4YIJA

Crystal structure of staphylcoccal nuclease variant delta+phs a109e at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Nuclease A
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4yijA00
2LKVA 2SOBA 1SYFA 2F0JA 2F0KA 3P75A 1JOKA 4KJOA 4MIUA 5CV7A 3SK4A 4F7XA 5CGKA 5KGUA 4N9PA 1A3VA 4QMGA 2PZUA 1EY0A 4HMJA 3TP8A 1TR5A 2F0IA 5JOBA 2SNSA 1SNDA 5C4HA 3QB3A 4K2KA 5IGGA 4NDXA 2F3VA 3MEHA 3SXHA 5IODA 4KJNA 5CV8A 3NP8A 4PMCA 1EYDA 4KV6A 4S3SA 2F0PA 3NUCA 4NP5A 4KD3A 5C5LA 4EQPA 2EY2A 2F0TA 1JORA 4EQOA 4DU9A 3SK5A 2OEOA 1F2YA 5CV9A 2EYFA 4NKLA 5C5MA 5CV5A 2M00A 2F0HA 1F2MA 1KDBA 2F0LA 1EZ8A 2F0NA 2OF1A 3DMUA 5CV4A 1A3UA 5IIFA 1II3A 2WACA 1STYA 5I9OA 1KABA 1SNMA 2PQEA 2EY5A 2EYLA 2EY6A 2F0OA 3ERQA 5DEHA 5IGBA 5I6YA 4OL7A 4DGZA 2PZWA 3T16A 3D8GA 3OSOA 3MVVA 4B9XA 5IGDA 1TQOA 4NMZA 3SR1A 1NUCA 3HZXA 3EVQA 4ZUJA 1EYCA 4WRDA 4YIJA 1EY8A 2F0FA 3EJIA 5EKLA 3MZ5A 5ISRA 1EQVA 2EYJA 4ZQ3A 5EGTA 3D4WA 1SYBA 2F0UA 4PMBA 3U9OA 4KD4A 5E3FA 5IGEA 1KAAA 2OXPA 3EROA 4ODGA 5KEEA 1EY9A 4QF4A 4I65A 5I6WA 2F0GA 5I9PA 5EKKA 4WORA 4B9WA 2F0WA 2F0MA 3MHBA 1STGA 3MXPA 3BDLA 3LX0A 3OWFA 1EY4A 4K5VA 2SNMA 4R8NA 1SYDA 4RKBA 1NSNS 4EVOA 3ITPA 5C4ZA 3D6CA 5KYIA 1SNCA 3NK9A 4KY7A 1EY7A 4K8IA 2PZTA 2QDBA 4KTAA 4QB4A 5HGTA 3OMCA 1TT2A 1JOOA 1A2UA 2F0QA 4IALA 4DF7A 3OMGA 4F8MA 1SYCA 2EXZA 3SK6A 1STAA 4K6DA 4KHVA 3TP5A 2F0VA 1A2TA 2PW7A 4K14A 4KY5A 1SYGA 4RKLA 5IOCA 2KQ3A 3NQTA 1KDAA 3H6MA 5IGFA 1SYEA 3DHQA 1SNOA 5CR3A 3TMEA 3TP7A 5JAVA 2O4XA 4J6HA 1EY5A 2KHSA 3HEJA 5KYLA 5KIXA 5DAUA 1ENAA 5J22A 1RKNA 3BDCA 5K5PA 5KRUA 2NUCA 4J1MA 4DFAA 4HMIA 2F3WA 3PMFA 1STHA 4LAAA 3VA5A 5IGCA 3S9WA 2F0DA 3C1FA 4KY6A 1AEXA 1ENCA 1STBA 5HURA 1IHZA 3R3OA 5C3WA 4N9TA 2RBMA 4H7BA 1EZ6A 4EQNA 5J39A 3P1HA 4PNYA 5J1ZA 1F2ZA 4ZUIA 2PW5A 1SNPA 4ME5A 4E6IA 1SNQA 1EYAA 2EYPA 4IZ8A 4K2LA 5CV6A 5M9OA 3E5SA 1JOQA 5NUCA 1A3TA 2EY1A 4K8JA 3SHLA 2ENBA 3NHHA 1EY6A 5E1FA 4K5WA 3C1EA 3QOJA 3QOLA 4HTHA 5F2DA 1KDCA 3V2TA 5CC4A 3SK8A 2EYOA 4IUNA 2HQEA 2F0SA 2EYHA 2EYMA 2RDFA 3D4DA 3RUZA 4ID6A 3TP6A 4K5XA 2RKSA 1U9RA 5C3XA 2PYKA 5C6AA 3NXWA 4G57A 1STNA 3T13A 2F0EA 4TRDA
chains in the Genus database with same CATH superfamily
1U5KA 2JA8H 3SK4A 5IWAQ 3GTJH 2YU9H 2IT1A 1VQ6A 2KCMA 1SBBB 5ELEA 4KJNA 3ZYYX 2FMMA 2EXDA 4RGNA 4YWMA 4DAYA 4NP5A 4CKEA 2RSNA 1PH7A 4ZCKA 1T5EA 1V9PA 5C3EH 3CCEA 4ZKCB 2QA4A 2EQSA 2BCOA 2F0NA 1VMCA 1W3SA 2QCPX 4POFA 4DPGA 5ELOA 1VQCA 3I56A 3RN2A 2E2IH 3MVVA 1YNJD 4XDXA 2A68C 1N32Q 3SR1A 1KAWA 2Z6BA 4KKUA 5EBDA 1TXYA 1S5CD 2DJFC 2F4VQ 1VQLA 4GNXB 4PMBA 3S2DH 5JEAJ 3AQQA 2K5HA 4A3KG 4MNOA 1EIYB 1F77A 1ESFA 1YHAA 1FYCA 1PTOF 4M1UB 2F0MA 1IBMQ 3AB9A 3UDFA 4HIOA 5C3XA 1EY4A 4K5VA 3TRZA 1NSNS 3URYA 4KY7A 4Q5VA 4JI4Q 2QDBA 5HGTA 1SJHD 4POGA 1PLFA 4BS9A 4KHVA 5ELBA 2VQFQ 1QG7A 1EU3A 3AU7A 4N8FA 3S2HB 2YV5A 1SYEA 1SNOA 2KA7A 1EY5A 2X6LA 5LMNQ 4DFAA 1PTOC 3HOUG 3LWUA 5DM73 3AFPA 1IBLL 3DXJC 5ELNA 4APVA 5JEAH 2WIIB 4L5TA 2RBMA 2AUKA 1KQSA 1TWCH 1I94Q 4WJWA 3F2CA 1Z9FA 3LGJA 3H15A 2VUMB 4OGQC 4R9WA 1GHJA 1OXSC 2NZHA 4B3TQ 3T53B 3CQZB 4P74A 4R4OA 1BCPB 4QUFA 5KNCA 3PUWA 1UE7A 4DAVA 1BXTA 3F2DA 2ICIA 3D4DA 2N88A 3I4NH 5FJ8H 5M5YH 1FVIA 3MXGA 1RIPA 3TZUA 1IBKL 1LTRD 3DLLA 3A0JA 3KBXA 4K0KQ 1WCMH 3E9HA 5AJ3L 1AP0A 5LL6S 1LV9A 2F0IA 4HAEA 1DOKA 1ET6A 3MEHA 2B2TA 4HCSA 5FLXE 2AHOB 5IT9L 3NELA 2Q2IA 1IZ6A 4Q0FA 1SDFA 3HOVG 1IYVA 4B3ML 1K0SA 1EYGA 1BKBA 2C9OA 1SLJA 4X3SA 2OF1A 2D5DA 2EOTA 5EQ0A 2NN6G 3AMUA 3ERQA 4Y7NH 4A3GB 3STBC 4LFAL 1EEID 5M5XB 4NW2A 2I46A 1K3BC 3KLSX 1PA6A 2UUBQ 4GKKL 3S16H 3PCOB 4PMWA 2PO4A 3H3VC 2E5LL 4RGMA 2JA7B 2I07B 3H0GH 4JI8L 5M3MH 4A3CH 2F4IA 1LTGD 2ZJQA 4JBMA 4JI6L 3HGBA 4X66L 4BWGB 1EY9A 4LUOA 5GQOA 1PH1A 5FOBB 1B4OA 3KOJA 1R4QB 4OIKA 5BR8Q 2SNMA 4LMQD 4EVOA 2NYZD 1X54A 5C3EB 1MSHA 3HKZG 4BBSH 2F0QA 3BJUA 5C0XH 4K0KL 1QILA 1RDPD 3TREA 1N33Q 1A2TA 3J80L 3FEWX 2KQ3A 2ZM6L 2G9DA 4R1JA 1Y8NB 3H6MA 4HN7A 3CU7A 2R6GA 3CXCA 4OO1H 5KYLA 2D9UA 3K5NA 4P72A 4X3KA 1V43A 2Q2UA 2FMCA 4HIDA 1HR0L 1C7YA 4DXFA 3N52A 4WFN3 4C2MH 2AWNA 5HURA 1VQ8A 4L6TB 1GHKA 1B9MA 1Q8IA 5GROA 3PSIA 4HJAA 4DR6L 1LLRD 4EQ5A 4LUVA 1QUQA 5NUCA 4A3EH 2JEAI 1E1OA 1Y14B 5J3BA 2BH2A 3QOLA 2QKIC 2PMZE 2JA6G 5FO7B 3ONAB 1YJNA 1BCPF 1K83H 2IW3A 2RDFA 2RHQB 3NWSA 5EPJA 4DUZL 1WI5A 1PV4A 2Z8LA 2NZ1D 3IKJA 1H9SB 2HCCA 3HOYB 1T9HA 2K03A 1SYFA 2VXWA 3TS2A 3GV6A 1M90C 1KLGD 4MHEA 3F2BA 2I5MX 3I3CA 1NCVA 2KCNA 1E2WA 1ONLA 1ZYRC 4BBRG 1D5XC 3CCJA 2F03A 4A3DH 1UE5A 1O7IA 3UI2A 2L9HA 1PYSB 1EEFD 4FXGC 3M4OH 1GOZA 3GTOH 2CWAA 1FD7D 1I50B 4GNXC 1Q12A 1MD2D 3UDGA 2M9VA 3I72A 3GTLH 2K14A 2L12A 1KIXA 1IBML 2V1CC 4NMZA 2KHIA 4MZ9A 1VDZA 1HNWQ 2A5HA 4PZ7A 2KCCA 4DV4Q 2UU9L 4IOAA 1O7LA 2OXPA 2O5IC 1I6HB 3IFDA 4LFCL 2B2YC 1ICWA 4P2CB 4P75A 2Z6KA 1N32L 5FO9B 1STGA 4JBKA 2PI2A 4DV6Q 2QF7A 4OONA 4OX9L 2B2UC 1TS2A 2UUAL 1TT2A 1PTOB 1A62A 2ZXPA 4IURA 1STEA 5L37A 1STAA 1TU2B 4DR7L 1FNVA 4K14A 1QZGA 3Q24A 1RCVD 2A69D 3NQTA 5JJIA 2K05A 1JICA 2D0OA 1K3RA 1C0AA 4U68A 3MEFA 1TY0A 2PQAB 1F2LA 1JT8A 1OXTA 4XXEA 1DD2A 1CI3M 3A5ZB 2M2LA 3HKSA 5C3WA 4DR5L 2JYOA 1CZGA 2F4VL 4C3JG 3G6EA 3I91A 4KI0A 1HNZQ 1K8OA 2B2UA 3ICEA 3A8IE 4GN4B 4Z9CB 1VQ5A 4V0BA 2Z4HA 5EBCA 2ZTCA 3D31A 4LWCA 4C3JB 1VQFA 1HUNA 5DLQE 3X3NA 2UUCL 2RKSA 4O1NA 4RCNA 4RWSC 4B3MQ 1CZWA 4RGOS 1HTPA 4LF7Q 4CDCC 1EIHA 1BDOA 2ASBA 2A69C 3GTLB 1KL9A 4GLAC 4A3LH 2LS01 3CAMA 2JP1A 2PI2E 1NJIC 1YNXA 3PUXA 5C0XI 2R93H 2UUBL 5C4XH 3A55A 1G291 4U673 1V1PA 5C5LA 4HSVA 2NVYH 2RCFA 1EIFA 4JI1Q 4KN7C 2HDLA 4IOCA 3K8AA 5I2YA 3B6YA 1B70B 2WACA 2BOSA 3K0XA 4LFCQ 1I4QA 4UAIA 3K7UC 1KLUD 2DY8A 4BY7B 4B9XA 3SDZA 1CHQD 4C1NI 4GLXA 3M3YH 3KUPA 4JI3Q 4C56C 2ICEC 4I7AA 4L63B 2A6HD 1QB5D 4QF4A 5C4JB 2B2WC 4A3FB 3CRKC 5I6WA 2ZM6Q 3ZJYC 2LY7A 4ZRZA 4KHPQ 3J81L 3KJOA 4IFDJ 2EJMA 2EPBA 4RKBA 5EPKA 1SYDA 4P71A 4DAMA 2OWOA 1U0LA 3VR2A 4A76A 3T1HL 2BA0A 2KEDA 4QB4A 3S1NH 3VR6A 3J81i 1W2BA 4KY5A 2F0VA 4FNFA 3FVQA 3W1GA 1Z47A 4YHHL 4DV2L 2R92H 1EQRA 4C3HH 5FO8B 5C44G 1IKLA 4AIMA 5A2QE 2VS1A 1G2SA 2RQXA 1MJCA 4JK1C 1Y69U 3Q6SA 4G7ZC 1XPRA 4CBVA 2XNAC 1WTXA 1SROA 3DWQA 2UUAQ 4A3JB 4GOPB 2AKWB 4AQYL 4RGTA 1SNPA 1TWCB 2BE5D 4ME5A 1EQQA 2R7FA 1AE2A 3RNUA 4K8JA 2IPKD 1FL0A 1LO5D 1K0RA 1EY6A 2JSOA 5BN4A 4O2DA 1QNKA 3CC4A 1HR0Q 1LUZA 4R4TA 3KDFB 4CHTB 3NTHA 1I4PA 2BA1A 3KF6B 1J9OA 4IUTA 1SAPA 4HIMA 2K52A 3KF6A 2JE6I 1RHPA 3G4SA 1FGBD 1NR2A 2F0JA 4AYBB 4Y7NB 4A3GH 4IN3A 5CGKA 1G8ZD 4A3KB 1JWSD 3DM3A 4J8QA 1TIID 1GVPA 3L0OA 3SXHA 3KLWA 1VQOA 3GTGH 4S3SA 1LTLA 2J4XA 3SE0A 1B2TA 2AWOA 1TWAB 2AUJD 1WTQA 1I6VC 4LF4L 1Q81C 1EUJA 4DV4L 2SEBD 3A7LA 1RTNA 5I9OA 2EY5A 3S2DB 2ALYB 2B2TC 1K73C 3U4ZA 1PFSA 5IGDA 1TQOA 1CTMA 1U4LA 1X56A 3KF8A 3PUVA 4RA8A 5C0XG 3I4NB 3D4RA 3EJIA 4DNTB 1D7QA 3RLNA 5D14A 1N34Q 1SYBA 1X3EA 3SEBA 1VQIA 4IUQA 1SRUA 2XVSA 3FP9A 4I65A 2N78A 1MSGA 2RDGA 2NWGA 3S14H 1TVXA 1P8LA 2K4KA 5KYIA 2R92G 2NBFA 3PO2G 1D1IA 1HNWL 1PVOA 1VQ7A 2UU9Q 1X55A 1FR3A 2L5TA 1YIJA 2KCTA 3Q23A 4CDFC 2E76C 4LF8Q 3MAQA 3TMEA 3CF5A 3QIAA 2VUMG 3HKZB 4ULLA 3HKZE 1BBWA 1PYWD 2EVBA 1EFID 2F0DA 1EFWA 3K58A 5FKAC 5D3IB 4OWWB 3R3OA 1EZ6A 2BDNA 2K04A 1SNQA 1EYAA 5CV6A 4NXMQ 2MQHA 5IY0A 1JOQA 1A3TA 4DV5Q 3GTQH 1EWHA 1CQFA 2KVMA 1YNJC 2EYOA 3FKIH 1OXXK 1Q82C 4JYAQ 2OTLA 1MI2A 4DK6C 5LHY1 3U4VA 1LTSD 3ULPA 3J7AF 3GTGB 4OX9Q 2H4OA 1PMRA 2MO0A 1HNZL 3D0FA 2K50A 4NXNL 2AQ1B 1LTAD 1JJGA 2B8FA 2PZUA 5BR8L 2I0QA 1G6PA 2MJ8A 4PMCA 1EYDA 1QNUA 3PO2H 1PZID 2EJGC 4JI8Q 2EYFA 1PFNA 1CKNA 5M3FH 4IFDI 2F0LA 1A3UA 5IWAL 4DR3L 2E74C 4B3SQ 5DEHA 1DZ1A 3K6OA 1DXMA 1YHQA 4OEMB 1VQGA 2A68D 2PMZB 3HOXB 2A1AA 3TN2A 4TKOB 3HOWH 1JB3A 3VYUA 5EGTA 2ZXOA 2UUCQ 4KD4A 1KAAA 3PF5A 3S15B 4NB3A 4NXML 1B1ZA 5G3LF 2EZVA 1XNQQ 1I3QH 4CKCA 4A3IH 2A74C 4WORA 4KKSA 5BN5A 5M5XH 3NTKA 1TS3A 3HRZC 3C3LA 1N34L 3N6RA 2DUDA 4BBSG 2A6ED 3R93A 5LMUQ 4K6DA 4BA2I 2XWBB 3S15H 3T4AC 3CW2C 5JAVA 3GP7A 4B3TL 5DAUA 4KLKA 4X3TA 1XMQQ 1H9MA 2F3WA 3JAML 3S9WA 4TVAB 5M3MB 3EFXD 1PH2A 1CKMA 1IHZA 2JA6B 1MGSA 3BVMA 3P1HA 1TS4A 3VYTA 1WVLA 2B2VC 2KBNA 2K33A 2EYPA 2ATWA 2WB1B 5C4XG 4A3EG 5IP9G 4A3GG 3V2TA 4HSPA 4ALPA 4RH6A 4GOPC 1XJVA 1HZAA 4IO9A 1D1KA 1JE5A 4GN3B 4JG2A 3T13A 4FF1A 2QDLA 1XPUA 3RZDH 3Q22A 1LYLA 4QJFA 2Y0SE 4CGYB 4DV0L 3TP8A 1E3PA 5H1SE 3HOUB 4DR1L 4NDXA 2B63G 4A3MB 2VZAA 3BZKA 4YWKA 1BCPD 1H95A 2EY2A 5IE8A 1AZQA 5JEAG 2E5LQ 4EQOA 3VYSA 4BA1I 2NN6I 2C35B 3GTPH 1B44D 1UEBA 3H3VI 3AYHB 1EZ8A 1II3A 1STYA 2YYZA 1SNMA 4A3MG 5T1GA 1HZ9A 5IP9H 2CCZA 1E24A 4C3IG 1G51A 1LT6D 5E4WC 4B3RL 4IUVA 1NUCA 2L11A 4GN5A 1H9JA 4GNXA 2NVQB 4F87A 3MXNB 2NVXH 4DR4Q 2Z6KC 4ZQ3A 5E7NA 3MXNA 4JI5Q 1NR4A 2Y0SG 4BXXG 1Y1VB 2F0GA 2HHHL 4DUYQ 1GUOA 3K7AB 3V05A 4FP5D 1QJOA 1KHIA 3MXPA 1WTVA 2HQLA 3J7A5 4JCVE 3LWEA 2K5QA 4GKJQ 4DV1L 1VQEA 4X3UA 2JEBI 4BBRH 3L9AX 4PQXA 3UE0A 1HRJA 2UXCQ 4IPDA 4JOIA 1YJWA 1E1TA 3J7YW 2O4XA 3HEJA 5IYBH 1EL0A 3QR8A 2Z1CA 3GO5A 3K80C 4A3EB 3S1RH 1N8RC 2UXDL 3E9IA 1NE3A 1ENCA 3CC2A 4MTNA 1E22A 4H7BA 1N33L 4CJ0B 4C3JH 2J7ZA 2Q8RE 3WOEA 1Q8KA 4IZ8A 1XWEA 4OO1I 3SHLA 4JI2L 1FNUA 1I4GA 1KDCA 3G48A 3GTKH 2NVQH 3TP6A 4ABNA 3T1YQ 3S1RB 4UPAA 3CHBD 1JORA 3M4QA 4JBWA 1I4XA 3GV3A 5EPLA 2LFNA 1A3VA 1EY0A 1C8CA 1HH2P 4LF8L 1HPCA 2MP1A 4A3DB 3A7AB 4GKJL 4HEDA 2XWJB 1QE6A 3K0YA 2A8VA 1IW7D 1NBWA 1AFPA 1F2YA 4JI7Q 2VL6A 1JE4A 2M00A 4RMFA 3CD6A 4RHSA 3NSWA 5IIFA 3K7AH 1ZXTA 1S5DD 1MJEA 1GM5A 5LMNW 3R8BA 3RZDB 1XXGA 4OL7A 2JA5B 1HXYD 3J81E 1QCBD 3MWYW 1KXLA 1FNWA 1SE8A 1UAPA 4WJ4A 1BNZA 3A5UA 3MFYA 5ISRA 2IHEA 3RZOB 1A63A 5HGQA 3EROA 5GAEC 2RHSB 4B3SL 4LF9Q 2F52A 3DM1A 3MXUA 4XQJA 4BY1H 3MC0B 2DNEA 2F0WA 4B9WA 1PHJA 2WB1G 3OIPA 5C4XB 1SSOA 2P5ZX 2JA5H 5JPNC 3M4PA 4R8NA 3M3YB 1ILQA 1S5BD 3E3XA 2IX1A 1I4RA 4MN3A 5JJZA 2HIVA 1E2VA 2G9HD 3K59A 1Z6HA 3VR3A 1QZHA 1LT4D 2ID0A 4LF5L 2R7ZG 3EA6A 1M1KC 3DUZA 1GKHA 1SE3A 2QW7A 3LNNA 4DV1Q 1QVFA 4HCEA 2K32A 3NE5B 4HJ5A 1VQNA 1I4HA 4FYDA 1UNSA 3D6WA 3QO2A 5KNBA 2JXMB 4LF7L 3V96A 1HA6A 1W6JA 2QGQA 1CA5A 2AMCB 3VYRA 2VNUD 4DV3Q 4LFBQ 1XNRL 2EYHA 2EYMA 3S24A 1C4QA 1Y8OB 4XIGS 1SFOB 3PIOA 2PYKA 3RR5A 3KBGA 4G57A 4V190 3BDCA 3PUZA 1RL2A 4DV7L 4MIUA 2F0KA 4DR7Q 4GLVB 3P7JA 4IJHA 2KEEA 3A54A 2ES2A 2OTJA 1AE3A 4RG1A 4JI2Q 2L4NA 4A3FG 2SNSA 2WAQE 1WFQA 2WAQB 3PGZA 4FXDA 3O13A 3CMAA 4KV6A 4X62L 2R3ZA 4QCLA 4QQBX 4G7OC 3SK5A 1N36L 5CV9A 1PRTD 3CPWA 3DMUA 2UXBQ 3OYYA 1PYBA 3QWNA 2DY7A 1S4ZA 4A3CG 3Q8DA 2FFKB 5A35A 3T16A 3D8GA 4A3KH 3GD7A 1ESRA 3K57A 2B8GA 4UDUC 1EU4A 4I7ZC 1DYQA 1EQVA 2EYJA 3D4WA 2F0UA 4JOIC 3U9OA 5E3FA 4A3JG 5JJKA 2XSCA 1QOHA 1V1QA 4DV5L 1X65A 4JI0L 5I9PA 3OTOQ 5IYBG 1SE4A 4DV3L 1T5XD 4X64Q 5AFWA 1M4VA 1VQDA 4DV0Q 2LMCB 3RN5A 3NBIA 5IYDG 2XIWA 3LX0A 2ZTEA 1R4PB 2SDFA 1TY2A 1CA6A 1EY7A 4H13C 4M8AA 2QEXA 1IBKQ 1K8AC 1JJ2A 5E4XA 1B7YB 3F2UA 5M5YB 4KMUC 2PPBC 5DM63 3HOWG 2OQ0A 4XYOA 1LABA 3MA2B 1TS5A 3NBHB 2HIXA 1E7ZA 1Q90A 2KOLA 3K5MA 3HOYG 3KLSA 4DK1A 4DR3Q 3TP7A 1JQYD 4HJ9A 1CHPD 4BY1B 1GUNA 2NUCA 4J1MA 3PMFA 1PFMA 1TWGB 1GO3E 3CMEA 2OQKA 3CCQA 2KJXA 2O2LD 3FMCA 5FLMH 1WOCA 4FDBA 5CBEE 2K5NA 1TWHB 2VQFL 1VQPA 4DV2Q 2WFWA 1B8AA 1CSPA 2R61A 4UP7A 1RTOA 4FVMA 4FF4A 3CQZH 1L2FA 3J81c 1XNQL 1XMOQ 4YY3Q 4K5WA 4HTHA 2VW9A 4KHPL 1PRTF 2CQAA 2EIFA 1VQHA 4TSSA 3W3AA 2B29A 4G7HC 3NXWA 3VDYA 1JB7A 3JC66 3OHXC 3UE1A 1QVCA 2LKVA 3P75A 4F7XA 1QWYA 4OIJA 5C44H 3EQLC 5ELCA 1VQ9A 1WD0A 5IGGA 2GA4B 2F3VA 1UWVA 3HS0C 4FF3A 1GUSA 1ML0D 2HUGA 4CDDC 1U4RA 1NMGA 2E75C 1IKMA 2MGSA 3TBIB 3K5LA 5GADC 3IFTA 2CH4A 2EYLA 2EY6A 3PIO3 1XMQL 2PZWA 2E2IB 2OT2A 1S3OA 5CBAE 1EYCA 4WRDA 1L1OC 5EKLA 4LUZA 4WJ3M 4UP8A 1HZCA 4DR6Q 3DEPA 4C3IB 4YCUA 1K28A 3VR5A 2N49A 1X3GA 3J80c 5FLXc 2Q2HA 3L3OC 1PDQA 2JQOA 3MFGA 3D6CA 1DONA 3P20A 3JAMc 4K6LA 1XTDA 4IQZA 2ZT9C 4XYQA 2OCEA 2ZJRA 1SYCA 2CQOA 5IOCA 4RKLA 1F9PA 3TEHB 2R92B 4DR1Q 2KHSA 4YCWA 1XMOL 1X6OA 1YVCA 3GTMH 2K1BA 1WTOA 3CCSA 1TWFB 4NPSA 3W1BA 1XNRQ 1WTHA 5C44B 1X9NA 4DR4L 4ZKBB 1RD9D 4NXNQ 4E6IA 4A3FH 1CQVA 4PZ6A 4B3RQ 4DUYL 2K5VA 2GVAA 3C1EA 5F2DA 5KNDA 4BY7G 1K83B 4RAUC 3HOXG 4A3IG 5C0XJ 1YITA 3RLOA 3G7LA 3IRBA 1WCMB 4TRDA 1RJTA 2SOBA 3M4OB 1JOKA 2R7ZB 4X6AH 1IYUA 3OPOA 5KGUA 4N9PA 1F9SA 1V1OA 3D3RA 2IHFA 2E2DC 4HMJA 1HCZA 1OTCA 4DAYB 4LFBL 4K2KA 1TWGH 4JI4L 1HUMA 1HFGA 5CV8A 5LMNL 2F0PA 1SXTA 1WCMG 1BO0A 3M9BA 5C5MA 2YTVA 4EX5A 1O7YA 1P16A 4LJZC 2JN4A 2PQEA 2CH4W 4A3DG 1JCKB 3HOVB 1H9RA 4KKTA 3SGIA 3KF8B 2IWHA 2UXDQ 4HJ7A 3HZXA 1Z7TA 4ZUJA 1S5FD 4PV1C 1GD7A 1KD1C 1X3PA 5D65A 3T1YL 3H09A 4ODGA 1I6HH 3GTPB 1YNND 3PIP3 1LTTD 2CFMA 3VR4A 2EE1A 5HY6A 4BBRB 2JA7G 4A3MH 1PXUA 5I6YA 2Z9HA 5TSSA 1PH6A 3NK9A 1L1OA 2K7VA 3GDEA 4ZK9B 5M3FB 2LXKA 2E8GA 3S1NB 1WD1A 1L1OB 2CHBD 4GS3A 4IALA 2IY5B 1Q7YC 2H5XA 4LF6L 4HR7B 1SYGA 2DJGC 2RDHA 4XT3B 1PH5A 4LK1C 1EOVA 5T1IA 3CCVA 5KIXA 1ENAA 4F88A 5K5PA 5KRUA 1CUKA 4A75A 3VA5A 4GKKQ 4JI1L 2NVXB 2B63B 1BCPC 3AFQA 5LMUL 1HR0W 3I4MH 3PO3H 4C3IH 3UDIA 3F1ZA 4J15A 3H94A 1N9WA 1EOTA 1B3AA 2KHJA 3M4YA 5K36H 3TZDA 3NHHA 1J8IA 5E1FA 4AYBG 2WKDA 3SK8A 4IUNA 3ND8A 1JJCB 3GTKB 1Q46A 1G2TA 5LL6X 1U9RA 3I90A 1HQMC 2E2HB 1ASYA 3ERSX 3OSOA 1RF2D 2PNRC 2XRSD 4KJOA 1O7ZA 3IL8A 3NBHA 1YBYA 2L1BA 4OHJA 3OWEB 1SNDA 4C1NK 1Y8PB 1TWFH 3TS0A 5A2QL 4FO2A 3J7AV 3I4MG 2F0TA 4JI3L 3PO3G 1LT3D 2OEOA 1J6QA 5CV5A 5M3FG 3K81C 5I2XA 3CC7A 4AH6A 1KTKA 4ZLTF 5CV4A 1KRSA 2FHTA 1EQTA 3EN2A 4ILWA 2RA4A 3A74A 1YJ9A 5IT9c 2R93B 5IYDH 3S1QH 1UE6A 1IL8A 1X3QA 4FF2A 4FXKC 3EVQA 1GXDC 4YIJA 3H0GG 2BH8A 4QL5A 3MZ5A 5ELFA 1BBXC 1VQAA 2MO1A 2EDGA 3L2PA 1BQQT 5IGEA 2J0TD 5IP7H 4OWTB 1Y1VH 2A6HC 1QUQB 2TMPA 1JC7A 3OW7A 3MHBA 3S1MH 4DAPA 3CCLA 2D0PA 1IW7C 1SNCA 2H1EA 3EBEA 1ET9A 1S40A 5I4DA 3OW2A 1PTOH 2XGTA 2JK8A 1H9SA 2HD3A 2R7DA 2B63H 3SK6A 1ZKOA 2F1MA 1KDAA 2XN9C 3MTSA 2UXBL 3FPUB 3BDOA 3ER0A 3TQYA 3GTJB 4J6HA 2KUMA 4IJLA 1Q1BA 3JAME 3U58A 3NQIA 2XRQD 4JBJA 3HOWB 1PH8A 3CCUA 1JWMD 4C3HG 4DKAC 5J39A 2RCNA 5FLXL 1Y1VG 2VQEL 2AQ3B 3U9SA 3E6ZX 2MPMA 2MNAA 1JWUD 5M9OA 1EWIA 2LSSA 4IFDH 4DR2Q 1J5EQ 3J7ZC 1SR3A 1C48A 4ID6A 4JI6Q 1CT1D 2K5DA 2A19A 3Q0AA 2FXQA 3FRPB 5C6AA 3I4LA 5FK9C 2K6AA 1TWAH 4LF4Q 3CRLC 2DGYA 3I4MB 3PO3B 3BVGA 1PZKD 2K01A 2JA8G 5IP7G 4A3BG 3I2ZA 1GUTA 1FJGL 3A8JE 1TR5A 1U4MA 5D3DA 4JV5Q 4DXGA 3R2TA 4KN4C 5IODA 2NVTB 4JC0A 4EQPA 2RF4A 1B3QA 2YTYA 4DU9A 2KECA 3GTOB 2B2WA 2JA8B 4DN4M 4NKLA 1CFMA 5C3EG 2E2JH 2O5JC 1F2MA 1KDBA 4DA2A 3DEOA 2BE5C 1GUWA 1KABA 3DWAA 3S1MB 2F0OA 2Q8IB 4AQYQ 3OTOL 1PH9A 4A93G 3PV0A 1HFNA 3KK7A 2WB1E 1MKHA 2JA7H 2VB2X 3UDXA 4IPHA 2VQEQ 4P73A 3RMHA 4OWXB 3VA7A 3NTIA 5JVG3 4YCVA 3KJPA 1C9OA 2RVLA 3S17H 4A93B 3F8TA 2ZXRA 1M8AA 2N3SA 3I7FA 3IAYA 1B50A 2Q8TA 3OWFA 1F9RA 5C4ZA 3ITPA 3QG1A 4TQUS 4KK7A 1BOSA 4ZAIA 2FJ2A 4UY8C 3OMGA 2EXZA 2B2YA 4LF9L 1GUGA 3HOYH 3S2HH 3J81j 5IGFA 4A93H 3S17B 4O42A 4EGVA 4A3BB 1BR9A 5J22A 1IXRA 1XPOA 3BS1A 1STHA 1V1PB 2FINB 4DNIA 3H91A 1Y1WH 4O0AA 4PZ8A 1PH4A 1STBA 1NTGA 1K8GA 4N9TA 1JR0D 4EQNA 5G3LD 5JVH3 1F2ZA 5EKIA 1PRTC 2PW5A 3BG3A 4IUUA 3CPFA 5CYUA 3E5SA 2AQ2B 1D6EC 2IX3A 1LT5D 2NTSA 1MIUA 1ILPA 4B08A 5FJ8G 3PUYA 3H0GB 5CMDA 2WP8J 1OXVA 1RODA 2K75A 1E2ZA 4RFBA 3GTQB 1U4PA 4CDEC 5CV7A 4QY7A 1G6ZA 2QILA 3I70A 1XYIA 3KLRA 3AEVA 2E2JB 3M7NA 2R7ZH 2K5WA 3QJYA 2ZJPA 1K8MA 3GTMB 1CKOA 2MHVA 1PFBA 1B9NA 3E0EA 2Q2TA 1ENFA 1WTRA 3BYYB 2PNHA 2ZTDA 3RLFA 1S5ED 4OO1G 2B3GA 1IBLQ 1F9QA 2I5LX 3H3VH 4BBSB 1AH9A 2UXCL 1A0IA 2B39A 2WAQG 1NY4A 2GVBA 5IYCG 1EWCA 4OXPA 3STBD 3U50C 2QEJC 1SFOH 3M85A 1PTOD 2WINB 4DR5Q 3HG9A 1VQBA 4L5SA 4GOPA 4R4CA 1LACA 3BYTB 3E0JA 1YHBA 5KEEA 5M5WB 2JJQA 4JW0A 4QUCA 3HOUH 1LM0A 1D2BA 5AJ3Q 4RHRA 1O78A 2CW0D 3WOFA 3HFZB 3G71A 3NWTA 4C2MB 4H0LC 4KTAA 1OXUA 4Y52H 1IYJB 3OMCA 1H9KA 4YWLA 5K36G 1MBYA 1CKNB 4A3IB 2R93G 3CP0A 1DOLA 2PW7A 2VY3A 5M5WH 3NEMA 2Z4IA 2YU9B 5CR3A 4A3LG 2D2CC 1WJJA 4YY3L 5IGCA 4X65L 4LAAA 1HNXL 1CM9A 1R9TB 5GAHC 4IFDG 4QIWE 3C1FA 1AEXA 4KHZA 3WDNA 1HJPA 4A3JH 2V4DA 1A6XA 4PNYA 5J1ZA 1AW7A 3HOZB 1YEZA 3T51B 1L0WA 2VUMH 4H02A 4L5RC 4BY1G 4LFAQ 4K2LA 1BBUA 1SJED 2EY1A 1FJGQ 3KFUA 3KDFA 1L0XB 1XX8A 1A15A 1D5MC 3NPPA 3FKIB 1VCIA 2JA6H 2NB0A 4A3BH 1Q1EA 2CVRA 4H44C 3RUZA 4IUPA 5CORA 2A73B 2K28A 1WTPA 1OO9B 4LNQA 1FGUA 3PQIA 4UP9A 4MTKA 4DR2L 1PRTB 1J5EL 3J80E 3FDTA 2IL8A 4CJ2C 4UHVA 3S14B 3NP8A 1UE1A 1ZYRD 1VQ4A 1ZEQX 2C5CA 2L55A 1DOMA 4R4QA 2I5HA 5FLMG 1WTWA 2BDOA 2TSSA 1D8LA 4XT1B 2A6EC 3I4NG 4L8JA 1Q86C 3ULJA 1ICFB 2HCIA 2HHHQ 1NAPA 4BXXH 2EJFC 1NMFA 5JJLA 2PCFB 2LXJA 3I73A 1VQKA 1I50H 3I4OA 1UEAB 4DUZQ 1XTCD 5EJWA 1BUVT 4LF6Q 3CKIB 4HIKA 1I3QB 4BY7H 1SE2A 5C4JH 3KYHC 1MHWC 4GZYC 1IL2A 1DGSA 1W6KA 2CW0C 2NN6H 2NVTH 1Y1WG 3BDLA 3BZCA 3K5OA 2JA9A 2B2VA 4HJ8A 1E0BA 2HDMA 3FKIG 2PZTA 3CCMA 1JOOA 4ME3A 3TSSA 4JI5L 4DV7Q 4N8X1 4DF7A 1SMXA 4F8MA 3TP5A 3M7GA 1CSQA 4XQQA 3S1QB 4ZYSA 2WKCA 2MFIA 2NZOA 3NENA 5IT9E 3HOZG 3FPPA 3W2DA 1S72A 1RKNA 3PIPA 3CCRA 4HMIA 1BVSA 4DNRB 3T1HQ 1N36Q 5EAYA 2PQAA 1X3FA 2Z0SA 3RZOH 1B53A 3OIQA 4ZUIA 1KRTA 1KNEA 3T56B 1X32A 3JAMi 3W5OA 2HT1A 4IPGA 1EIGA 1VS0A 3X3MA 5CC4A 4JPBW 1TKWB 4RCOA 1G91A 2F0SA 2CWPA 3BZDB 4K5XA 3ND9A 4XTCS 1AZPA 1STNA 2F0EA 4XQNA 3RD4A 3A56A 1DCZA 4X64L 3HOZH 1YNNC 3HP3A 4R4IA 4L5QA 4QMGA 5JOBA 3ULLA 5C4HA 3QB3A 1KC8C 4DV6L 5GAGC 1R9TH 4DK3C 5IYCH 4AYBE 3NUCA 4KD3A 1Y1WB 1UUPA 2RSOA 2L15A 5COYA 1L0YB 3PO2B 3L7ZC 2F0HA 1YZ6A 3BU2A 2E2HH 1PZJD 3EIVA 2YTXA 4QIWB 1ASZA 1BF4A 5IGBA 1HHVA 3J80i 2DN8A 4R8IA 1VF5C 4DGZA 4OELB 3HOVH 1HA5A 1VMPA 2KENA 3BVZA 3G6JB 1AN8A 1NNXA 1LTBD 1VF7A 3HOXH 1EY8A 2F0FA 1D5ZC 3WWVA 4JI7L 3SVMA 3R2IA 1DJRD 4C3HB 2NTTA 1LTID 1JMCA 1HTLD 5EKKA 2L0CA 1CK1A 1HQRD 4G4KA 5JPMC 1QVGA 1PH3A 2GN5A 4LF5Q 2N55A 2IJ0A 4JYAL 5ELDA 4JVZA 1HNXQ 3C2PA 2D62A 1O80A 4K8IA 1V8QA 1WYDA 2Y0SB 4LW1A 1A2UA 3GQBA 4CKBA 4X66Q 5BN3A 1A8VA 1GJXA 2F3IA 5M3MG 1KNAA 3A8KE 3I8ZA 3DWPA 1I94L 2JA5G 4PG3A 3FHWA 3DHQA 4JV5L 1Q3LA 2WV6D 2N8NA 4IPCA 1SN8A 4DK0A 2VB3X 2X6GA 4KY6A 2XTIA 1K9MC 4A4IA 1YI2A 4QGUA 1SEBD 2CKZB 1TWHH 4YHHQ 2IX0A 1I5FA 3TDQA 3I55A 1HZBA 2DNCA 2ENBA 1VQMA 3OOCA 3QOJA 4X65Q 2NVYB 1SMYC 3C46A 1SMYD 2HQEA 3S16B 3PF4A 4X62Q 4CJ1B 2X69A 2MUYA 2G5DA 5DNFA 1DM0B 4JI0Q 1VQJA
chains in the Genus database with same CATH topology
3SK4A 2IT1A 1SBBB 5ELEA 4KJNA 3ZYYX 2FMMA 4RGNA 4DAYA 4NP5A 4CKEA 2RSNA 1T5EA 4ZKCB 2BCOA 2F0NA 1VMCA 2QCPX 3MVVA 1YNJD 4XDXA 2A68C 3SR1A 4KKUA 5EBDA 1S5CD 4PMBA 5JEAJ 1F77A 1ESFA 1FYCA 1PTOF 4M1UB 2F0MA 3AB9A 5C3XA 1EY4A 4K5VA 1NSNS 3URYA 4KY7A 4Q5VA 2QDBA 5HGTA 1SJHD 1PLFA 4BS9A 4KHVA 5ELBA 1QG7A 1EU3A 3AU7A 3S2HB 1SYEA 1SNOA 2KA7A 1EY5A 2X6LA 4DFAA 1PTOC 3LWUA 5DM73 3DXJC 5JEAH 2WIIB 2RBMA 2AUKA 4WJWA 2VUMB 4OGQC 4R9WA 1GHJA 1OXSC 3T53B 3CQZB 1BCPB 4QUFA 5KNCA 3PUWA 4DAVA 1BXTA 2ICIA 3D4DA 2N88A 3MXGA 3TZUA 1LTRD 3KBXA 1AP0A 5LL6S 1LV9A 2F0IA 4HAEA 1DOKA 1ET6A 3MEHA 2B2TA 4HCSA 5FLXE 5IT9L 4Q0FA 1SDFA 1IYVA 2C9OA 4X3SA 2OF1A 2D5DA 2EOTA 5EQ0A 2NN6G 3AMUA 3ERQA 4A3GB 1EEID 5M5XB 4NW2A 2I46A 3KLSX 4PMWA 2PO4A 3H3VC 4RGMA 2JA7B 2I07B 2F4IA 1LTGD 3HGBA 4BWGB 1EY9A 5FOBB 1B4OA 1R4QB 4OIKA 2SNMA 4LMQD 4EVOA 2NYZD 5C3EB 1MSHA 2F0QA 5C0XH 1QILA 1RDPD 1A2TA 3J80L 3FEWX 2KQ3A 2G9DA 1Y8NB 3H6MA 4HN7A 3CU7A 2R6GA 4OO1H 5KYLA 2D9UA 3K5NA 4X3KA 1V43A 2FMCA 4DXFA 3N52A 4WFN3 2AWNA 5HURA 4L6TB 1GHKA 1B9MA 1Q8IA 1LLRD 5NUCA 2JEAI 3QOLA 2QKIC 5FO7B 3ONAB 1BCPF 2IW3A 2RDFA 3NWSA 5EPJA 2Z8LA 2NZ1D 3IKJA 1H9SB 2HCCA 3HOYB 2K03A 1SYFA 2VXWA 3GV6A 1KLGD 4MHEA 3I3CA 1NCVA 2KCNA 1E2WA 1ONLA 1ZYRC 1D5XC 2F03A 3UI2A 2L9HA 1EEFD 4FXGC 1GOZA 1FD7D 1I50B 1Q12A 1MD2D 2M9VA 3I72A 2L12A 4NMZA 1VDZA 2A5HA 2KCCA 1O7LA 2OXPA 2O5IC 1I6HB 3IFDA 2B2YC 1ICWA 4P2CB 5FO9B 1STGA 2QF7A 2B2UC 1TS2A 1TT2A 1PTOB 2ZXPA 4IURA 1STEA 1STAA 1TU2B 1FNVA 4K14A 3Q24A 1RCVD 2A69D 3NQTA 2K05A 1JICA 4U68A 1TY0A 1F2LA 1OXTA 4XXEA 1DD2A 1CI3M 2M2LA 5C3WA 2JYOA 1CZGA 4C3JG 3I91A 4KI0A 1K8OA 2B2UA 3A8IE 4Z9CB 4V0BA 2Z4HA 5EBCA 3D31A 4C3JB 1HUNA 3X3NA 2RKSA 4O1NA 4RCNA 4RWSC 1CZWA 4RGOS 1HTPA 1EIHA 1BDOA 2A69C 3GTLB 2LS01 2JP1A 3PUXA 5C0XI 3A55A 1G291 4U673 1V1PA 5C5LA 4HSVA 4KN7C 2HDLA 5I2YA 2WACA 2BOSA 1I4QA 4UAIA 1KLUD 2DY8A 4BY7B 4B9XA 4C1NI 3SDZA 1CHQD 3KUPA 4C56C 2ICEC 4L63B 2A6HD 1QB5D 4QF4A 5C4JB 2B2WC 4A3FB 3CRKC 5I6WA 2LY7A 4ZRZA 3J81L 4IFDJ 2EJMA 2EPBA 4RKBA 5EPKA 1SYDA 3VR2A 2BA0A 2KEDA 4QB4A 3VR6A 4KY5A 2F0VA 4FNFA 3FVQA 1Z47A 5FO8B 1IKLA 5A2QE 1G2SA 2RQXA 4JK1C 1Y69U 3Q6SA 4G7ZC 4CBVA 2XNAC 1WTXA 3DWQA 4A3JB 4RGTA 1SNPA 1TWCB 2BE5D 4ME5A 4K8JA 2IPKD 1LO5D 1EY6A 2JSOA 5BN4A 1QNKA 4CHTB 3NTHA 1I4PA 2BA1A 1J9OA 4IUTA 1SAPA 2JE6I 1RHPA 1FGBD 1NR2A 2F0JA 4AYBB 4Y7NB 4IN3A 5CGKA 1G8ZD 4A3KB 1JWSD 4J8QA 1TIID 3SXHA 4S3SA 2J4XA 3SE0A 1B2TA 2AWOA 1TWAB 2AUJD 1WTQA 1I6VC 2SEBD 3A7LA 1RTNA 5I9OA 2EY5A 3S2DB 2B2TC 5IGDA 1TQOA 1CTMA 1U4LA 3KF8A 3PUVA 4RA8A 5C0XG 3I4NB 3D4RA 3EJIA 4DNTB 5D14A 1SYBA 3SEBA 4IUQA 2XVSA 4I65A 1MSGA 2RDGA 2NWGA 1TVXA 5KYIA 2NBFA 1D1IA 1FR3A 2L5TA 3Q23A 2E76C 3MAQA 3TMEA 3QIAA 3HKZB 4ULLA 1PYWD 2EVBA 1EFID 2F0DA 3K58A 5FKAC 5D3IB 3R3OA 1EZ6A 2BDNA 2K04A 1SNQA 1EYAA 5CV6A 1JOQA 1A3TA 1EWHA 1CQFA 2KVMA 1YNJC 2EYOA 1OXXK 1MI2A 5LHY1 3J7AF 1LTSD 3GTGB 2H4OA 1PMRA 2AQ1B 1LTAD 2B8FA 2PZUA 2MJ8A 4PMCA 1EYDA 1QNUA 1PZID 2EJGC 2EYFA 1PFNA 4IFDI 2F0LA 1A3UA 2E74C 5DEHA 1DZ1A 3K6OA 1DXMA 2A68D 2PMZB 3HOXB 3TN2A 4TKOB 1JB3A 3VYUA 5EGTA 2ZXOA 4KD4A 1KAAA 3S15B 1B1ZA 5G3LF 2EZVA 4CKCA 2A74C 4WORA 4KKSA 5BN5A 3NTKA 1TS3A 3HRZC 3C3LA 3N6RA 2A6ED 3R93A 4K6DA 4BA2I 2XWBB 3T4AC 5JAVA 3GP7A 5DAUA 4X3TA 1H9MA 2F3WA 3JAML 3S9WA 5M3MB 3EFXD 1IHZA 2JA6B 1MGSA 3BVMA 3P1HA 1TS4A 3VYTA 1WVLA 2B2VC 2K33A 2EYPA 2WB1B 3V2TA 4HSPA 4RH6A 1D1KA 3T13A 4FF1A 3Q22A 4CGYB 3TP8A 3HOUB 4NDXA 4A3MB 1BCPD 2EY2A 1AZQA 5JEAG 4EQOA 3VYSA 4BA1I 2NN6I 1B44D 1EZ8A 1II3A 1STYA 2YYZA 1SNMA 5T1GA 4C3IG 1LT6D 5E4WC 4IUVA 1NUCA 2L11A 1H9JA 2NVQB 4F87A 4ZQ3A 3MXNA 1NR4A 1Y1VB 2F0GA 1GUOA 3K7AB 3V05A 4FP5D 1QJOA 3MXPA 1WTVA 3LWEA 2K5QA 4X3UA 2JEBI 3L9AX 4PQXA 1HRJA 3J7YW 2O4XA 3HEJA 1EL0A 2Z1CA 3GO5A 4A3EB 1ENCA 4H7BA 4CJ0B 2J7ZA 2Q8RE 3WOEA 4IZ8A 1XWEA 4OO1I 3SHLA 1FNUA 1I4GA 1KDCA 3TP6A 4ABNA 3S1RB 3CHBD 1JORA 4JBWA 1I4XA 3GV3A 5EPLA 2LFNA 1A3VA 1EY0A 1C8CA 1HPCA 2MP1A 4A3DB 3A7AB 4HEDA 2XWJB 1QE6A 3K0YA 1IW7D 1AFPA 1F2YA 1JE4A 2M00A 4RHSA 3NSWA 5IIFA 1ZXTA 1S5DD 3R8BA 3RZDB 1XXGA 4OL7A 2JA5B 1HXYD 3J81E 1QCBD 3MWYW 1FNWA 1UAPA 1BNZA 3MFYA 5ISRA 3RZOB 3EROA 3MXUA 3DM1A 4XQJA 3MC0B 2DNEA 2F0WA 4B9WA 5C4XB 3OIPA 1SSOA 5JPNC 4R8NA 3M3YB 1ILQA 1S5BD 2IX1A 1I4RA 4MN3A 5JJZA 1E2VA 2G9HD 3K59A 1Z6HA 3VR3A 1LT4D 2ID0A 3EA6A 3DUZA 1SE3A 3LNNA 4HCEA 2K32A 3NE5B 1I4HA 4FYDA 1UNSA 3D6WA 3QO2A 5KNBA 2JXMB 3V96A 1HA6A 1W6JA 1CA5A 3VYRA 2VNUD 2EYHA 2EYMA 1C4QA 1Y8OB 4XIGS 1SFOB 2PYKA 3KBGA 4G57A 4V190 3BDCA 3PUZA 4MIUA 2F0KA 3P7JA 2KEEA 3A54A 2L4NA 2SNSA 2WAQB 4FXDA 3O13A 4KV6A 2R3ZA 4QCLA 4G7OC 3SK5A 5CV9A 1PRTD 3DMUA 3QWNA 2DY7A 1S4ZA 2FFKB 5A35A 3T16A 3D8GA 3GD7A 1ESRA 3K57A 2B8GA 4UDUC 1EU4A 4I7ZC 1DYQA 1EQVA 2EYJA 3D4WA 2F0UA 3U9OA 5E3FA 2XSCA 1QOHA 5I9PA 1SE4A 1T5XD 5AFWA 1M4VA 2LMCB 3NBIA 2XIWA 3LX0A 1R4PB 2SDFA 1TY2A 1CA6A 1EY7A 4H13C 4M8AA 5E4XA 3F2UA 5M5YB 4KMUC 2PPBC 5DM63 4XYOA 1LABA 3MA2B 1TS5A 3K5MA 1Q90A 2KOLA 3KLSA 4DK1A 3TP7A 1JQYD 1CHPD 4BY1B 1GUNA 2NUCA 4J1MA 3PMFA 1PFMA 1TWGB 2KJXA 2O2LD 3FMCA 5CBEE 1TWHB 2R61A 1RTOA 4FVMA 4FF4A 4K5WA 4HTHA 1PRTF 2CQAA 4TSSA 3W3AA 4G7HC 3NXWA 3OHXC 2LKVA 3P75A 4F7XA 1QWYA 4OIJA 3EQLC 5ELCA 1WD0A 5IGGA 2GA4B 2F3VA 3HS0C 4FF3A 1GUSA 1ML0D 2HUGA 1U4RA 2E75C 1IKMA 2MGSA 3TBIB 3K5LA 3IFTA 2EYLA 2EY6A 3PIO3 2PZWA 2E2IB 2OT2A 5CBAE 1EYCA 4WRDA 5EKLA 3DEPA 4C3IB 3VR5A 3L3OC 1PDQA 3MFGA 3D6CA 1DONA 3P20A 4K6LA 4IQZA 2ZT9C 4XYQA 1SYCA 5IOCA 4RKLA 1F9PA 2R92B 2KHSA 2K1BA 1WTOA 1TWFB 5C44B 4ZKBB 1RD9D 4E6IA 1CQVA 3C1EA 5F2DA 5KNDA 1K83B 4RAUC 5C0XJ 3G7LA 1WCMB 4TRDA 1RJTA 2SOBA 3M4OB 1JOKA 2R7ZB 1IYUA 3OPOA 5KGUA 1F9SA 1V1OA 4N9PA 3D3RA 4HMJA 2E2DC 1HCZA 4K2KA 1HUMA 1HFGA 5CV8A 2F0PA 1SXTA 1BO0A 5C5MA 1O7YA 4LJZC 2PQEA 1JCKB 3HOVB 1H9RA 4KKTA 2IWHA 3HZXA 1Z7TA 4ZUJA 1S5FD 4PV1C 1X3PA 5D65A 3H09A 4ODGA 3GTPB 1YNND 3PIP3 1LTTD 3VR4A 2EE1A 4BBRB 1PXUA 5I6YA 5TSSA 3NK9A 2K7VA 4ZK9B 5M3FB 3S1NB 1WD1A 2CHBD 4IALA 4HR7B 1SYGA 2RDHA 4XT3B 4LK1C 5T1IA 5KIXA 1ENAA 4F88A 5K5PA 5KRUA 3VA5A 2NVXB 2B63B 1BCPC 3H94A 1EOTA 1B3AA 5K36H 3M4YA 3TZDA 3NHHA 1J8IA 5E1FA 2WKDA 3SK8A 4IUNA 3ND8A 3GTKB 1G2TA 5LL6X 1U9RA 3I90A 1HQMC 2E2HB 3OSOA 1RF2D 2PNRC 2XRSD 4KJOA 1O7ZA 3IL8A 3NBHA 2L1BA 4OHJA 3OWEB 1SNDA 4C1NK 1Y8PB 5A2QL 4FO2A 3J7AV 2F0TA 1LT3D 2OEOA 5CV5A 5I2XA 1KTKA 4ZLTF 5CV4A 2FHTA 1EQTA 4ILWA 2RA4A 2R93B 1IL8A 1X3QA 4FF2A 4FXKC 3EVQA 1GXDC 4YIJA 3MZ5A 5ELFA 1BBXC 2EDGA 1BQQT 5IGEA 2J0TD 2A6HC 2TMPA 1JC7A 3OW7A 3MHBA 4DAPA 1IW7C 1SNCA 2H1EA 1ET9A 5I4DA 1PTOH 1H9SA 3SK6A 1ZKOA 2F1MA 1KDAA 2XN9C 3MTSA 3FPUB 3BDOA 3GTJB 4J6HA 2KUMA 1Q1BA 3JAME 3NQIA 2XRQD 3HOWB 1JWMD 4C3HG 5J39A 5FLXL 2AQ3B 3U9SA 3E6ZX 2MPMA 1JWUD 5M9OA 4IFDH 1C48A 4ID6A 1CT1D 2K5DA 3Q0AA 5C6AA 3FRPB 3I4LA 5FK9C 2K6AA 3I4MB 3CRLC 3PO3B 3BVGA 1PZKD 2K01A 1GUTA 3A8JE 1TR5A 1U4MA 5D3DA 4DXGA 3R2TA 4KN4C 5IODA 2NVTB 4EQPA 4DU9A 2KECA 3GTOB 2B2WA 2JA8B 4DN4M 4NKLA 1CFMA 2O5JC 1F2MA 1KDBA 4DA2A 3DEOA 2BE5C 1GUWA 1KABA 3DWAA 3S1MB 2F0OA 2Q8IB 3PV0A 1HFNA 3KK7A 2VB2X 3RMHA 3VA7A 3NTIA 5JVG3 2RVLA 4A93B 2ZXRA 1M8AA 3IAYA 1B50A 2Q8TA 3OWFA 1F9RA 5C4ZA 3ITPA 3QG1A 4TQUS 4KK7A 1BOSA 4ZAIA 2FJ2A 3OMGA 2EXZA 2B2YA 1GUGA 5IGFA 3S17B 4O42A 4EGVA 4A3BB 1BR9A 5J22A 3BS1A 1STHA 1V1PB 2FINB 3H91A 1STBA 4N9TA 1JR0D 4EQNA 5G3LD 5JVH3 1F2ZA 5EKIA 1PRTC 2PW5A 3BG3A 4IUUA 5CYUA 3E5SA 2AQ2B 1D6EC 2IX3A 1LT5D 2NTSA 1ILPA 4B08A 3PUYA 3H0GB 5CMDA 2WP8J 1OXVA 1RODA 4RFBA 1E2ZA 3GTQB 1G6ZA 1U4PA 5CV7A 2QILA 3I70A 1XYIA 3KLRA 2E2JB 3M7NA 2K5WA 3QJYA 3GTMB 1K8MA 2MHVA 1PFBA 1B9NA 1ENFA 1WTRA 3BYYB 3RLFA 1S5ED 4OO1G 1F9QA 4BBSB 2B39A 1EWCA 2QEJC 3M85A 1PTOD 2WINB 3HG9A 1LACA 3BYTB 3E0JA 5KEEA 5M5WB 4QUCA 1D2BA 4RHRA 1O78A 2CW0D 3NWTA 4C2MB 4H0LC 4KTAA 1OXUA 3OMCA 1H9KA 5K36G 1MBYA 4A3IB 1DOLA 2PW7A 2YU9B 2Z4IA 5CR3A 2D2CC 5IGCA 4LAAA 1CM9A 1R9TB 4IFDG 3C1FA 1AEXA 4KHZA 3WDNA 2V4DA 1A6XA 4PNYA 5J1ZA 1AW7A 3HOZB 3T51B 4K2LA 1SJED 2EY1A 1L0XB 1XX8A 1A15A 1D5MC 3NPPA 3FKIB 1VCIA 2NB0A 1Q1EA 2CVRA 4H44C 3RUZA 4IUPA 5CORA 2A73B 2K28A 1WTPA 1OO9B 1PRTB 3J80E 3FDTA 2IL8A 4CJ2C 3S14B 3NP8A 1ZYRD 1ZEQX 2C5CA 2L55A 1DOMA 1WTWA 2BDOA 2TSSA 4XT1B 2A6EC 4L8JA 2HCIA 1NAPA 2EJFC 2PCFB 3I73A 1UEAB 1XTCD 5EJWA 1BUVT 3CKIB 1I3QB 1SE2A 4GZYC 1W6KA 2CW0C 2NN6H 3BDLA 3K5OA 2B2VA 1E0BA 2HDMA 2PZTA 1JOOA 3TSSA 4DF7A 4F8MA 3TP5A 3M7GA 4XQQA 3S1QB 4ZYSA 2WKCA 5IT9E 3FPPA 3W2DA 1RKNA 4HMIA 4DNRB 1B53A 3OIQA 4ZUIA 1KNEA 3T56B 1X32A 1EIGA 3X3MA 5CC4A 1TKWB 4RCOA 1G91A 2F0SA 3BZDB 4K5XA 3ND9A 4XTCS 1AZPA 1STNA 2F0EA 4XQNA 3RD4A 3A56A 1DCZA 1YNNC 3HP3A 4QMGA 5JOBA 5C4HA 3QB3A 3NUCA 4KD3A 1Y1WB 1UUPA 2RSOA 5COYA 1L0YB 3PO2B 3L7ZC 2F0HA 1PZJD 4QIWB 1BF4A 5IGBA 1HHVA 2DN8A 4R8IA 1VF5C 4DGZA 1HA5A 1VMPA 3BVZA 3G6JB 1AN8A 1LTBD 1VF7A 1EY8A 2F0FA 1D5ZC 3SVMA 3R2IA 1DJRD 4C3HB 2NTTA 1LTID 1HTLD 5EKKA 5JPMC 2L0CA 1CK1A 1HQRD 4G4KA 2N55A 2IJ0A 5ELDA 3C2PA 2D62A 1O80A 4K8IA 1V8QA 2Y0SB 1A2UA 3GQBA 4CKBA 5BN3A 1GJXA 1KNAA 3A8KE 3I8ZA 3DWPA 3DHQA 1Q3LA 2WV6D 4DK0A 2VB3X 2X6GA 4KY6A 1SEBD 2IX0A 3TDQA 2DNCA 2ENBA 3OOCA 3QOJA 2NVYB 1SMYC 3C46A 1SMYD 2HQEA 3S16B 4CJ1B 2X69A 2MUYA 5DNFA 1DM0B 3WOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKV A;  2SOB A;  1SYF A;  2F0J A;  2F0K A;  3P75 A;  1JOK A;  4KJO A;  4MIU A;  5CV7 A;  3SK4 A;  4F7X A;  5CGK A;  5KGU A;  4N9P A;  1A3V A;  4QMG A;  2PZU A;  1EY0 A;  4HMJ A;  3TP8 A;  1TR5 A;  2F0I A;  5JOB A;  2SNS A;  1SND A;  5C4H A;  3QB3 A;  4K2K A;  5IGG A;  4NDX A;  2F3V A;  3MEH A;  3SXH A;  5IOD A;  4KJN A;  5CV8 A;  3NP8 A;  4PMC A;  1EYD A;  4KV6 A;  4S3S A;  2F0P A;  3NUC A;  4NP5 A;  4KD3 A;  5C5L A;  4EQP A;  2EY2 A;  2F0T A;  1JOR A;  4EQO A;  4DU9 A;  3SK5 A;  2OEO A;  1F2Y A;  5CV9 A;  2EYF A;  4NKL A;  5C5M A;  5CV5 A;  2M00 A;  2F0H A;  1F2M A;  1KDB A;  2F0L A;  1EZ8 A;  2F0N A;  2OF1 A;  3DMU A;  5CV4 A;  1A3U A;  5IIF A;  1II3 A;  2WAC A;  1STY A;  5I9O A;  1KAB A;  1SNM A;  2PQE A;  2EY5 A;  2EYL A;  2EY6 A;  2F0O A;  3ERQ A;  5DEH A;  5IGB A;  5I6Y A;  4OL7 A;  4DGZ A;  2PZW A;  3T16 A;  3D8G A;  3OSO A;  3MVV A;  4B9X A;  5IGD A;  1TQO A;  4NMZ A;  3SR1 A;  1NUC A;  3HZX A;  3EVQ A;  4ZUJ A;  1EYC A;  4WRD A;  4YIJ A;  1EY8 A;  2F0F A;  3EJI A;  5EKL A;  3MZ5 A;  5ISR A;  1EQV A;  2EYJ A;  4ZQ3 A;  5EGT A;  3D4W A;  1SYB A;  2F0U A;  4PMB A;  3U9O A;  4KD4 A;  5E3F A;  5IGE A;  1KAA A;  2OXP A;  3ERO A;  4ODG A;  5KEE A;  1EY9 A;  4QF4 A;  4I65 A;  5I6W A;  2F0G A;  5I9P A;  5EKK A;  4WOR A;  4B9W A;  2F0W A;  2F0M A;  3MHB A;  1STG A;  3MXP A;  3BDL A;  3LX0 A;  3OWF A;  1EY4 A;  4K5V A;  2SNM A;  4R8N A;  1SYD A;  4RKB A;  1NSN S;  4EVO A;  3ITP A;  5C4Z A;  3D6C A;  5KYI A;  1SNC A;  3NK9 A;  4KY7 A;  1EY7 A;  4K8I A;  2PZT A;  2QDB A;  4KTA A;  4QB4 A;  5HGT A;  3OMC A;  1TT2 A;  1JOO A;  1A2U A;  2F0Q A;  4IAL A;  4DF7 A;  3OMG A;  4F8M A;  1SYC A;  2EXZ A;  3SK6 A;  1STA A;  4K6D A;  4KHV A;  3TP5 A;  2F0V A;  1A2T A;  2PW7 A;  4K14 A;  4KY5 A;  1SYG A;  4RKL A;  5IOC A;  2KQ3 A;  3NQT A;  1KDA A;  3H6M A;  5IGF A;  1SYE A;  3DHQ A;  1SNO A;  5CR3 A;  3TME A;  3TP7 A;  5JAV A;  2O4X A;  4J6H A;  1EY5 A;  2KHS A;  3HEJ A;  5KYL A;  5KIX A;  5DAU A;  1ENA A;  5J22 A;  1RKN A;  3BDC A;  5K5P A;  5KRU A;  2NUC A;  4J1M A;  4DFA A;  4HMI A;  2F3W A;  3PMF A;  1STH A;  4LAA A;  3VA5 A;  5IGC A;  3S9W A;  2F0D A;  3C1F A;  4KY6 A;  1AEX A;  1ENC A;  1STB A;  5HUR A;  1IHZ A;  3R3O A;  5C3W A;  4N9T A;  2RBM A;  4H7B A;  1EZ6 A;  4EQN A;  5J39 A;  3P1H A;  4PNY A;  5J1Z A;  1F2Z A;  4ZUI A;  2PW5 A;  1SNP A;  4ME5 A;  4E6I A;  1SNQ A;  1EYA A;  2EYP A;  4IZ8 A;  4K2L A;  5CV6 A;  5M9O A;  3E5S A;  1JOQ A;  5NUC A;  1A3T A;  2EY1 A;  4K8J A;  3SHL A;  2ENB A;  3NHH A;  1EY6 A;  5E1F A;  4K5W A;  3C1E A;  3QOJ A;  3QOL A;  4HTH A;  5F2D A;  1KDC A;  3V2T A;  5CC4 A;  3SK8 A;  2EYO A;  4IUN A;  2HQE A;  2F0S A;  2EYH A;  2EYM A;  2RDF A;  3D4D A;  3RUZ A;  4ID6 A;  3TP6 A;  4K5X A;  2RKS A;  1U9R A;  5C3X A;  2PYK A;  5C6A A;  3NXW A;  4G57 A;  1STN A;  3T13 A;  2F0E A;  4TRD A; 
#chains in the Genus database with same CATH topology
 1U5K A;  2JA8 H;  3SK4 A;  5IWA Q;  3GTJ H;  2YU9 H;  2IT1 A;  1VQ6 A;  2KCM A;  1SBB B;  5ELE A;  4KJN A;  3ZYY X;  2FMM A;  2EXD A;  4RGN A;  4YWM A;  4DAY A;  4NP5 A;  4CKE A;  2RSN A;  1PH7 A;  4ZCK A;  1T5E A;  1V9P A;  5C3E H;  3CCE A;  4ZKC B;  2QA4 A;  2EQS A;  2BCO A;  2F0N A;  1VMC A;  1W3S A;  2QCP X;  4POF A;  4DPG A;  5ELO A;  1VQC A;  3I56 A;  3RN2 A;  2E2I H;  3MVV A;  1YNJ D;  4XDX A;  2A68 C;  1N32 Q;  3SR1 A;  1KAW A;  2Z6B A;  4KKU A;  5EBD A;  1TXY A;  1S5C D;  2DJF C;  2F4V Q;  1VQL A;  4GNX B;  4PMB A;  3S2D H;  5JEA J;  3AQQ A;  2K5H A;  4A3K G;  4MNO A;  1EIY B;  1F77 A;  1ESF A;  1YHA A;  1FYC A;  1PTO F;  4M1U B;  2F0M A;  1IBM Q;  3AB9 A;  3UDF A;  4HIO A;  5C3X A;  1EY4 A;  4K5V A;  3TRZ A;  1NSN S;  3URY A;  4KY7 A;  4Q5V A;  4JI4 Q;  2QDB A;  5HGT A;  1SJH D;  4POG A;  1PLF A;  4BS9 A;  4KHV A;  5ELB A;  2VQF Q;  1QG7 A;  1EU3 A;  3AU7 A;  4N8F A;  3S2H B;  2YV5 A;  1SYE A;  1SNO A;  2KA7 A;  1EY5 A;  2X6L A;  5LMN Q;  4DFA A;  1PTO C;  3HOU G;  3LWU A;  5DM7 3;  3AFP A;  1IBL L;  3DXJ C;  5ELN A;  4APV A;  5JEA H;  2WII B;  4L5T A;  2RBM A;  2AUK A;  1KQS A;  1TWC H;  1I94 Q;  4WJW A;  3F2C A;  1Z9F A;  3LGJ A;  3H15 A;  2VUM B;  4OGQ C;  4R9W A;  1GHJ A;  1OXS C;  2NZH A;  4B3T Q;  3T53 B;  3CQZ B;  4P74 A;  4R4O A;  1BCP B;  4QUF A;  5KNC A;  3PUW A;  1UE7 A;  4DAV A;  1BXT A;  3F2D A;  2ICI A;  3D4D A;  2N88 A;  3I4N H;  5FJ8 H;  5M5Y H;  1FVI A;  3MXG A;  1RIP A;  3TZU A;  1IBK L;  1LTR D;  3DLL A;  3A0J A;  3KBX A;  4K0K Q;  1WCM H;  3E9H A;  5AJ3 L;  1AP0 A;  5LL6 S;  1LV9 A;  2F0I A;  4HAE A;  1DOK A;  1ET6 A;  3MEH A;  2B2T A;  4HCS A;  5FLX E;  2AHO B;  5IT9 L;  3NEL A;  2Q2I A;  1IZ6 A;  4Q0F A;  1SDF A;  3HOV G;  1IYV A;  4B3M L;  1K0S A;  1EYG A;  1BKB A;  2C9O A;  1SLJ A;  4X3S A;  2OF1 A;  2D5D A;  2EOT A;  5EQ0 A;  2NN6 G;  3AMU A;  3ERQ A;  4Y7N H;  4A3G B;  3STB C;  4LFA L;  1EEI D;  5M5X B;  4NW2 A;  2I46 A;  1K3B C;  3KLS X;  1PA6 A;  2UUB Q;  4GKK L;  3S16 H;  3PCO B;  4PMW A;  2PO4 A;  3H3V C;  2E5L L;  4RGM A;  2JA7 B;  2I07 B;  3H0G H;  4JI8 L;  5M3M H;  4A3C H;  2F4I A;  1LTG D;  2ZJQ A;  4JBM A;  4JI6 L;  3HGB A;  4X66 L;  4BWG B;  1EY9 A;  4LUO A;  5GQO A;  1PH1 A;  5FOB B;  1B4O A;  3KOJ A;  1R4Q B;  4OIK A;  5BR8 Q;  2SNM A;  4LMQ D;  4EVO A;  2NYZ D;  1X54 A;  5C3E B;  1MSH A;  3HKZ G;  4BBS H;  2F0Q A;  3BJU A;  5C0X H;  4K0K L;  1QIL A;  1RDP D;  3TRE A;  1N33 Q;  1A2T A;  3J80 L;  3FEW X;  2KQ3 A;  2ZM6 L;  2G9D A;  4R1J A;  1Y8N B;  3H6M A;  4HN7 A;  3CU7 A;  2R6G A;  3CXC A;  4OO1 H;  5KYL A;  2D9U A;  3K5N A;  4P72 A;  4X3K A;  1V43 A;  2Q2U A;  2FMC A;  4HID A;  1HR0 L;  1C7Y A;  4DXF A;  3N52 A;  4WFN 3;  4C2M H;  2AWN A;  5HUR A;  1VQ8 A;  4L6T B;  1GHK A;  1B9M A;  1Q8I A;  5GRO A;  3PSI A;  4HJA A;  4DR6 L;  1LLR D;  4EQ5 A;  4LUV A;  1QUQ A;  5NUC A;  4A3E H;  2JEA I;  1E1O A;  1Y14 B;  5J3B A;  2BH2 A;  3QOL A;  2QKI C;  2PMZ E;  2JA6 G;  5FO7 B;  3ONA B;  1YJN A;  1BCP F;  1K83 H;  2IW3 A;  2RDF A;  2RHQ B;  3NWS A;  5EPJ A;  4DUZ L;  1WI5 A;  1PV4 A;  2Z8L A;  2NZ1 D;  3IKJ A;  1H9S B;  2HCC A;  3HOY B;  1T9H A;  2K03 A;  1SYF A;  2VXW A;  3TS2 A;  3GV6 A;  1M90 C;  1KLG D;  4MHE A;  3F2B A;  2I5M X;  3I3C A;  1NCV A;  2KCN A;  1E2W A;  1ONL A;  1ZYR C;  4BBR G;  1D5X C;  3CCJ A;  2F03 A;  4A3D H;  1UE5 A;  1O7I A;  3UI2 A;  2L9H A;  1PYS B;  1EEF D;  4FXG C;  3M4O H;  1GOZ A;  3GTO H;  2CWA A;  1FD7 D;  1I50 B;  4GNX C;  1Q12 A;  1MD2 D;  3UDG A;  2M9V A;  3I72 A;  3GTL H;  2K14 A;  2L12 A;  1KIX A;  1IBM L;  2V1C C;  4NMZ A;  2KHI A;  4MZ9 A;  1VDZ A;  1HNW Q;  2A5H A;  4PZ7 A;  2KCC A;  4DV4 Q;  2UU9 L;  4IOA A;  1O7L A;  2OXP A;  2O5I C;  1I6H B;  3IFD A;  4LFC L;  2B2Y C;  1ICW A;  4P2C B;  4P75 A;  2Z6K A;  1N32 L;  5FO9 B;  1STG A;  4JBK A;  2PI2 A;  4DV6 Q;  2QF7 A;  4OON A;  4OX9 L;  2B2U C;  1TS2 A;  2UUA L;  1TT2 A;  1PTO B;  1A62 A;  2ZXP A;  4IUR A;  1STE A;  5L37 A;  1STA A;  1TU2 B;  4DR7 L;  1FNV A;  4K14 A;  1QZG A;  3Q24 A;  1RCV D;  2A69 D;  3NQT A;  5JJI A;  2K05 A;  1JIC A;  2D0O A;  1K3R A;  1C0A A;  4U68 A;  3MEF A;  1TY0 A;  2PQA B;  1F2L A;  1JT8 A;  1OXT A;  4XXE A;  1DD2 A;  1CI3 M;  3A5Z B;  2M2L A;  3HKS A;  5C3W A;  4DR5 L;  2JYO A;  1CZG A;  2F4V L;  4C3J G;  3G6E A;  3I91 A;  4KI0 A;  1HNZ Q;  1K8O A;  2B2U A;  3ICE A;  3A8I E;  4GN4 B;  4Z9C B;  1VQ5 A;  4V0B A;  2Z4H A;  5EBC A;  2ZTC A;  3D31 A;  4LWC A;  4C3J B;  1VQF A;  1HUN A;  5DLQ E;  3X3N A;  2UUC L;  2RKS A;  4O1N A;  4RCN A;  4RWS C;  4B3M Q;  1CZW A;  4RGO S;  1HTP A;  4LF7 Q;  4CDC C;  1EIH A;  1BDO A;  2ASB A;  2A69 C;  3GTL B;  1KL9 A;  4GLA C;  4A3L H;  2LS0 1;  3CAM A;  2JP1 A;  2PI2 E;  1NJI C;  1YNX A;  3PUX A;  5C0X I;  2R93 H;  2UUB L;  5C4X H;  3A55 A;  1G29 1;  4U67 3;  1V1P A;  5C5L A;  4HSV A;  2NVY H;  2RCF A;  1EIF A;  4JI1 Q;  4KN7 C;  2HDL A;  4IOC A;  3K8A A;  5I2Y A;  3B6Y A;  1B70 B;  2WAC A;  2BOS A;  3K0X A;  4LFC Q;  1I4Q A;  4UAI A;  3K7U C;  1KLU D;  2DY8 A;  4BY7 B;  4B9X A;  3SDZ A;  1CHQ D;  4C1N I;  4GLX A;  3M3Y H;  3KUP A;  4JI3 Q;  4C56 C;  2ICE C;  4I7A A;  4L63 B;  2A6H D;  1QB5 D;  4QF4 A;  5C4J B;  2B2W C;  4A3F B;  3CRK C;  5I6W A;  2ZM6 Q;  3ZJY C;  2LY7 A;  4ZRZ A;  4KHP Q;  3J81 L;  3KJO A;  4IFD J;  2EJM A;  2EPB A;  4RKB A;  5EPK A;  1SYD A;  4P71 A;  4DAM A;  2OWO A;  1U0L A;  3VR2 A;  4A76 A;  3T1H L;  2BA0 A;  2KED A;  4QB4 A;  3S1N H;  3VR6 A;  3J81 i;  1W2B A;  4KY5 A;  2F0V A;  4FNF A;  3FVQ A;  3W1G A;  1Z47 A;  4YHH L;  4DV2 L;  2R92 H;  1EQR A;  4C3H H;  5FO8 B;  5C44 G;  1IKL A;  4AIM A;  5A2Q E;  2VS1 A;  1G2S A;  2RQX A;  1MJC A;  4JK1 C;  1Y69 U;  3Q6S A;  4G7Z C;  1XPR A;  4CBV A;  2XNA C;  1WTX A;  1SRO A;  3DWQ A;  2UUA Q;  4A3J B;  4GOP B;  2AKW B;  4AQY L;  4RGT A;  1SNP A;  1TWC B;  2BE5 D;  4ME5 A;  1EQQ A;  2R7F A;  1AE2 A;  3RNU A;  4K8J A;  2IPK D;  1FL0 A;  1LO5 D;  1K0R A;  1EY6 A;  2JSO A;  5BN4 A;  4O2D A;  1QNK A;  3CC4 A;  1HR0 Q;  1LUZ A;  4R4T A;  3KDF B;  4CHT B;  3NTH A;  1I4P A;  2BA1 A;  3KF6 B;  1J9O A;  4IUT A;  1SAP A;  4HIM A;  2K52 A;  3KF6 A;  2JE6 I;  1RHP A;  3G4S A;  1FGB D;  1NR2 A;  2F0J A;  4AYB B;  4Y7N B;  4A3G H;  4IN3 A;  5CGK A;  1G8Z D;  4A3K B;  1JWS D;  3DM3 A;  4J8Q A;  1TII D;  1GVP A;  3L0O A;  3SXH A;  3KLW A;  1VQO A;  3GTG H;  4S3S A;  1LTL A;  2J4X A;  3SE0 A;  1B2T A;  2AWO A;  1TWA B;  2AUJ D;  1WTQ A;  1I6V C;  4LF4 L;  1Q81 C;  1EUJ A;  4DV4 L;  2SEB D;  3A7L A;  1RTN A;  5I9O A;  2EY5 A;  3S2D B;  2ALY B;  2B2T C;  1K73 C;  3U4Z A;  1PFS A;  5IGD A;  1TQO A;  1CTM A;  1U4L A;  1X56 A;  3KF8 A;  3PUV A;  4RA8 A;  5C0X G;  3I4N B;  3D4R A;  3EJI A;  4DNT B;  1D7Q A;  3RLN A;  5D14 A;  1N34 Q;  1SYB A;  1X3E A;  3SEB A;  1VQI A;  4IUQ A;  1SRU A;  2XVS A;  3FP9 A;  4I65 A;  2N78 A;  1MSG A;  2RDG A;  2NWG A;  3S14 H;  1TVX A;  1P8L A;  2K4K A;  5KYI A;  2R92 G;  2NBF A;  3PO2 G;  1D1I A;  1HNW L;  1PVO A;  1VQ7 A;  2UU9 Q;  1X55 A;  1FR3 A;  2L5T A;  1YIJ A;  2KCT A;  3Q23 A;  4CDF C;  2E76 C;  4LF8 Q;  3MAQ A;  3TME A;  3CF5 A;  3QIA A;  2VUM G;  3HKZ B;  4ULL A;  3HKZ E;  1BBW A;  1PYW D;  2EVB A;  1EFI D;  2F0D A;  1EFW A;  3K58 A;  5FKA C;  5D3I B;  4OWW B;  3R3O A;  1EZ6 A;  2BDN A;  2K04 A;  1SNQ A;  1EYA A;  5CV6 A;  4NXM Q;  2MQH A;  5IY0 A;  1JOQ A;  1A3T A;  4DV5 Q;  3GTQ H;  1EWH A;  1CQF A;  2KVM A;  1YNJ C;  2EYO A;  3FKI H;  1OXX K;  1Q82 C;  4JYA Q;  2OTL A;  1MI2 A;  4DK6 C;  5LHY 1;  3U4V A;  1LTS D;  3ULP A;  3J7A F;  3GTG B;  4OX9 Q;  2H4O A;  1PMR A;  2MO0 A;  1HNZ L;  3D0F A;  2K50 A;  4NXN L;  2AQ1 B;  1LTA D;  1JJG A;  2B8F A;  2PZU A;  5BR8 L;  2I0Q A;  1G6P A;  2MJ8 A;  4PMC A;  1EYD A;  1QNU A;  3PO2 H;  1PZI D;  2EJG C;  4JI8 Q;  2EYF A;  1PFN A;  1CKN A;  5M3F H;  4IFD I;  2F0L A;  1A3U A;  5IWA L;  4DR3 L;  2E74 C;  4B3S Q;  5DEH A;  1DZ1 A;  3K6O A;  1DXM A;  1YHQ A;  4OEM B;  1VQG A;  2A68 D;  2PMZ B;  3HOX B;  2A1A A;  3TN2 A;  4TKO B;  3HOW H;  1JB3 A;  3VYU A;  5EGT A;  2ZXO A;  2UUC Q;  4KD4 A;  1KAA A;  3PF5 A;  3S15 B;  4NB3 A;  4NXM L;  1B1Z A;  5G3L F;  2EZV A;  1XNQ Q;  1I3Q H;  4CKC A;  4A3I H;  2A74 C;  4WOR A;  4KKS A;  5BN5 A;  5M5X H;  3NTK A;  1TS3 A;  3HRZ C;  3C3L A;  1N34 L;  3N6R A;  2DUD A;  4BBS G;  2A6E D;  3R93 A;  5LMU Q;  4K6D A;  4BA2 I;  2XWB B;  3S15 H;  3T4A C;  3CW2 C;  5JAV A;  3GP7 A;  4B3T L;  5DAU A;  4KLK A;  4X3T A;  1XMQ Q;  1H9M A;  2F3W A;  3JAM L;  3S9W A;  4TVA B;  5M3M B;  3EFX D;  1PH2 A;  1CKM A;  1IHZ A;  2JA6 B;  1MGS A;  3BVM A;  3P1H A;  1TS4 A;  3VYT A;  1WVL A;  2B2V C;  2KBN A;  2K33 A;  2EYP A;  2ATW A;  2WB1 B;  5C4X G;  4A3E G;  5IP9 G;  4A3G G;  3V2T A;  4HSP A;  4ALP A;  4RH6 A;  4GOP C;  1XJV A;  1HZA A;  4IO9 A;  1D1K A;  1JE5 A;  4GN3 B;  4JG2 A;  3T13 A;  4FF1 A;  2QDL A;  1XPU A;  3RZD H;  3Q22 A;  1LYL A;  4QJF A;  2Y0S E;  4CGY B;  4DV0 L;  3TP8 A;  1E3P A;  5H1S E;  3HOU B;  4DR1 L;  4NDX A;  2B63 G;  4A3M B;  2VZA A;  3BZK A;  4YWK A;  1BCP D;  1H95 A;  2EY2 A;  5IE8 A;  1AZQ A;  5JEA G;  2E5L Q;  4EQO A;  3VYS A;  4BA1 I;  2NN6 I;  2C35 B;  3GTP H;  1B44 D;  1UEB A;  3H3V I;  3AYH B;  1EZ8 A;  1II3 A;  1STY A;  2YYZ A;  1SNM A;  4A3M G;  5T1G A;  1HZ9 A;  5IP9 H;  2CCZ A;  1E24 A;  4C3I G;  1G51 A;  1LT6 D;  5E4W C;  4B3R L;  4IUV A;  1NUC A;  2L11 A;  4GN5 A;  1H9J A;  4GNX A;  2NVQ B;  4F87 A;  3MXN B;  2NVX H;  4DR4 Q;  2Z6K C;  4ZQ3 A;  5E7N A;  3MXN A;  4JI5 Q;  1NR4 A;  2Y0S G;  4BXX G;  1Y1V B;  2F0G A;  2HHH L;  4DUY Q;  1GUO A;  3K7A B;  3V05 A;  4FP5 D;  1QJO A;  1KHI A;  3MXP A;  1WTV A;  2HQL A;  3J7A 5;  4JCV E;  3LWE A;  2K5Q A;  4GKJ Q;  4DV1 L;  1VQE A;  4X3U A;  2JEB I;  4BBR H;  3L9A X;  4PQX A;  3UE0 A;  1HRJ A;  2UXC Q;  4IPD A;  4JOI A;  1YJW A;  1E1T A;  3J7Y W;  2O4X A;  3HEJ A;  5IYB H;  1EL0 A;  3QR8 A;  2Z1C A;  3GO5 A;  3K80 C;  4A3E B;  3S1R H;  1N8R C;  2UXD L;  3E9I A;  1NE3 A;  1ENC A;  3CC2 A;  4MTN A;  1E22 A;  4H7B A;  1N33 L;  4CJ0 B;  4C3J H;  2J7Z A;  2Q8R E;  3WOE A;  1Q8K A;  4IZ8 A;  1XWE A;  4OO1 I;  3SHL A;  4JI2 L;  1FNU A;  1I4G A;  1KDC A;  3G48 A;  3GTK H;  2NVQ H;  3TP6 A;  4ABN A;  3T1Y Q;  3S1R B;  4UPA A;  3CHB D;  1JOR A;  3M4Q A;  4JBW A;  1I4X A;  3GV3 A;  5EPL A;  2LFN A;  1A3V A;  1EY0 A;  1C8C A;  1HH2 P;  4LF8 L;  1HPC A;  2MP1 A;  4A3D B;  3A7A B;  4GKJ L;  4HED A;  2XWJ B;  1QE6 A;  3K0Y A;  2A8V A;  1IW7 D;  1NBW A;  1AFP A;  1F2Y A;  4JI7 Q;  2VL6 A;  1JE4 A;  2M00 A;  4RMF A;  3CD6 A;  4RHS A;  3NSW A;  5IIF A;  3K7A H;  1ZXT A;  1S5D D;  1MJE A;  1GM5 A;  5LMN W;  3R8B A;  3RZD B;  1XXG A;  4OL7 A;  2JA5 B;  1HXY D;  3J81 E;  1QCB D;  3MWY W;  1KXL A;  1FNW A;  1SE8 A;  1UAP A;  4WJ4 A;  1BNZ A;  3A5U A;  3MFY A;  5ISR A;  2IHE A;  3RZO B;  1A63 A;  5HGQ A;  3ERO A;  5GAE C;  2RHS B;  4B3S L;  4LF9 Q;  2F52 A;  3DM1 A;  3MXU A;  4XQJ A;  4BY1 H;  3MC0 B;  2DNE A;  2F0W A;  4B9W A;  1PHJ A;  2WB1 G;  3OIP A;  5C4X B;  1SSO A;  2P5Z X;  2JA5 H;  5JPN C;  3M4P A;  4R8N A;  3M3Y B;  1ILQ A;  1S5B D;  3E3X A;  2IX1 A;  1I4R A;  4MN3 A;  5JJZ A;  2HIV A;  1E2V A;  2G9H D;  3K59 A;  1Z6H A;  3VR3 A;  1QZH A;  1LT4 D;  2ID0 A;  4LF5 L;  2R7Z G;  3EA6 A;  1M1K C;  3DUZ A;  1GKH A;  1SE3 A;  2QW7 A;  3LNN A;  4DV1 Q;  1QVF A;  4HCE A;  2K32 A;  3NE5 B;  4HJ5 A;  1VQN A;  1I4H A;  4FYD A;  1UNS A;  3D6W A;  3QO2 A;  5KNB A;  2JXM B;  4LF7 L;  3V96 A;  1HA6 A;  1W6J A;  2QGQ A;  1CA5 A;  2AMC B;  3VYR A;  2VNU D;  4DV3 Q;  4LFB Q;  1XNR L;  2EYH A;  2EYM A;  3S24 A;  1C4Q A;  1Y8O B;  4XIG S;  1SFO B;  3PIO A;  2PYK A;  3RR5 A;  3KBG A;  4G57 A;  4V19 0;  3BDC A;  3PUZ A;  1RL2 A;  4DV7 L;  4MIU A;  2F0K A;  4DR7 Q;  4GLV B;  3P7J A;  4IJH A;  2KEE A;  3A54 A;  2ES2 A;  2OTJ A;  1AE3 A;  4RG1 A;  4JI2 Q;  2L4N A;  4A3F G;  2SNS A;  2WAQ E;  1WFQ A;  2WAQ B;  3PGZ A;  4FXD A;  3O13 A;  3CMA A;  4KV6 A;  4X62 L;  2R3Z A;  4QCL A;  4QQB X;  4G7O C;  3SK5 A;  1N36 L;  5CV9 A;  1PRT D;  3CPW A;  3DMU A;  2UXB Q;  3OYY A;  1PYB A;  3QWN A;  2DY7 A;  1S4Z A;  4A3C G;  3Q8D A;  2FFK B;  5A35 A;  3T16 A;  3D8G A;  4A3K H;  3GD7 A;  1ESR A;  3K57 A;  2B8G A;  4UDU C;  1EU4 A;  4I7Z C;  1DYQ A;  1EQV A;  2EYJ A;  3D4W A;  2F0U A;  4JOI C;  3U9O A;  5E3F A;  4A3J G;  5JJK A;  2XSC A;  1QOH A;  1V1Q A;  4DV5 L;  1X65 A;  4JI0 L;  5I9P A;  3OTO Q;  5IYB G;  1SE4 A;  4DV3 L;  1T5X D;  4X64 Q;  5AFW A;  1M4V A;  1VQD A;  4DV0 Q;  2LMC B;  3RN5 A;  3NBI A;  5IYD G;  2XIW A;  3LX0 A;  2ZTE A;  1R4P B;  2SDF A;  1TY2 A;  1CA6 A;  1EY7 A;  4H13 C;  4M8A A;  2QEX A;  1IBK Q;  1K8A C;  1JJ2 A;  5E4X A;  1B7Y B;  3F2U A;  5M5Y B;  4KMU C;  2PPB C;  5DM6 3;  3HOW G;  2OQ0 A;  4XYO A;  1LAB A;  3MA2 B;  1TS5 A;  3NBH B;  2HIX A;  1E7Z A;  1Q90 A;  2KOL A;  3K5M A;  3HOY G;  3KLS A;  4DK1 A;  4DR3 Q;  3TP7 A;  1JQY D;  4HJ9 A;  1CHP D;  4BY1 B;  1GUN A;  2NUC A;  4J1M A;  3PMF A;  1PFM A;  1TWG B;  1GO3 E;  3CME A;  2OQK A;  3CCQ A;  2KJX A;  2O2L D;  3FMC A;  5FLM H;  1WOC A;  4FDB A;  5CBE E;  2K5N A;  1TWH B;  2VQF L;  1VQP A;  4DV2 Q;  2WFW A;  1B8A A;  1CSP A;  2R61 A;  4UP7 A;  1RTO A;  4FVM A;  4FF4 A;  3CQZ H;  1L2F A;  3J81 c;  1XNQ L;  1XMO Q;  4YY3 Q;  4K5W A;  4HTH A;  2VW9 A;  4KHP L;  1PRT F;  2CQA A;  2EIF A;  1VQH A;  4TSS A;  3W3A A;  2B29 A;  4G7H C;  3NXW A;  3VDY A;  1JB7 A;  3JC6 6;  3OHX C;  3UE1 A;  1QVC A;  2LKV A;  3P75 A;  4F7X A;  1QWY A;  4OIJ A;  5C44 H;  3EQL C;  5ELC A;  1VQ9 A;  1WD0 A;  5IGG A;  2GA4 B;  2F3V A;  1UWV A;  3HS0 C;  4FF3 A;  1GUS A;  1ML0 D;  2HUG A;  4CDD C;  1U4R A;  1NMG A;  2E75 C;  1IKM A;  2MGS A;  3TBI B;  3K5L A;  5GAD C;  3IFT A;  2CH4 A;  2EYL A;  2EY6 A;  3PIO 3;  1XMQ L;  2PZW A;  2E2I B;  2OT2 A;  1S3O A;  5CBA E;  1EYC A;  4WRD A;  1L1O C;  5EKL A;  4LUZ A;  4WJ3 M;  4UP8 A;  1HZC A;  4DR6 Q;  3DEP A;  4C3I B;  4YCU A;  1K28 A;  3VR5 A;  2N49 A;  1X3G A;  3J80 c;  5FLX c;  2Q2H A;  3L3O C;  1PDQ A;  2JQO A;  3MFG A;  3D6C A;  1DON A;  3P20 A;  3JAM c;  4K6L A;  1XTD A;  4IQZ A;  2ZT9 C;  4XYQ A;  2OCE A;  2ZJR A;  1SYC A;  2CQO A;  5IOC A;  4RKL A;  1F9P A;  3TEH B;  2R92 B;  4DR1 Q;  2KHS A;  4YCW A;  1XMO L;  1X6O A;  1YVC A;  3GTM H;  2K1B A;  1WTO A;  3CCS A;  1TWF B;  4NPS A;  3W1B A;  1XNR Q;  1WTH A;  5C44 B;  1X9N A;  4DR4 L;  4ZKB B;  1RD9 D;  4NXN Q;  4E6I A;  4A3F H;  1CQV A;  4PZ6 A;  4B3R Q;  4DUY L;  2K5V A;  2GVA A;  3C1E A;  5F2D A;  5KND A;  4BY7 G;  1K83 B;  4RAU C;  3HOX G;  4A3I G;  5C0X J;  1YIT A;  3RLO A;  3G7L A;  3IRB A;  1WCM B;  4TRD A;  1RJT A;  2SOB A;  3M4O B;  1JOK A;  2R7Z B;  4X6A H;  1IYU A;  3OPO A;  5KGU A;  4N9P A;  1F9S A;  1V1O A;  3D3R A;  2IHF A;  2E2D C;  4HMJ A;  1HCZ A;  1OTC A;  4DAY B;  4LFB L;  4K2K A;  1TWG H;  4JI4 L;  1HUM A;  1HFG A;  5CV8 A;  5LMN L;  2F0P A;  1SXT A;  1WCM G;  1BO0 A;  3M9B A;  5C5M A;  2YTV A;  4EX5 A;  1O7Y A;  1P16 A;  4LJZ C;  2JN4 A;  2PQE A;  2CH4 W;  4A3D G;  1JCK B;  3HOV B;  1H9R A;  4KKT A;  3SGI A;  3KF8 B;  2IWH A;  2UXD Q;  4HJ7 A;  3HZX A;  1Z7T A;  4ZUJ A;  1S5F D;  4PV1 C;  1GD7 A;  1KD1 C;  1X3P A;  5D65 A;  3T1Y L;  3H09 A;  4ODG A;  1I6H H;  3GTP B;  1YNN D;  3PIP 3;  1LTT D;  2CFM A;  3VR4 A;  2EE1 A;  5HY6 A;  4BBR B;  2JA7 G;  4A3M H;  1PXU A;  5I6Y A;  2Z9H A;  5TSS A;  1PH6 A;  3NK9 A;  1L1O A;  2K7V A;  3GDE A;  4ZK9 B;  5M3F B;  2LXK A;  2E8G A;  3S1N B;  1WD1 A;  1L1O B;  2CHB D;  4GS3 A;  4IAL A;  2IY5 B;  1Q7Y C;  2H5X A;  4LF6 L;  4HR7 B;  1SYG A;  2DJG C;  2RDH A;  4XT3 B;  1PH5 A;  4LK1 C;  1EOV A;  5T1I A;  3CCV A;  5KIX A;  1ENA A;  4F88 A;  5K5P A;  5KRU A;  1CUK A;  4A75 A;  3VA5 A;  4GKK Q;  4JI1 L;  2NVX B;  2B63 B;  1BCP C;  3AFQ A;  5LMU L;  1HR0 W;  3I4M H;  3PO3 H;  4C3I H;  3UDI A;  3F1Z A;  4J15 A;  3H94 A;  1N9W A;  1EOT A;  1B3A A;  2KHJ A;  3M4Y A;  5K36 H;  3TZD A;  3NHH A;  1J8I A;  5E1F A;  4AYB G;  2WKD A;  3SK8 A;  4IUN A;  3ND8 A;  1JJC B;  3GTK B;  1Q46 A;  1G2T A;  5LL6 X;  1U9R A;  3I90 A;  1HQM C;  2E2H B;  1ASY A;  3ERS X;  3OSO A;  1RF2 D;  2PNR C;  2XRS D;  4KJO A;  1O7Z A;  3IL8 A;  3NBH A;  1YBY A;  2L1B A;  4OHJ A;  3OWE B;  1SND A;  4C1N K;  1Y8P B;  1TWF H;  3TS0 A;  5A2Q L;  4FO2 A;  3J7A V;  3I4M G;  2F0T A;  4JI3 L;  3PO3 G;  1LT3 D;  2OEO A;  1J6Q A;  5CV5 A;  5M3F G;  3K81 C;  5I2X A;  3CC7 A;  4AH6 A;  1KTK A;  4ZLT F;  5CV4 A;  1KRS A;  2FHT A;  1EQT A;  3EN2 A;  4ILW A;  2RA4 A;  3A74 A;  1YJ9 A;  5IT9 c;  2R93 B;  5IYD H;  3S1Q H;  1UE6 A;  1IL8 A;  1X3Q A;  4FF2 A;  4FXK C;  3EVQ A;  1GXD C;  4YIJ A;  3H0G G;  2BH8 A;  4QL5 A;  3MZ5 A;  5ELF A;  1BBX C;  1VQA A;  2MO1 A;  2EDG A;  3L2P A;  1BQQ T;  5IGE A;  2J0T D;  5IP7 H;  4OWT B;  1Y1V H;  2A6H C;  1QUQ B;  2TMP A;  1JC7 A;  3OW7 A;  3MHB A;  3S1M H;  4DAP A;  3CCL A;  2D0P A;  1IW7 C;  1SNC A;  2H1E A;  3EBE A;  1ET9 A;  1S40 A;  5I4D A;  3OW2 A;  1PTO H;  2XGT A;  2JK8 A;  1H9S A;  2HD3 A;  2R7D A;  2B63 H;  3SK6 A;  1ZKO A;  2F1M A;  1KDA A;  2XN9 C;  3MTS A;  2UXB L;  3FPU B;  3BDO A;  3ER0 A;  3TQY A;  3GTJ B;  4J6H A;  2KUM A;  4IJL A;  1Q1B A;  3JAM E;  3U58 A;  3NQI A;  2XRQ D;  4JBJ A;  3HOW B;  1PH8 A;  3CCU A;  1JWM D;  4C3H G;  4DKA C;  5J39 A;  2RCN A;  5FLX L;  1Y1V G;  2VQE L;  2AQ3 B;  3U9S A;  3E6Z X;  2MPM A;  2MNA A;  1JWU D;  5M9O A;  1EWI A;  2LSS A;  4IFD H;  4DR2 Q;  1J5E Q;  3J7Z C;  1SR3 A;  1C48 A;  4ID6 A;  4JI6 Q;  1CT1 D;  2K5D A;  2A19 A;  3Q0A A;  2FXQ A;  3FRP B;  5C6A A;  3I4L A;  5FK9 C;  2K6A A;  1TWA H;  4LF4 Q;  3CRL C;  2DGY A;  3I4M B;  3PO3 B;  3BVG A;  1PZK D;  2K01 A;  2JA8 G;  5IP7 G;  4A3B G;  3I2Z A;  1GUT A;  1FJG L;  3A8J E;  1TR5 A;  1U4M A;  5D3D A;  4JV5 Q;  4DXG A;  3R2T A;  4KN4 C;  5IOD A;  2NVT B;  4JC0 A;  4EQP A;  2RF4 A;  1B3Q A;  2YTY A;  4DU9 A;  2KEC A;  3GTO B;  2B2W A;  2JA8 B;  4DN4 M;  4NKL A;  1CFM A;  5C3E G;  2E2J H;  2O5J C;  1F2M A;  1KDB A;  4DA2 A;  3DEO A;  2BE5 C;  1GUW A;  1KAB A;  3DWA A;  3S1M B;  2F0O A;  2Q8I B;  4AQY Q;  3OTO L;  1PH9 A;  4A93 G;  3PV0 A;  1HFN A;  3KK7 A;  2WB1 E;  1MKH A;  2JA7 H;  2VB2 X;  3UDX A;  4IPH A;  2VQE Q;  4P73 A;  3RMH A;  4OWX B;  3VA7 A;  3NTI A;  5JVG 3;  4YCV A;  3KJP A;  1C9O A;  2RVL A;  3S17 H;  4A93 B;  3F8T A;  2ZXR A;  1M8A A;  2N3S A;  3I7F A;  3IAY A;  1B50 A;  2Q8T A;  3OWF A;  1F9R A;  5C4Z A;  3ITP A;  3QG1 A;  4TQU S;  4KK7 A;  1BOS A;  4ZAI A;  2FJ2 A;  4UY8 C;  3OMG A;  2EXZ A;  2B2Y A;  4LF9 L;  1GUG A;  3HOY H;  3S2H H;  3J81 j;  5IGF A;  4A93 H;  3S17 B;  4O42 A;  4EGV A;  4A3B B;  1BR9 A;  5J22 A;  1IXR A;  1XPO A;  3BS1 A;  1STH A;  1V1P B;  2FIN B;  4DNI A;  3H91 A;  1Y1W H;  4O0A A;  4PZ8 A;  1PH4 A;  1STB A;  1NTG A;  1K8G A;  4N9T A;  1JR0 D;  4EQN A;  5G3L D;  5JVH 3;  1F2Z A;  5EKI A;  1PRT C;  2PW5 A;  3BG3 A;  4IUU A;  3CPF A;  5CYU A;  3E5S A;  2AQ2 B;  1D6E C;  2IX3 A;  1LT5 D;  2NTS A;  1MIU A;  1ILP A;  4B08 A;  5FJ8 G;  3PUY A;  3H0G B;  5CMD A;  2WP8 J;  1OXV A;  1ROD A;  2K75 A;  1E2Z A;  4RFB A;  3GTQ B;  1U4P A;  4CDE C;  5CV7 A;  4QY7 A;  1G6Z A;  2QIL A;  3I70 A;  1XYI A;  3KLR A;  3AEV A;  2E2J B;  3M7N A;  2R7Z H;  2K5W A;  3QJY A;  2ZJP A;  1K8M A;  3GTM B;  1CKO A;  2MHV A;  1PFB A;  1B9N A;  3E0E A;  2Q2T A;  1ENF A;  1WTR A;  3BYY B;  2PNH A;  2ZTD A;  3RLF A;  1S5E D;  4OO1 G;  2B3G A;  1IBL Q;  1F9Q A;  2I5L X;  3H3V H;  4BBS B;  1AH9 A;  2UXC L;  1A0I A;  2B39 A;  2WAQ G;  1NY4 A;  2GVB A;  5IYC G;  1EWC A;  4OXP A;  3STB D;  3U50 C;  2QEJ C;  1SFO H;  3M85 A;  1PTO D;  2WIN B;  4DR5 Q;  3HG9 A;  1VQB A;  4L5S A;  4GOP A;  4R4C A;  1LAC A;  3BYT B;  3E0J A;  1YHB A;  5KEE A;  5M5W B;  2JJQ A;  4JW0 A;  4QUC A;  3HOU H;  1LM0 A;  1D2B A;  5AJ3 Q;  4RHR A;  1O78 A;  2CW0 D;  3WOF A;  3HFZ B;  3G71 A;  3NWT A;  4C2M B;  4H0L C;  4KTA A;  1OXU A;  4Y52 H;  1IYJ B;  3OMC A;  1H9K A;  4YWL A;  5K36 G;  1MBY A;  1CKN B;  4A3I B;  2R93 G;  3CP0 A;  1DOL A;  2PW7 A;  2VY3 A;  5M5W H;  3NEM A;  2Z4I A;  2YU9 B;  5CR3 A;  4A3L G;  2D2C C;  1WJJ A;  4YY3 L;  5IGC A;  4X65 L;  4LAA A;  1HNX L;  1CM9 A;  1R9T B;  5GAH C;  4IFD G;  4QIW E;  3C1F A;  1AEX A;  4KHZ A;  3WDN A;  1HJP A;  4A3J H;  2V4D A;  1A6X A;  4PNY A;  5J1Z A;  1AW7 A;  3HOZ B;  1YEZ A;  3T51 B;  1L0W A;  2VUM H;  4H02 A;  4L5R C;  4BY1 G;  4LFA Q;  4K2L A;  1BBU A;  1SJE D;  2EY1 A;  1FJG Q;  3KFU A;  3KDF A;  1L0X B;  1XX8 A;  1A15 A;  1D5M C;  3NPP A;  3FKI B;  1VCI A;  2JA6 H;  2NB0 A;  4A3B H;  1Q1E A;  2CVR A;  4H44 C;  3RUZ A;  4IUP A;  5COR A;  2A73 B;  2K28 A;  1WTP A;  1OO9 B;  4LNQ A;  1FGU A;  3PQI A;  4UP9 A;  4MTK A;  4DR2 L;  1PRT B;  1J5E L;  3J80 E;  3FDT A;  2IL8 A;  4CJ2 C;  4UHV A;  3S14 B;  3NP8 A;  1UE1 A;  1ZYR D;  1VQ4 A;  1ZEQ X;  2C5C A;  2L55 A;  1DOM A;  4R4Q A;  2I5H A;  5FLM G;  1WTW A;  2BDO A;  2TSS A;  1D8L A;  4XT1 B;  2A6E C;  3I4N G;  4L8J A;  1Q86 C;  3ULJ A;  1ICF B;  2HCI A;  2HHH Q;  1NAP A;  4BXX H;  2EJF C;  1NMF A;  5JJL A;  2PCF B;  2LXJ A;  3I73 A;  1VQK A;  1I50 H;  3I4O A;  1UEA B;  4DUZ Q;  1XTC D;  5EJW A;  1BUV T;  4LF6 Q;  3CKI B;  4HIK A;  1I3Q B;  4BY7 H;  1SE2 A;  5C4J H;  3KYH C;  1MHW C;  4GZY C;  1IL2 A;  1DGS A;  1W6K A;  2CW0 C;  2NN6 H;  2NVT H;  1Y1W G;  3BDL A;  3BZC A;  3K5O A;  2JA9 A;  2B2V A;  4HJ8 A;  1E0B A;  2HDM A;  3FKI G;  2PZT A;  3CCM A;  1JOO A;  4ME3 A;  3TSS A;  4JI5 L;  4DV7 Q;  4N8X 1;  4DF7 A;  1SMX A;  4F8M A;  3TP5 A;  3M7G A;  1CSQ A;  4XQQ A;  3S1Q B;  4ZYS A;  2WKC A;  2MFI A;  2NZO A;  3NEN A;  5IT9 E;  3HOZ G;  3FPP A;  3W2D A;  1S72 A;  1RKN A;  3PIP A;  3CCR A;  4HMI A;  1BVS A;  4DNR B;  3T1H Q;  1N36 Q;  5EAY A;  2PQA A;  1X3F A;  2Z0S A;  3RZO H;  1B53 A;  3OIQ A;  4ZUI A;  1KRT A;  1KNE A;  3T56 B;  1X32 A;  3JAM i;  3W5O A;  2HT1 A;  4IPG A;  1EIG A;  1VS0 A;  3X3M A;  5CC4 A;  4JPB W;  1TKW B;  4RCO A;  1G91 A;  2F0S A;  2CWP A;  3BZD B;  4K5X A;  3ND9 A;  4XTC S;  1AZP A;  1STN A;  2F0E A;  4XQN A;  3RD4 A;  3A56 A;  1DCZ A;  4X64 L;  3HOZ H;  1YNN C;  3HP3 A;  4R4I A;  4L5Q A;  4QMG A;  5JOB A;  3ULL A;  5C4H A;  3QB3 A;  1KC8 C;  4DV6 L;  5GAG C;  1R9T H;  4DK3 C;  5IYC H;  4AYB E;  3NUC A;  4KD3 A;  1Y1W B;  1UUP A;  2RSO A;  2L15 A;  5COY A;  1L0Y B;  3PO2 B;  3L7Z C;  2F0H A;  1YZ6 A;  3BU2 A;  2E2H H;  1PZJ D;  3EIV A;  2YTX A;  4QIW B;  1ASZ A;  1BF4 A;  5IGB A;  1HHV A;  3J80 i;  2DN8 A;  4R8I A;  1VF5 C;  4DGZ A;  4OEL B;  3HOV H;  1HA5 A;  1VMP A;  2KEN A;  3BVZ A;  3G6J B;  1AN8 A;  1NNX A;  1LTB D;  1VF7 A;  3HOX H;  1EY8 A;  2F0F A;  1D5Z C;  3WWV A;  4JI7 L;  3SVM A;  3R2I A;  1DJR D;  4C3H B;  2NTT A;  1LTI D;  1JMC A;  1HTL D;  5EKK A;  2L0C A;  1CK1 A;  1HQR D;  4G4K A;  5JPM C;  1QVG A;  1PH3 A;  2GN5 A;  4LF5 Q;  2N55 A;  2IJ0 A;  4JYA L;  5ELD A;  4JVZ A;  1HNX Q;  3C2P A;  2D62 A;  1O80 A;  4K8I A;  1V8Q A;  1WYD A;  2Y0S B;  4LW1 A;  1A2U A;  3GQB A;  4CKB A;  4X66 Q;  5BN3 A;  1A8V A;  1GJX A;  2F3I A;  5M3M G;  1KNA A;  3A8K E;  3I8Z A;  3DWP A;  1I94 L;  2JA5 G;  4PG3 A;  3FHW A;  3DHQ A;  4JV5 L;  1Q3L A;  2WV6 D;  2N8N A;  4IPC A;  1SN8 A;  4DK0 A;  2VB3 X;  2X6G A;  4KY6 A;  2XTI A;  1K9M C;  4A4I A;  1YI2 A;  4QGU A;  1SEB D;  2CKZ B;  1TWH H;  4YHH Q;  2IX0 A;  1I5F A;  3TDQ A;  3I55 A;  1HZB A;  2DNC A;  2ENB A;  1VQM A;  3OOC A;  3QOJ A;  4X65 Q;  2NVY B;  1SMY C;  3C46 A;  1SMY D;  2HQE A;  3S16 B;  3PF4 A;  4X62 Q;  4CJ1 B;  2X69 A;  2MUY A;  2G5D A;  5DNF A;  1DM0 B;  4JI0 Q;  1VQJ A; 
#chains in the Genus database with same CATH homology
 3SK4 A;  2IT1 A;  1SBB B;  5ELE A;  4KJN A;  3ZYY X;  2FMM A;  4RGN A;  4DAY A;  4NP5 A;  4CKE A;  2RSN A;  1T5E A;  4ZKC B;  2BCO A;  2F0N A;  1VMC A;  2QCP X;  3MVV A;  1YNJ D;  4XDX A;  2A68 C;  3SR1 A;  4KKU A;  5EBD A;  1S5C D;  4PMB A;  5JEA J;  1F77 A;  1ESF A;  1FYC A;  1PTO F;  4M1U B;  2F0M A;  3AB9 A;  5C3X A;  1EY4 A;  4K5V A;  1NSN S;  3URY A;  4KY7 A;  4Q5V A;  2QDB A;  5HGT A;  1SJH D;  1PLF A;  4BS9 A;  4KHV A;  5ELB A;  1QG7 A;  1EU3 A;  3AU7 A;  3S2H B;  1SYE A;  1SNO A;  2KA7 A;  1EY5 A;  2X6L A;  4DFA A;  1PTO C;  3LWU A;  5DM7 3;  3DXJ C;  5JEA H;  2WII B;  2RBM A;  2AUK A;  4WJW A;  2VUM B;  4OGQ C;  4R9W A;  1GHJ A;  1OXS C;  3T53 B;  3CQZ B;  1BCP B;  4QUF A;  5KNC A;  3PUW A;  4DAV A;  1BXT A;  2ICI A;  3D4D A;  2N88 A;  3MXG A;  3TZU A;  1LTR D;  3KBX A;  1AP0 A;  5LL6 S;  1LV9 A;  2F0I A;  4HAE A;  1DOK A;  1ET6 A;  3MEH A;  2B2T A;  4HCS A;  5FLX E;  5IT9 L;  4Q0F A;  1SDF A;  1IYV A;  2C9O A;  4X3S A;  2OF1 A;  2D5D A;  2EOT A;  5EQ0 A;  2NN6 G;  3AMU A;  3ERQ A;  4A3G B;  1EEI D;  5M5X B;  4NW2 A;  2I46 A;  3KLS X;  4PMW A;  2PO4 A;  3H3V C;  4RGM A;  2JA7 B;  2I07 B;  2F4I A;  1LTG D;  3HGB A;  4BWG B;  1EY9 A;  5FOB B;  1B4O A;  1R4Q B;  4OIK A;  2SNM A;  4LMQ D;  4EVO A;  2NYZ D;  5C3E B;  1MSH A;  2F0Q A;  5C0X H;  1QIL A;  1RDP D;  1A2T A;  3J80 L;  3FEW X;  2KQ3 A;  2G9D A;  1Y8N B;  3H6M A;  4HN7 A;  3CU7 A;  2R6G A;  4OO1 H;  5KYL A;  2D9U A;  3K5N A;  4X3K A;  1V43 A;  2FMC A;  4DXF A;  3N52 A;  4WFN 3;  2AWN A;  5HUR A;  4L6T B;  1GHK A;  1B9M A;  1Q8I A;  1LLR D;  5NUC A;  2JEA I;  3QOL A;  2QKI C;  5FO7 B;  3ONA B;  1BCP F;  2IW3 A;  2RDF A;  3NWS A;  5EPJ A;  2Z8L A;  2NZ1 D;  3IKJ A;  1H9S B;  2HCC A;  3HOY B;  2K03 A;  1SYF A;  2VXW A;  3GV6 A;  1KLG D;  4MHE A;  3I3C A;  1NCV A;  2KCN A;  1E2W A;  1ONL A;  1ZYR C;  1D5X C;  2F03 A;  3UI2 A;  2L9H A;  1EEF D;  4FXG C;  1GOZ A;  1FD7 D;  1I50 B;  1Q12 A;  1MD2 D;  2M9V A;  3I72 A;  2L12 A;  4NMZ A;  1VDZ A;  2A5H A;  2KCC A;  1O7L A;  2OXP A;  2O5I C;  1I6H B;  3IFD A;  2B2Y C;  1ICW A;  4P2C B;  5FO9 B;  1STG A;  2QF7 A;  2B2U C;  1TS2 A;  1TT2 A;  1PTO B;  2ZXP A;  4IUR A;  1STE A;  1STA A;  1TU2 B;  1FNV A;  4K14 A;  3Q24 A;  1RCV D;  2A69 D;  3NQT A;  2K05 A;  1JIC A;  4U68 A;  1TY0 A;  1F2L A;  1OXT A;  4XXE A;  1DD2 A;  1CI3 M;  2M2L A;  5C3W A;  2JYO A;  1CZG A;  4C3J G;  3I91 A;  4KI0 A;  1K8O A;  2B2U A;  3A8I E;  4Z9C B;  4V0B A;  2Z4H A;  5EBC A;  3D31 A;  4C3J B;  1HUN A;  3X3N A;  2RKS A;  4O1N A;  4RCN A;  4RWS C;  1CZW A;  4RGO S;  1HTP A;  1EIH A;  1BDO A;  2A69 C;  3GTL B;  2LS0 1;  2JP1 A;  3PUX A;  5C0X I;  3A55 A;  1G29 1;  4U67 3;  1V1P A;  5C5L A;  4HSV A;  4KN7 C;  2HDL A;  5I2Y A;  2WAC A;  2BOS A;  1I4Q A;  4UAI A;  1KLU D;  2DY8 A;  4BY7 B;  4B9X A;  4C1N I;  3SDZ A;  1CHQ D;  3KUP A;  4C56 C;  2ICE C;  4L63 B;  2A6H D;  1QB5 D;  4QF4 A;  5C4J B;  2B2W C;  4A3F B;  3CRK C;  5I6W A;  2LY7 A;  4ZRZ A;  3J81 L;  4IFD J;  2EJM A;  2EPB A;  4RKB A;  5EPK A;  1SYD A;  3VR2 A;  2BA0 A;  2KED A;  4QB4 A;  3VR6 A;  4KY5 A;  2F0V A;  4FNF A;  3FVQ A;  1Z47 A;  5FO8 B;  1IKL A;  5A2Q E;  1G2S A;  2RQX A;  4JK1 C;  1Y69 U;  3Q6S A;  4G7Z C;  4CBV A;  2XNA C;  1WTX A;  3DWQ A;  4A3J B;  4RGT A;  1SNP A;  1TWC B;  2BE5 D;  4ME5 A;  4K8J A;  2IPK D;  1LO5 D;  1EY6 A;  2JSO A;  5BN4 A;  1QNK A;  4CHT B;  3NTH A;  1I4P A;  2BA1 A;  1J9O A;  4IUT A;  1SAP A;  2JE6 I;  1RHP A;  1FGB D;  1NR2 A;  2F0J A;  4AYB B;  4Y7N B;  4IN3 A;  5CGK A;  1G8Z D;  4A3K B;  1JWS D;  4J8Q A;  1TII D;  3SXH A;  4S3S A;  2J4X A;  3SE0 A;  1B2T A;  2AWO A;  1TWA B;  2AUJ D;  1WTQ A;  1I6V C;  2SEB D;  3A7L A;  1RTN A;  5I9O A;  2EY5 A;  3S2D B;  2B2T C;  5IGD A;  1TQO A;  1CTM A;  1U4L A;  3KF8 A;  3PUV A;  4RA8 A;  5C0X G;  3I4N B;  3D4R A;  3EJI A;  4DNT B;  5D14 A;  1SYB A;  3SEB A;  4IUQ A;  2XVS A;  4I65 A;  1MSG A;  2RDG A;  2NWG A;  1TVX A;  5KYI A;  2NBF A;  1D1I A;  1FR3 A;  2L5T A;  3Q23 A;  2E76 C;  3MAQ A;  3TME A;  3QIA A;  3HKZ B;  4ULL A;  1PYW D;  2EVB A;  1EFI D;  2F0D A;  3K58 A;  5FKA C;  5D3I B;  3R3O A;  1EZ6 A;  2BDN A;  2K04 A;  1SNQ A;  1EYA A;  5CV6 A;  1JOQ A;  1A3T A;  1EWH A;  1CQF A;  2KVM A;  1YNJ C;  2EYO A;  1OXX K;  1MI2 A;  5LHY 1;  3J7A F;  1LTS D;  3GTG B;  2H4O A;  1PMR A;  2AQ1 B;  1LTA D;  2B8F A;  2PZU A;  2MJ8 A;  4PMC A;  1EYD A;  1QNU A;  1PZI D;  2EJG C;  2EYF A;  1PFN A;  4IFD I;  2F0L A;  1A3U A;  2E74 C;  5DEH A;  1DZ1 A;  3K6O A;  1DXM A;  2A68 D;  2PMZ B;  3HOX B;  3TN2 A;  4TKO B;  1JB3 A;  3VYU A;  5EGT A;  2ZXO A;  4KD4 A;  1KAA A;  3S15 B;  1B1Z A;  5G3L F;  2EZV A;  4CKC A;  2A74 C;  4WOR A;  4KKS A;  5BN5 A;  3NTK A;  1TS3 A;  3HRZ C;  3C3L A;  3N6R A;  2A6E D;  3R93 A;  4K6D A;  4BA2 I;  2XWB B;  3T4A C;  5JAV A;  3GP7 A;  5DAU A;  4X3T A;  1H9M A;  2F3W A;  3JAM L;  3S9W A;  5M3M B;  3EFX D;  1IHZ A;  2JA6 B;  1MGS A;  3BVM A;  3P1H A;  1TS4 A;  3VYT A;  1WVL A;  2B2V C;  2K33 A;  2EYP A;  2WB1 B;  3V2T A;  4HSP A;  4RH6 A;  1D1K A;  3T13 A;  4FF1 A;  3Q22 A;  4CGY B;  3TP8 A;  3HOU B;  4NDX A;  4A3M B;  1BCP D;  2EY2 A;  1AZQ A;  5JEA G;  4EQO A;  3VYS A;  4BA1 I;  2NN6 I;  1B44 D;  1EZ8 A;  1II3 A;  1STY A;  2YYZ A;  1SNM A;  5T1G A;  4C3I G;  1LT6 D;  5E4W C;  4IUV A;  1NUC A;  2L11 A;  1H9J A;  2NVQ B;  4F87 A;  4ZQ3 A;  3MXN A;  1NR4 A;  1Y1V B;  2F0G A;  1GUO A;  3K7A B;  3V05 A;  4FP5 D;  1QJO A;  3MXP A;  1WTV A;  3LWE A;  2K5Q A;  4X3U A;  2JEB I;  3L9A X;  4PQX A;  1HRJ A;  3J7Y W;  2O4X A;  3HEJ A;  1EL0 A;  2Z1C A;  3GO5 A;  4A3E B;  1ENC A;  4H7B A;  4CJ0 B;  2J7Z A;  2Q8R E;  3WOE A;  4IZ8 A;  1XWE A;  4OO1 I;  3SHL A;  1FNU A;  1I4G A;  1KDC A;  3TP6 A;  4ABN A;  3S1R B;  3CHB D;  1JOR A;  4JBW A;  1I4X A;  3GV3 A;  5EPL A;  2LFN A;  1A3V A;  1EY0 A;  1C8C A;  1HPC A;  2MP1 A;  4A3D B;  3A7A B;  4HED A;  2XWJ B;  1QE6 A;  3K0Y A;  1IW7 D;  1AFP A;  1F2Y A;  1JE4 A;  2M00 A;  4RHS A;  3NSW A;  5IIF A;  1ZXT A;  1S5D D;  3R8B A;  3RZD B;  1XXG A;  4OL7 A;  2JA5 B;  1HXY D;  3J81 E;  1QCB D;  3MWY W;  1FNW A;  1UAP A;  1BNZ A;  3MFY A;  5ISR A;  3RZO B;  3ERO A;  3MXU A;  3DM1 A;  4XQJ A;  3MC0 B;  2DNE A;  2F0W A;  4B9W A;  5C4X B;  3OIP A;  1SSO A;  5JPN C;  4R8N A;  3M3Y B;  1ILQ A;  1S5B D;  2IX1 A;  1I4R A;  4MN3 A;  5JJZ A;  1E2V A;  2G9H D;  3K59 A;  1Z6H A;  3VR3 A;  1LT4 D;  2ID0 A;  3EA6 A;  3DUZ A;  1SE3 A;  3LNN A;  4HCE A;  2K32 A;  3NE5 B;  1I4H A;  4FYD A;  1UNS A;  3D6W A;  3QO2 A;  5KNB A;  2JXM B;  3V96 A;  1HA6 A;  1W6J A;  1CA5 A;  3VYR A;  2VNU D;  2EYH A;  2EYM A;  1C4Q A;  1Y8O B;  4XIG S;  1SFO B;  2PYK A;  3KBG A;  4G57 A;  4V19 0;  3BDC A;  3PUZ A;  4MIU A;  2F0K A;  3P7J A;  2KEE A;  3A54 A;  2L4N A;  2SNS A;  2WAQ B;  4FXD A;  3O13 A;  4KV6 A;  2R3Z A;  4QCL A;  4G7O C;  3SK5 A;  5CV9 A;  1PRT D;  3DMU A;  3QWN A;  2DY7 A;  1S4Z A;  2FFK B;  5A35 A;  3T16 A;  3D8G A;  3GD7 A;  1ESR A;  3K57 A;  2B8G A;  4UDU C;  1EU4 A;  4I7Z C;  1DYQ A;  1EQV A;  2EYJ A;  3D4W A;  2F0U A;  3U9O A;  5E3F A;  2XSC A;  1QOH A;  5I9P A;  1SE4 A;  1T5X D;  5AFW A;  1M4V A;  2LMC B;  3NBI A;  2XIW A;  3LX0 A;  1R4P B;  2SDF A;  1TY2 A;  1CA6 A;  1EY7 A;  4H13 C;  4M8A A;  5E4X A;  3F2U A;  5M5Y B;  4KMU C;  2PPB C;  5DM6 3;  4XYO A;  1LAB A;  3MA2 B;  1TS5 A;  3K5M A;  1Q90 A;  2KOL A;  3KLS A;  4DK1 A;  3TP7 A;  1JQY D;  1CHP D;  4BY1 B;  1GUN A;  2NUC A;  4J1M A;  3PMF A;  1PFM A;  1TWG B;  2KJX A;  2O2L D;  3FMC A;  5CBE E;  1TWH B;  2R61 A;  1RTO A;  4FVM A;  4FF4 A;  4K5W A;  4HTH A;  1PRT F;  2CQA A;  4TSS A;  3W3A A;  4G7H C;  3NXW A;  3OHX C;  2LKV A;  3P75 A;  4F7X A;  1QWY A;  4OIJ A;  3EQL C;  5ELC A;  1WD0 A;  5IGG A;  2GA4 B;  2F3V A;  3HS0 C;  4FF3 A;  1GUS A;  1ML0 D;  2HUG A;  1U4R A;  2E75 C;  1IKM A;  2MGS A;  3TBI B;  3K5L A;  3IFT A;  2EYL A;  2EY6 A;  3PIO 3;  2PZW A;  2E2I B;  2OT2 A;  5CBA E;  1EYC A;  4WRD A;  5EKL A;  3DEP A;  4C3I B;  3VR5 A;  3L3O C;  1PDQ A;  3MFG A;  3D6C A;  1DON A;  3P20 A;  4K6L A;  4IQZ A;  2ZT9 C;  4XYQ A;  1SYC A;  5IOC A;  4RKL A;  1F9P A;  2R92 B;  2KHS A;  2K1B A;  1WTO A;  1TWF B;  5C44 B;  4ZKB B;  1RD9 D;  4E6I A;  1CQV A;  3C1E A;  5F2D A;  5KND A;  1K83 B;  4RAU C;  5C0X J;  3G7L A;  1WCM B;  4TRD A;  1RJT A;  2SOB A;  3M4O B;  1JOK A;  2R7Z B;  1IYU A;  3OPO A;  5KGU A;  1F9S A;  1V1O A;  4N9P A;  3D3R A;  4HMJ A;  2E2D C;  1HCZ A;  4K2K A;  1HUM A;  1HFG A;  5CV8 A;  2F0P A;  1SXT A;  1BO0 A;  5C5M A;  1O7Y A;  4LJZ C;  2PQE A;  1JCK B;  3HOV B;  1H9R A;  4KKT A;  2IWH A;  3HZX A;  1Z7T A;  4ZUJ A;  1S5F D;  4PV1 C;  1X3P A;  5D65 A;  3H09 A;  4ODG A;  3GTP B;  1YNN D;  3PIP 3;  1LTT D;  3VR4 A;  2EE1 A;  4BBR B;  1PXU A;  5I6Y A;  5TSS A;  3NK9 A;  2K7V A;  4ZK9 B;  5M3F B;  3S1N B;  1WD1 A;  2CHB D;  4IAL A;  4HR7 B;  1SYG A;  2RDH A;  4XT3 B;  4LK1 C;  5T1I A;  5KIX A;  1ENA A;  4F88 A;  5K5P A;  5KRU A;  3VA5 A;  2NVX B;  2B63 B;  1BCP C;  3H94 A;  1EOT A;  1B3A A;  5K36 H;  3M4Y A;  3TZD A;  3NHH A;  1J8I A;  5E1F A;  2WKD A;  3SK8 A;  4IUN A;  3ND8 A;  3GTK B;  1G2T A;  5LL6 X;  1U9R A;  3I90 A;  1HQM C;  2E2H B;  3OSO A;  1RF2 D;  2PNR C;  2XRS D;  4KJO A;  1O7Z A;  3IL8 A;  3NBH A;  2L1B A;  4OHJ A;  3OWE B;  1SND A;  4C1N K;  1Y8P B;  5A2Q L;  4FO2 A;  3J7A V;  2F0T A;  1LT3 D;  2OEO A;  5CV5 A;  5I2X A;  1KTK A;  4ZLT F;  5CV4 A;  2FHT A;  1EQT A;  4ILW A;  2RA4 A;  2R93 B;  1IL8 A;  1X3Q A;  4FF2 A;  4FXK C;  3EVQ A;  1GXD C;  4YIJ A;  3MZ5 A;  5ELF A;  1BBX C;  2EDG A;  1BQQ T;  5IGE A;  2J0T D;  2A6H C;  2TMP A;  1JC7 A;  3OW7 A;  3MHB A;  4DAP A;  1IW7 C;  1SNC A;  2H1E A;  1ET9 A;  5I4D A;  1PTO H;  1H9S A;  3SK6 A;  1ZKO A;  2F1M A;  1KDA A;  2XN9 C;  3MTS A;  3FPU B;  3BDO A;  3GTJ B;  4J6H A;  2KUM A;  1Q1B A;  3JAM E;  3NQI A;  2XRQ D;  3HOW B;  1JWM D;  4C3H G;  5J39 A;  5FLX L;  2AQ3 B;  3U9S A;  3E6Z X;  2MPM A;  1JWU D;  5M9O A;  4IFD H;  1C48 A;  4ID6 A;  1CT1 D;  2K5D A;  3Q0A A;  5C6A A;  3FRP B;  3I4L A;  5FK9 C;  2K6A A;  3I4M B;  3CRL C;  3PO3 B;  3BVG A;  1PZK D;  2K01 A;  1GUT A;  3A8J E;  1TR5 A;  1U4M A;  5D3D A;  4DXG A;  3R2T A;  4KN4 C;  5IOD A;  2NVT B;  4EQP A;  4DU9 A;  2KEC A;  3GTO B;  2B2W A;  2JA8 B;  4DN4 M;  4NKL A;  1CFM A;  2O5J C;  1F2M A;  1KDB A;  4DA2 A;  3DEO A;  2BE5 C;  1GUW A;  1KAB A;  3DWA A;  3S1M B;  2F0O A;  2Q8I B;  3PV0 A;  1HFN A;  3KK7 A;  2VB2 X;  3RMH A;  3VA7 A;  3NTI A;  5JVG 3;  2RVL A;  4A93 B;  2ZXR A;  1M8A A;  3IAY A;  1B50 A;  2Q8T A;  3OWF A;  1F9R A;  5C4Z A;  3ITP A;  3QG1 A;  4TQU S;  4KK7 A;  1BOS A;  4ZAI A;  2FJ2 A;  3OMG A;  2EXZ A;  2B2Y A;  1GUG A;  5IGF A;  3S17 B;  4O42 A;  4EGV A;  4A3B B;  1BR9 A;  5J22 A;  3BS1 A;  1STH A;  1V1P B;  2FIN B;  3H91 A;  1STB A;  4N9T A;  1JR0 D;  4EQN A;  5G3L D;  5JVH 3;  1F2Z A;  5EKI A;  1PRT C;  2PW5 A;  3BG3 A;  4IUU A;  5CYU A;  3E5S A;  2AQ2 B;  1D6E C;  2IX3 A;  1LT5 D;  2NTS A;  1ILP A;  4B08 A;  3PUY A;  3H0G B;  5CMD A;  2WP8 J;  1OXV A;  1ROD A;  4RFB A;  1E2Z A;  3GTQ B;  1G6Z A;  1U4P A;  5CV7 A;  2QIL A;  3I70 A;  1XYI A;  3KLR A;  2E2J B;  3M7N A;  2K5W A;  3QJY A;  3GTM B;  1K8M A;  2MHV A;  1PFB A;  1B9N A;  1ENF A;  1WTR A;  3BYY B;  3RLF A;  1S5E D;  4OO1 G;  1F9Q A;  4BBS B;  2B39 A;  1EWC A;  2QEJ C;  3M85 A;  1PTO D;  2WIN B;  3HG9 A;  1LAC A;  3BYT B;  3E0J A;  5KEE A;  5M5W B;  4QUC A;  1D2B A;  4RHR A;  1O78 A;  2CW0 D;  3NWT A;  4C2M B;  4H0L C;  4KTA A;  1OXU A;  3OMC A;  1H9K A;  5K36 G;  1MBY A;  4A3I B;  1DOL A;  2PW7 A;  2YU9 B;  2Z4I A;  5CR3 A;  2D2C C;  5IGC A;  4LAA A;  1CM9 A;  1R9T B;  4IFD G;  3C1F A;  1AEX A;  4KHZ A;  3WDN A;  2V4D A;  1A6X A;  4PNY A;  5J1Z A;  1AW7 A;  3HOZ B;  3T51 B;  4K2L A;  1SJE D;  2EY1 A;  1L0X B;  1XX8 A;  1A15 A;  1D5M C;  3NPP A;  3FKI B;  1VCI A;  2NB0 A;  1Q1E A;  2CVR A;  4H44 C;  3RUZ A;  4IUP A;  5COR A;  2A73 B;  2K28 A;  1WTP A;  1OO9 B;  1PRT B;  3J80 E;  3FDT A;  2IL8 A;  4CJ2 C;  3S14 B;  3NP8 A;  1ZYR D;  1ZEQ X;  2C5C A;  2L55 A;  1DOM A;  1WTW A;  2BDO A;  2TSS A;  4XT1 B;  2A6E C;  4L8J A;  2HCI A;  1NAP A;  2EJF C;  2PCF B;  3I73 A;  1UEA B;  1XTC D;  5EJW A;  1BUV T;  3CKI B;  1I3Q B;  1SE2 A;  4GZY C;  1W6K A;  2CW0 C;  2NN6 H;  3BDL A;  3K5O A;  2B2V A;  1E0B A;  2HDM A;  2PZT A;  1JOO A;  3TSS A;  4DF7 A;  4F8M A;  3TP5 A;  3M7G A;  4XQQ A;  3S1Q B;  4ZYS A;  2WKC A;  5IT9 E;  3FPP A;  3W2D A;  1RKN A;  4HMI A;  4DNR B;  1B53 A;  3OIQ A;  4ZUI A;  1KNE A;  3T56 B;  1X32 A;  1EIG A;  3X3M A;  5CC4 A;  1TKW B;  4RCO A;  1G91 A;  2F0S A;  3BZD B;  4K5X A;  3ND9 A;  4XTC S;  1AZP A;  1STN A;  2F0E A;  4XQN A;  3RD4 A;  3A56 A;  1DCZ A;  1YNN C;  3HP3 A;  4QMG A;  5JOB A;  5C4H A;  3QB3 A;  3NUC A;  4KD3 A;  1Y1W B;  1UUP A;  2RSO A;  5COY A;  1L0Y B;  3PO2 B;  3L7Z C;  2F0H A;  1PZJ D;  4QIW B;  1BF4 A;  5IGB A;  1HHV A;  2DN8 A;  4R8I A;  1VF5 C;  4DGZ A;  1HA5 A;  1VMP A;  3BVZ A;  3G6J B;  1AN8 A;  1LTB D;  1VF7 A;  1EY8 A;  2F0F A;  1D5Z C;  3SVM A;  3R2I A;  1DJR D;  4C3H B;  2NTT A;  1LTI D;  1HTL D;  5EKK A;  5JPM C;  2L0C A;  1CK1 A;  1HQR D;  4G4K A;  2N55 A;  2IJ0 A;  5ELD A;  3C2P A;  2D62 A;  1O80 A;  4K8I A;  1V8Q A;  2Y0S B;  1A2U A;  3GQB A;  4CKB A;  5BN3 A;  1GJX A;  1KNA A;  3A8K E;  3I8Z A;  3DWP A;  3DHQ A;  1Q3L A;  2WV6 D;  4DK0 A;  2VB3 X;  2X6G A;  4KY6 A;  1SEB D;  2IX0 A;  3TDQ A;  2DNC A;  2ENB A;  3OOC A;  3QOJ A;  2NVY B;  1SMY C;  3C46 A;  1SMY D;  2HQE A;  3S16 B;  4CJ1 B;  2X69 A;  2MUY A;  5DNF A;  1DM0 B;  3WOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...