1EEID

Cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (CHOLERA TOXIN B)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eeiD00
1PRTC 1V1PB 1KLGD 1I4XA 2TSSA 1KTKA 1PRTF 1PRTB 1TS4A 1LTBD 3BYTB 3TSSA 1EU3A 1DYQA 1MD2D 1RD9D 1TS2A 1T5XD 1LT4D 5TSSA 1BXTA 3DWQA 1HA5A 4DXGA 2RDGA 5ELFA 1V1PA 3BVZA 1CHPD 1PTOH 4ZYSA 1JWUD 1JCKB 2J4XA 3DWPA 2RDHA 1HXYD 1PTOD 1EEID 1L0YB 1XXGA 2IJ0A 4RGNA 5ELBA 2SEBD 5I4DA 1S5FD 1CQVA 1RDPD 1SEBD 1ET9A 4RFBA 1LTID 1JWMD 1KLUD 3DWAA 1PZID 1FNUA 2AQ3B 1UNSA 3EFXD 1I4QA 2XNAC 1D6EC 1M4VA 2XRQD 1LTSD 1LT6D 3R2IA 1ET6A 1SE3A 4RGTA 1BCPD 1I4RA 3BVGA 4L63B 1B1ZA 2IPKD 4C56C 3KLSX 2ICIA 1GOZA 2QILA 3OWEB 1HQRD 1EFID 1SJHD 1CT1D 3MC0B 1AW7A 4RCOA 1JWSD 3MFGA 2NTTA 5ELCA 1EU4A 1DJRD 1PTOC 1D5ZC 4RHRA 1PZKD 2Z8LA 1I4PA 1PRTD 1PTOF 1PTOB 1TS3A 1RF2D 2XRSD 4BWGB 1UUPA 1LT5D 5FKAC 1TY0A 1G8ZD 1SJED 5FK9C 1FD7D 3SEBA 1LTRD 2CHBD 2AQ1B 3EA6A 3R2TA 1S5ED 4RGOS 1B44D 1SE4A 5ELEA 1LTGD 1S5CD 1FGBD 1BCPF 1S5DD 1BCPB 1I4GA 2NTSA 1F77A 2R61A 3GP7A 2AQ2B 2XN9C 1FNWA 1RCVD 1S5BD 4O1NA 4RGMA 1CK1A 1D5XC 1EEFD 1HTLD 4RHSA 4TSSA 3URYA 1L0XB 4L6TB 1STEA 3R8BA 1PYWD 1SBBB 2G9HD 1FNVA 3BYYB 4OHJA 5D3DA 1XTCD 4UDUC 2WV6D 4Z9CB 4RH6A 1JQYD 1TY2A 3BVMA 5D3IB 1V1OA 1BCPC 1AN8A 1EWCA 3CHBD 4DXFA 1I4HA 1TS5A 1LT3D 1SXTA 3BZDB 4K6LA 3W2DA 1D5MC 3O13A 1ESFA 2O2LD 1LTTD 1LLRD 1CHQD 1SE2A 1LTAD 3V05A 1LO5D 1PZJD 5ELDA 2QEJC 1ENFA 1JR0D 1QILA
chains in the Genus database with same CATH superfamily
1IBLQ 3DLLA 4O42A 2GVAA 2R92B 2BE5D 2TSSA 4YHHL 2AUJD 2QDLA 4XQJA 2EVBA 1SROA 1EY4A 2MHVA 4ZRZA 5BR8Q 1TWCH 4R4IA 3I4OA 1C9OA 1SLJA 3BG3A 4PNYA 5JJKA 2NZ1D 4A75A 3S1NB 3GTQH 2EYHA 4QUCA 3LWUA 4C1NK 1HXYD 3H09A 1W3SA 1UEAB 2AMCB 4UP9A 4BY1H 4JI3Q 3TZUA 3NWTA 1U0LA 1HJPA 4DV2Q 3DWAA 1IL2A 2A8VA 2Z6KA 3HOUH 1CKNA 4ZKCB 3NELA 3L2PA 2Q2UA 5F2DA 3I4NB 4JYAQ 2H1EA 3IFTA 4HTHA 2B63G 1B1ZA 2UXDL 5LMNQ 2FXQA 3F1ZA 5CBAE 4HJ8A 3VYRA 5J1ZA 2KHJA 1JB7A 2RCNA 5IGEA 1SYGA 5FLMG 3PSIA 4OEMB 4L5RC 3M4PA 3CRLC 2Y0SG 5LL6S 1PRTD 1NY4A 3RUZA 2HT1A 1ML0D 3RLNA 1E0BA 2F3WA 2QW7A 1K8MA 3U9OA 3KLRA 1KDCA 5FK9C 2YU9B 2Q2IA 1EL0A 4BBRB 2F3IA 2F0LA 1ILQA 3H91A 1XPOA 3PF5A 4HMJA 3TZDA 5IYDG 3GTJB 3G71A 3D31A 3J81E 3CMAA 4R4QA 3R93A 5CMDA 2KA7A 3T4AC 3P75A 1IBKL 4LFAQ 4R8NA 3SK4A 3CCEA 2B2UC 1XNQQ 4LF7Q 4TSSA 4DV6L 3HOXB 2F0JA 4GOPA 3HOYG 1V9PA 1PYWD 1SBBB 4B3ML 3Q0AA 4JI1Q 2L5TA 5D3DA 4DA2A 2HDLA 1JJCB 1LTLA 1WD0A 2BA0A 3C1EA 1UE5A 3G6JB 4OWWB 3R3OA 2DJGC 4DNIA 3Q23A 2F0UA 4A3DH 1HNZQ 2VZAA 4IOCA 2JEBI 4UAIA 1CA6A 2UXBL 3GTLB 3HG9A 3M7GA 3K59A 4DFAA 3AFQA 4LF4Q 1RJTA 5CORA 4ID6A 1QVGA 2N78A 5CV9A 1SYEA 3G7LA 1WTWA 2NVTB 3PIO3 3PO2H 1IBML 5IGDA 1WVLA 3FDTA 1TU2B 2PYKA 3GTMB 4DAMA 3HOWB 3CW2C 3RN5A 3K5LA 3K5MA 4F7XA 1VCIA 5KRUA 4YWKA 1IXRA 1B3AA 1V1PA 3JAML 1PLFA 1NTGA 1EQRA 1N36L 1JWUD 1AEXA 2ZJQA 1AH9A 1HFGA 5C3EH 5DM63 4EVOA 5HGQA 2SEBD 3EROA 4CDDC 2IHFA 1VQ6A 2JE6I 3SDZA 4NB3A 3PIOA 1UNSA 3EFXD 2QKIC 4CBVA 2E5LL 5C4JB 3NBHA 4EGVA 4L63B 1ONLA 4K2LA 4LF5L 2RHQB 4IJLA 1SMXA 3JAMi 4HCSA 2R3ZA 3J7A5 2B8GA 3MZ5A 1PTOC 1V43A 5M3FG 1QNKA 1YHBA 1U5KA 1TWCB 2EY1A 1I4PA 1C4QA 5AJ3L 1UUPA 3GTQB 1TY0A 3QIAA 2WB1G 3HKZG 2GN5A 4K8JA 4LFBQ 1OXVA 4BY1B 3CCJA 1UE1A 4G4KA 4C1NI 2E2JB 1ZYRC 3K57A 1S5DD 2KENA 1HUNA 3HOUB 3H0GG 4KY7A 4MTNA 1VQ5A 1X3PA 3CP0A 5CV4A 4B3TQ 3SGIA 4HIMA 1XWEA 2CVRA 1CK1A 1D5XC 1EEFD 1VF5C 3UDXA 1N32L 2HUGA 5DM73 3BYYB 4HJ9A 4MNOA 1M1KC 1QZHA 3DM1A 4AYBG 1Y14B 2ZXOA 3TDQA 3TP8A 4IPCA 1WD1A 5LMUL 1OXUA 4KK7A 3T1YQ 2F0EA 5NUCA 1D5MC 2BDNA 1SMYC 1M8AA 2O2LD 2B63H 2YTYA 3AYHB 3TN2A 1LACA 2L55A 2WB1E 1S40A 2KECA 1IYVA 5C3WA 1VQHA 3G4SA 5FLMH 1KHIA 2VXWA 3D4DA 2Z0SA 3ND8A 3ER0A 4OWTB 3PO3G 1O7ZA 3TP7A 4K5WA 1K8AC 1JMCA 3DMUA 4DUZL 2PMZE 1HR0W 3MTSA 1N9WA 3ULPA 4XQNA 1SRUA 2E76C 3K5NA 1TWFH 2CH4A 3CMEA 3J81i 4Y52H 2IY5B 1MSHA 2CWAA 1EY5A 3BZKA 4JI6L 4JI2Q 1Z9FA 2F3VA 2R7FA 1WTQA 1PDQA 3S16H 1VQEA 1D6EC 4DR4Q 4X3KA 4X66Q 1E1TA 5KGUA 3PO2B 2QILA 4JI4L 2ZJRA 1T9HA 4ZUIA 2L0CA 2PW7A 3CPWA 2M9VA 2Q8TA 4XXEA 1HFNA 3EBEA 5IGGA 1VQLA 2CFMA 1KAAA 4QGUA 3OTOQ 4OGQC 1YNJC 4OO1H 1CKOA 3OHXC 5EKIA 5C3EB 1F9SA 5M5YH 3A8KE 2VUMG 2DNEA 1PFBA 2Q8IB 5FJ8G 2K33A 4N9TA 3NPPA 2WFWA 2K32A 3MEHA 4FF4A 1UE6A 5C0XG 2B2WA 3N52A 1F77A 1NAPA 4ZK9B 2UU9L 1HR0L 3SR1A 2F0TA 1WI5A 1MJEA 5M5WH 4RGMA 3UI2A 1JICA 2F1MA 2XTIA 2KCCA 1Y1VH 2PI2E 1LYLA 1SNDA 1HNXQ 3UE0A 4FVMA 3A7AB 1Q7YC 1SAPA 5ELOA 3DUZA 4QJFA 1AN8A 4IUQA 4IUPA 3CD6A 4HIDA 1SR3A 2F0FA 1YEZA 4DR2L 3U58A 3ONAB 4NW2A 2DY8A 1KIXA 1E7ZA 1VQNA 3E0JA 3WOEA 5IYBG 5JJIA 1K28A 4C3IH 4TKOB 3GTKH 1YNXA 4LMQD 1QCBD 3PMFA 1JORA 2L15A 5M3FH 1DGSA 2JA6G 1RD9D 1NSNS 1K9MC 3I3CA 1AP0A 4DV1L 1STAA 4XDXA 4IQZA 1Q90A 3PCOB 1N34L 2R7ZH 1PTOD 3H0GH 1A0IA 2IJ0A 4RKLA 4OONA 1ET9A 1LTID 4C3JG 1JB3A 2B2YA 2B63B 5ELNA 1GHKA 1Z47A 2KBNA 1SNQA 3IKJA 1STGA 1ICWA 1ET6A 2NWGA 1PH4A 2CQOA 1QWYA 3HZXA 3S15B 2IPKD 1FVIA 2ATWA 4OX9L 3OWEB 2K28A 2KVMA 2NN6I 3OWFA 2QA4A 5DAUA 3HOWG 1CT1D 2Z1CA 1L1OC 1TR5A 2Y0SB 3H6MA 3S1QH 3K0YA 1EU4A 1RTOA 5C4ZA 4OIKA 1D5ZC 1BVSA 2Q2TA 1PTOF 5C44H 1ENAA 1BQQT 1TS3A 5E4XA 2H5XA 4NXNL 1OO9B 3A56A 5FKAC 4LF9L 1TWFB 3PUWA 1GHJA 2KCTA 1MHWC 1X6OA 5JVH3 4K8IA 1A3UA 3LNNA 2O5IC 4JVZA 5IODA 3PO3H 2VL6A 2EJMA 3E5SA 3EQLC 5ISRA 3S16B 1TVXA 5J3BA 4R4OA 1K0RA 1X65A 5JEAG 2UUCL 2PCFB 2JN4A 3HP3A 3MXGA 4APVA 3AU7A 2CH4W 4EX5A 3HOYB 2XVSA 1S72A 2K6AA 2F0IA 4F87A 2M00A 1STEA 4J1MA 1G2SA 2NVQB 1NUCA 4DV4L 2NZHA 4OL7A 1VQAA 4EQ5A 5J22A 2VW9A 4LUVA 2JA7H 3CCRA 4S3SA 1JQYD 1J6QA 3EJIA 1A2TA 1B7YB 3D4WA 2K01A 5M5YB 2HCIA 3PUVA 2XWJB 4FF2A 4LUZA 4TRDA 2EXDA 4B9XA 4DV0L 2MJ8A 2OQ0A 1PRTC 1J9OA 5IWAQ 2PQAB 3SVMA 5GADC 1EU3A 5M5WB 3CCSA 2MO1A 2FHTA 3MAQA 4IALA 1PTOH 1VQCA 1BOSA 1FJGL 2UUBQ 4LF8L 3T1HL 4DR6Q 5FJ8H 3KJPA 1EY0A 2BCOA 2D9UA 2RDHA 1AFPA 1A62A 5C0XH 1B70B 1HCZA 1JWMD 4DR1L 1CKMA 4XYQA 1LM0A 3RN2A 1H95A 2N49A 1D2BA 2QCPX 3K5OA 2MQHA 3T51B 3GTKB 2IHEA 4EQPA 4O0AA 4RCOA 4JI8L 5M3FB 1JWSD 4HSVA 1DJRD 1KNAA 4RWSC 5I2XA 4BA1I 2WB1B 3HKZB 2A6ED 1F9QA 2SOBA 4QIWE 4I7AA 2IWHA 1IZ6A 4JI5L 1RIPA 3FPPA 4U673 4A3DG 2R7ZB 3H0GB 4IFDI 5C4HA 2PMZB 1FGBD 1EZ6A 1WTRA 1YZ6A 4DK0A 2JA6H 3V2TA 1KNEA 4C3HG 2AQ2B 2Q2HA 2Z4IA 5IYCG 2VY3A 2LXJA 4LWCA 1D1IA 3UDGA 2IX0A 1OTCA 1PH2A 4AYBB 2HHHL 2KHSA 3R8BA 4QUFA 3GDEA 2RCFA 3S1QB 1VQOA 1N33L 4R4TA 4WRDA 1Q8KA 3S24A 1OXSC 4DV6Q 1C8CA 1E2VA 1F2MA 2WP8J 4BS9A 1NNXA 2MPMA 1EYDA 4NP5A 2IW3A 1BF4A 3KF6B 1J5EL 1I6VC 2NYZD 2JP1A 3PO3B 4CJ1B 2L1BA 4NDXA 5EBDA 1I4XA 3J80L 1ENCA 4WJWA 3DEPA 3X3NA 3K0XA 2I5MX 2UXBQ 1DCZA 1TS2A 1SYDA 4CGYB 4I65A 3JAME 2D0PA 2RDGA 4K2KA 5ELFA 1IKLA 2LKVA 2YYZA 1XNRL 2D2CC 1IBMQ 1X56A 2JA7B 1JCKB 1HPCA 3FVQA 5DEHA 1W6KA 1K8OA 4HMIA 2PZWA 1RHPA 1F9PA 2F0GA 2WACA 4HAEA 3JAMc 3TREA 3J80i 5FLXL 1NR2A 2XSCA 1FL0A 1I94L 5JOBA 3BDCA 2EYLA 4ABNA 4GN3B 4P73A 4JV5L 1VQJA 2LMCB 1CZWA 3MEFA 4DV5Q 1PHJA 2E2IH 2JQOA 2E5LQ 2D0OA 1CSPA 2IX3A 4QQBX 1G51A 3E9IA 4I7ZC 3H3VH 2DY7A 1PTOB 2K5DA 3CU7A 4LF5Q 2VUMB 3M7NA 4P71A 3T16A 2TMPA 2EZVA 1TXYA 4E6IA 4A93H 2F52A 3VYTA 1O78A 1PH3A 5AJ3Q 3KK7A 2OCEA 4AIMA 5A2QL 4JCVE 2XN9C 4L5QA 3VDYA 3J81j 3S14H 1ILPA 4AQYQ 2R7DA 1Q82C 5EJWA 1SNPA 2K5NA 4HSPA 4RH6A 2OWOA 3PUXA 1E22A 3HS0C 3AB9A 1N32Q 1S4ZA 3QJYA 2XIWA 1TS5A 5I9PA 3GTGB 3TS2A 2JA8H 1VQBA 2OEOA 4L8JA 1U4MA 3F2DA 1DZ1A 1QILA 3C2PA 2EXZA 3I7FA 2JA6B 2YV5A 4KHPL 1SYBA 1PRTF 3J81c 2MO0A 2RHSB 2B2VC 4R4CA 5FO7B 3F2CA 2MP1A 4DV3L 3S1MH 2PQAA 2C9OA 1D1KA 1EIFA 2FINB 4OO1G 1HUMA 1QJOA 4C3JB 1TWGH 2SNSA 4DUZQ 1QVFA 3FPUB 3SE0A 4B08A 1RTNA 3PUZA 5GQOA 4C3HH 4RFBA 5IYCH 2BOSA 4GZYC 4ME3A 4DUYL 5FO8B 1I5FA 3BVGA 1LV9A 2SDFA 4JI6Q 4ALPA 1HQRD 3LX0A 5LMNW 3C3LA 1G291 1QE6A 1CI3M 2PO4A 1Y1VG 5E1FA 3P7JA 5C3XA 5K5PA 4ZUJA 5IOCA 5L37A 3W1GA 1BNZA 1HZ9A 1I50H 5KEEA 5KYLA 1RF2D 2F03A 2G5DA 1K83H 3A8IE 1H9SB 2JA5H 4K0KL 3HOVG 4B3SL 4JG2A 3SEBA 2IX1A 2CHBD 5M3MG 4GKKL 1D7QA 1SE8A 1QUQB 1NBWA 1Y8NB 3K7AH 3OOCA 1PH8A 1XMOQ 3HRZC 4B3RL 2C5CA 5EPLA 4HN7A 4C3IG 3L3OC 1FNWA 3RMHA 3C1FA 3I73A 2JJQA 2VQFL 2K04A 1A15A 4LFCL 1PA6A 3HFZB 4KMUC 1IYUA 1EY6A 2I0QA 3OW7A 3M4OH 1VS0A 2E2IB 3HGBA 1C7YA 2UU9Q 3WWVA 4OELB 1KQSA 1V1OA 2EYJA 4DV2L 2RDFA 4KY6A 2B2UA 2L9HA 1A3VA 5EKKA 2R7ZG 1KL9A 1QOHA 4PG3A 4GNXC 2FMCA 4JYAL 2HQLA 1LTTD 2F4VL 1STNA 1A2UA 1HZCA 1U4RA 4JBMA 5IGFA 3D4RA 1K73C 5LMNL 3GQBA 1EIGA 4HIKA 4A3KH 4QIWB 3M9BA 1EWIA 3BYTB 4DR2Q 1HQMC 4NKLA 1H9RA 3KF6A 4RG1A 3QG1A 4PZ7A 3I91A 4YY3L 1Q86C 1EY8A 3N6RA 3BVZA 4YWMA 2LSSA 2EYFA 1BKBA 1EIHA 1L2FA 1Q12A 3NP8A 5C44G 4IURA 1B3QA 4A76A 2I5HA 1UAPA 3TBIB 1SEBD 2XGTA 1PZID 4LF6Q 2AQ3B 4DV1Q 2JA8B 4H44C 4KY5A 2WKDA 3MXNB 1PV4A 4XIGS 2XNAC 4LFAL 1UE7A 4GLAC 1N34Q 3G6EA 5CV8A 1BCPD 1X3EA 4JI1L 2PI2A 4G7HC 1PH7A 1JE4A 3NXWA 1PFSA 2AWOA 3PUYA 2ZT9C 5IGBA 1L1OB 1VQGA 4WJ3M 4RHRA 1G91A 1AE3A 2F0QA 1HNZL 1EY9A 2JA7G 4A3DB 3GTOH 3S1MB 4BBSG 1WTPA 1G6PA 1SJED 2D62A 5C5MA 1S5ED 2EDGA 4X3SA 2OTLA 1IW7C 2ZTEA 4C3HB 4UPAA 1BCPF 2RKSA 1HZBA 1O7LA 4NXNQ 1CM9A 4LF9Q 4KTAA 1PYSB 4KN7C 3T56B 4MZ9A 2A1AA 2JA9A 3S17H 4DNTB 1EIYB 2X69A 2NZOA 2L4NA 3MVVA 4KKUA 2F0KA 4QF4A 4LK1C 3SK5A 2MNAA 4HEDA 3C46A 3FHWA 4J8QA 1SFOH 2BDOA 1MIUA 4BXXH 3RLFA 4KHZA 3WDNA 2A68C 1XMQL 1ASYA 1FYCA 5D3IB 2NN6G 1I50B 3CHBD 1B53A 2IT1A 3VA5A 1PMRA 1K83B 2HIVA 2KUMA 4DV4Q 1B50A 2L11A 3HKSA 1S3OA 1E2WA 1WJJA 2A69D 4FXKC 3CQZH 3NTIA 2UUAL 4JBJA 1DOKA 1FGUA 2A6EC 2F4IA 1KDAA 5JEAJ 5IP9H 3M4QA 1KTKA 1RKNA 1PRTB 2UXCQ 3H3VC 1DYQA 1BO0A 5TSSA 1Y1WG 4YCWA 3CXCA 4NXML 3HOVH 1X32A 2HDMA 4CKEA 4N9PA 2OF1A 4DR3Q 2K5VA 5M3MH 4QL5A 1PYBA 2E2HH 3M4OB 1PXUA 3DWPA 1YHAA 4A4IA 2R93G 3Q22A 3D8GA 4PQXA 4GLXA 1FJGQ 4B3TL 1GUOA 4LF8Q 1AE2A 1JJ2A 4X65L 1BDOA 1DM0B 2VNUD 1SSOA 5IGCA 4IOAA 4FXGC 2ICIA 1GOZA 1PH9A 3LWEA 4A3KB 1A6XA 1SYFA 4DR1Q 3FRPB 2VB3X 2K75A 2MUYA 4KI0A 3K6OA 1U4PA 1X3FA 2A6HC 3T1YL 2A5HA 1WYDA 1YJ9A 4A3GH 1G8ZD 1FD7D 1T5EA 4FYDA 3HOZH 2K52A 5IP7G 1SE4A 5M5XH 3BS1A 2K7VA 1WTHA 4DK6C 4OIJA 2KCMA 1I4GA 3Q8DA 1H9SA 2R61A 2P5ZX 3J7AV 5I2YA 4TVAB 2N88A 2PQEA 4DPGA 1KABA 2EY5A 1MSGA 1QUQA 4MHEA 1A8VA 1EYCA 4RAUC 1FNVA 3RZDH 2ZTCA 1KXLA 4KD4A 4DV7L 1TY2A 1A63A 5HURA 3L9AX 4KD3A 3GTOB 5GAGC 3P20A 3AMUA 4LUOA 3KYHC 1LUZA 2HIXA 4GS3A 4XQQA 4DR5Q 4JI0L 1LTAD 2OQKA 4KV6A 1E3PA 2ZXRA 5ELDA 1GUSA 2JXMB 3J80E 4ZKBB 3S2DH 5AFWA 1RL2A 4FP5D 2PNRC 2WIIB 1TS4A 1GUGA 1LTBD 4IFDG 2LXKA 2I5LX 5KNDA 2K05A 4NMZA 3OTOL 4BBSH 2QF7A 4J15A 1Q81C 5K36G 2XWBB 3KDFB 1YVCA 4H13C 1VMCA 4A3IH 2KEEA 4ZYSA 4EQNA 4LAAA 3J80c 1I3QH 4ZLTF 1SFOB 3T13A 2J4XA 5C5LA 1O7IA 1TWAH 4CKBA 1HNWL 4GKJL 3VYSA 3E0EA 4JOIC 2ALYB 4POGA 1AZPA 5FLXE 3ZYYX 1XNRQ 4A93G 4DKAC 3OW2A 1P8LA 5E3FA 3CQZB 3R2IA 3T53B 4A3BH 4M1UB 1TWHH 3AEVA 3KLSX 1IW7D 1Y1VB 2B2TC 2EIFA 4Y7NH 2R92H 1B8AA 1GKHA 3MC0B 4KHVA 1U4LA 4FNFA 5FLXc 3MXNA 2NN6H 1GO3E 2FFKB 4YHHQ 3KUPA 2KCNA 1VQ7A 2EYOA 3HOVB 2Z8LA 4HIOA 3NUCA 3K58A 4IJHA 2XRSD 5M3MB 1LT5D 4JV5Q 1Q8IA 2C35B 1PFMA 4OXPA 2OT2A 2A68D 1L1OA 2ID0A 4RGOS 4A3FH 5ELEA 4IUVA 2JA8G 1S5CD 4TQUS 4C3IB 1U9RA 1PH6A 1C0AA 2RVLA 1R9TH 1BCPB 5A2QE 1Y1WH 2ICEC 1N8RC 3ERQA 3NQIA 4MN3A 3I4NH 3CCMA 4BA2I 3MA2B 1HTLD 1CZGA 1ICFB 1MI2A 1L0XB 4L6TB 1Q46A 2BA1A 2UXDQ 3ERSX 2R93H 3D0FA 1XTCD 3FKIG 2AWNA 1I6HH 1WCMG 1KD1C 4X3TA 1EWCA 1X3GA 4UP7A 1SXTA 4K6LA 3O13A 3E6ZX 4LW1A 4RCNA 2YU9H 3HOZB 5CR3A 3NQTA 3NENA 3B6YA 3RD4A 3GTJH 4RA8A 1CSQA 2R6GA 1MD2D 3CAMA 2O5JC 3D6CA 1LT4D 5IIFA 2WAQG 2Z6KC 1IBKQ 1OXTA 2ZM6L 4DXGA 1FR3A 5C44B 3KF8B 3I56A 5IP7H 3RZDB 5JPMC 4B3MQ 2NVXH 1V1QA 2PPBC 1EFWA 4ULLA 2KOLA 5EBCA 5JVG3 2JA5G 4HJ5A 2A6HD 3ZJYC 4DV3Q 1Q1EA 3TRZA 3VYUA 4F88A 3GTLH 2V1CC 1GUNA 1STHA 3MWYW 3GO5A 1CFMA 4OWXB 1I4RA 3F8TA 2NVTH 3S2DB 4YIJA 4P74A 3MXPA 3K80C 1Q1BA 3IL8A 3GTMH 3U50C 4BBSB 3I72A 4K6DA 2JSOA 1B9NA 1NMGA 1EYAA 3IRBA 4A3IB 2WAQE 3W1BA 1Y69U 1I3QB 3IAYA 4JI7L 4IO9A 1N36Q 4GOPC 3E9HA 1GUWA 3A8JE 4C2MH 2E74C 3S2HH 1VQDA 4X62L 3NBIA 1ESRA 4IFDH 2CWPA 2EYPA 2F0WA 3K7UC 3NHHA 3GP7A 5K36H 4B3SQ 3FMCA 4A3LH 3L0OA 4K14A 3A5ZB 1TT2A 4A3KG 4GKKQ 3PGZA 1TWHB 1WTOA 4FF3A 4Y7NB 5J39A 2UUBL 4DR6L 1K0SA 1Y8OB 2EY2A 3I8ZA 4B3RQ 4UDUC 1PH1A 2RSNA 3A74A 1EOTA 4Z9CB 3ULLA 3TP5A 3S9WA 3TQYA 1JE5A 1BR9A 2VQEL 1BCPC 3WOFA 2VQFQ 3Q24A 1YNND 4BY7G 1JOQA 3I4MG 1I4HA 4CDCC 4LFCQ 1LT3D 3BZDB 2F0NA 1YI2A 4P72A 3IFDA 3X3MA 2H4OA 1M90C 2QEXA 4G7OC 4KN4C 2EYMA 4GNXB 3V05A 4A3FB 3ULJA 3S1RH 1F9RA 2E2JH 1JR0D 5BN3A 1R9TB 3F2UA 1Y1WB 3CKIB 3TMEA 4CDEC 4DNRB 4WFN3 4UP8A 2LFNA 2F4VQ 2FJ2A 1BBWA 3D6WA 3VR5A 4YCVA 1WOCA 4CKCA 3A5UA 4QY7A 2Z4HA 2R93B 2EPBA 3D3RA 3HEJA 5IT9L 1I6HB 2F0OA 4WORA 5I6WA 1E2ZA 3OPOA 4X6AH 2L12A 4RGNA 1XPRA 1PVOA 3KDFA 4YY3Q 1VQMA 1CQVA 1RDPD 4A3EG 4IPHA 4X64L 1DONA 2X6LA 5LMUQ 4A3JH 5EGTA 2ZTDA 4KLKA 5C4XH 3KLWA 1Z6HA 2LS01 1STYA 3FKIH 4PZ8A 1TKWB 1WCMH 1SJHD 4DAPA 5BN4A 2ZJPA 3OIQA 4H02A 3STBC 2CKZB 2A69C 1AZQA 3UDIA 3LGJA 4CJ0B 4IZ8A 5GROA 1K3BC 4BXXG 5E4WC 2NVXB 2CW0D 3H94A 4DAYB 3VR2A 1CA5A 5FO9B 3EA6A 1VMPA 3KLSA 2PZUA 3DM3A 2Y0SE 4RMFA 1H9KA 1Z7TA 3TP6A 1S5BD 5G3LD 4O1NA 5IP9G 1EQQA 3VR6A 1HRJA 4IUTA 4DR7L 3URYA 5JJLA 4H7BA 4JI4Q 3QWNA 1B9MA 4ZQ3A 4N8FA 1P16A 4DN4M 1DOLA 1VQFA 1IBLL 3CF5A 1X3QA 2B3GA 4G57A 3PV0A 3UDFA 4JBKA 4C2MB 3S2HB 2KEDA 1XMQQ 1G6ZA 5BR8L 2GVBA 1ENFA 1JOKA 5G3LF 1MGSA 1SNOA 2K03A 3PQIA 4UHVA 2VS1A 5D65A 4QMGA 5CV5A 4DV5L 5CV7A 1TQOA 1YIJA 1VF7A 4JI3L 5I9OA 1PH5A 3GV3A 1BXTA 1HR0Q 5FOBB 1QVCA 1SNCA 2UUAQ 2GA4B 4M8AA 1F2LA 4JPBW 1BBXC 1K3RA 2IL8A 3BZCA 3L7ZC 4GN4B 3VR4A 3G48A 2NB0A 3CCLA 2JEAI 4A93B 2E75C 1L0YB 1XXGA 4KJNA 4A3GG 4NXMQ 1S5FD 3RZOH 3HOZG 2RA4A 2B2VA 3KF8A 5C0XJ 2F0DA 1FNUA 3OMCA 1Y8PB 3KBGA 3A54A 1M4VA 3BDLA 1DXMA 2ES2A 2EQSA 3S1RB 5CV6A 3TS0A 5DNFA 3SK8A 3TEHB 1D8LA 4YWLA 4AQYL 3S14B 1CUKA 1RODA 1HA6A 1KAWA 3KOJA 3A7LA 3M3YH 3J7AF 4BY7H 2RQXA 1UEBA 2NTTA 5ELCA 3FEWX 3VR3A 5JJZA 4X65Q 1YJNA 3I4MH 4OO1I 2DGYA 2B2WC 1XJVA 1KRTA 1O80A 4RKBA 1OXXK 1O7YA 3NE5B 1PFNA 2NVYH 2Z9HA 2NUCA 1E24A 4X3UA 1XNQL 2AQ1B 4DU9A 4LF7L 2QDBA 2OXPA 5COYA 5KNBA 4DAVA 3JC66 3J81L 4A3JB 3NWSA 2RF4A 5C4XB 4PMCA 4P75A 2JYOA 2EOTA 4HJ7A 3HKZE 3S15H 3FKIB 3K81C 1WCMB 1J8IA 2MFIA 5T1IA 4LNQA 1C48A 4OX9Q 3GTPH 1HZAA 2N55A 3OSOA 4MTKA 1SN8A 3RNUA 3NK9A 5HY6A 2CCZA 4LF4L 1GUTA 4A3EH 4L5SA 4A3IG 1TWGB 1EZ8A 3BVMA 1YJWA 4KKSA 4DGZA 1MKHA 1EWHA 4A3CG 4GN5A 4XYOA 1HHVA 1GD7A 5I6YA 1X9NA 5IYDH 4FO2A 3SK6A 1QNUA 4WJ4A 4DV7Q 3CC2A 1LO5D 1PZJD 1E1OA 4AYBE 3I4LA 2DUDA 1KLGD 3EIVA 5CBEE 2WAQB 3M4YA 4A3BG 2I46A 1STBA 1IHZA 2PZTA 4O2DA 4A3MG 3ICEA 2UUCQ 3HOYH 2EJGC 1YHQA 4JI0Q 2R92G 4GNXA 2B2YC 3DWQA 1HA5A 4DK1A 2NVQH 5T1GA 1CHPD 1BUVT 1EUJA 3CC7A 2JA5B 4PMBA 4CDFC 3STBD 5H1SE 4Q5VA 5EQ0A 2AHOB 5ELBA 3UE1A 3K7AB 1KLUD 3GD7A 1XMOL 3U4VA 2AUKA 4A3FG 2A74C 3AFPA 2MGSA 4Q0FA 4K5VA 1II3A 4ILWA 5JAVA 3DHQA 5GAEC 1HNWQ 4GKJQ 2B39A 4C56C 2DN8A 4DV0Q 3I4NG 4IFDJ 1AW7A 5LL6X 3MFYA 2K4KA 3MFGA 4LFBL 1MBYA 3RLOA 1X55A 2I07B 4L5TA 1VQIA 2KJXA 2B8FA 3I90A 4H0LC 3PF4A 5M9OA 3OMGA 2WINB 4BWGB 5LHY1 2BH2A 3T1HQ 1CTMA 1KRSA 1B44D 3RZOB 4ODGA 2HD3A 5EKLA 1NCVA 4ME5A 4BBRG 2N8NA 4JBWA 2CQAA 1WTVA 4DAYA 4XT3B 1IL8A 2X6GA 4XT1B 4HCEA 4J6HA 3NTKA 3FP9A 2ENBA 3M3YB 1NJIC 5KNCA 4BY7B 1XYIA 4IPGA 1W2BA 1W6JA 4JI8Q 3HOXG 1H9MA 3Q6SA 3I4MB 4JW0A 3P1HA 3CCUA 3CCVA 4F8MA 3F2BA 5EAYA 1XPUA 3ITPA 4LF6L 1ZXTA 3W2DA 2NVYB 1IYJB 1ESFA 4ZCKA 2K5WA 4IUNA 3MHBA 3PIP3 4JI5Q 1SE2A 2EY6A 2K5QA 3BU2A 4K5XA 1SDFA 2OTJA 1HH2P 1B4OA 2DJFC 3J7ZC 4FDBA 1GVPA 1XTDA 2F0SA 2ZXPA 1X54A 1MJCA 1HTPA 2EJFC 4R8IA 1T5XD 5KYIA 4KJOA 1ZYRD 4JI2L 3CPFA 2O4XA 3DXJC 3NEMA 2BH8A 3KJOA 2Q8RE 4EQOA 1VQ9A 3ND9A 3AQQA 3GTPB 1CKNB 2HHHQ 3E3XA 1QB5D 4DR4L 1R4PB 2M2LA 3I2ZA 5C0XI 5JPNC 4A3EB 3SXHA 4X66L 1VQ4A 1SYCA 1N33Q 3PIPA 2ZM6Q 3U9SA 3A0JA 2BE5C 3J7YW 4IUUA 1JC7A 1Q3LA 1DOMA 1EY7A 1UWVA 2XRQD 4MIUA 1LTSD 5HGTA 1SE3A 3S17B 4YCUA 2EE1A 1NR4A 1J5EQ 1EQTA 1YNNC 5A35A 3KBXA 4A3LG 1EFID 2LY7A 1SMYD 2KQ3A 3BDOA 2YTVA 2ASBA 4JC0A 1ASZA 3I55A 4A3CH 1EQVA 3OYYA 2F0HA 4DF7A 1ZEQX 2RSOA 3OIPA 4V0BA 3W5OA 1A3TA 3A55A 1JT8A 2V4DA 1VDZA 2D5DA 1JOOA 4LJZC 4GOPB 4A3MH 2PNHA 1JJGA 4R1JA 4BY1G 3K8AA 1NMFA 5D14A 2UXCL 1HNXL 2NTSA 5E7NA 2AKWB 2K1BA 4JI7Q 4ZAIA 3HOUG 3EVQA 1I94Q 1QZGA 1GM5A 4DR3L 4X62Q 4HJAA 4PZ6A 1KC8C 2E2HB 4U68A 1GXDC 3S1NH 2DNCA 2B29A 1R4QB 4P2CB 4G7ZC 3QOLA 3KFUA 4B9WA 4QB4A 4UY8C 2VUMH 1LABA 2SNMA 1GJXA 4R9WA 1LLRD 3QB3A 1YBYA 1CHQD 4POFA 3BJUA 2E2DC 1F2ZA 2VQEQ 4A3JG 1YNJD 5CC4A 1V1PB 3EN2A 4QCLA 5C4XG 5CGKA 2JK8A 3SHLA 2RBMA 4PV1C 3TSSA 2VB2X 3CRKC 3CC4A 2CW0C 2K5HA 5EPKA 5BN5A 2KHIA 1NE3A 1XX8A 1KDBA 1TIID 5KIXA 5IT9E 1CQFA 1G2TA 3W3AA 4DK3C 4GLVB 3RR5A 4A3GB 1IKMA 2A73B 4BBRH 3NBHB 1EEID 4PMWA 5M5XB 5I4DA 2A19A 2NBFA 5IYBH 3GTGH 2K50A 5IT9c 1K8GA 1I4QA 1F2YA 1SNMA 1VQPA 1LT6D 4RGTA 3CCQA 4IPDA 2HQEA 1B2TA 3HOXH 2HCCA 5IY0A 3U4ZA 3V96A 4X64Q 1VQKA 1WFQA 2YTXA 4JOIA 4FXDA 1YITA 4KHPQ 4IN3A 3PO2G 3H3VI 1BBUA 2F0PA 1WTXA 4KKTA 1PZKD 3I70A 3M85A 2QGQA 5EPJA 3VA7A 3NSWA 4CJ2C 2F0MA 1H9JA 2F0VA 3QO2A 4DR5L 2E8GA 2B2TA 3DEOA 4XTCS 1LTRD 2G9DA 4C3JH 3NTHA 3R2TA 1L0WA 1EOVA 5C3EG 1LTGD 1EYGA 2Z6BA 2PW5A 4HR7B 5CYUA 5GAHC 1ZKOA 3QR8A 1QG7A 4DUYQ 1RCVD 4FF1A 3HOWH 2WKCA 2J7ZA 2K14A 4RHSA 3H15A 3QOJA 1DD2A 2G9HD 4NPSA 4V190 4OHJA 2N3SA 2WV6D 4CHTB 1TWAB 2FMMA 3MXUA 5C6AA 4DR7Q 4DXFA 5IWAL 4N8X1 5IE8A 1V8QA 2J0TD 4K0KQ 4JK1C 1VQ8A 5C4JH 4AH6A 4A3BB 5DLQE 5JEAH 2QEJC 3GV6A 4A3MB
chains in the Genus database with same CATH topology
4O42A 2R92B 2BE5D 2TSSA 2AUJD 4XQJA 2EVBA 1EY4A 2MHVA 4ZRZA 3BG3A 4PNYA 2NZ1D 3S1NB 2EYHA 4QUCA 3LWUA 4C1NK 1HXYD 3H09A 1UEAB 3TZUA 3NWTA 3DWAA 4ZKCB 5F2DA 3I4NB 2H1EA 3IFTA 4HTHA 1B1ZA 5CBAE 3VYRA 5J1ZA 5IGEA 1SYGA 3CRLC 5LL6S 1PRTD 3RUZA 1ML0D 1E0BA 2F3WA 3U9OA 1K8MA 3KLRA 1KDCA 5FK9C 2YU9B 1EL0A 4BBRB 2F0LA 1ILQA 3H91A 4HMJA 3TZDA 3GTJB 3D31A 3J81E 3R93A 5CMDA 2KA7A 3T4AC 3P75A 3SK4A 4R8NA 2B2UC 4TSSA 3HOXB 2F0JA 1PYWD 1SBBB 3Q0AA 2L5TA 5D3DA 4DA2A 2HDLA 1WD0A 2BA0A 3C1EA 3G6JB 3R3OA 3Q23A 2F0UA 2JEBI 4UAIA 1CA6A 3GTLB 3HG9A 3M7GA 3K59A 4DFAA 1RJTA 5CORA 4ID6A 5CV9A 1SYEA 3G7LA 1WTWA 2NVTB 3PIO3 5IGDA 1WVLA 3FDTA 1TU2B 2PYKA 3GTMB 3HOWB 3K5LA 3K5MA 4F7XA 1VCIA 5KRUA 1B3AA 1V1PA 3JAML 1PLFA 1JWUD 1AEXA 1HFGA 5DM63 4EVOA 2SEBD 3EROA 2JE6I 3SDZA 1UNSA 3EFXD 2QKIC 4CBVA 5C4JB 3NBHA 4EGVA 4L63B 1ONLA 4K2LA 4HCSA 2R3ZA 2B8GA 3MZ5A 1PTOC 1V43A 1QNKA 1TWCB 2EY1A 1I4PA 1C4QA 1UUPA 3GTQB 1TY0A 3QIAA 4K8JA 1OXVA 4BY1B 4C1NI 4G4KA 2E2JB 1ZYRC 3K57A 1S5DD 1HUNA 3HOUB 4KY7A 1X3PA 5CV4A 1XWEA 2CVRA 1CK1A 1D5XC 1EEFD 1VF5C 2HUGA 5DM73 3BYYB 3DM1A 2ZXOA 3TDQA 3TP8A 1WD1A 1OXUA 4KK7A 2F0EA 5NUCA 1D5MC 2BDNA 1SMYC 1M8AA 2O2LD 3TN2A 1LACA 2L55A 2KECA 1IYVA 5C3WA 2VXWA 3D4DA 3ND8A 1O7ZA 3TP7A 4K5WA 3DMUA 3MTSA 4XQNA 2E76C 3K5NA 1MSHA 1EY5A 2F3VA 1WTQA 1PDQA 1D6EC 4X3KA 5KGUA 3PO2B 2QILA 4ZUIA 2L0CA 2PW7A 2M9VA 2Q8TA 4XXEA 1HFNA 5IGGA 1KAAA 4OGQC 1YNJC 4OO1H 3OHXC 5EKIA 5C3EB 1F9SA 3A8KE 2DNEA 1PFBA 2Q8IB 2K33A 4N9TA 3NPPA 2K32A 3MEHA 4FF4A 5C0XG 2B2WA 3N52A 1F77A 1NAPA 4ZK9B 3SR1A 2F0TA 4RGMA 3UI2A 1JICA 2F1MA 2KCCA 1SNDA 4FVMA 3A7AB 1SAPA 3DUZA 1AN8A 4IUQA 4IUPA 2F0FA 3ONAB 4NW2A 2DY8A 3E0JA 3WOEA 4TKOB 4LMQD 1QCBD 3PMFA 1JORA 1RD9D 1NSNS 3I3CA 1AP0A 1STAA 4XDXA 4IQZA 1Q90A 1PTOD 2IJ0A 4RKLA 1ET9A 1LTID 4C3JG 1JB3A 2B2YA 2B63B 1GHKA 1Z47A 1SNQA 3IKJA 1STGA 1ICWA 1ET6A 2NWGA 1QWYA 3HZXA 3S15B 2IPKD 3OWEB 2K28A 2KVMA 2NN6I 3OWFA 5DAUA 1CT1D 2Z1CA 1TR5A 2Y0SB 3H6MA 3K0YA 1EU4A 1RTOA 5C4ZA 4OIKA 1D5ZC 1PTOF 1ENAA 1BQQT 1TS3A 5E4XA 1OO9B 3A56A 5FKAC 1TWFB 3PUWA 1GHJA 5JVH3 4K8IA 1A3UA 3LNNA 2O5IC 5IODA 2EJMA 3E5SA 3EQLC 5ISRA 3S16B 1TVXA 5JEAG 2PCFB 3MXGA 3HP3A 3AU7A 3HOYB 2XVSA 2K6AA 2F0IA 4F87A 2M00A 1STEA 4J1MA 1G2SA 2NVQB 1NUCA 4OL7A 5J22A 4S3SA 1JQYD 3EJIA 1A2TA 3D4WA 2K01A 5M5YB 2HCIA 3PUVA 2XWJB 4FF2A 4TRDA 4B9XA 2MJ8A 1PRTC 1J9OA 3SVMA 1EU3A 5M5WB 2FHTA 3MAQA 4IALA 1PTOH 1BOSA 1EY0A 2BCOA 2D9UA 2RDHA 1AFPA 5C0XH 1HCZA 1JWMD 4XYQA 1D2BA 2QCPX 3K5OA 3T51B 3GTKB 4EQPA 4RCOA 5M3FB 1JWSD 4HSVA 1DJRD 1KNAA 4RWSC 5I2XA 4BA1I 2WB1B 3HKZB 2A6ED 1F9QA 2SOBA 2IWHA 3FPPA 4U673 2R7ZB 3H0GB 4IFDI 5C4HA 2PMZB 1FGBD 1EZ6A 1WTRA 4DK0A 3V2TA 1KNEA 4C3HG 2AQ2B 2Z4IA 1D1IA 2IX0A 4AYBB 2KHSA 3R8BA 4QUFA 3S1QB 4WRDA 1OXSC 1C8CA 1E2VA 1F2MA 2WP8J 4BS9A 2MPMA 1EYDA 4NP5A 2IW3A 1BF4A 1I6VC 2NYZD 2JP1A 3PO3B 4CJ1B 2L1BA 4NDXA 5EBDA 1I4XA 3J80L 1ENCA 4WJWA 3DEPA 3X3NA 1DCZA 1TS2A 1SYDA 4CGYB 4I65A 3JAME 2RDGA 4K2KA 5ELFA 1IKLA 2LKVA 2YYZA 2D2CC 2JA7B 1JCKB 1HPCA 3FVQA 5DEHA 1W6KA 1K8OA 4HMIA 2PZWA 1RHPA 1F9PA 2F0GA 2WACA 4HAEA 5FLXL 1NR2A 2XSCA 5JOBA 3BDCA 2EYLA 4ABNA 2LMCB 1CZWA 2IX3A 4I7ZC 2DY7A 1PTOB 2K5DA 3CU7A 2VUMB 3M7NA 3T16A 2TMPA 2EZVA 4E6IA 3VYTA 1O78A 3KK7A 5A2QL 2XN9C 1ILPA 5EJWA 1SNPA 4HSPA 4RH6A 3PUXA 3HS0C 3AB9A 1S4ZA 3QJYA 2XIWA 1TS5A 5I9PA 3GTGB 2OEOA 4L8JA 1U4MA 1DZ1A 1QILA 3C2PA 2EXZA 2JA6B 1SYBA 1PRTF 2B2VC 5FO7B 2MP1A 2C9OA 1D1KA 2FINB 4OO1G 1HUMA 1QJOA 4C3JB 2SNSA 3FPUB 3SE0A 4B08A 1RTNA 3PUZA 4RFBA 2BOSA 4GZYC 5FO8B 3BVGA 1LV9A 2SDFA 1HQRD 3LX0A 3C3LA 1G291 1QE6A 1CI3M 2PO4A 5E1FA 3P7JA 5C3XA 5K5PA 4ZUJA 5IOCA 1BNZA 5KEEA 5KYLA 1RF2D 2F03A 3A8IE 1H9SB 3SEBA 2IX1A 2CHBD 1Y8NB 3OOCA 3HRZC 2C5CA 5EPLA 4HN7A 4C3IG 3L3OC 1FNWA 3RMHA 3C1FA 3I73A 2K04A 1A15A 4KMUC 1IYUA 1EY6A 3OW7A 2E2IB 3HGBA 1V1OA 2EYJA 2RDFA 4KY6A 2B2UA 2L9HA 1A3VA 5EKKA 1QOHA 2FMCA 1LTTD 1STNA 1A2UA 1U4RA 5IGFA 3D4RA 3GQBA 1EIGA 4QIWB 3BYTB 1HQMC 4NKLA 1H9RA 3QG1A 3I91A 1EY8A 3N6RA 3BVZA 2EYFA 1EIHA 1Q12A 3NP8A 4IURA 1UAPA 3TBIB 1SEBD 1PZID 2AQ3B 2JA8B 4H44C 4KY5A 2WKDA 4XIGS 2XNAC 5CV8A 1BCPD 4G7HC 1JE4A 3NXWA 2AWOA 3PUYA 2ZT9C 5IGBA 4RHRA 1G91A 2F0QA 1EY9A 4A3DB 3S1MB 1WTPA 1SJED 2D62A 5C5MA 1S5ED 2EDGA 4X3SA 1IW7C 4C3HB 1BCPF 2RKSA 1O7LA 1CM9A 4KTAA 4KN7C 3T56B 4DNTB 2X69A 2L4NA 3MVVA 4KKUA 2F0KA 4QF4A 4LK1C 3SK5A 4HEDA 3C46A 4J8QA 2BDOA 3RLFA 4KHZA 3WDNA 2A68C 1FYCA 5D3IB 2NN6G 1I50B 3CHBD 1B53A 2IT1A 3VA5A 1PMRA 1K83B 2KUMA 1B50A 2L11A 1E2WA 4FXKC 2A69D 3NTIA 1DOKA 2A6EC 2F4IA 1KDAA 5JEAJ 1KTKA 1RKNA 1PRTB 3H3VC 1DYQA 1BO0A 5TSSA 1X32A 2HDMA 4CKEA 4N9PA 2OF1A 3M4OB 1PXUA 3DWPA 3Q22A 3D8GA 4PQXA 1GUOA 1BDOA 1DM0B 2VNUD 1SSOA 5IGCA 4FXGC 2ICIA 1GOZA 3LWEA 4A3KB 1A6XA 1SYFA 3FRPB 2VB3X 2MUYA 4KI0A 3K6OA 1U4PA 2A6HC 2A5HA 1G8ZD 1FD7D 1T5EA 4FYDA 1SE4A 3BS1A 2K7VA 4OIJA 1I4GA 1H9SA 2R61A 3J7AV 5I2YA 2N88A 2PQEA 1KABA 2EY5A 1MSGA 4MHEA 1EYCA 4RAUC 1FNVA 4KD4A 1TY2A 5HURA 3L9AX 4KD3A 3GTOB 3P20A 3AMUA 4XQQA 1LTAD 4KV6A 2ZXRA 5ELDA 1GUSA 2JXMB 3J80E 4ZKBB 5AFWA 4FP5D 2PNRC 2WIIB 1TS4A 1GUGA 1LTBD 4IFDG 5KNDA 2K05A 4NMZA 2QF7A 5K36G 2XWBB 4H13C 1VMCA 2KEEA 4ZYSA 4EQNA 4LAAA 4ZLTF 1SFOB 3T13A 2J4XA 5C5LA 4CKBA 3VYSA 1AZPA 5FLXE 3ZYYX 5E3FA 3CQZB 3R2IA 3T53B 4M1UB 3KLSX 1IW7D 1Y1VB 2B2TC 3MC0B 4KHVA 1U4LA 4FNFA 3MXNA 2NN6H 2FFKB 3KUPA 2KCNA 2EYOA 3HOVB 2Z8LA 3NUCA 3K58A 2XRSD 5M3MB 1LT5D 1Q8IA 1PFMA 2OT2A 2A68D 2ID0A 4RGOS 5ELEA 4IUVA 1S5CD 4TQUS 4C3IB 1U9RA 2RVLA 1BCPB 5A2QE 2ICEC 3ERQA 3NQIA 4MN3A 4BA2I 3MA2B 1HTLD 1CZGA 1MI2A 1L0XB 4L6TB 2BA1A 1XTCD 2AWNA 4X3TA 1EWCA 1SXTA 4K6LA 3O13A 3E6ZX 4RCNA 3HOZB 5CR3A 3NQTA 3RD4A 4RA8A 2R6GA 1MD2D 2O5JC 3D6CA 1LT4D 5IIFA 1OXTA 4DXGA 1FR3A 5C44B 3RZDB 5JPMC 2PPBC 4ULLA 2KOLA 5EBCA 5JVG3 2A6HD 1Q1EA 3VYUA 4F88A 1GUNA 1STHA 3MWYW 3GO5A 1CFMA 1I4RA 3S2DB 4YIJA 3MXPA 1Q1BA 3IL8A 4BBSB 3I72A 4K6DA 2JSOA 1B9NA 1EYAA 4A3IB 1Y69U 1I3QB 3IAYA 1GUWA 3A8JE 2E74C 3NBIA 1ESRA 4IFDH 2EYPA 2F0WA 3NHHA 3GP7A 5K36H 3FMCA 4K14A 1TT2A 1TWHB 1WTOA 4FF3A 4Y7NB 5J39A 1Y8OB 2EY2A 3I8ZA 4UDUC 2RSNA 4Z9CB 1EOTA 3TP5A 3S9WA 1BR9A 1BCPC 3WOFA 3Q24A 1YNND 1JOQA 1I4HA 1LT3D 3BZDB 2F0NA 3X3MA 3IFDA 2H4OA 4G7OC 4KN4C 2EYMA 3V05A 4A3FB 1F9RA 1JR0D 5BN3A 1R9TB 3F2UA 1Y1WB 3CKIB 3TMEA 4DNRB 4WFN3 2LFNA 2FJ2A 3D6WA 3VR5A 4CKCA 2Z4HA 2R93B 2EPBA 3D3RA 3HEJA 5IT9L 1I6HB 2F0OA 4WORA 5I6WA 1E2ZA 3OPOA 2L12A 4RGNA 1CQVA 1RDPD 1DONA 2X6LA 5EGTA 1Z6HA 2LS01 1STYA 1TKWB 1SJHD 4DAPA 5BN4A 3OIQA 2A69C 1AZQA 4CJ0B 4IZ8A 5E4WC 2NVXB 2CW0D 3H94A 3VR2A 1CA5A 5FO9B 3EA6A 1VMPA 3KLSA 2PZUA 1H9KA 1Z7TA 3TP6A 1S5BD 5G3LD 4O1NA 3VR6A 1HRJA 4IUTA 3URYA 4H7BA 3QWNA 1B9MA 4ZQ3A 4DN4M 1DOLA 1X3QA 4G57A 3PV0A 4C2MB 3S2HB 2KEDA 1G6ZA 5G3LF 1ENFA 1JOKA 1MGSA 1SNOA 2K03A 5D65A 4QMGA 5CV5A 5CV7A 1TQOA 1VF7A 5I9OA 3GV3A 1BXTA 5FOBB 1SNCA 2GA4B 4M8AA 1F2LA 1BBXC 2IL8A 3L7ZC 3VR4A 2NB0A 2JEAI 4A93B 2E75C 1L0YB 1XXGA 4KJNA 1S5FD 2RA4A 2B2VA 3KF8A 5C0XJ 2F0DA 1FNUA 3OMCA 1Y8PB 3KBGA 3A54A 1M4VA 3BDLA 1DXMA 3S1RB 5CV6A 5DNFA 3SK8A 3S14B 1RODA 1HA6A 3A7LA 3J7AF 2RQXA 5ELCA 2NTTA 3FEWX 3VR3A 5JJZA 4OO1I 2B2WC 1O80A 4RKBA 1OXXK 1O7YA 3NE5B 1PFNA 2NUCA 4X3UA 2AQ1B 4DU9A 2QDBA 2OXPA 5COYA 5KNBA 4DAVA 3J81L 4A3JB 3NWSA 5C4XB 4PMCA 2JYOA 2EOTA 3FKIB 1WCMB 1J8IA 5T1IA 1C48A 2N55A 3OSOA 3NK9A 1GUTA 1TWGB 1EZ8A 3BVMA 4KKSA 4DGZA 1EWHA 4XYOA 1HHVA 5I6YA 4FO2A 3SK6A 1QNUA 1LO5D 1PZJD 3I4LA 1KLGD 5CBEE 2WAQB 3M4YA 2I46A 1STBA 1IHZA 2PZTA 2EJGC 2B2YC 3DWQA 1HA5A 4DK1A 5T1GA 1CHPD 1BUVT 2JA5B 4PMBA 4Q5VA 5EQ0A 5ELBA 3K7AB 1KLUD 3GD7A 2AUKA 2A74C 2MGSA 4Q0FA 4K5VA 1II3A 4ILWA 5JAVA 3DHQA 2B39A 4C56C 2DN8A 4IFDJ 1AW7A 5LL6X 3MFYA 3MFGA 1MBYA 2I07B 2KJXA 2B8FA 3I90A 4H0LC 5M9OA 3OMGA 2WINB 4BWGB 5LHY1 1CTMA 1B44D 3RZOB 4ODGA 5EKLA 1NCVA 4ME5A 4JBWA 2CQAA 1WTVA 4DAYA 4XT3B 1IL8A 2X6GA 4XT1B 4HCEA 4J6HA 3NTKA 2ENBA 3M3YB 5KNCA 4BY7B 1XYIA 1W6JA 1H9MA 3Q6SA 3I4MB 3P1HA 4F8MA 3ITPA 1ZXTA 3W2DA 2NVYB 1ESFA 2K5WA 4IUNA 3MHBA 3PIP3 1SE2A 2EY6A 2K5QA 4K5XA 1SDFA 1B4OA 2F0SA 2ZXPA 1HTPA 2EJFC 4R8IA 1T5XD 5KYIA 4KJOA 1ZYRD 2O4XA 3DXJC 2Q8RE 4EQOA 3ND9A 3GTPB 1QB5D 1R4PB 2M2LA 5C0XI 5JPNC 4A3EB 3SXHA 1SYCA 3U9SA 2BE5C 3J7YW 4IUUA 1JC7A 1Q3LA 1DOMA 1EY7A 2XRQD 4MIUA 1LTSD 5HGTA 1SE3A 3S17B 2EE1A 1NR4A 1EQTA 1YNNC 5A35A 3KBXA 1EFID 2LY7A 1SMYD 2KQ3A 3BDOA 1EQVA 2F0HA 4DF7A 1ZEQX 2RSOA 3OIPA 4V0BA 1A3TA 3A55A 2V4DA 1VDZA 2D5DA 1JOOA 4LJZC 5D14A 2NTSA 2K1BA 4ZAIA 3EVQA 2E2HB 4U68A 1GXDC 2DNCA 1R4QB 4P2CB 4G7ZC 3QOLA 4B9WA 4QB4A 1LABA 2SNMA 1GJXA 4R9WA 1LLRD 3QB3A 1CHQD 2E2DC 1F2ZA 1YNJD 5CC4A 1V1PB 4QCLA 5CGKA 3SHLA 2RBMA 4PV1C 3TSSA 2VB2X 3CRKC 2CW0C 5EPKA 5BN5A 1XX8A 1KDBA 1TIID 5KIXA 5IT9E 1CQFA 1G2TA 3W3AA 4A3GB 1IKMA 2A73B 1EEID 4PMWA 5M5XB 5I4DA 2NBFA 1I4QA 1F2YA 1SNMA 1LT6D 4RGTA 2HQEA 1B2TA 2HCCA 3V96A 4FXDA 4IN3A 2F0PA 1WTXA 4KKTA 1PZKD 3I70A 3M85A 5EPJA 3VA7A 3NSWA 4CJ2C 2F0MA 1H9JA 2F0VA 3QO2A 3DEOA 2B2TA 4XTCS 1LTRD 2G9DA 3NTHA 3R2TA 1LTGD 2PW5A 4HR7B 5CYUA 1ZKOA 1QG7A 1RCVD 4FF1A 2WKCA 2J7ZA 4RHSA 3QOJA 1DD2A 2G9HD 4V190 4OHJA 2WV6D 4CHTB 1TWAB 2FMMA 3MXUA 5C6AA 4DXFA 1V8QA 2J0TD 4JK1C 4A3BB 5JEAH 2QEJC 3GV6A 4A3MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT C;  1V1P B;  1KLG D;  1I4X A;  2TSS A;  1KTK A;  1PRT F;  1PRT B;  1TS4 A;  1LTB D;  3BYT B;  3TSS A;  1EU3 A;  1DYQ A;  1MD2 D;  1RD9 D;  1TS2 A;  1T5X D;  1LT4 D;  5TSS A;  1BXT A;  3DWQ A;  1HA5 A;  4DXG A;  2RDG A;  5ELF A;  1V1P A;  3BVZ A;  1CHP D;  1PTO H;  4ZYS A;  1JWU D;  1JCK B;  2J4X A;  3DWP A;  2RDH A;  1HXY D;  1PTO D;  1EEI D;  1L0Y B;  1XXG A;  2IJ0 A;  4RGN A;  5ELB A;  2SEB D;  5I4D A;  1S5F D;  1CQV A;  1RDP D;  1SEB D;  1ET9 A;  4RFB A;  1LTI D;  1JWM D;  1KLU D;  3DWA A;  1PZI D;  1FNU A;  2AQ3 B;  1UNS A;  3EFX D;  1I4Q A;  2XNA C;  1D6E C;  1M4V A;  2XRQ D;  1LTS D;  1LT6 D;  3R2I A;  1ET6 A;  1SE3 A;  4RGT A;  1BCP D;  1I4R A;  3BVG A;  4L63 B;  1B1Z A;  2IPK D;  4C56 C;  3KLS X;  2ICI A;  1GOZ A;  2QIL A;  3OWE B;  1HQR D;  1EFI D;  1SJH D;  1CT1 D;  3MC0 B;  1AW7 A;  4RCO A;  1JWS D;  3MFG A;  2NTT A;  5ELC A;  1EU4 A;  1DJR D;  1PTO C;  1D5Z C;  4RHR A;  1PZK D;  2Z8L A;  1I4P A;  1PRT D;  1PTO F;  1PTO B;  1TS3 A;  1RF2 D;  2XRS D;  4BWG B;  1UUP A;  1LT5 D;  5FKA C;  1TY0 A;  1G8Z D;  1SJE D;  5FK9 C;  1FD7 D;  3SEB A;  1LTR D;  2CHB D;  2AQ1 B;  3EA6 A;  3R2T A;  1S5E D;  4RGO S;  1B44 D;  1SE4 A;  5ELE A;  1LTG D;  1S5C D;  1FGB D;  1BCP F;  1S5D D;  1BCP B;  1I4G A;  2NTS A;  1F77 A;  2R61 A;  3GP7 A;  2AQ2 B;  2XN9 C;  1FNW A;  1RCV D;  1S5B D;  4O1N A;  4RGM A;  1CK1 A;  1D5X C;  1EEF D;  1HTL D;  4RHS A;  4TSS A;  3URY A;  1L0X B;  4L6T B;  1STE A;  3R8B A;  1PYW D;  1SBB B;  2G9H D;  1FNV A;  3BYY B;  4OHJ A;  5D3D A;  1XTC D;  4UDU C;  2WV6 D;  4Z9C B;  4RH6 A;  1JQY D;  1TY2 A;  3BVM A;  5D3I B;  1V1O A;  1BCP C;  1AN8 A;  1EWC A;  3CHB D;  4DXF A;  1I4H A;  1TS5 A;  1LT3 D;  1SXT A;  3BZD B;  4K6L A;  3W2D A;  1D5M C;  3O13 A;  1ESF A;  2O2L D;  1LTT D;  1LLR D;  1CHQ D;  1SE2 A;  1LTA D;  3V05 A;  1LO5 D;  1PZJ D;  5ELD A;  2QEJ C;  1ENF A;  1JR0 D;  1QIL A; 
#chains in the Genus database with same CATH topology
 1IBL Q;  3DLL A;  4O42 A;  2GVA A;  2R92 B;  2BE5 D;  2TSS A;  4YHH L;  2AUJ D;  2QDL A;  4XQJ A;  2EVB A;  1SRO A;  1EY4 A;  2MHV A;  4ZRZ A;  5BR8 Q;  1TWC H;  4R4I A;  3I4O A;  1C9O A;  1SLJ A;  3BG3 A;  4PNY A;  5JJK A;  2NZ1 D;  4A75 A;  3S1N B;  3GTQ H;  2EYH A;  4QUC A;  3LWU A;  4C1N K;  1HXY D;  3H09 A;  1W3S A;  1UEA B;  2AMC B;  4UP9 A;  4BY1 H;  4JI3 Q;  3TZU A;  3NWT A;  1U0L A;  1HJP A;  4DV2 Q;  3DWA A;  1IL2 A;  2A8V A;  2Z6K A;  3HOU H;  1CKN A;  4ZKC B;  3NEL A;  3L2P A;  2Q2U A;  5F2D A;  3I4N B;  4JYA Q;  2H1E A;  3IFT A;  4HTH A;  2B63 G;  1B1Z A;  2UXD L;  5LMN Q;  2FXQ A;  3F1Z A;  5CBA E;  4HJ8 A;  3VYR A;  5J1Z A;  2KHJ A;  1JB7 A;  2RCN A;  5IGE A;  1SYG A;  5FLM G;  3PSI A;  4OEM B;  4L5R C;  3M4P A;  3CRL C;  2Y0S G;  5LL6 S;  1PRT D;  1NY4 A;  3RUZ A;  2HT1 A;  1ML0 D;  3RLN A;  1E0B A;  2F3W A;  2QW7 A;  1K8M A;  3U9O A;  3KLR A;  1KDC A;  5FK9 C;  2YU9 B;  2Q2I A;  1EL0 A;  4BBR B;  2F3I A;  2F0L A;  1ILQ A;  3H91 A;  1XPO A;  3PF5 A;  4HMJ A;  3TZD A;  5IYD G;  3GTJ B;  3G71 A;  3D31 A;  3J81 E;  3CMA A;  4R4Q A;  3R93 A;  5CMD A;  2KA7 A;  3T4A C;  3P75 A;  1IBK L;  4LFA Q;  4R8N A;  3SK4 A;  3CCE A;  2B2U C;  1XNQ Q;  4LF7 Q;  4TSS A;  4DV6 L;  3HOX B;  2F0J A;  4GOP A;  3HOY G;  1V9P A;  1PYW D;  1SBB B;  4B3M L;  3Q0A A;  4JI1 Q;  2L5T A;  5D3D A;  4DA2 A;  2HDL A;  1JJC B;  1LTL A;  1WD0 A;  2BA0 A;  3C1E A;  1UE5 A;  3G6J B;  4OWW B;  3R3O A;  2DJG C;  4DNI A;  3Q23 A;  2F0U A;  4A3D H;  1HNZ Q;  2VZA A;  4IOC A;  2JEB I;  4UAI A;  1CA6 A;  2UXB L;  3GTL B;  3HG9 A;  3M7G A;  3K59 A;  4DFA A;  3AFQ A;  4LF4 Q;  1RJT A;  5COR A;  4ID6 A;  1QVG A;  2N78 A;  5CV9 A;  1SYE A;  3G7L A;  1WTW A;  2NVT B;  3PIO 3;  3PO2 H;  1IBM L;  5IGD A;  1WVL A;  3FDT A;  1TU2 B;  2PYK A;  3GTM B;  4DAM A;  3HOW B;  3CW2 C;  3RN5 A;  3K5L A;  3K5M A;  4F7X A;  1VCI A;  5KRU A;  4YWK A;  1IXR A;  1B3A A;  1V1P A;  3JAM L;  1PLF A;  1NTG A;  1EQR A;  1N36 L;  1JWU D;  1AEX A;  2ZJQ A;  1AH9 A;  1HFG A;  5C3E H;  5DM6 3;  4EVO A;  5HGQ A;  2SEB D;  3ERO A;  4CDD C;  2IHF A;  1VQ6 A;  2JE6 I;  3SDZ A;  4NB3 A;  3PIO A;  1UNS A;  3EFX D;  2QKI C;  4CBV A;  2E5L L;  5C4J B;  3NBH A;  4EGV A;  4L63 B;  1ONL A;  4K2L A;  4LF5 L;  2RHQ B;  4IJL A;  1SMX A;  3JAM i;  4HCS A;  2R3Z A;  3J7A 5;  2B8G A;  3MZ5 A;  1PTO C;  1V43 A;  5M3F G;  1QNK A;  1YHB A;  1U5K A;  1TWC B;  2EY1 A;  1I4P A;  1C4Q A;  5AJ3 L;  1UUP A;  3GTQ B;  1TY0 A;  3QIA A;  2WB1 G;  3HKZ G;  2GN5 A;  4K8J A;  4LFB Q;  1OXV A;  4BY1 B;  3CCJ A;  1UE1 A;  4G4K A;  4C1N I;  2E2J B;  1ZYR C;  3K57 A;  1S5D D;  2KEN A;  1HUN A;  3HOU B;  3H0G G;  4KY7 A;  4MTN A;  1VQ5 A;  1X3P A;  3CP0 A;  5CV4 A;  4B3T Q;  3SGI A;  4HIM A;  1XWE A;  2CVR A;  1CK1 A;  1D5X C;  1EEF D;  1VF5 C;  3UDX A;  1N32 L;  2HUG A;  5DM7 3;  3BYY B;  4HJ9 A;  4MNO A;  1M1K C;  1QZH A;  3DM1 A;  4AYB G;  1Y14 B;  2ZXO A;  3TDQ A;  3TP8 A;  4IPC A;  1WD1 A;  5LMU L;  1OXU A;  4KK7 A;  3T1Y Q;  2F0E A;  5NUC A;  1D5M C;  2BDN A;  1SMY C;  1M8A A;  2O2L D;  2B63 H;  2YTY A;  3AYH B;  3TN2 A;  1LAC A;  2L55 A;  2WB1 E;  1S40 A;  2KEC A;  1IYV A;  5C3W A;  1VQH A;  3G4S A;  5FLM H;  1KHI A;  2VXW A;  3D4D A;  2Z0S A;  3ND8 A;  3ER0 A;  4OWT B;  3PO3 G;  1O7Z A;  3TP7 A;  4K5W A;  1K8A C;  1JMC A;  3DMU A;  4DUZ L;  2PMZ E;  1HR0 W;  3MTS A;  1N9W A;  3ULP A;  4XQN A;  1SRU A;  2E76 C;  3K5N A;  1TWF H;  2CH4 A;  3CME A;  3J81 i;  4Y52 H;  2IY5 B;  1MSH A;  2CWA A;  1EY5 A;  3BZK A;  4JI6 L;  4JI2 Q;  1Z9F A;  2F3V A;  2R7F A;  1WTQ A;  1PDQ A;  3S16 H;  1VQE A;  1D6E C;  4DR4 Q;  4X3K A;  4X66 Q;  1E1T A;  5KGU A;  3PO2 B;  2QIL A;  4JI4 L;  2ZJR A;  1T9H A;  4ZUI A;  2L0C A;  2PW7 A;  3CPW A;  2M9V A;  2Q8T A;  4XXE A;  1HFN A;  3EBE A;  5IGG A;  1VQL A;  2CFM A;  1KAA A;  4QGU A;  3OTO Q;  4OGQ C;  1YNJ C;  4OO1 H;  1CKO A;  3OHX C;  5EKI A;  5C3E B;  1F9S A;  5M5Y H;  3A8K E;  2VUM G;  2DNE A;  1PFB A;  2Q8I B;  5FJ8 G;  2K33 A;  4N9T A;  3NPP A;  2WFW A;  2K32 A;  3MEH A;  4FF4 A;  1UE6 A;  5C0X G;  2B2W A;  3N52 A;  1F77 A;  1NAP A;  4ZK9 B;  2UU9 L;  1HR0 L;  3SR1 A;  2F0T A;  1WI5 A;  1MJE A;  5M5W H;  4RGM A;  3UI2 A;  1JIC A;  2F1M A;  2XTI A;  2KCC A;  1Y1V H;  2PI2 E;  1LYL A;  1SND A;  1HNX Q;  3UE0 A;  4FVM A;  3A7A B;  1Q7Y C;  1SAP A;  5ELO A;  3DUZ A;  4QJF A;  1AN8 A;  4IUQ A;  4IUP A;  3CD6 A;  4HID A;  1SR3 A;  2F0F A;  1YEZ A;  4DR2 L;  3U58 A;  3ONA B;  4NW2 A;  2DY8 A;  1KIX A;  1E7Z A;  1VQN A;  3E0J A;  3WOE A;  5IYB G;  5JJI A;  1K28 A;  4C3I H;  4TKO B;  3GTK H;  1YNX A;  4LMQ D;  1QCB D;  3PMF A;  1JOR A;  2L15 A;  5M3F H;  1DGS A;  2JA6 G;  1RD9 D;  1NSN S;  1K9M C;  3I3C A;  1AP0 A;  4DV1 L;  1STA A;  4XDX A;  4IQZ A;  1Q90 A;  3PCO B;  1N34 L;  2R7Z H;  1PTO D;  3H0G H;  1A0I A;  2IJ0 A;  4RKL A;  4OON A;  1ET9 A;  1LTI D;  4C3J G;  1JB3 A;  2B2Y A;  2B63 B;  5ELN A;  1GHK A;  1Z47 A;  2KBN A;  1SNQ A;  3IKJ A;  1STG A;  1ICW A;  1ET6 A;  2NWG A;  1PH4 A;  2CQO A;  1QWY A;  3HZX A;  3S15 B;  2IPK D;  1FVI A;  2ATW A;  4OX9 L;  3OWE B;  2K28 A;  2KVM A;  2NN6 I;  3OWF A;  2QA4 A;  5DAU A;  3HOW G;  1CT1 D;  2Z1C A;  1L1O C;  1TR5 A;  2Y0S B;  3H6M A;  3S1Q H;  3K0Y A;  1EU4 A;  1RTO A;  5C4Z A;  4OIK A;  1D5Z C;  1BVS A;  2Q2T A;  1PTO F;  5C44 H;  1ENA A;  1BQQ T;  1TS3 A;  5E4X A;  2H5X A;  4NXN L;  1OO9 B;  3A56 A;  5FKA C;  4LF9 L;  1TWF B;  3PUW A;  1GHJ A;  2KCT A;  1MHW C;  1X6O A;  5JVH 3;  4K8I A;  1A3U A;  3LNN A;  2O5I C;  4JVZ A;  5IOD A;  3PO3 H;  2VL6 A;  2EJM A;  3E5S A;  3EQL C;  5ISR A;  3S16 B;  1TVX A;  5J3B A;  4R4O A;  1K0R A;  1X65 A;  5JEA G;  2UUC L;  2PCF B;  2JN4 A;  3HP3 A;  3MXG A;  4APV A;  3AU7 A;  2CH4 W;  4EX5 A;  3HOY B;  2XVS A;  1S72 A;  2K6A A;  2F0I A;  4F87 A;  2M00 A;  1STE A;  4J1M A;  1G2S A;  2NVQ B;  1NUC A;  4DV4 L;  2NZH A;  4OL7 A;  1VQA A;  4EQ5 A;  5J22 A;  2VW9 A;  4LUV A;  2JA7 H;  3CCR A;  4S3S A;  1JQY D;  1J6Q A;  3EJI A;  1A2T A;  1B7Y B;  3D4W A;  2K01 A;  5M5Y B;  2HCI A;  3PUV A;  2XWJ B;  4FF2 A;  4LUZ A;  4TRD A;  2EXD A;  4B9X A;  4DV0 L;  2MJ8 A;  2OQ0 A;  1PRT C;  1J9O A;  5IWA Q;  2PQA B;  3SVM A;  5GAD C;  1EU3 A;  5M5W B;  3CCS A;  2MO1 A;  2FHT A;  3MAQ A;  4IAL A;  1PTO H;  1VQC A;  1BOS A;  1FJG L;  2UUB Q;  4LF8 L;  3T1H L;  4DR6 Q;  5FJ8 H;  3KJP A;  1EY0 A;  2BCO A;  2D9U A;  2RDH A;  1AFP A;  1A62 A;  5C0X H;  1B70 B;  1HCZ A;  1JWM D;  4DR1 L;  1CKM A;  4XYQ A;  1LM0 A;  3RN2 A;  1H95 A;  2N49 A;  1D2B A;  2QCP X;  3K5O A;  2MQH A;  3T51 B;  3GTK B;  2IHE A;  4EQP A;  4O0A A;  4RCO A;  4JI8 L;  5M3F B;  1JWS D;  4HSV A;  1DJR D;  1KNA A;  4RWS C;  5I2X A;  4BA1 I;  2WB1 B;  3HKZ B;  2A6E D;  1F9Q A;  2SOB A;  4QIW E;  4I7A A;  2IWH A;  1IZ6 A;  4JI5 L;  1RIP A;  3FPP A;  4U67 3;  4A3D G;  2R7Z B;  3H0G B;  4IFD I;  5C4H A;  2PMZ B;  1FGB D;  1EZ6 A;  1WTR A;  1YZ6 A;  4DK0 A;  2JA6 H;  3V2T A;  1KNE A;  4C3H G;  2AQ2 B;  2Q2H A;  2Z4I A;  5IYC G;  2VY3 A;  2LXJ A;  4LWC A;  1D1I A;  3UDG A;  2IX0 A;  1OTC A;  1PH2 A;  4AYB B;  2HHH L;  2KHS A;  3R8B A;  4QUF A;  3GDE A;  2RCF A;  3S1Q B;  1VQO A;  1N33 L;  4R4T A;  4WRD A;  1Q8K A;  3S24 A;  1OXS C;  4DV6 Q;  1C8C A;  1E2V A;  1F2M A;  2WP8 J;  4BS9 A;  1NNX A;  2MPM A;  1EYD A;  4NP5 A;  2IW3 A;  1BF4 A;  3KF6 B;  1J5E L;  1I6V C;  2NYZ D;  2JP1 A;  3PO3 B;  4CJ1 B;  2L1B A;  4NDX A;  5EBD A;  1I4X A;  3J80 L;  1ENC A;  4WJW A;  3DEP A;  3X3N A;  3K0X A;  2I5M X;  2UXB Q;  1DCZ A;  1TS2 A;  1SYD A;  4CGY B;  4I65 A;  3JAM E;  2D0P A;  2RDG A;  4K2K A;  5ELF A;  1IKL A;  2LKV A;  2YYZ A;  1XNR L;  2D2C C;  1IBM Q;  1X56 A;  2JA7 B;  1JCK B;  1HPC A;  3FVQ A;  5DEH A;  1W6K A;  1K8O A;  4HMI A;  2PZW A;  1RHP A;  1F9P A;  2F0G A;  2WAC A;  4HAE A;  3JAM c;  3TRE A;  3J80 i;  5FLX L;  1NR2 A;  2XSC A;  1FL0 A;  1I94 L;  5JOB A;  3BDC A;  2EYL A;  4ABN A;  4GN3 B;  4P73 A;  4JV5 L;  1VQJ A;  2LMC B;  1CZW A;  3MEF A;  4DV5 Q;  1PHJ A;  2E2I H;  2JQO A;  2E5L Q;  2D0O A;  1CSP A;  2IX3 A;  4QQB X;  1G51 A;  3E9I A;  4I7Z C;  3H3V H;  2DY7 A;  1PTO B;  2K5D A;  3CU7 A;  4LF5 Q;  2VUM B;  3M7N A;  4P71 A;  3T16 A;  2TMP A;  2EZV A;  1TXY A;  4E6I A;  4A93 H;  2F52 A;  3VYT A;  1O78 A;  1PH3 A;  5AJ3 Q;  3KK7 A;  2OCE A;  4AIM A;  5A2Q L;  4JCV E;  2XN9 C;  4L5Q A;  3VDY A;  3J81 j;  3S14 H;  1ILP A;  4AQY Q;  2R7D A;  1Q82 C;  5EJW A;  1SNP A;  2K5N A;  4HSP A;  4RH6 A;  2OWO A;  3PUX A;  1E22 A;  3HS0 C;  3AB9 A;  1N32 Q;  1S4Z A;  3QJY A;  2XIW A;  1TS5 A;  5I9P A;  3GTG B;  3TS2 A;  2JA8 H;  1VQB A;  2OEO A;  4L8J A;  1U4M A;  3F2D A;  1DZ1 A;  1QIL A;  3C2P A;  2EXZ A;  3I7F A;  2JA6 B;  2YV5 A;  4KHP L;  1SYB A;  1PRT F;  3J81 c;  2MO0 A;  2RHS B;  2B2V C;  4R4C A;  5FO7 B;  3F2C A;  2MP1 A;  4DV3 L;  3S1M H;  2PQA A;  2C9O A;  1D1K A;  1EIF A;  2FIN B;  4OO1 G;  1HUM A;  1QJO A;  4C3J B;  1TWG H;  2SNS A;  4DUZ Q;  1QVF A;  3FPU B;  3SE0 A;  4B08 A;  1RTN A;  3PUZ A;  5GQO A;  4C3H H;  4RFB A;  5IYC H;  2BOS A;  4GZY C;  4ME3 A;  4DUY L;  5FO8 B;  1I5F A;  3BVG A;  1LV9 A;  2SDF A;  4JI6 Q;  4ALP A;  1HQR D;  3LX0 A;  5LMN W;  3C3L A;  1G29 1;  1QE6 A;  1CI3 M;  2PO4 A;  1Y1V G;  5E1F A;  3P7J A;  5C3X A;  5K5P A;  4ZUJ A;  5IOC A;  5L37 A;  3W1G A;  1BNZ A;  1HZ9 A;  1I50 H;  5KEE A;  5KYL A;  1RF2 D;  2F03 A;  2G5D A;  1K83 H;  3A8I E;  1H9S B;  2JA5 H;  4K0K L;  3HOV G;  4B3S L;  4JG2 A;  3SEB A;  2IX1 A;  2CHB D;  5M3M G;  4GKK L;  1D7Q A;  1SE8 A;  1QUQ B;  1NBW A;  1Y8N B;  3K7A H;  3OOC A;  1PH8 A;  1XMO Q;  3HRZ C;  4B3R L;  2C5C A;  5EPL A;  4HN7 A;  4C3I G;  3L3O C;  1FNW A;  3RMH A;  3C1F A;  3I73 A;  2JJQ A;  2VQF L;  2K04 A;  1A15 A;  4LFC L;  1PA6 A;  3HFZ B;  4KMU C;  1IYU A;  1EY6 A;  2I0Q A;  3OW7 A;  3M4O H;  1VS0 A;  2E2I B;  3HGB A;  1C7Y A;  2UU9 Q;  3WWV A;  4OEL B;  1KQS A;  1V1O A;  2EYJ A;  4DV2 L;  2RDF A;  4KY6 A;  2B2U A;  2L9H A;  1A3V A;  5EKK A;  2R7Z G;  1KL9 A;  1QOH A;  4PG3 A;  4GNX C;  2FMC A;  4JYA L;  2HQL A;  1LTT D;  2F4V L;  1STN A;  1A2U A;  1HZC A;  1U4R A;  4JBM A;  5IGF A;  3D4R A;  1K73 C;  5LMN L;  3GQB A;  1EIG A;  4HIK A;  4A3K H;  4QIW B;  3M9B A;  1EWI A;  3BYT B;  4DR2 Q;  1HQM C;  4NKL A;  1H9R A;  3KF6 A;  4RG1 A;  3QG1 A;  4PZ7 A;  3I91 A;  4YY3 L;  1Q86 C;  1EY8 A;  3N6R A;  3BVZ A;  4YWM A;  2LSS A;  2EYF A;  1BKB A;  1EIH A;  1L2F A;  1Q12 A;  3NP8 A;  5C44 G;  4IUR A;  1B3Q A;  4A76 A;  2I5H A;  1UAP A;  3TBI B;  1SEB D;  2XGT A;  1PZI D;  4LF6 Q;  2AQ3 B;  4DV1 Q;  2JA8 B;  4H44 C;  4KY5 A;  2WKD A;  3MXN B;  1PV4 A;  4XIG S;  2XNA C;  4LFA L;  1UE7 A;  4GLA C;  1N34 Q;  3G6E A;  5CV8 A;  1BCP D;  1X3E A;  4JI1 L;  2PI2 A;  4G7H C;  1PH7 A;  1JE4 A;  3NXW A;  1PFS A;  2AWO A;  3PUY A;  2ZT9 C;  5IGB A;  1L1O B;  1VQG A;  4WJ3 M;  4RHR A;  1G91 A;  1AE3 A;  2F0Q A;  1HNZ L;  1EY9 A;  2JA7 G;  4A3D B;  3GTO H;  3S1M B;  4BBS G;  1WTP A;  1G6P A;  1SJE D;  2D62 A;  5C5M A;  1S5E D;  2EDG A;  4X3S A;  2OTL A;  1IW7 C;  2ZTE A;  4C3H B;  4UPA A;  1BCP F;  2RKS A;  1HZB A;  1O7L A;  4NXN Q;  1CM9 A;  4LF9 Q;  4KTA A;  1PYS B;  4KN7 C;  3T56 B;  4MZ9 A;  2A1A A;  2JA9 A;  3S17 H;  4DNT B;  1EIY B;  2X69 A;  2NZO A;  2L4N A;  3MVV A;  4KKU A;  2F0K A;  4QF4 A;  4LK1 C;  3SK5 A;  2MNA A;  4HED A;  3C46 A;  3FHW A;  4J8Q A;  1SFO H;  2BDO A;  1MIU A;  4BXX H;  3RLF A;  4KHZ A;  3WDN A;  2A68 C;  1XMQ L;  1ASY A;  1FYC A;  5D3I B;  2NN6 G;  1I50 B;  3CHB D;  1B53 A;  2IT1 A;  3VA5 A;  1PMR A;  1K83 B;  2HIV A;  2KUM A;  4DV4 Q;  1B50 A;  2L11 A;  3HKS A;  1S3O A;  1E2W A;  1WJJ A;  2A69 D;  4FXK C;  3CQZ H;  3NTI A;  2UUA L;  4JBJ A;  1DOK A;  1FGU A;  2A6E C;  2F4I A;  1KDA A;  5JEA J;  5IP9 H;  3M4Q A;  1KTK A;  1RKN A;  1PRT B;  2UXC Q;  3H3V C;  1DYQ A;  1BO0 A;  5TSS A;  1Y1W G;  4YCW A;  3CXC A;  4NXM L;  3HOV H;  1X32 A;  2HDM A;  4CKE A;  4N9P A;  2OF1 A;  4DR3 Q;  2K5V A;  5M3M H;  4QL5 A;  1PYB A;  2E2H H;  3M4O B;  1PXU A;  3DWP A;  1YHA A;  4A4I A;  2R93 G;  3Q22 A;  3D8G A;  4PQX A;  4GLX A;  1FJG Q;  4B3T L;  1GUO A;  4LF8 Q;  1AE2 A;  1JJ2 A;  4X65 L;  1BDO A;  1DM0 B;  2VNU D;  1SSO A;  5IGC A;  4IOA A;  4FXG C;  2ICI A;  1GOZ A;  1PH9 A;  3LWE A;  4A3K B;  1A6X A;  1SYF A;  4DR1 Q;  3FRP B;  2VB3 X;  2K75 A;  2MUY A;  4KI0 A;  3K6O A;  1U4P A;  1X3F A;  2A6H C;  3T1Y L;  2A5H A;  1WYD A;  1YJ9 A;  4A3G H;  1G8Z D;  1FD7 D;  1T5E A;  4FYD A;  3HOZ H;  2K52 A;  5IP7 G;  1SE4 A;  5M5X H;  3BS1 A;  2K7V A;  1WTH A;  4DK6 C;  4OIJ A;  2KCM A;  1I4G A;  3Q8D A;  1H9S A;  2R61 A;  2P5Z X;  3J7A V;  5I2Y A;  4TVA B;  2N88 A;  2PQE A;  4DPG A;  1KAB A;  2EY5 A;  1MSG A;  1QUQ A;  4MHE A;  1A8V A;  1EYC A;  4RAU C;  1FNV A;  3RZD H;  2ZTC A;  1KXL A;  4KD4 A;  4DV7 L;  1TY2 A;  1A63 A;  5HUR A;  3L9A X;  4KD3 A;  3GTO B;  5GAG C;  3P20 A;  3AMU A;  4LUO A;  3KYH C;  1LUZ A;  2HIX A;  4GS3 A;  4XQQ A;  4DR5 Q;  4JI0 L;  1LTA D;  2OQK A;  4KV6 A;  1E3P A;  2ZXR A;  5ELD A;  1GUS A;  2JXM B;  3J80 E;  4ZKB B;  3S2D H;  5AFW A;  1RL2 A;  4FP5 D;  2PNR C;  2WII B;  1TS4 A;  1GUG A;  1LTB D;  4IFD G;  2LXK A;  2I5L X;  5KND A;  2K05 A;  4NMZ A;  3OTO L;  4BBS H;  2QF7 A;  4J15 A;  1Q81 C;  5K36 G;  2XWB B;  3KDF B;  1YVC A;  4H13 C;  1VMC A;  4A3I H;  2KEE A;  4ZYS A;  4EQN A;  4LAA A;  3J80 c;  1I3Q H;  4ZLT F;  1SFO B;  3T13 A;  2J4X A;  5C5L A;  1O7I A;  1TWA H;  4CKB A;  1HNW L;  4GKJ L;  3VYS A;  3E0E A;  4JOI C;  2ALY B;  4POG A;  1AZP A;  5FLX E;  3ZYY X;  1XNR Q;  4A93 G;  4DKA C;  3OW2 A;  1P8L A;  5E3F A;  3CQZ B;  3R2I A;  3T53 B;  4A3B H;  4M1U B;  1TWH H;  3AEV A;  3KLS X;  1IW7 D;  1Y1V B;  2B2T C;  2EIF A;  4Y7N H;  2R92 H;  1B8A A;  1GKH A;  3MC0 B;  4KHV A;  1U4L A;  4FNF A;  5FLX c;  3MXN A;  2NN6 H;  1GO3 E;  2FFK B;  4YHH Q;  3KUP A;  2KCN A;  1VQ7 A;  2EYO A;  3HOV B;  2Z8L A;  4HIO A;  3NUC A;  3K58 A;  4IJH A;  2XRS D;  5M3M B;  1LT5 D;  4JV5 Q;  1Q8I A;  2C35 B;  1PFM A;  4OXP A;  2OT2 A;  2A68 D;  1L1O A;  2ID0 A;  4RGO S;  4A3F H;  5ELE A;  4IUV A;  2JA8 G;  1S5C D;  4TQU S;  4C3I B;  1U9R A;  1PH6 A;  1C0A A;  2RVL A;  1R9T H;  1BCP B;  5A2Q E;  1Y1W H;  2ICE C;  1N8R C;  3ERQ A;  3NQI A;  4MN3 A;  3I4N H;  3CCM A;  4BA2 I;  3MA2 B;  1HTL D;  1CZG A;  1ICF B;  1MI2 A;  1L0X B;  4L6T B;  1Q46 A;  2BA1 A;  2UXD Q;  3ERS X;  2R93 H;  3D0F A;  1XTC D;  3FKI G;  2AWN A;  1I6H H;  1WCM G;  1KD1 C;  4X3T A;  1EWC A;  1X3G A;  4UP7 A;  1SXT A;  4K6L A;  3O13 A;  3E6Z X;  4LW1 A;  4RCN A;  2YU9 H;  3HOZ B;  5CR3 A;  3NQT A;  3NEN A;  3B6Y A;  3RD4 A;  3GTJ H;  4RA8 A;  1CSQ A;  2R6G A;  1MD2 D;  3CAM A;  2O5J C;  3D6C A;  1LT4 D;  5IIF A;  2WAQ G;  2Z6K C;  1IBK Q;  1OXT A;  2ZM6 L;  4DXG A;  1FR3 A;  5C44 B;  3KF8 B;  3I56 A;  5IP7 H;  3RZD B;  5JPM C;  4B3M Q;  2NVX H;  1V1Q A;  2PPB C;  1EFW A;  4ULL A;  2KOL A;  5EBC A;  5JVG 3;  2JA5 G;  4HJ5 A;  2A6H D;  3ZJY C;  4DV3 Q;  1Q1E A;  3TRZ A;  3VYU A;  4F88 A;  3GTL H;  2V1C C;  1GUN A;  1STH A;  3MWY W;  3GO5 A;  1CFM A;  4OWX B;  1I4R A;  3F8T A;  2NVT H;  3S2D B;  4YIJ A;  4P74 A;  3MXP A;  3K80 C;  1Q1B A;  3IL8 A;  3GTM H;  3U50 C;  4BBS B;  3I72 A;  4K6D A;  2JSO A;  1B9N A;  1NMG A;  1EYA A;  3IRB A;  4A3I B;  2WAQ E;  3W1B A;  1Y69 U;  1I3Q B;  3IAY A;  4JI7 L;  4IO9 A;  1N36 Q;  4GOP C;  3E9H A;  1GUW A;  3A8J E;  4C2M H;  2E74 C;  3S2H H;  1VQD A;  4X62 L;  3NBI A;  1ESR A;  4IFD H;  2CWP A;  2EYP A;  2F0W A;  3K7U C;  3NHH A;  3GP7 A;  5K36 H;  4B3S Q;  3FMC A;  4A3L H;  3L0O A;  4K14 A;  3A5Z B;  1TT2 A;  4A3K G;  4GKK Q;  3PGZ A;  1TWH B;  1WTO A;  4FF3 A;  4Y7N B;  5J39 A;  2UUB L;  4DR6 L;  1K0S A;  1Y8O B;  2EY2 A;  3I8Z A;  4B3R Q;  4UDU C;  1PH1 A;  2RSN A;  3A74 A;  1EOT A;  4Z9C B;  3ULL A;  3TP5 A;  3S9W A;  3TQY A;  1JE5 A;  1BR9 A;  2VQE L;  1BCP C;  3WOF A;  2VQF Q;  3Q24 A;  1YNN D;  4BY7 G;  1JOQ A;  3I4M G;  1I4H A;  4CDC C;  4LFC Q;  1LT3 D;  3BZD B;  2F0N A;  1YI2 A;  4P72 A;  3IFD A;  3X3M A;  2H4O A;  1M90 C;  2QEX A;  4G7O C;  4KN4 C;  2EYM A;  4GNX B;  3V05 A;  4A3F B;  3ULJ A;  3S1R H;  1F9R A;  2E2J H;  1JR0 D;  5BN3 A;  1R9T B;  3F2U A;  1Y1W B;  3CKI B;  3TME A;  4CDE C;  4DNR B;  4WFN 3;  4UP8 A;  2LFN A;  2F4V Q;  2FJ2 A;  1BBW A;  3D6W A;  3VR5 A;  4YCV A;  1WOC A;  4CKC A;  3A5U A;  4QY7 A;  2Z4H A;  2R93 B;  2EPB A;  3D3R A;  3HEJ A;  5IT9 L;  1I6H B;  2F0O A;  4WOR A;  5I6W A;  1E2Z A;  3OPO A;  4X6A H;  2L12 A;  4RGN A;  1XPR A;  1PVO A;  3KDF A;  4YY3 Q;  1VQM A;  1CQV A;  1RDP D;  4A3E G;  4IPH A;  4X64 L;  1DON A;  2X6L A;  5LMU Q;  4A3J H;  5EGT A;  2ZTD A;  4KLK A;  5C4X H;  3KLW A;  1Z6H A;  2LS0 1;  1STY A;  3FKI H;  4PZ8 A;  1TKW B;  1WCM H;  1SJH D;  4DAP A;  5BN4 A;  2ZJP A;  3OIQ A;  4H02 A;  3STB C;  2CKZ B;  2A69 C;  1AZQ A;  3UDI A;  3LGJ A;  4CJ0 B;  4IZ8 A;  5GRO A;  1K3B C;  4BXX G;  5E4W C;  2NVX B;  2CW0 D;  3H94 A;  4DAY B;  3VR2 A;  1CA5 A;  5FO9 B;  3EA6 A;  1VMP A;  3KLS A;  2PZU A;  3DM3 A;  2Y0S E;  4RMF A;  1H9K A;  1Z7T A;  3TP6 A;  1S5B D;  5G3L D;  4O1N A;  5IP9 G;  1EQQ A;  3VR6 A;  1HRJ A;  4IUT A;  4DR7 L;  3URY A;  5JJL A;  4H7B A;  4JI4 Q;  3QWN A;  1B9M A;  4ZQ3 A;  4N8F A;  1P16 A;  4DN4 M;  1DOL A;  1VQF A;  1IBL L;  3CF5 A;  1X3Q A;  2B3G A;  4G57 A;  3PV0 A;  3UDF A;  4JBK A;  4C2M B;  3S2H B;  2KED A;  1XMQ Q;  1G6Z A;  5BR8 L;  2GVB A;  1ENF A;  1JOK A;  5G3L F;  1MGS A;  1SNO A;  2K03 A;  3PQI A;  4UHV A;  2VS1 A;  5D65 A;  4QMG A;  5CV5 A;  4DV5 L;  5CV7 A;  1TQO A;  1YIJ A;  1VF7 A;  4JI3 L;  5I9O A;  1PH5 A;  3GV3 A;  1BXT A;  1HR0 Q;  5FOB B;  1QVC A;  1SNC A;  2UUA Q;  2GA4 B;  4M8A A;  1F2L A;  4JPB W;  1BBX C;  1K3R A;  2IL8 A;  3BZC A;  3L7Z C;  4GN4 B;  3VR4 A;  3G48 A;  2NB0 A;  3CCL A;  2JEA I;  4A93 B;  2E75 C;  1L0Y B;  1XXG A;  4KJN A;  4A3G G;  4NXM Q;  1S5F D;  3RZO H;  3HOZ G;  2RA4 A;  2B2V A;  3KF8 A;  5C0X J;  2F0D A;  1FNU A;  3OMC A;  1Y8P B;  3KBG A;  3A54 A;  1M4V A;  3BDL A;  1DXM A;  2ES2 A;  2EQS A;  3S1R B;  5CV6 A;  3TS0 A;  5DNF A;  3SK8 A;  3TEH B;  1D8L A;  4YWL A;  4AQY L;  3S14 B;  1CUK A;  1ROD A;  1HA6 A;  1KAW A;  3KOJ A;  3A7L A;  3M3Y H;  3J7A F;  4BY7 H;  2RQX A;  1UEB A;  2NTT A;  5ELC A;  3FEW X;  3VR3 A;  5JJZ A;  4X65 Q;  1YJN A;  3I4M H;  4OO1 I;  2DGY A;  2B2W C;  1XJV A;  1KRT A;  1O80 A;  4RKB A;  1OXX K;  1O7Y A;  3NE5 B;  1PFN A;  2NVY H;  2Z9H A;  2NUC A;  1E24 A;  4X3U A;  1XNQ L;  2AQ1 B;  4DU9 A;  4LF7 L;  2QDB A;  2OXP A;  5COY A;  5KNB A;  4DAV A;  3JC6 6;  3J81 L;  4A3J B;  3NWS A;  2RF4 A;  5C4X B;  4PMC A;  4P75 A;  2JYO A;  2EOT A;  4HJ7 A;  3HKZ E;  3S15 H;  3FKI B;  3K81 C;  1WCM B;  1J8I A;  2MFI A;  5T1I A;  4LNQ A;  1C48 A;  4OX9 Q;  3GTP H;  1HZA A;  2N55 A;  3OSO A;  4MTK A;  1SN8 A;  3RNU A;  3NK9 A;  5HY6 A;  2CCZ A;  4LF4 L;  1GUT A;  4A3E H;  4L5S A;  4A3I G;  1TWG B;  1EZ8 A;  3BVM A;  1YJW A;  4KKS A;  4DGZ A;  1MKH A;  1EWH A;  4A3C G;  4GN5 A;  4XYO A;  1HHV A;  1GD7 A;  5I6Y A;  1X9N A;  5IYD H;  4FO2 A;  3SK6 A;  1QNU A;  4WJ4 A;  4DV7 Q;  3CC2 A;  1LO5 D;  1PZJ D;  1E1O A;  4AYB E;  3I4L A;  2DUD A;  1KLG D;  3EIV A;  5CBE E;  2WAQ B;  3M4Y A;  4A3B G;  2I46 A;  1STB A;  1IHZ A;  2PZT A;  4O2D A;  4A3M G;  3ICE A;  2UUC Q;  3HOY H;  2EJG C;  1YHQ A;  4JI0 Q;  2R92 G;  4GNX A;  2B2Y C;  3DWQ A;  1HA5 A;  4DK1 A;  2NVQ H;  5T1G A;  1CHP D;  1BUV T;  1EUJ A;  3CC7 A;  2JA5 B;  4PMB A;  4CDF C;  3STB D;  5H1S E;  4Q5V A;  5EQ0 A;  2AHO B;  5ELB A;  3UE1 A;  3K7A B;  1KLU D;  3GD7 A;  1XMO L;  3U4V A;  2AUK A;  4A3F G;  2A74 C;  3AFP A;  2MGS A;  4Q0F A;  4K5V A;  1II3 A;  4ILW A;  5JAV A;  3DHQ A;  5GAE C;  1HNW Q;  4GKJ Q;  2B39 A;  4C56 C;  2DN8 A;  4DV0 Q;  3I4N G;  4IFD J;  1AW7 A;  5LL6 X;  3MFY A;  2K4K A;  3MFG A;  4LFB L;  1MBY A;  3RLO A;  1X55 A;  2I07 B;  4L5T A;  1VQI A;  2KJX A;  2B8F A;  3I90 A;  4H0L C;  3PF4 A;  5M9O A;  3OMG A;  2WIN B;  4BWG B;  5LHY 1;  2BH2 A;  3T1H Q;  1CTM A;  1KRS A;  1B44 D;  3RZO B;  4ODG A;  2HD3 A;  5EKL A;  1NCV A;  4ME5 A;  4BBR G;  2N8N A;  4JBW A;  2CQA A;  1WTV A;  4DAY A;  4XT3 B;  1IL8 A;  2X6G A;  4XT1 B;  4HCE A;  4J6H A;  3NTK A;  3FP9 A;  2ENB A;  3M3Y B;  1NJI C;  5KNC A;  4BY7 B;  1XYI A;  4IPG A;  1W2B A;  1W6J A;  4JI8 Q;  3HOX G;  1H9M A;  3Q6S A;  3I4M B;  4JW0 A;  3P1H A;  3CCU A;  3CCV A;  4F8M A;  3F2B A;  5EAY A;  1XPU A;  3ITP A;  4LF6 L;  1ZXT A;  3W2D A;  2NVY B;  1IYJ B;  1ESF A;  4ZCK A;  2K5W A;  4IUN A;  3MHB A;  3PIP 3;  4JI5 Q;  1SE2 A;  2EY6 A;  2K5Q A;  3BU2 A;  4K5X A;  1SDF A;  2OTJ A;  1HH2 P;  1B4O A;  2DJF C;  3J7Z C;  4FDB A;  1GVP A;  1XTD A;  2F0S A;  2ZXP A;  1X54 A;  1MJC A;  1HTP A;  2EJF C;  4R8I A;  1T5X D;  5KYI A;  4KJO A;  1ZYR D;  4JI2 L;  3CPF A;  2O4X A;  3DXJ C;  3NEM A;  2BH8 A;  3KJO A;  2Q8R E;  4EQO A;  1VQ9 A;  3ND9 A;  3AQQ A;  3GTP B;  1CKN B;  2HHH Q;  3E3X A;  1QB5 D;  4DR4 L;  1R4P B;  2M2L A;  3I2Z A;  5C0X I;  5JPN C;  4A3E B;  3SXH A;  4X66 L;  1VQ4 A;  1SYC A;  1N33 Q;  3PIP A;  2ZM6 Q;  3U9S A;  3A0J A;  2BE5 C;  3J7Y W;  4IUU A;  1JC7 A;  1Q3L A;  1DOM A;  1EY7 A;  1UWV A;  2XRQ D;  4MIU A;  1LTS D;  5HGT A;  1SE3 A;  3S17 B;  4YCU A;  2EE1 A;  1NR4 A;  1J5E Q;  1EQT A;  1YNN C;  5A35 A;  3KBX A;  4A3L G;  1EFI D;  2LY7 A;  1SMY D;  2KQ3 A;  3BDO A;  2YTV A;  2ASB A;  4JC0 A;  1ASZ A;  3I55 A;  4A3C H;  1EQV A;  3OYY A;  2F0H A;  4DF7 A;  1ZEQ X;  2RSO A;  3OIP A;  4V0B A;  3W5O A;  1A3T A;  3A55 A;  1JT8 A;  2V4D A;  1VDZ A;  2D5D A;  1JOO A;  4LJZ C;  4GOP B;  4A3M H;  2PNH A;  1JJG A;  4R1J A;  4BY1 G;  3K8A A;  1NMF A;  5D14 A;  2UXC L;  1HNX L;  2NTS A;  5E7N A;  2AKW B;  2K1B A;  4JI7 Q;  4ZAI A;  3HOU G;  3EVQ A;  1I94 Q;  1QZG A;  1GM5 A;  4DR3 L;  4X62 Q;  4HJA A;  4PZ6 A;  1KC8 C;  2E2H B;  4U68 A;  1GXD C;  3S1N H;  2DNC A;  2B29 A;  1R4Q B;  4P2C B;  4G7Z C;  3QOL A;  3KFU A;  4B9W A;  4QB4 A;  4UY8 C;  2VUM H;  1LAB A;  2SNM A;  1GJX A;  4R9W A;  1LLR D;  3QB3 A;  1YBY A;  1CHQ D;  4POF A;  3BJU A;  2E2D C;  1F2Z A;  2VQE Q;  4A3J G;  1YNJ D;  5CC4 A;  1V1P B;  3EN2 A;  4QCL A;  5C4X G;  5CGK A;  2JK8 A;  3SHL A;  2RBM A;  4PV1 C;  3TSS A;  2VB2 X;  3CRK C;  3CC4 A;  2CW0 C;  2K5H A;  5EPK A;  5BN5 A;  2KHI A;  1NE3 A;  1XX8 A;  1KDB A;  1TII D;  5KIX A;  5IT9 E;  1CQF A;  1G2T A;  3W3A A;  4DK3 C;  4GLV B;  3RR5 A;  4A3G B;  1IKM A;  2A73 B;  4BBR H;  3NBH B;  1EEI D;  4PMW A;  5M5X B;  5I4D A;  2A19 A;  2NBF A;  5IYB H;  3GTG H;  2K50 A;  5IT9 c;  1K8G A;  1I4Q A;  1F2Y A;  1SNM A;  1VQP A;  1LT6 D;  4RGT A;  3CCQ A;  4IPD A;  2HQE A;  1B2T A;  3HOX H;  2HCC A;  5IY0 A;  3U4Z A;  3V96 A;  4X64 Q;  1VQK A;  1WFQ A;  2YTX A;  4JOI A;  4FXD A;  1YIT A;  4KHP Q;  4IN3 A;  3PO2 G;  3H3V I;  1BBU A;  2F0P A;  1WTX A;  4KKT A;  1PZK D;  3I70 A;  3M85 A;  2QGQ A;  5EPJ A;  3VA7 A;  3NSW A;  4CJ2 C;  2F0M A;  1H9J A;  2F0V A;  3QO2 A;  4DR5 L;  2E8G A;  2B2T A;  3DEO A;  4XTC S;  1LTR D;  2G9D A;  4C3J H;  3NTH A;  3R2T A;  1L0W A;  1EOV A;  5C3E G;  1LTG D;  1EYG A;  2Z6B A;  2PW5 A;  4HR7 B;  5CYU A;  5GAH C;  1ZKO A;  3QR8 A;  1QG7 A;  4DUY Q;  1RCV D;  4FF1 A;  3HOW H;  2WKC A;  2J7Z A;  2K14 A;  4RHS A;  3H15 A;  3QOJ A;  1DD2 A;  2G9H D;  4NPS A;  4V19 0;  4OHJ A;  2N3S A;  2WV6 D;  4CHT B;  1TWA B;  2FMM A;  3MXU A;  5C6A A;  4DR7 Q;  4DXF A;  5IWA L;  4N8X 1;  5IE8 A;  1V8Q A;  2J0T D;  4K0K Q;  4JK1 C;  1VQ8 A;  5C4J H;  4AH6 A;  4A3B B;  5DLQ E;  5JEA H;  2QEJ C;  3GV6 A;  4A3M B; 
#chains in the Genus database with same CATH homology
 4O42 A;  2R92 B;  2BE5 D;  2TSS A;  2AUJ D;  4XQJ A;  2EVB A;  1EY4 A;  2MHV A;  4ZRZ A;  3BG3 A;  4PNY A;  2NZ1 D;  3S1N B;  2EYH A;  4QUC A;  3LWU A;  4C1N K;  1HXY D;  3H09 A;  1UEA B;  3TZU A;  3NWT A;  3DWA A;  4ZKC B;  5F2D A;  3I4N B;  2H1E A;  3IFT A;  4HTH A;  1B1Z A;  5CBA E;  3VYR A;  5J1Z A;  5IGE A;  1SYG A;  3CRL C;  5LL6 S;  1PRT D;  3RUZ A;  1ML0 D;  1E0B A;  2F3W A;  3U9O A;  1K8M A;  3KLR A;  1KDC A;  5FK9 C;  2YU9 B;  1EL0 A;  4BBR B;  2F0L A;  1ILQ A;  3H91 A;  4HMJ A;  3TZD A;  3GTJ B;  3D31 A;  3J81 E;  3R93 A;  5CMD A;  2KA7 A;  3T4A C;  3P75 A;  3SK4 A;  4R8N A;  2B2U C;  4TSS A;  3HOX B;  2F0J A;  1PYW D;  1SBB B;  3Q0A A;  2L5T A;  5D3D A;  4DA2 A;  2HDL A;  1WD0 A;  2BA0 A;  3C1E A;  3G6J B;  3R3O A;  3Q23 A;  2F0U A;  2JEB I;  4UAI A;  1CA6 A;  3GTL B;  3HG9 A;  3M7G A;  3K59 A;  4DFA A;  1RJT A;  5COR A;  4ID6 A;  5CV9 A;  1SYE A;  3G7L A;  1WTW A;  2NVT B;  3PIO 3;  5IGD A;  1WVL A;  3FDT A;  1TU2 B;  2PYK A;  3GTM B;  3HOW B;  3K5L A;  3K5M A;  4F7X A;  1VCI A;  5KRU A;  1B3A A;  1V1P A;  3JAM L;  1PLF A;  1JWU D;  1AEX A;  1HFG A;  5DM6 3;  4EVO A;  2SEB D;  3ERO A;  2JE6 I;  3SDZ A;  1UNS A;  3EFX D;  2QKI C;  4CBV A;  5C4J B;  3NBH A;  4EGV A;  4L63 B;  1ONL A;  4K2L A;  4HCS A;  2R3Z A;  2B8G A;  3MZ5 A;  1PTO C;  1V43 A;  1QNK A;  1TWC B;  2EY1 A;  1I4P A;  1C4Q A;  1UUP A;  3GTQ B;  1TY0 A;  3QIA A;  4K8J A;  1OXV A;  4BY1 B;  4C1N I;  4G4K A;  2E2J B;  1ZYR C;  3K57 A;  1S5D D;  1HUN A;  3HOU B;  4KY7 A;  1X3P A;  5CV4 A;  1XWE A;  2CVR A;  1CK1 A;  1D5X C;  1EEF D;  1VF5 C;  2HUG A;  5DM7 3;  3BYY B;  3DM1 A;  2ZXO A;  3TDQ A;  3TP8 A;  1WD1 A;  1OXU A;  4KK7 A;  2F0E A;  5NUC A;  1D5M C;  2BDN A;  1SMY C;  1M8A A;  2O2L D;  3TN2 A;  1LAC A;  2L55 A;  2KEC A;  1IYV A;  5C3W A;  2VXW A;  3D4D A;  3ND8 A;  1O7Z A;  3TP7 A;  4K5W A;  3DMU A;  3MTS A;  4XQN A;  2E76 C;  3K5N A;  1MSH A;  1EY5 A;  2F3V A;  1WTQ A;  1PDQ A;  1D6E C;  4X3K A;  5KGU A;  3PO2 B;  2QIL A;  4ZUI A;  2L0C A;  2PW7 A;  2M9V A;  2Q8T A;  4XXE A;  1HFN A;  5IGG A;  1KAA A;  4OGQ C;  1YNJ C;  4OO1 H;  3OHX C;  5EKI A;  5C3E B;  1F9S A;  3A8K E;  2DNE A;  1PFB A;  2Q8I B;  2K33 A;  4N9T A;  3NPP A;  2K32 A;  3MEH A;  4FF4 A;  5C0X G;  2B2W A;  3N52 A;  1F77 A;  1NAP A;  4ZK9 B;  3SR1 A;  2F0T A;  4RGM A;  3UI2 A;  1JIC A;  2F1M A;  2KCC A;  1SND A;  4FVM A;  3A7A B;  1SAP A;  3DUZ A;  1AN8 A;  4IUQ A;  4IUP A;  2F0F A;  3ONA B;  4NW2 A;  2DY8 A;  3E0J A;  3WOE A;  4TKO B;  4LMQ D;  1QCB D;  3PMF A;  1JOR A;  1RD9 D;  1NSN S;  3I3C A;  1AP0 A;  1STA A;  4XDX A;  4IQZ A;  1Q90 A;  1PTO D;  2IJ0 A;  4RKL A;  1ET9 A;  1LTI D;  4C3J G;  1JB3 A;  2B2Y A;  2B63 B;  1GHK A;  1Z47 A;  1SNQ A;  3IKJ A;  1STG A;  1ICW A;  1ET6 A;  2NWG A;  1QWY A;  3HZX A;  3S15 B;  2IPK D;  3OWE B;  2K28 A;  2KVM A;  2NN6 I;  3OWF A;  5DAU A;  1CT1 D;  2Z1C A;  1TR5 A;  2Y0S B;  3H6M A;  3K0Y A;  1EU4 A;  1RTO A;  5C4Z A;  4OIK A;  1D5Z C;  1PTO F;  1ENA A;  1BQQ T;  1TS3 A;  5E4X A;  1OO9 B;  3A56 A;  5FKA C;  1TWF B;  3PUW A;  1GHJ A;  5JVH 3;  4K8I A;  1A3U A;  3LNN A;  2O5I C;  5IOD A;  2EJM A;  3E5S A;  3EQL C;  5ISR A;  3S16 B;  1TVX A;  5JEA G;  2PCF B;  3MXG A;  3HP3 A;  3AU7 A;  3HOY B;  2XVS A;  2K6A A;  2F0I A;  4F87 A;  2M00 A;  1STE A;  4J1M A;  1G2S A;  2NVQ B;  1NUC A;  4OL7 A;  5J22 A;  4S3S A;  1JQY D;  3EJI A;  1A2T A;  3D4W A;  2K01 A;  5M5Y B;  2HCI A;  3PUV A;  2XWJ B;  4FF2 A;  4TRD A;  4B9X A;  2MJ8 A;  1PRT C;  1J9O A;  3SVM A;  1EU3 A;  5M5W B;  2FHT A;  3MAQ A;  4IAL A;  1PTO H;  1BOS A;  1EY0 A;  2BCO A;  2D9U A;  2RDH A;  1AFP A;  5C0X H;  1HCZ A;  1JWM D;  4XYQ A;  1D2B A;  2QCP X;  3K5O A;  3T51 B;  3GTK B;  4EQP A;  4RCO A;  5M3F B;  1JWS D;  4HSV A;  1DJR D;  1KNA A;  4RWS C;  5I2X A;  4BA1 I;  2WB1 B;  3HKZ B;  2A6E D;  1F9Q A;  2SOB A;  2IWH A;  3FPP A;  4U67 3;  2R7Z B;  3H0G B;  4IFD I;  5C4H A;  2PMZ B;  1FGB D;  1EZ6 A;  1WTR A;  4DK0 A;  3V2T A;  1KNE A;  4C3H G;  2AQ2 B;  2Z4I A;  1D1I A;  2IX0 A;  4AYB B;  2KHS A;  3R8B A;  4QUF A;  3S1Q B;  4WRD A;  1OXS C;  1C8C A;  1E2V A;  1F2M A;  2WP8 J;  4BS9 A;  2MPM A;  1EYD A;  4NP5 A;  2IW3 A;  1BF4 A;  1I6V C;  2NYZ D;  2JP1 A;  3PO3 B;  4CJ1 B;  2L1B A;  4NDX A;  5EBD A;  1I4X A;  3J80 L;  1ENC A;  4WJW A;  3DEP A;  3X3N A;  1DCZ A;  1TS2 A;  1SYD A;  4CGY B;  4I65 A;  3JAM E;  2RDG A;  4K2K A;  5ELF A;  1IKL A;  2LKV A;  2YYZ A;  2D2C C;  2JA7 B;  1JCK B;  1HPC A;  3FVQ A;  5DEH A;  1W6K A;  1K8O A;  4HMI A;  2PZW A;  1RHP A;  1F9P A;  2F0G A;  2WAC A;  4HAE A;  5FLX L;  1NR2 A;  2XSC A;  5JOB A;  3BDC A;  2EYL A;  4ABN A;  2LMC B;  1CZW A;  2IX3 A;  4I7Z C;  2DY7 A;  1PTO B;  2K5D A;  3CU7 A;  2VUM B;  3M7N A;  3T16 A;  2TMP A;  2EZV A;  4E6I A;  3VYT A;  1O78 A;  3KK7 A;  5A2Q L;  2XN9 C;  1ILP A;  5EJW A;  1SNP A;  4HSP A;  4RH6 A;  3PUX A;  3HS0 C;  3AB9 A;  1S4Z A;  3QJY A;  2XIW A;  1TS5 A;  5I9P A;  3GTG B;  2OEO A;  4L8J A;  1U4M A;  1DZ1 A;  1QIL A;  3C2P A;  2EXZ A;  2JA6 B;  1SYB A;  1PRT F;  2B2V C;  5FO7 B;  2MP1 A;  2C9O A;  1D1K A;  2FIN B;  4OO1 G;  1HUM A;  1QJO A;  4C3J B;  2SNS A;  3FPU B;  3SE0 A;  4B08 A;  1RTN A;  3PUZ A;  4RFB A;  2BOS A;  4GZY C;  5FO8 B;  3BVG A;  1LV9 A;  2SDF A;  1HQR D;  3LX0 A;  3C3L A;  1G29 1;  1QE6 A;  1CI3 M;  2PO4 A;  5E1F A;  3P7J A;  5C3X A;  5K5P A;  4ZUJ A;  5IOC A;  1BNZ A;  5KEE A;  5KYL A;  1RF2 D;  2F03 A;  3A8I E;  1H9S B;  3SEB A;  2IX1 A;  2CHB D;  1Y8N B;  3OOC A;  3HRZ C;  2C5C A;  5EPL A;  4HN7 A;  4C3I G;  3L3O C;  1FNW A;  3RMH A;  3C1F A;  3I73 A;  2K04 A;  1A15 A;  4KMU C;  1IYU A;  1EY6 A;  3OW7 A;  2E2I B;  3HGB A;  1V1O A;  2EYJ A;  2RDF A;  4KY6 A;  2B2U A;  2L9H A;  1A3V A;  5EKK A;  1QOH A;  2FMC A;  1LTT D;  1STN A;  1A2U A;  1U4R A;  5IGF A;  3D4R A;  3GQB A;  1EIG A;  4QIW B;  3BYT B;  1HQM C;  4NKL A;  1H9R A;  3QG1 A;  3I91 A;  1EY8 A;  3N6R A;  3BVZ A;  2EYF A;  1EIH A;  1Q12 A;  3NP8 A;  4IUR A;  1UAP A;  3TBI B;  1SEB D;  1PZI D;  2AQ3 B;  2JA8 B;  4H44 C;  4KY5 A;  2WKD A;  4XIG S;  2XNA C;  5CV8 A;  1BCP D;  4G7H C;  1JE4 A;  3NXW A;  2AWO A;  3PUY A;  2ZT9 C;  5IGB A;  4RHR A;  1G91 A;  2F0Q A;  1EY9 A;  4A3D B;  3S1M B;  1WTP A;  1SJE D;  2D62 A;  5C5M A;  1S5E D;  2EDG A;  4X3S A;  1IW7 C;  4C3H B;  1BCP F;  2RKS A;  1O7L A;  1CM9 A;  4KTA A;  4KN7 C;  3T56 B;  4DNT B;  2X69 A;  2L4N A;  3MVV A;  4KKU A;  2F0K A;  4QF4 A;  4LK1 C;  3SK5 A;  4HED A;  3C46 A;  4J8Q A;  2BDO A;  3RLF A;  4KHZ A;  3WDN A;  2A68 C;  1FYC A;  5D3I B;  2NN6 G;  1I50 B;  3CHB D;  1B53 A;  2IT1 A;  3VA5 A;  1PMR A;  1K83 B;  2KUM A;  1B50 A;  2L11 A;  1E2W A;  4FXK C;  2A69 D;  3NTI A;  1DOK A;  2A6E C;  2F4I A;  1KDA A;  5JEA J;  1KTK A;  1RKN A;  1PRT B;  3H3V C;  1DYQ A;  1BO0 A;  5TSS A;  1X32 A;  2HDM A;  4CKE A;  4N9P A;  2OF1 A;  3M4O B;  1PXU A;  3DWP A;  3Q22 A;  3D8G A;  4PQX A;  1GUO A;  1BDO A;  1DM0 B;  2VNU D;  1SSO A;  5IGC A;  4FXG C;  2ICI A;  1GOZ A;  3LWE A;  4A3K B;  1A6X A;  1SYF A;  3FRP B;  2VB3 X;  2MUY A;  4KI0 A;  3K6O A;  1U4P A;  2A6H C;  2A5H A;  1G8Z D;  1FD7 D;  1T5E A;  4FYD A;  1SE4 A;  3BS1 A;  2K7V A;  4OIJ A;  1I4G A;  1H9S A;  2R61 A;  3J7A V;  5I2Y A;  2N88 A;  2PQE A;  1KAB A;  2EY5 A;  1MSG A;  4MHE A;  1EYC A;  4RAU C;  1FNV A;  4KD4 A;  1TY2 A;  5HUR A;  3L9A X;  4KD3 A;  3GTO B;  3P20 A;  3AMU A;  4XQQ A;  1LTA D;  4KV6 A;  2ZXR A;  5ELD A;  1GUS A;  2JXM B;  3J80 E;  4ZKB B;  5AFW A;  4FP5 D;  2PNR C;  2WII B;  1TS4 A;  1GUG A;  1LTB D;  4IFD G;  5KND A;  2K05 A;  4NMZ A;  2QF7 A;  5K36 G;  2XWB B;  4H13 C;  1VMC A;  2KEE A;  4ZYS A;  4EQN A;  4LAA A;  4ZLT F;  1SFO B;  3T13 A;  2J4X A;  5C5L A;  4CKB A;  3VYS A;  1AZP A;  5FLX E;  3ZYY X;  5E3F A;  3CQZ B;  3R2I A;  3T53 B;  4M1U B;  3KLS X;  1IW7 D;  1Y1V B;  2B2T C;  3MC0 B;  4KHV A;  1U4L A;  4FNF A;  3MXN A;  2NN6 H;  2FFK B;  3KUP A;  2KCN A;  2EYO A;  3HOV B;  2Z8L A;  3NUC A;  3K58 A;  2XRS D;  5M3M B;  1LT5 D;  1Q8I A;  1PFM A;  2OT2 A;  2A68 D;  2ID0 A;  4RGO S;  5ELE A;  4IUV A;  1S5C D;  4TQU S;  4C3I B;  1U9R A;  2RVL A;  1BCP B;  5A2Q E;  2ICE C;  3ERQ A;  3NQI A;  4MN3 A;  4BA2 I;  3MA2 B;  1HTL D;  1CZG A;  1MI2 A;  1L0X B;  4L6T B;  2BA1 A;  1XTC D;  2AWN A;  4X3T A;  1EWC A;  1SXT A;  4K6L A;  3O13 A;  3E6Z X;  4RCN A;  3HOZ B;  5CR3 A;  3NQT A;  3RD4 A;  4RA8 A;  2R6G A;  1MD2 D;  2O5J C;  3D6C A;  1LT4 D;  5IIF A;  1OXT A;  4DXG A;  1FR3 A;  5C44 B;  3RZD B;  5JPM C;  2PPB C;  4ULL A;  2KOL A;  5EBC A;  5JVG 3;  2A6H D;  1Q1E A;  3VYU A;  4F88 A;  1GUN A;  1STH A;  3MWY W;  3GO5 A;  1CFM A;  1I4R A;  3S2D B;  4YIJ A;  3MXP A;  1Q1B A;  3IL8 A;  4BBS B;  3I72 A;  4K6D A;  2JSO A;  1B9N A;  1EYA A;  4A3I B;  1Y69 U;  1I3Q B;  3IAY A;  1GUW A;  3A8J E;  2E74 C;  3NBI A;  1ESR A;  4IFD H;  2EYP A;  2F0W A;  3NHH A;  3GP7 A;  5K36 H;  3FMC A;  4K14 A;  1TT2 A;  1TWH B;  1WTO A;  4FF3 A;  4Y7N B;  5J39 A;  1Y8O B;  2EY2 A;  3I8Z A;  4UDU C;  2RSN A;  4Z9C B;  1EOT A;  3TP5 A;  3S9W A;  1BR9 A;  1BCP C;  3WOF A;  3Q24 A;  1YNN D;  1JOQ A;  1I4H A;  1LT3 D;  3BZD B;  2F0N A;  3X3M A;  3IFD A;  2H4O A;  4G7O C;  4KN4 C;  2EYM A;  3V05 A;  4A3F B;  1F9R A;  1JR0 D;  5BN3 A;  1R9T B;  3F2U A;  1Y1W B;  3CKI B;  3TME A;  4DNR B;  4WFN 3;  2LFN A;  2FJ2 A;  3D6W A;  3VR5 A;  4CKC A;  2Z4H A;  2R93 B;  2EPB A;  3D3R A;  3HEJ A;  5IT9 L;  1I6H B;  2F0O A;  4WOR A;  5I6W A;  1E2Z A;  3OPO A;  2L12 A;  4RGN A;  1CQV A;  1RDP D;  1DON A;  2X6L A;  5EGT A;  1Z6H A;  2LS0 1;  1STY A;  1TKW B;  1SJH D;  4DAP A;  5BN4 A;  3OIQ A;  2A69 C;  1AZQ A;  4CJ0 B;  4IZ8 A;  5E4W C;  2NVX B;  2CW0 D;  3H94 A;  3VR2 A;  1CA5 A;  5FO9 B;  3EA6 A;  1VMP A;  3KLS A;  2PZU A;  1H9K A;  1Z7T A;  3TP6 A;  1S5B D;  5G3L D;  4O1N A;  3VR6 A;  1HRJ A;  4IUT A;  3URY A;  4H7B A;  3QWN A;  1B9M A;  4ZQ3 A;  4DN4 M;  1DOL A;  1X3Q A;  4G57 A;  3PV0 A;  4C2M B;  3S2H B;  2KED A;  1G6Z A;  5G3L F;  1ENF A;  1JOK A;  1MGS A;  1SNO A;  2K03 A;  5D65 A;  4QMG A;  5CV5 A;  5CV7 A;  1TQO A;  1VF7 A;  5I9O A;  3GV3 A;  1BXT A;  5FOB B;  1SNC A;  2GA4 B;  4M8A A;  1F2L A;  1BBX C;  2IL8 A;  3L7Z C;  3VR4 A;  2NB0 A;  2JEA I;  4A93 B;  2E75 C;  1L0Y B;  1XXG A;  4KJN A;  1S5F D;  2RA4 A;  2B2V A;  3KF8 A;  5C0X J;  2F0D A;  1FNU A;  3OMC A;  1Y8P B;  3KBG A;  3A54 A;  1M4V A;  3BDL A;  1DXM A;  3S1R B;  5CV6 A;  5DNF A;  3SK8 A;  3S14 B;  1ROD A;  1HA6 A;  3A7L A;  3J7A F;  2RQX A;  5ELC A;  2NTT A;  3FEW X;  3VR3 A;  5JJZ A;  4OO1 I;  2B2W C;  1O80 A;  4RKB A;  1OXX K;  1O7Y A;  3NE5 B;  1PFN A;  2NUC A;  4X3U A;  2AQ1 B;  4DU9 A;  2QDB A;  2OXP A;  5COY A;  5KNB A;  4DAV A;  3J81 L;  4A3J B;  3NWS A;  5C4X B;  4PMC A;  2JYO A;  2EOT A;  3FKI B;  1WCM B;  1J8I A;  5T1I A;  1C48 A;  2N55 A;  3OSO A;  3NK9 A;  1GUT A;  1TWG B;  1EZ8 A;  3BVM A;  4KKS A;  4DGZ A;  1EWH A;  4XYO A;  1HHV A;  5I6Y A;  4FO2 A;  3SK6 A;  1QNU A;  1LO5 D;  1PZJ D;  3I4L A;  1KLG D;  5CBE E;  2WAQ B;  3M4Y A;  2I46 A;  1STB A;  1IHZ A;  2PZT A;  2EJG C;  2B2Y C;  3DWQ A;  1HA5 A;  4DK1 A;  5T1G A;  1CHP D;  1BUV T;  2JA5 B;  4PMB A;  4Q5V A;  5EQ0 A;  5ELB A;  3K7A B;  1KLU D;  3GD7 A;  2AUK A;  2A74 C;  2MGS A;  4Q0F A;  4K5V A;  1II3 A;  4ILW A;  5JAV A;  3DHQ A;  2B39 A;  4C56 C;  2DN8 A;  4IFD J;  1AW7 A;  5LL6 X;  3MFY A;  3MFG A;  1MBY A;  2I07 B;  2KJX A;  2B8F A;  3I90 A;  4H0L C;  5M9O A;  3OMG A;  2WIN B;  4BWG B;  5LHY 1;  1CTM A;  1B44 D;  3RZO B;  4ODG A;  5EKL A;  1NCV A;  4ME5 A;  4JBW A;  2CQA A;  1WTV A;  4DAY A;  4XT3 B;  1IL8 A;  2X6G A;  4XT1 B;  4HCE A;  4J6H A;  3NTK A;  2ENB A;  3M3Y B;  5KNC A;  4BY7 B;  1XYI A;  1W6J A;  1H9M A;  3Q6S A;  3I4M B;  3P1H A;  4F8M A;  3ITP A;  1ZXT A;  3W2D A;  2NVY B;  1ESF A;  2K5W A;  4IUN A;  3MHB A;  3PIP 3;  1SE2 A;  2EY6 A;  2K5Q A;  4K5X A;  1SDF A;  1B4O A;  2F0S A;  2ZXP A;  1HTP A;  2EJF C;  4R8I A;  1T5X D;  5KYI A;  4KJO A;  1ZYR D;  2O4X A;  3DXJ C;  2Q8R E;  4EQO A;  3ND9 A;  3GTP B;  1QB5 D;  1R4P B;  2M2L A;  5C0X I;  5JPN C;  4A3E B;  3SXH A;  1SYC A;  3U9S A;  2BE5 C;  3J7Y W;  4IUU A;  1JC7 A;  1Q3L A;  1DOM A;  1EY7 A;  2XRQ D;  4MIU A;  1LTS D;  5HGT A;  1SE3 A;  3S17 B;  2EE1 A;  1NR4 A;  1EQT A;  1YNN C;  5A35 A;  3KBX A;  1EFI D;  2LY7 A;  1SMY D;  2KQ3 A;  3BDO A;  1EQV A;  2F0H A;  4DF7 A;  1ZEQ X;  2RSO A;  3OIP A;  4V0B A;  1A3T A;  3A55 A;  2V4D A;  1VDZ A;  2D5D A;  1JOO A;  4LJZ C;  5D14 A;  2NTS A;  2K1B A;  4ZAI A;  3EVQ A;  2E2H B;  4U68 A;  1GXD C;  2DNC A;  1R4Q B;  4P2C B;  4G7Z C;  3QOL A;  4B9W A;  4QB4 A;  1LAB A;  2SNM A;  1GJX A;  4R9W A;  1LLR D;  3QB3 A;  1CHQ D;  2E2D C;  1F2Z A;  1YNJ D;  5CC4 A;  1V1P B;  4QCL A;  5CGK A;  3SHL A;  2RBM A;  4PV1 C;  3TSS A;  2VB2 X;  3CRK C;  2CW0 C;  5EPK A;  5BN5 A;  1XX8 A;  1KDB A;  1TII D;  5KIX A;  5IT9 E;  1CQF A;  1G2T A;  3W3A A;  4A3G B;  1IKM A;  2A73 B;  1EEI D;  4PMW A;  5M5X B;  5I4D A;  2NBF A;  1I4Q A;  1F2Y A;  1SNM A;  1LT6 D;  4RGT A;  2HQE A;  1B2T A;  2HCC A;  3V96 A;  4FXD A;  4IN3 A;  2F0P A;  1WTX A;  4KKT A;  1PZK D;  3I70 A;  3M85 A;  5EPJ A;  3VA7 A;  3NSW A;  4CJ2 C;  2F0M A;  1H9J A;  2F0V A;  3QO2 A;  3DEO A;  2B2T A;  4XTC S;  1LTR D;  2G9D A;  3NTH A;  3R2T A;  1LTG D;  2PW5 A;  4HR7 B;  5CYU A;  1ZKO A;  1QG7 A;  1RCV D;  4FF1 A;  2WKC A;  2J7Z A;  4RHS A;  3QOJ A;  1DD2 A;  2G9H D;  4V19 0;  4OHJ A;  2WV6 D;  4CHT B;  1TWA B;  2FMM A;  3MXU A;  5C6A A;  4DXF A;  1V8Q A;  2J0T D;  4JK1 C;  4A3B B;  5JEA H;  2QEJ C;  3GV6 A;  4A3M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...