4YIJA

Crystal structure of staphylcoccal nuclease variant delta+phs a109e at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nuclease A
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4yijA00
3OSOA 4LAAA 5F2DA 2PZWA 3OWFA 3DHQA 5EGTA 5KIXA 2F0DA 1EZ8A 1F2ZA 1NUCA 4K6DA 2F0TA 3SR1A 3QOLA 3BDLA 2F0OA 1EZ6A 3NQTA 4K2LA 5CV8A 5C5LA 1STAA 5IGDA 3S9WA 2F0GA 1IHZA 1JORA 2F0LA 1F2MA 4EVOA 4N9TA 2F0VA 3EVQA 3EROA 4KJNA 4OL7A 5DAUA 4H7BA 2EY2A 5C5MA 3SK4A 1STGA 2F0EA 2F0PA 1KDBA 4DGZA 1EY9A 2RKSA 4ODGA 2F0KA 1A2UA 1A2TA 3D8GA 3QOJA 4DU9A 5CC4A 5IOCA 1NSNS 1SNDA 4B9XA 1EY5A 4TRDA 3SK5A 4QF4A 4YIJA 3TP8A 1SYDA 5C3WA 2EXZA 1EY8A 4KTAA 2KQ3A 2EY6A 1F2YA 2EY1A 5J22A 1SYGA 2F0FA 4K14A 1U9RA 3D6CA 3C1FA 2PZUA 4HMJA 4K8IA 4WORA 4NKLA 4MIUA 2PZTA 5CV9A 3D4DA 4ZQ3A 3RUZA 3P1HA 3H6MA 5KGUA 4J1MA 4KJOA 5KYLA 1JOOA 2EYFA 1SYBA 1AEXA 4N9PA 4ZUJA 2F3WA 3T16A 3NHHA 3TP6A 4EQNA 5E3FA 3MHBA 2F0HA 2EYJA 4PNYA 5M9OA 4PMCA 1STHA 1SNQA 4EQOA 3TMEA 2WACA 4KY7A 5CV6A 3BDCA 3MVVA 4I65A 3P75A 3PMFA 5J1ZA 2PYKA 3VA5A 2OEOA 4K8JA 5I6YA 4DF7A 1TR5A 5I9OA 5IIFA 4NMZA 4NP5A 4RKBA 5JAVA 1EY6A 5E1FA 3SK6A 1A3UA 5HGTA 4KV6A 5DEHA 5IGGA 3NK9A 3U9OA 3E5SA 4K5VA 2M00A 3TP5A 5IGEA 3OMGA 2F3VA 5K5PA 5IODA 4RKLA 4KY6A 2F0SA 2EYMA 4NDXA 4F8MA 3NXWA 3MXPA 2NUCA 2EYOA 1ENAA 3NUCA 4KD4A 1ENCA 2HQEA 2F0NA 1KABA 2RBMA 2OXPA 3NP8A 2O4XA 4G57A 4HMIA 5CR3A 5C3XA 5IGBA 2SOBA 4B9WA 2EY5A 5CV4A 4F7XA 1EQVA 3R3OA 2RDFA 4KY5A 2EYLA 5NUCA 4S3SA 2PW7A 1SNPA 1TT2A 3EJIA 4IZ8A 3HZXA 4ZUIA 3SK8A 4DFAA 5C4HA 1STBA 3MEHA 5C4ZA 5KYIA 3DMUA 3T13A 1STNA 5CV5A 5I9PA 4K5WA 5HURA 1EYDA 1EY7A 4IUNA 5I6WA 1EYAA 2KHSA 2PW5A 3OMCA 4K2KA 4EQPA 5KEEA 4ID6A 4ME5A 1KAAA 4PMBA 4IALA 2F0MA 2F0IA 2SNMA 5CGKA 2ENBA 2OF1A 4WRDA 1RKNA 2F0UA 5EKLA 1A3VA 4QB4A 3SHLA 1A3TA 1KDAA 1SNCA 2F0JA 3C1EA 4KD3A 5EKKA 4J6HA 1SYEA 3QB3A 5JOBA 1SNOA 5IGFA 3D4WA 4K5XA 3LX0A 5IGCA 5KRUA 1JOKA 4R8NA 2PQEA 4QMGA 1SNMA 3SXHA 1STYA 4HTHA 4KHVA 5C6AA 3ERQA 1SYCA 1EYCA 2EYHA 2F0QA 2LKVA 2SNSA 5ISRA 1TQOA 1SYFA 1JOQA 2EYPA 3V2TA 2F0WA 3HEJA 3ITPA 1KDCA 3MZ5A 5CV7A 1EY4A 1EY0A 3TP7A 5J39A 2QDBA 4E6IA 1II3A
chains in the Genus database with same CATH superfamily
5I4DA 2JA6B 1D7QA 3SVMA 1GD7A 1N34Q 5ELNA 4PZ8A 4A75A 1H9SB 4K2LA 1CKOA 3T51B 4GN4B 3L2PA 1PH8A 1F2MA 2XWBB 1BNZA 4YCWA 1S3OA 1LT6D 1XWEA 2KENA 5FO8B 3U58A 4A3EG 4B08A 2A6EC 3Q6SA 4DNTB 1P8LA 3BVGA 2KCCA 4A3IB 2F0KA 1QCBD 2K7VA 1XPRA 3UDFA 4A3FB 2P5ZX 4C1NK 2HD3A 4LNQA 1EY5A 5EPJA 1GHKA 2C5CA 1G91A 4JI1L 3TEHB 1PH2A 2K01A 4XQNA 2DNCA 1U9RA 1CI3M 4RFBA 5A2QE 1E2VA 3IL8A 4IN3A 2LY7A 1B8AA 5GQOA 4IPCA 2IW3A 2SEBD 1X9NA 3HOZH 1EFID 1P16A 4OIJA 1DYQA 3GTKB 3A5ZB 4XYQA 4JOIC 1X3EA 4H0LC 3PO3G 1V1PB 2E2IB 1EY6A 4C3HG 3MXGA 2B3GA 1Q46A 1HTPA 2EJMA 2WKDA 4BA2I 3HGBA 2F3VA 5COYA 3S17H 4IPHA 3L7ZC 2NVTH 2CQAA 3M85A 3TREA 4RGNA 4KK7A 1Q7YC 1N34L 1AH9A 2IX0A 2RBMA 2NZ1D 4G57A 1E2ZA 4HMIA 5IP7H 3A55A 3MXNA 1N8RC 3BS1A 2HUGA 4H13C 1I94Q 1SNPA 3I4LA 2CCZA 2BE5C 3MEHA 2B2UA 2A68D 5CYUA 2JA8B 1BQQT 2A73B 1MI2A 3HOUB 4NXNQ 4GN3B 1CTMA 3FKIG 1A62A 3T53B 1MHWC 3ERSX 1D1KA 1NCVA 3I4NB 1I3QH 2OTLA 4AQYQ 4QJFA 1YNXA 1LV9A 4KN4C 1OXVA 3PUZA 1PFMA 4ME3A 1WTOA 3OW2A 3S2DB 3D6WA 3DHQA 2B2VA 3KK7A 2E5LQ 4DUYQ 1PTOC 4QIWB 3NQTA 2GVBA 2QDLA 4M8AA 3H94A 3RLNA 2F0VA 4LUZA 1MIUA 3E9IA 1X65A 4YWMA 2CQOA 1KDBA 4R8IA 2E76C 2QKIC 3B6YA 4C3IH 4R4CA 1WTPA 3WOFA 4DV6Q 1A6XA 2B2UC 1LM0A 5C3WA 2I5MX 2QGQA 4KKTA 1I94L 3HOWG 2V4DA 2DUDA 1C48A 2Z1CA 5J22A 3H3VI 3C1FA 4MIUA 1I6VC 4LK1C 4R9WA 4Y52H 1LO5D 1FL0A 1NMFA 1CQFA 1BBUA 1B9MA 5BN3A 1LT5D 4JI8Q 1PH6A 1L1OB 3H91A 3TMEA 2WACA 1B7YB 5CV6A 4C2MB 4AQYL 4ABNA 3CW2C 4K8JA 1HZ9A 3H09A 3AFPA 3GQBA 3WWVA 4A76A 4B3MQ 1NNXA 2RSOA 2F4VQ 5DLQE 1FGUA 3QR8A 3NXWA 2D0PA 4HR7B 2A6ED 4GLXA 1JE4A 2HQLA 2JK8A 2F0NA 4BY1G 2E5LL 4DUYL 3NP8A 1PH7A 2MFIA 3CPWA 1QG7A 1KRSA 2UU9Q 4DV1Q 2AQ1B 5C4XG 1VQLA 2B63G 1JORA 1K3RA 4JI6Q 3CF5A 2R7ZH 3K8AA 1MBYA 3NWSA 3E3XA 1EYAA 3STBC 2FMCA 5KEEA 4PMBA 4DV6L 4IALA 4UP9A 4QB4A 4DAYA 1BR9A 5IOCA 1PA6A 1K28A 2RHQB 2J7ZA 4HIOA 1SNMA 2KOLA 4A3GG 1STYA 3RZOB 4KHVA 4U673 1RD9D 4XXEA 4POFA 1D5XC 1TQOA 4DR2Q 3W1GA 3ITPA 4JI8L 3NWTA 3MZ5A 1F2LA 3ND8A 2PI2A 2A8VA 2KA7A 3BDLA 4F87A 1W6KA 3CPFA 4LAAA 1Y8OB 4YWKA 3TZDA 3HP3A 1HCZA 5JJLA 4B3ML 1EZ6A 1X3GA 1B50A 3DUZA 2X6GA 2F4VL 2L0CA 1I4RA 4IUVA 5A2QL 3NTKA 1B70B 2F0PA 4WJ3M 1EY9A 3FRPB 4A3MB 4BY7G 3QOJA 5CC4A 1PRTC 1NSNS 1J9OA 1Q1EA 4RG1A 1M4VA 2UU9L 2E8GA 2YTXA 2Q2UA 2PI2E 4DV1L 5ELDA 4MTKA 3R8BA 1SYGA 4O1NA 1HJPA 3KBXA 4JI6L 1TVXA 4NKLA 5CV9A 2O2LD 4KJOA 2VZAA 1BF4A 5JEAJ 4G4KA 1CKNB 3OYYA 1LTLA 3OOCA 1WTHA 5D3IB 4I65A 3BYYB 5I9OA 1JQYD 4FVMA 2Z6KA 1SAPA 1PH9A 3BVMA 3E5SA 3HOYB 4DR2L 1OTCA 4BBRH 1ASYA 3PGZA 4B3SQ 4C3JB 2YYZA 3BVZA 3TDQA 4Y7NB 4J8QA 3LWEA 4C1NI 4A3CG 2G9HD 1NY4A 3ZJYC 4MHEA 3I55A 1O7IA 4GOPA 1HTLD 3H0GG 4DFAA 1IXRA 1WTQA 5C4ZA 2ICEC 1EYDA 1BCPB 5CBAE 3I2ZA 2NN6H 3K5NA 4UP7A 1KXLA 1TIID 4A3JB 1GUTA 3A56A 4LFCQ 1GXDC 3PIOA 1UUPA 3K5MA 3TS2A 4CDFC 1SBBB 2A1AA 3AMUA 4R8NA 2PQEA 4JBMA 2WAQG 1YEZA 3G7LA 2JSOA 4PMWA 4AYBE 2SNSA 2LKVA 3GTKH 1W2BA 2JA5B 4DR3Q 3KF6A 1S40A 5CV7A 1VQ4A 4E6IA 1ASZA 2VNUD 4X3SA 1H9JA 3PIPA 5CV8A 4NW2A 2I07B 4GLVB 1BXTA 4HJAA 1IHZA 5FKAC 4APVA 3GDEA 2F0LA 2VUMB 4DXGA 3CCVA 1CT1D 2X6LA 3T4AC 4B3SL 4DUZQ 4L5TA 1IBLQ 3L3OC 2ASBA 4V190 1FNUA 2EVBA 2GN5A 4IO9A 3G6JB 1A2UA 1DOLA 5C44G 1YNNC 4RGTA 1WJJA 3HOXH 3SE0A 1SYDA 5M3FB 2H5XA 1EY8A 4GZYC 2EY6A 2MO1A 3GTLB 2R92B 5IGGA 1EQRA 3M4YA 5IE8A 2JA7B 3H3VH 4PZ6A 1CSPA 4DR6Q 1VQ9A 2CVRA 3DWQA 3M3YH 2EYFA 5E7NA 3TS0A 1SYBA 3DWAA 1LTGD 3CRKC 1IZ6A 1ICWA 1TS2A 2Y0SG 1ZKOA 4LFCL 3UDIA 3I7FA 2UUAQ 1QVGA 1CZGA 1SNQA 3P75A 4DF7A 1JJCB 4NP5A 4ZCKA 4MTNA 2R93B 2NTSA 1BO0A 2E2HB 1IYJB 3Q0AA 1EIFA 4DR3L 2KJXA 3KLRA 2YTVA 1ZXTA 1ILQA 4L8JA 4LF5Q 4FYDA 1EEID 1D2BA 5IWAQ 1K8OA 4TVAB 1XMQQ 2ZTDA 1KNEA 1WTXA 1EIHA 1W3SA 2EY5A 5JEAH 3BU2A 3QG1A 4DUZL 4A93B 1IBLL 5I2XA 4ZKCB 5KNBA 4IUNA 1TS4A 1IKLA 2DY8A 4YY3Q 1CHPD 1A8VA 1RL2A 4KHPQ 2A5HA 1JICA 2F4IA 5T1IA 4RH6A 1HRJA 1WCMG 1MJCA 4HIKA 3HOZG 4H44C 4X66Q 1WYDA 4DR6L 5IYBH 5C4JH 2SDFA 3AU7A 4JI4Q 2AUKA 1U5KA 3N6RA 3FPPA 2UUAL 2Q8TA 1HZCA 1A63A 2BCOA 2KEEA 4OELB 1UAPA 1EQTA 4I7AA 2NTTA 1YVCA 1JE5A 4A3LH 1U0LA 4LF7Q 4ZRZA 1SROA 1OO9B 2R3ZA 4IUTA 5JVH3 4JG2A 1Y69U 3CD6A 1PTOB 2IL8A 3OIPA 2B8GA 2E2JH 1J8IA 1KD1C 4EGVA 1Y1VH 1UE5A 4ULLA 4IJHA 1ZYRD 4LF5L 5IWAL 1S4ZA 1V43A 2K5DA 3T56B 3F2BA 3M9BA 1TWCH 1XMQL 3S1QB 2A6HD 4ZAIA 4NXMQ 3MXNB 2Q2IA 3PUWA 4HSVA 3TP8A 3V05A 4KTAA 2K52A 3DEPA 1RCVD 2VS1A 4R4QA 5CBEE 2WAQE 4K8IA 3HKZG 4ZQ3A 4IFDI 1VQ7A 5IYCH 5L37A 1A15A 1TWGH 1AEXA 4N9PA 5ELCA 4EQNA 1ESFA 4YY3L 5FLXc 5D14A 1L0XB 4KHPL 1HNXQ 1K0SA 3PSIA 3CQZH 4X3TA 3KUPA 1JJ2A 4X66L 1A3UA 3NEMA 4KV6A 4H02A 4A3KH 4QY7A 4JI4L 1B4OA 2HIVA 1D8LA 3GTOB 1BCPF 4AIMA 2HCIA 4FF2A 1VF7A 3GD7A 2ID0A 5DM73 3RN2A 2B2YC 4PZ7A 1YNND 5C3EB 5CR3A 4ZKBB 4LF7L 1QILA 1VQDA 5CV4A 1G6PA 3D4RA 4C3IG 5A35A 4S3SA 2PW7A 3SK8A 2UXBQ 3VR5A 2ICIA 3GTGB 4K5WA 5H1SE 2EDGA 4FP5D 4A3DH 2PW5A 2Y0SE 1AW7A 4ZLTF 3G4SA 3HOVH 1I4XA 5J39A 2K5VA 4NXML 1RKNA 5AJ3Q 2LSSA 3S14B 2YU9B 4A3EB 2NWGA 3U50C 1I6HB 3RZDH 1K8GA 5KNCA 2ATWA 4JI5Q 2K5NA 1SLJA 1EL0A 2Q8IB 1EEFD 1B1ZA 1TXYA 2B2TC 3CP0A 4DK0A 2MHVA 1HNXL 3URYA 5M5XB 2AWNA 4IFDJ 4HEDA 5IYDH 5EGTA 4CDEC 1TWFB 4LF8Q 3I4MH 3J81i 4JI2Q 2DGYA 1U4LA 1HA6A 1SEBD 4EVOA 4AH6A 2EOTA 4KJNA 2B39A 3PO3B 1AN8A 2RKSA 4OGQC 3K80C 3KDFB 2GA4B 1WTVA 2QEJC 5M5YH 2VB3X 1SFOB 3A74A 1DOMA 3CCRA 3PF5A 3S1NB 4RCOA 3VYTA 2R7ZG 2EXZA 3G48A 1PRTB 5D3DA 1Q90A 4JW0A 1OXSC 3D4DA 3K7AH 4M1UB 4JBWA 1Z7TA 1PMRA 3NENA 1LTID 3A0JA 2FHTA 4G7HC 3NHHA 1I5FA 5AJ3L 4DAYB 4P74A 1PH3A 1PVOA 3HS0C 4JI5L 2ZTCA 3NK9A 5LMNQ 3U9OA 3FKIB 1EFWA 1ONLA 5FK9C 4RKLA 2Q8RE 1HR0W 3CMEA 1I50B 1F9QA 5GAEC 2ZTEA 3J81E 2HQEA 1TWAB 1AFPA 4LF8L 3TSSA 2JA9A 4OO1H 4JI2L 1CSQA 1U4MA 1IL8A 2CW0C 3HKZE 2ZXPA 5BN5A 3PO2H 3U4VA 3EJIA 4OWTB 2PQAB 4R4TA 2WFWA 3VR3A 2BA1A 3TZUA 2QEXA 2A74C 1JWMD 1SE2A 2QILA 1A3TA 5EKKA 1VQBA 1SYEA 1TS3A 1DCZA 4DAMA 4GNXA 2K14A 1VMPA 3GTJH 1PTOF 2LS01 1QOHA 1UE6A 2FXQA 4GN5A 4YCUA 3K59A 2EYPA 3V2TA 3HOWB 3AYHB 3RLOA 3BYTB 4O0AA 2NN6I 3L9AX 1HXYD 2PZWA 2Z4IA 3I56A 3DM1A 3W5OA 5M3MH 4FXDA 5IP9G 2BDNA 1S5FD 2BA0A 3QOLA 3GTQB 2AMCB 2Z4HA 5IGDA 3RMHA 5DM63 3SEBA 4B3TQ 1STGA 4RAUC 2OT2A 2I0QA 4BBSH 1SNDA 4GLAC 1YJNA 1AZPA 1VQMA 1G2SA 1LTAD 5EKIA 4UHVA 3VA7A 2NN6G 2WKCA 2NVYH 4BY1B 4LFAQ 1JWSD 1IL2A 1QUQB 5KGUA 1WI5A 2XN9C 1C9OA 1GVPA 5J3BA 3SDZA 1BCPD 3RD4A 4ZK9B 3Q24A 1QZGA 3UDXA 4IFDH 1WOCA 2NBFA 1S5BD 5ELFA 3GTMB 3NBHB 5C4XB 2B63B 1DXMA 3MVVA 5IY0A 2EQSA 1XNQQ 1FD7D 4NMZA 1VQKA 2K04A 1CUKA 3K5LA 3FP9A 3EN2A 5IGEA 2XTIA 3KJOA 1EWIA 3J81c 2AHOB 3KF6B 3MXUA 4F8MA 4DV2Q 2RSNA 4A3GB 1ENAA 1WTWA 4KD4A 2VXWA 1K73C 3OHXC 2TSSA 1CK1A 1DOKA 4TKOB 2XGTA 4NXNL 1TY0A 1CQVA 2JJQA 2RQXA 2MGSA 2SOBA 3NQIA 4F7XA 3G71A 4B3TL 1QNKA 5KYIA 1TWHB 3GTPB 2N78A 1K83H 5CV5A 3HOXG 2BH2A 3VR6A 2NVQB 4AYBG 2AKWB 2N8NA 4P73A 2E2DC 1NE3A 2B2VC 4WRDA 2K05A 2L55A 4MN3A 1Y1WH 1HQMC 1T9HA 2RCNA 2RDGA 2M2LA 1E24A 4LFAL 4POGA 4BY7B 2Z0SA 3K81C 2J0TD 1NAPA 1C4QA 1PLFA 1XNRQ 1M90C 2O5IC 5ISRA 3CMAA 1EY0A 4UPAA 4IQZA 2AQ2B 2L9HA 2G9DA 2ZXOA 1R4PB 4GS3A 3JC66 1XNQL 3FDTA 1MD2D 1IW7C 1YNJC 5T1GA 3GTOH 3M4OH 3PIO3 3KF8B 4OWXB 1Q3LA 3DEOA 4N9TA 3X3NA 4OL7A 2EY2A 5M5WH 4DV2L 4JYAQ 4X65Q 2A19A 3UDGA 4ODGA 1A2TA 5JEAG 5FOBB 1K9MC 2NZHA 1VQJA 1XTDA 1YITA 2QCPX 2KQ3A 1L0YB 1SJHD 3GTGH 1DZ1A 5LMNW 4K14A 1VS0A 1G8ZD 4IPDA 3H6MA 2N88A 3PIP3 3QO2A 3J7A5 2VY3A 1A0IA 4HJ8A 4DR5Q 4A3BH 2BE5D 4A3EH 4DR7Q 3H0GB 1C8CA 3J81L 1ENFA 5IYBG 2PMZE 2OEOA 4FXGC 4RWSC 5JPNC 2J4XA 3SK6A 1XNRL 2JQOA 2IWHA 3W1BA 1O7LA 2M00A 5IODA 4P75A 4DV0Q 2WAQB 2FMMA 1YZ6A 1WD0A 2WB1G 4PG3A 2I5LX 1R9TB 3S16H 1F9PA 4TSSA 4WFN3 4FF4A 4DPGA 1O78A 1Y1VG 2DNEA 1IKMA 2KCTA 4KY5A 5FLMH 4ZUIA 1PTOD 4JYAL 4X65L 3S2HH 1B3QA 1F77A 5C0XJ 3NELA 1QB5D 3ER0A 4ID6A 5EJWA 2F03A 1HZBA 4DV3Q 1VQ5A 1M8AA 1A3VA 2JA6H 3I72A 1T5EA 2F0JA 2N3SA 2Z6BA 5IYCG 1XPOA 3OTOQ 3F1ZA 1JOKA 2Q2TA 1KQSA 5C44B 3ERQA 2EYHA 3GP7A 4DR5L 1SMYC 3BZCA 3AEVA 1B44D 1SYFA 3CRLC 1CFMA 3KFUA 3A8IE 1I4PA 3TP7A 4DR7L 1KC8C 2B2WA 2QDBA 4A3IH 5HGQA 3R3OA 4A3FH 4A3KG 3R2IA 4N8FA 4TQUS 2EZVA 1JJGA 3FKIH 4RMFA 2F0DA 3PQIA 4K6DA 4LF6Q 3NSWA 2Y0SB 1JR0D 5EAYA 2VB2X 5K36H 1V1OA 3JAMi 2OQ0A 2I46A 5C5MA 3SK4A 4DV0L 1CA6A 3GO5A 4O42A 4LW1A 3RNUA 5IT9E 4DU9A 1H95A 4OEMB 2R61A 2I5HA 2L12A 2XRSD 3SK5A 2OWOA 1D6EC 2Z6KC 1KTKA 4PQXA 2E2IH 3MC0B 4RA8A 4A3DG 3DLLA 2H4OA 3HOVG 2K5QA 4ZYSA 4HCEA 1S5ED 4FO2A 4DV3L 3UE1A 1STHA 2V1CC 1EOVA 3PMFA 3BZKA 4JCVE 3OTOL 4ALPA 3STBD 3H3VC 1IW7D 1YNJD 5IIFA 2OQKA 4GOPC 4RKBA 2RVLA 5KNDA 5JJZA 2B2WC 2KHIA 5HGTA 4JBKA 3KJPA 1WCMB 2F0SA 2JA8H 2DJFC 4O2DA 3OW7A 3HOUH 3HOZB 3I4MG 4IURA 3NUCA 3M4QA 1KHIA 4CJ2C 4R1JA 1U4RA 3DM3A 4LF6L 3JAME 3I4NH 3CHBD 1H9KA 1F9RA 1VQFA 2EYLA 2UUBQ 4HIDA 5C4HA 4KMUC 1VQ8A 2A69C 3NTHA 1GUWA 3K0YA 1AZQA 3OMCA 3KLSA 4HN7A 3S2DH 2PNHA 1BKBA 1JB3A 3I3CA 1B3AA 2XWJB 1SNOA 1VQAA 5BR8Q 5IGCA 5KRUA 1PRTD 4OO1I 2MP1A 4QMGA 3D0FA 2EE1A 1RTNA 1Z6HA 4WJWA 3Q22A 1EY4A 2Z8LA 3HKZB 3QIAA 4B3RQ 2WB1E 1HR0Q 3CCJA 1VQOA 4R4OA 1FNVA 1F2ZA 1I3QB 1BBWA 4HJ5A 5C0XH 1WTRA 3EROA 2RCFA 5IT9c 4RHSA 3AB9A 4QQBX 2UXCQ 1EQQA 1E22A 3PO2G 3J7YW 1YIJA 4C2MH 3L0OA 4TRDA 3ONAB 1D5ZC 4EQ5A 1VQPA 2K5HA 2UUBL 2JEBI 1YHAA 1E0BA 1J5EQ 2NVQH 2ZJRA 1STEA 1Q86C 3RUZA 1HFNA 1JT8A 2KBNA 3J80E 1GKHA 4RCNA 4QCLA 4LFBQ 1ZEQX 1BOSA 3MHBA 4C3IB 2LFNA 2F0HA 4FNFA 4JBJA 4PNYA 4PMCA 1GUNA 3OIQA 3I73A 5IP7G 1Q82C 5BR8L 2QA4A 4DV4Q 3CU7A 3CCQA 1CA5A 5E1FA 1E2WA 1PZID 1CKNA 3OMGA 4KHZA 1H9RA 5M3MG 3JAMc 3E0JA 3K6OA 1CKMA 3MXPA 3RR5A 4B3RL 3IFTA 1HR0L 1EOTA 1RODA 1E7ZA 3C3LA 1ESRA 4K6LA 1KRTA 2IT1A 3ULPA 4F88A 4NPSA 4BBSG 1XXGA 3RZOH 4I7ZC 3I91A 4KKSA 3A5UA 2KCMA 2K50A 3LNNA 3M7GA 1STBA 1STNA 4CJ0B 2UXCL 4UP8A 5I6WA 2KHSA 1PFBA 1BVSA 1VQEA 2KUMA 3F8TA 1LABA 2K33A 3SHLA 4EQOA 4X62Q 2CKZB 4FF1A 1O7YA 4IFDG 1J5EL 4KKUA 4PV1C 1HUNA 1CM9A 1JOQA 3H0GH 2R7ZB 4LFBL 3HEJA 4JVZA 2VQFQ 4A3MH 5ELOA 5IT9L 1LTBD 1X54A 4DV4L 1Y14B 4DNRB 2AQ3B 3OWFA 2Z9HA 2BOSA 2K5WA 3BG3A 1NUCA 4OXPA 2L1BA 1NMGA 2A68C 1STAA 4UDUC 2F0GA 3I4OA 3MFYA 4OONA 5DAUA 3IRBA 2XSCA 4B9XA 1GM5A 1QZHA 3S15B 2CHBD 1SR3A 3ICEA 5GAGC 5GADC 3A8JE 1S72A 1RHPA 1HPCA 4WORA 3HOYH 1G51A 3P1HA 2XIWA 3I70A 2JE6I 1QVCA 1NJIC 2D62A 1Y1WG 4C3JH 1KIXA 1RJTA 2IX3A 1N9WA 4P2CB 2EYJA 4Y7NH 2JYOA 4X62L 1YHBA 1L0WA 2DY7A 4C3HB 5C44H 3VA5A 3JAML 5I6YA 3KBGA 2G5DA 1VQIA 1PH5A 2Q2HA 4DR1Q 4KI0A 3TP5A 2VQFL 5K5PA 1EUJA 2UXBL 1OXTA 1IYVA 4FF3A 2K32A 3UI2A 2ZT9C 2NUCA 2EIFA 2N55A 3S24A 4A3JH 2XVSA 1X3FA 2IJ0A 2EPBA 4JOIA 4J15A 3W3AA 1RIPA 3R93A 4LJZC 3TN2A 5JJIA 2N49A 2JA5H 2PMZB 3CAMA 2XRQD 2DJGC 3AQQA 4DR4Q 2MNAA 3FPUB 2F0IA 2K1BA 3H15A 2F0UA 3O13A 3P20A 1JB7A 1KDAA 1SNCA 3C1EA 5IGFA 1VDZA 1MGSA 5G3LD 4JI0Q 1B53A 4A3BG 1I4HA 2CFMA 1SE4A 2VUMH 1UE1A 2WV6D 4IOCA 1G6ZA 4RGMA 2ALYB 2PO4A 4IJLA 2AWOA 3A7AB 2EXDA 2ZJPA 1II3A 3M4PA 4RGOS 4XIGS 5M3FH 1EZ8A 4XT1B 1WCMH 3GTLH 2R92H 4DR1L 1Q81C 2MO0A 2JA7H 1U4PA 1I4GA 1SSOA 4H7BA 1XX8A 2DN8A 4HJ7A 4LF4Q 3J80L 1GHJA 4DGZA 2F1MA 1IYUA 3PF4A 5FO9B 3D8GA 3LWUA 5FLMG 4X6AH 2CWAA 3F2CA 1X6OA 3AFQA 1LTSD 1ML0D 3T1HQ 1JC7A 2F0FA 4YIJA 2RHSB 4HMJA 4BBRG 4DV7Q 2R93H 4L63B 2PZTA 4MZ9A 2E2HH 3U4ZA 1N36Q 2UUCQ 5LMNL 4DR4L 2JA6G 1JOOA 4XQQA 2L4NA 1J6QA 3UE0A 2VL6A 2F3WA 2HIXA 3TP6A 2ZM6Q 1LUZA 1AE3A 4X3KA 1EU3A 3IKJA 1X55A 2VQEQ 2HDLA 3BZDB 3J7ZC 3HOXB 3DXJC 3OWEB 3ZYYX 4JI0L 2NVXB 1LTTD 5EPKA 1LT4D 2PCFB 1GUOA 1QE6A 4DK3C 2KECA 4AYBB 3QWNA 3CCMA 3EBEA 4IPGA 4A3IG 2IPKD 4XDXA 4A3FG 1PYWD 4A93H 3F2DA 4KY6A 4GOPB 3M3YB 3S1RB 4NDXA 3PUXA 3K58A 5K36G 4HIMA 4DAPA 4JPBW 5C3XA 4CBVA 2IX1A 1AP0A 3FHWA 1VQ6A 4DKAC 2D2CC 4GNXC 1EQVA 2C35B 3R2TA 4IZ8A 3K57A 5FJ8H 1Y8PB 4QUCA 4LF4L 3DMUA 3Q8DA 2MUYA 1PYBA 1KAAA 4L5QA 1Q8KA 2JXMB 4LMQD 5EBDA 1SJED 1SDFA 2F3IA 1HUMA 3QB3A 3T1HL 3D4WA 4K5XA 4DV7L 4QL5A 1FYCA 1N36L 5C6AA 2UUCL 1T5XD 2ZJQA 1PTOH 1YJ9A 4JI7Q 1LT3D 2ZM6L 3VYUA 1PDQA 2VQEL 3W2DA 5ELEA 1DONA 2YTYA 4CHTB 3S1QH 2AUJD 3IFDA 5F2DA 1ILPA 1B2TA 5KIXA 1RTOA 1GOZA 2JA8G 2F0OA 4DK1A 1RDPD 1TU2B 3HOUG 1PH1A 3ND9A 4BA1I 5C4JB 1K8MA 1FJGQ 4FXKC 3I4NG 3NPPA 2QW7A 2RDHA 2RA4A 1X32A 2IHFA 1V8QA 2BH8A 2EJGC 4L6TB 1GJXA 3CXCA 3VR2A 3BJUA 4YWLA 2PZUA 1L2FA 2WB1B 5C0XI 2FFKB 3I90A 2IY5B 4BS9A 3S1MB 2UXDQ 4J1MA 1YI2A 1PRTF 4GKKQ 2E2JB 1Y1VB 1E1TA 3KDFA 2CW0D 3KLWA 1C0AA 1XYIA 5E3FA 4BXXH 1HNZQ 5C3EH 1TWCB 3BDCA 5J1ZA 4HCSA 5E4XA 1HFGA 4P71A 4XQJA 1H9SA 3K7UC 5LMUQ 4JI7L 1XPUA 2MPMA 4K5VA 4L5RC 1Z9FA 1TWGB 4ILWA 4A4IA 3X3MA 1ENCA 5C0XG 2M9VA 1Z47A 4LF9Q 2CH4A 3CQZB 1EWHA 3S14H 2YU9H 1I6HH 2O5JC 1CHQD 4B9WA 1MSGA 4A3KB 4KN7C 1FJGL 4MNOA 1KNAA 3K5OA 3S15H 4ME5A 1KL9A 4V0BA 5M5XH 4A3LG 1KLUD 1SMXA 1YBYA 3OPOA 1TWFH 2D0OA 4IOAA 2PQAA 1V1PA 1VQGA 1OXXK 1D1IA 2K4KA 2UXDL 4GKKL 1GUSA 1CZWA 1IBMQ 3PO3H 5CMDA 3FVQA 1KDCA 4C3HH 1HNZL 4A3DB 3HOVB 2BDOA 3EQLC 5E4WC 1SFOH 1XJVA 3S1NH 3U9SA 4DXFA 3CCSA 1AE2A 1LYLA 3SR1A 5LMUL 1N32Q 1ICFB 3RZDB 3MA2B 1Y8NB 3T1YQ 1FR3A 1SRUA 4LUVA 2ZXRA 4Q0FA 2JP1A 1VQCA 3TBIB 4RHRA 2JN4A 1O80A 4YHHQ 4FDBA 2C9OA 4LF9L 5TSSA 3RN5A 4QF4A 3MTSA 1H9MA 1F2YA 3I4MB 5IP9H 3D6CA 1Q12A 2L11A 1UNSA 2FJ2A 5DNFA 4DN4M 4DV5Q 1I50H 1V1QA 3CCEA 4NB3A 2LMCB 1MJEA 3PUVA 1SXTA 5M5YB 1TWAH 2PYKA 3BDOA 4BWGB 4HSPA 1HA5A 1QUQA 2FINB 4CDDC 4UY8C 1ZYRC 1BUVT 4A3MG 1IBML 3K7AB 2LXKA 4P72A 2EYMA 5I2YA 2A6HC 3NBHA 2OTJA 3HRZC 4LWCA 1FNWA 1VF5C 4IUPA 2PPBC 1G2TA 1EIGA 1ET6A 2NZOA 2L15A 2XNAC 5AFWA 1YJWA 4DAVA 1N32L 2IHEA 3T1YL 3A8KE 2HDMA 2JEAI 2R6GA 3C46A 4OIKA 5M9OA 5FO7B 4YHHL 3HOWH 4QIWE 1N33Q 3HFZB 4K2KA 1LLRD 3SGIA 4EQPA 5CGKA 5IYDG 5EBCA 5EKLA 3HOYG 1I4QA 1L1OA 2HHHQ 4KD3A 4J6HA 3GTQH 3MAQA 3K0XA 4C3JG 3C2PA 3SXHA 1QNUA 4HTHA 3PO2B 2L5TA 1HH2P 1SE8A 4LUOA 4DV5L 3CC7A 4QGUA 1SN8A 2NVXH 5CORA 2PNRC 2YV5A 1PFNA 3S17B 5JVG3 3KYHC 2D9UA 3A54A 2NVTB 4CKBA 2F0TA 3EA6A 4R4IA 1LTRD 4CKEA 3S1RH 4XT3B 3J80i 4BY1H 4A3JG 3GTJB 1YHQA 4GKJQ 5HY6A 2F0EA 1HHVA 3E6ZX 5FLXE 3CCUA 3GTMH 5C4XH 1PZKD 1DJRD 2B63H 1NR2A 1UEAB 5GROA 5GAHC 1M1KC 3VR4A 1VQNA 3GV3A 2KCNA 2K75A 3F2UA 5M3MB 2JA5G 3D31A 3A7LA 2WIIB 3KF8A 1JMCA 1X3PA 3CCLA 4OX9Q 1NTGA 4HJ9A 1L1OC 3KOJA 5G3LF 5KYLA 1N33L 2R7FA 4BBSB 4ZUJA 3T16A 3N52A 4A3GH 3PCOB 2D5DA 1O7ZA 1XMOQ 2HHHL 1B9NA 4CKCA 2VUMG 4OO1G 5JPMC 4OWWB 4XYOA 3D3RA 2NVYB 1WD1A 3NTIA 4KLKA 4X3UA 3CC2A 2R7DA 1KAWA 1TWHH 3VYSA 3GTPH 1PXUA 5M3FG 1QWYA 3NBIA 3ULJA 2EYOA 1SMYD 1TY2A 2R92G 1HNWQ 1PYSB 1K8AC 2JA7G 2O4XA 4CGYB 3FMCA 1S5DD 2CWPA 3WDNA 1EWCA 4BY7H 2F52A 1V9PA 2RDFA 1TT2A 4GKJL 3EIVA 3T13A 1NBWA 4GNXB 3PV0A 5HURA 1XTCD 1QVFA 1EY7A 1KLGD 5BN4A 5JJKA 1RF2D 4K0KQ 3I8ZA 2ENBA 2ES2A 2R93G 1GUGA 1PHJA 2LXJA 2H1EA 2B2YA 1UEBA 3ULLA 4L5SA 1BDOA 1MSHA 2NB0A 4Q5VA 1WVLA 1PV4A 4OX9L 3S1MH 3IAYA 4DK6C 3VDYA 1E1OA 1JWUD 5D65A 3CKIB 5LL6X 1K3BC 1SYCA 4G7OC 2F0QA 2KHJA 3EFXD 4JV5Q 1K83B 3P7JA 1HQRD 4XTCS 4N8X1 2X69A 1EYGA 1XMOL 4X64Q 5LL6S 4UAIA 3OSOA 4CJ1B 4A93G 3FEWX 1Y1WB 2RF4A 5C5LA 3S9WA 4JC0A 1VQHA 1JCKB 3EVQA 5LHY1 1ET9A 4A3CH 5ELBA 1LACA 2HCCA 1HNWL 3VYRA 1DM0B 4QUFA 1X56A 2K6AA 3GV6A 2B2TA 4DNIA 3E9HA 4DA2A 3TQYA 1FGBD 5FJ8G 2KEDA 2MJ8A 1UE7A 4WJ4A 2K28A 3WOEA 3Q23A 2EY1A 3M4OB 4U68A 1SE3A 5JOBA 1PZJD 4JK1C 4Z9CB 1QJOA 4JI3Q 3KLSX 5M5WB 1VMCA 1IBKQ 4EX5A 4K0KL 1EIYB 2HT1A 2A69D 4KY7A 1R9TH 3CC4A 1WFQA 1R4QB 2WINB 4CDCC 2EJFC 4HAEA 1Q1BA 1TR5A 4YCVA 2KVMA 1FVIA 1TS5A 3G6EA 5DEHA 1G291 2VW9A 3QJYA 3PUYA 3J81j 4JV5L 1NR4A 3J80c 2TMPA 3MWYW 4X64L 1BBXC 3J7AF 4A3BB 3J7AV 2GVAA 1KABA 4G7ZC 2OXPA 1Q8IA 3LGJA 5IGBA 1BCPC 4JI1Q 1MKHA 5NUCA 3MEFA 3MFGA 5JAVA 1S5CD 3HZXA 2MQHA 4IUUA 5I9PA 1UWVA 2WP8J 2E75C 1TKWB 2F0MA 2SNMA 2OF1A 2K03A 1X3QA 3TRZA 3V96A 1HZAA 1DGSA 1E3PA 4OHJA 3S16B 2B8FA 1GO3E 3LX0A 1OXUA 4BXXG 3E0EA 1D5MC 4JI3L 5EPLA 1F9SA 1EYCA 1PH4A 1VCIA 3S2HB 5C3EG 4IUQA 1IBKL 2CH4W 2E74C 2F0WA 2OCEA 1EU4A 1PFSA 3DWPA 4C56C 3M7NA 5EQ0A 2NYZD 3NE5B 4BBRB 2QF7A 1C7YA 3RLFA 2B29A 5FLXL 3HKSA 1K0RA 1W6JA 1DD2A 3HG9A
chains in the Genus database with same CATH topology
5I4DA 2JA6B 3SVMA 1H9SB 4K2LA 3T51B 1F2MA 2XWBB 1BNZA 1LT6D 1XWEA 5FO8B 4B08A 2A6EC 3Q6SA 4DNTB 3BVGA 2KCCA 4A3IB 2F0KA 1QCBD 2K7VA 4A3FB 4C1NK 1GHKA 1EY5A 5EPJA 2C5CA 1G91A 2K01A 4XQNA 2DNCA 1U9RA 1CI3M 4RFBA 5A2QE 1E2VA 3IL8A 4IN3A 2LY7A 2IW3A 2SEBD 1EFID 4OIJA 1DYQA 3GTKB 4XYQA 4H0LC 1V1PB 2E2IB 1EY6A 4C3HG 3MXGA 1HTPA 2EJMA 2WKDA 4BA2I 3HGBA 2F3VA 5COYA 3L7ZC 2CQAA 3M85A 4RGNA 4KK7A 2IX0A 2RBMA 2NZ1D 4G57A 1E2ZA 4HMIA 3A55A 3MXNA 3BS1A 2HUGA 4H13C 1SNPA 3I4LA 2BE5C 3MEHA 2B2UA 2A68D 5CYUA 2JA8B 1BQQT 2A73B 1MI2A 3HOUB 1CTMA 3T53B 1D1KA 1NCVA 3I4NB 1LV9A 4KN4C 1OXVA 3PUZA 1PFMA 1WTOA 3S2DB 3D6WA 3DHQA 2B2VA 3KK7A 1PTOC 4QIWB 3NQTA 4M8AA 3H94A 2F0VA 1KDBA 4R8IA 2E76C 2QKIC 1WTPA 3WOFA 1A6XA 2B2UC 5C3WA 4KKTA 2V4DA 1C48A 2Z1CA 5J22A 3C1FA 4MIUA 1I6VC 4LK1C 4R9WA 1LO5D 1CQFA 1B9MA 5BN3A 1LT5D 3H91A 3TMEA 2WACA 5CV6A 4C2MB 4ABNA 4K8JA 3H09A 3GQBA 2RSOA 3NXWA 4HR7B 2A6ED 1JE4A 2F0NA 3NP8A 1QG7A 2AQ1B 1JORA 1MBYA 3NWSA 1EYAA 2FMCA 5KEEA 4PMBA 4IALA 4QB4A 4DAYA 1BR9A 5IOCA 2J7ZA 3RZOB 1SNMA 2KOLA 1STYA 4KHVA 4U673 1RD9D 4XXEA 1D5XC 1TQOA 3ITPA 3NWTA 3MZ5A 1F2LA 3ND8A 2KA7A 3BDLA 4F87A 1W6KA 4LAAA 1Y8OB 3TZDA 3HP3A 1HCZA 1EZ6A 1B50A 3DUZA 2X6GA 2L0CA 1I4RA 4IUVA 5A2QL 3NTKA 2F0PA 1EY9A 3FRPB 4A3MB 3QOJA 5CC4A 1PRTC 1NSNS 1J9OA 1Q1EA 1M4VA 5ELDA 3R8BA 1SYGA 4O1NA 3KBXA 1TVXA 4NKLA 5CV9A 2O2LD 4KJOA 1BF4A 5JEAJ 4G4KA 3OOCA 5D3IB 4I65A 3BYYB 5I9OA 1JQYD 4FVMA 1SAPA 3BVMA 3E5SA 3HOYB 4C3JB 2YYZA 3BVZA 3TDQA 4Y7NB 4J8QA 3LWEA 4C1NI 2G9HD 4MHEA 1HTLD 4DFAA 1WTQA 5C4ZA 2ICEC 1EYDA 1BCPB 5CBAE 2NN6H 3K5NA 1TIID 4A3JB 1GUTA 3A56A 1GXDC 1UUPA 3K5MA 1SBBB 3AMUA 4R8NA 2PQEA 3G7LA 2JSOA 4PMWA 2SNSA 2LKVA 2JA5B 5CV7A 4E6IA 2VNUD 4X3SA 1H9JA 5CV8A 4NW2A 2I07B 1BXTA 1IHZA 5FKAC 2F0LA 2VUMB 4DXGA 1CT1D 2X6LA 3T4AC 3L3OC 4V190 1FNUA 2EVBA 3G6JB 1A2UA 1DOLA 1YNNC 4RGTA 3SE0A 1SYDA 5M3FB 1EY8A 4GZYC 2EY6A 3GTLB 2R92B 5IGGA 3M4YA 2JA7B 2CVRA 3DWQA 2EYFA 1SYBA 3DWAA 1LTGD 3CRKC 1ICWA 1TS2A 1ZKOA 1CZGA 1SNQA 3P75A 4DF7A 4NP5A 2R93B 2NTSA 1BO0A 2E2HB 3Q0AA 2KJXA 3KLRA 1ZXTA 1ILQA 4L8JA 4FYDA 1EEID 1D2BA 1K8OA 1KNEA 1WTXA 1EIHA 2EY5A 5JEAH 3QG1A 4A93B 5I2XA 4ZKCB 5KNBA 4IUNA 1TS4A 1IKLA 2DY8A 1CHPD 2A5HA 1JICA 2F4IA 5T1IA 4RH6A 1HRJA 4H44C 2SDFA 3AU7A 2AUKA 3N6RA 3FPPA 2Q8TA 2BCOA 2KEEA 1UAPA 1EQTA 2NTTA 4ZRZA 1OO9B 2R3ZA 4IUTA 5JVH3 1Y69U 1PTOB 2IL8A 3OIPA 2B8GA 1J8IA 4EGVA 4ULLA 1ZYRD 1S4ZA 1V43A 2K5DA 3T56B 3S1QB 2A6HD 4ZAIA 3PUWA 4HSVA 3TP8A 3V05A 4KTAA 3DEPA 1RCVD 5CBEE 4K8IA 4ZQ3A 4IFDI 1A15A 5ELCA 1AEXA 4N9PA 4EQNA 1ESFA 5D14A 1L0XB 4X3TA 3KUPA 1A3UA 4KV6A 1B4OA 3GTOB 1BCPF 2HCIA 4FF2A 1VF7A 3GD7A 2ID0A 5DM73 2B2YC 1YNND 5C3EB 5CR3A 4ZKBB 1QILA 5CV4A 3D4RA 4C3IG 5A35A 4S3SA 2PW7A 3SK8A 3VR5A 2ICIA 3GTGB 4K5WA 2EDGA 4FP5D 2PW5A 1AW7A 4ZLTF 1I4XA 5J39A 1RKNA 3S14B 2YU9B 4A3EB 2NWGA 1I6HB 5KNCA 1EL0A 2Q8IB 1EEFD 1B1ZA 2B2TC 4DK0A 2MHVA 3URYA 5M5XB 2AWNA 4IFDJ 4HEDA 5EGTA 1TWFB 1HA6A 1U4LA 1SEBD 4EVOA 2EOTA 4KJNA 2B39A 3PO3B 1AN8A 2RKSA 4OGQC 2GA4B 1WTVA 2QEJC 2VB3X 1SFOB 1DOMA 3S1NB 4RCOA 3VYTA 2EXZA 1PRTB 5D3DA 1Q90A 4M1UB 1OXSC 3D4DA 4JBWA 1Z7TA 1PMRA 1LTID 2FHTA 4G7HC 3NHHA 3HS0C 3NK9A 3U9OA 3FKIB 1ONLA 5FK9C 4RKLA 2Q8RE 1I50B 1F9QA 3J81E 2HQEA 1TWAB 1AFPA 3TSSA 4OO1H 1U4MA 1IL8A 2CW0C 2ZXPA 5BN5A 3EJIA 3VR3A 2BA1A 3TZUA 2A74C 1JWMD 1SE2A 2QILA 1A3TA 5EKKA 1SYEA 1TS3A 1DCZA 1VMPA 1PTOF 2LS01 1QOHA 3K59A 2EYPA 3V2TA 3HOWB 3BYTB 2NN6I 3L9AX 1HXYD 2PZWA 2Z4IA 3DM1A 4FXDA 2BDNA 1S5FD 2BA0A 3QOLA 3GTQB 5IGDA 2Z4HA 3RMHA 5DM63 3SEBA 1STGA 4RAUC 2OT2A 1SNDA 1AZPA 1G2SA 1LTAD 5EKIA 3VA7A 2NN6G 2WKCA 4BY1B 1JWSD 5KGUA 4ZK9B 2XN9C 3SDZA 4FF1A 1BCPD 3RD4A 3Q24A 4IFDH 2NBFA 1S5BD 5ELFA 3GTMB 5C4XB 2B63B 1DXMA 3MVVA 1FD7D 4NMZA 2K04A 3K5LA 5IGEA 3MXUA 4F8MA 2RSNA 4A3GB 1ENAA 1WTWA 4KD4A 2VXWA 3OHXC 2TSSA 1CK1A 1DOKA 4TKOB 1TY0A 1CQVA 2RQXA 2SOBA 2MGSA 3NQIA 4F7XA 1QNKA 5KYIA 1TWHB 3GTPB 5CV5A 3VR6A 2NVQB 2E2DC 2B2VC 4WRDA 2K05A 2L55A 4MN3A 1HQMC 2RDGA 2M2LA 4BY7B 2J0TD 1NAPA 1C4QA 1PLFA 2O5IC 5ISRA 1EY0A 4IQZA 2AQ2B 2L9HA 2G9DA 2ZXOA 1R4PB 3FDTA 1MD2D 1IW7C 1YNJC 5T1GA 3PIO3 1Q3LA 3DEOA 4N9TA 3X3NA 4OL7A 2EY2A 4ODGA 1A2TA 5JEAG 5FOBB 2QCPX 2KQ3A 1L0YB 1SJHD 1DZ1A 4K14A 1G8ZD 3H6MA 2N88A 3PIP3 3QO2A 2BE5D 3H0GB 1C8CA 3J81L 1ENFA 2OEOA 4FXGC 5JPNC 4RWSC 2J4XA 3SK6A 2IWHA 1O7LA 2M00A 5IODA 2WAQB 2FMMA 1WD0A 1R9TB 1F9PA 4TSSA 4WFN3 4FF4A 1O78A 2DNEA 1IKMA 4KY5A 4ZUIA 1PTOD 1F77A 5C0XJ 1QB5D 4ID6A 5EJWA 2F03A 1A3VA 1M8AA 3I72A 1T5EA 2F0JA 1JOKA 5C44B 3ERQA 2EYHA 3GP7A 1SMYC 1B44D 1SYFA 3CRLC 1CFMA 3A8IE 1I4PA 3TP7A 2B2WA 2QDBA 3R3OA 3R2IA 4TQUS 2EZVA 2F0DA 4K6DA 3NSWA 2Y0SB 1JR0D 2VB2X 5K36H 1V1OA 2I46A 5C5MA 3SK4A 1CA6A 3GO5A 4O42A 5IT9E 4DU9A 2R61A 2L12A 2XRSD 3SK5A 1D6EC 1KTKA 4PQXA 3MC0B 4RA8A 2H4OA 2K5QA 4ZYSA 4HCEA 1S5ED 4FO2A 1STHA 3PMFA 3H3VC 1IW7D 1YNJD 5IIFA 4RKBA 2RVLA 5KNDA 5JJZA 2B2WC 5HGTA 1WCMB 2F0SA 3OW7A 3HOZB 4IURA 3NUCA 4CJ2C 1U4RA 3JAME 3CHBD 1H9KA 1F9RA 2EYLA 5C4HA 4KMUC 2A69C 3NTHA 1GUWA 3K0YA 1AZQA 3OMCA 3KLSA 4HN7A 1JB3A 3I3CA 1B3AA 2XWJB 1SNOA 5IGCA 5KRUA 1PRTD 4OO1I 2MP1A 4QMGA 2EE1A 1RTNA 1Z6HA 4WJWA 3Q22A 1EY4A 2Z8LA 3HKZB 3QIAA 1FNVA 1F2ZA 1I3QB 5C0XH 1WTRA 3EROA 4RHSA 3AB9A 3J7YW 4TRDA 3ONAB 1D5ZC 2JEBI 1E0BA 1STEA 1HFNA 3RUZA 3J80E 4RCNA 4QCLA 1ZEQX 1BOSA 3MHBA 4C3IB 2LFNA 2F0HA 4FNFA 4PNYA 4PMCA 1GUNA 3OIQA 3I73A 3CU7A 1CA5A 5E1FA 1E2WA 1PZID 3OMGA 4KHZA 1H9RA 3E0JA 3K6OA 3MXPA 3IFTA 1EOTA 1RODA 3C3LA 1ESRA 4K6LA 2IT1A 4F88A 1XXGA 4I7ZC 3I91A 4KKSA 3LNNA 3M7GA 1STBA 1STNA 4CJ0B 5I6WA 2KHSA 1PFBA 2KUMA 1LABA 2K33A 3SHLA 4EQOA 1O7YA 4IFDG 4KKUA 4PV1C 1HUNA 1CM9A 1JOQA 2R7ZB 3HEJA 5IT9L 1LTBD 4DNRB 2AQ3B 3OWFA 2BOSA 2K5WA 3BG3A 1NUCA 2L1BA 2A68C 1STAA 4UDUC 2F0GA 3MFYA 5DAUA 2XSCA 4B9XA 3S15B 2CHBD 3A8JE 1RHPA 1HPCA 4WORA 2XIWA 3P1HA 3I70A 2JE6I 2D62A 1RJTA 2IX3A 4P2CB 2EYJA 2JYOA 2DY7A 4C3HB 3VA5A 3JAML 5I6YA 3KBGA 4KI0A 3TP5A 5K5PA 1OXTA 1IYVA 4FF3A 2K32A 3UI2A 2ZT9C 2NUCA 2N55A 2XVSA 2IJ0A 2EPBA 3W3AA 3R93A 4LJZC 3TN2A 2PMZB 2XRQD 3FPUB 2F0IA 2K1BA 2F0UA 3O13A 3P20A 1KDAA 1SNCA 3C1EA 5IGFA 1VDZA 1MGSA 5G3LD 1B53A 1I4HA 1SE4A 2WV6D 1G6ZA 4RGMA 2PO4A 2AWOA 3A7AB 1II3A 4RGOS 4XIGS 1EZ8A 4XT1B 1U4PA 1I4GA 1SSOA 4H7BA 1XX8A 2DN8A 3J80L 1GHJA 4DGZA 2F1MA 1IYUA 5FO9B 3D8GA 3LWUA 1LTSD 1ML0D 1JC7A 2F0FA 4YIJA 4HMJA 4L63B 2PZTA 1JOOA 4XQQA 2L4NA 2F3WA 3TP6A 4X3KA 1EU3A 3IKJA 2HDLA 3BZDB 3HOXB 3DXJC 3OWEB 3ZYYX 2NVXB 1LTTD 5EPKA 1LT4D 2PCFB 1GUOA 1QE6A 2KECA 4AYBB 3QWNA 2IPKD 4XDXA 1PYWD 4KY6A 3M3YB 3S1RB 4NDXA 3PUXA 3K58A 5K36G 4DAPA 5C3XA 4CBVA 2IX1A 1AP0A 2D2CC 1EQVA 3R2TA 4IZ8A 3K57A 1Y8PB 4QUCA 3DMUA 2MUYA 1KAAA 2JXMB 4LMQD 5EBDA 1SJED 1SDFA 3QB3A 1HUMA 3D4WA 4K5XA 1FYCA 5C6AA 1T5XD 1PTOH 1LT3D 3VYUA 1PDQA 3W2DA 5ELEA 1DONA 4CHTB 2AUJD 3IFDA 5F2DA 1ILPA 1B2TA 5KIXA 1RTOA 1GOZA 2F0OA 4DK1A 1RDPD 1TU2B 3ND9A 4BA1I 5C4JB 1K8MA 4FXKC 3NPPA 2RDHA 2RA4A 1X32A 1V8QA 2EJGC 4L6TB 1GJXA 3VR2A 2PZUA 2WB1B 5C0XI 2FFKB 3I90A 4BS9A 3S1MB 2E2JB 4J1MA 1PRTF 1Y1VB 2CW0D 1XYIA 5E3FA 1TWCB 3BDCA 5J1ZA 4HCSA 5E4XA 1HFGA 4XQJA 1H9SA 2MPMA 4K5VA 1TWGB 4ILWA 3X3MA 1ENCA 5C0XG 2M9VA 1Z47A 3CQZB 1EWHA 2O5JC 1CHQD 4B9WA 1MSGA 4A3KB 4KN7C 1KNAA 3K5OA 4ME5A 4V0BA 1KLUD 3OPOA 1V1PA 1OXXK 1D1IA 1GUSA 1CZWA 5CMDA 3FVQA 1KDCA 4A3DB 3HOVB 2BDOA 3EQLC 5E4WC 3U9SA 4DXFA 3SR1A 3RZDB 3MA2B 1Y8NB 1FR3A 2ZXRA 4Q0FA 2JP1A 3TBIB 4RHRA 1O80A 2C9OA 5TSSA 4QF4A 3MTSA 1H9MA 1F2YA 3I4MB 3D6CA 1Q12A 2L11A 1UNSA 2FJ2A 5DNFA 4DN4M 2LMCB 3PUVA 1SXTA 5M5YB 2PYKA 3BDOA 4BWGB 4HSPA 1HA5A 2FINB 1ZYRC 1BUVT 3K7AB 2EYMA 5I2YA 2A6HC 3NBHA 3HRZC 1FNWA 1VF5C 4IUPA 2PPBC 1G2TA 1EIGA 1ET6A 2XNAC 5AFWA 4DAVA 3A8KE 2HDMA 2JEAI 2R6GA 3C46A 4OIKA 5M9OA 5FO7B 4K2KA 1LLRD 4EQPA 5CGKA 5EBCA 5EKLA 1I4QA 4KD3A 4J6HA 3MAQA 4C3JG 3C2PA 3SXHA 1QNUA 4HTHA 3PO2B 2L5TA 5CORA 2PNRC 1PFNA 3S17B 5JVG3 2D9UA 3A54A 2NVTB 4CKBA 2F0TA 3EA6A 1LTRD 4CKEA 4XT3B 3GTJB 2F0EA 1HHVA 3E6ZX 5FLXE 1PZKD 1DJRD 1NR2A 1UEAB 3VR4A 3GV3A 2KCNA 3F2UA 5M3MB 3D31A 3A7LA 2WIIB 3KF8A 1X3PA 5G3LF 5KYLA 4BBSB 4ZUJA 3T16A 3N52A 2D5DA 1O7ZA 1B9NA 4CKCA 4OO1G 5JPMC 4XYOA 3D3RA 2NVYB 1WD1A 3NTIA 4X3UA 3VYSA 1PXUA 1QWYA 3NBIA 2EYOA 1SMYD 1TY2A 2O4XA 4CGYB 3FMCA 1S5DD 3WDNA 1EWCA 2RDFA 1TT2A 3T13A 3PV0A 5HURA 1XTCD 1EY7A 1KLGD 5BN4A 1RF2D 3I8ZA 2ENBA 1GUGA 2H1EA 2B2YA 1BDOA 1MSHA 2NB0A 4Q5VA 1WVLA 3IAYA 1JWUD 5D65A 3CKIB 5LL6X 1SYCA 4G7OC 2F0QA 3EFXD 1K83B 3P7JA 1HQRD 4XTCS 2X69A 5LL6S 4UAIA 3OSOA 4CJ1B 3FEWX 1Y1WB 5C5LA 3S9WA 1JCKB 3EVQA 5LHY1 1ET9A 5ELBA 1LACA 2HCCA 3VYRA 1DM0B 4QUFA 2K6AA 3GV6A 2B2TA 4DA2A 1FGBD 2KEDA 2MJ8A 2K28A 3WOEA 3Q23A 2EY1A 3M4OB 4U68A 1SE3A 5JOBA 1PZJD 4JK1C 4Z9CB 1QJOA 3KLSX 5M5WB 1VMCA 2A69D 4KY7A 1R4QB 2WINB 2EJFC 4HAEA 1Q1BA 1TR5A 2KVMA 1TS5A 5DEHA 1G291 3QJYA 3PUYA 1NR4A 2TMPA 3MWYW 1BBXC 3J7AF 4A3BB 3J7AV 1KABA 4G7ZC 2OXPA 1Q8IA 5IGBA 1BCPC 5NUCA 3MFGA 5JAVA 1S5CD 3HZXA 4IUUA 5I9PA 2WP8J 2E75C 1TKWB 2F0MA 2SNMA 2OF1A 2K03A 1X3QA 3V96A 4OHJA 3S16B 2B8FA 3LX0A 1OXUA 1D5MC 5EPLA 1F9SA 1EYCA 1VCIA 3S2HB 4IUQA 2E74C 2F0WA 1EU4A 3DWPA 4C56C 3M7NA 5EQ0A 2NYZD 3NE5B 4BBRB 2QF7A 3RLFA 5FLXL 1W6JA 1DD2A 3HG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSO A;  4LAA A;  5F2D A;  2PZW A;  3OWF A;  3DHQ A;  5EGT A;  5KIX A;  2F0D A;  1EZ8 A;  1F2Z A;  1NUC A;  4K6D A;  2F0T A;  3SR1 A;  3QOL A;  3BDL A;  2F0O A;  1EZ6 A;  3NQT A;  4K2L A;  5CV8 A;  5C5L A;  1STA A;  5IGD A;  3S9W A;  2F0G A;  1IHZ A;  1JOR A;  2F0L A;  1F2M A;  4EVO A;  4N9T A;  2F0V A;  3EVQ A;  3ERO A;  4KJN A;  4OL7 A;  5DAU A;  4H7B A;  2EY2 A;  5C5M A;  3SK4 A;  1STG A;  2F0E A;  2F0P A;  1KDB A;  4DGZ A;  1EY9 A;  2RKS A;  4ODG A;  2F0K A;  1A2U A;  1A2T A;  3D8G A;  3QOJ A;  4DU9 A;  5CC4 A;  5IOC A;  1NSN S;  1SND A;  4B9X A;  1EY5 A;  4TRD A;  3SK5 A;  4QF4 A;  4YIJ A;  3TP8 A;  1SYD A;  5C3W A;  2EXZ A;  1EY8 A;  4KTA A;  2KQ3 A;  2EY6 A;  1F2Y A;  2EY1 A;  5J22 A;  1SYG A;  2F0F A;  4K14 A;  1U9R A;  3D6C A;  3C1F A;  2PZU A;  4HMJ A;  4K8I A;  4WOR A;  4NKL A;  4MIU A;  2PZT A;  5CV9 A;  3D4D A;  4ZQ3 A;  3RUZ A;  3P1H A;  3H6M A;  5KGU A;  4J1M A;  4KJO A;  5KYL A;  1JOO A;  2EYF A;  1SYB A;  1AEX A;  4N9P A;  4ZUJ A;  2F3W A;  3T16 A;  3NHH A;  3TP6 A;  4EQN A;  5E3F A;  3MHB A;  2F0H A;  2EYJ A;  4PNY A;  5M9O A;  4PMC A;  1STH A;  1SNQ A;  4EQO A;  3TME A;  2WAC A;  4KY7 A;  5CV6 A;  3BDC A;  3MVV A;  4I65 A;  3P75 A;  3PMF A;  5J1Z A;  2PYK A;  3VA5 A;  2OEO A;  4K8J A;  5I6Y A;  4DF7 A;  1TR5 A;  5I9O A;  5IIF A;  4NMZ A;  4NP5 A;  4RKB A;  5JAV A;  1EY6 A;  5E1F A;  3SK6 A;  1A3U A;  5HGT A;  4KV6 A;  5DEH A;  5IGG A;  3NK9 A;  3U9O A;  3E5S A;  4K5V A;  2M00 A;  3TP5 A;  5IGE A;  3OMG A;  2F3V A;  5K5P A;  5IOD A;  4RKL A;  4KY6 A;  2F0S A;  2EYM A;  4NDX A;  4F8M A;  3NXW A;  3MXP A;  2NUC A;  2EYO A;  1ENA A;  3NUC A;  4KD4 A;  1ENC A;  2HQE A;  2F0N A;  1KAB A;  2RBM A;  2OXP A;  3NP8 A;  2O4X A;  4G57 A;  4HMI A;  5CR3 A;  5C3X A;  5IGB A;  2SOB A;  4B9W A;  2EY5 A;  5CV4 A;  4F7X A;  1EQV A;  3R3O A;  2RDF A;  4KY5 A;  2EYL A;  5NUC A;  4S3S A;  2PW7 A;  1SNP A;  1TT2 A;  3EJI A;  4IZ8 A;  3HZX A;  4ZUI A;  3SK8 A;  4DFA A;  5C4H A;  1STB A;  3MEH A;  5C4Z A;  5KYI A;  3DMU A;  3T13 A;  1STN A;  5CV5 A;  5I9P A;  4K5W A;  5HUR A;  1EYD A;  1EY7 A;  4IUN A;  5I6W A;  1EYA A;  2KHS A;  2PW5 A;  3OMC A;  4K2K A;  4EQP A;  5KEE A;  4ID6 A;  4ME5 A;  1KAA A;  4PMB A;  4IAL A;  2F0M A;  2F0I A;  2SNM A;  5CGK A;  2ENB A;  2OF1 A;  4WRD A;  1RKN A;  2F0U A;  5EKL A;  1A3V A;  4QB4 A;  3SHL A;  1A3T A;  1KDA A;  1SNC A;  2F0J A;  3C1E A;  4KD3 A;  5EKK A;  4J6H A;  1SYE A;  3QB3 A;  5JOB A;  1SNO A;  5IGF A;  3D4W A;  4K5X A;  3LX0 A;  5IGC A;  5KRU A;  1JOK A;  4R8N A;  2PQE A;  4QMG A;  1SNM A;  3SXH A;  1STY A;  4HTH A;  4KHV A;  5C6A A;  3ERQ A;  1SYC A;  1EYC A;  2EYH A;  2F0Q A;  2LKV A;  2SNS A;  5ISR A;  1TQO A;  1SYF A;  1JOQ A;  2EYP A;  3V2T A;  2F0W A;  3HEJ A;  3ITP A;  1KDC A;  3MZ5 A;  5CV7 A;  1EY4 A;  1EY0 A;  3TP7 A;  5J39 A;  2QDB A;  4E6I A;  1II3 A; 
#chains in the Genus database with same CATH topology
 5I4D A;  2JA6 B;  1D7Q A;  3SVM A;  1GD7 A;  1N34 Q;  5ELN A;  4PZ8 A;  4A75 A;  1H9S B;  4K2L A;  1CKO A;  3T51 B;  4GN4 B;  3L2P A;  1PH8 A;  1F2M A;  2XWB B;  1BNZ A;  4YCW A;  1S3O A;  1LT6 D;  1XWE A;  2KEN A;  5FO8 B;  3U58 A;  4A3E G;  4B08 A;  2A6E C;  3Q6S A;  4DNT B;  1P8L A;  3BVG A;  2KCC A;  4A3I B;  2F0K A;  1QCB D;  2K7V A;  1XPR A;  3UDF A;  4A3F B;  2P5Z X;  4C1N K;  2HD3 A;  4LNQ A;  1EY5 A;  5EPJ A;  1GHK A;  2C5C A;  1G91 A;  4JI1 L;  3TEH B;  1PH2 A;  2K01 A;  4XQN A;  2DNC A;  1U9R A;  1CI3 M;  4RFB A;  5A2Q E;  1E2V A;  3IL8 A;  4IN3 A;  2LY7 A;  1B8A A;  5GQO A;  4IPC A;  2IW3 A;  2SEB D;  1X9N A;  3HOZ H;  1EFI D;  1P16 A;  4OIJ A;  1DYQ A;  3GTK B;  3A5Z B;  4XYQ A;  4JOI C;  1X3E A;  4H0L C;  3PO3 G;  1V1P B;  2E2I B;  1EY6 A;  4C3H G;  3MXG A;  2B3G A;  1Q46 A;  1HTP A;  2EJM A;  2WKD A;  4BA2 I;  3HGB A;  2F3V A;  5COY A;  3S17 H;  4IPH A;  3L7Z C;  2NVT H;  2CQA A;  3M85 A;  3TRE A;  4RGN A;  4KK7 A;  1Q7Y C;  1N34 L;  1AH9 A;  2IX0 A;  2RBM A;  2NZ1 D;  4G57 A;  1E2Z A;  4HMI A;  5IP7 H;  3A55 A;  3MXN A;  1N8R C;  3BS1 A;  2HUG A;  4H13 C;  1I94 Q;  1SNP A;  3I4L A;  2CCZ A;  2BE5 C;  3MEH A;  2B2U A;  2A68 D;  5CYU A;  2JA8 B;  1BQQ T;  2A73 B;  1MI2 A;  3HOU B;  4NXN Q;  4GN3 B;  1CTM A;  3FKI G;  1A62 A;  3T53 B;  1MHW C;  3ERS X;  1D1K A;  1NCV A;  3I4N B;  1I3Q H;  2OTL A;  4AQY Q;  4QJF A;  1YNX A;  1LV9 A;  4KN4 C;  1OXV A;  3PUZ A;  1PFM A;  4ME3 A;  1WTO A;  3OW2 A;  3S2D B;  3D6W A;  3DHQ A;  2B2V A;  3KK7 A;  2E5L Q;  4DUY Q;  1PTO C;  4QIW B;  3NQT A;  2GVB A;  2QDL A;  4M8A A;  3H94 A;  3RLN A;  2F0V A;  4LUZ A;  1MIU A;  3E9I A;  1X65 A;  4YWM A;  2CQO A;  1KDB A;  4R8I A;  2E76 C;  2QKI C;  3B6Y A;  4C3I H;  4R4C A;  1WTP A;  3WOF A;  4DV6 Q;  1A6X A;  2B2U C;  1LM0 A;  5C3W A;  2I5M X;  2QGQ A;  4KKT A;  1I94 L;  3HOW G;  2V4D A;  2DUD A;  1C48 A;  2Z1C A;  5J22 A;  3H3V I;  3C1F A;  4MIU A;  1I6V C;  4LK1 C;  4R9W A;  4Y52 H;  1LO5 D;  1FL0 A;  1NMF A;  1CQF A;  1BBU A;  1B9M A;  5BN3 A;  1LT5 D;  4JI8 Q;  1PH6 A;  1L1O B;  3H91 A;  3TME A;  2WAC A;  1B7Y B;  5CV6 A;  4C2M B;  4AQY L;  4ABN A;  3CW2 C;  4K8J A;  1HZ9 A;  3H09 A;  3AFP A;  3GQB A;  3WWV A;  4A76 A;  4B3M Q;  1NNX A;  2RSO A;  2F4V Q;  5DLQ E;  1FGU A;  3QR8 A;  3NXW A;  2D0P A;  4HR7 B;  2A6E D;  4GLX A;  1JE4 A;  2HQL A;  2JK8 A;  2F0N A;  4BY1 G;  2E5L L;  4DUY L;  3NP8 A;  1PH7 A;  2MFI A;  3CPW A;  1QG7 A;  1KRS A;  2UU9 Q;  4DV1 Q;  2AQ1 B;  5C4X G;  1VQL A;  2B63 G;  1JOR A;  1K3R A;  4JI6 Q;  3CF5 A;  2R7Z H;  3K8A A;  1MBY A;  3NWS A;  3E3X A;  1EYA A;  3STB C;  2FMC A;  5KEE A;  4PMB A;  4DV6 L;  4IAL A;  4UP9 A;  4QB4 A;  4DAY A;  1BR9 A;  5IOC A;  1PA6 A;  1K28 A;  2RHQ B;  2J7Z A;  4HIO A;  1SNM A;  2KOL A;  4A3G G;  1STY A;  3RZO B;  4KHV A;  4U67 3;  1RD9 D;  4XXE A;  4POF A;  1D5X C;  1TQO A;  4DR2 Q;  3W1G A;  3ITP A;  4JI8 L;  3NWT A;  3MZ5 A;  1F2L A;  3ND8 A;  2PI2 A;  2A8V A;  2KA7 A;  3BDL A;  4F87 A;  1W6K A;  3CPF A;  4LAA A;  1Y8O B;  4YWK A;  3TZD A;  3HP3 A;  1HCZ A;  5JJL A;  4B3M L;  1EZ6 A;  1X3G A;  1B50 A;  3DUZ A;  2X6G A;  2F4V L;  2L0C A;  1I4R A;  4IUV A;  5A2Q L;  3NTK A;  1B70 B;  2F0P A;  4WJ3 M;  1EY9 A;  3FRP B;  4A3M B;  4BY7 G;  3QOJ A;  5CC4 A;  1PRT C;  1NSN S;  1J9O A;  1Q1E A;  4RG1 A;  1M4V A;  2UU9 L;  2E8G A;  2YTX A;  2Q2U A;  2PI2 E;  4DV1 L;  5ELD A;  4MTK A;  3R8B A;  1SYG A;  4O1N A;  1HJP A;  3KBX A;  4JI6 L;  1TVX A;  4NKL A;  5CV9 A;  2O2L D;  4KJO A;  2VZA A;  1BF4 A;  5JEA J;  4G4K A;  1CKN B;  3OYY A;  1LTL A;  3OOC A;  1WTH A;  5D3I B;  4I65 A;  3BYY B;  5I9O A;  1JQY D;  4FVM A;  2Z6K A;  1SAP A;  1PH9 A;  3BVM A;  3E5S A;  3HOY B;  4DR2 L;  1OTC A;  4BBR H;  1ASY A;  3PGZ A;  4B3S Q;  4C3J B;  2YYZ A;  3BVZ A;  3TDQ A;  4Y7N B;  4J8Q A;  3LWE A;  4C1N I;  4A3C G;  2G9H D;  1NY4 A;  3ZJY C;  4MHE A;  3I55 A;  1O7I A;  4GOP A;  1HTL D;  3H0G G;  4DFA A;  1IXR A;  1WTQ A;  5C4Z A;  2ICE C;  1EYD A;  1BCP B;  5CBA E;  3I2Z A;  2NN6 H;  3K5N A;  4UP7 A;  1KXL A;  1TII D;  4A3J B;  1GUT A;  3A56 A;  4LFC Q;  1GXD C;  3PIO A;  1UUP A;  3K5M A;  3TS2 A;  4CDF C;  1SBB B;  2A1A A;  3AMU A;  4R8N A;  2PQE A;  4JBM A;  2WAQ G;  1YEZ A;  3G7L A;  2JSO A;  4PMW A;  4AYB E;  2SNS A;  2LKV A;  3GTK H;  1W2B A;  2JA5 B;  4DR3 Q;  3KF6 A;  1S40 A;  5CV7 A;  1VQ4 A;  4E6I A;  1ASZ A;  2VNU D;  4X3S A;  1H9J A;  3PIP A;  5CV8 A;  4NW2 A;  2I07 B;  4GLV B;  1BXT A;  4HJA A;  1IHZ A;  5FKA C;  4APV A;  3GDE A;  2F0L A;  2VUM B;  4DXG A;  3CCV A;  1CT1 D;  2X6L A;  3T4A C;  4B3S L;  4DUZ Q;  4L5T A;  1IBL Q;  3L3O C;  2ASB A;  4V19 0;  1FNU A;  2EVB A;  2GN5 A;  4IO9 A;  3G6J B;  1A2U A;  1DOL A;  5C44 G;  1YNN C;  4RGT A;  1WJJ A;  3HOX H;  3SE0 A;  1SYD A;  5M3F B;  2H5X A;  1EY8 A;  4GZY C;  2EY6 A;  2MO1 A;  3GTL B;  2R92 B;  5IGG A;  1EQR A;  3M4Y A;  5IE8 A;  2JA7 B;  3H3V H;  4PZ6 A;  1CSP A;  4DR6 Q;  1VQ9 A;  2CVR A;  3DWQ A;  3M3Y H;  2EYF A;  5E7N A;  3TS0 A;  1SYB A;  3DWA A;  1LTG D;  3CRK C;  1IZ6 A;  1ICW A;  1TS2 A;  2Y0S G;  1ZKO A;  4LFC L;  3UDI A;  3I7F A;  2UUA Q;  1QVG A;  1CZG A;  1SNQ A;  3P75 A;  4DF7 A;  1JJC B;  4NP5 A;  4ZCK A;  4MTN A;  2R93 B;  2NTS A;  1BO0 A;  2E2H B;  1IYJ B;  3Q0A A;  1EIF A;  4DR3 L;  2KJX A;  3KLR A;  2YTV A;  1ZXT A;  1ILQ A;  4L8J A;  4LF5 Q;  4FYD A;  1EEI D;  1D2B A;  5IWA Q;  1K8O A;  4TVA B;  1XMQ Q;  2ZTD A;  1KNE A;  1WTX A;  1EIH A;  1W3S A;  2EY5 A;  5JEA H;  3BU2 A;  3QG1 A;  4DUZ L;  4A93 B;  1IBL L;  5I2X A;  4ZKC B;  5KNB A;  4IUN A;  1TS4 A;  1IKL A;  2DY8 A;  4YY3 Q;  1CHP D;  1A8V A;  1RL2 A;  4KHP Q;  2A5H A;  1JIC A;  2F4I A;  5T1I A;  4RH6 A;  1HRJ A;  1WCM G;  1MJC A;  4HIK A;  3HOZ G;  4H44 C;  4X66 Q;  1WYD A;  4DR6 L;  5IYB H;  5C4J H;  2SDF A;  3AU7 A;  4JI4 Q;  2AUK A;  1U5K A;  3N6R A;  3FPP A;  2UUA L;  2Q8T A;  1HZC A;  1A63 A;  2BCO A;  2KEE A;  4OEL B;  1UAP A;  1EQT A;  4I7A A;  2NTT A;  1YVC A;  1JE5 A;  4A3L H;  1U0L A;  4LF7 Q;  4ZRZ A;  1SRO A;  1OO9 B;  2R3Z A;  4IUT A;  5JVH 3;  4JG2 A;  1Y69 U;  3CD6 A;  1PTO B;  2IL8 A;  3OIP A;  2B8G A;  2E2J H;  1J8I A;  1KD1 C;  4EGV A;  1Y1V H;  1UE5 A;  4ULL A;  4IJH A;  1ZYR D;  4LF5 L;  5IWA L;  1S4Z A;  1V43 A;  2K5D A;  3T56 B;  3F2B A;  3M9B A;  1TWC H;  1XMQ L;  3S1Q B;  2A6H D;  4ZAI A;  4NXM Q;  3MXN B;  2Q2I A;  3PUW A;  4HSV A;  3TP8 A;  3V05 A;  4KTA A;  2K52 A;  3DEP A;  1RCV D;  2VS1 A;  4R4Q A;  5CBE E;  2WAQ E;  4K8I A;  3HKZ G;  4ZQ3 A;  4IFD I;  1VQ7 A;  5IYC H;  5L37 A;  1A15 A;  1TWG H;  1AEX A;  4N9P A;  5ELC A;  4EQN A;  1ESF A;  4YY3 L;  5FLX c;  5D14 A;  1L0X B;  4KHP L;  1HNX Q;  1K0S A;  3PSI A;  3CQZ H;  4X3T A;  3KUP A;  1JJ2 A;  4X66 L;  1A3U A;  3NEM A;  4KV6 A;  4H02 A;  4A3K H;  4QY7 A;  4JI4 L;  1B4O A;  2HIV A;  1D8L A;  3GTO B;  1BCP F;  4AIM A;  2HCI A;  4FF2 A;  1VF7 A;  3GD7 A;  2ID0 A;  5DM7 3;  3RN2 A;  2B2Y C;  4PZ7 A;  1YNN D;  5C3E B;  5CR3 A;  4ZKB B;  4LF7 L;  1QIL A;  1VQD A;  5CV4 A;  1G6P A;  3D4R A;  4C3I G;  5A35 A;  4S3S A;  2PW7 A;  3SK8 A;  2UXB Q;  3VR5 A;  2ICI A;  3GTG B;  4K5W A;  5H1S E;  2EDG A;  4FP5 D;  4A3D H;  2PW5 A;  2Y0S E;  1AW7 A;  4ZLT F;  3G4S A;  3HOV H;  1I4X A;  5J39 A;  2K5V A;  4NXM L;  1RKN A;  5AJ3 Q;  2LSS A;  3S14 B;  2YU9 B;  4A3E B;  2NWG A;  3U50 C;  1I6H B;  3RZD H;  1K8G A;  5KNC A;  2ATW A;  4JI5 Q;  2K5N A;  1SLJ A;  1EL0 A;  2Q8I B;  1EEF D;  1B1Z A;  1TXY A;  2B2T C;  3CP0 A;  4DK0 A;  2MHV A;  1HNX L;  3URY A;  5M5X B;  2AWN A;  4IFD J;  4HED A;  5IYD H;  5EGT A;  4CDE C;  1TWF B;  4LF8 Q;  3I4M H;  3J81 i;  4JI2 Q;  2DGY A;  1U4L A;  1HA6 A;  1SEB D;  4EVO A;  4AH6 A;  2EOT A;  4KJN A;  2B39 A;  3PO3 B;  1AN8 A;  2RKS A;  4OGQ C;  3K80 C;  3KDF B;  2GA4 B;  1WTV A;  2QEJ C;  5M5Y H;  2VB3 X;  1SFO B;  3A74 A;  1DOM A;  3CCR A;  3PF5 A;  3S1N B;  4RCO A;  3VYT A;  2R7Z G;  2EXZ A;  3G48 A;  1PRT B;  5D3D A;  1Q90 A;  4JW0 A;  1OXS C;  3D4D A;  3K7A H;  4M1U B;  4JBW A;  1Z7T A;  1PMR A;  3NEN A;  1LTI D;  3A0J A;  2FHT A;  4G7H C;  3NHH A;  1I5F A;  5AJ3 L;  4DAY B;  4P74 A;  1PH3 A;  1PVO A;  3HS0 C;  4JI5 L;  2ZTC A;  3NK9 A;  5LMN Q;  3U9O A;  3FKI B;  1EFW A;  1ONL A;  5FK9 C;  4RKL A;  2Q8R E;  1HR0 W;  3CME A;  1I50 B;  1F9Q A;  5GAE C;  2ZTE A;  3J81 E;  2HQE A;  1TWA B;  1AFP A;  4LF8 L;  3TSS A;  2JA9 A;  4OO1 H;  4JI2 L;  1CSQ A;  1U4M A;  1IL8 A;  2CW0 C;  3HKZ E;  2ZXP A;  5BN5 A;  3PO2 H;  3U4V A;  3EJI A;  4OWT B;  2PQA B;  4R4T A;  2WFW A;  3VR3 A;  2BA1 A;  3TZU A;  2QEX A;  2A74 C;  1JWM D;  1SE2 A;  2QIL A;  1A3T A;  5EKK A;  1VQB A;  1SYE A;  1TS3 A;  1DCZ A;  4DAM A;  4GNX A;  2K14 A;  1VMP A;  3GTJ H;  1PTO F;  2LS0 1;  1QOH A;  1UE6 A;  2FXQ A;  4GN5 A;  4YCU A;  3K59 A;  2EYP A;  3V2T A;  3HOW B;  3AYH B;  3RLO A;  3BYT B;  4O0A A;  2NN6 I;  3L9A X;  1HXY D;  2PZW A;  2Z4I A;  3I56 A;  3DM1 A;  3W5O A;  5M3M H;  4FXD A;  5IP9 G;  2BDN A;  1S5F D;  2BA0 A;  3QOL A;  3GTQ B;  2AMC B;  2Z4H A;  5IGD A;  3RMH A;  5DM6 3;  3SEB A;  4B3T Q;  1STG A;  4RAU C;  2OT2 A;  2I0Q A;  4BBS H;  1SND A;  4GLA C;  1YJN A;  1AZP A;  1VQM A;  1G2S A;  1LTA D;  5EKI A;  4UHV A;  3VA7 A;  2NN6 G;  2WKC A;  2NVY H;  4BY1 B;  4LFA Q;  1JWS D;  1IL2 A;  1QUQ B;  5KGU A;  1WI5 A;  2XN9 C;  1C9O A;  1GVP A;  5J3B A;  3SDZ A;  1BCP D;  3RD4 A;  4ZK9 B;  3Q24 A;  1QZG A;  3UDX A;  4IFD H;  1WOC A;  2NBF A;  1S5B D;  5ELF A;  3GTM B;  3NBH B;  5C4X B;  2B63 B;  1DXM A;  3MVV A;  5IY0 A;  2EQS A;  1XNQ Q;  1FD7 D;  4NMZ A;  1VQK A;  2K04 A;  1CUK A;  3K5L A;  3FP9 A;  3EN2 A;  5IGE A;  2XTI A;  3KJO A;  1EWI A;  3J81 c;  2AHO B;  3KF6 B;  3MXU A;  4F8M A;  4DV2 Q;  2RSN A;  4A3G B;  1ENA A;  1WTW A;  4KD4 A;  2VXW A;  1K73 C;  3OHX C;  2TSS A;  1CK1 A;  1DOK A;  4TKO B;  2XGT A;  4NXN L;  1TY0 A;  1CQV A;  2JJQ A;  2RQX A;  2MGS A;  2SOB A;  3NQI A;  4F7X A;  3G71 A;  4B3T L;  1QNK A;  5KYI A;  1TWH B;  3GTP B;  2N78 A;  1K83 H;  5CV5 A;  3HOX G;  2BH2 A;  3VR6 A;  2NVQ B;  4AYB G;  2AKW B;  2N8N A;  4P73 A;  2E2D C;  1NE3 A;  2B2V C;  4WRD A;  2K05 A;  2L55 A;  4MN3 A;  1Y1W H;  1HQM C;  1T9H A;  2RCN A;  2RDG A;  2M2L A;  1E24 A;  4LFA L;  4POG A;  4BY7 B;  2Z0S A;  3K81 C;  2J0T D;  1NAP A;  1C4Q A;  1PLF A;  1XNR Q;  1M90 C;  2O5I C;  5ISR A;  3CMA A;  1EY0 A;  4UPA A;  4IQZ A;  2AQ2 B;  2L9H A;  2G9D A;  2ZXO A;  1R4P B;  4GS3 A;  3JC6 6;  1XNQ L;  3FDT A;  1MD2 D;  1IW7 C;  1YNJ C;  5T1G A;  3GTO H;  3M4O H;  3PIO 3;  3KF8 B;  4OWX B;  1Q3L A;  3DEO A;  4N9T A;  3X3N A;  4OL7 A;  2EY2 A;  5M5W H;  4DV2 L;  4JYA Q;  4X65 Q;  2A19 A;  3UDG A;  4ODG A;  1A2T A;  5JEA G;  5FOB B;  1K9M C;  2NZH A;  1VQJ A;  1XTD A;  1YIT A;  2QCP X;  2KQ3 A;  1L0Y B;  1SJH D;  3GTG H;  1DZ1 A;  5LMN W;  4K14 A;  1VS0 A;  1G8Z D;  4IPD A;  3H6M A;  2N88 A;  3PIP 3;  3QO2 A;  3J7A 5;  2VY3 A;  1A0I A;  4HJ8 A;  4DR5 Q;  4A3B H;  2BE5 D;  4A3E H;  4DR7 Q;  3H0G B;  1C8C A;  3J81 L;  1ENF A;  5IYB G;  2PMZ E;  2OEO A;  4FXG C;  4RWS C;  5JPN C;  2J4X A;  3SK6 A;  1XNR L;  2JQO A;  2IWH A;  3W1B A;  1O7L A;  2M00 A;  5IOD A;  4P75 A;  4DV0 Q;  2WAQ B;  2FMM A;  1YZ6 A;  1WD0 A;  2WB1 G;  4PG3 A;  2I5L X;  1R9T B;  3S16 H;  1F9P A;  4TSS A;  4WFN 3;  4FF4 A;  4DPG A;  1O78 A;  1Y1V G;  2DNE A;  1IKM A;  2KCT A;  4KY5 A;  5FLM H;  4ZUI A;  1PTO D;  4JYA L;  4X65 L;  3S2H H;  1B3Q A;  1F77 A;  5C0X J;  3NEL A;  1QB5 D;  3ER0 A;  4ID6 A;  5EJW A;  2F03 A;  1HZB A;  4DV3 Q;  1VQ5 A;  1M8A A;  1A3V A;  2JA6 H;  3I72 A;  1T5E A;  2F0J A;  2N3S A;  2Z6B A;  5IYC G;  1XPO A;  3OTO Q;  3F1Z A;  1JOK A;  2Q2T A;  1KQS A;  5C44 B;  3ERQ A;  2EYH A;  3GP7 A;  4DR5 L;  1SMY C;  3BZC A;  3AEV A;  1B44 D;  1SYF A;  3CRL C;  1CFM A;  3KFU A;  3A8I E;  1I4P A;  3TP7 A;  4DR7 L;  1KC8 C;  2B2W A;  2QDB A;  4A3I H;  5HGQ A;  3R3O A;  4A3F H;  4A3K G;  3R2I A;  4N8F A;  4TQU S;  2EZV A;  1JJG A;  3FKI H;  4RMF A;  2F0D A;  3PQI A;  4K6D A;  4LF6 Q;  3NSW A;  2Y0S B;  1JR0 D;  5EAY A;  2VB2 X;  5K36 H;  1V1O A;  3JAM i;  2OQ0 A;  2I46 A;  5C5M A;  3SK4 A;  4DV0 L;  1CA6 A;  3GO5 A;  4O42 A;  4LW1 A;  3RNU A;  5IT9 E;  4DU9 A;  1H95 A;  4OEM B;  2R61 A;  2I5H A;  2L12 A;  2XRS D;  3SK5 A;  2OWO A;  1D6E C;  2Z6K C;  1KTK A;  4PQX A;  2E2I H;  3MC0 B;  4RA8 A;  4A3D G;  3DLL A;  2H4O A;  3HOV G;  2K5Q A;  4ZYS A;  4HCE A;  1S5E D;  4FO2 A;  4DV3 L;  3UE1 A;  1STH A;  2V1C C;  1EOV A;  3PMF A;  3BZK A;  4JCV E;  3OTO L;  4ALP A;  3STB D;  3H3V C;  1IW7 D;  1YNJ D;  5IIF A;  2OQK A;  4GOP C;  4RKB A;  2RVL A;  5KND A;  5JJZ A;  2B2W C;  2KHI A;  5HGT A;  4JBK A;  3KJP A;  1WCM B;  2F0S A;  2JA8 H;  2DJF C;  4O2D A;  3OW7 A;  3HOU H;  3HOZ B;  3I4M G;  4IUR A;  3NUC A;  3M4Q A;  1KHI A;  4CJ2 C;  4R1J A;  1U4R A;  3DM3 A;  4LF6 L;  3JAM E;  3I4N H;  3CHB D;  1H9K A;  1F9R A;  1VQF A;  2EYL A;  2UUB Q;  4HID A;  5C4H A;  4KMU C;  1VQ8 A;  2A69 C;  3NTH A;  1GUW A;  3K0Y A;  1AZQ A;  3OMC A;  3KLS A;  4HN7 A;  3S2D H;  2PNH A;  1BKB A;  1JB3 A;  3I3C A;  1B3A A;  2XWJ B;  1SNO A;  1VQA A;  5BR8 Q;  5IGC A;  5KRU A;  1PRT D;  4OO1 I;  2MP1 A;  4QMG A;  3D0F A;  2EE1 A;  1RTN A;  1Z6H A;  4WJW A;  3Q22 A;  1EY4 A;  2Z8L A;  3HKZ B;  3QIA A;  4B3R Q;  2WB1 E;  1HR0 Q;  3CCJ A;  1VQO A;  4R4O A;  1FNV A;  1F2Z A;  1I3Q B;  1BBW A;  4HJ5 A;  5C0X H;  1WTR A;  3ERO A;  2RCF A;  5IT9 c;  4RHS A;  3AB9 A;  4QQB X;  2UXC Q;  1EQQ A;  1E22 A;  3PO2 G;  3J7Y W;  1YIJ A;  4C2M H;  3L0O A;  4TRD A;  3ONA B;  1D5Z C;  4EQ5 A;  1VQP A;  2K5H A;  2UUB L;  2JEB I;  1YHA A;  1E0B A;  1J5E Q;  2NVQ H;  2ZJR A;  1STE A;  1Q86 C;  3RUZ A;  1HFN A;  1JT8 A;  2KBN A;  3J80 E;  1GKH A;  4RCN A;  4QCL A;  4LFB Q;  1ZEQ X;  1BOS A;  3MHB A;  4C3I B;  2LFN A;  2F0H A;  4FNF A;  4JBJ A;  4PNY A;  4PMC A;  1GUN A;  3OIQ A;  3I73 A;  5IP7 G;  1Q82 C;  5BR8 L;  2QA4 A;  4DV4 Q;  3CU7 A;  3CCQ A;  1CA5 A;  5E1F A;  1E2W A;  1PZI D;  1CKN A;  3OMG A;  4KHZ A;  1H9R A;  5M3M G;  3JAM c;  3E0J A;  3K6O A;  1CKM A;  3MXP A;  3RR5 A;  4B3R L;  3IFT A;  1HR0 L;  1EOT A;  1ROD A;  1E7Z A;  3C3L A;  1ESR A;  4K6L A;  1KRT A;  2IT1 A;  3ULP A;  4F88 A;  4NPS A;  4BBS G;  1XXG A;  3RZO H;  4I7Z C;  3I91 A;  4KKS A;  3A5U A;  2KCM A;  2K50 A;  3LNN A;  3M7G A;  1STB A;  1STN A;  4CJ0 B;  2UXC L;  4UP8 A;  5I6W A;  2KHS A;  1PFB A;  1BVS A;  1VQE A;  2KUM A;  3F8T A;  1LAB A;  2K33 A;  3SHL A;  4EQO A;  4X62 Q;  2CKZ B;  4FF1 A;  1O7Y A;  4IFD G;  1J5E L;  4KKU A;  4PV1 C;  1HUN A;  1CM9 A;  1JOQ A;  3H0G H;  2R7Z B;  4LFB L;  3HEJ A;  4JVZ A;  2VQF Q;  4A3M H;  5ELO A;  5IT9 L;  1LTB D;  1X54 A;  4DV4 L;  1Y14 B;  4DNR B;  2AQ3 B;  3OWF A;  2Z9H A;  2BOS A;  2K5W A;  3BG3 A;  1NUC A;  4OXP A;  2L1B A;  1NMG A;  2A68 C;  1STA A;  4UDU C;  2F0G A;  3I4O A;  3MFY A;  4OON A;  5DAU A;  3IRB A;  2XSC A;  4B9X A;  1GM5 A;  1QZH A;  3S15 B;  2CHB D;  1SR3 A;  3ICE A;  5GAG C;  5GAD C;  3A8J E;  1S72 A;  1RHP A;  1HPC A;  4WOR A;  3HOY H;  1G51 A;  3P1H A;  2XIW A;  3I70 A;  2JE6 I;  1QVC A;  1NJI C;  2D62 A;  1Y1W G;  4C3J H;  1KIX A;  1RJT A;  2IX3 A;  1N9W A;  4P2C B;  2EYJ A;  4Y7N H;  2JYO A;  4X62 L;  1YHB A;  1L0W A;  2DY7 A;  4C3H B;  5C44 H;  3VA5 A;  3JAM L;  5I6Y A;  3KBG A;  2G5D A;  1VQI A;  1PH5 A;  2Q2H A;  4DR1 Q;  4KI0 A;  3TP5 A;  2VQF L;  5K5P A;  1EUJ A;  2UXB L;  1OXT A;  1IYV A;  4FF3 A;  2K32 A;  3UI2 A;  2ZT9 C;  2NUC A;  2EIF A;  2N55 A;  3S24 A;  4A3J H;  2XVS A;  1X3F A;  2IJ0 A;  2EPB A;  4JOI A;  4J15 A;  3W3A A;  1RIP A;  3R93 A;  4LJZ C;  3TN2 A;  5JJI A;  2N49 A;  2JA5 H;  2PMZ B;  3CAM A;  2XRQ D;  2DJG C;  3AQQ A;  4DR4 Q;  2MNA A;  3FPU B;  2F0I A;  2K1B A;  3H15 A;  2F0U A;  3O13 A;  3P20 A;  1JB7 A;  1KDA A;  1SNC A;  3C1E A;  5IGF A;  1VDZ A;  1MGS A;  5G3L D;  4JI0 Q;  1B53 A;  4A3B G;  1I4H A;  2CFM A;  1SE4 A;  2VUM H;  1UE1 A;  2WV6 D;  4IOC A;  1G6Z A;  4RGM A;  2ALY B;  2PO4 A;  4IJL A;  2AWO A;  3A7A B;  2EXD A;  2ZJP A;  1II3 A;  3M4P A;  4RGO S;  4XIG S;  5M3F H;  1EZ8 A;  4XT1 B;  1WCM H;  3GTL H;  2R92 H;  4DR1 L;  1Q81 C;  2MO0 A;  2JA7 H;  1U4P A;  1I4G A;  1SSO A;  4H7B A;  1XX8 A;  2DN8 A;  4HJ7 A;  4LF4 Q;  3J80 L;  1GHJ A;  4DGZ A;  2F1M A;  1IYU A;  3PF4 A;  5FO9 B;  3D8G A;  3LWU A;  5FLM G;  4X6A H;  2CWA A;  3F2C A;  1X6O A;  3AFQ A;  1LTS D;  1ML0 D;  3T1H Q;  1JC7 A;  2F0F A;  4YIJ A;  2RHS B;  4HMJ A;  4BBR G;  4DV7 Q;  2R93 H;  4L63 B;  2PZT A;  4MZ9 A;  2E2H H;  3U4Z A;  1N36 Q;  2UUC Q;  5LMN L;  4DR4 L;  2JA6 G;  1JOO A;  4XQQ A;  2L4N A;  1J6Q A;  3UE0 A;  2VL6 A;  2F3W A;  2HIX A;  3TP6 A;  2ZM6 Q;  1LUZ A;  1AE3 A;  4X3K A;  1EU3 A;  3IKJ A;  1X55 A;  2VQE Q;  2HDL A;  3BZD B;  3J7Z C;  3HOX B;  3DXJ C;  3OWE B;  3ZYY X;  4JI0 L;  2NVX B;  1LTT D;  5EPK A;  1LT4 D;  2PCF B;  1GUO A;  1QE6 A;  4DK3 C;  2KEC A;  4AYB B;  3QWN A;  3CCM A;  3EBE A;  4IPG A;  4A3I G;  2IPK D;  4XDX A;  4A3F G;  1PYW D;  4A93 H;  3F2D A;  4KY6 A;  4GOP B;  3M3Y B;  3S1R B;  4NDX A;  3PUX A;  3K58 A;  5K36 G;  4HIM A;  4DAP A;  4JPB W;  5C3X A;  4CBV A;  2IX1 A;  1AP0 A;  3FHW A;  1VQ6 A;  4DKA C;  2D2C C;  4GNX C;  1EQV A;  2C35 B;  3R2T A;  4IZ8 A;  3K57 A;  5FJ8 H;  1Y8P B;  4QUC A;  4LF4 L;  3DMU A;  3Q8D A;  2MUY A;  1PYB A;  1KAA A;  4L5Q A;  1Q8K A;  2JXM B;  4LMQ D;  5EBD A;  1SJE D;  1SDF A;  2F3I A;  1HUM A;  3QB3 A;  3T1H L;  3D4W A;  4K5X A;  4DV7 L;  4QL5 A;  1FYC A;  1N36 L;  5C6A A;  2UUC L;  1T5X D;  2ZJQ A;  1PTO H;  1YJ9 A;  4JI7 Q;  1LT3 D;  2ZM6 L;  3VYU A;  1PDQ A;  2VQE L;  3W2D A;  5ELE A;  1DON A;  2YTY A;  4CHT B;  3S1Q H;  2AUJ D;  3IFD A;  5F2D A;  1ILP A;  1B2T A;  5KIX A;  1RTO A;  1GOZ A;  2JA8 G;  2F0O A;  4DK1 A;  1RDP D;  1TU2 B;  3HOU G;  1PH1 A;  3ND9 A;  4BA1 I;  5C4J B;  1K8M A;  1FJG Q;  4FXK C;  3I4N G;  3NPP A;  2QW7 A;  2RDH A;  2RA4 A;  1X32 A;  2IHF A;  1V8Q A;  2BH8 A;  2EJG C;  4L6T B;  1GJX A;  3CXC A;  3VR2 A;  3BJU A;  4YWL A;  2PZU A;  1L2F A;  2WB1 B;  5C0X I;  2FFK B;  3I90 A;  2IY5 B;  4BS9 A;  3S1M B;  2UXD Q;  4J1M A;  1YI2 A;  1PRT F;  4GKK Q;  2E2J B;  1Y1V B;  1E1T A;  3KDF A;  2CW0 D;  3KLW A;  1C0A A;  1XYI A;  5E3F A;  4BXX H;  1HNZ Q;  5C3E H;  1TWC B;  3BDC A;  5J1Z A;  4HCS A;  5E4X A;  1HFG A;  4P71 A;  4XQJ A;  1H9S A;  3K7U C;  5LMU Q;  4JI7 L;  1XPU A;  2MPM A;  4K5V A;  4L5R C;  1Z9F A;  1TWG B;  4ILW A;  4A4I A;  3X3M A;  1ENC A;  5C0X G;  2M9V A;  1Z47 A;  4LF9 Q;  2CH4 A;  3CQZ B;  1EWH A;  3S14 H;  2YU9 H;  1I6H H;  2O5J C;  1CHQ D;  4B9W A;  1MSG A;  4A3K B;  4KN7 C;  1FJG L;  4MNO A;  1KNA A;  3K5O A;  3S15 H;  4ME5 A;  1KL9 A;  4V0B A;  5M5X H;  4A3L G;  1KLU D;  1SMX A;  1YBY A;  3OPO A;  1TWF H;  2D0O A;  4IOA A;  2PQA A;  1V1P A;  1VQG A;  1OXX K;  1D1I A;  2K4K A;  2UXD L;  4GKK L;  1GUS A;  1CZW A;  1IBM Q;  3PO3 H;  5CMD A;  3FVQ A;  1KDC A;  4C3H H;  1HNZ L;  4A3D B;  3HOV B;  2BDO A;  3EQL C;  5E4W C;  1SFO H;  1XJV A;  3S1N H;  3U9S A;  4DXF A;  3CCS A;  1AE2 A;  1LYL A;  3SR1 A;  5LMU L;  1N32 Q;  1ICF B;  3RZD B;  3MA2 B;  1Y8N B;  3T1Y Q;  1FR3 A;  1SRU A;  4LUV A;  2ZXR A;  4Q0F A;  2JP1 A;  1VQC A;  3TBI B;  4RHR A;  2JN4 A;  1O80 A;  4YHH Q;  4FDB A;  2C9O A;  4LF9 L;  5TSS A;  3RN5 A;  4QF4 A;  3MTS A;  1H9M A;  1F2Y A;  3I4M B;  5IP9 H;  3D6C A;  1Q12 A;  2L11 A;  1UNS A;  2FJ2 A;  5DNF A;  4DN4 M;  4DV5 Q;  1I50 H;  1V1Q A;  3CCE A;  4NB3 A;  2LMC B;  1MJE A;  3PUV A;  1SXT A;  5M5Y B;  1TWA H;  2PYK A;  3BDO A;  4BWG B;  4HSP A;  1HA5 A;  1QUQ A;  2FIN B;  4CDD C;  4UY8 C;  1ZYR C;  1BUV T;  4A3M G;  1IBM L;  3K7A B;  2LXK A;  4P72 A;  2EYM A;  5I2Y A;  2A6H C;  3NBH A;  2OTJ A;  3HRZ C;  4LWC A;  1FNW A;  1VF5 C;  4IUP A;  2PPB C;  1G2T A;  1EIG A;  1ET6 A;  2NZO A;  2L15 A;  2XNA C;  5AFW A;  1YJW A;  4DAV A;  1N32 L;  2IHE A;  3T1Y L;  3A8K E;  2HDM A;  2JEA I;  2R6G A;  3C46 A;  4OIK A;  5M9O A;  5FO7 B;  4YHH L;  3HOW H;  4QIW E;  1N33 Q;  3HFZ B;  4K2K A;  1LLR D;  3SGI A;  4EQP A;  5CGK A;  5IYD G;  5EBC A;  5EKL A;  3HOY G;  1I4Q A;  1L1O A;  2HHH Q;  4KD3 A;  4J6H A;  3GTQ H;  3MAQ A;  3K0X A;  4C3J G;  3C2P A;  3SXH A;  1QNU A;  4HTH A;  3PO2 B;  2L5T A;  1HH2 P;  1SE8 A;  4LUO A;  4DV5 L;  3CC7 A;  4QGU A;  1SN8 A;  2NVX H;  5COR A;  2PNR C;  2YV5 A;  1PFN A;  3S17 B;  5JVG 3;  3KYH C;  2D9U A;  3A54 A;  2NVT B;  4CKB A;  2F0T A;  3EA6 A;  4R4I A;  1LTR D;  4CKE A;  3S1R H;  4XT3 B;  3J80 i;  4BY1 H;  4A3J G;  3GTJ B;  1YHQ A;  4GKJ Q;  5HY6 A;  2F0E A;  1HHV A;  3E6Z X;  5FLX E;  3CCU A;  3GTM H;  5C4X H;  1PZK D;  1DJR D;  2B63 H;  1NR2 A;  1UEA B;  5GRO A;  5GAH C;  1M1K C;  3VR4 A;  1VQN A;  3GV3 A;  2KCN A;  2K75 A;  3F2U A;  5M3M B;  2JA5 G;  3D31 A;  3A7L A;  2WII B;  3KF8 A;  1JMC A;  1X3P A;  3CCL A;  4OX9 Q;  1NTG A;  4HJ9 A;  1L1O C;  3KOJ A;  5G3L F;  5KYL A;  1N33 L;  2R7F A;  4BBS B;  4ZUJ A;  3T16 A;  3N52 A;  4A3G H;  3PCO B;  2D5D A;  1O7Z A;  1XMO Q;  2HHH L;  1B9N A;  4CKC A;  2VUM G;  4OO1 G;  5JPM C;  4OWW B;  4XYO A;  3D3R A;  2NVY B;  1WD1 A;  3NTI A;  4KLK A;  4X3U A;  3CC2 A;  2R7D A;  1KAW A;  1TWH H;  3VYS A;  3GTP H;  1PXU A;  5M3F G;  1QWY A;  3NBI A;  3ULJ A;  2EYO A;  1SMY D;  1TY2 A;  2R92 G;  1HNW Q;  1PYS B;  1K8A C;  2JA7 G;  2O4X A;  4CGY B;  3FMC A;  1S5D D;  2CWP A;  3WDN A;  1EWC A;  4BY7 H;  2F52 A;  1V9P A;  2RDF A;  1TT2 A;  4GKJ L;  3EIV A;  3T13 A;  1NBW A;  4GNX B;  3PV0 A;  5HUR A;  1XTC D;  1QVF A;  1EY7 A;  1KLG D;  5BN4 A;  5JJK A;  1RF2 D;  4K0K Q;  3I8Z A;  2ENB A;  2ES2 A;  2R93 G;  1GUG A;  1PHJ A;  2LXJ A;  2H1E A;  2B2Y A;  1UEB A;  3ULL A;  4L5S A;  1BDO A;  1MSH A;  2NB0 A;  4Q5V A;  1WVL A;  1PV4 A;  4OX9 L;  3S1M H;  3IAY A;  4DK6 C;  3VDY A;  1E1O A;  1JWU D;  5D65 A;  3CKI B;  5LL6 X;  1K3B C;  1SYC A;  4G7O C;  2F0Q A;  2KHJ A;  3EFX D;  4JV5 Q;  1K83 B;  3P7J A;  1HQR D;  4XTC S;  4N8X 1;  2X69 A;  1EYG A;  1XMO L;  4X64 Q;  5LL6 S;  4UAI A;  3OSO A;  4CJ1 B;  4A93 G;  3FEW X;  1Y1W B;  2RF4 A;  5C5L A;  3S9W A;  4JC0 A;  1VQH A;  1JCK B;  3EVQ A;  5LHY 1;  1ET9 A;  4A3C H;  5ELB A;  1LAC A;  2HCC A;  1HNW L;  3VYR A;  1DM0 B;  4QUF A;  1X56 A;  2K6A A;  3GV6 A;  2B2T A;  4DNI A;  3E9H A;  4DA2 A;  3TQY A;  1FGB D;  5FJ8 G;  2KED A;  2MJ8 A;  1UE7 A;  4WJ4 A;  2K28 A;  3WOE A;  3Q23 A;  2EY1 A;  3M4O B;  4U68 A;  1SE3 A;  5JOB A;  1PZJ D;  4JK1 C;  4Z9C B;  1QJO A;  4JI3 Q;  3KLS X;  5M5W B;  1VMC A;  1IBK Q;  4EX5 A;  4K0K L;  1EIY B;  2HT1 A;  2A69 D;  4KY7 A;  1R9T H;  3CC4 A;  1WFQ A;  1R4Q B;  2WIN B;  4CDC C;  2EJF C;  4HAE A;  1Q1B A;  1TR5 A;  4YCV A;  2KVM A;  1FVI A;  1TS5 A;  3G6E A;  5DEH A;  1G29 1;  2VW9 A;  3QJY A;  3PUY A;  3J81 j;  4JV5 L;  1NR4 A;  3J80 c;  2TMP A;  3MWY W;  4X64 L;  1BBX C;  3J7A F;  4A3B B;  3J7A V;  2GVA A;  1KAB A;  4G7Z C;  2OXP A;  1Q8I A;  3LGJ A;  5IGB A;  1BCP C;  4JI1 Q;  1MKH A;  5NUC A;  3MEF A;  3MFG A;  5JAV A;  1S5C D;  3HZX A;  2MQH A;  4IUU A;  5I9P A;  1UWV A;  2WP8 J;  2E75 C;  1TKW B;  2F0M A;  2SNM A;  2OF1 A;  2K03 A;  1X3Q A;  3TRZ A;  3V96 A;  1HZA A;  1DGS A;  1E3P A;  4OHJ A;  3S16 B;  2B8F A;  1GO3 E;  3LX0 A;  1OXU A;  4BXX G;  3E0E A;  1D5M C;  4JI3 L;  5EPL A;  1F9S A;  1EYC A;  1PH4 A;  1VCI A;  3S2H B;  5C3E G;  4IUQ A;  1IBK L;  2CH4 W;  2E74 C;  2F0W A;  2OCE A;  1EU4 A;  1PFS A;  3DWP A;  4C56 C;  3M7N A;  5EQ0 A;  2NYZ D;  3NE5 B;  4BBR B;  2QF7 A;  1C7Y A;  3RLF A;  2B29 A;  5FLX L;  3HKS A;  1K0R A;  1W6J A;  1DD2 A;  3HG9 A; 
#chains in the Genus database with same CATH homology
 5I4D A;  2JA6 B;  3SVM A;  1H9S B;  4K2L A;  3T51 B;  1F2M A;  2XWB B;  1BNZ A;  1LT6 D;  1XWE A;  5FO8 B;  4B08 A;  2A6E C;  3Q6S A;  4DNT B;  3BVG A;  2KCC A;  4A3I B;  2F0K A;  1QCB D;  2K7V A;  4A3F B;  4C1N K;  1GHK A;  1EY5 A;  5EPJ A;  2C5C A;  1G91 A;  2K01 A;  4XQN A;  2DNC A;  1U9R A;  1CI3 M;  4RFB A;  5A2Q E;  1E2V A;  3IL8 A;  4IN3 A;  2LY7 A;  2IW3 A;  2SEB D;  1EFI D;  4OIJ A;  1DYQ A;  3GTK B;  4XYQ A;  4H0L C;  1V1P B;  2E2I B;  1EY6 A;  4C3H G;  3MXG A;  1HTP A;  2EJM A;  2WKD A;  4BA2 I;  3HGB A;  2F3V A;  5COY A;  3L7Z C;  2CQA A;  3M85 A;  4RGN A;  4KK7 A;  2IX0 A;  2RBM A;  2NZ1 D;  4G57 A;  1E2Z A;  4HMI A;  3A55 A;  3MXN A;  3BS1 A;  2HUG A;  4H13 C;  1SNP A;  3I4L A;  2BE5 C;  3MEH A;  2B2U A;  2A68 D;  5CYU A;  2JA8 B;  1BQQ T;  2A73 B;  1MI2 A;  3HOU B;  1CTM A;  3T53 B;  1D1K A;  1NCV A;  3I4N B;  1LV9 A;  4KN4 C;  1OXV A;  3PUZ A;  1PFM A;  1WTO A;  3S2D B;  3D6W A;  3DHQ A;  2B2V A;  3KK7 A;  1PTO C;  4QIW B;  3NQT A;  4M8A A;  3H94 A;  2F0V A;  1KDB A;  4R8I A;  2E76 C;  2QKI C;  1WTP A;  3WOF A;  1A6X A;  2B2U C;  5C3W A;  4KKT A;  2V4D A;  1C48 A;  2Z1C A;  5J22 A;  3C1F A;  4MIU A;  1I6V C;  4LK1 C;  4R9W A;  1LO5 D;  1CQF A;  1B9M A;  5BN3 A;  1LT5 D;  3H91 A;  3TME A;  2WAC A;  5CV6 A;  4C2M B;  4ABN A;  4K8J A;  3H09 A;  3GQB A;  2RSO A;  3NXW A;  4HR7 B;  2A6E D;  1JE4 A;  2F0N A;  3NP8 A;  1QG7 A;  2AQ1 B;  1JOR A;  1MBY A;  3NWS A;  1EYA A;  2FMC A;  5KEE A;  4PMB A;  4IAL A;  4QB4 A;  4DAY A;  1BR9 A;  5IOC A;  2J7Z A;  3RZO B;  1SNM A;  2KOL A;  1STY A;  4KHV A;  4U67 3;  1RD9 D;  4XXE A;  1D5X C;  1TQO A;  3ITP A;  3NWT A;  3MZ5 A;  1F2L A;  3ND8 A;  2KA7 A;  3BDL A;  4F87 A;  1W6K A;  4LAA A;  1Y8O B;  3TZD A;  3HP3 A;  1HCZ A;  1EZ6 A;  1B50 A;  3DUZ A;  2X6G A;  2L0C A;  1I4R A;  4IUV A;  5A2Q L;  3NTK A;  2F0P A;  1EY9 A;  3FRP B;  4A3M B;  3QOJ A;  5CC4 A;  1PRT C;  1NSN S;  1J9O A;  1Q1E A;  1M4V A;  5ELD A;  3R8B A;  1SYG A;  4O1N A;  3KBX A;  1TVX A;  4NKL A;  5CV9 A;  2O2L D;  4KJO A;  1BF4 A;  5JEA J;  4G4K A;  3OOC A;  5D3I B;  4I65 A;  3BYY B;  5I9O A;  1JQY D;  4FVM A;  1SAP A;  3BVM A;  3E5S A;  3HOY B;  4C3J B;  2YYZ A;  3BVZ A;  3TDQ A;  4Y7N B;  4J8Q A;  3LWE A;  4C1N I;  2G9H D;  4MHE A;  1HTL D;  4DFA A;  1WTQ A;  5C4Z A;  2ICE C;  1EYD A;  1BCP B;  5CBA E;  2NN6 H;  3K5N A;  1TII D;  4A3J B;  1GUT A;  3A56 A;  1GXD C;  1UUP A;  3K5M A;  1SBB B;  3AMU A;  4R8N A;  2PQE A;  3G7L A;  2JSO A;  4PMW A;  2SNS A;  2LKV A;  2JA5 B;  5CV7 A;  4E6I A;  2VNU D;  4X3S A;  1H9J A;  5CV8 A;  4NW2 A;  2I07 B;  1BXT A;  1IHZ A;  5FKA C;  2F0L A;  2VUM B;  4DXG A;  1CT1 D;  2X6L A;  3T4A C;  3L3O C;  4V19 0;  1FNU A;  2EVB A;  3G6J B;  1A2U A;  1DOL A;  1YNN C;  4RGT A;  3SE0 A;  1SYD A;  5M3F B;  1EY8 A;  4GZY C;  2EY6 A;  3GTL B;  2R92 B;  5IGG A;  3M4Y A;  2JA7 B;  2CVR A;  3DWQ A;  2EYF A;  1SYB A;  3DWA A;  1LTG D;  3CRK C;  1ICW A;  1TS2 A;  1ZKO A;  1CZG A;  1SNQ A;  3P75 A;  4DF7 A;  4NP5 A;  2R93 B;  2NTS A;  1BO0 A;  2E2H B;  3Q0A A;  2KJX A;  3KLR A;  1ZXT A;  1ILQ A;  4L8J A;  4FYD A;  1EEI D;  1D2B A;  1K8O A;  1KNE A;  1WTX A;  1EIH A;  2EY5 A;  5JEA H;  3QG1 A;  4A93 B;  5I2X A;  4ZKC B;  5KNB A;  4IUN A;  1TS4 A;  1IKL A;  2DY8 A;  1CHP D;  2A5H A;  1JIC A;  2F4I A;  5T1I A;  4RH6 A;  1HRJ A;  4H44 C;  2SDF A;  3AU7 A;  2AUK A;  3N6R A;  3FPP A;  2Q8T A;  2BCO A;  2KEE A;  1UAP A;  1EQT A;  2NTT A;  4ZRZ A;  1OO9 B;  2R3Z A;  4IUT A;  5JVH 3;  1Y69 U;  1PTO B;  2IL8 A;  3OIP A;  2B8G A;  1J8I A;  4EGV A;  4ULL A;  1ZYR D;  1S4Z A;  1V43 A;  2K5D A;  3T56 B;  3S1Q B;  2A6H D;  4ZAI A;  3PUW A;  4HSV A;  3TP8 A;  3V05 A;  4KTA A;  3DEP A;  1RCV D;  5CBE E;  4K8I A;  4ZQ3 A;  4IFD I;  1A15 A;  5ELC A;  1AEX A;  4N9P A;  4EQN A;  1ESF A;  5D14 A;  1L0X B;  4X3T A;  3KUP A;  1A3U A;  4KV6 A;  1B4O A;  3GTO B;  1BCP F;  2HCI A;  4FF2 A;  1VF7 A;  3GD7 A;  2ID0 A;  5DM7 3;  2B2Y C;  1YNN D;  5C3E B;  5CR3 A;  4ZKB B;  1QIL A;  5CV4 A;  3D4R A;  4C3I G;  5A35 A;  4S3S A;  2PW7 A;  3SK8 A;  3VR5 A;  2ICI A;  3GTG B;  4K5W A;  2EDG A;  4FP5 D;  2PW5 A;  1AW7 A;  4ZLT F;  1I4X A;  5J39 A;  1RKN A;  3S14 B;  2YU9 B;  4A3E B;  2NWG A;  1I6H B;  5KNC A;  1EL0 A;  2Q8I B;  1EEF D;  1B1Z A;  2B2T C;  4DK0 A;  2MHV A;  3URY A;  5M5X B;  2AWN A;  4IFD J;  4HED A;  5EGT A;  1TWF B;  1HA6 A;  1U4L A;  1SEB D;  4EVO A;  2EOT A;  4KJN A;  2B39 A;  3PO3 B;  1AN8 A;  2RKS A;  4OGQ C;  2GA4 B;  1WTV A;  2QEJ C;  2VB3 X;  1SFO B;  1DOM A;  3S1N B;  4RCO A;  3VYT A;  2EXZ A;  1PRT B;  5D3D A;  1Q90 A;  4M1U B;  1OXS C;  3D4D A;  4JBW A;  1Z7T A;  1PMR A;  1LTI D;  2FHT A;  4G7H C;  3NHH A;  3HS0 C;  3NK9 A;  3U9O A;  3FKI B;  1ONL A;  5FK9 C;  4RKL A;  2Q8R E;  1I50 B;  1F9Q A;  3J81 E;  2HQE A;  1TWA B;  1AFP A;  3TSS A;  4OO1 H;  1U4M A;  1IL8 A;  2CW0 C;  2ZXP A;  5BN5 A;  3EJI A;  3VR3 A;  2BA1 A;  3TZU A;  2A74 C;  1JWM D;  1SE2 A;  2QIL A;  1A3T A;  5EKK A;  1SYE A;  1TS3 A;  1DCZ A;  1VMP A;  1PTO F;  2LS0 1;  1QOH A;  3K59 A;  2EYP A;  3V2T A;  3HOW B;  3BYT B;  2NN6 I;  3L9A X;  1HXY D;  2PZW A;  2Z4I A;  3DM1 A;  4FXD A;  2BDN A;  1S5F D;  2BA0 A;  3QOL A;  3GTQ B;  5IGD A;  2Z4H A;  3RMH A;  5DM6 3;  3SEB A;  1STG A;  4RAU C;  2OT2 A;  1SND A;  1AZP A;  1G2S A;  1LTA D;  5EKI A;  3VA7 A;  2NN6 G;  2WKC A;  4BY1 B;  1JWS D;  5KGU A;  4ZK9 B;  2XN9 C;  3SDZ A;  4FF1 A;  1BCP D;  3RD4 A;  3Q24 A;  4IFD H;  2NBF A;  1S5B D;  5ELF A;  3GTM B;  5C4X B;  2B63 B;  1DXM A;  3MVV A;  1FD7 D;  4NMZ A;  2K04 A;  3K5L A;  5IGE A;  3MXU A;  4F8M A;  2RSN A;  4A3G B;  1ENA A;  1WTW A;  4KD4 A;  2VXW A;  3OHX C;  2TSS A;  1CK1 A;  1DOK A;  4TKO B;  1TY0 A;  1CQV A;  2RQX A;  2SOB A;  2MGS A;  3NQI A;  4F7X A;  1QNK A;  5KYI A;  1TWH B;  3GTP B;  5CV5 A;  3VR6 A;  2NVQ B;  2E2D C;  2B2V C;  4WRD A;  2K05 A;  2L55 A;  4MN3 A;  1HQM C;  2RDG A;  2M2L A;  4BY7 B;  2J0T D;  1NAP A;  1C4Q A;  1PLF A;  2O5I C;  5ISR A;  1EY0 A;  4IQZ A;  2AQ2 B;  2L9H A;  2G9D A;  2ZXO A;  1R4P B;  3FDT A;  1MD2 D;  1IW7 C;  1YNJ C;  5T1G A;  3PIO 3;  1Q3L A;  3DEO A;  4N9T A;  3X3N A;  4OL7 A;  2EY2 A;  4ODG A;  1A2T A;  5JEA G;  5FOB B;  2QCP X;  2KQ3 A;  1L0Y B;  1SJH D;  1DZ1 A;  4K14 A;  1G8Z D;  3H6M A;  2N88 A;  3PIP 3;  3QO2 A;  2BE5 D;  3H0G B;  1C8C A;  3J81 L;  1ENF A;  2OEO A;  4FXG C;  5JPN C;  4RWS C;  2J4X A;  3SK6 A;  2IWH A;  1O7L A;  2M00 A;  5IOD A;  2WAQ B;  2FMM A;  1WD0 A;  1R9T B;  1F9P A;  4TSS A;  4WFN 3;  4FF4 A;  1O78 A;  2DNE A;  1IKM A;  4KY5 A;  4ZUI A;  1PTO D;  1F77 A;  5C0X J;  1QB5 D;  4ID6 A;  5EJW A;  2F03 A;  1A3V A;  1M8A A;  3I72 A;  1T5E A;  2F0J A;  1JOK A;  5C44 B;  3ERQ A;  2EYH A;  3GP7 A;  1SMY C;  1B44 D;  1SYF A;  3CRL C;  1CFM A;  3A8I E;  1I4P A;  3TP7 A;  2B2W A;  2QDB A;  3R3O A;  3R2I A;  4TQU S;  2EZV A;  2F0D A;  4K6D A;  3NSW A;  2Y0S B;  1JR0 D;  2VB2 X;  5K36 H;  1V1O A;  2I46 A;  5C5M A;  3SK4 A;  1CA6 A;  3GO5 A;  4O42 A;  5IT9 E;  4DU9 A;  2R61 A;  2L12 A;  2XRS D;  3SK5 A;  1D6E C;  1KTK A;  4PQX A;  3MC0 B;  4RA8 A;  2H4O A;  2K5Q A;  4ZYS A;  4HCE A;  1S5E D;  4FO2 A;  1STH A;  3PMF A;  3H3V C;  1IW7 D;  1YNJ D;  5IIF A;  4RKB A;  2RVL A;  5KND A;  5JJZ A;  2B2W C;  5HGT A;  1WCM B;  2F0S A;  3OW7 A;  3HOZ B;  4IUR A;  3NUC A;  4CJ2 C;  1U4R A;  3JAM E;  3CHB D;  1H9K A;  1F9R A;  2EYL A;  5C4H A;  4KMU C;  2A69 C;  3NTH A;  1GUW A;  3K0Y A;  1AZQ A;  3OMC A;  3KLS A;  4HN7 A;  1JB3 A;  3I3C A;  1B3A A;  2XWJ B;  1SNO A;  5IGC A;  5KRU A;  1PRT D;  4OO1 I;  2MP1 A;  4QMG A;  2EE1 A;  1RTN A;  1Z6H A;  4WJW A;  3Q22 A;  1EY4 A;  2Z8L A;  3HKZ B;  3QIA A;  1FNV A;  1F2Z A;  1I3Q B;  5C0X H;  1WTR A;  3ERO A;  4RHS A;  3AB9 A;  3J7Y W;  4TRD A;  3ONA B;  1D5Z C;  2JEB I;  1E0B A;  1STE A;  1HFN A;  3RUZ A;  3J80 E;  4RCN A;  4QCL A;  1ZEQ X;  1BOS A;  3MHB A;  4C3I B;  2LFN A;  2F0H A;  4FNF A;  4PNY A;  4PMC A;  1GUN A;  3OIQ A;  3I73 A;  3CU7 A;  1CA5 A;  5E1F A;  1E2W A;  1PZI D;  3OMG A;  4KHZ A;  1H9R A;  3E0J A;  3K6O A;  3MXP A;  3IFT A;  1EOT A;  1ROD A;  3C3L A;  1ESR A;  4K6L A;  2IT1 A;  4F88 A;  1XXG A;  4I7Z C;  3I91 A;  4KKS A;  3LNN A;  3M7G A;  1STB A;  1STN A;  4CJ0 B;  5I6W A;  2KHS A;  1PFB A;  2KUM A;  1LAB A;  2K33 A;  3SHL A;  4EQO A;  1O7Y A;  4IFD G;  4KKU A;  4PV1 C;  1HUN A;  1CM9 A;  1JOQ A;  2R7Z B;  3HEJ A;  5IT9 L;  1LTB D;  4DNR B;  2AQ3 B;  3OWF A;  2BOS A;  2K5W A;  3BG3 A;  1NUC A;  2L1B A;  2A68 C;  1STA A;  4UDU C;  2F0G A;  3MFY A;  5DAU A;  2XSC A;  4B9X A;  3S15 B;  2CHB D;  3A8J E;  1RHP A;  1HPC A;  4WOR A;  2XIW A;  3P1H A;  3I70 A;  2JE6 I;  2D62 A;  1RJT A;  2IX3 A;  4P2C B;  2EYJ A;  2JYO A;  2DY7 A;  4C3H B;  3VA5 A;  3JAM L;  5I6Y A;  3KBG A;  4KI0 A;  3TP5 A;  5K5P A;  1OXT A;  1IYV A;  4FF3 A;  2K32 A;  3UI2 A;  2ZT9 C;  2NUC A;  2N55 A;  2XVS A;  2IJ0 A;  2EPB A;  3W3A A;  3R93 A;  4LJZ C;  3TN2 A;  2PMZ B;  2XRQ D;  3FPU B;  2F0I A;  2K1B A;  2F0U A;  3O13 A;  3P20 A;  1KDA A;  1SNC A;  3C1E A;  5IGF A;  1VDZ A;  1MGS A;  5G3L D;  1B53 A;  1I4H A;  1SE4 A;  2WV6 D;  1G6Z A;  4RGM A;  2PO4 A;  2AWO A;  3A7A B;  1II3 A;  4RGO S;  4XIG S;  1EZ8 A;  4XT1 B;  1U4P A;  1I4G A;  1SSO A;  4H7B A;  1XX8 A;  2DN8 A;  3J80 L;  1GHJ A;  4DGZ A;  2F1M A;  1IYU A;  5FO9 B;  3D8G A;  3LWU A;  1LTS D;  1ML0 D;  1JC7 A;  2F0F A;  4YIJ A;  4HMJ A;  4L63 B;  2PZT A;  1JOO A;  4XQQ A;  2L4N A;  2F3W A;  3TP6 A;  4X3K A;  1EU3 A;  3IKJ A;  2HDL A;  3BZD B;  3HOX B;  3DXJ C;  3OWE B;  3ZYY X;  2NVX B;  1LTT D;  5EPK A;  1LT4 D;  2PCF B;  1GUO A;  1QE6 A;  2KEC A;  4AYB B;  3QWN A;  2IPK D;  4XDX A;  1PYW D;  4KY6 A;  3M3Y B;  3S1R B;  4NDX A;  3PUX A;  3K58 A;  5K36 G;  4DAP A;  5C3X A;  4CBV A;  2IX1 A;  1AP0 A;  2D2C C;  1EQV A;  3R2T A;  4IZ8 A;  3K57 A;  1Y8P B;  4QUC A;  3DMU A;  2MUY A;  1KAA A;  2JXM B;  4LMQ D;  5EBD A;  1SJE D;  1SDF A;  3QB3 A;  1HUM A;  3D4W A;  4K5X A;  1FYC A;  5C6A A;  1T5X D;  1PTO H;  1LT3 D;  3VYU A;  1PDQ A;  3W2D A;  5ELE A;  1DON A;  4CHT B;  2AUJ D;  3IFD A;  5F2D A;  1ILP A;  1B2T A;  5KIX A;  1RTO A;  1GOZ A;  2F0O A;  4DK1 A;  1RDP D;  1TU2 B;  3ND9 A;  4BA1 I;  5C4J B;  1K8M A;  4FXK C;  3NPP A;  2RDH A;  2RA4 A;  1X32 A;  1V8Q A;  2EJG C;  4L6T B;  1GJX A;  3VR2 A;  2PZU A;  2WB1 B;  5C0X I;  2FFK B;  3I90 A;  4BS9 A;  3S1M B;  2E2J B;  4J1M A;  1PRT F;  1Y1V B;  2CW0 D;  1XYI A;  5E3F A;  1TWC B;  3BDC A;  5J1Z A;  4HCS A;  5E4X A;  1HFG A;  4XQJ A;  1H9S A;  2MPM A;  4K5V A;  1TWG B;  4ILW A;  3X3M A;  1ENC A;  5C0X G;  2M9V A;  1Z47 A;  3CQZ B;  1EWH A;  2O5J C;  1CHQ D;  4B9W A;  1MSG A;  4A3K B;  4KN7 C;  1KNA A;  3K5O A;  4ME5 A;  4V0B A;  1KLU D;  3OPO A;  1V1P A;  1OXX K;  1D1I A;  1GUS A;  1CZW A;  5CMD A;  3FVQ A;  1KDC A;  4A3D B;  3HOV B;  2BDO A;  3EQL C;  5E4W C;  3U9S A;  4DXF A;  3SR1 A;  3RZD B;  3MA2 B;  1Y8N B;  1FR3 A;  2ZXR A;  4Q0F A;  2JP1 A;  3TBI B;  4RHR A;  1O80 A;  2C9O A;  5TSS A;  4QF4 A;  3MTS A;  1H9M A;  1F2Y A;  3I4M B;  3D6C A;  1Q12 A;  2L11 A;  1UNS A;  2FJ2 A;  5DNF A;  4DN4 M;  2LMC B;  3PUV A;  1SXT A;  5M5Y B;  2PYK A;  3BDO A;  4BWG B;  4HSP A;  1HA5 A;  2FIN B;  1ZYR C;  1BUV T;  3K7A B;  2EYM A;  5I2Y A;  2A6H C;  3NBH A;  3HRZ C;  1FNW A;  1VF5 C;  4IUP A;  2PPB C;  1G2T A;  1EIG A;  1ET6 A;  2XNA C;  5AFW A;  4DAV A;  3A8K E;  2HDM A;  2JEA I;  2R6G A;  3C46 A;  4OIK A;  5M9O A;  5FO7 B;  4K2K A;  1LLR D;  4EQP A;  5CGK A;  5EBC A;  5EKL A;  1I4Q A;  4KD3 A;  4J6H A;  3MAQ A;  4C3J G;  3C2P A;  3SXH A;  1QNU A;  4HTH A;  3PO2 B;  2L5T A;  5COR A;  2PNR C;  1PFN A;  3S17 B;  5JVG 3;  2D9U A;  3A54 A;  2NVT B;  4CKB A;  2F0T A;  3EA6 A;  1LTR D;  4CKE A;  4XT3 B;  3GTJ B;  2F0E A;  1HHV A;  3E6Z X;  5FLX E;  1PZK D;  1DJR D;  1NR2 A;  1UEA B;  3VR4 A;  3GV3 A;  2KCN A;  3F2U A;  5M3M B;  3D31 A;  3A7L A;  2WII B;  3KF8 A;  1X3P A;  5G3L F;  5KYL A;  4BBS B;  4ZUJ A;  3T16 A;  3N52 A;  2D5D A;  1O7Z A;  1B9N A;  4CKC A;  4OO1 G;  5JPM C;  4XYO A;  3D3R A;  2NVY B;  1WD1 A;  3NTI A;  4X3U A;  3VYS A;  1PXU A;  1QWY A;  3NBI A;  2EYO A;  1SMY D;  1TY2 A;  2O4X A;  4CGY B;  3FMC A;  1S5D D;  3WDN A;  1EWC A;  2RDF A;  1TT2 A;  3T13 A;  3PV0 A;  5HUR A;  1XTC D;  1EY7 A;  1KLG D;  5BN4 A;  1RF2 D;  3I8Z A;  2ENB A;  1GUG A;  2H1E A;  2B2Y A;  1BDO A;  1MSH A;  2NB0 A;  4Q5V A;  1WVL A;  3IAY A;  1JWU D;  5D65 A;  3CKI B;  5LL6 X;  1SYC A;  4G7O C;  2F0Q A;  3EFX D;  1K83 B;  3P7J A;  1HQR D;  4XTC S;  2X69 A;  5LL6 S;  4UAI A;  3OSO A;  4CJ1 B;  3FEW X;  1Y1W B;  5C5L A;  3S9W A;  1JCK B;  3EVQ A;  5LHY 1;  1ET9 A;  5ELB A;  1LAC A;  2HCC A;  3VYR A;  1DM0 B;  4QUF A;  2K6A A;  3GV6 A;  2B2T A;  4DA2 A;  1FGB D;  2KED A;  2MJ8 A;  2K28 A;  3WOE A;  3Q23 A;  2EY1 A;  3M4O B;  4U68 A;  1SE3 A;  5JOB A;  1PZJ D;  4JK1 C;  4Z9C B;  1QJO A;  3KLS X;  5M5W B;  1VMC A;  2A69 D;  4KY7 A;  1R4Q B;  2WIN B;  2EJF C;  4HAE A;  1Q1B A;  1TR5 A;  2KVM A;  1TS5 A;  5DEH A;  1G29 1;  3QJY A;  3PUY A;  1NR4 A;  2TMP A;  3MWY W;  1BBX C;  3J7A F;  4A3B B;  3J7A V;  1KAB A;  4G7Z C;  2OXP A;  1Q8I A;  5IGB A;  1BCP C;  5NUC A;  3MFG A;  5JAV A;  1S5C D;  3HZX A;  4IUU A;  5I9P A;  2WP8 J;  2E75 C;  1TKW B;  2F0M A;  2SNM A;  2OF1 A;  2K03 A;  1X3Q A;  3V96 A;  4OHJ A;  3S16 B;  2B8F A;  3LX0 A;  1OXU A;  1D5M C;  5EPL A;  1F9S A;  1EYC A;  1VCI A;  3S2H B;  4IUQ A;  2E74 C;  2F0W A;  1EU4 A;  3DWP A;  4C56 C;  3M7N A;  5EQ0 A;  2NYZ D;  3NE5 B;  4BBR B;  2QF7 A;  3RLF A;  5FLX L;  1W6J A;  1DD2 A;  3HG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...