4YIJA

Crystal structure of staphylcoccal nuclease variant delta+phs a109e at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4yijA00
1AEXA 1EYAA 2KQ3A 5IODA 2OF1A 4N9TA 2F0JA 1SYGA 2PQEA 4HMIA 4K8IA 1ENCA 5IGDA 4J1MA 1EYCA 2OXPA 3NQTA 4K14A 4ODGA 5C4HA 5CV7A 4PNYA 3SK4A 2F0EA 4H7BA 2LKVA 5C6AA 1A3TA 1STNA 4MIUA 3NXWA 3BDLA 1SYBA 5NUCA 1A2UA 2F0UA 2OEOA 5K5PA 5M9OA 1II3A 1KDBA 2HQEA 4KY5A 3DHQA 5IOCA 3MEHA 5CR3A 4K6DA 5KYIA 2EYOA 4KTAA 3SHLA 2PW7A 2M00A 4K2LA 4K5VA 2F0GA 2RKSA 5KIXA 3QOLA 1SNQA 5I6YA 3P75A 3MHBA 3TMEA 4KJNA 4EQOA 2PZTA 3OMCA 3S9WA 4DFAA 3U9OA 1JORA 1KABA 2F0QA 3OWFA 2ENBA 1SYCA 2SNMA 1TR5A 3SK5A 5C3WA 4QB4A 5KEEA 1SNDA 3C1EA 4WRDA 1F2YA 1SYFA 2O4XA 3SR1A 4KY7A 5IGFA 4K5XA 2EY6A 5CC4A 5J22A 5HGTA 1EY8A 1KDAA 2F0OA 3BDCA 5C4ZA 2F0NA 4NDXA 1SYDA 2F0DA 4HMJA 4WORA 2PW5A 2EYFA 4HTHA 1STGA 4OL7A 1EZ6A 3C1FA 3TP8A 1SNPA 5DAUA 2F0IA 2F0FA 3P1HA 2F0MA 4G57A 4K5WA 5JAVA 1KDCA 1EZ8A 4K8JA 3VA5A 1NSNS 5CV4A 1EYDA 5CV6A 4F7XA 1JOKA 5EKLA 5IGCA 1NUCA 3D6CA 4KV6A 4K2KA 1A3UA 5KRUA 4S3SA 4EQNA 3OMGA 2EY1A 4NP5A 3PMFA 5EKKA 2EXZA 2NUCA 3MXPA 3TP7A 2EYLA 5CV8A 5EGTA 3SK6A 5IGGA 5I9OA 4KY6A 4EVOA 2PZWA 1JOQA 1EY0A 4R8NA 3E5SA 1EY6A 4IZ8A 5E3FA 5C5LA 4PMCA 4DF7A 5I6WA 1IHZA 1SYEA 2RBMA 2F0TA 3D4DA 3QB3A 1EY4A 2F3VA 3LX0A 3HZXA 1EY5A 1RKNA 2KHSA 2F0SA 5C3XA 4IALA 4ZUJA 4F8MA 5ISRA 2EY5A 2SOBA 3EROA 3NK9A 4ID6A 4KD3A 4NMZA 5CV5A 3HEJA 4EQPA 5J39A 1F2MA 3ERQA 5E1FA 1U9RA 2F3WA 4NKLA 2F0LA 1STYA 2PZUA 2SNSA 3D8GA 4I65A 5CV9A 3SXHA 3TP5A 4YIJA 3NP8A 2EYJA 2RDFA 3EJIA 3OSOA 4KHVA 4QF4A 3T16A 4B9WA 3NHHA 4IUNA 4ZUIA 1STAA 2F0KA 4TRDA 1A2TA 2F0WA 4QMGA 2QDBA 5J1ZA 4KJOA 5DEHA 1SNCA 2EYHA 5IGEA 4ME5A 5HURA 1EY9A 1ENAA 2WACA 5C5MA 3DMUA 2F0VA 5JOBA 3SK8A 4DU9A 4E6IA 2EYPA 4RKLA 4ZQ3A 1JOOA 4PMBA 5I9PA 2EYMA 4N9PA 1SNOA 1TQOA 5IGBA 2EY2A 4DGZA 3EVQA 4B9XA 3H6MA 4LAAA 5IIFA 1EY7A 3ITPA 1KAAA 3V2TA 5KYLA 3R3OA 1F2ZA 3NUCA 1SNMA 3MZ5A 5F2DA 3TP6A 3D4WA 1A3VA 3T13A 5CGKA 4KD4A 1EQVA 1TT2A 2PYKA 1STHA 2F0HA 3RUZA 2F0PA 1STBA 3QOJA 4RKBA 3MVVA 4J6HA 5KGUA
chains in the Genus database with same CATH superfamily
3L3OC 2XGTA 2NB0A 3KLRA 1KHIA 1N36Q 1G6ZA 5FJ8H 1HNWQ 2JA5B 2N78A 1CZGA 2N88A 1M8AA 2QDLA 4X64L 4JI0Q 3NPPA 5LMNW 4DXGA 4BY7G 1OXVA 5JPMC 4A3DH 4IFDG 2CKZB 2RA4A 5M3MB 1R4PB 4NW2A 1DD2A 2HQEA 4IQZA 5FLMG 2EYOA 1TS5A 4LF7L 4Y52H 1LO5D 3ER0A 1Q90A 1S5DD 2YTXA 4K5VA 4R4OA 1RODA 4DV4Q 2NVQB 1ZYRC 3OMCA 4O42A 4N8FA 5E7NA 1Z7TA 4A3EB 1A63A 3S15H 4AYBG 3GTPB 4XIGS 4R9WA 2R92G 3UI2A 1IW7D 2O5JC 2B2WC 2B2VC 4X3TA 4PQXA 1K28A 4PG3A 1HTLD 1SN8A 3QIAA 1ICFB 1VQ5A 3T1YL 3G4SA 3RLFA 3NTKA 3VA5A 1QB5D 1CKNB 1JOKA 1H9RA 1WYDA 1PFSA 5BR8Q 3ND9A 5EKKA 3DM3A 4L5QA 1K83B 3D31A 1HZAA 2BA1A 3E5SA 3KBGA 4B3ML 2NN6H 4UDUC 3CD6A 2R93H 1GXDC 1G8ZD 2F0TA 3VR5A 2WB1B 4MN3A 2NVYH 2LFNA 4CDFC 2HDMA 5J39A 2A69D 2R7ZG 1P16A 4DV2Q 1J9OA 3MXNA 1XPRA 2PPBC 2NZ1D 2K33A 5M5XB 4B9WA 2EYJA 4LF4L 4LW1A 1BCPF 5BN4A 1FNWA 5J1ZA 1NE3A 1HXYD 1ENAA 2HDLA 4B3RQ 3I4MH 2JSOA 1IYUA 1IBML 2VQEL 4KKUA 1VQ6A 2EY2A 4RGOS 1PH2A 3TRZA 2MO0A 1OXSC 3B6YA 1Y1WB 1PYSB 5F2DA 1N9WA 2RDGA 2ALYB 1LT6D 2IW3A 1YVCA 1W2BA 1N34L 3QOJA 5LHY1 5IGCA 4C3HH 2UXBQ 3A8KE 3GTQB 1PRTB 4CJ0B 4A3IB 1JE4A 5M5WH 4OXPA 2KOLA 5C4XH 4BA2I 1A2UA 3KF8A 2DGYA 2L4NA 3CRKC 5IYBH 3HOWH 3C46A 2HT1A 1DM0B 4A3GH 2F03A 1H9KA 5I6YA 3P75A 3TMEA 1ICWA 1YNXA 1B3QA 4DR6Q 3VYSA 4JCVE 1E0BA 4BY1B 2V4DA 2O4XA 4DK6C 5AFWA 2F0DA 4HMJA 1O7ZA 3A0JA 3AB9A 5GAEC 1EZ6A 3M4OH 2WAQE 4JI4Q 3IL8A 5JAVA 3S2HB 2IL8A 2NTSA 1ILQA 3D6CA 1Y1VH 4A3CH 1IKMA 3HOYH 1N36L 4DK3C 3GDEA 2RCFA 1HNWL 4YCUA 1KC8C 1BO0A 3FKIB 5ELFA 3GV3A 2CW0D 4XDXA 3J7AF 1STEA 3Q0AA 4JI0L 2RHQB 3A7LA 2JA5H 1X56A 4JC0A 1B50A 1V43A 1SBBB 2NTTA 5CGKA 3CCMA 1XYIA 4CJ1B 2PCFB 3H09A 3I55A 1JJ2A 5M3MH 1ESRA 1IW7C 4YIJA 3IRBA 1X65A 5K36G 4DV4L 3BG3A 3HOVG 2HUGA 4LMQD 2FHTA 2Q2TA 1EOVA 1SLJA 2R6GA 2NVQH 4DN4M 1KAWA 4N9PA 1CSPA 1HQMC 3PF5A 4A3EH 1EQQA 5EKIA 1CHPD 1ONLA 2X6GA 4B9XA 1HR0Q 3CCSA 3AEVA 3GTPH 3BS1A 4LK1C 1EQVA 4A93B 2R93G 5FO9B 2NZOA 2N8NA 4DUZQ 3U4ZA 5KGUA 3F1ZA 1FJGQ 5BR8L 3S24A 1SYGA 1WI5A 3SGIA 2KHIA 1ENCA 4QUFA 5CORA 4RFBA 2A69C 3U9SA 4OHJA 1K83H 3J7ZC 4J8QA 1DOKA 1I4PA 1WTWA 1QE6A 4ZAIA 1LABA 2L55A 4DV2L 4GZYC 3J80c 4ZCKA 4H44C 1NBWA 3OOCA 2YTVA 2F0QA 1BBUA 5EBCA 2AKWB 2KJXA 4DPGA 4JV5Q 4B3RL 5M5XH 3SR1A 1YNJD 1J8IA 3QJYA 2F0OA 4R1JA 1PFNA 4HSVA 1Q7YC 1D5XC 1SJED 4GNXC 1AZPA 3GTLB 3I90A 1M90C 1EZ8A 3GV6A 4GOPC 1XXGA 1Y1WH 4DKAC 1K73C 4M1UB 1XTDA 2I5LX 5L37A 2UXBL 2NUCA 1K0RA 2NN6I 1YJWA 3CHBD 3VYRA 4BA1I 1EIYB 1T5XD 4DR3Q 3GP7A 1N8RC 2HQLA 4X3UA 3GTQH 2R7FA 4JI6Q 3FDTA 2JEAI 2AUKA 4A3IH 1BCPB 1NR4A 1EFID 4A3LG 3TQYA 1JJCB 1STYA 1WFQA 4PZ7A 3T16A 1JB7A 2EQSA 4DR6L 2EYHA 4NXMQ 3CKIB 3BZKA 1YJ9A 2HCIA 1HFGA 4ZQ3A 4RKLA 4PMBA 4ILWA 3X3NA 1IBKQ 5CBEE 5IIFA 2XWBB 4BY1H 4JBMA 4UP8A 2CW0C 1PH8A 1PDQA 2JA5G 3HOXB 2D0OA 4JI4L 2E8GA 1VQIA 1VQKA 4JI5Q 3V05A 3HKZG 4C3JB 4HMIA 4K8IA 1S5FD 4X65Q 3S2HH 1QCBD 1LUZA 3HGBA 3I2ZA 3JAMc 2I0QA 4H13C 2UXDQ 5JJLA 1HUMA 4OWTB 1B7YB 5FO7B 2NVTB 4YCWA 3FKIH 2NZHA 3U4VA 3F2BA 5NUCA 5IT9c 4FXDA 5AJ3Q 1KIXA 2B2YA 1K3RA 3OTOQ 1B1ZA 2R61A 3QR8A 2B39A 2JA8B 4JI1Q 3RLOA 3HOUB 1L0XB 2UU9Q 1CUKA 1YHBA 3RD4A 1WCMB 1X3FA 1MBYA 4KJNA 4HIOA 4LF5Q 3WOFA 1F9QA 1HNZQ 1K3BC 3A8IE 1AFPA 1EL0A 3M4YA 1AN8A 3NSWA 1NAPA 5IGFA 2EZVA 5IYCG 2K50A 1KDAA 2RSNA 1EQTA 2A73B 3KYHC 1HR0L 2DN8A 2EDGA 1LTAD 1EEFD 2FXQA 5DAUA 2VW9A 2K5HA 3M3YB 2N49A 3RZDB 1QVFA 1MSGA 1A3UA 2EJFC 3TEHB 1FJGL 2GA4B 3S1RB 1G291 1E24A 2RF4A 4KN4C 4HR7B 4WFN3 4A93H 5CV8A 5IGGA 1VS0A 2PZWA 2WB1G 1GJXA 2D2CC 2MQHA 2PMZE 5T1IA 1AE2A 5I6WA 3ONAB 1KNAA 1IHZA 5E4WC 1U4RA 2I07B 3A74A 3K5MA 4Q0FA 1VQ8A 5EQ0A 4DAYB 3UE1A 2AHOB 3NK9A 1J5EQ 4WJWA 5KNCA 2UUBQ 2HD3A 3CC2A 1T9HA 1CZWA 1U9RA 4YY3Q 3S1QB 1YNJC 1Y69U 1D5MC 1G51A 3NP8A 3NTIA 2I5HA 5EBDA 3K8AA 4QF4A 1I4GA 3K0XA 5C4ZA 4ZUIA 5IY0A 2A19A 2SEBD 3I91A 3UDFA 4QMGA 1U4PA 3H3VC 4JV5L 2VB3X 1PXUA 2F0VA 1Y1WG 1RJTA 4XT3B 2JEBI 3M4QA 3CCEA 5M3FB 3KOJA 1Q12A 2BE5D 1F2ZA 1HTPA 3Q22A 1NTGA 1DGSA 3N52A 1A8VA 3D3RA 5C44B 4O2DA 4A3IG 4R4IA 3GTLH 3VYUA 5C4HA 3MTSA 3SK4A 2LY7A 1L0WA 1IZ6A 4DR3L 2H1EA 2CCZA 4JI6L 3SE0A 4DR2Q 5CYUA 4DR7Q 1F9RA 1ZYRD 3BYYB 4CGYB 4KHPQ 5ELDA 5KYIA 4GLXA 1B8AA 3MFGA 1EUJA 4GKKQ 4KMUC 2WIIB 4BBSH 1SE4A 3NBHA 5ELEA 4QL5A 1JORA 4XYQA 1ZXTA 5IP7H 4P74A 4NXML 3N6RA 3F2CA 1PVOA 1LTID 4MHEA 1I5FA 1GUWA 2K75A 1TY0A 2F0NA 1IBKL 1LT5D 4L5TA 1V1QA 3GD7A 4A3MG 1WTRA 5FO8B 2RSOA 3PUZA 4JVZA 1NUCA 5JPNC 3VR6A 2KVMA 2KEDA 1JICA 4JI5L 1W6JA 3PMFA 3VR2A 2GN5A 5EGTA 3SK6A 3HOXH 4X65L 2KENA 2UXDL 1D7QA 4PMCA 2YYZA 4C3JH 1B3AA 4CKCA 2E2IB 1RF2D 4BBRB 4NXNQ 4F8MA 1A6XA 2SOBA 4EQPA 5AJ3L 1CQVA 5C0XJ 2Z6BA 2B2UA 4TKOB 3CRLC 2NVTH 1PTOD 2NYZD 4JI1L 3D8GA 4XQNA 4XQQA 2UU9L 2PQAA 5D3IB 1PH7A 3MXNB 4LFCQ 2JP1A 4GOPA 3CC4A 2MP1A 1BBXC 4LF5L 2JA8H 3HOUH 3BVMA 4WJ3M 1HNZL 4DNTB 2IX0A 4CDCC 2RHSB 5GROA 5CBAE 1WCMH 3PUVA 1QVGA 3LWUA 2Y0SB 2K5VA 1SNOA 2EXDA 1X6OA 3GTOB 2IJ0A 3A5ZB 3BU2A 4A3GB 3J81j 1HZCA 2E2JH 4XYOA 3QO2A 1V1OA 1HJPA 3K0YA 1WTXA 3M9BA 1HFNA 1WD0A 4IUUA 4K6LA 2WKDA 2NVXB 2KQ3A 2HIXA 3M3YH 2LXKA 3RZDH 2PQEA 5M5YB 5I2XA 3CXCA 3S1RH 2B63B 3G6EA 2QGQA 5HY6A 4GN3B 3IFDA 1C48A 4A3BB 5K5PA 2BOSA 1J5EL 2JXMB 4K6DA 2UUBL 4IUPA 3ICEA 3TS0A 4YY3L 2M9VA 1ET9A 1UAPA 3PUXA 1PH9A 1XPUA 5KIXA 4RHRA 4EQOA 2BE5C 3I7FA 2CH4A 2C35B 2CWAA 3S1QH 2A6ED 1X55A 1F2YA 2M2LA 5ELBA 2MFIA 1VMCA 3OPOA 4IOAA 1WOCA 1XTCD 3BDCA 4ZKBB 4A3KB 4X66Q 1CQFA 4APVA 1QILA 5E4XA 3TP8A 1SNPA 2F0FA 1I50B 5M3FH 3HKSA 2JK8A 3VR3A 3BZCA 1SAPA 3K6OA 3ERSX 4G4KA 1S5BD 1WTQA 3H94A 3S1NB 4FO2A 1PH4A 2CQOA 1QVCA 5C44H 1SYEA 2XIWA 1EY4A 5COYA 3W2DA 4DR2L 2F3VA 1QZHA 4DR7L 1E7ZA 4KHPL 1H9MA 4NMZA 1NNXA 1CKMA 4DXFA 2CHBD 4GKKL 1WJJA 5CC4A 1HZBA 3DUZA 2RDFA 1TXYA 2DY8A 3C3LA 4LF8Q 2KCCA 1YI2A 1SNCA 1KLGD 4OWWB 1EIGA 4ME5A 5IYDG 1O7LA 5EPLA 3K57A 2KECA 3LNNA 1SMXA 3FVQA 2ZXPA 3EIVA 4HJ9A 1UEBA 2EYMA 2PMZB 2FMMA 1BUVT 3MZ5A 1E3PA 1NR2A 2PYKA 1CTMA 2D5DA 4IFDJ 2D9UA 2Z0SA 3NBIA 2NBFA 4LFAQ 1LTRD 4CHTB 1JT8A 1G2SA 1IL2A 2Z6KA 1VQNA 1S4ZA 1UNSA 2XRSD 1MGSA 2JA6G 3E9IA 4PNYA 3TS2A 2VNUD 1PTOC 2P5ZX 3KF6B 4JK1C 3L2PA 3T53B 1BF4A 1YIJA 1PZID 3I4NG 2JA8G 4CJ2C 1KQSA 2F0UA 2B2YC 3KDFA 2KA7A 4NXNL 1JCKB 1F2LA 2XN9C 2DY7A 1R9TB 3JAMi 4IFDI 2ICEC 1CKOA 1RIPA 3CCVA 4GKJQ 4HJ7A 1VQLA 2E2IH 4JI3Q 1A0IA 2EE1A 2E76C 4BBRH 4ABNA 3HOZG 3SEBA 4IPGA 4KHZA 3CMEA 4OO1H 4FYDA 4LFCL 2K32A 2IWHA 4XTCS 5DM73 3PIO3 3S17H 4LFBQ 2CWPA 4DUYQ 3URYA 1QUQA 1SJHD 3OIPA 4B3SL 1FR3A 4KY7A 5GADC 5JEAG 2MJ8A 4U68A 4MTNA 3PIOA 1OXUA 3KBXA 4DK1A 3JAML 4AQYQ 4V190 3NE5B 4QY7A 3CQZB 3KLSX 2UUAQ 4I7AA 4IUTA 3GTOH 5CV4A 4F7XA 3MEFA 3S1MB 5D14A 2EY1A 3A56A 2IPKD 3D6WA 1B53A 4IZ8A 3J7A5 5C5LA 1XJVA 2NVXH 1LYLA 5LMUQ 5FJ8G 5M5YH 1Q8IA 1EYGA 1EY5A 1D2BA 2WAQG 3PO2B 4FF2A 1BVSA 1D6EC 1VQBA 4P73A 2B63H 1IXRA 1QNUA 1D1IA 2A6EC 3ERQA 1V9PA 1VQCA 1XMOQ 4A3BH 5GQOA 2PZUA 4A3DG 1KTKA 1NY4A 3EJIA 2KEEA 4CKEA 1R4QB 3NTHA 3R93A 3PUYA 5IGEA 3H15A 4GN4B 4DU9A 4GLAC 2ZTEA 4RCNA 2OTJA 1Q86C 3A54A 4G7ZC 2CVRA 4LAAA 2BA0A 2BH8A 3ITPA 4X66L 3V2TA 1L0YB 1BKBA 3P20A 5C44G 4A3KH 2E2HB 4POGA 5D3DA 2DNEA 1AEXA 3K59A 4TSSA 5FLXc 2QEXA 1I50H 1QG7A 2K5NA 4ODGA 1S5CD 5C4JH 4JOIA 3CAMA 2HHHQ 1GUSA 2F0EA 4RG1A 3J81E 5C6AA 4UP9A 4YHHQ 2L12A 3S1NH 3CMAA 1EIFA 4A4IA 1RD9D 2L11A 4QJFA 3TZDA 4L8JA 1CA6A 4G7HC 2AQ2B 2CH4W 1CKNA 4X3SA 1XNRQ 1JQYD 2NN6G 2VUMB 3SHLA 1HZ9A 1B2TA 4A3FB 2F0GA 2H4OA 2PO4A 1I6HB 1O7YA 1O80A 1EOTA 1WVLA 1KABA 4LF8L 1TWGB 5KEEA 4R8IA 1SYFA 1SFOB 1PA6A 2YTYA 1VQHA 2IX3A 3PO3H 4R4QA 2IHEA 1TIID 4JI2Q 3DWPA 1MSHA 1AE3A 3RZOB 5EJWA 4EGVA 3I4MG 3P1HA 2F0MA 1KDCA 1UEAB 3GTJB 3T56B 1MKHA 4LFAL 1CT1D 2B2TA 2HCCA 3UDXA 3MXPA 3A5UA 2C9OA 2JA7B 4EVOA 1K8GA 4IPCA 1UE1A 3A55A 4UPAA 2IT1A 3NQIA 2R3ZA 5BN3A 4DV0Q 3L0OA 5DLQE 1VQMA 4Y7NB 1DYQA 5JJZA 4DV3Q 3GO5A 1V1PB 4C3HG 4DR5Q 1AP0A 1SROA 4NB3A 3LX0A 5LL6X 2IY5B 3K5OA 1NMFA 3PF4A 3NWSA 1YHAA 2B2UC 3PIPA 1YHQA 4ME3A 3VYTA 1JWMD 1OO9B 3HS0C 4GKJL 3JC66 3SVMA 4JI3L 1XPOA 1B44D 5C4XG 1BBWA 1TWHB 5FKAC 1R9TH 3J81i 1U5KA 2Y0SG 5IYBG 3HOWG 4EQ5A 4DUYL 2ZJRA 3GTMB 2Z9HA 1L1OC 5BN5A 4HIDA 2Y0SE 1QZGA 4A3GG 4BXXH 4QUCA 1LT3D 3EN2A 2KHJA 1EY7A 3RNUA 3Q8DA 1HA6A 5KYLA 4BY7B 4AQYL 4BBSB 1GVPA 3T13A 1E2ZA 2ID0A 4KD4A 2UUAL 1STHA 3RUZA 1Y14B 3J81L 1M4VA 3I4LA 2FJ2A 2L5TA 3CQZH 2B63G 1DZ1A 3EBEA 3E3XA 5CV7A 1EWIA 3S1MH 4RMFA 1IL8A 4JBKA 4A3CG 1Y1VG 2QF7A 4RGTA 5LMUL 3NXWA 3KJOA 3CCQA 3HOYG 1X54A 5IWAQ 4HJAA 3KFUA 2R92B 1K8MA 3PGZA 2L1BA 4Q5VA 3MFYA 3K7UC 4XXEA 2OTLA 4KY5A 1DCZA 4GN5A 2E5LQ 4OO1I 2J4XA 3OW7A 4X6AH 1XMOL 1A62A 5C0XH 3RLNA 1KNEA 3PO2H 1PFBA 5DM63 3S9WA 1SNDA 3C1EA 4IURA 1BOSA 3GTKB 4R4CA 1JJGA 4RGNA 5M3MG 5I4DA 5HGTA 4IUVA 3H3VI 2BH2A 1HUNA 1TS3A 4HTHA 2VS1A 2F0IA 3S14B 1XWEA 4OIKA 2O2LD 4A3EG 4EQNA 2R7ZB 2EXZA 3J7YW 2E2HH 4DAVA 2LS01 1H9SB 3DWAA 1JWSD 2HHHL 3W5OA 2E2JB 2ASBA 1K8OA 4YHHL 2GVBA 3HFZB 2BDOA 2EOTA 1QNKA 2EY5A 1EIHA 2PNRC 3HEJA 2N3SA 1XNRL 3MAQA 3OIQA 2F3WA 2VZAA 4ZKCB 4FVMA 4DUZL 1DJRD 4LJZC 5EPJA 4GNXB 1HQRD 1SE2A 2VUMH 1TWAB 1EY9A 3I56A 4A3FH 4DR1Q 3E0EA 1I6HH 3EVQA 4DAPA 1OTCA 1TWGH 4JI2L 1KAAA 3NUCA 1SFOH 3ULPA 3D4WA 3BVZA 5A2QE 2A74C 1X3QA 2Z6KC 1VQ7A 4KKSA 3RZOH 3GTGB 2QILA 1N33Q 2OF1A 3GTJH 5IGDA 1HRJA 1EYCA 1SR3A 3PCOB 4DV0L 1JC7A 1QWYA 1UE6A 3CU7A 1EU3A 2Q2IA 1AH9A 4DV3L 2JA7H 4DR5L 3TN2A 4K0KQ 1BXTA 2XWJB 4Y7NH 1VF7A 4LF9Q 3MEHA 3MA2B 5IP9H 1S72A 4IOCA 3I72A 4X62Q 1SSOA 3EQLC 1PV4A 4JBWA 4HEDA 5ELOA 4CDEC 4DAMA 2PZTA 2JYOA 2CQAA 5KNBA 3E9HA 3SK5A 2Z4IA 1FD7D 1TWHH 1PRTD 1PHJA 1ASZA 3RMHA 2EY6A 3ULJA 4NDXA 3HG9A 3FHWA 3GTMH 3K81C 2EYFA 1STGA 3C1FA 1JB3A 2K1BA 2YV5A 4G57A 3KLSA 3PSIA 3DEPA 1YNND 3CP0A 4BY7H 4BY1G 4O1NA 4HSPA 4IFDH 1SE3A 1IYVA 1LM0A 4NPSA 1H95A 5JVG3 4JI7Q 4R8NA 1YITA 3F2UA 3HOVB 1Q46A 5FLMH 2J7ZA 4C56C 3PO2G 1UUPA 4LWCA 3PUWA 2WP8J 5IWAL 2KHSA 2F4VQ 4ZUJA 2QW7A 2SDFA 4IJHA 1C0AA 4DNIA 1GM5A 1HA5A 4AIMA 2E5LL 4JPBW 1TS4A 4A76A 2F0LA 5CV9A 2R92H 4I65A 3TBIB 3FKIG 3OSOA 1LACA 4IO9A 5LL6S 4B3TQ 1PYBA 4OIJA 5HURA 3Q23A 5A2QL 4L5SA 5C5MA 2VB2X 5DNFA 2EYPA 2MPMA 1TWFB 3J7AV 5LMNQ 3LGJA 1JR0D 4DGZA 2AMCB 5ELCA 3IAYA 3GTKH 4UY8C 3J80E 1EWCA 3OTOL 3VA7A 3S17B 1GHJA 4N8X1 1K0SA 5IODA 3S14H 4N9TA 1EU4A 4WJ4A 2F1MA 4JOIC 1Q8KA 3STBC 1N32Q 1PH1A 2QCPX 4RAUC 3DEOA 2R7ZH 1VDZA 1C7YA 1YJNA 4XT1B 2IHFA 1L1OA 3I8ZA 4MIUA 2NWGA 4DA2A 3M7NA 2Q8RE 2KCMA 1KRTA 2VUMG 4A93G 3L9AX 5M9OA 4A3FG 5C0XI 1UWVA 3KDFB 1IKLA 2B29A 3E6ZX 3RR5A 4KTAA 1VCIA 1VQAA 3IFTA 2WINB 3S2DB 1I4HA 3NELA 4QB4A 4WRDA 3IKJA 4DR1L 1QUQB 4DAYA 4LUOA 4A3JB 1EY8A 1PFMA 1S3OA 1SYDA 1TWAH 3G6JB 1IBLQ 3M7GA 3LWEA 1FVIA 4F88A 3KF8B 4K5WA 1MJEA 1NSNS 2G5DA 4DV6Q 5CV6A 2B2TC 2EJGC 2HIVA 1KD1C 4JI8Q 3WWVA 1Y8PB 4JBJA 1N33L 1PTOF 4HCEA 1SDFA 3K80C 2TSSA 3FEWX 3X3MA 5EPKA 3GTGH 1VQ4A 3J80i 1I6VC 2QKIC 4K0KL 3HZXA 4MNOA 4KD3A 3M4PA 5KNDA 2AUJD 3ULLA 4LF9L 5FK9C 3I73A 5E1FA 3ND8A 4X62L 1PRTC 1E22A 2KCTA 5C4JB 4IUNA 3MXGA 4KLKA 1LTLA 2F0KA 4TRDA 3JAME 4C1NK 4I7ZC 1I94Q 2H5XA 3HKZB 2WACA 3L7ZC 3J80L 1YBYA 5J3BA 3K5NA 3CCUA 2BDNA 4BBSG 5FOBB 1BQQT 5IT9E 3BJUA 1YNNC 2VQFQ 1U4LA 4FF1A 4LUVA 2DJGC 5IP7G 3TP6A 2EVBA 1TT2A 5EAYA 1BCPD 2F0PA 4RH6A 2RKSA 3DLLA 5G3LD 4OELB 1RTOA 3PO3B 4KI0A 4B08A 2XVSA 4J1MA 4JI7L 3D0FA 3RN5A 4H0LC 3U50C 1OXTA 1WTHA 4O0AA 4UHVA 4C3IB 3CCJA 4AYBE 1DOMA 5K36H 3HOVH 3HOXG 2F4VL 5IOCA 3AFPA 1GO3E 2ZJPA 5GAHC 4C3JG 3F8TA 3W1GA 2M00A 4K2LA 1ENFA 2ZM6Q 3QOLA 3O13A 1CA5A 4DFAA 2RDHA 3RN2A 2SNMA 4B3TL 3ZJYC 1HPCA 1YEZA 5J22A 2JN4A 5LMNL 5A35A 1GOZA 2X69A 2KCNA 3HOUG 1TWFH 1JE5A 2K5DA 1KLUD 1WCMG 2CFMA 4K8JA 2UUCQ 1D5ZC 1ML0D 2K28A 3BVGA 4QQBX 2E74C 4LF6Q 3FPPA 2QEJC 3I4OA 1X3GA 3BZDB 5G3LF 4KY6A 5ELNA 1N32L 3CF5A 4RHSA 1B70B 1BR9A 1EFWA 1DXMA 2K05A 3KK7A 1YZ6A 2F3IA 1RCVD 5C3XA 3AMUA 3WDNA 1G91A 4A75A 2FMCA 1DOLA 4JYAQ 1NJIC 2EIFA 3H3VH 4EX5A 3VR4A 4DNRB 2ZXRA 4JG2A 3SXHA 3TREA 4KHVA 5IT9L 3NHHA 2D62A 1TS2A 1JMCA 1TY2A 1CHQD 4BWGB 3S2DH 3U58A 1K9MC 1JOOA 3KLWA 1PYWD 4C2MB 1EQRA 3H6MA 2K14A 2VY3A 3AFQA 3FP9A 4X3KA 3FRPB 1IBLL 1RHPA 2JA9A 1X9NA 4UP7A 2PI2E 4A3JH 1A3VA 1BNZA 2BCOA 4DV6L 1HNXQ 1EYAA 4JI8L 4KN7C 1TVXA 2A5HA 1LV9A 2F0JA 3CW2C 1TWCB 4L5RC 5M3FG 4K14A 3K7AB 4A3LH 2FFKB 2YU9B 3OHXC 2LKVA 4P2CB 1C9OA 1VMPA 1STNA 1PH3A 3BDLA 1SYBA 2QA4A 5T1GA 2ZXOA 2OEOA 1SMYD 3FMCA 5JEAJ 1X3EA 4DV5Q 2MNAA 4L6TB 1I3QB 2PW7A 4A3MB 2K04A 4HCSA 4PZ6A 1PZJD 1S5ED 4J15A 3U9OA 1LTTD 5GAGC 3MC0B 2ENBA 1I94L 4F87A 4MTKA 5I2YA 3HP3A 2N55A 1L2FA 1BCPC 1W6KA 4K5XA 3PV0A 2VQFL 4OGQC 3Q6SA 3OW2A 3ZYYX 1UE5A 1PTOB 1GUGA 4FF3A 1D1KA 1CM9A 4HIMA 3R2TA 1EYDA 3R2IA 1I4RA 4K2KA 1Z6HA 3TP7A 1SXTA 5I9OA 1QOHA 4ALPA 4DF7A 4HN7A 2JQOA 4RWSC 1Y8NB 2RBMA 4LUZA 3G7LA 3WOEA 3K58A 2MGSA 3H0GB 3C2PA 2AQ3B 1LTGD 5ISRA 4ZLTF 3DM1A 4P71A 2RCNA 4RCOA 5C3EB 4C3IH 2R7DA 4DV7Q 1XX8A 2K01A 4NKLA 4HJ8A 1G2TA 3I70A 2SNSA 5IYCH 5JJIA 2ZM6L 1ZKOA 2G9HD 1A2TA 2QDBA 1FYCA 4KJOA 1TU2B 3KF6A 1SRUA 5I9PA 4BBRG 4P75A 3PIP3 1Z9FA 4RA8A 4OO1G 4IPHA 2TMPA 3G48A 3PQIA 3TZUA 3S16B 3BDOA 3W1BA 1ET6A 3NENA 2UUCL 3CPWA 1STBA 1B4OA 2ICIA 4LF6L 2RVLA 1C8CA 3DWQA 4IJLA 3F2DA 1Q81C 4LFBL 4H7BA 1WTPA 1FNUA 4IPDA 1II3A 3P7JA 5D65A 4TVAB 3DHQA 3Q24A 5CR3A 4JYAL 1BDOA 1I4XA 1SNQA 4DK0A 1H9JA 2K4KA 4A3JG 2ZT9C 4TQUS 4QIWE 1MIUA 1HCZA 3DXJC 1EWHA 1UE7A 1AW7A 4A3BG 2XSCA 1LTBD 1FNVA 4CKBA 4CBVA 2Z8LA 2PNHA 1HR0W 2B2WA 2B2VA 4AYBB 4WORA 2PW5A 1T5EA 5JVH3 1NCVA 4C2MH 1XNQQ 2L9HA 1MI2A 1HNXL 2FINB 2F4IA 2XTIA 4NP5A 4POFA 1SMYC 3NBHB 3QG1A 1JOQA 1EY0A 1EY6A 4FNFA 4A3KG 4R4TA 1JWUD 1XMQQ 4YWMA 3D4DA 1TWCH 2C5CA 2EPBA 3EA6A 4DR4Q 1RKNA 2Q2UA 3K7AH 2YU9H 2LMCB 1TKWB 3UDGA 2E2DC 2MHVA 4OONA 4DV5L 1QJOA 1SEBD 2I5MX 3T4AC 3TP5A 2OCEA 4H02A 4C1NI 1STAA 2B8GA 3E0JA 2ATWA 4L63B 1VQJA 1I3QH 3EFXD 3HKZE 2ZJQA 1EEID 3TSSA 3MWYW 4A3MH 1IYJB 4E6IA 1Y8OB 2OQ0A 2JA6B 2A68D 2LXJA 4V0BA 4DV1Q 3STBD 3I4NB 2UXCQ 1O78A 4G7OC 3K5LA 4FP5D 3PO3G 1PTOH 2WFWA 2JJQA 1U0LA 2PQAB 3HOZB 4C3IG 2OXPA 4ZYSA 4GOPB 2DJFC 3OYYA 2G9DA 1RTNA 2K6AA 1A3TA 1F77A 3AU7A 3GQBA 1ZEQX 1L1OB 1J6QA 2KBNA 1LT4D 1A15A 1KDBA 2Z1CA 5IE8A 1DONA 4UAIA 4DV7L 1HHVA 3H0GH 4YWLA 1E2WA 4GS3A 4JW0A 1Z47A 5C3EH 1WD1A 1LTSD 2E75C 1KXLA 1I4QA 2MUYA 2Q8TA 1X3PA 1V1PA 3CPFA 4OX9Q 2WB1E 3A8JE 5H1SE 2RQXA 1HH2P 2A8VA 1VQDA 4MZ9A 3T1HQ 2B3GA 4OL7A 2Q8IB 3NEMA 4P72A 1E1OA 1VQ9A 2WAQB 4BXXG 1PH6A 5EKLA 1VQPA 4KV6A 2F52A 1P8LA 1ESFA 1KRSA 3OMGA 1RL2A 1KL9A 2AWNA 4PZ8A 3S16H 3CC7A 2EYLA 4A3DB 1C4QA 4OEMB 1FL0A 3NWTA 1B9MA 5E3FA 2A6HD 4X64Q 3QB3A 1Q3LA 2VL6A 4CDDC 1GUTA 1F9PA 1B9NA 2F0SA 4IALA 2WKCA 4ID6A 2JE6I 3UDIA 1F2MA 2ES2A 4LF7Q 4Z9CB 5FLXE 3S15B 2Q2HA 1FGBD 2DNCA 1W3SA 2F0WA 4U673 4FXKC 1MJCA 5DEHA 3BYTB 1GHKA 3SK8A 1VQGA 4QCLA 1PMRA 1GD7A 1VQEA 5C0XG 1PH5A 4KK7A 3SDZA 1TQOA 5IGBA 2D0PA 1PLFA 3R3OA 1ASYA 2I46A 1SNMA 3T1YQ 3KUPA 1MD2D 2F0HA 1F9SA 1XNQL 3MVVA 4ZRZA 1VQFA 2R93B 2AQ1B 2OQKA 3A7AB 1K8AC 4B3MQ 3NQTA 2NVYB 1GKHA 1CSQA 1S40A 5CMDA 1RDPD 1XMQL 2ZTCA 4BS9A 2J0TD 3D4RA 3VDYA 2EJMA 1PRTF 4DR4L 3TDQA 3I3CA 1VF5C 2A1AA 1FGUA 2MO1A 5IYDH 4ZK9B 3T51B 4IN3A 3FPUB 3G71A 3CCLA 3I4MB 4HAEA 3R8BA 4LF4Q 2A68C 1H9SA 3CCRA 1LLRD 3MHBA 4IUQA 1OXXK 3OWFA 1CI3M 1SYCA 1TR5A 4LNQA 5C3WA 2L15A 2L0CA 1Q82C 3HRZC 1AZQA 2KUMA 2K52A 1IBMQ 4M8AA 2VQEQ 3AQQA 2DUDA 1MHWC 4PV1C 2K5WA 1SE8A 1E2VA 3J81c 2XRQD 1E1TA 1Q1BA 1V8QA 4C3HB 5JJKA 4DV1L 2B8FA 1U4MA 2JA6H 2UXCL 4GNXA 4QGUA 1GUNA 1N34Q 4KKTA 4ULLA 5HGQA 5KRUA 2X6LA 4PMWA 3QWNA 4S3SA 4FXGC 1VQOA 3I4NH 5M5WB 4FF4A 2O5IC 2K5QA 2XNAC 5C4XB 3H91A 4B3SQ 4YWKA 1PZKD 3V96A 3H0GG 2K7VA 3M85A 4QIWB 3HOWB 4HIKA 5FLXL 5C3EG 2V1CC 3HOZH 1D8LA 2PI2A 1M1KC 1CFMA 1Q1EA 3AYHB 1G6PA 1CK1A 1NMGA 3OWEB 3EROA 1WTVA 5CV5A 3W3AA 2OT2A 4OWXB 3UE0A 5JEAH 2JA7G 4GLVB 5TSSA 4HJ5A 2AWOA 5IP9G 1ILPA 2GVAA 3DMUA 5JOBA 2OWOA 1GUOA 4OX9L 4FDBA 2Z4HA 3M4OB 2LSSA 2ZTDA 3KJPA 1Y1VB 2VXWA 4XQJA 3MXUA 3T1HL 3HOYB 4YCVA 2IX1A 1WTOA 4AH6A 1O7IA 1X32A 2WV6D 2A6HC 4RKBA 4J6HA 4RGMA 2K03A
chains in the Genus database with same CATH topology
3L3OC 2NB0A 3KLRA 1G6ZA 2JA5B 1CZGA 2N88A 1M8AA 3NPPA 4DXGA 1OXVA 5JPMC 4IFDG 2RA4A 5M3MB 1R4PB 4NW2A 1DD2A 2HQEA 4IQZA 2EYOA 1TS5A 1LO5D 1Q90A 1S5DD 4K5VA 1RODA 2NVQB 1ZYRC 3OMCA 4O42A 1Z7TA 4A3EB 3GTPB 4XIGS 4R9WA 2O5JC 3UI2A 1IW7D 2B2WC 2B2VC 4X3TA 4PQXA 1HTLD 3QIAA 3RLFA 3NTKA 3VA5A 1QB5D 1JOKA 1H9RA 3ND9A 5EKKA 1K83B 3D31A 2BA1A 3E5SA 3KBGA 2NN6H 4UDUC 1GXDC 1G8ZD 2F0TA 3VR5A 2WB1B 4MN3A 2LFNA 2HDMA 5J39A 2A69D 1J9OA 3MXNA 2PPBC 2NZ1D 2K33A 5M5XB 4B9WA 2EYJA 1BCPF 5BN4A 1FNWA 5J1ZA 1HXYD 1ENAA 2HDLA 2JSOA 1IYUA 4KKUA 2EY2A 4RGOS 1OXSC 1Y1WB 5F2DA 2RDGA 1LT6D 2IW3A 3QOJA 5LHY1 5IGCA 3A8KE 3GTQB 1PRTB 4CJ0B 4A3IB 1JE4A 2KOLA 4BA2I 1A2UA 3KF8A 2L4NA 3CRKC 3C46A 1DM0B 2F03A 1H9KA 5I6YA 3P75A 3TMEA 1ICWA 3VYSA 1E0BA 4BY1B 2V4DA 2O4XA 5AFWA 2F0DA 4HMJA 1O7ZA 3AB9A 1EZ6A 3IL8A 5JAVA 3S2HB 2IL8A 2NTSA 1ILQA 3D6CA 1IKMA 1BO0A 3FKIB 5ELFA 3GV3A 2CW0D 4XDXA 3J7AF 1STEA 3Q0AA 3A7LA 1B50A 1V43A 1SBBB 2NTTA 5CGKA 1XYIA 4CJ1B 2PCFB 3H09A 1ESRA 1IW7C 4YIJA 5K36G 3BG3A 2HUGA 4LMQD 2FHTA 2R6GA 4DN4M 4N9PA 1HQMC 5EKIA 1CHPD 1ONLA 2X6GA 4B9XA 3BS1A 4LK1C 1EQVA 4A93B 5FO9B 5KGUA 1SYGA 4QUFA 1ENCA 5CORA 4RFBA 2A69C 3U9SA 4OHJA 4J8QA 1DOKA 1I4PA 1WTWA 1QE6A 4ZAIA 1LABA 2L55A 4GZYC 4H44C 3OOCA 2F0QA 5EBCA 2KJXA 3SR1A 1YNJD 3QJYA 2F0OA 1PFNA 4HSVA 1D5XC 1SJED 1AZPA 3GTLB 3I90A 1EZ8A 3GV6A 1XXGA 4M1UB 2NUCA 2NN6I 3CHBD 3VYRA 4BA1I 1T5XD 3GP7A 4X3UA 3FDTA 2JEAI 2AUKA 1BCPB 1NR4A 1EFID 1STYA 3T16A 2EYHA 3CKIB 2HCIA 1HFGA 4ZQ3A 4RKLA 4PMBA 4ILWA 3X3NA 5CBEE 5IIFA 2XWBB 2CW0C 1PDQA 3HOXB 3V05A 4C3JB 4HMIA 4K8IA 1S5FD 1QCBD 3HGBA 4H13C 1HUMA 5FO7B 2NVTB 5NUCA 4FXDA 2B2YA 1B1ZA 2R61A 2B39A 2JA8B 3HOUB 1L0XB 3RD4A 1WCMB 1MBYA 4KJNA 3WOFA 1F9QA 3A8IE 1AFPA 1EL0A 3M4YA 1AN8A 3NSWA 1NAPA 5IGFA 2EZVA 1KDAA 2RSNA 1EQTA 2A73B 2DN8A 2EDGA 1LTAD 1EEFD 5DAUA 3M3YB 3RZDB 1MSGA 1A3UA 2EJFC 2GA4B 3S1RB 1G291 4WFN3 4KN4C 4HR7B 5CV8A 5IGGA 2PZWA 1GJXA 2D2CC 5T1IA 5I6WA 3ONAB 1KNAA 1IHZA 5E4WC 1U4RA 2I07B 3K5MA 4Q0FA 5EQ0A 3NK9A 4WJWA 5KNCA 1U9RA 1CZWA 3S1QB 1YNJC 1Y69U 1D5MC 1J8IA 5C4ZA 3NP8A 3NTIA 5EBDA 4QF4A 1I4GA 4ZUIA 2SEBD 3I91A 4QMGA 1U4PA 3H3VC 2VB3X 1PXUA 2F0VA 1RJTA 4XT3B 2JEBI 5M3FB 1Q12A 2BE5D 1F2ZA 1HTPA 3Q22A 3N52A 3D3RA 5C44B 3VYUA 5C4HA 3MTSA 3SK4A 2LY7A 2H1EA 3SE0A 5CYUA 1F9RA 1ZYRD 3BYYB 4CGYB 5ELDA 5KYIA 3MFGA 4KMUC 2WIIB 1SE4A 3NBHA 5ELEA 1JORA 4XYQA 1ZXTA 3N6RA 1LTID 4MHEA 1GUWA 1TY0A 2F0NA 1LT5D 3GD7A 1WTRA 5FO8B 2RSOA 3PUZA 1NUCA 5JPNC 3VR6A 2KVMA 2KEDA 1JICA 1W6JA 3PMFA 3VR2A 5EGTA 3SK6A 4PMCA 2YYZA 1B3AA 4CKCA 2E2IB 1RF2D 4BBRB 4F8MA 1A6XA 2SOBA 4EQPA 1CQVA 5C0XJ 2B2UA 4TKOB 3CRLC 1PTOD 2NYZD 3D8GA 4XQNA 4XQQA 5D3IB 2JP1A 2MP1A 1BBXC 3BVMA 4DNTB 2IX0A 5CBAE 3PUVA 3LWUA 2Y0SB 1SNOA 3GTOB 2IJ0A 4A3GB 4XYOA 3QO2A 1V1OA 3K0YA 1WTXA 1HFNA 1WD0A 4IUUA 4K6LA 2WKDA 2NVXB 2KQ3A 2PQEA 5M5YB 5I2XA 2B63B 3IFDA 1C48A 4A3BB 5K5PA 2BOSA 2JXMB 4K6DA 4IUPA 2M9VA 1ET9A 1UAPA 3PUXA 5KIXA 4RHRA 4EQOA 2BE5C 2A6ED 1F2YA 2M2LA 5ELBA 1VMCA 3OPOA 1XTCD 3BDCA 4ZKBB 4A3KB 1CQFA 1QILA 5E4XA 3TP8A 1SNPA 2F0FA 1I50B 3VR3A 1SAPA 3K6OA 4G4KA 1S5BD 1WTQA 3H94A 3S1NB 4FO2A 1SYEA 2XIWA 1EY4A 5COYA 3W2DA 2F3VA 1H9MA 4NMZA 4DXFA 2CHBD 5CC4A 3DUZA 2RDFA 2DY8A 3C3LA 2KCCA 1SNCA 1KLGD 1EIGA 4ME5A 1O7LA 5EPLA 3K57A 2KECA 3LNNA 3FVQA 2ZXPA 2PMZB 2EYMA 2FMMA 1BUVT 3MZ5A 1NR2A 2PYKA 1CTMA 2D5DA 4IFDJ 2D9UA 3NBIA 2NBFA 4CHTB 1LTRD 1G2SA 1S4ZA 1UNSA 2XRSD 1MGSA 4PNYA 2VNUD 1PTOC 4JK1C 3T53B 1BF4A 1PZID 4CJ2C 2F0UA 2B2YC 2KA7A 1JCKB 1F2LA 2XN9C 2DY7A 1R9TB 4IFDI 2ICEC 2EE1A 2E76C 4ABNA 3SEBA 4KHZA 4FYDA 4OO1H 2K32A 2IWHA 4XTCS 5DM73 3PIO3 3URYA 1SJHD 3OIPA 1FR3A 4KY7A 5JEAG 2MJ8A 4U68A 1OXUA 3KBXA 4DK1A 3JAML 4V190 3NE5B 3CQZB 3KLSX 4IUTA 5CV4A 4F7XA 3S1MB 5D14A 2EY1A 3A56A 2IPKD 3D6WA 1B53A 4IZ8A 5C5LA 1Q8IA 1EY5A 1D2BA 3PO2B 4FF2A 1D6EC 1QNUA 2A6EC 1D1IA 3ERQA 2PZUA 1KTKA 3EJIA 2KEEA 4CKEA 1R4QB 3NTHA 3R93A 3PUYA 5IGEA 4DU9A 4RCNA 3A54A 4G7ZC 2CVRA 4LAAA 2BA0A 3ITPA 3V2TA 1L0YB 3P20A 2E2HB 5D3DA 2DNEA 1AEXA 3K59A 4TSSA 1QG7A 4ODGA 1S5CD 1GUSA 2F0EA 3J81E 5C6AA 2L12A 1RD9D 2L11A 3TZDA 4L8JA 1CA6A 4G7HC 2AQ2B 4X3SA 1JQYD 2NN6G 2VUMB 3SHLA 1B2TA 4A3FB 2F0GA 2H4OA 2PO4A 1I6HB 1O7YA 1O80A 1EOTA 1WVLA 1KABA 1TWGB 5KEEA 4R8IA 1SYFA 1SFOB 2IX3A 1TIID 3DWPA 1MSHA 3RZOB 5EJWA 4EGVA 3P1HA 2F0MA 1KDCA 1UEAB 3GTJB 3T56B 1CT1D 2B2TA 2HCCA 3MXPA 2C9OA 2JA7B 4EVOA 3A55A 2IT1A 3NQIA 2R3ZA 5BN3A 4Y7NB 1DYQA 5JJZA 3GO5A 1V1PB 4C3HG 1AP0A 5LL6X 3LX0A 3K5OA 3NWSA 2B2UC 3VYTA 1JWMD 1OO9B 3HS0C 3SVMA 1B44D 1TWHB 5FKAC 3GTMB 5BN5A 4QUCA 1LT3D 1EY7A 1HA6A 5KYLA 4BY7B 4BBSB 3T13A 1E2ZA 2ID0A 4KD4A 1STHA 3RUZA 3J81L 1M4VA 3I4LA 2FJ2A 2L5TA 1DZ1A 5CV7A 1IL8A 2QF7A 4RGTA 3NXWA 2R92B 1K8MA 2L1BA 4Q5VA 3MFYA 4XXEA 4KY5A 1DCZA 4OO1I 2J4XA 3OW7A 5C0XH 1KNEA 1PFBA 5DM63 3S9WA 1SNDA 3C1EA 4IURA 1BOSA 3GTKB 4RGNA 5I4DA 5HGTA 4IUVA 1HUNA 1TS3A 4HTHA 2F0IA 3S14B 1XWEA 4OIKA 2O2LD 4EQNA 2R7ZB 2EXZA 3J7YW 4DAVA 2LS01 1H9SB 3DWAA 1JWSD 2E2JB 1K8OA 2BDOA 2EOTA 1QNKA 2EY5A 1EIHA 2PNRC 3HEJA 3MAQA 3OIQA 2F3WA 4ZKCB 4FVMA 1DJRD 4LJZC 5EPJA 1HQRD 1SE2A 1TWAB 1EY9A 3EVQA 4DAPA 1KAAA 3NUCA 3D4WA 3BVZA 5A2QE 2A74C 1X3QA 4KKSA 3GTGB 2QILA 2OF1A 5IGDA 1HRJA 1EYCA 1JC7A 1QWYA 3CU7A 1EU3A 3TN2A 1BXTA 2XWJB 1VF7A 3MEHA 3MA2B 3I72A 1SSOA 3EQLC 4JBWA 4HEDA 2PZTA 2JYOA 2CQAA 5KNBA 3SK5A 2Z4IA 1FD7D 1PRTD 3RMHA 2EY6A 4NDXA 3HG9A 2EYFA 1STGA 3C1FA 1JB3A 2K1BA 4G57A 3KLSA 3DEPA 1YNND 4O1NA 4HSPA 4IFDH 1SE3A 1IYVA 5JVG3 4R8NA 3F2UA 3HOVB 2J7ZA 4C56C 1UUPA 3PUWA 2WP8J 2KHSA 4ZUJA 2SDFA 1HA5A 1TS4A 2F0LA 5CV9A 4I65A 3TBIB 3OSOA 1LACA 5LL6S 4OIJA 5HURA 3Q23A 5A2QL 5C5MA 2VB2X 5DNFA 2EYPA 2MPMA 1TWFB 3J7AV 4DGZA 1JR0D 5ELCA 3IAYA 3J80E 1EWCA 3VA7A 3S17B 1GHJA 5IODA 4N9TA 1EU4A 2F1MA 2QCPX 4RAUC 3DEOA 1VDZA 4XT1B 3I8ZA 4MIUA 2NWGA 4DA2A 3M7NA 2Q8RE 3L9AX 5M9OA 5C0XI 1IKLA 3E6ZX 4KTAA 1VCIA 3IFTA 2WINB 3S2DB 1I4HA 4QB4A 4WRDA 3IKJA 4DAYA 4A3JB 1EY8A 1PFMA 1SYDA 3G6JB 3M7GA 3LWEA 4F88A 4K5WA 1NSNS 5CV6A 2B2TC 2EJGC 1Y8PB 1PTOF 4HCEA 1SDFA 2TSSA 3FEWX 3X3MA 5EPKA 1I6VC 2QKIC 3HZXA 4KD3A 5KNDA 2AUJD 5FK9C 3I73A 5E1FA 3ND8A 1PRTC 5C4JB 4IUNA 3MXGA 2F0KA 4TRDA 3JAME 4C1NK 4I7ZC 3HKZB 2WACA 3L7ZC 3J80L 3K5NA 2BDNA 5FOBB 1BQQT 5IT9E 1YNNC 1U4LA 4FF1A 3TP6A 2EVBA 1TT2A 1BCPD 2F0PA 4RH6A 2RKSA 5G3LD 1RTOA 3PO3B 4KI0A 4B08A 2XVSA 4J1MA 4H0LC 1OXTA 4C3IB 1DOMA 5K36H 5IOCA 4C3JG 2M00A 4K2LA 1ENFA 3QOLA 3O13A 1CA5A 4DFAA 2RDHA 2SNMA 1HPCA 5J22A 5A35A 1GOZA 2X69A 2KCNA 2K5DA 1KLUD 4K8JA 1D5ZC 1ML0D 2K28A 3BVGA 2E74C 3FPPA 2QEJC 3BZDB 5G3LF 4KY6A 4RHSA 1BR9A 1DXMA 2K05A 3KK7A 1RCVD 5C3XA 3AMUA 3WDNA 1G91A 2FMCA 1DOLA 3VR4A 4DNRB 2ZXRA 3SXHA 4KHVA 5IT9L 3NHHA 2D62A 1TS2A 1TY2A 1CHQD 4BWGB 1JOOA 1PYWD 4C2MB 3H6MA 4X3KA 3FRPB 1RHPA 1A3VA 1BNZA 2BCOA 1EYAA 4KN7C 1TVXA 2A5HA 1LV9A 2F0JA 1TWCB 4K14A 3K7AB 2FFKB 2YU9B 3OHXC 2LKVA 4P2CB 1VMPA 1STNA 3BDLA 1SYBA 5T1GA 2ZXOA 2OEOA 1SMYD 3FMCA 5JEAJ 4L6TB 1I3QB 2PW7A 4A3MB 2K04A 4HCSA 1PZJD 1S5ED 3U9OA 1LTTD 3MC0B 2ENBA 4F87A 5I2YA 3HP3A 2N55A 1BCPC 1W6KA 4K5XA 3PV0A 4OGQC 3Q6SA 3ZYYX 1PTOB 1GUGA 4FF3A 1D1KA 1CM9A 3R2TA 1EYDA 3R2IA 1I4RA 4K2KA 1Z6HA 3TP7A 1SXTA 5I9OA 1QOHA 4DF7A 4HN7A 4RWSC 1Y8NB 2RBMA 3G7LA 3WOEA 3K58A 2MGSA 3H0GB 3C2PA 2AQ3B 1LTGD 5ISRA 4ZLTF 3DM1A 4RCOA 5C3EB 1XX8A 2K01A 4NKLA 1G2TA 3I70A 2SNSA 1ZKOA 2G9HD 1A2TA 2QDBA 1FYCA 4KJOA 1TU2B 5I9PA 3PIP3 4RA8A 4OO1G 2TMPA 3TZUA 3S16B 3BDOA 1ET6A 1STBA 1B4OA 2ICIA 2RVLA 1C8CA 3DWQA 4H7BA 1WTPA 1FNUA 1II3A 3P7JA 5D65A 3DHQA 3Q24A 5CR3A 1BDOA 1I4XA 1SNQA 4DK0A 1H9JA 2ZT9C 4TQUS 1HCZA 3DXJC 1EWHA 1AW7A 2XSCA 1LTBD 1FNVA 4CKBA 4CBVA 2Z8LA 2B2WA 2B2VA 4AYBB 4WORA 2PW5A 1T5EA 5JVH3 1NCVA 2L9HA 1MI2A 2FINB 2F4IA 4NP5A 1SMYC 3QG1A 1JOQA 1EY0A 1EY6A 4FNFA 1JWUD 3D4DA 2C5CA 2EPBA 3EA6A 1RKNA 2LMCB 1TKWB 2E2DC 2MHVA 1QJOA 1SEBD 3T4AC 3TP5A 4C1NI 1STAA 2B8GA 3E0JA 4L63B 3EFXD 1EEID 3TSSA 3MWYW 4E6IA 1Y8OB 2JA6B 2A68D 4V0BA 3I4NB 1O78A 4G7OC 3K5LA 4FP5D 1PTOH 3HOZB 4C3IG 2OXPA 4ZYSA 2G9DA 1RTNA 2K6AA 1A3TA 1F77A 3AU7A 3GQBA 1ZEQX 1LT4D 1A15A 1KDBA 2Z1CA 1DONA 4UAIA 1HHVA 1E2WA 1Z47A 1WD1A 1LTSD 2E75C 1I4QA 2MUYA 2Q8TA 1X3PA 1V1PA 3A8JE 2RQXA 4OL7A 2Q8IB 2WAQB 5EKLA 4KV6A 1ESFA 3OMGA 2AWNA 2EYLA 4A3DB 1C4QA 3NWTA 1B9MA 5E3FA 2A6HD 3QB3A 1Q3LA 1GUTA 1F9PA 1B9NA 2F0SA 4IALA 2WKCA 4ID6A 2JE6I 1F2MA 4Z9CB 5FLXE 3S15B 1FGBD 2DNCA 2F0WA 4U673 4FXKC 5DEHA 3BYTB 1GHKA 3SK8A 4QCLA 1PMRA 5C0XG 4KK7A 3SDZA 1TQOA 5IGBA 1PLFA 3R3OA 2I46A 1SNMA 3KUPA 1MD2D 2F0HA 1F9SA 3MVVA 4ZRZA 2R93B 2AQ1B 3A7AB 3NQTA 2NVYB 5CMDA 1RDPD 4BS9A 2J0TD 3D4RA 2EJMA 1PRTF 3TDQA 3I3CA 1VF5C 4ZK9B 3T51B 4IN3A 3FPUB 3I4MB 4HAEA 3R8BA 2A68C 1H9SA 1LLRD 3MHBA 4IUQA 1OXXK 3OWFA 1CI3M 1SYCA 1TR5A 5C3WA 2L0CA 3HRZC 1AZQA 2KUMA 4M8AA 4PV1C 2K5WA 1E2VA 2XRQD 1Q1BA 1V8QA 4C3HB 2B8FA 1U4MA 1GUNA 4KKTA 4ULLA 5KRUA 2X6LA 4PMWA 3QWNA 4S3SA 4FXGC 5M5WB 4FF4A 2O5IC 2K5QA 2XNAC 5C4XB 3H91A 1PZKD 3V96A 3M85A 2K7VA 4QIWB 3HOWB 5FLXL 1CFMA 1Q1EA 1CK1A 3OWEB 3EROA 1WTVA 5CV5A 3W3AA 2OT2A 5JEAH 5TSSA 2AWOA 1ILPA 3DMUA 5JOBA 1GUOA 2Z4HA 3M4OB 1Y1VB 2VXWA 4XQJA 3MXUA 3HOYB 2IX1A 1WTOA 1X32A 2WV6D 2A6HC 4RKBA 4J6HA 4RGMA 2K03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEX A;  1EYA A;  2KQ3 A;  5IOD A;  2OF1 A;  4N9T A;  2F0J A;  1SYG A;  2PQE A;  4HMI A;  4K8I A;  1ENC A;  5IGD A;  4J1M A;  1EYC A;  2OXP A;  3NQT A;  4K14 A;  4ODG A;  5C4H A;  5CV7 A;  4PNY A;  3SK4 A;  2F0E A;  4H7B A;  2LKV A;  5C6A A;  1A3T A;  1STN A;  4MIU A;  3NXW A;  3BDL A;  1SYB A;  5NUC A;  1A2U A;  2F0U A;  2OEO A;  5K5P A;  5M9O A;  1II3 A;  1KDB A;  2HQE A;  4KY5 A;  3DHQ A;  5IOC A;  3MEH A;  5CR3 A;  4K6D A;  5KYI A;  2EYO A;  4KTA A;  3SHL A;  2PW7 A;  2M00 A;  4K2L A;  4K5V A;  2F0G A;  2RKS A;  5KIX A;  3QOL A;  1SNQ A;  5I6Y A;  3P75 A;  3MHB A;  3TME A;  4KJN A;  4EQO A;  2PZT A;  3OMC A;  3S9W A;  4DFA A;  3U9O A;  1JOR A;  1KAB A;  2F0Q A;  3OWF A;  2ENB A;  1SYC A;  2SNM A;  1TR5 A;  3SK5 A;  5C3W A;  4QB4 A;  5KEE A;  1SND A;  3C1E A;  4WRD A;  1F2Y A;  1SYF A;  2O4X A;  3SR1 A;  4KY7 A;  5IGF A;  4K5X A;  2EY6 A;  5CC4 A;  5J22 A;  5HGT A;  1EY8 A;  1KDA A;  2F0O A;  3BDC A;  5C4Z A;  2F0N A;  4NDX A;  1SYD A;  2F0D A;  4HMJ A;  4WOR A;  2PW5 A;  2EYF A;  4HTH A;  1STG A;  4OL7 A;  1EZ6 A;  3C1F A;  3TP8 A;  1SNP A;  5DAU A;  2F0I A;  2F0F A;  3P1H A;  2F0M A;  4G57 A;  4K5W A;  5JAV A;  1KDC A;  1EZ8 A;  4K8J A;  3VA5 A;  1NSN S;  5CV4 A;  1EYD A;  5CV6 A;  4F7X A;  1JOK A;  5EKL A;  5IGC A;  1NUC A;  3D6C A;  4KV6 A;  4K2K A;  1A3U A;  5KRU A;  4S3S A;  4EQN A;  3OMG A;  2EY1 A;  4NP5 A;  3PMF A;  5EKK A;  2EXZ A;  2NUC A;  3MXP A;  3TP7 A;  2EYL A;  5CV8 A;  5EGT A;  3SK6 A;  5IGG A;  5I9O A;  4KY6 A;  4EVO A;  2PZW A;  1JOQ A;  1EY0 A;  4R8N A;  3E5S A;  1EY6 A;  4IZ8 A;  5E3F A;  5C5L A;  4PMC A;  4DF7 A;  5I6W A;  1IHZ A;  1SYE A;  2RBM A;  2F0T A;  3D4D A;  3QB3 A;  1EY4 A;  2F3V A;  3LX0 A;  3HZX A;  1EY5 A;  1RKN A;  2KHS A;  2F0S A;  5C3X A;  4IAL A;  4ZUJ A;  4F8M A;  5ISR A;  2EY5 A;  2SOB A;  3ERO A;  3NK9 A;  4ID6 A;  4KD3 A;  4NMZ A;  5CV5 A;  3HEJ A;  4EQP A;  5J39 A;  1F2M A;  3ERQ A;  5E1F A;  1U9R A;  2F3W A;  4NKL A;  2F0L A;  1STY A;  2PZU A;  2SNS A;  3D8G A;  4I65 A;  5CV9 A;  3SXH A;  3TP5 A;  4YIJ A;  3NP8 A;  2EYJ A;  2RDF A;  3EJI A;  3OSO A;  4KHV A;  4QF4 A;  3T16 A;  4B9W A;  3NHH A;  4IUN A;  4ZUI A;  1STA A;  2F0K A;  4TRD A;  1A2T A;  2F0W A;  4QMG A;  2QDB A;  5J1Z A;  4KJO A;  5DEH A;  1SNC A;  2EYH A;  5IGE A;  4ME5 A;  5HUR A;  1EY9 A;  1ENA A;  2WAC A;  5C5M A;  3DMU A;  2F0V A;  5JOB A;  3SK8 A;  4DU9 A;  4E6I A;  2EYP A;  4RKL A;  4ZQ3 A;  1JOO A;  4PMB A;  5I9P A;  2EYM A;  4N9P A;  1SNO A;  1TQO A;  5IGB A;  2EY2 A;  4DGZ A;  3EVQ A;  4B9X A;  3H6M A;  4LAA A;  5IIF A;  1EY7 A;  3ITP A;  1KAA A;  3V2T A;  5KYL A;  3R3O A;  1F2Z A;  3NUC A;  1SNM A;  3MZ5 A;  5F2D A;  3TP6 A;  3D4W A;  1A3V A;  3T13 A;  5CGK A;  4KD4 A;  1EQV A;  1TT2 A;  2PYK A;  1STH A;  2F0H A;  3RUZ A;  2F0P A;  1STB A;  3QOJ A;  4RKB A;  3MVV A;  4J6H A;  5KGU A; 
#chains in the Genus database with same CATH topology
 3L3O C;  2XGT A;  2NB0 A;  3KLR A;  1KHI A;  1N36 Q;  1G6Z A;  5FJ8 H;  1HNW Q;  2JA5 B;  2N78 A;  1CZG A;  2N88 A;  1M8A A;  2QDL A;  4X64 L;  4JI0 Q;  3NPP A;  5LMN W;  4DXG A;  4BY7 G;  1OXV A;  5JPM C;  4A3D H;  4IFD G;  2CKZ B;  2RA4 A;  5M3M B;  1R4P B;  4NW2 A;  1DD2 A;  2HQE A;  4IQZ A;  5FLM G;  2EYO A;  1TS5 A;  4LF7 L;  4Y52 H;  1LO5 D;  3ER0 A;  1Q90 A;  1S5D D;  2YTX A;  4K5V A;  4R4O A;  1ROD A;  4DV4 Q;  2NVQ B;  1ZYR C;  3OMC A;  4O42 A;  4N8F A;  5E7N A;  1Z7T A;  4A3E B;  1A63 A;  3S15 H;  4AYB G;  3GTP B;  4XIG S;  4R9W A;  2R92 G;  3UI2 A;  1IW7 D;  2O5J C;  2B2W C;  2B2V C;  4X3T A;  4PQX A;  1K28 A;  4PG3 A;  1HTL D;  1SN8 A;  3QIA A;  1ICF B;  1VQ5 A;  3T1Y L;  3G4S A;  3RLF A;  3NTK A;  3VA5 A;  1QB5 D;  1CKN B;  1JOK A;  1H9R A;  1WYD A;  1PFS A;  5BR8 Q;  3ND9 A;  5EKK A;  3DM3 A;  4L5Q A;  1K83 B;  3D31 A;  1HZA A;  2BA1 A;  3E5S A;  3KBG A;  4B3M L;  2NN6 H;  4UDU C;  3CD6 A;  2R93 H;  1GXD C;  1G8Z D;  2F0T A;  3VR5 A;  2WB1 B;  4MN3 A;  2NVY H;  2LFN A;  4CDF C;  2HDM A;  5J39 A;  2A69 D;  2R7Z G;  1P16 A;  4DV2 Q;  1J9O A;  3MXN A;  1XPR A;  2PPB C;  2NZ1 D;  2K33 A;  5M5X B;  4B9W A;  2EYJ A;  4LF4 L;  4LW1 A;  1BCP F;  5BN4 A;  1FNW A;  5J1Z A;  1NE3 A;  1HXY D;  1ENA A;  2HDL A;  4B3R Q;  3I4M H;  2JSO A;  1IYU A;  1IBM L;  2VQE L;  4KKU A;  1VQ6 A;  2EY2 A;  4RGO S;  1PH2 A;  3TRZ A;  2MO0 A;  1OXS C;  3B6Y A;  1Y1W B;  1PYS B;  5F2D A;  1N9W A;  2RDG A;  2ALY B;  1LT6 D;  2IW3 A;  1YVC A;  1W2B A;  1N34 L;  3QOJ A;  5LHY 1;  5IGC A;  4C3H H;  2UXB Q;  3A8K E;  3GTQ B;  1PRT B;  4CJ0 B;  4A3I B;  1JE4 A;  5M5W H;  4OXP A;  2KOL A;  5C4X H;  4BA2 I;  1A2U A;  3KF8 A;  2DGY A;  2L4N A;  3CRK C;  5IYB H;  3HOW H;  3C46 A;  2HT1 A;  1DM0 B;  4A3G H;  2F03 A;  1H9K A;  5I6Y A;  3P75 A;  3TME A;  1ICW A;  1YNX A;  1B3Q A;  4DR6 Q;  3VYS A;  4JCV E;  1E0B A;  4BY1 B;  2V4D A;  2O4X A;  4DK6 C;  5AFW A;  2F0D A;  4HMJ A;  1O7Z A;  3A0J A;  3AB9 A;  5GAE C;  1EZ6 A;  3M4O H;  2WAQ E;  4JI4 Q;  3IL8 A;  5JAV A;  3S2H B;  2IL8 A;  2NTS A;  1ILQ A;  3D6C A;  1Y1V H;  4A3C H;  1IKM A;  3HOY H;  1N36 L;  4DK3 C;  3GDE A;  2RCF A;  1HNW L;  4YCU A;  1KC8 C;  1BO0 A;  3FKI B;  5ELF A;  3GV3 A;  2CW0 D;  4XDX A;  3J7A F;  1STE A;  3Q0A A;  4JI0 L;  2RHQ B;  3A7L A;  2JA5 H;  1X56 A;  4JC0 A;  1B50 A;  1V43 A;  1SBB B;  2NTT A;  5CGK A;  3CCM A;  1XYI A;  4CJ1 B;  2PCF B;  3H09 A;  3I55 A;  1JJ2 A;  5M3M H;  1ESR A;  1IW7 C;  4YIJ A;  3IRB A;  1X65 A;  5K36 G;  4DV4 L;  3BG3 A;  3HOV G;  2HUG A;  4LMQ D;  2FHT A;  2Q2T A;  1EOV A;  1SLJ A;  2R6G A;  2NVQ H;  4DN4 M;  1KAW A;  4N9P A;  1CSP A;  1HQM C;  3PF5 A;  4A3E H;  1EQQ A;  5EKI A;  1CHP D;  1ONL A;  2X6G A;  4B9X A;  1HR0 Q;  3CCS A;  3AEV A;  3GTP H;  3BS1 A;  4LK1 C;  1EQV A;  4A93 B;  2R93 G;  5FO9 B;  2NZO A;  2N8N A;  4DUZ Q;  3U4Z A;  5KGU A;  3F1Z A;  1FJG Q;  5BR8 L;  3S24 A;  1SYG A;  1WI5 A;  3SGI A;  2KHI A;  1ENC A;  4QUF A;  5COR A;  4RFB A;  2A69 C;  3U9S A;  4OHJ A;  1K83 H;  3J7Z C;  4J8Q A;  1DOK A;  1I4P A;  1WTW A;  1QE6 A;  4ZAI A;  1LAB A;  2L55 A;  4DV2 L;  4GZY C;  3J80 c;  4ZCK A;  4H44 C;  1NBW A;  3OOC A;  2YTV A;  2F0Q A;  1BBU A;  5EBC A;  2AKW B;  2KJX A;  4DPG A;  4JV5 Q;  4B3R L;  5M5X H;  3SR1 A;  1YNJ D;  1J8I A;  3QJY A;  2F0O A;  4R1J A;  1PFN A;  4HSV A;  1Q7Y C;  1D5X C;  1SJE D;  4GNX C;  1AZP A;  3GTL B;  3I90 A;  1M90 C;  1EZ8 A;  3GV6 A;  4GOP C;  1XXG A;  1Y1W H;  4DKA C;  1K73 C;  4M1U B;  1XTD A;  2I5L X;  5L37 A;  2UXB L;  2NUC A;  1K0R A;  2NN6 I;  1YJW A;  3CHB D;  3VYR A;  4BA1 I;  1EIY B;  1T5X D;  4DR3 Q;  3GP7 A;  1N8R C;  2HQL A;  4X3U A;  3GTQ H;  2R7F A;  4JI6 Q;  3FDT A;  2JEA I;  2AUK A;  4A3I H;  1BCP B;  1NR4 A;  1EFI D;  4A3L G;  3TQY A;  1JJC B;  1STY A;  1WFQ A;  4PZ7 A;  3T16 A;  1JB7 A;  2EQS A;  4DR6 L;  2EYH A;  4NXM Q;  3CKI B;  3BZK A;  1YJ9 A;  2HCI A;  1HFG A;  4ZQ3 A;  4RKL A;  4PMB A;  4ILW A;  3X3N A;  1IBK Q;  5CBE E;  5IIF A;  2XWB B;  4BY1 H;  4JBM A;  4UP8 A;  2CW0 C;  1PH8 A;  1PDQ A;  2JA5 G;  3HOX B;  2D0O A;  4JI4 L;  2E8G A;  1VQI A;  1VQK A;  4JI5 Q;  3V05 A;  3HKZ G;  4C3J B;  4HMI A;  4K8I A;  1S5F D;  4X65 Q;  3S2H H;  1QCB D;  1LUZ A;  3HGB A;  3I2Z A;  3JAM c;  2I0Q A;  4H13 C;  2UXD Q;  5JJL A;  1HUM A;  4OWT B;  1B7Y B;  5FO7 B;  2NVT B;  4YCW A;  3FKI H;  2NZH A;  3U4V A;  3F2B A;  5NUC A;  5IT9 c;  4FXD A;  5AJ3 Q;  1KIX A;  2B2Y A;  1K3R A;  3OTO Q;  1B1Z A;  2R61 A;  3QR8 A;  2B39 A;  2JA8 B;  4JI1 Q;  3RLO A;  3HOU B;  1L0X B;  2UU9 Q;  1CUK A;  1YHB A;  3RD4 A;  1WCM B;  1X3F A;  1MBY A;  4KJN A;  4HIO A;  4LF5 Q;  3WOF A;  1F9Q A;  1HNZ Q;  1K3B C;  3A8I E;  1AFP A;  1EL0 A;  3M4Y A;  1AN8 A;  3NSW A;  1NAP A;  5IGF A;  2EZV A;  5IYC G;  2K50 A;  1KDA A;  2RSN A;  1EQT A;  2A73 B;  3KYH C;  1HR0 L;  2DN8 A;  2EDG A;  1LTA D;  1EEF D;  2FXQ A;  5DAU A;  2VW9 A;  2K5H A;  3M3Y B;  2N49 A;  3RZD B;  1QVF A;  1MSG A;  1A3U A;  2EJF C;  3TEH B;  1FJG L;  2GA4 B;  3S1R B;  1G29 1;  1E24 A;  2RF4 A;  4KN4 C;  4HR7 B;  4WFN 3;  4A93 H;  5CV8 A;  5IGG A;  1VS0 A;  2PZW A;  2WB1 G;  1GJX A;  2D2C C;  2MQH A;  2PMZ E;  5T1I A;  1AE2 A;  5I6W A;  3ONA B;  1KNA A;  1IHZ A;  5E4W C;  1U4R A;  2I07 B;  3A74 A;  3K5M A;  4Q0F A;  1VQ8 A;  5EQ0 A;  4DAY B;  3UE1 A;  2AHO B;  3NK9 A;  1J5E Q;  4WJW A;  5KNC A;  2UUB Q;  2HD3 A;  3CC2 A;  1T9H A;  1CZW A;  1U9R A;  4YY3 Q;  3S1Q B;  1YNJ C;  1Y69 U;  1D5M C;  1G51 A;  3NP8 A;  3NTI A;  2I5H A;  5EBD A;  3K8A A;  4QF4 A;  1I4G A;  3K0X A;  5C4Z A;  4ZUI A;  5IY0 A;  2A19 A;  2SEB D;  3I91 A;  3UDF A;  4QMG A;  1U4P A;  3H3V C;  4JV5 L;  2VB3 X;  1PXU A;  2F0V A;  1Y1W G;  1RJT A;  4XT3 B;  2JEB I;  3M4Q A;  3CCE A;  5M3F B;  3KOJ A;  1Q12 A;  2BE5 D;  1F2Z A;  1HTP A;  3Q22 A;  1NTG A;  1DGS A;  3N52 A;  1A8V A;  3D3R A;  5C44 B;  4O2D A;  4A3I G;  4R4I A;  3GTL H;  3VYU A;  5C4H A;  3MTS A;  3SK4 A;  2LY7 A;  1L0W A;  1IZ6 A;  4DR3 L;  2H1E A;  2CCZ A;  4JI6 L;  3SE0 A;  4DR2 Q;  5CYU A;  4DR7 Q;  1F9R A;  1ZYR D;  3BYY B;  4CGY B;  4KHP Q;  5ELD A;  5KYI A;  4GLX A;  1B8A A;  3MFG A;  1EUJ A;  4GKK Q;  4KMU C;  2WII B;  4BBS H;  1SE4 A;  3NBH A;  5ELE A;  4QL5 A;  1JOR A;  4XYQ A;  1ZXT A;  5IP7 H;  4P74 A;  4NXM L;  3N6R A;  3F2C A;  1PVO A;  1LTI D;  4MHE A;  1I5F A;  1GUW A;  2K75 A;  1TY0 A;  2F0N A;  1IBK L;  1LT5 D;  4L5T A;  1V1Q A;  3GD7 A;  4A3M G;  1WTR A;  5FO8 B;  2RSO A;  3PUZ A;  4JVZ A;  1NUC A;  5JPN C;  3VR6 A;  2KVM A;  2KED A;  1JIC A;  4JI5 L;  1W6J A;  3PMF A;  3VR2 A;  2GN5 A;  5EGT A;  3SK6 A;  3HOX H;  4X65 L;  2KEN A;  2UXD L;  1D7Q A;  4PMC A;  2YYZ A;  4C3J H;  1B3A A;  4CKC A;  2E2I B;  1RF2 D;  4BBR B;  4NXN Q;  4F8M A;  1A6X A;  2SOB A;  4EQP A;  5AJ3 L;  1CQV A;  5C0X J;  2Z6B A;  2B2U A;  4TKO B;  3CRL C;  2NVT H;  1PTO D;  2NYZ D;  4JI1 L;  3D8G A;  4XQN A;  4XQQ A;  2UU9 L;  2PQA A;  5D3I B;  1PH7 A;  3MXN B;  4LFC Q;  2JP1 A;  4GOP A;  3CC4 A;  2MP1 A;  1BBX C;  4LF5 L;  2JA8 H;  3HOU H;  3BVM A;  4WJ3 M;  1HNZ L;  4DNT B;  2IX0 A;  4CDC C;  2RHS B;  5GRO A;  5CBA E;  1WCM H;  3PUV A;  1QVG A;  3LWU A;  2Y0S B;  2K5V A;  1SNO A;  2EXD A;  1X6O A;  3GTO B;  2IJ0 A;  3A5Z B;  3BU2 A;  4A3G B;  3J81 j;  1HZC A;  2E2J H;  4XYO A;  3QO2 A;  1V1O A;  1HJP A;  3K0Y A;  1WTX A;  3M9B A;  1HFN A;  1WD0 A;  4IUU A;  4K6L A;  2WKD A;  2NVX B;  2KQ3 A;  2HIX A;  3M3Y H;  2LXK A;  3RZD H;  2PQE A;  5M5Y B;  5I2X A;  3CXC A;  3S1R H;  2B63 B;  3G6E A;  2QGQ A;  5HY6 A;  4GN3 B;  3IFD A;  1C48 A;  4A3B B;  5K5P A;  2BOS A;  1J5E L;  2JXM B;  4K6D A;  2UUB L;  4IUP A;  3ICE A;  3TS0 A;  4YY3 L;  2M9V A;  1ET9 A;  1UAP A;  3PUX A;  1PH9 A;  1XPU A;  5KIX A;  4RHR A;  4EQO A;  2BE5 C;  3I7F A;  2CH4 A;  2C35 B;  2CWA A;  3S1Q H;  2A6E D;  1X55 A;  1F2Y A;  2M2L A;  5ELB A;  2MFI A;  1VMC A;  3OPO A;  4IOA A;  1WOC A;  1XTC D;  3BDC A;  4ZKB B;  4A3K B;  4X66 Q;  1CQF A;  4APV A;  1QIL A;  5E4X A;  3TP8 A;  1SNP A;  2F0F A;  1I50 B;  5M3F H;  3HKS A;  2JK8 A;  3VR3 A;  3BZC A;  1SAP A;  3K6O A;  3ERS X;  4G4K A;  1S5B D;  1WTQ A;  3H94 A;  3S1N B;  4FO2 A;  1PH4 A;  2CQO A;  1QVC A;  5C44 H;  1SYE A;  2XIW A;  1EY4 A;  5COY A;  3W2D A;  4DR2 L;  2F3V A;  1QZH A;  4DR7 L;  1E7Z A;  4KHP L;  1H9M A;  4NMZ A;  1NNX A;  1CKM A;  4DXF A;  2CHB D;  4GKK L;  1WJJ A;  5CC4 A;  1HZB A;  3DUZ A;  2RDF A;  1TXY A;  2DY8 A;  3C3L A;  4LF8 Q;  2KCC A;  1YI2 A;  1SNC A;  1KLG D;  4OWW B;  1EIG A;  4ME5 A;  5IYD G;  1O7L A;  5EPL A;  3K57 A;  2KEC A;  3LNN A;  1SMX A;  3FVQ A;  2ZXP A;  3EIV A;  4HJ9 A;  1UEB A;  2EYM A;  2PMZ B;  2FMM A;  1BUV T;  3MZ5 A;  1E3P A;  1NR2 A;  2PYK A;  1CTM A;  2D5D A;  4IFD J;  2D9U A;  2Z0S A;  3NBI A;  2NBF A;  4LFA Q;  1LTR D;  4CHT B;  1JT8 A;  1G2S A;  1IL2 A;  2Z6K A;  1VQN A;  1S4Z A;  1UNS A;  2XRS D;  1MGS A;  2JA6 G;  3E9I A;  4PNY A;  3TS2 A;  2VNU D;  1PTO C;  2P5Z X;  3KF6 B;  4JK1 C;  3L2P A;  3T53 B;  1BF4 A;  1YIJ A;  1PZI D;  3I4N G;  2JA8 G;  4CJ2 C;  1KQS A;  2F0U A;  2B2Y C;  3KDF A;  2KA7 A;  4NXN L;  1JCK B;  1F2L A;  2XN9 C;  2DY7 A;  1R9T B;  3JAM i;  4IFD I;  2ICE C;  1CKO A;  1RIP A;  3CCV A;  4GKJ Q;  4HJ7 A;  1VQL A;  2E2I H;  4JI3 Q;  1A0I A;  2EE1 A;  2E76 C;  4BBR H;  4ABN A;  3HOZ G;  3SEB A;  4IPG A;  4KHZ A;  3CME A;  4OO1 H;  4FYD A;  4LFC L;  2K32 A;  2IWH A;  4XTC S;  5DM7 3;  3PIO 3;  3S17 H;  4LFB Q;  2CWP A;  4DUY Q;  3URY A;  1QUQ A;  1SJH D;  3OIP A;  4B3S L;  1FR3 A;  4KY7 A;  5GAD C;  5JEA G;  2MJ8 A;  4U68 A;  4MTN A;  3PIO A;  1OXU A;  3KBX A;  4DK1 A;  3JAM L;  4AQY Q;  4V19 0;  3NE5 B;  4QY7 A;  3CQZ B;  3KLS X;  2UUA Q;  4I7A A;  4IUT A;  3GTO H;  5CV4 A;  4F7X A;  3MEF A;  3S1M B;  5D14 A;  2EY1 A;  3A56 A;  2IPK D;  3D6W A;  1B53 A;  4IZ8 A;  3J7A 5;  5C5L A;  1XJV A;  2NVX H;  1LYL A;  5LMU Q;  5FJ8 G;  5M5Y H;  1Q8I A;  1EYG A;  1EY5 A;  1D2B A;  2WAQ G;  3PO2 B;  4FF2 A;  1BVS A;  1D6E C;  1VQB A;  4P73 A;  2B63 H;  1IXR A;  1QNU A;  1D1I A;  2A6E C;  3ERQ A;  1V9P A;  1VQC A;  1XMO Q;  4A3B H;  5GQO A;  2PZU A;  4A3D G;  1KTK A;  1NY4 A;  3EJI A;  2KEE A;  4CKE A;  1R4Q B;  3NTH A;  3R93 A;  3PUY A;  5IGE A;  3H15 A;  4GN4 B;  4DU9 A;  4GLA C;  2ZTE A;  4RCN A;  2OTJ A;  1Q86 C;  3A54 A;  4G7Z C;  2CVR A;  4LAA A;  2BA0 A;  2BH8 A;  3ITP A;  4X66 L;  3V2T A;  1L0Y B;  1BKB A;  3P20 A;  5C44 G;  4A3K H;  2E2H B;  4POG A;  5D3D A;  2DNE A;  1AEX A;  3K59 A;  4TSS A;  5FLX c;  2QEX A;  1I50 H;  1QG7 A;  2K5N A;  4ODG A;  1S5C D;  5C4J H;  4JOI A;  3CAM A;  2HHH Q;  1GUS A;  2F0E A;  4RG1 A;  3J81 E;  5C6A A;  4UP9 A;  4YHH Q;  2L12 A;  3S1N H;  3CMA A;  1EIF A;  4A4I A;  1RD9 D;  2L11 A;  4QJF A;  3TZD A;  4L8J A;  1CA6 A;  4G7H C;  2AQ2 B;  2CH4 W;  1CKN A;  4X3S A;  1XNR Q;  1JQY D;  2NN6 G;  2VUM B;  3SHL A;  1HZ9 A;  1B2T A;  4A3F B;  2F0G A;  2H4O A;  2PO4 A;  1I6H B;  1O7Y A;  1O80 A;  1EOT A;  1WVL A;  1KAB A;  4LF8 L;  1TWG B;  5KEE A;  4R8I A;  1SYF A;  1SFO B;  1PA6 A;  2YTY A;  1VQH A;  2IX3 A;  3PO3 H;  4R4Q A;  2IHE A;  1TII D;  4JI2 Q;  3DWP A;  1MSH A;  1AE3 A;  3RZO B;  5EJW A;  4EGV A;  3I4M G;  3P1H A;  2F0M A;  1KDC A;  1UEA B;  3GTJ B;  3T56 B;  1MKH A;  4LFA L;  1CT1 D;  2B2T A;  2HCC A;  3UDX A;  3MXP A;  3A5U A;  2C9O A;  2JA7 B;  4EVO A;  1K8G A;  4IPC A;  1UE1 A;  3A55 A;  4UPA A;  2IT1 A;  3NQI A;  2R3Z A;  5BN3 A;  4DV0 Q;  3L0O A;  5DLQ E;  1VQM A;  4Y7N B;  1DYQ A;  5JJZ A;  4DV3 Q;  3GO5 A;  1V1P B;  4C3H G;  4DR5 Q;  1AP0 A;  1SRO A;  4NB3 A;  3LX0 A;  5LL6 X;  2IY5 B;  3K5O A;  1NMF A;  3PF4 A;  3NWS A;  1YHA A;  2B2U C;  3PIP A;  1YHQ A;  4ME3 A;  3VYT A;  1JWM D;  1OO9 B;  3HS0 C;  4GKJ L;  3JC6 6;  3SVM A;  4JI3 L;  1XPO A;  1B44 D;  5C4X G;  1BBW A;  1TWH B;  5FKA C;  1R9T H;  3J81 i;  1U5K A;  2Y0S G;  5IYB G;  3HOW G;  4EQ5 A;  4DUY L;  2ZJR A;  3GTM B;  2Z9H A;  1L1O C;  5BN5 A;  4HID A;  2Y0S E;  1QZG A;  4A3G G;  4BXX H;  4QUC A;  1LT3 D;  3EN2 A;  2KHJ A;  1EY7 A;  3RNU A;  3Q8D A;  1HA6 A;  5KYL A;  4BY7 B;  4AQY L;  4BBS B;  1GVP A;  3T13 A;  1E2Z A;  2ID0 A;  4KD4 A;  2UUA L;  1STH A;  3RUZ A;  1Y14 B;  3J81 L;  1M4V A;  3I4L A;  2FJ2 A;  2L5T A;  3CQZ H;  2B63 G;  1DZ1 A;  3EBE A;  3E3X A;  5CV7 A;  1EWI A;  3S1M H;  4RMF A;  1IL8 A;  4JBK A;  4A3C G;  1Y1V G;  2QF7 A;  4RGT A;  5LMU L;  3NXW A;  3KJO A;  3CCQ A;  3HOY G;  1X54 A;  5IWA Q;  4HJA A;  3KFU A;  2R92 B;  1K8M A;  3PGZ A;  2L1B A;  4Q5V A;  3MFY A;  3K7U C;  4XXE A;  2OTL A;  4KY5 A;  1DCZ A;  4GN5 A;  2E5L Q;  4OO1 I;  2J4X A;  3OW7 A;  4X6A H;  1XMO L;  1A62 A;  5C0X H;  3RLN A;  1KNE A;  3PO2 H;  1PFB A;  5DM6 3;  3S9W A;  1SND A;  3C1E A;  4IUR A;  1BOS A;  3GTK B;  4R4C A;  1JJG A;  4RGN A;  5M3M G;  5I4D A;  5HGT A;  4IUV A;  3H3V I;  2BH2 A;  1HUN A;  1TS3 A;  4HTH A;  2VS1 A;  2F0I A;  3S14 B;  1XWE A;  4OIK A;  2O2L D;  4A3E G;  4EQN A;  2R7Z B;  2EXZ A;  3J7Y W;  2E2H H;  4DAV A;  2LS0 1;  1H9S B;  3DWA A;  1JWS D;  2HHH L;  3W5O A;  2E2J B;  2ASB A;  1K8O A;  4YHH L;  2GVB A;  3HFZ B;  2BDO A;  2EOT A;  1QNK A;  2EY5 A;  1EIH A;  2PNR C;  3HEJ A;  2N3S A;  1XNR L;  3MAQ A;  3OIQ A;  2F3W A;  2VZA A;  4ZKC B;  4FVM A;  4DUZ L;  1DJR D;  4LJZ C;  5EPJ A;  4GNX B;  1HQR D;  1SE2 A;  2VUM H;  1TWA B;  1EY9 A;  3I56 A;  4A3F H;  4DR1 Q;  3E0E A;  1I6H H;  3EVQ A;  4DAP A;  1OTC A;  1TWG H;  4JI2 L;  1KAA A;  3NUC A;  1SFO H;  3ULP A;  3D4W A;  3BVZ A;  5A2Q E;  2A74 C;  1X3Q A;  2Z6K C;  1VQ7 A;  4KKS A;  3RZO H;  3GTG B;  2QIL A;  1N33 Q;  2OF1 A;  3GTJ H;  5IGD A;  1HRJ A;  1EYC A;  1SR3 A;  3PCO B;  4DV0 L;  1JC7 A;  1QWY A;  1UE6 A;  3CU7 A;  1EU3 A;  2Q2I A;  1AH9 A;  4DV3 L;  2JA7 H;  4DR5 L;  3TN2 A;  4K0K Q;  1BXT A;  2XWJ B;  4Y7N H;  1VF7 A;  4LF9 Q;  3MEH A;  3MA2 B;  5IP9 H;  1S72 A;  4IOC A;  3I72 A;  4X62 Q;  1SSO A;  3EQL C;  1PV4 A;  4JBW A;  4HED A;  5ELO A;  4CDE C;  4DAM A;  2PZT A;  2JYO A;  2CQA A;  5KNB A;  3E9H A;  3SK5 A;  2Z4I A;  1FD7 D;  1TWH H;  1PRT D;  1PHJ A;  1ASZ A;  3RMH A;  2EY6 A;  3ULJ A;  4NDX A;  3HG9 A;  3FHW A;  3GTM H;  3K81 C;  2EYF A;  1STG A;  3C1F A;  1JB3 A;  2K1B A;  2YV5 A;  4G57 A;  3KLS A;  3PSI A;  3DEP A;  1YNN D;  3CP0 A;  4BY7 H;  4BY1 G;  4O1N A;  4HSP A;  4IFD H;  1SE3 A;  1IYV A;  1LM0 A;  4NPS A;  1H95 A;  5JVG 3;  4JI7 Q;  4R8N A;  1YIT A;  3F2U A;  3HOV B;  1Q46 A;  5FLM H;  2J7Z A;  4C56 C;  3PO2 G;  1UUP A;  4LWC A;  3PUW A;  2WP8 J;  5IWA L;  2KHS A;  2F4V Q;  4ZUJ A;  2QW7 A;  2SDF A;  4IJH A;  1C0A A;  4DNI A;  1GM5 A;  1HA5 A;  4AIM A;  2E5L L;  4JPB W;  1TS4 A;  4A76 A;  2F0L A;  5CV9 A;  2R92 H;  4I65 A;  3TBI B;  3FKI G;  3OSO A;  1LAC A;  4IO9 A;  5LL6 S;  4B3T Q;  1PYB A;  4OIJ A;  5HUR A;  3Q23 A;  5A2Q L;  4L5S A;  5C5M A;  2VB2 X;  5DNF A;  2EYP A;  2MPM A;  1TWF B;  3J7A V;  5LMN Q;  3LGJ A;  1JR0 D;  4DGZ A;  2AMC B;  5ELC A;  3IAY A;  3GTK H;  4UY8 C;  3J80 E;  1EWC A;  3OTO L;  3VA7 A;  3S17 B;  1GHJ A;  4N8X 1;  1K0S A;  5IOD A;  3S14 H;  4N9T A;  1EU4 A;  4WJ4 A;  2F1M A;  4JOI C;  1Q8K A;  3STB C;  1N32 Q;  1PH1 A;  2QCP X;  4RAU C;  3DEO A;  2R7Z H;  1VDZ A;  1C7Y A;  1YJN A;  4XT1 B;  2IHF A;  1L1O A;  3I8Z A;  4MIU A;  2NWG A;  4DA2 A;  3M7N A;  2Q8R E;  2KCM A;  1KRT A;  2VUM G;  4A93 G;  3L9A X;  5M9O A;  4A3F G;  5C0X I;  1UWV A;  3KDF B;  1IKL A;  2B29 A;  3E6Z X;  3RR5 A;  4KTA A;  1VCI A;  1VQA A;  3IFT A;  2WIN B;  3S2D B;  1I4H A;  3NEL A;  4QB4 A;  4WRD A;  3IKJ A;  4DR1 L;  1QUQ B;  4DAY A;  4LUO A;  4A3J B;  1EY8 A;  1PFM A;  1S3O A;  1SYD A;  1TWA H;  3G6J B;  1IBL Q;  3M7G A;  3LWE A;  1FVI A;  4F88 A;  3KF8 B;  4K5W A;  1MJE A;  1NSN S;  2G5D A;  4DV6 Q;  5CV6 A;  2B2T C;  2EJG C;  2HIV A;  1KD1 C;  4JI8 Q;  3WWV A;  1Y8P B;  4JBJ A;  1N33 L;  1PTO F;  4HCE A;  1SDF A;  3K80 C;  2TSS A;  3FEW X;  3X3M A;  5EPK A;  3GTG H;  1VQ4 A;  3J80 i;  1I6V C;  2QKI C;  4K0K L;  3HZX A;  4MNO A;  4KD3 A;  3M4P A;  5KND A;  2AUJ D;  3ULL A;  4LF9 L;  5FK9 C;  3I73 A;  5E1F A;  3ND8 A;  4X62 L;  1PRT C;  1E22 A;  2KCT A;  5C4J B;  4IUN A;  3MXG A;  4KLK A;  1LTL A;  2F0K A;  4TRD A;  3JAM E;  4C1N K;  4I7Z C;  1I94 Q;  2H5X A;  3HKZ B;  2WAC A;  3L7Z C;  3J80 L;  1YBY A;  5J3B A;  3K5N A;  3CCU A;  2BDN A;  4BBS G;  5FOB B;  1BQQ T;  5IT9 E;  3BJU A;  1YNN C;  2VQF Q;  1U4L A;  4FF1 A;  4LUV A;  2DJG C;  5IP7 G;  3TP6 A;  2EVB A;  1TT2 A;  5EAY A;  1BCP D;  2F0P A;  4RH6 A;  2RKS A;  3DLL A;  5G3L D;  4OEL B;  1RTO A;  3PO3 B;  4KI0 A;  4B08 A;  2XVS A;  4J1M A;  4JI7 L;  3D0F A;  3RN5 A;  4H0L C;  3U50 C;  1OXT A;  1WTH A;  4O0A A;  4UHV A;  4C3I B;  3CCJ A;  4AYB E;  1DOM A;  5K36 H;  3HOV H;  3HOX G;  2F4V L;  5IOC A;  3AFP A;  1GO3 E;  2ZJP A;  5GAH C;  4C3J G;  3F8T A;  3W1G A;  2M00 A;  4K2L A;  1ENF A;  2ZM6 Q;  3QOL A;  3O13 A;  1CA5 A;  4DFA A;  2RDH A;  3RN2 A;  2SNM A;  4B3T L;  3ZJY C;  1HPC A;  1YEZ A;  5J22 A;  2JN4 A;  5LMN L;  5A35 A;  1GOZ A;  2X69 A;  2KCN A;  3HOU G;  1TWF H;  1JE5 A;  2K5D A;  1KLU D;  1WCM G;  2CFM A;  4K8J A;  2UUC Q;  1D5Z C;  1ML0 D;  2K28 A;  3BVG A;  4QQB X;  2E74 C;  4LF6 Q;  3FPP A;  2QEJ C;  3I4O A;  1X3G A;  3BZD B;  5G3L F;  4KY6 A;  5ELN A;  1N32 L;  3CF5 A;  4RHS A;  1B70 B;  1BR9 A;  1EFW A;  1DXM A;  2K05 A;  3KK7 A;  1YZ6 A;  2F3I A;  1RCV D;  5C3X A;  3AMU A;  3WDN A;  1G91 A;  4A75 A;  2FMC A;  1DOL A;  4JYA Q;  1NJI C;  2EIF A;  3H3V H;  4EX5 A;  3VR4 A;  4DNR B;  2ZXR A;  4JG2 A;  3SXH A;  3TRE A;  4KHV A;  5IT9 L;  3NHH A;  2D62 A;  1TS2 A;  1JMC A;  1TY2 A;  1CHQ D;  4BWG B;  3S2D H;  3U58 A;  1K9M C;  1JOO A;  3KLW A;  1PYW D;  4C2M B;  1EQR A;  3H6M A;  2K14 A;  2VY3 A;  3AFQ A;  3FP9 A;  4X3K A;  3FRP B;  1IBL L;  1RHP A;  2JA9 A;  1X9N A;  4UP7 A;  2PI2 E;  4A3J H;  1A3V A;  1BNZ A;  2BCO A;  4DV6 L;  1HNX Q;  1EYA A;  4JI8 L;  4KN7 C;  1TVX A;  2A5H A;  1LV9 A;  2F0J A;  3CW2 C;  1TWC B;  4L5R C;  5M3F G;  4K14 A;  3K7A B;  4A3L H;  2FFK B;  2YU9 B;  3OHX C;  2LKV A;  4P2C B;  1C9O A;  1VMP A;  1STN A;  1PH3 A;  3BDL A;  1SYB A;  2QA4 A;  5T1G A;  2ZXO A;  2OEO A;  1SMY D;  3FMC A;  5JEA J;  1X3E A;  4DV5 Q;  2MNA A;  4L6T B;  1I3Q B;  2PW7 A;  4A3M B;  2K04 A;  4HCS A;  4PZ6 A;  1PZJ D;  1S5E D;  4J15 A;  3U9O A;  1LTT D;  5GAG C;  3MC0 B;  2ENB A;  1I94 L;  4F87 A;  4MTK A;  5I2Y A;  3HP3 A;  2N55 A;  1L2F A;  1BCP C;  1W6K A;  4K5X A;  3PV0 A;  2VQF L;  4OGQ C;  3Q6S A;  3OW2 A;  3ZYY X;  1UE5 A;  1PTO B;  1GUG A;  4FF3 A;  1D1K A;  1CM9 A;  4HIM A;  3R2T A;  1EYD A;  3R2I A;  1I4R A;  4K2K A;  1Z6H A;  3TP7 A;  1SXT A;  5I9O A;  1QOH A;  4ALP A;  4DF7 A;  4HN7 A;  2JQO A;  4RWS C;  1Y8N B;  2RBM A;  4LUZ A;  3G7L A;  3WOE A;  3K58 A;  2MGS A;  3H0G B;  3C2P A;  2AQ3 B;  1LTG D;  5ISR A;  4ZLT F;  3DM1 A;  4P71 A;  2RCN A;  4RCO A;  5C3E B;  4C3I H;  2R7D A;  4DV7 Q;  1XX8 A;  2K01 A;  4NKL A;  4HJ8 A;  1G2T A;  3I70 A;  2SNS A;  5IYC H;  5JJI A;  2ZM6 L;  1ZKO A;  2G9H D;  1A2T A;  2QDB A;  1FYC A;  4KJO A;  1TU2 B;  3KF6 A;  1SRU A;  5I9P A;  4BBR G;  4P75 A;  3PIP 3;  1Z9F A;  4RA8 A;  4OO1 G;  4IPH A;  2TMP A;  3G48 A;  3PQI A;  3TZU A;  3S16 B;  3BDO A;  3W1B A;  1ET6 A;  3NEN A;  2UUC L;  3CPW A;  1STB A;  1B4O A;  2ICI A;  4LF6 L;  2RVL A;  1C8C A;  3DWQ A;  4IJL A;  3F2D A;  1Q81 C;  4LFB L;  4H7B A;  1WTP A;  1FNU A;  4IPD A;  1II3 A;  3P7J A;  5D65 A;  4TVA B;  3DHQ A;  3Q24 A;  5CR3 A;  4JYA L;  1BDO A;  1I4X A;  1SNQ A;  4DK0 A;  1H9J A;  2K4K A;  4A3J G;  2ZT9 C;  4TQU S;  4QIW E;  1MIU A;  1HCZ A;  3DXJ C;  1EWH A;  1UE7 A;  1AW7 A;  4A3B G;  2XSC A;  1LTB D;  1FNV A;  4CKB A;  4CBV A;  2Z8L A;  2PNH A;  1HR0 W;  2B2W A;  2B2V A;  4AYB B;  4WOR A;  2PW5 A;  1T5E A;  5JVH 3;  1NCV A;  4C2M H;  1XNQ Q;  2L9H A;  1MI2 A;  1HNX L;  2FIN B;  2F4I A;  2XTI A;  4NP5 A;  4POF A;  1SMY C;  3NBH B;  3QG1 A;  1JOQ A;  1EY0 A;  1EY6 A;  4FNF A;  4A3K G;  4R4T A;  1JWU D;  1XMQ Q;  4YWM A;  3D4D A;  1TWC H;  2C5C A;  2EPB A;  3EA6 A;  4DR4 Q;  1RKN A;  2Q2U A;  3K7A H;  2YU9 H;  2LMC B;  1TKW B;  3UDG A;  2E2D C;  2MHV A;  4OON A;  4DV5 L;  1QJO A;  1SEB D;  2I5M X;  3T4A C;  3TP5 A;  2OCE A;  4H02 A;  4C1N I;  1STA A;  2B8G A;  3E0J A;  2ATW A;  4L63 B;  1VQJ A;  1I3Q H;  3EFX D;  3HKZ E;  2ZJQ A;  1EEI D;  3TSS A;  3MWY W;  4A3M H;  1IYJ B;  4E6I A;  1Y8O B;  2OQ0 A;  2JA6 B;  2A68 D;  2LXJ A;  4V0B A;  4DV1 Q;  3STB D;  3I4N B;  2UXC Q;  1O78 A;  4G7O C;  3K5L A;  4FP5 D;  3PO3 G;  1PTO H;  2WFW A;  2JJQ A;  1U0L A;  2PQA B;  3HOZ B;  4C3I G;  2OXP A;  4ZYS A;  4GOP B;  2DJF C;  3OYY A;  2G9D A;  1RTN A;  2K6A A;  1A3T A;  1F77 A;  3AU7 A;  3GQB A;  1ZEQ X;  1L1O B;  1J6Q A;  2KBN A;  1LT4 D;  1A15 A;  1KDB A;  2Z1C A;  5IE8 A;  1DON A;  4UAI A;  4DV7 L;  1HHV A;  3H0G H;  4YWL A;  1E2W A;  4GS3 A;  4JW0 A;  1Z47 A;  5C3E H;  1WD1 A;  1LTS D;  2E75 C;  1KXL A;  1I4Q A;  2MUY A;  2Q8T A;  1X3P A;  1V1P A;  3CPF A;  4OX9 Q;  2WB1 E;  3A8J E;  5H1S E;  2RQX A;  1HH2 P;  2A8V A;  1VQD A;  4MZ9 A;  3T1H Q;  2B3G A;  4OL7 A;  2Q8I B;  3NEM A;  4P72 A;  1E1O A;  1VQ9 A;  2WAQ B;  4BXX G;  1PH6 A;  5EKL A;  1VQP A;  4KV6 A;  2F52 A;  1P8L A;  1ESF A;  1KRS A;  3OMG A;  1RL2 A;  1KL9 A;  2AWN A;  4PZ8 A;  3S16 H;  3CC7 A;  2EYL A;  4A3D B;  1C4Q A;  4OEM B;  1FL0 A;  3NWT A;  1B9M A;  5E3F A;  2A6H D;  4X64 Q;  3QB3 A;  1Q3L A;  2VL6 A;  4CDD C;  1GUT A;  1F9P A;  1B9N A;  2F0S A;  4IAL A;  2WKC A;  4ID6 A;  2JE6 I;  3UDI A;  1F2M A;  2ES2 A;  4LF7 Q;  4Z9C B;  5FLX E;  3S15 B;  2Q2H A;  1FGB D;  2DNC A;  1W3S A;  2F0W A;  4U67 3;  4FXK C;  1MJC A;  5DEH A;  3BYT B;  1GHK A;  3SK8 A;  1VQG A;  4QCL A;  1PMR A;  1GD7 A;  1VQE A;  5C0X G;  1PH5 A;  4KK7 A;  3SDZ A;  1TQO A;  5IGB A;  2D0P A;  1PLF A;  3R3O A;  1ASY A;  2I46 A;  1SNM A;  3T1Y Q;  3KUP A;  1MD2 D;  2F0H A;  1F9S A;  1XNQ L;  3MVV A;  4ZRZ A;  1VQF A;  2R93 B;  2AQ1 B;  2OQK A;  3A7A B;  1K8A C;  4B3M Q;  3NQT A;  2NVY B;  1GKH A;  1CSQ A;  1S40 A;  5CMD A;  1RDP D;  1XMQ L;  2ZTC A;  4BS9 A;  2J0T D;  3D4R A;  3VDY A;  2EJM A;  1PRT F;  4DR4 L;  3TDQ A;  3I3C A;  1VF5 C;  2A1A A;  1FGU A;  2MO1 A;  5IYD H;  4ZK9 B;  3T51 B;  4IN3 A;  3FPU B;  3G71 A;  3CCL A;  3I4M B;  4HAE A;  3R8B A;  4LF4 Q;  2A68 C;  1H9S A;  3CCR A;  1LLR D;  3MHB A;  4IUQ A;  1OXX K;  3OWF A;  1CI3 M;  1SYC A;  1TR5 A;  4LNQ A;  5C3W A;  2L15 A;  2L0C A;  1Q82 C;  3HRZ C;  1AZQ A;  2KUM A;  2K52 A;  1IBM Q;  4M8A A;  2VQE Q;  3AQQ A;  2DUD A;  1MHW C;  4PV1 C;  2K5W A;  1SE8 A;  1E2V A;  3J81 c;  2XRQ D;  1E1T A;  1Q1B A;  1V8Q A;  4C3H B;  5JJK A;  4DV1 L;  2B8F A;  1U4M A;  2JA6 H;  2UXC L;  4GNX A;  4QGU A;  1GUN A;  1N34 Q;  4KKT A;  4ULL A;  5HGQ A;  5KRU A;  2X6L A;  4PMW A;  3QWN A;  4S3S A;  4FXG C;  1VQO A;  3I4N H;  5M5W B;  4FF4 A;  2O5I C;  2K5Q A;  2XNA C;  5C4X B;  3H91 A;  4B3S Q;  4YWK A;  1PZK D;  3V96 A;  3H0G G;  2K7V A;  3M85 A;  4QIW B;  3HOW B;  4HIK A;  5FLX L;  5C3E G;  2V1C C;  3HOZ H;  1D8L A;  2PI2 A;  1M1K C;  1CFM A;  1Q1E A;  3AYH B;  1G6P A;  1CK1 A;  1NMG A;  3OWE B;  3ERO A;  1WTV A;  5CV5 A;  3W3A A;  2OT2 A;  4OWX B;  3UE0 A;  5JEA H;  2JA7 G;  4GLV B;  5TSS A;  4HJ5 A;  2AWO A;  5IP9 G;  1ILP A;  2GVA A;  3DMU A;  5JOB A;  2OWO A;  1GUO A;  4OX9 L;  4FDB A;  2Z4H A;  3M4O B;  2LSS A;  2ZTD A;  3KJP A;  1Y1V B;  2VXW A;  4XQJ A;  3MXU A;  3T1H L;  3HOY B;  4YCV A;  2IX1 A;  1WTO A;  4AH6 A;  1O7I A;  1X32 A;  2WV6 D;  2A6H C;  4RKB A;  4J6H A;  4RGM A;  2K03 A; 
#chains in the Genus database with same CATH homology
 3L3O C;  2NB0 A;  3KLR A;  1G6Z A;  2JA5 B;  1CZG A;  2N88 A;  1M8A A;  3NPP A;  4DXG A;  1OXV A;  5JPM C;  4IFD G;  2RA4 A;  5M3M B;  1R4P B;  4NW2 A;  1DD2 A;  2HQE A;  4IQZ A;  2EYO A;  1TS5 A;  1LO5 D;  1Q90 A;  1S5D D;  4K5V A;  1ROD A;  2NVQ B;  1ZYR C;  3OMC A;  4O42 A;  1Z7T A;  4A3E B;  3GTP B;  4XIG S;  4R9W A;  2O5J C;  3UI2 A;  1IW7 D;  2B2W C;  2B2V C;  4X3T A;  4PQX A;  1HTL D;  3QIA A;  3RLF A;  3NTK A;  3VA5 A;  1QB5 D;  1JOK A;  1H9R A;  3ND9 A;  5EKK A;  1K83 B;  3D31 A;  2BA1 A;  3E5S A;  3KBG A;  2NN6 H;  4UDU C;  1GXD C;  1G8Z D;  2F0T A;  3VR5 A;  2WB1 B;  4MN3 A;  2LFN A;  2HDM A;  5J39 A;  2A69 D;  1J9O A;  3MXN A;  2PPB C;  2NZ1 D;  2K33 A;  5M5X B;  4B9W A;  2EYJ A;  1BCP F;  5BN4 A;  1FNW A;  5J1Z A;  1HXY D;  1ENA A;  2HDL A;  2JSO A;  1IYU A;  4KKU A;  2EY2 A;  4RGO S;  1OXS C;  1Y1W B;  5F2D A;  2RDG A;  1LT6 D;  2IW3 A;  3QOJ A;  5LHY 1;  5IGC A;  3A8K E;  3GTQ B;  1PRT B;  4CJ0 B;  4A3I B;  1JE4 A;  2KOL A;  4BA2 I;  1A2U A;  3KF8 A;  2L4N A;  3CRK C;  3C46 A;  1DM0 B;  2F03 A;  1H9K A;  5I6Y A;  3P75 A;  3TME A;  1ICW A;  3VYS A;  1E0B A;  4BY1 B;  2V4D A;  2O4X A;  5AFW A;  2F0D A;  4HMJ A;  1O7Z A;  3AB9 A;  1EZ6 A;  3IL8 A;  5JAV A;  3S2H B;  2IL8 A;  2NTS A;  1ILQ A;  3D6C A;  1IKM A;  1BO0 A;  3FKI B;  5ELF A;  3GV3 A;  2CW0 D;  4XDX A;  3J7A F;  1STE A;  3Q0A A;  3A7L A;  1B50 A;  1V43 A;  1SBB B;  2NTT A;  5CGK A;  1XYI A;  4CJ1 B;  2PCF B;  3H09 A;  1ESR A;  1IW7 C;  4YIJ A;  5K36 G;  3BG3 A;  2HUG A;  4LMQ D;  2FHT A;  2R6G A;  4DN4 M;  4N9P A;  1HQM C;  5EKI A;  1CHP D;  1ONL A;  2X6G A;  4B9X A;  3BS1 A;  4LK1 C;  1EQV A;  4A93 B;  5FO9 B;  5KGU A;  1SYG A;  4QUF A;  1ENC A;  5COR A;  4RFB A;  2A69 C;  3U9S A;  4OHJ A;  4J8Q A;  1DOK A;  1I4P A;  1WTW A;  1QE6 A;  4ZAI A;  1LAB A;  2L55 A;  4GZY C;  4H44 C;  3OOC A;  2F0Q A;  5EBC A;  2KJX A;  3SR1 A;  1YNJ D;  3QJY A;  2F0O A;  1PFN A;  4HSV A;  1D5X C;  1SJE D;  1AZP A;  3GTL B;  3I90 A;  1EZ8 A;  3GV6 A;  1XXG A;  4M1U B;  2NUC A;  2NN6 I;  3CHB D;  3VYR A;  4BA1 I;  1T5X D;  3GP7 A;  4X3U A;  3FDT A;  2JEA I;  2AUK A;  1BCP B;  1NR4 A;  1EFI D;  1STY A;  3T16 A;  2EYH A;  3CKI B;  2HCI A;  1HFG A;  4ZQ3 A;  4RKL A;  4PMB A;  4ILW A;  3X3N A;  5CBE E;  5IIF A;  2XWB B;  2CW0 C;  1PDQ A;  3HOX B;  3V05 A;  4C3J B;  4HMI A;  4K8I A;  1S5F D;  1QCB D;  3HGB A;  4H13 C;  1HUM A;  5FO7 B;  2NVT B;  5NUC A;  4FXD A;  2B2Y A;  1B1Z A;  2R61 A;  2B39 A;  2JA8 B;  3HOU B;  1L0X B;  3RD4 A;  1WCM B;  1MBY A;  4KJN A;  3WOF A;  1F9Q A;  3A8I E;  1AFP A;  1EL0 A;  3M4Y A;  1AN8 A;  3NSW A;  1NAP A;  5IGF A;  2EZV A;  1KDA A;  2RSN A;  1EQT A;  2A73 B;  2DN8 A;  2EDG A;  1LTA D;  1EEF D;  5DAU A;  3M3Y B;  3RZD B;  1MSG A;  1A3U A;  2EJF C;  2GA4 B;  3S1R B;  1G29 1;  4WFN 3;  4KN4 C;  4HR7 B;  5CV8 A;  5IGG A;  2PZW A;  1GJX A;  2D2C C;  5T1I A;  5I6W A;  3ONA B;  1KNA A;  1IHZ A;  5E4W C;  1U4R A;  2I07 B;  3K5M A;  4Q0F A;  5EQ0 A;  3NK9 A;  4WJW A;  5KNC A;  1U9R A;  1CZW A;  3S1Q B;  1YNJ C;  1Y69 U;  1D5M C;  1J8I A;  5C4Z A;  3NP8 A;  3NTI A;  5EBD A;  4QF4 A;  1I4G A;  4ZUI A;  2SEB D;  3I91 A;  4QMG A;  1U4P A;  3H3V C;  2VB3 X;  1PXU A;  2F0V A;  1RJT A;  4XT3 B;  2JEB I;  5M3F B;  1Q12 A;  2BE5 D;  1F2Z A;  1HTP A;  3Q22 A;  3N52 A;  3D3R A;  5C44 B;  3VYU A;  5C4H A;  3MTS A;  3SK4 A;  2LY7 A;  2H1E A;  3SE0 A;  5CYU A;  1F9R A;  1ZYR D;  3BYY B;  4CGY B;  5ELD A;  5KYI A;  3MFG A;  4KMU C;  2WII B;  1SE4 A;  3NBH A;  5ELE A;  1JOR A;  4XYQ A;  1ZXT A;  3N6R A;  1LTI D;  4MHE A;  1GUW A;  1TY0 A;  2F0N A;  1LT5 D;  3GD7 A;  1WTR A;  5FO8 B;  2RSO A;  3PUZ A;  1NUC A;  5JPN C;  3VR6 A;  2KVM A;  2KED A;  1JIC A;  1W6J A;  3PMF A;  3VR2 A;  5EGT A;  3SK6 A;  4PMC A;  2YYZ A;  1B3A A;  4CKC A;  2E2I B;  1RF2 D;  4BBR B;  4F8M A;  1A6X A;  2SOB A;  4EQP A;  1CQV A;  5C0X J;  2B2U A;  4TKO B;  3CRL C;  1PTO D;  2NYZ D;  3D8G A;  4XQN A;  4XQQ A;  5D3I B;  2JP1 A;  2MP1 A;  1BBX C;  3BVM A;  4DNT B;  2IX0 A;  5CBA E;  3PUV A;  3LWU A;  2Y0S B;  1SNO A;  3GTO B;  2IJ0 A;  4A3G B;  4XYO A;  3QO2 A;  1V1O A;  3K0Y A;  1WTX A;  1HFN A;  1WD0 A;  4IUU A;  4K6L A;  2WKD A;  2NVX B;  2KQ3 A;  2PQE A;  5M5Y B;  5I2X A;  2B63 B;  3IFD A;  1C48 A;  4A3B B;  5K5P A;  2BOS A;  2JXM B;  4K6D A;  4IUP A;  2M9V A;  1ET9 A;  1UAP A;  3PUX A;  5KIX A;  4RHR A;  4EQO A;  2BE5 C;  2A6E D;  1F2Y A;  2M2L A;  5ELB A;  1VMC A;  3OPO A;  1XTC D;  3BDC A;  4ZKB B;  4A3K B;  1CQF A;  1QIL A;  5E4X A;  3TP8 A;  1SNP A;  2F0F A;  1I50 B;  3VR3 A;  1SAP A;  3K6O A;  4G4K A;  1S5B D;  1WTQ A;  3H94 A;  3S1N B;  4FO2 A;  1SYE A;  2XIW A;  1EY4 A;  5COY A;  3W2D A;  2F3V A;  1H9M A;  4NMZ A;  4DXF A;  2CHB D;  5CC4 A;  3DUZ A;  2RDF A;  2DY8 A;  3C3L A;  2KCC A;  1SNC A;  1KLG D;  1EIG A;  4ME5 A;  1O7L A;  5EPL A;  3K57 A;  2KEC A;  3LNN A;  3FVQ A;  2ZXP A;  2PMZ B;  2EYM A;  2FMM A;  1BUV T;  3MZ5 A;  1NR2 A;  2PYK A;  1CTM A;  2D5D A;  4IFD J;  2D9U A;  3NBI A;  2NBF A;  4CHT B;  1LTR D;  1G2S A;  1S4Z A;  1UNS A;  2XRS D;  1MGS A;  4PNY A;  2VNU D;  1PTO C;  4JK1 C;  3T53 B;  1BF4 A;  1PZI D;  4CJ2 C;  2F0U A;  2B2Y C;  2KA7 A;  1JCK B;  1F2L A;  2XN9 C;  2DY7 A;  1R9T B;  4IFD I;  2ICE C;  2EE1 A;  2E76 C;  4ABN A;  3SEB A;  4KHZ A;  4FYD A;  4OO1 H;  2K32 A;  2IWH A;  4XTC S;  5DM7 3;  3PIO 3;  3URY A;  1SJH D;  3OIP A;  1FR3 A;  4KY7 A;  5JEA G;  2MJ8 A;  4U68 A;  1OXU A;  3KBX A;  4DK1 A;  3JAM L;  4V19 0;  3NE5 B;  3CQZ B;  3KLS X;  4IUT A;  5CV4 A;  4F7X A;  3S1M B;  5D14 A;  2EY1 A;  3A56 A;  2IPK D;  3D6W A;  1B53 A;  4IZ8 A;  5C5L A;  1Q8I A;  1EY5 A;  1D2B A;  3PO2 B;  4FF2 A;  1D6E C;  1QNU A;  2A6E C;  1D1I A;  3ERQ A;  2PZU A;  1KTK A;  3EJI A;  2KEE A;  4CKE A;  1R4Q B;  3NTH A;  3R93 A;  3PUY A;  5IGE A;  4DU9 A;  4RCN A;  3A54 A;  4G7Z C;  2CVR A;  4LAA A;  2BA0 A;  3ITP A;  3V2T A;  1L0Y B;  3P20 A;  2E2H B;  5D3D A;  2DNE A;  1AEX A;  3K59 A;  4TSS A;  1QG7 A;  4ODG A;  1S5C D;  1GUS A;  2F0E A;  3J81 E;  5C6A A;  2L12 A;  1RD9 D;  2L11 A;  3TZD A;  4L8J A;  1CA6 A;  4G7H C;  2AQ2 B;  4X3S A;  1JQY D;  2NN6 G;  2VUM B;  3SHL A;  1B2T A;  4A3F B;  2F0G A;  2H4O A;  2PO4 A;  1I6H B;  1O7Y A;  1O80 A;  1EOT A;  1WVL A;  1KAB A;  1TWG B;  5KEE A;  4R8I A;  1SYF A;  1SFO B;  2IX3 A;  1TII D;  3DWP A;  1MSH A;  3RZO B;  5EJW A;  4EGV A;  3P1H A;  2F0M A;  1KDC A;  1UEA B;  3GTJ B;  3T56 B;  1CT1 D;  2B2T A;  2HCC A;  3MXP A;  2C9O A;  2JA7 B;  4EVO A;  3A55 A;  2IT1 A;  3NQI A;  2R3Z A;  5BN3 A;  4Y7N B;  1DYQ A;  5JJZ A;  3GO5 A;  1V1P B;  4C3H G;  1AP0 A;  5LL6 X;  3LX0 A;  3K5O A;  3NWS A;  2B2U C;  3VYT A;  1JWM D;  1OO9 B;  3HS0 C;  3SVM A;  1B44 D;  1TWH B;  5FKA C;  3GTM B;  5BN5 A;  4QUC A;  1LT3 D;  1EY7 A;  1HA6 A;  5KYL A;  4BY7 B;  4BBS B;  3T13 A;  1E2Z A;  2ID0 A;  4KD4 A;  1STH A;  3RUZ A;  3J81 L;  1M4V A;  3I4L A;  2FJ2 A;  2L5T A;  1DZ1 A;  5CV7 A;  1IL8 A;  2QF7 A;  4RGT A;  3NXW A;  2R92 B;  1K8M A;  2L1B A;  4Q5V A;  3MFY A;  4XXE A;  4KY5 A;  1DCZ A;  4OO1 I;  2J4X A;  3OW7 A;  5C0X H;  1KNE A;  1PFB A;  5DM6 3;  3S9W A;  1SND A;  3C1E A;  4IUR A;  1BOS A;  3GTK B;  4RGN A;  5I4D A;  5HGT A;  4IUV A;  1HUN A;  1TS3 A;  4HTH A;  2F0I A;  3S14 B;  1XWE A;  4OIK A;  2O2L D;  4EQN A;  2R7Z B;  2EXZ A;  3J7Y W;  4DAV A;  2LS0 1;  1H9S B;  3DWA A;  1JWS D;  2E2J B;  1K8O A;  2BDO A;  2EOT A;  1QNK A;  2EY5 A;  1EIH A;  2PNR C;  3HEJ A;  3MAQ A;  3OIQ A;  2F3W A;  4ZKC B;  4FVM A;  1DJR D;  4LJZ C;  5EPJ A;  1HQR D;  1SE2 A;  1TWA B;  1EY9 A;  3EVQ A;  4DAP A;  1KAA A;  3NUC A;  3D4W A;  3BVZ A;  5A2Q E;  2A74 C;  1X3Q A;  4KKS A;  3GTG B;  2QIL A;  2OF1 A;  5IGD A;  1HRJ A;  1EYC A;  1JC7 A;  1QWY A;  3CU7 A;  1EU3 A;  3TN2 A;  1BXT A;  2XWJ B;  1VF7 A;  3MEH A;  3MA2 B;  3I72 A;  1SSO A;  3EQL C;  4JBW A;  4HED A;  2PZT A;  2JYO A;  2CQA A;  5KNB A;  3SK5 A;  2Z4I A;  1FD7 D;  1PRT D;  3RMH A;  2EY6 A;  4NDX A;  3HG9 A;  2EYF A;  1STG A;  3C1F A;  1JB3 A;  2K1B A;  4G57 A;  3KLS A;  3DEP A;  1YNN D;  4O1N A;  4HSP A;  4IFD H;  1SE3 A;  1IYV A;  5JVG 3;  4R8N A;  3F2U A;  3HOV B;  2J7Z A;  4C56 C;  1UUP A;  3PUW A;  2WP8 J;  2KHS A;  4ZUJ A;  2SDF A;  1HA5 A;  1TS4 A;  2F0L A;  5CV9 A;  4I65 A;  3TBI B;  3OSO A;  1LAC A;  5LL6 S;  4OIJ A;  5HUR A;  3Q23 A;  5A2Q L;  5C5M A;  2VB2 X;  5DNF A;  2EYP A;  2MPM A;  1TWF B;  3J7A V;  4DGZ A;  1JR0 D;  5ELC A;  3IAY A;  3J80 E;  1EWC A;  3VA7 A;  3S17 B;  1GHJ A;  5IOD A;  4N9T A;  1EU4 A;  2F1M A;  2QCP X;  4RAU C;  3DEO A;  1VDZ A;  4XT1 B;  3I8Z A;  4MIU A;  2NWG A;  4DA2 A;  3M7N A;  2Q8R E;  3L9A X;  5M9O A;  5C0X I;  1IKL A;  3E6Z X;  4KTA A;  1VCI A;  3IFT A;  2WIN B;  3S2D B;  1I4H A;  4QB4 A;  4WRD A;  3IKJ A;  4DAY A;  4A3J B;  1EY8 A;  1PFM A;  1SYD A;  3G6J B;  3M7G A;  3LWE A;  4F88 A;  4K5W A;  1NSN S;  5CV6 A;  2B2T C;  2EJG C;  1Y8P B;  1PTO F;  4HCE A;  1SDF A;  2TSS A;  3FEW X;  3X3M A;  5EPK A;  1I6V C;  2QKI C;  3HZX A;  4KD3 A;  5KND A;  2AUJ D;  5FK9 C;  3I73 A;  5E1F A;  3ND8 A;  1PRT C;  5C4J B;  4IUN A;  3MXG A;  2F0K A;  4TRD A;  3JAM E;  4C1N K;  4I7Z C;  3HKZ B;  2WAC A;  3L7Z C;  3J80 L;  3K5N A;  2BDN A;  5FOB B;  1BQQ T;  5IT9 E;  1YNN C;  1U4L A;  4FF1 A;  3TP6 A;  2EVB A;  1TT2 A;  1BCP D;  2F0P A;  4RH6 A;  2RKS A;  5G3L D;  1RTO A;  3PO3 B;  4KI0 A;  4B08 A;  2XVS A;  4J1M A;  4H0L C;  1OXT A;  4C3I B;  1DOM A;  5K36 H;  5IOC A;  4C3J G;  2M00 A;  4K2L A;  1ENF A;  3QOL A;  3O13 A;  1CA5 A;  4DFA A;  2RDH A;  2SNM A;  1HPC A;  5J22 A;  5A35 A;  1GOZ A;  2X69 A;  2KCN A;  2K5D A;  1KLU D;  4K8J A;  1D5Z C;  1ML0 D;  2K28 A;  3BVG A;  2E74 C;  3FPP A;  2QEJ C;  3BZD B;  5G3L F;  4KY6 A;  4RHS A;  1BR9 A;  1DXM A;  2K05 A;  3KK7 A;  1RCV D;  5C3X A;  3AMU A;  3WDN A;  1G91 A;  2FMC A;  1DOL A;  3VR4 A;  4DNR B;  2ZXR A;  3SXH A;  4KHV A;  5IT9 L;  3NHH A;  2D62 A;  1TS2 A;  1TY2 A;  1CHQ D;  4BWG B;  1JOO A;  1PYW D;  4C2M B;  3H6M A;  4X3K A;  3FRP B;  1RHP A;  1A3V A;  1BNZ A;  2BCO A;  1EYA A;  4KN7 C;  1TVX A;  2A5H A;  1LV9 A;  2F0J A;  1TWC B;  4K14 A;  3K7A B;  2FFK B;  2YU9 B;  3OHX C;  2LKV A;  4P2C B;  1VMP A;  1STN A;  3BDL A;  1SYB A;  5T1G A;  2ZXO A;  2OEO A;  1SMY D;  3FMC A;  5JEA J;  4L6T B;  1I3Q B;  2PW7 A;  4A3M B;  2K04 A;  4HCS A;  1PZJ D;  1S5E D;  3U9O A;  1LTT D;  3MC0 B;  2ENB A;  4F87 A;  5I2Y A;  3HP3 A;  2N55 A;  1BCP C;  1W6K A;  4K5X A;  3PV0 A;  4OGQ C;  3Q6S A;  3ZYY X;  1PTO B;  1GUG A;  4FF3 A;  1D1K A;  1CM9 A;  3R2T A;  1EYD A;  3R2I A;  1I4R A;  4K2K A;  1Z6H A;  3TP7 A;  1SXT A;  5I9O A;  1QOH A;  4DF7 A;  4HN7 A;  4RWS C;  1Y8N B;  2RBM A;  3G7L A;  3WOE A;  3K58 A;  2MGS A;  3H0G B;  3C2P A;  2AQ3 B;  1LTG D;  5ISR A;  4ZLT F;  3DM1 A;  4RCO A;  5C3E B;  1XX8 A;  2K01 A;  4NKL A;  1G2T A;  3I70 A;  2SNS A;  1ZKO A;  2G9H D;  1A2T A;  2QDB A;  1FYC A;  4KJO A;  1TU2 B;  5I9P A;  3PIP 3;  4RA8 A;  4OO1 G;  2TMP A;  3TZU A;  3S16 B;  3BDO A;  1ET6 A;  1STB A;  1B4O A;  2ICI A;  2RVL A;  1C8C A;  3DWQ A;  4H7B A;  1WTP A;  1FNU A;  1II3 A;  3P7J A;  5D65 A;  3DHQ A;  3Q24 A;  5CR3 A;  1BDO A;  1I4X A;  1SNQ A;  4DK0 A;  1H9J A;  2ZT9 C;  4TQU S;  1HCZ A;  3DXJ C;  1EWH A;  1AW7 A;  2XSC A;  1LTB D;  1FNV A;  4CKB A;  4CBV A;  2Z8L A;  2B2W A;  2B2V A;  4AYB B;  4WOR A;  2PW5 A;  1T5E A;  5JVH 3;  1NCV A;  2L9H A;  1MI2 A;  2FIN B;  2F4I A;  4NP5 A;  1SMY C;  3QG1 A;  1JOQ A;  1EY0 A;  1EY6 A;  4FNF A;  1JWU D;  3D4D A;  2C5C A;  2EPB A;  3EA6 A;  1RKN A;  2LMC B;  1TKW B;  2E2D C;  2MHV A;  1QJO A;  1SEB D;  3T4A C;  3TP5 A;  4C1N I;  1STA A;  2B8G A;  3E0J A;  4L63 B;  3EFX D;  1EEI D;  3TSS A;  3MWY W;  4E6I A;  1Y8O B;  2JA6 B;  2A68 D;  4V0B A;  3I4N B;  1O78 A;  4G7O C;  3K5L A;  4FP5 D;  1PTO H;  3HOZ B;  4C3I G;  2OXP A;  4ZYS A;  2G9D A;  1RTN A;  2K6A A;  1A3T A;  1F77 A;  3AU7 A;  3GQB A;  1ZEQ X;  1LT4 D;  1A15 A;  1KDB A;  2Z1C A;  1DON A;  4UAI A;  1HHV A;  1E2W A;  1Z47 A;  1WD1 A;  1LTS D;  2E75 C;  1I4Q A;  2MUY A;  2Q8T A;  1X3P A;  1V1P A;  3A8J E;  2RQX A;  4OL7 A;  2Q8I B;  2WAQ B;  5EKL A;  4KV6 A;  1ESF A;  3OMG A;  2AWN A;  2EYL A;  4A3D B;  1C4Q A;  3NWT A;  1B9M A;  5E3F A;  2A6H D;  3QB3 A;  1Q3L A;  1GUT A;  1F9P A;  1B9N A;  2F0S A;  4IAL A;  2WKC A;  4ID6 A;  2JE6 I;  1F2M A;  4Z9C B;  5FLX E;  3S15 B;  1FGB D;  2DNC A;  2F0W A;  4U67 3;  4FXK C;  5DEH A;  3BYT B;  1GHK A;  3SK8 A;  4QCL A;  1PMR A;  5C0X G;  4KK7 A;  3SDZ A;  1TQO A;  5IGB A;  1PLF A;  3R3O A;  2I46 A;  1SNM A;  3KUP A;  1MD2 D;  2F0H A;  1F9S A;  3MVV A;  4ZRZ A;  2R93 B;  2AQ1 B;  3A7A B;  3NQT A;  2NVY B;  5CMD A;  1RDP D;  4BS9 A;  2J0T D;  3D4R A;  2EJM A;  1PRT F;  3TDQ A;  3I3C A;  1VF5 C;  4ZK9 B;  3T51 B;  4IN3 A;  3FPU B;  3I4M B;  4HAE A;  3R8B A;  2A68 C;  1H9S A;  1LLR D;  3MHB A;  4IUQ A;  1OXX K;  3OWF A;  1CI3 M;  1SYC A;  1TR5 A;  5C3W A;  2L0C A;  3HRZ C;  1AZQ A;  2KUM A;  4M8A A;  4PV1 C;  2K5W A;  1E2V A;  2XRQ D;  1Q1B A;  1V8Q A;  4C3H B;  2B8F A;  1U4M A;  1GUN A;  4KKT A;  4ULL A;  5KRU A;  2X6L A;  4PMW A;  3QWN A;  4S3S A;  4FXG C;  5M5W B;  4FF4 A;  2O5I C;  2K5Q A;  2XNA C;  5C4X B;  3H91 A;  1PZK D;  3V96 A;  3M85 A;  2K7V A;  4QIW B;  3HOW B;  5FLX L;  1CFM A;  1Q1E A;  1CK1 A;  3OWE B;  3ERO A;  1WTV A;  5CV5 A;  3W3A A;  2OT2 A;  5JEA H;  5TSS A;  2AWO A;  1ILP A;  3DMU A;  5JOB A;  1GUO A;  2Z4H A;  3M4O B;  1Y1V B;  2VXW A;  4XQJ A;  3MXU A;  3HOY B;  2IX1 A;  1WTO A;  1X32 A;  2WV6 D;  2A6H C;  4RKB A;  4J6H A;  4RGM A;  2K03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...