2NUCA

Staphlococcal nuclease, ethane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nucA00
2F0QA 1EYCA 1A2TA 2EY2A 2EY5A 2EYHA 2OEOA 3OMGA 3MHBA 1SNQA 3LX0A 4ZQ3A 5C5LA 1SYBA 1STBA 3OSOA 3SK4A 1STHA 4J6HA 1KAAA 4KTAA 5DEHA 4RKBA 5KYIA 1KDAA 3ERQA 3QOLA 2M00A 1STYA 4N9PA 1JOKA 2F0EA 4DF7A 4F7XA 5C3XA 1ENAA 4KY7A 5C5MA 2PW7A 3VA5A 2EYLA 3DMUA 4K8IA 1SNMA 3SR1A 3EJIA 1RKNA 4K14A 4NDXA 3BDCA 4G57A 4KHVA 2F0TA 2ENBA 4IZ8A 4KY6A 3D4WA 4S3SA 3T16A 4NMZA 3SK5A 5IGEA 2O4XA 2EYMA 2F0KA 2F0DA 3QOJA 1EY9A 2F0SA 3PMFA 4PMCA 2PZWA 4TRDA 2F0VA 2EYOA 3P1HA 4KD4A 5IGCA 5IODA 1EZ8A 5IOCA 4I65A 4WORA 5JOBA 1SYGA 3R3OA 5M9OA 4K5WA 5NUCA 5J22A 5EGTA 1SYEA 2F0IA 4HTHA 4N9TA 4YIJA 1U9RA 2F0FA 2RBMA 2PZUA 1EZ6A 3NHHA 4F8MA 5C3WA 4OL7A 1SYCA 5KYLA 4K5XA 5EKLA 5KRUA 2RDFA 1A3TA 2F0MA 5HURA 2OF1A 3H6MA 5CGKA 1EY4A 1EYDA 2F3VA 5JAVA 1STNA 3NXWA 1SNCA 2KHSA 2F0UA 3MZ5A 2F0NA 5IGDA 1EY5A 1STAA 2EYFA 3QB3A 3NP8A 3HZXA 4QF4A 5CV6A 1EY7A 1JORA 3TP5A 4H7BA 2EY6A 4KY5A 3SHLA 2EY1A 2HQEA 3MXPA 5KGUA 1SYFA 2SOBA 3S9WA 4K8JA 5IGFA 4KV6A 2KQ3A 1II3A 3NUCA 4K2KA 5IGBA 1NUCA 2RKSA 2SNSA 1F2YA 2F0GA 4ID6A 1KDBA 2LKVA 2F0PA 4J1MA 2F0OA 4K5VA 3SK8A 5CV5A 1SNOA 3SXHA 1F2MA 5E3FA 3D8GA 2EXZA 5CV7A 2F0WA 1ENCA 5J39A 5ISRA 3D6CA 1IHZA 5CV8A 5E1FA 4IUNA 4EQNA 1EY0A 1AEXA 1A3VA 5IGGA 5F2DA 2EYPA 1NSNS 2F0JA 2F0LA 3RUZA 1KABA 1SNPA 5CV9A 1EY8A 5DAUA 3TP6A 5I6YA 1A2UA 4RKLA 4IALA 4HMIA 2OXPA 3OMCA 4PNYA 3TP7A 4DFAA 4EQOA 5C4HA 4EQPA 5K5PA 3EROA 3C1EA 3U9OA 4NP5A 4B9WA 5KIXA 4WRDA 4ZUIA 4B9XA 2F0HA 3HEJA 3OWFA 5J1ZA 4K2LA 3SK6A 4ODGA 1SYDA 4ME5A 1EY6A 1A3UA 4K6DA 4ZUJA 1F2ZA 2NUCA 3C1FA 4KD3A 4KJOA 1EQVA 3EVQA 5EKKA 3DHQA 2F3WA 3ITPA 5HGTA 5IIFA 3TMEA 3P75A 2QDBA 1SNDA 1JOOA 5C4ZA 3E5SA 3MVVA 4NKLA 5CV4A 1JOQA 5CC4A 4MIUA 4R8NA 5I9PA 2SNMA 2PQEA 3MEHA 2PW5A 4KJNA 5CR3A 3T13A 3NQTA 4DU9A 5I6WA 1TT2A 4PMBA 5C6AA 1TQOA 4QB4A 3V2TA 3NK9A 3BDLA 4E6IA 5I9OA 2EYJA 1KDCA 4LAAA 4QMGA 3D4DA 2WACA 1EYAA 2PYKA 4DGZA 4EVOA 4HMJA 1STGA 3TP8A 5KEEA 2PZTA 1TR5A
chains in the Genus database with same CATH superfamily
3FRPB 2EYHA 2CW0D 1DD2A 1AE3A 1STBA 1CI3M 4RKBA 3U4ZA 1MD2D 3I7FA 2NVXH 1Q8KA 1BQQT 2Z1CA 3S16H 5FO7B 4UHVA 1YVCA 4IZ8A 1RTNA 3O13A 5BN3A 2ZM6Q 4A3JH 5IGEA 1PRTF 3I4LA 4OO1H 5FLXE 2DNEA 1LTSD 5M3FH 4M8AA 2KCTA 5CBAE 1VQ8A 5IGCA 2VB3X 2Z8LA 3I70A 3TBIB 5M9OA 2K04A 5E7NA 3CCSA 2JA8H 3PO3B 4DAPA 3KJPA 3HRZC 2NN6I 3NHHA 1CM9A 4C3IG 1WTRA 3NBIA 1N34L 1N33Q 4GLAC 2K5NA 1DOKA 2B3GA 2IY5B 2A6HC 1PTOC 3R2IA 4BBRG 2KENA 2F3VA 3GTMB 1PH3A 4DV2Q 3K5LA 4DK3C 3TP5A 3F2DA 1JT8A 1JJ2A 1X54A 4L63B 2EXZA 3D6CA 1BBWA 4HJ8A 2XRSD 1OXVA 1NSNS 2K32A 4GLVB 2F0LA 2N78A 4A3GB 1DM0B 4IFDJ 2OXPA 4DFAA 2UU9Q 2BH8A 3G6JB 2L5TA 4FF2A 3KJOA 4LNQA 2K03A 3ER0A 1ET6A 3I73A 1VQMA 3AQQA 4IN3A 1QB5D 1S5BD 3AEVA 4DV4Q 1F9PA 1EWCA 4AH6A 2R92G 4C56C 4G7OC 3FP9A 3W3AA 1Q7YC 5GAGC 4ZLTF 2LXJA 5G3LF 2Q8IB 1WVLA 2N55A 2ZJQA 2JA7H 3ICEA 3PF4A 1AP0A 1I94Q 2Z6BA 1XYIA 2M2LA 4KI0A 2B2VA 1KDCA 2D5DA 2VQEL 1Q12A 1D1IA 2B8GA 4H13C 2QA4A 4BY7B 2O2LD 1BOSA 2DY7A 4IOCA 2HHHQ 4O2DA 1SYBA 4Q0FA 4JI8Q 4HJ7A 1ENFA 3BS1A 4JI0Q 1CSPA 3D6WA 4A93G 4DUZL 4K8IA 1SNMA 3KLWA 1RKNA 1VQGA 4R4OA 2F0KA 1VQOA 3T51B 1YZ6A 1JQYD 3BZDB 4POFA 4DK1A 4ULLA 4I65A 3JAME 1A8VA 1PA6A 2F03A 4I7ZC 1M90C 1IBKQ 4DR1L 4C3HH 4OO1I 3M4OB 4YIJA 1TWGH 4IO9A 1XNRL 1MGSA 2Q8TA 3D4RA 2LS01 4GKKL 2WFWA 4X62L 3HOZB 1K8MA 4DR4L 4BY1G 4X6AH 2PMZE 1JMCA 1K73C 5C4JH 3TEHB 2PPBC 1B2TA 1QOHA 5CV6A 3W1GA 1D5XC 4KY5A 1S5FD 1SMYC 1SYFA 1ML0D 2B2VC 2LSSA 3VYSA 4ZYSA 1PHJA 1ILPA 2E5LL 3PO2H 5CMDA 1N8RC 4GN3B 3C3LA 1D5MC 4LW1A 2Q2IA 4IUNA 1EFWA 3ERSX 1K8GA 3S1RH 1AZPA 1LTBD 2D9UA 2MO1A 3X3MA 3TS0A 3W2DA 5EPKA 4IALA 1RD9D 1STEA 4IURA 4G7HC 4WRDA 2VUMH 1F9SA 1YHAA 3MXGA 3PO3G 1Y8PB 3OWFA 3Q8DA 5FJ8H 2WAQE 4OHJA 1VQIA 1SYDA 1SE8A 4IQZA 1RF2D 2ATWA 4JI7L 4IUUA 2F3WA 3H3VC 5IP7H 3EIVA 2NVQB 1JOOA 1I3QB 2B2WA 2B2TA 1JOQA 4EQ5A 2SNMA 3MEHA 1UE5A 2I5HA 4KJNA 4IFDH 2NB0A 4B3SQ 3CQZH 4C3JB 1BNZA 2B8FA 1Q8IA 1W6JA 4PMBA 4GN4B 4IJHA 4RGMA 4FF1A 2DN8A 1P8LA 1W6KA 3GQBA 3MA2B 4JOIA 3BVZA 3R2TA 1VCIA 3Q23A 4DR6L 3OPOA 3KF6B 1UE1A 2EJFC 4P72A 4R4TA 3GTLH 2JA6H 2ID0A 4A3GG 1QZGA 4N9PA 2F0EA 3I4OA 4OEMB 3A54A 2UUCQ 4MN3A 2WIIB 1LLRD 4RGTA 2BDOA 1DZ1A 4DV0Q 2O4XA 4O1NA 3A5UA 1O7ZA 4TSSA 1GUOA 1T9HA 3FKIH 2EYOA 3K58A 4A3LH 5C4XB 3IRBA 5EGTA 5M5WH 2QKIC 4N9TA 1U4LA 2KECA 4DK0A 1SSOA 1DOMA 4G7ZC 4XQQA 1E0BA 3SEBA 1VQEA 1WCMG 4DR2Q 5ELEA 4BY7G 1BO0A 3P20A 2XIWA 1ESRA 3TQYA 4JV5L 3HOUB 1M8AA 4BXXH 2TMPA 3ND8A 4JBMA 3S9WA 4JI3Q 4YWMA 5IGBA 5LHY1 4ID6A 1HFGA 1KDBA 1I4HA 3EBEA 4JOIC 2JA5H 1TWAH 3PUZA 2B39A 1BBUA 3KF6A 2IHEA 3OW7A 4YY3Q 1ENCA 4DV4L 2BE5C 4G4KA 3M7GA 1QZHA 2QW7A 4C1NK 5FK9C 4X64Q 2VL6A 3CCQA 4EQOA 2RDGA 5FO9B 3I4NB 3HEJA 1EL0A 4LMQD 4P74A 3K7AB 4ME5A 2PNRC 4LFBQ 4K6DA 4ZUJA 2OWOA 3HOZG 1TY2A 5GADC 3ITPA 4QCLA 3KFUA 1V1PA 2OT2A 2RQXA 3TREA 4JI8L 2F1MA 2R93H 4JI0L 1KL9A 4AQYQ 3M4YA 4IFDI 1J5EL 4A3IH 1T5XD 2AQ1B 1PLFA 1B1ZA 1PZID 4LUZA 3NTHA 1X3GA 4JW0A 1PH6A 1IBML 3I91A 3BG3A 4X3TA 1HPCA 5C0XG 1SJED 1YNND 1QUQB 3S14B 2RHQB 3G4SA 5BR8L 4R4QA 5JPNC 3BDCA 1R4PB 4G57A 3T16A 3ULJA 5JEAJ 1L0XB 4KKSA 5M5XH 5DM73 1B3QA 2AWNA 2OQ0A 4XXEA 1VMCA 1NMGA 4UP7A 1GM5A 3ZJYC 1PZJD 3PUXA 4C3JG 2K1BA 4K5XA 1LT5D 5HGQA 1A0IA 2FMMA 3GTKH 4A3KH 1EY4A 5JAVA 3Q22A 1HQMC 1MSHA 2KHSA 3M3YH 3WDNA 1STAA 4A3FB 4CDEC 5JJKA 3EA6A 5KGUA 5IYDG 3CW2C 2RKSA 5ELCA 3D0FA 1SFOB 4BBSH 1VQ4A 4MTKA 4A4IA 1JICA 4ILWA 4PG3A 4FDBA 1KABA 5LMNW 1NJIC 1IW7C 1Q86C 3CC4A 5C4XG 5M5YB 3S2HH 1NAPA 2H1EA 3GTQB 3OMCA 4JBJA 1VF7A 4PNYA 2YU9B 1CTMA 1PFBA 4EQPA 1SE2A 2ZJPA 5JJLA 1SR3A 1R9TH 1GOZA 1MHWC 1FL0A 4UY8C 1EY6A 2L0CA 2NUCA 2PQAB 1N34Q 2EOTA 1L2FA 2LFNA 2EQSA 1SE4A 4JYAL 4LF6L 1EIHA 3PUYA 1AE2A 1Y1WB 1KTKA 1VQ5A 2Z4IA 3HOUG 5ELNA 4YCVA 2L9HA 1D5ZC 4RGNA 3DM1A 2AQ2B 2FJ2A 5JVG3 3HOYH 2WACA 3CPFA 1CT1D 3IAYA 1STGA 2C9OA 1GUNA 2R7ZB 2PMZB 4RFBA 4QGUA 4DV0L 3IFTA 1CUKA 1Y8OB 2JXMB 1I4QA 3H0GH 3SK4A 2EZVA 2DNCA 1D8LA 2E2JH 2IWHA 4CDDC 1NE3A 5CORA 1QNKA 3EFXD 3DWAA 4F7XA 2I46A 3LGJA 4HJ5A 3VR4A 2EYLA 3I4NG 4DV5L 1FGBD 2R61A 2L4NA 3NEMA 3QOJA 2XGTA 3E6ZX 2F0VA 4KD4A 1ZEQX 2GVAA 2I0QA 1SYGA 1K83H 1TKWB 2JP1A 2KCNA 2LMCB 2NVTH 3GTGB 1S5ED 2OQKA 2PQAA 1BKBA 1VQHA 5E4XA 4C3IH 4X65L 3D31A 1G91A 3AFPA 1B44D 3W5OA 4NXML 4BBRH 4B3ML 3SE0A 3GV6A 2VQEQ 5EKIA 4HSVA 1AFPA 3RZDH 3K81C 2JEAI 3U9SA 4LFAL 2HCIA 4IUTA 5C3EB 3OTOL 4RH6A 2HIVA 2P5ZX 2SOBA 1B9NA 5L37A 4XT1B 4KV6A 1PH4A 2A74C 4AYBE 3NUCA 3M85A 4KHZA 1KRSA 3SK8A 4L5QA 3STBD 3CKIB 2B29A 3CD6A 4DUZQ 4LFBL 1BCPD 5CV7A 4OIKA 3EQLC 2NTSA 1SMXA 4JG2A 4DK6C 2WP8J 1A3VA 4RHRA 5M3MB 4Y52H 1LT6D 1U5KA 3Q24A 3S1MH 5I6YA 4Y7NH 1HR0W 3FEWX 1NBWA 4JI6L 1PTOH 1C7YA 3K0YA 1HNZL 4GKKQ 2R92H 3DHQA 4A3MB 4DR4Q 2K6AA 4ZAIA 4K0KL 4U673 4NKLA 2OTLA 4AIMA 2K5WA 4R1JA 3RZOH 1HNWL 3H94A 3M4QA 4RG1A 4A3FG 1EOTA 1L1OB 4JI2L 4ZKCB 2RSOA 2CKZB 4U68A 4JI5Q 2R3ZA 2CWPA 4DGZA 4HMJA 3T53B 2E5LQ 2F0QA 2HCCA 2L15A 4R8IA 1Z7TA 1S3OA 3QOLA 1VQFA 3KUPA 4ZKBB 3TZUA 4DN4M 4RCOA 3VA5A 4A93H 3TRZA 3OYYA 3LWEA 4NDXA 3CCRA 2ENBA 1TS2A 1YNNC 3SGIA 1DONA 5IP9G 5H1SE 1X65A 4JI7Q 3NE5B 3I4MB 2VZAA 5IODA 1HZCA 1K8OA 2B2UA 1G6PA 1Y1WG 1CK1A 1I4PA 1MI2A 3T56B 4ZK9B 2QEXA 1I6HB 1C9OA 4XDXA 1HXYD 2RDFA 1WD1A 3GTOH 1VQCA 2E8GA 2K75A 4BY1H 1A15A 2NVXB 2R7ZG 1RL2A 1K0SA 2WB1E 1GUWA 4RHSA 5IYBG 1VQ9A 3S16B 3Q0AA 1V8QA 1SJHD 2A5HA 2AHOB 2AMCB 4DR6Q 3QIAA 2EJMA 3NQIA 1VQAA 1KXLA 3RLOA 4O0AA 4K8JA 4OWXB 1PMRA 4DAMA 1SNOA 1GHKA 1F2MA 1TVXA 1BCPB 4N8FA 1WD0A 4HR7B 1AEXA 3E0JA 4FF4A 1BVSA 1FNUA 1CHPD 4HCEA 1C8CA 3MFGA 3U58A 1I4GA 5KIXA 1ZKOA 3H15A 4A3DG 1XTCD 5EQ0A 4UDUC 4ODGA 4HN7A 1H9SA 1E1OA 3C1FA 1QE6A 1U4MA 3EVQA 4L8JA 4PMWA 3G71A 2B2UC 2QDBA 2H5XA 3E5SA 3GTMH 1X3QA 3P7JA 1Y1VH 1KIXA 4XT3B 5C3EG 1CQFA 4JV5Q 4A75A 1PRTD 1S5DD 1WTOA 2UXDL 1B3AA 4IUQA 1Y69U 2GA4B 1U4PA 1IL2A 1TU2B 1L1OC 4C1NI 2L1BA 3LX0A 1SEBD 2RCNA 4YHHL 1PFSA 2YTVA 5M3MG 1VQBA 4A3GH 5JVH3 1OXUA 3NENA 1X3PA 1X55A 1IBLL 3RR5A 3AYHB 3CRLC 3HG9A 2IW3A 1UE6A 4CDFC 3PGZA 1Z47A 3J81L 4KY6A 2A8VA 4P73A 5ELFA 4PMCA 5D65A 1WTVA 1VQ7A 2JA7B 4QY7A 2K01A 4A3MG 2MNAA 1OXXK 2A69D 3IKJA 2F0FA 1EFID 3T1HL 1ZYRC 5C3WA 1Q1EA 3NWSA 2VS1A 4ME3A 5C44H 1X3EA 2A19A 1WCMH 1VDZA 4XQJA 3K6OA 1J5EQ 1L0YB 1O7IA 4R4CA 2ZXRA 3PSIA 1XMOQ 3OHXC 1NY4A 2XN9C 4DV7L 1GHJA 2JSOA 1IBMQ 3SHLA 5E4WC 2ZXPA 3F2CA 1BF4A 1B7YB 1M1KC 1E2ZA 1I4XA 3S17H 5BR8Q 1K8AC 1BDOA 3I72A 5D14A 1HUNA 4C3HB 2JE6I 5G3LD 2WKDA 1TWGB 2CH4W 3DM3A 1MSGA 4NW2A 3DEOA 1Q82C 1K3RA 1TY0A 1C0AA 3S2DB 3I4MG 2NWGA 1BCPC 3Q6SA 1CKNB 1D2BA 5C4JB 3M4OH 5COYA 4K2LA 1F2ZA 4JI5L 4KD3A 2CWAA 3HOZH 3C46A 2JJQA 4OX9L 1F9QA 1LT4D 1QNUA 2PI2A 1K9MC 2JQOA 5LMNL 3M7NA 3MVVA 1EQRA 2FFKB 3PO2B 1XX8A 2G9DA 4H0LC 1F9RA 4DU9A 3MFYA 3CC2A 4FO2A 2BOSA 1PRTB 3BYTB 3GD7A 4CGYB 3S1RB 2ES2A 1E24A 3BDLA 3PIO3 1F77A 1CHQD 1EQTA 1V1QA 1ASYA 3HOXB 2QDLA 3K59A 1B50A 2D62A 3FDTA 3PIOA 4GZYC 1ESFA 2UUAL 5ELDA 4KKUA 1CQVA 3CCVA 2MGSA 4MZ9A 4DV6L 3E0EA 4IUVA 3SR1A 3VR2A 3J81c 5I2YA 1YNXA 2EYMA 2F0DA 3CQZB 1JJCB 1HCZA 2B63H 4DV3L 2RCFA 5IT9L 2XTIA 1MJEA 2NVQH 1RJTA 1I3QH 4JYAQ 3RD4A 4LF6Q 5NUCA 1PVOA 1EU4A 1JE5A 4C2MH 2X69A 4C3JH 2DJGC 3WOFA 3BJUA 5DNFA 1A3TA 2HUGA 1KHIA 2OF1A 5CGKA 2CW0C 4A3EH 2F0NA 1XPUA 4UP9A 2A68D 3BU2A 4QUCA 4NXNL 2EY1A 4A3BB 1WTXA 5IYDH 3WWVA 1DYQA 3CXCA 2UXBQ 5IGFA 4OONA 3FKIB 4J1MA 1CZWA 1NNXA 2PCFB 1LTGD 3TSSA 2DJFC 1IXRA 3J7AV 5M5WB 4DV5Q 3QWNA 5EPLA 2ICEC 4ZRZA 2SEBD 2JA7G 1Z6HA 4QIWB 1YIJA 3KBGA 3MTSA 1A2UA 1MBYA 2JN4A 3TP7A 4NP5A 3A74A 5J1ZA 2V1CC 2K50A 3J81j 4EGVA 1A3UA 3GTPB 4X65Q 2BCOA 1MKHA 4OWWB 1YNJD 1LV9A 1U4RA 4NXMQ 1VQJA 3I55A 4B3MQ 3R93A 2K5VA 2MP1A 3J7AF 2JA5B 2ALYB 4FVMA 4RWSC 5I6WA 3S15H 4LFAQ 4LF8Q 1TT2A 3OTOQ 4UPAA 1I50H 4FP5D 1XMQL 4F88A 2EYJA 1IKLA 3KLSX 5KEEA 2PZTA 1B9MA 1YHQA 3OMGA 4C3HG 2Q2UA 2WB1B 1PRTC 3PV0A 4RAUC 2KUMA 5IWAL 1Y14B 4LFCL 1TWFB 1ET9A 3HS0C 4KK7A 3FMCA 1TS4A 3HKZE 4JI6Q 5A2QL 1H9KA 3S24A 4KHVA 3B6YA 1XNQQ 3K7AH 3SK5A 1PH8A 4FXKC 4X66L 1HNZQ 3CAMA 1GKHA 3UDFA 3S1NH 1EUJA 5IT9c 3K0XA 2B2YC 5EBCA 1XMOL 4K0KQ 4A3IB 4X3KA 3PO2G 2K28A 1HNWQ 4KN7C 1SAPA 4JI2Q 4PZ7A 3HOWB 5EKLA 3E3XA 3KYHC 2A69C 1XTDA 1O80A 1G8ZD 3BDOA 2NVYB 3HKSA 1DXMA 1JCKB 3HOXG 1S40A 5KNCA 3K80C 2EYFA 5IT9E 4F87A 1RIPA 5BN4A 1D7QA 2EY6A 1HZ9A 3MXPA 1NCVA 2BA1A 2JYOA 2I5MX 5M5XB 1II3A 2CFMA 2K52A 4GN5A 2Z6KC 1PTOF 2SNSA 2A6ED 2F4IA 1ONLA 1RODA 2Z9HA 3A55A 2F0JA 5FLMG 2MQHA 3SVMA 2E2DC 1N36L 5K5PA 3AMUA 4A3KB 2YV5A 2CH4A 3CP0A 5A35A 1CA5A 2K4KA 3K7UC 3SK6A 3M3YB 2BH2A 4Q5VA 5D3IB 1LYLA 2XRQD 1VS0A 3OIPA 1EIFA 3NTKA 4FXGC 4BBSB 3CU7A 3MWYW 4O42A 3A8IE 4A3FH 3PQIA 2OTJA 1QUQA 4A3BG 1EWHA 5K36H 1SFOH 3UDIA 1S4ZA 4RCNA 2NYZD 3T13A 5KNDA 1R9TB 3LNNA 4MTNA 3QG1A 2KCCA 4UP8A 3GTQH 2IX3A 3GTJB 3S1QB 2KOLA 1LTID 1KLGD 2F0TA 4DPGA 1EY9A 1JWSD 2IHFA 2E2IH 5IP9H 2BDNA 1VQ6A 4BXXG 1DJRD 1H95A 2H4OA 4WORA 2XWBB 2JA5G 2HD3A 2RVLA 3J7YW 1CA6A 1U9RA 2RBMA 4B08A 2UXBL 2I5LX 3H0GB 2E2JB 3K8AA 4CBVA 5KNBA 2F0MA 1CFMA 1KAWA 2UXDQ 3KF8B 2HT1A 2R7ZH 1STNA 1HJPA 1V43A 4QF4A 3QB3A 3G7LA 2WB1G 3G6EA 1SRUA 4Z9CB 2KHJA 3JC66 4CHTB 4YHHQ 1G2TA 1HUMA 2D2CC 2F0OA 3KK7A 1IBLQ 1Y8NB 3SDZA 1K83B 4H44C 2NVTB 4EQNA 1HA6A 3KDFB 1GXDC 2WAQB 1Q46A 2EYPA 4OELB 2AQ3B 4A3CG 2CHBD 3VYRA 3L9AX 2K05A 4A3DH 4LF8L 4CJ2C 1VQLA 4LF9L 3NTIA 5IY0A 4DR5L 2XSCA 3T1HQ 3HOWG 4IPCA 2M9VA 4P71A 3J7ZC 4DV1L 4LF7L 3DLLA 2E2HB 3DWQA 5HGTA 1N32L 4JI1L 1UAPA 2KEDA 3L2PA 4DXFA 1BBXC 1JR0D 4LJZC 3N6RA 1TWHH 4DV7Q 4HIOA 2DY8A 1LTAD 1GUSA 1PXUA 1TQOA 3NK9A 5LMUL 3KF8A 3S1MB 3I3CA 1IZ6A 1EEID 3UI2A 1CSQA 2XVSA 2D0PA 1XNQL 1EYCA 2OEOA 2HIXA 4JBWA 2L55A 3MHBA 5LL6X 1E3PA 1UNSA 4KTAA 5ELBA 5T1GA 3IL8A 1O7LA 4JC0A 1STYA 4DF7A 1ENAA 3MEFA 4A3KG 2D0OA 2XNAC 3DMUA 3ONAB 1N9WA 2O5IC 1EIYB 4LF4Q 4J8QA 1A63A 3AB9A 3KDFA 2QCPX 1OXTA 2JA9A 2UUBL 1W2BA 4A3MH 4OX9Q 4BS9A 2VNUD 5LMNQ 4TQUS 3VDYA 5AJ3L 1G6ZA 1LO5D 1G51A 3HOVB 4DR3L 1Q81C 1E1TA 1KNAA 3IFDA 3U50C 2MUYA 3BZCA 4V0BA 4GKJL 2CQOA 4DNRB 3A8KE 5IGDA 1WJJA 3MZ5A 5IYCG 3KLSA 1VF5C 4QQBX 1PH2A 3PCOB 3WOEA 5GROA 4JCVE 2UUAQ 2HDLA 2KQ3A 1LUZA 1NUCA 1TWCH 2ZJRA 4YWLA 4DV6Q 2IX0A 3M9BA 2J7ZA 3SXHA 1EU3A 1D1KA 1HZAA 3J80L 4MNOA 4ZCKA 1EY0A 2KHIA 1S5CD 5F2DA 4I7AA 3DWPA 4NPSA 4BA1I 1SNPA 5DAUA 1EY8A 4L6TB 3TDQA 3MAQA 1PFNA 2LY7A 4DV3Q 1MIUA 4N8X1 3GTOB 4BY1B 3L3OC 5HY6A 5C4HA 2TSSA 1D6EC 1L1OA 4ZUIA 4DKAC 1UEBA 3HKZB 4A3JB 3H0GG 1I6HH 3A8JE 5M3FB 3JAML 1LTRD 1UEAB 3NELA 1DGSA 4CJ1B 4PZ6A 4MIUA 1ZXTA 1PYWD 2JA8B 1RCVD 2PQEA 5CR3A 1H9RA 4HSPA 2KBNA 1V1OA 4KLKA 4JVZA 2N8NA 4NXNQ 5C6AA 3L0OA 3V2TA 4E6IA 2VW9A 3H09A 3G48A 3GV3A 2ASBA 2Y0SE 4V190 4RGOS 3PF5A 1EWIA 3MXNB 3PO3H 2IPKD 1OTCA 2K7VA 5I9OA 4FYDA 3DEPA 2O5JC 4J6HA 2WAQG 5DEHA 3RN5A 4K6LA 4CKCA 4JBKA 3CCMA 1CKOA 2E76C 1XJVA 5JEAG 5C0XJ 1EYGA 1YJ9A 1WFQA 4IJLA 2RDHA 2VQFL 1Y1VB 2EVBA 4S3SA 2VB2X 4FXDA 3RLFA 4B3TL 3LWUA 1VQKA 2PZWA 4BA2I 3OOCA 2BE5D 1KD1C 2NN6G 1EZ8A 1PV4A 5JOBA 3R3OA 4RMFA 3QR8A 4WJ4A 4L5TA 4HTHA 1HR0Q 1C4QA 3TS2A 1FNWA 2RHSB 3BVMA 1OO9B 2MFIA 2WV6D 5HURA 1J8IA 1SBBB 1XMQQ 2N88A 3H3VH 1EYDA 3J7A5 2G9HD 3I56A 1E22A 1JORA 1XXGA 2XWJB 2J4XA 4M1UB 2K14A 5IWAQ 1SDFA 2MPMA 4L5SA 4LFCQ 2KEEA 1FJGQ 1BUVT 2EJGC 2LKVA 3MXNA 1UUPA 3J80c 5E3FA 1KLUD 4EX5A 1HFNA 1JE4A 1WTPA 2HDMA 1GJXA 3RUZA 4X66Q 5CV9A 3AFQA 2CCZA 2WINB 2QILA 1V9PA 1H9JA 5C44B 4BY7H 4HMIA 1WCMB 3EROA 1E7ZA 3U9OA 4B9WA 3I90A 1VQNA 3HOVG 1EQQA 1I5FA 1KC8C 3JAMc 4HIKA 4P75A 3J80E 4OWTB 2F4VL 1WTWA 4R8NA 3V05A 5I9PA 2J0TD 3S17B 3QO2A 1YJNA 3VYUA 2L11A 4JI4L 5FOBB 3STBC 2KVMA 4HJ9A 1K3BC 3A0JA 4LF4L 2QEJC 1QVFA 1IYVA 2CQAA 4DNTB 5C5LA 4X3UA 4DNIA 1GVPA 1EOVA 1SNQA 3BYYB 4TKOB 3A7AB 3FVQA 4B3RL 5EAYA 1JWMD 3E9HA 3ERQA 1SLJA 1L0WA 3S2DH 3BVGA 4LWCA 2FMCA 2AWOA 2Z4HA 4R9WA 4DR7L 4GS3A 2PW7A 1N36Q 5GAEC 3HGBA 4XTCS 3UE0A 1IKMA 4XYQA 3HKZG 2FXQA 3RLNA 4A3JG 3D4WA 3PUVA 4OO1G 3PMFA 3AU7A 2YTYA 5M3FG 1SROA 2Q2TA 4TRDA 2NZOA 1EEFD 1IW7D 1JB3A 2Z0SA 2QF7A 2JA8G 3VR6A 2UXCL 4OGQC 2VUMB 1YBYA 4R4IA 5C0XH 2PZUA 4F8MA 1LABA 3A7LA 2X6GA 4OL7A 5GAHC 5KYLA 4JK1C 1BXTA 4GLXA 3H6MA 4LF5L 1QVCA 4AYBB 4P2CB 4MHEA 1UWVA 3T1YL 2Q2HA 1O78A 4KHPL 2KA7A 3HOXH 4CDCC 3HZXA 1FD7D 1LM0A 4H7BA 4L5RC 1ICFB 3H3VI 3CMEA 1PH9A 2EIFA 4K2KA 3R8BA 1CKNA 1PFMA 1F2YA 2F0GA 2B63B 2WKCA 1YJWA 1SXTA 3D8GA 1LTLA 4NB3A 1Y1VG 2NBFA 5AFWA 1B8AA 4C2MB 3GTLB 1KNEA 3J81E 1R4QB 4OXPA 2JA6B 5FLMH 5CYUA 2Q8RE 4XQNA 3PIP3 3A5ZB 3GDEA 3MC0B 4LUVA 5T1IA 1GUGA 2RSNA 2ZM6L 4A3EB 1I4RA 1CKMA 1TS3A 3PIPA 1HHVA 2AUKA 4IPDA 3VA7A 4KJOA 5EKKA 3FHWA 1K28A 1QG7A 3P75A 4HIDA 2ZTCA 2JEBI 3CCUA 1F2LA 2VXWA 3NWTA 5I2XA 2RF4A 3F8TA 5ELOA 1GD7A 1N33L 4A76A 4A3BH 5C4XH 4HJAA 1WI5A 2B2YA 4LAAA 1FR3A 2DUDA 4DV2L 3DXJC 1X6OA 2EY2A 1V1PB 3J80i 1OXSC 3OSOA 5KYIA 1STHA 3K5OA 5BN5A 5DLQE 3CPWA 2M00A 2F3IA 1JOKA 3E9IA 5C44G 1JWUD 2IX1A 3KOJA 5C5MA 3W1BA 1HR0L 2B2WC 1TWAB 2B2TC 3EJIA 3NPPA 4K14A 3HOUH 4HCSA 3GP7A 1PDQA 4LF9Q 4DR5Q 3GTPH 5I4DA 4LK1C 3URYA 3JAMi 3S15B 1Q3LA 1O7YA 4X3SA 4DV1Q 1I50B 4LF7Q 2Z6KA 1S72A 4IPGA 2UU9L 2F52A 1N32Q 4JI1Q 4YCWA 5J22A 3VYTA 3OW2A 2YYZA 2PO4A 2R7DA 3ULLA 1FJGL 1PZKD 1PH7A 3CCLA 2NZ1D 1WTHA 1Z9FA 1QCBD 5LMUQ 4IOAA 4CKEA 3K57A 3I4NH 5C0XI 1G291 2EE1A 4OIJA 4PZ8A 3I2ZA 1VQPA 5CBEE 2R93B 1HNXQ 1I94L 2FHTA 2HQEA 4UAIA 1TWFH 1WYDA 4IPHA 4GNXB 3S1NB 1DOLA 2DGYA 2E74C 2FINB 5FKAC 2EPBA 5FO8B 1XPRA 2Y0SB 2HHHL 1SN8A 5ISRA 1A62A 1IHZA 2N49A 5IGGA 4ABNA 1B53A 3BZKA 1J9OA 4A3CH 1SE3A 1YEZA 2UUBQ 2NTTA 4CKBA 2JK8A 2VUMG 4B9XA 5FJ8G 5AJ3Q 3GO5A 2EXDA 1QVGA 3HOWH 4GOPB 1EQVA 3S14H 4DR3Q 5IIFA 3TMEA 5IP7G 4AYBG 2GN5A 1AZQA 1IBKL 3J81i 2NVYH 5CV4A 3KBXA 4GKJQ 4IFDG 2PW5A 1IYUA 1KRTA 3NQTA 3MXUA 1MJCA 4DUYQ 3FPUB 2MHVA 2GVBA 2IT1A 4HAEA 3GTKB 2B63G 4EVOA 2A73B 2K33A 1A2TA 2OCEA 1K0RA 3KLRA 4ZQ3A 1KAAA 2MJ8A 2NZHA 1J6QA 3NSWA 2JA6G 1C48A 3M4PA 1B4OA 3CCJA 1X56A 4GNXA 2ZT9C 1TXYA 3PUWA 1FNVA 1GO3E 4DXGA 4JPBW 3CCEA 2IJ0A 4A3EG 2R7FA 1BR9A 4RA8A 4FF3A 3V96A 4BWGB 5D3DA 3FKIG 3F1ZA 1JJGA 1X3FA 4A3LG 2R6GA 1IL8A 3P1HA 1XPOA 3S2HB 1HRJA 2A6HD 1PTOD 2IL8A 4K5WA 3ZYYX 1SYEA 5TSSA 1EZ6A 4GOPA 1SYCA 3VR5A 5M5YH 1PYSB 1RDPD 5KRUA 3ND9A 3EN2A 2YU9H 2PI2E 1JB7A 5JPMC 1AN8A 1HQRD 4WJ3M 1H9MA 1QJOA 4B3SL 5IYCH 3ULPA 2G5DA 1EY5A 4DAVA 1HTLD 4H02A 4CJ0B 1EY7A 4HEDA 2HQLA 5IE8A 2ZTEA 1PH5A 2E2IB 2CVRA 3HOYB 4QL5A 3T4AC 1PYBA 1RHPA 2F0PA 3GTJH 1Y1WH 3S1QH 3UE1A 2N3SA 2ZXOA 3TZDA 1RTOA 1QWYA 4WFN3 2VQFQ 5J39A 5E1FA 2L12A 3D3RA 4DA2A 3FPPA 5A2QE 2A1AA 1M4VA 4GNXC 4B3TQ 3CC7A 4RKLA 1ASZA 2UUCL 3C1EA 5IYBH 4LUOA 2F0HA 3A56A 4POGA 1FVIA 2C5CA 1U0LA 3RMHA 3H91A 5C4ZA 3CF5A 2ICIA 2A68C 1BCPF 5CC4A 1A6XA 1ICWA 3NBHB 1WTQA 4GOPC 2R93G 2VY3A 1E2WA 2C35B 4C3IB 5GQOA 1YITA 3CMAA 1Q1BA 1LT3D 1ZYRD 4APVA 2KJXA 4QJFA 5J3BA 4BBRB 4DR2L 3D4DA 4A3IG 1YI2A 1EYAA 3X3NA 3TP8A 3GTGH 3RZDB 5FLXL 3F2UA 2Y0SG 2EY5A 4A3DB 1QILA 1GUTA 4JI3L 2X6LA 1KDAA 3HP3A 4KMUC 5EPJA 2BA0A 5DM63 1B70B 1YHBA 5C3XA 4KY7A 5JEAH 2AUJD 1NR2A 3I8ZA 3CHBD 4PQXA 4YY3L 5C3EH 1HZBA 2MO0A 4DAYB 4NMZA 2AKWB 1YNJC 2F0SA 1LTTD 1TWHB 2E2HH 4X64L 1EIGA 2NN6H 4Y7NB 4KKTA 4WJWA 5IOCA 2F4VQ 1PTOB 2F0IA 5EJWA 1HNXL 2E75C 5JJIA 1PH1A 5M3MH 1G2SA 5JJZA 2V4DA 3VR3A 1SMYD 3OIQA 2R92B 4JI4Q 1W3SA 1IYJB 2SDFA 1AW7A 3NXWA 1SNCA 1NR4A 2K5HA 5LL6S 2F0UA 1X9NA 3NBHA 3RZOB 1ILQA 3RN2A 1Q90A 1VMPA 3OWEB 2RA4A 2EDGA 3NP8A 4XYOA 1WOCA 4DR1Q 1LACA 1XNRQ 4B3RQ 4AQYL 1E2VA 2I07B 2LXKA 4X62Q 3K5NA 1NMFA 3UDGA 4K5VA 4PV1C 4BBSG 4IUPA 4DR7Q 5CV5A 2ZTDA 2F0WA 5CV8A 2YTXA 1FGUA 5EBDA 3QJYA 1X32A 3U4VA 3DUZA 4HIMA 1JC7A 3CRKC 3L7ZC 1HH2P 4YCUA 3N52A 1UE7A 3TP6A 4YWKA 3F2BA 5K36G 4A93B 4TVAB 4DUYL 1P16A 4DAYA 1CZGA 2UXCQ 1FYCA 1AH9A 1TIID 4KN4C 1NTGA 3HOVH 2KCMA 1VQDA 4QIWE 4FNFA 3TN2A 1HA5A 1I6VC 3RNUA 2QGQA 1HTPA 4LF5Q 1SNDA 2K5DA 1TWCB 1TS5A 1DCZA 4QUFA 3T1YQ 2PNHA 1T5EA 4KHPQ 3C2PA 1XWEA 4XIGS 2K5QA 2A6EC 1KQSA 1H9SB 3I4MH 4QB4A 3UDXA 4J15A 4QMGA 3HOYG 3K5MA 2PYKA 4ALPA 5FLXc 3HFZB 1TR5A
chains in the Genus database with same CATH topology
3FRPB 2EYHA 2CW0D 1DD2A 1STBA 1CI3M 4RKBA 1MD2D 1BQQT 2Z1CA 5FO7B 4IZ8A 1RTNA 3O13A 5BN3A 5IGEA 1PRTF 3I4LA 4OO1H 5FLXE 2DNEA 1LTSD 4M8AA 5CBAE 5IGCA 2VB3X 2Z8LA 3I70A 3TBIB 5M9OA 2K04A 3PO3B 4DAPA 3HRZC 2NN6I 3NHHA 1CM9A 4C3IG 1WTRA 3NBIA 1DOKA 2A6HC 1PTOC 3R2IA 2F3VA 3GTMB 3K5LA 3TP5A 4L63B 2EXZA 3D6CA 2XRSD 1OXVA 1NSNS 2K32A 2F0LA 4A3GB 1DM0B 4IFDJ 2OXPA 4DFAA 3G6JB 2L5TA 4FF2A 2K03A 1ET6A 3I73A 4IN3A 1QB5D 1S5BD 1F9PA 1EWCA 4C56C 4G7OC 3W3AA 4ZLTF 5G3LF 2Q8IB 1WVLA 2N55A 1AP0A 1XYIA 2M2LA 4KI0A 2B2VA 1KDCA 2D5DA 1Q12A 1D1IA 2B8GA 4H13C 4BY7B 2O2LD 1BOSA 2DY7A 1SYBA 4Q0FA 1ENFA 3BS1A 3D6WA 4K8IA 1SNMA 1RKNA 2F0KA 3T51B 1JQYD 3BZDB 4DK1A 4ULLA 4I65A 3JAME 2F03A 4I7ZC 4OO1I 3M4OB 4YIJA 1MGSA 2Q8TA 3D4RA 2LS01 3HOZB 1K8MA 2PPBC 1B2TA 1QOHA 5CV6A 1D5XC 4KY5A 1S5FD 1SMYC 1SYFA 1ML0D 2B2VC 3VYSA 4ZYSA 1ILPA 5CMDA 3C3LA 1D5MC 4IUNA 1AZPA 1LTBD 2D9UA 3X3MA 3W2DA 5EPKA 4IALA 1RD9D 1STEA 4IURA 4G7HC 4WRDA 1F9SA 3MXGA 1Y8PB 3OWFA 4OHJA 1SYDA 4IQZA 1RF2D 4IUUA 2F3WA 3H3VC 2NVQB 1JOOA 1I3QB 2B2WA 2B2TA 1JOQA 2SNMA 3MEHA 4IFDH 4KJNA 2NB0A 4C3JB 1BNZA 2B8FA 1Q8IA 1W6JA 4PMBA 4RGMA 4FF1A 2DN8A 1W6KA 3GQBA 3MA2B 3BVZA 1VCIA 3R2TA 3Q23A 3OPOA 2EJFC 2ID0A 4N9PA 2F0EA 3A54A 4MN3A 2WIIB 1LLRD 4RGTA 2BDOA 1DZ1A 2O4XA 4O1NA 1O7ZA 4TSSA 1GUOA 2EYOA 3K58A 5C4XB 5EGTA 2QKIC 4N9TA 1U4LA 2KECA 4DK0A 1SSOA 1DOMA 4G7ZC 4XQQA 1E0BA 3SEBA 5ELEA 1BO0A 3P20A 2XIWA 1ESRA 3HOUB 1M8AA 2TMPA 3ND8A 3S9WA 5IGBA 5LHY1 4ID6A 1HFGA 1KDBA 1I4HA 3PUZA 2B39A 3OW7A 1ENCA 2BE5C 4G4KA 3M7GA 4C1NK 5FK9C 4EQOA 2RDGA 5FO9B 3I4NB 3HEJA 1EL0A 4LMQD 3K7AB 4ME5A 2PNRC 4K6DA 4ZUJA 1TY2A 3ITPA 4QCLA 1V1PA 2OT2A 2RQXA 2F1MA 3M4YA 4IFDI 1T5XD 2AQ1B 1PLFA 1B1ZA 1PZID 3NTHA 3I91A 3BG3A 4X3TA 1HPCA 5C0XG 1SJED 1YNND 3S14B 5JPNC 3BDCA 1R4PB 4G57A 3T16A 5JEAJ 1L0XB 4KKSA 5DM73 2AWNA 4XXEA 1VMCA 1PZJD 3PUXA 4C3JG 2K1BA 4K5XA 1LT5D 2FMMA 1EY4A 5JAVA 3Q22A 1HQMC 1MSHA 2KHSA 3WDNA 1STAA 4A3FB 3EA6A 5KGUA 2RKSA 5ELCA 1SFOB 1JICA 4ILWA 1KABA 1IW7C 5M5YB 1NAPA 2H1EA 3GTQB 3OMCA 4PNYA 1VF7A 2YU9B 1CTMA 1PFBA 4EQPA 1SE2A 1GOZA 1EY6A 2L0CA 2NUCA 2EOTA 2LFNA 1SE4A 1EIHA 3PUYA 1Y1WB 1KTKA 2Z4IA 2L9HA 1D5ZC 4RGNA 3DM1A 2AQ2B 2FJ2A 5JVG3 2WACA 1CT1D 3IAYA 1STGA 2C9OA 1GUNA 2R7ZB 2PMZB 4RFBA 3IFTA 1Y8OB 2JXMB 1I4QA 3SK4A 2EZVA 2DNCA 2IWHA 5CORA 1QNKA 3EFXD 3DWAA 4F7XA 2I46A 3VR4A 2EYLA 1FGBD 2R61A 2L4NA 3QOJA 3E6ZX 2F0VA 4KD4A 1ZEQX 1SYGA 1TKWB 2JP1A 2KCNA 2LMCB 3GTGB 1S5ED 5E4XA 3D31A 1G91A 1B44D 3SE0A 3GV6A 5EKIA 4HSVA 1AFPA 2JEAI 3U9SA 2HCIA 4IUTA 5C3EB 4RH6A 2SOBA 1B9NA 4XT1B 4KV6A 2A74C 3NUCA 3M85A 4KHZA 3SK8A 3CKIB 1BCPD 5CV7A 4OIKA 3EQLC 2NTSA 2WP8J 1A3VA 4RHRA 5M3MB 1LT6D 3Q24A 5I6YA 3FEWX 1PTOH 3K0YA 3DHQA 4A3MB 2K6AA 4ZAIA 4U673 4NKLA 2K5WA 3H94A 1EOTA 4ZKCB 2RSOA 4U68A 2R3ZA 4DGZA 4HMJA 3T53B 2F0QA 2HCCA 4R8IA 1Z7TA 3QOLA 3KUPA 4ZKBB 3TZUA 4DN4M 4RCOA 3VA5A 3LWEA 4NDXA 2ENBA 1TS2A 1YNNC 1DONA 3NE5B 3I4MB 5IODA 1K8OA 2B2UA 1CK1A 1I4PA 1MI2A 3T56B 4ZK9B 1I6HB 4XDXA 1HXYD 2RDFA 1WD1A 1A15A 2NVXB 1GUWA 4RHSA 3S16B 3Q0AA 1V8QA 1SJHD 2A5HA 3QIAA 2EJMA 3NQIA 4K8JA 1PMRA 1SNOA 1GHKA 1F2MA 1TVXA 1BCPB 1WD0A 4HR7B 1AEXA 3E0JA 4FF4A 1FNUA 1CHPD 4HCEA 1C8CA 3MFGA 1I4GA 5KIXA 1ZKOA 1XTCD 5EQ0A 4UDUC 4ODGA 4HN7A 1H9SA 3C1FA 1QE6A 1U4MA 3EVQA 4L8JA 4PMWA 2B2UC 2QDBA 3E5SA 1X3QA 3P7JA 4XT3B 1CQFA 1PRTD 1S5DD 1WTOA 1B3AA 4IUQA 1Y69U 2GA4B 1U4PA 1TU2B 4C1NI 2L1BA 3LX0A 1SEBD 5JVH3 1OXUA 1X3PA 3CRLC 3HG9A 2IW3A 1Z47A 3J81L 4KY6A 5ELFA 4PMCA 5D65A 1WTVA 2JA7B 2K01A 1OXXK 2A69D 3IKJA 2F0FA 1EFID 1ZYRC 5C3WA 1Q1EA 3NWSA 1VDZA 4XQJA 3K6OA 1L0YB 2ZXRA 3OHXC 2XN9C 1GHJA 2JSOA 3SHLA 5E4WC 2ZXPA 1BF4A 1E2ZA 1I4XA 1BDOA 3I72A 5D14A 1HUNA 4C3HB 2JE6I 5G3LD 2WKDA 1TWGB 1MSGA 4NW2A 3DEOA 1TY0A 3S2DB 2NWGA 1BCPC 3Q6SA 1D2BA 5C4JB 5COYA 4K2LA 1F2ZA 4KD3A 3C46A 1F9QA 1LT4D 1QNUA 3M7NA 3MVVA 2FFKB 3PO2B 1XX8A 2G9DA 4H0LC 1F9RA 4DU9A 3MFYA 4FO2A 2BOSA 1PRTB 3BYTB 3GD7A 4CGYB 3S1RB 3BDLA 3PIO3 1F77A 1CHQD 1EQTA 3HOXB 3K59A 1B50A 2D62A 3FDTA 4GZYC 1ESFA 5ELDA 4KKUA 1CQVA 2MGSA 4IUVA 3SR1A 3VR2A 5I2YA 2EYMA 2F0DA 3CQZB 1HCZA 5IT9L 1RJTA 3RD4A 5NUCA 1EU4A 2X69A 3WOFA 5DNFA 1A3TA 2HUGA 2OF1A 5CGKA 2CW0C 2F0NA 2A68D 4QUCA 2EY1A 4A3BB 1WTXA 1DYQA 5IGFA 3FKIB 4J1MA 1CZWA 2PCFB 1LTGD 3TSSA 3J7AV 5M5WB 3QWNA 5EPLA 2ICEC 4ZRZA 2SEBD 1Z6HA 4QIWB 3KBGA 3MTSA 1A2UA 1MBYA 3TP7A 4NP5A 5J1ZA 4EGVA 1A3UA 3GTPB 2BCOA 1YNJD 1LV9A 1U4RA 3R93A 2MP1A 3J7AF 2JA5B 4FVMA 4RWSC 5I6WA 1TT2A 4FP5D 4F88A 2EYJA 1IKLA 3KLSX 5KEEA 2PZTA 1B9MA 3OMGA 4C3HG 2WB1B 1PRTC 3PV0A 4RAUC 2KUMA 1TWFB 1ET9A 3HS0C 4KK7A 3FMCA 1TS4A 5A2QL 1H9KA 4KHVA 3SK5A 4FXKC 2B2YC 5EBCA 4A3IB 4X3KA 2K28A 4KN7C 1SAPA 3HOWB 5EKLA 2A69C 1O80A 1G8ZD 3BDOA 2NVYB 1DXMA 1JCKB 5KNCA 2EYFA 5IT9E 4F87A 5BN4A 2EY6A 3MXPA 1NCVA 2BA1A 2JYOA 5M5XB 1II3A 1PTOF 2SNSA 2A6ED 2F4IA 1ONLA 1RODA 3A55A 2F0JA 3SVMA 2E2DC 5K5PA 3AMUA 4A3KB 5A35A 1CA5A 3SK6A 3M3YB 4Q5VA 5D3IB 2XRQD 3OIPA 3NTKA 4FXGC 4BBSB 3CU7A 3MWYW 4O42A 3A8IE 1EWHA 5K36H 1S4ZA 4RCNA 2NYZD 3T13A 5KNDA 1R9TB 3LNNA 3QG1A 2KCCA 2IX3A 3GTJB 3S1QB 2KOLA 1LTID 1KLGD 2F0TA 1EY9A 1JWSD 2BDNA 1DJRD 2H4OA 4WORA 2XWBB 2RVLA 3J7YW 1CA6A 1U9RA 2RBMA 4B08A 3H0GB 2E2JB 4CBVA 5KNBA 2F0MA 1CFMA 1STNA 1V43A 4QF4A 3QB3A 3G7LA 4Z9CB 4CHTB 1G2TA 1HUMA 2D2CC 2F0OA 3KK7A 1Y8NB 3SDZA 1K83B 4H44C 2NVTB 4EQNA 1HA6A 1GXDC 2WAQB 2EYPA 2AQ3B 2CHBD 3VYRA 3L9AX 2K05A 4CJ2C 3NTIA 2XSCA 2M9VA 2E2HB 3DWQA 5HGTA 1UAPA 2KEDA 4DXFA 1BBXC 1JR0D 4LJZC 3N6RA 2DY8A 1LTAD 1GUSA 1PXUA 1TQOA 3NK9A 3KF8A 3S1MB 3I3CA 1EEID 3UI2A 2XVSA 1EYCA 2OEOA 4JBWA 2L55A 3MHBA 5LL6X 1UNSA 4KTAA 5ELBA 5T1GA 3IL8A 1O7LA 1STYA 4DF7A 1ENAA 2XNAC 3DMUA 3ONAB 2O5IC 4J8QA 3AB9A 2QCPX 1OXTA 2VNUD 4BS9A 4TQUS 1G6ZA 1LO5D 3HOVB 1KNAA 3IFDA 2MUYA 4V0BA 4DNRB 3A8KE 5IGDA 3MZ5A 3KLSA 1VF5C 3WOEA 2HDLA 2KQ3A 1NUCA 2IX0A 2J7ZA 3SXHA 1EU3A 1D1KA 3J80L 1EY0A 1S5CD 5F2DA 3DWPA 4BA1I 1SNPA 5DAUA 1EY8A 4L6TB 3TDQA 3MAQA 1PFNA 2LY7A 3GTOB 4BY1B 3L3OC 5C4HA 2TSSA 1D6EC 4ZUIA 3HKZB 4A3JB 3A8JE 5M3FB 3JAML 1LTRD 1UEAB 4CJ1B 4MIUA 1ZXTA 1PYWD 2JA8B 1RCVD 2PQEA 5CR3A 1H9RA 4HSPA 1V1OA 5C6AA 3V2TA 4E6IA 3H09A 3GV3A 4V190 4RGOS 2IPKD 2K7VA 5I9OA 4FYDA 3DEPA 2O5JC 4J6HA 5DEHA 4K6LA 4CKCA 2E76C 5JEAG 5C0XJ 2RDHA 1Y1VB 2EVBA 4S3SA 2VB2X 4FXDA 3RLFA 3LWUA 4BA2I 2PZWA 3OOCA 2BE5D 2NN6G 1EZ8A 5JOBA 3R3OA 4HTHA 1C4QA 1FNWA 3BVMA 1OO9B 2WV6D 5HURA 1J8IA 1SBBB 2N88A 1EYDA 2G9HD 1JORA 1XXGA 2XWJB 2J4XA 4M1UB 1SDFA 2MPMA 2KEEA 1BUVT 2EJGC 2LKVA 3MXNA 1UUPA 5E3FA 1KLUD 1HFNA 1JE4A 1WTPA 2HDMA 1GJXA 3RUZA 5CV9A 2WINB 2QILA 1H9JA 5C44B 4HMIA 1WCMB 3EROA 3U9OA 4B9WA 3I90A 3J80E 1WTWA 4R8NA 3V05A 5I9PA 2J0TD 3S17B 3QO2A 3VYUA 2L11A 5FOBB 2KVMA 2QEJC 1IYVA 2CQAA 4DNTB 5C5LA 4X3UA 1SNQA 4TKOB 3BYYB 3A7AB 3FVQA 1JWMD 3ERQA 3BVGA 2FMCA 2AWOA 2Z4HA 4R9WA 2PW7A 3HGBA 4XTCS 1IKMA 4XYQA 3D4WA 3PUVA 4OO1G 3PMFA 3AU7A 4TRDA 1EEFD 1IW7D 1JB3A 2QF7A 2VUMB 3VR6A 4OGQC 5C0XH 2PZUA 4F8MA 1LABA 3A7LA 2X6GA 4OL7A 5KYLA 4JK1C 1BXTA 3H6MA 4AYBB 4P2CB 4MHEA 1O78A 2KA7A 3HZXA 1FD7D 4H7BA 4K2KA 3R8BA 1PFMA 1F2YA 2F0GA 2B63B 2WKCA 1SXTA 3D8GA 2NBFA 5AFWA 4C2MB 3GTLB 1KNEA 3J81E 1R4QB 2JA6B 5CYUA 2Q8RE 4XQNA 3PIP3 3MC0B 5T1IA 1GUGA 2RSNA 4A3EB 1I4RA 1TS3A 1HHVA 2AUKA 3VA7A 4KJOA 5EKKA 1QG7A 3P75A 2JEBI 1F2LA 2VXWA 3NWTA 5I2XA 2B2YA 4LAAA 1FR3A 3DXJC 2EY2A 1V1PB 1OXSC 3OSOA 5KYIA 1STHA 3K5OA 5BN5A 2M00A 1JOKA 1JWUD 2IX1A 5C5MA 2B2WC 1TWAB 2B2TC 3EJIA 3NPPA 4K14A 4HCSA 3GP7A 1PDQA 5I4DA 4LK1C 3URYA 3S15B 1Q3LA 1O7YA 4X3SA 1I50B 5J22A 3VYTA 2YYZA 2PO4A 1PZKD 2NZ1D 1QCBD 4CKEA 3K57A 5C0XI 1G291 2EE1A 4OIJA 5CBEE 2R93B 2FHTA 2HQEA 4UAIA 3S1NB 1DOLA 2FINB 2E74C 5FKAC 2EPBA 5FO8B 2Y0SB 5ISRA 1IHZA 5IGGA 4ABNA 1B53A 1J9OA 1SE3A 2NTTA 4CKBA 4B9XA 3GO5A 1EQVA 5IIFA 3TMEA 1AZQA 5CV4A 3KBXA 4IFDG 2PW5A 1IYUA 3NQTA 3MXUA 3FPUB 2MHVA 2IT1A 4HAEA 3GTKB 4EVOA 2A73B 2K33A 1A2TA 3KLRA 4ZQ3A 1KAAA 2MJ8A 3NSWA 1C48A 1B4OA 2ZT9C 3PUWA 1FNVA 4DXGA 2IJ0A 1BR9A 4RA8A 4FF3A 3V96A 4BWGB 5D3DA 2R6GA 1IL8A 3P1HA 3S2HB 1HRJA 2A6HD 1PTOD 2IL8A 4K5WA 3ZYYX 1SYEA 5TSSA 1EZ6A 1SYCA 3VR5A 1RDPD 5KRUA 3ND9A 5JPMC 1AN8A 1HQRD 1H9MA 1QJOA 1EY5A 4DAVA 1HTLD 4CJ0B 1EY7A 4HEDA 2E2IB 2CVRA 3HOYB 3T4AC 1RHPA 2F0PA 2ZXOA 3TZDA 1RTOA 1QWYA 4WFN3 5J39A 5E1FA 2L12A 3D3RA 4DA2A 3FPPA 5A2QE 1M4VA 4RKLA 3C1EA 2F0HA 3A56A 2C5CA 3RMHA 3H91A 5C4ZA 2ICIA 2A68C 1BCPF 5CC4A 1A6XA 1ICWA 1WTQA 1E2WA 4C3IB 1Q1BA 1LT3D 1ZYRD 2KJXA 4BBRB 3D4DA 1EYAA 3X3NA 3TP8A 3RZDB 5FLXL 3F2UA 2EY5A 4A3DB 1QILA 1GUTA 2X6LA 1KDAA 3HP3A 4KMUC 5EPJA 2BA0A 5DM63 5C3XA 4KY7A 5JEAH 2AUJD 1NR2A 3I8ZA 3CHBD 4PQXA 4NMZA 1YNJC 2F0SA 1LTTD 1TWHB 1EIGA 2NN6H 4Y7NB 4KKTA 4WJWA 5IOCA 1PTOB 2F0IA 5EJWA 2E75C 1G2SA 5JJZA 2V4DA 3VR3A 1SMYD 3OIQA 2R92B 2SDFA 1AW7A 3NXWA 1SNCA 1NR4A 5LL6S 2F0UA 3NBHA 3RZOB 1ILQA 1Q90A 1VMPA 3OWEB 2RA4A 2EDGA 3NP8A 4XYOA 1LACA 1E2VA 2I07B 3K5NA 4K5VA 4PV1C 4IUPA 5CV5A 2F0WA 5CV8A 5EBDA 3QJYA 1X32A 3DUZA 1JC7A 3CRKC 3L7ZC 3N52A 3TP6A 5K36G 4A93B 4DAYA 1CZGA 1FYCA 1TIID 4KN4C 4FNFA 3TN2A 1HA5A 1I6VC 1HTPA 1SNDA 2K5DA 1TWCB 1TS5A 1DCZA 4QUFA 1T5EA 3C2PA 1XWEA 4XIGS 2K5QA 2A6EC 1H9SB 4QB4A 4QMGA 3K5MA 2PYKA 1TR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Q A;  1EYC A;  1A2T A;  2EY2 A;  2EY5 A;  2EYH A;  2OEO A;  3OMG A;  3MHB A;  1SNQ A;  3LX0 A;  4ZQ3 A;  5C5L A;  1SYB A;  1STB A;  3OSO A;  3SK4 A;  1STH A;  4J6H A;  1KAA A;  4KTA A;  5DEH A;  4RKB A;  5KYI A;  1KDA A;  3ERQ A;  3QOL A;  2M00 A;  1STY A;  4N9P A;  1JOK A;  2F0E A;  4DF7 A;  4F7X A;  5C3X A;  1ENA A;  4KY7 A;  5C5M A;  2PW7 A;  3VA5 A;  2EYL A;  3DMU A;  4K8I A;  1SNM A;  3SR1 A;  3EJI A;  1RKN A;  4K14 A;  4NDX A;  3BDC A;  4G57 A;  4KHV A;  2F0T A;  2ENB A;  4IZ8 A;  4KY6 A;  3D4W A;  4S3S A;  3T16 A;  4NMZ A;  3SK5 A;  5IGE A;  2O4X A;  2EYM A;  2F0K A;  2F0D A;  3QOJ A;  1EY9 A;  2F0S A;  3PMF A;  4PMC A;  2PZW A;  4TRD A;  2F0V A;  2EYO A;  3P1H A;  4KD4 A;  5IGC A;  5IOD A;  1EZ8 A;  5IOC A;  4I65 A;  4WOR A;  5JOB A;  1SYG A;  3R3O A;  5M9O A;  4K5W A;  5NUC A;  5J22 A;  5EGT A;  1SYE A;  2F0I A;  4HTH A;  4N9T A;  4YIJ A;  1U9R A;  2F0F A;  2RBM A;  2PZU A;  1EZ6 A;  3NHH A;  4F8M A;  5C3W A;  4OL7 A;  1SYC A;  5KYL A;  4K5X A;  5EKL A;  5KRU A;  2RDF A;  1A3T A;  2F0M A;  5HUR A;  2OF1 A;  3H6M A;  5CGK A;  1EY4 A;  1EYD A;  2F3V A;  5JAV A;  1STN A;  3NXW A;  1SNC A;  2KHS A;  2F0U A;  3MZ5 A;  2F0N A;  5IGD A;  1EY5 A;  1STA A;  2EYF A;  3QB3 A;  3NP8 A;  3HZX A;  4QF4 A;  5CV6 A;  1EY7 A;  1JOR A;  3TP5 A;  4H7B A;  2EY6 A;  4KY5 A;  3SHL A;  2EY1 A;  2HQE A;  3MXP A;  5KGU A;  1SYF A;  2SOB A;  3S9W A;  4K8J A;  5IGF A;  4KV6 A;  2KQ3 A;  1II3 A;  3NUC A;  4K2K A;  5IGB A;  1NUC A;  2RKS A;  2SNS A;  1F2Y A;  2F0G A;  4ID6 A;  1KDB A;  2LKV A;  2F0P A;  4J1M A;  2F0O A;  4K5V A;  3SK8 A;  5CV5 A;  1SNO A;  3SXH A;  1F2M A;  5E3F A;  3D8G A;  2EXZ A;  5CV7 A;  2F0W A;  1ENC A;  5J39 A;  5ISR A;  3D6C A;  1IHZ A;  5CV8 A;  5E1F A;  4IUN A;  4EQN A;  1EY0 A;  1AEX A;  1A3V A;  5IGG A;  5F2D A;  2EYP A;  1NSN S;  2F0J A;  2F0L A;  3RUZ A;  1KAB A;  1SNP A;  5CV9 A;  1EY8 A;  5DAU A;  3TP6 A;  5I6Y A;  1A2U A;  4RKL A;  4IAL A;  4HMI A;  2OXP A;  3OMC A;  4PNY A;  3TP7 A;  4DFA A;  4EQO A;  5C4H A;  4EQP A;  5K5P A;  3ERO A;  3C1E A;  3U9O A;  4NP5 A;  4B9W A;  5KIX A;  4WRD A;  4ZUI A;  4B9X A;  2F0H A;  3HEJ A;  3OWF A;  5J1Z A;  4K2L A;  3SK6 A;  4ODG A;  1SYD A;  4ME5 A;  1EY6 A;  1A3U A;  4K6D A;  4ZUJ A;  1F2Z A;  2NUC A;  3C1F A;  4KD3 A;  4KJO A;  1EQV A;  3EVQ A;  5EKK A;  3DHQ A;  2F3W A;  3ITP A;  5HGT A;  5IIF A;  3TME A;  3P75 A;  2QDB A;  1SND A;  1JOO A;  5C4Z A;  3E5S A;  3MVV A;  4NKL A;  5CV4 A;  1JOQ A;  5CC4 A;  4MIU A;  4R8N A;  5I9P A;  2SNM A;  2PQE A;  3MEH A;  2PW5 A;  4KJN A;  5CR3 A;  3T13 A;  3NQT A;  4DU9 A;  5I6W A;  1TT2 A;  4PMB A;  5C6A A;  1TQO A;  4QB4 A;  3V2T A;  3NK9 A;  3BDL A;  4E6I A;  5I9O A;  2EYJ A;  1KDC A;  4LAA A;  4QMG A;  3D4D A;  2WAC A;  1EYA A;  2PYK A;  4DGZ A;  4EVO A;  4HMJ A;  1STG A;  3TP8 A;  5KEE A;  2PZT A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 3FRP B;  2EYH A;  2CW0 D;  1DD2 A;  1AE3 A;  1STB A;  1CI3 M;  4RKB A;  3U4Z A;  1MD2 D;  3I7F A;  2NVX H;  1Q8K A;  1BQQ T;  2Z1C A;  3S16 H;  5FO7 B;  4UHV A;  1YVC A;  4IZ8 A;  1RTN A;  3O13 A;  5BN3 A;  2ZM6 Q;  4A3J H;  5IGE A;  1PRT F;  3I4L A;  4OO1 H;  5FLX E;  2DNE A;  1LTS D;  5M3F H;  4M8A A;  2KCT A;  5CBA E;  1VQ8 A;  5IGC A;  2VB3 X;  2Z8L A;  3I70 A;  3TBI B;  5M9O A;  2K04 A;  5E7N A;  3CCS A;  2JA8 H;  3PO3 B;  4DAP A;  3KJP A;  3HRZ C;  2NN6 I;  3NHH A;  1CM9 A;  4C3I G;  1WTR A;  3NBI A;  1N34 L;  1N33 Q;  4GLA C;  2K5N A;  1DOK A;  2B3G A;  2IY5 B;  2A6H C;  1PTO C;  3R2I A;  4BBR G;  2KEN A;  2F3V A;  3GTM B;  1PH3 A;  4DV2 Q;  3K5L A;  4DK3 C;  3TP5 A;  3F2D A;  1JT8 A;  1JJ2 A;  1X54 A;  4L63 B;  2EXZ A;  3D6C A;  1BBW A;  4HJ8 A;  2XRS D;  1OXV A;  1NSN S;  2K32 A;  4GLV B;  2F0L A;  2N78 A;  4A3G B;  1DM0 B;  4IFD J;  2OXP A;  4DFA A;  2UU9 Q;  2BH8 A;  3G6J B;  2L5T A;  4FF2 A;  3KJO A;  4LNQ A;  2K03 A;  3ER0 A;  1ET6 A;  3I73 A;  1VQM A;  3AQQ A;  4IN3 A;  1QB5 D;  1S5B D;  3AEV A;  4DV4 Q;  1F9P A;  1EWC A;  4AH6 A;  2R92 G;  4C56 C;  4G7O C;  3FP9 A;  3W3A A;  1Q7Y C;  5GAG C;  4ZLT F;  2LXJ A;  5G3L F;  2Q8I B;  1WVL A;  2N55 A;  2ZJQ A;  2JA7 H;  3ICE A;  3PF4 A;  1AP0 A;  1I94 Q;  2Z6B A;  1XYI A;  2M2L A;  4KI0 A;  2B2V A;  1KDC A;  2D5D A;  2VQE L;  1Q12 A;  1D1I A;  2B8G A;  4H13 C;  2QA4 A;  4BY7 B;  2O2L D;  1BOS A;  2DY7 A;  4IOC A;  2HHH Q;  4O2D A;  1SYB A;  4Q0F A;  4JI8 Q;  4HJ7 A;  1ENF A;  3BS1 A;  4JI0 Q;  1CSP A;  3D6W A;  4A93 G;  4DUZ L;  4K8I A;  1SNM A;  3KLW A;  1RKN A;  1VQG A;  4R4O A;  2F0K A;  1VQO A;  3T51 B;  1YZ6 A;  1JQY D;  3BZD B;  4POF A;  4DK1 A;  4ULL A;  4I65 A;  3JAM E;  1A8V A;  1PA6 A;  2F03 A;  4I7Z C;  1M90 C;  1IBK Q;  4DR1 L;  4C3H H;  4OO1 I;  3M4O B;  4YIJ A;  1TWG H;  4IO9 A;  1XNR L;  1MGS A;  2Q8T A;  3D4R A;  2LS0 1;  4GKK L;  2WFW A;  4X62 L;  3HOZ B;  1K8M A;  4DR4 L;  4BY1 G;  4X6A H;  2PMZ E;  1JMC A;  1K73 C;  5C4J H;  3TEH B;  2PPB C;  1B2T A;  1QOH A;  5CV6 A;  3W1G A;  1D5X C;  4KY5 A;  1S5F D;  1SMY C;  1SYF A;  1ML0 D;  2B2V C;  2LSS A;  3VYS A;  4ZYS A;  1PHJ A;  1ILP A;  2E5L L;  3PO2 H;  5CMD A;  1N8R C;  4GN3 B;  3C3L A;  1D5M C;  4LW1 A;  2Q2I A;  4IUN A;  1EFW A;  3ERS X;  1K8G A;  3S1R H;  1AZP A;  1LTB D;  2D9U A;  2MO1 A;  3X3M A;  3TS0 A;  3W2D A;  5EPK A;  4IAL A;  1RD9 D;  1STE A;  4IUR A;  4G7H C;  4WRD A;  2VUM H;  1F9S A;  1YHA A;  3MXG A;  3PO3 G;  1Y8P B;  3OWF A;  3Q8D A;  5FJ8 H;  2WAQ E;  4OHJ A;  1VQI A;  1SYD A;  1SE8 A;  4IQZ A;  1RF2 D;  2ATW A;  4JI7 L;  4IUU A;  2F3W A;  3H3V C;  5IP7 H;  3EIV A;  2NVQ B;  1JOO A;  1I3Q B;  2B2W A;  2B2T A;  1JOQ A;  4EQ5 A;  2SNM A;  3MEH A;  1UE5 A;  2I5H A;  4KJN A;  4IFD H;  2NB0 A;  4B3S Q;  3CQZ H;  4C3J B;  1BNZ A;  2B8F A;  1Q8I A;  1W6J A;  4PMB A;  4GN4 B;  4IJH A;  4RGM A;  4FF1 A;  2DN8 A;  1P8L A;  1W6K A;  3GQB A;  3MA2 B;  4JOI A;  3BVZ A;  3R2T A;  1VCI A;  3Q23 A;  4DR6 L;  3OPO A;  3KF6 B;  1UE1 A;  2EJF C;  4P72 A;  4R4T A;  3GTL H;  2JA6 H;  2ID0 A;  4A3G G;  1QZG A;  4N9P A;  2F0E A;  3I4O A;  4OEM B;  3A54 A;  2UUC Q;  4MN3 A;  2WII B;  1LLR D;  4RGT A;  2BDO A;  1DZ1 A;  4DV0 Q;  2O4X A;  4O1N A;  3A5U A;  1O7Z A;  4TSS A;  1GUO A;  1T9H A;  3FKI H;  2EYO A;  3K58 A;  4A3L H;  5C4X B;  3IRB A;  5EGT A;  5M5W H;  2QKI C;  4N9T A;  1U4L A;  2KEC A;  4DK0 A;  1SSO A;  1DOM A;  4G7Z C;  4XQQ A;  1E0B A;  3SEB A;  1VQE A;  1WCM G;  4DR2 Q;  5ELE A;  4BY7 G;  1BO0 A;  3P20 A;  2XIW A;  1ESR A;  3TQY A;  4JV5 L;  3HOU B;  1M8A A;  4BXX H;  2TMP A;  3ND8 A;  4JBM A;  3S9W A;  4JI3 Q;  4YWM A;  5IGB A;  5LHY 1;  4ID6 A;  1HFG A;  1KDB A;  1I4H A;  3EBE A;  4JOI C;  2JA5 H;  1TWA H;  3PUZ A;  2B39 A;  1BBU A;  3KF6 A;  2IHE A;  3OW7 A;  4YY3 Q;  1ENC A;  4DV4 L;  2BE5 C;  4G4K A;  3M7G A;  1QZH A;  2QW7 A;  4C1N K;  5FK9 C;  4X64 Q;  2VL6 A;  3CCQ A;  4EQO A;  2RDG A;  5FO9 B;  3I4N B;  3HEJ A;  1EL0 A;  4LMQ D;  4P74 A;  3K7A B;  4ME5 A;  2PNR C;  4LFB Q;  4K6D A;  4ZUJ A;  2OWO A;  3HOZ G;  1TY2 A;  5GAD C;  3ITP A;  4QCL A;  3KFU A;  1V1P A;  2OT2 A;  2RQX A;  3TRE A;  4JI8 L;  2F1M A;  2R93 H;  4JI0 L;  1KL9 A;  4AQY Q;  3M4Y A;  4IFD I;  1J5E L;  4A3I H;  1T5X D;  2AQ1 B;  1PLF A;  1B1Z A;  1PZI D;  4LUZ A;  3NTH A;  1X3G A;  4JW0 A;  1PH6 A;  1IBM L;  3I91 A;  3BG3 A;  4X3T A;  1HPC A;  5C0X G;  1SJE D;  1YNN D;  1QUQ B;  3S14 B;  2RHQ B;  3G4S A;  5BR8 L;  4R4Q A;  5JPN C;  3BDC A;  1R4P B;  4G57 A;  3T16 A;  3ULJ A;  5JEA J;  1L0X B;  4KKS A;  5M5X H;  5DM7 3;  1B3Q A;  2AWN A;  2OQ0 A;  4XXE A;  1VMC A;  1NMG A;  4UP7 A;  1GM5 A;  3ZJY C;  1PZJ D;  3PUX A;  4C3J G;  2K1B A;  4K5X A;  1LT5 D;  5HGQ A;  1A0I A;  2FMM A;  3GTK H;  4A3K H;  1EY4 A;  5JAV A;  3Q22 A;  1HQM C;  1MSH A;  2KHS A;  3M3Y H;  3WDN A;  1STA A;  4A3F B;  4CDE C;  5JJK A;  3EA6 A;  5KGU A;  5IYD G;  3CW2 C;  2RKS A;  5ELC A;  3D0F A;  1SFO B;  4BBS H;  1VQ4 A;  4MTK A;  4A4I A;  1JIC A;  4ILW A;  4PG3 A;  4FDB A;  1KAB A;  5LMN W;  1NJI C;  1IW7 C;  1Q86 C;  3CC4 A;  5C4X G;  5M5Y B;  3S2H H;  1NAP A;  2H1E A;  3GTQ B;  3OMC A;  4JBJ A;  1VF7 A;  4PNY A;  2YU9 B;  1CTM A;  1PFB A;  4EQP A;  1SE2 A;  2ZJP A;  5JJL A;  1SR3 A;  1R9T H;  1GOZ A;  1MHW C;  1FL0 A;  4UY8 C;  1EY6 A;  2L0C A;  2NUC A;  2PQA B;  1N34 Q;  2EOT A;  1L2F A;  2LFN A;  2EQS A;  1SE4 A;  4JYA L;  4LF6 L;  1EIH A;  3PUY A;  1AE2 A;  1Y1W B;  1KTK A;  1VQ5 A;  2Z4I A;  3HOU G;  5ELN A;  4YCV A;  2L9H A;  1D5Z C;  4RGN A;  3DM1 A;  2AQ2 B;  2FJ2 A;  5JVG 3;  3HOY H;  2WAC A;  3CPF A;  1CT1 D;  3IAY A;  1STG A;  2C9O A;  1GUN A;  2R7Z B;  2PMZ B;  4RFB A;  4QGU A;  4DV0 L;  3IFT A;  1CUK A;  1Y8O B;  2JXM B;  1I4Q A;  3H0G H;  3SK4 A;  2EZV A;  2DNC A;  1D8L A;  2E2J H;  2IWH A;  4CDD C;  1NE3 A;  5COR A;  1QNK A;  3EFX D;  3DWA A;  4F7X A;  2I46 A;  3LGJ A;  4HJ5 A;  3VR4 A;  2EYL A;  3I4N G;  4DV5 L;  1FGB D;  2R61 A;  2L4N A;  3NEM A;  3QOJ A;  2XGT A;  3E6Z X;  2F0V A;  4KD4 A;  1ZEQ X;  2GVA A;  2I0Q A;  1SYG A;  1K83 H;  1TKW B;  2JP1 A;  2KCN A;  2LMC B;  2NVT H;  3GTG B;  1S5E D;  2OQK A;  2PQA A;  1BKB A;  1VQH A;  5E4X A;  4C3I H;  4X65 L;  3D31 A;  1G91 A;  3AFP A;  1B44 D;  3W5O A;  4NXM L;  4BBR H;  4B3M L;  3SE0 A;  3GV6 A;  2VQE Q;  5EKI A;  4HSV A;  1AFP A;  3RZD H;  3K81 C;  2JEA I;  3U9S A;  4LFA L;  2HCI A;  4IUT A;  5C3E B;  3OTO L;  4RH6 A;  2HIV A;  2P5Z X;  2SOB A;  1B9N A;  5L37 A;  4XT1 B;  4KV6 A;  1PH4 A;  2A74 C;  4AYB E;  3NUC A;  3M85 A;  4KHZ A;  1KRS A;  3SK8 A;  4L5Q A;  3STB D;  3CKI B;  2B29 A;  3CD6 A;  4DUZ Q;  4LFB L;  1BCP D;  5CV7 A;  4OIK A;  3EQL C;  2NTS A;  1SMX A;  4JG2 A;  4DK6 C;  2WP8 J;  1A3V A;  4RHR A;  5M3M B;  4Y52 H;  1LT6 D;  1U5K A;  3Q24 A;  3S1M H;  5I6Y A;  4Y7N H;  1HR0 W;  3FEW X;  1NBW A;  4JI6 L;  1PTO H;  1C7Y A;  3K0Y A;  1HNZ L;  4GKK Q;  2R92 H;  3DHQ A;  4A3M B;  4DR4 Q;  2K6A A;  4ZAI A;  4K0K L;  4U67 3;  4NKL A;  2OTL A;  4AIM A;  2K5W A;  4R1J A;  3RZO H;  1HNW L;  3H94 A;  3M4Q A;  4RG1 A;  4A3F G;  1EOT A;  1L1O B;  4JI2 L;  4ZKC B;  2RSO A;  2CKZ B;  4U68 A;  4JI5 Q;  2R3Z A;  2CWP A;  4DGZ A;  4HMJ A;  3T53 B;  2E5L Q;  2F0Q A;  2HCC A;  2L15 A;  4R8I A;  1Z7T A;  1S3O A;  3QOL A;  1VQF A;  3KUP A;  4ZKB B;  3TZU A;  4DN4 M;  4RCO A;  3VA5 A;  4A93 H;  3TRZ A;  3OYY A;  3LWE A;  4NDX A;  3CCR A;  2ENB A;  1TS2 A;  1YNN C;  3SGI A;  1DON A;  5IP9 G;  5H1S E;  1X65 A;  4JI7 Q;  3NE5 B;  3I4M B;  2VZA A;  5IOD A;  1HZC A;  1K8O A;  2B2U A;  1G6P A;  1Y1W G;  1CK1 A;  1I4P A;  1MI2 A;  3T56 B;  4ZK9 B;  2QEX A;  1I6H B;  1C9O A;  4XDX A;  1HXY D;  2RDF A;  1WD1 A;  3GTO H;  1VQC A;  2E8G A;  2K75 A;  4BY1 H;  1A15 A;  2NVX B;  2R7Z G;  1RL2 A;  1K0S A;  2WB1 E;  1GUW A;  4RHS A;  5IYB G;  1VQ9 A;  3S16 B;  3Q0A A;  1V8Q A;  1SJH D;  2A5H A;  2AHO B;  2AMC B;  4DR6 Q;  3QIA A;  2EJM A;  3NQI A;  1VQA A;  1KXL A;  3RLO A;  4O0A A;  4K8J A;  4OWX B;  1PMR A;  4DAM A;  1SNO A;  1GHK A;  1F2M A;  1TVX A;  1BCP B;  4N8F A;  1WD0 A;  4HR7 B;  1AEX A;  3E0J A;  4FF4 A;  1BVS A;  1FNU A;  1CHP D;  4HCE A;  1C8C A;  3MFG A;  3U58 A;  1I4G A;  5KIX A;  1ZKO A;  3H15 A;  4A3D G;  1XTC D;  5EQ0 A;  4UDU C;  4ODG A;  4HN7 A;  1H9S A;  1E1O A;  3C1F A;  1QE6 A;  1U4M A;  3EVQ A;  4L8J A;  4PMW A;  3G71 A;  2B2U C;  2QDB A;  2H5X A;  3E5S A;  3GTM H;  1X3Q A;  3P7J A;  1Y1V H;  1KIX A;  4XT3 B;  5C3E G;  1CQF A;  4JV5 Q;  4A75 A;  1PRT D;  1S5D D;  1WTO A;  2UXD L;  1B3A A;  4IUQ A;  1Y69 U;  2GA4 B;  1U4P A;  1IL2 A;  1TU2 B;  1L1O C;  4C1N I;  2L1B A;  3LX0 A;  1SEB D;  2RCN A;  4YHH L;  1PFS A;  2YTV A;  5M3M G;  1VQB A;  4A3G H;  5JVH 3;  1OXU A;  3NEN A;  1X3P A;  1X55 A;  1IBL L;  3RR5 A;  3AYH B;  3CRL C;  3HG9 A;  2IW3 A;  1UE6 A;  4CDF C;  3PGZ A;  1Z47 A;  3J81 L;  4KY6 A;  2A8V A;  4P73 A;  5ELF A;  4PMC A;  5D65 A;  1WTV A;  1VQ7 A;  2JA7 B;  4QY7 A;  2K01 A;  4A3M G;  2MNA A;  1OXX K;  2A69 D;  3IKJ A;  2F0F A;  1EFI D;  3T1H L;  1ZYR C;  5C3W A;  1Q1E A;  3NWS A;  2VS1 A;  4ME3 A;  5C44 H;  1X3E A;  2A19 A;  1WCM H;  1VDZ A;  4XQJ A;  3K6O A;  1J5E Q;  1L0Y B;  1O7I A;  4R4C A;  2ZXR A;  3PSI A;  1XMO Q;  3OHX C;  1NY4 A;  2XN9 C;  4DV7 L;  1GHJ A;  2JSO A;  1IBM Q;  3SHL A;  5E4W C;  2ZXP A;  3F2C A;  1BF4 A;  1B7Y B;  1M1K C;  1E2Z A;  1I4X A;  3S17 H;  5BR8 Q;  1K8A C;  1BDO A;  3I72 A;  5D14 A;  1HUN A;  4C3H B;  2JE6 I;  5G3L D;  2WKD A;  1TWG B;  2CH4 W;  3DM3 A;  1MSG A;  4NW2 A;  3DEO A;  1Q82 C;  1K3R A;  1TY0 A;  1C0A A;  3S2D B;  3I4M G;  2NWG A;  1BCP C;  3Q6S A;  1CKN B;  1D2B A;  5C4J B;  3M4O H;  5COY A;  4K2L A;  1F2Z A;  4JI5 L;  4KD3 A;  2CWA A;  3HOZ H;  3C46 A;  2JJQ A;  4OX9 L;  1F9Q A;  1LT4 D;  1QNU A;  2PI2 A;  1K9M C;  2JQO A;  5LMN L;  3M7N A;  3MVV A;  1EQR A;  2FFK B;  3PO2 B;  1XX8 A;  2G9D A;  4H0L C;  1F9R A;  4DU9 A;  3MFY A;  3CC2 A;  4FO2 A;  2BOS A;  1PRT B;  3BYT B;  3GD7 A;  4CGY B;  3S1R B;  2ES2 A;  1E24 A;  3BDL A;  3PIO 3;  1F77 A;  1CHQ D;  1EQT A;  1V1Q A;  1ASY A;  3HOX B;  2QDL A;  3K59 A;  1B50 A;  2D62 A;  3FDT A;  3PIO A;  4GZY C;  1ESF A;  2UUA L;  5ELD A;  4KKU A;  1CQV A;  3CCV A;  2MGS A;  4MZ9 A;  4DV6 L;  3E0E A;  4IUV A;  3SR1 A;  3VR2 A;  3J81 c;  5I2Y A;  1YNX A;  2EYM A;  2F0D A;  3CQZ B;  1JJC B;  1HCZ A;  2B63 H;  4DV3 L;  2RCF A;  5IT9 L;  2XTI A;  1MJE A;  2NVQ H;  1RJT A;  1I3Q H;  4JYA Q;  3RD4 A;  4LF6 Q;  5NUC A;  1PVO A;  1EU4 A;  1JE5 A;  4C2M H;  2X69 A;  4C3J H;  2DJG C;  3WOF A;  3BJU A;  5DNF A;  1A3T A;  2HUG A;  1KHI A;  2OF1 A;  5CGK A;  2CW0 C;  4A3E H;  2F0N A;  1XPU A;  4UP9 A;  2A68 D;  3BU2 A;  4QUC A;  4NXN L;  2EY1 A;  4A3B B;  1WTX A;  5IYD H;  3WWV A;  1DYQ A;  3CXC A;  2UXB Q;  5IGF A;  4OON A;  3FKI B;  4J1M A;  1CZW A;  1NNX A;  2PCF B;  1LTG D;  3TSS A;  2DJF C;  1IXR A;  3J7A V;  5M5W B;  4DV5 Q;  3QWN A;  5EPL A;  2ICE C;  4ZRZ A;  2SEB D;  2JA7 G;  1Z6H A;  4QIW B;  1YIJ A;  3KBG A;  3MTS A;  1A2U A;  1MBY A;  2JN4 A;  3TP7 A;  4NP5 A;  3A74 A;  5J1Z A;  2V1C C;  2K50 A;  3J81 j;  4EGV A;  1A3U A;  3GTP B;  4X65 Q;  2BCO A;  1MKH A;  4OWW B;  1YNJ D;  1LV9 A;  1U4R A;  4NXM Q;  1VQJ A;  3I55 A;  4B3M Q;  3R93 A;  2K5V A;  2MP1 A;  3J7A F;  2JA5 B;  2ALY B;  4FVM A;  4RWS C;  5I6W A;  3S15 H;  4LFA Q;  4LF8 Q;  1TT2 A;  3OTO Q;  4UPA A;  1I50 H;  4FP5 D;  1XMQ L;  4F88 A;  2EYJ A;  1IKL A;  3KLS X;  5KEE A;  2PZT A;  1B9M A;  1YHQ A;  3OMG A;  4C3H G;  2Q2U A;  2WB1 B;  1PRT C;  3PV0 A;  4RAU C;  2KUM A;  5IWA L;  1Y14 B;  4LFC L;  1TWF B;  1ET9 A;  3HS0 C;  4KK7 A;  3FMC A;  1TS4 A;  3HKZ E;  4JI6 Q;  5A2Q L;  1H9K A;  3S24 A;  4KHV A;  3B6Y A;  1XNQ Q;  3K7A H;  3SK5 A;  1PH8 A;  4FXK C;  4X66 L;  1HNZ Q;  3CAM A;  1GKH A;  3UDF A;  3S1N H;  1EUJ A;  5IT9 c;  3K0X A;  2B2Y C;  5EBC A;  1XMO L;  4K0K Q;  4A3I B;  4X3K A;  3PO2 G;  2K28 A;  1HNW Q;  4KN7 C;  1SAP A;  4JI2 Q;  4PZ7 A;  3HOW B;  5EKL A;  3E3X A;  3KYH C;  2A69 C;  1XTD A;  1O80 A;  1G8Z D;  3BDO A;  2NVY B;  3HKS A;  1DXM A;  1JCK B;  3HOX G;  1S40 A;  5KNC A;  3K80 C;  2EYF A;  5IT9 E;  4F87 A;  1RIP A;  5BN4 A;  1D7Q A;  2EY6 A;  1HZ9 A;  3MXP A;  1NCV A;  2BA1 A;  2JYO A;  2I5M X;  5M5X B;  1II3 A;  2CFM A;  2K52 A;  4GN5 A;  2Z6K C;  1PTO F;  2SNS A;  2A6E D;  2F4I A;  1ONL A;  1ROD A;  2Z9H A;  3A55 A;  2F0J A;  5FLM G;  2MQH A;  3SVM A;  2E2D C;  1N36 L;  5K5P A;  3AMU A;  4A3K B;  2YV5 A;  2CH4 A;  3CP0 A;  5A35 A;  1CA5 A;  2K4K A;  3K7U C;  3SK6 A;  3M3Y B;  2BH2 A;  4Q5V A;  5D3I B;  1LYL A;  2XRQ D;  1VS0 A;  3OIP A;  1EIF A;  3NTK A;  4FXG C;  4BBS B;  3CU7 A;  3MWY W;  4O42 A;  3A8I E;  4A3F H;  3PQI A;  2OTJ A;  1QUQ A;  4A3B G;  1EWH A;  5K36 H;  1SFO H;  3UDI A;  1S4Z A;  4RCN A;  2NYZ D;  3T13 A;  5KND A;  1R9T B;  3LNN A;  4MTN A;  3QG1 A;  2KCC A;  4UP8 A;  3GTQ H;  2IX3 A;  3GTJ B;  3S1Q B;  2KOL A;  1LTI D;  1KLG D;  2F0T A;  4DPG A;  1EY9 A;  1JWS D;  2IHF A;  2E2I H;  5IP9 H;  2BDN A;  1VQ6 A;  4BXX G;  1DJR D;  1H95 A;  2H4O A;  4WOR A;  2XWB B;  2JA5 G;  2HD3 A;  2RVL A;  3J7Y W;  1CA6 A;  1U9R A;  2RBM A;  4B08 A;  2UXB L;  2I5L X;  3H0G B;  2E2J B;  3K8A A;  4CBV A;  5KNB A;  2F0M A;  1CFM A;  1KAW A;  2UXD Q;  3KF8 B;  2HT1 A;  2R7Z H;  1STN A;  1HJP A;  1V43 A;  4QF4 A;  3QB3 A;  3G7L A;  2WB1 G;  3G6E A;  1SRU A;  4Z9C B;  2KHJ A;  3JC6 6;  4CHT B;  4YHH Q;  1G2T A;  1HUM A;  2D2C C;  2F0O A;  3KK7 A;  1IBL Q;  1Y8N B;  3SDZ A;  1K83 B;  4H44 C;  2NVT B;  4EQN A;  1HA6 A;  3KDF B;  1GXD C;  2WAQ B;  1Q46 A;  2EYP A;  4OEL B;  2AQ3 B;  4A3C G;  2CHB D;  3VYR A;  3L9A X;  2K05 A;  4A3D H;  4LF8 L;  4CJ2 C;  1VQL A;  4LF9 L;  3NTI A;  5IY0 A;  4DR5 L;  2XSC A;  3T1H Q;  3HOW G;  4IPC A;  2M9V A;  4P71 A;  3J7Z C;  4DV1 L;  4LF7 L;  3DLL A;  2E2H B;  3DWQ A;  5HGT A;  1N32 L;  4JI1 L;  1UAP A;  2KED A;  3L2P A;  4DXF A;  1BBX C;  1JR0 D;  4LJZ C;  3N6R A;  1TWH H;  4DV7 Q;  4HIO A;  2DY8 A;  1LTA D;  1GUS A;  1PXU A;  1TQO A;  3NK9 A;  5LMU L;  3KF8 A;  3S1M B;  3I3C A;  1IZ6 A;  1EEI D;  3UI2 A;  1CSQ A;  2XVS A;  2D0P A;  1XNQ L;  1EYC A;  2OEO A;  2HIX A;  4JBW A;  2L55 A;  3MHB A;  5LL6 X;  1E3P A;  1UNS A;  4KTA A;  5ELB A;  5T1G A;  3IL8 A;  1O7L A;  4JC0 A;  1STY A;  4DF7 A;  1ENA A;  3MEF A;  4A3K G;  2D0O A;  2XNA C;  3DMU A;  3ONA B;  1N9W A;  2O5I C;  1EIY B;  4LF4 Q;  4J8Q A;  1A63 A;  3AB9 A;  3KDF A;  2QCP X;  1OXT A;  2JA9 A;  2UUB L;  1W2B A;  4A3M H;  4OX9 Q;  4BS9 A;  2VNU D;  5LMN Q;  4TQU S;  3VDY A;  5AJ3 L;  1G6Z A;  1LO5 D;  1G51 A;  3HOV B;  4DR3 L;  1Q81 C;  1E1T A;  1KNA A;  3IFD A;  3U50 C;  2MUY A;  3BZC A;  4V0B A;  4GKJ L;  2CQO A;  4DNR B;  3A8K E;  5IGD A;  1WJJ A;  3MZ5 A;  5IYC G;  3KLS A;  1VF5 C;  4QQB X;  1PH2 A;  3PCO B;  3WOE A;  5GRO A;  4JCV E;  2UUA Q;  2HDL A;  2KQ3 A;  1LUZ A;  1NUC A;  1TWC H;  2ZJR A;  4YWL A;  4DV6 Q;  2IX0 A;  3M9B A;  2J7Z A;  3SXH A;  1EU3 A;  1D1K A;  1HZA A;  3J80 L;  4MNO A;  4ZCK A;  1EY0 A;  2KHI A;  1S5C D;  5F2D A;  4I7A A;  3DWP A;  4NPS A;  4BA1 I;  1SNP A;  5DAU A;  1EY8 A;  4L6T B;  3TDQ A;  3MAQ A;  1PFN A;  2LY7 A;  4DV3 Q;  1MIU A;  4N8X 1;  3GTO B;  4BY1 B;  3L3O C;  5HY6 A;  5C4H A;  2TSS A;  1D6E C;  1L1O A;  4ZUI A;  4DKA C;  1UEB A;  3HKZ B;  4A3J B;  3H0G G;  1I6H H;  3A8J E;  5M3F B;  3JAM L;  1LTR D;  1UEA B;  3NEL A;  1DGS A;  4CJ1 B;  4PZ6 A;  4MIU A;  1ZXT A;  1PYW D;  2JA8 B;  1RCV D;  2PQE A;  5CR3 A;  1H9R A;  4HSP A;  2KBN A;  1V1O A;  4KLK A;  4JVZ A;  2N8N A;  4NXN Q;  5C6A A;  3L0O A;  3V2T A;  4E6I A;  2VW9 A;  3H09 A;  3G48 A;  3GV3 A;  2ASB A;  2Y0S E;  4V19 0;  4RGO S;  3PF5 A;  1EWI A;  3MXN B;  3PO3 H;  2IPK D;  1OTC A;  2K7V A;  5I9O A;  4FYD A;  3DEP A;  2O5J C;  4J6H A;  2WAQ G;  5DEH A;  3RN5 A;  4K6L A;  4CKC A;  4JBK A;  3CCM A;  1CKO A;  2E76 C;  1XJV A;  5JEA G;  5C0X J;  1EYG A;  1YJ9 A;  1WFQ A;  4IJL A;  2RDH A;  2VQF L;  1Y1V B;  2EVB A;  4S3S A;  2VB2 X;  4FXD A;  3RLF A;  4B3T L;  3LWU A;  1VQK A;  2PZW A;  4BA2 I;  3OOC A;  2BE5 D;  1KD1 C;  2NN6 G;  1EZ8 A;  1PV4 A;  5JOB A;  3R3O A;  4RMF A;  3QR8 A;  4WJ4 A;  4L5T A;  4HTH A;  1HR0 Q;  1C4Q A;  3TS2 A;  1FNW A;  2RHS B;  3BVM A;  1OO9 B;  2MFI A;  2WV6 D;  5HUR A;  1J8I A;  1SBB B;  1XMQ Q;  2N88 A;  3H3V H;  1EYD A;  3J7A 5;  2G9H D;  3I56 A;  1E22 A;  1JOR A;  1XXG A;  2XWJ B;  2J4X A;  4M1U B;  2K14 A;  5IWA Q;  1SDF A;  2MPM A;  4L5S A;  4LFC Q;  2KEE A;  1FJG Q;  1BUV T;  2EJG C;  2LKV A;  3MXN A;  1UUP A;  3J80 c;  5E3F A;  1KLU D;  4EX5 A;  1HFN A;  1JE4 A;  1WTP A;  2HDM A;  1GJX A;  3RUZ A;  4X66 Q;  5CV9 A;  3AFQ A;  2CCZ A;  2WIN B;  2QIL A;  1V9P A;  1H9J A;  5C44 B;  4BY7 H;  4HMI A;  1WCM B;  3ERO A;  1E7Z A;  3U9O A;  4B9W A;  3I90 A;  1VQN A;  3HOV G;  1EQQ A;  1I5F A;  1KC8 C;  3JAM c;  4HIK A;  4P75 A;  3J80 E;  4OWT B;  2F4V L;  1WTW A;  4R8N A;  3V05 A;  5I9P A;  2J0T D;  3S17 B;  3QO2 A;  1YJN A;  3VYU A;  2L11 A;  4JI4 L;  5FOB B;  3STB C;  2KVM A;  4HJ9 A;  1K3B C;  3A0J A;  4LF4 L;  2QEJ C;  1QVF A;  1IYV A;  2CQA A;  4DNT B;  5C5L A;  4X3U A;  4DNI A;  1GVP A;  1EOV A;  1SNQ A;  3BYY B;  4TKO B;  3A7A B;  3FVQ A;  4B3R L;  5EAY A;  1JWM D;  3E9H A;  3ERQ A;  1SLJ A;  1L0W A;  3S2D H;  3BVG A;  4LWC A;  2FMC A;  2AWO A;  2Z4H A;  4R9W A;  4DR7 L;  4GS3 A;  2PW7 A;  1N36 Q;  5GAE C;  3HGB A;  4XTC S;  3UE0 A;  1IKM A;  4XYQ A;  3HKZ G;  2FXQ A;  3RLN A;  4A3J G;  3D4W A;  3PUV A;  4OO1 G;  3PMF A;  3AU7 A;  2YTY A;  5M3F G;  1SRO A;  2Q2T A;  4TRD A;  2NZO A;  1EEF D;  1IW7 D;  1JB3 A;  2Z0S A;  2QF7 A;  2JA8 G;  3VR6 A;  2UXC L;  4OGQ C;  2VUM B;  1YBY A;  4R4I A;  5C0X H;  2PZU A;  4F8M A;  1LAB A;  3A7L A;  2X6G A;  4OL7 A;  5GAH C;  5KYL A;  4JK1 C;  1BXT A;  4GLX A;  3H6M A;  4LF5 L;  1QVC A;  4AYB B;  4P2C B;  4MHE A;  1UWV A;  3T1Y L;  2Q2H A;  1O78 A;  4KHP L;  2KA7 A;  3HOX H;  4CDC C;  3HZX A;  1FD7 D;  1LM0 A;  4H7B A;  4L5R C;  1ICF B;  3H3V I;  3CME A;  1PH9 A;  2EIF A;  4K2K A;  3R8B A;  1CKN A;  1PFM A;  1F2Y A;  2F0G A;  2B63 B;  2WKC A;  1YJW A;  1SXT A;  3D8G A;  1LTL A;  4NB3 A;  1Y1V G;  2NBF A;  5AFW A;  1B8A A;  4C2M B;  3GTL B;  1KNE A;  3J81 E;  1R4Q B;  4OXP A;  2JA6 B;  5FLM H;  5CYU A;  2Q8R E;  4XQN A;  3PIP 3;  3A5Z B;  3GDE A;  3MC0 B;  4LUV A;  5T1I A;  1GUG A;  2RSN A;  2ZM6 L;  4A3E B;  1I4R A;  1CKM A;  1TS3 A;  3PIP A;  1HHV A;  2AUK A;  4IPD A;  3VA7 A;  4KJO A;  5EKK A;  3FHW A;  1K28 A;  1QG7 A;  3P75 A;  4HID A;  2ZTC A;  2JEB I;  3CCU A;  1F2L A;  2VXW A;  3NWT A;  5I2X A;  2RF4 A;  3F8T A;  5ELO A;  1GD7 A;  1N33 L;  4A76 A;  4A3B H;  5C4X H;  4HJA A;  1WI5 A;  2B2Y A;  4LAA A;  1FR3 A;  2DUD A;  4DV2 L;  3DXJ C;  1X6O A;  2EY2 A;  1V1P B;  3J80 i;  1OXS C;  3OSO A;  5KYI A;  1STH A;  3K5O A;  5BN5 A;  5DLQ E;  3CPW A;  2M00 A;  2F3I A;  1JOK A;  3E9I A;  5C44 G;  1JWU D;  2IX1 A;  3KOJ A;  5C5M A;  3W1B A;  1HR0 L;  2B2W C;  1TWA B;  2B2T C;  3EJI A;  3NPP A;  4K14 A;  3HOU H;  4HCS A;  3GP7 A;  1PDQ A;  4LF9 Q;  4DR5 Q;  3GTP H;  5I4D A;  4LK1 C;  3URY A;  3JAM i;  3S15 B;  1Q3L A;  1O7Y A;  4X3S A;  4DV1 Q;  1I50 B;  4LF7 Q;  2Z6K A;  1S72 A;  4IPG A;  2UU9 L;  2F52 A;  1N32 Q;  4JI1 Q;  4YCW A;  5J22 A;  3VYT A;  3OW2 A;  2YYZ A;  2PO4 A;  2R7D A;  3ULL A;  1FJG L;  1PZK D;  1PH7 A;  3CCL A;  2NZ1 D;  1WTH A;  1Z9F A;  1QCB D;  5LMU Q;  4IOA A;  4CKE A;  3K57 A;  3I4N H;  5C0X I;  1G29 1;  2EE1 A;  4OIJ A;  4PZ8 A;  3I2Z A;  1VQP A;  5CBE E;  2R93 B;  1HNX Q;  1I94 L;  2FHT A;  2HQE A;  4UAI A;  1TWF H;  1WYD A;  4IPH A;  4GNX B;  3S1N B;  1DOL A;  2DGY A;  2E74 C;  2FIN B;  5FKA C;  2EPB A;  5FO8 B;  1XPR A;  2Y0S B;  2HHH L;  1SN8 A;  5ISR A;  1A62 A;  1IHZ A;  2N49 A;  5IGG A;  4ABN A;  1B53 A;  3BZK A;  1J9O A;  4A3C H;  1SE3 A;  1YEZ A;  2UUB Q;  2NTT A;  4CKB A;  2JK8 A;  2VUM G;  4B9X A;  5FJ8 G;  5AJ3 Q;  3GO5 A;  2EXD A;  1QVG A;  3HOW H;  4GOP B;  1EQV A;  3S14 H;  4DR3 Q;  5IIF A;  3TME A;  5IP7 G;  4AYB G;  2GN5 A;  1AZQ A;  1IBK L;  3J81 i;  2NVY H;  5CV4 A;  3KBX A;  4GKJ Q;  4IFD G;  2PW5 A;  1IYU A;  1KRT A;  3NQT A;  3MXU A;  1MJC A;  4DUY Q;  3FPU B;  2MHV A;  2GVB A;  2IT1 A;  4HAE A;  3GTK B;  2B63 G;  4EVO A;  2A73 B;  2K33 A;  1A2T A;  2OCE A;  1K0R A;  3KLR A;  4ZQ3 A;  1KAA A;  2MJ8 A;  2NZH A;  1J6Q A;  3NSW A;  2JA6 G;  1C48 A;  3M4P A;  1B4O A;  3CCJ A;  1X56 A;  4GNX A;  2ZT9 C;  1TXY A;  3PUW A;  1FNV A;  1GO3 E;  4DXG A;  4JPB W;  3CCE A;  2IJ0 A;  4A3E G;  2R7F A;  1BR9 A;  4RA8 A;  4FF3 A;  3V96 A;  4BWG B;  5D3D A;  3FKI G;  3F1Z A;  1JJG A;  1X3F A;  4A3L G;  2R6G A;  1IL8 A;  3P1H A;  1XPO A;  3S2H B;  1HRJ A;  2A6H D;  1PTO D;  2IL8 A;  4K5W A;  3ZYY X;  1SYE A;  5TSS A;  1EZ6 A;  4GOP A;  1SYC A;  3VR5 A;  5M5Y H;  1PYS B;  1RDP D;  5KRU A;  3ND9 A;  3EN2 A;  2YU9 H;  2PI2 E;  1JB7 A;  5JPM C;  1AN8 A;  1HQR D;  4WJ3 M;  1H9M A;  1QJO A;  4B3S L;  5IYC H;  3ULP A;  2G5D A;  1EY5 A;  4DAV A;  1HTL D;  4H02 A;  4CJ0 B;  1EY7 A;  4HED A;  2HQL A;  5IE8 A;  2ZTE A;  1PH5 A;  2E2I B;  2CVR A;  3HOY B;  4QL5 A;  3T4A C;  1PYB A;  1RHP A;  2F0P A;  3GTJ H;  1Y1W H;  3S1Q H;  3UE1 A;  2N3S A;  2ZXO A;  3TZD A;  1RTO A;  1QWY A;  4WFN 3;  2VQF Q;  5J39 A;  5E1F A;  2L12 A;  3D3R A;  4DA2 A;  3FPP A;  5A2Q E;  2A1A A;  1M4V A;  4GNX C;  4B3T Q;  3CC7 A;  4RKL A;  1ASZ A;  2UUC L;  3C1E A;  5IYB H;  4LUO A;  2F0H A;  3A56 A;  4POG A;  1FVI A;  2C5C A;  1U0L A;  3RMH A;  3H91 A;  5C4Z A;  3CF5 A;  2ICI A;  2A68 C;  1BCP F;  5CC4 A;  1A6X A;  1ICW A;  3NBH B;  1WTQ A;  4GOP C;  2R93 G;  2VY3 A;  1E2W A;  2C35 B;  4C3I B;  5GQO A;  1YIT A;  3CMA A;  1Q1B A;  1LT3 D;  1ZYR D;  4APV A;  2KJX A;  4QJF A;  5J3B A;  4BBR B;  4DR2 L;  3D4D A;  4A3I G;  1YI2 A;  1EYA A;  3X3N A;  3TP8 A;  3GTG H;  3RZD B;  5FLX L;  3F2U A;  2Y0S G;  2EY5 A;  4A3D B;  1QIL A;  1GUT A;  4JI3 L;  2X6L A;  1KDA A;  3HP3 A;  4KMU C;  5EPJ A;  2BA0 A;  5DM6 3;  1B70 B;  1YHB A;  5C3X A;  4KY7 A;  5JEA H;  2AUJ D;  1NR2 A;  3I8Z A;  3CHB D;  4PQX A;  4YY3 L;  5C3E H;  1HZB A;  2MO0 A;  4DAY B;  4NMZ A;  2AKW B;  1YNJ C;  2F0S A;  1LTT D;  1TWH B;  2E2H H;  4X64 L;  1EIG A;  2NN6 H;  4Y7N B;  4KKT A;  4WJW A;  5IOC A;  2F4V Q;  1PTO B;  2F0I A;  5EJW A;  1HNX L;  2E75 C;  5JJI A;  1PH1 A;  5M3M H;  1G2S A;  5JJZ A;  2V4D A;  3VR3 A;  1SMY D;  3OIQ A;  2R92 B;  4JI4 Q;  1W3S A;  1IYJ B;  2SDF A;  1AW7 A;  3NXW A;  1SNC A;  1NR4 A;  2K5H A;  5LL6 S;  2F0U A;  1X9N A;  3NBH A;  3RZO B;  1ILQ A;  3RN2 A;  1Q90 A;  1VMP A;  3OWE B;  2RA4 A;  2EDG A;  3NP8 A;  4XYO A;  1WOC A;  4DR1 Q;  1LAC A;  1XNR Q;  4B3R Q;  4AQY L;  1E2V A;  2I07 B;  2LXK A;  4X62 Q;  3K5N A;  1NMF A;  3UDG A;  4K5V A;  4PV1 C;  4BBS G;  4IUP A;  4DR7 Q;  5CV5 A;  2ZTD A;  2F0W A;  5CV8 A;  2YTX A;  1FGU A;  5EBD A;  3QJY A;  1X32 A;  3U4V A;  3DUZ A;  4HIM A;  1JC7 A;  3CRK C;  3L7Z C;  1HH2 P;  4YCU A;  3N52 A;  1UE7 A;  3TP6 A;  4YWK A;  3F2B A;  5K36 G;  4A93 B;  4TVA B;  4DUY L;  1P16 A;  4DAY A;  1CZG A;  2UXC Q;  1FYC A;  1AH9 A;  1TII D;  4KN4 C;  1NTG A;  3HOV H;  2KCM A;  1VQD A;  4QIW E;  4FNF A;  3TN2 A;  1HA5 A;  1I6V C;  3RNU A;  2QGQ A;  1HTP A;  4LF5 Q;  1SND A;  2K5D A;  1TWC B;  1TS5 A;  1DCZ A;  4QUF A;  3T1Y Q;  2PNH A;  1T5E A;  4KHP Q;  3C2P A;  1XWE A;  4XIG S;  2K5Q A;  2A6E C;  1KQS A;  1H9S B;  3I4M H;  4QB4 A;  3UDX A;  4J15 A;  4QMG A;  3HOY G;  3K5M A;  2PYK A;  4ALP A;  5FLX c;  3HFZ B;  1TR5 A; 
#chains in the Genus database with same CATH homology
 3FRP B;  2EYH A;  2CW0 D;  1DD2 A;  1STB A;  1CI3 M;  4RKB A;  1MD2 D;  1BQQ T;  2Z1C A;  5FO7 B;  4IZ8 A;  1RTN A;  3O13 A;  5BN3 A;  5IGE A;  1PRT F;  3I4L A;  4OO1 H;  5FLX E;  2DNE A;  1LTS D;  4M8A A;  5CBA E;  5IGC A;  2VB3 X;  2Z8L A;  3I70 A;  3TBI B;  5M9O A;  2K04 A;  3PO3 B;  4DAP A;  3HRZ C;  2NN6 I;  3NHH A;  1CM9 A;  4C3I G;  1WTR A;  3NBI A;  1DOK A;  2A6H C;  1PTO C;  3R2I A;  2F3V A;  3GTM B;  3K5L A;  3TP5 A;  4L63 B;  2EXZ A;  3D6C A;  2XRS D;  1OXV A;  1NSN S;  2K32 A;  2F0L A;  4A3G B;  1DM0 B;  4IFD J;  2OXP A;  4DFA A;  3G6J B;  2L5T A;  4FF2 A;  2K03 A;  1ET6 A;  3I73 A;  4IN3 A;  1QB5 D;  1S5B D;  1F9P A;  1EWC A;  4C56 C;  4G7O C;  3W3A A;  4ZLT F;  5G3L F;  2Q8I B;  1WVL A;  2N55 A;  1AP0 A;  1XYI A;  2M2L A;  4KI0 A;  2B2V A;  1KDC A;  2D5D A;  1Q12 A;  1D1I A;  2B8G A;  4H13 C;  4BY7 B;  2O2L D;  1BOS A;  2DY7 A;  1SYB A;  4Q0F A;  1ENF A;  3BS1 A;  3D6W A;  4K8I A;  1SNM A;  1RKN A;  2F0K A;  3T51 B;  1JQY D;  3BZD B;  4DK1 A;  4ULL A;  4I65 A;  3JAM E;  2F03 A;  4I7Z C;  4OO1 I;  3M4O B;  4YIJ A;  1MGS A;  2Q8T A;  3D4R A;  2LS0 1;  3HOZ B;  1K8M A;  2PPB C;  1B2T A;  1QOH A;  5CV6 A;  1D5X C;  4KY5 A;  1S5F D;  1SMY C;  1SYF A;  1ML0 D;  2B2V C;  3VYS A;  4ZYS A;  1ILP A;  5CMD A;  3C3L A;  1D5M C;  4IUN A;  1AZP A;  1LTB D;  2D9U A;  3X3M A;  3W2D A;  5EPK A;  4IAL A;  1RD9 D;  1STE A;  4IUR A;  4G7H C;  4WRD A;  1F9S A;  3MXG A;  1Y8P B;  3OWF A;  4OHJ A;  1SYD A;  4IQZ A;  1RF2 D;  4IUU A;  2F3W A;  3H3V C;  2NVQ B;  1JOO A;  1I3Q B;  2B2W A;  2B2T A;  1JOQ A;  2SNM A;  3MEH A;  4IFD H;  4KJN A;  2NB0 A;  4C3J B;  1BNZ A;  2B8F A;  1Q8I A;  1W6J A;  4PMB A;  4RGM A;  4FF1 A;  2DN8 A;  1W6K A;  3GQB A;  3MA2 B;  3BVZ A;  1VCI A;  3R2T A;  3Q23 A;  3OPO A;  2EJF C;  2ID0 A;  4N9P A;  2F0E A;  3A54 A;  4MN3 A;  2WII B;  1LLR D;  4RGT A;  2BDO A;  1DZ1 A;  2O4X A;  4O1N A;  1O7Z A;  4TSS A;  1GUO A;  2EYO A;  3K58 A;  5C4X B;  5EGT A;  2QKI C;  4N9T A;  1U4L A;  2KEC A;  4DK0 A;  1SSO A;  1DOM A;  4G7Z C;  4XQQ A;  1E0B A;  3SEB A;  5ELE A;  1BO0 A;  3P20 A;  2XIW A;  1ESR A;  3HOU B;  1M8A A;  2TMP A;  3ND8 A;  3S9W A;  5IGB A;  5LHY 1;  4ID6 A;  1HFG A;  1KDB A;  1I4H A;  3PUZ A;  2B39 A;  3OW7 A;  1ENC A;  2BE5 C;  4G4K A;  3M7G A;  4C1N K;  5FK9 C;  4EQO A;  2RDG A;  5FO9 B;  3I4N B;  3HEJ A;  1EL0 A;  4LMQ D;  3K7A B;  4ME5 A;  2PNR C;  4K6D A;  4ZUJ A;  1TY2 A;  3ITP A;  4QCL A;  1V1P A;  2OT2 A;  2RQX A;  2F1M A;  3M4Y A;  4IFD I;  1T5X D;  2AQ1 B;  1PLF A;  1B1Z A;  1PZI D;  3NTH A;  3I91 A;  3BG3 A;  4X3T A;  1HPC A;  5C0X G;  1SJE D;  1YNN D;  3S14 B;  5JPN C;  3BDC A;  1R4P B;  4G57 A;  3T16 A;  5JEA J;  1L0X B;  4KKS A;  5DM7 3;  2AWN A;  4XXE A;  1VMC A;  1PZJ D;  3PUX A;  4C3J G;  2K1B A;  4K5X A;  1LT5 D;  2FMM A;  1EY4 A;  5JAV A;  3Q22 A;  1HQM C;  1MSH A;  2KHS A;  3WDN A;  1STA A;  4A3F B;  3EA6 A;  5KGU A;  2RKS A;  5ELC A;  1SFO B;  1JIC A;  4ILW A;  1KAB A;  1IW7 C;  5M5Y B;  1NAP A;  2H1E A;  3GTQ B;  3OMC A;  4PNY A;  1VF7 A;  2YU9 B;  1CTM A;  1PFB A;  4EQP A;  1SE2 A;  1GOZ A;  1EY6 A;  2L0C A;  2NUC A;  2EOT A;  2LFN A;  1SE4 A;  1EIH A;  3PUY A;  1Y1W B;  1KTK A;  2Z4I A;  2L9H A;  1D5Z C;  4RGN A;  3DM1 A;  2AQ2 B;  2FJ2 A;  5JVG 3;  2WAC A;  1CT1 D;  3IAY A;  1STG A;  2C9O A;  1GUN A;  2R7Z B;  2PMZ B;  4RFB A;  3IFT A;  1Y8O B;  2JXM B;  1I4Q A;  3SK4 A;  2EZV A;  2DNC A;  2IWH A;  5COR A;  1QNK A;  3EFX D;  3DWA A;  4F7X A;  2I46 A;  3VR4 A;  2EYL A;  1FGB D;  2R61 A;  2L4N A;  3QOJ A;  3E6Z X;  2F0V A;  4KD4 A;  1ZEQ X;  1SYG A;  1TKW B;  2JP1 A;  2KCN A;  2LMC B;  3GTG B;  1S5E D;  5E4X A;  3D31 A;  1G91 A;  1B44 D;  3SE0 A;  3GV6 A;  5EKI A;  4HSV A;  1AFP A;  2JEA I;  3U9S A;  2HCI A;  4IUT A;  5C3E B;  4RH6 A;  2SOB A;  1B9N A;  4XT1 B;  4KV6 A;  2A74 C;  3NUC A;  3M85 A;  4KHZ A;  3SK8 A;  3CKI B;  1BCP D;  5CV7 A;  4OIK A;  3EQL C;  2NTS A;  2WP8 J;  1A3V A;  4RHR A;  5M3M B;  1LT6 D;  3Q24 A;  5I6Y A;  3FEW X;  1PTO H;  3K0Y A;  3DHQ A;  4A3M B;  2K6A A;  4ZAI A;  4U67 3;  4NKL A;  2K5W A;  3H94 A;  1EOT A;  4ZKC B;  2RSO A;  4U68 A;  2R3Z A;  4DGZ A;  4HMJ A;  3T53 B;  2F0Q A;  2HCC A;  4R8I A;  1Z7T A;  3QOL A;  3KUP A;  4ZKB B;  3TZU A;  4DN4 M;  4RCO A;  3VA5 A;  3LWE A;  4NDX A;  2ENB A;  1TS2 A;  1YNN C;  1DON A;  3NE5 B;  3I4M B;  5IOD A;  1K8O A;  2B2U A;  1CK1 A;  1I4P A;  1MI2 A;  3T56 B;  4ZK9 B;  1I6H B;  4XDX A;  1HXY D;  2RDF A;  1WD1 A;  1A15 A;  2NVX B;  1GUW A;  4RHS A;  3S16 B;  3Q0A A;  1V8Q A;  1SJH D;  2A5H A;  3QIA A;  2EJM A;  3NQI A;  4K8J A;  1PMR A;  1SNO A;  1GHK A;  1F2M A;  1TVX A;  1BCP B;  1WD0 A;  4HR7 B;  1AEX A;  3E0J A;  4FF4 A;  1FNU A;  1CHP D;  4HCE A;  1C8C A;  3MFG A;  1I4G A;  5KIX A;  1ZKO A;  1XTC D;  5EQ0 A;  4UDU C;  4ODG A;  4HN7 A;  1H9S A;  3C1F A;  1QE6 A;  1U4M A;  3EVQ A;  4L8J A;  4PMW A;  2B2U C;  2QDB A;  3E5S A;  1X3Q A;  3P7J A;  4XT3 B;  1CQF A;  1PRT D;  1S5D D;  1WTO A;  1B3A A;  4IUQ A;  1Y69 U;  2GA4 B;  1U4P A;  1TU2 B;  4C1N I;  2L1B A;  3LX0 A;  1SEB D;  5JVH 3;  1OXU A;  1X3P A;  3CRL C;  3HG9 A;  2IW3 A;  1Z47 A;  3J81 L;  4KY6 A;  5ELF A;  4PMC A;  5D65 A;  1WTV A;  2JA7 B;  2K01 A;  1OXX K;  2A69 D;  3IKJ A;  2F0F A;  1EFI D;  1ZYR C;  5C3W A;  1Q1E A;  3NWS A;  1VDZ A;  4XQJ A;  3K6O A;  1L0Y B;  2ZXR A;  3OHX C;  2XN9 C;  1GHJ A;  2JSO A;  3SHL A;  5E4W C;  2ZXP A;  1BF4 A;  1E2Z A;  1I4X A;  1BDO A;  3I72 A;  5D14 A;  1HUN A;  4C3H B;  2JE6 I;  5G3L D;  2WKD A;  1TWG B;  1MSG A;  4NW2 A;  3DEO A;  1TY0 A;  3S2D B;  2NWG A;  1BCP C;  3Q6S A;  1D2B A;  5C4J B;  5COY A;  4K2L A;  1F2Z A;  4KD3 A;  3C46 A;  1F9Q A;  1LT4 D;  1QNU A;  3M7N A;  3MVV A;  2FFK B;  3PO2 B;  1XX8 A;  2G9D A;  4H0L C;  1F9R A;  4DU9 A;  3MFY A;  4FO2 A;  2BOS A;  1PRT B;  3BYT B;  3GD7 A;  4CGY B;  3S1R B;  3BDL A;  3PIO 3;  1F77 A;  1CHQ D;  1EQT A;  3HOX B;  3K59 A;  1B50 A;  2D62 A;  3FDT A;  4GZY C;  1ESF A;  5ELD A;  4KKU A;  1CQV A;  2MGS A;  4IUV A;  3SR1 A;  3VR2 A;  5I2Y A;  2EYM A;  2F0D A;  3CQZ B;  1HCZ A;  5IT9 L;  1RJT A;  3RD4 A;  5NUC A;  1EU4 A;  2X69 A;  3WOF A;  5DNF A;  1A3T A;  2HUG A;  2OF1 A;  5CGK A;  2CW0 C;  2F0N A;  2A68 D;  4QUC A;  2EY1 A;  4A3B B;  1WTX A;  1DYQ A;  5IGF A;  3FKI B;  4J1M A;  1CZW A;  2PCF B;  1LTG D;  3TSS A;  3J7A V;  5M5W B;  3QWN A;  5EPL A;  2ICE C;  4ZRZ A;  2SEB D;  1Z6H A;  4QIW B;  3KBG A;  3MTS A;  1A2U A;  1MBY A;  3TP7 A;  4NP5 A;  5J1Z A;  4EGV A;  1A3U A;  3GTP B;  2BCO A;  1YNJ D;  1LV9 A;  1U4R A;  3R93 A;  2MP1 A;  3J7A F;  2JA5 B;  4FVM A;  4RWS C;  5I6W A;  1TT2 A;  4FP5 D;  4F88 A;  2EYJ A;  1IKL A;  3KLS X;  5KEE A;  2PZT A;  1B9M A;  3OMG A;  4C3H G;  2WB1 B;  1PRT C;  3PV0 A;  4RAU C;  2KUM A;  1TWF B;  1ET9 A;  3HS0 C;  4KK7 A;  3FMC A;  1TS4 A;  5A2Q L;  1H9K A;  4KHV A;  3SK5 A;  4FXK C;  2B2Y C;  5EBC A;  4A3I B;  4X3K A;  2K28 A;  4KN7 C;  1SAP A;  3HOW B;  5EKL A;  2A69 C;  1O80 A;  1G8Z D;  3BDO A;  2NVY B;  1DXM A;  1JCK B;  5KNC A;  2EYF A;  5IT9 E;  4F87 A;  5BN4 A;  2EY6 A;  3MXP A;  1NCV A;  2BA1 A;  2JYO A;  5M5X B;  1II3 A;  1PTO F;  2SNS A;  2A6E D;  2F4I A;  1ONL A;  1ROD A;  3A55 A;  2F0J A;  3SVM A;  2E2D C;  5K5P A;  3AMU A;  4A3K B;  5A35 A;  1CA5 A;  3SK6 A;  3M3Y B;  4Q5V A;  5D3I B;  2XRQ D;  3OIP A;  3NTK A;  4FXG C;  4BBS B;  3CU7 A;  3MWY W;  4O42 A;  3A8I E;  1EWH A;  5K36 H;  1S4Z A;  4RCN A;  2NYZ D;  3T13 A;  5KND A;  1R9T B;  3LNN A;  3QG1 A;  2KCC A;  2IX3 A;  3GTJ B;  3S1Q B;  2KOL A;  1LTI D;  1KLG D;  2F0T A;  1EY9 A;  1JWS D;  2BDN A;  1DJR D;  2H4O A;  4WOR A;  2XWB B;  2RVL A;  3J7Y W;  1CA6 A;  1U9R A;  2RBM A;  4B08 A;  3H0G B;  2E2J B;  4CBV A;  5KNB A;  2F0M A;  1CFM A;  1STN A;  1V43 A;  4QF4 A;  3QB3 A;  3G7L A;  4Z9C B;  4CHT B;  1G2T A;  1HUM A;  2D2C C;  2F0O A;  3KK7 A;  1Y8N B;  3SDZ A;  1K83 B;  4H44 C;  2NVT B;  4EQN A;  1HA6 A;  1GXD C;  2WAQ B;  2EYP A;  2AQ3 B;  2CHB D;  3VYR A;  3L9A X;  2K05 A;  4CJ2 C;  3NTI A;  2XSC A;  2M9V A;  2E2H B;  3DWQ A;  5HGT A;  1UAP A;  2KED A;  4DXF A;  1BBX C;  1JR0 D;  4LJZ C;  3N6R A;  2DY8 A;  1LTA D;  1GUS A;  1PXU A;  1TQO A;  3NK9 A;  3KF8 A;  3S1M B;  3I3C A;  1EEI D;  3UI2 A;  2XVS A;  1EYC A;  2OEO A;  4JBW A;  2L55 A;  3MHB A;  5LL6 X;  1UNS A;  4KTA A;  5ELB A;  5T1G A;  3IL8 A;  1O7L A;  1STY A;  4DF7 A;  1ENA A;  2XNA C;  3DMU A;  3ONA B;  2O5I C;  4J8Q A;  3AB9 A;  2QCP X;  1OXT A;  2VNU D;  4BS9 A;  4TQU S;  1G6Z A;  1LO5 D;  3HOV B;  1KNA A;  3IFD A;  2MUY A;  4V0B A;  4DNR B;  3A8K E;  5IGD A;  3MZ5 A;  3KLS A;  1VF5 C;  3WOE A;  2HDL A;  2KQ3 A;  1NUC A;  2IX0 A;  2J7Z A;  3SXH A;  1EU3 A;  1D1K A;  3J80 L;  1EY0 A;  1S5C D;  5F2D A;  3DWP A;  4BA1 I;  1SNP A;  5DAU A;  1EY8 A;  4L6T B;  3TDQ A;  3MAQ A;  1PFN A;  2LY7 A;  3GTO B;  4BY1 B;  3L3O C;  5C4H A;  2TSS A;  1D6E C;  4ZUI A;  3HKZ B;  4A3J B;  3A8J E;  5M3F B;  3JAM L;  1LTR D;  1UEA B;  4CJ1 B;  4MIU A;  1ZXT A;  1PYW D;  2JA8 B;  1RCV D;  2PQE A;  5CR3 A;  1H9R A;  4HSP A;  1V1O A;  5C6A A;  3V2T A;  4E6I A;  3H09 A;  3GV3 A;  4V19 0;  4RGO S;  2IPK D;  2K7V A;  5I9O A;  4FYD A;  3DEP A;  2O5J C;  4J6H A;  5DEH A;  4K6L A;  4CKC A;  2E76 C;  5JEA G;  5C0X J;  2RDH A;  1Y1V B;  2EVB A;  4S3S A;  2VB2 X;  4FXD A;  3RLF A;  3LWU A;  4BA2 I;  2PZW A;  3OOC A;  2BE5 D;  2NN6 G;  1EZ8 A;  5JOB A;  3R3O A;  4HTH A;  1C4Q A;  1FNW A;  3BVM A;  1OO9 B;  2WV6 D;  5HUR A;  1J8I A;  1SBB B;  2N88 A;  1EYD A;  2G9H D;  1JOR A;  1XXG A;  2XWJ B;  2J4X A;  4M1U B;  1SDF A;  2MPM A;  2KEE A;  1BUV T;  2EJG C;  2LKV A;  3MXN A;  1UUP A;  5E3F A;  1KLU D;  1HFN A;  1JE4 A;  1WTP A;  2HDM A;  1GJX A;  3RUZ A;  5CV9 A;  2WIN B;  2QIL A;  1H9J A;  5C44 B;  4HMI A;  1WCM B;  3ERO A;  3U9O A;  4B9W A;  3I90 A;  3J80 E;  1WTW A;  4R8N A;  3V05 A;  5I9P A;  2J0T D;  3S17 B;  3QO2 A;  3VYU A;  2L11 A;  5FOB B;  2KVM A;  2QEJ C;  1IYV A;  2CQA A;  4DNT B;  5C5L A;  4X3U A;  1SNQ A;  4TKO B;  3BYY B;  3A7A B;  3FVQ A;  1JWM D;  3ERQ A;  3BVG A;  2FMC A;  2AWO A;  2Z4H A;  4R9W A;  2PW7 A;  3HGB A;  4XTC S;  1IKM A;  4XYQ A;  3D4W A;  3PUV A;  4OO1 G;  3PMF A;  3AU7 A;  4TRD A;  1EEF D;  1IW7 D;  1JB3 A;  2QF7 A;  2VUM B;  3VR6 A;  4OGQ C;  5C0X H;  2PZU A;  4F8M A;  1LAB A;  3A7L A;  2X6G A;  4OL7 A;  5KYL A;  4JK1 C;  1BXT A;  3H6M A;  4AYB B;  4P2C B;  4MHE A;  1O78 A;  2KA7 A;  3HZX A;  1FD7 D;  4H7B A;  4K2K A;  3R8B A;  1PFM A;  1F2Y A;  2F0G A;  2B63 B;  2WKC A;  1SXT A;  3D8G A;  2NBF A;  5AFW A;  4C2M B;  3GTL B;  1KNE A;  3J81 E;  1R4Q B;  2JA6 B;  5CYU A;  2Q8R E;  4XQN A;  3PIP 3;  3MC0 B;  5T1I A;  1GUG A;  2RSN A;  4A3E B;  1I4R A;  1TS3 A;  1HHV A;  2AUK A;  3VA7 A;  4KJO A;  5EKK A;  1QG7 A;  3P75 A;  2JEB I;  1F2L A;  2VXW A;  3NWT A;  5I2X A;  2B2Y A;  4LAA A;  1FR3 A;  3DXJ C;  2EY2 A;  1V1P B;  1OXS C;  3OSO A;  5KYI A;  1STH A;  3K5O A;  5BN5 A;  2M00 A;  1JOK A;  1JWU D;  2IX1 A;  5C5M A;  2B2W C;  1TWA B;  2B2T C;  3EJI A;  3NPP A;  4K14 A;  4HCS A;  3GP7 A;  1PDQ A;  5I4D A;  4LK1 C;  3URY A;  3S15 B;  1Q3L A;  1O7Y A;  4X3S A;  1I50 B;  5J22 A;  3VYT A;  2YYZ A;  2PO4 A;  1PZK D;  2NZ1 D;  1QCB D;  4CKE A;  3K57 A;  5C0X I;  1G29 1;  2EE1 A;  4OIJ A;  5CBE E;  2R93 B;  2FHT A;  2HQE A;  4UAI A;  3S1N B;  1DOL A;  2FIN B;  2E74 C;  5FKA C;  2EPB A;  5FO8 B;  2Y0S B;  5ISR A;  1IHZ A;  5IGG A;  4ABN A;  1B53 A;  1J9O A;  1SE3 A;  2NTT A;  4CKB A;  4B9X A;  3GO5 A;  1EQV A;  5IIF A;  3TME A;  1AZQ A;  5CV4 A;  3KBX A;  4IFD G;  2PW5 A;  1IYU A;  3NQT A;  3MXU A;  3FPU B;  2MHV A;  2IT1 A;  4HAE A;  3GTK B;  4EVO A;  2A73 B;  2K33 A;  1A2T A;  3KLR A;  4ZQ3 A;  1KAA A;  2MJ8 A;  3NSW A;  1C48 A;  1B4O A;  2ZT9 C;  3PUW A;  1FNV A;  4DXG A;  2IJ0 A;  1BR9 A;  4RA8 A;  4FF3 A;  3V96 A;  4BWG B;  5D3D A;  2R6G A;  1IL8 A;  3P1H A;  3S2H B;  1HRJ A;  2A6H D;  1PTO D;  2IL8 A;  4K5W A;  3ZYY X;  1SYE A;  5TSS A;  1EZ6 A;  1SYC A;  3VR5 A;  1RDP D;  5KRU A;  3ND9 A;  5JPM C;  1AN8 A;  1HQR D;  1H9M A;  1QJO A;  1EY5 A;  4DAV A;  1HTL D;  4CJ0 B;  1EY7 A;  4HED A;  2E2I B;  2CVR A;  3HOY B;  3T4A C;  1RHP A;  2F0P A;  2ZXO A;  3TZD A;  1RTO A;  1QWY A;  4WFN 3;  5J39 A;  5E1F A;  2L12 A;  3D3R A;  4DA2 A;  3FPP A;  5A2Q E;  1M4V A;  4RKL A;  3C1E A;  2F0H A;  3A56 A;  2C5C A;  3RMH A;  3H91 A;  5C4Z A;  2ICI A;  2A68 C;  1BCP F;  5CC4 A;  1A6X A;  1ICW A;  1WTQ A;  1E2W A;  4C3I B;  1Q1B A;  1LT3 D;  1ZYR D;  2KJX A;  4BBR B;  3D4D A;  1EYA A;  3X3N A;  3TP8 A;  3RZD B;  5FLX L;  3F2U A;  2EY5 A;  4A3D B;  1QIL A;  1GUT A;  2X6L A;  1KDA A;  3HP3 A;  4KMU C;  5EPJ A;  2BA0 A;  5DM6 3;  5C3X A;  4KY7 A;  5JEA H;  2AUJ D;  1NR2 A;  3I8Z A;  3CHB D;  4PQX A;  4NMZ A;  1YNJ C;  2F0S A;  1LTT D;  1TWH B;  1EIG A;  2NN6 H;  4Y7N B;  4KKT A;  4WJW A;  5IOC A;  1PTO B;  2F0I A;  5EJW A;  2E75 C;  1G2S A;  5JJZ A;  2V4D A;  3VR3 A;  1SMY D;  3OIQ A;  2R92 B;  2SDF A;  1AW7 A;  3NXW A;  1SNC A;  1NR4 A;  5LL6 S;  2F0U A;  3NBH A;  3RZO B;  1ILQ A;  1Q90 A;  1VMP A;  3OWE B;  2RA4 A;  2EDG A;  3NP8 A;  4XYO A;  1LAC A;  1E2V A;  2I07 B;  3K5N A;  4K5V A;  4PV1 C;  4IUP A;  5CV5 A;  2F0W A;  5CV8 A;  5EBD A;  3QJY A;  1X32 A;  3DUZ A;  1JC7 A;  3CRK C;  3L7Z C;  3N52 A;  3TP6 A;  5K36 G;  4A93 B;  4DAY A;  1CZG A;  1FYC A;  1TII D;  4KN4 C;  4FNF A;  3TN2 A;  1HA5 A;  1I6V C;  1HTP A;  1SND A;  2K5D A;  1TWC B;  1TS5 A;  1DCZ A;  4QUF A;  1T5E A;  3C2P A;  1XWE A;  4XIG S;  2K5Q A;  2A6E C;  1H9S B;  4QB4 A;  4QMG A;  3K5M A;  2PYK A;  1TR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...