1HTLD

Mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Mutation of a buried residue causes loss of activity but no conformational change in the heat-labile enterotoxin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htlD00
1SJHD 2AQ1B 1D5MC 1L0XB 4TSSA 4Z9CB 1RF2D 3BVMA 1CHQD 4L63B 1TS5A 3V05A 1S5DD 2XRQD 1PTOF 4BWGB 1FD7D 1SXTA 1MD2D 3R2TA 1PTOB 4RFBA 1PZID 1PTOC 4K6LA 3BVZA 5FK9C 1TY0A 2Z8LA 3EA6A 2O2LD 3SEBA 1V1PA 4DXGA 1TS2A 3BYYB 2AQ2B 3CHBD 3R2IA 5ELBA 1M4VA 1CHPD 1HA5A 1LTID 2NTTA 1ET6A 1V1PB 5D3IB 5ELFA 5FKAC 4ZYSA 1LT5D 1I4QA 2ICIA 3MFGA 4RGNA 1JR0D 1LTAD 1S5ED 1RDPD 1TS3A 1FNVA 1LTRD 1PRTD 1JWSD 4DXFA 2R61A 3BZDB 1D5ZC 4UDUC 1LTGD 1HXYD 1LLRD 2QILA 3MC0B 1F77A 5ELCA 2XNAC 4RHSA 1L0YB 1LTBD 1STEA 1D5XC 1XXGA 2RDHA 1JWUD 1S5CD 1AN8A 2XN9C 3EFXD 2XRSD 1D6EC 1LT4D 1BCPF 1EEFD 1PTOH 4RGOS 1HQRD 1SE3A 1GOZA 1I4PA 1FGBD 1BCPB 1JCKB 1FNWA 3BVGA 1QILA 3R8BA 1KLGD 5TSSA 1BCPC 1PTOD 1CK1A 1FNUA 1ET9A 1DJRD 1I4XA 1TY2A 4RGTA 2SEBD 1EWCA 4OHJA 1CT1D 4RCOA 1RCVD 1LT3D 3TSSA 1JWMD 1I4HA 3W2DA 1RD9D 3URYA 1V1OA 1LTSD 1ESFA 1PRTB 1PYWD 4RH6A 3O13A 1HTLD 1LTTD 5ELEA 3KLSX 1LT6D 2CHBD 1B1ZA 4C56C 5D3DA 1EFID 1JQYD 1EU3A 1PZKD 2QEJC 2NTSA 1S5FD 2G9HD 2J4XA 1I4GA 1SEBD 1SE2A 3DWAA 1B44D 1SBBB 1XTCD 3GP7A 3DWPA 1S5BD 5I4DA 2IPKD 1UNSA 1EEID 4RGMA 1BCPD 4L6TB 1DYQA 4O1NA 2RDGA 2IJ0A 1PZJD 1EU4A 1PRTF 1LO5D 3BYTB 2WV6D 2AQ3B 1ENFA 3OWEB 1TS4A 1SJED 1SE4A 1KLUD 2TSSA 1PRTC 1UUPA 4RHRA 1AW7A 1BXTA 1KTKA 5ELDA 1CQVA 1G8ZD 1I4RA 3DWQA 1T5XD
chains in the Genus database with same CATH superfamily
1A3UA 1GHJA 1R9TB 1PDQA 2DY7A 4X64L 3HOVG 3T1HQ 2RBMA 3OOCA 1U9RA 5A2QE 3I4NB 3M4PA 4S3SA 3G48A 1PH8A 1B4OA 2PQAA 4IURA 4C1NI 1PZID 4FO2A 2F0IA 2K03A 4C1NK 1G2SA 3AEVA 1P16A 5IOCA 3PUXA 1S3OA 3GTMH 1EY5A 4FDBA 1E1TA 4RKLA 3K7AH 2OTJA 1GUOA 1CUKA 1OXSC 2C5CA 4PG3A 1LTLA 1QVCA 2ICIA 5KEEA 3NP8A 4DAPA 2JA8G 5M5XB 2VS1A 1NR2A 3WDNA 3VR6A 2FINB 2R61A 3LNNA 4UDUC 4A3GH 3TN2A 3CCRA 4G7ZC 3MTSA 1A3VA 4PZ6A 4RHSA 2VB3X 2A74C 1STEA 4KJNA 4X65L 1D6EC 1VQEA 3CCQA 3J80i 3RUZA 4KHPL 3OMCA 5M3MG 2BH2A 3H94A 1KLGD 2UXBL 3TP5A 5CV8A 2K5NA 1HNWL 4UPAA 4DNRB 1CK1A 1YIJA 4A3MH 4C2MB 1KQSA 3M85A 1U4MA 4HJAA 1DJRD 3J80c 5D14A 2AWOA 1MSGA 1TY2A 1K0SA 1RCVD 3KDFA 3CW2C 3W1GA 1NJIC 1XMOQ 3AFPA 4NDXA 4XQQA 5IE8A 4LF9Q 3PO3H 5E7NA 4Y7NH 4DR3L 2DJFC 1B1ZA 3Q24A 5ISRA 3HOYH 5JPNC 1PZKD 4A3BH 1MSHA 4KY6A 2XWJB 4JI0Q 2KJXA 4A3EG 3HG9A 4BA2I 3IKJA 3NBIA 1I3QH 3PUYA 2JA5H 4OX9Q 3N6RA 1ENAA 2YU9H 1EEID 5J3BA 3FDTA 4JK1C 4ZLTF 4RCNA 3NQIA 1WTRA 2OCEA 3BS1A 3GTPB 1C9OA 4DR2Q 2EDGA 3D3RA 1SE4A 3IFDA 1I50H 2IT1A 2UUBL 4DAYB 4I65A 1IBLQ 5M3FB 2G9DA 2KBNA 2HDLA 3KK7A 4JBKA 4DV0L 1B70B 1G91A 1SFOB 2Z6BA 3AMUA 1DZ1A 3BU2A 1C48A 3ERQA 3I70A 2D9UA 5L37A 5CORA 4I7AA 2F4VQ 4BY7G 3KBGA 3R2TA 3ZJYC 2F0PA 1O7IA 4XXEA 1QJOA 3K5OA 1LABA 2OT2A 2F4IA 3NXWA 3K5LA 1AP0A 1G6ZA 3GTLH 4ZYSA 2NVYB 1QNUA 1K73C 3U50C 1ML0D 1YNND 2E5LQ 3JAML 5IYBG 4L5SA 5GADC 3PUVA 4IO9A 4A3CH 1H9MA 1TWGH 1HXYD 2K1BA 3BG3A 3VR4A 1BVSA 1OXXK 2KCNA 3EFXD 3MHBA 2XRSD 3I91A 2N8NA 1KAWA 1T5EA 2ZTDA 3CRKC 1VQ4A 3E3XA 2B8GA 1BCPC 5E1FA 3KF6A 3A7AB 5C3EG 2BE5C 2J7ZA 4ZUJA 1X65A 2JSOA 4DN4M 1CQFA 2K5VA 5LL6S 1QCBD 3HOXH 1B9NA 4PMWA 2VUMB 2GA4B 1GHKA 3P1HA 4A3FG 1DM0B 3OSOA 4YCUA 1EQQA 1I4HA 1RD9D 1SNQA 1HQMC 5IYDH 5T1GA 4LAAA 5JOBA 1KD1C 2RVLA 2MNAA 2K32A 3D6CA 4ZAIA 1HR0W 3SGIA 3GO5A 2J4XA 4E6IA 2E2HB 1HNXL 3PIPA 1IYUA 1X3PA 1STAA 4KKUA 4FP5D 4JI2L 3T16A 3GTQB 4HEDA 2A6HD 1HNZQ 3KJPA 2IJ0A 4NW2A 1A3TA 2VL6A 1XNQL 1VQ5A 4L5RC 1GXDC 1A62A 2KHIA 1PYBA 4GOPA 2XGTA 1PRTC 3D31A 2GN5A 1BXTA 3I4NG 2EYPA 1HUNA 1N9WA 4LFCL 2MJ8A 3ER0A 5AFWA 3OTOL 4BY1H 5AJ3Q 4BBRB 2L9HA 3HRZC 1WTHA 4DFAA 2PYKA 4DV5Q 1N34Q 2EY2A 4B08A 3FVQA 2L0CA 2VXWA 1VCIA 1PHJA 4A93B 4K2KA 3CAMA 3K57A 1AE2A 1YNJC 4FYDA 2V4DA 5ELFA 2F0JA 3A54A 4Q5VA 4LF5Q 1KNEA 3FPUB 3E0EA 2Z4IA 3JAMi 3J7AF 5IP7G 3ITPA 1MKHA 3NWTA 4JI0L 4ZK9B 1ASYA 1E7ZA 3IL8A 1D5XC 4ZKBB 2XN9C 3M3YH 3T4AC 3JAMc 1SYCA 5IWAL 2F1MA 2OWOA 4KD4A 3UI2A 4X3TA 4JI1Q 4WJWA 1UEBA 4LW1A 2AHOB 5GAGC 2E75C 5GROA 2EYFA 5C0XI 4DR2L 5KNCA 3S1QH 2O4XA 5DM73 4JW0A 2Q2HA 2JA6B 2VNUD 1WVLA 1IBLL 2NN6G 3I4OA 3H09A 4F8MA 3ONAB 2XIWA 2HCCA 2OQKA 1LACA 1K8AC 5K36G 3QOLA 5KIXA 4RH6A 4DR4Q 3PCOB 3MFYA 4JBWA 4OWTB 2B2YA 5FJ8G 1WOCA 3I4LA 3Q23A 5IT9L 3NQTA 2N88A 1K9MC 1B2TA 2DUDA 2EYOA 3KYHC 4YWLA 2HIXA 5IODA 2IPKD 1ZYRD 4QL5A 4EQOA 1WTQA 2K6AA 2SDFA 4QIWB 4JI6Q 5M3FG 5JEAG 2XSCA 1ZKOA 2E76C 2VQEQ 4RHRA 1I4RA 4IUTA 1HFNA 2B2WA 1RF2D 3MEFA 1IBKQ 3NE5B 1S5DD 4ME5A 3F2BA 3A5ZB 4BWGB 1EQVA 2FMMA 4IQZA 5EKLA 3KLSA 3VYUA 1B53A 2KEDA 2B3GA 5DLQE 1EY6A 1WTWA 3CKIB 1TY0A 4CJ1B 3K6OA 5FO7B 1CSQA 1V1PA 4UAIA 1VQ7A 1NE3A 3HOUH 3R2IA 5JVH3 2UUAQ 1OXUA 4Q0FA 3S2HH 4LNQA 4ILWA 3FP9A 1UAPA 1FJGQ 4DXFA 3K5NA 2QDLA 1KL9A 3J81i 3BZDB 2I07B 4CGYB 4XYOA 2A8VA 2ICEC 3A8IE 3RLOA 1LV9A 1IYVA 1JWUD 4H02A 4DV4L 3J81c 2HD3A 3CCSA 1I4PA 1JCKB 5HY6A 3TS2A 2VUMG 5BR8L 5TSSA 2KCMA 5FLXL 3NUCA 2MP1A 4A4IA 2ASBA 4XT3B 4GNXA 4HSPA 2K01A 3NSWA 1EIYB 2F0WA 2LXJA 2EIFA 5M5YH 1O80A 4KMUC 4B3SQ 1SNOA 4IFDH 4JI7Q 1HZBA 5ELEA 5EPJA 2HQLA 4HMJA 2E8GA 3P20A 4DR1Q 3NTKA 1YEZA 1K0RA 1VQDA 2WAQB 2JA9A 3F2DA 1PA6A 3A8KE 1BDOA 3ULJA 1ICWA 1Q90A 3M4OB 2CVRA 4HTHA 4O1NA 1STYA 4RA8A 4PNYA 2NZOA 2D5DA 4LF5L 2HDMA 2B2UA 5C4JH 4ODGA 4U673 1ZEQX 3K0YA 1KXLA 1ONLA 4K5XA 2PNHA 2TSSA 3TZDA 4C3JB 4DV1Q 4A75A 4YCWA 1VQMA 2F0GA 3J7YW 1X3QA 1KTKA 1V43A 5LL6X 5IIFA 2UUCL 4BBRG 1L0XB 1W6KA 3AU7A 3HGBA 1SLJA 1DOMA 2B2YC 4QIWE 1UWVA 3OWFA 3V05A 3AYHB 4JI1L 2AMCB 3RZOB 4A93G 3NBHA 4DV3Q 1VS0A 1WTXA 5ELNA 4HCEA 2Z6KC 5CBEE 5CV6A 2EQSA 2K4KA 1J8IA 1NMFA 5CV7A 1TR5A 1DD2A 2R7ZB 3S1RH 4WJ3M 3I72A 4HSVA 1M4VA 2PQEA 3GD7A 1N36L 3UDFA 1LT5D 3RN2A 3CXCA 1LTAD 1X56A 3GTJH 3CMAA 2QW7A 1EQRA 4JI4Q 3QJYA 1H95A 3DM1A 1AFPA 3BZCA 3RR5A 5J22A 2NVQH 1EIFA 3CCVA 2B2WC 3ZYYX 5HGQA 1LLRD 4FF2A 1T9HA 2F0KA 3GTOH 1F77A 3MXGA 2XNAC 2IX3A 4B3TL 4ZKCB 3PO2G 2RDHA 1RTOA 5I2YA 1LT4D 1SE3A 2KHJA 4CKBA 1FGBD 2JA6G 3HOVH 2C9OA 5E4WC 1HZCA 3KF8B 1ET9A 5KNDA 1IXRA 3VYRA 2MO0A 2VQEL 4R4OA 4RGTA 4DAVA 4UP9A 4LF4L 4GN5A 5C3XA 1CT1D 3GTMB 1E22A 2QF7A 3PIOA 3K7AB 1LT3D 1JWMD 3MAQA 1Y1VB 1IBKL 3J80L 5FLMH 3SK6A 2Q2UA 1EYAA 2JA8H 3LWUA 1Q12A 2WACA 4L8JA 1KRSA 3S17H 2MGSA 1QE6A 1CA6A 5A35A 4JV5L 5DEHA 1CM9A 1WFQA 4GNXC 5C4HA 2LXKA 3LWEA 4MHEA 4A3MB 1B9MA 1QB5D 1SJED 2ZXRA 1IW7C 4TVAB 2SNMA 4DV6Q 2WAQE 1T5XD 2CCZA 2NWGA 3S16H 4YY3L 3GTGH 1CI3M 3M4YA 3EN2A 1GKHA 4QQBX 3QO2A 2NVTH 4KK7A 1IHZA 1Y8NB 4Y7NB 3CQZH 2YYZA 1PTOB 2B29A 4K6LA 4HJ9A 1SYDA 2LMCB 4BA1I 2PQAB 4RKBA 5JAVA 3PIP3 4A3EH 2PI2A 1Q82C 1II3A 2B2UC 4B3SL 1CHPD 3OYYA 2YU9B 2MO1A 3AQQA 4DU9A 2SNSA 4FF1A 2NZ1D 3PV0A 3U58A 1S5ED 1SAPA 1ILQA 3T53B 4C3IH 4NXMQ 4DR1L 1PH1A 1I50B 2CWAA 1E0BA 1JJ2A 4TKOB 1MIUA 2V1CC 1UE5A 3QR8A 3MA2B 2EJGC 4IUUA 4A3DH 4K0KQ 1HQRD 4P2CB 3S9WA 3FKIH 2D0PA 2PO4A 4K5WA 1Y1WH 3VR5A 1PTOD 4IUNA 3HOWB 1SMXA 1PH9A 4HIDA 2R92B 4N9TA 4GKJQ 1PXUA 4LUZA 4KHZA 3QB3A 2QA4A 1HTPA 1BKBA 3PMFA 1UE1A 1JC7A 1NMGA 4DR5Q 4J15A 4DGZA 3GTLB 1PRTB 3KDFB 4JI3L 2L4NA 3O13A 4RWSC 1HTLD 4P75A 1LT6D 2F0MA 4C56C 2E2IH 4AQYL 1B3AA 2WAQG 5EBDA 2EYHA 4FF3A 4DV3L 3Q22A 3CC7A 2PZTA 2HQEA 4TRDA 2NYZD 1VQIA 1TWGB 1AE3A 3MEHA 4JPBW 2F0UA 4GN4B 1V1QA 2B2VC 2PW7A 1Y8PB 3G7LA 5LMNW 1YJWA 5LMUL 4IPGA 4C3JG 2F0NA 3EJIA 1PZJD 4QB4A 4NXNL 4V190 4OO1G 4X62L 4LFBQ 2F0FA 1XWEA 3BDLA 3A56A 1QVFA 4H7BA 2KHSA 4JI5Q 4ULLA 2EJMA 3MXNA 3HOXB 4CJ2C 3T1YQ 4OWWB 3PF4A 1HZAA 3A8JE 4BBSB 4IUPA 1YZ6A 4M1UB 4A3FH 4N9PA 2QKIC 3F1ZA 4KKTA 1XJVA 3L3OC 1X32A 5GAEC 3ICEA 2FHTA 4DNIA 1XMQQ 4DK1A 4LF7L 3HKSA 3PUZA 2YTXA 3T51B 4EX5A 5C5LA 5IP9G 1GUNA 2VQFQ 2R7ZG 1F9PA 2F3VA 1H9RA 2R3ZA 3FEWX 2P5ZX 3N52A 5KNBA 1PH3A 4IFDJ 4B3ML 1YBYA 1NCVA 5JJKA 1B7YB 4JYAL 3G71A 3OW2A 3WOEA 4QUCA 1E2WA 2AQ2B 4IN3A 2OTLA 4LFAQ 1V8QA 5IYCG 3HP3A 1LUZA 3H6MA 5HURA 1EIGA 3BDCA 1O7YA 1E1OA 2BCOA 5LMNL 1BBXC 1MBYA 1HHVA 2ZXPA 1LTBD 2PMZB 3I4NH 1DONA 1QILA 2ID0A 4F87A 2NZHA 5IGEA 2MUYA 3Q0AA 4DUZQ 3NTHA 1VQBA 1I94L 1Y1VG 4DF7A 4IPCA 4L5QA 4YCVA 1KC8C 3KF6B 3CC2A 4K8IA 1D2BA 4RCOA 5M5XH 4OONA 4XDXA 2F0OA 3GQBA 1TXYA 3STBD 1A8VA 3RN5A 2B63H 4CDEC 5EQ0A 1X55A 5DNFA 3J80E 4DR7Q 2RDFA 3P75A 4K8JA 1CKOA 5IP7H 4I7ZC 2HCIA 2VY3A 4GLXA 3DWAA 3JC66 3R3OA 4A3MG 3M3YB 1N32Q 2DGYA 1KHIA 1U4PA 2EVBA 1MI2A 2RDGA 4PZ8A 1RJTA 1G2TA 2AQ3B 2EXDA 3E9HA 3ULLA 1JE5A 3T1HL 2PCFB 3S1QB 1EY4A 1UUPA 4DV7Q 4AIMA 2R93H 4GOPB 1Q1BA 2WKCA 3M7GA 2ZTCA 3OPOA 2NN6H 4Z9CB 3PF5A 2A6ED 1I6HB 3D4DA 2NN6I 2RHQB 5K36H 1Y14B 2Y0SB 1CKMA 4G57A 5IGGA 2PPBC 4RFBA 3X3NA 1FVIA 2X6GA 1K83H 3M7NA 1K8OA 3U4ZA 1F2YA 4X66Q 2LFNA 3GTPH 2Q2TA 1TU2B 4DR5L 1JJCB 1CKNA 2EYLA 4KY7A 4QF4A 3V2TA 4UP8A 1JR0D 1TS3A 2EY5A 2LKVA 1NTGA 1G291 1PH2A 5CC4A 4XTCS 3AB9A 2KCCA 1L1OA 1D5ZC 2JA7H 3HS0C 1GUWA 1SFOH 1CA5A 2AKWB 2R6GA 3MXPA 4A3KH 1EQTA 5CMDA 1M90C 4DA2A 1GO3E 3HOWG 2HUGA 1OTCA 1TT2A 4LUOA 3WOFA 1S5CD 1EY9A 3TP7A 1WD0A 1A0IA 1D1IA 2R92G 5CV4A 2PZUA 2Q8TA 3BVGA 1L2FA 3R8BA 4B3RQ 5IY0A 3CCJA 3DEOA 1XMOL 4LFBL 3SXHA 2F0TA 1TWHB 2ZM6Q 1GVPA 3NELA 4LF9L 4QJFA 1W3SA 4R1JA 4ZUIA 3J81L 3T1YL 1NNXA 1M1KC 3NPPA 4DV2Q 2UU9Q 2PMZE 2RHSB 1JOQA 3HOUB 3TP6A 1ESFA 1GD7A 2UXDQ 4A3CG 3S2HB 3A7LA 1LTTD 1E2VA 1WCMH 1XMQL 4ZQ3A 3UDGA 4OX9L 1H9SA 1OO9B 2F3IA 1UE6A 3LX0A 2VQFL 5C44H 3K80C 4K14A 2CW0D 1LM0A 2KA7A 5C0XH 5CGKA 2FFKB 3ULPA 2CQOA 5EPKA 1SBBB 3GP7A 3ND8A 1VQ8A 3MWYW 4HR7B 1YI2A 3VYSA 1Q1EA 3OMGA 2H4OA 3VDYA 4LFAL 4X6AH 4GLVB 4TQUS 3BYTB 1EYDA 3E9IA 1ENFA 4BBSG 1YNNC 2EY1A 1NUCA 4A3JB 1NR4A 1XPUA 1DOKA 3TP8A 2F4VL 4POGA 3DUZA 2CWPA 4IJLA 5M5YB 1E24A 1GUGA 3PIO3 3BVMA 4RMFA 4EQNA 2HIVA 4GZYC 1TS5A 3F2CA 3K7UC 4GN3B 2E2HH 2Z6KA 3IFTA 3QIAA 1ESRA 2OQ0A 4FXGC 5FK9C 2E5LL 3SHLA 1BQQT 1NBWA 3S14B 4LF6Q 2IW3A 4DK3C 1YHAA 2G5DA 1TS2A 1SE8A 4IOAA 3M4QA 3BYYB 2OF1A 3D4WA 1HA5A 1Q7YC 5T1IA 1V1PB 1QUQA 3MFGA 2Y0SE 3S1NH 1A2UA 4YWMA 4QMGA 1STNA 1JWSD 3A74A 2F0SA 1QOHA 2IX0A 3L0OA 5M5WH 3D8GA 5FO9B 2K50A 3HOZH 3I2ZA 2EYJA 1N8RC 3GV6A 3K8AA 4A3IH 1EEFD 1N32L 4RGOS 2B39A 2N55A 4HIMA 2A6HC 4C3HH 4HAEA 1EY0A 1VQ9A 1ICFB 2RCNA 2JQOA 1SYGA 4F88A 4QUFA 4OGQC 1X3EA 1IZ6A 4NB3A 5BN4A 5C3WA 4YWKA 5EAYA 4HJ8A 1SMYD 4IUVA 4JOIC 5D65A 1I4XA 4DV7L 1WYDA 2B8FA 4P71A 4G7OC 3JAME 4GNXB 3S1RB 1CTMA 1JB3A 4OIKA 4JBJA 2MQHA 3QOJA 3H91A 2IY5B 1PVOA 1L1OC 3S15B 3GTJB 4GS3A 3H0GH 3S2DH 3D6WA 4ABNA 1HNZL 3UDXA 2QEJC 2NTSA 4H44C 5C4XH 3I55A 1BF4A 1I4GA 1E2ZA 3TREA 1VQGA 4BXXH 2EJFC 4YHHQ 5A2QL 3GTOB 2UXCQ 2ENBA 5I4DA 1UNSA 1BBUA 4N8X1 3PO2H 1I5FA 4BS9A 1N33Q 4R4IA 4R8NA 3C46A 4B9WA 2A19A 2ATWA 1VQPA 4GKKQ 1YITA 4XT1B 1X3FA 2LSSA 3KBXA 3WWVA 5JJIA 4NP5A 1K3BC 5AJ3L 4RAUC 1WI5A 2Y0SG 1XNRQ 1SSOA 2HHHQ 4DV5L 1N34L 2YV5A 1J6QA 2IWHA 1H9JA 1IL8A 3NENA 5H1SE 1MD2D 4DR6Q 1DGSA 1EFWA 2A68D 2ZM6L 2Q8IB 3CP0A 2BDNA 4OELB 3EA6A 3NBHB 3J81j 1JB7A 2A69D 4X64Q 3S17B 2I5HA 2K7VA 2R7DA 4IPDA 3X3MA 4LUVA 3CPFA 4IALA 1O7ZA 1QG7A 1KRTA 1U5KA 2RSOA 1VF7A 1ZXTA 4EQ5A 5KYLA 3G4SA 3Q6SA 3FPPA 4CHTB 1A15A 4X3KA 3MC0B 4R4QA 2Z9HA 1L0YB 1RL2A 1S4ZA 3S16B 4J8QA 5G3LD 3GTGB 5IGFA 1ZYRC 5EKKA 2NVTB 4JVZA 3CQZB 1PFNA 3EVQA 3C3LA 4L5TA 3I4MH 1CZGA 3DHQA 2E2JH 3PSIA 3GTKH 3EBEA 3HOUG 4DR4L 2L1BA 1QWYA 1H9KA 1C4QA 4KHPQ 1EZ8A 1VQJA 4A3EB 1A2TA 3U4VA 3URYA 4DNTB 4B9XA 2M9VA 1AZPA 1IKLA 1EWHA 3BDOA 5I6YA 3S1MH 1UE7A 2CHBD 5D3DA 1EU3A 2B2VA 2IHFA 4C3IB 5J39A 1IL2A 2G9HD 1SYFA 4JI6L 5BN3A 4DR3Q 4NPSA 1E3PA 3LGJA 4JBMA 3RD4A 1AZQA 4A3DB 3NEMA 1MGSA 3W5OA 4GLAC 4J6HA 4A3JG 3FKIB 1EU4A 2MPMA 2JK8A 3PGZA 1VQAA 3DMUA 1VMPA 1Y1WB 2WV6D 1EL0A 3TS0A 2F0QA 4FNFA 4PZ7A 4WORA 3S24A 4IFDG 4UP7A 4IUQA 1AEXA 3DWQA 2EZVA 1D5MC 4A3GB 3TBIB 5IT9E 2N49A 3VYTA 1Q8KA 2K52A 4R4TA 2ZT9C 3K58A 4CKEA 1PTOF 3B6YA 2E2IB 2WB1B 2CFMA 3U9SA 2KVMA 3TDQA 1SNDA 2UUAL 1TKWB 3A55A 4LJZC 4P74A 1X54A 4APVA 5M3MH 2CH4W 3M4OH 2JEAI 2O2LD 1FJGL 5CYUA 2O5IC 1VF5C 1YJ9A 1QVGA 2L11A 4KD3A 1LTID 3I7FA 1M8AA 5D3IB 4A3LG 1D1KA 4KN4C 4RGNA 3GV3A 4C3JH 4DKAC 3TQYA 1TWFH 4NKLA 4OO1I 3PO3B 1TWCH 2KECA 3FHWA 1J5EQ 5C4ZA 1K8MA 3HOYB 1YVCA 1BO0A 1MJCA 4A3BB 4PQXA 1EOTA 2I0QA 2UXCL 2J0TD 3OWEB 4O2DA 1PH4A 4A3FB 4XQNA 1SNPA 2NB0A 2AUKA 1I3QB 1BCPB 1N33L 2QEXA 2JA5B 4H13C 3MXUA 2WIIB 4JC0A 2A1AA 1TVXA 4JI7L 2QCPX 3SE0A 3BJUA 1LYLA 5CBAE 5JPMC 1PH6A 1Q46A 1XNRL 4P72A 2JYOA 1HCZA 3FMCA 3E0JA 5IYCH 3I73A 3W1BA 1SDFA 1EY8A 1FR3A 4P73A 1HPCA 3R93A 2EXZA 3J7ZC 5FLXE 3RZDH 2CQAA 5EGTA 1B44D 1XTCD 1JE4A 2VZAA 4BY7H 1RODA 1WJJA 3UDIA 3CD6A 4DV1L 3GDEA 1V9PA 1BCPD 5NUCA 4OXPA 1SNCA 1WTOA 3SK8A 2BE5D 2F0DA 1HNXQ 4FXDA 2VB2X 4JI2Q 2PNRC 1IBMQ 1GUSA 1Y1VH 3CCMA 4H0LC 5IYBH 2F3WA 5FLMG 1XNQQ 3NWSA 3MXNB 1G51A 2O5JC 1GJXA 2B63B 5LHY1 4HIOA 1EZ6A 5KGUA 1KABA 3RLFA 4O42A 4R9WA 2N78A 4LFCQ 1B3QA 1K8GA 5EKIA 4IOCA 3MVVA 4RG1A 2NVXH 4JI4L 3HEJA 5EJWA 3DM3A 1YNXA 5C3EH 3OTOQ 2K5WA 4ALPA 4QGUA 1RTNA 4QY7A 1F2LA 1PLFA 1R4QB 3HKZB 1BBWA 4DPGA 3KJOA 1XPRA 1STBA 3CC4A 2WB1E 1FNVA 2D0OA 2ZTEA 2LY7A 3W3AA 1PRTD 5COYA 1WTVA 1F9RA 1CSPA 4XQJA 1HR0Q 2D62A 2K5HA 2ZXOA 2H1EA 3NHHA 2R93B 5ELCA 1TWAH 1XXGA 2F03A 2RA4A 2PI2E 1Q86C 1PTOH 1RIPA 3BZKA 4HMIA 1KAAA 1QZHA 4EGVA 2KEEA 3E5SA 4LWCA 5FOBB 3D0FA 1K83B 5IWAQ 3K0XA 2K04A 1YNJD 2YTVA 3CRLC 1BR9A 4AYBB 1R9TH 4C3IG 2DNCA 1C7YA 1JMCA 2I5MX 2A73B 5GQOA 3SDZA 1D8LA 1VQKA 2RCFA 3IAYA 3SR1A 1GUTA 1FYCA 2CH4A 4JI8Q 4R8IA 4A3DG 2M00A 2F0VA 2JA7B 4BY1B 4IZ8A 2AUJD 3FKIG 4A3KB 1P8LA 4KLKA 3DWPA 1Y1WG 2LS01 2K05A 5CV9A 1PFSA 2MFIA 3HOWH 1RKNA 3HFZB 1HUMA 4DV6L 2R92H 3A5UA 1XX8A 4DAYA 4A3GG 4XYQA 2ES2A 2B2TC 4MNOA 1J5EL 3NK9A 1IYJB 3T56B 2WB1G 2AQ1B 5J1ZA 1SN8A 3CU7A 1CHQD 5ELOA 1F2ZA 4M8AA 1CFMA 1WCMB 3D4RA 1SXTA 4A76A 4C2MH 4KN7C 2IX1A 1DXMA 2QGQA 5C44B 5I9OA 1PTOC 1PYSB 3BVZA 1K3RA 2OXPA 4OL7A 4NXML 4PMCA 1Z7TA 1G6PA 3H15A 3PO3G 1ET6A 3UE1A 1CZWA 4UHVA 4JCVE 3IRBA 2DNEA 3HOYG 2Q8RE 1CKNB 4A3BG 4K0KL 1JOOA 4BBSH 3L2PA 1STHA 2N3SA 2JA5G 1L1OB 4EQPA 5FJ8H 4KY5A 1EYCA 1AN8A 3Q8DA 4O0AA 4GKJL 2QDBA 3HKZE 5IGCA 3CCEA 2L15A 1FNWA 3OIPA 4JOIA 2JN4A 1MHWC 3TMEA 2K75A 1VQFA 4ME3A 4LF8Q 2HT1A 1IBML 4DV4Q 1JT8A 5M3FH 5JEAH 1SRUA 4LMQD 5BR8Q 3W2DA 1BOSA 1KDBA 1BUVT 1VQHA 3C1FA 3KLSX 1A63A 3S1NB 5K5PA 1I6VC 4V0BA 1JQYD 4CDCC 2NBFA 2EE1A 3M9BA 1U0LA 5BN5A 1X3GA 1H9SB 2DN8A 4CJ0B 4CDFC 2Q2IA 5C5MA 1PFMA 5M5WB 1NY4A 2BH8A 2KQ3A 3RNUA 4AYBE 2KOLA 4JI5L 1S5BD 3HOZB 4A3IB 2NVYH 4HN7A 1DYQA 2OEOA 1GM5A 3MZ5A 4C3HB 3CF5A 1SYBA 2H5XA 5F2DA 3VA7A 1Y8OB 2GVBA 4DUYQ 1STGA 4G7HC 3ERSX 2NUCA 4OIJA 4JG2A 3V96A 1HR0L 3L7ZC 4K6DA 2X6LA 1S40A 2B63G 2JXMB 1R4PB 2F0EA 4KJOA 2VW9A 1VQ6A 4FXKC 5KYIA 1Y69U 2Z0SA 3H0GB 4U68A 3G6EA 1VQCA 3S2DB 2RSNA 2UUCQ 1K28A 3HOXG 3OW7A 4KI0A 5C4XB 3UE0A 1XPOA 3HKZG 2VUMH 3C2PA 3SEBA 4ID6A 3CHBD 5ELBA 5IYDG 2NTTA 2L12A 5FKAC 3PO2B 1JOKA 1RDPD 3RLNA 2R93G 3STBC 1QUQB 3QWNA 1RHPA 1KDAA 4JI8L 4HIKA 2M2LA 3I8ZA 1I6HH 2DJGC 3CCUA 1N36Q 3GTQH 4DUZL 4MTKA 3F8TA 1FGUA 3OHXC 3CPWA 1XYIA 1GOZA 2EPBA 3A0JA 5FO8B 2C35B 4AYBG 3U9OA 5JVG3 1Q8IA 4B3TQ 5C4JB 5I9PA 2IHEA 4KKSA 3TEHB 4DR7L 5E3FA 3KUPA 3TSSA 2IL8A 1BNZA 4FF4A 1LTSD 3TZUA 1PYWD 2JA7G 4BY1G 1L0WA 2A6EC 4BBRH 4A3KG 4LF4Q 1W6JA 4ZRZA 4Y52H 1S5FD 2YTYA 1SEBD 5CR3A 2WKDA 4CBVA 4A93H 1PFBA 3I3CA 1ASZA 1J9OA 1TWHH 1HH2P 2JJQA 1O7LA 1A6XA 1LO5D 3VA5A 3SK5A 5HGTA 3I4MB 2PW5A 1KLUD 1WD1A 2E2JB 3GTKB 1Z9FA 2KUMA 2K28A 1AW7A 2E74C 2JP1A 4JV5Q 5JJLA 1G8ZD 1WCMG 2ZJRA 1SJHD 3EROA 2NVQB 4TSSA 3KLWA 4GOPC 5G3LF 5C44G 2BA1A 2KENA 1DCZA 4X66L 3S1MB 4WFN3 4X3UA 5C0XG 1Z47A 2XRQD 1FD7D 2DY8A 5EPLA 2L5TA 4YY3Q 1U4RA 4LF8L 2JA6H 3HOVB 2Z8LA 1PH7A 1MJEA 3OIQA 4KHVA 1YJNA 4G4KA 2JE6I 4FVMA 5CV5A 4POFA 4MN3A 5DAUA 3PUWA 1B8AA 2Z4HA 3K5MA 4A3JH 1KIXA 2FMCA 1IW7D 4IPHA 1Q81C 1LTRD 4DK6C 2XWBB 3C1EA 2BA0A 2XTIA 3SK4A 2MHVA 4B3RL 3J7A5 1LTGD 2JA8B 2CW0C 4J1MA 3T13A 3CMEA 2R7FA 4IFDI 1B50A 3P7JA 4OWXB 1TQOA 2FXQA 4EVOA 4DV2L 2UU9L 1YHBA 3S14H 3QG1A 2UXDL 1FNUA 4DUYL 4K5VA 5M3MB 1PV4A 2D2CC 1EWCA 4OHJA 1Q3LA 1AH9A 5IT9c 2WP8J 4PV1C 5JJZA 1JJGA 1VQOA 2XVSA 3H3VH 4A3LH 3K81C 1NAPA 1HJPA 3H3VI 2SOBA 2WFWA 2K14A 1YHQA 1EFID 1F9SA 3SVMA 1EUJA 1TWFB 4MZ9A 3HOZG 4A3IG 3KFUA 2PZWA 4X3SA 1TWCB 3ND9A 4IJHA 2BDOA 1C0AA 1VQNA 3E6ZX 1W2BA 4JI3Q 4C3HG 4HCSA 2EOTA 4AQYQ 2ZJPA 4X65Q 2KCTA 1X9NA 1EWIA 1PH5A 1QZGA 4RGMA 4L6TB 4LK1C 1UEAB 1XTDA 3J81E 2K33A 2UXBQ 5I6WA 1HNWQ 2RKSA 1C8CA 4UY8C 2L55A 4YIJA 1EOVA 4R4CA 4HJ7A 5GAHC 5LMUQ 1ENCA 5ELDA 1CQVA 4WRDA 4F7XA 2CKZB 2WINB 2ALYB 3H0GG 4NXNQ 3S15H 2E2DC 4X62Q 1VMCA 3DEPA 4L63B 5C4XG 4LF6L 2TMPA 2K5DA 2I46A 3AFQA 1NSNS 5C6AA 1HRJA 1F2MA 5JEAJ 4BXXG 4OEMB 5IGDA 1PMRA 3NTIA 1JORA 3HZXA 4PMBA 1OXTA 1KDCA 2X69A 4LF7Q 4DXGA 3RZDB 4BY7B 1SMYC 2K5QA 2GVAA 4ZCKA 5EBCA 1VDZA 3J7AV 3KOJA 1I4QA 4K2LA 1EYGA 2I5LX 4B3MQ 2EY6A 4JYAQ 4DAMA 1VQLA 3CCLA 2UUBQ 1SNMA 5FLXc 3H3VC 2QILA 5E4XA 4DK0A 3EIVA 3L9AX 4DV0Q 1O78A 2FJ2A 5M9OA 4MIUA 1BCPF 4KTAA 5LMNQ 2EYMA 3G6JB 1WTPA 2RF4A 3TRZA 1SR3A 3KF8A 4AH6A 3FRPB 4QCLA 5C0XJ 2ZJQA 1EY7A 4CDDC 1JICA 3DXJC 1F9QA 1ILPA 1S72A 4OO1H 2NVXB 1DOLA 5DM63 2SEBD 2AWNA 2F0LA 3EQLC 5C3EB 1HZ9A 1U4LA 1V1OA 1KNAA 2RQXA 4MTNA 3VR2A 4YHHL 1SROA 1I94Q 1OXVA 4XIGS 2BOSA 3RZOH 3I56A 1SYEA 3RMHA 2A5HA 1FL0A 4NMZA 2F52A 1SE2A 3I90A 2A68C 1TIID 1HFGA 5IP9H 4GKKL 1Z6HA 2R7ZH 4CKCA 1D7QA 1TWAB 2A69C 3I4MG 5IGBA 3DLLA 3PQIA 5KRUA 2B2TA 1X6OA 1IKMA 3K59A 2HHHL 1PRTF 2F0HA 4WJ4A 4N8FA 4HJ5A 1TS4A 4KV6A 5I2XA 2Z1CA 3VR3A 3KLRA 1HA6A 4DR6L 3F2UA 2JEBI 1EIHA 1QNKA
chains in the Genus database with same CATH topology
1A3UA 1GHJA 1R9TB 1PDQA 2DY7A 2RBMA 3OOCA 1U9RA 5A2QE 3I4NB 4S3SA 1B4OA 4IURA 4C1NI 1PZID 4FO2A 2F0IA 2K03A 4C1NK 1G2SA 5IOCA 3PUXA 1EY5A 4RKLA 1GUOA 1OXSC 2C5CA 2ICIA 5KEEA 3NP8A 4DAPA 5M5XB 1NR2A 3WDNA 3VR6A 2FINB 2R61A 3LNNA 4UDUC 3TN2A 4G7ZC 3MTSA 1A3VA 4RHSA 2VB3X 2A74C 1STEA 4KJNA 1D6EC 3RUZA 3OMCA 3H94A 1KLGD 3TP5A 5CV8A 4DNRB 1CK1A 4C2MB 3M85A 1U4MA 1DJRD 5D14A 2AWOA 1MSGA 1TY2A 1RCVD 4NDXA 4XQQA 1B1ZA 3Q24A 5ISRA 5JPNC 1PZKD 1MSHA 4KY6A 2XWJB 2KJXA 3HG9A 4BA2I 3IKJA 3NBIA 3PUYA 3N6RA 1ENAA 1EEID 3FDTA 4JK1C 4ZLTF 4RCNA 3NQIA 1WTRA 3BS1A 3GTPB 2EDGA 3D3RA 1SE4A 3IFDA 2IT1A 4I65A 5M3FB 2G9DA 2HDLA 3KK7A 1G91A 1SFOB 3AMUA 1DZ1A 3ERQA 1C48A 3I70A 2D9UA 5CORA 3KBGA 3R2TA 2F0PA 4XXEA 1QJOA 3K5OA 1LABA 2OT2A 2F4IA 3NXWA 3K5LA 1AP0A 1G6ZA 4ZYSA 2NVYB 1QNUA 1ML0D 1YNND 3JAML 3PUVA 1H9MA 1HXYD 2K1BA 3BG3A 3VR4A 1OXXK 2KCNA 3EFXD 3MHBA 2XRSD 3I91A 1T5EA 3CRKC 2B8GA 1BCPC 5E1FA 3A7AB 2BE5C 2J7ZA 4ZUJA 2JSOA 4DN4M 1CQFA 5LL6S 1QCBD 1B9NA 4PMWA 2VUMB 2GA4B 1GHKA 3P1HA 1DM0B 3OSOA 1I4HA 1RD9D 1SNQA 1HQMC 5T1GA 4LAAA 5JOBA 2RVLA 2K32A 3D6CA 4ZAIA 3GO5A 2J4XA 4E6IA 2E2HB 1IYUA 1X3PA 1STAA 4KKUA 4FP5D 3T16A 3GTQB 4HEDA 2A6HD 2IJ0A 4NW2A 1A3TA 1GXDC 1PRTC 3D31A 1BXTA 2EYPA 1HUNA 2MJ8A 5AFWA 4BBRB 2L9HA 3HRZC 4DFAA 2PYKA 2EY2A 4B08A 3FVQA 2L0CA 2VXWA 1VCIA 4A93B 4K2KA 3K57A 1YNJC 4FYDA 2V4DA 5ELFA 2F0JA 3A54A 4Q5VA 1KNEA 3FPUB 2Z4IA 3J7AF 3ITPA 3NWTA 4ZK9B 3IL8A 1D5XC 4ZKBB 2XN9C 3T4AC 1SYCA 2F1MA 4KD4A 3UI2A 4X3TA 4WJWA 2E75C 5C0XI 2EYFA 5KNCA 2O4XA 5DM73 2JA6B 2VNUD 1WVLA 2NN6G 3H09A 4F8MA 3ONAB 2XIWA 2HCCA 1LACA 5K36G 3QOLA 5KIXA 4RH6A 3MFYA 4JBWA 2B2YA 3I4LA 3Q23A 5IT9L 3NQTA 2N88A 1B2TA 2EYOA 5IODA 2IPKD 1ZYRD 4EQOA 1WTQA 2K6AA 2SDFA 4QIWB 5JEAG 2XSCA 1ZKOA 2E76C 4RHRA 1I4RA 4IUTA 1HFNA 2B2WA 1RF2D 3NE5B 1S5DD 4ME5A 4BWGB 1EQVA 2FMMA 4IQZA 5EKLA 3KLSA 3VYUA 1B53A 2KEDA 1EY6A 1WTWA 3CKIB 1TY0A 4CJ1B 3K6OA 5FO7B 1V1PA 4UAIA 3R2IA 5JVH3 1OXUA 4Q0FA 4ILWA 1UAPA 4DXFA 3K5NA 3BZDB 2I07B 4CGYB 4XYOA 2ICEC 3A8IE 1LV9A 1IYVA 1JWUD 1I4PA 1JCKB 5FLXL 5TSSA 3NUCA 2MP1A 4XT3B 4HSPA 2K01A 3NSWA 2F0WA 1O80A 4KMUC 1SNOA 4IFDH 5ELEA 5EPJA 4HMJA 3P20A 3NTKA 2WAQB 3A8KE 1BDOA 1ICWA 1Q90A 3M4OB 2CVRA 4HTHA 4O1NA 1STYA 4RA8A 4PNYA 2D5DA 2HDMA 2B2UA 4ODGA 4U673 1ZEQX 3K0YA 1ONLA 4K5XA 2TSSA 4C3JB 3TZDA 2F0GA 3J7YW 1X3QA 1KTKA 1V43A 5LL6X 5IIFA 1L0XB 1W6KA 3AU7A 3HGBA 1DOMA 2B2YC 3OWFA 3V05A 3RZOB 3NBHA 1WTXA 4HCEA 5CBEE 5CV6A 1J8IA 5CV7A 1TR5A 1DD2A 2R7ZB 3I72A 4HSVA 1M4VA 2PQEA 3GD7A 1LT5D 1LTAD 3QJYA 3DM1A 1AFPA 5J22A 2B2WC 3ZYYX 1LLRD 4FF2A 2F0KA 1F77A 3MXGA 2XNAC 2IX3A 4ZKCB 2RDHA 1RTOA 5I2YA 1LT4D 1SE3A 4CKBA 1FGBD 2C9OA 5E4WC 1ET9A 5KNDA 3VYRA 4RGTA 4DAVA 5C3XA 1CT1D 3GTMB 2QF7A 3K7AB 1LT3D 1JWMD 3MAQA 1Y1VB 3J80L 3SK6A 1EYAA 3LWUA 1Q12A 2WACA 4L8JA 2MGSA 1QE6A 1CA6A 5A35A 5DEHA 1CM9A 5C4HA 3LWEA 4MHEA 4A3MB 1B9MA 1QB5D 1SJED 2ZXRA 1IW7C 2SNMA 1T5XD 2NWGA 1CI3M 3M4YA 3QO2A 4KK7A 1IHZA 1Y8NB 4Y7NB 2YYZA 1PTOB 4K6LA 1SYDA 2LMCB 4BA1I 4RKBA 5JAVA 3PIP3 1II3A 2B2UC 2YU9B 1CHPD 4DU9A 2SNSA 4FF1A 2NZ1D 3PV0A 1S5ED 1SAPA 1ILQA 3T53B 1I50B 1E0BA 4TKOB 3MA2B 2EJGC 4IUUA 1HQRD 4P2CB 3S9WA 4K5WA 2PO4A 3VR5A 1PTOD 4IUNA 3HOWB 2R92B 4N9TA 1PXUA 4KHZA 3QB3A 1HTPA 3PMFA 1JC7A 4DGZA 3GTLB 1PRTB 2L4NA 3O13A 4RWSC 1HTLD 1LT6D 2F0MA 4C56C 1B3AA 5EBDA 2EYHA 4FF3A 3Q22A 2PZTA 2HQEA 4TRDA 2NYZD 1TWGB 3MEHA 2F0UA 2B2VC 2PW7A 1Y8PB 3G7LA 4C3JG 2F0NA 3EJIA 1PZJD 4QB4A 4V190 4OO1G 2F0FA 1XWEA 3BDLA 3A56A 4H7BA 2KHSA 4ULLA 2EJMA 3MXNA 3HOXB 4CJ2C 3A8JE 4BBSB 4IUPA 4M1UB 4N9PA 2QKIC 4KKTA 3L3OC 1X32A 2FHTA 4DK1A 3PUZA 3T51B 5C5LA 1GUNA 1F9PA 2F3VA 1H9RA 2R3ZA 3FEWX 3N52A 5KNBA 4IFDJ 1NCVA 3WOEA 4QUCA 1E2WA 2AQ2B 4IN3A 1V8QA 3HP3A 3H6MA 5HURA 1EIGA 3BDCA 1O7YA 2BCOA 1BBXC 1MBYA 1HHVA 2ZXPA 1LTBD 2PMZB 1DONA 1QILA 2ID0A 4F87A 5IGEA 2MUYA 3Q0AA 3NTHA 4DF7A 4K8IA 1D2BA 4RCOA 4XDXA 2F0OA 3GQBA 5EQ0A 5DNFA 3J80E 2RDFA 3P75A 4K8JA 4I7ZC 2HCIA 3DWAA 3R3OA 3M3YB 1U4PA 2EVBA 1MI2A 2RDGA 1RJTA 1G2TA 2AQ3B 2PCFB 3S1QB 1EY4A 1UUPA 1Q1BA 2WKCA 3M7GA 3OPOA 4Z9CB 2NN6H 2A6ED 1I6HB 3D4DA 2NN6I 5K36H 2Y0SB 4G57A 5IGGA 2PPBC 4RFBA 3X3NA 2X6GA 3M7NA 1K8OA 1F2YA 2LFNA 1TU2B 2EYLA 4KY7A 4QF4A 3V2TA 1JR0D 1TS3A 2EY5A 2LKVA 1G291 5CC4A 4XTCS 3AB9A 2KCCA 1D5ZC 3HS0C 1GUWA 1CA5A 2R6GA 3MXPA 1EQTA 5CMDA 4DA2A 2HUGA 1TT2A 3WOFA 1S5CD 1EY9A 3TP7A 1WD0A 1D1IA 5CV4A 2PZUA 2Q8TA 3BVGA 3R8BA 3DEOA 3SXHA 2F0TA 1TWHB 4ZUIA 3J81L 3NPPA 1JOQA 3HOUB 3TP6A 1ESFA 3S2HB 3A7LA 1LTTD 1E2VA 4ZQ3A 1H9SA 1OO9B 3LX0A 4K14A 2CW0D 2KA7A 5C0XH 5CGKA 2FFKB 5EPKA 1SBBB 3GP7A 3ND8A 3MWYW 4HR7B 3VYSA 1Q1EA 3OMGA 2H4OA 4TQUS 3BYTB 1EYDA 1ENFA 1YNNC 2EY1A 1NUCA 4A3JB 1NR4A 1DOKA 3TP8A 3DUZA 5M5YB 1GUGA 3PIO3 3BVMA 4EQNA 4GZYC 1TS5A 3IFTA 3QIAA 1ESRA 4FXGC 5FK9C 3SHLA 1BQQT 3S14B 2IW3A 1TS2A 3BYYB 2OF1A 3D4WA 1HA5A 5T1IA 1V1PB 3MFGA 1A2UA 4QMGA 1STNA 1JWSD 2F0SA 1QOHA 2IX0A 3D8GA 5FO9B 2EYJA 3GV6A 1EEFD 4RGOS 2B39A 2N55A 2A6HC 4HAEA 1EY0A 1SYGA 4F88A 4QUFA 4OGQC 5BN4A 5C3WA 1SMYD 4IUVA 5D65A 1I4XA 2B8FA 4G7OC 3JAME 3S1RB 1CTMA 1JB3A 4OIKA 3QOJA 3H91A 3S15B 3GTJB 3D6WA 4ABNA 2QEJC 2NTSA 4H44C 1BF4A 1I4GA 1E2ZA 2EJFC 5A2QL 3GTOB 2ENBA 5I4DA 1UNSA 4BS9A 4R8NA 3C46A 4B9WA 4XT1B 3KBXA 4NP5A 4RAUC 1SSOA 2IWHA 1H9JA 1IL8A 1MD2D 2A68D 2Q8IB 2BDNA 3EA6A 2A69D 3S17B 2K7VA 3X3MA 4IALA 1O7ZA 1QG7A 2RSOA 1VF7A 1ZXTA 5KYLA 3Q6SA 3FPPA 4CHTB 1A15A 4X3KA 3MC0B 1L0YB 1S4ZA 3S16B 4J8QA 5G3LD 3GTGB 5IGFA 1ZYRC 5EKKA 2NVTB 3CQZB 1PFNA 3EVQA 3C3LA 1CZGA 3DHQA 2L1BA 1QWYA 1H9KA 1C4QA 1EZ8A 4A3EB 1A2TA 3URYA 4DNTB 4B9XA 2M9VA 1AZPA 1IKLA 1EWHA 3BDOA 5I6YA 2CHBD 5D3DA 1EU3A 2B2VA 4C3IB 5J39A 2G9HD 1SYFA 5BN3A 3RD4A 1AZQA 4A3DB 1MGSA 4J6HA 3FKIB 1EU4A 2MPMA 3DMUA 1VMPA 1Y1WB 2WV6D 1EL0A 2F0QA 4FNFA 4WORA 4IFDG 4IUQA 1AEXA 3DWQA 2EZVA 1D5MC 4A3GB 3TBIB 5IT9E 3VYTA 3K58A 2ZT9C 4CKEA 1PTOF 2E2IB 2WB1B 3U9SA 2KVMA 3TDQA 1SNDA 1TKWB 3A55A 4LJZC 2JEAI 2O2LD 5CYUA 2O5IC 1VF5C 2L11A 4KD3A 1LTID 1M8AA 5D3IB 1D1KA 4KN4C 4RGNA 3GV3A 4NKLA 4OO1I 3PO3B 2KECA 5C4ZA 1K8MA 3HOYB 1BO0A 4A3BB 4PQXA 1EOTA 2J0TD 3OWEB 4A3FB 4XQNA 1SNPA 2NB0A 2AUKA 1I3QB 1BCPB 2JA5B 4H13C 3MXUA 2WIIB 1TVXA 2QCPX 3SE0A 5CBAE 5JPMC 2JYOA 1HCZA 3FMCA 3E0JA 3I73A 1SDFA 1EY8A 1FR3A 1HPCA 3R93A 2EXZA 5FLXE 2CQAA 5EGTA 1B44D 1XTCD 1JE4A 1RODA 1BCPD 5NUCA 1SNCA 1WTOA 3SK8A 2BE5D 2F0DA 4FXDA 2VB2X 2PNRC 1GUSA 4H0LC 2F3WA 3NWSA 2O5JC 1GJXA 2B63B 5LHY1 1EZ6A 5KGUA 1KABA 3RLFA 4O42A 4R9WA 5EKIA 3MVVA 3HEJA 5EJWA 2K5WA 1RTNA 1R4QB 1F2LA 1PLFA 3HKZB 1STBA 1FNVA 3W3AA 2LY7A 5COYA 1PRTD 1WTVA 1F9RA 4XQJA 2D62A 2ZXOA 2H1EA 3NHHA 2R93B 5ELCA 1XXGA 2F03A 2RA4A 1PTOH 4HMIA 1KAAA 4EGVA 2KEEA 3E5SA 5FOBB 1K83B 2K04A 1YNJD 3CRLC 1BR9A 4AYBB 4C3IG 2DNCA 2A73B 3SDZA 3IAYA 3SR1A 1GUTA 1FYCA 4R8IA 2M00A 2F0VA 2JA7B 4BY1B 4IZ8A 2AUJD 4A3KB 3DWPA 2LS01 2K05A 5CV9A 1RKNA 1HUMA 1XX8A 4DAYA 4XYQA 2B2TC 3NK9A 3T56B 2AQ1B 5J1ZA 3CU7A 1CHQD 1F2ZA 4M8AA 1CFMA 1WCMB 3D4RA 1SXTA 2IX1A 4KN7C 1DXMA 5C44B 5I9OA 1PTOC 3BVZA 2OXPA 4OL7A 4PMCA 1Z7TA 1ET6A 1CZWA 2DNEA 2Q8RE 1JOOA 1STHA 4EQPA 4KY5A 1EYCA 1AN8A 2QDBA 5IGCA 1FNWA 3OIPA 3TMEA 5JEAH 4LMQD 3W2DA 1BOSA 1KDBA 1BUVT 3C1FA 3KLSX 3S1NB 5K5PA 1I6VC 4V0BA 1JQYD 2NBFA 2EE1A 5BN5A 1H9SB 2DN8A 4CJ0B 5C5MA 1PFMA 5M5WB 2KQ3A 2KOLA 1S5BD 3HOZB 4A3IB 4HN7A 1DYQA 2OEOA 3MZ5A 4C3HB 1SYBA 5F2DA 3VA7A 1Y8OB 1STGA 4G7HC 2NUCA 4OIJA 3V96A 3L7ZC 4K6DA 2X6LA 2JXMB 1R4PB 2F0EA 4KJOA 4FXKC 5KYIA 1Y69U 3H0GB 4U68A 3S2DB 2RSNA 3OW7A 4KI0A 5C4XB 3C2PA 3SEBA 4ID6A 3CHBD 5ELBA 2NTTA 2L12A 5FKAC 3PO2B 1JOKA 1RDPD 3QWNA 1RHPA 1KDAA 2M2LA 3I8ZA 3OHXC 1XYIA 1GOZA 2EPBA 5FO8B 3U9OA 5JVG3 1Q8IA 5C4JB 5I9PA 4KKSA 5E3FA 3KUPA 3TSSA 2IL8A 1BNZA 4FF4A 1LTSD 3TZUA 1PYWD 2A6EC 1W6JA 4ZRZA 1S5FD 1SEBD 5CR3A 2WKDA 4CBVA 1PFBA 3I3CA 1J9OA 1O7LA 1A6XA 1LO5D 3VA5A 3SK5A 5HGTA 3I4MB 2PW5A 1KLUD 1WD1A 2E2JB 3GTKB 2KUMA 2K28A 1AW7A 2E74C 2JP1A 1G8ZD 1SJHD 3EROA 2NVQB 4TSSA 5G3LF 2BA1A 1DCZA 3S1MB 4WFN3 4X3UA 5C0XG 1Z47A 2XRQD 1FD7D 2DY8A 5EPLA 2L5TA 1U4RA 3HOVB 2Z8LA 3OIQA 4KHVA 4G4KA 2JE6I 4FVMA 5CV5A 4MN3A 5DAUA 3PUWA 2Z4HA 3K5MA 2FMCA 1IW7D 1LTRD 2XWBB 3C1EA 2BA0A 3SK4A 2MHVA 1LTGD 2JA8B 2CW0C 4J1MA 3T13A 4IFDI 1B50A 3P7JA 1TQOA 4EVOA 3QG1A 1FNUA 4K5VA 5M3MB 2D2CC 1EWCA 4OHJA 1Q3LA 2WP8J 4PV1C 5JJZA 2XVSA 1NAPA 2SOBA 1EFID 1F9SA 3SVMA 1TWFB 2PZWA 4X3SA 1TWCB 3ND9A 2BDOA 3E6ZX 4C3HG 4HCSA 2EOTA 4RGMA 4L6TB 4LK1C 1UEAB 3J81E 2K33A 5I6WA 2RKSA 1C8CA 2L55A 4YIJA 1ENCA 5ELDA 1CQVA 4WRDA 4F7XA 2WINB 2E2DC 1VMCA 3DEPA 4L63B 2TMPA 2K5DA 2I46A 5C6AA 1NSNS 1HRJA 1F2MA 5JEAJ 5IGDA 1PMRA 3NTIA 1JORA 3HZXA 4PMBA 1OXTA 1KDCA 2X69A 4DXGA 3RZDB 4BY7B 1SMYC 2K5QA 5EBCA 1VDZA 3J7AV 1I4QA 4K2LA 2EY6A 1SNMA 3H3VC 2QILA 5E4XA 4DK0A 3L9AX 1O78A 2FJ2A 5M9OA 4MIUA 1BCPF 4KTAA 2EYMA 3G6JB 1WTPA 3KF8A 3FRPB 4QCLA 5C0XJ 1EY7A 1JICA 3DXJC 1F9QA 1ILPA 4OO1H 2NVXB 1DOLA 5DM63 2SEBD 2AWNA 2F0LA 3EQLC 5C3EB 1U4LA 1V1OA 1KNAA 2RQXA 3VR2A 1OXVA 4XIGS 2BOSA 1SYEA 3RMHA 2A5HA 4NMZA 1SE2A 3I90A 2A68C 1TIID 1HFGA 1Z6HA 4CKCA 1TWAB 2A69C 5IGBA 5KRUA 2B2TA 1IKMA 3K59A 1PRTF 2F0HA 1TS4A 4KV6A 5I2XA 2Z1CA 3VR3A 3KLRA 1HA6A 3F2UA 2JEBI 1EIHA 1QNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJH D;  2AQ1 B;  1D5M C;  1L0X B;  4TSS A;  4Z9C B;  1RF2 D;  3BVM A;  1CHQ D;  4L63 B;  1TS5 A;  3V05 A;  1S5D D;  2XRQ D;  1PTO F;  4BWG B;  1FD7 D;  1SXT A;  1MD2 D;  3R2T A;  1PTO B;  4RFB A;  1PZI D;  1PTO C;  4K6L A;  3BVZ A;  5FK9 C;  1TY0 A;  2Z8L A;  3EA6 A;  2O2L D;  3SEB A;  1V1P A;  4DXG A;  1TS2 A;  3BYY B;  2AQ2 B;  3CHB D;  3R2I A;  5ELB A;  1M4V A;  1CHP D;  1HA5 A;  1LTI D;  2NTT A;  1ET6 A;  1V1P B;  5D3I B;  5ELF A;  5FKA C;  4ZYS A;  1LT5 D;  1I4Q A;  2ICI A;  3MFG A;  4RGN A;  1JR0 D;  1LTA D;  1S5E D;  1RDP D;  1TS3 A;  1FNV A;  1LTR D;  1PRT D;  1JWS D;  4DXF A;  2R61 A;  3BZD B;  1D5Z C;  4UDU C;  1LTG D;  1HXY D;  1LLR D;  2QIL A;  3MC0 B;  1F77 A;  5ELC A;  2XNA C;  4RHS A;  1L0Y B;  1LTB D;  1STE A;  1D5X C;  1XXG A;  2RDH A;  1JWU D;  1S5C D;  1AN8 A;  2XN9 C;  3EFX D;  2XRS D;  1D6E C;  1LT4 D;  1BCP F;  1EEF D;  1PTO H;  4RGO S;  1HQR D;  1SE3 A;  1GOZ A;  1I4P A;  1FGB D;  1BCP B;  1JCK B;  1FNW A;  3BVG A;  1QIL A;  3R8B A;  1KLG D;  5TSS A;  1BCP C;  1PTO D;  1CK1 A;  1FNU A;  1ET9 A;  1DJR D;  1I4X A;  1TY2 A;  4RGT A;  2SEB D;  1EWC A;  4OHJ A;  1CT1 D;  4RCO A;  1RCV D;  1LT3 D;  3TSS A;  1JWM D;  1I4H A;  3W2D A;  1RD9 D;  3URY A;  1V1O A;  1LTS D;  1ESF A;  1PRT B;  1PYW D;  4RH6 A;  3O13 A;  1HTL D;  1LTT D;  5ELE A;  3KLS X;  1LT6 D;  2CHB D;  1B1Z A;  4C56 C;  5D3D A;  1EFI D;  1JQY D;  1EU3 A;  1PZK D;  2QEJ C;  2NTS A;  1S5F D;  2G9H D;  2J4X A;  1I4G A;  1SEB D;  1SE2 A;  3DWA A;  1B44 D;  1SBB B;  1XTC D;  3GP7 A;  3DWP A;  1S5B D;  5I4D A;  2IPK D;  1UNS A;  1EEI D;  4RGM A;  1BCP D;  4L6T B;  1DYQ A;  4O1N A;  2RDG A;  2IJ0 A;  1PZJ D;  1EU4 A;  1PRT F;  1LO5 D;  3BYT B;  2WV6 D;  2AQ3 B;  1ENF A;  3OWE B;  1TS4 A;  1SJE D;  1SE4 A;  1KLU D;  2TSS A;  1PRT C;  1UUP A;  4RHR A;  1AW7 A;  1BXT A;  1KTK A;  5ELD A;  1CQV A;  1G8Z D;  1I4R A;  3DWQ A;  1T5X D; 
#chains in the Genus database with same CATH topology
 1A3U A;  1GHJ A;  1R9T B;  1PDQ A;  2DY7 A;  4X64 L;  3HOV G;  3T1H Q;  2RBM A;  3OOC A;  1U9R A;  5A2Q E;  3I4N B;  3M4P A;  4S3S A;  3G48 A;  1PH8 A;  1B4O A;  2PQA A;  4IUR A;  4C1N I;  1PZI D;  4FO2 A;  2F0I A;  2K03 A;  4C1N K;  1G2S A;  3AEV A;  1P16 A;  5IOC A;  3PUX A;  1S3O A;  3GTM H;  1EY5 A;  4FDB A;  1E1T A;  4RKL A;  3K7A H;  2OTJ A;  1GUO A;  1CUK A;  1OXS C;  2C5C A;  4PG3 A;  1LTL A;  1QVC A;  2ICI A;  5KEE A;  3NP8 A;  4DAP A;  2JA8 G;  5M5X B;  2VS1 A;  1NR2 A;  3WDN A;  3VR6 A;  2FIN B;  2R61 A;  3LNN A;  4UDU C;  4A3G H;  3TN2 A;  3CCR A;  4G7Z C;  3MTS A;  1A3V A;  4PZ6 A;  4RHS A;  2VB3 X;  2A74 C;  1STE A;  4KJN A;  4X65 L;  1D6E C;  1VQE A;  3CCQ A;  3J80 i;  3RUZ A;  4KHP L;  3OMC A;  5M3M G;  2BH2 A;  3H94 A;  1KLG D;  2UXB L;  3TP5 A;  5CV8 A;  2K5N A;  1HNW L;  4UPA A;  4DNR B;  1CK1 A;  1YIJ A;  4A3M H;  4C2M B;  1KQS A;  3M85 A;  1U4M A;  4HJA A;  1DJR D;  3J80 c;  5D14 A;  2AWO A;  1MSG A;  1TY2 A;  1K0S A;  1RCV D;  3KDF A;  3CW2 C;  3W1G A;  1NJI C;  1XMO Q;  3AFP A;  4NDX A;  4XQQ A;  5IE8 A;  4LF9 Q;  3PO3 H;  5E7N A;  4Y7N H;  4DR3 L;  2DJF C;  1B1Z A;  3Q24 A;  5ISR A;  3HOY H;  5JPN C;  1PZK D;  4A3B H;  1MSH A;  4KY6 A;  2XWJ B;  4JI0 Q;  2KJX A;  4A3E G;  3HG9 A;  4BA2 I;  3IKJ A;  3NBI A;  1I3Q H;  3PUY A;  2JA5 H;  4OX9 Q;  3N6R A;  1ENA A;  2YU9 H;  1EEI D;  5J3B A;  3FDT A;  4JK1 C;  4ZLT F;  4RCN A;  3NQI A;  1WTR A;  2OCE A;  3BS1 A;  3GTP B;  1C9O A;  4DR2 Q;  2EDG A;  3D3R A;  1SE4 A;  3IFD A;  1I50 H;  2IT1 A;  2UUB L;  4DAY B;  4I65 A;  1IBL Q;  5M3F B;  2G9D A;  2KBN A;  2HDL A;  3KK7 A;  4JBK A;  4DV0 L;  1B70 B;  1G91 A;  1SFO B;  2Z6B A;  3AMU A;  1DZ1 A;  3BU2 A;  1C48 A;  3ERQ A;  3I70 A;  2D9U A;  5L37 A;  5COR A;  4I7A A;  2F4V Q;  4BY7 G;  3KBG A;  3R2T A;  3ZJY C;  2F0P A;  1O7I A;  4XXE A;  1QJO A;  3K5O A;  1LAB A;  2OT2 A;  2F4I A;  3NXW A;  3K5L A;  1AP0 A;  1G6Z A;  3GTL H;  4ZYS A;  2NVY B;  1QNU A;  1K73 C;  3U50 C;  1ML0 D;  1YNN D;  2E5L Q;  3JAM L;  5IYB G;  4L5S A;  5GAD C;  3PUV A;  4IO9 A;  4A3C H;  1H9M A;  1TWG H;  1HXY D;  2K1B A;  3BG3 A;  3VR4 A;  1BVS A;  1OXX K;  2KCN A;  3EFX D;  3MHB A;  2XRS D;  3I91 A;  2N8N A;  1KAW A;  1T5E A;  2ZTD A;  3CRK C;  1VQ4 A;  3E3X A;  2B8G A;  1BCP C;  5E1F A;  3KF6 A;  3A7A B;  5C3E G;  2BE5 C;  2J7Z A;  4ZUJ A;  1X65 A;  2JSO A;  4DN4 M;  1CQF A;  2K5V A;  5LL6 S;  1QCB D;  3HOX H;  1B9N A;  4PMW A;  2VUM B;  2GA4 B;  1GHK A;  3P1H A;  4A3F G;  1DM0 B;  3OSO A;  4YCU A;  1EQQ A;  1I4H A;  1RD9 D;  1SNQ A;  1HQM C;  5IYD H;  5T1G A;  4LAA A;  5JOB A;  1KD1 C;  2RVL A;  2MNA A;  2K32 A;  3D6C A;  4ZAI A;  1HR0 W;  3SGI A;  3GO5 A;  2J4X A;  4E6I A;  2E2H B;  1HNX L;  3PIP A;  1IYU A;  1X3P A;  1STA A;  4KKU A;  4FP5 D;  4JI2 L;  3T16 A;  3GTQ B;  4HED A;  2A6H D;  1HNZ Q;  3KJP A;  2IJ0 A;  4NW2 A;  1A3T A;  2VL6 A;  1XNQ L;  1VQ5 A;  4L5R C;  1GXD C;  1A62 A;  2KHI A;  1PYB A;  4GOP A;  2XGT A;  1PRT C;  3D31 A;  2GN5 A;  1BXT A;  3I4N G;  2EYP A;  1HUN A;  1N9W A;  4LFC L;  2MJ8 A;  3ER0 A;  5AFW A;  3OTO L;  4BY1 H;  5AJ3 Q;  4BBR B;  2L9H A;  3HRZ C;  1WTH A;  4DFA A;  2PYK A;  4DV5 Q;  1N34 Q;  2EY2 A;  4B08 A;  3FVQ A;  2L0C A;  2VXW A;  1VCI A;  1PHJ A;  4A93 B;  4K2K A;  3CAM A;  3K57 A;  1AE2 A;  1YNJ C;  4FYD A;  2V4D A;  5ELF A;  2F0J A;  3A54 A;  4Q5V A;  4LF5 Q;  1KNE A;  3FPU B;  3E0E A;  2Z4I A;  3JAM i;  3J7A F;  5IP7 G;  3ITP A;  1MKH A;  3NWT A;  4JI0 L;  4ZK9 B;  1ASY A;  1E7Z A;  3IL8 A;  1D5X C;  4ZKB B;  2XN9 C;  3M3Y H;  3T4A C;  3JAM c;  1SYC A;  5IWA L;  2F1M A;  2OWO A;  4KD4 A;  3UI2 A;  4X3T A;  4JI1 Q;  4WJW A;  1UEB A;  4LW1 A;  2AHO B;  5GAG C;  2E75 C;  5GRO A;  2EYF A;  5C0X I;  4DR2 L;  5KNC A;  3S1Q H;  2O4X A;  5DM7 3;  4JW0 A;  2Q2H A;  2JA6 B;  2VNU D;  1WVL A;  1IBL L;  2NN6 G;  3I4O A;  3H09 A;  4F8M A;  3ONA B;  2XIW A;  2HCC A;  2OQK A;  1LAC A;  1K8A C;  5K36 G;  3QOL A;  5KIX A;  4RH6 A;  4DR4 Q;  3PCO B;  3MFY A;  4JBW A;  4OWT B;  2B2Y A;  5FJ8 G;  1WOC A;  3I4L A;  3Q23 A;  5IT9 L;  3NQT A;  2N88 A;  1K9M C;  1B2T A;  2DUD A;  2EYO A;  3KYH C;  4YWL A;  2HIX A;  5IOD A;  2IPK D;  1ZYR D;  4QL5 A;  4EQO A;  1WTQ A;  2K6A A;  2SDF A;  4QIW B;  4JI6 Q;  5M3F G;  5JEA G;  2XSC A;  1ZKO A;  2E76 C;  2VQE Q;  4RHR A;  1I4R A;  4IUT A;  1HFN A;  2B2W A;  1RF2 D;  3MEF A;  1IBK Q;  3NE5 B;  1S5D D;  4ME5 A;  3F2B A;  3A5Z B;  4BWG B;  1EQV A;  2FMM A;  4IQZ A;  5EKL A;  3KLS A;  3VYU A;  1B53 A;  2KED A;  2B3G A;  5DLQ E;  1EY6 A;  1WTW A;  3CKI B;  1TY0 A;  4CJ1 B;  3K6O A;  5FO7 B;  1CSQ A;  1V1P A;  4UAI A;  1VQ7 A;  1NE3 A;  3HOU H;  3R2I A;  5JVH 3;  2UUA Q;  1OXU A;  4Q0F A;  3S2H H;  4LNQ A;  4ILW A;  3FP9 A;  1UAP A;  1FJG Q;  4DXF A;  3K5N A;  2QDL A;  1KL9 A;  3J81 i;  3BZD B;  2I07 B;  4CGY B;  4XYO A;  2A8V A;  2ICE C;  3A8I E;  3RLO A;  1LV9 A;  1IYV A;  1JWU D;  4H02 A;  4DV4 L;  3J81 c;  2HD3 A;  3CCS A;  1I4P A;  1JCK B;  5HY6 A;  3TS2 A;  2VUM G;  5BR8 L;  5TSS A;  2KCM A;  5FLX L;  3NUC A;  2MP1 A;  4A4I A;  2ASB A;  4XT3 B;  4GNX A;  4HSP A;  2K01 A;  3NSW A;  1EIY B;  2F0W A;  2LXJ A;  2EIF A;  5M5Y H;  1O80 A;  4KMU C;  4B3S Q;  1SNO A;  4IFD H;  4JI7 Q;  1HZB A;  5ELE A;  5EPJ A;  2HQL A;  4HMJ A;  2E8G A;  3P20 A;  4DR1 Q;  3NTK A;  1YEZ A;  1K0R A;  1VQD A;  2WAQ B;  2JA9 A;  3F2D A;  1PA6 A;  3A8K E;  1BDO A;  3ULJ A;  1ICW A;  1Q90 A;  3M4O B;  2CVR A;  4HTH A;  4O1N A;  1STY A;  4RA8 A;  4PNY A;  2NZO A;  2D5D A;  4LF5 L;  2HDM A;  2B2U A;  5C4J H;  4ODG A;  4U67 3;  1ZEQ X;  3K0Y A;  1KXL A;  1ONL A;  4K5X A;  2PNH A;  2TSS A;  3TZD A;  4C3J B;  4DV1 Q;  4A75 A;  4YCW A;  1VQM A;  2F0G A;  3J7Y W;  1X3Q A;  1KTK A;  1V43 A;  5LL6 X;  5IIF A;  2UUC L;  4BBR G;  1L0X B;  1W6K A;  3AU7 A;  3HGB A;  1SLJ A;  1DOM A;  2B2Y C;  4QIW E;  1UWV A;  3OWF A;  3V05 A;  3AYH B;  4JI1 L;  2AMC B;  3RZO B;  4A93 G;  3NBH A;  4DV3 Q;  1VS0 A;  1WTX A;  5ELN A;  4HCE A;  2Z6K C;  5CBE E;  5CV6 A;  2EQS A;  2K4K A;  1J8I A;  1NMF A;  5CV7 A;  1TR5 A;  1DD2 A;  2R7Z B;  3S1R H;  4WJ3 M;  3I72 A;  4HSV A;  1M4V A;  2PQE A;  3GD7 A;  1N36 L;  3UDF A;  1LT5 D;  3RN2 A;  3CXC A;  1LTA D;  1X56 A;  3GTJ H;  3CMA A;  2QW7 A;  1EQR A;  4JI4 Q;  3QJY A;  1H95 A;  3DM1 A;  1AFP A;  3BZC A;  3RR5 A;  5J22 A;  2NVQ H;  1EIF A;  3CCV A;  2B2W C;  3ZYY X;  5HGQ A;  1LLR D;  4FF2 A;  1T9H A;  2F0K A;  3GTO H;  1F77 A;  3MXG A;  2XNA C;  2IX3 A;  4B3T L;  4ZKC B;  3PO2 G;  2RDH A;  1RTO A;  5I2Y A;  1LT4 D;  1SE3 A;  2KHJ A;  4CKB A;  1FGB D;  2JA6 G;  3HOV H;  2C9O A;  5E4W C;  1HZC A;  3KF8 B;  1ET9 A;  5KND A;  1IXR A;  3VYR A;  2MO0 A;  2VQE L;  4R4O A;  4RGT A;  4DAV A;  4UP9 A;  4LF4 L;  4GN5 A;  5C3X A;  1CT1 D;  3GTM B;  1E22 A;  2QF7 A;  3PIO A;  3K7A B;  1LT3 D;  1JWM D;  3MAQ A;  1Y1V B;  1IBK L;  3J80 L;  5FLM H;  3SK6 A;  2Q2U A;  1EYA A;  2JA8 H;  3LWU A;  1Q12 A;  2WAC A;  4L8J A;  1KRS A;  3S17 H;  2MGS A;  1QE6 A;  1CA6 A;  5A35 A;  4JV5 L;  5DEH A;  1CM9 A;  1WFQ A;  4GNX C;  5C4H A;  2LXK A;  3LWE A;  4MHE A;  4A3M B;  1B9M A;  1QB5 D;  1SJE D;  2ZXR A;  1IW7 C;  4TVA B;  2SNM A;  4DV6 Q;  2WAQ E;  1T5X D;  2CCZ A;  2NWG A;  3S16 H;  4YY3 L;  3GTG H;  1CI3 M;  3M4Y A;  3EN2 A;  1GKH A;  4QQB X;  3QO2 A;  2NVT H;  4KK7 A;  1IHZ A;  1Y8N B;  4Y7N B;  3CQZ H;  2YYZ A;  1PTO B;  2B29 A;  4K6L A;  4HJ9 A;  1SYD A;  2LMC B;  4BA1 I;  2PQA B;  4RKB A;  5JAV A;  3PIP 3;  4A3E H;  2PI2 A;  1Q82 C;  1II3 A;  2B2U C;  4B3S L;  1CHP D;  3OYY A;  2YU9 B;  2MO1 A;  3AQQ A;  4DU9 A;  2SNS A;  4FF1 A;  2NZ1 D;  3PV0 A;  3U58 A;  1S5E D;  1SAP A;  1ILQ A;  3T53 B;  4C3I H;  4NXM Q;  4DR1 L;  1PH1 A;  1I50 B;  2CWA A;  1E0B A;  1JJ2 A;  4TKO B;  1MIU A;  2V1C C;  1UE5 A;  3QR8 A;  3MA2 B;  2EJG C;  4IUU A;  4A3D H;  4K0K Q;  1HQR D;  4P2C B;  3S9W A;  3FKI H;  2D0P A;  2PO4 A;  4K5W A;  1Y1W H;  3VR5 A;  1PTO D;  4IUN A;  3HOW B;  1SMX A;  1PH9 A;  4HID A;  2R92 B;  4N9T A;  4GKJ Q;  1PXU A;  4LUZ A;  4KHZ A;  3QB3 A;  2QA4 A;  1HTP A;  1BKB A;  3PMF A;  1UE1 A;  1JC7 A;  1NMG A;  4DR5 Q;  4J15 A;  4DGZ A;  3GTL B;  1PRT B;  3KDF B;  4JI3 L;  2L4N A;  3O13 A;  4RWS C;  1HTL D;  4P75 A;  1LT6 D;  2F0M A;  4C56 C;  2E2I H;  4AQY L;  1B3A A;  2WAQ G;  5EBD A;  2EYH A;  4FF3 A;  4DV3 L;  3Q22 A;  3CC7 A;  2PZT A;  2HQE A;  4TRD A;  2NYZ D;  1VQI A;  1TWG B;  1AE3 A;  3MEH A;  4JPB W;  2F0U A;  4GN4 B;  1V1Q A;  2B2V C;  2PW7 A;  1Y8P B;  3G7L A;  5LMN W;  1YJW A;  5LMU L;  4IPG A;  4C3J G;  2F0N A;  3EJI A;  1PZJ D;  4QB4 A;  4NXN L;  4V19 0;  4OO1 G;  4X62 L;  4LFB Q;  2F0F A;  1XWE A;  3BDL A;  3A56 A;  1QVF A;  4H7B A;  2KHS A;  4JI5 Q;  4ULL A;  2EJM A;  3MXN A;  3HOX B;  4CJ2 C;  3T1Y Q;  4OWW B;  3PF4 A;  1HZA A;  3A8J E;  4BBS B;  4IUP A;  1YZ6 A;  4M1U B;  4A3F H;  4N9P A;  2QKI C;  3F1Z A;  4KKT A;  1XJV A;  3L3O C;  1X32 A;  5GAE C;  3ICE A;  2FHT A;  4DNI A;  1XMQ Q;  4DK1 A;  4LF7 L;  3HKS A;  3PUZ A;  2YTX A;  3T51 B;  4EX5 A;  5C5L A;  5IP9 G;  1GUN A;  2VQF Q;  2R7Z G;  1F9P A;  2F3V A;  1H9R A;  2R3Z A;  3FEW X;  2P5Z X;  3N52 A;  5KNB A;  1PH3 A;  4IFD J;  4B3M L;  1YBY A;  1NCV A;  5JJK A;  1B7Y B;  4JYA L;  3G71 A;  3OW2 A;  3WOE A;  4QUC A;  1E2W A;  2AQ2 B;  4IN3 A;  2OTL A;  4LFA Q;  1V8Q A;  5IYC G;  3HP3 A;  1LUZ A;  3H6M A;  5HUR A;  1EIG A;  3BDC A;  1O7Y A;  1E1O A;  2BCO A;  5LMN L;  1BBX C;  1MBY A;  1HHV A;  2ZXP A;  1LTB D;  2PMZ B;  3I4N H;  1DON A;  1QIL A;  2ID0 A;  4F87 A;  2NZH A;  5IGE A;  2MUY A;  3Q0A A;  4DUZ Q;  3NTH A;  1VQB A;  1I94 L;  1Y1V G;  4DF7 A;  4IPC A;  4L5Q A;  4YCV A;  1KC8 C;  3KF6 B;  3CC2 A;  4K8I A;  1D2B A;  4RCO A;  5M5X H;  4OON A;  4XDX A;  2F0O A;  3GQB A;  1TXY A;  3STB D;  1A8V A;  3RN5 A;  2B63 H;  4CDE C;  5EQ0 A;  1X55 A;  5DNF A;  3J80 E;  4DR7 Q;  2RDF A;  3P75 A;  4K8J A;  1CKO A;  5IP7 H;  4I7Z C;  2HCI A;  2VY3 A;  4GLX A;  3DWA A;  3JC6 6;  3R3O A;  4A3M G;  3M3Y B;  1N32 Q;  2DGY A;  1KHI A;  1U4P A;  2EVB A;  1MI2 A;  2RDG A;  4PZ8 A;  1RJT A;  1G2T A;  2AQ3 B;  2EXD A;  3E9H A;  3ULL A;  1JE5 A;  3T1H L;  2PCF B;  3S1Q B;  1EY4 A;  1UUP A;  4DV7 Q;  4AIM A;  2R93 H;  4GOP B;  1Q1B A;  2WKC A;  3M7G A;  2ZTC A;  3OPO A;  2NN6 H;  4Z9C B;  3PF5 A;  2A6E D;  1I6H B;  3D4D A;  2NN6 I;  2RHQ B;  5K36 H;  1Y14 B;  2Y0S B;  1CKM A;  4G57 A;  5IGG A;  2PPB C;  4RFB A;  3X3N A;  1FVI A;  2X6G A;  1K83 H;  3M7N A;  1K8O A;  3U4Z A;  1F2Y A;  4X66 Q;  2LFN A;  3GTP H;  2Q2T A;  1TU2 B;  4DR5 L;  1JJC B;  1CKN A;  2EYL A;  4KY7 A;  4QF4 A;  3V2T A;  4UP8 A;  1JR0 D;  1TS3 A;  2EY5 A;  2LKV A;  1NTG A;  1G29 1;  1PH2 A;  5CC4 A;  4XTC S;  3AB9 A;  2KCC A;  1L1O A;  1D5Z C;  2JA7 H;  3HS0 C;  1GUW A;  1SFO H;  1CA5 A;  2AKW B;  2R6G A;  3MXP A;  4A3K H;  1EQT A;  5CMD A;  1M90 C;  4DA2 A;  1GO3 E;  3HOW G;  2HUG A;  1OTC A;  1TT2 A;  4LUO A;  3WOF A;  1S5C D;  1EY9 A;  3TP7 A;  1WD0 A;  1A0I A;  1D1I A;  2R92 G;  5CV4 A;  2PZU A;  2Q8T A;  3BVG A;  1L2F A;  3R8B A;  4B3R Q;  5IY0 A;  3CCJ A;  3DEO A;  1XMO L;  4LFB L;  3SXH A;  2F0T A;  1TWH B;  2ZM6 Q;  1GVP A;  3NEL A;  4LF9 L;  4QJF A;  1W3S A;  4R1J A;  4ZUI A;  3J81 L;  3T1Y L;  1NNX A;  1M1K C;  3NPP A;  4DV2 Q;  2UU9 Q;  2PMZ E;  2RHS B;  1JOQ A;  3HOU B;  3TP6 A;  1ESF A;  1GD7 A;  2UXD Q;  4A3C G;  3S2H B;  3A7L A;  1LTT D;  1E2V A;  1WCM H;  1XMQ L;  4ZQ3 A;  3UDG A;  4OX9 L;  1H9S A;  1OO9 B;  2F3I A;  1UE6 A;  3LX0 A;  2VQF L;  5C44 H;  3K80 C;  4K14 A;  2CW0 D;  1LM0 A;  2KA7 A;  5C0X H;  5CGK A;  2FFK B;  3ULP A;  2CQO A;  5EPK A;  1SBB B;  3GP7 A;  3ND8 A;  1VQ8 A;  3MWY W;  4HR7 B;  1YI2 A;  3VYS A;  1Q1E A;  3OMG A;  2H4O A;  3VDY A;  4LFA L;  4X6A H;  4GLV B;  4TQU S;  3BYT B;  1EYD A;  3E9I A;  1ENF A;  4BBS G;  1YNN C;  2EY1 A;  1NUC A;  4A3J B;  1NR4 A;  1XPU A;  1DOK A;  3TP8 A;  2F4V L;  4POG A;  3DUZ A;  2CWP A;  4IJL A;  5M5Y B;  1E24 A;  1GUG A;  3PIO 3;  3BVM A;  4RMF A;  4EQN A;  2HIV A;  4GZY C;  1TS5 A;  3F2C A;  3K7U C;  4GN3 B;  2E2H H;  2Z6K A;  3IFT A;  3QIA A;  1ESR A;  2OQ0 A;  4FXG C;  5FK9 C;  2E5L L;  3SHL A;  1BQQ T;  1NBW A;  3S14 B;  4LF6 Q;  2IW3 A;  4DK3 C;  1YHA A;  2G5D A;  1TS2 A;  1SE8 A;  4IOA A;  3M4Q A;  3BYY B;  2OF1 A;  3D4W A;  1HA5 A;  1Q7Y C;  5T1I A;  1V1P B;  1QUQ A;  3MFG A;  2Y0S E;  3S1N H;  1A2U A;  4YWM A;  4QMG A;  1STN A;  1JWS D;  3A74 A;  2F0S A;  1QOH A;  2IX0 A;  3L0O A;  5M5W H;  3D8G A;  5FO9 B;  2K50 A;  3HOZ H;  3I2Z A;  2EYJ A;  1N8R C;  3GV6 A;  3K8A A;  4A3I H;  1EEF D;  1N32 L;  4RGO S;  2B39 A;  2N55 A;  4HIM A;  2A6H C;  4C3H H;  4HAE A;  1EY0 A;  1VQ9 A;  1ICF B;  2RCN A;  2JQO A;  1SYG A;  4F88 A;  4QUF A;  4OGQ C;  1X3E A;  1IZ6 A;  4NB3 A;  5BN4 A;  5C3W A;  4YWK A;  5EAY A;  4HJ8 A;  1SMY D;  4IUV A;  4JOI C;  5D65 A;  1I4X A;  4DV7 L;  1WYD A;  2B8F A;  4P71 A;  4G7O C;  3JAM E;  4GNX B;  3S1R B;  1CTM A;  1JB3 A;  4OIK A;  4JBJ A;  2MQH A;  3QOJ A;  3H91 A;  2IY5 B;  1PVO A;  1L1O C;  3S15 B;  3GTJ B;  4GS3 A;  3H0G H;  3S2D H;  3D6W A;  4ABN A;  1HNZ L;  3UDX A;  2QEJ C;  2NTS A;  4H44 C;  5C4X H;  3I55 A;  1BF4 A;  1I4G A;  1E2Z A;  3TRE A;  1VQG A;  4BXX H;  2EJF C;  4YHH Q;  5A2Q L;  3GTO B;  2UXC Q;  2ENB A;  5I4D A;  1UNS A;  1BBU A;  4N8X 1;  3PO2 H;  1I5F A;  4BS9 A;  1N33 Q;  4R4I A;  4R8N A;  3C46 A;  4B9W A;  2A19 A;  2ATW A;  1VQP A;  4GKK Q;  1YIT A;  4XT1 B;  1X3F A;  2LSS A;  3KBX A;  3WWV A;  5JJI A;  4NP5 A;  1K3B C;  5AJ3 L;  4RAU C;  1WI5 A;  2Y0S G;  1XNR Q;  1SSO A;  2HHH Q;  4DV5 L;  1N34 L;  2YV5 A;  1J6Q A;  2IWH A;  1H9J A;  1IL8 A;  3NEN A;  5H1S E;  1MD2 D;  4DR6 Q;  1DGS A;  1EFW A;  2A68 D;  2ZM6 L;  2Q8I B;  3CP0 A;  2BDN A;  4OEL B;  3EA6 A;  3NBH B;  3J81 j;  1JB7 A;  2A69 D;  4X64 Q;  3S17 B;  2I5H A;  2K7V A;  2R7D A;  4IPD A;  3X3M A;  4LUV A;  3CPF A;  4IAL A;  1O7Z A;  1QG7 A;  1KRT A;  1U5K A;  2RSO A;  1VF7 A;  1ZXT A;  4EQ5 A;  5KYL A;  3G4S A;  3Q6S A;  3FPP A;  4CHT B;  1A15 A;  4X3K A;  3MC0 B;  4R4Q A;  2Z9H A;  1L0Y B;  1RL2 A;  1S4Z A;  3S16 B;  4J8Q A;  5G3L D;  3GTG B;  5IGF A;  1ZYR C;  5EKK A;  2NVT B;  4JVZ A;  3CQZ B;  1PFN A;  3EVQ A;  3C3L A;  4L5T A;  3I4M H;  1CZG A;  3DHQ A;  2E2J H;  3PSI A;  3GTK H;  3EBE A;  3HOU G;  4DR4 L;  2L1B A;  1QWY A;  1H9K A;  1C4Q A;  4KHP Q;  1EZ8 A;  1VQJ A;  4A3E B;  1A2T A;  3U4V A;  3URY A;  4DNT B;  4B9X A;  2M9V A;  1AZP A;  1IKL A;  1EWH A;  3BDO A;  5I6Y A;  3S1M H;  1UE7 A;  2CHB D;  5D3D A;  1EU3 A;  2B2V A;  2IHF A;  4C3I B;  5J39 A;  1IL2 A;  2G9H D;  1SYF A;  4JI6 L;  5BN3 A;  4DR3 Q;  4NPS A;  1E3P A;  3LGJ A;  4JBM A;  3RD4 A;  1AZQ A;  4A3D B;  3NEM A;  1MGS A;  3W5O A;  4GLA C;  4J6H A;  4A3J G;  3FKI B;  1EU4 A;  2MPM A;  2JK8 A;  3PGZ A;  1VQA A;  3DMU A;  1VMP A;  1Y1W B;  2WV6 D;  1EL0 A;  3TS0 A;  2F0Q A;  4FNF A;  4PZ7 A;  4WOR A;  3S24 A;  4IFD G;  4UP7 A;  4IUQ A;  1AEX A;  3DWQ A;  2EZV A;  1D5M C;  4A3G B;  3TBI B;  5IT9 E;  2N49 A;  3VYT A;  1Q8K A;  2K52 A;  4R4T A;  2ZT9 C;  3K58 A;  4CKE A;  1PTO F;  3B6Y A;  2E2I B;  2WB1 B;  2CFM A;  3U9S A;  2KVM A;  3TDQ A;  1SND A;  2UUA L;  1TKW B;  3A55 A;  4LJZ C;  4P74 A;  1X54 A;  4APV A;  5M3M H;  2CH4 W;  3M4O H;  2JEA I;  2O2L D;  1FJG L;  5CYU A;  2O5I C;  1VF5 C;  1YJ9 A;  1QVG A;  2L11 A;  4KD3 A;  1LTI D;  3I7F A;  1M8A A;  5D3I B;  4A3L G;  1D1K A;  4KN4 C;  4RGN A;  3GV3 A;  4C3J H;  4DKA C;  3TQY A;  1TWF H;  4NKL A;  4OO1 I;  3PO3 B;  1TWC H;  2KEC A;  3FHW A;  1J5E Q;  5C4Z A;  1K8M A;  3HOY B;  1YVC A;  1BO0 A;  1MJC A;  4A3B B;  4PQX A;  1EOT A;  2I0Q A;  2UXC L;  2J0T D;  3OWE B;  4O2D A;  1PH4 A;  4A3F B;  4XQN A;  1SNP A;  2NB0 A;  2AUK A;  1I3Q B;  1BCP B;  1N33 L;  2QEX A;  2JA5 B;  4H13 C;  3MXU A;  2WII B;  4JC0 A;  2A1A A;  1TVX A;  4JI7 L;  2QCP X;  3SE0 A;  3BJU A;  1LYL A;  5CBA E;  5JPM C;  1PH6 A;  1Q46 A;  1XNR L;  4P72 A;  2JYO A;  1HCZ A;  3FMC A;  3E0J A;  5IYC H;  3I73 A;  3W1B A;  1SDF A;  1EY8 A;  1FR3 A;  4P73 A;  1HPC A;  3R93 A;  2EXZ A;  3J7Z C;  5FLX E;  3RZD H;  2CQA A;  5EGT A;  1B44 D;  1XTC D;  1JE4 A;  2VZA A;  4BY7 H;  1ROD A;  1WJJ A;  3UDI A;  3CD6 A;  4DV1 L;  3GDE A;  1V9P A;  1BCP D;  5NUC A;  4OXP A;  1SNC A;  1WTO A;  3SK8 A;  2BE5 D;  2F0D A;  1HNX Q;  4FXD A;  2VB2 X;  4JI2 Q;  2PNR C;  1IBM Q;  1GUS A;  1Y1V H;  3CCM A;  4H0L C;  5IYB H;  2F3W A;  5FLM G;  1XNQ Q;  3NWS A;  3MXN B;  1G51 A;  2O5J C;  1GJX A;  2B63 B;  5LHY 1;  4HIO A;  1EZ6 A;  5KGU A;  1KAB A;  3RLF A;  4O42 A;  4R9W A;  2N78 A;  4LFC Q;  1B3Q A;  1K8G A;  5EKI A;  4IOC A;  3MVV A;  4RG1 A;  2NVX H;  4JI4 L;  3HEJ A;  5EJW A;  3DM3 A;  1YNX A;  5C3E H;  3OTO Q;  2K5W A;  4ALP A;  4QGU A;  1RTN A;  4QY7 A;  1F2L A;  1PLF A;  1R4Q B;  3HKZ B;  1BBW A;  4DPG A;  3KJO A;  1XPR A;  1STB A;  3CC4 A;  2WB1 E;  1FNV A;  2D0O A;  2ZTE A;  2LY7 A;  3W3A A;  1PRT D;  5COY A;  1WTV A;  1F9R A;  1CSP A;  4XQJ A;  1HR0 Q;  2D62 A;  2K5H A;  2ZXO A;  2H1E A;  3NHH A;  2R93 B;  5ELC A;  1TWA H;  1XXG A;  2F03 A;  2RA4 A;  2PI2 E;  1Q86 C;  1PTO H;  1RIP A;  3BZK A;  4HMI A;  1KAA A;  1QZH A;  4EGV A;  2KEE A;  3E5S A;  4LWC A;  5FOB B;  3D0F A;  1K83 B;  5IWA Q;  3K0X A;  2K04 A;  1YNJ D;  2YTV A;  3CRL C;  1BR9 A;  4AYB B;  1R9T H;  4C3I G;  2DNC A;  1C7Y A;  1JMC A;  2I5M X;  2A73 B;  5GQO A;  3SDZ A;  1D8L A;  1VQK A;  2RCF A;  3IAY A;  3SR1 A;  1GUT A;  1FYC A;  2CH4 A;  4JI8 Q;  4R8I A;  4A3D G;  2M00 A;  2F0V A;  2JA7 B;  4BY1 B;  4IZ8 A;  2AUJ D;  3FKI G;  4A3K B;  1P8L A;  4KLK A;  3DWP A;  1Y1W G;  2LS0 1;  2K05 A;  5CV9 A;  1PFS A;  2MFI A;  3HOW H;  1RKN A;  3HFZ B;  1HUM A;  4DV6 L;  2R92 H;  3A5U A;  1XX8 A;  4DAY A;  4A3G G;  4XYQ A;  2ES2 A;  2B2T C;  4MNO A;  1J5E L;  3NK9 A;  1IYJ B;  3T56 B;  2WB1 G;  2AQ1 B;  5J1Z A;  1SN8 A;  3CU7 A;  1CHQ D;  5ELO A;  1F2Z A;  4M8A A;  1CFM A;  1WCM B;  3D4R A;  1SXT A;  4A76 A;  4C2M H;  4KN7 C;  2IX1 A;  1DXM A;  2QGQ A;  5C44 B;  5I9O A;  1PTO C;  1PYS B;  3BVZ A;  1K3R A;  2OXP A;  4OL7 A;  4NXM L;  4PMC A;  1Z7T A;  1G6P A;  3H15 A;  3PO3 G;  1ET6 A;  3UE1 A;  1CZW A;  4UHV A;  4JCV E;  3IRB A;  2DNE A;  3HOY G;  2Q8R E;  1CKN B;  4A3B G;  4K0K L;  1JOO A;  4BBS H;  3L2P A;  1STH A;  2N3S A;  2JA5 G;  1L1O B;  4EQP A;  5FJ8 H;  4KY5 A;  1EYC A;  1AN8 A;  3Q8D A;  4O0A A;  4GKJ L;  2QDB A;  3HKZ E;  5IGC A;  3CCE A;  2L15 A;  1FNW A;  3OIP A;  4JOI A;  2JN4 A;  1MHW C;  3TME A;  2K75 A;  1VQF A;  4ME3 A;  4LF8 Q;  2HT1 A;  1IBM L;  4DV4 Q;  1JT8 A;  5M3F H;  5JEA H;  1SRU A;  4LMQ D;  5BR8 Q;  3W2D A;  1BOS A;  1KDB A;  1BUV T;  1VQH A;  3C1F A;  3KLS X;  1A63 A;  3S1N B;  5K5P A;  1I6V C;  4V0B A;  1JQY D;  4CDC C;  2NBF A;  2EE1 A;  3M9B A;  1U0L A;  5BN5 A;  1X3G A;  1H9S B;  2DN8 A;  4CJ0 B;  4CDF C;  2Q2I A;  5C5M A;  1PFM A;  5M5W B;  1NY4 A;  2BH8 A;  2KQ3 A;  3RNU A;  4AYB E;  2KOL A;  4JI5 L;  1S5B D;  3HOZ B;  4A3I B;  2NVY H;  4HN7 A;  1DYQ A;  2OEO A;  1GM5 A;  3MZ5 A;  4C3H B;  3CF5 A;  1SYB A;  2H5X A;  5F2D A;  3VA7 A;  1Y8O B;  2GVB A;  4DUY Q;  1STG A;  4G7H C;  3ERS X;  2NUC A;  4OIJ A;  4JG2 A;  3V96 A;  1HR0 L;  3L7Z C;  4K6D A;  2X6L A;  1S40 A;  2B63 G;  2JXM B;  1R4P B;  2F0E A;  4KJO A;  2VW9 A;  1VQ6 A;  4FXK C;  5KYI A;  1Y69 U;  2Z0S A;  3H0G B;  4U68 A;  3G6E A;  1VQC A;  3S2D B;  2RSN A;  2UUC Q;  1K28 A;  3HOX G;  3OW7 A;  4KI0 A;  5C4X B;  3UE0 A;  1XPO A;  3HKZ G;  2VUM H;  3C2P A;  3SEB A;  4ID6 A;  3CHB D;  5ELB A;  5IYD G;  2NTT A;  2L12 A;  5FKA C;  3PO2 B;  1JOK A;  1RDP D;  3RLN A;  2R93 G;  3STB C;  1QUQ B;  3QWN A;  1RHP A;  1KDA A;  4JI8 L;  4HIK A;  2M2L A;  3I8Z A;  1I6H H;  2DJG C;  3CCU A;  1N36 Q;  3GTQ H;  4DUZ L;  4MTK A;  3F8T A;  1FGU A;  3OHX C;  3CPW A;  1XYI A;  1GOZ A;  2EPB A;  3A0J A;  5FO8 B;  2C35 B;  4AYB G;  3U9O A;  5JVG 3;  1Q8I A;  4B3T Q;  5C4J B;  5I9P A;  2IHE A;  4KKS A;  3TEH B;  4DR7 L;  5E3F A;  3KUP A;  3TSS A;  2IL8 A;  1BNZ A;  4FF4 A;  1LTS D;  3TZU A;  1PYW D;  2JA7 G;  4BY1 G;  1L0W A;  2A6E C;  4BBR H;  4A3K G;  4LF4 Q;  1W6J A;  4ZRZ A;  4Y52 H;  1S5F D;  2YTY A;  1SEB D;  5CR3 A;  2WKD A;  4CBV A;  4A93 H;  1PFB A;  3I3C A;  1ASZ A;  1J9O A;  1TWH H;  1HH2 P;  2JJQ A;  1O7L A;  1A6X A;  1LO5 D;  3VA5 A;  3SK5 A;  5HGT A;  3I4M B;  2PW5 A;  1KLU D;  1WD1 A;  2E2J B;  3GTK B;  1Z9F A;  2KUM A;  2K28 A;  1AW7 A;  2E74 C;  2JP1 A;  4JV5 Q;  5JJL A;  1G8Z D;  1WCM G;  2ZJR A;  1SJH D;  3ERO A;  2NVQ B;  4TSS A;  3KLW A;  4GOP C;  5G3L F;  5C44 G;  2BA1 A;  2KEN A;  1DCZ A;  4X66 L;  3S1M B;  4WFN 3;  4X3U A;  5C0X G;  1Z47 A;  2XRQ D;  1FD7 D;  2DY8 A;  5EPL A;  2L5T A;  4YY3 Q;  1U4R A;  4LF8 L;  2JA6 H;  3HOV B;  2Z8L A;  1PH7 A;  1MJE A;  3OIQ A;  4KHV A;  1YJN A;  4G4K A;  2JE6 I;  4FVM A;  5CV5 A;  4POF A;  4MN3 A;  5DAU A;  3PUW A;  1B8A A;  2Z4H A;  3K5M A;  4A3J H;  1KIX A;  2FMC A;  1IW7 D;  4IPH A;  1Q81 C;  1LTR D;  4DK6 C;  2XWB B;  3C1E A;  2BA0 A;  2XTI A;  3SK4 A;  2MHV A;  4B3R L;  3J7A 5;  1LTG D;  2JA8 B;  2CW0 C;  4J1M A;  3T13 A;  3CME A;  2R7F A;  4IFD I;  1B50 A;  3P7J A;  4OWX B;  1TQO A;  2FXQ A;  4EVO A;  4DV2 L;  2UU9 L;  1YHB A;  3S14 H;  3QG1 A;  2UXD L;  1FNU A;  4DUY L;  4K5V A;  5M3M B;  1PV4 A;  2D2C C;  1EWC A;  4OHJ A;  1Q3L A;  1AH9 A;  5IT9 c;  2WP8 J;  4PV1 C;  5JJZ A;  1JJG A;  1VQO A;  2XVS A;  3H3V H;  4A3L H;  3K81 C;  1NAP A;  1HJP A;  3H3V I;  2SOB A;  2WFW A;  2K14 A;  1YHQ A;  1EFI D;  1F9S A;  3SVM A;  1EUJ A;  1TWF B;  4MZ9 A;  3HOZ G;  4A3I G;  3KFU A;  2PZW A;  4X3S A;  1TWC B;  3ND9 A;  4IJH A;  2BDO A;  1C0A A;  1VQN A;  3E6Z X;  1W2B A;  4JI3 Q;  4C3H G;  4HCS A;  2EOT A;  4AQY Q;  2ZJP A;  4X65 Q;  2KCT A;  1X9N A;  1EWI A;  1PH5 A;  1QZG A;  4RGM A;  4L6T B;  4LK1 C;  1UEA B;  1XTD A;  3J81 E;  2K33 A;  2UXB Q;  5I6W A;  1HNW Q;  2RKS A;  1C8C A;  4UY8 C;  2L55 A;  4YIJ A;  1EOV A;  4R4C A;  4HJ7 A;  5GAH C;  5LMU Q;  1ENC A;  5ELD A;  1CQV A;  4WRD A;  4F7X A;  2CKZ B;  2WIN B;  2ALY B;  3H0G G;  4NXN Q;  3S15 H;  2E2D C;  4X62 Q;  1VMC A;  3DEP A;  4L63 B;  5C4X G;  4LF6 L;  2TMP A;  2K5D A;  2I46 A;  3AFQ A;  1NSN S;  5C6A A;  1HRJ A;  1F2M A;  5JEA J;  4BXX G;  4OEM B;  5IGD A;  1PMR A;  3NTI A;  1JOR A;  3HZX A;  4PMB A;  1OXT A;  1KDC A;  2X69 A;  4LF7 Q;  4DXG A;  3RZD B;  4BY7 B;  1SMY C;  2K5Q A;  2GVA A;  4ZCK A;  5EBC A;  1VDZ A;  3J7A V;  3KOJ A;  1I4Q A;  4K2L A;  1EYG A;  2I5L X;  4B3M Q;  2EY6 A;  4JYA Q;  4DAM A;  1VQL A;  3CCL A;  2UUB Q;  1SNM A;  5FLX c;  3H3V C;  2QIL A;  5E4X A;  4DK0 A;  3EIV A;  3L9A X;  4DV0 Q;  1O78 A;  2FJ2 A;  5M9O A;  4MIU A;  1BCP F;  4KTA A;  5LMN Q;  2EYM A;  3G6J B;  1WTP A;  2RF4 A;  3TRZ A;  1SR3 A;  3KF8 A;  4AH6 A;  3FRP B;  4QCL A;  5C0X J;  2ZJQ A;  1EY7 A;  4CDD C;  1JIC A;  3DXJ C;  1F9Q A;  1ILP A;  1S72 A;  4OO1 H;  2NVX B;  1DOL A;  5DM6 3;  2SEB D;  2AWN A;  2F0L A;  3EQL C;  5C3E B;  1HZ9 A;  1U4L A;  1V1O A;  1KNA A;  2RQX A;  4MTN A;  3VR2 A;  4YHH L;  1SRO A;  1I94 Q;  1OXV A;  4XIG S;  2BOS A;  3RZO H;  3I56 A;  1SYE A;  3RMH A;  2A5H A;  1FL0 A;  4NMZ A;  2F52 A;  1SE2 A;  3I90 A;  2A68 C;  1TII D;  1HFG A;  5IP9 H;  4GKK L;  1Z6H A;  2R7Z H;  4CKC A;  1D7Q A;  1TWA B;  2A69 C;  3I4M G;  5IGB A;  3DLL A;  3PQI A;  5KRU A;  2B2T A;  1X6O A;  1IKM A;  3K59 A;  2HHH L;  1PRT F;  2F0H A;  4WJ4 A;  4N8F A;  4HJ5 A;  1TS4 A;  4KV6 A;  5I2X A;  2Z1C A;  3VR3 A;  3KLR A;  1HA6 A;  4DR6 L;  3F2U A;  2JEB I;  1EIH A;  1QNK A; 
#chains in the Genus database with same CATH homology
 1A3U A;  1GHJ A;  1R9T B;  1PDQ A;  2DY7 A;  2RBM A;  3OOC A;  1U9R A;  5A2Q E;  3I4N B;  4S3S A;  1B4O A;  4IUR A;  4C1N I;  1PZI D;  4FO2 A;  2F0I A;  2K03 A;  4C1N K;  1G2S A;  5IOC A;  3PUX A;  1EY5 A;  4RKL A;  1GUO A;  1OXS C;  2C5C A;  2ICI A;  5KEE A;  3NP8 A;  4DAP A;  5M5X B;  1NR2 A;  3WDN A;  3VR6 A;  2FIN B;  2R61 A;  3LNN A;  4UDU C;  3TN2 A;  4G7Z C;  3MTS A;  1A3V A;  4RHS A;  2VB3 X;  2A74 C;  1STE A;  4KJN A;  1D6E C;  3RUZ A;  3OMC A;  3H94 A;  1KLG D;  3TP5 A;  5CV8 A;  4DNR B;  1CK1 A;  4C2M B;  3M85 A;  1U4M A;  1DJR D;  5D14 A;  2AWO A;  1MSG A;  1TY2 A;  1RCV D;  4NDX A;  4XQQ A;  1B1Z A;  3Q24 A;  5ISR A;  5JPN C;  1PZK D;  1MSH A;  4KY6 A;  2XWJ B;  2KJX A;  3HG9 A;  4BA2 I;  3IKJ A;  3NBI A;  3PUY A;  3N6R A;  1ENA A;  1EEI D;  3FDT A;  4JK1 C;  4ZLT F;  4RCN A;  3NQI A;  1WTR A;  3BS1 A;  3GTP B;  2EDG A;  3D3R A;  1SE4 A;  3IFD A;  2IT1 A;  4I65 A;  5M3F B;  2G9D A;  2HDL A;  3KK7 A;  1G91 A;  1SFO B;  3AMU A;  1DZ1 A;  3ERQ A;  1C48 A;  3I70 A;  2D9U A;  5COR A;  3KBG A;  3R2T A;  2F0P A;  4XXE A;  1QJO A;  3K5O A;  1LAB A;  2OT2 A;  2F4I A;  3NXW A;  3K5L A;  1AP0 A;  1G6Z A;  4ZYS A;  2NVY B;  1QNU A;  1ML0 D;  1YNN D;  3JAM L;  3PUV A;  1H9M A;  1HXY D;  2K1B A;  3BG3 A;  3VR4 A;  1OXX K;  2KCN A;  3EFX D;  3MHB A;  2XRS D;  3I91 A;  1T5E A;  3CRK C;  2B8G A;  1BCP C;  5E1F A;  3A7A B;  2BE5 C;  2J7Z A;  4ZUJ A;  2JSO A;  4DN4 M;  1CQF A;  5LL6 S;  1QCB D;  1B9N A;  4PMW A;  2VUM B;  2GA4 B;  1GHK A;  3P1H A;  1DM0 B;  3OSO A;  1I4H A;  1RD9 D;  1SNQ A;  1HQM C;  5T1G A;  4LAA A;  5JOB A;  2RVL A;  2K32 A;  3D6C A;  4ZAI A;  3GO5 A;  2J4X A;  4E6I A;  2E2H B;  1IYU A;  1X3P A;  1STA A;  4KKU A;  4FP5 D;  3T16 A;  3GTQ B;  4HED A;  2A6H D;  2IJ0 A;  4NW2 A;  1A3T A;  1GXD C;  1PRT C;  3D31 A;  1BXT A;  2EYP A;  1HUN A;  2MJ8 A;  5AFW A;  4BBR B;  2L9H A;  3HRZ C;  4DFA A;  2PYK A;  2EY2 A;  4B08 A;  3FVQ A;  2L0C A;  2VXW A;  1VCI A;  4A93 B;  4K2K A;  3K57 A;  1YNJ C;  4FYD A;  2V4D A;  5ELF A;  2F0J A;  3A54 A;  4Q5V A;  1KNE A;  3FPU B;  2Z4I A;  3J7A F;  3ITP A;  3NWT A;  4ZK9 B;  3IL8 A;  1D5X C;  4ZKB B;  2XN9 C;  3T4A C;  1SYC A;  2F1M A;  4KD4 A;  3UI2 A;  4X3T A;  4WJW A;  2E75 C;  5C0X I;  2EYF A;  5KNC A;  2O4X A;  5DM7 3;  2JA6 B;  2VNU D;  1WVL A;  2NN6 G;  3H09 A;  4F8M A;  3ONA B;  2XIW A;  2HCC A;  1LAC A;  5K36 G;  3QOL A;  5KIX A;  4RH6 A;  3MFY A;  4JBW A;  2B2Y A;  3I4L A;  3Q23 A;  5IT9 L;  3NQT A;  2N88 A;  1B2T A;  2EYO A;  5IOD A;  2IPK D;  1ZYR D;  4EQO A;  1WTQ A;  2K6A A;  2SDF A;  4QIW B;  5JEA G;  2XSC A;  1ZKO A;  2E76 C;  4RHR A;  1I4R A;  4IUT A;  1HFN A;  2B2W A;  1RF2 D;  3NE5 B;  1S5D D;  4ME5 A;  4BWG B;  1EQV A;  2FMM A;  4IQZ A;  5EKL A;  3KLS A;  3VYU A;  1B53 A;  2KED A;  1EY6 A;  1WTW A;  3CKI B;  1TY0 A;  4CJ1 B;  3K6O A;  5FO7 B;  1V1P A;  4UAI A;  3R2I A;  5JVH 3;  1OXU A;  4Q0F A;  4ILW A;  1UAP A;  4DXF A;  3K5N A;  3BZD B;  2I07 B;  4CGY B;  4XYO A;  2ICE C;  3A8I E;  1LV9 A;  1IYV A;  1JWU D;  1I4P A;  1JCK B;  5FLX L;  5TSS A;  3NUC A;  2MP1 A;  4XT3 B;  4HSP A;  2K01 A;  3NSW A;  2F0W A;  1O80 A;  4KMU C;  1SNO A;  4IFD H;  5ELE A;  5EPJ A;  4HMJ A;  3P20 A;  3NTK A;  2WAQ B;  3A8K E;  1BDO A;  1ICW A;  1Q90 A;  3M4O B;  2CVR A;  4HTH A;  4O1N A;  1STY A;  4RA8 A;  4PNY A;  2D5D A;  2HDM A;  2B2U A;  4ODG A;  4U67 3;  1ZEQ X;  3K0Y A;  1ONL A;  4K5X A;  2TSS A;  4C3J B;  3TZD A;  2F0G A;  3J7Y W;  1X3Q A;  1KTK A;  1V43 A;  5LL6 X;  5IIF A;  1L0X B;  1W6K A;  3AU7 A;  3HGB A;  1DOM A;  2B2Y C;  3OWF A;  3V05 A;  3RZO B;  3NBH A;  1WTX A;  4HCE A;  5CBE E;  5CV6 A;  1J8I A;  5CV7 A;  1TR5 A;  1DD2 A;  2R7Z B;  3I72 A;  4HSV A;  1M4V A;  2PQE A;  3GD7 A;  1LT5 D;  1LTA D;  3QJY A;  3DM1 A;  1AFP A;  5J22 A;  2B2W C;  3ZYY X;  1LLR D;  4FF2 A;  2F0K A;  1F77 A;  3MXG A;  2XNA C;  2IX3 A;  4ZKC B;  2RDH A;  1RTO A;  5I2Y A;  1LT4 D;  1SE3 A;  4CKB A;  1FGB D;  2C9O A;  5E4W C;  1ET9 A;  5KND A;  3VYR A;  4RGT A;  4DAV A;  5C3X A;  1CT1 D;  3GTM B;  2QF7 A;  3K7A B;  1LT3 D;  1JWM D;  3MAQ A;  1Y1V B;  3J80 L;  3SK6 A;  1EYA A;  3LWU A;  1Q12 A;  2WAC A;  4L8J A;  2MGS A;  1QE6 A;  1CA6 A;  5A35 A;  5DEH A;  1CM9 A;  5C4H A;  3LWE A;  4MHE A;  4A3M B;  1B9M A;  1QB5 D;  1SJE D;  2ZXR A;  1IW7 C;  2SNM A;  1T5X D;  2NWG A;  1CI3 M;  3M4Y A;  3QO2 A;  4KK7 A;  1IHZ A;  1Y8N B;  4Y7N B;  2YYZ A;  1PTO B;  4K6L A;  1SYD A;  2LMC B;  4BA1 I;  4RKB A;  5JAV A;  3PIP 3;  1II3 A;  2B2U C;  2YU9 B;  1CHP D;  4DU9 A;  2SNS A;  4FF1 A;  2NZ1 D;  3PV0 A;  1S5E D;  1SAP A;  1ILQ A;  3T53 B;  1I50 B;  1E0B A;  4TKO B;  3MA2 B;  2EJG C;  4IUU A;  1HQR D;  4P2C B;  3S9W A;  4K5W A;  2PO4 A;  3VR5 A;  1PTO D;  4IUN A;  3HOW B;  2R92 B;  4N9T A;  1PXU A;  4KHZ A;  3QB3 A;  1HTP A;  3PMF A;  1JC7 A;  4DGZ A;  3GTL B;  1PRT B;  2L4N A;  3O13 A;  4RWS C;  1HTL D;  1LT6 D;  2F0M A;  4C56 C;  1B3A A;  5EBD A;  2EYH A;  4FF3 A;  3Q22 A;  2PZT A;  2HQE A;  4TRD A;  2NYZ D;  1TWG B;  3MEH A;  2F0U A;  2B2V C;  2PW7 A;  1Y8P B;  3G7L A;  4C3J G;  2F0N A;  3EJI A;  1PZJ D;  4QB4 A;  4V19 0;  4OO1 G;  2F0F A;  1XWE A;  3BDL A;  3A56 A;  4H7B A;  2KHS A;  4ULL A;  2EJM A;  3MXN A;  3HOX B;  4CJ2 C;  3A8J E;  4BBS B;  4IUP A;  4M1U B;  4N9P A;  2QKI C;  4KKT A;  3L3O C;  1X32 A;  2FHT A;  4DK1 A;  3PUZ A;  3T51 B;  5C5L A;  1GUN A;  1F9P A;  2F3V A;  1H9R A;  2R3Z A;  3FEW X;  3N52 A;  5KNB A;  4IFD J;  1NCV A;  3WOE A;  4QUC A;  1E2W A;  2AQ2 B;  4IN3 A;  1V8Q A;  3HP3 A;  3H6M A;  5HUR A;  1EIG A;  3BDC A;  1O7Y A;  2BCO A;  1BBX C;  1MBY A;  1HHV A;  2ZXP A;  1LTB D;  2PMZ B;  1DON A;  1QIL A;  2ID0 A;  4F87 A;  5IGE A;  2MUY A;  3Q0A A;  3NTH A;  4DF7 A;  4K8I A;  1D2B A;  4RCO A;  4XDX A;  2F0O A;  3GQB A;  5EQ0 A;  5DNF A;  3J80 E;  2RDF A;  3P75 A;  4K8J A;  4I7Z C;  2HCI A;  3DWA A;  3R3O A;  3M3Y B;  1U4P A;  2EVB A;  1MI2 A;  2RDG A;  1RJT A;  1G2T A;  2AQ3 B;  2PCF B;  3S1Q B;  1EY4 A;  1UUP A;  1Q1B A;  2WKC A;  3M7G A;  3OPO A;  4Z9C B;  2NN6 H;  2A6E D;  1I6H B;  3D4D A;  2NN6 I;  5K36 H;  2Y0S B;  4G57 A;  5IGG A;  2PPB C;  4RFB A;  3X3N A;  2X6G A;  3M7N A;  1K8O A;  1F2Y A;  2LFN A;  1TU2 B;  2EYL A;  4KY7 A;  4QF4 A;  3V2T A;  1JR0 D;  1TS3 A;  2EY5 A;  2LKV A;  1G29 1;  5CC4 A;  4XTC S;  3AB9 A;  2KCC A;  1D5Z C;  3HS0 C;  1GUW A;  1CA5 A;  2R6G A;  3MXP A;  1EQT A;  5CMD A;  4DA2 A;  2HUG A;  1TT2 A;  3WOF A;  1S5C D;  1EY9 A;  3TP7 A;  1WD0 A;  1D1I A;  5CV4 A;  2PZU A;  2Q8T A;  3BVG A;  3R8B A;  3DEO A;  3SXH A;  2F0T A;  1TWH B;  4ZUI A;  3J81 L;  3NPP A;  1JOQ A;  3HOU B;  3TP6 A;  1ESF A;  3S2H B;  3A7L A;  1LTT D;  1E2V A;  4ZQ3 A;  1H9S A;  1OO9 B;  3LX0 A;  4K14 A;  2CW0 D;  2KA7 A;  5C0X H;  5CGK A;  2FFK B;  5EPK A;  1SBB B;  3GP7 A;  3ND8 A;  3MWY W;  4HR7 B;  3VYS A;  1Q1E A;  3OMG A;  2H4O A;  4TQU S;  3BYT B;  1EYD A;  1ENF A;  1YNN C;  2EY1 A;  1NUC A;  4A3J B;  1NR4 A;  1DOK A;  3TP8 A;  3DUZ A;  5M5Y B;  1GUG A;  3PIO 3;  3BVM A;  4EQN A;  4GZY C;  1TS5 A;  3IFT A;  3QIA A;  1ESR A;  4FXG C;  5FK9 C;  3SHL A;  1BQQ T;  3S14 B;  2IW3 A;  1TS2 A;  3BYY B;  2OF1 A;  3D4W A;  1HA5 A;  5T1I A;  1V1P B;  3MFG A;  1A2U A;  4QMG A;  1STN A;  1JWS D;  2F0S A;  1QOH A;  2IX0 A;  3D8G A;  5FO9 B;  2EYJ A;  3GV6 A;  1EEF D;  4RGO S;  2B39 A;  2N55 A;  2A6H C;  4HAE A;  1EY0 A;  1SYG A;  4F88 A;  4QUF A;  4OGQ C;  5BN4 A;  5C3W A;  1SMY D;  4IUV A;  5D65 A;  1I4X A;  2B8F A;  4G7O C;  3JAM E;  3S1R B;  1CTM A;  1JB3 A;  4OIK A;  3QOJ A;  3H91 A;  3S15 B;  3GTJ B;  3D6W A;  4ABN A;  2QEJ C;  2NTS A;  4H44 C;  1BF4 A;  1I4G A;  1E2Z A;  2EJF C;  5A2Q L;  3GTO B;  2ENB A;  5I4D A;  1UNS A;  4BS9 A;  4R8N A;  3C46 A;  4B9W A;  4XT1 B;  3KBX A;  4NP5 A;  4RAU C;  1SSO A;  2IWH A;  1H9J A;  1IL8 A;  1MD2 D;  2A68 D;  2Q8I B;  2BDN A;  3EA6 A;  2A69 D;  3S17 B;  2K7V A;  3X3M A;  4IAL A;  1O7Z A;  1QG7 A;  2RSO A;  1VF7 A;  1ZXT A;  5KYL A;  3Q6S A;  3FPP A;  4CHT B;  1A15 A;  4X3K A;  3MC0 B;  1L0Y B;  1S4Z A;  3S16 B;  4J8Q A;  5G3L D;  3GTG B;  5IGF A;  1ZYR C;  5EKK A;  2NVT B;  3CQZ B;  1PFN A;  3EVQ A;  3C3L A;  1CZG A;  3DHQ A;  2L1B A;  1QWY A;  1H9K A;  1C4Q A;  1EZ8 A;  4A3E B;  1A2T A;  3URY A;  4DNT B;  4B9X A;  2M9V A;  1AZP A;  1IKL A;  1EWH A;  3BDO A;  5I6Y A;  2CHB D;  5D3D A;  1EU3 A;  2B2V A;  4C3I B;  5J39 A;  2G9H D;  1SYF A;  5BN3 A;  3RD4 A;  1AZQ A;  4A3D B;  1MGS A;  4J6H A;  3FKI B;  1EU4 A;  2MPM A;  3DMU A;  1VMP A;  1Y1W B;  2WV6 D;  1EL0 A;  2F0Q A;  4FNF A;  4WOR A;  4IFD G;  4IUQ A;  1AEX A;  3DWQ A;  2EZV A;  1D5M C;  4A3G B;  3TBI B;  5IT9 E;  3VYT A;  3K58 A;  2ZT9 C;  4CKE A;  1PTO F;  2E2I B;  2WB1 B;  3U9S A;  2KVM A;  3TDQ A;  1SND A;  1TKW B;  3A55 A;  4LJZ C;  2JEA I;  2O2L D;  5CYU A;  2O5I C;  1VF5 C;  2L11 A;  4KD3 A;  1LTI D;  1M8A A;  5D3I B;  1D1K A;  4KN4 C;  4RGN A;  3GV3 A;  4NKL A;  4OO1 I;  3PO3 B;  2KEC A;  5C4Z A;  1K8M A;  3HOY B;  1BO0 A;  4A3B B;  4PQX A;  1EOT A;  2J0T D;  3OWE B;  4A3F B;  4XQN A;  1SNP A;  2NB0 A;  2AUK A;  1I3Q B;  1BCP B;  2JA5 B;  4H13 C;  3MXU A;  2WII B;  1TVX A;  2QCP X;  3SE0 A;  5CBA E;  5JPM C;  2JYO A;  1HCZ A;  3FMC A;  3E0J A;  3I73 A;  1SDF A;  1EY8 A;  1FR3 A;  1HPC A;  3R93 A;  2EXZ A;  5FLX E;  2CQA A;  5EGT A;  1B44 D;  1XTC D;  1JE4 A;  1ROD A;  1BCP D;  5NUC A;  1SNC A;  1WTO A;  3SK8 A;  2BE5 D;  2F0D A;  4FXD A;  2VB2 X;  2PNR C;  1GUS A;  4H0L C;  2F3W A;  3NWS A;  2O5J C;  1GJX A;  2B63 B;  5LHY 1;  1EZ6 A;  5KGU A;  1KAB A;  3RLF A;  4O42 A;  4R9W A;  5EKI A;  3MVV A;  3HEJ A;  5EJW A;  2K5W A;  1RTN A;  1R4Q B;  1F2L A;  1PLF A;  3HKZ B;  1STB A;  1FNV A;  3W3A A;  2LY7 A;  5COY A;  1PRT D;  1WTV A;  1F9R A;  4XQJ A;  2D62 A;  2ZXO A;  2H1E A;  3NHH A;  2R93 B;  5ELC A;  1XXG A;  2F03 A;  2RA4 A;  1PTO H;  4HMI A;  1KAA A;  4EGV A;  2KEE A;  3E5S A;  5FOB B;  1K83 B;  2K04 A;  1YNJ D;  3CRL C;  1BR9 A;  4AYB B;  4C3I G;  2DNC A;  2A73 B;  3SDZ A;  3IAY A;  3SR1 A;  1GUT A;  1FYC A;  4R8I A;  2M00 A;  2F0V A;  2JA7 B;  4BY1 B;  4IZ8 A;  2AUJ D;  4A3K B;  3DWP A;  2LS0 1;  2K05 A;  5CV9 A;  1RKN A;  1HUM A;  1XX8 A;  4DAY A;  4XYQ A;  2B2T C;  3NK9 A;  3T56 B;  2AQ1 B;  5J1Z A;  3CU7 A;  1CHQ D;  1F2Z A;  4M8A A;  1CFM A;  1WCM B;  3D4R A;  1SXT A;  2IX1 A;  4KN7 C;  1DXM A;  5C44 B;  5I9O A;  1PTO C;  3BVZ A;  2OXP A;  4OL7 A;  4PMC A;  1Z7T A;  1ET6 A;  1CZW A;  2DNE A;  2Q8R E;  1JOO A;  1STH A;  4EQP A;  4KY5 A;  1EYC A;  1AN8 A;  2QDB A;  5IGC A;  1FNW A;  3OIP A;  3TME A;  5JEA H;  4LMQ D;  3W2D A;  1BOS A;  1KDB A;  1BUV T;  3C1F A;  3KLS X;  3S1N B;  5K5P A;  1I6V C;  4V0B A;  1JQY D;  2NBF A;  2EE1 A;  5BN5 A;  1H9S B;  2DN8 A;  4CJ0 B;  5C5M A;  1PFM A;  5M5W B;  2KQ3 A;  2KOL A;  1S5B D;  3HOZ B;  4A3I B;  4HN7 A;  1DYQ A;  2OEO A;  3MZ5 A;  4C3H B;  1SYB A;  5F2D A;  3VA7 A;  1Y8O B;  1STG A;  4G7H C;  2NUC A;  4OIJ A;  3V96 A;  3L7Z C;  4K6D A;  2X6L A;  2JXM B;  1R4P B;  2F0E A;  4KJO A;  4FXK C;  5KYI A;  1Y69 U;  3H0G B;  4U68 A;  3S2D B;  2RSN A;  3OW7 A;  4KI0 A;  5C4X B;  3C2P A;  3SEB A;  4ID6 A;  3CHB D;  5ELB A;  2NTT A;  2L12 A;  5FKA C;  3PO2 B;  1JOK A;  1RDP D;  3QWN A;  1RHP A;  1KDA A;  2M2L A;  3I8Z A;  3OHX C;  1XYI A;  1GOZ A;  2EPB A;  5FO8 B;  3U9O A;  5JVG 3;  1Q8I A;  5C4J B;  5I9P A;  4KKS A;  5E3F A;  3KUP A;  3TSS A;  2IL8 A;  1BNZ A;  4FF4 A;  1LTS D;  3TZU A;  1PYW D;  2A6E C;  1W6J A;  4ZRZ A;  1S5F D;  1SEB D;  5CR3 A;  2WKD A;  4CBV A;  1PFB A;  3I3C A;  1J9O A;  1O7L A;  1A6X A;  1LO5 D;  3VA5 A;  3SK5 A;  5HGT A;  3I4M B;  2PW5 A;  1KLU D;  1WD1 A;  2E2J B;  3GTK B;  2KUM A;  2K28 A;  1AW7 A;  2E74 C;  2JP1 A;  1G8Z D;  1SJH D;  3ERO A;  2NVQ B;  4TSS A;  5G3L F;  2BA1 A;  1DCZ A;  3S1M B;  4WFN 3;  4X3U A;  5C0X G;  1Z47 A;  2XRQ D;  1FD7 D;  2DY8 A;  5EPL A;  2L5T A;  1U4R A;  3HOV B;  2Z8L A;  3OIQ A;  4KHV A;  4G4K A;  2JE6 I;  4FVM A;  5CV5 A;  4MN3 A;  5DAU A;  3PUW A;  2Z4H A;  3K5M A;  2FMC A;  1IW7 D;  1LTR D;  2XWB B;  3C1E A;  2BA0 A;  3SK4 A;  2MHV A;  1LTG D;  2JA8 B;  2CW0 C;  4J1M A;  3T13 A;  4IFD I;  1B50 A;  3P7J A;  1TQO A;  4EVO A;  3QG1 A;  1FNU A;  4K5V A;  5M3M B;  2D2C C;  1EWC A;  4OHJ A;  1Q3L A;  2WP8 J;  4PV1 C;  5JJZ A;  2XVS A;  1NAP A;  2SOB A;  1EFI D;  1F9S A;  3SVM A;  1TWF B;  2PZW A;  4X3S A;  1TWC B;  3ND9 A;  2BDO A;  3E6Z X;  4C3H G;  4HCS A;  2EOT A;  4RGM A;  4L6T B;  4LK1 C;  1UEA B;  3J81 E;  2K33 A;  5I6W A;  2RKS A;  1C8C A;  2L55 A;  4YIJ A;  1ENC A;  5ELD A;  1CQV A;  4WRD A;  4F7X A;  2WIN B;  2E2D C;  1VMC A;  3DEP A;  4L63 B;  2TMP A;  2K5D A;  2I46 A;  5C6A A;  1NSN S;  1HRJ A;  1F2M A;  5JEA J;  5IGD A;  1PMR A;  3NTI A;  1JOR A;  3HZX A;  4PMB A;  1OXT A;  1KDC A;  2X69 A;  4DXG A;  3RZD B;  4BY7 B;  1SMY C;  2K5Q A;  5EBC A;  1VDZ A;  3J7A V;  1I4Q A;  4K2L A;  2EY6 A;  1SNM A;  3H3V C;  2QIL A;  5E4X A;  4DK0 A;  3L9A X;  1O78 A;  2FJ2 A;  5M9O A;  4MIU A;  1BCP F;  4KTA A;  2EYM A;  3G6J B;  1WTP A;  3KF8 A;  3FRP B;  4QCL A;  5C0X J;  1EY7 A;  1JIC A;  3DXJ C;  1F9Q A;  1ILP A;  4OO1 H;  2NVX B;  1DOL A;  5DM6 3;  2SEB D;  2AWN A;  2F0L A;  3EQL C;  5C3E B;  1U4L A;  1V1O A;  1KNA A;  2RQX A;  3VR2 A;  1OXV A;  4XIG S;  2BOS A;  1SYE A;  3RMH A;  2A5H A;  4NMZ A;  1SE2 A;  3I90 A;  2A68 C;  1TII D;  1HFG A;  1Z6H A;  4CKC A;  1TWA B;  2A69 C;  5IGB A;  5KRU A;  2B2T A;  1IKM A;  3K59 A;  1PRT F;  2F0H A;  1TS4 A;  4KV6 A;  5I2X A;  2Z1C A;  3VR3 A;  3KLR A;  1HA6 A;  3F2U A;  2JEB I;  1EIH A;  1QNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...