2NUCA

Staphlococcal nuclease, ethane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
b'LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nucA00
4K2KA 3H6MA 3QOJA 3SR1A 3ITPA 1SYGA 1EY6A 4ZUIA 2F0WA 3PMFA 5C4ZA 4IALA 5CV6A 3SK5A 2F0FA 3MXPA 1ENAA 2F0EA 5KYIA 1NUCA 2RKSA 4KHVA 2EYMA 2EYLA 3RUZA 5CGKA 4EQNA 4EVOA 1F2MA 4J6HA 5CV8A 4HMIA 1EY9A 4IUNA 2OXPA 4J1MA 5CR3A 2NUCA 5EKLA 4B9WA 2EYPA 5F2DA 1U9RA 1NSNS 4F8MA 1AEXA 1EQVA 2EY5A 2F0PA 3TP5A 5C6AA 3MVVA 2PYKA 5I9OA 2KQ3A 1IHZA 2F0VA 1SYDA 4LAAA 1KDAA 4ODGA 3EJIA 5C3WA 4KJOA 3DHQA 1EYAA 5C5MA 2SNMA 4EQOA 3NXWA 4K8IA 1A3VA 4NMZA 1KABA 4IZ8A 2PZWA 3C1FA 2F0SA 4NKLA 2F0HA 1STHA 5IGGA 3NHHA 5HGTA 3OMCA 5CV4A 2EYFA 3C1EA 5J1ZA 2F0LA 4HTHA 1KDBA 3SXHA 3V2TA 2M00A 1KAAA 4PMCA 3QB3A 5E1FA 1SNDA 5DAUA 4KD3A 3MZ5A 1ENCA 5IGEA 5IGDA 5KYLA 2EYOA 1SNQA 2F3WA 1A3TA 1SNPA 2EYJA 3D8GA 4K5VA 1EY8A 4K14A 4YIJA 5J22A 5I9PA 4K6DA 1EY4A 3D6CA 2F0KA 1EY0A 4K5WA 4KD4A 4N9TA 3T16A 2PZUA 3TMEA 4DU9A 4K2LA 1JOOA 2F0GA 3OMGA 4ZQ3A 3S9WA 1SNOA 5JAVA 1F2ZA 1A3UA 1EY5A 5CV9A 4KTAA 3MHBA 2F0MA 5CV5A 3SHLA 3P75A 5EKKA 4WORA 2EY1A 1JORA 2LKVA 3DMUA 3MEHA 3SK4A 4KV6A 4E6IA 2F0IA 4KY5A 2OEOA 5EGTA 3EVQA 5CV7A 3T13A 3U9OA 5C3XA 2PW5A 5CC4A 5IGCA 3HZXA 5I6YA 4TRDA 2PZTA 3D4DA 3TP7A 5C4HA 5IOCA 2SNSA 3NUCA 1SNCA 4NDXA 3ERQA 4ME5A 3NP8A 4ZUJA 1EZ6A 1SNMA 2O4XA 3SK8A 3BDLA 4PNYA 1EYCA 4KY6A 2F0NA 3NK9A 4DF7A 1STYA 4MIUA 3TP6A 2EYHA 3VA5A 1STBA 5IGBA 2F0TA 5HURA 4DGZA 5M9OA 1A2UA 5IIFA 5I6WA 1JOKA 3QOLA 1RKNA 3BDCA 3OSOA 4HMJA 4N9PA 5JOBA 3TP8A 2OF1A 4KJNA 5NUCA 1SYBA 1EYDA 4OL7A 2F0QA 1SYCA 2F0OA 2QDBA 2F0DA 4H7BA 5KEEA 4QF4A 2SOBA 4WRDA 1SYFA 5E3FA 2EY6A 4KY7A 4R8NA 5K5PA 4ID6A 4K5XA 4QMGA 1TQOA 1II3A 2EY2A 5IGFA 2F0JA 1F2YA 4NP5A 3LX0A 2RDFA 1SYEA 4G57A 4QB4A 1STAA 1STGA 1STNA 4I65A 2HQEA 4RKLA 5KRUA 3NQTA 1JOQA 3EROA 3OWFA 1TR5A 5C5LA 4B9XA 1KDCA 2EXZA 1EY7A 3D4WA 4S3SA 5KIXA 2F3VA 4PMBA 5KGUA 1EZ8A 2KHSA 5DEHA 3R3OA 2F0UA 4RKBA 1A2TA 3HEJA 3SK6A 2ENBA 4DFAA 3E5SA 5J39A 2PQEA 4EQPA 5ISRA 2WACA 1TT2A 2PW7A 3P1HA 2RBMA 4K8JA 5IODA 4F7XA
chains in the Genus database with same CATH superfamily
1A62A 3PMFA 3H3VI 5LMUL 2R3ZA 4DR4L 3PUXA 2RKSA 1KRTA 4A76A 2JN4A 5CR3A 2VXWA 1NSNS 3FMCA 1MHWC 1SE3A 1KRSA 2EJGC 4JI1L 4X66Q 1JB3A 3ZYYX 4LF8L 4YCVA 1OXVA 2R92B 2KENA 3I91A 3OIPA 3MFYA 3OYYA 1AH9A 1L1OC 5CV4A 3X3MA 1IBML 3HOZH 1N33L 1C48A 3HKZE 1SXTA 4WJ3M 3EQLC 5KYLA 4DR6L 1A3TA 4LFBL 3HOXB 1JE5A 1XMQQ 4B3MQ 3N52A 2N88A 1O7ZA 1PH6A 1K8AC 4N9TA 2I0QA 3MXUA 3EFXD 4H44C 3HOZG 1F2ZA 3FKIH 1EY5A 3MXNA 2BE5C 2KCMA 3P75A 3N6RA 1O78A 4E6IA 3NWTA 2Y0SE 1XMOL 3I2ZA 1HR0L 2J4XA 1L0YB 4G4KA 1CHPD 2B2YC 4AYBE 1GO3E 4DNTB 3ERQA 4DR5L 4X3SA 4O0AA 1JWSD 1HJPA 4C1NK 5ELCA 2HT1A 3M4OH 3FKIG 3CF5A 4C2MB 2DY7A 3K0XA 4WJ4A 3HOWB 2WINB 3HRZC 1IL8A 4AIMA 1U4PA 4LF6L 2QDBA 4NXML 1VQOA 1H9RA 1K8MA 2MPMA 1T9HA 1OXSC 2SOBA 1GHJA 4KY7A 4B3SQ 3OWEB 1FNVA 2RHSB 1STNA 2HQEA 2HUGA 3T1YL 2NZHA 5E7NA 2CW0D 4JW0A 4IPGA 3FPPA 4RA8A 3CRLC 4A3MH 3I8ZA 4K2KA 1R9TB 1D6EC 1QNUA 4IALA 1KQSA 3G4SA 2F0EA 2XGTA 3L2PA 4ULLA 4IFDH 4HMIA 2ATWA 1PFNA 1DZ1A 2PMZB 5F2DA 3QWNA 5GROA 4H13C 5C6AA 2LFNA 3E0JA 1IHZA 1SYDA 2E2HB 5C3WA 2OQ0A 3SVMA 3FVQA 3FHWA 1HRJA 1VQ9A 3J81c 3VDYA 3C1FA 2F0SA 2JP1A 3ND9A 1PZID 3I7FA 2RDHA 1LTAD 1PXUA 4IFDG 2AHOB 4EQ5A 1AE2A 5E4WC 4X6AH 4LMQD 4C3IB 3SEBA 1WTXA 4RAUC 1SNDA 1EWHA 3MZ5A 1JMCA 5FLXc 4MHEA 4BBRG 5IP9H 1K8GA 3MA2B 3J80L 1EIFA 1B70B 1TWFH 3BZDB 5T1GA 1ONLA 3EIVA 1X32A 4LW1A 1L2FA 4A3EB 1FNWA 1SFOH 1ET9A 4KN7C 1SAPA 1E1TA 2KUMA 3MEHA 4DAPA 2B39A 2WB1G 4TQUS 3HZXA 2RQXA 5IP9G 3TZUA 3RZOB 2UU9L 1L0XB 4A3LG 4C56C 3S16H 1JC7A 3F2CA 4L6TB 1PA6A 4V190 3I72A 1D1KA 2L0CA 3PIPA 4UDUC 1DJRD 2CKZB 3S15B 2F3IA 4V0BA 3A55A 1I4QA 4K6LA 4BBSH 2M9VA 2ZTCA 3R2TA 2FMCA 4DR7L 1D5ZC 1LTTD 1IBLQ 1CSQA 3VR3A 1JOQA 3EROA 4DAVA 3ULLA 5LL6S 1T5EA 3D4WA 4RCNA 2ZJPA 4A3DG 3GDEA 1BF4A 2F0UA 2RF4A 3PO2H 3GTQH 3D3RA 4RGNA 3K5LA 1D8LA 3KF8A 3ITPA 4ZUIA 1RL2A 3G6EA 3CCRA 1U5KA 2EYLA 4N8X1 3A8JE 4A93B 4DV6L 3S17B 1WVLA 4XQQA 1MJCA 3OTOL 4GNXA 3PO2G 2PNHA 3VYRA 3W2DA 2Q8TA 1VQ8A 2V4DA 5C5MA 1YJNA 1QZGA 3NXWA 3PO3B 2VQFL 1SSOA 4DR3Q 5C4XH 1O7IA 4JI3Q 2AMCB 4KK7A 2YU9H 5C44B 3OW7A 4R4CA 2ZM6Q 3K7AB 2WV6D 4IUPA 1RTOA 4P72A 2UXDQ 1ENCA 2JE6I 3QIAA 5CYUA 2F4VL 2EJMA 2ID0A 1KXLA 1GD7A 1BBXC 2KOLA 5C4XG 4DU9A 5JEAH 2YTYA 3HOVB 1HZAA 2B2UC 1KLGD 3DM3A 3G7LA 4R4QA 4R4OA 1K3RA 4WORA 1CK1A 3TSSA 5BN5A 1HR0W 4LF9Q 5JJZA 3ND8A 2EVBA 2PW5A 1Z9FA 1I3QB 2X6GA 4GOPA 3KJPA 2BH2A 2Q2HA 4YCUA 1K0RA 4JPBW 1NCVA 1MSHA 1GUGA 4DGZA 1KC8C 1RKNA 1I4RA 4YY3Q 3LWEA 5JVG3 4P73A 1VQ4A 2JA5B 3DWAA 3T51B 4H02A 2JSOA 3ER0A 4BS9A 2A6EC 5M3FH 3A56A 2MNAA 1JE4A 5IT9E 1F2YA 2J7ZA 5IYBH 4JI4L 5BN3A 1SN8A 5C0XH 2JEBI 4QY7A 5JJLA 1EIHA 1S40A 2KHSA 3GO5A 4IN3A 1Y1VG 1LTSD 1KL9A 4NXNQ 4A3BB 2AQ1B 3S2DB 3GTOB 2EXDA 1H9MA 4XTCS 3HOYH 5M5XB 2CH4W 4JI8L 2CH4A 5CV6A 1S4ZA 5IYBG 2GVBA 4JBWA 4CDCC 3J80E 5M5WH 2MQHA 3D31A 4OWTB 1I6VC 1J5EQ 4A3GH 1XTCD 3I4NH 4BY1H 2F0VA 4LF5Q 4ODGA 1F2LA 4JBMA 4EQOA 1G8ZD 2IHFA 3HOYG 3J7AF 4OHJA 4LUVA 3CCMA 4MTKA 1Q8IA 3NHHA 1PRTF 4HTHA 3SDZA 2RSNA 4C3HB 4A3GG 1JWUD 4N8FA 2R93G 2KHIA 4UY8C 3I4NG 1ICWA 5DM63 3Q23A 1ENFA 3MFGA 5AJ3L 3DEPA 2UUAL 3GTKH 3GTLB 3I90A 1L1OA 4K5VA 2CCZA 4A3JB 3I55A 3GTPH 5IP7H 4A3KG 2L11A 4QUFA 5DNFA 2UUCL 3NTIA 1WOCA 2P5ZX 2B8FA 2C35B 1XNQL 4JYAQ 1TIID 1WCMB 1BOSA 5CV9A 3MHBA 1UWVA 3GTJB 2LSSA 1EWIA 2N55A 4PV1C 2F0IA 4KY5A 5FK9C 2SDFA 3BS1A 4UPAA 3L0OA 4RFBA 5IP7G 3J7YW 3SK8A 2FHTA 3NELA 2ICEC 2K14A 4OEMB 3KOJA 1FJGQ 1S5DD 4DXFA 4A3CH 4JI0L 2PMZE 1K3BC 3Q0AA 1PYSB 2K5HA 2MO0A 2B2YA 3A54A 5JPMC 1BCPF 1EYDA 1SYCA 1HNWL 1TS3A 1V1PA 4YWLA 4A3FH 2NVYB 3RLOA 1X56A 1N34L 3H3VH 2Y0SG 1JCKB 1V43A 3T56B 2NVTH 3VYSA 1CTMA 4G57A 2HCIA 4AYBG 4FF4A 3PIOA 2AUJD 4G7ZC 2JA7H 3NQIA 2MUYA 4CJ0B 3J80c 3ICEA 4PMBA 3E9IA 1EWCA 2I5HA 1N33Q 1I6HB 2RHQB 4A3FG 1I94Q 4HR7B 1N32Q 3P1HA 5KYIA 2DNEA 2C5CA 3U9SA 3QOJA 1YJWA 3HS0C 3MXPA 5ELNA 1NUCA 2H1EA 1E24A 2JYOA 1FGBD 1PTOF 4LWCA 1GUNA 3I4MB 1YNJD 4HCSA 3MVVA 1MI2A 1YEZA 2GA4B 1IW7C 1Q81C 4JI6L 2KEEA 3WDNA 4KHPQ 4C3JH 1JQYD 1P16A 1TS4A 4X62L 5JVH3 3S1RB 1K83B 2BE5D 3U4ZA 1EFWA 1OO9B 1HR0Q 2HHHQ 1GHKA 5FLMH 3BJUA 5D14A 3G48A 4KLKA 4OO1I 1LACA 2MHVA 3PCOB 1BDOA 5IWAL 4CGYB 3O13A 1NJIC 3BZCA 1PRTC 1SLJA 3KF8B 4L5QA 1NAPA 4J8QA 5IGEA 4DV4L 1DOMA 3H15A 4GKJL 4CKEA 4LF7L 3S14B 3NSWA 3D6CA 3W1GA 1Q12A 4NXMQ 2UXCL 3K8AA 3M7NA 3L3OC 1DCZA 2PI2A 2CVRA 2V1CC 1PMRA 1LTID 4RGMA 2OTLA 3CXCA 2ZXOA 2A69C 5EKIA 1JJ2A 4JI5L 4ZLTF 3J7AV 3U9OA 3KLRA 3MTSA 2RSOA 2JEAI 2NYZD 2I46A 1SMXA 3A8KE 1TKWB 3RLNA 3CQZH 2B63B 5IGBA 5G3LD 2D9UA 4QIWB 2I5LX 5FJ8H 1VMCA 1FL0A 1UAPA 1X3EA 1E2VA 4OL7A 2B8GA 4H7BA 1EQQA 3I73A 3I4LA 3VR4A 2DY8A 1BCPC 2B2WA 2A68C 4XT3B 5T1IA 2KA7A 2EJFC 4DKAC 5C3EB 3K59A 1GVPA 4YWKA 3HOUB 3U50C 1X3FA 2JA8B 4K0KL 3GQBA 1EZ8A 1PH2A 3HEJA 4GOPB 4DFAA 2QILA 4EX5A 4TSSA 1VQPA 4IUQA 3H91A 4XQJA 5LMNW 1HXYD 5C4JB 3JAMi 4A75A 1GOZA 1WTPA 2NVXB 2PCFB 5M3MH 2E2IB 3PUZA 1E22A 3F2BA 2YTXA 5M5YB 1DXMA 1WD1A 1CSPA 1PDQA 1IXRA 1VQGA 1PHJA 1IKMA 1PTOC 1BKBA 1PH7A 1B9MA 3JC66 4NMZA 4DUZQ 1KABA 4IZ8A 3D0FA 3K58A 1UE7A 2ZXPA 5E4XA 3JAML 2RA4A 1XWEA 3VYTA 1HTLD 3PQIA 2AQ2B 2QW7A 4DV5L 3ULPA 3NBIA 2R7ZH 4DUYQ 4HCEA 5E1FA 2Z4IA 2JA9A 4L8JA 1A0IA 1FR3A 4X65L 1F77A 1HFGA 1O7YA 1SNQA 3FRPB 4Y7NB 1WJJA 5FO9B 2N78A 1TWCB 1K9MC 2F0KA 4JOIC 1Q82C 3GTGB 5K36H 4RHSA 2BOSA 3AFPA 4WFN3 4I7ZC 1EUJA 2OT2A 2R7ZG 4CKBA 1QJOA 2XIWA 1WTVA 1EU4A 4DR7Q 3GTMH 3FKIB 2NVQB 5CC4A 1XXGA 4EGVA 4GKKQ 1F9PA 4OELB 1PTOH 2VUMB 4Q5VA 1HA5A 1XNRQ 3J81E 1SJHD 1H9KA 3IL8A 5IIFA 2BCOA 3Q6SA 1STEA 2OF1A 4DNRB 1HHVA 1FYCA 3FDTA 1L1OB 2VQEL 2XSCA 4POGA 5DM73 1V1QA 3KLSA 5FLXE 3GV6A 3UDGA 4ID6A 4QMGA 1TQOA 1HUMA 1TWGB 1S5FD 4XXEA 3M7GA 1V8QA 2R92H 2K03A 1VQLA 1HTPA 4S3SA 1G291 5KGUA 1YHQA 2NWGA 4KHZA 4O1NA 2E74C 4JI7L 2VW9A 2D5DA 3W3AA 1N36L 1A63A 4F7XA 1HFNA 2IL8A 1SYGA 5BR8L 1YIJA 3SK5A 1G91A 1ENAA 3M9BA 3HOXH 1ZEQX 2R92G 4JV5Q 1V1PB 5ELEA 3L7ZC 4POFA 5BN4A 1PFBA 4DV0L 1B1ZA 4GLXA 4K8IA 4IPDA 5D3IB 1VQEA 1O7LA 4ZRZA 4TVAB 4BBRB 2MJ8A 3HOXG 3TBIB 1TY2A 2F0LA 4HN7A 3MWYW 1S5ED 2WFWA 2KEDA 1DOLA 5IYDH 5DAUA 2K7VA 3B6YA 3VR5A 4C2MH 1PH8A 2NN6I 2QA4A 4LFAL 2EYJA 5I9PA 2UUBQ 1GJXA 3HOWH 1UE6A 2Q2UA 2WB1B 2EZVA 4LFCL 3TDQA 1LABA 4A3MG 4G7HC 1F9SA 2F0GA 4JI2L 4GS3A 1SR3A 3BYYB 3CAMA 2MO1A 4DV1Q 2ES2A 4AQYQ 3SHLA 2A6ED 2LKVA 2RDGA 4FNFA 3SE0A 5ELDA 5IYDG 1HNXL 4PMWA 4R8IA 1VF7A 2FJ2A 4TRDA 2PZTA 5I2XA 3HOWG 3S1QB 2B2TA 2Q8RE 3BDLA 2PPBC 3NK9A 4LJZC 5HGQA 5I4DA 2WAQG 1PVOA 2F0TA 5HURA 1VS0A 4IPHA 2QGQA 4YHHQ 4LF4L 1R9TH 4N9PA 1B8AA 2F52A 1ASZA 1QG7A 5LMNQ 1B3QA 1Y1WB 1AZQA 3M85A 3M4YA 3TS0A 4CDDC 4A3DB 4WRDA 4HAEA 4JBJA 1IBKQ 1GUSA 4BY7B 3VR2A 1X9NA 1BQQT 1II3A 2E2HH 4DR2L 1SYEA 2Z6KC 4DAYA 2KCCA 3OWFA 1M1KC 1EY7A 2DJGC 3JAME 1I4GA 2E5LQ 1UEAB 1DD2A 3E5SA 1EIYB 2PQEA 1QVFA 1TT2A 1E7ZA 1U0LA 1YNNC 2EIFA 4C3IH 3H6MA 1PH3A 5EPKA 4DPGA 2F0WA 2A74C 5AJ3Q 2UXBQ 2KVMA 3RUZA 5COYA 4OX9Q 4IUNA 5EAYA 4QL5A 3ERSX 3VR6A 4BA2I 2RCNA 2B3GA 1Q86C 1L0WA 4A3EH 1IYJB 4O42A 3RN5A 4X66L 3KUPA 4Y52H 3PUWA 5GAHC 1HA6A 2L9HA 5HY6A 3RZOH 2HCCA 3HFZB 1KDBA 4BBSG 2K5QA 4QIWE 1A6XA 1EOVA 4F87A 3K7UC 2WP8J 1LUZA 2KCNA 1WTHA 2WIIB 2EYOA 4A3EG 1PH1A 2C9OA 2BH8A 1EY4A 3TRZA 3M3YB 1EEID 2K32A 4XIGS 1YZ6A 1QNKA 4A3IB 1XMQL 3PSIA 4B3ML 1ML0D 4B08A 3DLLA 4B3TQ 2MP1A 3S15H 3CP0A 1JR0D 3TEHB 3BU2A 3MC0B 3SK4A 1ASYA 2OEOA 5KNDA 4GLVB 1TVXA 4M8AA 2CWPA 5TSSA 5GAEC 2E75C 3NWSA 2YTVA 3CMEA 4ZYSA 3IKJA 3CW2C 2FMMA 1NNXA 1YJ9A 2EYHA 3UE1A 5D3DA 5M9OA 1BBUA 1ZYRC 4GN5A 2AUKA 3KBGA 5NUCA 1PFMA 2IPKD 3CU7A 4P2CB 2IX0A 1SMYD 3K5MA 3RZDB 4A93H 3RLFA 3S17H 4IFDJ 4GZYC 1Y8PB 3JAMc 2IT1A 5E3FA 1R4QB 1Y1VB 1J9OA 3HP3A 4IUUA 3H0GB 5CMDA 1ICFB 3UDIA 1IW7D 4RWSC 5JEAG 2XN9C 4B3SL 2CQOA 4GN3B 3PO3H 3CC2A 4P74A 5LHY1 3CKIB 2BA1A 4DV2Q 2YV5A 5C44H 1OTCA 4A93G 1A2TA 3PF4A 2M2LA 4K8JA 3K7AH 1WTQA 1X54A 1PRTD 4KMUC 4GKJQ 4B3RQ 2AQ3B 1NMGA 4KHVA 1VQ6A 2NB0A 4OO1H 1SEBD 1WYDA 2EYPA 2MGSA 3HOVH 2ZXRA 5I9OA 5D65A 5C44G 2PYKA 4Q0FA 5M5WB 2DJFC 4RH6A 2OTJA 2JA6B 4XQNA 1EIGA 3S1MB 3BYTB 2R93B 1JWMD 2A69D 4ZAIA 5A2QL 4UP7A 4JC0A 3RR5A 2IWHA 4NKLA 2JK8A 4MN3A 2AWOA 4OONA 2G9HD 5M3FG 3F2DA 1I3QH 4A3KB 3STBC 3HOVG 1GUWA 3QB3A 1X55A 3M4QA 1ILPA 4DN4M 2G5DA 1S72A 4X3TA 3K80C 1JT8A 2FXQA 5C0XG 3R8BA 2R7DA 4JBKA 4YIJA 1AZPA 2K04A 4FYDA 4JVZA 1QUQA 4NW2A 2L5TA 3EA6A 4K5WA 5IY0A 4CHTB 4HIKA 1G6PA 1PFSA 2B2VC 2XWBB 3OMGA 2JA5H 2A5HA 1BXTA 3U58A 4BXXH 1EFID 4HIMA 2HDLA 3SGIA 1BCPD 2BDOA 3CD6A 3GP7A 1TWAB 4KV6A 4DV3Q 5GAGC 1JICA 2IJ0A 3EVQA 5CBAE 3TZDA 4DA2A 5IOCA 4BY1G 1SNCA 3K5OA 4IOAA 1EZ6A 4DV7Q 4PNYA 2JA5G 3H3VC 4A3BH 3MXGA 3TP6A 3T1HQ 3S2DH 4BXXG 3GTOH 1Q46A 4XYQA 2O5JC 1A2UA 5M5XH 2E8GA 3BDCA 1C0AA 3TP8A 2EQSA 4TKOB 3VA7A 2IHEA 3KK7A 1HZBA 2X69A 1GUOA 4L5SA 2XRQD 3HGBA 5KNCA 3J7A5 3C2PA 4MZ9A 5CORA 3HKZG 2KECA 1GKHA 1M4VA 1SRUA 2WKDA 4FP5D 1I50B 1S5CD 1KDCA 1AE3A 1B7YB 1HCZA 1PZJD 3S2HB 2QCPX 3SK6A 1IBLL 2ENBA 1SE8A 1IL2A 3A7LA 4C3HH 5LMUQ 4DR4Q 3NE5B 5IE8A 3NTKA 1TU2B 1EY6A 4QCLA 1EQRA 3KLWA 5C4ZA 3GTLH 4ZKCB 4JI1Q 1QCBD 1SBBB 4A3JH 2ALYB 5JEAJ 4C1NI 4LF8Q 2Z0SA 1CKOA 3G6JB 1LLRD 4A3CG 5FOBB 3GV3A 1WCMH 1XX8A 2K52A 4UP9A 1EQTA 5EBCA 3GTJH 3KFUA 1EYAA 1WD0A 1EU3A 2KHJA 3L9AX 1IBMQ 4DAYB 1HQRD 5ELBA 1GXDC 2XRSD 5HGTA 3LWUA 3A5ZB 1HNZL 4DR3L 1KNEA 3V2TA 4DR6Q 4LFBQ 4JI3L 2Z8LA 3WWVA 1WCMG 1RCVD 3QR8A 2E2JB 1PH5A 3G71A 2JA7G 4K14A 4X3KA 2PI2E 2UXDL 3EN2A 4K2LA 4WJWA 4FO2A 3OOCA 2NVYH 3NBHA 1U4LA 3S9WA 5JAVA 1XMOQ 2VB3X 2O2LD 3S1NB 3CCUA 1R4PB 5EPJA 1ET6A 2DN8A 1W6KA 3OW2A 4DR5Q 2N49A 4DR1L 2KJXA 1X3PA 1D7QA 1ZKOA 5C0XJ 5C4HA 4X64L 5FO8B 1GM5A 2G9DA 4LF9L 4C3JG 1EYCA 3LGJA 4KY6A 1B3AA 2K28A 1I6HH 2PO4A 4LF6Q 4OIKA 5FLMG 1KHIA 1I4PA 1Q90A 3RD4A 4GNXC 4UAIA 1SYFA 3I4MH 1TWHB 4RMFA 4YY3L 1K73C 4K5XA 4L5RC 3T1YQ 1PRTB 3E3XA 3PUVA 1K28A 3PUYA 1E2ZA 1NE3A 3UDFA 4G7OC 3S1RH 5I2YA 5C5LA 1K83H 1TR5A 4BA1I 4UHVA 4ABNA 5KIXA 1O80A 3CCSA 2K4KA 2Q2IA 2L4NA 1N8RC 5JPNC 1LV9A 5J39A 3CCQA 2WACA 1BO0A 1ESFA 1I4XA 5IODA 1CZWA 1IKLA 4NXNL 3CCJA 4KN4C 3S24A 1B44D 3DXJC 4CJ1B 3S14H 1F2MA 1WTWA 1EY9A 1MBYA 1D5XC 4JI2Q 2ICIA 1HH2P 2HIXA 1CKNA 3CC4A 3UI2A 2NN6H 4IPCA 1B2TA 1TXYA 3ONAB 1E0BA 5FJ8G 2F1MA 1IYVA 1VQBA 1J5EL 4BWGB 1BBWA 4LF5L 5IGGA 3E9HA 4F88A 2EYFA 3C1EA 3I4OA 4X3UA 1BCPB 4PMCA 4L5TA 1PYWD 4U68A 2A6HC 2B63H 3M4PA 2CWAA 4Z9CB 1VQAA 1VQMA 2NZOA 2RVLA 4HJ8A 3QJYA 4KKUA 3FPUB 3T4AC 2K5VA 2L15A 5EKKA 2EY1A 2UU9Q 4JYAL 5C3EH 2B63G 1K0SA 3ZJYC 3MEFA 2K1BA 5M3MG 3BVGA 1BNZA 3HOUH 3IFDA 2JA8H 2SNSA 2D2CC 3HOZB 3HG9A 4ME5A 3E6ZX 3CCLA 1YHBA 2F0NA 2K50A 1STBA 2OCEA 2RCFA 2QDLA 4JK1C 2EE1A 3OSOA 1YNND 1EOTA 4KJNA 1SYBA 5C4JH 2NVXH 1MSGA 1WFQA 4JG2A 2F0DA 1QUQB 3HOUG 1LYLA 1SE4A 1Y8NB 2PNRC 2JA8G 3UDXA 3TS2A 2E2IH 3NEMA 5M5YH 2Z9HA 2Q8IB 5IGFA 1W2BA 3A5UA 2F0JA 1E2WA 4NB3A 4DK3C 4LNQA 1MIUA 2FINB 3D6WA 2B2UA 4KKSA 1WTRA 1VQ7A 1G6ZA 5K36G 1SROA 2GVAA 2F3VA 2E76C 4XT1B 4PG3A 1HQMC 3M4OB 1OXUA 4DV6Q 1MGSA 4ILWA 1AW7A 1I94L 1N32L 2I07B 3HKSA 2D0OA 4Y7NH 3OTOQ 1A15A 1X3GA 4EQNA 1TWCH 4EVOA 2IX3A 2Z4HA 1Q7YC 4IQZA 3GTGH 1LTGD 1J6QA 1PZKD 2VQFQ 1AP0A 1YNJC 1QZHA 1LT5D 1H9SB 3CCVA 2L1BA 3DHQA 1SJED 5FKAC 1KD1C 3K57A 1Q1BA 3DEOA 2NVQH 4KHPL 5EBDA 3KDFA 2DNCA 1LO5D 1BR9A 1RD9D 4A3MB 2VUMH 4OWXB 2F4VQ 2HHHL 3OHXC 2WKCA 2K01A 5IGDA 4R1JA 1NY4A 2LY7A 2B29A 2PQAA 1TS5A 1ZYRD 1X65A 4HJ7A 1JOOA 4RHRA 1LTLA 4ALPA 1J8IA 3KBXA 3RN2A 1WTOA 1KNAA 2VUMG 4KTAA 4HJAA 2WAQB 1TWGH 2BA0A 3TQYA 2Q2TA 1QVCA 1C9OA 2D0PA 5ELOA 2B2VA 3K6OA 1FGUA 3T53B 2GN5A 2R61A 5L37A 2NTTA 1IYUA 1VMPA 4GLAC 1HPCA 4QJFA 4R9WA 3QOLA 4IOCA 3MAQA 4HMJA 1TWFB 3DWQA 2F0QA 2JQOA 4HSVA 1Y8OB 2N3SA 3F1ZA 5A35A 4R8NA 2K5NA 4JI4Q 3NBHB 3BVMA 1SFOB 1W6JA 1QVGA 3LNNA 1HUNA 1CZGA 1C4QA 5AFWA 1STAA 1G51A 1D1IA 5IT9L 4IURA 3BZKA 1JJCB 1U4MA 4BBRH 1Q1EA 3J80i 4RKBA 1DM0B 3S16B 4JI8Q 1CI3M 2EOTA 4CBVA 4P75A 3TREA 4CDEC 3STBD 3I56A 3Q22A 1B9NA 5KNBA 2HQLA 3SR1A 4DAMA 2XVSA 5EPLA 1HZ9A 1VQHA 3J7ZC 3KLSX 5CV8A 4J6HA 1VQIA 5H1SE 2OXPA 4APVA 1M8AA 2IW3A 1BVSA 1U9RA 2CFMA 3NPPA 3OIQA 3R2IA 2BDNA 1I5FA 1LM0A 4BBSB 3PIP3 4KJOA 4A3LH 4YWMA 4DXGA 1RIPA 3URYA 4QGUA 3CPWA 3PO2B 2H5XA 3GTQB 1TY0A 4DUZL 1KTKA 1F9RA 1CQVA 2Z1CA 4FVMA 2M00A 3S1QH 4FXKC 1HZCA 2UUAQ 2NZ1D 1FNUA 1PH4A 2UUCQ 2IX1A 1XNQQ 4DUYL 1CKMA 4KD4A 3T16A 1G2TA 1VQNA 1Y1WH 2PZUA 3C3LA 2B2WC 2L12A 4R4IA 1CM9A 4A3DH 4C3IG 1NBWA 1CKNB 2OWOA 4BY7H 1RF2D 5CV5A 4FXDA 1JORA 5C4XB 1P8LA 2XNAC 4LUZA 3VYUA 3RMHA 2YU9B 1JJGA 5I6YA 4A4IA 3TP7A 1RJTA 3OPOA 3TN2A 3NUCA 3A74A 2NTSA 4NDXA 2IY5B 1Y1WG 4JCVE 2SEBD 2E2DC 4JI0Q 1DOKA 3AB9A 1NMFA 1PYBA 1RODA 4GKKL 1HNWQ 1MJEA 4BY7G 1XNRL 1RHPA 2FFKB 1NR2A 4ZK9B 4RGOS 1OXTA 1Q8KA 2YYZA 2ZJQA 3DM1A 1S5BD 1TS2A 4IUTA 1T5XD 1N34Q 1CFMA 1Y14B 1LT6D 1DYQA 4RG1A 2RDFA 4QB4A 4I65A 5KRUA 2EXZA 1U4RA 3AU7A 5DEHA 1HNZQ 1N9WA 3ULJA 3KJOA 1EYGA 2AWNA 4KKTA 2F0FA 3K81C 1A8VA 1E3PA 1RDPD 3IFTA 4JI6Q 2NUCA 1LTBD 3M3YH 1NR4A 1YI2A 2F0PA 4X62Q 4A3IH 5M3FB 4JV5L 2KQ3A 1B4OA 1KDAA 3EJIA 2Z6BA 2R7FA 1PV4A 2CW0C 1DGSA 1LT4D 2I5MX 4XDXA 4DR1Q 5EQ0A 1VQFA 4IJLA 1FVIA 1C7YA 2F0HA 1STHA 2X6LA 1B53A 4X64Q 5IWAQ 3NENA 5J1ZA 4DV4Q 2F4IA 1AFPA 2QEJC 4IFDI 1KAAA 4LF7Q 2R6GA 3HOYB 4A3IG 3PO3G 4KD3A 2UXCQ 1Z47A 2F3WA 3AFQA 4R4TA 3PV0A 5J22A 1EY8A 3KF6A 4K6DA 4A3GB 3RZDH 4JI5Q 1LTRD 3I4NB 4BY1B 2UUBL 4RGTA 1Y1VH 1A3UA 3H0GH 3BDOA 3PGZA 2XWJB 3P20A 1SE2A 4OO1G 2TSSA 4DV1L 3F8TA 3T13A 1Z7TA 4AQYL 3D4DA 3AQQA 3MXNB 4LUOA 2A1AA 3KDFB 4ZUJA 1SNMA 1B50A 1NTGA 4IUVA 4ZKBB 2ZTDA 3VA5A 4LK1C 3H0GG 4GN4B 4XYOA 3GTKB 3HKZB 5JOBA 1QILA 3GTPB 2K33A 3EBEA 2PQAB 5KEEA 3KYHC 4YHHL 1V1OA 4QF4A 4O2DA 1W3SA 2EY6A 2A68D 3CMAA 1YVCA 3CCEA 5LMNL 4JOIA 5K5PA 5JJIA 2EY2A 3U4VA 4K0KQ 4HJ5A 2A8VA 2JA6H 2OQKA 3S1MH 3X3NA 1IBKL 2R93H 3FEWX 4RKLA 1VQ5A 2JXMB 1VQJA 1D2BA 2L55A 2K05A 3V05A 5DLQE 2Y0SB 2CHBD 1YNXA 4A3KH 1D5MC 2PW7A 2RBMA 1YHAA 2E5LL 4AYBB 2LMCB 3QG1A 4OIJA 2ZJRA 1C8CA 4FF3A 1UE1A 2JA6G 2DGYA 2A6HD 5CGKA 1H9SA 2EYMA 4FF2A 3V96A 3I70A 4A3FB 4J1MA 2AKWB 4A3BG 2K75A 2WAQE 2QKIC 4F8MA 2UXBL 1EQVA 2EY5A 3TP5A 1H9JA 3CC7A 4HJ9A 3Q24A 4LAAA 1PTOD 3W1BA 4OX9L 2NVTB 1K8OA 3IRBA 1XTDA 1ESRA 4PZ7A 2SNMA 4DK0A 2VL6A 1WI5A 2B2TC 1TWAH 2HD3A 4DV5Q 2JA7B 4YCWA 1CT1D 3J81j 2NBFA 3H09A 2WB1E 3SXHA 4X65Q 4P71A 2KCTA 1EL0A 3PIO3 2KBNA 2VB2X 1RTNA 2VY3A 4UP8A 3D8GA 4HEDA 4IJHA 1YITA 1EEFD 2TMPA 5IYCH 1EY0A 1SDFA 3TMEA 4C3HG 5IT9c 4QQBX 3BVZA 5J3BA 4HIDA 3CPFA 4L63B 4C3JB 1KIXA 3J81i 3P7JA 3DMUA 1XYIA 3PF5A 5JJKA 4A3JG 2N8NA 5GQOA 4B3TL 5CV7A 3E0EA 5C3XA 1I50H 1ILQA 1V9PA 1Q3LA 4HSPA 4DNIA 5IYCG 4NPSA 3IAYA 4DK1A 3S2HH 2F03A 2ZM6L 1STYA 1Y69U 2VQEQ 1PLFA 3J81L 4AH6A 1XJVA 2F0OA 1LT3D 4U673 1SMYC 1DONA 1FD7D 3RNUA 2XTIA 2ZTEA 4PQXA 2CQAA 5FLXL 4CDFC 3LX0A 2O5IC 3BG3A 1STGA 3K0YA 1XPRA 1M90C 4B9XA 1UNSA 3A8IE 5GADC 1X3QA 4JI7Q 2LXJA 3QO2A 1N36Q 3A7AB 4MNOA 2EPBA 3R3OA 1H95A 5BR8Q 1QWYA 1QOHA 4EQPA 3CQZB 3C46A 1JB7A 4DV2L 1CA5A 4CJ2C 2E2JH 1VF5C 4OXPA 1UUPA 5ELFA 1S3OA 3CRKC 3I3CA 4B9WA 5EKLA 4DV0Q 1AEXA 4B3RL 5C0XI 3DWPA 1E1OA 5A2QE 4QUCA 3S1NH 2A73B 1A3VA 2PZWA 2MFIA 4PZ6A 4GNXB 3I4MG 4M1UB 1UEBA 1YBYA 2Z6KA 3OMCA 1VQDA 1MD2D 2K6AA 1KAWA 4LFAQ 1OXXK 3DUZA 2ZT9C 4DK6C 4RCOA 1BUVT 4LFCQ 1SNPA 4PZ8A 1X6OA 4FDBA 1UE5A 5M3MB 4KI0A 4H0LC 1CHQD 2D62A 4ZQ3A 1HNXQ 3AMUA 1SNOA 4GOPC 3A0JA 4FF1A 1TWHH 1I4HA 1XPUA 1KLUD 1VQKA 2F0MA 3AEVA 1PH9A 1CQFA 5EGTA 2JJQA 5IGCA 3CHBD 1VDZA 2NN6G 4MTNA 3AYHB 3NP8A 2HDMA 2QEXA 2O4XA 4DV3L 2R7ZB 4ZCKA 2DUDA 4LF4Q 2VZAA 4DF7A 3Q8DA 5FO7B 4MIUA 2VS1A 1CUKA 3D4RA 3K5NA 2QF7A 1JOKA 5I6WA 4DV7L 4HIOA 2VNUD 1GUTA 2HIVA 3T1HL 3UE0A 3KF6B 2LS01 1MKHA 5LL6X 2EDGA 4DR2Q 3W5OA 3H94A 1ZXTA 2K5DA 3GTMB 4NP5A 1CA6A 1XPOA 1QB5D 3F2UA 1G2SA 2LXKA 3GD7A 2A19A 4OWWB 3NQTA 5G3LF 2H4OA 1Z6HA 1IZ6A 3FP9A 1AN8A 4J15A 1F9QA 1PTOB 3R93A 3WOEA 1VCIA 1VQCA 1QE6A 3NTHA 4OGQC 2J0TD 5EJWA 4CKCA 2ASBA 5ISRA 4IO9A 4ME3A 4I7AA 3WOFA 1FJGL 5C3EG 4FXGC 5CBEE 2K5WA
chains in the Genus database with same CATH topology
3PMFA 2R3ZA 3PUXA 2RKSA 5CR3A 2VXWA 1NSNS 3FMCA 1SE3A 2EJGC 1JB3A 3ZYYX 1OXVA 2R92B 3I91A 3OIPA 3MFYA 5CV4A 3X3MA 1C48A 1SXTA 3EQLC 5KYLA 1A3TA 3HOXB 3N52A 2N88A 1O7ZA 4N9TA 3MXUA 3EFXD 4H44C 1F2ZA 1EY5A 3MXNA 2BE5C 3P75A 3N6RA 1O78A 4E6IA 3NWTA 2J4XA 1L0YB 4G4KA 1CHPD 2B2YC 4DNTB 3ERQA 4X3SA 1JWSD 4C1NK 5ELCA 4C2MB 2DY7A 3HOWB 2WINB 3HRZC 1IL8A 1U4PA 2QDBA 1H9RA 1K8MA 2MPMA 1OXSC 2SOBA 1GHJA 4KY7A 3OWEB 1FNVA 1STNA 2HQEA 2HUGA 2CW0D 3FPPA 4RA8A 3CRLC 3I8ZA 4K2KA 1R9TB 1D6EC 1QNUA 4IALA 2F0EA 4ULLA 4IFDH 4HMIA 1PFNA 1DZ1A 2PMZB 5F2DA 3QWNA 4H13C 5C6AA 2LFNA 3E0JA 1IHZA 1SYDA 2E2HB 5C3WA 3SVMA 3FVQA 1HRJA 3C1FA 2F0SA 2JP1A 3ND9A 1PZID 2RDHA 1LTAD 1PXUA 4IFDG 5E4WC 4LMQD 4C3IB 3SEBA 1WTXA 4RAUC 1SNDA 1EWHA 3MZ5A 4MHEA 3MA2B 3J80L 3BZDB 5T1GA 1ONLA 1X32A 4A3EB 1FNWA 1ET9A 4KN7C 1SAPA 3MEHA 2KUMA 4DAPA 2B39A 4TQUS 3HZXA 2RQXA 3TZUA 3RZOB 1L0XB 4C56C 1JC7A 4L6TB 4V190 3I72A 1D1KA 2L0CA 4UDUC 1DJRD 3S15B 4V0BA 3A55A 1I4QA 4K6LA 2M9VA 3R2TA 2FMCA 1D5ZC 1LTTD 3VR3A 1JOQA 3EROA 4DAVA 5LL6S 1T5EA 3D4WA 4RCNA 1BF4A 2F0UA 3D3RA 4RGNA 3K5LA 3KF8A 3ITPA 4ZUIA 2EYLA 3A8JE 4A93B 3S17B 1WVLA 4XQQA 3VYRA 3W2DA 2Q8TA 2V4DA 5C5MA 3NXWA 3PO3B 1SSOA 4KK7A 5C44B 3OW7A 3K7AB 2WV6D 4IUPA 1RTOA 1ENCA 2JE6I 3QIAA 5CYUA 2EJMA 2ID0A 1BBXC 2KOLA 4DU9A 5JEAH 3HOVB 2B2UC 1KLGD 3G7LA 4WORA 1CK1A 3TSSA 5BN5A 5JJZA 3ND8A 2EVBA 2PW5A 1I3QB 2X6GA 1NCVA 1MSHA 1GUGA 4DGZA 1RKNA 1I4RA 3LWEA 5JVG3 2JA5B 3DWAA 3T51B 2JSOA 4BS9A 2A6EC 3A56A 1JE4A 5IT9E 1F2YA 2J7ZA 5BN3A 5C0XH 2JEBI 1EIHA 2KHSA 3GO5A 4IN3A 1LTSD 4A3BB 2AQ1B 3S2DB 3GTOB 1H9MA 4XTCS 5M5XB 5CV6A 1S4ZA 4JBWA 3J80E 3D31A 1I6VC 1XTCD 2F0VA 4ODGA 1F2LA 4EQOA 1G8ZD 3J7AF 4OHJA 1Q8IA 3NHHA 1PRTF 4HTHA 3SDZA 2RSNA 4C3HB 1JWUD 1ICWA 5DM63 3Q23A 1ENFA 3MFGA 3GTLB 3DEPA 3I90A 4K5VA 4A3JB 2L11A 4QUFA 5DNFA 3NTIA 2B8FA 1TIID 1WCMB 1BOSA 5CV9A 3MHBA 3GTJB 2N55A 4PV1C 2F0IA 4KY5A 5FK9C 2SDFA 3BS1A 4RFBA 3J7YW 3SK8A 2FHTA 2ICEC 1S5DD 4DXFA 3Q0AA 2B2YA 3A54A 5JPMC 1BCPF 1EYDA 1SYCA 1TS3A 1V1PA 2NVYB 1JCKB 1V43A 3T56B 3VYSA 1CTMA 4G57A 2HCIA 4FF4A 2AUJD 4G7ZC 3NQIA 2MUYA 4CJ0B 4PMBA 1EWCA 1I6HB 4HR7B 3P1HA 5KYIA 2DNEA 2C5CA 3U9SA 3QOJA 3HS0C 3MXPA 1NUCA 2H1EA 2JYOA 1FGBD 1PTOF 1GUNA 3I4MB 1YNJD 4HCSA 3MVVA 1MI2A 2GA4B 1IW7C 2KEEA 3WDNA 1JQYD 1TS4A 5JVH3 3S1RB 1K83B 2BE5D 1OO9B 1GHKA 5D14A 4OO1I 1LACA 2MHVA 1BDOA 4CGYB 3O13A 1PRTC 5IGEA 1NAPA 4J8QA 1DOMA 4CKEA 3S14B 3NSWA 3D6CA 1Q12A 3M7NA 3L3OC 1DCZA 4RGMA 2CVRA 1PMRA 1LTID 2ZXOA 2A69C 5EKIA 4ZLTF 3J7AV 3U9OA 3KLRA 3MTSA 2RSOA 2JEAI 2NYZD 2I46A 3A8KE 1TKWB 2B63B 5IGBA 5G3LD 2D9UA 4QIWB 1VMCA 1UAPA 1E2VA 4OL7A 2B8GA 4H7BA 3I73A 3I4LA 3VR4A 2DY8A 1BCPC 2B2WA 2A68C 4XT3B 5T1IA 2KA7A 2EJFC 5C3EB 3K59A 3HOUB 2JA8B 3GQBA 1EZ8A 3HEJA 4DFAA 2QILA 4TSSA 4IUQA 3H91A 4XQJA 1HXYD 5C4JB 1WTPA 1GOZA 2NVXB 2PCFB 2E2IB 3PUZA 5M5YB 1DXMA 1WD1A 1PDQA 1IKMA 1PTOC 1B9MA 4NMZA 1KABA 4IZ8A 3K58A 2ZXPA 5E4XA 3JAML 2RA4A 1XWEA 3VYTA 1HTLD 2AQ2B 3NBIA 4HCEA 5E1FA 2Z4IA 4L8JA 1FR3A 1F77A 1HFGA 1O7YA 1SNQA 3FRPB 4Y7NB 5FO9B 1TWCB 2F0KA 3GTGB 5K36H 4RHSA 2BOSA 4WFN3 4I7ZC 2OT2A 4CKBA 1QJOA 2XIWA 1WTVA 1EU4A 3FKIB 2NVQB 5CC4A 1XXGA 4EGVA 1F9PA 2VUMB 1PTOH 4Q5VA 1HA5A 3J81E 1SJHD 1H9KA 3IL8A 5IIFA 2BCOA 3Q6SA 1STEA 2OF1A 4DNRB 1HHVA 1FYCA 3FDTA 2XSCA 5DM73 3KLSA 5FLXE 3GV6A 4ID6A 4QMGA 1TQOA 1HUMA 1TWGB 1S5FD 4XXEA 3M7GA 1V8QA 2K03A 1HTPA 4S3SA 1G291 5KGUA 2NWGA 4KHZA 4O1NA 2E74C 2D5DA 3W3AA 4F7XA 1HFNA 2IL8A 1SYGA 3SK5A 1G91A 1ENAA 1ZEQX 1V1PB 5ELEA 3L7ZC 5BN4A 1PFBA 1B1ZA 4K8IA 5D3IB 1O7LA 4ZRZA 4BBRB 2MJ8A 3TBIB 1TY2A 2F0LA 4HN7A 3MWYW 1S5ED 2KEDA 1DOLA 5DAUA 2K7VA 3VR5A 2NN6I 2EYJA 5I9PA 1GJXA 2WB1B 2EZVA 3TDQA 1LABA 4G7HC 1F9SA 2F0GA 3BYYB 3SHLA 2A6ED 2LKVA 2RDGA 4FNFA 3SE0A 5ELDA 4PMWA 4R8IA 1VF7A 2FJ2A 4TRDA 2PZTA 5I2XA 3S1QB 2B2TA 2Q8RE 3BDLA 2PPBC 3NK9A 4LJZC 5I4DA 2F0TA 5HURA 4N9PA 1QG7A 1Y1WB 1AZQA 3M85A 3M4YA 4A3DB 4WRDA 4HAEA 1GUSA 4BY7B 3VR2A 1BQQT 1II3A 1SYEA 4DAYA 2KCCA 3OWFA 1EY7A 3JAME 1I4GA 1UEAB 1DD2A 3E5SA 2PQEA 1TT2A 1YNNC 3H6MA 5EPKA 2F0WA 2A74C 2KVMA 3RUZA 5COYA 4IUNA 3VR6A 4BA2I 4O42A 3KUPA 3PUWA 1HA6A 2L9HA 2HCCA 1KDBA 2K5QA 1A6XA 4F87A 2WP8J 2KCNA 2WIIB 2EYOA 2C9OA 1EY4A 3M3YB 1EEID 2K32A 4XIGS 1QNKA 4A3IB 1ML0D 4B08A 2MP1A 1JR0D 3MC0B 3SK4A 2OEOA 5KNDA 1TVXA 4M8AA 5TSSA 2E75C 3NWSA 4ZYSA 3IKJA 2FMMA 2EYHA 5D3DA 5M9OA 1ZYRC 2AUKA 3KBGA 5NUCA 1PFMA 4P2CB 2IPKD 3CU7A 2IX0A 1SMYD 3K5MA 3RZDB 3RLFA 4IFDJ 4GZYC 1Y8PB 2IT1A 5E3FA 1R4QB 1Y1VB 1J9OA 3HP3A 4IUUA 3H0GB 5CMDA 1IW7D 4RWSC 5JEAG 2XN9C 5LHY1 3CKIB 2BA1A 1A2TA 2M2LA 4K8JA 1WTQA 1PRTD 4KMUC 2AQ3B 4KHVA 2NB0A 4OO1H 1SEBD 2EYPA 2MGSA 2ZXRA 5I9OA 5D65A 2PYKA 4Q0FA 5M5WB 4RH6A 2JA6B 4XQNA 1EIGA 3S1MB 3BYTB 2R93B 1JWMD 2A69D 4ZAIA 5A2QL 2IWHA 4NKLA 4MN3A 2AWOA 2G9HD 4A3KB 1GUWA 3QB3A 1ILPA 4DN4M 4X3TA 5C0XG 3R8BA 4YIJA 1AZPA 2K04A 4FYDA 4NW2A 2L5TA 3EA6A 4K5WA 4CHTB 2B2VC 2XWBB 3OMGA 2A5HA 1BXTA 1EFID 2HDLA 1BCPD 2BDOA 3GP7A 1TWAB 4KV6A 1JICA 2IJ0A 3EVQA 5CBAE 3TZDA 4DA2A 5IOCA 1SNCA 3K5OA 1EZ6A 4PNYA 3H3VC 3MXGA 3TP6A 4XYQA 2O5JC 1A2UA 3BDCA 3TP8A 4TKOB 3VA7A 3KK7A 2X69A 1GUOA 2XRQD 3HGBA 5KNCA 3C2PA 5CORA 2KECA 1M4VA 2WKDA 4FP5D 1I50B 1S5CD 1KDCA 1HCZA 1PZJD 3S2HB 2QCPX 3SK6A 2ENBA 3A7LA 3NE5B 3NTKA 1TU2B 1EY6A 4QCLA 5C4ZA 4ZKCB 1QCBD 1SBBB 5JEAJ 4C1NI 3G6JB 1LLRD 5FOBB 3GV3A 1XX8A 1EQTA 5EBCA 1EYAA 1WD0A 1EU3A 3L9AX 1HQRD 5ELBA 1GXDC 2XRSD 5HGTA 3LWUA 1KNEA 3V2TA 2Z8LA 1RCVD 2E2JB 4K14A 4X3KA 4K2LA 4WJWA 4FO2A 3OOCA 3NBHA 1U4LA 3S9WA 5JAVA 2VB3X 2O2LD 3S1NB 1R4PB 5EPJA 1ET6A 2DN8A 1W6KA 2KJXA 1X3PA 1ZKOA 5C0XJ 5C4HA 5FO8B 2G9DA 4C3JG 1EYCA 4KY6A 1B3AA 2K28A 2PO4A 4OIKA 1I4PA 1Q90A 3RD4A 4UAIA 1SYFA 1TWHB 4K5XA 1PRTB 3PUVA 3PUYA 1E2ZA 4G7OC 5I2YA 5C5LA 1TR5A 4BA1I 4ABNA 5KIXA 1O80A 2L4NA 5JPNC 1LV9A 5J39A 2WACA 1BO0A 1ESFA 1I4XA 5IODA 1CZWA 1IKLA 4KN4C 1B44D 3DXJC 4CJ1B 1F2MA 1WTWA 1EY9A 1MBYA 1D5XC 2ICIA 3UI2A 2NN6H 1B2TA 3ONAB 1E0BA 2F1MA 1IYVA 4BWGB 5IGGA 4F88A 2EYFA 3C1EA 4X3UA 1BCPB 4PMCA 1PYWD 4U68A 2A6HC 4Z9CB 2RVLA 3QJYA 4KKUA 3FPUB 3T4AC 5EKKA 2EY1A 2K1BA 3BVGA 1BNZA 3IFDA 2SNSA 2D2CC 3HOZB 3HG9A 4ME5A 3E6ZX 2F0NA 1STBA 4JK1C 2EE1A 3OSOA 1YNND 1EOTA 4KJNA 1SYBA 1MSGA 2F0DA 1SE4A 1Y8NB 2PNRC 2Q8IB 5IGFA 2F0JA 1E2WA 2FINB 3D6WA 2B2UA 4KKSA 1WTRA 1G6ZA 5K36G 2F3VA 2E76C 4XT1B 1HQMC 3M4OB 1OXUA 1MGSA 4ILWA 1AW7A 2I07B 1A15A 4EQNA 4EVOA 2IX3A 2Z4HA 4IQZA 1LTGD 1PZKD 1AP0A 1YNJC 1LT5D 1H9SB 2L1BA 3DHQA 1SJED 5FKAC 3K57A 1Q1BA 3DEOA 5EBDA 2DNCA 1LO5D 1BR9A 1RD9D 4A3MB 3OHXC 2WKCA 2K01A 5IGDA 2LY7A 1TS5A 1ZYRD 1JOOA 4RHRA 1J8IA 3KBXA 1WTOA 1KNAA 4KTAA 2WAQB 2BA0A 2B2VA 3K6OA 3T53B 2R61A 2NTTA 1IYUA 1VMPA 1HPCA 4R9WA 3QOLA 3MAQA 4HMJA 1TWFB 3DWQA 2F0QA 4HSVA 1Y8OB 5A35A 4R8NA 3BVMA 1SFOB 1W6JA 3LNNA 1HUNA 1CZGA 1C4QA 5AFWA 1STAA 1D1IA 5IT9L 4IURA 1U4MA 1Q1EA 4RKBA 1DM0B 3S16B 1CI3M 2EOTA 4CBVA 3Q22A 5KNBA 1B9NA 3SR1A 2XVSA 5EPLA 3KLSX 5CV8A 4J6HA 2OXPA 1M8AA 2IW3A 1U9RA 3NPPA 3OIQA 3R2IA 2BDNA 4BBSB 3PIP3 4KJOA 4DXGA 3URYA 3PO2B 3GTQB 1TY0A 1KTKA 1F9RA 1CQVA 2Z1CA 4FVMA 2M00A 4FXKC 2NZ1D 1FNUA 2IX1A 4KD4A 3T16A 1G2TA 2PZUA 3C3LA 2B2WC 2L12A 1CM9A 4C3IG 1RF2D 5CV5A 4FXDA 1JORA 5C4XB 3VYUA 2XNAC 3RMHA 2YU9B 5I6YA 3TP7A 1RJTA 3TN2A 3OPOA 3NUCA 4NDXA 2NTSA 2SEBD 2E2DC 1DOKA 3AB9A 1RODA 1RHPA 2FFKB 1NR2A 4ZK9B 4RGOS 1OXTA 2YYZA 3DM1A 1S5BD 1TS2A 4IUTA 1T5XD 1CFMA 1LT6D 1DYQA 2RDFA 4QB4A 4I65A 5KRUA 2EXZA 1U4RA 3AU7A 5DEHA 2AWNA 4KKTA 2F0FA 1RDPD 3IFTA 2NUCA 1LTBD 1NR4A 2F0PA 5M3FB 2KQ3A 1B4OA 1KDAA 3EJIA 2CW0C 1LT4D 4XDXA 5EQ0A 2F0HA 1STHA 2X6LA 1B53A 5J1ZA 2F4IA 1AFPA 2QEJC 4IFDI 1KAAA 2R6GA 3HOYB 4KD3A 1Z47A 2F3WA 3PV0A 5J22A 1EY8A 4K6DA 4A3GB 1LTRD 3I4NB 4BY1B 4RGTA 1A3UA 3BDOA 2XWJB 3P20A 1SE2A 4OO1G 2TSSA 3T13A 1Z7TA 3D4DA 4ZUJA 1SNMA 1B50A 4IUVA 4ZKBB 3VA5A 4LK1C 4XYOA 3GTKB 3HKZB 5JOBA 1QILA 3GTPB 2K33A 5KEEA 1V1OA 4QF4A 2EY6A 2A68D 5K5PA 2EY2A 3X3NA 3FEWX 4RKLA 2JXMB 1D2BA 2L55A 2K05A 3V05A 2Y0SB 2CHBD 1D5MC 2PW7A 2RBMA 4AYBB 2LMCB 3QG1A 4OIJA 1C8CA 4FF3A 2A6HD 5CGKA 1H9SA 2EYMA 4FF2A 3V96A 3I70A 4A3FB 4J1MA 2QKIC 4F8MA 1EQVA 2EY5A 3TP5A 1H9JA 3Q24A 4LAAA 1PTOD 1K8OA 2NVTB 1ESRA 2SNMA 4DK0A 2B2TC 2JA7B 1CT1D 2NBFA 3H09A 3SXHA 1EL0A 3PIO3 2VB2X 1RTNA 3D8GA 4HEDA 1EEFD 2TMPA 1EY0A 1SDFA 3TMEA 4C3HG 3BVZA 4C3JB 4L63B 3P7JA 3DMUA 1XYIA 5CV7A 5C3XA 1ILQA 1Q3LA 4HSPA 3IAYA 4DK1A 2F03A 1STYA 1Y69U 1PLFA 3J81L 2F0OA 1LT3D 4U673 1SMYC 1DONA 1FD7D 4PQXA 2CQAA 5FLXL 3LX0A 2O5IC 3BG3A 1STGA 3K0YA 4B9XA 1UNSA 3A8IE 1X3QA 3QO2A 3A7AB 2EPBA 3R3OA 1QWYA 1QOHA 4EQPA 3CQZB 3C46A 1CA5A 4CJ2C 1VF5C 1UUPA 5ELFA 3CRKC 3I3CA 4B9WA 5EKLA 1AEXA 5C0XI 3DWPA 5A2QE 4QUCA 2A73B 1A3VA 2PZWA 4M1UB 3OMCA 1MD2D 2K6AA 1OXXK 3DUZA 2ZT9C 4RCOA 1BUVT 1SNPA 5M3MB 4KI0A 4H0LC 1CHQD 2D62A 4ZQ3A 3AMUA 1SNOA 4FF1A 1I4HA 1KLUD 2F0MA 1CQFA 5EGTA 5IGCA 3CHBD 1VDZA 2NN6G 3NP8A 2HDMA 2R7ZB 2O4XA 4DF7A 5FO7B 4MIUA 3D4RA 3K5NA 2QF7A 1JOKA 5I6WA 2VNUD 1GUTA 2LS01 5LL6X 2EDGA 3H94A 1ZXTA 2K5DA 3GTMB 4NP5A 1CA6A 1QB5D 3F2UA 1G2SA 3GD7A 3NQTA 5G3LF 2H4OA 1Z6HA 1AN8A 1F9QA 1PTOB 4CKCA 3R93A 3WOEA 1VCIA 3NTHA 1QE6A 4OGQC 2J0TD 5EJWA 5ISRA 3WOFA 4FXGC 5CBEE 2K5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2K A;  3H6M A;  3QOJ A;  3SR1 A;  3ITP A;  1SYG A;  1EY6 A;  4ZUI A;  2F0W A;  3PMF A;  5C4Z A;  4IAL A;  5CV6 A;  3SK5 A;  2F0F A;  3MXP A;  1ENA A;  2F0E A;  5KYI A;  1NUC A;  2RKS A;  4KHV A;  2EYM A;  2EYL A;  3RUZ A;  5CGK A;  4EQN A;  4EVO A;  1F2M A;  4J6H A;  5CV8 A;  4HMI A;  1EY9 A;  4IUN A;  2OXP A;  4J1M A;  5CR3 A;  2NUC A;  5EKL A;  4B9W A;  2EYP A;  5F2D A;  1U9R A;  1NSN S;  4F8M A;  1AEX A;  1EQV A;  2EY5 A;  2F0P A;  3TP5 A;  5C6A A;  3MVV A;  2PYK A;  5I9O A;  2KQ3 A;  1IHZ A;  2F0V A;  1SYD A;  4LAA A;  1KDA A;  4ODG A;  3EJI A;  5C3W A;  4KJO A;  3DHQ A;  1EYA A;  5C5M A;  2SNM A;  4EQO A;  3NXW A;  4K8I A;  1A3V A;  4NMZ A;  1KAB A;  4IZ8 A;  2PZW A;  3C1F A;  2F0S A;  4NKL A;  2F0H A;  1STH A;  5IGG A;  3NHH A;  5HGT A;  3OMC A;  5CV4 A;  2EYF A;  3C1E A;  5J1Z A;  2F0L A;  4HTH A;  1KDB A;  3SXH A;  3V2T A;  2M00 A;  1KAA A;  4PMC A;  3QB3 A;  5E1F A;  1SND A;  5DAU A;  4KD3 A;  3MZ5 A;  1ENC A;  5IGE A;  5IGD A;  5KYL A;  2EYO A;  1SNQ A;  2F3W A;  1A3T A;  1SNP A;  2EYJ A;  3D8G A;  4K5V A;  1EY8 A;  4K14 A;  4YIJ A;  5J22 A;  5I9P A;  4K6D A;  1EY4 A;  3D6C A;  2F0K A;  1EY0 A;  4K5W A;  4KD4 A;  4N9T A;  3T16 A;  2PZU A;  3TME A;  4DU9 A;  4K2L A;  1JOO A;  2F0G A;  3OMG A;  4ZQ3 A;  3S9W A;  1SNO A;  5JAV A;  1F2Z A;  1A3U A;  1EY5 A;  5CV9 A;  4KTA A;  3MHB A;  2F0M A;  5CV5 A;  3SHL A;  3P75 A;  5EKK A;  4WOR A;  2EY1 A;  1JOR A;  2LKV A;  3DMU A;  3MEH A;  3SK4 A;  4KV6 A;  4E6I A;  2F0I A;  4KY5 A;  2OEO A;  5EGT A;  3EVQ A;  5CV7 A;  3T13 A;  3U9O A;  5C3X A;  2PW5 A;  5CC4 A;  5IGC A;  3HZX A;  5I6Y A;  4TRD A;  2PZT A;  3D4D A;  3TP7 A;  5C4H A;  5IOC A;  2SNS A;  3NUC A;  1SNC A;  4NDX A;  3ERQ A;  4ME5 A;  3NP8 A;  4ZUJ A;  1EZ6 A;  1SNM A;  2O4X A;  3SK8 A;  3BDL A;  4PNY A;  1EYC A;  4KY6 A;  2F0N A;  3NK9 A;  4DF7 A;  1STY A;  4MIU A;  3TP6 A;  2EYH A;  3VA5 A;  1STB A;  5IGB A;  2F0T A;  5HUR A;  4DGZ A;  5M9O A;  1A2U A;  5IIF A;  5I6W A;  1JOK A;  3QOL A;  1RKN A;  3BDC A;  3OSO A;  4HMJ A;  4N9P A;  5JOB A;  3TP8 A;  2OF1 A;  4KJN A;  5NUC A;  1SYB A;  1EYD A;  4OL7 A;  2F0Q A;  1SYC A;  2F0O A;  2QDB A;  2F0D A;  4H7B A;  5KEE A;  4QF4 A;  2SOB A;  4WRD A;  1SYF A;  5E3F A;  2EY6 A;  4KY7 A;  4R8N A;  5K5P A;  4ID6 A;  4K5X A;  4QMG A;  1TQO A;  1II3 A;  2EY2 A;  5IGF A;  2F0J A;  1F2Y A;  4NP5 A;  3LX0 A;  2RDF A;  1SYE A;  4G57 A;  4QB4 A;  1STA A;  1STG A;  1STN A;  4I65 A;  2HQE A;  4RKL A;  5KRU A;  3NQT A;  1JOQ A;  3ERO A;  3OWF A;  1TR5 A;  5C5L A;  4B9X A;  1KDC A;  2EXZ A;  1EY7 A;  3D4W A;  4S3S A;  5KIX A;  2F3V A;  4PMB A;  5KGU A;  1EZ8 A;  2KHS A;  5DEH A;  3R3O A;  2F0U A;  4RKB A;  1A2T A;  3HEJ A;  3SK6 A;  2ENB A;  4DFA A;  3E5S A;  5J39 A;  2PQE A;  4EQP A;  5ISR A;  2WAC A;  1TT2 A;  2PW7 A;  3P1H A;  2RBM A;  4K8J A;  5IOD A;  4F7X A; 
#chains in the Genus database with same CATH topology
 1A62 A;  3PMF A;  3H3V I;  5LMU L;  2R3Z A;  4DR4 L;  3PUX A;  2RKS A;  1KRT A;  4A76 A;  2JN4 A;  5CR3 A;  2VXW A;  1NSN S;  3FMC A;  1MHW C;  1SE3 A;  1KRS A;  2EJG C;  4JI1 L;  4X66 Q;  1JB3 A;  3ZYY X;  4LF8 L;  4YCV A;  1OXV A;  2R92 B;  2KEN A;  3I91 A;  3OIP A;  3MFY A;  3OYY A;  1AH9 A;  1L1O C;  5CV4 A;  3X3M A;  1IBM L;  3HOZ H;  1N33 L;  1C48 A;  3HKZ E;  1SXT A;  4WJ3 M;  3EQL C;  5KYL A;  4DR6 L;  1A3T A;  4LFB L;  3HOX B;  1JE5 A;  1XMQ Q;  4B3M Q;  3N52 A;  2N88 A;  1O7Z A;  1PH6 A;  1K8A C;  4N9T A;  2I0Q A;  3MXU A;  3EFX D;  4H44 C;  3HOZ G;  1F2Z A;  3FKI H;  1EY5 A;  3MXN A;  2BE5 C;  2KCM A;  3P75 A;  3N6R A;  1O78 A;  4E6I A;  3NWT A;  2Y0S E;  1XMO L;  3I2Z A;  1HR0 L;  2J4X A;  1L0Y B;  4G4K A;  1CHP D;  2B2Y C;  4AYB E;  1GO3 E;  4DNT B;  3ERQ A;  4DR5 L;  4X3S A;  4O0A A;  1JWS D;  1HJP A;  4C1N K;  5ELC A;  2HT1 A;  3M4O H;  3FKI G;  3CF5 A;  4C2M B;  2DY7 A;  3K0X A;  4WJ4 A;  3HOW B;  2WIN B;  3HRZ C;  1IL8 A;  4AIM A;  1U4P A;  4LF6 L;  2QDB A;  4NXM L;  1VQO A;  1H9R A;  1K8M A;  2MPM A;  1T9H A;  1OXS C;  2SOB A;  1GHJ A;  4KY7 A;  4B3S Q;  3OWE B;  1FNV A;  2RHS B;  1STN A;  2HQE A;  2HUG A;  3T1Y L;  2NZH A;  5E7N A;  2CW0 D;  4JW0 A;  4IPG A;  3FPP A;  4RA8 A;  3CRL C;  4A3M H;  3I8Z A;  4K2K A;  1R9T B;  1D6E C;  1QNU A;  4IAL A;  1KQS A;  3G4S A;  2F0E A;  2XGT A;  3L2P A;  4ULL A;  4IFD H;  4HMI A;  2ATW A;  1PFN A;  1DZ1 A;  2PMZ B;  5F2D A;  3QWN A;  5GRO A;  4H13 C;  5C6A A;  2LFN A;  3E0J A;  1IHZ A;  1SYD A;  2E2H B;  5C3W A;  2OQ0 A;  3SVM A;  3FVQ A;  3FHW A;  1HRJ A;  1VQ9 A;  3J81 c;  3VDY A;  3C1F A;  2F0S A;  2JP1 A;  3ND9 A;  1PZI D;  3I7F A;  2RDH A;  1LTA D;  1PXU A;  4IFD G;  2AHO B;  4EQ5 A;  1AE2 A;  5E4W C;  4X6A H;  4LMQ D;  4C3I B;  3SEB A;  1WTX A;  4RAU C;  1SND A;  1EWH A;  3MZ5 A;  1JMC A;  5FLX c;  4MHE A;  4BBR G;  5IP9 H;  1K8G A;  3MA2 B;  3J80 L;  1EIF A;  1B70 B;  1TWF H;  3BZD B;  5T1G A;  1ONL A;  3EIV A;  1X32 A;  4LW1 A;  1L2F A;  4A3E B;  1FNW A;  1SFO H;  1ET9 A;  4KN7 C;  1SAP A;  1E1T A;  2KUM A;  3MEH A;  4DAP A;  2B39 A;  2WB1 G;  4TQU S;  3HZX A;  2RQX A;  5IP9 G;  3TZU A;  3RZO B;  2UU9 L;  1L0X B;  4A3L G;  4C56 C;  3S16 H;  1JC7 A;  3F2C A;  4L6T B;  1PA6 A;  4V19 0;  3I72 A;  1D1K A;  2L0C A;  3PIP A;  4UDU C;  1DJR D;  2CKZ B;  3S15 B;  2F3I A;  4V0B A;  3A55 A;  1I4Q A;  4K6L A;  4BBS H;  2M9V A;  2ZTC A;  3R2T A;  2FMC A;  4DR7 L;  1D5Z C;  1LTT D;  1IBL Q;  1CSQ A;  3VR3 A;  1JOQ A;  3ERO A;  4DAV A;  3ULL A;  5LL6 S;  1T5E A;  3D4W A;  4RCN A;  2ZJP A;  4A3D G;  3GDE A;  1BF4 A;  2F0U A;  2RF4 A;  3PO2 H;  3GTQ H;  3D3R A;  4RGN A;  3K5L A;  1D8L A;  3KF8 A;  3ITP A;  4ZUI A;  1RL2 A;  3G6E A;  3CCR A;  1U5K A;  2EYL A;  4N8X 1;  3A8J E;  4A93 B;  4DV6 L;  3S17 B;  1WVL A;  4XQQ A;  1MJC A;  3OTO L;  4GNX A;  3PO2 G;  2PNH A;  3VYR A;  3W2D A;  2Q8T A;  1VQ8 A;  2V4D A;  5C5M A;  1YJN A;  1QZG A;  3NXW A;  3PO3 B;  2VQF L;  1SSO A;  4DR3 Q;  5C4X H;  1O7I A;  4JI3 Q;  2AMC B;  4KK7 A;  2YU9 H;  5C44 B;  3OW7 A;  4R4C A;  2ZM6 Q;  3K7A B;  2WV6 D;  4IUP A;  1RTO A;  4P72 A;  2UXD Q;  1ENC A;  2JE6 I;  3QIA A;  5CYU A;  2F4V L;  2EJM A;  2ID0 A;  1KXL A;  1GD7 A;  1BBX C;  2KOL A;  5C4X G;  4DU9 A;  5JEA H;  2YTY A;  3HOV B;  1HZA A;  2B2U C;  1KLG D;  3DM3 A;  3G7L A;  4R4Q A;  4R4O A;  1K3R A;  4WOR A;  1CK1 A;  3TSS A;  5BN5 A;  1HR0 W;  4LF9 Q;  5JJZ A;  3ND8 A;  2EVB A;  2PW5 A;  1Z9F A;  1I3Q B;  2X6G A;  4GOP A;  3KJP A;  2BH2 A;  2Q2H A;  4YCU A;  1K0R A;  4JPB W;  1NCV A;  1MSH A;  1GUG A;  4DGZ A;  1KC8 C;  1RKN A;  1I4R A;  4YY3 Q;  3LWE A;  5JVG 3;  4P73 A;  1VQ4 A;  2JA5 B;  3DWA A;  3T51 B;  4H02 A;  2JSO A;  3ER0 A;  4BS9 A;  2A6E C;  5M3F H;  3A56 A;  2MNA A;  1JE4 A;  5IT9 E;  1F2Y A;  2J7Z A;  5IYB H;  4JI4 L;  5BN3 A;  1SN8 A;  5C0X H;  2JEB I;  4QY7 A;  5JJL A;  1EIH A;  1S40 A;  2KHS A;  3GO5 A;  4IN3 A;  1Y1V G;  1LTS D;  1KL9 A;  4NXN Q;  4A3B B;  2AQ1 B;  3S2D B;  3GTO B;  2EXD A;  1H9M A;  4XTC S;  3HOY H;  5M5X B;  2CH4 W;  4JI8 L;  2CH4 A;  5CV6 A;  1S4Z A;  5IYB G;  2GVB A;  4JBW A;  4CDC C;  3J80 E;  5M5W H;  2MQH A;  3D31 A;  4OWT B;  1I6V C;  1J5E Q;  4A3G H;  1XTC D;  3I4N H;  4BY1 H;  2F0V A;  4LF5 Q;  4ODG A;  1F2L A;  4JBM A;  4EQO A;  1G8Z D;  2IHF A;  3HOY G;  3J7A F;  4OHJ A;  4LUV A;  3CCM A;  4MTK A;  1Q8I A;  3NHH A;  1PRT F;  4HTH A;  3SDZ A;  2RSN A;  4C3H B;  4A3G G;  1JWU D;  4N8F A;  2R93 G;  2KHI A;  4UY8 C;  3I4N G;  1ICW A;  5DM6 3;  3Q23 A;  1ENF A;  3MFG A;  5AJ3 L;  3DEP A;  2UUA L;  3GTK H;  3GTL B;  3I90 A;  1L1O A;  4K5V A;  2CCZ A;  4A3J B;  3I55 A;  3GTP H;  5IP7 H;  4A3K G;  2L11 A;  4QUF A;  5DNF A;  2UUC L;  3NTI A;  1WOC A;  2P5Z X;  2B8F A;  2C35 B;  1XNQ L;  4JYA Q;  1TII D;  1WCM B;  1BOS A;  5CV9 A;  3MHB A;  1UWV A;  3GTJ B;  2LSS A;  1EWI A;  2N55 A;  4PV1 C;  2F0I A;  4KY5 A;  5FK9 C;  2SDF A;  3BS1 A;  4UPA A;  3L0O A;  4RFB A;  5IP7 G;  3J7Y W;  3SK8 A;  2FHT A;  3NEL A;  2ICE C;  2K14 A;  4OEM B;  3KOJ A;  1FJG Q;  1S5D D;  4DXF A;  4A3C H;  4JI0 L;  2PMZ E;  1K3B C;  3Q0A A;  1PYS B;  2K5H A;  2MO0 A;  2B2Y A;  3A54 A;  5JPM C;  1BCP F;  1EYD A;  1SYC A;  1HNW L;  1TS3 A;  1V1P A;  4YWL A;  4A3F H;  2NVY B;  3RLO A;  1X56 A;  1N34 L;  3H3V H;  2Y0S G;  1JCK B;  1V43 A;  3T56 B;  2NVT H;  3VYS A;  1CTM A;  4G57 A;  2HCI A;  4AYB G;  4FF4 A;  3PIO A;  2AUJ D;  4G7Z C;  2JA7 H;  3NQI A;  2MUY A;  4CJ0 B;  3J80 c;  3ICE A;  4PMB A;  3E9I A;  1EWC A;  2I5H A;  1N33 Q;  1I6H B;  2RHQ B;  4A3F G;  1I94 Q;  4HR7 B;  1N32 Q;  3P1H A;  5KYI A;  2DNE A;  2C5C A;  3U9S A;  3QOJ A;  1YJW A;  3HS0 C;  3MXP A;  5ELN A;  1NUC A;  2H1E A;  1E24 A;  2JYO A;  1FGB D;  1PTO F;  4LWC A;  1GUN A;  3I4M B;  1YNJ D;  4HCS A;  3MVV A;  1MI2 A;  1YEZ A;  2GA4 B;  1IW7 C;  1Q81 C;  4JI6 L;  2KEE A;  3WDN A;  4KHP Q;  4C3J H;  1JQY D;  1P16 A;  1TS4 A;  4X62 L;  5JVH 3;  3S1R B;  1K83 B;  2BE5 D;  3U4Z A;  1EFW A;  1OO9 B;  1HR0 Q;  2HHH Q;  1GHK A;  5FLM H;  3BJU A;  5D14 A;  3G48 A;  4KLK A;  4OO1 I;  1LAC A;  2MHV A;  3PCO B;  1BDO A;  5IWA L;  4CGY B;  3O13 A;  1NJI C;  3BZC A;  1PRT C;  1SLJ A;  3KF8 B;  4L5Q A;  1NAP A;  4J8Q A;  5IGE A;  4DV4 L;  1DOM A;  3H15 A;  4GKJ L;  4CKE A;  4LF7 L;  3S14 B;  3NSW A;  3D6C A;  3W1G A;  1Q12 A;  4NXM Q;  2UXC L;  3K8A A;  3M7N A;  3L3O C;  1DCZ A;  2PI2 A;  2CVR A;  2V1C C;  1PMR A;  1LTI D;  4RGM A;  2OTL A;  3CXC A;  2ZXO A;  2A69 C;  5EKI A;  1JJ2 A;  4JI5 L;  4ZLT F;  3J7A V;  3U9O A;  3KLR A;  3MTS A;  2RSO A;  2JEA I;  2NYZ D;  2I46 A;  1SMX A;  3A8K E;  1TKW B;  3RLN A;  3CQZ H;  2B63 B;  5IGB A;  5G3L D;  2D9U A;  4QIW B;  2I5L X;  5FJ8 H;  1VMC A;  1FL0 A;  1UAP A;  1X3E A;  1E2V A;  4OL7 A;  2B8G A;  4H7B A;  1EQQ A;  3I73 A;  3I4L A;  3VR4 A;  2DY8 A;  1BCP C;  2B2W A;  2A68 C;  4XT3 B;  5T1I A;  2KA7 A;  2EJF C;  4DKA C;  5C3E B;  3K59 A;  1GVP A;  4YWK A;  3HOU B;  3U50 C;  1X3F A;  2JA8 B;  4K0K L;  3GQB A;  1EZ8 A;  1PH2 A;  3HEJ A;  4GOP B;  4DFA A;  2QIL A;  4EX5 A;  4TSS A;  1VQP A;  4IUQ A;  3H91 A;  4XQJ A;  5LMN W;  1HXY D;  5C4J B;  3JAM i;  4A75 A;  1GOZ A;  1WTP A;  2NVX B;  2PCF B;  5M3M H;  2E2I B;  3PUZ A;  1E22 A;  3F2B A;  2YTX A;  5M5Y B;  1DXM A;  1WD1 A;  1CSP A;  1PDQ A;  1IXR A;  1VQG A;  1PHJ A;  1IKM A;  1PTO C;  1BKB A;  1PH7 A;  1B9M A;  3JC6 6;  4NMZ A;  4DUZ Q;  1KAB A;  4IZ8 A;  3D0F A;  3K58 A;  1UE7 A;  2ZXP A;  5E4X A;  3JAM L;  2RA4 A;  1XWE A;  3VYT A;  1HTL D;  3PQI A;  2AQ2 B;  2QW7 A;  4DV5 L;  3ULP A;  3NBI A;  2R7Z H;  4DUY Q;  4HCE A;  5E1F A;  2Z4I A;  2JA9 A;  4L8J A;  1A0I A;  1FR3 A;  4X65 L;  1F77 A;  1HFG A;  1O7Y A;  1SNQ A;  3FRP B;  4Y7N B;  1WJJ A;  5FO9 B;  2N78 A;  1TWC B;  1K9M C;  2F0K A;  4JOI C;  1Q82 C;  3GTG B;  5K36 H;  4RHS A;  2BOS A;  3AFP A;  4WFN 3;  4I7Z C;  1EUJ A;  2OT2 A;  2R7Z G;  4CKB A;  1QJO A;  2XIW A;  1WTV A;  1EU4 A;  4DR7 Q;  3GTM H;  3FKI B;  2NVQ B;  5CC4 A;  1XXG A;  4EGV A;  4GKK Q;  1F9P A;  4OEL B;  1PTO H;  2VUM B;  4Q5V A;  1HA5 A;  1XNR Q;  3J81 E;  1SJH D;  1H9K A;  3IL8 A;  5IIF A;  2BCO A;  3Q6S A;  1STE A;  2OF1 A;  4DNR B;  1HHV A;  1FYC A;  3FDT A;  1L1O B;  2VQE L;  2XSC A;  4POG A;  5DM7 3;  1V1Q A;  3KLS A;  5FLX E;  3GV6 A;  3UDG A;  4ID6 A;  4QMG A;  1TQO A;  1HUM A;  1TWG B;  1S5F D;  4XXE A;  3M7G A;  1V8Q A;  2R92 H;  2K03 A;  1VQL A;  1HTP A;  4S3S A;  1G29 1;  5KGU A;  1YHQ A;  2NWG A;  4KHZ A;  4O1N A;  2E74 C;  4JI7 L;  2VW9 A;  2D5D A;  3W3A A;  1N36 L;  1A63 A;  4F7X A;  1HFN A;  2IL8 A;  1SYG A;  5BR8 L;  1YIJ A;  3SK5 A;  1G91 A;  1ENA A;  3M9B A;  3HOX H;  1ZEQ X;  2R92 G;  4JV5 Q;  1V1P B;  5ELE A;  3L7Z C;  4POF A;  5BN4 A;  1PFB A;  4DV0 L;  1B1Z A;  4GLX A;  4K8I A;  4IPD A;  5D3I B;  1VQE A;  1O7L A;  4ZRZ A;  4TVA B;  4BBR B;  2MJ8 A;  3HOX G;  3TBI B;  1TY2 A;  2F0L A;  4HN7 A;  3MWY W;  1S5E D;  2WFW A;  2KED A;  1DOL A;  5IYD H;  5DAU A;  2K7V A;  3B6Y A;  3VR5 A;  4C2M H;  1PH8 A;  2NN6 I;  2QA4 A;  4LFA L;  2EYJ A;  5I9P A;  2UUB Q;  1GJX A;  3HOW H;  1UE6 A;  2Q2U A;  2WB1 B;  2EZV A;  4LFC L;  3TDQ A;  1LAB A;  4A3M G;  4G7H C;  1F9S A;  2F0G A;  4JI2 L;  4GS3 A;  1SR3 A;  3BYY B;  3CAM A;  2MO1 A;  4DV1 Q;  2ES2 A;  4AQY Q;  3SHL A;  2A6E D;  2LKV A;  2RDG A;  4FNF A;  3SE0 A;  5ELD A;  5IYD G;  1HNX L;  4PMW A;  4R8I A;  1VF7 A;  2FJ2 A;  4TRD A;  2PZT A;  5I2X A;  3HOW G;  3S1Q B;  2B2T A;  2Q8R E;  3BDL A;  2PPB C;  3NK9 A;  4LJZ C;  5HGQ A;  5I4D A;  2WAQ G;  1PVO A;  2F0T A;  5HUR A;  1VS0 A;  4IPH A;  2QGQ A;  4YHH Q;  4LF4 L;  1R9T H;  4N9P A;  1B8A A;  2F52 A;  1ASZ A;  1QG7 A;  5LMN Q;  1B3Q A;  1Y1W B;  1AZQ A;  3M85 A;  3M4Y A;  3TS0 A;  4CDD C;  4A3D B;  4WRD A;  4HAE A;  4JBJ A;  1IBK Q;  1GUS A;  4BY7 B;  3VR2 A;  1X9N A;  1BQQ T;  1II3 A;  2E2H H;  4DR2 L;  1SYE A;  2Z6K C;  4DAY A;  2KCC A;  3OWF A;  1M1K C;  1EY7 A;  2DJG C;  3JAM E;  1I4G A;  2E5L Q;  1UEA B;  1DD2 A;  3E5S A;  1EIY B;  2PQE A;  1QVF A;  1TT2 A;  1E7Z A;  1U0L A;  1YNN C;  2EIF A;  4C3I H;  3H6M A;  1PH3 A;  5EPK A;  4DPG A;  2F0W A;  2A74 C;  5AJ3 Q;  2UXB Q;  2KVM A;  3RUZ A;  5COY A;  4OX9 Q;  4IUN A;  5EAY A;  4QL5 A;  3ERS X;  3VR6 A;  4BA2 I;  2RCN A;  2B3G A;  1Q86 C;  1L0W A;  4A3E H;  1IYJ B;  4O42 A;  3RN5 A;  4X66 L;  3KUP A;  4Y52 H;  3PUW A;  5GAH C;  1HA6 A;  2L9H A;  5HY6 A;  3RZO H;  2HCC A;  3HFZ B;  1KDB A;  4BBS G;  2K5Q A;  4QIW E;  1A6X A;  1EOV A;  4F87 A;  3K7U C;  2WP8 J;  1LUZ A;  2KCN A;  1WTH A;  2WII B;  2EYO A;  4A3E G;  1PH1 A;  2C9O A;  2BH8 A;  1EY4 A;  3TRZ A;  3M3Y B;  1EEI D;  2K32 A;  4XIG S;  1YZ6 A;  1QNK A;  4A3I B;  1XMQ L;  3PSI A;  4B3M L;  1ML0 D;  4B08 A;  3DLL A;  4B3T Q;  2MP1 A;  3S15 H;  3CP0 A;  1JR0 D;  3TEH B;  3BU2 A;  3MC0 B;  3SK4 A;  1ASY A;  2OEO A;  5KND A;  4GLV B;  1TVX A;  4M8A A;  2CWP A;  5TSS A;  5GAE C;  2E75 C;  3NWS A;  2YTV A;  3CME A;  4ZYS A;  3IKJ A;  3CW2 C;  2FMM A;  1NNX A;  1YJ9 A;  2EYH A;  3UE1 A;  5D3D A;  5M9O A;  1BBU A;  1ZYR C;  4GN5 A;  2AUK A;  3KBG A;  5NUC A;  1PFM A;  2IPK D;  3CU7 A;  4P2C B;  2IX0 A;  1SMY D;  3K5M A;  3RZD B;  4A93 H;  3RLF A;  3S17 H;  4IFD J;  4GZY C;  1Y8P B;  3JAM c;  2IT1 A;  5E3F A;  1R4Q B;  1Y1V B;  1J9O A;  3HP3 A;  4IUU A;  3H0G B;  5CMD A;  1ICF B;  3UDI A;  1IW7 D;  4RWS C;  5JEA G;  2XN9 C;  4B3S L;  2CQO A;  4GN3 B;  3PO3 H;  3CC2 A;  4P74 A;  5LHY 1;  3CKI B;  2BA1 A;  4DV2 Q;  2YV5 A;  5C44 H;  1OTC A;  4A93 G;  1A2T A;  3PF4 A;  2M2L A;  4K8J A;  3K7A H;  1WTQ A;  1X54 A;  1PRT D;  4KMU C;  4GKJ Q;  4B3R Q;  2AQ3 B;  1NMG A;  4KHV A;  1VQ6 A;  2NB0 A;  4OO1 H;  1SEB D;  1WYD A;  2EYP A;  2MGS A;  3HOV H;  2ZXR A;  5I9O A;  5D65 A;  5C44 G;  2PYK A;  4Q0F A;  5M5W B;  2DJF C;  4RH6 A;  2OTJ A;  2JA6 B;  4XQN A;  1EIG A;  3S1M B;  3BYT B;  2R93 B;  1JWM D;  2A69 D;  4ZAI A;  5A2Q L;  4UP7 A;  4JC0 A;  3RR5 A;  2IWH A;  4NKL A;  2JK8 A;  4MN3 A;  2AWO A;  4OON A;  2G9H D;  5M3F G;  3F2D A;  1I3Q H;  4A3K B;  3STB C;  3HOV G;  1GUW A;  3QB3 A;  1X55 A;  3M4Q A;  1ILP A;  4DN4 M;  2G5D A;  1S72 A;  4X3T A;  3K80 C;  1JT8 A;  2FXQ A;  5C0X G;  3R8B A;  2R7D A;  4JBK A;  4YIJ A;  1AZP A;  2K04 A;  4FYD A;  4JVZ A;  1QUQ A;  4NW2 A;  2L5T A;  3EA6 A;  4K5W A;  5IY0 A;  4CHT B;  4HIK A;  1G6P A;  1PFS A;  2B2V C;  2XWB B;  3OMG A;  2JA5 H;  2A5H A;  1BXT A;  3U58 A;  4BXX H;  1EFI D;  4HIM A;  2HDL A;  3SGI A;  1BCP D;  2BDO A;  3CD6 A;  3GP7 A;  1TWA B;  4KV6 A;  4DV3 Q;  5GAG C;  1JIC A;  2IJ0 A;  3EVQ A;  5CBA E;  3TZD A;  4DA2 A;  5IOC A;  4BY1 G;  1SNC A;  3K5O A;  4IOA A;  1EZ6 A;  4DV7 Q;  4PNY A;  2JA5 G;  3H3V C;  4A3B H;  3MXG A;  3TP6 A;  3T1H Q;  3S2D H;  4BXX G;  3GTO H;  1Q46 A;  4XYQ A;  2O5J C;  1A2U A;  5M5X H;  2E8G A;  3BDC A;  1C0A A;  3TP8 A;  2EQS A;  4TKO B;  3VA7 A;  2IHE A;  3KK7 A;  1HZB A;  2X69 A;  1GUO A;  4L5S A;  2XRQ D;  3HGB A;  5KNC A;  3J7A 5;  3C2P A;  4MZ9 A;  5COR A;  3HKZ G;  2KEC A;  1GKH A;  1M4V A;  1SRU A;  2WKD A;  4FP5 D;  1I50 B;  1S5C D;  1KDC A;  1AE3 A;  1B7Y B;  1HCZ A;  1PZJ D;  3S2H B;  2QCP X;  3SK6 A;  1IBL L;  2ENB A;  1SE8 A;  1IL2 A;  3A7L A;  4C3H H;  5LMU Q;  4DR4 Q;  3NE5 B;  5IE8 A;  3NTK A;  1TU2 B;  1EY6 A;  4QCL A;  1EQR A;  3KLW A;  5C4Z A;  3GTL H;  4ZKC B;  4JI1 Q;  1QCB D;  1SBB B;  4A3J H;  2ALY B;  5JEA J;  4C1N I;  4LF8 Q;  2Z0S A;  1CKO A;  3G6J B;  1LLR D;  4A3C G;  5FOB B;  3GV3 A;  1WCM H;  1XX8 A;  2K52 A;  4UP9 A;  1EQT A;  5EBC A;  3GTJ H;  3KFU A;  1EYA A;  1WD0 A;  1EU3 A;  2KHJ A;  3L9A X;  1IBM Q;  4DAY B;  1HQR D;  5ELB A;  1GXD C;  2XRS D;  5HGT A;  3LWU A;  3A5Z B;  1HNZ L;  4DR3 L;  1KNE A;  3V2T A;  4DR6 Q;  4LFB Q;  4JI3 L;  2Z8L A;  3WWV A;  1WCM G;  1RCV D;  3QR8 A;  2E2J B;  1PH5 A;  3G71 A;  2JA7 G;  4K14 A;  4X3K A;  2PI2 E;  2UXD L;  3EN2 A;  4K2L A;  4WJW A;  4FO2 A;  3OOC A;  2NVY H;  3NBH A;  1U4L A;  3S9W A;  5JAV A;  1XMO Q;  2VB3 X;  2O2L D;  3S1N B;  3CCU A;  1R4P B;  5EPJ A;  1ET6 A;  2DN8 A;  1W6K A;  3OW2 A;  4DR5 Q;  2N49 A;  4DR1 L;  2KJX A;  1X3P A;  1D7Q A;  1ZKO A;  5C0X J;  5C4H A;  4X64 L;  5FO8 B;  1GM5 A;  2G9D A;  4LF9 L;  4C3J G;  1EYC A;  3LGJ A;  4KY6 A;  1B3A A;  2K28 A;  1I6H H;  2PO4 A;  4LF6 Q;  4OIK A;  5FLM G;  1KHI A;  1I4P A;  1Q90 A;  3RD4 A;  4GNX C;  4UAI A;  1SYF A;  3I4M H;  1TWH B;  4RMF A;  4YY3 L;  1K73 C;  4K5X A;  4L5R C;  3T1Y Q;  1PRT B;  3E3X A;  3PUV A;  1K28 A;  3PUY A;  1E2Z A;  1NE3 A;  3UDF A;  4G7O C;  3S1R H;  5I2Y A;  5C5L A;  1K83 H;  1TR5 A;  4BA1 I;  4UHV A;  4ABN A;  5KIX A;  1O80 A;  3CCS A;  2K4K A;  2Q2I A;  2L4N A;  1N8R C;  5JPN C;  1LV9 A;  5J39 A;  3CCQ A;  2WAC A;  1BO0 A;  1ESF A;  1I4X A;  5IOD A;  1CZW A;  1IKL A;  4NXN L;  3CCJ A;  4KN4 C;  3S24 A;  1B44 D;  3DXJ C;  4CJ1 B;  3S14 H;  1F2M A;  1WTW A;  1EY9 A;  1MBY A;  1D5X C;  4JI2 Q;  2ICI A;  1HH2 P;  2HIX A;  1CKN A;  3CC4 A;  3UI2 A;  2NN6 H;  4IPC A;  1B2T A;  1TXY A;  3ONA B;  1E0B A;  5FJ8 G;  2F1M A;  1IYV A;  1VQB A;  1J5E L;  4BWG B;  1BBW A;  4LF5 L;  5IGG A;  3E9H A;  4F88 A;  2EYF A;  3C1E A;  3I4O A;  4X3U A;  1BCP B;  4PMC A;  4L5T A;  1PYW D;  4U68 A;  2A6H C;  2B63 H;  3M4P A;  2CWA A;  4Z9C B;  1VQA A;  1VQM A;  2NZO A;  2RVL A;  4HJ8 A;  3QJY A;  4KKU A;  3FPU B;  3T4A C;  2K5V A;  2L15 A;  5EKK A;  2EY1 A;  2UU9 Q;  4JYA L;  5C3E H;  2B63 G;  1K0S A;  3ZJY C;  3MEF A;  2K1B A;  5M3M G;  3BVG A;  1BNZ A;  3HOU H;  3IFD A;  2JA8 H;  2SNS A;  2D2C C;  3HOZ B;  3HG9 A;  4ME5 A;  3E6Z X;  3CCL A;  1YHB A;  2F0N A;  2K50 A;  1STB A;  2OCE A;  2RCF A;  2QDL A;  4JK1 C;  2EE1 A;  3OSO A;  1YNN D;  1EOT A;  4KJN A;  1SYB A;  5C4J H;  2NVX H;  1MSG A;  1WFQ A;  4JG2 A;  2F0D A;  1QUQ B;  3HOU G;  1LYL A;  1SE4 A;  1Y8N B;  2PNR C;  2JA8 G;  3UDX A;  3TS2 A;  2E2I H;  3NEM A;  5M5Y H;  2Z9H A;  2Q8I B;  5IGF A;  1W2B A;  3A5U A;  2F0J A;  1E2W A;  4NB3 A;  4DK3 C;  4LNQ A;  1MIU A;  2FIN B;  3D6W A;  2B2U A;  4KKS A;  1WTR A;  1VQ7 A;  1G6Z A;  5K36 G;  1SRO A;  2GVA A;  2F3V A;  2E76 C;  4XT1 B;  4PG3 A;  1HQM C;  3M4O B;  1OXU A;  4DV6 Q;  1MGS A;  4ILW A;  1AW7 A;  1I94 L;  1N32 L;  2I07 B;  3HKS A;  2D0O A;  4Y7N H;  3OTO Q;  1A15 A;  1X3G A;  4EQN A;  1TWC H;  4EVO A;  2IX3 A;  2Z4H A;  1Q7Y C;  4IQZ A;  3GTG H;  1LTG D;  1J6Q A;  1PZK D;  2VQF Q;  1AP0 A;  1YNJ C;  1QZH A;  1LT5 D;  1H9S B;  3CCV A;  2L1B A;  3DHQ A;  1SJE D;  5FKA C;  1KD1 C;  3K57 A;  1Q1B A;  3DEO A;  2NVQ H;  4KHP L;  5EBD A;  3KDF A;  2DNC A;  1LO5 D;  1BR9 A;  1RD9 D;  4A3M B;  2VUM H;  4OWX B;  2F4V Q;  2HHH L;  3OHX C;  2WKC A;  2K01 A;  5IGD A;  4R1J A;  1NY4 A;  2LY7 A;  2B29 A;  2PQA A;  1TS5 A;  1ZYR D;  1X65 A;  4HJ7 A;  1JOO A;  4RHR A;  1LTL A;  4ALP A;  1J8I A;  3KBX A;  3RN2 A;  1WTO A;  1KNA A;  2VUM G;  4KTA A;  4HJA A;  2WAQ B;  1TWG H;  2BA0 A;  3TQY A;  2Q2T A;  1QVC A;  1C9O A;  2D0P A;  5ELO A;  2B2V A;  3K6O A;  1FGU A;  3T53 B;  2GN5 A;  2R61 A;  5L37 A;  2NTT A;  1IYU A;  1VMP A;  4GLA C;  1HPC A;  4QJF A;  4R9W A;  3QOL A;  4IOC A;  3MAQ A;  4HMJ A;  1TWF B;  3DWQ A;  2F0Q A;  2JQO A;  4HSV A;  1Y8O B;  2N3S A;  3F1Z A;  5A35 A;  4R8N A;  2K5N A;  4JI4 Q;  3NBH B;  3BVM A;  1SFO B;  1W6J A;  1QVG A;  3LNN A;  1HUN A;  1CZG A;  1C4Q A;  5AFW A;  1STA A;  1G51 A;  1D1I A;  5IT9 L;  4IUR A;  3BZK A;  1JJC B;  1U4M A;  4BBR H;  1Q1E A;  3J80 i;  4RKB A;  1DM0 B;  3S16 B;  4JI8 Q;  1CI3 M;  2EOT A;  4CBV A;  4P75 A;  3TRE A;  4CDE C;  3STB D;  3I56 A;  3Q22 A;  1B9N A;  5KNB A;  2HQL A;  3SR1 A;  4DAM A;  2XVS A;  5EPL A;  1HZ9 A;  1VQH A;  3J7Z C;  3KLS X;  5CV8 A;  4J6H A;  1VQI A;  5H1S E;  2OXP A;  4APV A;  1M8A A;  2IW3 A;  1BVS A;  1U9R A;  2CFM A;  3NPP A;  3OIQ A;  3R2I A;  2BDN A;  1I5F A;  1LM0 A;  4BBS B;  3PIP 3;  4KJO A;  4A3L H;  4YWM A;  4DXG A;  1RIP A;  3URY A;  4QGU A;  3CPW A;  3PO2 B;  2H5X A;  3GTQ B;  1TY0 A;  4DUZ L;  1KTK A;  1F9R A;  1CQV A;  2Z1C A;  4FVM A;  2M00 A;  3S1Q H;  4FXK C;  1HZC A;  2UUA Q;  2NZ1 D;  1FNU A;  1PH4 A;  2UUC Q;  2IX1 A;  1XNQ Q;  4DUY L;  1CKM A;  4KD4 A;  3T16 A;  1G2T A;  1VQN A;  1Y1W H;  2PZU A;  3C3L A;  2B2W C;  2L12 A;  4R4I A;  1CM9 A;  4A3D H;  4C3I G;  1NBW A;  1CKN B;  2OWO A;  4BY7 H;  1RF2 D;  5CV5 A;  4FXD A;  1JOR A;  5C4X B;  1P8L A;  2XNA C;  4LUZ A;  3VYU A;  3RMH A;  2YU9 B;  1JJG A;  5I6Y A;  4A4I A;  3TP7 A;  1RJT A;  3OPO A;  3TN2 A;  3NUC A;  3A74 A;  2NTS A;  4NDX A;  2IY5 B;  1Y1W G;  4JCV E;  2SEB D;  2E2D C;  4JI0 Q;  1DOK A;  3AB9 A;  1NMF A;  1PYB A;  1ROD A;  4GKK L;  1HNW Q;  1MJE A;  4BY7 G;  1XNR L;  1RHP A;  2FFK B;  1NR2 A;  4ZK9 B;  4RGO S;  1OXT A;  1Q8K A;  2YYZ A;  2ZJQ A;  3DM1 A;  1S5B D;  1TS2 A;  4IUT A;  1T5X D;  1N34 Q;  1CFM A;  1Y14 B;  1LT6 D;  1DYQ A;  4RG1 A;  2RDF A;  4QB4 A;  4I65 A;  5KRU A;  2EXZ A;  1U4R A;  3AU7 A;  5DEH A;  1HNZ Q;  1N9W A;  3ULJ A;  3KJO A;  1EYG A;  2AWN A;  4KKT A;  2F0F A;  3K81 C;  1A8V A;  1E3P A;  1RDP D;  3IFT A;  4JI6 Q;  2NUC A;  1LTB D;  3M3Y H;  1NR4 A;  1YI2 A;  2F0P A;  4X62 Q;  4A3I H;  5M3F B;  4JV5 L;  2KQ3 A;  1B4O A;  1KDA A;  3EJI A;  2Z6B A;  2R7F A;  1PV4 A;  2CW0 C;  1DGS A;  1LT4 D;  2I5M X;  4XDX A;  4DR1 Q;  5EQ0 A;  1VQF A;  4IJL A;  1FVI A;  1C7Y A;  2F0H A;  1STH A;  2X6L A;  1B53 A;  4X64 Q;  5IWA Q;  3NEN A;  5J1Z A;  4DV4 Q;  2F4I A;  1AFP A;  2QEJ C;  4IFD I;  1KAA A;  4LF7 Q;  2R6G A;  3HOY B;  4A3I G;  3PO3 G;  4KD3 A;  2UXC Q;  1Z47 A;  2F3W A;  3AFQ A;  4R4T A;  3PV0 A;  5J22 A;  1EY8 A;  3KF6 A;  4K6D A;  4A3G B;  3RZD H;  4JI5 Q;  1LTR D;  3I4N B;  4BY1 B;  2UUB L;  4RGT A;  1Y1V H;  1A3U A;  3H0G H;  3BDO A;  3PGZ A;  2XWJ B;  3P20 A;  1SE2 A;  4OO1 G;  2TSS A;  4DV1 L;  3F8T A;  3T13 A;  1Z7T A;  4AQY L;  3D4D A;  3AQQ A;  3MXN B;  4LUO A;  2A1A A;  3KDF B;  4ZUJ A;  1SNM A;  1B50 A;  1NTG A;  4IUV A;  4ZKB B;  2ZTD A;  3VA5 A;  4LK1 C;  3H0G G;  4GN4 B;  4XYO A;  3GTK B;  3HKZ B;  5JOB A;  1QIL A;  3GTP B;  2K33 A;  3EBE A;  2PQA B;  5KEE A;  3KYH C;  4YHH L;  1V1O A;  4QF4 A;  4O2D A;  1W3S A;  2EY6 A;  2A68 D;  3CMA A;  1YVC A;  3CCE A;  5LMN L;  4JOI A;  5K5P A;  5JJI A;  2EY2 A;  3U4V A;  4K0K Q;  4HJ5 A;  2A8V A;  2JA6 H;  2OQK A;  3S1M H;  3X3N A;  1IBK L;  2R93 H;  3FEW X;  4RKL A;  1VQ5 A;  2JXM B;  1VQJ A;  1D2B A;  2L55 A;  2K05 A;  3V05 A;  5DLQ E;  2Y0S B;  2CHB D;  1YNX A;  4A3K H;  1D5M C;  2PW7 A;  2RBM A;  1YHA A;  2E5L L;  4AYB B;  2LMC B;  3QG1 A;  4OIJ A;  2ZJR A;  1C8C A;  4FF3 A;  1UE1 A;  2JA6 G;  2DGY A;  2A6H D;  5CGK A;  1H9S A;  2EYM A;  4FF2 A;  3V96 A;  3I70 A;  4A3F B;  4J1M A;  2AKW B;  4A3B G;  2K75 A;  2WAQ E;  2QKI C;  4F8M A;  2UXB L;  1EQV A;  2EY5 A;  3TP5 A;  1H9J A;  3CC7 A;  4HJ9 A;  3Q24 A;  4LAA A;  1PTO D;  3W1B A;  4OX9 L;  2NVT B;  1K8O A;  3IRB A;  1XTD A;  1ESR A;  4PZ7 A;  2SNM A;  4DK0 A;  2VL6 A;  1WI5 A;  2B2T C;  1TWA H;  2HD3 A;  4DV5 Q;  2JA7 B;  4YCW A;  1CT1 D;  3J81 j;  2NBF A;  3H09 A;  2WB1 E;  3SXH A;  4X65 Q;  4P71 A;  2KCT A;  1EL0 A;  3PIO 3;  2KBN A;  2VB2 X;  1RTN A;  2VY3 A;  4UP8 A;  3D8G A;  4HED A;  4IJH A;  1YIT A;  1EEF D;  2TMP A;  5IYC H;  1EY0 A;  1SDF A;  3TME A;  4C3H G;  5IT9 c;  4QQB X;  3BVZ A;  5J3B A;  4HID A;  3CPF A;  4L63 B;  4C3J B;  1KIX A;  3J81 i;  3P7J A;  3DMU A;  1XYI A;  3PF5 A;  5JJK A;  4A3J G;  2N8N A;  5GQO A;  4B3T L;  5CV7 A;  3E0E A;  5C3X A;  1I50 H;  1ILQ A;  1V9P A;  1Q3L A;  4HSP A;  4DNI A;  5IYC G;  4NPS A;  3IAY A;  4DK1 A;  3S2H H;  2F03 A;  2ZM6 L;  1STY A;  1Y69 U;  2VQE Q;  1PLF A;  3J81 L;  4AH6 A;  1XJV A;  2F0O A;  1LT3 D;  4U67 3;  1SMY C;  1DON A;  1FD7 D;  3RNU A;  2XTI A;  2ZTE A;  4PQX A;  2CQA A;  5FLX L;  4CDF C;  3LX0 A;  2O5I C;  3BG3 A;  1STG A;  3K0Y A;  1XPR A;  1M90 C;  4B9X A;  1UNS A;  3A8I E;  5GAD C;  1X3Q A;  4JI7 Q;  2LXJ A;  3QO2 A;  1N36 Q;  3A7A B;  4MNO A;  2EPB A;  3R3O A;  1H95 A;  5BR8 Q;  1QWY A;  1QOH A;  4EQP A;  3CQZ B;  3C46 A;  1JB7 A;  4DV2 L;  1CA5 A;  4CJ2 C;  2E2J H;  1VF5 C;  4OXP A;  1UUP A;  5ELF A;  1S3O A;  3CRK C;  3I3C A;  4B9W A;  5EKL A;  4DV0 Q;  1AEX A;  4B3R L;  5C0X I;  3DWP A;  1E1O A;  5A2Q E;  4QUC A;  3S1N H;  2A73 B;  1A3V A;  2PZW A;  2MFI A;  4PZ6 A;  4GNX B;  3I4M G;  4M1U B;  1UEB A;  1YBY A;  2Z6K A;  3OMC A;  1VQD A;  1MD2 D;  2K6A A;  1KAW A;  4LFA Q;  1OXX K;  3DUZ A;  2ZT9 C;  4DK6 C;  4RCO A;  1BUV T;  4LFC Q;  1SNP A;  4PZ8 A;  1X6O A;  4FDB A;  1UE5 A;  5M3M B;  4KI0 A;  4H0L C;  1CHQ D;  2D62 A;  4ZQ3 A;  1HNX Q;  3AMU A;  1SNO A;  4GOP C;  3A0J A;  4FF1 A;  1TWH H;  1I4H A;  1XPU A;  1KLU D;  1VQK A;  2F0M A;  3AEV A;  1PH9 A;  1CQF A;  5EGT A;  2JJQ A;  5IGC A;  3CHB D;  1VDZ A;  2NN6 G;  4MTN A;  3AYH B;  3NP8 A;  2HDM A;  2QEX A;  2O4X A;  4DV3 L;  2R7Z B;  4ZCK A;  2DUD A;  4LF4 Q;  2VZA A;  4DF7 A;  3Q8D A;  5FO7 B;  4MIU A;  2VS1 A;  1CUK A;  3D4R A;  3K5N A;  2QF7 A;  1JOK A;  5I6W A;  4DV7 L;  4HIO A;  2VNU D;  1GUT A;  2HIV A;  3T1H L;  3UE0 A;  3KF6 B;  2LS0 1;  1MKH A;  5LL6 X;  2EDG A;  4DR2 Q;  3W5O A;  3H94 A;  1ZXT A;  2K5D A;  3GTM B;  4NP5 A;  1CA6 A;  1XPO A;  1QB5 D;  3F2U A;  1G2S A;  2LXK A;  3GD7 A;  2A19 A;  4OWW B;  3NQT A;  5G3L F;  2H4O A;  1Z6H A;  1IZ6 A;  3FP9 A;  1AN8 A;  4J15 A;  1F9Q A;  1PTO B;  3R93 A;  3WOE A;  1VCI A;  1VQC A;  1QE6 A;  3NTH A;  4OGQ C;  2J0T D;  5EJW A;  4CKC A;  2ASB A;  5ISR A;  4IO9 A;  4ME3 A;  4I7A A;  3WOF A;  1FJG L;  5C3E G;  4FXG C;  5CBE E;  2K5W A; 
#chains in the Genus database with same CATH homology
 3PMF A;  2R3Z A;  3PUX A;  2RKS A;  5CR3 A;  2VXW A;  1NSN S;  3FMC A;  1SE3 A;  2EJG C;  1JB3 A;  3ZYY X;  1OXV A;  2R92 B;  3I91 A;  3OIP A;  3MFY A;  5CV4 A;  3X3M A;  1C48 A;  1SXT A;  3EQL C;  5KYL A;  1A3T A;  3HOX B;  3N52 A;  2N88 A;  1O7Z A;  4N9T A;  3MXU A;  3EFX D;  4H44 C;  1F2Z A;  1EY5 A;  3MXN A;  2BE5 C;  3P75 A;  3N6R A;  1O78 A;  4E6I A;  3NWT A;  2J4X A;  1L0Y B;  4G4K A;  1CHP D;  2B2Y C;  4DNT B;  3ERQ A;  4X3S A;  1JWS D;  4C1N K;  5ELC A;  4C2M B;  2DY7 A;  3HOW B;  2WIN B;  3HRZ C;  1IL8 A;  1U4P A;  2QDB A;  1H9R A;  1K8M A;  2MPM A;  1OXS C;  2SOB A;  1GHJ A;  4KY7 A;  3OWE B;  1FNV A;  1STN A;  2HQE A;  2HUG A;  2CW0 D;  3FPP A;  4RA8 A;  3CRL C;  3I8Z A;  4K2K A;  1R9T B;  1D6E C;  1QNU A;  4IAL A;  2F0E A;  4ULL A;  4IFD H;  4HMI A;  1PFN A;  1DZ1 A;  2PMZ B;  5F2D A;  3QWN A;  4H13 C;  5C6A A;  2LFN A;  3E0J A;  1IHZ A;  1SYD A;  2E2H B;  5C3W A;  3SVM A;  3FVQ A;  1HRJ A;  3C1F A;  2F0S A;  2JP1 A;  3ND9 A;  1PZI D;  2RDH A;  1LTA D;  1PXU A;  4IFD G;  5E4W C;  4LMQ D;  4C3I B;  3SEB A;  1WTX A;  4RAU C;  1SND A;  1EWH A;  3MZ5 A;  4MHE A;  3MA2 B;  3J80 L;  3BZD B;  5T1G A;  1ONL A;  1X32 A;  4A3E B;  1FNW A;  1ET9 A;  4KN7 C;  1SAP A;  3MEH A;  2KUM A;  4DAP A;  2B39 A;  4TQU S;  3HZX A;  2RQX A;  3TZU A;  3RZO B;  1L0X B;  4C56 C;  1JC7 A;  4L6T B;  4V19 0;  3I72 A;  1D1K A;  2L0C A;  4UDU C;  1DJR D;  3S15 B;  4V0B A;  3A55 A;  1I4Q A;  4K6L A;  2M9V A;  3R2T A;  2FMC A;  1D5Z C;  1LTT D;  3VR3 A;  1JOQ A;  3ERO A;  4DAV A;  5LL6 S;  1T5E A;  3D4W A;  4RCN A;  1BF4 A;  2F0U A;  3D3R A;  4RGN A;  3K5L A;  3KF8 A;  3ITP A;  4ZUI A;  2EYL A;  3A8J E;  4A93 B;  3S17 B;  1WVL A;  4XQQ A;  3VYR A;  3W2D A;  2Q8T A;  2V4D A;  5C5M A;  3NXW A;  3PO3 B;  1SSO A;  4KK7 A;  5C44 B;  3OW7 A;  3K7A B;  2WV6 D;  4IUP A;  1RTO A;  1ENC A;  2JE6 I;  3QIA A;  5CYU A;  2EJM A;  2ID0 A;  1BBX C;  2KOL A;  4DU9 A;  5JEA H;  3HOV B;  2B2U C;  1KLG D;  3G7L A;  4WOR A;  1CK1 A;  3TSS A;  5BN5 A;  5JJZ A;  3ND8 A;  2EVB A;  2PW5 A;  1I3Q B;  2X6G A;  1NCV A;  1MSH A;  1GUG A;  4DGZ A;  1RKN A;  1I4R A;  3LWE A;  5JVG 3;  2JA5 B;  3DWA A;  3T51 B;  2JSO A;  4BS9 A;  2A6E C;  3A56 A;  1JE4 A;  5IT9 E;  1F2Y A;  2J7Z A;  5BN3 A;  5C0X H;  2JEB I;  1EIH A;  2KHS A;  3GO5 A;  4IN3 A;  1LTS D;  4A3B B;  2AQ1 B;  3S2D B;  3GTO B;  1H9M A;  4XTC S;  5M5X B;  5CV6 A;  1S4Z A;  4JBW A;  3J80 E;  3D31 A;  1I6V C;  1XTC D;  2F0V A;  4ODG A;  1F2L A;  4EQO A;  1G8Z D;  3J7A F;  4OHJ A;  1Q8I A;  3NHH A;  1PRT F;  4HTH A;  3SDZ A;  2RSN A;  4C3H B;  1JWU D;  1ICW A;  5DM6 3;  3Q23 A;  1ENF A;  3MFG A;  3GTL B;  3DEP A;  3I90 A;  4K5V A;  4A3J B;  2L11 A;  4QUF A;  5DNF A;  3NTI A;  2B8F A;  1TII D;  1WCM B;  1BOS A;  5CV9 A;  3MHB A;  3GTJ B;  2N55 A;  4PV1 C;  2F0I A;  4KY5 A;  5FK9 C;  2SDF A;  3BS1 A;  4RFB A;  3J7Y W;  3SK8 A;  2FHT A;  2ICE C;  1S5D D;  4DXF A;  3Q0A A;  2B2Y A;  3A54 A;  5JPM C;  1BCP F;  1EYD A;  1SYC A;  1TS3 A;  1V1P A;  2NVY B;  1JCK B;  1V43 A;  3T56 B;  3VYS A;  1CTM A;  4G57 A;  2HCI A;  4FF4 A;  2AUJ D;  4G7Z C;  3NQI A;  2MUY A;  4CJ0 B;  4PMB A;  1EWC A;  1I6H B;  4HR7 B;  3P1H A;  5KYI A;  2DNE A;  2C5C A;  3U9S A;  3QOJ A;  3HS0 C;  3MXP A;  1NUC A;  2H1E A;  2JYO A;  1FGB D;  1PTO F;  1GUN A;  3I4M B;  1YNJ D;  4HCS A;  3MVV A;  1MI2 A;  2GA4 B;  1IW7 C;  2KEE A;  3WDN A;  1JQY D;  1TS4 A;  5JVH 3;  3S1R B;  1K83 B;  2BE5 D;  1OO9 B;  1GHK A;  5D14 A;  4OO1 I;  1LAC A;  2MHV A;  1BDO A;  4CGY B;  3O13 A;  1PRT C;  5IGE A;  1NAP A;  4J8Q A;  1DOM A;  4CKE A;  3S14 B;  3NSW A;  3D6C A;  1Q12 A;  3M7N A;  3L3O C;  1DCZ A;  4RGM A;  2CVR A;  1PMR A;  1LTI D;  2ZXO A;  2A69 C;  5EKI A;  4ZLT F;  3J7A V;  3U9O A;  3KLR A;  3MTS A;  2RSO A;  2JEA I;  2NYZ D;  2I46 A;  3A8K E;  1TKW B;  2B63 B;  5IGB A;  5G3L D;  2D9U A;  4QIW B;  1VMC A;  1UAP A;  1E2V A;  4OL7 A;  2B8G A;  4H7B A;  3I73 A;  3I4L A;  3VR4 A;  2DY8 A;  1BCP C;  2B2W A;  2A68 C;  4XT3 B;  5T1I A;  2KA7 A;  2EJF C;  5C3E B;  3K59 A;  3HOU B;  2JA8 B;  3GQB A;  1EZ8 A;  3HEJ A;  4DFA A;  2QIL A;  4TSS A;  4IUQ A;  3H91 A;  4XQJ A;  1HXY D;  5C4J B;  1WTP A;  1GOZ A;  2NVX B;  2PCF B;  2E2I B;  3PUZ A;  5M5Y B;  1DXM A;  1WD1 A;  1PDQ A;  1IKM A;  1PTO C;  1B9M A;  4NMZ A;  1KAB A;  4IZ8 A;  3K58 A;  2ZXP A;  5E4X A;  3JAM L;  2RA4 A;  1XWE A;  3VYT A;  1HTL D;  2AQ2 B;  3NBI A;  4HCE A;  5E1F A;  2Z4I A;  4L8J A;  1FR3 A;  1F77 A;  1HFG A;  1O7Y A;  1SNQ A;  3FRP B;  4Y7N B;  5FO9 B;  1TWC B;  2F0K A;  3GTG B;  5K36 H;  4RHS A;  2BOS A;  4WFN 3;  4I7Z C;  2OT2 A;  4CKB A;  1QJO A;  2XIW A;  1WTV A;  1EU4 A;  3FKI B;  2NVQ B;  5CC4 A;  1XXG A;  4EGV A;  1F9P A;  2VUM B;  1PTO H;  4Q5V A;  1HA5 A;  3J81 E;  1SJH D;  1H9K A;  3IL8 A;  5IIF A;  2BCO A;  3Q6S A;  1STE A;  2OF1 A;  4DNR B;  1HHV A;  1FYC A;  3FDT A;  2XSC A;  5DM7 3;  3KLS A;  5FLX E;  3GV6 A;  4ID6 A;  4QMG A;  1TQO A;  1HUM A;  1TWG B;  1S5F D;  4XXE A;  3M7G A;  1V8Q A;  2K03 A;  1HTP A;  4S3S A;  1G29 1;  5KGU A;  2NWG A;  4KHZ A;  4O1N A;  2E74 C;  2D5D A;  3W3A A;  4F7X A;  1HFN A;  2IL8 A;  1SYG A;  3SK5 A;  1G91 A;  1ENA A;  1ZEQ X;  1V1P B;  5ELE A;  3L7Z C;  5BN4 A;  1PFB A;  1B1Z A;  4K8I A;  5D3I B;  1O7L A;  4ZRZ A;  4BBR B;  2MJ8 A;  3TBI B;  1TY2 A;  2F0L A;  4HN7 A;  3MWY W;  1S5E D;  2KED A;  1DOL A;  5DAU A;  2K7V A;  3VR5 A;  2NN6 I;  2EYJ A;  5I9P A;  1GJX A;  2WB1 B;  2EZV A;  3TDQ A;  1LAB A;  4G7H C;  1F9S A;  2F0G A;  3BYY B;  3SHL A;  2A6E D;  2LKV A;  2RDG A;  4FNF A;  3SE0 A;  5ELD A;  4PMW A;  4R8I A;  1VF7 A;  2FJ2 A;  4TRD A;  2PZT A;  5I2X A;  3S1Q B;  2B2T A;  2Q8R E;  3BDL A;  2PPB C;  3NK9 A;  4LJZ C;  5I4D A;  2F0T A;  5HUR A;  4N9P A;  1QG7 A;  1Y1W B;  1AZQ A;  3M85 A;  3M4Y A;  4A3D B;  4WRD A;  4HAE A;  1GUS A;  4BY7 B;  3VR2 A;  1BQQ T;  1II3 A;  1SYE A;  4DAY A;  2KCC A;  3OWF A;  1EY7 A;  3JAM E;  1I4G A;  1UEA B;  1DD2 A;  3E5S A;  2PQE A;  1TT2 A;  1YNN C;  3H6M A;  5EPK A;  2F0W A;  2A74 C;  2KVM A;  3RUZ A;  5COY A;  4IUN A;  3VR6 A;  4BA2 I;  4O42 A;  3KUP A;  3PUW A;  1HA6 A;  2L9H A;  2HCC A;  1KDB A;  2K5Q A;  1A6X A;  4F87 A;  2WP8 J;  2KCN A;  2WII B;  2EYO A;  2C9O A;  1EY4 A;  3M3Y B;  1EEI D;  2K32 A;  4XIG S;  1QNK A;  4A3I B;  1ML0 D;  4B08 A;  2MP1 A;  1JR0 D;  3MC0 B;  3SK4 A;  2OEO A;  5KND A;  1TVX A;  4M8A A;  5TSS A;  2E75 C;  3NWS A;  4ZYS A;  3IKJ A;  2FMM A;  2EYH A;  5D3D A;  5M9O A;  1ZYR C;  2AUK A;  3KBG A;  5NUC A;  1PFM A;  4P2C B;  2IPK D;  3CU7 A;  2IX0 A;  1SMY D;  3K5M A;  3RZD B;  3RLF A;  4IFD J;  4GZY C;  1Y8P B;  2IT1 A;  5E3F A;  1R4Q B;  1Y1V B;  1J9O A;  3HP3 A;  4IUU A;  3H0G B;  5CMD A;  1IW7 D;  4RWS C;  5JEA G;  2XN9 C;  5LHY 1;  3CKI B;  2BA1 A;  1A2T A;  2M2L A;  4K8J A;  1WTQ A;  1PRT D;  4KMU C;  2AQ3 B;  4KHV A;  2NB0 A;  4OO1 H;  1SEB D;  2EYP A;  2MGS A;  2ZXR A;  5I9O A;  5D65 A;  2PYK A;  4Q0F A;  5M5W B;  4RH6 A;  2JA6 B;  4XQN A;  1EIG A;  3S1M B;  3BYT B;  2R93 B;  1JWM D;  2A69 D;  4ZAI A;  5A2Q L;  2IWH A;  4NKL A;  4MN3 A;  2AWO A;  2G9H D;  4A3K B;  1GUW A;  3QB3 A;  1ILP A;  4DN4 M;  4X3T A;  5C0X G;  3R8B A;  4YIJ A;  1AZP A;  2K04 A;  4FYD A;  4NW2 A;  2L5T A;  3EA6 A;  4K5W A;  4CHT B;  2B2V C;  2XWB B;  3OMG A;  2A5H A;  1BXT A;  1EFI D;  2HDL A;  1BCP D;  2BDO A;  3GP7 A;  1TWA B;  4KV6 A;  1JIC A;  2IJ0 A;  3EVQ A;  5CBA E;  3TZD A;  4DA2 A;  5IOC A;  1SNC A;  3K5O A;  1EZ6 A;  4PNY A;  3H3V C;  3MXG A;  3TP6 A;  4XYQ A;  2O5J C;  1A2U A;  3BDC A;  3TP8 A;  4TKO B;  3VA7 A;  3KK7 A;  2X69 A;  1GUO A;  2XRQ D;  3HGB A;  5KNC A;  3C2P A;  5COR A;  2KEC A;  1M4V A;  2WKD A;  4FP5 D;  1I50 B;  1S5C D;  1KDC A;  1HCZ A;  1PZJ D;  3S2H B;  2QCP X;  3SK6 A;  2ENB A;  3A7L A;  3NE5 B;  3NTK A;  1TU2 B;  1EY6 A;  4QCL A;  5C4Z A;  4ZKC B;  1QCB D;  1SBB B;  5JEA J;  4C1N I;  3G6J B;  1LLR D;  5FOB B;  3GV3 A;  1XX8 A;  1EQT A;  5EBC A;  1EYA A;  1WD0 A;  1EU3 A;  3L9A X;  1HQR D;  5ELB A;  1GXD C;  2XRS D;  5HGT A;  3LWU A;  1KNE A;  3V2T A;  2Z8L A;  1RCV D;  2E2J B;  4K14 A;  4X3K A;  4K2L A;  4WJW A;  4FO2 A;  3OOC A;  3NBH A;  1U4L A;  3S9W A;  5JAV A;  2VB3 X;  2O2L D;  3S1N B;  1R4P B;  5EPJ A;  1ET6 A;  2DN8 A;  1W6K A;  2KJX A;  1X3P A;  1ZKO A;  5C0X J;  5C4H A;  5FO8 B;  2G9D A;  4C3J G;  1EYC A;  4KY6 A;  1B3A A;  2K28 A;  2PO4 A;  4OIK A;  1I4P A;  1Q90 A;  3RD4 A;  4UAI A;  1SYF A;  1TWH B;  4K5X A;  1PRT B;  3PUV A;  3PUY A;  1E2Z A;  4G7O C;  5I2Y A;  5C5L A;  1TR5 A;  4BA1 I;  4ABN A;  5KIX A;  1O80 A;  2L4N A;  5JPN C;  1LV9 A;  5J39 A;  2WAC A;  1BO0 A;  1ESF A;  1I4X A;  5IOD A;  1CZW A;  1IKL A;  4KN4 C;  1B44 D;  3DXJ C;  4CJ1 B;  1F2M A;  1WTW A;  1EY9 A;  1MBY A;  1D5X C;  2ICI A;  3UI2 A;  2NN6 H;  1B2T A;  3ONA B;  1E0B A;  2F1M A;  1IYV A;  4BWG B;  5IGG A;  4F88 A;  2EYF A;  3C1E A;  4X3U A;  1BCP B;  4PMC A;  1PYW D;  4U68 A;  2A6H C;  4Z9C B;  2RVL A;  3QJY A;  4KKU A;  3FPU B;  3T4A C;  5EKK A;  2EY1 A;  2K1B A;  3BVG A;  1BNZ A;  3IFD A;  2SNS A;  2D2C C;  3HOZ B;  3HG9 A;  4ME5 A;  3E6Z X;  2F0N A;  1STB A;  4JK1 C;  2EE1 A;  3OSO A;  1YNN D;  1EOT A;  4KJN A;  1SYB A;  1MSG A;  2F0D A;  1SE4 A;  1Y8N B;  2PNR C;  2Q8I B;  5IGF A;  2F0J A;  1E2W A;  2FIN B;  3D6W A;  2B2U A;  4KKS A;  1WTR A;  1G6Z A;  5K36 G;  2F3V A;  2E76 C;  4XT1 B;  1HQM C;  3M4O B;  1OXU A;  1MGS A;  4ILW A;  1AW7 A;  2I07 B;  1A15 A;  4EQN A;  4EVO A;  2IX3 A;  2Z4H A;  4IQZ A;  1LTG D;  1PZK D;  1AP0 A;  1YNJ C;  1LT5 D;  1H9S B;  2L1B A;  3DHQ A;  1SJE D;  5FKA C;  3K57 A;  1Q1B A;  3DEO A;  5EBD A;  2DNC A;  1LO5 D;  1BR9 A;  1RD9 D;  4A3M B;  3OHX C;  2WKC A;  2K01 A;  5IGD A;  2LY7 A;  1TS5 A;  1ZYR D;  1JOO A;  4RHR A;  1J8I A;  3KBX A;  1WTO A;  1KNA A;  4KTA A;  2WAQ B;  2BA0 A;  2B2V A;  3K6O A;  3T53 B;  2R61 A;  2NTT A;  1IYU A;  1VMP A;  1HPC A;  4R9W A;  3QOL A;  3MAQ A;  4HMJ A;  1TWF B;  3DWQ A;  2F0Q A;  4HSV A;  1Y8O B;  5A35 A;  4R8N A;  3BVM A;  1SFO B;  1W6J A;  3LNN A;  1HUN A;  1CZG A;  1C4Q A;  5AFW A;  1STA A;  1D1I A;  5IT9 L;  4IUR A;  1U4M A;  1Q1E A;  4RKB A;  1DM0 B;  3S16 B;  1CI3 M;  2EOT A;  4CBV A;  3Q22 A;  5KNB A;  1B9N A;  3SR1 A;  2XVS A;  5EPL A;  3KLS X;  5CV8 A;  4J6H A;  2OXP A;  1M8A A;  2IW3 A;  1U9R A;  3NPP A;  3OIQ A;  3R2I A;  2BDN A;  4BBS B;  3PIP 3;  4KJO A;  4DXG A;  3URY A;  3PO2 B;  3GTQ B;  1TY0 A;  1KTK A;  1F9R A;  1CQV A;  2Z1C A;  4FVM A;  2M00 A;  4FXK C;  2NZ1 D;  1FNU A;  2IX1 A;  4KD4 A;  3T16 A;  1G2T A;  2PZU A;  3C3L A;  2B2W C;  2L12 A;  1CM9 A;  4C3I G;  1RF2 D;  5CV5 A;  4FXD A;  1JOR A;  5C4X B;  3VYU A;  2XNA C;  3RMH A;  2YU9 B;  5I6Y A;  3TP7 A;  1RJT A;  3TN2 A;  3OPO A;  3NUC A;  4NDX A;  2NTS A;  2SEB D;  2E2D C;  1DOK A;  3AB9 A;  1ROD A;  1RHP A;  2FFK B;  1NR2 A;  4ZK9 B;  4RGO S;  1OXT A;  2YYZ A;  3DM1 A;  1S5B D;  1TS2 A;  4IUT A;  1T5X D;  1CFM A;  1LT6 D;  1DYQ A;  2RDF A;  4QB4 A;  4I65 A;  5KRU A;  2EXZ A;  1U4R A;  3AU7 A;  5DEH A;  2AWN A;  4KKT A;  2F0F A;  1RDP D;  3IFT A;  2NUC A;  1LTB D;  1NR4 A;  2F0P A;  5M3F B;  2KQ3 A;  1B4O A;  1KDA A;  3EJI A;  2CW0 C;  1LT4 D;  4XDX A;  5EQ0 A;  2F0H A;  1STH A;  2X6L A;  1B53 A;  5J1Z A;  2F4I A;  1AFP A;  2QEJ C;  4IFD I;  1KAA A;  2R6G A;  3HOY B;  4KD3 A;  1Z47 A;  2F3W A;  3PV0 A;  5J22 A;  1EY8 A;  4K6D A;  4A3G B;  1LTR D;  3I4N B;  4BY1 B;  4RGT A;  1A3U A;  3BDO A;  2XWJ B;  3P20 A;  1SE2 A;  4OO1 G;  2TSS A;  3T13 A;  1Z7T A;  3D4D A;  4ZUJ A;  1SNM A;  1B50 A;  4IUV A;  4ZKB B;  3VA5 A;  4LK1 C;  4XYO A;  3GTK B;  3HKZ B;  5JOB A;  1QIL A;  3GTP B;  2K33 A;  5KEE A;  1V1O A;  4QF4 A;  2EY6 A;  2A68 D;  5K5P A;  2EY2 A;  3X3N A;  3FEW X;  4RKL A;  2JXM B;  1D2B A;  2L55 A;  2K05 A;  3V05 A;  2Y0S B;  2CHB D;  1D5M C;  2PW7 A;  2RBM A;  4AYB B;  2LMC B;  3QG1 A;  4OIJ A;  1C8C A;  4FF3 A;  2A6H D;  5CGK A;  1H9S A;  2EYM A;  4FF2 A;  3V96 A;  3I70 A;  4A3F B;  4J1M A;  2QKI C;  4F8M A;  1EQV A;  2EY5 A;  3TP5 A;  1H9J A;  3Q24 A;  4LAA A;  1PTO D;  1K8O A;  2NVT B;  1ESR A;  2SNM A;  4DK0 A;  2B2T C;  2JA7 B;  1CT1 D;  2NBF A;  3H09 A;  3SXH A;  1EL0 A;  3PIO 3;  2VB2 X;  1RTN A;  3D8G A;  4HED A;  1EEF D;  2TMP A;  1EY0 A;  1SDF A;  3TME A;  4C3H G;  3BVZ A;  4C3J B;  4L63 B;  3P7J A;  3DMU A;  1XYI A;  5CV7 A;  5C3X A;  1ILQ A;  1Q3L A;  4HSP A;  3IAY A;  4DK1 A;  2F03 A;  1STY A;  1Y69 U;  1PLF A;  3J81 L;  2F0O A;  1LT3 D;  4U67 3;  1SMY C;  1DON A;  1FD7 D;  4PQX A;  2CQA A;  5FLX L;  3LX0 A;  2O5I C;  3BG3 A;  1STG A;  3K0Y A;  4B9X A;  1UNS A;  3A8I E;  1X3Q A;  3QO2 A;  3A7A B;  2EPB A;  3R3O A;  1QWY A;  1QOH A;  4EQP A;  3CQZ B;  3C46 A;  1CA5 A;  4CJ2 C;  1VF5 C;  1UUP A;  5ELF A;  3CRK C;  3I3C A;  4B9W A;  5EKL A;  1AEX A;  5C0X I;  3DWP A;  5A2Q E;  4QUC A;  2A73 B;  1A3V A;  2PZW A;  4M1U B;  3OMC A;  1MD2 D;  2K6A A;  1OXX K;  3DUZ A;  2ZT9 C;  4RCO A;  1BUV T;  1SNP A;  5M3M B;  4KI0 A;  4H0L C;  1CHQ D;  2D62 A;  4ZQ3 A;  3AMU A;  1SNO A;  4FF1 A;  1I4H A;  1KLU D;  2F0M A;  1CQF A;  5EGT A;  5IGC A;  3CHB D;  1VDZ A;  2NN6 G;  3NP8 A;  2HDM A;  2R7Z B;  2O4X A;  4DF7 A;  5FO7 B;  4MIU A;  3D4R A;  3K5N A;  2QF7 A;  1JOK A;  5I6W A;  2VNU D;  1GUT A;  2LS0 1;  5LL6 X;  2EDG A;  3H94 A;  1ZXT A;  2K5D A;  3GTM B;  4NP5 A;  1CA6 A;  1QB5 D;  3F2U A;  1G2S A;  3GD7 A;  3NQT A;  5G3L F;  2H4O A;  1Z6H A;  1AN8 A;  1F9Q A;  1PTO B;  4CKC A;  3R93 A;  3WOE A;  1VCI A;  3NTH A;  1QE6 A;  4OGQ C;  2J0T D;  5EJW A;  5ISR A;  3WOF A;  4FXG C;  5CBE E;  2K5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...