1PTOD

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
DVPYVLVKTNMVVTSVAMKPYEVTPTRMLVCGIAAKLGAAASSPDAHVPFCFGKDLKRPGSSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELIRMVECSGKQDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
total genus 22
structure length 110
sequence length 110
chains with identical sequence E, J, K
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09275 Pertus-S4-tox Pertussis toxin S4 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoD00
3W2DA 1I4GA 1PTOB 4L63B 1CT1D 1EU4A 2AQ2B 1HA5A 4K6LA 1L0YB 1MD2D 1PRTB 1STEA 4RHSA 1BCPF 4BWGB 1LTID 1I4HA 3URYA 1PZKD 2QILA 1JR0D 5FKAC 1FNWA 2Z8LA 2RDHA 5D3IB 1SE2A 5ELEA 1D6EC 1TS2A 2G9HD 1BCPC 1PTOF 5I4DA 2TSSA 2WV6D 2CHBD 3R2TA 1XTCD 3CHBD 1L0XB 5ELDA 3SEBA 1LTRD 2RDGA 3MC0B 1PTOC 2XRQD 1RDPD 3BVZA 1FD7D 1JWSD 1LTBD 1TS4A 1QILA 1FNUA 3BVMA 2NTTA 1EU3A 1FGBD 1I4PA 1LLRD 3BVGA 2ICIA 1LTGD 1LT3D 1S5BD 1HXYD 1BCPD 1EEID 4DXFA 2AQ3B 2J4XA 1AN8A 3R8BA 1XXGA 4UDUC 3KLSX 1TS3A 3DWPA 4RHRA 1S5DD 1LT5D 4RGMA 5D3DA 4DXGA 1PRTF 2IPKD 1LTAD 1CHQD 1PTOD 4C56C 1PZID 1TS5A 1V1OA 4ZYSA 1SEBD 2SEBD 1PYWD 1CHPD 4TSSA 1EEFD 1ENFA 1I4QA 2NTSA 2AQ1B 3DWAA 5ELFA 5ELBA 1PRTC 3O13A 1BXTA 1LTSD 1PTOH 2O2LD 4RGOS 1AW7A 3OWEB 1KTKA 4OHJA 1SBBB 3EFXD 1D5ZC 1KLUD 3BYTB 1EWCA 2XRSD 1HTLD 1CQVA 1FNVA 1SE4A 1JQYD 1PZJD 2XN9C 1JCKB 1UUPA 3TSSA 1EFID 1F77A 1S5FD 1UNSA 5FK9C 1B1ZA 1ET9A 1ESFA 4RH6A 5ELCA 1SXTA 3BZDB 1V1PA 5TSSA 3V05A 1I4RA 3MFGA 1DJRD 1LTTD 1G8ZD 2XNAC 4RFBA 1PRTD 3BYYB 1M4VA 1GOZA 1B44D 1I4XA 4RCOA 4Z9CB 3GP7A 1RD9D 1CK1A 4O1NA 4RGTA 1SJHD 2QEJC 1JWUD 1TY0A 1D5XC 1HQRD 1LT4D 1S5CD 1RCVD 1SE3A 1KLGD 1D5MC 1LO5D 2IJ0A 3DWQA 1TY2A 1BCPB 1RF2D 1LT6D 1JWMD 1T5XD 4L6TB 1S5ED 1V1PB 2R61A 3R2IA 1SJED 1DYQA 4RGNA 1ET6A 3EA6A
chains in the Genus database with same CATH superfamily
3EVQA 4KK7A 1SDFA 2A74C 1CTMA 2CH4W 3GTMB 2PI2E 2Z6KA 4JI7Q 1VQIA 1RKNA 4LUZA 1L0YB 1STEA 1HFGA 4JI4L 1K83B 2CQAA 5KIXA 4DV2Q 5JPMC 4K5VA 1PDQA 4OO1G 4G7OC 1JR0D 2KBNA 1YNND 3HOVG 3MXNA 2F0UA 3E0EA 3TQYA 1VMPA 3ERQA 2FMCA 5DM63 2CHBD 3M4PA 5E7NA 2B63H 3S14B 4X3TA 1B2TA 1KRTA 1VQCA 1FVIA 2R92H 5ELDA 1SYCA 4LUVA 3AMUA 1KHIA 2A5HA 4DR6Q 1PH5A 2DJGC 1PTOC 5M9OA 3CCJA 1QVFA 3KF8A 4WJ3M 1J9OA 2WAQB 1Q8KA 1L2FA 4U673 3I72A 5I9OA 3PIO3 5C4XB 3BVGA 4JK1C 1BR9A 1E1TA 1JE5A 4DKAC 3CQZH 1QUQA 2HHHL 3A56A 2IHEA 1GHJA 1QNKA 1SRUA 1ZYRD 5K36G 1UAPA 3HOZH 3T1YL 2DNCA 4DXGA 2K5DA 4AQYL 1LTAD 5M5XH 1QVCA 4C3IH 2PNHA 1G291 1EEFD 1U5KA 1EL0A 1C8CA 4DV0L 2DN8A 1KAWA 5IYCG 2EJMA 3PIP3 2PQAB 3OW2A 2JA8H 5M3FH 3TEHB 3WOFA 4A3MB 1WTVA 3A74A 4G4KA 5IYBH 2IY5B 1HTLD 5C4JH 4A93B 2B2TA 2E2DC 3Q0AA 3TSSA 5FK9C 1PH2A 4OGQC 4G7HC 1KAAA 2YU9H 2KQ3A 2BA0A 2E76C 2KEEA 4FXGC 3W1BA 2K01A 5FLXL 5C0XI 1IBKL 1HR0Q 1EQQA 4EQ5A 4FYDA 5M5WH 2VQEL 4K2KA 3S1MH 2K5HA 3JAML 5CORA 1R4PB 4JC0A 4O1NA 4DR7L 2EY5A 2IX3A 4FP5D 1RCVD 2E2HB 1KLGD 2PI2A 5G3LD 2B2VC 3EN2A 2ES2A 4F88A 4GLXA 1W6KA 1S5ED 4KD3A 5C44G 1SNOA 1I3QH 4LFBL 2VZAA 5J22A 3CF5A 3NBIA 4UP7A 2SOBA 4LFAL 4DAVA 1RL2A 1MI2A 2D9UA 3I56A 4NXNQ 3HOYH 3GTKB 2OEOA 1EU4A 5IGBA 3Q6SA 3SHLA 5IE8A 4QB4A 5M5YH 3G6EA 4DNTB 4B3SQ 3FKIH 4IOCA 4FVMA 4QUCA 3VR4A 5ELEA 4OX9Q 1J5EQ 2ZTDA 5GROA 4KY7A 5C4HA 3HOUB 2K28A 2P5ZX 2R3ZA 4UP9A 1L0XB 4JBJA 2WB1B 2F0IA 4DK6C 1BKBA 5E4WC 1D2BA 5IGEA 4U68A 3P7JA 3GTPB 3VA5A 2MHVA 5A2QL 4JI4Q 4DV3L 4UAIA 4O2DA 3U50C 2NVYH 2VQFL 2F0JA 4HJ8A 2Z6KC 4OO1I 4HJ7A 4IPHA 2KHSA 1X54A 3PO3H 1DOKA 3M4QA 5F2DA 1MSGA 1EZ8A 1GHKA 1Q46A 4DR5L 4DR3L 4LF4L 1HFNA 1I4QA 2AQ1B 1M1KC 1FL0A 4MTKA 4WJWA 1LTSD 3M7GA 4KD4A 4ODGA 2D5DA 4JVZA 1SBBB 3STBD 3TZDA 2ZJQA 3I2ZA 1VQ9A 4GNXB 4C3HH 1NR2A 1EWCA 1STBA 2E75C 4LF9L 2ICEC 4HCEA 2HHHQ 1CUKA 4ZUIA 3AQQA 2K1BA 2V4DA 4WRDA 1LACA 1F77A 5IYDG 3T1YQ 2K32A 3SDZA 4AQYQ 4TQUS 4XYOA 1Q1BA 1Y1VB 1LV9A 2K5NA 2KCCA 2OXPA 1DJRD 4X3SA 1WTPA 1O80A 3MFYA 3QOLA 5M3MG 4DV0Q 3NK9A 1X9NA 2NVXB 4L5SA 2QEJC 4HIKA 3QIAA 3GV3A 1D5XC 4JI5L 2XWJB 1SYBA 2IJ0A 5CBEE 1I50B 3KYHC 2ZJRA 1HA6A 2ZXOA 4A3EG 3DHQA 1F9SA 1ZXTA 1AE3A 2F0PA 1GVPA 1SJED 3CAMA 4EVOA 4A3BH 3PO2H 4A3DG 2ZT9C 1WCMH 3D0FA 3DM1A 1IBKQ 1STYA 2AKWB 2VQEQ 4DNRB 1NSNS 1Y14B 5KNBA 5GAGC 1I94L 1XJVA 3K81C 2Y0SB 2EXZA 4DR7Q 1Q81C 2WACA 4IJLA 1LUZA 4BXXH 1K9MC 2F0VA 1PH3A 5FJ8H 2EPBA 3FVQA 1SMYC 3KDFB 4BY1G 2F0NA 2VUMG 1Y8OB 2Z1CA 1KC8C 2R93G 3CHBD 5DAUA 4LFBQ 1HTPA 2OTLA 3KOJA 4LFAQ 4AH6A 1B3QA 2JE6I 1FNUA 1JC7A 3MZ5A 3ND9A 4HSVA 4XXEA 2JJQA 4YCUA 5C0XH 1K3RA 3I90A 1UEAB 5HGQA 1S5BD 1FR3A 4JI2L 3BS1A 3NPPA 4P71A 1E2ZA 1UWVA 2B63B 4A3GG 4DXFA 4MNOA 3R8BA 2R92B 1HNXL 4UDUC 3KLSX 3J7YW 2K03A 2HD3A 4HSPA 3KUPA 1BO0A 4QCLA 5HY6A 4C56C 4YY3L 3T1HL 4NMZA 4DUZL 4K14A 4BS9A 4HMIA 3CRLC 4IPGA 3CU7A 1AE2A 2B2WA 2FINB 5ELBA 4NXML 1AH9A 1GKHA 2L4NA 4P74A 1X3FA 2K14A 3MEHA 1E0BA 2F0QA 2VQFQ 2EYLA 2L12A 4HAEA 3HOZB 3Q8DA 1VF7A 1PYSB 5CV7A 5M5XB 4C3IB 4ALPA 3NSWA 2F3VA 4XQQA 4QGUA 1PH6A 2EDGA 1BDOA 3HOWG 1NAPA 2ALYB 5D65A 1EIHA 4DR5Q 4DR3Q 4LF4Q 1PH8A 4GZYC 5C3EG 4ZRZA 1GOZA 2JA8B 5M3FB 3GP7A 1VQAA 3C1FA 3I73A 3HOXH 4DF7A 3J81E 1LT4D 5C4JB 5FLMG 2H5XA 3OW7A 2A68D 3T4AC 4LF9Q 1J8IA 3VR6A 2YU9B 2PQEA 1SYGA 2HUGA 5M5WB 3S1MB 3ULJA 4BBRG 1ONLA 1Q82C 4OO1H 2E8GA 5IP7H 2LY7A 5E3FA 5CC4A 1D1KA 3CCUA 4QL5A 5LHY1 3IAYA 3RZDB 2LKVA 4XDXA 3TN2A 3UDIA 4JI5Q 1VQBA 2RDHA 1SE2A 2IWHA 3S17B 1I3QB 4GNXC 3CKIB 4A3KG 3W1GA 2YTVA 1YI2A 4QMGA 3HOYB 1X3PA 2KHIA 3E6ZX 4UP8A 4KN7C 2JN4A 2DNEA 1GD7A 1A3TA 3VR3A 3FKIB 1XPRA 1CKNB 2YTYA 4MHEA 3AU7A 1I94Q 3DMUA 3OSOA 4BA1I 2OQKA 2TMPA 5K36H 1K28A 4R9WA 2X6GA 3I8ZA 2PZWA 3HKZE 3OPOA 1EEID 2EIFA 1FGUA 4N9PA 1Q86C 1CSQA 2VXWA 3SVMA 1SNCA 1WVLA 1OXSC 2L0CA 3K0XA 4JBMA 3I7FA 4E6IA 1CHQD 1ENFA 2NVYB 1YJNA 3S2HB 3F1ZA 4X64L 2O2LD 2CQOA 1AW7A 4C3JH 1P8LA 2UXDL 4JI2Q 1PFMA 1KLUD 3PO3B 1HNXQ 2HCCA 4RMFA 2YV5A 4F8MA 5LMUL 1PA6A 1CKMA 2VY3A 1G2SA 3C3LA 4N8X1 1VQFA 2EJFC 3EIVA 3VYUA 4DR2L 3T1HQ 4ZKBB 4DUZQ 3CCRA 5IIFA 1HUMA 2KCTA 4C3HB 1RD9D 4NXMQ 4GKJL 1VCIA 4LK1C 4BBSB 4ME3A 1T9HA 1Y1WH 1XNQL 4O42A 1NY4A 1STNA 3DUZA 3GTLH 3UDFA 3TMEA 1D5MC 2KJXA 4HCSA 2CH4A 3I3CA 1L1OA 1BBUA 4YCWA 2Q8TA 2XTIA 1B50A 1W2BA 1H9MA 1UE1A 1GUWA 2C5CA 1PTOB 4H0LC 3BG3A 4PMWA 3KF6A 4K6LA 3P20A 1HJPA 2NN6G 1X3QA 3VA7A 4RG1A 2MGSA 2DUDA 1WD1A 4A3BB 2R7DA 1D6EC 5COYA 1BCPC 1EQRA 2IW3A 2KEDA 1DGSA 4GKKL 5JJKA 5C5LA 3ICEA 3S1RB 2HDLA 2UU9L 5AJ3L 1TR5A 3RD4A 1LABA 2X69A 2F0LA 1N36L 2R7ZG 2FXQA 1QOHA 4EQNA 2JA5B 1AN8A 1F9QA 2QW7A 5DM73 4A76A 3PUYA 1H9SB 5FLXc 2L11A 2PW7A 3MA2B 1KABA 4AYBG 1PTOD 4FF3A 3WOEA 2XSCA 4DV6L 3GTGB 4JG2A 3JAMc 2K75A 5JVG3 3I55A 2A69C 1OXUA 1PH1A 1IKMA 1QJOA 1GJXA 5ELOA 1OXXK 1D5ZC 2QA4A 1PFSA 2F0TA 4JPBW 1YITA 3IL8A 2HT1A 1BBXC 3NTIA 2KHJA 4A3CH 1S5FD 4X62L 1B1ZA 3BZDB 1V1PA 3V05A 4HIMA 4RFBA 4X64Q 1B8AA 1XYIA 3RLOA 4ABNA 1VQMA 2UXDQ 1XPOA 4WFN3 4A3DH 1LO5D 1TY2A 4I7ZC 1U0LA 2KECA 5ISRA 2IX1A 2F0GA 3MTSA 4L6TB 5LMUQ 3WDNA 3RUZA 3J81L 1M90C 1DYQA 4RGNA 3PGZA 1B4OA 2NBFA 3SE0A 2IT1A 4CHTB 3M4OH 3GD7A 2GVAA 2X6LA 2K6AA 4GKJQ 2L55A 1HR0W 1PYBA 4F87A 1XNQQ 3MXUA 4IFDJ 1VQ6A 1EFWA 1B53A 2DGYA 2WV6D 4DAYA 3SEBA 1PFBA 1CZGA 3BDCA 1A15A 2NVTB 3U4ZA 1F2MA 4BY7G 4PZ7A 2K04A 4A3JH 2RSOA 3A7AB 4A3IH 2M2LA 3M4YA 3H6MA 3MXNB 4FF2A 2JA6B 1SAPA 4QIWB 1LLRD 5I6YA 3M9BA 4Y7NH 4DA2A 2EY1A 1LT3D 3PCOB 1PVOA 1IBMQ 3K7UC 3ZYYX 1K8OA 2CWAA 1H95A 2CFMA 3M7NA 3E9IA 3BZCA 1C48A 1PV4A 1WFQA 3GTQH 1K0SA 4RA8A 3H0GH 3KF8B 1A0IA 1LT5D 1PRTF 5T1GA 3NBHA 3QB3A 1V1OA 1GUSA 2PZUA 4GKKQ 1PMRA 3PV0A 3I4NG 3NP8A 2C35B 4R4IA 1QWYA 1ASZA 2UU9Q 1G6PA 4FO2A 2F0WA 5AJ3Q 1QUQB 3AFPA 2Q8RE 4LF6L 3J7AF 1TU2B 3CPFA 2KA7A 1N36Q 1K8AC 1EY7A 1QNUA 4JI3L 5C3EH 4B3TL 1XPUA 1TIID 1SE4A 5FO7B 2Q2TA 1JQYD 1C4QA 5IP9G 3G4SA 4JI0L 1O7IA 3HZXA 4RCNA 2VNUD 1DCZA 5ELCA 5FLMH 1E24A 4DV6Q 3TDQA 2K5WA 4C3JB 1XMQL 3CRKC 4DAMA 1KNAA 3TP8A 1W3SA 3VYSA 3KBXA 1A2UA 2CW0C 4P73A 2K50A 1PH4A 2D2CC 1DOLA 5EGTA 3CCVA 1U4LA 4A75A 1YJ9A 1V1QA 2WAQG 3H3VI 2Z4IA 3IRBA 1TKWB 4X62Q 1CSPA 3A8KE 1S72A 2FHTA 5C4XG 1Q12A 1Y1WB 1IYVA 4A3KH 2F0KA 2UUAL 3K59A 1TVXA 1EY9A 5FKAC 2QILA 2MO1A 2D62A 2Z8LA 3E9HA 3PUWA 4ZLTF 3IFDA 4AIMA 1LM0A 4K8IA 2G9HD 5HURA 1YBYA 2LMCB 3NWSA 3J81j 3K5OA 3NHHA 2UUCL 2L1BA 4XT3B 1X6OA 3BVZA 2JA7H 4IALA 5EKLA 3SK8A 3BVMA 3X3MA 2CCZA 2A19A 3J81i 3ND8A 3TS2A 3PIOA 4A3MG 3PF5A 3N6RA 4A93G 1ILPA 3E5SA 2G5DA 4RKBA 3K5NA 3EQLC 1SMYD 3PQIA 5EKIA 1S5DD 2H4OA 4R4QA 1TWCH 3HRZC 2EOTA 1EWIA 1CA6A 1VQPA 1PZID 3W3AA 1OTCA 4A3LG 2KENA 4OIJA 1H9JA 1BOSA 5EKKA 4JBKA 4IPDA 3KLWA 1EY6A 5EPLA 1UE6A 3PIPA 1KTKA 1V8QA 1Z6HA 3L7ZC 4KY6A 4P2CB 3S1QH 3BZKA 3TZUA 1JOKA 3UE1A 5DNFA 3LWEA 1X65A 3OYYA 1IZ6A 1XX8A 4NB3A 1WOCA 2MPMA 5IOCA 4JOIA 1M4VA 2RDFA 1B3AA 3FRPB 3CXCA 4CKEA 3SR1A 3HOUG 1STGA 1TY0A 4YHHL 4DV1L 1EIFA 1LTLA 4LF6Q 2B8GA 5KNDA 4X3KA 5GADC 1EWHA 2BDNA 1RIPA 2WB1G 4JI3Q 3V2TA 1U4RA 2B8FA 2R61A 4LW1A 4B3TQ 3SXHA 1N34L 1KL9A 1U9RA 4JI0Q 3V96A 1I5FA 5I2XA 4H02A 2BCOA 1OO9B 5DLQE 1XWEA 5IGDA 3W2DA 4L63B 1XMQQ 1AZQA 5C6AA 1CT1D 2AQ2B 5KGUA 2A6ED 2OCEA 3A54A 3F2BA 3J80E 2QF7A 4IUUA 4MTNA 3DEPA 2A6HD 1Y8PB 1WTOA 1GUGA 1Z47A 1ICFB 1QZHA 5KRUA 2GA4B 2JP1A 2UXBL 2O4XA 3M4OB 3OHXC 4GOPA 3U9OA 1Q7YC 1G91A 1LTRD 3CC2A 4C1NK 4KI0A 3ULLA 5IT9E 1CZWA 1FD7D 4DU9A 1RTOA 1VF5C 1Q1EA 1FGBD 1I4PA 4K5WA 2UUAQ 4B08A 2Q2UA 1CM9A 2QKIC 5JEAJ 5IGCA 2A73B 3A7LA 2B2TC 2JEBI 3X3NA 2AQ3B 2MJ8A 1VQ7A 1K8MA 4CJ2C 1X32A 1Y1VG 3JAMi 2MO0A 1PHJA 4A3JB 2UUCQ 4A3IB 1PXUA 2JXMB 4I65A 4C2MH 4Y7NB 1B9MA 3D6WA 4P72A 2EY2A 5JPNC 1X56A 1JOOA 1SLJA 2VW9A 3GTQB 3H0GB 2DJFC 3KJOA 3J80c 4GLVB 1WTRA 1HZAA 2B2UA 2BDOA 1C7YA 3D8GA 4C1NI 3CCQA 3I4MH 1UNSA 1ENAA 4DK0A 4YWKA 4YWMA 3K8AA 1AZPA 2Y0SG 2F1MA 1N9WA 2ATWA 2K05A 2E2IH 4N8FA 5IT9c 3UI2A 3A8IE 4HR7B 2F4IA 3FPPA 3CQZB 1QE6A 3CPWA 4RGTA 3NUCA 4XQJA 2FMMA 4F7XA 2GN5A 1EYDA 5C3EB 4EQPA 3MXPA 1BCPB 2WKDA 4YWLA 1LT6D 4A4IA 1D1IA 1YHAA 1ET6A 1CFMA 2QGQA 2XGTA 3E0JA 4IURA 3PUVA 5KEEA 2AHOB 2PNRC 5LMNW 5BR8L 2Q2HA 2B63G 2SNSA 3QJYA 2R92G 3S1NH 2LSSA 2A6EC 4YHHQ 4DV1Q 1FNWA 1STHA 5D3IB 4PG3A 4KMUC 2A6HC 5BN5A 1FYCA 4PMCA 5NUCA 3CMAA 4JOIC 3SK5A 1N34Q 1XTCD 3U4VA 3L9AX 2ASBA 1EY4A 2NZHA 1RJTA 3ONAB 2UUBL 3FPUB 2HQLA 3HOVH 1JOQA 5T1IA 4JI8Q 4XTCS 1VQJA 3HOZG 3K7AH 4OELB 4C3IG 4DN4M 2F52A 1BCPD 3C1EA 4DR1L 1K0RA 2C9OA 4S3SA 1UE7A 1SFOH 2RHSB 2JA7B 2PYKA 3ITPA 4POGA 2UXBQ 1C0AA 4XIGS 2R6GA 2JA8G 1KDAA 1I6HH 5M3FG 1SEBD 2SEBD 4TSSA 5M5YB 5D14A 4APVA 4QUFA 1R9TH 1PFNA 4PV1C 3O13A 1WD0A 3K5MA 1YEZA 3NXWA 3CMEA 1EQTA 5IP9H 2F0OA 3LNNA 1OXTA 1K3BC 3ER0A 2N3SA 1TWCB 4UPAA 1MJCA 4GOPC 3J81c 1FJGL 2XRSD 1HRJA 4KV6A 4A3FG 3L2PA 1TXYA 3QR8A 2WFWA 5EBCA 1EQVA 1O7ZA 1BUVT 4AYBE 5IYCH 4NDXA 5TSSA 2A69D 1MHWC 1B44D 2N78A 3S1QB 4HMJA 2SNMA 1SYEA 1WYDA 2PO4A 3KLRA 1HHVA 4HIDA 1HNZL 3HOYG 5IGGA 2ZTEA 2F03A 3I4LA 1RF2D 4IUQA 1IW7C 4TVAB 3FKIG 1ESRA 3ERSX 2JQOA 1CQFA 2F0MA 2FFKB 4NW2A 2LXJA 4FXDA 1Q90A 4YIJA 1G6ZA 4ID6A 1PRTB 5I6WA 2M00A 2B2UC 1O7YA 3KK7A 4DV4L 5C44H 1PZKD 4B3RL 4X3UA 4OWTB 1KIXA 1HQMC 2F3IA 1HZCA 4HEDA 1G51A 1HH2P 2Z9HA 3OMCA 3J80L 2XVSA 5JVH3 1U4PA 2MQHA 3KF6B 5CV4A 2B3GA 1A6XA 4PQXA 2B2WC 3K5LA 1Z9FA 2PPBC 1T5EA 5BR8Q 2B39A 1NJIC 2K5VA 3PO3G 1EU3A 3TBIB 3NTHA 4HN7A 3F2UA 4HIOA 2KVMA 2ZXPA 5IT9L 2EVBA 4M8AA 2RKSA 1JJ2A 2L9HA 1IBML 5BN3A 2WKCA 2OT2A 3PO2B 4JCVE 3OOCA 1IYUA 4HTHA 3CCMA 1EYGA 3HKZB 1WCMB 4ZAIA 2MFIA 1TWFH 3CCEA 5D3DA 4ZQ3A 2LFNA 3CCSA 1QG7A 4C3HG 4OWWB 4BBSG 4LF8L 2UUBQ 2WINB 1F2LA 1Y8NB 2NTSA 2PMZE 4IO9A 2IX0A 2AWOA 3RMHA 1C9OA 1NUCA 5FO8B 5KYIA 2E2JH 4KY5A 2CKZB 3S2DH 1EUJA 4DR1Q 4DV7L 3HFZB 1CQVA 1RODA 1SSOA 4H44C 5HGTA 4C2MB 1A63A 1PZJD 2EJGC 4X6AH 2ZXRA 1MGSA 3T51B 4ZUJA 3OIPA 3MFGA 3MHBA 1G8ZD 2RF4A 4KKUA 4PMBA 4A3BG 4OIKA 2F3WA 3R93A 1GXDC 2N88A 5IYDH 3I4MB 1Q8IA 1WTQA 1F2YA 2NWGA 3DWQA 1NE3A 3HEJA 3KLSA 4ZK9B 3KJPA 2KCMA 4RKLA 4DK3C 1FJGQ 2F0EA 1JWMD 1JORA 1V1PB 3NTKA 1SR3A 5A2QE 2ID0A 4FDBA 2E2IB 5M3MH 3EA6A 3QOJA 4LF7Q 4DR4L 4JW0A 4HJ5A 3RNUA 4IOAA 2CW0D 2JA5G 4BWGB 4A3EH 1SNDA 2AWNA 1HNZQ 3AB9A 2GVBA 4ZKCB 3NENA 2RBMA 2I5LX 3TP7A 2K7VA 2OQ0A 2Q2IA 4MIUA 4DGZA 3MWYW 2B2VA 5CMDA 1N8RC 4EGVA 2WAQE 4CDEC 3SK6A 3K80C 3RLFA 3RLNA 3HOXB 1SMXA 1VQEA 2WIIB 1N33L 4GN4B 4G7ZC 2AUKA 1Y1VH 4IN3A 4BY1H 4DV4Q 5CYUA 3MXGA 2VUMH 2R93H 4DAYB 4B3RQ 4RAUC 2J4XA 1MIUA 3E3XA 1E2VA 1VQNA 2KCNA 5DEHA 1AP0A 3HOVB 1S40A 4CBVA 2IPKD 3K7AB 3B6YA 3D3RA 4POFA 4LF5L 3GTOH 4A3GH 5I9PA 3DWAA 3J80i 5IY0A 1VDZA 3OMGA 1PRTC 2WP8J 2MNAA 2ZJPA 2EXDA 1L1OC 3PSIA 1VQ8A 1SFOB 1G2TA 2VB2X 4OEMB 3K6OA 1BBWA 3BU2A 1KD1C 2VL6A 2NN6I 3NBHB 5LL6X 4K8JA 1J6QA 4IFDG 1NBWA 1S3OA 2LXKA 1R9TB 2Z4HA 1ESFA 4LF8Q 2D0PA 2FJ2A 3U9SA 5EAYA 1DXMA 3LGJA 4J15A 3VR2A 3M3YH 1VQLA 1YHBA 4GN3B 5IP7G 1S4ZA 3HOWH 5EPJA 4DV7Q 2YYZA 4KTAA 2L15A 4JI6Q 1XTDA 4KHPL 3CD6A 1NR4A 2JA6G 1KNEA 5H1SE 4JV5L 3RZOH 1I4GA 3U58A 1UEBA 2I46A 3TP5A 3BDLA 4HJ9A 3D4DA 5A35A 1QCBD 2MUYA 4GS3A 5LL6S 2KUMA 2QCPX 1JICA 4CKCA 2F0SA 4BBRH 1KQSA 1B70B 4J1MA 3HKSA 1PTOF 3OIQA 2WB1E 2N55A 4B9WA 1ASYA 3H3VC 3RR5A 2NYZD 1I6VC 4LNQA 1B9NA 2QEXA 4GLAC 5C4ZA 4DR4Q 4IZ8A 1ICWA 1HPCA 1CA5A 2XRQD 1RDPD 3N52A 1LTBD 2BH2A 5C44B 4JYAQ 3GTLB 2HIXA 1BNZA 4G57A 4R8NA 2RSNA 1YZ6A 2EYMA 4MN3A 1A3UA 1HXYD 1PH9A 2N8NA 2I07B 3GO5A 2BE5C 1CKOA 2F4VL 2KOLA 4C3JG 1TS3A 2PQAA 3NQIA 3SGIA 1ZKOA 2AMCB 1PLFA 4R4CA 1N33Q 4QY7A 3OTOL 1BXTA 1Z7TA 4TRDA 1EOTA 4A3FH 1TWAH 1SN8A 4OHJA 1TWFB 3PUXA 5CV9A 3S24A 3BYTB 3T13A 4B9XA 4XT1B 3RZDH 3FDTA 1II3A 1YNJC 2YTXA 1A62A 1ILQA 4YCVA 3S17H 1Y1WG 1EFID 5J1ZA 3CC7A 1ET9A 3VYRA 4RH6A 1SYFA 2PW5A 1YJWA 4XQNA 4L5RC 1HNWL 1E7ZA 3P1HA 2EYJA 1JJGA 4LF5Q 1LTTD 1IBLL 4R4TA 2E2JB 4L5QA 3BYYB 3S2DB 2JA9A 3FMCA 4IJHA 4K0KQ 1JB3A 4UY8C 4K6DA 1CK1A 1X3GA 1SJHD 1HQRD 1F9PA 2IHFA 1VQ5A 3H91A 1IL8A 1YNNC 1MJEA 4WJ4A 3CC4A 3I91A 4J8QA 4Y52H 1JJCB 1BVSA 4CDFC 4TKOB 2O5IC 4PNYA 2Y0SE 4IFDI 3GTJH 2B2YA 3A0JA 1HA5A 5CR3A 1L0WA 1IHZA 1I4HA 3UDGA 4ULLA 3S2HH 4XYQA 5M3MB 1TS2A 3NQTA 2BH8A 4ZCKA 3Q24A 4FNFA 2TSSA 2R7FA 1VS0A 3R2TA 5CGKA 4KHPQ 1ZYRC 2NN6H 1WTXA 2HDMA 3KBGA 3D31A 4A3EB 1VQKA 4JV5Q 1JWSD 3J7A5 3G6JB 2SDFA 3F8TA 4JI8L 2NTTA 4EX5A 1HCZA 4QQBX 4A3DB 2ICIA 3ZJYC 1SNQA 1VQDA 4BBSH 4QF4A 1ML0D 3D4RA 3HG9A 4IUPA 5CV8A 4CKBA 4GOPB 4DFAA 1EIYB 1XNRL 3AEVA 4B3ML 1DM0B 1AFPA 4DUYL 1D7QA 2QDLA 3DWPA 3S15H 4GNXA 3CP0A 1M8AA 4CDCC 4KKTA 2F0DA 4ZYSA 3T16A 1CHPD 4LFCL 4KKSA 4BY1B 2R7ZH 5ELFA 2VUMB 2R93B 1JT8A 4X66L 4A3CG 5FO9B 2EYFA 4OXPA 1PTOH 2XWBB 3TREA 3NE5B 3J7AV 4N9TA 1EZ6A 3K0YA 3JC66 2B29A 2K4KA 1TQOA 2F4VQ 3BDOA 3GTOB 4A3GB 1IYJB 1GO3E 1BF4A 3AYHB 2I5MX 4NP5A 4DK1A 2CWPA 4LJZC 1I4RA 4IPCA 3TP6A 3H3VH 4R4OA 5GQOA 4JI1L 2JSOA 1I4XA 1NCVA 3OTOQ 5G3LF 2NZ1D 3S1RH 1MBYA 2F0FA 1IXRA 2NVQH 5JEAG 2NUCA 3DM3A 5FOBB 4CDDC 1T5XD 1STAA 3FHWA 2JA5H 1EY0A 4DPGA 1VQOA 1EIGA 1RHPA 1EYAA 3M3YB 1HNWQ 3KDFA 5KNCA 1HZ9A 1IBLQ 3HOWB 2EYPA 4ME5A 3GTGH 2K5QA 1RTNA 2HQEA 1TWGH 4GN5A 2RVLA 5LMNL 4A3JG 1JB7A 5E4XA 4A3IG 2VB3X 4K2LA 1IW7D 5ELNA 2RQXA 3A8JE 3TS0A 3RZOB 3UE0A 3W5OA 3S16H 4DV5L 1SE8A 5C3XA 5IODA 3Q22A 2RCFA 1K8GA 2LS01 3MC0B 4FF4A 2Z6BA 1GUOA 3LWUA 3H0GG 1SYDA 4BBRB 4DV3Q 4KJNA 4L5TA 1WJJA 5BN4A 1H9RA 1NMGA 1SROA 2OTJA 3VR5A 1ZEQX 3STBC 1LYLA 4NPSA 4DNIA 1XXGA 4BY7H 2OWOA 3C2PA 3UDXA 5IWAL 1P16A 1QVGA 1IKLA 4DAPA 1TWHH 2B2YC 4RWSC 3K57A 1N32L 2O5JC 1DONA 4A3KB 1EY5A 5J3BA 3GDEA 4CGYB 3EROA 4O0AA 2BA1A 4RGOS 3PMFA 4IFDH 1QB5D 3EFXD 4LMQD 3EJIA 2UXCL 3DEOA 2JYOA 1XNRQ 4UHVA 4FF1A 4B3MQ 1FNVA 2I0QA 2MP1A 3QG1A 3I4NH 4DUYQ 1NTGA 1JCKB 1UUPA 5GAEC 3A5ZB 1H9KA 5IYBG 4A3FB 1TWAB 1SNMA 4LFCQ 1D8LA 2I5HA 2VS1A 1F9RA 4R8IA 4EQOA 1YNXA 4X66Q 3Q23A 2NVTH 3WWVA 3GTMH 3J7ZC 4J6HA 1VQHA 4OWXB 4OL7A 5KYLA 5IGFA 1KDBA 1WTWA 2JA6H 5CV6A 1K83H 4KHZA 2E74C 2ZTCA 1XMOL 3C46A 1WTHA 2V1CC 4OONA 1PH7A 4LF7L 4I7AA 4V0BA 1VQGA 5L37A 1GM5A 3A55A 1UE5A 2F0HA 5JAVA 4MZ9A 3S14H 1A8VA 4JI1Q 4L8JA 1NNXA 2EE1A 4PZ6A 4RHSA 1LTID 1W6JA 5JOBA 3URYA 2JA7G 1CKNA 4IUTA 1V9PA 2QDBA 1U4MA 1JE4A 3MAQA 1E3PA 5C4XH 3QO2A 2RHQB 1HZBA 3GTJB 4BA2I 1TT2A 2RCNA 1V43A 2L5TA 3NWTA 4LUOA 3L3OC 4IUNA 1KDCA 2XIWA 3GV6A 1L1OB 3RN5A 2HIVA 1DD2A 4NKLA 5LMNQ 2Z0SA 1OXVA 4H7BA 2AUJD 3D4WA 1MKHA 3VDYA 3MVVA 2ZM6L 5I2YA 3H94A 4RGMA 4DV5Q 4YY3Q 4A3MH 4Q5VA 4A93H 3K58A 2EY6A 4M1UB 2PCFB 1YIJA 1NMFA 3OWEB 4FXKC 5CBAE 4X65L 2ENBA 3S15B 5FLXE 3NELA 1YHQA 2NB0A 4WORA 2E5LL 2A68C 4A3LH 2EQSA 3DLLA 1IL2A 2M9VA 3AFQA 2N49A 5IWAQ 2E2HH 1BQQT 3BJUA 2R7ZB 3JAME 2Q8IB 1N32Q 1E22A 1SXTA 4R1JA 4JI7L 3P75A 2XNAC 1R4QB 1PRTD 3RN2A 4Z9CB 4RCOA 4AYBB 2EYHA 4DV2L 3HP3A 1JWUD 3GTKH 1AEXA 1SE3A 4KN4C 1F2ZA 4KLKA 5EQ0A 2G9DA 2UXCQ 5C5MA 3F2CA 1KRSA 5E1FA 2EZVA 2DY8A 1GUNA 3R2IA 4JI6L 3NEMA 3GQBA 1QZGA 3QWNA 1X3EA 4DR6L 2DY7A 3PF4A 1E2WA 3HOUH 1VMCA 1MSHA 4IQZA 3H15A 3CCLA 1CI3M 1MD2D 5EPKA 2NVQB 1BCPF 4P75A 3MEFA 3PO2G 3TRZA 3G48A 3HKZG 5AFWA 1WCMG 1VQ4A 5EBDA 3GTPH 3T53B 5C0XJ 5K5PA 3S9WA 1XMOQ 5I4DA 2RA4A 3T56B 1ENCA 3G71A 3FP9A 4JBWA 1K73C 4BXXG 2J7ZA 2OF1A 2K52A 2RDGA 1JMCA 1DZ1A 1H9SA 4QIWE 5FJ8G 4HJAA 1TS4A 1QILA 2J0TD 1TWGB 3HGBA 1SNPA 4JYAL 2JEAI 3VYTA 4LAAA 3G7LA 2EYOA 1LTGD 2H1EA 1O78A 1O7LA 5JJLA 3S16B 2D0OA 3HS0C 3IFTA 4CJ0B 1A2TA 5C0XG 3L0OA 1KXLA 3I4OA 4RHRA 5C3WA 1YVCA 1EOVA 3CW2C 4K0KL 2IL8A 1TS5A 1HR0L 3IKJA 3M85A 1PYWD 5JJIA 3D6CA 3S1NB 1E1OA 3KFUA 3I4MG 3R3OA 4ILWA 2A8VA 3SK4A 4BY7B 4PZ8A 5J39A 2PZTA 2PMZB 5CV5A 2BOSA 3FEWX 1DOMA 1HUNA 1TWHB 4LWCA 2JK8A 2BE5D 2NVXH 3F2DA 3H09A 5EJWA 1EY8A 2A1AA 4QJFA 5JJZA 2XN9C 1Y69U 3PUZA 2ZM6Q 3I70A 4KJOA 1B7YB 5GAHC 4DR2Q 1I50H 3EBEA 4NXNL 1WI5A 3LX0A 5JEAH 2NZOA 4V190 1EYCA 3DXJC 2CVRA 3ULPA 4B3SL 4X65Q 1S5CD 3I4NB 4K5XA 1Q3LA 2K33A 4CJ1B 4OX9L 2HCIA 4IUVA 4KHVA 2E5LQ 1A3VA 3OWFA 1J5EL 1I6HB 1YNJD 4Q0FA 3A5UA 1X55A 4H13C 3HOXG 1GUTA
chains in the Genus database with same CATH topology
3EVQA 4KK7A 1SDFA 2A74C 1CTMA 3GTMB 1RKNA 1L0YB 1STEA 1HFGA 1K83B 2CQAA 5KIXA 5JPMC 4K5VA 1PDQA 4OO1G 4G7OC 1JR0D 1YNND 3MXNA 2F0UA 1VMPA 3ERQA 2FMCA 5DM63 2CHBD 3S14B 4X3TA 1B2TA 5ELDA 1SYCA 3AMUA 2A5HA 1PTOC 5M9OA 3KF8A 1J9OA 2WAQB 4U673 3I72A 5I9OA 3PIO3 5C4XB 3BVGA 4JK1C 1BR9A 3A56A 1GHJA 1QNKA 1ZYRD 5K36G 1UAPA 2DNCA 4DXGA 2K5DA 1LTAD 1G291 1EEFD 1EL0A 1C8CA 2DN8A 2EJMA 3PIP3 3WOFA 4A3MB 1WTVA 4G4KA 1HTLD 4A93B 2B2TA 2E2DC 3Q0AA 3TSSA 5FK9C 4OGQC 4G7HC 1KAAA 2KQ3A 2BA0A 2E76C 2KEEA 4FXGC 5FLXL 2K01A 5C0XI 4FYDA 4K2KA 3JAML 5CORA 1R4PB 4O1NA 2EY5A 2IX3A 4FP5D 1RCVD 2E2HB 1KLGD 5G3LD 2B2VC 4F88A 1W6KA 1S5ED 4KD3A 1SNOA 5J22A 3NBIA 2SOBA 4DAVA 1MI2A 2D9UA 3GTKB 2OEOA 1EU4A 5IGBA 3Q6SA 3SHLA 4QB4A 4DNTB 4FVMA 4QUCA 3VR4A 5ELEA 3HOUB 4KY7A 5C4HA 2K28A 2R3ZA 1L0XB 2WB1B 2F0IA 5E4WC 1D2BA 5IGEA 4U68A 3P7JA 3GTPB 3VA5A 2MHVA 5A2QL 4UAIA 2F0JA 4OO1I 2KHSA 1DOKA 5F2DA 1MSGA 1EZ8A 1GHKA 1HFNA 1I4QA 2AQ1B 4WJWA 1LTSD 3M7GA 4KD4A 4ODGA 2D5DA 1SBBB 3TZDA 1NR2A 1EWCA 1STBA 2E75C 2ICEC 4HCEA 4ZUIA 2K1BA 2V4DA 4WRDA 1LACA 1F77A 2K32A 3SDZA 4TQUS 4XYOA 1Q1BA 1Y1VB 1LV9A 2KCCA 2OXPA 1DJRD 4X3SA 1WTPA 1O80A 3MFYA 3QOLA 3NK9A 2NVXB 2QEJC 3QIAA 3GV3A 1D5XC 2XWJB 1SYBA 2IJ0A 5CBEE 1I50B 1HA6A 2ZXOA 3DHQA 1F9SA 1ZXTA 2F0PA 1SJED 4EVOA 2ZT9C 3DM1A 1STYA 4DNRB 1NSNS 5KNBA 2Y0SB 2EXZA 2WACA 2F0VA 2EPBA 3FVQA 1SMYC 2F0NA 1Y8OB 2Z1CA 3CHBD 5DAUA 1HTPA 2JE6I 1FNUA 1JC7A 3MZ5A 3ND9A 4HSVA 4XXEA 5C0XH 3I90A 1UEAB 1S5BD 1FR3A 3BS1A 3NPPA 1E2ZA 2B63B 4DXFA 3R8BA 2R92B 4UDUC 3KLSX 3J7YW 2K03A 4HSPA 3KUPA 1BO0A 4QCLA 4C56C 4NMZA 4K14A 4BS9A 4HMIA 3CRLC 3CU7A 2B2WA 2FINB 5ELBA 2L4NA 3MEHA 1E0BA 2F0QA 2EYLA 2L12A 4HAEA 3HOZB 1VF7A 5CV7A 5M5XB 4C3IB 3NSWA 2F3VA 4XQQA 2EDGA 1BDOA 1NAPA 5D65A 1EIHA 4GZYC 4ZRZA 1GOZA 2JA8B 5M3FB 3GP7A 3C1FA 3I73A 4DF7A 3J81E 1LT4D 5C4JB 3OW7A 2A68D 3T4AC 1J8IA 3VR6A 2YU9B 2PQEA 1SYGA 2HUGA 5M5WB 3S1MB 1ONLA 4OO1H 2LY7A 5E3FA 5CC4A 1D1KA 5LHY1 3IAYA 3RZDB 2LKVA 4XDXA 3TN2A 2RDHA 1SE2A 2IWHA 3S17B 1I3QB 3CKIB 4QMGA 3HOYB 1X3PA 3E6ZX 4KN7C 2DNEA 1A3TA 3VR3A 3FKIB 4MHEA 3AU7A 3DMUA 3OSOA 4BA1I 2TMPA 5K36H 4R9WA 2X6GA 3I8ZA 2PZWA 3OPOA 1EEID 4N9PA 2VXWA 3SVMA 1SNCA 1WVLA 1OXSC 2L0CA 4E6IA 1CHQD 1ENFA 2NVYB 3S2HB 2O2LD 1AW7A 1PFMA 1KLUD 3PO3B 2HCCA 4F8MA 1G2SA 3C3LA 2EJFC 3VYUA 4ZKBB 5IIFA 1HUMA 4C3HB 1RD9D 4BBSB 1VCIA 4LK1C 4O42A 1STNA 3DUZA 3TMEA 1D5MC 2KJXA 4HCSA 3I3CA 2Q8TA 1B50A 1H9MA 1GUWA 2C5CA 1PTOB 4H0LC 3BG3A 4PMWA 4K6LA 3P20A 2NN6G 1X3QA 3VA7A 2MGSA 1WD1A 4A3BB 1D6EC 5COYA 1BCPC 2IW3A 2KEDA 5C5LA 3S1RB 2HDLA 1TR5A 3RD4A 1LABA 2X69A 2F0LA 1QOHA 4EQNA 2JA5B 1AN8A 1F9QA 5DM73 3PUYA 1H9SB 2L11A 2PW7A 3MA2B 1KABA 1PTOD 4FF3A 3WOEA 2XSCA 3GTGB 5JVG3 2A69C 1OXUA 1IKMA 1QJOA 1GJXA 1OXXK 1D5ZC 2F0TA 3IL8A 1BBXC 3NTIA 1S5FD 1B1ZA 3BZDB 1V1PA 3V05A 4RFBA 1XYIA 4ABNA 4WFN3 1LO5D 1TY2A 4I7ZC 2KECA 5ISRA 2IX1A 2F0GA 3MTSA 4L6TB 3WDNA 3RUZA 3J81L 1DYQA 4RGNA 1B4OA 2NBFA 3SE0A 2IT1A 4CHTB 3GD7A 2X6LA 2K6AA 2L55A 4F87A 3MXUA 4IFDJ 1B53A 2WV6D 4DAYA 3SEBA 1PFBA 1CZGA 3BDCA 1A15A 2NVTB 1F2MA 2K04A 2RSOA 3A7AB 2M2LA 3M4YA 3H6MA 4FF2A 2JA6B 1SAPA 4QIWB 1LLRD 5I6YA 4DA2A 2EY1A 1LT3D 3ZYYX 1K8OA 3M7NA 1C48A 4RA8A 1LT5D 1PRTF 5T1GA 3NBHA 3QB3A 1V1OA 1GUSA 2PZUA 1PMRA 3PV0A 3NP8A 1QWYA 4FO2A 2F0WA 2Q8RE 3J7AF 1TU2B 2KA7A 1EY7A 1QNUA 1TIID 1SE4A 5FO7B 1JQYD 1C4QA 3HZXA 4RCNA 2VNUD 1DCZA 5ELCA 3TDQA 2K5WA 4C3JB 3CRKC 1KNAA 3TP8A 3VYSA 3KBXA 1A2UA 2CW0C 2D2CC 1DOLA 5EGTA 1U4LA 2Z4IA 1TKWB 3A8KE 2FHTA 1Q12A 1Y1WB 1IYVA 2F0KA 3K59A 1TVXA 1EY9A 5FKAC 2QILA 2D62A 2Z8LA 4ZLTF 3PUWA 3IFDA 4K8IA 2G9HD 5HURA 2LMCB 3NWSA 3K5OA 3NHHA 2L1BA 4XT3B 3BVZA 4IALA 5EKLA 3SK8A 3BVMA 3X3MA 3ND8A 3N6RA 1ILPA 3E5SA 4RKBA 3K5NA 3EQLC 1SMYD 5EKIA 1S5DD 2H4OA 3HRZC 2EOTA 1CA6A 1PZID 3W3AA 4OIJA 1H9JA 1BOSA 5EKKA 1EY6A 5EPLA 1KTKA 1V8QA 1Z6HA 3L7ZC 4KY6A 4P2CB 3TZUA 1JOKA 5DNFA 3LWEA 1XX8A 2MPMA 5IOCA 1M4VA 2RDFA 1B3AA 3FRPB 4CKEA 3SR1A 1STGA 1TY0A 2B8GA 5KNDA 4X3KA 1EWHA 2BDNA 3V2TA 1U4RA 2B8FA 2R61A 3SXHA 1U9RA 3V96A 5I2XA 2BCOA 1OO9B 1XWEA 5IGDA 3W2DA 4L63B 1AZQA 5C6AA 1CT1D 2AQ2B 5KGUA 2A6ED 3A54A 3J80E 2QF7A 4IUUA 3DEPA 2A6HD 1Y8PB 1WTOA 1GUGA 1Z47A 5KRUA 2GA4B 2JP1A 2O4XA 3M4OB 3OHXC 3U9OA 1G91A 1LTRD 4C1NK 4KI0A 5IT9E 1CZWA 1FD7D 4DU9A 1RTOA 1VF5C 1Q1EA 1FGBD 1I4PA 4K5WA 4B08A 1CM9A 2QKIC 5JEAJ 5IGCA 2A73B 3A7LA 2B2TC 2JEBI 3X3NA 2AQ3B 2MJ8A 1K8MA 4CJ2C 1X32A 4A3JB 4A3IB 1PXUA 2JXMB 4I65A 4Y7NB 1B9MA 3D6WA 2EY2A 5JPNC 1JOOA 3GTQB 3H0GB 1WTRA 2B2UA 2BDOA 3D8GA 4C1NI 1UNSA 1ENAA 4DK0A 1AZPA 2F1MA 2K05A 3UI2A 3A8IE 4HR7B 2F4IA 3FPPA 3CQZB 1QE6A 4RGTA 3NUCA 4XQJA 2FMMA 4F7XA 5C3EB 1EYDA 4EQPA 3MXPA 1BCPB 2WKDA 1LT6D 1D1IA 1ET6A 1CFMA 3E0JA 4IURA 3PUVA 5KEEA 2PNRC 2SNSA 3QJYA 2A6EC 1FNWA 1STHA 5D3IB 4KMUC 2A6HC 5BN5A 1FYCA 4PMCA 5NUCA 3SK5A 1XTCD 3L9AX 1EY4A 1RJTA 3ONAB 3FPUB 1JOQA 5T1IA 4XTCS 4C3IG 4DN4M 1BCPD 3C1EA 2C9OA 4S3SA 2JA7B 2PYKA 3ITPA 4XIGS 2R6GA 1KDAA 1SEBD 2SEBD 4TSSA 5M5YB 5D14A 4QUFA 1PFNA 4PV1C 3O13A 1WD0A 3K5MA 3NXWA 1EQTA 2F0OA 3LNNA 1OXTA 1TWCB 2XRSD 1HRJA 4KV6A 5EBCA 1EQVA 1O7ZA 1BUVT 4NDXA 5TSSA 2A69D 1B44D 3S1QB 4HMJA 2SNMA 1SYEA 2PO4A 3KLRA 1HHVA 5IGGA 2F03A 3I4LA 1RF2D 4IUQA 1IW7C 1ESRA 1CQFA 2F0MA 2FFKB 4NW2A 4FXDA 1Q90A 4YIJA 1G6ZA 4ID6A 1PRTB 5I6WA 2M00A 2B2UC 1O7YA 3KK7A 1PZKD 4X3UA 1HQMC 4HEDA 3OMCA 3J80L 2XVSA 5JVH3 1U4PA 5CV4A 1A6XA 4PQXA 2B2WC 3K5LA 2PPBC 1T5EA 2B39A 1EU3A 3TBIB 3NTHA 4HN7A 3F2UA 2KVMA 2ZXPA 5IT9L 2EVBA 4M8AA 2RKSA 2L9HA 5BN3A 2WKCA 2OT2A 3PO2B 3OOCA 1IYUA 4HTHA 3HKZB 1WCMB 4ZAIA 5D3DA 4ZQ3A 2LFNA 1QG7A 4C3HG 2WINB 1F2LA 1Y8NB 2NTSA 2IX0A 2AWOA 3RMHA 1NUCA 5FO8B 5KYIA 4KY5A 1CQVA 1RODA 1SSOA 4H44C 5HGTA 4C2MB 1PZJD 2EJGC 2ZXRA 1MGSA 3T51B 4ZUJA 3MFGA 3OIPA 3MHBA 1G8ZD 4KKUA 4PMBA 4OIKA 2F3WA 3R93A 1GXDC 2N88A 3I4MB 1Q8IA 1WTQA 1F2YA 2NWGA 3DWQA 3HEJA 3KLSA 4ZK9B 4RKLA 2F0EA 1JWMD 1JORA 1V1PB 3NTKA 5A2QE 2ID0A 2E2IB 3EA6A 3QOJA 2CW0D 4BWGB 1SNDA 2AWNA 3AB9A 4ZKCB 2RBMA 3TP7A 2K7VA 4MIUA 4DGZA 3MWYW 2B2VA 5CMDA 4EGVA 3SK6A 3RLFA 3HOXB 2WIIB 4G7ZC 2AUKA 4IN3A 5CYUA 3MXGA 4RAUC 2J4XA 1E2VA 2KCNA 5DEHA 1AP0A 3HOVB 4CBVA 2IPKD 3K7AB 3D3RA 5I9PA 3DWAA 1VDZA 3OMGA 1PRTC 2WP8J 1SFOB 1G2TA 2VB2X 3K6OA 2NN6I 5LL6X 4K8JA 4IFDG 1R9TB 2Z4HA 1ESFA 2FJ2A 3U9SA 1DXMA 3VR2A 1S4ZA 5EPJA 2YYZA 4KTAA 1NR4A 1KNEA 1I4GA 2I46A 3TP5A 3BDLA 3D4DA 5A35A 1QCBD 2MUYA 5LL6S 2KUMA 2QCPX 1JICA 4CKCA 2F0SA 4J1MA 1PTOF 3OIQA 2N55A 4B9WA 3H3VC 2NYZD 1I6VC 1B9NA 5C4ZA 4IZ8A 1ICWA 1HPCA 1CA5A 2XRQD 1RDPD 3N52A 1LTBD 5C44B 3GTLB 1BNZA 4G57A 4R8NA 2RSNA 2EYMA 4MN3A 1A3UA 1HXYD 2I07B 3GO5A 2BE5C 2KOLA 4C3JG 1TS3A 3NQIA 1ZKOA 1PLFA 1BXTA 1Z7TA 4TRDA 1EOTA 4OHJA 1TWFB 3PUXA 5CV9A 3T13A 3BYTB 4B9XA 4XT1B 3FDTA 1II3A 1YNJC 1ILQA 1EFID 5J1ZA 1ET9A 3VYRA 4RH6A 1SYFA 2PW5A 4XQNA 3P1HA 2EYJA 1LTTD 2E2JB 3BYYB 3S2DB 3FMCA 1JB3A 4K6DA 1CK1A 1SJHD 1HQRD 1F9PA 3H91A 1IL8A 1YNNC 3I91A 4J8QA 4TKOB 2O5IC 4PNYA 4IFDI 2B2YA 1HA5A 5CR3A 1IHZA 1I4HA 4ULLA 4XYQA 5M3MB 1TS2A 3NQTA 3Q24A 4FNFA 2TSSA 3R2TA 5CGKA 1ZYRC 2NN6H 1WTXA 2HDMA 3KBGA 3D31A 4A3EB 1JWSD 3G6JB 2SDFA 2NTTA 1HCZA 4A3DB 2ICIA 1SNQA 4QF4A 1ML0D 3D4RA 3HG9A 4IUPA 5CV8A 4CKBA 4DFAA 1DM0B 1AFPA 3DWPA 1M8AA 4KKTA 2F0DA 4ZYSA 3T16A 1CHPD 4KKSA 4BY1B 5ELFA 2VUMB 2R93B 5FO9B 2EYFA 1PTOH 2XWBB 3NE5B 3J7AV 4N9TA 1EZ6A 3K0YA 1TQOA 3BDOA 3GTOB 4A3GB 1BF4A 4NP5A 4DK1A 4LJZC 1I4RA 3TP6A 2JSOA 1I4XA 1NCVA 5G3LF 2NZ1D 1MBYA 2F0FA 5JEAG 2NUCA 5FOBB 1T5XD 1STAA 1EY0A 1EIGA 1RHPA 1EYAA 3M3YB 5KNCA 3HOWB 2EYPA 4ME5A 2K5QA 1RTNA 2HQEA 2RVLA 5E4XA 2VB3X 4K2LA 1IW7D 2RQXA 3A8JE 3RZOB 5C3XA 5IODA 3Q22A 2LS01 3MC0B 4FF4A 1GUOA 3LWUA 1SYDA 4BBRB 4KJNA 5BN4A 1H9RA 3VR5A 1ZEQX 1XXGA 3C2PA 1IKLA 4DAPA 2B2YC 4RWSC 3K57A 2O5JC 1DONA 4A3KB 1EY5A 4CGYB 3EROA 2BA1A 4RGOS 3PMFA 4IFDH 1QB5D 3EFXD 4LMQD 3EJIA 3DEOA 2JYOA 4FF1A 1FNVA 2MP1A 3QG1A 1JCKB 1UUPA 1H9KA 4A3FB 1TWAB 1SNMA 1F9RA 4R8IA 4EQOA 3Q23A 4J6HA 4OL7A 5KYLA 5IGFA 1KDBA 1WTWA 5CV6A 4KHZA 2E74C 3C46A 4V0BA 3A55A 2F0HA 5JAVA 4L8JA 2EE1A 4RHSA 1LTID 1W6JA 5JOBA 3URYA 4IUTA 2QDBA 1U4MA 1JE4A 3MAQA 3QO2A 3GTJB 4BA2I 1TT2A 1V43A 2L5TA 3NWTA 3L3OC 4IUNA 1KDCA 2XIWA 3GV6A 1DD2A 4NKLA 1OXVA 4H7BA 2AUJD 3D4WA 3MVVA 5I2YA 3H94A 4RGMA 4Q5VA 3K58A 2EY6A 4M1UB 2PCFB 3OWEB 5CBAE 4FXKC 2ENBA 3S15B 5FLXE 2NB0A 4WORA 2A68C 2M9VA 1BQQT 2R7ZB 3JAME 2Q8IB 1SXTA 3P75A 2XNAC 1R4QB 1PRTD 4Z9CB 4RCOA 4AYBB 2EYHA 3HP3A 1JWUD 1AEXA 1SE3A 4KN4C 1F2ZA 5EQ0A 2G9DA 5C5MA 2EZVA 5E1FA 2DY8A 1GUNA 3R2IA 3GQBA 3QWNA 2DY7A 1E2WA 1VMCA 1MSHA 4IQZA 1CI3M 1MD2D 5EPKA 2NVQB 1BCPF 5AFWA 5EBDA 3T53B 5C0XJ 5K5PA 3S9WA 5I4DA 2RA4A 3T56B 1ENCA 4JBWA 2J7ZA 2OF1A 2RDGA 1DZ1A 1H9SA 1TS4A 1QILA 2J0TD 1TWGB 3HGBA 1SNPA 2JEAI 3VYTA 4LAAA 3G7LA 2EYOA 1LTGD 2H1EA 1O78A 1O7LA 3S16B 3HS0C 3IFTA 4CJ0B 1A2TA 5C0XG 4RHRA 5C3WA 2IL8A 1TS5A 3IKJA 3M85A 1PYWD 3D6CA 3S1NB 3R3OA 4ILWA 3SK4A 4BY7B 5J39A 2PZTA 2PMZB 5CV5A 2BOSA 3FEWX 1DOMA 1HUNA 1TWHB 2BE5D 3H09A 5EJWA 1EY8A 5JJZA 2XN9C 1Y69U 3PUZA 3I70A 4KJOA 3LX0A 5JEAH 4V190 1EYCA 3DXJC 2CVRA 1S5CD 3I4NB 4K5XA 1Q3LA 2K33A 4CJ1B 2HCIA 4IUVA 4KHVA 1A3VA 3OWFA 1I6HB 1YNJD 4Q0FA 4H13C 1GUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W2D A;  1I4G A;  1PTO B;  4L63 B;  1CT1 D;  1EU4 A;  2AQ2 B;  1HA5 A;  4K6L A;  1L0Y B;  1MD2 D;  1PRT B;  1STE A;  4RHS A;  1BCP F;  4BWG B;  1LTI D;  1I4H A;  3URY A;  1PZK D;  2QIL A;  1JR0 D;  5FKA C;  1FNW A;  2Z8L A;  2RDH A;  5D3I B;  1SE2 A;  5ELE A;  1D6E C;  1TS2 A;  2G9H D;  1BCP C;  1PTO F;  5I4D A;  2TSS A;  2WV6 D;  2CHB D;  3R2T A;  1XTC D;  3CHB D;  1L0X B;  5ELD A;  3SEB A;  1LTR D;  2RDG A;  3MC0 B;  1PTO C;  2XRQ D;  1RDP D;  3BVZ A;  1FD7 D;  1JWS D;  1LTB D;  1TS4 A;  1QIL A;  1FNU A;  3BVM A;  2NTT A;  1EU3 A;  1FGB D;  1I4P A;  1LLR D;  3BVG A;  2ICI A;  1LTG D;  1LT3 D;  1S5B D;  1HXY D;  1BCP D;  1EEI D;  4DXF A;  2AQ3 B;  2J4X A;  1AN8 A;  3R8B A;  1XXG A;  4UDU C;  3KLS X;  1TS3 A;  3DWP A;  4RHR A;  1S5D D;  1LT5 D;  4RGM A;  5D3D A;  4DXG A;  1PRT F;  2IPK D;  1LTA D;  1CHQ D;  1PTO D;  4C56 C;  1PZI D;  1TS5 A;  1V1O A;  4ZYS A;  1SEB D;  2SEB D;  1PYW D;  1CHP D;  4TSS A;  1EEF D;  1ENF A;  1I4Q A;  2NTS A;  2AQ1 B;  3DWA A;  5ELF A;  5ELB A;  1PRT C;  3O13 A;  1BXT A;  1LTS D;  1PTO H;  2O2L D;  4RGO S;  1AW7 A;  3OWE B;  1KTK A;  4OHJ A;  1SBB B;  3EFX D;  1D5Z C;  1KLU D;  3BYT B;  1EWC A;  2XRS D;  1HTL D;  1CQV A;  1FNV A;  1SE4 A;  1JQY D;  1PZJ D;  2XN9 C;  1JCK B;  1UUP A;  3TSS A;  1EFI D;  1F77 A;  1S5F D;  1UNS A;  5FK9 C;  1B1Z A;  1ET9 A;  1ESF A;  4RH6 A;  5ELC A;  1SXT A;  3BZD B;  1V1P A;  5TSS A;  3V05 A;  1I4R A;  3MFG A;  1DJR D;  1LTT D;  1G8Z D;  2XNA C;  4RFB A;  1PRT D;  3BYY B;  1M4V A;  1GOZ A;  1B44 D;  1I4X A;  4RCO A;  4Z9C B;  3GP7 A;  1RD9 D;  1CK1 A;  4O1N A;  4RGT A;  1SJH D;  2QEJ C;  1JWU D;  1TY0 A;  1D5X C;  1HQR D;  1LT4 D;  1S5C D;  1RCV D;  1SE3 A;  1KLG D;  1D5M C;  1LO5 D;  2IJ0 A;  3DWQ A;  1TY2 A;  1BCP B;  1RF2 D;  1LT6 D;  1JWM D;  1T5X D;  4L6T B;  1S5E D;  1V1P B;  2R61 A;  3R2I A;  1SJE D;  1DYQ A;  4RGN A;  1ET6 A;  3EA6 A; 
#chains in the Genus database with same CATH topology
 3EVQ A;  4KK7 A;  1SDF A;  2A74 C;  1CTM A;  2CH4 W;  3GTM B;  2PI2 E;  2Z6K A;  4JI7 Q;  1VQI A;  1RKN A;  4LUZ A;  1L0Y B;  1STE A;  1HFG A;  4JI4 L;  1K83 B;  2CQA A;  5KIX A;  4DV2 Q;  5JPM C;  4K5V A;  1PDQ A;  4OO1 G;  4G7O C;  1JR0 D;  2KBN A;  1YNN D;  3HOV G;  3MXN A;  2F0U A;  3E0E A;  3TQY A;  1VMP A;  3ERQ A;  2FMC A;  5DM6 3;  2CHB D;  3M4P A;  5E7N A;  2B63 H;  3S14 B;  4X3T A;  1B2T A;  1KRT A;  1VQC A;  1FVI A;  2R92 H;  5ELD A;  1SYC A;  4LUV A;  3AMU A;  1KHI A;  2A5H A;  4DR6 Q;  1PH5 A;  2DJG C;  1PTO C;  5M9O A;  3CCJ A;  1QVF A;  3KF8 A;  4WJ3 M;  1J9O A;  2WAQ B;  1Q8K A;  1L2F A;  4U67 3;  3I72 A;  5I9O A;  3PIO 3;  5C4X B;  3BVG A;  4JK1 C;  1BR9 A;  1E1T A;  1JE5 A;  4DKA C;  3CQZ H;  1QUQ A;  2HHH L;  3A56 A;  2IHE A;  1GHJ A;  1QNK A;  1SRU A;  1ZYR D;  5K36 G;  1UAP A;  3HOZ H;  3T1Y L;  2DNC A;  4DXG A;  2K5D A;  4AQY L;  1LTA D;  5M5X H;  1QVC A;  4C3I H;  2PNH A;  1G29 1;  1EEF D;  1U5K A;  1EL0 A;  1C8C A;  4DV0 L;  2DN8 A;  1KAW A;  5IYC G;  2EJM A;  3PIP 3;  2PQA B;  3OW2 A;  2JA8 H;  5M3F H;  3TEH B;  3WOF A;  4A3M B;  1WTV A;  3A74 A;  4G4K A;  5IYB H;  2IY5 B;  1HTL D;  5C4J H;  4A93 B;  2B2T A;  2E2D C;  3Q0A A;  3TSS A;  5FK9 C;  1PH2 A;  4OGQ C;  4G7H C;  1KAA A;  2YU9 H;  2KQ3 A;  2BA0 A;  2E76 C;  2KEE A;  4FXG C;  3W1B A;  2K01 A;  5FLX L;  5C0X I;  1IBK L;  1HR0 Q;  1EQQ A;  4EQ5 A;  4FYD A;  5M5W H;  2VQE L;  4K2K A;  3S1M H;  2K5H A;  3JAM L;  5COR A;  1R4P B;  4JC0 A;  4O1N A;  4DR7 L;  2EY5 A;  2IX3 A;  4FP5 D;  1RCV D;  2E2H B;  1KLG D;  2PI2 A;  5G3L D;  2B2V C;  3EN2 A;  2ES2 A;  4F88 A;  4GLX A;  1W6K A;  1S5E D;  4KD3 A;  5C44 G;  1SNO A;  1I3Q H;  4LFB L;  2VZA A;  5J22 A;  3CF5 A;  3NBI A;  4UP7 A;  2SOB A;  4LFA L;  4DAV A;  1RL2 A;  1MI2 A;  2D9U A;  3I56 A;  4NXN Q;  3HOY H;  3GTK B;  2OEO A;  1EU4 A;  5IGB A;  3Q6S A;  3SHL A;  5IE8 A;  4QB4 A;  5M5Y H;  3G6E A;  4DNT B;  4B3S Q;  3FKI H;  4IOC A;  4FVM A;  4QUC A;  3VR4 A;  5ELE A;  4OX9 Q;  1J5E Q;  2ZTD A;  5GRO A;  4KY7 A;  5C4H A;  3HOU B;  2K28 A;  2P5Z X;  2R3Z A;  4UP9 A;  1L0X B;  4JBJ A;  2WB1 B;  2F0I A;  4DK6 C;  1BKB A;  5E4W C;  1D2B A;  5IGE A;  4U68 A;  3P7J A;  3GTP B;  3VA5 A;  2MHV A;  5A2Q L;  4JI4 Q;  4DV3 L;  4UAI A;  4O2D A;  3U50 C;  2NVY H;  2VQF L;  2F0J A;  4HJ8 A;  2Z6K C;  4OO1 I;  4HJ7 A;  4IPH A;  2KHS A;  1X54 A;  3PO3 H;  1DOK A;  3M4Q A;  5F2D A;  1MSG A;  1EZ8 A;  1GHK A;  1Q46 A;  4DR5 L;  4DR3 L;  4LF4 L;  1HFN A;  1I4Q A;  2AQ1 B;  1M1K C;  1FL0 A;  4MTK A;  4WJW A;  1LTS D;  3M7G A;  4KD4 A;  4ODG A;  2D5D A;  4JVZ A;  1SBB B;  3STB D;  3TZD A;  2ZJQ A;  3I2Z A;  1VQ9 A;  4GNX B;  4C3H H;  1NR2 A;  1EWC A;  1STB A;  2E75 C;  4LF9 L;  2ICE C;  4HCE A;  2HHH Q;  1CUK A;  4ZUI A;  3AQQ A;  2K1B A;  2V4D A;  4WRD A;  1LAC A;  1F77 A;  5IYD G;  3T1Y Q;  2K32 A;  3SDZ A;  4AQY Q;  4TQU S;  4XYO A;  1Q1B A;  1Y1V B;  1LV9 A;  2K5N A;  2KCC A;  2OXP A;  1DJR D;  4X3S A;  1WTP A;  1O80 A;  3MFY A;  3QOL A;  5M3M G;  4DV0 Q;  3NK9 A;  1X9N A;  2NVX B;  4L5S A;  2QEJ C;  4HIK A;  3QIA A;  3GV3 A;  1D5X C;  4JI5 L;  2XWJ B;  1SYB A;  2IJ0 A;  5CBE E;  1I50 B;  3KYH C;  2ZJR A;  1HA6 A;  2ZXO A;  4A3E G;  3DHQ A;  1F9S A;  1ZXT A;  1AE3 A;  2F0P A;  1GVP A;  1SJE D;  3CAM A;  4EVO A;  4A3B H;  3PO2 H;  4A3D G;  2ZT9 C;  1WCM H;  3D0F A;  3DM1 A;  1IBK Q;  1STY A;  2AKW B;  2VQE Q;  4DNR B;  1NSN S;  1Y14 B;  5KNB A;  5GAG C;  1I94 L;  1XJV A;  3K81 C;  2Y0S B;  2EXZ A;  4DR7 Q;  1Q81 C;  2WAC A;  4IJL A;  1LUZ A;  4BXX H;  1K9M C;  2F0V A;  1PH3 A;  5FJ8 H;  2EPB A;  3FVQ A;  1SMY C;  3KDF B;  4BY1 G;  2F0N A;  2VUM G;  1Y8O B;  2Z1C A;  1KC8 C;  2R93 G;  3CHB D;  5DAU A;  4LFB Q;  1HTP A;  2OTL A;  3KOJ A;  4LFA Q;  4AH6 A;  1B3Q A;  2JE6 I;  1FNU A;  1JC7 A;  3MZ5 A;  3ND9 A;  4HSV A;  4XXE A;  2JJQ A;  4YCU A;  5C0X H;  1K3R A;  3I90 A;  1UEA B;  5HGQ A;  1S5B D;  1FR3 A;  4JI2 L;  3BS1 A;  3NPP A;  4P71 A;  1E2Z A;  1UWV A;  2B63 B;  4A3G G;  4DXF A;  4MNO A;  3R8B A;  2R92 B;  1HNX L;  4UDU C;  3KLS X;  3J7Y W;  2K03 A;  2HD3 A;  4HSP A;  3KUP A;  1BO0 A;  4QCL A;  5HY6 A;  4C56 C;  4YY3 L;  3T1H L;  4NMZ A;  4DUZ L;  4K14 A;  4BS9 A;  4HMI A;  3CRL C;  4IPG A;  3CU7 A;  1AE2 A;  2B2W A;  2FIN B;  5ELB A;  4NXM L;  1AH9 A;  1GKH A;  2L4N A;  4P74 A;  1X3F A;  2K14 A;  3MEH A;  1E0B A;  2F0Q A;  2VQF Q;  2EYL A;  2L12 A;  4HAE A;  3HOZ B;  3Q8D A;  1VF7 A;  1PYS B;  5CV7 A;  5M5X B;  4C3I B;  4ALP A;  3NSW A;  2F3V A;  4XQQ A;  4QGU A;  1PH6 A;  2EDG A;  1BDO A;  3HOW G;  1NAP A;  2ALY B;  5D65 A;  1EIH A;  4DR5 Q;  4DR3 Q;  4LF4 Q;  1PH8 A;  4GZY C;  5C3E G;  4ZRZ A;  1GOZ A;  2JA8 B;  5M3F B;  3GP7 A;  1VQA A;  3C1F A;  3I73 A;  3HOX H;  4DF7 A;  3J81 E;  1LT4 D;  5C4J B;  5FLM G;  2H5X A;  3OW7 A;  2A68 D;  3T4A C;  4LF9 Q;  1J8I A;  3VR6 A;  2YU9 B;  2PQE A;  1SYG A;  2HUG A;  5M5W B;  3S1M B;  3ULJ A;  4BBR G;  1ONL A;  1Q82 C;  4OO1 H;  2E8G A;  5IP7 H;  2LY7 A;  5E3F A;  5CC4 A;  1D1K A;  3CCU A;  4QL5 A;  5LHY 1;  3IAY A;  3RZD B;  2LKV A;  4XDX A;  3TN2 A;  3UDI A;  4JI5 Q;  1VQB A;  2RDH A;  1SE2 A;  2IWH A;  3S17 B;  1I3Q B;  4GNX C;  3CKI B;  4A3K G;  3W1G A;  2YTV A;  1YI2 A;  4QMG A;  3HOY B;  1X3P A;  2KHI A;  3E6Z X;  4UP8 A;  4KN7 C;  2JN4 A;  2DNE A;  1GD7 A;  1A3T A;  3VR3 A;  3FKI B;  1XPR A;  1CKN B;  2YTY A;  4MHE A;  3AU7 A;  1I94 Q;  3DMU A;  3OSO A;  4BA1 I;  2OQK A;  2TMP A;  5K36 H;  1K28 A;  4R9W A;  2X6G A;  3I8Z A;  2PZW A;  3HKZ E;  3OPO A;  1EEI D;  2EIF A;  1FGU A;  4N9P A;  1Q86 C;  1CSQ A;  2VXW A;  3SVM A;  1SNC A;  1WVL A;  1OXS C;  2L0C A;  3K0X A;  4JBM A;  3I7F A;  4E6I A;  1CHQ D;  1ENF A;  2NVY B;  1YJN A;  3S2H B;  3F1Z A;  4X64 L;  2O2L D;  2CQO A;  1AW7 A;  4C3J H;  1P8L A;  2UXD L;  4JI2 Q;  1PFM A;  1KLU D;  3PO3 B;  1HNX Q;  2HCC A;  4RMF A;  2YV5 A;  4F8M A;  5LMU L;  1PA6 A;  1CKM A;  2VY3 A;  1G2S A;  3C3L A;  4N8X 1;  1VQF A;  2EJF C;  3EIV A;  3VYU A;  4DR2 L;  3T1H Q;  4ZKB B;  4DUZ Q;  3CCR A;  5IIF A;  1HUM A;  2KCT A;  4C3H B;  1RD9 D;  4NXM Q;  4GKJ L;  1VCI A;  4LK1 C;  4BBS B;  4ME3 A;  1T9H A;  1Y1W H;  1XNQ L;  4O42 A;  1NY4 A;  1STN A;  3DUZ A;  3GTL H;  3UDF A;  3TME A;  1D5M C;  2KJX A;  4HCS A;  2CH4 A;  3I3C A;  1L1O A;  1BBU A;  4YCW A;  2Q8T A;  2XTI A;  1B50 A;  1W2B A;  1H9M A;  1UE1 A;  1GUW A;  2C5C A;  1PTO B;  4H0L C;  3BG3 A;  4PMW A;  3KF6 A;  4K6L A;  3P20 A;  1HJP A;  2NN6 G;  1X3Q A;  3VA7 A;  4RG1 A;  2MGS A;  2DUD A;  1WD1 A;  4A3B B;  2R7D A;  1D6E C;  5COY A;  1BCP C;  1EQR A;  2IW3 A;  2KED A;  1DGS A;  4GKK L;  5JJK A;  5C5L A;  3ICE A;  3S1R B;  2HDL A;  2UU9 L;  5AJ3 L;  1TR5 A;  3RD4 A;  1LAB A;  2X69 A;  2F0L A;  1N36 L;  2R7Z G;  2FXQ A;  1QOH A;  4EQN A;  2JA5 B;  1AN8 A;  1F9Q A;  2QW7 A;  5DM7 3;  4A76 A;  3PUY A;  1H9S B;  5FLX c;  2L11 A;  2PW7 A;  3MA2 B;  1KAB A;  4AYB G;  1PTO D;  4FF3 A;  3WOE A;  2XSC A;  4DV6 L;  3GTG B;  4JG2 A;  3JAM c;  2K75 A;  5JVG 3;  3I55 A;  2A69 C;  1OXU A;  1PH1 A;  1IKM A;  1QJO A;  1GJX A;  5ELO A;  1OXX K;  1D5Z C;  2QA4 A;  1PFS A;  2F0T A;  4JPB W;  1YIT A;  3IL8 A;  2HT1 A;  1BBX C;  3NTI A;  2KHJ A;  4A3C H;  1S5F D;  4X62 L;  1B1Z A;  3BZD B;  1V1P A;  3V05 A;  4HIM A;  4RFB A;  4X64 Q;  1B8A A;  1XYI A;  3RLO A;  4ABN A;  1VQM A;  2UXD Q;  1XPO A;  4WFN 3;  4A3D H;  1LO5 D;  1TY2 A;  4I7Z C;  1U0L A;  2KEC A;  5ISR A;  2IX1 A;  2F0G A;  3MTS A;  4L6T B;  5LMU Q;  3WDN A;  3RUZ A;  3J81 L;  1M90 C;  1DYQ A;  4RGN A;  3PGZ A;  1B4O A;  2NBF A;  3SE0 A;  2IT1 A;  4CHT B;  3M4O H;  3GD7 A;  2GVA A;  2X6L A;  2K6A A;  4GKJ Q;  2L55 A;  1HR0 W;  1PYB A;  4F87 A;  1XNQ Q;  3MXU A;  4IFD J;  1VQ6 A;  1EFW A;  1B53 A;  2DGY A;  2WV6 D;  4DAY A;  3SEB A;  1PFB A;  1CZG A;  3BDC A;  1A15 A;  2NVT B;  3U4Z A;  1F2M A;  4BY7 G;  4PZ7 A;  2K04 A;  4A3J H;  2RSO A;  3A7A B;  4A3I H;  2M2L A;  3M4Y A;  3H6M A;  3MXN B;  4FF2 A;  2JA6 B;  1SAP A;  4QIW B;  1LLR D;  5I6Y A;  3M9B A;  4Y7N H;  4DA2 A;  2EY1 A;  1LT3 D;  3PCO B;  1PVO A;  1IBM Q;  3K7U C;  3ZYY X;  1K8O A;  2CWA A;  1H95 A;  2CFM A;  3M7N A;  3E9I A;  3BZC A;  1C48 A;  1PV4 A;  1WFQ A;  3GTQ H;  1K0S A;  4RA8 A;  3H0G H;  3KF8 B;  1A0I A;  1LT5 D;  1PRT F;  5T1G A;  3NBH A;  3QB3 A;  1V1O A;  1GUS A;  2PZU A;  4GKK Q;  1PMR A;  3PV0 A;  3I4N G;  3NP8 A;  2C35 B;  4R4I A;  1QWY A;  1ASZ A;  2UU9 Q;  1G6P A;  4FO2 A;  2F0W A;  5AJ3 Q;  1QUQ B;  3AFP A;  2Q8R E;  4LF6 L;  3J7A F;  1TU2 B;  3CPF A;  2KA7 A;  1N36 Q;  1K8A C;  1EY7 A;  1QNU A;  4JI3 L;  5C3E H;  4B3T L;  1XPU A;  1TII D;  1SE4 A;  5FO7 B;  2Q2T A;  1JQY D;  1C4Q A;  5IP9 G;  3G4S A;  4JI0 L;  1O7I A;  3HZX A;  4RCN A;  2VNU D;  1DCZ A;  5ELC A;  5FLM H;  1E24 A;  4DV6 Q;  3TDQ A;  2K5W A;  4C3J B;  1XMQ L;  3CRK C;  4DAM A;  1KNA A;  3TP8 A;  1W3S A;  3VYS A;  3KBX A;  1A2U A;  2CW0 C;  4P73 A;  2K50 A;  1PH4 A;  2D2C C;  1DOL A;  5EGT A;  3CCV A;  1U4L A;  4A75 A;  1YJ9 A;  1V1Q A;  2WAQ G;  3H3V I;  2Z4I A;  3IRB A;  1TKW B;  4X62 Q;  1CSP A;  3A8K E;  1S72 A;  2FHT A;  5C4X G;  1Q12 A;  1Y1W B;  1IYV A;  4A3K H;  2F0K A;  2UUA L;  3K59 A;  1TVX A;  1EY9 A;  5FKA C;  2QIL A;  2MO1 A;  2D62 A;  2Z8L A;  3E9H A;  3PUW A;  4ZLT F;  3IFD A;  4AIM A;  1LM0 A;  4K8I A;  2G9H D;  5HUR A;  1YBY A;  2LMC B;  3NWS A;  3J81 j;  3K5O A;  3NHH A;  2UUC L;  2L1B A;  4XT3 B;  1X6O A;  3BVZ A;  2JA7 H;  4IAL A;  5EKL A;  3SK8 A;  3BVM A;  3X3M A;  2CCZ A;  2A19 A;  3J81 i;  3ND8 A;  3TS2 A;  3PIO A;  4A3M G;  3PF5 A;  3N6R A;  4A93 G;  1ILP A;  3E5S A;  2G5D A;  4RKB A;  3K5N A;  3EQL C;  1SMY D;  3PQI A;  5EKI A;  1S5D D;  2H4O A;  4R4Q A;  1TWC H;  3HRZ C;  2EOT A;  1EWI A;  1CA6 A;  1VQP A;  1PZI D;  3W3A A;  1OTC A;  4A3L G;  2KEN A;  4OIJ A;  1H9J A;  1BOS A;  5EKK A;  4JBK A;  4IPD A;  3KLW A;  1EY6 A;  5EPL A;  1UE6 A;  3PIP A;  1KTK A;  1V8Q A;  1Z6H A;  3L7Z C;  4KY6 A;  4P2C B;  3S1Q H;  3BZK A;  3TZU A;  1JOK A;  3UE1 A;  5DNF A;  3LWE A;  1X65 A;  3OYY A;  1IZ6 A;  1XX8 A;  4NB3 A;  1WOC A;  2MPM A;  5IOC A;  4JOI A;  1M4V A;  2RDF A;  1B3A A;  3FRP B;  3CXC A;  4CKE A;  3SR1 A;  3HOU G;  1STG A;  1TY0 A;  4YHH L;  4DV1 L;  1EIF A;  1LTL A;  4LF6 Q;  2B8G A;  5KND A;  4X3K A;  5GAD C;  1EWH A;  2BDN A;  1RIP A;  2WB1 G;  4JI3 Q;  3V2T A;  1U4R A;  2B8F A;  2R61 A;  4LW1 A;  4B3T Q;  3SXH A;  1N34 L;  1KL9 A;  1U9R A;  4JI0 Q;  3V96 A;  1I5F A;  5I2X A;  4H02 A;  2BCO A;  1OO9 B;  5DLQ E;  1XWE A;  5IGD A;  3W2D A;  4L63 B;  1XMQ Q;  1AZQ A;  5C6A A;  1CT1 D;  2AQ2 B;  5KGU A;  2A6E D;  2OCE A;  3A54 A;  3F2B A;  3J80 E;  2QF7 A;  4IUU A;  4MTN A;  3DEP A;  2A6H D;  1Y8P B;  1WTO A;  1GUG A;  1Z47 A;  1ICF B;  1QZH A;  5KRU A;  2GA4 B;  2JP1 A;  2UXB L;  2O4X A;  3M4O B;  3OHX C;  4GOP A;  3U9O A;  1Q7Y C;  1G91 A;  1LTR D;  3CC2 A;  4C1N K;  4KI0 A;  3ULL A;  5IT9 E;  1CZW A;  1FD7 D;  4DU9 A;  1RTO A;  1VF5 C;  1Q1E A;  1FGB D;  1I4P A;  4K5W A;  2UUA Q;  4B08 A;  2Q2U A;  1CM9 A;  2QKI C;  5JEA J;  5IGC A;  2A73 B;  3A7L A;  2B2T C;  2JEB I;  3X3N A;  2AQ3 B;  2MJ8 A;  1VQ7 A;  1K8M A;  4CJ2 C;  1X32 A;  1Y1V G;  3JAM i;  2MO0 A;  1PHJ A;  4A3J B;  2UUC Q;  4A3I B;  1PXU A;  2JXM B;  4I65 A;  4C2M H;  4Y7N B;  1B9M A;  3D6W A;  4P72 A;  2EY2 A;  5JPN C;  1X56 A;  1JOO A;  1SLJ A;  2VW9 A;  3GTQ B;  3H0G B;  2DJF C;  3KJO A;  3J80 c;  4GLV B;  1WTR A;  1HZA A;  2B2U A;  2BDO A;  1C7Y A;  3D8G A;  4C1N I;  3CCQ A;  3I4M H;  1UNS A;  1ENA A;  4DK0 A;  4YWK A;  4YWM A;  3K8A A;  1AZP A;  2Y0S G;  2F1M A;  1N9W A;  2ATW A;  2K05 A;  2E2I H;  4N8F A;  5IT9 c;  3UI2 A;  3A8I E;  4HR7 B;  2F4I A;  3FPP A;  3CQZ B;  1QE6 A;  3CPW A;  4RGT A;  3NUC A;  4XQJ A;  2FMM A;  4F7X A;  2GN5 A;  1EYD A;  5C3E B;  4EQP A;  3MXP A;  1BCP B;  2WKD A;  4YWL A;  1LT6 D;  4A4I A;  1D1I A;  1YHA A;  1ET6 A;  1CFM A;  2QGQ A;  2XGT A;  3E0J A;  4IUR A;  3PUV A;  5KEE A;  2AHO B;  2PNR C;  5LMN W;  5BR8 L;  2Q2H A;  2B63 G;  2SNS A;  3QJY A;  2R92 G;  3S1N H;  2LSS A;  2A6E C;  4YHH Q;  4DV1 Q;  1FNW A;  1STH A;  5D3I B;  4PG3 A;  4KMU C;  2A6H C;  5BN5 A;  1FYC A;  4PMC A;  5NUC A;  3CMA A;  4JOI C;  3SK5 A;  1N34 Q;  1XTC D;  3U4V A;  3L9A X;  2ASB A;  1EY4 A;  2NZH A;  1RJT A;  3ONA B;  2UUB L;  3FPU B;  2HQL A;  3HOV H;  1JOQ A;  5T1I A;  4JI8 Q;  4XTC S;  1VQJ A;  3HOZ G;  3K7A H;  4OEL B;  4C3I G;  4DN4 M;  2F52 A;  1BCP D;  3C1E A;  4DR1 L;  1K0R A;  2C9O A;  4S3S A;  1UE7 A;  1SFO H;  2RHS B;  2JA7 B;  2PYK A;  3ITP A;  4POG A;  2UXB Q;  1C0A A;  4XIG S;  2R6G A;  2JA8 G;  1KDA A;  1I6H H;  5M3F G;  1SEB D;  2SEB D;  4TSS A;  5M5Y B;  5D14 A;  4APV A;  4QUF A;  1R9T H;  1PFN A;  4PV1 C;  3O13 A;  1WD0 A;  3K5M A;  1YEZ A;  3NXW A;  3CME A;  1EQT A;  5IP9 H;  2F0O A;  3LNN A;  1OXT A;  1K3B C;  3ER0 A;  2N3S A;  1TWC B;  4UPA A;  1MJC A;  4GOP C;  3J81 c;  1FJG L;  2XRS D;  1HRJ A;  4KV6 A;  4A3F G;  3L2P A;  1TXY A;  3QR8 A;  2WFW A;  5EBC A;  1EQV A;  1O7Z A;  1BUV T;  4AYB E;  5IYC H;  4NDX A;  5TSS A;  2A69 D;  1MHW C;  1B44 D;  2N78 A;  3S1Q B;  4HMJ A;  2SNM A;  1SYE A;  1WYD A;  2PO4 A;  3KLR A;  1HHV A;  4HID A;  1HNZ L;  3HOY G;  5IGG A;  2ZTE A;  2F03 A;  3I4L A;  1RF2 D;  4IUQ A;  1IW7 C;  4TVA B;  3FKI G;  1ESR A;  3ERS X;  2JQO A;  1CQF A;  2F0M A;  2FFK B;  4NW2 A;  2LXJ A;  4FXD A;  1Q90 A;  4YIJ A;  1G6Z A;  4ID6 A;  1PRT B;  5I6W A;  2M00 A;  2B2U C;  1O7Y A;  3KK7 A;  4DV4 L;  5C44 H;  1PZK D;  4B3R L;  4X3U A;  4OWT B;  1KIX A;  1HQM C;  2F3I A;  1HZC A;  4HED A;  1G51 A;  1HH2 P;  2Z9H A;  3OMC A;  3J80 L;  2XVS A;  5JVH 3;  1U4P A;  2MQH A;  3KF6 B;  5CV4 A;  2B3G A;  1A6X A;  4PQX A;  2B2W C;  3K5L A;  1Z9F A;  2PPB C;  1T5E A;  5BR8 Q;  2B39 A;  1NJI C;  2K5V A;  3PO3 G;  1EU3 A;  3TBI B;  3NTH A;  4HN7 A;  3F2U A;  4HIO A;  2KVM A;  2ZXP A;  5IT9 L;  2EVB A;  4M8A A;  2RKS A;  1JJ2 A;  2L9H A;  1IBM L;  5BN3 A;  2WKC A;  2OT2 A;  3PO2 B;  4JCV E;  3OOC A;  1IYU A;  4HTH A;  3CCM A;  1EYG A;  3HKZ B;  1WCM B;  4ZAI A;  2MFI A;  1TWF H;  3CCE A;  5D3D A;  4ZQ3 A;  2LFN A;  3CCS A;  1QG7 A;  4C3H G;  4OWW B;  4BBS G;  4LF8 L;  2UUB Q;  2WIN B;  1F2L A;  1Y8N B;  2NTS A;  2PMZ E;  4IO9 A;  2IX0 A;  2AWO A;  3RMH A;  1C9O A;  1NUC A;  5FO8 B;  5KYI A;  2E2J H;  4KY5 A;  2CKZ B;  3S2D H;  1EUJ A;  4DR1 Q;  4DV7 L;  3HFZ B;  1CQV A;  1ROD A;  1SSO A;  4H44 C;  5HGT A;  4C2M B;  1A63 A;  1PZJ D;  2EJG C;  4X6A H;  2ZXR A;  1MGS A;  3T51 B;  4ZUJ A;  3OIP A;  3MFG A;  3MHB A;  1G8Z D;  2RF4 A;  4KKU A;  4PMB A;  4A3B G;  4OIK A;  2F3W A;  3R93 A;  1GXD C;  2N88 A;  5IYD H;  3I4M B;  1Q8I A;  1WTQ A;  1F2Y A;  2NWG A;  3DWQ A;  1NE3 A;  3HEJ A;  3KLS A;  4ZK9 B;  3KJP A;  2KCM A;  4RKL A;  4DK3 C;  1FJG Q;  2F0E A;  1JWM D;  1JOR A;  1V1P B;  3NTK A;  1SR3 A;  5A2Q E;  2ID0 A;  4FDB A;  2E2I B;  5M3M H;  3EA6 A;  3QOJ A;  4LF7 Q;  4DR4 L;  4JW0 A;  4HJ5 A;  3RNU A;  4IOA A;  2CW0 D;  2JA5 G;  4BWG B;  4A3E H;  1SND A;  2AWN A;  1HNZ Q;  3AB9 A;  2GVB A;  4ZKC B;  3NEN A;  2RBM A;  2I5L X;  3TP7 A;  2K7V A;  2OQ0 A;  2Q2I A;  4MIU A;  4DGZ A;  3MWY W;  2B2V A;  5CMD A;  1N8R C;  4EGV A;  2WAQ E;  4CDE C;  3SK6 A;  3K80 C;  3RLF A;  3RLN A;  3HOX B;  1SMX A;  1VQE A;  2WII B;  1N33 L;  4GN4 B;  4G7Z C;  2AUK A;  1Y1V H;  4IN3 A;  4BY1 H;  4DV4 Q;  5CYU A;  3MXG A;  2VUM H;  2R93 H;  4DAY B;  4B3R Q;  4RAU C;  2J4X A;  1MIU A;  3E3X A;  1E2V A;  1VQN A;  2KCN A;  5DEH A;  1AP0 A;  3HOV B;  1S40 A;  4CBV A;  2IPK D;  3K7A B;  3B6Y A;  3D3R A;  4POF A;  4LF5 L;  3GTO H;  4A3G H;  5I9P A;  3DWA A;  3J80 i;  5IY0 A;  1VDZ A;  3OMG A;  1PRT C;  2WP8 J;  2MNA A;  2ZJP A;  2EXD A;  1L1O C;  3PSI A;  1VQ8 A;  1SFO B;  1G2T A;  2VB2 X;  4OEM B;  3K6O A;  1BBW A;  3BU2 A;  1KD1 C;  2VL6 A;  2NN6 I;  3NBH B;  5LL6 X;  4K8J A;  1J6Q A;  4IFD G;  1NBW A;  1S3O A;  2LXK A;  1R9T B;  2Z4H A;  1ESF A;  4LF8 Q;  2D0P A;  2FJ2 A;  3U9S A;  5EAY A;  1DXM A;  3LGJ A;  4J15 A;  3VR2 A;  3M3Y H;  1VQL A;  1YHB A;  4GN3 B;  5IP7 G;  1S4Z A;  3HOW H;  5EPJ A;  4DV7 Q;  2YYZ A;  4KTA A;  2L15 A;  4JI6 Q;  1XTD A;  4KHP L;  3CD6 A;  1NR4 A;  2JA6 G;  1KNE A;  5H1S E;  4JV5 L;  3RZO H;  1I4G A;  3U58 A;  1UEB A;  2I46 A;  3TP5 A;  3BDL A;  4HJ9 A;  3D4D A;  5A35 A;  1QCB D;  2MUY A;  4GS3 A;  5LL6 S;  2KUM A;  2QCP X;  1JIC A;  4CKC A;  2F0S A;  4BBR H;  1KQS A;  1B70 B;  4J1M A;  3HKS A;  1PTO F;  3OIQ A;  2WB1 E;  2N55 A;  4B9W A;  1ASY A;  3H3V C;  3RR5 A;  2NYZ D;  1I6V C;  4LNQ A;  1B9N A;  2QEX A;  4GLA C;  5C4Z A;  4DR4 Q;  4IZ8 A;  1ICW A;  1HPC A;  1CA5 A;  2XRQ D;  1RDP D;  3N52 A;  1LTB D;  2BH2 A;  5C44 B;  4JYA Q;  3GTL B;  2HIX A;  1BNZ A;  4G57 A;  4R8N A;  2RSN A;  1YZ6 A;  2EYM A;  4MN3 A;  1A3U A;  1HXY D;  1PH9 A;  2N8N A;  2I07 B;  3GO5 A;  2BE5 C;  1CKO A;  2F4V L;  2KOL A;  4C3J G;  1TS3 A;  2PQA A;  3NQI A;  3SGI A;  1ZKO A;  2AMC B;  1PLF A;  4R4C A;  1N33 Q;  4QY7 A;  3OTO L;  1BXT A;  1Z7T A;  4TRD A;  1EOT A;  4A3F H;  1TWA H;  1SN8 A;  4OHJ A;  1TWF B;  3PUX A;  5CV9 A;  3S24 A;  3BYT B;  3T13 A;  4B9X A;  4XT1 B;  3RZD H;  3FDT A;  1II3 A;  1YNJ C;  2YTX A;  1A62 A;  1ILQ A;  4YCV A;  3S17 H;  1Y1W G;  1EFI D;  5J1Z A;  3CC7 A;  1ET9 A;  3VYR A;  4RH6 A;  1SYF A;  2PW5 A;  1YJW A;  4XQN A;  4L5R C;  1HNW L;  1E7Z A;  3P1H A;  2EYJ A;  1JJG A;  4LF5 Q;  1LTT D;  1IBL L;  4R4T A;  2E2J B;  4L5Q A;  3BYY B;  3S2D B;  2JA9 A;  3FMC A;  4IJH A;  4K0K Q;  1JB3 A;  4UY8 C;  4K6D A;  1CK1 A;  1X3G A;  1SJH D;  1HQR D;  1F9P A;  2IHF A;  1VQ5 A;  3H91 A;  1IL8 A;  1YNN C;  1MJE A;  4WJ4 A;  3CC4 A;  3I91 A;  4J8Q A;  4Y52 H;  1JJC B;  1BVS A;  4CDF C;  4TKO B;  2O5I C;  4PNY A;  2Y0S E;  4IFD I;  3GTJ H;  2B2Y A;  3A0J A;  1HA5 A;  5CR3 A;  1L0W A;  1IHZ A;  1I4H A;  3UDG A;  4ULL A;  3S2H H;  4XYQ A;  5M3M B;  1TS2 A;  3NQT A;  2BH8 A;  4ZCK A;  3Q24 A;  4FNF A;  2TSS A;  2R7F A;  1VS0 A;  3R2T A;  5CGK A;  4KHP Q;  1ZYR C;  2NN6 H;  1WTX A;  2HDM A;  3KBG A;  3D31 A;  4A3E B;  1VQK A;  4JV5 Q;  1JWS D;  3J7A 5;  3G6J B;  2SDF A;  3F8T A;  4JI8 L;  2NTT A;  4EX5 A;  1HCZ A;  4QQB X;  4A3D B;  2ICI A;  3ZJY C;  1SNQ A;  1VQD A;  4BBS H;  4QF4 A;  1ML0 D;  3D4R A;  3HG9 A;  4IUP A;  5CV8 A;  4CKB A;  4GOP B;  4DFA A;  1EIY B;  1XNR L;  3AEV A;  4B3M L;  1DM0 B;  1AFP A;  4DUY L;  1D7Q A;  2QDL A;  3DWP A;  3S15 H;  4GNX A;  3CP0 A;  1M8A A;  4CDC C;  4KKT A;  2F0D A;  4ZYS A;  3T16 A;  1CHP D;  4LFC L;  4KKS A;  4BY1 B;  2R7Z H;  5ELF A;  2VUM B;  2R93 B;  1JT8 A;  4X66 L;  4A3C G;  5FO9 B;  2EYF A;  4OXP A;  1PTO H;  2XWB B;  3TRE A;  3NE5 B;  3J7A V;  4N9T A;  1EZ6 A;  3K0Y A;  3JC6 6;  2B29 A;  2K4K A;  1TQO A;  2F4V Q;  3BDO A;  3GTO B;  4A3G B;  1IYJ B;  1GO3 E;  1BF4 A;  3AYH B;  2I5M X;  4NP5 A;  4DK1 A;  2CWP A;  4LJZ C;  1I4R A;  4IPC A;  3TP6 A;  3H3V H;  4R4O A;  5GQO A;  4JI1 L;  2JSO A;  1I4X A;  1NCV A;  3OTO Q;  5G3L F;  2NZ1 D;  3S1R H;  1MBY A;  2F0F A;  1IXR A;  2NVQ H;  5JEA G;  2NUC A;  3DM3 A;  5FOB B;  4CDD C;  1T5X D;  1STA A;  3FHW A;  2JA5 H;  1EY0 A;  4DPG A;  1VQO A;  1EIG A;  1RHP A;  1EYA A;  3M3Y B;  1HNW Q;  3KDF A;  5KNC A;  1HZ9 A;  1IBL Q;  3HOW B;  2EYP A;  4ME5 A;  3GTG H;  2K5Q A;  1RTN A;  2HQE A;  1TWG H;  4GN5 A;  2RVL A;  5LMN L;  4A3J G;  1JB7 A;  5E4X A;  4A3I G;  2VB3 X;  4K2L A;  1IW7 D;  5ELN A;  2RQX A;  3A8J E;  3TS0 A;  3RZO B;  3UE0 A;  3W5O A;  3S16 H;  4DV5 L;  1SE8 A;  5C3X A;  5IOD A;  3Q22 A;  2RCF A;  1K8G A;  2LS0 1;  3MC0 B;  4FF4 A;  2Z6B A;  1GUO A;  3LWU A;  3H0G G;  1SYD A;  4BBR B;  4DV3 Q;  4KJN A;  4L5T A;  1WJJ A;  5BN4 A;  1H9R A;  1NMG A;  1SRO A;  2OTJ A;  3VR5 A;  1ZEQ X;  3STB C;  1LYL A;  4NPS A;  4DNI A;  1XXG A;  4BY7 H;  2OWO A;  3C2P A;  3UDX A;  5IWA L;  1P16 A;  1QVG A;  1IKL A;  4DAP A;  1TWH H;  2B2Y C;  4RWS C;  3K57 A;  1N32 L;  2O5J C;  1DON A;  4A3K B;  1EY5 A;  5J3B A;  3GDE A;  4CGY B;  3ERO A;  4O0A A;  2BA1 A;  4RGO S;  3PMF A;  4IFD H;  1QB5 D;  3EFX D;  4LMQ D;  3EJI A;  2UXC L;  3DEO A;  2JYO A;  1XNR Q;  4UHV A;  4FF1 A;  4B3M Q;  1FNV A;  2I0Q A;  2MP1 A;  3QG1 A;  3I4N H;  4DUY Q;  1NTG A;  1JCK B;  1UUP A;  5GAE C;  3A5Z B;  1H9K A;  5IYB G;  4A3F B;  1TWA B;  1SNM A;  4LFC Q;  1D8L A;  2I5H A;  2VS1 A;  1F9R A;  4R8I A;  4EQO A;  1YNX A;  4X66 Q;  3Q23 A;  2NVT H;  3WWV A;  3GTM H;  3J7Z C;  4J6H A;  1VQH A;  4OWX B;  4OL7 A;  5KYL A;  5IGF A;  1KDB A;  1WTW A;  2JA6 H;  5CV6 A;  1K83 H;  4KHZ A;  2E74 C;  2ZTC A;  1XMO L;  3C46 A;  1WTH A;  2V1C C;  4OON A;  1PH7 A;  4LF7 L;  4I7A A;  4V0B A;  1VQG A;  5L37 A;  1GM5 A;  3A55 A;  1UE5 A;  2F0H A;  5JAV A;  4MZ9 A;  3S14 H;  1A8V A;  4JI1 Q;  4L8J A;  1NNX A;  2EE1 A;  4PZ6 A;  4RHS A;  1LTI D;  1W6J A;  5JOB A;  3URY A;  2JA7 G;  1CKN A;  4IUT A;  1V9P A;  2QDB A;  1U4M A;  1JE4 A;  3MAQ A;  1E3P A;  5C4X H;  3QO2 A;  2RHQ B;  1HZB A;  3GTJ B;  4BA2 I;  1TT2 A;  2RCN A;  1V43 A;  2L5T A;  3NWT A;  4LUO A;  3L3O C;  4IUN A;  1KDC A;  2XIW A;  3GV6 A;  1L1O B;  3RN5 A;  2HIV A;  1DD2 A;  4NKL A;  5LMN Q;  2Z0S A;  1OXV A;  4H7B A;  2AUJ D;  3D4W A;  1MKH A;  3VDY A;  3MVV A;  2ZM6 L;  5I2Y A;  3H94 A;  4RGM A;  4DV5 Q;  4YY3 Q;  4A3M H;  4Q5V A;  4A93 H;  3K58 A;  2EY6 A;  4M1U B;  2PCF B;  1YIJ A;  1NMF A;  3OWE B;  4FXK C;  5CBA E;  4X65 L;  2ENB A;  3S15 B;  5FLX E;  3NEL A;  1YHQ A;  2NB0 A;  4WOR A;  2E5L L;  2A68 C;  4A3L H;  2EQS A;  3DLL A;  1IL2 A;  2M9V A;  3AFQ A;  2N49 A;  5IWA Q;  2E2H H;  1BQQ T;  3BJU A;  2R7Z B;  3JAM E;  2Q8I B;  1N32 Q;  1E22 A;  1SXT A;  4R1J A;  4JI7 L;  3P75 A;  2XNA C;  1R4Q B;  1PRT D;  3RN2 A;  4Z9C B;  4RCO A;  4AYB B;  2EYH A;  4DV2 L;  3HP3 A;  1JWU D;  3GTK H;  1AEX A;  1SE3 A;  4KN4 C;  1F2Z A;  4KLK A;  5EQ0 A;  2G9D A;  2UXC Q;  5C5M A;  3F2C A;  1KRS A;  5E1F A;  2EZV A;  2DY8 A;  1GUN A;  3R2I A;  4JI6 L;  3NEM A;  3GQB A;  1QZG A;  3QWN A;  1X3E A;  4DR6 L;  2DY7 A;  3PF4 A;  1E2W A;  3HOU H;  1VMC A;  1MSH A;  4IQZ A;  3H15 A;  3CCL A;  1CI3 M;  1MD2 D;  5EPK A;  2NVQ B;  1BCP F;  4P75 A;  3MEF A;  3PO2 G;  3TRZ A;  3G48 A;  3HKZ G;  5AFW A;  1WCM G;  1VQ4 A;  5EBD A;  3GTP H;  3T53 B;  5C0X J;  5K5P A;  3S9W A;  1XMO Q;  5I4D A;  2RA4 A;  3T56 B;  1ENC A;  3G71 A;  3FP9 A;  4JBW A;  1K73 C;  4BXX G;  2J7Z A;  2OF1 A;  2K52 A;  2RDG A;  1JMC A;  1DZ1 A;  1H9S A;  4QIW E;  5FJ8 G;  4HJA A;  1TS4 A;  1QIL A;  2J0T D;  1TWG B;  3HGB A;  1SNP A;  4JYA L;  2JEA I;  3VYT A;  4LAA A;  3G7L A;  2EYO A;  1LTG D;  2H1E A;  1O78 A;  1O7L A;  5JJL A;  3S16 B;  2D0O A;  3HS0 C;  3IFT A;  4CJ0 B;  1A2T A;  5C0X G;  3L0O A;  1KXL A;  3I4O A;  4RHR A;  5C3W A;  1YVC A;  1EOV A;  3CW2 C;  4K0K L;  2IL8 A;  1TS5 A;  1HR0 L;  3IKJ A;  3M85 A;  1PYW D;  5JJI A;  3D6C A;  3S1N B;  1E1O A;  3KFU A;  3I4M G;  3R3O A;  4ILW A;  2A8V A;  3SK4 A;  4BY7 B;  4PZ8 A;  5J39 A;  2PZT A;  2PMZ B;  5CV5 A;  2BOS A;  3FEW X;  1DOM A;  1HUN A;  1TWH B;  4LWC A;  2JK8 A;  2BE5 D;  2NVX H;  3F2D A;  3H09 A;  5EJW A;  1EY8 A;  2A1A A;  4QJF A;  5JJZ A;  2XN9 C;  1Y69 U;  3PUZ A;  2ZM6 Q;  3I70 A;  4KJO A;  1B7Y B;  5GAH C;  4DR2 Q;  1I50 H;  3EBE A;  4NXN L;  1WI5 A;  3LX0 A;  5JEA H;  2NZO A;  4V19 0;  1EYC A;  3DXJ C;  2CVR A;  3ULP A;  4B3S L;  4X65 Q;  1S5C D;  3I4N B;  4K5X A;  1Q3L A;  2K33 A;  4CJ1 B;  4OX9 L;  2HCI A;  4IUV A;  4KHV A;  2E5L Q;  1A3V A;  3OWF A;  1J5E L;  1I6H B;  1YNJ D;  4Q0F A;  3A5U A;  1X55 A;  4H13 C;  3HOX G;  1GUT A; 
#chains in the Genus database with same CATH homology
 3EVQ A;  4KK7 A;  1SDF A;  2A74 C;  1CTM A;  3GTM B;  1RKN A;  1L0Y B;  1STE A;  1HFG A;  1K83 B;  2CQA A;  5KIX A;  5JPM C;  4K5V A;  1PDQ A;  4OO1 G;  4G7O C;  1JR0 D;  1YNN D;  3MXN A;  2F0U A;  1VMP A;  3ERQ A;  2FMC A;  5DM6 3;  2CHB D;  3S14 B;  4X3T A;  1B2T A;  5ELD A;  1SYC A;  3AMU A;  2A5H A;  1PTO C;  5M9O A;  3KF8 A;  1J9O A;  2WAQ B;  4U67 3;  3I72 A;  5I9O A;  3PIO 3;  5C4X B;  3BVG A;  4JK1 C;  1BR9 A;  3A56 A;  1GHJ A;  1QNK A;  1ZYR D;  5K36 G;  1UAP A;  2DNC A;  4DXG A;  2K5D A;  1LTA D;  1G29 1;  1EEF D;  1EL0 A;  1C8C A;  2DN8 A;  2EJM A;  3PIP 3;  3WOF A;  4A3M B;  1WTV A;  4G4K A;  1HTL D;  4A93 B;  2B2T A;  2E2D C;  3Q0A A;  3TSS A;  5FK9 C;  4OGQ C;  4G7H C;  1KAA A;  2KQ3 A;  2BA0 A;  2E76 C;  2KEE A;  4FXG C;  5FLX L;  2K01 A;  5C0X I;  4FYD A;  4K2K A;  3JAM L;  5COR A;  1R4P B;  4O1N A;  2EY5 A;  2IX3 A;  4FP5 D;  1RCV D;  2E2H B;  1KLG D;  5G3L D;  2B2V C;  4F88 A;  1W6K A;  1S5E D;  4KD3 A;  1SNO A;  5J22 A;  3NBI A;  2SOB A;  4DAV A;  1MI2 A;  2D9U A;  3GTK B;  2OEO A;  1EU4 A;  5IGB A;  3Q6S A;  3SHL A;  4QB4 A;  4DNT B;  4FVM A;  4QUC A;  3VR4 A;  5ELE A;  3HOU B;  4KY7 A;  5C4H A;  2K28 A;  2R3Z A;  1L0X B;  2WB1 B;  2F0I A;  5E4W C;  1D2B A;  5IGE A;  4U68 A;  3P7J A;  3GTP B;  3VA5 A;  2MHV A;  5A2Q L;  4UAI A;  2F0J A;  4OO1 I;  2KHS A;  1DOK A;  5F2D A;  1MSG A;  1EZ8 A;  1GHK A;  1HFN A;  1I4Q A;  2AQ1 B;  4WJW A;  1LTS D;  3M7G A;  4KD4 A;  4ODG A;  2D5D A;  1SBB B;  3TZD A;  1NR2 A;  1EWC A;  1STB A;  2E75 C;  2ICE C;  4HCE A;  4ZUI A;  2K1B A;  2V4D A;  4WRD A;  1LAC A;  1F77 A;  2K32 A;  3SDZ A;  4TQU S;  4XYO A;  1Q1B A;  1Y1V B;  1LV9 A;  2KCC A;  2OXP A;  1DJR D;  4X3S A;  1WTP A;  1O80 A;  3MFY A;  3QOL A;  3NK9 A;  2NVX B;  2QEJ C;  3QIA A;  3GV3 A;  1D5X C;  2XWJ B;  1SYB A;  2IJ0 A;  5CBE E;  1I50 B;  1HA6 A;  2ZXO A;  3DHQ A;  1F9S A;  1ZXT A;  2F0P A;  1SJE D;  4EVO A;  2ZT9 C;  3DM1 A;  1STY A;  4DNR B;  1NSN S;  5KNB A;  2Y0S B;  2EXZ A;  2WAC A;  2F0V A;  2EPB A;  3FVQ A;  1SMY C;  2F0N A;  1Y8O B;  2Z1C A;  3CHB D;  5DAU A;  1HTP A;  2JE6 I;  1FNU A;  1JC7 A;  3MZ5 A;  3ND9 A;  4HSV A;  4XXE A;  5C0X H;  3I90 A;  1UEA B;  1S5B D;  1FR3 A;  3BS1 A;  3NPP A;  1E2Z A;  2B63 B;  4DXF A;  3R8B A;  2R92 B;  4UDU C;  3KLS X;  3J7Y W;  2K03 A;  4HSP A;  3KUP A;  1BO0 A;  4QCL A;  4C56 C;  4NMZ A;  4K14 A;  4BS9 A;  4HMI A;  3CRL C;  3CU7 A;  2B2W A;  2FIN B;  5ELB A;  2L4N A;  3MEH A;  1E0B A;  2F0Q A;  2EYL A;  2L12 A;  4HAE A;  3HOZ B;  1VF7 A;  5CV7 A;  5M5X B;  4C3I B;  3NSW A;  2F3V A;  4XQQ A;  2EDG A;  1BDO A;  1NAP A;  5D65 A;  1EIH A;  4GZY C;  4ZRZ A;  1GOZ A;  2JA8 B;  5M3F B;  3GP7 A;  3C1F A;  3I73 A;  4DF7 A;  3J81 E;  1LT4 D;  5C4J B;  3OW7 A;  2A68 D;  3T4A C;  1J8I A;  3VR6 A;  2YU9 B;  2PQE A;  1SYG A;  2HUG A;  5M5W B;  3S1M B;  1ONL A;  4OO1 H;  2LY7 A;  5E3F A;  5CC4 A;  1D1K A;  5LHY 1;  3IAY A;  3RZD B;  2LKV A;  4XDX A;  3TN2 A;  2RDH A;  1SE2 A;  2IWH A;  3S17 B;  1I3Q B;  3CKI B;  4QMG A;  3HOY B;  1X3P A;  3E6Z X;  4KN7 C;  2DNE A;  1A3T A;  3VR3 A;  3FKI B;  4MHE A;  3AU7 A;  3DMU A;  3OSO A;  4BA1 I;  2TMP A;  5K36 H;  4R9W A;  2X6G A;  3I8Z A;  2PZW A;  3OPO A;  1EEI D;  4N9P A;  2VXW A;  3SVM A;  1SNC A;  1WVL A;  1OXS C;  2L0C A;  4E6I A;  1CHQ D;  1ENF A;  2NVY B;  3S2H B;  2O2L D;  1AW7 A;  1PFM A;  1KLU D;  3PO3 B;  2HCC A;  4F8M A;  1G2S A;  3C3L A;  2EJF C;  3VYU A;  4ZKB B;  5IIF A;  1HUM A;  4C3H B;  1RD9 D;  4BBS B;  1VCI A;  4LK1 C;  4O42 A;  1STN A;  3DUZ A;  3TME A;  1D5M C;  2KJX A;  4HCS A;  3I3C A;  2Q8T A;  1B50 A;  1H9M A;  1GUW A;  2C5C A;  1PTO B;  4H0L C;  3BG3 A;  4PMW A;  4K6L A;  3P20 A;  2NN6 G;  1X3Q A;  3VA7 A;  2MGS A;  1WD1 A;  4A3B B;  1D6E C;  5COY A;  1BCP C;  2IW3 A;  2KED A;  5C5L A;  3S1R B;  2HDL A;  1TR5 A;  3RD4 A;  1LAB A;  2X69 A;  2F0L A;  1QOH A;  4EQN A;  2JA5 B;  1AN8 A;  1F9Q A;  5DM7 3;  3PUY A;  1H9S B;  2L11 A;  2PW7 A;  3MA2 B;  1KAB A;  1PTO D;  4FF3 A;  3WOE A;  2XSC A;  3GTG B;  5JVG 3;  2A69 C;  1OXU A;  1IKM A;  1QJO A;  1GJX A;  1OXX K;  1D5Z C;  2F0T A;  3IL8 A;  1BBX C;  3NTI A;  1S5F D;  1B1Z A;  3BZD B;  1V1P A;  3V05 A;  4RFB A;  1XYI A;  4ABN A;  4WFN 3;  1LO5 D;  1TY2 A;  4I7Z C;  2KEC A;  5ISR A;  2IX1 A;  2F0G A;  3MTS A;  4L6T B;  3WDN A;  3RUZ A;  3J81 L;  1DYQ A;  4RGN A;  1B4O A;  2NBF A;  3SE0 A;  2IT1 A;  4CHT B;  3GD7 A;  2X6L A;  2K6A A;  2L55 A;  4F87 A;  3MXU A;  4IFD J;  1B53 A;  2WV6 D;  4DAY A;  3SEB A;  1PFB A;  1CZG A;  3BDC A;  1A15 A;  2NVT B;  1F2M A;  2K04 A;  2RSO A;  3A7A B;  2M2L A;  3M4Y A;  3H6M A;  4FF2 A;  2JA6 B;  1SAP A;  4QIW B;  1LLR D;  5I6Y A;  4DA2 A;  2EY1 A;  1LT3 D;  3ZYY X;  1K8O A;  3M7N A;  1C48 A;  4RA8 A;  1LT5 D;  1PRT F;  5T1G A;  3NBH A;  3QB3 A;  1V1O A;  1GUS A;  2PZU A;  1PMR A;  3PV0 A;  3NP8 A;  1QWY A;  4FO2 A;  2F0W A;  2Q8R E;  3J7A F;  1TU2 B;  2KA7 A;  1EY7 A;  1QNU A;  1TII D;  1SE4 A;  5FO7 B;  1JQY D;  1C4Q A;  3HZX A;  4RCN A;  2VNU D;  1DCZ A;  5ELC A;  3TDQ A;  2K5W A;  4C3J B;  3CRK C;  1KNA A;  3TP8 A;  3VYS A;  3KBX A;  1A2U A;  2CW0 C;  2D2C C;  1DOL A;  5EGT A;  1U4L A;  2Z4I A;  1TKW B;  3A8K E;  2FHT A;  1Q12 A;  1Y1W B;  1IYV A;  2F0K A;  3K59 A;  1TVX A;  1EY9 A;  5FKA C;  2QIL A;  2D62 A;  2Z8L A;  4ZLT F;  3PUW A;  3IFD A;  4K8I A;  2G9H D;  5HUR A;  2LMC B;  3NWS A;  3K5O A;  3NHH A;  2L1B A;  4XT3 B;  3BVZ A;  4IAL A;  5EKL A;  3SK8 A;  3BVM A;  3X3M A;  3ND8 A;  3N6R A;  1ILP A;  3E5S A;  4RKB A;  3K5N A;  3EQL C;  1SMY D;  5EKI A;  1S5D D;  2H4O A;  3HRZ C;  2EOT A;  1CA6 A;  1PZI D;  3W3A A;  4OIJ A;  1H9J A;  1BOS A;  5EKK A;  1EY6 A;  5EPL A;  1KTK A;  1V8Q A;  1Z6H A;  3L7Z C;  4KY6 A;  4P2C B;  3TZU A;  1JOK A;  5DNF A;  3LWE A;  1XX8 A;  2MPM A;  5IOC A;  1M4V A;  2RDF A;  1B3A A;  3FRP B;  4CKE A;  3SR1 A;  1STG A;  1TY0 A;  2B8G A;  5KND A;  4X3K A;  1EWH A;  2BDN A;  3V2T A;  1U4R A;  2B8F A;  2R61 A;  3SXH A;  1U9R A;  3V96 A;  5I2X A;  2BCO A;  1OO9 B;  1XWE A;  5IGD A;  3W2D A;  4L63 B;  1AZQ A;  5C6A A;  1CT1 D;  2AQ2 B;  5KGU A;  2A6E D;  3A54 A;  3J80 E;  2QF7 A;  4IUU A;  3DEP A;  2A6H D;  1Y8P B;  1WTO A;  1GUG A;  1Z47 A;  5KRU A;  2GA4 B;  2JP1 A;  2O4X A;  3M4O B;  3OHX C;  3U9O A;  1G91 A;  1LTR D;  4C1N K;  4KI0 A;  5IT9 E;  1CZW A;  1FD7 D;  4DU9 A;  1RTO A;  1VF5 C;  1Q1E A;  1FGB D;  1I4P A;  4K5W A;  4B08 A;  1CM9 A;  2QKI C;  5JEA J;  5IGC A;  2A73 B;  3A7L A;  2B2T C;  2JEB I;  3X3N A;  2AQ3 B;  2MJ8 A;  1K8M A;  4CJ2 C;  1X32 A;  4A3J B;  4A3I B;  1PXU A;  2JXM B;  4I65 A;  4Y7N B;  1B9M A;  3D6W A;  2EY2 A;  5JPN C;  1JOO A;  3GTQ B;  3H0G B;  1WTR A;  2B2U A;  2BDO A;  3D8G A;  4C1N I;  1UNS A;  1ENA A;  4DK0 A;  1AZP A;  2F1M A;  2K05 A;  3UI2 A;  3A8I E;  4HR7 B;  2F4I A;  3FPP A;  3CQZ B;  1QE6 A;  4RGT A;  3NUC A;  4XQJ A;  2FMM A;  4F7X A;  5C3E B;  1EYD A;  4EQP A;  3MXP A;  1BCP B;  2WKD A;  1LT6 D;  1D1I A;  1ET6 A;  1CFM A;  3E0J A;  4IUR A;  3PUV A;  5KEE A;  2PNR C;  2SNS A;  3QJY A;  2A6E C;  1FNW A;  1STH A;  5D3I B;  4KMU C;  2A6H C;  5BN5 A;  1FYC A;  4PMC A;  5NUC A;  3SK5 A;  1XTC D;  3L9A X;  1EY4 A;  1RJT A;  3ONA B;  3FPU B;  1JOQ A;  5T1I A;  4XTC S;  4C3I G;  4DN4 M;  1BCP D;  3C1E A;  2C9O A;  4S3S A;  2JA7 B;  2PYK A;  3ITP A;  4XIG S;  2R6G A;  1KDA A;  1SEB D;  2SEB D;  4TSS A;  5M5Y B;  5D14 A;  4QUF A;  1PFN A;  4PV1 C;  3O13 A;  1WD0 A;  3K5M A;  3NXW A;  1EQT A;  2F0O A;  3LNN A;  1OXT A;  1TWC B;  2XRS D;  1HRJ A;  4KV6 A;  5EBC A;  1EQV A;  1O7Z A;  1BUV T;  4NDX A;  5TSS A;  2A69 D;  1B44 D;  3S1Q B;  4HMJ A;  2SNM A;  1SYE A;  2PO4 A;  3KLR A;  1HHV A;  5IGG A;  2F03 A;  3I4L A;  1RF2 D;  4IUQ A;  1IW7 C;  1ESR A;  1CQF A;  2F0M A;  2FFK B;  4NW2 A;  4FXD A;  1Q90 A;  4YIJ A;  1G6Z A;  4ID6 A;  1PRT B;  5I6W A;  2M00 A;  2B2U C;  1O7Y A;  3KK7 A;  1PZK D;  4X3U A;  1HQM C;  4HED A;  3OMC A;  3J80 L;  2XVS A;  5JVH 3;  1U4P A;  5CV4 A;  1A6X A;  4PQX A;  2B2W C;  3K5L A;  2PPB C;  1T5E A;  2B39 A;  1EU3 A;  3TBI B;  3NTH A;  4HN7 A;  3F2U A;  2KVM A;  2ZXP A;  5IT9 L;  2EVB A;  4M8A A;  2RKS A;  2L9H A;  5BN3 A;  2WKC A;  2OT2 A;  3PO2 B;  3OOC A;  1IYU A;  4HTH A;  3HKZ B;  1WCM B;  4ZAI A;  5D3D A;  4ZQ3 A;  2LFN A;  1QG7 A;  4C3H G;  2WIN B;  1F2L A;  1Y8N B;  2NTS A;  2IX0 A;  2AWO A;  3RMH A;  1NUC A;  5FO8 B;  5KYI A;  4KY5 A;  1CQV A;  1ROD A;  1SSO A;  4H44 C;  5HGT A;  4C2M B;  1PZJ D;  2EJG C;  2ZXR A;  1MGS A;  3T51 B;  4ZUJ A;  3MFG A;  3OIP A;  3MHB A;  1G8Z D;  4KKU A;  4PMB A;  4OIK A;  2F3W A;  3R93 A;  1GXD C;  2N88 A;  3I4M B;  1Q8I A;  1WTQ A;  1F2Y A;  2NWG A;  3DWQ A;  3HEJ A;  3KLS A;  4ZK9 B;  4RKL A;  2F0E A;  1JWM D;  1JOR A;  1V1P B;  3NTK A;  5A2Q E;  2ID0 A;  2E2I B;  3EA6 A;  3QOJ A;  2CW0 D;  4BWG B;  1SND A;  2AWN A;  3AB9 A;  4ZKC B;  2RBM A;  3TP7 A;  2K7V A;  4MIU A;  4DGZ A;  3MWY W;  2B2V A;  5CMD A;  4EGV A;  3SK6 A;  3RLF A;  3HOX B;  2WII B;  4G7Z C;  2AUK A;  4IN3 A;  5CYU A;  3MXG A;  4RAU C;  2J4X A;  1E2V A;  2KCN A;  5DEH A;  1AP0 A;  3HOV B;  4CBV A;  2IPK D;  3K7A B;  3D3R A;  5I9P A;  3DWA A;  1VDZ A;  3OMG A;  1PRT C;  2WP8 J;  1SFO B;  1G2T A;  2VB2 X;  3K6O A;  2NN6 I;  5LL6 X;  4K8J A;  4IFD G;  1R9T B;  2Z4H A;  1ESF A;  2FJ2 A;  3U9S A;  1DXM A;  3VR2 A;  1S4Z A;  5EPJ A;  2YYZ A;  4KTA A;  1NR4 A;  1KNE A;  1I4G A;  2I46 A;  3TP5 A;  3BDL A;  3D4D A;  5A35 A;  1QCB D;  2MUY A;  5LL6 S;  2KUM A;  2QCP X;  1JIC A;  4CKC A;  2F0S A;  4J1M A;  1PTO F;  3OIQ A;  2N55 A;  4B9W A;  3H3V C;  2NYZ D;  1I6V C;  1B9N A;  5C4Z A;  4IZ8 A;  1ICW A;  1HPC A;  1CA5 A;  2XRQ D;  1RDP D;  3N52 A;  1LTB D;  5C44 B;  3GTL B;  1BNZ A;  4G57 A;  4R8N A;  2RSN A;  2EYM A;  4MN3 A;  1A3U A;  1HXY D;  2I07 B;  3GO5 A;  2BE5 C;  2KOL A;  4C3J G;  1TS3 A;  3NQI A;  1ZKO A;  1PLF A;  1BXT A;  1Z7T A;  4TRD A;  1EOT A;  4OHJ A;  1TWF B;  3PUX A;  5CV9 A;  3T13 A;  3BYT B;  4B9X A;  4XT1 B;  3FDT A;  1II3 A;  1YNJ C;  1ILQ A;  1EFI D;  5J1Z A;  1ET9 A;  3VYR A;  4RH6 A;  1SYF A;  2PW5 A;  4XQN A;  3P1H A;  2EYJ A;  1LTT D;  2E2J B;  3BYY B;  3S2D B;  3FMC A;  1JB3 A;  4K6D A;  1CK1 A;  1SJH D;  1HQR D;  1F9P A;  3H91 A;  1IL8 A;  1YNN C;  3I91 A;  4J8Q A;  4TKO B;  2O5I C;  4PNY A;  4IFD I;  2B2Y A;  1HA5 A;  5CR3 A;  1IHZ A;  1I4H A;  4ULL A;  4XYQ A;  5M3M B;  1TS2 A;  3NQT A;  3Q24 A;  4FNF A;  2TSS A;  3R2T A;  5CGK A;  1ZYR C;  2NN6 H;  1WTX A;  2HDM A;  3KBG A;  3D31 A;  4A3E B;  1JWS D;  3G6J B;  2SDF A;  2NTT A;  1HCZ A;  4A3D B;  2ICI A;  1SNQ A;  4QF4 A;  1ML0 D;  3D4R A;  3HG9 A;  4IUP A;  5CV8 A;  4CKB A;  4DFA A;  1DM0 B;  1AFP A;  3DWP A;  1M8A A;  4KKT A;  2F0D A;  4ZYS A;  3T16 A;  1CHP D;  4KKS A;  4BY1 B;  5ELF A;  2VUM B;  2R93 B;  5FO9 B;  2EYF A;  1PTO H;  2XWB B;  3NE5 B;  3J7A V;  4N9T A;  1EZ6 A;  3K0Y A;  1TQO A;  3BDO A;  3GTO B;  4A3G B;  1BF4 A;  4NP5 A;  4DK1 A;  4LJZ C;  1I4R A;  3TP6 A;  2JSO A;  1I4X A;  1NCV A;  5G3L F;  2NZ1 D;  1MBY A;  2F0F A;  5JEA G;  2NUC A;  5FOB B;  1T5X D;  1STA A;  1EY0 A;  1EIG A;  1RHP A;  1EYA A;  3M3Y B;  5KNC A;  3HOW B;  2EYP A;  4ME5 A;  2K5Q A;  1RTN A;  2HQE A;  2RVL A;  5E4X A;  2VB3 X;  4K2L A;  1IW7 D;  2RQX A;  3A8J E;  3RZO B;  5C3X A;  5IOD A;  3Q22 A;  2LS0 1;  3MC0 B;  4FF4 A;  1GUO A;  3LWU A;  1SYD A;  4BBR B;  4KJN A;  5BN4 A;  1H9R A;  3VR5 A;  1ZEQ X;  1XXG A;  3C2P A;  1IKL A;  4DAP A;  2B2Y C;  4RWS C;  3K57 A;  2O5J C;  1DON A;  4A3K B;  1EY5 A;  4CGY B;  3ERO A;  2BA1 A;  4RGO S;  3PMF A;  4IFD H;  1QB5 D;  3EFX D;  4LMQ D;  3EJI A;  3DEO A;  2JYO A;  4FF1 A;  1FNV A;  2MP1 A;  3QG1 A;  1JCK B;  1UUP A;  1H9K A;  4A3F B;  1TWA B;  1SNM A;  1F9R A;  4R8I A;  4EQO A;  3Q23 A;  4J6H A;  4OL7 A;  5KYL A;  5IGF A;  1KDB A;  1WTW A;  5CV6 A;  4KHZ A;  2E74 C;  3C46 A;  4V0B A;  3A55 A;  2F0H A;  5JAV A;  4L8J A;  2EE1 A;  4RHS A;  1LTI D;  1W6J A;  5JOB A;  3URY A;  4IUT A;  2QDB A;  1U4M A;  1JE4 A;  3MAQ A;  3QO2 A;  3GTJ B;  4BA2 I;  1TT2 A;  1V43 A;  2L5T A;  3NWT A;  3L3O C;  4IUN A;  1KDC A;  2XIW A;  3GV6 A;  1DD2 A;  4NKL A;  1OXV A;  4H7B A;  2AUJ D;  3D4W A;  3MVV A;  5I2Y A;  3H94 A;  4RGM A;  4Q5V A;  3K58 A;  2EY6 A;  4M1U B;  2PCF B;  3OWE B;  5CBA E;  4FXK C;  2ENB A;  3S15 B;  5FLX E;  2NB0 A;  4WOR A;  2A68 C;  2M9V A;  1BQQ T;  2R7Z B;  3JAM E;  2Q8I B;  1SXT A;  3P75 A;  2XNA C;  1R4Q B;  1PRT D;  4Z9C B;  4RCO A;  4AYB B;  2EYH A;  3HP3 A;  1JWU D;  1AEX A;  1SE3 A;  4KN4 C;  1F2Z A;  5EQ0 A;  2G9D A;  5C5M A;  2EZV A;  5E1F A;  2DY8 A;  1GUN A;  3R2I A;  3GQB A;  3QWN A;  2DY7 A;  1E2W A;  1VMC A;  1MSH A;  4IQZ A;  1CI3 M;  1MD2 D;  5EPK A;  2NVQ B;  1BCP F;  5AFW A;  5EBD A;  3T53 B;  5C0X J;  5K5P A;  3S9W A;  5I4D A;  2RA4 A;  3T56 B;  1ENC A;  4JBW A;  2J7Z A;  2OF1 A;  2RDG A;  1DZ1 A;  1H9S A;  1TS4 A;  1QIL A;  2J0T D;  1TWG B;  3HGB A;  1SNP A;  2JEA I;  3VYT A;  4LAA A;  3G7L A;  2EYO A;  1LTG D;  2H1E A;  1O78 A;  1O7L A;  3S16 B;  3HS0 C;  3IFT A;  4CJ0 B;  1A2T A;  5C0X G;  4RHR A;  5C3W A;  2IL8 A;  1TS5 A;  3IKJ A;  3M85 A;  1PYW D;  3D6C A;  3S1N B;  3R3O A;  4ILW A;  3SK4 A;  4BY7 B;  5J39 A;  2PZT A;  2PMZ B;  5CV5 A;  2BOS A;  3FEW X;  1DOM A;  1HUN A;  1TWH B;  2BE5 D;  3H09 A;  5EJW A;  1EY8 A;  5JJZ A;  2XN9 C;  1Y69 U;  3PUZ A;  3I70 A;  4KJO A;  3LX0 A;  5JEA H;  4V19 0;  1EYC A;  3DXJ C;  2CVR A;  1S5C D;  3I4N B;  4K5X A;  1Q3L A;  2K33 A;  4CJ1 B;  2HCI A;  4IUV A;  4KHV A;  1A3V A;  3OWF A;  1I6H B;  1YNJ D;  4Q0F A;  4H13 C;  1GUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...