1EEID

Cholera toxin b-pentamer complexed with metanitrophenyl-alpha-d-galactose
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords PROTEIN (CHOLERA TOXIN B)
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eeiD00
5ELEA 3MFGA 1SE2A 1SJHD 1LLRD 1EU3A 3URYA 4RCOA 1SE4A 1PRTD 3CHBD 1LT4D 2IPKD 2R61A 1LO5D 3BVZA 2AQ2B 3EA6A 1LTID 1SBBB 1STEA 1G8ZD 1JWSD 1B1ZA 5D3DA 2QILA 1LT5D 1CK1A 1LTTD 1EEFD 2NTSA 2O2LD 3BVGA 4DXFA 1I4RA 1D5XC 1FGBD 1SXTA 1BCPD 4Z9CB 4L63B 1TS3A 1BXTA 1ET9A 1KLGD 4UDUC 1PTOC 2NTTA 1D5MC 2QEJC 3TSSA 1V1PA 1EU4A 4RGNA 5ELFA 1LTGD 2XRSD 1PRTC 3BZDB 4RGOS 5TSSA 4RHRA 1CQVA 1CHQD 1TS2A 1SE3A 1UUPA 1KLUD 1HA5A 1D6EC 1PTOB 5ELBA 1JWMD 3GP7A 1I4XA 5D3IB 2RDGA 1LTBD 1V1OA 1ENFA 5ELCA 1PTOH 1RCVD 3BVMA 3DWAA 3DWPA 1SEBD 3R2IA 4C56C 4RGTA 2SEBD 1S5DD 1I4QA 1EEID 2XN9C 1LTAD 1ET6A 1UNSA 1EFID 4OHJA 1BCPB 2XRQD 2Z8LA 1LTSD 1PRTB 3BYYB 3R8BA 2AQ1B 3W2DA 5FKAC 4DXGA 1JR0D 1T5XD 1MD2D 5ELDA 1L0YB 3MC0B 2AQ3B 1D5ZC 1QILA 2XNAC 1L0XB 4K6LA 1S5BD 2IJ0A 1M4VA 2RDHA 4RGMA 1AW7A 1ESFA 1AN8A 1PTOD 1PRTF 1CT1D 1KTKA 1BCPF 1V1PB 2G9HD 1LTRD 1XTCD 3R2TA 1RD9D 1FNUA 1PTOF 1CHPD 1S5ED 2WV6D 3SEBA 3O13A 3BYTB 1BCPC 1EWCA 2TSSA 1LT6D 1LT3D 4TSSA 3DWQA 1HQRD 1JQYD 1TY2A 3EFXD 3V05A 1RF2D 3KLSX 1RDPD 4RH6A 4RHSA 1I4GA 1PZJD 2CHBD 5I4DA 1HTLD 1I4HA 2ICIA 5FK9C 4BWGB 1TY0A 1DJRD 4RFBA 1FNWA 1PZID 1SJED 1F77A 4ZYSA 1B44D 1FNVA 1GOZA 1PYWD 1S5FD 1DYQA 1HXYD 1XXGA 1PZKD 2J4XA 1TS4A 1TS5A 1JCKB 4L6TB 1I4PA 1S5CD 1FD7D 1JWUD 4O1NA 3OWEB
chains in the Genus database with same CATH superfamily
3D31A 5FO7B 1IKLA 4OO1G 4YWMA 1YNJC 5T1IA 1VQIA 4DR1L 4BS9A 1U4PA 2JEAI 4K2LA 1TT2A 2EE1A 4DR6Q 2KOLA 2ENBA 3I91A 3GTKB 1LTID 2QILA 4U673 2F1MA 4JW0A 3WDNA 4A4IA 5IYBH 4K6DA 5M3MG 2Z6KC 3H6MA 1KLGD 4UDUC 4B9XA 4H7BA 3D8GA 4OWTB 1O7ZA 2F0DA 3S17B 3L9AX 1SFOB 4C3JB 1HNXQ 4UPAA 1MJCA 1Q81C 5IWAQ 3M4YA 4DAYA 1N33L 5NUCA 3TREA 3F1ZA 3K59A 2EZVA 4JI2L 1G2SA 5HURA 1W6JA 5IE8A 4H0LC 1PFNA 1K0RA 1ET6A 2PPBC 3FPPA 2MPMA 4B3TQ 1SSOA 2YU9H 2ICEC 1HZAA 3BZKA 2N88A 1IHZA 5JJIA 1PH5A 4GKKQ 1D5ZC 4H02A 1SFOH 1HZBA 1VQFA 1XPOA 1K83B 1YVCA 1K3BC 3VYTA 2SDFA 1HHVA 2BH8A 2RDHA 4A3EB 2MQHA 4YWKA 5C4ZA 1VQ7A 1XWEA 3HOXB 4CJ2C 1FNUA 4GOPC 1VF7A 3GTGH 4MNOA 2PI2E 4LF9Q 1NCVA 1RODA 4TSSA 3TP8A 1J9OA 2L0CA 2FMMA 2OEOA 1JOOA 4CJ0B 2UUBL 3U9SA 2F0WA 3R93A 5FJ8H 4DR3Q 2RA4A 4HJ5A 1IXRA 2CHBD 1B53A 1VQPA 4OX9L 1SJED 4FO2A 3TBIB 3PIO3 1DYQA 2K03A 2QF7A 1IW7D 3M85A 1RTNA 1ZEQX 5DM63 2MNAA 1DGSA 3RR5A 4K2KA 1XPUA 3OWEB 1HZCA 2KHJA 2JE6I 3GTOH 1II3A 2J7ZA 1YBYA 3TQYA 4DAMA 5JJKA 1EIFA 5LL6X 2IL8A 1X9NA 4IN3A 1ICFB 3IFDA 4HEDA 2F4VQ 3S1QB 2EYHA 4JI2Q 5JVH3 4LW1A 3H3VC 1YHAA 1XNQQ 3ULJA 2E76C 3ICEA 2BH2A 4LF9L 3HOYG 2B63G 4GKKL 1TQOA 1L0WA 2I5LX 3CC2A 4OO1I 2E5LQ 2UUCQ 4E6IA 3F8TA 5CV5A 3HOZH 3PUYA 1KLUD 1XMOL 4HIMA 1SLJA 4POGA 5E3FA 3BJUA 5D3IB 3V2TA 4RA8A 2A69D 2EQSA 3LX0A 4YCWA 5EQ0A 4A3GH 4C1NK 3UDIA 3K8AA 1N34L 1B2TA 1NY4A 2C35B 3RLNA 1OO9B 2F0HA 4OIKA 4DXGA 5GQOA 4HJAA 3A8JE 3KF6A 4JI7Q 4BBSH 1GUSA 1FVIA 3RZDB 1IBML 2K32A 1JE4A 2IT1A 4L8JA 1J5EL 2QKIC 2D0PA 5IYCH 3T53B 4DF7A 1Q90A 1WCMB 2JA8B 3M4OH 1UEBA 2K75A 3SEBA 1S5ED 5KIXA 2VQEL 3PV0A 2E2IB 5I6WA 4ALPA 1BCPC 5JPNC 1X56A 1TKWB 3A54A 5IIFA 1E1TA 4DV2L 2ZTDA 2B2VC 5IYCG 4JCVE 3VYUA 2NVYH 1RIPA 4QJFA 3EN2A 5E1FA 1PVOA 4CKBA 2HCCA 2PO4A 3HOVG 1TS5A 1X55A 4L6TB 2D0OA 4A3EG 5IGGA 4XT1B 4POFA 2UUCL 2XWBB 1ASZA 4JI1Q 4NB3A 5C5MA 1OXTA 2WAQG 5M5YH 1V1QA 2ZTCA 3F2CA 4A3FG 3WOFA 4LUOA 3OW2A 3E5SA 3GD7A 1STHA 4P73A 2HUGA 3HOWH 1QWYA 2EYLA 2E8GA 1YI2A 3QG1A 4BY7G 4HIDA 4A3EH 2VQEQ 5GAEC 3ZYYX 1E2ZA 1HTPA 5C0XG 1GUWA 2A5HA 1DOLA 1GUNA 2RQXA 2FHTA 4A3BG 3DM1A 1IBMQ 3S14H 1U5KA 4DV5L 1I6HH 4R8NA 1VQMA 1WCMH 1J5EQ 2JA8H 4A3FH 5ELFA 4IOAA 3Q22A 4KK7A 4RHRA 1CHQD 4KJOA 3VA5A 3CCSA 4HAEA 1JWMD 4XDXA 3NWSA 1A15A 1YNJD 4JC0A 2AWOA 5C0XH 3RMHA 1TXYA 4Y52H 2KEDA 3GQBA 2MGSA 2Z8LA 1H9JA 2B2VA 3W2DA 4DPGA 1GUTA 4N9TA 4LMQD 1YHBA 1G6PA 5C6AA 1QILA 2UXDL 4A3JH 1S5BD 2EY1A 2WAQE 3S16B 4JBJA 1E1OA 4RGMA 2QDBA 2BE5D 4DAPA 4EVOA 3QOLA 4S3SA 3TDQA 1K8AC 3J80E 4B9WA 2GVBA 3E9IA 2V4DA 1Q46A 3EBEA 2C5CA 4ZLTF 4HJ9A 1CZGA 1FJGQ 4WJ4A 1SDFA 1D7QA 4LF8Q 5DLQE 3H91A 1L2FA 1A2UA 2PCFB 4NP5A 1I94Q 3RLOA 4ZYSA 1N33Q 3K5LA 3KJOA 2N55A 2JYOA 1Y69U 4ZQ3A 1E7ZA 1SR3A 4DR4Q 4X65L 3RLFA 2JJQA 4A3GB 3NTIA 3CRKC 1PH9A 4V0BA 3S15B 3SVMA 5CV7A 3HOWB 1PH4A 3URYA 1SYEA 1HQMC 4CJ1B 5I6YA 2A8VA 3CHBD 1B7YB 1SNQA 1QZGA 3BG3A 4MTKA 3W5OA 1K28A 2B2YA 1EY5A 2A6HD 2JA6G 2ZM6Q 1K0SA 1R9TH 1RL2A 5IGCA 3Q23A 4IUPA 3UDXA 1ILQA 3S1NB 2B2WA 3GTGB 2KBNA 4HCSA 1HNWL 1A3VA 1TIID 2EY2A 3A56A 1ET9A 4X3SA 2L15A 3GTJB 1CUKA 3U50C 2Z0SA 3KK7A 5CMDA 4DUZQ 4FXDA 2VQFQ 1DCZA 1HRJA 5ELOA 4IUNA 4GS3A 2YV5A 2JA9A 5LMUL 2JA6H 4A3IB 1PTOB 1PHJA 4HN7A 3HKZG 4TKOB 1NAPA 4OGQC 4X3KA 2EIFA 3F2DA 1HR0Q 1N32L 3DWAA 3ULLA 2YTYA 2CQAA 4QF4A 4G57A 2Q2UA 3SK5A 3DUZA 1CA6A 4IFDI 2ZJRA 3VYSA 1C4QA 3WWVA 3J80L 1Q1BA 1B50A 3PF4A 4BY1G 2L5TA 2IJ0A 4EQPA 3GTPH 1ZYRD 3PQIA 4DKAC 3SDZA 1Y1WB 5IYBG 1YJ9A 1PRTF 4N8FA 2L1BA 1XNRL 4A93G 2TSSA 1MBYA 1EIHA 2RDFA 3VYRA 4R4OA 4XIGS 4IQZA 3EFXD 5JEAJ 3TEHB 3PIPA 4X62L 4HIKA 4BY1H 5KGUA 1SNCA 2VQFL 1F2LA 1I4HA 4HJ8A 5IY0A 1DJRD 4KHPQ 4AYBE 1B44D 1YNXA 5EKKA 3F2BA 4A93H 1CKNA 3J80c 4BBSB 1N34Q 4K5XA 1I3QH 1STBA 1STNA 1SAPA 2VY3A 4Q0FA 1G2TA 4B3SL 3HOYH 4B3ML 3C46A 4G7OC 2NZOA 1LT4D 3L3OC 2ID0A 4XQNA 3S17H 4R4TA 3AEVA 4GN4B 2K1BA 2N8NA 4AQYQ 3BDLA 1STYA 3Q6SA 1KRTA 4KN7C 1V8QA 4EQNA 4MTNA 4RKBA 4DR5L 2O2LD 2JP1A 3GTQB 1BBXC 1XPRA 1VMPA 2LSSA 4ZUJA 2F0IA 1PTOC 3MAQA 4JOIC 1V1PA 2AUKA 3G6EA 1L1OA 4L5QA 2EY6A 1SNOA 2YU9B 1JB3A 2XRSD 3DXJC 1TVXA 5IGBA 1A63A 4OONA 2QEXA 3PUWA 4KD3A 3H3VH 1F9SA 5ELCA 4KKSA 3AB9A 5C3EB 1YJWA 2GN5A 5BN3A 3I4NH 2KJXA 2A19A 1WTWA 2UU9L 4LF5L 4YCVA 4JBKA 3OSOA 3FDTA 5C0XJ 4OL7A 3R8BA 3P1HA 2F0KA 3NP8A 1EOVA 3FP9A 2EPBA 4PG3A 5EPLA 3UE0A 3MHBA 4FF2A 2CH4W 1D1KA 2PZWA 1ESFA 2NZ1D 3DM3A 1QOHA 5CV6A 1XMQQ 1V1PB 5K36H 5ISRA 3AQQA 1EQTA 5J39A 4DAYB 1WTPA 1Q86C 4DV7L 2Q2IA 4JBMA 2IHEA 1UAPA 4RHSA 5A2QL 1AZQA 3FRPB 3J7ZC 4ULLA 1EQQA 4LF6Q 4A3MG 1PDQA 5E4WC 3HOXH 1JMCA 3Q0AA 1F77A 5KNBA 1GUGA 3GTQH 1NSNS 4UP8A 4LK1C 4R4QA 3IKJA 5ELNA 3B6YA 1KABA 1X54A 4BBSG 4QL5A 4X6AH 1A62A 1JWUD 2K04A 2L55A 1IBKL 2L4NA 1VQCA 2NYZD 1SJHD 3A0JA 4KN4C 4DR2L 4K14A 3A8IE 1C0AA 2R93H 2R92H 4YHHQ 3KDFA 3CCJA 2QCPX 2RHQB 4TVAB 1SROA 3E0EA 2UXDQ 3RZOB 3HFZB 4KHVA 1WFQA 2F0EA 3PO2G 2I07B 5JJLA 2A1AA 3J7YW 3NSWA 3RZOH 3OW7A 1STEA 1HNZL 1KD1C 3A55A 4UHVA 5M5YB 2K4KA 4M1UB 3LWUA 1FGBD 1GHJA 3D6CA 2GA4B 4XXEA 5K5PA 2EYJA 1Y14B 4DV6Q 1VQOA 2CWPA 1SNMA 2IX0A 2VZAA 2YYZA 4JVZA 4X3UA 4ME5A 1JOQA 4K5WA 1C8CA 3T1HQ 3H0GG 2K14A 5TSSA 4PZ6A 4EQ5A 2LKVA 1UUPA 3PO2H 4FF3A 5IP7H 3VR2A 5J22A 5HY6A 4N9PA 3G4SA 4BY7B 1QCBD 1MI2A 1I4QA 2RKSA 5M3FH 3E3XA 2I5MX 2A68C 4LFAL 2B2TC 5F2DA 2KQ3A 1F2ZA 3H0GH 1OXSC 3H15A 3HZXA 2X6GA 4LFCL 3HOWG 3HOZB 2UXBL 2E2JB 1TWAH 2L9HA 1JOKA 4JI8Q 2CWAA 4XT3B 4IFDG 2DN8A 4Q5VA 2Z9HA 1KTKA 2D9UA 1EYCA 4A3BH 2P5ZX 2IWHA 2MO0A 3I90A 4DV1Q 1TWGH 4ILWA 5EPJA 4A3IH 1KXLA 3D4RA 2WFWA 4J8QA 2F0LA 1I4GA 1F9PA 2N49A 3T1HL 1TWAB 5I4DA 2R7FA 4P2CB 1QG7A 3TP5A 1BNZA 4DV3Q 1QVCA 1YIJA 2F03A 4CKCA 1PYWD 1LABA 2K5NA 4QIWB 3H09A 4NPSA 3QOJA 3D6WA 4H13C 3QO2A 1JCKB 3K0YA 3FKIB 4NDXA 1KQSA 2VW9A 2LXJA 2F0VA 5ELEA 2JXMB 2RVLA 5EAYA 4LFAQ 4ABNA 3A5UA 3KLSA 1DM0B 2K28A 5E4XA 2R7ZH 2IY5B 3STBC 4OXPA 2K7VA 1YEZA 2A6ED 2IPKD 1T9HA 3BVZA 5CORA 1NR4A 2QW7A 2VB3X 1PH3A 1SBBB 4C2MB 3RNUA 1XNRQ 1Z7TA 2KENA 1ZXTA 1EEFD 1LUZA 1EZ8A 3FEWX 4RCNA 2LY7A 3KYHC 4B08A 2CW0C 2F3IA 1Y8PB 1IBKQ 1CM9A 3EIVA 4IURA 4PV1C 5C3XA 1TS2A 3HGBA 4JI0Q 2L11A 3IAYA 3GP7A 2ZJPA 2B2TA 4WJ3M 4G7ZC 1Q8IA 2DY8A 4DAVA 3I4MG 3TZDA 2WINB 3NXWA 5M5XB 2HHHL 5I9PA 3S15H 2PNRC 4A3CH 2A6HC 4UP7A 1ENAA 1EY4A 5FKAC 3NBIA 2WACA 3RN5A 4B3SQ 3M4OB 4B3RL 4DV3L 4YY3Q 4K6LA 3RD4A 3SGIA 4KY5A 3CP0A 1PTOD 1GO3E 3SHLA 5IODA 3UI2A 1BCPF 3VR6A 1RD9D 1PTOF 2WV6D 4IUVA 3CCQA 5J3BA 2VL6A 1BUVT 2EYOA 1ONLA 3S2HB 3AYHB 3MXPA 4I65A 3GV3A 2EJFC 1VQBA 2VS1A 4HSPA 1Z9FA 1EOTA 3VDYA 1G6ZA 2RSOA 4DFAA 2E5LL 1VQKA 1GJXA 3I8ZA 4KTAA 3E9HA 1KAAA 4IZ8A 3HOUB 3QJYA 2V1CC 1WYDA 4BWGB 4NXML 4R1JA 1F9RA 1X3FA 1N36Q 2ES2A 3TS2A 4BXXH 3NTHA 1VDZA 1XX8A 2O4XA 2NWGA 3NUCA 1EIYB 1AE2A 1BKBA 2QDLA 1CA5A 1V9PA 1SE2A 1EWIA 2E2HH 2LXKA 3QB3A 2XTIA 4K5VA 2PI2A 4KV6A 3MEFA 1DOKA 4HMJA 3OIQA 1K3RA 3J81c 1NJIC 2R61A 5KYIA 4ZKBB 1PFMA 3LWEA 2OF1A 2EYFA 2G5DA 4IUQA 3NQTA 1CK1A 1JJCB 3UDFA 2AHOB 2NTSA 2Z4HA 3EQLC 5FOBB 4A3BB 1TS3A 3I4NG 3PMFA 2EJGC 4B3RQ 5KYLA 3A8KE 2PQAB 1QJOA 1LTGD 1M90C 2NN6H 1PRTC 4RGOS 5DNFA 5FO9B 1HUNA 1PFSA 4HMIA 4F88A 2R6GA 1LV9A 5C4XH 3KJPA 3CRLC 4P74A 2QGQA 1WTVA 3OWFA 1ENFA 2TMPA 4PNYA 3DMUA 1PH1A 4R4IA 3S1MB 3HKZE 2SEBD 1KIXA 1EFID 5C0XI 5JJZA 1SE8A 3A74A 4JI1L 4LF4Q 3ERSX 5FO8B 4A3JB 2VUMG 1T5XD 3OHXC 4C1NI 2D2CC 2HQLA 4WJWA 1YITA 5C4XG 1K83H 1CZWA 4A3FB 4DR6L 3IRBA 4LFBL 4IPGA 1O7YA 2WIIB 2Z4IA 5T1GA 3W1BA 5C44G 2QA4A 3G7LA 2B29A 2FINB 3A7AB 2BOSA 1MGSA 3PGZA 3D0FA 3R2TA 2AUJD 5CBAE 1MJEA 1GM5A 1CHPD 4A3LH 1PH8A 1SRUA 2B2UA 4I7ZC 4JI5L 5L37A 3SR1A 3J81L 5H1SE 2PW7A 3DEOA 3CCUA 5LL6S 2A69C 5CV9A 3PO2B 2SNMA 4DK6C 2KHSA 1W3SA 3T4AC 2GVAA 3ND8A 4FP5D 5JOBA 3MXNA 4HR7B 3EROA 5GAGC 5KEEA 3MXUA 2HCIA 5FK9C 5FLMG 1LACA 2F3WA 5CR3A 1Y1VH 1I5FA 3CXCA 1OTCA 5IYDG 3N52A 5KNCA 1VQEA 3TRZA 1I4PA 3I55A 5GROA 4O1NA 1G91A 1WTXA 3G6JB 4CDEC 3RUZA 1VQ8A 3K7AH 1PH7A 4QUCA 4RCOA 4C3JG 1C48A 4LFCQ 1S40A 2F0GA 3FVQA 4DUYL 1Y1VG 4DK1A 1MHWC 3GTMB 2O5JC 4OX9Q 1BR9A 3TP7A 1JWSD 3I73A 5JEAH 2CVRA 1QE6A 2MHVA 5C3WA 4DV1L 3HOXG 3N6RA 4KMUC 4JI7L 3NBHB 2Q2TA 2F0OA 2QEJC 1EU4A 3L2PA 1HA6A 1ZKOA 1HCZA 1Q8KA 3MZ5A 1U4LA 3OMGA 1D8LA 1PH6A 3CCLA 3CPFA 3NEMA 1HA5A 1WJJA 3OIPA 4LAAA 4HIOA 2DJGC 4IJLA 3BS1A 1H95A 3SK4A 5M9OA 4DR4L 1LTBD 2I5HA 3CW2C 3U9OA 5HGTA 3S1MH 4RGTA 1EWHA 5FLXE 2DNEA 2X69A 3KDFB 3K58A 3TMEA 3C3LA 1PRTB 1J6QA 1HUMA 2LS01 1JR0D 1KDBA 3I4LA 4F8MA 1AFPA 1KDAA 3PO3G 4ODGA 4BY7H 2NN6I 2CW0D 1KC8C 2FJ2A 1EFWA 3J81j 2Y0SE 2JA6B 4L5TA 1HH2P 1UWVA 1CSQA 4AYBB 3I3CA 2KCCA 3L7ZC 1HJPA 1TY2A 4FF4A 2IX1A 1GVPA 2NVTB 3J81i 4DUZL 1G291 1S72A 5IP7G 1JICA 2SNSA 4BA2I 2DGYA 1NNXA 2BDNA 1XMOQ 3JAME 1LTLA 1PYBA 2KEEA 5M3FG 1YNND 2C9OA 4I7AA 1A8VA 4XTCS 2XWJB 5CV4A 1XYIA 1FNVA 4DV4Q 1HR0L 4J6HA 1N32Q 4J15A 1TS4A 2A68D 5KNDA 1U4MA 2HHHQ 4BBRH 1CKOA 2UXCL 4IALA 4RG1A 4GLVB 1NTGA 3T16A 4IFDH 2IHFA 2OQ0A 3IL8A 2JK8A 2M9VA 2X6LA 3E0JA 1GHKA 4R8IA 1KAWA 1X3QA 3GTOB 4O0AA 1X3PA 3X3MA 2E74C 4KKTA 1WOCA 3I72A 4ME3A 1Q7YC 2SOBA 4K0KL 4JI6Q 5BN4A 4A93B 3QIAA 1VQJA 3PUZA 4Z9CB 1EYGA 1PV4A 1L1OB 4A3CG 3KF8B 2JA7B 4YWLA 1VF5C 4DNIA 2JA7G 4GLAC 3HS0C 4C2MH 3KUPA 1MSGA 1ENCA 1Q1EA 4OWXB 1H9RA 2NB0A 2D5DA 1EIGA 1P16A 5CGKA 2B2YC 1O7IA 1UEAB 1BO0A 2JN4A 1STAA 1UNSA 3K80C 5D14A 1U4RA 3UE1A 3GO5A 4LF8L 1BCPB 4A3KH 3K0XA 2JA7H 4B3MQ 4GZYC 4FDBA 2PQEA 3K5NA 1EL0A 1QUQB 1NMGA 1L1OC 4ZAIA 4NXNQ 4HTHA 2ZT9C 3X3NA 4CDCC 2EJMA 2XIWA 1HNXL 1AN8A 3WOEA 4AQYL 2LMCB 2F4VL 3HP3A 4X65Q 1NMFA 3OMCA 5D65A 4QUFA 2ZXRA 1HFNA 1FR3A 3G48A 2OCEA 4KHZA 1QZHA 3VA7A 4JI6L 1E0BA 1WI5A 2Y0SG 5C3EH 3V05A 3T1YQ 5G3LD 1DXMA 1BBWA 2K5DA 1BDOA 2F0PA 3BDCA 2ALYB 3A7LA 1VQ6A 1VMCA 2ICIA 2KCNA 4QY7A 4R9WA 1Y1WG 1CQFA 1FNWA 1G51A 2NZHA 1PZID 4F7XA 1XNQL 1XXGA 1XTDA 4DNRB 4CDFC 1PZKD 1IW7C 2ZXPA 5C3EG 1EZ6A 5EJWA 2PZTA 2D62A 5DEHA 3I7FA 5M3FB 2BDOA 1FJGL 4F87A 3MXGA 4GKJQ 2UUBQ 4LNQA 2B2WC 1W2BA 2NN6G 1DOMA 4L5SA 4OEMB 1VQAA 2B3GA 4OIJA 3CCMA 3EA6A 4JPBW 3T13A 1I94L 3GDEA 1TU2B 1B3QA 2KECA 5D3DA 4DV4L 4ID6A 3S1RB 1H9SA 3NPPA 1I6HB 1OXUA 4BY1B 2F0UA 4IPHA 1HFGA 3ITPA 1K8OA 1KDCA 4A3DB 4MZ9A 4A3DG 2DNCA 2F0QA 2VUMH 4DV2Q 3M7NA 4BXXG 3MEHA 1VQ9A 1SE3A 5FJ8G 2NVTH 2HDLA 4GOPB 4GOPA 1I3QB 4C3IB 1F2MA 4C56C 5IT9L 1YZ6A 1VS0A 3VR5A 4GNXC 4ZRZA 2E2IH 4K0KQ 2EOTA 4HCEA 3QR8A 3NTKA 2K52A 4A3DH 1EY9A 3EVQA 5IP9H 2F3VA 1MD2D 4YHHL 4GN5A 3S9WA 1UE1A 1WTQA 4MIUA 5IT9E 4DK3C 5JVG3 1E2WA 3GV6A 3ER0A 1BOSA 2K05A 2CQOA 5FLMH 3QWNA 1LYLA 3TZUA 1I6VC 3JC66 4LUZA 1M1KC 4XQQA 1TWFH 5COYA 5IYDH 2KA7A 2FXQA 2JEBI 3TS0A 1EY8A 4LWCA 5IP9G 1EYAA 4RH6A 3VR4A 2BCOA 4PQXA 3D4DA 4AYBG 1TR5A 3R3OA 1ICWA 3M4PA 5C4XB 2WB1B 4IUUA 1EY0A 5LMUQ 2VNUD 1MSHA 1U0LA 4PZ8A 1N8RC 1V43A 1H9SB 1JE5A 1JT8A 1X3EA 3FKIH 4FXGC 2J0TD 1YJNA 2F52A 1TWCH 2CKZB 2VXWA 1UE6A 4JV5Q 1VQ4A 2CFMA 3OOCA 3MFGA 2B8FA 2PW5A 3U4VA 2G9DA 1LLRD 2I46A 4KY7A 4KY6A 4NMZA 5C44H 3GTLB 1H9MA 1SE4A 1Q12A 5EBDA 1KHIA 4GN3B 5K36G 3K7AB 1F2YA 5C44B 4A3LG 3JAMi 2Z1CA 4V190 1PFBA 4AIMA 3KLRA 5DAUA 3NK9A 2AQ2B 2L12A 3HOYB 3KBXA 3ULPA 3K5OA 1EQVA 3S1RH 2F0SA 4K8JA 1QVFA 4QIWE 4R4CA 4A3MH 1SXTA 2PYKA 1VQLA 2HDMA 2Q8RE 4JYAQ 2CCZA 3CC7A 1D5MC 1SYBA 4XYOA 1E24A 2NVQH 2N78A 1CQVA 1HPCA 3K57A 4GKJL 5J1ZA 2A74C 1X32A 3MFYA 2LFNA 3NHHA 1Z47A 2EYMA 3S24A 1WVLA 3SXHA 2JQOA 4Y7NH 1K73C 1PTOH 4CKEA 5A2QE 4FXKC 2RF4A 2XGTA 1S5DD 1O78A 1EEID 4C3JH 1LM0A 1LTAD 5AJ3Q 1AZPA 1A3TA 4HSVA 3H3VI 3CCRA 3GTJH 2E2DC 4IUTA 5ELDA 1EQRA 2XNAC 1TWFB 1WTRA 5JEAG 2A73B 1IZ6A 2EY5A 3PIOA 1M4VA 3UDGA 1BBUA 2NUCA 4IO9A 3OTOL 3CMAA 3I4NB 1SNPA 1XTCD 2K5HA 2PZUA 2HT1A 1CSPA 4P71A 5HGQA 3ONAB 4JV5L 1LT6D 5EKIA 1EY7A 1HQRD 2RCNA 3CQZB 3DEPA 2AMCB 1RF2D 4DR2Q 2AKWB 4BBRG 1JJ2A 4LF5Q 3I70A 5FLXL 5GAHC 1M8AA 4P75A 1B9NA 1PZJD 1MIUA 5IGFA 1A6XA 1OXVA 4ZCKA 4FVMA 4JBWA 1AP0A 2OQKA 2PMZE 1WCMG 2JA8G 4A3KB 4CGYB 3KOJA 4QMGA 4BA1I 5A35A 2UU9Q 3I4MB 3K6OA 1FD7D 4DV6L 4G7HC 4DR7Q 4QQBX 1UE7A 1BVSA 2FMCA 1E2VA 3CF5A 1C9OA 3T51B 2B39A 4BBRB 1RTOA 3MA2B 1K8MA 4C3IH 1ILPA 5IT9c 1VQDA 3KLWA 5C4HA 4M8AA 2F0FA 2UUAL 1GKHA 1VQGA 3LNNA 5IOCA 4WRDA 1B1ZA 5AJ3L 2ZJQA 1LTTD 4UAIA 3ERQA 1QNKA 2JSOA 4DV0L 1VQNA 1CKNB 1WTOA 1BXTA 5CC4A 3SE0A 2BE5C 4C3IG 3HKZB 3GTPB 1S3OA 2WB1E 4XYQA 2Z6BA 2RSNA 3P75A 2M00A 2WAQB 3J7AF 4NXMQ 2Z6KA 2HQEA 4KHPL 1OXXK 1IKMA 2VB2X 3D3RA 2B2UC 3M7GA 1ML0D 3SK8A 1RCVD 3Q24A 1IBLL 2ZM6L 4JI4Q 1SYGA 2R7ZG 1A0IA 4ZUIA 4X64Q 4X62Q 2F0TA 1PLFA 3J81E 1LTSD 1JJGA 1A3UA 4PMBA 1I50H 4RKLA 1P8LA 1KL9A 4C3HH 2KUMA 4JYAL 2OTJA 1L0XB 2ZXOA 1E22A 4A75A 3ZJYC 1RHPA 3RZDH 2KCTA 2Q2HA 1VCIA 2B8GA 1EUJA 1J8IA 1SMYD 1WTHA 2AWNA 4MHEA 4APVA 2XVSA 2BA0A 4DR7L 1EWCA 3D4WA 3CCEA 4EQOA 1BQQT 3DWQA 4DNTB 4EGVA 5G3LF 1R9TB 4CDDC 2A6EC 3RN2A 3IFTA 1GXDC 4FYDA 4A3MB 2KHIA 4DV5Q 4IJHA 3CC4A 3I4MH 2UUAQ 4RFBA 3TN2A 2ASBA 4KKUA 2RHSB 2OT2A 1WD0A 1CI3M 1QB5D 4IOCA 4EX5A 1S5FD 5BR8L 2Q8IB 2OXPA 2J4XA 3CU7A 3J80i 3S1NH 3TP6A 1X6OA 4DV0Q 1SNDA 1S5CD 2JA5G 2OWOA 3J7A5 5JAVA 3CKIB 4QGUA 2IX3A 1JB7A 2UXBQ 2DJFC 3J7AV 4UP9A 5KRUA 3AMUA 1SYCA 3GTKH 4X3TA 1PXUA 1X3GA 1CKMA 2H5XA 1O80A 5LMNW 3I56A 2IW3A 4PMCA 5C4JB 1LT5D 4ZKCB 2JA5H 1E3PA 3FPUB 3KBGA 1I4RA 2R7ZB 3HKSA 1FYCA 1H9KA 4OO1H 1R4PB 1ZYRC 3KF6B 1Y1WH 3DHQA 2NTTA 3H0GB 5LMNQ 4YY3L 3F2UA 3CQZH 4KJNA 2K50A 1U9RA 3U4ZA 5EGTA 1XJVA 1TWHH 5ELBA 4L5RC 2K33A 1N9WA 1Q3LA 3JAML 2RDGA 2ZTEA 3BVMA 1B9MA 3PSIA 5BR8Q 3R2IA 1IL8A 5M3MH 3CMEA 3PUVA 4DV7Q 3W3AA 5EKLA 2XN9C 1KRSA 3I4OA 4DR5Q 1Y1VB 1B3AA 4LF6L 2E75C 3MWYW 4DR1Q 2PNHA 4QCLA 1FL0A 3MC0B 2AQ3B 4DUYQ 4J1MA 1D1IA 1ASYA 5CYUA 2MJ8A 2N3SA 4DU9A 5CBEE 3EJIA 3PIP3 4JK1C 1Q82C 1QNUA 1HNZQ 1QVGA 3FKIG 3S2HH 2NVQB 2KCMA 4PMWA 2Q8TA 1HNWQ 3HOVB 1IBLQ 4JI4L 3M3YB 3GTLH 3T56B 2I0QA 1JORA 1TWGB 2BA1A 1B8AA 2PQAA 5LMNL 1O7LA 1DD2A 5IWAL 4JI0L 4CBVA 4H44C 2HD3A 1Z6HA 1PMRA 1EYDA 4ZK9B 1R4QB 2K01A 1VQ5A 3BDOA 2EYPA 3P20A 1XMQL 1SN8A 4P72A 3HOZG 3A5ZB 1NUCA 4K8IA 1EU3A 1Y8NB 2F0NA 4DK0A 2R93B 2K5QA 2K5WA 2Y0SB 2KVMA 1NBWA 1CFMA 5I2XA 1LO5D 2ATWA 2DY7A 3C1EA 3C1FA 3OTOQ 1QUQA 1F9QA 5FLXc 4UY8C 2MUYA 4GNXB 4GNXA 3HRZC 2YTVA 3K81C 3BVGA 4DXFA 3AU7A 4GLXA 3NBHA 1BCPD 3PF5A 1D2BA 1FGUA 1K8GA 2R3ZA 4DR3L 1K9MC 4RGNA 1NR2A 4JI8L 2H4OA 3OPOA 2MO1A 3STBD 1IL2A 5M3MB 1HZ9A 3GTMH 4MN3A 2F0JA 3G71A 1HR0W 4LUVA 5I2YA 3FHWA 2B63B 1EY6A 4A76A 2EXZA 4RMFA 3DWPA 1AE3A 4X66L 1YHQA 1ESRA 1KNAA 2R7DA 1MKHA 2B63H 3V96A 2M2LA 2UXCQ 5IGEA 4OHJA 5CV8A 4FF1A 2XRQD 4LJZC 3AFQA 4YCUA 1SYDA 2AQ1B 3HOVH 3I2ZA 4NKLA 4CHTB 3U58A 1L0YB 5LHY1 3L0OA 3PCOB 2E2JH 3HOUH 3E6ZX 3OYYA 3LGJA 4JI3Q 2NVXB 1W6KA 3NENA 1RJTA 5E7NA 4LF7Q 1AW7A 3VR3A 2OTLA 1RKNA 4A3GG 1CT1D 3HG9A 2R93G 4XQJA 1LTRD 2R92G 1STGA 3O13A 1NE3A 1LT3D 5M5XH 1B4OA 4NW2A 3MTSA 4PZ7A 4HJ7A 3M3YH 1DONA 4DGZA 1RDPD 4N8X1 3BZCA 3ND9A 2E2HB 1X65A 3HOUG 3S16H 4G4KA 4LF4L 3NELA 1S4ZA 2R92B 1UE5A 1HTLD 5C4JH 2JA5B 1KNEA 2WB1G 1TY0A 4Y7NB 3HEJA 4DN4M 2CH4A 4KLKA 3BU2A 3K7UC 2YTXA 2HIXA 3FMCA 4O42A 1CTMA 4OELB 4IPCA 5AFWA 1HXYD 3C2PA 3PO3H 4X64L 1IYUA 3JAMc 4JI5Q 1SMYC 3PO3B 1DZ1A 1PRTD 3S2DB 2F0MA 2RBMA 2H1EA 1A2TA 2EXDA 4NXNL 4KI0A 2O5IC 4LFBQ 2HIVA 1SYFA 2EDGA 3S14B 1JC7A 3Q8DA 3W1GA 4X66Q 3P7JA 4OWWB 1TWCB 3K5MA 3AFPA 1G8ZD 4A3JG 2VUMB 2WKCA 4B3TL 5DM73 3H94A 1D5XC 1SMXA 3T1YL 4L63B 3PUXA 1WD1A 1I50B 2DUDA 5BN5A 1AEXA 4FNFA 5C5LA 3TSSA 4TQUS 3M9BA 1IYVA 3BZDB 4LF7L 3M4QA 1AH9A 2MFIA 2NVYB 4A3IG 1D6EC 2WKDA 1PA6A 5I9OA 3S1QH 1I4XA 5JPMC 1B70B 4TRDA 2FFKB 1V1OA 1N36L 1C7YA 4DA2A 1SEBD 3SK6A 3NQIA 2MP1A 1Y8OB 4RAUC 2K5VA 3BYYB 1YNNC 1GD7A 3CD6A 5M5WH 1VQHA 2RCFA 4JOIA 3DLLA 2NVXH 4IPDA 5M5WB 1PH2A 3MVVA 2WP8J 2G9HD 1PYSB 3KF8A 2EVBA 1GUOA 2PMZB 3BYTB 4C3HB 4QB4A 4IFDJ 3MXNB 1JQYD 2F4IA 1TWHB 4WORA 3KLSX 1T5EA 3NWTA 5EPKA 3CCVA 2NBFA 4O2DA 4RWSC 4U68A 4WFN3 5IGDA 5EBCA 3NE5B 3CPWA 4JI3L 5GADC 1IYJB 4AH6A 4A3KG 3CAMA 1BF4A 2K6AA 2XSCA 4YIJA 3S2DH 4JG2A 1GOZA 4C3HG 4KD4A 3KFUA
chains in the Genus database with same CATH topology
3D31A 5FO7B 1IKLA 4OO1G 1YNJC 5T1IA 4BS9A 1U4PA 2JEAI 4K2LA 1TT2A 2EE1A 2KOLA 2ENBA 3I91A 3GTKB 1LTID 2QILA 4U673 2F1MA 3WDNA 4K6DA 3H6MA 1KLGD 4UDUC 4B9XA 4H7BA 3D8GA 1O7ZA 2F0DA 3S17B 3L9AX 1SFOB 4C3JB 3M4YA 4DAYA 5NUCA 3K59A 2EZVA 1G2SA 5HURA 1W6JA 4H0LC 1PFNA 1ET6A 2PPBC 3FPPA 2MPMA 1SSOA 2ICEC 2N88A 1IHZA 1D5ZC 1K83B 3VYTA 2SDFA 1HHVA 2RDHA 4A3EB 5C4ZA 1XWEA 3HOXB 4CJ2C 1FNUA 1VF7A 1NCVA 1RODA 4TSSA 3TP8A 1J9OA 2L0CA 2FMMA 2OEOA 1JOOA 4CJ0B 3U9SA 2F0WA 3R93A 2RA4A 2CHBD 1B53A 1SJED 4FO2A 3TBIB 3PIO3 1DYQA 2K03A 2QF7A 1IW7D 3M85A 1RTNA 1ZEQX 5DM63 4K2KA 3OWEB 2JE6I 1II3A 2J7ZA 5LL6X 2IL8A 4IN3A 3IFDA 4HEDA 3S1QB 2EYHA 5JVH3 3H3VC 2E76C 1TQOA 4OO1I 4E6IA 5CV5A 3PUYA 1KLUD 5E3FA 5D3IB 3V2TA 4RA8A 2A69D 3LX0A 5EQ0A 4C1NK 1B2TA 1OO9B 2F0HA 4OIKA 4DXGA 3A8JE 1GUSA 3RZDB 2K32A 1JE4A 2IT1A 4L8JA 2QKIC 3T53B 4DF7A 1Q90A 1WCMB 2JA8B 3SEBA 1S5ED 5KIXA 3PV0A 2E2IB 5I6WA 1BCPC 5JPNC 1TKWB 3A54A 5IIFA 2B2VC 3VYUA 5E1FA 4CKBA 2HCCA 2PO4A 1TS5A 4L6TB 5IGGA 4XT1B 2XWBB 5C5MA 1OXTA 3WOFA 3E5SA 3GD7A 1STHA 2HUGA 1QWYA 2EYLA 3QG1A 3ZYYX 1E2ZA 1HTPA 5C0XG 1GUWA 2A5HA 1DOLA 1GUNA 2RQXA 2FHTA 3DM1A 4R8NA 5ELFA 3Q22A 4KK7A 4RHRA 1CHQD 4KJOA 3VA5A 4HAEA 1JWMD 4XDXA 3NWSA 1A15A 1YNJD 2AWOA 5C0XH 3RMHA 2KEDA 3GQBA 2MGSA 2Z8LA 3W2DA 1H9JA 2B2VA 1GUTA 4N9TA 4LMQD 5C6AA 1QILA 1S5BD 2EY1A 3S16B 4RGMA 2QDBA 2BE5D 4DAPA 4EVOA 3QOLA 4S3SA 3TDQA 3J80E 4B9WA 2V4DA 2C5CA 4ZLTF 1CZGA 1SDFA 3H91A 1A2UA 2PCFB 4NP5A 4ZYSA 3K5LA 2N55A 2JYOA 1Y69U 4ZQ3A 3RLFA 4A3GB 3NTIA 3CRKC 4V0BA 3S15B 3SVMA 5CV7A 3HOWB 3URYA 1SYEA 1HQMC 4CJ1B 5I6YA 3CHBD 1SNQA 3BG3A 2B2YA 1EY5A 2A6HD 5IGCA 3Q23A 4IUPA 3S1NB 1ILQA 2B2WA 3GTGB 4HCSA 1A3VA 1TIID 2EY2A 3A56A 1ET9A 4X3SA 3GTJB 3KK7A 5CMDA 4FXDA 1DCZA 1HRJA 4IUNA 4A3IB 1PTOB 4HN7A 4TKOB 1NAPA 4OGQC 4X3KA 3DWAA 2CQAA 4QF4A 4G57A 3SK5A 3DUZA 1CA6A 4IFDI 3VYSA 1C4QA 3J80L 1Q1BA 1B50A 2L5TA 2IJ0A 4EQPA 1ZYRD 1Y1WB 3SDZA 1PRTF 2L1BA 2TSSA 1MBYA 1EIHA 2RDFA 3VYRA 4XIGS 4IQZA 3EFXD 5JEAJ 5KGUA 1SNCA 1F2LA 1I4HA 1DJRD 1B44D 5EKKA 4BBSB 4K5XA 1STBA 1STNA 1SAPA 4Q0FA 1G2TA 3C46A 4G7OC 3L3OC 1LT4D 2ID0A 4XQNA 2K1BA 3BDLA 1STYA 3Q6SA 4KN7C 1V8QA 4EQNA 4RKBA 2O2LD 2JP1A 3GTQB 1BBXC 1VMPA 4ZUJA 2F0IA 1PTOC 3MAQA 1V1PA 2AUKA 2EY6A 1SNOA 2YU9B 1JB3A 2XRSD 3DXJC 1TVXA 5IGBA 3PUWA 4KD3A 1F9SA 5ELCA 4KKSA 3AB9A 5C3EB 5BN3A 2KJXA 1WTWA 3OSOA 3FDTA 5C0XJ 4OL7A 3R8BA 3P1HA 2F0KA 3NP8A 2EPBA 5EPLA 3MHBA 4FF2A 1D1KA 2PZWA 1ESFA 2NZ1D 1QOHA 5CV6A 1V1PB 5K36H 5ISRA 1EQTA 5J39A 1WTPA 1UAPA 4RHSA 5A2QL 1AZQA 3FRPB 4ULLA 1PDQA 5E4WC 3Q0AA 1F77A 5KNBA 1GUGA 1NSNS 4LK1C 3IKJA 1KABA 1JWUD 2K04A 2L55A 2L4NA 2NYZD 1SJHD 4KN4C 4K14A 3A8IE 2QCPX 3RZOB 4KHVA 2F0EA 2I07B 3J7YW 3NSWA 3OW7A 1STEA 3A55A 5M5YB 4M1UB 3LWUA 1FGBD 1GHJA 3D6CA 2GA4B 4XXEA 5K5PA 2EYJA 1SNMA 2IX0A 2YYZA 4X3UA 1JOQA 4ME5A 4K5WA 1C8CA 5TSSA 2LKVA 1UUPA 4FF3A 3VR2A 5J22A 4N9PA 4BY7B 1QCBD 1MI2A 1I4QA 2RKSA 2A68C 2B2TC 5F2DA 2KQ3A 1F2ZA 1OXSC 3HZXA 2X6GA 3HOZB 2E2JB 2L9HA 1JOKA 4XT3B 4IFDG 2DN8A 4Q5VA 1KTKA 2D9UA 1EYCA 2IWHA 3I90A 4ILWA 5EPJA 3D4RA 4J8QA 2F0LA 1I4GA 1F9PA 1TWAB 5I4DA 4P2CB 3TP5A 1QG7A 1BNZA 2F03A 4CKCA 1PYWD 1LABA 4QIWB 3H09A 3QOJA 3D6WA 4H13C 3QO2A 1JCKB 3K0YA 3FKIB 4NDXA 2F0VA 5ELEA 2JXMB 2RVLA 4ABNA 3KLSA 1DM0B 2K28A 5E4XA 2K7VA 2A6ED 2IPKD 3BVZA 5CORA 1NR4A 2VB3X 1SBBB 4C2MB 1Z7TA 1ZXTA 1EEFD 1EZ8A 3FEWX 4RCNA 2LY7A 4B08A 2CW0C 1Y8PB 1CM9A 4IURA 4PV1C 5C3XA 1TS2A 3HGBA 2L11A 3IAYA 3GP7A 2B2TA 4G7ZC 1Q8IA 2DY8A 4DAVA 3TZDA 2WINB 3NXWA 5M5XB 5I9PA 2PNRC 2A6HC 1ENAA 1EY4A 5FKAC 3NBIA 2WACA 3M4OB 4K6LA 3RD4A 4KY5A 1PTOD 3SHLA 5IODA 3UI2A 3VR6A 1BCPF 1RD9D 1PTOF 2WV6D 4IUVA 1BUVT 2EYOA 1ONLA 3S2HB 3MXPA 4I65A 3GV3A 2EJFC 4HSPA 1EOTA 1G6ZA 2RSOA 4DFAA 1GJXA 3I8ZA 4KTAA 1KAAA 4IZ8A 3HOUB 3QJYA 4BWGB 1F9RA 3NTHA 1VDZA 1XX8A 2O4XA 2NWGA 3NUCA 1CA5A 1SE2A 3QB3A 4K5VA 4KV6A 1DOKA 4HMJA 3OIQA 2R61A 5KYIA 4ZKBB 1PFMA 3LWEA 2OF1A 2EYFA 4IUQA 3NQTA 1CK1A 2NTSA 2Z4HA 3EQLC 5FOBB 4A3BB 1TS3A 3PMFA 2EJGC 5KYLA 3A8KE 1QJOA 1LTGD 2NN6H 1PRTC 4RGOS 5DNFA 5FO9B 1HUNA 4HMIA 4F88A 2R6GA 1LV9A 3CRLC 1WTVA 3OWFA 1ENFA 2TMPA 4PNYA 3DMUA 3S1MB 2SEBD 1EFID 5C0XI 5JJZA 5FO8B 4A3JB 1T5XD 3OHXC 4C1NI 2D2CC 4WJWA 1CZWA 4A3FB 1O7YA 2WIIB 2Z4IA 5T1GA 3G7LA 2FINB 3A7AB 2BOSA 1MGSA 3R2TA 2AUJD 5CBAE 1CHPD 2B2UA 4I7ZC 3SR1A 3J81L 2PW7A 3DEOA 5LL6S 2A69C 5CV9A 3PO2B 2SNMA 2KHSA 3T4AC 3ND8A 4FP5D 5JOBA 3MXNA 5KEEA 4HR7B 3EROA 3MXUA 2HCIA 5FK9C 1LACA 2F3WA 5CR3A 3N52A 5KNCA 1I4PA 1G91A 4O1NA 1WTXA 3G6JB 3RUZA 4QUCA 4RCOA 4C3JG 1C48A 2F0GA 3FVQA 4DK1A 3GTMB 2O5JC 1BR9A 3TP7A 1JWSD 3I73A 5JEAH 2CVRA 1QE6A 2MHVA 5C3WA 3N6RA 4KMUC 2F0OA 2QEJC 1EU4A 1HA6A 1ZKOA 1HCZA 3MZ5A 1U4LA 3OMGA 1HA5A 3OIPA 4LAAA 3BS1A 3SK4A 5M9OA 1LTBD 3U9OA 5HGTA 4RGTA 1EWHA 5FLXE 2DNEA 2X69A 3K58A 3TMEA 3C3LA 1PRTB 1HUMA 2LS01 1JR0D 1KDBA 3I4LA 4F8MA 1AFPA 1KDAA 4ODGA 2NN6I 2CW0D 2FJ2A 2JA6B 4AYBB 3I3CA 2KCCA 3L7ZC 1TY2A 4FF4A 2IX1A 2NVTB 1G291 1JICA 2SNSA 4BA2I 2BDNA 3JAME 2KEEA 1XYIA 1YNND 2C9OA 4XTCS 2XWJB 5CV4A 1FNVA 4J6HA 1TS4A 2A68D 5KNDA 1U4MA 4IALA 3T16A 4IFDH 3IL8A 2M9VA 2X6LA 3E0JA 1GHKA 4R8IA 1X3QA 3GTOB 1X3PA 3X3MA 2E74C 4KKTA 3I72A 2SOBA 5BN4A 4A93B 3QIAA 3PUZA 4Z9CB 2JA7B 1VF5C 3HS0C 3KUPA 1MSGA 1ENCA 1Q1EA 1H9RA 2NB0A 2D5DA 1EIGA 5CGKA 2B2YC 1UEAB 1BO0A 1STAA 1UNSA 5D14A 1U4RA 3GO5A 1BCPB 4GZYC 2PQEA 3K5NA 1EL0A 4ZAIA 4HTHA 2ZT9C 3X3NA 2EJMA 2XIWA 1AN8A 3WOEA 2LMCB 3HP3A 3OMCA 5D65A 4QUFA 2ZXRA 1HFNA 1FR3A 4KHZA 3VA7A 1E0BA 3V05A 5G3LD 1DXMA 2K5DA 1BDOA 2F0PA 3BDCA 3A7LA 1VMCA 2ICIA 2KCNA 4R9WA 1CQFA 1FNWA 1PZID 4F7XA 1XXGA 4DNRB 1PZKD 1IW7C 2ZXPA 1EZ6A 5EJWA 2PZTA 2D62A 5DEHA 5M3FB 2BDOA 4F87A 3MXGA 2B2WC 2NN6G 1DOMA 4OIJA 3EA6A 3T13A 1TU2B 2KECA 5D3DA 3S1RB 4ID6A 1H9SA 3NPPA 1I6HB 4BY1B 1OXUA 2F0UA 1HFGA 3ITPA 1K8OA 1KDCA 4A3DB 2DNCA 2F0QA 3M7NA 3MEHA 1SE3A 2HDLA 1I3QB 4C3IB 1F2MA 4C56C 5IT9L 3VR5A 4ZRZA 2EOTA 4HCEA 3NTKA 1EY9A 3EVQA 2F3VA 1MD2D 3S9WA 1WTQA 4MIUA 5IT9E 5JVG3 1E2WA 3GV6A 1BOSA 2K05A 3QWNA 3TZUA 1I6VC 4XQQA 5COYA 2KA7A 2JEBI 1EY8A 1EYAA 4RH6A 3VR4A 2BCOA 4PQXA 3D4DA 1TR5A 3R3OA 1ICWA 5C4XB 2WB1B 4IUUA 1EY0A 2VNUD 1MSHA 1V43A 1H9SB 4FXGC 2J0TD 2VXWA 3OOCA 3MFGA 2B8FA 2PW5A 2G9DA 1LLRD 2I46A 4KY7A 4KY6A 4NMZA 3GTLB 1H9MA 1SE4A 1Q12A 5EBDA 5K36G 3K7AB 1F2YA 5C44B 2Z1CA 4V190 1PFBA 3KLRA 5DAUA 3NK9A 2AQ2B 2L12A 3HOYB 3KBXA 3K5OA 1EQVA 2F0SA 4K8JA 1SXTA 2PYKA 2HDMA 2Q8RE 1D5MC 1SYBA 4XYOA 1CQVA 1HPCA 3K57A 5J1ZA 2A74C 1X32A 3MFYA 2LFNA 3NHHA 1Z47A 2EYMA 1WVLA 3SXHA 1PTOH 4CKEA 5A2QE 4FXKC 1S5DD 1EEID 1O78A 1LTAD 1AZPA 1A3TA 4HSVA 2E2DC 4IUTA 5ELDA 2XNAC 1TWFB 1WTRA 5JEAG 2A73B 2EY5A 1M4VA 2NUCA 3I4NB 1SNPA 1XTCD 2PZUA 3ONAB 1LT6D 5EKIA 1EY7A 1HQRD 3CQZB 3DEPA 1RF2D 3I70A 5FLXL 1M8AA 1B9NA 1PZJD 5IGFA 1A6XA 1OXVA 4FVMA 4JBWA 1AP0A 4A3KB 4CGYB 4QMGA 4BA1I 5A35A 3I4MB 3K6OA 1FD7D 4G7HC 2FMCA 1E2VA 3T51B 2B39A 4BBRB 1RTOA 3MA2B 1K8MA 1ILPA 5C4HA 4M8AA 2F0FA 3LNNA 5IOCA 4WRDA 1B1ZA 1LTTD 4UAIA 3ERQA 1QNKA 2JSOA 1WTOA 1BXTA 5CC4A 3SE0A 2BE5C 4C3IG 3HKZB 3GTPB 4XYQA 2RSNA 3P75A 2M00A 2WAQB 3J7AF 2HQEA 1OXXK 1IKMA 2VB2X 3D3RA 2B2UC 3M7GA 1ML0D 3SK8A 1RCVD 3Q24A 1SYGA 4ZUIA 2F0TA 1PLFA 3J81E 1LTSD 1A3UA 4PMBA 4RKLA 2KUMA 1L0XB 2ZXOA 1RHPA 1VCIA 2B8GA 1J8IA 1SMYD 2AWNA 4MHEA 2XVSA 2BA0A 1EWCA 3D4WA 4EQOA 1BQQT 3DWQA 4DNTB 4EGVA 5G3LF 1R9TB 2A6EC 3IFTA 1GXDC 4FYDA 4A3MB 4RFBA 3TN2A 4KKUA 2OT2A 1WD0A 1CI3M 1QB5D 1S5FD 2Q8IB 2OXPA 2J4XA 3CU7A 3TP6A 1SNDA 1S5CD 5JAVA 3CKIB 2IX3A 3J7AV 5KRUA 3AMUA 1SYCA 4X3TA 1PXUA 1O80A 2IW3A 4PMCA 5C4JB 1LT5D 4ZKCB 3FPUB 3KBGA 1I4RA 2R7ZB 1FYCA 1H9KA 4OO1H 1R4PB 1ZYRC 3DHQA 2NTTA 3H0GB 3F2UA 4KJNA 1U9RA 5EGTA 5ELBA 2K33A 1Q3LA 3JAML 2RDGA 3BVMA 1B9MA 3R2IA 1IL8A 3PUVA 3W3AA 5EKLA 2XN9C 1Y1VB 1B3AA 2E75C 3MWYW 4QCLA 3MC0B 2AQ3B 4J1MA 1D1IA 5CYUA 2MJ8A 4DU9A 5CBEE 3EJIA 3PIP3 4JK1C 1QNUA 2NVQB 2Q8TA 4PMWA 3HOVB 3M3YB 3T56B 1JORA 1TWGB 2BA1A 1DD2A 1O7LA 4CBVA 4H44C 1Z6HA 1PMRA 1EYDA 4ZK9B 1R4QB 2K01A 3BDOA 2EYPA 3P20A 1NUCA 4K8IA 1EU3A 1Y8NB 2F0NA 4DK0A 2R93B 2K5QA 2K5WA 2Y0SB 2KVMA 1CFMA 5I2XA 1LO5D 2DY7A 3C1EA 3C1FA 1F9QA 2MUYA 3HRZC 3BVGA 4DXFA 3AU7A 3NBHA 1BCPD 1D2BA 2R3ZA 4RGNA 1NR2A 2H4OA 3OPOA 5M3MB 4MN3A 2F0JA 5I2YA 2B63B 1EY6A 2EXZA 3DWPA 1ESRA 1KNAA 3V96A 2M2LA 5IGEA 4OHJA 5CV8A 4FF1A 2XRQD 4LJZC 1SYDA 2AQ1B 4NKLA 4CHTB 1L0YB 5LHY1 3E6ZX 2NVXB 1W6KA 1RJTA 1AW7A 3VR3A 1RKNA 1CT1D 3HG9A 4XQJA 1LTRD 1STGA 3O13A 1LT3D 1B4OA 3MTSA 4NW2A 1DONA 4DGZA 1RDPD 3ND9A 2E2HB 4G4KA 1S4ZA 2R92B 1HTLD 2JA5B 1KNEA 1TY0A 4Y7NB 3HEJA 4DN4M 3FMCA 4O42A 1CTMA 5AFWA 1HXYD 3C2PA 1IYUA 1SMYC 3PO3B 1DZ1A 1PRTD 3S2DB 2F0MA 2RBMA 2H1EA 1A2TA 4KI0A 2O5IC 1SYFA 2EDGA 3S14B 1JC7A 3P7JA 1TWCB 3K5MA 1G8ZD 2VUMB 2WKCA 5DM73 3H94A 1D5XC 4L63B 3PUXA 1WD1A 1I50B 5BN5A 1AEXA 4FNFA 5C5LA 3TSSA 4TQUS 1IYVA 3BZDB 2NVYB 1D6EC 2WKDA 5I9OA 1I4XA 5JPMC 4TRDA 2FFKB 1V1OA 4DA2A 1SEBD 3SK6A 3NQIA 2MP1A 1Y8OB 4RAUC 3BYYB 1YNNC 5M5WB 3MVVA 2WP8J 2G9HD 3KF8A 2EVBA 1GUOA 2PMZB 3BYTB 4C3HB 4QB4A 4IFDJ 1JQYD 2F4IA 1TWHB 4WORA 3KLSX 1T5EA 3NWTA 5EPKA 2NBFA 4RWSC 4U68A 4WFN3 5IGDA 5EBCA 3NE5B 1BF4A 2K6AA 2XSCA 4YIJA 1GOZA 4C3HG 4KD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELE A;  3MFG A;  1SE2 A;  1SJH D;  1LLR D;  1EU3 A;  3URY A;  4RCO A;  1SE4 A;  1PRT D;  3CHB D;  1LT4 D;  2IPK D;  2R61 A;  1LO5 D;  3BVZ A;  2AQ2 B;  3EA6 A;  1LTI D;  1SBB B;  1STE A;  1G8Z D;  1JWS D;  1B1Z A;  5D3D A;  2QIL A;  1LT5 D;  1CK1 A;  1LTT D;  1EEF D;  2NTS A;  2O2L D;  3BVG A;  4DXF A;  1I4R A;  1D5X C;  1FGB D;  1SXT A;  1BCP D;  4Z9C B;  4L63 B;  1TS3 A;  1BXT A;  1ET9 A;  1KLG D;  4UDU C;  1PTO C;  2NTT A;  1D5M C;  2QEJ C;  3TSS A;  1V1P A;  1EU4 A;  4RGN A;  5ELF A;  1LTG D;  2XRS D;  1PRT C;  3BZD B;  4RGO S;  5TSS A;  4RHR A;  1CQV A;  1CHQ D;  1TS2 A;  1SE3 A;  1UUP A;  1KLU D;  1HA5 A;  1D6E C;  1PTO B;  5ELB A;  1JWM D;  3GP7 A;  1I4X A;  5D3I B;  2RDG A;  1LTB D;  1V1O A;  1ENF A;  5ELC A;  1PTO H;  1RCV D;  3BVM A;  3DWA A;  3DWP A;  1SEB D;  3R2I A;  4C56 C;  4RGT A;  2SEB D;  1S5D D;  1I4Q A;  1EEI D;  2XN9 C;  1LTA D;  1ET6 A;  1UNS A;  1EFI D;  4OHJ A;  1BCP B;  2XRQ D;  2Z8L A;  1LTS D;  1PRT B;  3BYY B;  3R8B A;  2AQ1 B;  3W2D A;  5FKA C;  4DXG A;  1JR0 D;  1T5X D;  1MD2 D;  5ELD A;  1L0Y B;  3MC0 B;  2AQ3 B;  1D5Z C;  1QIL A;  2XNA C;  1L0X B;  4K6L A;  1S5B D;  2IJ0 A;  1M4V A;  2RDH A;  4RGM A;  1AW7 A;  1ESF A;  1AN8 A;  1PTO D;  1PRT F;  1CT1 D;  1KTK A;  1BCP F;  1V1P B;  2G9H D;  1LTR D;  1XTC D;  3R2T A;  1RD9 D;  1FNU A;  1PTO F;  1CHP D;  1S5E D;  2WV6 D;  3SEB A;  3O13 A;  3BYT B;  1BCP C;  1EWC A;  2TSS A;  1LT6 D;  1LT3 D;  4TSS A;  3DWQ A;  1HQR D;  1JQY D;  1TY2 A;  3EFX D;  3V05 A;  1RF2 D;  3KLS X;  1RDP D;  4RH6 A;  4RHS A;  1I4G A;  1PZJ D;  2CHB D;  5I4D A;  1HTL D;  1I4H A;  2ICI A;  5FK9 C;  4BWG B;  1TY0 A;  1DJR D;  4RFB A;  1FNW A;  1PZI D;  1SJE D;  1F77 A;  4ZYS A;  1B44 D;  1FNV A;  1GOZ A;  1PYW D;  1S5F D;  1DYQ A;  1HXY D;  1XXG A;  1PZK D;  2J4X A;  1TS4 A;  1TS5 A;  1JCK B;  4L6T B;  1I4P A;  1S5C D;  1FD7 D;  1JWU D;  4O1N A;  3OWE B; 
#chains in the Genus database with same CATH topology
 3D31 A;  5FO7 B;  1IKL A;  4OO1 G;  4YWM A;  1YNJ C;  5T1I A;  1VQI A;  4DR1 L;  4BS9 A;  1U4P A;  2JEA I;  4K2L A;  1TT2 A;  2EE1 A;  4DR6 Q;  2KOL A;  2ENB A;  3I91 A;  3GTK B;  1LTI D;  2QIL A;  4U67 3;  2F1M A;  4JW0 A;  3WDN A;  4A4I A;  5IYB H;  4K6D A;  5M3M G;  2Z6K C;  3H6M A;  1KLG D;  4UDU C;  4B9X A;  4H7B A;  3D8G A;  4OWT B;  1O7Z A;  2F0D A;  3S17 B;  3L9A X;  1SFO B;  4C3J B;  1HNX Q;  4UPA A;  1MJC A;  1Q81 C;  5IWA Q;  3M4Y A;  4DAY A;  1N33 L;  5NUC A;  3TRE A;  3F1Z A;  3K59 A;  2EZV A;  4JI2 L;  1G2S A;  5HUR A;  1W6J A;  5IE8 A;  4H0L C;  1PFN A;  1K0R A;  1ET6 A;  2PPB C;  3FPP A;  2MPM A;  4B3T Q;  1SSO A;  2YU9 H;  2ICE C;  1HZA A;  3BZK A;  2N88 A;  1IHZ A;  5JJI A;  1PH5 A;  4GKK Q;  1D5Z C;  4H02 A;  1SFO H;  1HZB A;  1VQF A;  1XPO A;  1K83 B;  1YVC A;  1K3B C;  3VYT A;  2SDF A;  1HHV A;  2BH8 A;  2RDH A;  4A3E B;  2MQH A;  4YWK A;  5C4Z A;  1VQ7 A;  1XWE A;  3HOX B;  4CJ2 C;  1FNU A;  4GOP C;  1VF7 A;  3GTG H;  4MNO A;  2PI2 E;  4LF9 Q;  1NCV A;  1ROD A;  4TSS A;  3TP8 A;  1J9O A;  2L0C A;  2FMM A;  2OEO A;  1JOO A;  4CJ0 B;  2UUB L;  3U9S A;  2F0W A;  3R93 A;  5FJ8 H;  4DR3 Q;  2RA4 A;  4HJ5 A;  1IXR A;  2CHB D;  1B53 A;  1VQP A;  4OX9 L;  1SJE D;  4FO2 A;  3TBI B;  3PIO 3;  1DYQ A;  2K03 A;  2QF7 A;  1IW7 D;  3M85 A;  1RTN A;  1ZEQ X;  5DM6 3;  2MNA A;  1DGS A;  3RR5 A;  4K2K A;  1XPU A;  3OWE B;  1HZC A;  2KHJ A;  2JE6 I;  3GTO H;  1II3 A;  2J7Z A;  1YBY A;  3TQY A;  4DAM A;  5JJK A;  1EIF A;  5LL6 X;  2IL8 A;  1X9N A;  4IN3 A;  1ICF B;  3IFD A;  4HED A;  2F4V Q;  3S1Q B;  2EYH A;  4JI2 Q;  5JVH 3;  4LW1 A;  3H3V C;  1YHA A;  1XNQ Q;  3ULJ A;  2E76 C;  3ICE A;  2BH2 A;  4LF9 L;  3HOY G;  2B63 G;  4GKK L;  1TQO A;  1L0W A;  2I5L X;  3CC2 A;  4OO1 I;  2E5L Q;  2UUC Q;  4E6I A;  3F8T A;  5CV5 A;  3HOZ H;  3PUY A;  1KLU D;  1XMO L;  4HIM A;  1SLJ A;  4POG A;  5E3F A;  3BJU A;  5D3I B;  3V2T A;  4RA8 A;  2A69 D;  2EQS A;  3LX0 A;  4YCW A;  5EQ0 A;  4A3G H;  4C1N K;  3UDI A;  3K8A A;  1N34 L;  1B2T A;  1NY4 A;  2C35 B;  3RLN A;  1OO9 B;  2F0H A;  4OIK A;  4DXG A;  5GQO A;  4HJA A;  3A8J E;  3KF6 A;  4JI7 Q;  4BBS H;  1GUS A;  1FVI A;  3RZD B;  1IBM L;  2K32 A;  1JE4 A;  2IT1 A;  4L8J A;  1J5E L;  2QKI C;  2D0P A;  5IYC H;  3T53 B;  4DF7 A;  1Q90 A;  1WCM B;  2JA8 B;  3M4O H;  1UEB A;  2K75 A;  3SEB A;  1S5E D;  5KIX A;  2VQE L;  3PV0 A;  2E2I B;  5I6W A;  4ALP A;  1BCP C;  5JPN C;  1X56 A;  1TKW B;  3A54 A;  5IIF A;  1E1T A;  4DV2 L;  2ZTD A;  2B2V C;  5IYC G;  4JCV E;  3VYU A;  2NVY H;  1RIP A;  4QJF A;  3EN2 A;  5E1F A;  1PVO A;  4CKB A;  2HCC A;  2PO4 A;  3HOV G;  1TS5 A;  1X55 A;  4L6T B;  2D0O A;  4A3E G;  5IGG A;  4XT1 B;  4POF A;  2UUC L;  2XWB B;  1ASZ A;  4JI1 Q;  4NB3 A;  5C5M A;  1OXT A;  2WAQ G;  5M5Y H;  1V1Q A;  2ZTC A;  3F2C A;  4A3F G;  3WOF A;  4LUO A;  3OW2 A;  3E5S A;  3GD7 A;  1STH A;  4P73 A;  2HUG A;  3HOW H;  1QWY A;  2EYL A;  2E8G A;  1YI2 A;  3QG1 A;  4BY7 G;  4HID A;  4A3E H;  2VQE Q;  5GAE C;  3ZYY X;  1E2Z A;  1HTP A;  5C0X G;  1GUW A;  2A5H A;  1DOL A;  1GUN A;  2RQX A;  2FHT A;  4A3B G;  3DM1 A;  1IBM Q;  3S14 H;  1U5K A;  4DV5 L;  1I6H H;  4R8N A;  1VQM A;  1WCM H;  1J5E Q;  2JA8 H;  4A3F H;  5ELF A;  4IOA A;  3Q22 A;  4KK7 A;  4RHR A;  1CHQ D;  4KJO A;  3VA5 A;  3CCS A;  4HAE A;  1JWM D;  4XDX A;  3NWS A;  1A15 A;  1YNJ D;  4JC0 A;  2AWO A;  5C0X H;  3RMH A;  1TXY A;  4Y52 H;  2KED A;  3GQB A;  2MGS A;  2Z8L A;  1H9J A;  2B2V A;  3W2D A;  4DPG A;  1GUT A;  4N9T A;  4LMQ D;  1YHB A;  1G6P A;  5C6A A;  1QIL A;  2UXD L;  4A3J H;  1S5B D;  2EY1 A;  2WAQ E;  3S16 B;  4JBJ A;  1E1O A;  4RGM A;  2QDB A;  2BE5 D;  4DAP A;  4EVO A;  3QOL A;  4S3S A;  3TDQ A;  1K8A C;  3J80 E;  4B9W A;  2GVB A;  3E9I A;  2V4D A;  1Q46 A;  3EBE A;  2C5C A;  4ZLT F;  4HJ9 A;  1CZG A;  1FJG Q;  4WJ4 A;  1SDF A;  1D7Q A;  4LF8 Q;  5DLQ E;  3H91 A;  1L2F A;  1A2U A;  2PCF B;  4NP5 A;  1I94 Q;  3RLO A;  4ZYS A;  1N33 Q;  3K5L A;  3KJO A;  2N55 A;  2JYO A;  1Y69 U;  4ZQ3 A;  1E7Z A;  1SR3 A;  4DR4 Q;  4X65 L;  3RLF A;  2JJQ A;  4A3G B;  3NTI A;  3CRK C;  1PH9 A;  4V0B A;  3S15 B;  3SVM A;  5CV7 A;  3HOW B;  1PH4 A;  3URY A;  1SYE A;  1HQM C;  4CJ1 B;  5I6Y A;  2A8V A;  3CHB D;  1B7Y B;  1SNQ A;  1QZG A;  3BG3 A;  4MTK A;  3W5O A;  1K28 A;  2B2Y A;  1EY5 A;  2A6H D;  2JA6 G;  2ZM6 Q;  1K0S A;  1R9T H;  1RL2 A;  5IGC A;  3Q23 A;  4IUP A;  3UDX A;  1ILQ A;  3S1N B;  2B2W A;  3GTG B;  2KBN A;  4HCS A;  1HNW L;  1A3V A;  1TII D;  2EY2 A;  3A56 A;  1ET9 A;  4X3S A;  2L15 A;  3GTJ B;  1CUK A;  3U50 C;  2Z0S A;  3KK7 A;  5CMD A;  4DUZ Q;  4FXD A;  2VQF Q;  1DCZ A;  1HRJ A;  5ELO A;  4IUN A;  4GS3 A;  2YV5 A;  2JA9 A;  5LMU L;  2JA6 H;  4A3I B;  1PTO B;  1PHJ A;  4HN7 A;  3HKZ G;  4TKO B;  1NAP A;  4OGQ C;  4X3K A;  2EIF A;  3F2D A;  1HR0 Q;  1N32 L;  3DWA A;  3ULL A;  2YTY A;  2CQA A;  4QF4 A;  4G57 A;  2Q2U A;  3SK5 A;  3DUZ A;  1CA6 A;  4IFD I;  2ZJR A;  3VYS A;  1C4Q A;  3WWV A;  3J80 L;  1Q1B A;  1B50 A;  3PF4 A;  4BY1 G;  2L5T A;  2IJ0 A;  4EQP A;  3GTP H;  1ZYR D;  3PQI A;  4DKA C;  3SDZ A;  1Y1W B;  5IYB G;  1YJ9 A;  1PRT F;  4N8F A;  2L1B A;  1XNR L;  4A93 G;  2TSS A;  1MBY A;  1EIH A;  2RDF A;  3VYR A;  4R4O A;  4XIG S;  4IQZ A;  3EFX D;  5JEA J;  3TEH B;  3PIP A;  4X62 L;  4HIK A;  4BY1 H;  5KGU A;  1SNC A;  2VQF L;  1F2L A;  1I4H A;  4HJ8 A;  5IY0 A;  1DJR D;  4KHP Q;  4AYB E;  1B44 D;  1YNX A;  5EKK A;  3F2B A;  4A93 H;  1CKN A;  3J80 c;  4BBS B;  1N34 Q;  4K5X A;  1I3Q H;  1STB A;  1STN A;  1SAP A;  2VY3 A;  4Q0F A;  1G2T A;  4B3S L;  3HOY H;  4B3M L;  3C46 A;  4G7O C;  2NZO A;  1LT4 D;  3L3O C;  2ID0 A;  4XQN A;  3S17 H;  4R4T A;  3AEV A;  4GN4 B;  2K1B A;  2N8N A;  4AQY Q;  3BDL A;  1STY A;  3Q6S A;  1KRT A;  4KN7 C;  1V8Q A;  4EQN A;  4MTN A;  4RKB A;  4DR5 L;  2O2L D;  2JP1 A;  3GTQ B;  1BBX C;  1XPR A;  1VMP A;  2LSS A;  4ZUJ A;  2F0I A;  1PTO C;  3MAQ A;  4JOI C;  1V1P A;  2AUK A;  3G6E A;  1L1O A;  4L5Q A;  2EY6 A;  1SNO A;  2YU9 B;  1JB3 A;  2XRS D;  3DXJ C;  1TVX A;  5IGB A;  1A63 A;  4OON A;  2QEX A;  3PUW A;  4KD3 A;  3H3V H;  1F9S A;  5ELC A;  4KKS A;  3AB9 A;  5C3E B;  1YJW A;  2GN5 A;  5BN3 A;  3I4N H;  2KJX A;  2A19 A;  1WTW A;  2UU9 L;  4LF5 L;  4YCV A;  4JBK A;  3OSO A;  3FDT A;  5C0X J;  4OL7 A;  3R8B A;  3P1H A;  2F0K A;  3NP8 A;  1EOV A;  3FP9 A;  2EPB A;  4PG3 A;  5EPL A;  3UE0 A;  3MHB A;  4FF2 A;  2CH4 W;  1D1K A;  2PZW A;  1ESF A;  2NZ1 D;  3DM3 A;  1QOH A;  5CV6 A;  1XMQ Q;  1V1P B;  5K36 H;  5ISR A;  3AQQ A;  1EQT A;  5J39 A;  4DAY B;  1WTP A;  1Q86 C;  4DV7 L;  2Q2I A;  4JBM A;  2IHE A;  1UAP A;  4RHS A;  5A2Q L;  1AZQ A;  3FRP B;  3J7Z C;  4ULL A;  1EQQ A;  4LF6 Q;  4A3M G;  1PDQ A;  5E4W C;  3HOX H;  1JMC A;  3Q0A A;  1F77 A;  5KNB A;  1GUG A;  3GTQ H;  1NSN S;  4UP8 A;  4LK1 C;  4R4Q A;  3IKJ A;  5ELN A;  3B6Y A;  1KAB A;  1X54 A;  4BBS G;  4QL5 A;  4X6A H;  1A62 A;  1JWU D;  2K04 A;  2L55 A;  1IBK L;  2L4N A;  1VQC A;  2NYZ D;  1SJH D;  3A0J A;  4KN4 C;  4DR2 L;  4K14 A;  3A8I E;  1C0A A;  2R93 H;  2R92 H;  4YHH Q;  3KDF A;  3CCJ A;  2QCP X;  2RHQ B;  4TVA B;  1SRO A;  3E0E A;  2UXD Q;  3RZO B;  3HFZ B;  4KHV A;  1WFQ A;  2F0E A;  3PO2 G;  2I07 B;  5JJL A;  2A1A A;  3J7Y W;  3NSW A;  3RZO H;  3OW7 A;  1STE A;  1HNZ L;  1KD1 C;  3A55 A;  4UHV A;  5M5Y B;  2K4K A;  4M1U B;  3LWU A;  1FGB D;  1GHJ A;  3D6C A;  2GA4 B;  4XXE A;  5K5P A;  2EYJ A;  1Y14 B;  4DV6 Q;  1VQO A;  2CWP A;  1SNM A;  2IX0 A;  2VZA A;  2YYZ A;  4JVZ A;  4X3U A;  4ME5 A;  1JOQ A;  4K5W A;  1C8C A;  3T1H Q;  3H0G G;  2K14 A;  5TSS A;  4PZ6 A;  4EQ5 A;  2LKV A;  1UUP A;  3PO2 H;  4FF3 A;  5IP7 H;  3VR2 A;  5J22 A;  5HY6 A;  4N9P A;  3G4S A;  4BY7 B;  1QCB D;  1MI2 A;  1I4Q A;  2RKS A;  5M3F H;  3E3X A;  2I5M X;  2A68 C;  4LFA L;  2B2T C;  5F2D A;  2KQ3 A;  1F2Z A;  3H0G H;  1OXS C;  3H15 A;  3HZX A;  2X6G A;  4LFC L;  3HOW G;  3HOZ B;  2UXB L;  2E2J B;  1TWA H;  2L9H A;  1JOK A;  4JI8 Q;  2CWA A;  4XT3 B;  4IFD G;  2DN8 A;  4Q5V A;  2Z9H A;  1KTK A;  2D9U A;  1EYC A;  4A3B H;  2P5Z X;  2IWH A;  2MO0 A;  3I90 A;  4DV1 Q;  1TWG H;  4ILW A;  5EPJ A;  4A3I H;  1KXL A;  3D4R A;  2WFW A;  4J8Q A;  2F0L A;  1I4G A;  1F9P A;  2N49 A;  3T1H L;  1TWA B;  5I4D A;  2R7F A;  4P2C B;  1QG7 A;  3TP5 A;  1BNZ A;  4DV3 Q;  1QVC A;  1YIJ A;  2F03 A;  4CKC A;  1PYW D;  1LAB A;  2K5N A;  4QIW B;  3H09 A;  4NPS A;  3QOJ A;  3D6W A;  4H13 C;  3QO2 A;  1JCK B;  3K0Y A;  3FKI B;  4NDX A;  1KQS A;  2VW9 A;  2LXJ A;  2F0V A;  5ELE A;  2JXM B;  2RVL A;  5EAY A;  4LFA Q;  4ABN A;  3A5U A;  3KLS A;  1DM0 B;  2K28 A;  5E4X A;  2R7Z H;  2IY5 B;  3STB C;  4OXP A;  2K7V A;  1YEZ A;  2A6E D;  2IPK D;  1T9H A;  3BVZ A;  5COR A;  1NR4 A;  2QW7 A;  2VB3 X;  1PH3 A;  1SBB B;  4C2M B;  3RNU A;  1XNR Q;  1Z7T A;  2KEN A;  1ZXT A;  1EEF D;  1LUZ A;  1EZ8 A;  3FEW X;  4RCN A;  2LY7 A;  3KYH C;  4B08 A;  2CW0 C;  2F3I A;  1Y8P B;  1IBK Q;  1CM9 A;  3EIV A;  4IUR A;  4PV1 C;  5C3X A;  1TS2 A;  3HGB A;  4JI0 Q;  2L11 A;  3IAY A;  3GP7 A;  2ZJP A;  2B2T A;  4WJ3 M;  4G7Z C;  1Q8I A;  2DY8 A;  4DAV A;  3I4M G;  3TZD A;  2WIN B;  3NXW A;  5M5X B;  2HHH L;  5I9P A;  3S15 H;  2PNR C;  4A3C H;  2A6H C;  4UP7 A;  1ENA A;  1EY4 A;  5FKA C;  3NBI A;  2WAC A;  3RN5 A;  4B3S Q;  3M4O B;  4B3R L;  4DV3 L;  4YY3 Q;  4K6L A;  3RD4 A;  3SGI A;  4KY5 A;  3CP0 A;  1PTO D;  1GO3 E;  3SHL A;  5IOD A;  3UI2 A;  1BCP F;  3VR6 A;  1RD9 D;  1PTO F;  2WV6 D;  4IUV A;  3CCQ A;  5J3B A;  2VL6 A;  1BUV T;  2EYO A;  1ONL A;  3S2H B;  3AYH B;  3MXP A;  4I65 A;  3GV3 A;  2EJF C;  1VQB A;  2VS1 A;  4HSP A;  1Z9F A;  1EOT A;  3VDY A;  1G6Z A;  2RSO A;  4DFA A;  2E5L L;  1VQK A;  1GJX A;  3I8Z A;  4KTA A;  3E9H A;  1KAA A;  4IZ8 A;  3HOU B;  3QJY A;  2V1C C;  1WYD A;  4BWG B;  4NXM L;  4R1J A;  1F9R A;  1X3F A;  1N36 Q;  2ES2 A;  3TS2 A;  4BXX H;  3NTH A;  1VDZ A;  1XX8 A;  2O4X A;  2NWG A;  3NUC A;  1EIY B;  1AE2 A;  1BKB A;  2QDL A;  1CA5 A;  1V9P A;  1SE2 A;  1EWI A;  2E2H H;  2LXK A;  3QB3 A;  2XTI A;  4K5V A;  2PI2 A;  4KV6 A;  3MEF A;  1DOK A;  4HMJ A;  3OIQ A;  1K3R A;  3J81 c;  1NJI C;  2R61 A;  5KYI A;  4ZKB B;  1PFM A;  3LWE A;  2OF1 A;  2EYF A;  2G5D A;  4IUQ A;  3NQT A;  1CK1 A;  1JJC B;  3UDF A;  2AHO B;  2NTS A;  2Z4H A;  3EQL C;  5FOB B;  4A3B B;  1TS3 A;  3I4N G;  3PMF A;  2EJG C;  4B3R Q;  5KYL A;  3A8K E;  2PQA B;  1QJO A;  1LTG D;  1M90 C;  2NN6 H;  1PRT C;  4RGO S;  5DNF A;  5FO9 B;  1HUN A;  1PFS A;  4HMI A;  4F88 A;  2R6G A;  1LV9 A;  5C4X H;  3KJP A;  3CRL C;  4P74 A;  2QGQ A;  1WTV A;  3OWF A;  1ENF A;  2TMP A;  4PNY A;  3DMU A;  1PH1 A;  4R4I A;  3S1M B;  3HKZ E;  2SEB D;  1KIX A;  1EFI D;  5C0X I;  5JJZ A;  1SE8 A;  3A74 A;  4JI1 L;  4LF4 Q;  3ERS X;  5FO8 B;  4A3J B;  2VUM G;  1T5X D;  3OHX C;  4C1N I;  2D2C C;  2HQL A;  4WJW A;  1YIT A;  5C4X G;  1K83 H;  1CZW A;  4A3F B;  4DR6 L;  3IRB A;  4LFB L;  4IPG A;  1O7Y A;  2WII B;  2Z4I A;  5T1G A;  3W1B A;  5C44 G;  2QA4 A;  3G7L A;  2B29 A;  2FIN B;  3A7A B;  2BOS A;  1MGS A;  3PGZ A;  3D0F A;  3R2T A;  2AUJ D;  5CBA E;  1MJE A;  1GM5 A;  1CHP D;  4A3L H;  1PH8 A;  1SRU A;  2B2U A;  4I7Z C;  4JI5 L;  5L37 A;  3SR1 A;  3J81 L;  5H1S E;  2PW7 A;  3DEO A;  3CCU A;  5LL6 S;  2A69 C;  5CV9 A;  3PO2 B;  2SNM A;  4DK6 C;  2KHS A;  1W3S A;  3T4A C;  2GVA A;  3ND8 A;  4FP5 D;  5JOB A;  3MXN A;  4HR7 B;  3ERO A;  5GAG C;  5KEE A;  3MXU A;  2HCI A;  5FK9 C;  5FLM G;  1LAC A;  2F3W A;  5CR3 A;  1Y1V H;  1I5F A;  3CXC A;  1OTC A;  5IYD G;  3N52 A;  5KNC A;  1VQE A;  3TRZ A;  1I4P A;  3I55 A;  5GRO A;  4O1N A;  1G91 A;  1WTX A;  3G6J B;  4CDE C;  3RUZ A;  1VQ8 A;  3K7A H;  1PH7 A;  4QUC A;  4RCO A;  4C3J G;  1C48 A;  4LFC Q;  1S40 A;  2F0G A;  3FVQ A;  4DUY L;  1Y1V G;  4DK1 A;  1MHW C;  3GTM B;  2O5J C;  4OX9 Q;  1BR9 A;  3TP7 A;  1JWS D;  3I73 A;  5JEA H;  2CVR A;  1QE6 A;  2MHV A;  5C3W A;  4DV1 L;  3HOX G;  3N6R A;  4KMU C;  4JI7 L;  3NBH B;  2Q2T A;  2F0O A;  2QEJ C;  1EU4 A;  3L2P A;  1HA6 A;  1ZKO A;  1HCZ A;  1Q8K A;  3MZ5 A;  1U4L A;  3OMG A;  1D8L A;  1PH6 A;  3CCL A;  3CPF A;  3NEM A;  1HA5 A;  1WJJ A;  3OIP A;  4LAA A;  4HIO A;  2DJG C;  4IJL A;  3BS1 A;  1H95 A;  3SK4 A;  5M9O A;  4DR4 L;  1LTB D;  2I5H A;  3CW2 C;  3U9O A;  5HGT A;  3S1M H;  4RGT A;  1EWH A;  5FLX E;  2DNE A;  2X69 A;  3KDF B;  3K58 A;  3TME A;  3C3L A;  1PRT B;  1J6Q A;  1HUM A;  2LS0 1;  1JR0 D;  1KDB A;  3I4L A;  4F8M A;  1AFP A;  1KDA A;  3PO3 G;  4ODG A;  4BY7 H;  2NN6 I;  2CW0 D;  1KC8 C;  2FJ2 A;  1EFW A;  3J81 j;  2Y0S E;  2JA6 B;  4L5T A;  1HH2 P;  1UWV A;  1CSQ A;  4AYB B;  3I3C A;  2KCC A;  3L7Z C;  1HJP A;  1TY2 A;  4FF4 A;  2IX1 A;  1GVP A;  2NVT B;  3J81 i;  4DUZ L;  1G29 1;  1S72 A;  5IP7 G;  1JIC A;  2SNS A;  4BA2 I;  2DGY A;  1NNX A;  2BDN A;  1XMO Q;  3JAM E;  1LTL A;  1PYB A;  2KEE A;  5M3F G;  1YNN D;  2C9O A;  4I7A A;  1A8V A;  4XTC S;  2XWJ B;  5CV4 A;  1XYI A;  1FNV A;  4DV4 Q;  1HR0 L;  4J6H A;  1N32 Q;  4J15 A;  1TS4 A;  2A68 D;  5KND A;  1U4M A;  2HHH Q;  4BBR H;  1CKO A;  2UXC L;  4IAL A;  4RG1 A;  4GLV B;  1NTG A;  3T16 A;  4IFD H;  2IHF A;  2OQ0 A;  3IL8 A;  2JK8 A;  2M9V A;  2X6L A;  3E0J A;  1GHK A;  4R8I A;  1KAW A;  1X3Q A;  3GTO B;  4O0A A;  1X3P A;  3X3M A;  2E74 C;  4KKT A;  1WOC A;  3I72 A;  4ME3 A;  1Q7Y C;  2SOB A;  4K0K L;  4JI6 Q;  5BN4 A;  4A93 B;  3QIA A;  1VQJ A;  3PUZ A;  4Z9C B;  1EYG A;  1PV4 A;  1L1O B;  4A3C G;  3KF8 B;  2JA7 B;  4YWL A;  1VF5 C;  4DNI A;  2JA7 G;  4GLA C;  3HS0 C;  4C2M H;  3KUP A;  1MSG A;  1ENC A;  1Q1E A;  4OWX B;  1H9R A;  2NB0 A;  2D5D A;  1EIG A;  1P16 A;  5CGK A;  2B2Y C;  1O7I A;  1UEA B;  1BO0 A;  2JN4 A;  1STA A;  1UNS A;  3K80 C;  5D14 A;  1U4R A;  3UE1 A;  3GO5 A;  4LF8 L;  1BCP B;  4A3K H;  3K0X A;  2JA7 H;  4B3M Q;  4GZY C;  4FDB A;  2PQE A;  3K5N A;  1EL0 A;  1QUQ B;  1NMG A;  1L1O C;  4ZAI A;  4NXN Q;  4HTH A;  2ZT9 C;  3X3N A;  4CDC C;  2EJM A;  2XIW A;  1HNX L;  1AN8 A;  3WOE A;  4AQY L;  2LMC B;  2F4V L;  3HP3 A;  4X65 Q;  1NMF A;  3OMC A;  5D65 A;  4QUF A;  2ZXR A;  1HFN A;  1FR3 A;  3G48 A;  2OCE A;  4KHZ A;  1QZH A;  3VA7 A;  4JI6 L;  1E0B A;  1WI5 A;  2Y0S G;  5C3E H;  3V05 A;  3T1Y Q;  5G3L D;  1DXM A;  1BBW A;  2K5D A;  1BDO A;  2F0P A;  3BDC A;  2ALY B;  3A7L A;  1VQ6 A;  1VMC A;  2ICI A;  2KCN A;  4QY7 A;  4R9W A;  1Y1W G;  1CQF A;  1FNW A;  1G51 A;  2NZH A;  1PZI D;  4F7X A;  1XNQ L;  1XXG A;  1XTD A;  4DNR B;  4CDF C;  1PZK D;  1IW7 C;  2ZXP A;  5C3E G;  1EZ6 A;  5EJW A;  2PZT A;  2D62 A;  5DEH A;  3I7F A;  5M3F B;  2BDO A;  1FJG L;  4F87 A;  3MXG A;  4GKJ Q;  2UUB Q;  4LNQ A;  2B2W C;  1W2B A;  2NN6 G;  1DOM A;  4L5S A;  4OEM B;  1VQA A;  2B3G A;  4OIJ A;  3CCM A;  3EA6 A;  4JPB W;  3T13 A;  1I94 L;  3GDE A;  1TU2 B;  1B3Q A;  2KEC A;  5D3D A;  4DV4 L;  4ID6 A;  3S1R B;  1H9S A;  3NPP A;  1I6H B;  1OXU A;  4BY1 B;  2F0U A;  4IPH A;  1HFG A;  3ITP A;  1K8O A;  1KDC A;  4A3D B;  4MZ9 A;  4A3D G;  2DNC A;  2F0Q A;  2VUM H;  4DV2 Q;  3M7N A;  4BXX G;  3MEH A;  1VQ9 A;  1SE3 A;  5FJ8 G;  2NVT H;  2HDL A;  4GOP B;  4GOP A;  1I3Q B;  4C3I B;  1F2M A;  4C56 C;  5IT9 L;  1YZ6 A;  1VS0 A;  3VR5 A;  4GNX C;  4ZRZ A;  2E2I H;  4K0K Q;  2EOT A;  4HCE A;  3QR8 A;  3NTK A;  2K52 A;  4A3D H;  1EY9 A;  3EVQ A;  5IP9 H;  2F3V A;  1MD2 D;  4YHH L;  4GN5 A;  3S9W A;  1UE1 A;  1WTQ A;  4MIU A;  5IT9 E;  4DK3 C;  5JVG 3;  1E2W A;  3GV6 A;  3ER0 A;  1BOS A;  2K05 A;  2CQO A;  5FLM H;  3QWN A;  1LYL A;  3TZU A;  1I6V C;  3JC6 6;  4LUZ A;  1M1K C;  4XQQ A;  1TWF H;  5COY A;  5IYD H;  2KA7 A;  2FXQ A;  2JEB I;  3TS0 A;  1EY8 A;  4LWC A;  5IP9 G;  1EYA A;  4RH6 A;  3VR4 A;  2BCO A;  4PQX A;  3D4D A;  4AYB G;  1TR5 A;  3R3O A;  1ICW A;  3M4P A;  5C4X B;  2WB1 B;  4IUU A;  1EY0 A;  5LMU Q;  2VNU D;  1MSH A;  1U0L A;  4PZ8 A;  1N8R C;  1V43 A;  1H9S B;  1JE5 A;  1JT8 A;  1X3E A;  3FKI H;  4FXG C;  2J0T D;  1YJN A;  2F52 A;  1TWC H;  2CKZ B;  2VXW A;  1UE6 A;  4JV5 Q;  1VQ4 A;  2CFM A;  3OOC A;  3MFG A;  2B8F A;  2PW5 A;  3U4V A;  2G9D A;  1LLR D;  2I46 A;  4KY7 A;  4KY6 A;  4NMZ A;  5C44 H;  3GTL B;  1H9M A;  1SE4 A;  1Q12 A;  5EBD A;  1KHI A;  4GN3 B;  5K36 G;  3K7A B;  1F2Y A;  5C44 B;  4A3L G;  3JAM i;  2Z1C A;  4V19 0;  1PFB A;  4AIM A;  3KLR A;  5DAU A;  3NK9 A;  2AQ2 B;  2L12 A;  3HOY B;  3KBX A;  3ULP A;  3K5O A;  1EQV A;  3S1R H;  2F0S A;  4K8J A;  1QVF A;  4QIW E;  4R4C A;  4A3M H;  1SXT A;  2PYK A;  1VQL A;  2HDM A;  2Q8R E;  4JYA Q;  2CCZ A;  3CC7 A;  1D5M C;  1SYB A;  4XYO A;  1E24 A;  2NVQ H;  2N78 A;  1CQV A;  1HPC A;  3K57 A;  4GKJ L;  5J1Z A;  2A74 C;  1X32 A;  3MFY A;  2LFN A;  3NHH A;  1Z47 A;  2EYM A;  3S24 A;  1WVL A;  3SXH A;  2JQO A;  4Y7N H;  1K73 C;  1PTO H;  4CKE A;  5A2Q E;  4FXK C;  2RF4 A;  2XGT A;  1S5D D;  1O78 A;  1EEI D;  4C3J H;  1LM0 A;  1LTA D;  5AJ3 Q;  1AZP A;  1A3T A;  4HSV A;  3H3V I;  3CCR A;  3GTJ H;  2E2D C;  4IUT A;  5ELD A;  1EQR A;  2XNA C;  1TWF B;  1WTR A;  5JEA G;  2A73 B;  1IZ6 A;  2EY5 A;  3PIO A;  1M4V A;  3UDG A;  1BBU A;  2NUC A;  4IO9 A;  3OTO L;  3CMA A;  3I4N B;  1SNP A;  1XTC D;  2K5H A;  2PZU A;  2HT1 A;  1CSP A;  4P71 A;  5HGQ A;  3ONA B;  4JV5 L;  1LT6 D;  5EKI A;  1EY7 A;  1HQR D;  2RCN A;  3CQZ B;  3DEP A;  2AMC B;  1RF2 D;  4DR2 Q;  2AKW B;  4BBR G;  1JJ2 A;  4LF5 Q;  3I70 A;  5FLX L;  5GAH C;  1M8A A;  4P75 A;  1B9N A;  1PZJ D;  1MIU A;  5IGF A;  1A6X A;  1OXV A;  4ZCK A;  4FVM A;  4JBW A;  1AP0 A;  2OQK A;  2PMZ E;  1WCM G;  2JA8 G;  4A3K B;  4CGY B;  3KOJ A;  4QMG A;  4BA1 I;  5A35 A;  2UU9 Q;  3I4M B;  3K6O A;  1FD7 D;  4DV6 L;  4G7H C;  4DR7 Q;  4QQB X;  1UE7 A;  1BVS A;  2FMC A;  1E2V A;  3CF5 A;  1C9O A;  3T51 B;  2B39 A;  4BBR B;  1RTO A;  3MA2 B;  1K8M A;  4C3I H;  1ILP A;  5IT9 c;  1VQD A;  3KLW A;  5C4H A;  4M8A A;  2F0F A;  2UUA L;  1GKH A;  1VQG A;  3LNN A;  5IOC A;  4WRD A;  1B1Z A;  5AJ3 L;  2ZJQ A;  1LTT D;  4UAI A;  3ERQ A;  1QNK A;  2JSO A;  4DV0 L;  1VQN A;  1CKN B;  1WTO A;  1BXT A;  5CC4 A;  3SE0 A;  2BE5 C;  4C3I G;  3HKZ B;  3GTP B;  1S3O A;  2WB1 E;  4XYQ A;  2Z6B A;  2RSN A;  3P75 A;  2M00 A;  2WAQ B;  3J7A F;  4NXM Q;  2Z6K A;  2HQE A;  4KHP L;  1OXX K;  1IKM A;  2VB2 X;  3D3R A;  2B2U C;  3M7G A;  1ML0 D;  3SK8 A;  1RCV D;  3Q24 A;  1IBL L;  2ZM6 L;  4JI4 Q;  1SYG A;  2R7Z G;  1A0I A;  4ZUI A;  4X64 Q;  4X62 Q;  2F0T A;  1PLF A;  3J81 E;  1LTS D;  1JJG A;  1A3U A;  4PMB A;  1I50 H;  4RKL A;  1P8L A;  1KL9 A;  4C3H H;  2KUM A;  4JYA L;  2OTJ A;  1L0X B;  2ZXO A;  1E22 A;  4A75 A;  3ZJY C;  1RHP A;  3RZD H;  2KCT A;  2Q2H A;  1VCI A;  2B8G A;  1EUJ A;  1J8I A;  1SMY D;  1WTH A;  2AWN A;  4MHE A;  4APV A;  2XVS A;  2BA0 A;  4DR7 L;  1EWC A;  3D4W A;  3CCE A;  4EQO A;  1BQQ T;  3DWQ A;  4DNT B;  4EGV A;  5G3L F;  1R9T B;  4CDD C;  2A6E C;  3RN2 A;  3IFT A;  1GXD C;  4FYD A;  4A3M B;  2KHI A;  4DV5 Q;  4IJH A;  3CC4 A;  3I4M H;  2UUA Q;  4RFB A;  3TN2 A;  2ASB A;  4KKU A;  2RHS B;  2OT2 A;  1WD0 A;  1CI3 M;  1QB5 D;  4IOC A;  4EX5 A;  1S5F D;  5BR8 L;  2Q8I B;  2OXP A;  2J4X A;  3CU7 A;  3J80 i;  3S1N H;  3TP6 A;  1X6O A;  4DV0 Q;  1SND A;  1S5C D;  2JA5 G;  2OWO A;  3J7A 5;  5JAV A;  3CKI B;  4QGU A;  2IX3 A;  1JB7 A;  2UXB Q;  2DJF C;  3J7A V;  4UP9 A;  5KRU A;  3AMU A;  1SYC A;  3GTK H;  4X3T A;  1PXU A;  1X3G A;  1CKM A;  2H5X A;  1O80 A;  5LMN W;  3I56 A;  2IW3 A;  4PMC A;  5C4J B;  1LT5 D;  4ZKC B;  2JA5 H;  1E3P A;  3FPU B;  3KBG A;  1I4R A;  2R7Z B;  3HKS A;  1FYC A;  1H9K A;  4OO1 H;  1R4P B;  1ZYR C;  3KF6 B;  1Y1W H;  3DHQ A;  2NTT A;  3H0G B;  5LMN Q;  4YY3 L;  3F2U A;  3CQZ H;  4KJN A;  2K50 A;  1U9R A;  3U4Z A;  5EGT A;  1XJV A;  1TWH H;  5ELB A;  4L5R C;  2K33 A;  1N9W A;  1Q3L A;  3JAM L;  2RDG A;  2ZTE A;  3BVM A;  1B9M A;  3PSI A;  5BR8 Q;  3R2I A;  1IL8 A;  5M3M H;  3CME A;  3PUV A;  4DV7 Q;  3W3A A;  5EKL A;  2XN9 C;  1KRS A;  3I4O A;  4DR5 Q;  1Y1V B;  1B3A A;  4LF6 L;  2E75 C;  3MWY W;  4DR1 Q;  2PNH A;  4QCL A;  1FL0 A;  3MC0 B;  2AQ3 B;  4DUY Q;  4J1M A;  1D1I A;  1ASY A;  5CYU A;  2MJ8 A;  2N3S A;  4DU9 A;  5CBE E;  3EJI A;  3PIP 3;  4JK1 C;  1Q82 C;  1QNU A;  1HNZ Q;  1QVG A;  3FKI G;  3S2H H;  2NVQ B;  2KCM A;  4PMW A;  2Q8T A;  1HNW Q;  3HOV B;  1IBL Q;  4JI4 L;  3M3Y B;  3GTL H;  3T56 B;  2I0Q A;  1JOR A;  1TWG B;  2BA1 A;  1B8A A;  2PQA A;  5LMN L;  1O7L A;  1DD2 A;  5IWA L;  4JI0 L;  4CBV A;  4H44 C;  2HD3 A;  1Z6H A;  1PMR A;  1EYD A;  4ZK9 B;  1R4Q B;  2K01 A;  1VQ5 A;  3BDO A;  2EYP A;  3P20 A;  1XMQ L;  1SN8 A;  4P72 A;  3HOZ G;  3A5Z B;  1NUC A;  4K8I A;  1EU3 A;  1Y8N B;  2F0N A;  4DK0 A;  2R93 B;  2K5Q A;  2K5W A;  2Y0S B;  2KVM A;  1NBW A;  1CFM A;  5I2X A;  1LO5 D;  2ATW A;  2DY7 A;  3C1E A;  3C1F A;  3OTO Q;  1QUQ A;  1F9Q A;  5FLX c;  4UY8 C;  2MUY A;  4GNX B;  4GNX A;  3HRZ C;  2YTV A;  3K81 C;  3BVG A;  4DXF A;  3AU7 A;  4GLX A;  3NBH A;  1BCP D;  3PF5 A;  1D2B A;  1FGU A;  1K8G A;  2R3Z A;  4DR3 L;  1K9M C;  4RGN A;  1NR2 A;  4JI8 L;  2H4O A;  3OPO A;  2MO1 A;  3STB D;  1IL2 A;  5M3M B;  1HZ9 A;  3GTM H;  4MN3 A;  2F0J A;  3G71 A;  1HR0 W;  4LUV A;  5I2Y A;  3FHW A;  2B63 B;  1EY6 A;  4A76 A;  2EXZ A;  4RMF A;  3DWP A;  1AE3 A;  4X66 L;  1YHQ A;  1ESR A;  1KNA A;  2R7D A;  1MKH A;  2B63 H;  3V96 A;  2M2L A;  2UXC Q;  5IGE A;  4OHJ A;  5CV8 A;  4FF1 A;  2XRQ D;  4LJZ C;  3AFQ A;  4YCU A;  1SYD A;  2AQ1 B;  3HOV H;  3I2Z A;  4NKL A;  4CHT B;  3U58 A;  1L0Y B;  5LHY 1;  3L0O A;  3PCO B;  2E2J H;  3HOU H;  3E6Z X;  3OYY A;  3LGJ A;  4JI3 Q;  2NVX B;  1W6K A;  3NEN A;  1RJT A;  5E7N A;  4LF7 Q;  1AW7 A;  3VR3 A;  2OTL A;  1RKN A;  4A3G G;  1CT1 D;  3HG9 A;  2R93 G;  4XQJ A;  1LTR D;  2R92 G;  1STG A;  3O13 A;  1NE3 A;  1LT3 D;  5M5X H;  1B4O A;  4NW2 A;  3MTS A;  4PZ7 A;  4HJ7 A;  3M3Y H;  1DON A;  4DGZ A;  1RDP D;  4N8X 1;  3BZC A;  3ND9 A;  2E2H B;  1X65 A;  3HOU G;  3S16 H;  4G4K A;  4LF4 L;  3NEL A;  1S4Z A;  2R92 B;  1UE5 A;  1HTL D;  5C4J H;  2JA5 B;  1KNE A;  2WB1 G;  1TY0 A;  4Y7N B;  3HEJ A;  4DN4 M;  2CH4 A;  4KLK A;  3BU2 A;  3K7U C;  2YTX A;  2HIX A;  3FMC A;  4O42 A;  1CTM A;  4OEL B;  4IPC A;  5AFW A;  1HXY D;  3C2P A;  3PO3 H;  4X64 L;  1IYU A;  3JAM c;  4JI5 Q;  1SMY C;  3PO3 B;  1DZ1 A;  1PRT D;  3S2D B;  2F0M A;  2RBM A;  2H1E A;  1A2T A;  2EXD A;  4NXN L;  4KI0 A;  2O5I C;  4LFB Q;  2HIV A;  1SYF A;  2EDG A;  3S14 B;  1JC7 A;  3Q8D A;  3W1G A;  4X66 Q;  3P7J A;  4OWW B;  1TWC B;  3K5M A;  3AFP A;  1G8Z D;  4A3J G;  2VUM B;  2WKC A;  4B3T L;  5DM7 3;  3H94 A;  1D5X C;  1SMX A;  3T1Y L;  4L63 B;  3PUX A;  1WD1 A;  1I50 B;  2DUD A;  5BN5 A;  1AEX A;  4FNF A;  5C5L A;  3TSS A;  4TQU S;  3M9B A;  1IYV A;  3BZD B;  4LF7 L;  3M4Q A;  1AH9 A;  2MFI A;  2NVY B;  4A3I G;  1D6E C;  2WKD A;  1PA6 A;  5I9O A;  3S1Q H;  1I4X A;  5JPM C;  1B70 B;  4TRD A;  2FFK B;  1V1O A;  1N36 L;  1C7Y A;  4DA2 A;  1SEB D;  3SK6 A;  3NQI A;  2MP1 A;  1Y8O B;  4RAU C;  2K5V A;  3BYY B;  1YNN C;  1GD7 A;  3CD6 A;  5M5W H;  1VQH A;  2RCF A;  4JOI A;  3DLL A;  2NVX H;  4IPD A;  5M5W B;  1PH2 A;  3MVV A;  2WP8 J;  2G9H D;  1PYS B;  3KF8 A;  2EVB A;  1GUO A;  2PMZ B;  3BYT B;  4C3H B;  4QB4 A;  4IFD J;  3MXN B;  1JQY D;  2F4I A;  1TWH B;  4WOR A;  3KLS X;  1T5E A;  3NWT A;  5EPK A;  3CCV A;  2NBF A;  4O2D A;  4RWS C;  4U68 A;  4WFN 3;  5IGD A;  5EBC A;  3NE5 B;  3CPW A;  4JI3 L;  5GAD C;  1IYJ B;  4AH6 A;  4A3K G;  3CAM A;  1BF4 A;  2K6A A;  2XSC A;  4YIJ A;  3S2D H;  4JG2 A;  1GOZ A;  4C3H G;  4KD4 A;  3KFU A; 
#chains in the Genus database with same CATH homology
 3D31 A;  5FO7 B;  1IKL A;  4OO1 G;  1YNJ C;  5T1I A;  4BS9 A;  1U4P A;  2JEA I;  4K2L A;  1TT2 A;  2EE1 A;  2KOL A;  2ENB A;  3I91 A;  3GTK B;  1LTI D;  2QIL A;  4U67 3;  2F1M A;  3WDN A;  4K6D A;  3H6M A;  1KLG D;  4UDU C;  4B9X A;  4H7B A;  3D8G A;  1O7Z A;  2F0D A;  3S17 B;  3L9A X;  1SFO B;  4C3J B;  3M4Y A;  4DAY A;  5NUC A;  3K59 A;  2EZV A;  1G2S A;  5HUR A;  1W6J A;  4H0L C;  1PFN A;  1ET6 A;  2PPB C;  3FPP A;  2MPM A;  1SSO A;  2ICE C;  2N88 A;  1IHZ A;  1D5Z C;  1K83 B;  3VYT A;  2SDF A;  1HHV A;  2RDH A;  4A3E B;  5C4Z A;  1XWE A;  3HOX B;  4CJ2 C;  1FNU A;  1VF7 A;  1NCV A;  1ROD A;  4TSS A;  3TP8 A;  1J9O A;  2L0C A;  2FMM A;  2OEO A;  1JOO A;  4CJ0 B;  3U9S A;  2F0W A;  3R93 A;  2RA4 A;  2CHB D;  1B53 A;  1SJE D;  4FO2 A;  3TBI B;  3PIO 3;  1DYQ A;  2K03 A;  2QF7 A;  1IW7 D;  3M85 A;  1RTN A;  1ZEQ X;  5DM6 3;  4K2K A;  3OWE B;  2JE6 I;  1II3 A;  2J7Z A;  5LL6 X;  2IL8 A;  4IN3 A;  3IFD A;  4HED A;  3S1Q B;  2EYH A;  5JVH 3;  3H3V C;  2E76 C;  1TQO A;  4OO1 I;  4E6I A;  5CV5 A;  3PUY A;  1KLU D;  5E3F A;  5D3I B;  3V2T A;  4RA8 A;  2A69 D;  3LX0 A;  5EQ0 A;  4C1N K;  1B2T A;  1OO9 B;  2F0H A;  4OIK A;  4DXG A;  3A8J E;  1GUS A;  3RZD B;  2K32 A;  1JE4 A;  2IT1 A;  4L8J A;  2QKI C;  3T53 B;  4DF7 A;  1Q90 A;  1WCM B;  2JA8 B;  3SEB A;  1S5E D;  5KIX A;  3PV0 A;  2E2I B;  5I6W A;  1BCP C;  5JPN C;  1TKW B;  3A54 A;  5IIF A;  2B2V C;  3VYU A;  5E1F A;  4CKB A;  2HCC A;  2PO4 A;  1TS5 A;  4L6T B;  5IGG A;  4XT1 B;  2XWB B;  5C5M A;  1OXT A;  3WOF A;  3E5S A;  3GD7 A;  1STH A;  2HUG A;  1QWY A;  2EYL A;  3QG1 A;  3ZYY X;  1E2Z A;  1HTP A;  5C0X G;  1GUW A;  2A5H A;  1DOL A;  1GUN A;  2RQX A;  2FHT A;  3DM1 A;  4R8N A;  5ELF A;  3Q22 A;  4KK7 A;  4RHR A;  1CHQ D;  4KJO A;  3VA5 A;  4HAE A;  1JWM D;  4XDX A;  3NWS A;  1A15 A;  1YNJ D;  2AWO A;  5C0X H;  3RMH A;  2KED A;  3GQB A;  2MGS A;  2Z8L A;  3W2D A;  1H9J A;  2B2V A;  1GUT A;  4N9T A;  4LMQ D;  5C6A A;  1QIL A;  1S5B D;  2EY1 A;  3S16 B;  4RGM A;  2QDB A;  2BE5 D;  4DAP A;  4EVO A;  3QOL A;  4S3S A;  3TDQ A;  3J80 E;  4B9W A;  2V4D A;  2C5C A;  4ZLT F;  1CZG A;  1SDF A;  3H91 A;  1A2U A;  2PCF B;  4NP5 A;  4ZYS A;  3K5L A;  2N55 A;  2JYO A;  1Y69 U;  4ZQ3 A;  3RLF A;  4A3G B;  3NTI A;  3CRK C;  4V0B A;  3S15 B;  3SVM A;  5CV7 A;  3HOW B;  3URY A;  1SYE A;  1HQM C;  4CJ1 B;  5I6Y A;  3CHB D;  1SNQ A;  3BG3 A;  2B2Y A;  1EY5 A;  2A6H D;  5IGC A;  3Q23 A;  4IUP A;  3S1N B;  1ILQ A;  2B2W A;  3GTG B;  4HCS A;  1A3V A;  1TII D;  2EY2 A;  3A56 A;  1ET9 A;  4X3S A;  3GTJ B;  3KK7 A;  5CMD A;  4FXD A;  1DCZ A;  1HRJ A;  4IUN A;  4A3I B;  1PTO B;  4HN7 A;  4TKO B;  1NAP A;  4OGQ C;  4X3K A;  3DWA A;  2CQA A;  4QF4 A;  4G57 A;  3SK5 A;  3DUZ A;  1CA6 A;  4IFD I;  3VYS A;  1C4Q A;  3J80 L;  1Q1B A;  1B50 A;  2L5T A;  2IJ0 A;  4EQP A;  1ZYR D;  1Y1W B;  3SDZ A;  1PRT F;  2L1B A;  2TSS A;  1MBY A;  1EIH A;  2RDF A;  3VYR A;  4XIG S;  4IQZ A;  3EFX D;  5JEA J;  5KGU A;  1SNC A;  1F2L A;  1I4H A;  1DJR D;  1B44 D;  5EKK A;  4BBS B;  4K5X A;  1STB A;  1STN A;  1SAP A;  4Q0F A;  1G2T A;  3C46 A;  4G7O C;  3L3O C;  1LT4 D;  2ID0 A;  4XQN A;  2K1B A;  3BDL A;  1STY A;  3Q6S A;  4KN7 C;  1V8Q A;  4EQN A;  4RKB A;  2O2L D;  2JP1 A;  3GTQ B;  1BBX C;  1VMP A;  4ZUJ A;  2F0I A;  1PTO C;  3MAQ A;  1V1P A;  2AUK A;  2EY6 A;  1SNO A;  2YU9 B;  1JB3 A;  2XRS D;  3DXJ C;  1TVX A;  5IGB A;  3PUW A;  4KD3 A;  1F9S A;  5ELC A;  4KKS A;  3AB9 A;  5C3E B;  5BN3 A;  2KJX A;  1WTW A;  3OSO A;  3FDT A;  5C0X J;  4OL7 A;  3R8B A;  3P1H A;  2F0K A;  3NP8 A;  2EPB A;  5EPL A;  3MHB A;  4FF2 A;  1D1K A;  2PZW A;  1ESF A;  2NZ1 D;  1QOH A;  5CV6 A;  1V1P B;  5K36 H;  5ISR A;  1EQT A;  5J39 A;  1WTP A;  1UAP A;  4RHS A;  5A2Q L;  1AZQ A;  3FRP B;  4ULL A;  1PDQ A;  5E4W C;  3Q0A A;  1F77 A;  5KNB A;  1GUG A;  1NSN S;  4LK1 C;  3IKJ A;  1KAB A;  1JWU D;  2K04 A;  2L55 A;  2L4N A;  2NYZ D;  1SJH D;  4KN4 C;  4K14 A;  3A8I E;  2QCP X;  3RZO B;  4KHV A;  2F0E A;  2I07 B;  3J7Y W;  3NSW A;  3OW7 A;  1STE A;  3A55 A;  5M5Y B;  4M1U B;  3LWU A;  1FGB D;  1GHJ A;  3D6C A;  2GA4 B;  4XXE A;  5K5P A;  2EYJ A;  1SNM A;  2IX0 A;  2YYZ A;  4X3U A;  1JOQ A;  4ME5 A;  4K5W A;  1C8C A;  5TSS A;  2LKV A;  1UUP A;  4FF3 A;  3VR2 A;  5J22 A;  4N9P A;  4BY7 B;  1QCB D;  1MI2 A;  1I4Q A;  2RKS A;  2A68 C;  2B2T C;  5F2D A;  2KQ3 A;  1F2Z A;  1OXS C;  3HZX A;  2X6G A;  3HOZ B;  2E2J B;  2L9H A;  1JOK A;  4XT3 B;  4IFD G;  2DN8 A;  4Q5V A;  1KTK A;  2D9U A;  1EYC A;  2IWH A;  3I90 A;  4ILW A;  5EPJ A;  3D4R A;  4J8Q A;  2F0L A;  1I4G A;  1F9P A;  1TWA B;  5I4D A;  4P2C B;  3TP5 A;  1QG7 A;  1BNZ A;  2F03 A;  4CKC A;  1PYW D;  1LAB A;  4QIW B;  3H09 A;  3QOJ A;  3D6W A;  4H13 C;  3QO2 A;  1JCK B;  3K0Y A;  3FKI B;  4NDX A;  2F0V A;  5ELE A;  2JXM B;  2RVL A;  4ABN A;  3KLS A;  1DM0 B;  2K28 A;  5E4X A;  2K7V A;  2A6E D;  2IPK D;  3BVZ A;  5COR A;  1NR4 A;  2VB3 X;  1SBB B;  4C2M B;  1Z7T A;  1ZXT A;  1EEF D;  1EZ8 A;  3FEW X;  4RCN A;  2LY7 A;  4B08 A;  2CW0 C;  1Y8P B;  1CM9 A;  4IUR A;  4PV1 C;  5C3X A;  1TS2 A;  3HGB A;  2L11 A;  3IAY A;  3GP7 A;  2B2T A;  4G7Z C;  1Q8I A;  2DY8 A;  4DAV A;  3TZD A;  2WIN B;  3NXW A;  5M5X B;  5I9P A;  2PNR C;  2A6H C;  1ENA A;  1EY4 A;  5FKA C;  3NBI A;  2WAC A;  3M4O B;  4K6L A;  3RD4 A;  4KY5 A;  1PTO D;  3SHL A;  5IOD A;  3UI2 A;  3VR6 A;  1BCP F;  1RD9 D;  1PTO F;  2WV6 D;  4IUV A;  1BUV T;  2EYO A;  1ONL A;  3S2H B;  3MXP A;  4I65 A;  3GV3 A;  2EJF C;  4HSP A;  1EOT A;  1G6Z A;  2RSO A;  4DFA A;  1GJX A;  3I8Z A;  4KTA A;  1KAA A;  4IZ8 A;  3HOU B;  3QJY A;  4BWG B;  1F9R A;  3NTH A;  1VDZ A;  1XX8 A;  2O4X A;  2NWG A;  3NUC A;  1CA5 A;  1SE2 A;  3QB3 A;  4K5V A;  4KV6 A;  1DOK A;  4HMJ A;  3OIQ A;  2R61 A;  5KYI A;  4ZKB B;  1PFM A;  3LWE A;  2OF1 A;  2EYF A;  4IUQ A;  3NQT A;  1CK1 A;  2NTS A;  2Z4H A;  3EQL C;  5FOB B;  4A3B B;  1TS3 A;  3PMF A;  2EJG C;  5KYL A;  3A8K E;  1QJO A;  1LTG D;  2NN6 H;  1PRT C;  4RGO S;  5DNF A;  5FO9 B;  1HUN A;  4HMI A;  4F88 A;  2R6G A;  1LV9 A;  3CRL C;  1WTV A;  3OWF A;  1ENF A;  2TMP A;  4PNY A;  3DMU A;  3S1M B;  2SEB D;  1EFI D;  5C0X I;  5JJZ A;  5FO8 B;  4A3J B;  1T5X D;  3OHX C;  4C1N I;  2D2C C;  4WJW A;  1CZW A;  4A3F B;  1O7Y A;  2WII B;  2Z4I A;  5T1G A;  3G7L A;  2FIN B;  3A7A B;  2BOS A;  1MGS A;  3R2T A;  2AUJ D;  5CBA E;  1CHP D;  2B2U A;  4I7Z C;  3SR1 A;  3J81 L;  2PW7 A;  3DEO A;  5LL6 S;  2A69 C;  5CV9 A;  3PO2 B;  2SNM A;  2KHS A;  3T4A C;  3ND8 A;  4FP5 D;  5JOB A;  3MXN A;  5KEE A;  4HR7 B;  3ERO A;  3MXU A;  2HCI A;  5FK9 C;  1LAC A;  2F3W A;  5CR3 A;  3N52 A;  5KNC A;  1I4P A;  1G91 A;  4O1N A;  1WTX A;  3G6J B;  3RUZ A;  4QUC A;  4RCO A;  4C3J G;  1C48 A;  2F0G A;  3FVQ A;  4DK1 A;  3GTM B;  2O5J C;  1BR9 A;  3TP7 A;  1JWS D;  3I73 A;  5JEA H;  2CVR A;  1QE6 A;  2MHV A;  5C3W A;  3N6R A;  4KMU C;  2F0O A;  2QEJ C;  1EU4 A;  1HA6 A;  1ZKO A;  1HCZ A;  3MZ5 A;  1U4L A;  3OMG A;  1HA5 A;  3OIP A;  4LAA A;  3BS1 A;  3SK4 A;  5M9O A;  1LTB D;  3U9O A;  5HGT A;  4RGT A;  1EWH A;  5FLX E;  2DNE A;  2X69 A;  3K58 A;  3TME A;  3C3L A;  1PRT B;  1HUM A;  2LS0 1;  1JR0 D;  1KDB A;  3I4L A;  4F8M A;  1AFP A;  1KDA A;  4ODG A;  2NN6 I;  2CW0 D;  2FJ2 A;  2JA6 B;  4AYB B;  3I3C A;  2KCC A;  3L7Z C;  1TY2 A;  4FF4 A;  2IX1 A;  2NVT B;  1G29 1;  1JIC A;  2SNS A;  4BA2 I;  2BDN A;  3JAM E;  2KEE A;  1XYI A;  1YNN D;  2C9O A;  4XTC S;  2XWJ B;  5CV4 A;  1FNV A;  4J6H A;  1TS4 A;  2A68 D;  5KND A;  1U4M A;  4IAL A;  3T16 A;  4IFD H;  3IL8 A;  2M9V A;  2X6L A;  3E0J A;  1GHK A;  4R8I A;  1X3Q A;  3GTO B;  1X3P A;  3X3M A;  2E74 C;  4KKT A;  3I72 A;  2SOB A;  5BN4 A;  4A93 B;  3QIA A;  3PUZ A;  4Z9C B;  2JA7 B;  1VF5 C;  3HS0 C;  3KUP A;  1MSG A;  1ENC A;  1Q1E A;  1H9R A;  2NB0 A;  2D5D A;  1EIG A;  5CGK A;  2B2Y C;  1UEA B;  1BO0 A;  1STA A;  1UNS A;  5D14 A;  1U4R A;  3GO5 A;  1BCP B;  4GZY C;  2PQE A;  3K5N A;  1EL0 A;  4ZAI A;  4HTH A;  2ZT9 C;  3X3N A;  2EJM A;  2XIW A;  1AN8 A;  3WOE A;  2LMC B;  3HP3 A;  3OMC A;  5D65 A;  4QUF A;  2ZXR A;  1HFN A;  1FR3 A;  4KHZ A;  3VA7 A;  1E0B A;  3V05 A;  5G3L D;  1DXM A;  2K5D A;  1BDO A;  2F0P A;  3BDC A;  3A7L A;  1VMC A;  2ICI A;  2KCN A;  4R9W A;  1CQF A;  1FNW A;  1PZI D;  4F7X A;  1XXG A;  4DNR B;  1PZK D;  1IW7 C;  2ZXP A;  1EZ6 A;  5EJW A;  2PZT A;  2D62 A;  5DEH A;  5M3F B;  2BDO A;  4F87 A;  3MXG A;  2B2W C;  2NN6 G;  1DOM A;  4OIJ A;  3EA6 A;  3T13 A;  1TU2 B;  2KEC A;  5D3D A;  3S1R B;  4ID6 A;  1H9S A;  3NPP A;  1I6H B;  4BY1 B;  1OXU A;  2F0U A;  1HFG A;  3ITP A;  1K8O A;  1KDC A;  4A3D B;  2DNC A;  2F0Q A;  3M7N A;  3MEH A;  1SE3 A;  2HDL A;  1I3Q B;  4C3I B;  1F2M A;  4C56 C;  5IT9 L;  3VR5 A;  4ZRZ A;  2EOT A;  4HCE A;  3NTK A;  1EY9 A;  3EVQ A;  2F3V A;  1MD2 D;  3S9W A;  1WTQ A;  4MIU A;  5IT9 E;  5JVG 3;  1E2W A;  3GV6 A;  1BOS A;  2K05 A;  3QWN A;  3TZU A;  1I6V C;  4XQQ A;  5COY A;  2KA7 A;  2JEB I;  1EY8 A;  1EYA A;  4RH6 A;  3VR4 A;  2BCO A;  4PQX A;  3D4D A;  1TR5 A;  3R3O A;  1ICW A;  5C4X B;  2WB1 B;  4IUU A;  1EY0 A;  2VNU D;  1MSH A;  1V43 A;  1H9S B;  4FXG C;  2J0T D;  2VXW A;  3OOC A;  3MFG A;  2B8F A;  2PW5 A;  2G9D A;  1LLR D;  2I46 A;  4KY7 A;  4KY6 A;  4NMZ A;  3GTL B;  1H9M A;  1SE4 A;  1Q12 A;  5EBD A;  5K36 G;  3K7A B;  1F2Y A;  5C44 B;  2Z1C A;  4V19 0;  1PFB A;  3KLR A;  5DAU A;  3NK9 A;  2AQ2 B;  2L12 A;  3HOY B;  3KBX A;  3K5O A;  1EQV A;  2F0S A;  4K8J A;  1SXT A;  2PYK A;  2HDM A;  2Q8R E;  1D5M C;  1SYB A;  4XYO A;  1CQV A;  1HPC A;  3K57 A;  5J1Z A;  2A74 C;  1X32 A;  3MFY A;  2LFN A;  3NHH A;  1Z47 A;  2EYM A;  1WVL A;  3SXH A;  1PTO H;  4CKE A;  5A2Q E;  4FXK C;  1S5D D;  1EEI D;  1O78 A;  1LTA D;  1AZP A;  1A3T A;  4HSV A;  2E2D C;  4IUT A;  5ELD A;  2XNA C;  1TWF B;  1WTR A;  5JEA G;  2A73 B;  2EY5 A;  1M4V A;  2NUC A;  3I4N B;  1SNP A;  1XTC D;  2PZU A;  3ONA B;  1LT6 D;  5EKI A;  1EY7 A;  1HQR D;  3CQZ B;  3DEP A;  1RF2 D;  3I70 A;  5FLX L;  1M8A A;  1B9N A;  1PZJ D;  5IGF A;  1A6X A;  1OXV A;  4FVM A;  4JBW A;  1AP0 A;  4A3K B;  4CGY B;  4QMG A;  4BA1 I;  5A35 A;  3I4M B;  3K6O A;  1FD7 D;  4G7H C;  2FMC A;  1E2V A;  3T51 B;  2B39 A;  4BBR B;  1RTO A;  3MA2 B;  1K8M A;  1ILP A;  5C4H A;  4M8A A;  2F0F A;  3LNN A;  5IOC A;  4WRD A;  1B1Z A;  1LTT D;  4UAI A;  3ERQ A;  1QNK A;  2JSO A;  1WTO A;  1BXT A;  5CC4 A;  3SE0 A;  2BE5 C;  4C3I G;  3HKZ B;  3GTP B;  4XYQ A;  2RSN A;  3P75 A;  2M00 A;  2WAQ B;  3J7A F;  2HQE A;  1OXX K;  1IKM A;  2VB2 X;  3D3R A;  2B2U C;  3M7G A;  1ML0 D;  3SK8 A;  1RCV D;  3Q24 A;  1SYG A;  4ZUI A;  2F0T A;  1PLF A;  3J81 E;  1LTS D;  1A3U A;  4PMB A;  4RKL A;  2KUM A;  1L0X B;  2ZXO A;  1RHP A;  1VCI A;  2B8G A;  1J8I A;  1SMY D;  2AWN A;  4MHE A;  2XVS A;  2BA0 A;  1EWC A;  3D4W A;  4EQO A;  1BQQ T;  3DWQ A;  4DNT B;  4EGV A;  5G3L F;  1R9T B;  2A6E C;  3IFT A;  1GXD C;  4FYD A;  4A3M B;  4RFB A;  3TN2 A;  4KKU A;  2OT2 A;  1WD0 A;  1CI3 M;  1QB5 D;  1S5F D;  2Q8I B;  2OXP A;  2J4X A;  3CU7 A;  3TP6 A;  1SND A;  1S5C D;  5JAV A;  3CKI B;  2IX3 A;  3J7A V;  5KRU A;  3AMU A;  1SYC A;  4X3T A;  1PXU A;  1O80 A;  2IW3 A;  4PMC A;  5C4J B;  1LT5 D;  4ZKC B;  3FPU B;  3KBG A;  1I4R A;  2R7Z B;  1FYC A;  1H9K A;  4OO1 H;  1R4P B;  1ZYR C;  3DHQ A;  2NTT A;  3H0G B;  3F2U A;  4KJN A;  1U9R A;  5EGT A;  5ELB A;  2K33 A;  1Q3L A;  3JAM L;  2RDG A;  3BVM A;  1B9M A;  3R2I A;  1IL8 A;  3PUV A;  3W3A A;  5EKL A;  2XN9 C;  1Y1V B;  1B3A A;  2E75 C;  3MWY W;  4QCL A;  3MC0 B;  2AQ3 B;  4J1M A;  1D1I A;  5CYU A;  2MJ8 A;  4DU9 A;  5CBE E;  3EJI A;  3PIP 3;  4JK1 C;  1QNU A;  2NVQ B;  2Q8T A;  4PMW A;  3HOV B;  3M3Y B;  3T56 B;  1JOR A;  1TWG B;  2BA1 A;  1DD2 A;  1O7L A;  4CBV A;  4H44 C;  1Z6H A;  1PMR A;  1EYD A;  4ZK9 B;  1R4Q B;  2K01 A;  3BDO A;  2EYP A;  3P20 A;  1NUC A;  4K8I A;  1EU3 A;  1Y8N B;  2F0N A;  4DK0 A;  2R93 B;  2K5Q A;  2K5W A;  2Y0S B;  2KVM A;  1CFM A;  5I2X A;  1LO5 D;  2DY7 A;  3C1E A;  3C1F A;  1F9Q A;  2MUY A;  3HRZ C;  3BVG A;  4DXF A;  3AU7 A;  3NBH A;  1BCP D;  1D2B A;  2R3Z A;  4RGN A;  1NR2 A;  2H4O A;  3OPO A;  5M3M B;  4MN3 A;  2F0J A;  5I2Y A;  2B63 B;  1EY6 A;  2EXZ A;  3DWP A;  1ESR A;  1KNA A;  3V96 A;  2M2L A;  5IGE A;  4OHJ A;  5CV8 A;  4FF1 A;  2XRQ D;  4LJZ C;  1SYD A;  2AQ1 B;  4NKL A;  4CHT B;  1L0Y B;  5LHY 1;  3E6Z X;  2NVX B;  1W6K A;  1RJT A;  1AW7 A;  3VR3 A;  1RKN A;  1CT1 D;  3HG9 A;  4XQJ A;  1LTR D;  1STG A;  3O13 A;  1LT3 D;  1B4O A;  3MTS A;  4NW2 A;  1DON A;  4DGZ A;  1RDP D;  3ND9 A;  2E2H B;  4G4K A;  1S4Z A;  2R92 B;  1HTL D;  2JA5 B;  1KNE A;  1TY0 A;  4Y7N B;  3HEJ A;  4DN4 M;  3FMC A;  4O42 A;  1CTM A;  5AFW A;  1HXY D;  3C2P A;  1IYU A;  1SMY C;  3PO3 B;  1DZ1 A;  1PRT D;  3S2D B;  2F0M A;  2RBM A;  2H1E A;  1A2T A;  4KI0 A;  2O5I C;  1SYF A;  2EDG A;  3S14 B;  1JC7 A;  3P7J A;  1TWC B;  3K5M A;  1G8Z D;  2VUM B;  2WKC A;  5DM7 3;  3H94 A;  1D5X C;  4L63 B;  3PUX A;  1WD1 A;  1I50 B;  5BN5 A;  1AEX A;  4FNF A;  5C5L A;  3TSS A;  4TQU S;  1IYV A;  3BZD B;  2NVY B;  1D6E C;  2WKD A;  5I9O A;  1I4X A;  5JPM C;  4TRD A;  2FFK B;  1V1O A;  4DA2 A;  1SEB D;  3SK6 A;  3NQI A;  2MP1 A;  1Y8O B;  4RAU C;  3BYY B;  1YNN C;  5M5W B;  3MVV A;  2WP8 J;  2G9H D;  3KF8 A;  2EVB A;  1GUO A;  2PMZ B;  3BYT B;  4C3H B;  4QB4 A;  4IFD J;  1JQY D;  2F4I A;  1TWH B;  4WOR A;  3KLS X;  1T5E A;  3NWT A;  5EPK A;  2NBF A;  4RWS C;  4U68 A;  4WFN 3;  5IGD A;  5EBC A;  3NE5 B;  1BF4 A;  2K6A A;  2XSC A;  4YIJ A;  1GOZ A;  4C3H G;  4KD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...