2NUCA

Staphlococcal nuclease, ethane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nucA00
1EY4A 2F0TA 5J39A 4DU9A 1STHA 3HZXA 1STBA 4HMIA 2F0JA 5JAVA 1SNOA 1A3TA 2F0IA 4KV6A 5J1ZA 2F0FA 1A2UA 1STGA 5CV4A 4YIJA 3SK4A 3U9OA 2F0DA 2NUCA 5CR3A 5KYLA 1SYBA 1EQVA 3D6CA 1IHZA 1SNDA 2F0EA 3D8GA 3ITPA 4IZ8A 4QF4A 3MZ5A 2F0HA 2PZWA 3TMEA 5KRUA 2PW5A 4TRDA 4J6HA 4WRDA 1SNQA 2EYLA 4PMCA 2KQ3A 2RDFA 3QOLA 2F0WA 3TP8A 3OSOA 1TT2A 5CV5A 1EY5A 2RKSA 4NP5A 2QDBA 3R3OA 5C5MA 5NUCA 3TP6A 2M00A 2F0PA 4ME5A 4KHVA 4KJOA 1SNPA 5I9OA 1JORA 3T13A 3DMUA 3EVQA 3MEHA 3NUCA 4KD3A 1EYDA 3C1FA 4K5WA 4QB4A 5CGKA 4LAAA 3OMCA 3OWFA 4HMJA 5DEHA 1STNA 3PMFA 3ERQA 1RKNA 4WORA 5IODA 2F0KA 1SYEA 4ZUIA 5EKKA 2WACA 3E5SA 5CV8A 2PW7A 4N9TA 2ENBA 4DGZA 1KDAA 1A3UA 3NQTA 2EXZA 3V2TA 1A3VA 2PZUA 1SYFA 1SYDA 2OEOA 3BDCA 1EY6A 5K5PA 4F7XA 4EQPA 3H6MA 3S9WA 4G57A 3VA5A 1ENAA 3EJIA 1SYGA 1F2ZA 2EYPA 3SK5A 1TR5A 2HQEA 5IGGA 5HGTA 1EY8A 2SNMA 3D4WA 4QMGA 5C4ZA 3HEJA 1KAAA 4EQOA 2F0OA 5ISRA 5IGCA 5C3WA 2EYJA 3C1EA 2O4XA 5J22A 5KIXA 2PZTA 1SNMA 5C4HA 4ZQ3A 4KD4A 3NXWA 2F0GA 1NUCA 2F0QA 4K5VA 1JOKA 4OL7A 2F0NA 2F3WA 5F2DA 3D4DA 1EY0A 4ID6A 4K8JA 4K8IA 3SHLA 5E1FA 3RUZA 5E3FA 2F3VA 4KTAA 2KHSA 5DAUA 2EY5A 5KEEA 5HURA 3MVVA 2F0VA 3NP8A 5C3XA 4ZUJA 5IGBA 4EVOA 4KJNA 1JOOA 5KGUA 4DF7A 5CV9A 2EYFA 4S3SA 1EYCA 1SNCA 4KY5A 4ODGA 1EY9A 2EY1A 5CV7A 1EZ8A 1EYAA 4HTHA 4IALA 4N9PA 3SXHA 2EYOA 2EYMA 1AEXA 2LKVA 4H7BA 1A2TA 3TP5A 1TQOA 4E6IA 1II3A 1NSNS 3BDLA 3DHQA 3QB3A 4K14A 4R8NA 5C5LA 4B9WA 5CC4A 5IOCA 5KYIA 5M9OA 1STAA 4I65A 4NKLA 2EYHA 5CV6A 1KDBA 2SOBA 3SK8A 4PMBA 3P1HA 3P75A 4KY6A 3TP7A 3MHBA 5IIFA 3NHHA 4RKBA 5I9PA 3NK9A 1KABA 2EY2A 2RBMA 4K2LA 1EY7A 2F0MA 1ENCA 2PQEA 4KY7A 4PNYA 5IGEA 5IGFA 3EROA 4NDXA 5JOBA 4MIUA 1STYA 2EY6A 2PYKA 1F2MA 1KDCA 2OF1A 4K2KA 5EKLA 1EZ6A 1JOQA 1F2YA 5EGTA 4EQNA 4RKLA 2F0SA 4NMZA 3SK6A 4K6DA 5IGDA 4DFAA 5I6YA 3T16A 2SNSA 3LX0A 4F8MA 2OXPA 2F0UA 3QOJA 2F0LA 3SR1A 4J1MA 4B9XA 5C6AA 5I6WA 3MXPA 3OMGA 1U9RA 4K5XA 4IUNA 1SYCA
chains in the Genus database with same CATH superfamily
1T5XD 2OT2A 5IYCH 3A54A 4C3JB 2K7VA 4P72A 2EPBA 3GD7A 5L37A 4JI0Q 3FPPA 1CK1A 2ZJQA 4AYBG 4HIDA 4A3EB 3TREA 1VQCA 2F4VL 3RNUA 2F3IA 5TSSA 4A3JG 2A5HA 4QIWE 2G9DA 3TP6A 4JCVE 4DV4L 4LWCA 3CCQA 4B3TL 4KD3A 1NCVA 3CCLA 2QF7A 1BCPD 2K5DA 3ERQA 5IP9H 3K8AA 4POGA 3U58A 1E0BA 2PW7A 3KOJA 4DGZA 3L2PA 1CUKA 1NR4A 3CCSA 5EKIA 1JQYD 3WWVA 1OXTA 3MWYW 4N8X1 5D14A 5IYCG 1YNNC 3P7JA 1PYWD 3NBIA 1ENAA 3SK5A 5EBCA 3GV6A 2JA9A 4O0AA 3JAMi 1UWVA 1LTAD 3PIOA 4WJ4A 2EYJA 5C4XB 4NB3A 1PMRA 1LUZA 2WP8J 2I5HA 1PZID 3TS0A 3F2UA 3PIP3 3UE1A 4K0KL 4RCNA 1I3QH 2Q8RE 4A3MB 1KRTA 4GLAC 1SLJA 2JE6I 1X3EA 4R4CA 2K14A 3I72A 3BDLA 3G6JB 4C3JH 1QWYA 4LFCL 3J7A5 3G71A 3FEWX 3GDEA 4PMBA 1IBKL 1TY0A 5M3MG 2HHHQ 1KQSA 1EL0A 1B4OA 1VQEA 1S5BD 1K83B 4MTKA 2N49A 2QDLA 1I3QB 5IGEA 2RDGA 4DA2A 4KKTA 1STYA 3I4NH 3MXNB 1K8GA 1K0SA 4RKLA 2F0SA 3GTQH 5C4XG 1VQLA 2Q8TA 5M3FG 2JA6B 4B3SQ 3TRZA 4BBRH 1H95A 5M3MH 2WFWA 1JJGA 2A68D 4QJFA 2L4NA 4OO1H 4X64Q 1XPOA 5K36H 3OMGA 1EY4A 1Y69U 1L0YB 4J8QA 5JAVA 4YY3Q 3ER0A 1N36Q 4YWLA 1ZEQX 5M5XB 1STEA 1IHZA 3HP3A 1HR0W 3R2IA 3MZ5A 4A3BB 1KHIA 2PW5A 4X3SA 4KHZA 1CFMA 1R4PB 4A3CG 1PH7A 4ABNA 3KLWA 3R3OA 3UE0A 4HSVA 4JG2A 3PUYA 3T1HQ 1C0AA 4LAAA 3S16B 2CHBD 1Q3LA 2XSCA 2F0KA 4CHTB 4IUPA 1A6XA 4HIOA 1YVCA 3S17H 2HCCA 1VQPA 1YJNA 4DV5L 2I07B 1SMYC 3F2DA 2CH4A 1IBMQ 3VR2A 5BR8L 5C0XI 1GHJA 2LMCB 3FKIG 5HGTA 4QMGA 5FKAC 2SEBD 5ISRA 2L12A 3QJYA 5JJIA 3HOXH 1QZHA 3E6ZX 4JI2L 5EAYA 2F0GA 4JI1L 1KNEA 1CQFA 5IP9G 4A3JH 4DR5L 2F3WA 3D3RA 1U4PA 1UE1A 3HOYH 4OONA 2B2YA 4BXXH 3A8JE 2B29A 2MPMA 1YHAA 3GP7A 1PTOH 4H0LC 5CYUA 2PNHA 3S2DH 1ILPA 4BY1B 4S3SA 4JBMA 1F9SA 1LT4D 1NMFA 1Z47A 2WAQB 4JI8L 4UPAA 2N8NA 4GOPA 1IXRA 4E6IA 5LL6X 3KLSA 1FVIA 4A3DH 4JI4Q 2V1CC 4DR7L 2OTLA 1M1KC 1WOCA 1HFGA 4KHPQ 3HOUB 3NK9A 3HOVH 1ENCA 2E2HB 2FMCA 1A8VA 1F2MA 1KDCA 2OF1A 2RCNA 2VUMB 4UP8A 1U4MA 2KBNA 2L5TA 2MHVA 1JE4A 3PCOB 4P74A 1P8LA 2YU9B 2WB1G 2GVAA 4R9WA 1G291 1RDPD 3BZCA 4DV7Q 3PO2B 2KECA 3PO3H 4BY7B 2AQ3B 1GUGA 1PTOD 3HOUH 2BCOA 3KF8B 4QF4A 1XMOQ 4J6HA 1O80A 3NBHB 4PG3A 3ERSX 3O13A 3CCVA 1VQHA 3KLSX 4X3TA 4JYAQ 4QGUA 3NWSA 2B2TA 3MFYA 1G51A 4C1NI 2D2CC 1CZWA 1GKHA 2IT1A 4MHEA 3VA7A 1KRSA 1S3OA 5IT9c 1I6VC 2JA5H 1PTOB 1O7IA 1DOMA 1TWCB 1XTDA 2E5LL 2NVXB 3GTKH 1SBBB 5M5WH 2PZUA 1BKBA 3RLNA 4F7XA 2A69D 3VYTA 1LTTD 5A2QE 1TWGB 1HZ9A 2IW3A 1H9SA 4MTNA 5M5YB 4O42A 4IUQA 4F88A 5I4DA 1C7YA 1UE6A 1SNMA 4X3UA 2JA7H 2AUKA 2D62A 3K7AB 4M1UB 4OIKA 5F2DA 4YHHQ 1C48A 1AE2A 1LYLA 1CKMA 3R2TA 5KNDA 5D65A 5HURA 2M9VA 3SGIA 4EVOA 3ND8A 4GN5A 3GV3A 1I6HB 2EYFA 1IBLQ 4KY5A 1PH3A 2E2JB 1IYVA 3OIQA 2B63B 4Y52H 1TWHB 4HTHA 4HAEA 3M4YA 1P16A 1A2TA 4BXXG 1TS5A 4H13C 1PTOF 3I8ZA 1PH9A 4DK3C 5EPLA 3S1RH 4LNQA 3JAMc 2VY3A 4UP9A 1KIXA 2QKIC 1QG7A 4A93H 2A73B 4RKBA 3KBXA 1WTOA 4KY7A 1TWCH 1VQBA 2AQ2B 4DK1A 4DV6Q 1PH4A 2PYKA 1JOQA 3HOYB 1EZ6A 4C3JG 4EQNA 1HNZQ 1CKNB 4YHHL 3HFZB 3K5OA 2VXWA 1I50H 1B53A 2F0UA 1BQQT 4JC0A 2JA8H 5JEAJ 4DUZL 3ICEA 2Q2TA 4A3JB 3L3OC 3UDGA 1PVOA 3AFQA 2ATWA 1Y1WH 3CU7A 5BR8Q 1RHPA 1E2VA 1IL2A 3HOVG 1W3SA 2A6EC 3S14B 2Z6BA 3PIPA 1SJHD 1X32A 1B8AA 2ZXRA 3A7AB 1FGBD 4WRDA 1WVLA 1EUJA 3GTMB 1HTPA 2Q2IA 2K32A 1Q1EA 3CKIB 2L11A 2PMZB 1JWMD 1XMOL 1VQ7A 4M8AA 4B3MQ 1EYDA 4KK7A 1X9NA 2EVBA 5IWAL 1AZPA 1XPUA 5GQOA 4JV5Q 2Q2UA 4A3DB 3M3YB 3RLFA 3G7LA 3H91A 5C4XH 2NZHA 1SYDA 2O5JC 4BWGB 1SYGA 3I4MG 4O2DA 4A3MG 1V1QA 4B3RL 2R61A 4CJ0B 3KJPA 3CRLC 3FP9A 4LF9L 1WTRA 1X3GA 2MFIA 4HJAA 2VS1A 5E1FA 2J7ZA 1Y14B 4UAIA 2F3VA 3MXGA 4KTAA 4OIJA 3M85A 3DUZA 3NP8A 1HR0Q 1CHQD 3OTOQ 4A3IH 2A8VA 3A74A 1EQRA 4LMQD 1TQOA 4CGYB 4LF7L 1CTMA 5C5LA 1HTLD 3PSIA 4FF4A 1FYCA 1X56A 1R9TH 4GNXB 2NZOA 4DV2L 3MTSA 3MHBA 5C0XJ 4DR2Q 2XIWA 3NHHA 2QCPX 3L9AX 4DR2L 3Q23A 4YCVA 3RZOB 1EY7A 2F0MA 1WTVA 4MIUA 1VQGA 2A68C 4KKSA 4NMZA 4DR5Q 2H1EA 3W1BA 2AUJD 3E0EA 2XRQD 2EXDA 2OXPA 3J81i 2F0LA 1ICWA 2VZAA 4A3GH 2CQOA 2P5ZX 1HXYD 1A3TA 2Y0SB 1STGA 4YIJA 5LMNW 3ND9A 5FO7B 2PNRC 4DNTB 3H0GG 4DR6L 1F2LA 2PZWA 4DV6L 3K5MA 4ZYSA 3QOLA 3EQLC 2A74C 1OXUA 2CFMA 1YBYA 2RKSA 5NUCA 3M3YH 4A3KB 5M5XH 1BR9A 4C1NK 3T1YQ 2RF4A 3ZYYX 3T4AC 1QUQA 1STNA 4LF8Q 1BCPF 2ICIA 1ZKOA 1T9HA 1XJVA 3AYHB 1NR2A 2CH4W 1WCMH 2R7ZH 3S1MB 3V05A 5C0XG 1H9RA 1ZYRC 4DAYB 4A3IB 3U50C 4CJ1B 1EIFA 4UP7A 3JAML 3W2DA 3T51B 4NXML 2JQOA 5IGGA 2QEJC 4YWKA 2UXCL 1J9OA 2F0OA 1PH2A 4JI3Q 2X6LA 4A3FG 1O7YA 2PZTA 2F0NA 4PZ7A 4DAYA 2JK8A 4K8IA 1FJGQ 1BCPC 5JJZA 1UE7A 4X65Q 5C4JB 4OWTB 3HKZG 1NTGA 2Z0SA 1SXTA 4ZLTF 1SNCA 3BU2A 2IX0A 4EQ5A 1EU4A 1EZ8A 2GN5A 2UUBQ 4QUFA 1DD2A 2Z1CA 3K5LA 3TP5A 1WCMG 5M9OA 2ZXPA 1QE6A 5FLXL 2HQLA 2IL8A 2EJFC 2A6ED 4OWXB 5FLMH 3KBGA 4Q5VA 1D5ZC 2WKCA 2R92H 4BS9A 2D9UA 4PNYA 4UDUC 3I56A 2EY6A 2BDNA 2C5CA 3FVQA 2K5WA 1Z7TA 2AMCB 4OELB 3OOCA 3DWAA 1K28A 5I6YA 4Q0FA 4A3EH 1FR3A 3C3LA 2IHEA 3KF6A 1XMQQ 5KGUA 2NTTA 4AYBE 3PIO3 1VQ9A 1K73C 2VQEL 3J7AF 5AJ3Q 3NPPA 4RGOS 2R7DA 3J7AV 3N6RA 1N36L 1K8AC 3D8GA 1A15A 4JI6L 5JJLA 5HY6A 1ILQA 4GLVB 1N8RC 1VMPA 2KCMA 4JI1Q 1PRTF 1WD1A 1VQIA 1ET6A 1RF2D 4CDFC 2V4DA 3CCMA 2K50A 2X6GA 5ELNA 4ME5A 5C3EG 2B2UA 2K52A 1GHKA 1GXDC 1Y1WB 4FYDA 4QB4A 3OMCA 1PYSB 3PF4A 4TKOB 4C3HH 1SYEA 1SJED 1G91A 1LTID 3PO3G 1YEZA 3BVMA 1KLUD 2ID0A 3K0XA 1W2BA 2XVSA 3MAQA 3J7ZC 2K1BA 4Y7NH 2VQFQ 1SN8A 1BBWA 1XNQQ 1BO0A 3EJIA 3J81c 3R8BA 1EY8A 4QUCA 4CKCA 2EJGC 1IL8A 5IGCA 1S5ED 4RAUC 3TEHB 4EX5A 4R4OA 1EQTA 4DN4M 1QVCA 4DV1L 1B44D 2RHSB 4YCWA 1VQDA 3KLRA 1NUCA 2KEEA 2NVTH 4K8JA 4FF3A 4FF2A 3E0JA 1JCKB 4F87A 4C2MH 5JPMC 5JPNC 4B08A 2OTJA 2ZJPA 3BZDB 1N34L 1PFBA 1AW7A 1KC8C 1VQ4A 5DM63 3AQQA 1TWAB 1LT5D 2QGQA 3BYYB 4LJZC 3W3AA 1AEXA 1MSHA 3CPFA 4DV3Q 2WV6D 1G6PA 3H0GH 1S5FD 5E4XA 4G7ZC 1H9SB 5CV6A 2NN6I 1PXUA 4ULLA 4DR7Q 2MQHA 5LHY1 1HH2P 1W6JA 1RD9D 4RGTA 4P73A 2WKDA 1KLGD 4KHPL 2B2UC 4HJ7A 3HKSA 3F8TA 4K2KA 4B3TQ 2PI2A 4HJ5A 5EGTA 2JA7G 4YY3L 4IFDJ 3BDOA 1ICFB 3KF8A 2L0CA 4A3EG 2UUBL 3SR1A 1HZAA 5C6AA 2G5DA 1I50B 2ASBA 5LMNL 1NBWA 4JK1C 4JI5Q 1B7YB 2IJ0A 4HEDA 3STBD 1HR0L 1LV9A 2F0FA 3J81j 1C4QA 4R4TA 3DEPA 5FO9B 2R93B 1VQMA 2NUCA 1QVGA 3AEVA 4X64L 4LW1A 3NTIA 4GNXA 4A93B 2R7ZG 4DNIA 3H3VI 4LUZA 5IYDG 3RZDH 2F0WA 4HIMA 3OSOA 3CQZH 5I2XA 1O7ZA 4A3CH 1RTOA 3UDIA 4XYOA 1ZXTA 2H4OA 1V8QA 3L7ZC 4DV5Q 1F9QA 3NUCA 1I6HH 4OWWB 2VQEQ 1IW7C 2N3SA 4ZUIA 3IRBA 1EEFD 3S24A 4H02A 1KDAA 1JC7A 1JWSD 3K7AH 3CQZB 2R7FA 1E3PA 4G57A 2K33A 3NEMA 1TR5A 1X54A 2SNMA 1KXLA 3HEJA 1GD7A 4TVAB 1CA6A 3GTOH 1CHPD 1PA6A 3I4NG 1E1TA 1BUVT 3Q8DA 2JEAI 4IOAA 1YHQA 4RA8A 3JC66 4C56C 3S15B 3WOFA 2F1MA 5ELEA 4CKEA 1SR3A 2OCEA 2KHSA 3HKZE 1KNAA 4PMWA 5CORA 4P75A 1PRTB 3GTLH 1WTPA 3K59A 2E76C 3VYSA 1GUSA 4IN3A 3F1ZA 1V1PB 4IALA 4FVMA 2LKVA 1VS0A 1O78A 2J0TD 5BN4A 1VQNA 1O7LA 2NVQB 3CCJA 5KYIA 1AP0A 1D5MC 1K83H 4ME3A 1STAA 1GO3E 4NKLA 1L1OC 1CKOA 1CSPA 2PCFB 1B9MA 2A6HD 4RHSA 3V96A 5IIFA 3S17B 3W5OA 1L1OB 1CI3M 1MKHA 1K9MC 4IFDG 4XIGS 1F2YA 1VQKA 1VQ8A 2F4VQ 5EJWA 1EWCA 3SK6A 1QCBD 1YNXA 2BE5C 3MEFA 4JBWA 2B2YC 1HNXL 1TVXA 3EN2A 3I3CA 1IKLA 2D0PA 3AU7A 4R4IA 4RHRA 3SVMA 4X65L 3C2PA 2RHQB 5M5YH 2K04A 1STHA 3K5NA 1MJEA 3RZDB 5J1ZA 4A3BH 1I4QA 4KI0A 5KYLA 1QZGA 3DLLA 2F0EA 5ELCA 4KN4C 4CDCC 4IFDH 2KHIA 3A0JA 3S1QH 1UNSA 1CQVA 1SDFA 2A1AA 3OWEB 1U4LA 2N78A 5FJ8G 2QDBA 1D1KA 3K80C 4A3IG 1V43A 3CC2A 3HG9A 1JORA 1MGSA 3FKIB 5DEHA 3HS0C 1JICA 2IHFA 4DR1L 1PRTC 1M90C 2ENBA 3A7LA 4APVA 3CC4A 3FMCA 2EXZA 3V2TA 5KRUA 4JI4L 5K5PA 1MI2A 5GAHC 3NTHA 5LMUQ 4L5RC 3HOXB 2UXDQ 1GJXA 4DK0A 1YHBA 4A3MH 5FJ8H 1L0WA 2YU9H 1BOSA 3T56B 1DOLA 1YNND 1D7QA 2EQSA 2WAQG 5C44H 4HN7A 4RWSC 2HDMA 2E2JH 3S16H 1J5EQ 3G4SA 5DNFA 4KMUC 1SSOA 5E3FA 5E7NA 2E2IB 3NELA 3GTGH 5ELDA 5DAUA 2E74C 1S40A 3IFDA 1WTQA 1JOOA 4PV1C 4DF7A 4LF6L 1KL9A 3B6YA 2DJGC 2HHHL 2VUMG 3OTOL 2EYMA 3TSSA 4DUYQ 3AB9A 2RA4A 2ZTDA 1BCPB 2DJFC 3CAMA 4Y7NB 4ZAIA 1NE3A 1AFPA 4WJ3M 5M5WB 4FNFA 1L2FA 4K2LA 1HPCA 1M4VA 1HRJA 4BBSG 1QOHA 5C44G 4C3IB 5EKLA 1XMQL 2DY7A 3T1YL 2ZT9C 5M3FB 2B3GA 2JA6G 4A3GB 2NN6H 4CDEC 2C35B 4DFAA 3KYHC 4J1MA 3S2HH 1IW7D 4IQZA 2ICEC 2MNAA 1HQRD 4K5XA 1LTBD 2EIFA 3X3NA 3F2BA 4GKKL 4DV7L 2Y0SG 5IT9E 2MO0A 3SK4A 3U9OA 1PFSA 3H0GB 2R92G 1WCMB 1QUQB 4JI0L 1U4RA 4DR6Q 5CMDA 2MP1A 2K03A 3PO3B 2EYLA 1D6EC 3SDZA 4X3KA 3TP8A 2VL6A 5M3FH 3G6EA 4B3SL 4H44C 4QQBX 1B1ZA 2M00A 1BDOA 1FGUA 1FJGL 4BBSB 1X3QA 1NJIC 3TBIB 5FK9C 2VQFL 1NAPA 3LNNA 2HT1A 1SMXA 3A5ZB 3FPUB 3GTJH 3M7NA 3NWTA 5EQ0A 3BDCA 3WOEA 1WD0A 1EY6A 3GQBA 4FXKC 4IURA 2FMMA 2SDFA 3H6MA 1HQMC 2YTYA 4XQQA 3D4WA 2R92B 1DCZA 4EQOA 4GNXC 3DM3A 3PO2G 2JN4A 4XTCS 2B63G 2O4XA 4TQUS 5C4HA 5LMUL 2XNAC 2KHJA 2JA6H 4JOIC 1JMCA 3GTQB 3CMEA 4ID6A 3SHLA 4LUVA 4DPGA 1HNWQ 1K3BC 1BVSA 3RUZA 5C3EB 3U9SA 4JBKA 3NQIA 2K5VA 4BY7G 1JE5A 1I5FA 2KA7A 5CV9A 3T53B 2LFNA 5COYA 3M4QA 3H15A 4YCUA 3RMHA 1PH5A 2K01A 2O2LD 1SE4A 2MO1A 5IE8A 3VYRA 1ZYRD 3S1MH 1TWGH 2Z6KC 3DHQA 3HOZH 2UXBQ 5K36G 4OHJA 1N34Q 2UXBL 4NXNQ 1GUWA 1PZKD 2K75A 1Q1BA 1ONLA 1FNVA 4A75A 1KABA 3CRKC 5CBAE 4RFBA 5KNBA 1N33Q 3A55A 3KK7A 2VB3X 2R93G 4B3ML 2JJQA 3GTLB 4BBRG 1EIYB 4BA2I 1H9KA 5IWAQ 1HNWL 3U4ZA 3T16A 2SNSA 1V1PA 1VMCA 3CC7A 3HOZG 1NMGA 1BBXC 5JVG3 2F0TA 1IBLL 2F0IA 3PV0A 2AKWB 3GTPB 1A2UA 4CKBA 2HUGA 2F0DA 3K57A 3PF5A 3TN2A 1JB3A 4RMFA 1SNDA 1YJWA 1MJCA 2B2WC 4AYBB 4PMCA 2O5IC 4QL5A 4ALPA 1EY5A 3PQIA 1D2BA 4BBSH 3H09A 3LWEA 4KJOA 1TS3A 4LFBQ 3GTGB 1LT3D 1PH8A 1KAWA 3D4RA 4BBRB 1B70B 1RKNA 1VDZA 2B8FA 1WFQA 3E9HA 3HOYG 2X69A 4IPGA 1SAPA 4N9TA 1XTCD 3S14H 4GS3A 1Y1VB 3FHWA 1HZCA 4DXGA 1A3VA 1Y8NB 4JOIA 1EFID 4FDBA 1PYBA 2DY8A 4C3HG 4JPBW 2BA1A 1CZGA 4MN3A 1OXXK 4DV4Q 2CCZA 1YIJA 4WFN3 4LF8L 3K7UC 3D4DA 2Z6KA 3M7GA 2DUDA 4DR3L 1E2ZA 3ZJYC 4AH6A 3GO5A 4KJNA 1EYAA 3TDQA 5HGQA 4YWMA 3SXHA 4JI8Q 3K58A 1HA6A 1QVFA 1SEBD 2I5MX 1NSNS 1SRUA 3QB3A 2PQAB 2A6HC 3RN2A 4JI7Q 3SK8A 1DYQA 1CT1D 2NN6G 2ES2A 4IPHA 1Q46A 3OYYA 2KENA 2EY2A 4G7OC 1K8OA 2BE5D 4XT3B 5IGFA 4OO1I 3ONAB 4U68A 3CMAA 2IX1A 2G9HD 3W1GA 4GKJQ 4DK6C 1IYUA 1AH9A 4JI5L 3I4MB 2JEBI 2GA4B 1VCIA 1QB5D 5J39A 3KJOA 3M4OH 3HZXA 1HJPA 1STBA 3VDYA 1ASYA 2IWHA 3HOVB 5G3LF 1S72A 1DONA 2Y0SE 2UUCL 3Q0AA 4A3FH 3I4OA 3T1HL 1EU3A 1CSQA 1YZ6A 4V0BA 3MC0B 4HCEA 4IFDI 5JJKA 2E2DC 2L15A 2CVRA 4IUTA 1QNKA 4JI6Q 1XXGA 5ELOA 5M3MB 1TWFB 1E2WA 2KCTA 1XWEA 3TQYA 5IYDH 3CCEA 1GM5A 2K28A 1SMYD 5KNCA 2N55A 4A3FB 2WACA 3S1RB 5CV8A 3UI2A 4RCOA 3NSWA 4B3RQ 2WB1E 2R3ZA 4X62Q 1GUOA 5FLXc 1I4PA 2VB2X 3E9IA 1DGSA 3G48A 1HHVA 1WI5A 4HJ8A 1VF7A 2CW0C 3NXWA 3K81C 1VF5C 3M4OB 4UY8C 2AQ1B 3A5UA 2CWAA 1EY0A 1EWHA 1TY2A 4KLKA 1A62A 5A2QL 3FRPB 1Z6HA 2ZTEA 2F0VA 5C3XA 2E2IH 1L1OA 2DNCA 1DZ1A 2XWBB 2LSSA 5CV7A 4A3BG 4G4KA 1J8IA 1ML0D 3UDFA 1G6ZA 2EE1A 1PH6A 1B9NA 2NVXH 3PUXA 5G3LD 5IOCA 1A0IA 4B9WA 4A3GG 1I4HA 5DLQE 4OXPA 2R93H 3CP0A 1LT6D 4DXFA 2BH8A 1SE8A 5DM73 2UXCQ 1GUNA 1PH1A 3PUWA 1J5EL 1ESRA 1I4GA 2DNEA 2K5NA 3HOUG 2TMPA 2NVYB 2BDOA 3IKJA 3EROA 4NDXA 4OEMB 4HJ9A 4DR3Q 5LMNQ 2AHOB 1WTHA 3X3MA 2E75C 4GKKQ 2KEDA 3NENA 2XTIA 4ZRZA 3IFTA 1LACA 2IX3A 2C9OA 1C9OA 5H1SE 4ZKCB 5C0XH 2WB1B 2BOSA 4HMIA 2F0JA 1SNOA 2K4KA 4QY7A 3QIAA 1BXTA 3S1QB 3N52A 3D6CA 1EEID 3Q6SA 3J7YW 4IZ8A 4NXNL 2HIXA 3C46A 1SNQA 4IPCA 2ZJRA 1YNJD 1E24A 1GVPA 5CV5A 1GOZA 4IJHA 4A3KG 3UDXA 4KHVA 1PFMA 2H5XA 1MHWC 4UHVA 5CGKA 4K5WA 3EFXD 2OWOA 4TSSA 3KF6B 5IODA 2CWPA 3E5SA 1MD2D 2RVLA 5IP7H 1EWIA 2A69C 4DV0Q 2AWOA 2A19A 3OHXC 1TS2A 1SYFA 2CKZB 2AWNA 2PQAA 3I4LA 1XNQL 2L1BA 2Q2HA 2R6GA 4LK1C 3RR5A 2IY5B 3J80i 2RDHA 1N32L 5C4ZA 1PLFA 1KTKA 1OXVA 4LFCQ 2J4XA 2D5DA 2NTSA 1LABA 2ZM6L 3BVGA 3S2DB 5C4JH 1TWFH 3J80c 1Q7YC 1PRTD 2K6AA 3HOWH 1I4XA 1XNRL 4ODGA 4HR7B 4DR1Q 3DEOA 2EYOA 4H7BA 2Z4HA 3KUPA 2WAQE 1RL2A 5CC4A 3E3XA 4ZCKA 4I65A 4XYQA 1E7ZA 3NTKA 1XX8A 2SOBA 3OW7A 3SEBA 3BS1A 2IPKD 2I46A 4LF4L 4FO2A 4N8FA 1EOTA 2MGSA 2YV5A 1AZQA 5I9PA 4PZ8A 4P71A 1FNWA 5FO8B 1A63A 2KJXA 5JOBA 3EA6A 4L6TB 1OXSC 4AIMA 4L8JA 3Q24A 2EZVA 2RSOA 3HOWB 3F2CA 4K6DA 5IGDA 2R7ZB 4FXGC 3LX0A 2VUMH 4OO1G 1RJTA 4L63B 4EGVA 2Z9HA 4XXEA 3OPOA 2PMZE 5GROA 5CBEE 4U673 4OX9L 4FP5D 4R8IA 1JR0D 4KV6A 1HNXQ 4GN3B 4DNRB 1SE3A 3KDFA 2B2TC 1TS4A 3VR3A 1F9RA 2I0QA 2HDLA 1Q82C 1DXMA 2M2LA 2K5QA 2Z4IA 2CW0D 1N32Q 3BG3A 5C5MA 4JYAL 5I9OA 2UU9L 4JI2Q 2UU9Q 3VR6A 1HCZA 4JVZA 3OWFA 4R4QA 3ULPA 3I73A 2QW7A 4WORA 3K6OA 1V1OA 2XRSD 3I55A 5EKKA 2E5LQ 1ENFA 3EIVA 1Q90A 3I4NB 1HA5A 4DAMA 1WJJA 4NXMQ 3I70A 4EQPA 3S9WA 1G2SA 4LF5Q 4LF9Q 3A8IE 2BA0A 2OQKA 1S5CD 3S2HB 2FHTA 3WDNA 2VNUD 2KOLA 4IUUA 1G8ZD 1RCVD 2UXDL 3I2ZA 3RN5A 1S4ZA 1TWAH 1HUMA 1EIGA 3CCRA 3H3VH 5ELBA 4JV5L 4JBJA 1I94L 3AMUA 4DV3L 2LXKA 1D8LA 1B2TA 4PZ6A 4KN7C 3A56A 2RCFA 2EY1A 3DM1A 1F9PA 1T5EA 5E4WC 1B50A 2MUYA 1Q8IA 4K6LA 1Z9FA 4K14A 4NPSA 1SFOH 4ZK9B 3D31A 4DKAC 4LF5L 1YNJC 1PHJA 2PI2E 1QILA 4MNOA 2UUCQ 3NE5B 1M8AA 3J81E 4ILWA 5D3IB 5BN3A 4A3DG 5IT9L 1QNUA 4NW2A 2OQ0A 1Q8KA 2JSOA 1YJ9A 1Y8PB 3QOJA 1F77A 1VQ5A 3D0FA 2F03A 2E8GA 1IBML 3FDTA 2Q8IB 2QEXA 5CR3A 3STBC 5BN5A 2KUMA 5IP7G 2RQXA 2F0HA 3TMEA 2YTVA 4LFAQ 3IL8A 2KVMA 1AN8A 3U4VA 1K0RA 3FKIH 4KKUA 5EBDA 2NZ1D 3I7FA 1PFNA 3CF5A 3M9BA 1RIPA 1UUPA 3BVZA 1PV4A 4A3KH 2YYZA 2N88A 3CPWA 3HOXG 1X3PA 3MEHA 4A3LG 1UEAB 1CA5A 3M4PA 3RD4A 2FXQA 1KD1C 3VR4A 3QWNA 1VQJA 1Y8OB 2B8GA 5AFWA 1XPRA 3S15H 3NQTA 1LTLA 2F4IA 3CD6A 2HD3A 4WJWA 3VYUA 3KDFB 5AJ3L 1YI2A 3PUZA 5EPJA 3A8KE 4HIKA 2EOTA 1VQAA 5C3WA 1TWHH 1NNXA 5LL6S 4DV1Q 1Q12A 3PO2H 3OIPA 4FF1A 4KD4A 1JJCB 1JOKA 2FFKB 1LLRD 3ULJA 5T1IA 1X65A 1HFNA 4AQYQ 4HSPA 5KEEA 1D5XC 3CW2C 5IGBA 4LUOA 4I7AA 3HRZC 1EY9A 5FLMG 3LWUA 3DWPA 4N9PA 4C3IG 1HUNA 1OO9B 1H9MA 4DR4Q 1IZ6A 3I90A 1PTOC 5GADC 3AFPA 3P75A 3I91A 3TP7A 1NY4A 3GTKB 1EOVA 4GOPC 1IYJB 4ZKBB 3MA2B 1FD7D 3H94A 3K0YA 2TSSA 4GOPB 1BF4A 1UEBA 2NWGA 4C3IH 4F8MA 4DAPA 2UUAQ 3Q22A 3QR8A 3MXPA 2ZXOA 4HCSA 4OGQC 1SYCA 1Q81C 2RSNA 4DU9A 2MJ8A 1Q86C 2B39A 2KCNA 5CV4A 4MZ9A 3GTOB 1E22A 2QILA 4QCLA 1AE3A 4TRDA 1MSGA 2I5LX 2KQ3A 2RDFA 1Y1VH 1PDQA 3DXJC 1TT2A 2JXMB 1DJRD 4J15A 2F0PA 2E2HH 3LGJA 2XWJB 1EYGA 3QO2A 1SE2A 3DMUA 3EVQA 1B3AA 1EFWA 2B63H 3C1FA 4RG1A 4BY1G 3PMFA 3GTMH 1V9PA 5ELFA 3S1NB 1IKMA 5C44B 4GLXA 1RTNA 5FOBB 2GVBA 2HIVA 2NVQH 3PUVA 2QA4A 1A3UA 3RZOH 1DM0B 4O1NA 1EIHA 4LF6Q 1MBYA 4A3LH 2DGYA 3VA5A 5JEAG 2EYPA 2ZM6Q 4DAVA 1QJOA 1I4RA 2KCCA 4DR4L 2LS01 3C1EA 5GAGC 4XQNA 5KIXA 2L55A 1OTCA 3KFUA 3ULLA 2F0QA 1HNZL 4OL7A 2HCIA 3J80L 1LTSD 3P20A 3MXNA 2EY5A 2NVYH 4LF7Q 3MVVA 4ZUJA 4L5QA 3L0OA 1WTWA 4BY1H 1TXYA 3OW2A 3SE0A 4K0KQ 1JT8A 4POFA 1EYCA 1FL0A 4DV2Q 1UAPA 3HGBA 1JJ2A 3MFGA 4RGMA 1PZJD 2B2VA 2ALYB 4R8NA 5J3BA 1DOKA 3CXCA 1BNZA 1LO5D 2EYHA 4BY7H 1RODA 4IUVA 1K8MA 2JA5G 3P1HA 1WTXA 4IPDA 1K3RA 4I7ZC 3HKZB 3HOZB 4X66L 4A4IA 2RBMA 1N9WA 3VR5A 2PQEA 4A76A 2UUAL 1L0XB 4RH6A 2JA8G 3CHBD 2EDGA 1SROA 1VQFA 3H3VC 1FNUA 2BH2A 2JA7B 1XYIA 4C2MB 3QG1A 1GUTA 2NB0A 3BJUA 1E1OA 5C3EH 1C8CA 4B9XA 1W6KA 5I6WA 1I94Q 5D3DA 4CBVA 3S1NH 1WYDA 1S5DD 4QIWB 3BYTB 3DWQA 2YTXA 5IYBH 1JB7A 1SYBA 1EQVA 1U0LA 3ITPA 1R4QB 2K5HA 2CQAA 4XQJA 4LFAL 1IBKQ 2JA5B 4CDDC 2WINB 4NP5A 4Z9CB 4GN4B 1ASZA 4GKJL 2PPBC 4X6AH 2JA8B 1TKWB 1X55A 1SNPA 4BA1I 3GTPH 3T13A 1BBUA 4LFBL 2NYZD 1X3FA 4HMJA 1UE5A 3J81L 3TS2A 1X6OA 3D6WA 4OX9Q 1U5KA 4X62L 3RLOA 1CM9A 4PQXA 3TZUA 2FJ2A 4IOCA 4IO9A 4DUZQ 4DUYL 1TU2B 2EJMA 4DV0L 2LXJA 4JI3L 5I2YA 4L5SA 2OEOA 4JI7L 3R93A 1R9TB 1D1IA 1Y1WG 2NBFA 3TZDA 1F2ZA 2DN8A 2HQEA 5IY0A 2B2WA 3BZKA 3I4MH 3J80E 1KAAA 5T1GA 5A35A 2JYOA 4FXDA 5J22A 4ZQ3A 3URYA 2JP1A 4K5VA 3IAYA 4V190 5IYBG 4X66Q 3JAME 5JEAH 1ET9A 5EPKA 4AQYL 4G7HC 2B2VC 3PGZA 4L5TA 2PO4A 1N33L 2D0OA 3EBEA 4XDXA 1H9JA 1HZBA 2F52A 2WIIB 2NVTB 1XNRQ 1VQOA 4A93G 1VQ6A 1B3QA 1LTGD 3MXUA 1MIUA 2ZTCA 2K05A 1CKNA 1II3A 1ESFA 4RGNA 1TIID 2L9HA 1KDBA 4GZYC 4LF4Q 4KY6A 1YITA 1SFOB 4IJLA 2VW9A 1Y1VG 1G2TA 2LY7A 4XT1B 1JWUD 1LM0A 2Z8LA 2XN9C 1EQQA 3NBHA 1J6QA 4CJ2C 2FINB 5FLXE 3HOWG 1LTRD 4R1JA 3GTJB 4P2CB 3CCUA 4JW0A 5JVH3 5GAEC 1U9RA 4C3HB 2XGTA 4IUNA
chains in the Genus database with same CATH topology
1T5XD 2OT2A 3A54A 4C3JB 2K7VA 2EPBA 3GD7A 3FPPA 1CK1A 4A3EB 5TSSA 2A5HA 2G9DA 3TP6A 4KD3A 1NCVA 2QF7A 1BCPD 2K5DA 3ERQA 1E0BA 2PW7A 4DGZA 1NR4A 5EKIA 1JQYD 1OXTA 3MWYW 5D14A 1YNNC 3P7JA 1PYWD 3NBIA 1ENAA 3SK5A 5EBCA 3GV6A 1LTAD 2EYJA 5C4XB 1PMRA 2WP8J 1PZID 3F2UA 3PIP3 4RCNA 2Q8RE 4A3MB 2JE6I 3I72A 3BDLA 3G6JB 1QWYA 3FEWX 4PMBA 1TY0A 1EL0A 1B4OA 1S5BD 1K83B 1I3QB 5IGEA 2RDGA 4DA2A 4KKTA 1STYA 4RKLA 2F0SA 2Q8TA 2JA6B 2A68D 2L4NA 4OO1H 5K36H 3OMGA 1EY4A 1Y69U 1L0YB 4J8QA 5JAVA 1ZEQX 5M5XB 1STEA 1IHZA 3HP3A 3R2IA 3MZ5A 4A3BB 2PW5A 4X3SA 4KHZA 1CFMA 1R4PB 4ABNA 3R3OA 4HSVA 3PUYA 4LAAA 3S16B 2CHBD 1Q3LA 2XSCA 2F0KA 4CHTB 4IUPA 1A6XA 2HCCA 2I07B 1SMYC 3VR2A 5C0XI 1GHJA 2LMCB 5HGTA 4QMGA 5FKAC 2SEBD 5ISRA 2L12A 3QJYA 3E6ZX 2F0GA 1KNEA 1CQFA 2F3WA 3D3RA 1U4PA 2B2YA 3A8JE 2MPMA 3GP7A 1PTOH 4H0LC 5CYUA 1ILPA 4BY1B 4S3SA 1F9SA 1LT4D 1Z47A 2WAQB 4E6IA 5LL6X 3KLSA 1HFGA 3HOUB 3NK9A 1ENCA 2E2HB 2FMCA 1F2MA 1KDCA 2OF1A 2VUMB 1U4MA 2L5TA 2MHVA 1JE4A 2YU9B 4R9WA 1G291 1RDPD 3PO2B 2KECA 4BY7B 2AQ3B 1GUGA 1PTOD 2BCOA 4QF4A 4J6HA 1O80A 3O13A 3KLSX 4X3TA 3NWSA 2B2TA 3MFYA 4C1NI 2D2CC 1CZWA 2IT1A 4MHEA 3VA7A 1I6VC 1PTOB 1DOMA 1TWCB 2NVXB 1SBBB 2PZUA 4F7XA 2A69D 3VYTA 1LTTD 5A2QE 1TWGB 2IW3A 1H9SA 5M5YB 4O42A 4IUQA 4F88A 5I4DA 1SNMA 4X3UA 2AUKA 2D62A 3K7AB 4M1UB 4OIKA 5F2DA 1C48A 3R2TA 5KNDA 5D65A 5HURA 2M9VA 4EVOA 3ND8A 3GV3A 1I6HB 2EYFA 4KY5A 2E2JB 1IYVA 3OIQA 2B63B 1TWHB 4HTHA 4HAEA 3M4YA 1A2TA 1TS5A 1PTOF 4H13C 3I8ZA 5EPLA 2QKIC 1QG7A 2A73B 4RKBA 3KBXA 1WTOA 4KY7A 4DK1A 2AQ2B 2PYKA 1JOQA 3HOYB 1EZ6A 4C3JG 4EQNA 3K5OA 2VXWA 1B53A 2F0UA 1BQQT 5JEAJ 4A3JB 3L3OC 3CU7A 1RHPA 1E2VA 2A6EC 3S14B 1SJHD 1X32A 2ZXRA 3A7AB 1FGBD 4WRDA 1WVLA 3GTMB 1HTPA 2K32A 1Q1EA 3CKIB 2L11A 2PMZB 1JWMD 4M8AA 1EYDA 4KK7A 2EVBA 1AZPA 4A3DB 3M3YB 3RLFA 3G7LA 3H91A 1SYDA 2O5JC 4BWGB 1SYGA 2R61A 4CJ0B 3CRLC 1WTRA 5E1FA 2J7ZA 4UAIA 2F3VA 3MXGA 4KTAA 4OIJA 3M85A 3DUZA 3NP8A 1CHQD 4LMQD 1TQOA 4CGYB 1CTMA 5C5LA 1HTLD 4FF4A 1FYCA 3MTSA 3MHBA 5C0XJ 2XIWA 3NHHA 2QCPX 3L9AX 3RZOB 3Q23A 1EY7A 2F0MA 1WTVA 4MIUA 2A68C 4KKSA 4NMZA 2H1EA 2AUJD 2XRQD 2OXPA 2F0LA 1ICWA 1HXYD 1A3TA 2Y0SB 1STGA 4YIJA 3ND9A 5FO7B 2PNRC 4DNTB 1F2LA 2PZWA 3K5MA 4ZYSA 3QOLA 3EQLC 2A74C 1OXUA 2RKSA 5NUCA 4A3KB 1BR9A 4C1NK 3ZYYX 3T4AC 1STNA 1BCPF 2ICIA 1ZKOA 1NR2A 3S1MB 3V05A 5C0XG 1H9RA 1ZYRC 4A3IB 4CJ1B 3JAML 3W2DA 3T51B 5IGGA 2QEJC 1J9OA 2F0OA 2X6LA 1O7YA 2PZTA 2F0NA 4DAYA 4K8IA 1BCPC 5JJZA 5C4JB 1SXTA 4ZLTF 1SNCA 2IX0A 1EU4A 1EZ8A 4QUFA 1DD2A 2Z1CA 3K5LA 3TP5A 5M9OA 2ZXPA 1QE6A 5FLXL 2IL8A 2EJFC 2A6ED 3KBGA 4Q5VA 1D5ZC 2WKCA 4BS9A 2D9UA 4PNYA 4UDUC 2EY6A 2BDNA 2C5CA 3FVQA 2K5WA 1Z7TA 3OOCA 3DWAA 5I6YA 4Q0FA 1FR3A 3C3LA 5KGUA 2NTTA 3PIO3 3J7AF 3NPPA 4RGOS 3J7AV 3N6RA 3D8GA 1A15A 1ILQA 1VMPA 1PRTF 1WD1A 1ET6A 1RF2D 2V4DA 2X6GA 4ME5A 2B2UA 1GHKA 1GXDC 1Y1WB 4FYDA 4QB4A 3OMCA 4TKOB 1SYEA 1SJED 1G91A 1LTID 3BVMA 1KLUD 2ID0A 2XVSA 3MAQA 2K1BA 1BO0A 3EJIA 3R8BA 1EY8A 4QUCA 4CKCA 2EJGC 1IL8A 5IGCA 1S5ED 4RAUC 1EQTA 4DN4M 1B44D 3KLRA 1NUCA 2KEEA 4K8JA 4FF3A 4FF2A 3E0JA 1JCKB 4F87A 5JPMC 5JPNC 4B08A 3BZDB 1PFBA 1AW7A 5DM63 1TWAB 1LT5D 3BYYB 4LJZC 3W3AA 1AEXA 1MSHA 2WV6D 1S5FD 5E4XA 4G7ZC 1H9SB 5CV6A 2NN6I 1PXUA 4ULLA 5LHY1 1W6JA 1RD9D 4RGTA 2WKDA 1KLGD 2B2UC 4K2KA 5EGTA 4IFDJ 3BDOA 3KF8A 2L0CA 3SR1A 5C6AA 1I50B 4JK1C 2IJ0A 4HEDA 1LV9A 2F0FA 1C4QA 3DEPA 5FO9B 2R93B 2NUCA 3NTIA 4A93B 2F0WA 3OSOA 5I2XA 1O7ZA 1RTOA 4XYOA 1ZXTA 2H4OA 1V8QA 3L7ZC 1F9QA 3NUCA 1IW7C 4ZUIA 1EEFD 1KDAA 1JC7A 1JWSD 3CQZB 4G57A 2K33A 1TR5A 2SNMA 3HEJA 1CA6A 1CHPD 1BUVT 2JEAI 4RA8A 4C56C 3S15B 3WOFA 2F1MA 5ELEA 4CKEA 2KHSA 1KNAA 4PMWA 5CORA 1PRTB 1WTPA 3K59A 2E76C 3VYSA 1GUSA 4IN3A 1V1PB 4IALA 4FVMA 2LKVA 1O78A 2J0TD 5BN4A 1O7LA 2NVQB 1AP0A 5KYIA 1D5MC 1STAA 4NKLA 2PCFB 1B9MA 2A6HD 4RHSA 3V96A 5IIFA 3S17B 1CI3M 4IFDG 4XIGS 1F2YA 5EJWA 1EWCA 3SK6A 1QCBD 2BE5C 2B2YC 4JBWA 1TVXA 1IKLA 3AU7A 3I3CA 3C2PA 3SVMA 4RHRA 2K04A 1STHA 3K5NA 3RZDB 5J1ZA 1I4QA 4KI0A 5KYLA 2F0EA 5ELCA 4KN4C 4IFDH 1UNSA 1CQVA 1SDFA 3OWEB 1U4LA 2QDBA 1D1KA 1V43A 3HG9A 1JORA 1MGSA 3FKIB 5DEHA 3HS0C 1JICA 1PRTC 2ENBA 3A7LA 3FMCA 2EXZA 3V2TA 5KRUA 5K5PA 1MI2A 3NTHA 3HOXB 1GJXA 4DK0A 1BOSA 3T56B 1DOLA 1YNND 4HN7A 4RWSC 2HDMA 5DNFA 4KMUC 1SSOA 5E3FA 2E2IB 5ELDA 5DAUA 2E74C 3IFDA 1WTQA 1JOOA 4PV1C 4DF7A 2EYMA 3TSSA 3AB9A 2RA4A 1BCPB 4Y7NB 4ZAIA 1AFPA 5M5WB 4FNFA 4K2LA 1HPCA 1M4VA 1HRJA 1QOHA 4C3IB 5EKLA 2DY7A 2ZT9C 5M3FB 4A3GB 2NN6H 4DFAA 4J1MA 1IW7D 4IQZA 2ICEC 1HQRD 4K5XA 3X3NA 1LTBD 5IT9E 3SK4A 3U9OA 3H0GB 1WCMB 1U4RA 5CMDA 2MP1A 2K03A 3PO3B 2EYLA 1D6EC 3SDZA 4X3KA 3TP8A 4H44C 1B1ZA 2M00A 1BDOA 4BBSB 1X3QA 3TBIB 5FK9C 1NAPA 3LNNA 3FPUB 3M7NA 3NWTA 5EQ0A 3BDCA 3WOEA 1WD0A 1EY6A 3GQBA 4FXKC 4IURA 2FMMA 2SDFA 3H6MA 1HQMC 4XQQA 3D4WA 2R92B 1DCZA 4EQOA 4XTCS 2O4XA 4TQUS 5C4HA 2XNAC 3GTQB 4ID6A 3SHLA 3RUZA 5C3EB 3U9SA 3NQIA 3T53B 2KA7A 5CV9A 2LFNA 5COYA 3RMHA 2K01A 2O2LD 1SE4A 3VYRA 1ZYRD 3DHQA 5K36G 4OHJA 1GUWA 1PZKD 1Q1BA 1ONLA 1FNVA 1KABA 3CRKC 5CBAE 4RFBA 5KNBA 3A55A 3KK7A 2VB3X 3GTLB 4BA2I 1H9KA 3T16A 2SNSA 1V1PA 1VMCA 1BBXC 5JVG3 2F0TA 2F0IA 3PV0A 3GTPB 1A2UA 4CKBA 2HUGA 2F0DA 3K57A 3TN2A 1JB3A 1SNDA 2B2WC 4AYBB 4PMCA 2O5IC 1EY5A 1D2BA 3H09A 3LWEA 4KJOA 1TS3A 3GTGB 1LT3D 3D4RA 4BBRB 1RKNA 1VDZA 2B8FA 2X69A 1SAPA 4N9TA 1XTCD 1Y1VB 4DXGA 1A3VA 1Y8NB 1EFID 2DY8A 4C3HG 2BA1A 1CZGA 4MN3A 1OXXK 4WFN3 3D4DA 3M7GA 1E2ZA 3GO5A 4KJNA 1EYAA 3TDQA 3SXHA 3K58A 1HA6A 1SEBD 1NSNS 3QB3A 2A6HC 3SK8A 1DYQA 1CT1D 2NN6G 1K8OA 2EY2A 4G7OC 2BE5D 4XT3B 5IGFA 4OO1I 3ONAB 4U68A 2IX1A 2G9HD 1IYUA 3I4MB 2JEBI 2GA4B 1VCIA 1QB5D 5J39A 3HZXA 1STBA 2IWHA 3HOVB 5G3LF 1DONA 3Q0AA 1EU3A 4V0BA 3MC0B 4HCEA 4IFDI 2E2DC 4IUTA 2CVRA 1QNKA 1XXGA 5M3MB 1TWFB 1E2WA 1XWEA 2K28A 1SMYD 5KNCA 2N55A 4A3FB 2WACA 3S1RB 5CV8A 3UI2A 4RCOA 3NSWA 2R3ZA 1GUOA 1I4PA 2VB2X 1HHVA 1VF7A 2CW0C 3NXWA 1VF5C 3M4OB 2AQ1B 1EY0A 1EWHA 1TY2A 5A2QL 3FRPB 1Z6HA 2F0VA 5C3XA 2DNCA 1DZ1A 2XWBB 5CV7A 4G4KA 1J8IA 1ML0D 1G6ZA 2EE1A 1B9NA 3PUXA 5G3LD 5IOCA 4B9WA 1I4HA 1LT6D 4DXFA 5DM73 1GUNA 3PUWA 1ESRA 1I4GA 2DNEA 2NVYB 2TMPA 2BDOA 3IKJA 3EROA 4NDXA 3X3MA 2E75C 2KEDA 4ZRZA 1LACA 3IFTA 2IX3A 2C9OA 4ZKCB 5C0XH 2WB1B 2BOSA 4HMIA 2F0JA 1SNOA 3QIAA 1BXTA 3S1QB 3N52A 3D6CA 1EEID 3Q6SA 3J7YW 4IZ8A 3C46A 1SNQA 1YNJD 5CV5A 1GOZA 4KHVA 1PFMA 5CGKA 4K5WA 3EFXD 4TSSA 5IODA 3E5SA 1MD2D 2RVLA 2A69C 2AWOA 3OHXC 1TS2A 1SYFA 2AWNA 3I4LA 2L1BA 2R6GA 4LK1C 1U9RA 2RDHA 5C4ZA 1PLFA 1KTKA 1OXVA 2J4XA 2D5DA 2NTSA 1LABA 3BVGA 3S2DB 1PRTD 2K6AA 1I4XA 4ODGA 4HR7B 3DEOA 2EYOA 4H7BA 2Z4HA 3KUPA 5CC4A 4XYQA 4I65A 3NTKA 1XX8A 2SOBA 3OW7A 3SEBA 3BS1A 2IPKD 2I46A 4FO2A 1EOTA 2MGSA 1AZQA 5I9PA 1FNWA 5FO8B 2KJXA 5JOBA 3EA6A 4L6TB 1OXSC 4L8JA 3Q24A 2EZVA 2RSOA 3HOWB 4K6DA 5IGDA 2R7ZB 4FXGC 3LX0A 4OO1G 1RJTA 4L63B 4EGVA 4XXEA 3OPOA 5CBEE 4U673 4FP5D 4R8IA 1JR0D 4KV6A 4DNRB 1SE3A 2B2TC 1TS4A 3VR3A 1F9RA 2HDLA 1DXMA 2M2LA 2K5QA 2Z4IA 2CW0D 3BG3A 5C5MA 5I9OA 3VR6A 1HCZA 3OWFA 3I73A 4WORA 3K6OA 1V1OA 2XRSD 5EKKA 1ENFA 3I4NB 1Q90A 1HA5A 3I70A 4EQPA 3S9WA 1G2SA 3A8IE 2BA0A 1S5CD 3S2HB 2FHTA 3WDNA 2VNUD 2KOLA 4IUUA 1G8ZD 1RCVD 1S4ZA 1HUMA 1EIGA 5ELBA 3AMUA 1B2TA 4KN7C 3A56A 2EY1A 3DM1A 1F9PA 1T5EA 5E4WC 1B50A 2MUYA 1Q8IA 4K6LA 4K14A 4ZK9B 3D31A 1YNJC 1QILA 3NE5B 1M8AA 3J81E 5BN3A 4ILWA 5D3IB 5IT9L 1QNUA 4NW2A 2JSOA 1Y8PB 3QOJA 1F77A 2F03A 3FDTA 2Q8IB 5CR3A 5BN5A 2KUMA 2RQXA 2F0HA 3TMEA 3IL8A 2KVMA 1AN8A 4KKUA 5EBDA 2NZ1D 1PFNA 3BVZA 1UUPA 2YYZA 2N88A 1X3PA 3MEHA 1UEAB 1CA5A 3RD4A 3VR4A 3QWNA 1Y8OB 2B8GA 5AFWA 3NQTA 2F4IA 4WJWA 3VYUA 3PUZA 5EPJA 3A8KE 2EOTA 5C3WA 5LL6S 1Q12A 3OIPA 4FF1A 4KD4A 1JOKA 2FFKB 1LLRD 5T1IA 1HFNA 4HSPA 5KEEA 1D5XC 5IGBA 3HRZC 1EY9A 3LWUA 3DWPA 4N9PA 4C3IG 1HUNA 1OO9B 1H9MA 3I90A 1PTOC 3P75A 3I91A 3TP7A 3GTKB 4ZKBB 3MA2B 1FD7D 3H94A 3K0YA 2TSSA 1BF4A 2NWGA 4F8MA 4DAPA 3MXPA 2ZXOA 4HCSA 4OGQC 1SYCA 2RSNA 4DU9A 2MJ8A 2B39A 2KCNA 5CV4A 3GTOB 2QILA 4QCLA 4TRDA 1MSGA 2KQ3A 2RDFA 1PDQA 3DXJC 1TT2A 2JXMB 1DJRD 2F0PA 2XWJB 3QO2A 1SE2A 3DMUA 3EVQA 1B3AA 3C1FA 3PMFA 5ELFA 3S1NB 1IKMA 5C44B 1RTNA 5FOBB 3PUVA 1A3UA 1DM0B 4O1NA 1EIHA 1MBYA 3VA5A 5JEAG 2EYPA 4DAVA 1QJOA 1I4RA 2KCCA 2LS01 3C1EA 4XQNA 5KIXA 2L55A 2F0QA 4OL7A 2HCIA 3J80L 1LTSD 3P20A 3MXNA 2EY5A 3MVVA 4ZUJA 1WTWA 3SE0A 1EYCA 1UAPA 3HGBA 3MFGA 4RGMA 1PZJD 2B2VA 4R8NA 1DOKA 1BNZA 1LO5D 2EYHA 1RODA 4IUVA 1K8MA 3P1HA 1WTXA 4I7ZC 3HKZB 3HOZB 2RBMA 3VR5A 2PQEA 1L0XB 4RH6A 3CHBD 2EDGA 3H3VC 1FNUA 2JA7B 1XYIA 4C2MB 3QG1A 1GUTA 2NB0A 1C8CA 4B9XA 1W6KA 5I6WA 5D3DA 4CBVA 1S5DD 4QIWB 3BYTB 3DWQA 1SYBA 1EQVA 3ITPA 1R4QB 4XQJA 2CQAA 2JA5B 2WINB 4NP5A 4Z9CB 2PPBC 2JA8B 1TKWB 1SNPA 4BA1I 3T13A 2NYZD 4HMJA 3J81L 3D6WA 1CM9A 4PQXA 3TZUA 2FJ2A 1TU2B 2EJMA 5I2YA 2OEOA 3R93A 1R9TB 1D1IA 2NBFA 3TZDA 1F2ZA 2DN8A 2HQEA 3J80E 1KAAA 5T1GA 5A35A 2JYOA 4FXDA 5J22A 4ZQ3A 3URYA 2JP1A 4K5VA 3IAYA 4V190 3JAME 5JEAH 1ET9A 4G7HC 5EPKA 2B2VC 2PO4A 4XDXA 1H9JA 2WIIB 2NVTB 1LTGD 3MXUA 2K05A 1II3A 1ESFA 4RGNA 1TIID 2L9HA 1KDBA 4GZYC 4KY6A 1SFOB 1G2TA 2LY7A 4XT1B 1JWUD 2Z8LA 2XN9C 3NBHA 4CJ2C 2FINB 5FLXE 1LTRD 3GTJB 4P2CB 5JVH3 2B2WA 4C3HB 3Q22A 4IUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY4 A;  2F0T A;  5J39 A;  4DU9 A;  1STH A;  3HZX A;  1STB A;  4HMI A;  2F0J A;  5JAV A;  1SNO A;  1A3T A;  2F0I A;  4KV6 A;  5J1Z A;  2F0F A;  1A2U A;  1STG A;  5CV4 A;  4YIJ A;  3SK4 A;  3U9O A;  2F0D A;  2NUC A;  5CR3 A;  5KYL A;  1SYB A;  1EQV A;  3D6C A;  1IHZ A;  1SND A;  2F0E A;  3D8G A;  3ITP A;  4IZ8 A;  4QF4 A;  3MZ5 A;  2F0H A;  2PZW A;  3TME A;  5KRU A;  2PW5 A;  4TRD A;  4J6H A;  4WRD A;  1SNQ A;  2EYL A;  4PMC A;  2KQ3 A;  2RDF A;  3QOL A;  2F0W A;  3TP8 A;  3OSO A;  1TT2 A;  5CV5 A;  1EY5 A;  2RKS A;  4NP5 A;  2QDB A;  3R3O A;  5C5M A;  5NUC A;  3TP6 A;  2M00 A;  2F0P A;  4ME5 A;  4KHV A;  4KJO A;  1SNP A;  5I9O A;  1JOR A;  3T13 A;  3DMU A;  3EVQ A;  3MEH A;  3NUC A;  4KD3 A;  1EYD A;  3C1F A;  4K5W A;  4QB4 A;  5CGK A;  4LAA A;  3OMC A;  3OWF A;  4HMJ A;  5DEH A;  1STN A;  3PMF A;  3ERQ A;  1RKN A;  4WOR A;  5IOD A;  2F0K A;  1SYE A;  4ZUI A;  5EKK A;  2WAC A;  3E5S A;  5CV8 A;  2PW7 A;  4N9T A;  2ENB A;  4DGZ A;  1KDA A;  1A3U A;  3NQT A;  2EXZ A;  3V2T A;  1A3V A;  2PZU A;  1SYF A;  1SYD A;  2OEO A;  3BDC A;  1EY6 A;  5K5P A;  4F7X A;  4EQP A;  3H6M A;  3S9W A;  4G57 A;  3VA5 A;  1ENA A;  3EJI A;  1SYG A;  1F2Z A;  2EYP A;  3SK5 A;  1TR5 A;  2HQE A;  5IGG A;  5HGT A;  1EY8 A;  2SNM A;  3D4W A;  4QMG A;  5C4Z A;  3HEJ A;  1KAA A;  4EQO A;  2F0O A;  5ISR A;  5IGC A;  5C3W A;  2EYJ A;  3C1E A;  2O4X A;  5J22 A;  5KIX A;  2PZT A;  1SNM A;  5C4H A;  4ZQ3 A;  4KD4 A;  3NXW A;  2F0G A;  1NUC A;  2F0Q A;  4K5V A;  1JOK A;  4OL7 A;  2F0N A;  2F3W A;  5F2D A;  3D4D A;  1EY0 A;  4ID6 A;  4K8J A;  4K8I A;  3SHL A;  5E1F A;  3RUZ A;  5E3F A;  2F3V A;  4KTA A;  2KHS A;  5DAU A;  2EY5 A;  5KEE A;  5HUR A;  3MVV A;  2F0V A;  3NP8 A;  5C3X A;  4ZUJ A;  5IGB A;  4EVO A;  4KJN A;  1JOO A;  5KGU A;  4DF7 A;  5CV9 A;  2EYF A;  4S3S A;  1EYC A;  1SNC A;  4KY5 A;  4ODG A;  1EY9 A;  2EY1 A;  5CV7 A;  1EZ8 A;  1EYA A;  4HTH A;  4IAL A;  4N9P A;  3SXH A;  2EYO A;  2EYM A;  1AEX A;  2LKV A;  4H7B A;  1A2T A;  3TP5 A;  1TQO A;  4E6I A;  1II3 A;  1NSN S;  3BDL A;  3DHQ A;  3QB3 A;  4K14 A;  4R8N A;  5C5L A;  4B9W A;  5CC4 A;  5IOC A;  5KYI A;  5M9O A;  1STA A;  4I65 A;  4NKL A;  2EYH A;  5CV6 A;  1KDB A;  2SOB A;  3SK8 A;  4PMB A;  3P1H A;  3P75 A;  4KY6 A;  3TP7 A;  3MHB A;  5IIF A;  3NHH A;  4RKB A;  5I9P A;  3NK9 A;  1KAB A;  2EY2 A;  2RBM A;  4K2L A;  1EY7 A;  2F0M A;  1ENC A;  2PQE A;  4KY7 A;  4PNY A;  5IGE A;  5IGF A;  3ERO A;  4NDX A;  5JOB A;  4MIU A;  1STY A;  2EY6 A;  2PYK A;  1F2M A;  1KDC A;  2OF1 A;  4K2K A;  5EKL A;  1EZ6 A;  1JOQ A;  1F2Y A;  5EGT A;  4EQN A;  4RKL A;  2F0S A;  4NMZ A;  3SK6 A;  4K6D A;  5IGD A;  4DFA A;  5I6Y A;  3T16 A;  2SNS A;  3LX0 A;  4F8M A;  2OXP A;  2F0U A;  3QOJ A;  2F0L A;  3SR1 A;  4J1M A;  4B9X A;  5C6A A;  5I6W A;  3MXP A;  3OMG A;  1U9R A;  4K5X A;  4IUN A;  1SYC A; 
#chains in the Genus database with same CATH topology
 1T5X D;  2OT2 A;  5IYC H;  3A54 A;  4C3J B;  2K7V A;  4P72 A;  2EPB A;  3GD7 A;  5L37 A;  4JI0 Q;  3FPP A;  1CK1 A;  2ZJQ A;  4AYB G;  4HID A;  4A3E B;  3TRE A;  1VQC A;  2F4V L;  3RNU A;  2F3I A;  5TSS A;  4A3J G;  2A5H A;  4QIW E;  2G9D A;  3TP6 A;  4JCV E;  4DV4 L;  4LWC A;  3CCQ A;  4B3T L;  4KD3 A;  1NCV A;  3CCL A;  2QF7 A;  1BCP D;  2K5D A;  3ERQ A;  5IP9 H;  3K8A A;  4POG A;  3U58 A;  1E0B A;  2PW7 A;  3KOJ A;  4DGZ A;  3L2P A;  1CUK A;  1NR4 A;  3CCS A;  5EKI A;  1JQY D;  3WWV A;  1OXT A;  3MWY W;  4N8X 1;  5D14 A;  5IYC G;  1YNN C;  3P7J A;  1PYW D;  3NBI A;  1ENA A;  3SK5 A;  5EBC A;  3GV6 A;  2JA9 A;  4O0A A;  3JAM i;  1UWV A;  1LTA D;  3PIO A;  4WJ4 A;  2EYJ A;  5C4X B;  4NB3 A;  1PMR A;  1LUZ A;  2WP8 J;  2I5H A;  1PZI D;  3TS0 A;  3F2U A;  3PIP 3;  3UE1 A;  4K0K L;  4RCN A;  1I3Q H;  2Q8R E;  4A3M B;  1KRT A;  4GLA C;  1SLJ A;  2JE6 I;  1X3E A;  4R4C A;  2K14 A;  3I72 A;  3BDL A;  3G6J B;  4C3J H;  1QWY A;  4LFC L;  3J7A 5;  3G71 A;  3FEW X;  3GDE A;  4PMB A;  1IBK L;  1TY0 A;  5M3M G;  2HHH Q;  1KQS A;  1EL0 A;  1B4O A;  1VQE A;  1S5B D;  1K83 B;  4MTK A;  2N49 A;  2QDL A;  1I3Q B;  5IGE A;  2RDG A;  4DA2 A;  4KKT A;  1STY A;  3I4N H;  3MXN B;  1K8G A;  1K0S A;  4RKL A;  2F0S A;  3GTQ H;  5C4X G;  1VQL A;  2Q8T A;  5M3F G;  2JA6 B;  4B3S Q;  3TRZ A;  4BBR H;  1H95 A;  5M3M H;  2WFW A;  1JJG A;  2A68 D;  4QJF A;  2L4N A;  4OO1 H;  4X64 Q;  1XPO A;  5K36 H;  3OMG A;  1EY4 A;  1Y69 U;  1L0Y B;  4J8Q A;  5JAV A;  4YY3 Q;  3ER0 A;  1N36 Q;  4YWL A;  1ZEQ X;  5M5X B;  1STE A;  1IHZ A;  3HP3 A;  1HR0 W;  3R2I A;  3MZ5 A;  4A3B B;  1KHI A;  2PW5 A;  4X3S A;  4KHZ A;  1CFM A;  1R4P B;  4A3C G;  1PH7 A;  4ABN A;  3KLW A;  3R3O A;  3UE0 A;  4HSV A;  4JG2 A;  3PUY A;  3T1H Q;  1C0A A;  4LAA A;  3S16 B;  2CHB D;  1Q3L A;  2XSC A;  2F0K A;  4CHT B;  4IUP A;  1A6X A;  4HIO A;  1YVC A;  3S17 H;  2HCC A;  1VQP A;  1YJN A;  4DV5 L;  2I07 B;  1SMY C;  3F2D A;  2CH4 A;  1IBM Q;  3VR2 A;  5BR8 L;  5C0X I;  1GHJ A;  2LMC B;  3FKI G;  5HGT A;  4QMG A;  5FKA C;  2SEB D;  5ISR A;  2L12 A;  3QJY A;  5JJI A;  3HOX H;  1QZH A;  3E6Z X;  4JI2 L;  5EAY A;  2F0G A;  4JI1 L;  1KNE A;  1CQF A;  5IP9 G;  4A3J H;  4DR5 L;  2F3W A;  3D3R A;  1U4P A;  1UE1 A;  3HOY H;  4OON A;  2B2Y A;  4BXX H;  3A8J E;  2B29 A;  2MPM A;  1YHA A;  3GP7 A;  1PTO H;  4H0L C;  5CYU A;  2PNH A;  3S2D H;  1ILP A;  4BY1 B;  4S3S A;  4JBM A;  1F9S A;  1LT4 D;  1NMF A;  1Z47 A;  2WAQ B;  4JI8 L;  4UPA A;  2N8N A;  4GOP A;  1IXR A;  4E6I A;  5LL6 X;  3KLS A;  1FVI A;  4A3D H;  4JI4 Q;  2V1C C;  4DR7 L;  2OTL A;  1M1K C;  1WOC A;  1HFG A;  4KHP Q;  3HOU B;  3NK9 A;  3HOV H;  1ENC A;  2E2H B;  2FMC A;  1A8V A;  1F2M A;  1KDC A;  2OF1 A;  2RCN A;  2VUM B;  4UP8 A;  1U4M A;  2KBN A;  2L5T A;  2MHV A;  1JE4 A;  3PCO B;  4P74 A;  1P8L A;  2YU9 B;  2WB1 G;  2GVA A;  4R9W A;  1G29 1;  1RDP D;  3BZC A;  4DV7 Q;  3PO2 B;  2KEC A;  3PO3 H;  4BY7 B;  2AQ3 B;  1GUG A;  1PTO D;  3HOU H;  2BCO A;  3KF8 B;  4QF4 A;  1XMO Q;  4J6H A;  1O80 A;  3NBH B;  4PG3 A;  3ERS X;  3O13 A;  3CCV A;  1VQH A;  3KLS X;  4X3T A;  4JYA Q;  4QGU A;  3NWS A;  2B2T A;  3MFY A;  1G51 A;  4C1N I;  2D2C C;  1CZW A;  1GKH A;  2IT1 A;  4MHE A;  3VA7 A;  1KRS A;  1S3O A;  5IT9 c;  1I6V C;  2JA5 H;  1PTO B;  1O7I A;  1DOM A;  1TWC B;  1XTD A;  2E5L L;  2NVX B;  3GTK H;  1SBB B;  5M5W H;  2PZU A;  1BKB A;  3RLN A;  4F7X A;  2A69 D;  3VYT A;  1LTT D;  5A2Q E;  1TWG B;  1HZ9 A;  2IW3 A;  1H9S A;  4MTN A;  5M5Y B;  4O42 A;  4IUQ A;  4F88 A;  5I4D A;  1C7Y A;  1UE6 A;  1SNM A;  4X3U A;  2JA7 H;  2AUK A;  2D62 A;  3K7A B;  4M1U B;  4OIK A;  5F2D A;  4YHH Q;  1C48 A;  1AE2 A;  1LYL A;  1CKM A;  3R2T A;  5KND A;  5D65 A;  5HUR A;  2M9V A;  3SGI A;  4EVO A;  3ND8 A;  4GN5 A;  3GV3 A;  1I6H B;  2EYF A;  1IBL Q;  4KY5 A;  1PH3 A;  2E2J B;  1IYV A;  3OIQ A;  2B63 B;  4Y52 H;  1TWH B;  4HTH A;  4HAE A;  3M4Y A;  1P16 A;  1A2T A;  4BXX G;  1TS5 A;  4H13 C;  1PTO F;  3I8Z A;  1PH9 A;  4DK3 C;  5EPL A;  3S1R H;  4LNQ A;  3JAM c;  2VY3 A;  4UP9 A;  1KIX A;  2QKI C;  1QG7 A;  4A93 H;  2A73 B;  4RKB A;  3KBX A;  1WTO A;  4KY7 A;  1TWC H;  1VQB A;  2AQ2 B;  4DK1 A;  4DV6 Q;  1PH4 A;  2PYK A;  1JOQ A;  3HOY B;  1EZ6 A;  4C3J G;  4EQN A;  1HNZ Q;  1CKN B;  4YHH L;  3HFZ B;  3K5O A;  2VXW A;  1I50 H;  1B53 A;  2F0U A;  1BQQ T;  4JC0 A;  2JA8 H;  5JEA J;  4DUZ L;  3ICE A;  2Q2T A;  4A3J B;  3L3O C;  3UDG A;  1PVO A;  3AFQ A;  2ATW A;  1Y1W H;  3CU7 A;  5BR8 Q;  1RHP A;  1E2V A;  1IL2 A;  3HOV G;  1W3S A;  2A6E C;  3S14 B;  2Z6B A;  3PIP A;  1SJH D;  1X32 A;  1B8A A;  2ZXR A;  3A7A B;  1FGB D;  4WRD A;  1WVL A;  1EUJ A;  3GTM B;  1HTP A;  2Q2I A;  2K32 A;  1Q1E A;  3CKI B;  2L11 A;  2PMZ B;  1JWM D;  1XMO L;  1VQ7 A;  4M8A A;  4B3M Q;  1EYD A;  4KK7 A;  1X9N A;  2EVB A;  5IWA L;  1AZP A;  1XPU A;  5GQO A;  4JV5 Q;  2Q2U A;  4A3D B;  3M3Y B;  3RLF A;  3G7L A;  3H91 A;  5C4X H;  2NZH A;  1SYD A;  2O5J C;  4BWG B;  1SYG A;  3I4M G;  4O2D A;  4A3M G;  1V1Q A;  4B3R L;  2R61 A;  4CJ0 B;  3KJP A;  3CRL C;  3FP9 A;  4LF9 L;  1WTR A;  1X3G A;  2MFI A;  4HJA A;  2VS1 A;  5E1F A;  2J7Z A;  1Y14 B;  4UAI A;  2F3V A;  3MXG A;  4KTA A;  4OIJ A;  3M85 A;  3DUZ A;  3NP8 A;  1HR0 Q;  1CHQ D;  3OTO Q;  4A3I H;  2A8V A;  3A74 A;  1EQR A;  4LMQ D;  1TQO A;  4CGY B;  4LF7 L;  1CTM A;  5C5L A;  1HTL D;  3PSI A;  4FF4 A;  1FYC A;  1X56 A;  1R9T H;  4GNX B;  2NZO A;  4DV2 L;  3MTS A;  3MHB A;  5C0X J;  4DR2 Q;  2XIW A;  3NHH A;  2QCP X;  3L9A X;  4DR2 L;  3Q23 A;  4YCV A;  3RZO B;  1EY7 A;  2F0M A;  1WTV A;  4MIU A;  1VQG A;  2A68 C;  4KKS A;  4NMZ A;  4DR5 Q;  2H1E A;  3W1B A;  2AUJ D;  3E0E A;  2XRQ D;  2EXD A;  2OXP A;  3J81 i;  2F0L A;  1ICW A;  2VZA A;  4A3G H;  2CQO A;  2P5Z X;  1HXY D;  1A3T A;  2Y0S B;  1STG A;  4YIJ A;  5LMN W;  3ND9 A;  5FO7 B;  2PNR C;  4DNT B;  3H0G G;  4DR6 L;  1F2L A;  2PZW A;  4DV6 L;  3K5M A;  4ZYS A;  3QOL A;  3EQL C;  2A74 C;  1OXU A;  2CFM A;  1YBY A;  2RKS A;  5NUC A;  3M3Y H;  4A3K B;  5M5X H;  1BR9 A;  4C1N K;  3T1Y Q;  2RF4 A;  3ZYY X;  3T4A C;  1QUQ A;  1STN A;  4LF8 Q;  1BCP F;  2ICI A;  1ZKO A;  1T9H A;  1XJV A;  3AYH B;  1NR2 A;  2CH4 W;  1WCM H;  2R7Z H;  3S1M B;  3V05 A;  5C0X G;  1H9R A;  1ZYR C;  4DAY B;  4A3I B;  3U50 C;  4CJ1 B;  1EIF A;  4UP7 A;  3JAM L;  3W2D A;  3T51 B;  4NXM L;  2JQO A;  5IGG A;  2QEJ C;  4YWK A;  2UXC L;  1J9O A;  2F0O A;  1PH2 A;  4JI3 Q;  2X6L A;  4A3F G;  1O7Y A;  2PZT A;  2F0N A;  4PZ7 A;  4DAY A;  2JK8 A;  4K8I A;  1FJG Q;  1BCP C;  5JJZ A;  1UE7 A;  4X65 Q;  5C4J B;  4OWT B;  3HKZ G;  1NTG A;  2Z0S A;  1SXT A;  4ZLT F;  1SNC A;  3BU2 A;  2IX0 A;  4EQ5 A;  1EU4 A;  1EZ8 A;  2GN5 A;  2UUB Q;  4QUF A;  1DD2 A;  2Z1C A;  3K5L A;  3TP5 A;  1WCM G;  5M9O A;  2ZXP A;  1QE6 A;  5FLX L;  2HQL A;  2IL8 A;  2EJF C;  2A6E D;  4OWX B;  5FLM H;  3KBG A;  4Q5V A;  1D5Z C;  2WKC A;  2R92 H;  4BS9 A;  2D9U A;  4PNY A;  4UDU C;  3I56 A;  2EY6 A;  2BDN A;  2C5C A;  3FVQ A;  2K5W A;  1Z7T A;  2AMC B;  4OEL B;  3OOC A;  3DWA A;  1K28 A;  5I6Y A;  4Q0F A;  4A3E H;  1FR3 A;  3C3L A;  2IHE A;  3KF6 A;  1XMQ Q;  5KGU A;  2NTT A;  4AYB E;  3PIO 3;  1VQ9 A;  1K73 C;  2VQE L;  3J7A F;  5AJ3 Q;  3NPP A;  4RGO S;  2R7D A;  3J7A V;  3N6R A;  1N36 L;  1K8A C;  3D8G A;  1A15 A;  4JI6 L;  5JJL A;  5HY6 A;  1ILQ A;  4GLV B;  1N8R C;  1VMP A;  2KCM A;  4JI1 Q;  1PRT F;  1WD1 A;  1VQI A;  1ET6 A;  1RF2 D;  4CDF C;  2V4D A;  3CCM A;  2K50 A;  2X6G A;  5ELN A;  4ME5 A;  5C3E G;  2B2U A;  2K52 A;  1GHK A;  1GXD C;  1Y1W B;  4FYD A;  4QB4 A;  3OMC A;  1PYS B;  3PF4 A;  4TKO B;  4C3H H;  1SYE A;  1SJE D;  1G91 A;  1LTI D;  3PO3 G;  1YEZ A;  3BVM A;  1KLU D;  2ID0 A;  3K0X A;  1W2B A;  2XVS A;  3MAQ A;  3J7Z C;  2K1B A;  4Y7N H;  2VQF Q;  1SN8 A;  1BBW A;  1XNQ Q;  1BO0 A;  3EJI A;  3J81 c;  3R8B A;  1EY8 A;  4QUC A;  4CKC A;  2EJG C;  1IL8 A;  5IGC A;  1S5E D;  4RAU C;  3TEH B;  4EX5 A;  4R4O A;  1EQT A;  4DN4 M;  1QVC A;  4DV1 L;  1B44 D;  2RHS B;  4YCW A;  1VQD A;  3KLR A;  1NUC A;  2KEE A;  2NVT H;  4K8J A;  4FF3 A;  4FF2 A;  3E0J A;  1JCK B;  4F87 A;  4C2M H;  5JPM C;  5JPN C;  4B08 A;  2OTJ A;  2ZJP A;  3BZD B;  1N34 L;  1PFB A;  1AW7 A;  1KC8 C;  1VQ4 A;  5DM6 3;  3AQQ A;  1TWA B;  1LT5 D;  2QGQ A;  3BYY B;  4LJZ C;  3W3A A;  1AEX A;  1MSH A;  3CPF A;  4DV3 Q;  2WV6 D;  1G6P A;  3H0G H;  1S5F D;  5E4X A;  4G7Z C;  1H9S B;  5CV6 A;  2NN6 I;  1PXU A;  4ULL A;  4DR7 Q;  2MQH A;  5LHY 1;  1HH2 P;  1W6J A;  1RD9 D;  4RGT A;  4P73 A;  2WKD A;  1KLG D;  4KHP L;  2B2U C;  4HJ7 A;  3HKS A;  3F8T A;  4K2K A;  4B3T Q;  2PI2 A;  4HJ5 A;  5EGT A;  2JA7 G;  4YY3 L;  4IFD J;  3BDO A;  1ICF B;  3KF8 A;  2L0C A;  4A3E G;  2UUB L;  3SR1 A;  1HZA A;  5C6A A;  2G5D A;  1I50 B;  2ASB A;  5LMN L;  1NBW A;  4JK1 C;  4JI5 Q;  1B7Y B;  2IJ0 A;  4HED A;  3STB D;  1HR0 L;  1LV9 A;  2F0F A;  3J81 j;  1C4Q A;  4R4T A;  3DEP A;  5FO9 B;  2R93 B;  1VQM A;  2NUC A;  1QVG A;  3AEV A;  4X64 L;  4LW1 A;  3NTI A;  4GNX A;  4A93 B;  2R7Z G;  4DNI A;  3H3V I;  4LUZ A;  5IYD G;  3RZD H;  2F0W A;  4HIM A;  3OSO A;  3CQZ H;  5I2X A;  1O7Z A;  4A3C H;  1RTO A;  3UDI A;  4XYO A;  1ZXT A;  2H4O A;  1V8Q A;  3L7Z C;  4DV5 Q;  1F9Q A;  3NUC A;  1I6H H;  4OWW B;  2VQE Q;  1IW7 C;  2N3S A;  4ZUI A;  3IRB A;  1EEF D;  3S24 A;  4H02 A;  1KDA A;  1JC7 A;  1JWS D;  3K7A H;  3CQZ B;  2R7F A;  1E3P A;  4G57 A;  2K33 A;  3NEM A;  1TR5 A;  1X54 A;  2SNM A;  1KXL A;  3HEJ A;  1GD7 A;  4TVA B;  1CA6 A;  3GTO H;  1CHP D;  1PA6 A;  3I4N G;  1E1T A;  1BUV T;  3Q8D A;  2JEA I;  4IOA A;  1YHQ A;  4RA8 A;  3JC6 6;  4C56 C;  3S15 B;  3WOF A;  2F1M A;  5ELE A;  4CKE A;  1SR3 A;  2OCE A;  2KHS A;  3HKZ E;  1KNA A;  4PMW A;  5COR A;  4P75 A;  1PRT B;  3GTL H;  1WTP A;  3K59 A;  2E76 C;  3VYS A;  1GUS A;  4IN3 A;  3F1Z A;  1V1P B;  4IAL A;  4FVM A;  2LKV A;  1VS0 A;  1O78 A;  2J0T D;  5BN4 A;  1VQN A;  1O7L A;  2NVQ B;  3CCJ A;  5KYI A;  1AP0 A;  1D5M C;  1K83 H;  4ME3 A;  1STA A;  1GO3 E;  4NKL A;  1L1O C;  1CKO A;  1CSP A;  2PCF B;  1B9M A;  2A6H D;  4RHS A;  3V96 A;  5IIF A;  3S17 B;  3W5O A;  1L1O B;  1CI3 M;  1MKH A;  1K9M C;  4IFD G;  4XIG S;  1F2Y A;  1VQK A;  1VQ8 A;  2F4V Q;  5EJW A;  1EWC A;  3SK6 A;  1QCB D;  1YNX A;  2BE5 C;  3MEF A;  4JBW A;  2B2Y C;  1HNX L;  1TVX A;  3EN2 A;  3I3C A;  1IKL A;  2D0P A;  3AU7 A;  4R4I A;  4RHR A;  3SVM A;  4X65 L;  3C2P A;  2RHQ B;  5M5Y H;  2K04 A;  1STH A;  3K5N A;  1MJE A;  3RZD B;  5J1Z A;  4A3B H;  1I4Q A;  4KI0 A;  5KYL A;  1QZG A;  3DLL A;  2F0E A;  5ELC A;  4KN4 C;  4CDC C;  4IFD H;  2KHI A;  3A0J A;  3S1Q H;  1UNS A;  1CQV A;  1SDF A;  2A1A A;  3OWE B;  1U4L A;  2N78 A;  5FJ8 G;  2QDB A;  1D1K A;  3K80 C;  4A3I G;  1V43 A;  3CC2 A;  3HG9 A;  1JOR A;  1MGS A;  3FKI B;  5DEH A;  3HS0 C;  1JIC A;  2IHF A;  4DR1 L;  1PRT C;  1M90 C;  2ENB A;  3A7L A;  4APV A;  3CC4 A;  3FMC A;  2EXZ A;  3V2T A;  5KRU A;  4JI4 L;  5K5P A;  1MI2 A;  5GAH C;  3NTH A;  5LMU Q;  4L5R C;  3HOX B;  2UXD Q;  1GJX A;  4DK0 A;  1YHB A;  4A3M H;  5FJ8 H;  1L0W A;  2YU9 H;  1BOS A;  3T56 B;  1DOL A;  1YNN D;  1D7Q A;  2EQS A;  2WAQ G;  5C44 H;  4HN7 A;  4RWS C;  2HDM A;  2E2J H;  3S16 H;  1J5E Q;  3G4S A;  5DNF A;  4KMU C;  1SSO A;  5E3F A;  5E7N A;  2E2I B;  3NEL A;  3GTG H;  5ELD A;  5DAU A;  2E74 C;  1S40 A;  3IFD A;  1WTQ A;  1JOO A;  4PV1 C;  4DF7 A;  4LF6 L;  1KL9 A;  3B6Y A;  2DJG C;  2HHH L;  2VUM G;  3OTO L;  2EYM A;  3TSS A;  4DUY Q;  3AB9 A;  2RA4 A;  2ZTD A;  1BCP B;  2DJF C;  3CAM A;  4Y7N B;  4ZAI A;  1NE3 A;  1AFP A;  4WJ3 M;  5M5W B;  4FNF A;  1L2F A;  4K2L A;  1HPC A;  1M4V A;  1HRJ A;  4BBS G;  1QOH A;  5C44 G;  4C3I B;  5EKL A;  1XMQ L;  2DY7 A;  3T1Y L;  2ZT9 C;  5M3F B;  2B3G A;  2JA6 G;  4A3G B;  2NN6 H;  4CDE C;  2C35 B;  4DFA A;  3KYH C;  4J1M A;  3S2H H;  1IW7 D;  4IQZ A;  2ICE C;  2MNA A;  1HQR D;  4K5X A;  1LTB D;  2EIF A;  3X3N A;  3F2B A;  4GKK L;  4DV7 L;  2Y0S G;  5IT9 E;  2MO0 A;  3SK4 A;  3U9O A;  1PFS A;  3H0G B;  2R92 G;  1WCM B;  1QUQ B;  4JI0 L;  1U4R A;  4DR6 Q;  5CMD A;  2MP1 A;  2K03 A;  3PO3 B;  2EYL A;  1D6E C;  3SDZ A;  4X3K A;  3TP8 A;  2VL6 A;  5M3F H;  3G6E A;  4B3S L;  4H44 C;  4QQB X;  1B1Z A;  2M00 A;  1BDO A;  1FGU A;  1FJG L;  4BBS B;  1X3Q A;  1NJI C;  3TBI B;  5FK9 C;  2VQF L;  1NAP A;  3LNN A;  2HT1 A;  1SMX A;  3A5Z B;  3FPU B;  3GTJ H;  3M7N A;  3NWT A;  5EQ0 A;  3BDC A;  3WOE A;  1WD0 A;  1EY6 A;  3GQB A;  4FXK C;  4IUR A;  2FMM A;  2SDF A;  3H6M A;  1HQM C;  2YTY A;  4XQQ A;  3D4W A;  2R92 B;  1DCZ A;  4EQO A;  4GNX C;  3DM3 A;  3PO2 G;  2JN4 A;  4XTC S;  2B63 G;  2O4X A;  4TQU S;  5C4H A;  5LMU L;  2XNA C;  2KHJ A;  2JA6 H;  4JOI C;  1JMC A;  3GTQ B;  3CME A;  4ID6 A;  3SHL A;  4LUV A;  4DPG A;  1HNW Q;  1K3B C;  1BVS A;  3RUZ A;  5C3E B;  3U9S A;  4JBK A;  3NQI A;  2K5V A;  4BY7 G;  1JE5 A;  1I5F A;  2KA7 A;  5CV9 A;  3T53 B;  2LFN A;  5COY A;  3M4Q A;  3H15 A;  4YCU A;  3RMH A;  1PH5 A;  2K01 A;  2O2L D;  1SE4 A;  2MO1 A;  5IE8 A;  3VYR A;  1ZYR D;  3S1M H;  1TWG H;  2Z6K C;  3DHQ A;  3HOZ H;  2UXB Q;  5K36 G;  4OHJ A;  1N34 Q;  2UXB L;  4NXN Q;  1GUW A;  1PZK D;  2K75 A;  1Q1B A;  1ONL A;  1FNV A;  4A75 A;  1KAB A;  3CRK C;  5CBA E;  4RFB A;  5KNB A;  1N33 Q;  3A55 A;  3KK7 A;  2VB3 X;  2R93 G;  4B3M L;  2JJQ A;  3GTL B;  4BBR G;  1EIY B;  4BA2 I;  1H9K A;  5IWA Q;  1HNW L;  3U4Z A;  3T16 A;  2SNS A;  1V1P A;  1VMC A;  3CC7 A;  3HOZ G;  1NMG A;  1BBX C;  5JVG 3;  2F0T A;  1IBL L;  2F0I A;  3PV0 A;  2AKW B;  3GTP B;  1A2U A;  4CKB A;  2HUG A;  2F0D A;  3K57 A;  3PF5 A;  3TN2 A;  1JB3 A;  4RMF A;  1SND A;  1YJW A;  1MJC A;  2B2W C;  4AYB B;  4PMC A;  2O5I C;  4QL5 A;  4ALP A;  1EY5 A;  3PQI A;  1D2B A;  4BBS H;  3H09 A;  3LWE A;  4KJO A;  1TS3 A;  4LFB Q;  3GTG B;  1LT3 D;  1PH8 A;  1KAW A;  3D4R A;  4BBR B;  1B70 B;  1RKN A;  1VDZ A;  2B8F A;  1WFQ A;  3E9H A;  3HOY G;  2X69 A;  4IPG A;  1SAP A;  4N9T A;  1XTC D;  3S14 H;  4GS3 A;  1Y1V B;  3FHW A;  1HZC A;  4DXG A;  1A3V A;  1Y8N B;  4JOI A;  1EFI D;  4FDB A;  1PYB A;  2DY8 A;  4C3H G;  4JPB W;  2BA1 A;  1CZG A;  4MN3 A;  1OXX K;  4DV4 Q;  2CCZ A;  1YIJ A;  4WFN 3;  4LF8 L;  3K7U C;  3D4D A;  2Z6K A;  3M7G A;  2DUD A;  4DR3 L;  1E2Z A;  3ZJY C;  4AH6 A;  3GO5 A;  4KJN A;  1EYA A;  3TDQ A;  5HGQ A;  4YWM A;  3SXH A;  4JI8 Q;  3K58 A;  1HA6 A;  1QVF A;  1SEB D;  2I5M X;  1NSN S;  1SRU A;  3QB3 A;  2PQA B;  2A6H C;  3RN2 A;  4JI7 Q;  3SK8 A;  1DYQ A;  1CT1 D;  2NN6 G;  2ES2 A;  4IPH A;  1Q46 A;  3OYY A;  2KEN A;  2EY2 A;  4G7O C;  1K8O A;  2BE5 D;  4XT3 B;  5IGF A;  4OO1 I;  3ONA B;  4U68 A;  3CMA A;  2IX1 A;  2G9H D;  3W1G A;  4GKJ Q;  4DK6 C;  1IYU A;  1AH9 A;  4JI5 L;  3I4M B;  2JEB I;  2GA4 B;  1VCI A;  1QB5 D;  5J39 A;  3KJO A;  3M4O H;  3HZX A;  1HJP A;  1STB A;  3VDY A;  1ASY A;  2IWH A;  3HOV B;  5G3L F;  1S72 A;  1DON A;  2Y0S E;  2UUC L;  3Q0A A;  4A3F H;  3I4O A;  3T1H L;  1EU3 A;  1CSQ A;  1YZ6 A;  4V0B A;  3MC0 B;  4HCE A;  4IFD I;  5JJK A;  2E2D C;  2L15 A;  2CVR A;  4IUT A;  1QNK A;  4JI6 Q;  1XXG A;  5ELO A;  5M3M B;  1TWF B;  1E2W A;  2KCT A;  1XWE A;  3TQY A;  5IYD H;  3CCE A;  1GM5 A;  2K28 A;  1SMY D;  5KNC A;  2N55 A;  4A3F B;  2WAC A;  3S1R B;  5CV8 A;  3UI2 A;  4RCO A;  3NSW A;  4B3R Q;  2WB1 E;  2R3Z A;  4X62 Q;  1GUO A;  5FLX c;  1I4P A;  2VB2 X;  3E9I A;  1DGS A;  3G48 A;  1HHV A;  1WI5 A;  4HJ8 A;  1VF7 A;  2CW0 C;  3NXW A;  3K81 C;  1VF5 C;  3M4O B;  4UY8 C;  2AQ1 B;  3A5U A;  2CWA A;  1EY0 A;  1EWH A;  1TY2 A;  4KLK A;  1A62 A;  5A2Q L;  3FRP B;  1Z6H A;  2ZTE A;  2F0V A;  5C3X A;  2E2I H;  1L1O A;  2DNC A;  1DZ1 A;  2XWB B;  2LSS A;  5CV7 A;  4A3B G;  4G4K A;  1J8I A;  1ML0 D;  3UDF A;  1G6Z A;  2EE1 A;  1PH6 A;  1B9N A;  2NVX H;  3PUX A;  5G3L D;  5IOC A;  1A0I A;  4B9W A;  4A3G G;  1I4H A;  5DLQ E;  4OXP A;  2R93 H;  3CP0 A;  1LT6 D;  4DXF A;  2BH8 A;  1SE8 A;  5DM7 3;  2UXC Q;  1GUN A;  1PH1 A;  3PUW A;  1J5E L;  1ESR A;  1I4G A;  2DNE A;  2K5N A;  3HOU G;  2TMP A;  2NVY B;  2BDO A;  3IKJ A;  3ERO A;  4NDX A;  4OEM B;  4HJ9 A;  4DR3 Q;  5LMN Q;  2AHO B;  1WTH A;  3X3M A;  2E75 C;  4GKK Q;  2KED A;  3NEN A;  2XTI A;  4ZRZ A;  3IFT A;  1LAC A;  2IX3 A;  2C9O A;  1C9O A;  5H1S E;  4ZKC B;  5C0X H;  2WB1 B;  2BOS A;  4HMI A;  2F0J A;  1SNO A;  2K4K A;  4QY7 A;  3QIA A;  1BXT A;  3S1Q B;  3N52 A;  3D6C A;  1EEI D;  3Q6S A;  3J7Y W;  4IZ8 A;  4NXN L;  2HIX A;  3C46 A;  1SNQ A;  4IPC A;  2ZJR A;  1YNJ D;  1E24 A;  1GVP A;  5CV5 A;  1GOZ A;  4IJH A;  4A3K G;  3UDX A;  4KHV A;  1PFM A;  2H5X A;  1MHW C;  4UHV A;  5CGK A;  4K5W A;  3EFX D;  2OWO A;  4TSS A;  3KF6 B;  5IOD A;  2CWP A;  3E5S A;  1MD2 D;  2RVL A;  5IP7 H;  1EWI A;  2A69 C;  4DV0 Q;  2AWO A;  2A19 A;  3OHX C;  1TS2 A;  1SYF A;  2CKZ B;  2AWN A;  2PQA A;  3I4L A;  1XNQ L;  2L1B A;  2Q2H A;  2R6G A;  4LK1 C;  3RR5 A;  2IY5 B;  3J80 i;  2RDH A;  1N32 L;  5C4Z A;  1PLF A;  1KTK A;  1OXV A;  4LFC Q;  2J4X A;  2D5D A;  2NTS A;  1LAB A;  2ZM6 L;  3BVG A;  3S2D B;  5C4J H;  1TWF H;  3J80 c;  1Q7Y C;  1PRT D;  2K6A A;  3HOW H;  1I4X A;  1XNR L;  4ODG A;  4HR7 B;  4DR1 Q;  3DEO A;  2EYO A;  4H7B A;  2Z4H A;  3KUP A;  2WAQ E;  1RL2 A;  5CC4 A;  3E3X A;  4ZCK A;  4I65 A;  4XYQ A;  1E7Z A;  3NTK A;  1XX8 A;  2SOB A;  3OW7 A;  3SEB A;  3BS1 A;  2IPK D;  2I46 A;  4LF4 L;  4FO2 A;  4N8F A;  1EOT A;  2MGS A;  2YV5 A;  1AZQ A;  5I9P A;  4PZ8 A;  4P71 A;  1FNW A;  5FO8 B;  1A63 A;  2KJX A;  5JOB A;  3EA6 A;  4L6T B;  1OXS C;  4AIM A;  4L8J A;  3Q24 A;  2EZV A;  2RSO A;  3HOW B;  3F2C A;  4K6D A;  5IGD A;  2R7Z B;  4FXG C;  3LX0 A;  2VUM H;  4OO1 G;  1RJT A;  4L63 B;  4EGV A;  2Z9H A;  4XXE A;  3OPO A;  2PMZ E;  5GRO A;  5CBE E;  4U67 3;  4OX9 L;  4FP5 D;  4R8I A;  1JR0 D;  4KV6 A;  1HNX Q;  4GN3 B;  4DNR B;  1SE3 A;  3KDF A;  2B2T C;  1TS4 A;  3VR3 A;  1F9R A;  2I0Q A;  2HDL A;  1Q82 C;  1DXM A;  2M2L A;  2K5Q A;  2Z4I A;  2CW0 D;  1N32 Q;  3BG3 A;  5C5M A;  4JYA L;  5I9O A;  2UU9 L;  4JI2 Q;  2UU9 Q;  3VR6 A;  1HCZ A;  4JVZ A;  3OWF A;  4R4Q A;  3ULP A;  3I73 A;  2QW7 A;  4WOR A;  3K6O A;  1V1O A;  2XRS D;  3I55 A;  5EKK A;  2E5L Q;  1ENF A;  3EIV A;  1Q90 A;  3I4N B;  1HA5 A;  4DAM A;  1WJJ A;  4NXM Q;  3I70 A;  4EQP A;  3S9W A;  1G2S A;  4LF5 Q;  4LF9 Q;  3A8I E;  2BA0 A;  2OQK A;  1S5C D;  3S2H B;  2FHT A;  3WDN A;  2VNU D;  2KOL A;  4IUU A;  1G8Z D;  1RCV D;  2UXD L;  3I2Z A;  3RN5 A;  1S4Z A;  1TWA H;  1HUM A;  1EIG A;  3CCR A;  3H3V H;  5ELB A;  4JV5 L;  4JBJ A;  1I94 L;  3AMU A;  4DV3 L;  2LXK A;  1D8L A;  1B2T A;  4PZ6 A;  4KN7 C;  3A56 A;  2RCF A;  2EY1 A;  3DM1 A;  1F9P A;  1T5E A;  5E4W C;  1B50 A;  2MUY A;  1Q8I A;  4K6L A;  1Z9F A;  4K14 A;  4NPS A;  1SFO H;  4ZK9 B;  3D31 A;  4DKA C;  4LF5 L;  1YNJ C;  1PHJ A;  2PI2 E;  1QIL A;  4MNO A;  2UUC Q;  3NE5 B;  1M8A A;  3J81 E;  4ILW A;  5D3I B;  5BN3 A;  4A3D G;  5IT9 L;  1QNU A;  4NW2 A;  2OQ0 A;  1Q8K A;  2JSO A;  1YJ9 A;  1Y8P B;  3QOJ A;  1F77 A;  1VQ5 A;  3D0F A;  2F03 A;  2E8G A;  1IBM L;  3FDT A;  2Q8I B;  2QEX A;  5CR3 A;  3STB C;  5BN5 A;  2KUM A;  5IP7 G;  2RQX A;  2F0H A;  3TME A;  2YTV A;  4LFA Q;  3IL8 A;  2KVM A;  1AN8 A;  3U4V A;  1K0R A;  3FKI H;  4KKU A;  5EBD A;  2NZ1 D;  3I7F A;  1PFN A;  3CF5 A;  3M9B A;  1RIP A;  1UUP A;  3BVZ A;  1PV4 A;  4A3K H;  2YYZ A;  2N88 A;  3CPW A;  3HOX G;  1X3P A;  3MEH A;  4A3L G;  1UEA B;  1CA5 A;  3M4P A;  3RD4 A;  2FXQ A;  1KD1 C;  3VR4 A;  3QWN A;  1VQJ A;  1Y8O B;  2B8G A;  5AFW A;  1XPR A;  3S15 H;  3NQT A;  1LTL A;  2F4I A;  3CD6 A;  2HD3 A;  4WJW A;  3VYU A;  3KDF B;  5AJ3 L;  1YI2 A;  3PUZ A;  5EPJ A;  3A8K E;  4HIK A;  2EOT A;  1VQA A;  5C3W A;  1TWH H;  1NNX A;  5LL6 S;  4DV1 Q;  1Q12 A;  3PO2 H;  3OIP A;  4FF1 A;  4KD4 A;  1JJC B;  1JOK A;  2FFK B;  1LLR D;  3ULJ A;  5T1I A;  1X65 A;  1HFN A;  4AQY Q;  4HSP A;  5KEE A;  1D5X C;  3CW2 C;  5IGB A;  4LUO A;  4I7A A;  3HRZ C;  1EY9 A;  5FLM G;  3LWU A;  3DWP A;  4N9P A;  4C3I G;  1HUN A;  1OO9 B;  1H9M A;  4DR4 Q;  1IZ6 A;  3I90 A;  1PTO C;  5GAD C;  3AFP A;  3P75 A;  3I91 A;  3TP7 A;  1NY4 A;  3GTK B;  1EOV A;  4GOP C;  1IYJ B;  4ZKB B;  3MA2 B;  1FD7 D;  3H94 A;  3K0Y A;  2TSS A;  4GOP B;  1BF4 A;  1UEB A;  2NWG A;  4C3I H;  4F8M A;  4DAP A;  2UUA Q;  3Q22 A;  3QR8 A;  3MXP A;  2ZXO A;  4HCS A;  4OGQ C;  1SYC A;  1Q81 C;  2RSN A;  4DU9 A;  2MJ8 A;  1Q86 C;  2B39 A;  2KCN A;  5CV4 A;  4MZ9 A;  3GTO B;  1E22 A;  2QIL A;  4QCL A;  1AE3 A;  4TRD A;  1MSG A;  2I5L X;  2KQ3 A;  2RDF A;  1Y1V H;  1PDQ A;  3DXJ C;  1TT2 A;  2JXM B;  1DJR D;  4J15 A;  2F0P A;  2E2H H;  3LGJ A;  2XWJ B;  1EYG A;  3QO2 A;  1SE2 A;  3DMU A;  3EVQ A;  1B3A A;  1EFW A;  2B63 H;  3C1F A;  4RG1 A;  4BY1 G;  3PMF A;  3GTM H;  1V9P A;  5ELF A;  3S1N B;  1IKM A;  5C44 B;  4GLX A;  1RTN A;  5FOB B;  2GVB A;  2HIV A;  2NVQ H;  3PUV A;  2QA4 A;  1A3U A;  3RZO H;  1DM0 B;  4O1N A;  1EIH A;  4LF6 Q;  1MBY A;  4A3L H;  2DGY A;  3VA5 A;  5JEA G;  2EYP A;  2ZM6 Q;  4DAV A;  1QJO A;  1I4R A;  2KCC A;  4DR4 L;  2LS0 1;  3C1E A;  5GAG C;  4XQN A;  5KIX A;  2L55 A;  1OTC A;  3KFU A;  3ULL A;  2F0Q A;  1HNZ L;  4OL7 A;  2HCI A;  3J80 L;  1LTS D;  3P20 A;  3MXN A;  2EY5 A;  2NVY H;  4LF7 Q;  3MVV A;  4ZUJ A;  4L5Q A;  3L0O A;  1WTW A;  4BY1 H;  1TXY A;  3OW2 A;  3SE0 A;  4K0K Q;  1JT8 A;  4POF A;  1EYC A;  1FL0 A;  4DV2 Q;  1UAP A;  3HGB A;  1JJ2 A;  3MFG A;  4RGM A;  1PZJ D;  2B2V A;  2ALY B;  4R8N A;  5J3B A;  1DOK A;  3CXC A;  1BNZ A;  1LO5 D;  2EYH A;  4BY7 H;  1ROD A;  4IUV A;  1K8M A;  2JA5 G;  3P1H A;  1WTX A;  4IPD A;  1K3R A;  4I7Z C;  3HKZ B;  3HOZ B;  4X66 L;  4A4I A;  2RBM A;  1N9W A;  3VR5 A;  2PQE A;  4A76 A;  2UUA L;  1L0X B;  4RH6 A;  2JA8 G;  3CHB D;  2EDG A;  1SRO A;  1VQF A;  3H3V C;  1FNU A;  2BH2 A;  2JA7 B;  1XYI A;  4C2M B;  3QG1 A;  1GUT A;  2NB0 A;  3BJU A;  1E1O A;  5C3E H;  1C8C A;  4B9X A;  1W6K A;  5I6W A;  1I94 Q;  5D3D A;  4CBV A;  3S1N H;  1WYD A;  1S5D D;  4QIW B;  3BYT B;  3DWQ A;  2YTX A;  5IYB H;  1JB7 A;  1SYB A;  1EQV A;  1U0L A;  3ITP A;  1R4Q B;  2K5H A;  2CQA A;  4XQJ A;  4LFA L;  1IBK Q;  2JA5 B;  4CDD C;  2WIN B;  4NP5 A;  4Z9C B;  4GN4 B;  1ASZ A;  4GKJ L;  2PPB C;  4X6A H;  2JA8 B;  1TKW B;  1X55 A;  1SNP A;  4BA1 I;  3GTP H;  3T13 A;  1BBU A;  4LFB L;  2NYZ D;  1X3F A;  4HMJ A;  1UE5 A;  3J81 L;  3TS2 A;  1X6O A;  3D6W A;  4OX9 Q;  1U5K A;  4X62 L;  3RLO A;  1CM9 A;  4PQX A;  3TZU A;  2FJ2 A;  4IOC A;  4IO9 A;  4DUZ Q;  4DUY L;  1TU2 B;  2EJM A;  4DV0 L;  2LXJ A;  4JI3 L;  5I2Y A;  4L5S A;  2OEO A;  4JI7 L;  3R93 A;  1R9T B;  1D1I A;  1Y1W G;  2NBF A;  3TZD A;  1F2Z A;  2DN8 A;  2HQE A;  5IY0 A;  2B2W A;  3BZK A;  3I4M H;  3J80 E;  1KAA A;  5T1G A;  5A35 A;  2JYO A;  4FXD A;  5J22 A;  4ZQ3 A;  3URY A;  2JP1 A;  4K5V A;  3IAY A;  4V19 0;  5IYB G;  4X66 Q;  3JAM E;  5JEA H;  1ET9 A;  5EPK A;  4AQY L;  4G7H C;  2B2V C;  3PGZ A;  4L5T A;  2PO4 A;  1N33 L;  2D0O A;  3EBE A;  4XDX A;  1H9J A;  1HZB A;  2F52 A;  2WII B;  2NVT B;  1XNR Q;  1VQO A;  4A93 G;  1VQ6 A;  1B3Q A;  1LTG D;  3MXU A;  1MIU A;  2ZTC A;  2K05 A;  1CKN A;  1II3 A;  1ESF A;  4RGN A;  1TII D;  2L9H A;  1KDB A;  4GZY C;  4LF4 Q;  4KY6 A;  1YIT A;  1SFO B;  4IJL A;  2VW9 A;  1Y1V G;  1G2T A;  2LY7 A;  4XT1 B;  1JWU D;  1LM0 A;  2Z8L A;  2XN9 C;  1EQQ A;  3NBH A;  1J6Q A;  4CJ2 C;  2FIN B;  5FLX E;  3HOW G;  1LTR D;  4R1J A;  3GTJ B;  4P2C B;  3CCU A;  4JW0 A;  5JVH 3;  5GAE C;  1U9R A;  4C3H B;  2XGT A;  4IUN A; 
#chains in the Genus database with same CATH homology
 1T5X D;  2OT2 A;  3A54 A;  4C3J B;  2K7V A;  2EPB A;  3GD7 A;  3FPP A;  1CK1 A;  4A3E B;  5TSS A;  2A5H A;  2G9D A;  3TP6 A;  4KD3 A;  1NCV A;  2QF7 A;  1BCP D;  2K5D A;  3ERQ A;  1E0B A;  2PW7 A;  4DGZ A;  1NR4 A;  5EKI A;  1JQY D;  1OXT A;  3MWY W;  5D14 A;  1YNN C;  3P7J A;  1PYW D;  3NBI A;  1ENA A;  3SK5 A;  5EBC A;  3GV6 A;  1LTA D;  2EYJ A;  5C4X B;  1PMR A;  2WP8 J;  1PZI D;  3F2U A;  3PIP 3;  4RCN A;  2Q8R E;  4A3M B;  2JE6 I;  3I72 A;  3BDL A;  3G6J B;  1QWY A;  3FEW X;  4PMB A;  1TY0 A;  1EL0 A;  1B4O A;  1S5B D;  1K83 B;  1I3Q B;  5IGE A;  2RDG A;  4DA2 A;  4KKT A;  1STY A;  4RKL A;  2F0S A;  2Q8T A;  2JA6 B;  2A68 D;  2L4N A;  4OO1 H;  5K36 H;  3OMG A;  1EY4 A;  1Y69 U;  1L0Y B;  4J8Q A;  5JAV A;  1ZEQ X;  5M5X B;  1STE A;  1IHZ A;  3HP3 A;  3R2I A;  3MZ5 A;  4A3B B;  2PW5 A;  4X3S A;  4KHZ A;  1CFM A;  1R4P B;  4ABN A;  3R3O A;  4HSV A;  3PUY A;  4LAA A;  3S16 B;  2CHB D;  1Q3L A;  2XSC A;  2F0K A;  4CHT B;  4IUP A;  1A6X A;  2HCC A;  2I07 B;  1SMY C;  3VR2 A;  5C0X I;  1GHJ A;  2LMC B;  5HGT A;  4QMG A;  5FKA C;  2SEB D;  5ISR A;  2L12 A;  3QJY A;  3E6Z X;  2F0G A;  1KNE A;  1CQF A;  2F3W A;  3D3R A;  1U4P A;  2B2Y A;  3A8J E;  2MPM A;  3GP7 A;  1PTO H;  4H0L C;  5CYU A;  1ILP A;  4BY1 B;  4S3S A;  1F9S A;  1LT4 D;  1Z47 A;  2WAQ B;  4E6I A;  5LL6 X;  3KLS A;  1HFG A;  3HOU B;  3NK9 A;  1ENC A;  2E2H B;  2FMC A;  1F2M A;  1KDC A;  2OF1 A;  2VUM B;  1U4M A;  2L5T A;  2MHV A;  1JE4 A;  2YU9 B;  4R9W A;  1G29 1;  1RDP D;  3PO2 B;  2KEC A;  4BY7 B;  2AQ3 B;  1GUG A;  1PTO D;  2BCO A;  4QF4 A;  4J6H A;  1O80 A;  3O13 A;  3KLS X;  4X3T A;  3NWS A;  2B2T A;  3MFY A;  4C1N I;  2D2C C;  1CZW A;  2IT1 A;  4MHE A;  3VA7 A;  1I6V C;  1PTO B;  1DOM A;  1TWC B;  2NVX B;  1SBB B;  2PZU A;  4F7X A;  2A69 D;  3VYT A;  1LTT D;  5A2Q E;  1TWG B;  2IW3 A;  1H9S A;  5M5Y B;  4O42 A;  4IUQ A;  4F88 A;  5I4D A;  1SNM A;  4X3U A;  2AUK A;  2D62 A;  3K7A B;  4M1U B;  4OIK A;  5F2D A;  1C48 A;  3R2T A;  5KND A;  5D65 A;  5HUR A;  2M9V A;  4EVO A;  3ND8 A;  3GV3 A;  1I6H B;  2EYF A;  4KY5 A;  2E2J B;  1IYV A;  3OIQ A;  2B63 B;  1TWH B;  4HTH A;  4HAE A;  3M4Y A;  1A2T A;  1TS5 A;  1PTO F;  4H13 C;  3I8Z A;  5EPL A;  2QKI C;  1QG7 A;  2A73 B;  4RKB A;  3KBX A;  1WTO A;  4KY7 A;  4DK1 A;  2AQ2 B;  2PYK A;  1JOQ A;  3HOY B;  1EZ6 A;  4C3J G;  4EQN A;  3K5O A;  2VXW A;  1B53 A;  2F0U A;  1BQQ T;  5JEA J;  4A3J B;  3L3O C;  3CU7 A;  1RHP A;  1E2V A;  2A6E C;  3S14 B;  1SJH D;  1X32 A;  2ZXR A;  3A7A B;  1FGB D;  4WRD A;  1WVL A;  3GTM B;  1HTP A;  2K32 A;  1Q1E A;  3CKI B;  2L11 A;  2PMZ B;  1JWM D;  4M8A A;  1EYD A;  4KK7 A;  2EVB A;  1AZP A;  4A3D B;  3M3Y B;  3RLF A;  3G7L A;  3H91 A;  1SYD A;  2O5J C;  4BWG B;  1SYG A;  2R61 A;  4CJ0 B;  3CRL C;  1WTR A;  5E1F A;  2J7Z A;  4UAI A;  2F3V A;  3MXG A;  4KTA A;  4OIJ A;  3M85 A;  3DUZ A;  3NP8 A;  1CHQ D;  4LMQ D;  1TQO A;  4CGY B;  1CTM A;  5C5L A;  1HTL D;  4FF4 A;  1FYC A;  3MTS A;  3MHB A;  5C0X J;  2XIW A;  3NHH A;  2QCP X;  3L9A X;  3RZO B;  3Q23 A;  1EY7 A;  2F0M A;  1WTV A;  4MIU A;  2A68 C;  4KKS A;  4NMZ A;  2H1E A;  2AUJ D;  2XRQ D;  2OXP A;  2F0L A;  1ICW A;  1HXY D;  1A3T A;  2Y0S B;  1STG A;  4YIJ A;  3ND9 A;  5FO7 B;  2PNR C;  4DNT B;  1F2L A;  2PZW A;  3K5M A;  4ZYS A;  3QOL A;  3EQL C;  2A74 C;  1OXU A;  2RKS A;  5NUC A;  4A3K B;  1BR9 A;  4C1N K;  3ZYY X;  3T4A C;  1STN A;  1BCP F;  2ICI A;  1ZKO A;  1NR2 A;  3S1M B;  3V05 A;  5C0X G;  1H9R A;  1ZYR C;  4A3I B;  4CJ1 B;  3JAM L;  3W2D A;  3T51 B;  5IGG A;  2QEJ C;  1J9O A;  2F0O A;  2X6L A;  1O7Y A;  2PZT A;  2F0N A;  4DAY A;  4K8I A;  1BCP C;  5JJZ A;  5C4J B;  1SXT A;  4ZLT F;  1SNC A;  2IX0 A;  1EU4 A;  1EZ8 A;  4QUF A;  1DD2 A;  2Z1C A;  3K5L A;  3TP5 A;  5M9O A;  2ZXP A;  1QE6 A;  5FLX L;  2IL8 A;  2EJF C;  2A6E D;  3KBG A;  4Q5V A;  1D5Z C;  2WKC A;  4BS9 A;  2D9U A;  4PNY A;  4UDU C;  2EY6 A;  2BDN A;  2C5C A;  3FVQ A;  2K5W A;  1Z7T A;  3OOC A;  3DWA A;  5I6Y A;  4Q0F A;  1FR3 A;  3C3L A;  5KGU A;  2NTT A;  3PIO 3;  3J7A F;  3NPP A;  4RGO S;  3J7A V;  3N6R A;  3D8G A;  1A15 A;  1ILQ A;  1VMP A;  1PRT F;  1WD1 A;  1ET6 A;  1RF2 D;  2V4D A;  2X6G A;  4ME5 A;  2B2U A;  1GHK A;  1GXD C;  1Y1W B;  4FYD A;  4QB4 A;  3OMC A;  4TKO B;  1SYE A;  1SJE D;  1G91 A;  1LTI D;  3BVM A;  1KLU D;  2ID0 A;  2XVS A;  3MAQ A;  2K1B A;  1BO0 A;  3EJI A;  3R8B A;  1EY8 A;  4QUC A;  4CKC A;  2EJG C;  1IL8 A;  5IGC A;  1S5E D;  4RAU C;  1EQT A;  4DN4 M;  1B44 D;  3KLR A;  1NUC A;  2KEE A;  4K8J A;  4FF3 A;  4FF2 A;  3E0J A;  1JCK B;  4F87 A;  5JPM C;  5JPN C;  4B08 A;  3BZD B;  1PFB A;  1AW7 A;  5DM6 3;  1TWA B;  1LT5 D;  3BYY B;  4LJZ C;  3W3A A;  1AEX A;  1MSH A;  2WV6 D;  1S5F D;  5E4X A;  4G7Z C;  1H9S B;  5CV6 A;  2NN6 I;  1PXU A;  4ULL A;  5LHY 1;  1W6J A;  1RD9 D;  4RGT A;  2WKD A;  1KLG D;  2B2U C;  4K2K A;  5EGT A;  4IFD J;  3BDO A;  3KF8 A;  2L0C A;  3SR1 A;  5C6A A;  1I50 B;  4JK1 C;  2IJ0 A;  4HED A;  1LV9 A;  2F0F A;  1C4Q A;  3DEP A;  5FO9 B;  2R93 B;  2NUC A;  3NTI A;  4A93 B;  2F0W A;  3OSO A;  5I2X A;  1O7Z A;  1RTO A;  4XYO A;  1ZXT A;  2H4O A;  1V8Q A;  3L7Z C;  1F9Q A;  3NUC A;  1IW7 C;  4ZUI A;  1EEF D;  1KDA A;  1JC7 A;  1JWS D;  3CQZ B;  4G57 A;  2K33 A;  1TR5 A;  2SNM A;  3HEJ A;  1CA6 A;  1CHP D;  1BUV T;  2JEA I;  4RA8 A;  4C56 C;  3S15 B;  3WOF A;  2F1M A;  5ELE A;  4CKE A;  2KHS A;  1KNA A;  4PMW A;  5COR A;  1PRT B;  1WTP A;  3K59 A;  2E76 C;  3VYS A;  1GUS A;  4IN3 A;  1V1P B;  4IAL A;  4FVM A;  2LKV A;  1O78 A;  2J0T D;  5BN4 A;  1O7L A;  2NVQ B;  1AP0 A;  5KYI A;  1D5M C;  1STA A;  4NKL A;  2PCF B;  1B9M A;  2A6H D;  4RHS A;  3V96 A;  5IIF A;  3S17 B;  1CI3 M;  4IFD G;  4XIG S;  1F2Y A;  5EJW A;  1EWC A;  3SK6 A;  1QCB D;  2BE5 C;  2B2Y C;  4JBW A;  1TVX A;  1IKL A;  3AU7 A;  3I3C A;  3C2P A;  3SVM A;  4RHR A;  2K04 A;  1STH A;  3K5N A;  3RZD B;  5J1Z A;  1I4Q A;  4KI0 A;  5KYL A;  2F0E A;  5ELC A;  4KN4 C;  4IFD H;  1UNS A;  1CQV A;  1SDF A;  3OWE B;  1U4L A;  2QDB A;  1D1K A;  1V43 A;  3HG9 A;  1JOR A;  1MGS A;  3FKI B;  5DEH A;  3HS0 C;  1JIC A;  1PRT C;  2ENB A;  3A7L A;  3FMC A;  2EXZ A;  3V2T A;  5KRU A;  5K5P A;  1MI2 A;  3NTH A;  3HOX B;  1GJX A;  4DK0 A;  1BOS A;  3T56 B;  1DOL A;  1YNN D;  4HN7 A;  4RWS C;  2HDM A;  5DNF A;  4KMU C;  1SSO A;  5E3F A;  2E2I B;  5ELD A;  5DAU A;  2E74 C;  3IFD A;  1WTQ A;  1JOO A;  4PV1 C;  4DF7 A;  2EYM A;  3TSS A;  3AB9 A;  2RA4 A;  1BCP B;  4Y7N B;  4ZAI A;  1AFP A;  5M5W B;  4FNF A;  4K2L A;  1HPC A;  1M4V A;  1HRJ A;  1QOH A;  4C3I B;  5EKL A;  2DY7 A;  2ZT9 C;  5M3F B;  4A3G B;  2NN6 H;  4DFA A;  4J1M A;  1IW7 D;  4IQZ A;  2ICE C;  1HQR D;  4K5X A;  3X3N A;  1LTB D;  5IT9 E;  3SK4 A;  3U9O A;  3H0G B;  1WCM B;  1U4R A;  5CMD A;  2MP1 A;  2K03 A;  3PO3 B;  2EYL A;  1D6E C;  3SDZ A;  4X3K A;  3TP8 A;  4H44 C;  1B1Z A;  2M00 A;  1BDO A;  4BBS B;  1X3Q A;  3TBI B;  5FK9 C;  1NAP A;  3LNN A;  3FPU B;  3M7N A;  3NWT A;  5EQ0 A;  3BDC A;  3WOE A;  1WD0 A;  1EY6 A;  3GQB A;  4FXK C;  4IUR A;  2FMM A;  2SDF A;  3H6M A;  1HQM C;  4XQQ A;  3D4W A;  2R92 B;  1DCZ A;  4EQO A;  4XTC S;  2O4X A;  4TQU S;  5C4H A;  2XNA C;  3GTQ B;  4ID6 A;  3SHL A;  3RUZ A;  5C3E B;  3U9S A;  3NQI A;  3T53 B;  2KA7 A;  5CV9 A;  2LFN A;  5COY A;  3RMH A;  2K01 A;  2O2L D;  1SE4 A;  3VYR A;  1ZYR D;  3DHQ A;  5K36 G;  4OHJ A;  1GUW A;  1PZK D;  1Q1B A;  1ONL A;  1FNV A;  1KAB A;  3CRK C;  5CBA E;  4RFB A;  5KNB A;  3A55 A;  3KK7 A;  2VB3 X;  3GTL B;  4BA2 I;  1H9K A;  3T16 A;  2SNS A;  1V1P A;  1VMC A;  1BBX C;  5JVG 3;  2F0T A;  2F0I A;  3PV0 A;  3GTP B;  1A2U A;  4CKB A;  2HUG A;  2F0D A;  3K57 A;  3TN2 A;  1JB3 A;  1SND A;  2B2W C;  4AYB B;  4PMC A;  2O5I C;  1EY5 A;  1D2B A;  3H09 A;  3LWE A;  4KJO A;  1TS3 A;  3GTG B;  1LT3 D;  3D4R A;  4BBR B;  1RKN A;  1VDZ A;  2B8F A;  2X69 A;  1SAP A;  4N9T A;  1XTC D;  1Y1V B;  4DXG A;  1A3V A;  1Y8N B;  1EFI D;  2DY8 A;  4C3H G;  2BA1 A;  1CZG A;  4MN3 A;  1OXX K;  4WFN 3;  3D4D A;  3M7G A;  1E2Z A;  3GO5 A;  4KJN A;  1EYA A;  3TDQ A;  3SXH A;  3K58 A;  1HA6 A;  1SEB D;  1NSN S;  3QB3 A;  2A6H C;  3SK8 A;  1DYQ A;  1CT1 D;  2NN6 G;  1K8O A;  2EY2 A;  4G7O C;  2BE5 D;  4XT3 B;  5IGF A;  4OO1 I;  3ONA B;  4U68 A;  2IX1 A;  2G9H D;  1IYU A;  3I4M B;  2JEB I;  2GA4 B;  1VCI A;  1QB5 D;  5J39 A;  3HZX A;  1STB A;  2IWH A;  3HOV B;  5G3L F;  1DON A;  3Q0A A;  1EU3 A;  4V0B A;  3MC0 B;  4HCE A;  4IFD I;  2E2D C;  4IUT A;  2CVR A;  1QNK A;  1XXG A;  5M3M B;  1TWF B;  1E2W A;  1XWE A;  2K28 A;  1SMY D;  5KNC A;  2N55 A;  4A3F B;  2WAC A;  3S1R B;  5CV8 A;  3UI2 A;  4RCO A;  3NSW A;  2R3Z A;  1GUO A;  1I4P A;  2VB2 X;  1HHV A;  1VF7 A;  2CW0 C;  3NXW A;  1VF5 C;  3M4O B;  2AQ1 B;  1EY0 A;  1EWH A;  1TY2 A;  5A2Q L;  3FRP B;  1Z6H A;  2F0V A;  5C3X A;  2DNC A;  1DZ1 A;  2XWB B;  5CV7 A;  4G4K A;  1J8I A;  1ML0 D;  1G6Z A;  2EE1 A;  1B9N A;  3PUX A;  5G3L D;  5IOC A;  4B9W A;  1I4H A;  1LT6 D;  4DXF A;  5DM7 3;  1GUN A;  3PUW A;  1ESR A;  1I4G A;  2DNE A;  2NVY B;  2TMP A;  2BDO A;  3IKJ A;  3ERO A;  4NDX A;  3X3M A;  2E75 C;  2KED A;  4ZRZ A;  1LAC A;  3IFT A;  2IX3 A;  2C9O A;  4ZKC B;  5C0X H;  2WB1 B;  2BOS A;  4HMI A;  2F0J A;  1SNO A;  3QIA A;  1BXT A;  3S1Q B;  3N52 A;  3D6C A;  1EEI D;  3Q6S A;  3J7Y W;  4IZ8 A;  3C46 A;  1SNQ A;  1YNJ D;  5CV5 A;  1GOZ A;  4KHV A;  1PFM A;  5CGK A;  4K5W A;  3EFX D;  4TSS A;  5IOD A;  3E5S A;  1MD2 D;  2RVL A;  2A69 C;  2AWO A;  3OHX C;  1TS2 A;  1SYF A;  2AWN A;  3I4L A;  2L1B A;  2R6G A;  4LK1 C;  1U9R A;  2RDH A;  5C4Z A;  1PLF A;  1KTK A;  1OXV A;  2J4X A;  2D5D A;  2NTS A;  1LAB A;  3BVG A;  3S2D B;  1PRT D;  2K6A A;  1I4X A;  4ODG A;  4HR7 B;  3DEO A;  2EYO A;  4H7B A;  2Z4H A;  3KUP A;  5CC4 A;  4XYQ A;  4I65 A;  3NTK A;  1XX8 A;  2SOB A;  3OW7 A;  3SEB A;  3BS1 A;  2IPK D;  2I46 A;  4FO2 A;  1EOT A;  2MGS A;  1AZQ A;  5I9P A;  1FNW A;  5FO8 B;  2KJX A;  5JOB A;  3EA6 A;  4L6T B;  1OXS C;  4L8J A;  3Q24 A;  2EZV A;  2RSO A;  3HOW B;  4K6D A;  5IGD A;  2R7Z B;  4FXG C;  3LX0 A;  4OO1 G;  1RJT A;  4L63 B;  4EGV A;  4XXE A;  3OPO A;  5CBE E;  4U67 3;  4FP5 D;  4R8I A;  1JR0 D;  4KV6 A;  4DNR B;  1SE3 A;  2B2T C;  1TS4 A;  3VR3 A;  1F9R A;  2HDL A;  1DXM A;  2M2L A;  2K5Q A;  2Z4I A;  2CW0 D;  3BG3 A;  5C5M A;  5I9O A;  3VR6 A;  1HCZ A;  3OWF A;  3I73 A;  4WOR A;  3K6O A;  1V1O A;  2XRS D;  5EKK A;  1ENF A;  3I4N B;  1Q90 A;  1HA5 A;  3I70 A;  4EQP A;  3S9W A;  1G2S A;  3A8I E;  2BA0 A;  1S5C D;  3S2H B;  2FHT A;  3WDN A;  2VNU D;  2KOL A;  4IUU A;  1G8Z D;  1RCV D;  1S4Z A;  1HUM A;  1EIG A;  5ELB A;  3AMU A;  1B2T A;  4KN7 C;  3A56 A;  2EY1 A;  3DM1 A;  1F9P A;  1T5E A;  5E4W C;  1B50 A;  2MUY A;  1Q8I A;  4K6L A;  4K14 A;  4ZK9 B;  3D31 A;  1YNJ C;  1QIL A;  3NE5 B;  1M8A A;  3J81 E;  5BN3 A;  4ILW A;  5D3I B;  5IT9 L;  1QNU A;  4NW2 A;  2JSO A;  1Y8P B;  3QOJ A;  1F77 A;  2F03 A;  3FDT A;  2Q8I B;  5CR3 A;  5BN5 A;  2KUM A;  2RQX A;  2F0H A;  3TME A;  3IL8 A;  2KVM A;  1AN8 A;  4KKU A;  5EBD A;  2NZ1 D;  1PFN A;  3BVZ A;  1UUP A;  2YYZ A;  2N88 A;  1X3P A;  3MEH A;  1UEA B;  1CA5 A;  3RD4 A;  3VR4 A;  3QWN A;  1Y8O B;  2B8G A;  5AFW A;  3NQT A;  2F4I A;  4WJW A;  3VYU A;  3PUZ A;  5EPJ A;  3A8K E;  2EOT A;  5C3W A;  5LL6 S;  1Q12 A;  3OIP A;  4FF1 A;  4KD4 A;  1JOK A;  2FFK B;  1LLR D;  5T1I A;  1HFN A;  4HSP A;  5KEE A;  1D5X C;  5IGB A;  3HRZ C;  1EY9 A;  3LWU A;  3DWP A;  4N9P A;  4C3I G;  1HUN A;  1OO9 B;  1H9M A;  3I90 A;  1PTO C;  3P75 A;  3I91 A;  3TP7 A;  3GTK B;  4ZKB B;  3MA2 B;  1FD7 D;  3H94 A;  3K0Y A;  2TSS A;  1BF4 A;  2NWG A;  4F8M A;  4DAP A;  3MXP A;  2ZXO A;  4HCS A;  4OGQ C;  1SYC A;  2RSN A;  4DU9 A;  2MJ8 A;  2B39 A;  2KCN A;  5CV4 A;  3GTO B;  2QIL A;  4QCL A;  4TRD A;  1MSG A;  2KQ3 A;  2RDF A;  1PDQ A;  3DXJ C;  1TT2 A;  2JXM B;  1DJR D;  2F0P A;  2XWJ B;  3QO2 A;  1SE2 A;  3DMU A;  3EVQ A;  1B3A A;  3C1F A;  3PMF A;  5ELF A;  3S1N B;  1IKM A;  5C44 B;  1RTN A;  5FOB B;  3PUV A;  1A3U A;  1DM0 B;  4O1N A;  1EIH A;  1MBY A;  3VA5 A;  5JEA G;  2EYP A;  4DAV A;  1QJO A;  1I4R A;  2KCC A;  2LS0 1;  3C1E A;  4XQN A;  5KIX A;  2L55 A;  2F0Q A;  4OL7 A;  2HCI A;  3J80 L;  1LTS D;  3P20 A;  3MXN A;  2EY5 A;  3MVV A;  4ZUJ A;  1WTW A;  3SE0 A;  1EYC A;  1UAP A;  3HGB A;  3MFG A;  4RGM A;  1PZJ D;  2B2V A;  4R8N A;  1DOK A;  1BNZ A;  1LO5 D;  2EYH A;  1ROD A;  4IUV A;  1K8M A;  3P1H A;  1WTX A;  4I7Z C;  3HKZ B;  3HOZ B;  2RBM A;  3VR5 A;  2PQE A;  1L0X B;  4RH6 A;  3CHB D;  2EDG A;  3H3V C;  1FNU A;  2JA7 B;  1XYI A;  4C2M B;  3QG1 A;  1GUT A;  2NB0 A;  1C8C A;  4B9X A;  1W6K A;  5I6W A;  5D3D A;  4CBV A;  1S5D D;  4QIW B;  3BYT B;  3DWQ A;  1SYB A;  1EQV A;  3ITP A;  1R4Q B;  4XQJ A;  2CQA A;  2JA5 B;  2WIN B;  4NP5 A;  4Z9C B;  2PPB C;  2JA8 B;  1TKW B;  1SNP A;  4BA1 I;  3T13 A;  2NYZ D;  4HMJ A;  3J81 L;  3D6W A;  1CM9 A;  4PQX A;  3TZU A;  2FJ2 A;  1TU2 B;  2EJM A;  5I2Y A;  2OEO A;  3R93 A;  1R9T B;  1D1I A;  2NBF A;  3TZD A;  1F2Z A;  2DN8 A;  2HQE A;  3J80 E;  1KAA A;  5T1G A;  5A35 A;  2JYO A;  4FXD A;  5J22 A;  4ZQ3 A;  3URY A;  2JP1 A;  4K5V A;  3IAY A;  4V19 0;  3JAM E;  5JEA H;  1ET9 A;  4G7H C;  5EPK A;  2B2V C;  2PO4 A;  4XDX A;  1H9J A;  2WII B;  2NVT B;  1LTG D;  3MXU A;  2K05 A;  1II3 A;  1ESF A;  4RGN A;  1TII D;  2L9H A;  1KDB A;  4GZY C;  4KY6 A;  1SFO B;  1G2T A;  2LY7 A;  4XT1 B;  1JWU D;  2Z8L A;  2XN9 C;  3NBH A;  4CJ2 C;  2FIN B;  5FLX E;  1LTR D;  3GTJ B;  4P2C B;  5JVH 3;  2B2W A;  4C3H B;  3Q22 A;  4IUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...