4YIJA

Crystal structure of staphylcoccal nuclease variant delta+phs a109e at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
b'KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4yijA00
4HTHA 4ZUJA 5JOBA 4KV6A 3DHQA 5IODA 3D8GA 3BDLA 4ZUIA 1EY5A 4PMCA 3MXPA 4S3SA 3V2TA 5IOCA 4K5XA 3HEJA 5C4HA 3E5SA 1II3A 2F0QA 3D4WA 2PYKA 2O4XA 3DMUA 3NXWA 3SR1A 1EY0A 3ERQA 4B9WA 2F0GA 5JAVA 5J39A 4KY5A 1IHZA 4IZ8A 5NUCA 2F0IA 5KYIA 1EY9A 5C6AA 5IGEA 5C5LA 5CV8A 4F8MA 2RBMA 2SNSA 1RKNA 3OWFA 2ENBA 2EYFA 3PMFA 4ME5A 5CV9A 4EQOA 4NMZA 3NHHA 1SNDA 4B9XA 1SYBA 4H7BA 1SYGA 4WORA 3SK5A 4R8NA 1KDCA 1U9RA 2F0VA 1KDAA 2PW7A 4KY7A 3QOLA 4TRDA 5J22A 2EYPA 3NUCA 5CC4A 2SOBA 5CV5A 1STYA 2F0OA 2WACA 3HZXA 3SK8A 3OMCA 2F0TA 5CV4A 5IGFA 4EQNA 5CV7A 2F0HA 4KJNA 5F2DA 4HMJA 4QF4A 3MEHA 1EY4A 2F3VA 3SK6A 1A2UA 1EZ8A 4DGZA 1EY8A 1STGA 1F2YA 4QMGA 1SNPA 1SNOA 2PZTA 1NUCA 2EYLA 5E3FA 1A3UA 1KDBA 2OEOA 4PNYA 1JOQA 2F0PA 2EYOA 5C4ZA 5HURA 1STBA 4ID6A 1SYEA 5E1FA 5EKKA 2EY2A 3SXHA 1STHA 2HQEA 5CGKA 2M00A 2EY5A 3P75A 4K8IA 5KRUA 4K8JA 3EVQA 3QOJA 5EGTA 4EQPA 3OMGA 5I6WA 5I6YA 5IIFA 2OXPA 5DEHA 4E6IA 1STAA 1EZ6A 3EJIA 1ENCA 2OF1A 4NDXA 5IGDA 1SNMA 2F0NA 4K2LA 4KTAA 4KY6A 2F0KA 2F0DA 3BDCA 4LAAA 2RDFA 1A3TA 2PW5A 3ITPA 1TR5A 3NQTA 4ZQ3A 5KIXA 5ISRA 3C1FA 3LX0A 2KQ3A 3MZ5A 2RKSA 1SYDA 1EQVA 1EYDA 1SYCA 3SHLA 5IGGA 4PMBA 4DF7A 1EY6A 3NP8A 5CR3A 2F3WA 1AEXA 2PQEA 2QDBA 3MHBA 1F2ZA 3MVVA 3OSOA 4J6HA 4K6DA 4MIUA 5I9PA 5IGBA 3TP6A 4IALA 4DU9A 3EROA 2F0UA 2NUCA 2SNMA 2F0LA 4QB4A 2PZUA 3TP8A 1A3VA 3NK9A 4KD4A 4NKLA 4K2KA 1KABA 4J1MA 1F2MA 5I9OA 5KEEA 1EYAA 4NP5A 4RKLA 5J1ZA 2LKVA 1A2TA 3U9OA 1SYFA 2F0MA 3QB3A 4DFAA 3T13A 3TP5A 5M9OA 3D6CA 4N9PA 1SNCA 3H6MA 4I65A 3RUZA 3S9WA 1JORA 2F0FA 4K5WA 3SK4A 4KJOA 2EY6A 2PZWA 1JOKA 1SNQA 3TP7A 4OL7A 1JOOA 4YIJA 2EXZA 4K14A 4KHVA 3D4DA 5KYLA 4G57A 5K5PA 2F0EA 2KHSA 4N9TA 3T16A 3TMEA 5HGTA 1ENAA 4HMIA 3C1EA 1STNA 1TQOA 4KD3A 5EKLA 1KAAA 4F7XA 5C3XA 5DAUA 5CV6A 2EYMA 5KGUA 2EY1A 1EY7A 3P1HA 4IUNA 1EYCA 5C3WA 4ODGA 3R3OA 2F0SA 1NSNS 2EYJA 3VA5A 4RKBA 4WRDA 4EVOA 5IGCA 5C5MA 4K5VA 2F0JA 2F0WA 2EYHA 1TT2A
chains in the Genus database with same CATH superfamily
1FVIA 1SEBD 1TWAB 1IKMA 1X3GA 4KHPL 1WTHA 1IYUA 3D4WA 3NXWA 4GNXA 4BA1I 5IYCH 4HJ7A 2VQFQ 1XNQL 3GTLH 5C6AA 4YCVA 1PH6A 1YHBA 1XPRA 3X3MA 5M3MH 4YY3L 2ENBA 2KCNA 2BDOA 3UE0A 2CH4W 3DWAA 3AU7A 4KY7A 1AN8A 4A3CG 5C0XJ 2ZXPA 5ELBA 2UUAQ 2VQEL 4DUZQ 3H3VH 4APVA 2CWAA 2UUBQ 1SFOH 4DV6L 3KUPA 1QG7A 1F9SA 1DCZA 1DM0B 3PF5A 3EA6A 3IRBA 1U4LA 1NCVA 4ZCKA 4F88A 4BY7G 2WAQE 1VQFA 1BNZA 4CGYB 2HQEA 3S1QH 1MJEA 1Y8NB 1EFID 3E9IA 1HNXQ 2O2LD 1PTOC 2PMZE 1Q8KA 3FDTA 2VW9A 3I4NH 2OXPA 4OEMB 2Q2IA 1EZ6A 2CHBD 2J4XA 2NZOA 3OW2A 4LF7Q 1I50B 1EIYB 2F0KA 4GKJL 3TBIB 3TZUA 1S40A 3EFXD 2A19A 2KQ3A 1SYDA 1LTLA 3T51B 3S2DH 4DV1Q 1EY6A 3KBGA 3NP8A 4KHZA 2A6ED 1Y8PB 1F77A 2NUCA 3DXJC 4FNFA 1RJTA 4KD4A 1ASYA 3NSWA 1F2MA 2N8NA 4LUVA 4CDCC 4NP5A 3L9AX 3HOYH 1A2TA 2RSOA 1ML0D 2OWOA 4FO2A 2B29A 2HDLA 3M3YH 4X3UA 2C35B 3TS2A 4H0LC 4IUUA 2QKIC 5M3FG 5DM63 3T1HL 1NR4A 4GLAC 1Z6HA 4OO1G 1TS5A 4KD3A 2NB0A 3KBXA 4HIMA 3A54A 3BVMA 1FD7D 3OIPA 1S72A 1TY0A 4WRDA 1YJNA 5G3LD 3RD4A 4X65Q 1KDAA 2F0WA 2EYHA 3DHQA 5ELNA 2J7ZA 1HA5A 3BYYB 4B08A 4OX9L 2I46A 1VF5C 2JYOA 2JA8B 1SE8A 4R4OA 2R6GA 3Q6SA 5JAVA 5H1SE 4JI1Q 4O1NA 2FINB 1M8AA 1EWCA 1OXTA 3PIP3 4HCEA 1TWGH 3GD7A 5LMNL 2XIWA 2EYFA 1D7QA 2TSSA 3GTOH 3I56A 2JA5B 1SNDA 1GUSA 3J7ZC 3J7A5 3GTGH 5LMNW 1XWEA 3FP9A 4DV4Q 4DXFA 5ELCA 5FO9B 1HFNA 3HFZB 3Q24A 4JI3L 1J8IA 1BO0A 5EPJA 1A2UA 1IZ6A 2BE5D 1EYGA 3UDFA 4C1NI 1SNPA 3D31A 2XVSA 3I2ZA 1WTOA 2D5DA 1N33Q 2VS1A 3NELA 5HGQA 3K8AA 3L3OC 3P75A 2PPBC 4C3JG 3EIVA 1IKLA 4RGMA 5JJLA 1YHQA 1E24A 3W3AA 1SR3A 4BY7B 2KHJA 2IX3A 2Z0SA 2UXBQ 3TRZA 4ME3A 5IYDH 5ISRA 2JSOA 2Q8RE 3C1FA 1B1ZA 2UU9Q 4EGVA 3HP3A 1MKHA 2F3WA 4LF8L 3U4ZA 4DU9A 4NXNQ 1PXUA 2SNMA 1F9PA 1JJ2A 3IL8A 2AHOB 1CT1D 1KLGD 3CQZH 4DNTB 3LGJA 1PFMA 2F0FA 3HOUG 1S3OA 1T5EA 2EXZA 4YWKA 4F87A 2O5IC 2ID0A 2KHSA 4N9TA 1SN8A 3T16A 3VR2A 2Z9HA 3WOEA 4U673 1MBYA 1YI2A 1PRTC 3PUZA 5G3LF 1IL8A 4QL5A 2EE1A 2F0SA 1MD2D 1NSNS 3FKIH 3PSIA 3K57A 3CCMA 1LTTD 1DONA 2B2TC 5KIXA 1VQDA 4X3KA 1LO5D 4ILWA 1EY5A 2HIXA 3V2TA 4EQ5A 5FO8B 4K5XA 5BN5A 2O4XA 3T1YQ 2H4OA 2PCFB 3RZOB 1FGUA 2L1BA 1LTAD 5C5LA 1LT5D 4JI8L 1N32L 4ME5A 4EQOA 2L55A 1O7LA 3R8BA 4B9XA 1UE1A 4R8NA 2PNRC 2KECA 1V1QA 2F0VA 1PH9A 1KNAA 4DAPA 4FF1A 4DAYB 2B2WC 3PUYA 1VQ8A 4FF4A 1C48A 4X66Q 4XQNA 1CKOA 4R4QA 3MXGA 5F2DA 1BCPC 1QCBD 4RA8A 1NUCA 4JK1C 3UDXA 4ZAIA 1SDFA 1SYEA 2NVYB 4ZKBB 2K5QA 1AZQA 4DAVA 3UDGA 1PFSA 3PCOB 5I6WA 2JJQA 4JG2A 4EQPA 1S4ZA 5GADC 1YBYA 2FJ2A 3MEFA 1STAA 3G6EA 2XN9C 2Q2TA 3MTSA 2K33A 1I50H 4L63B 3VR6A 1TWHH 5ELOA 1ZEQX 1Q3LA 1K83B 3I4MG 1EQRA 1G2SA 3M9BA 4C3JB 2PMZB 2AQ2B 2BDNA 1RODA 2V1CC 2AQ1B 4TKOB 2PQEA 3I7FA 3ULJA 4KN7C 3TP6A 4A3GG 5LHY1 1HH2P 3NK9A 2LSSA 5I9OA 4DK0A 1EYAA 3GQBA 1HCZA 3NWTA 4UAIA 1I4PA 3GTMB 4AQYQ 1YNXA 5EPKA 1K8GA 3HS0C 2Q8TA 2VQFL 1YNJC 2EY6A 2R7FA 1E7ZA 1TS2A 3DUZA 2BCOA 2FMCA 4AYBG 1W2BA 1FL0A 5IT9E 1Y1WG 1I4QA 4L5TA 5JVH3 3I55A 4OONA 4PG3A 3NTKA 1TWCB 3HOUB 2UUAL 4YCWA 4DUZL 2R7ZG 1VQGA 1E1TA 2UUBL 5IGCA 1IYVA 2N3SA 4KV6A 2N78A 1SSOA 3P7JA 1H9MA 4A3JG 2K5WA 3E5SA 1WTPA 4DR3L 2K52A 2XWBB 3NPPA 1EEID 1LT6D 1NR2A 1HNXL 1QJOA 1PH8A 4RGTA 1YITA 1CHPD 3BG3A 4FXDA 1RKNA 3FVQA 4DR6Q 2JA5H 2OQKA 4DR1Q 3FMCA 4LF7L 2K4KA 1N8RC 1PLFA 2F52A 3A5UA 1YHAA 3GP7A 3C46A 2CW0D 2F4VQ 4A3LG 1EWHA 4EQNA 4AIMA 3K0YA 4Y7NB 4DV1L 4KJNA 1PTOD 2IPKD 5EQ0A 1WCMB 3MWYW 2EJFC 1STGA 4FP5D 4A3KG 1SNOA 5IP7G 3KJPA 5M5YB 1VQ5A 1HZ9A 3AFPA 2EYOA 4ID6A 3J7YW 4CJ0B 2R93G 1G6PA 1NAPA 1STHA 1R4QB 5BN4A 3K5LA 1JQYD 2K28A 3HOZB 3OMGA 4C3HG 1S5ED 4DR7Q 2NTSA 1B7YB 1ENCA 1CSQA 1QZHA 5I2XA 4BY7H 3S15B 4KTAA 5LL6X 1F9QA 5FO7B 2QGQA 2YV5A 3TQYA 1CTMA 2UXDQ 1SROA 4UDUC 5IGGA 4A93B 1EQVA 3GV3A 3S24A 3CC4A 3CF5A 2IT1A 4IPGA 3MVVA 3BU2A 3HG9A 3M4QA 4X65L 3F2CA 1HUMA 3HRZC 4MTKA 2YTYA 4GOPB 3J7AF 4IJLA 4TQUS 5BN3A 4R8IA 1H9JA 4A3GB 3DM3A 4A3BG 1GOZA 2PZWA 2BA0A 1PHJA 1X55A 5FKAC 3KFUA 1S5BD 4Q5VA 2F0EA 3TMEA 5CV6A 1LT3D 3H15A 3HOWG 3P1HA 1HZBA 4DV4L 4OWWB 2Z6KC 5M3FH 1L0YB 4AYBB 4K5VA 1Y1WB 1PZKD 1B9NA 3M4YA 1SMYC 3BDLA 3K7UC 4R9WA 1J9OA 1N33L 1II3A 1ET9A 5JPNC 1LV9A 3RZOH 3OOCA 3A8IE 2A1AA 1DGSA 4C3IG 2HHHQ 1VCIA 2K14A 3Q8DA 4J8QA 5IT9c 4A3JB 1KHIA 3KDFB 2XWJB 4H7BA 5GROA 3SK5A 2LY7A 2UXBL 2EVBA 3F8TA 1U9RA 1E0BA 1WI5A 3I90A 2VUMG 1EIFA 1PTOF 2UU9L 4A3DG 1OXSC 4IFDG 4BWGB 1KAWA 2P5ZX 2ASBA 1VQLA 1F9RA 3KDFA 1VF7A 1G51A 3RN5A 3ZJYC 2ICEC 4IUVA 3MXUA 1HXYD 1IXRA 1SMXA 4XT1B 2B2YC 2NVYH 5A2QL 3NQIA 2DGYA 1YZ6A 1JB3A 1Q46A 1I6VC 4JOIC 4A3KB 1IBKL 1VQJA 1SE4A 1M1KC 2V4DA 1B50A 3AMUA 2OF1A 3A8KE 1JR0D 1HFGA 1AP0A 4LAAA 4ZKCB 4JI7Q 5AJ3Q 3PO2B 1A3TA 2PW5A 1K83H 2A68D 3ITPA 1B53A 3NWSA 2H1EA 4C3JH 1Q12A 1W6JA 2MO0A 3CU7A 2A8VA 2E74C 2K5NA 3K7AB 3K5NA 4DF7A 4LF4L 5JJIA 4DN4M 1X3QA 1U0LA 1XYIA 3CRKC 4ZLTF 2WB1G 1R4PB 1PTOB 1YJ9A 2LKVA 1NBWA 2JA6G 1M4VA 1SLJA 3D3RA 3GTMH 3PF4A 2F1MA 3T1YL 4WJ4A 3U50C 3D6CA 5C3EG 2JA7B 1H9KA 1JOKA 3TP7A 1C8CA 5IT9L 1ONLA 3VR3A 1O7YA 1PH7A 5JEAJ 1KRSA 2A6HC 4DXGA 3H0GB 5IWAQ 1WVLA 1NMFA 1TWCH 1EYCA 4GLXA 3HOUH 1UAPA 4ODGA 2WV6D 4X66L 1TS3A 4M8AA 2NVTB 1E3PA 1VQPA 2Q8IB 1HNWQ 3RLNA 2TMPA 1R9TB 1L0XB 3OTOQ 3NTHA 4HIKA 2WKCA 3HOWB 3S2HB 4DKAC 3V96A 3SR1A 4B9WA 1LYLA 1EU4A 4DNIA 4RH6A 3KLSX 1NNXA 1CI3M 2N55A 4G7OC 2FFKB 1I6HB 3MC0B 1DD2A 1FNWA 1U4PA 2SNSA 4P73A 1VQHA 1GO3E 4H13C 1RTOA 3CCUA 2F4IA 3D6WA 2LFNA 1X56A 3I4LA 4XDXA 2EYPA 1WTRA 3A55A 2E76C 1STYA 4LF6L 3OMCA 2EXDA 3OIQA 4MTNA 5CV7A 2K01A 4BY1G 3QR8A 4Y7NH 4XYQA 3J80L 1E2VA 1WCMH 4QMGA 2SDFA 1G291 5M5YH 2VUMB 4JBKA 1MSGA 1JJCB 4HSPA 4X62Q 3SXHA 1EU3A 2ALYB 2EJGC 2HT1A 3HOZH 5I6YA 4YHHQ 3F2DA 3ZYYX 3BVZA 3PUWA 4L6TB 1YNNC 1U4MA 3S15H 4A3MG 4A75A 4IO9A 4K2LA 5CV4A 4C2MB 2AWNA 1KLUD 3BDCA 4GZYC 1L1OC 1LTGD 2L11A 4JI0Q 4FF2A 3SE0A 4JW0A 1DJRD 4A93H 1QE6A 3SEBA 1CZGA 4HSVA 3A0JA 4HEDA 3J81i 3TP8A 1OXVA 2F0LA 2RDHA 3S17B 4QQBX 3F2UA 1QWYA 4POGA 4ZYSA 3CP0A 1MJCA 2F0MA 3T13A 1XJVA 1PRTF 1V43A 3PIPA 1WFQA 3OPOA 4A3GH 1DZ1A 1V8QA 1TWHB 4KN4C 3C3LA 5T1IA 4IPDA 2RSNA 1Q81C 2WB1B 1K8AC 2A69C 2L9HA 1SE2A 2JA6B 4DR6L 1O7ZA 4DR1L 5K36G 1QOHA 3K81C 4HMIA 4KI0A 4OO1I 1K0SA 5C3XA 1PV4A 4OIJA 2F4VL 4HCSA 2RVLA 3Q23A 1BOSA 1X3PA 4MN3A 1HR0L 1HTLD 2CQOA 3CMEA 1Y1WH 5JOBA 1LACA 1PDQA 1YVCA 1JCKB 2MP1A 1D8LA 1LTID 1WTXA 4MHEA 1HR0W 3PV0A 1BR9A 2K32A 5L37A 1EOTA 5J39A 3MXNB 1KL9A 5C0XI 1W3SA 2WP8J 4LUOA 4DR7L 3OWFA 4A3JH 4ABNA 1SYBA 3WDNA 4CDFC 2ZTDA 3FPPA 3MXNA 1PRTB 2AQ3B 5FK9C 2XTIA 1HQRD 2UXDL 3VDYA 4DK1A 3CCVA 2NBFA 1OO9B 4HMJA 1U4RA 2K50A 2PI2E 1YIJA 4JVZA 5E4XA 4V190 1A3UA 1VS0A 5C0XG 4QUCA 2KCCA 2B2TA 2EY2A 2UUCQ 4BY1B 4BA2I 5CGKA 1X6OA 4Q0FA 1WTQA 5EGTA 4A3KH 5IP7H 4X3SA 4DUYQ 1UNSA 2R93H 4JI5L 3I3CA 3JC66 2KEDA 4OWTB 3PO2H 1K8MA 2RDFA 1TR5A 3HKZG 4C56C 2PO4A 3EQLC 2RKSA 1TU2B 1BCPB 1EYDA 1SYCA 2IW3A 3K7AH 4L8JA 4PMBA 3OSOA 1F2ZA 4A3MB 4IOCA 1RIPA 4GN4B 4NKLA 1Z47A 1PTOH 4CKBA 2HDMA 4NPSA 3E0EA 4P74A 3TP5A 5LMUL 5JJZA 2QA4A 1FJGQ 1F2LA 2JEAI 2NZHA 1J6QA 2JA7H 4H44C 2HHHL 5IE8A 4DV2Q 4BXXH 1DOKA 1CKNB 4JI4Q 1ENAA 1ESFA 1STNA 1TQOA 3H0GH 3D0FA 2R61A 3TZDA 1RD9D 4A3BH 5KGUA 4KK7A 3UDIA 3ERSX 1CFMA 1DOMA 3AYHB 5IP9G 2NVTH 4WFN3 4ZRZA 1K3BC 1U5KA 1CKNA 2YU9B 1EEFD 1SJHD 1Y1VG 2ZM6Q 4RMFA 1R9TH 3GTJB 4V0BA 3W1GA 3HOWH 2AMCB 3S2HH 2KVMA 3HEJA 4FDBA 2PYKA 5A35A 3ERQA 4PMWA 4AYBE 2CWPA 1TVXA 2R92G 2JE6I 5IGEA 1I6HH 5CV8A 1KIXA 1D1IA 1K73C 1TY2A 1I4XA 3I8ZA 3J81c 2LMCB 4JI7L 5AJ3L 5M3FB 4TRDA 2A74C 2G9HD 3G48A 5DLQE 1FR3A 2VZAA 2F0TA 2RHQB 3QJYA 2KA7A 3UI2A 4HJ9A 4B3RQ 4QF4A 2F3VA 5FLMG 3OHXC 1JWMD 1CQFA 1A8VA 1N36Q 2VUMH 1YEZA 4CJ1B 4A3DH 3AB9A 4IFDH 2K03A 1XTDA 4DV0Q 2IX0A 1BXTA 1T9HA 3WWVA 1E2ZA 2QDLA 4HJ8A 5DEHA 1JE5A 3URYA 1HTPA 5D14A 2DY7A 3ICEA 3J7AV 3L2PA 3TN2A 2YTXA 4KY6A 2NWGA 4C2MH 5D3DA 2SEBD 3E9HA 3KLSA 3MAQA 3LX0A 5IWAL 1CA6A 3GTPH 3BVGA 1IW7C 1VQAA 4RAUC 1VDZA 4MIUA 4DAYA 3ER0A 1C0AA 1PYWD 1H95A 4J15A 1ICWA 5LL6S 1GUGA 3HKZB 4L5SA 1HNWL 2L15A 4K2KA 3S17H 3OTOL 3T56B 2KCTA 3RMHA 2MJ8A 1CM9A 1S5CD 5M3MG 1PA6A 3HOVG 3LWEA 1K8OA 4K5WA 1ZYRD 4YIJA 3BJUA 2JA6H 4UPAA 3TSSA 1H9RA 1X65A 2K05A 3R93A 2AUJD 3RLOA 3IFDA 5IYBG 2HCIA 1I94Q 3A7AB 1A63A 1ILPA 1TXYA 2AWOA 1X32A 2ZTEA 1BBXC 3CCRA 1TKWB 4FVMA 5JJKA 3CC2A 2BOSA 4PMCA 4S3SA 4MNOA 2D2CC 4P2CB 4B3MQ 5C4HA 3PGZA 2F0QA 3GTKB 3DMUA 1LT4D 1RDPD 1L2FA 1Q8IA 2YTVA 3N52A 1Y1VB 4YHHL 3IKJA 2RBMA 3CHBD 3S14B 3STBC 3PMFA 2F3IA 3J81j 1V1OA 2D0PA 2IX1A 3TS0A 2R92B 4JI0L 1QVFA 4GN3B 3SK8A 2X69A 1XMQQ 1CA5A 1JWSD 3I70A 1QUQB 3CPFA 5E4WC 1O80A 1CUKA 5DM73 1GHKA 2Z6KA 2MQHA 2GVBA 3D4RA 4BY1H 1EQQA 4IURA 1QUQA 4BBSG 4O42A 2WINB 3ULPA 3GO5A 4E6IA 1A0IA 4RGOS 2MHVA 3TDQA 2A6EC 1I4GA 1SNMA 4LF9Q 4FXGC 2H5XA 3F2BA 2JP1A 1AE2A 1SJED 2PI2A 3RLFA 4UY8C 1X9NA 4DV5Q 4RCNA 4J6HA 4A3CH 1VQ7A 4A3MH 1CK1A 1SE3A 3QIAA 3M7GA 2X6LA 4H02A 3BZKA 1B3AA 1MGSA 5M5XB 4N9PA 1BDOA 5C4JB 3H6MA 1RL2A 2Y0SG 4KJOA 4OL7A 4UP9A 2RQXA 4K14A 4KLKA 4RFBA 2E2DC 1UUPA 4JOIA 4R4IA 2EZVA 2I5MX 3TEHB 2CCZA 1GM5A 1XXGA 3C1EA 2AUKA 1I3QH 5EKLA 4G7ZC 5I4DA 2IHEA 2EY1A 3TREA 1EY7A 3I4MB 4ALPA 2OTJA 2WB1E 5D65A 5K36H 2YU9H 2EIFA 5KNDA 1P16A 3GTJH 4JI1L 4B3SQ 1PYSB 4IPHA 5IOCA 2C9OA 4PZ8A 2UUCL 1HUNA 3K5MA 4GOPA 1GXDC 4OX9Q 1C7YA 2KOLA 3AEVA 2L12A 2K5VA 3KF6B 3A74A 5I2YA 1VQ4A 5IYDG 3KLRA 3HKSA 3L7ZC 3NHHA 1HA6A 4WORA 1HJPA 2BE5C 5LMNQ 1PZID 4JBJA 1B8AA 2SOBA 4OO1H 3KF6A 3BDOA 4DR5Q 1Q7YC 2DY8A 2NZ1D 1WYDA 4IFDI 1E1OA 3SK6A 3S1NB 1EY4A 4DGZA 1NE3A 1GUWA 1KC8C 3A7LA 2HCCA 3PIO3 2PZTA 1UE7A 2R7ZB 3I72A 3EBEA 1IBLQ 2RCFA 4P72A 5KRUA 1QNKA 2K5HA 2B2VC 3I73A 1ZXTA 1PFBA 5C0XH 2MUYA 2LXKA 1XNRQ 4DV2L 2QF7A 4C1NK 5C44G 4ZQ3A 3KF8B 3H09A 4JI4L 1G6ZA 4BBSB 4LUZA 4QUFA 4JI2Q 4DR2Q 1X54A 4DPGA 1CSPA 3FKIG 3L0OA 1OXXK 4NXNL 5CR3A 1AEXA 4LK1C 3DWQA 3GTQB 1ESRA 4I7ZC 3KF8A 3EROA 4QB4A 3RZDB 2PZUA 2OT2A 2ZM6L 1KABA 1X3EA 4JI6Q 1K0RA 1XTCD 1XX8A 1PMRA 1SYFA 1QB5D 3QB3A 4Y52H 1B9MA 2R93B 1YJWA 1MIUA 1Q1BA 2MFIA 2DJFC 5FLXE 1L1OB 1DYQA 1JOOA 1FNUA 4C3HB 2VB2X 1MHWC 5BR8Q 4LFAQ 3CPWA 4PZ6A 2Y0SB 4IUNA 5C3WA 2EJMA 5EKIA 1L1OA 1Y8OB 1HHVA 4IJHA 1KNEA 3MA2B 2NN6G 1ZKOA 3H3VC 1N36L 1LTBD 4IPCA 5TSSA 3PUXA 2IWHA 2EPBA 2E8GA 1GKHA 2M9VA 2KENA 1OXUA 1PRTD 3GTKH 2ZJRA 1BQQT 4KY5A 4HR7B 1C4QA 2EOTA 2MGSA 4OXPA 3E6ZX 1EY9A 1HNZQ 1Y1VH 4LF5Q 3ULLA 3S14H 1GUTA 1Q90A 1OTCA 2L0CA 3PQIA 4A3BB 1SYGA 2L4NA 4OGQC 2E2JB 1B4OA 4JPBW 3OYYA 1N32Q 1VQBA 2R92H 5CV5A 5C4XG 1B2TA 3S1MB 2I5LX 1NY4A 1WD0A 1BUVT 1PH4A 4ZK9B 2JEBI 1LLRD 1FGBD 2RA4A 2IHFA 5E3FA 1UE5A 4PNYA 1N34Q 5T1GA 2BH8A 5C4ZA 1JWUD 1WOCA 2K04A 4KKSA 4RCOA 3ND8A 5FLMH 1BCPD 2M00A 1VQEA 4XTCS 2EY5A 2OTLA 4HIDA 2IJ0A 1GUOA 3U58A 2B63G 4C3IB 4N8FA 1CQVA 2YYZA 1UEAB 1G2TA 4IUTA 4XQJA 4R4TA 5ELEA 4IN3A 4DV3Q 3NBHB 1EUJA 2B2UC 3SHLA 2O5JC 1I94L 2KUMA 2NYZD 2Z4HA 2GVAA 2QEJC 4PZ7A 3VYUA 4A3DB 5C44B 3SGIA 1TS4A 1KRTA 4XT3B 2F0UA 2JA8G 3T53B 2XSCA 4JV5Q 4AQYL 3NBHA 5J1ZA 3BS1A 4B3ML 2ZJPA 1TIID 5M5XH 4GKKQ 5C4JH 3RUZA 4UHVA 2JA5G 3HKZE 2ZT9C 1XPOA 3KJOA 3F1ZA 5KYLA 3GTPB 2Q2HA 2B8FA 2VB3X 3SVMA 4LFCQ 2RHSB 4TVAB 2VL6A 3HOVH 1YNJD 2DUDA 3O13A 1PH3A 3I4MH 1AH9A 4KMUC 1XMQL 2K7VA 4PQXA 5JEAG 3RR5A 3X3NA 1EQTA 4A3FG 4HJ5A 3STBD 3KOJA 3D8GA 3GV6A 2KCMA 5IYBH 4MZ9A 4OELB 3K6OA 2QEXA 3CCSA 1A62A 2B39A 2FMMA 1IHZA 3CW2C 4IZ8A 5FLXc 4LMQD 2CW0C 1XPUA 5CMDA 4KKUA 4F8MA 4DR3Q 3J81E 3C2PA 1KQSA 2K5DA 5CV9A 2CH4A 1K28A 5C3EB 5CBAE 3W2DA 4LF9L 3IAYA 1ILQA 3R2TA 2WFWA 1C9OA 2HD3A 1GJXA 2HUGA 4YCUA 4XYOA 2DJGC 2NVQB 2L5TA 1GUNA 2F0HA 1UEBA 4UP7A 4DV5L 3S1NH 1H9SB 1EY8A 4XXEA 2R7ZH 2I0QA 1D5XC 3K5OA 2EDGA 2ZJQA 3U4VA 4A3IG 5C4XB 1STBA 2UXCQ 1BCPF 4BBRG 1WTVA 3NBIA 1WJJA 4K8IA 1H9SA 3QOJA 5IIFA 4A4IA 4CBVA 3SDZA 3W5OA 3EJIA 4NDXA 3FRPB 3ND9A 1VQCA 3K0XA 2K1BA 3T4AC 5CBEE 4DV7Q 3CCEA 4BBSH 3CRLC 1XMOQ 3K58A 1M90C 4N8X1 2B63B 3GTQH 4A3LH 4IALA 5J3BA 3NENA 4GNXC 4BS9A 3RZDH 4A3EG 4AH6A 5ELDA 2E2HB 4B3SL 3QWNA 5D3IB 1IL2A 5FLXL 2LS01 4DFAA 4B3TQ 4K0KQ 2RF4A 2QCPX 1SNCA 4L5QA 3M4OH 2IL8A 3DLLA 3G4SA 5IY0A 4KHVA 2ZTCA 3D4DA 4WJWA 4C3HH 1LM0A 4JYAQ 4DR4Q 5M5WB 2XRSD 1VQNA 2R7DA 4A76A 1PFNA 1RCVD 3DWPA 2Q2UA 1D6EC 2B2WA 1KXLA 1CHQD 4DR5L 4LFBQ 3LNNA 3VA5A 4EVOA 5C5MA 1TT2A 2E5LQ 3VR4A 1AW7A 4YWMA 5GAGC 1IBLL 1E2WA 2Z4IA 2KJXA 1GD7A 1VQOA 4A3FB 4QIWB 1LTRD 3M85A 1SMYD 1I3QB 2WAQG 5JPMC 4NMZA 1XNRL 2NVXB 2GN5A 1UWVA 1CZWA 2JXMB 2MPMA 2E75C 2E2JH 1P8LA 1KDCA 2M2LA 2DNEA 4DR2L 4JI2L 2G9DA 1UE6A 4DK6C 2WACA 2ICIA 3HZXA 2VY3A 3S1MH 1AFPA 3R2IA 5FJ8G 3PO3G 4HJAA 3MEHA 4LWCA 2OEOA 3HOXG 3MFYA 2JN4A 5HURA 4JI6L 4POFA 4RGNA 5AFWA 2A68C 3IFTA 4K8JA 1Q82C 4PV1C 1I4HA 4IUQA 2PNHA 1PYBA 3OW7A 2CVRA 4C3IH 4A3IB 2LXJA 1IBKQ 3CMAA 4JBMA 1LUZA 1VQKA 4BBRB 4O0AA 5BR8L 4LFAL 1KTKA 1BBUA 1JE4A 4JBWA 3K80C 1IBMQ 2KHIA 4WJ3M 3K59A 4OWXB 5C44H 1EIHA 2DN8A 4NXMQ 2Z8LA 1S5FD 4J1MA 5KEEA 1I5FA 4LF4Q 4QY7A 3VYSA 4X3TA 3ONAB 4LW1A 2I07B 1NJIC 1TWAH 1MI2A 4XQQA 5M9OA 1J5EQ 2WKDA 1JORA 4IUPA 4CDEC 3SK4A 1HNZL 3EN2A 4DNRB 4M1UB 4A3EB 4LF5L 3KK7A 5KNBA 2VNUD 1RF2D 5HGTA 1B44D 4P71A 1SAPA 3H3VI 1WCMG 4CKEA 1BVSA 1VMPA 2EYJA 5IYCG 3E3XA 2A6HD 4F7XA 5E7NA 4NB3A 4CDDC 5IODA 4LJZC 2X6GA 4X64Q 2Y0SE 1N34L 3HOZG 4RWSC 1V1PB 1Y14B 3J81L 2NN6H 4GLVB 2F0IA 5KYIA 5JVG3 4IOAA 3BZCA 5GQOA 3WOFA 3CKIB 5C3EH 1JMCA 5CORA 2CKZB 4A93G 1B3QA 1V1PA 5A2QE 3CCLA 2PW7A 1X3FA 3QOLA 2JK8A 3NUCA 1L0WA 3VR5A 2ZXOA 4DV3L 5IGFA 1VQMA 2WAQB 2NVQH 5EBDA 1EZ8A 4LF6Q 1D1KA 1SXTA 1F2YA 4R4CA 3I4NG 2N49A 4X62L 3S1RB 4HAEA 4JV5L 5C4XH 4KHPQ 3S16B 2E2IB 3MFGA 5DNFA 1TWFB 3DEPA 4DK3C 1VQ9A 3PO3B 1XNQQ 2XNAC 3CCJA 4GKKL 1GVPA 5GAHC 3JAMi 2A73B 4YY3Q 3HOXB 2G5DA 1T5XD 1QILA 3UE1A 1PVOA 5GAEC 2F0DA 4LFCL 2AKWB 1QVGA 4NW2A 2VQEQ 3VA7A 2B63H 1ASZA 3HOYG 4DA2A 5IGDA 1YNND 4DV6Q 4K6DA 1LTSD 1EIGA 4I7AA 3I4OA 3VYRA 2PQAB 4QJFA 1AZPA 2OCEA 3JAME 4GS3A 1SRUA 2XRQD 2E2HH 3G7LA 4RKLA 3U9SA 1Y69U 1RTNA 3U9OA 1JT8A 4G7HC 3H94A 2KBNA 2B3GA 5FOBB 3N6RA 1EFWA 2PQAA 4FXKC 2JA8H 1O78A 1STEA 3CXCA 3DM1A 3J80i 2B8GA 3FEWX 3PUVA 5K5PA 5M5WH 4GKJQ 2B2VA 1NMGA 1KAAA 3NTIA 2DNCA 3NE5B 2A69D 3PIOA 1BBWA 2FHTA 3RNUA 2F0JA 4ZUIA 1PH1A 1HR0Q 2CQAA 1A6XA 2UXCL 2B2YA 3E0JA 3J80E 3LWUA 4HN7A 2BH2A 3V05A 5JEAH 5HY6A 3GTLB 4A3FH 1WD1A 1JJGA 5M3MB 2ES2A 3T1HQ 3PO2G 4IFDJ 2RCNA 3HOVB 1A15A 3Q22A 2NVXH 2D0OA 1DOLA 1RHPA 2CFMA 3M4PA 5J22A 4DV7L 2D62A 1PH5A 1VQ6A 5CC4A 2BA1A 1XMOL 2WIIB 2F0OA 4L5RC 4XIGS 4QGUA 1VMCA 1GHJA 1SFOB 1VQIA 5CYUA 1HZCA 2ZXRA 3G6JB 4KKTA 1E22A 2EYLA 1KDBA 1JICA 1Q1EA 2F0PA 1K9MC 2K75A 4UP8A 5EKKA 1G91A 1IYJB 3S1QB 4DUYL 1CKMA 2JA7G 4B3TL 4K0KL 4BXXG 2C5CA 3I4NB 2QILA 3H91A 4RG1A 4FYDA 1BF4A 4A3IH 3H0GG 4ULLA 2ATWA 4IQZA 4JYAL 2F0NA 4RHRA 4DR4L 4BBRH 3GDEA 4X6AH 4JI5Q 4EX5A 1QZGA 3MZ5A 3BYTB 3S2DB 1Z7TA 4ZUJA 4JI3Q 3MHBA 2QDBA 1HZAA 4LFBL 1LABA 3Q0AA 3OWEB 2K6AA 5IGBA 4OHJA 3QO2A 2I5HA 3CAMA 2E5LL 3KLWA 3BZDB 1FJGL 3HOYB 1Q86C 3A56A 4I65A 3M3YB 1AE3A 4A3EH 1KD1C 1B70B 2VXWA 5LMUQ 4FF3A 2KEEA 2NTTA 1JC7A 1NTGA 2GA4B 4U68A 1S5DD 5EJWA 4O2DA 3HGBA 1D5MC 5DAUA 2EYMA 4LF8Q 2A5HA 4P75A 3CD6A 3JAMc 2OQ0A 2B2UA 2NN6I 3EVQA 2FXQA 4HTHA 4K6LA 3MXPA 2Z1CA 3M4OB 3RN2A 2MO1A 1EY0A 2F0GA 2N88A 1D5ZC 1SBBB 2XGTA 1ET6A 1TWGB 3GTOB 4QCLA 1V9PA 3NEMA 1O7IA 3GTGB 1QVCA 2Z6BA 4B3RL 4QIWE 5KNCA 2JA9A 1IBML 1DXMA 4CJ2C 5IP9H 4NXML 1FNVA 4JC0A 4DV0L 3S1RH 1Z9FA 1JOQA 3J80c 3S16H 1D2BA 2E2IH 3CC7A 1HQMC 5E1FA 1TWFH 3I91A 4HIOA 3M7NA 5FJ8H 3PO3H 4GOPC 2IY5B 1WTWA 1J5EL 1G8ZD 3HOXH 4JI8Q 2EQSA 5EBCA 1W6KA 3A8JE 3B6YA 4CKCA 4CHTB 3A5ZB 4YWLA 5NUCA 4R1JA 3NQTA 1EOVA 3KYHC 1PH2A 1HRJA 5EPLA 4OIKA 2RDGA 3JAML 5I9PA 2MNAA 1PZJD 2R3ZA 3AFQA 3CCQA 1A3VA 1HPCA 1EWIA 4LNQA 1ZYRC 1QNUA 1IW7D 4X64L 4TSSA 3VYTA 3G71A 4RHSA 3CQZB 5EAYA 1EL0A 2J0TD 1ICFB 2HIVA 3P20A 2JQOA 5ELFA 2QW7A 3S9WA 4JCVE 1SNQA 1I4RA 2HQLA 4DAMA 4G4KA 3FHWA 1BKBA 1ENFA 4G57A 5COYA 4GN5A 3QG1A 1K3RA 2D9UA 1JB7A 3W1BA 2F03A 3DEOA 4GNXB 3R3OA 1N9WA 3FKIB 4RKBA 1FYCA 3AQQA 4Z9CB 1MSHA 3FPUB
chains in the Genus database with same CATH topology
1SEBD 1TWAB 1IKMA 1IYUA 3D4WA 3NXWA 4BA1I 5C6AA 3X3MA 2ENBA 2KCNA 2BDOA 3DWAA 3AU7A 4KY7A 1AN8A 5C0XJ 2ZXPA 5ELBA 3KUPA 1QG7A 1F9SA 1DCZA 1DM0B 3EA6A 1U4LA 1NCVA 4F88A 1BNZA 4CGYB 2HQEA 1Y8NB 1EFID 2O2LD 1PTOC 3FDTA 2OXPA 1EZ6A 2CHBD 2J4XA 1I50B 2F0KA 3TBIB 3TZUA 3EFXD 2KQ3A 1SYDA 3T51B 1EY6A 3KBGA 3NP8A 4KHZA 2A6ED 1Y8PB 1F77A 2NUCA 3DXJC 4FNFA 1RJTA 4KD4A 3NSWA 1F2MA 4NP5A 3L9AX 1A2TA 2RSOA 1ML0D 4FO2A 2HDLA 4X3UA 4H0LC 4IUUA 2QKIC 5DM63 1NR4A 1Z6HA 4OO1G 1TS5A 4KD3A 2NB0A 3KBXA 3A54A 3BVMA 1FD7D 3OIPA 1TY0A 4WRDA 5G3LD 3RD4A 1KDAA 2F0WA 2EYHA 3DHQA 2J7ZA 1HA5A 3BYYB 4B08A 2I46A 1VF5C 2JYOA 2JA8B 2R6GA 3Q6SA 5JAVA 4O1NA 2FINB 1M8AA 1EWCA 1OXTA 3PIP3 4HCEA 3GD7A 2XIWA 2EYFA 2TSSA 2JA5B 1SNDA 1GUSA 1XWEA 4DXFA 5ELCA 5FO9B 1HFNA 3Q24A 1J8IA 1BO0A 5EPJA 1A2UA 2BE5D 4C1NI 1SNPA 3D31A 2XVSA 1WTOA 2D5DA 3L3OC 3P75A 2PPBC 4C3JG 1IKLA 4RGMA 3W3AA 4BY7B 2IX3A 5ISRA 2JSOA 2Q8RE 3C1FA 1B1ZA 4EGVA 3HP3A 2F3WA 4DU9A 1PXUA 2SNMA 1F9PA 3IL8A 1CT1D 1KLGD 4DNTB 1PFMA 2F0FA 1T5EA 2EXZA 4F87A 2O5IC 2ID0A 2KHSA 4N9TA 3T16A 3VR2A 3WOEA 4U673 1MBYA 1PRTC 3PUZA 5G3LF 1IL8A 2EE1A 2F0SA 1MD2D 1NSNS 3K57A 1LTTD 1DONA 2B2TC 5KIXA 4X3KA 1LO5D 4ILWA 1EY5A 3V2TA 5FO8B 4K5XA 5BN5A 2O4XA 2H4OA 2PCFB 3RZOB 2L1BA 1LTAD 5C5LA 1LT5D 4ME5A 4EQOA 2L55A 1O7LA 3R8BA 4B9XA 4R8NA 2PNRC 2KECA 4FF1A 2F0VA 1KNAA 4DAPA 2B2WC 3PUYA 4FF4A 1C48A 4XQNA 5F2DA 3MXGA 1BCPC 1QCBD 4RA8A 1NUCA 4JK1C 4ZAIA 1SDFA 1SYEA 2NVYB 4ZKBB 2K5QA 1AZQA 4DAVA 5I6WA 4EQPA 1S4ZA 2FJ2A 1STAA 2XN9C 3MTSA 2K33A 4L63B 3VR6A 1ZEQX 1Q3LA 1K83B 1G2SA 4C3JB 2PMZB 2AQ2B 2BDNA 1RODA 2AQ1B 4TKOB 2PQEA 4KN7C 3TP6A 5LHY1 3NK9A 5I9OA 4DK0A 1EYAA 3GQBA 1HCZA 3NWTA 4UAIA 1I4PA 3GTMB 5EPKA 3HS0C 2Q8TA 1YNJC 2EY6A 1TS2A 3DUZA 2BCOA 2FMCA 5IT9E 1I4QA 5JVH3 3NTKA 1TWCB 3HOUB 5IGCA 1IYVA 4KV6A 1SSOA 3P7JA 1H9MA 2K5WA 3E5SA 1WTPA 2XWBB 3NPPA 1EEID 1LT6D 1NR2A 1QJOA 4RGTA 1CHPD 3BG3A 4FXDA 1RKNA 3FVQA 3FMCA 1PLFA 3GP7A 3C46A 2CW0D 1EWHA 4EQNA 3K0YA 4Y7NB 4KJNA 1PTOD 2IPKD 5EQ0A 1WCMB 3MWYW 2EJFC 1STGA 4FP5D 1SNOA 5M5YB 2EYOA 4ID6A 3J7YW 4CJ0B 1NAPA 1STHA 1R4QB 5BN4A 3K5LA 1JQYD 2K28A 3HOZB 3OMGA 4C3HG 1S5ED 2NTSA 1ENCA 3S15B 5I2XA 4KTAA 5LL6X 1F9QA 5FO7B 1CTMA 4UDUC 5IGGA 4A93B 1EQVA 3GV3A 2IT1A 3MVVA 3HG9A 1HUMA 3HRZC 3J7AF 4TQUS 5BN3A 4R8IA 1H9JA 4A3GB 1GOZA 2PZWA 2BA0A 5FKAC 1S5BD 4Q5VA 2F0EA 3TMEA 5CV6A 1LT3D 3P1HA 1L0YB 4AYBB 4K5VA 1Y1WB 1PZKD 1B9NA 3M4YA 1SMYC 3BDLA 4R9WA 1J9OA 1II3A 1ET9A 5JPNC 1LV9A 3OOCA 3A8IE 4C3IG 1VCIA 4J8QA 4A3JB 2XWJB 4H7BA 3SK5A 2LY7A 2EVBA 1U9RA 1E0BA 3I90A 1PTOF 1OXSC 4IFDG 4BWGB 1F9RA 1VF7A 2ICEC 4IUVA 3MXUA 1HXYD 4XT1B 2B2YC 5A2QL 3NQIA 1JB3A 1I6VC 4A3KB 1SE4A 2V4DA 1B50A 3AMUA 2OF1A 3A8KE 1JR0D 1HFGA 1AP0A 4LAAA 4ZKCB 3PO2B 1A3TA 2PW5A 2A68D 3ITPA 1B53A 3NWSA 2H1EA 1Q12A 1W6JA 3CU7A 2E74C 3K7AB 3K5NA 4DF7A 4DN4M 1X3QA 1XYIA 3CRKC 4ZLTF 1R4PB 1PTOB 2LKVA 1M4VA 3D3RA 2F1MA 3D6CA 2JA7B 1H9KA 1JOKA 3TP7A 1C8CA 5IT9L 1ONLA 3VR3A 1O7YA 5JEAJ 2A6HC 4DXGA 3H0GB 1WVLA 1EYCA 1UAPA 4ODGA 2WV6D 1TS3A 4M8AA 2NVTB 2Q8IB 2TMPA 1R9TB 1L0XB 3NTHA 2WKCA 3HOWB 3S2HB 3V96A 3SR1A 4B9WA 1EU4A 4RH6A 3KLSX 1CI3M 2N55A 4G7OC 2FFKB 1I6HB 3MC0B 1DD2A 1FNWA 1U4PA 2SNSA 4H13C 1RTOA 2F4IA 3D6WA 2LFNA 3I4LA 4XDXA 2EYPA 1WTRA 3A55A 2E76C 1STYA 3OMCA 3OIQA 3J80L 5CV7A 2K01A 4XYQA 1E2VA 4QMGA 2SDFA 1G291 2VUMB 1MSGA 4HSPA 3SXHA 1EU3A 2EJGC 5I6YA 3ZYYX 3BVZA 3PUWA 4L6TB 1YNNC 1U4MA 4K2LA 5CV4A 4C2MB 2AWNA 1KLUD 3BDCA 4GZYC 1LTGD 2L11A 4FF2A 3SE0A 1DJRD 1QE6A 3SEBA 1CZGA 4HSVA 4HEDA 3TP8A 1OXVA 2F0LA 2RDHA 3S17B 3F2UA 1QWYA 4ZYSA 2F0MA 3T13A 1PRTF 1V43A 3OPOA 1DZ1A 1V8QA 1TWHB 4KN4C 3C3LA 5T1IA 2RSNA 2WB1B 2A69C 2L9HA 1SE2A 2JA6B 1O7ZA 5K36G 1QOHA 4HMIA 4KI0A 4OO1I 5C3XA 4OIJA 4HCSA 2RVLA 3Q23A 1BOSA 1X3PA 4MN3A 1HTLD 5JOBA 1LACA 1PDQA 1JCKB 2MP1A 1LTID 1WTXA 4MHEA 3PV0A 1BR9A 2K32A 5J39A 1EOTA 5C0XI 2WP8J 3OWFA 4ABNA 1SYBA 3WDNA 3FPPA 3MXNA 1PRTB 2AQ3B 5FK9C 1HQRD 4DK1A 2NBFA 1OO9B 4HMJA 1U4RA 5E4XA 4V190 1A3UA 5C0XG 4QUCA 2KCCA 2B2TA 2EY2A 4BY1B 4BA2I 5CGKA 4Q0FA 1WTQA 5EGTA 4X3SA 1UNSA 3I3CA 2KEDA 1K8MA 2RDFA 1TR5A 4C56C 2PO4A 3EQLC 1TU2B 2RKSA 1BCPB 1EYDA 1SYCA 2IW3A 4L8JA 4PMBA 3OSOA 1F2ZA 4A3MB 4NKLA 1Z47A 1PTOH 4CKBA 2HDMA 3TP5A 5JJZA 1F2LA 2JEAI 4H44C 1DOKA 1ENAA 1ESFA 1STNA 1TQOA 3TZDA 2R61A 1RD9D 5KGUA 4KK7A 1CFMA 1DOMA 4WFN3 4ZRZA 2YU9B 1SJHD 1EEFD 3GTJB 4V0BA 2KVMA 3HEJA 2PYKA 5A35A 3ERQA 4PMWA 1TVXA 2JE6I 5IGEA 5CV8A 1D1IA 1TY2A 1I4XA 3I8ZA 2LMCB 5M3FB 4TRDA 2A74C 2G9HD 1FR3A 2F0TA 3QJYA 3UI2A 2KA7A 4QF4A 2F3VA 1JWMD 1CQFA 3OHXC 4CJ1B 3AB9A 4IFDH 2K03A 2IX0A 1BXTA 1E2ZA 5DEHA 3URYA 1HTPA 5D14A 2DY7A 3J7AV 3TN2A 4KY6A 2NWGA 5D3DA 2SEBD 3KLSA 3MAQA 3LX0A 1CA6A 3BVGA 1IW7C 4RAUC 1VDZA 4MIUA 4DAYA 1PYWD 1ICWA 5LL6S 1GUGA 3HKZB 4K2KA 3T56B 3RMHA 2MJ8A 1CM9A 1S5CD 3LWEA 1K8OA 4K5WA 1ZYRD 4YIJA 3TSSA 1H9RA 2K05A 3R93A 2AUJD 3IFDA 2HCIA 3A7AB 1ILPA 2AWOA 1X32A 1BBXC 1TKWB 4FVMA 2BOSA 4PMCA 4S3SA 2D2CC 4P2CB 5C4HA 2F0QA 3GTKB 3DMUA 1LT4D 1RDPD 1Q8IA 3N52A 1Y1VB 3IKJA 2RBMA 3CHBD 3S14B 3PMFA 1V1OA 2IX1A 2R92B 3SK8A 2X69A 1CA5A 1JWSD 3I70A 5E4WC 1O80A 5DM73 1GHKA 3D4RA 4IURA 4O42A 2WINB 3GO5A 4E6IA 4RGOS 2MHVA 3TDQA 2A6EC 1I4GA 1SNMA 4FXGC 2JP1A 1SJED 3RLFA 4RCNA 4J6HA 1CK1A 1SE3A 3QIAA 3M7GA 2X6LA 1B3AA 1MGSA 5M5XB 4N9PA 1BDOA 5C4JB 3H6MA 4KJOA 4OL7A 2RQXA 4K14A 4RFBA 2E2DC 1UUPA 2EZVA 1XXGA 3C1EA 2AUKA 5EKLA 4G7ZC 5I4DA 2EY1A 1EY7A 3I4MB 5D65A 5K36H 5KNDA 5IOCA 2C9OA 1HUNA 3K5MA 1GXDC 2KOLA 2L12A 5I2YA 3KLRA 3L7ZC 3NHHA 1HA6A 4WORA 2BE5C 1PZID 2SOBA 4OO1H 3BDOA 2DY8A 2NZ1D 4IFDI 3SK6A 3S1NB 1EY4A 4DGZA 1GUWA 3A7LA 2HCCA 3PIO3 2PZTA 2R7ZB 3I72A 5KRUA 1QNKA 2B2VC 3I73A 1ZXTA 1PFBA 5C0XH 2MUYA 2QF7A 4C1NK 4ZQ3A 3H09A 1G6ZA 4BBSB 4QUFA 1OXXK 5CR3A 1AEXA 4LK1C 3DWQA 3GTQB 1ESRA 4I7ZC 3KF8A 3EROA 4QB4A 3RZDB 2PZUA 2OT2A 1KABA 1XTCD 1XX8A 1PMRA 1SYFA 1QB5D 3QB3A 1B9MA 2R93B 1Q1BA 5FLXE 1DYQA 1JOOA 1FNUA 4C3HB 2VB2X 2Y0SB 4IUNA 5C3WA 2EJMA 5EKIA 1Y8OB 1HHVA 1KNEA 3MA2B 2NN6G 1ZKOA 3H3VC 1LTBD 5TSSA 3PUXA 2IWHA 2EPBA 2M9VA 1OXUA 1PRTD 1BQQT 4KY5A 4HR7B 1C4QA 2EOTA 2MGSA 3E6ZX 1EY9A 1GUTA 1Q90A 2L0CA 4A3BB 1SYGA 2L4NA 4OGQC 2E2JB 1B4OA 5CV5A 1B2TA 3S1MB 1WD0A 1BUVT 4ZK9B 2JEBI 1LLRD 1FGBD 2RA4A 5E3FA 4PNYA 5T1GA 5C4ZA 1JWUD 2K04A 4KKSA 4RCOA 3ND8A 1BCPD 2M00A 4XTCS 2EY5A 2IJ0A 1GUOA 4C3IB 1CQVA 2YYZA 1UEAB 1G2TA 4IUTA 4XQJA 5ELEA 4IN3A 2B2UC 3SHLA 2O5JC 2KUMA 2NYZD 2Z4HA 2QEJC 3VYUA 4A3DB 5C44B 1TS4A 4XT3B 2F0UA 3T53B 2XSCA 3NBHA 5J1ZA 3BS1A 1TIID 3RUZA 2ZT9C 5KYLA 3GTPB 2B8FA 2VB3X 3SVMA 1YNJD 3O13A 4KMUC 2K7VA 4PQXA 5JEAG 3X3NA 1EQTA 3D8GA 3GV6A 3K6OA 2B39A 2FMMA 1IHZA 4IZ8A 4LMQD 2CW0C 5CMDA 4KKUA 4F8MA 3J81E 3C2PA 2K5DA 5CV9A 5C3EB 5CBAE 3W2DA 3IAYA 1ILQA 3R2TA 1GJXA 2HUGA 4XYOA 2NVQB 2L5TA 1GUNA 2F0HA 1H9SB 1EY8A 4XXEA 1D5XC 3K5OA 2EDGA 5C4XB 1STBA 1BCPF 1WTVA 3NBIA 4K8IA 1H9SA 3QOJA 5IIFA 4CBVA 3SDZA 3EJIA 4NDXA 3FRPB 3ND9A 2K1BA 3T4AC 5CBEE 3CRLC 3K58A 2B63B 4IALA 4BS9A 5ELDA 2E2HB 3QWNA 5D3IB 5FLXL 2LS01 4DFAA 2QCPX 1SNCA 2IL8A 4KHVA 3D4DA 4WJWA 5M5WB 2XRSD 1PFNA 1RCVD 3DWPA 1D6EC 2B2WA 1CHQD 3LNNA 3VA5A 4EVOA 5C5MA 1TT2A 3VR4A 1AW7A 1E2WA 2Z4IA 2KJXA 4A3FB 4QIWB 1LTRD 3M85A 1SMYD 1I3QB 5JPMC 4NMZA 2NVXB 1CZWA 2JXMB 2MPMA 2E75C 1KDCA 2M2LA 2DNEA 2G9DA 2WACA 2ICIA 3HZXA 1AFPA 3R2IA 3MEHA 2OEOA 3MFYA 5HURA 4RGNA 5AFWA 2A68C 3IFTA 4K8JA 4PV1C 1I4HA 4IUQA 3OW7A 2CVRA 4A3IB 4BBRB 1KTKA 1JE4A 4JBWA 3K59A 1EIHA 2DN8A 2Z8LA 1S5FD 4J1MA 5KEEA 3VYSA 4X3TA 3ONAB 2I07B 1MI2A 4XQQA 5M9OA 2WKDA 1JORA 4IUPA 3SK4A 4DNRB 4A3EB 4M1UB 3KK7A 5KNBA 2VNUD 1RF2D 5HGTA 1B44D 1SAPA 4CKEA 1VMPA 2EYJA 2A6HD 4F7XA 5IODA 4LJZC 2X6GA 4RWSC 1V1PB 3J81L 2NN6H 2F0IA 5KYIA 5JVG3 3WOFA 3CKIB 5CORA 1V1PA 5A2QE 2PW7A 3QOLA 3NUCA 3VR5A 2ZXOA 5IGFA 2WAQB 5EBDA 1EZ8A 1D1KA 1SXTA 1F2YA 3S1RB 4HAEA 3S16B 2E2IB 3MFGA 5DNFA 1TWFB 3DEPA 3PO3B 2XNAC 2A73B 3HOXB 1T5XD 1QILA 2F0DA 4NW2A 3VA7A 4DA2A 5IGDA 1YNND 4K6DA 1LTSD 1EIGA 3VYRA 1AZPA 3JAME 2XRQD 3G7LA 4RKLA 3U9SA 1Y69U 1RTNA 3U9OA 4G7HC 3H94A 5FOBB 3N6RA 4FXKC 1O78A 1STEA 3DM1A 5K5PA 2B8GA 3FEWX 3PUVA 2B2VA 1KAAA 3NTIA 2DNCA 3NE5B 2A69D 2FHTA 2F0JA 4ZUIA 2CQAA 1A6XA 2B2YA 3E0JA 3J80E 3LWUA 4HN7A 3V05A 5JEAH 3GTLB 1WD1A 5M3MB 4IFDJ 3HOVB 1A15A 3Q22A 1DOLA 1RHPA 5J22A 2D62A 5CC4A 2BA1A 2WIIB 2F0OA 4XIGS 1VMCA 1GHJA 1SFOB 5CYUA 2ZXRA 3G6JB 4KKTA 2EYLA 1KDBA 1JICA 1Q1EA 2F0PA 5EKKA 1G91A 3S1QB 2C5CA 3I4NB 2QILA 3H91A 4FYDA 1BF4A 4ULLA 4IQZA 2F0NA 4RHRA 3MZ5A 3BYTB 3S2DB 1Z7TA 4ZUJA 3MHBA 2QDBA 1LABA 3Q0AA 3OWEB 2K6AA 5IGBA 4OHJA 3QO2A 3BZDB 3HOYB 3A56A 4I65A 3M3YB 2VXWA 4FF3A 2KEEA 2NTTA 1JC7A 2GA4B 4U68A 1S5DD 5EJWA 3HGBA 1D5MC 5DAUA 2EYMA 2A5HA 3EVQA 2B2UA 2NN6I 4HTHA 4K6LA 3MXPA 2Z1CA 3M4OB 1EY0A 2F0GA 2N88A 1D5ZC 1SBBB 1ET6A 1TWGB 3GTOB 4QCLA 3GTGB 5KNCA 1DXMA 4CJ2C 1FNVA 1JOQA 1D2BA 1HQMC 5E1FA 3M7NA 3I91A 1WTWA 1G8ZD 5EBCA 1W6KA 3A8JE 4CKCA 4CHTB 5NUCA 3NQTA 1HRJA 5EPLA 4OIKA 2RDGA 3JAML 5I9PA 1PZJD 2R3ZA 1A3VA 1HPCA 1ZYRC 1QNUA 1IW7D 4TSSA 3VYTA 4RHSA 3CQZB 1EL0A 2J0TD 3P20A 5ELFA 3S9WA 1SNQA 1I4RA 4G4KA 1ENFA 4G57A 5COYA 3QG1A 2D9UA 2F03A 3DEOA 3R3OA 3FKIB 4RKBA 1FYCA 4Z9CB 1MSHA 3FPUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTH A;  4ZUJ A;  5JOB A;  4KV6 A;  3DHQ A;  5IOD A;  3D8G A;  3BDL A;  4ZUI A;  1EY5 A;  4PMC A;  3MXP A;  4S3S A;  3V2T A;  5IOC A;  4K5X A;  3HEJ A;  5C4H A;  3E5S A;  1II3 A;  2F0Q A;  3D4W A;  2PYK A;  2O4X A;  3DMU A;  3NXW A;  3SR1 A;  1EY0 A;  3ERQ A;  4B9W A;  2F0G A;  5JAV A;  5J39 A;  4KY5 A;  1IHZ A;  4IZ8 A;  5NUC A;  2F0I A;  5KYI A;  1EY9 A;  5C6A A;  5IGE A;  5C5L A;  5CV8 A;  4F8M A;  2RBM A;  2SNS A;  1RKN A;  3OWF A;  2ENB A;  2EYF A;  3PMF A;  4ME5 A;  5CV9 A;  4EQO A;  4NMZ A;  3NHH A;  1SND A;  4B9X A;  1SYB A;  4H7B A;  1SYG A;  4WOR A;  3SK5 A;  4R8N A;  1KDC A;  1U9R A;  2F0V A;  1KDA A;  2PW7 A;  4KY7 A;  3QOL A;  4TRD A;  5J22 A;  2EYP A;  3NUC A;  5CC4 A;  2SOB A;  5CV5 A;  1STY A;  2F0O A;  2WAC A;  3HZX A;  3SK8 A;  3OMC A;  2F0T A;  5CV4 A;  5IGF A;  4EQN A;  5CV7 A;  2F0H A;  4KJN A;  5F2D A;  4HMJ A;  4QF4 A;  3MEH A;  1EY4 A;  2F3V A;  3SK6 A;  1A2U A;  1EZ8 A;  4DGZ A;  1EY8 A;  1STG A;  1F2Y A;  4QMG A;  1SNP A;  1SNO A;  2PZT A;  1NUC A;  2EYL A;  5E3F A;  1A3U A;  1KDB A;  2OEO A;  4PNY A;  1JOQ A;  2F0P A;  2EYO A;  5C4Z A;  5HUR A;  1STB A;  4ID6 A;  1SYE A;  5E1F A;  5EKK A;  2EY2 A;  3SXH A;  1STH A;  2HQE A;  5CGK A;  2M00 A;  2EY5 A;  3P75 A;  4K8I A;  5KRU A;  4K8J A;  3EVQ A;  3QOJ A;  5EGT A;  4EQP A;  3OMG A;  5I6W A;  5I6Y A;  5IIF A;  2OXP A;  5DEH A;  4E6I A;  1STA A;  1EZ6 A;  3EJI A;  1ENC A;  2OF1 A;  4NDX A;  5IGD A;  1SNM A;  2F0N A;  4K2L A;  4KTA A;  4KY6 A;  2F0K A;  2F0D A;  3BDC A;  4LAA A;  2RDF A;  1A3T A;  2PW5 A;  3ITP A;  1TR5 A;  3NQT A;  4ZQ3 A;  5KIX A;  5ISR A;  3C1F A;  3LX0 A;  2KQ3 A;  3MZ5 A;  2RKS A;  1SYD A;  1EQV A;  1EYD A;  1SYC A;  3SHL A;  5IGG A;  4PMB A;  4DF7 A;  1EY6 A;  3NP8 A;  5CR3 A;  2F3W A;  1AEX A;  2PQE A;  2QDB A;  3MHB A;  1F2Z A;  3MVV A;  3OSO A;  4J6H A;  4K6D A;  4MIU A;  5I9P A;  5IGB A;  3TP6 A;  4IAL A;  4DU9 A;  3ERO A;  2F0U A;  2NUC A;  2SNM A;  2F0L A;  4QB4 A;  2PZU A;  3TP8 A;  1A3V A;  3NK9 A;  4KD4 A;  4NKL A;  4K2K A;  1KAB A;  4J1M A;  1F2M A;  5I9O A;  5KEE A;  1EYA A;  4NP5 A;  4RKL A;  5J1Z A;  2LKV A;  1A2T A;  3U9O A;  1SYF A;  2F0M A;  3QB3 A;  4DFA A;  3T13 A;  3TP5 A;  5M9O A;  3D6C A;  4N9P A;  1SNC A;  3H6M A;  4I65 A;  3RUZ A;  3S9W A;  1JOR A;  2F0F A;  4K5W A;  3SK4 A;  4KJO A;  2EY6 A;  2PZW A;  1JOK A;  1SNQ A;  3TP7 A;  4OL7 A;  1JOO A;  4YIJ A;  2EXZ A;  4K14 A;  4KHV A;  3D4D A;  5KYL A;  4G57 A;  5K5P A;  2F0E A;  2KHS A;  4N9T A;  3T16 A;  3TME A;  5HGT A;  1ENA A;  4HMI A;  3C1E A;  1STN A;  1TQO A;  4KD3 A;  5EKL A;  1KAA A;  4F7X A;  5C3X A;  5DAU A;  5CV6 A;  2EYM A;  5KGU A;  2EY1 A;  1EY7 A;  3P1H A;  4IUN A;  1EYC A;  5C3W A;  4ODG A;  3R3O A;  2F0S A;  1NSN S;  2EYJ A;  3VA5 A;  4RKB A;  4WRD A;  4EVO A;  5IGC A;  5C5M A;  4K5V A;  2F0J A;  2F0W A;  2EYH A;  1TT2 A; 
#chains in the Genus database with same CATH topology
 1FVI A;  1SEB D;  1TWA B;  1IKM A;  1X3G A;  4KHP L;  1WTH A;  1IYU A;  3D4W A;  3NXW A;  4GNX A;  4BA1 I;  5IYC H;  4HJ7 A;  2VQF Q;  1XNQ L;  3GTL H;  5C6A A;  4YCV A;  1PH6 A;  1YHB A;  1XPR A;  3X3M A;  5M3M H;  4YY3 L;  2ENB A;  2KCN A;  2BDO A;  3UE0 A;  2CH4 W;  3DWA A;  3AU7 A;  4KY7 A;  1AN8 A;  4A3C G;  5C0X J;  2ZXP A;  5ELB A;  2UUA Q;  2VQE L;  4DUZ Q;  3H3V H;  4APV A;  2CWA A;  2UUB Q;  1SFO H;  4DV6 L;  3KUP A;  1QG7 A;  1F9S A;  1DCZ A;  1DM0 B;  3PF5 A;  3EA6 A;  3IRB A;  1U4L A;  1NCV A;  4ZCK A;  4F88 A;  4BY7 G;  2WAQ E;  1VQF A;  1BNZ A;  4CGY B;  2HQE A;  3S1Q H;  1MJE A;  1Y8N B;  1EFI D;  3E9I A;  1HNX Q;  2O2L D;  1PTO C;  2PMZ E;  1Q8K A;  3FDT A;  2VW9 A;  3I4N H;  2OXP A;  4OEM B;  2Q2I A;  1EZ6 A;  2CHB D;  2J4X A;  2NZO A;  3OW2 A;  4LF7 Q;  1I50 B;  1EIY B;  2F0K A;  4GKJ L;  3TBI B;  3TZU A;  1S40 A;  3EFX D;  2A19 A;  2KQ3 A;  1SYD A;  1LTL A;  3T51 B;  3S2D H;  4DV1 Q;  1EY6 A;  3KBG A;  3NP8 A;  4KHZ A;  2A6E D;  1Y8P B;  1F77 A;  2NUC A;  3DXJ C;  4FNF A;  1RJT A;  4KD4 A;  1ASY A;  3NSW A;  1F2M A;  2N8N A;  4LUV A;  4CDC C;  4NP5 A;  3L9A X;  3HOY H;  1A2T A;  2RSO A;  1ML0 D;  2OWO A;  4FO2 A;  2B29 A;  2HDL A;  3M3Y H;  4X3U A;  2C35 B;  3TS2 A;  4H0L C;  4IUU A;  2QKI C;  5M3F G;  5DM6 3;  3T1H L;  1NR4 A;  4GLA C;  1Z6H A;  4OO1 G;  1TS5 A;  4KD3 A;  2NB0 A;  3KBX A;  4HIM A;  3A54 A;  3BVM A;  1FD7 D;  3OIP A;  1S72 A;  1TY0 A;  4WRD A;  1YJN A;  5G3L D;  3RD4 A;  4X65 Q;  1KDA A;  2F0W A;  2EYH A;  3DHQ A;  5ELN A;  2J7Z A;  1HA5 A;  3BYY B;  4B08 A;  4OX9 L;  2I46 A;  1VF5 C;  2JYO A;  2JA8 B;  1SE8 A;  4R4O A;  2R6G A;  3Q6S A;  5JAV A;  5H1S E;  4JI1 Q;  4O1N A;  2FIN B;  1M8A A;  1EWC A;  1OXT A;  3PIP 3;  4HCE A;  1TWG H;  3GD7 A;  5LMN L;  2XIW A;  2EYF A;  1D7Q A;  2TSS A;  3GTO H;  3I56 A;  2JA5 B;  1SND A;  1GUS A;  3J7Z C;  3J7A 5;  3GTG H;  5LMN W;  1XWE A;  3FP9 A;  4DV4 Q;  4DXF A;  5ELC A;  5FO9 B;  1HFN A;  3HFZ B;  3Q24 A;  4JI3 L;  1J8I A;  1BO0 A;  5EPJ A;  1A2U A;  1IZ6 A;  2BE5 D;  1EYG A;  3UDF A;  4C1N I;  1SNP A;  3D31 A;  2XVS A;  3I2Z A;  1WTO A;  2D5D A;  1N33 Q;  2VS1 A;  3NEL A;  5HGQ A;  3K8A A;  3L3O C;  3P75 A;  2PPB C;  4C3J G;  3EIV A;  1IKL A;  4RGM A;  5JJL A;  1YHQ A;  1E24 A;  3W3A A;  1SR3 A;  4BY7 B;  2KHJ A;  2IX3 A;  2Z0S A;  2UXB Q;  3TRZ A;  4ME3 A;  5IYD H;  5ISR A;  2JSO A;  2Q8R E;  3C1F A;  1B1Z A;  2UU9 Q;  4EGV A;  3HP3 A;  1MKH A;  2F3W A;  4LF8 L;  3U4Z A;  4DU9 A;  4NXN Q;  1PXU A;  2SNM A;  1F9P A;  1JJ2 A;  3IL8 A;  2AHO B;  1CT1 D;  1KLG D;  3CQZ H;  4DNT B;  3LGJ A;  1PFM A;  2F0F A;  3HOU G;  1S3O A;  1T5E A;  2EXZ A;  4YWK A;  4F87 A;  2O5I C;  2ID0 A;  2KHS A;  4N9T A;  1SN8 A;  3T16 A;  3VR2 A;  2Z9H A;  3WOE A;  4U67 3;  1MBY A;  1YI2 A;  1PRT C;  3PUZ A;  5G3L F;  1IL8 A;  4QL5 A;  2EE1 A;  2F0S A;  1MD2 D;  1NSN S;  3FKI H;  3PSI A;  3K57 A;  3CCM A;  1LTT D;  1DON A;  2B2T C;  5KIX A;  1VQD A;  4X3K A;  1LO5 D;  4ILW A;  1EY5 A;  2HIX A;  3V2T A;  4EQ5 A;  5FO8 B;  4K5X A;  5BN5 A;  2O4X A;  3T1Y Q;  2H4O A;  2PCF B;  3RZO B;  1FGU A;  2L1B A;  1LTA D;  5C5L A;  1LT5 D;  4JI8 L;  1N32 L;  4ME5 A;  4EQO A;  2L55 A;  1O7L A;  3R8B A;  4B9X A;  1UE1 A;  4R8N A;  2PNR C;  2KEC A;  1V1Q A;  2F0V A;  1PH9 A;  1KNA A;  4DAP A;  4FF1 A;  4DAY B;  2B2W C;  3PUY A;  1VQ8 A;  4FF4 A;  1C48 A;  4X66 Q;  4XQN A;  1CKO A;  4R4Q A;  3MXG A;  5F2D A;  1BCP C;  1QCB D;  4RA8 A;  1NUC A;  4JK1 C;  3UDX A;  4ZAI A;  1SDF A;  1SYE A;  2NVY B;  4ZKB B;  2K5Q A;  1AZQ A;  4DAV A;  3UDG A;  1PFS A;  3PCO B;  5I6W A;  2JJQ A;  4JG2 A;  4EQP A;  1S4Z A;  5GAD C;  1YBY A;  2FJ2 A;  3MEF A;  1STA A;  3G6E A;  2XN9 C;  2Q2T A;  3MTS A;  2K33 A;  1I50 H;  4L63 B;  3VR6 A;  1TWH H;  5ELO A;  1ZEQ X;  1Q3L A;  1K83 B;  3I4M G;  1EQR A;  1G2S A;  3M9B A;  4C3J B;  2PMZ B;  2AQ2 B;  2BDN A;  1ROD A;  2V1C C;  2AQ1 B;  4TKO B;  2PQE A;  3I7F A;  3ULJ A;  4KN7 C;  3TP6 A;  4A3G G;  5LHY 1;  1HH2 P;  3NK9 A;  2LSS A;  5I9O A;  4DK0 A;  1EYA A;  3GQB A;  1HCZ A;  3NWT A;  4UAI A;  1I4P A;  3GTM B;  4AQY Q;  1YNX A;  5EPK A;  1K8G A;  3HS0 C;  2Q8T A;  2VQF L;  1YNJ C;  2EY6 A;  2R7F A;  1E7Z A;  1TS2 A;  3DUZ A;  2BCO A;  2FMC A;  4AYB G;  1W2B A;  1FL0 A;  5IT9 E;  1Y1W G;  1I4Q A;  4L5T A;  5JVH 3;  3I55 A;  4OON A;  4PG3 A;  3NTK A;  1TWC B;  3HOU B;  2UUA L;  4YCW A;  4DUZ L;  2R7Z G;  1VQG A;  1E1T A;  2UUB L;  5IGC A;  1IYV A;  2N3S A;  4KV6 A;  2N78 A;  1SSO A;  3P7J A;  1H9M A;  4A3J G;  2K5W A;  3E5S A;  1WTP A;  4DR3 L;  2K52 A;  2XWB B;  3NPP A;  1EEI D;  1LT6 D;  1NR2 A;  1HNX L;  1QJO A;  1PH8 A;  4RGT A;  1YIT A;  1CHP D;  3BG3 A;  4FXD A;  1RKN A;  3FVQ A;  4DR6 Q;  2JA5 H;  2OQK A;  4DR1 Q;  3FMC A;  4LF7 L;  2K4K A;  1N8R C;  1PLF A;  2F52 A;  3A5U A;  1YHA A;  3GP7 A;  3C46 A;  2CW0 D;  2F4V Q;  4A3L G;  1EWH A;  4EQN A;  4AIM A;  3K0Y A;  4Y7N B;  4DV1 L;  4KJN A;  1PTO D;  2IPK D;  5EQ0 A;  1WCM B;  3MWY W;  2EJF C;  1STG A;  4FP5 D;  4A3K G;  1SNO A;  5IP7 G;  3KJP A;  5M5Y B;  1VQ5 A;  1HZ9 A;  3AFP A;  2EYO A;  4ID6 A;  3J7Y W;  4CJ0 B;  2R93 G;  1G6P A;  1NAP A;  1STH A;  1R4Q B;  5BN4 A;  3K5L A;  1JQY D;  2K28 A;  3HOZ B;  3OMG A;  4C3H G;  1S5E D;  4DR7 Q;  2NTS A;  1B7Y B;  1ENC A;  1CSQ A;  1QZH A;  5I2X A;  4BY7 H;  3S15 B;  4KTA A;  5LL6 X;  1F9Q A;  5FO7 B;  2QGQ A;  2YV5 A;  3TQY A;  1CTM A;  2UXD Q;  1SRO A;  4UDU C;  5IGG A;  4A93 B;  1EQV A;  3GV3 A;  3S24 A;  3CC4 A;  3CF5 A;  2IT1 A;  4IPG A;  3MVV A;  3BU2 A;  3HG9 A;  3M4Q A;  4X65 L;  3F2C A;  1HUM A;  3HRZ C;  4MTK A;  2YTY A;  4GOP B;  3J7A F;  4IJL A;  4TQU S;  5BN3 A;  4R8I A;  1H9J A;  4A3G B;  3DM3 A;  4A3B G;  1GOZ A;  2PZW A;  2BA0 A;  1PHJ A;  1X55 A;  5FKA C;  3KFU A;  1S5B D;  4Q5V A;  2F0E A;  3TME A;  5CV6 A;  1LT3 D;  3H15 A;  3HOW G;  3P1H A;  1HZB A;  4DV4 L;  4OWW B;  2Z6K C;  5M3F H;  1L0Y B;  4AYB B;  4K5V A;  1Y1W B;  1PZK D;  1B9N A;  3M4Y A;  1SMY C;  3BDL A;  3K7U C;  4R9W A;  1J9O A;  1N33 L;  1II3 A;  1ET9 A;  5JPN C;  1LV9 A;  3RZO H;  3OOC A;  3A8I E;  2A1A A;  1DGS A;  4C3I G;  2HHH Q;  1VCI A;  2K14 A;  3Q8D A;  4J8Q A;  5IT9 c;  4A3J B;  1KHI A;  3KDF B;  2XWJ B;  4H7B A;  5GRO A;  3SK5 A;  2LY7 A;  2UXB L;  2EVB A;  3F8T A;  1U9R A;  1E0B A;  1WI5 A;  3I90 A;  2VUM G;  1EIF A;  1PTO F;  2UU9 L;  4A3D G;  1OXS C;  4IFD G;  4BWG B;  1KAW A;  2P5Z X;  2ASB A;  1VQL A;  1F9R A;  3KDF A;  1VF7 A;  1G51 A;  3RN5 A;  3ZJY C;  2ICE C;  4IUV A;  3MXU A;  1HXY D;  1IXR A;  1SMX A;  4XT1 B;  2B2Y C;  2NVY H;  5A2Q L;  3NQI A;  2DGY A;  1YZ6 A;  1JB3 A;  1Q46 A;  1I6V C;  4JOI C;  4A3K B;  1IBK L;  1VQJ A;  1SE4 A;  1M1K C;  2V4D A;  1B50 A;  3AMU A;  2OF1 A;  3A8K E;  1JR0 D;  1HFG A;  1AP0 A;  4LAA A;  4ZKC B;  4JI7 Q;  5AJ3 Q;  3PO2 B;  1A3T A;  2PW5 A;  1K83 H;  2A68 D;  3ITP A;  1B53 A;  3NWS A;  2H1E A;  4C3J H;  1Q12 A;  1W6J A;  2MO0 A;  3CU7 A;  2A8V A;  2E74 C;  2K5N A;  3K7A B;  3K5N A;  4DF7 A;  4LF4 L;  5JJI A;  4DN4 M;  1X3Q A;  1U0L A;  1XYI A;  3CRK C;  4ZLT F;  2WB1 G;  1R4P B;  1PTO B;  1YJ9 A;  2LKV A;  1NBW A;  2JA6 G;  1M4V A;  1SLJ A;  3D3R A;  3GTM H;  3PF4 A;  2F1M A;  3T1Y L;  4WJ4 A;  3U50 C;  3D6C A;  5C3E G;  2JA7 B;  1H9K A;  1JOK A;  3TP7 A;  1C8C A;  5IT9 L;  1ONL A;  3VR3 A;  1O7Y A;  1PH7 A;  5JEA J;  1KRS A;  2A6H C;  4DXG A;  3H0G B;  5IWA Q;  1WVL A;  1NMF A;  1TWC H;  1EYC A;  4GLX A;  3HOU H;  1UAP A;  4ODG A;  2WV6 D;  4X66 L;  1TS3 A;  4M8A A;  2NVT B;  1E3P A;  1VQP A;  2Q8I B;  1HNW Q;  3RLN A;  2TMP A;  1R9T B;  1L0X B;  3OTO Q;  3NTH A;  4HIK A;  2WKC A;  3HOW B;  3S2H B;  4DKA C;  3V96 A;  3SR1 A;  4B9W A;  1LYL A;  1EU4 A;  4DNI A;  4RH6 A;  3KLS X;  1NNX A;  1CI3 M;  2N55 A;  4G7O C;  2FFK B;  1I6H B;  3MC0 B;  1DD2 A;  1FNW A;  1U4P A;  2SNS A;  4P73 A;  1VQH A;  1GO3 E;  4H13 C;  1RTO A;  3CCU A;  2F4I A;  3D6W A;  2LFN A;  1X56 A;  3I4L A;  4XDX A;  2EYP A;  1WTR A;  3A55 A;  2E76 C;  1STY A;  4LF6 L;  3OMC A;  2EXD A;  3OIQ A;  4MTN A;  5CV7 A;  2K01 A;  4BY1 G;  3QR8 A;  4Y7N H;  4XYQ A;  3J80 L;  1E2V A;  1WCM H;  4QMG A;  2SDF A;  1G29 1;  5M5Y H;  2VUM B;  4JBK A;  1MSG A;  1JJC B;  4HSP A;  4X62 Q;  3SXH A;  1EU3 A;  2ALY B;  2EJG C;  2HT1 A;  3HOZ H;  5I6Y A;  4YHH Q;  3F2D A;  3ZYY X;  3BVZ A;  3PUW A;  4L6T B;  1YNN C;  1U4M A;  3S15 H;  4A3M G;  4A75 A;  4IO9 A;  4K2L A;  5CV4 A;  4C2M B;  2AWN A;  1KLU D;  3BDC A;  4GZY C;  1L1O C;  1LTG D;  2L11 A;  4JI0 Q;  4FF2 A;  3SE0 A;  4JW0 A;  1DJR D;  4A93 H;  1QE6 A;  3SEB A;  1CZG A;  4HSV A;  3A0J A;  4HED A;  3J81 i;  3TP8 A;  1OXV A;  2F0L A;  2RDH A;  3S17 B;  4QQB X;  3F2U A;  1QWY A;  4POG A;  4ZYS A;  3CP0 A;  1MJC A;  2F0M A;  3T13 A;  1XJV A;  1PRT F;  1V43 A;  3PIP A;  1WFQ A;  3OPO A;  4A3G H;  1DZ1 A;  1V8Q A;  1TWH B;  4KN4 C;  3C3L A;  5T1I A;  4IPD A;  2RSN A;  1Q81 C;  2WB1 B;  1K8A C;  2A69 C;  2L9H A;  1SE2 A;  2JA6 B;  4DR6 L;  1O7Z A;  4DR1 L;  5K36 G;  1QOH A;  3K81 C;  4HMI A;  4KI0 A;  4OO1 I;  1K0S A;  5C3X A;  1PV4 A;  4OIJ A;  2F4V L;  4HCS A;  2RVL A;  3Q23 A;  1BOS A;  1X3P A;  4MN3 A;  1HR0 L;  1HTL D;  2CQO A;  3CME A;  1Y1W H;  5JOB A;  1LAC A;  1PDQ A;  1YVC A;  1JCK B;  2MP1 A;  1D8L A;  1LTI D;  1WTX A;  4MHE A;  1HR0 W;  3PV0 A;  1BR9 A;  2K32 A;  5L37 A;  1EOT A;  5J39 A;  3MXN B;  1KL9 A;  5C0X I;  1W3S A;  2WP8 J;  4LUO A;  4DR7 L;  3OWF A;  4A3J H;  4ABN A;  1SYB A;  3WDN A;  4CDF C;  2ZTD A;  3FPP A;  3MXN A;  1PRT B;  2AQ3 B;  5FK9 C;  2XTI A;  1HQR D;  2UXD L;  3VDY A;  4DK1 A;  3CCV A;  2NBF A;  1OO9 B;  4HMJ A;  1U4R A;  2K50 A;  2PI2 E;  1YIJ A;  4JVZ A;  5E4X A;  4V19 0;  1A3U A;  1VS0 A;  5C0X G;  4QUC A;  2KCC A;  2B2T A;  2EY2 A;  2UUC Q;  4BY1 B;  4BA2 I;  5CGK A;  1X6O A;  4Q0F A;  1WTQ A;  5EGT A;  4A3K H;  5IP7 H;  4X3S A;  4DUY Q;  1UNS A;  2R93 H;  4JI5 L;  3I3C A;  3JC6 6;  2KED A;  4OWT B;  3PO2 H;  1K8M A;  2RDF A;  1TR5 A;  3HKZ G;  4C56 C;  2PO4 A;  3EQL C;  2RKS A;  1TU2 B;  1BCP B;  1EYD A;  1SYC A;  2IW3 A;  3K7A H;  4L8J A;  4PMB A;  3OSO A;  1F2Z A;  4A3M B;  4IOC A;  1RIP A;  4GN4 B;  4NKL A;  1Z47 A;  1PTO H;  4CKB A;  2HDM A;  4NPS A;  3E0E A;  4P74 A;  3TP5 A;  5LMU L;  5JJZ A;  2QA4 A;  1FJG Q;  1F2L A;  2JEA I;  2NZH A;  1J6Q A;  2JA7 H;  4H44 C;  2HHH L;  5IE8 A;  4DV2 Q;  4BXX H;  1DOK A;  1CKN B;  4JI4 Q;  1ENA A;  1ESF A;  1STN A;  1TQO A;  3H0G H;  3D0F A;  2R61 A;  3TZD A;  1RD9 D;  4A3B H;  5KGU A;  4KK7 A;  3UDI A;  3ERS X;  1CFM A;  1DOM A;  3AYH B;  5IP9 G;  2NVT H;  4WFN 3;  4ZRZ A;  1K3B C;  1U5K A;  1CKN A;  2YU9 B;  1EEF D;  1SJH D;  1Y1V G;  2ZM6 Q;  4RMF A;  1R9T H;  3GTJ B;  4V0B A;  3W1G A;  3HOW H;  2AMC B;  3S2H H;  2KVM A;  3HEJ A;  4FDB A;  2PYK A;  5A35 A;  3ERQ A;  4PMW A;  4AYB E;  2CWP A;  1TVX A;  2R92 G;  2JE6 I;  5IGE A;  1I6H H;  5CV8 A;  1KIX A;  1D1I A;  1K73 C;  1TY2 A;  1I4X A;  3I8Z A;  3J81 c;  2LMC B;  4JI7 L;  5AJ3 L;  5M3F B;  4TRD A;  2A74 C;  2G9H D;  3G48 A;  5DLQ E;  1FR3 A;  2VZA A;  2F0T A;  2RHQ B;  3QJY A;  2KA7 A;  3UI2 A;  4HJ9 A;  4B3R Q;  4QF4 A;  2F3V A;  5FLM G;  3OHX C;  1JWM D;  1CQF A;  1A8V A;  1N36 Q;  2VUM H;  1YEZ A;  4CJ1 B;  4A3D H;  3AB9 A;  4IFD H;  2K03 A;  1XTD A;  4DV0 Q;  2IX0 A;  1BXT A;  1T9H A;  3WWV A;  1E2Z A;  2QDL A;  4HJ8 A;  5DEH A;  1JE5 A;  3URY A;  1HTP A;  5D14 A;  2DY7 A;  3ICE A;  3J7A V;  3L2P A;  3TN2 A;  2YTX A;  4KY6 A;  2NWG A;  4C2M H;  5D3D A;  2SEB D;  3E9H A;  3KLS A;  3MAQ A;  3LX0 A;  5IWA L;  1CA6 A;  3GTP H;  3BVG A;  1IW7 C;  1VQA A;  4RAU C;  1VDZ A;  4MIU A;  4DAY A;  3ER0 A;  1C0A A;  1PYW D;  1H95 A;  4J15 A;  1ICW A;  5LL6 S;  1GUG A;  3HKZ B;  4L5S A;  1HNW L;  2L15 A;  4K2K A;  3S17 H;  3OTO L;  3T56 B;  2KCT A;  3RMH A;  2MJ8 A;  1CM9 A;  1S5C D;  5M3M G;  1PA6 A;  3HOV G;  3LWE A;  1K8O A;  4K5W A;  1ZYR D;  4YIJ A;  3BJU A;  2JA6 H;  4UPA A;  3TSS A;  1H9R A;  1X65 A;  2K05 A;  3R93 A;  2AUJ D;  3RLO A;  3IFD A;  5IYB G;  2HCI A;  1I94 Q;  3A7A B;  1A63 A;  1ILP A;  1TXY A;  2AWO A;  1X32 A;  2ZTE A;  1BBX C;  3CCR A;  1TKW B;  4FVM A;  5JJK A;  3CC2 A;  2BOS A;  4PMC A;  4S3S A;  4MNO A;  2D2C C;  4P2C B;  4B3M Q;  5C4H A;  3PGZ A;  2F0Q A;  3GTK B;  3DMU A;  1LT4 D;  1RDP D;  1L2F A;  1Q8I A;  2YTV A;  3N52 A;  1Y1V B;  4YHH L;  3IKJ A;  2RBM A;  3CHB D;  3S14 B;  3STB C;  3PMF A;  2F3I A;  3J81 j;  1V1O A;  2D0P A;  2IX1 A;  3TS0 A;  2R92 B;  4JI0 L;  1QVF A;  4GN3 B;  3SK8 A;  2X69 A;  1XMQ Q;  1CA5 A;  1JWS D;  3I70 A;  1QUQ B;  3CPF A;  5E4W C;  1O80 A;  1CUK A;  5DM7 3;  1GHK A;  2Z6K A;  2MQH A;  2GVB A;  3D4R A;  4BY1 H;  1EQQ A;  4IUR A;  1QUQ A;  4BBS G;  4O42 A;  2WIN B;  3ULP A;  3GO5 A;  4E6I A;  1A0I A;  4RGO S;  2MHV A;  3TDQ A;  2A6E C;  1I4G A;  1SNM A;  4LF9 Q;  4FXG C;  2H5X A;  3F2B A;  2JP1 A;  1AE2 A;  1SJE D;  2PI2 A;  3RLF A;  4UY8 C;  1X9N A;  4DV5 Q;  4RCN A;  4J6H A;  4A3C H;  1VQ7 A;  4A3M H;  1CK1 A;  1SE3 A;  3QIA A;  3M7G A;  2X6L A;  4H02 A;  3BZK A;  1B3A A;  1MGS A;  5M5X B;  4N9P A;  1BDO A;  5C4J B;  3H6M A;  1RL2 A;  2Y0S G;  4KJO A;  4OL7 A;  4UP9 A;  2RQX A;  4K14 A;  4KLK A;  4RFB A;  2E2D C;  1UUP A;  4JOI A;  4R4I A;  2EZV A;  2I5M X;  3TEH B;  2CCZ A;  1GM5 A;  1XXG A;  3C1E A;  2AUK A;  1I3Q H;  5EKL A;  4G7Z C;  5I4D A;  2IHE A;  2EY1 A;  3TRE A;  1EY7 A;  3I4M B;  4ALP A;  2OTJ A;  2WB1 E;  5D65 A;  5K36 H;  2YU9 H;  2EIF A;  5KND A;  1P16 A;  3GTJ H;  4JI1 L;  4B3S Q;  1PYS B;  4IPH A;  5IOC A;  2C9O A;  4PZ8 A;  2UUC L;  1HUN A;  3K5M A;  4GOP A;  1GXD C;  4OX9 Q;  1C7Y A;  2KOL A;  3AEV A;  2L12 A;  2K5V A;  3KF6 B;  3A74 A;  5I2Y A;  1VQ4 A;  5IYD G;  3KLR A;  3HKS A;  3L7Z C;  3NHH A;  1HA6 A;  4WOR A;  1HJP A;  2BE5 C;  5LMN Q;  1PZI D;  4JBJ A;  1B8A A;  2SOB A;  4OO1 H;  3KF6 A;  3BDO A;  4DR5 Q;  1Q7Y C;  2DY8 A;  2NZ1 D;  1WYD A;  4IFD I;  1E1O A;  3SK6 A;  3S1N B;  1EY4 A;  4DGZ A;  1NE3 A;  1GUW A;  1KC8 C;  3A7L A;  2HCC A;  3PIO 3;  2PZT A;  1UE7 A;  2R7Z B;  3I72 A;  3EBE A;  1IBL Q;  2RCF A;  4P72 A;  5KRU A;  1QNK A;  2K5H A;  2B2V C;  3I73 A;  1ZXT A;  1PFB A;  5C0X H;  2MUY A;  2LXK A;  1XNR Q;  4DV2 L;  2QF7 A;  4C1N K;  5C44 G;  4ZQ3 A;  3KF8 B;  3H09 A;  4JI4 L;  1G6Z A;  4BBS B;  4LUZ A;  4QUF A;  4JI2 Q;  4DR2 Q;  1X54 A;  4DPG A;  1CSP A;  3FKI G;  3L0O A;  1OXX K;  4NXN L;  5CR3 A;  1AEX A;  4LK1 C;  3DWQ A;  3GTQ B;  1ESR A;  4I7Z C;  3KF8 A;  3ERO A;  4QB4 A;  3RZD B;  2PZU A;  2OT2 A;  2ZM6 L;  1KAB A;  1X3E A;  4JI6 Q;  1K0R A;  1XTC D;  1XX8 A;  1PMR A;  1SYF A;  1QB5 D;  3QB3 A;  4Y52 H;  1B9M A;  2R93 B;  1YJW A;  1MIU A;  1Q1B A;  2MFI A;  2DJF C;  5FLX E;  1L1O B;  1DYQ A;  1JOO A;  1FNU A;  4C3H B;  2VB2 X;  1MHW C;  5BR8 Q;  4LFA Q;  3CPW A;  4PZ6 A;  2Y0S B;  4IUN A;  5C3W A;  2EJM A;  5EKI A;  1L1O A;  1Y8O B;  1HHV A;  4IJH A;  1KNE A;  3MA2 B;  2NN6 G;  1ZKO A;  3H3V C;  1N36 L;  1LTB D;  4IPC A;  5TSS A;  3PUX A;  2IWH A;  2EPB A;  2E8G A;  1GKH A;  2M9V A;  2KEN A;  1OXU A;  1PRT D;  3GTK H;  2ZJR A;  1BQQ T;  4KY5 A;  4HR7 B;  1C4Q A;  2EOT A;  2MGS A;  4OXP A;  3E6Z X;  1EY9 A;  1HNZ Q;  1Y1V H;  4LF5 Q;  3ULL A;  3S14 H;  1GUT A;  1Q90 A;  1OTC A;  2L0C A;  3PQI A;  4A3B B;  1SYG A;  2L4N A;  4OGQ C;  2E2J B;  1B4O A;  4JPB W;  3OYY A;  1N32 Q;  1VQB A;  2R92 H;  5CV5 A;  5C4X G;  1B2T A;  3S1M B;  2I5L X;  1NY4 A;  1WD0 A;  1BUV T;  1PH4 A;  4ZK9 B;  2JEB I;  1LLR D;  1FGB D;  2RA4 A;  2IHF A;  5E3F A;  1UE5 A;  4PNY A;  1N34 Q;  5T1G A;  2BH8 A;  5C4Z A;  1JWU D;  1WOC A;  2K04 A;  4KKS A;  4RCO A;  3ND8 A;  5FLM H;  1BCP D;  2M00 A;  1VQE A;  4XTC S;  2EY5 A;  2OTL A;  4HID A;  2IJ0 A;  1GUO A;  3U58 A;  2B63 G;  4C3I B;  4N8F A;  1CQV A;  2YYZ A;  1UEA B;  1G2T A;  4IUT A;  4XQJ A;  4R4T A;  5ELE A;  4IN3 A;  4DV3 Q;  3NBH B;  1EUJ A;  2B2U C;  3SHL A;  2O5J C;  1I94 L;  2KUM A;  2NYZ D;  2Z4H A;  2GVA A;  2QEJ C;  4PZ7 A;  3VYU A;  4A3D B;  5C44 B;  3SGI A;  1TS4 A;  1KRT A;  4XT3 B;  2F0U A;  2JA8 G;  3T53 B;  2XSC A;  4JV5 Q;  4AQY L;  3NBH A;  5J1Z A;  3BS1 A;  4B3M L;  2ZJP A;  1TII D;  5M5X H;  4GKK Q;  5C4J H;  3RUZ A;  4UHV A;  2JA5 G;  3HKZ E;  2ZT9 C;  1XPO A;  3KJO A;  3F1Z A;  5KYL A;  3GTP B;  2Q2H A;  2B8F A;  2VB3 X;  3SVM A;  4LFC Q;  2RHS B;  4TVA B;  2VL6 A;  3HOV H;  1YNJ D;  2DUD A;  3O13 A;  1PH3 A;  3I4M H;  1AH9 A;  4KMU C;  1XMQ L;  2K7V A;  4PQX A;  5JEA G;  3RR5 A;  3X3N A;  1EQT A;  4A3F G;  4HJ5 A;  3STB D;  3KOJ A;  3D8G A;  3GV6 A;  2KCM A;  5IYB H;  4MZ9 A;  4OEL B;  3K6O A;  2QEX A;  3CCS A;  1A62 A;  2B39 A;  2FMM A;  1IHZ A;  3CW2 C;  4IZ8 A;  5FLX c;  4LMQ D;  2CW0 C;  1XPU A;  5CMD A;  4KKU A;  4F8M A;  4DR3 Q;  3J81 E;  3C2P A;  1KQS A;  2K5D A;  5CV9 A;  2CH4 A;  1K28 A;  5C3E B;  5CBA E;  3W2D A;  4LF9 L;  3IAY A;  1ILQ A;  3R2T A;  2WFW A;  1C9O A;  2HD3 A;  1GJX A;  2HUG A;  4YCU A;  4XYO A;  2DJG C;  2NVQ B;  2L5T A;  1GUN A;  2F0H A;  1UEB A;  4UP7 A;  4DV5 L;  3S1N H;  1H9S B;  1EY8 A;  4XXE A;  2R7Z H;  2I0Q A;  1D5X C;  3K5O A;  2EDG A;  2ZJQ A;  3U4V A;  4A3I G;  5C4X B;  1STB A;  2UXC Q;  1BCP F;  4BBR G;  1WTV A;  3NBI A;  1WJJ A;  4K8I A;  1H9S A;  3QOJ A;  5IIF A;  4A4I A;  4CBV A;  3SDZ A;  3W5O A;  3EJI A;  4NDX A;  3FRP B;  3ND9 A;  1VQC A;  3K0X A;  2K1B A;  3T4A C;  5CBE E;  4DV7 Q;  3CCE A;  4BBS H;  3CRL C;  1XMO Q;  3K58 A;  1M90 C;  4N8X 1;  2B63 B;  3GTQ H;  4A3L H;  4IAL A;  5J3B A;  3NEN A;  4GNX C;  4BS9 A;  3RZD H;  4A3E G;  4AH6 A;  5ELD A;  2E2H B;  4B3S L;  3QWN A;  5D3I B;  1IL2 A;  5FLX L;  2LS0 1;  4DFA A;  4B3T Q;  4K0K Q;  2RF4 A;  2QCP X;  1SNC A;  4L5Q A;  3M4O H;  2IL8 A;  3DLL A;  3G4S A;  5IY0 A;  4KHV A;  2ZTC A;  3D4D A;  4WJW A;  4C3H H;  1LM0 A;  4JYA Q;  4DR4 Q;  5M5W B;  2XRS D;  1VQN A;  2R7D A;  4A76 A;  1PFN A;  1RCV D;  3DWP A;  2Q2U A;  1D6E C;  2B2W A;  1KXL A;  1CHQ D;  4DR5 L;  4LFB Q;  3LNN A;  3VA5 A;  4EVO A;  5C5M A;  1TT2 A;  2E5L Q;  3VR4 A;  1AW7 A;  4YWM A;  5GAG C;  1IBL L;  1E2W A;  2Z4I A;  2KJX A;  1GD7 A;  1VQO A;  4A3F B;  4QIW B;  1LTR D;  3M85 A;  1SMY D;  1I3Q B;  2WAQ G;  5JPM C;  4NMZ A;  1XNR L;  2NVX B;  2GN5 A;  1UWV A;  1CZW A;  2JXM B;  2MPM A;  2E75 C;  2E2J H;  1P8L A;  1KDC A;  2M2L A;  2DNE A;  4DR2 L;  4JI2 L;  2G9D A;  1UE6 A;  4DK6 C;  2WAC A;  2ICI A;  3HZX A;  2VY3 A;  3S1M H;  1AFP A;  3R2I A;  5FJ8 G;  3PO3 G;  4HJA A;  3MEH A;  4LWC A;  2OEO A;  3HOX G;  3MFY A;  2JN4 A;  5HUR A;  4JI6 L;  4POF A;  4RGN A;  5AFW A;  2A68 C;  3IFT A;  4K8J A;  1Q82 C;  4PV1 C;  1I4H A;  4IUQ A;  2PNH A;  1PYB A;  3OW7 A;  2CVR A;  4C3I H;  4A3I B;  2LXJ A;  1IBK Q;  3CMA A;  4JBM A;  1LUZ A;  1VQK A;  4BBR B;  4O0A A;  5BR8 L;  4LFA L;  1KTK A;  1BBU A;  1JE4 A;  4JBW A;  3K80 C;  1IBM Q;  2KHI A;  4WJ3 M;  3K59 A;  4OWX B;  5C44 H;  1EIH A;  2DN8 A;  4NXM Q;  2Z8L A;  1S5F D;  4J1M A;  5KEE A;  1I5F A;  4LF4 Q;  4QY7 A;  3VYS A;  4X3T A;  3ONA B;  4LW1 A;  2I07 B;  1NJI C;  1TWA H;  1MI2 A;  4XQQ A;  5M9O A;  1J5E Q;  2WKD A;  1JOR A;  4IUP A;  4CDE C;  3SK4 A;  1HNZ L;  3EN2 A;  4DNR B;  4M1U B;  4A3E B;  4LF5 L;  3KK7 A;  5KNB A;  2VNU D;  1RF2 D;  5HGT A;  1B44 D;  4P71 A;  1SAP A;  3H3V I;  1WCM G;  4CKE A;  1BVS A;  1VMP A;  2EYJ A;  5IYC G;  3E3X A;  2A6H D;  4F7X A;  5E7N A;  4NB3 A;  4CDD C;  5IOD A;  4LJZ C;  2X6G A;  4X64 Q;  2Y0S E;  1N34 L;  3HOZ G;  4RWS C;  1V1P B;  1Y14 B;  3J81 L;  2NN6 H;  4GLV B;  2F0I A;  5KYI A;  5JVG 3;  4IOA A;  3BZC A;  5GQO A;  3WOF A;  3CKI B;  5C3E H;  1JMC A;  5COR A;  2CKZ B;  4A93 G;  1B3Q A;  1V1P A;  5A2Q E;  3CCL A;  2PW7 A;  1X3F A;  3QOL A;  2JK8 A;  3NUC A;  1L0W A;  3VR5 A;  2ZXO A;  4DV3 L;  5IGF A;  1VQM A;  2WAQ B;  2NVQ H;  5EBD A;  1EZ8 A;  4LF6 Q;  1D1K A;  1SXT A;  1F2Y A;  4R4C A;  3I4N G;  2N49 A;  4X62 L;  3S1R B;  4HAE A;  4JV5 L;  5C4X H;  4KHP Q;  3S16 B;  2E2I B;  3MFG A;  5DNF A;  1TWF B;  3DEP A;  4DK3 C;  1VQ9 A;  3PO3 B;  1XNQ Q;  2XNA C;  3CCJ A;  4GKK L;  1GVP A;  5GAH C;  3JAM i;  2A73 B;  4YY3 Q;  3HOX B;  2G5D A;  1T5X D;  1QIL A;  3UE1 A;  1PVO A;  5GAE C;  2F0D A;  4LFC L;  2AKW B;  1QVG A;  4NW2 A;  2VQE Q;  3VA7 A;  2B63 H;  1ASZ A;  3HOY G;  4DA2 A;  5IGD A;  1YNN D;  4DV6 Q;  4K6D A;  1LTS D;  1EIG A;  4I7A A;  3I4O A;  3VYR A;  2PQA B;  4QJF A;  1AZP A;  2OCE A;  3JAM E;  4GS3 A;  1SRU A;  2XRQ D;  2E2H H;  3G7L A;  4RKL A;  3U9S A;  1Y69 U;  1RTN A;  3U9O A;  1JT8 A;  4G7H C;  3H94 A;  2KBN A;  2B3G A;  5FOB B;  3N6R A;  1EFW A;  2PQA A;  4FXK C;  2JA8 H;  1O78 A;  1STE A;  3CXC A;  3DM1 A;  3J80 i;  2B8G A;  3FEW X;  3PUV A;  5K5P A;  5M5W H;  4GKJ Q;  2B2V A;  1NMG A;  1KAA A;  3NTI A;  2DNC A;  3NE5 B;  2A69 D;  3PIO A;  1BBW A;  2FHT A;  3RNU A;  2F0J A;  4ZUI A;  1PH1 A;  1HR0 Q;  2CQA A;  1A6X A;  2UXC L;  2B2Y A;  3E0J A;  3J80 E;  3LWU A;  4HN7 A;  2BH2 A;  3V05 A;  5JEA H;  5HY6 A;  3GTL B;  4A3F H;  1WD1 A;  1JJG A;  5M3M B;  2ES2 A;  3T1H Q;  3PO2 G;  4IFD J;  2RCN A;  3HOV B;  1A15 A;  3Q22 A;  2NVX H;  2D0O A;  1DOL A;  1RHP A;  2CFM A;  3M4P A;  5J22 A;  4DV7 L;  2D62 A;  1PH5 A;  1VQ6 A;  5CC4 A;  2BA1 A;  1XMO L;  2WII B;  2F0O A;  4L5R C;  4XIG S;  4QGU A;  1VMC A;  1GHJ A;  1SFO B;  1VQI A;  5CYU A;  1HZC A;  2ZXR A;  3G6J B;  4KKT A;  1E22 A;  2EYL A;  1KDB A;  1JIC A;  1Q1E A;  2F0P A;  1K9M C;  2K75 A;  4UP8 A;  5EKK A;  1G91 A;  1IYJ B;  3S1Q B;  4DUY L;  1CKM A;  2JA7 G;  4B3T L;  4K0K L;  4BXX G;  2C5C A;  3I4N B;  2QIL A;  3H91 A;  4RG1 A;  4FYD A;  1BF4 A;  4A3I H;  3H0G G;  4ULL A;  2ATW A;  4IQZ A;  4JYA L;  2F0N A;  4RHR A;  4DR4 L;  4BBR H;  3GDE A;  4X6A H;  4JI5 Q;  4EX5 A;  1QZG A;  3MZ5 A;  3BYT B;  3S2D B;  1Z7T A;  4ZUJ A;  4JI3 Q;  3MHB A;  2QDB A;  1HZA A;  4LFB L;  1LAB A;  3Q0A A;  3OWE B;  2K6A A;  5IGB A;  4OHJ A;  3QO2 A;  2I5H A;  3CAM A;  2E5L L;  3KLW A;  3BZD B;  1FJG L;  3HOY B;  1Q86 C;  3A56 A;  4I65 A;  3M3Y B;  1AE3 A;  4A3E H;  1KD1 C;  1B70 B;  2VXW A;  5LMU Q;  4FF3 A;  2KEE A;  2NTT A;  1JC7 A;  1NTG A;  2GA4 B;  4U68 A;  1S5D D;  5EJW A;  4O2D A;  3HGB A;  1D5M C;  5DAU A;  2EYM A;  4LF8 Q;  2A5H A;  4P75 A;  3CD6 A;  3JAM c;  2OQ0 A;  2B2U A;  2NN6 I;  3EVQ A;  2FXQ A;  4HTH A;  4K6L A;  3MXP A;  2Z1C A;  3M4O B;  3RN2 A;  2MO1 A;  1EY0 A;  2F0G A;  2N88 A;  1D5Z C;  1SBB B;  2XGT A;  1ET6 A;  1TWG B;  3GTO B;  4QCL A;  1V9P A;  3NEM A;  1O7I A;  3GTG B;  1QVC A;  2Z6B A;  4B3R L;  4QIW E;  5KNC A;  2JA9 A;  1IBM L;  1DXM A;  4CJ2 C;  5IP9 H;  4NXM L;  1FNV A;  4JC0 A;  4DV0 L;  3S1R H;  1Z9F A;  1JOQ A;  3J80 c;  3S16 H;  1D2B A;  2E2I H;  3CC7 A;  1HQM C;  5E1F A;  1TWF H;  3I91 A;  4HIO A;  3M7N A;  5FJ8 H;  3PO3 H;  4GOP C;  2IY5 B;  1WTW A;  1J5E L;  1G8Z D;  3HOX H;  4JI8 Q;  2EQS A;  5EBC A;  1W6K A;  3A8J E;  3B6Y A;  4CKC A;  4CHT B;  3A5Z B;  4YWL A;  5NUC A;  4R1J A;  3NQT A;  1EOV A;  3KYH C;  1PH2 A;  1HRJ A;  5EPL A;  4OIK A;  2RDG A;  3JAM L;  5I9P A;  2MNA A;  1PZJ D;  2R3Z A;  3AFQ A;  3CCQ A;  1A3V A;  1HPC A;  1EWI A;  4LNQ A;  1ZYR C;  1QNU A;  1IW7 D;  4X64 L;  4TSS A;  3VYT A;  3G71 A;  4RHS A;  3CQZ B;  5EAY A;  1EL0 A;  2J0T D;  1ICF B;  2HIV A;  3P20 A;  2JQO A;  5ELF A;  2QW7 A;  3S9W A;  4JCV E;  1SNQ A;  1I4R A;  2HQL A;  4DAM A;  4G4K A;  3FHW A;  1BKB A;  1ENF A;  4G57 A;  5COY A;  4GN5 A;  3QG1 A;  1K3R A;  2D9U A;  1JB7 A;  3W1B A;  2F03 A;  3DEO A;  4GNX B;  3R3O A;  1N9W A;  3FKI B;  4RKB A;  1FYC A;  3AQQ A;  4Z9C B;  1MSH A;  3FPU B; 
#chains in the Genus database with same CATH homology
 1SEB D;  1TWA B;  1IKM A;  1IYU A;  3D4W A;  3NXW A;  4BA1 I;  5C6A A;  3X3M A;  2ENB A;  2KCN A;  2BDO A;  3DWA A;  3AU7 A;  4KY7 A;  1AN8 A;  5C0X J;  2ZXP A;  5ELB A;  3KUP A;  1QG7 A;  1F9S A;  1DCZ A;  1DM0 B;  3EA6 A;  1U4L A;  1NCV A;  4F88 A;  1BNZ A;  4CGY B;  2HQE A;  1Y8N B;  1EFI D;  2O2L D;  1PTO C;  3FDT A;  2OXP A;  1EZ6 A;  2CHB D;  2J4X A;  1I50 B;  2F0K A;  3TBI B;  3TZU A;  3EFX D;  2KQ3 A;  1SYD A;  3T51 B;  1EY6 A;  3KBG A;  3NP8 A;  4KHZ A;  2A6E D;  1Y8P B;  1F77 A;  2NUC A;  3DXJ C;  4FNF A;  1RJT A;  4KD4 A;  3NSW A;  1F2M A;  4NP5 A;  3L9A X;  1A2T A;  2RSO A;  1ML0 D;  4FO2 A;  2HDL A;  4X3U A;  4H0L C;  4IUU A;  2QKI C;  5DM6 3;  1NR4 A;  1Z6H A;  4OO1 G;  1TS5 A;  4KD3 A;  2NB0 A;  3KBX A;  3A54 A;  3BVM A;  1FD7 D;  3OIP A;  1TY0 A;  4WRD A;  5G3L D;  3RD4 A;  1KDA A;  2F0W A;  2EYH A;  3DHQ A;  2J7Z A;  1HA5 A;  3BYY B;  4B08 A;  2I46 A;  1VF5 C;  2JYO A;  2JA8 B;  2R6G A;  3Q6S A;  5JAV A;  4O1N A;  2FIN B;  1M8A A;  1EWC A;  1OXT A;  3PIP 3;  4HCE A;  3GD7 A;  2XIW A;  2EYF A;  2TSS A;  2JA5 B;  1SND A;  1GUS A;  1XWE A;  4DXF A;  5ELC A;  5FO9 B;  1HFN A;  3Q24 A;  1J8I A;  1BO0 A;  5EPJ A;  1A2U A;  2BE5 D;  4C1N I;  1SNP A;  3D31 A;  2XVS A;  1WTO A;  2D5D A;  3L3O C;  3P75 A;  2PPB C;  4C3J G;  1IKL A;  4RGM A;  3W3A A;  4BY7 B;  2IX3 A;  5ISR A;  2JSO A;  2Q8R E;  3C1F A;  1B1Z A;  4EGV A;  3HP3 A;  2F3W A;  4DU9 A;  1PXU A;  2SNM A;  1F9P A;  3IL8 A;  1CT1 D;  1KLG D;  4DNT B;  1PFM A;  2F0F A;  1T5E A;  2EXZ A;  4F87 A;  2O5I C;  2ID0 A;  2KHS A;  4N9T A;  3T16 A;  3VR2 A;  3WOE A;  4U67 3;  1MBY A;  1PRT C;  3PUZ A;  5G3L F;  1IL8 A;  2EE1 A;  2F0S A;  1MD2 D;  1NSN S;  3K57 A;  1LTT D;  1DON A;  2B2T C;  5KIX A;  4X3K A;  1LO5 D;  4ILW A;  1EY5 A;  3V2T A;  5FO8 B;  4K5X A;  5BN5 A;  2O4X A;  2H4O A;  2PCF B;  3RZO B;  2L1B A;  1LTA D;  5C5L A;  1LT5 D;  4ME5 A;  4EQO A;  2L55 A;  1O7L A;  3R8B A;  4B9X A;  4R8N A;  2PNR C;  2KEC A;  4FF1 A;  2F0V A;  1KNA A;  4DAP A;  2B2W C;  3PUY A;  4FF4 A;  1C48 A;  4XQN A;  5F2D A;  3MXG A;  1BCP C;  1QCB D;  4RA8 A;  1NUC A;  4JK1 C;  4ZAI A;  1SDF A;  1SYE A;  2NVY B;  4ZKB B;  2K5Q A;  1AZQ A;  4DAV A;  5I6W A;  4EQP A;  1S4Z A;  2FJ2 A;  1STA A;  2XN9 C;  3MTS A;  2K33 A;  4L63 B;  3VR6 A;  1ZEQ X;  1Q3L A;  1K83 B;  1G2S A;  4C3J B;  2PMZ B;  2AQ2 B;  2BDN A;  1ROD A;  2AQ1 B;  4TKO B;  2PQE A;  4KN7 C;  3TP6 A;  5LHY 1;  3NK9 A;  5I9O A;  4DK0 A;  1EYA A;  3GQB A;  1HCZ A;  3NWT A;  4UAI A;  1I4P A;  3GTM B;  5EPK A;  3HS0 C;  2Q8T A;  1YNJ C;  2EY6 A;  1TS2 A;  3DUZ A;  2BCO A;  2FMC A;  5IT9 E;  1I4Q A;  5JVH 3;  3NTK A;  1TWC B;  3HOU B;  5IGC A;  1IYV A;  4KV6 A;  1SSO A;  3P7J A;  1H9M A;  2K5W A;  3E5S A;  1WTP A;  2XWB B;  3NPP A;  1EEI D;  1LT6 D;  1NR2 A;  1QJO A;  4RGT A;  1CHP D;  3BG3 A;  4FXD A;  1RKN A;  3FVQ A;  3FMC A;  1PLF A;  3GP7 A;  3C46 A;  2CW0 D;  1EWH A;  4EQN A;  3K0Y A;  4Y7N B;  4KJN A;  1PTO D;  2IPK D;  5EQ0 A;  1WCM B;  3MWY W;  2EJF C;  1STG A;  4FP5 D;  1SNO A;  5M5Y B;  2EYO A;  4ID6 A;  3J7Y W;  4CJ0 B;  1NAP A;  1STH A;  1R4Q B;  5BN4 A;  3K5L A;  1JQY D;  2K28 A;  3HOZ B;  3OMG A;  4C3H G;  1S5E D;  2NTS A;  1ENC A;  3S15 B;  5I2X A;  4KTA A;  5LL6 X;  1F9Q A;  5FO7 B;  1CTM A;  4UDU C;  5IGG A;  4A93 B;  1EQV A;  3GV3 A;  2IT1 A;  3MVV A;  3HG9 A;  1HUM A;  3HRZ C;  3J7A F;  4TQU S;  5BN3 A;  4R8I A;  1H9J A;  4A3G B;  1GOZ A;  2PZW A;  2BA0 A;  5FKA C;  1S5B D;  4Q5V A;  2F0E A;  3TME A;  5CV6 A;  1LT3 D;  3P1H A;  1L0Y B;  4AYB B;  4K5V A;  1Y1W B;  1PZK D;  1B9N A;  3M4Y A;  1SMY C;  3BDL A;  4R9W A;  1J9O A;  1II3 A;  1ET9 A;  5JPN C;  1LV9 A;  3OOC A;  3A8I E;  4C3I G;  1VCI A;  4J8Q A;  4A3J B;  2XWJ B;  4H7B A;  3SK5 A;  2LY7 A;  2EVB A;  1U9R A;  1E0B A;  3I90 A;  1PTO F;  1OXS C;  4IFD G;  4BWG B;  1F9R A;  1VF7 A;  2ICE C;  4IUV A;  3MXU A;  1HXY D;  4XT1 B;  2B2Y C;  5A2Q L;  3NQI A;  1JB3 A;  1I6V C;  4A3K B;  1SE4 A;  2V4D A;  1B50 A;  3AMU A;  2OF1 A;  3A8K E;  1JR0 D;  1HFG A;  1AP0 A;  4LAA A;  4ZKC B;  3PO2 B;  1A3T A;  2PW5 A;  2A68 D;  3ITP A;  1B53 A;  3NWS A;  2H1E A;  1Q12 A;  1W6J A;  3CU7 A;  2E74 C;  3K7A B;  3K5N A;  4DF7 A;  4DN4 M;  1X3Q A;  1XYI A;  3CRK C;  4ZLT F;  1R4P B;  1PTO B;  2LKV A;  1M4V A;  3D3R A;  2F1M A;  3D6C A;  2JA7 B;  1H9K A;  1JOK A;  3TP7 A;  1C8C A;  5IT9 L;  1ONL A;  3VR3 A;  1O7Y A;  5JEA J;  2A6H C;  4DXG A;  3H0G B;  1WVL A;  1EYC A;  1UAP A;  4ODG A;  2WV6 D;  1TS3 A;  4M8A A;  2NVT B;  2Q8I B;  2TMP A;  1R9T B;  1L0X B;  3NTH A;  2WKC A;  3HOW B;  3S2H B;  3V96 A;  3SR1 A;  4B9W A;  1EU4 A;  4RH6 A;  3KLS X;  1CI3 M;  2N55 A;  4G7O C;  2FFK B;  1I6H B;  3MC0 B;  1DD2 A;  1FNW A;  1U4P A;  2SNS A;  4H13 C;  1RTO A;  2F4I A;  3D6W A;  2LFN A;  3I4L A;  4XDX A;  2EYP A;  1WTR A;  3A55 A;  2E76 C;  1STY A;  3OMC A;  3OIQ A;  3J80 L;  5CV7 A;  2K01 A;  4XYQ A;  1E2V A;  4QMG A;  2SDF A;  1G29 1;  2VUM B;  1MSG A;  4HSP A;  3SXH A;  1EU3 A;  2EJG C;  5I6Y A;  3ZYY X;  3BVZ A;  3PUW A;  4L6T B;  1YNN C;  1U4M A;  4K2L A;  5CV4 A;  4C2M B;  2AWN A;  1KLU D;  3BDC A;  4GZY C;  1LTG D;  2L11 A;  4FF2 A;  3SE0 A;  1DJR D;  1QE6 A;  3SEB A;  1CZG A;  4HSV A;  4HED A;  3TP8 A;  1OXV A;  2F0L A;  2RDH A;  3S17 B;  3F2U A;  1QWY A;  4ZYS A;  2F0M A;  3T13 A;  1PRT F;  1V43 A;  3OPO A;  1DZ1 A;  1V8Q A;  1TWH B;  4KN4 C;  3C3L A;  5T1I A;  2RSN A;  2WB1 B;  2A69 C;  2L9H A;  1SE2 A;  2JA6 B;  1O7Z A;  5K36 G;  1QOH A;  4HMI A;  4KI0 A;  4OO1 I;  5C3X A;  4OIJ A;  4HCS A;  2RVL A;  3Q23 A;  1BOS A;  1X3P A;  4MN3 A;  1HTL D;  5JOB A;  1LAC A;  1PDQ A;  1JCK B;  2MP1 A;  1LTI D;  1WTX A;  4MHE A;  3PV0 A;  1BR9 A;  2K32 A;  5J39 A;  1EOT A;  5C0X I;  2WP8 J;  3OWF A;  4ABN A;  1SYB A;  3WDN A;  3FPP A;  3MXN A;  1PRT B;  2AQ3 B;  5FK9 C;  1HQR D;  4DK1 A;  2NBF A;  1OO9 B;  4HMJ A;  1U4R A;  5E4X A;  4V19 0;  1A3U A;  5C0X G;  4QUC A;  2KCC A;  2B2T A;  2EY2 A;  4BY1 B;  4BA2 I;  5CGK A;  4Q0F A;  1WTQ A;  5EGT A;  4X3S A;  1UNS A;  3I3C A;  2KED A;  1K8M A;  2RDF A;  1TR5 A;  4C56 C;  2PO4 A;  3EQL C;  1TU2 B;  2RKS A;  1BCP B;  1EYD A;  1SYC A;  2IW3 A;  4L8J A;  4PMB A;  3OSO A;  1F2Z A;  4A3M B;  4NKL A;  1Z47 A;  1PTO H;  4CKB A;  2HDM A;  3TP5 A;  5JJZ A;  1F2L A;  2JEA I;  4H44 C;  1DOK A;  1ENA A;  1ESF A;  1STN A;  1TQO A;  3TZD A;  2R61 A;  1RD9 D;  5KGU A;  4KK7 A;  1CFM A;  1DOM A;  4WFN 3;  4ZRZ A;  2YU9 B;  1SJH D;  1EEF D;  3GTJ B;  4V0B A;  2KVM A;  3HEJ A;  2PYK A;  5A35 A;  3ERQ A;  4PMW A;  1TVX A;  2JE6 I;  5IGE A;  5CV8 A;  1D1I A;  1TY2 A;  1I4X A;  3I8Z A;  2LMC B;  5M3F B;  4TRD A;  2A74 C;  2G9H D;  1FR3 A;  2F0T A;  3QJY A;  3UI2 A;  2KA7 A;  4QF4 A;  2F3V A;  1JWM D;  1CQF A;  3OHX C;  4CJ1 B;  3AB9 A;  4IFD H;  2K03 A;  2IX0 A;  1BXT A;  1E2Z A;  5DEH A;  3URY A;  1HTP A;  5D14 A;  2DY7 A;  3J7A V;  3TN2 A;  4KY6 A;  2NWG A;  5D3D A;  2SEB D;  3KLS A;  3MAQ A;  3LX0 A;  1CA6 A;  3BVG A;  1IW7 C;  4RAU C;  1VDZ A;  4MIU A;  4DAY A;  1PYW D;  1ICW A;  5LL6 S;  1GUG A;  3HKZ B;  4K2K A;  3T56 B;  3RMH A;  2MJ8 A;  1CM9 A;  1S5C D;  3LWE A;  1K8O A;  4K5W A;  1ZYR D;  4YIJ A;  3TSS A;  1H9R A;  2K05 A;  3R93 A;  2AUJ D;  3IFD A;  2HCI A;  3A7A B;  1ILP A;  2AWO A;  1X32 A;  1BBX C;  1TKW B;  4FVM A;  2BOS A;  4PMC A;  4S3S A;  2D2C C;  4P2C B;  5C4H A;  2F0Q A;  3GTK B;  3DMU A;  1LT4 D;  1RDP D;  1Q8I A;  3N52 A;  1Y1V B;  3IKJ A;  2RBM A;  3CHB D;  3S14 B;  3PMF A;  1V1O A;  2IX1 A;  2R92 B;  3SK8 A;  2X69 A;  1CA5 A;  1JWS D;  3I70 A;  5E4W C;  1O80 A;  5DM7 3;  1GHK A;  3D4R A;  4IUR A;  4O42 A;  2WIN B;  3GO5 A;  4E6I A;  4RGO S;  2MHV A;  3TDQ A;  2A6E C;  1I4G A;  1SNM A;  4FXG C;  2JP1 A;  1SJE D;  3RLF A;  4RCN A;  4J6H A;  1CK1 A;  1SE3 A;  3QIA A;  3M7G A;  2X6L A;  1B3A A;  1MGS A;  5M5X B;  4N9P A;  1BDO A;  5C4J B;  3H6M A;  4KJO A;  4OL7 A;  2RQX A;  4K14 A;  4RFB A;  2E2D C;  1UUP A;  2EZV A;  1XXG A;  3C1E A;  2AUK A;  5EKL A;  4G7Z C;  5I4D A;  2EY1 A;  1EY7 A;  3I4M B;  5D65 A;  5K36 H;  5KND A;  5IOC A;  2C9O A;  1HUN A;  3K5M A;  1GXD C;  2KOL A;  2L12 A;  5I2Y A;  3KLR A;  3L7Z C;  3NHH A;  1HA6 A;  4WOR A;  2BE5 C;  1PZI D;  2SOB A;  4OO1 H;  3BDO A;  2DY8 A;  2NZ1 D;  4IFD I;  3SK6 A;  3S1N B;  1EY4 A;  4DGZ A;  1GUW A;  3A7L A;  2HCC A;  3PIO 3;  2PZT A;  2R7Z B;  3I72 A;  5KRU A;  1QNK A;  2B2V C;  3I73 A;  1ZXT A;  1PFB A;  5C0X H;  2MUY A;  2QF7 A;  4C1N K;  4ZQ3 A;  3H09 A;  1G6Z A;  4BBS B;  4QUF A;  1OXX K;  5CR3 A;  1AEX A;  4LK1 C;  3DWQ A;  3GTQ B;  1ESR A;  4I7Z C;  3KF8 A;  3ERO A;  4QB4 A;  3RZD B;  2PZU A;  2OT2 A;  1KAB A;  1XTC D;  1XX8 A;  1PMR A;  1SYF A;  1QB5 D;  3QB3 A;  1B9M A;  2R93 B;  1Q1B A;  5FLX E;  1DYQ A;  1JOO A;  1FNU A;  4C3H B;  2VB2 X;  2Y0S B;  4IUN A;  5C3W A;  2EJM A;  5EKI A;  1Y8O B;  1HHV A;  1KNE A;  3MA2 B;  2NN6 G;  1ZKO A;  3H3V C;  1LTB D;  5TSS A;  3PUX A;  2IWH A;  2EPB A;  2M9V A;  1OXU A;  1PRT D;  1BQQ T;  4KY5 A;  4HR7 B;  1C4Q A;  2EOT A;  2MGS A;  3E6Z X;  1EY9 A;  1GUT A;  1Q90 A;  2L0C A;  4A3B B;  1SYG A;  2L4N A;  4OGQ C;  2E2J B;  1B4O A;  5CV5 A;  1B2T A;  3S1M B;  1WD0 A;  1BUV T;  4ZK9 B;  2JEB I;  1LLR D;  1FGB D;  2RA4 A;  5E3F A;  4PNY A;  5T1G A;  5C4Z A;  1JWU D;  2K04 A;  4KKS A;  4RCO A;  3ND8 A;  1BCP D;  2M00 A;  4XTC S;  2EY5 A;  2IJ0 A;  1GUO A;  4C3I B;  1CQV A;  2YYZ A;  1UEA B;  1G2T A;  4IUT A;  4XQJ A;  5ELE A;  4IN3 A;  2B2U C;  3SHL A;  2O5J C;  2KUM A;  2NYZ D;  2Z4H A;  2QEJ C;  3VYU A;  4A3D B;  5C44 B;  1TS4 A;  4XT3 B;  2F0U A;  3T53 B;  2XSC A;  3NBH A;  5J1Z A;  3BS1 A;  1TII D;  3RUZ A;  2ZT9 C;  5KYL A;  3GTP B;  2B8F A;  2VB3 X;  3SVM A;  1YNJ D;  3O13 A;  4KMU C;  2K7V A;  4PQX A;  5JEA G;  3X3N A;  1EQT A;  3D8G A;  3GV6 A;  3K6O A;  2B39 A;  2FMM A;  1IHZ A;  4IZ8 A;  4LMQ D;  2CW0 C;  5CMD A;  4KKU A;  4F8M A;  3J81 E;  3C2P A;  2K5D A;  5CV9 A;  5C3E B;  5CBA E;  3W2D A;  3IAY A;  1ILQ A;  3R2T A;  1GJX A;  2HUG A;  4XYO A;  2NVQ B;  2L5T A;  1GUN A;  2F0H A;  1H9S B;  1EY8 A;  4XXE A;  1D5X C;  3K5O A;  2EDG A;  5C4X B;  1STB A;  1BCP F;  1WTV A;  3NBI A;  4K8I A;  1H9S A;  3QOJ A;  5IIF A;  4CBV A;  3SDZ A;  3EJI A;  4NDX A;  3FRP B;  3ND9 A;  2K1B A;  3T4A C;  5CBE E;  3CRL C;  3K58 A;  2B63 B;  4IAL A;  4BS9 A;  5ELD A;  2E2H B;  3QWN A;  5D3I B;  5FLX L;  2LS0 1;  4DFA A;  2QCP X;  1SNC A;  2IL8 A;  4KHV A;  3D4D A;  4WJW A;  5M5W B;  2XRS D;  1PFN A;  1RCV D;  3DWP A;  1D6E C;  2B2W A;  1CHQ D;  3LNN A;  3VA5 A;  4EVO A;  5C5M A;  1TT2 A;  3VR4 A;  1AW7 A;  1E2W A;  2Z4I A;  2KJX A;  4A3F B;  4QIW B;  1LTR D;  3M85 A;  1SMY D;  1I3Q B;  5JPM C;  4NMZ A;  2NVX B;  1CZW A;  2JXM B;  2MPM A;  2E75 C;  1KDC A;  2M2L A;  2DNE A;  2G9D A;  2WAC A;  2ICI A;  3HZX A;  1AFP A;  3R2I A;  3MEH A;  2OEO A;  3MFY A;  5HUR A;  4RGN A;  5AFW A;  2A68 C;  3IFT A;  4K8J A;  4PV1 C;  1I4H A;  4IUQ A;  3OW7 A;  2CVR A;  4A3I B;  4BBR B;  1KTK A;  1JE4 A;  4JBW A;  3K59 A;  1EIH A;  2DN8 A;  2Z8L A;  1S5F D;  4J1M A;  5KEE A;  3VYS A;  4X3T A;  3ONA B;  2I07 B;  1MI2 A;  4XQQ A;  5M9O A;  2WKD A;  1JOR A;  4IUP A;  3SK4 A;  4DNR B;  4A3E B;  4M1U B;  3KK7 A;  5KNB A;  2VNU D;  1RF2 D;  5HGT A;  1B44 D;  1SAP A;  4CKE A;  1VMP A;  2EYJ A;  2A6H D;  4F7X A;  5IOD A;  4LJZ C;  2X6G A;  4RWS C;  1V1P B;  3J81 L;  2NN6 H;  2F0I A;  5KYI A;  5JVG 3;  3WOF A;  3CKI B;  5COR A;  1V1P A;  5A2Q E;  2PW7 A;  3QOL A;  3NUC A;  3VR5 A;  2ZXO A;  5IGF A;  2WAQ B;  5EBD A;  1EZ8 A;  1D1K A;  1SXT A;  1F2Y A;  3S1R B;  4HAE A;  3S16 B;  2E2I B;  3MFG A;  5DNF A;  1TWF B;  3DEP A;  3PO3 B;  2XNA C;  2A73 B;  3HOX B;  1T5X D;  1QIL A;  2F0D A;  4NW2 A;  3VA7 A;  4DA2 A;  5IGD A;  1YNN D;  4K6D A;  1LTS D;  1EIG A;  3VYR A;  1AZP A;  3JAM E;  2XRQ D;  3G7L A;  4RKL A;  3U9S A;  1Y69 U;  1RTN A;  3U9O A;  4G7H C;  3H94 A;  5FOB B;  3N6R A;  4FXK C;  1O78 A;  1STE A;  3DM1 A;  5K5P A;  2B8G A;  3FEW X;  3PUV A;  2B2V A;  1KAA A;  3NTI A;  2DNC A;  3NE5 B;  2A69 D;  2FHT A;  2F0J A;  4ZUI A;  2CQA A;  1A6X A;  2B2Y A;  3E0J A;  3J80 E;  3LWU A;  4HN7 A;  3V05 A;  5JEA H;  3GTL B;  1WD1 A;  5M3M B;  4IFD J;  3HOV B;  1A15 A;  3Q22 A;  1DOL A;  1RHP A;  5J22 A;  2D62 A;  5CC4 A;  2BA1 A;  2WII B;  2F0O A;  4XIG S;  1VMC A;  1GHJ A;  1SFO B;  5CYU A;  2ZXR A;  3G6J B;  4KKT A;  2EYL A;  1KDB A;  1JIC A;  1Q1E A;  2F0P A;  5EKK A;  1G91 A;  3S1Q B;  2C5C A;  3I4N B;  2QIL A;  3H91 A;  4FYD A;  1BF4 A;  4ULL A;  4IQZ A;  2F0N A;  4RHR A;  3MZ5 A;  3BYT B;  3S2D B;  1Z7T A;  4ZUJ A;  3MHB A;  2QDB A;  1LAB A;  3Q0A A;  3OWE B;  2K6A A;  5IGB A;  4OHJ A;  3QO2 A;  3BZD B;  3HOY B;  3A56 A;  4I65 A;  3M3Y B;  2VXW A;  4FF3 A;  2KEE A;  2NTT A;  1JC7 A;  2GA4 B;  4U68 A;  1S5D D;  5EJW A;  3HGB A;  1D5M C;  5DAU A;  2EYM A;  2A5H A;  3EVQ A;  2B2U A;  2NN6 I;  4HTH A;  4K6L A;  3MXP A;  2Z1C A;  3M4O B;  1EY0 A;  2F0G A;  2N88 A;  1D5Z C;  1SBB B;  1ET6 A;  1TWG B;  3GTO B;  4QCL A;  3GTG B;  5KNC A;  1DXM A;  4CJ2 C;  1FNV A;  1JOQ A;  1D2B A;  1HQM C;  5E1F A;  3M7N A;  3I91 A;  1WTW A;  1G8Z D;  5EBC A;  1W6K A;  3A8J E;  4CKC A;  4CHT B;  5NUC A;  3NQT A;  1HRJ A;  5EPL A;  4OIK A;  2RDG A;  3JAM L;  5I9P A;  1PZJ D;  2R3Z A;  1A3V A;  1HPC A;  1ZYR C;  1QNU A;  1IW7 D;  4TSS A;  3VYT A;  4RHS A;  3CQZ B;  1EL0 A;  2J0T D;  3P20 A;  5ELF A;  3S9W A;  1SNQ A;  1I4R A;  4G4K A;  1ENF A;  4G57 A;  5COY A;  3QG1 A;  2D9U A;  2F03 A;  3DEO A;  3R3O A;  3FKI B;  4RKB A;  1FYC A;  4Z9C B;  1MSH A;  3FPU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...