1HTLD

Mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Mutation of a buried residue causes loss of activity but no conformational change in the heat-labile enterotoxin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1995-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1htlD00
3BYYB 3BYTB 5ELCA 1RD9D 1SXTA 1DYQA 3EFXD 2WV6D 1T5XD 4L63B 4RFBA 2XNAC 1ET9A 3MC0B 1XTCD 1CHPD 1EEFD 1QILA 4RH6A 1PRTF 1HQRD 1PYWD 3MFGA 5I4DA 1S5FD 1AN8A 1MD2D 1G8ZD 1LTBD 1S5DD 4O1NA 1SJED 2RDGA 1FGBD 1LT5D 4TSSA 1V1PB 3BVZA 2QEJC 3CHBD 1B1ZA 3R2IA 3BVGA 1BCPB 2QILA 1D6EC 1CHQD 1CT1D 1JQYD 2XN9C 1GOZA 2Z8LA 1EWCA 4RHRA 3DWPA 1JWUD 3DWQA 1LTSD 2NTSA 4L6TB 1UNSA 1BCPD 5TSSA 1PTOF 1I4GA 1I4HA 1PRTB 1TY2A 1PZJD 4DXFA 4RGNA 1JCKB 1LO5D 2R61A 1SJHD 3V05A 1LTAD 1PZKD 1LTRD 2AQ2B 1JR0D 1L0YB 1BCPC 5ELDA 1TS3A 1PRTD 1B44D 1PTOH 2IJ0A 4RHSA 4RGMA 5D3IB 4RGOS 3TSSA 5ELBA 1FNVA 1CQVA 3SEBA 2AQ3B 1D5MC 1D5ZC 1XXGA 1ENFA 1LT3D 1SBBB 1EU3A 2G9HD 4ZYSA 1EEID 1S5ED 1PRTC 1LTTD 3DWAA 1S5CD 1PTOB 3OWEB 5ELFA 1JWSD 1KLUD 1TY0A 1AW7A 4DXGA 3URYA 4RGTA 3W2DA 1RCVD 1SE3A 1TS4A 4RCOA 4Z9CB 1STEA 1DJRD 1FNWA 4K6LA 5FK9C 1RDPD 1BXTA 1V1PA 2O2LD 2NTTA 1LTGD 5ELEA 1PTOD 1ESFA 1TS2A 1TS5A 2TSSA 1SEBD 3KLSX 1EU4A 1HA5A 4BWGB 2SEBD 1F77A 1FNUA 1V1OA 4UDUC 1ET6A 3R2TA 2IPKD 1FD7D 1RF2D 3O13A 1LLRD 1SE4A 1LT6D 1S5BD 1EFID 1PTOC 1I4PA 2AQ1B 1HTLD 2XRQD 1L0XB 1KLGD 5FKAC 2CHBD 1SE2A 4C56C 1PZID 2ICIA 1M4VA 2J4XA 1HXYD 3BZDB 1D5XC 1UUPA 1CK1A 5D3DA 4OHJA 3BVMA 3GP7A 1JWMD 2RDHA 3EA6A 1LTID 1BCPF 2XRSD 1I4QA 3R8BA 1KTKA 1I4RA 1I4XA 1LT4D
chains in the Genus database with same CATH superfamily
4OWTB 3BYYB 4A3BH 1SNMA 3CCEA 5IT9L 1XNQQ 2AHOB 2Q2HA 3T13A 3G48A 4KN4C 1Q12A 5KEEA 1HR0W 1MSHA 4RFBA 1ET9A 1VQGA 4LMQD 4DK6C 1J8IA 3QOJA 2EXZA 3KF8B 2H1EA 1VQHA 1EY0A 1HZBA 2SNMA 4A3KB 3U9OA 4DR5L 1S5DD 2K52A 4N9PA 1FGBD 1TVXA 4O0AA 4FF3A 4TSSA 4PNYA 2I0QA 4IUVA 3R2IA 2WKCA 4IPHA 2HDLA 2L12A 3KF6A 4JI1Q 5KYLA 4IFDG 4EGVA 2KA7A 3FKIB 4R4IA 5FLXE 2F0SA 3DWPA 4QGUA 4B3TL 5IGBA 1B53A 1H95A 1EQRA 2K32A 1SNQA 1BCPD 5JPNC 3CQZB 1SYDA 3F1ZA 4DPGA 5M5XH 2N55A 1MSGA 1EIHA 2E8GA 2XVSA 4J8QA 2J0TD 2JA8H 5E7NA 2AQ2B 2A68C 5C0XI 3C1EA 3S1RH 3HOWB 1SLJA 3FEWX 3HOYB 1A3TA 1QVGA 1EY5A 4OO1H 1D5ZC 5K36H 3RLFA 1A63A 4KI0A 4DV3L 3KJPA 1G6PA 3U9SA 4E6IA 1STNA 4C3JG 4XTCS 1SNDA 1JT8A 1K8AC 1DOMA 4GN4B 1VQ5A 4BXXG 1RCVD 2N49A 1CZWA 4RCOA 5C4JH 1B7YB 1OXUA 3K5NA 3E3XA 2OF1A 4HSPA 5J39A 4C3HH 1IHZA 3ITPA 2PQAB 4QIWE 1TS5A 4NDXA 4JVZA 2NVXB 3H3VH 2XTIA 3IFDA 2O5JC 5M5YH 1WTQA 1IW7C 3A74A 3O13A 5FLXc 1SE4A 1DM0B 4ZUJA 1S5BD 4A3JG 5I2YA 2EYOA 1EFID 3BDLA 1U4MA 1IBML 2B2WA 1WYDA 4DV5Q 5C3EG 2BDNA 3PUVA 1HCZA 3BZKA 2JA6B 2F0TA 2AMCB 4JW0A 5CORA 1HA6A 2E2HB 3PIP3 5LMUQ 3TP8A 1STHA 3BZDB 4C1NK 2JA5H 1X3EA 4IUQA 3L9AX 1GM5A 3S1QH 2PYKA 4WJ3M 1EYDA 5DM73 2K03A 1A62A 5C44G 4DR3L 3HOVB 2WB1G 5JPMC 1VQLA 3I70A 4CGYB 2E2JB 1R9TB 1I4QA 4WJWA 1CZGA 1Q81C 3NQTA 2X69A 4CDEC 4P73A 2WP8J 1M90C 2QDBA 1O78A 2MNAA 1OTCA 4GNXA 2KEEA 4WORA 1Q1BA 3M85A 1Y1VG 5IP7G 1PFNA 1TKWB 2EYJA 3K7AH 1C0AA 2F0HA 3H09A 1EWCA 1SMYD 2CKZB 3SVMA 3PUZA 1PH1A 2CCZA 3VYRA 3A0JA 4G7OC 4LF4L 4KD4A 2KQ3A 4NXML 1UE5A 3MEFA 4QIWB 2TMPA 1SJHD 2B2YC 2XGTA 3V05A 1LTRD 2I5LX 1TS3A 3GTGB 4KY7A 1QUQB 4A75A 2YV5A 4RHSA 4LF7L 4MTKA 4NPSA 2VXWA 2DJFC 3K5OA 1H9MA 4GZYC 3PO2G 1KDCA 1QVCA 1QWYA 1S5CD 1KLUD 3HP3A 3AEVA 5ELNA 3ER0A 2E2DC 3ND8A 2E76C 5CV4A 1NUCA 3S24A 4K6LA 1ENCA 3S15H 1ZYRD 2A74C 1IYUA 4L5RC 1YBYA 4LF6Q 4DR1L 2F1MA 4LFCQ 3EQLC 1UE6A 3MXNA 1EU4A 4IALA 4LF8L 4QQBX 2IPKD 1EOTA 2JA7G 4OELB 4CJ0B 4BBSB 1TWGH 1A0IA 5FKAC 4XXEA 1K83H 3J81L 3DHQA 4KN7C 1KNEA 2QCPX 2VQEL 1X55A 4APVA 2JSOA 1VMPA 4A3KG 2SDFA 1CKOA 3E0EA 4G7HC 4LNQA 4OHJA 1NMFA 4EVOA 1HZCA 3X3MA 2RA4A 3S17H 2GVAA 1I6HH 3CCQA 1G51A 5JEAJ 4FXGC 4AIMA 3NP8A 1IXRA 2JN4A 2PO4A 1YVCA 3FKIG 5C4XB 3QJYA 4V0BA 1SXTA 3H94A 1JOOA 2XWJB 3GO5A 4XQJA 2CWPA 3CD6A 2QGQA 1F9RA 2RSNA 4DR6Q 5DAUA 1HUNA 1PRTF 4HIMA 2KENA 3EBEA 3D8GA 4K8JA 1LTBD 2L11A 1IL8A 2K5VA 3CU7A 4X3TA 3V96A 4CKBA 2A69D 4OO1I 3BVZA 1X56A 4JI5L 1B1ZA 3VR3A 2PZUA 2YTVA 1JJGA 2XN9C 5E1FA 3HOYG 2R6GA 3HKZE 1HFGA 1VS0A 3GDEA 1HNZL 2AKWB 2LMCB 4DR4L 3HOXH 4DAMA 3A7AB 4DNIA 3H3VI 1VQCA 1Q8IA 1K8GA 2K50A 3M4OB 1GHKA 2C9OA 5ELDA 4B9WA 2ZM6Q 3L3OC 4A3IB 5T1IA 1XMQQ 1YNND 3J80L 1JORA 2RHQB 1BVSA 4NKLA 2R93H 2F52A 1CQVA 4FO2A 2AUJD 2B2WC 2G9HD 3PGZA 4GLAC 2L55A 2BA0A 4DNTB 2JA6G 2KCMA 2CW0D 2GN5A 3TS0A 3I3CA 3GTQB 1F9PA 4EQ5A 1QZGA 4DV2L 4RG1A 3TP6A 4YWMA 4C2MB 3J81j 1AE3A 1CKNA 2JP1A 3VDYA 1WTVA 4OX9Q 5IE8A 1ENAA 4IURA 3NWSA 4GS3A 5IP9H 1BBXC 1EIFA 2SNSA 1PH8A 3HOVG 1ET6A 3L0OA 1EYGA 1LT6D 4IZ8A 2E74C 1UE1A 4GNXC 1S72A 4H13C 1HUMA 1BUVT 2F0FA 4QJFA 5M3MB 5IYDG 4MN3A 4C56C 2ICIA 2E5LQ 5KNDA 1CK1A 1FGUA 2N3SA 2RCNA 4DUZL 3FPPA 2HCIA 2RDHA 5AJ3Q 4IPDA 3HKZB 5FLMG 4HIOA 3BDOA 4KTAA 4ALPA 2V4DA 1Q46A 4TQUS 4X64L 4B9XA 2EJGC 4G4KA 4DR5Q 2F0MA 3A8IE 3QIAA 2L5TA 1FL0A 1IBLL 1VQAA 2NUCA 3OW2A 4KHZA 4K0KQ 4IUNA 1W3SA 4A3LG 2H5XA 4IFDJ 1UAPA 4U673 1A8VA 4ZKBB 5M5XB 2L4NA 2QEJC 3CHBD 4DGZA 2JYOA 2G9DA 5AFWA 5E4XA 3VR2A 3F2BA 3PF5A 3BG3A 1HHVA 3T56B 1B9MA 1NJIC 4BBRB 2OEOA 4A76A 4L6TB 5BN5A 1ESRA 3KLRA 4BY1H 1GUOA 4L5QA 4DUYQ 1NR2A 1TY2A 1HNWL 3SR1A 1PZJD 4JI4L 2A6HD 2RHSB 3CC2A 3R3OA 1DCZA 3K0YA 5LMNL 3KDFB 1JJCB 1QE6A 4RKLA 3KF6B 2Q8TA 4KJNA 5I6WA 1AZQA 4FYDA 1Y8PB 4CKCA 3T1YQ 1ICFB 3AFQA 1FNVA 4MIUA 1D5MC 4C3HB 3GTMB 1EU3A 2UUAL 4BBSG 1STAA 4AH6A 3U4ZA 1F2YA 3CCMA 2X6LA 3HKSA 1HJPA 2FFKB 1N36Q 4BY7H 3NENA 4B3MQ 3S2DB 4YY3L 1LTGD 1PTOD 1NE3A 1HA5A 2NVTH 2JA5B 2PZWA 1C7YA 2K33A 1LLRD 3OPOA 4EQOA 3S1QB 5C4XG 2B3GA 2BCOA 1K73C 1GUSA 4DV0L 1PYBA 3GTKH 1FJGL 1Z9FA 1SNOA 1W2BA 1HXYD 3TRZA 3PUYA 2KUMA 4X3UA 1HQMC 2M9VA 3J7AF 3AFPA 5GROA 1SN8A 3QB3A 3NWTA 1QVFA 1QG7A 3MVVA 3GTLH 1C4QA 3K8AA 4DN4M 2WV6D 1T5XD 4KHPL 2XNAC 3MC0B 2HHHQ 1GVPA 1MBYA 4PG3A 1V1PB 4GOPC 1TWCB 3LNNA 1VMCA 3RN5A 4A3IG 1NAPA 3S16B 3J7ZC 3J7A5 1R4QB 4XQNA 4RHRA 4DR2Q 5COYA 2EVBA 4A3EH 3G6JB 1I6VC 1GXDC 2R92B 5NUCA 1HR0Q 2ICEC 3ULLA 5BR8L 2F3VA 1I94L 1PH4A 2FJ2A 3NTIA 3TP5A 4A3MH 1YNJC 3AYHB 1K0SA 2M00A 1XMOL 4A3DH 2R7FA 4DV7L 3K6OA 3SGIA 4OEMB 1JMCA 3STBC 1SNPA 2CH4A 1XNRQ 2AQ3B 1J5EQ 1XXGA 2KVMA 4FNFA 4TVAB 1EQVA 1X3GA 1IZ6A 2FHTA 5M3MG 2N8NA 1VQ9A 2UXBL 4LUZA 1TWGB 1PH7A 3UE0A 2Z0SA 3BS1A 1K83B 4N9TA 4HMIA 1ESFA 4OIKA 3AQQA 2QEXA 1TS2A 1PH9A 1XYIA 3Q0AA 2SEBD 3HKZG 1LTLA 4UDUC 2EYMA 1X54A 1WJJA 2MO1A 4EQPA 4JBMA 1SFOB 4TRDA 1NR4A 1IKMA 5IYCH 1U4RA 4LAAA 3S17B 4LF5L 4JYAQ 2XRQD 3UDGA 1SMXA 4F88A 1S40A 2CH4W 2EZVA 1SE2A 1Z47A 1RODA 2K5WA 1DZ1A 5GAEC 1M4VA 1SROA 4IUUA 2XIWA 2X6GA 4JI0Q 4JCVE 3EJIA 1ZXTA 1QNUA 4YWLA 5JJKA 1TWHH 2B2YA 2F3IA 4RCNA 3MXNB 1Q7YC 1KDBA 4DKAC 1HRJA 2BE5D 4NW2A 1TWFH 1SJED 2JJQA 2UU9L 4FF4A 4JI3L 4BBRG 3QO2A 1DYQA 1F9SA 2IL8A 4H0LC 5A2QL 1EY7A 1N32L 2DNEA 4JI5Q 2A8VA 1HQRD 5I4DA 1Q1EA 4OO1G 2D0OA 5K36G 3S1NB 4JI6L 2KECA 2F0UA 1LT5D 4YIJA 4DV4Q 3IKJA 3HOXB 3BVGA 3KYHC 1CT1D 1TT2A 4A3FH 2MQHA 3H0GH 1Q86C 3T1HL 1HTPA 4C3HG 2Q2UA 2JA7B 2EXDA 4XYOA 1VQIA 1UNSA 1Z6HA 2C35B 2PW7A 2OT2A 2R93B 1PRTB 3S14H 3P20A 4X3SA 4DA2A 3CP0A 1VDZA 2RQXA 1J6QA 3ULPA 1L0YB 2Z6BA 3RR5A 2O5IC 1BCPC 1VQDA 2K7VA 2WAQE 2F0NA 3E6ZX 1V8QA 4GN3B 3VR4A 5JJIA 5IGCA 1Q82C 3GD7A 4GKKL 1E3PA 2JA5G 5ELBA 3OHXC 2YU9B 1KHIA 1SBBB 5KGUA 1H9KA 1JB3A 1NTGA 3WOFA 1E24A 1OXVA 2NWGA 4DR7L 3OTOQ 5F2DA 5J1ZA 1JWSD 4K2KA 1SAPA 3PO3H 1EY8A 3W2DA 4Y52H 4NP5A 1WTPA 3GTPB 4MHEA 1F2MA 3DM3A 1Y8NB 3M4QA 3RUZA 3VYUA 3UDXA 1Y14B 3I4NH 1U4PA 2HDMA 3TZDA 1N8RC 4JBKA 4OONA 3CF5A 4JI8L 1EFWA 3I56A 4CDCC 2IT1A 1CTMA 4JV5Q 4OGQC 3E9IA 1CSQA 1VQ4A 4KY6A 4B3RQ 4YCVA 5IGFA 1QOHA 1U0LA 2QDLA 1WTWA 1BR9A 5M3FB 2ZXOA 2CQOA 4X64Q 1A3VA 1SYEA 2ALYB 1CKNB 1AE2A 1E2ZA 4LFBL 2MP1A 1L0WA 1UWVA 1PFBA 2AUKA 4UAIA 1I4RA 1GD7A 1EY4A 1B50A 4L5TA 1HZ9A 2EY6A 2K04A 3G6EA 2R92G 3QWNA 1VQBA 4RH6A 3PV0A 1F2LA 2PI2A 3CCJA 5KNBA 2WAQB 1C8CA 1PH3A 5JAVA 1E22A 5M5WH 3NEMA 5IT9E 2VB2X 2B63H 4JBJA 4P72A 2F03A 1Y1WH 1CHQD 1KL9A 2IHFA 2A6ED 4AYBG 1MGSA 5IWAQ 4DV1L 4Y7NH 5CV9A 5C0XJ 4CBVA 2EYFA 1X32A 3AB9A 2P5ZX 2HT1A 2DJGC 2NVQB 3NELA 5TSSA 2Z1CA 4DK0A 1K28A 3K5MA 1SMYC 1RL2A 2Q2IA 4RGNA 2KHJA 3W1BA 4X62Q 1L1OA 3S1MB 3RZDH 2NBFA 5EBDA 1A6XA 2PNRC 3RD4A 5D3IB 1A15A 1E0BA 3NTKA 4MTNA 5IODA 4LFAQ 3SEBA 2ZTDA 4IPCA 4JI7L 2NZOA 1GKHA 2OQ0A 1KDAA 2HIVA 5L37A 2BH8A 3Q6SA 1HNXQ 4KMUC 5I2XA 4YWKA 5ELFA 2NVTB 4X66L 2JE6I 4IO9A 4ME3A 5LHY1 3BJUA 1QJOA 2LS01 3A8JE 3UI2A 2O2LD 5IT9c 3GTKB 1TU2B 1A2TA 4XT1B 4P75A 3RLOA 4C3JH 1X3FA 1QNKA 3C3LA 1WTHA 4BXXH 4GKJQ 1MIUA 3JAML 1RHPA 2A5HA 4LF9L 3SDZA 3J7AV 2JA9A 1ZYRC 5H1SE 4KY5A 2ZTCA 4DAVA 2L9HA 3NBHA 4ZK9B 4HJ9A 1B3QA 1PZID 1AH9A 1D5XC 4ABNA 1ZKOA 2NN6H 1WTRA 3LWUA 2DY7A 4AQYL 3S2HH 1RJTA 2UUCQ 3HOXG 4CDFC 2FINB 3FHWA 5EJWA 4B3SL 1LT4D 4F8MA 2VQFQ 3D6CA 4HJ5A 5LL6X 3M3YH 4YHHL 3GQBA 1VQMA 2RSOA 2R93G 3HS0C 4HTHA 4A3EB 3JC66 1D2BA 1D1KA 5GAGC 2FMMA 1VQ7A 1N33Q 4JOIA 4X65Q 2O4XA 1JB7A 3GV6A 4IUTA 1D1IA 2UXDQ 1N34L 1K3RA 3T4AC 5BN4A 4BA2I 1D6EC 1JQYD 3GV3A 2YYZA 1IBKL 2D2CC 4A3MB 1SYBA 2QF7A 4JI2L 2NVYH 3DXJC 2A69C 4ZLTF 1PXUA 3HFZB 1LTSD 5IP9G 4LK1C 3E5SA 4RAUC 5LMNW 2K4KA 1YHAA 4UP9A 2UUBL 2NB0A 4FP5D 1STBA 4CJ2C 1KABA 3CC7A 3MAQA 3P75A 1PTOH 3OIQA 1DONA 3F2CA 4LJZC 4A93B 2M2LA 5FO9B 3RZOH 4RA8A 1X3PA 1YNNC 1C9OA 2B2UC 1AW7A 2EOTA 1YZ6A 4QMGA 1N9WA 1PH5A 4RGTA 3K81C 5M3FG 3NK9A 4GLVB 3RN2A 1I3QH 3I4OA 3PO2H 1GJXA 3PMFA 4ME5A 4C3IH 4LF5Q 2CW0C 1SNCA 2UXCQ 4UY8C 1EOVA 4GOPA 1F77A 5ELOA 2B8GA 4P71A 1EIGA 4BS9A 1O7ZA 5G3LF 3MXPA 3FP9A 2FMCA 3MZ5A 1TWFB 2WAQG 3F2UA 1XNQL 1JE5A 3M7GA 4FXKC 2ZJRA 2H4OA 1KRTA 2F4VQ 3PUXA 5IIFA 2DGYA 3J81E 1WTXA 1PMRA 3NBIA 3VYSA 1YI2A 2N78A 5GADC 1RF2D 2EY5A 1SRUA 2K1BA 5GAHC 2ENBA 2V1CC 5I9OA 4JI1L 3DM1A 2F0IA 4A3FB 3H0GB 1HH2P 1L1OC 1S5FD 5BN3A 4FVMA 2NZHA 5EKIA 4A3BB 2BOSA 3FKIH 4DV6Q 3T1HQ 1QCBD 3LGJA 5JJLA 3CMEA 1DXMA 2RBMA 3S14B 5C4HA 3ERQA 2ZXPA 2Z8LA 4CDDC 3G71A 4LUVA 1VQJA 1WTOA 4NXNL 1U5KA 3HGBA 4M1UB 3X3NA 4QUCA 1Q90A 2HD3A 1KAWA 1OXSC 1STGA 2K5DA 4K6DA 4R4OA 1O7LA 4I65A 3HOWH 4R8IA 4B3TQ 3P7JA 2I07B 4R4TA 2QA4A 3KLWA 3PO3B 3KOJA 4I7ZC 2PMZE 3J81c 1B44D 1IKLA 2A6HC 2FXQA 1EYAA 4BA1I 4R8NA 5EAYA 2JA8B 3N6RA 1PDQA 3TREA 1ENFA 4XT3B 2DUDA 1DGSA 2HIXA 3CRLC 2ES2A 4ZAIA 3S1RB 1B70B 2K6AA 2NN6I 3J80E 2D0PA 1Z7TA 1TY0A 1EIYB 1ZEQX 3M7NA 4QB4A 4UHVA 1VQEA 5C0XG 3K5LA 4DV5L 5FK9C 2B2TC 5DM63 5IYBG 1AP0A 5LMUL 3TEHB 4DV3Q 3PIOA 3GTOH 2JA6H 3C1FA 5C4JB 4XQQA 2RDFA 2PCFB 1B4OA 2PNHA 3KFUA 3A5UA 2ZXRA 1BDOA 1F9QA 1PTOC 1CA5A 3QOLA 3H15A 5M5YB 5C3WA 3G4SA 4JOIC 3HOVH 4A3EG 1XPUA 2R7ZH 5HURA 2E2JH 1R9TH 3OSOA 2EY2A 2JQOA 3KK7A 1MI2A 2IX0A 3T53B 1SYFA 3MHBA 1SR3A 3HG9A 4ILWA 1BCPF 1QUQA 1IBMQ 3CRKC 3H6MA 1T5EA 5CMDA 4A3MG 1W6KA 1NSNS 2B63B 3DMUA 3QG1A 1Y1WB 5T1GA 3CCSA 1RD9D 4AYBE 3EFXD 1TWAH 3SXHA 1Y8OB 2YTXA 4LWCA 3J80c 3IFTA 1CUKA 1KRSA 5FLMH 1CI3M 1XX8A 1MD2D 2PMZB 4DR3Q 1YHQA 4O1NA 5C3XA 1BNZA 4HIDA 1WCMH 1EQQA 1G2TA 4A3CG 1B9NA 3DLLA 1FVIA 3PUWA 3I2ZA 4A93G 3DEOA 2F0DA 5JJZA 1YITA 4KK7A 2IW3A 3OYYA 3K7AB 3I4MH 4EQNA 2B2VA 5J22A 1VQKA 2L1BA 5IYCG 3OW7A 3MWYW 1PZKD 3FPUB 2F0JA 5FJ8G 1IL2A 4N8X1 4QUFA 4N8FA 3BU2A 1PRTD 2K5QA 3TDQA 2CFMA 1IYVA 1EZ8A 2VY3A 2VUMH 2C5CA 5CV6A 4LF4Q 4NXMQ 5KNCA 1LT3D 2PW5A 4LF6L 4LFCL 1TIID 4ZYSA 1M1KC 1S5ED 1XJVA 2B39A 1ICWA 3Q22A 4GNXB 1H9SA 1L1OB 1SE3A 4KD3A 4KKUA 3V2TA 3EROA 2LSSA 3A55A 4LF7Q 2I5MX 4LW1A 5IOCA 2XSCA 4EX5A 3OOCA 4AYBB 1BBWA 3TS2A 3S15B 3EN2A 4HJ7A 1QZHA 1WD0A 3S2HB 3PIPA 5LL6S 3W1GA 4OWXB 1EY6A 4R9WA 4A3FG 3H0GG 3C2PA 4DR1Q 3PF4A 1BO0A 4A3BG 1PFMA 3TBIB 4LF8Q 5C4XH 3M3YB 1PLFA 2R7DA 4R4CA 1LTID 2K5NA 1EWIA 3HOZH 2XRSD 5C5LA 1AFPA 1SYCA 1KTKA 2VQEQ 1I4XA 1PHJA 1I50H 1UE7A 3E0JA 4A3GH 1A2UA 3IAYA 1I6HB 3BZCA 3NBHB 4L63B 4X6AH 2BE5C 3Q8DA 3CMAA 2HQLA 2I46A 3HOUH 1FR3A 5FLXL 4CKEA 1B8AA 2RCFA 3S9WA 2K05A 1VQ6A 1MKHA 1GUGA 2HCCA 5CV7A 2IHEA 3PO3G 4K2LA 3K59A 1NCVA 3UDFA 1LABA 1DOLA 2JA8G 1JWUD 2E2IH 3I4NG 2DN8A 2MUYA 1XMQL 3CCUA 1D7QA 4C1NI 4U68A 1LO5D 2R61A 3CKIB 1E1OA 2QW7A 4UP8A 3ZJYC 5IGGA 4Q5VA 2K28A 4H7BA 1O7IA 2VW9A 1RIPA 1CM9A 1HNZQ 2Q8RE 3TSSA 3A54A 5JEAH 1I3QB 3GTQH 4IUPA 4DR4Q 3K0XA 4OX9L 3CC4A 3TP7A 2MGSA 2WIIB 4C3IB 2DY8A 4OL7A 2XWBB 1K3BC 3MXUA 3CCRA 4IJHA 4B08A 4HSVA 4HIKA 3URYA 3NTHA 2EE1A 2Y0SE 3HRZC 2DNCA 4HR7B 5CC4A 4ZRZA 4KKSA 3PSIA 4J1MA 1E2VA 3J81i 3ZYYX 2EQSA 4TKOB 1SEBD 3D4WA 2E5LL 3IL8A 4DK3C 1FNUA 4DAYA 4RKBA 2B63G 3LX0A 3MA2B 5EPJA 5HY6A 5AJ3L 2OQKA 4DV2Q 1Y1WG 1I4PA 1HTLD 2KCNA 3VA7A 3NQIA 1VQNA 5J3BA 1RTNA 3AU7A 2ZJQA 5D14A 1KC8C 2VL6A 3OMCA 5EKKA 1KNAA 5D3DA 2EY1A 5EKLA 4K0KL 3KDFA 4GOPB 5CV8A 2SOBA 4IPGA 4WRDA 1EL0A 1WFQA 1PV4A 4PMWA 4K8IA 2B2VC 1K8MA 4KV6A 2PPBC 1J9OA 3TMEA 4DUZQ 1XTCD 1A3UA 2L0CA 1QILA 4RMFA 1K8OA 2MPMA 2F0WA 2B2UA 1JJ2A 1G8ZD 1STYA 3I55A 4JK1C 2EIFA 4DUYL 4BBRH 5A2QE 4NXNQ 3RLNA 4L8JA 2OTJA 5KYIA 1IBLQ 1GOZA 4F7XA 1H9JA 4R1JA 2EPBA 2Y0SB 1NNXA 3J80i 2F0EA 2A68D 3HEJA 2A6EC 3T1YL 1I4HA 4K5XA 3EIVA 1R4PB 1TR5A 5I9PA 1JR0D 4BY1B 3GTMH 3DUZA 1BBUA 3UDIA 2IY5B 2E75C 4J6HA 1N36L 2D5DA 1TQOA 4Q0FA 2F0PA 4B3ML 3I90A 1HNWQ 2NN6G 3CW2C 4JI4Q 4GN5A 1MJCA 1IYJB 3S2DH 1LTTD 4FF2A 3GTOB 3OWEB 1H9RA 3NPPA 4DXGA 4K5WA 5LMNQ 2VS1A 3A56A 1STEA 1IW7D 2ZJPA 4J15A 4IFDH 4K14A 1BXTA 1V1PA 2WFWA 4PQXA 2F3WA 4F87A 5ELEA 3Q23A 2J7ZA 2UUAQ 4ODGA 2R7ZB 1JICA 3D0FA 2Z6KA 4BY7B 3KBXA 4GLXA 1GHJA 1AZPA 2QKIC 2EYLA 2OTLA 1PVOA 4S3SA 4WJ4A 1B3AA 4XYQA 4YY3Q 5K5PA 2ZT9C 3ERSX 4IN3A 1CSPA 1UUPA 1TWAB 3GP7A 4MZ9A 2HHHL 1JWMD 2GA4B 2JEBI 2JK8A 4ZUIA 4DV0Q 2JXMB 3D4DA 4IQZA 3FRPB 1FJGQ 1WCMB 1LACA 3LWEA 1DD2A 3BYTB 2I5HA 2LXJA 1EUJA 4HCSA 1ILQA 1TWCH 3RMHA 4A4IA 3FVQA 5FOBB 1C48A 4DR2L 3SK4A 5FO8B 3S16H 4ULLA 1PYWD 5CBAE 2K14A 1YJ9A 5CYUA 3GTLB 5E4WC 3FDTA 1PYSB 3BDCA 4A3JH 1HR0L 3I4MB 2ID0A 2F0KA 1X9NA 5ISRA 2R92H 1BCPB 2B2TA 4PV1C 3KLSA 4KLKA 5C3EH 4KHPQ 2IWHA 3M9BA 5EQ0A 2Q8IB 2LFNA 2NTSA 4C3IG 5C5MA 2LKVA 1EWHA 1PTOF 2F0LA 2VUMB 4V190 1XNRL 1J5EL 4NMZA 5I6YA 3VYTA 2WKDA 2GVBA 2HQEA 4NB3A 1JCKB 4DXFA 5C44H 4ZKCB 3GTJH 3CAMA 4G7ZC 1EY9A 1HZAA 1WI5A 1YHBA 3Q24A 3I91A 2B8FA 3A5ZB 5BR8Q 1I94Q 4M8AA 1VQFA 1W6JA 1Y1VH 5IP7H 4HAEA 1CA6A 4A3DB 1O80A 3DWAA 4G57A 5EBCA 1XMOQ 1ML0D 4DV7Q 4JYAL 3N52A 1MHWC 1SFOH 3K58A 4LUOA 2D9UA 2TSSA 3KLSX 4POFA 4JI0L 1BQQT 5HGTA 1FD7D 5JVG3 3H3VC 2UXBQ 2AQ1B 2CVRA 3ONAB 4H44C 4DK1A 3HOZB 3SK8A 5E3FA 2CHBD 3ND9A 1KXLA 1H9SB 3KF8A 1D8LA 3NUCA 1I50B 3OWFA 4DFAA 3JAME 4A3GB 1O7YA 4CHTB 3BVMA 3E9HA 3HOUB 3EA6A 5C6AA 3HOWG 2Z4IA 1E2WA 3H91A 3M4YA 3QR8A 3R8BA 4DV4L 3S1NH 2KBNA 1UEAB 5DEHA 1TWHB 5KRUA 2Y0SG 4K5VA 4ID6A 3VR5A 1OXXK 5DLQE 1EEFD 3DEPA 2F4IA 2EJFC 2WINB 3KBGA 3MFGA 2Q2TA 2E2IB 3L7ZC 4ZCKA 4WFN3 4OIJA 4IOCA 2JA7H 4BY1G 2RKSA 4OWWB 2UU9Q 4JI3Q 1E1TA 3MEHA 1L2FA 5JVH3 1XPRA 1N32Q 5EPLA 4PZ6A 1YJNA 2A19A 4DNRB 3DWQA 3I73A 4A3KH 4IFDI 4JI6Q 1JE4A 2K5HA 1LUZA 3W5OA 1I4GA 2VZAA 1I5FA 1X3QA 1TXYA 2MO0A 2NZ1D 3P1HA 5D65A 2VNUD 3JAMc 1HFNA 1AEXA 4HMJA 3OTOL 3KJOA 4XIGS 2YU9H 4JPBW 1G2SA 2K01A 3CXCA 2Z6KC 2PQAA 1KQSA 2IJ0A 4JBWA 3TQYA 3K80C 2R7ZG 3CQZH 4BY7G 2Z4HA 5M3MH 5CR3A 1PA6A 3MTSA 3GTPH 4KJOA 1MJEA 1EEID 3SHLA 2LY7A 1RKNA 4UPAA 5M9OA 2ATWA 3A8KE 4JV5L 2BA1A 5GQOA 4OXPA 4O2DA 1VF7A 2B29A 3HOYH 4GKKQ 4B3RL 5CGKA 1E7ZA 1RDPD 3G7LA 1YIJA 1SSOA 3WWVA 2IX1A 2AWNA 2PQEA 3I72A 3MXGA 4BWGB 4PZ8A 1P16A 3I4LA 1V1OA 4DR7Q 1VQOA 1GUTA 1WCMG 4HJ8A 3MFYA 3KUPA 2KHSA 1JOKA 5M3FH 4QY7A 3W3AA 3UE1A 3I4NB 3U58A 4MNOA 2K75A 1ONLA 4POGA 2NVXH 5C4ZA 3CPFA 4YCWA 4JI8Q 1PH2A 2PI2E 3I4MG 4L5SA 1XWEA 3F2DA 3B6YA 4DAYB 5FO7B 3VA5A 4P2CB 2OXPA 1V43A 2E2HH 1ASZA 5CBEE 5CV5A 4HN7A 5ELCA 5IWAL 2VUMG 4LFBQ 2MJ8A 2D62A 1AN8A 1BF4A 2F0QA 2MFIA 2EYPA 2WACA 2RDGA 1XPOA 1EQTA 3F8TA 2KEDA 1NY4A 4XDXA 1EYCA 2RF4A 3WOEA 2NVQH 3AMUA 2KJXA 2R3ZA 4X62L 2A73B 3I8ZA 3SK6A 4ZQ3A 4DU9A 5M5WB 1G291 1G91A 5IYDH 3TZUA 5HGQA 3S1MH 4A3DG 4JG2A 1T9HA 5IGEA 4LFAL 5KIXA 4Y7NB 2KHIA 1HPCA 1HNXL 1KD1C 2CWAA 4HJAA 1VQPA 1SDFA 2BDOA 1LTAD 4DV1Q 1LM0A 3D6WA 3VR6A 1V9PA 3C46A 3OMGA 1GUNA 1U9RA 4RGMA 2RVLA 3A7LA 4RGOS 3T16A 2KOLA 3RZDB 4A3LH 2YTYA 3TN2A 2WB1E 3EVQA 1PRTC 2AWOA 1P8LA 3HOZG 4GKJL 1OXTA 2G5DA 4QL5A 4PMCA 3GTGH 1K0RA 1TS4A 4Z9CB 1RTOA 2HUGA 1DJRD 4A3GG 1ILPA 4DAPA 3PQIA 4X3KA 2KCCA 4JI7Q 1B2TA 4O42A 3NSWA 3HOUG 1WOCA 4KHVA 1M8AA 3NE5B 2F0VA 4X66Q 3R2TA 3I7FA 4DF7A 4FXDA 1LV9A 5C0XH 1Q3LA 1YJWA 3U4VA 2IX3A 2UUCL 3CCVA 5IYBH 4C3JB 1G6ZA 2EDGA 3D4RA 1YNXA 3WDNA 1S4ZA 2VQFL 2J4XA 1NMGA 3CPWA 2OCEA 4QCLA 2L15A 4LF9Q 3IRBA 1CFMA 2CQAA 2ZTEA 4BBSH 3NXWA 2EYHA 1WVLA 1N33L 3PCOB 3ICEA 1X65A 4X65L 1BKBA 3OIPA 3RNUA 4A3JB 4R4QA 2UXDL 4YCUA 1UEBA 1FYCA 5C3EB 5IGDA 3D3RA 1CHPD 1VF5C 5JEAG 4AQYQ 3HZXA 4HCEA 5G3LD 2F0OA 1CKMA 5EPKA 3SK5A 1NBWA 4B3SQ 1VQ8A 4DR6L 1F2ZA 1DOKA 2QILA 5JOBA 5C44B 2NYZD 2WB1B 2OWOA 1EZ6A 1KAAA 3GTJB 3M4PA 2N88A 4H02A 4YHHQ 3ULJA 1YNJD 4UP7A 1Q8KA 2F0GA 1PH6A 3CCLA 4A3CH 1GO3E 1N34Q 2A1AA 1X6OA 2NVYB 1Y1VB 3STBD 1IBKQ 4A93H 3NHHA 1K9MC 4JI2Q 1QB5D 1GUWA 1JOQA 1JC7A 4IOAA 2JEAI 1XTDA 3J7YW 1SYGA 2PZTA 1Y69U 2UUBQ 2VB3X 4P74A 3D31A 2ZM6L 5EGTA 2UXCL 2LXKA 2Z9HA 3T51B 5FJ8H 3M4OH 3K57A 1PTOB 1LYLA 4A3IH 1WD1A 3JAMi 1KIXA 1YEZA 1FNWA 3RZOB 4FDBA 4KKTA 2KCTA 2NTTA 4PZ7A 1U4LA 4CJ1B 4QF4A 3R93A 4FF1A 1PFSA 3PO2B 2F4VL 3PIO3 2MHVA 1BOSA 1L0XB 4C2MH 5DNFA 1KLGD 4HEDA 1OO9B 4PMBA 3L2PA 3U50C 5IY0A 4RWSC 5A35A 3SE0A 2BH2A 1ASYA 2ASBA 4I7AA 1VCIA 1SE8A 1II3A 3FMCA 1V1QA 1S3OA 4IJLA 4JC0A 4DV6L 2EJMA 1CQFA 3K7UC
chains in the Genus database with same CATH topology
3BYYB 1SNMA 5IT9L 3T13A 4KN4C 1Q12A 5KEEA 1MSHA 4RFBA 1ET9A 4LMQD 1J8IA 3QOJA 2EXZA 2H1EA 1EY0A 2SNMA 4A3KB 3U9OA 1S5DD 4N9PA 1FGBD 1TVXA 4FF3A 4TSSA 4PNYA 4IUVA 3R2IA 2WKCA 2HDLA 2L12A 5KYLA 4IFDG 4EGVA 2KA7A 3FKIB 5FLXE 2F0SA 3DWPA 5IGBA 1B53A 2K32A 1SNQA 1BCPD 5JPNC 3CQZB 1SYDA 2N55A 1MSGA 1EIHA 2XVSA 4J8QA 2J0TD 2AQ2B 2A68C 5C0XI 3C1EA 3HOWB 3FEWX 3HOYB 1A3TA 1EY5A 4OO1H 1D5ZC 5K36H 3RLFA 4KI0A 3U9SA 4E6IA 1STNA 4C3JG 4XTCS 1SNDA 1DOMA 1RCVD 1CZWA 4RCOA 1OXUA 3K5NA 2OF1A 4HSPA 5J39A 1IHZA 3ITPA 1TS5A 4NDXA 2NVXB 2O5JC 3IFDA 1WTQA 1IW7C 3O13A 1SE4A 1DM0B 4ZUJA 1S5BD 5I2YA 2EYOA 1EFID 3BDLA 1U4MA 2B2WA 2BDNA 3PUVA 1HCZA 2JA6B 2F0TA 1HA6A 5CORA 2E2HB 3PIP3 3TP8A 1STHA 3BZDB 4C1NK 4IUQA 3L9AX 2PYKA 1EYDA 5DM73 2K03A 3HOVB 5JPMC 3I70A 4CGYB 2E2JB 1R9TB 1I4QA 4WJWA 1CZGA 3NQTA 2X69A 2WP8J 2QDBA 1O78A 2KEEA 4WORA 1Q1BA 3M85A 1PFNA 1TKWB 2EYJA 2F0HA 3H09A 1EWCA 1SMYD 3SVMA 3PUZA 3VYRA 4G7OC 4KD4A 2KQ3A 4QIWB 2TMPA 1SJHD 2B2YC 3V05A 1LTRD 1TS3A 3GTGB 4KY7A 4RHSA 2VXWA 3K5OA 1H9MA 4GZYC 1KDCA 1S5CD 1QWYA 1KLUD 3HP3A 2E2DC 3ND8A 2E76C 5CV4A 1NUCA 4K6LA 1ENCA 1ZYRD 2A74C 1IYUA 2F1MA 3EQLC 3MXNA 1EU4A 4IALA 2IPKD 1EOTA 4CJ0B 4BBSB 5FKAC 4XXEA 3J81L 3DHQA 4KN7C 1KNEA 2QCPX 2JSOA 1VMPA 2SDFA 4G7HC 4OHJA 4EVOA 3X3MA 2RA4A 5JEAJ 4FXGC 3NP8A 2PO4A 5C4XB 4V0BA 3QJYA 1SXTA 3H94A 1JOOA 2XWJB 3GO5A 4XQJA 1F9RA 2RSNA 5DAUA 1HUNA 1PRTF 3D8GA 4K8JA 1LTBD 2L11A 1IL8A 3CU7A 4X3TA 3V96A 4CKBA 2A69D 4OO1I 3BVZA 1B1ZA 3VR3A 2PZUA 2XN9C 5E1FA 2R6GA 1HFGA 2LMCB 3A7AB 1Q8IA 3M4OB 1GHKA 2C9OA 5ELDA 4B9WA 3L3OC 4A3IB 5T1IA 1YNND 3J80L 1JORA 4NKLA 1CQVA 4FO2A 2AUJD 2B2WC 2G9HD 2L55A 2BA0A 4DNTB 2CW0D 3I3CA 3GTQB 1F9PA 3TP6A 4C2MB 2JP1A 1WTVA 1ENAA 4IURA 3NWSA 1BBXC 2SNSA 1ET6A 1LT6D 4IZ8A 2E74C 4H13C 1HUMA 1BUVT 2F0FA 5M3MB 4MN3A 4C56C 2ICIA 5KNDA 1CK1A 3FPPA 2HCIA 2RDHA 3HKZB 3BDOA 4KTAA 2V4DA 4TQUS 4B9XA 2EJGC 4G4KA 2F0MA 3A8IE 3QIAA 2L5TA 2NUCA 4KHZA 4IUNA 4IFDJ 1UAPA 4U673 4ZKBB 5M5XB 2L4NA 2QEJC 3CHBD 4DGZA 2JYOA 2G9DA 5AFWA 3VR2A 5E4XA 3BG3A 1HHVA 3T56B 1B9MA 4BBRB 2OEOA 4L6TB 5BN5A 1ESRA 3KLRA 1GUOA 1NR2A 1TY2A 3SR1A 1PZJD 2A6HD 3R3OA 1DCZA 3K0YA 1QE6A 5I6WA 4RKLA 2Q8TA 4KJNA 4FYDA 1AZQA 1Y8PB 4CKCA 1FNVA 4MIUA 1D5MC 4C3HB 3GTMB 1EU3A 1STAA 1F2YA 2X6LA 2FFKB 3S2DB 1LTGD 1PTOD 1HA5A 2JA5B 2PZWA 2K33A 1LLRD 3OPOA 4EQOA 3S1QB 2BCOA 1GUSA 1SNOA 1HXYD 3PUYA 2KUMA 4X3UA 1HQMC 2M9VA 3J7AF 3QB3A 3NWTA 1QG7A 3MVVA 1C4QA 4DN4M 2WV6D 1T5XD 2XNAC 3MC0B 1MBYA 1V1PB 1TWCB 3LNNA 1VMCA 1NAPA 3S16B 1R4QB 4XQNA 4RHRA 5COYA 2EVBA 3G6JB 1I6VC 1GXDC 2R92B 5NUCA 2ICEC 2F3VA 2FJ2A 3NTIA 3TP5A 1YNJC 2M00A 3K6OA 1SNPA 2AQ3B 1XXGA 2KVMA 4FNFA 1EQVA 2FHTA 1TWGB 3BS1A 1K83B 4N9TA 4HMIA 1ESFA 4OIKA 1TS2A 1XYIA 3Q0AA 2SEBD 4UDUC 2EYMA 4EQPA 1SFOB 4TRDA 1NR4A 1IKMA 1U4RA 4LAAA 3S17B 2XRQD 4F88A 2EZVA 1SE2A 1Z47A 1RODA 2K5WA 1DZ1A 1M4VA 4IUUA 2XIWA 2X6GA 3EJIA 1ZXTA 1QNUA 2B2YA 4RCNA 1KDBA 1HRJA 2BE5D 4NW2A 1SJED 4FF4A 3QO2A 1DYQA 1F9SA 2IL8A 4H0LC 5A2QL 1EY7A 2DNEA 1HQRD 5I4DA 1Q1EA 4OO1G 5K36G 3S1NB 2KECA 2F0UA 1LT5D 4YIJA 3IKJA 3HOXB 3BVGA 1CT1D 1TT2A 1HTPA 4C3HG 2JA7B 4XYOA 1Z6HA 1UNSA 2PW7A 2OT2A 2R93B 1PRTB 3P20A 4X3SA 4DA2A 1VDZA 2RQXA 1L0YB 2O5IC 1BCPC 2K7VA 2F0NA 3E6ZX 1V8QA 3VR4A 5IGCA 3GD7A 5ELBA 3OHXC 2YU9B 1SBBB 5KGUA 1H9KA 1JB3A 3WOFA 1OXVA 2NWGA 5F2DA 5J1ZA 1JWSD 4K2KA 1SAPA 1EY8A 3W2DA 4NP5A 1WTPA 3GTPB 4MHEA 1F2MA 1Y8NB 3RUZA 3VYUA 1U4PA 2HDMA 3TZDA 2IT1A 1CTMA 4OGQC 4KY6A 5IGFA 1QOHA 1WTWA 1BR9A 5M3FB 2ZXOA 1A3VA 1SYEA 1E2ZA 2MP1A 1PFBA 2AUKA 4UAIA 1I4RA 1EY4A 1B50A 2EY6A 2K04A 3QWNA 4RH6A 3PV0A 1F2LA 5KNBA 2WAQB 1C8CA 5JAVA 5IT9E 2VB2X 2F03A 1CHQD 2A6ED 1MGSA 5CV9A 5C0XJ 4CBVA 2EYFA 1X32A 3AB9A 2NVQB 5TSSA 2Z1CA 4DK0A 3K5MA 1SMYC 4RGNA 3S1MB 2NBFA 5EBDA 1A6XA 2PNRC 3RD4A 5D3IB 1A15A 1E0BA 3NTKA 5IODA 3SEBA 1KDAA 3Q6SA 4KMUC 5I2XA 5ELFA 2NVTB 2JE6I 5LHY1 1QJOA 2LS01 3A8JE 3UI2A 2O2LD 3GTKB 1TU2B 1A2TA 4XT1B 1QNKA 3C3LA 3JAML 1RHPA 2A5HA 3J7AV 3SDZA 1ZYRC 4KY5A 4DAVA 2L9HA 3NBHA 4ZK9B 1PZID 1D5XC 4ABNA 1ZKOA 2NN6H 1WTRA 3LWUA 2DY7A 1RJTA 2FINB 5EJWA 1LT4D 4F8MA 3D6CA 5LL6X 3GQBA 2RSOA 3HS0C 4HTHA 4A3EB 1D2BA 1D1KA 2FMMA 2O4XA 3GV6A 4IUTA 1D1IA 3T4AC 5BN4A 4BA2I 1D6EC 1JQYD 3GV3A 2YYZA 2D2CC 4A3MB 1SYBA 2QF7A 3DXJC 2A69C 4ZLTF 1PXUA 1LTSD 4LK1C 3E5SA 4RAUC 2NB0A 4FP5D 1STBA 4CJ2C 1KABA 3MAQA 3P75A 1PTOH 3OIQA 1DONA 4LJZC 4A93B 2M2LA 5FO9B 4RA8A 1X3PA 1YNNC 2B2UC 1AW7A 2EOTA 4QMGA 4RGTA 3NK9A 1GJXA 3PMFA 4ME5A 2CW0C 1SNCA 1F77A 2B8GA 1EIGA 4BS9A 1O7ZA 5G3LF 3MXPA 2FMCA 3MZ5A 1TWFB 3F2UA 3M7GA 4FXKC 2H4OA 3PUXA 5IIFA 3J81E 1WTXA 1PMRA 3NBIA 3VYSA 1RF2D 2EY5A 2K1BA 2ENBA 5I9OA 3DM1A 2F0IA 4A3FB 3H0GB 1S5FD 5BN3A 4FVMA 5EKIA 4A3BB 2BOSA 1QCBD 1DXMA 2RBMA 3S14B 5C4HA 3ERQA 2ZXPA 2Z8LA 1WTOA 3HGBA 4M1UB 3X3NA 4QUCA 1Q90A 1OXSC 1STGA 2K5DA 4K6DA 1O7LA 4I65A 4R8IA 3P7JA 2I07B 3PO3B 4I7ZC 1B44D 1IKLA 2A6HC 1EYAA 4BA1I 4R8NA 2JA8B 3N6RA 1PDQA 1ENFA 4XT3B 3CRLC 4ZAIA 3S1RB 2K6AA 2NN6I 3J80E 1Z7TA 1TY0A 1ZEQX 3M7NA 4QB4A 5C0XG 3K5LA 5FK9C 2B2TC 5DM63 1AP0A 3C1FA 5C4JB 4XQQA 2RDFA 2PCFB 1B4OA 2ZXRA 1BDOA 1F9QA 1PTOC 1CA5A 3QOLA 5M5YB 5C3WA 5HURA 3OSOA 2EY2A 3KK7A 1MI2A 2IX0A 3T53B 1SYFA 3MHBA 3HG9A 4ILWA 1BCPF 3CRKC 3H6MA 1T5EA 5CMDA 1W6KA 1NSNS 2B63B 3DMUA 3QG1A 1Y1WB 5T1GA 1RD9D 3EFXD 3SXHA 1Y8OB 3IFTA 1CI3M 1XX8A 1MD2D 2PMZB 4O1NA 5C3XA 1BNZA 1G2TA 1B9NA 3PUWA 3DEOA 2F0DA 5JJZA 4KK7A 2IW3A 3K7AB 4EQNA 2B2VA 5J22A 2L1BA 3OW7A 3MWYW 1PZKD 3FPUB 2F0JA 4QUFA 1PRTD 2K5QA 3TDQA 1IYVA 1EZ8A 2C5CA 5CV6A 5KNCA 1LT3D 2PW5A 1TIID 4ZYSA 1S5ED 2B39A 1ICWA 3Q22A 1H9SA 1SE3A 4KD3A 3V2TA 4KKUA 3EROA 3A55A 5IOCA 2XSCA 3OOCA 4AYBB 3S15B 1WD0A 3S2HB 5LL6S 1EY6A 4R9WA 3C2PA 1BO0A 1PFMA 3TBIB 3M3YB 1PLFA 1LTID 2XRSD 5C5LA 1AFPA 1SYCA 1KTKA 1I4XA 3E0JA 1A2UA 3IAYA 1I6HB 4L63B 2BE5C 2I46A 1FR3A 5FLXL 4CKEA 3S9WA 2K05A 1GUGA 2HCCA 5CV7A 4K2LA 3K59A 1NCVA 1LABA 1DOLA 1JWUD 2DN8A 2MUYA 4C1NI 4U68A 1LO5D 2R61A 3CKIB 5IGGA 4Q5VA 2K28A 4H7BA 1CM9A 2Q8RE 3TSSA 3A54A 5JEAH 1I3QB 4IUPA 3TP7A 2MGSA 2WIIB 4C3IB 2DY8A 4OL7A 2XWBB 3MXUA 4B08A 4HSVA 3URYA 3NTHA 2EE1A 3HRZC 2DNCA 4HR7B 5CC4A 4ZRZA 4KKSA 4J1MA 1E2VA 3ZYYX 4TKOB 1SEBD 3D4WA 3IL8A 1FNUA 4DAYA 4RKBA 3LX0A 3MA2B 5EPJA 1I4PA 1HTLD 2KCNA 3VA7A 3NQIA 1RTNA 3AU7A 5D14A 3OMCA 5EKKA 1KNAA 5D3DA 2EY1A 5EKLA 5CV8A 2SOBA 4WRDA 1EL0A 4PMWA 4K8IA 2B2VC 1K8MA 4KV6A 2PPBC 1J9OA 3TMEA 1XTCD 1A3UA 2L0CA 1QILA 1K8OA 2MPMA 2F0WA 2B2UA 1G8ZD 1STYA 4JK1C 5A2QE 4L8JA 5KYIA 4F7XA 1GOZA 1H9JA 2EPBA 2Y0SB 2F0EA 2A68D 3HEJA 2A6EC 1I4HA 4K5XA 1R4PB 1TR5A 5I9PA 1JR0D 4BY1B 3DUZA 2E75C 4J6HA 2D5DA 1TQOA 4Q0FA 2F0PA 3I90A 2NN6G 1LTTD 4FF2A 3GTOB 3OWEB 1H9RA 3NPPA 4DXGA 4K5WA 3A56A 1STEA 1IW7D 4IFDH 4K14A 1BXTA 1V1PA 4PQXA 2F3WA 4F87A 5ELEA 3Q23A 2J7ZA 4ODGA 2R7ZB 1JICA 4BY7B 3KBXA 1GHJA 1AZPA 2QKIC 2EYLA 4S3SA 1B3AA 4XYQA 5K5PA 2ZT9C 4IN3A 1UUPA 1TWAB 3GP7A 1JWMD 2GA4B 2JEBI 4ZUIA 2JXMB 3D4DA 4IQZA 3FRPB 1WCMB 1LACA 3LWEA 1DD2A 3BYTB 4HCSA 1ILQA 3RMHA 3FVQA 5FOBB 1C48A 3SK4A 5FO8B 4ULLA 1PYWD 5CBAE 5CYUA 3GTLB 5E4WC 3FDTA 3BDCA 3I4MB 2ID0A 2F0KA 5ISRA 1BCPB 2B2TA 4PV1C 3KLSA 2IWHA 5EQ0A 2Q8IB 2LFNA 2NTSA 4C3IG 5C5MA 2LKVA 1EWHA 1PTOF 2F0LA 2VUMB 4V190 4NMZA 5I6YA 3VYTA 2WKDA 2HQEA 4DXFA 1JCKB 4ZKCB 4G7ZC 1EY9A 3Q24A 3I91A 2B8FA 4M8AA 1W6JA 4HAEA 1CA6A 4A3DB 1O80A 3DWAA 4G57A 5EBCA 1ML0D 3N52A 3K58A 2D9UA 2TSSA 3KLSX 1BQQT 5HGTA 1FD7D 5JVG3 3H3VC 2AQ1B 2CVRA 3ONAB 4H44C 4DK1A 3HOZB 3SK8A 5E3FA 2CHBD 3ND9A 1H9SB 3KF8A 3NUCA 1I50B 3OWFA 4DFAA 3JAME 4A3GB 1O7YA 4CHTB 3BVMA 3HOUB 3EA6A 5C6AA 2Z4IA 1E2WA 3H91A 3M4YA 3R8BA 1UEAB 5DEHA 1TWHB 5KRUA 4K5VA 4ID6A 3VR5A 1OXXK 1EEFD 3DEPA 2F4IA 2EJFC 2WINB 3KBGA 3MFGA 2E2IB 3L7ZC 4WFN3 4OIJA 2RKSA 3MEHA 5JVH3 5EPLA 4DNRB 3DWQA 3I73A 4IFDI 1JE4A 1I4GA 1X3QA 2NZ1D 3P1HA 5D65A 2VNUD 1HFNA 1AEXA 4HMJA 4XIGS 1G2SA 2K01A 2IJ0A 4JBWA 2Z4HA 5CR3A 3MTSA 4KJOA 1EEID 3SHLA 2LY7A 1RKNA 5M9OA 3A8KE 2BA1A 1VF7A 5CGKA 1RDPD 3G7LA 1SSOA 2IX1A 2AWNA 2PQEA 3I72A 3MXGA 4BWGB 3I4LA 1V1OA 1GUTA 3MFYA 3KUPA 2KHSA 1JOKA 3W3AA 3I4NB 1ONLA 5C4ZA 1XWEA 5FO7B 3VA5A 4P2CB 2OXPA 1V43A 5CBEE 5CV5A 4HN7A 5ELCA 2MJ8A 2D62A 1AN8A 1BF4A 2F0QA 2EYPA 2WACA 2RDGA 1EQTA 2KEDA 4XDXA 1EYCA 3WOEA 3AMUA 2KJXA 2R3ZA 2A73B 3I8ZA 3SK6A 4ZQ3A 4DU9A 5M5WB 1G291 1G91A 3TZUA 5IGEA 5KIXA 4Y7NB 1HPCA 1SDFA 2BDOA 1LTAD 3D6WA 3VR6A 3C46A 3OMGA 1GUNA 1U9RA 4RGMA 2RVLA 3A7LA 4RGOS 3T16A 2KOLA 3RZDB 3TN2A 3EVQA 1PRTC 2AWOA 1OXTA 4PMCA 1TS4A 4Z9CB 1RTOA 2HUGA 1DJRD 1ILPA 4DAPA 4X3KA 2KCCA 1B2TA 4O42A 3NSWA 4KHVA 1M8AA 3NE5B 2F0VA 4FXDA 3R2TA 4DF7A 1LV9A 5C0XH 1Q3LA 2IX3A 4C3JB 1G6ZA 2EDGA 3D4RA 3WDNA 1S4ZA 2J4XA 4QCLA 1CFMA 2CQAA 3NXWA 2EYHA 1WVLA 3OIPA 4A3JB 1FYCA 5C3EB 5IGDA 3D3RA 1CHPD 1VF5C 5JEAG 3HZXA 4HCEA 5G3LD 2F0OA 5EPKA 3SK5A 1F2ZA 1DOKA 2QILA 5JOBA 5C44B 2NYZD 2WB1B 3GTJB 1EZ6A 1KAAA 2N88A 1YNJD 2F0GA 2NVYB 1Y1VB 3NHHA 1QB5D 1GUWA 1JOQA 1JC7A 2JEAI 3J7YW 1SYGA 2PZTA 1Y69U 2VB3X 3D31A 5EGTA 3T51B 3K57A 1PTOB 1WD1A 1FNWA 3RZOB 4KKTA 2NTTA 1U4LA 4CJ1B 4QF4A 3R93A 4FF1A 3PO2B 3PIO3 2MHVA 1BOSA 1L0XB 5DNFA 1KLGD 4HEDA 1OO9B 4PMBA 4RWSC 5A35A 3SE0A 1VCIA 1II3A 3FMCA 2EJMA 1CQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYY B;  3BYT B;  5ELC A;  1RD9 D;  1SXT A;  1DYQ A;  3EFX D;  2WV6 D;  1T5X D;  4L63 B;  4RFB A;  2XNA C;  1ET9 A;  3MC0 B;  1XTC D;  1CHP D;  1EEF D;  1QIL A;  4RH6 A;  1PRT F;  1HQR D;  1PYW D;  3MFG A;  5I4D A;  1S5F D;  1AN8 A;  1MD2 D;  1G8Z D;  1LTB D;  1S5D D;  4O1N A;  1SJE D;  2RDG A;  1FGB D;  1LT5 D;  4TSS A;  1V1P B;  3BVZ A;  2QEJ C;  3CHB D;  1B1Z A;  3R2I A;  3BVG A;  1BCP B;  2QIL A;  1D6E C;  1CHQ D;  1CT1 D;  1JQY D;  2XN9 C;  1GOZ A;  2Z8L A;  1EWC A;  4RHR A;  3DWP A;  1JWU D;  3DWQ A;  1LTS D;  2NTS A;  4L6T B;  1UNS A;  1BCP D;  5TSS A;  1PTO F;  1I4G A;  1I4H A;  1PRT B;  1TY2 A;  1PZJ D;  4DXF A;  4RGN A;  1JCK B;  1LO5 D;  2R61 A;  1SJH D;  3V05 A;  1LTA D;  1PZK D;  1LTR D;  2AQ2 B;  1JR0 D;  1L0Y B;  1BCP C;  5ELD A;  1TS3 A;  1PRT D;  1B44 D;  1PTO H;  2IJ0 A;  4RHS A;  4RGM A;  5D3I B;  4RGO S;  3TSS A;  5ELB A;  1FNV A;  1CQV A;  3SEB A;  2AQ3 B;  1D5M C;  1D5Z C;  1XXG A;  1ENF A;  1LT3 D;  1SBB B;  1EU3 A;  2G9H D;  4ZYS A;  1EEI D;  1S5E D;  1PRT C;  1LTT D;  3DWA A;  1S5C D;  1PTO B;  3OWE B;  5ELF A;  1JWS D;  1KLU D;  1TY0 A;  1AW7 A;  4DXG A;  3URY A;  4RGT A;  3W2D A;  1RCV D;  1SE3 A;  1TS4 A;  4RCO A;  4Z9C B;  1STE A;  1DJR D;  1FNW A;  4K6L A;  5FK9 C;  1RDP D;  1BXT A;  1V1P A;  2O2L D;  2NTT A;  1LTG D;  5ELE A;  1PTO D;  1ESF A;  1TS2 A;  1TS5 A;  2TSS A;  1SEB D;  3KLS X;  1EU4 A;  1HA5 A;  4BWG B;  2SEB D;  1F77 A;  1FNU A;  1V1O A;  4UDU C;  1ET6 A;  3R2T A;  2IPK D;  1FD7 D;  1RF2 D;  3O13 A;  1LLR D;  1SE4 A;  1LT6 D;  1S5B D;  1EFI D;  1PTO C;  1I4P A;  2AQ1 B;  1HTL D;  2XRQ D;  1L0X B;  1KLG D;  5FKA C;  2CHB D;  1SE2 A;  4C56 C;  1PZI D;  2ICI A;  1M4V A;  2J4X A;  1HXY D;  3BZD B;  1D5X C;  1UUP A;  1CK1 A;  5D3D A;  4OHJ A;  3BVM A;  3GP7 A;  1JWM D;  2RDH A;  3EA6 A;  1LTI D;  1BCP F;  2XRS D;  1I4Q A;  3R8B A;  1KTK A;  1I4R A;  1I4X A;  1LT4 D; 
#chains in the Genus database with same CATH topology
 4OWT B;  3BYY B;  4A3B H;  1SNM A;  3CCE A;  5IT9 L;  1XNQ Q;  2AHO B;  2Q2H A;  3T13 A;  3G48 A;  4KN4 C;  1Q12 A;  5KEE A;  1HR0 W;  1MSH A;  4RFB A;  1ET9 A;  1VQG A;  4LMQ D;  4DK6 C;  1J8I A;  3QOJ A;  2EXZ A;  3KF8 B;  2H1E A;  1VQH A;  1EY0 A;  1HZB A;  2SNM A;  4A3K B;  3U9O A;  4DR5 L;  1S5D D;  2K52 A;  4N9P A;  1FGB D;  1TVX A;  4O0A A;  4FF3 A;  4TSS A;  4PNY A;  2I0Q A;  4IUV A;  3R2I A;  2WKC A;  4IPH A;  2HDL A;  2L12 A;  3KF6 A;  4JI1 Q;  5KYL A;  4IFD G;  4EGV A;  2KA7 A;  3FKI B;  4R4I A;  5FLX E;  2F0S A;  3DWP A;  4QGU A;  4B3T L;  5IGB A;  1B53 A;  1H95 A;  1EQR A;  2K32 A;  1SNQ A;  1BCP D;  5JPN C;  3CQZ B;  1SYD A;  3F1Z A;  4DPG A;  5M5X H;  2N55 A;  1MSG A;  1EIH A;  2E8G A;  2XVS A;  4J8Q A;  2J0T D;  2JA8 H;  5E7N A;  2AQ2 B;  2A68 C;  5C0X I;  3C1E A;  3S1R H;  3HOW B;  1SLJ A;  3FEW X;  3HOY B;  1A3T A;  1QVG A;  1EY5 A;  4OO1 H;  1D5Z C;  5K36 H;  3RLF A;  1A63 A;  4KI0 A;  4DV3 L;  3KJP A;  1G6P A;  3U9S A;  4E6I A;  1STN A;  4C3J G;  4XTC S;  1SND A;  1JT8 A;  1K8A C;  1DOM A;  4GN4 B;  1VQ5 A;  4BXX G;  1RCV D;  2N49 A;  1CZW A;  4RCO A;  5C4J H;  1B7Y B;  1OXU A;  3K5N A;  3E3X A;  2OF1 A;  4HSP A;  5J39 A;  4C3H H;  1IHZ A;  3ITP A;  2PQA B;  4QIW E;  1TS5 A;  4NDX A;  4JVZ A;  2NVX B;  3H3V H;  2XTI A;  3IFD A;  2O5J C;  5M5Y H;  1WTQ A;  1IW7 C;  3A74 A;  3O13 A;  5FLX c;  1SE4 A;  1DM0 B;  4ZUJ A;  1S5B D;  4A3J G;  5I2Y A;  2EYO A;  1EFI D;  3BDL A;  1U4M A;  1IBM L;  2B2W A;  1WYD A;  4DV5 Q;  5C3E G;  2BDN A;  3PUV A;  1HCZ A;  3BZK A;  2JA6 B;  2F0T A;  2AMC B;  4JW0 A;  5COR A;  1HA6 A;  2E2H B;  3PIP 3;  5LMU Q;  3TP8 A;  1STH A;  3BZD B;  4C1N K;  2JA5 H;  1X3E A;  4IUQ A;  3L9A X;  1GM5 A;  3S1Q H;  2PYK A;  4WJ3 M;  1EYD A;  5DM7 3;  2K03 A;  1A62 A;  5C44 G;  4DR3 L;  3HOV B;  2WB1 G;  5JPM C;  1VQL A;  3I70 A;  4CGY B;  2E2J B;  1R9T B;  1I4Q A;  4WJW A;  1CZG A;  1Q81 C;  3NQT A;  2X69 A;  4CDE C;  4P73 A;  2WP8 J;  1M90 C;  2QDB A;  1O78 A;  2MNA A;  1OTC A;  4GNX A;  2KEE A;  4WOR A;  1Q1B A;  3M85 A;  1Y1V G;  5IP7 G;  1PFN A;  1TKW B;  2EYJ A;  3K7A H;  1C0A A;  2F0H A;  3H09 A;  1EWC A;  1SMY D;  2CKZ B;  3SVM A;  3PUZ A;  1PH1 A;  2CCZ A;  3VYR A;  3A0J A;  4G7O C;  4LF4 L;  4KD4 A;  2KQ3 A;  4NXM L;  1UE5 A;  3MEF A;  4QIW B;  2TMP A;  1SJH D;  2B2Y C;  2XGT A;  3V05 A;  1LTR D;  2I5L X;  1TS3 A;  3GTG B;  4KY7 A;  1QUQ B;  4A75 A;  2YV5 A;  4RHS A;  4LF7 L;  4MTK A;  4NPS A;  2VXW A;  2DJF C;  3K5O A;  1H9M A;  4GZY C;  3PO2 G;  1KDC A;  1QVC A;  1QWY A;  1S5C D;  1KLU D;  3HP3 A;  3AEV A;  5ELN A;  3ER0 A;  2E2D C;  3ND8 A;  2E76 C;  5CV4 A;  1NUC A;  3S24 A;  4K6L A;  1ENC A;  3S15 H;  1ZYR D;  2A74 C;  1IYU A;  4L5R C;  1YBY A;  4LF6 Q;  4DR1 L;  2F1M A;  4LFC Q;  3EQL C;  1UE6 A;  3MXN A;  1EU4 A;  4IAL A;  4LF8 L;  4QQB X;  2IPK D;  1EOT A;  2JA7 G;  4OEL B;  4CJ0 B;  4BBS B;  1TWG H;  1A0I A;  5FKA C;  4XXE A;  1K83 H;  3J81 L;  3DHQ A;  4KN7 C;  1KNE A;  2QCP X;  2VQE L;  1X55 A;  4APV A;  2JSO A;  1VMP A;  4A3K G;  2SDF A;  1CKO A;  3E0E A;  4G7H C;  4LNQ A;  4OHJ A;  1NMF A;  4EVO A;  1HZC A;  3X3M A;  2RA4 A;  3S17 H;  2GVA A;  1I6H H;  3CCQ A;  1G51 A;  5JEA J;  4FXG C;  4AIM A;  3NP8 A;  1IXR A;  2JN4 A;  2PO4 A;  1YVC A;  3FKI G;  5C4X B;  3QJY A;  4V0B A;  1SXT A;  3H94 A;  1JOO A;  2XWJ B;  3GO5 A;  4XQJ A;  2CWP A;  3CD6 A;  2QGQ A;  1F9R A;  2RSN A;  4DR6 Q;  5DAU A;  1HUN A;  1PRT F;  4HIM A;  2KEN A;  3EBE A;  3D8G A;  4K8J A;  1LTB D;  2L11 A;  1IL8 A;  2K5V A;  3CU7 A;  4X3T A;  3V96 A;  4CKB A;  2A69 D;  4OO1 I;  3BVZ A;  1X56 A;  4JI5 L;  1B1Z A;  3VR3 A;  2PZU A;  2YTV A;  1JJG A;  2XN9 C;  5E1F A;  3HOY G;  2R6G A;  3HKZ E;  1HFG A;  1VS0 A;  3GDE A;  1HNZ L;  2AKW B;  2LMC B;  4DR4 L;  3HOX H;  4DAM A;  3A7A B;  4DNI A;  3H3V I;  1VQC A;  1Q8I A;  1K8G A;  2K50 A;  3M4O B;  1GHK A;  2C9O A;  5ELD A;  4B9W A;  2ZM6 Q;  3L3O C;  4A3I B;  5T1I A;  1XMQ Q;  1YNN D;  3J80 L;  1JOR A;  2RHQ B;  1BVS A;  4NKL A;  2R93 H;  2F52 A;  1CQV A;  4FO2 A;  2AUJ D;  2B2W C;  2G9H D;  3PGZ A;  4GLA C;  2L55 A;  2BA0 A;  4DNT B;  2JA6 G;  2KCM A;  2CW0 D;  2GN5 A;  3TS0 A;  3I3C A;  3GTQ B;  1F9P A;  4EQ5 A;  1QZG A;  4DV2 L;  4RG1 A;  3TP6 A;  4YWM A;  4C2M B;  3J81 j;  1AE3 A;  1CKN A;  2JP1 A;  3VDY A;  1WTV A;  4OX9 Q;  5IE8 A;  1ENA A;  4IUR A;  3NWS A;  4GS3 A;  5IP9 H;  1BBX C;  1EIF A;  2SNS A;  1PH8 A;  3HOV G;  1ET6 A;  3L0O A;  1EYG A;  1LT6 D;  4IZ8 A;  2E74 C;  1UE1 A;  4GNX C;  1S72 A;  4H13 C;  1HUM A;  1BUV T;  2F0F A;  4QJF A;  5M3M B;  5IYD G;  4MN3 A;  4C56 C;  2ICI A;  2E5L Q;  5KND A;  1CK1 A;  1FGU A;  2N3S A;  2RCN A;  4DUZ L;  3FPP A;  2HCI A;  2RDH A;  5AJ3 Q;  4IPD A;  3HKZ B;  5FLM G;  4HIO A;  3BDO A;  4KTA A;  4ALP A;  2V4D A;  1Q46 A;  4TQU S;  4X64 L;  4B9X A;  2EJG C;  4G4K A;  4DR5 Q;  2F0M A;  3A8I E;  3QIA A;  2L5T A;  1FL0 A;  1IBL L;  1VQA A;  2NUC A;  3OW2 A;  4KHZ A;  4K0K Q;  4IUN A;  1W3S A;  4A3L G;  2H5X A;  4IFD J;  1UAP A;  4U67 3;  1A8V A;  4ZKB B;  5M5X B;  2L4N A;  2QEJ C;  3CHB D;  4DGZ A;  2JYO A;  2G9D A;  5AFW A;  5E4X A;  3VR2 A;  3F2B A;  3PF5 A;  3BG3 A;  1HHV A;  3T56 B;  1B9M A;  1NJI C;  4BBR B;  2OEO A;  4A76 A;  4L6T B;  5BN5 A;  1ESR A;  3KLR A;  4BY1 H;  1GUO A;  4L5Q A;  4DUY Q;  1NR2 A;  1TY2 A;  1HNW L;  3SR1 A;  1PZJ D;  4JI4 L;  2A6H D;  2RHS B;  3CC2 A;  3R3O A;  1DCZ A;  3K0Y A;  5LMN L;  3KDF B;  1JJC B;  1QE6 A;  4RKL A;  3KF6 B;  2Q8T A;  4KJN A;  5I6W A;  1AZQ A;  4FYD A;  1Y8P B;  4CKC A;  3T1Y Q;  1ICF B;  3AFQ A;  1FNV A;  4MIU A;  1D5M C;  4C3H B;  3GTM B;  1EU3 A;  2UUA L;  4BBS G;  1STA A;  4AH6 A;  3U4Z A;  1F2Y A;  3CCM A;  2X6L A;  3HKS A;  1HJP A;  2FFK B;  1N36 Q;  4BY7 H;  3NEN A;  4B3M Q;  3S2D B;  4YY3 L;  1LTG D;  1PTO D;  1NE3 A;  1HA5 A;  2NVT H;  2JA5 B;  2PZW A;  1C7Y A;  2K33 A;  1LLR D;  3OPO A;  4EQO A;  3S1Q B;  5C4X G;  2B3G A;  2BCO A;  1K73 C;  1GUS A;  4DV0 L;  1PYB A;  3GTK H;  1FJG L;  1Z9F A;  1SNO A;  1W2B A;  1HXY D;  3TRZ A;  3PUY A;  2KUM A;  4X3U A;  1HQM C;  2M9V A;  3J7A F;  3AFP A;  5GRO A;  1SN8 A;  3QB3 A;  3NWT A;  1QVF A;  1QG7 A;  3MVV A;  3GTL H;  1C4Q A;  3K8A A;  4DN4 M;  2WV6 D;  1T5X D;  4KHP L;  2XNA C;  3MC0 B;  2HHH Q;  1GVP A;  1MBY A;  4PG3 A;  1V1P B;  4GOP C;  1TWC B;  3LNN A;  1VMC A;  3RN5 A;  4A3I G;  1NAP A;  3S16 B;  3J7Z C;  3J7A 5;  1R4Q B;  4XQN A;  4RHR A;  4DR2 Q;  5COY A;  2EVB A;  4A3E H;  3G6J B;  1I6V C;  1GXD C;  2R92 B;  5NUC A;  1HR0 Q;  2ICE C;  3ULL A;  5BR8 L;  2F3V A;  1I94 L;  1PH4 A;  2FJ2 A;  3NTI A;  3TP5 A;  4A3M H;  1YNJ C;  3AYH B;  1K0S A;  2M00 A;  1XMO L;  4A3D H;  2R7F A;  4DV7 L;  3K6O A;  3SGI A;  4OEM B;  1JMC A;  3STB C;  1SNP A;  2CH4 A;  1XNR Q;  2AQ3 B;  1J5E Q;  1XXG A;  2KVM A;  4FNF A;  4TVA B;  1EQV A;  1X3G A;  1IZ6 A;  2FHT A;  5M3M G;  2N8N A;  1VQ9 A;  2UXB L;  4LUZ A;  1TWG B;  1PH7 A;  3UE0 A;  2Z0S A;  3BS1 A;  1K83 B;  4N9T A;  4HMI A;  1ESF A;  4OIK A;  3AQQ A;  2QEX A;  1TS2 A;  1PH9 A;  1XYI A;  3Q0A A;  2SEB D;  3HKZ G;  1LTL A;  4UDU C;  2EYM A;  1X54 A;  1WJJ A;  2MO1 A;  4EQP A;  4JBM A;  1SFO B;  4TRD A;  1NR4 A;  1IKM A;  5IYC H;  1U4R A;  4LAA A;  3S17 B;  4LF5 L;  4JYA Q;  2XRQ D;  3UDG A;  1SMX A;  4F88 A;  1S40 A;  2CH4 W;  2EZV A;  1SE2 A;  1Z47 A;  1ROD A;  2K5W A;  1DZ1 A;  5GAE C;  1M4V A;  1SRO A;  4IUU A;  2XIW A;  2X6G A;  4JI0 Q;  4JCV E;  3EJI A;  1ZXT A;  1QNU A;  4YWL A;  5JJK A;  1TWH H;  2B2Y A;  2F3I A;  4RCN A;  3MXN B;  1Q7Y C;  1KDB A;  4DKA C;  1HRJ A;  2BE5 D;  4NW2 A;  1TWF H;  1SJE D;  2JJQ A;  2UU9 L;  4FF4 A;  4JI3 L;  4BBR G;  3QO2 A;  1DYQ A;  1F9S A;  2IL8 A;  4H0L C;  5A2Q L;  1EY7 A;  1N32 L;  2DNE A;  4JI5 Q;  2A8V A;  1HQR D;  5I4D A;  1Q1E A;  4OO1 G;  2D0O A;  5K36 G;  3S1N B;  4JI6 L;  2KEC A;  2F0U A;  1LT5 D;  4YIJ A;  4DV4 Q;  3IKJ A;  3HOX B;  3BVG A;  3KYH C;  1CT1 D;  1TT2 A;  4A3F H;  2MQH A;  3H0G H;  1Q86 C;  3T1H L;  1HTP A;  4C3H G;  2Q2U A;  2JA7 B;  2EXD A;  4XYO A;  1VQI A;  1UNS A;  1Z6H A;  2C35 B;  2PW7 A;  2OT2 A;  2R93 B;  1PRT B;  3S14 H;  3P20 A;  4X3S A;  4DA2 A;  3CP0 A;  1VDZ A;  2RQX A;  1J6Q A;  3ULP A;  1L0Y B;  2Z6B A;  3RR5 A;  2O5I C;  1BCP C;  1VQD A;  2K7V A;  2WAQ E;  2F0N A;  3E6Z X;  1V8Q A;  4GN3 B;  3VR4 A;  5JJI A;  5IGC A;  1Q82 C;  3GD7 A;  4GKK L;  1E3P A;  2JA5 G;  5ELB A;  3OHX C;  2YU9 B;  1KHI A;  1SBB B;  5KGU A;  1H9K A;  1JB3 A;  1NTG A;  3WOF A;  1E24 A;  1OXV A;  2NWG A;  4DR7 L;  3OTO Q;  5F2D A;  5J1Z A;  1JWS D;  4K2K A;  1SAP A;  3PO3 H;  1EY8 A;  3W2D A;  4Y52 H;  4NP5 A;  1WTP A;  3GTP B;  4MHE A;  1F2M A;  3DM3 A;  1Y8N B;  3M4Q A;  3RUZ A;  3VYU A;  3UDX A;  1Y14 B;  3I4N H;  1U4P A;  2HDM A;  3TZD A;  1N8R C;  4JBK A;  4OON A;  3CF5 A;  4JI8 L;  1EFW A;  3I56 A;  4CDC C;  2IT1 A;  1CTM A;  4JV5 Q;  4OGQ C;  3E9I A;  1CSQ A;  1VQ4 A;  4KY6 A;  4B3R Q;  4YCV A;  5IGF A;  1QOH A;  1U0L A;  2QDL A;  1WTW A;  1BR9 A;  5M3F B;  2ZXO A;  2CQO A;  4X64 Q;  1A3V A;  1SYE A;  2ALY B;  1CKN B;  1AE2 A;  1E2Z A;  4LFB L;  2MP1 A;  1L0W A;  1UWV A;  1PFB A;  2AUK A;  4UAI A;  1I4R A;  1GD7 A;  1EY4 A;  1B50 A;  4L5T A;  1HZ9 A;  2EY6 A;  2K04 A;  3G6E A;  2R92 G;  3QWN A;  1VQB A;  4RH6 A;  3PV0 A;  1F2L A;  2PI2 A;  3CCJ A;  5KNB A;  2WAQ B;  1C8C A;  1PH3 A;  5JAV A;  1E22 A;  5M5W H;  3NEM A;  5IT9 E;  2VB2 X;  2B63 H;  4JBJ A;  4P72 A;  2F03 A;  1Y1W H;  1CHQ D;  1KL9 A;  2IHF A;  2A6E D;  4AYB G;  1MGS A;  5IWA Q;  4DV1 L;  4Y7N H;  5CV9 A;  5C0X J;  4CBV A;  2EYF A;  1X32 A;  3AB9 A;  2P5Z X;  2HT1 A;  2DJG C;  2NVQ B;  3NEL A;  5TSS A;  2Z1C A;  4DK0 A;  1K28 A;  3K5M A;  1SMY C;  1RL2 A;  2Q2I A;  4RGN A;  2KHJ A;  3W1B A;  4X62 Q;  1L1O A;  3S1M B;  3RZD H;  2NBF A;  5EBD A;  1A6X A;  2PNR C;  3RD4 A;  5D3I B;  1A15 A;  1E0B A;  3NTK A;  4MTN A;  5IOD A;  4LFA Q;  3SEB A;  2ZTD A;  4IPC A;  4JI7 L;  2NZO A;  1GKH A;  2OQ0 A;  1KDA A;  2HIV A;  5L37 A;  2BH8 A;  3Q6S A;  1HNX Q;  4KMU C;  5I2X A;  4YWK A;  5ELF A;  2NVT B;  4X66 L;  2JE6 I;  4IO9 A;  4ME3 A;  5LHY 1;  3BJU A;  1QJO A;  2LS0 1;  3A8J E;  3UI2 A;  2O2L D;  5IT9 c;  3GTK B;  1TU2 B;  1A2T A;  4XT1 B;  4P75 A;  3RLO A;  4C3J H;  1X3F A;  1QNK A;  3C3L A;  1WTH A;  4BXX H;  4GKJ Q;  1MIU A;  3JAM L;  1RHP A;  2A5H A;  4LF9 L;  3SDZ A;  3J7A V;  2JA9 A;  1ZYR C;  5H1S E;  4KY5 A;  2ZTC A;  4DAV A;  2L9H A;  3NBH A;  4ZK9 B;  4HJ9 A;  1B3Q A;  1PZI D;  1AH9 A;  1D5X C;  4ABN A;  1ZKO A;  2NN6 H;  1WTR A;  3LWU A;  2DY7 A;  4AQY L;  3S2H H;  1RJT A;  2UUC Q;  3HOX G;  4CDF C;  2FIN B;  3FHW A;  5EJW A;  4B3S L;  1LT4 D;  4F8M A;  2VQF Q;  3D6C A;  4HJ5 A;  5LL6 X;  3M3Y H;  4YHH L;  3GQB A;  1VQM A;  2RSO A;  2R93 G;  3HS0 C;  4HTH A;  4A3E B;  3JC6 6;  1D2B A;  1D1K A;  5GAG C;  2FMM A;  1VQ7 A;  1N33 Q;  4JOI A;  4X65 Q;  2O4X A;  1JB7 A;  3GV6 A;  4IUT A;  1D1I A;  2UXD Q;  1N34 L;  1K3R A;  3T4A C;  5BN4 A;  4BA2 I;  1D6E C;  1JQY D;  3GV3 A;  2YYZ A;  1IBK L;  2D2C C;  4A3M B;  1SYB A;  2QF7 A;  4JI2 L;  2NVY H;  3DXJ C;  2A69 C;  4ZLT F;  1PXU A;  3HFZ B;  1LTS D;  5IP9 G;  4LK1 C;  3E5S A;  4RAU C;  5LMN W;  2K4K A;  1YHA A;  4UP9 A;  2UUB L;  2NB0 A;  4FP5 D;  1STB A;  4CJ2 C;  1KAB A;  3CC7 A;  3MAQ A;  3P75 A;  1PTO H;  3OIQ A;  1DON A;  3F2C A;  4LJZ C;  4A93 B;  2M2L A;  5FO9 B;  3RZO H;  4RA8 A;  1X3P A;  1YNN C;  1C9O A;  2B2U C;  1AW7 A;  2EOT A;  1YZ6 A;  4QMG A;  1N9W A;  1PH5 A;  4RGT A;  3K81 C;  5M3F G;  3NK9 A;  4GLV B;  3RN2 A;  1I3Q H;  3I4O A;  3PO2 H;  1GJX A;  3PMF A;  4ME5 A;  4C3I H;  4LF5 Q;  2CW0 C;  1SNC A;  2UXC Q;  4UY8 C;  1EOV A;  4GOP A;  1F77 A;  5ELO A;  2B8G A;  4P71 A;  1EIG A;  4BS9 A;  1O7Z A;  5G3L F;  3MXP A;  3FP9 A;  2FMC A;  3MZ5 A;  1TWF B;  2WAQ G;  3F2U A;  1XNQ L;  1JE5 A;  3M7G A;  4FXK C;  2ZJR A;  2H4O A;  1KRT A;  2F4V Q;  3PUX A;  5IIF A;  2DGY A;  3J81 E;  1WTX A;  1PMR A;  3NBI A;  3VYS A;  1YI2 A;  2N78 A;  5GAD C;  1RF2 D;  2EY5 A;  1SRU A;  2K1B A;  5GAH C;  2ENB A;  2V1C C;  5I9O A;  4JI1 L;  3DM1 A;  2F0I A;  4A3F B;  3H0G B;  1HH2 P;  1L1O C;  1S5F D;  5BN3 A;  4FVM A;  2NZH A;  5EKI A;  4A3B B;  2BOS A;  3FKI H;  4DV6 Q;  3T1H Q;  1QCB D;  3LGJ A;  5JJL A;  3CME A;  1DXM A;  2RBM A;  3S14 B;  5C4H A;  3ERQ A;  2ZXP A;  2Z8L A;  4CDD C;  3G71 A;  4LUV A;  1VQJ A;  1WTO A;  4NXN L;  1U5K A;  3HGB A;  4M1U B;  3X3N A;  4QUC A;  1Q90 A;  2HD3 A;  1KAW A;  1OXS C;  1STG A;  2K5D A;  4K6D A;  4R4O A;  1O7L A;  4I65 A;  3HOW H;  4R8I A;  4B3T Q;  3P7J A;  2I07 B;  4R4T A;  2QA4 A;  3KLW A;  3PO3 B;  3KOJ A;  4I7Z C;  2PMZ E;  3J81 c;  1B44 D;  1IKL A;  2A6H C;  2FXQ A;  1EYA A;  4BA1 I;  4R8N A;  5EAY A;  2JA8 B;  3N6R A;  1PDQ A;  3TRE A;  1ENF A;  4XT3 B;  2DUD A;  1DGS A;  2HIX A;  3CRL C;  2ES2 A;  4ZAI A;  3S1R B;  1B70 B;  2K6A A;  2NN6 I;  3J80 E;  2D0P A;  1Z7T A;  1TY0 A;  1EIY B;  1ZEQ X;  3M7N A;  4QB4 A;  4UHV A;  1VQE A;  5C0X G;  3K5L A;  4DV5 L;  5FK9 C;  2B2T C;  5DM6 3;  5IYB G;  1AP0 A;  5LMU L;  3TEH B;  4DV3 Q;  3PIO A;  3GTO H;  2JA6 H;  3C1F A;  5C4J B;  4XQQ A;  2RDF A;  2PCF B;  1B4O A;  2PNH A;  3KFU A;  3A5U A;  2ZXR A;  1BDO A;  1F9Q A;  1PTO C;  1CA5 A;  3QOL A;  3H15 A;  5M5Y B;  5C3W A;  3G4S A;  4JOI C;  3HOV H;  4A3E G;  1XPU A;  2R7Z H;  5HUR A;  2E2J H;  1R9T H;  3OSO A;  2EY2 A;  2JQO A;  3KK7 A;  1MI2 A;  2IX0 A;  3T53 B;  1SYF A;  3MHB A;  1SR3 A;  3HG9 A;  4ILW A;  1BCP F;  1QUQ A;  1IBM Q;  3CRK C;  3H6M A;  1T5E A;  5CMD A;  4A3M G;  1W6K A;  1NSN S;  2B63 B;  3DMU A;  3QG1 A;  1Y1W B;  5T1G A;  3CCS A;  1RD9 D;  4AYB E;  3EFX D;  1TWA H;  3SXH A;  1Y8O B;  2YTX A;  4LWC A;  3J80 c;  3IFT A;  1CUK A;  1KRS A;  5FLM H;  1CI3 M;  1XX8 A;  1MD2 D;  2PMZ B;  4DR3 Q;  1YHQ A;  4O1N A;  5C3X A;  1BNZ A;  4HID A;  1WCM H;  1EQQ A;  1G2T A;  4A3C G;  1B9N A;  3DLL A;  1FVI A;  3PUW A;  3I2Z A;  4A93 G;  3DEO A;  2F0D A;  5JJZ A;  1YIT A;  4KK7 A;  2IW3 A;  3OYY A;  3K7A B;  3I4M H;  4EQN A;  2B2V A;  5J22 A;  1VQK A;  2L1B A;  5IYC G;  3OW7 A;  3MWY W;  1PZK D;  3FPU B;  2F0J A;  5FJ8 G;  1IL2 A;  4N8X 1;  4QUF A;  4N8F A;  3BU2 A;  1PRT D;  2K5Q A;  3TDQ A;  2CFM A;  1IYV A;  1EZ8 A;  2VY3 A;  2VUM H;  2C5C A;  5CV6 A;  4LF4 Q;  4NXM Q;  5KNC A;  1LT3 D;  2PW5 A;  4LF6 L;  4LFC L;  1TII D;  4ZYS A;  1M1K C;  1S5E D;  1XJV A;  2B39 A;  1ICW A;  3Q22 A;  4GNX B;  1H9S A;  1L1O B;  1SE3 A;  4KD3 A;  4KKU A;  3V2T A;  3ERO A;  2LSS A;  3A55 A;  4LF7 Q;  2I5M X;  4LW1 A;  5IOC A;  2XSC A;  4EX5 A;  3OOC A;  4AYB B;  1BBW A;  3TS2 A;  3S15 B;  3EN2 A;  4HJ7 A;  1QZH A;  1WD0 A;  3S2H B;  3PIP A;  5LL6 S;  3W1G A;  4OWX B;  1EY6 A;  4R9W A;  4A3F G;  3H0G G;  3C2P A;  4DR1 Q;  3PF4 A;  1BO0 A;  4A3B G;  1PFM A;  3TBI B;  4LF8 Q;  5C4X H;  3M3Y B;  1PLF A;  2R7D A;  4R4C A;  1LTI D;  2K5N A;  1EWI A;  3HOZ H;  2XRS D;  5C5L A;  1AFP A;  1SYC A;  1KTK A;  2VQE Q;  1I4X A;  1PHJ A;  1I50 H;  1UE7 A;  3E0J A;  4A3G H;  1A2U A;  3IAY A;  1I6H B;  3BZC A;  3NBH B;  4L63 B;  4X6A H;  2BE5 C;  3Q8D A;  3CMA A;  2HQL A;  2I46 A;  3HOU H;  1FR3 A;  5FLX L;  4CKE A;  1B8A A;  2RCF A;  3S9W A;  2K05 A;  1VQ6 A;  1MKH A;  1GUG A;  2HCC A;  5CV7 A;  2IHE A;  3PO3 G;  4K2L A;  3K59 A;  1NCV A;  3UDF A;  1LAB A;  1DOL A;  2JA8 G;  1JWU D;  2E2I H;  3I4N G;  2DN8 A;  2MUY A;  1XMQ L;  3CCU A;  1D7Q A;  4C1N I;  4U68 A;  1LO5 D;  2R61 A;  3CKI B;  1E1O A;  2QW7 A;  4UP8 A;  3ZJY C;  5IGG A;  4Q5V A;  2K28 A;  4H7B A;  1O7I A;  2VW9 A;  1RIP A;  1CM9 A;  1HNZ Q;  2Q8R E;  3TSS A;  3A54 A;  5JEA H;  1I3Q B;  3GTQ H;  4IUP A;  4DR4 Q;  3K0X A;  4OX9 L;  3CC4 A;  3TP7 A;  2MGS A;  2WII B;  4C3I B;  2DY8 A;  4OL7 A;  2XWB B;  1K3B C;  3MXU A;  3CCR A;  4IJH A;  4B08 A;  4HSV A;  4HIK A;  3URY A;  3NTH A;  2EE1 A;  2Y0S E;  3HRZ C;  2DNC A;  4HR7 B;  5CC4 A;  4ZRZ A;  4KKS A;  3PSI A;  4J1M A;  1E2V A;  3J81 i;  3ZYY X;  2EQS A;  4TKO B;  1SEB D;  3D4W A;  2E5L L;  3IL8 A;  4DK3 C;  1FNU A;  4DAY A;  4RKB A;  2B63 G;  3LX0 A;  3MA2 B;  5EPJ A;  5HY6 A;  5AJ3 L;  2OQK A;  4DV2 Q;  1Y1W G;  1I4P A;  1HTL D;  2KCN A;  3VA7 A;  3NQI A;  1VQN A;  5J3B A;  1RTN A;  3AU7 A;  2ZJQ A;  5D14 A;  1KC8 C;  2VL6 A;  3OMC A;  5EKK A;  1KNA A;  5D3D A;  2EY1 A;  5EKL A;  4K0K L;  3KDF A;  4GOP B;  5CV8 A;  2SOB A;  4IPG A;  4WRD A;  1EL0 A;  1WFQ A;  1PV4 A;  4PMW A;  4K8I A;  2B2V C;  1K8M A;  4KV6 A;  2PPB C;  1J9O A;  3TME A;  4DUZ Q;  1XTC D;  1A3U A;  2L0C A;  1QIL A;  4RMF A;  1K8O A;  2MPM A;  2F0W A;  2B2U A;  1JJ2 A;  1G8Z D;  1STY A;  3I55 A;  4JK1 C;  2EIF A;  4DUY L;  4BBR H;  5A2Q E;  4NXN Q;  3RLN A;  4L8J A;  2OTJ A;  5KYI A;  1IBL Q;  1GOZ A;  4F7X A;  1H9J A;  4R1J A;  2EPB A;  2Y0S B;  1NNX A;  3J80 i;  2F0E A;  2A68 D;  3HEJ A;  2A6E C;  3T1Y L;  1I4H A;  4K5X A;  3EIV A;  1R4P B;  1TR5 A;  5I9P A;  1JR0 D;  4BY1 B;  3GTM H;  3DUZ A;  1BBU A;  3UDI A;  2IY5 B;  2E75 C;  4J6H A;  1N36 L;  2D5D A;  1TQO A;  4Q0F A;  2F0P A;  4B3M L;  3I90 A;  1HNW Q;  2NN6 G;  3CW2 C;  4JI4 Q;  4GN5 A;  1MJC A;  1IYJ B;  3S2D H;  1LTT D;  4FF2 A;  3GTO B;  3OWE B;  1H9R A;  3NPP A;  4DXG A;  4K5W A;  5LMN Q;  2VS1 A;  3A56 A;  1STE A;  1IW7 D;  2ZJP A;  4J15 A;  4IFD H;  4K14 A;  1BXT A;  1V1P A;  2WFW A;  4PQX A;  2F3W A;  4F87 A;  5ELE A;  3Q23 A;  2J7Z A;  2UUA Q;  4ODG A;  2R7Z B;  1JIC A;  3D0F A;  2Z6K A;  4BY7 B;  3KBX A;  4GLX A;  1GHJ A;  1AZP A;  2QKI C;  2EYL A;  2OTL A;  1PVO A;  4S3S A;  4WJ4 A;  1B3A A;  4XYQ A;  4YY3 Q;  5K5P A;  2ZT9 C;  3ERS X;  4IN3 A;  1CSP A;  1UUP A;  1TWA B;  3GP7 A;  4MZ9 A;  2HHH L;  1JWM D;  2GA4 B;  2JEB I;  2JK8 A;  4ZUI A;  4DV0 Q;  2JXM B;  3D4D A;  4IQZ A;  3FRP B;  1FJG Q;  1WCM B;  1LAC A;  3LWE A;  1DD2 A;  3BYT B;  2I5H A;  2LXJ A;  1EUJ A;  4HCS A;  1ILQ A;  1TWC H;  3RMH A;  4A4I A;  3FVQ A;  5FOB B;  1C48 A;  4DR2 L;  3SK4 A;  5FO8 B;  3S16 H;  4ULL A;  1PYW D;  5CBA E;  2K14 A;  1YJ9 A;  5CYU A;  3GTL B;  5E4W C;  3FDT A;  1PYS B;  3BDC A;  4A3J H;  1HR0 L;  3I4M B;  2ID0 A;  2F0K A;  1X9N A;  5ISR A;  2R92 H;  1BCP B;  2B2T A;  4PV1 C;  3KLS A;  4KLK A;  5C3E H;  4KHP Q;  2IWH A;  3M9B A;  5EQ0 A;  2Q8I B;  2LFN A;  2NTS A;  4C3I G;  5C5M A;  2LKV A;  1EWH A;  1PTO F;  2F0L A;  2VUM B;  4V19 0;  1XNR L;  1J5E L;  4NMZ A;  5I6Y A;  3VYT A;  2WKD A;  2GVB A;  2HQE A;  4NB3 A;  1JCK B;  4DXF A;  5C44 H;  4ZKC B;  3GTJ H;  3CAM A;  4G7Z C;  1EY9 A;  1HZA A;  1WI5 A;  1YHB A;  3Q24 A;  3I91 A;  2B8F A;  3A5Z B;  5BR8 Q;  1I94 Q;  4M8A A;  1VQF A;  1W6J A;  1Y1V H;  5IP7 H;  4HAE A;  1CA6 A;  4A3D B;  1O80 A;  3DWA A;  4G57 A;  5EBC A;  1XMO Q;  1ML0 D;  4DV7 Q;  4JYA L;  3N52 A;  1MHW C;  1SFO H;  3K58 A;  4LUO A;  2D9U A;  2TSS A;  3KLS X;  4POF A;  4JI0 L;  1BQQ T;  5HGT A;  1FD7 D;  5JVG 3;  3H3V C;  2UXB Q;  2AQ1 B;  2CVR A;  3ONA B;  4H44 C;  4DK1 A;  3HOZ B;  3SK8 A;  5E3F A;  2CHB D;  3ND9 A;  1KXL A;  1H9S B;  3KF8 A;  1D8L A;  3NUC A;  1I50 B;  3OWF A;  4DFA A;  3JAM E;  4A3G B;  1O7Y A;  4CHT B;  3BVM A;  3E9H A;  3HOU B;  3EA6 A;  5C6A A;  3HOW G;  2Z4I A;  1E2W A;  3H91 A;  3M4Y A;  3QR8 A;  3R8B A;  4DV4 L;  3S1N H;  2KBN A;  1UEA B;  5DEH A;  1TWH B;  5KRU A;  2Y0S G;  4K5V A;  4ID6 A;  3VR5 A;  1OXX K;  5DLQ E;  1EEF D;  3DEP A;  2F4I A;  2EJF C;  2WIN B;  3KBG A;  3MFG A;  2Q2T A;  2E2I B;  3L7Z C;  4ZCK A;  4WFN 3;  4OIJ A;  4IOC A;  2JA7 H;  4BY1 G;  2RKS A;  4OWW B;  2UU9 Q;  4JI3 Q;  1E1T A;  3MEH A;  1L2F A;  5JVH 3;  1XPR A;  1N32 Q;  5EPL A;  4PZ6 A;  1YJN A;  2A19 A;  4DNR B;  3DWQ A;  3I73 A;  4A3K H;  4IFD I;  4JI6 Q;  1JE4 A;  2K5H A;  1LUZ A;  3W5O A;  1I4G A;  2VZA A;  1I5F A;  1X3Q A;  1TXY A;  2MO0 A;  2NZ1 D;  3P1H A;  5D65 A;  2VNU D;  3JAM c;  1HFN A;  1AEX A;  4HMJ A;  3OTO L;  3KJO A;  4XIG S;  2YU9 H;  4JPB W;  1G2S A;  2K01 A;  3CXC A;  2Z6K C;  2PQA A;  1KQS A;  2IJ0 A;  4JBW A;  3TQY A;  3K80 C;  2R7Z G;  3CQZ H;  4BY7 G;  2Z4H A;  5M3M H;  5CR3 A;  1PA6 A;  3MTS A;  3GTP H;  4KJO A;  1MJE A;  1EEI D;  3SHL A;  2LY7 A;  1RKN A;  4UPA A;  5M9O A;  2ATW A;  3A8K E;  4JV5 L;  2BA1 A;  5GQO A;  4OXP A;  4O2D A;  1VF7 A;  2B29 A;  3HOY H;  4GKK Q;  4B3R L;  5CGK A;  1E7Z A;  1RDP D;  3G7L A;  1YIJ A;  1SSO A;  3WWV A;  2IX1 A;  2AWN A;  2PQE A;  3I72 A;  3MXG A;  4BWG B;  4PZ8 A;  1P16 A;  3I4L A;  1V1O A;  4DR7 Q;  1VQO A;  1GUT A;  1WCM G;  4HJ8 A;  3MFY A;  3KUP A;  2KHS A;  1JOK A;  5M3F H;  4QY7 A;  3W3A A;  3UE1 A;  3I4N B;  3U58 A;  4MNO A;  2K75 A;  1ONL A;  4POG A;  2NVX H;  5C4Z A;  3CPF A;  4YCW A;  4JI8 Q;  1PH2 A;  2PI2 E;  3I4M G;  4L5S A;  1XWE A;  3F2D A;  3B6Y A;  4DAY B;  5FO7 B;  3VA5 A;  4P2C B;  2OXP A;  1V43 A;  2E2H H;  1ASZ A;  5CBE E;  5CV5 A;  4HN7 A;  5ELC A;  5IWA L;  2VUM G;  4LFB Q;  2MJ8 A;  2D62 A;  1AN8 A;  1BF4 A;  2F0Q A;  2MFI A;  2EYP A;  2WAC A;  2RDG A;  1XPO A;  1EQT A;  3F8T A;  2KED A;  1NY4 A;  4XDX A;  1EYC A;  2RF4 A;  3WOE A;  2NVQ H;  3AMU A;  2KJX A;  2R3Z A;  4X62 L;  2A73 B;  3I8Z A;  3SK6 A;  4ZQ3 A;  4DU9 A;  5M5W B;  1G29 1;  1G91 A;  5IYD H;  3TZU A;  5HGQ A;  3S1M H;  4A3D G;  4JG2 A;  1T9H A;  5IGE A;  4LFA L;  5KIX A;  4Y7N B;  2KHI A;  1HPC A;  1HNX L;  1KD1 C;  2CWA A;  4HJA A;  1VQP A;  1SDF A;  2BDO A;  1LTA D;  4DV1 Q;  1LM0 A;  3D6W A;  3VR6 A;  1V9P A;  3C46 A;  3OMG A;  1GUN A;  1U9R A;  4RGM A;  2RVL A;  3A7L A;  4RGO S;  3T16 A;  2KOL A;  3RZD B;  4A3L H;  2YTY A;  3TN2 A;  2WB1 E;  3EVQ A;  1PRT C;  2AWO A;  1P8L A;  3HOZ G;  4GKJ L;  1OXT A;  2G5D A;  4QL5 A;  4PMC A;  3GTG H;  1K0R A;  1TS4 A;  4Z9C B;  1RTO A;  2HUG A;  1DJR D;  4A3G G;  1ILP A;  4DAP A;  3PQI A;  4X3K A;  2KCC A;  4JI7 Q;  1B2T A;  4O42 A;  3NSW A;  3HOU G;  1WOC A;  4KHV A;  1M8A A;  3NE5 B;  2F0V A;  4X66 Q;  3R2T A;  3I7F A;  4DF7 A;  4FXD A;  1LV9 A;  5C0X H;  1Q3L A;  1YJW A;  3U4V A;  2IX3 A;  2UUC L;  3CCV A;  5IYB H;  4C3J B;  1G6Z A;  2EDG A;  3D4R A;  1YNX A;  3WDN A;  1S4Z A;  2VQF L;  2J4X A;  1NMG A;  3CPW A;  2OCE A;  4QCL A;  2L15 A;  4LF9 Q;  3IRB A;  1CFM A;  2CQA A;  2ZTE A;  4BBS H;  3NXW A;  2EYH A;  1WVL A;  1N33 L;  3PCO B;  3ICE A;  1X65 A;  4X65 L;  1BKB A;  3OIP A;  3RNU A;  4A3J B;  4R4Q A;  2UXD L;  4YCU A;  1UEB A;  1FYC A;  5C3E B;  5IGD A;  3D3R A;  1CHP D;  1VF5 C;  5JEA G;  4AQY Q;  3HZX A;  4HCE A;  5G3L D;  2F0O A;  1CKM A;  5EPK A;  3SK5 A;  1NBW A;  4B3S Q;  1VQ8 A;  4DR6 L;  1F2Z A;  1DOK A;  2QIL A;  5JOB A;  5C44 B;  2NYZ D;  2WB1 B;  2OWO A;  1EZ6 A;  1KAA A;  3GTJ B;  3M4P A;  2N88 A;  4H02 A;  4YHH Q;  3ULJ A;  1YNJ D;  4UP7 A;  1Q8K A;  2F0G A;  1PH6 A;  3CCL A;  4A3C H;  1GO3 E;  1N34 Q;  2A1A A;  1X6O A;  2NVY B;  1Y1V B;  3STB D;  1IBK Q;  4A93 H;  3NHH A;  1K9M C;  4JI2 Q;  1QB5 D;  1GUW A;  1JOQ A;  1JC7 A;  4IOA A;  2JEA I;  1XTD A;  3J7Y W;  1SYG A;  2PZT A;  1Y69 U;  2UUB Q;  2VB3 X;  4P74 A;  3D31 A;  2ZM6 L;  5EGT A;  2UXC L;  2LXK A;  2Z9H A;  3T51 B;  5FJ8 H;  3M4O H;  3K57 A;  1PTO B;  1LYL A;  4A3I H;  1WD1 A;  3JAM i;  1KIX A;  1YEZ A;  1FNW A;  3RZO B;  4FDB A;  4KKT A;  2KCT A;  2NTT A;  4PZ7 A;  1U4L A;  4CJ1 B;  4QF4 A;  3R93 A;  4FF1 A;  1PFS A;  3PO2 B;  2F4V L;  3PIO 3;  2MHV A;  1BOS A;  1L0X B;  4C2M H;  5DNF A;  1KLG D;  4HED A;  1OO9 B;  4PMB A;  3L2P A;  3U50 C;  5IY0 A;  4RWS C;  5A35 A;  3SE0 A;  2BH2 A;  1ASY A;  2ASB A;  4I7A A;  1VCI A;  1SE8 A;  1II3 A;  3FMC A;  1V1Q A;  1S3O A;  4IJL A;  4JC0 A;  4DV6 L;  2EJM A;  1CQF A;  3K7U C; 
#chains in the Genus database with same CATH homology
 3BYY B;  1SNM A;  5IT9 L;  3T13 A;  4KN4 C;  1Q12 A;  5KEE A;  1MSH A;  4RFB A;  1ET9 A;  4LMQ D;  1J8I A;  3QOJ A;  2EXZ A;  2H1E A;  1EY0 A;  2SNM A;  4A3K B;  3U9O A;  1S5D D;  4N9P A;  1FGB D;  1TVX A;  4FF3 A;  4TSS A;  4PNY A;  4IUV A;  3R2I A;  2WKC A;  2HDL A;  2L12 A;  5KYL A;  4IFD G;  4EGV A;  2KA7 A;  3FKI B;  5FLX E;  2F0S A;  3DWP A;  5IGB A;  1B53 A;  2K32 A;  1SNQ A;  1BCP D;  5JPN C;  3CQZ B;  1SYD A;  2N55 A;  1MSG A;  1EIH A;  2XVS A;  4J8Q A;  2J0T D;  2AQ2 B;  2A68 C;  5C0X I;  3C1E A;  3HOW B;  3FEW X;  3HOY B;  1A3T A;  1EY5 A;  4OO1 H;  1D5Z C;  5K36 H;  3RLF A;  4KI0 A;  3U9S A;  4E6I A;  1STN A;  4C3J G;  4XTC S;  1SND A;  1DOM A;  1RCV D;  1CZW A;  4RCO A;  1OXU A;  3K5N A;  2OF1 A;  4HSP A;  5J39 A;  1IHZ A;  3ITP A;  1TS5 A;  4NDX A;  2NVX B;  2O5J C;  3IFD A;  1WTQ A;  1IW7 C;  3O13 A;  1SE4 A;  1DM0 B;  4ZUJ A;  1S5B D;  5I2Y A;  2EYO A;  1EFI D;  3BDL A;  1U4M A;  2B2W A;  2BDN A;  3PUV A;  1HCZ A;  2JA6 B;  2F0T A;  1HA6 A;  5COR A;  2E2H B;  3PIP 3;  3TP8 A;  1STH A;  3BZD B;  4C1N K;  4IUQ A;  3L9A X;  2PYK A;  1EYD A;  5DM7 3;  2K03 A;  3HOV B;  5JPM C;  3I70 A;  4CGY B;  2E2J B;  1R9T B;  1I4Q A;  4WJW A;  1CZG A;  3NQT A;  2X69 A;  2WP8 J;  2QDB A;  1O78 A;  2KEE A;  4WOR A;  1Q1B A;  3M85 A;  1PFN A;  1TKW B;  2EYJ A;  2F0H A;  3H09 A;  1EWC A;  1SMY D;  3SVM A;  3PUZ A;  3VYR A;  4G7O C;  4KD4 A;  2KQ3 A;  4QIW B;  2TMP A;  1SJH D;  2B2Y C;  3V05 A;  1LTR D;  1TS3 A;  3GTG B;  4KY7 A;  4RHS A;  2VXW A;  3K5O A;  1H9M A;  4GZY C;  1KDC A;  1S5C D;  1QWY A;  1KLU D;  3HP3 A;  2E2D C;  3ND8 A;  2E76 C;  5CV4 A;  1NUC A;  4K6L A;  1ENC A;  1ZYR D;  2A74 C;  1IYU A;  2F1M A;  3EQL C;  3MXN A;  1EU4 A;  4IAL A;  2IPK D;  1EOT A;  4CJ0 B;  4BBS B;  5FKA C;  4XXE A;  3J81 L;  3DHQ A;  4KN7 C;  1KNE A;  2QCP X;  2JSO A;  1VMP A;  2SDF A;  4G7H C;  4OHJ A;  4EVO A;  3X3M A;  2RA4 A;  5JEA J;  4FXG C;  3NP8 A;  2PO4 A;  5C4X B;  4V0B A;  3QJY A;  1SXT A;  3H94 A;  1JOO A;  2XWJ B;  3GO5 A;  4XQJ A;  1F9R A;  2RSN A;  5DAU A;  1HUN A;  1PRT F;  3D8G A;  4K8J A;  1LTB D;  2L11 A;  1IL8 A;  3CU7 A;  4X3T A;  3V96 A;  4CKB A;  2A69 D;  4OO1 I;  3BVZ A;  1B1Z A;  3VR3 A;  2PZU A;  2XN9 C;  5E1F A;  2R6G A;  1HFG A;  2LMC B;  3A7A B;  1Q8I A;  3M4O B;  1GHK A;  2C9O A;  5ELD A;  4B9W A;  3L3O C;  4A3I B;  5T1I A;  1YNN D;  3J80 L;  1JOR A;  4NKL A;  1CQV A;  4FO2 A;  2AUJ D;  2B2W C;  2G9H D;  2L55 A;  2BA0 A;  4DNT B;  2CW0 D;  3I3C A;  3GTQ B;  1F9P A;  3TP6 A;  4C2M B;  2JP1 A;  1WTV A;  1ENA A;  4IUR A;  3NWS A;  1BBX C;  2SNS A;  1ET6 A;  1LT6 D;  4IZ8 A;  2E74 C;  4H13 C;  1HUM A;  1BUV T;  2F0F A;  5M3M B;  4MN3 A;  4C56 C;  2ICI A;  5KND A;  1CK1 A;  3FPP A;  2HCI A;  2RDH A;  3HKZ B;  3BDO A;  4KTA A;  2V4D A;  4TQU S;  4B9X A;  2EJG C;  4G4K A;  2F0M A;  3A8I E;  3QIA A;  2L5T A;  2NUC A;  4KHZ A;  4IUN A;  4IFD J;  1UAP A;  4U67 3;  4ZKB B;  5M5X B;  2L4N A;  2QEJ C;  3CHB D;  4DGZ A;  2JYO A;  2G9D A;  5AFW A;  3VR2 A;  5E4X A;  3BG3 A;  1HHV A;  3T56 B;  1B9M A;  4BBR B;  2OEO A;  4L6T B;  5BN5 A;  1ESR A;  3KLR A;  1GUO A;  1NR2 A;  1TY2 A;  3SR1 A;  1PZJ D;  2A6H D;  3R3O A;  1DCZ A;  3K0Y A;  1QE6 A;  5I6W A;  4RKL A;  2Q8T A;  4KJN A;  4FYD A;  1AZQ A;  1Y8P B;  4CKC A;  1FNV A;  4MIU A;  1D5M C;  4C3H B;  3GTM B;  1EU3 A;  1STA A;  1F2Y A;  2X6L A;  2FFK B;  3S2D B;  1LTG D;  1PTO D;  1HA5 A;  2JA5 B;  2PZW A;  2K33 A;  1LLR D;  3OPO A;  4EQO A;  3S1Q B;  2BCO A;  1GUS A;  1SNO A;  1HXY D;  3PUY A;  2KUM A;  4X3U A;  1HQM C;  2M9V A;  3J7A F;  3QB3 A;  3NWT A;  1QG7 A;  3MVV A;  1C4Q A;  4DN4 M;  2WV6 D;  1T5X D;  2XNA C;  3MC0 B;  1MBY A;  1V1P B;  1TWC B;  3LNN A;  1VMC A;  1NAP A;  3S16 B;  1R4Q B;  4XQN A;  4RHR A;  5COY A;  2EVB A;  3G6J B;  1I6V C;  1GXD C;  2R92 B;  5NUC A;  2ICE C;  2F3V A;  2FJ2 A;  3NTI A;  3TP5 A;  1YNJ C;  2M00 A;  3K6O A;  1SNP A;  2AQ3 B;  1XXG A;  2KVM A;  4FNF A;  1EQV A;  2FHT A;  1TWG B;  3BS1 A;  1K83 B;  4N9T A;  4HMI A;  1ESF A;  4OIK A;  1TS2 A;  1XYI A;  3Q0A A;  2SEB D;  4UDU C;  2EYM A;  4EQP A;  1SFO B;  4TRD A;  1NR4 A;  1IKM A;  1U4R A;  4LAA A;  3S17 B;  2XRQ D;  4F88 A;  2EZV A;  1SE2 A;  1Z47 A;  1ROD A;  2K5W A;  1DZ1 A;  1M4V A;  4IUU A;  2XIW A;  2X6G A;  3EJI A;  1ZXT A;  1QNU A;  2B2Y A;  4RCN A;  1KDB A;  1HRJ A;  2BE5 D;  4NW2 A;  1SJE D;  4FF4 A;  3QO2 A;  1DYQ A;  1F9S A;  2IL8 A;  4H0L C;  5A2Q L;  1EY7 A;  2DNE A;  1HQR D;  5I4D A;  1Q1E A;  4OO1 G;  5K36 G;  3S1N B;  2KEC A;  2F0U A;  1LT5 D;  4YIJ A;  3IKJ A;  3HOX B;  3BVG A;  1CT1 D;  1TT2 A;  1HTP A;  4C3H G;  2JA7 B;  4XYO A;  1Z6H A;  1UNS A;  2PW7 A;  2OT2 A;  2R93 B;  1PRT B;  3P20 A;  4X3S A;  4DA2 A;  1VDZ A;  2RQX A;  1L0Y B;  2O5I C;  1BCP C;  2K7V A;  2F0N A;  3E6Z X;  1V8Q A;  3VR4 A;  5IGC A;  3GD7 A;  5ELB A;  3OHX C;  2YU9 B;  1SBB B;  5KGU A;  1H9K A;  1JB3 A;  3WOF A;  1OXV A;  2NWG A;  5F2D A;  5J1Z A;  1JWS D;  4K2K A;  1SAP A;  1EY8 A;  3W2D A;  4NP5 A;  1WTP A;  3GTP B;  4MHE A;  1F2M A;  1Y8N B;  3RUZ A;  3VYU A;  1U4P A;  2HDM A;  3TZD A;  2IT1 A;  1CTM A;  4OGQ C;  4KY6 A;  5IGF A;  1QOH A;  1WTW A;  1BR9 A;  5M3F B;  2ZXO A;  1A3V A;  1SYE A;  1E2Z A;  2MP1 A;  1PFB A;  2AUK A;  4UAI A;  1I4R A;  1EY4 A;  1B50 A;  2EY6 A;  2K04 A;  3QWN A;  4RH6 A;  3PV0 A;  1F2L A;  5KNB A;  2WAQ B;  1C8C A;  5JAV A;  5IT9 E;  2VB2 X;  2F03 A;  1CHQ D;  2A6E D;  1MGS A;  5CV9 A;  5C0X J;  4CBV A;  2EYF A;  1X32 A;  3AB9 A;  2NVQ B;  5TSS A;  2Z1C A;  4DK0 A;  3K5M A;  1SMY C;  4RGN A;  3S1M B;  2NBF A;  5EBD A;  1A6X A;  2PNR C;  3RD4 A;  5D3I B;  1A15 A;  1E0B A;  3NTK A;  5IOD A;  3SEB A;  1KDA A;  3Q6S A;  4KMU C;  5I2X A;  5ELF A;  2NVT B;  2JE6 I;  5LHY 1;  1QJO A;  2LS0 1;  3A8J E;  3UI2 A;  2O2L D;  3GTK B;  1TU2 B;  1A2T A;  4XT1 B;  1QNK A;  3C3L A;  3JAM L;  1RHP A;  2A5H A;  3J7A V;  3SDZ A;  1ZYR C;  4KY5 A;  4DAV A;  2L9H A;  3NBH A;  4ZK9 B;  1PZI D;  1D5X C;  4ABN A;  1ZKO A;  2NN6 H;  1WTR A;  3LWU A;  2DY7 A;  1RJT A;  2FIN B;  5EJW A;  1LT4 D;  4F8M A;  3D6C A;  5LL6 X;  3GQB A;  2RSO A;  3HS0 C;  4HTH A;  4A3E B;  1D2B A;  1D1K A;  2FMM A;  2O4X A;  3GV6 A;  4IUT A;  1D1I A;  3T4A C;  5BN4 A;  4BA2 I;  1D6E C;  1JQY D;  3GV3 A;  2YYZ A;  2D2C C;  4A3M B;  1SYB A;  2QF7 A;  3DXJ C;  2A69 C;  4ZLT F;  1PXU A;  1LTS D;  4LK1 C;  3E5S A;  4RAU C;  2NB0 A;  4FP5 D;  1STB A;  4CJ2 C;  1KAB A;  3MAQ A;  3P75 A;  1PTO H;  3OIQ A;  1DON A;  4LJZ C;  4A93 B;  2M2L A;  5FO9 B;  4RA8 A;  1X3P A;  1YNN C;  2B2U C;  1AW7 A;  2EOT A;  4QMG A;  4RGT A;  3NK9 A;  1GJX A;  3PMF A;  4ME5 A;  2CW0 C;  1SNC A;  1F77 A;  2B8G A;  1EIG A;  4BS9 A;  1O7Z A;  5G3L F;  3MXP A;  2FMC A;  3MZ5 A;  1TWF B;  3F2U A;  3M7G A;  4FXK C;  2H4O A;  3PUX A;  5IIF A;  3J81 E;  1WTX A;  1PMR A;  3NBI A;  3VYS A;  1RF2 D;  2EY5 A;  2K1B A;  2ENB A;  5I9O A;  3DM1 A;  2F0I A;  4A3F B;  3H0G B;  1S5F D;  5BN3 A;  4FVM A;  5EKI A;  4A3B B;  2BOS A;  1QCB D;  1DXM A;  2RBM A;  3S14 B;  5C4H A;  3ERQ A;  2ZXP A;  2Z8L A;  1WTO A;  3HGB A;  4M1U B;  3X3N A;  4QUC A;  1Q90 A;  1OXS C;  1STG A;  2K5D A;  4K6D A;  1O7L A;  4I65 A;  4R8I A;  3P7J A;  2I07 B;  3PO3 B;  4I7Z C;  1B44 D;  1IKL A;  2A6H C;  1EYA A;  4BA1 I;  4R8N A;  2JA8 B;  3N6R A;  1PDQ A;  1ENF A;  4XT3 B;  3CRL C;  4ZAI A;  3S1R B;  2K6A A;  2NN6 I;  3J80 E;  1Z7T A;  1TY0 A;  1ZEQ X;  3M7N A;  4QB4 A;  5C0X G;  3K5L A;  5FK9 C;  2B2T C;  5DM6 3;  1AP0 A;  3C1F A;  5C4J B;  4XQQ A;  2RDF A;  2PCF B;  1B4O A;  2ZXR A;  1BDO A;  1F9Q A;  1PTO C;  1CA5 A;  3QOL A;  5M5Y B;  5C3W A;  5HUR A;  3OSO A;  2EY2 A;  3KK7 A;  1MI2 A;  2IX0 A;  3T53 B;  1SYF A;  3MHB A;  3HG9 A;  4ILW A;  1BCP F;  3CRK C;  3H6M A;  1T5E A;  5CMD A;  1W6K A;  1NSN S;  2B63 B;  3DMU A;  3QG1 A;  1Y1W B;  5T1G A;  1RD9 D;  3EFX D;  3SXH A;  1Y8O B;  3IFT A;  1CI3 M;  1XX8 A;  1MD2 D;  2PMZ B;  4O1N A;  5C3X A;  1BNZ A;  1G2T A;  1B9N A;  3PUW A;  3DEO A;  2F0D A;  5JJZ A;  4KK7 A;  2IW3 A;  3K7A B;  4EQN A;  2B2V A;  5J22 A;  2L1B A;  3OW7 A;  3MWY W;  1PZK D;  3FPU B;  2F0J A;  4QUF A;  1PRT D;  2K5Q A;  3TDQ A;  1IYV A;  1EZ8 A;  2C5C A;  5CV6 A;  5KNC A;  1LT3 D;  2PW5 A;  1TII D;  4ZYS A;  1S5E D;  2B39 A;  1ICW A;  3Q22 A;  1H9S A;  1SE3 A;  4KD3 A;  3V2T A;  4KKU A;  3ERO A;  3A55 A;  5IOC A;  2XSC A;  3OOC A;  4AYB B;  3S15 B;  1WD0 A;  3S2H B;  5LL6 S;  1EY6 A;  4R9W A;  3C2P A;  1BO0 A;  1PFM A;  3TBI B;  3M3Y B;  1PLF A;  1LTI D;  2XRS D;  5C5L A;  1AFP A;  1SYC A;  1KTK A;  1I4X A;  3E0J A;  1A2U A;  3IAY A;  1I6H B;  4L63 B;  2BE5 C;  2I46 A;  1FR3 A;  5FLX L;  4CKE A;  3S9W A;  2K05 A;  1GUG A;  2HCC A;  5CV7 A;  4K2L A;  3K59 A;  1NCV A;  1LAB A;  1DOL A;  1JWU D;  2DN8 A;  2MUY A;  4C1N I;  4U68 A;  1LO5 D;  2R61 A;  3CKI B;  5IGG A;  4Q5V A;  2K28 A;  4H7B A;  1CM9 A;  2Q8R E;  3TSS A;  3A54 A;  5JEA H;  1I3Q B;  4IUP A;  3TP7 A;  2MGS A;  2WII B;  4C3I B;  2DY8 A;  4OL7 A;  2XWB B;  3MXU A;  4B08 A;  4HSV A;  3URY A;  3NTH A;  2EE1 A;  3HRZ C;  2DNC A;  4HR7 B;  5CC4 A;  4ZRZ A;  4KKS A;  4J1M A;  1E2V A;  3ZYY X;  4TKO B;  1SEB D;  3D4W A;  3IL8 A;  1FNU A;  4DAY A;  4RKB A;  3LX0 A;  3MA2 B;  5EPJ A;  1I4P A;  1HTL D;  2KCN A;  3VA7 A;  3NQI A;  1RTN A;  3AU7 A;  5D14 A;  3OMC A;  5EKK A;  1KNA A;  5D3D A;  2EY1 A;  5EKL A;  5CV8 A;  2SOB A;  4WRD A;  1EL0 A;  4PMW A;  4K8I A;  2B2V C;  1K8M A;  4KV6 A;  2PPB C;  1J9O A;  3TME A;  1XTC D;  1A3U A;  2L0C A;  1QIL A;  1K8O A;  2MPM A;  2F0W A;  2B2U A;  1G8Z D;  1STY A;  4JK1 C;  5A2Q E;  4L8J A;  5KYI A;  4F7X A;  1GOZ A;  1H9J A;  2EPB A;  2Y0S B;  2F0E A;  2A68 D;  3HEJ A;  2A6E C;  1I4H A;  4K5X A;  1R4P B;  1TR5 A;  5I9P A;  1JR0 D;  4BY1 B;  3DUZ A;  2E75 C;  4J6H A;  2D5D A;  1TQO A;  4Q0F A;  2F0P A;  3I90 A;  2NN6 G;  1LTT D;  4FF2 A;  3GTO B;  3OWE B;  1H9R A;  3NPP A;  4DXG A;  4K5W A;  3A56 A;  1STE A;  1IW7 D;  4IFD H;  4K14 A;  1BXT A;  1V1P A;  4PQX A;  2F3W A;  4F87 A;  5ELE A;  3Q23 A;  2J7Z A;  4ODG A;  2R7Z B;  1JIC A;  4BY7 B;  3KBX A;  1GHJ A;  1AZP A;  2QKI C;  2EYL A;  4S3S A;  1B3A A;  4XYQ A;  5K5P A;  2ZT9 C;  4IN3 A;  1UUP A;  1TWA B;  3GP7 A;  1JWM D;  2GA4 B;  2JEB I;  4ZUI A;  2JXM B;  3D4D A;  4IQZ A;  3FRP B;  1WCM B;  1LAC A;  3LWE A;  1DD2 A;  3BYT B;  4HCS A;  1ILQ A;  3RMH A;  3FVQ A;  5FOB B;  1C48 A;  3SK4 A;  5FO8 B;  4ULL A;  1PYW D;  5CBA E;  5CYU A;  3GTL B;  5E4W C;  3FDT A;  3BDC A;  3I4M B;  2ID0 A;  2F0K A;  5ISR A;  1BCP B;  2B2T A;  4PV1 C;  3KLS A;  2IWH A;  5EQ0 A;  2Q8I B;  2LFN A;  2NTS A;  4C3I G;  5C5M A;  2LKV A;  1EWH A;  1PTO F;  2F0L A;  2VUM B;  4V19 0;  4NMZ A;  5I6Y A;  3VYT A;  2WKD A;  2HQE A;  4DXF A;  1JCK B;  4ZKC B;  4G7Z C;  1EY9 A;  3Q24 A;  3I91 A;  2B8F A;  4M8A A;  1W6J A;  4HAE A;  1CA6 A;  4A3D B;  1O80 A;  3DWA A;  4G57 A;  5EBC A;  1ML0 D;  3N52 A;  3K58 A;  2D9U A;  2TSS A;  3KLS X;  1BQQ T;  5HGT A;  1FD7 D;  5JVG 3;  3H3V C;  2AQ1 B;  2CVR A;  3ONA B;  4H44 C;  4DK1 A;  3HOZ B;  3SK8 A;  5E3F A;  2CHB D;  3ND9 A;  1H9S B;  3KF8 A;  3NUC A;  1I50 B;  3OWF A;  4DFA A;  3JAM E;  4A3G B;  1O7Y A;  4CHT B;  3BVM A;  3HOU B;  3EA6 A;  5C6A A;  2Z4I A;  1E2W A;  3H91 A;  3M4Y A;  3R8B A;  1UEA B;  5DEH A;  1TWH B;  5KRU A;  4K5V A;  4ID6 A;  3VR5 A;  1OXX K;  1EEF D;  3DEP A;  2F4I A;  2EJF C;  2WIN B;  3KBG A;  3MFG A;  2E2I B;  3L7Z C;  4WFN 3;  4OIJ A;  2RKS A;  3MEH A;  5JVH 3;  5EPL A;  4DNR B;  3DWQ A;  3I73 A;  4IFD I;  1JE4 A;  1I4G A;  1X3Q A;  2NZ1 D;  3P1H A;  5D65 A;  2VNU D;  1HFN A;  1AEX A;  4HMJ A;  4XIG S;  1G2S A;  2K01 A;  2IJ0 A;  4JBW A;  2Z4H A;  5CR3 A;  3MTS A;  4KJO A;  1EEI D;  3SHL A;  2LY7 A;  1RKN A;  5M9O A;  3A8K E;  2BA1 A;  1VF7 A;  5CGK A;  1RDP D;  3G7L A;  1SSO A;  2IX1 A;  2AWN A;  2PQE A;  3I72 A;  3MXG A;  4BWG B;  3I4L A;  1V1O A;  1GUT A;  3MFY A;  3KUP A;  2KHS A;  1JOK A;  3W3A A;  3I4N B;  1ONL A;  5C4Z A;  1XWE A;  5FO7 B;  3VA5 A;  4P2C B;  2OXP A;  1V43 A;  5CBE E;  5CV5 A;  4HN7 A;  5ELC A;  2MJ8 A;  2D62 A;  1AN8 A;  1BF4 A;  2F0Q A;  2EYP A;  2WAC A;  2RDG A;  1EQT A;  2KED A;  4XDX A;  1EYC A;  3WOE A;  3AMU A;  2KJX A;  2R3Z A;  2A73 B;  3I8Z A;  3SK6 A;  4ZQ3 A;  4DU9 A;  5M5W B;  1G29 1;  1G91 A;  3TZU A;  5IGE A;  5KIX A;  4Y7N B;  1HPC A;  1SDF A;  2BDO A;  1LTA D;  3D6W A;  3VR6 A;  3C46 A;  3OMG A;  1GUN A;  1U9R A;  4RGM A;  2RVL A;  3A7L A;  4RGO S;  3T16 A;  2KOL A;  3RZD B;  3TN2 A;  3EVQ A;  1PRT C;  2AWO A;  1OXT A;  4PMC A;  1TS4 A;  4Z9C B;  1RTO A;  2HUG A;  1DJR D;  1ILP A;  4DAP A;  4X3K A;  2KCC A;  1B2T A;  4O42 A;  3NSW A;  4KHV A;  1M8A A;  3NE5 B;  2F0V A;  4FXD A;  3R2T A;  4DF7 A;  1LV9 A;  5C0X H;  1Q3L A;  2IX3 A;  4C3J B;  1G6Z A;  2EDG A;  3D4R A;  3WDN A;  1S4Z A;  2J4X A;  4QCL A;  1CFM A;  2CQA A;  3NXW A;  2EYH A;  1WVL A;  3OIP A;  4A3J B;  1FYC A;  5C3E B;  5IGD A;  3D3R A;  1CHP D;  1VF5 C;  5JEA G;  3HZX A;  4HCE A;  5G3L D;  2F0O A;  5EPK A;  3SK5 A;  1F2Z A;  1DOK A;  2QIL A;  5JOB A;  5C44 B;  2NYZ D;  2WB1 B;  3GTJ B;  1EZ6 A;  1KAA A;  2N88 A;  1YNJ D;  2F0G A;  2NVY B;  1Y1V B;  3NHH A;  1QB5 D;  1GUW A;  1JOQ A;  1JC7 A;  2JEA I;  3J7Y W;  1SYG A;  2PZT A;  1Y69 U;  2VB3 X;  3D31 A;  5EGT A;  3T51 B;  3K57 A;  1PTO B;  1WD1 A;  1FNW A;  3RZO B;  4KKT A;  2NTT A;  1U4L A;  4CJ1 B;  4QF4 A;  3R93 A;  4FF1 A;  3PO2 B;  3PIO 3;  2MHV A;  1BOS A;  1L0X B;  5DNF A;  1KLG D;  4HED A;  1OO9 B;  4PMB A;  4RWS C;  5A35 A;  3SE0 A;  1VCI A;  1II3 A;  3FMC A;  2EJM A;  1CQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...