2NUCA

Staphlococcal nuclease, ethane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nucA00
1EY6A 1JOQA 5F2DA 4OL7A 2PW7A 5CV7A 1SYGA 5HGTA 2OF1A 1STNA 2PZUA 3U9OA 3EJIA 3D4WA 3LX0A 2F0UA 4K2KA 4K5WA 4ME5A 4QMGA 4ZQ3A 2F0WA 4HMJA 5K5PA 1SYCA 2SOBA 4ZUJA 2LKVA 5EKLA 4KY6A 2F0VA 5KYIA 1SYEA 5CV8A 3ERQA 1II3A 1NUCA 2EYMA 2F0TA 2PZTA 3BDLA 5IODA 5C3XA 2KHSA 3SK6A 3OMCA 1SNDA 2PYKA 5E3FA 3NK9A 3OSOA 5KEEA 3V2TA 1SNOA 2PW5A 1EY9A 4I65A 2HQEA 4J1MA 5I9OA 4DF7A 4ODGA 3TMEA 4NP5A 2PQEA 4B9XA 2ENBA 2NUCA 4HMIA 1STGA 5DEHA 5C5MA 3RUZA 4EQOA 4IALA 2RDFA 4QB4A 5IIFA 1KDAA 4NDXA 4TRDA 1KABA 5NUCA 2EYFA 5IGFA 3R3OA 4EQPA 5CGKA 3T13A 5CV4A 2M00A 4KY7A 5IGEA 5ISRA 5J39A 5CR3A 4QF4A 3MHBA 2F0JA 4KJNA 5M9OA 2EYLA 4J6HA 5JOBA 5HURA 1TT2A 3SK5A 2EY5A 5IGGA 5J22A 3C1EA 2SNMA 3QOLA 4EQNA 3SK8A 5KIXA 4K8JA 4G57A 1A2UA 4WORA 1F2ZA 4YIJA 1JORA 1KDBA 2EYJA 4K2LA 1SNPA 1SNQA 3D4DA 2F0MA 5KYLA 2RBMA 2F3WA 3EVQA 4LAAA 4KJOA 2SNSA 1SYBA 3QOJA 1EZ8A 3DHQA 3TP5A 3SHLA 3SK4A 4K8IA 4PNYA 4MIUA 4ZUIA 3ITPA 1AEXA 1EYCA 1EY7A 1U9RA 3D6CA 3P75A 1EY5A 4PMBA 5E1FA 3H6MA 5IGBA 4K5XA 1EYDA 5KRUA 5C6AA 3NQTA 2QDBA 3MVVA 1KAAA 4S3SA 1STAA 4K5VA 1EQVA 2F0IA 1EY4A 2RKSA 5J1ZA 4F7XA 3C1FA 4RKLA 2F3VA 3OWFA 1SYDA 2OEOA 4IZ8A 1KDCA 5C5LA 3T16A 5I6YA 3NP8A 1STHA 3TP6A 4DU9A 3EROA 4N9TA 4H7BA 2EY2A 5C4ZA 4DFAA 2F0GA 5IOCA 2F0NA 2F0DA 2F0HA 4K6DA 1SYFA 2WACA 2EYHA 3P1HA 2EY6A 4KTAA 5CV9A 3SXHA 5I9PA 5KGUA 3D8GA 4RKBA 3DMUA 1EZ6A 5C4HA 3TP8A 2F0OA 3VA5A 1TQOA 2EXZA 2O4XA 1A3TA 4DGZA 2EY1A 1ENCA 3MXPA 4N9PA 3NXWA 1F2YA 2F0LA 4EVOA 1A3VA 4NKLA 4F8MA 2F0QA 3QB3A 1STYA 1SNMA 1JOKA 3BDCA 3MEHA 3SR1A 4HTHA 3E5SA 5IGDA 1JOOA 2F0PA 4E6IA 5EGTA 2F0KA 4ID6A 5CC4A 3NHHA 3NUCA 2KQ3A 1NSNS 4K14A 1IHZA 1F2MA 1TR5A 4KY5A 1STBA 4B9WA 3TP7A 3OMGA 3MZ5A 1EYAA 2EYPA 4KHVA 5CV6A 1A3UA 5C3WA 2F0SA 5I6WA 1A2TA 3S9WA 2PZWA 4NMZA 4WRDA 1EY0A 2F0FA 3HEJA 4KD3A 4R8NA 5CV5A 5IGCA 4IUNA 4KV6A 2F0EA 5JAVA 3HZXA 1ENAA 1EY8A 2EYOA 5EKKA 1SNCA 2OXPA 3PMFA 4PMCA 1RKNA 5DAUA 4KD4A
chains in the Genus database with same CATH superfamily
3VYSA 1ICWA 4DUYL 3EJIA 1LTGD 1VF7A 2HIXA 2NN6H 2F0WA 4JI1Q 3UI2A 4KY6A 5KYIA 1SYEA 5IT9L 1GXDC 4GN4B 1QCBD 1O7YA 4IOAA 5K36H 1SNDA 1VCIA 4KI0A 5E3FA 1WYDA 4P2CB 1PRTF 4XXEA 2Q8IB 2E74C 1A63A 5C5MA 1Y8NB 4KHPL 3KJOA 2ZT9C 1KDAA 1WOCA 2R93G 5IGFA 3I4NG 1TXYA 3OHXC 2RQXA 3BVGA 5JOBA 1UWVA 3FHWA 4O2DA 3SK5A 3SDZA 3UE1A 1ESRA 2J7ZA 4WFN3 4K8JA 4G57A 4IJHA 4OIKA 3D4DA 4GKJQ 5ELNA 4DR3L 1TS4A 5LL6S 3CCRA 1N34L 2NTSA 4X66L 4DAYA 3RMHA 3PIOA 1G6ZA 1NBWA 2Z9HA 1FJGL 1Y8PB 1I4HA 2RKSA 1EWCA 4AH6A 3PO2G 3OTOQ 4JI3L 2K32A 4ZLTF 4L5QA 2EY2A 3IL8A 1VQDA 1Z47A 2XVSA 4JV5Q 2N78A 4I7AA 1C0AA 1L2FA 2DNEA 4JK1C 4G7HC 3CXCA 1VQNA 2WIIB 3S2DH 3KF6A 2K1BA 4N8X1 5JVH3 2EQSA 2QDLA 2CWPA 1L1OC 4ID6A 3BYTB 4PZ8A 1J9OA 1NJIC 4K14A 1FD7D 3T51B 4L5RC 3RR5A 3MZ5A 2JYOA 4KHVA 2HHHL 1DOKA 1F9SA 2BA1A 4R8IA 4A3IH 2VUMH 3S16H 4DR1Q 3I4LA 4F88A 1EY8A 1GM5A 4R4CA 4DN4M 2AQ2B 3PMFA 2OXPA 1N36L 1PH4A 4KD4A 4OWXB 2A6ED 4WJ3M 3J81c 2UXCQ 2EVBA 1IYJB 4JI5L 1B9MA 2B2VA 1VQ9A 1H9RA 3PO2B 2D0PA 1EU4A 3A0JA 2UXDL 3QJYA 5TSSA 1NE3A 4ZK9B 1PMRA 2F0TA 4HAEA 3HOXH 5KNDA 5KEEA 1LT4D 1AZPA 3MFGA 1KD1C 2AUJD 1S72A 1H9SB 3BG3A 4C2MH 1G6PA 4KN4C 1PTOC 2BE5C 5ELFA 2UUBL 4QB4A 5I2YA 1VQMA 2F4VL 1AN8A 4DV2Q 2NN6G 2M00A 1LTSD 2IJ0A 1K3BC 2JEAI 1HNZL 2F0JA 4YCUA 4KKSA 4X3TA 4A93H 2IT1A 2KECA 5K36G 1YJWA 2O5IC 3BYYB 2B2UA 2IHEA 2VQFL 3ND9A 4IUPA 1Q86C 3S14B 1BUVT 2CVRA 3N52A 1QE6A 3UDXA 1BKBA 4DPGA 2CW0D 3FEWX 1C7YA 1B3QA 1HRJA 4MZ9A 5LMNW 5COYA 1AFPA 4LF7Q 1YITA 2O2LD 3TZDA 1B8AA 3OWFA 2UUAL 1D1KA 1HZ9A 1K8MA 4YHHL 2NVQB 4DFAA 3A74A 2A74C 2RSOA 4LFBQ 1JJ2A 1AW7A 3QG1A 1JJCB 1SSOA 1ENCA 1D8LA 4DUZL 2VS1A 4IFDG 1DXMA 1X6OA 1IBKQ 1I4RA 1ASZA 5EPLA 1HFNA 4HCEA 1SMXA 5EGTA 2F0KA 3IRBA 3VYTA 2MO0A 3J7YW 3S1QH 1MD2D 1BCPB 1Y69U 4C3JG 1XTDA 2H5XA 1PH7A 1KAWA 3HEJA 2F0FA 1X3PA 1CFMA 4UY8C 2AHOB 1Z7TA 3T53B 4BXXH 2YTVA 4LMQD 3ICEA 1XYIA 1IL2A 5F2DA 3U4ZA 1STNA 3HOVH 1FGBD 2WB1G 4LF6L 3DM3A 2Z4HA 1CK1A 3A5UA 1XNRL 1ONLA 4G4KA 2FXQA 4K0KL 4BBSH 2JA8B 1LTRD 4BA2I 1WTWA 4DV6Q 1Q3LA 2KOLA 3VR6A 1XMOL 2VUMG 5FO8B 1EY9A 1FNUA 2HQEA 4B08A 2A1AA 3MTSA 4DK3C 2X6LA 3SEBA 4NP5A 4ZKBB 4UP9A 1KL9A 3CD6A 4XT1B 3TZUA 2SDFA 4KLKA 4EQPA 1WVLA 2E2IH 5JEAJ 2XSCA 3GTLH 1YIJA 3D0FA 4R4TA 3FKIH 3CCMA 1HNWQ 5JJLA 5FJ8H 4B3SQ 1EYGA 2UU9Q 1KDBA 3EVQA 1BF4A 4DNTB 1I50H 2UXBL 4JI8L 2QKIC 2N49A 1WTPA 3S2DB 4ME3A 3HFZB 3A8KE 4UAIA 2DY7A 1WTRA 1CT1D 5LMUQ 1C8CA 4A93G 2B2TC 1S5CD 2Z6BA 4QL5A 1TWGH 1GVPA 4A3IB 1BNZA 1T5XD 1EFID 2VUMB 2F0GA 2NZHA 4N8FA 3X3NA 4A3MG 3P1HA 4RG1A 3GTOH 2HQLA 3D8GA 3WDNA 1FVIA 1YBYA 1UEAB 2I5MX 3NXWA 1F2YA 2F0LA 2ZTCA 4FO2A 3HOUG 3PUXA 5IP7H 3G7LA 1E2WA 4X6AH 1WCMH 1XX8A 5CC4A 2QA4A 3HOXB 3KK7A 3GTPB 2Q2IA 5GAGC 2L0CA 4C2MB 3PUYA 1VMPA 1VS0A 4CDEC 4IUNA 3A56A 3DM1A 4FVMA 5EKKA 1R9TH 4JI4L 1QG7A 3GTGB 2L12A 2BH8A 4Y7NB 4DK1A 3NBHB 1MI2A 1STEA 4ABNA 5AJ3L 1A15A 3ZJYC 3D4WA 1GUTA 4H13C 1U4LA 4JOIA 1F77A 1WJJA 4RCNA 4LF4L 4JYAQ 2K75A 3NTKA 3R2TA 3A55A 3ERQA 1HPCA 4HN7A 3BDLA 1NR2A 1F2LA 1TWCH 3NK9A 4MTNA 1WI5A 4BXXG 3KYHC 1KQSA 1PVOA 2C5CA 1FL0A 4C1NI 4DR7Q 2NUCA 4DK6C 5IYDG 3PIO3 2RDFA 4HIKA 3R3OA 3RD4A 1X3GA 2F1MA 3I4OA 3T13A 1HFGA 5J39A 2LS01 2JXMB 3OYYA 4BBSG 2Q2TA 5C44B 2BCOA 1BDOA 1MHWC 2CW0C 2CWAA 3U9SA 1V8QA 1U0LA 1KIXA 1QWYA 1K8OA 3M4OH 1JWMD 2NVYH 3V96A 3QWNA 3KBGA 4LAAA 3QOJA 4DV1L 3G71A 1M1KC 2A8VA 3CKIB 5JEAH 5EJWA 3GTKH 4ALPA 1H9KA 2HD3A 4RHSA 2B29A 2QDBA 4HSPA 1STAA 1Y1WH 2Q2HA 1UUPA 2JA5H 2F3VA 1I6HB 3A7LA 3NP8A 4OEMB 4DU9A 5FJ8G 3W5OA 3MXUA 3S2HH 4XYQA 1SYFA 5A2QL 3EFXD 1H9SA 2AKWB 1VQGA 1UAPA 4RKBA 4DXGA 3L9AX 3M4QA 2Q2UA 5C4XG 2CQOA 2UUCQ 3D31A 4MNOA 3HOVB 1QILA 2NBFA 1A3VA 4NKLA 5GAHC 4X64Q 3MEFA 1J6QA 1U4PA 5BR8L 1IBMQ 4OX9Q 3Q24A 3NUCA 2NTTA 3CCSA 2ZM6L 3S1NB 2R7FA 4BY7H 2CHBD 1KXLA 2F0SA 3J81L 1HTPA 3OIPA 1N32L 5CV5A 3T1YL 3MXNA 1AE3A 1VQEA 1FYCA 3T56B 1ENAA 4FNFA 3W2DA 4L6TB 1N33Q 2E2IB 1L0XB 4TKOB 5C6AA 4R4QA 5IP7G 2A68D 3GTLB 1WCMG 2LY7A 2K28A 3TDQA 2PZUA 2L5TA 1ZYRD 3FKIB 2VL6A 4ZQ3A 4HMJA 5K5PA 1JWSD 2QILA 4OO1H 4NXNQ 3AMUA 4DR2Q 2L1BA 1B53A 1MSHA 2EYMA 5IODA 5ELBA 2PYKA 3RZOH 2B2VC 2EOTA 2D2CC 3A54A 3VA7A 3T4AC 3R93A 3BVMA 2WAQB 3H3VI 5DM63 1E24A 2RA4A 3CU7A 3NWTA 1BR9A 3DWAA 5JJZA 1SAPA 2E75C 4X62Q 3MHBA 4CBVA 2Q8RE 2CKZB 1LTTD 1TWGB 3I55A 4DV0L 1YJ9A 4KK7A 3CAMA 1SNPA 1B7YB 5KYLA 4RWSC 3E9IA 4AQYL 5EKIA 3I7FA 1C48A 2IPKD 1TWFB 4TVAB 3TP5A 2OT2A 1SE4A 4C3IH 2B2UC 1EYCA 1I5FA 2VXWA 3BZDB 2AQ3B 5L37A 4LUVA 5BN5A 5E1FA 3TSSA 2SEBD 2F0IA 3URYA 4P75A 1PTOD 2BE5D 1PYBA 1XJVA 3VYRA 1PTOH 4L63B 2Y0SE 4KTAA 2VQEL 5JEAG 3A5ZB 3AYHB 2Y0SB 1XNQQ 3VA5A 2OQKA 4IUVA 3G6JB 4LF5L 2ZTDA 4J8QA 4P74A 1BCPF 1ILPA 2Z8LA 2JA5G 2QW7A 2NN6I 3W1GA 1Y14B 4LUOA 1DD2A 1OXSC 4HJ8A 4QJFA 4YWMA 4FXDA 3PV0A 1A3UA 1HQMC 4NMZA 5IGCA 4NPSA 4KV6A 5FOBB 1QVFA 4IJLA 1O80A 1VQBA 1CZWA 1WTVA 2EJFC 1KHIA 3GDEA 5GAEC 1VDZA 4Z9CB 4GOPB 1V1PB 1JC7A 1F9RA 2PMZE 2P5ZX 1VMCA 4C56C 2XWBB 3J80E 4BY7G 2PMZB 4FDBA 2PZTA 1TU2B 1HZBA 1ZKOA 2IW3A 3KLWA 3OMCA 2E5LL 1RTOA 2OQ0A 1W6JA 1CKNB 3I3CA 3GTKB 4BWGB 4DV4Q 2J0TD 3CCVA 5LMNQ 5HGQA 4CKEA 1KABA 1MKHA 1Y1WB 2XRSD 5ISRA 1K83B 1MJEA 3GO5A 2KA7A 4OO1G 1PLFA 4QIWB 5G3LD 4RFBA 2EYLA 3CW2C 5HURA 2H1EA 2J4XA 4CGYB 3S2HB 1NNXA 3H0GB 1VQAA 1MSGA 1I4PA 1B2TA 4A3FB 1G51A 4LF8L 3HOZG 4L5SA 1PFBA 1RDPD 3SHLA 2CH4W 1Q12A 1AEXA 3EA6A 5LHY1 3RLFA 1EQQA 1JMCA 2CCZA 1SJED 2JA9A 2X6GA 3NBHA 1HZAA 1J5EL 4DR6L 1LYLA 2A69D 3NQTA 2MHVA 2O5JC 4A3GG 5C4JH 1IL8A 3S15H 3ULPA 3KOJA 2IX3A 4BY7B 3TP6A 1KNAA 4H7BA 5M3MH 4CDCC 3ULJA 1S5BD 1CI3M 4C3IG 5KGUA 2EY6A 4JI0L 3K6OA 1UEBA 2XNAC 4KHPQ 2ZXOA 2EY1A 2WFWA 5HY6A 1A62A 5M5WB 2BOSA 3FDTA 1L0WA 2B3GA 3MFYA 2HUGA 4IFDH 4E6IA 1FR3A 4B3RL 4BBRH 1IHZA 3D6WA 3J81i 3RZOB 2IY5B 2A68C 4A3CG 4C3JH 1EY0A 1ZYRC 4DR3Q 3M7NA 3A7AB 3I4MH 3E6ZX 4IN3A 1N34Q 4X66Q 3P20A 3L3OC 1F9PA 2K05A 3M4PA 4BY1H 2R93B 1FJGQ 1JB3A 1JQYD 3I4NB 5HGTA 4K2KA 2F0UA 4J15A 4QMGA 5E4XA 3ULLA 4Q5VA 4JI3Q 5H1SE 2Z4IA 2B39A 1S3OA 4XQJA 5IWAL 2MJ8A 2PW5A 2N8NA 2K5NA 2PPBC 1SXTA 1PRTD 4RGOS 5C0XJ 4HIOA 2NB0A 2XIWA 4JCVE 1IKLA 2EYFA 1SEBD 4JI6L 2WKCA 3RN2A 1I94L 1BXTA 1HZCA 4OGQC 1VQ8A 2L9HA 5J22A 2B8GA 2KENA 2I5LX 4R4IA 2HHHQ 3FPPA 1A2UA 2KJXA 2KHIA 3PIPA 3K7AH 4K2LA 5M5YH 4IOCA 1V1OA 2RBMA 2F3WA 3QIAA 3PF5A 5D3IB 5DLQE 3TBIB 4JI2L 2DNCA 1VQKA 1N36Q 4Q0FA 1W6KA 1Z6HA 3NWSA 2KBNA 4LWCA 1TIID 1T5EA 5KRUA 1PV4A 4EX5A 4JI5Q 1KAAA 4RGMA 3EQLC 1Q8IA 1B44D 2FFKB 1IXRA 1P16A 4V0BA 5C5LA 2UXDQ 3I56A 1YNJC 1LT5D 3CMAA 2NVTB 3RZDB 1PH6A 1SLJA 2F0HA 3K57A 4IPDA 1QUQA 5I9PA 2RSNA 1XWEA 4A3MH 2EXZA 4TQUS 2UUBQ 2AQ1B 2QEXA 1A8VA 2WINB 4EVOA 3TRZA 2F4VQ 2VNUD 3CC7A 3PO3H 1Y8OB 1LT6D 3DLLA 4MHEA 1RCVD 1TVXA 3NTHA 1HNZQ 1R4QB 4JC0A 3UDGA 3HOUH 1JWUD 1EUJA 5M3MG 3JAME 1EFWA 2YTXA 4DAVA 1QZGA 3GD7A 4CJ2C 1WD0A 2VQFQ 1PH3A 1EYAA 3FRPB 3MWYW 1A2TA 3KF8B 4YY3L 1RF2D 4APVA 4UPAA 4HEDA 5IYCG 3D4RA 1ILQA 3K5OA 5M5XH 2MFIA 4DKAC 3I91A 5GQOA 1S5DD 3GTMH 1K3RA 1DZ1A 4ME5A 1D5XC 4BBRG 4C3HG 2UUAQ 2N55A 5EKLA 1CA5A 4YHHQ 1PH9A 3FVQA 2A6HD 4DV7L 3VR3A 3I4MG 4POFA 1B1ZA 2L4NA 1ENFA 1X9NA 1VQLA 4YWKA 4BY1G 2OTLA 2PQAB 1Y1VH 4BA1I 3W3AA 4DUZQ 1H9MA 1TY0A 3V05A 5T1IA 4A3KG 5D14A 5IYDH 4A3BH 1YVCA 2G9DA 1LM0A 3S15B 3CCUA 4QQBX 4UP8A 2JSOA 1FNWA 3L0OA 1MGSA 5M3MB 3K5MA 5KIXA 1EEFD 4GKKL 2K52A 2FMCA 2DJFC 1O7ZA 2K5QA 2RVLA 2A69C 2ICIA 1EU3A 5C0XH 3BU2A 4JG2A 2JE6I 1Q82C 2SNSA 2YU9H 3K58A 2PCFB 3SK4A 4DR5L 2QF7A 4YWLA 2N3SA 1D7QA 2EZVA 1EYDA 4LF6Q 4GOPA 1V1PA 4DNIA 3NQIA 1AE2A 4BBRB 1XNRQ 1HNXL 1CSQA 4DR4L 4K0KQ 1EEID 4IZ8A 2ZJRA 1LTLA 3GV6A 3LGJA 4C3JB 1LACA 1XMOQ 3CRKC 3I4MB 1OXXK 4X65L 3UDIA 2Z0SA 3EIVA 3DMUA 1O7IA 2ID0A 4BY1B 5FLXE 3I8ZA 1QJOA 5CBEE 4H44C 1IYVA 1BOSA 1VQJA 1B3AA 5C4XH 4HTHA 3E5SA 2WB1B 2M9VA 3NTIA 3BZCA 2MPMA 5IT9E 3N6RA 3TP7A 3KUPA 2CQAA 3WOFA 3S16B 1DYQA 4KD3A 2UXBQ 4JI8Q 2BA0A 3J7AF 1VQ5A 5I9OA 2DJGC 4OWTB 3OW2A 3PO3G 3DXJC 3GTQH 4FF2A 3S1MH 1J8IA 1LT3D 4JPBW 1GOZA 1PRTC 4MN3A 1GD7A 1EL0A 4DV5L 2K5DA 1ICFB 3OW7A 1E0BA 1II3A 1SFOH 1KRSA 4ZKCB 5ELEA 1I3QH 2JQOA 3CQZH 4RMFA 4J1MA 2OWOA 3G48A 3TMEA 4XYOA 2PQEA 4HIMA 4FXKC 3CMEA 4OHJA 1JJGA 2RCFA 1NMGA 3OWEB 3A8JE 1I4GA 1XPUA 5CV4A 4KY7A 1K73C 3R8BA 3CHBD 3CPWA 2MNAA 4RGNA 4A93B 4LF9L 1TT2A 1PXUA 5IGGA 2F4IA 4NW2A 1BVSA 2K50A 1F2ZA 4YIJA 4V190 2R7DA 4H0LC 4A3MB 1OXTA 2B8FA 4POGA 4A3EH 1Y1VG 1XMQL 3HRZC 4JI4Q 2JA6H 1VQOA 1LABA 5FLMH 1U9RA 1PZID 4A3BG 1E7ZA 1EIGA 2V4DA 4X3UA 4JBMA 5AJ3Q 1YI2A 1XPOA 3HOUB 1DCZA 1VF5C 3MVVA 2K7VA 2B63H 4NXML 1D5ZC 2N88A 4LF4Q 3Q23A 3HKZG 1N8RC 2QGQA 3CF5A 3AQQA 1IBLL 5C0XG 1ZXTA 2F0DA 1XTCD 2EYHA 1Q1EA 1JR0D 2ZJQA 3SXHA 3K80C 4B3TL 5M5XB 2CH4A 3OPOA 3MXPA 3I90A 3M7GA 3GTMB 3DUZA 4AYBG 4GNXB 3MA2B 4AIMA 3BDCA 4KHZA 2FMMA 1UE7A 3JC66 4GN5A 3S1QB 1YEZA 3NHHA 4OO1I 5EPKA 3TN2A 1NSNS 3H91A 1AH9A 2WKDA 4LFCL 4QUCA 2MP1A 3VR2A 5M3FH 1MIUA 3T1HL 1GHKA 4R8NA 1HR0L 4RHRA 1Y1VB 4DV1Q 2AWNA 5JAVA 1IW7D 3CPFA 4A3JH 4JVZA 1E2VA 2A5HA 4QY7A 2HIVA 1EY6A 3CP0A 3KF6B 2A6HC 1SYGA 4IPHA 2KEDA 1PFNA 4LFAL 1ASYA 2JP1A 1SJHD 3HOYH 4BBSB 3CRLC 3HKZB 4HSVA 3PIP3 4JI7L 2GN5A 1DOMA 2WP8J 1S4ZA 2YU9B 1SE8A 1MJCA 2EE1A 2I07B 2XGTA 5FKAC 4B3MQ 4JBWA 5JPMC 1N9WA 1U4RA 1K8GA 5AFWA 5D3DA 5BR8Q 3IKJA 1X3FA 2GVAA 2YYZA 3H09A 4XT3B 1JE5A 4P71A 5EBCA 1LV9A 4XQQA 2ZM6Q 1JB7A 1B50A 5ELDA 3IFTA 1N32Q 4OIJA 1OO9B 3T1YQ 2F0MA 4A3DG 1I50B 2F52A 2WAQE 4KJOA 5FO9B 4JW0A 3DHQA 1HTLD 3HOZH 3AEVA 3CC2A 3I70A 3D6CA 5C4XB 5BN3A 1K8AC 4P73A 2ICEC 2EJMA 4K5XA 1PH8A 1CQFA 1GHJA 1EQVA 5C3EG 1PYWD 1HJPA 4HJAA 1LLRD 2OEOA 3T16A 4A3GH 1G291 2ZXPA 5KNCA 3GTOB 1UE5A 2MO1A 4A3EG 5IOCA 4K6DA 5CV9A 2JA6G 5FLMG 1CKOA 2K33A 1BQQT 2O4XA 2PQAA 2HCIA 2A19A 2KCTA 2B63G 1JOKA 1WCMB 3MEHA 5CYUA 3I73A 1D2BA 4K6LA 5I2XA 1WTOA 4DV0Q 1F2MA 1OXUA 1I3QB 2TSSA 3CQZB 2PZWA 4GS3A 4AQYQ 3PF4A 4A3CH 4HIDA 4X3SA 1R9TB 4XQNA 3BJUA 1PZKD 1RJTA 3HZXA 2PO4A 2K01A 4GN3B 3TS2A 1W2BA 4PMCA 4L8JA 4PV1C 1WTQA 1YNJD 1G2SA 1EQRA 5CV7A 1VQ4A 2K4KA 1FGUA 2I46A 1LO5D 1CSPA 4HR7B 2JK8A 2R7ZH 4XDXA 4DAPA 1VQFA 5M3FG 1X3QA 1TWCB 2AWOA 1HH2P 2PI2E 4A3EB 2VQEQ 3RN5A 2DN8A 4A3JG 3FMCA 2FHTA 3VDYA 2GVBA 2RDGA 4HMIA 1STGA 3O13A 1JICA 2E2HH 4IALA 1CTMA 2VY3A 4LF5Q 4GLAC 2OTJA 2KEEA 1YJNA 3HOYG 5M9OA 2ASBA 1I4QA 5EQ0A 4CHTB 2KUMA 3M4OB 1Q46A 1OXVA 2NVYB 4DV3L 2K14A 1PFMA 1WFQA 3S14H 3NE5B 3J80c 1EY7A 2M2LA 2NYZD 3I2ZA 4QIWE 1LUZA 3H6MA 3WOEA 1G91A 1PHJA 2JA5B 1A0IA 4IFDI 1YNND 3C1FA 4JI1L 4DA2A 1SYDA 1GUSA 2B2YA 3OIQA 1VQPA 3Q8DA 4OXPA 2KCMA 2IHFA 1NR4A 1CQVA 4A3JB 2NVQH 2E5LQ 2WACA 2IL8A 1HR0W 1KRTA 5C4HA 1EZ6A 2F0OA 2B2WA 4PQXA 2F0QA 1STYA 4ULLA 1SNMA 3M9BA 3HOYB 4DUYQ 3HOWH 2Z6KA 1BCPD 1IW7C 1CHQD 4IURA 2H4OA 4XIGS 4LF8Q 3ER0A 4M8AA 3NENA 4GKJL 4ZAIA 3CC4A 2I0QA 2E2DC 3TREA 1EWIA 1JOQA 1WTHA 3FPUB 5KNBA 5IYCH 1J5EQ 4DR6Q 1NMFA 1QNKA 5ELCA 1K28A 3M3YH 1GUOA 2MUYA 3EN2A 2SOBA 1VQ6A 4M1UB 2F0VA 3OTOL 3TEHB 4FF3A 4C3HH 2JA8H 5C3XA 3OOCA 1GUWA 1GO3E 5J3BA 1CHPD 3V2TA 4JI0Q 3HOZB 4I65A 1V43A 4L5TA 4JV5L 2CFMA 1LTAD 2E76C 4EQOA 1L1OB 3E0EA 4KKTA 2DUDA 4RCOA 4GNXA 1DONA 1E1TA 4A3KH 2R7ZG 4KJNA 4A3GB 4B3RQ 1D6EC 2K5VA 4DNRB 1O78A 4IUTA 4JOIC 4PMWA 3NPPA 4U68A 2R6GA 1PDQA 3F2DA 5A2QE 3H94A 4C3IB 1VQIA 1TWAH 4DR1L 3ITPA 2K5WA 1DOLA 3Q22A 1MBYA 2ALYB 2UXCL 2XWJB 1P8LA 5GROA 3ERSX 3K5LA 3PQIA 3QR8A 5I6YA 1BBWA 3NBIA 1TY2A 1A6XA 4IQZA 3G4SA 3TS0A 1SROA 1PTOB 2HCCA 2XN9C 1S40A 3J81E 5IWAQ 2VW9A 2LFNA 2KCCA 2PNHA 3C2PA 4LNQA 2IX0A 1TS2A 3NSWA 2L55A 4IUUA 4FYDA 2HT1A 1SN8A 5FK9C 1EIFA 4JI6Q 5CMDA 1ZEQX 4DV2L 3JAMi 2R7ZB 2X69A 1I94Q 1IZ6A 1GUNA 4FF1A 1ET6A 3WWVA 1QB5D 1U4MA 3E0JA 2RDHA 5JVG3 3OMGA 3GTPH 3NELA 5C3WA 5LL6X 3KFUA 4OONA 1F9QA 4UDUC 4TSSA 2E2HB 1PH2A 4JI2Q 2D62A 2RHQB 4GZYC 1UE1A 2LMCB 3GTJH 3VR5A 3GTGH 1SRUA 1G8ZD 4Y52H 1XPRA 4Y7NH 3HOWG 3H3VC 4LF7L 3U9OA 1D1IA 1T9HA 5EBDA 1UNSA 3KLRA 1SYCA 5T1GA 5IY0A 3S17H 1DGSA 1O7LA 5JPNC 1NUCA 3SK6A 1RIPA 2G5DA 3MXNB 5C0XI 3LWEA 4DF7A 1YZ6A 4LFBL 3HG9A 3KLSX 3JAMc 2NZ1D 4CKCA 2ATWA 3SVMA 4RA8A 1IBKL 3F1ZA 1GUGA 3QO2A 4IO9A 4G7OC 1M8AA 5C44H 2JA8G 3QOLA 4EQNA 3SK8A 1AP0A 2RCNA 1CZGA 1SR3A 3Q6SA 1CKMA 3RLNA 4YY3Q 1KTKA 2R61A 2EJGC 3S1RH 1YNNC 2LSSA 1EZ8A 4FXGC 2E8GA 4PNYA 4ZUIA 2BDNA 4A75A 1Q81C 3C3LA 3VYUA 1VQHA 2FJ2A 1VQ7A 3HOWB 4UHVA 3F2BA 3EBEA 3MC0B 5C4JB 1Q8KA 5J1ZA 5BN4A 1GKHA 2ZTEA 4BS9A 1QZHA 4ILWA 1KDCA 3IAYA 1STHA 5D65A 2D9UA 3ND8A 3HP3A 3RLOA 1I6HH 1S5FD 4DV7Q 3DWQA 1OTCA 5C4ZA 4DV6L 4KMUC 1BBUA 3GV3A 4DK0A 1ET9A 2EPBA 1NAPA 2PI2A 1BCPC 1WTXA 2F3IA 3PUVA 4CJ1B 3M85A 1SBBB 2A73B 3K7UC 3M3YB 2HDLA 1QOHA 4PZ6A 1AZQA 2LXKA 1X3EA 1V9PA 3STBD 3LNNA 2MQHA 2QCPX 4GLVB 2KQ3A 1Z9FA 4C3HB 4G7ZC 2F03A 5CORA 1XXGA 4GKKQ 1RL2A 4A3IG 5A35A 3K5NA 3H15A 1HNWL 1EOTA 3S1NH 4B3SL 1FNVA 2UU9L 1SMYD 2DY8A 4YCVA 3J81j 2JA7H 1JCKB 4DR5Q 1HHVA 1HUNA 3CCQA 1CKNA 3KBXA 1KC8C 3K0YA 3DEPA 1U5KA 2Z1CA 3C46A 2R92H 2WB1E 2PW7A 4A3KB 2K03A 3KDFB 4EGVA 4QGUA 3LX0A 4K5WA 1HNXQ 4DR4Q 3R2IA 3HOXG 5LMUL 5FLXc 1HXYD 4CDFC 2XRQD 1PA6A 1TWAB 4X65Q 2PNRC 4ODGA 2BH2A 5DM73 3CCEA 2JEBI 5IT9c 1PRTB 4TRDA 5CGKA 1BBXC 4OWWB 4DXFA 3M4YA 2VZAA 5CR3A 1TWHH 3SE0A 3FP9A 4J6HA 2KHJA 1B70B 1IKMA 3C1EA 3J80L 1QVGA 3K7AB 5M5YB 2D5DA 1HUMA 3ONAB 5E7NA 4A4IA 3UE0A 4K8IA 1E22A 4C1NK 4A3DH 1TWFH 4X3KA 5GADC 1K0SA 5IYBH 4PMBA 3UDFA 2FINB 5FO7B 2RF4A 2YTYA 2VB2X 1R4PB 5C44G 4F7XA 3RNUA 3K8AA 1DJRD 1PH1A 4DV5Q 4JYAL 3G6EA 5C3EH 4UP7A 2A6EC 1ESFA 1HA6A 1B4OA 2JN4A 2KCNA 4IUQA 4ZRZA 3GTJB 1KLUD 4R4OA 2B2YC 1YHAA 3DWPA 1G2TA 2V1CC 4DR7L 1K0RA 1L1OA 1SDFA 3PO3B 3CCLA 3QB3A 1D5MC 2B2WC 1JOOA 3S17B 4A3LH 3S24A 4LF9Q 3BDOA 5JJKA 2LXJA 4CKBA 2L11A 2HDMA 3PUZA 1TR5A 4KY5A 2G9HD 4O0AA 3U4VA 2EYPA 2Z6KC 1EOVA 1K9MC 1XMQQ 2E2JH 4H02A 1KLGD 5ELOA 1HQRD 2NVXH 1SNCA 4R1JA 4LJZC 2K04A 5IP9H 4DAYB 3HOVG 1PYSB 2JJQA 4OL7A 2ZJPA 4NXMQ 4RH6A 3B6YA 4KN7C 1JT8A 1C4QA 3AU7A 3F2CA 5CV8A 1IBLQ 3MXGA 3S1RB 2KHSA 3OSOA 4QUFA 3IFDA 1X32A 2JA7G 4LUZA 3F2UA 3TQYA 2ZXRA 1HA5A 1Q90A 4B3TQ 4MTKA 3J7ZC 2ENBA 2R92G 1I4XA 3HS0C 3AB9A 1CUKA 3K81C 4O42A 5IIFA 4A3BB 1JE4A 1UE6A 5NUCA 2UUCL 4IPCA 2TMPA 2K6AA 1X65A 3FKIG 4X64L 2WV6D 3HKZE 5CBAE 4A76A 4QF4A 1WD1A 1K83H 1E3PA 1IYUA 1IBML 1EQTA 4OX9L 1QVCA 2EY5A 4PZ7A 3U50C 4GNXC 4LFCQ 1I6VC 1V1QA 3AFQA 3H0GH 2EYJA 3T1HQ 1HR0Q 2XTIA 1TS3A 1YNXA 4A3FH 5IE8A 2WAQG 2NZOA 4F87A 4B3ML 4AYBE 2D0OA 1PH5A 1N33L 1EY5A 4YCWA 2MGSA 2IX1A 4ZCKA 1RD9D 3GQBA 1KNEA 2YV5A 4AYBB 5IGBA 3HKSA 1X54A 4LFAQ 4S3SA 1PTOF 2K5HA 4RKLA 5DNFA 1Q7YC 4U673 4RAUC 4NXNL 4JI7Q 1HCZA 4DR2L 2QEJC 3EROA 3PSIA 1NCVA 5E4WC 2JA7B 1NTGA 1EIYB 2F0NA 3L7ZC 3KF8A 3STBC 5IYBG 3TP8A 4HJ5A 4OELB 2R92B 1A3TA 2ES2A 3AFPA 3F8TA 5EAYA 3E9HA 3W1BA 3Q0AA 5M5WH 3SR1A 1SMYC 1E1OA 2F0PA 3I72A 2NWGA 4X62L 2R3ZA 4PG3A 4I7ZC 2EDGA 4HCSA 1PZJD 1M4VA 1E2ZA 4B9WA 2C35B 2OCEA 3P7JA 3BS1A 5I6WA 3S9WA 1QUQB 4WRDA 1M90C 1ML0D 1GJXA 1DM0B 2KVMA 2Y0SG 4DAMA 4FF4A 2IWHA 1RODA 3HGBA 3GTQB 2RHSB 3KJPA 2C9OA 3S1MB 1TWHB 4WJ4A 4A3LG 2OF1A 3NEMA 2R93H 2BDOA 3I4NH 2VB3X 4ZYSA 4JBKA 4ZUJA 2DGYA 1SFOB 2LKVA 3JAML 3DEOA 4LW1A 4FP5D 1C9OA 1EWHA 1SNOA 4CDDC 4HJ9A 4A3DB 4CJ0B 1TS5A 1X56A 3BVZA 5IP9G 4B9XA 1CM9A 5DEHA 3RUZA 4R9WA 1XNQL 4NB3A 1BO0A 1H9JA 3E3XA 4NDXA 1L0YB 3A8IE 5G3LF 3U58A 5I4DA 5IGEA 4LK1C 3PGZA 4KKUA 3ZYYX 4XTCS 4P72A 3J80i 5C3EB 3D3RA 4IPGA 4IFDJ 3K59A 2SNMA 3KLSA 2GA4B 3SGIA 4EQ5A 3PO2H 4WORA 3PUWA 1JORA 1EIHA 1SNQA 2AMCB 1YHQA 3GP7A 4HJ7A 2JA6B 3J7A5 3VR4A 3K0XA 2AUKA 2Q8TA 1SYBA 4MIUA 3H3VH 2L15A 3P75A 2B2TA 1Y1WG 2B63B 3KDFA 3LWUA 1S5ED 4K5VA 1EY4A 5EPJA 4RGTA 1LTBD 3H0GG 4N9TA 1SE3A 3L2PA 3BZKA 2E2JB 4A3FG 1YHBA 2NVTH 3RZDH 1SE2A 2EIFA 2NVXB 5JJIA 1W3SA 4DGZA 1TQOA 4DV4L 1NY4A 4N9PA 5LMNL 1PFSA 2I5HA 4F8MA 4JBJA 4WJWA 5IGDA 3CCJA 4GLXA 1TKWB 1QNUA 1VQCA 2EXDA 3PCOB 1H95A 1CA6A 1STBA 3J7AV 5M3FB 1LTID 5CV6A 4DV3Q 1X55A 4GOPC 1Q1BA 4QCLA 3MAQA 1RHPA 2F0EA 4O1NA 2EYOA 3X3MA 5FLXL 1B9NA 1RKNA 1RTNA 5DAUA
chains in the Genus database with same CATH topology
3VYSA 1ICWA 3EJIA 1LTGD 1VF7A 2NN6H 2F0WA 3UI2A 4KY6A 5KYIA 1SYEA 5IT9L 1GXDC 1QCBD 1O7YA 5K36H 1SNDA 1VCIA 4KI0A 5E3FA 4P2CB 1PRTF 4XXEA 2Q8IB 2E74C 5C5MA 1Y8NB 2ZT9C 1KDAA 5IGFA 3OHXC 2RQXA 3BVGA 5JOBA 3SK5A 3SDZA 1ESRA 2J7ZA 4WFN3 4K8JA 4G57A 4OIKA 3D4DA 1TS4A 5LL6S 2NTSA 4DAYA 3RMHA 1G6ZA 1Y8PB 1I4HA 2RKSA 1EWCA 2K32A 4ZLTF 2EY2A 3IL8A 1Z47A 2XVSA 2DNEA 4JK1C 4G7HC 2WIIB 2K1BA 5JVH3 4ID6A 3BYTB 1J9OA 4K14A 1FD7D 3T51B 3MZ5A 2JYOA 4KHVA 1DOKA 1F9SA 2BA1A 4R8IA 3I4LA 4F88A 1EY8A 4DN4M 2AQ2B 2OXPA 3PMFA 4KD4A 2A6ED 2EVBA 1B9MA 2B2VA 1H9RA 3PO2B 1EU4A 3QJYA 5TSSA 4ZK9B 1PMRA 2F0TA 4HAEA 5KNDA 5KEEA 1LT4D 1AZPA 3MFGA 2AUJD 1H9SB 3BG3A 4KN4C 1PTOC 2BE5C 5ELFA 4QB4A 5I2YA 1AN8A 2NN6G 2M00A 1LTSD 2IJ0A 2JEAI 2F0JA 4KKSA 4X3TA 2IT1A 2KECA 5K36G 2O5IC 3BYYB 2B2UA 3ND9A 4IUPA 3S14B 1BUVT 2CVRA 3N52A 1QE6A 2CW0D 3FEWX 1HRJA 5COYA 1AFPA 2O2LD 3TZDA 3OWFA 1D1KA 1K8MA 2NVQB 4DFAA 2A74C 2RSOA 1AW7A 3QG1A 1SSOA 1ENCA 4IFDG 1DXMA 1I4RA 5EPLA 1HFNA 4HCEA 5EGTA 2F0KA 3VYTA 3J7YW 1MD2D 1BCPB 1Y69U 4C3JG 3HEJA 2F0FA 1X3PA 1CFMA 1Z7TA 3T53B 4LMQD 1XYIA 5F2DA 1STNA 1FGBD 2Z4HA 1CK1A 1ONLA 4G4KA 2JA8B 1LTRD 4BA2I 1WTWA 1Q3LA 2KOLA 3VR6A 5FO8B 1EY9A 1FNUA 2HQEA 4B08A 3MTSA 2X6LA 3SEBA 4NP5A 4ZKBB 4XT1B 3TZUA 2SDFA 4EQPA 1WVLA 5JEAJ 2XSCA 1KDBA 3EVQA 1BF4A 4DNTB 1WTPA 2QKIC 3S2DB 3A8KE 4UAIA 2DY7A 1WTRA 1CT1D 1C8CA 2B2TC 1S5CD 1BNZA 4A3IB 2VUMB 1T5XD 1EFID 2F0GA 3X3NA 3P1HA 3D8GA 3WDNA 1UEAB 3NXWA 1F2YA 2F0LA 4FO2A 3PUXA 3G7LA 1E2WA 1XX8A 5CC4A 3HOXB 3KK7A 3GTPB 2L0CA 4C2MB 3PUYA 1VMPA 4IUNA 3A56A 3DM1A 4FVMA 5EKKA 1QG7A 3GTGB 2L12A 4Y7NB 4DK1A 1MI2A 1STEA 4ABNA 1A15A 3D4WA 1GUTA 4H13C 1U4LA 1F77A 4RCNA 3NTKA 3R2TA 3A55A 3ERQA 1HPCA 4HN7A 3BDLA 1NR2A 1F2LA 3NK9A 2C5CA 4C1NI 2NUCA 3PIO3 2RDFA 3R3OA 3RD4A 2F1MA 3T13A 1HFGA 5J39A 2LS01 2JXMB 5C44B 2BCOA 1BDOA 2CW0C 3U9SA 1V8QA 1QWYA 1K8OA 1JWMD 3V96A 3QWNA 3KBGA 4LAAA 3QOJA 3CKIB 5JEAH 5EJWA 1H9KA 4RHSA 2QDBA 4HSPA 1STAA 1UUPA 2F3VA 1I6HB 3A7LA 3NP8A 4DU9A 3MXUA 4XYQA 1SYFA 5A2QL 1H9SA 3EFXD 1UAPA 4RKBA 4DXGA 3L9AX 3D31A 3HOVB 1QILA 2NBFA 1A3VA 4NKLA 1U4PA 3Q24A 3NUCA 2NTTA 3S1NB 2CHBD 2F0SA 3J81L 1HTPA 3OIPA 5CV5A 3MXNA 1FYCA 3T56B 1ENAA 4FNFA 3W2DA 4L6TB 2E2IB 1L0XB 5C6AA 4TKOB 2A68D 3GTLB 2LY7A 2K28A 3TDQA 2PZUA 2L5TA 1ZYRD 3FKIB 4ZQ3A 4HMJA 5K5PA 1JWSD 2QILA 4OO1H 3AMUA 2L1BA 1B53A 1MSHA 2EYMA 5IODA 5ELBA 2PYKA 2B2VC 2EOTA 2D2CC 3A54A 3VA7A 3T4AC 3R93A 3BVMA 2WAQB 5DM63 2RA4A 3CU7A 3NWTA 1BR9A 3DWAA 5JJZA 1SAPA 2E75C 3MHBA 4CBVA 2Q8RE 1LTTD 1TWGB 4KK7A 1SNPA 5KYLA 4RWSC 5EKIA 1C48A 2IPKD 1TWFB 3TP5A 2OT2A 1SE4A 2B2UC 1EYCA 2VXWA 3BZDB 2AQ3B 5BN5A 5E1FA 3TSSA 2SEBD 2F0IA 3URYA 1PTOD 2BE5D 3VYRA 1PTOH 4L63B 4KTAA 5JEAG 2Y0SB 3VA5A 4IUVA 3G6JB 4J8QA 1BCPF 1ILPA 2Z8LA 2NN6I 1DD2A 1OXSC 4FXDA 3PV0A 1A3UA 1HQMC 4NMZA 5IGCA 4KV6A 5FOBB 1O80A 1WTVA 1CZWA 2EJFC 1VDZA 4Z9CB 1V1PB 1JC7A 1F9RA 1VMCA 4C56C 2XWBB 3J80E 2PMZB 2PZTA 1TU2B 1ZKOA 2IW3A 3OMCA 1RTOA 1W6JA 3I3CA 3GTKB 4BWGB 2J0TD 4CKEA 1KABA 1Y1WB 2XRSD 5ISRA 1K83B 3GO5A 2KA7A 4OO1G 1PLFA 4QIWB 5G3LD 4RFBA 2EYLA 5HURA 2H1EA 2J4XA 4CGYB 3S2HB 3H0GB 1MSGA 1I4PA 1B2TA 4A3FB 1PFBA 1RDPD 3SHLA 1Q12A 1AEXA 3EA6A 5LHY1 3RLFA 1SJED 2X6GA 3NBHA 2A69D 3NQTA 2MHVA 2O5JC 1IL8A 2IX3A 4BY7B 3TP6A 1KNAA 4H7BA 1S5BD 1CI3M 4C3IG 5KGUA 2EY6A 3K6OA 2XNAC 2ZXOA 2EY1A 5M5WB 2BOSA 3FDTA 3MFYA 2HUGA 4IFDH 4E6IA 1FR3A 1IHZA 3D6WA 3RZOB 2A68C 1EY0A 1ZYRC 3M7NA 3A7AB 3E6ZX 4IN3A 3P20A 3L3OC 1F9PA 2K05A 2R93B 1JB3A 1JQYD 3I4NB 5HGTA 4K2KA 2F0UA 4QMGA 5E4XA 4Q5VA 2Z4IA 2B39A 4XQJA 2MJ8A 2PW5A 2PPBC 1SXTA 1PRTD 4RGOS 5C0XJ 2NB0A 2XIWA 1IKLA 2EYFA 1SEBD 2WKCA 1BXTA 4OGQC 2L9HA 5J22A 2B8GA 3FPPA 1A2UA 2KJXA 4K2LA 1V1OA 2RBMA 2F3WA 3QIAA 5D3IB 3TBIB 2DNCA 4Q0FA 1W6KA 1Z6HA 3NWSA 1TIID 1T5EA 5KRUA 1KAAA 4RGMA 3EQLC 1Q8IA 1B44D 2FFKB 4V0BA 5C5LA 1YNJC 1LT5D 2NVTB 3RZDB 2F0HA 3K57A 5I9PA 2RSNA 1XWEA 2EXZA 4TQUS 2AQ1B 2WINB 4EVOA 2VNUD 1Y8OB 1LT6D 4MHEA 1RCVD 1TVXA 3NTHA 1R4QB 1JWUD 3JAME 4DAVA 3GD7A 4CJ2C 1WD0A 1EYAA 3FRPB 3MWYW 1A2TA 1RF2D 4HEDA 3D4RA 1ILQA 3K5OA 3I91A 1S5DD 1DZ1A 4ME5A 1D5XC 4C3HG 2N55A 5EKLA 1CA5A 3FVQA 2A6HD 3VR3A 1B1ZA 2L4NA 1ENFA 4BA1I 3W3AA 1H9MA 1TY0A 3V05A 5T1IA 5D14A 2G9DA 3S15B 2JSOA 1FNWA 1MGSA 5M3MB 3K5MA 5KIXA 1EEFD 2FMCA 1O7ZA 2K5QA 2RVLA 2A69C 2ICIA 1EU3A 5C0XH 2JE6I 2SNSA 3K58A 2PCFB 3SK4A 2QF7A 2EZVA 1EYDA 1V1PA 3NQIA 4BBRB 1EEID 4IZ8A 3GV6A 4C3JB 1LACA 3CRKC 3I4MB 1OXXK 3DMUA 2ID0A 4BY1B 5FLXE 3I8ZA 1QJOA 5CBEE 4H44C 1IYVA 1BOSA 1B3AA 4HTHA 3E5SA 2WB1B 2M9VA 3NTIA 2MPMA 5IT9E 3N6RA 3TP7A 3KUPA 2CQAA 3WOFA 3S16B 1DYQA 4KD3A 2BA0A 3J7AF 5I9OA 3DXJC 4FF2A 1J8IA 1LT3D 1GOZA 1PRTC 4MN3A 1EL0A 2K5DA 3OW7A 1E0BA 1II3A 4ZKCB 5ELEA 4J1MA 3TMEA 4XYOA 2PQEA 4FXKC 4OHJA 3OWEB 3A8JE 1I4GA 5CV4A 4KY7A 3R8BA 3CHBD 4RGNA 4A93B 1TT2A 1PXUA 5IGGA 2F4IA 4NW2A 1F2ZA 4YIJA 4V190 4H0LC 4A3MB 1OXTA 2B8FA 3HRZC 1LABA 1U9RA 1PZID 1EIGA 2V4DA 4X3UA 3HOUB 1DCZA 1VF5C 3MVVA 2K7VA 1D5ZC 2N88A 3Q23A 5C0XG 1ZXTA 2F0DA 1XTCD 2EYHA 1Q1EA 1JR0D 3SXHA 5M5XB 3OPOA 3MXPA 3I90A 3M7GA 3GTMB 3DUZA 3MA2B 3BDCA 4KHZA 2FMMA 3S1QB 3NHHA 4OO1I 5EPKA 3TN2A 1NSNS 3H91A 2WKDA 4QUCA 2MP1A 3VR2A 1GHKA 4R8NA 4RHRA 1Y1VB 2AWNA 5JAVA 1IW7D 1E2VA 2A5HA 1EY6A 2A6HC 1SYGA 2KEDA 1PFNA 2JP1A 1SJHD 4BBSB 3CRLC 3HKZB 4HSVA 3PIP3 1DOMA 2WP8J 1S4ZA 2YU9B 2EE1A 2I07B 5FKAC 4JBWA 5JPMC 1U4RA 5AFWA 5D3DA 3IKJA 2YYZA 3H09A 4XT3B 4XQQA 5EBCA 1B50A 1LV9A 5ELDA 3IFTA 4OIJA 1OO9B 2F0MA 1I50B 4KJOA 5FO9B 3DHQA 1HTLD 3I70A 3D6CA 5C4XB 5BN3A 2ICEC 2EJMA 4K5XA 1CQFA 1GHJA 1EQVA 1PYWD 1LLRD 2OEOA 3T16A 1G291 2ZXPA 5KNCA 3GTOB 5IOCA 4K6DA 5CV9A 2K33A 1BQQT 2O4XA 2HCIA 1JOKA 1WCMB 3MEHA 5CYUA 3I73A 1D2BA 4K6LA 5I2XA 1WTOA 1F2MA 1OXUA 1I3QB 2TSSA 3CQZB 2PZWA 4X3SA 1R9TB 4XQNA 1PZKD 1RJTA 3HZXA 2PO4A 2K01A 4PMCA 4L8JA 4PV1C 1WTQA 1YNJD 1G2SA 5CV7A 2I46A 1LO5D 4HR7B 4XDXA 4DAPA 1X3QA 1TWCB 2AWOA 4A3EB 2DN8A 3FMCA 2FHTA 2RDGA 4HMIA 1STGA 3O13A 1JICA 4IALA 1CTMA 2KEEA 5M9OA 1I4QA 5EQ0A 4CHTB 2KUMA 3M4OB 1OXVA 2NVYB 1PFMA 3NE5B 1EY7A 2M2LA 2NYZD 3H6MA 3WOEA 1G91A 2JA5B 4IFDI 1YNND 3C1FA 4DA2A 1SYDA 1GUSA 2B2YA 3OIQA 1NR4A 1CQVA 4A3JB 2WACA 2IL8A 5C4HA 1EZ6A 2F0OA 2B2WA 4PQXA 2F0QA 1STYA 4ULLA 1SNMA 3HOYB 1BCPD 1IW7C 1CHQD 4IURA 2H4OA 4XIGS 4M8AA 4ZAIA 2E2DC 1JOQA 3FPUB 5KNBA 1QNKA 5ELCA 1GUOA 2MUYA 2SOBA 4M1UB 2F0VA 4FF3A 5C3XA 3OOCA 1GUWA 1CHPD 3V2TA 3HOZB 4I65A 1V43A 1LTAD 2E76C 4EQOA 4KKTA 4RCOA 1DONA 4KJNA 4A3GB 1D6EC 4DNRB 1O78A 4IUTA 4PMWA 3NPPA 4U68A 2R6GA 1PDQA 5A2QE 4C3IB 3H94A 3ITPA 2K5WA 1DOLA 3Q22A 1MBYA 2XWJB 3K5LA 5I6YA 3NBIA 1TY2A 1A6XA 4IQZA 1PTOB 2HCCA 2XN9C 3J81E 2LFNA 2KCCA 3C2PA 2IX0A 1TS2A 3NSWA 2L55A 4IUUA 4FYDA 5FK9C 5CMDA 1ZEQX 2R7ZB 2X69A 1GUNA 4FF1A 1ET6A 1QB5D 1U4MA 3E0JA 2RDHA 5JVG3 3OMGA 5C3WA 5LL6X 1F9QA 4UDUC 4TSSA 2E2HB 2D62A 4GZYC 2LMCB 3VR5A 1G8ZD 3H3VC 3U9OA 1D1IA 5EBDA 1UNSA 3KLRA 1SYCA 5T1GA 1O7LA 5JPNC 1NUCA 3SK6A 5C0XI 3LWEA 4DF7A 3HG9A 3KLSX 2NZ1D 4CKCA 3SVMA 4RA8A 1GUGA 3QO2A 4G7OC 1M8AA 3QOLA 4EQNA 3SK8A 1AP0A 1CZGA 3Q6SA 1KTKA 2R61A 2EJGC 1YNNC 1EZ8A 4FXGC 4PNYA 4ZUIA 2BDNA 3C3LA 3VYUA 2FJ2A 3HOWB 3MC0B 5C4JB 5J1ZA 5BN4A 4BS9A 4ILWA 1KDCA 3IAYA 1STHA 5D65A 2D9UA 3ND8A 3HP3A 1S5FD 3DWQA 5C4ZA 4KMUC 3GV3A 4DK0A 1ET9A 2EPBA 1NAPA 1BCPC 1WTXA 3PUVA 4CJ1B 3M85A 1SBBB 2A73B 3M3YB 2HDLA 1QOHA 1AZQA 3LNNA 2QCPX 4C3HB 2KQ3A 4G7ZC 2F03A 5CORA 1XXGA 5A35A 3K5NA 1EOTA 1FNVA 1SMYD 2DY8A 1JCKB 1HHVA 1HUNA 3KBXA 3K0YA 3DEPA 2Z1CA 3C46A 2PW7A 4A3KB 2K03A 4EGVA 3LX0A 4K5WA 3R2IA 1HXYD 2XRQD 1TWAB 2PNRC 4ODGA 5DM73 2JEBI 1PRTB 4TRDA 5CGKA 1BBXC 4DXFA 3M4YA 5CR3A 3SE0A 4J6HA 1IKMA 3C1EA 3J80L 3K7AB 5M5YB 2D5DA 1HUMA 3ONAB 4K8IA 4C1NK 4X3KA 4PMBA 2FINB 5FO7B 2VB2X 1R4PB 4F7XA 1DJRD 2A6EC 1ESFA 1HA6A 1B4OA 2KCNA 4IUQA 4ZRZA 3GTJB 1KLUD 2B2YC 3DWPA 1G2TA 1SDFA 3PO3B 3QB3A 1D5MC 2B2WC 1JOOA 3S17B 3BDOA 4CKBA 2L11A 2HDMA 3PUZA 1TR5A 4KY5A 2G9HD 2EYPA 1KLGD 1HQRD 1SNCA 4LJZC 2K04A 4OL7A 4RH6A 4KN7C 1C4QA 3AU7A 5CV8A 3MXGA 3S1RB 2KHSA 3OSOA 4QUFA 3IFDA 1X32A 3F2UA 2ZXRA 1HA5A 1Q90A 2ENBA 1I4XA 3HS0C 3AB9A 4O42A 5IIFA 4A3BB 1JE4A 5NUCA 2TMPA 2K6AA 2WV6D 5CBAE 1WD1A 4QF4A 1IYUA 1EQTA 2EY5A 1I6VC 2EYJA 1TS3A 4F87A 1EY5A 2MGSA 2IX1A 1RD9D 3GQBA 1KNEA 4AYBB 5IGBA 4S3SA 1PTOF 4RKLA 5DNFA 4U673 4RAUC 1HCZA 2QEJC 3EROA 1NCVA 5E4WC 2JA7B 2F0NA 3L7ZC 3KF8A 3TP8A 2R92B 1A3TA 3Q0AA 3SR1A 1SMYC 2F0PA 3I72A 2NWGA 2R3ZA 4I7ZC 2EDGA 4HCSA 1PZJD 1M4VA 1E2ZA 4B9WA 3P7JA 3BS1A 5I6WA 3S9WA 4WRDA 1ML0D 1GJXA 1DM0B 2KVMA 4FF4A 2IWHA 1RODA 3HGBA 3GTQB 2C9OA 3S1MB 1TWHB 2OF1A 2BDOA 2VB3X 4ZYSA 4ZUJA 1SFOB 2LKVA 3JAML 3DEOA 4FP5D 1EWHA 1SNOA 4A3DB 4CJ0B 1TS5A 3BVZA 4B9XA 1CM9A 5DEHA 3RUZA 4R9WA 1BO0A 1H9JA 4NDXA 1L0YB 3A8IE 5G3LF 5I4DA 5IGEA 4LK1C 4KKUA 3ZYYX 4XTCS 5C3EB 3D3RA 4IFDJ 3K59A 2SNMA 3KLSA 2GA4B 4WORA 3PUWA 1JORA 1EIHA 1SNQA 3GP7A 2JA6B 3VR4A 2Q8TA 2AUKA 1SYBA 4MIUA 3P75A 2B2TA 2B63B 3LWUA 1S5ED 4K5VA 1EY4A 5EPJA 4RGTA 1LTBD 4N9TA 1SE3A 2E2JB 1SE2A 2NVXB 4DGZA 1TQOA 4N9PA 4F8MA 4WJWA 5IGDA 1TKWB 1QNUA 1CA6A 1STBA 3J7AV 5M3FB 1LTID 5CV6A 1Q1BA 4QCLA 3MAQA 1RHPA 2F0EA 4O1NA 2EYOA 3X3MA 5FLXL 1B9NA 1RKNA 1RTNA 5DAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  1JOQ A;  5F2D A;  4OL7 A;  2PW7 A;  5CV7 A;  1SYG A;  5HGT A;  2OF1 A;  1STN A;  2PZU A;  3U9O A;  3EJI A;  3D4W A;  3LX0 A;  2F0U A;  4K2K A;  4K5W A;  4ME5 A;  4QMG A;  4ZQ3 A;  2F0W A;  4HMJ A;  5K5P A;  1SYC A;  2SOB A;  4ZUJ A;  2LKV A;  5EKL A;  4KY6 A;  2F0V A;  5KYI A;  1SYE A;  5CV8 A;  3ERQ A;  1II3 A;  1NUC A;  2EYM A;  2F0T A;  2PZT A;  3BDL A;  5IOD A;  5C3X A;  2KHS A;  3SK6 A;  3OMC A;  1SND A;  2PYK A;  5E3F A;  3NK9 A;  3OSO A;  5KEE A;  3V2T A;  1SNO A;  2PW5 A;  1EY9 A;  4I65 A;  2HQE A;  4J1M A;  5I9O A;  4DF7 A;  4ODG A;  3TME A;  4NP5 A;  2PQE A;  4B9X A;  2ENB A;  2NUC A;  4HMI A;  1STG A;  5DEH A;  5C5M A;  3RUZ A;  4EQO A;  4IAL A;  2RDF A;  4QB4 A;  5IIF A;  1KDA A;  4NDX A;  4TRD A;  1KAB A;  5NUC A;  2EYF A;  5IGF A;  3R3O A;  4EQP A;  5CGK A;  3T13 A;  5CV4 A;  2M00 A;  4KY7 A;  5IGE A;  5ISR A;  5J39 A;  5CR3 A;  4QF4 A;  3MHB A;  2F0J A;  4KJN A;  5M9O A;  2EYL A;  4J6H A;  5JOB A;  5HUR A;  1TT2 A;  3SK5 A;  2EY5 A;  5IGG A;  5J22 A;  3C1E A;  2SNM A;  3QOL A;  4EQN A;  3SK8 A;  5KIX A;  4K8J A;  4G57 A;  1A2U A;  4WOR A;  1F2Z A;  4YIJ A;  1JOR A;  1KDB A;  2EYJ A;  4K2L A;  1SNP A;  1SNQ A;  3D4D A;  2F0M A;  5KYL A;  2RBM A;  2F3W A;  3EVQ A;  4LAA A;  4KJO A;  2SNS A;  1SYB A;  3QOJ A;  1EZ8 A;  3DHQ A;  3TP5 A;  3SHL A;  3SK4 A;  4K8I A;  4PNY A;  4MIU A;  4ZUI A;  3ITP A;  1AEX A;  1EYC A;  1EY7 A;  1U9R A;  3D6C A;  3P75 A;  1EY5 A;  4PMB A;  5E1F A;  3H6M A;  5IGB A;  4K5X A;  1EYD A;  5KRU A;  5C6A A;  3NQT A;  2QDB A;  3MVV A;  1KAA A;  4S3S A;  1STA A;  4K5V A;  1EQV A;  2F0I A;  1EY4 A;  2RKS A;  5J1Z A;  4F7X A;  3C1F A;  4RKL A;  2F3V A;  3OWF A;  1SYD A;  2OEO A;  4IZ8 A;  1KDC A;  5C5L A;  3T16 A;  5I6Y A;  3NP8 A;  1STH A;  3TP6 A;  4DU9 A;  3ERO A;  4N9T A;  4H7B A;  2EY2 A;  5C4Z A;  4DFA A;  2F0G A;  5IOC A;  2F0N A;  2F0D A;  2F0H A;  4K6D A;  1SYF A;  2WAC A;  2EYH A;  3P1H A;  2EY6 A;  4KTA A;  5CV9 A;  3SXH A;  5I9P A;  5KGU A;  3D8G A;  4RKB A;  3DMU A;  1EZ6 A;  5C4H A;  3TP8 A;  2F0O A;  3VA5 A;  1TQO A;  2EXZ A;  2O4X A;  1A3T A;  4DGZ A;  2EY1 A;  1ENC A;  3MXP A;  4N9P A;  3NXW A;  1F2Y A;  2F0L A;  4EVO A;  1A3V A;  4NKL A;  4F8M A;  2F0Q A;  3QB3 A;  1STY A;  1SNM A;  1JOK A;  3BDC A;  3MEH A;  3SR1 A;  4HTH A;  3E5S A;  5IGD A;  1JOO A;  2F0P A;  4E6I A;  5EGT A;  2F0K A;  4ID6 A;  5CC4 A;  3NHH A;  3NUC A;  2KQ3 A;  1NSN S;  4K14 A;  1IHZ A;  1F2M A;  1TR5 A;  4KY5 A;  1STB A;  4B9W A;  3TP7 A;  3OMG A;  3MZ5 A;  1EYA A;  2EYP A;  4KHV A;  5CV6 A;  1A3U A;  5C3W A;  2F0S A;  5I6W A;  1A2T A;  3S9W A;  2PZW A;  4NMZ A;  4WRD A;  1EY0 A;  2F0F A;  3HEJ A;  4KD3 A;  4R8N A;  5CV5 A;  5IGC A;  4IUN A;  4KV6 A;  2F0E A;  5JAV A;  3HZX A;  1ENA A;  1EY8 A;  2EYO A;  5EKK A;  1SNC A;  2OXP A;  3PMF A;  4PMC A;  1RKN A;  5DAU A;  4KD4 A; 
#chains in the Genus database with same CATH topology
 3VYS A;  1ICW A;  4DUY L;  3EJI A;  1LTG D;  1VF7 A;  2HIX A;  2NN6 H;  2F0W A;  4JI1 Q;  3UI2 A;  4KY6 A;  5KYI A;  1SYE A;  5IT9 L;  1GXD C;  4GN4 B;  1QCB D;  1O7Y A;  4IOA A;  5K36 H;  1SND A;  1VCI A;  4KI0 A;  5E3F A;  1WYD A;  4P2C B;  1PRT F;  4XXE A;  2Q8I B;  2E74 C;  1A63 A;  5C5M A;  1Y8N B;  4KHP L;  3KJO A;  2ZT9 C;  1KDA A;  1WOC A;  2R93 G;  5IGF A;  3I4N G;  1TXY A;  3OHX C;  2RQX A;  3BVG A;  5JOB A;  1UWV A;  3FHW A;  4O2D A;  3SK5 A;  3SDZ A;  3UE1 A;  1ESR A;  2J7Z A;  4WFN 3;  4K8J A;  4G57 A;  4IJH A;  4OIK A;  3D4D A;  4GKJ Q;  5ELN A;  4DR3 L;  1TS4 A;  5LL6 S;  3CCR A;  1N34 L;  2NTS A;  4X66 L;  4DAY A;  3RMH A;  3PIO A;  1G6Z A;  1NBW A;  2Z9H A;  1FJG L;  1Y8P B;  1I4H A;  2RKS A;  1EWC A;  4AH6 A;  3PO2 G;  3OTO Q;  4JI3 L;  2K32 A;  4ZLT F;  4L5Q A;  2EY2 A;  3IL8 A;  1VQD A;  1Z47 A;  2XVS A;  4JV5 Q;  2N78 A;  4I7A A;  1C0A A;  1L2F A;  2DNE A;  4JK1 C;  4G7H C;  3CXC A;  1VQN A;  2WII B;  3S2D H;  3KF6 A;  2K1B A;  4N8X 1;  5JVH 3;  2EQS A;  2QDL A;  2CWP A;  1L1O C;  4ID6 A;  3BYT B;  4PZ8 A;  1J9O A;  1NJI C;  4K14 A;  1FD7 D;  3T51 B;  4L5R C;  3RR5 A;  3MZ5 A;  2JYO A;  4KHV A;  2HHH L;  1DOK A;  1F9S A;  2BA1 A;  4R8I A;  4A3I H;  2VUM H;  3S16 H;  4DR1 Q;  3I4L A;  4F88 A;  1EY8 A;  1GM5 A;  4R4C A;  4DN4 M;  2AQ2 B;  3PMF A;  2OXP A;  1N36 L;  1PH4 A;  4KD4 A;  4OWX B;  2A6E D;  4WJ3 M;  3J81 c;  2UXC Q;  2EVB A;  1IYJ B;  4JI5 L;  1B9M A;  2B2V A;  1VQ9 A;  1H9R A;  3PO2 B;  2D0P A;  1EU4 A;  3A0J A;  2UXD L;  3QJY A;  5TSS A;  1NE3 A;  4ZK9 B;  1PMR A;  2F0T A;  4HAE A;  3HOX H;  5KND A;  5KEE A;  1LT4 D;  1AZP A;  3MFG A;  1KD1 C;  2AUJ D;  1S72 A;  1H9S B;  3BG3 A;  4C2M H;  1G6P A;  4KN4 C;  1PTO C;  2BE5 C;  5ELF A;  2UUB L;  4QB4 A;  5I2Y A;  1VQM A;  2F4V L;  1AN8 A;  4DV2 Q;  2NN6 G;  2M00 A;  1LTS D;  2IJ0 A;  1K3B C;  2JEA I;  1HNZ L;  2F0J A;  4YCU A;  4KKS A;  4X3T A;  4A93 H;  2IT1 A;  2KEC A;  5K36 G;  1YJW A;  2O5I C;  3BYY B;  2B2U A;  2IHE A;  2VQF L;  3ND9 A;  4IUP A;  1Q86 C;  3S14 B;  1BUV T;  2CVR A;  3N52 A;  1QE6 A;  3UDX A;  1BKB A;  4DPG A;  2CW0 D;  3FEW X;  1C7Y A;  1B3Q A;  1HRJ A;  4MZ9 A;  5LMN W;  5COY A;  1AFP A;  4LF7 Q;  1YIT A;  2O2L D;  3TZD A;  1B8A A;  3OWF A;  2UUA L;  1D1K A;  1HZ9 A;  1K8M A;  4YHH L;  2NVQ B;  4DFA A;  3A74 A;  2A74 C;  2RSO A;  4LFB Q;  1JJ2 A;  1AW7 A;  3QG1 A;  1JJC B;  1SSO A;  1ENC A;  1D8L A;  4DUZ L;  2VS1 A;  4IFD G;  1DXM A;  1X6O A;  1IBK Q;  1I4R A;  1ASZ A;  5EPL A;  1HFN A;  4HCE A;  1SMX A;  5EGT A;  2F0K A;  3IRB A;  3VYT A;  2MO0 A;  3J7Y W;  3S1Q H;  1MD2 D;  1BCP B;  1Y69 U;  4C3J G;  1XTD A;  2H5X A;  1PH7 A;  1KAW A;  3HEJ A;  2F0F A;  1X3P A;  1CFM A;  4UY8 C;  2AHO B;  1Z7T A;  3T53 B;  4BXX H;  2YTV A;  4LMQ D;  3ICE A;  1XYI A;  1IL2 A;  5F2D A;  3U4Z A;  1STN A;  3HOV H;  1FGB D;  2WB1 G;  4LF6 L;  3DM3 A;  2Z4H A;  1CK1 A;  3A5U A;  1XNR L;  1ONL A;  4G4K A;  2FXQ A;  4K0K L;  4BBS H;  2JA8 B;  1LTR D;  4BA2 I;  1WTW A;  4DV6 Q;  1Q3L A;  2KOL A;  3VR6 A;  1XMO L;  2VUM G;  5FO8 B;  1EY9 A;  1FNU A;  2HQE A;  4B08 A;  2A1A A;  3MTS A;  4DK3 C;  2X6L A;  3SEB A;  4NP5 A;  4ZKB B;  4UP9 A;  1KL9 A;  3CD6 A;  4XT1 B;  3TZU A;  2SDF A;  4KLK A;  4EQP A;  1WVL A;  2E2I H;  5JEA J;  2XSC A;  3GTL H;  1YIJ A;  3D0F A;  4R4T A;  3FKI H;  3CCM A;  1HNW Q;  5JJL A;  5FJ8 H;  4B3S Q;  1EYG A;  2UU9 Q;  1KDB A;  3EVQ A;  1BF4 A;  4DNT B;  1I50 H;  2UXB L;  4JI8 L;  2QKI C;  2N49 A;  1WTP A;  3S2D B;  4ME3 A;  3HFZ B;  3A8K E;  4UAI A;  2DY7 A;  1WTR A;  1CT1 D;  5LMU Q;  1C8C A;  4A93 G;  2B2T C;  1S5C D;  2Z6B A;  4QL5 A;  1TWG H;  1GVP A;  4A3I B;  1BNZ A;  1T5X D;  1EFI D;  2VUM B;  2F0G A;  2NZH A;  4N8F A;  3X3N A;  4A3M G;  3P1H A;  4RG1 A;  3GTO H;  2HQL A;  3D8G A;  3WDN A;  1FVI A;  1YBY A;  1UEA B;  2I5M X;  3NXW A;  1F2Y A;  2F0L A;  2ZTC A;  4FO2 A;  3HOU G;  3PUX A;  5IP7 H;  3G7L A;  1E2W A;  4X6A H;  1WCM H;  1XX8 A;  5CC4 A;  2QA4 A;  3HOX B;  3KK7 A;  3GTP B;  2Q2I A;  5GAG C;  2L0C A;  4C2M B;  3PUY A;  1VMP A;  1VS0 A;  4CDE C;  4IUN A;  3A56 A;  3DM1 A;  4FVM A;  5EKK A;  1R9T H;  4JI4 L;  1QG7 A;  3GTG B;  2L12 A;  2BH8 A;  4Y7N B;  4DK1 A;  3NBH B;  1MI2 A;  1STE A;  4ABN A;  5AJ3 L;  1A15 A;  3ZJY C;  3D4W A;  1GUT A;  4H13 C;  1U4L A;  4JOI A;  1F77 A;  1WJJ A;  4RCN A;  4LF4 L;  4JYA Q;  2K75 A;  3NTK A;  3R2T A;  3A55 A;  3ERQ A;  1HPC A;  4HN7 A;  3BDL A;  1NR2 A;  1F2L A;  1TWC H;  3NK9 A;  4MTN A;  1WI5 A;  4BXX G;  3KYH C;  1KQS A;  1PVO A;  2C5C A;  1FL0 A;  4C1N I;  4DR7 Q;  2NUC A;  4DK6 C;  5IYD G;  3PIO 3;  2RDF A;  4HIK A;  3R3O A;  3RD4 A;  1X3G A;  2F1M A;  3I4O A;  3T13 A;  1HFG A;  5J39 A;  2LS0 1;  2JXM B;  3OYY A;  4BBS G;  2Q2T A;  5C44 B;  2BCO A;  1BDO A;  1MHW C;  2CW0 C;  2CWA A;  3U9S A;  1V8Q A;  1U0L A;  1KIX A;  1QWY A;  1K8O A;  3M4O H;  1JWM D;  2NVY H;  3V96 A;  3QWN A;  3KBG A;  4LAA A;  3QOJ A;  4DV1 L;  3G71 A;  1M1K C;  2A8V A;  3CKI B;  5JEA H;  5EJW A;  3GTK H;  4ALP A;  1H9K A;  2HD3 A;  4RHS A;  2B29 A;  2QDB A;  4HSP A;  1STA A;  1Y1W H;  2Q2H A;  1UUP A;  2JA5 H;  2F3V A;  1I6H B;  3A7L A;  3NP8 A;  4OEM B;  4DU9 A;  5FJ8 G;  3W5O A;  3MXU A;  3S2H H;  4XYQ A;  1SYF A;  5A2Q L;  3EFX D;  1H9S A;  2AKW B;  1VQG A;  1UAP A;  4RKB A;  4DXG A;  3L9A X;  3M4Q A;  2Q2U A;  5C4X G;  2CQO A;  2UUC Q;  3D31 A;  4MNO A;  3HOV B;  1QIL A;  2NBF A;  1A3V A;  4NKL A;  5GAH C;  4X64 Q;  3MEF A;  1J6Q A;  1U4P A;  5BR8 L;  1IBM Q;  4OX9 Q;  3Q24 A;  3NUC A;  2NTT A;  3CCS A;  2ZM6 L;  3S1N B;  2R7F A;  4BY7 H;  2CHB D;  1KXL A;  2F0S A;  3J81 L;  1HTP A;  3OIP A;  1N32 L;  5CV5 A;  3T1Y L;  3MXN A;  1AE3 A;  1VQE A;  1FYC A;  3T56 B;  1ENA A;  4FNF A;  3W2D A;  4L6T B;  1N33 Q;  2E2I B;  1L0X B;  4TKO B;  5C6A A;  4R4Q A;  5IP7 G;  2A68 D;  3GTL B;  1WCM G;  2LY7 A;  2K28 A;  3TDQ A;  2PZU A;  2L5T A;  1ZYR D;  3FKI B;  2VL6 A;  4ZQ3 A;  4HMJ A;  5K5P A;  1JWS D;  2QIL A;  4OO1 H;  4NXN Q;  3AMU A;  4DR2 Q;  2L1B A;  1B53 A;  1MSH A;  2EYM A;  5IOD A;  5ELB A;  2PYK A;  3RZO H;  2B2V C;  2EOT A;  2D2C C;  3A54 A;  3VA7 A;  3T4A C;  3R93 A;  3BVM A;  2WAQ B;  3H3V I;  5DM6 3;  1E24 A;  2RA4 A;  3CU7 A;  3NWT A;  1BR9 A;  3DWA A;  5JJZ A;  1SAP A;  2E75 C;  4X62 Q;  3MHB A;  4CBV A;  2Q8R E;  2CKZ B;  1LTT D;  1TWG B;  3I55 A;  4DV0 L;  1YJ9 A;  4KK7 A;  3CAM A;  1SNP A;  1B7Y B;  5KYL A;  4RWS C;  3E9I A;  4AQY L;  5EKI A;  3I7F A;  1C48 A;  2IPK D;  1TWF B;  4TVA B;  3TP5 A;  2OT2 A;  1SE4 A;  4C3I H;  2B2U C;  1EYC A;  1I5F A;  2VXW A;  3BZD B;  2AQ3 B;  5L37 A;  4LUV A;  5BN5 A;  5E1F A;  3TSS A;  2SEB D;  2F0I A;  3URY A;  4P75 A;  1PTO D;  2BE5 D;  1PYB A;  1XJV A;  3VYR A;  1PTO H;  4L63 B;  2Y0S E;  4KTA A;  2VQE L;  5JEA G;  3A5Z B;  3AYH B;  2Y0S B;  1XNQ Q;  3VA5 A;  2OQK A;  4IUV A;  3G6J B;  4LF5 L;  2ZTD A;  4J8Q A;  4P74 A;  1BCP F;  1ILP A;  2Z8L A;  2JA5 G;  2QW7 A;  2NN6 I;  3W1G A;  1Y14 B;  4LUO A;  1DD2 A;  1OXS C;  4HJ8 A;  4QJF A;  4YWM A;  4FXD A;  3PV0 A;  1A3U A;  1HQM C;  4NMZ A;  5IGC A;  4NPS A;  4KV6 A;  5FOB B;  1QVF A;  4IJL A;  1O80 A;  1VQB A;  1CZW A;  1WTV A;  2EJF C;  1KHI A;  3GDE A;  5GAE C;  1VDZ A;  4Z9C B;  4GOP B;  1V1P B;  1JC7 A;  1F9R A;  2PMZ E;  2P5Z X;  1VMC A;  4C56 C;  2XWB B;  3J80 E;  4BY7 G;  2PMZ B;  4FDB A;  2PZT A;  1TU2 B;  1HZB A;  1ZKO A;  2IW3 A;  3KLW A;  3OMC A;  2E5L L;  1RTO A;  2OQ0 A;  1W6J A;  1CKN B;  3I3C A;  3GTK B;  4BWG B;  4DV4 Q;  2J0T D;  3CCV A;  5LMN Q;  5HGQ A;  4CKE A;  1KAB A;  1MKH A;  1Y1W B;  2XRS D;  5ISR A;  1K83 B;  1MJE A;  3GO5 A;  2KA7 A;  4OO1 G;  1PLF A;  4QIW B;  5G3L D;  4RFB A;  2EYL A;  3CW2 C;  5HUR A;  2H1E A;  2J4X A;  4CGY B;  3S2H B;  1NNX A;  3H0G B;  1VQA A;  1MSG A;  1I4P A;  1B2T A;  4A3F B;  1G51 A;  4LF8 L;  3HOZ G;  4L5S A;  1PFB A;  1RDP D;  3SHL A;  2CH4 W;  1Q12 A;  1AEX A;  3EA6 A;  5LHY 1;  3RLF A;  1EQQ A;  1JMC A;  2CCZ A;  1SJE D;  2JA9 A;  2X6G A;  3NBH A;  1HZA A;  1J5E L;  4DR6 L;  1LYL A;  2A69 D;  3NQT A;  2MHV A;  2O5J C;  4A3G G;  5C4J H;  1IL8 A;  3S15 H;  3ULP A;  3KOJ A;  2IX3 A;  4BY7 B;  3TP6 A;  1KNA A;  4H7B A;  5M3M H;  4CDC C;  3ULJ A;  1S5B D;  1CI3 M;  4C3I G;  5KGU A;  2EY6 A;  4JI0 L;  3K6O A;  1UEB A;  2XNA C;  4KHP Q;  2ZXO A;  2EY1 A;  2WFW A;  5HY6 A;  1A62 A;  5M5W B;  2BOS A;  3FDT A;  1L0W A;  2B3G A;  3MFY A;  2HUG A;  4IFD H;  4E6I A;  1FR3 A;  4B3R L;  4BBR H;  1IHZ A;  3D6W A;  3J81 i;  3RZO B;  2IY5 B;  2A68 C;  4A3C G;  4C3J H;  1EY0 A;  1ZYR C;  4DR3 Q;  3M7N A;  3A7A B;  3I4M H;  3E6Z X;  4IN3 A;  1N34 Q;  4X66 Q;  3P20 A;  3L3O C;  1F9P A;  2K05 A;  3M4P A;  4BY1 H;  2R93 B;  1FJG Q;  1JB3 A;  1JQY D;  3I4N B;  5HGT A;  4K2K A;  2F0U A;  4J15 A;  4QMG A;  5E4X A;  3ULL A;  4Q5V A;  4JI3 Q;  5H1S E;  2Z4I A;  2B39 A;  1S3O A;  4XQJ A;  5IWA L;  2MJ8 A;  2PW5 A;  2N8N A;  2K5N A;  2PPB C;  1SXT A;  1PRT D;  4RGO S;  5C0X J;  4HIO A;  2NB0 A;  2XIW A;  4JCV E;  1IKL A;  2EYF A;  1SEB D;  4JI6 L;  2WKC A;  3RN2 A;  1I94 L;  1BXT A;  1HZC A;  4OGQ C;  1VQ8 A;  2L9H A;  5J22 A;  2B8G A;  2KEN A;  2I5L X;  4R4I A;  2HHH Q;  3FPP A;  1A2U A;  2KJX A;  2KHI A;  3PIP A;  3K7A H;  4K2L A;  5M5Y H;  4IOC A;  1V1O A;  2RBM A;  2F3W A;  3QIA A;  3PF5 A;  5D3I B;  5DLQ E;  3TBI B;  4JI2 L;  2DNC A;  1VQK A;  1N36 Q;  4Q0F A;  1W6K A;  1Z6H A;  3NWS A;  2KBN A;  4LWC A;  1TII D;  1T5E A;  5KRU A;  1PV4 A;  4EX5 A;  4JI5 Q;  1KAA A;  4RGM A;  3EQL C;  1Q8I A;  1B44 D;  2FFK B;  1IXR A;  1P16 A;  4V0B A;  5C5L A;  2UXD Q;  3I56 A;  1YNJ C;  1LT5 D;  3CMA A;  2NVT B;  3RZD B;  1PH6 A;  1SLJ A;  2F0H A;  3K57 A;  4IPD A;  1QUQ A;  5I9P A;  2RSN A;  1XWE A;  4A3M H;  2EXZ A;  4TQU S;  2UUB Q;  2AQ1 B;  2QEX A;  1A8V A;  2WIN B;  4EVO A;  3TRZ A;  2F4V Q;  2VNU D;  3CC7 A;  3PO3 H;  1Y8O B;  1LT6 D;  3DLL A;  4MHE A;  1RCV D;  1TVX A;  3NTH A;  1HNZ Q;  1R4Q B;  4JC0 A;  3UDG A;  3HOU H;  1JWU D;  1EUJ A;  5M3M G;  3JAM E;  1EFW A;  2YTX A;  4DAV A;  1QZG A;  3GD7 A;  4CJ2 C;  1WD0 A;  2VQF Q;  1PH3 A;  1EYA A;  3FRP B;  3MWY W;  1A2T A;  3KF8 B;  4YY3 L;  1RF2 D;  4APV A;  4UPA A;  4HED A;  5IYC G;  3D4R A;  1ILQ A;  3K5O A;  5M5X H;  2MFI A;  4DKA C;  3I91 A;  5GQO A;  1S5D D;  3GTM H;  1K3R A;  1DZ1 A;  4ME5 A;  1D5X C;  4BBR G;  4C3H G;  2UUA Q;  2N55 A;  5EKL A;  1CA5 A;  4YHH Q;  1PH9 A;  3FVQ A;  2A6H D;  4DV7 L;  3VR3 A;  3I4M G;  4POF A;  1B1Z A;  2L4N A;  1ENF A;  1X9N A;  1VQL A;  4YWK A;  4BY1 G;  2OTL A;  2PQA B;  1Y1V H;  4BA1 I;  3W3A A;  4DUZ Q;  1H9M A;  1TY0 A;  3V05 A;  5T1I A;  4A3K G;  5D14 A;  5IYD H;  4A3B H;  1YVC A;  2G9D A;  1LM0 A;  3S15 B;  3CCU A;  4QQB X;  4UP8 A;  2JSO A;  1FNW A;  3L0O A;  1MGS A;  5M3M B;  3K5M A;  5KIX A;  1EEF D;  4GKK L;  2K52 A;  2FMC A;  2DJF C;  1O7Z A;  2K5Q A;  2RVL A;  2A69 C;  2ICI A;  1EU3 A;  5C0X H;  3BU2 A;  4JG2 A;  2JE6 I;  1Q82 C;  2SNS A;  2YU9 H;  3K58 A;  2PCF B;  3SK4 A;  4DR5 L;  2QF7 A;  4YWL A;  2N3S A;  1D7Q A;  2EZV A;  1EYD A;  4LF6 Q;  4GOP A;  1V1P A;  4DNI A;  3NQI A;  1AE2 A;  4BBR B;  1XNR Q;  1HNX L;  1CSQ A;  4DR4 L;  4K0K Q;  1EEI D;  4IZ8 A;  2ZJR A;  1LTL A;  3GV6 A;  3LGJ A;  4C3J B;  1LAC A;  1XMO Q;  3CRK C;  3I4M B;  1OXX K;  4X65 L;  3UDI A;  2Z0S A;  3EIV A;  3DMU A;  1O7I A;  2ID0 A;  4BY1 B;  5FLX E;  3I8Z A;  1QJO A;  5CBE E;  4H44 C;  1IYV A;  1BOS A;  1VQJ A;  1B3A A;  5C4X H;  4HTH A;  3E5S A;  2WB1 B;  2M9V A;  3NTI A;  3BZC A;  2MPM A;  5IT9 E;  3N6R A;  3TP7 A;  3KUP A;  2CQA A;  3WOF A;  3S16 B;  1DYQ A;  4KD3 A;  2UXB Q;  4JI8 Q;  2BA0 A;  3J7A F;  1VQ5 A;  5I9O A;  2DJG C;  4OWT B;  3OW2 A;  3PO3 G;  3DXJ C;  3GTQ H;  4FF2 A;  3S1M H;  1J8I A;  1LT3 D;  4JPB W;  1GOZ A;  1PRT C;  4MN3 A;  1GD7 A;  1EL0 A;  4DV5 L;  2K5D A;  1ICF B;  3OW7 A;  1E0B A;  1II3 A;  1SFO H;  1KRS A;  4ZKC B;  5ELE A;  1I3Q H;  2JQO A;  3CQZ H;  4RMF A;  4J1M A;  2OWO A;  3G48 A;  3TME A;  4XYO A;  2PQE A;  4HIM A;  4FXK C;  3CME A;  4OHJ A;  1JJG A;  2RCF A;  1NMG A;  3OWE B;  3A8J E;  1I4G A;  1XPU A;  5CV4 A;  4KY7 A;  1K73 C;  3R8B A;  3CHB D;  3CPW A;  2MNA A;  4RGN A;  4A93 B;  4LF9 L;  1TT2 A;  1PXU A;  5IGG A;  2F4I A;  4NW2 A;  1BVS A;  2K50 A;  1F2Z A;  4YIJ A;  4V19 0;  2R7D A;  4H0L C;  4A3M B;  1OXT A;  2B8F A;  4POG A;  4A3E H;  1Y1V G;  1XMQ L;  3HRZ C;  4JI4 Q;  2JA6 H;  1VQO A;  1LAB A;  5FLM H;  1U9R A;  1PZI D;  4A3B G;  1E7Z A;  1EIG A;  2V4D A;  4X3U A;  4JBM A;  5AJ3 Q;  1YI2 A;  1XPO A;  3HOU B;  1DCZ A;  1VF5 C;  3MVV A;  2K7V A;  2B63 H;  4NXM L;  1D5Z C;  2N88 A;  4LF4 Q;  3Q23 A;  3HKZ G;  1N8R C;  2QGQ A;  3CF5 A;  3AQQ A;  1IBL L;  5C0X G;  1ZXT A;  2F0D A;  1XTC D;  2EYH A;  1Q1E A;  1JR0 D;  2ZJQ A;  3SXH A;  3K80 C;  4B3T L;  5M5X B;  2CH4 A;  3OPO A;  3MXP A;  3I90 A;  3M7G A;  3GTM B;  3DUZ A;  4AYB G;  4GNX B;  3MA2 B;  4AIM A;  3BDC A;  4KHZ A;  2FMM A;  1UE7 A;  3JC6 6;  4GN5 A;  3S1Q B;  1YEZ A;  3NHH A;  4OO1 I;  5EPK A;  3TN2 A;  1NSN S;  3H91 A;  1AH9 A;  2WKD A;  4LFC L;  4QUC A;  2MP1 A;  3VR2 A;  5M3F H;  1MIU A;  3T1H L;  1GHK A;  4R8N A;  1HR0 L;  4RHR A;  1Y1V B;  4DV1 Q;  2AWN A;  5JAV A;  1IW7 D;  3CPF A;  4A3J H;  4JVZ A;  1E2V A;  2A5H A;  4QY7 A;  2HIV A;  1EY6 A;  3CP0 A;  3KF6 B;  2A6H C;  1SYG A;  4IPH A;  2KED A;  1PFN A;  4LFA L;  1ASY A;  2JP1 A;  1SJH D;  3HOY H;  4BBS B;  3CRL C;  3HKZ B;  4HSV A;  3PIP 3;  4JI7 L;  2GN5 A;  1DOM A;  2WP8 J;  1S4Z A;  2YU9 B;  1SE8 A;  1MJC A;  2EE1 A;  2I07 B;  2XGT A;  5FKA C;  4B3M Q;  4JBW A;  5JPM C;  1N9W A;  1U4R A;  1K8G A;  5AFW A;  5D3D A;  5BR8 Q;  3IKJ A;  1X3F A;  2GVA A;  2YYZ A;  3H09 A;  4XT3 B;  1JE5 A;  4P71 A;  5EBC A;  1LV9 A;  4XQQ A;  2ZM6 Q;  1JB7 A;  1B50 A;  5ELD A;  3IFT A;  1N32 Q;  4OIJ A;  1OO9 B;  3T1Y Q;  2F0M A;  4A3D G;  1I50 B;  2F52 A;  2WAQ E;  4KJO A;  5FO9 B;  4JW0 A;  3DHQ A;  1HTL D;  3HOZ H;  3AEV A;  3CC2 A;  3I70 A;  3D6C A;  5C4X B;  5BN3 A;  1K8A C;  4P73 A;  2ICE C;  2EJM A;  4K5X A;  1PH8 A;  1CQF A;  1GHJ A;  1EQV A;  5C3E G;  1PYW D;  1HJP A;  4HJA A;  1LLR D;  2OEO A;  3T16 A;  4A3G H;  1G29 1;  2ZXP A;  5KNC A;  3GTO B;  1UE5 A;  2MO1 A;  4A3E G;  5IOC A;  4K6D A;  5CV9 A;  2JA6 G;  5FLM G;  1CKO A;  2K33 A;  1BQQ T;  2O4X A;  2PQA A;  2HCI A;  2A19 A;  2KCT A;  2B63 G;  1JOK A;  1WCM B;  3MEH A;  5CYU A;  3I73 A;  1D2B A;  4K6L A;  5I2X A;  1WTO A;  4DV0 Q;  1F2M A;  1OXU A;  1I3Q B;  2TSS A;  3CQZ B;  2PZW A;  4GS3 A;  4AQY Q;  3PF4 A;  4A3C H;  4HID A;  4X3S A;  1R9T B;  4XQN A;  3BJU A;  1PZK D;  1RJT A;  3HZX A;  2PO4 A;  2K01 A;  4GN3 B;  3TS2 A;  1W2B A;  4PMC A;  4L8J A;  4PV1 C;  1WTQ A;  1YNJ D;  1G2S A;  1EQR A;  5CV7 A;  1VQ4 A;  2K4K A;  1FGU A;  2I46 A;  1LO5 D;  1CSP A;  4HR7 B;  2JK8 A;  2R7Z H;  4XDX A;  4DAP A;  1VQF A;  5M3F G;  1X3Q A;  1TWC B;  2AWO A;  1HH2 P;  2PI2 E;  4A3E B;  2VQE Q;  3RN5 A;  2DN8 A;  4A3J G;  3FMC A;  2FHT A;  3VDY A;  2GVB A;  2RDG A;  4HMI A;  1STG A;  3O13 A;  1JIC A;  2E2H H;  4IAL A;  1CTM A;  2VY3 A;  4LF5 Q;  4GLA C;  2OTJ A;  2KEE A;  1YJN A;  3HOY G;  5M9O A;  2ASB A;  1I4Q A;  5EQ0 A;  4CHT B;  2KUM A;  3M4O B;  1Q46 A;  1OXV A;  2NVY B;  4DV3 L;  2K14 A;  1PFM A;  1WFQ A;  3S14 H;  3NE5 B;  3J80 c;  1EY7 A;  2M2L A;  2NYZ D;  3I2Z A;  4QIW E;  1LUZ A;  3H6M A;  3WOE A;  1G91 A;  1PHJ A;  2JA5 B;  1A0I A;  4IFD I;  1YNN D;  3C1F A;  4JI1 L;  4DA2 A;  1SYD A;  1GUS A;  2B2Y A;  3OIQ A;  1VQP A;  3Q8D A;  4OXP A;  2KCM A;  2IHF A;  1NR4 A;  1CQV A;  4A3J B;  2NVQ H;  2E5L Q;  2WAC A;  2IL8 A;  1HR0 W;  1KRT A;  5C4H A;  1EZ6 A;  2F0O A;  2B2W A;  4PQX A;  2F0Q A;  1STY A;  4ULL A;  1SNM A;  3M9B A;  3HOY B;  4DUY Q;  3HOW H;  2Z6K A;  1BCP D;  1IW7 C;  1CHQ D;  4IUR A;  2H4O A;  4XIG S;  4LF8 Q;  3ER0 A;  4M8A A;  3NEN A;  4GKJ L;  4ZAI A;  3CC4 A;  2I0Q A;  2E2D C;  3TRE A;  1EWI A;  1JOQ A;  1WTH A;  3FPU B;  5KNB A;  5IYC H;  1J5E Q;  4DR6 Q;  1NMF A;  1QNK A;  5ELC A;  1K28 A;  3M3Y H;  1GUO A;  2MUY A;  3EN2 A;  2SOB A;  1VQ6 A;  4M1U B;  2F0V A;  3OTO L;  3TEH B;  4FF3 A;  4C3H H;  2JA8 H;  5C3X A;  3OOC A;  1GUW A;  1GO3 E;  5J3B A;  1CHP D;  3V2T A;  4JI0 Q;  3HOZ B;  4I65 A;  1V43 A;  4L5T A;  4JV5 L;  2CFM A;  1LTA D;  2E76 C;  4EQO A;  1L1O B;  3E0E A;  4KKT A;  2DUD A;  4RCO A;  4GNX A;  1DON A;  1E1T A;  4A3K H;  2R7Z G;  4KJN A;  4A3G B;  4B3R Q;  1D6E C;  2K5V A;  4DNR B;  1O78 A;  4IUT A;  4JOI C;  4PMW A;  3NPP A;  4U68 A;  2R6G A;  1PDQ A;  3F2D A;  5A2Q E;  3H94 A;  4C3I B;  1VQI A;  1TWA H;  4DR1 L;  3ITP A;  2K5W A;  1DOL A;  3Q22 A;  1MBY A;  2ALY B;  2UXC L;  2XWJ B;  1P8L A;  5GRO A;  3ERS X;  3K5L A;  3PQI A;  3QR8 A;  5I6Y A;  1BBW A;  3NBI A;  1TY2 A;  1A6X A;  4IQZ A;  3G4S A;  3TS0 A;  1SRO A;  1PTO B;  2HCC A;  2XN9 C;  1S40 A;  3J81 E;  5IWA Q;  2VW9 A;  2LFN A;  2KCC A;  2PNH A;  3C2P A;  4LNQ A;  2IX0 A;  1TS2 A;  3NSW A;  2L55 A;  4IUU A;  4FYD A;  2HT1 A;  1SN8 A;  5FK9 C;  1EIF A;  4JI6 Q;  5CMD A;  1ZEQ X;  4DV2 L;  3JAM i;  2R7Z B;  2X69 A;  1I94 Q;  1IZ6 A;  1GUN A;  4FF1 A;  1ET6 A;  3WWV A;  1QB5 D;  1U4M A;  3E0J A;  2RDH A;  5JVG 3;  3OMG A;  3GTP H;  3NEL A;  5C3W A;  5LL6 X;  3KFU A;  4OON A;  1F9Q A;  4UDU C;  4TSS A;  2E2H B;  1PH2 A;  4JI2 Q;  2D62 A;  2RHQ B;  4GZY C;  1UE1 A;  2LMC B;  3GTJ H;  3VR5 A;  3GTG H;  1SRU A;  1G8Z D;  4Y52 H;  1XPR A;  4Y7N H;  3HOW G;  3H3V C;  4LF7 L;  3U9O A;  1D1I A;  1T9H A;  5EBD A;  1UNS A;  3KLR A;  1SYC A;  5T1G A;  5IY0 A;  3S17 H;  1DGS A;  1O7L A;  5JPN C;  1NUC A;  3SK6 A;  1RIP A;  2G5D A;  3MXN B;  5C0X I;  3LWE A;  4DF7 A;  1YZ6 A;  4LFB L;  3HG9 A;  3KLS X;  3JAM c;  2NZ1 D;  4CKC A;  2ATW A;  3SVM A;  4RA8 A;  1IBK L;  3F1Z A;  1GUG A;  3QO2 A;  4IO9 A;  4G7O C;  1M8A A;  5C44 H;  2JA8 G;  3QOL A;  4EQN A;  3SK8 A;  1AP0 A;  2RCN A;  1CZG A;  1SR3 A;  3Q6S A;  1CKM A;  3RLN A;  4YY3 Q;  1KTK A;  2R61 A;  2EJG C;  3S1R H;  1YNN C;  2LSS A;  1EZ8 A;  4FXG C;  2E8G A;  4PNY A;  4ZUI A;  2BDN A;  4A75 A;  1Q81 C;  3C3L A;  3VYU A;  1VQH A;  2FJ2 A;  1VQ7 A;  3HOW B;  4UHV A;  3F2B A;  3EBE A;  3MC0 B;  5C4J B;  1Q8K A;  5J1Z A;  5BN4 A;  1GKH A;  2ZTE A;  4BS9 A;  1QZH A;  4ILW A;  1KDC A;  3IAY A;  1STH A;  5D65 A;  2D9U A;  3ND8 A;  3HP3 A;  3RLO A;  1I6H H;  1S5F D;  4DV7 Q;  3DWQ A;  1OTC A;  5C4Z A;  4DV6 L;  4KMU C;  1BBU A;  3GV3 A;  4DK0 A;  1ET9 A;  2EPB A;  1NAP A;  2PI2 A;  1BCP C;  1WTX A;  2F3I A;  3PUV A;  4CJ1 B;  3M85 A;  1SBB B;  2A73 B;  3K7U C;  3M3Y B;  2HDL A;  1QOH A;  4PZ6 A;  1AZQ A;  2LXK A;  1X3E A;  1V9P A;  3STB D;  3LNN A;  2MQH A;  2QCP X;  4GLV B;  2KQ3 A;  1Z9F A;  4C3H B;  4G7Z C;  2F03 A;  5COR A;  1XXG A;  4GKK Q;  1RL2 A;  4A3I G;  5A35 A;  3K5N A;  3H15 A;  1HNW L;  1EOT A;  3S1N H;  4B3S L;  1FNV A;  2UU9 L;  1SMY D;  2DY8 A;  4YCV A;  3J81 j;  2JA7 H;  1JCK B;  4DR5 Q;  1HHV A;  1HUN A;  3CCQ A;  1CKN A;  3KBX A;  1KC8 C;  3K0Y A;  3DEP A;  1U5K A;  2Z1C A;  3C46 A;  2R92 H;  2WB1 E;  2PW7 A;  4A3K B;  2K03 A;  3KDF B;  4EGV A;  4QGU A;  3LX0 A;  4K5W A;  1HNX Q;  4DR4 Q;  3R2I A;  3HOX G;  5LMU L;  5FLX c;  1HXY D;  4CDF C;  2XRQ D;  1PA6 A;  1TWA B;  4X65 Q;  2PNR C;  4ODG A;  2BH2 A;  5DM7 3;  3CCE A;  2JEB I;  5IT9 c;  1PRT B;  4TRD A;  5CGK A;  1BBX C;  4OWW B;  4DXF A;  3M4Y A;  2VZA A;  5CR3 A;  1TWH H;  3SE0 A;  3FP9 A;  4J6H A;  2KHJ A;  1B70 B;  1IKM A;  3C1E A;  3J80 L;  1QVG A;  3K7A B;  5M5Y B;  2D5D A;  1HUM A;  3ONA B;  5E7N A;  4A4I A;  3UE0 A;  4K8I A;  1E22 A;  4C1N K;  4A3D H;  1TWF H;  4X3K A;  5GAD C;  1K0S A;  5IYB H;  4PMB A;  3UDF A;  2FIN B;  5FO7 B;  2RF4 A;  2YTY A;  2VB2 X;  1R4P B;  5C44 G;  4F7X A;  3RNU A;  3K8A A;  1DJR D;  1PH1 A;  4DV5 Q;  4JYA L;  3G6E A;  5C3E H;  4UP7 A;  2A6E C;  1ESF A;  1HA6 A;  1B4O A;  2JN4 A;  2KCN A;  4IUQ A;  4ZRZ A;  3GTJ B;  1KLU D;  4R4O A;  2B2Y C;  1YHA A;  3DWP A;  1G2T A;  2V1C C;  4DR7 L;  1K0R A;  1L1O A;  1SDF A;  3PO3 B;  3CCL A;  3QB3 A;  1D5M C;  2B2W C;  1JOO A;  3S17 B;  4A3L H;  3S24 A;  4LF9 Q;  3BDO A;  5JJK A;  2LXJ A;  4CKB A;  2L11 A;  2HDM A;  3PUZ A;  1TR5 A;  4KY5 A;  2G9H D;  4O0A A;  3U4V A;  2EYP A;  2Z6K C;  1EOV A;  1K9M C;  1XMQ Q;  2E2J H;  4H02 A;  1KLG D;  5ELO A;  1HQR D;  2NVX H;  1SNC A;  4R1J A;  4LJZ C;  2K04 A;  5IP9 H;  4DAY B;  3HOV G;  1PYS B;  2JJQ A;  4OL7 A;  2ZJP A;  4NXM Q;  4RH6 A;  3B6Y A;  4KN7 C;  1JT8 A;  1C4Q A;  3AU7 A;  3F2C A;  5CV8 A;  1IBL Q;  3MXG A;  3S1R B;  2KHS A;  3OSO A;  4QUF A;  3IFD A;  1X32 A;  2JA7 G;  4LUZ A;  3F2U A;  3TQY A;  2ZXR A;  1HA5 A;  1Q90 A;  4B3T Q;  4MTK A;  3J7Z C;  2ENB A;  2R92 G;  1I4X A;  3HS0 C;  3AB9 A;  1CUK A;  3K81 C;  4O42 A;  5IIF A;  4A3B B;  1JE4 A;  1UE6 A;  5NUC A;  2UUC L;  4IPC A;  2TMP A;  2K6A A;  1X65 A;  3FKI G;  4X64 L;  2WV6 D;  3HKZ E;  5CBA E;  4A76 A;  4QF4 A;  1WD1 A;  1K83 H;  1E3P A;  1IYU A;  1IBM L;  1EQT A;  4OX9 L;  1QVC A;  2EY5 A;  4PZ7 A;  3U50 C;  4GNX C;  4LFC Q;  1I6V C;  1V1Q A;  3AFQ A;  3H0G H;  2EYJ A;  3T1H Q;  1HR0 Q;  2XTI A;  1TS3 A;  1YNX A;  4A3F H;  5IE8 A;  2WAQ G;  2NZO A;  4F87 A;  4B3M L;  4AYB E;  2D0O A;  1PH5 A;  1N33 L;  1EY5 A;  4YCW A;  2MGS A;  2IX1 A;  4ZCK A;  1RD9 D;  3GQB A;  1KNE A;  2YV5 A;  4AYB B;  5IGB A;  3HKS A;  1X54 A;  4LFA Q;  4S3S A;  1PTO F;  2K5H A;  4RKL A;  5DNF A;  1Q7Y C;  4U67 3;  4RAU C;  4NXN L;  4JI7 Q;  1HCZ A;  4DR2 L;  2QEJ C;  3ERO A;  3PSI A;  1NCV A;  5E4W C;  2JA7 B;  1NTG A;  1EIY B;  2F0N A;  3L7Z C;  3KF8 A;  3STB C;  5IYB G;  3TP8 A;  4HJ5 A;  4OEL B;  2R92 B;  1A3T A;  2ES2 A;  3AFP A;  3F8T A;  5EAY A;  3E9H A;  3W1B A;  3Q0A A;  5M5W H;  3SR1 A;  1SMY C;  1E1O A;  2F0P A;  3I72 A;  2NWG A;  4X62 L;  2R3Z A;  4PG3 A;  4I7Z C;  2EDG A;  4HCS A;  1PZJ D;  1M4V A;  1E2Z A;  4B9W A;  2C35 B;  2OCE A;  3P7J A;  3BS1 A;  5I6W A;  3S9W A;  1QUQ B;  4WRD A;  1M90 C;  1ML0 D;  1GJX A;  1DM0 B;  2KVM A;  2Y0S G;  4DAM A;  4FF4 A;  2IWH A;  1ROD A;  3HGB A;  3GTQ B;  2RHS B;  3KJP A;  2C9O A;  3S1M B;  1TWH B;  4WJ4 A;  4A3L G;  2OF1 A;  3NEM A;  2R93 H;  2BDO A;  3I4N H;  2VB3 X;  4ZYS A;  4JBK A;  4ZUJ A;  2DGY A;  1SFO B;  2LKV A;  3JAM L;  3DEO A;  4LW1 A;  4FP5 D;  1C9O A;  1EWH A;  1SNO A;  4CDD C;  4HJ9 A;  4A3D B;  4CJ0 B;  1TS5 A;  1X56 A;  3BVZ A;  5IP9 G;  4B9X A;  1CM9 A;  5DEH A;  3RUZ A;  4R9W A;  1XNQ L;  4NB3 A;  1BO0 A;  1H9J A;  3E3X A;  4NDX A;  1L0Y B;  3A8I E;  5G3L F;  3U58 A;  5I4D A;  5IGE A;  4LK1 C;  3PGZ A;  4KKU A;  3ZYY X;  4XTC S;  4P72 A;  3J80 i;  5C3E B;  3D3R A;  4IPG A;  4IFD J;  3K59 A;  2SNM A;  3KLS A;  2GA4 B;  3SGI A;  4EQ5 A;  3PO2 H;  4WOR A;  3PUW A;  1JOR A;  1EIH A;  1SNQ A;  2AMC B;  1YHQ A;  3GP7 A;  4HJ7 A;  2JA6 B;  3J7A 5;  3VR4 A;  3K0X A;  2AUK A;  2Q8T A;  1SYB A;  4MIU A;  3H3V H;  2L15 A;  3P75 A;  2B2T A;  1Y1W G;  2B63 B;  3KDF A;  3LWU A;  1S5E D;  4K5V A;  1EY4 A;  5EPJ A;  4RGT A;  1LTB D;  3H0G G;  4N9T A;  1SE3 A;  3L2P A;  3BZK A;  2E2J B;  4A3F G;  1YHB A;  2NVT H;  3RZD H;  1SE2 A;  2EIF A;  2NVX B;  5JJI A;  1W3S A;  4DGZ A;  1TQO A;  4DV4 L;  1NY4 A;  4N9P A;  5LMN L;  1PFS A;  2I5H A;  4F8M A;  4JBJ A;  4WJW A;  5IGD A;  3CCJ A;  4GLX A;  1TKW B;  1QNU A;  1VQC A;  2EXD A;  3PCO B;  1H95 A;  1CA6 A;  1STB A;  3J7A V;  5M3F B;  1LTI D;  5CV6 A;  4DV3 Q;  1X55 A;  4GOP C;  1Q1B A;  4QCL A;  3MAQ A;  1RHP A;  2F0E A;  4O1N A;  2EYO A;  3X3M A;  5FLX L;  1B9N A;  1RKN A;  1RTN A;  5DAU A; 
#chains in the Genus database with same CATH homology
 3VYS A;  1ICW A;  3EJI A;  1LTG D;  1VF7 A;  2NN6 H;  2F0W A;  3UI2 A;  4KY6 A;  5KYI A;  1SYE A;  5IT9 L;  1GXD C;  1QCB D;  1O7Y A;  5K36 H;  1SND A;  1VCI A;  4KI0 A;  5E3F A;  4P2C B;  1PRT F;  4XXE A;  2Q8I B;  2E74 C;  5C5M A;  1Y8N B;  2ZT9 C;  1KDA A;  5IGF A;  3OHX C;  2RQX A;  3BVG A;  5JOB A;  3SK5 A;  3SDZ A;  1ESR A;  2J7Z A;  4WFN 3;  4K8J A;  4G57 A;  4OIK A;  3D4D A;  1TS4 A;  5LL6 S;  2NTS A;  4DAY A;  3RMH A;  1G6Z A;  1Y8P B;  1I4H A;  2RKS A;  1EWC A;  2K32 A;  4ZLT F;  2EY2 A;  3IL8 A;  1Z47 A;  2XVS A;  2DNE A;  4JK1 C;  4G7H C;  2WII B;  2K1B A;  5JVH 3;  4ID6 A;  3BYT B;  1J9O A;  4K14 A;  1FD7 D;  3T51 B;  3MZ5 A;  2JYO A;  4KHV A;  1DOK A;  1F9S A;  2BA1 A;  4R8I A;  3I4L A;  4F88 A;  1EY8 A;  4DN4 M;  2AQ2 B;  2OXP A;  3PMF A;  4KD4 A;  2A6E D;  2EVB A;  1B9M A;  2B2V A;  1H9R A;  3PO2 B;  1EU4 A;  3QJY A;  5TSS A;  4ZK9 B;  1PMR A;  2F0T A;  4HAE A;  5KND A;  5KEE A;  1LT4 D;  1AZP A;  3MFG A;  2AUJ D;  1H9S B;  3BG3 A;  4KN4 C;  1PTO C;  2BE5 C;  5ELF A;  4QB4 A;  5I2Y A;  1AN8 A;  2NN6 G;  2M00 A;  1LTS D;  2IJ0 A;  2JEA I;  2F0J A;  4KKS A;  4X3T A;  2IT1 A;  2KEC A;  5K36 G;  2O5I C;  3BYY B;  2B2U A;  3ND9 A;  4IUP A;  3S14 B;  1BUV T;  2CVR A;  3N52 A;  1QE6 A;  2CW0 D;  3FEW X;  1HRJ A;  5COY A;  1AFP A;  2O2L D;  3TZD A;  3OWF A;  1D1K A;  1K8M A;  2NVQ B;  4DFA A;  2A74 C;  2RSO A;  1AW7 A;  3QG1 A;  1SSO A;  1ENC A;  4IFD G;  1DXM A;  1I4R A;  5EPL A;  1HFN A;  4HCE A;  5EGT A;  2F0K A;  3VYT A;  3J7Y W;  1MD2 D;  1BCP B;  1Y69 U;  4C3J G;  3HEJ A;  2F0F A;  1X3P A;  1CFM A;  1Z7T A;  3T53 B;  4LMQ D;  1XYI A;  5F2D A;  1STN A;  1FGB D;  2Z4H A;  1CK1 A;  1ONL A;  4G4K A;  2JA8 B;  1LTR D;  4BA2 I;  1WTW A;  1Q3L A;  2KOL A;  3VR6 A;  5FO8 B;  1EY9 A;  1FNU A;  2HQE A;  4B08 A;  3MTS A;  2X6L A;  3SEB A;  4NP5 A;  4ZKB B;  4XT1 B;  3TZU A;  2SDF A;  4EQP A;  1WVL A;  5JEA J;  2XSC A;  1KDB A;  3EVQ A;  1BF4 A;  4DNT B;  1WTP A;  2QKI C;  3S2D B;  3A8K E;  4UAI A;  2DY7 A;  1WTR A;  1CT1 D;  1C8C A;  2B2T C;  1S5C D;  1BNZ A;  4A3I B;  2VUM B;  1T5X D;  1EFI D;  2F0G A;  3X3N A;  3P1H A;  3D8G A;  3WDN A;  1UEA B;  3NXW A;  1F2Y A;  2F0L A;  4FO2 A;  3PUX A;  3G7L A;  1E2W A;  1XX8 A;  5CC4 A;  3HOX B;  3KK7 A;  3GTP B;  2L0C A;  4C2M B;  3PUY A;  1VMP A;  4IUN A;  3A56 A;  3DM1 A;  4FVM A;  5EKK A;  1QG7 A;  3GTG B;  2L12 A;  4Y7N B;  4DK1 A;  1MI2 A;  1STE A;  4ABN A;  1A15 A;  3D4W A;  1GUT A;  4H13 C;  1U4L A;  1F77 A;  4RCN A;  3NTK A;  3R2T A;  3A55 A;  3ERQ A;  1HPC A;  4HN7 A;  3BDL A;  1NR2 A;  1F2L A;  3NK9 A;  2C5C A;  4C1N I;  2NUC A;  3PIO 3;  2RDF A;  3R3O A;  3RD4 A;  2F1M A;  3T13 A;  1HFG A;  5J39 A;  2LS0 1;  2JXM B;  5C44 B;  2BCO A;  1BDO A;  2CW0 C;  3U9S A;  1V8Q A;  1QWY A;  1K8O A;  1JWM D;  3V96 A;  3QWN A;  3KBG A;  4LAA A;  3QOJ A;  3CKI B;  5JEA H;  5EJW A;  1H9K A;  4RHS A;  2QDB A;  4HSP A;  1STA A;  1UUP A;  2F3V A;  1I6H B;  3A7L A;  3NP8 A;  4DU9 A;  3MXU A;  4XYQ A;  1SYF A;  5A2Q L;  1H9S A;  3EFX D;  1UAP A;  4RKB A;  4DXG A;  3L9A X;  3D31 A;  3HOV B;  1QIL A;  2NBF A;  1A3V A;  4NKL A;  1U4P A;  3Q24 A;  3NUC A;  2NTT A;  3S1N B;  2CHB D;  2F0S A;  3J81 L;  1HTP A;  3OIP A;  5CV5 A;  3MXN A;  1FYC A;  3T56 B;  1ENA A;  4FNF A;  3W2D A;  4L6T B;  2E2I B;  1L0X B;  5C6A A;  4TKO B;  2A68 D;  3GTL B;  2LY7 A;  2K28 A;  3TDQ A;  2PZU A;  2L5T A;  1ZYR D;  3FKI B;  4ZQ3 A;  4HMJ A;  5K5P A;  1JWS D;  2QIL A;  4OO1 H;  3AMU A;  2L1B A;  1B53 A;  1MSH A;  2EYM A;  5IOD A;  5ELB A;  2PYK A;  2B2V C;  2EOT A;  2D2C C;  3A54 A;  3VA7 A;  3T4A C;  3R93 A;  3BVM A;  2WAQ B;  5DM6 3;  2RA4 A;  3CU7 A;  3NWT A;  1BR9 A;  3DWA A;  5JJZ A;  1SAP A;  2E75 C;  3MHB A;  4CBV A;  2Q8R E;  1LTT D;  1TWG B;  4KK7 A;  1SNP A;  5KYL A;  4RWS C;  5EKI A;  1C48 A;  2IPK D;  1TWF B;  3TP5 A;  2OT2 A;  1SE4 A;  2B2U C;  1EYC A;  2VXW A;  3BZD B;  2AQ3 B;  5BN5 A;  5E1F A;  3TSS A;  2SEB D;  2F0I A;  3URY A;  1PTO D;  2BE5 D;  3VYR A;  1PTO H;  4L63 B;  4KTA A;  5JEA G;  2Y0S B;  3VA5 A;  4IUV A;  3G6J B;  4J8Q A;  1BCP F;  1ILP A;  2Z8L A;  2NN6 I;  1DD2 A;  1OXS C;  4FXD A;  3PV0 A;  1A3U A;  1HQM C;  4NMZ A;  5IGC A;  4KV6 A;  5FOB B;  1O80 A;  1WTV A;  1CZW A;  2EJF C;  1VDZ A;  4Z9C B;  1V1P B;  1JC7 A;  1F9R A;  1VMC A;  4C56 C;  2XWB B;  3J80 E;  2PMZ B;  2PZT A;  1TU2 B;  1ZKO A;  2IW3 A;  3OMC A;  1RTO A;  1W6J A;  3I3C A;  3GTK B;  4BWG B;  2J0T D;  4CKE A;  1KAB A;  1Y1W B;  2XRS D;  5ISR A;  1K83 B;  3GO5 A;  2KA7 A;  4OO1 G;  1PLF A;  4QIW B;  5G3L D;  4RFB A;  2EYL A;  5HUR A;  2H1E A;  2J4X A;  4CGY B;  3S2H B;  3H0G B;  1MSG A;  1I4P A;  1B2T A;  4A3F B;  1PFB A;  1RDP D;  3SHL A;  1Q12 A;  1AEX A;  3EA6 A;  5LHY 1;  3RLF A;  1SJE D;  2X6G A;  3NBH A;  2A69 D;  3NQT A;  2MHV A;  2O5J C;  1IL8 A;  2IX3 A;  4BY7 B;  3TP6 A;  1KNA A;  4H7B A;  1S5B D;  1CI3 M;  4C3I G;  5KGU A;  2EY6 A;  3K6O A;  2XNA C;  2ZXO A;  2EY1 A;  5M5W B;  2BOS A;  3FDT A;  3MFY A;  2HUG A;  4IFD H;  4E6I A;  1FR3 A;  1IHZ A;  3D6W A;  3RZO B;  2A68 C;  1EY0 A;  1ZYR C;  3M7N A;  3A7A B;  3E6Z X;  4IN3 A;  3P20 A;  3L3O C;  1F9P A;  2K05 A;  2R93 B;  1JB3 A;  1JQY D;  3I4N B;  5HGT A;  4K2K A;  2F0U A;  4QMG A;  5E4X A;  4Q5V A;  2Z4I A;  2B39 A;  4XQJ A;  2MJ8 A;  2PW5 A;  2PPB C;  1SXT A;  1PRT D;  4RGO S;  5C0X J;  2NB0 A;  2XIW A;  1IKL A;  2EYF A;  1SEB D;  2WKC A;  1BXT A;  4OGQ C;  2L9H A;  5J22 A;  2B8G A;  3FPP A;  1A2U A;  2KJX A;  4K2L A;  1V1O A;  2RBM A;  2F3W A;  3QIA A;  5D3I B;  3TBI B;  2DNC A;  4Q0F A;  1W6K A;  1Z6H A;  3NWS A;  1TII D;  1T5E A;  5KRU A;  1KAA A;  4RGM A;  3EQL C;  1Q8I A;  1B44 D;  2FFK B;  4V0B A;  5C5L A;  1YNJ C;  1LT5 D;  2NVT B;  3RZD B;  2F0H A;  3K57 A;  5I9P A;  2RSN A;  1XWE A;  2EXZ A;  4TQU S;  2AQ1 B;  2WIN B;  4EVO A;  2VNU D;  1Y8O B;  1LT6 D;  4MHE A;  1RCV D;  1TVX A;  3NTH A;  1R4Q B;  1JWU D;  3JAM E;  4DAV A;  3GD7 A;  4CJ2 C;  1WD0 A;  1EYA A;  3FRP B;  3MWY W;  1A2T A;  1RF2 D;  4HED A;  3D4R A;  1ILQ A;  3K5O A;  3I91 A;  1S5D D;  1DZ1 A;  4ME5 A;  1D5X C;  4C3H G;  2N55 A;  5EKL A;  1CA5 A;  3FVQ A;  2A6H D;  3VR3 A;  1B1Z A;  2L4N A;  1ENF A;  4BA1 I;  3W3A A;  1H9M A;  1TY0 A;  3V05 A;  5T1I A;  5D14 A;  2G9D A;  3S15 B;  2JSO A;  1FNW A;  1MGS A;  5M3M B;  3K5M A;  5KIX A;  1EEF D;  2FMC A;  1O7Z A;  2K5Q A;  2RVL A;  2A69 C;  2ICI A;  1EU3 A;  5C0X H;  2JE6 I;  2SNS A;  3K58 A;  2PCF B;  3SK4 A;  2QF7 A;  2EZV A;  1EYD A;  1V1P A;  3NQI A;  4BBR B;  1EEI D;  4IZ8 A;  3GV6 A;  4C3J B;  1LAC A;  3CRK C;  3I4M B;  1OXX K;  3DMU A;  2ID0 A;  4BY1 B;  5FLX E;  3I8Z A;  1QJO A;  5CBE E;  4H44 C;  1IYV A;  1BOS A;  1B3A A;  4HTH A;  3E5S A;  2WB1 B;  2M9V A;  3NTI A;  2MPM A;  5IT9 E;  3N6R A;  3TP7 A;  3KUP A;  2CQA A;  3WOF A;  3S16 B;  1DYQ A;  4KD3 A;  2BA0 A;  3J7A F;  5I9O A;  3DXJ C;  4FF2 A;  1J8I A;  1LT3 D;  1GOZ A;  1PRT C;  4MN3 A;  1EL0 A;  2K5D A;  3OW7 A;  1E0B A;  1II3 A;  4ZKC B;  5ELE A;  4J1M A;  3TME A;  4XYO A;  2PQE A;  4FXK C;  4OHJ A;  3OWE B;  3A8J E;  1I4G A;  5CV4 A;  4KY7 A;  3R8B A;  3CHB D;  4RGN A;  4A93 B;  1TT2 A;  1PXU A;  5IGG A;  2F4I A;  4NW2 A;  1F2Z A;  4YIJ A;  4V19 0;  4H0L C;  4A3M B;  1OXT A;  2B8F A;  3HRZ C;  1LAB A;  1U9R A;  1PZI D;  1EIG A;  2V4D A;  4X3U A;  3HOU B;  1DCZ A;  1VF5 C;  3MVV A;  2K7V A;  1D5Z C;  2N88 A;  3Q23 A;  5C0X G;  1ZXT A;  2F0D A;  1XTC D;  2EYH A;  1Q1E A;  1JR0 D;  3SXH A;  5M5X B;  3OPO A;  3MXP A;  3I90 A;  3M7G A;  3GTM B;  3DUZ A;  3MA2 B;  3BDC A;  4KHZ A;  2FMM A;  3S1Q B;  3NHH A;  4OO1 I;  5EPK A;  3TN2 A;  1NSN S;  3H91 A;  2WKD A;  4QUC A;  2MP1 A;  3VR2 A;  1GHK A;  4R8N A;  4RHR A;  1Y1V B;  2AWN A;  5JAV A;  1IW7 D;  1E2V A;  2A5H A;  1EY6 A;  2A6H C;  1SYG A;  2KED A;  1PFN A;  2JP1 A;  1SJH D;  4BBS B;  3CRL C;  3HKZ B;  4HSV A;  3PIP 3;  1DOM A;  2WP8 J;  1S4Z A;  2YU9 B;  2EE1 A;  2I07 B;  5FKA C;  4JBW A;  5JPM C;  1U4R A;  5AFW A;  5D3D A;  3IKJ A;  2YYZ A;  3H09 A;  4XT3 B;  4XQQ A;  5EBC A;  1B50 A;  1LV9 A;  5ELD A;  3IFT A;  4OIJ A;  1OO9 B;  2F0M A;  1I50 B;  4KJO A;  5FO9 B;  3DHQ A;  1HTL D;  3I70 A;  3D6C A;  5C4X B;  5BN3 A;  2ICE C;  2EJM A;  4K5X A;  1CQF A;  1GHJ A;  1EQV A;  1PYW D;  1LLR D;  2OEO A;  3T16 A;  1G29 1;  2ZXP A;  5KNC A;  3GTO B;  5IOC A;  4K6D A;  5CV9 A;  2K33 A;  1BQQ T;  2O4X A;  2HCI A;  1JOK A;  1WCM B;  3MEH A;  5CYU A;  3I73 A;  1D2B A;  4K6L A;  5I2X A;  1WTO A;  1F2M A;  1OXU A;  1I3Q B;  2TSS A;  3CQZ B;  2PZW A;  4X3S A;  1R9T B;  4XQN A;  1PZK D;  1RJT A;  3HZX A;  2PO4 A;  2K01 A;  4PMC A;  4L8J A;  4PV1 C;  1WTQ A;  1YNJ D;  1G2S A;  5CV7 A;  2I46 A;  1LO5 D;  4HR7 B;  4XDX A;  4DAP A;  1X3Q A;  1TWC B;  2AWO A;  4A3E B;  2DN8 A;  3FMC A;  2FHT A;  2RDG A;  4HMI A;  1STG A;  3O13 A;  1JIC A;  4IAL A;  1CTM A;  2KEE A;  5M9O A;  1I4Q A;  5EQ0 A;  4CHT B;  2KUM A;  3M4O B;  1OXV A;  2NVY B;  1PFM A;  3NE5 B;  1EY7 A;  2M2L A;  2NYZ D;  3H6M A;  3WOE A;  1G91 A;  2JA5 B;  4IFD I;  1YNN D;  3C1F A;  4DA2 A;  1SYD A;  1GUS A;  2B2Y A;  3OIQ A;  1NR4 A;  1CQV A;  4A3J B;  2WAC A;  2IL8 A;  5C4H A;  1EZ6 A;  2F0O A;  2B2W A;  4PQX A;  2F0Q A;  1STY A;  4ULL A;  1SNM A;  3HOY B;  1BCP D;  1IW7 C;  1CHQ D;  4IUR A;  2H4O A;  4XIG S;  4M8A A;  4ZAI A;  2E2D C;  1JOQ A;  3FPU B;  5KNB A;  1QNK A;  5ELC A;  1GUO A;  2MUY A;  2SOB A;  4M1U B;  2F0V A;  4FF3 A;  5C3X A;  3OOC A;  1GUW A;  1CHP D;  3V2T A;  3HOZ B;  4I65 A;  1V43 A;  1LTA D;  2E76 C;  4EQO A;  4KKT A;  4RCO A;  1DON A;  4KJN A;  4A3G B;  1D6E C;  4DNR B;  1O78 A;  4IUT A;  4PMW A;  3NPP A;  4U68 A;  2R6G A;  1PDQ A;  5A2Q E;  4C3I B;  3H94 A;  3ITP A;  2K5W A;  1DOL A;  3Q22 A;  1MBY A;  2XWJ B;  3K5L A;  5I6Y A;  3NBI A;  1TY2 A;  1A6X A;  4IQZ A;  1PTO B;  2HCC A;  2XN9 C;  3J81 E;  2LFN A;  2KCC A;  3C2P A;  2IX0 A;  1TS2 A;  3NSW A;  2L55 A;  4IUU A;  4FYD A;  5FK9 C;  5CMD A;  1ZEQ X;  2R7Z B;  2X69 A;  1GUN A;  4FF1 A;  1ET6 A;  1QB5 D;  1U4M A;  3E0J A;  2RDH A;  5JVG 3;  3OMG A;  5C3W A;  5LL6 X;  1F9Q A;  4UDU C;  4TSS A;  2E2H B;  2D62 A;  4GZY C;  2LMC B;  3VR5 A;  1G8Z D;  3H3V C;  3U9O A;  1D1I A;  5EBD A;  1UNS A;  3KLR A;  1SYC A;  5T1G A;  1O7L A;  5JPN C;  1NUC A;  3SK6 A;  5C0X I;  3LWE A;  4DF7 A;  3HG9 A;  3KLS X;  2NZ1 D;  4CKC A;  3SVM A;  4RA8 A;  1GUG A;  3QO2 A;  4G7O C;  1M8A A;  3QOL A;  4EQN A;  3SK8 A;  1AP0 A;  1CZG A;  3Q6S A;  1KTK A;  2R61 A;  2EJG C;  1YNN C;  1EZ8 A;  4FXG C;  4PNY A;  4ZUI A;  2BDN A;  3C3L A;  3VYU A;  2FJ2 A;  3HOW B;  3MC0 B;  5C4J B;  5J1Z A;  5BN4 A;  4BS9 A;  4ILW A;  1KDC A;  3IAY A;  1STH A;  5D65 A;  2D9U A;  3ND8 A;  3HP3 A;  1S5F D;  3DWQ A;  5C4Z A;  4KMU C;  3GV3 A;  4DK0 A;  1ET9 A;  2EPB A;  1NAP A;  1BCP C;  1WTX A;  3PUV A;  4CJ1 B;  3M85 A;  1SBB B;  2A73 B;  3M3Y B;  2HDL A;  1QOH A;  1AZQ A;  3LNN A;  2QCP X;  4C3H B;  2KQ3 A;  4G7Z C;  2F03 A;  5COR A;  1XXG A;  5A35 A;  3K5N A;  1EOT A;  1FNV A;  1SMY D;  2DY8 A;  1JCK B;  1HHV A;  1HUN A;  3KBX A;  3K0Y A;  3DEP A;  2Z1C A;  3C46 A;  2PW7 A;  4A3K B;  2K03 A;  4EGV A;  3LX0 A;  4K5W A;  3R2I A;  1HXY D;  2XRQ D;  1TWA B;  2PNR C;  4ODG A;  5DM7 3;  2JEB I;  1PRT B;  4TRD A;  5CGK A;  1BBX C;  4DXF A;  3M4Y A;  5CR3 A;  3SE0 A;  4J6H A;  1IKM A;  3C1E A;  3J80 L;  3K7A B;  5M5Y B;  2D5D A;  1HUM A;  3ONA B;  4K8I A;  4C1N K;  4X3K A;  4PMB A;  2FIN B;  5FO7 B;  2VB2 X;  1R4P B;  4F7X A;  1DJR D;  2A6E C;  1ESF A;  1HA6 A;  1B4O A;  2KCN A;  4IUQ A;  4ZRZ A;  3GTJ B;  1KLU D;  2B2Y C;  3DWP A;  1G2T A;  1SDF A;  3PO3 B;  3QB3 A;  1D5M C;  2B2W C;  1JOO A;  3S17 B;  3BDO A;  4CKB A;  2L11 A;  2HDM A;  3PUZ A;  1TR5 A;  4KY5 A;  2G9H D;  2EYP A;  1KLG D;  1HQR D;  1SNC A;  4LJZ C;  2K04 A;  4OL7 A;  4RH6 A;  4KN7 C;  1C4Q A;  3AU7 A;  5CV8 A;  3MXG A;  3S1R B;  2KHS A;  3OSO A;  4QUF A;  3IFD A;  1X32 A;  3F2U A;  2ZXR A;  1HA5 A;  1Q90 A;  2ENB A;  1I4X A;  3HS0 C;  3AB9 A;  4O42 A;  5IIF A;  4A3B B;  1JE4 A;  5NUC A;  2TMP A;  2K6A A;  2WV6 D;  5CBA E;  1WD1 A;  4QF4 A;  1IYU A;  1EQT A;  2EY5 A;  1I6V C;  2EYJ A;  1TS3 A;  4F87 A;  1EY5 A;  2MGS A;  2IX1 A;  1RD9 D;  3GQB A;  1KNE A;  4AYB B;  5IGB A;  4S3S A;  1PTO F;  4RKL A;  5DNF A;  4U67 3;  4RAU C;  1HCZ A;  2QEJ C;  3ERO A;  1NCV A;  5E4W C;  2JA7 B;  2F0N A;  3L7Z C;  3KF8 A;  3TP8 A;  2R92 B;  1A3T A;  3Q0A A;  3SR1 A;  1SMY C;  2F0P A;  3I72 A;  2NWG A;  2R3Z A;  4I7Z C;  2EDG A;  4HCS A;  1PZJ D;  1M4V A;  1E2Z A;  4B9W A;  3P7J A;  3BS1 A;  5I6W A;  3S9W A;  4WRD A;  1ML0 D;  1GJX A;  1DM0 B;  2KVM A;  4FF4 A;  2IWH A;  1ROD A;  3HGB A;  3GTQ B;  2C9O A;  3S1M B;  1TWH B;  2OF1 A;  2BDO A;  2VB3 X;  4ZYS A;  4ZUJ A;  1SFO B;  2LKV A;  3JAM L;  3DEO A;  4FP5 D;  1EWH A;  1SNO A;  4A3D B;  4CJ0 B;  1TS5 A;  3BVZ A;  4B9X A;  1CM9 A;  5DEH A;  3RUZ A;  4R9W A;  1BO0 A;  1H9J A;  4NDX A;  1L0Y B;  3A8I E;  5G3L F;  5I4D A;  5IGE A;  4LK1 C;  4KKU A;  3ZYY X;  4XTC S;  5C3E B;  3D3R A;  4IFD J;  3K59 A;  2SNM A;  3KLS A;  2GA4 B;  4WOR A;  3PUW A;  1JOR A;  1EIH A;  1SNQ A;  3GP7 A;  2JA6 B;  3VR4 A;  2Q8T A;  2AUK A;  1SYB A;  4MIU A;  3P75 A;  2B2T A;  2B63 B;  3LWU A;  1S5E D;  4K5V A;  1EY4 A;  5EPJ A;  4RGT A;  1LTB D;  4N9T A;  1SE3 A;  2E2J B;  1SE2 A;  2NVX B;  4DGZ A;  1TQO A;  4N9P A;  4F8M A;  4WJW A;  5IGD A;  1TKW B;  1QNU A;  1CA6 A;  1STB A;  3J7A V;  5M3F B;  1LTI D;  5CV6 A;  1Q1B A;  4QCL A;  3MAQ A;  1RHP A;  2F0E A;  4O1N A;  2EYO A;  3X3M A;  5FLX L;  1B9N A;  1RKN A;  1RTN A;  5DAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...