2H1EA

Tandem chromodomains of budding yeast chd1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
166
structure length
166
Chain Sequence
DFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Implications of Evolutionary Differences in CHD Double Chromodomains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Chromo domain protein 1
total genus 47
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2h1eA02
3SVMA 2HUGA 1WTRA 2FMMA 2N88A 2L11A 3FDTA 3DEPA 4NW2A 1DZ1A 2BDNA 4ZKCB 4X3UA 4RAUC 5D14A 5AFWA 2XIWA 4ZLTF 5CBEE 2B2TC 2R3ZA 2Q8TA 3R93A 4X3TA 1G6ZA 5DNFA 1JICA 3LWEA 4MN3A 1F2LA 2MP1A 4CJ2C 2DY8A 1NR2A 1AZQA 2JYOA 5CBAE 1G2TA 1ILQA 2NYZD 4CJ0B 4IUQA 1B3AA 2MJ8A 1F9PA 1B50A 3ONAB 2FFKB 2KVMA 4DN4M 2K05A 1HFNA 4XT3B 5E4XA 4IUPA 2RSNA 3GV6A 1NAPA 2IL8A 3KBXA 2EE1A 4R8IA 5EPJA 2D9UA 1MGSA 2JP1A 3UI2A 3I8ZA 3IL8A 1RTNA 1XX8A 5EJWA 1G91A 1HUMA 1SAPA 2J7ZA 1WTXA 4CJ1B 1WTVA 1ESRA 3H91A 2M2LA 1WVLA 4IURA 1G2SA 5JJZA 2CVRA 2L12A 1KNAA 1PFBA 2B2WA 1EIGA 2B2TA 1DOKA 2VXWA 1QG7A 1U4MA 3DM1A 1AZPA 3GV3A 1ZXTA 4UAIA 4HEDA 1WTPA 1F9RA 1BNZA 1B53A 4LMQD 2DY7A 4U68A 1EQTA 2B2UA 3N52A 3KUPA 4OIKA 1EL0A 1F9QA 2X6LA 4MHEA 4XDXA 1BBXC 4QUCA 2X6GA 1QNKA 2B2VC 1QE6A 2NWGA 5EPLA 1DOMA 1B2TA 3TZDA 2KOLA 2B2VA 4HSVA 2RA4A 2EPBA 2HDLA 2L9HA 1EOTA 4IUVA 1BF4A 1CM9A 4O42A 1WTQA 2SDFA 3Q6SA 3P7JA 3DEOA 4IUTA 5D65A 4ZKBB 1U4LA 1O80A 1SDFA 5EKIA 5CMDA 1HA6A 1HHVA 1JE4A 1BO0A 1NR4A 1IKMA 1PLFA 4HCSA 1X3QA 1A15A 2HDMA 2KUMA 3MTSA 1DOLA 1Q3LA 3TN2A 1B4OA 2MPMA 1MI2A 1ICWA 3QO2A 4HAEA 1S4ZA 2NZ1D 3I90A 2L1BA 1WTOA 1HRJA 5CORA 4QUFA 3F2UA 2K01A 1WTWA 3D6WA 1PFMA 2KEDA 4RWSC 5EPKA 1IL8A 3FPUB 1CA5A 1C8CA 1VMCA 2K1BA 1MSGA 2K03A 1EIHA 5EQ0A 1ML0D 1HUNA 4ZAIA 1RHPA 1HFGA 1TVXA 1F9SA 1O7ZA 1WD0A 3MWYW 1NCVA 2HCCA 1PFNA 1IKLA 3I91A 2KEEA 4IUUA 1RTOA 1O7YA 4OIJA 1MSHA 1X3PA 1CA6A 2H1EA 2B2YC 1M8AA 1X32A 2MGSA 2RVLA 2FJ2A 1J8IA 1ILPA 2B2YA 1RODA 2X69A 2KECA 2Q8RE 1J9OA 1KNEA 2N55A 4XT1B 2EOTA 3HP3A 5T1IA 3I3CA 2FINB 1LV9A 1PDQA 4X3KA 2L4NA 4X3SA 2B2UC 1RJTA 1U4RA 4RA8A 1U4PA 5COYA 2RSOA 3G7LA 5E4WC 5T1GA 1E0BA 3IFDA 1AP0A 2FHTA 2B2WC 2HCIA 2K28A 4ZK9B 1GUWA 1DONA 1WD1A 1SSOA 4R9WA 1XYIA 2K04A 1VMPA
chains in the Genus database with same CATH superfamily
1JB7A 3RN2A 1PTOF 4LUZA 1DJRD 1L0YB 5J39A 2PW5A 1H95A 4ZKCB 2O5IC 2NBFA 2B2TC 4GLAC 1SLJA 2CQOA 4P75A 3T16A 5DNFA 1SE2A 2AQ1B 1SNOA 3BDOA 2LMCB 1XJVA 4TSSA 1WTHA 4EVOA 2K05A 2F1MA 2K5QA 2R7FA 4DAYB 5I9PA 2JA6B 4LF5L 4R8IA 3C1EA 3UI2A 1X6OA 1AW7A 1EU3A 1HUMA 3A0JA 3ND8A 3J7A5 1YEZA 1D5ZC 2F0NA 1HZBA 2PQEA 4UP8A 1Y1VH 4M8AA 3ZYYX 5IWAL 1U4MA 2MO0A 4B3MQ 1XNRQ 4KV6A 4KY6A 1SJED 1Z7TA 5LMUQ 2ICEC 2F0OA 2PZTA 2X6LA 4A3GG 3CC7A 4C1NI 2F0PA 2FMCA 5M9OA 1B2TA 1L1OB 4GOPB 3FEWX 3KF8B 1C0AA 2NVQB 2YV5A 5EKIA 3TREA 3U50C 2EXDA 2JXMB 4A3BB 1G6PA 4POGA 1QZHA 4XQNA 2D0PA 1KLUD 1T5XD 3TP6A 2K75A 4BY1G 3H3VI 1PZID 1CHQD 3NENA 4KI0A 3PIO3 1CHPD 4ZUJA 2ZXPA 1UE6A 4A3LH 4S3SA 5FLMG 1S72A 1STAA 5IODA 4Q0FA 1SJHD 4P72A 1ML0D 5GAHC 2JA7H 5F2DA 2GA4B 4PZ8A 2UXCQ 1IW7C 3GQBA 1IKLA 1RDPD 4F87A 1EYCA 2RVLA 1QUQB 3M9BA 2MUYA 3TDQA 3OIQA 4JI6Q 1A6XA 5IP7G 1SMYD 4P74A 1ZYRC 5COYA 4APVA 4OXPA 2ZTDA 2UUBQ 3I4MG 4OHJA 3KF6B 3G6EA 1GUWA 3A55A 3S14H 3GTPH 1GHKA 4LF4Q 2R92H 4JC0A 4QY7A 5M3MG 3FPPA 4A93B 4A76A 2LKVA 3J80c 1PYWD 1I3QH 3S14B 1WCMG 3K59A 4DR7L 2F3WA 1TWGH 5G3LD 1U9RA 4LUVA 1WOCA 3ND9A 3ONAB 1HFNA 4LF7Q 4BBRH 3UDXA 1XTDA 4A3MB 2VB2X 3B6YA 3CCLA 1NTGA 1E2ZA 1SRUA 3VYSA 3M85A 1E3PA 1EFID 5M5XB 4DGZA 2Z8LA 3HOYH 3HOWB 1PFBA 2AKWB 4JOIA 1PFSA 4UP7A 5C4ZA 1FL0A 1CKOA 1L2FA 1WTPA 3A7AB 4C2MH 4JI4L 3VR4A 5HURA 5A2QE 1H9RA 4GN3B 3N52A 1F9QA 1PTOB 3CPWA 2Q8IB 1PH6A 3K80C 4V0BA 2HDLA 3ITPA 2D5DA 1K9MC 2UXDL 2EYJA 2F0KA 3S2DH 1X56A 3OHXC 2PI2A 4YCUA 2I5MX 5C4XG 4XQJA 1HH2P 1CKNA 2K5NA 2VQEQ 5IIFA 1PZKD 2MO1A 5JEAG 3TRZA 3U9OA 4JV5L 1IHZA 5IWAQ 3OIPA 4BY7H 1TS4A 4DUYQ 1YI2A 5IYCG 5LMNL 2C35B 1AE2A 3L0OA 1UUPA 5LMUL 1BKBA 2JE6I 3HOYB 5M5XH 2YTYA 5I2XA 4JI7L 1BCPC 3RLNA 4FP5D 4WFN3 1MHWC 2F4VL 1RODA 2IT1A 2NN6H 3FRPB 4ME5A 3GTMB 1JWMD 4JBKA 1KNEA 2N55A 3OW7A 2XVSA 1ENFA 1PRTF 4X3SA 2CFMA 3HOXB 1HZ9A 4X64Q 1U4PA 2RSOA 1AEXA 1HTLD 5M5WB 3S16H 2OT2A 1KHIA 4ZK9B 2OQKA 4LF6Q 1HNZQ 3M7NA 1HZCA 2VB3X 2R7ZH 2EQSA 3CP0A 3DUZA 1YHQA 2N88A 5M5YB 3H94A 1A63A 3GTLH 1EY4A 4G57A 5C5LA 2AQ3B 4JG2A 4DA2A 1VQ6A 2UXCL 4HMIA 2C9OA 2IJ0A 4K8IA 4BBSG 1IBKL 1QWYA 2FFKB 1SE8A 1HTPA 3NQIA 1CZGA 5I6YA 5EJWA 2B63G 3BS1A 2K5WA 4MIUA 3STBD 4RH6A 2K5VA 4F8MA 5TSSA 4A3FH 2PI2E 2E74C 2Z6BA 3AFPA 4LMQD 1I6VC 4YY3L 1EQTA 4CBVA 1Y8PB 3QB3A 2IW3A 4YHHQ 1CT1D 2N78A 1GUSA 3QR8A 4HSVA 4N9PA 1B9MA 4A3EB 1IYUA 1U4LA 4K8JA 3CC2A 1HHVA 1QJOA 5JJIA 4DR1L 3I56A 3SE0A 4BY1B 3AMUA 4A3GH 1Q3LA 5NUCA 5C3WA 2NZ1D 3I90A 3NXWA 3U4VA 2JA8H 1KRSA 4EQ5A 1JJCB 2G5DA 3KJPA 4KHPQ 3D6WA 1JB3A 1STNA 4DV3L 1HXYD 3IFTA 2HHHL 1IYVA 3DWQA 1V1PB 4JPBW 2K50A 2K1BA 1V9PA 2RBMA 5GADC 2JJQA 4DV6L 3SDZA 2VUMB 4ILWA 4IUUA 3GTGH 5M5YH 1WYDA 4B3SQ 4NMZA 3OW2A 2TMPA 1N36L 3I4MB 4WJ3M 3RUZA 4Y7NH 1XMQQ 3PIPA 1GUNA 1CFMA 2KHJA 4JW0A 5C4HA 1Y8OB 2HCIA 2A74C 3EJIA 3I55A 1TXYA 3HOWG 1DM0B 4C3HH 3MC0B 1GD7A 2D2CC 3VR5A 4DV7Q 1HNWL 4IPCA 3ULPA 2R7DA 3FDTA 2Q2UA 3I4NG 3OYYA 2WB1B 3QOJA 3I2ZA 2R7ZB 2F03A 3R93A 1CKMA 1XXGA 2BH2A 4EQNA 3SXHA 2JA6H 5M3FB 4UHVA 1EIFA 1JOOA 4XT3B 5E4XA 2HIVA 1PVOA 3J7ZC 1TKWB 1PH1A 1B3QA 3PO2B 5KNDA 4JI1L 4DR2Q 5EPJA 3E3XA 2Q2IA 1IW7D 3I8ZA 5KEEA 3L7ZC 1TWHH 1Q86C 1BDOA 1CSQA 3GV3A 4J15A 5IGGA 4UAIA 2Z4IA 1K73C 4KY7A 2D0OA 3HGBA 1EEID 1BUVT 1PTOH 2H4OA 1BCPB 3G48A 3WOFA 3BZDB 4XDXA 4QGUA 5JPMC 2EYFA 1DOMA 4AYBG 2CQAA 3RLFA 1IBLL 5DM73 4IUTA 4A3JG 2WB1E 3L9AX 4IQZA 5CV4A 1K8MA 5LMNQ 3NBIA 4K0KQ 4KKUA 1R9TH 3CCVA 3DMUA 1K83H 3QO2A 3CCQA 2WAQE 4IJHA 4FXKC 2GVAA 1CQFA 2F0UA 1Q81C 1FD7D 1VQFA 4DV5Q 2E75C 3A8IE 4UPAA 5JEAJ 2G9HD 2ES2A 3I4MH 3KLSA 3CXCA 1CA5A 2QKIC 3GD7A 5H1SE 1STEA 5IGEA 1VQPA 5J1ZA 2UXBQ 2HCCA 2LXJA 2BDOA 4LFCQ 3I4LA 1VQDA 3H09A 1FVIA 4OO1I 1QNUA 4NP5A 3G6JB 3ERQA 3HP3A 3I72A 1LV9A 4X3KA 1RJTA 2PNRC 5HGTA 4A3DG 4RG1A 4BBRG 3F1ZA 5IE8A 1DONA 2KENA 4O2DA 3D0FA 3UDGA 4DNIA 1G8ZD 1O7IA 5FLXL 1NNXA 4H44C 1SYFA 3S9WA 1A3VA 1IXRA 4DV0L 3S24A 3F2DA 4K5XA 4RAUC 4X3UA 5CV8A 3DHQA 3FKIG 2N3SA 1X3FA 1AN8A 4UDUC 3U4ZA 1S5ED 1ZEQX 1ASZA 4RFBA 3K5MA 5CBAE 3AB9A 1NSNS 4RGNA 4DN4M 5IYCH 4BWGB 3N6RA 2F0DA 2VL6A 4PQXA 1R4PB 1WI5A 1JOQA 2IPKD 1G91A 1SAPA 2J7ZA 1D5MC 3RZDB 3H91A 1BCPD 3E6ZX 1XNQQ 3F2BA 4MTKA 3JAMi 5DEHA 4FF1A 3HOVB 3F2CA 1LT6D 4MZ9A 2ZXOA 1S3OA 2UXDQ 1EWHA 1PH4A 3D6CA 2CW0D 3TP7A 3TZUA 4LAAA 5AJ3L 4JK1C 2L9HA 2GVBA 3CF5A 3PUXA 1Y1VB 2NB0A 4Q5VA 3V2TA 4KN4C 1BO0A 1TWAH 2SNSA 3EN2A 1A15A 4A3IH 4FF3A 2OEOA 4A3KB 1Y1WG 1EYDA 1KC8C 2Y0SG 4XXEA 1SNMA 3VDYA 1SYCA 3T56B 2B8GA 2NVXB 3URYA 4RWSC 1BR9A 2F4VQ 4KHZA 1DCZA 1YNJC 4OWTB 1HQMC 4DR6L 2V4DA 3SK8A 1NY4A 3HOVH 1RHPA 3VR3A 1TVXA 2E2IB 1JWUD 5C0XG 3NP8A 2JA8G 1KDAA 1NCVA 4BA1I 1II3A 4HIDA 3S2DB 4DXFA 1YHAA 3S1RH 4DXGA 2ZM6L 1X55A 1GM5A 2X69A 4LF6L 4C56C 2IX1A 3HOZH 1FGUA 2B2UC 3PV0A 5KYLA 1NMGA 3FVQA 1LTTD 3A8JE 3Q23A 2I0QA 1SYBA 3IFDA 5CC4A 3VA5A 4TVAB 1FNWA 2KCNA 1SFOH 1TWGB 3ZJYC 2ICIA 1CUKA 1GKHA 2K04A 1NUCA 1B8AA 1SNDA 3DEPA 1J5EQ 1SE3A 2R3ZA 3A5ZB 4MN3A 1XPUA 3RZOB 2JN4A 1YZ6A 2UXBL 1H9KA 1ILQA 2NYZD 1JR0D 4H0LC 4GZYC 4IUPA 1KQSA 3VR6A 1NAPA 4DV1L 1ZYRD 4NDXA 5I6WA 4EQPA 4BY1H 4CJ1B 4J8QA 5HGQA 2QA4A 4RKLA 1SN8A 4XYQA 5LMNW 1RCVD 3J81i 5FLMH 1DOKA 2EY6A 1ZXTA 4A3MG 3NHHA 2WB1G 1RKNA 4P73A 5GQOA 5C4JH 3BZCA 4DR1Q 2EYMA 5GROA 1I5FA 1Q46A 1VCIA 1OXSC 4HN7A 4C3HG 1PYBA 2NZOA 2ZT9C 2B2VA 4HCEA 4I7AA 1VQLA 3BYTB 3EROA 1T9HA 1V1QA 1K8GA 2UU9L 5D3IB 1HA6A 3BDCA 4JBJA 3R8BA 4C3JG 2EXZA 4IPGA 3OWFA 1O7LA 4HMJA 1MJEA 3NWTA 2MPMA 4KMUC 1ICWA 4HAEA 2JA5G 5ELFA 1S5FD 2B3GA 1VQJA 2EY5A 1AFPA 1RF2D 1X3GA 4RCOA 4A3JH 1QVFA 2VS1A 4AQYL 3NQTA 2EJFC 1EWIA 5FLXc 1IL8A 4JI6L 1N36Q 3GTMH 4NB3A 1F9SA 5FKAC 5JVG3 1WD0A 1I94Q 4RCNA 2XSCA 3I91A 3NSWA 1O7YA 3MXNB 4OIJA 4RGMA 2H1EA 4JI0Q 5IP9G 1U5KA 4R4CA 4QJFA 3KYHC 1X65A 1FGBD 2JA6G 4POFA 1PDQA 1Z9FA 4XIGS 3VR2A 5T1GA 2M00A 4EX5A 4ID6A 4LUOA 1YNNC 4DR7Q 2LFNA 2VY3A 1RIPA 1Q82C 3T13A 5KNCA 3UE0A 2QEXA 4R9WA 4A3KH 1XPRA 2WKDA 2WIIB 1QILA 3CCJA 1QVCA 2A19A 1I4GA 2MNAA 4IJLA 1CI3M 2DNEA 3SGIA 3LWUA 2XIWA 1VQEA 1G6ZA 4X3TA 3S1MB 2F0MA 4C1NK 1Y8NB 2LY7A 3K58A 2JA5B 1R4QB 5FO7B 2RCNA 5M5WH 4KY5A 4MNOA 2MQHA 1JQYD 1E24A 4QF4A 3K81C 3L2PA 2A68C 2G9DA 1KDBA 2JK8A 1K3RA 1LLRD 2AWOA 3M4QA 4HIOA 1N34L 2LS01 5C44G 3J7AF 2ENBA 3I70A 1DXMA 2I5LX 2NN6I 2WACA 3IAYA 1B9NA 2F52A 4M1UB 3KDFA 1SMYC 4LF4L 1N8RC 1Q1BA 3Q22A 2E76C 4GN5A 2B2VC 1SBBB 5I4DA 3SR1A 1VF7A 2NUCA 3M4YA 4A3GB 1EOTA 3W1GA 2O4XA 3P7JA 5D65A 4CDFC 4WJWA 3M3YH 2JEBI 4K5WA 3OTOL 1JE4A 2IY5B 4LF9Q 4BXXH 3STBC 2KUMA 3KJOA 4AH6A 2HQEA 2F0VA 4A3CG 2L1BA 4WJ4A 3ICEA 1ONLA 5C3EH 2L15A 4BBSB 1PHJA 1PRTB 3G71A 1GXDC 2IHFA 2NVYB 3EQLC 5EPKA 2ZXRA 3EBEA 2JA8B 4DV4Q 1VMCA 1O78A 4C3IG 5I2YA 2F3VA 1Y1WH 2MFIA 2CHBD 2F0QA 1N32L 3CMEA 4HJAA 3IRBA 4WORA 1CA6A 4OWXB 3D4WA 5FK9C 2MGSA 3KDFB 3P20A 1GUOA 2YTXA 3S1NB 1N33L 2KECA 1Q7YC 4E6IA 2XNAC 1LACA 1IL2A 2L4NA 1VQCA 3K8AA 1L0WA 4ULLA 1CTMA 2A8VA 2Y0SB 2NTSA 2V1CC 4AYBB 4A3FG 2NVTH 2ALYB 3HRZC 3FMCA 3O13A 5BN3A 4X65Q 4PV1C 2C5CA 4LNQA 2L11A 4TKOB 3PUYA 4NW2A 4LFAQ 4DR4L 2A5HA 2KBNA 4K2KA 1I6HB 2AQ2B 3LWEA 1NJIC 3T51B 1S5BD 2AUKA 2PZWA 4HJ7A 3D8GA 3LX0A 4BA2I 1KL9A 2JYOA 2JA9A 2K52A 3BG3A 4QCLA 2KVMA 3V05A 4JI0L 1YNXA 1DGSA 1YNJD 4GKKQ 5FO8B 1HZAA 4QMGA 5EKLA 2EE1A 4L5TA 5G3LF 2ATWA 3GTKH 4A3IB 1WTXA 4R1JA 3S1QB 3M4OH 3M3YB 2A1AA 2WP8J 4H13C 2E2IH 1KABA 1LTID 2R93G 1FYCA 4DV0Q 2DY7A 1TY2A 4OL7A 1XTCD 1GJXA 4BY7B 1HCZA 2B2UA 3KUPA 1TWFH 1EOVA 5KRUA 4A3DB 4QUCA 4A3LG 5C5MA 1W6JA 2JA5H 1VDZA 4K0KL 2EPBA 3S1MH 1CM9A 3Q8DA 3Q6SA 1STGA 5IY0A 3JAME 3QG1A 2OXPA 1W6KA 3RZDH 2RHSB 1X3QA 3CD6A 1MIUA 1JORA 1EWCA 1TS5A 4IPHA 3K0YA 1B4OA 2PCFB 5IT9L 4DV1Q 3MEHA 4PMWA 1F2ZA 2PYKA 3TQYA 3S17H 4JYAL 4G4KA 4A3JB 1G51A 1TY0A 1LYLA 3T1HL 3DWAA 3GTJH 1QOHA 4C2MB 5K5PA 3S2HB 1D7QA 3HKZG 4NPSA 4YWKA 1F2YA 2VUMH 4QIWB 4B3RL 2B8FA 3T1HQ 2YYZA 1GOZA 2Q8RE 1HNWQ 1TS2A 2KHIA 1LTBD 1F2MA 4OWWB 3NWSA 1RD9D 1KD1C 4KN7C 4OEMB 5KNBA 4IFDJ 2NTTA 2HQLA 1TU2B 3OWEB 4X62Q 2XWBB 2EYPA 2PZUA 1OO9B 2DJFC 5E7NA 3CCRA 3HOUH 3PO3H 4KHVA 1STBA 3S1QH 4IFDH 4JI1Q 1DZ1A 5C0XI 1SYGA 3K57A 5D14A 4CGYB 1Y1WB 1JICA 2QW7A 5IGFA 2OTJA 2OTLA 4A3MH 3T4AC 1KAWA 2QDBA 3MXNA 1NR2A 3H6MA 1L1OA 3PF4A 2A6HD 2EDGA 2Q2HA 3WWVA 2B63B 5KIXA 2Z1CA 1XNQL 2CWAA 2D9UA 2PMZE 2K6AA 3FKIB 1XMOQ 1V43A 1VQ4A 1ENCA 1EUJA 1OTCA 2M2LA 1WVLA 1LT5D 1EIGA 4IOAA 2B2TA 3DM1A 4AYBE 2JA7B 2JEAI 3OSOA 4HEDA 5CV7A 1F9RA 4FXDA 2RDHA 4O1NA 5JPNC 2MHVA 3RR5A 3EVQA 1E1TA 5LL6X 3TS0A 3CKIB 5C44H 2WAQG 1ICFB 4A3KG 3PF5A 1LM0A 4IFDI 3TBIB 1PH8A 1LO5D 5IYDG 4A93H 5K36H 3J80E 4GKJQ 4L63B 1LUZA 3MFGA 5ELDA 3KK7A 1B1ZA 3R2TA 4YCWA 1D8LA 1S4ZA 2CH4A 3VYUA 1EY0A 1WTOA 3HFZB 4FXGC 1EIYB 4DV6Q 1WTWA 1PFMA 2F0IA 3S17B 2OF1A 3P1HA 2K14A 4BXXG 4K2LA 5JVH3 4GLXA 2K03A 4X66L 3C46A 3HZXA 1VQKA 3D3RA 1K0SA 2J4XA 3U58A 1YJNA 3CRKC 2O2LD 1DD2A 3HOUB 3PO3B 1J8IA 2KCCA 2ZJQA 4FF4A 2F0EA 5ELOA 1EY6A 3P75A 5FO9B 1SFOB 3PO2H 4RGOS 5T1IA 3S16B 5FJ8H 1GUGA 3GDEA 5I9OA 1KDCA 3GTQB 1V8QA 1TR5A 3OTOQ 2QEJC 4KTAA 2B29A 4LF9L 1W3SA 1E2WA 1LABA 4CKEA 5ELBA 5CYUA 1TS3A 3I4OA 1I50B 2PNHA 5ELCA 3GTGB 1QB5D 1EQRA 5A35A 5CBEE 4A75A 5M3FG 2Q8TA 2E2JB 4IALA 3S2HH 1HA5A 1QZGA 3GTOB 1F2LA 3WDNA 2CKZB 1AZQA 3NTIA 3E9HA 2A73B 1TWFB 3VYTA 5FLXE 1Q1EA 3GV6A 4EGVA 3J7YW 3KBXA 4A3IG 2HT1A 2KQ3A 4DK0A 3MXUA 4HJ9A 2N8NA 1WCMB 2A6EC 4DKAC 3K7AH 1OXXK 4ZCKA 1I4HA 1WTVA 3U9SA 1ESRA 3KF6A 3C1FA 4DUZL 4HR7B 1AZPA 3NBHB 3K5LA 4F7XA 4N8FA 3PCOB 4P2CB 3TSSA 4FF2A 1VQBA 4C3JB 5C4XB 1B70B 2CCZA 2RKSA 5EGTA 4FYDA 4X65L 1XYIA 5CV6A 3V96A 4DK3C 4ALPA 2ZJRA 2Y0SE 4G7ZC 5EPLA 3E0EA 2RA4A 4NXML 4GOPC 3R2IA 1VQOA 4O42A 3T1YL 2SDFA 3D4RA 3H0GH 2UUAQ 3J7AV 1AE3A 5CMDA 1Q12A 1IKMA 1C7YA 2L0CA 4HIMA 1DYQA 3NUCA 1H9JA 3S15H 4NXNL 5BN5A 4GKKL 4RHSA 4CKBA 1D2BA 3IKJA 4U673 1HR0W 3F2UA 2PPBC 2KEDA 1EY9A 4LFCL 2F0SA 1C8CA 2IX0A 1K3BC 3S15B 1F77A 2SEBD 3S1NH 4PG3A 4L8JA 4B3SL 1SMXA 2E5LL 1MD2D 1PRTD 1M8AA 4I7ZC 2K33A 2YU9H 4PZ7A 4PMCA 4LF8L 1PV4A 1PA6A 1KRTA 3HKSA 1H9SA 1VS0A 4IFDG 1ET6A 2A68D 5IT9c 1CK1A 4OGQC 1JWSD 4DV7L 2CW0C 1SYEA 4YIJA 4GNXA 1P8LA 2UUCL 1BOSA 1UAPA 2KCTA 3PGZA 4B3ML 1XNRL 1E2VA 1FNVA 4RMFA 2PW7A 1BCPF 4P71A 1EYAA 1CSPA 2BDNA 4OX9L 1I50H 1GUTA 4XQQA 1GHJA 3KFUA 2DGYA 2MP1A 1VQNA 2DJGC 4CJ0B 4KKSA 1LTRD 5EBDA 3AQQA 4C3JH 2RSNA 1HQRD 5CV9A 5BR8L 4JCVE 3RZOH 1YNND 4N8X1 2VW9A 2VQFL 2R92G 3S1RB 1L1OC 1XX8A 3FHWA 1FJGL 2ZJPA 2VUMG 1TWAB 3K6OA 5M3MH 2JA7G 5ELNA 1PTOD 3M4PA 4LWCA 4KK7A 2K5DA 1QG7A 4DAMA 4K6LA 5JAVA 3W3AA 5L37A 1WCMH 2KJXA 2UU9Q 4A3EG 2OWOA 1SROA 1QUQA 4IN3A 2QDLA 3A7LA 4A3DH 3MXGA 2XGTA 3W1BA 4MHEA 5IP7H 2YTVA 4BS9A 3R3OA 3J81L 2D62A 4X64L 2CWPA 3CHBD 1PLFA 1PZJD 1J6QA 3KF8A 2AHOB 4L6TB 3BVMA 4JI3L 1I94L 4LK1C 3W5OA 5IGBA 3ULJA 4B3TL 1PXUA 3ERSX 1LT3D 2F0LA 3SK5A 1KXLA 3LGJA 5EBCA 5A2QL 5D3DA 1KTKA 1I3QB 1EIHA 1B44D 1HFGA 4JI8Q 5EAYA 2KEEA 1RTOA 3NK9A 1X3PA 2H5XA 1X32A 2B2YA 4X62L 1LTAD 5CGKA 3FKIH 4DR5Q 4H7BA 5EKKA 4XT1B 2R6GA 1JMCA 2B63H 4RKBA 2FINB 3E0JA 1UE5A 2O5JC 4JYAQ 5CV5A 3RLOA 4DAYA 5LHY1 1ESFA 1STHA 4DR5L 1I4PA 2FMMA 2I07B 5IOCA 1CZWA 1TWCB 3NTHA 4KD4A 1Q8KA 4CDEC 5KYIA 3PUZA 2DY8A 2TSSA 1D1KA 4X66Q 3CAMA 4FDBA 5GAGC 4PZ6A 2B39A 4DU9A 4LFBQ 4FVMA 2VZAA 1D5XC 5BN4A 1PH3A 1RTNA 1HNXL 1JJ2A 4LF7L 3DM3A 2XN9C 3I7FA 2AMCB 1KNAA 4NXMQ 3AU7A 1X9NA 3PO2G 3TEHB 4WRDA 5IYBG 4J1MA 4C3IH 3HOZG 1GO3E 3KLWA 1J5EL 1VQAA 1EL0A 1BBXC 4GKJL 4NXNQ 3CCMA 1YJ9A 3A5UA 1QNKA 5ISRA 1K83B 2SOBA 3E5SA 4XTCS 1S5DD 5C0XH 3WOEA 2BH8A 4OO1G 4DFAA 1SNCA 1EZ8A 1C4QA 2EJGC 2ZTEA 3ER0A 3TN2A 4JBMA 1N32Q 1Q90A 1NBWA 3CRLC 4MTNA 2KA7A 4JI2L 1VQ7A 1N33Q 4BBSH 2F0WA 4LF8Q 3EFXD 2BE5D 4B3RQ 1RL2A 1BBUA 1EZ6A 2ZM6Q 4Z9CB 1YVCA 3MWYW 4G7HC 3M4OB 2NVQH 4DUYL 2B2YC 4H02A 1ILPA 3MHBA 4DR2L 3KOJA 2R93B 5GAEC 2A6HC 4N9TA 4ODGA 1U4RA 4FO2A 4DNTB 4Y7NB 3NEMA 1AP0A 2FHTA 5JOBA 1YITA 3PQIA 2R93H 4B3TQ 4KJNA 3Q24A 3SVMA 1WTRA 1IBML 4FNFA 3CMAA 3TP5A 1HR0L 5AFWA 4DNRB 4PNYA 4CDCC 4HJ5A 1FJGQ 5CR3A 3TMEA 1G2TA 2E2HB 3J81c 2MJ8A 1M4VA 1N34Q 1VQ5A 1A0IA 4IOCA 2E5LQ 1A3UA 3NELA 2F0TA 3SHLA 1EU4A 1XWEA 3HG9A 3CQZH 3SK6A 1HJPA 1ET9A 1G291 3CC4A 5IP9H 3UDFA 4IURA 2QCPX 1D1IA 2CVRA 5JJZA 2WFWA 2E2DC 4JI5L 1YHBA 2RHQB 5C44B 3J80i 2UUAL 4HJ8A 3H15A 2PO4A 2HIXA 2NVYH 3T53B 4L5RC 4A3BG 3PIOA 2X6GA 1M90C 4LFAL 2RDFA 4DR4Q 2FXQA 4Y52H 1I6HH 1BF4A 4HSPA 2YU9B 1W2BA 3HOWH 3C3LA 1OXUA 4JI4Q 1GVPA 3NBHA 2R92B 2EVBA 2UUBL 3MEFA 1XMOL 1DOLA 4B9XA 1V1OA 3H3VH 3HS0C 5IT9E 3MAQA 2A69D 1N9WA 1FR3A 5CORA 1PH2A 4QUFA 1SNPA 3Q0AA 4KLKA 3JAML 1L0XB 3MVVA 2NZHA 4JVZA 3VYRA 1VQ8A 4B08A 4DR3Q 5DLQE 1HUNA 4ZAIA 1PMRA 2DUDA 2WKCA 3J80L 1TT2A 1MSHA 1VQ9A 1YBYA 3QIAA 3QJYA 2XWJB 4A3EH 3PUWA 3T1YQ 2EZVA 4GNXC 2EJMA 4PMBA 3W2DA 1QCBD 3K0XA 4OX9Q 5C4XH 5E4WC 4R8NA 2A6ED 4IZ8A 4K6DA 2WAQB 2CH4W 1A62A 3TS2A 1E22A 3F8TA 4ABNA 3RN5A 3AEVA 1B7YB 1TWHB 3X3NA 5J22A 3HEJA 1ASYA 2KHSA 2BA1A 2I46A 4AIMA 1IZ6A 4YCVA 2VNUD 3NTKA 1HNXQ 1JOKA 4ZYSA 3C2PA 1ENAA 4CJ2C 2RQXA 4GLVB 5ELEA 4IUQA 1B3AA 5IGDA 4ZRZA 3MFYA 3QWNA 2R61A 4QQBX 2ZTCA 2E2HH 1S40A 1QVGA 1I4RA 2QILA 4RGTA 3NE5B 4KHPL 2IHEA 2JP1A 3E9IA 3IL8A 4O0AA 2F3IA 3A56A 4L5SA 1G2SA 2L12A 3CU7A 4LF5Q 4DF7A 2VXWA 4C3HB 5JJLA 1K8AC 4J6HA 3A8KE 1EEFD 1B53A 4A3CH 2R7ZG 3AYHB 1IBMQ 2LSSA 2EYLA 3HOZB 4CKCA 4LW1A 3LNNA 1VQHA 4JI7Q 3BJUA 3SEBA 3UDIA 4DAVA 1KLGD 1PRTC 1C48A 4B9WA 4R4TA 1SDFA 1EFWA 1U0LA 3PMFA 5M3MB 2WV6D 4HCSA 3G4SA 1EQQA 3D4DA 5LL6S 2IX3A 5C6AA 1MI2A 1MJCA 1KIXA 1E1OA 1EQVA 3CCSA 1BBWA 3QOLA 4UP9A 4BBRB 1HRJA 2XTIA 2K01A 4JI8L 2VQEL 5KGUA 2N49A 3RD4A 5JJKA 5M3FH 1EY8A 3FPUB 4A4IA 1LTLA 1K0RA 3BVZA 1MSGA 4XYOA 3OMCA 1VF5C 4DV5L 2Z6KC 3HOXG 1PFNA 4L5QA 3DLLA 3OPOA 1K8OA 1PH5A 1SEBD 2F0GA 1ZKOA 3SK4A 3GTKB 1I4QA 3M7GA 3CPFA 2UUCQ 1JC7A 3X3MA 1P16A 4RA8A 3G7LA 2B2WC 4OELB 4UY8C 3UE1A 4DK1A 1SSOA 5E1FA 2PQAB 5C3EG 1NE3A 1TWCH 2J0TD 1SXTA 3MXPA 4ZLTF 4LFBL 1EY7A 3J81E 2EY2A 1JE5A 4R4QA 4ME3A 3D31A 2AWNA 1F9PA 3BVGA 1B50A 2BOSA 2K4KA 1TQOA 1JJGA 2BE5C 1D6EC 4TRDA 4C3IB 1EY5A 1LTGD 3KLSX 4A3BH 3HOVG 4R4OA 4AQYQ 1XPOA 2I5HA 4OO1H 3H0GB 1Y69U 3HKZE 4OONA 4JV5Q 1STYA 1SYDA 1UEBA 3I73A 1KAAA 4QL5A 1BNZA 2BA0A 4U68A 3I4NH 2PQAA 4ZUIA 5IGCA 1LT4D 1Y1VG 5HY6A 4DAPA 4CDDC 4F88A 3VA7A 2KOLA 4R4IA 4JI2Q 1R9TB 2E2JH 3GTLB 1PH9A 2Q2TA 3DEOA 1XMQL 3BYYB 3K5NA 3OOCA 3K7AB 2HDMA 1NMFA 2JQOA 3MTSA 4EQOA 4X6AH 5BR8Q 2QF7A 2ASBA 3PSIA 1A2UA 4DK6C 1IBLQ 3KLRA 1PYSB 2DN8A 4GS3A 3MA2B 3NPPA 1V1PA 1T5EA 3BZKA 2F0JA 2RF4A 2WINB 2BCOA 5FOBB 1YJWA 1JT8A 4DV3Q 4ZQ3A 2DNCA 3HOUG 3A74A 3PO3G 3GO5A 4QIWE 2OQ0A 2QGQA 5C0XJ 1UNSA 2FJ2A 1IBKQ 1E7ZA 3CW2C 2K32A 1Z47A 2F0HA 3GP7A 1HPCA 4YWLA 4DV2Q 2EOTA 5DM63 3GTQH 4GOPA 3EIVA 1HR0Q 4V190 2NVXH 2AUJD 1C9OA 3J81j 4JI3Q 1VQIA 1MBYA 3EA6A 3AFQA 4A93G 3JAMc 2RDGA 3H3VC 5IYDH 5K36G 4DV2L 2Z9HA 2EIFA 2HUGA 1M1KC 5AJ3Q 4KJOA 1EYGA 2KCMA 1HNZL 1YIJA 4YHHL 2NVTB 1H9SB 1SR3A 4KD3A 2A69C 2EY1A 2P5ZX 4DPGA 1A3TA 4JBWA 2PMZB 2Z6KA 2E8GA 5C3XA 1WFQA 4DR3L 4LJZC 5JEAH 1SNQA 4RHRA 5C4JB 3I4NB 2IL8A 1IYJB 1H9MA 2GN5A 1BQQT 4IPDA 5J3BA 1BXTA 1MGSA 1MKHA 2K5HA 2IWHA 3CCEA 1Z6HA 1BVSA 1UEAB 1UWVA 3KBGA 3MZ5A 4NKLA 2B2WA 1UE7A 4I65A 3FP9A 1X54A 3L3OC 2JSOA 3K7UC 1WJJA 5FJ8G 3A54A 4QB4A 1A2TA 3ULLA 1UE1A 1AH9A 4OIKA 2ID0A 3HOYG 3TP8A 1QE6A 1I4XA 2NWGA 3TZDA 2Z0SA 4A3FB 4IUVA 4K5VA 1WTQA 1LTSD 2K7VA 2XRQD 4ZKBB 4YY3Q 1O80A 4BY7G 4GN4B 2EYOA 4TQUS 1NR4A 4HIKA 4G7OC 1VQGA 1X3EA 2M9VA 1TIID 1Q8IA 4JOIC 3GTPB 2SNMA 1CQVA 4HTHA 4GNXB 3DXJC 2LXKA 3JC66 3K5OA 1OXVA 4DUZQ 2OCEA 2EYHA 4JI5Q 1FNUA 2VQFQ 3CCUA 1S5CD 3PUVA 5E3FA 1A8VA 2NN6G 5C3EB 3DWPA 2L55A 3OMGA 5DAUA 5EQ0A 1K28A 1VQMA 4IO9A 1O7ZA 4IUNA 2HD3A 4CHTB 3RNUA 4DV4L 1JCKB 2Z4HA 2HHHQ 1PTOC 3CQZB 4K14A 2XRSD 3RMHA 3PIP3 1J9OA 2F4IA 3BDLA 3GTJB 4DR6Q 3I3CA 1Y14B 1OXTA 2RCFA 3HKZB 4YWMA 3HOXH 1PH7A 3BU2A 1E0BA 2L5TA 2K28A 4KKTA 1SE4A 5IYBH 1WD1A 3GTOH 3H0GG 1CKNB 2F0FA 1VMPA
chains in the Genus database with same CATH topology
1PTOF 1DJRD 1L0YB 5J39A 2PW5A 4ZKCB 2O5IC 2NBFA 2B2TC 3T16A 5DNFA 1SE2A 2AQ1B 1SNOA 3BDOA 2LMCB 4TSSA 4EVOA 2K05A 2F1MA 2K5QA 5I9PA 2JA6B 4R8IA 3C1EA 3UI2A 1EU3A 1AW7A 1HUMA 3ND8A 1D5ZC 2F0NA 2PQEA 4M8AA 3ZYYX 1U4MA 4KV6A 4KY6A 1SJED 1Z7TA 2ICEC 2F0OA 2PZTA 2X6LA 4C1NI 2F0PA 2FMCA 5M9OA 1B2TA 3FEWX 2NVQB 5EKIA 2JXMB 4A3BB 4XQNA 1KLUD 1T5XD 3TP6A 1PZID 1CHQD 4KI0A 3PIO3 1CHPD 4ZUJA 2ZXPA 4S3SA 1STAA 5IODA 4Q0FA 1SJHD 1ML0D 5F2DA 2GA4B 1IW7C 3GQBA 1IKLA 1RDPD 4F87A 1EYCA 2RVLA 2MUYA 3TDQA 3OIQA 1A6XA 1SMYD 1ZYRC 5COYA 4OHJA 1GUWA 3A55A 1GHKA 3FPPA 4A93B 2LKVA 1PYWD 3S14B 3K59A 2F3WA 5G3LD 1U9RA 3ND9A 3ONAB 1HFNA 4A3MB 2VB2X 1E2ZA 3VYSA 3M85A 1EFID 5M5XB 4DGZA 2Z8LA 3HOWB 1PFBA 5C4ZA 1WTPA 3A7AB 3VR4A 5HURA 5A2QE 1H9RA 3N52A 1F9QA 1PTOB 2Q8IB 4V0BA 2HDLA 3ITPA 2D5DA 2EYJA 2F0KA 3OHXC 4XQJA 5IIFA 1PZKD 5JEAG 3U9OA 1IHZA 3OIPA 1TS4A 1UUPA 2JE6I 3HOYB 5I2XA 1BCPC 4FP5D 4WFN3 1RODA 2IT1A 2NN6H 3FRPB 4ME5A 3GTMB 1JWMD 1KNEA 2N55A 3OW7A 2XVSA 1ENFA 1PRTF 4X3SA 3HOXB 1U4PA 2RSOA 1AEXA 1HTLD 5M5WB 2OT2A 4ZK9B 3M7NA 2VB3X 3DUZA 2N88A 5M5YB 3H94A 1EY4A 4G57A 5C5LA 2AQ3B 4DA2A 4HMIA 2C9OA 2IJ0A 4K8IA 1QWYA 2FFKB 1HTPA 3NQIA 1CZGA 5I6YA 5EJWA 3BS1A 2K5WA 4MIUA 4RH6A 4F8MA 5TSSA 2E74C 4LMQD 1I6VC 1EQTA 4CBVA 1Y8PB 3QB3A 2IW3A 1CT1D 1GUSA 4HSVA 4N9PA 1B9MA 4A3EB 1IYUA 1U4LA 4K8JA 1HHVA 1QJOA 3SE0A 4BY1B 3AMUA 1Q3LA 5NUCA 5C3WA 2NZ1D 3I90A 3NXWA 3D6WA 1JB3A 1STNA 1HXYD 3IFTA 1IYVA 3DWQA 1V1PB 2K1BA 2RBMA 3SDZA 2VUMB 4ILWA 4IUUA 4NMZA 2TMPA 3I4MB 3RUZA 1GUNA 1CFMA 5C4HA 1Y8OB 2HCIA 2A74C 3EJIA 1DM0B 3MC0B 2D2CC 3VR5A 3FDTA 2WB1B 3QOJA 2R7ZB 2F03A 3R93A 1XXGA 4EQNA 3SXHA 5M3FB 1JOOA 4XT3B 5E4XA 1TKWB 3PO2B 5KNDA 5EPJA 1IW7D 3I8ZA 5KEEA 3L7ZC 1BDOA 3GV3A 5IGGA 4UAIA 2Z4IA 4KY7A 3HGBA 1EEID 1BUVT 1PTOH 2H4OA 1BCPB 3WOFA 3BZDB 4XDXA 5JPMC 2EYFA 1DOMA 2CQAA 3RLFA 5DM73 4IUTA 3L9AX 4IQZA 5CV4A 1K8MA 3NBIA 4KKUA 3DMUA 3QO2A 4FXKC 1CQFA 2F0UA 1FD7D 2E75C 3A8IE 5JEAJ 2G9HD 3KLSA 1CA5A 2QKIC 3GD7A 1STEA 5IGEA 5J1ZA 2HCCA 2BDOA 3I4LA 3H09A 4OO1I 1QNUA 4NP5A 3G6JB 3ERQA 3HP3A 3I72A 1LV9A 4X3KA 1RJTA 2PNRC 5HGTA 1DONA 1G8ZD 5FLXL 4H44C 1SYFA 3S9WA 1A3VA 4K5XA 4RAUC 4X3UA 5CV8A 3DHQA 1AN8A 4UDUC 1S5ED 1ZEQX 4RFBA 3K5MA 5CBAE 3AB9A 1NSNS 4RGNA 4DN4M 4BWGB 3N6RA 2F0DA 4PQXA 1R4PB 1JOQA 2IPKD 1G91A 1SAPA 2J7ZA 1D5MC 3RZDB 3H91A 1BCPD 3E6ZX 3HOVB 4FF1A 5DEHA 1LT6D 2ZXOA 1EWHA 3D6CA 2CW0D 3TP7A 3TZUA 4LAAA 4JK1C 2L9HA 3PUXA 1Y1VB 2NB0A 4Q5VA 3V2TA 4KN4C 1BO0A 2SNSA 1A15A 4FF3A 2OEOA 4A3KB 1EYDA 4XXEA 1SNMA 1SYCA 3T56B 2B8GA 2NVXB 3URYA 4RWSC 1BR9A 4KHZA 1DCZA 1YNJC 1HQMC 2V4DA 3SK8A 1RHPA 3VR3A 1TVXA 2E2IB 1JWUD 5C0XG 3NP8A 1KDAA 1NCVA 4BA1I 1II3A 3S2DB 4DXFA 4DXGA 2X69A 4C56C 2IX1A 2B2UC 3PV0A 5KYLA 3FVQA 1LTTD 3A8JE 3Q23A 1SYBA 3IFDA 5CC4A 3VA5A 1FNWA 2KCNA 1TWGB 2ICIA 2K04A 1NUCA 1SNDA 3DEPA 1SE3A 2R3ZA 4MN3A 3RZOB 1H9KA 1ILQA 2NYZD 1JR0D 4H0LC 4GZYC 4IUPA 3VR6A 1NAPA 1ZYRD 4NDXA 5I6WA 4EQPA 4CJ1B 4J8QA 4RKLA 4XYQA 1RCVD 1DOKA 2EY6A 1ZXTA 3NHHA 1RKNA 2EYMA 1VCIA 1OXSC 4HN7A 4C3HG 4HCEA 2ZT9C 2B2VA 3BYTB 3EROA 1HA6A 5D3IB 3BDCA 4C3JG 3R8BA 2EXZA 3OWFA 1O7LA 4HMJA 3NWTA 2MPMA 4KMUC 1ICWA 4HAEA 5ELFA 1S5FD 2EY5A 1AFPA 1RF2D 4RCOA 3NQTA 2EJFC 1IL8A 1F9SA 5FKAC 5JVG3 1WD0A 4RCNA 2XSCA 3I91A 3NSWA 1O7YA 4OIJA 4RGMA 2H1EA 1FGBD 1PDQA 4XIGS 3VR2A 5T1GA 2M00A 4ID6A 1YNNC 2LFNA 3T13A 5KNCA 4R9WA 2WKDA 2WIIB 1QILA 1I4GA 1CI3M 2DNEA 3LWUA 2XIWA 1G6ZA 4X3TA 3S1MB 2F0MA 4C1NK 1Y8NB 2LY7A 3K58A 2JA5B 1R4QB 5FO7B 4KY5A 1JQYD 4QF4A 2A68C 2G9DA 1KDBA 1LLRD 2AWOA 2LS01 3J7AF 3IAYA 2ENBA 3I70A 1DXMA 2NN6I 2WACA 1B9NA 4M1UB 1SMYC 1Q1BA 3Q22A 2E76C 2B2VC 1SBBB 5I4DA 3SR1A 1VF7A 2NUCA 3M4YA 4A3GB 1EOTA 2O4XA 3P7JA 5D65A 4WJWA 2JEBI 4K5WA 1JE4A 2KUMA 2HQEA 2F0VA 2L1BA 1ONLA 4BBSB 1PRTB 1GXDC 2NVYB 3EQLC 5EPKA 2ZXRA 2JA8B 1VMCA 5I2YA 1O78A 4C3IG 2F3VA 2CHBD 2F0QA 4WORA 1CA6A 3D4WA 5FK9C 2MGSA 3P20A 1GUOA 3S1NB 2KECA 4E6IA 2XNAC 1LACA 2L4NA 4ULLA 1CTMA 2Y0SB 2NTSA 4AYBB 3HRZC 3FMCA 3O13A 5BN3A 4PV1C 2C5CA 2L11A 4TKOB 3PUYA 4NW2A 2A5HA 4K2KA 1I6HB 2AQ2B 3LWEA 3T51B 1S5BD 2AUKA 2PZWA 3D8GA 3LX0A 4BA2I 4QCLA 2JYOA 3BG3A 2KVMA 3V05A 1YNJD 5FO8B 4QMGA 5EKLA 2EE1A 5G3LF 4A3IB 1WTXA 3S1QB 3M3YB 2WP8J 4H13C 1KABA 1LTID 1FYCA 2DY7A 1TY2A 4OL7A 1XTCD 1GJXA 4BY7B 1HCZA 2B2UA 3KUPA 5KRUA 4A3DB 4QUCA 5C5MA 1W6JA 1VDZA 2EPBA 1CM9A 3Q6SA 1STGA 3JAME 3QG1A 2OXPA 1W6KA 1X3QA 1JORA 1EWCA 1TS5A 3K0YA 1B4OA 2PCFB 5IT9L 3MEHA 4PMWA 1F2ZA 2PYKA 4A3JB 4G4KA 1TY0A 3DWAA 1QOHA 4C2MB 5K5PA 3S2HB 1F2YA 4QIWB 2B8FA 2YYZA 1GOZA 2Q8RE 1TS2A 1LTBD 1F2MA 3NWSA 1RD9D 4KN7C 5KNBA 4IFDJ 2NTTA 1TU2B 3OWEB 2XWBB 2EYPA 2PZUA 1OO9B 4KHVA 1STBA 1DZ1A 4IFDH 5C0XI 1SYGA 3K57A 5D14A 4CGYB 1Y1WB 1JICA 5IGFA 3T4AC 2QDBA 3MXNA 1NR2A 3H6MA 2A6HD 2EDGA 2B63B 5KIXA 2Z1CA 3FKIB 2D9UA 2K6AA 1V43A 1ENCA 2M2LA 1WVLA 1LT5D 1EIGA 2B2TA 3DM1A 2JA7B 2JEAI 3OSOA 4HEDA 5CV7A 1F9RA 4FXDA 2RDHA 4O1NA 5JPNC 2MHVA 3EVQA 5LL6X 3CKIB 4IFDI 3TBIB 1LO5D 5K36H 3J80E 4L63B 3MFGA 5ELDA 3KK7A 1B1ZA 3R2TA 1S4ZA 3VYUA 1EY0A 1WTOA 4FXGC 1WTWA 1PFMA 2F0IA 3S17B 2OF1A 3P1HA 4K2LA 5JVH3 2K03A 3C46A 3HZXA 3D3RA 2J4XA 3CRKC 2O2LD 1DD2A 3HOUB 3PO3B 1J8IA 2KCCA 4FF4A 2F0EA 1EY6A 3P75A 5FO9B 1SFOB 4RGOS 5T1IA 3S16B 1GUGA 5I9OA 1KDCA 3GTQB 1V8QA 1TR5A 2QEJC 4KTAA 1E2WA 1LABA 4CKEA 5ELBA 5CYUA 1TS3A 1I50B 5ELCA 3GTGB 1QB5D 5A35A 5CBEE 2Q8TA 2E2JB 4IALA 1HA5A 3GTOB 1F2LA 3WDNA 1AZQA 3NTIA 2A73B 1TWFB 3VYTA 5FLXE 1Q1EA 3GV6A 4EGVA 3J7YW 3KBXA 2KQ3A 4DK0A 3MXUA 1WCMB 2A6EC 1OXXK 1I4HA 1WTVA 3U9SA 1ESRA 3C1FA 4HR7B 1AZPA 3K5LA 4F7XA 4P2CB 3TSSA 4FF2A 4C3JB 5C4XB 4FYDA 2RKSA 5EGTA 5CV6A 3V96A 4G7ZC 5EPLA 2RA4A 3R2IA 4O42A 2SDFA 3D4RA 3J7AV 5CMDA 1Q12A 1IKMA 2L0CA 1DYQA 3NUCA 1H9JA 5BN5A 4RHSA 4CKBA 1D2BA 3IKJA 4U673 3F2UA 2PPBC 2KEDA 1EY9A 2F0SA 1C8CA 2IX0A 3S15B 1F77A 2SEBD 4L8JA 1MD2D 1PRTD 1M8AA 4I7ZC 2K33A 4PMCA 4IFDG 1H9SA 1ET6A 2A68D 1CK1A 4OGQC 1JWSD 2CW0C 1SYEA 4YIJA 1BOSA 1UAPA 1E2VA 1FNVA 2PW7A 1BCPF 1EYAA 2BDNA 1GUTA 4XQQA 1GHJA 2MP1A 4CJ0B 4KKSA 1LTRD 5EBDA 2RSNA 1HQRD 5CV9A 1YNND 3S1RB 1XX8A 1TWAB 3K6OA 1PTOD 4KK7A 2K5DA 1QG7A 4K6LA 5JAVA 3W3AA 2KJXA 4IN3A 3A7LA 3MXGA 4MHEA 4BS9A 3R3OA 3J81L 2D62A 3CHBD 1PLFA 1PZJD 3KF8A 4L6TB 3BVMA 4LK1C 5IGBA 1PXUA 1LT3D 2F0LA 3SK5A 5EBCA 5A2QL 5D3DA 1KTKA 1I3QB 1EIHA 1B44D 1HFGA 2KEEA 1RTOA 3NK9A 1X3PA 1X32A 2B2YA 1LTAD 5CGKA 4H7BA 5EKKA 4XT1B 2R6GA 4RKBA 2FINB 3E0JA 2O5JC 5CV5A 4DAYA 5LHY1 1ESFA 1STHA 1I4PA 2FMMA 2I07B 5IOCA 1CZWA 1TWCB 3NTHA 4KD4A 5KYIA 3PUZA 2DY8A 2TSSA 1D1KA 2B39A 4DU9A 4FVMA 1D5XC 5BN4A 1RTNA 2XN9C 1KNAA 3AU7A 4WRDA 4J1MA 1EL0A 1BBXC 1QNKA 5ISRA 1K83B 2SOBA 3E5SA 4XTCS 1S5DD 5C0XH 3WOEA 4OO1G 4DFAA 1SNCA 1EZ8A 1C4QA 2EJGC 3TN2A 1Q90A 3CRLC 2KA7A 2F0WA 3EFXD 2BE5D 1EZ6A 4Z9CB 3MWYW 4G7HC 3M4OB 2B2YC 1ILPA 3MHBA 2R93B 2A6HC 4N9TA 4ODGA 1U4RA 4FO2A 4DNTB 4Y7NB 1AP0A 2FHTA 5JOBA 4KJNA 3Q24A 3SVMA 1WTRA 4FNFA 3TP5A 5AFWA 4DNRB 4PNYA 5CR3A 3TMEA 1G2TA 2E2HB 2MJ8A 1M4VA 1A3UA 2F0TA 3SHLA 1EU4A 1XWEA 3HG9A 3SK6A 1ET9A 1G291 4IURA 2QCPX 1D1IA 2CVRA 5JJZA 2E2DC 5C44B 2PO4A 3T53B 2X6GA 2RDFA 1BF4A 4HSPA 2YU9B 3C3LA 1OXUA 3NBHA 2R92B 2EVBA 1DOLA 4B9XA 1V1OA 3HS0C 5IT9E 3MAQA 2A69D 1FR3A 5CORA 4QUFA 1SNPA 3Q0AA 3JAML 1L0XB 3MVVA 3VYRA 4B08A 1HUNA 4ZAIA 1PMRA 2WKCA 3J80L 1TT2A 1MSHA 3QJYA 3QIAA 2XWJB 3PUWA 2EZVA 2EJMA 4PMBA 3W2DA 1QCBD 5E4WC 4R8NA 2A6ED 4IZ8A 4K6DA 2WAQB 4ABNA 1TWHB 3X3NA 5J22A 3HEJA 2KHSA 2BA1A 2I46A 2VNUD 3NTKA 1JOKA 4ZYSA 3C2PA 1ENAA 4CJ2C 2RQXA 5ELEA 4IUQA 1B3AA 5IGDA 4ZRZA 3MFYA 3QWNA 2R61A 1I4RA 2QILA 4RGTA 3NE5B 2JP1A 3IL8A 3A56A 1G2SA 2L12A 3CU7A 4DF7A 2VXWA 4C3HB 4J6HA 3A8KE 1EEFD 1B53A 2EYLA 3HOZB 4CKCA 3LNNA 3SEBA 4DAVA 1KLGD 1PRTC 1C48A 4B9WA 1SDFA 3PMFA 5M3MB 2WV6D 4HCSA 3D4DA 5LL6S 2IX3A 5C6AA 1MI2A 1EQVA 3QOLA 4BBRB 1HRJA 2K01A 5KGUA 3RD4A 1EY8A 3FPUB 3BVZA 1MSGA 4XYOA 3OMCA 1VF5C 1PFNA 3OPOA 1K8OA 1SEBD 2F0GA 1ZKOA 3SK4A 3GTKB 1I4QA 3M7GA 1JC7A 3X3MA 4RA8A 3G7LA 2B2WC 4DK1A 1SSOA 5E1FA 2J0TD 1SXTA 3MXPA 4ZLTF 1EY7A 3J81E 2EY2A 3D31A 2AWNA 1F9PA 3BVGA 1B50A 2BOSA 1TQOA 2BE5C 1D6EC 4TRDA 4C3IB 1EY5A 1LTGD 3KLSX 4OO1H 3H0GB 1Y69U 1STYA 1SYDA 3I73A 1KAAA 1BNZA 2BA0A 4U68A 4ZUIA 5IGCA 1LT4D 4DAPA 4F88A 3VA7A 2KOLA 1R9TB 3GTLB 3DEOA 3BYYB 3K5NA 3OOCA 3K7AB 2HDMA 3MTSA 4EQOA 2QF7A 1A2UA 3KLRA 2DN8A 3MA2B 3NPPA 1V1PA 1T5EA 2F0JA 2WINB 2BCOA 5FOBB 4ZQ3A 2DNCA 3GO5A 5C0XJ 1UNSA 2FJ2A 2K32A 1Z47A 2F0HA 3GP7A 1HPCA 2EOTA 5DM63 4V190 2AUJD 1MBYA 3EA6A 5K36G 2RDGA 3H3VC 2HUGA 4KJOA 2NVTB 1H9SB 2EY1A 2A69C 4KD3A 1A3TA 4JBWA 2PMZB 5C3XA 4LJZC 5JEAH 1SNQA 4RHRA 5C4JB 3I4NB 2IL8A 1H9MA 1BQQT 1BXTA 1MGSA 2IWHA 1Z6HA 1UEAB 3KBGA 3MZ5A 4NKLA 2B2WA 4I65A 3L3OC 2JSOA 3A54A 4QB4A 1A2TA 4OIKA 2ID0A 3TP8A 1QE6A 1I4XA 2NWGA 3TZDA 4A3FB 4IUVA 4K5VA 1WTQA 1LTSD 2K7VA 2XRQD 4ZKBB 1O80A 4TQUS 2EYOA 1NR4A 4G7OC 2M9VA 1TIID 1Q8IA 3GTPB 2SNMA 1CQVA 4HTHA 3DXJC 1OXVA 3K5OA 2EYHA 1FNUA 1S5CD 3PUVA 5E3FA 2NN6G 5C3EB 3DWPA 2L55A 3OMGA 5DAUA 5EQ0A 1O7ZA 4IUNA 4CHTB 1JCKB 2Z4HA 1PTOC 3CQZB 4K14A 2XRSD 3RMHA 3PIP3 1J9OA 2F4IA 3BDLA 3GTJB 3I3CA 1OXTA 3HKZB 1E0BA 2L5TA 2K28A 4KKTA 1SE4A 1WD1A 1XYIA 2F0FA 1VMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVM A;  2HUG A;  1WTR A;  2FMM A;  2N88 A;  2L11 A;  3FDT A;  3DEP A;  4NW2 A;  1DZ1 A;  2BDN A;  4ZKC B;  4X3U A;  4RAU C;  5D14 A;  5AFW A;  2XIW A;  4ZLT F;  5CBE E;  2B2T C;  2R3Z A;  2Q8T A;  3R93 A;  4X3T A;  1G6Z A;  5DNF A;  1JIC A;  3LWE A;  4MN3 A;  1F2L A;  2MP1 A;  4CJ2 C;  2DY8 A;  1NR2 A;  1AZQ A;  2JYO A;  5CBA E;  1G2T A;  1ILQ A;  2NYZ D;  4CJ0 B;  4IUQ A;  1B3A A;  2MJ8 A;  1F9P A;  1B50 A;  3ONA B;  2FFK B;  2KVM A;  4DN4 M;  2K05 A;  1HFN A;  4XT3 B;  5E4X A;  4IUP A;  2RSN A;  3GV6 A;  1NAP A;  2IL8 A;  3KBX A;  2EE1 A;  4R8I A;  5EPJ A;  2D9U A;  1MGS A;  2JP1 A;  3UI2 A;  3I8Z A;  3IL8 A;  1RTN A;  1XX8 A;  5EJW A;  1G91 A;  1HUM A;  1SAP A;  2J7Z A;  1WTX A;  4CJ1 B;  1WTV A;  1ESR A;  3H91 A;  2M2L A;  1WVL A;  4IUR A;  1G2S A;  5JJZ A;  2CVR A;  2L12 A;  1KNA A;  1PFB A;  2B2W A;  1EIG A;  2B2T A;  1DOK A;  2VXW A;  1QG7 A;  1U4M A;  3DM1 A;  1AZP A;  3GV3 A;  1ZXT A;  4UAI A;  4HED A;  1WTP A;  1F9R A;  1BNZ A;  1B53 A;  4LMQ D;  2DY7 A;  4U68 A;  1EQT A;  2B2U A;  3N52 A;  3KUP A;  4OIK A;  1EL0 A;  1F9Q A;  2X6L A;  4MHE A;  4XDX A;  1BBX C;  4QUC A;  2X6G A;  1QNK A;  2B2V C;  1QE6 A;  2NWG A;  5EPL A;  1DOM A;  1B2T A;  3TZD A;  2KOL A;  2B2V A;  4HSV A;  2RA4 A;  2EPB A;  2HDL A;  2L9H A;  1EOT A;  4IUV A;  1BF4 A;  1CM9 A;  4O42 A;  1WTQ A;  2SDF A;  3Q6S A;  3P7J A;  3DEO A;  4IUT A;  5D65 A;  4ZKB B;  1U4L A;  1O80 A;  1SDF A;  5EKI A;  5CMD A;  1HA6 A;  1HHV A;  1JE4 A;  1BO0 A;  1NR4 A;  1IKM A;  1PLF A;  4HCS A;  1X3Q A;  1A15 A;  2HDM A;  2KUM A;  3MTS A;  1DOL A;  1Q3L A;  3TN2 A;  1B4O A;  2MPM A;  1MI2 A;  1ICW A;  3QO2 A;  4HAE A;  1S4Z A;  2NZ1 D;  3I90 A;  2L1B A;  1WTO A;  1HRJ A;  5COR A;  4QUF A;  3F2U A;  2K01 A;  1WTW A;  3D6W A;  1PFM A;  2KED A;  4RWS C;  5EPK A;  1IL8 A;  3FPU B;  1CA5 A;  1C8C A;  1VMC A;  2K1B A;  1MSG A;  2K03 A;  1EIH A;  5EQ0 A;  1ML0 D;  1HUN A;  4ZAI A;  1RHP A;  1HFG A;  1TVX A;  1F9S A;  1O7Z A;  1WD0 A;  3MWY W;  1NCV A;  2HCC A;  1PFN A;  1IKL A;  3I91 A;  2KEE A;  4IUU A;  1RTO A;  1O7Y A;  4OIJ A;  1MSH A;  1X3P A;  1CA6 A;  2H1E A;  2B2Y C;  1M8A A;  1X32 A;  2MGS A;  2RVL A;  2FJ2 A;  1J8I A;  1ILP A;  2B2Y A;  1ROD A;  2X69 A;  2KEC A;  2Q8R E;  1J9O A;  1KNE A;  2N55 A;  4XT1 B;  2EOT A;  3HP3 A;  5T1I A;  3I3C A;  2FIN B;  1LV9 A;  1PDQ A;  4X3K A;  2L4N A;  4X3S A;  2B2U C;  1RJT A;  1U4R A;  4RA8 A;  1U4P A;  5COY A;  2RSO A;  3G7L A;  5E4W C;  5T1G A;  1E0B A;  3IFD A;  1AP0 A;  2FHT A;  2B2W C;  2HCI A;  2K28 A;  4ZK9 B;  1GUW A;  1DON A;  1WD1 A;  1SSO A;  4R9W A;  1XYI A;  2K04 A;  1VMP A; 
#chains in the Genus database with same CATH topology
 1JB7 A;  3RN2 A;  1PTO F;  4LUZ A;  1DJR D;  1L0Y B;  5J39 A;  2PW5 A;  1H95 A;  4ZKC B;  2O5I C;  2NBF A;  2B2T C;  4GLA C;  1SLJ A;  2CQO A;  4P75 A;  3T16 A;  5DNF A;  1SE2 A;  2AQ1 B;  1SNO A;  3BDO A;  2LMC B;  1XJV A;  4TSS A;  1WTH A;  4EVO A;  2K05 A;  2F1M A;  2K5Q A;  2R7F A;  4DAY B;  5I9P A;  2JA6 B;  4LF5 L;  4R8I A;  3C1E A;  3UI2 A;  1X6O A;  1AW7 A;  1EU3 A;  1HUM A;  3A0J A;  3ND8 A;  3J7A 5;  1YEZ A;  1D5Z C;  2F0N A;  1HZB A;  2PQE A;  4UP8 A;  1Y1V H;  4M8A A;  3ZYY X;  5IWA L;  1U4M A;  2MO0 A;  4B3M Q;  1XNR Q;  4KV6 A;  4KY6 A;  1SJE D;  1Z7T A;  5LMU Q;  2ICE C;  2F0O A;  2PZT A;  2X6L A;  4A3G G;  3CC7 A;  4C1N I;  2F0P A;  2FMC A;  5M9O A;  1B2T A;  1L1O B;  4GOP B;  3FEW X;  3KF8 B;  1C0A A;  2NVQ B;  2YV5 A;  5EKI A;  3TRE A;  3U50 C;  2EXD A;  2JXM B;  4A3B B;  1G6P A;  4POG A;  1QZH A;  4XQN A;  2D0P A;  1KLU D;  1T5X D;  3TP6 A;  2K75 A;  4BY1 G;  3H3V I;  1PZI D;  1CHQ D;  3NEN A;  4KI0 A;  3PIO 3;  1CHP D;  4ZUJ A;  2ZXP A;  1UE6 A;  4A3L H;  4S3S A;  5FLM G;  1S72 A;  1STA A;  5IOD A;  4Q0F A;  1SJH D;  4P72 A;  1ML0 D;  5GAH C;  2JA7 H;  5F2D A;  2GA4 B;  4PZ8 A;  2UXC Q;  1IW7 C;  3GQB A;  1IKL A;  1RDP D;  4F87 A;  1EYC A;  2RVL A;  1QUQ B;  3M9B A;  2MUY A;  3TDQ A;  3OIQ A;  4JI6 Q;  1A6X A;  5IP7 G;  1SMY D;  4P74 A;  1ZYR C;  5COY A;  4APV A;  4OXP A;  2ZTD A;  2UUB Q;  3I4M G;  4OHJ A;  3KF6 B;  3G6E A;  1GUW A;  3A55 A;  3S14 H;  3GTP H;  1GHK A;  4LF4 Q;  2R92 H;  4JC0 A;  4QY7 A;  5M3M G;  3FPP A;  4A93 B;  4A76 A;  2LKV A;  3J80 c;  1PYW D;  1I3Q H;  3S14 B;  1WCM G;  3K59 A;  4DR7 L;  2F3W A;  1TWG H;  5G3L D;  1U9R A;  4LUV A;  1WOC A;  3ND9 A;  3ONA B;  1HFN A;  4LF7 Q;  4BBR H;  3UDX A;  1XTD A;  4A3M B;  2VB2 X;  3B6Y A;  3CCL A;  1NTG A;  1E2Z A;  1SRU A;  3VYS A;  3M85 A;  1E3P A;  1EFI D;  5M5X B;  4DGZ A;  2Z8L A;  3HOY H;  3HOW B;  1PFB A;  2AKW B;  4JOI A;  1PFS A;  4UP7 A;  5C4Z A;  1FL0 A;  1CKO A;  1L2F A;  1WTP A;  3A7A B;  4C2M H;  4JI4 L;  3VR4 A;  5HUR A;  5A2Q E;  1H9R A;  4GN3 B;  3N52 A;  1F9Q A;  1PTO B;  3CPW A;  2Q8I B;  1PH6 A;  3K80 C;  4V0B A;  2HDL A;  3ITP A;  2D5D A;  1K9M C;  2UXD L;  2EYJ A;  2F0K A;  3S2D H;  1X56 A;  3OHX C;  2PI2 A;  4YCU A;  2I5M X;  5C4X G;  4XQJ A;  1HH2 P;  1CKN A;  2K5N A;  2VQE Q;  5IIF A;  1PZK D;  2MO1 A;  5JEA G;  3TRZ A;  3U9O A;  4JV5 L;  1IHZ A;  5IWA Q;  3OIP A;  4BY7 H;  1TS4 A;  4DUY Q;  1YI2 A;  5IYC G;  5LMN L;  2C35 B;  1AE2 A;  3L0O A;  1UUP A;  5LMU L;  1BKB A;  2JE6 I;  3HOY B;  5M5X H;  2YTY A;  5I2X A;  4JI7 L;  1BCP C;  3RLN A;  4FP5 D;  4WFN 3;  1MHW C;  2F4V L;  1ROD A;  2IT1 A;  2NN6 H;  3FRP B;  4ME5 A;  3GTM B;  1JWM D;  4JBK A;  1KNE A;  2N55 A;  3OW7 A;  2XVS A;  1ENF A;  1PRT F;  4X3S A;  2CFM A;  3HOX B;  1HZ9 A;  4X64 Q;  1U4P A;  2RSO A;  1AEX A;  1HTL D;  5M5W B;  3S16 H;  2OT2 A;  1KHI A;  4ZK9 B;  2OQK A;  4LF6 Q;  1HNZ Q;  3M7N A;  1HZC A;  2VB3 X;  2R7Z H;  2EQS A;  3CP0 A;  3DUZ A;  1YHQ A;  2N88 A;  5M5Y B;  3H94 A;  1A63 A;  3GTL H;  1EY4 A;  4G57 A;  5C5L A;  2AQ3 B;  4JG2 A;  4DA2 A;  1VQ6 A;  2UXC L;  4HMI A;  2C9O A;  2IJ0 A;  4K8I A;  4BBS G;  1IBK L;  1QWY A;  2FFK B;  1SE8 A;  1HTP A;  3NQI A;  1CZG A;  5I6Y A;  5EJW A;  2B63 G;  3BS1 A;  2K5W A;  4MIU A;  3STB D;  4RH6 A;  2K5V A;  4F8M A;  5TSS A;  4A3F H;  2PI2 E;  2E74 C;  2Z6B A;  3AFP A;  4LMQ D;  1I6V C;  4YY3 L;  1EQT A;  4CBV A;  1Y8P B;  3QB3 A;  2IW3 A;  4YHH Q;  1CT1 D;  2N78 A;  1GUS A;  3QR8 A;  4HSV A;  4N9P A;  1B9M A;  4A3E B;  1IYU A;  1U4L A;  4K8J A;  3CC2 A;  1HHV A;  1QJO A;  5JJI A;  4DR1 L;  3I56 A;  3SE0 A;  4BY1 B;  3AMU A;  4A3G H;  1Q3L A;  5NUC A;  5C3W A;  2NZ1 D;  3I90 A;  3NXW A;  3U4V A;  2JA8 H;  1KRS A;  4EQ5 A;  1JJC B;  2G5D A;  3KJP A;  4KHP Q;  3D6W A;  1JB3 A;  1STN A;  4DV3 L;  1HXY D;  3IFT A;  2HHH L;  1IYV A;  3DWQ A;  1V1P B;  4JPB W;  2K50 A;  2K1B A;  1V9P A;  2RBM A;  5GAD C;  2JJQ A;  4DV6 L;  3SDZ A;  2VUM B;  4ILW A;  4IUU A;  3GTG H;  5M5Y H;  1WYD A;  4B3S Q;  4NMZ A;  3OW2 A;  2TMP A;  1N36 L;  3I4M B;  4WJ3 M;  3RUZ A;  4Y7N H;  1XMQ Q;  3PIP A;  1GUN A;  1CFM A;  2KHJ A;  4JW0 A;  5C4H A;  1Y8O B;  2HCI A;  2A74 C;  3EJI A;  3I55 A;  1TXY A;  3HOW G;  1DM0 B;  4C3H H;  3MC0 B;  1GD7 A;  2D2C C;  3VR5 A;  4DV7 Q;  1HNW L;  4IPC A;  3ULP A;  2R7D A;  3FDT A;  2Q2U A;  3I4N G;  3OYY A;  2WB1 B;  3QOJ A;  3I2Z A;  2R7Z B;  2F03 A;  3R93 A;  1CKM A;  1XXG A;  2BH2 A;  4EQN A;  3SXH A;  2JA6 H;  5M3F B;  4UHV A;  1EIF A;  1JOO A;  4XT3 B;  5E4X A;  2HIV A;  1PVO A;  3J7Z C;  1TKW B;  1PH1 A;  1B3Q A;  3PO2 B;  5KND A;  4JI1 L;  4DR2 Q;  5EPJ A;  3E3X A;  2Q2I A;  1IW7 D;  3I8Z A;  5KEE A;  3L7Z C;  1TWH H;  1Q86 C;  1BDO A;  1CSQ A;  3GV3 A;  4J15 A;  5IGG A;  4UAI A;  2Z4I A;  1K73 C;  4KY7 A;  2D0O A;  3HGB A;  1EEI D;  1BUV T;  1PTO H;  2H4O A;  1BCP B;  3G48 A;  3WOF A;  3BZD B;  4XDX A;  4QGU A;  5JPM C;  2EYF A;  1DOM A;  4AYB G;  2CQA A;  3RLF A;  1IBL L;  5DM7 3;  4IUT A;  4A3J G;  2WB1 E;  3L9A X;  4IQZ A;  5CV4 A;  1K8M A;  5LMN Q;  3NBI A;  4K0K Q;  4KKU A;  1R9T H;  3CCV A;  3DMU A;  1K83 H;  3QO2 A;  3CCQ A;  2WAQ E;  4IJH A;  4FXK C;  2GVA A;  1CQF A;  2F0U A;  1Q81 C;  1FD7 D;  1VQF A;  4DV5 Q;  2E75 C;  3A8I E;  4UPA A;  5JEA J;  2G9H D;  2ES2 A;  3I4M H;  3KLS A;  3CXC A;  1CA5 A;  2QKI C;  3GD7 A;  5H1S E;  1STE A;  5IGE A;  1VQP A;  5J1Z A;  2UXB Q;  2HCC A;  2LXJ A;  2BDO A;  4LFC Q;  3I4L A;  1VQD A;  3H09 A;  1FVI A;  4OO1 I;  1QNU A;  4NP5 A;  3G6J B;  3ERQ A;  3HP3 A;  3I72 A;  1LV9 A;  4X3K A;  1RJT A;  2PNR C;  5HGT A;  4A3D G;  4RG1 A;  4BBR G;  3F1Z A;  5IE8 A;  1DON A;  2KEN A;  4O2D A;  3D0F A;  3UDG A;  4DNI A;  1G8Z D;  1O7I A;  5FLX L;  1NNX A;  4H44 C;  1SYF A;  3S9W A;  1A3V A;  1IXR A;  4DV0 L;  3S24 A;  3F2D A;  4K5X A;  4RAU C;  4X3U A;  5CV8 A;  3DHQ A;  3FKI G;  2N3S A;  1X3F A;  1AN8 A;  4UDU C;  3U4Z A;  1S5E D;  1ZEQ X;  1ASZ A;  4RFB A;  3K5M A;  5CBA E;  3AB9 A;  1NSN S;  4RGN A;  4DN4 M;  5IYC H;  4BWG B;  3N6R A;  2F0D A;  2VL6 A;  4PQX A;  1R4P B;  1WI5 A;  1JOQ A;  2IPK D;  1G91 A;  1SAP A;  2J7Z A;  1D5M C;  3RZD B;  3H91 A;  1BCP D;  3E6Z X;  1XNQ Q;  3F2B A;  4MTK A;  3JAM i;  5DEH A;  4FF1 A;  3HOV B;  3F2C A;  1LT6 D;  4MZ9 A;  2ZXO A;  1S3O A;  2UXD Q;  1EWH A;  1PH4 A;  3D6C A;  2CW0 D;  3TP7 A;  3TZU A;  4LAA A;  5AJ3 L;  4JK1 C;  2L9H A;  2GVB A;  3CF5 A;  3PUX A;  1Y1V B;  2NB0 A;  4Q5V A;  3V2T A;  4KN4 C;  1BO0 A;  1TWA H;  2SNS A;  3EN2 A;  1A15 A;  4A3I H;  4FF3 A;  2OEO A;  4A3K B;  1Y1W G;  1EYD A;  1KC8 C;  2Y0S G;  4XXE A;  1SNM A;  3VDY A;  1SYC A;  3T56 B;  2B8G A;  2NVX B;  3URY A;  4RWS C;  1BR9 A;  2F4V Q;  4KHZ A;  1DCZ A;  1YNJ C;  4OWT B;  1HQM C;  4DR6 L;  2V4D A;  3SK8 A;  1NY4 A;  3HOV H;  1RHP A;  3VR3 A;  1TVX A;  2E2I B;  1JWU D;  5C0X G;  3NP8 A;  2JA8 G;  1KDA A;  1NCV A;  4BA1 I;  1II3 A;  4HID A;  3S2D B;  4DXF A;  1YHA A;  3S1R H;  4DXG A;  2ZM6 L;  1X55 A;  1GM5 A;  2X69 A;  4LF6 L;  4C56 C;  2IX1 A;  3HOZ H;  1FGU A;  2B2U C;  3PV0 A;  5KYL A;  1NMG A;  3FVQ A;  1LTT D;  3A8J E;  3Q23 A;  2I0Q A;  1SYB A;  3IFD A;  5CC4 A;  3VA5 A;  4TVA B;  1FNW A;  2KCN A;  1SFO H;  1TWG B;  3ZJY C;  2ICI A;  1CUK A;  1GKH A;  2K04 A;  1NUC A;  1B8A A;  1SND A;  3DEP A;  1J5E Q;  1SE3 A;  2R3Z A;  3A5Z B;  4MN3 A;  1XPU A;  3RZO B;  2JN4 A;  1YZ6 A;  2UXB L;  1H9K A;  1ILQ A;  2NYZ D;  1JR0 D;  4H0L C;  4GZY C;  4IUP A;  1KQS A;  3VR6 A;  1NAP A;  4DV1 L;  1ZYR D;  4NDX A;  5I6W A;  4EQP A;  4BY1 H;  4CJ1 B;  4J8Q A;  5HGQ A;  2QA4 A;  4RKL A;  1SN8 A;  4XYQ A;  5LMN W;  1RCV D;  3J81 i;  5FLM H;  1DOK A;  2EY6 A;  1ZXT A;  4A3M G;  3NHH A;  2WB1 G;  1RKN A;  4P73 A;  5GQO A;  5C4J H;  3BZC A;  4DR1 Q;  2EYM A;  5GRO A;  1I5F A;  1Q46 A;  1VCI A;  1OXS C;  4HN7 A;  4C3H G;  1PYB A;  2NZO A;  2ZT9 C;  2B2V A;  4HCE A;  4I7A A;  1VQL A;  3BYT B;  3ERO A;  1T9H A;  1V1Q A;  1K8G A;  2UU9 L;  5D3I B;  1HA6 A;  3BDC A;  4JBJ A;  3R8B A;  4C3J G;  2EXZ A;  4IPG A;  3OWF A;  1O7L A;  4HMJ A;  1MJE A;  3NWT A;  2MPM A;  4KMU C;  1ICW A;  4HAE A;  2JA5 G;  5ELF A;  1S5F D;  2B3G A;  1VQJ A;  2EY5 A;  1AFP A;  1RF2 D;  1X3G A;  4RCO A;  4A3J H;  1QVF A;  2VS1 A;  4AQY L;  3NQT A;  2EJF C;  1EWI A;  5FLX c;  1IL8 A;  4JI6 L;  1N36 Q;  3GTM H;  4NB3 A;  1F9S A;  5FKA C;  5JVG 3;  1WD0 A;  1I94 Q;  4RCN A;  2XSC A;  3I91 A;  3NSW A;  1O7Y A;  3MXN B;  4OIJ A;  4RGM A;  2H1E A;  4JI0 Q;  5IP9 G;  1U5K A;  4R4C A;  4QJF A;  3KYH C;  1X65 A;  1FGB D;  2JA6 G;  4POF A;  1PDQ A;  1Z9F A;  4XIG S;  3VR2 A;  5T1G A;  2M00 A;  4EX5 A;  4ID6 A;  4LUO A;  1YNN C;  4DR7 Q;  2LFN A;  2VY3 A;  1RIP A;  1Q82 C;  3T13 A;  5KNC A;  3UE0 A;  2QEX A;  4R9W A;  4A3K H;  1XPR A;  2WKD A;  2WII B;  1QIL A;  3CCJ A;  1QVC A;  2A19 A;  1I4G A;  2MNA A;  4IJL A;  1CI3 M;  2DNE A;  3SGI A;  3LWU A;  2XIW A;  1VQE A;  1G6Z A;  4X3T A;  3S1M B;  2F0M A;  4C1N K;  1Y8N B;  2LY7 A;  3K58 A;  2JA5 B;  1R4Q B;  5FO7 B;  2RCN A;  5M5W H;  4KY5 A;  4MNO A;  2MQH A;  1JQY D;  1E24 A;  4QF4 A;  3K81 C;  3L2P A;  2A68 C;  2G9D A;  1KDB A;  2JK8 A;  1K3R A;  1LLR D;  2AWO A;  3M4Q A;  4HIO A;  1N34 L;  2LS0 1;  5C44 G;  3J7A F;  2ENB A;  3I70 A;  1DXM A;  2I5L X;  2NN6 I;  2WAC A;  3IAY A;  1B9N A;  2F52 A;  4M1U B;  3KDF A;  1SMY C;  4LF4 L;  1N8R C;  1Q1B A;  3Q22 A;  2E76 C;  4GN5 A;  2B2V C;  1SBB B;  5I4D A;  3SR1 A;  1VF7 A;  2NUC A;  3M4Y A;  4A3G B;  1EOT A;  3W1G A;  2O4X A;  3P7J A;  5D65 A;  4CDF C;  4WJW A;  3M3Y H;  2JEB I;  4K5W A;  3OTO L;  1JE4 A;  2IY5 B;  4LF9 Q;  4BXX H;  3STB C;  2KUM A;  3KJO A;  4AH6 A;  2HQE A;  2F0V A;  4A3C G;  2L1B A;  4WJ4 A;  3ICE A;  1ONL A;  5C3E H;  2L15 A;  4BBS B;  1PHJ A;  1PRT B;  3G71 A;  1GXD C;  2IHF A;  2NVY B;  3EQL C;  5EPK A;  2ZXR A;  3EBE A;  2JA8 B;  4DV4 Q;  1VMC A;  1O78 A;  4C3I G;  5I2Y A;  2F3V A;  1Y1W H;  2MFI A;  2CHB D;  2F0Q A;  1N32 L;  3CME A;  4HJA A;  3IRB A;  4WOR A;  1CA6 A;  4OWX B;  3D4W A;  5FK9 C;  2MGS A;  3KDF B;  3P20 A;  1GUO A;  2YTX A;  3S1N B;  1N33 L;  2KEC A;  1Q7Y C;  4E6I A;  2XNA C;  1LAC A;  1IL2 A;  2L4N A;  1VQC A;  3K8A A;  1L0W A;  4ULL A;  1CTM A;  2A8V A;  2Y0S B;  2NTS A;  2V1C C;  4AYB B;  4A3F G;  2NVT H;  2ALY B;  3HRZ C;  3FMC A;  3O13 A;  5BN3 A;  4X65 Q;  4PV1 C;  2C5C A;  4LNQ A;  2L11 A;  4TKO B;  3PUY A;  4NW2 A;  4LFA Q;  4DR4 L;  2A5H A;  2KBN A;  4K2K A;  1I6H B;  2AQ2 B;  3LWE A;  1NJI C;  3T51 B;  1S5B D;  2AUK A;  2PZW A;  4HJ7 A;  3D8G A;  3LX0 A;  4BA2 I;  1KL9 A;  2JYO A;  2JA9 A;  2K52 A;  3BG3 A;  4QCL A;  2KVM A;  3V05 A;  4JI0 L;  1YNX A;  1DGS A;  1YNJ D;  4GKK Q;  5FO8 B;  1HZA A;  4QMG A;  5EKL A;  2EE1 A;  4L5T A;  5G3L F;  2ATW A;  3GTK H;  4A3I B;  1WTX A;  4R1J A;  3S1Q B;  3M4O H;  3M3Y B;  2A1A A;  2WP8 J;  4H13 C;  2E2I H;  1KAB A;  1LTI D;  2R93 G;  1FYC A;  4DV0 Q;  2DY7 A;  1TY2 A;  4OL7 A;  1XTC D;  1GJX A;  4BY7 B;  1HCZ A;  2B2U A;  3KUP A;  1TWF H;  1EOV A;  5KRU A;  4A3D B;  4QUC A;  4A3L G;  5C5M A;  1W6J A;  2JA5 H;  1VDZ A;  4K0K L;  2EPB A;  3S1M H;  1CM9 A;  3Q8D A;  3Q6S A;  1STG A;  5IY0 A;  3JAM E;  3QG1 A;  2OXP A;  1W6K A;  3RZD H;  2RHS B;  1X3Q A;  3CD6 A;  1MIU A;  1JOR A;  1EWC A;  1TS5 A;  4IPH A;  3K0Y A;  1B4O A;  2PCF B;  5IT9 L;  4DV1 Q;  3MEH A;  4PMW A;  1F2Z A;  2PYK A;  3TQY A;  3S17 H;  4JYA L;  4G4K A;  4A3J B;  1G51 A;  1TY0 A;  1LYL A;  3T1H L;  3DWA A;  3GTJ H;  1QOH A;  4C2M B;  5K5P A;  3S2H B;  1D7Q A;  3HKZ G;  4NPS A;  4YWK A;  1F2Y A;  2VUM H;  4QIW B;  4B3R L;  2B8F A;  3T1H Q;  2YYZ A;  1GOZ A;  2Q8R E;  1HNW Q;  1TS2 A;  2KHI A;  1LTB D;  1F2M A;  4OWW B;  3NWS A;  1RD9 D;  1KD1 C;  4KN7 C;  4OEM B;  5KNB A;  4IFD J;  2NTT A;  2HQL A;  1TU2 B;  3OWE B;  4X62 Q;  2XWB B;  2EYP A;  2PZU A;  1OO9 B;  2DJF C;  5E7N A;  3CCR A;  3HOU H;  3PO3 H;  4KHV A;  1STB A;  3S1Q H;  4IFD H;  4JI1 Q;  1DZ1 A;  5C0X I;  1SYG A;  3K57 A;  5D14 A;  4CGY B;  1Y1W B;  1JIC A;  2QW7 A;  5IGF A;  2OTJ A;  2OTL A;  4A3M H;  3T4A C;  1KAW A;  2QDB A;  3MXN A;  1NR2 A;  3H6M A;  1L1O A;  3PF4 A;  2A6H D;  2EDG A;  2Q2H A;  3WWV A;  2B63 B;  5KIX A;  2Z1C A;  1XNQ L;  2CWA A;  2D9U A;  2PMZ E;  2K6A A;  3FKI B;  1XMO Q;  1V43 A;  1VQ4 A;  1ENC A;  1EUJ A;  1OTC A;  2M2L A;  1WVL A;  1LT5 D;  1EIG A;  4IOA A;  2B2T A;  3DM1 A;  4AYB E;  2JA7 B;  2JEA I;  3OSO A;  4HED A;  5CV7 A;  1F9R A;  4FXD A;  2RDH A;  4O1N A;  5JPN C;  2MHV A;  3RR5 A;  3EVQ A;  1E1T A;  5LL6 X;  3TS0 A;  3CKI B;  5C44 H;  2WAQ G;  1ICF B;  4A3K G;  3PF5 A;  1LM0 A;  4IFD I;  3TBI B;  1PH8 A;  1LO5 D;  5IYD G;  4A93 H;  5K36 H;  3J80 E;  4GKJ Q;  4L63 B;  1LUZ A;  3MFG A;  5ELD A;  3KK7 A;  1B1Z A;  3R2T A;  4YCW A;  1D8L A;  1S4Z A;  2CH4 A;  3VYU A;  1EY0 A;  1WTO A;  3HFZ B;  4FXG C;  1EIY B;  4DV6 Q;  1WTW A;  1PFM A;  2F0I A;  3S17 B;  2OF1 A;  3P1H A;  2K14 A;  4BXX G;  4K2L A;  5JVH 3;  4GLX A;  2K03 A;  4X66 L;  3C46 A;  3HZX A;  1VQK A;  3D3R A;  1K0S A;  2J4X A;  3U58 A;  1YJN A;  3CRK C;  2O2L D;  1DD2 A;  3HOU B;  3PO3 B;  1J8I A;  2KCC A;  2ZJQ A;  4FF4 A;  2F0E A;  5ELO A;  1EY6 A;  3P75 A;  5FO9 B;  1SFO B;  3PO2 H;  4RGO S;  5T1I A;  3S16 B;  5FJ8 H;  1GUG A;  3GDE A;  5I9O A;  1KDC A;  3GTQ B;  1V8Q A;  1TR5 A;  3OTO Q;  2QEJ C;  4KTA A;  2B29 A;  4LF9 L;  1W3S A;  1E2W A;  1LAB A;  4CKE A;  5ELB A;  5CYU A;  1TS3 A;  3I4O A;  1I50 B;  2PNH A;  5ELC A;  3GTG B;  1QB5 D;  1EQR A;  5A35 A;  5CBE E;  4A75 A;  5M3F G;  2Q8T A;  2E2J B;  4IAL A;  3S2H H;  1HA5 A;  1QZG A;  3GTO B;  1F2L A;  3WDN A;  2CKZ B;  1AZQ A;  3NTI A;  3E9H A;  2A73 B;  1TWF B;  3VYT A;  5FLX E;  1Q1E A;  3GV6 A;  4EGV A;  3J7Y W;  3KBX A;  4A3I G;  2HT1 A;  2KQ3 A;  4DK0 A;  3MXU A;  4HJ9 A;  2N8N A;  1WCM B;  2A6E C;  4DKA C;  3K7A H;  1OXX K;  4ZCK A;  1I4H A;  1WTV A;  3U9S A;  1ESR A;  3KF6 A;  3C1F A;  4DUZ L;  4HR7 B;  1AZP A;  3NBH B;  3K5L A;  4F7X A;  4N8F A;  3PCO B;  4P2C B;  3TSS A;  4FF2 A;  1VQB A;  4C3J B;  5C4X B;  1B70 B;  2CCZ A;  2RKS A;  5EGT A;  4FYD A;  4X65 L;  1XYI A;  5CV6 A;  3V96 A;  4DK3 C;  4ALP A;  2ZJR A;  2Y0S E;  4G7Z C;  5EPL A;  3E0E A;  2RA4 A;  4NXM L;  4GOP C;  3R2I A;  1VQO A;  4O42 A;  3T1Y L;  2SDF A;  3D4R A;  3H0G H;  2UUA Q;  3J7A V;  1AE3 A;  5CMD A;  1Q12 A;  1IKM A;  1C7Y A;  2L0C A;  4HIM A;  1DYQ A;  3NUC A;  1H9J A;  3S15 H;  4NXN L;  5BN5 A;  4GKK L;  4RHS A;  4CKB A;  1D2B A;  3IKJ A;  4U67 3;  1HR0 W;  3F2U A;  2PPB C;  2KED A;  1EY9 A;  4LFC L;  2F0S A;  1C8C A;  2IX0 A;  1K3B C;  3S15 B;  1F77 A;  2SEB D;  3S1N H;  4PG3 A;  4L8J A;  4B3S L;  1SMX A;  2E5L L;  1MD2 D;  1PRT D;  1M8A A;  4I7Z C;  2K33 A;  2YU9 H;  4PZ7 A;  4PMC A;  4LF8 L;  1PV4 A;  1PA6 A;  1KRT A;  3HKS A;  1H9S A;  1VS0 A;  4IFD G;  1ET6 A;  2A68 D;  5IT9 c;  1CK1 A;  4OGQ C;  1JWS D;  4DV7 L;  2CW0 C;  1SYE A;  4YIJ A;  4GNX A;  1P8L A;  2UUC L;  1BOS A;  1UAP A;  2KCT A;  3PGZ A;  4B3M L;  1XNR L;  1E2V A;  1FNV A;  4RMF A;  2PW7 A;  1BCP F;  4P71 A;  1EYA A;  1CSP A;  2BDN A;  4OX9 L;  1I50 H;  1GUT A;  4XQQ A;  1GHJ A;  3KFU A;  2DGY A;  2MP1 A;  1VQN A;  2DJG C;  4CJ0 B;  4KKS A;  1LTR D;  5EBD A;  3AQQ A;  4C3J H;  2RSN A;  1HQR D;  5CV9 A;  5BR8 L;  4JCV E;  3RZO H;  1YNN D;  4N8X 1;  2VW9 A;  2VQF L;  2R92 G;  3S1R B;  1L1O C;  1XX8 A;  3FHW A;  1FJG L;  2ZJP A;  2VUM G;  1TWA B;  3K6O A;  5M3M H;  2JA7 G;  5ELN A;  1PTO D;  3M4P A;  4LWC A;  4KK7 A;  2K5D A;  1QG7 A;  4DAM A;  4K6L A;  5JAV A;  3W3A A;  5L37 A;  1WCM H;  2KJX A;  2UU9 Q;  4A3E G;  2OWO A;  1SRO A;  1QUQ A;  4IN3 A;  2QDL A;  3A7L A;  4A3D H;  3MXG A;  2XGT A;  3W1B A;  4MHE A;  5IP7 H;  2YTV A;  4BS9 A;  3R3O A;  3J81 L;  2D62 A;  4X64 L;  2CWP A;  3CHB D;  1PLF A;  1PZJ D;  1J6Q A;  3KF8 A;  2AHO B;  4L6T B;  3BVM A;  4JI3 L;  1I94 L;  4LK1 C;  3W5O A;  5IGB A;  3ULJ A;  4B3T L;  1PXU A;  3ERS X;  1LT3 D;  2F0L A;  3SK5 A;  1KXL A;  3LGJ A;  5EBC A;  5A2Q L;  5D3D A;  1KTK A;  1I3Q B;  1EIH A;  1B44 D;  1HFG A;  4JI8 Q;  5EAY A;  2KEE A;  1RTO A;  3NK9 A;  1X3P A;  2H5X A;  1X32 A;  2B2Y A;  4X62 L;  1LTA D;  5CGK A;  3FKI H;  4DR5 Q;  4H7B A;  5EKK A;  4XT1 B;  2R6G A;  1JMC A;  2B63 H;  4RKB A;  2FIN B;  3E0J A;  1UE5 A;  2O5J C;  4JYA Q;  5CV5 A;  3RLO A;  4DAY A;  5LHY 1;  1ESF A;  1STH A;  4DR5 L;  1I4P A;  2FMM A;  2I07 B;  5IOC A;  1CZW A;  1TWC B;  3NTH A;  4KD4 A;  1Q8K A;  4CDE C;  5KYI A;  3PUZ A;  2DY8 A;  2TSS A;  1D1K A;  4X66 Q;  3CAM A;  4FDB A;  5GAG C;  4PZ6 A;  2B39 A;  4DU9 A;  4LFB Q;  4FVM A;  2VZA A;  1D5X C;  5BN4 A;  1PH3 A;  1RTN A;  1HNX L;  1JJ2 A;  4LF7 L;  3DM3 A;  2XN9 C;  3I7F A;  2AMC B;  1KNA A;  4NXM Q;  3AU7 A;  1X9N A;  3PO2 G;  3TEH B;  4WRD A;  5IYB G;  4J1M A;  4C3I H;  3HOZ G;  1GO3 E;  3KLW A;  1J5E L;  1VQA A;  1EL0 A;  1BBX C;  4GKJ L;  4NXN Q;  3CCM A;  1YJ9 A;  3A5U A;  1QNK A;  5ISR A;  1K83 B;  2SOB A;  3E5S A;  4XTC S;  1S5D D;  5C0X H;  3WOE A;  2BH8 A;  4OO1 G;  4DFA A;  1SNC A;  1EZ8 A;  1C4Q A;  2EJG C;  2ZTE A;  3ER0 A;  3TN2 A;  4JBM A;  1N32 Q;  1Q90 A;  1NBW A;  3CRL C;  4MTN A;  2KA7 A;  4JI2 L;  1VQ7 A;  1N33 Q;  4BBS H;  2F0W A;  4LF8 Q;  3EFX D;  2BE5 D;  4B3R Q;  1RL2 A;  1BBU A;  1EZ6 A;  2ZM6 Q;  4Z9C B;  1YVC A;  3MWY W;  4G7H C;  3M4O B;  2NVQ H;  4DUY L;  2B2Y C;  4H02 A;  1ILP A;  3MHB A;  4DR2 L;  3KOJ A;  2R93 B;  5GAE C;  2A6H C;  4N9T A;  4ODG A;  1U4R A;  4FO2 A;  4DNT B;  4Y7N B;  3NEM A;  1AP0 A;  2FHT A;  5JOB A;  1YIT A;  3PQI A;  2R93 H;  4B3T Q;  4KJN A;  3Q24 A;  3SVM A;  1WTR A;  1IBM L;  4FNF A;  3CMA A;  3TP5 A;  1HR0 L;  5AFW A;  4DNR B;  4PNY A;  4CDC C;  4HJ5 A;  1FJG Q;  5CR3 A;  3TME A;  1G2T A;  2E2H B;  3J81 c;  2MJ8 A;  1M4V A;  1N34 Q;  1VQ5 A;  1A0I A;  4IOC A;  2E5L Q;  1A3U A;  3NEL A;  2F0T A;  3SHL A;  1EU4 A;  1XWE A;  3HG9 A;  3CQZ H;  3SK6 A;  1HJP A;  1ET9 A;  1G29 1;  3CC4 A;  5IP9 H;  3UDF A;  4IUR A;  2QCP X;  1D1I A;  2CVR A;  5JJZ A;  2WFW A;  2E2D C;  4JI5 L;  1YHB A;  2RHQ B;  5C44 B;  3J80 i;  2UUA L;  4HJ8 A;  3H15 A;  2PO4 A;  2HIX A;  2NVY H;  3T53 B;  4L5R C;  4A3B G;  3PIO A;  2X6G A;  1M90 C;  4LFA L;  2RDF A;  4DR4 Q;  2FXQ A;  4Y52 H;  1I6H H;  1BF4 A;  4HSP A;  2YU9 B;  1W2B A;  3HOW H;  3C3L A;  1OXU A;  4JI4 Q;  1GVP A;  3NBH A;  2R92 B;  2EVB A;  2UUB L;  3MEF A;  1XMO L;  1DOL A;  4B9X A;  1V1O A;  3H3V H;  3HS0 C;  5IT9 E;  3MAQ A;  2A69 D;  1N9W A;  1FR3 A;  5COR A;  1PH2 A;  4QUF A;  1SNP A;  3Q0A A;  4KLK A;  3JAM L;  1L0X B;  3MVV A;  2NZH A;  4JVZ A;  3VYR A;  1VQ8 A;  4B08 A;  4DR3 Q;  5DLQ E;  1HUN A;  4ZAI A;  1PMR A;  2DUD A;  2WKC A;  3J80 L;  1TT2 A;  1MSH A;  1VQ9 A;  1YBY A;  3QIA A;  3QJY A;  2XWJ B;  4A3E H;  3PUW A;  3T1Y Q;  2EZV A;  4GNX C;  2EJM A;  4PMB A;  3W2D A;  1QCB D;  3K0X A;  4OX9 Q;  5C4X H;  5E4W C;  4R8N A;  2A6E D;  4IZ8 A;  4K6D A;  2WAQ B;  2CH4 W;  1A62 A;  3TS2 A;  1E22 A;  3F8T A;  4ABN A;  3RN5 A;  3AEV A;  1B7Y B;  1TWH B;  3X3N A;  5J22 A;  3HEJ A;  1ASY A;  2KHS A;  2BA1 A;  2I46 A;  4AIM A;  1IZ6 A;  4YCV A;  2VNU D;  3NTK A;  1HNX Q;  1JOK A;  4ZYS A;  3C2P A;  1ENA A;  4CJ2 C;  2RQX A;  4GLV B;  5ELE A;  4IUQ A;  1B3A A;  5IGD A;  4ZRZ A;  3MFY A;  3QWN A;  2R61 A;  4QQB X;  2ZTC A;  2E2H H;  1S40 A;  1QVG A;  1I4R A;  2QIL A;  4RGT A;  3NE5 B;  4KHP L;  2IHE A;  2JP1 A;  3E9I A;  3IL8 A;  4O0A A;  2F3I A;  3A56 A;  4L5S A;  1G2S A;  2L12 A;  3CU7 A;  4LF5 Q;  4DF7 A;  2VXW A;  4C3H B;  5JJL A;  1K8A C;  4J6H A;  3A8K E;  1EEF D;  1B53 A;  4A3C H;  2R7Z G;  3AYH B;  1IBM Q;  2LSS A;  2EYL A;  3HOZ B;  4CKC A;  4LW1 A;  3LNN A;  1VQH A;  4JI7 Q;  3BJU A;  3SEB A;  3UDI A;  4DAV A;  1KLG D;  1PRT C;  1C48 A;  4B9W A;  4R4T A;  1SDF A;  1EFW A;  1U0L A;  3PMF A;  5M3M B;  2WV6 D;  4HCS A;  3G4S A;  1EQQ A;  3D4D A;  5LL6 S;  2IX3 A;  5C6A A;  1MI2 A;  1MJC A;  1KIX A;  1E1O A;  1EQV A;  3CCS A;  1BBW A;  3QOL A;  4UP9 A;  4BBR B;  1HRJ A;  2XTI A;  2K01 A;  4JI8 L;  2VQE L;  5KGU A;  2N49 A;  3RD4 A;  5JJK A;  5M3F H;  1EY8 A;  3FPU B;  4A4I A;  1LTL A;  1K0R A;  3BVZ A;  1MSG A;  4XYO A;  3OMC A;  1VF5 C;  4DV5 L;  2Z6K C;  3HOX G;  1PFN A;  4L5Q A;  3DLL A;  3OPO A;  1K8O A;  1PH5 A;  1SEB D;  2F0G A;  1ZKO A;  3SK4 A;  3GTK B;  1I4Q A;  3M7G A;  3CPF A;  2UUC Q;  1JC7 A;  3X3M A;  1P16 A;  4RA8 A;  3G7L A;  2B2W C;  4OEL B;  4UY8 C;  3UE1 A;  4DK1 A;  1SSO A;  5E1F A;  2PQA B;  5C3E G;  1NE3 A;  1TWC H;  2J0T D;  1SXT A;  3MXP A;  4ZLT F;  4LFB L;  1EY7 A;  3J81 E;  2EY2 A;  1JE5 A;  4R4Q A;  4ME3 A;  3D31 A;  2AWN A;  1F9P A;  3BVG A;  1B50 A;  2BOS A;  2K4K A;  1TQO A;  1JJG A;  2BE5 C;  1D6E C;  4TRD A;  4C3I B;  1EY5 A;  1LTG D;  3KLS X;  4A3B H;  3HOV G;  4R4O A;  4AQY Q;  1XPO A;  2I5H A;  4OO1 H;  3H0G B;  1Y69 U;  3HKZ E;  4OON A;  4JV5 Q;  1STY A;  1SYD A;  1UEB A;  3I73 A;  1KAA A;  4QL5 A;  1BNZ A;  2BA0 A;  4U68 A;  3I4N H;  2PQA A;  4ZUI A;  5IGC A;  1LT4 D;  1Y1V G;  5HY6 A;  4DAP A;  4CDD C;  4F88 A;  3VA7 A;  2KOL A;  4R4I A;  4JI2 Q;  1R9T B;  2E2J H;  3GTL B;  1PH9 A;  2Q2T A;  3DEO A;  1XMQ L;  3BYY B;  3K5N A;  3OOC A;  3K7A B;  2HDM A;  1NMF A;  2JQO A;  3MTS A;  4EQO A;  4X6A H;  5BR8 Q;  2QF7 A;  2ASB A;  3PSI A;  1A2U A;  4DK6 C;  1IBL Q;  3KLR A;  1PYS B;  2DN8 A;  4GS3 A;  3MA2 B;  3NPP A;  1V1P A;  1T5E A;  3BZK A;  2F0J A;  2RF4 A;  2WIN B;  2BCO A;  5FOB B;  1YJW A;  1JT8 A;  4DV3 Q;  4ZQ3 A;  2DNC A;  3HOU G;  3A74 A;  3PO3 G;  3GO5 A;  4QIW E;  2OQ0 A;  2QGQ A;  5C0X J;  1UNS A;  2FJ2 A;  1IBK Q;  1E7Z A;  3CW2 C;  2K32 A;  1Z47 A;  2F0H A;  3GP7 A;  1HPC A;  4YWL A;  4DV2 Q;  2EOT A;  5DM6 3;  3GTQ H;  4GOP A;  3EIV A;  1HR0 Q;  4V19 0;  2NVX H;  2AUJ D;  1C9O A;  3J81 j;  4JI3 Q;  1VQI A;  1MBY A;  3EA6 A;  3AFQ A;  4A93 G;  3JAM c;  2RDG A;  3H3V C;  5IYD H;  5K36 G;  4DV2 L;  2Z9H A;  2EIF A;  2HUG A;  1M1K C;  5AJ3 Q;  4KJO A;  1EYG A;  2KCM A;  1HNZ L;  1YIJ A;  4YHH L;  2NVT B;  1H9S B;  1SR3 A;  4KD3 A;  2A69 C;  2EY1 A;  2P5Z X;  4DPG A;  1A3T A;  4JBW A;  2PMZ B;  2Z6K A;  2E8G A;  5C3X A;  1WFQ A;  4DR3 L;  4LJZ C;  5JEA H;  1SNQ A;  4RHR A;  5C4J B;  3I4N B;  2IL8 A;  1IYJ B;  1H9M A;  2GN5 A;  1BQQ T;  4IPD A;  5J3B A;  1BXT A;  1MGS A;  1MKH A;  2K5H A;  2IWH A;  3CCE A;  1Z6H A;  1BVS A;  1UEA B;  1UWV A;  3KBG A;  3MZ5 A;  4NKL A;  2B2W A;  1UE7 A;  4I65 A;  3FP9 A;  1X54 A;  3L3O C;  2JSO A;  3K7U C;  1WJJ A;  5FJ8 G;  3A54 A;  4QB4 A;  1A2T A;  3ULL A;  1UE1 A;  1AH9 A;  4OIK A;  2ID0 A;  3HOY G;  3TP8 A;  1QE6 A;  1I4X A;  2NWG A;  3TZD A;  2Z0S A;  4A3F B;  4IUV A;  4K5V A;  1WTQ A;  1LTS D;  2K7V A;  2XRQ D;  4ZKB B;  4YY3 Q;  1O80 A;  4BY7 G;  4GN4 B;  2EYO A;  4TQU S;  1NR4 A;  4HIK A;  4G7O C;  1VQG A;  1X3E A;  2M9V A;  1TII D;  1Q8I A;  4JOI C;  3GTP B;  2SNM A;  1CQV A;  4HTH A;  4GNX B;  3DXJ C;  2LXK A;  3JC6 6;  3K5O A;  1OXV A;  4DUZ Q;  2OCE A;  2EYH A;  4JI5 Q;  1FNU A;  2VQF Q;  3CCU A;  1S5C D;  3PUV A;  5E3F A;  1A8V A;  2NN6 G;  5C3E B;  3DWP A;  2L55 A;  3OMG A;  5DAU A;  5EQ0 A;  1K28 A;  1VQM A;  4IO9 A;  1O7Z A;  4IUN A;  2HD3 A;  4CHT B;  3RNU A;  4DV4 L;  1JCK B;  2Z4H A;  2HHH Q;  1PTO C;  3CQZ B;  4K14 A;  2XRS D;  3RMH A;  3PIP 3;  1J9O A;  2F4I A;  3BDL A;  3GTJ B;  4DR6 Q;  3I3C A;  1Y14 B;  1OXT A;  2RCF A;  3HKZ B;  4YWM A;  3HOX H;  1PH7 A;  3BU2 A;  1E0B A;  2L5T A;  2K28 A;  4KKT A;  1SE4 A;  5IYB H;  1WD1 A;  3GTO H;  3H0G G;  1CKN B;  2F0F A;  1VMP A; 
#chains in the Genus database with same CATH homology
 1PTO F;  1DJR D;  1L0Y B;  5J39 A;  2PW5 A;  4ZKC B;  2O5I C;  2NBF A;  2B2T C;  3T16 A;  5DNF A;  1SE2 A;  2AQ1 B;  1SNO A;  3BDO A;  2LMC B;  4TSS A;  4EVO A;  2K05 A;  2F1M A;  2K5Q A;  5I9P A;  2JA6 B;  4R8I A;  3C1E A;  3UI2 A;  1EU3 A;  1AW7 A;  1HUM A;  3ND8 A;  1D5Z C;  2F0N A;  2PQE A;  4M8A A;  3ZYY X;  1U4M A;  4KV6 A;  4KY6 A;  1SJE D;  1Z7T A;  2ICE C;  2F0O A;  2PZT A;  2X6L A;  4C1N I;  2F0P A;  2FMC A;  5M9O A;  1B2T A;  3FEW X;  2NVQ B;  5EKI A;  2JXM B;  4A3B B;  4XQN A;  1KLU D;  1T5X D;  3TP6 A;  1PZI D;  1CHQ D;  4KI0 A;  3PIO 3;  1CHP D;  4ZUJ A;  2ZXP A;  4S3S A;  1STA A;  5IOD A;  4Q0F A;  1SJH D;  1ML0 D;  5F2D A;  2GA4 B;  1IW7 C;  3GQB A;  1IKL A;  1RDP D;  4F87 A;  1EYC A;  2RVL A;  2MUY A;  3TDQ A;  3OIQ A;  1A6X A;  1SMY D;  1ZYR C;  5COY A;  4OHJ A;  1GUW A;  3A55 A;  1GHK A;  3FPP A;  4A93 B;  2LKV A;  1PYW D;  3S14 B;  3K59 A;  2F3W A;  5G3L D;  1U9R A;  3ND9 A;  3ONA B;  1HFN A;  4A3M B;  2VB2 X;  1E2Z A;  3VYS A;  3M85 A;  1EFI D;  5M5X B;  4DGZ A;  2Z8L A;  3HOW B;  1PFB A;  5C4Z A;  1WTP A;  3A7A B;  3VR4 A;  5HUR A;  5A2Q E;  1H9R A;  3N52 A;  1F9Q A;  1PTO B;  2Q8I B;  4V0B A;  2HDL A;  3ITP A;  2D5D A;  2EYJ A;  2F0K A;  3OHX C;  4XQJ A;  5IIF A;  1PZK D;  5JEA G;  3U9O A;  1IHZ A;  3OIP A;  1TS4 A;  1UUP A;  2JE6 I;  3HOY B;  5I2X A;  1BCP C;  4FP5 D;  4WFN 3;  1ROD A;  2IT1 A;  2NN6 H;  3FRP B;  4ME5 A;  3GTM B;  1JWM D;  1KNE A;  2N55 A;  3OW7 A;  2XVS A;  1ENF A;  1PRT F;  4X3S A;  3HOX B;  1U4P A;  2RSO A;  1AEX A;  1HTL D;  5M5W B;  2OT2 A;  4ZK9 B;  3M7N A;  2VB3 X;  3DUZ A;  2N88 A;  5M5Y B;  3H94 A;  1EY4 A;  4G57 A;  5C5L A;  2AQ3 B;  4DA2 A;  4HMI A;  2C9O A;  2IJ0 A;  4K8I A;  1QWY A;  2FFK B;  1HTP A;  3NQI A;  1CZG A;  5I6Y A;  5EJW A;  3BS1 A;  2K5W A;  4MIU A;  4RH6 A;  4F8M A;  5TSS A;  2E74 C;  4LMQ D;  1I6V C;  1EQT A;  4CBV A;  1Y8P B;  3QB3 A;  2IW3 A;  1CT1 D;  1GUS A;  4HSV A;  4N9P A;  1B9M A;  4A3E B;  1IYU A;  1U4L A;  4K8J A;  1HHV A;  1QJO A;  3SE0 A;  4BY1 B;  3AMU A;  1Q3L A;  5NUC A;  5C3W A;  2NZ1 D;  3I90 A;  3NXW A;  3D6W A;  1JB3 A;  1STN A;  1HXY D;  3IFT A;  1IYV A;  3DWQ A;  1V1P B;  2K1B A;  2RBM A;  3SDZ A;  2VUM B;  4ILW A;  4IUU A;  4NMZ A;  2TMP A;  3I4M B;  3RUZ A;  1GUN A;  1CFM A;  5C4H A;  1Y8O B;  2HCI A;  2A74 C;  3EJI A;  1DM0 B;  3MC0 B;  2D2C C;  3VR5 A;  3FDT A;  2WB1 B;  3QOJ A;  2R7Z B;  2F03 A;  3R93 A;  1XXG A;  4EQN A;  3SXH A;  5M3F B;  1JOO A;  4XT3 B;  5E4X A;  1TKW B;  3PO2 B;  5KND A;  5EPJ A;  1IW7 D;  3I8Z A;  5KEE A;  3L7Z C;  1BDO A;  3GV3 A;  5IGG A;  4UAI A;  2Z4I A;  4KY7 A;  3HGB A;  1EEI D;  1BUV T;  1PTO H;  2H4O A;  1BCP B;  3WOF A;  3BZD B;  4XDX A;  5JPM C;  2EYF A;  1DOM A;  2CQA A;  3RLF A;  5DM7 3;  4IUT A;  3L9A X;  4IQZ A;  5CV4 A;  1K8M A;  3NBI A;  4KKU A;  3DMU A;  3QO2 A;  4FXK C;  1CQF A;  2F0U A;  1FD7 D;  2E75 C;  3A8I E;  5JEA J;  2G9H D;  3KLS A;  1CA5 A;  2QKI C;  3GD7 A;  1STE A;  5IGE A;  5J1Z A;  2HCC A;  2BDO A;  3I4L A;  3H09 A;  4OO1 I;  1QNU A;  4NP5 A;  3G6J B;  3ERQ A;  3HP3 A;  3I72 A;  1LV9 A;  4X3K A;  1RJT A;  2PNR C;  5HGT A;  1DON A;  1G8Z D;  5FLX L;  4H44 C;  1SYF A;  3S9W A;  1A3V A;  4K5X A;  4RAU C;  4X3U A;  5CV8 A;  3DHQ A;  1AN8 A;  4UDU C;  1S5E D;  1ZEQ X;  4RFB A;  3K5M A;  5CBA E;  3AB9 A;  1NSN S;  4RGN A;  4DN4 M;  4BWG B;  3N6R A;  2F0D A;  4PQX A;  1R4P B;  1JOQ A;  2IPK D;  1G91 A;  1SAP A;  2J7Z A;  1D5M C;  3RZD B;  3H91 A;  1BCP D;  3E6Z X;  3HOV B;  4FF1 A;  5DEH A;  1LT6 D;  2ZXO A;  1EWH A;  3D6C A;  2CW0 D;  3TP7 A;  3TZU A;  4LAA A;  4JK1 C;  2L9H A;  3PUX A;  1Y1V B;  2NB0 A;  4Q5V A;  3V2T A;  4KN4 C;  1BO0 A;  2SNS A;  1A15 A;  4FF3 A;  2OEO A;  4A3K B;  1EYD A;  4XXE A;  1SNM A;  1SYC A;  3T56 B;  2B8G A;  2NVX B;  3URY A;  4RWS C;  1BR9 A;  4KHZ A;  1DCZ A;  1YNJ C;  1HQM C;  2V4D A;  3SK8 A;  1RHP A;  3VR3 A;  1TVX A;  2E2I B;  1JWU D;  5C0X G;  3NP8 A;  1KDA A;  1NCV A;  4BA1 I;  1II3 A;  3S2D B;  4DXF A;  4DXG A;  2X69 A;  4C56 C;  2IX1 A;  2B2U C;  3PV0 A;  5KYL A;  3FVQ A;  1LTT D;  3A8J E;  3Q23 A;  1SYB A;  3IFD A;  5CC4 A;  3VA5 A;  1FNW A;  2KCN A;  1TWG B;  2ICI A;  2K04 A;  1NUC A;  1SND A;  3DEP A;  1SE3 A;  2R3Z A;  4MN3 A;  3RZO B;  1H9K A;  1ILQ A;  2NYZ D;  1JR0 D;  4H0L C;  4GZY C;  4IUP A;  3VR6 A;  1NAP A;  1ZYR D;  4NDX A;  5I6W A;  4EQP A;  4CJ1 B;  4J8Q A;  4RKL A;  4XYQ A;  1RCV D;  1DOK A;  2EY6 A;  1ZXT A;  3NHH A;  1RKN A;  2EYM A;  1VCI A;  1OXS C;  4HN7 A;  4C3H G;  4HCE A;  2ZT9 C;  2B2V A;  3BYT B;  3ERO A;  1HA6 A;  5D3I B;  3BDC A;  4C3J G;  3R8B A;  2EXZ A;  3OWF A;  1O7L A;  4HMJ A;  3NWT A;  2MPM A;  4KMU C;  1ICW A;  4HAE A;  5ELF A;  1S5F D;  2EY5 A;  1AFP A;  1RF2 D;  4RCO A;  3NQT A;  2EJF C;  1IL8 A;  1F9S A;  5FKA C;  5JVG 3;  1WD0 A;  4RCN A;  2XSC A;  3I91 A;  3NSW A;  1O7Y A;  4OIJ A;  4RGM A;  2H1E A;  1FGB D;  1PDQ A;  4XIG S;  3VR2 A;  5T1G A;  2M00 A;  4ID6 A;  1YNN C;  2LFN A;  3T13 A;  5KNC A;  4R9W A;  2WKD A;  2WII B;  1QIL A;  1I4G A;  1CI3 M;  2DNE A;  3LWU A;  2XIW A;  1G6Z A;  4X3T A;  3S1M B;  2F0M A;  4C1N K;  1Y8N B;  2LY7 A;  3K58 A;  2JA5 B;  1R4Q B;  5FO7 B;  4KY5 A;  1JQY D;  4QF4 A;  2A68 C;  2G9D A;  1KDB A;  1LLR D;  2AWO A;  2LS0 1;  3J7A F;  3IAY A;  2ENB A;  3I70 A;  1DXM A;  2NN6 I;  2WAC A;  1B9N A;  4M1U B;  1SMY C;  1Q1B A;  3Q22 A;  2E76 C;  2B2V C;  1SBB B;  5I4D A;  3SR1 A;  1VF7 A;  2NUC A;  3M4Y A;  4A3G B;  1EOT A;  2O4X A;  3P7J A;  5D65 A;  4WJW A;  2JEB I;  4K5W A;  1JE4 A;  2KUM A;  2HQE A;  2F0V A;  2L1B A;  1ONL A;  4BBS B;  1PRT B;  1GXD C;  2NVY B;  3EQL C;  5EPK A;  2ZXR A;  2JA8 B;  1VMC A;  5I2Y A;  1O78 A;  4C3I G;  2F3V A;  2CHB D;  2F0Q A;  4WOR A;  1CA6 A;  3D4W A;  5FK9 C;  2MGS A;  3P20 A;  1GUO A;  3S1N B;  2KEC A;  4E6I A;  2XNA C;  1LAC A;  2L4N A;  4ULL A;  1CTM A;  2Y0S B;  2NTS A;  4AYB B;  3HRZ C;  3FMC A;  3O13 A;  5BN3 A;  4PV1 C;  2C5C A;  2L11 A;  4TKO B;  3PUY A;  4NW2 A;  2A5H A;  4K2K A;  1I6H B;  2AQ2 B;  3LWE A;  3T51 B;  1S5B D;  2AUK A;  2PZW A;  3D8G A;  3LX0 A;  4BA2 I;  4QCL A;  2JYO A;  3BG3 A;  2KVM A;  3V05 A;  1YNJ D;  5FO8 B;  4QMG A;  5EKL A;  2EE1 A;  5G3L F;  4A3I B;  1WTX A;  3S1Q B;  3M3Y B;  2WP8 J;  4H13 C;  1KAB A;  1LTI D;  1FYC A;  2DY7 A;  1TY2 A;  4OL7 A;  1XTC D;  1GJX A;  4BY7 B;  1HCZ A;  2B2U A;  3KUP A;  5KRU A;  4A3D B;  4QUC A;  5C5M A;  1W6J A;  1VDZ A;  2EPB A;  1CM9 A;  3Q6S A;  1STG A;  3JAM E;  3QG1 A;  2OXP A;  1W6K A;  1X3Q A;  1JOR A;  1EWC A;  1TS5 A;  3K0Y A;  1B4O A;  2PCF B;  5IT9 L;  3MEH A;  4PMW A;  1F2Z A;  2PYK A;  4A3J B;  4G4K A;  1TY0 A;  3DWA A;  1QOH A;  4C2M B;  5K5P A;  3S2H B;  1F2Y A;  4QIW B;  2B8F A;  2YYZ A;  1GOZ A;  2Q8R E;  1TS2 A;  1LTB D;  1F2M A;  3NWS A;  1RD9 D;  4KN7 C;  5KNB A;  4IFD J;  2NTT A;  1TU2 B;  3OWE B;  2XWB B;  2EYP A;  2PZU A;  1OO9 B;  4KHV A;  1STB A;  1DZ1 A;  4IFD H;  5C0X I;  1SYG A;  3K57 A;  5D14 A;  4CGY B;  1Y1W B;  1JIC A;  5IGF A;  3T4A C;  2QDB A;  3MXN A;  1NR2 A;  3H6M A;  2A6H D;  2EDG A;  2B63 B;  5KIX A;  2Z1C A;  3FKI B;  2D9U A;  2K6A A;  1V43 A;  1ENC A;  2M2L A;  1WVL A;  1LT5 D;  1EIG A;  2B2T A;  3DM1 A;  2JA7 B;  2JEA I;  3OSO A;  4HED A;  5CV7 A;  1F9R A;  4FXD A;  2RDH A;  4O1N A;  5JPN C;  2MHV A;  3EVQ A;  5LL6 X;  3CKI B;  4IFD I;  3TBI B;  1LO5 D;  5K36 H;  3J80 E;  4L63 B;  3MFG A;  5ELD A;  3KK7 A;  1B1Z A;  3R2T A;  1S4Z A;  3VYU A;  1EY0 A;  1WTO A;  4FXG C;  1WTW A;  1PFM A;  2F0I A;  3S17 B;  2OF1 A;  3P1H A;  4K2L A;  5JVH 3;  2K03 A;  3C46 A;  3HZX A;  3D3R A;  2J4X A;  3CRK C;  2O2L D;  1DD2 A;  3HOU B;  3PO3 B;  1J8I A;  2KCC A;  4FF4 A;  2F0E A;  1EY6 A;  3P75 A;  5FO9 B;  1SFO B;  4RGO S;  5T1I A;  3S16 B;  1GUG A;  5I9O A;  1KDC A;  3GTQ B;  1V8Q A;  1TR5 A;  2QEJ C;  4KTA A;  1E2W A;  1LAB A;  4CKE A;  5ELB A;  5CYU A;  1TS3 A;  1I50 B;  5ELC A;  3GTG B;  1QB5 D;  5A35 A;  5CBE E;  2Q8T A;  2E2J B;  4IAL A;  1HA5 A;  3GTO B;  1F2L A;  3WDN A;  1AZQ A;  3NTI A;  2A73 B;  1TWF B;  3VYT A;  5FLX E;  1Q1E A;  3GV6 A;  4EGV A;  3J7Y W;  3KBX A;  2KQ3 A;  4DK0 A;  3MXU A;  1WCM B;  2A6E C;  1OXX K;  1I4H A;  1WTV A;  3U9S A;  1ESR A;  3C1F A;  4HR7 B;  1AZP A;  3K5L A;  4F7X A;  4P2C B;  3TSS A;  4FF2 A;  4C3J B;  5C4X B;  4FYD A;  2RKS A;  5EGT A;  5CV6 A;  3V96 A;  4G7Z C;  5EPL A;  2RA4 A;  3R2I A;  4O42 A;  2SDF A;  3D4R A;  3J7A V;  5CMD A;  1Q12 A;  1IKM A;  2L0C A;  1DYQ A;  3NUC A;  1H9J A;  5BN5 A;  4RHS A;  4CKB A;  1D2B A;  3IKJ A;  4U67 3;  3F2U A;  2PPB C;  2KED A;  1EY9 A;  2F0S A;  1C8C A;  2IX0 A;  3S15 B;  1F77 A;  2SEB D;  4L8J A;  1MD2 D;  1PRT D;  1M8A A;  4I7Z C;  2K33 A;  4PMC A;  4IFD G;  1H9S A;  1ET6 A;  2A68 D;  1CK1 A;  4OGQ C;  1JWS D;  2CW0 C;  1SYE A;  4YIJ A;  1BOS A;  1UAP A;  1E2V A;  1FNV A;  2PW7 A;  1BCP F;  1EYA A;  2BDN A;  1GUT A;  4XQQ A;  1GHJ A;  2MP1 A;  4CJ0 B;  4KKS A;  1LTR D;  5EBD A;  2RSN A;  1HQR D;  5CV9 A;  1YNN D;  3S1R B;  1XX8 A;  1TWA B;  3K6O A;  1PTO D;  4KK7 A;  2K5D A;  1QG7 A;  4K6L A;  5JAV A;  3W3A A;  2KJX A;  4IN3 A;  3A7L A;  3MXG A;  4MHE A;  4BS9 A;  3R3O A;  3J81 L;  2D62 A;  3CHB D;  1PLF A;  1PZJ D;  3KF8 A;  4L6T B;  3BVM A;  4LK1 C;  5IGB A;  1PXU A;  1LT3 D;  2F0L A;  3SK5 A;  5EBC A;  5A2Q L;  5D3D A;  1KTK A;  1I3Q B;  1EIH A;  1B44 D;  1HFG A;  2KEE A;  1RTO A;  3NK9 A;  1X3P A;  1X32 A;  2B2Y A;  1LTA D;  5CGK A;  4H7B A;  5EKK A;  4XT1 B;  2R6G A;  4RKB A;  2FIN B;  3E0J A;  2O5J C;  5CV5 A;  4DAY A;  5LHY 1;  1ESF A;  1STH A;  1I4P A;  2FMM A;  2I07 B;  5IOC A;  1CZW A;  1TWC B;  3NTH A;  4KD4 A;  5KYI A;  3PUZ A;  2DY8 A;  2TSS A;  1D1K A;  2B39 A;  4DU9 A;  4FVM A;  1D5X C;  5BN4 A;  1RTN A;  2XN9 C;  1KNA A;  3AU7 A;  4WRD A;  4J1M A;  1EL0 A;  1BBX C;  1QNK A;  5ISR A;  1K83 B;  2SOB A;  3E5S A;  4XTC S;  1S5D D;  5C0X H;  3WOE A;  4OO1 G;  4DFA A;  1SNC A;  1EZ8 A;  1C4Q A;  2EJG C;  3TN2 A;  1Q90 A;  3CRL C;  2KA7 A;  2F0W A;  3EFX D;  2BE5 D;  1EZ6 A;  4Z9C B;  3MWY W;  4G7H C;  3M4O B;  2B2Y C;  1ILP A;  3MHB A;  2R93 B;  2A6H C;  4N9T A;  4ODG A;  1U4R A;  4FO2 A;  4DNT B;  4Y7N B;  1AP0 A;  2FHT A;  5JOB A;  4KJN A;  3Q24 A;  3SVM A;  1WTR A;  4FNF A;  3TP5 A;  5AFW A;  4DNR B;  4PNY A;  5CR3 A;  3TME A;  1G2T A;  2E2H B;  2MJ8 A;  1M4V A;  1A3U A;  2F0T A;  3SHL A;  1EU4 A;  1XWE A;  3HG9 A;  3SK6 A;  1ET9 A;  1G29 1;  4IUR A;  2QCP X;  1D1I A;  2CVR A;  5JJZ A;  2E2D C;  5C44 B;  2PO4 A;  3T53 B;  2X6G A;  2RDF A;  1BF4 A;  4HSP A;  2YU9 B;  3C3L A;  1OXU A;  3NBH A;  2R92 B;  2EVB A;  1DOL A;  4B9X A;  1V1O A;  3HS0 C;  5IT9 E;  3MAQ A;  2A69 D;  1FR3 A;  5COR A;  4QUF A;  1SNP A;  3Q0A A;  3JAM L;  1L0X B;  3MVV A;  3VYR A;  4B08 A;  1HUN A;  4ZAI A;  1PMR A;  2WKC A;  3J80 L;  1TT2 A;  1MSH A;  3QJY A;  3QIA A;  2XWJ B;  3PUW A;  2EZV A;  2EJM A;  4PMB A;  3W2D A;  1QCB D;  5E4W C;  4R8N A;  2A6E D;  4IZ8 A;  4K6D A;  2WAQ B;  4ABN A;  1TWH B;  3X3N A;  5J22 A;  3HEJ A;  2KHS A;  2BA1 A;  2I46 A;  2VNU D;  3NTK A;  1JOK A;  4ZYS A;  3C2P A;  1ENA A;  4CJ2 C;  2RQX A;  5ELE A;  4IUQ A;  1B3A A;  5IGD A;  4ZRZ A;  3MFY A;  3QWN A;  2R61 A;  1I4R A;  2QIL A;  4RGT A;  3NE5 B;  2JP1 A;  3IL8 A;  3A56 A;  1G2S A;  2L12 A;  3CU7 A;  4DF7 A;  2VXW A;  4C3H B;  4J6H A;  3A8K E;  1EEF D;  1B53 A;  2EYL A;  3HOZ B;  4CKC A;  3LNN A;  3SEB A;  4DAV A;  1KLG D;  1PRT C;  1C48 A;  4B9W A;  1SDF A;  3PMF A;  5M3M B;  2WV6 D;  4HCS A;  3D4D A;  5LL6 S;  2IX3 A;  5C6A A;  1MI2 A;  1EQV A;  3QOL A;  4BBR B;  1HRJ A;  2K01 A;  5KGU A;  3RD4 A;  1EY8 A;  3FPU B;  3BVZ A;  1MSG A;  4XYO A;  3OMC A;  1VF5 C;  1PFN A;  3OPO A;  1K8O A;  1SEB D;  2F0G A;  1ZKO A;  3SK4 A;  3GTK B;  1I4Q A;  3M7G A;  1JC7 A;  3X3M A;  4RA8 A;  3G7L A;  2B2W C;  4DK1 A;  1SSO A;  5E1F A;  2J0T D;  1SXT A;  3MXP A;  4ZLT F;  1EY7 A;  3J81 E;  2EY2 A;  3D31 A;  2AWN A;  1F9P A;  3BVG A;  1B50 A;  2BOS A;  1TQO A;  2BE5 C;  1D6E C;  4TRD A;  4C3I B;  1EY5 A;  1LTG D;  3KLS X;  4OO1 H;  3H0G B;  1Y69 U;  1STY A;  1SYD A;  3I73 A;  1KAA A;  1BNZ A;  2BA0 A;  4U68 A;  4ZUI A;  5IGC A;  1LT4 D;  4DAP A;  4F88 A;  3VA7 A;  2KOL A;  1R9T B;  3GTL B;  3DEO A;  3BYY B;  3K5N A;  3OOC A;  3K7A B;  2HDM A;  3MTS A;  4EQO A;  2QF7 A;  1A2U A;  3KLR A;  2DN8 A;  3MA2 B;  3NPP A;  1V1P A;  1T5E A;  2F0J A;  2WIN B;  2BCO A;  5FOB B;  4ZQ3 A;  2DNC A;  3GO5 A;  5C0X J;  1UNS A;  2FJ2 A;  2K32 A;  1Z47 A;  2F0H A;  3GP7 A;  1HPC A;  2EOT A;  5DM6 3;  4V19 0;  2AUJ D;  1MBY A;  3EA6 A;  5K36 G;  2RDG A;  3H3V C;  2HUG A;  4KJO A;  2NVT B;  1H9S B;  2EY1 A;  2A69 C;  4KD3 A;  1A3T A;  4JBW A;  2PMZ B;  5C3X A;  4LJZ C;  5JEA H;  1SNQ A;  4RHR A;  5C4J B;  3I4N B;  2IL8 A;  1H9M A;  1BQQ T;  1BXT A;  1MGS A;  2IWH A;  1Z6H A;  1UEA B;  3KBG A;  3MZ5 A;  4NKL A;  2B2W A;  4I65 A;  3L3O C;  2JSO A;  3A54 A;  4QB4 A;  1A2T A;  4OIK A;  2ID0 A;  3TP8 A;  1QE6 A;  1I4X A;  2NWG A;  3TZD A;  4A3F B;  4IUV A;  4K5V A;  1WTQ A;  1LTS D;  2K7V A;  2XRQ D;  4ZKB B;  1O80 A;  4TQU S;  2EYO A;  1NR4 A;  4G7O C;  2M9V A;  1TII D;  1Q8I A;  3GTP B;  2SNM A;  1CQV A;  4HTH A;  3DXJ C;  1OXV A;  3K5O A;  2EYH A;  1FNU A;  1S5C D;  3PUV A;  5E3F A;  2NN6 G;  5C3E B;  3DWP A;  2L55 A;  3OMG A;  5DAU A;  5EQ0 A;  1O7Z A;  4IUN A;  4CHT B;  1JCK B;  2Z4H A;  1PTO C;  3CQZ B;  4K14 A;  2XRS D;  3RMH A;  3PIP 3;  1J9O A;  2F4I A;  3BDL A;  3GTJ B;  3I3C A;  1OXT A;  3HKZ B;  1E0B A;  2L5T A;  2K28 A;  4KKT A;  1SE4 A;  1WD1 A;  1XYI A;  2F0F A;  1VMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...