1EEID

Cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHOLERA TOXIN B)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eeiD00
1SE3A 1D5XC 1SJED 1CT1D 3KLSX 1S5DD 4RGTA 1D6EC 1UNSA 4RGMA 1BCPD 1AW7A 3MFGA 1JWMD 5FK9C 1SJHD 4RCOA 2O2LD 1LLRD 5ELCA 1PRTF 2SEBD 3BVZA 4RHSA 1L0XB 1G8ZD 1V1OA 1LO5D 1EWCA 2CHBD 1UUPA 5D3DA 3BVGA 1FD7D 1JCKB 1HA5A 1HXYD 2AQ2B 2RDGA 1GOZA 2NTSA 3DWQA 5ELDA 1CHQD 1V1PB 3TSSA 4O1NA 4RHRA 1TS3A 4BWGB 1LTTD 1F77A 1S5ED 2XN9C 2R61A 3R2TA 1LTID 3DWAA 3O13A 1MD2D 1JQYD 1EU4A 1PTOF 1I4QA 1L0YB 2XRSD 2XRQD 1PZJD 1JWUD 1I4RA 2AQ3B 3W2DA 4C56C 1S5CD 3BZDB 4L6TB 1S5BD 1AN8A 3EA6A 4DXGA 3DWPA 1RF2D 3GP7A 1M4VA 5I4DA 1B44D 1ENFA 1LT3D 4K6LA 2J4XA 1HQRD 1EEID 1V1PA 1PYWD 1PRTB 1XTCD 3SEBA 1SEBD 1KTKA 3R8BA 1KLGD 1LT5D 4L63B 1I4GA 1PZKD 1LT4D 1PRTC 5ELBA 1BCPF 1ESFA 3EFXD 5D3IB 1EEFD 1I4HA 3BYYB 2IPKD 2Z8LA 1JWSD 3OWEB 1XXGA 2WV6D 1SXTA 1PTOB 1KLUD 1EFID 3BYTB 3MC0B 1PRTD 5TSSA 1S5FD 1TY0A 2RDHA 2XNAC 1SE4A 2ICIA 1PTOC 1QILA 2IJ0A 5FKAC 1I4PA 2AQ1B 1BXTA 2TSSA 1TS5A 1EU3A 1SBBB 3CHBD 1FNVA 4RGNA 1LTRD 1RD9D 1LTGD 1LT6D 1CK1A 2NTTA 4RGOS 1RDPD 4RFBA 4DXFA 1PTOD 1D5MC 1DYQA 3URYA 1LTBD 1TS2A 1LTAD 1PZID 1TS4A 1CHPD 1PTOH 4ZYSA 3V05A 1BCPB 1FNWA 2QEJC 1LTSD 1SE2A 5ELFA 1D5ZC 1T5XD 5ELEA 3R2IA 2G9HD 1I4XA 4OHJA 1CQVA 4RH6A 1ET9A 1JR0D 1BCPC 1TY2A 4UDUC 3BVMA 1B1ZA 1DJRD 1FGBD 4Z9CB 1FNUA 1RCVD 4TSSA 1STEA 1HTLD 2QILA 1ET6A
chains in the Genus database with same CATH superfamily
1FGUA 2LXKA 1CT1D 5AFWA 2RCFA 4I65A 4RGMA 5DM63 1K3BC 4GLXA 3RZDB 3G4SA 4A4IA 1AZQA 4RCOA 1EIGA 4G57A 4R4TA 1Q1EA 3HKZG 2JYOA 2OTJA 4AYBE 3KF8A 5E7NA 2N49A 4BY7B 1NJIC 2MO0A 3OHXC 2BH2A 4JI4Q 2Q8TA 1W3SA 1LTTD 1D1KA 1FVIA 3K59A 1SR3A 2WB1G 5JJLA 3CPFA 1SRUA 1PFNA 3I3CA 4UY8C 4LUZA 2BOSA 5A2QL 1KAWA 2VXWA 3CKIB 1LACA 4B3TQ 1QNKA 3W1GA 2BE5C 2J4XA 2F3VA 3HOZG 3EVQA 4Q0FA 4HAEA 3HGBA 1PH8A 3S1NB 2FFKB 4R1JA 4YCWA 3HEJA 3IFTA 5IWAQ 2VUMG 4YWLA 4OWTB 5C6AA 1DXMA 4A3KH 3E3XA 2HIVA 2V4DA 2GA4B 1F9SA 2A5HA 4C3HH 2B2VA 3VDYA 2F0LA 2TMPA 5DLQE 4M8AA 1Q12A 2YV5A 2F0KA 2ICIA 1PHJA 4GNXC 2F1MA 3BDLA 3V2TA 4AIMA 4G7ZC 2EVBA 1B9MA 3S2DH 3I4NG 2VL6A 3CHBD 2B8GA 4HIDA 1JB7A 2I0QA 4F8MA 3HOZH 1TWFH 3KYHC 1EYCA 4FO2A 2A6EC 3UDGA 5JAVA 1GUOA 4KJOA 4DAPA 3I72A 2VUMH 1RODA 5C4JB 5LMNL 3NWTA 2WAQE 3E0JA 1IZ6A 1XNQL 1ILPA 4RH6A 4YIJA 4NXNL 1I50H 3OW2A 1R9TH 4DNIA 5LL6X 3TN2A 1SYCA 1N34L 3SEBA 2DY7A 5EKLA 4XXEA 1V43A 3KLSX 4KHZA 2JA6B 1BBUA 1KAAA 2EXDA 3I4NH 5EKKA 1QE6A 2N78A 4JYAQ 2MUYA 1YNJD 1S40A 1UUPA 3HKZE 2K05A 1HXYD 2CQAA 1EY6A 2Y0SG 3J7AV 1JICA 2EY2A 4AYBB 3R93A 5EKIA 1GHKA 3RZOB 1UE5A 2KCMA 2B2UA 5T1GA 2EJMA 2MO1A 3I4MB 1STAA 3S16B 1IYJB 2CH4A 2F0HA 4IQZA 2EYOA 4XQNA 4HJAA 2VQFL 3PUXA 1Z47A 3MA2B 1CA6A 3VYTA 2I5MX 2DY8A 1VQMA 4EX5A 1TQOA 1VQBA 5I4DA 1E1OA 5IYBG 4IUNA 4KKUA 3JAMc 3S15H 4GKJQ 1AEXA 1X56A 3GTJH 1HA6A 4A3LG 2P5ZX 3J7YW 4YY3L 3K58A 3H09A 1HNWQ 3QB3A 1CKNA 1T9HA 4ID6A 3KJPA 4Y7NB 1LYLA 3FKIG 1K0SA 1YHAA 4FXGC 1EQRA 3J80E 2EY1A 3OTOL 1IBKL 5EAYA 2WINB 2SNMA 3HOYG 3ULLA 4JW0A 4X66Q 4IFDG 2QDLA 3GTGB 3U58A 2ZXOA 4GZYC 2LS01 5CV7A 2E5LQ 1BO0A 1BXTA 1B4OA 2I5LX 1TKWB 1SMYD 4OGQC 5IYBH 5ISRA 1LTGD 2EYFA 2K75A 3M3YB 3HRZC 4A3MB 1JOOA 1PTOD 4A3LH 1WJJA 1PV4A 4CKCA 1LTAD 2BA0A 1YIJA 1IBML 1RTOA 3K0XA 1C4QA 5CV8A 2IX1A 5ELEA 3FKIH 2L15A 2YTYA 5BR8Q 4IUUA 4B3RQ 3HOYH 1FNUA 4QL5A 2ZJPA 2WAQB 4IFDH 3QR8A 3PUYA 2OQKA 3I90A 1ET6A 1STHA 2QF7A 3NBHB 5A35A 2K5NA 3QIAA 1R4PB 2YTXA 3IFDA 4ODGA 4DV0L 1JWMD 1EL0A 4JI4L 4U673 1SJHD 4POGA 4MN3A 1PH2A 2PI2E 5JEAG 1E24A 1YEZA 2LSSA 4KK7A 2EYPA 4JBJA 4HIKA 1NCVA 3S1QH 1HA5A 5FJ8H 2K5HA 3A0JA 2NTSA 3DM1A 4P71A 2UXCQ 4O1NA 2EOTA 4B3TL 4A93G 1QG7A 4XQQA 3HKZB 4MHEA 2ZM6Q 1AH9A 2IT1A 3CP0A 2K50A 4OEMB 2B63B 3IAYA 3A5ZB 5CGKA 1SNDA 2KENA 4YWKA 5LMNW 1OXUA 3H94A 5C5LA 1X3GA 1NAPA 4A3KB 5C0XI 1EY0A 3BS1A 1I6VC 4C3HB 3X3NA 4X65Q 2VW9A 4BA2I 3GTKH 5IWAL 1Q3LA 1K28A 2ICEC 3ZYYX 5JEAH 4H7BA 2FJ2A 4A76A 3D8GA 3RN2A 3S2DB 1A3UA 4L5SA 3WDNA 3G7LA 3NE5B 5K36G 2EDGA 4A93H 1TWFB 5IP7H 4LFBQ 2JXMB 3OWEB 1UE1A 3UE0A 1VQJA 3G6EA 1HQMC 1SYGA 1KQSA 3EBEA 5C3XA 1D1IA 5KNCA 1Q8IA 4IPCA 2VUMB 1NR4A 2AKWB 2AUKA 2BDOA 2LMCB 4PV1C 3J81L 1EOTA 2K52A 2AQ1B 4JOIC 4H02A 1R9TB 4A3GH 3KOJA 3QOLA 1RIPA 3MFYA 2PZTA 1ZEQX 1RD9D 1Y14B 1O7YA 2F4IA 1GUGA 3MZ5A 1RDPD 3I91A 2UUAQ 1X3PA 4BA1I 3SK4A 1K9MC 3S24A 2F0EA 4DR3Q 1J6QA 2MP1A 1L1OC 1D5ZC 3ICEA 1HRJA 3GTMB 4ME3A 2RHQB 3A54A 2B39A 1B1ZA 4DR7Q 4JYAL 1NNXA 4L5TA 1TWHH 1EOVA 4PZ8A 1WTPA 3IRBA 5M9OA 2Q2IA 4K8JA 2NZOA 4EQ5A 3GTOH 3KFUA 3PO3G 1Y8PB 4BXXG 4GN4B 3FPUB 1L0XB 1Y1WG 2K4KA 2DJGC 2PO4A 2WIIB 3T53B 1SMXA 5KYLA 4IPGA 4OIJA 4LF5Q 3J80i 2NZHA 3S15B 4CJ1B 2F3WA 3STBC 3GTJB 4NW2A 1K8OA 2GN5A 1PTOF 2WKDA 3M4YA 3ERQA 1WD1A 4FDBA 3M4PA 4BY7G 3SK6A 1VQ6A 4IUPA 2B29A 3N52A 2A73B 3OYYA 1PH4A 3GP7A 1BVSA 4R8NA 3PO3H 3VR2A 4BXXH 4JI3Q 3A56A 1E7ZA 1YBYA 3FPPA 1KHIA 4R9WA 3SK8A 4X66L 1JJGA 1HFGA 2LKVA 4DK3C 4OL7A 1ESFA 3CCLA 2X6GA 1EEFD 1K8MA 3EIVA 5M3MH 4XTCS 2E5LL 1XXGA 4QY7A 4JBKA 1G6ZA 5FLXL 1VQ8A 3J80c 1SMYC 3BYTB 3I55A 5TSSA 1TIID 2IX0A 3FKIB 1PTOC 4OO1I 3KLWA 3MEHA 1I4PA 3CMAA 1L2FA 2F0PA 3HOYB 1DZ1A 5I2YA 2I46A 1CK1A 2ZT9C 4LF7Q 1H9SA 5BR8L 4PMCA 1DYQA 5M5YH 4B3RL 1PZID 3CCRA 4DR6Q 2H1EA 3V05A 1FNWA 1SROA 3P75A 1SAPA 2CW0C 5KGUA 5IIFA 3S1QB 4OHJA 5JPNC 3E5SA 3CC4A 3NENA 4A3DG 3ONAB 4IUTA 4BBRG 4GN5A 3VR4A 4K0KQ 3D0FA 1WTWA 3MXNA 2OTLA 1D5XC 3WWVA 2B3GA 5JJIA 1GO3E 2UXCL 2YYZA 3FVQA 4FYDA 1VQ5A 1U0LA 5CR3A 1C9OA 4PG3A 2ZM6L 4RHSA 1GKHA 2RQXA 1CSQA 2KCCA 5KEEA 4GOPA 4ZK9B 3GTKB 2RHSB 1U5KA 4DAMA 2JA6G 3VR5A 1H9RA 2HHHQ 5FOBB 2L5TA 3O13A 1R4QB 4X65L 4V190 1UE6A 2OEOA 4QUCA 5EGTA 4FF2A 3TRZA 1WTHA 3IL8A 2O5JC 4A3DH 4A93B 3TP7A 2QCPX 4BBRH 5DAUA 3CC7A 2V1CC 3ITPA 2X69A 4ME5A 1CKMA 1S3OA 3LGJA 4DV3Q 1F2ZA 1Z6HA 3V96A 1ENFA 4IPHA 3I4MG 4X3SA 4WFN3 1MI2A 3GQBA 1RTNA 3UDFA 2R7DA 1EUJA 1SEBD 2PPBC 4A3GB 1B50A 1PZKD 2DNEA 1Z7TA 3CU7A 3TREA 4APVA 2NVXB 3FHWA 1VQ4A 2JA6H 3HG9A 4A3IB 1MHWC 3B6YA 3DMUA 1DOLA 4XT3B 2WACA 4KN7C 4AH6A 1EFID 2E2IH 2PQAB 1D2BA 2UUAL 2ZJRA 4U68A 2Z1CA 1AE2A 3J81j 1QZHA 3J7A5 4DR3L 5IP9G 4FXKC 2TSSA 4HIMA 1AE3A 1S72A 1J5EQ 1TWHB 3J7AF 5HURA 1PFSA 4C2MH 4RFBA 1K8GA 1PH7A 1VQOA 4OIKA 5IYCG 3GTOB 4DN4M 3NBIA 1TS2A 2ZJQA 4EQOA 4DR7L 5D14A 5GAHC 2D5DA 1PTOH 4ZYSA 1EY5A 3CCMA 5ELFA 5GROA 1YNND 5BN5A 1I4XA 4IFDJ 1LUZA 1ET9A 4A3MG 2Q8RE 2LXJA 4UP8A 3H15A 5I6YA 1MJCA 2K14A 4GKKQ 1ZYRD 3QG1A 4TSSA 1STEA 3PV0A 1X3FA 2EE1A 3W3AA 4J8QA 2XTIA 4LF5L 1S5DD 3SR1A 2E2JH 1BCPD 5IP9H 3TZUA 3L2PA 3AYHB 2SDFA 4O2DA 4P75A 1H95A 1LO5D 3K7UC 2HCIA 2WAQG 3VR6A 3OIQA 4KHPQ 3PO3B 1CHQD 1V1PB 5E1FA 3K81C 2D9UA 4KY6A 4X6AH 1GUNA 2B2TA 2XN9C 3SE0A 3R2TA 4A3MH 3K57A 3JC66 4JI3L 4C56C 4ZQ3A 1JC7A 1RKNA 4L6TB 5M3MB 1Q86C 1E0BA 4A3EH 1WD0A 2PYKA 1BBWA 2Z6BA 1RF2D 5JEAJ 2UU9Q 1Q81C 3PIP3 2B2YA 1J8IA 4IUQA 2CH4W 1SYFA 1E2ZA 2R7ZH 2B63G 4JV5Q 1OO9B 1JMCA 3TP5A 4DV0Q 4TQUS 2K5QA 3A8JE 4A3KG 1PH5A 2NVYH 2G5DA 4C3HG 4JVZA 1N36Q 1EQVA 5IGDA 3ZJYC 5M5YB 5I6WA 4KMUC 4NDXA 4J1MA 5HGQA 5M3FH 3I4OA 1PH3A 1Z9FA 3NTHA 1UEAB 5LL6S 4LF7L 4QQBX 1BDOA 3DEOA 1Q7YC 2JE6I 1VQ7A 1QILA 1VQPA 3EJIA 3TQYA 2EZVA 1C7YA 4DR6L 1DOKA 3BZCA 2L4NA 4XYOA 1BR9A 4LMQD 1II3A 3T16A 1ICFB 2AWOA 2HUGA 1XPOA 2B2UC 2B63H 4DXFA 3OSOA 3GTQH 3URYA 1L1OB 1XNRQ 1JT8A 4K0KL 3NPPA 4KV6A 1XJVA 3EQLC 3R2IA 1NUCA 4C3JG 3TMEA 2E74C 2KBNA 2KECA 3P1HA 1KDBA 3NQTA 1N33Q 1CI3M 3E9IA 4L5RC 3MXGA 4CDEC 1SJED 1IBLL 1NY4A 1GHJA 4A3DB 2A69D 4BBRB 2HHHL 2JK8A 4DK0A 2LFNA 2NWGA 1LLRD 3MAQA 1HZ9A 2HCCA 1HFNA 4CJ2C 2ASBA 3GO5A 2RDGA 4NKLA 1YVCA 3BU2A 1EWIA 1B53A 3TSSA 2L55A 1ILQA 1SNMA 1C8CA 2F0QA 2Q2UA 5GAEC 2PQEA 2KQ3A 4ZRZA 2GVAA 2R92H 5C0XH 2F0IA 2MHVA 4K5WA 4DV3L 1L0YB 4C3JH 3FMCA 4K14A 3T56B 3D4RA 4DV4Q 1SLJA 1YI2A 1G6PA 3A55A 2QA4A 1VQAA 2JA5G 4JI6Q 4JI8Q 1ASYA 3GTMH 2E2IB 4XT1B 3CXCA 3JAML 2PI2A 4ZUJA 1KDCA 1PYWD 2PW5A 4FF1A 4WJWA 5IGBA 1EYGA 1BCPF 4C2MB 1M1KC 2F0FA 5CV9A 1VQDA 3I2ZA 3STBD 4NXMQ 1J5EL 1SXTA 4JC0A 1PTOB 3CF5A 1TWCH 3F8TA 3RUZA 5FO9B 1EYDA 3GV6A 1QUQB 4X64L 2VB3X 2JA5H 1JOKA 3NTIA 5M5XH 2FXQA 2K03A 2MQHA 5CMDA 4ZUIA 3PIO3 5K5PA 5E4WC 1JORA 1YNNC 1MIUA 3PF4A 1DOMA 2E2HH 1A0IA 1YJNA 2E2JB 1TS4A 2VZAA 3M85A 4GKKL 1WTXA 1ZYRC 2MJ8A 1NBWA 3UI2A 1A3TA 4POFA 3M7NA 1VS0A 3RLFA 2RKSA 2R7FA 4HCEA 1CKOA 1BCPC 4DUZL 1TU2B 5HY6A 1VCIA 3UE1A 1HNXQ 2VY3A 2L12A 3RN5A 1YHBA 5DEHA 4KHPL 3KLRA 2BDNA 4PNYA 3G48A 4DNRB 4H0LC 3MFGA 1TVXA 2F0NA 4LK1C 1B3QA 1U4PA 5FJ8G 4UPAA 2MPMA 2QW7A 4QJFA 4A3EB 3GDEA 5DM73 1N8RC 3D4WA 2CHBD 3PIOA 2N3SA 1TR5A 2M9VA 1Y8NB 2KVMA 2KEEA 1MSGA 4YCUA 3CMEA 1A62A 3T4AC 3NTKA 2R7ZB 5FO8B 2NN6I 3F2BA 1HZCA 1NTGA 1TS3A 4BWGB 1F77A 2F0OA 3K8AA 2ZTEA 2UU9L 1I3QH 1DD2A 1FR3A 2NVYB 2CW0D 4OO1G 1NMGA 1BUVT 1EY4A 1JWUD 1WCMG 1YZ6A 4JV5L 1PLFA 2K6AA 4GLAC 5CORA 4CDCC 1RL2A 4KKSA 1X32A 5M3FB 3PQIA 1N36L 1B44D 3BDCA 4JI0Q 2Z6KA 1HQRD 3TS0A 1V9PA 2Q8IB 1PDQA 3MHBA 3BDOA 4HR7B 3OMGA 4TRDA 3OW7A 2IL8A 5IP7G 3C2PA 3NHHA 3GTLB 2R3ZA 2Z9HA 2KHSA 1LT4D 1OTCA 2K5VA 3QO2A 5J1ZA 3K80C 5H1SE 3GTQB 2O4XA 2LY7A 5CBAE 4OO1H 3K0YA 1PRTD 3I56A 1WCMH 4HEDA 1JJCB 4A3GG 2K1BA 1XNRL 4HSVA 4X3UA 3ND8A 2HDLA 4A3IG 2JA7H 2Q2HA 4A3JH 1EU3A 4BBSG 1WFQA 4GLVB 4KJNA 1IXRA 3S2HH 1V1QA 1C48A 3M4OB 4V0BA 2PZWA 2IWHA 3HOXG 4XDXA 1IYUA 2F0DA 1N33L 2SNSA 2AMCB 3CCEA 1SE2A 2PQAA 1Y69U 4BY1G 3C1EA 2JA8G 5J22A 1TWAH 5IOCA 2A69C 3HOVG 3Q23A 4C1NI 2AUJD 1NE3A 4A75A 1VQHA 1HTLD 4LFAQ 2R92B 1UWVA 2CWAA 2NVXH 4DAYB 4DV1Q 4C3JB 2KCNA 5JJZA 4A3IH 3S1MH 4BBSH 5FK9C 1STGA 1ZXTA 2O2LD 3BVZA 3SDZA 1GVPA 3C1FA 2WP8J 4A3FG 3HOXH 3CPWA 1FD7D 2I5HA 1XPRA 5GQOA 4X3KA 2F0MA 1Q1BA 4CBVA 2VNUD 4ABNA 4DV4L 1F9PA 2F0VA 3TEHB 4UP7A 2R61A 1ASZA 4JI6L 1WTQA 2F0GA 4JI8L 2A6HD 4BY1H 2JA8H 1QZGA 2HT1A 3HOVH 2F4VQ 2AQ3B 1ML0D 2M2LA 1QOHA 1AN8A 3EA6A 3PO2H 1TWCB 2BH8A 4FP5D 3E9HA 2A68D 4C3IH 3ND9A 1V1PA 3D6WA 3C46A 2ALYB 2R6GA 4NXML 1XTCD 5EPKA 5EBCA 2JA5B 4H13C 5M3MG 3U4VA 5M5XB 4A3FH 2EJGC 1BNZA 3L3OC 1PH6A 2WKCA 4IZ8A 4L63B 1E2WA 2M00A 5C44H 4LF9Q 3EFXD 2F3IA 4L5QA 4K8IA 4IOAA 2E2HB 4DK1A 1LV9A 3MEFA 1GD7A 1TT2A 5G3LF 1K3RA 3MC0B 3S1RH 1YHQA 1S5FD 1TY0A 4IO9A 3WOFA 1G51A 2DUDA 2XIWA 4GOPC 1A15A 1CZGA 3HOWH 4JCVE 4NB3A 4YHHQ 2I07B 1WTOA 2RVLA 4DPGA 3Q6SA 1XMOL 1S4ZA 5IT9E 1B2TA 3ER0A 4R4QA 1QB5D 4YWMA 3OPOA 1HNXL 3T1YQ 3CCUA 4JI5Q 1F2YA 1LTSD 4GNXB 1A63A 1WOCA 1JE4A 4P2CB 2YTVA 4JOIA 1O7ZA 2K5DA 3HKSA 1ONLA 2B2WA 3BVMA 4LF4Q 1EY7A 1SYBA 1CKNB 2D2CC 1FJGQ 2N88A 1I3QB 2RA4A 2JSOA 5CV4A 2X6LA 3CCSA 1L1OA 3H0GB 5IGGA 4WJ4A 4JK1C 3P7JA 1PRTF 3DM3A 3X3MA 5D3DA 1EWHA 4QMGA 1JCKB 5ELOA 2VQEQ 3DWQA 1VQKA 2OQ0A 2KJXA 4KY7A 4A3CH 3SHLA 2E75C 3DWAA 1VF7A 4JI0L 1GUSA 2ZXPA 5A2QE 5CV6A 3W2DA 5KRUA 1WYDA 3BZDB 4B08A 2CWPA 5JPMC 3CAMA 1U9RA 1VF5C 1PFMA 1WCMB 1IBLQ 4NPSA 2EXZA 1CSPA 3VYUA 3NK9A 3AQQA 1WVLA 2JA7B 2KUMA 4A3JB 2QDBA 1PRTC 1NMFA 3S2HB 3SXHA 2Z4HA 5KIXA 4J6HA 4K5XA 3FEWX 4LF6Q 1HR0Q 4DAVA 3I7FA 1UEBA 4N9PA 1E3PA 1KRSA 2F0TA 1P8LA 2OCEA 2RBMA 5GAGC 3GV3A 1X6OA 3HFZB 1TWAB 5COYA 4DU9A 1Y1VH 1TS5A 3VR3A 4JBMA 1FNVA 4RGNA 1LT6D 5CYUA 1VQEA 4DR4Q 4CDDC 1HUMA 1HJPA 1X65A 4OONA 4LFCQ 1QVCA 3S1MB 4BBSB 1Q90A 3QJYA 2UXBQ 4LFAL 1BCPB 2G9HD 4DV1L 3HOXB 1KXLA 1XTDA 1K73C 2B2YC 5IE8A 2JQOA 2DNCA 3KBXA 4G4KA 1FGBD 2UXDQ 3CQZH 2HDMA 5C5MA 1E1TA 1L0WA 2JEBI 2QILA 4B9WA 1F2MA 1SE3A 2MGSA 3K5LA 4BY1B 1VQ9A 2JA8B 4RCNA 3HZXA 2E76C 3BJUA 3HOVB 2KA7A 5BN3A 3FDTA 4A3BG 2JJQA 3Q24A 4X64Q 1PYSB 4P73A 3JAME 1EZ6A 1KNAA 2A6HC 4XIGS 1C0AA 3PO2B 2AQ2B 5ELNA 2F4VL 3U9SA 1HUNA 5C4HA 1IKLA 4OWWB 4C3IB 4RHRA 1CA5A 1BKBA 4A3FB 1MD2D 1F2LA 4A3EG 1U4RA 5DNFA 2HQEA 1HZAA 5C44B 4CKBA 2A68C 1A6XA 5C4ZA 3IKJA 4DUZQ 4KTAA 3KLSA 5KNBA 2R7ZG 2EYJA 1BF4A 1G2TA 3PSIA 4LF9L 3S1RB 3D3RA 2A1AA 4LUVA 2B2VC 4A3BH 1A3VA 4ULLA 1DM0B 3T51B 3H91A 3S14H 4DA2A 4FF4A 4LJZC 4FNFA 4DR1Q 3W1BA 1VQIA 4M1UB 4JI2Q 3HOWB 3R8BA 1STYA 1LT5D 4RWSC 5M3FG 3E6ZX 1OXVA 1U4LA 3NBHA 1YJ9A 3BZKA 2FINB 4DK6C 2Z8LA 3PGZA 2E2DC 3T13A 4B3SQ 4YHHL 4K5VA 2N8NA 2PNHA 4HJ8A 3T1HQ 3LWEA 2K01A 4B3MQ 2ZXRA 4F87A 4AQYQ 3F1ZA 1KIXA 1JOQA 2D0PA 2NVTH 3D4DA 3T1YL 2L0CA 1X55A 4JI5L 1IHZA 4IJLA 4MNOA 4RG1A 4R8IA 1XWEA 4BS9A 5CBEE 4RGOS 1EY9A 2NN6G 1GUTA 1O80A 5CV5A 4LF4L 3VA7A 1SFOH 4WJ3M 5IT9c 5AJ3Q 3BG3A 2XGTA 4KKTA 4IURA 1FJGL 1NR2A 1WI5A 4G7OC 1B9NA 5JJKA 4RKBA 2UUCQ 4HIOA 1RJTA 3QWNA 1B3AA 4UHVA 1F9QA 4RAUC 3K5OA 1SNOA 1TY2A 3PUWA 4KY5A 3WOEA 4DUYL 2R93G 5M5WH 1M8AA 3GTLH 1TWGB 4LWCA 2VQEL 1SN8A 3PIPA 1LM0A 1D6EC 4N8X1 4TKOB 1ESRA 1JJ2A 1K83H 4PZ6A 3CW2C 3S17H 2IY5B 4CKEA 2N55A 1MBYA 1G91A 1G8ZD 3NWSA 1AZPA 2NN6H 4K6DA 1QCBD 3BVGA 3SK5A 3AMUA 2JA9A 2ZTDA 1KL9A 2R92G 5C0XG 2PW7A 1KABA 4LAAA 1I6HH 2F0UA 3F2CA 1H9SB 4IN3A 1K0RA 4ALPA 3A7AB 2F03A 4RMFA 5FLMG 3L7ZC 1P16A 3M4OH 4ZKBB 1XYIA 2R93H 4DAYA 2CKZB 1OXTA 5C3EG 2WFWA 2NUCA 4KI0A 5IY0A 3KF6B 4OWXB 4DXGA 1E22A 3FP9A 3QOJA 1XMQQ 1AP0A 4JPBW 4X62Q 4XQJA 1Y8OB 5JVG3 4LF6L 1HR0L 2IW3A 2L11A 3MXNB 4EVOA 1Y1VB 4LF8Q 3N6RA 2OT2A 2EQSA 1IKMA 1EFWA 1YITA 5IODA 4DV6Q 1J9OA 1RHPA 2HQLA 5FLMH 4GOPB 3Q22A 1O78A 4DR4L 3CRKC 1HPCA 5C3EH 3J81E 2K04A 1SE4A 3HOUG 3H3VI 4LFCL 2IJ0A 3TBIB 3ERSX 3JAMi 3PCOB 2UXBL 5T1IA 3CQZB 1D8LA 1YNXA 1A2UA 3SVMA 4WORA 3E0EA 4MTNA 2L9HA 2UXDL 1AFPA 5J3BA 2B8FA 1BOSA 5I9PA 3KBGA 4IUVA 2KOLA 5HGTA 2L1BA 5EQ0A 1W6JA 4ILWA 2ATWA 2D62A 4LUOA 2ENBA 4L8JA 2Z6KC 5I2XA 3NQIA 4HTHA 2WB1E 4DF7A 1N32Q 1W2BA 3HOUH 1DCZA 3J7ZC 4NP5A 4RGTA 1UNSA 5IYDG 3F2DA 1GJXA 1V1OA 2NZ1D 1Q8KA 2EYHA 3CD6A 4GNXA 4JBWA 4UP9A 3AB9A 3KJOA 3I4LA 4MTKA 1V8QA 5ELDA 4A3BB 4HJ9A 2CVRA 1IL8A 4DKAC 1XMOQ 3RLOA 1HH2P 2YU9H 3S14B 5EJWA 3H0GG 3P20A 1JQYD 3U9OA 4YCVA 1JB3A 4E6IA 4N8FA 4EQNA 2DN8A 3S9WA 4CJ0B 2D0OA 1I4RA 1T5EA 3MXUA 1ENAA 1S5CD 2A74C 3ULPA 4DR1L 4JI2L 3AU7A 2E8GA 5G3LD 4DV2Q 3KUPA 1KC8C 3M9BA 3I8ZA 4O0AA 2RSNA 3D6CA 3EN2A 1VQNA 1YJWA 5IYDH 4ZAIA 5LMUQ 2A19A 1PRTB 4IPDA 4B3SL 2IX3A 3LWUA 3G6JB 2NVTB 2Q2TA 4IOCA 1KTKA 4JI1Q 4C1NK 2XSCA 3T1HL 3PUZA 4B3ML 3FRPB 2K7VA 5D3IB 1EYAA 4DR5Q 3DLLA 4AQYL 1VQGA 1VQCA 4I7AA 2RF4A 2KCTA 3OMCA 2IPKD 5FLXE 1JWSD 3H0GH 5KYIA 3UDXA 4HSPA 1SFOB 2QEXA 2C35B 1SNPA 2NBFA 4DNTB 2JA7G 1GUWA 1U4MA 3M4QA 3A7LA 4A3JG 4DV7Q 3LX0A 1EIHA 5AJ3L 5FO7B 2OF1A 3KDFB 1I94Q 2CFMA 1SBBB 5M5WB 2BCOA 4Q5VA 1CTMA 2UUCL 4QB4A 2VS1A 1HTPA 1UE7A 4X3TA 5LHY1 1K83B 4PMBA 1PYBA 3S17B 3KF8B 1HR0W 1H9KA 4R4CA 2NVQH 1GM5A 1H9JA 4QGUA 3RD4A 4F7XA 4K2LA 3TS2A 1QJOA 2Y0SE 2Z4IA 2DGYA 3MTSA 3R3OA 3RNUA 1I6HB 2RSOA 4XYQA 4JI7Q 3NXWA 3ULJA 4NMZA 3AEVA 3LNNA 3U50C 2WB1B 2R93B 4KHVA 1FL0A 1I5FA 1LABA 3TZDA 2ES2A 3TP8A 1STBA 3RR5A 5NUCA 4DR2Q 4TVAB 1ENCA 3W5OA 2F0JA 4N9TA 1SYDA 4UAIA 3VYSA 1IL2A 4MZ9A 4GN3B 4G7HC 3J81i 4RA8A 1X54A 2FHTA 1XMQL 2XRQD 3HOZB 1PZJD 4X62L 3A8IE 4MIUA 4F88A 3PO2G 3MWYW 1XX8A 1VQLA 3RLNA 3GTPH 1S5BD 3I70A 2CQOA 5JVH3 3Q8DA 5D65A 4C3IG 4LF8L 4CDFC 1LTLA 3DWPA 2NB0A 4QIWE 1IW7D 4K6LA 1HNZQ 5C3EB 4WRDA 5C4XG 1I50B 5C44G 3M7GA 4DV6L 3TP6A 3OWFA 2B2WC 3UDIA 4RKLA 5ELBA 1FYCA 2DJFC 1KNEA 3BYYB 3I4NB 4IJHA 4FXDA 5K36H 2IHEA 4OX9Q 2EJFC 5J39A 1KLUD 2OXPA 3G71A 1MKHA 1Q82C 1EIYB 3HOWG 2PNRC 1UAPA 1SDFA 3J81c 3SGIA 3K6OA 2HD3A 1EQTA 1X3EA 1YNJC 3K7AH 4HN7A 4DV5Q 2RCNA 4FVMA 4ZLTF 5C4XH 3HOUB 1D5MC 2F0SA 1G2SA 3K5MA 3A74A 3HS0C 4KLKA 5JOBA 1PFBA 1H9MA 1O7IA 1N32L 3J80L 2CCZA 2RDFA 1CQVA 4ZCKA 1JR0D 4UDUC 5F2DA 1BQQT 3CC2A 2UUBQ 2YU9B 1RCVD 4GS3A 2XWJB 4PZ7A 3PMFA 3DEPA 1VMCA 2Y0SB 4EGVA 4GKJL 3CCJA 3VYRA 1CZWA 4IFDI 1EY8A 1VMPA 4PMWA 3L9AX 5ELCA 1HNWL 2SEBD 4A3CG 3CCVA 4I7ZC 1WTRA 4ZKCB 1CFMA 1DGSA 4KN4C 1ICWA 4S3SA 3OIPA 2IHFA 1K8AC 1MSHA 5KNDA 1Y1WH 1A2TA 4DV2L 1LTID 3NP8A 1EU4A 1I4QA 2AWNA 3PF5A 3TDQA 2XRSD 5L37A 5LMUL 4KD3A 3RZDH 2NYZD 2EY6A 2O5IC 3VA5A 4CHTB 3D31A 4JI1L 4DUYQ 4DGZA 4BY7H 4DR5L 4HJ7A 1X9NA 3AFPA 1X3QA 2FMMA 2PMZE 2J7ZA 5EPLA 1EEID 3H3VC 2JN4A 4OXPA 4QIWB 5C0XJ 3C3LA 1OXXK 1TWGH 1KLGD 2J0TD 2PZUA 2BE5D 4DV7L 3PUVA 2AHOB 1I4HA 3Q0AA 3I73A 1XPUA 4R4OA 1I94L 2WV6D 1QVGA 4K2KA 3CRLC 5FLXc 3KF6A 4J15A 2C9OA 1Y1VG 2NVQB 3KK7A 4EQPA 1VDZA 2EY5A 2H4OA 2RDHA 2XNAC 4R4IA 1ZKOA 3DXJC 1PXUA 1VQFA 2F0WA 1HCZA 5IGFA 3H6MA 4LW1A 1PH9A 3S1NH 5EPJA 2H5XA 1LTRD 1QWYA 1TXYA 2NTTA 3MVVA 1KRTA 4P72A 1CQFA 3NUCA 5E3FA 2OWOA 2QEJC 1T5XD 2JEAI 2MNAA 1CUKA 2EPBA 3DHQA 4JI7L 1A8VA 4QF4A 1Q46A 2A6ED 1DJRD 4DR2L 1PMRA 1KD1C 4JG2A 2C5CA 2KEDA 3A8KE 2B2TC 5LMNQ 1STNA 1XNQQ 1AW7A 1NSNS 1OXSC 3RMHA 4NXNQ 4AYBG 4O42A 3GTPB 3U4ZA 1BBXC 5C4JH 1F9RA 4B9XA 1N34Q 1SNQA 4DFAA 4KD4A 1EWCA 3DUZA 3MXPA 4Y52H 2K33A 2XWBB 1WTVA 4LFBL 3F2UA 1GOZA 2MFIA 4QCLA 4HJ5A 1QUQA 1EZ8A 1S5ED 3OOCA 2QGQA 4HMJA 2K5WA 1HZBA 3GD7A 1SYEA 4OELB 5GADC 1HNZL 1IW7C 3EROA 1QVFA 2K32A 1B8AA 4HMIA 1PA6A 4P74A 2ZTCA 3AFQA 1MJEA 1M4VA 1JE5A 1LT3D 1HHVA 1EQQA 1G291 3RZOH 2K28A 2VQFQ 4OX9L 3NEMA 1SNCA 3I4MH 3CCQA 2PMZB 4LNQA 3K5NA 5IGEA 3S16H 2JP1A 1I4GA 3HP3A 2ID0A 5C3WA 3K7AB 3L0OA 1B7YB 5C4XB 2EYMA 5IGCA 1IYVA 1PH1A 2F52A 5CC4A 3NELA 1SSOA 1O7LA 3H3VH 5BN4A 4PQXA 2G9DA 1E2VA 4DV5L 4YY3Q 1N9WA 4HCSA 2VB2X 4QUFA 5FKAC 5I9OA 1GXDC 1W6KA 3OTOQ 1EIFA 1IBKQ 1DONA 2SOBA 1D7QA 1KDAA 4Y7NH 2PCFB 1CM9A 2BA1A 1LTBD 2GVBA 2XVSA 3NSWA 1PVOA 1M90C 2UUBL 2QKIC 1CHPD 2HIXA 4FF3A 5IT9L 2KHIA 5IYCH 2A8VA 3GTGH 3A5UA 5E4XA 1QNUA 2EYLA 4H44C 2KHJA 1MGSA 2FMCA 2Z0SA 4IALA 4CGYB 1SE8A 4Z9CB 1Y1WB 5EBDA 3KDFA 1IBMQ 3M3YH 1B70B 2EIFA
chains in the Genus database with same CATH topology
1CT1D 5AFWA 4I65A 4RGMA 5DM63 3RZDB 1AZQA 4RCOA 1EIGA 4G57A 1Q1EA 2JYOA 3KF8A 4BY7B 3OHXC 2Q8TA 3K59A 1LTTD 1D1KA 1PFNA 3I3CA 2BOSA 5A2QL 2VXWA 3CKIB 1LACA 1QNKA 2BE5C 2J4XA 2F3VA 3EVQA 4Q0FA 4HAEA 3HGBA 3S1NB 2FFKB 3HEJA 3IFTA 5C6AA 1DXMA 2V4DA 2GA4B 1F9SA 2A5HA 2B2VA 2F0LA 2TMPA 4M8AA 1Q12A 2F0KA 2ICIA 2F1MA 3BDLA 3V2TA 4G7ZC 2EVBA 1B9MA 3CHBD 2B8GA 4F8MA 1EYCA 4FO2A 2A6EC 5JAVA 1GUOA 4KJOA 4DAPA 3I72A 1RODA 5C4JB 3NWTA 3E0JA 1ILPA 4RH6A 4YIJA 5LL6X 3TN2A 1SYCA 3SEBA 2DY7A 5EKLA 4XXEA 1V43A 3KLSX 4KHZA 2JA6B 1KAAA 5EKKA 1QE6A 2MUYA 1YNJD 1UUPA 2K05A 1HXYD 2CQAA 1EY6A 3J7AV 1JICA 2EY2A 4AYBB 3R93A 5EKIA 1GHKA 3RZOB 2B2UA 5T1GA 2EJMA 3I4MB 1STAA 3S16B 2F0HA 4IQZA 2EYOA 4XQNA 3PUXA 1Z47A 3MA2B 1CA6A 3VYTA 2DY8A 1TQOA 5I4DA 4IUNA 4KKUA 1AEXA 1HA6A 3J7YW 3K58A 3H09A 3QB3A 4ID6A 4Y7NB 4FXGC 3J80E 2EY1A 2WINB 2SNMA 4IFDG 3GTGB 2ZXOA 4GZYC 2LS01 5CV7A 1BO0A 1BXTA 1B4OA 1TKWB 1SMYD 4OGQC 5ISRA 1LTGD 2EYFA 3M3YB 3HRZC 4A3MB 1JOOA 1PTOD 4CKCA 1LTAD 2BA0A 1RTOA 1C4QA 5CV8A 2IX1A 5ELEA 4IUUA 1FNUA 2WAQB 4IFDH 3PUYA 3I90A 1ET6A 1STHA 2QF7A 5A35A 3IFDA 1R4PB 3QIAA 4ODGA 1EL0A 1JWMD 4U673 1SJHD 4MN3A 5JEAG 4KK7A 2EYPA 1NCVA 1HA5A 2NTSA 3DM1A 4O1NA 2EOTA 1QG7A 4XQQA 3HKZB 4MHEA 2IT1A 2B63B 3IAYA 5CGKA 1SNDA 1OXUA 3H94A 5C5LA 1NAPA 4A3KB 5C0XI 1EY0A 3BS1A 1I6VC 4C3HB 3X3NA 4BA2I 1Q3LA 2ICEC 3ZYYX 5JEAH 4H7BA 2FJ2A 3D8GA 3S2DB 1A3UA 3WDNA 3G7LA 3NE5B 5K36G 2EDGA 1TWFB 2JXMB 3OWEB 1HQMC 1SYGA 5C3XA 1D1IA 5KNCA 1Q8IA 2VUMB 1NR4A 2AUKA 2BDOA 2LMCB 4PV1C 3J81L 1EOTA 2AQ1B 1R9TB 3QOLA 3MFYA 2PZTA 1ZEQX 1RD9D 1O7YA 2F4IA 1GUGA 3MZ5A 1RDPD 3I91A 1X3PA 4BA1I 3SK4A 2F0EA 2MP1A 1D5ZC 1HRJA 3GTMB 3A54A 2B39A 1B1ZA 1WTPA 5M9OA 4K8JA 1Y8PB 3FPUB 1L0XB 2PO4A 3T53B 2WIIB 5KYLA 4OIJA 3S15B 4CJ1B 2F3WA 3GTJB 4NW2A 1K8OA 1PTOF 2WKDA 3M4YA 3ERQA 1WD1A 3SK6A 4IUPA 3N52A 2A73B 3GP7A 4R8NA 3VR2A 3A56A 3FPPA 4R9WA 3SK8A 1HFGA 2LKVA 4OL7A 1ESFA 2X6GA 1EEFD 1K8MA 4XTCS 1XXGA 1G6ZA 5FLXL 1SMYC 3BYTB 5TSSA 1TIID 2IX0A 3FKIB 1PTOC 4OO1I 3MEHA 1I4PA 3HOYB 2F0PA 1DZ1A 5I2YA 2I46A 1CK1A 2ZT9C 1H9SA 4PMCA 1DYQA 1PZID 2H1EA 3V05A 1FNWA 3P75A 1SAPA 2CW0C 5KGUA 5IIFA 3S1QB 4OHJA 5JPNC 3E5SA 3ONAB 4IUTA 3VR4A 1WTWA 3MXNA 1D5XC 2YYZA 3FVQA 4FYDA 5CR3A 4RHSA 2RQXA 2KCCA 5KEEA 4ZK9B 3GTKB 3VR5A 1H9RA 5FOBB 2L5TA 3O13A 1R4QB 4V190 2OEOA 4QUCA 5EGTA 4FF2A 3IL8A 2O5JC 4A93B 3TP7A 2QCPX 5DAUA 3ITPA 2X69A 4ME5A 1F2ZA 1Z6HA 3V96A 1ENFA 4X3SA 4WFN3 1MI2A 3GQBA 1RTNA 1SEBD 2PPBC 4A3GB 1B50A 1PZKD 2DNEA 1Z7TA 3CU7A 2NVXB 3HG9A 4A3IB 3DMUA 1DOLA 4XT3B 2WACA 4KN7C 1EFID 1D2BA 4U68A 2Z1CA 4FXKC 2TSSA 1TWHB 3J7AF 5HURA 4RFBA 4OIKA 3GTOB 4DN4M 3NBIA 1TS2A 4EQOA 5D14A 2D5DA 1PTOH 4ZYSA 1EY5A 5ELFA 1YNND 5BN5A 1I4XA 4IFDJ 1ET9A 2Q8RE 5I6YA 1ZYRD 3QG1A 4TSSA 1STEA 3PV0A 2EE1A 3W3AA 4J8QA 1S5DD 3SR1A 1BCPD 3TZUA 2SDFA 1LO5D 2HCIA 3VR6A 3OIQA 3PO3B 1CHQD 1V1PB 5E1FA 2D9UA 4KY6A 1GUNA 2B2TA 2XN9C 3SE0A 3R2TA 3K57A 4C56C 4ZQ3A 1JC7A 1RKNA 4L6TB 5M3MB 1E0BA 1WD0A 2PYKA 1RF2D 5JEAJ 3PIP3 2B2YA 1J8IA 4IUQA 1SYFA 1E2ZA 1OO9B 3TP5A 4TQUS 2K5QA 3A8JE 4C3HG 1EQVA 5IGDA 5M5YB 5I6WA 4KMUC 4NDXA 4J1MA 3NTHA 1UEAB 5LL6S 1BDOA 3DEOA 2JE6I 1QILA 3EJIA 2EZVA 1DOKA 2L4NA 4XYOA 1BR9A 4LMQD 1II3A 3T16A 2AWOA 2HUGA 2B2UC 4DXFA 3OSOA 3URYA 3NPPA 4KV6A 3EQLC 3R2IA 1NUCA 4C3JG 3TMEA 2E74C 2KECA 3P1HA 1KDBA 3NQTA 1CI3M 3MXGA 1SJED 1GHJA 4A3DB 2A69D 4BBRB 4DK0A 2LFNA 2NWGA 1LLRD 3MAQA 2HCCA 1HFNA 4CJ2C 3GO5A 2RDGA 4NKLA 3TSSA 1B53A 2L55A 1ILQA 1SNMA 1C8CA 2F0QA 2PQEA 2KQ3A 4ZRZA 5C0XH 2F0IA 2MHVA 4K5WA 1L0YB 3FMCA 4K14A 3T56B 3D4RA 3A55A 2E2IB 4XT1B 3JAML 4ZUJA 1KDCA 1PYWD 2PW5A 4FF1A 4WJWA 5IGBA 1BCPF 4C2MB 2F0FA 5CV9A 1SXTA 1PTOB 3RUZA 5FO9B 1EYDA 3GV6A 2VB3X 1JOKA 3NTIA 2K03A 5CMDA 4ZUIA 3PIO3 5K5PA 5E4WC 1JORA 1YNNC 1DOMA 2E2JB 1TS4A 3M85A 1WTXA 1ZYRC 2MJ8A 3UI2A 3M7NA 1A3TA 3RLFA 2RKSA 4HCEA 1BCPC 1TU2B 1VCIA 2L12A 5DEHA 3KLRA 2BDNA 4PNYA 4DNRB 4H0LC 3MFGA 1TVXA 2F0NA 4LK1C 1U4PA 2MPMA 4A3EB 5DM73 3D4WA 2CHBD 1TR5A 2M9VA 1Y8NB 2KVMA 2KEEA 1MSGA 3T4AC 3NTKA 2R7ZB 5FO8B 2NN6I 1TS3A 4BWGB 1F77A 2F0OA 1DD2A 1FR3A 2NVYB 2CW0D 4OO1G 1BUVT 1EY4A 1JWUD 1PLFA 2K6AA 5CORA 4KKSA 1X32A 5M3FB 1B44D 3BDCA 1HQRD 2Q8IB 1PDQA 3MHBA 3BDOA 4HR7B 3OMGA 4TRDA 3OW7A 2IL8A 3C2PA 3NHHA 3GTLB 2R3ZA 2KHSA 1LT4D 3QO2A 5J1ZA 3GTQB 2O4XA 2LY7A 5CBAE 4OO1H 3K0YA 1PRTD 4HEDA 2K1BA 4HSVA 4X3UA 3ND8A 2HDLA 1EU3A 4KJNA 1C48A 3M4OB 4V0BA 2PZWA 2IWHA 4XDXA 1IYUA 2F0DA 2SNSA 1SE2A 1Y69U 3C1EA 5J22A 5IOCA 2A69C 3Q23A 4C1NI 2AUJD 1HTLD 2R92B 4C3JB 2KCNA 5JJZA 5FK9C 1STGA 1ZXTA 2O2LD 3BVZA 3SDZA 3C1FA 2WP8J 1FD7D 4X3KA 2F0MA 1Q1BA 4CBVA 2VNUD 4ABNA 1F9PA 2F0VA 2R61A 1WTQA 2F0GA 2A6HD 2AQ3B 1ML0D 2M2LA 1QOHA 1AN8A 3EA6A 1TWCB 4FP5D 2A68D 3ND9A 1V1PA 3D6WA 3C46A 2R6GA 1XTCD 5EPKA 5EBCA 2JA5B 4H13C 5M5XB 1BNZA 2EJGC 3L3OC 2WKCA 4IZ8A 4L63B 1E2WA 2M00A 3EFXD 4K8IA 2E2HB 4DK1A 1LV9A 5G3LF 1TT2A 3MC0B 1S5FD 1TY0A 3WOFA 2XIWA 1A15A 1CZGA 2I07B 1WTOA 2RVLA 3Q6SA 1S4ZA 5IT9E 1B2TA 1QB5D 3OPOA 1F2YA 1LTSD 1JE4A 4P2CB 1O7ZA 2K5DA 1ONLA 2B2WA 3BVMA 1EY7A 1SYBA 2D2CC 2N88A 1I3QB 2RA4A 2JSOA 5CV4A 2X6LA 3H0GB 5IGGA 4JK1C 3P7JA 1PRTF 3X3MA 5D3DA 1EWHA 4QMGA 1JCKB 3DWQA 2KJXA 4KY7A 3SHLA 2E75C 3DWAA 1VF7A 1GUSA 2ZXPA 5A2QE 5CV6A 5KRUA 3W2DA 4B08A 3BZDB 5JPMC 1U9RA 1VF5C 1PFMA 1WCMB 2EXZA 3VYUA 3NK9A 1WVLA 2JA7B 2KUMA 4A3JB 2QDBA 1PRTC 3S2HB 3SXHA 2Z4HA 5KIXA 4J6HA 4K5XA 3FEWX 4DAVA 4N9PA 2F0TA 2RBMA 3GV3A 1TWAB 5COYA 4DU9A 1TS5A 3VR3A 1FNVA 4RGNA 1LT6D 5CYUA 1HUMA 3S1MB 4BBSB 1Q90A 3QJYA 1BCPB 2G9HD 3HOXB 2B2YC 2DNCA 3KBXA 4G4KA 1FGBD 2HDMA 5C5MA 2JEBI 2QILA 4B9WA 1F2MA 1SE3A 2MGSA 3K5LA 4BY1B 2JA8B 4RCNA 3HZXA 2E76C 3HOVB 2KA7A 5BN3A 3FDTA 3Q24A 3JAME 1EZ6A 1KNAA 2A6HC 4XIGS 3PO2B 2AQ2B 3U9SA 1HUNA 5C4HA 1IKLA 4C3IB 4RHRA 1CA5A 4A3FB 1MD2D 1F2LA 1U4RA 5DNFA 2HQEA 5C44B 4CKBA 2A68C 1A6XA 5C4ZA 3IKJA 4KTAA 3KLSA 5KNBA 2EYJA 1BF4A 1G2TA 3S1RB 3D3RA 2B2VC 1A3VA 4ULLA 1DM0B 3T51B 3H91A 4DA2A 4FF4A 4LJZC 4FNFA 3HOWB 4M1UB 3R8BA 1STYA 1LT5D 4RWSC 3E6ZX 1OXVA 1U4LA 3NBHA 2FINB 2Z8LA 2E2DC 3T13A 4K5VA 3LWEA 2K01A 2ZXRA 4F87A 1JOQA 3D4DA 2L0CA 1IHZA 4R8IA 1XWEA 4BS9A 5CBEE 4RGOS 1EY9A 2NN6G 1GUTA 1O80A 5CV5A 3VA7A 3BG3A 4KKTA 4IURA 1NR2A 4G7OC 1B9NA 4RKBA 1RJTA 3QWNA 1B3AA 1F9QA 4RAUC 3K5OA 1SNOA 1TY2A 3PUWA 4KY5A 3WOEA 1M8AA 1TWGB 1D6EC 4TKOB 1ESRA 4CKEA 2N55A 1MBYA 1G91A 1G8ZD 3NWSA 1AZPA 2NN6H 4K6DA 1QCBD 3BVGA 3SK5A 3AMUA 5C0XG 2PW7A 1KABA 4LAAA 2F0UA 1H9SB 4IN3A 2F03A 3A7AB 3L7ZC 4ZKBB 1XYIA 4DAYA 1OXTA 2NUCA 4KI0A 4DXGA 3QOJA 1AP0A 4XQJA 1Y8OB 5JVG3 2IW3A 2L11A 4EVOA 1Y1VB 3N6RA 2OT2A 1IKMA 5IODA 1J9OA 1RHPA 3Q22A 1O78A 3CRKC 1HPCA 3J81E 2K04A 1SE4A 2IJ0A 3TBIB 5T1IA 3CQZB 1A2UA 3SVMA 4WORA 2L9HA 1AFPA 2B8FA 1BOSA 5I9PA 3KBGA 4IUVA 2KOLA 5HGTA 2L1BA 5EQ0A 1W6JA 4ILWA 2D62A 2ENBA 4L8JA 5I2XA 3NQIA 4HTHA 4DF7A 1DCZA 4NP5A 4RGTA 1UNSA 1GJXA 1V1OA 2NZ1D 2EYHA 4JBWA 3AB9A 3I4LA 1V8QA 5ELDA 4A3BB 2CVRA 1IL8A 3S14B 5EJWA 3P20A 1JQYD 3U9OA 1JB3A 4E6IA 4EQNA 2DN8A 3S9WA 4CJ0B 3MXUA 1I4RA 1T5EA 1ENAA 1S5CD 2A74C 3AU7A 5G3LD 3KUPA 3I8ZA 2RSNA 3D6CA 4ZAIA 1PRTB 2IX3A 3LWUA 3G6JB 2NVTB 1KTKA 4C1NK 2XSCA 3PUZA 3FRPB 2K7VA 5D3IB 1EYAA 5FLXE 3OMCA 2IPKD 1JWSD 5KYIA 4HSPA 1SFOB 1SNPA 2NBFA 4DNTB 1GUWA 1U4MA 3A7LA 3LX0A 1EIHA 5FO7B 2OF1A 1SBBB 5M5WB 2BCOA 4Q5VA 1CTMA 4QB4A 1HTPA 4X3TA 5LHY1 1K83B 4PMBA 3S17B 1H9KA 1H9JA 3RD4A 4F7XA 4K2LA 1QJOA 2Z4IA 3MTSA 3R3OA 1I6HB 2RSOA 4XYQA 3NXWA 4NMZA 3LNNA 2WB1B 2R93B 4KHVA 1LABA 3TZDA 3TP8A 1STBA 5NUCA 1ENCA 2F0JA 4N9TA 1SYDA 4UAIA 3VYSA 4G7HC 4RA8A 2FHTA 2XRQD 3HOZB 1PZJD 3A8IE 4MIUA 4F88A 3MWYW 1XX8A 1S5BD 3I70A 5JVH3 5D65A 4C3IG 3DWPA 2NB0A 1IW7D 4K6LA 5C3EB 4WRDA 1I50B 3M7GA 3TP6A 3OWFA 2B2WC 4RKLA 5ELBA 1FYCA 1KNEA 3BYYB 3I4NB 4FXDA 5K36H 2EJFC 5J39A 1KLUD 2OXPA 2PNRC 1UAPA 1SDFA 3K6OA 1EQTA 1YNJC 4HN7A 4FVMA 4ZLTF 3HOUB 1D5MC 2F0SA 1G2SA 3K5MA 3HS0C 5JOBA 1PFBA 1H9MA 3J80L 2RDFA 1CQVA 1JR0D 4UDUC 5F2DA 1BQQT 2YU9B 1RCVD 2XWJB 3DEPA 3PMFA 1VMCA 2Y0SB 4EGVA 3VYRA 1CZWA 4IFDI 1EY8A 1VMPA 4PMWA 3L9AX 5ELCA 2SEBD 4I7ZC 1WTRA 4ZKCB 1CFMA 4KN4C 1ICWA 4S3SA 3OIPA 1MSHA 5KNDA 1A2TA 1LTID 3NP8A 1EU4A 1I4QA 2AWNA 3TDQA 2XRSD 4KD3A 2NYZD 2EY6A 2O5IC 3VA5A 4CHTB 3D31A 4DGZA 1X3QA 2FMMA 2J7ZA 5EPLA 1EEID 3H3VC 4QIWB 5C0XJ 3C3LA 1OXXK 1KLGD 2J0TD 2PZUA 2BE5D 3PUVA 1I4HA 3Q0AA 3I73A 2WV6D 4K2KA 3CRLC 2C9OA 2NVQB 3KK7A 4EQPA 1VDZA 2EY5A 2H4OA 2RDHA 2XNAC 1ZKOA 3DXJC 1PXUA 2F0WA 1HCZA 5IGFA 3H6MA 5EPJA 1LTRD 1QWYA 2NTTA 3MVVA 1CQFA 3NUCA 5E3FA 2QEJC 1T5XD 2JEAI 3DHQA 2EPBA 4QF4A 2A6ED 1DJRD 1PMRA 2C5CA 2KEDA 3A8KE 2B2TC 1STNA 1AW7A 1NSNS 1OXSC 3RMHA 4O42A 3GTPB 1BBXC 1F9RA 4B9XA 1SNQA 4DFAA 4KD4A 1EWCA 3DUZA 3MXPA 2K33A 2XWBB 1WTVA 3F2UA 1GOZA 4QCLA 1S5ED 1EZ8A 3OOCA 4HMJA 2K5WA 3GD7A 1SYEA 1IW7C 3EROA 2K32A 4HMIA 1M4VA 1LT3D 1HHVA 1G291 2K28A 1SNCA 2PMZB 3K5NA 5IGEA 2JP1A 1I4GA 3HP3A 2ID0A 5C3WA 3K7AB 5C4XB 2EYMA 5IGCA 1IYVA 5CC4A 1SSOA 1O7LA 5BN4A 4PQXA 2G9DA 1E2VA 4HCSA 2VB2X 4QUFA 5FKAC 5I9OA 1GXDC 1W6KA 1DONA 2SOBA 1KDAA 2PCFB 1CM9A 2BA1A 1LTBD 3NSWA 2XVSA 2QKIC 1CHPD 4FF3A 5IT9L 5E4XA 1QNUA 2EYLA 4H44C 1MGSA 2FMCA 4IALA 4CGYB 4Z9CB 1Y1WB 5EBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE3 A;  1D5X C;  1SJE D;  1CT1 D;  3KLS X;  1S5D D;  4RGT A;  1D6E C;  1UNS A;  4RGM A;  1BCP D;  1AW7 A;  3MFG A;  1JWM D;  5FK9 C;  1SJH D;  4RCO A;  2O2L D;  1LLR D;  5ELC A;  1PRT F;  2SEB D;  3BVZ A;  4RHS A;  1L0X B;  1G8Z D;  1V1O A;  1LO5 D;  1EWC A;  2CHB D;  1UUP A;  5D3D A;  3BVG A;  1FD7 D;  1JCK B;  1HA5 A;  1HXY D;  2AQ2 B;  2RDG A;  1GOZ A;  2NTS A;  3DWQ A;  5ELD A;  1CHQ D;  1V1P B;  3TSS A;  4O1N A;  4RHR A;  1TS3 A;  4BWG B;  1LTT D;  1F77 A;  1S5E D;  2XN9 C;  2R61 A;  3R2T A;  1LTI D;  3DWA A;  3O13 A;  1MD2 D;  1JQY D;  1EU4 A;  1PTO F;  1I4Q A;  1L0Y B;  2XRS D;  2XRQ D;  1PZJ D;  1JWU D;  1I4R A;  2AQ3 B;  3W2D A;  4C56 C;  1S5C D;  3BZD B;  4L6T B;  1S5B D;  1AN8 A;  3EA6 A;  4DXG A;  3DWP A;  1RF2 D;  3GP7 A;  1M4V A;  5I4D A;  1B44 D;  1ENF A;  1LT3 D;  4K6L A;  2J4X A;  1HQR D;  1EEI D;  1V1P A;  1PYW D;  1PRT B;  1XTC D;  3SEB A;  1SEB D;  1KTK A;  3R8B A;  1KLG D;  1LT5 D;  4L63 B;  1I4G A;  1PZK D;  1LT4 D;  1PRT C;  5ELB A;  1BCP F;  1ESF A;  3EFX D;  5D3I B;  1EEF D;  1I4H A;  3BYY B;  2IPK D;  2Z8L A;  1JWS D;  3OWE B;  1XXG A;  2WV6 D;  1SXT A;  1PTO B;  1KLU D;  1EFI D;  3BYT B;  3MC0 B;  1PRT D;  5TSS A;  1S5F D;  1TY0 A;  2RDH A;  2XNA C;  1SE4 A;  2ICI A;  1PTO C;  1QIL A;  2IJ0 A;  5FKA C;  1I4P A;  2AQ1 B;  1BXT A;  2TSS A;  1TS5 A;  1EU3 A;  1SBB B;  3CHB D;  1FNV A;  4RGN A;  1LTR D;  1RD9 D;  1LTG D;  1LT6 D;  1CK1 A;  2NTT A;  4RGO S;  1RDP D;  4RFB A;  4DXF A;  1PTO D;  1D5M C;  1DYQ A;  3URY A;  1LTB D;  1TS2 A;  1LTA D;  1PZI D;  1TS4 A;  1CHP D;  1PTO H;  4ZYS A;  3V05 A;  1BCP B;  1FNW A;  2QEJ C;  1LTS D;  1SE2 A;  5ELF A;  1D5Z C;  1T5X D;  5ELE A;  3R2I A;  2G9H D;  1I4X A;  4OHJ A;  1CQV A;  4RH6 A;  1ET9 A;  1JR0 D;  1BCP C;  1TY2 A;  4UDU C;  3BVM A;  1B1Z A;  1DJR D;  1FGB D;  4Z9C B;  1FNU A;  1RCV D;  4TSS A;  1STE A;  1HTL D;  2QIL A;  1ET6 A; 
#chains in the Genus database with same CATH topology
 1FGU A;  2LXK A;  1CT1 D;  5AFW A;  2RCF A;  4I65 A;  4RGM A;  5DM6 3;  1K3B C;  4GLX A;  3RZD B;  3G4S A;  4A4I A;  1AZQ A;  4RCO A;  1EIG A;  4G57 A;  4R4T A;  1Q1E A;  3HKZ G;  2JYO A;  2OTJ A;  4AYB E;  3KF8 A;  5E7N A;  2N49 A;  4BY7 B;  1NJI C;  2MO0 A;  3OHX C;  2BH2 A;  4JI4 Q;  2Q8T A;  1W3S A;  1LTT D;  1D1K A;  1FVI A;  3K59 A;  1SR3 A;  2WB1 G;  5JJL A;  3CPF A;  1SRU A;  1PFN A;  3I3C A;  4UY8 C;  4LUZ A;  2BOS A;  5A2Q L;  1KAW A;  2VXW A;  3CKI B;  1LAC A;  4B3T Q;  1QNK A;  3W1G A;  2BE5 C;  2J4X A;  2F3V A;  3HOZ G;  3EVQ A;  4Q0F A;  4HAE A;  3HGB A;  1PH8 A;  3S1N B;  2FFK B;  4R1J A;  4YCW A;  3HEJ A;  3IFT A;  5IWA Q;  2VUM G;  4YWL A;  4OWT B;  5C6A A;  1DXM A;  4A3K H;  3E3X A;  2HIV A;  2V4D A;  2GA4 B;  1F9S A;  2A5H A;  4C3H H;  2B2V A;  3VDY A;  2F0L A;  2TMP A;  5DLQ E;  4M8A A;  1Q12 A;  2YV5 A;  2F0K A;  2ICI A;  1PHJ A;  4GNX C;  2F1M A;  3BDL A;  3V2T A;  4AIM A;  4G7Z C;  2EVB A;  1B9M A;  3S2D H;  3I4N G;  2VL6 A;  3CHB D;  2B8G A;  4HID A;  1JB7 A;  2I0Q A;  4F8M A;  3HOZ H;  1TWF H;  3KYH C;  1EYC A;  4FO2 A;  2A6E C;  3UDG A;  5JAV A;  1GUO A;  4KJO A;  4DAP A;  3I72 A;  2VUM H;  1ROD A;  5C4J B;  5LMN L;  3NWT A;  2WAQ E;  3E0J A;  1IZ6 A;  1XNQ L;  1ILP A;  4RH6 A;  4YIJ A;  4NXN L;  1I50 H;  3OW2 A;  1R9T H;  4DNI A;  5LL6 X;  3TN2 A;  1SYC A;  1N34 L;  3SEB A;  2DY7 A;  5EKL A;  4XXE A;  1V43 A;  3KLS X;  4KHZ A;  2JA6 B;  1BBU A;  1KAA A;  2EXD A;  3I4N H;  5EKK A;  1QE6 A;  2N78 A;  4JYA Q;  2MUY A;  1YNJ D;  1S40 A;  1UUP A;  3HKZ E;  2K05 A;  1HXY D;  2CQA A;  1EY6 A;  2Y0S G;  3J7A V;  1JIC A;  2EY2 A;  4AYB B;  3R93 A;  5EKI A;  1GHK A;  3RZO B;  1UE5 A;  2KCM A;  2B2U A;  5T1G A;  2EJM A;  2MO1 A;  3I4M B;  1STA A;  3S16 B;  1IYJ B;  2CH4 A;  2F0H A;  4IQZ A;  2EYO A;  4XQN A;  4HJA A;  2VQF L;  3PUX A;  1Z47 A;  3MA2 B;  1CA6 A;  3VYT A;  2I5M X;  2DY8 A;  1VQM A;  4EX5 A;  1TQO A;  1VQB A;  5I4D A;  1E1O A;  5IYB G;  4IUN A;  4KKU A;  3JAM c;  3S15 H;  4GKJ Q;  1AEX A;  1X56 A;  3GTJ H;  1HA6 A;  4A3L G;  2P5Z X;  3J7Y W;  4YY3 L;  3K58 A;  3H09 A;  1HNW Q;  3QB3 A;  1CKN A;  1T9H A;  4ID6 A;  3KJP A;  4Y7N B;  1LYL A;  3FKI G;  1K0S A;  1YHA A;  4FXG C;  1EQR A;  3J80 E;  2EY1 A;  3OTO L;  1IBK L;  5EAY A;  2WIN B;  2SNM A;  3HOY G;  3ULL A;  4JW0 A;  4X66 Q;  4IFD G;  2QDL A;  3GTG B;  3U58 A;  2ZXO A;  4GZY C;  2LS0 1;  5CV7 A;  2E5L Q;  1BO0 A;  1BXT A;  1B4O A;  2I5L X;  1TKW B;  1SMY D;  4OGQ C;  5IYB H;  5ISR A;  1LTG D;  2EYF A;  2K75 A;  3M3Y B;  3HRZ C;  4A3M B;  1JOO A;  1PTO D;  4A3L H;  1WJJ A;  1PV4 A;  4CKC A;  1LTA D;  2BA0 A;  1YIJ A;  1IBM L;  1RTO A;  3K0X A;  1C4Q A;  5CV8 A;  2IX1 A;  5ELE A;  3FKI H;  2L15 A;  2YTY A;  5BR8 Q;  4IUU A;  4B3R Q;  3HOY H;  1FNU A;  4QL5 A;  2ZJP A;  2WAQ B;  4IFD H;  3QR8 A;  3PUY A;  2OQK A;  3I90 A;  1ET6 A;  1STH A;  2QF7 A;  3NBH B;  5A35 A;  2K5N A;  3QIA A;  1R4P B;  2YTX A;  3IFD A;  4ODG A;  4DV0 L;  1JWM D;  1EL0 A;  4JI4 L;  4U67 3;  1SJH D;  4POG A;  4MN3 A;  1PH2 A;  2PI2 E;  5JEA G;  1E24 A;  1YEZ A;  2LSS A;  4KK7 A;  2EYP A;  4JBJ A;  4HIK A;  1NCV A;  3S1Q H;  1HA5 A;  5FJ8 H;  2K5H A;  3A0J A;  2NTS A;  3DM1 A;  4P71 A;  2UXC Q;  4O1N A;  2EOT A;  4B3T L;  4A93 G;  1QG7 A;  4XQQ A;  3HKZ B;  4MHE A;  2ZM6 Q;  1AH9 A;  2IT1 A;  3CP0 A;  2K50 A;  4OEM B;  2B63 B;  3IAY A;  3A5Z B;  5CGK A;  1SND A;  2KEN A;  4YWK A;  5LMN W;  1OXU A;  3H94 A;  5C5L A;  1X3G A;  1NAP A;  4A3K B;  5C0X I;  1EY0 A;  3BS1 A;  1I6V C;  4C3H B;  3X3N A;  4X65 Q;  2VW9 A;  4BA2 I;  3GTK H;  5IWA L;  1Q3L A;  1K28 A;  2ICE C;  3ZYY X;  5JEA H;  4H7B A;  2FJ2 A;  4A76 A;  3D8G A;  3RN2 A;  3S2D B;  1A3U A;  4L5S A;  3WDN A;  3G7L A;  3NE5 B;  5K36 G;  2EDG A;  4A93 H;  1TWF B;  5IP7 H;  4LFB Q;  2JXM B;  3OWE B;  1UE1 A;  3UE0 A;  1VQJ A;  3G6E A;  1HQM C;  1SYG A;  1KQS A;  3EBE A;  5C3X A;  1D1I A;  5KNC A;  1Q8I A;  4IPC A;  2VUM B;  1NR4 A;  2AKW B;  2AUK A;  2BDO A;  2LMC B;  4PV1 C;  3J81 L;  1EOT A;  2K52 A;  2AQ1 B;  4JOI C;  4H02 A;  1R9T B;  4A3G H;  3KOJ A;  3QOL A;  1RIP A;  3MFY A;  2PZT A;  1ZEQ X;  1RD9 D;  1Y14 B;  1O7Y A;  2F4I A;  1GUG A;  3MZ5 A;  1RDP D;  3I91 A;  2UUA Q;  1X3P A;  4BA1 I;  3SK4 A;  1K9M C;  3S24 A;  2F0E A;  4DR3 Q;  1J6Q A;  2MP1 A;  1L1O C;  1D5Z C;  3ICE A;  1HRJ A;  3GTM B;  4ME3 A;  2RHQ B;  3A54 A;  2B39 A;  1B1Z A;  4DR7 Q;  4JYA L;  1NNX A;  4L5T A;  1TWH H;  1EOV A;  4PZ8 A;  1WTP A;  3IRB A;  5M9O A;  2Q2I A;  4K8J A;  2NZO A;  4EQ5 A;  3GTO H;  3KFU A;  3PO3 G;  1Y8P B;  4BXX G;  4GN4 B;  3FPU B;  1L0X B;  1Y1W G;  2K4K A;  2DJG C;  2PO4 A;  2WII B;  3T53 B;  1SMX A;  5KYL A;  4IPG A;  4OIJ A;  4LF5 Q;  3J80 i;  2NZH A;  3S15 B;  4CJ1 B;  2F3W A;  3STB C;  3GTJ B;  4NW2 A;  1K8O A;  2GN5 A;  1PTO F;  2WKD A;  3M4Y A;  3ERQ A;  1WD1 A;  4FDB A;  3M4P A;  4BY7 G;  3SK6 A;  1VQ6 A;  4IUP A;  2B29 A;  3N52 A;  2A73 B;  3OYY A;  1PH4 A;  3GP7 A;  1BVS A;  4R8N A;  3PO3 H;  3VR2 A;  4BXX H;  4JI3 Q;  3A56 A;  1E7Z A;  1YBY A;  3FPP A;  1KHI A;  4R9W A;  3SK8 A;  4X66 L;  1JJG A;  1HFG A;  2LKV A;  4DK3 C;  4OL7 A;  1ESF A;  3CCL A;  2X6G A;  1EEF D;  1K8M A;  3EIV A;  5M3M H;  4XTC S;  2E5L L;  1XXG A;  4QY7 A;  4JBK A;  1G6Z A;  5FLX L;  1VQ8 A;  3J80 c;  1SMY C;  3BYT B;  3I55 A;  5TSS A;  1TII D;  2IX0 A;  3FKI B;  1PTO C;  4OO1 I;  3KLW A;  3MEH A;  1I4P A;  3CMA A;  1L2F A;  2F0P A;  3HOY B;  1DZ1 A;  5I2Y A;  2I46 A;  1CK1 A;  2ZT9 C;  4LF7 Q;  1H9S A;  5BR8 L;  4PMC A;  1DYQ A;  5M5Y H;  4B3R L;  1PZI D;  3CCR A;  4DR6 Q;  2H1E A;  3V05 A;  1FNW A;  1SRO A;  3P75 A;  1SAP A;  2CW0 C;  5KGU A;  5IIF A;  3S1Q B;  4OHJ A;  5JPN C;  3E5S A;  3CC4 A;  3NEN A;  4A3D G;  3ONA B;  4IUT A;  4BBR G;  4GN5 A;  3VR4 A;  4K0K Q;  3D0F A;  1WTW A;  3MXN A;  2OTL A;  1D5X C;  3WWV A;  2B3G A;  5JJI A;  1GO3 E;  2UXC L;  2YYZ A;  3FVQ A;  4FYD A;  1VQ5 A;  1U0L A;  5CR3 A;  1C9O A;  4PG3 A;  2ZM6 L;  4RHS A;  1GKH A;  2RQX A;  1CSQ A;  2KCC A;  5KEE A;  4GOP A;  4ZK9 B;  3GTK B;  2RHS B;  1U5K A;  4DAM A;  2JA6 G;  3VR5 A;  1H9R A;  2HHH Q;  5FOB B;  2L5T A;  3O13 A;  1R4Q B;  4X65 L;  4V19 0;  1UE6 A;  2OEO A;  4QUC A;  5EGT A;  4FF2 A;  3TRZ A;  1WTH A;  3IL8 A;  2O5J C;  4A3D H;  4A93 B;  3TP7 A;  2QCP X;  4BBR H;  5DAU A;  3CC7 A;  2V1C C;  3ITP A;  2X69 A;  4ME5 A;  1CKM A;  1S3O A;  3LGJ A;  4DV3 Q;  1F2Z A;  1Z6H A;  3V96 A;  1ENF A;  4IPH A;  3I4M G;  4X3S A;  4WFN 3;  1MI2 A;  3GQB A;  1RTN A;  3UDF A;  2R7D A;  1EUJ A;  1SEB D;  2PPB C;  4A3G B;  1B50 A;  1PZK D;  2DNE A;  1Z7T A;  3CU7 A;  3TRE A;  4APV A;  2NVX B;  3FHW A;  1VQ4 A;  2JA6 H;  3HG9 A;  4A3I B;  1MHW C;  3B6Y A;  3DMU A;  1DOL A;  4XT3 B;  2WAC A;  4KN7 C;  4AH6 A;  1EFI D;  2E2I H;  2PQA B;  1D2B A;  2UUA L;  2ZJR A;  4U68 A;  2Z1C A;  1AE2 A;  3J81 j;  1QZH A;  3J7A 5;  4DR3 L;  5IP9 G;  4FXK C;  2TSS A;  4HIM A;  1AE3 A;  1S72 A;  1J5E Q;  1TWH B;  3J7A F;  5HUR A;  1PFS A;  4C2M H;  4RFB A;  1K8G A;  1PH7 A;  1VQO A;  4OIK A;  5IYC G;  3GTO B;  4DN4 M;  3NBI A;  1TS2 A;  2ZJQ A;  4EQO A;  4DR7 L;  5D14 A;  5GAH C;  2D5D A;  1PTO H;  4ZYS A;  1EY5 A;  3CCM A;  5ELF A;  5GRO A;  1YNN D;  5BN5 A;  1I4X A;  4IFD J;  1LUZ A;  1ET9 A;  4A3M G;  2Q8R E;  2LXJ A;  4UP8 A;  3H15 A;  5I6Y A;  1MJC A;  2K14 A;  4GKK Q;  1ZYR D;  3QG1 A;  4TSS A;  1STE A;  3PV0 A;  1X3F A;  2EE1 A;  3W3A A;  4J8Q A;  2XTI A;  4LF5 L;  1S5D D;  3SR1 A;  2E2J H;  1BCP D;  5IP9 H;  3TZU A;  3L2P A;  3AYH B;  2SDF A;  4O2D A;  4P75 A;  1H95 A;  1LO5 D;  3K7U C;  2HCI A;  2WAQ G;  3VR6 A;  3OIQ A;  4KHP Q;  3PO3 B;  1CHQ D;  1V1P B;  5E1F A;  3K81 C;  2D9U A;  4KY6 A;  4X6A H;  1GUN A;  2B2T A;  2XN9 C;  3SE0 A;  3R2T A;  4A3M H;  3K57 A;  3JC6 6;  4JI3 L;  4C56 C;  4ZQ3 A;  1JC7 A;  1RKN A;  4L6T B;  5M3M B;  1Q86 C;  1E0B A;  4A3E H;  1WD0 A;  2PYK A;  1BBW A;  2Z6B A;  1RF2 D;  5JEA J;  2UU9 Q;  1Q81 C;  3PIP 3;  2B2Y A;  1J8I A;  4IUQ A;  2CH4 W;  1SYF A;  1E2Z A;  2R7Z H;  2B63 G;  4JV5 Q;  1OO9 B;  1JMC A;  3TP5 A;  4DV0 Q;  4TQU S;  2K5Q A;  3A8J E;  4A3K G;  1PH5 A;  2NVY H;  2G5D A;  4C3H G;  4JVZ A;  1N36 Q;  1EQV A;  5IGD A;  3ZJY C;  5M5Y B;  5I6W A;  4KMU C;  4NDX A;  4J1M A;  5HGQ A;  5M3F H;  3I4O A;  1PH3 A;  1Z9F A;  3NTH A;  1UEA B;  5LL6 S;  4LF7 L;  4QQB X;  1BDO A;  3DEO A;  1Q7Y C;  2JE6 I;  1VQ7 A;  1QIL A;  1VQP A;  3EJI A;  3TQY A;  2EZV A;  1C7Y A;  4DR6 L;  1DOK A;  3BZC A;  2L4N A;  4XYO A;  1BR9 A;  4LMQ D;  1II3 A;  3T16 A;  1ICF B;  2AWO A;  2HUG A;  1XPO A;  2B2U C;  2B63 H;  4DXF A;  3OSO A;  3GTQ H;  3URY A;  1L1O B;  1XNR Q;  1JT8 A;  4K0K L;  3NPP A;  4KV6 A;  1XJV A;  3EQL C;  3R2I A;  1NUC A;  4C3J G;  3TME A;  2E74 C;  2KBN A;  2KEC A;  3P1H A;  1KDB A;  3NQT A;  1N33 Q;  1CI3 M;  3E9I A;  4L5R C;  3MXG A;  4CDE C;  1SJE D;  1IBL L;  1NY4 A;  1GHJ A;  4A3D B;  2A69 D;  4BBR B;  2HHH L;  2JK8 A;  4DK0 A;  2LFN A;  2NWG A;  1LLR D;  3MAQ A;  1HZ9 A;  2HCC A;  1HFN A;  4CJ2 C;  2ASB A;  3GO5 A;  2RDG A;  4NKL A;  1YVC A;  3BU2 A;  1EWI A;  1B53 A;  3TSS A;  2L55 A;  1ILQ A;  1SNM A;  1C8C A;  2F0Q A;  2Q2U A;  5GAE C;  2PQE A;  2KQ3 A;  4ZRZ A;  2GVA A;  2R92 H;  5C0X H;  2F0I A;  2MHV A;  4K5W A;  4DV3 L;  1L0Y B;  4C3J H;  3FMC A;  4K14 A;  3T56 B;  3D4R A;  4DV4 Q;  1SLJ A;  1YI2 A;  1G6P A;  3A55 A;  2QA4 A;  1VQA A;  2JA5 G;  4JI6 Q;  4JI8 Q;  1ASY A;  3GTM H;  2E2I B;  4XT1 B;  3CXC A;  3JAM L;  2PI2 A;  4ZUJ A;  1KDC A;  1PYW D;  2PW5 A;  4FF1 A;  4WJW A;  5IGB A;  1EYG A;  1BCP F;  4C2M B;  1M1K C;  2F0F A;  5CV9 A;  1VQD A;  3I2Z A;  3STB D;  4NXM Q;  1J5E L;  1SXT A;  4JC0 A;  1PTO B;  3CF5 A;  1TWC H;  3F8T A;  3RUZ A;  5FO9 B;  1EYD A;  3GV6 A;  1QUQ B;  4X64 L;  2VB3 X;  2JA5 H;  1JOK A;  3NTI A;  5M5X H;  2FXQ A;  2K03 A;  2MQH A;  5CMD A;  4ZUI A;  3PIO 3;  5K5P A;  5E4W C;  1JOR A;  1YNN C;  1MIU A;  3PF4 A;  1DOM A;  2E2H H;  1A0I A;  1YJN A;  2E2J B;  1TS4 A;  2VZA A;  3M85 A;  4GKK L;  1WTX A;  1ZYR C;  2MJ8 A;  1NBW A;  3UI2 A;  1A3T A;  4POF A;  3M7N A;  1VS0 A;  3RLF A;  2RKS A;  2R7F A;  4HCE A;  1CKO A;  1BCP C;  4DUZ L;  1TU2 B;  5HY6 A;  1VCI A;  3UE1 A;  1HNX Q;  2VY3 A;  2L12 A;  3RN5 A;  1YHB A;  5DEH A;  4KHP L;  3KLR A;  2BDN A;  4PNY A;  3G48 A;  4DNR B;  4H0L C;  3MFG A;  1TVX A;  2F0N A;  4LK1 C;  1B3Q A;  1U4P A;  5FJ8 G;  4UPA A;  2MPM A;  2QW7 A;  4QJF A;  4A3E B;  3GDE A;  5DM7 3;  1N8R C;  3D4W A;  2CHB D;  3PIO A;  2N3S A;  1TR5 A;  2M9V A;  1Y8N B;  2KVM A;  2KEE A;  1MSG A;  4YCU A;  3CME A;  1A62 A;  3T4A C;  3NTK A;  2R7Z B;  5FO8 B;  2NN6 I;  3F2B A;  1HZC A;  1NTG A;  1TS3 A;  4BWG B;  1F77 A;  2F0O A;  3K8A A;  2ZTE A;  2UU9 L;  1I3Q H;  1DD2 A;  1FR3 A;  2NVY B;  2CW0 D;  4OO1 G;  1NMG A;  1BUV T;  1EY4 A;  1JWU D;  1WCM G;  1YZ6 A;  4JV5 L;  1PLF A;  2K6A A;  4GLA C;  5COR A;  4CDC C;  1RL2 A;  4KKS A;  1X32 A;  5M3F B;  3PQI A;  1N36 L;  1B44 D;  3BDC A;  4JI0 Q;  2Z6K A;  1HQR D;  3TS0 A;  1V9P A;  2Q8I B;  1PDQ A;  3MHB A;  3BDO A;  4HR7 B;  3OMG A;  4TRD A;  3OW7 A;  2IL8 A;  5IP7 G;  3C2P A;  3NHH A;  3GTL B;  2R3Z A;  2Z9H A;  2KHS A;  1LT4 D;  1OTC A;  2K5V A;  3QO2 A;  5J1Z A;  3K80 C;  5H1S E;  3GTQ B;  2O4X A;  2LY7 A;  5CBA E;  4OO1 H;  3K0Y A;  1PRT D;  3I56 A;  1WCM H;  4HED A;  1JJC B;  4A3G G;  2K1B A;  1XNR L;  4HSV A;  4X3U A;  3ND8 A;  2HDL A;  4A3I G;  2JA7 H;  2Q2H A;  4A3J H;  1EU3 A;  4BBS G;  1WFQ A;  4GLV B;  4KJN A;  1IXR A;  3S2H H;  1V1Q A;  1C48 A;  3M4O B;  4V0B A;  2PZW A;  2IWH A;  3HOX G;  4XDX A;  1IYU A;  2F0D A;  1N33 L;  2SNS A;  2AMC B;  3CCE A;  1SE2 A;  2PQA A;  1Y69 U;  4BY1 G;  3C1E A;  2JA8 G;  5J22 A;  1TWA H;  5IOC A;  2A69 C;  3HOV G;  3Q23 A;  4C1N I;  2AUJ D;  1NE3 A;  4A75 A;  1VQH A;  1HTL D;  4LFA Q;  2R92 B;  1UWV A;  2CWA A;  2NVX H;  4DAY B;  4DV1 Q;  4C3J B;  2KCN A;  5JJZ A;  4A3I H;  3S1M H;  4BBS H;  5FK9 C;  1STG A;  1ZXT A;  2O2L D;  3BVZ A;  3SDZ A;  1GVP A;  3C1F A;  2WP8 J;  4A3F G;  3HOX H;  3CPW A;  1FD7 D;  2I5H A;  1XPR A;  5GQO A;  4X3K A;  2F0M A;  1Q1B A;  4CBV A;  2VNU D;  4ABN A;  4DV4 L;  1F9P A;  2F0V A;  3TEH B;  4UP7 A;  2R61 A;  1ASZ A;  4JI6 L;  1WTQ A;  2F0G A;  4JI8 L;  2A6H D;  4BY1 H;  2JA8 H;  1QZG A;  2HT1 A;  3HOV H;  2F4V Q;  2AQ3 B;  1ML0 D;  2M2L A;  1QOH A;  1AN8 A;  3EA6 A;  3PO2 H;  1TWC B;  2BH8 A;  4FP5 D;  3E9H A;  2A68 D;  4C3I H;  3ND9 A;  1V1P A;  3D6W A;  3C46 A;  2ALY B;  2R6G A;  4NXM L;  1XTC D;  5EPK A;  5EBC A;  2JA5 B;  4H13 C;  5M3M G;  3U4V A;  5M5X B;  4A3F H;  2EJG C;  1BNZ A;  3L3O C;  1PH6 A;  2WKC A;  4IZ8 A;  4L63 B;  1E2W A;  2M00 A;  5C44 H;  4LF9 Q;  3EFX D;  2F3I A;  4L5Q A;  4K8I A;  4IOA A;  2E2H B;  4DK1 A;  1LV9 A;  3MEF A;  1GD7 A;  1TT2 A;  5G3L F;  1K3R A;  3MC0 B;  3S1R H;  1YHQ A;  1S5F D;  1TY0 A;  4IO9 A;  3WOF A;  1G51 A;  2DUD A;  2XIW A;  4GOP C;  1A15 A;  1CZG A;  3HOW H;  4JCV E;  4NB3 A;  4YHH Q;  2I07 B;  1WTO A;  2RVL A;  4DPG A;  3Q6S A;  1XMO L;  1S4Z A;  5IT9 E;  1B2T A;  3ER0 A;  4R4Q A;  1QB5 D;  4YWM A;  3OPO A;  1HNX L;  3T1Y Q;  3CCU A;  4JI5 Q;  1F2Y A;  1LTS D;  4GNX B;  1A63 A;  1WOC A;  1JE4 A;  4P2C B;  2YTV A;  4JOI A;  1O7Z A;  2K5D A;  3HKS A;  1ONL A;  2B2W A;  3BVM A;  4LF4 Q;  1EY7 A;  1SYB A;  1CKN B;  2D2C C;  1FJG Q;  2N88 A;  1I3Q B;  2RA4 A;  2JSO A;  5CV4 A;  2X6L A;  3CCS A;  1L1O A;  3H0G B;  5IGG A;  4WJ4 A;  4JK1 C;  3P7J A;  1PRT F;  3DM3 A;  3X3M A;  5D3D A;  1EWH A;  4QMG A;  1JCK B;  5ELO A;  2VQE Q;  3DWQ A;  1VQK A;  2OQ0 A;  2KJX A;  4KY7 A;  4A3C H;  3SHL A;  2E75 C;  3DWA A;  1VF7 A;  4JI0 L;  1GUS A;  2ZXP A;  5A2Q E;  5CV6 A;  3W2D A;  5KRU A;  1WYD A;  3BZD B;  4B08 A;  2CWP A;  5JPM C;  3CAM A;  1U9R A;  1VF5 C;  1PFM A;  1WCM B;  1IBL Q;  4NPS A;  2EXZ A;  1CSP A;  3VYU A;  3NK9 A;  3AQQ A;  1WVL A;  2JA7 B;  2KUM A;  4A3J B;  2QDB A;  1PRT C;  1NMF A;  3S2H B;  3SXH A;  2Z4H A;  5KIX A;  4J6H A;  4K5X A;  3FEW X;  4LF6 Q;  1HR0 Q;  4DAV A;  3I7F A;  1UEB A;  4N9P A;  1E3P A;  1KRS A;  2F0T A;  1P8L A;  2OCE A;  2RBM A;  5GAG C;  3GV3 A;  1X6O A;  3HFZ B;  1TWA B;  5COY A;  4DU9 A;  1Y1V H;  1TS5 A;  3VR3 A;  4JBM A;  1FNV A;  4RGN A;  1LT6 D;  5CYU A;  1VQE A;  4DR4 Q;  4CDD C;  1HUM A;  1HJP A;  1X65 A;  4OON A;  4LFC Q;  1QVC A;  3S1M B;  4BBS B;  1Q90 A;  3QJY A;  2UXB Q;  4LFA L;  1BCP B;  2G9H D;  4DV1 L;  3HOX B;  1KXL A;  1XTD A;  1K73 C;  2B2Y C;  5IE8 A;  2JQO A;  2DNC A;  3KBX A;  4G4K A;  1FGB D;  2UXD Q;  3CQZ H;  2HDM A;  5C5M A;  1E1T A;  1L0W A;  2JEB I;  2QIL A;  4B9W A;  1F2M A;  1SE3 A;  2MGS A;  3K5L A;  4BY1 B;  1VQ9 A;  2JA8 B;  4RCN A;  3HZX A;  2E76 C;  3BJU A;  3HOV B;  2KA7 A;  5BN3 A;  3FDT A;  4A3B G;  2JJQ A;  3Q24 A;  4X64 Q;  1PYS B;  4P73 A;  3JAM E;  1EZ6 A;  1KNA A;  2A6H C;  4XIG S;  1C0A A;  3PO2 B;  2AQ2 B;  5ELN A;  2F4V L;  3U9S A;  1HUN A;  5C4H A;  1IKL A;  4OWW B;  4C3I B;  4RHR A;  1CA5 A;  1BKB A;  4A3F B;  1MD2 D;  1F2L A;  4A3E G;  1U4R A;  5DNF A;  2HQE A;  1HZA A;  5C44 B;  4CKB A;  2A68 C;  1A6X A;  5C4Z A;  3IKJ A;  4DUZ Q;  4KTA A;  3KLS A;  5KNB A;  2R7Z G;  2EYJ A;  1BF4 A;  1G2T A;  3PSI A;  4LF9 L;  3S1R B;  3D3R A;  2A1A A;  4LUV A;  2B2V C;  4A3B H;  1A3V A;  4ULL A;  1DM0 B;  3T51 B;  3H91 A;  3S14 H;  4DA2 A;  4FF4 A;  4LJZ C;  4FNF A;  4DR1 Q;  3W1B A;  1VQI A;  4M1U B;  4JI2 Q;  3HOW B;  3R8B A;  1STY A;  1LT5 D;  4RWS C;  5M3F G;  3E6Z X;  1OXV A;  1U4L A;  3NBH A;  1YJ9 A;  3BZK A;  2FIN B;  4DK6 C;  2Z8L A;  3PGZ A;  2E2D C;  3T13 A;  4B3S Q;  4YHH L;  4K5V A;  2N8N A;  2PNH A;  4HJ8 A;  3T1H Q;  3LWE A;  2K01 A;  4B3M Q;  2ZXR A;  4F87 A;  4AQY Q;  3F1Z A;  1KIX A;  1JOQ A;  2D0P A;  2NVT H;  3D4D A;  3T1Y L;  2L0C A;  1X55 A;  4JI5 L;  1IHZ A;  4IJL A;  4MNO A;  4RG1 A;  4R8I A;  1XWE A;  4BS9 A;  5CBE E;  4RGO S;  1EY9 A;  2NN6 G;  1GUT A;  1O80 A;  5CV5 A;  4LF4 L;  3VA7 A;  1SFO H;  4WJ3 M;  5IT9 c;  5AJ3 Q;  3BG3 A;  2XGT A;  4KKT A;  4IUR A;  1FJG L;  1NR2 A;  1WI5 A;  4G7O C;  1B9N A;  5JJK A;  4RKB A;  2UUC Q;  4HIO A;  1RJT A;  3QWN A;  1B3A A;  4UHV A;  1F9Q A;  4RAU C;  3K5O A;  1SNO A;  1TY2 A;  3PUW A;  4KY5 A;  3WOE A;  4DUY L;  2R93 G;  5M5W H;  1M8A A;  3GTL H;  1TWG B;  4LWC A;  2VQE L;  1SN8 A;  3PIP A;  1LM0 A;  1D6E C;  4N8X 1;  4TKO B;  1ESR A;  1JJ2 A;  1K83 H;  4PZ6 A;  3CW2 C;  3S17 H;  2IY5 B;  4CKE A;  2N55 A;  1MBY A;  1G91 A;  1G8Z D;  3NWS A;  1AZP A;  2NN6 H;  4K6D A;  1QCB D;  3BVG A;  3SK5 A;  3AMU A;  2JA9 A;  2ZTD A;  1KL9 A;  2R92 G;  5C0X G;  2PW7 A;  1KAB A;  4LAA A;  1I6H H;  2F0U A;  3F2C A;  1H9S B;  4IN3 A;  1K0R A;  4ALP A;  3A7A B;  2F03 A;  4RMF A;  5FLM G;  3L7Z C;  1P16 A;  3M4O H;  4ZKB B;  1XYI A;  2R93 H;  4DAY A;  2CKZ B;  1OXT A;  5C3E G;  2WFW A;  2NUC A;  4KI0 A;  5IY0 A;  3KF6 B;  4OWX B;  4DXG A;  1E22 A;  3FP9 A;  3QOJ A;  1XMQ Q;  1AP0 A;  4JPB W;  4X62 Q;  4XQJ A;  1Y8O B;  5JVG 3;  4LF6 L;  1HR0 L;  2IW3 A;  2L11 A;  3MXN B;  4EVO A;  1Y1V B;  4LF8 Q;  3N6R A;  2OT2 A;  2EQS A;  1IKM A;  1EFW A;  1YIT A;  5IOD A;  4DV6 Q;  1J9O A;  1RHP A;  2HQL A;  5FLM H;  4GOP B;  3Q22 A;  1O78 A;  4DR4 L;  3CRK C;  1HPC A;  5C3E H;  3J81 E;  2K04 A;  1SE4 A;  3HOU G;  3H3V I;  4LFC L;  2IJ0 A;  3TBI B;  3ERS X;  3JAM i;  3PCO B;  2UXB L;  5T1I A;  3CQZ B;  1D8L A;  1YNX A;  1A2U A;  3SVM A;  4WOR A;  3E0E A;  4MTN A;  2L9H A;  2UXD L;  1AFP A;  5J3B A;  2B8F A;  1BOS A;  5I9P A;  3KBG A;  4IUV A;  2KOL A;  5HGT A;  2L1B A;  5EQ0 A;  1W6J A;  4ILW A;  2ATW A;  2D62 A;  4LUO A;  2ENB A;  4L8J A;  2Z6K C;  5I2X A;  3NQI A;  4HTH A;  2WB1 E;  4DF7 A;  1N32 Q;  1W2B A;  3HOU H;  1DCZ A;  3J7Z C;  4NP5 A;  4RGT A;  1UNS A;  5IYD G;  3F2D A;  1GJX A;  1V1O A;  2NZ1 D;  1Q8K A;  2EYH A;  3CD6 A;  4GNX A;  4JBW A;  4UP9 A;  3AB9 A;  3KJO A;  3I4L A;  4MTK A;  1V8Q A;  5ELD A;  4A3B B;  4HJ9 A;  2CVR A;  1IL8 A;  4DKA C;  1XMO Q;  3RLO A;  1HH2 P;  2YU9 H;  3S14 B;  5EJW A;  3H0G G;  3P20 A;  1JQY D;  3U9O A;  4YCV A;  1JB3 A;  4E6I A;  4N8F A;  4EQN A;  2DN8 A;  3S9W A;  4CJ0 B;  2D0O A;  1I4R A;  1T5E A;  3MXU A;  1ENA A;  1S5C D;  2A74 C;  3ULP A;  4DR1 L;  4JI2 L;  3AU7 A;  2E8G A;  5G3L D;  4DV2 Q;  3KUP A;  1KC8 C;  3M9B A;  3I8Z A;  4O0A A;  2RSN A;  3D6C A;  3EN2 A;  1VQN A;  1YJW A;  5IYD H;  4ZAI A;  5LMU Q;  2A19 A;  1PRT B;  4IPD A;  4B3S L;  2IX3 A;  3LWU A;  3G6J B;  2NVT B;  2Q2T A;  4IOC A;  1KTK A;  4JI1 Q;  4C1N K;  2XSC A;  3T1H L;  3PUZ A;  4B3M L;  3FRP B;  2K7V A;  5D3I B;  1EYA A;  4DR5 Q;  3DLL A;  4AQY L;  1VQG A;  1VQC A;  4I7A A;  2RF4 A;  2KCT A;  3OMC A;  2IPK D;  5FLX E;  1JWS D;  3H0G H;  5KYI A;  3UDX A;  4HSP A;  1SFO B;  2QEX A;  2C35 B;  1SNP A;  2NBF A;  4DNT B;  2JA7 G;  1GUW A;  1U4M A;  3M4Q A;  3A7L A;  4A3J G;  4DV7 Q;  3LX0 A;  1EIH A;  5AJ3 L;  5FO7 B;  2OF1 A;  3KDF B;  1I94 Q;  2CFM A;  1SBB B;  5M5W B;  2BCO A;  4Q5V A;  1CTM A;  2UUC L;  4QB4 A;  2VS1 A;  1HTP A;  1UE7 A;  4X3T A;  5LHY 1;  1K83 B;  4PMB A;  1PYB A;  3S17 B;  3KF8 B;  1HR0 W;  1H9K A;  4R4C A;  2NVQ H;  1GM5 A;  1H9J A;  4QGU A;  3RD4 A;  4F7X A;  4K2L A;  3TS2 A;  1QJO A;  2Y0S E;  2Z4I A;  2DGY A;  3MTS A;  3R3O A;  3RNU A;  1I6H B;  2RSO A;  4XYQ A;  4JI7 Q;  3NXW A;  3ULJ A;  4NMZ A;  3AEV A;  3LNN A;  3U50 C;  2WB1 B;  2R93 B;  4KHV A;  1FL0 A;  1I5F A;  1LAB A;  3TZD A;  2ES2 A;  3TP8 A;  1STB A;  3RR5 A;  5NUC A;  4DR2 Q;  4TVA B;  1ENC A;  3W5O A;  2F0J A;  4N9T A;  1SYD A;  4UAI A;  3VYS A;  1IL2 A;  4MZ9 A;  4GN3 B;  4G7H C;  3J81 i;  4RA8 A;  1X54 A;  2FHT A;  1XMQ L;  2XRQ D;  3HOZ B;  1PZJ D;  4X62 L;  3A8I E;  4MIU A;  4F88 A;  3PO2 G;  3MWY W;  1XX8 A;  1VQL A;  3RLN A;  3GTP H;  1S5B D;  3I70 A;  2CQO A;  5JVH 3;  3Q8D A;  5D65 A;  4C3I G;  4LF8 L;  4CDF C;  1LTL A;  3DWP A;  2NB0 A;  4QIW E;  1IW7 D;  4K6L A;  1HNZ Q;  5C3E B;  4WRD A;  5C4X G;  1I50 B;  5C44 G;  3M7G A;  4DV6 L;  3TP6 A;  3OWF A;  2B2W C;  3UDI A;  4RKL A;  5ELB A;  1FYC A;  2DJF C;  1KNE A;  3BYY B;  3I4N B;  4IJH A;  4FXD A;  5K36 H;  2IHE A;  4OX9 Q;  2EJF C;  5J39 A;  1KLU D;  2OXP A;  3G71 A;  1MKH A;  1Q82 C;  1EIY B;  3HOW G;  2PNR C;  1UAP A;  1SDF A;  3J81 c;  3SGI A;  3K6O A;  2HD3 A;  1EQT A;  1X3E A;  1YNJ C;  3K7A H;  4HN7 A;  4DV5 Q;  2RCN A;  4FVM A;  4ZLT F;  5C4X H;  3HOU B;  1D5M C;  2F0S A;  1G2S A;  3K5M A;  3A74 A;  3HS0 C;  4KLK A;  5JOB A;  1PFB A;  1H9M A;  1O7I A;  1N32 L;  3J80 L;  2CCZ A;  2RDF A;  1CQV A;  4ZCK A;  1JR0 D;  4UDU C;  5F2D A;  1BQQ T;  3CC2 A;  2UUB Q;  2YU9 B;  1RCV D;  4GS3 A;  2XWJ B;  4PZ7 A;  3PMF A;  3DEP A;  1VMC A;  2Y0S B;  4EGV A;  4GKJ L;  3CCJ A;  3VYR A;  1CZW A;  4IFD I;  1EY8 A;  1VMP A;  4PMW A;  3L9A X;  5ELC A;  1HNW L;  2SEB D;  4A3C G;  3CCV A;  4I7Z C;  1WTR A;  4ZKC B;  1CFM A;  1DGS A;  4KN4 C;  1ICW A;  4S3S A;  3OIP A;  2IHF A;  1K8A C;  1MSH A;  5KND A;  1Y1W H;  1A2T A;  4DV2 L;  1LTI D;  3NP8 A;  1EU4 A;  1I4Q A;  2AWN A;  3PF5 A;  3TDQ A;  2XRS D;  5L37 A;  5LMU L;  4KD3 A;  3RZD H;  2NYZ D;  2EY6 A;  2O5I C;  3VA5 A;  4CHT B;  3D31 A;  4JI1 L;  4DUY Q;  4DGZ A;  4BY7 H;  4DR5 L;  4HJ7 A;  1X9N A;  3AFP A;  1X3Q A;  2FMM A;  2PMZ E;  2J7Z A;  5EPL A;  1EEI D;  3H3V C;  2JN4 A;  4OXP A;  4QIW B;  5C0X J;  3C3L A;  1OXX K;  1TWG H;  1KLG D;  2J0T D;  2PZU A;  2BE5 D;  4DV7 L;  3PUV A;  2AHO B;  1I4H A;  3Q0A A;  3I73 A;  1XPU A;  4R4O A;  1I94 L;  2WV6 D;  1QVG A;  4K2K A;  3CRL C;  5FLX c;  3KF6 A;  4J15 A;  2C9O A;  1Y1V G;  2NVQ B;  3KK7 A;  4EQP A;  1VDZ A;  2EY5 A;  2H4O A;  2RDH A;  2XNA C;  4R4I A;  1ZKO A;  3DXJ C;  1PXU A;  1VQF A;  2F0W A;  1HCZ A;  5IGF A;  3H6M A;  4LW1 A;  1PH9 A;  3S1N H;  5EPJ A;  2H5X A;  1LTR D;  1QWY A;  1TXY A;  2NTT A;  3MVV A;  1KRT A;  4P72 A;  1CQF A;  3NUC A;  5E3F A;  2OWO A;  2QEJ C;  1T5X D;  2JEA I;  2MNA A;  1CUK A;  2EPB A;  3DHQ A;  4JI7 L;  1A8V A;  4QF4 A;  1Q46 A;  2A6E D;  1DJR D;  4DR2 L;  1PMR A;  1KD1 C;  4JG2 A;  2C5C A;  2KED A;  3A8K E;  2B2T C;  5LMN Q;  1STN A;  1XNQ Q;  1AW7 A;  1NSN S;  1OXS C;  3RMH A;  4NXN Q;  4AYB G;  4O42 A;  3GTP B;  3U4Z A;  1BBX C;  5C4J H;  1F9R A;  4B9X A;  1N34 Q;  1SNQ A;  4DFA A;  4KD4 A;  1EWC A;  3DUZ A;  3MXP A;  4Y52 H;  2K33 A;  2XWB B;  1WTV A;  4LFB L;  3F2U A;  1GOZ A;  2MFI A;  4QCL A;  4HJ5 A;  1QUQ A;  1EZ8 A;  1S5E D;  3OOC A;  2QGQ A;  4HMJ A;  2K5W A;  1HZB A;  3GD7 A;  1SYE A;  4OEL B;  5GAD C;  1HNZ L;  1IW7 C;  3ERO A;  1QVF A;  2K32 A;  1B8A A;  4HMI A;  1PA6 A;  4P74 A;  2ZTC A;  3AFQ A;  1MJE A;  1M4V A;  1JE5 A;  1LT3 D;  1HHV A;  1EQQ A;  1G29 1;  3RZO H;  2K28 A;  2VQF Q;  4OX9 L;  3NEM A;  1SNC A;  3I4M H;  3CCQ A;  2PMZ B;  4LNQ A;  3K5N A;  5IGE A;  3S16 H;  2JP1 A;  1I4G A;  3HP3 A;  2ID0 A;  5C3W A;  3K7A B;  3L0O A;  1B7Y B;  5C4X B;  2EYM A;  5IGC A;  1IYV A;  1PH1 A;  2F52 A;  5CC4 A;  3NEL A;  1SSO A;  1O7L A;  3H3V H;  5BN4 A;  4PQX A;  2G9D A;  1E2V A;  4DV5 L;  4YY3 Q;  1N9W A;  4HCS A;  2VB2 X;  4QUF A;  5FKA C;  5I9O A;  1GXD C;  1W6K A;  3OTO Q;  1EIF A;  1IBK Q;  1DON A;  2SOB A;  1D7Q A;  1KDA A;  4Y7N H;  2PCF B;  1CM9 A;  2BA1 A;  1LTB D;  2GVB A;  2XVS A;  3NSW A;  1PVO A;  1M90 C;  2UUB L;  2QKI C;  1CHP D;  2HIX A;  4FF3 A;  5IT9 L;  2KHI A;  5IYC H;  2A8V A;  3GTG H;  3A5U A;  5E4X A;  1QNU A;  2EYL A;  4H44 C;  2KHJ A;  1MGS A;  2FMC A;  2Z0S A;  4IAL A;  4CGY B;  1SE8 A;  4Z9C B;  1Y1W B;  5EBD A;  3KDF A;  1IBM Q;  3M3Y H;  1B70 B;  2EIF A; 
#chains in the Genus database with same CATH homology
 1CT1 D;  5AFW A;  4I65 A;  4RGM A;  5DM6 3;  3RZD B;  1AZQ A;  4RCO A;  1EIG A;  4G57 A;  1Q1E A;  2JYO A;  3KF8 A;  4BY7 B;  3OHX C;  2Q8T A;  3K59 A;  1LTT D;  1D1K A;  1PFN A;  3I3C A;  2BOS A;  5A2Q L;  2VXW A;  3CKI B;  1LAC A;  1QNK A;  2BE5 C;  2J4X A;  2F3V A;  3EVQ A;  4Q0F A;  4HAE A;  3HGB A;  3S1N B;  2FFK B;  3HEJ A;  3IFT A;  5C6A A;  1DXM A;  2V4D A;  2GA4 B;  1F9S A;  2A5H A;  2B2V A;  2F0L A;  2TMP A;  4M8A A;  1Q12 A;  2F0K A;  2ICI A;  2F1M A;  3BDL A;  3V2T A;  4G7Z C;  2EVB A;  1B9M A;  3CHB D;  2B8G A;  4F8M A;  1EYC A;  4FO2 A;  2A6E C;  5JAV A;  1GUO A;  4KJO A;  4DAP A;  3I72 A;  1ROD A;  5C4J B;  3NWT A;  3E0J A;  1ILP A;  4RH6 A;  4YIJ A;  5LL6 X;  3TN2 A;  1SYC A;  3SEB A;  2DY7 A;  5EKL A;  4XXE A;  1V43 A;  3KLS X;  4KHZ A;  2JA6 B;  1KAA A;  5EKK A;  1QE6 A;  2MUY A;  1YNJ D;  1UUP A;  2K05 A;  1HXY D;  2CQA A;  1EY6 A;  3J7A V;  1JIC A;  2EY2 A;  4AYB B;  3R93 A;  5EKI A;  1GHK A;  3RZO B;  2B2U A;  5T1G A;  2EJM A;  3I4M B;  1STA A;  3S16 B;  2F0H A;  4IQZ A;  2EYO A;  4XQN A;  3PUX A;  1Z47 A;  3MA2 B;  1CA6 A;  3VYT A;  2DY8 A;  1TQO A;  5I4D A;  4IUN A;  4KKU A;  1AEX A;  1HA6 A;  3J7Y W;  3K58 A;  3H09 A;  3QB3 A;  4ID6 A;  4Y7N B;  4FXG C;  3J80 E;  2EY1 A;  2WIN B;  2SNM A;  4IFD G;  3GTG B;  2ZXO A;  4GZY C;  2LS0 1;  5CV7 A;  1BO0 A;  1BXT A;  1B4O A;  1TKW B;  1SMY D;  4OGQ C;  5ISR A;  1LTG D;  2EYF A;  3M3Y B;  3HRZ C;  4A3M B;  1JOO A;  1PTO D;  4CKC A;  1LTA D;  2BA0 A;  1RTO A;  1C4Q A;  5CV8 A;  2IX1 A;  5ELE A;  4IUU A;  1FNU A;  2WAQ B;  4IFD H;  3PUY A;  3I90 A;  1ET6 A;  1STH A;  2QF7 A;  5A35 A;  3IFD A;  1R4P B;  3QIA A;  4ODG A;  1EL0 A;  1JWM D;  4U67 3;  1SJH D;  4MN3 A;  5JEA G;  4KK7 A;  2EYP A;  1NCV A;  1HA5 A;  2NTS A;  3DM1 A;  4O1N A;  2EOT A;  1QG7 A;  4XQQ A;  3HKZ B;  4MHE A;  2IT1 A;  2B63 B;  3IAY A;  5CGK A;  1SND A;  1OXU A;  3H94 A;  5C5L A;  1NAP A;  4A3K B;  5C0X I;  1EY0 A;  3BS1 A;  1I6V C;  4C3H B;  3X3N A;  4BA2 I;  1Q3L A;  2ICE C;  3ZYY X;  5JEA H;  4H7B A;  2FJ2 A;  3D8G A;  3S2D B;  1A3U A;  3WDN A;  3G7L A;  3NE5 B;  5K36 G;  2EDG A;  1TWF B;  2JXM B;  3OWE B;  1HQM C;  1SYG A;  5C3X A;  1D1I A;  5KNC A;  1Q8I A;  2VUM B;  1NR4 A;  2AUK A;  2BDO A;  2LMC B;  4PV1 C;  3J81 L;  1EOT A;  2AQ1 B;  1R9T B;  3QOL A;  3MFY A;  2PZT A;  1ZEQ X;  1RD9 D;  1O7Y A;  2F4I A;  1GUG A;  3MZ5 A;  1RDP D;  3I91 A;  1X3P A;  4BA1 I;  3SK4 A;  2F0E A;  2MP1 A;  1D5Z C;  1HRJ A;  3GTM B;  3A54 A;  2B39 A;  1B1Z A;  1WTP A;  5M9O A;  4K8J A;  1Y8P B;  3FPU B;  1L0X B;  2PO4 A;  3T53 B;  2WII B;  5KYL A;  4OIJ A;  3S15 B;  4CJ1 B;  2F3W A;  3GTJ B;  4NW2 A;  1K8O A;  1PTO F;  2WKD A;  3M4Y A;  3ERQ A;  1WD1 A;  3SK6 A;  4IUP A;  3N52 A;  2A73 B;  3GP7 A;  4R8N A;  3VR2 A;  3A56 A;  3FPP A;  4R9W A;  3SK8 A;  1HFG A;  2LKV A;  4OL7 A;  1ESF A;  2X6G A;  1EEF D;  1K8M A;  4XTC S;  1XXG A;  1G6Z A;  5FLX L;  1SMY C;  3BYT B;  5TSS A;  1TII D;  2IX0 A;  3FKI B;  1PTO C;  4OO1 I;  3MEH A;  1I4P A;  3HOY B;  2F0P A;  1DZ1 A;  5I2Y A;  2I46 A;  1CK1 A;  2ZT9 C;  1H9S A;  4PMC A;  1DYQ A;  1PZI D;  2H1E A;  3V05 A;  1FNW A;  3P75 A;  1SAP A;  2CW0 C;  5KGU A;  5IIF A;  3S1Q B;  4OHJ A;  5JPN C;  3E5S A;  3ONA B;  4IUT A;  3VR4 A;  1WTW A;  3MXN A;  1D5X C;  2YYZ A;  3FVQ A;  4FYD A;  5CR3 A;  4RHS A;  2RQX A;  2KCC A;  5KEE A;  4ZK9 B;  3GTK B;  3VR5 A;  1H9R A;  5FOB B;  2L5T A;  3O13 A;  1R4Q B;  4V19 0;  2OEO A;  4QUC A;  5EGT A;  4FF2 A;  3IL8 A;  2O5J C;  4A93 B;  3TP7 A;  2QCP X;  5DAU A;  3ITP A;  2X69 A;  4ME5 A;  1F2Z A;  1Z6H A;  3V96 A;  1ENF A;  4X3S A;  4WFN 3;  1MI2 A;  3GQB A;  1RTN A;  1SEB D;  2PPB C;  4A3G B;  1B50 A;  1PZK D;  2DNE A;  1Z7T A;  3CU7 A;  2NVX B;  3HG9 A;  4A3I B;  3DMU A;  1DOL A;  4XT3 B;  2WAC A;  4KN7 C;  1EFI D;  1D2B A;  4U68 A;  2Z1C A;  4FXK C;  2TSS A;  1TWH B;  3J7A F;  5HUR A;  4RFB A;  4OIK A;  3GTO B;  4DN4 M;  3NBI A;  1TS2 A;  4EQO A;  5D14 A;  2D5D A;  1PTO H;  4ZYS A;  1EY5 A;  5ELF A;  1YNN D;  5BN5 A;  1I4X A;  4IFD J;  1ET9 A;  2Q8R E;  5I6Y A;  1ZYR D;  3QG1 A;  4TSS A;  1STE A;  3PV0 A;  2EE1 A;  3W3A A;  4J8Q A;  1S5D D;  3SR1 A;  1BCP D;  3TZU A;  2SDF A;  1LO5 D;  2HCI A;  3VR6 A;  3OIQ A;  3PO3 B;  1CHQ D;  1V1P B;  5E1F A;  2D9U A;  4KY6 A;  1GUN A;  2B2T A;  2XN9 C;  3SE0 A;  3R2T A;  3K57 A;  4C56 C;  4ZQ3 A;  1JC7 A;  1RKN A;  4L6T B;  5M3M B;  1E0B A;  1WD0 A;  2PYK A;  1RF2 D;  5JEA J;  3PIP 3;  2B2Y A;  1J8I A;  4IUQ A;  1SYF A;  1E2Z A;  1OO9 B;  3TP5 A;  4TQU S;  2K5Q A;  3A8J E;  4C3H G;  1EQV A;  5IGD A;  5M5Y B;  5I6W A;  4KMU C;  4NDX A;  4J1M A;  3NTH A;  1UEA B;  5LL6 S;  1BDO A;  3DEO A;  2JE6 I;  1QIL A;  3EJI A;  2EZV A;  1DOK A;  2L4N A;  4XYO A;  1BR9 A;  4LMQ D;  1II3 A;  3T16 A;  2AWO A;  2HUG A;  2B2U C;  4DXF A;  3OSO A;  3URY A;  3NPP A;  4KV6 A;  3EQL C;  3R2I A;  1NUC A;  4C3J G;  3TME A;  2E74 C;  2KEC A;  3P1H A;  1KDB A;  3NQT A;  1CI3 M;  3MXG A;  1SJE D;  1GHJ A;  4A3D B;  2A69 D;  4BBR B;  4DK0 A;  2LFN A;  2NWG A;  1LLR D;  3MAQ A;  2HCC A;  1HFN A;  4CJ2 C;  3GO5 A;  2RDG A;  4NKL A;  3TSS A;  1B53 A;  2L55 A;  1ILQ A;  1SNM A;  1C8C A;  2F0Q A;  2PQE A;  2KQ3 A;  4ZRZ A;  5C0X H;  2F0I A;  2MHV A;  4K5W A;  1L0Y B;  3FMC A;  4K14 A;  3T56 B;  3D4R A;  3A55 A;  2E2I B;  4XT1 B;  3JAM L;  4ZUJ A;  1KDC A;  1PYW D;  2PW5 A;  4FF1 A;  4WJW A;  5IGB A;  1BCP F;  4C2M B;  2F0F A;  5CV9 A;  1SXT A;  1PTO B;  3RUZ A;  5FO9 B;  1EYD A;  3GV6 A;  2VB3 X;  1JOK A;  3NTI A;  2K03 A;  5CMD A;  4ZUI A;  3PIO 3;  5K5P A;  5E4W C;  1JOR A;  1YNN C;  1DOM A;  2E2J B;  1TS4 A;  3M85 A;  1WTX A;  1ZYR C;  2MJ8 A;  3UI2 A;  3M7N A;  1A3T A;  3RLF A;  2RKS A;  4HCE A;  1BCP C;  1TU2 B;  1VCI A;  2L12 A;  5DEH A;  3KLR A;  2BDN A;  4PNY A;  4DNR B;  4H0L C;  3MFG A;  1TVX A;  2F0N A;  4LK1 C;  1U4P A;  2MPM A;  4A3E B;  5DM7 3;  3D4W A;  2CHB D;  1TR5 A;  2M9V A;  1Y8N B;  2KVM A;  2KEE A;  1MSG A;  3T4A C;  3NTK A;  2R7Z B;  5FO8 B;  2NN6 I;  1TS3 A;  4BWG B;  1F77 A;  2F0O A;  1DD2 A;  1FR3 A;  2NVY B;  2CW0 D;  4OO1 G;  1BUV T;  1EY4 A;  1JWU D;  1PLF A;  2K6A A;  5COR A;  4KKS A;  1X32 A;  5M3F B;  1B44 D;  3BDC A;  1HQR D;  2Q8I B;  1PDQ A;  3MHB A;  3BDO A;  4HR7 B;  3OMG A;  4TRD A;  3OW7 A;  2IL8 A;  3C2P A;  3NHH A;  3GTL B;  2R3Z A;  2KHS A;  1LT4 D;  3QO2 A;  5J1Z A;  3GTQ B;  2O4X A;  2LY7 A;  5CBA E;  4OO1 H;  3K0Y A;  1PRT D;  4HED A;  2K1B A;  4HSV A;  4X3U A;  3ND8 A;  2HDL A;  1EU3 A;  4KJN A;  1C48 A;  3M4O B;  4V0B A;  2PZW A;  2IWH A;  4XDX A;  1IYU A;  2F0D A;  2SNS A;  1SE2 A;  1Y69 U;  3C1E A;  5J22 A;  5IOC A;  2A69 C;  3Q23 A;  4C1N I;  2AUJ D;  1HTL D;  2R92 B;  4C3J B;  2KCN A;  5JJZ A;  5FK9 C;  1STG A;  1ZXT A;  2O2L D;  3BVZ A;  3SDZ A;  3C1F A;  2WP8 J;  1FD7 D;  4X3K A;  2F0M A;  1Q1B A;  4CBV A;  2VNU D;  4ABN A;  1F9P A;  2F0V A;  2R61 A;  1WTQ A;  2F0G A;  2A6H D;  2AQ3 B;  1ML0 D;  2M2L A;  1QOH A;  1AN8 A;  3EA6 A;  1TWC B;  4FP5 D;  2A68 D;  3ND9 A;  1V1P A;  3D6W A;  3C46 A;  2R6G A;  1XTC D;  5EPK A;  5EBC A;  2JA5 B;  4H13 C;  5M5X B;  1BNZ A;  2EJG C;  3L3O C;  2WKC A;  4IZ8 A;  4L63 B;  1E2W A;  2M00 A;  3EFX D;  4K8I A;  2E2H B;  4DK1 A;  1LV9 A;  5G3L F;  1TT2 A;  3MC0 B;  1S5F D;  1TY0 A;  3WOF A;  2XIW A;  1A15 A;  1CZG A;  2I07 B;  1WTO A;  2RVL A;  3Q6S A;  1S4Z A;  5IT9 E;  1B2T A;  1QB5 D;  3OPO A;  1F2Y A;  1LTS D;  1JE4 A;  4P2C B;  1O7Z A;  2K5D A;  1ONL A;  2B2W A;  3BVM A;  1EY7 A;  1SYB A;  2D2C C;  2N88 A;  1I3Q B;  2RA4 A;  2JSO A;  5CV4 A;  2X6L A;  3H0G B;  5IGG A;  4JK1 C;  3P7J A;  1PRT F;  3X3M A;  5D3D A;  1EWH A;  4QMG A;  1JCK B;  3DWQ A;  2KJX A;  4KY7 A;  3SHL A;  2E75 C;  3DWA A;  1VF7 A;  1GUS A;  2ZXP A;  5A2Q E;  5CV6 A;  5KRU A;  3W2D A;  4B08 A;  3BZD B;  5JPM C;  1U9R A;  1VF5 C;  1PFM A;  1WCM B;  2EXZ A;  3VYU A;  3NK9 A;  1WVL A;  2JA7 B;  2KUM A;  4A3J B;  2QDB A;  1PRT C;  3S2H B;  3SXH A;  2Z4H A;  5KIX A;  4J6H A;  4K5X A;  3FEW X;  4DAV A;  4N9P A;  2F0T A;  2RBM A;  3GV3 A;  1TWA B;  5COY A;  4DU9 A;  1TS5 A;  3VR3 A;  1FNV A;  4RGN A;  1LT6 D;  5CYU A;  1HUM A;  3S1M B;  4BBS B;  1Q90 A;  3QJY A;  1BCP B;  2G9H D;  3HOX B;  2B2Y C;  2DNC A;  3KBX A;  4G4K A;  1FGB D;  2HDM A;  5C5M A;  2JEB I;  2QIL A;  4B9W A;  1F2M A;  1SE3 A;  2MGS A;  3K5L A;  4BY1 B;  2JA8 B;  4RCN A;  3HZX A;  2E76 C;  3HOV B;  2KA7 A;  5BN3 A;  3FDT A;  3Q24 A;  3JAM E;  1EZ6 A;  1KNA A;  2A6H C;  4XIG S;  3PO2 B;  2AQ2 B;  3U9S A;  1HUN A;  5C4H A;  1IKL A;  4C3I B;  4RHR A;  1CA5 A;  4A3F B;  1MD2 D;  1F2L A;  1U4R A;  5DNF A;  2HQE A;  5C44 B;  4CKB A;  2A68 C;  1A6X A;  5C4Z A;  3IKJ A;  4KTA A;  3KLS A;  5KNB A;  2EYJ A;  1BF4 A;  1G2T A;  3S1R B;  3D3R A;  2B2V C;  1A3V A;  4ULL A;  1DM0 B;  3T51 B;  3H91 A;  4DA2 A;  4FF4 A;  4LJZ C;  4FNF A;  3HOW B;  4M1U B;  3R8B A;  1STY A;  1LT5 D;  4RWS C;  3E6Z X;  1OXV A;  1U4L A;  3NBH A;  2FIN B;  2Z8L A;  2E2D C;  3T13 A;  4K5V A;  3LWE A;  2K01 A;  2ZXR A;  4F87 A;  1JOQ A;  3D4D A;  2L0C A;  1IHZ A;  4R8I A;  1XWE A;  4BS9 A;  5CBE E;  4RGO S;  1EY9 A;  2NN6 G;  1GUT A;  1O80 A;  5CV5 A;  3VA7 A;  3BG3 A;  4KKT A;  4IUR A;  1NR2 A;  4G7O C;  1B9N A;  4RKB A;  1RJT A;  3QWN A;  1B3A A;  1F9Q A;  4RAU C;  3K5O A;  1SNO A;  1TY2 A;  3PUW A;  4KY5 A;  3WOE A;  1M8A A;  1TWG B;  1D6E C;  4TKO B;  1ESR A;  4CKE A;  2N55 A;  1MBY A;  1G91 A;  1G8Z D;  3NWS A;  1AZP A;  2NN6 H;  4K6D A;  1QCB D;  3BVG A;  3SK5 A;  3AMU A;  5C0X G;  2PW7 A;  1KAB A;  4LAA A;  2F0U A;  1H9S B;  4IN3 A;  2F03 A;  3A7A B;  3L7Z C;  4ZKB B;  1XYI A;  4DAY A;  1OXT A;  2NUC A;  4KI0 A;  4DXG A;  3QOJ A;  1AP0 A;  4XQJ A;  1Y8O B;  5JVG 3;  2IW3 A;  2L11 A;  4EVO A;  1Y1V B;  3N6R A;  2OT2 A;  1IKM A;  5IOD A;  1J9O A;  1RHP A;  3Q22 A;  1O78 A;  3CRK C;  1HPC A;  3J81 E;  2K04 A;  1SE4 A;  2IJ0 A;  3TBI B;  5T1I A;  3CQZ B;  1A2U A;  3SVM A;  4WOR A;  2L9H A;  1AFP A;  2B8F A;  1BOS A;  5I9P A;  3KBG A;  4IUV A;  2KOL A;  5HGT A;  2L1B A;  5EQ0 A;  1W6J A;  4ILW A;  2D62 A;  2ENB A;  4L8J A;  5I2X A;  3NQI A;  4HTH A;  4DF7 A;  1DCZ A;  4NP5 A;  4RGT A;  1UNS A;  1GJX A;  1V1O A;  2NZ1 D;  2EYH A;  4JBW A;  3AB9 A;  3I4L A;  1V8Q A;  5ELD A;  4A3B B;  2CVR A;  1IL8 A;  3S14 B;  5EJW A;  3P20 A;  1JQY D;  3U9O A;  1JB3 A;  4E6I A;  4EQN A;  2DN8 A;  3S9W A;  4CJ0 B;  3MXU A;  1I4R A;  1T5E A;  1ENA A;  1S5C D;  2A74 C;  3AU7 A;  5G3L D;  3KUP A;  3I8Z A;  2RSN A;  3D6C A;  4ZAI A;  1PRT B;  2IX3 A;  3LWU A;  3G6J B;  2NVT B;  1KTK A;  4C1N K;  2XSC A;  3PUZ A;  3FRP B;  2K7V A;  5D3I B;  1EYA A;  5FLX E;  3OMC A;  2IPK D;  1JWS D;  5KYI A;  4HSP A;  1SFO B;  1SNP A;  2NBF A;  4DNT B;  1GUW A;  1U4M A;  3A7L A;  3LX0 A;  1EIH A;  5FO7 B;  2OF1 A;  1SBB B;  5M5W B;  2BCO A;  4Q5V A;  1CTM A;  4QB4 A;  1HTP A;  4X3T A;  5LHY 1;  1K83 B;  4PMB A;  3S17 B;  1H9K A;  1H9J A;  3RD4 A;  4F7X A;  4K2L A;  1QJO A;  2Z4I A;  3MTS A;  3R3O A;  1I6H B;  2RSO A;  4XYQ A;  3NXW A;  4NMZ A;  3LNN A;  2WB1 B;  2R93 B;  4KHV A;  1LAB A;  3TZD A;  3TP8 A;  1STB A;  5NUC A;  1ENC A;  2F0J A;  4N9T A;  1SYD A;  4UAI A;  3VYS A;  4G7H C;  4RA8 A;  2FHT A;  2XRQ D;  3HOZ B;  1PZJ D;  3A8I E;  4MIU A;  4F88 A;  3MWY W;  1XX8 A;  1S5B D;  3I70 A;  5JVH 3;  5D65 A;  4C3I G;  3DWP A;  2NB0 A;  1IW7 D;  4K6L A;  5C3E B;  4WRD A;  1I50 B;  3M7G A;  3TP6 A;  3OWF A;  2B2W C;  4RKL A;  5ELB A;  1FYC A;  1KNE A;  3BYY B;  3I4N B;  4FXD A;  5K36 H;  2EJF C;  5J39 A;  1KLU D;  2OXP A;  2PNR C;  1UAP A;  1SDF A;  3K6O A;  1EQT A;  1YNJ C;  4HN7 A;  4FVM A;  4ZLT F;  3HOU B;  1D5M C;  2F0S A;  1G2S A;  3K5M A;  3HS0 C;  5JOB A;  1PFB A;  1H9M A;  3J80 L;  2RDF A;  1CQV A;  1JR0 D;  4UDU C;  5F2D A;  1BQQ T;  2YU9 B;  1RCV D;  2XWJ B;  3DEP A;  3PMF A;  1VMC A;  2Y0S B;  4EGV A;  3VYR A;  1CZW A;  4IFD I;  1EY8 A;  1VMP A;  4PMW A;  3L9A X;  5ELC A;  2SEB D;  4I7Z C;  1WTR A;  4ZKC B;  1CFM A;  4KN4 C;  1ICW A;  4S3S A;  3OIP A;  1MSH A;  5KND A;  1A2T A;  1LTI D;  3NP8 A;  1EU4 A;  1I4Q A;  2AWN A;  3TDQ A;  2XRS D;  4KD3 A;  2NYZ D;  2EY6 A;  2O5I C;  3VA5 A;  4CHT B;  3D31 A;  4DGZ A;  1X3Q A;  2FMM A;  2J7Z A;  5EPL A;  1EEI D;  3H3V C;  4QIW B;  5C0X J;  3C3L A;  1OXX K;  1KLG D;  2J0T D;  2PZU A;  2BE5 D;  3PUV A;  1I4H A;  3Q0A A;  3I73 A;  2WV6 D;  4K2K A;  3CRL C;  2C9O A;  2NVQ B;  3KK7 A;  4EQP A;  1VDZ A;  2EY5 A;  2H4O A;  2RDH A;  2XNA C;  1ZKO A;  3DXJ C;  1PXU A;  2F0W A;  1HCZ A;  5IGF A;  3H6M A;  5EPJ A;  1LTR D;  1QWY A;  2NTT A;  3MVV A;  1CQF A;  3NUC A;  5E3F A;  2QEJ C;  1T5X D;  2JEA I;  3DHQ A;  2EPB A;  4QF4 A;  2A6E D;  1DJR D;  1PMR A;  2C5C A;  2KED A;  3A8K E;  2B2T C;  1STN A;  1AW7 A;  1NSN S;  1OXS C;  3RMH A;  4O42 A;  3GTP B;  1BBX C;  1F9R A;  4B9X A;  1SNQ A;  4DFA A;  4KD4 A;  1EWC A;  3DUZ A;  3MXP A;  2K33 A;  2XWB B;  1WTV A;  3F2U A;  1GOZ A;  4QCL A;  1S5E D;  1EZ8 A;  3OOC A;  4HMJ A;  2K5W A;  3GD7 A;  1SYE A;  1IW7 C;  3ERO A;  2K32 A;  4HMI A;  1M4V A;  1LT3 D;  1HHV A;  1G29 1;  2K28 A;  1SNC A;  2PMZ B;  3K5N A;  5IGE A;  2JP1 A;  1I4G A;  3HP3 A;  2ID0 A;  5C3W A;  3K7A B;  5C4X B;  2EYM A;  5IGC A;  1IYV A;  5CC4 A;  1SSO A;  1O7L A;  5BN4 A;  4PQX A;  2G9D A;  1E2V A;  4HCS A;  2VB2 X;  4QUF A;  5FKA C;  5I9O A;  1GXD C;  1W6K A;  1DON A;  2SOB A;  1KDA A;  2PCF B;  1CM9 A;  2BA1 A;  1LTB D;  3NSW A;  2XVS A;  2QKI C;  1CHP D;  4FF3 A;  5IT9 L;  5E4X A;  1QNU A;  2EYL A;  4H44 C;  1MGS A;  2FMC A;  4IAL A;  4CGY B;  4Z9C B;  1Y1W B;  5EBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...