2QW7A

Carboxysome subunit, ccml
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
MQLAKVLGTVVSTSKTPNLTGVKLLLVQFLDTKGQPLERYEVAGDVVGAGLNEWVLVARGSAARKERGNGDRPLDAMVVGIIDTVNVASGSLYNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein ccmL
publication title Atomic-level models of the bacterial carboxysome shell.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Structural protein
total genus 15
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2007-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2qw7A00
2RCFA 2HD3A 4JW0A 2Z9HA 4N8FA 5L37A 2QW7A 4I7AA 4N8X1 4JVZA
chains in the Genus database with same CATH superfamily
3AU7A 4DR4L 1K28A 2A6HD 2I46A 2JP1A 2I5MX 5C3WA 2QKIC 1Q8IA 3E3XA 2DNEA 5IT9L 3QO2A 1EQRA 1UE7A 2VQFL 2LY7A 2K7VA 4EVOA 4U673 4ILWA 3RLOA 5J39A 3S1RH 3TRZA 2Q2UA 1IBKL 3N52A 3NTHA 2B2UA 4ZRZA 1K8OA 3L3OC 4LF9Q 4A75A 2RDFA 4L5QA 3I4OA 1NBWA 1A15A 1QNUA 1PYWD 1B53A 2B2TA 2D0OA 5M3MB 2Y0SB 1XNRL 1IKLA 1VCIA 5BR8L 3GTJH 5G3LD 2E2HB 3RD4A 1JB3A 4JI4L 3DHQA 1QG7A 2TSSA 2ZTDA 2EY6A 3FKIG 1JR0D 1JQYD 4G7ZC 4JI2L 1PTOB 2NVYB 2PNRC 5D3DA 3PO3H 4P73A 3P20A 4XIGS 2AQ3B 5CGKA 1PV4A 1FNVA 1LABA 3U9OA 4CJ2C 1LTGD 2BCOA 1I50B 1C9OA 2A19A 1YJNA 2K5VA 5M5XH 3DXJC 4DK6C 4GN4B 4IFDG 5C6AA 1Q46A 3VDYA 4K0KL 4RFBA 5GAEC 3EIVA 4OX9L 1AE3A 3HG9A 3CCQA 5I2XA 4JI7L 4O1NA 3HOXH 4A3JG 2KCTA 3VYRA 2UUBQ 3TQYA 4DNIA 1UE5A 5M3MG 3GTGB 2Y0SG 3HFZB 1XXGA 4RKBA 1PZKD 5CR3A 3ICEA 1U4LA 1GUGA 4C3IH 2F0LA 4B3MQ 1K3BC 2V4DA 1X54A 2Q8IB 4UY8C 5GAGC 3H94A 5ELFA 4HR7B 1LTTD 2F0VA 2Z4HA 1EWHA 2XVSA 2R93H 4BY7B 2KECA 1EZ8A 4ZKCB 1PZJD 2F0IA 2QDBA 3PMFA 1STAA 2JEAI 2A68C 3HOYH 1ZEQX 2RDGA 1N34L 2A73B 1AEXA 3F8TA 4DV7Q 4R1JA 4TVAB 2XNAC 1B2TA 1EIFA 4JOIA 4A3EG 1Q90A 4LF6L 3HOWH 2JA6H 4OHJA 1KLUD 4OELB 4A3GB 3AB9A 1KRSA 2YTXA 2LS01 1JWSD 3MXPA 1J6QA 1B9NA 1U4MA 5IYCG 3OWEB 5C3EH 2IWHA 4HJ8A 3PQIA 3IFTA 1Q1EA 2AWOA 4DNRB 1HPCA 2KUMA 3S17H 4QUCA 1MHWC 1DGSA 1SYCA 3E5SA 3EJIA 1SYEA 1QCBD 1YNND 4A3IB 3TMEA 3AEVA 3CXCA 1YZ6A 4JBWA 2PCFB 3VYTA 3DMUA 5CBAE 4KHPL 2NVQH 3FRPB 4KI0A 1KDBA 2F0QA 3KYHC 5FO9B 2DN8A 4YCVA 1DCZA 4EQ5A 3RMHA 2ASBA 2OWOA 2JA9A 1LTSD 4BY1G 2UXBQ 3FP9A 1XPUA 4F87A 1L0WA 2VY3A 3EROA 2D5DA 4XDXA 2PZTA 2F0DA 3S15B 3TBIB 1XPOA 2HIXA 1PXUA 4LMQD 2GN5A 1CT1D 3S2HB 4WJ3M 1K8MA 3QJYA 1CTMA 2F0EA 3K5OA 1STYA 4X3UA 3GTQH 2K03A 1SFOH 4JPBW 1I3QB 1TS2A 1LM0A 1AZPA 1TWGH 4A3IG 4DV4Q 4GKJL 4C3HH 4POGA 2N78A 1Y8PB 3PO2H 3W2DA 2A69D 3T4AC 4RGMA 4DR6Q 2QEJC 5IWAL 4LFAL 1LACA 3JAME 5JPMC 4IZ8A 3QOJA 4YHHL 4GOPA 3DM3A 1D2BA 2VUMB 4HJ7A 2CVRA 3BVZA 2X6GA 5IODA 3ND9A 5CMDA 3D4RA 1HR0L 1W3SA 5KGUA 1L1OB 4NXNL 3K57A 3RLNA 1KNAA 5IYDH 3CHBD 3CQZH 2EE1A 2NZ1D 3HKSA 2AWNA 4HIMA 4HJAA 1N8RC 1X65A 3M4PA 4HMIA 1W6JA 5FLXL 1HNZQ 4JI6Q 2NB0A 3A8JE 1LO5D 1XJVA 4HCSA 5JVH3 2F4VQ 1X3EA 2EYMA 2YTYA 1F2ZA 2F3VA 3NPPA 3LX0A 3M4YA 4A3KG 1SYDA 3PF4A 1IYUA 2PZUA 5KNCA 4A3BH 4HSPA 3NHHA 1DJRD 1W6KA 5LMNL 1BBXC 1CQVA 1EQVA 4YY3L 2VUMG 2JA8B 2Q8RE 1CKOA 1BKBA 3NUCA 4Y52H 2WKDA 5FK9C 1WI5A 4IJHA 3GD7A 3QG1A 4KY7A 1Y8OB 4ODGA 4BBRH 2R3ZA 5C4ZA 1K9MC 3CW2C 1VQHA 5CV7A 2OEOA 4JI3L 2Z1CA 1S72A 5E1FA 1CFMA 3H91A 1FJGL 3HZXA 5A35A 4IPCA 4TQUS 1HNWQ 2AUJD 4A3FH 2D62A 4OO1G 1H9SA 3VR4A 3W1GA 1QVGA 2FMMA 4K6LA 3OPOA 3KJPA 1PMRA 3BZCA 3F2BA 1I6HH 1RTOA 2RCFA 1VQAA 1EYCA 1VQ8A 5E3FA 3KJOA 1L2FA 2ICEC 3CC7A 3I4MH 5C5MA 1X3QA 4NXML 3WDNA 1KDAA 2JA8G 4LF5Q 1XMQQ 3I8ZA 3MXGA 3VR2A 3J80L 2KBNA 2VNUD 3E0EA 2XIWA 5C4JB 4IUQA 3EA6A 3VYUA 4LUZA 4Y7NH 5IP9H 3G6EA 2WINB 2MQHA 1TT2A 4DAYB 4QB4A 5ELEA 5EKKA 4JYAL 2ENBA 1TKWB 2YYZA 1VQ9A 1XTDA 2M2LA 3S1QH 1CZWA 4CJ1B 4LF8Q 1VMCA 4IUTA 3VR5A 4GNXB 2R7ZB 3TS2A 1LUZA 3EFXD 1U4RA 4IPHA 5FJ8H 5JEAJ 2QDLA 3OHXC 3O13A 1YJ9A 2HCIA 2BA0A 4B3SL 3S17B 4TSSA 5CORA 2EY5A 1ZXTA 1SEBD 2F0HA 2F0KA 4DR7L 1XNQQ 2EYLA 1UWVA 4FNFA 1UUPA 1BUVT 4P74A 2H1EA 5ELNA 1KL9A 5CV4A 5EBCA 2E2JH 4YCUA 2EYOA 4OONA 2B3GA 2XWBB 4KK7A 2B39A 1N32L 3UDGA 4C1NI 3TEHB 1VQCA 1DOLA 3RZDH 3A55A 1I4QA 3FKIH 4DV0Q 3S1MH 1NSNS 3M85A 4C2MB 1TVXA 4LFBQ 4RAUC 3J7YW 4MN3A 1BQQT 4H13C 5IGBA 3AQQA 4RH6A 3I4NH 3AFQA 1DXMA 1TWFH 4FVMA 4YWLA 1KD1C 4O0AA 2Q2HA 2PQAB 2JA5B 5K36H 5M9OA 2LKVA 3HKZB 2IT1A 2J0TD 5E4XA 4IFDH 1BCPF 1ESRA 3ZYYX 2E5LL 1K8AC 3MEHA 1YITA 2JEBI 1D5XC 1LTBD 2VB2X 4A93G 1KABA 4JI1L 4X65L 2SNMA 4A3JH 4K2KA 2K05A 1ZYRD 2PZWA 1STNA 2XN9C 1IYVA 1CK1A 3C1EA 1YHBA 2PW7A 3L0OA 4JG2A 4JV5Q 1B4OA 1VQ4A 4LAAA 5NUCA 5J22A 1JJGA 5JJIA 1NCVA 2HQLA 4GOPB 2R7FA 3RZOH 2PW5A 4YIJA 4DR4Q 4BA1I 3SDZA 1STBA 2KHIA 1E2ZA 1K3RA 1EWCA 1SMYC 1TWCB 5LL6X 1EY7A 2VQFQ 2PNHA 4DPGA 4NKLA 1LT5D 1JC7A 2O5IC 3LNNA 5ELCA 1PHJA 4HTHA 1IBKQ 3GTMH 3TREA 3L7ZC 1WD0A 2MUYA 4A3EH 1VQDA 2R61A 3GTOH 1HUNA 2SDFA 4UHVA 2EY1A 1R4QB 4CDFC 2FFKB 3SK8A 4CHTB 1XNRQ 4QUFA 5BR8Q 4JI4Q 1B3AA 3SXHA 3DEPA 1SE3A 5LMNW 1AE2A 4JI2Q 5HY6A 1IHZA 1NUCA 3HOVH 3TSSA 3OYYA 2X69A 3EN2A 4HN7A 3CC2A 2UU9L 2UXDQ 1QILA 4DFAA 1D5MC 3J7A5 3T53B 3H0GB 3KDFA 4IURA 5COYA 1FNUA 3BDLA 4WJ4A 3F2DA 3CD6A 2VXWA 4JBJA 4NB3A 4K0KQ 3F1ZA 4OX9Q 4J15A 1WCMG 3HEJA 3GTPB 4JI7Q 4BY1H 4FO2A 1S4ZA 3S2DH 5D3IB 3ULPA 2F0MA 1VQMA 3UE1A 4KHVA 3CCSA 3I3CA 2EYFA 1EQTA 5M5YH 1EYGA 2B2TC 1R4PB 3SE0A 1GVPA 1WFQA 2B2VA 5FLMH 1NJIC 1C8CA 1H9JA 1YHQA 1PYBA 4R4CA 4G7HC 4IFDI 1ML0D 2H4OA 1CHPD 3GTKH 3Q23A 1PH6A 1J5EL 5EGTA 2AQ2B 2QA4A 1N34Q 3PUXA 4WFN3 1BBWA 2IX3A 3MVVA 3TZUA 2F0TA 3H0GG 3JAMi 1VQ6A 1QE6A 2D9UA 5FKAC 1SXTA 4LF6Q 1HHVA 2A6EC 4DV6Q 1EL0A 5T1GA 4JI8Q 3HOUB 3J81E 1QWYA 3I91A 3MC0B 3M7GA 4ULLA 1GUWA 3AMUA 2BH2A 4O2DA 3K7AH 1EY9A 4AQYL 3GTLH 2B29A 1F2MA 3P7JA 1P16A 2K04A 3S24A 2M9VA 1BCPC 3M4OH 4JK1C 3EQLC 1GJXA 2NTSA 4R4QA 1Y1WB 2WIIB 3LWEA 5KRUA 2CQAA 1V8QA 2OQ0A 5CV9A 2NTTA 2G9HD 4LW1A 3OMCA 4LUVA 1X3FA 4JI0L 2WAQE 2Z6KA 4PMBA 2XRSD 3SHLA 3VA5A 2MFIA 4A3KH 1YEZA 1GKHA 2C35B 2MJ8A 5KIXA 5JAVA 2PO4A 1E3PA 2BE5C 4XT3B 1WYDA 4A3LG 4GLVB 2I5LX 3Q8DA 1TS5A 5DEHA 1VQGA 4OWTB 4A3DG 5J1ZA 4DGZA 1GUTA 1SJED 1HA6A 5IYBG 1PRTD 1TS4A 3MEFA 5HURA 1SNCA 3K80C 1GUOA 4DXFA 2Z0SA 3CC4A 2CKZB 3HOZG 1CKNB 4G57A 4RHRA 4GNXC 1RKNA 2QGQA 1Y1WG 2YU9H 5M3FH 2WB1E 1DONA 2J7ZA 4GKJQ 4XYQA 1JORA 4OO1H 2MHVA 1B8AA 1BO0A 3EBEA 4NPSA 2JN4A 1TWHH 1STEA 2IHFA 4LFAQ 5IWAQ 1A3UA 1P8LA 1V9PA 4YHHQ 1FR3A 3I72A 1HZAA 3KF6A 1S40A 4DUZL 4RGTA 4ALPA 5IY0A 1HR0Q 2LXKA 3MXNB 4RA8A 4LF4L 4NXNQ 2K75A 5I4DA 1BNZA 4BBSH 1HZ9A 5C4HA 1KC8C 4QCLA 5C0XG 4CGYB 1WD1A 5D65A 1HQMC 1EY4A 2CHBD 4DR5L 1F9RA 2ZT9C 2A5HA 3D3RA 1QZGA 4ZUIA 4DR3L 1M1KC 1D1KA 2IX1A 3S14B 2KOLA 3MWYW 4N9PA 4H7BA 1A8VA 4POFA 3I7FA 1VQBA 1IKMA 3C46A 4PV1C 4DV2Q 5C44B 3J81c 5C4XH 4A3CH 2CWAA 4CKEA 1PTOD 5M5WH 1B1ZA 4R9WA 1S5FD 4XQQA 3A5ZB 1GD7A 3A7AB 1KDCA 4DNTB 2NVTH 5LMNQ 2N8NA 5JEAG 1Q1BA 3CRLC 1Y1VH 2CWPA 3U58A 2MNAA 4X3KA 4E6IA 2Q2TA 4FF4A 5BN5A 4DV3Q 1KRTA 4GOPC 2JA7H 3FDTA 2GVBA 3D4WA 4BS9A 4HJ5A 3HOVB 5EAYA 1WTQA 5G3LF 3JAML 1Y8NB 3G4SA 1JOOA 2EVBA 2HDLA 5I6YA 4KY5A 3UI2A 3KDFB 4JI3Q 1HQRD 1SDFA 1EFWA 4LFCL 3KLSX 2RHQB 3F2UA 3M3YH 1FJGQ 4JI5L 1MD2D 3M7NA 2PQEA 4BWGB 1GO3E 4FP5D 2R92B 1V1QA 3RUZA 1IL2A 5AJ3L 3OTOL 5C44G 4K6DA 3SVMA 1STHA 2HUGA 2C9OA 4NDXA 3TDQA 2FMCA 3B6YA 4HIKA 4DV1Q 1Q82C 2AKWB 4EGVA 4BY7G 4KV6A 2EZVA 3K6OA 5M5YB 4A3MB 5JJLA 4NXMQ 1E22A 3PUVA 3J80i 1L0XB 1JJ2A 3A0JA 1LT4D 4IJLA 4RHSA 4JCVE 1HXYD 4FF1A 1CA6A 4GS3A 1QVCA 3CCUA 1PDQA 4A3GG 4A93H 2JQOA 1VMPA 2PPBC 1QOHA 3IKJA 1O7ZA 1WTWA 1I94L 1AN8A 3NTIA 4N8X1 4OO1I 5JPNC 4AH6A 3T51B 4N9TA 2OCEA 3C3LA 4QQBX 4B9WA 4HCEA 5IE8A 4JYAQ 4NP5A 2R92G 2B63B 1SROA 3GP7A 4UP7A 1U0LA 4X66L 1TR5A 5EBDA 3KUPA 2CQOA 4IUNA 1IW7D 4R4IA 1YNJC 1STGA 1JMCA 2IHEA 4UP8A 1MSHA 4X62L 2R6GA 5A2QE 2N88A 3AYHB 4B3SQ 4B3TQ 3IL8A 1ICWA 3T56B 5JJZA 1AP0A 2CH4A 4C3JB 4DR7Q 1K83H 1WTHA 4HSVA 3CCVA 3S16B 2JJQA 2IX0A 1BBUA 1UAPA 2IL8A 2F0UA 2IPKD 4IQZA 1N32Q 1VQFA 3I55A 3CCLA 5T1IA 3H3VC 4OGQC 1LV9A 3N6RA 3J7ZC 1EWIA 2B63G 2MO1A 3RN2A 2F0FA 4K8JA 3S1RB 2KCMA 2F0SA 3CP0A 3BVMA 3MAQA 4DV5L 1O7YA 1LLRD 1K0RA 2A6HC 2F03A 3J7AF 2E2IH 5IT9c 3MFYA 1V1OA 4FDBA 1HZBA 4BXXG 1HFNA 4KN4C 3MXUA 4ME5A 1F9SA 3RNUA 2FHTA 4IPDA 2E5LQ 5E4WC 2ZXOA 1YJWA 3GTJB 3NP8A 1Y14B 3Q22A 1EEID 4JI1Q 2JSOA 1DOKA 4X65Q 1MJCA 2EYPA 4XT1B 5ELBA 3PO3B 4DR1L 1TY2A 2J4XA 1CHQD 3S1NH 2DNCA 2DY8A 2F1MA 4FXKC 3QWNA 2PMZB 5M5XB 1E24A 1HRJA 3QR8A 2PMZE 2I07B 2DUDA 2ES2A 1V1PA 1H9RA 4RMFA 4DK1A 1SYGA 3TS0A 4LWCA 2LMCB 1B44D 2I0QA 3HOXB 1BCPB 2G9DA 1PA6A 3G48A 1F77A 4H44C 4P75A 1DYQA 1TQOA 1TWAH 3PUYA 3DWPA 4OWXB 2WP8J 1GHKA 1F9PA 4C3IB 4QY7A 1KLGD 1Z6HA 1BXTA 3SK4A 3C2PA 1PVOA 4IOCA 5L37A 3PO3G 1QUQA 3JC66 1MJEA 1VQNA 2ICIA 3DLLA 1QNKA 4KJOA 2UUCL 5IGEA 1I4RA 2R93B 2JE6I 4CDDC 3K5MA 2NVTB 4FXGC 3HOYB 1NY4A 2XRQD 5CV5A 3L2PA 4G4KA 1T9HA 4X6AH 2HHHL 3IRBA 2LSSA 1PFNA 2G5DA 2XWJB 1DM0B 2EIFA 5CV8A 2A8VA 2C5CA 2F3WA 4IFDJ 5GROA 1WVLA 3HOWB 1G6ZA 2JA6B 1SJHD 2HD3A 4MIUA 2H5XA 3NBHA 2EJMA 3HOXG 3J7AV 2NVXH 1HJPA 1TY0A 2L4NA 2RHSB 4IPGA 4MTNA 5ISRA 4DK3C 5KNDA 1N33L 5C3EB 4A3LH 2VQEL 4C3IG 1PH9A 1LT6D 4QGUA 4RG1A 3DUZA 3ND8A 2P5ZX 4A3DH 4MHEA 4RGOS 2FINB 4A76A 4FYDA 4J6HA 2R93G 3W3AA 4I65A 1WTVA 2NVQB 1WJJA 1T5XD 4LJZC 1ONLA 4JBMA 1R9TH 3HOYG 2FJ2A 2BE5D 4L8JA 4KHZA 2NYZD 4RCNA 4DR6L 1JCKB 2L0CA 3FPPA 3HOWG 3D6WA 2JA6G 3G6JB 1LYLA 2RF4A 1YNNC 5LHY1 5GAHC 2NZOA 4K2LA 1JWMD 2F0JA 5F2DA 1A2TA 2R7ZG 5C3EG 4R8IA 4DUYL 3IAYA 1U9RA 4AYBE 5IGGA 1CZGA 3NBIA 5EPKA 3T1YQ 1OTCA 2AMCB 1RJTA 1G6PA 4AQYQ 3V2TA 1C7YA 1VF5C 3BZDB 3GTQB 1SFOB 5C0XH 2O2LD 4YCWA 1TWGB 4QF4A 1SN8A 2L12A 5EJWA 1SNPA 1D5ZC 4C3HB 2F0OA 4KD4A 3CCMA 2B2VC 5M3MH 3PO2B 1C4QA 1F2YA 4X3SA 2E2HH 5GADC 3J81j 1B7YB 2L5TA 4ZAIA 4JI0Q 2OXPA 1IXRA 1CA5A 1PTOH 2NVYH 1HTPA 1NR4A 5ELOA 1WTXA 3KOJA 1BOSA 3KLWA 4N8FA 1OO9B 3PIPA 3U50C 3CQZB 2RCNA 5EQ0A 2SNSA 1IZ6A 1I50H 4OEMB 2JA5G 1ET9A 3M4QA 4JC0A 4Z9CB 3HKZG 5FO7B 3BDCA 2BDNA 4DN4M 3NELA 1SYFA 4K14A 1KNEA 2VB3X 4KKTA 2IW3A 4PZ7A 4HMJA 4OL7A 1XYIA 2KEDA 3J81L 1X9NA 1I4XA 2E2IB 4DAMA 4L5SA 5JJKA 1I5FA 1ET6A 3GTGH 3H6MA 3PO2G 3EVQA 5IYCH 4A3BB 2A68D 3TP5A 1K73C 1XTCD 4DXGA 1LTRD 1PFSA 3I56A 4IO9A 1QB5D 2RSNA 2EXZA 4O42A 4UDUC 3R8BA 5K5PA 4B3RL 4QJFA 2UXCL 2Z6KC 1CQFA 4ZYSA 4QIWB 2YV5A 3K0XA 4BY7H 2E75C 2WACA 5IYDG 1D8LA 1YHAA 2K52A 1ILPA 4BBRB 4QIWE 4S3SA 4DUZQ 2DJGC 5GQOA 2QCPX 1OXVA 4LF4Q 1SE8A 1EIGA 1KXLA 5DAUA 1XPRA 4DR5Q 3DEOA 3PIP3 3CU7A 5BN3A 2EPBA 2A1AA 2B2UC 2HCCA 4GKKL 4A3GH 1Z47A 4FXDA 1S5DD 1L0YB 4A3FB 1H9SB 3I2ZA 3PSIA 2ZJQA 4DR3Q 3NWSA 3T1HL 1YVCA 1VQKA 2MP1A 3VYSA 2Z6BA 4A3BG 1EY5A 2N49A 1I6HB 4L6TB 1O78A 4B9XA 2B2WA 4KLKA 4DR2L 3QIAA 1JT8A 3I4MB 2NUCA 1LT3D 4LF7L 3E9HA 4R4OA 3PUWA 1RD9D 1Q81C 5TSSA 1NMGA 2EXDA 4A3IH 5C0XI 1SAPA 4X64L 1S5BD 1EY6A 1JE4A 1A2UA 1D1IA 4U68A 1M90C 1LTLA 1VQLA 1UE6A 3QB3A 3CAMA 4IALA 1X3GA 3KK7A 4Y7NB 1N36L 3K5LA 2K5NA 4PNYA 1Z7TA 3R3OA 2IY5B 1IBLL 2ZJPA 4A3FG 4IOAA 3KFUA 3NBHB 1JB7A 3BDOA 4LFCQ 2KCCA 4DV0L 3I73A 4TKOB 1YNJD 4ID6A 2RDHA 3S1QB 2EJGC 4K8IA 3S15H 1IBML 1EU4A 1E2WA 1Q7YC 1C0AA 2NN6G 4XTCS 3VR6A 3A74A 5AJ3Q 3OTOQ 3KBGA 3VR3A 3S2HH 3A7LA 2K5QA 2NBFA 3BG3A 1SNOA 4LK1C 2WAQB 4CKCA 2CW0C 4DA2A 1I3QH 4F8MA 4KHPQ 4ZKBB 3AFPA 4M8AA 1G2TA 3D31A 3S9WA 4OXPA 2K28A 4BXXH 3UDXA 2E2JB 1R9TB 1SNQA 3SGIA 2F0WA 1FYCA 2E74C 2E2DC 3FHWA 4CJ0B 5IP9G 1W2BA 2UUAL 1XMOL 4JOIC 3HOUG 1YBYA 4KKSA 3RZDB 1HH2P 1I94Q 3D8GA 3FKIB 2VUMH 3SK5A 3S1MB 4DU9A 3ERSX 1NTGA 5CC4A 2K14A 3MFGA 1GHJA 1L1OA 4UPAA 2KCNA 5KYLA 2JYOA 2WB1B 5FO8B 3I4NB 5KNBA 3GV3A 2M00A 1TWFB 4QMGA 1YIJA 4X66Q 5FJ8G 2OTJA 1ESFA 1EU3A 5CV6A 2I5HA 3PIOA 1GM5A 2WAQG 2PYKA 1SYBA 3NXWA 2KVMA 4X62Q 4JBKA 4YWKA 1PH1A 3STBC 2VS1A 1KTKA 1HNXL 1MI2A 2DGYA 1TIID 4A3JB 1EIYB 3UE0A 1DZ1A 1RL2A 3K59A 2ID0A 3V96A 4DAVA 3D0FA 3BYTB 3ZJYC 2Y0SE 2IJ0A 1RIPA 2OQKA 3ULLA 2JA8H 1CUKA 1JJCB 3RZOB 3I70A 1B9MA 3LGJA 3CCEA 3LWUA 4Q0FA 1UNSA 3ONAB 1EOVA 1EYDA 1NAPA 3CCRA 1ZYRC 1TS3A 1MGSA 2WB1G 3I4NG 1G291 2UXDL 1I4HA 3VA7A 5K36G 3K8AA 3E6ZX 3FVQA 4WORA 1EZ6A 1RCVD 2F0GA 2QF7A 5IP7G 4DV5Q 3GTMB 1E1OA 4KD3A 4A3EB 3K81C 2HIVA 3A8IE 2VZAA 3GTOB 2ATWA 2KHSA 3WOFA 1AH9A 4WRDA 2RKSA 5I6WA 1G91A 2K32A 5HGTA 2OF1A 1CSQA 1FNWA 4F88A 2B2YA 2L15A 3R2TA 1IL8A 4HIOA 3PIO3 1KHIA 4ZQ3A 4YY3Q 1PH2A 1PRTF 3OSOA 2XGTA 5C3XA 5A2QL 3X3MA 4UAIA 4DR1Q 2ZTCA 3WOEA 1VQ5A 3PGZA 4RWSC 4KN7C 2N55A 3OIPA 1II3A 4ZCKA 5IT9E 5LMUL 4H02A 3GDEA 3W5OA 3OW7A 5C4JH 4LNQA 2F0NA 1J8IA 4DAPA 1I6VC 3G71A 3T16A 1EY0A 2DY7A 1MSGA 1S5ED 1Q3LA 3HRZC 4DAYA 4BY1B 4DV6L 4JI8L 1CI3M 5IOCA 3S2DB 4QL5A 3TZDA 5CYUA 4DF7A 1GOZA 2VW9A 3M9BA 5DM73 1EQQA 2F3IA 3DM1A 3ITPA 2R7ZH 1X56A 4GNXA 4V0BA 3PUZA 2EYHA 1Z9FA 1OXUA 3V05A 3FEWX 3SR1A 4ZUJA 2ZM6L 3HOVG 1FVIA 2UUCQ 3GTKB 1SRUA 2K50A 1A0IA 2L55A 4X3TA 3H15A 3TN2A 5J3BA 3CCJA 2BOSA 4C56C 1HFGA 3TP8A 2HHHQ 2E76C 2L11A 2EQSA 3MHBA 1PTOF 2Z4IA 1E0BA 1K8GA 1D7QA 1LTAD 3PV0A 1SNMA 1PFBA 1HZCA 4C2MH 3K7AB 1ICFB 1YNXA 4CDEC 3GTLB 1NMFA 1N33Q 1XX8A 5DNFA 3D6CA 3K7UC 3MTSA 2VQEQ 4A3MG 1CKMA 4ZLTF 2Z9HA 2GA4B 4LF9L 3C1FA 5KYIA 4XQNA 3M4OB 2RVLA 2JA5H 5FLMG 4L5RC 4J1MA 4MNOA 3BJUA 1PYSB 2PQAA 1ILQA 2L9HA 1SLJA 2X6LA 1X55A 1BVSA 1PH7A 3CMEA 2WKCA 3NE5B 5I9PA 3H09A 3T13A 1PLFA 1BR9A 4APVA 3NWTA 3URYA 4MZ9A 1SMYD 2NZHA 1SBBB 1VQJA 4A3KB 1WTOA 2F0PA 3SK6A 1VS0A 4IUVA 3E9IA 2K1BA 4OWWB 1U5KA 2K6AA 4GLAC 5C5LA 2K5WA 1TWCH 1A63A 3BVGA 1H95A 4DUYQ 2LXJA 3GO5A 4DK0A 2GVAA 2Z8LA 1Q86C 2UUBL 1M8AA 2KEEA 4KMUC 4C3JG 1SSOA 1WCMH 2YU9B 2MGSA 5M3FB 2YTVA 3Q6SA 3RN5A 1O7IA 4NMZA 3D4DA 4B3ML 4RKLA 1PRTC 2K01A 4GN3B 4DV2L 5IGCA 4R4TA 4XQJA 1QVFA 3PCOB 1EIHA 5BN4A 1ENAA 1EY8A 2BH8A 4RCOA 1TWHB 4IN3A 4FF2A 4C1NK 4K5XA 5H1SE 2SOBA 2EYJA 3KF6B 3RR5A 3U4VA 1KAAA 1JE5A 2F52A 2PI2A 1I4GA 3U4ZA 1QZHA 1EOTA 3X3NA 4DV7L 1EFID 4Q5VA 4BBSB 4JVZA 1G2SA 4DV3L 1F9QA 4YWMA 3UDIA 4H0LC 4AIMA 1TXYA 1EEFD 3H0GH 3OOCA 5LL6S 1GXDC 2VL6A 1Q8KA 3KLRA 3HP3A 1RF2D 2KENA 3J81i 3CPFA 1Y69U 2K5HA 3NK9A 5M3FG 2RSOA 1BDOA 3GTPH 2F4IA 3G7LA 1HTLD 2K33A 4B08A 4EQOA 5C4XB 2LFNA 1HA5A 3NQTA 1ENCA 5M5WB 3CRKC 2TMPA 1C48A 2EJFC 4ME3A 1GUNA 3BU2A 1I4PA 4DV1L 4TRDA 2NN6H 1K0SA 4P72A 2B8GA 4IUPA 3KF8A 4R8NA 1E2VA 4PZ8A 2AHOB 4EQNA 1KIXA 3CPWA 4B3RQ 1Y1VB 2A6ED 2UXCQ 5DLQE 2UU9Q 2JA7B 5JVG3 4BBSG 2ZXRA 1PTOC 1M4VA 3A56A 3KBXA 2UXBL 4PMWA 3R2IA 4PG3A 5C0XJ 3H3VH 1PH4A 2KJXA 5FLXE 2QILA 1QJOA 1BCPD 1LTID 3BZKA 3M3YB 2B8FA 4MTKA 1ASYA 4A4IA 2ZTEA 4L63B 2JK8A 4GKKQ 3U9SA 3P1HA 2ZJRA 3NQIA 3HOUH 1JOQA 3JAMc 1NNXA 1SMXA 1RTNA 3T1HQ 1G8ZD 2XTIA 2CW0D 3UDFA 5C4XG 4A3CG 2AUKA 5IYBH 2RA4A 4JW0A 4LUOA 4DR2Q 1AZQA 1KAWA 3FPUB 3HOZH 1NE3A 3NENA 3NSWA 1JOKA 3OMGA 5EPLA 5I2YA 4DV4L 4LF7Q 2Q2IA 4HIDA 1Y1WH 1HUMA 1Y1VG 2NWGA 4GLXA 4DKAC 3OIQA 4B3TL 2JA7G 1J5EQ 4X64Q 2RBMA 3HS0C 3CKIB 3K0YA 2O5JC 1A3VA 4A93B 1B3QA 2QEXA 4PQXA 3CF5A 4I7ZC 4L5TA 3OWFA 1CM9A 5IGFA 1JWUD 5ELDA 2ALYB 4AYBB 4IUUA 1PH8A 1N36Q 4PMCA 1H9KA 1E1TA 2EOTA 2MO0A 2KHJA 4RGNA 1H9MA 1IBLQ 2EY2A 3E0JA 1WTPA 4F7XA 1J9OA 1HNZL 4JI6L 4V190 1IBMQ 2L1BA 1OXSC 3STBD 3RLFA 2CFMA 4CBVA 1RODA 2F4VL 2QW7A 2V1CC 2D0PA 2B2WC 1CKNA 3HGBA 1CSPA 2BA1A 2D2CC 5IP7H 1SE4A 4EQPA 3NTKA 4G7OC 1K83B 3A54A 3J80E 2RQXA 3OW2A 3A8KE 3HKZE 5CBEE 1O7LA 3F2CA 4EX5A 1IW7C 4K5WA 3Q24A 1FGUA 2K5DA 4CKBA 2OTLA 2DJFC 3MA2B 4AYBG 4BA2I 1VQ7A 2UUAQ 1XMOQ 2A69C 5JEAH 1ZKOA 1MIUA 3K5NA 2NN6I 4J8QA 2K4KA 4OIJA 1BF4A 2MPMA 1EYAA 3TP7A 5I9OA 1O80A 3MXNA 1HR0W 1VQEA 3BYYB 4KY6A 2N3SA 1X6OA 2R7DA 1D6EC 1HNWL 4C3HG 3H3VI 3I4LA 3ULJA 3S14H 5FLXc 1MBYA 1VF7A 3ERQA 1A62A 1X32A 5EPJA 1WCMB 1N9WA 4FF3A 2ZXPA 5KEEA 1VDZA 2JXMB 3WWVA 1HNXQ 5C44H 3DWAA 1OXXK 1UE1A 3W1BA 4P2CB 1FD7D 2XSCA 3GQBA 4P71A 4LF5L 2HT1A 3NEMA 3S1NB 1X3PA 1XMQL 3R93A 1RHPA 4M1UB 3CMAA 4GZYC 1A3TA 2A74C 3MZ5A 3BS1A 2E8GA 1SR3A 3GV6A 3K58A 4ZK9B 2PI2E 2WFWA 1V1PB 1V43A 2Q8TA 1U4PA 2HDMA 1GUSA 1UEBA 1L1OC 4KKUA 1YI2A 1S3OA 1JICA 3SEBA 1ENFA 5E7NA 1UEAB 1TWAB 2WV6D 4K5VA 1FGBD 5DM63 4LF8L 2R92H 1Q12A 3Q0AA 1AW7A 1WTRA 5EKIA 2AQ1B 4XXEA 4ABNA 1EUJA 2OT2A 4KTAA 1QUQB 1B50A 4HJ9A 1S5CD 5IIFA 3I90A 2BDOA 1KQSA 4A3MH 4BBRG 3KF8B 4NW2A 2KA7A 1XNQL 1A6XA 4GN5A 5EKLA 1PFMA 1TU2B 5FOBB 3DWQA 1AFPA 1HCZA 4HAEA 1VQPA 4OIKA 5LMUQ 3PF5A 3J80c 1OXTA 3ER0A 1PZID 2CH4W 1F2LA 4JI5Q 1ASZA 2O4XA 5D14A 1NR2A 2NVXB 5AFWA 1PH3A 1WOCA 4LFBL 3QOLA 2B63H 3I4MG 1DD2A 2EDGA 3FMCA 5HGQA 3L9AX 4UP9A 2KQ3A 1G51A 2SEBD 5JOBA 3IFDA 3T1YL 4KJNA 4A3DB 5IGDA 1PRTB 1SNDA 1IYJB 2HQEA 4XYOA 2B2YC 4I7AA 2CCZA 4HEDA 3HOZB 1SE2A 3A5UA 1T5EA 3TP6A 1RDPD 1VQOA 2ZM6Q 4C3JH 3KLSA 1VQIA 1PH5A 3S16H 4PZ6A 4JV5L 1MKHA 2FXQA 4WJWA 4CDCC 1E7ZA 1DOMA 1B70B 3P75A 1FL0A 1XWEA
chains in the Genus database with same CATH topology
2RCFA 2HD3A 4JW0A 2Z9HA 4N8FA 5L37A 2QW7A 4I7AA 4N8X1 4JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCF A;  2HD3 A;  4JW0 A;  2Z9H A;  4N8F A;  5L37 A;  2QW7 A;  4I7A A;  4N8X 1;  4JVZ A; 
#chains in the Genus database with same CATH topology
 3AU7 A;  4DR4 L;  1K28 A;  2A6H D;  2I46 A;  2JP1 A;  2I5M X;  5C3W A;  2QKI C;  1Q8I A;  3E3X A;  2DNE A;  5IT9 L;  3QO2 A;  1EQR A;  1UE7 A;  2VQF L;  2LY7 A;  2K7V A;  4EVO A;  4U67 3;  4ILW A;  3RLO A;  5J39 A;  3S1R H;  3TRZ A;  2Q2U A;  1IBK L;  3N52 A;  3NTH A;  2B2U A;  4ZRZ A;  1K8O A;  3L3O C;  4LF9 Q;  4A75 A;  2RDF A;  4L5Q A;  3I4O A;  1NBW A;  1A15 A;  1QNU A;  1PYW D;  1B53 A;  2B2T A;  2D0O A;  5M3M B;  2Y0S B;  1XNR L;  1IKL A;  1VCI A;  5BR8 L;  3GTJ H;  5G3L D;  2E2H B;  3RD4 A;  1JB3 A;  4JI4 L;  3DHQ A;  1QG7 A;  2TSS A;  2ZTD A;  2EY6 A;  3FKI G;  1JR0 D;  1JQY D;  4G7Z C;  4JI2 L;  1PTO B;  2NVY B;  2PNR C;  5D3D A;  3PO3 H;  4P73 A;  3P20 A;  4XIG S;  2AQ3 B;  5CGK A;  1PV4 A;  1FNV A;  1LAB A;  3U9O A;  4CJ2 C;  1LTG D;  2BCO A;  1I50 B;  1C9O A;  2A19 A;  1YJN A;  2K5V A;  5M5X H;  3DXJ C;  4DK6 C;  4GN4 B;  4IFD G;  5C6A A;  1Q46 A;  3VDY A;  4K0K L;  4RFB A;  5GAE C;  3EIV A;  4OX9 L;  1AE3 A;  3HG9 A;  3CCQ A;  5I2X A;  4JI7 L;  4O1N A;  3HOX H;  4A3J G;  2KCT A;  3VYR A;  2UUB Q;  3TQY A;  4DNI A;  1UE5 A;  5M3M G;  3GTG B;  2Y0S G;  3HFZ B;  1XXG A;  4RKB A;  1PZK D;  5CR3 A;  3ICE A;  1U4L A;  1GUG A;  4C3I H;  2F0L A;  4B3M Q;  1K3B C;  2V4D A;  1X54 A;  2Q8I B;  4UY8 C;  5GAG C;  3H94 A;  5ELF A;  4HR7 B;  1LTT D;  2F0V A;  2Z4H A;  1EWH A;  2XVS A;  2R93 H;  4BY7 B;  2KEC A;  1EZ8 A;  4ZKC B;  1PZJ D;  2F0I A;  2QDB A;  3PMF A;  1STA A;  2JEA I;  2A68 C;  3HOY H;  1ZEQ X;  2RDG A;  1N34 L;  2A73 B;  1AEX A;  3F8T A;  4DV7 Q;  4R1J A;  4TVA B;  2XNA C;  1B2T A;  1EIF A;  4JOI A;  4A3E G;  1Q90 A;  4LF6 L;  3HOW H;  2JA6 H;  4OHJ A;  1KLU D;  4OEL B;  4A3G B;  3AB9 A;  1KRS A;  2YTX A;  2LS0 1;  1JWS D;  3MXP A;  1J6Q A;  1B9N A;  1U4M A;  5IYC G;  3OWE B;  5C3E H;  2IWH A;  4HJ8 A;  3PQI A;  3IFT A;  1Q1E A;  2AWO A;  4DNR B;  1HPC A;  2KUM A;  3S17 H;  4QUC A;  1MHW C;  1DGS A;  1SYC A;  3E5S A;  3EJI A;  1SYE A;  1QCB D;  1YNN D;  4A3I B;  3TME A;  3AEV A;  3CXC A;  1YZ6 A;  4JBW A;  2PCF B;  3VYT A;  3DMU A;  5CBA E;  4KHP L;  2NVQ H;  3FRP B;  4KI0 A;  1KDB A;  2F0Q A;  3KYH C;  5FO9 B;  2DN8 A;  4YCV A;  1DCZ A;  4EQ5 A;  3RMH A;  2ASB A;  2OWO A;  2JA9 A;  1LTS D;  4BY1 G;  2UXB Q;  3FP9 A;  1XPU A;  4F87 A;  1L0W A;  2VY3 A;  3ERO A;  2D5D A;  4XDX A;  2PZT A;  2F0D A;  3S15 B;  3TBI B;  1XPO A;  2HIX A;  1PXU A;  4LMQ D;  2GN5 A;  1CT1 D;  3S2H B;  4WJ3 M;  1K8M A;  3QJY A;  1CTM A;  2F0E A;  3K5O A;  1STY A;  4X3U A;  3GTQ H;  2K03 A;  1SFO H;  4JPB W;  1I3Q B;  1TS2 A;  1LM0 A;  1AZP A;  1TWG H;  4A3I G;  4DV4 Q;  4GKJ L;  4C3H H;  4POG A;  2N78 A;  1Y8P B;  3PO2 H;  3W2D A;  2A69 D;  3T4A C;  4RGM A;  4DR6 Q;  2QEJ C;  5IWA L;  4LFA L;  1LAC A;  3JAM E;  5JPM C;  4IZ8 A;  3QOJ A;  4YHH L;  4GOP A;  3DM3 A;  1D2B A;  2VUM B;  4HJ7 A;  2CVR A;  3BVZ A;  2X6G A;  5IOD A;  3ND9 A;  5CMD A;  3D4R A;  1HR0 L;  1W3S A;  5KGU A;  1L1O B;  4NXN L;  3K57 A;  3RLN A;  1KNA A;  5IYD H;  3CHB D;  3CQZ H;  2EE1 A;  2NZ1 D;  3HKS A;  2AWN A;  4HIM A;  4HJA A;  1N8R C;  1X65 A;  3M4P A;  4HMI A;  1W6J A;  5FLX L;  1HNZ Q;  4JI6 Q;  2NB0 A;  3A8J E;  1LO5 D;  1XJV A;  4HCS A;  5JVH 3;  2F4V Q;  1X3E A;  2EYM A;  2YTY A;  1F2Z A;  2F3V A;  3NPP A;  3LX0 A;  3M4Y A;  4A3K G;  1SYD A;  3PF4 A;  1IYU A;  2PZU A;  5KNC A;  4A3B H;  4HSP A;  3NHH A;  1DJR D;  1W6K A;  5LMN L;  1BBX C;  1CQV A;  1EQV A;  4YY3 L;  2VUM G;  2JA8 B;  2Q8R E;  1CKO A;  1BKB A;  3NUC A;  4Y52 H;  2WKD A;  5FK9 C;  1WI5 A;  4IJH A;  3GD7 A;  3QG1 A;  4KY7 A;  1Y8O B;  4ODG A;  4BBR H;  2R3Z A;  5C4Z A;  1K9M C;  3CW2 C;  1VQH A;  5CV7 A;  2OEO A;  4JI3 L;  2Z1C A;  1S72 A;  5E1F A;  1CFM A;  3H91 A;  1FJG L;  3HZX A;  5A35 A;  4IPC A;  4TQU S;  1HNW Q;  2AUJ D;  4A3F H;  2D62 A;  4OO1 G;  1H9S A;  3VR4 A;  3W1G A;  1QVG A;  2FMM A;  4K6L A;  3OPO A;  3KJP A;  1PMR A;  3BZC A;  3F2B A;  1I6H H;  1RTO A;  2RCF A;  1VQA A;  1EYC A;  1VQ8 A;  5E3F A;  3KJO A;  1L2F A;  2ICE C;  3CC7 A;  3I4M H;  5C5M A;  1X3Q A;  4NXM L;  3WDN A;  1KDA A;  2JA8 G;  4LF5 Q;  1XMQ Q;  3I8Z A;  3MXG A;  3VR2 A;  3J80 L;  2KBN A;  2VNU D;  3E0E A;  2XIW A;  5C4J B;  4IUQ A;  3EA6 A;  3VYU A;  4LUZ A;  4Y7N H;  5IP9 H;  3G6E A;  2WIN B;  2MQH A;  1TT2 A;  4DAY B;  4QB4 A;  5ELE A;  5EKK A;  4JYA L;  2ENB A;  1TKW B;  2YYZ A;  1VQ9 A;  1XTD A;  2M2L A;  3S1Q H;  1CZW A;  4CJ1 B;  4LF8 Q;  1VMC A;  4IUT A;  3VR5 A;  4GNX B;  2R7Z B;  3TS2 A;  1LUZ A;  3EFX D;  1U4R A;  4IPH A;  5FJ8 H;  5JEA J;  2QDL A;  3OHX C;  3O13 A;  1YJ9 A;  2HCI A;  2BA0 A;  4B3S L;  3S17 B;  4TSS A;  5COR A;  2EY5 A;  1ZXT A;  1SEB D;  2F0H A;  2F0K A;  4DR7 L;  1XNQ Q;  2EYL A;  1UWV A;  4FNF A;  1UUP A;  1BUV T;  4P74 A;  2H1E A;  5ELN A;  1KL9 A;  5CV4 A;  5EBC A;  2E2J H;  4YCU A;  2EYO A;  4OON A;  2B3G A;  2XWB B;  4KK7 A;  2B39 A;  1N32 L;  3UDG A;  4C1N I;  3TEH B;  1VQC A;  1DOL A;  3RZD H;  3A55 A;  1I4Q A;  3FKI H;  4DV0 Q;  3S1M H;  1NSN S;  3M85 A;  4C2M B;  1TVX A;  4LFB Q;  4RAU C;  3J7Y W;  4MN3 A;  1BQQ T;  4H13 C;  5IGB A;  3AQQ A;  4RH6 A;  3I4N H;  3AFQ A;  1DXM A;  1TWF H;  4FVM A;  4YWL A;  1KD1 C;  4O0A A;  2Q2H A;  2PQA B;  2JA5 B;  5K36 H;  5M9O A;  2LKV A;  3HKZ B;  2IT1 A;  2J0T D;  5E4X A;  4IFD H;  1BCP F;  1ESR A;  3ZYY X;  2E5L L;  1K8A C;  3MEH A;  1YIT A;  2JEB I;  1D5X C;  1LTB D;  2VB2 X;  4A93 G;  1KAB A;  4JI1 L;  4X65 L;  2SNM A;  4A3J H;  4K2K A;  2K05 A;  1ZYR D;  2PZW A;  1STN A;  2XN9 C;  1IYV A;  1CK1 A;  3C1E A;  1YHB A;  2PW7 A;  3L0O A;  4JG2 A;  4JV5 Q;  1B4O A;  1VQ4 A;  4LAA A;  5NUC A;  5J22 A;  1JJG A;  5JJI A;  1NCV A;  2HQL A;  4GOP B;  2R7F A;  3RZO H;  2PW5 A;  4YIJ A;  4DR4 Q;  4BA1 I;  3SDZ A;  1STB A;  2KHI A;  1E2Z A;  1K3R A;  1EWC A;  1SMY C;  1TWC B;  5LL6 X;  1EY7 A;  2VQF Q;  2PNH A;  4DPG A;  4NKL A;  1LT5 D;  1JC7 A;  2O5I C;  3LNN A;  5ELC A;  1PHJ A;  4HTH A;  1IBK Q;  3GTM H;  3TRE A;  3L7Z C;  1WD0 A;  2MUY A;  4A3E H;  1VQD A;  2R61 A;  3GTO H;  1HUN A;  2SDF A;  4UHV A;  2EY1 A;  1R4Q B;  4CDF C;  2FFK B;  3SK8 A;  4CHT B;  1XNR Q;  4QUF A;  5BR8 Q;  4JI4 Q;  1B3A A;  3SXH A;  3DEP A;  1SE3 A;  5LMN W;  1AE2 A;  4JI2 Q;  5HY6 A;  1IHZ A;  1NUC A;  3HOV H;  3TSS A;  3OYY A;  2X69 A;  3EN2 A;  4HN7 A;  3CC2 A;  2UU9 L;  2UXD Q;  1QIL A;  4DFA A;  1D5M C;  3J7A 5;  3T53 B;  3H0G B;  3KDF A;  4IUR A;  5COY A;  1FNU A;  3BDL A;  4WJ4 A;  3F2D A;  3CD6 A;  2VXW A;  4JBJ A;  4NB3 A;  4K0K Q;  3F1Z A;  4OX9 Q;  4J15 A;  1WCM G;  3HEJ A;  3GTP B;  4JI7 Q;  4BY1 H;  4FO2 A;  1S4Z A;  3S2D H;  5D3I B;  3ULP A;  2F0M A;  1VQM A;  3UE1 A;  4KHV A;  3CCS A;  3I3C A;  2EYF A;  1EQT A;  5M5Y H;  1EYG A;  2B2T C;  1R4P B;  3SE0 A;  1GVP A;  1WFQ A;  2B2V A;  5FLM H;  1NJI C;  1C8C A;  1H9J A;  1YHQ A;  1PYB A;  4R4C A;  4G7H C;  4IFD I;  1ML0 D;  2H4O A;  1CHP D;  3GTK H;  3Q23 A;  1PH6 A;  1J5E L;  5EGT A;  2AQ2 B;  2QA4 A;  1N34 Q;  3PUX A;  4WFN 3;  1BBW A;  2IX3 A;  3MVV A;  3TZU A;  2F0T A;  3H0G G;  3JAM i;  1VQ6 A;  1QE6 A;  2D9U A;  5FKA C;  1SXT A;  4LF6 Q;  1HHV A;  2A6E C;  4DV6 Q;  1EL0 A;  5T1G A;  4JI8 Q;  3HOU B;  3J81 E;  1QWY A;  3I91 A;  3MC0 B;  3M7G A;  4ULL A;  1GUW A;  3AMU A;  2BH2 A;  4O2D A;  3K7A H;  1EY9 A;  4AQY L;  3GTL H;  2B29 A;  1F2M A;  3P7J A;  1P16 A;  2K04 A;  3S24 A;  2M9V A;  1BCP C;  3M4O H;  4JK1 C;  3EQL C;  1GJX A;  2NTS A;  4R4Q A;  1Y1W B;  2WII B;  3LWE A;  5KRU A;  2CQA A;  1V8Q A;  2OQ0 A;  5CV9 A;  2NTT A;  2G9H D;  4LW1 A;  3OMC A;  4LUV A;  1X3F A;  4JI0 L;  2WAQ E;  2Z6K A;  4PMB A;  2XRS D;  3SHL A;  3VA5 A;  2MFI A;  4A3K H;  1YEZ A;  1GKH A;  2C35 B;  2MJ8 A;  5KIX A;  5JAV A;  2PO4 A;  1E3P A;  2BE5 C;  4XT3 B;  1WYD A;  4A3L G;  4GLV B;  2I5L X;  3Q8D A;  1TS5 A;  5DEH A;  1VQG A;  4OWT B;  4A3D G;  5J1Z A;  4DGZ A;  1GUT A;  1SJE D;  1HA6 A;  5IYB G;  1PRT D;  1TS4 A;  3MEF A;  5HUR A;  1SNC A;  3K80 C;  1GUO A;  4DXF A;  2Z0S A;  3CC4 A;  2CKZ B;  3HOZ G;  1CKN B;  4G57 A;  4RHR A;  4GNX C;  1RKN A;  2QGQ A;  1Y1W G;  2YU9 H;  5M3F H;  2WB1 E;  1DON A;  2J7Z A;  4GKJ Q;  4XYQ A;  1JOR A;  4OO1 H;  2MHV A;  1B8A A;  1BO0 A;  3EBE A;  4NPS A;  2JN4 A;  1TWH H;  1STE A;  2IHF A;  4LFA Q;  5IWA Q;  1A3U A;  1P8L A;  1V9P A;  4YHH Q;  1FR3 A;  3I72 A;  1HZA A;  3KF6 A;  1S40 A;  4DUZ L;  4RGT A;  4ALP A;  5IY0 A;  1HR0 Q;  2LXK A;  3MXN B;  4RA8 A;  4LF4 L;  4NXN Q;  2K75 A;  5I4D A;  1BNZ A;  4BBS H;  1HZ9 A;  5C4H A;  1KC8 C;  4QCL A;  5C0X G;  4CGY B;  1WD1 A;  5D65 A;  1HQM C;  1EY4 A;  2CHB D;  4DR5 L;  1F9R A;  2ZT9 C;  2A5H A;  3D3R A;  1QZG A;  4ZUI A;  4DR3 L;  1M1K C;  1D1K A;  2IX1 A;  3S14 B;  2KOL A;  3MWY W;  4N9P A;  4H7B A;  1A8V A;  4POF A;  3I7F A;  1VQB A;  1IKM A;  3C46 A;  4PV1 C;  4DV2 Q;  5C44 B;  3J81 c;  5C4X H;  4A3C H;  2CWA A;  4CKE A;  1PTO D;  5M5W H;  1B1Z A;  4R9W A;  1S5F D;  4XQQ A;  3A5Z B;  1GD7 A;  3A7A B;  1KDC A;  4DNT B;  2NVT H;  5LMN Q;  2N8N A;  5JEA G;  1Q1B A;  3CRL C;  1Y1V H;  2CWP A;  3U58 A;  2MNA A;  4X3K A;  4E6I A;  2Q2T A;  4FF4 A;  5BN5 A;  4DV3 Q;  1KRT A;  4GOP C;  2JA7 H;  3FDT A;  2GVB A;  3D4W A;  4BS9 A;  4HJ5 A;  3HOV B;  5EAY A;  1WTQ A;  5G3L F;  3JAM L;  1Y8N B;  3G4S A;  1JOO A;  2EVB A;  2HDL A;  5I6Y A;  4KY5 A;  3UI2 A;  3KDF B;  4JI3 Q;  1HQR D;  1SDF A;  1EFW A;  4LFC L;  3KLS X;  2RHQ B;  3F2U A;  3M3Y H;  1FJG Q;  4JI5 L;  1MD2 D;  3M7N A;  2PQE A;  4BWG B;  1GO3 E;  4FP5 D;  2R92 B;  1V1Q A;  3RUZ A;  1IL2 A;  5AJ3 L;  3OTO L;  5C44 G;  4K6D A;  3SVM A;  1STH A;  2HUG A;  2C9O A;  4NDX A;  3TDQ A;  2FMC A;  3B6Y A;  4HIK A;  4DV1 Q;  1Q82 C;  2AKW B;  4EGV A;  4BY7 G;  4KV6 A;  2EZV A;  3K6O A;  5M5Y B;  4A3M B;  5JJL A;  4NXM Q;  1E22 A;  3PUV A;  3J80 i;  1L0X B;  1JJ2 A;  3A0J A;  1LT4 D;  4IJL A;  4RHS A;  4JCV E;  1HXY D;  4FF1 A;  1CA6 A;  4GS3 A;  1QVC A;  3CCU A;  1PDQ A;  4A3G G;  4A93 H;  2JQO A;  1VMP A;  2PPB C;  1QOH A;  3IKJ A;  1O7Z A;  1WTW A;  1I94 L;  1AN8 A;  3NTI A;  4N8X 1;  4OO1 I;  5JPN C;  4AH6 A;  3T51 B;  4N9T A;  2OCE A;  3C3L A;  4QQB X;  4B9W A;  4HCE A;  5IE8 A;  4JYA Q;  4NP5 A;  2R92 G;  2B63 B;  1SRO A;  3GP7 A;  4UP7 A;  1U0L A;  4X66 L;  1TR5 A;  5EBD A;  3KUP A;  2CQO A;  4IUN A;  1IW7 D;  4R4I A;  1YNJ C;  1STG A;  1JMC A;  2IHE A;  4UP8 A;  1MSH A;  4X62 L;  2R6G A;  5A2Q E;  2N88 A;  3AYH B;  4B3S Q;  4B3T Q;  3IL8 A;  1ICW A;  3T56 B;  5JJZ A;  1AP0 A;  2CH4 A;  4C3J B;  4DR7 Q;  1K83 H;  1WTH A;  4HSV A;  3CCV A;  3S16 B;  2JJQ A;  2IX0 A;  1BBU A;  1UAP A;  2IL8 A;  2F0U A;  2IPK D;  4IQZ A;  1N32 Q;  1VQF A;  3I55 A;  3CCL A;  5T1I A;  3H3V C;  4OGQ C;  1LV9 A;  3N6R A;  3J7Z C;  1EWI A;  2B63 G;  2MO1 A;  3RN2 A;  2F0F A;  4K8J A;  3S1R B;  2KCM A;  2F0S A;  3CP0 A;  3BVM A;  3MAQ A;  4DV5 L;  1O7Y A;  1LLR D;  1K0R A;  2A6H C;  2F03 A;  3J7A F;  2E2I H;  5IT9 c;  3MFY A;  1V1O A;  4FDB A;  1HZB A;  4BXX G;  1HFN A;  4KN4 C;  3MXU A;  4ME5 A;  1F9S A;  3RNU A;  2FHT A;  4IPD A;  2E5L Q;  5E4W C;  2ZXO A;  1YJW A;  3GTJ B;  3NP8 A;  1Y14 B;  3Q22 A;  1EEI D;  4JI1 Q;  2JSO A;  1DOK A;  4X65 Q;  1MJC A;  2EYP A;  4XT1 B;  5ELB A;  3PO3 B;  4DR1 L;  1TY2 A;  2J4X A;  1CHQ D;  3S1N H;  2DNC A;  2DY8 A;  2F1M A;  4FXK C;  3QWN A;  2PMZ B;  5M5X B;  1E24 A;  1HRJ A;  3QR8 A;  2PMZ E;  2I07 B;  2DUD A;  2ES2 A;  1V1P A;  1H9R A;  4RMF A;  4DK1 A;  1SYG A;  3TS0 A;  4LWC A;  2LMC B;  1B44 D;  2I0Q A;  3HOX B;  1BCP B;  2G9D A;  1PA6 A;  3G48 A;  1F77 A;  4H44 C;  4P75 A;  1DYQ A;  1TQO A;  1TWA H;  3PUY A;  3DWP A;  4OWX B;  2WP8 J;  1GHK A;  1F9P A;  4C3I B;  4QY7 A;  1KLG D;  1Z6H A;  1BXT A;  3SK4 A;  3C2P A;  1PVO A;  4IOC A;  5L37 A;  3PO3 G;  1QUQ A;  3JC6 6;  1MJE A;  1VQN A;  2ICI A;  3DLL A;  1QNK A;  4KJO A;  2UUC L;  5IGE A;  1I4R A;  2R93 B;  2JE6 I;  4CDD C;  3K5M A;  2NVT B;  4FXG C;  3HOY B;  1NY4 A;  2XRQ D;  5CV5 A;  3L2P A;  4G4K A;  1T9H A;  4X6A H;  2HHH L;  3IRB A;  2LSS A;  1PFN A;  2G5D A;  2XWJ B;  1DM0 B;  2EIF A;  5CV8 A;  2A8V A;  2C5C A;  2F3W A;  4IFD J;  5GRO A;  1WVL A;  3HOW B;  1G6Z A;  2JA6 B;  1SJH D;  2HD3 A;  4MIU A;  2H5X A;  3NBH A;  2EJM A;  3HOX G;  3J7A V;  2NVX H;  1HJP A;  1TY0 A;  2L4N A;  2RHS B;  4IPG A;  4MTN A;  5ISR A;  4DK3 C;  5KND A;  1N33 L;  5C3E B;  4A3L H;  2VQE L;  4C3I G;  1PH9 A;  1LT6 D;  4QGU A;  4RG1 A;  3DUZ A;  3ND8 A;  2P5Z X;  4A3D H;  4MHE A;  4RGO S;  2FIN B;  4A76 A;  4FYD A;  4J6H A;  2R93 G;  3W3A A;  4I65 A;  1WTV A;  2NVQ B;  1WJJ A;  1T5X D;  4LJZ C;  1ONL A;  4JBM A;  1R9T H;  3HOY G;  2FJ2 A;  2BE5 D;  4L8J A;  4KHZ A;  2NYZ D;  4RCN A;  4DR6 L;  1JCK B;  2L0C A;  3FPP A;  3HOW G;  3D6W A;  2JA6 G;  3G6J B;  1LYL A;  2RF4 A;  1YNN C;  5LHY 1;  5GAH C;  2NZO A;  4K2L A;  1JWM D;  2F0J A;  5F2D A;  1A2T A;  2R7Z G;  5C3E G;  4R8I A;  4DUY L;  3IAY A;  1U9R A;  4AYB E;  5IGG A;  1CZG A;  3NBI A;  5EPK A;  3T1Y Q;  1OTC A;  2AMC B;  1RJT A;  1G6P A;  4AQY Q;  3V2T A;  1C7Y A;  1VF5 C;  3BZD B;  3GTQ B;  1SFO B;  5C0X H;  2O2L D;  4YCW A;  1TWG B;  4QF4 A;  1SN8 A;  2L12 A;  5EJW A;  1SNP A;  1D5Z C;  4C3H B;  2F0O A;  4KD4 A;  3CCM A;  2B2V C;  5M3M H;  3PO2 B;  1C4Q A;  1F2Y A;  4X3S A;  2E2H H;  5GAD C;  3J81 j;  1B7Y B;  2L5T A;  4ZAI A;  4JI0 Q;  2OXP A;  1IXR A;  1CA5 A;  1PTO H;  2NVY H;  1HTP A;  1NR4 A;  5ELO A;  1WTX A;  3KOJ A;  1BOS A;  3KLW A;  4N8F A;  1OO9 B;  3PIP A;  3U50 C;  3CQZ B;  2RCN A;  5EQ0 A;  2SNS A;  1IZ6 A;  1I50 H;  4OEM B;  2JA5 G;  1ET9 A;  3M4Q A;  4JC0 A;  4Z9C B;  3HKZ G;  5FO7 B;  3BDC A;  2BDN A;  4DN4 M;  3NEL A;  1SYF A;  4K14 A;  1KNE A;  2VB3 X;  4KKT A;  2IW3 A;  4PZ7 A;  4HMJ A;  4OL7 A;  1XYI A;  2KED A;  3J81 L;  1X9N A;  1I4X A;  2E2I B;  4DAM A;  4L5S A;  5JJK A;  1I5F A;  1ET6 A;  3GTG H;  3H6M A;  3PO2 G;  3EVQ A;  5IYC H;  4A3B B;  2A68 D;  3TP5 A;  1K73 C;  1XTC D;  4DXG A;  1LTR D;  1PFS A;  3I56 A;  4IO9 A;  1QB5 D;  2RSN A;  2EXZ A;  4O42 A;  4UDU C;  3R8B A;  5K5P A;  4B3R L;  4QJF A;  2UXC L;  2Z6K C;  1CQF A;  4ZYS A;  4QIW B;  2YV5 A;  3K0X A;  4BY7 H;  2E75 C;  2WAC A;  5IYD G;  1D8L A;  1YHA A;  2K52 A;  1ILP A;  4BBR B;  4QIW E;  4S3S A;  4DUZ Q;  2DJG C;  5GQO A;  2QCP X;  1OXV A;  4LF4 Q;  1SE8 A;  1EIG A;  1KXL A;  5DAU A;  1XPR A;  4DR5 Q;  3DEO A;  3PIP 3;  3CU7 A;  5BN3 A;  2EPB A;  2A1A A;  2B2U C;  2HCC A;  4GKK L;  4A3G H;  1Z47 A;  4FXD A;  1S5D D;  1L0Y B;  4A3F B;  1H9S B;  3I2Z A;  3PSI A;  2ZJQ A;  4DR3 Q;  3NWS A;  3T1H L;  1YVC A;  1VQK A;  2MP1 A;  3VYS A;  2Z6B A;  4A3B G;  1EY5 A;  2N49 A;  1I6H B;  4L6T B;  1O78 A;  4B9X A;  2B2W A;  4KLK A;  4DR2 L;  3QIA A;  1JT8 A;  3I4M B;  2NUC A;  1LT3 D;  4LF7 L;  3E9H A;  4R4O A;  3PUW A;  1RD9 D;  1Q81 C;  5TSS A;  1NMG A;  2EXD A;  4A3I H;  5C0X I;  1SAP A;  4X64 L;  1S5B D;  1EY6 A;  1JE4 A;  1A2U A;  1D1I A;  4U68 A;  1M90 C;  1LTL A;  1VQL A;  1UE6 A;  3QB3 A;  3CAM A;  4IAL A;  1X3G A;  3KK7 A;  4Y7N B;  1N36 L;  3K5L A;  2K5N A;  4PNY A;  1Z7T A;  3R3O A;  2IY5 B;  1IBL L;  2ZJP A;  4A3F G;  4IOA A;  3KFU A;  3NBH B;  1JB7 A;  3BDO A;  4LFC Q;  2KCC A;  4DV0 L;  3I73 A;  4TKO B;  1YNJ D;  4ID6 A;  2RDH A;  3S1Q B;  2EJG C;  4K8I A;  3S15 H;  1IBM L;  1EU4 A;  1E2W A;  1Q7Y C;  1C0A A;  2NN6 G;  4XTC S;  3VR6 A;  3A74 A;  5AJ3 Q;  3OTO Q;  3KBG A;  3VR3 A;  3S2H H;  3A7L A;  2K5Q A;  2NBF A;  3BG3 A;  1SNO A;  4LK1 C;  2WAQ B;  4CKC A;  2CW0 C;  4DA2 A;  1I3Q H;  4F8M A;  4KHP Q;  4ZKB B;  3AFP A;  4M8A A;  1G2T A;  3D31 A;  3S9W A;  4OXP A;  2K28 A;  4BXX H;  3UDX A;  2E2J B;  1R9T B;  1SNQ A;  3SGI A;  2F0W A;  1FYC A;  2E74 C;  2E2D C;  3FHW A;  4CJ0 B;  5IP9 G;  1W2B A;  2UUA L;  1XMO L;  4JOI C;  3HOU G;  1YBY A;  4KKS A;  3RZD B;  1HH2 P;  1I94 Q;  3D8G A;  3FKI B;  2VUM H;  3SK5 A;  3S1M B;  4DU9 A;  3ERS X;  1NTG A;  5CC4 A;  2K14 A;  3MFG A;  1GHJ A;  1L1O A;  4UPA A;  2KCN A;  5KYL A;  2JYO A;  2WB1 B;  5FO8 B;  3I4N B;  5KNB A;  3GV3 A;  2M00 A;  1TWF B;  4QMG A;  1YIJ A;  4X66 Q;  5FJ8 G;  2OTJ A;  1ESF A;  1EU3 A;  5CV6 A;  2I5H A;  3PIO A;  1GM5 A;  2WAQ G;  2PYK A;  1SYB A;  3NXW A;  2KVM A;  4X62 Q;  4JBK A;  4YWK A;  1PH1 A;  3STB C;  2VS1 A;  1KTK A;  1HNX L;  1MI2 A;  2DGY A;  1TII D;  4A3J B;  1EIY B;  3UE0 A;  1DZ1 A;  1RL2 A;  3K59 A;  2ID0 A;  3V96 A;  4DAV A;  3D0F A;  3BYT B;  3ZJY C;  2Y0S E;  2IJ0 A;  1RIP A;  2OQK A;  3ULL A;  2JA8 H;  1CUK A;  1JJC B;  3RZO B;  3I70 A;  1B9M A;  3LGJ A;  3CCE A;  3LWU A;  4Q0F A;  1UNS A;  3ONA B;  1EOV A;  1EYD A;  1NAP A;  3CCR A;  1ZYR C;  1TS3 A;  1MGS A;  2WB1 G;  3I4N G;  1G29 1;  2UXD L;  1I4H A;  3VA7 A;  5K36 G;  3K8A A;  3E6Z X;  3FVQ A;  4WOR A;  1EZ6 A;  1RCV D;  2F0G A;  2QF7 A;  5IP7 G;  4DV5 Q;  3GTM B;  1E1O A;  4KD3 A;  4A3E B;  3K81 C;  2HIV A;  3A8I E;  2VZA A;  3GTO B;  2ATW A;  2KHS A;  3WOF A;  1AH9 A;  4WRD A;  2RKS A;  5I6W A;  1G91 A;  2K32 A;  5HGT A;  2OF1 A;  1CSQ A;  1FNW A;  4F88 A;  2B2Y A;  2L15 A;  3R2T A;  1IL8 A;  4HIO A;  3PIO 3;  1KHI A;  4ZQ3 A;  4YY3 Q;  1PH2 A;  1PRT F;  3OSO A;  2XGT A;  5C3X A;  5A2Q L;  3X3M A;  4UAI A;  4DR1 Q;  2ZTC A;  3WOE A;  1VQ5 A;  3PGZ A;  4RWS C;  4KN7 C;  2N55 A;  3OIP A;  1II3 A;  4ZCK A;  5IT9 E;  5LMU L;  4H02 A;  3GDE A;  3W5O A;  3OW7 A;  5C4J H;  4LNQ A;  2F0N A;  1J8I A;  4DAP A;  1I6V C;  3G71 A;  3T16 A;  1EY0 A;  2DY7 A;  1MSG A;  1S5E D;  1Q3L A;  3HRZ C;  4DAY A;  4BY1 B;  4DV6 L;  4JI8 L;  1CI3 M;  5IOC A;  3S2D B;  4QL5 A;  3TZD A;  5CYU A;  4DF7 A;  1GOZ A;  2VW9 A;  3M9B A;  5DM7 3;  1EQQ A;  2F3I A;  3DM1 A;  3ITP A;  2R7Z H;  1X56 A;  4GNX A;  4V0B A;  3PUZ A;  2EYH A;  1Z9F A;  1OXU A;  3V05 A;  3FEW X;  3SR1 A;  4ZUJ A;  2ZM6 L;  3HOV G;  1FVI A;  2UUC Q;  3GTK B;  1SRU A;  2K50 A;  1A0I A;  2L55 A;  4X3T A;  3H15 A;  3TN2 A;  5J3B A;  3CCJ A;  2BOS A;  4C56 C;  1HFG A;  3TP8 A;  2HHH Q;  2E76 C;  2L11 A;  2EQS A;  3MHB A;  1PTO F;  2Z4I A;  1E0B A;  1K8G A;  1D7Q A;  1LTA D;  3PV0 A;  1SNM A;  1PFB A;  1HZC A;  4C2M H;  3K7A B;  1ICF B;  1YNX A;  4CDE C;  3GTL B;  1NMF A;  1N33 Q;  1XX8 A;  5DNF A;  3D6C A;  3K7U C;  3MTS A;  2VQE Q;  4A3M G;  1CKM A;  4ZLT F;  2Z9H A;  2GA4 B;  4LF9 L;  3C1F A;  5KYI A;  4XQN A;  3M4O B;  2RVL A;  2JA5 H;  5FLM G;  4L5R C;  4J1M A;  4MNO A;  3BJU A;  1PYS B;  2PQA A;  1ILQ A;  2L9H A;  1SLJ A;  2X6L A;  1X55 A;  1BVS A;  1PH7 A;  3CME A;  2WKC A;  3NE5 B;  5I9P A;  3H09 A;  3T13 A;  1PLF A;  1BR9 A;  4APV A;  3NWT A;  3URY A;  4MZ9 A;  1SMY D;  2NZH A;  1SBB B;  1VQJ A;  4A3K B;  1WTO A;  2F0P A;  3SK6 A;  1VS0 A;  4IUV A;  3E9I A;  2K1B A;  4OWW B;  1U5K A;  2K6A A;  4GLA C;  5C5L A;  2K5W A;  1TWC H;  1A63 A;  3BVG A;  1H95 A;  4DUY Q;  2LXJ A;  3GO5 A;  4DK0 A;  2GVA A;  2Z8L A;  1Q86 C;  2UUB L;  1M8A A;  2KEE A;  4KMU C;  4C3J G;  1SSO A;  1WCM H;  2YU9 B;  2MGS A;  5M3F B;  2YTV A;  3Q6S A;  3RN5 A;  1O7I A;  4NMZ A;  3D4D A;  4B3M L;  4RKL A;  1PRT C;  2K01 A;  4GN3 B;  4DV2 L;  5IGC A;  4R4T A;  4XQJ A;  1QVF A;  3PCO B;  1EIH A;  5BN4 A;  1ENA A;  1EY8 A;  2BH8 A;  4RCO A;  1TWH B;  4IN3 A;  4FF2 A;  4C1N K;  4K5X A;  5H1S E;  2SOB A;  2EYJ A;  3KF6 B;  3RR5 A;  3U4V A;  1KAA A;  1JE5 A;  2F52 A;  2PI2 A;  1I4G A;  3U4Z A;  1QZH A;  1EOT A;  3X3N A;  4DV7 L;  1EFI D;  4Q5V A;  4BBS B;  4JVZ A;  1G2S A;  4DV3 L;  1F9Q A;  4YWM A;  3UDI A;  4H0L C;  4AIM A;  1TXY A;  1EEF D;  3H0G H;  3OOC A;  5LL6 S;  1GXD C;  2VL6 A;  1Q8K A;  3KLR A;  3HP3 A;  1RF2 D;  2KEN A;  3J81 i;  3CPF A;  1Y69 U;  2K5H A;  3NK9 A;  5M3F G;  2RSO A;  1BDO A;  3GTP H;  2F4I A;  3G7L A;  1HTL D;  2K33 A;  4B08 A;  4EQO A;  5C4X B;  2LFN A;  1HA5 A;  3NQT A;  1ENC A;  5M5W B;  3CRK C;  2TMP A;  1C48 A;  2EJF C;  4ME3 A;  1GUN A;  3BU2 A;  1I4P A;  4DV1 L;  4TRD A;  2NN6 H;  1K0S A;  4P72 A;  2B8G A;  4IUP A;  3KF8 A;  4R8N A;  1E2V A;  4PZ8 A;  2AHO B;  4EQN A;  1KIX A;  3CPW A;  4B3R Q;  1Y1V B;  2A6E D;  2UXC Q;  5DLQ E;  2UU9 Q;  2JA7 B;  5JVG 3;  4BBS G;  2ZXR A;  1PTO C;  1M4V A;  3A56 A;  3KBX A;  2UXB L;  4PMW A;  3R2I A;  4PG3 A;  5C0X J;  3H3V H;  1PH4 A;  2KJX A;  5FLX E;  2QIL A;  1QJO A;  1BCP D;  1LTI D;  3BZK A;  3M3Y B;  2B8F A;  4MTK A;  1ASY A;  4A4I A;  2ZTE A;  4L63 B;  2JK8 A;  4GKK Q;  3U9S A;  3P1H A;  2ZJR A;  3NQI A;  3HOU H;  1JOQ A;  3JAM c;  1NNX A;  1SMX A;  1RTN A;  3T1H Q;  1G8Z D;  2XTI A;  2CW0 D;  3UDF A;  5C4X G;  4A3C G;  2AUK A;  5IYB H;  2RA4 A;  4JW0 A;  4LUO A;  4DR2 Q;  1AZQ A;  1KAW A;  3FPU B;  3HOZ H;  1NE3 A;  3NEN A;  3NSW A;  1JOK A;  3OMG A;  5EPL A;  5I2Y A;  4DV4 L;  4LF7 Q;  2Q2I A;  4HID A;  1Y1W H;  1HUM A;  1Y1V G;  2NWG A;  4GLX A;  4DKA C;  3OIQ A;  4B3T L;  2JA7 G;  1J5E Q;  4X64 Q;  2RBM A;  3HS0 C;  3CKI B;  3K0Y A;  2O5J C;  1A3V A;  4A93 B;  1B3Q A;  2QEX A;  4PQX A;  3CF5 A;  4I7Z C;  4L5T A;  3OWF A;  1CM9 A;  5IGF A;  1JWU D;  5ELD A;  2ALY B;  4AYB B;  4IUU A;  1PH8 A;  1N36 Q;  4PMC A;  1H9K A;  1E1T A;  2EOT A;  2MO0 A;  2KHJ A;  4RGN A;  1H9M A;  1IBL Q;  2EY2 A;  3E0J A;  1WTP A;  4F7X A;  1J9O A;  1HNZ L;  4JI6 L;  4V19 0;  1IBM Q;  2L1B A;  1OXS C;  3STB D;  3RLF A;  2CFM A;  4CBV A;  1ROD A;  2F4V L;  2QW7 A;  2V1C C;  2D0P A;  2B2W C;  1CKN A;  3HGB A;  1CSP A;  2BA1 A;  2D2C C;  5IP7 H;  1SE4 A;  4EQP A;  3NTK A;  4G7O C;  1K83 B;  3A54 A;  3J80 E;  2RQX A;  3OW2 A;  3A8K E;  3HKZ E;  5CBE E;  1O7L A;  3F2C A;  4EX5 A;  1IW7 C;  4K5W A;  3Q24 A;  1FGU A;  2K5D A;  4CKB A;  2OTL A;  2DJF C;  3MA2 B;  4AYB G;  4BA2 I;  1VQ7 A;  2UUA Q;  1XMO Q;  2A69 C;  5JEA H;  1ZKO A;  1MIU A;  3K5N A;  2NN6 I;  4J8Q A;  2K4K A;  4OIJ A;  1BF4 A;  2MPM A;  1EYA A;  3TP7 A;  5I9O A;  1O80 A;  3MXN A;  1HR0 W;  1VQE A;  3BYY B;  4KY6 A;  2N3S A;  1X6O A;  2R7D A;  1D6E C;  1HNW L;  4C3H G;  3H3V I;  3I4L A;  3ULJ A;  3S14 H;  5FLX c;  1MBY A;  1VF7 A;  3ERQ A;  1A62 A;  1X32 A;  5EPJ A;  1WCM B;  1N9W A;  4FF3 A;  2ZXP A;  5KEE A;  1VDZ A;  2JXM B;  3WWV A;  1HNX Q;  5C44 H;  3DWA A;  1OXX K;  1UE1 A;  3W1B A;  4P2C B;  1FD7 D;  2XSC A;  3GQB A;  4P71 A;  4LF5 L;  2HT1 A;  3NEM A;  3S1N B;  1X3P A;  1XMQ L;  3R93 A;  1RHP A;  4M1U B;  3CMA A;  4GZY C;  1A3T A;  2A74 C;  3MZ5 A;  3BS1 A;  2E8G A;  1SR3 A;  3GV6 A;  3K58 A;  4ZK9 B;  2PI2 E;  2WFW A;  1V1P B;  1V43 A;  2Q8T A;  1U4P A;  2HDM A;  1GUS A;  1UEB A;  1L1O C;  4KKU A;  1YI2 A;  1S3O A;  1JIC A;  3SEB A;  1ENF A;  5E7N A;  1UEA B;  1TWA B;  2WV6 D;  4K5V A;  1FGB D;  5DM6 3;  4LF8 L;  2R92 H;  1Q12 A;  3Q0A A;  1AW7 A;  1WTR A;  5EKI A;  2AQ1 B;  4XXE A;  4ABN A;  1EUJ A;  2OT2 A;  4KTA A;  1QUQ B;  1B50 A;  4HJ9 A;  1S5C D;  5IIF A;  3I90 A;  2BDO A;  1KQS A;  4A3M H;  4BBR G;  3KF8 B;  4NW2 A;  2KA7 A;  1XNQ L;  1A6X A;  4GN5 A;  5EKL A;  1PFM A;  1TU2 B;  5FOB B;  3DWQ A;  1AFP A;  1HCZ A;  4HAE A;  1VQP A;  4OIK A;  5LMU Q;  3PF5 A;  3J80 c;  1OXT A;  3ER0 A;  1PZI D;  2CH4 W;  1F2L A;  4JI5 Q;  1ASZ A;  2O4X A;  5D14 A;  1NR2 A;  2NVX B;  5AFW A;  1PH3 A;  1WOC A;  4LFB L;  3QOL A;  2B63 H;  3I4M G;  1DD2 A;  2EDG A;  3FMC A;  5HGQ A;  3L9A X;  4UP9 A;  2KQ3 A;  1G51 A;  2SEB D;  5JOB A;  3IFD A;  3T1Y L;  4KJN A;  4A3D B;  5IGD A;  1PRT B;  1SND A;  1IYJ B;  2HQE A;  4XYO A;  2B2Y C;  4I7A A;  2CCZ A;  4HED A;  3HOZ B;  1SE2 A;  3A5U A;  1T5E A;  3TP6 A;  1RDP D;  1VQO A;  2ZM6 Q;  4C3J H;  3KLS A;  1VQI A;  1PH5 A;  3S16 H;  4PZ6 A;  4JV5 L;  1MKH A;  2FXQ A;  4WJW A;  4CDC C;  1E7Z A;  1DOM A;  1B70 B;  3P75 A;  1FL0 A;  1XWE A; 
#chains in the Genus database with same CATH homology
 2RCF A;  2HD3 A;  4JW0 A;  2Z9H A;  4N8F A;  5L37 A;  2QW7 A;  4I7A A;  4N8X 1;  4JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...