2H1EA

Tandem chromodomains of budding yeast chd1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
DFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromo domain protein 1
publication title Molecular Implications of Evolutionary Differences in CHD Double Chromodomains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 47
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2h1eA02
1QE6A 5EPKA 1CA6A 1F9QA 1KNEA 3P7JA 1KNAA 1X3QA 5DNFA 1MGSA 4UAIA 2Q8TA 1QNKA 2B2VA 4XT3B 2B2TC 3IL8A 1BF4A 1EOTA 2L12A 3SVMA 1HUNA 2EE1A 2HDMA 2KEDA 1XX8A 3H91A 4OIJA 3UI2A 3LWEA 2KVMA 2K28A 4HEDA 1CM9A 1HHVA 1RTNA 2L9HA 2X6LA 3GV6A 4OIKA 4CJ0B 1F2LA 4HCSA 2NYZD 3I90A 2MP1A 2B2YA 1HA6A 2K05A 4IUUA 4X3SA 1WTXA 1DOLA 4ZLTF 2M2LA 4IURA 4ZKCB 4QUCA 3QO2A 1WTQA 1O7YA 5CBEE 2HUGA 1B2TA 3D6WA 1NAPA 2B2UC 3IFDA 4MN3A 1NR2A 1AP0A 1J8IA 1F9RA 1HFGA 3KBXA 1G91A 1RJTA 4ZAIA 1PLFA 1AZQA 1BO0A 4X3KA 1VMCA 2SDFA 4X3TA 1B53A 1NR4A 2FJ2A 3KUPA 1LV9A 2FINB 1C8CA 1DZ1A 1GUWA 3TN2A 5EPLA 5EJWA 4MHEA 3DEPA 4XDXA 1U4RA 1RODA 2B2VC 2B2WA 3I3CA 4RAUC 1WTOA 1XYIA 1AZPA 3FPUB 1MI2A 3HP3A 2RA4A 2MJ8A 3F2UA 4CJ2C 2L1BA 2XIWA 1EL0A 1G6ZA 3ONAB 1RHPA 2FMMA 2H1EA 2HCCA 5E4XA 4CJ1B 1ILPA 3DM1A 1MSHA 1F9SA 2KECA 2L4NA 2RSOA 5T1GA 1IKMA 2JP1A 3I91A 1ZXTA 3G7LA 1DONA 2EPBA 4HAEA 4HSVA 1ILQA 1EIGA 1U4PA 4RWSC 4ZKBB 2B2YC 2CVRA 1CA5A 5EPJA 2KEEA 4NW2A 2KOLA 1SDFA 4IUVA 2NWGA 1WTWA 2K01A 1HRJA 1NCVA 1QG7A 2R3ZA 4QUFA 1O7ZA 5E4WC 4XT1B 5CORA 4DN4M 2DY8A 1ICWA 2FFKB 2HDLA 2RSNA 3N52A 5AFWA 1HFNA 4IUQA 5D65A 2K04A 1S4ZA 2Q8RE 1A15A 3FDTA 1M8AA 1O80A 2VXWA 2B2WC 3R93A 4RA8A 4IUPA 1ESRA 4ZK9B 2KUMA 3GV3A 5EKIA 1PDQA 2NZ1D 5COYA 1WTPA 1SSOA 5EQ0A 1JICA 2B2TA 2EOTA 1HUMA 4R8IA 1MSGA 2X6GA 1X3PA 3MWYW 1BBXC 1G2SA 1EIHA 1DOKA 1F9PA 3DEOA 5CBAE 1PFMA 2N55A 4IUTA 4R9WA 3MTSA 5T1IA 1WTRA 1X32A 1B4OA 1DOMA 1WTVA 4X3UA 1WD0A 1G2TA 1RTOA 3TZDA 5JJZA 4LMQD 1WD1A 1ML0D 2RVLA 5D14A 2MGSA 1U4LA 1PFNA 1B3AA 1Q3LA 1IKLA 3Q6SA 4U68A 1BNZA 5CMDA 2DY7A 2HCIA 4O42A 1SAPA 1VMPA 1B50A 2JYOA 2N88A 2K1BA 1WVLA 2B2UA 1E0BA 3I8ZA 2D9UA 2BDNA 2X69A 2IL8A 2J7ZA 2L11A 1U4MA 1J9OA 2K03A 1IL8A 2MPMA 2FHTA 1EQTA 1JE4A 1PFBA 1TVXA
chains in the Genus database with same CATH superfamily
1TWHH 1I94Q 1RD9D 2K5QA 1WOCA 1LUZA 1Y1WH 2OTLA 1Q8KA 1YBYA 3A74A 4XT3B 1C9OA 3A56A 3IL8A 3NE5B 4K5VA 3HOZH 3K80C 3MFGA 5JJIA 3OWFA 4EQOA 1N32L 2TSSA 3S2DB 2R61A 1I6HB 3S24A 2BCOA 4GN3B 4QL5A 4K0KQ 3PMFA 1IXRA 1CKOA 2B2YA 2Q8IB 1EYGA 3V96A 3MAQA 1SEBD 2YV5A 1STYA 5IP9H 3D6WA 2RCFA 2O5JC 3TRZA 2H4OA 2RDGA 2R7DA 1F2YA 4KD4A 3D0FA 3HOXH 2SNMA 4JI0L 3BVMA 1GUTA 4DV2Q 3QB3A 4DAYB 4PMCA 5A2QE 3S1RH 1PTOC 2I5MX 3HZXA 4V0BA 1NTGA 1SYBA 4JOIC 4DA2A 4DAVA 1QVFA 3F2UA 2UXBL 3M4OB 4CJ1B 4B08A 3I4MG 4HIKA 4PZ7A 1YNXA 2JA6G 1A62A 1RF2D 2CFMA 2D0OA 4LF9L 5IGDA 2PW5A 1EIGA 4LF6L 2R6GA 3SGIA 2VB2X 2I07B 5EPJA 1MIUA 3LNNA 3BU2A 1K8OA 1EFWA 2M00A 4FXDA 2NTSA 3SK8A 1PZKD 1ICFB 4NPSA 1QJOA 3F1ZA 1D1KA 1XPUA 3MEFA 3PO2G 2CWPA 2QDBA 3N52A 2A19A 5BR8Q 4A3JH 2K5WA 2WKDA 2C5CA 5JPMC 1W3SA 3HKSA 2AWNA 4C3JB 1N8RC 3VR4A 2F4VL 2CW0C 1YIJA 1GHJA 4ODGA 1Q1EA 3OIQA 4A3KB 1LTSD 3FP9A 3GTMB 1WJJA 3W3AA 4QIWE 1PRTF 5C5MA 4JI7L 4QJFA 3CF5A 4G7HC 1Q3LA 1OXUA 2A6HD 2KCCA 2JEBI 4CHTB 1GUSA 1B1ZA 1X56A 5M5YB 3AFQA 1GVPA 1U4MA 2K03A 4JI6L 3KF6B 5J22A 4EQPA 4JI5L 2HQEA 1EQTA 4A3LG 4JYAQ 4A93B 1JJ2A 1PRTC 4GNXB 3AEVA 2NZOA 4UHVA 2MO0A 5HURA 2PW7A 1SE8A 2E75C 2O5IC 2ZXRA 5IYCG 4GKKL 3GDEA 4WFN3 4OL7A 1YJNA 5FO8B 2UXDQ 3I90A 2Q2TA 1VQ8A 3PQIA 4IUUA 1EY6A 2JA5G 3VR5A 1WTQA 5AJ3Q 2KCNA 1H9JA 5LL6X 3CRLC 4DR1L 3OMCA 4G4KA 2IW3A 4A3FH 1OXXK 1TWFH 2OEOA 3KUPA 4A3MG 1SYGA 2Z0SA 4DFAA 1K8AC 3K7AH 1L1OA 2B2WA 1M1KC 2LMCB 2RBMA 4NXNQ 2KHSA 3UE1A 1OO9B 4BY1B 1I4PA 4FDBA 3WOEA 3K58A 3FKIB 3FMCA 1T5EA 4C1NK 5M5XB 4RWSC 3VR6A 4L5QA 2B63G 1PA6A 2B2YC 4K8IA 5M3FB 2IX1A 2VUMG 3U4VA 1SYCA 4JI8Q 3EROA 3C46A 4L5RC 1TS4A 1V9PA 2NN6H 4IPDA 1X6OA 3CCEA 3EFXD 4OO1I 1KAAA 3H3VC 1Y69U 4BBRG 4DN4M 3CCRA 1MJEA 1HFNA 2RSNA 4IUQA 2Q2IA 4DNRB 3M85A 2Q8RE 2UXCL 1DJRD 5IWAL 3R93A 1HJPA 4HCEA 3HOUG 4KHZA 2RDFA 2KUMA 1LT3D 4LF8Q 3S1QH 3S9WA 2Z1CA 4F88A 4Y52H 1K8MA 2E2DC 4K2KA 2PZUA 4YY3L 1KDBA 1Y8PB 3A7LA 4WJ4A 5CBAE 5M3MG 1N34L 4P71A 1N33L 1LTLA 5IODA 2Y0SB 1IYVA 3F2CA 5C4JH 2KHIA 4FF3A 2A69D 5I2XA 1W6JA 4LK1C 5A2QL 1BDOA 2EVBA 1BCPC 3C1EA 2D9UA 2V4DA 4DV4L 1FJGL 1EWCA 4UDUC 2KJXA 1PFBA 1TVXA 3P7JA 1SMXA 2B3GA 4UAIA 2XVSA 1XJVA 2XWJB 4B9XA 1X3EA 2MO1A 3W1BA 2QEXA 2EE1A 1IW7C 4OIJA 5KYLA 4JI4L 1OXTA 4KKUA 2D0PA 2WFWA 4KKSA 3T1HL 2PNRC 5ELEA 2ZJPA 3HOVB 1E7ZA 4GN4B 5CGKA 1Z47A 1HTPA 1S5CD 1H9RA 1TS2A 1O7IA 4DR2Q 3I4MH 2JA6H 5KGUA 1IBKL 4GLXA 4B3SL 3D4RA 4PMBA 1DCZA 2DJFC 1PYSB 2R7ZH 4DAPA 1TWAH 4X3KA 2LFNA 2GVBA 2WAQE 4XYOA 5C3EH 1DD2A 3TN2A 1PH1A 2AUKA 3W2DA 1PH9A 1YITA 1WTOA 1R4PB 1HZAA 3L9AX 2F4IA 1PVOA 1KXLA 1CKMA 4IN3A 3E6ZX 2HCCA 3PO2H 4X62L 4RGTA 2KCMA 3I91A 3CHBD 3D3RA 2A8VA 3CCJA 2I0QA 1CA5A 1STBA 1PTOD 4POFA 4BBSG 3HFZB 3UDXA 3WOFA 2AQ1B 4CGYB 4FF2A 3A8JE 1STHA 1L1OB 3I2ZA 2LXKA 3HKZB 2SEBD 1Y8OB 3NENA 4KN4C 3IRBA 2OXPA 4O1NA 2R93G 5HGQA 1X54A 3Q8DA 4OX9L 2B2WC 5H1SE 4DUZQ 4FF4A 4RA8A 1EWHA 3S2HH 4KV6A 1HNXQ 3D31A 5M5WH 4DR5L 2B2TA 4J1MA 2UU9Q 4R8IA 2E2HH 3I72A 4A3LH 3VYSA 4UP7A 2F0EA 2A74C 1WTRA 1TQOA 3PSIA 3PIOA 1S5DD 1R9TH 4NDXA 3RZDB 3EIVA 1PYWD 1C7YA 1LT5D 4L5SA 2CW0D 2HCIA 2QGQA 2F0LA 4BA1I 3RN5A 4K0KL 4QQBX 1XXGA 2RKSA 3A5UA 4NXMQ 3TREA 3VYTA 4IPHA 5D3DA 2K5VA 1KRSA 4QY7A 4PZ6A 4DAMA 2JA5H 1E3PA 2XSCA 1WCMB 4FNFA 1JOKA 4P75A 1QNKA 3GTGH 3TP5A 2EXZA 4P72A 5KYIA 4A3DG 3BDCA 2VY3A 4DV2L 1XX8A 1GD7A 4A3MH 1RTNA 2VW9A 3HOWB 2QDLA 1VQEA 2F3IA 2PZTA 3J80i 2CCZA 3C3LA 4GOPA 4CJ0B 1Q12A 4C1NI 1PTOH 2JA9A 1PRTD 3M4PA 2QKIC 2YYZA 1QUQB 1A3TA 1IYUA 4QUCA 3I7FA 3SK6A 1HZCA 1SYEA 1LTRD 1YHBA 5IYDG 3S1MB 1KDCA 4PNYA 3M7GA 1I4GA 2B63H 1U9RA 3ULPA 3MXUA 2VUMH 1B53A 3QWNA 2HQLA 2MFIA 2XRQD 4H44C 3ULJA 2PI2E 4PMWA 5IGGA 1XYIA 5BR8L 1SJHD 3IKJA 2DUDA 4RHSA 4BBRH 5FK9C 1WYDA 3NBHB 1AFPA 2JJQA 3NWSA 2JP1A 3G7LA 3GTLB 3HOUH 5C44B 3GTKH 4DR3Q 1EYAA 4KJNA 4ME3A 4YWMA 3KK7A 4GKJQ 3TP6A 1A2TA 5EAYA 2F0VA 3E5SA 3GTQB 2VQEL 1NCVA 5FKAC 2N78A 5M3MH 2E74C 2PQEA 4RCNA 2TMPA 1FL0A 2PO4A 4QF4A 3TSSA 2F0TA 1NNXA 2NVYH 1PZID 2JE6I 5TSSA 1QWYA 3QIAA 1SNCA 1TS3A 3NQIA 1PFSA 2NVTB 2YU9B 5KEEA 1PH8A 1GXDC 5ELFA 2XRSD 3DWQA 4MTKA 4HJ5A 1QZHA 1STGA 1LABA 1E2ZA 3M3YB 3CCLA 1FNWA 4ZUJA 3KF8A 4KY6A 3RR5A 1BNZA 1VS0A 3VYRA 4BY7B 2JYOA 2J7ZA 2MUYA 1X55A 4KHPQ 1V1QA 2MPMA 5C3XA 3F2DA 1EWIA 2RQXA 4G7ZC 5AJ3L 1KTKA 1SRUA 2A6HC 1X3QA 4FVMA 5DLQE 4BWGB 1MGSA 2EYHA 1MJCA 2F0SA 2B2TC 1EOTA 3Q0AA 1E2VA 1B9MA 3H91A 3F8TA 4K14A 3UI2A 1BCPD 3S15H 3TP7A 3K57A 3GV6A 3QOJA 4NXNL 1CZGA 2L0CA 2E2JH 5DAUA 4P2CB 1DOLA 1X9NA 2NUCA 4OGQC 2LS01 1NBWA 3W1GA 1IW7D 1B44D 2DN8A 3H0GG 3PUXA 5LMNQ 2K32A 1RJTA 1UE5A 2FJ2A 4BBSH 4JOIA 2CHBD 5EPLA 4F87A 2JN4A 3SR1A 2WIIB 4CDEC 2EXDA 4UPAA 4GOPB 1B70B 1HPCA 2C9OA 3CMEA 1EL0A 2R93H 3DM1A 5BN4A 3K5NA 3VR3A 2HHHL 1TR5A 4LF8L 1ILQA 1S72A 4OXPA 1EUJA 3OTOL 1KRTA 4A3IB 5GADC 1XMQQ 4IALA 2ATWA 5GROA 1VQ9A 1F2MA 2UUBQ 4FXGC 3RLOA 4LF5Q 2WB1B 5E4WC 4O0AA 2EY1A 3KLSX 3HEJA 1ZKOA 2PMZB 2IY5B 3MXGA 1JB7A 3HGBA 1Y1VG 1EZ8A 3OPOA 1LTID 1V1PB 1UEAB 1NY4A 1GUNA 1PDQA 3A7AB 5LMNW 4GZYC 4DV1Q 2EJFC 1UWVA 3K59A 1X3PA 3NELA 4YCVA 4HIMA 4ZCKA 1D8LA 1SLJA 3BYTB 3Q24A 2EYMA 4X3UA 4IQZA 4Q5VA 3T4AC 4A3DH 1HNWQ 2RVLA 2MGSA 1IKLA 1C0AA 2DY7A 4AQYL 1I50B 1K3BC 1PH2A 2A68C 2X69A 5ELOA 3S16B 3E3XA 4DR2L 2A69C 4LW1A 3G71A 2WAQG 1BQQT 1JORA 1H9KA 2H5XA 2E5LQ 5IYDH 3I4OA 3TS0A 1HUNA 3R8BA 3KYHC 5EBDA 3GD7A 1SE3A 4A3GG 4IPCA 1VQAA 4JI2Q 2F0GA 4HIOA 3J7ZC 5J1ZA 1VQCA 2BE5D 4LFCL 1HA6A 2DGYA 3U58A 1EEID 4JI1Q 5CBEE 4N9TA 4IFDJ 1NAPA 2ZTEA 5C6AA 4KJOA 2NVQB 1FNVA 1J8IA 1YJ9A 1CTMA 2VQFQ 4FF1A 2OWOA 3HOYG 2QCPX 1BO0A 1UEBA 4C3IG 2FINB 4JBKA 2BDOA 5JVH3 3DEPA 3CRKC 3LX0A 3HG9A 1GM5A 5I4DA 1I6VC 1G6ZA 3GQBA 1PTOF 2ZXPA 4C2MH 4DUZL 1F9SA 5CV7A 2Z6KC 3STBC 1HNXL 1S5BD 1DONA 2UU9L 1SE2A 4XIGS 5ELCA 4A3BH 2F0DA 1EYDA 3PUYA 1FNUA 4FO2A 1YNNC 3KDFB 3BZDB 3KLRA 4LNQA 5JJKA 4MIUA 3OIPA 2KOLA 3MZ5A 4M8AA 2JA8G 1HRJA 3OW2A 5CV5A 1QG7A 4AYBG 1EU4A 3V2TA 1EY5A 1W6KA 3X3NA 1AEXA 1VQIA 4HJ8A 1H9SB 4A3CG 5D65A 3CQZH 5IY0A 4IFDG 4LJZC 1YHAA 2PNHA 4JV5L 1UE1A 5DEHA 2NZ1D 3DWAA 2R7ZG 4TQUS 1STAA 4RGMA 1TKWB 1BBXC 4DF7A 5C3EG 3IFTA 1V8QA 1EY8A 2D5DA 1JQYD 1ENFA 1K73C 2F0JA 1ET6A 2OQKA 4CKCA 3J80E 4U68A 3S1NH 4K6DA 2K1BA 2OF1A 5C4ZA 2G9DA 2L11A 1HQMC 4X64Q 4RFBA 1Q8IA 5D3IB 5EKKA 4TVAB 1K83H 2R92G 1SFOH 2VS1A 2Q8TA 2B2VA 3RZOH 3H0GH 3MXNA 4DNIA 3KLWA 2E2IB 2BA1A 1EYCA 3BJUA 2IJ0A 1PH4A 3J7AF 5C4XB 4BA2I 3FHWA 1K28A 2UUCQ 1PRTB 3PF5A 2PQAB 1A3VA 2O4XA 2LXJA 1I4XA 2IHFA 3I4NH 1AP0A 4LFAQ 1CK1A 3KBXA 4GKJL 1HNZQ 2SDFA 1E22A 1L0WA 3ULLA 5CV8A 5LL6S 3E9HA 3RNUA 1U4RA 1S40A 5C0XI 3FPUB 1MI2A 2MHVA 4CJ2C 3G48A 3KJPA 1EY4A 1MSHA 2N3SA 3CMAA 2L15A 4JCVE 4DV6Q 4JBJA 1M4VA 1Y1VH 4DV5L 1PYBA 4RMFA 3GTPB 2F0UA 1XNQQ 1SDFA 2XGTA 5KNDA 2J4XA 3K5LA 2NBFA 3VYUA 3K0YA 1A63A 1CHPD 1I3QB 4MTNA 3UDIA 5C3WA 3M9BA 3K8AA 2IX0A 4IUPA 1E1TA 4BBSB 4JBWA 3K6OA 4KHPL 1JICA 2EOTA 1B9NA 1GO3E 3CCQA 3QOLA 4A3EB 3I70A 1L0YB 4TRDA 4LAAA 3M4YA 1X32A 5IT9c 2KA7A 4LUZA 2XNAC 3EQLC 3S17H 3TZUA 5IT9L 2JA7B 3NTHA 4A3GH 4ALPA 4JW0A 4KKTA 2BDNA 2QEJC 4JG2A 4OWXB 5K5PA 1YZ6A 2FXQA 3T1YQ 1Q46A 5EBCA 4C3HH 1KNEA 1BCPF 4WJ3M 1NMGA 4FYDA 2EYJA 3PO3H 3F2BA 5LMNL 1TWGB 3OYYA 4K2LA 1X3FA 1SBBB 4RH6A 2IHEA 2ZXOA 3HOYH 4WJWA 2NVXH 4K8JA 2A68D 1KD1C 1IBMQ 1CM9A 1BCPB 1TWCB 1KDAA 4C3IH 1PH3A 4DR6Q 1JCKB 1DXMA 4DK6C 4A76A 5K36H 1K8GA 1SNOA 1H9MA 1N9WA 4R4QA 2IX3A 3CW2C 4RHRA 1QOHA 5ELBA 3QO2A 2ZM6Q 3NSWA 4DPGA 1NR2A 5FLMH 4Y7NH 3SXHA 4JI3Q 4C3JG 1VQGA 4I65A 2LSSA 1BR9A 1Q81C 1C8CA 3MXNB 2K6AA 2UUBL 1XTCD 5I9PA 1B7YB 2B2VC 3I73A 4LF5L 2JA8H 1STEA 1EY9A 1GKHA 3H3VI 4DNTB 2RHSB 3J80c 2L1BA 2PPBC 2K52A 3TEHB 3J80L 1NE3A 3G6JB 4A3CH 4DR4Q 4IFDH 1D5MC 1S5ED 4DV1L 4DU9A 3ICEA 4TSSA 1D2BA 2A73B 2OQ0A 1LLRD 3DM3A 4NW2A 4A93G 3DMUA 1VQPA 1HH2P 4J15A 4QUFA 2R3ZA 3PV0A 1O7ZA 4XT1B 1L2FA 3STBD 1HNWL 1TWHB 2GN5A 2OCEA 5AFWA 1XMOL 1YEZA 4QIWB 1XNRQ 1Y1WB 4DV3Q 2KENA 1YNND 2AUJD 4B3RQ 1BKBA 2Z4HA 3GV3A 3HOZB 4X65L 5GAGC 3GTOH 2R92H 3H15A 2E5LL 3RUZA 1GHKA 3J7AV 3ER0A 1O78A 1YI2A 2EIFA 1ML0D 5CR3A 1PH5A 4V190 2Q2HA 3FPPA 3HOXB 4XXEA 4J6HA 4GLVB 4BY1G 1FYCA 4JI1L 3S1RB 3BVZA 5DNFA 2Z8LA 3IAYA 1I94L 2WINB 3OHXC 1QNUA 1LM0A 1N36Q 1Y14B 3P75A 5M3FG 3KOJA 1EIYB 4KHVA 3GTJH 1QILA 1IZ6A 1IBLQ 3A54A 1ZYRD 4R1JA 4AYBE 1KAWA 1AE2A 4X3SA 4XQNA 1VQ5A 3SK4A 2GVAA 2CQOA 4AIMA 1LT6D 2ZT9C 1IL2A 4RKBA 2BE5C 3S14H 2AQ3B 1G91A 4LWCA 4XTCS 4A3JB 3PCOB 3J7A5 5EKLA 5LMUQ 5EJWA 4I7AA 2RA4A 2O2LD 5IYBG 4OWWB 1GUWA 1JOQA 4H7BA 1RHPA 2Y0SG 5E1FA 1ILPA 1K0SA 4LF9Q 4IOCA 1H95A 5L37A 4ZKBB 4LF6Q 1CT1D 2K75A 1SR3A 1CSPA 3S2DH 1I6HH 2F0FA 1MBYA 2B39A 1VF5C 1W2BA 2D2CC 2K7VA 1Q86C 5CV6A 3L0OA 1A3UA 5FOBB 2DJGC 1A2UA 1X3GA 3HOVG 1ESRA 4X64L 4AH6A 1WTPA 3ERQA 1D7QA 4L6TB 3DWPA 3M4OH 2IWHA 3BDOA 1SE4A 1KHIA 1PFMA 4JI7Q 1EIFA 1SNQA 2QW7A 3J81i 1B4OA 4DV7Q 4PZ8A 1XWEA 4R4IA 1RTOA 3BG3A 4JC0A 2AWOA 1WD1A 4NKLA 2QILA 4OELB 4UY8C 1VQLA 4A3FB 3BYYB 1TWFB 1LTBD 2UUCL 1VQ6A 4JI5Q 1JJCB 2YTXA 2F03A 2PI2A 4A3BG 1JE4A 3A5ZB 3K7AB 1HCZA 4JYAL 4LFAL 5DM63 4JK1C 1HNZL 3PF4A 1B3QA 2K5NA 4APVA 4JBMA 1I4QA 3NPPA 4C3JH 1Q1BA 1VQDA 1VQ7A 4A3KH 1QVCA 4PG3A 3CAMA 4PQXA 3NQTA 1E24A 3EN2A 2WAQB 3HKZG 2UXDL 2K05A 1DYQA 3L3OC 1MHWC 4IURA 4HJ9A 2L55A 4DR1Q 1AN8A 1O7YA 1JOOA 4ZQ3A 1STNA 2K33A 4HTHA 3NP8A 1KL9A 1VMCA 1UE7A 5M5YH 4X66Q 5J39A 1E2WA 4A93H 4XDXA 3D6CA 3S1QB 1EZ6A 1K0RA 1Z7TA 3A0JA 2Z6KA 1FR3A 4DGZA 2ASBA 3TDQA 2F0PA 3H6MA 2KECA 4IJLA 3WWVA 3BZKA 5LHY1 4LFBQ 1TY2A 1FVIA 2RDHA 4HSVA 1VCIA 1CZWA 1PH7A 1LYLA 1JWUD 5C4JB 1CKNA 3T51B 1MD2D 1EEFD 1Z6HA 4IUVA 4HMJA 4JI8L 1WCMG 1ASZA 5J3BA 1DM0B 4HJAA 3MC0B 3NTKA 3G6EA 3I4LA 5IWAQ 1SNDA 3HOWG 3PUVA 3OW7A 3RMHA 3I4NG 4Q0FA 2ENBA 1MSGA 4BY1H 1F9PA 2EYFA 2NN6I 1SXTA 4LF4Q 1KIXA 3EA6A 2JK8A 4CKEA 4DAYA 1G2TA 3QJYA 3X3MA 5M3FH 4DR6L 3I4MB 1U4LA 2JA6B 5C4HA 1KQSA 1WVLA 5KRUA 2R7ZB 2B2UA 1E0BA 1TWAB 3E0JA 4KN7C 3PIP3 2VZAA 1VQHA 5C3EB 3M7NA 1ET9A 1D5ZC 3E0EA 4DXGA 1KNAA 3TQYA 1BXTA 1LT4D 1LTAD 1F2ZA 4JI3L 1HXYD 1EY0A 3PO2B 4JPBW 3HS0C 5FLXE 2QA4A 4JI4Q 3H09A 1D5XC 2KEDA 2P5ZX 3T1HQ 1VQNA 1II3A 2F0OA 3D4WA 1Q7YC 5FO9B 3TS2A 3AMUA 4OIKA 3CD6A 3DHQA 2ES2A 1VQKA 2VNUD 2IT1A 4ZLTF 5IYBH 2EY6A 4YHHQ 1HR0Q 4DR4L 1B2TA 4EQNA 1IBKQ 1KC8C 4MN3A 4B9WA 3NK9A 1K9MC 4OEMB 4ILWA 4F8MA 4DR7Q 1Q90A 4Z9CB 4HJ7A 4YCUA 3S2HB 2NTTA 5M5WB 3C2PA 1XPRA 4RAUC 4N8FA 3A8KE 3KF8B 2UUAQ 2KHJA 1TY0A 3NHHA 4MZ9A 4DK0A 1XNRL 5IOCA 2E2HB 4DV3L 2Q2UA 4IFDI 4C3HG 1IKMA 4E6IA 2F0QA 3J81j 4BY7G 3PO3G 1JMCA 3HOVH 1R9TB 4A4IA 4GNXA 3I55A 1ZEQX 1FGUA 2PZWA 1KLUD 1PZJD 4QMGA 1WTWA 4U673 5IT9E 3QG1A 4CKBA 4F7XA 3L7ZC 2AKWB 2JA5B 2DY8A 2DNEA 4OX9Q 1TS5A 1WI5A 5K36G 5EGTA 2A1AA 1HR0W 3L2PA 3FVQA 3GTGB 2VB3X 4ME5A 4DR5Q 1CI3M 5I9OA 5IGEA 5FLMG 1EQRA 4M1UB 3R3OA 1P16A 3NUCA 4A3MB 1CKNB 1GJXA 1WTHA 3K0XA 5IP7G 2E76C 1S3OA 1PTOB 4BS9A 1N36L 4R9WA 5T1IA 4YCWA 2BA0A 1LACA 2Z9HA 2EYOA 3B6YA 1IBLL 4OONA 3KJOA 4K6LA 1HQRD 2N88A 2F0MA 1SYFA 1BVSA 3I8ZA 2B63B 2XWBB 3QR8A 4DK3C 4LF7Q 1ASYA 2VUMB 4NXML 2RCNA 4UP8A 3NXWA 1CA6A 1RKNA 3VA7A 1JR0D 2Y0SE 4NMZA 1VQBA 4G7OC 2YTYA 1OTCA 1CQVA 4BBRB 1BF4A 1CUKA 3V05A 3SVMA 2EDGA 3LWEA 2KVMA 5LMUL 4A3IG 5JEAJ 3HOUB 3GTKB 2EZVA 1U0LA 3CKIB 2WACA 2NYZD 2MP1A 2WB1G 3SHLA 3CXCA 1SMYD 1S5FD 4ZUIA 1ZYRC 4YIJA 2B2UC 5M3MB 3RZDH 1VQOA 3VR2A 5IGCA 4XQQA 3ERSX 4X3TA 1NR4A 1SROA 4RKLA 2NVYB 3CCMA 1SN8A 1WCMH 4B3MQ 4DUYQ 1HTLD 3OSOA 3LGJA 3SDZA 1JJGA 3JAMc 1NUCA 2H1EA 3OWEB 2RSOA 2G9HD 3JC66 4LUOA 3JAML 2EPBA 1I4HA 3HOWH 2CQAA 1UNSA 5G3LD 3RLFA 1VQ4A 1G51A 4DR3L 4WRDA 4YWKA 4DV0Q 5JEAG 1VQMA 1RDPD 2VQEQ 4DXFA 4BXXG 3J81E 2F1MA 3MFYA 1E1OA 1G291 1QB5D 4DK1A 5FLXc 4DV7L 3FRPB 1B8AA 3S1MH 1LO5D 3EJIA 5F2DA 5CYUA 5FLXL 2EY5A 1MKHA 1VF7A 2F0HA 1CQFA 1M8AA 4RGOS 1SNMA 4NB3A 1QZGA 4ID6A 5HY6A 5COYA 2A6EC 1SSOA 4IOAA 2F3WA 4R8NA 1YVCA 4H0LC 4NP5A 3S15B 3HKZE 1T9HA 1G2SA 1Y8NB 1DOKA 5CV4A 3Q23A 2E2JB 4EGVA 3HRZC 4GNXC 3GTLH 1KLGD 1ENAA 5E7NA 4L5TA 2XTIA 3RLNA 3T16A 2MNAA 5C44H 3TZDA 3CCVA 1BBWA 5D14A 2XN9C 4HMIA 5CV9A 1D1IA 3BDLA 1B3AA 1SNPA 3Q6SA 3G4SA 1LTTD 2WKCA 5KNCA 1VMPA 4FXKC 3K81C 2ZTDA 4IPGA 4K5XA 5C0XJ 3GTQH 2VL6A 1IL8A 5EPKA 2BOSA 1JC7A 4K5WA 3SE0A 4B3TQ 4IO9A 4X66L 2R93B 4TKOB 2CWAA 3WDNA 3Q22A 4KLKA 2K5DA 2AQ2B 3VA5A 4HEDA 2BH8A 2J0TD 2NVTH 2YU9H 1XPOA 2YTVA 2X6LA 1J6QA 1V1OA 3M3YH 1WTXA 4JVZA 3AYHB 2SOBA 4LFBL 3LWUA 2ID0A 3SEBA 4BY7H 1YNJC 1RIPA 3MXPA 1PLFA 5C5LA 1JB3A 1FGBD 1EU3A 3AFPA 4L63B 1AW7A 4EQ5A 5C0XG 3I3CA 3NTIA 1UAPA 1BOSA 1NSNS 4QCLA 2MJ8A 3AB9A 4KY5A 3JAMi 3K5OA 1K3RA 1BBUA 5E4XA 5FJ8G 1T5XD 1CSQA 2HHHQ 3MEHA 1JT8A 1ZXTA 4HIDA 3URYA 3CC2A 1O7LA 5A35A 1J5EQ 1PH6A 4A3DB 2CVRA 3OTOQ 4HR7B 1SJED 3CCSA 1RCVD 4XQJA 2ICEC 4I7ZC 3RD4A 1C4QA 5I6YA 4LF4L 1IYJB 1XMQL 2R7FA 5IP7H 2EQSA 2D62A 4A3KG 5CORA 2B8GA 2HDLA 2NB0A 3CC7A 2VXWA 1O80A 3NEMA 1TU2B 1QUQA 1GUOA 1PXUA 5C4XG 5EKIA 1FD7D 3U9SA 2C35B 3N6RA 3UE0A 1C48A 3BVGA 2K14A 2KCTA 3EVQA 1GOZA 1HZBA 4GS3A 1U5KA 2N8NA 3OMGA 2K4KA 4RCOA 3K5MA 3T53B 4OO1G 4N8X1 1JWMD 1PMRA 4LMQD 1TXYA 5HGTA 1OXSC 4ZRZA 2M9VA 4AQYQ 1EQVA 4A3IH 2Z4IA 4KI0A 3A8IE 2N49A 4MNOA 3NBHA 5DM73 1G6PA 2LY7A 2IL8A 4CDFC 1NMFA 4R4OA 1J9OA 4YHHL 5KNBA 1HR0L 2FHTA 4MHEA 4RG1A 1QE6A 5E3FA 1F9QA 5IIFA 2SNSA 5NUCA 3CU7A 1ONLA 4ZYSA 3PGZA 3GO5A 2AMCB 2L12A 4C2MB 2I5LX 4DR7L 4O2DA 5I6WA 3J81c 5CC4A 1HHVA 3BS1A 2NZHA 2UUAL 3KLSA 1I5FA 4A3BB 4JI2L 3J81L 3U4ZA 5ELNA 4LFCQ 3P1HA 1WFQA 2E8GA 2M2LA 1VDZA 3E9IA 1I50H 2PYKA 4H02A 3FKIG 4ZAIA 1ESFA 3CQZB 2VQFL 3S16H 1DZ1A 4KD3A 5JEAH 4A3EG 4BXXH 1N32Q 1JE5A 3HP3A 1L1OC 2XIWA 1I4RA 3ONAB 2GA4B 5T1GA 3U9OA 2JA7G 2RF4A 4P73A 1YHQA 2JEAI 2EJMA 3A55A 1A8VA 2HIXA 2MQHA 3S1NB 2NWGA 3W5OA 4JI0Q 4QGUA 2IPKD 4GLAC 1PHJA 2NVQH 2G5DA 1K83B 4CDDC 5IYCH 1Z9FA 1SFOB 2UXBQ 1S4ZA 1R4QB 1A15A 4P74A 4OWTB 5JJLA 1L0XB 3T56B 4LF7L 3H0GB 4JV5Q 3RZOB 4ZK9B 4YWLA 2F3VA 2ZJRA 4EVOA 2BH2A 2B8FA 2HT1A 2KQ3A 2WB1E 3O13A 2PMZE 2N55A 3MTSA 3ZJYC 1XTDA 1DOMA 2F52A 2ZTCA 4HN7A 3I56A 2K5HA 1PFNA 2A6ED 4R4CA 4IUNA 5ISRA 3PIO3 3I4NB 4O42A 2B29A 5JPNC 3R2IA 2RHQB 2QF7A 1YJWA 5JAVA 2F4VQ 1PV4A 1BUVT 2F0WA 2ICIA 1GUGA 3FEWX 4FP5D 1Y1VB 5GAHC 4UP9A 2CKZB 4B3ML 4DUYL 3MVVA 5C0XH 1F2LA 2DNCA 1V1PA 4KY7A 4JI6Q 3NBIA 3T13A 5FJ8H 1EFID 4EX5A 3UDGA 1Y1WG 1QCBD 3ND8A 1RL2A 2FMCA 1A6XA 3HOZG 1AZQA 4DV0L 1LV9A 4KK7A 3K7UC 1SMYC 1TIID 2OTJA 1RODA 4GKKQ 1P8LA 5M9OA 5G3LF 3GTMH 2FMMA 3H94A 4L8JA 4DKAC 5IP9G 1EY7A 2F0NA 2L4NA 4DV5Q 1YNJD 2E2IH 1G8ZD 4DV6L 1U4PA 3UDFA 5I2YA 5C4XH 3HOXG 3S17B 1XNQL 2I5HA 3KFUA 4A3GB 2K01A 1VQFA 4GN5A 4C3HB 1M90C 4OO1H 4QB4A 3PO3B 2K04A 3FDTA 3SK5A 3HOYB 2NVXB 4RGNA 5GAEC 2A5HA 4C3IB 1KABA 2LKVA 3DEOA 4B3TL 3DLLA 2CH4W 4IUTA 1D6EC 1WTVA 5JOBA 2HD3A 4H13C 1OXVA 5JJZA 3CP0A 4A3JG 3GTPH 3U50C 4PV1C 5BN5A 4Y7NB 2UXCQ 1B50A 3PIPA 4KMUC 3RN2A 4OHJA 3TMEA 1EQQA 1SYDA 3R2TA 1F77A 3MHBA 2V1CC 3CPWA 3T1YL 1I3QH 3PUWA 2EJGC 3AU7A 4YY3Q 3C1FA 1EOVA 2JA8B 3KDFA 2JXMB 4AYBB 1QVGA 1N34Q 1N33Q 2HDMA 3FKIH 3PUZA 1TT2A 2HIVA 4CBVA 2K28A 5M5XH 3AQQA 2L9HA 2EYLA 4S3SA 1IBML 3M4QA 4IZ8A 1H9SA 4G57A 3JAME 4HCSA 4A3EH 3H3VH 5GQOA 4ULLA 4DV4Q 3VDYA 1FJGQ 4GOPC 1A0IA 3GP7A 3EBEA 4ZKCB 1LTGD 1J5EL 2HUGA 1NJIC 3MA2B 2ZM6L 3IFDA 2JA7H 1UUPA 2WP8J 1F9RA 1HFGA 3OOCA 4KTAA 5ELDA 2OT2A 3D8GA 3CCUA 1AH9A 5BN3A 5C44G 4R4TA 2JSOA 1VQJA 1IHZA 3TBIB 2ZJQA 1AZPA 3BZCA 4HSPA 4LUVA 1TWGH 2F0IA 3GTOB 3P20A 2R92B 3KBGA 2F0KA 2JQOA 1DGSA 4HAEA 1TWCH 4WORA 1X65A 4A3FG 4B3SQ 1HA5A 2KEEA 3CPFA 1Q82C 1CHQD 4N9PA 5FO7B 3TP8A 5IE8A 2WV6D 3D4DA 3ZYYX 4J8QA 1XMOQ 3ND9A 1ICWA 2FFKB 1ENCA 5JVG3 2EY2A 4X6AH 2ALYB 4X62Q 4A75A 1V43A 2PQAA 3DUZA 4X65Q 4B3RL 3KF6A 5EQ0A 5KIXA 3GTJB 2L5TA 3J7YW 1AE3A 1HUMA 4ABNA 1UE6A 1CFMA 2EYPA 2X6GA 2AHOB 2NN6G 3MWYW 1EIHA 1JWSD 2Z6BA 5IGBA 2I46A 4CDCC 1WD0A 4POGA 3ITPA 1HZ9A 2CH4A 5IGFA 3DXJC 3CC4A 5CMDA 3NWTA 4XYQA 1SAPA 2KBNA 3S14B 2K50A 4IJHA 4C56C 2PCFB
chains in the Genus database with same CATH topology
1RD9D 2K5QA 4XT3B 3A56A 3IL8A 3NE5B 4K5VA 3MFGA 3OWFA 4EQOA 2TSSA 3S2DB 2R61A 1I6HB 2BCOA 3PMFA 2B2YA 2Q8IB 3V96A 3MAQA 1SEBD 1STYA 3D6WA 2O5JC 2H4OA 2RDGA 1F2YA 4KD4A 2SNMA 3BVMA 1GUTA 3QB3A 4PMCA 5A2QE 1PTOC 3HZXA 4V0BA 1SYBA 4DAVA 4DA2A 3F2UA 3M4OB 4CJ1B 4B08A 1RF2D 5IGDA 2PW5A 1EIGA 2R6GA 2VB2X 2I07B 5EPJA 3LNNA 1K8OA 2M00A 4FXDA 2NTSA 3SK8A 1PZKD 1QJOA 1D1KA 2QDBA 3N52A 2K5WA 2WKDA 2C5CA 5JPMC 2AWNA 4C3JB 3VR4A 2CW0C 1GHJA 4ODGA 1Q1EA 3OIQA 4A3KB 1LTSD 3GTMB 3W3AA 1PRTF 5C5MA 4G7HC 1Q3LA 1OXUA 2A6HD 2KCCA 2JEBI 4CHTB 1GUSA 1B1ZA 5M5YB 1U4MA 2K03A 5J22A 4EQPA 2HQEA 1EQTA 4A93B 1PRTC 5HURA 2PW7A 2E75C 2O5IC 2ZXRA 4WFN3 4OL7A 5FO8B 3I90A 4IUUA 1EY6A 3VR5A 1WTQA 2KCNA 1H9JA 5LL6X 3CRLC 3OMCA 4G4KA 2IW3A 1OXXK 2OEOA 3KUPA 1SYGA 4DFAA 2B2WA 2LMCB 2RBMA 2KHSA 1OO9B 4BY1B 1I4PA 3WOEA 3K58A 3FKIB 3FMCA 1T5EA 4C1NK 5M5XB 4RWSC 3VR6A 2B2YC 4K8IA 5M3FB 2IX1A 1SYCA 3EROA 3C46A 1TS4A 2NN6H 3EFXD 4OO1I 1KAAA 3H3VC 1Y69U 4DN4M 1HFNA 2RSNA 4IUQA 4DNRB 3M85A 2Q8RE 1DJRD 3R93A 4HCEA 4KHZA 2RDFA 2KUMA 1LT3D 3S9WA 2Z1CA 4F88A 1K8MA 2E2DC 4K2KA 2PZUA 1KDBA 1Y8PB 3A7LA 5CBAE 5IODA 2Y0SB 1IYVA 4FF3A 2A69D 5I2XA 1W6JA 4LK1C 5A2QL 1BDOA 2EVBA 1BCPC 3C1EA 2D9UA 2V4DA 1EWCA 4UDUC 2KJXA 1PFBA 1TVXA 3P7JA 4UAIA 2XVSA 2XWJB 4B9XA 2EE1A 1IW7C 4OIJA 5KYLA 1OXTA 4KKUA 4KKSA 2PNRC 5ELEA 3HOVB 5CGKA 1Z47A 1HTPA 1S5CD 1H9RA 1TS2A 5KGUA 3D4RA 4PMBA 1DCZA 4DAPA 4X3KA 2LFNA 4XYOA 1DD2A 3TN2A 2AUKA 3W2DA 1WTOA 1R4PB 3L9AX 2F4IA 4IN3A 3E6ZX 2HCCA 4RGTA 3I91A 3CHBD 3D3RA 1CA5A 1STBA 1PTOD 3WOFA 2AQ1B 4CGYB 4FF2A 3A8JE 1STHA 3HKZB 2SEBD 1Y8OB 4KN4C 2OXPA 4O1NA 2B2WC 4FF4A 4RA8A 1EWHA 4KV6A 3D31A 2B2TA 4J1MA 4R8IA 3I72A 3VYSA 2F0EA 2A74C 1WTRA 1TQOA 1S5DD 4NDXA 3RZDB 1PYWD 1LT5D 2CW0D 2HCIA 2F0LA 4BA1I 1XXGA 2RKSA 3VYTA 5D3DA 2XSCA 1WCMB 4FNFA 1JOKA 1QNKA 3TP5A 2EXZA 5KYIA 3BDCA 1XX8A 1RTNA 3HOWB 2PZTA 3C3LA 4CJ0B 1Q12A 4C1NI 1PTOH 1PRTD 2QKIC 2YYZA 1A3TA 1IYUA 4QUCA 3SK6A 1SYEA 1LTRD 3S1MB 1KDCA 4PNYA 3M7GA 1I4GA 1U9RA 3MXUA 1B53A 3QWNA 2XRQD 4H44C 5IGGA 4PMWA 1XYIA 1SJHD 3IKJA 4RHSA 5FK9C 1AFPA 3NWSA 2JP1A 3G7LA 3GTLB 5C44B 1EYAA 4KJNA 3KK7A 3TP6A 1A2TA 2F0VA 3E5SA 3GTQB 1NCVA 5FKAC 2E74C 2PQEA 4RCNA 2TMPA 2PO4A 4QF4A 3TSSA 2F0TA 1PZID 2JE6I 5TSSA 1QWYA 3QIAA 1SNCA 1TS3A 3NQIA 2NVTB 2YU9B 5KEEA 1GXDC 5ELFA 2XRSD 3DWQA 1STGA 1LABA 1E2ZA 3M3YB 1FNWA 4ZUJA 3KF8A 4KY6A 1BNZA 3VYRA 4BY7B 2JYOA 2J7ZA 2MUYA 2MPMA 5C3XA 2RQXA 4G7ZC 1KTKA 2A6HC 1X3QA 4FVMA 4BWGB 1MGSA 2EYHA 2F0SA 2B2TC 1EOTA 3Q0AA 1E2VA 1B9MA 3H91A 4K14A 3UI2A 1BCPD 3TP7A 3K57A 3GV6A 3QOJA 1CZGA 2L0CA 5DAUA 4P2CB 1DOLA 2NUCA 4OGQC 2LS01 1IW7D 1B44D 2DN8A 3PUXA 2K32A 1RJTA 2FJ2A 2CHBD 5EPLA 4F87A 3SR1A 2WIIB 1HPCA 2C9OA 1EL0A 3DM1A 5BN4A 3K5NA 3VR3A 1TR5A 1ILQA 4A3IB 4IALA 1F2MA 4FXGC 2WB1B 5E4WC 2EY1A 3KLSX 3HEJA 1ZKOA 2PMZB 3MXGA 3HGBA 1EZ8A 3OPOA 1LTID 1V1PB 1UEAB 1GUNA 1PDQA 3A7AB 4GZYC 2EJFC 3K59A 1X3PA 3BYTB 3Q24A 2EYMA 4X3UA 4IQZA 4Q5VA 3T4AC 2RVLA 2MGSA 1IKLA 2DY7A 1I50B 2A68C 2X69A 3S16B 2A69C 1BQQT 1JORA 1H9KA 1HUNA 3R8BA 5EBDA 3GD7A 1SE3A 2F0GA 5J1ZA 2BE5D 1HA6A 1EEID 5CBEE 4N9TA 4IFDJ 1NAPA 5C6AA 4KJOA 2NVQB 1FNVA 1J8IA 1CTMA 4FF1A 2QCPX 1BO0A 4C3IG 2FINB 2BDOA 5JVH3 3DEPA 3CRKC 3LX0A 3HG9A 5I4DA 1I6VC 1G6ZA 3GQBA 1PTOF 2ZXPA 1F9SA 5CV7A 1DONA 1S5BD 1SE2A 4XIGS 5ELCA 2F0DA 1EYDA 3PUYA 1FNUA 4FO2A 1YNNC 3BZDB 3KLRA 4MIUA 3OIPA 2KOLA 3MZ5A 4M8AA 1HRJA 5CV5A 1QG7A 1EU4A 3V2TA 1EY5A 1W6KA 3X3NA 1AEXA 1H9SB 5D65A 4IFDG 4LJZC 5DEHA 2NZ1D 3DWAA 4TQUS 1STAA 4RGMA 1TKWB 1BBXC 4DF7A 3IFTA 1V8QA 1EY8A 2D5DA 1JQYD 1ENFA 2F0JA 1ET6A 4CKCA 3J80E 4U68A 4K6DA 2K1BA 2OF1A 5C4ZA 2G9DA 2L11A 1HQMC 4RFBA 1Q8IA 5D3IB 5EKKA 2Q8TA 2B2VA 3MXNA 2E2IB 2BA1A 1EYCA 2IJ0A 3J7AF 5C4XB 4BA2I 1PRTB 1A3VA 2O4XA 1I4XA 1AP0A 1CK1A 3KBXA 2SDFA 5CV8A 5LL6S 1U4RA 5C0XI 3FPUB 1MI2A 2MHVA 4CJ2C 1EY4A 1MSHA 1M4VA 3GTPB 2F0UA 1SDFA 5KNDA 3K5LA 2J4XA 2NBFA 3VYUA 3K0YA 1CHPD 1I3QB 5C3WA 2IX0A 4IUPA 4BBSB 4JBWA 3K6OA 1JICA 2EOTA 1B9NA 3QOLA 4A3EB 3I70A 1L0YB 4TRDA 4LAAA 3M4YA 1X32A 2KA7A 2XNAC 3EQLC 3TZUA 5IT9L 2JA7B 3NTHA 4KKTA 2BDNA 2QEJC 5K5PA 5EBCA 1KNEA 1BCPF 4FYDA 2EYJA 1TWGB 4K2LA 1SBBB 4RH6A 2ZXOA 4WJWA 4K8JA 2A68D 1CM9A 1BCPB 1TWCB 1KDAA 1JCKB 1DXMA 5K36H 1SNOA 1H9MA 2IX3A 4RHRA 5ELBA 1QOHA 3QO2A 3NSWA 1NR2A 3SXHA 4C3JG 4I65A 1BR9A 1C8CA 2K6AA 1XTCD 5I9PA 2B2VC 3I73A 1STEA 1EY9A 4DNTB 2L1BA 2PPBC 3J80L 3G6JB 4IFDH 1D5MC 1S5ED 4DU9A 4TSSA 1D2BA 2A73B 1LLRD 4NW2A 3DMUA 4QUFA 2R3ZA 3PV0A 1O7ZA 4XT1B 1TWHB 5AFWA 4QIWB 1Y1WB 1YNND 2AUJD 2Z4HA 3GV3A 3HOZB 3RUZA 1GHKA 3J7AV 1O78A 1ML0D 5CR3A 4V190 3FPPA 3HOXB 4XXEA 4J6HA 1FYCA 3S1RB 3BVZA 5DNFA 2Z8LA 3IAYA 2WINB 3OHXC 1QNUA 3P75A 4KHVA 1QILA 3A54A 1ZYRD 4X3SA 4XQNA 3SK4A 1LT6D 2ZT9C 4RKBA 2BE5C 2AQ3B 1G91A 4XTCS 4A3JB 5EKLA 5EJWA 2RA4A 2O2LD 1GUWA 1JOQA 4H7BA 1RHPA 1ILPA 5E1FA 4ZKBB 1CT1D 2F0FA 1MBYA 2B39A 1VF5C 2D2CC 2K7VA 5CV6A 1A3UA 5FOBB 1A2UA 1ESRA 1WTPA 3ERQA 4L6TB 3DWPA 2IWHA 3BDOA 1SE4A 1PFMA 1SNQA 1B4OA 1XWEA 1RTOA 3BG3A 2AWOA 1WD1A 4NKLA 2QILA 4A3FB 3BYYB 1TWFB 1LTBD 2F03A 1JE4A 3K7AB 1HCZA 5DM63 4JK1C 1I4QA 3NPPA 1Q1BA 4PQXA 3NQTA 2WAQB 2K05A 1DYQA 3L3OC 4IURA 2L55A 1AN8A 1O7YA 1JOOA 4ZQ3A 1STNA 2K33A 4HTHA 3NP8A 1VMCA 5J39A 1E2WA 4XDXA 3D6CA 3S1QB 1EZ6A 1Z7TA 1FR3A 4DGZA 3TDQA 2F0PA 3H6MA 2KECA 5LHY1 1TY2A 2RDHA 4HSVA 1VCIA 1CZWA 5C4JB 1JWUD 3T51B 1MD2D 1EEFD 1Z6HA 4IUVA 4HMJA 1DM0B 3MC0B 3NTKA 3I4LA 1SNDA 3PUVA 3OW7A 3RMHA 4Q0FA 2ENBA 1MSGA 1F9PA 2EYFA 2NN6I 1SXTA 3EA6A 4CKEA 4DAYA 1G2TA 3QJYA 3X3MA 3I4MB 1U4LA 2JA6B 5C4HA 1WVLA 5KRUA 2R7ZB 2B2UA 1E0BA 1TWAB 3E0JA 4KN7C 3PIP3 5C3EB 3M7NA 1ET9A 1D5ZC 4DXGA 1KNAA 1BXTA 1LT4D 1LTAD 1F2ZA 1HXYD 1EY0A 3PO2B 3HS0C 5FLXE 3H09A 1D5XC 2KEDA 1II3A 2F0OA 3D4WA 5FO9B 3AMUA 4OIKA 3DHQA 2VNUD 2IT1A 4ZLTF 2EY6A 1B2TA 4EQNA 4MN3A 4B9WA 3NK9A 4ILWA 4F8MA 1Q90A 4Z9CB 3S2HB 2NTTA 5M5WB 3C2PA 4RAUC 3A8KE 1TY0A 3NHHA 4DK0A 2E2HB 5IOCA 4IFDI 4C3HG 1IKMA 4E6IA 2F0QA 1R9TB 1ZEQX 2PZWA 1KLUD 1PZJD 4QMGA 1WTWA 4U673 5IT9E 3QG1A 4CKBA 4F7XA 3L7ZC 2JA5B 2DY8A 2DNEA 1TS5A 5K36G 5EGTA 3FVQA 3GTGB 2VB3X 4ME5A 1CI3M 5I9OA 5IGEA 4M1UB 3R3OA 3NUCA 4A3MB 1GJXA 2E76C 1PTOB 4BS9A 4R9WA 5T1IA 2BA0A 1LACA 2EYOA 4K6LA 1HQRD 2N88A 2F0MA 1SYFA 2B63B 3I8ZA 2XWBB 2VUMB 3NXWA 1CA6A 1RKNA 3VA7A 1JR0D 4NMZA 4G7OC 1CQVA 4BBRB 1BF4A 3V05A 3SVMA 2EDGA 3LWEA 2KVMA 5JEAJ 3HOUB 3GTKB 2EZVA 3CKIB 2WACA 2NYZD 2MP1A 3SHLA 1SMYD 1S5FD 4ZUIA 1ZYRC 4YIJA 2B2UC 5M3MB 3VR2A 5IGCA 4XQQA 4X3TA 1NR4A 4RKLA 2NVYB 1HTLD 3OSOA 3SDZA 1NUCA 2H1EA 3OWEB 2RSOA 2G9HD 3JAML 2EPBA 1I4HA 2CQAA 1UNSA 5G3LD 3RLFA 4WRDA 5JEAG 1RDPD 4DXFA 3J81E 2F1MA 3MFYA 1G291 1QB5D 4DK1A 3FRPB 1LO5D 3EJIA 5F2DA 5CYUA 5FLXL 2EY5A 1VF7A 2F0HA 1CQFA 1M8AA 4RGOS 1SNMA 4ID6A 5COYA 2A6EC 1SSOA 2F3WA 4R8NA 4H0LC 4NP5A 3S15B 1G2SA 1Y8NB 1DOKA 5CV4A 3Q23A 2E2JB 4EGVA 3HRZC 1KLGD 1ENAA 3T16A 3TZDA 5D14A 2XN9C 4HMIA 5CV9A 1D1IA 3BDLA 1B3AA 1SNPA 3Q6SA 1LTTD 2WKCA 5KNCA 1VMPA 4FXKC 4K5XA 5C0XJ 1IL8A 5EPKA 2BOSA 1JC7A 4K5WA 3SE0A 2R93B 4TKOB 3WDNA 3Q22A 2K5DA 2AQ2B 3VA5A 4HEDA 2J0TD 2X6LA 1V1OA 1WTXA 2SOBA 3LWUA 2ID0A 3SEBA 1YNJC 3MXPA 1PLFA 5C5LA 1JB3A 1FGBD 1EU3A 4L63B 1AW7A 5C0XG 3I3CA 3NTIA 1UAPA 1BOSA 1NSNS 4QCLA 2MJ8A 3AB9A 4KY5A 3K5OA 5E4XA 1T5XD 3MEHA 1ZXTA 3URYA 1O7LA 5A35A 4A3DB 2CVRA 4HR7B 1SJED 1RCVD 4XQJA 2ICEC 4I7ZC 3RD4A 1C4QA 5I6YA 2D62A 5CORA 2B8GA 2HDLA 2NB0A 2VXWA 1O80A 1TU2B 1GUOA 1PXUA 5EKIA 1FD7D 3U9SA 3N6RA 1C48A 3BVGA 3EVQA 1GOZA 3OMGA 4RCOA 3K5MA 3T53B 4OO1G 1JWMD 1PMRA 4LMQD 5HGTA 1OXSC 4ZRZA 2M9VA 1EQVA 2Z4IA 4KI0A 3A8IE 3NBHA 5DM73 2LY7A 2IL8A 1J9OA 5KNBA 2FHTA 4MHEA 1QE6A 5E3FA 1F9QA 5IIFA 2SNSA 5NUCA 3CU7A 1ONLA 4ZYSA 3GO5A 2L12A 4C2MB 5I6WA 5CC4A 1HHVA 3BS1A 3KLSA 4A3BB 3J81L 3P1HA 2M2LA 1VDZA 2PYKA 4ZAIA 1ESFA 3CQZB 1DZ1A 4KD3A 5JEAH 3HP3A 2XIWA 1I4RA 3ONAB 2GA4B 5T1GA 3U9OA 2JEAI 2EJMA 3A55A 3S1NB 2NWGA 2IPKD 1K83B 1SFOB 1S4ZA 1R4QB 1A15A 1L0XB 3T56B 3RZOB 3H0GB 4ZK9B 2F3VA 4EVOA 2B8FA 2KQ3A 3O13A 2N55A 3MTSA 1DOMA 4HN7A 1PFNA 2A6ED 3PIO3 4IUNA 5ISRA 3I4NB 4O42A 5JPNC 3R2IA 2QF7A 5JAVA 1BUVT 2F0WA 2ICIA 1GUGA 3FEWX 4FP5D 1Y1VB 3MVVA 5C0XH 1F2LA 2DNCA 1V1PA 4KY7A 3NBIA 3T13A 1EFID 1QCBD 3ND8A 2FMCA 1A6XA 1AZQA 1LV9A 4KK7A 1SMYC 1TIID 1RODA 5M9OA 5G3LF 2FMMA 3H94A 4L8JA 1EY7A 2F0NA 2L4NA 1YNJD 1G8ZD 1U4PA 5I2YA 3S17B 4A3GB 2K01A 4C3HB 4OO1H 4QB4A 3PO3B 2K04A 3FDTA 3SK5A 3HOYB 2NVXB 4RGNA 2A5HA 4C3IB 1KABA 2LKVA 3DEOA 4IUTA 1D6EC 1WTVA 5JOBA 4H13C 1OXVA 5JJZA 4PV1C 5BN5A 4Y7NB 1B50A 4KMUC 4OHJA 3TMEA 1SYDA 3R2TA 1F77A 3MHBA 3PUWA 2EJGC 3AU7A 3C1FA 2JA8B 2JXMB 4AYBB 2HDMA 3PUZA 1TT2A 4CBVA 2K28A 2L9HA 2EYLA 4S3SA 4IZ8A 1H9SA 4G57A 3JAME 4HCSA 4ULLA 3GP7A 4ZKCB 1LTGD 2HUGA 3MA2B 3IFDA 1UUPA 2WP8J 1F9RA 1HFGA 3OOCA 4KTAA 5ELDA 2OT2A 3D8GA 5BN3A 3TBIB 2JSOA 1IHZA 1AZPA 4HSPA 2F0IA 3GTOB 3P20A 2R92B 3KBGA 2F0KA 4HAEA 4WORA 1HA5A 2KEEA 1CHQD 4N9PA 5FO7B 3TP8A 2WV6D 3D4DA 3ZYYX 4J8QA 3ND9A 1ICWA 2FFKB 1ENCA 5JVG3 2EY2A 1V43A 3DUZA 5EQ0A 5KIXA 3GTJB 2L5TA 3J7YW 1HUMA 4ABNA 1CFMA 2EYPA 2X6GA 2NN6G 3MWYW 1EIHA 1JWSD 5IGBA 2I46A 1WD0A 3ITPA 5IGFA 3DXJC 5CMDA 3NWTA 4XYQA 1SAPA 3S14B 4C56C 2PCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QE6 A;  5EPK A;  1CA6 A;  1F9Q A;  1KNE A;  3P7J A;  1KNA A;  1X3Q A;  5DNF A;  1MGS A;  4UAI A;  2Q8T A;  1QNK A;  2B2V A;  4XT3 B;  2B2T C;  3IL8 A;  1BF4 A;  1EOT A;  2L12 A;  3SVM A;  1HUN A;  2EE1 A;  2HDM A;  2KED A;  1XX8 A;  3H91 A;  4OIJ A;  3UI2 A;  3LWE A;  2KVM A;  2K28 A;  4HED A;  1CM9 A;  1HHV A;  1RTN A;  2L9H A;  2X6L A;  3GV6 A;  4OIK A;  4CJ0 B;  1F2L A;  4HCS A;  2NYZ D;  3I90 A;  2MP1 A;  2B2Y A;  1HA6 A;  2K05 A;  4IUU A;  4X3S A;  1WTX A;  1DOL A;  4ZLT F;  2M2L A;  4IUR A;  4ZKC B;  4QUC A;  3QO2 A;  1WTQ A;  1O7Y A;  5CBE E;  2HUG A;  1B2T A;  3D6W A;  1NAP A;  2B2U C;  3IFD A;  4MN3 A;  1NR2 A;  1AP0 A;  1J8I A;  1F9R A;  1HFG A;  3KBX A;  1G91 A;  1RJT A;  4ZAI A;  1PLF A;  1AZQ A;  1BO0 A;  4X3K A;  1VMC A;  2SDF A;  4X3T A;  1B53 A;  1NR4 A;  2FJ2 A;  3KUP A;  1LV9 A;  2FIN B;  1C8C A;  1DZ1 A;  1GUW A;  3TN2 A;  5EPL A;  5EJW A;  4MHE A;  3DEP A;  4XDX A;  1U4R A;  1ROD A;  2B2V C;  2B2W A;  3I3C A;  4RAU C;  1WTO A;  1XYI A;  1AZP A;  3FPU B;  1MI2 A;  3HP3 A;  2RA4 A;  2MJ8 A;  3F2U A;  4CJ2 C;  2L1B A;  2XIW A;  1EL0 A;  1G6Z A;  3ONA B;  1RHP A;  2FMM A;  2H1E A;  2HCC A;  5E4X A;  4CJ1 B;  1ILP A;  3DM1 A;  1MSH A;  1F9S A;  2KEC A;  2L4N A;  2RSO A;  5T1G A;  1IKM A;  2JP1 A;  3I91 A;  1ZXT A;  3G7L A;  1DON A;  2EPB A;  4HAE A;  4HSV A;  1ILQ A;  1EIG A;  1U4P A;  4RWS C;  4ZKB B;  2B2Y C;  2CVR A;  1CA5 A;  5EPJ A;  2KEE A;  4NW2 A;  2KOL A;  1SDF A;  4IUV A;  2NWG A;  1WTW A;  2K01 A;  1HRJ A;  1NCV A;  1QG7 A;  2R3Z A;  4QUF A;  1O7Z A;  5E4W C;  4XT1 B;  5COR A;  4DN4 M;  2DY8 A;  1ICW A;  2FFK B;  2HDL A;  2RSN A;  3N52 A;  5AFW A;  1HFN A;  4IUQ A;  5D65 A;  2K04 A;  1S4Z A;  2Q8R E;  1A15 A;  3FDT A;  1M8A A;  1O80 A;  2VXW A;  2B2W C;  3R93 A;  4RA8 A;  4IUP A;  1ESR A;  4ZK9 B;  2KUM A;  3GV3 A;  5EKI A;  1PDQ A;  2NZ1 D;  5COY A;  1WTP A;  1SSO A;  5EQ0 A;  1JIC A;  2B2T A;  2EOT A;  1HUM A;  4R8I A;  1MSG A;  2X6G A;  1X3P A;  3MWY W;  1BBX C;  1G2S A;  1EIH A;  1DOK A;  1F9P A;  3DEO A;  5CBA E;  1PFM A;  2N55 A;  4IUT A;  4R9W A;  3MTS A;  5T1I A;  1WTR A;  1X32 A;  1B4O A;  1DOM A;  1WTV A;  4X3U A;  1WD0 A;  1G2T A;  1RTO A;  3TZD A;  5JJZ A;  4LMQ D;  1WD1 A;  1ML0 D;  2RVL A;  5D14 A;  2MGS A;  1U4L A;  1PFN A;  1B3A A;  1Q3L A;  1IKL A;  3Q6S A;  4U68 A;  1BNZ A;  5CMD A;  2DY7 A;  2HCI A;  4O42 A;  1SAP A;  1VMP A;  1B50 A;  2JYO A;  2N88 A;  2K1B A;  1WVL A;  2B2U A;  1E0B A;  3I8Z A;  2D9U A;  2BDN A;  2X69 A;  2IL8 A;  2J7Z A;  2L11 A;  1U4M A;  1J9O A;  2K03 A;  1IL8 A;  2MPM A;  2FHT A;  1EQT A;  1JE4 A;  1PFB A;  1TVX A; 
#chains in the Genus database with same CATH topology
 1TWH H;  1I94 Q;  1RD9 D;  2K5Q A;  1WOC A;  1LUZ A;  1Y1W H;  2OTL A;  1Q8K A;  1YBY A;  3A74 A;  4XT3 B;  1C9O A;  3A56 A;  3IL8 A;  3NE5 B;  4K5V A;  3HOZ H;  3K80 C;  3MFG A;  5JJI A;  3OWF A;  4EQO A;  1N32 L;  2TSS A;  3S2D B;  2R61 A;  1I6H B;  3S24 A;  2BCO A;  4GN3 B;  4QL5 A;  4K0K Q;  3PMF A;  1IXR A;  1CKO A;  2B2Y A;  2Q8I B;  1EYG A;  3V96 A;  3MAQ A;  1SEB D;  2YV5 A;  1STY A;  5IP9 H;  3D6W A;  2RCF A;  2O5J C;  3TRZ A;  2H4O A;  2RDG A;  2R7D A;  1F2Y A;  4KD4 A;  3D0F A;  3HOX H;  2SNM A;  4JI0 L;  3BVM A;  1GUT A;  4DV2 Q;  3QB3 A;  4DAY B;  4PMC A;  5A2Q E;  3S1R H;  1PTO C;  2I5M X;  3HZX A;  4V0B A;  1NTG A;  1SYB A;  4JOI C;  4DA2 A;  4DAV A;  1QVF A;  3F2U A;  2UXB L;  3M4O B;  4CJ1 B;  4B08 A;  3I4M G;  4HIK A;  4PZ7 A;  1YNX A;  2JA6 G;  1A62 A;  1RF2 D;  2CFM A;  2D0O A;  4LF9 L;  5IGD A;  2PW5 A;  1EIG A;  4LF6 L;  2R6G A;  3SGI A;  2VB2 X;  2I07 B;  5EPJ A;  1MIU A;  3LNN A;  3BU2 A;  1K8O A;  1EFW A;  2M00 A;  4FXD A;  2NTS A;  3SK8 A;  1PZK D;  1ICF B;  4NPS A;  1QJO A;  3F1Z A;  1D1K A;  1XPU A;  3MEF A;  3PO2 G;  2CWP A;  2QDB A;  3N52 A;  2A19 A;  5BR8 Q;  4A3J H;  2K5W A;  2WKD A;  2C5C A;  5JPM C;  1W3S A;  3HKS A;  2AWN A;  4C3J B;  1N8R C;  3VR4 A;  2F4V L;  2CW0 C;  1YIJ A;  1GHJ A;  4ODG A;  1Q1E A;  3OIQ A;  4A3K B;  1LTS D;  3FP9 A;  3GTM B;  1WJJ A;  3W3A A;  4QIW E;  1PRT F;  5C5M A;  4JI7 L;  4QJF A;  3CF5 A;  4G7H C;  1Q3L A;  1OXU A;  2A6H D;  2KCC A;  2JEB I;  4CHT B;  1GUS A;  1B1Z A;  1X56 A;  5M5Y B;  3AFQ A;  1GVP A;  1U4M A;  2K03 A;  4JI6 L;  3KF6 B;  5J22 A;  4EQP A;  4JI5 L;  2HQE A;  1EQT A;  4A3L G;  4JYA Q;  4A93 B;  1JJ2 A;  1PRT C;  4GNX B;  3AEV A;  2NZO A;  4UHV A;  2MO0 A;  5HUR A;  2PW7 A;  1SE8 A;  2E75 C;  2O5I C;  2ZXR A;  5IYC G;  4GKK L;  3GDE A;  4WFN 3;  4OL7 A;  1YJN A;  5FO8 B;  2UXD Q;  3I90 A;  2Q2T A;  1VQ8 A;  3PQI A;  4IUU A;  1EY6 A;  2JA5 G;  3VR5 A;  1WTQ A;  5AJ3 Q;  2KCN A;  1H9J A;  5LL6 X;  3CRL C;  4DR1 L;  3OMC A;  4G4K A;  2IW3 A;  4A3F H;  1OXX K;  1TWF H;  2OEO A;  3KUP A;  4A3M G;  1SYG A;  2Z0S A;  4DFA A;  1K8A C;  3K7A H;  1L1O A;  2B2W A;  1M1K C;  2LMC B;  2RBM A;  4NXN Q;  2KHS A;  3UE1 A;  1OO9 B;  4BY1 B;  1I4P A;  4FDB A;  3WOE A;  3K58 A;  3FKI B;  3FMC A;  1T5E A;  4C1N K;  5M5X B;  4RWS C;  3VR6 A;  4L5Q A;  2B63 G;  1PA6 A;  2B2Y C;  4K8I A;  5M3F B;  2IX1 A;  2VUM G;  3U4V A;  1SYC A;  4JI8 Q;  3ERO A;  3C46 A;  4L5R C;  1TS4 A;  1V9P A;  2NN6 H;  4IPD A;  1X6O A;  3CCE A;  3EFX D;  4OO1 I;  1KAA A;  3H3V C;  1Y69 U;  4BBR G;  4DN4 M;  3CCR A;  1MJE A;  1HFN A;  2RSN A;  4IUQ A;  2Q2I A;  4DNR B;  3M85 A;  2Q8R E;  2UXC L;  1DJR D;  5IWA L;  3R93 A;  1HJP A;  4HCE A;  3HOU G;  4KHZ A;  2RDF A;  2KUM A;  1LT3 D;  4LF8 Q;  3S1Q H;  3S9W A;  2Z1C A;  4F88 A;  4Y52 H;  1K8M A;  2E2D C;  4K2K A;  2PZU A;  4YY3 L;  1KDB A;  1Y8P B;  3A7L A;  4WJ4 A;  5CBA E;  5M3M G;  1N34 L;  4P71 A;  1N33 L;  1LTL A;  5IOD A;  2Y0S B;  1IYV A;  3F2C A;  5C4J H;  2KHI A;  4FF3 A;  2A69 D;  5I2X A;  1W6J A;  4LK1 C;  5A2Q L;  1BDO A;  2EVB A;  1BCP C;  3C1E A;  2D9U A;  2V4D A;  4DV4 L;  1FJG L;  1EWC A;  4UDU C;  2KJX A;  1PFB A;  1TVX A;  3P7J A;  1SMX A;  2B3G A;  4UAI A;  2XVS A;  1XJV A;  2XWJ B;  4B9X A;  1X3E A;  2MO1 A;  3W1B A;  2QEX A;  2EE1 A;  1IW7 C;  4OIJ A;  5KYL A;  4JI4 L;  1OXT A;  4KKU A;  2D0P A;  2WFW A;  4KKS A;  3T1H L;  2PNR C;  5ELE A;  2ZJP A;  3HOV B;  1E7Z A;  4GN4 B;  5CGK A;  1Z47 A;  1HTP A;  1S5C D;  1H9R A;  1TS2 A;  1O7I A;  4DR2 Q;  3I4M H;  2JA6 H;  5KGU A;  1IBK L;  4GLX A;  4B3S L;  3D4R A;  4PMB A;  1DCZ A;  2DJF C;  1PYS B;  2R7Z H;  4DAP A;  1TWA H;  4X3K A;  2LFN A;  2GVB A;  2WAQ E;  4XYO A;  5C3E H;  1DD2 A;  3TN2 A;  1PH1 A;  2AUK A;  3W2D A;  1PH9 A;  1YIT A;  1WTO A;  1R4P B;  1HZA A;  3L9A X;  2F4I A;  1PVO A;  1KXL A;  1CKM A;  4IN3 A;  3E6Z X;  2HCC A;  3PO2 H;  4X62 L;  4RGT A;  2KCM A;  3I91 A;  3CHB D;  3D3R A;  2A8V A;  3CCJ A;  2I0Q A;  1CA5 A;  1STB A;  1PTO D;  4POF A;  4BBS G;  3HFZ B;  3UDX A;  3WOF A;  2AQ1 B;  4CGY B;  4FF2 A;  3A8J E;  1STH A;  1L1O B;  3I2Z A;  2LXK A;  3HKZ B;  2SEB D;  1Y8O B;  3NEN A;  4KN4 C;  3IRB A;  2OXP A;  4O1N A;  2R93 G;  5HGQ A;  1X54 A;  3Q8D A;  4OX9 L;  2B2W C;  5H1S E;  4DUZ Q;  4FF4 A;  4RA8 A;  1EWH A;  3S2H H;  4KV6 A;  1HNX Q;  3D31 A;  5M5W H;  4DR5 L;  2B2T A;  4J1M A;  2UU9 Q;  4R8I A;  2E2H H;  3I72 A;  4A3L H;  3VYS A;  4UP7 A;  2F0E A;  2A74 C;  1WTR A;  1TQO A;  3PSI A;  3PIO A;  1S5D D;  1R9T H;  4NDX A;  3RZD B;  3EIV A;  1PYW D;  1C7Y A;  1LT5 D;  4L5S A;  2CW0 D;  2HCI A;  2QGQ A;  2F0L A;  4BA1 I;  3RN5 A;  4K0K L;  4QQB X;  1XXG A;  2RKS A;  3A5U A;  4NXM Q;  3TRE A;  3VYT A;  4IPH A;  5D3D A;  2K5V A;  1KRS A;  4QY7 A;  4PZ6 A;  4DAM A;  2JA5 H;  1E3P A;  2XSC A;  1WCM B;  4FNF A;  1JOK A;  4P75 A;  1QNK A;  3GTG H;  3TP5 A;  2EXZ A;  4P72 A;  5KYI A;  4A3D G;  3BDC A;  2VY3 A;  4DV2 L;  1XX8 A;  1GD7 A;  4A3M H;  1RTN A;  2VW9 A;  3HOW B;  2QDL A;  1VQE A;  2F3I A;  2PZT A;  3J80 i;  2CCZ A;  3C3L A;  4GOP A;  4CJ0 B;  1Q12 A;  4C1N I;  1PTO H;  2JA9 A;  1PRT D;  3M4P A;  2QKI C;  2YYZ A;  1QUQ B;  1A3T A;  1IYU A;  4QUC A;  3I7F A;  3SK6 A;  1HZC A;  1SYE A;  1LTR D;  1YHB A;  5IYD G;  3S1M B;  1KDC A;  4PNY A;  3M7G A;  1I4G A;  2B63 H;  1U9R A;  3ULP A;  3MXU A;  2VUM H;  1B53 A;  3QWN A;  2HQL A;  2MFI A;  2XRQ D;  4H44 C;  3ULJ A;  2PI2 E;  4PMW A;  5IGG A;  1XYI A;  5BR8 L;  1SJH D;  3IKJ A;  2DUD A;  4RHS A;  4BBR H;  5FK9 C;  1WYD A;  3NBH B;  1AFP A;  2JJQ A;  3NWS A;  2JP1 A;  3G7L A;  3GTL B;  3HOU H;  5C44 B;  3GTK H;  4DR3 Q;  1EYA A;  4KJN A;  4ME3 A;  4YWM A;  3KK7 A;  4GKJ Q;  3TP6 A;  1A2T A;  5EAY A;  2F0V A;  3E5S A;  3GTQ B;  2VQE L;  1NCV A;  5FKA C;  2N78 A;  5M3M H;  2E74 C;  2PQE A;  4RCN A;  2TMP A;  1FL0 A;  2PO4 A;  4QF4 A;  3TSS A;  2F0T A;  1NNX A;  2NVY H;  1PZI D;  2JE6 I;  5TSS A;  1QWY A;  3QIA A;  1SNC A;  1TS3 A;  3NQI A;  1PFS A;  2NVT B;  2YU9 B;  5KEE A;  1PH8 A;  1GXD C;  5ELF A;  2XRS D;  3DWQ A;  4MTK A;  4HJ5 A;  1QZH A;  1STG A;  1LAB A;  1E2Z A;  3M3Y B;  3CCL A;  1FNW A;  4ZUJ A;  3KF8 A;  4KY6 A;  3RR5 A;  1BNZ A;  1VS0 A;  3VYR A;  4BY7 B;  2JYO A;  2J7Z A;  2MUY A;  1X55 A;  4KHP Q;  1V1Q A;  2MPM A;  5C3X A;  3F2D A;  1EWI A;  2RQX A;  4G7Z C;  5AJ3 L;  1KTK A;  1SRU A;  2A6H C;  1X3Q A;  4FVM A;  5DLQ E;  4BWG B;  1MGS A;  2EYH A;  1MJC A;  2F0S A;  2B2T C;  1EOT A;  3Q0A A;  1E2V A;  1B9M A;  3H91 A;  3F8T A;  4K14 A;  3UI2 A;  1BCP D;  3S15 H;  3TP7 A;  3K57 A;  3GV6 A;  3QOJ A;  4NXN L;  1CZG A;  2L0C A;  2E2J H;  5DAU A;  4P2C B;  1DOL A;  1X9N A;  2NUC A;  4OGQ C;  2LS0 1;  1NBW A;  3W1G A;  1IW7 D;  1B44 D;  2DN8 A;  3H0G G;  3PUX A;  5LMN Q;  2K32 A;  1RJT A;  1UE5 A;  2FJ2 A;  4BBS H;  4JOI A;  2CHB D;  5EPL A;  4F87 A;  2JN4 A;  3SR1 A;  2WII B;  4CDE C;  2EXD A;  4UPA A;  4GOP B;  1B70 B;  1HPC A;  2C9O A;  3CME A;  1EL0 A;  2R93 H;  3DM1 A;  5BN4 A;  3K5N A;  3VR3 A;  2HHH L;  1TR5 A;  4LF8 L;  1ILQ A;  1S72 A;  4OXP A;  1EUJ A;  3OTO L;  1KRT A;  4A3I B;  5GAD C;  1XMQ Q;  4IAL A;  2ATW A;  5GRO A;  1VQ9 A;  1F2M A;  2UUB Q;  4FXG C;  3RLO A;  4LF5 Q;  2WB1 B;  5E4W C;  4O0A A;  2EY1 A;  3KLS X;  3HEJ A;  1ZKO A;  2PMZ B;  2IY5 B;  3MXG A;  1JB7 A;  3HGB A;  1Y1V G;  1EZ8 A;  3OPO A;  1LTI D;  1V1P B;  1UEA B;  1NY4 A;  1GUN A;  1PDQ A;  3A7A B;  5LMN W;  4GZY C;  4DV1 Q;  2EJF C;  1UWV A;  3K59 A;  1X3P A;  3NEL A;  4YCV A;  4HIM A;  4ZCK A;  1D8L A;  1SLJ A;  3BYT B;  3Q24 A;  2EYM A;  4X3U A;  4IQZ A;  4Q5V A;  3T4A C;  4A3D H;  1HNW Q;  2RVL A;  2MGS A;  1IKL A;  1C0A A;  2DY7 A;  4AQY L;  1I50 B;  1K3B C;  1PH2 A;  2A68 C;  2X69 A;  5ELO A;  3S16 B;  3E3X A;  4DR2 L;  2A69 C;  4LW1 A;  3G71 A;  2WAQ G;  1BQQ T;  1JOR A;  1H9K A;  2H5X A;  2E5L Q;  5IYD H;  3I4O A;  3TS0 A;  1HUN A;  3R8B A;  3KYH C;  5EBD A;  3GD7 A;  1SE3 A;  4A3G G;  4IPC A;  1VQA A;  4JI2 Q;  2F0G A;  4HIO A;  3J7Z C;  5J1Z A;  1VQC A;  2BE5 D;  4LFC L;  1HA6 A;  2DGY A;  3U58 A;  1EEI D;  4JI1 Q;  5CBE E;  4N9T A;  4IFD J;  1NAP A;  2ZTE A;  5C6A A;  4KJO A;  2NVQ B;  1FNV A;  1J8I A;  1YJ9 A;  1CTM A;  2VQF Q;  4FF1 A;  2OWO A;  3HOY G;  2QCP X;  1BO0 A;  1UEB A;  4C3I G;  2FIN B;  4JBK A;  2BDO A;  5JVH 3;  3DEP A;  3CRK C;  3LX0 A;  3HG9 A;  1GM5 A;  5I4D A;  1I6V C;  1G6Z A;  3GQB A;  1PTO F;  2ZXP A;  4C2M H;  4DUZ L;  1F9S A;  5CV7 A;  2Z6K C;  3STB C;  1HNX L;  1S5B D;  1DON A;  2UU9 L;  1SE2 A;  4XIG S;  5ELC A;  4A3B H;  2F0D A;  1EYD A;  3PUY A;  1FNU A;  4FO2 A;  1YNN C;  3KDF B;  3BZD B;  3KLR A;  4LNQ A;  5JJK A;  4MIU A;  3OIP A;  2KOL A;  3MZ5 A;  4M8A A;  2JA8 G;  1HRJ A;  3OW2 A;  5CV5 A;  1QG7 A;  4AYB G;  1EU4 A;  3V2T A;  1EY5 A;  1W6K A;  3X3N A;  1AEX A;  1VQI A;  4HJ8 A;  1H9S B;  4A3C G;  5D65 A;  3CQZ H;  5IY0 A;  4IFD G;  4LJZ C;  1YHA A;  2PNH A;  4JV5 L;  1UE1 A;  5DEH A;  2NZ1 D;  3DWA A;  2R7Z G;  4TQU S;  1STA A;  4RGM A;  1TKW B;  1BBX C;  4DF7 A;  5C3E G;  3IFT A;  1V8Q A;  1EY8 A;  2D5D A;  1JQY D;  1ENF A;  1K73 C;  2F0J A;  1ET6 A;  2OQK A;  4CKC A;  3J80 E;  4U68 A;  3S1N H;  4K6D A;  2K1B A;  2OF1 A;  5C4Z A;  2G9D A;  2L11 A;  1HQM C;  4X64 Q;  4RFB A;  1Q8I A;  5D3I B;  5EKK A;  4TVA B;  1K83 H;  2R92 G;  1SFO H;  2VS1 A;  2Q8T A;  2B2V A;  3RZO H;  3H0G H;  3MXN A;  4DNI A;  3KLW A;  2E2I B;  2BA1 A;  1EYC A;  3BJU A;  2IJ0 A;  1PH4 A;  3J7A F;  5C4X B;  4BA2 I;  3FHW A;  1K28 A;  2UUC Q;  1PRT B;  3PF5 A;  2PQA B;  1A3V A;  2O4X A;  2LXJ A;  1I4X A;  2IHF A;  3I4N H;  1AP0 A;  4LFA Q;  1CK1 A;  3KBX A;  4GKJ L;  1HNZ Q;  2SDF A;  1E22 A;  1L0W A;  3ULL A;  5CV8 A;  5LL6 S;  3E9H A;  3RNU A;  1U4R A;  1S40 A;  5C0X I;  3FPU B;  1MI2 A;  2MHV A;  4CJ2 C;  3G48 A;  3KJP A;  1EY4 A;  1MSH A;  2N3S A;  3CMA A;  2L15 A;  4JCV E;  4DV6 Q;  4JBJ A;  1M4V A;  1Y1V H;  4DV5 L;  1PYB A;  4RMF A;  3GTP B;  2F0U A;  1XNQ Q;  1SDF A;  2XGT A;  5KND A;  2J4X A;  3K5L A;  2NBF A;  3VYU A;  3K0Y A;  1A63 A;  1CHP D;  1I3Q B;  4MTN A;  3UDI A;  5C3W A;  3M9B A;  3K8A A;  2IX0 A;  4IUP A;  1E1T A;  4BBS B;  4JBW A;  3K6O A;  4KHP L;  1JIC A;  2EOT A;  1B9N A;  1GO3 E;  3CCQ A;  3QOL A;  4A3E B;  3I70 A;  1L0Y B;  4TRD A;  4LAA A;  3M4Y A;  1X32 A;  5IT9 c;  2KA7 A;  4LUZ A;  2XNA C;  3EQL C;  3S17 H;  3TZU A;  5IT9 L;  2JA7 B;  3NTH A;  4A3G H;  4ALP A;  4JW0 A;  4KKT A;  2BDN A;  2QEJ C;  4JG2 A;  4OWX B;  5K5P A;  1YZ6 A;  2FXQ A;  3T1Y Q;  1Q46 A;  5EBC A;  4C3H H;  1KNE A;  1BCP F;  4WJ3 M;  1NMG A;  4FYD A;  2EYJ A;  3PO3 H;  3F2B A;  5LMN L;  1TWG B;  3OYY A;  4K2L A;  1X3F A;  1SBB B;  4RH6 A;  2IHE A;  2ZXO A;  3HOY H;  4WJW A;  2NVX H;  4K8J A;  2A68 D;  1KD1 C;  1IBM Q;  1CM9 A;  1BCP B;  1TWC B;  1KDA A;  4C3I H;  1PH3 A;  4DR6 Q;  1JCK B;  1DXM A;  4DK6 C;  4A76 A;  5K36 H;  1K8G A;  1SNO A;  1H9M A;  1N9W A;  4R4Q A;  2IX3 A;  3CW2 C;  4RHR A;  1QOH A;  5ELB A;  3QO2 A;  2ZM6 Q;  3NSW A;  4DPG A;  1NR2 A;  5FLM H;  4Y7N H;  3SXH A;  4JI3 Q;  4C3J G;  1VQG A;  4I65 A;  2LSS A;  1BR9 A;  1Q81 C;  1C8C A;  3MXN B;  2K6A A;  2UUB L;  1XTC D;  5I9P A;  1B7Y B;  2B2V C;  3I73 A;  4LF5 L;  2JA8 H;  1STE A;  1EY9 A;  1GKH A;  3H3V I;  4DNT B;  2RHS B;  3J80 c;  2L1B A;  2PPB C;  2K52 A;  3TEH B;  3J80 L;  1NE3 A;  3G6J B;  4A3C H;  4DR4 Q;  4IFD H;  1D5M C;  1S5E D;  4DV1 L;  4DU9 A;  3ICE A;  4TSS A;  1D2B A;  2A73 B;  2OQ0 A;  1LLR D;  3DM3 A;  4NW2 A;  4A93 G;  3DMU A;  1VQP A;  1HH2 P;  4J15 A;  4QUF A;  2R3Z A;  3PV0 A;  1O7Z A;  4XT1 B;  1L2F A;  3STB D;  1HNW L;  1TWH B;  2GN5 A;  2OCE A;  5AFW A;  1XMO L;  1YEZ A;  4QIW B;  1XNR Q;  1Y1W B;  4DV3 Q;  2KEN A;  1YNN D;  2AUJ D;  4B3R Q;  1BKB A;  2Z4H A;  3GV3 A;  3HOZ B;  4X65 L;  5GAG C;  3GTO H;  2R92 H;  3H15 A;  2E5L L;  3RUZ A;  1GHK A;  3J7A V;  3ER0 A;  1O78 A;  1YI2 A;  2EIF A;  1ML0 D;  5CR3 A;  1PH5 A;  4V19 0;  2Q2H A;  3FPP A;  3HOX B;  4XXE A;  4J6H A;  4GLV B;  4BY1 G;  1FYC A;  4JI1 L;  3S1R B;  3BVZ A;  5DNF A;  2Z8L A;  3IAY A;  1I94 L;  2WIN B;  3OHX C;  1QNU A;  1LM0 A;  1N36 Q;  1Y14 B;  3P75 A;  5M3F G;  3KOJ A;  1EIY B;  4KHV A;  3GTJ H;  1QIL A;  1IZ6 A;  1IBL Q;  3A54 A;  1ZYR D;  4R1J A;  4AYB E;  1KAW A;  1AE2 A;  4X3S A;  4XQN A;  1VQ5 A;  3SK4 A;  2GVA A;  2CQO A;  4AIM A;  1LT6 D;  2ZT9 C;  1IL2 A;  4RKB A;  2BE5 C;  3S14 H;  2AQ3 B;  1G91 A;  4LWC A;  4XTC S;  4A3J B;  3PCO B;  3J7A 5;  5EKL A;  5LMU Q;  5EJW A;  4I7A A;  2RA4 A;  2O2L D;  5IYB G;  4OWW B;  1GUW A;  1JOQ A;  4H7B A;  1RHP A;  2Y0S G;  5E1F A;  1ILP A;  1K0S A;  4LF9 Q;  4IOC A;  1H95 A;  5L37 A;  4ZKB B;  4LF6 Q;  1CT1 D;  2K75 A;  1SR3 A;  1CSP A;  3S2D H;  1I6H H;  2F0F A;  1MBY A;  2B39 A;  1VF5 C;  1W2B A;  2D2C C;  2K7V A;  1Q86 C;  5CV6 A;  3L0O A;  1A3U A;  5FOB B;  2DJG C;  1A2U A;  1X3G A;  3HOV G;  1ESR A;  4X64 L;  4AH6 A;  1WTP A;  3ERQ A;  1D7Q A;  4L6T B;  3DWP A;  3M4O H;  2IWH A;  3BDO A;  1SE4 A;  1KHI A;  1PFM A;  4JI7 Q;  1EIF A;  1SNQ A;  2QW7 A;  3J81 i;  1B4O A;  4DV7 Q;  4PZ8 A;  1XWE A;  4R4I A;  1RTO A;  3BG3 A;  4JC0 A;  2AWO A;  1WD1 A;  4NKL A;  2QIL A;  4OEL B;  4UY8 C;  1VQL A;  4A3F B;  3BYY B;  1TWF B;  1LTB D;  2UUC L;  1VQ6 A;  4JI5 Q;  1JJC B;  2YTX A;  2F03 A;  2PI2 A;  4A3B G;  1JE4 A;  3A5Z B;  3K7A B;  1HCZ A;  4JYA L;  4LFA L;  5DM6 3;  4JK1 C;  1HNZ L;  3PF4 A;  1B3Q A;  2K5N A;  4APV A;  4JBM A;  1I4Q A;  3NPP A;  4C3J H;  1Q1B A;  1VQD A;  1VQ7 A;  4A3K H;  1QVC A;  4PG3 A;  3CAM A;  4PQX A;  3NQT A;  1E24 A;  3EN2 A;  2WAQ B;  3HKZ G;  2UXD L;  2K05 A;  1DYQ A;  3L3O C;  1MHW C;  4IUR A;  4HJ9 A;  2L55 A;  4DR1 Q;  1AN8 A;  1O7Y A;  1JOO A;  4ZQ3 A;  1STN A;  2K33 A;  4HTH A;  3NP8 A;  1KL9 A;  1VMC A;  1UE7 A;  5M5Y H;  4X66 Q;  5J39 A;  1E2W A;  4A93 H;  4XDX A;  3D6C A;  3S1Q B;  1EZ6 A;  1K0R A;  1Z7T A;  3A0J A;  2Z6K A;  1FR3 A;  4DGZ A;  2ASB A;  3TDQ A;  2F0P A;  3H6M A;  2KEC A;  4IJL A;  3WWV A;  3BZK A;  5LHY 1;  4LFB Q;  1TY2 A;  1FVI A;  2RDH A;  4HSV A;  1VCI A;  1CZW A;  1PH7 A;  1LYL A;  1JWU D;  5C4J B;  1CKN A;  3T51 B;  1MD2 D;  1EEF D;  1Z6H A;  4IUV A;  4HMJ A;  4JI8 L;  1WCM G;  1ASZ A;  5J3B A;  1DM0 B;  4HJA A;  3MC0 B;  3NTK A;  3G6E A;  3I4L A;  5IWA Q;  1SND A;  3HOW G;  3PUV A;  3OW7 A;  3RMH A;  3I4N G;  4Q0F A;  2ENB A;  1MSG A;  4BY1 H;  1F9P A;  2EYF A;  2NN6 I;  1SXT A;  4LF4 Q;  1KIX A;  3EA6 A;  2JK8 A;  4CKE A;  4DAY A;  1G2T A;  3QJY A;  3X3M A;  5M3F H;  4DR6 L;  3I4M B;  1U4L A;  2JA6 B;  5C4H A;  1KQS A;  1WVL A;  5KRU A;  2R7Z B;  2B2U A;  1E0B A;  1TWA B;  3E0J A;  4KN7 C;  3PIP 3;  2VZA A;  1VQH A;  5C3E B;  3M7N A;  1ET9 A;  1D5Z C;  3E0E A;  4DXG A;  1KNA A;  3TQY A;  1BXT A;  1LT4 D;  1LTA D;  1F2Z A;  4JI3 L;  1HXY D;  1EY0 A;  3PO2 B;  4JPB W;  3HS0 C;  5FLX E;  2QA4 A;  4JI4 Q;  3H09 A;  1D5X C;  2KED A;  2P5Z X;  3T1H Q;  1VQN A;  1II3 A;  2F0O A;  3D4W A;  1Q7Y C;  5FO9 B;  3TS2 A;  3AMU A;  4OIK A;  3CD6 A;  3DHQ A;  2ES2 A;  1VQK A;  2VNU D;  2IT1 A;  4ZLT F;  5IYB H;  2EY6 A;  4YHH Q;  1HR0 Q;  4DR4 L;  1B2T A;  4EQN A;  1IBK Q;  1KC8 C;  4MN3 A;  4B9W A;  3NK9 A;  1K9M C;  4OEM B;  4ILW A;  4F8M A;  4DR7 Q;  1Q90 A;  4Z9C B;  4HJ7 A;  4YCU A;  3S2H B;  2NTT A;  5M5W B;  3C2P A;  1XPR A;  4RAU C;  4N8F A;  3A8K E;  3KF8 B;  2UUA Q;  2KHJ A;  1TY0 A;  3NHH A;  4MZ9 A;  4DK0 A;  1XNR L;  5IOC A;  2E2H B;  4DV3 L;  2Q2U A;  4IFD I;  4C3H G;  1IKM A;  4E6I A;  2F0Q A;  3J81 j;  4BY7 G;  3PO3 G;  1JMC A;  3HOV H;  1R9T B;  4A4I A;  4GNX A;  3I55 A;  1ZEQ X;  1FGU A;  2PZW A;  1KLU D;  1PZJ D;  4QMG A;  1WTW A;  4U67 3;  5IT9 E;  3QG1 A;  4CKB A;  4F7X A;  3L7Z C;  2AKW B;  2JA5 B;  2DY8 A;  2DNE A;  4OX9 Q;  1TS5 A;  1WI5 A;  5K36 G;  5EGT A;  2A1A A;  1HR0 W;  3L2P A;  3FVQ A;  3GTG B;  2VB3 X;  4ME5 A;  4DR5 Q;  1CI3 M;  5I9O A;  5IGE A;  5FLM G;  1EQR A;  4M1U B;  3R3O A;  1P16 A;  3NUC A;  4A3M B;  1CKN B;  1GJX A;  1WTH A;  3K0X A;  5IP7 G;  2E76 C;  1S3O A;  1PTO B;  4BS9 A;  1N36 L;  4R9W A;  5T1I A;  4YCW A;  2BA0 A;  1LAC A;  2Z9H A;  2EYO A;  3B6Y A;  1IBL L;  4OON A;  3KJO A;  4K6L A;  1HQR D;  2N88 A;  2F0M A;  1SYF A;  1BVS A;  3I8Z A;  2B63 B;  2XWB B;  3QR8 A;  4DK3 C;  4LF7 Q;  1ASY A;  2VUM B;  4NXM L;  2RCN A;  4UP8 A;  3NXW A;  1CA6 A;  1RKN A;  3VA7 A;  1JR0 D;  2Y0S E;  4NMZ A;  1VQB A;  4G7O C;  2YTY A;  1OTC A;  1CQV A;  4BBR B;  1BF4 A;  1CUK A;  3V05 A;  3SVM A;  2EDG A;  3LWE A;  2KVM A;  5LMU L;  4A3I G;  5JEA J;  3HOU B;  3GTK B;  2EZV A;  1U0L A;  3CKI B;  2WAC A;  2NYZ D;  2MP1 A;  2WB1 G;  3SHL A;  3CXC A;  1SMY D;  1S5F D;  4ZUI A;  1ZYR C;  4YIJ A;  2B2U C;  5M3M B;  3RZD H;  1VQO A;  3VR2 A;  5IGC A;  4XQQ A;  3ERS X;  4X3T A;  1NR4 A;  1SRO A;  4RKL A;  2NVY B;  3CCM A;  1SN8 A;  1WCM H;  4B3M Q;  4DUY Q;  1HTL D;  3OSO A;  3LGJ A;  3SDZ A;  1JJG A;  3JAM c;  1NUC A;  2H1E A;  3OWE B;  2RSO A;  2G9H D;  3JC6 6;  4LUO A;  3JAM L;  2EPB A;  1I4H A;  3HOW H;  2CQA A;  1UNS A;  5G3L D;  3RLF A;  1VQ4 A;  1G51 A;  4DR3 L;  4WRD A;  4YWK A;  4DV0 Q;  5JEA G;  1VQM A;  1RDP D;  2VQE Q;  4DXF A;  4BXX G;  3J81 E;  2F1M A;  3MFY A;  1E1O A;  1G29 1;  1QB5 D;  4DK1 A;  5FLX c;  4DV7 L;  3FRP B;  1B8A A;  3S1M H;  1LO5 D;  3EJI A;  5F2D A;  5CYU A;  5FLX L;  2EY5 A;  1MKH A;  1VF7 A;  2F0H A;  1CQF A;  1M8A A;  4RGO S;  1SNM A;  4NB3 A;  1QZG A;  4ID6 A;  5HY6 A;  5COY A;  2A6E C;  1SSO A;  4IOA A;  2F3W A;  4R8N A;  1YVC A;  4H0L C;  4NP5 A;  3S15 B;  3HKZ E;  1T9H A;  1G2S A;  1Y8N B;  1DOK A;  5CV4 A;  3Q23 A;  2E2J B;  4EGV A;  3HRZ C;  4GNX C;  3GTL H;  1KLG D;  1ENA A;  5E7N A;  4L5T A;  2XTI A;  3RLN A;  3T16 A;  2MNA A;  5C44 H;  3TZD A;  3CCV A;  1BBW A;  5D14 A;  2XN9 C;  4HMI A;  5CV9 A;  1D1I A;  3BDL A;  1B3A A;  1SNP A;  3Q6S A;  3G4S A;  1LTT D;  2WKC A;  5KNC A;  1VMP A;  4FXK C;  3K81 C;  2ZTD A;  4IPG A;  4K5X A;  5C0X J;  3GTQ H;  2VL6 A;  1IL8 A;  5EPK A;  2BOS A;  1JC7 A;  4K5W A;  3SE0 A;  4B3T Q;  4IO9 A;  4X66 L;  2R93 B;  4TKO B;  2CWA A;  3WDN A;  3Q22 A;  4KLK A;  2K5D A;  2AQ2 B;  3VA5 A;  4HED A;  2BH8 A;  2J0T D;  2NVT H;  2YU9 H;  1XPO A;  2YTV A;  2X6L A;  1J6Q A;  1V1O A;  3M3Y H;  1WTX A;  4JVZ A;  3AYH B;  2SOB A;  4LFB L;  3LWU A;  2ID0 A;  3SEB A;  4BY7 H;  1YNJ C;  1RIP A;  3MXP A;  1PLF A;  5C5L A;  1JB3 A;  1FGB D;  1EU3 A;  3AFP A;  4L63 B;  1AW7 A;  4EQ5 A;  5C0X G;  3I3C A;  3NTI A;  1UAP A;  1BOS A;  1NSN S;  4QCL A;  2MJ8 A;  3AB9 A;  4KY5 A;  3JAM i;  3K5O A;  1K3R A;  1BBU A;  5E4X A;  5FJ8 G;  1T5X D;  1CSQ A;  2HHH Q;  3MEH A;  1JT8 A;  1ZXT A;  4HID A;  3URY A;  3CC2 A;  1O7L A;  5A35 A;  1J5E Q;  1PH6 A;  4A3D B;  2CVR A;  3OTO Q;  4HR7 B;  1SJE D;  3CCS A;  1RCV D;  4XQJ A;  2ICE C;  4I7Z C;  3RD4 A;  1C4Q A;  5I6Y A;  4LF4 L;  1IYJ B;  1XMQ L;  2R7F A;  5IP7 H;  2EQS A;  2D62 A;  4A3K G;  5COR A;  2B8G A;  2HDL A;  2NB0 A;  3CC7 A;  2VXW A;  1O80 A;  3NEM A;  1TU2 B;  1QUQ A;  1GUO A;  1PXU A;  5C4X G;  5EKI A;  1FD7 D;  3U9S A;  2C35 B;  3N6R A;  3UE0 A;  1C48 A;  3BVG A;  2K14 A;  2KCT A;  3EVQ A;  1GOZ A;  1HZB A;  4GS3 A;  1U5K A;  2N8N A;  3OMG A;  2K4K A;  4RCO A;  3K5M A;  3T53 B;  4OO1 G;  4N8X 1;  1JWM D;  1PMR A;  4LMQ D;  1TXY A;  5HGT A;  1OXS C;  4ZRZ A;  2M9V A;  4AQY Q;  1EQV A;  4A3I H;  2Z4I A;  4KI0 A;  3A8I E;  2N49 A;  4MNO A;  3NBH A;  5DM7 3;  1G6P A;  2LY7 A;  2IL8 A;  4CDF C;  1NMF A;  4R4O A;  1J9O A;  4YHH L;  5KNB A;  1HR0 L;  2FHT A;  4MHE A;  4RG1 A;  1QE6 A;  5E3F A;  1F9Q A;  5IIF A;  2SNS A;  5NUC A;  3CU7 A;  1ONL A;  4ZYS A;  3PGZ A;  3GO5 A;  2AMC B;  2L12 A;  4C2M B;  2I5L X;  4DR7 L;  4O2D A;  5I6W A;  3J81 c;  5CC4 A;  1HHV A;  3BS1 A;  2NZH A;  2UUA L;  3KLS A;  1I5F A;  4A3B B;  4JI2 L;  3J81 L;  3U4Z A;  5ELN A;  4LFC Q;  3P1H A;  1WFQ A;  2E8G A;  2M2L A;  1VDZ A;  3E9I A;  1I50 H;  2PYK A;  4H02 A;  3FKI G;  4ZAI A;  1ESF A;  3CQZ B;  2VQF L;  3S16 H;  1DZ1 A;  4KD3 A;  5JEA H;  4A3E G;  4BXX H;  1N32 Q;  1JE5 A;  3HP3 A;  1L1O C;  2XIW A;  1I4R A;  3ONA B;  2GA4 B;  5T1G A;  3U9O A;  2JA7 G;  2RF4 A;  4P73 A;  1YHQ A;  2JEA I;  2EJM A;  3A55 A;  1A8V A;  2HIX A;  2MQH A;  3S1N B;  2NWG A;  3W5O A;  4JI0 Q;  4QGU A;  2IPK D;  4GLA C;  1PHJ A;  2NVQ H;  2G5D A;  1K83 B;  4CDD C;  5IYC H;  1Z9F A;  1SFO B;  2UXB Q;  1S4Z A;  1R4Q B;  1A15 A;  4P74 A;  4OWT B;  5JJL A;  1L0X B;  3T56 B;  4LF7 L;  3H0G B;  4JV5 Q;  3RZO B;  4ZK9 B;  4YWL A;  2F3V A;  2ZJR A;  4EVO A;  2BH2 A;  2B8F A;  2HT1 A;  2KQ3 A;  2WB1 E;  3O13 A;  2PMZ E;  2N55 A;  3MTS A;  3ZJY C;  1XTD A;  1DOM A;  2F52 A;  2ZTC A;  4HN7 A;  3I56 A;  2K5H A;  1PFN A;  2A6E D;  4R4C A;  4IUN A;  5ISR A;  3PIO 3;  3I4N B;  4O42 A;  2B29 A;  5JPN C;  3R2I A;  2RHQ B;  2QF7 A;  1YJW A;  5JAV A;  2F4V Q;  1PV4 A;  1BUV T;  2F0W A;  2ICI A;  1GUG A;  3FEW X;  4FP5 D;  1Y1V B;  5GAH C;  4UP9 A;  2CKZ B;  4B3M L;  4DUY L;  3MVV A;  5C0X H;  1F2L A;  2DNC A;  1V1P A;  4KY7 A;  4JI6 Q;  3NBI A;  3T13 A;  5FJ8 H;  1EFI D;  4EX5 A;  3UDG A;  1Y1W G;  1QCB D;  3ND8 A;  1RL2 A;  2FMC A;  1A6X A;  3HOZ G;  1AZQ A;  4DV0 L;  1LV9 A;  4KK7 A;  3K7U C;  1SMY C;  1TII D;  2OTJ A;  1ROD A;  4GKK Q;  1P8L A;  5M9O A;  5G3L F;  3GTM H;  2FMM A;  3H94 A;  4L8J A;  4DKA C;  5IP9 G;  1EY7 A;  2F0N A;  2L4N A;  4DV5 Q;  1YNJ D;  2E2I H;  1G8Z D;  4DV6 L;  1U4P A;  3UDF A;  5I2Y A;  5C4X H;  3HOX G;  3S17 B;  1XNQ L;  2I5H A;  3KFU A;  4A3G B;  2K01 A;  1VQF A;  4GN5 A;  4C3H B;  1M90 C;  4OO1 H;  4QB4 A;  3PO3 B;  2K04 A;  3FDT A;  3SK5 A;  3HOY B;  2NVX B;  4RGN A;  5GAE C;  2A5H A;  4C3I B;  1KAB A;  2LKV A;  3DEO A;  4B3T L;  3DLL A;  2CH4 W;  4IUT A;  1D6E C;  1WTV A;  5JOB A;  2HD3 A;  4H13 C;  1OXV A;  5JJZ A;  3CP0 A;  4A3J G;  3GTP H;  3U50 C;  4PV1 C;  5BN5 A;  4Y7N B;  2UXC Q;  1B50 A;  3PIP A;  4KMU C;  3RN2 A;  4OHJ A;  3TME A;  1EQQ A;  1SYD A;  3R2T A;  1F77 A;  3MHB A;  2V1C C;  3CPW A;  3T1Y L;  1I3Q H;  3PUW A;  2EJG C;  3AU7 A;  4YY3 Q;  3C1F A;  1EOV A;  2JA8 B;  3KDF A;  2JXM B;  4AYB B;  1QVG A;  1N34 Q;  1N33 Q;  2HDM A;  3FKI H;  3PUZ A;  1TT2 A;  2HIV A;  4CBV A;  2K28 A;  5M5X H;  3AQQ A;  2L9H A;  2EYL A;  4S3S A;  1IBM L;  3M4Q A;  4IZ8 A;  1H9S A;  4G57 A;  3JAM E;  4HCS A;  4A3E H;  3H3V H;  5GQO A;  4ULL A;  4DV4 Q;  3VDY A;  1FJG Q;  4GOP C;  1A0I A;  3GP7 A;  3EBE A;  4ZKC B;  1LTG D;  1J5E L;  2HUG A;  1NJI C;  3MA2 B;  2ZM6 L;  3IFD A;  2JA7 H;  1UUP A;  2WP8 J;  1F9R A;  1HFG A;  3OOC A;  4KTA A;  5ELD A;  2OT2 A;  3D8G A;  3CCU A;  1AH9 A;  5BN3 A;  5C44 G;  4R4T A;  2JSO A;  1VQJ A;  1IHZ A;  3TBI B;  2ZJQ A;  1AZP A;  3BZC A;  4HSP A;  4LUV A;  1TWG H;  2F0I A;  3GTO B;  3P20 A;  2R92 B;  3KBG A;  2F0K A;  2JQO A;  1DGS A;  4HAE A;  1TWC H;  4WOR A;  1X65 A;  4A3F G;  4B3S Q;  1HA5 A;  2KEE A;  3CPF A;  1Q82 C;  1CHQ D;  4N9P A;  5FO7 B;  3TP8 A;  5IE8 A;  2WV6 D;  3D4D A;  3ZYY X;  4J8Q A;  1XMO Q;  3ND9 A;  1ICW A;  2FFK B;  1ENC A;  5JVG 3;  2EY2 A;  4X6A H;  2ALY B;  4X62 Q;  4A75 A;  1V43 A;  2PQA A;  3DUZ A;  4X65 Q;  4B3R L;  3KF6 A;  5EQ0 A;  5KIX A;  3GTJ B;  2L5T A;  3J7Y W;  1AE3 A;  1HUM A;  4ABN A;  1UE6 A;  1CFM A;  2EYP A;  2X6G A;  2AHO B;  2NN6 G;  3MWY W;  1EIH A;  1JWS D;  2Z6B A;  5IGB A;  2I46 A;  4CDC C;  1WD0 A;  4POG A;  3ITP A;  1HZ9 A;  2CH4 A;  5IGF A;  3DXJ C;  3CC4 A;  5CMD A;  3NWT A;  4XYQ A;  1SAP A;  2KBN A;  3S14 B;  2K50 A;  4IJH A;  4C56 C;  2PCF B; 
#chains in the Genus database with same CATH homology
 1RD9 D;  2K5Q A;  4XT3 B;  3A56 A;  3IL8 A;  3NE5 B;  4K5V A;  3MFG A;  3OWF A;  4EQO A;  2TSS A;  3S2D B;  2R61 A;  1I6H B;  2BCO A;  3PMF A;  2B2Y A;  2Q8I B;  3V96 A;  3MAQ A;  1SEB D;  1STY A;  3D6W A;  2O5J C;  2H4O A;  2RDG A;  1F2Y A;  4KD4 A;  2SNM A;  3BVM A;  1GUT A;  3QB3 A;  4PMC A;  5A2Q E;  1PTO C;  3HZX A;  4V0B A;  1SYB A;  4DAV A;  4DA2 A;  3F2U A;  3M4O B;  4CJ1 B;  4B08 A;  1RF2 D;  5IGD A;  2PW5 A;  1EIG A;  2R6G A;  2VB2 X;  2I07 B;  5EPJ A;  3LNN A;  1K8O A;  2M00 A;  4FXD A;  2NTS A;  3SK8 A;  1PZK D;  1QJO A;  1D1K A;  2QDB A;  3N52 A;  2K5W A;  2WKD A;  2C5C A;  5JPM C;  2AWN A;  4C3J B;  3VR4 A;  2CW0 C;  1GHJ A;  4ODG A;  1Q1E A;  3OIQ A;  4A3K B;  1LTS D;  3GTM B;  3W3A A;  1PRT F;  5C5M A;  4G7H C;  1Q3L A;  1OXU A;  2A6H D;  2KCC A;  2JEB I;  4CHT B;  1GUS A;  1B1Z A;  5M5Y B;  1U4M A;  2K03 A;  5J22 A;  4EQP A;  2HQE A;  1EQT A;  4A93 B;  1PRT C;  5HUR A;  2PW7 A;  2E75 C;  2O5I C;  2ZXR A;  4WFN 3;  4OL7 A;  5FO8 B;  3I90 A;  4IUU A;  1EY6 A;  3VR5 A;  1WTQ A;  2KCN A;  1H9J A;  5LL6 X;  3CRL C;  3OMC A;  4G4K A;  2IW3 A;  1OXX K;  2OEO A;  3KUP A;  1SYG A;  4DFA A;  2B2W A;  2LMC B;  2RBM A;  2KHS A;  1OO9 B;  4BY1 B;  1I4P A;  3WOE A;  3K58 A;  3FKI B;  3FMC A;  1T5E A;  4C1N K;  5M5X B;  4RWS C;  3VR6 A;  2B2Y C;  4K8I A;  5M3F B;  2IX1 A;  1SYC A;  3ERO A;  3C46 A;  1TS4 A;  2NN6 H;  3EFX D;  4OO1 I;  1KAA A;  3H3V C;  1Y69 U;  4DN4 M;  1HFN A;  2RSN A;  4IUQ A;  4DNR B;  3M85 A;  2Q8R E;  1DJR D;  3R93 A;  4HCE A;  4KHZ A;  2RDF A;  2KUM A;  1LT3 D;  3S9W A;  2Z1C A;  4F88 A;  1K8M A;  2E2D C;  4K2K A;  2PZU A;  1KDB A;  1Y8P B;  3A7L A;  5CBA E;  5IOD A;  2Y0S B;  1IYV A;  4FF3 A;  2A69 D;  5I2X A;  1W6J A;  4LK1 C;  5A2Q L;  1BDO A;  2EVB A;  1BCP C;  3C1E A;  2D9U A;  2V4D A;  1EWC A;  4UDU C;  2KJX A;  1PFB A;  1TVX A;  3P7J A;  4UAI A;  2XVS A;  2XWJ B;  4B9X A;  2EE1 A;  1IW7 C;  4OIJ A;  5KYL A;  1OXT A;  4KKU A;  4KKS A;  2PNR C;  5ELE A;  3HOV B;  5CGK A;  1Z47 A;  1HTP A;  1S5C D;  1H9R A;  1TS2 A;  5KGU A;  3D4R A;  4PMB A;  1DCZ A;  4DAP A;  4X3K A;  2LFN A;  4XYO A;  1DD2 A;  3TN2 A;  2AUK A;  3W2D A;  1WTO A;  1R4P B;  3L9A X;  2F4I A;  4IN3 A;  3E6Z X;  2HCC A;  4RGT A;  3I91 A;  3CHB D;  3D3R A;  1CA5 A;  1STB A;  1PTO D;  3WOF A;  2AQ1 B;  4CGY B;  4FF2 A;  3A8J E;  1STH A;  3HKZ B;  2SEB D;  1Y8O B;  4KN4 C;  2OXP A;  4O1N A;  2B2W C;  4FF4 A;  4RA8 A;  1EWH A;  4KV6 A;  3D31 A;  2B2T A;  4J1M A;  4R8I A;  3I72 A;  3VYS A;  2F0E A;  2A74 C;  1WTR A;  1TQO A;  1S5D D;  4NDX A;  3RZD B;  1PYW D;  1LT5 D;  2CW0 D;  2HCI A;  2F0L A;  4BA1 I;  1XXG A;  2RKS A;  3VYT A;  5D3D A;  2XSC A;  1WCM B;  4FNF A;  1JOK A;  1QNK A;  3TP5 A;  2EXZ A;  5KYI A;  3BDC A;  1XX8 A;  1RTN A;  3HOW B;  2PZT A;  3C3L A;  4CJ0 B;  1Q12 A;  4C1N I;  1PTO H;  1PRT D;  2QKI C;  2YYZ A;  1A3T A;  1IYU A;  4QUC A;  3SK6 A;  1SYE A;  1LTR D;  3S1M B;  1KDC A;  4PNY A;  3M7G A;  1I4G A;  1U9R A;  3MXU A;  1B53 A;  3QWN A;  2XRQ D;  4H44 C;  5IGG A;  4PMW A;  1XYI A;  1SJH D;  3IKJ A;  4RHS A;  5FK9 C;  1AFP A;  3NWS A;  2JP1 A;  3G7L A;  3GTL B;  5C44 B;  1EYA A;  4KJN A;  3KK7 A;  3TP6 A;  1A2T A;  2F0V A;  3E5S A;  3GTQ B;  1NCV A;  5FKA C;  2E74 C;  2PQE A;  4RCN A;  2TMP A;  2PO4 A;  4QF4 A;  3TSS A;  2F0T A;  1PZI D;  2JE6 I;  5TSS A;  1QWY A;  3QIA A;  1SNC A;  1TS3 A;  3NQI A;  2NVT B;  2YU9 B;  5KEE A;  1GXD C;  5ELF A;  2XRS D;  3DWQ A;  1STG A;  1LAB A;  1E2Z A;  3M3Y B;  1FNW A;  4ZUJ A;  3KF8 A;  4KY6 A;  1BNZ A;  3VYR A;  4BY7 B;  2JYO A;  2J7Z A;  2MUY A;  2MPM A;  5C3X A;  2RQX A;  4G7Z C;  1KTK A;  2A6H C;  1X3Q A;  4FVM A;  4BWG B;  1MGS A;  2EYH A;  2F0S A;  2B2T C;  1EOT A;  3Q0A A;  1E2V A;  1B9M A;  3H91 A;  4K14 A;  3UI2 A;  1BCP D;  3TP7 A;  3K57 A;  3GV6 A;  3QOJ A;  1CZG A;  2L0C A;  5DAU A;  4P2C B;  1DOL A;  2NUC A;  4OGQ C;  2LS0 1;  1IW7 D;  1B44 D;  2DN8 A;  3PUX A;  2K32 A;  1RJT A;  2FJ2 A;  2CHB D;  5EPL A;  4F87 A;  3SR1 A;  2WII B;  1HPC A;  2C9O A;  1EL0 A;  3DM1 A;  5BN4 A;  3K5N A;  3VR3 A;  1TR5 A;  1ILQ A;  4A3I B;  4IAL A;  1F2M A;  4FXG C;  2WB1 B;  5E4W C;  2EY1 A;  3KLS X;  3HEJ A;  1ZKO A;  2PMZ B;  3MXG A;  3HGB A;  1EZ8 A;  3OPO A;  1LTI D;  1V1P B;  1UEA B;  1GUN A;  1PDQ A;  3A7A B;  4GZY C;  2EJF C;  3K59 A;  1X3P A;  3BYT B;  3Q24 A;  2EYM A;  4X3U A;  4IQZ A;  4Q5V A;  3T4A C;  2RVL A;  2MGS A;  1IKL A;  2DY7 A;  1I50 B;  2A68 C;  2X69 A;  3S16 B;  2A69 C;  1BQQ T;  1JOR A;  1H9K A;  1HUN A;  3R8B A;  5EBD A;  3GD7 A;  1SE3 A;  2F0G A;  5J1Z A;  2BE5 D;  1HA6 A;  1EEI D;  5CBE E;  4N9T A;  4IFD J;  1NAP A;  5C6A A;  4KJO A;  2NVQ B;  1FNV A;  1J8I A;  1CTM A;  4FF1 A;  2QCP X;  1BO0 A;  4C3I G;  2FIN B;  2BDO A;  5JVH 3;  3DEP A;  3CRK C;  3LX0 A;  3HG9 A;  5I4D A;  1I6V C;  1G6Z A;  3GQB A;  1PTO F;  2ZXP A;  1F9S A;  5CV7 A;  1DON A;  1S5B D;  1SE2 A;  4XIG S;  5ELC A;  2F0D A;  1EYD A;  3PUY A;  1FNU A;  4FO2 A;  1YNN C;  3BZD B;  3KLR A;  4MIU A;  3OIP A;  2KOL A;  3MZ5 A;  4M8A A;  1HRJ A;  5CV5 A;  1QG7 A;  1EU4 A;  3V2T A;  1EY5 A;  1W6K A;  3X3N A;  1AEX A;  1H9S B;  5D65 A;  4IFD G;  4LJZ C;  5DEH A;  2NZ1 D;  3DWA A;  4TQU S;  1STA A;  4RGM A;  1TKW B;  1BBX C;  4DF7 A;  3IFT A;  1V8Q A;  1EY8 A;  2D5D A;  1JQY D;  1ENF A;  2F0J A;  1ET6 A;  4CKC A;  3J80 E;  4U68 A;  4K6D A;  2K1B A;  2OF1 A;  5C4Z A;  2G9D A;  2L11 A;  1HQM C;  4RFB A;  1Q8I A;  5D3I B;  5EKK A;  2Q8T A;  2B2V A;  3MXN A;  2E2I B;  2BA1 A;  1EYC A;  2IJ0 A;  3J7A F;  5C4X B;  4BA2 I;  1PRT B;  1A3V A;  2O4X A;  1I4X A;  1AP0 A;  1CK1 A;  3KBX A;  2SDF A;  5CV8 A;  5LL6 S;  1U4R A;  5C0X I;  3FPU B;  1MI2 A;  2MHV A;  4CJ2 C;  1EY4 A;  1MSH A;  1M4V A;  3GTP B;  2F0U A;  1SDF A;  5KND A;  3K5L A;  2J4X A;  2NBF A;  3VYU A;  3K0Y A;  1CHP D;  1I3Q B;  5C3W A;  2IX0 A;  4IUP A;  4BBS B;  4JBW A;  3K6O A;  1JIC A;  2EOT A;  1B9N A;  3QOL A;  4A3E B;  3I70 A;  1L0Y B;  4TRD A;  4LAA A;  3M4Y A;  1X32 A;  2KA7 A;  2XNA C;  3EQL C;  3TZU A;  5IT9 L;  2JA7 B;  3NTH A;  4KKT A;  2BDN A;  2QEJ C;  5K5P A;  5EBC A;  1KNE A;  1BCP F;  4FYD A;  2EYJ A;  1TWG B;  4K2L A;  1SBB B;  4RH6 A;  2ZXO A;  4WJW A;  4K8J A;  2A68 D;  1CM9 A;  1BCP B;  1TWC B;  1KDA A;  1JCK B;  1DXM A;  5K36 H;  1SNO A;  1H9M A;  2IX3 A;  4RHR A;  5ELB A;  1QOH A;  3QO2 A;  3NSW A;  1NR2 A;  3SXH A;  4C3J G;  4I65 A;  1BR9 A;  1C8C A;  2K6A A;  1XTC D;  5I9P A;  2B2V C;  3I73 A;  1STE A;  1EY9 A;  4DNT B;  2L1B A;  2PPB C;  3J80 L;  3G6J B;  4IFD H;  1D5M C;  1S5E D;  4DU9 A;  4TSS A;  1D2B A;  2A73 B;  1LLR D;  4NW2 A;  3DMU A;  4QUF A;  2R3Z A;  3PV0 A;  1O7Z A;  4XT1 B;  1TWH B;  5AFW A;  4QIW B;  1Y1W B;  1YNN D;  2AUJ D;  2Z4H A;  3GV3 A;  3HOZ B;  3RUZ A;  1GHK A;  3J7A V;  1O78 A;  1ML0 D;  5CR3 A;  4V19 0;  3FPP A;  3HOX B;  4XXE A;  4J6H A;  1FYC A;  3S1R B;  3BVZ A;  5DNF A;  2Z8L A;  3IAY A;  2WIN B;  3OHX C;  1QNU A;  3P75 A;  4KHV A;  1QIL A;  3A54 A;  1ZYR D;  4X3S A;  4XQN A;  3SK4 A;  1LT6 D;  2ZT9 C;  4RKB A;  2BE5 C;  2AQ3 B;  1G91 A;  4XTC S;  4A3J B;  5EKL A;  5EJW A;  2RA4 A;  2O2L D;  1GUW A;  1JOQ A;  4H7B A;  1RHP A;  1ILP A;  5E1F A;  4ZKB B;  1CT1 D;  2F0F A;  1MBY A;  2B39 A;  1VF5 C;  2D2C C;  2K7V A;  5CV6 A;  1A3U A;  5FOB B;  1A2U A;  1ESR A;  1WTP A;  3ERQ A;  4L6T B;  3DWP A;  2IWH A;  3BDO A;  1SE4 A;  1PFM A;  1SNQ A;  1B4O A;  1XWE A;  1RTO A;  3BG3 A;  2AWO A;  1WD1 A;  4NKL A;  2QIL A;  4A3F B;  3BYY B;  1TWF B;  1LTB D;  2F03 A;  1JE4 A;  3K7A B;  1HCZ A;  5DM6 3;  4JK1 C;  1I4Q A;  3NPP A;  1Q1B A;  4PQX A;  3NQT A;  2WAQ B;  2K05 A;  1DYQ A;  3L3O C;  4IUR A;  2L55 A;  1AN8 A;  1O7Y A;  1JOO A;  4ZQ3 A;  1STN A;  2K33 A;  4HTH A;  3NP8 A;  1VMC A;  5J39 A;  1E2W A;  4XDX A;  3D6C A;  3S1Q B;  1EZ6 A;  1Z7T A;  1FR3 A;  4DGZ A;  3TDQ A;  2F0P A;  3H6M A;  2KEC A;  5LHY 1;  1TY2 A;  2RDH A;  4HSV A;  1VCI A;  1CZW A;  5C4J B;  1JWU D;  3T51 B;  1MD2 D;  1EEF D;  1Z6H A;  4IUV A;  4HMJ A;  1DM0 B;  3MC0 B;  3NTK A;  3I4L A;  1SND A;  3PUV A;  3OW7 A;  3RMH A;  4Q0F A;  2ENB A;  1MSG A;  1F9P A;  2EYF A;  2NN6 I;  1SXT A;  3EA6 A;  4CKE A;  4DAY A;  1G2T A;  3QJY A;  3X3M A;  3I4M B;  1U4L A;  2JA6 B;  5C4H A;  1WVL A;  5KRU A;  2R7Z B;  2B2U A;  1E0B A;  1TWA B;  3E0J A;  4KN7 C;  3PIP 3;  5C3E B;  3M7N A;  1ET9 A;  1D5Z C;  4DXG A;  1KNA A;  1BXT A;  1LT4 D;  1LTA D;  1F2Z A;  1HXY D;  1EY0 A;  3PO2 B;  3HS0 C;  5FLX E;  3H09 A;  1D5X C;  2KED A;  1II3 A;  2F0O A;  3D4W A;  5FO9 B;  3AMU A;  4OIK A;  3DHQ A;  2VNU D;  2IT1 A;  4ZLT F;  2EY6 A;  1B2T A;  4EQN A;  4MN3 A;  4B9W A;  3NK9 A;  4ILW A;  4F8M A;  1Q90 A;  4Z9C B;  3S2H B;  2NTT A;  5M5W B;  3C2P A;  4RAU C;  3A8K E;  1TY0 A;  3NHH A;  4DK0 A;  2E2H B;  5IOC A;  4IFD I;  4C3H G;  1IKM A;  4E6I A;  2F0Q A;  1R9T B;  1ZEQ X;  2PZW A;  1KLU D;  1PZJ D;  4QMG A;  1WTW A;  4U67 3;  5IT9 E;  3QG1 A;  4CKB A;  4F7X A;  3L7Z C;  2JA5 B;  2DY8 A;  2DNE A;  1TS5 A;  5K36 G;  5EGT A;  3FVQ A;  3GTG B;  2VB3 X;  4ME5 A;  1CI3 M;  5I9O A;  5IGE A;  4M1U B;  3R3O A;  3NUC A;  4A3M B;  1GJX A;  2E76 C;  1PTO B;  4BS9 A;  4R9W A;  5T1I A;  2BA0 A;  1LAC A;  2EYO A;  4K6L A;  1HQR D;  2N88 A;  2F0M A;  1SYF A;  2B63 B;  3I8Z A;  2XWB B;  2VUM B;  3NXW A;  1CA6 A;  1RKN A;  3VA7 A;  1JR0 D;  4NMZ A;  4G7O C;  1CQV A;  4BBR B;  1BF4 A;  3V05 A;  3SVM A;  2EDG A;  3LWE A;  2KVM A;  5JEA J;  3HOU B;  3GTK B;  2EZV A;  3CKI B;  2WAC A;  2NYZ D;  2MP1 A;  3SHL A;  1SMY D;  1S5F D;  4ZUI A;  1ZYR C;  4YIJ A;  2B2U C;  5M3M B;  3VR2 A;  5IGC A;  4XQQ A;  4X3T A;  1NR4 A;  4RKL A;  2NVY B;  1HTL D;  3OSO A;  3SDZ A;  1NUC A;  2H1E A;  3OWE B;  2RSO A;  2G9H D;  3JAM L;  2EPB A;  1I4H A;  2CQA A;  1UNS A;  5G3L D;  3RLF A;  4WRD A;  5JEA G;  1RDP D;  4DXF A;  3J81 E;  2F1M A;  3MFY A;  1G29 1;  1QB5 D;  4DK1 A;  3FRP B;  1LO5 D;  3EJI A;  5F2D A;  5CYU A;  5FLX L;  2EY5 A;  1VF7 A;  2F0H A;  1CQF A;  1M8A A;  4RGO S;  1SNM A;  4ID6 A;  5COY A;  2A6E C;  1SSO A;  2F3W A;  4R8N A;  4H0L C;  4NP5 A;  3S15 B;  1G2S A;  1Y8N B;  1DOK A;  5CV4 A;  3Q23 A;  2E2J B;  4EGV A;  3HRZ C;  1KLG D;  1ENA A;  3T16 A;  3TZD A;  5D14 A;  2XN9 C;  4HMI A;  5CV9 A;  1D1I A;  3BDL A;  1B3A A;  1SNP A;  3Q6S A;  1LTT D;  2WKC A;  5KNC A;  1VMP A;  4FXK C;  4K5X A;  5C0X J;  1IL8 A;  5EPK A;  2BOS A;  1JC7 A;  4K5W A;  3SE0 A;  2R93 B;  4TKO B;  3WDN A;  3Q22 A;  2K5D A;  2AQ2 B;  3VA5 A;  4HED A;  2J0T D;  2X6L A;  1V1O A;  1WTX A;  2SOB A;  3LWU A;  2ID0 A;  3SEB A;  1YNJ C;  3MXP A;  1PLF A;  5C5L A;  1JB3 A;  1FGB D;  1EU3 A;  4L63 B;  1AW7 A;  5C0X G;  3I3C A;  3NTI A;  1UAP A;  1BOS A;  1NSN S;  4QCL A;  2MJ8 A;  3AB9 A;  4KY5 A;  3K5O A;  5E4X A;  1T5X D;  3MEH A;  1ZXT A;  3URY A;  1O7L A;  5A35 A;  4A3D B;  2CVR A;  4HR7 B;  1SJE D;  1RCV D;  4XQJ A;  2ICE C;  4I7Z C;  3RD4 A;  1C4Q A;  5I6Y A;  2D62 A;  5COR A;  2B8G A;  2HDL A;  2NB0 A;  2VXW A;  1O80 A;  1TU2 B;  1GUO A;  1PXU A;  5EKI A;  1FD7 D;  3U9S A;  3N6R A;  1C48 A;  3BVG A;  3EVQ A;  1GOZ A;  3OMG A;  4RCO A;  3K5M A;  3T53 B;  4OO1 G;  1JWM D;  1PMR A;  4LMQ D;  5HGT A;  1OXS C;  4ZRZ A;  2M9V A;  1EQV A;  2Z4I A;  4KI0 A;  3A8I E;  3NBH A;  5DM7 3;  2LY7 A;  2IL8 A;  1J9O A;  5KNB A;  2FHT A;  4MHE A;  1QE6 A;  5E3F A;  1F9Q A;  5IIF A;  2SNS A;  5NUC A;  3CU7 A;  1ONL A;  4ZYS A;  3GO5 A;  2L12 A;  4C2M B;  5I6W A;  5CC4 A;  1HHV A;  3BS1 A;  3KLS A;  4A3B B;  3J81 L;  3P1H A;  2M2L A;  1VDZ A;  2PYK A;  4ZAI A;  1ESF A;  3CQZ B;  1DZ1 A;  4KD3 A;  5JEA H;  3HP3 A;  2XIW A;  1I4R A;  3ONA B;  2GA4 B;  5T1G A;  3U9O A;  2JEA I;  2EJM A;  3A55 A;  3S1N B;  2NWG A;  2IPK D;  1K83 B;  1SFO B;  1S4Z A;  1R4Q B;  1A15 A;  1L0X B;  3T56 B;  3RZO B;  3H0G B;  4ZK9 B;  2F3V A;  4EVO A;  2B8F A;  2KQ3 A;  3O13 A;  2N55 A;  3MTS A;  1DOM A;  4HN7 A;  1PFN A;  2A6E D;  3PIO 3;  4IUN A;  5ISR A;  3I4N B;  4O42 A;  5JPN C;  3R2I A;  2QF7 A;  5JAV A;  1BUV T;  2F0W A;  2ICI A;  1GUG A;  3FEW X;  4FP5 D;  1Y1V B;  3MVV A;  5C0X H;  1F2L A;  2DNC A;  1V1P A;  4KY7 A;  3NBI A;  3T13 A;  1EFI D;  1QCB D;  3ND8 A;  2FMC A;  1A6X A;  1AZQ A;  1LV9 A;  4KK7 A;  1SMY C;  1TII D;  1ROD A;  5M9O A;  5G3L F;  2FMM A;  3H94 A;  4L8J A;  1EY7 A;  2F0N A;  2L4N A;  1YNJ D;  1G8Z D;  1U4P A;  5I2Y A;  3S17 B;  4A3G B;  2K01 A;  4C3H B;  4OO1 H;  4QB4 A;  3PO3 B;  2K04 A;  3FDT A;  3SK5 A;  3HOY B;  2NVX B;  4RGN A;  2A5H A;  4C3I B;  1KAB A;  2LKV A;  3DEO A;  4IUT A;  1D6E C;  1WTV A;  5JOB A;  4H13 C;  1OXV A;  5JJZ A;  4PV1 C;  5BN5 A;  4Y7N B;  1B50 A;  4KMU C;  4OHJ A;  3TME A;  1SYD A;  3R2T A;  1F77 A;  3MHB A;  3PUW A;  2EJG C;  3AU7 A;  3C1F A;  2JA8 B;  2JXM B;  4AYB B;  2HDM A;  3PUZ A;  1TT2 A;  4CBV A;  2K28 A;  2L9H A;  2EYL A;  4S3S A;  4IZ8 A;  1H9S A;  4G57 A;  3JAM E;  4HCS A;  4ULL A;  3GP7 A;  4ZKC B;  1LTG D;  2HUG A;  3MA2 B;  3IFD A;  1UUP A;  2WP8 J;  1F9R A;  1HFG A;  3OOC A;  4KTA A;  5ELD A;  2OT2 A;  3D8G A;  5BN3 A;  3TBI B;  2JSO A;  1IHZ A;  1AZP A;  4HSP A;  2F0I A;  3GTO B;  3P20 A;  2R92 B;  3KBG A;  2F0K A;  4HAE A;  4WOR A;  1HA5 A;  2KEE A;  1CHQ D;  4N9P A;  5FO7 B;  3TP8 A;  2WV6 D;  3D4D A;  3ZYY X;  4J8Q A;  3ND9 A;  1ICW A;  2FFK B;  1ENC A;  5JVG 3;  2EY2 A;  1V43 A;  3DUZ A;  5EQ0 A;  5KIX A;  3GTJ B;  2L5T A;  3J7Y W;  1HUM A;  4ABN A;  1CFM A;  2EYP A;  2X6G A;  2NN6 G;  3MWY W;  1EIH A;  1JWS D;  5IGB A;  2I46 A;  1WD0 A;  3ITP A;  5IGF A;  3DXJ C;  5CMD A;  3NWT A;  4XYQ A;  1SAP A;  3S14 B;  4C56 C;  2PCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...