4LF8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8Q00
3HOUG 1PH2A 2PI2E 2Q2HA 1JMCA 3GTLH 1IBML 4BXXH 4JBJA 2VQEQ 1EOVA 1JJCB 3RLNA 1RIPA 2KHJA 3GD7A 1UWVA 1I3QH 1KD1C 4QGUA 2VUMG 5GADC 4IFDI 1FGUA 1WCMG 3M3YH 2F52A 4JC0A 4JBMA 4JI0Q 1VQBA 2E2IH 4J15A 4HIDA 4A3KG 3GTPH 1G6PA 1EIYB 1E24A 5JEAG 2R7ZG 1I94Q 2OCEA 5FJ8G 1TWGH 3UDGA 3OW2A 4NPSA 2F4VQ 1LM0A 3CD6A 1Z47A 4P71A 3CPWA 3GTQH 2OQKA 2BH2A 4B3TQ 3D0FA 1EUJA 1KXLA 1HJPA 3PIPA 4DV4Q 3M4QA 1PA6A 4A3FG 1Y1VH 1CUKA 1SFOH 4YCVA 4B3SL 3HKZE 3HOYH 3S1MH 4X6AH 3W1BA 2OQ0A 2FXQA 1IBKQ 4LF8L 2JE6I 1PH1A 4IPGA 3BJUA 4UP7A 5FLXc 4B3RQ 2F3IA 4A3CG 4R4OA 1K9MC 5ELOA 1O7IA 3HOZG 3G71A 1KC8C 3CQZH 1MKHA 1NBWA 4L5TA 4PZ6A 1VQAA 3F1ZA 5C0XI 2WAQG 1A62A 2CCZA 2NVQH 2OWOA 2XGTA 2QA4A 1KAWA 1LTLA 1Q12A 2OTJA 3W5OA 2JJQA 4P73A 3CCJA 3PGZA 3KF8B 2MQHA 1IL2A 1PH7A 4GLVB 4MNOA 4DKAC 4OONA 4YCUA 4Y7NH 4OWWB 1U5KA 1VQNA 5JJLA 1Y1WH 4DR4L 2WB1G 1SN8A 2VNUD 4L5RC 2UXBL 1B7YB 4A3BH 4P74A 5C3EG 4GN4B 4DV2Q 1QUQA 2HIVA 3A5ZB 3I55A 1XMQL 1VQ5A 2WB1E 4DR5Q 5IYCG 3J7ZC 3CF5A 4BBRH 4LFCQ 2CWPA 2N8NA 1KRTA 1V43A 4LFCL 4JI3L 4YY3Q 3TREA 4GLAC 4APVA 5IP7H 4JI5Q 1EYGA 4LUZA 3CXCA 4UY8C 3EIVA 4RMFA 4JOIC 3F2BA 5IYDG 4OXPA 3EBEA 3G48A 1S72A 3H3VI 4QJFA 4C3IH 4PMWA 1X6OA 2WAQE 1VQ8A 4AQYQ 3A5UA 1I6HH 4IO9A 4JI4Q 3IRBA 4JCVE 2R7DA 5M5YH 4HJAA 2BA0A 1VQ4A 3U4VA 1HNXQ 3J7A5 3S14H 4IJLA 2I0QA 4LF9Q 1L1OC 4JI1Q 4BXXG 4GOPB 1G291 4EX5A 4A3IG 4A3MH 4POGA 1UEBA 2JA9A 4XTCS 3CCEA 1IBLQ 2JQOA 3K81C 4WJ4A 1RL2A 3CCSA 5K36G 1L1OB 1VQHA 4LF5Q 4LF6Q 3CCQA 1M90C 1E3PA 4HIKA 4LFAQ 3AEVA 3J81i 3F8TA 1HZBA 1L1OA 1WCMH 3J81c 1SLJA 3L2PA 3NENA 1OXUA 4DK6C 3GTGH 5FLMG 1N36Q 4A3KH 4B3SQ 3KF6A 3CCRA 2C35B 2AHOB 3L7ZC 2K5HA 3M85A 4DR1L 1BKBA 1YITA 2KENA 1C7YA 1TWAH 2WP8J 1S40A 1VCIA 3GDEA 2I5LX 4X66Q 4DV1Q 1GD7A 4BBSH 3KF6B 4DR2Q 4YWKA 2RF4A 4JI7L 1EIFA 3PF5A 2K5VA 1OXXK 4MZ9A 1PYSB 3L0OA 5M3MG 2ALYB 2UU9Q 4JV5Q 5IYBH 1OTCA 3HOWG 1PH3A 1FJGL 2Z6KA 1WI5A 3HOXH 4BBSG 1Q1EA 1YHAA 5C0XG 2VQFQ 1YZ6A 3K7AH 3KDFA 2N3SA 4JV5L 4C3JH 5C44H 4Y52H 1PFSA 2NN6I 2Z6KC 4JBKA 1FVIA 2Q2IA 1VQIA 1C9OA 4R1JA 1WOCA 2ID0A 3TEHB 1N34L 1K8AC 3OYYA 2VQEL 4DV3L 4A3LH 1W3SA 2VZAA 2VL6A 4NB3A 3ULLA 4X64L 4BBRG 2IY5B 2Z0SA 4DV0L 2CQOA 1AE3A 4HIMA 3I7FA 3CMEA 4RG1A 1XNRQ 5ELNA 2VS1A 5IT9c 1VQ9A 1MIUA 4UP9A 4A3DG 3A0JA 4IJHA 2E8GA 1VQ6A 4OO1G 4R4CA 4HJ5A 5LMNW 5BR8Q 1PH5A 4QY7A 1X55A 4X62Q 3OTOL 3PUYA 3G4SA 1Q86C 1BBWA 2KHIA 1X3EA 4ME3A 2L15A 1N33L 2IX1A 4R4TA 5IWAL 4A4IA 4AYBE 1TWCH 3VDYA 1X9NA 5JJIA 2VQFL 1VQDA 3RZDH 1M1KC 4K0KQ 3LGJA 4GOPA 4LFAL 3UE0A 3I4NG 4DNIA 5DLQE 2B63H 2KCMA 5EAYA 3T1YQ 1OXSC 1NMFA 2JK8A 5LMNL 1QZGA 1U0LA 3NEMA 1BBUA 2Q2UA 3UE1A 1GVPA 1IBLL 2JA7G 1Y14B 2NZHA 1XJVA 3FP9A 4YY3L 5GROA 2R6GA 4JI7Q 2R92G 1N8RC 1S3OA 4TVAB 1MJEA 3TRZA 2MNAA 2CWAA 2YTXA 4QIWE 4P75A 4JI4L 4X62L 1VQJA 1Q46A 3J80i 1E1TA 2K4KA 2DUDA 4PZ7A 2LSSA 3RLOA 1QVCA 1X54A 4IPDA 4PG3A 3SGIA 1PH9A 4BY1G 3CC2A 2AWNA 4A3MG 1PV4A 2Q2TA 4R4QA 4MTNA 5FJ8H 4DR6L 1KL9A 1N9WA 4DAMA 5FLMH 3GO5A 4X64Q 5J3BA 1FL0A 3I56A 4DR2L 4O2DA 4DV3Q 4JBWA 3CMAA 1NE3A 2ZJRA 4A3GH 4JYAQ 1A63A 2YTYA 1H95A 1HNXL 2EXDA 3KDFB 3M4OH 1OXVA 4JI1L 3CC4A 2UXCQ 4A3FH 2JA5H 3WWVA 4WJ3M 3CP0A 2A19A 1LUZA 4A3EG 2PQAB 1CKMA 3DM3A 4HIOA 4DV7L 2QGQA 3H0GH 2E2HH 3PV0A 1UE1A 4BY7H 2NN6G 2B29A 4LW1A 2B3GA 3RN5A 4LF4Q 2D0OA 2PQAA 4NXNL 4JI5L 3S2HH 1IBKL 4LF8Q 2K75A 2JA5G 3PF4A 4A3BG 2Y0SE 1GM5A 5C3EH 4JI6Q 1JT8A 1C0AA 4YHHL 4DUYQ 1QVFA 4DR5L 4YHHQ 3RR5A 4DUYL 4DAYB 1YJWA 1HNZQ 3CAMA 2UXDQ 2RHQB 4JI3Q 3PUZA 4DK3C 4IPHA 2D62A 4XIGS 1Y1WG 1WYDA 1JE5A 3PUWA 5IP9H 3HFZB 4DV6Q 2F4VL 4A76A 1NTGA 5C4XH 4H02A 3CCMA 2UUBL 4DV7Q 1KHIA 2A1AA 2NVXH 4LF5L 4LF7Q 1X65A 3K8AA 2UXCL 1N32Q 4KHZA 1PH4A 3UDXA 4DR3L 2LXJA 3GTMH 1J6QA 1IBMQ 4LF9L 4A93G 1EQRA 3ULPA 2LXKA 1T9HA 2R93G 2PMZE 3F2DA 4JG2A 2H5XA 1XMOL 4DV2L 3D31A 2HQLA 3PUXA 2OTLA 4R4IA 2HIXA 3JAMi 4AH6A 3KOJA 5IE8A 4IPCA 2NZOA 4A75A 3JAMc 1YI2A 4NXMQ 1YJNA 1XMOQ 3PO2H 3M9BA 1XNQL 4A93H 3PUVA 4IFDG 2VUMH 1HNWQ 5AJ3Q 1HR0L 1D7QA 4GS3A 2DGYA 1Q81C 1TWFH 5M3FG 2UUCQ 1UE5A 2AMCB 4JYAL 2NVTH 1QVGA 3RN2A 3B6YA 4LFBL 1HH2P 4KHPL 1X56A 4KHPQ 2CFMA 1V1QA 2EQSA 1CSQA 2IHEA 2PI2A 4UPAA 1TWHH 4C2MH 4POFA 4DV4L 4NXNQ 2EIFA 2N49A 1VQFA 5JJKA 4LUOA 1EFWA 2I5MX 1OXTA 3S1RH 2UXBQ 2IX0A 3BZKA 3MEFA 1JB7A 2A8VA 4DV6L 2ZJPA 1E22A 1SMXA 2RHSB 3FHWA 4GLXA 3NBHB 1I5FA 3TS0A 1IXRA 1VQLA 3F2CA 1A0IA 1VQKA 3ER0A 2JA6G 1X3GA 1B8AA 3U4ZA 3ERSX 3STBC 2K52A 2CKZB 3CPFA 3I4MG 1L2FA 2YV5A 1JJ2A 1HNZL 3PSIA 1V9PA 3T1HL 1DGSA 1P8LA 1UE6A 1IZ6A 3MXNB 4OWTB 5GAHC 4B3TL 2RCNA 3HKZG 3G6EA 3HOWH 1Y1VG 3GTJH 2JA6H 4X65Q 2MO0A 4DR6Q 1HNWL 1N32L 4NXML 4TQUS 3KYHC 3TQYA 1K73C 1XPOA 2K14A 3T1YL 2ZJQA 2VW9A 1Q7YC 4JI8L 2HHHQ 4LF4L 3RZOH 4DR4Q 1VS0A 4HJ9A 2AKWB 4BY7G 1WJJA 5IYBG 1I50H 2IT1A 2V1CC 3I2ZA 5LMUL 2N78A 2ASBA 5C4XG 1J5EQ 5HY6A 4A3DH 4JI0L 1E7ZA 2D0PA 1VQOA 1SR3A 2UUCL 3H0GG 4LFBQ 2ZM6Q 1P16A 1UE7A 1QZHA 2KBNA 3PO3H 3E0EA 1CKOA 3KJPA 4DUZQ 4JI2L 5AJ3L 3UDIA 1SROA 2JEBI 5HGQA 1HR0Q 5M5WH 3ICEA 3RLFA 1VQEA 1XNQQ 4LNQA 3TS2A 5IP9G 4DV5Q 3HOZH 1CKNB 4AYBG 3H3VH 4A3JG 2Y0SG 4K0KL 1I94L 1YEZA 3ULJA 1AE2A 2ZTCA 1D8LA 4DV0Q 2BA1A 1N33Q 2ZTDA 4B3ML 3A74A 2UXDL 1VQGA 3AQQA 3EN2A 4DR3Q 4O0AA 2R7FA 2E2JH 2JA8H 1TXYA 3DLLA 3E9IA 1Q1BA 3RNUA 4GKKL 4FDBA 4HJ8A 4B3MQ 5C4JH 2UU9L 1B70B 4PZ8A 5BR8L 1KIXA 4JOIA 2JEAI 4EQ5A 4OX9Q 3CC7A 1SE8A 3S2DH 1X3FA 1HZAA 3S1QH 1R9TH 4GKJL 1SRUA 2VY3A 3BU2A 5M5XH 1PH8A 2AWOA 3PO2G 3ZJYC 3E9HA 4GNXA 2R93H 3CCUA 4GN3B 2MFIA 2R7ZH 4C3HH 1EQQA 1PVOA 3OTOQ 3PCOB 3J80c 5JEAJ 4JI6L 1K0RA 2XTIA 3CW2C 4GN5A 2KCTA 5C0XJ 1N36L 4BA2I 3NELA 3M7NA 2PNHA 3K0XA 5M3MH 5M3FH 4L5QA 5LMUQ 2YU9H 4DR7L 1WFQA 4P72A 3AFPA 3STBD 1PHJA 3GTOH 4BA1I 3JC66 1YJ9A 2E5LL 1XTDA 3HOXG 4OX9L 2UUAQ 3K80C 4LF6L 1PYBA 2GVBA 3HOYG 5C44G 4OWXB 4X65L 1NY4A 1VQCA 4BY1H 1XNRL 4IOAA 4A3IH 1G51A 2YYZA 4DPGA 2YTVA 1YIJA 4AIMA 2QEXA 5IWAQ 2ZM6L 3I4MH 5H1SE 1NMGA 1N34Q 1JJGA 5GQOA 3BZCA 1A8VA 4QL5A 1HR0W 2MO1A 1KRSA 2K50A 2WFWA 3KLWA 3W1GA 4ALPA 1J5EL 1HZCA 1VQ7A 4KI0A 1YHQA 4A3GG 2ZTEA 3HOVH 4QQBX 1IYJB 5LMNQ 1Q82C 1K3RA 2HHHL 1XPUA 4YWMA 4GKJQ 1K8GA 5GAEC 3Q8DA 1LYLA 2ATWA 4DR7Q 4IOCA 1GO3E 3S24A 4YWLA 1ASYA 2ES2A 1CKNA 3HOVG 3T1HQ 4IFDJ 3CCVA 3I4OA 3AFQA 4GKKQ 4HJ7A 3CCLA 1HZ9A 2IHFA 5E7NA 3S17H 1YHBA 4KLKA 1XMQQ 4A3CH 4DR1Q 1ASZA 2JA8G 3S16H 2HT1A 4A3LG 4OO1I 3M4PA 1XPRA 1VQPA 1CSPA 4A3EH 5IY0A 1MJCA 4YCWA 3KFUA 3U50C 2B63G 2I5HA 3PO3G 3UDFA 1E1OA 4UP8A 1PH6A 3FKIG 4B3RL 3HKSA 1YVCA 4JI2Q 3KJOA 1GKHA 2JA7H 5IYCH 1VQMA 1AH9A 2R92H 4X66L 4DV1L 4DUZL 1BVSA 4GNXC 1K83H 4A3JH 5IP7G 1YBYA 3J81j 4GNXB 1Z9FA 4GOPC 1W2BA 3GTKH 3FKIH 1Q8KA 1NJIC 1YNXA 5IYDH 2UUAL 2NVYH 4LF7L 3HOUH 3K7UC 1EWIA 1QUQB 3S1NH 3PIOA 3H15A 2E5LQ 2GVAA 4LWCA 4L5SA 1FJGQ 3AYHB 2GN5A 4AQYL 3U58A 2UUBQ 3S15H 4JI8Q 5GAGC 4DV5L 3I4NH 2BH8A 4LUVA 1L0WA 1KQSA 2K5NA
chains in the Genus database with same CATH superfamily
5IGCA 1IBML 5HURA 2VUMG 1BXTA 1LACA 3GD7A 3KBXA 3T13A 2NVXB 2X6LA 3OIQA 1FGUA 4C56C 1LTTD 4JI0Q 5KIXA 2BDNA 3RZOB 3W3AA 2ICEC 1PTOD 3IFDA 1SE2A 1HUMA 1Z47A 4P71A 2PZWA 3NTKA 2OQKA 4O1NA 1PZJD 3PIPA 4DV4Q 3M4QA 1PA6A 3BYYB 5D65A 3NE5B 1SFOH 5C4ZA 4LF8L 2OEOA 1PH1A 3T16A 1K9MC 1NR4A 1WD0A 1VQAA 3F1ZA 5C0XI 1EEID 3VR6A 2A69C 2B2TA 3CCJA 1LTAD 3KF8B 2MQHA 4YCUA 1WTHA 5KNCA 4H44C 1VQNA 5JJLA 3P7JA 2WB1G 1TS4A 4L5RC 4DV2Q 1K3BC 1SDFA 1STYA 2HIVA 3A5ZB 3I55A 1VQ5A 3CF5A 2FHTA 4TSSA 4LFCQ 1V43A 4YY3Q 3TREA 3Q23A 2CW0D 2PMZB 4UY8C 1DJRD 4IURA 4JOIC 4B08A 3F2BA 4OXPA 3EBEA 3H3VI 1SYGA 3TP5A 2WAQE 3S1MB 4IO9A 1DOKA 1K8OA 4JI4Q 3GTKB 3OMCA 5M5YH 4HJAA 2BA0A 2HUGA 1YNJD 2I0QA 5BN5A 4LF9Q 2LMCB 4BXXG 1G291 4ABNA 2O5JC 3CKIB 1RL2A 2NTSA 4YIJA 1E3PA 3BZDB 3AEVA 3MEHA 3F8TA 1J8IA 3NENA 1N36Q 2K5HA 1MSHA 2F0GA 4DR1L 1EY6A 5I6YA 1YITA 2KENA 2F0QA 5JAVA 1G91A 2I5LX 4DV1Q 3KF6B 2EYJA 3MXGA 1H9RA 4V190 4KKSA 2F3VA 2B2UA 3DWPA 3F2UA 4CHTB 3FMCA 1PH3A 2Z6KA 5FO8B 3T56B 2VQFQ 3J7YW 3KDFA 4ZRZA 1C9OA 4R1JA 2VQEL 3NHHA 3MXPA 4S3SA 4NB3A 4BBRG 2IY5B 4DV0L 2J7ZA 1KAAA 1AE3A 2A74C 3CRLC 1XNRQ 1H9JA 4R4CA 2F0IA 1SE4A 3TMEA 3OTOL 3G4SA 2AUKA 5EGTA 1X3EA 2L15A 1L0YB 4R4TA 4AYBE 1TWCH 4KKUA 3DM1A 3C2PA 1VQDA 3EVQA 1M1KC 5FLXE 4GOPA 1CT1D 2G9HD 1ZEQX 4J1MA 4DNIA 4QCLA 2G5DA 5EKIA 1NMFA 5LMNL 1QZGA 3UE1A 1GVPA 1EZ6A 4FXGC 1S3OA 4TVAB 2RKSA 1MJEA 2J0TD 3TRZA 2F03A 4K5XA 2VXWA 4HAEA 4JI4L 1FGBD 2X6GA 1IYVA 4KMUC 3SGIA 1F2ZA 1HPCA 2OF1A 1HFGA 4MTNA 5FJ8H 2ZXRA 2D2CC 5FLMH 4X64Q 1FL0A 1A3TA 1CI3M 1QWYA 3CMAA 1GUNA 2ZJRA 2EXDA 1WCMB 1YNNC 1O7ZA 3M4OH 2PO4A 5C4HA 4FNFA 1CKMA 1ONLA 2WV6D 2EPBA 2NN6G 4LW1A 2D0OA 1KLUD 4NXNL 4JI5L 1IBKL 2K75A 2JA5G 1LO5D 1A6XA 1GM5A 1C0AA 3E3XA 4WORA 5A35A 1DCZA 4YHHL 4DUYL 2B39A 2UXDQ 2KCCA 4JI3Q 2B2VA 3PUZA 2H1EA 1WYDA 3U9OA 1GXDC 5DM73 5IP9H 3HFZB 2F4VL 5C4XH 4H02A 4E6IA 4DV7Q 1B53A 3HP3A 4L63B 2B8FA 2IL8A 4I7AA 2IJ0A 3A56A 3MVVA 3GTMH 1JORA 3MAQA 5E4WC 2E2DC 4A93G 2LXKA 3G6JB 1STNA 4TRDA 2EDGA 5KRUA 4DV2L 2F0KA 1PFNA 2OTLA 4BY1B 4A75A 1BCPC 3KOJA 4IPCA 1YI2A 1XWEA 2L9HA 3JAMc 1YJNA 2KUMA 3M9BA 1IW7D 4C1NK 1HNWQ 2G9DA 1HR0L 5M3FG 1K28A 2AMCB 1QVGA 1X56A 1B3AA 1V1QA 2EQSA 2PI2A 4UPAA 4C2MH 4DV4L 2EIFA 4H0LC 2XRSD 2QCPX 5JJKA 5CC4A 1EFWA 3S1RH 3BZKA 1DONA 2RQXA 3FHWA 1I4GA 1ESRA 1VQLA 2NVTB 4DK0A 2AQ3B 2F0EA 3ERSX 2K52A 3A8IE 5J22A 1G2TA 1JJ2A 4FF2A 4WRDA 3T1HL 1UE6A 3D3RA 2RCNA 3HKZG 1N32L 2PCFB 1Y1VG 2AQ2B 4TQUS 3KYHC 1XPOA 1Q7YC 2HHHQ 3SXHA 4RGMA 4EQNA 4QUCA 5JOBA 2AKWB 3I90A 5IYBG 1I50H 2V1CC 2N78A 1J5EQ 4JI0L 5ELDA 1E7ZA 2D0PA 4KV6A 3FEWX 1SR3A 3ITPA 1PRTF 2KBNA 1GUSA 4XYQA 2BCOA 3NK9A 2JEBI 3UDIA 5HGQA 5EKKA 1XNQQ 4CKBA 4LNQA 5JVG3 3HOZH 2K03A 4A3JG 2Y0SG 5KNDA 3TP6A 4DV0Q 1R9TB 3PMFA 4IFDH 2QDLA 1EZ8A 3NPPA 2JA8H 3GTPB 1O7LA 4FDBA 1EEFD 1EY0A 2UU9L 4UDUC 2XNAC 4EQ5A 1X3FA 1HZAA 3OIPA 3BU2A 5CV6A 1PMRA 3PO2G 4A3MB 1JICA 2DNCA 1HCZA 1D1IA 1TIID 5C4XB 2MFIA 2Q8TA 1ZXTA 2SNSA 4IUUA 5EBDA 1K0RA 2XN9C 2KCTA 4C1NI 5C0XJ 3M7NA 4CJ0B 2BE5C 2F0NA 3K0XA 4L6TB 5M3FH 5LMUQ 4R8NA 2PNRC 1YJ9A 3MFGA 3TDQA 1EFID 1PYBA 2K05A 4C3JG 2R61A 1XNRL 3LNNA 2QEXA 5H1SE 1NMGA 1JJGA 2VUMB 3SR1A 3K7AB 1VF7A 2RDFA 2K50A 1J5EL 1VQ7A 3J80L 4ALPA 4KI0A 1YHQA 4IUNA 1QOHA 2HHHL 2N88A 4YWMA 3EJIA 4J6HA 1LYLA 4YWLA 1CKNA 5I9OA 1SE3A 1F9SA 4RCNA 4GKKQ 4OL7A 1R4PB 4HJ7A 1HZ9A 1HQRD 2IHFA 3TP8A 1YHBA 1G6ZA 3BVZA 5KGUA 4DR1Q 1FNUA 4A3LG 1PZID 2PZTA 1RCVD 1VQPA 1E2WA 1KTKA 4YCWA 3I72A 3U50C 1BQQT 2SOBA 2I5HA 3VYTA 4UP8A 1PH6A 1LTID 5DAUA 2PYKA 3HKSA 4JI2Q 5IYCH 2R92B 4X66L 4GNXC 1BVSA 4ME5A 4A3JH 3J81j 4GNXB 1I4XA 5BN4A 5IYDH 4NMZA 1QUQB 4C3IG 3S1NH 4L5SA 4LWCA 1FJGQ 3PIP3 1M8AA 2Q8RE 2A6HC 4JI8Q 4DV5L 3KLSX 1RHPA 4LUVA 1KQSA 2UU9Q 1KDAA 3VYRA 1PH2A 2Q2HA 3GTLH 4JBJA 2VQEQ 5I4DA 1RIPA 3BYTB 4IFDI 1I4RA 1WCMG 3X3NA 2F52A 1LTGD 4JBMA 2ENBA 5EBCA 1SYCA 4HIDA 2CHBD 1EIYB 1E24A 4N8X1 3UDGA 1TWGH 3OW2A 2A5HA 4NPSA 1LM0A 4DGZA 2F4IA 3SK5A 3A8KE 4IZ8A 1Y1VH 2VB2X 1CUKA 1ML0D 4YCVA 3W1BA 2FXQA 4PQXA 3P20A 2JE6I 4A3GB 4IPGA 5JPNC 4B3RQ 4IUPA 3M4OB 4OEMB 1O7IA 3QG1A 1NCVA 3HOZG 3OWFA 1MKHA 1NBWA 2JYOA 2NVQH 2OWOA 2XGTA 2QA4A 1Q12A 1KAWA 2RCFA 2OTJA 1GUOA 2PPBC 5LHY1 1SYBA 2JJQA 2D9UA 1AW7A 2KOLA 3IFTA 4MHEA 1MI2A 4OO1H 1IL2A 2FMCA 4CDDC 4GLVB 4OWWB 1CQVA 1CHQD 1EYAA 2IW3A 2KHSA 3HOXB 2UXBL 5C3EG 4DFAA 3E6ZX 4XDXA 4NP5A 4DR5Q 1SYEA 3ND8A 4BBRH 3E0JA 2N8NA 2NB0A 1ZYRC 3I70A 4APVA 4KY6A 5IP7H 4LUZA 3CXCA 3EIVA 4RMFA 5CBAE 3NWTA 3G48A 4QJFA 3TN2A 2MP1A 4PMWA 2RA4A 2NBFA 3NWSA 4AQYQ 2EJMA 3J7A5 1QB5D 1PTOB 4JI1Q 3GTJB 1QG7A 2E76C 4GOPB 4A93B 2L0CA 3IKJA 1UEBA 2WIIB 1HTLD 2DJFC 4LF6Q 5IOCA 5CBEE 1D2BA 4ZYSA 1WCMH 3DEPA 3AU7A 3CCRA 2C35B 2AHOB 2QKIC 4C3HG 1BKBA 2FINB 1HQMC 3S17B 1C7YA 2WP8J 1S40A 3GDEA 4X66Q 3CRKC 4YWKA 4H13C 1B50A 3GV6A 2K5VA 5M3MG 4JV5Q 3L0OA 4DNTB 3HOWG 1FJGL 4ZAIA 3MC0B 4BBSG 1Q1EA 1YHAA 1YZ6A 1FNVA 5C44H 2L5TA 2Z6KC 1FVIA 1WOCA 2F0LA 2ID0A 1VMCA 3MA2B 4A3LH 3Q6SA 2Z0SA 4TKOB 2Z1CA 4HIMA 3I7FA 5CV4A 3R8BA 4RG1A 5NUCA 1HFNA 4IQZA 3A0JA 4OO1G 4HJ5A 1FD7D 5ELFA 4QY7A 1SXTA 2B2YC 2M9VA 1BF4A 5M5YB 5C5MA 1LABA 4ME3A 2A68C 2A73B 1EIGA 1STAA 3TSSA 3VDYA 2JSOA 4PV1C 1V1OA 4FP5D 2SNMA 2B63H 2KCMA 2Z9HA 2JK8A 2KCNA 3RUZA 3NEMA 1KLGD 3OWEB 2Q2UA 3S2DB 2JA7G 4EVOA 1EL0A 3FP9A 4JI7Q 5GROA 2R92G 5ISRA 3A8JE 4FF4A 4QIWE 4X62L 1STGA 1VQJA 2CH4A 5EQ0A 2K4KA 2LSSA 4IPDA 1BDOA 4BY1G 1PV4A 2Q2TA 3CQZB 4CDCC 2HD3A 2DY7A 3J80E 3KUPA 3I56A 5M5WB 5ELEA 4JBWA 1ENFA 1NE3A 2E74C 3MHBA 5EKLA 4JI1L 1FYCA 4ZKCB 3CC4A 4A3FH 2JA5H 4V0BA 2PQAB 4HIOA 1SFOB 2E2HH 3PV0A 4C3JB 4BY7H 2B29A 2B3GA 3RN5A 1NSNS 3EQLC 3S2HH 4LF8Q 3C46A 2Y0SE 4IALA 5C3EH 4JI6Q 1LT5D 4DUYQ 3RR5A 4DAYB 1S5DD 1HNZQ 2F0FA 4IPHA 2D62A 4XIGS 1CQFA 1CM9A 3H6MA 5E1FA 1Z7TA 4UAIA 4DAYA 4A76A 1H9MA 4ID6A 2NVXH 4LF5L 4O42A 4LF7Q 4K5VA 1PZKD 3NP8A 2EZVA 1N32Q 1D5XC 2WINB 3M4YA 2K6AA 1PH4A 2LXJA 1T9HA 2R93G 2PMZE 4JG2A 3D31A 3PUXA 5G3LD 3JAMi 5IE8A 2WB1B 5IT9L 4G7HC 3DUZA 1GUGA 3PUVA 4IFDG 1JCKB 2VUMH 5CMDA 5AJ3Q 1D7QA 2DGYA 4N8FA 5EJWA 2JA7B 3U9SA 1PFBA 4LFBL 1A2TA 3RN2A 1SNPA 2CFMA 2IHEA 2IWHA 1EQTA 2CVRA 1TWHH 2X69A 1DOMA 4RHSA 1LTSD 1VQFA 1IKLA 3D6CA 1GJXA 2I5MX 1OXTA 2BE5D 1ET6A 2F1MA 2J4XA 2A8VA 5CV8A 2ZJPA 1E22A 4KN4C 4GLXA 3MFYA 3TS0A 2BDOA 5C3WA 2K7VA 1A0IA 1EU4A 3SHLA 4A3BB 3ER0A 1BCPF 2HQEA 3STBC 3A54A 4J8QA 2KVMA 1HNZL 2I07B 1V9PA 2NWGA 1P8LA 3NXWA 3MXNB 2PQEA 4KTAA 1Y1WB 4B3TL 1B2TA 3HOWH 3GTJH 3TQYA 3RZOH 3J7AF 1VS0A 2JP1A 1GHJA 1WJJA 3I2ZA 1G2SA 3MTSA 5CGKA 3OSOA 4KHVA 2YU9B 1WTVA 2UUCL 2L11A 3I91A 3PO3H 1CKOA 4JI2L 3T4AC 3TZDA 5I6WA 3ICEA 3K6OA 4ZLTF 1ILPA 1CKNB 1H9SA 4B9WA 4DU9A 1I94L 4K0KL 5ELBA 3ULJA 3GTQB 5CV5A 2ZTCA 2BA1A 3D4RA 1N33Q 2JA6B 4O0AA 2E2JH 3RNUA 2K04A 4B3MQ 1AZPA 2JEAI 3VR5A 2CQAA 4A3EB 1Q3LA 1TU2B 5C5LA 3ZJYC 3E9HA 2R93H 3WOEA 4DXFA 3BG3A 1BBXC 4X3UA 4K8IA 2R7ZH 1PVOA 3PCOB 3J80c 3K5OA 4JI6L 1F9RA 3OW7A 4QB4A 5DEHA 4I65A 4P72A 1C4QA 3AFPA 5TSSA 3STBD 1PHJA 2VB3X 3JC66 1XTDA 3HOXG 4OX9L 1DXMA 2F0WA 2L1BA 2GVBA 1EIHA 2OXPA 4A3IH 1G51A 5IODA 1YIJA 4AIMA 3I4MH 1CTMA 1KRSA 4A3GG 3GTOB 1HZCA 4RWSC 2ZTEA 3ONAB 5KYLA 4QQBX 1IYJB 5LMNQ 1Q82C 4GKJQ 3Q8DA 2B8GA 1CK1A 2RVLA 2ATWA 4DR7Q 3N6RA 3S24A 4FF3A 2RSOA 3HOVG 5C0XH 1GHKA 4IFDJ 2EY2A 4DAVA 3CCLA 2K32A 2EYLA 4ULLA 1I4PA 4OO1I 3S16H 4XXEA 3M4PA 5E4XA 1RODA 4KJNA 1CSPA 3NUCA 5IY0A 1B3QA 4DAPA 3PO3G 5DNFA 3W2DA 3KJOA 1UAPA 2XVSA 3K0YA 1VQMA 1AH9A 1STBA 1YBYA 3P75A 1Z9FA 1NAPA 3FKIH 1E2ZA 1NJIC 1YNXA 4MTKA 2UUAL 2NVYH 4HEDA 4LF7L 3K7UC 2R3ZA 3VA5A 1CA5A 1EY8A 3AYHB 4AQYL 2UUBQ 2EY6A 5GAGC 1DZ1A 4G4KA 3I4NH 1TQOA 1S72A 1L0WA 1JOOA 3HOUG 1DYQA 4XT3B 4BXXH 3R2IA 1EOVA 1JJCB 3QOJA 2KHJA 4QGUA 4FVMA 4HCSA 1WVLA 4F8MA 1BCPD 3DEOA 1Q8IA 4ZUJA 3SK4A 2EJFC 2E2IH 2E2JB 2R7ZG 1I94Q 2OCEA 2PW7A 5FJ8G 1SMYC 4RGTA 3CD6A 1Y69U 3CPWA 3BDLA 3GTQH 4NDXA 1EU3A 1S4ZA 4ODGA 4Y7NB 1W6KA 3D0FA 1EUJA 5M3FB 1H9KA 2LY7A 5LL6X 5J39A 3Q0AA 4U673 2OQ0A 1JE4A 2P5ZX 2MPMA 4UP7A 5FLXc 5CV9A 5FKAC 1AP0A 1WTRA 4A3CG 5ELOA 4PMCA 1STEA 1I4HA 4L5TA 4PZ6A 1II3A 2WAQG 2CCZA 1JWSD 1LTLA 5LL6S 5FLXL 3W5OA 2RDGA 3G7LA 4P73A 2O2LD 1RDPD 4MNOA 2F0DA 4DR4L 1EY9A 1SN8A 4M8AA 2A69D 2VNUD 4CDEC 1B7YB 4A3BH 2TSSA 3R93A 4GN4B 1O80A 1XMQL 4OHJA 2WB1E 3J7ZC 4JI3L 1WTXA 2KQ3A 1BO0A 4JI5Q 4N9PA 1V1PA 4HMJA 3M7GA 3J81L 1JWUD 1X6OA 2M00A 4XYOA 1V1PB 5A2QL 2F0PA 2AQ1B 4JCVE 1VQ4A 4R9WA 1HNXQ 4KD4A 3HOUB 4K2KA 5I2YA 1PXUA 4Q0FA 1PTOC 4A3IG 2C5CA 2JA9A 4XTCS 3J81E 3CCSA 1L1OB 1VQHA 4LF5Q 1S5FD 3AMUA 5E3FA 1M90C 4NW2A 4HIKA 3J81i 2XIWA 1HZBA 1L1OA 4EQPA 3L2PA 1OXUA 4DK6C 2EOTA 2XRQD 5FLMG 3GTGH 4OELB 4B3SQ 4F87A 3FPPA 3L7ZC 3M85A 4XQJA 1TS5A 1TWAH 3SE0A 1VCIA 4BBSH 5KYIA 4DR2Q 4KKTA 3NQTA 1EIFA 1ICWA 3HKZB 3PF5A 1OXXK 4MZ9A 1PYSB 1U4RA 4L8JA 2ALYB 5IYBH 2D5DA 1WI5A 2NN6H 4K5WA 3K5MA 4JV5L 3PO3B 5C0XG 4XQQA 1IL8A 2N3SA 4C3JH 4BY7B 1PFSA 2NN6I 3HOVB 4JBKA 2E2HB 3TEHB 1VQIA 3SK6A 2B2UC 3OYYA 4DV3L 3BDCA 3CMEA 3X3MA 2VS1A 5IT9c 3HOWB 3L9AX 4ZCKA 4UP9A 4AYBB 2E8GA 5LMNW 5BR8Q 4CGYB 1PH5A 4X62Q 1X55A 1LT3D 4ZUIA 3QWNA 4RHRA 5D3IB 4CJ1B 2F0MA 3PUYA 3C1EA 1SJED 4KY5A 1WD1A 1DD2A 5IWAL 5JPMC 1X9NA 2R93B 2VQFL 2ZT9C 1Z6HA 4C3IB 2KEEA 3C3LA 3RZDH 1PYWD 3V05A 5D14A 3TP7A 5FOBB 3I4NG 4A3DB 5DLQE 2XSCA 5EAYA 1BBUA 2NZHA 2EYFA 4IN3A 2R6GA 2WACA 1V8QA 2O5IC 5T1GA 4LK1C 3BS1A 3QOLA 3J80i 3DWAA 3RLOA 3I4LA 2TMPA 4PG3A 3HRZC 2AWNA 4G7OC 1BCPB 3WOFA 4DR6L 4DAMA 3GO5A 4DR2L 1D5ZC 4H7BA 3TBIB 2V4DA 3Q22A 1A63A 1HNXL 2JXMB 3KDFB 5I9PA 1VMPA 4WJ3M 4ZK9B 2A19A 1LUZA 4DNRB 4A3EG 1B4OA 5L37A 1SNOA 1EYDA 2QGQA 3H0GH 5J1ZA 4K6DA 1I4QA 5C44B 4LF4Q 1C8CA 5C3EB 4GZYC 3PF4A 1ZKOA 4A3BG 3K5LA 1JT8A 4WFN3 1QVFA 3S14B 1YJWA 2B2VC 4DK3C 1JE5A 1NUCA 4Q5VA 2NVQB 1TR5A 5CR3A 1Q90A 2MUYA 1EWHA 3A7LA 3ZYYX 2A1AA 4RH6A 1LV9A 3UI2A 4KD3A 2EY1A 1X65A 2UXCL 4KHZA 2EVBA 3GTGB 3OOCA 1K0SA 4B9XA 3PIO3 3OPOA 1Y1VB 3T51B 2CW0C 4N9TA 2NTTA 1XMOL 1F2MA 3QR8A 2EJGC 2HQLA 5CV7A 1E2VA 4AH6A 4ILWA 2Q8IB 4IUTA 1EY7A 3PO2H 1RTOA 1XNQL 4IUQA 1EWCA 4GS3A 1TWFH 1DM0B 1SMYD 1A3UA 5C3XA 4JK1C 1UE5A 1O78A 2NVTH 1HHVA 3B6YA 1HH2P 1JOQA 4KHPQ 3HG9A 3S16B 5IGDA 4NXNQ 2N49A 3S1RB 1B9NA 2UXBQ 2IX0A 3MEFA 5M3MB 3P1HA 4DV6L 2FJ2A 4LAAA 1PTOF 1SMXA 3NBHB 3HOYB 1IXRA 4CBVA 3F2CA 4BBSB 1VQKA 1X3GA 1B8AA 3U4ZA 4C3HB 3AB9A 3CPFA 2NZ1D 3CU7A 3G6EA 4DR6Q 2JA6H 4X65Q 3L3OC 1TKWB 4LF4L 2K14A 2ZJQA 2VW9A 2Z6BA 3KK7A 1AN8A 2IT1A 5LMUL 2ASBA 3GQBA 1I3QB 4JVZA 5HY6A 2DY8A 1GUWA 2M2LA 4MN3A 1LTBD 3H0GG 4X3SA 1P16A 1QZHA 3E0EA 3KJPA 1HR0Q 2K5DA 1VQEA 3OMGA 1MD2D 5IP9G 2GA4B 2R7ZB 3H3VH 1O7YA 1RD9D 1YEZA 1UUPA 3PO2B 5CORA 2K01A 4MIUA 1VDZA 1VQGA 3AQQA 3EN2A 2R7FA 1TXYA 5A2QE 1J9OA 4HJ8A 4PZ8A 5BR8L 1KIXA 4OX9Q 1SE8A 2L55A 1W6JA 3HS0C 1ILQA 4GKJL 5FO9B 2VY3A 5M5XH 2AWOA 4GNXA 1D6EC 3CCUA 1JOKA 3QO2A 1A15A 4EGVA 4FO2A 5JEAH 1EQQA 5JEAJ 1TWHB 4F7XA 2E75C 2XTIA 3CW2C 2B2WA 4GN5A 1N36L 4K14A 2PNHA 1TVXA 2YU9H 4DR7L 1WFQA 2SDFA 4BA1I 2E5LL 1CZWA 1MHWC 4HN7A 1SSOA 2WKCA 1SAPA 1QNKA 3HOYG 1VF5C 4JPBW 1BOSA 4X65L 1VQCA 3KBGA 4IOAA 2YYZA 1IHZA 2YTVA 1SBBB 1AZQA 2K28A 1SYFA 1N34Q 3QB3A 3FRPB 4PMBA 5GQOA 1A8VA 4QL5A 4CKCA 2WFWA 3KLWA 4P2CB 1ZYRD 1EOTA 1T5XD 1OO9B 2F3WA 3I73A 3VR2A 1FNWA 4EQOA 3HOVH 1TY0A 1K3RA 1XPUA 2F0TA 3RMHA 5GAEC 5F2DA 4IOCA 1YNJC 2KECA 1LTRD 2ES2A 2B2YA 4CDFC 1STHA 3T1HQ 1HXYD 3IAYA 3AFQA 5E7NA 5KNBA 3FDTA 2F0HA 1XMQQ 1K83B 4FXKC 1ASZA 4A3CH 2HT1A 1SYDA 1MJCA 3KFUA 2NVYB 1EY5A 3UDFA 1E1OA 1QCBD 2QF7A 3FKIG 4B3RL 1U4MA 1YVCA 1GKHA 1KNEA 1F2LA 2DN8A 2L12A 1JR0D 4OGQC 1BR9A 3RZDB 4DUZL 5IP7G 1W2BA 4GOPC 1XYIA 1S5BD 3DXJC 4K6LA 4FF1A 1Q8KA 4OIKA 3HOUH 3PIOA 1QE6A 2E5LQ 2GVAA 2GN5A 3PQIA 4CKEA 1EY4A 1UEAB 3U58A 4RFBA 2BH8A 4NXMQ 2PI2E 1JMCA 4Z9CB 1KD1C 3RLNA 4CJ2C 1UWVA 1I3QH 5GADC 3M3YH 2ICIA 5EPLA 4JC0A 3MXUA 3JAML 1VQBA 4I7ZC 4G7ZC 4J15A 4A3KG 1G6PA 3GTPH 2JA8B 1A2UA 2AUJD 4QMGA 5JEAG 2B2WC 1F9QA 2DJGC 2HCCA 3S2HB 2F4VQ 4BWGB 1EYCA 1TS2A 4BS9A 2B63B 2BH2A 5JVH3 4B3TQ 3I4MB 1KXLA 1HJPA 3JAME 1R4QB 4A3FG 2IX3A 3H0GB 4B3SL 4FXDA 4XT1B 3HKZE 3HOYH 2RBMA 3S1MH 4X6AH 1TWAB 4IUVA 1IBKQ 3BJUA 2OT2A 2HCIA 2F3IA 1TS3A 1X3PA 4R4OA 2PW5A 3G71A 1KC8C 3CQZH 3K59A 4FYDA 1A62A 4DXGA 5C4JB 3PGZA 1Y8PB 1AEXA 1PH7A 4DKAC 4OONA 4Y7NH 1RTNA 1RKNA 2H4OA 1U5KA 4X3KA 2RSNA 3KF8A 3KLSA 1Y1WH 4HCEA 3H91A 1WTPA 4P74A 1QUQA 1A3VA 5IYCG 1IKMA 3GTLB 2CWPA 1KRTA 2RDHA 4LFCL 4K2LA 4RKLA 4GLAC 1EYGA 3EROA 5IYDG 4QUFA 2Z4HA 4HSPA 4C3IH 5D3DA 4LMQD 2EY5A 4M1UB 3LX0A 4KK7A 1VQ8A 2ZXOA 3A5UA 1I6HH 3IRBA 2R7DA 3S14H 1PLFA 3U4VA 4IJLA 4X3TA 2LFNA 1L1OC 2PZUA 4EX5A 4POGA 4A3MH 3CCEA 1IBLQ 2JQOA 3K81C 4WJ4A 3CCQA 5HGTA 4LFAQ 3J81c 1Y8NB 1SLJA 1KDBA 3MWYW 4A3KH 3KF6A 1E0BA 2QILA 1JQYD 1SEBD 3GV3A 3D4WA 1GD7A 1LT6D 4BBRB 2RF4A 4JI7L 3MZ5A 1BNZA 2F0OA 3SEBA 1OTCA 4OIJA 1IYUA 1HUNA 2MGSA 3HOXH 2LKVA 3K7AH 4Y52H 4RA8A 1IW7C 2Q2IA 1N34L 1K8AC 1MGSA 1W3SA 2VZAA 1MSGA 4KN7C 2VL6A 3ULLA 4X64L 1U9RA 2CQOA 1F9PA 1U4PA 5ELNA 1D5MC 4JW0A 1VQ9A 1MIUA 3H09A 5IIFA 4G57A 3I4NB 4A3DG 4IJHA 1VQ6A 1NR2A 4KJOA 1D1KA 2O4XA 3ND9A 2LS01 3DHQA 1Q86C 1BBWA 2KHIA 1PFMA 1CZGA 1N33L 2IX1A 5JJIA 4A4IA 1Y8OB 1KDCA 3NTIA 3Q24A 3A7AB 4U68A 4K0KQ 3LGJA 4LFAL 3UE0A 3T1YQ 1OXSC 3D8GA 1SNMA 1U0LA 2XWBB 3BVGA 1KABA 4PNYA 2EYMA 3VA7A 1PDQA 4RKBA 1IBLL 1Y14B 1XJVA 4YY3L 4DK1A 1N8RC 1X32A 2QEJC 2Z4IA 2MNAA 2CWAA 2F0SA 2YTXA 4P75A 2FMMA 1Q46A 5JJZA 1C48A 1E1TA 2A68D 4K8JA 2DUDA 4PZ7A 1PH9A 1QVCA 1X54A 1WTOA 3CC2A 4A3MG 2Y0SB 3BDOA 2NYZD 3M3YB 3A55A 4R4QA 4R8IA 3J7AV 1KL9A 1N9WA 5J3BA 1PRTD 3I8ZA 4O2DA 4DV3Q 4A3GH 4JYAQ 2YTYA 1H95A 3N52A 4LJZC 1I50B 1SJHD 2EYPA 2I46A 1OXVA 3NBHA 3S1QB 2UXCQ 1ET9A 3FPUB 2B2TC 4HTHA 3WWVA 3CP0A 1B9MA 1ICFB 1K8MA 1TWFB 3DM3A 3HGBA 4DV7L 1NNXA 2EE1A 2N55A 1UE1A 2NUCA 3WDNA 2A6ED 2PQAA 3ERQA 2F0JA 1CA6A 5KEEA 1L0XB 1WTWA 3RD4A 4DR5L 4YHHQ 4HMIA 3CAMA 2RHQB 1XX8A 1Y1WG 3PUWA 2HDMA 4DV6Q 1NTGA 3CCMA 2UUBL 1FR3A 1KHIA 5DM63 3K8AA 1TT2A 3UDXA 4DR3L 4RGOS 1RJTA 1HA5A 1QJOA 1J6QA 4ZKBB 1LT4D 1IBMQ 4LF9L 3H94A 1EQRA 3ULPA 2EXZA 1G8ZD 4DN4M 3F2DA 2H5XA 3K58A 1ENAA 3QIAA 4R4IA 2F0VA 2HIXA 2K5WA 2NZOA 1XMOQ 4A93H 5G3LF 4RGNA 2KA7A 2CH4W 5FO7B 3NSWA 1Q81C 2ZXPA 1HRJA 2UUCQ 2BOSA 4JYAL 3D4DA 4KHPL 1CSQA 4F88A 4POFA 3SDZA 4QF4A 2WKDA 4LUOA 2EYOA 4A3KB 1JB7A 1HA6A 2RHSB 1I5FA 1PRTC 5K36H 2JA6G 2KEDA 3C1FA 1F77A 2CKZB 3I4MG 1L2FA 2YV5A 3PSIA 1LLRD 1DGSA 1IZ6A 4OWTB 4KY7A 5BN3A 5M9OA 5GAHC 5M5XB 1HNWL 2MO0A 3K5NA 4NXML 1YNND 2K33A 1K73C 1B44D 2QDBA 3T1YL 5IGBA 5T1IA 4JI8L 5IGFA 4DR4Q 3MXNA 2E2IB 4HJ9A 2DNEA 1I6HB 4BY7G 5I2XA 5C4XG 4UHVA 5C6AA 3HOZB 1XTCD 4A3DH 1RF2D 2JA5B 3HZXA 1VQOA 3LWEA 3GP7A 4LFBQ 4XQNA 1UNSA 2ZM6Q 1UE7A 2FFKB 4DUZQ 2MJ8A 5AJ3L 1SROA 5M5WH 2JN4A 3RLFA 3V96A 3QJYA 3EFXD 3TS2A 4DV5Q 5CYUA 4AYBG 2QW7A 5IGGA 1CFMA 3FKIB 1ENCA 3H3VC 1AE2A 1T5EA 1D8LA 1H9SB 3SK8A 2ZTDA 4B3ML 1JB3A 1S5ED 3A74A 2UXDL 2IPKD 4DR3Q 3DLLA 3E9IA 1Q1BA 1GUTA 4GKKL 2Z8LA 1TY2A 1QNUA 5C4JH 1B70B 4JOIA 3R2TA 4ZQ3A 2KJXA 3CC7A 3S2DH 2K5QA 3S1QH 1S5CD 1R9TH 1SRUA 1PH8A 3S9WA 3CHBD 3I3CA 1TWCB 2A6HD 4HR7B 3S15B 4NKLA 3K57A 4GN3B 3T53B 3D6WA 3HEJA 4C3HH 2SEBD 3OTOQ 3VYSA 4C2MB 2K1BA 4BA2I 3NELA 5EPJA 1I6VC 4QIWB 3S1NB 1SNCA 5M3MH 4L5QA 5K5PA 3GTOH 2C9OA 1DOLA 1AFPA 3R3OA 1SNQA 4A3JB 2UUAQ 3K80C 1U4LA 4LF6L 5EPKA 5C44G 4OWXB 4BY1H 1NY4A 3LWUA 1JWMD 4DPGA 3KLRA 3VR4A 5IWAQ 2ZM6L 4A3IB 5IT9E 4A3FB 1XXGA 4DF7A 3VR3A 3GTMB 3BZCA 1HR0W 3NBIA 2MO1A 5K36G 4RAUC 3W1GA 3EA6A 1WTQA 1PRTB 3NTHA 1TWGB 1CHPD 1ESFA 1K8GA 1HTPA 1GO3E 1KNAA 4HSVA 3SVMA 2A6EC 4WJWA 3NQIA 2MHVA 1ASYA 2HDLA 2L4NA 3CCVA 3I4OA 5COYA 3S17H 1BUVT 4RCOA 4KLKA 2JA8G 1X3QA 3V2TA 1XPRA 1SNDA 4A3EH 3VYUA 2B63G 4DA2A 1QILA 3DWQA 1JC7A 3TZUA 5FK9C 2JA7H 3URYA 3FVQA 1MBYA 1EQVA 4DV1L 3BVMA 2R92H 2F0UA 1B1ZA 3IL8A 1K83H 3OHXC 3E5SA 5IGEA 2XWJB 3GTKH 1PTOH 1EWIA 5ELCA 3DMUA 3O13A 3H15A 1GOZA 1M4VA 2EYHA 3S15H 5AFWA 2WAQB 1F2YA 2K5NA
chains in the Genus database with same CATH topology
3HOUG 1PH2A 2PI2E 2Q2HA 1JMCA 3GTLH 1IBML 4BXXH 4JBJA 2VQEQ 1EOVA 1JJCB 3RLNA 1RIPA 2KHJA 3GD7A 1UWVA 1I3QH 1KD1C 4QGUA 2VUMG 5GADC 4IFDI 1FGUA 1WCMG 3M3YH 2F52A 4JC0A 4JBMA 4JI0Q 1VQBA 2E2IH 4J15A 4HIDA 4A3KG 3GTPH 1G6PA 1EIYB 1E24A 5JEAG 2R7ZG 1I94Q 2OCEA 5FJ8G 1TWGH 3UDGA 3OW2A 4NPSA 2F4VQ 1LM0A 3CD6A 1Z47A 4P71A 3CPWA 3GTQH 2OQKA 2BH2A 4B3TQ 3D0FA 1EUJA 1KXLA 1HJPA 3PIPA 4DV4Q 3M4QA 1PA6A 4A3FG 1Y1VH 1CUKA 1SFOH 4YCVA 4B3SL 3HKZE 3HOYH 3S1MH 4X6AH 3W1BA 2OQ0A 2FXQA 1IBKQ 4LF8L 2JE6I 1PH1A 4IPGA 3BJUA 4UP7A 5FLXc 4B3RQ 2F3IA 4A3CG 4R4OA 1K9MC 5ELOA 1O7IA 3HOZG 3G71A 1KC8C 3CQZH 1MKHA 1NBWA 4L5TA 4PZ6A 1VQAA 3F1ZA 5C0XI 2WAQG 1A62A 2CCZA 2NVQH 2OWOA 2XGTA 2QA4A 1KAWA 1LTLA 1Q12A 2OTJA 3W5OA 2JJQA 4P73A 3CCJA 3PGZA 3KF8B 2MQHA 1IL2A 1PH7A 4GLVB 4MNOA 4DKAC 4OONA 4YCUA 4Y7NH 4OWWB 1U5KA 1VQNA 5JJLA 1Y1WH 4DR4L 2WB1G 1SN8A 2VNUD 4L5RC 2UXBL 1B7YB 4A3BH 4P74A 5C3EG 4GN4B 4DV2Q 1QUQA 2HIVA 3A5ZB 3I55A 1XMQL 1VQ5A 2WB1E 4DR5Q 5IYCG 3J7ZC 3CF5A 4BBRH 4LFCQ 2CWPA 2N8NA 1KRTA 1V43A 4LFCL 4JI3L 4YY3Q 3TREA 4GLAC 4APVA 5IP7H 4JI5Q 1EYGA 4LUZA 3CXCA 4UY8C 3EIVA 4RMFA 4JOIC 3F2BA 5IYDG 4OXPA 3EBEA 3G48A 1S72A 3H3VI 4QJFA 4C3IH 4PMWA 1X6OA 2WAQE 1VQ8A 4AQYQ 3A5UA 1I6HH 4IO9A 4JI4Q 3IRBA 4JCVE 2R7DA 5M5YH 4HJAA 2BA0A 1VQ4A 3U4VA 1HNXQ 3J7A5 3S14H 4IJLA 2I0QA 4LF9Q 1L1OC 4JI1Q 4BXXG 4GOPB 1G291 4EX5A 4A3IG 4A3MH 4POGA 1UEBA 2JA9A 4XTCS 3CCEA 1IBLQ 2JQOA 3K81C 4WJ4A 1RL2A 3CCSA 5K36G 1L1OB 1VQHA 4LF5Q 4LF6Q 3CCQA 1M90C 1E3PA 4HIKA 4LFAQ 3AEVA 3J81i 3F8TA 1HZBA 1L1OA 1WCMH 3J81c 1SLJA 3L2PA 3NENA 1OXUA 4DK6C 3GTGH 5FLMG 1N36Q 4A3KH 4B3SQ 3KF6A 3CCRA 2C35B 2AHOB 3L7ZC 2K5HA 3M85A 4DR1L 1BKBA 1YITA 2KENA 1C7YA 1TWAH 2WP8J 1S40A 1VCIA 3GDEA 2I5LX 4X66Q 4DV1Q 1GD7A 4BBSH 3KF6B 4DR2Q 4YWKA 2RF4A 4JI7L 1EIFA 3PF5A 2K5VA 1OXXK 4MZ9A 1PYSB 3L0OA 5M3MG 2ALYB 2UU9Q 4JV5Q 5IYBH 1OTCA 3HOWG 1PH3A 1FJGL 2Z6KA 1WI5A 3HOXH 4BBSG 1Q1EA 1YHAA 5C0XG 2VQFQ 1YZ6A 3K7AH 3KDFA 2N3SA 4JV5L 4C3JH 5C44H 4Y52H 1PFSA 2NN6I 2Z6KC 4JBKA 1FVIA 2Q2IA 1VQIA 1C9OA 4R1JA 1WOCA 2ID0A 3TEHB 1N34L 1K8AC 3OYYA 2VQEL 4DV3L 4A3LH 1W3SA 2VZAA 2VL6A 4NB3A 3ULLA 4X64L 4BBRG 2IY5B 2Z0SA 4DV0L 2CQOA 1AE3A 4HIMA 3I7FA 3CMEA 4RG1A 1XNRQ 5ELNA 2VS1A 5IT9c 1VQ9A 1MIUA 4UP9A 4A3DG 3A0JA 4IJHA 2E8GA 1VQ6A 4OO1G 4R4CA 4HJ5A 5LMNW 5BR8Q 1PH5A 4QY7A 1X55A 4X62Q 3OTOL 3PUYA 3G4SA 1Q86C 1BBWA 2KHIA 1X3EA 4ME3A 2L15A 1N33L 2IX1A 4R4TA 5IWAL 4A4IA 4AYBE 1TWCH 3VDYA 1X9NA 5JJIA 2VQFL 1VQDA 3RZDH 1M1KC 4K0KQ 3LGJA 4GOPA 4LFAL 3UE0A 3I4NG 4DNIA 5DLQE 2B63H 2KCMA 5EAYA 3T1YQ 1OXSC 1NMFA 2JK8A 5LMNL 1QZGA 1U0LA 3NEMA 1BBUA 2Q2UA 3UE1A 1GVPA 1IBLL 2JA7G 1Y14B 2NZHA 1XJVA 3FP9A 4YY3L 5GROA 2R6GA 4JI7Q 2R92G 1N8RC 1S3OA 4TVAB 1MJEA 3TRZA 2MNAA 2CWAA 2YTXA 4QIWE 4P75A 4JI4L 4X62L 1VQJA 1Q46A 3J80i 1E1TA 2K4KA 2DUDA 4PZ7A 2LSSA 3RLOA 1QVCA 1X54A 4IPDA 4PG3A 3SGIA 1PH9A 4BY1G 3CC2A 2AWNA 4A3MG 1PV4A 2Q2TA 4R4QA 4MTNA 5FJ8H 4DR6L 1KL9A 1N9WA 4DAMA 5FLMH 3GO5A 4X64Q 5J3BA 1FL0A 3I56A 4DR2L 4O2DA 4DV3Q 4JBWA 3CMAA 1NE3A 2ZJRA 4A3GH 4JYAQ 1A63A 2YTYA 1H95A 1HNXL 2EXDA 3KDFB 3M4OH 1OXVA 4JI1L 3CC4A 2UXCQ 4A3FH 2JA5H 3WWVA 4WJ3M 3CP0A 2A19A 1LUZA 4A3EG 2PQAB 1CKMA 3DM3A 4HIOA 4DV7L 2QGQA 3H0GH 2E2HH 3PV0A 1UE1A 4BY7H 2NN6G 2B29A 4LW1A 2B3GA 3RN5A 4LF4Q 2D0OA 2PQAA 4NXNL 4JI5L 3S2HH 1IBKL 4LF8Q 2K75A 2JA5G 3PF4A 4A3BG 2Y0SE 1GM5A 5C3EH 4JI6Q 1JT8A 1C0AA 4YHHL 4DUYQ 1QVFA 4DR5L 4YHHQ 3RR5A 4DUYL 4DAYB 1YJWA 1HNZQ 3CAMA 2UXDQ 2RHQB 4JI3Q 3PUZA 4DK3C 4IPHA 2D62A 4XIGS 1Y1WG 1WYDA 1JE5A 3PUWA 5IP9H 3HFZB 4DV6Q 2F4VL 4A76A 1NTGA 5C4XH 4H02A 3CCMA 2UUBL 4DV7Q 1KHIA 2A1AA 2NVXH 4LF5L 4LF7Q 1X65A 3K8AA 2UXCL 1N32Q 4KHZA 1PH4A 3UDXA 4DR3L 2LXJA 3GTMH 1J6QA 1IBMQ 4LF9L 4A93G 1EQRA 3ULPA 2LXKA 1T9HA 2R93G 2PMZE 3F2DA 4JG2A 2H5XA 1XMOL 4DV2L 3D31A 2HQLA 3PUXA 2OTLA 4R4IA 2HIXA 3JAMi 4AH6A 3KOJA 5IE8A 4IPCA 2NZOA 4A75A 3JAMc 1YI2A 4NXMQ 1YJNA 1XMOQ 3PO2H 3M9BA 1XNQL 4A93H 3PUVA 4IFDG 2VUMH 1HNWQ 5AJ3Q 1HR0L 1D7QA 4GS3A 2DGYA 1Q81C 1TWFH 5M3FG 2UUCQ 1UE5A 2AMCB 4JYAL 2NVTH 1QVGA 3RN2A 3B6YA 4LFBL 1HH2P 4KHPL 1X56A 4KHPQ 2CFMA 1V1QA 2EQSA 1CSQA 2IHEA 2PI2A 4UPAA 1TWHH 4C2MH 4POFA 4DV4L 4NXNQ 2EIFA 2N49A 1VQFA 5JJKA 4LUOA 1EFWA 2I5MX 1OXTA 3S1RH 2UXBQ 2IX0A 3BZKA 3MEFA 1JB7A 2A8VA 4DV6L 2ZJPA 1E22A 1SMXA 2RHSB 3FHWA 4GLXA 3NBHB 1I5FA 3TS0A 1IXRA 1VQLA 3F2CA 1A0IA 1VQKA 3ER0A 2JA6G 1X3GA 1B8AA 3U4ZA 3ERSX 3STBC 2K52A 2CKZB 3CPFA 3I4MG 1L2FA 2YV5A 1JJ2A 1HNZL 3PSIA 1V9PA 3T1HL 1DGSA 1P8LA 1UE6A 1IZ6A 3MXNB 4OWTB 5GAHC 4B3TL 2RCNA 3HKZG 3G6EA 3HOWH 1Y1VG 3GTJH 2JA6H 4X65Q 2MO0A 4DR6Q 1HNWL 1N32L 4NXML 4TQUS 3KYHC 3TQYA 1K73C 1XPOA 2K14A 3T1YL 2ZJQA 2VW9A 1Q7YC 4JI8L 2HHHQ 4LF4L 3RZOH 4DR4Q 1VS0A 4HJ9A 2AKWB 4BY7G 1WJJA 5IYBG 1I50H 2IT1A 2V1CC 3I2ZA 5LMUL 2N78A 2ASBA 5C4XG 1J5EQ 5HY6A 4A3DH 4JI0L 1E7ZA 2D0PA 1VQOA 1SR3A 2UUCL 3H0GG 4LFBQ 2ZM6Q 1P16A 1UE7A 1QZHA 2KBNA 3PO3H 3E0EA 1CKOA 3KJPA 4DUZQ 4JI2L 5AJ3L 3UDIA 1SROA 2JEBI 5HGQA 1HR0Q 5M5WH 3ICEA 3RLFA 1VQEA 1XNQQ 4LNQA 3TS2A 5IP9G 4DV5Q 3HOZH 1CKNB 4AYBG 3H3VH 4A3JG 2Y0SG 4K0KL 1I94L 1YEZA 3ULJA 1AE2A 2ZTCA 1D8LA 4DV0Q 2BA1A 1N33Q 2ZTDA 4B3ML 3A74A 2UXDL 1VQGA 3AQQA 3EN2A 4DR3Q 4O0AA 2R7FA 2E2JH 2JA8H 1TXYA 3DLLA 3E9IA 1Q1BA 3RNUA 4GKKL 4FDBA 4HJ8A 4B3MQ 5C4JH 2UU9L 1B70B 4PZ8A 5BR8L 1KIXA 4JOIA 2JEAI 4EQ5A 4OX9Q 3CC7A 1SE8A 3S2DH 1X3FA 1HZAA 3S1QH 1R9TH 4GKJL 1SRUA 2VY3A 3BU2A 5M5XH 1PH8A 2AWOA 3PO2G 3ZJYC 3E9HA 4GNXA 2R93H 3CCUA 4GN3B 2MFIA 2R7ZH 4C3HH 1EQQA 1PVOA 3OTOQ 3PCOB 3J80c 5JEAJ 4JI6L 1K0RA 2XTIA 3CW2C 4GN5A 2KCTA 5C0XJ 1N36L 4BA2I 3NELA 3M7NA 2PNHA 3K0XA 5M3MH 5M3FH 4L5QA 5LMUQ 2YU9H 4DR7L 1WFQA 4P72A 3AFPA 3STBD 1PHJA 3GTOH 4BA1I 3JC66 1YJ9A 2E5LL 1XTDA 3HOXG 4OX9L 2UUAQ 3K80C 4LF6L 1PYBA 2GVBA 3HOYG 5C44G 4OWXB 4X65L 1NY4A 1VQCA 4BY1H 1XNRL 4IOAA 4A3IH 1G51A 2YYZA 4DPGA 2YTVA 1YIJA 4AIMA 2QEXA 5IWAQ 2ZM6L 3I4MH 5H1SE 1NMGA 1N34Q 1JJGA 5GQOA 3BZCA 1A8VA 4QL5A 1HR0W 2MO1A 1KRSA 2K50A 2WFWA 3KLWA 3W1GA 4ALPA 1J5EL 1HZCA 1VQ7A 4KI0A 1YHQA 4A3GG 2ZTEA 3HOVH 4QQBX 1IYJB 5LMNQ 1Q82C 1K3RA 2HHHL 1XPUA 4YWMA 4GKJQ 1K8GA 5GAEC 3Q8DA 1LYLA 2ATWA 4DR7Q 4IOCA 1GO3E 3S24A 4YWLA 1ASYA 2ES2A 1CKNA 3HOVG 3T1HQ 4IFDJ 3CCVA 3I4OA 3AFQA 4GKKQ 4HJ7A 3CCLA 1HZ9A 2IHFA 5E7NA 3S17H 1YHBA 4KLKA 1XMQQ 4A3CH 4DR1Q 1ASZA 2JA8G 3S16H 2HT1A 4A3LG 4OO1I 3M4PA 1XPRA 1VQPA 1CSPA 4A3EH 5IY0A 1MJCA 4YCWA 3KFUA 3U50C 2B63G 2I5HA 3PO3G 3UDFA 1E1OA 4UP8A 1PH6A 3FKIG 4B3RL 3HKSA 1YVCA 4JI2Q 3KJOA 1GKHA 2JA7H 5IYCH 1VQMA 1AH9A 2R92H 4X66L 4DV1L 4DUZL 1BVSA 4GNXC 1K83H 4A3JH 5IP7G 1YBYA 3J81j 4GNXB 1Z9FA 4GOPC 1W2BA 3GTKH 3FKIH 1Q8KA 1NJIC 1YNXA 5IYDH 2UUAL 2NVYH 4LF7L 3HOUH 3K7UC 1EWIA 1QUQB 3S1NH 3PIOA 3H15A 2E5LQ 2GVAA 4LWCA 4L5SA 1FJGQ 3AYHB 2GN5A 4AQYL 3U58A 2UUBQ 3S15H 4JI8Q 5GAGC 4DV5L 3I4NH 2BH8A 4LUVA 1L0WA 1KQSA 2K5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU G;  1PH2 A;  2PI2 E;  2Q2H A;  1JMC A;  3GTL H;  1IBM L;  4BXX H;  4JBJ A;  2VQE Q;  1EOV A;  1JJC B;  3RLN A;  1RIP A;  2KHJ A;  3GD7 A;  1UWV A;  1I3Q H;  1KD1 C;  4QGU A;  2VUM G;  5GAD C;  4IFD I;  1FGU A;  1WCM G;  3M3Y H;  2F52 A;  4JC0 A;  4JBM A;  4JI0 Q;  1VQB A;  2E2I H;  4J15 A;  4HID A;  4A3K G;  3GTP H;  1G6P A;  1EIY B;  1E24 A;  5JEA G;  2R7Z G;  1I94 Q;  2OCE A;  5FJ8 G;  1TWG H;  3UDG A;  3OW2 A;  4NPS A;  2F4V Q;  1LM0 A;  3CD6 A;  1Z47 A;  4P71 A;  3CPW A;  3GTQ H;  2OQK A;  2BH2 A;  4B3T Q;  3D0F A;  1EUJ A;  1KXL A;  1HJP A;  3PIP A;  4DV4 Q;  3M4Q A;  1PA6 A;  4A3F G;  1Y1V H;  1CUK A;  1SFO H;  4YCV A;  4B3S L;  3HKZ E;  3HOY H;  3S1M H;  4X6A H;  3W1B A;  2OQ0 A;  2FXQ A;  1IBK Q;  4LF8 L;  2JE6 I;  1PH1 A;  4IPG A;  3BJU A;  4UP7 A;  5FLX c;  4B3R Q;  2F3I A;  4A3C G;  4R4O A;  1K9M C;  5ELO A;  1O7I A;  3HOZ G;  3G71 A;  1KC8 C;  3CQZ H;  1MKH A;  1NBW A;  4L5T A;  4PZ6 A;  1VQA A;  3F1Z A;  5C0X I;  2WAQ G;  1A62 A;  2CCZ A;  2NVQ H;  2OWO A;  2XGT A;  2QA4 A;  1KAW A;  1LTL A;  1Q12 A;  2OTJ A;  3W5O A;  2JJQ A;  4P73 A;  3CCJ A;  3PGZ A;  3KF8 B;  2MQH A;  1IL2 A;  1PH7 A;  4GLV B;  4MNO A;  4DKA C;  4OON A;  4YCU A;  4Y7N H;  4OWW B;  1U5K A;  1VQN A;  5JJL A;  1Y1W H;  4DR4 L;  2WB1 G;  1SN8 A;  2VNU D;  4L5R C;  2UXB L;  1B7Y B;  4A3B H;  4P74 A;  5C3E G;  4GN4 B;  4DV2 Q;  1QUQ A;  2HIV A;  3A5Z B;  3I55 A;  1XMQ L;  1VQ5 A;  2WB1 E;  4DR5 Q;  5IYC G;  3J7Z C;  3CF5 A;  4BBR H;  4LFC Q;  2CWP A;  2N8N A;  1KRT A;  1V43 A;  4LFC L;  4JI3 L;  4YY3 Q;  3TRE A;  4GLA C;  4APV A;  5IP7 H;  4JI5 Q;  1EYG A;  4LUZ A;  3CXC A;  4UY8 C;  3EIV A;  4RMF A;  4JOI C;  3F2B A;  5IYD G;  4OXP A;  3EBE A;  3G48 A;  1S72 A;  3H3V I;  4QJF A;  4C3I H;  4PMW A;  1X6O A;  2WAQ E;  1VQ8 A;  4AQY Q;  3A5U A;  1I6H H;  4IO9 A;  4JI4 Q;  3IRB A;  4JCV E;  2R7D A;  5M5Y H;  4HJA A;  2BA0 A;  1VQ4 A;  3U4V A;  1HNX Q;  3J7A 5;  3S14 H;  4IJL A;  2I0Q A;  4LF9 Q;  1L1O C;  4JI1 Q;  4BXX G;  4GOP B;  1G29 1;  4EX5 A;  4A3I G;  4A3M H;  4POG A;  1UEB A;  2JA9 A;  4XTC S;  3CCE A;  1IBL Q;  2JQO A;  3K81 C;  4WJ4 A;  1RL2 A;  3CCS A;  5K36 G;  1L1O B;  1VQH A;  4LF5 Q;  4LF6 Q;  3CCQ A;  1M90 C;  1E3P A;  4HIK A;  4LFA Q;  3AEV A;  3J81 i;  3F8T A;  1HZB A;  1L1O A;  1WCM H;  3J81 c;  1SLJ A;  3L2P A;  3NEN A;  1OXU A;  4DK6 C;  3GTG H;  5FLM G;  1N36 Q;  4A3K H;  4B3S Q;  3KF6 A;  3CCR A;  2C35 B;  2AHO B;  3L7Z C;  2K5H A;  3M85 A;  4DR1 L;  1BKB A;  1YIT A;  2KEN A;  1C7Y A;  1TWA H;  2WP8 J;  1S40 A;  1VCI A;  3GDE A;  2I5L X;  4X66 Q;  4DV1 Q;  1GD7 A;  4BBS H;  3KF6 B;  4DR2 Q;  4YWK A;  2RF4 A;  4JI7 L;  1EIF A;  3PF5 A;  2K5V A;  1OXX K;  4MZ9 A;  1PYS B;  3L0O A;  5M3M G;  2ALY B;  2UU9 Q;  4JV5 Q;  5IYB H;  1OTC A;  3HOW G;  1PH3 A;  1FJG L;  2Z6K A;  1WI5 A;  3HOX H;  4BBS G;  1Q1E A;  1YHA A;  5C0X G;  2VQF Q;  1YZ6 A;  3K7A H;  3KDF A;  2N3S A;  4JV5 L;  4C3J H;  5C44 H;  4Y52 H;  1PFS A;  2NN6 I;  2Z6K C;  4JBK A;  1FVI A;  2Q2I A;  1VQI A;  1C9O A;  4R1J A;  1WOC A;  2ID0 A;  3TEH B;  1N34 L;  1K8A C;  3OYY A;  2VQE L;  4DV3 L;  4A3L H;  1W3S A;  2VZA A;  2VL6 A;  4NB3 A;  3ULL A;  4X64 L;  4BBR G;  2IY5 B;  2Z0S A;  4DV0 L;  2CQO A;  1AE3 A;  4HIM A;  3I7F A;  3CME A;  4RG1 A;  1XNR Q;  5ELN A;  2VS1 A;  5IT9 c;  1VQ9 A;  1MIU A;  4UP9 A;  4A3D G;  3A0J A;  4IJH A;  2E8G A;  1VQ6 A;  4OO1 G;  4R4C A;  4HJ5 A;  5LMN W;  5BR8 Q;  1PH5 A;  4QY7 A;  1X55 A;  4X62 Q;  3OTO L;  3PUY A;  3G4S A;  1Q86 C;  1BBW A;  2KHI A;  1X3E A;  4ME3 A;  2L15 A;  1N33 L;  2IX1 A;  4R4T A;  5IWA L;  4A4I A;  4AYB E;  1TWC H;  3VDY A;  1X9N A;  5JJI A;  2VQF L;  1VQD A;  3RZD H;  1M1K C;  4K0K Q;  3LGJ A;  4GOP A;  4LFA L;  3UE0 A;  3I4N G;  4DNI A;  5DLQ E;  2B63 H;  2KCM A;  5EAY A;  3T1Y Q;  1OXS C;  1NMF A;  2JK8 A;  5LMN L;  1QZG A;  1U0L A;  3NEM A;  1BBU A;  2Q2U A;  3UE1 A;  1GVP A;  1IBL L;  2JA7 G;  1Y14 B;  2NZH A;  1XJV A;  3FP9 A;  4YY3 L;  5GRO A;  2R6G A;  4JI7 Q;  2R92 G;  1N8R C;  1S3O A;  4TVA B;  1MJE A;  3TRZ A;  2MNA A;  2CWA A;  2YTX A;  4QIW E;  4P75 A;  4JI4 L;  4X62 L;  1VQJ A;  1Q46 A;  3J80 i;  1E1T A;  2K4K A;  2DUD A;  4PZ7 A;  2LSS A;  3RLO A;  1QVC A;  1X54 A;  4IPD A;  4PG3 A;  3SGI A;  1PH9 A;  4BY1 G;  3CC2 A;  2AWN A;  4A3M G;  1PV4 A;  2Q2T A;  4R4Q A;  4MTN A;  5FJ8 H;  4DR6 L;  1KL9 A;  1N9W A;  4DAM A;  5FLM H;  3GO5 A;  4X64 Q;  5J3B A;  1FL0 A;  3I56 A;  4DR2 L;  4O2D A;  4DV3 Q;  4JBW A;  3CMA A;  1NE3 A;  2ZJR A;  4A3G H;  4JYA Q;  1A63 A;  2YTY A;  1H95 A;  1HNX L;  2EXD A;  3KDF B;  3M4O H;  1OXV A;  4JI1 L;  3CC4 A;  2UXC Q;  4A3F H;  2JA5 H;  3WWV A;  4WJ3 M;  3CP0 A;  2A19 A;  1LUZ A;  4A3E G;  2PQA B;  1CKM A;  3DM3 A;  4HIO A;  4DV7 L;  2QGQ A;  3H0G H;  2E2H H;  3PV0 A;  1UE1 A;  4BY7 H;  2NN6 G;  2B29 A;  4LW1 A;  2B3G A;  3RN5 A;  4LF4 Q;  2D0O A;  2PQA A;  4NXN L;  4JI5 L;  3S2H H;  1IBK L;  4LF8 Q;  2K75 A;  2JA5 G;  3PF4 A;  4A3B G;  2Y0S E;  1GM5 A;  5C3E H;  4JI6 Q;  1JT8 A;  1C0A A;  4YHH L;  4DUY Q;  1QVF A;  4DR5 L;  4YHH Q;  3RR5 A;  4DUY L;  4DAY B;  1YJW A;  1HNZ Q;  3CAM A;  2UXD Q;  2RHQ B;  4JI3 Q;  3PUZ A;  4DK3 C;  4IPH A;  2D62 A;  4XIG S;  1Y1W G;  1WYD A;  1JE5 A;  3PUW A;  5IP9 H;  3HFZ B;  4DV6 Q;  2F4V L;  4A76 A;  1NTG A;  5C4X H;  4H02 A;  3CCM A;  2UUB L;  4DV7 Q;  1KHI A;  2A1A A;  2NVX H;  4LF5 L;  4LF7 Q;  1X65 A;  3K8A A;  2UXC L;  1N32 Q;  4KHZ A;  1PH4 A;  3UDX A;  4DR3 L;  2LXJ A;  3GTM H;  1J6Q A;  1IBM Q;  4LF9 L;  4A93 G;  1EQR A;  3ULP A;  2LXK A;  1T9H A;  2R93 G;  2PMZ E;  3F2D A;  4JG2 A;  2H5X A;  1XMO L;  4DV2 L;  3D31 A;  2HQL A;  3PUX A;  2OTL A;  4R4I A;  2HIX A;  3JAM i;  4AH6 A;  3KOJ A;  5IE8 A;  4IPC A;  2NZO A;  4A75 A;  3JAM c;  1YI2 A;  4NXM Q;  1YJN A;  1XMO Q;  3PO2 H;  3M9B A;  1XNQ L;  4A93 H;  3PUV A;  4IFD G;  2VUM H;  1HNW Q;  5AJ3 Q;  1HR0 L;  1D7Q A;  4GS3 A;  2DGY A;  1Q81 C;  1TWF H;  5M3F G;  2UUC Q;  1UE5 A;  2AMC B;  4JYA L;  2NVT H;  1QVG A;  3RN2 A;  3B6Y A;  4LFB L;  1HH2 P;  4KHP L;  1X56 A;  4KHP Q;  2CFM A;  1V1Q A;  2EQS A;  1CSQ A;  2IHE A;  2PI2 A;  4UPA A;  1TWH H;  4C2M H;  4POF A;  4DV4 L;  4NXN Q;  2EIF A;  2N49 A;  1VQF A;  5JJK A;  4LUO A;  1EFW A;  2I5M X;  1OXT A;  3S1R H;  2UXB Q;  2IX0 A;  3BZK A;  3MEF A;  1JB7 A;  2A8V A;  4DV6 L;  2ZJP A;  1E22 A;  1SMX A;  2RHS B;  3FHW A;  4GLX A;  3NBH B;  1I5F A;  3TS0 A;  1IXR A;  1VQL A;  3F2C A;  1A0I A;  1VQK A;  3ER0 A;  2JA6 G;  1X3G A;  1B8A A;  3U4Z A;  3ERS X;  3STB C;  2K52 A;  2CKZ B;  3CPF A;  3I4M G;  1L2F A;  2YV5 A;  1JJ2 A;  1HNZ L;  3PSI A;  1V9P A;  3T1H L;  1DGS A;  1P8L A;  1UE6 A;  1IZ6 A;  3MXN B;  4OWT B;  5GAH C;  4B3T L;  2RCN A;  3HKZ G;  3G6E A;  3HOW H;  1Y1V G;  3GTJ H;  2JA6 H;  4X65 Q;  2MO0 A;  4DR6 Q;  1HNW L;  1N32 L;  4NXM L;  4TQU S;  3KYH C;  3TQY A;  1K73 C;  1XPO A;  2K14 A;  3T1Y L;  2ZJQ A;  2VW9 A;  1Q7Y C;  4JI8 L;  2HHH Q;  4LF4 L;  3RZO H;  4DR4 Q;  1VS0 A;  4HJ9 A;  2AKW B;  4BY7 G;  1WJJ A;  5IYB G;  1I50 H;  2IT1 A;  2V1C C;  3I2Z A;  5LMU L;  2N78 A;  2ASB A;  5C4X G;  1J5E Q;  5HY6 A;  4A3D H;  4JI0 L;  1E7Z A;  2D0P A;  1VQO A;  1SR3 A;  2UUC L;  3H0G G;  4LFB Q;  2ZM6 Q;  1P16 A;  1UE7 A;  1QZH A;  2KBN A;  3PO3 H;  3E0E A;  1CKO A;  3KJP A;  4DUZ Q;  4JI2 L;  5AJ3 L;  3UDI A;  1SRO A;  2JEB I;  5HGQ A;  1HR0 Q;  5M5W H;  3ICE A;  3RLF A;  1VQE A;  1XNQ Q;  4LNQ A;  3TS2 A;  5IP9 G;  4DV5 Q;  3HOZ H;  1CKN B;  4AYB G;  3H3V H;  4A3J G;  2Y0S G;  4K0K L;  1I94 L;  1YEZ A;  3ULJ A;  1AE2 A;  2ZTC A;  1D8L A;  4DV0 Q;  2BA1 A;  1N33 Q;  2ZTD A;  4B3M L;  3A74 A;  2UXD L;  1VQG A;  3AQQ A;  3EN2 A;  4DR3 Q;  4O0A A;  2R7F A;  2E2J H;  2JA8 H;  1TXY A;  3DLL A;  3E9I A;  1Q1B A;  3RNU A;  4GKK L;  4FDB A;  4HJ8 A;  4B3M Q;  5C4J H;  2UU9 L;  1B70 B;  4PZ8 A;  5BR8 L;  1KIX A;  4JOI A;  2JEA I;  4EQ5 A;  4OX9 Q;  3CC7 A;  1SE8 A;  3S2D H;  1X3F A;  1HZA A;  3S1Q H;  1R9T H;  4GKJ L;  1SRU A;  2VY3 A;  3BU2 A;  5M5X H;  1PH8 A;  2AWO A;  3PO2 G;  3ZJY C;  3E9H A;  4GNX A;  2R93 H;  3CCU A;  4GN3 B;  2MFI A;  2R7Z H;  4C3H H;  1EQQ A;  1PVO A;  3OTO Q;  3PCO B;  3J80 c;  5JEA J;  4JI6 L;  1K0R A;  2XTI A;  3CW2 C;  4GN5 A;  2KCT A;  5C0X J;  1N36 L;  4BA2 I;  3NEL A;  3M7N A;  2PNH A;  3K0X A;  5M3M H;  5M3F H;  4L5Q A;  5LMU Q;  2YU9 H;  4DR7 L;  1WFQ A;  4P72 A;  3AFP A;  3STB D;  1PHJ A;  3GTO H;  4BA1 I;  3JC6 6;  1YJ9 A;  2E5L L;  1XTD A;  3HOX G;  4OX9 L;  2UUA Q;  3K80 C;  4LF6 L;  1PYB A;  2GVB A;  3HOY G;  5C44 G;  4OWX B;  4X65 L;  1NY4 A;  1VQC A;  4BY1 H;  1XNR L;  4IOA A;  4A3I H;  1G51 A;  2YYZ A;  4DPG A;  2YTV A;  1YIJ A;  4AIM A;  2QEX A;  5IWA Q;  2ZM6 L;  3I4M H;  5H1S E;  1NMG A;  1N34 Q;  1JJG A;  5GQO A;  3BZC A;  1A8V A;  4QL5 A;  1HR0 W;  2MO1 A;  1KRS A;  2K50 A;  2WFW A;  3KLW A;  3W1G A;  4ALP A;  1J5E L;  1HZC A;  1VQ7 A;  4KI0 A;  1YHQ A;  4A3G G;  2ZTE A;  3HOV H;  4QQB X;  1IYJ B;  5LMN Q;  1Q82 C;  1K3R A;  2HHH L;  1XPU A;  4YWM A;  4GKJ Q;  1K8G A;  5GAE C;  3Q8D A;  1LYL A;  2ATW A;  4DR7 Q;  4IOC A;  1GO3 E;  3S24 A;  4YWL A;  1ASY A;  2ES2 A;  1CKN A;  3HOV G;  3T1H Q;  4IFD J;  3CCV A;  3I4O A;  3AFQ A;  4GKK Q;  4HJ7 A;  3CCL A;  1HZ9 A;  2IHF A;  5E7N A;  3S17 H;  1YHB A;  4KLK A;  1XMQ Q;  4A3C H;  4DR1 Q;  1ASZ A;  2JA8 G;  3S16 H;  2HT1 A;  4A3L G;  4OO1 I;  3M4P A;  1XPR A;  1VQP A;  1CSP A;  4A3E H;  5IY0 A;  1MJC A;  4YCW A;  3KFU A;  3U50 C;  2B63 G;  2I5H A;  3PO3 G;  3UDF A;  1E1O A;  4UP8 A;  1PH6 A;  3FKI G;  4B3R L;  3HKS A;  1YVC A;  4JI2 Q;  3KJO A;  1GKH A;  2JA7 H;  5IYC H;  1VQM A;  1AH9 A;  2R92 H;  4X66 L;  4DV1 L;  4DUZ L;  1BVS A;  4GNX C;  1K83 H;  4A3J H;  5IP7 G;  1YBY A;  3J81 j;  4GNX B;  1Z9F A;  4GOP C;  1W2B A;  3GTK H;  3FKI H;  1Q8K A;  1NJI C;  1YNX A;  5IYD H;  2UUA L;  2NVY H;  4LF7 L;  3HOU H;  3K7U C;  1EWI A;  1QUQ B;  3S1N H;  3PIO A;  3H15 A;  2E5L Q;  2GVA A;  4LWC A;  4L5S A;  1FJG Q;  3AYH B;  2GN5 A;  4AQY L;  3U58 A;  2UUB Q;  3S15 H;  4JI8 Q;  5GAG C;  4DV5 L;  3I4N H;  2BH8 A;  4LUV A;  1L0W A;  1KQS A;  2K5N A; 
#chains in the Genus database with same CATH topology
 5IGC A;  1IBM L;  5HUR A;  2VUM G;  1BXT A;  1LAC A;  3GD7 A;  3KBX A;  3T13 A;  2NVX B;  2X6L A;  3OIQ A;  1FGU A;  4C56 C;  1LTT D;  4JI0 Q;  5KIX A;  2BDN A;  3RZO B;  3W3A A;  2ICE C;  1PTO D;  3IFD A;  1SE2 A;  1HUM A;  1Z47 A;  4P71 A;  2PZW A;  3NTK A;  2OQK A;  4O1N A;  1PZJ D;  3PIP A;  4DV4 Q;  3M4Q A;  1PA6 A;  3BYY B;  5D65 A;  3NE5 B;  1SFO H;  5C4Z A;  4LF8 L;  2OEO A;  1PH1 A;  3T16 A;  1K9M C;  1NR4 A;  1WD0 A;  1VQA A;  3F1Z A;  5C0X I;  1EEI D;  3VR6 A;  2A69 C;  2B2T A;  3CCJ A;  1LTA D;  3KF8 B;  2MQH A;  4YCU A;  1WTH A;  5KNC A;  4H44 C;  1VQN A;  5JJL A;  3P7J A;  2WB1 G;  1TS4 A;  4L5R C;  4DV2 Q;  1K3B C;  1SDF A;  1STY A;  2HIV A;  3A5Z B;  3I55 A;  1VQ5 A;  3CF5 A;  2FHT A;  4TSS A;  4LFC Q;  1V43 A;  4YY3 Q;  3TRE A;  3Q23 A;  2CW0 D;  2PMZ B;  4UY8 C;  1DJR D;  4IUR A;  4JOI C;  4B08 A;  3F2B A;  4OXP A;  3EBE A;  3H3V I;  1SYG A;  3TP5 A;  2WAQ E;  3S1M B;  4IO9 A;  1DOK A;  1K8O A;  4JI4 Q;  3GTK B;  3OMC A;  5M5Y H;  4HJA A;  2BA0 A;  2HUG A;  1YNJ D;  2I0Q A;  5BN5 A;  4LF9 Q;  2LMC B;  4BXX G;  1G29 1;  4ABN A;  2O5J C;  3CKI B;  1RL2 A;  2NTS A;  4YIJ A;  1E3P A;  3BZD B;  3AEV A;  3MEH A;  3F8T A;  1J8I A;  3NEN A;  1N36 Q;  2K5H A;  1MSH A;  2F0G A;  4DR1 L;  1EY6 A;  5I6Y A;  1YIT A;  2KEN A;  2F0Q A;  5JAV A;  1G91 A;  2I5L X;  4DV1 Q;  3KF6 B;  2EYJ A;  3MXG A;  1H9R A;  4V19 0;  4KKS A;  2F3V A;  2B2U A;  3DWP A;  3F2U A;  4CHT B;  3FMC A;  1PH3 A;  2Z6K A;  5FO8 B;  3T56 B;  2VQF Q;  3J7Y W;  3KDF A;  4ZRZ A;  1C9O A;  4R1J A;  2VQE L;  3NHH A;  3MXP A;  4S3S A;  4NB3 A;  4BBR G;  2IY5 B;  4DV0 L;  2J7Z A;  1KAA A;  1AE3 A;  2A74 C;  3CRL C;  1XNR Q;  1H9J A;  4R4C A;  2F0I A;  1SE4 A;  3TME A;  3OTO L;  3G4S A;  2AUK A;  5EGT A;  1X3E A;  2L15 A;  1L0Y B;  4R4T A;  4AYB E;  1TWC H;  4KKU A;  3DM1 A;  3C2P A;  1VQD A;  3EVQ A;  1M1K C;  5FLX E;  4GOP A;  1CT1 D;  2G9H D;  1ZEQ X;  4J1M A;  4DNI A;  4QCL A;  2G5D A;  5EKI A;  1NMF A;  5LMN L;  1QZG A;  3UE1 A;  1GVP A;  1EZ6 A;  4FXG C;  1S3O A;  4TVA B;  2RKS A;  1MJE A;  2J0T D;  3TRZ A;  2F03 A;  4K5X A;  2VXW A;  4HAE A;  4JI4 L;  1FGB D;  2X6G A;  1IYV A;  4KMU C;  3SGI A;  1F2Z A;  1HPC A;  2OF1 A;  1HFG A;  4MTN A;  5FJ8 H;  2ZXR A;  2D2C C;  5FLM H;  4X64 Q;  1FL0 A;  1A3T A;  1CI3 M;  1QWY A;  3CMA A;  1GUN A;  2ZJR A;  2EXD A;  1WCM B;  1YNN C;  1O7Z A;  3M4O H;  2PO4 A;  5C4H A;  4FNF A;  1CKM A;  1ONL A;  2WV6 D;  2EPB A;  2NN6 G;  4LW1 A;  2D0O A;  1KLU D;  4NXN L;  4JI5 L;  1IBK L;  2K75 A;  2JA5 G;  1LO5 D;  1A6X A;  1GM5 A;  1C0A A;  3E3X A;  4WOR A;  5A35 A;  1DCZ A;  4YHH L;  4DUY L;  2B39 A;  2UXD Q;  2KCC A;  4JI3 Q;  2B2V A;  3PUZ A;  2H1E A;  1WYD A;  3U9O A;  1GXD C;  5DM7 3;  5IP9 H;  3HFZ B;  2F4V L;  5C4X H;  4H02 A;  4E6I A;  4DV7 Q;  1B53 A;  3HP3 A;  4L63 B;  2B8F A;  2IL8 A;  4I7A A;  2IJ0 A;  3A56 A;  3MVV A;  3GTM H;  1JOR A;  3MAQ A;  5E4W C;  2E2D C;  4A93 G;  2LXK A;  3G6J B;  1STN A;  4TRD A;  2EDG A;  5KRU A;  4DV2 L;  2F0K A;  1PFN A;  2OTL A;  4BY1 B;  4A75 A;  1BCP C;  3KOJ A;  4IPC A;  1YI2 A;  1XWE A;  2L9H A;  3JAM c;  1YJN A;  2KUM A;  3M9B A;  1IW7 D;  4C1N K;  1HNW Q;  2G9D A;  1HR0 L;  5M3F G;  1K28 A;  2AMC B;  1QVG A;  1X56 A;  1B3A A;  1V1Q A;  2EQS A;  2PI2 A;  4UPA A;  4C2M H;  4DV4 L;  2EIF A;  4H0L C;  2XRS D;  2QCP X;  5JJK A;  5CC4 A;  1EFW A;  3S1R H;  3BZK A;  1DON A;  2RQX A;  3FHW A;  1I4G A;  1ESR A;  1VQL A;  2NVT B;  4DK0 A;  2AQ3 B;  2F0E A;  3ERS X;  2K52 A;  3A8I E;  5J22 A;  1G2T A;  1JJ2 A;  4FF2 A;  4WRD A;  3T1H L;  1UE6 A;  3D3R A;  2RCN A;  3HKZ G;  1N32 L;  2PCF B;  1Y1V G;  2AQ2 B;  4TQU S;  3KYH C;  1XPO A;  1Q7Y C;  2HHH Q;  3SXH A;  4RGM A;  4EQN A;  4QUC A;  5JOB A;  2AKW B;  3I90 A;  5IYB G;  1I50 H;  2V1C C;  2N78 A;  1J5E Q;  4JI0 L;  5ELD A;  1E7Z A;  2D0P A;  4KV6 A;  3FEW X;  1SR3 A;  3ITP A;  1PRT F;  2KBN A;  1GUS A;  4XYQ A;  2BCO A;  3NK9 A;  2JEB I;  3UDI A;  5HGQ A;  5EKK A;  1XNQ Q;  4CKB A;  4LNQ A;  5JVG 3;  3HOZ H;  2K03 A;  4A3J G;  2Y0S G;  5KND A;  3TP6 A;  4DV0 Q;  1R9T B;  3PMF A;  4IFD H;  2QDL A;  1EZ8 A;  3NPP A;  2JA8 H;  3GTP B;  1O7L A;  4FDB A;  1EEF D;  1EY0 A;  2UU9 L;  4UDU C;  2XNA C;  4EQ5 A;  1X3F A;  1HZA A;  3OIP A;  3BU2 A;  5CV6 A;  1PMR A;  3PO2 G;  4A3M B;  1JIC A;  2DNC A;  1HCZ A;  1D1I A;  1TII D;  5C4X B;  2MFI A;  2Q8T A;  1ZXT A;  2SNS A;  4IUU A;  5EBD A;  1K0R A;  2XN9 C;  2KCT A;  4C1N I;  5C0X J;  3M7N A;  4CJ0 B;  2BE5 C;  2F0N A;  3K0X A;  4L6T B;  5M3F H;  5LMU Q;  4R8N A;  2PNR C;  1YJ9 A;  3MFG A;  3TDQ A;  1EFI D;  1PYB A;  2K05 A;  4C3J G;  2R61 A;  1XNR L;  3LNN A;  2QEX A;  5H1S E;  1NMG A;  1JJG A;  2VUM B;  3SR1 A;  3K7A B;  1VF7 A;  2RDF A;  2K50 A;  1J5E L;  1VQ7 A;  3J80 L;  4ALP A;  4KI0 A;  1YHQ A;  4IUN A;  1QOH A;  2HHH L;  2N88 A;  4YWM A;  3EJI A;  4J6H A;  1LYL A;  4YWL A;  1CKN A;  5I9O A;  1SE3 A;  1F9S A;  4RCN A;  4GKK Q;  4OL7 A;  1R4P B;  4HJ7 A;  1HZ9 A;  1HQR D;  2IHF A;  3TP8 A;  1YHB A;  1G6Z A;  3BVZ A;  5KGU A;  4DR1 Q;  1FNU A;  4A3L G;  1PZI D;  2PZT A;  1RCV D;  1VQP A;  1E2W A;  1KTK A;  4YCW A;  3I72 A;  3U50 C;  1BQQ T;  2SOB A;  2I5H A;  3VYT A;  4UP8 A;  1PH6 A;  1LTI D;  5DAU A;  2PYK A;  3HKS A;  4JI2 Q;  5IYC H;  2R92 B;  4X66 L;  4GNX C;  1BVS A;  4ME5 A;  4A3J H;  3J81 j;  4GNX B;  1I4X A;  5BN4 A;  5IYD H;  4NMZ A;  1QUQ B;  4C3I G;  3S1N H;  4L5S A;  4LWC A;  1FJG Q;  3PIP 3;  1M8A A;  2Q8R E;  2A6H C;  4JI8 Q;  4DV5 L;  3KLS X;  1RHP A;  4LUV A;  1KQS A;  2UU9 Q;  1KDA A;  3VYR A;  1PH2 A;  2Q2H A;  3GTL H;  4JBJ A;  2VQE Q;  5I4D A;  1RIP A;  3BYT B;  4IFD I;  1I4R A;  1WCM G;  3X3N A;  2F52 A;  1LTG D;  4JBM A;  2ENB A;  5EBC A;  1SYC A;  4HID A;  2CHB D;  1EIY B;  1E24 A;  4N8X 1;  3UDG A;  1TWG H;  3OW2 A;  2A5H A;  4NPS A;  1LM0 A;  4DGZ A;  2F4I A;  3SK5 A;  3A8K E;  4IZ8 A;  1Y1V H;  2VB2 X;  1CUK A;  1ML0 D;  4YCV A;  3W1B A;  2FXQ A;  4PQX A;  3P20 A;  2JE6 I;  4A3G B;  4IPG A;  5JPN C;  4B3R Q;  4IUP A;  3M4O B;  4OEM B;  1O7I A;  3QG1 A;  1NCV A;  3HOZ G;  3OWF A;  1MKH A;  1NBW A;  2JYO A;  2NVQ H;  2OWO A;  2XGT A;  2QA4 A;  1Q12 A;  1KAW A;  2RCF A;  2OTJ A;  1GUO A;  2PPB C;  5LHY 1;  1SYB A;  2JJQ A;  2D9U A;  1AW7 A;  2KOL A;  3IFT A;  4MHE A;  1MI2 A;  4OO1 H;  1IL2 A;  2FMC A;  4CDD C;  4GLV B;  4OWW B;  1CQV A;  1CHQ D;  1EYA A;  2IW3 A;  2KHS A;  3HOX B;  2UXB L;  5C3E G;  4DFA A;  3E6Z X;  4XDX A;  4NP5 A;  4DR5 Q;  1SYE A;  3ND8 A;  4BBR H;  3E0J A;  2N8N A;  2NB0 A;  1ZYR C;  3I70 A;  4APV A;  4KY6 A;  5IP7 H;  4LUZ A;  3CXC A;  3EIV A;  4RMF A;  5CBA E;  3NWT A;  3G48 A;  4QJF A;  3TN2 A;  2MP1 A;  4PMW A;  2RA4 A;  2NBF A;  3NWS A;  4AQY Q;  2EJM A;  3J7A 5;  1QB5 D;  1PTO B;  4JI1 Q;  3GTJ B;  1QG7 A;  2E76 C;  4GOP B;  4A93 B;  2L0C A;  3IKJ A;  1UEB A;  2WII B;  1HTL D;  2DJF C;  4LF6 Q;  5IOC A;  5CBE E;  1D2B A;  4ZYS A;  1WCM H;  3DEP A;  3AU7 A;  3CCR A;  2C35 B;  2AHO B;  2QKI C;  4C3H G;  1BKB A;  2FIN B;  1HQM C;  3S17 B;  1C7Y A;  2WP8 J;  1S40 A;  3GDE A;  4X66 Q;  3CRK C;  4YWK A;  4H13 C;  1B50 A;  3GV6 A;  2K5V A;  5M3M G;  4JV5 Q;  3L0O A;  4DNT B;  3HOW G;  1FJG L;  4ZAI A;  3MC0 B;  4BBS G;  1Q1E A;  1YHA A;  1YZ6 A;  1FNV A;  5C44 H;  2L5T A;  2Z6K C;  1FVI A;  1WOC A;  2F0L A;  2ID0 A;  1VMC A;  3MA2 B;  4A3L H;  3Q6S A;  2Z0S A;  4TKO B;  2Z1C A;  4HIM A;  3I7F A;  5CV4 A;  3R8B A;  4RG1 A;  5NUC A;  1HFN A;  4IQZ A;  3A0J A;  4OO1 G;  4HJ5 A;  1FD7 D;  5ELF A;  4QY7 A;  1SXT A;  2B2Y C;  2M9V A;  1BF4 A;  5M5Y B;  5C5M A;  1LAB A;  4ME3 A;  2A68 C;  2A73 B;  1EIG A;  1STA A;  3TSS A;  3VDY A;  2JSO A;  4PV1 C;  1V1O A;  4FP5 D;  2SNM A;  2B63 H;  2KCM A;  2Z9H A;  2JK8 A;  2KCN A;  3RUZ A;  3NEM A;  1KLG D;  3OWE B;  2Q2U A;  3S2D B;  2JA7 G;  4EVO A;  1EL0 A;  3FP9 A;  4JI7 Q;  5GRO A;  2R92 G;  5ISR A;  3A8J E;  4FF4 A;  4QIW E;  4X62 L;  1STG A;  1VQJ A;  2CH4 A;  5EQ0 A;  2K4K A;  2LSS A;  4IPD A;  1BDO A;  4BY1 G;  1PV4 A;  2Q2T A;  3CQZ B;  4CDC C;  2HD3 A;  2DY7 A;  3J80 E;  3KUP A;  3I56 A;  5M5W B;  5ELE A;  4JBW A;  1ENF A;  1NE3 A;  2E74 C;  3MHB A;  5EKL A;  4JI1 L;  1FYC A;  4ZKC B;  3CC4 A;  4A3F H;  2JA5 H;  4V0B A;  2PQA B;  4HIO A;  1SFO B;  2E2H H;  3PV0 A;  4C3J B;  4BY7 H;  2B29 A;  2B3G A;  3RN5 A;  1NSN S;  3EQL C;  3S2H H;  4LF8 Q;  3C46 A;  2Y0S E;  4IAL A;  5C3E H;  4JI6 Q;  1LT5 D;  4DUY Q;  3RR5 A;  4DAY B;  1S5D D;  1HNZ Q;  2F0F A;  4IPH A;  2D62 A;  4XIG S;  1CQF A;  1CM9 A;  3H6M A;  5E1F A;  1Z7T A;  4UAI A;  4DAY A;  4A76 A;  1H9M A;  4ID6 A;  2NVX H;  4LF5 L;  4O42 A;  4LF7 Q;  4K5V A;  1PZK D;  3NP8 A;  2EZV A;  1N32 Q;  1D5X C;  2WIN B;  3M4Y A;  2K6A A;  1PH4 A;  2LXJ A;  1T9H A;  2R93 G;  2PMZ E;  4JG2 A;  3D31 A;  3PUX A;  5G3L D;  3JAM i;  5IE8 A;  2WB1 B;  5IT9 L;  4G7H C;  3DUZ A;  1GUG A;  3PUV A;  4IFD G;  1JCK B;  2VUM H;  5CMD A;  5AJ3 Q;  1D7Q A;  2DGY A;  4N8F A;  5EJW A;  2JA7 B;  3U9S A;  1PFB A;  4LFB L;  1A2T A;  3RN2 A;  1SNP A;  2CFM A;  2IHE A;  2IWH A;  1EQT A;  2CVR A;  1TWH H;  2X69 A;  1DOM A;  4RHS A;  1LTS D;  1VQF A;  1IKL A;  3D6C A;  1GJX A;  2I5M X;  1OXT A;  2BE5 D;  1ET6 A;  2F1M A;  2J4X A;  2A8V A;  5CV8 A;  2ZJP A;  1E22 A;  4KN4 C;  4GLX A;  3MFY A;  3TS0 A;  2BDO A;  5C3W A;  2K7V A;  1A0I A;  1EU4 A;  3SHL A;  4A3B B;  3ER0 A;  1BCP F;  2HQE A;  3STB C;  3A54 A;  4J8Q A;  2KVM A;  1HNZ L;  2I07 B;  1V9P A;  2NWG A;  1P8L A;  3NXW A;  3MXN B;  2PQE A;  4KTA A;  1Y1W B;  4B3T L;  1B2T A;  3HOW H;  3GTJ H;  3TQY A;  3RZO H;  3J7A F;  1VS0 A;  2JP1 A;  1GHJ A;  1WJJ A;  3I2Z A;  1G2S A;  3MTS A;  5CGK A;  3OSO A;  4KHV A;  2YU9 B;  1WTV A;  2UUC L;  2L11 A;  3I91 A;  3PO3 H;  1CKO A;  4JI2 L;  3T4A C;  3TZD A;  5I6W A;  3ICE A;  3K6O A;  4ZLT F;  1ILP A;  1CKN B;  1H9S A;  4B9W A;  4DU9 A;  1I94 L;  4K0K L;  5ELB A;  3ULJ A;  3GTQ B;  5CV5 A;  2ZTC A;  2BA1 A;  3D4R A;  1N33 Q;  2JA6 B;  4O0A A;  2E2J H;  3RNU A;  2K04 A;  4B3M Q;  1AZP A;  2JEA I;  3VR5 A;  2CQA A;  4A3E B;  1Q3L A;  1TU2 B;  5C5L A;  3ZJY C;  3E9H A;  2R93 H;  3WOE A;  4DXF A;  3BG3 A;  1BBX C;  4X3U A;  4K8I A;  2R7Z H;  1PVO A;  3PCO B;  3J80 c;  3K5O A;  4JI6 L;  1F9R A;  3OW7 A;  4QB4 A;  5DEH A;  4I65 A;  4P72 A;  1C4Q A;  3AFP A;  5TSS A;  3STB D;  1PHJ A;  2VB3 X;  3JC6 6;  1XTD A;  3HOX G;  4OX9 L;  1DXM A;  2F0W A;  2L1B A;  2GVB A;  1EIH A;  2OXP A;  4A3I H;  1G51 A;  5IOD A;  1YIJ A;  4AIM A;  3I4M H;  1CTM A;  1KRS A;  4A3G G;  3GTO B;  1HZC A;  4RWS C;  2ZTE A;  3ONA B;  5KYL A;  4QQB X;  1IYJ B;  5LMN Q;  1Q82 C;  4GKJ Q;  3Q8D A;  2B8G A;  1CK1 A;  2RVL A;  2ATW A;  4DR7 Q;  3N6R A;  3S24 A;  4FF3 A;  2RSO A;  3HOV G;  5C0X H;  1GHK A;  4IFD J;  2EY2 A;  4DAV A;  3CCL A;  2K32 A;  2EYL A;  4ULL A;  1I4P A;  4OO1 I;  3S16 H;  4XXE A;  3M4P A;  5E4X A;  1ROD A;  4KJN A;  1CSP A;  3NUC A;  5IY0 A;  1B3Q A;  4DAP A;  3PO3 G;  5DNF A;  3W2D A;  3KJO A;  1UAP A;  2XVS A;  3K0Y A;  1VQM A;  1AH9 A;  1STB A;  1YBY A;  3P75 A;  1Z9F A;  1NAP A;  3FKI H;  1E2Z A;  1NJI C;  1YNX A;  4MTK A;  2UUA L;  2NVY H;  4HED A;  4LF7 L;  3K7U C;  2R3Z A;  3VA5 A;  1CA5 A;  1EY8 A;  3AYH B;  4AQY L;  2UUB Q;  2EY6 A;  5GAG C;  1DZ1 A;  4G4K A;  3I4N H;  1TQO A;  1S72 A;  1L0W A;  1JOO A;  3HOU G;  1DYQ A;  4XT3 B;  4BXX H;  3R2I A;  1EOV A;  1JJC B;  3QOJ A;  2KHJ A;  4QGU A;  4FVM A;  4HCS A;  1WVL A;  4F8M A;  1BCP D;  3DEO A;  1Q8I A;  4ZUJ A;  3SK4 A;  2EJF C;  2E2I H;  2E2J B;  2R7Z G;  1I94 Q;  2OCE A;  2PW7 A;  5FJ8 G;  1SMY C;  4RGT A;  3CD6 A;  1Y69 U;  3CPW A;  3BDL A;  3GTQ H;  4NDX A;  1EU3 A;  1S4Z A;  4ODG A;  4Y7N B;  1W6K A;  3D0F A;  1EUJ A;  5M3F B;  1H9K A;  2LY7 A;  5LL6 X;  5J39 A;  3Q0A A;  4U67 3;  2OQ0 A;  1JE4 A;  2P5Z X;  2MPM A;  4UP7 A;  5FLX c;  5CV9 A;  5FKA C;  1AP0 A;  1WTR A;  4A3C G;  5ELO A;  4PMC A;  1STE A;  1I4H A;  4L5T A;  4PZ6 A;  1II3 A;  2WAQ G;  2CCZ A;  1JWS D;  1LTL A;  5LL6 S;  5FLX L;  3W5O A;  2RDG A;  3G7L A;  4P73 A;  2O2L D;  1RDP D;  4MNO A;  2F0D A;  4DR4 L;  1EY9 A;  1SN8 A;  4M8A A;  2A69 D;  2VNU D;  4CDE C;  1B7Y B;  4A3B H;  2TSS A;  3R93 A;  4GN4 B;  1O80 A;  1XMQ L;  4OHJ A;  2WB1 E;  3J7Z C;  4JI3 L;  1WTX A;  2KQ3 A;  1BO0 A;  4JI5 Q;  4N9P A;  1V1P A;  4HMJ A;  3M7G A;  3J81 L;  1JWU D;  1X6O A;  2M00 A;  4XYO A;  1V1P B;  5A2Q L;  2F0P A;  2AQ1 B;  4JCV E;  1VQ4 A;  4R9W A;  1HNX Q;  4KD4 A;  3HOU B;  4K2K A;  5I2Y A;  1PXU A;  4Q0F A;  1PTO C;  4A3I G;  2C5C A;  2JA9 A;  4XTC S;  3J81 E;  3CCS A;  1L1O B;  1VQH A;  4LF5 Q;  1S5F D;  3AMU A;  5E3F A;  1M90 C;  4NW2 A;  4HIK A;  3J81 i;  2XIW A;  1HZB A;  1L1O A;  4EQP A;  3L2P A;  1OXU A;  4DK6 C;  2EOT A;  2XRQ D;  5FLM G;  3GTG H;  4OEL B;  4B3S Q;  4F87 A;  3FPP A;  3L7Z C;  3M85 A;  4XQJ A;  1TS5 A;  1TWA H;  3SE0 A;  1VCI A;  4BBS H;  5KYI A;  4DR2 Q;  4KKT A;  3NQT A;  1EIF A;  1ICW A;  3HKZ B;  3PF5 A;  1OXX K;  4MZ9 A;  1PYS B;  1U4R A;  4L8J A;  2ALY B;  5IYB H;  2D5D A;  1WI5 A;  2NN6 H;  4K5W A;  3K5M A;  4JV5 L;  3PO3 B;  5C0X G;  4XQQ A;  1IL8 A;  2N3S A;  4C3J H;  4BY7 B;  1PFS A;  2NN6 I;  3HOV B;  4JBK A;  2E2H B;  3TEH B;  1VQI A;  3SK6 A;  2B2U C;  3OYY A;  4DV3 L;  3BDC A;  3CME A;  3X3M A;  2VS1 A;  5IT9 c;  3HOW B;  3L9A X;  4ZCK A;  4UP9 A;  4AYB B;  2E8G A;  5LMN W;  5BR8 Q;  4CGY B;  1PH5 A;  4X62 Q;  1X55 A;  1LT3 D;  4ZUI A;  3QWN A;  4RHR A;  5D3I B;  4CJ1 B;  2F0M A;  3PUY A;  3C1E A;  1SJE D;  4KY5 A;  1WD1 A;  1DD2 A;  5IWA L;  5JPM C;  1X9N A;  2R93 B;  2VQF L;  2ZT9 C;  1Z6H A;  4C3I B;  2KEE A;  3C3L A;  3RZD H;  1PYW D;  3V05 A;  5D14 A;  3TP7 A;  5FOB B;  3I4N G;  4A3D B;  5DLQ E;  2XSC A;  5EAY A;  1BBU A;  2NZH A;  2EYF A;  4IN3 A;  2R6G A;  2WAC A;  1V8Q A;  2O5I C;  5T1G A;  4LK1 C;  3BS1 A;  3QOL A;  3J80 i;  3DWA A;  3RLO A;  3I4L A;  2TMP A;  4PG3 A;  3HRZ C;  2AWN A;  4G7O C;  1BCP B;  3WOF A;  4DR6 L;  4DAM A;  3GO5 A;  4DR2 L;  1D5Z C;  4H7B A;  3TBI B;  2V4D A;  3Q22 A;  1A63 A;  1HNX L;  2JXM B;  3KDF B;  5I9P A;  1VMP A;  4WJ3 M;  4ZK9 B;  2A19 A;  1LUZ A;  4DNR B;  4A3E G;  1B4O A;  5L37 A;  1SNO A;  1EYD A;  2QGQ A;  3H0G H;  5J1Z A;  4K6D A;  1I4Q A;  5C44 B;  4LF4 Q;  1C8C A;  5C3E B;  4GZY C;  3PF4 A;  1ZKO A;  4A3B G;  3K5L A;  1JT8 A;  4WFN 3;  1QVF A;  3S14 B;  1YJW A;  2B2V C;  4DK3 C;  1JE5 A;  1NUC A;  4Q5V A;  2NVQ B;  1TR5 A;  5CR3 A;  1Q90 A;  2MUY A;  1EWH A;  3A7L A;  3ZYY X;  2A1A A;  4RH6 A;  1LV9 A;  3UI2 A;  4KD3 A;  2EY1 A;  1X65 A;  2UXC L;  4KHZ A;  2EVB A;  3GTG B;  3OOC A;  1K0S A;  4B9X A;  3PIO 3;  3OPO A;  1Y1V B;  3T51 B;  2CW0 C;  4N9T A;  2NTT A;  1XMO L;  1F2M A;  3QR8 A;  2EJG C;  2HQL A;  5CV7 A;  1E2V A;  4AH6 A;  4ILW A;  2Q8I B;  4IUT A;  1EY7 A;  3PO2 H;  1RTO A;  1XNQ L;  4IUQ A;  1EWC A;  4GS3 A;  1TWF H;  1DM0 B;  1SMY D;  1A3U A;  5C3X A;  4JK1 C;  1UE5 A;  1O78 A;  2NVT H;  1HHV A;  3B6Y A;  1HH2 P;  1JOQ A;  4KHP Q;  3HG9 A;  3S16 B;  5IGD A;  4NXN Q;  2N49 A;  3S1R B;  1B9N A;  2UXB Q;  2IX0 A;  3MEF A;  5M3M B;  3P1H A;  4DV6 L;  2FJ2 A;  4LAA A;  1PTO F;  1SMX A;  3NBH B;  3HOY B;  1IXR A;  4CBV A;  3F2C A;  4BBS B;  1VQK A;  1X3G A;  1B8A A;  3U4Z A;  4C3H B;  3AB9 A;  3CPF A;  2NZ1 D;  3CU7 A;  3G6E A;  4DR6 Q;  2JA6 H;  4X65 Q;  3L3O C;  1TKW B;  4LF4 L;  2K14 A;  2ZJQ A;  2VW9 A;  2Z6B A;  3KK7 A;  1AN8 A;  2IT1 A;  5LMU L;  2ASB A;  3GQB A;  1I3Q B;  4JVZ A;  5HY6 A;  2DY8 A;  1GUW A;  2M2L A;  4MN3 A;  1LTB D;  3H0G G;  4X3S A;  1P16 A;  1QZH A;  3E0E A;  3KJP A;  1HR0 Q;  2K5D A;  1VQE A;  3OMG A;  1MD2 D;  5IP9 G;  2GA4 B;  2R7Z B;  3H3V H;  1O7Y A;  1RD9 D;  1YEZ A;  1UUP A;  3PO2 B;  5COR A;  2K01 A;  4MIU A;  1VDZ A;  1VQG A;  3AQQ A;  3EN2 A;  2R7F A;  1TXY A;  5A2Q E;  1J9O A;  4HJ8 A;  4PZ8 A;  5BR8 L;  1KIX A;  4OX9 Q;  1SE8 A;  2L55 A;  1W6J A;  3HS0 C;  1ILQ A;  4GKJ L;  5FO9 B;  2VY3 A;  5M5X H;  2AWO A;  4GNX A;  1D6E C;  3CCU A;  1JOK A;  3QO2 A;  1A15 A;  4EGV A;  4FO2 A;  5JEA H;  1EQQ A;  5JEA J;  1TWH B;  4F7X A;  2E75 C;  2XTI A;  3CW2 C;  2B2W A;  4GN5 A;  1N36 L;  4K14 A;  2PNH A;  1TVX A;  2YU9 H;  4DR7 L;  1WFQ A;  2SDF A;  4BA1 I;  2E5L L;  1CZW A;  1MHW C;  4HN7 A;  1SSO A;  2WKC A;  1SAP A;  1QNK A;  3HOY G;  1VF5 C;  4JPB W;  1BOS A;  4X65 L;  1VQC A;  3KBG A;  4IOA A;  2YYZ A;  1IHZ A;  2YTV A;  1SBB B;  1AZQ A;  2K28 A;  1SYF A;  1N34 Q;  3QB3 A;  3FRP B;  4PMB A;  5GQO A;  1A8V A;  4QL5 A;  4CKC A;  2WFW A;  3KLW A;  4P2C B;  1ZYR D;  1EOT A;  1T5X D;  1OO9 B;  2F3W A;  3I73 A;  3VR2 A;  1FNW A;  4EQO A;  3HOV H;  1TY0 A;  1K3R A;  1XPU A;  2F0T A;  3RMH A;  5GAE C;  5F2D A;  4IOC A;  1YNJ C;  2KEC A;  1LTR D;  2ES2 A;  2B2Y A;  4CDF C;  1STH A;  3T1H Q;  1HXY D;  3IAY A;  3AFQ A;  5E7N A;  5KNB A;  3FDT A;  2F0H A;  1XMQ Q;  1K83 B;  4FXK C;  1ASZ A;  4A3C H;  2HT1 A;  1SYD A;  1MJC A;  3KFU A;  2NVY B;  1EY5 A;  3UDF A;  1E1O A;  1QCB D;  2QF7 A;  3FKI G;  4B3R L;  1U4M A;  1YVC A;  1GKH A;  1KNE A;  1F2L A;  2DN8 A;  2L12 A;  1JR0 D;  4OGQ C;  1BR9 A;  3RZD B;  4DUZ L;  5IP7 G;  1W2B A;  4GOP C;  1XYI A;  1S5B D;  3DXJ C;  4K6L A;  4FF1 A;  1Q8K A;  4OIK A;  3HOU H;  3PIO A;  1QE6 A;  2E5L Q;  2GVA A;  2GN5 A;  3PQI A;  4CKE A;  1EY4 A;  1UEA B;  3U58 A;  4RFB A;  2BH8 A;  4NXM Q;  2PI2 E;  1JMC A;  4Z9C B;  1KD1 C;  3RLN A;  4CJ2 C;  1UWV A;  1I3Q H;  5GAD C;  3M3Y H;  2ICI A;  5EPL A;  4JC0 A;  3MXU A;  3JAM L;  1VQB A;  4I7Z C;  4G7Z C;  4J15 A;  4A3K G;  1G6P A;  3GTP H;  2JA8 B;  1A2U A;  2AUJ D;  4QMG A;  5JEA G;  2B2W C;  1F9Q A;  2DJG C;  2HCC A;  3S2H B;  2F4V Q;  4BWG B;  1EYC A;  1TS2 A;  4BS9 A;  2B63 B;  2BH2 A;  5JVH 3;  4B3T Q;  3I4M B;  1KXL A;  1HJP A;  3JAM E;  1R4Q B;  4A3F G;  2IX3 A;  3H0G B;  4B3S L;  4FXD A;  4XT1 B;  3HKZ E;  3HOY H;  2RBM A;  3S1M H;  4X6A H;  1TWA B;  4IUV A;  1IBK Q;  3BJU A;  2OT2 A;  2HCI A;  2F3I A;  1TS3 A;  1X3P A;  4R4O A;  2PW5 A;  3G71 A;  1KC8 C;  3CQZ H;  3K59 A;  4FYD A;  1A62 A;  4DXG A;  5C4J B;  3PGZ A;  1Y8P B;  1AEX A;  1PH7 A;  4DKA C;  4OON A;  4Y7N H;  1RTN A;  1RKN A;  2H4O A;  1U5K A;  4X3K A;  2RSN A;  3KF8 A;  3KLS A;  1Y1W H;  4HCE A;  3H91 A;  1WTP A;  4P74 A;  1QUQ A;  1A3V A;  5IYC G;  1IKM A;  3GTL B;  2CWP A;  1KRT A;  2RDH A;  4LFC L;  4K2L A;  4RKL A;  4GLA C;  1EYG A;  3ERO A;  5IYD G;  4QUF A;  2Z4H A;  4HSP A;  4C3I H;  5D3D A;  4LMQ D;  2EY5 A;  4M1U B;  3LX0 A;  4KK7 A;  1VQ8 A;  2ZXO A;  3A5U A;  1I6H H;  3IRB A;  2R7D A;  3S14 H;  1PLF A;  3U4V A;  4IJL A;  4X3T A;  2LFN A;  1L1O C;  2PZU A;  4EX5 A;  4POG A;  4A3M H;  3CCE A;  1IBL Q;  2JQO A;  3K81 C;  4WJ4 A;  3CCQ A;  5HGT A;  4LFA Q;  3J81 c;  1Y8N B;  1SLJ A;  1KDB A;  3MWY W;  4A3K H;  3KF6 A;  1E0B A;  2QIL A;  1JQY D;  1SEB D;  3GV3 A;  3D4W A;  1GD7 A;  1LT6 D;  4BBR B;  2RF4 A;  4JI7 L;  3MZ5 A;  1BNZ A;  2F0O A;  3SEB A;  1OTC A;  4OIJ A;  1IYU A;  1HUN A;  2MGS A;  3HOX H;  2LKV A;  3K7A H;  4Y52 H;  4RA8 A;  1IW7 C;  2Q2I A;  1N34 L;  1K8A C;  1MGS A;  1W3S A;  2VZA A;  1MSG A;  4KN7 C;  2VL6 A;  3ULL A;  4X64 L;  1U9R A;  2CQO A;  1F9P A;  1U4P A;  5ELN A;  1D5M C;  4JW0 A;  1VQ9 A;  1MIU A;  3H09 A;  5IIF A;  4G57 A;  3I4N B;  4A3D G;  4IJH A;  1VQ6 A;  1NR2 A;  4KJO A;  1D1K A;  2O4X A;  3ND9 A;  2LS0 1;  3DHQ A;  1Q86 C;  1BBW A;  2KHI A;  1PFM A;  1CZG A;  1N33 L;  2IX1 A;  5JJI A;  4A4I A;  1Y8O B;  1KDC A;  3NTI A;  3Q24 A;  3A7A B;  4U68 A;  4K0K Q;  3LGJ A;  4LFA L;  3UE0 A;  3T1Y Q;  1OXS C;  3D8G A;  1SNM A;  1U0L A;  2XWB B;  3BVG A;  1KAB A;  4PNY A;  2EYM A;  3VA7 A;  1PDQ A;  4RKB A;  1IBL L;  1Y14 B;  1XJV A;  4YY3 L;  4DK1 A;  1N8R C;  1X32 A;  2QEJ C;  2Z4I A;  2MNA A;  2CWA A;  2F0S A;  2YTX A;  4P75 A;  2FMM A;  1Q46 A;  5JJZ A;  1C48 A;  1E1T A;  2A68 D;  4K8J A;  2DUD A;  4PZ7 A;  1PH9 A;  1QVC A;  1X54 A;  1WTO A;  3CC2 A;  4A3M G;  2Y0S B;  3BDO A;  2NYZ D;  3M3Y B;  3A55 A;  4R4Q A;  4R8I A;  3J7A V;  1KL9 A;  1N9W A;  5J3B A;  1PRT D;  3I8Z A;  4O2D A;  4DV3 Q;  4A3G H;  4JYA Q;  2YTY A;  1H95 A;  3N52 A;  4LJZ C;  1I50 B;  1SJH D;  2EYP A;  2I46 A;  1OXV A;  3NBH A;  3S1Q B;  2UXC Q;  1ET9 A;  3FPU B;  2B2T C;  4HTH A;  3WWV A;  3CP0 A;  1B9M A;  1ICF B;  1K8M A;  1TWF B;  3DM3 A;  3HGB A;  4DV7 L;  1NNX A;  2EE1 A;  2N55 A;  1UE1 A;  2NUC A;  3WDN A;  2A6E D;  2PQA A;  3ERQ A;  2F0J A;  1CA6 A;  5KEE A;  1L0X B;  1WTW A;  3RD4 A;  4DR5 L;  4YHH Q;  4HMI A;  3CAM A;  2RHQ B;  1XX8 A;  1Y1W G;  3PUW A;  2HDM A;  4DV6 Q;  1NTG A;  3CCM A;  2UUB L;  1FR3 A;  1KHI A;  5DM6 3;  3K8A A;  1TT2 A;  3UDX A;  4DR3 L;  4RGO S;  1RJT A;  1HA5 A;  1QJO A;  1J6Q A;  4ZKB B;  1LT4 D;  1IBM Q;  4LF9 L;  3H94 A;  1EQR A;  3ULP A;  2EXZ A;  1G8Z D;  4DN4 M;  3F2D A;  2H5X A;  3K58 A;  1ENA A;  3QIA A;  4R4I A;  2F0V A;  2HIX A;  2K5W A;  2NZO A;  1XMO Q;  4A93 H;  5G3L F;  4RGN A;  2KA7 A;  2CH4 W;  5FO7 B;  3NSW A;  1Q81 C;  2ZXP A;  1HRJ A;  2UUC Q;  2BOS A;  4JYA L;  3D4D A;  4KHP L;  1CSQ A;  4F88 A;  4POF A;  3SDZ A;  4QF4 A;  2WKD A;  4LUO A;  2EYO A;  4A3K B;  1JB7 A;  1HA6 A;  2RHS B;  1I5F A;  1PRT C;  5K36 H;  2JA6 G;  2KED A;  3C1F A;  1F77 A;  2CKZ B;  3I4M G;  1L2F A;  2YV5 A;  3PSI A;  1LLR D;  1DGS A;  1IZ6 A;  4OWT B;  4KY7 A;  5BN3 A;  5M9O A;  5GAH C;  5M5X B;  1HNW L;  2MO0 A;  3K5N A;  4NXM L;  1YNN D;  2K33 A;  1K73 C;  1B44 D;  2QDB A;  3T1Y L;  5IGB A;  5T1I A;  4JI8 L;  5IGF A;  4DR4 Q;  3MXN A;  2E2I B;  4HJ9 A;  2DNE A;  1I6H B;  4BY7 G;  5I2X A;  5C4X G;  4UHV A;  5C6A A;  3HOZ B;  1XTC D;  4A3D H;  1RF2 D;  2JA5 B;  3HZX A;  1VQO A;  3LWE A;  3GP7 A;  4LFB Q;  4XQN A;  1UNS A;  2ZM6 Q;  1UE7 A;  2FFK B;  4DUZ Q;  2MJ8 A;  5AJ3 L;  1SRO A;  5M5W H;  2JN4 A;  3RLF A;  3V96 A;  3QJY A;  3EFX D;  3TS2 A;  4DV5 Q;  5CYU A;  4AYB G;  2QW7 A;  5IGG A;  1CFM A;  3FKI B;  1ENC A;  3H3V C;  1AE2 A;  1T5E A;  1D8L A;  1H9S B;  3SK8 A;  2ZTD A;  4B3M L;  1JB3 A;  1S5E D;  3A74 A;  2UXD L;  2IPK D;  4DR3 Q;  3DLL A;  3E9I A;  1Q1B A;  1GUT A;  4GKK L;  2Z8L A;  1TY2 A;  1QNU A;  5C4J H;  1B70 B;  4JOI A;  3R2T A;  4ZQ3 A;  2KJX A;  3CC7 A;  3S2D H;  2K5Q A;  3S1Q H;  1S5C D;  1R9T H;  1SRU A;  1PH8 A;  3S9W A;  3CHB D;  3I3C A;  1TWC B;  2A6H D;  4HR7 B;  3S15 B;  4NKL A;  3K57 A;  4GN3 B;  3T53 B;  3D6W A;  3HEJ A;  4C3H H;  2SEB D;  3OTO Q;  3VYS A;  4C2M B;  2K1B A;  4BA2 I;  3NEL A;  5EPJ A;  1I6V C;  4QIW B;  3S1N B;  1SNC A;  5M3M H;  4L5Q A;  5K5P A;  3GTO H;  2C9O A;  1DOL A;  1AFP A;  3R3O A;  1SNQ A;  4A3J B;  2UUA Q;  3K80 C;  1U4L A;  4LF6 L;  5EPK A;  5C44 G;  4OWX B;  4BY1 H;  1NY4 A;  3LWU A;  1JWM D;  4DPG A;  3KLR A;  3VR4 A;  5IWA Q;  2ZM6 L;  4A3I B;  5IT9 E;  4A3F B;  1XXG A;  4DF7 A;  3VR3 A;  3GTM B;  3BZC A;  1HR0 W;  3NBI A;  2MO1 A;  5K36 G;  4RAU C;  3W1G A;  3EA6 A;  1WTQ A;  1PRT B;  3NTH A;  1TWG B;  1CHP D;  1ESF A;  1K8G A;  1HTP A;  1GO3 E;  1KNA A;  4HSV A;  3SVM A;  2A6E C;  4WJW A;  3NQI A;  2MHV A;  1ASY A;  2HDL A;  2L4N A;  3CCV A;  3I4O A;  5COY A;  3S17 H;  1BUV T;  4RCO A;  4KLK A;  2JA8 G;  1X3Q A;  3V2T A;  1XPR A;  1SND A;  4A3E H;  3VYU A;  2B63 G;  4DA2 A;  1QIL A;  3DWQ A;  1JC7 A;  3TZU A;  5FK9 C;  2JA7 H;  3URY A;  3FVQ A;  1MBY A;  1EQV A;  4DV1 L;  3BVM A;  2R92 H;  2F0U A;  1B1Z A;  3IL8 A;  1K83 H;  3OHX C;  3E5S A;  5IGE A;  2XWJ B;  3GTK H;  1PTO H;  1EWI A;  5ELC A;  3DMU A;  3O13 A;  3H15 A;  1GOZ A;  1M4V A;  2EYH A;  3S15 H;  5AFW A;  2WAQ B;  1F2Y A;  2K5N A; 
#chains in the Genus database with same CATH homology
 3HOU G;  1PH2 A;  2PI2 E;  2Q2H A;  1JMC A;  3GTL H;  1IBM L;  4BXX H;  4JBJ A;  2VQE Q;  1EOV A;  1JJC B;  3RLN A;  1RIP A;  2KHJ A;  3GD7 A;  1UWV A;  1I3Q H;  1KD1 C;  4QGU A;  2VUM G;  5GAD C;  4IFD I;  1FGU A;  1WCM G;  3M3Y H;  2F52 A;  4JC0 A;  4JBM A;  4JI0 Q;  1VQB A;  2E2I H;  4J15 A;  4HID A;  4A3K G;  3GTP H;  1G6P A;  1EIY B;  1E24 A;  5JEA G;  2R7Z G;  1I94 Q;  2OCE A;  5FJ8 G;  1TWG H;  3UDG A;  3OW2 A;  4NPS A;  2F4V Q;  1LM0 A;  3CD6 A;  1Z47 A;  4P71 A;  3CPW A;  3GTQ H;  2OQK A;  2BH2 A;  4B3T Q;  3D0F A;  1EUJ A;  1KXL A;  1HJP A;  3PIP A;  4DV4 Q;  3M4Q A;  1PA6 A;  4A3F G;  1Y1V H;  1CUK A;  1SFO H;  4YCV A;  4B3S L;  3HKZ E;  3HOY H;  3S1M H;  4X6A H;  3W1B A;  2OQ0 A;  2FXQ A;  1IBK Q;  4LF8 L;  2JE6 I;  1PH1 A;  4IPG A;  3BJU A;  4UP7 A;  5FLX c;  4B3R Q;  2F3I A;  4A3C G;  4R4O A;  1K9M C;  5ELO A;  1O7I A;  3HOZ G;  3G71 A;  1KC8 C;  3CQZ H;  1MKH A;  1NBW A;  4L5T A;  4PZ6 A;  1VQA A;  3F1Z A;  5C0X I;  2WAQ G;  1A62 A;  2CCZ A;  2NVQ H;  2OWO A;  2XGT A;  2QA4 A;  1KAW A;  1LTL A;  1Q12 A;  2OTJ A;  3W5O A;  2JJQ A;  4P73 A;  3CCJ A;  3PGZ A;  3KF8 B;  2MQH A;  1IL2 A;  1PH7 A;  4GLV B;  4MNO A;  4DKA C;  4OON A;  4YCU A;  4Y7N H;  4OWW B;  1U5K A;  1VQN A;  5JJL A;  1Y1W H;  4DR4 L;  2WB1 G;  1SN8 A;  2VNU D;  4L5R C;  2UXB L;  1B7Y B;  4A3B H;  4P74 A;  5C3E G;  4GN4 B;  4DV2 Q;  1QUQ A;  2HIV A;  3A5Z B;  3I55 A;  1XMQ L;  1VQ5 A;  2WB1 E;  4DR5 Q;  5IYC G;  3J7Z C;  3CF5 A;  4BBR H;  4LFC Q;  2CWP A;  2N8N A;  1KRT A;  1V43 A;  4LFC L;  4JI3 L;  4YY3 Q;  3TRE A;  4GLA C;  4APV A;  5IP7 H;  4JI5 Q;  1EYG A;  4LUZ A;  3CXC A;  4UY8 C;  3EIV A;  4RMF A;  4JOI C;  3F2B A;  5IYD G;  4OXP A;  3EBE A;  3G48 A;  1S72 A;  3H3V I;  4QJF A;  4C3I H;  4PMW A;  1X6O A;  2WAQ E;  1VQ8 A;  4AQY Q;  3A5U A;  1I6H H;  4IO9 A;  4JI4 Q;  3IRB A;  4JCV E;  2R7D A;  5M5Y H;  4HJA A;  2BA0 A;  1VQ4 A;  3U4V A;  1HNX Q;  3J7A 5;  3S14 H;  4IJL A;  2I0Q A;  4LF9 Q;  1L1O C;  4JI1 Q;  4BXX G;  4GOP B;  1G29 1;  4EX5 A;  4A3I G;  4A3M H;  4POG A;  1UEB A;  2JA9 A;  4XTC S;  3CCE A;  1IBL Q;  2JQO A;  3K81 C;  4WJ4 A;  1RL2 A;  3CCS A;  5K36 G;  1L1O B;  1VQH A;  4LF5 Q;  4LF6 Q;  3CCQ A;  1M90 C;  1E3P A;  4HIK A;  4LFA Q;  3AEV A;  3J81 i;  3F8T A;  1HZB A;  1L1O A;  1WCM H;  3J81 c;  1SLJ A;  3L2P A;  3NEN A;  1OXU A;  4DK6 C;  3GTG H;  5FLM G;  1N36 Q;  4A3K H;  4B3S Q;  3KF6 A;  3CCR A;  2C35 B;  2AHO B;  3L7Z C;  2K5H A;  3M85 A;  4DR1 L;  1BKB A;  1YIT A;  2KEN A;  1C7Y A;  1TWA H;  2WP8 J;  1S40 A;  1VCI A;  3GDE A;  2I5L X;  4X66 Q;  4DV1 Q;  1GD7 A;  4BBS H;  3KF6 B;  4DR2 Q;  4YWK A;  2RF4 A;  4JI7 L;  1EIF A;  3PF5 A;  2K5V A;  1OXX K;  4MZ9 A;  1PYS B;  3L0O A;  5M3M G;  2ALY B;  2UU9 Q;  4JV5 Q;  5IYB H;  1OTC A;  3HOW G;  1PH3 A;  1FJG L;  2Z6K A;  1WI5 A;  3HOX H;  4BBS G;  1Q1E A;  1YHA A;  5C0X G;  2VQF Q;  1YZ6 A;  3K7A H;  3KDF A;  2N3S A;  4JV5 L;  4C3J H;  5C44 H;  4Y52 H;  1PFS A;  2NN6 I;  2Z6K C;  4JBK A;  1FVI A;  2Q2I A;  1VQI A;  1C9O A;  4R1J A;  1WOC A;  2ID0 A;  3TEH B;  1N34 L;  1K8A C;  3OYY A;  2VQE L;  4DV3 L;  4A3L H;  1W3S A;  2VZA A;  2VL6 A;  4NB3 A;  3ULL A;  4X64 L;  4BBR G;  2IY5 B;  2Z0S A;  4DV0 L;  2CQO A;  1AE3 A;  4HIM A;  3I7F A;  3CME A;  4RG1 A;  1XNR Q;  5ELN A;  2VS1 A;  5IT9 c;  1VQ9 A;  1MIU A;  4UP9 A;  4A3D G;  3A0J A;  4IJH A;  2E8G A;  1VQ6 A;  4OO1 G;  4R4C A;  4HJ5 A;  5LMN W;  5BR8 Q;  1PH5 A;  4QY7 A;  1X55 A;  4X62 Q;  3OTO L;  3PUY A;  3G4S A;  1Q86 C;  1BBW A;  2KHI A;  1X3E A;  4ME3 A;  2L15 A;  1N33 L;  2IX1 A;  4R4T A;  5IWA L;  4A4I A;  4AYB E;  1TWC H;  3VDY A;  1X9N A;  5JJI A;  2VQF L;  1VQD A;  3RZD H;  1M1K C;  4K0K Q;  3LGJ A;  4GOP A;  4LFA L;  3UE0 A;  3I4N G;  4DNI A;  5DLQ E;  2B63 H;  2KCM A;  5EAY A;  3T1Y Q;  1OXS C;  1NMF A;  2JK8 A;  5LMN L;  1QZG A;  1U0L A;  3NEM A;  1BBU A;  2Q2U A;  3UE1 A;  1GVP A;  1IBL L;  2JA7 G;  1Y14 B;  2NZH A;  1XJV A;  3FP9 A;  4YY3 L;  5GRO A;  2R6G A;  4JI7 Q;  2R92 G;  1N8R C;  1S3O A;  4TVA B;  1MJE A;  3TRZ A;  2MNA A;  2CWA A;  2YTX A;  4QIW E;  4P75 A;  4JI4 L;  4X62 L;  1VQJ A;  1Q46 A;  3J80 i;  1E1T A;  2K4K A;  2DUD A;  4PZ7 A;  2LSS A;  3RLO A;  1QVC A;  1X54 A;  4IPD A;  4PG3 A;  3SGI A;  1PH9 A;  4BY1 G;  3CC2 A;  2AWN A;  4A3M G;  1PV4 A;  2Q2T A;  4R4Q A;  4MTN A;  5FJ8 H;  4DR6 L;  1KL9 A;  1N9W A;  4DAM A;  5FLM H;  3GO5 A;  4X64 Q;  5J3B A;  1FL0 A;  3I56 A;  4DR2 L;  4O2D A;  4DV3 Q;  4JBW A;  3CMA A;  1NE3 A;  2ZJR A;  4A3G H;  4JYA Q;  1A63 A;  2YTY A;  1H95 A;  1HNX L;  2EXD A;  3KDF B;  3M4O H;  1OXV A;  4JI1 L;  3CC4 A;  2UXC Q;  4A3F H;  2JA5 H;  3WWV A;  4WJ3 M;  3CP0 A;  2A19 A;  1LUZ A;  4A3E G;  2PQA B;  1CKM A;  3DM3 A;  4HIO A;  4DV7 L;  2QGQ A;  3H0G H;  2E2H H;  3PV0 A;  1UE1 A;  4BY7 H;  2NN6 G;  2B29 A;  4LW1 A;  2B3G A;  3RN5 A;  4LF4 Q;  2D0O A;  2PQA A;  4NXN L;  4JI5 L;  3S2H H;  1IBK L;  4LF8 Q;  2K75 A;  2JA5 G;  3PF4 A;  4A3B G;  2Y0S E;  1GM5 A;  5C3E H;  4JI6 Q;  1JT8 A;  1C0A A;  4YHH L;  4DUY Q;  1QVF A;  4DR5 L;  4YHH Q;  3RR5 A;  4DUY L;  4DAY B;  1YJW A;  1HNZ Q;  3CAM A;  2UXD Q;  2RHQ B;  4JI3 Q;  3PUZ A;  4DK3 C;  4IPH A;  2D62 A;  4XIG S;  1Y1W G;  1WYD A;  1JE5 A;  3PUW A;  5IP9 H;  3HFZ B;  4DV6 Q;  2F4V L;  4A76 A;  1NTG A;  5C4X H;  4H02 A;  3CCM A;  2UUB L;  4DV7 Q;  1KHI A;  2A1A A;  2NVX H;  4LF5 L;  4LF7 Q;  1X65 A;  3K8A A;  2UXC L;  1N32 Q;  4KHZ A;  1PH4 A;  3UDX A;  4DR3 L;  2LXJ A;  3GTM H;  1J6Q A;  1IBM Q;  4LF9 L;  4A93 G;  1EQR A;  3ULP A;  2LXK A;  1T9H A;  2R93 G;  2PMZ E;  3F2D A;  4JG2 A;  2H5X A;  1XMO L;  4DV2 L;  3D31 A;  2HQL A;  3PUX A;  2OTL A;  4R4I A;  2HIX A;  3JAM i;  4AH6 A;  3KOJ A;  5IE8 A;  4IPC A;  2NZO A;  4A75 A;  3JAM c;  1YI2 A;  4NXM Q;  1YJN A;  1XMO Q;  3PO2 H;  3M9B A;  1XNQ L;  4A93 H;  3PUV A;  4IFD G;  2VUM H;  1HNW Q;  5AJ3 Q;  1HR0 L;  1D7Q A;  4GS3 A;  2DGY A;  1Q81 C;  1TWF H;  5M3F G;  2UUC Q;  1UE5 A;  2AMC B;  4JYA L;  2NVT H;  1QVG A;  3RN2 A;  3B6Y A;  4LFB L;  1HH2 P;  4KHP L;  1X56 A;  4KHP Q;  2CFM A;  1V1Q A;  2EQS A;  1CSQ A;  2IHE A;  2PI2 A;  4UPA A;  1TWH H;  4C2M H;  4POF A;  4DV4 L;  4NXN Q;  2EIF A;  2N49 A;  1VQF A;  5JJK A;  4LUO A;  1EFW A;  2I5M X;  1OXT A;  3S1R H;  2UXB Q;  2IX0 A;  3BZK A;  3MEF A;  1JB7 A;  2A8V A;  4DV6 L;  2ZJP A;  1E22 A;  1SMX A;  2RHS B;  3FHW A;  4GLX A;  3NBH B;  1I5F A;  3TS0 A;  1IXR A;  1VQL A;  3F2C A;  1A0I A;  1VQK A;  3ER0 A;  2JA6 G;  1X3G A;  1B8A A;  3U4Z A;  3ERS X;  3STB C;  2K52 A;  2CKZ B;  3CPF A;  3I4M G;  1L2F A;  2YV5 A;  1JJ2 A;  1HNZ L;  3PSI A;  1V9P A;  3T1H L;  1DGS A;  1P8L A;  1UE6 A;  1IZ6 A;  3MXN B;  4OWT B;  5GAH C;  4B3T L;  2RCN A;  3HKZ G;  3G6E A;  3HOW H;  1Y1V G;  3GTJ H;  2JA6 H;  4X65 Q;  2MO0 A;  4DR6 Q;  1HNW L;  1N32 L;  4NXM L;  4TQU S;  3KYH C;  3TQY A;  1K73 C;  1XPO A;  2K14 A;  3T1Y L;  2ZJQ A;  2VW9 A;  1Q7Y C;  4JI8 L;  2HHH Q;  4LF4 L;  3RZO H;  4DR4 Q;  1VS0 A;  4HJ9 A;  2AKW B;  4BY7 G;  1WJJ A;  5IYB G;  1I50 H;  2IT1 A;  2V1C C;  3I2Z A;  5LMU L;  2N78 A;  2ASB A;  5C4X G;  1J5E Q;  5HY6 A;  4A3D H;  4JI0 L;  1E7Z A;  2D0P A;  1VQO A;  1SR3 A;  2UUC L;  3H0G G;  4LFB Q;  2ZM6 Q;  1P16 A;  1UE7 A;  1QZH A;  2KBN A;  3PO3 H;  3E0E A;  1CKO A;  3KJP A;  4DUZ Q;  4JI2 L;  5AJ3 L;  3UDI A;  1SRO A;  2JEB I;  5HGQ A;  1HR0 Q;  5M5W H;  3ICE A;  3RLF A;  1VQE A;  1XNQ Q;  4LNQ A;  3TS2 A;  5IP9 G;  4DV5 Q;  3HOZ H;  1CKN B;  4AYB G;  3H3V H;  4A3J G;  2Y0S G;  4K0K L;  1I94 L;  1YEZ A;  3ULJ A;  1AE2 A;  2ZTC A;  1D8L A;  4DV0 Q;  2BA1 A;  1N33 Q;  2ZTD A;  4B3M L;  3A74 A;  2UXD L;  1VQG A;  3AQQ A;  3EN2 A;  4DR3 Q;  4O0A A;  2R7F A;  2E2J H;  2JA8 H;  1TXY A;  3DLL A;  3E9I A;  1Q1B A;  3RNU A;  4GKK L;  4FDB A;  4HJ8 A;  4B3M Q;  5C4J H;  2UU9 L;  1B70 B;  4PZ8 A;  5BR8 L;  1KIX A;  4JOI A;  2JEA I;  4EQ5 A;  4OX9 Q;  3CC7 A;  1SE8 A;  3S2D H;  1X3F A;  1HZA A;  3S1Q H;  1R9T H;  4GKJ L;  1SRU A;  2VY3 A;  3BU2 A;  5M5X H;  1PH8 A;  2AWO A;  3PO2 G;  3ZJY C;  3E9H A;  4GNX A;  2R93 H;  3CCU A;  4GN3 B;  2MFI A;  2R7Z H;  4C3H H;  1EQQ A;  1PVO A;  3OTO Q;  3PCO B;  3J80 c;  5JEA J;  4JI6 L;  1K0R A;  2XTI A;  3CW2 C;  4GN5 A;  2KCT A;  5C0X J;  1N36 L;  4BA2 I;  3NEL A;  3M7N A;  2PNH A;  3K0X A;  5M3M H;  5M3F H;  4L5Q A;  5LMU Q;  2YU9 H;  4DR7 L;  1WFQ A;  4P72 A;  3AFP A;  3STB D;  1PHJ A;  3GTO H;  4BA1 I;  3JC6 6;  1YJ9 A;  2E5L L;  1XTD A;  3HOX G;  4OX9 L;  2UUA Q;  3K80 C;  4LF6 L;  1PYB A;  2GVB A;  3HOY G;  5C44 G;  4OWX B;  4X65 L;  1NY4 A;  1VQC A;  4BY1 H;  1XNR L;  4IOA A;  4A3I H;  1G51 A;  2YYZ A;  4DPG A;  2YTV A;  1YIJ A;  4AIM A;  2QEX A;  5IWA Q;  2ZM6 L;  3I4M H;  5H1S E;  1NMG A;  1N34 Q;  1JJG A;  5GQO A;  3BZC A;  1A8V A;  4QL5 A;  1HR0 W;  2MO1 A;  1KRS A;  2K50 A;  2WFW A;  3KLW A;  3W1G A;  4ALP A;  1J5E L;  1HZC A;  1VQ7 A;  4KI0 A;  1YHQ A;  4A3G G;  2ZTE A;  3HOV H;  4QQB X;  1IYJ B;  5LMN Q;  1Q82 C;  1K3R A;  2HHH L;  1XPU A;  4YWM A;  4GKJ Q;  1K8G A;  5GAE C;  3Q8D A;  1LYL A;  2ATW A;  4DR7 Q;  4IOC A;  1GO3 E;  3S24 A;  4YWL A;  1ASY A;  2ES2 A;  1CKN A;  3HOV G;  3T1H Q;  4IFD J;  3CCV A;  3I4O A;  3AFQ A;  4GKK Q;  4HJ7 A;  3CCL A;  1HZ9 A;  2IHF A;  5E7N A;  3S17 H;  1YHB A;  4KLK A;  1XMQ Q;  4A3C H;  4DR1 Q;  1ASZ A;  2JA8 G;  3S16 H;  2HT1 A;  4A3L G;  4OO1 I;  3M4P A;  1XPR A;  1VQP A;  1CSP A;  4A3E H;  5IY0 A;  1MJC A;  4YCW A;  3KFU A;  3U50 C;  2B63 G;  2I5H A;  3PO3 G;  3UDF A;  1E1O A;  4UP8 A;  1PH6 A;  3FKI G;  4B3R L;  3HKS A;  1YVC A;  4JI2 Q;  3KJO A;  1GKH A;  2JA7 H;  5IYC H;  1VQM A;  1AH9 A;  2R92 H;  4X66 L;  4DV1 L;  4DUZ L;  1BVS A;  4GNX C;  1K83 H;  4A3J H;  5IP7 G;  1YBY A;  3J81 j;  4GNX B;  1Z9F A;  4GOP C;  1W2B A;  3GTK H;  3FKI H;  1Q8K A;  1NJI C;  1YNX A;  5IYD H;  2UUA L;  2NVY H;  4LF7 L;  3HOU H;  3K7U C;  1EWI A;  1QUQ B;  3S1N H;  3PIO A;  3H15 A;  2E5L Q;  2GVA A;  4LWC A;  4L5S A;  1FJG Q;  3AYH B;  2GN5 A;  4AQY L;  3U58 A;  2UUB Q;  3S15 H;  4JI8 Q;  5GAG C;  4DV5 L;  3I4N H;  2BH8 A;  4LUV A;  1L0W A;  1KQS A;  2K5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...