1EEID

Cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHOLERA TOXIN B)
molecule tags Toxin
source organism Vibrio cholerae
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eeiD00
1JWSD 2WV6D 1BCPC 1JCKB 2G9HD 5FK9C 3BVMA 4TSSA 1TS5A 3BYYB 1T5XD 2XN9C 2R61A 1DYQA 1B44D 1FNVA 1LO5D 1LTTD 1M4VA 1PRTB 1LTRD 1FNUA 1LLRD 1GOZA 1ENFA 1SE2A 3BVGA 5ELCA 1S5FD 4UDUC 5ELBA 1ET9A 2XNAC 4OHJA 1D5XC 3URYA 1XXGA 3TSSA 2O2LD 1RF2D 1EU4A 1FD7D 1LTAD 4RFBA 1L0YB 4L63B 2J4XA 1DJRD 2XRSD 5D3IB 2RDHA 4Z9CB 1B1ZA 1G8ZD 4RHRA 1TS2A 1PTOD 1EEID 1LT6D 1SBBB 1PRTD 1ESFA 3KLSX 2AQ3B 1PTOB 1TY2A 1S5BD 3BZDB 3DWPA 5D3DA 1PTOF 1AW7A 1LTSD 1S5DD 2CHBD 1LTGD 2QILA 1STEA 4RCOA 3SEBA 3OWEB 1V1PB 1PYWD 1UUPA 1TS4A 5ELFA 1BCPF 1LT3D 5I4DA 1FGBD 2AQ2B 5ELDA 1D5MC 1TS3A 1EFID 1I4HA 4DXFA 1JWUD 1RCVD 4L6TB 1AN8A 1KTKA 1HA5A 5FKAC 1LT4D 1D6EC 3R8BA 1PZJD 1D5ZC 3EA6A 2NTTA 1KLGD 3MFGA 4RGNA 2SEBD 1F77A 3W2DA 1FNWA 1JR0D 1I4PA 2IPKD 1V1PA 5TSSA 1SE3A 1V1OA 2TSSA 3DWAA 1EU3A 1LT5D 1PTOH 4C56C 4DXGA 2QEJC 1SJED 1PZKD 1EWCA 1S5ED 1SJHD 4BWGB 2IJ0A 1JQYD 3R2TA 1PRTC 1SXTA 3EFXD 3GP7A 2NTSA 4RGOS 3BVZA 1PZID 1PTOC 2AQ1B 1TY0A 4K6LA 1KLUD 1HQRD 1S5CD 5ELEA 1CQVA 1LTID 1RD9D 1I4GA 1ET6A 1QILA 3MC0B 1CT1D 3BYTB 1MD2D 4RGTA 1L0XB 1CHPD 1XTCD 2Z8LA 4RGMA 1PRTF 3O13A 1JWMD 3V05A 1EEFD 4RHSA 1HTLD 3R2IA 3CHBD 3DWQA 4ZYSA 1I4XA 4RH6A 1BCPD 1SE4A 2ICIA 1RDPD 1HXYD 1LTBD 2RDGA 1I4RA 4O1NA 1BCPB 1CHQD 1UNSA 1BXTA 1I4QA 1SEBD 2XRQD 1CK1A
chains in the Genus database with same CATH superfamily
4DAYB 1JCKB 1EOVA 3HKZG 1SRUA 1A3VA 3GV3A 4ZKCB 5C0XI 3ZYYX 3RR5A 4UP9A 4EGVA 1RODA 4HJAA 3J7AV 1KXLA 1GOZA 3I70A 2SNMA 1YNXA 2ATWA 1XPRA 4HJ5A 5J39A 4BY1B 5CR3A 1QOHA 4ULLA 1GUOA 1XXGA 2JE6I 1C48A 3PIP3 5EBCA 2PPBC 4DR3Q 2F3WA 3Q24A 3CMEA 1LT6D 3MAQA 2NBFA 1BBXC 4AYBB 1EIYB 3T1HQ 2N49A 2SNSA 5I2YA 2PNHA 1A0IA 1U4MA 1C0AA 2DN8A 1ZYRD 3SEBA 1M1KC 2CKZB 4KY6A 3K57A 3ERSX 5GAGC 4FNFA 2JJQA 5G3LF 1CKOA 1S40A 1NNXA 1ASZA 3HOYH 2LSSA 4C1NI 1RCVD 3SDZA 1WCMB 5GQOA 5M3FB 1VQOA 3HFZB 3CQZH 4B9WA 2HIVA 3ND9A 1SYCA 4IOCA 4JBMA 3IRBA 1MGSA 4IQZA 4YY3Q 3NBHA 4A3BH 1EU3A 4RG1A 1HH2P 5CBEE 5BR8Q 1EY8A 1G6ZA 4A3JG 1I94L 3R2TA 1HZCA 3EFXD 1QZGA 1GM5A 4JYAL 2KHJA 4FVMA 5DNFA 2YU9B 1N34L 1YNND 3IFTA 1PFNA 5E7NA 4JI5Q 3GTMB 4DUYL 3BVZA 4BBRH 1VQ6A 4J8QA 4DV2L 3A5ZB 5E3FA 3VYSA 4BY1H 4LMQD 2D62A 4RAUC 3U50C 1D1KA 1CHPD 1H9RA 3R3OA 5LHY1 3OMGA 4DN4M 1PH6A 4OWTB 3LNNA 1MBYA 3CHBD 4DV6Q 4QGUA 2FXQA 1YNJC 4QUCA 3RNUA 4GOPA 1D2BA 3S1QB 4X66Q 2HCIA 2YYZA 4CHTB 1T9HA 2RDGA 1VQPA 2RA4A 4BXXG 4Y7NB 3S2DH 3J7ZC 3NE5B 4QCLA 2KEEA 3WOFA 1D7QA 4LUOA 4DR4Q 4OEMB 1FYCA 3KK7A 1BCPC 2QA4A 2A8VA 2LFNA 3I2ZA 1GUWA 3D8GA 1DYQA 1LO5D 2DY7A 3U9SA 4JI7L 4OO1G 2YTVA 4DV5L 4C2MB 5FLMH 3BVGA 4C3IH 2ZJQA 1VQCA 2JA6B 1Q86C 2K33A 4OONA 2VS1A 3AU7A 3WWVA 1SFOB 4YCUA 3AEVA 1KAWA 2PZTA 3FP9A 4PV1C 4H13C 3NENA 2MP1A 4HIDA 1TVXA 1IXRA 2XVSA 3D31A 5ELOA 3I72A 1BQQT 3V96A 4BY7H 2KEDA 2L11A 2M2LA 2ZJPA 1NBWA 5LL6S 4K5VA 2DNEA 4P73A 1ILQA 4UP7A 2WINB 2GN5A 1IW7D 1AW7A 2IT1A 5IOCA 3KFUA 4X65Q 2AUKA 3BJUA 4PG3A 3VR5A 4IJLA 1K0RA 1UUPA 1KL9A 1A8VA 3PIO3 3HGBA 3CD6A 1NR4A 1RTNA 3AYHB 1UE5A 2A19A 4YIJA 4DNIA 1E0BA 1J9OA 2UXCQ 2HHHL 3ER0A 1XPOA 4BA2I 3J80L 1VQNA 3W1BA 3GTLH 3G48A 3J81j 2PCFB 4DNTB 2F0FA 4UHVA 4BWGB 2XWBB 1OXXK 2A69C 5FJ8G 2IW3A 2NTSA 3S1RB 4U673 1RIPA 4J15A 4KV6A 3W5OA 1N34Q 5BN4A 2DUDA 4JYAQ 1VQ4A 1K8MA 1CT1D 1L0WA 2D9UA 2Z8LA 3H0GH 2Q8TA 5IYBG 3O13A 3STBC 3T51B 3JC66 2NZHA 5M5YB 1OXTA 1CSPA 4R4OA 1NR2A 4X3SA 3NTHA 4N9PA 1JJ2A 3DLLA 2JA6G 4YCVA 1EIGA 3PCOB 1BDOA 2PQAB 2JA5B 4YWKA 4UY8C 1YEZA 4GKKL 4AYBG 5JAVA 1X9NA 1HZ9A 1V9PA 2PZWA 3BVMA 3VYTA 4HIOA 2WAQB 2WACA 5GAHC 2NYZD 3CPWA 2NVXB 1Q46A 3ICEA 4CKBA 2A73B 5IYBH 4XYOA 3GTGB 3EIVA 3L7ZC 5DLQE 5IGCA 4C3JB 1SNCA 4UP8A 1LTAD 1EYAA 1L0YB 2F0SA 5JEAG 1KHIA 3NELA 3CAMA 4LF4L 1B1ZA 4XQQA 5HGQA 1ZXTA 4O42A 1J8IA 1I94Q 3VR6A 1WFQA 3D4DA 3BZDB 4LF7L 3JAML 4A4IA 2K01A 1N33Q 1F9SA 1WTQA 1SSOA 1PYWD 2NB0A 3M9BA 4XXEA 1HFGA 3H09A 1WCMG 3L2PA 1QNUA 1I4HA 2NVQH 3TBIB 2I0QA 1HNWL 3CCJA 4TRDA 1VQDA 1KTKA 4OWXB 5FKAC 3BU2A 4L5QA 4A3EH 3NXWA 2A69D 1BVSA 1H9MA 1SN8A 3Q0AA 4GNXB 4DK3C 4PMCA 3W2DA 2F1MA 4A3LH 1JR0D 1I4PA 1PFSA 4EQ5A 1YITA 1PVOA 3VR2A 4N9TA 4XQJA 3G4SA 4R9WA 4LWCA 1KDCA 3K81C 4A3GG 5CBAE 3A54A 1JQYD 2PZUA 4B3TL 1EY5A 4I7ZC 3HOUH 2F0GA 1UE6A 1CKMA 4YHHL 3QOJA 1XMQL 4LF4Q 1QWYA 5M3MB 1N32Q 2AWNA 2I5MX 2CCZA 3E0JA 1HQRD 4R1JA 3SK5A 1DOLA 1Q90A 5KRUA 3RN2A 1QILA 4BBSG 4LF5Q 1GHJA 3RLFA 1I3QH 3MVVA 5IWAQ 4A93H 2F0IA 3DWQA 3A8KE 1IW7C 1TWGB 4IUUA 1U4RA 5C4XG 1F2ZA 4KKTA 1RDPD 3X3NA 1B2TA 1JT8A 3AQQA 3NPPA 2UXCL 5C44B 3HS0C 3I4NH 2EYLA 1DM0B 4CKEA 4DV7L 4HJ7A 3ONAB 1UE1A 1WVLA 3NP8A 2SDFA 2FJ2A 1HNZL 1YBYA 4A76A 1M4VA 3X3MA 4G57A 1AEXA 1FNUA 1Q82C 2F0UA 4IUTA 2VUMB 4DKAC 1IZ6A 2WKCA 3TN2A 2B2UA 2BE5D 1LV9A 4O0AA 4EX5A 1JJGA 3SXHA 2K75A 2ENBA 1IYUA 4R8IA 1ENCA 1UWVA 1MI2A 2ZXRA 1ESFA 3UI2A 5A35A 1IHZA 5IY0A 1YHQA 3E0EA 4ZCKA 1NMFA 4LFBQ 5F2DA 3OTOL 2HDMA 2IL8A 5IIFA 2QILA 3NBIA 1U5KA 1QVFA 4QIWE 5C5MA 4KI0A 4X64L 1LT3D 5FO8B 5C3EH 2FHTA 1D5MC 1YZ6A 3UDGA 3CXCA 4DV0Q 2XIWA 3I55A 3MXNA 3NSWA 4L6TB 1ICWA 1TT2A 1NTGA 3T53B 3E9HA 5K36H 1D6EC 2OTJA 3EA6A 4LW1A 1FNWA 2N8NA 2NN6H 4GN3B 3GTOB 2X69A 2B8GA 3N6RA 5IYCG 1EY0A 1KDAA 2F0PA 3H3VH 1BR9A 5CV5A 5JJKA 2E5LQ 1CA6A 3D0FA 2B2VC 5JPMC 1KIXA 1PTOC 3K7AB 1CFMA 4IUVA 5EKIA 3H94A 2UUCL 2JA6H 1VQBA 2K1BA 4R4IA 1SYGA 3GTKH 1O7LA 4APVA 1PYSB 3K5NA 4A3IG 5IGGA 3CCVA 3F2DA 2VW9A 4CGYB 2A6HD 1F2MA 2N55A 1VQ8A 1JICA 4K5WA 3FPPA 2CH4A 2A6EC 1E2VA 4JOIA 3HOWB 4QMGA 5H1SE 1IBML 2G9HD 1F2YA 3T1YQ 3U4ZA 3UDFA 5C4JB 3DEPA 3LWEA 3TREA 3NWTA 4FXGC 1ILPA 3S16B 1HNXQ 2XNAC 2F0JA 3V2TA 4B3SL 4WRDA 1WYDA 2MQHA 1Y1VH 5KNCA 3ULPA 1SROA 3BDCA 4X62L 1R9TH 1H9JA 5T1IA 3A5UA 4BXXH 1TS2A 2N88A 4B3SQ 1K73C 3KLSX 1EFWA 3DUZA 1HQMC 4A3BB 3CKIB 5FO7B 1I6HH 1PFBA 2WAQE 5CV4A 4RCOA 1HRJA 2K6AA 3NTIA 3GDEA 4BY1G 5E4WC 2AQ2B 4FDBA 5M5XH 3HRZC 1CM9A 5ELDA 3J81i 1F9PA 1CSQA 5IYDG 3C46A 2ZM6L 4DXFA 1JWUD 4TQUS 2EYJA 2R92B 2AMCB 1CI3M 1KLGD 4ABNA 1KNEA 5JOBA 1X65A 3H0GG 1KDBA 5GAEC 2F0NA 4JVZA 2K5NA 2Z9HA 2R7ZH 1MJCA 5LMNL 3HOUB 1X54A 5KGUA 4IPGA 3I4MB 1Y1VB 4M8AA 3HOXG 1Q81C 3K7AH 3FPUB 2L0CA 4QJFA 4HJ9A 2UUAQ 1H9SA 4WJWA 1ONLA 3MC0B 4A93G 5M3FG 4RGTA 2Y0SE 1SMYD 3E3XA 1PRTF 1WTHA 1BBUA 2OF1A 2EVBA 2FINB 4ZYSA 5C3XA 2KCTA 2B39A 2PQEA 2KUMA 2RF4A 4GN5A 4JOIC 5G3LD 4HCSA 4X3TA 3RZOH 2KJXA 3OMCA 1K9MC 1I4RA 4QY7A 1OO9B 1C7YA 1BCPB 3CF5A 2XRQD 2KHIA 4X6AH 4OIKA 2MHVA 5CORA 5C5LA 2JXMB 5FLXL 2RQXA 1PLFA 4DAVA 1V8QA 2E2HH 4TSSA 2BE5C 2CW0D 1WTWA 1LTTD 5EQ0A 3OIQA 4KLKA 3SK4A 1G91A 1PRTB 3BZCA 1ENFA 3J80c 5ELBA 1VQ9A 2EYMA 3TP7A 3I4NB 1D5XC 3SK6A 4A3BG 1TWAH 1YI2A 4B3ML 1Y1WG 2F0HA 2NVYH 3BDLA 4IOAA 4RFBA 1VQFA 4GOPC 5M5XB 2J4XA 5FOBB 1QZHA 1PDQA 2HT1A 4FF1A 5E1FA 4ZUIA 4GN4B 4DV1L 1PA6A 2JA8B 2MJ8A 4DK6C 1PTOF 3BZKA 5IT9E 1PFMA 1PXUA 2LXJA 2ID0A 2ZXPA 3J81L 3DMUA 2Z4HA 4A3MB 4DR1L 4RCNA 4JI0L 4FXDA 2MO0A 3CMAA 3QB3A 3MFGA 1X3GA 4A3CH 4P2CB 2IX1A 2EE1A 2JA7H 3M4OB 1SE3A 1V1OA 1XNRQ 1C9OA 5IWAL 2VL6A 2RHSB 1SJED 1MKHA 5CV7A 1E2WA 1SJHD 2B2YA 2RKSA 4A93B 4DV1Q 1SXTA 4CDEC 2KENA 4LFCL 4FF4A 3GTOH 1SNDA 5EPJA 1KLUD 1LM0A 5IE8A 3M4OH 1ET6A 2NUCA 1S3OA 1MD2D 2YTXA 2QKIC 3QJYA 4EQNA 1PYBA 1LUZA 1QVGA 5K5PA 1SDFA 5FLMG 1G291 1HNZQ 1SNQA 2N78A 4M1UB 3H0GB 1N36L 3HOYG 2B2WC 2HQLA 2EIFA 4A75A 2Z6BA 5HY6A 1VQMA 1B9NA 5JPNC 3EN2A 1P8LA 1VQHA 2VZAA 3Q8DA 1E1OA 4L5RC 4LK1C 2WV6D 4A3FG 4AQYQ 3S1RH 1TWCB 2XN9C 4KY7A 5IP9H 1N33L 4CDCC 2R7DA 3ZJYC 4QL5A 2EY5A 1XMOQ 5ELCA 3CCMA 3L9AX 4ZLTF 2P5ZX 1U4LA 5AJ3L 1HTPA 3J7YW 4A3IB 5C4HA 4OHJA 2JA8G 1F9QA 3CCUA 3IAYA 1RKNA 2K52A 2A68D 2XRSD 1B3QA 1FVIA 4LF9Q 4UPAA 4KMUC 4C3JH 3HOWG 1HUMA 1S5BD 2ZTDA 3GTGH 1KABA 3TDQA 5JVG3 1LTLA 2E75C 5CV9A 3VYUA 2JP1A 5BN3A 1V1QA 4XQNA 1I6VC 4UAIA 4IURA 4DR7Q 1VQEA 4B08A 4QUFA 3PIPA 5EBDA 5M9OA 4MIUA 3K80C 1EY7A 4C3IG 1WTXA 1Y69U 2KA7A 2JA7B 4OO1H 2L12A 4XDXA 1UEBA 4LNQA 4IFDI 2IPKD 5C4XH 3S2HB 2HD3A 5M5WH 1YJWA 4C56C 1K8AC 4K2LA 1KRTA 3NBHB 1RHPA 2PMZE 3G71A 4BBSB 5DEHA 2M00A 4C3HB 3OWFA 1XNQQ 4LF6L 1WTRA 4HR7B 1Y1WH 1VQ7A 2B8FA 2E5LL 3K6OA 4IPDA 3BYTB 1GUTA 1Y14B 2E2DC 4JI2Q 4YWMA 3CQZB 4A3DG 1K83H 1Y8OB 3DEOA 4RHSA 1VQKA 4BY7B 3RN5A 4IJHA 1AE2A 3FEWX 3IKJA 1HXYD 1K3BC 3ULJA 5I2XA 5IGBA 2EDGA 2I07B 4JI1L 1LABA 5EPKA 1B8AA 1STGA 1FJGQ 3PQIA 1GUGA 2EY1A 2HDLA 4JI0Q 3GV6A 4DNRB 3HOVB 4MN3A 3I8ZA 2EQSA 3HKZE 4C2MH 4NXML 1JJCB 4P74A 1EQRA 2QGQA 4ME3A 2YV5A 3E9IA 2F0EA 3S2HH 2E2HB 2PQAA 1VQJA 1L1OA 1QCBD 1SE2A 5C44H 5IP9G 1EWIA 4C1NK 4B3RL 1F9RA 3CC2A 4P75A 3KUPA 4J1MA 4POGA 2R7FA 2C5CA 1TWGH 1FR3A 3TZDA 3J81E 4I7AA 2R92H 4IZ8A 1VF7A 4Q5VA 1DJRD 4OX9L 3PO3H 2OTLA 3KLSA 1I5FA 1O7ZA 1DONA 1PRTD 4POFA 4IFDJ 3CCRA 1Z9FA 1II3A 5ELNA 3OYYA 2MPMA 1LTGD 4OXPA 1STEA 4LFAL 5D14A 1PH8A 3PO2H 1XYIA 2PNRC 1ML0D 4DUZL 2VUMG 2R93G 1JB3A 1X3QA 3RZDB 1EYGA 5ISRA 3ND8A 2ICEC 5CYUA 3SK8A 3R8BA 2JK8A 1C4QA 2Y0SG 4DV3Q 1V43A 3FRPB 4LAAA 4X66L 4LFAQ 4WFN3 2F0WA 3SHLA 2UXDQ 3RZOB 2A6ED 3SE0A 3HEJA 1YVCA 3H3VI 4A3CG 1S5ED 1WTOA 1G51A 2JA5H 2Q8IB 2EXZA 2F4VL 1WJJA 2MFIA 2NVYB 4OX9Q 3NWSA 2BA1A 4RGOS 4A3KB 1XNQL 2XGTA 4IUNA 2WP8J 2R6GA 5LMNQ 2KCCA 5FJ8H 3A7LA 1IKMA 5JVH3 4ALPA 2ALYB 4JG2A 3RLNA 3T13A 2K5DA 4IO9A 4QIWB 4IPCA 4N8X1 1HR0L 4RH6A 4YY3L 3QR8A 4V190 4U68A 3I4OA 1S4ZA 4R4TA 1A63A 4MTNA 4DR4L 4Y7NH 4GNXC 3KF8B 2WAQG 3J81c 1CHQD 4RA8A 3TEHB 4ID6A 1TQOA 2KVMA 1HZBA 1HPCA 2F0MA 4G4KA 3TS2A 2R61A 5LL6X 2WKDA 1HJPA 4K5XA 3HOWH 1SYBA 2RDFA 1HA6A 4JBWA 4DR5Q 1EIFA 4FYDA 2WB1E 3GTPH 4JI2L 1IBLL 5M5YH 1O7YA 2H4OA 2CWAA 1Z47A 4BY7G 1PH1A 4LF9L 3EJIA 1FD7D 1GHKA 3CCEA 4JI8L 1U4PA 2MGSA 2F0TA 3NHHA 1KRSA 1A3UA 4BA1I 1NAPA 5A2QE 1UEAB 4YHHQ 1AH9A 1PTOD 1EEID 1DCZA 2OCEA 4PMWA 3EQLC 4DU9A 1AFPA 4YCWA 3CPFA 3MXNB 3OHXC 3WOEA 4DR5L 1W6KA 2JYOA 1LTSD 3A74A 1S5DD 3OW2A 1T5EA 4DFAA 3HOVH 4IUPA 1E24A 1J5EQ 1EWHA 2ES2A 1MHWC 2WB1G 5I4DA 3HOXH 2E76C 5LMUQ 4ZAIA 2X6LA 4DAYA 5IT9c 4K2KA 2Z1CA 1TWAB 4H44C 2H5XA 3I73A 1X55A 2DJFC 4DGZA 2TMPA 3IL8A 5HGTA 3S17B 1I6HB 2Q2UA 2RBMA 1J5EL 1HHVA 2EJFC 2TSSA 3PF4A 1AE3A 1E7ZA 3PSIA 3KOJA 4WORA 2B63G 4DXGA 5M3MG 4R8NA 3A8JE 1L2FA 2VQFQ 1O78A 4XTCS 1X6OA 3K58A 3FMCA 4JI8Q 4BS9A 4K6LA 1TY0A 2GA4B 1A62A 3KBGA 5C4ZA 4IFDG 1PV4A 2OWOA 1CUKA 4PQXA 5JJZA 4K8JA 2HIXA 1B3AA 3QWNA 1L0XB 4CJ0B 3PO2G 2CFMA 3R93A 3DM1A 3R2IA 1SNPA 1STNA 4LJZC 2IY5B 5FO9B 2AHOB 2PMZB 1EY9A 3I7FA 5AFWA 4DR1Q 3CCQA 3Q6SA 2R92G 5KIXA 1GVPA 1K8OA 1T5XD 4GLVB 1YHAA 3HZXA 3GTKB 4X65L 2HQEA 3BS1A 3SVMA 1HR0Q 2R7ZG 1NCVA 5C0XG 3BDOA 1AZQA 1S5FD 4UDUC 1NSNS 4NW2A 4E6IA 3RMHA 2PI2E 1QG7A 2VB3X 1SE8A 2G5DA 4EQOA 1UE7A 3I4MG 2GVBA 3HOXB 5CC4A 1R4PB 4A3EB 2O5IC 2RDHA 3M85A 1QUQB 4K0KL 1JE5A 4H0LC 4BBRB 1DXMA 1WI5A 2F03A 2HCCA 5I9PA 1YJNA 3P7JA 4HIMA 2DJGC 2NWGA 4H02A 1JMCA 3KLRA 4NDXA 3S14H 1EUJA 5T1GA 2EOTA 3DM3A 5IGFA 3GD7A 3KLWA 1XWEA 1TKWB 5KNDA 4DPGA 5IP7G 1RTOA 4KY5A 1R9TB 1JORA 3BG3A 2F0KA 4JV5Q 1GKHA 3QOLA 1WCMH 3S24A 3GTPB 2AWOA 4H7BA 1JOOA 2H1EA 1VCIA 2J7ZA 5CV8A 4X64Q 5IYCH 4GS3A 3J7AF 3LX0A 5JJIA 1CZWA 1XTDA 1HFNA 1IYJB 1EQQA 3CRLC 1N9WA 4ZUJA 1K83B 3DXJC 1GJXA 3AFPA 5D65A 4L5TA 4XT3B 1D8LA 3GQBA 4YWLA 1S5CD 2F4IA 4N8FA 3RD4A 4F87A 5KNBA 3IFDA 1GO3E 3KYHC 1RL2A 3T56B 2B3GA 1NY4A 3I91A 2Z6KC 1I4XA 1E3PA 1BCPD 1Q3LA 5JEAJ 3AMUA 2ICIA 1SYDA 2K5VA 3H6MA 3QO2A 3K0YA 3PUWA 5E4XA 2NVTB 3CCSA 2B63B 2EYFA 2E74C 1IKLA 5LMUL 2IX0A 2K4KA 2PW5A 1NJIC 1AP0A 4NXNL 1A3TA 1PH3A 4RMFA 2AKWB 1VQ5A 1B44D 5EGTA 4AIMA 4JK1C 1Q12A 1WD1A 5EPLA 1F2LA 4KN7C 2F0DA 3CRKC 2K5HA 2G9DA 3PIOA 1STHA 5DAUA 1Y8PB 2BCOA 5J22A 1D1IA 4LUZA 2EYOA 1EY6A 1G8ZD 2EPBA 3E6ZX 2AUJD 1PMRA 4KJNA 4TKOB 1X3FA 1CQFA 2QW7A 2K28A 1EZ6A 3KJPA 2AQ3B 4GKJQ 1PTOB 5M5WB 2QF7A 4PNYA 1BBWA 1KNAA 1Q8KA 3FKIH 3S14B 4HMJA 5IT9L 1V1PB 4QF4A 3Q22A 3GTJB 4ZKBB 3S1MH 4IUQA 1TS3A 3FHWA 3L0OA 4DAPA 3E5SA 3U4VA 1CKNB 3OIPA 5FLXE 2UU9L 1B9MA 1TWFH 2V4DA 4JI4Q 3K5LA 3MXPA 5IYDH 3OPOA 2Z6KA 1FL0A 5TSSA 4NMZA 2CH4W 1GUSA 4DF7A 1VDZA 2VNUD 1SLJA 2D2CC 1Y8NB 3KF6B 3CCLA 4ZQ3A 1M90C 3T1HL 2IJ0A 3M3YB 4KK7A 5I6WA 2JEAI 3F2UA 4DR3L 2A6HC 1KQSA 3NTKA 1K28A 1U0LA 1PZID 4JBKA 2AQ1B 3TP8A 1EOTA 1RD9D 3U9OA 3DHQA 1XPUA 3PO3B 1IBLQ 1IL8A 1BO0A 4DA2A 3P1HA 2C9OA 3FKIG 5J1ZA 3I56A 5M3FH 3EVQA 1PH7A 2MUYA 3TQYA 2D0PA 1XNRL 2E2IB 2K14A 1SYFA 4HEDA 4P72A 2VB2X 3HOYB 4PZ7A 3I3CA 1RJTA 1SR3A 4JV5L 2MO1A 4BBSH 1BXTA 3D6CA 4O2DA 1BF4A 1WTVA 1BKBA 4KHZA 5FK9C 1FNVA 4JC0A 1N8RC 1H9SB 3A7AB 3OTOQ 3C2PA 3D6WA 4CDFC 4C3JG 2RHQB 5J3BA 3F2CA 1B70B 2BH8A 3G7LA 3M7NA 3K5OA 4WJ3M 4K6DA 3S16H 2I46A 2LY7A 1NMGA 3VA5A 4LFCQ 4I65A 4JI3L 3M4QA 3MEHA 1WD0A 4FP5D 5GADC 3GTQH 1IBKL 2NZ1D 3STBD 3FVQA 1LYLA 5M3MH 1QE6A 3KJOA 1SFOH 1W3SA 3DWPA 2B63H 4A3FB 1GXDC 3VYRA 3M3YH 1TR5A 3T4AC 1DD2A 2A74C 1PH5A 1TS4A 2QEXA 1GD7A 2Y0SB 4ZK9B 1SNOA 3LWUA 4KTAA 4S3SA 4GZYC 4WJ4A 2B2WA 1EFID 3MXGA 1PH9A 4DV0L 1A6XA 4X3UA 1L1OB 1EL0A 4KKSA 2QDLA 1JE4A 2JQOA 1TWFB 2RCFA 2B2TC 5JEAH 4PZ8A 3WDNA 5KYLA 2SEBD 4AYBE 2QDBA 4XT1B 5GROA 1HR0W 3S15H 1M8AA 4DV6L 4EQPA 4TVAB 1LT5D 4KD3A 2B2VA 2E8GA 1ZYRC 1SMXA 4HTHA 1E2ZA 1EWCA 4HMIA 3PUZA 4K0KQ 3FKIB 4X3KA 3GTLB 1SNMA 2A5HA 2BDNA 3HP3A 4JBJA 1P16A 4F88A 2L1BA 3HOUG 1XMQQ 2L55A 2B2YC 3M4YA 5I6YA 3HKZB 4OWWB 2L4NA 2XTIA 4DR2Q 4HIKA 1XTCD 3ULLA 3TS0A 5BR8L 4CJ2C 4A3LG 1QVCA 3QG1A 2JA7G 2C35B 1EIHA 2ZTCA 4DV4L 4KHPQ 4O1NA 2PI2A 5DM73 2UU9Q 3SGIA 1I4QA 1SEBD 2LKVA 1JWSD 2JN4A 4A3KH 3OW7A 4OO1I 4R4CA 4Y52H 4IPHA 5C0XH 1J6QA 5KEEA 3J80i 1G2TA 1LTRD 2B2UC 3TMEA 3PF5A 2KHSA 2OQKA 2F0LA 3D4RA 1A2UA 4HSPA 1XJVA 2A1AA 4L5SA 3Q23A 4A3DB 3ITPA 1HCZA 2WFWA 3MHBA 2KBNA 4OGQC 3VDYA 3ERQA 4A3KG 2K32A 2RSOA 3VA7A 4L63B 1H95A 5C0XJ 4Z9CB 3K59A 5EKKA 5IGDA 2VQFL 4JI5L 2LXKA 1SBBB 1NUCA 1SMYC 3M4PA 3B6YA 1R4QB 4CDDC 4B3TQ 5C3EB 1TY2A 2FMMA 1JC7A 2Q2HA 1B53A 1PH4A 4A3GH 1KC8C 2EJMA 1MSHA 3NQIA 2PYKA 2E2JH 4NXNQ 4AQYL 1FGBD 1C8CA 3MTSA 2FFKB 2I5HA 3H15A 2B29A 4JW0A 3I90A 1JB7A 1N36Q 2RCNA 1D5ZC 1VMPA 4RGNA 2NTTA 4DV4Q 4FO2A 4RKBA 3H3VC 4HSVA 1JOQA 4K8IA 2UXBL 4F8MA 1EYDA 3CU7A 2NN6G 2UUCQ 1BOSA 1WTPA 3RZDH 2EYHA 5FLXc 3PMFA 5I9OA 2Z4IA 3PO3G 5K36G 4X62Q 3UDIA 3CP0A 1Q1BA 2UUBQ 1CQVA 3S1QH 2D0OA 1CTMA 3VR4A 5AJ3Q 1I50H 1XMOL 2L9HA 1HZAA 1EEFD 4HN7A 1KD1C 3F2BA 2EY2A 1HUNA 1GUNA 2E2JB 2DY8A 2WB1B 1LTBD 2OQ0A 3U58A 4FXKC 3TP6A 3RLOA 1B7YB 1EY4A 2VQEQ 3SR1A 1SYEA 4JI6Q 3KDFB 4DUZQ 4Q0FA 3MFYA 1DOMA 1TS5A 2O5JC 2IX3A 3PO2B 4HCEA 5EKLA 4A3DH 2IHEA 1NE3A 3CC4A 4NPSA 4MHEA 1STAA 1TWHB 4HJ8A 2K03A 2O2LD 1RF2D 4DR6Q 3I4LA 2F3VA 3MEFA 2BA0A 1QJOA 1AZPA 2O4XA 4L8JA 2E2IH 2F4VQ 5A2QL 2BH2A 4DR6L 3I4NG 3S9WA 4GOPB 1E22A 1EQVA 3TZUA 3VR3A 3S1MB 1IL2A 1YNNC 4A3GB 4ODGA 3JAME 1STYA 1TWCH 3C1EA 4GLXA 2CHBD 2R7ZB 4G7HC 3C3LA 4JI7Q 5C3WA 4ZRZA 1MIUA 2HHHQ 2F0OA 2RSNA 3T16A 2J0TD 4NXMQ 2ZT9C 2MNAA 4JI6L 3OOCA 4IN3A 2VQEL 1ESRA 1O80A 1AN8A 1FJGL 1HA5A 4CJ1B 1Q8IA 3A0JA 2Q2TA 5C4XB 1B4OA 1SAPA 1V1PA 4A3IH 2IHFA 3CW2C 3K0XA 4LFBL 4LF8L 3A56A 1TU2B 2F52A 2NVQB 3J7A5 1DOKA 1QUQA 1CKNA 1FGUA 2UUBL 4OIJA 2SOBA 1ICFB 2CQOA 4LF6Q 1LACA 2Q2IA 4A3EG 2EXDA 2Q8RE 4XIGS 4C3HG 2VUMH 5DM63 4NKLA 4MNOA 2B2TA 3HOZH 2NZOA 2X6GA 2EZVA 2ZXOA 3NQTA 2CQAA 5EAYA 1MJEA 3CC7A 2M9VA 4KHVA 5CMDA 4A3FH 5COYA 1ENAA 2FMCA 1HNWQ 4QB4A 1IYVA 1E1TA 3GTQB 3K7UC 2EYPA 5C3EG 3PUYA 4QQBX 5KYIA 3HOVG 4K14A 2K50A 1CZGA 4KN4C 3BYYB 3HG9A 1ZKOA 3W3AA 1Z6HA 2NN6I 3S15B 4OL7A 2JA5G 4OELB 1LLRD 4LF7Q 4CBVA 2JA9A 1OXVA 1X56A 3FDTA 4PMBA 4GKJL 1VF5C 1ET9A 3URYA 2UUAL 2KECA 1TWHH 3TSSA 3KBXA 1EU4A 1A2TA 4C3HH 1U9RA 5IP7H 3MWYW 4DV2Q 1N32L 4RWSC 1BNZA 4BBRG 1VMCA 1HNXL 2PW7A 2BOSA 1OXSC 4JCVE 3EROA 5D3DA 1Q7YC 2R93H 4A3JH 3LGJA 1S72A 1VQIA 1VQAA 3PV0A 3T1YL 2VXWA 4J6HA 2RVLA 1Z7TA 1G6PA 5BN5A 4DAMA 4B9XA 2K05A 4CKCA 3F8TA 4DR7L 3GTJH 3UE1A 1B50A 1LT4D 2XSCA 3A55A 5LMNW 2K04A 1DZ1A 2WIIB 2R3ZA 4G7ZC 3MXUA 1EQTA 1G2SA 2CW0C 3QIAA 2EY6A 1WOCA 1PTOH 1YHBA 1VQGA 3MZ5A 3NEMA 1OXUA 5C44G 4DR2L 2KQ3A 3GP7A 2KCNA 1OTCA 1YNJD 1Q1EA 1VS0A 4IALA 4P71A 1K0SA 3S1NH 2DGYA 1I4GA 4HAEA 3OSOA 1K8GA 1STBA 2NVXH 3TRZA 4RGMA 1L1OC 4LF8Q 1JWMD 2ZTEA 1PHJA 2UXDL 3NK9A 3MA2B 1IBMQ 1I50B 4GKKQ 3L3OC 2R93B 2L15A 1UAPA 2F3IA 3KDFA 4NP5A 1YIJA 5IODA 3AFQA 1X3EA 4C3IB 2KCMA 3HKSA 3GO5A 3EBEA 3KF6A 3I4MH 4KHPL 3K8AA 4FF2A 2OT2A 3W1GA 1JOKA 2QCPX 2N3SA 4LUVA 3HOZB 2BDOA 3G6EA 1ASYA 3P75A 3PUVA 2IWHA 4PZ6A 2KOLA 1IBKQ 4JPBW 4G7OC 2F0QA 4DK0A 4JI3Q 3KF8A 1CA5A 3K5MA 3D3RA 1I3QB 4XYQA 1TXYA 1W2BA 3M7GA 2XWJB 5D3IB 3RUZA 4AH6A 4FF3A 4RHRA 2ASBA 3G6JB 3S1NB 2JSOA 3UE0A 1Y1WB 3C1FA 4MTKA 1EYCA 1XX8A 5JJLA 2K7VA 3H91A 4A3JB 4KKUA 5CV6A 2NVTH 1PH2A 3HOZG 2DNCA 3OWEB 3UDXA 3GTMH 5ELFA 4DV3L 1BCPF 1O7IA 1W6JA 5C6AA 4R4QA 1X32A 1ZEQX 3N52A 1A15A 5CGKA 4A3MH 4IFDH 4DV7Q 2A68C 2D5DA 2CVRA 4KJOA 1QB5D 2LS01 1DGSA 4JI1Q 1PZJD 4A3MG 3TP5A 3D4WA 4ILWA 1F77A 1QNKA 3PUXA 3PGZA 3DWAA 2Z0SA 2JA8H 3AB9A 4V0BA 2OEOA 1BUVT 2QEJC 4GNXA 1PZKD 4LF5L 2V1CC 1MSGA 1PRTC 4KD4A 5C4JH 1YJ9A 2LMCB 2VY3A 1H9KA 4F7XA 4DUYQ 4DK1A 5L37A 2EJGC 5ELEA 1Y1VG 4B3MQ 1K3RA 1LTID 2HUGA 1KAAA 3NUCA 3A8IE 2JEBI 5NUCA 2I5LX 5EJWA 2YU9H 3J80E 4GLAC 3JAMi 2OXPA 4B3RQ 2UXBQ 3V05A 5HURA 1HTLD 1X3PA 4DV5Q 5IGEA 1EZ8A 1SE4A 4NB3A 4EVOA 2L5TA 2CWPA 2F0VA 4ME5A 4RKLA 2ZJRA 4JI4L 4MZ9A 3P20A 2YTYA 3S2DB 3S17H 2K5QA 2K5WA 1TIID 2PO4A 2GVAA 2ZM6Q 3F1ZA 1UNSA 3JAMc 1VQLA 1CK1A
chains in the Genus database with same CATH topology
1JCKB 1A3VA 3GV3A 4ZKCB 5C0XI 3ZYYX 4EGVA 1RODA 3J7AV 1GOZA 3I70A 2SNMA 5J39A 4BY1B 5CR3A 1QOHA 4ULLA 1GUOA 1XXGA 2JE6I 1C48A 3PIP3 5EBCA 2PPBC 2F3WA 3Q24A 1LT6D 3MAQA 2NBFA 1BBXC 4AYBB 2SNSA 5I2YA 1U4MA 2DN8A 1ZYRD 3SEBA 4KY6A 3K57A 4FNFA 5G3LF 4C1NI 1RCVD 3SDZA 1WCMB 5M3FB 4B9WA 3ND9A 1SYCA 1MGSA 4IQZA 3NBHA 1EU3A 5CBEE 1EY8A 1G6ZA 3R2TA 3EFXD 4FVMA 5DNFA 2YU9B 1YNND 3IFTA 1PFNA 3GTMB 3BVZA 4J8QA 5E3FA 3VYSA 4LMQD 2D62A 4RAUC 1D1KA 1CHPD 1H9RA 3R3OA 5LHY1 3OMGA 4DN4M 3LNNA 1MBYA 3CHBD 4QUCA 1YNJC 1D2BA 3S1QB 2HCIA 2YYZA 4CHTB 2RDGA 2RA4A 4Y7NB 3NE5B 4QCLA 2KEEA 3WOFA 1FYCA 3KK7A 1BCPC 2LFNA 1GUWA 3D8GA 1DYQA 1LO5D 2DY7A 3U9SA 4OO1G 4C2MB 3BVGA 2JA6B 2K33A 3AU7A 1SFOB 2PZTA 4PV1C 4H13C 2MP1A 1TVXA 2XVSA 3D31A 3I72A 1BQQT 3V96A 2KEDA 2L11A 2M2LA 5LL6S 4K5VA 2DNEA 1ILQA 2WINB 1IW7D 1AW7A 2IT1A 5IOCA 2AUKA 3VR5A 1UUPA 3PIO3 3HGBA 1NR4A 1RTNA 4YIJA 1E0BA 1J9OA 4BA2I 3J80L 2PCFB 4DNTB 2F0FA 4BWGB 2XWBB 1OXXK 2A69C 2IW3A 2NTSA 3S1RB 4U673 4KV6A 5BN4A 1K8MA 1CT1D 2D9UA 2Z8LA 2Q8TA 3O13A 3T51B 5M5YB 1OXTA 1NR2A 4X3SA 3NTHA 4N9PA 1EIGA 1BDOA 2JA5B 5JAVA 2PZWA 3VYTA 3BVMA 2WAQB 2WACA 2NYZD 2NVXB 4CKBA 2A73B 4XYOA 3GTGB 3L7ZC 5IGCA 4C3JB 1SNCA 1LTAD 1EYAA 1L0YB 2F0SA 5JEAG 1B1ZA 4XQQA 1ZXTA 4O42A 1J8IA 3VR6A 3D4DA 3BZDB 3JAML 2K01A 1F9SA 1WTQA 1SSOA 1PYWD 2NB0A 4XXEA 1HFGA 3H09A 1QNUA 1I4HA 3TBIB 4TRDA 1CK1A 1KTKA 5FKAC 3NXWA 2A69D 1H9MA 3Q0AA 4PMCA 3W2DA 2F1MA 1JR0D 1I4PA 3VR2A 4N9TA 4XQJA 4R9WA 1KDCA 5CBAE 3A54A 1JQYD 2PZUA 1EY5A 4I7ZC 2F0GA 3QOJA 1QWYA 5M3MB 2AWNA 3E0JA 1HQRD 3SK5A 1DOLA 1Q90A 5KRUA 1QILA 1GHJA 3RLFA 3MVVA 2F0IA 3DWQA 3A8KE 1IW7C 1TWGB 4IUUA 1U4RA 1F2ZA 4KKTA 1RDPD 3X3NA 1B2TA 3NPPA 5C44B 3HS0C 2EYLA 1DM0B 4CKEA 3ONAB 1WVLA 3NP8A 2SDFA 2FJ2A 1M4VA 3X3MA 4G57A 1AEXA 1FNUA 2F0UA 4IUTA 2VUMB 2WKCA 3TN2A 2B2UA 2BE5D 1LV9A 3SXHA 2ENBA 1IYUA 4R8IA 1ENCA 1MI2A 2ZXRA 1ESFA 3UI2A 5A35A 1IHZA 5F2DA 2HDMA 2IL8A 5IIFA 2QILA 3NBIA 5C5MA 4KI0A 1LT3D 5FO8B 2FHTA 1D5MC 2XIWA 3MXNA 3NSWA 4L6TB 1ICWA 1TT2A 3T53B 5K36H 1D6EC 3EA6A 1FNWA 2NN6H 3GTOB 2X69A 2B8GA 3N6RA 1EY0A 1KDAA 2F0PA 1BR9A 5CV5A 1CA6A 2B2VC 5JPMC 1PTOC 3K7AB 1CFMA 4IUVA 5EKIA 3H94A 2K1BA 1SYGA 1O7LA 3K5NA 5IGGA 4CGYB 2A6HD 1F2MA 2N55A 1JICA 4K5WA 3FPPA 2A6EC 1E2VA 3HOWB 4QMGA 2G9HD 1F2YA 5C4JB 3DEPA 3LWEA 3NWTA 4FXGC 1ILPA 3S16B 2XNAC 2F0JA 3V2TA 4WRDA 5KNCA 3BDCA 1H9JA 5T1IA 1TS2A 2N88A 3KLSX 3DUZA 1HQMC 4A3BB 3CKIB 5FO7B 1PFBA 5CV4A 4RCOA 1HRJA 2K6AA 3NTIA 5E4WC 2AQ2B 3HRZC 1CM9A 5ELDA 1F9PA 3C46A 4DXFA 1JWUD 4TQUS 2EYJA 2R92B 1CI3M 1KLGD 4ABNA 1KNEA 5JOBA 1KDBA 2F0NA 3HOUB 5KGUA 3I4MB 1Y1VB 4M8AA 3FPUB 2L0CA 1H9SA 4WJWA 1ONLA 3MC0B 4RGTA 1SMYD 1PRTF 2OF1A 2EVBA 2FINB 5C3XA 4ZYSA 2B39A 2PQEA 2KUMA 5G3LD 4HCSA 4X3TA 2KJXA 3OMCA 1I4RA 1OO9B 1BCPB 2XRQD 4OIKA 2MHVA 5CORA 5C5LA 2JXMB 5FLXL 2RQXA 1PLFA 4DAVA 1V8QA 4TSSA 2BE5C 2CW0D 1WTWA 1LTTD 5EQ0A 3OIQA 1G91A 3SK4A 1PRTB 1ENFA 5ELBA 2EYMA 3TP7A 3I4NB 1D5XC 3SK6A 2F0HA 3BDLA 4RFBA 5M5XB 2J4XA 5FOBB 1PDQA 4FF1A 5E1FA 4ZUIA 2JA8B 2MJ8A 1PTOF 5IT9E 1PFMA 1PXUA 2ID0A 2ZXPA 3J81L 3DMUA 2Z4HA 4A3MB 4RCNA 4FXDA 3QB3A 3MFGA 4P2CB 2IX1A 2EE1A 3M4OB 1SE3A 1V1OA 1SJED 5CV7A 1E2WA 1SJHD 2B2YA 2RKSA 4A93B 1SXTA 4FF4A 1SNDA 5EPJA 1KLUD 1ET6A 2NUCA 1MD2D 2QKIC 3QJYA 4EQNA 5K5PA 1SDFA 1G291 1SNQA 4M1UB 3H0GB 2B2WC 1B9NA 5JPNC 4LK1C 2WV6D 1TWCB 2XN9C 4KY7A 2EY5A 5ELCA 3L9AX 4ZLTF 1U4LA 1HTPA 3J7YW 4A3IB 5C4HA 4OHJA 1F9QA 3IAYA 1RKNA 2A68D 2XRSD 4KMUC 1HUMA 1S5BD 1KABA 3TDQA 5JVG3 2E75C 3VYUA 5CV9A 2JP1A 5BN3A 4XQNA 1I6VC 4UAIA 4IURA 4B08A 4QUFA 5EBDA 5M9OA 4MIUA 1EY7A 4C3IG 1WTXA 1Y69U 2KA7A 2JA7B 4OO1H 2L12A 4XDXA 4IFDI 2IPKD 3S2HB 4C56C 4K2LA 1RHPA 4BBSB 5DEHA 2M00A 4C3HB 3OWFA 1WTRA 4HR7B 2B8FA 3K6OA 3BYTB 1GUTA 2E2DC 3CQZB 1Y8OB 3DEOA 4RHSA 4BY7B 3FEWX 3IKJA 1HXYD 5I2XA 5IGBA 2EDGA 2I07B 1LABA 5EPKA 1STGA 1GUGA 2EY1A 2HDLA 3GV6A 4DNRB 3HOVB 4MN3A 3I8ZA 2E2HB 2F0EA 1QCBD 1SE2A 4C1NK 1F9RA 3KUPA 4J1MA 2C5CA 1FR3A 3TZDA 3J81E 4IZ8A 1VF7A 4Q5VA 1DJRD 3KLSA 1O7ZA 1DONA 1PRTD 4IFDJ 1II3A 2MPMA 1LTGD 1STEA 5D14A 1XYIA 2PNRC 1ML0D 1JB3A 1X3QA 3RZDB 5ISRA 3ND8A 2ICEC 5CYUA 3SK8A 3R8BA 1C4QA 1V43A 3FRPB 4LAAA 4WFN3 2F0WA 3SHLA 3RZOB 2A6ED 3SE0A 3HEJA 1S5ED 1WTOA 2Q8IB 2EXZA 2NVYB 3NWSA 2BA1A 4RGOS 4A3KB 4IUNA 2WP8J 2R6GA 2KCCA 3A7LA 1IKMA 5JVH3 3T13A 2K5DA 4QIWB 4RH6A 4V190 4U68A 1S4ZA 1CHQD 4RA8A 4ID6A 1TQOA 2KVMA 1HPCA 2F0MA 4G4KA 2R61A 5LL6X 2WKDA 4K5XA 1SYBA 2RDFA 1HA6A 4JBWA 4FYDA 1O7YA 2H4OA 1Z47A 3EJIA 1FD7D 1GHKA 1U4PA 2MGSA 2F0TA 3NHHA 1A3UA 4BA1I 1NAPA 5A2QE 1UEAB 1PTOD 1EEID 1DCZA 4PMWA 3EQLC 4DU9A 1AFPA 3OHXC 3WOEA 1W6KA 2JYOA 1LTSD 1S5DD 1T5EA 4DFAA 4IUPA 1EWHA 5I4DA 2E76C 4ZAIA 2X6LA 4DAYA 4K2KA 2Z1CA 1TWAB 4H44C 3I73A 4DGZA 2TMPA 3IL8A 5HGTA 3S17B 1I6HB 2RBMA 1HHVA 2EJFC 2TSSA 4WORA 4DXGA 4R8NA 3A8JE 1O78A 4XTCS 3K58A 3FMCA 4BS9A 4K6LA 1TY0A 2GA4B 3KBGA 5C4ZA 4IFDG 4PQXA 5JJZA 4K8JA 1B3AA 3QWNA 1L0XB 4CJ0B 3R93A 3DM1A 3R2IA 1SNPA 1STNA 4LJZC 5FO9B 2PMZB 1EY9A 5AFWA 3Q6SA 5KIXA 1K8OA 1T5XD 3HZXA 3GTKB 2HQEA 3BS1A 3SVMA 1NCVA 5C0XG 3BDOA 1AZQA 1S5FD 4UDUC 1NSNS 4NW2A 4E6IA 3RMHA 1QG7A 2VB3X 4EQOA 3HOXB 5CC4A 2O5IC 1R4PB 4A3EB 2RDHA 3M85A 4H0LC 4BBRB 1DXMA 2F03A 2HCCA 5I9PA 3P7JA 2NWGA 3KLRA 4NDXA 5T1GA 2EOTA 5IGFA 3GD7A 1XWEA 1TKWB 5KNDA 1RTOA 4KY5A 1R9TB 1JORA 3BG3A 2F0KA 3QOLA 3GTPB 2AWOA 4H7BA 1JOOA 2H1EA 1VCIA 2J7ZA 5CV8A 3J7AF 3LX0A 1CZWA 1HFNA 3CRLC 4ZUJA 1K83B 3DXJC 1GJXA 5D65A 4XT3B 3GQBA 1S5CD 2F4IA 3RD4A 4F87A 5KNBA 3IFDA 3T56B 3I91A 1I4XA 1Q3LA 1BCPD 5JEAJ 3AMUA 2ICIA 1SYDA 3H6MA 3QO2A 3K0YA 3PUWA 5E4XA 2NVTB 2B63B 2EYFA 2E74C 1IKLA 2IX0A 1AP0A 2PW5A 1A3TA 1B44D 5EGTA 4JK1C 1Q12A 1WD1A 5EPLA 1F2LA 4KN7C 2F0DA 3CRKC 2G9DA 1STHA 5DAUA 1Y8PB 2BCOA 5J22A 1D1IA 2EYOA 1EY6A 1G8ZD 2EPBA 3E6ZX 2AUJD 1PMRA 4KJNA 4TKOB 1CQFA 2K28A 1EZ6A 2AQ3B 1PTOB 5M5WB 2QF7A 4PNYA 1KNAA 3S14B 4HMJA 5IT9L 1V1PB 4QF4A 3Q22A 3GTJB 4ZKBB 4IUQA 1TS3A 4DAPA 3E5SA 3OIPA 1B9MA 2V4DA 3K5LA 3MXPA 3OPOA 5TSSA 4NMZA 4DF7A 1GUSA 1VDZA 2VNUD 2D2CC 1Y8NB 4ZQ3A 2IJ0A 3M3YB 4KK7A 5I6WA 2JEAI 3F2UA 2A6HC 3NTKA 1PZID 2AQ1B 3TP8A 1EOTA 1RD9D 3U9OA 3DHQA 3PO3B 1IL8A 1BO0A 4DA2A 3P1HA 2C9OA 5J1ZA 3EVQA 2MUYA 2E2IB 1SYFA 4HEDA 3HOYB 2VB2X 3I3CA 1RJTA 1BXTA 3D6CA 1BF4A 1WTVA 4KHZA 5FK9C 1FNVA 1H9SB 3A7AB 3C2PA 3D6WA 4C3JG 3G7LA 3M7NA 3K5OA 4K6DA 2I46A 2LY7A 3VA5A 4I65A 3MEHA 1WD0A 4FP5D 2NZ1D 3FVQA 1QE6A 3DWPA 4A3FB 1GXDC 3VYRA 1TR5A 3T4AC 1DD2A 2A74C 1TS4A 2Y0SB 4ZK9B 1SNOA 3LWUA 4KTAA 4S3SA 4GZYC 2B2WA 1EFID 3MXGA 1A6XA 4X3UA 1EL0A 4KKSA 1JE4A 1TWFB 2B2TC 5JEAH 3WDNA 5KYLA 2SEBD 2QDBA 4XT1B 1M8AA 4EQPA 1LT5D 4KD3A 2B2VA 1ZYRC 4HTHA 1E2ZA 1EWCA 4HMIA 3PUZA 3FKIB 4X3KA 3GTLB 1SNMA 2A5HA 2BDNA 3HP3A 4F88A 2L1BA 2L55A 2B2YC 3M4YA 5I6YA 3HKZB 2L4NA 1XTCD 4CJ2C 3QG1A 1EIHA 4O1NA 5DM73 1I4QA 1SEBD 2LKVA 1JWSD 3OW7A 4OO1I 5C0XH 5KEEA 1G2TA 1LTRD 2B2UC 3TMEA 2KHSA 4HSPA 2F0LA 3D4RA 1A2UA 3Q23A 4A3DB 3ITPA 1HCZA 3MHBA 4OGQC 3ERQA 2K32A 2RSOA 3VA7A 4L63B 5C0XJ 4Z9CB 3K59A 5EKKA 5IGDA 1SBBB 1NUCA 1SMYC 1R4QB 5C3EB 1TY2A 2FMMA 1JC7A 1B53A 2EJMA 1MSHA 3NQIA 2PYKA 1C8CA 1FGBD 3MTSA 2FFKB 3I90A 1D5ZC 1VMPA 4RGNA 2NTTA 3H3VC 4FO2A 4RKBA 4HSVA 1JOQA 4K8IA 4F8MA 1EYDA 3CU7A 2NN6G 1BOSA 1WTPA 2EYHA 3PMFA 5I9OA 2Z4IA 5K36G 1Q1BA 1CQVA 1CTMA 3VR4A 2L9HA 1EEFD 4HN7A 2EY2A 1HUNA 1GUNA 2E2JB 2DY8A 2WB1B 1LTBD 4FXKC 3TP6A 1EY4A 3SR1A 1SYEA 4Q0FA 3MFYA 1DOMA 1TS5A 2O5JC 2IX3A 3PO2B 4HCEA 5EKLA 4MHEA 1STAA 1TWHB 2K03A 2O2LD 1RF2D 3I4LA 2F3VA 2BA0A 1QJOA 1AZPA 2O4XA 4L8JA 5A2QL 3S9WA 1EQVA 3TZUA 3VR3A 3S1MB 4A3GB 1YNNC 4ODGA 3JAME 1STYA 3C1EA 2CHBD 2R7ZB 4G7HC 3C3LA 5C3WA 4ZRZA 2F0OA 2RSNA 3T16A 2J0TD 2ZT9C 3OOCA 4IN3A 1ESRA 1O80A 1AN8A 1HA5A 4CJ1B 1Q8IA 5C4XB 1B4OA 1SAPA 1V1PA 3A56A 1TU2B 2NVQB 1DOKA 4OIJA 2SOBA 1LACA 2Q8RE 4XIGS 4C3HG 5DM63 4NKLA 2B2TA 2X6GA 2EZVA 2ZXOA 3NQTA 2CQAA 2M9VA 4KHVA 5CMDA 5COYA 1ENAA 2FMCA 4QB4A 1IYVA 3GTQB 2EYPA 3PUYA 5KYIA 4K14A 1CZGA 4KN4C 3BYYB 3HG9A 1ZKOA 3W3AA 1Z6HA 2NN6I 3S15B 4OL7A 1LLRD 4CBVA 1OXVA 3FDTA 4PMBA 1VF5C 1ET9A 3URYA 2KECA 3TSSA 3KBXA 1EU4A 1A2TA 1U9RA 3MWYW 4RWSC 1BNZA 1VMCA 2PW7A 2BOSA 1OXSC 5D3DA 3EROA 3PV0A 2VXWA 4J6HA 2RVLA 1Z7TA 5BN5A 4B9XA 2K05A 4CKCA 1B50A 1LT4D 2XSCA 3A55A 2K04A 1DZ1A 2WIIB 2R3ZA 4G7ZC 3MXUA 1EQTA 1G2SA 2CW0C 3QIAA 2EY6A 1PTOH 3MZ5A 1OXUA 2KQ3A 3GP7A 2KCNA 1YNJD 1Q1EA 4IALA 1I4GA 4HAEA 3OSOA 1STBA 4RGMA 1JWMD 3NK9A 3MA2B 1I50B 3L3OC 2R93B 1UAPA 4NP5A 5IODA 4C3IB 3GO5A 4FF2A 2OT2A 1JOKA 2QCPX 3HOZB 2BDOA 3P75A 3PUVA 2IWHA 2KOLA 4G7OC 2F0QA 4DK0A 3KF8A 1CA5A 3K5MA 3D3RA 1I3QB 4XYQA 3M7GA 2XWJB 5D3IB 3RUZA 4FF3A 4RHRA 3G6JB 3S1NB 2JSOA 1Y1WB 3C1FA 1EYCA 1XX8A 2K7VA 3H91A 4A3JB 4KKUA 5CV6A 2DNCA 3OWEB 5ELFA 1BCPF 1W6JA 5C6AA 1X32A 1ZEQX 3N52A 1A15A 5CGKA 4IFDH 2A68C 2D5DA 2CVRA 4KJOA 1QB5D 2LS01 1PZJD 3TP5A 3D4WA 4ILWA 1F77A 1QNKA 3PUXA 3DWAA 3AB9A 4V0BA 2OEOA 1BUVT 2QEJC 1PZKD 1MSGA 1PRTC 4KD4A 2LMCB 1H9KA 4F7XA 4DK1A 2EJGC 5ELEA 1LTID 2HUGA 1KAAA 3NUCA 3A8IE 2JEBI 5NUCA 5EJWA 3J80E 2OXPA 3V05A 5HURA 1HTLD 1X3PA 5IGEA 1EZ8A 1SE4A 4EVOA 2L5TA 2F0VA 4ME5A 4RKLA 3P20A 3S2DB 2K5QA 2K5WA 1TIID 2PO4A 1UNSA 5FLXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWS D;  2WV6 D;  1BCP C;  1JCK B;  2G9H D;  5FK9 C;  3BVM A;  4TSS A;  1TS5 A;  3BYY B;  1T5X D;  2XN9 C;  2R61 A;  1DYQ A;  1B44 D;  1FNV A;  1LO5 D;  1LTT D;  1M4V A;  1PRT B;  1LTR D;  1FNU A;  1LLR D;  1GOZ A;  1ENF A;  1SE2 A;  3BVG A;  5ELC A;  1S5F D;  4UDU C;  5ELB A;  1ET9 A;  2XNA C;  4OHJ A;  1D5X C;  3URY A;  1XXG A;  3TSS A;  2O2L D;  1RF2 D;  1EU4 A;  1FD7 D;  1LTA D;  4RFB A;  1L0Y B;  4L63 B;  2J4X A;  1DJR D;  2XRS D;  5D3I B;  2RDH A;  4Z9C B;  1B1Z A;  1G8Z D;  4RHR A;  1TS2 A;  1PTO D;  1EEI D;  1LT6 D;  1SBB B;  1PRT D;  1ESF A;  3KLS X;  2AQ3 B;  1PTO B;  1TY2 A;  1S5B D;  3BZD B;  3DWP A;  5D3D A;  1PTO F;  1AW7 A;  1LTS D;  1S5D D;  2CHB D;  1LTG D;  2QIL A;  1STE A;  4RCO A;  3SEB A;  3OWE B;  1V1P B;  1PYW D;  1UUP A;  1TS4 A;  5ELF A;  1BCP F;  1LT3 D;  5I4D A;  1FGB D;  2AQ2 B;  5ELD A;  1D5M C;  1TS3 A;  1EFI D;  1I4H A;  4DXF A;  1JWU D;  1RCV D;  4L6T B;  1AN8 A;  1KTK A;  1HA5 A;  5FKA C;  1LT4 D;  1D6E C;  3R8B A;  1PZJ D;  1D5Z C;  3EA6 A;  2NTT A;  1KLG D;  3MFG A;  4RGN A;  2SEB D;  1F77 A;  3W2D A;  1FNW A;  1JR0 D;  1I4P A;  2IPK D;  1V1P A;  5TSS A;  1SE3 A;  1V1O A;  2TSS A;  3DWA A;  1EU3 A;  1LT5 D;  1PTO H;  4C56 C;  4DXG A;  2QEJ C;  1SJE D;  1PZK D;  1EWC A;  1S5E D;  1SJH D;  4BWG B;  2IJ0 A;  1JQY D;  3R2T A;  1PRT C;  1SXT A;  3EFX D;  3GP7 A;  2NTS A;  4RGO S;  3BVZ A;  1PZI D;  1PTO C;  2AQ1 B;  1TY0 A;  4K6L A;  1KLU D;  1HQR D;  1S5C D;  5ELE A;  1CQV A;  1LTI D;  1RD9 D;  1I4G A;  1ET6 A;  1QIL A;  3MC0 B;  1CT1 D;  3BYT B;  1MD2 D;  4RGT A;  1L0X B;  1CHP D;  1XTC D;  2Z8L A;  4RGM A;  1PRT F;  3O13 A;  1JWM D;  3V05 A;  1EEF D;  4RHS A;  1HTL D;  3R2I A;  3CHB D;  3DWQ A;  4ZYS A;  1I4X A;  4RH6 A;  1BCP D;  1SE4 A;  2ICI A;  1RDP D;  1HXY D;  1LTB D;  2RDG A;  1I4R A;  4O1N A;  1BCP B;  1CHQ D;  1UNS A;  1BXT A;  1I4Q A;  1SEB D;  2XRQ D;  1CK1 A; 
#chains in the Genus database with same CATH topology
 4DAY B;  1JCK B;  1EOV A;  3HKZ G;  1SRU A;  1A3V A;  3GV3 A;  4ZKC B;  5C0X I;  3ZYY X;  3RR5 A;  4UP9 A;  4EGV A;  1ROD A;  4HJA A;  3J7A V;  1KXL A;  1GOZ A;  3I70 A;  2SNM A;  1YNX A;  2ATW A;  1XPR A;  4HJ5 A;  5J39 A;  4BY1 B;  5CR3 A;  1QOH A;  4ULL A;  1GUO A;  1XXG A;  2JE6 I;  1C48 A;  3PIP 3;  5EBC A;  2PPB C;  4DR3 Q;  2F3W A;  3Q24 A;  3CME A;  1LT6 D;  3MAQ A;  2NBF A;  1BBX C;  4AYB B;  1EIY B;  3T1H Q;  2N49 A;  2SNS A;  5I2Y A;  2PNH A;  1A0I A;  1U4M A;  1C0A A;  2DN8 A;  1ZYR D;  3SEB A;  1M1K C;  2CKZ B;  4KY6 A;  3K57 A;  3ERS X;  5GAG C;  4FNF A;  2JJQ A;  5G3L F;  1CKO A;  1S40 A;  1NNX A;  1ASZ A;  3HOY H;  2LSS A;  4C1N I;  1RCV D;  3SDZ A;  1WCM B;  5GQO A;  5M3F B;  1VQO A;  3HFZ B;  3CQZ H;  4B9W A;  2HIV A;  3ND9 A;  1SYC A;  4IOC A;  4JBM A;  3IRB A;  1MGS A;  4IQZ A;  4YY3 Q;  3NBH A;  4A3B H;  1EU3 A;  4RG1 A;  1HH2 P;  5CBE E;  5BR8 Q;  1EY8 A;  1G6Z A;  4A3J G;  1I94 L;  3R2T A;  1HZC A;  3EFX D;  1QZG A;  1GM5 A;  4JYA L;  2KHJ A;  4FVM A;  5DNF A;  2YU9 B;  1N34 L;  1YNN D;  3IFT A;  1PFN A;  5E7N A;  4JI5 Q;  3GTM B;  4DUY L;  3BVZ A;  4BBR H;  1VQ6 A;  4J8Q A;  4DV2 L;  3A5Z B;  5E3F A;  3VYS A;  4BY1 H;  4LMQ D;  2D62 A;  4RAU C;  3U50 C;  1D1K A;  1CHP D;  1H9R A;  3R3O A;  5LHY 1;  3OMG A;  4DN4 M;  1PH6 A;  4OWT B;  3LNN A;  1MBY A;  3CHB D;  4DV6 Q;  4QGU A;  2FXQ A;  1YNJ C;  4QUC A;  3RNU A;  4GOP A;  1D2B A;  3S1Q B;  4X66 Q;  2HCI A;  2YYZ A;  4CHT B;  1T9H A;  2RDG A;  1VQP A;  2RA4 A;  4BXX G;  4Y7N B;  3S2D H;  3J7Z C;  3NE5 B;  4QCL A;  2KEE A;  3WOF A;  1D7Q A;  4LUO A;  4DR4 Q;  4OEM B;  1FYC A;  3KK7 A;  1BCP C;  2QA4 A;  2A8V A;  2LFN A;  3I2Z A;  1GUW A;  3D8G A;  1DYQ A;  1LO5 D;  2DY7 A;  3U9S A;  4JI7 L;  4OO1 G;  2YTV A;  4DV5 L;  4C2M B;  5FLM H;  3BVG A;  4C3I H;  2ZJQ A;  1VQC A;  2JA6 B;  1Q86 C;  2K33 A;  4OON A;  2VS1 A;  3AU7 A;  3WWV A;  1SFO B;  4YCU A;  3AEV A;  1KAW A;  2PZT A;  3FP9 A;  4PV1 C;  4H13 C;  3NEN A;  2MP1 A;  4HID A;  1TVX A;  1IXR A;  2XVS A;  3D31 A;  5ELO A;  3I72 A;  1BQQ T;  3V96 A;  4BY7 H;  2KED A;  2L11 A;  2M2L A;  2ZJP A;  1NBW A;  5LL6 S;  4K5V A;  2DNE A;  4P73 A;  1ILQ A;  4UP7 A;  2WIN B;  2GN5 A;  1IW7 D;  1AW7 A;  2IT1 A;  5IOC A;  3KFU A;  4X65 Q;  2AUK A;  3BJU A;  4PG3 A;  3VR5 A;  4IJL A;  1K0R A;  1UUP A;  1KL9 A;  1A8V A;  3PIO 3;  3HGB A;  3CD6 A;  1NR4 A;  1RTN A;  3AYH B;  1UE5 A;  2A19 A;  4YIJ A;  4DNI A;  1E0B A;  1J9O A;  2UXC Q;  2HHH L;  3ER0 A;  1XPO A;  4BA2 I;  3J80 L;  1VQN A;  3W1B A;  3GTL H;  3G48 A;  3J81 j;  2PCF B;  4DNT B;  2F0F A;  4UHV A;  4BWG B;  2XWB B;  1OXX K;  2A69 C;  5FJ8 G;  2IW3 A;  2NTS A;  3S1R B;  4U67 3;  1RIP A;  4J15 A;  4KV6 A;  3W5O A;  1N34 Q;  5BN4 A;  2DUD A;  4JYA Q;  1VQ4 A;  1K8M A;  1CT1 D;  1L0W A;  2D9U A;  2Z8L A;  3H0G H;  2Q8T A;  5IYB G;  3O13 A;  3STB C;  3T51 B;  3JC6 6;  2NZH A;  5M5Y B;  1OXT A;  1CSP A;  4R4O A;  1NR2 A;  4X3S A;  3NTH A;  4N9P A;  1JJ2 A;  3DLL A;  2JA6 G;  4YCV A;  1EIG A;  3PCO B;  1BDO A;  2PQA B;  2JA5 B;  4YWK A;  4UY8 C;  1YEZ A;  4GKK L;  4AYB G;  5JAV A;  1X9N A;  1HZ9 A;  1V9P A;  2PZW A;  3BVM A;  3VYT A;  4HIO A;  2WAQ B;  2WAC A;  5GAH C;  2NYZ D;  3CPW A;  2NVX B;  1Q46 A;  3ICE A;  4CKB A;  2A73 B;  5IYB H;  4XYO A;  3GTG B;  3EIV A;  3L7Z C;  5DLQ E;  5IGC A;  4C3J B;  1SNC A;  4UP8 A;  1LTA D;  1EYA A;  1L0Y B;  2F0S A;  5JEA G;  1KHI A;  3NEL A;  3CAM A;  4LF4 L;  1B1Z A;  4XQQ A;  5HGQ A;  1ZXT A;  4O42 A;  1J8I A;  1I94 Q;  3VR6 A;  1WFQ A;  3D4D A;  3BZD B;  4LF7 L;  3JAM L;  4A4I A;  2K01 A;  1N33 Q;  1F9S A;  1WTQ A;  1SSO A;  1PYW D;  2NB0 A;  3M9B A;  4XXE A;  1HFG A;  3H09 A;  1WCM G;  3L2P A;  1QNU A;  1I4H A;  2NVQ H;  3TBI B;  2I0Q A;  1HNW L;  3CCJ A;  4TRD A;  1VQD A;  1KTK A;  4OWX B;  5FKA C;  3BU2 A;  4L5Q A;  4A3E H;  3NXW A;  2A69 D;  1BVS A;  1H9M A;  1SN8 A;  3Q0A A;  4GNX B;  4DK3 C;  4PMC A;  3W2D A;  2F1M A;  4A3L H;  1JR0 D;  1I4P A;  1PFS A;  4EQ5 A;  1YIT A;  1PVO A;  3VR2 A;  4N9T A;  4XQJ A;  3G4S A;  4R9W A;  4LWC A;  1KDC A;  3K81 C;  4A3G G;  5CBA E;  3A54 A;  1JQY D;  2PZU A;  4B3T L;  1EY5 A;  4I7Z C;  3HOU H;  2F0G A;  1UE6 A;  1CKM A;  4YHH L;  3QOJ A;  1XMQ L;  4LF4 Q;  1QWY A;  5M3M B;  1N32 Q;  2AWN A;  2I5M X;  2CCZ A;  3E0J A;  1HQR D;  4R1J A;  3SK5 A;  1DOL A;  1Q90 A;  5KRU A;  3RN2 A;  1QIL A;  4BBS G;  4LF5 Q;  1GHJ A;  3RLF A;  1I3Q H;  3MVV A;  5IWA Q;  4A93 H;  2F0I A;  3DWQ A;  3A8K E;  1IW7 C;  1TWG B;  4IUU A;  1U4R A;  5C4X G;  1F2Z A;  4KKT A;  1RDP D;  3X3N A;  1B2T A;  1JT8 A;  3AQQ A;  3NPP A;  2UXC L;  5C44 B;  3HS0 C;  3I4N H;  2EYL A;  1DM0 B;  4CKE A;  4DV7 L;  4HJ7 A;  3ONA B;  1UE1 A;  1WVL A;  3NP8 A;  2SDF A;  2FJ2 A;  1HNZ L;  1YBY A;  4A76 A;  1M4V A;  3X3M A;  4G57 A;  1AEX A;  1FNU A;  1Q82 C;  2F0U A;  4IUT A;  2VUM B;  4DKA C;  1IZ6 A;  2WKC A;  3TN2 A;  2B2U A;  2BE5 D;  1LV9 A;  4O0A A;  4EX5 A;  1JJG A;  3SXH A;  2K75 A;  2ENB A;  1IYU A;  4R8I A;  1ENC A;  1UWV A;  1MI2 A;  2ZXR A;  1ESF A;  3UI2 A;  5A35 A;  1IHZ A;  5IY0 A;  1YHQ A;  3E0E A;  4ZCK A;  1NMF A;  4LFB Q;  5F2D A;  3OTO L;  2HDM A;  2IL8 A;  5IIF A;  2QIL A;  3NBI A;  1U5K A;  1QVF A;  4QIW E;  5C5M A;  4KI0 A;  4X64 L;  1LT3 D;  5FO8 B;  5C3E H;  2FHT A;  1D5M C;  1YZ6 A;  3UDG A;  3CXC A;  4DV0 Q;  2XIW A;  3I55 A;  3MXN A;  3NSW A;  4L6T B;  1ICW A;  1TT2 A;  1NTG A;  3T53 B;  3E9H A;  5K36 H;  1D6E C;  2OTJ A;  3EA6 A;  4LW1 A;  1FNW A;  2N8N A;  2NN6 H;  4GN3 B;  3GTO B;  2X69 A;  2B8G A;  3N6R A;  5IYC G;  1EY0 A;  1KDA A;  2F0P A;  3H3V H;  1BR9 A;  5CV5 A;  5JJK A;  2E5L Q;  1CA6 A;  3D0F A;  2B2V C;  5JPM C;  1KIX A;  1PTO C;  3K7A B;  1CFM A;  4IUV A;  5EKI A;  3H94 A;  2UUC L;  2JA6 H;  1VQB A;  2K1B A;  4R4I A;  1SYG A;  3GTK H;  1O7L A;  4APV A;  1PYS B;  3K5N A;  4A3I G;  5IGG A;  3CCV A;  3F2D A;  2VW9 A;  4CGY B;  2A6H D;  1F2M A;  2N55 A;  1VQ8 A;  1JIC A;  4K5W A;  3FPP A;  2CH4 A;  2A6E C;  1E2V A;  4JOI A;  3HOW B;  4QMG A;  5H1S E;  1IBM L;  2G9H D;  1F2Y A;  3T1Y Q;  3U4Z A;  3UDF A;  5C4J B;  3DEP A;  3LWE A;  3TRE A;  3NWT A;  4FXG C;  1ILP A;  3S16 B;  1HNX Q;  2XNA C;  2F0J A;  3V2T A;  4B3S L;  4WRD A;  1WYD A;  2MQH A;  1Y1V H;  5KNC A;  3ULP A;  1SRO A;  3BDC A;  4X62 L;  1R9T H;  1H9J A;  5T1I A;  3A5U A;  4BXX H;  1TS2 A;  2N88 A;  4B3S Q;  1K73 C;  3KLS X;  1EFW A;  3DUZ A;  1HQM C;  4A3B B;  3CKI B;  5FO7 B;  1I6H H;  1PFB A;  2WAQ E;  5CV4 A;  4RCO A;  1HRJ A;  2K6A A;  3NTI A;  3GDE A;  4BY1 G;  5E4W C;  2AQ2 B;  4FDB A;  5M5X H;  3HRZ C;  1CM9 A;  5ELD A;  3J81 i;  1F9P A;  1CSQ A;  5IYD G;  3C46 A;  2ZM6 L;  4DXF A;  1JWU D;  4TQU S;  2EYJ A;  2R92 B;  2AMC B;  1CI3 M;  1KLG D;  4ABN A;  1KNE A;  5JOB A;  1X65 A;  3H0G G;  1KDB A;  5GAE C;  2F0N A;  4JVZ A;  2K5N A;  2Z9H A;  2R7Z H;  1MJC A;  5LMN L;  3HOU B;  1X54 A;  5KGU A;  4IPG A;  3I4M B;  1Y1V B;  4M8A A;  3HOX G;  1Q81 C;  3K7A H;  3FPU B;  2L0C A;  4QJF A;  4HJ9 A;  2UUA Q;  1H9S A;  4WJW A;  1ONL A;  3MC0 B;  4A93 G;  5M3F G;  4RGT A;  2Y0S E;  1SMY D;  3E3X A;  1PRT F;  1WTH A;  1BBU A;  2OF1 A;  2EVB A;  2FIN B;  4ZYS A;  5C3X A;  2KCT A;  2B39 A;  2PQE A;  2KUM A;  2RF4 A;  4GN5 A;  4JOI C;  5G3L D;  4HCS A;  4X3T A;  3RZO H;  2KJX A;  3OMC A;  1K9M C;  1I4R A;  4QY7 A;  1OO9 B;  1C7Y A;  1BCP B;  3CF5 A;  2XRQ D;  2KHI A;  4X6A H;  4OIK A;  2MHV A;  5COR A;  5C5L A;  2JXM B;  5FLX L;  2RQX A;  1PLF A;  4DAV A;  1V8Q A;  2E2H H;  4TSS A;  2BE5 C;  2CW0 D;  1WTW A;  1LTT D;  5EQ0 A;  3OIQ A;  4KLK A;  3SK4 A;  1G91 A;  1PRT B;  3BZC A;  1ENF A;  3J80 c;  5ELB A;  1VQ9 A;  2EYM A;  3TP7 A;  3I4N B;  1D5X C;  3SK6 A;  4A3B G;  1TWA H;  1YI2 A;  4B3M L;  1Y1W G;  2F0H A;  2NVY H;  3BDL A;  4IOA A;  4RFB A;  1VQF A;  4GOP C;  5M5X B;  2J4X A;  5FOB B;  1QZH A;  1PDQ A;  2HT1 A;  4FF1 A;  5E1F A;  4ZUI A;  4GN4 B;  4DV1 L;  1PA6 A;  2JA8 B;  2MJ8 A;  4DK6 C;  1PTO F;  3BZK A;  5IT9 E;  1PFM A;  1PXU A;  2LXJ A;  2ID0 A;  2ZXP A;  3J81 L;  3DMU A;  2Z4H A;  4A3M B;  4DR1 L;  4RCN A;  4JI0 L;  4FXD A;  2MO0 A;  3CMA A;  3QB3 A;  3MFG A;  1X3G A;  4A3C H;  4P2C B;  2IX1 A;  2EE1 A;  2JA7 H;  3M4O B;  1SE3 A;  1V1O A;  1XNR Q;  1C9O A;  5IWA L;  2VL6 A;  2RHS B;  1SJE D;  1MKH A;  5CV7 A;  1E2W A;  1SJH D;  2B2Y A;  2RKS A;  4A93 B;  4DV1 Q;  1SXT A;  4CDE C;  2KEN A;  4LFC L;  4FF4 A;  3GTO H;  1SND A;  5EPJ A;  1KLU D;  1LM0 A;  5IE8 A;  3M4O H;  1ET6 A;  2NUC A;  1S3O A;  1MD2 D;  2YTX A;  2QKI C;  3QJY A;  4EQN A;  1PYB A;  1LUZ A;  1QVG A;  5K5P A;  1SDF A;  5FLM G;  1G29 1;  1HNZ Q;  1SNQ A;  2N78 A;  4M1U B;  3H0G B;  1N36 L;  3HOY G;  2B2W C;  2HQL A;  2EIF A;  4A75 A;  2Z6B A;  5HY6 A;  1VQM A;  1B9N A;  5JPN C;  3EN2 A;  1P8L A;  1VQH A;  2VZA A;  3Q8D A;  1E1O A;  4L5R C;  4LK1 C;  2WV6 D;  4A3F G;  4AQY Q;  3S1R H;  1TWC B;  2XN9 C;  4KY7 A;  5IP9 H;  1N33 L;  4CDC C;  2R7D A;  3ZJY C;  4QL5 A;  2EY5 A;  1XMO Q;  5ELC A;  3CCM A;  3L9A X;  4ZLT F;  2P5Z X;  1U4L A;  5AJ3 L;  1HTP A;  3J7Y W;  4A3I B;  5C4H A;  4OHJ A;  2JA8 G;  1F9Q A;  3CCU A;  3IAY A;  1RKN A;  2K52 A;  2A68 D;  2XRS D;  1B3Q A;  1FVI A;  4LF9 Q;  4UPA A;  4KMU C;  4C3J H;  3HOW G;  1HUM A;  1S5B D;  2ZTD A;  3GTG H;  1KAB A;  3TDQ A;  5JVG 3;  1LTL A;  2E75 C;  5CV9 A;  3VYU A;  2JP1 A;  5BN3 A;  1V1Q A;  4XQN A;  1I6V C;  4UAI A;  4IUR A;  4DR7 Q;  1VQE A;  4B08 A;  4QUF A;  3PIP A;  5EBD A;  5M9O A;  4MIU A;  3K80 C;  1EY7 A;  4C3I G;  1WTX A;  1Y69 U;  2KA7 A;  2JA7 B;  4OO1 H;  2L12 A;  4XDX A;  1UEB A;  4LNQ A;  4IFD I;  2IPK D;  5C4X H;  3S2H B;  2HD3 A;  5M5W H;  1YJW A;  4C56 C;  1K8A C;  4K2L A;  1KRT A;  3NBH B;  1RHP A;  2PMZ E;  3G71 A;  4BBS B;  5DEH A;  2M00 A;  4C3H B;  3OWF A;  1XNQ Q;  4LF6 L;  1WTR A;  4HR7 B;  1Y1W H;  1VQ7 A;  2B8F A;  2E5L L;  3K6O A;  4IPD A;  3BYT B;  1GUT A;  1Y14 B;  2E2D C;  4JI2 Q;  4YWM A;  3CQZ B;  4A3D G;  1K83 H;  1Y8O B;  3DEO A;  4RHS A;  1VQK A;  4BY7 B;  3RN5 A;  4IJH A;  1AE2 A;  3FEW X;  3IKJ A;  1HXY D;  1K3B C;  3ULJ A;  5I2X A;  5IGB A;  2EDG A;  2I07 B;  4JI1 L;  1LAB A;  5EPK A;  1B8A A;  1STG A;  1FJG Q;  3PQI A;  1GUG A;  2EY1 A;  2HDL A;  4JI0 Q;  3GV6 A;  4DNR B;  3HOV B;  4MN3 A;  3I8Z A;  2EQS A;  3HKZ E;  4C2M H;  4NXM L;  1JJC B;  4P74 A;  1EQR A;  2QGQ A;  4ME3 A;  2YV5 A;  3E9I A;  2F0E A;  3S2H H;  2E2H B;  2PQA A;  1VQJ A;  1L1O A;  1QCB D;  1SE2 A;  5C44 H;  5IP9 G;  1EWI A;  4C1N K;  4B3R L;  1F9R A;  3CC2 A;  4P75 A;  3KUP A;  4J1M A;  4POG A;  2R7F A;  2C5C A;  1TWG H;  1FR3 A;  3TZD A;  3J81 E;  4I7A A;  2R92 H;  4IZ8 A;  1VF7 A;  4Q5V A;  1DJR D;  4OX9 L;  3PO3 H;  2OTL A;  3KLS A;  1I5F A;  1O7Z A;  1DON A;  1PRT D;  4POF A;  4IFD J;  3CCR A;  1Z9F A;  1II3 A;  5ELN A;  3OYY A;  2MPM A;  1LTG D;  4OXP A;  1STE A;  4LFA L;  5D14 A;  1PH8 A;  3PO2 H;  1XYI A;  2PNR C;  1ML0 D;  4DUZ L;  2VUM G;  2R93 G;  1JB3 A;  1X3Q A;  3RZD B;  1EYG A;  5ISR A;  3ND8 A;  2ICE C;  5CYU A;  3SK8 A;  3R8B A;  2JK8 A;  1C4Q A;  2Y0S G;  4DV3 Q;  1V43 A;  3FRP B;  4LAA A;  4X66 L;  4LFA Q;  4WFN 3;  2F0W A;  3SHL A;  2UXD Q;  3RZO B;  2A6E D;  3SE0 A;  3HEJ A;  1YVC A;  3H3V I;  4A3C G;  1S5E D;  1WTO A;  1G51 A;  2JA5 H;  2Q8I B;  2EXZ A;  2F4V L;  1WJJ A;  2MFI A;  2NVY B;  4OX9 Q;  3NWS A;  2BA1 A;  4RGO S;  4A3K B;  1XNQ L;  2XGT A;  4IUN A;  2WP8 J;  2R6G A;  5LMN Q;  2KCC A;  5FJ8 H;  3A7L A;  1IKM A;  5JVH 3;  4ALP A;  2ALY B;  4JG2 A;  3RLN A;  3T13 A;  2K5D A;  4IO9 A;  4QIW B;  4IPC A;  4N8X 1;  1HR0 L;  4RH6 A;  4YY3 L;  3QR8 A;  4V19 0;  4U68 A;  3I4O A;  1S4Z A;  4R4T A;  1A63 A;  4MTN A;  4DR4 L;  4Y7N H;  4GNX C;  3KF8 B;  2WAQ G;  3J81 c;  1CHQ D;  4RA8 A;  3TEH B;  4ID6 A;  1TQO A;  2KVM A;  1HZB A;  1HPC A;  2F0M A;  4G4K A;  3TS2 A;  2R61 A;  5LL6 X;  2WKD A;  1HJP A;  4K5X A;  3HOW H;  1SYB A;  2RDF A;  1HA6 A;  4JBW A;  4DR5 Q;  1EIF A;  4FYD A;  2WB1 E;  3GTP H;  4JI2 L;  1IBL L;  5M5Y H;  1O7Y A;  2H4O A;  2CWA A;  1Z47 A;  4BY7 G;  1PH1 A;  4LF9 L;  3EJI A;  1FD7 D;  1GHK A;  3CCE A;  4JI8 L;  1U4P A;  2MGS A;  2F0T A;  3NHH A;  1KRS A;  1A3U A;  4BA1 I;  1NAP A;  5A2Q E;  1UEA B;  4YHH Q;  1AH9 A;  1PTO D;  1EEI D;  1DCZ A;  2OCE A;  4PMW A;  3EQL C;  4DU9 A;  1AFP A;  4YCW A;  3CPF A;  3MXN B;  3OHX C;  3WOE A;  4DR5 L;  1W6K A;  2JYO A;  1LTS D;  3A74 A;  1S5D D;  3OW2 A;  1T5E A;  4DFA A;  3HOV H;  4IUP A;  1E24 A;  1J5E Q;  1EWH A;  2ES2 A;  1MHW C;  2WB1 G;  5I4D A;  3HOX H;  2E76 C;  5LMU Q;  4ZAI A;  2X6L A;  4DAY A;  5IT9 c;  4K2K A;  2Z1C A;  1TWA B;  4H44 C;  2H5X A;  3I73 A;  1X55 A;  2DJF C;  4DGZ A;  2TMP A;  3IL8 A;  5HGT A;  3S17 B;  1I6H B;  2Q2U A;  2RBM A;  1J5E L;  1HHV A;  2EJF C;  2TSS A;  3PF4 A;  1AE3 A;  1E7Z A;  3PSI A;  3KOJ A;  4WOR A;  2B63 G;  4DXG A;  5M3M G;  4R8N A;  3A8J E;  1L2F A;  2VQF Q;  1O78 A;  4XTC S;  1X6O A;  3K58 A;  3FMC A;  4JI8 Q;  4BS9 A;  4K6L A;  1TY0 A;  2GA4 B;  1A62 A;  3KBG A;  5C4Z A;  4IFD G;  1PV4 A;  2OWO A;  1CUK A;  4PQX A;  5JJZ A;  4K8J A;  2HIX A;  1B3A A;  3QWN A;  1L0X B;  4CJ0 B;  3PO2 G;  2CFM A;  3R93 A;  3DM1 A;  3R2I A;  1SNP A;  1STN A;  4LJZ C;  2IY5 B;  5FO9 B;  2AHO B;  2PMZ B;  1EY9 A;  3I7F A;  5AFW A;  4DR1 Q;  3CCQ A;  3Q6S A;  2R92 G;  5KIX A;  1GVP A;  1K8O A;  1T5X D;  4GLV B;  1YHA A;  3HZX A;  3GTK B;  4X65 L;  2HQE A;  3BS1 A;  3SVM A;  1HR0 Q;  2R7Z G;  1NCV A;  5C0X G;  3BDO A;  1AZQ A;  1S5F D;  4UDU C;  1NSN S;  4NW2 A;  4E6I A;  3RMH A;  2PI2 E;  1QG7 A;  2VB3 X;  1SE8 A;  2G5D A;  4EQO A;  1UE7 A;  3I4M G;  2GVB A;  3HOX B;  5CC4 A;  1R4P B;  4A3E B;  2O5I C;  2RDH A;  3M85 A;  1QUQ B;  4K0K L;  1JE5 A;  4H0L C;  4BBR B;  1DXM A;  1WI5 A;  2F03 A;  2HCC A;  5I9P A;  1YJN A;  3P7J A;  4HIM A;  2DJG C;  2NWG A;  4H02 A;  1JMC A;  3KLR A;  4NDX A;  3S14 H;  1EUJ A;  5T1G A;  2EOT A;  3DM3 A;  5IGF A;  3GD7 A;  3KLW A;  1XWE A;  1TKW B;  5KND A;  4DPG A;  5IP7 G;  1RTO A;  4KY5 A;  1R9T B;  1JOR A;  3BG3 A;  2F0K A;  4JV5 Q;  1GKH A;  3QOL A;  1WCM H;  3S24 A;  3GTP B;  2AWO A;  4H7B A;  1JOO A;  2H1E A;  1VCI A;  2J7Z A;  5CV8 A;  4X64 Q;  5IYC H;  4GS3 A;  3J7A F;  3LX0 A;  5JJI A;  1CZW A;  1XTD A;  1HFN A;  1IYJ B;  1EQQ A;  3CRL C;  1N9W A;  4ZUJ A;  1K83 B;  3DXJ C;  1GJX A;  3AFP A;  5D65 A;  4L5T A;  4XT3 B;  1D8L A;  3GQB A;  4YWL A;  1S5C D;  2F4I A;  4N8F A;  3RD4 A;  4F87 A;  5KNB A;  3IFD A;  1GO3 E;  3KYH C;  1RL2 A;  3T56 B;  2B3G A;  1NY4 A;  3I91 A;  2Z6K C;  1I4X A;  1E3P A;  1BCP D;  1Q3L A;  5JEA J;  3AMU A;  2ICI A;  1SYD A;  2K5V A;  3H6M A;  3QO2 A;  3K0Y A;  3PUW A;  5E4X A;  2NVT B;  3CCS A;  2B63 B;  2EYF A;  2E74 C;  1IKL A;  5LMU L;  2IX0 A;  2K4K A;  2PW5 A;  1NJI C;  1AP0 A;  4NXN L;  1A3T A;  1PH3 A;  4RMF A;  2AKW B;  1VQ5 A;  1B44 D;  5EGT A;  4AIM A;  4JK1 C;  1Q12 A;  1WD1 A;  5EPL A;  1F2L A;  4KN7 C;  2F0D A;  3CRK C;  2K5H A;  2G9D A;  3PIO A;  1STH A;  5DAU A;  1Y8P B;  2BCO A;  5J22 A;  1D1I A;  4LUZ A;  2EYO A;  1EY6 A;  1G8Z D;  2EPB A;  3E6Z X;  2AUJ D;  1PMR A;  4KJN A;  4TKO B;  1X3F A;  1CQF A;  2QW7 A;  2K28 A;  1EZ6 A;  3KJP A;  2AQ3 B;  4GKJ Q;  1PTO B;  5M5W B;  2QF7 A;  4PNY A;  1BBW A;  1KNA A;  1Q8K A;  3FKI H;  3S14 B;  4HMJ A;  5IT9 L;  1V1P B;  4QF4 A;  3Q22 A;  3GTJ B;  4ZKB B;  3S1M H;  4IUQ A;  1TS3 A;  3FHW A;  3L0O A;  4DAP A;  3E5S A;  3U4V A;  1CKN B;  3OIP A;  5FLX E;  2UU9 L;  1B9M A;  1TWF H;  2V4D A;  4JI4 Q;  3K5L A;  3MXP A;  5IYD H;  3OPO A;  2Z6K A;  1FL0 A;  5TSS A;  4NMZ A;  2CH4 W;  1GUS A;  4DF7 A;  1VDZ A;  2VNU D;  1SLJ A;  2D2C C;  1Y8N B;  3KF6 B;  3CCL A;  4ZQ3 A;  1M90 C;  3T1H L;  2IJ0 A;  3M3Y B;  4KK7 A;  5I6W A;  2JEA I;  3F2U A;  4DR3 L;  2A6H C;  1KQS A;  3NTK A;  1K28 A;  1U0L A;  1PZI D;  4JBK A;  2AQ1 B;  3TP8 A;  1EOT A;  1RD9 D;  3U9O A;  3DHQ A;  1XPU A;  3PO3 B;  1IBL Q;  1IL8 A;  1BO0 A;  4DA2 A;  3P1H A;  2C9O A;  3FKI G;  5J1Z A;  3I56 A;  5M3F H;  3EVQ A;  1PH7 A;  2MUY A;  3TQY A;  2D0P A;  1XNR L;  2E2I B;  2K14 A;  1SYF A;  4HED A;  4P72 A;  2VB2 X;  3HOY B;  4PZ7 A;  3I3C A;  1RJT A;  1SR3 A;  4JV5 L;  2MO1 A;  4BBS H;  1BXT A;  3D6C A;  4O2D A;  1BF4 A;  1WTV A;  1BKB A;  4KHZ A;  5FK9 C;  1FNV A;  4JC0 A;  1N8R C;  1H9S B;  3A7A B;  3OTO Q;  3C2P A;  3D6W A;  4CDF C;  4C3J G;  2RHQ B;  5J3B A;  3F2C A;  1B70 B;  2BH8 A;  3G7L A;  3M7N A;  3K5O A;  4WJ3 M;  4K6D A;  3S16 H;  2I46 A;  2LY7 A;  1NMG A;  3VA5 A;  4LFC Q;  4I65 A;  4JI3 L;  3M4Q A;  3MEH A;  1WD0 A;  4FP5 D;  5GAD C;  3GTQ H;  1IBK L;  2NZ1 D;  3STB D;  3FVQ A;  1LYL A;  5M3M H;  1QE6 A;  3KJO A;  1SFO H;  1W3S A;  3DWP A;  2B63 H;  4A3F B;  1GXD C;  3VYR A;  3M3Y H;  1TR5 A;  3T4A C;  1DD2 A;  2A74 C;  1PH5 A;  1TS4 A;  2QEX A;  1GD7 A;  2Y0S B;  4ZK9 B;  1SNO A;  3LWU A;  4KTA A;  4S3S A;  4GZY C;  4WJ4 A;  2B2W A;  1EFI D;  3MXG A;  1PH9 A;  4DV0 L;  1A6X A;  4X3U A;  1L1O B;  1EL0 A;  4KKS A;  2QDL A;  1JE4 A;  2JQO A;  1TWF B;  2RCF A;  2B2T C;  5JEA H;  4PZ8 A;  3WDN A;  5KYL A;  2SEB D;  4AYB E;  2QDB A;  4XT1 B;  5GRO A;  1HR0 W;  3S15 H;  1M8A A;  4DV6 L;  4EQP A;  4TVA B;  1LT5 D;  4KD3 A;  2B2V A;  2E8G A;  1ZYR C;  1SMX A;  4HTH A;  1E2Z A;  1EWC A;  4HMI A;  3PUZ A;  4K0K Q;  3FKI B;  4X3K A;  3GTL B;  1SNM A;  2A5H A;  2BDN A;  3HP3 A;  4JBJ A;  1P16 A;  4F88 A;  2L1B A;  3HOU G;  1XMQ Q;  2L55 A;  2B2Y C;  3M4Y A;  5I6Y A;  3HKZ B;  4OWW B;  2L4N A;  2XTI A;  4DR2 Q;  4HIK A;  1XTC D;  3ULL A;  3TS0 A;  5BR8 L;  4CJ2 C;  4A3L G;  1QVC A;  3QG1 A;  2JA7 G;  2C35 B;  1EIH A;  2ZTC A;  4DV4 L;  4KHP Q;  4O1N A;  2PI2 A;  5DM7 3;  2UU9 Q;  3SGI A;  1I4Q A;  1SEB D;  2LKV A;  1JWS D;  2JN4 A;  4A3K H;  3OW7 A;  4OO1 I;  4R4C A;  4Y52 H;  4IPH A;  5C0X H;  1J6Q A;  5KEE A;  3J80 i;  1G2T A;  1LTR D;  2B2U C;  3TME A;  3PF5 A;  2KHS A;  2OQK A;  2F0L A;  3D4R A;  1A2U A;  4HSP A;  1XJV A;  2A1A A;  4L5S A;  3Q23 A;  4A3D B;  3ITP A;  1HCZ A;  2WFW A;  3MHB A;  2KBN A;  4OGQ C;  3VDY A;  3ERQ A;  4A3K G;  2K32 A;  2RSO A;  3VA7 A;  4L63 B;  1H95 A;  5C0X J;  4Z9C B;  3K59 A;  5EKK A;  5IGD A;  2VQF L;  4JI5 L;  2LXK A;  1SBB B;  1NUC A;  1SMY C;  3M4P A;  3B6Y A;  1R4Q B;  4CDD C;  4B3T Q;  5C3E B;  1TY2 A;  2FMM A;  1JC7 A;  2Q2H A;  1B53 A;  1PH4 A;  4A3G H;  1KC8 C;  2EJM A;  1MSH A;  3NQI A;  2PYK A;  2E2J H;  4NXN Q;  4AQY L;  1FGB D;  1C8C A;  3MTS A;  2FFK B;  2I5H A;  3H15 A;  2B29 A;  4JW0 A;  3I90 A;  1JB7 A;  1N36 Q;  2RCN A;  1D5Z C;  1VMP A;  4RGN A;  2NTT A;  4DV4 Q;  4FO2 A;  4RKB A;  3H3V C;  4HSV A;  1JOQ A;  4K8I A;  2UXB L;  4F8M A;  1EYD A;  3CU7 A;  2NN6 G;  2UUC Q;  1BOS A;  1WTP A;  3RZD H;  2EYH A;  5FLX c;  3PMF A;  5I9O A;  2Z4I A;  3PO3 G;  5K36 G;  4X62 Q;  3UDI A;  3CP0 A;  1Q1B A;  2UUB Q;  1CQV A;  3S1Q H;  2D0O A;  1CTM A;  3VR4 A;  5AJ3 Q;  1I50 H;  1XMO L;  2L9H A;  1HZA A;  1EEF D;  4HN7 A;  1KD1 C;  3F2B A;  2EY2 A;  1HUN A;  1GUN A;  2E2J B;  2DY8 A;  2WB1 B;  1LTB D;  2OQ0 A;  3U58 A;  4FXK C;  3TP6 A;  3RLO A;  1B7Y B;  1EY4 A;  2VQE Q;  3SR1 A;  1SYE A;  4JI6 Q;  3KDF B;  4DUZ Q;  4Q0F A;  3MFY A;  1DOM A;  1TS5 A;  2O5J C;  2IX3 A;  3PO2 B;  4HCE A;  5EKL A;  4A3D H;  2IHE A;  1NE3 A;  3CC4 A;  4NPS A;  4MHE A;  1STA A;  1TWH B;  4HJ8 A;  2K03 A;  2O2L D;  1RF2 D;  4DR6 Q;  3I4L A;  2F3V A;  3MEF A;  2BA0 A;  1QJO A;  1AZP A;  2O4X A;  4L8J A;  2E2I H;  2F4V Q;  5A2Q L;  2BH2 A;  4DR6 L;  3I4N G;  3S9W A;  4GOP B;  1E22 A;  1EQV A;  3TZU A;  3VR3 A;  3S1M B;  1IL2 A;  1YNN C;  4A3G B;  4ODG A;  3JAM E;  1STY A;  1TWC H;  3C1E A;  4GLX A;  2CHB D;  2R7Z B;  4G7H C;  3C3L A;  4JI7 Q;  5C3W A;  4ZRZ A;  1MIU A;  2HHH Q;  2F0O A;  2RSN A;  3T16 A;  2J0T D;  4NXM Q;  2ZT9 C;  2MNA A;  4JI6 L;  3OOC A;  4IN3 A;  2VQE L;  1ESR A;  1O80 A;  1AN8 A;  1FJG L;  1HA5 A;  4CJ1 B;  1Q8I A;  3A0J A;  2Q2T A;  5C4X B;  1B4O A;  1SAP A;  1V1P A;  4A3I H;  2IHF A;  3CW2 C;  3K0X A;  4LFB L;  4LF8 L;  3A56 A;  1TU2 B;  2F52 A;  2NVQ B;  3J7A 5;  1DOK A;  1QUQ A;  1CKN A;  1FGU A;  2UUB L;  4OIJ A;  2SOB A;  1ICF B;  2CQO A;  4LF6 Q;  1LAC A;  2Q2I A;  4A3E G;  2EXD A;  2Q8R E;  4XIG S;  4C3H G;  2VUM H;  5DM6 3;  4NKL A;  4MNO A;  2B2T A;  3HOZ H;  2NZO A;  2X6G A;  2EZV A;  2ZXO A;  3NQT A;  2CQA A;  5EAY A;  1MJE A;  3CC7 A;  2M9V A;  4KHV A;  5CMD A;  4A3F H;  5COY A;  1ENA A;  2FMC A;  1HNW Q;  4QB4 A;  1IYV A;  1E1T A;  3GTQ B;  3K7U C;  2EYP A;  5C3E G;  3PUY A;  4QQB X;  5KYI A;  3HOV G;  4K14 A;  2K50 A;  1CZG A;  4KN4 C;  3BYY B;  3HG9 A;  1ZKO A;  3W3A A;  1Z6H A;  2NN6 I;  3S15 B;  4OL7 A;  2JA5 G;  4OEL B;  1LLR D;  4LF7 Q;  4CBV A;  2JA9 A;  1OXV A;  1X56 A;  3FDT A;  4PMB A;  4GKJ L;  1VF5 C;  1ET9 A;  3URY A;  2UUA L;  2KEC A;  1TWH H;  3TSS A;  3KBX A;  1EU4 A;  1A2T A;  4C3H H;  1U9R A;  5IP7 H;  3MWY W;  4DV2 Q;  1N32 L;  4RWS C;  1BNZ A;  4BBR G;  1VMC A;  1HNX L;  2PW7 A;  2BOS A;  1OXS C;  4JCV E;  3ERO A;  5D3D A;  1Q7Y C;  2R93 H;  4A3J H;  3LGJ A;  1S72 A;  1VQI A;  1VQA A;  3PV0 A;  3T1Y L;  2VXW A;  4J6H A;  2RVL A;  1Z7T A;  1G6P A;  5BN5 A;  4DAM A;  4B9X A;  2K05 A;  4CKC A;  3F8T A;  4DR7 L;  3GTJ H;  3UE1 A;  1B50 A;  1LT4 D;  2XSC A;  3A55 A;  5LMN W;  2K04 A;  1DZ1 A;  2WII B;  2R3Z A;  4G7Z C;  3MXU A;  1EQT A;  1G2S A;  2CW0 C;  3QIA A;  2EY6 A;  1WOC A;  1PTO H;  1YHB A;  1VQG A;  3MZ5 A;  3NEM A;  1OXU A;  5C44 G;  4DR2 L;  2KQ3 A;  3GP7 A;  2KCN A;  1OTC A;  1YNJ D;  1Q1E A;  1VS0 A;  4IAL A;  4P71 A;  1K0S A;  3S1N H;  2DGY A;  1I4G A;  4HAE A;  3OSO A;  1K8G A;  1STB A;  2NVX H;  3TRZ A;  4RGM A;  1L1O C;  4LF8 Q;  1JWM D;  2ZTE A;  1PHJ A;  2UXD L;  3NK9 A;  3MA2 B;  1IBM Q;  1I50 B;  4GKK Q;  3L3O C;  2R93 B;  2L15 A;  1UAP A;  2F3I A;  3KDF A;  4NP5 A;  1YIJ A;  5IOD A;  3AFQ A;  1X3E A;  4C3I B;  2KCM A;  3HKS A;  3GO5 A;  3EBE A;  3KF6 A;  3I4M H;  4KHP L;  3K8A A;  4FF2 A;  2OT2 A;  3W1G A;  1JOK A;  2QCP X;  2N3S A;  4LUV A;  3HOZ B;  2BDO A;  3G6E A;  1ASY A;  3P75 A;  3PUV A;  2IWH A;  4PZ6 A;  2KOL A;  1IBK Q;  4JPB W;  4G7O C;  2F0Q A;  4DK0 A;  4JI3 Q;  3KF8 A;  1CA5 A;  3K5M A;  3D3R A;  1I3Q B;  4XYQ A;  1TXY A;  1W2B A;  3M7G A;  2XWJ B;  5D3I B;  3RUZ A;  4AH6 A;  4FF3 A;  4RHR A;  2ASB A;  3G6J B;  3S1N B;  2JSO A;  3UE0 A;  1Y1W B;  3C1F A;  4MTK A;  1EYC A;  1XX8 A;  5JJL A;  2K7V A;  3H91 A;  4A3J B;  4KKU A;  5CV6 A;  2NVT H;  1PH2 A;  3HOZ G;  2DNC A;  3OWE B;  3UDX A;  3GTM H;  5ELF A;  4DV3 L;  1BCP F;  1O7I A;  1W6J A;  5C6A A;  4R4Q A;  1X32 A;  1ZEQ X;  3N52 A;  1A15 A;  5CGK A;  4A3M H;  4IFD H;  4DV7 Q;  2A68 C;  2D5D A;  2CVR A;  4KJO A;  1QB5 D;  2LS0 1;  1DGS A;  4JI1 Q;  1PZJ D;  4A3M G;  3TP5 A;  3D4W A;  4ILW A;  1F77 A;  1QNK A;  3PUX A;  3PGZ A;  3DWA A;  2Z0S A;  2JA8 H;  3AB9 A;  4V0B A;  2OEO A;  1BUV T;  2QEJ C;  4GNX A;  1PZK D;  4LF5 L;  2V1C C;  1MSG A;  1PRT C;  4KD4 A;  5C4J H;  1YJ9 A;  2LMC B;  2VY3 A;  1H9K A;  4F7X A;  4DUY Q;  4DK1 A;  5L37 A;  2EJG C;  5ELE A;  1Y1V G;  4B3M Q;  1K3R A;  1LTI D;  2HUG A;  1KAA A;  3NUC A;  3A8I E;  2JEB I;  5NUC A;  2I5L X;  5EJW A;  2YU9 H;  3J80 E;  4GLA C;  3JAM i;  2OXP A;  4B3R Q;  2UXB Q;  3V05 A;  5HUR A;  1HTL D;  1X3P A;  4DV5 Q;  5IGE A;  1EZ8 A;  1SE4 A;  4NB3 A;  4EVO A;  2L5T A;  2CWP A;  2F0V A;  4ME5 A;  4RKL A;  2ZJR A;  4JI4 L;  4MZ9 A;  3P20 A;  2YTY A;  3S2D B;  3S17 H;  2K5Q A;  2K5W A;  1TII D;  2PO4 A;  2GVA A;  2ZM6 Q;  3F1Z A;  1UNS A;  3JAM c;  1VQL A;  1CK1 A; 
#chains in the Genus database with same CATH homology
 1JCK B;  1A3V A;  3GV3 A;  4ZKC B;  5C0X I;  3ZYY X;  4EGV A;  1ROD A;  3J7A V;  1GOZ A;  3I70 A;  2SNM A;  5J39 A;  4BY1 B;  5CR3 A;  1QOH A;  4ULL A;  1GUO A;  1XXG A;  2JE6 I;  1C48 A;  3PIP 3;  5EBC A;  2PPB C;  2F3W A;  3Q24 A;  1LT6 D;  3MAQ A;  2NBF A;  1BBX C;  4AYB B;  2SNS A;  5I2Y A;  1U4M A;  2DN8 A;  1ZYR D;  3SEB A;  4KY6 A;  3K57 A;  4FNF A;  5G3L F;  4C1N I;  1RCV D;  3SDZ A;  1WCM B;  5M3F B;  4B9W A;  3ND9 A;  1SYC A;  1MGS A;  4IQZ A;  3NBH A;  1EU3 A;  5CBE E;  1EY8 A;  1G6Z A;  3R2T A;  3EFX D;  4FVM A;  5DNF A;  2YU9 B;  1YNN D;  3IFT A;  1PFN A;  3GTM B;  3BVZ A;  4J8Q A;  5E3F A;  3VYS A;  4LMQ D;  2D62 A;  4RAU C;  1D1K A;  1CHP D;  1H9R A;  3R3O A;  5LHY 1;  3OMG A;  4DN4 M;  3LNN A;  1MBY A;  3CHB D;  4QUC A;  1YNJ C;  1D2B A;  3S1Q B;  2HCI A;  2YYZ A;  4CHT B;  2RDG A;  2RA4 A;  4Y7N B;  3NE5 B;  4QCL A;  2KEE A;  3WOF A;  1FYC A;  3KK7 A;  1BCP C;  2LFN A;  1GUW A;  3D8G A;  1DYQ A;  1LO5 D;  2DY7 A;  3U9S A;  4OO1 G;  4C2M B;  3BVG A;  2JA6 B;  2K33 A;  3AU7 A;  1SFO B;  2PZT A;  4PV1 C;  4H13 C;  2MP1 A;  1TVX A;  2XVS A;  3D31 A;  3I72 A;  1BQQ T;  3V96 A;  2KED A;  2L11 A;  2M2L A;  5LL6 S;  4K5V A;  2DNE A;  1ILQ A;  2WIN B;  1IW7 D;  1AW7 A;  2IT1 A;  5IOC A;  2AUK A;  3VR5 A;  1UUP A;  3PIO 3;  3HGB A;  1NR4 A;  1RTN A;  4YIJ A;  1E0B A;  1J9O A;  4BA2 I;  3J80 L;  2PCF B;  4DNT B;  2F0F A;  4BWG B;  2XWB B;  1OXX K;  2A69 C;  2IW3 A;  2NTS A;  3S1R B;  4U67 3;  4KV6 A;  5BN4 A;  1K8M A;  1CT1 D;  2D9U A;  2Z8L A;  2Q8T A;  3O13 A;  3T51 B;  5M5Y B;  1OXT A;  1NR2 A;  4X3S A;  3NTH A;  4N9P A;  1EIG A;  1BDO A;  2JA5 B;  5JAV A;  2PZW A;  3VYT A;  3BVM A;  2WAQ B;  2WAC A;  2NYZ D;  2NVX B;  4CKB A;  2A73 B;  4XYO A;  3GTG B;  3L7Z C;  5IGC A;  4C3J B;  1SNC A;  1LTA D;  1EYA A;  1L0Y B;  2F0S A;  5JEA G;  1B1Z A;  4XQQ A;  1ZXT A;  4O42 A;  1J8I A;  3VR6 A;  3D4D A;  3BZD B;  3JAM L;  2K01 A;  1F9S A;  1WTQ A;  1SSO A;  1PYW D;  2NB0 A;  4XXE A;  1HFG A;  3H09 A;  1QNU A;  1I4H A;  3TBI B;  4TRD A;  1CK1 A;  1KTK A;  5FKA C;  3NXW A;  2A69 D;  1H9M A;  3Q0A A;  4PMC A;  3W2D A;  2F1M A;  1JR0 D;  1I4P A;  3VR2 A;  4N9T A;  4XQJ A;  4R9W A;  1KDC A;  5CBA E;  3A54 A;  1JQY D;  2PZU A;  1EY5 A;  4I7Z C;  2F0G A;  3QOJ A;  1QWY A;  5M3M B;  2AWN A;  3E0J A;  1HQR D;  3SK5 A;  1DOL A;  1Q90 A;  5KRU A;  1QIL A;  1GHJ A;  3RLF A;  3MVV A;  2F0I A;  3DWQ A;  3A8K E;  1IW7 C;  1TWG B;  4IUU A;  1U4R A;  1F2Z A;  4KKT A;  1RDP D;  3X3N A;  1B2T A;  3NPP A;  5C44 B;  3HS0 C;  2EYL A;  1DM0 B;  4CKE A;  3ONA B;  1WVL A;  3NP8 A;  2SDF A;  2FJ2 A;  1M4V A;  3X3M A;  4G57 A;  1AEX A;  1FNU A;  2F0U A;  4IUT A;  2VUM B;  2WKC A;  3TN2 A;  2B2U A;  2BE5 D;  1LV9 A;  3SXH A;  2ENB A;  1IYU A;  4R8I A;  1ENC A;  1MI2 A;  2ZXR A;  1ESF A;  3UI2 A;  5A35 A;  1IHZ A;  5F2D A;  2HDM A;  2IL8 A;  5IIF A;  2QIL A;  3NBI A;  5C5M A;  4KI0 A;  1LT3 D;  5FO8 B;  2FHT A;  1D5M C;  2XIW A;  3MXN A;  3NSW A;  4L6T B;  1ICW A;  1TT2 A;  3T53 B;  5K36 H;  1D6E C;  3EA6 A;  1FNW A;  2NN6 H;  3GTO B;  2X69 A;  2B8G A;  3N6R A;  1EY0 A;  1KDA A;  2F0P A;  1BR9 A;  5CV5 A;  1CA6 A;  2B2V C;  5JPM C;  1PTO C;  3K7A B;  1CFM A;  4IUV A;  5EKI A;  3H94 A;  2K1B A;  1SYG A;  1O7L A;  3K5N A;  5IGG A;  4CGY B;  2A6H D;  1F2M A;  2N55 A;  1JIC A;  4K5W A;  3FPP A;  2A6E C;  1E2V A;  3HOW B;  4QMG A;  2G9H D;  1F2Y A;  5C4J B;  3DEP A;  3LWE A;  3NWT A;  4FXG C;  1ILP A;  3S16 B;  2XNA C;  2F0J A;  3V2T A;  4WRD A;  5KNC A;  3BDC A;  1H9J A;  5T1I A;  1TS2 A;  2N88 A;  3KLS X;  3DUZ A;  1HQM C;  4A3B B;  3CKI B;  5FO7 B;  1PFB A;  5CV4 A;  4RCO A;  1HRJ A;  2K6A A;  3NTI A;  5E4W C;  2AQ2 B;  3HRZ C;  1CM9 A;  5ELD A;  1F9P A;  3C46 A;  4DXF A;  1JWU D;  4TQU S;  2EYJ A;  2R92 B;  1CI3 M;  1KLG D;  4ABN A;  1KNE A;  5JOB A;  1KDB A;  2F0N A;  3HOU B;  5KGU A;  3I4M B;  1Y1V B;  4M8A A;  3FPU B;  2L0C A;  1H9S A;  4WJW A;  1ONL A;  3MC0 B;  4RGT A;  1SMY D;  1PRT F;  2OF1 A;  2EVB A;  2FIN B;  5C3X A;  4ZYS A;  2B39 A;  2PQE A;  2KUM A;  5G3L D;  4HCS A;  4X3T A;  2KJX A;  3OMC A;  1I4R A;  1OO9 B;  1BCP B;  2XRQ D;  4OIK A;  2MHV A;  5COR A;  5C5L A;  2JXM B;  5FLX L;  2RQX A;  1PLF A;  4DAV A;  1V8Q A;  4TSS A;  2BE5 C;  2CW0 D;  1WTW A;  1LTT D;  5EQ0 A;  3OIQ A;  1G91 A;  3SK4 A;  1PRT B;  1ENF A;  5ELB A;  2EYM A;  3TP7 A;  3I4N B;  1D5X C;  3SK6 A;  2F0H A;  3BDL A;  4RFB A;  5M5X B;  2J4X A;  5FOB B;  1PDQ A;  4FF1 A;  5E1F A;  4ZUI A;  2JA8 B;  2MJ8 A;  1PTO F;  5IT9 E;  1PFM A;  1PXU A;  2ID0 A;  2ZXP A;  3J81 L;  3DMU A;  2Z4H A;  4A3M B;  4RCN A;  4FXD A;  3QB3 A;  3MFG A;  4P2C B;  2IX1 A;  2EE1 A;  3M4O B;  1SE3 A;  1V1O A;  1SJE D;  5CV7 A;  1E2W A;  1SJH D;  2B2Y A;  2RKS A;  4A93 B;  1SXT A;  4FF4 A;  1SND A;  5EPJ A;  1KLU D;  1ET6 A;  2NUC A;  1MD2 D;  2QKI C;  3QJY A;  4EQN A;  5K5P A;  1SDF A;  1G29 1;  1SNQ A;  4M1U B;  3H0G B;  2B2W C;  1B9N A;  5JPN C;  4LK1 C;  2WV6 D;  1TWC B;  2XN9 C;  4KY7 A;  2EY5 A;  5ELC A;  3L9A X;  4ZLT F;  1U4L A;  1HTP A;  3J7Y W;  4A3I B;  5C4H A;  4OHJ A;  1F9Q A;  3IAY A;  1RKN A;  2A68 D;  2XRS D;  4KMU C;  1HUM A;  1S5B D;  1KAB A;  3TDQ A;  5JVG 3;  2E75 C;  3VYU A;  5CV9 A;  2JP1 A;  5BN3 A;  4XQN A;  1I6V C;  4UAI A;  4IUR A;  4B08 A;  4QUF A;  5EBD A;  5M9O A;  4MIU A;  1EY7 A;  4C3I G;  1WTX A;  1Y69 U;  2KA7 A;  2JA7 B;  4OO1 H;  2L12 A;  4XDX A;  4IFD I;  2IPK D;  3S2H B;  4C56 C;  4K2L A;  1RHP A;  4BBS B;  5DEH A;  2M00 A;  4C3H B;  3OWF A;  1WTR A;  4HR7 B;  2B8F A;  3K6O A;  3BYT B;  1GUT A;  2E2D C;  3CQZ B;  1Y8O B;  3DEO A;  4RHS A;  4BY7 B;  3FEW X;  3IKJ A;  1HXY D;  5I2X A;  5IGB A;  2EDG A;  2I07 B;  1LAB A;  5EPK A;  1STG A;  1GUG A;  2EY1 A;  2HDL A;  3GV6 A;  4DNR B;  3HOV B;  4MN3 A;  3I8Z A;  2E2H B;  2F0E A;  1QCB D;  1SE2 A;  4C1N K;  1F9R A;  3KUP A;  4J1M A;  2C5C A;  1FR3 A;  3TZD A;  3J81 E;  4IZ8 A;  1VF7 A;  4Q5V A;  1DJR D;  3KLS A;  1O7Z A;  1DON A;  1PRT D;  4IFD J;  1II3 A;  2MPM A;  1LTG D;  1STE A;  5D14 A;  1XYI A;  2PNR C;  1ML0 D;  1JB3 A;  1X3Q A;  3RZD B;  5ISR A;  3ND8 A;  2ICE C;  5CYU A;  3SK8 A;  3R8B A;  1C4Q A;  1V43 A;  3FRP B;  4LAA A;  4WFN 3;  2F0W A;  3SHL A;  3RZO B;  2A6E D;  3SE0 A;  3HEJ A;  1S5E D;  1WTO A;  2Q8I B;  2EXZ A;  2NVY B;  3NWS A;  2BA1 A;  4RGO S;  4A3K B;  4IUN A;  2WP8 J;  2R6G A;  2KCC A;  3A7L A;  1IKM A;  5JVH 3;  3T13 A;  2K5D A;  4QIW B;  4RH6 A;  4V19 0;  4U68 A;  1S4Z A;  1CHQ D;  4RA8 A;  4ID6 A;  1TQO A;  2KVM A;  1HPC A;  2F0M A;  4G4K A;  2R61 A;  5LL6 X;  2WKD A;  4K5X A;  1SYB A;  2RDF A;  1HA6 A;  4JBW A;  4FYD A;  1O7Y A;  2H4O A;  1Z47 A;  3EJI A;  1FD7 D;  1GHK A;  1U4P A;  2MGS A;  2F0T A;  3NHH A;  1A3U A;  4BA1 I;  1NAP A;  5A2Q E;  1UEA B;  1PTO D;  1EEI D;  1DCZ A;  4PMW A;  3EQL C;  4DU9 A;  1AFP A;  3OHX C;  3WOE A;  1W6K A;  2JYO A;  1LTS D;  1S5D D;  1T5E A;  4DFA A;  4IUP A;  1EWH A;  5I4D A;  2E76 C;  4ZAI A;  2X6L A;  4DAY A;  4K2K A;  2Z1C A;  1TWA B;  4H44 C;  3I73 A;  4DGZ A;  2TMP A;  3IL8 A;  5HGT A;  3S17 B;  1I6H B;  2RBM A;  1HHV A;  2EJF C;  2TSS A;  4WOR A;  4DXG A;  4R8N A;  3A8J E;  1O78 A;  4XTC S;  3K58 A;  3FMC A;  4BS9 A;  4K6L A;  1TY0 A;  2GA4 B;  3KBG A;  5C4Z A;  4IFD G;  4PQX A;  5JJZ A;  4K8J A;  1B3A A;  3QWN A;  1L0X B;  4CJ0 B;  3R93 A;  3DM1 A;  3R2I A;  1SNP A;  1STN A;  4LJZ C;  5FO9 B;  2PMZ B;  1EY9 A;  5AFW A;  3Q6S A;  5KIX A;  1K8O A;  1T5X D;  3HZX A;  3GTK B;  2HQE A;  3BS1 A;  3SVM A;  1NCV A;  5C0X G;  3BDO A;  1AZQ A;  1S5F D;  4UDU C;  1NSN S;  4NW2 A;  4E6I A;  3RMH A;  1QG7 A;  2VB3 X;  4EQO A;  3HOX B;  5CC4 A;  2O5I C;  1R4P B;  4A3E B;  2RDH A;  3M85 A;  4H0L C;  4BBR B;  1DXM A;  2F03 A;  2HCC A;  5I9P A;  3P7J A;  2NWG A;  3KLR A;  4NDX A;  5T1G A;  2EOT A;  5IGF A;  3GD7 A;  1XWE A;  1TKW B;  5KND A;  1RTO A;  4KY5 A;  1R9T B;  1JOR A;  3BG3 A;  2F0K A;  3QOL A;  3GTP B;  2AWO A;  4H7B A;  1JOO A;  2H1E A;  1VCI A;  2J7Z A;  5CV8 A;  3J7A F;  3LX0 A;  1CZW A;  1HFN A;  3CRL C;  4ZUJ A;  1K83 B;  3DXJ C;  1GJX A;  5D65 A;  4XT3 B;  3GQB A;  1S5C D;  2F4I A;  3RD4 A;  4F87 A;  5KNB A;  3IFD A;  3T56 B;  3I91 A;  1I4X A;  1Q3L A;  1BCP D;  5JEA J;  3AMU A;  2ICI A;  1SYD A;  3H6M A;  3QO2 A;  3K0Y A;  3PUW A;  5E4X A;  2NVT B;  2B63 B;  2EYF A;  2E74 C;  1IKL A;  2IX0 A;  1AP0 A;  2PW5 A;  1A3T A;  1B44 D;  5EGT A;  4JK1 C;  1Q12 A;  1WD1 A;  5EPL A;  1F2L A;  4KN7 C;  2F0D A;  3CRK C;  2G9D A;  1STH A;  5DAU A;  1Y8P B;  2BCO A;  5J22 A;  1D1I A;  2EYO A;  1EY6 A;  1G8Z D;  2EPB A;  3E6Z X;  2AUJ D;  1PMR A;  4KJN A;  4TKO B;  1CQF A;  2K28 A;  1EZ6 A;  2AQ3 B;  1PTO B;  5M5W B;  2QF7 A;  4PNY A;  1KNA A;  3S14 B;  4HMJ A;  5IT9 L;  1V1P B;  4QF4 A;  3Q22 A;  3GTJ B;  4ZKB B;  4IUQ A;  1TS3 A;  4DAP A;  3E5S A;  3OIP A;  1B9M A;  2V4D A;  3K5L A;  3MXP A;  3OPO A;  5TSS A;  4NMZ A;  4DF7 A;  1GUS A;  1VDZ A;  2VNU D;  2D2C C;  1Y8N B;  4ZQ3 A;  2IJ0 A;  3M3Y B;  4KK7 A;  5I6W A;  2JEA I;  3F2U A;  2A6H C;  3NTK A;  1PZI D;  2AQ1 B;  3TP8 A;  1EOT A;  1RD9 D;  3U9O A;  3DHQ A;  3PO3 B;  1IL8 A;  1BO0 A;  4DA2 A;  3P1H A;  2C9O A;  5J1Z A;  3EVQ A;  2MUY A;  2E2I B;  1SYF A;  4HED A;  3HOY B;  2VB2 X;  3I3C A;  1RJT A;  1BXT A;  3D6C A;  1BF4 A;  1WTV A;  4KHZ A;  5FK9 C;  1FNV A;  1H9S B;  3A7A B;  3C2P A;  3D6W A;  4C3J G;  3G7L A;  3M7N A;  3K5O A;  4K6D A;  2I46 A;  2LY7 A;  3VA5 A;  4I65 A;  3MEH A;  1WD0 A;  4FP5 D;  2NZ1 D;  3FVQ A;  1QE6 A;  3DWP A;  4A3F B;  1GXD C;  3VYR A;  1TR5 A;  3T4A C;  1DD2 A;  2A74 C;  1TS4 A;  2Y0S B;  4ZK9 B;  1SNO A;  3LWU A;  4KTA A;  4S3S A;  4GZY C;  2B2W A;  1EFI D;  3MXG A;  1A6X A;  4X3U A;  1EL0 A;  4KKS A;  1JE4 A;  1TWF B;  2B2T C;  5JEA H;  3WDN A;  5KYL A;  2SEB D;  2QDB A;  4XT1 B;  1M8A A;  4EQP A;  1LT5 D;  4KD3 A;  2B2V A;  1ZYR C;  4HTH A;  1E2Z A;  1EWC A;  4HMI A;  3PUZ A;  3FKI B;  4X3K A;  3GTL B;  1SNM A;  2A5H A;  2BDN A;  3HP3 A;  4F88 A;  2L1B A;  2L55 A;  2B2Y C;  3M4Y A;  5I6Y A;  3HKZ B;  2L4N A;  1XTC D;  4CJ2 C;  3QG1 A;  1EIH A;  4O1N A;  5DM7 3;  1I4Q A;  1SEB D;  2LKV A;  1JWS D;  3OW7 A;  4OO1 I;  5C0X H;  5KEE A;  1G2T A;  1LTR D;  2B2U C;  3TME A;  2KHS A;  4HSP A;  2F0L A;  3D4R A;  1A2U A;  3Q23 A;  4A3D B;  3ITP A;  1HCZ A;  3MHB A;  4OGQ C;  3ERQ A;  2K32 A;  2RSO A;  3VA7 A;  4L63 B;  5C0X J;  4Z9C B;  3K59 A;  5EKK A;  5IGD A;  1SBB B;  1NUC A;  1SMY C;  1R4Q B;  5C3E B;  1TY2 A;  2FMM A;  1JC7 A;  1B53 A;  2EJM A;  1MSH A;  3NQI A;  2PYK A;  1C8C A;  1FGB D;  3MTS A;  2FFK B;  3I90 A;  1D5Z C;  1VMP A;  4RGN A;  2NTT A;  3H3V C;  4FO2 A;  4RKB A;  4HSV A;  1JOQ A;  4K8I A;  4F8M A;  1EYD A;  3CU7 A;  2NN6 G;  1BOS A;  1WTP A;  2EYH A;  3PMF A;  5I9O A;  2Z4I A;  5K36 G;  1Q1B A;  1CQV A;  1CTM A;  3VR4 A;  2L9H A;  1EEF D;  4HN7 A;  2EY2 A;  1HUN A;  1GUN A;  2E2J B;  2DY8 A;  2WB1 B;  1LTB D;  4FXK C;  3TP6 A;  1EY4 A;  3SR1 A;  1SYE A;  4Q0F A;  3MFY A;  1DOM A;  1TS5 A;  2O5J C;  2IX3 A;  3PO2 B;  4HCE A;  5EKL A;  4MHE A;  1STA A;  1TWH B;  2K03 A;  2O2L D;  1RF2 D;  3I4L A;  2F3V A;  2BA0 A;  1QJO A;  1AZP A;  2O4X A;  4L8J A;  5A2Q L;  3S9W A;  1EQV A;  3TZU A;  3VR3 A;  3S1M B;  4A3G B;  1YNN C;  4ODG A;  3JAM E;  1STY A;  3C1E A;  2CHB D;  2R7Z B;  4G7H C;  3C3L A;  5C3W A;  4ZRZ A;  2F0O A;  2RSN A;  3T16 A;  2J0T D;  2ZT9 C;  3OOC A;  4IN3 A;  1ESR A;  1O80 A;  1AN8 A;  1HA5 A;  4CJ1 B;  1Q8I A;  5C4X B;  1B4O A;  1SAP A;  1V1P A;  3A56 A;  1TU2 B;  2NVQ B;  1DOK A;  4OIJ A;  2SOB A;  1LAC A;  2Q8R E;  4XIG S;  4C3H G;  5DM6 3;  4NKL A;  2B2T A;  2X6G A;  2EZV A;  2ZXO A;  3NQT A;  2CQA A;  2M9V A;  4KHV A;  5CMD A;  5COY A;  1ENA A;  2FMC A;  4QB4 A;  1IYV A;  3GTQ B;  2EYP A;  3PUY A;  5KYI A;  4K14 A;  1CZG A;  4KN4 C;  3BYY B;  3HG9 A;  1ZKO A;  3W3A A;  1Z6H A;  2NN6 I;  3S15 B;  4OL7 A;  1LLR D;  4CBV A;  1OXV A;  3FDT A;  4PMB A;  1VF5 C;  1ET9 A;  3URY A;  2KEC A;  3TSS A;  3KBX A;  1EU4 A;  1A2T A;  1U9R A;  3MWY W;  4RWS C;  1BNZ A;  1VMC A;  2PW7 A;  2BOS A;  1OXS C;  5D3D A;  3ERO A;  3PV0 A;  2VXW A;  4J6H A;  2RVL A;  1Z7T A;  5BN5 A;  4B9X A;  2K05 A;  4CKC A;  1B50 A;  1LT4 D;  2XSC A;  3A55 A;  2K04 A;  1DZ1 A;  2WII B;  2R3Z A;  4G7Z C;  3MXU A;  1EQT A;  1G2S A;  2CW0 C;  3QIA A;  2EY6 A;  1PTO H;  3MZ5 A;  1OXU A;  2KQ3 A;  3GP7 A;  2KCN A;  1YNJ D;  1Q1E A;  4IAL A;  1I4G A;  4HAE A;  3OSO A;  1STB A;  4RGM A;  1JWM D;  3NK9 A;  3MA2 B;  1I50 B;  3L3O C;  2R93 B;  1UAP A;  4NP5 A;  5IOD A;  4C3I B;  3GO5 A;  4FF2 A;  2OT2 A;  1JOK A;  2QCP X;  3HOZ B;  2BDO A;  3P75 A;  3PUV A;  2IWH A;  2KOL A;  4G7O C;  2F0Q A;  4DK0 A;  3KF8 A;  1CA5 A;  3K5M A;  3D3R A;  1I3Q B;  4XYQ A;  3M7G A;  2XWJ B;  5D3I B;  3RUZ A;  4FF3 A;  4RHR A;  3G6J B;  3S1N B;  2JSO A;  1Y1W B;  3C1F A;  1EYC A;  1XX8 A;  2K7V A;  3H91 A;  4A3J B;  4KKU A;  5CV6 A;  2DNC A;  3OWE B;  5ELF A;  1BCP F;  1W6J A;  5C6A A;  1X32 A;  1ZEQ X;  3N52 A;  1A15 A;  5CGK A;  4IFD H;  2A68 C;  2D5D A;  2CVR A;  4KJO A;  1QB5 D;  2LS0 1;  1PZJ D;  3TP5 A;  3D4W A;  4ILW A;  1F77 A;  1QNK A;  3PUX A;  3DWA A;  3AB9 A;  4V0B A;  2OEO A;  1BUV T;  2QEJ C;  1PZK D;  1MSG A;  1PRT C;  4KD4 A;  2LMC B;  1H9K A;  4F7X A;  4DK1 A;  2EJG C;  5ELE A;  1LTI D;  2HUG A;  1KAA A;  3NUC A;  3A8I E;  2JEB I;  5NUC A;  5EJW A;  3J80 E;  2OXP A;  3V05 A;  5HUR A;  1HTL D;  1X3P A;  5IGE A;  1EZ8 A;  1SE4 A;  4EVO A;  2L5T A;  2F0V A;  4ME5 A;  4RKL A;  3P20 A;  3S2D B;  2K5Q A;  2K5W A;  1TII D;  2PO4 A;  1UNS A;  5FLX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...