 4K8IA 3H0GH 2LKVA 2ES2A 1HNXL 3BJUA 1PRTD 1HR0Q 4K5VA 2UUCQ 4A93B 1LT5D 3LNNA 3BZDB 5I9OA 2CKZB 3BVZA 2H4OA 4DU9A 4JBJA 1C48A 1S4ZA 3CC7A 2VQEQ 3UDGA 2QDBA 1G6ZA 1NMFA 3URYA 2OTJA 1HPCA 2N88A 4LFAQ 4M8AA 1GUTA 1XYIA 1BBUA 2DY8A 5M3MB 2E2JH 4OWWB 2GVBA 3I90A 4C3JG 5FLXL 5FLXE 1M8AA 1OTCA 4ID6A 3D4DA 4KY6A 4FF4A 1G2SA 5A2QE 2B2WA 3ITPA 4RGTA 1L0WA 4QMGA 4JVZA 1F9QA 3GP7A 4K2LA 4RG1A 2AMCB 1HUMA 1KABA 3GQBA 1LV9A 1H95A 3M4QA 3R2TA 1STHA 2M9VA 2B63H 5C0XJ 4XTCS 4LF5Q 4CHTB 4K0KQ 4L5RC 3HOXG 4FXDA 4Q5VA 2JEBI 3KDFA 1EY5A 1X3FA 4YIJA 2MGSA 5EPKA 2NTSA 5AJ3Q 3ULLA 4DV3Q 4A3EB 1PTOF 4OONA 1MHWC 4O42A 2WFWA 1M90C 2RA4A 4EGVA 4N9TA 5JJLA 1DYQA 2RSOA 4BY7H 1LO5D 1X9NA 1SE4A 2K5DA 2OQ0A 5IGGA 4GKJQ 3CCSA 3OMCA 1Y1VG 1VQJA 1SE8A 3GV6A 1E1OA 1HNWQ 4MN3A 1W3SA 1TIID 4X64L 4K8JA 2F0SA 5IT9L 4OEMB 4JW0A 3H91A 1GUWA 5IP9G 1UWVA 2R7ZB 1U5KA 2JA8H 5E4WC 3S1QB 4HSVA 4DNTB 1NUCA 1X55A 3SK6A 2F0IA 2LFNA 1NCVA 1RF2D 4DV6Q 2Z9HA 3FKIH 3W1BA 2VS1A 2UUCL 5E3FA 2L11A 1IL8A 2EYMA 3BVMA 4P72A 5JVH3 3VYUA 1X65A 4UY8C 3EVQA 1F9RA 1CQFA 3S2DB 3S16B 1HTLD 4X64Q 3Q22A 2F0DA 1LTRD 1UE1A 1K8AC 1ML0D 3P75A 1BDOA 5I2XA 4KKTA 2X6LA 2AQ2B 3HOUH 3T53B 3J81L 1EWCA 3HP3A 3K57A 1E2VA 2L55A 3G7LA 3NBHB 2IT1A 1U0LA 1ESRA 4ALPA 1TS3A 2A8VA 2R93H 1H9SB 3LX0A 1YHQA 5AJ3L 3CCJA 3M4PA 1TWAH 2IW3A 1HZAA 1WTXA 5ELOA 2OWOA 1IYUA 1IKLA 3DWAA 5CORA 2ZTCA 1S5DD 4HIMA 3CAMA 2OXPA 4HIKA 2R7DA 1YJ9A 4DV7Q 4GKKL 1H9RA 3A74A 1N32Q 5BR8Q 3E6ZX 5IYCH 2EZVA 5GAEC 3GTJH 1PMRA 2D0OA 4K5WA 1II3A 3OHXC 2BH2A 1KHIA 2E2IB 1AP0A 2ZM6Q 1KAAA 4GNXC 4LF9L 1EU4A 5JJZA 4JI1L 2YU9B 4EQOA 1PYSB 1IL2A 3DM1A 2J0TD 1LTAD 3TS0A 4DV6L 2M00A 3VDYA 3I70A 1JORA 3MXGA 2C35B 1F2YA 3KBXA 3HOUG 3RN2A 1SE3A 2O4XA 2KJXA 1RDPD 5C5LA 3TDQA 1STYA 1SSOA 2EQSA 2JJQA 1PLFA 3RLFA 1IZ6A 1FL0A 2WV6D 1GUGA 2ZTDA 5C4JB 1M1KC 5T1IA 4ZQ3A 3B6YA 1YNJD 2H1EA 4IFDG 3JAME 4HCEA 1IBKQ 3U58A 1B8AA 1L1OB 1VQIA 3T13A 4ZKBB 1JR0D 1O7LA 1V9PA 3MEFA 2A19A 4R1JA 5C44H 4KY5A 3D3RA 2BDOA 4DUYQ 2RSNA 3X3NA 1L2FA 2F0NA 3CCLA 1R4PB 1C8CA 4IJHA 4P74A 5IP7G 2WP8J 2JA5G 3CC4A 3H0GG 3NENA 3E9HA 3IRBA 4DA2A 3PIP3 2HT1A 1SMYC 3I3CA 3SVMA 3K0XA 3KJPA 2NVQH 2ZM6L 3DWQA 1BVSA 3GTKH 5J3BA 1IBMQ 4A3LG 1UE6A 2A6HC 3S16H 1Z6HA 1VQOA 1B50A 3QOJA 4JBMA 1BCPF 2A6ED 1JQYD 2F52A 1B9NA 5J1ZA 1V1OA 3D0FA 3I4NB 2E2HH 1QNKA 1IYVA 4EQPA 4OO1H 1SYGA 3VA7A 3MFYA 4E6IA 3NEMA 2GN5A 2GA4B 4PZ6A 1ASYA 3BDOA 2KVMA 4PG3A 1YI2A 1PA6A 1KLGD 3UI2A 4IPHA 4JI8Q 2E75C 1SXTA 2WB1B 5EBDA 1TQOA 3D4WA 3HOYB 2H5XA 4RCOA 1Y8NB 3MZ5A 4DUZL 4A3JG 3DHQA 1Z7TA 1YVCA 4IJLA 3T51B 4J8QA 4QJFA 4EX5A 3PQIA 2QEXA 4R9WA 1DOKA 4GOPB 1HHVA 4RGOS 4CDFC 4OWTB 2B63G 2R92H 4DV5L 1DD2A 4ZUIA 1PTOC 1RIPA 1Y69U 3S14B 2E5LL 2V1CC 3S9WA 1LT6D 3VYSA 3JC66 1QJOA 2M2LA 1PZID 4ZAIA 4B08A 5IIFA 1AH9A 1HCZA 4OO1G 2NVYB 4K2KA 4HCSA 1CTMA 1STNA 4DUYL 1ET9A 2OF1A 4DV3L 1HTPA 2J4XA 4LFCL 4P71A 2KA7A 4JCVE 3L7ZC 1LLRD 4UPAA 1WTVA 4DK3C 2K5HA 3A5UA 2F0PA 2CWAA 3F2CA 4HJ5A 2PO4A 5EPJA 2WKDA 5C6AA 2R61A 5FK9C 1LTLA 5IP7H 1ILQA 1VMPA 4MNOA 1CQVA 2KOLA 4FF1A 2K5VA 4WJ3M 1A2TA 3CW2C 4TSSA 3GTQH 3NQIA 4DAPA 1NR4A 1SJED 1LTSD 3MXNA 1TWHH 1P16A 3HOZH 1I4GA 5FO7B 1I6HB 4HJ9A 5M3MH 1Q8IA 1H9SA 4C3HB 4A3IG 1XMQL 1UE7A 4ODGA 5D3DA 1AE2A 5EAYA 2RHSB 1TR5A 4FF2A 4KMUC 1W6KA 2A68D 3RLOA 3K81C 5IGDA 4L5SA 3UDXA 2D9UA 4YWKA 1MSGA 1BR9A 2WIIB 3U4ZA 4KHZA 4G7ZC 1TS2A 1K9MC 3KF6A 5FO8B 5HY6A 2ID0A 5G3LD 3CRKC 1TWCB 1EY7A 1RD9D 1YIJA 3MXPA 5IODA 3A7LA 1JWUD 2Q8TA 1JMCA 4A3FB 2NYZD 1T9HA 1CHPD 2F0TA 5EQ0A 3AQQA 1CA6A 1XX8A 3U9SA 1SLJA 1CZWA 4H7BA 2JA8B 3S1QH 2YTYA 2PYKA 3QWNA 3KOJA 1HRJA 3GTKB 2QA4A 2PPBC 4DR5L 2J7ZA 4C1NI 3FKIG 4KN4C 4POFA 4DR4L 1A6XA 3R93A 4U673 3HOVB 1KD1C 3NWSA 4A3FH 1WYDA 4BY7B 2HUGA 1SNQA 1TWHB 4IOAA 3STBD 3QG1A 4FF3A 2N49A 1HNXQ 2UXDL 5EKIA 3PF4A 4R4OA 1V1PA 5CC4A 2F3VA 4PMWA 1TS5A 3K8AA 4ZYSA 2B2TC 1MKHA 4FXKC 3M85A 1VQ4A 1LTBD 5G3LF 2IJ0A 1X3QA 2P5ZX 2PI2A 4DV5Q 3HKZE 5KNDA 3M9BA 3RMHA 1C7YA 4A3CH 2NZ1D 2DUDA 2EJMA 1SNCA 1QVFA 2OT2A 3GTPH 3HGBA 2R7ZG 4A3BH 1PH3A 2DJGC 1VQCA 4CBVA 3LWEA 4GN5A 4MHEA 1QNUA 3S2HB 1STBA 4DV1L 1YHBA 4KJOA 1J9OA 1N9WA 4WORA 3S15H 4BBRH 4KK7A 4HJ7A 1XMQQ 2YU9H 4DR7Q 5M5YH 3I4MB 2E76C 2IL8A 1DOMA 3U9OA 2UUAL 4BS9A 3ZYYX 2CFMA 5C0XH 1DJRD 1I4RA 3A55A 2KENA 2F0KA 1EY4A 3HOXB 4DV4Q 2F4VQ 3I2ZA 3T16A 4A93H 3MXNB 1R9TB 3JAMi 2RCNA 2FFKB 1FNUA 2K52A 3L9AX 4WRDA 2NWGA 4A3BB 5GQOA 2FJ2A 5IP9H 2AWOA 3CCQA 1NE3A 4RMFA 5I4DA 1G2TA 4I7ZC 4F87A 5M5XH 4C3HG 4A3IB 4FYDA 2IWHA 2F0FA 1EOTA 1V8QA 2F0LA 3A8KE 4WFN3 4LMQD 1E0BA 3IFTA 4CGYB 3ND8A 2K33A 3I8ZA 1LTID 1C0AA 4BY1H 2N78A 1S72A 1EYDA 1I6VC 3TBIB 2K75A 4RA8A 4JI2Q 1QOHA 4DF7A 4UP9A 5M3FB 4B3RQ 2LXJA 1VQBA 4AYBB 1SDFA 3K7UC 1J5EQ 3BS1A 1WTWA 2WB1G 3I4LA 1TWAB 1RKNA 2XN9C 2PQAB 4GNXB 3NTIA 5AFWA 4C56C 1PH2A 1NJIC 3CCVA 3KLWA 1UNSA 1FGUA 3NQTA 5IOCA 5ELFA 1I4HA 2DY7A 2QGQA 2PMZE 1MJCA 4XQQA 4G7HC 1FNWA 3FDTA 4JYAL 4A93G 3S17B 3I4NG 2AUKA 2LXKA 2WAQG 3TZDA 4EVOA 4JI6Q 1YZ6A 4HR7B 2ATWA 3EBEA 2AWNA 2QKIC 3PGZA 1RODA 5IYDG 1DXMA 3I4NH 1EIHA 3TP7A 4X62L 4DR6L 1S5BD 2VQFQ 1EU3A 2KHSA 3GTLH 5FJ8H 3F2UA 1UEAB 1SYEA 4BXXH 3TRZA 1QCBD 2R7FA 5CGKA 3KJOA 2VUMH 3P7JA 3CD6A 1AE3A 2I5HA 1A8VA 4JK1C 1GO3E 1AW7A 1Y14B 3PO2B 2HQLA 1XMOQ 4QIWE 2XVSA 4IFDI 1K8MA 3G4SA 2X6GA 4NDXA 1T5XD 1XPOA 4YCVA 2A69D 2NN6H 4DAMA 3EFXD 4GZYC 1VCIA 3T56B 1YNXA 1FVIA 4P2CB 3WOFA 3M7GA 1SYCA 1KLUD 4Q0FA 4UHVA 4NXNQ 3STBC 4CJ2C 1UEBA 2HDLA 3RZDB 5C3EH 2EYLA 4GLXA 1FYCA 1A3VA 1VQMA 3H3VH 2MJ8A 1EUJA 2F0VA 4A3DH 4M1UB 3J81c 4RGNA 3H15A 2HIVA 1ICFB 4XQNA 5K5PA 2JA5H 1U4MA 4POGA 1D2BA 3VR3A 4PQXA 1QZGA 1Q46A 1VQLA 1Y1WG 1U4LA 2Y0SE 2B2YC 3FPUB 5M5XB 3CQZB 2IX0A 4X66Q 3AEVA 3AB9A 1EIYB 2JA5B 4KN7C 5K36H 5D14A 5I2YA 1TY0A 3A0JA 4JI3Q 1B9MA 1STGA 3LGJA 4UAIA 5M5WB 1WTRA 4ZK9B 3I55A 2F0MA 1EFID 3N52A 4FDBA 3SEBA 1F77A 1Q1EA 4I7AA 3PO3B 2R93G 2EOTA 2IHFA 3U4VA 1XNRQ 4C1NK 2EPBA 1A62A 1FJGQ 1X32A 1XXGA 3KDFB 4OHJA 3TSSA 2KCTA 5M5WH 1IKMA 1FNVA 2KCMA 4PZ8A 1ZXTA 1IBKL 2DJFC 2K01A 3CXCA 5C0XG 3X3MA 3R2IA 4WJWA 3TEHB 5CV4A 1K83H 2ZJQA 1RTNA 1L1OC 3MAQA 4XDXA 3C1FA 5F2DA 5LMNW 1I4PA 4A75A 4QF4A 3NBHA 3EROA 1VQ9A 3A54A 3GTGH 4H02A 3K7AH 3J7A5 4GKJL 3W2DA 3S1RB 1LT3D 3A5ZB 2SOBA 4PMBA 1DM0B 4DK0A 1CKOA 1JOKA 5FKAC 1EOVA 5I6WA 2HHHQ 4DR6Q 4HMJA 3HOWB 2IHEA 4X3KA 2RKSA 4CDEC 4B3TQ 2RHQB 3QOLA 2RDFA 5EGTA 1KNAA 5JEAG 1KDCA 1SN8A 4JI3L 2UU9Q 4QCLA 1PZKD 2IX3A 5DNFA 1A3TA 1OXSC 4J1MA 1VDZA 1T5EA 3V96A 2KHJA 1WVLA 2EYPA 1CUKA 4S3SA 2F0HA 5I6YA 1C9OA 2I0QA 3NPPA 4RKBA 2JSOA 5ELBA 1JOQA 3H6MA 3C3LA 2B29A 4H13C 1V1PB 2K50A 5KEEA 1WFQA 3K58A 1K0RA 4QB4A 3I56A 3PO3G 4OL7A 1D7QA 2PW5A 5ELNA 3M7NA 2EY1A 4IUVA 1PH8A 1HQRD 3QIAA 3DM3A 1PDQA 3TN2A 2WINB 1VS0A 4A3JH 2FINB 3EQLC 5ELEA 4BBSB 2PNHA 3HOYH 2YYZA 1KDBA 3QJYA 1VQ6A 2A6HD 4JC0A 2CCZA 4Y52H 4DGZA 1YJNA 4IO9A 2VXWA 4KHPL 4B9WA 2Q2TA 1STAA 4C3JB 2R92G 1CI3M 4ABNA 4JI7Q 4JI7L 2UXBL 3HG9A 2E2HB 2C9OA 2ZXOA 3NTKA 1SR3A 2MFIA 2E8GA 2PI2E 3KF6B 2YTXA 1Y1VB 2Z4IA 2ZTEA 1I3QH 4B9XA 5HURA 1JWSD 1X3PA 2B2YA 1P8LA 1Y8OB 4DK1A 5EPLA 1IBLQ 4A3EG 5C44G 1QUQB 2VQEL 4YWMA 4KLKA 4F8MA 3G6EA 4FXGC 4ULLA 1N8RC 5M3FG 3FHWA 5ELCA 5KRUA 1CKMA 3BYTB 1F2MA 2B2WC 2KEEA 2DNCA 3MHBA 3J7ZC 5EJWA 1XNQL 3SHLA 5DM63 3GTQB 4LF4L 1OO9B 4A3MH 1JB7A 3H3VI 2SNMA 1YNJC 5IGBA 2EY6A 2K14A 1JB3A 3BG3A 4XQJA 1O7ZA 1GUSA 1B2TA 2A1AA 3S1NB 1NSNS 3CF5A 1JC7A 3J81i 3RD4A 4XYQA 1CK1A 1D5MC 1UUPA 3K5MA 5M5YB 2EVBA 2R6GA 1PH5A 3I72A 2EYFA 4LFBQ 4X6AH 1ZYRC 4DR1L 1SNPA 1I94Q 2FMMA 4G4KA 2HQEA 3TP8A 3CCRA 4DR3Q 1PHJA 2JQOA 4IFDH 4V0BA 1BQQT 2F3IA 1PV4A 4OXPA 1K3RA 2PW7A 1BNZA 3I7FA 3FP9A 1BOSA 3FVQA 2X69A 4DAVA 1N32L 2ICIA 4AQYQ 3PO2H 1D8LA 2MPMA 3DXJC 1CM9A 4BXXG 2DNEA 2HHHL 2KHIA 3I73A 1MD2D 3KFUA 3L0OA 2A5HA 4AYBG 2VW9A 2JA7H 1B44D 1SMYD 3SK8A 1HNZL 4LAAA 2QW7A 4C3IB 4XT1B 4KTAA 2TSSA 1EWHA 1BKBA 1GHKA 1GKHA 1TVXA 1PVOA 4N8X1 3AYHB 2NN6G 1E7ZA 1X56A 4GS3A 4DR5Q 3NHHA 3E0EA 3S17H 2R7ZH 4A3BG 3OOCA 3MXUA 5FLMG 1PH7A 1I50H 3NE5B 1IW7C 3E9IA 2F0EA 3SGIA 5CBAE 1K0SA 4XYOA 1H9JA 1OXVA 4MIUA 5CBEE 2Q2HA 2F3WA 2DN8A 3P20A 1E3PA 5IWAQ 2BA0A 3FKIB 1V1QA 1FR3A 2VY3A 4KD4A 3IAYA 4NXML 2N8NA 1BCPC 1E2ZA 3BVGA 4DN4M 4A3FG 5NUCA 2D5DA 2NVXB 1OXTA 1N36L 3WOEA 5GADC 1AEXA 3S1MH 2Q2UA 2F4VL 4DV4L 2HCIA 2PNRC 3GTOH 3S15B 1HZ9A 1MGSA 3QB3A 1PH9A 3Q24A 1EZ8A 3PIPA 3H94A 1R9TH 1YNND 1RL2A 2UXCQ 1TS4A 4X65Q 1EQQA 1BF4A 2XRQD 5FLMH 1Q81C 1SJHD 4A3GG 2VNUD 1JWMD 1Q1BA 2A68C 3MC0B 4A3GB 1O80A 5TSSA 2FMCA 4YCWA 2F1MA 4HAEA 3DEPA 4C3IG 4TQUS 5LMUQ 3I4MH 1IXRA 1OXXK 1UE5A 1J6QA 4LF5L 5FO9B 4BY7G 5K36G 1ASZA 4BY1G 3OIQA
chains in the Genus database with same CATH topology
5JEAJ 3KBGA 3J7AF 1EQTA 1CHQD 1PRTC 2FHTA 3DUZA 2PZWA 1LT4D 4RH6A 4LK1C 3K7AB 1RTOA 1B4OA 2KCCA 2Q8RE 2LS01 1B1ZA 4JBWA 3DMUA 1KDAA 3MEHA 1IHZA 5KGUA 2O5JC 5COYA 3C1EA 1YNNC 1STEA 3FMCA 1ZKOA 3RZOB 4KKUA 3GTLB 2LY7A 4ME5A 4TKOB 1QWYA 4HMIA 2Q8IB 2B2UC 1SBBB 3FPPA 2QILA 2K05A 1LABA 2A73B 3H3VC 2ZT9C 1D1IA 1R4QB 2CVRA 5LL6X 2Y0SB 2O5IC 2WACA 4IURA 4V190 3D6WA 2F03A 3M4OB 1PYWD 2XNAC 5C44B 4RGMA 1C4QA 4CKEA 4HN7A 1DOLA 1WD1A 4KY7A 2K03A 1SNDA 4IUQA 5C3EB 1BCPB 3Q6SA 1WCMB 3L3OC 1EY0A 2NVTB 1D5XC 4R8IA 4U68A 1U4RA 1JOOA 3DWPA 4ZLTF 1V43A 2ENBA 1EZ6A 3K5OA 4FNFA 1WTPA 3PUZA 4OIKA 2D62A 1GXDC 4HTHA 4QUFA 1PXUA 3HZXA 1UAPA 4BA2I 2EJFC 4RFBA 1I4XA 4NP5A 4RHSA 2V4DA 2IPKD 4NKLA 1MBYA 4A3MB 1PFBA 3MWYW 4O1NA 3J7YW 1ZYRD 4CJ1B 3MA2B 1EY9A 2L12A 1TY2A 2XSCA 1DONA 1HA6A 3HOUB 4C2MB 5CMDA 3J7AV 2F0QA 2I07B 1HFGA 3S1MB 1AZPA 3GTJB 2I46A 3D8GA 3TP5A 2R92B 2CW0C 2NB0A 2B2TA 5A35A 2JE6I 1RJTA 3Q0AA 2JP1A 2KEDA 3SXHA 3H0GB 1GOZA 2PQEA 4G57A 4FO2A 2B2VA 3NP8A 1D1KA 5DAUA 1EEID 3A8JE 1OXUA 1A3UA 3OMGA 2RDHA 3OIPA 1CFMA 2CHBD 3J81E 4IUUA 1K83B 3HEJA 2CQAA 3WDNA 1G291 2XIWA 2NN6I 1F9SA 1S5CD 5EKKA 4RHRA 1G91A 3PIO3 3R3OA 5CV8A 4ZUJA 2RVLA 4K14A 1ENFA 3FEWX 1BBXC 3SK4A 2BE5D 1H9MA 2L1BA 4PNYA 1BXTA 3GTPB 1O7YA 1BCPD 4CKCA 1LACA 3PUYA 2AQ1B 1LTTD 3C2PA 5CR3A 5LL6S 3M4YA 4ZRZA 4BBRB 4L63B 4DAYA 4UDUC 4I65A 3RUZA 1A2UA 2KUMA 4J6HA 3Q23A 2KQ3A 1NAPA 3NXWA 2R3ZA 2K04A 2RQXA 1CA5A 4RAUC 4K6DA 5DM73 4KV6A 5C3XA 3ONAB 3FRPB 1AZQA 1M4VA 1W6JA 4Z9CB 1K8OA 2C5CA 3GD7A 2HDMA 3IKJA 4NW2A 1WTOA 4H0LC 1EEFD 3VR5A 3SDZA 1SAPA 3KLSX 3HS0C 2B8FA 4FVMA 1VMCA 4CJ0B 1GJXA 2A74C 3PUXA 3VR4A 1EY6A 4KKSA 1B53A 1DZ1A 2VB2X 4HSPA 2JA7B 5C0XI 4X3SA 4BA1I 1U4PA 3MVVA 3VA5A 4XXEA 1PFMA 1AFPA 1HFNA 3VR2A 4KI0A 4R8NA 1WTQA 1J8IA 2VUMB 3J80E 2XWBB 4KJNA 5A2QL 3K5LA 1U9RA 4KD3A 5EBCA 4XT3B 2O2LD 2XRSD 5CV6A 2K28A 1QILA 2G9HD 3KF8A 4CKBA 1O78A 2JYOA 4IUNA 2KECA 1SYDA 1LTGD 5HGTA 2BDNA 2K7VA 4K5XA 3VYRA 1A15A 2WAQB 2F0WA 1SYBA 2PZTA 1Q90A 2EDGA 1EIGA 5C4XB 1EYCA 4BY1B 1EQVA 3VYTA 1RCVD 4XIGS 3PUWA 1WD0A 3AMUA 1GHJA 1ICWA 3GTOB 2BCOA 3TP6A 3KLRA 3E0JA 5C4ZA 3J80L 2NTTA 1PTOD 2AQ3B 3D31A 2L0CA 2QCPX 1TKWB 2EE1A 4A3DB 2NBFA 2K6AA 1PTOH 4DXGA 4DFAA 1AN8A 4QIWB 5CV7A 3OSOA 2EY5A 1BO0A 4IALA 5KNCA 5BN5A 2EYJA 1F2ZA 3D4RA 3QO2A 4PV1C 4QUCA 4KHVA 3NBIA 4DXFA 2JXMB 1XTCD 1XWEA 4OIJA 3CKIB 2Z8LA 1FD7D 2B39A 4LJZC 3DEOA 1KNEA 4Y7NB 3MFGA 3KLSA 1G8ZD 2F0JA 4HEDA 4L8JA 1S5ED 1E2WA 3D6CA 2K32A 4IFDJ 5D65A 5KYLA 3N6RA 4OO1I 1JICA 2CW0D 3OWEB 4IUPA 2XWJB 4RCNA 5IGCA 1SNMA 2EJGC 3A7AB 1L0YB 1MSHA 2RDGA 2OEOA 2MP1A 4ZKCB 1ZEQX 1HA5A 4IZ8A 1PTOB 1D5ZC 1Y1WB 2BOSA 1ET6A 3W3AA 4A3KB 3EA6A 2NVQB 1I3QB 4ILWA 2EY2A 3JAML 5C5MA 5M9OA 4BWGB 2LMCB 5ELDA 2PMZB 1ESFA 3R8BA 4G7OC 3NSWA 1CZGA 4F7XA 1GUNA 1HUNA 5ISRA 1VF5C 1I50B 5KYIA 5E1FA 3GTMB 5IGFA 3OWFA 1HQMC 1VF7A 4DNRB 2EYOA 4L6TB 4A3JB 1QG7A 5J39A 2A69C 2F4IA 4TRDA 2BA1A 3M3YB 2E74C 3I91A 3EJIA 2K5QA 4PMCA 2SEBD 2K1BA 5C4HA 1L0XB 1F2LA 4OGQC 1HXYD 4FP5D 2NUCA 1NR2A 5BN3A 3CU7A 5EKLA 2EXZA 3SK5A 5C3WA 5FOBB 1TU2B 4EQNA 1Z47A 2B63B 5CYUA 2MHVA 5CV9A 3BDCA 1SE2A 1PRTB 1SEBD 2Z4HA 2N55A 2WKCA 2TMPA 2ZXPA 1SNOA 3PV0A 5JPNC 2QF7A 3NWTA 5JAVA 3G6JB 5E4XA 1TWFB 3V05A 1QB5D 2F0OA 5IT9E 2VB3X 2E2JB 1JE4A 5KNBA 2IX1A 2AUJD 3PUVA 3TZUA 2D2CC 4N9PA 5LHY1 2QEJC 4IN3A 3K0YA 3KK7A 3E5SA 3GTGB 1ENAA 3HRZC 1PZJD 5BN4A 1IW7D 1BUVT 3A56A 5JVG3 2F0UA 5D3IB 1EY8A 3K59A 5JEAH 3KUPA 1S5FD 2JEAI 3C46A 2SDFA 3SR1A 1ILPA 1FGBD 3MTSA 1F9PA 1QE6A 4X3TA 1B3AA 4RKLA 2ZXRA 1MI2A 4K6LA 2JA6B 3P1HA 2HCCA 3GO5A 2B8GA 1RHPA 2KCNA 4F88A 3IFDA 3NUCA 3ND9A 3OPOA 4H44C 5IGEA 5T1GA 3HOZB 2R93B 2B2VC 3GV3A 1I4QA 4RWSC 2E2DC 3NTHA 3T4AC 2PZUA 1JCKB 3NK9A 1TT2A 3LWUA 3BDLA 3OW7A 3TMEA 1Q12A 2EYHA 2BE5C 2A6EC 1EYAA 3AU7A 5JPMC 2L4NA 1PRTF 1Y8PB 3HKZB 1GUOA 3ERQA 5CV5A 2L5TA 3A8IE 4IQZA 3O13A 5KIXA 1DCZA 3SE0A 4NMZA 2K5WA 3CHBD 2G9DA 5I9PA 4X3UA 3CRLC 3H09A 2B2UA 1H9KA 1KTKA 5JOBA 2RBMA 2Z1CA 1SFOB 1PFNA 2L9HA 3V2TA 2MUYA 2ICEC 3VR6A 1Q3LA 5J22A 1TWGB 1D6EC 2SNSA 4IUTA 1CT1D 3BYYB 3K5NA 3PMFA 1ONLA 1ENCA 1EL0A 1SYFA 2F0GA 2PCFB 5DEHA 3K6OA 3IL8A 4K8IA 2LKVA 1PRTD 4K5VA 4A93B 1LT5D 3LNNA 3BZDB 5I9OA 3BVZA 2H4OA 4DU9A 1C48A 1S4ZA 2QDBA 1G6ZA 3URYA 1HPCA 2N88A 4M8AA 1GUTA 1XYIA 2DY8A 5M3MB 3I90A 4C3JG 5FLXL 5FLXE 1M8AA 4ID6A 3D4DA 4KY6A 4FF4A 1G2SA 5A2QE 2B2WA 3ITPA 4RGTA 4QMGA 1F9QA 3GP7A 4K2LA 1HUMA 1KABA 3GQBA 1LV9A 3R2TA 1STHA 2M9VA 5C0XJ 4XTCS 4CHTB 4FXDA 4Q5VA 2JEBI 1EY5A 4YIJA 5EPKA 2MGSA 2NTSA 4A3EB 1PTOF 4O42A 2RA4A 4EGVA 4N9TA 1DYQA 2RSOA 1LO5D 1SE4A 2K5DA 5IGGA 3OMCA 3GV6A 4MN3A 1TIID 4K8JA 2F0SA 5IT9L 3H91A 1GUWA 2R7ZB 3S1QB 5E4WC 4HSVA 4DNTB 1NUCA 3SK6A 2F0IA 2LFNA 1NCVA 1RF2D 5E3FA 2L11A 1IL8A 2EYMA 3BVMA 5JVH3 3VYUA 3EVQA 1F9RA 1CQFA 3S2DB 3S16B 1HTLD 3Q22A 2F0DA 1LTRD 1ML0D 3P75A 1BDOA 5I2XA 4KKTA 2X6LA 2AQ2B 3T53B 3J81L 1EWCA 3HP3A 3K57A 1E2VA 2L55A 3G7LA 2IT1A 1ESRA 1TS3A 1H9SB 3LX0A 2IW3A 1WTXA 1IYUA 1IKLA 3DWAA 5CORA 1S5DD 2OXPA 1H9RA 3E6ZX 2EZVA 1PMRA 4K5WA 1II3A 3OHXC 2E2IB 1AP0A 1KAAA 1EU4A 5JJZA 2YU9B 4EQOA 3DM1A 2J0TD 1LTAD 2M00A 3I70A 1JORA 3MXGA 1F2YA 3KBXA 1SE3A 2O4XA 2KJXA 1RDPD 5C5LA 3TDQA 1STYA 1SSOA 3RLFA 1PLFA 2WV6D 1GUGA 5C4JB 5T1IA 4ZQ3A 1YNJD 2H1EA 4IFDG 3JAME 4HCEA 3T13A 4ZKBB 1JR0D 1O7LA 4KY5A 3D3RA 2BDOA 2RSNA 3X3NA 2F0NA 1R4PB 1C8CA 2WP8J 4DA2A 3PIP3 1SMYC 3I3CA 3SVMA 3DWQA 2A6HC 1Z6HA 1B50A 3QOJA 1BCPF 2A6ED 1JQYD 1B9NA 5J1ZA 1V1OA 3I4NB 1QNKA 1IYVA 4EQPA 4OO1H 1SYGA 3VA7A 3MFYA 4E6IA 2GA4B 3BDOA 2KVMA 1KLGD 3UI2A 2E75C 5EBDA 1SXTA 2WB1B 1TQOA 3D4WA 3HOYB 4RCOA 1Y8NB 3MZ5A 3DHQA 1Z7TA 3T51B 4J8QA 4R9WA 1DOKA 1HHVA 4RGOS 1DD2A 4ZUIA 1PTOC 1Y69U 3S14B 3S9WA 1LT6D 3VYSA 1QJOA 2M2LA 1PZID 4ZAIA 4B08A 5IIFA 1HCZA 4OO1G 2NVYB 4K2KA 4HCSA 1CTMA 1STNA 1ET9A 2OF1A 1HTPA 2J4XA 2KA7A 3L7ZC 1LLRD 1WTVA 2F0PA 2PO4A 5EPJA 2WKDA 5C6AA 2R61A 5FK9C 1ILQA 1VMPA 1CQVA 2KOLA 4FF1A 1A2TA 4TSSA 3NQIA 4DAPA 1NR4A 1SJED 1LTSD 3MXNA 1I4GA 5FO7B 1I6HB 1Q8IA 1H9SA 4C3HB 4ODGA 5D3DA 1TR5A 4FF2A 1W6KA 2A68D 4KMUC 5IGDA 2D9UA 1MSGA 1BR9A 2WIIB 4KHZA 4G7ZC 1TS2A 5FO8B 2ID0A 5G3LD 3CRKC 1TWCB 1EY7A 1RD9D 3MXPA 5IODA 3A7LA 1JWUD 2Q8TA 4A3FB 2NYZD 1CA6A 1CHPD 2F0TA 5EQ0A 1XX8A 3U9SA 1CZWA 4H7BA 2JA8B 2PYKA 3QWNA 1HRJA 3GTKB 2PPBC 2J7ZA 4C1NI 4KN4C 1A6XA 3R93A 4U673 3HOVB 3NWSA 4BY7B 2HUGA 1SNQA 1TWHB 3QG1A 4FF3A 5EKIA 1V1PA 5CC4A 2F3VA 4PMWA 1TS5A 4ZYSA 2B2TC 4FXKC 3M85A 1LTBD 5G3LF 2IJ0A 1X3QA 5KNDA 3RMHA 2NZ1D 2EJMA 1SNCA 2OT2A 3HGBA 4CBVA 3LWEA 4MHEA 1QNUA 3S2HB 1STBA 4KJOA 1J9OA 4WORA 4KK7A 3I4MB 2E76C 2IL8A 1DOMA 3U9OA 4BS9A 3ZYYX 5C0XH 1DJRD 1I4RA 3A55A 2F0KA 1EY4A 3HOXB 3T16A 1R9TB 2FFKB 1FNUA 4WRDA 3L9AX 2NWGA 4A3BB 2FJ2A 2AWOA 5I4DA 1G2TA 4I7ZC 4F87A 4C3HG 4A3IB 4FYDA 2IWHA 2F0FA 1EOTA 1V8QA 2F0LA 3A8KE 4WFN3 4LMQD 1E0BA 3IFTA 4CGYB 3ND8A 2K33A 3I8ZA 1LTID 1EYDA 1I6VC 3TBIB 4RA8A 1QOHA 4DF7A 5M3FB 4AYBB 1SDFA 3BS1A 1WTWA 3I4LA 1RKNA 1TWAB 2XN9C 3NTIA 5AFWA 4C56C 1UNSA 3NQTA 5IOCA 5ELFA 1I4HA 2DY7A 4XQQA 4G7HC 1FNWA 3FDTA 3S17B 2AUKA 3TZDA 4EVOA 4HR7B 2AWNA 2QKIC 1RODA 1DXMA 1EIHA 3TP7A 1S5BD 1EU3A 2KHSA 3F2UA 1UEAB 1SYEA 1QCBD 5CGKA 3P7JA 4JK1C 1AW7A 3PO2B 2XVSA 4IFDI 1K8MA 2X6GA 4NDXA 1T5XD 2A69D 2NN6H 3EFXD 4GZYC 1VCIA 3T56B 4P2CB 3WOFA 3M7GA 1SYCA 1KLUD 4Q0FA 4CJ2C 2HDLA 3RZDB 2EYLA 1FYCA 1A3VA 2MJ8A 2F0VA 4M1UB 4RGNA 4XQNA 5K5PA 1U4MA 1D2BA 3VR3A 4PQXA 1U4LA 3FPUB 2B2YC 5M5XB 3CQZB 2IX0A 3AB9A 2JA5B 4KN7C 5K36H 5D14A 5I2YA 1TY0A 1B9MA 1STGA 4UAIA 5M5WB 1WTRA 4ZK9B 2F0MA 1EFID 3N52A 3SEBA 1F77A 1Q1EA 3PO3B 2EOTA 4C1NK 2EPBA 1X32A 1XXGA 4OHJA 3TSSA 1IKMA 1FNVA 1ZXTA 2K01A 5C0XG 3X3MA 3R2IA 4WJWA 5CV4A 1RTNA 3MAQA 4XDXA 3C1FA 5F2DA 1I4PA 4QF4A 3NBHA 3EROA 3A54A 3W2DA 3S1RB 1LT3D 2SOBA 4PMBA 1DM0B 4DK0A 1JOKA 5FKAC 5I6WA 4HMJA 3HOWB 4X3KA 2RKSA 3QOLA 2RDFA 5EGTA 1KNAA 5JEAG 1KDCA 4QCLA 1PZKD 2IX3A 5DNFA 1A3TA 1OXSC 4J1MA 1VDZA 1T5EA 3V96A 1WVLA 2EYPA 4S3SA 2F0HA 5I6YA 3NPPA 4RKBA 2JSOA 5ELBA 1JOQA 3H6MA 3C3LA 4H13C 1V1PB 5KEEA 3K58A 4QB4A 4OL7A 2PW5A 3M7NA 2EY1A 4IUVA 1HQRD 3QIAA 1PDQA 3TN2A 2WINB 4BBSB 2FINB 3EQLC 5ELEA 2YYZA 1KDBA 3QJYA 2A6HD 4DGZA 2VXWA 4B9WA 1STAA 4C3JB 1CI3M 4ABNA 3HG9A 2E2HB 2C9OA 2ZXOA 3NTKA 1Y1VB 2Z4IA 4B9XA 5HURA 1JWSD 1X3PA 2B2YA 1Y8OB 4DK1A 5EPLA 4F8MA 4FXGC 4ULLA 5KRUA 5ELCA 1F2MA 3BYTB 2B2WC 2KEEA 2DNCA 3MHBA 5EJWA 3SHLA 5DM63 3GTQB 1OO9B 2SNMA 1YNJC 5IGBA 2EY6A 3BG3A 1JB3A 4XQJA 1O7ZA 1GUSA 1B2TA 3S1NB 1NSNS 1JC7A 3RD4A 4XYQA 1CK1A 1D5MC 1UUPA 3K5MA 5M5YB 2EVBA 2R6GA 3I72A 2EYFA 1ZYRC 1SNPA 2FMMA 4G4KA 2HQEA 3TP8A 4IFDH 4V0BA 1BQQT 2PW7A 1BNZA 1BOSA 3FVQA 2X69A 4DAVA 2ICIA 2MPMA 3DXJC 1CM9A 2DNEA 3I73A 1MD2D 2A5HA 1B44D 1SMYD 3SK8A 4LAAA 4C3IB 4XT1B 4KTAA 2TSSA 1EWHA 1GHKA 1TVXA 2NN6G 3NHHA 3OOCA 3MXUA 3NE5B 1IW7C 2F0EA 5CBAE 4XYOA 1H9JA 1OXVA 4MIUA 5CBEE 2F3WA 2DN8A 3P20A 2BA0A 3FKIB 1FR3A 4KD4A 3IAYA 1BCPC 1E2ZA 3BVGA 4DN4M 5NUCA 2D5DA 2NVXB 1OXTA 3WOEA 1AEXA 2HCIA 2PNRC 3S15B 1MGSA 3QB3A 3Q24A 1EZ8A 3H94A 1YNND 1TS4A 1BF4A 2XRQD 1SJHD 2VNUD 1JWMD 1Q1BA 2A68C 3MC0B 4A3GB 1O80A 5TSSA 2FMCA 2F1MA 4HAEA 3DEPA 4C3IG 4TQUS 1OXXK 5FO9B 5K36G 3OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C56 C;  3CHB D;  1UNS A;  1MD2 D;  1TY0 A;  2NTS A;  1SE3 A;  1PTO C;  1B44 D;  5ELF A;  1I4H A;  1PTO F;  1PZJ D;  1RDP D;  1CHQ D;  1PRT C;  1EFI D;  1ENF A;  1LT6 D;  1KTK A;  1F77 A;  1DYQ A;  3SEB A;  4RFB A;  1PZI D;  5D3I B;  1I4X A;  1LO5 D;  1FNW A;  1LT4 D;  1SE4 A;  1S5F D;  2TSS A;  4RHS A;  1V1P A;  2WV6 D;  4L6T B;  4RH6 A;  2O2L D;  2IPK D;  1XXG A;  1TS5 A;  4OHJ A;  3TSS A;  4DXF A;  4ZYS A;  1FGB D;  2XRS D;  1XTC D;  1FNV A;  1B1Z A;  1QIL A;  1D6E C;  1LTB D;  1ET9 A;  4O1N A;  1CT1 D;  2IJ0 A;  2J4X A;  3BYY B;  3R2I A;  1BXT A;  1JR0 D;  1JWS D;  2Z8L A;  4K6L A;  1S5B D;  1STE A;  1BCP D;  2G9H D;  1EU3 A;  1FD7 D;  1LLR D;  1TY2 A;  2SEB D;  2AQ1 B;  1LTT D;  3MFG A;  1I4P A;  1RF2 D;  1G8Z D;  1L0X B;  1LTG D;  1S5E D;  3BVM A;  2R61 A;  4L63 B;  5FK9 C;  3W2D A;  1HXY D;  1LT3 D;  4UDU C;  1PRT D;  1CQV A;  1SBB B;  3BYT B;  3DWQ A;  5ELC A;  2QIL A;  4TSS A;  1LT5 D;  1HTL D;  1AW7 A;  3OWE B;  1LTR D;  3BZD B;  5FKA C;  1SJE D;  1BCP C;  1LTS D;  3BVZ A;  3BVG A;  1BCP F;  1I4G A;  2AQ2 B;  1JQY D;  1EWC A;  1I4Q A;  1T5X D;  3URY A;  1L0Y B;  1TS3 A;  1DJR D;  1I4R A;  1V1O A;  1GOZ A;  5D3D A;  1PYW D;  3EFX D;  1RCV D;  1JCK B;  1PZK D;  3DWA A;  2XNA C;  2RDG A;  1M4V A;  1S5D D;  4RGM A;  1SEB D;  1CK1 A;  1EEI D;  1PRT B;  1SE2 A;  1KLU D;  4Z9C B;  1FNU A;  1D5M C;  1UUP A;  1TS2 A;  1KLG D;  2RDH A;  1TS4 A;  5I4D A;  1EEF D;  1SXT A;  2CHB D;  5ELB A;  1RD9 D;  2XRQ D;  3KLS X;  1HA5 A;  1SJH D;  1JWM D;  1V1P B;  2NTT A;  4RGT A;  1PTO B;  1D5Z C;  1PRT F;  1PTO D;  3MC0 B;  3GP7 A;  1JWU D;  4RCO A;  5TSS A;  1BCP B;  1ET6 A;  2AQ3 B;  4RGN A;  1D5X C;  1CHP D;  1EU4 A;  3EA6 A;  3V05 A;  1LTI D;  3DWP A;  3R2T A;  1LTA D;  1PTO H;  4DXG A;  1HQR D;  4RGO S;  1S5C D;  2ICI A;  3O13 A;  4RHR A;  4BWG B;  5ELD A;  1ESF A;  5ELE A;  3R8B A;  1AN8 A;  2QEJ C;  2XN9 C; 
#chains in the Genus database with same CATH topology
 1S40 A;  5JEA J;  3HOW H;  3KBG A;  5C4X G;  5HGQ A;  3K80 C;  3J7A F;  1KXL A;  4X65 L;  1EQT A;  1CHQ D;  1PRT C;  1S3O A;  2JA6 G;  1I94 L;  2FHT A;  1WJJ A;  3DUZ A;  2PZW A;  1LT4 D;  1I5F A;  4JYA Q;  4RH6 A;  4YCU A;  4LK1 C;  3K7A B;  1RTO A;  1B4O A;  2CWP A;  2KCC A;  1G51 A;  2Q8R E;  2LS0 1;  1B1Z A;  4JBW A;  3OW2 A;  3DMU A;  1KDA A;  3MEH A;  4DR4 Q;  1HR0 W;  1IHZ A;  5KGU A;  2O5J C;  5COY A;  3C1E A;  1YNN C;  2YTV A;  1STE A;  3FMC A;  1ZKO A;  3RZO B;  4KKU A;  1K3B C;  2HIX A;  3GTL B;  2VL6 A;  2LY7 A;  4ME5 A;  3L2P A;  4TKO B;  1QWY A;  4LF4 Q;  4HMI A;  2MO0 A;  4DNI A;  2Q8I B;  2JK8 A;  1XPR A;  5M3F H;  4LW1 A;  3BZC A;  2B2U C;  2MQH A;  1SBB B;  3FPP A;  1KAW A;  3S1N H;  2QIL A;  2K05 A;  1LAB A;  3PSI A;  2A73 B;  3H3V C;  2ZT9 C;  1D1I A;  1R4Q B;  4JI2 L;  2CVR A;  4AH6 A;  2Y0S B;  5LL6 X;  2O5I C;  2VUM G;  4JI5 L;  2WAC A;  2Z6K A;  1HJP A;  4IUR A;  1XNR L;  4V19 0;  3D6W A;  3HOY G;  4ME3 A;  1K8G A;  2F03 A;  3M4O B;  3JAM c;  1PYW D;  2CQO A;  4LF8 L;  2XNA C;  5C44 B;  4RGM A;  2JA7 G;  5IWA L;  1N34 L;  1VQD A;  1C4Q A;  5IYD H;  4CKE A;  4NXN L;  4HN7 A;  1DOL A;  1WD1 A;  4KY7 A;  3CMA A;  2K03 A;  1SND A;  4IUQ A;  1W2B A;  4B3M L;  1Q7Y C;  5C3E B;  1BCP B;  3Q6S A;  1WCM B;  3L3O C;  1EY0 A;  4KHP Q;  2NVT B;  1D5X C;  4R8I A;  4U68 A;  1U4R A;  1JOO A;  3DWP A;  4ZLT F;  1V43 A;  2ENB A;  1EZ6 A;  3K5O A;  4A3K G;  4FNF A;  1K73 C;  3TS2 A;  3F2D A;  1WTP A;  3PUZ A;  3CPF A;  3W1G A;  4OIK A;  2D62 A;  1GXD C;  2ALY B;  4HTH A;  4QUF A;  1N36 Q;  1PXU A;  3HZX A;  1UAP A;  4BA2 I;  2EJF C;  4RFB A;  1I4X A;  4NP5 A;  4RHS A;  2V4D A;  2IPK D;  4NKL A;  1MBY A;  1MIU A;  4X62 Q;  3OYY A;  4A3M B;  1PFB A;  4LF8 Q;  3MWY W;  1HZC A;  4O1N A;  3J7Y W;  1ZYR D;  4CJ1 B;  4JV5 L;  3MA2 B;  1EY9 A;  2L12 A;  1TY2 A;  2XSC A;  3EIV A;  1X54 A;  3CQZ H;  1DON A;  4LUV A;  4GLA C;  1HA6 A;  3CCE A;  3HOU B;  4C2M B;  1SRU A;  5CMD A;  3J7A V;  2G5D A;  2F0Q A;  2I07 B;  1HFG A;  4GLV B;  3S1M B;  1CSQ A;  1AZP A;  1VQK A;  3GTJ B;  2I46 A;  1GM5 A;  3D8G A;  1Y1W H;  3TP5 A;  2JA6 H;  2R92 B;  5LMN L;  2CW0 C;  2NB0 A;  2B2T A;  5A35 A;  2I5M X;  2JE6 I;  3UDI A;  1RJT A;  3Q0A A;  2JP1 A;  2KED A;  3SXH A;  3H0G B;  1N34 Q;  4WJ4 A;  1GOZ A;  4DR3 L;  4BBS G;  2PQE A;  1HR0 L;  1KRT A;  2UU9 L;  1B3Q A;  4G57 A;  4DPG A;  4FO2 A;  2B2V A;  3NP8 A;  1D1K A;  4DR2 L;  5DAU A;  1EEI D;  1Z9F A;  3A8J E;  1OXU A;  1A3U A;  3OMG A;  4IPG A;  2RDH A;  1FJG L;  1GD7 A;  3OIP A;  4C3H H;  4R4Q A;  1CFM A;  2CHB D;  3J81 E;  4IUU A;  1K83 B;  3HEJ A;  2CQA A;  2ZJP A;  1WI5 A;  3WDN A;  4X66 L;  1G29 1;  2XIW A;  2NN6 I;  1F9S A;  1XJV A;  3QR8 A;  1S5C D;  5JJK A;  5EKK A;  4RHR A;  1G91 A;  4DV7 L;  4GKK Q;  1HNW L;  3PIO 3;  4AYB E;  3R3O A;  3U50 C;  5C4X H;  1Q86 C;  5CV8 A;  4GOP A;  3HOW G;  4ZUJ A;  2RVL A;  4K14 A;  1ENF A;  3FEW X;  1YHA A;  1BBX C;  2UUB Q;  3SK4 A;  2BE5 D;  1H9M A;  1X3G A;  4JOI C;  1PFS A;  2L1B A;  4PNY A;  1KIX A;  1BXT A;  3GTP B;  1VQ8 A;  3J80 c;  1O7Y A;  1BCP D;  4CKC A;  5C4J H;  1LAC A;  1WCM H;  3PUY A;  2AQ1 B;  1LTT D;  3C2P A;  4JOI A;  5CR3 A;  5LL6 S;  3M4Y A;  4JI5 Q;  4ZRZ A;  1KQS A;  4BBR B;  4L63 B;  1VQF A;  2NZH A;  1IYJ B;  4DAY A;  4UDU C;  4I65 A;  1EIF A;  1YBY A;  3RUZ A;  2NVY H;  1A2U A;  2KUM A;  4J6H A;  2MNA A;  3Q23 A;  2KQ3 A;  4O0A A;  4DV0 L;  1NAP A;  3NXW A;  2R3Z A;  1JJG A;  2K04 A;  2L15 A;  1PYB A;  2RQX A;  1CA5 A;  4OWX B;  4RAU C;  4K6D A;  5DM7 3;  4KV6 A;  5C3X A;  1N33 L;  3ONA B;  3T1H Q;  3FRP B;  3T1H L;  1AZQ A;  2NVX H;  1QVC A;  1M4V A;  1W6J A;  4JI1 Q;  4Z9C B;  1K8O A;  2RF4 A;  2C5C A;  1JJC B;  4JBK A;  5M3M G;  2K5N A;  1E1T A;  2HDM A;  3GD7 A;  3IKJ A;  4NW2 A;  3AFQ A;  5DLQ E;  1WTO A;  4H0L C;  1WCM G;  4NPS A;  1EEF D;  5C3E G;  3VR5 A;  3SDZ A;  1SAP A;  3KLS X;  3HS0 C;  2B8F A;  4FVM A;  4IOC A;  1VMC A;  4DK6 C;  4CJ0 B;  1GJX A;  2A74 C;  2OTL A;  4C3I H;  3PUX A;  3VR4 A;  1EY6 A;  4YWL A;  4KKS A;  4P75 A;  1B53 A;  2ASB A;  1DZ1 A;  1TWF H;  2VB2 X;  4HSP A;  4YHH Q;  2MO1 A;  2JA7 B;  5C0X I;  4X3S A;  4BA1 I;  1U4P A;  1EFW A;  3MVV A;  4MTN A;  3VA5 A;  4P73 A;  4XXE A;  1PFM A;  2AKW B;  1AFP A;  1HFN A;  3VR2 A;  4KI0 A;  4R8N A;  2OQK A;  1WTQ A;  1J8I A;  4DV2 L;  2VUM B;  3J80 E;  2XWB B;  3CP0 A;  4JI4 L;  3F1Z A;  4KJN A;  5A2Q L;  3PO2 G;  3K5L A;  1U9R A;  4KD3 A;  5EBC A;  4XT3 B;  3CC2 A;  3E3X A;  2UXC L;  1E22 A;  2O2L D;  4DKA C;  2CH4 W;  4LWC A;  3TRE A;  5IE8 A;  2XRS D;  5CV6 A;  2K28 A;  3WWV A;  1QIL A;  1LUZ A;  2UUA Q;  2WB1 E;  1YIT A;  2HD3 A;  2G9H D;  3KF8 A;  2QDL A;  4CKB A;  1O78 A;  4HID A;  2JYO A;  4DUZ Q;  4IUN A;  1EYG A;  2KEC A;  1SYD A;  1LTG D;  4BBR G;  5HGT A;  1K28 A;  2BDN A;  2WAQ E;  2K7V A;  4K5X A;  1PH6 A;  3VYR A;  1XNQ Q;  1A15 A;  2WAQ B;  2F0W A;  1SYB A;  2PZT A;  1BBW A;  1VQH A;  5BR8 L;  3M3Y H;  3UDF A;  1Q8K A;  1NTG A;  1JE5 A;  4DAY B;  1Q90 A;  2EDG A;  3HKZ G;  1NY4 A;  1EIG A;  4R4I A;  5C4X B;  1EYC A;  1IBL L;  2RCF A;  4BY1 B;  1EQV A;  3VYT A;  1RCV D;  4XIG S;  1QZH A;  3PUW A;  1WD0 A;  2AHO B;  3AMU A;  1Y1V H;  1GHJ A;  2D0P A;  5IYB H;  4GOP C;  1ICW A;  5LMN Q;  2Z6B A;  3GTO B;  2BCO A;  3ULJ A;  3TP6 A;  3KLR A;  3E0J A;  5C4Z A;  4A3C G;  2NTT A;  3J80 L;  1PTO D;  2AQ3 B;  3D31 A;  4MZ9 A;  2L0C A;  4AQY L;  4OEL B;  2QCP X;  1TKW B;  3HOX H;  4B3M Q;  2EE1 A;  1N33 Q;  4A3D B;  2NBF A;  2K6A A;  1PTO H;  4DXG A;  4LFA L;  4DFA A;  5JJI A;  3BZK A;  4B3R L;  4JV5 Q;  4DV0 Q;  3HOV G;  1AN8 A;  4A3I H;  4A4I A;  4QIW B;  5CV7 A;  1B7Y B;  3OSO A;  2EY5 A;  1BO0 A;  4IAL A;  3I4M G;  5KNC A;  4A3L H;  3HOV H;  5BN5 A;  4JI0 L;  2Q2I A;  5IT9 c;  1JT8 A;  4LF7 L;  2EYJ A;  1F2Z A;  3HKS A;  3D4R A;  3QO2 A;  4PV1 C;  4C3J H;  4QUC A;  3PCO B;  4KHV A;  3UE0 A;  3OTO Q;  3NBI A;  4DXF A;  2JXM B;  1XTC D;  5L37 A;  1XWE A;  3W5O A;  3F2B A;  4OIJ A;  2E5L Q;  1IBM L;  3CKI B;  1EWI A;  1KL9 A;  2K4K A;  2Z8L A;  4DR1 Q;  1FD7 D;  2B39 A;  4LJZ C;  3RZO H;  3DEO A;  4R4C A;  1KNE A;  3TQY A;  4Y7N B;  1SFO H;  3MFG A;  3KLS A;  3S2H H;  1G8Z D;  2B3G A;  1HNZ Q;  4O2D A;  2F0J A;  4HED A;  4L8J A;  1S5E D;  1E2W A;  3D6C A;  2K32 A;  4DR7 L;  4IFD J;  5D65 A;  5KYL A;  3N6R A;  2YV5 A;  4OO1 I;  1JIC A;  3S1R H;  2CW0 D;  3OWE B;  4IUP A;  2XWJ B;  3HOZ G;  4JI8 L;  4RCN A;  1E24 A;  5IGC A;  3I4O A;  1WTH A;  4JPB W;  1SNM A;  1YEZ A;  2EJG C;  3A7A B;  3S24 A;  4QY7 A;  3PF5 A;  1L0Y B;  4TVA B;  1MSH A;  3CME A;  4PZ7 A;  1CKN A;  2RDG A;  4QL5 A;  5IYB G;  4DV1 Q;  2JA8 G;  4YY3 L;  2OEO A;  2MP1 A;  4QGU A;  4LNQ A;  4QQB X;  4ZKC B;  2E2I H;  5GAH C;  1ZEQ X;  4J15 A;  1HA5 A;  4CDC C;  4IZ8 A;  1PTO B;  1D5Z C;  5H1S E;  1Y1W B;  2BOS A;  4A3G H;  1ET6 A;  4LUZ A;  3W3A A;  3PO3 H;  4A3K B;  1O7I A;  3EA6 A;  1EQR A;  4K0K L;  2NVQ B;  4JG2 A;  1I3Q B;  4ILW A;  2EY2 A;  3JAM L;  1KRS A;  5C5M A;  3G48 A;  4HJ8 A;  3BU2 A;  5M9O A;  4BWG B;  2LMC B;  1XPU A;  2NZO A;  5ELD A;  2PMZ B;  3M4O H;  1ESF A;  3R8B A;  1VQ5 A;  4G7O C;  4JI0 Q;  2FXQ A;  3NSW A;  2CH4 A;  1CZG A;  4NB3 A;  4LFC Q;  4F7X A;  1GUN A;  1HUN A;  4OX9 Q;  5ISR A;  1VF5 C;  4ZCK A;  1I50 B;  5KYI A;  5E1F A;  3GTM B;  1NMG A;  5IGF A;  3OWF A;  1HQM C;  3F8T A;  1VF7 A;  4DNR B;  2VZA A;  2EYO A;  4GN3 B;  1VQE A;  4L5T A;  4L6T B;  3GTM H;  4A3J B;  5IY0 A;  4BBS H;  4A3M G;  3GDE A;  1QG7 A;  5J39 A;  3G71 A;  2A69 C;  2F4I A;  3RZD H;  4TRD A;  2BA1 A;  2Y0S G;  3Q8D A;  3M3Y B;  1VQP A;  2LSS A;  2E74 C;  1QVG A;  3I91 A;  3EJI A;  2K5Q A;  4PMC A;  1CSP A;  2SEB D;  2K1B A;  5C4H A;  4IPD A;  3RR5 A;  1L0X B;  4N8F A;  1G6P A;  1LM0 A;  4A3K H;  2Z6K C;  1F2L A;  4OGQ C;  1HXY D;  1TWG H;  2OCE A;  1TXY A;  4LF9 Q;  4FP5 D;  2NUC A;  1NR2 A;  5BN3 A;  3CU7 A;  5EKL A;  2EXZ A;  3SK5 A;  5C3W A;  5FOB B;  2UUB L;  1TU2 B;  3RNU A;  1NBW A;  1A0I A;  3UE1 A;  4EQN A;  1Z47 A;  4LF6 L;  4OX9 L;  1B70 B;  3KF8 B;  2B63 B;  2MHV A;  5CYU A;  3OTO L;  5CV9 A;  3BDC A;  1SEB D;  1PRT B;  1SE2 A;  3DLL A;  2Z4H A;  2N55 A;  2WKC A;  2TMP A;  2ZXP A;  5E7N A;  5GRO A;  1SNO A;  3PV0 A;  5JPN C;  2QF7 A;  3NWT A;  1SMX A;  2I5L X;  5JAV A;  5IYC G;  3G6J B;  5E4X A;  4JI4 Q;  1TWF B;  3V05 A;  1QB5 D;  5GAG C;  2F0O A;  5IT9 E;  2VB3 X;  2E2J B;  1JE4 A;  1NNX A;  5KNB A;  2IX1 A;  4YY3 Q;  2AUJ D;  3PUV A;  3TZU A;  2D2C C;  4R4T A;  4N9P A;  3AFP A;  5LHY 1;  2QEJ C;  4IN3 A;  3K0Y A;  3KK7 A;  4CDD C;  3E5S A;  3GTG B;  2IY5 B;  1ENA A;  3HRZ C;  1PZJ D;  5BN4 A;  3RN5 A;  1IW7 D;  1BUV T;  4B3S L;  3A56 A;  2F0U A;  5JVG 3;  5D3I B;  1EY8 A;  4EQ5 A;  3K59 A;  5JEA H;  3KUP A;  1S5F D;  2JEA I;  3C46 A;  2SDF A;  2UXB Q;  4C2M H;  2XTI A;  3SR1 A;  4GN4 B;  3HFZ B;  1FGB D;  3MTS A;  1ILP A;  1F9P A;  3J80 i;  1QE6 A;  4X3T A;  1B3A A;  4A3E H;  1TWC H;  1JJ2 A;  4RKL A;  2ZXR A;  1MI2 A;  4K6L A;  2JA6 B;  3P1H A;  2HCC A;  3GO5 A;  1A63 A;  2B8G A;  3KYH C;  1RHP A;  2KCN A;  4F88 A;  1XMO L;  4APV A;  3IFD A;  1MJE A;  3NUC A;  4JI6 L;  1VQ7 A;  5FJ8 G;  1PH4 A;  3ND9 A;  3OPO A;  4B3S Q;  4H44 C;  4AIM A;  1SRO A;  4MTK A;  3RLN A;  5IGE A;  5T1G A;  4A76 A;  3HOZ B;  4A3D G;  1J5E L;  2R93 B;  4HJA A;  2B2V C;  4IPC A;  2JA9 A;  3GV3 A;  1KC8 C;  1I4Q A;  4LUO A;  3ULP A;  4NXM Q;  4RWS C;  2E2D C;  2JN4 A;  3NTH A;  5LMU L;  3T4A C;  2PZU A;  3CCU A;  1JCK B;  3NK9 A;  3S2D H;  1TT2 A;  1VQA A;  2BH8 A;  2NVT H;  1YJW A;  1WOC A;  3S14 H;  3LWU A;  4HIO A;  2GVA A;  2ZJR A;  3BDL A;  1PH1 A;  3OW7 A;  3TME A;  1Q12 A;  2EYH A;  4DV2 Q;  2BE5 C;  2A6E C;  1EYA A;  4LFB L;  3AU7 A;  5JPM C;  2VQF L;  2L4N A;  2UXD Q;  1PRT F;  1Y8P B;  1QUQ A;  3HKZ B;  4LF6 Q;  3T1Y Q;  1GUO A;  3T1Y L;  3ERQ A;  5CV5 A;  3ZJY C;  2L5T A;  2EIF A;  1Q82 C;  2KBN A;  3A8I E;  2N3S A;  4IQZ A;  3O13 A;  5KIX A;  1L1O A;  1DCZ A;  3SE0 A;  4NMZ A;  4L5Q A;  2K5W A;  1LYL A;  3CHB D;  2G9D A;  3J81 j;  5I9P A;  4X3U A;  3CRL C;  1VQN A;  3ICE A;  3H09 A;  3PIO A;  1VQG A;  3CPW A;  2B2U A;  1H9K A;  1KTK A;  5JOB A;  4B3T L;  1XTD A;  2RBM A;  2Z1C A;  4UP7 A;  4Y7N H;  1SFO B;  2DGY A;  3ERS X;  2Z0S A;  4UP8 A;  1PFN A;  2L9H A;  3EN2 A;  4DR2 Q;  3V2T A;  2MUY A;  2ICE C;  3VR6 A;  4LF7 Q;  2PQA A;  1Q3L A;  4GNX A;  5J22 A;  2XGT A;  1TWG B;  1D6E C;  2SNS A;  1X3E A;  5FLX c;  4IUT A;  3CCM A;  1CT1 D;  4YHH L;  1GVP A;  3BYY B;  2EXD A;  3K5N A;  1CKN B;  3PMF A;  1ONL A;  3ER0 A;  1ENC A;  1X6O A;  1DGS A;  1EL0 A;  1HH2 P;  3NEL A;  1SYF A;  1HZB A;  2F0G A;  2PCF B;  5DEH A;  3K6O A;  1I6H H;  3IL8 A;  4K8I A;  3H0G H;  2LKV A;  2ES2 A;  1HNX L;  3BJU A;  1PRT D;  1HR0 Q;  4K5V A;  2UUC Q;  4A93 B;  1LT5 D;  3LNN A;  3BZD B;  5I9O A;  2CKZ B;  3BVZ A;  2H4O A;  4DU9 A;  4JBJ A;  1C48 A;  1S4Z A;  3CC7 A;  2VQE Q;  3UDG A;  2QDB A;  1G6Z A;  1NMF A;  3URY A;  2OTJ A;  1HPC A;  2N88 A;  4LFA Q;  4M8A A;  1GUT A;  1XYI A;  1BBU A;  2DY8 A;  5M3M B;  2E2J H;  4OWW B;  2GVB A;  3I90 A;  4C3J G;  5FLX L;  5FLX E;  1M8A A;  1OTC A;  4ID6 A;  3D4D A;  4KY6 A;  4FF4 A;  1G2S A;  5A2Q E;  2B2W A;  3ITP A;  4RGT A;  1L0W A;  4QMG A;  4JVZ A;  1F9Q A;  3GP7 A;  4K2L A;  4RG1 A;  2AMC B;  1HUM A;  1KAB A;  3GQB A;  1LV9 A;  1H95 A;  3M4Q A;  3R2T A;  1STH A;  2M9V A;  2B63 H;  5C0X J;  4XTC S;  4LF5 Q;  4CHT B;  4K0K Q;  4L5R C;  3HOX G;  4FXD A;  4Q5V A;  2JEB I;  3KDF A;  1EY5 A;  1X3F A;  4YIJ A;  2MGS A;  5EPK A;  2NTS A;  5AJ3 Q;  3ULL A;  4DV3 Q;  4A3E B;  1PTO F;  4OON A;  1MHW C;  4O42 A;  2WFW A;  1M90 C;  2RA4 A;  4EGV A;  4N9T A;  5JJL A;  1DYQ A;  2RSO A;  4BY7 H;  1LO5 D;  1X9N A;  1SE4 A;  2K5D A;  2OQ0 A;  5IGG A;  4GKJ Q;  3CCS A;  3OMC A;  1Y1V G;  1VQJ A;  1SE8 A;  3GV6 A;  1E1O A;  1HNW Q;  4MN3 A;  1W3S A;  1TII D;  4X64 L;  4K8J A;  2F0S A;  5IT9 L;  4OEM B;  4JW0 A;  3H91 A;  1GUW A;  5IP9 G;  1UWV A;  2R7Z B;  1U5K A;  2JA8 H;  5E4W C;  3S1Q B;  4HSV A;  4DNT B;  1NUC A;  1X55 A;  3SK6 A;  2F0I A;  2LFN A;  1NCV A;  1RF2 D;  4DV6 Q;  2Z9H A;  3FKI H;  3W1B A;  2VS1 A;  2UUC L;  5E3F A;  2L11 A;  1IL8 A;  2EYM A;  3BVM A;  4P72 A;  5JVH 3;  3VYU A;  1X65 A;  4UY8 C;  3EVQ A;  1F9R A;  1CQF A;  3S2D B;  3S16 B;  1HTL D;  4X64 Q;  3Q22 A;  2F0D A;  1LTR D;  1UE1 A;  1K8A C;  1ML0 D;  3P75 A;  1BDO A;  5I2X A;  4KKT A;  2X6L A;  2AQ2 B;  3HOU H;  3T53 B;  3J81 L;  1EWC A;  3HP3 A;  3K57 A;  1E2V A;  2L55 A;  3G7L A;  3NBH B;  2IT1 A;  1U0L A;  1ESR A;  4ALP A;  1TS3 A;  2A8V A;  2R93 H;  1H9S B;  3LX0 A;  1YHQ A;  5AJ3 L;  3CCJ A;  3M4P A;  1TWA H;  2IW3 A;  1HZA A;  1WTX A;  5ELO A;  2OWO A;  1IYU A;  1IKL A;  3DWA A;  5COR A;  2ZTC A;  1S5D D;  4HIM A;  3CAM A;  2OXP A;  4HIK A;  2R7D A;  1YJ9 A;  4DV7 Q;  4GKK L;  1H9R A;  3A74 A;  1N32 Q;  5BR8 Q;  3E6Z X;  5IYC H;  2EZV A;  5GAE C;  3GTJ H;  1PMR A;  2D0O A;  4K5W A;  1II3 A;  3OHX C;  2BH2 A;  1KHI A;  2E2I B;  1AP0 A;  2ZM6 Q;  1KAA A;  4GNX C;  4LF9 L;  1EU4 A;  5JJZ A;  4JI1 L;  2YU9 B;  4EQO A;  1PYS B;  1IL2 A;  3DM1 A;  2J0T D;  1LTA D;  3TS0 A;  4DV6 L;  2M00 A;  3VDY A;  3I70 A;  1JOR A;  3MXG A;  2C35 B;  1F2Y A;  3KBX A;  3HOU G;  3RN2 A;  1SE3 A;  2O4X A;  2KJX A;  1RDP D;  5C5L A;  3TDQ A;  1STY A;  1SSO A;  2EQS A;  2JJQ A;  1PLF A;  3RLF A;  1IZ6 A;  1FL0 A;  2WV6 D;  1GUG A;  2ZTD A;  5C4J B;  1M1K C;  5T1I A;  4ZQ3 A;  3B6Y A;  1YNJ D;  2H1E A;  4IFD G;  3JAM E;  4HCE A;  1IBK Q;  3U58 A;  1B8A A;  1L1O B;  1VQI A;  3T13 A;  4ZKB B;  1JR0 D;  1O7L A;  1V9P A;  3MEF A;  2A19 A;  4R1J A;  5C44 H;  4KY5 A;  3D3R A;  2BDO A;  4DUY Q;  2RSN A;  3X3N A;  1L2F A;  2F0N A;  3CCL A;  1R4P B;  1C8C A;  4IJH A;  4P74 A;  5IP7 G;  2WP8 J;  2JA5 G;  3CC4 A;  3H0G G;  3NEN A;  3E9H A;  3IRB A;  4DA2 A;  3PIP 3;  2HT1 A;  1SMY C;  3I3C A;  3SVM A;  3K0X A;  3KJP A;  2NVQ H;  2ZM6 L;  3DWQ A;  1BVS A;  3GTK H;  5J3B A;  1IBM Q;  4A3L G;  1UE6 A;  2A6H C;  3S16 H;  1Z6H A;  1VQO A;  1B50 A;  3QOJ A;  4JBM A;  1BCP F;  2A6E D;  1JQY D;  2F52 A;  1B9N A;  5J1Z A;  1V1O A;  3D0F A;  3I4N B;  2E2H H;  1QNK A;  1IYV A;  4EQP A;  4OO1 H;  1SYG A;  3VA7 A;  3MFY A;  4E6I A;  3NEM A;  2GN5 A;  2GA4 B;  4PZ6 A;  1ASY A;  3BDO A;  2KVM A;  4PG3 A;  1YI2 A;  1PA6 A;  1KLG D;  3UI2 A;  4IPH A;  4JI8 Q;  2E75 C;  1SXT A;  2WB1 B;  5EBD A;  1TQO A;  3D4W A;  3HOY B;  2H5X A;  4RCO A;  1Y8N B;  3MZ5 A;  4DUZ L;  4A3J G;  3DHQ A;  1Z7T A;  1YVC A;  4IJL A;  3T51 B;  4J8Q A;  4QJF A;  4EX5 A;  3PQI A;  2QEX A;  4R9W A;  1DOK A;  4GOP B;  1HHV A;  4RGO S;  4CDF C;  4OWT B;  2B63 G;  2R92 H;  4DV5 L;  1DD2 A;  4ZUI A;  1PTO C;  1RIP A;  1Y69 U;  3S14 B;  2E5L L;  2V1C C;  3S9W A;  1LT6 D;  3VYS A;  3JC6 6;  1QJO A;  2M2L A;  1PZI D;  4ZAI A;  4B08 A;  5IIF A;  1AH9 A;  1HCZ A;  4OO1 G;  2NVY B;  4K2K A;  4HCS A;  1CTM A;  1STN A;  4DUY L;  1ET9 A;  2OF1 A;  4DV3 L;  1HTP A;  2J4X A;  4LFC L;  4P71 A;  2KA7 A;  4JCV E;  3L7Z C;  1LLR D;  4UPA A;  1WTV A;  4DK3 C;  2K5H A;  3A5U A;  2F0P A;  2CWA A;  3F2C A;  4HJ5 A;  2PO4 A;  5EPJ A;  2WKD A;  5C6A A;  2R61 A;  5FK9 C;  1LTL A;  5IP7 H;  1ILQ A;  1VMP A;  4MNO A;  1CQV A;  2KOL A;  4FF1 A;  2K5V A;  4WJ3 M;  1A2T A;  3CW2 C;  4TSS A;  3GTQ H;  3NQI A;  4DAP A;  1NR4 A;  1SJE D;  1LTS D;  3MXN A;  1TWH H;  1P16 A;  3HOZ H;  1I4G A;  5FO7 B;  1I6H B;  4HJ9 A;  5M3M H;  1Q8I A;  1H9S A;  4C3H B;  4A3I G;  1XMQ L;  1UE7 A;  4ODG A;  5D3D A;  1AE2 A;  5EAY A;  2RHS B;  1TR5 A;  4FF2 A;  4KMU C;  1W6K A;  2A68 D;  3RLO A;  3K81 C;  5IGD A;  4L5S A;  3UDX A;  2D9U A;  4YWK A;  1MSG A;  1BR9 A;  2WII B;  3U4Z A;  4KHZ A;  4G7Z C;  1TS2 A;  1K9M C;  3KF6 A;  5FO8 B;  5HY6 A;  2ID0 A;  5G3L D;  3CRK C;  1TWC B;  1EY7 A;  1RD9 D;  1YIJ A;  3MXP A;  5IOD A;  3A7L A;  1JWU D;  2Q8T A;  1JMC A;  4A3F B;  2NYZ D;  1T9H A;  1CHP D;  2F0T A;  5EQ0 A;  3AQQ A;  1CA6 A;  1XX8 A;  3U9S A;  1SLJ A;  1CZW A;  4H7B A;  2JA8 B;  3S1Q H;  2YTY A;  2PYK A;  3QWN A;  3KOJ A;  1HRJ A;  3GTK B;  2QA4 A;  2PPB C;  4DR5 L;  2J7Z A;  4C1N I;  3FKI G;  4KN4 C;  4POF A;  4DR4 L;  1A6X A;  3R93 A;  4U67 3;  3HOV B;  1KD1 C;  3NWS A;  4A3F H;  1WYD A;  4BY7 B;  2HUG A;  1SNQ A;  1TWH B;  4IOA A;  3STB D;  3QG1 A;  4FF3 A;  2N49 A;  1HNX Q;  2UXD L;  5EKI A;  3PF4 A;  4R4O A;  1V1P A;  5CC4 A;  2F3V A;  4PMW A;  1TS5 A;  3K8A A;  4ZYS A;  2B2T C;  1MKH A;  4FXK C;  3M85 A;  1VQ4 A;  1LTB D;  5G3L F;  2IJ0 A;  1X3Q A;  2P5Z X;  2PI2 A;  4DV5 Q;  3HKZ E;  5KND A;  3M9B A;  3RMH A;  1C7Y A;  4A3C H;  2NZ1 D;  2DUD A;  2EJM A;  1SNC A;  1QVF A;  2OT2 A;  3GTP H;  3HGB A;  2R7Z G;  4A3B H;  1PH3 A;  2DJG C;  1VQC A;  4CBV A;  3LWE A;  4GN5 A;  4MHE A;  1QNU A;  3S2H B;  1STB A;  4DV1 L;  1YHB A;  4KJO A;  1J9O A;  1N9W A;  4WOR A;  3S15 H;  4BBR H;  4KK7 A;  4HJ7 A;  1XMQ Q;  2YU9 H;  4DR7 Q;  5M5Y H;  3I4M B;  2E76 C;  2IL8 A;  1DOM A;  3U9O A;  2UUA L;  4BS9 A;  3ZYY X;  2CFM A;  5C0X H;  1DJR D;  1I4R A;  3A55 A;  2KEN A;  2F0K A;  1EY4 A;  3HOX B;  4DV4 Q;  2F4V Q;  3I2Z A;  3T16 A;  4A93 H;  3MXN B;  1R9T B;  3JAM i;  2RCN A;  2FFK B;  1FNU A;  2K52 A;  3L9A X;  4WRD A;  2NWG A;  4A3B B;  5GQO A;  2FJ2 A;  5IP9 H;  2AWO A;  3CCQ A;  1NE3 A;  4RMF A;  5I4D A;  1G2T A;  4I7Z C;  4F87 A;  5M5X H;  4C3H G;  4A3I B;  4FYD A;  2IWH A;  2F0F A;  1EOT A;  1V8Q A;  2F0L A;  3A8K E;  4WFN 3;  4LMQ D;  1E0B A;  3IFT A;  4CGY B;  3ND8 A;  2K33 A;  3I8Z A;  1LTI D;  1C0A A;  4BY1 H;  2N78 A;  1S72 A;  1EYD A;  1I6V C;  3TBI B;  2K75 A;  4RA8 A;  4JI2 Q;  1QOH A;  4DF7 A;  4UP9 A;  5M3F B;  4B3R Q;  2LXJ A;  1VQB A;  4AYB B;  1SDF A;  3K7U C;  1J5E Q;  3BS1 A;  1WTW A;  2WB1 G;  3I4L A;  1TWA B;  1RKN A;  2XN9 C;  2PQA B;  4GNX B;  3NTI A;  5AFW A;  4C56 C;  1PH2 A;  1NJI C;  3CCV A;  3KLW A;  1UNS A;  1FGU A;  3NQT A;  5IOC A;  5ELF A;  1I4H A;  2DY7 A;  2QGQ A;  2PMZ E;  1MJC A;  4XQQ A;  4G7H C;  1FNW A;  3FDT A;  4JYA L;  4A93 G;  3S17 B;  3I4N G;  2AUK A;  2LXK A;  2WAQ G;  3TZD A;  4EVO A;  4JI6 Q;  1YZ6 A;  4HR7 B;  2ATW A;  3EBE A;  2AWN A;  2QKI C;  3PGZ A;  1ROD A;  5IYD G;  1DXM A;  3I4N H;  1EIH A;  3TP7 A;  4X62 L;  4DR6 L;  1S5B D;  2VQF Q;  1EU3 A;  2KHS A;  3GTL H;  5FJ8 H;  3F2U A;  1UEA B;  1SYE A;  4BXX H;  3TRZ A;  1QCB D;  2R7F A;  5CGK A;  3KJO A;  2VUM H;  3P7J A;  3CD6 A;  1AE3 A;  2I5H A;  1A8V A;  4JK1 C;  1GO3 E;  1AW7 A;  1Y14 B;  3PO2 B;  2HQL A;  1XMO Q;  4QIW E;  2XVS A;  4IFD I;  1K8M A;  3G4S A;  2X6G A;  4NDX A;  1T5X D;  1XPO A;  4YCV A;  2A69 D;  2NN6 H;  4DAM A;  3EFX D;  4GZY C;  1VCI A;  3T56 B;  1YNX A;  1FVI A;  4P2C B;  3WOF A;  3M7G A;  1SYC A;  1KLU D;  4Q0F A;  4UHV A;  4NXN Q;  3STB C;  4CJ2 C;  1UEB A;  2HDL A;  3RZD B;  5C3E H;  2EYL A;  4GLX A;  1FYC A;  1A3V A;  1VQM A;  3H3V H;  2MJ8 A;  1EUJ A;  2F0V A;  4A3D H;  4M1U B;  3J81 c;  4RGN A;  3H15 A;  2HIV A;  1ICF B;  4XQN A;  5K5P A;  2JA5 H;  1U4M A;  4POG A;  1D2B A;  3VR3 A;  4PQX A;  1QZG A;  1Q46 A;  1VQL A;  1Y1W G;  1U4L A;  2Y0S E;  2B2Y C;  3FPU B;  5M5X B;  3CQZ B;  2IX0 A;  4X66 Q;  3AEV A;  3AB9 A;  1EIY B;  2JA5 B;  4KN7 C;  5K36 H;  5D14 A;  5I2Y A;  1TY0 A;  3A0J A;  4JI3 Q;  1B9M A;  1STG A;  3LGJ A;  4UAI A;  5M5W B;  1WTR A;  4ZK9 B;  3I55 A;  2F0M A;  1EFI D;  3N52 A;  4FDB A;  3SEB A;  1F77 A;  1Q1E A;  4I7A A;  3PO3 B;  2R93 G;  2EOT A;  2IHF A;  3U4V A;  1XNR Q;  4C1N K;  2EPB A;  1A62 A;  1FJG Q;  1X32 A;  1XXG A;  3KDF B;  4OHJ A;  3TSS A;  2KCT A;  5M5W H;  1IKM A;  1FNV A;  2KCM A;  4PZ8 A;  1ZXT A;  1IBK L;  2DJF C;  2K01 A;  3CXC A;  5C0X G;  3X3M A;  3R2I A;  4WJW A;  3TEH B;  5CV4 A;  1K83 H;  2ZJQ A;  1RTN A;  1L1O C;  3MAQ A;  4XDX A;  3C1F A;  5F2D A;  5LMN W;  1I4P A;  4A75 A;  4QF4 A;  3NBH A;  3ERO A;  1VQ9 A;  3A54 A;  3GTG H;  4H02 A;  3K7A H;  3J7A 5;  4GKJ L;  3W2D A;  3S1R B;  1LT3 D;  3A5Z B;  2SOB A;  4PMB A;  1DM0 B;  4DK0 A;  1CKO A;  1JOK A;  5FKA C;  1EOV A;  5I6W A;  2HHH Q;  4DR6 Q;  4HMJ A;  3HOW B;  2IHE A;  4X3K A;  2RKS A;  4CDE C;  4B3T Q;  2RHQ B;  3QOL A;  2RDF A;  5EGT A;  1KNA A;  5JEA G;  1KDC A;  1SN8 A;  4JI3 L;  2UU9 Q;  4QCL A;  1PZK D;  2IX3 A;  5DNF A;  1A3T A;  1OXS C;  4J1M A;  1VDZ A;  1T5E A;  3V96 A;  2KHJ A;  1WVL A;  2EYP A;  1CUK A;  4S3S A;  2F0H A;  5I6Y A;  1C9O A;  2I0Q A;  3NPP A;  4RKB A;  2JSO A;  5ELB A;  1JOQ A;  3H6M A;  3C3L A;  2B29 A;  4H13 C;  1V1P B;  2K50 A;  5KEE A;  1WFQ A;  3K58 A;  1K0R A;  4QB4 A;  3I56 A;  3PO3 G;  4OL7 A;  1D7Q A;  2PW5 A;  5ELN A;  3M7N A;  2EY1 A;  4IUV A;  1PH8 A;  1HQR D;  3QIA A;  3DM3 A;  1PDQ A;  3TN2 A;  2WIN B;  1VS0 A;  4A3J H;  2FIN B;  3EQL C;  5ELE A;  4BBS B;  2PNH A;  3HOY H;  2YYZ A;  1KDB A;  3QJY A;  1VQ6 A;  2A6H D;  4JC0 A;  2CCZ A;  4Y52 H;  4DGZ A;  1YJN A;  4IO9 A;  2VXW A;  4KHP L;  4B9W A;  2Q2T A;  1STA A;  4C3J B;  2R92 G;  1CI3 M;  4ABN A;  4JI7 Q;  4JI7 L;  2UXB L;  3HG9 A;  2E2H B;  2C9O A;  2ZXO A;  3NTK A;  1SR3 A;  2MFI A;  2E8G A;  2PI2 E;  3KF6 B;  2YTX A;  1Y1V B;  2Z4I A;  2ZTE A;  1I3Q H;  4B9X A;  5HUR A;  1JWS D;  1X3P A;  2B2Y A;  1P8L A;  1Y8O B;  4DK1 A;  5EPL A;  1IBL Q;  4A3E G;  5C44 G;  1QUQ B;  2VQE L;  4YWM A;  4KLK A;  4F8M A;  3G6E A;  4FXG C;  4ULL A;  1N8R C;  5M3F G;  3FHW A;  5ELC A;  5KRU A;  1CKM A;  3BYT B;  1F2M A;  2B2W C;  2KEE A;  2DNC A;  3MHB A;  3J7Z C;  5EJW A;  1XNQ L;  3SHL A;  5DM6 3;  3GTQ B;  4LF4 L;  1OO9 B;  4A3M H;  1JB7 A;  3H3V I;  2SNM A;  1YNJ C;  5IGB A;  2EY6 A;  2K14 A;  1JB3 A;  3BG3 A;  4XQJ A;  1O7Z A;  1GUS A;  1B2T A;  2A1A A;  3S1N B;  1NSN S;  3CF5 A;  1JC7 A;  3J81 i;  3RD4 A;  4XYQ A;  1CK1 A;  1D5M C;  1UUP A;  3K5M A;  5M5Y B;  2EVB A;  2R6G A;  1PH5 A;  3I72 A;  2EYF A;  4LFB Q;  4X6A H;  1ZYR C;  4DR1 L;  1SNP A;  1I94 Q;  2FMM A;  4G4K A;  2HQE A;  3TP8 A;  3CCR A;  4DR3 Q;  1PHJ A;  2JQO A;  4IFD H;  4V0B A;  1BQQ T;  2F3I A;  1PV4 A;  4OXP A;  1K3R A;  2PW7 A;  1BNZ A;  3I7F A;  3FP9 A;  1BOS A;  3FVQ A;  2X69 A;  4DAV A;  1N32 L;  2ICI A;  4AQY Q;  3PO2 H;  1D8L A;  2MPM A;  3DXJ C;  1CM9 A;  4BXX G;  2DNE A;  2HHH L;  2KHI A;  3I73 A;  1MD2 D;  3KFU A;  3L0O A;  2A5H A;  4AYB G;  2VW9 A;  2JA7 H;  1B44 D;  1SMY D;  3SK8 A;  1HNZ L;  4LAA A;  2QW7 A;  4C3I B;  4XT1 B;  4KTA A;  2TSS A;  1EWH A;  1BKB A;  1GHK A;  1GKH A;  1TVX A;  1PVO A;  4N8X 1;  3AYH B;  2NN6 G;  1E7Z A;  1X56 A;  4GS3 A;  4DR5 Q;  3NHH A;  3E0E A;  3S17 H;  2R7Z H;  4A3B G;  3OOC A;  3MXU A;  5FLM G;  1PH7 A;  1I50 H;  3NE5 B;  1IW7 C;  3E9I A;  2F0E A;  3SGI A;  5CBA E;  1K0S A;  4XYO A;  1H9J A;  1OXV A;  4MIU A;  5CBE E;  2Q2H A;  2F3W A;  2DN8 A;  3P20 A;  1E3P A;  5IWA Q;  2BA0 A;  3FKI B;  1V1Q A;  1FR3 A;  2VY3 A;  4KD4 A;  3IAY A;  4NXM L;  2N8N A;  1BCP C;  1E2Z A;  3BVG A;  4DN4 M;  4A3F G;  5NUC A;  2D5D A;  2NVX B;  1OXT A;  1N36 L;  3WOE A;  5GAD C;  1AEX A;  3S1M H;  2Q2U A;  2F4V L;  4DV4 L;  2HCI A;  2PNR C;  3GTO H;  3S15 B;  1HZ9 A;  1MGS A;  3QB3 A;  1PH9 A;  3Q24 A;  1EZ8 A;  3PIP A;  3H94 A;  1R9T H;  1YNN D;  1RL2 A;  2UXC Q;  1TS4 A;  4X65 Q;  1EQQ A;  1BF4 A;  2XRQ D;  5FLM H;  1Q81 C;  1SJH D;  4A3G G;  2VNU D;  1JWM D;  1Q1B A;  2A68 C;  3MC0 B;  4A3G B;  1O80 A;  5TSS A;  2FMC A;  4YCW A;  2F1M A;  4HAE A;  3DEP A;  4C3I G;  4TQU S;  5LMU Q;  3I4M H;  1IXR A;  1OXX K;  1UE5 A;  1J6Q A;  4LF5 L;  5FO9 B;  4BY7 G;  5K36 G;  1ASZ A;  4BY1 G;  3OIQ A; 
#chains in the Genus database with same CATH homology
 5JEA J;  3KBG A;  3J7A F;  1EQT A;  1CHQ D;  1PRT C;  2FHT A;  3DUZ A;  2PZW A;  1LT4 D;  4RH6 A;  4LK1 C;  3K7A B;  1RTO A;  1B4O A;  2KCC A;  2Q8R E;  2LS0 1;  1B1Z A;  4JBW A;  3DMU A;  1KDA A;  3MEH A;  1IHZ A;  5KGU A;  2O5J C;  5COY A;  3C1E A;  1YNN C;  1STE A;  3FMC A;  1ZKO A;  3RZO B;  4KKU A;  3GTL B;  2LY7 A;  4ME5 A;  4TKO B;  1QWY A;  4HMI A;  2Q8I B;  2B2U C;  1SBB B;  3FPP A;  2QIL A;  2K05 A;  1LAB A;  2A73 B;  3H3V C;  2ZT9 C;  1D1I A;  1R4Q B;  2CVR A;  5LL6 X;  2Y0S B;  2O5I C;  2WAC A;  4IUR A;  4V19 0;  3D6W A;  2F03 A;  3M4O B;  1PYW D;  2XNA C;  5C44 B;  4RGM A;  1C4Q A;  4CKE A;  4HN7 A;  1DOL A;  1WD1 A;  4KY7 A;  2K03 A;  1SND A;  4IUQ A;  5C3E B;  1BCP B;  3Q6S A;  1WCM B;  3L3O C;  1EY0 A;  2NVT B;  1D5X C;  4R8I A;  4U68 A;  1U4R A;  1JOO A;  3DWP A;  4ZLT F;  1V43 A;  2ENB A;  1EZ6 A;  3K5O A;  4FNF A;  1WTP A;  3PUZ A;  4OIK A;  2D62 A;  1GXD C;  4HTH A;  4QUF A;  1PXU A;  3HZX A;  1UAP A;  4BA2 I;  2EJF C;  4RFB A;  1I4X A;  4NP5 A;  4RHS A;  2V4D A;  2IPK D;  4NKL A;  1MBY A;  4A3M B;  1PFB A;  3MWY W;  4O1N A;  3J7Y W;  1ZYR D;  4CJ1 B;  3MA2 B;  1EY9 A;  2L12 A;  1TY2 A;  2XSC A;  1DON A;  1HA6 A;  3HOU B;  4C2M B;  5CMD A;  3J7A V;  2F0Q A;  2I07 B;  1HFG A;  3S1M B;  1AZP A;  3GTJ B;  2I46 A;  3D8G A;  3TP5 A;  2R92 B;  2CW0 C;  2NB0 A;  2B2T A;  5A35 A;  2JE6 I;  1RJT A;  3Q0A A;  2JP1 A;  2KED A;  3SXH A;  3H0G B;  1GOZ A;  2PQE A;  4G57 A;  4FO2 A;  2B2V A;  3NP8 A;  1D1K A;  5DAU A;  1EEI D;  3A8J E;  1OXU A;  1A3U A;  3OMG A;  2RDH A;  3OIP A;  1CFM A;  2CHB D;  3J81 E;  4IUU A;  1K83 B;  3HEJ A;  2CQA A;  3WDN A;  1G29 1;  2XIW A;  2NN6 I;  1F9S A;  1S5C D;  5EKK A;  4RHR A;  1G91 A;  3PIO 3;  3R3O A;  5CV8 A;  4ZUJ A;  2RVL A;  4K14 A;  1ENF A;  3FEW X;  1BBX C;  3SK4 A;  2BE5 D;  1H9M A;  2L1B A;  4PNY A;  1BXT A;  3GTP B;  1O7Y A;  1BCP D;  4CKC A;  1LAC A;  3PUY A;  2AQ1 B;  1LTT D;  3C2P A;  5CR3 A;  5LL6 S;  3M4Y A;  4ZRZ A;  4BBR B;  4L63 B;  4DAY A;  4UDU C;  4I65 A;  3RUZ A;  1A2U A;  2KUM A;  4J6H A;  3Q23 A;  2KQ3 A;  1NAP A;  3NXW A;  2R3Z A;  2K04 A;  2RQX A;  1CA5 A;  4RAU C;  4K6D A;  5DM7 3;  4KV6 A;  5C3X A;  3ONA B;  3FRP B;  1AZQ A;  1M4V A;  1W6J A;  4Z9C B;  1K8O A;  2C5C A;  3GD7 A;  2HDM A;  3IKJ A;  4NW2 A;  1WTO A;  4H0L C;  1EEF D;  3VR5 A;  3SDZ A;  1SAP A;  3KLS X;  3HS0 C;  2B8F A;  4FVM A;  1VMC A;  4CJ0 B;  1GJX A;  2A74 C;  3PUX A;  3VR4 A;  1EY6 A;  4KKS A;  1B53 A;  1DZ1 A;  2VB2 X;  4HSP A;  2JA7 B;  5C0X I;  4X3S A;  4BA1 I;  1U4P A;  3MVV A;  3VA5 A;  4XXE A;  1PFM A;  1AFP A;  1HFN A;  3VR2 A;  4KI0 A;  4R8N A;  1WTQ A;  1J8I A;  2VUM B;  3J80 E;  2XWB B;  4KJN A;  5A2Q L;  3K5L A;  1U9R A;  4KD3 A;  5EBC A;  4XT3 B;  2O2L D;  2XRS D;  5CV6 A;  2K28 A;  1QIL A;  2G9H D;  3KF8 A;  4CKB A;  1O78 A;  2JYO A;  4IUN A;  2KEC A;  1SYD A;  1LTG D;  5HGT A;  2BDN A;  2K7V A;  4K5X A;  3VYR A;  1A15 A;  2WAQ B;  2F0W A;  1SYB A;  2PZT A;  1Q90 A;  2EDG A;  1EIG A;  5C4X B;  1EYC A;  4BY1 B;  1EQV A;  3VYT A;  1RCV D;  4XIG S;  3PUW A;  1WD0 A;  3AMU A;  1GHJ A;  1ICW A;  3GTO B;  2BCO A;  3TP6 A;  3KLR A;  3E0J A;  5C4Z A;  3J80 L;  2NTT A;  1PTO D;  2AQ3 B;  3D31 A;  2L0C A;  2QCP X;  1TKW B;  2EE1 A;  4A3D B;  2NBF A;  2K6A A;  1PTO H;  4DXG A;  4DFA A;  1AN8 A;  4QIW B;  5CV7 A;  3OSO A;  2EY5 A;  1BO0 A;  4IAL A;  5KNC A;  5BN5 A;  2EYJ A;  1F2Z A;  3D4R A;  3QO2 A;  4PV1 C;  4QUC A;  4KHV A;  3NBI A;  4DXF A;  2JXM B;  1XTC D;  1XWE A;  4OIJ A;  3CKI B;  2Z8L A;  1FD7 D;  2B39 A;  4LJZ C;  3DEO A;  1KNE A;  4Y7N B;  3MFG A;  3KLS A;  1G8Z D;  2F0J A;  4HED A;  4L8J A;  1S5E D;  1E2W A;  3D6C A;  2K32 A;  4IFD J;  5D65 A;  5KYL A;  3N6R A;  4OO1 I;  1JIC A;  2CW0 D;  3OWE B;  4IUP A;  2XWJ B;  4RCN A;  5IGC A;  1SNM A;  2EJG C;  3A7A B;  1L0Y B;  1MSH A;  2RDG A;  2OEO A;  2MP1 A;  4ZKC B;  1ZEQ X;  1HA5 A;  4IZ8 A;  1PTO B;  1D5Z C;  1Y1W B;  2BOS A;  1ET6 A;  3W3A A;  4A3K B;  3EA6 A;  2NVQ B;  1I3Q B;  4ILW A;  2EY2 A;  3JAM L;  5C5M A;  5M9O A;  4BWG B;  2LMC B;  5ELD A;  2PMZ B;  1ESF A;  3R8B A;  4G7O C;  3NSW A;  1CZG A;  4F7X A;  1GUN A;  1HUN A;  5ISR A;  1VF5 C;  1I50 B;  5KYI A;  5E1F A;  3GTM B;  5IGF A;  3OWF A;  1HQM C;  1VF7 A;  4DNR B;  2EYO A;  4L6T B;  4A3J B;  1QG7 A;  5J39 A;  2A69 C;  2F4I A;  4TRD A;  2BA1 A;  3M3Y B;  2E74 C;  3I91 A;  3EJI A;  2K5Q A;  4PMC A;  2SEB D;  2K1B A;  5C4H A;  1L0X B;  1F2L A;  4OGQ C;  1HXY D;  4FP5 D;  2NUC A;  1NR2 A;  5BN3 A;  3CU7 A;  5EKL A;  2EXZ A;  3SK5 A;  5C3W A;  5FOB B;  1TU2 B;  4EQN A;  1Z47 A;  2B63 B;  5CYU A;  2MHV A;  5CV9 A;  3BDC A;  1SE2 A;  1PRT B;  1SEB D;  2Z4H A;  2N55 A;  2WKC A;  2TMP A;  2ZXP A;  1SNO A;  3PV0 A;  5JPN C;  2QF7 A;  3NWT A;  5JAV A;  3G6J B;  5E4X A;  1TWF B;  3V05 A;  1QB5 D;  2F0O A;  5IT9 E;  2VB3 X;  2E2J B;  1JE4 A;  5KNB A;  2IX1 A;  2AUJ D;  3PUV A;  3TZU A;  2D2C C;  4N9P A;  5LHY 1;  2QEJ C;  4IN3 A;  3K0Y A;  3KK7 A;  3E5S A;  3GTG B;  1ENA A;  3HRZ C;  1PZJ D;  5BN4 A;  1IW7 D;  1BUV T;  3A56 A;  5JVG 3;  2F0U A;  5D3I B;  1EY8 A;  3K59 A;  5JEA H;  3KUP A;  1S5F D;  2JEA I;  3C46 A;  2SDF A;  3SR1 A;  1ILP A;  1FGB D;  3MTS A;  1F9P A;  1QE6 A;  4X3T A;  1B3A A;  4RKL A;  2ZXR A;  1MI2 A;  4K6L A;  2JA6 B;  3P1H A;  2HCC A;  3GO5 A;  2B8G A;  1RHP A;  2KCN A;  4F88 A;  3IFD A;  3NUC A;  3ND9 A;  3OPO A;  4H44 C;  5IGE A;  5T1G A;  3HOZ B;  2R93 B;  2B2V C;  3GV3 A;  1I4Q A;  4RWS C;  2E2D C;  3NTH A;  3T4A C;  2PZU A;  1JCK B;  3NK9 A;  1TT2 A;  3LWU A;  3BDL A;  3OW7 A;  3TME A;  1Q12 A;  2EYH A;  2BE5 C;  2A6E C;  1EYA A;  3AU7 A;  5JPM C;  2L4N A;  1PRT F;  1Y8P B;  3HKZ B;  1GUO A;  3ERQ A;  5CV5 A;  2L5T A;  3A8I E;  4IQZ A;  3O13 A;  5KIX A;  1DCZ A;  3SE0 A;  4NMZ A;  2K5W A;  3CHB D;  2G9D A;  5I9P A;  4X3U A;  3CRL C;  3H09 A;  2B2U A;  1H9K A;  1KTK A;  5JOB A;  2RBM A;  2Z1C A;  1SFO B;  1PFN A;  2L9H A;  3V2T A;  2MUY A;  2ICE C;  3VR6 A;  1Q3L A;  5J22 A;  1TWG B;  1D6E C;  2SNS A;  4IUT A;  1CT1 D;  3BYY B;  3K5N A;  3PMF A;  1ONL A;  1ENC A;  1EL0 A;  1SYF A;  2F0G A;  2PCF B;  5DEH A;  3K6O A;  3IL8 A;  4K8I A;  2LKV A;  1PRT D;  4K5V A;  4A93 B;  1LT5 D;  3LNN A;  3BZD B;  5I9O A;  3BVZ A;  2H4O A;  4DU9 A;  1C48 A;  1S4Z A;  2QDB A;  1G6Z A;  3URY A;  1HPC A;  2N88 A;  4M8A A;  1GUT A;  1XYI A;  2DY8 A;  5M3M B;  3I90 A;  4C3J G;  5FLX L;  5FLX E;  1M8A A;  4ID6 A;  3D4D A;  4KY6 A;  4FF4 A;  1G2S A;  5A2Q E;  2B2W A;  3ITP A;  4RGT A;  4QMG A;  1F9Q A;  3GP7 A;  4K2L A;  1HUM A;  1KAB A;  3GQB A;  1LV9 A;  3R2T A;  1STH A;  2M9V A;  5C0X J;  4XTC S;  4CHT B;  4FXD A;  4Q5V A;  2JEB I;  1EY5 A;  4YIJ A;  5EPK A;  2MGS A;  2NTS A;  4A3E B;  1PTO F;  4O42 A;  2RA4 A;  4EGV A;  4N9T A;  1DYQ A;  2RSO A;  1LO5 D;  1SE4 A;  2K5D A;  5IGG A;  3OMC A;  3GV6 A;  4MN3 A;  1TII D;  4K8J A;  2F0S A;  5IT9 L;  3H91 A;  1GUW A;  2R7Z B;  3S1Q B;  5E4W C;  4HSV A;  4DNT B;  1NUC A;  3SK6 A;  2F0I A;  2LFN A;  1NCV A;  1RF2 D;  5E3F A;  2L11 A;  1IL8 A;  2EYM A;  3BVM A;  5JVH 3;  3VYU A;  3EVQ A;  1F9R A;  1CQF A;  3S2D B;  3S16 B;  1HTL D;  3Q22 A;  2F0D A;  1LTR D;  1ML0 D;  3P75 A;  1BDO A;  5I2X A;  4KKT A;  2X6L A;  2AQ2 B;  3T53 B;  3J81 L;  1EWC A;  3HP3 A;  3K57 A;  1E2V A;  2L55 A;  3G7L A;  2IT1 A;  1ESR A;  1TS3 A;  1H9S B;  3LX0 A;  2IW3 A;  1WTX A;  1IYU A;  1IKL A;  3DWA A;  5COR A;  1S5D D;  2OXP A;  1H9R A;  3E6Z X;  2EZV A;  1PMR A;  4K5W A;  1II3 A;  3OHX C;  2E2I B;  1AP0 A;  1KAA A;  1EU4 A;  5JJZ A;  2YU9 B;  4EQO A;  3DM1 A;  2J0T D;  1LTA D;  2M00 A;  3I70 A;  1JOR A;  3MXG A;  1F2Y A;  3KBX A;  1SE3 A;  2O4X A;  2KJX A;  1RDP D;  5C5L A;  3TDQ A;  1STY A;  1SSO A;  3RLF A;  1PLF A;  2WV6 D;  1GUG A;  5C4J B;  5T1I A;  4ZQ3 A;  1YNJ D;  2H1E A;  4IFD G;  3JAM E;  4HCE A;  3T13 A;  4ZKB B;  1JR0 D;  1O7L A;  4KY5 A;  3D3R A;  2BDO A;  2RSN A;  3X3N A;  2F0N A;  1R4P B;  1C8C A;  2WP8 J;  4DA2 A;  3PIP 3;  1SMY C;  3I3C A;  3SVM A;  3DWQ A;  2A6H C;  1Z6H A;  1B50 A;  3QOJ A;  1BCP F;  2A6E D;  1JQY D;  1B9N A;  5J1Z A;  1V1O A;  3I4N B;  1QNK A;  1IYV A;  4EQP A;  4OO1 H;  1SYG A;  3VA7 A;  3MFY A;  4E6I A;  2GA4 B;  3BDO A;  2KVM A;  1KLG D;  3UI2 A;  2E75 C;  5EBD A;  1SXT A;  2WB1 B;  1TQO A;  3D4W A;  3HOY B;  4RCO A;  1Y8N B;  3MZ5 A;  3DHQ A;  1Z7T A;  3T51 B;  4J8Q A;  4R9W A;  1DOK A;  1HHV A;  4RGO S;  1DD2 A;  4ZUI A;  1PTO C;  1Y69 U;  3S14 B;  3S9W A;  1LT6 D;  3VYS A;  1QJO A;  2M2L A;  1PZI D;  4ZAI A;  4B08 A;  5IIF A;  1HCZ A;  4OO1 G;  2NVY B;  4K2K A;  4HCS A;  1CTM A;  1STN A;  1ET9 A;  2OF1 A;  1HTP A;  2J4X A;  2KA7 A;  3L7Z C;  1LLR D;  1WTV A;  2F0P A;  2PO4 A;  5EPJ A;  2WKD A;  5C6A A;  2R61 A;  5FK9 C;  1ILQ A;  1VMP A;  1CQV A;  2KOL A;  4FF1 A;  1A2T A;  4TSS A;  3NQI A;  4DAP A;  1NR4 A;  1SJE D;  1LTS D;  3MXN A;  1I4G A;  5FO7 B;  1I6H B;  1Q8I A;  1H9S A;  4C3H B;  4ODG A;  5D3D A;  1TR5 A;  4FF2 A;  1W6K A;  2A68 D;  4KMU C;  5IGD A;  2D9U A;  1MSG A;  1BR9 A;  2WII B;  4KHZ A;  4G7Z C;  1TS2 A;  5FO8 B;  2ID0 A;  5G3L D;  3CRK C;  1TWC B;  1EY7 A;  1RD9 D;  3MXP A;  5IOD A;  3A7L A;  1JWU D;  2Q8T A;  4A3F B;  2NYZ D;  1CA6 A;  1CHP D;  2F0T A;  5EQ0 A;  1XX8 A;  3U9S A;  1CZW A;  4H7B A;  2JA8 B;  2PYK A;  3QWN A;  1HRJ A;  3GTK B;  2PPB C;  2J7Z A;  4C1N I;  4KN4 C;  1A6X A;  3R93 A;  4U67 3;  3HOV B;  3NWS A;  4BY7 B;  2HUG A;  1SNQ A;  1TWH B;  3QG1 A;  4FF3 A;  5EKI A;  1V1P A;  5CC4 A;  2F3V A;  4PMW A;  1TS5 A;  4ZYS A;  2B2T C;  4FXK C;  3M85 A;  1LTB D;  5G3L F;  2IJ0 A;  1X3Q A;  5KND A;  3RMH A;  2NZ1 D;  2EJM A;  1SNC A;  2OT2 A;  3HGB A;  4CBV A;  3LWE A;  4MHE A;  1QNU A;  3S2H B;  1STB A;  4KJO A;  1J9O A;  4WOR A;  4KK7 A;  3I4M B;  2E76 C;  2IL8 A;  1DOM A;  3U9O A;  4BS9 A;  3ZYY X;  5C0X H;  1DJR D;  1I4R A;  3A55 A;  2F0K A;  1EY4 A;  3HOX B;  3T16 A;  1R9T B;  2FFK B;  1FNU A;  4WRD A;  3L9A X;  2NWG A;  4A3B B;  2FJ2 A;  2AWO A;  5I4D A;  1G2T A;  4I7Z C;  4F87 A;  4C3H G;  4A3I B;  4FYD A;  2IWH A;  2F0F A;  1EOT A;  1V8Q A;  2F0L A;  3A8K E;  4WFN 3;  4LMQ D;  1E0B A;  3IFT A;  4CGY B;  3ND8 A;  2K33 A;  3I8Z A;  1LTI D;  1EYD A;  1I6V C;  3TBI B;  4RA8 A;  1QOH A;  4DF7 A;  5M3F B;  4AYB B;  1SDF A;  3BS1 A;  1WTW A;  3I4L A;  1RKN A;  1TWA B;  2XN9 C;  3NTI A;  5AFW A;  4C56 C;  1UNS A;  3NQT A;  5IOC A;  5ELF A;  1I4H A;  2DY7 A;  4XQQ A;  4G7H C;  1FNW A;  3FDT A;  3S17 B;  2AUK A;  3TZD A;  4EVO A;  4HR7 B;  2AWN A;  2QKI C;  1ROD A;  1DXM A;  1EIH A;  3TP7 A;  1S5B D;  1EU3 A;  2KHS A;  3F2U A;  1UEA B;  1SYE A;  1QCB D;  5CGK A;  3P7J A;  4JK1 C;  1AW7 A;  3PO2 B;  2XVS A;  4IFD I;  1K8M A;  2X6G A;  4NDX A;  1T5X D;  2A69 D;  2NN6 H;  3EFX D;  4GZY C;  1VCI A;  3T56 B;  4P2C B;  3WOF A;  3M7G A;  1SYC A;  1KLU D;  4Q0F A;  4CJ2 C;  2HDL A;  3RZD B;  2EYL A;  1FYC A;  1A3V A;  2MJ8 A;  2F0V A;  4M1U B;  4RGN A;  4XQN A;  5K5P A;  1U4M A;  1D2B A;  3VR3 A;  4PQX A;  1U4L A;  3FPU B;  2B2Y C;  5M5X B;  3CQZ B;  2IX0 A;  3AB9 A;  2JA5 B;  4KN7 C;  5K36 H;  5D14 A;  5I2Y A;  1TY0 A;  1B9M A;  1STG A;  4UAI A;  5M5W B;  1WTR A;  4ZK9 B;  2F0M A;  1EFI D;  3N52 A;  3SEB A;  1F77 A;  1Q1E A;  3PO3 B;  2EOT A;  4C1N K;  2EPB A;  1X32 A;  1XXG A;  4OHJ A;  3TSS A;  1IKM A;  1FNV A;  1ZXT A;  2K01 A;  5C0X G;  3X3M A;  3R2I A;  4WJW A;  5CV4 A;  1RTN A;  3MAQ A;  4XDX A;  3C1F A;  5F2D A;  1I4P A;  4QF4 A;  3NBH A;  3ERO A;  3A54 A;  3W2D A;  3S1R B;  1LT3 D;  2SOB A;  4PMB A;  1DM0 B;  4DK0 A;  1JOK A;  5FKA C;  5I6W A;  4HMJ A;  3HOW B;  4X3K A;  2RKS A;  3QOL A;  2RDF A;  5EGT A;  1KNA A;  5JEA G;  1KDC A;  4QCL A;  1PZK D;  2IX3 A;  5DNF A;  1A3T A;  1OXS C;  4J1M A;  1VDZ A;  1T5E A;  3V96 A;  1WVL A;  2EYP A;  4S3S A;  2F0H A;  5I6Y A;  3NPP A;  4RKB A;  2JSO A;  5ELB A;  1JOQ A;  3H6M A;  3C3L A;  4H13 C;  1V1P B;  5KEE A;  3K58 A;  4QB4 A;  4OL7 A;  2PW5 A;  3M7N A;  2EY1 A;  4IUV A;  1HQR D;  3QIA A;  1PDQ A;  3TN2 A;  2WIN B;  4BBS B;  2FIN B;  3EQL C;  5ELE A;  2YYZ A;  1KDB A;  3QJY A;  2A6H D;  4DGZ A;  2VXW A;  4B9W A;  1STA A;  4C3J B;  1CI3 M;  4ABN A;  3HG9 A;  2E2H B;  2C9O A;  2ZXO A;  3NTK A;  1Y1V B;  2Z4I A;  4B9X A;  5HUR A;  1JWS D;  1X3P A;  2B2Y A;  1Y8O B;  4DK1 A;  5EPL A;  4F8M A;  4FXG C;  4ULL A;  5KRU A;  5ELC A;  1F2M A;  3BYT B;  2B2W C;  2KEE A;  2DNC A;  3MHB A;  5EJW A;  3SHL A;  5DM6 3;  3GTQ B;  1OO9 B;  2SNM A;  1YNJ C;  5IGB A;  2EY6 A;  3BG3 A;  1JB3 A;  4XQJ A;  1O7Z A;  1GUS A;  1B2T A;  3S1N B;  1NSN S;  1JC7 A;  3RD4 A;  4XYQ A;  1CK1 A;  1D5M C;  1UUP A;  3K5M A;  5M5Y B;  2EVB A;  2R6G A;  3I72 A;  2EYF A;  1ZYR C;  1SNP A;  2FMM A;  4G4K A;  2HQE A;  3TP8 A;  4IFD H;  4V0B A;  1BQQ T;  2PW7 A;  1BNZ A;  1BOS A;  3FVQ A;  2X69 A;  4DAV A;  2ICI A;  2MPM A;  3DXJ C;  1CM9 A;  2DNE A;  3I73 A;  1MD2 D;  2A5H A;  1B44 D;  1SMY D;  3SK8 A;  4LAA A;  4C3I B;  4XT1 B;  4KTA A;  2TSS A;  1EWH A;  1GHK A;  1TVX A;  2NN6 G;  3NHH A;  3OOC A;  3MXU A;  3NE5 B;  1IW7 C;  2F0E A;  5CBA E;  4XYO A;  1H9J A;  1OXV A;  4MIU A;  5CBE E;  2F3W A;  2DN8 A;  3P20 A;  2BA0 A;  3FKI B;  1FR3 A;  4KD4 A;  3IAY A;  1BCP C;  1E2Z A;  3BVG A;  4DN4 M;  5NUC A;  2D5D A;  2NVX B;  1OXT A;  3WOE A;  1AEX A;  2HCI A;  2PNR C;  3S15 B;  1MGS A;  3QB3 A;  3Q24 A;  1EZ8 A;  3H94 A;  1YNN D;  1TS4 A;  1BF4 A;  2XRQ D;  1SJH D;  2VNU D;  1JWM D;  1Q1B A;  2A68 C;  3MC0 B;  4A3G B;  1O80 A;  5TSS A;  2FMC A;  2F1M A;  4HAE A;  3DEP A;  4C3I G;  4TQU S;  1OXX K;  5FO9 B;  5K36 G;  3OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...