4LF8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8Q00
2VS1A 4NXML 3J80i 2K50A 2VQEL 3UDGA 4BY7H 3HOZH 5C4XH 5AJ3Q 3CD6A 1QZHA 3GTJH 3CCVA 1J5EQ 3KJPA 3U50C 1HR0L 4OWTB 4JI1L 1VCIA 3J81j 1PH2A 2R6GA 2MQHA 4AIMA 1I50H 4DUZL 3K8AA 1Z9FA 4GOPB 4A3JH 2E2HH 4YWLA 3AEVA 3FP9A 3H3VH 4A3BG 1D7QA 2YYZA 1X55A 2AWNA 5H1SE 1YI2A 2NZOA 2CFMA 1EYGA 2HHHL 1XMQL 1VQNA 3S1QH 3HFZB 1XNQQ 2UXCL 4ME3A 4IJHA 1P8LA 4LUZA 1PH4A 1S40A 5LMNL 1IBML 2ALYB 3CC2A 4QY7A 3CF5A 3CCMA 1BKBA 2H5XA 3PUWA 2QA4A 4HJ9A 2DGYA 4A3KG 2LXJA 4LFAL 2LSSA 3BU2A 2RCNA 2VW9A 5JJKA 2Z0SA 4DV5Q 2JE6I 3NBHB 3CXCA 5M5WH 1E1TA 3PUXA 2PMZE 1Q46A 3CCEA 1JJGA 1J6QA 1M90C 3HOUG 3S16H 3TS0A 1AE2A 2OCEA 3D0FA 1Y14B 4JI1Q 4BBSG 3AQQA 4KI0A 4DUZQ 3I4NG 4BXXG 4C2MH 2K52A 3RN5A 4DR1L 4JI6L 1HZBA 4A3KH 2D0OA 4JG2A 1N33L 1CSQA 3CCRA 1O7IA 5C0XJ 4LFCL 2ASBA 2UXCQ 5JEAJ 4UP7A 2MO1A 3L2PA 1XNRL 1X6OA 1YHAA 3ULLA 3S15H 5JJIA 1Q1EA 1K8GA 2JA7G 1C0AA 4X64Q 4OWWB 3CW2C 1PV4A 3I4NH 4BXXH 4OO1I 4UP8A 5FLXc 4A3MG 4DPGA 2JEBI 1GKHA 5ELOA 1PFSA 3STBD 4GN5A 4L5QA 1YJWA 2YTXA 2CKZB 3J7ZC 1VQGA 4OO1G 1YITA 1IYJB 3TQYA 4GKKQ 1GO3E 2JA7H 2Q2HA 4R4OA 5BR8L 3J80c 1B8AA 1HH2P 1YEZA 5C0XG 1SLJA 1K3RA 3RLNA 2IX0A 5DLQE 4R4TA 3UE1A 4POFA 5IP9H 1KIXA 2ZJQA 3OTOL 1L2FA 1A62A 2BA1A 1S3OA 3GD7A 4YHHQ 4HIKA 1N34L 1X9NA 4HJ5A 4A76A 4P72A 3KDFB 2JA8G 1D8LA 4O2DA 2KCMA 2UUCL 3STBC 2I0QA 1PH8A 2VNUD 2Y0SG 3DM3A 1YIJA 4YCUA 4LFBL 4DR2L 4DV0Q 1VQ6A 3E0EA 1Q82C 2F4VQ 3W1BA 4X65L 2R92G 3FKIG 1KL9A 2YTVA 2UU9Q 3TREA 1JMCA 2Z6KA 4R4IA 3PGZA 3KF6A 2R7DA 5GADC 3I55A 2ZJPA 1IZ6A 5BR8Q 1X65A 4IPHA 2ZM6L 5M3FG 1V43A 3MEFA 4J15A 1WI5A 2OQKA 1XPOA 1N34Q 1YNXA 1SRUA 1PH9A 3M4QA 1Y1WH 1SE8A 5IP7H 3PSIA 3PF4A 3ULPA 1VQ4A 4X6AH 5AJ3L 3I4MH 1CUKA 5IYBG 4GN3B 2I5LX 5GQOA 1NMGA 3FHWA 2VQFL 1B7YB 4IPCA 3M85A 4QGUA 4DR2Q 4LFBQ 3GTPH 2UXBL 4X65Q 4LWCA 1UE6A 2IHFA 2R93G 1VQFA 3CP0A 3E9HA 1SMXA 1RIPA 4C3HH 5HGQA 1NY4A 4BY7G 3HOZG 1QVCA 3PO2H 4DV2L 5C4XG 4BA2I 3PUZA 4LF5L 1MIUA 1A63A 1N9WA 2WB1E 2ZTEA 2HIXA 4RG1A 4YWKA 1VQOA 5IYBH 3HOYH 1XPRA 4AYBG 1YBYA 3F2BA 2CCZA 4Y52H 4TVAB 4GNXB 1K73C 1Q8KA 3CMEA 5E7NA 1CSPA 4MTNA 5C3EG 4FDBA 1A8VA 3M9BA 1IBLQ 1I5FA 5IY0A 2OWOA 1MJCA 4IPDA 4DV5L 5IWAL 4PG3A 4PMWA 1UE5A 1SFOH 4QQBX 2OQ0A 3K7AH 2N78A 3KLWA 3GTKH 1RL2A 3S24A 2ID0A 3GTMH 4KHPL 2HIVA 4JBWA 2VQFQ 3RZDH 3EIVA 2UXBQ 1PVOA 2GN5A 4LNQA 1Q1BA 2F52A 4EQ5A 4C3JH 4AQYQ 2EQSA 3S2DH 4BBRG 1GVPA 5GAHC 5C3EH 3A5UA 3SGIA 4GLXA 2R7ZG 4DV2Q 5GROA 3PIPA 1L1OB 2CWAA 4A3FG 4LW1A 1S72A 2BH8A 2IY5B 1ASYA 1BBUA 5GAGC 4IFDI 1KRTA 1DGSA 4IPGA 4X64L 4P71A 4EX5A 3TEHB 3RR5A 3RZOH 1NMFA 2B3GA 5GAEC 1QZGA 4DR7L 5LMUQ 4A3DH 4BBRH 2E8GA 1HNWQ 1KAWA 2WP8J 5IWAQ 2C35B 2PI2A 4LUVA 4GOPA 1IL2A 2R7ZH 4IFDG 2MO0A 1PYBA 1VQ8A 3CCLA 4GS3A 2JA6G 4A3FH 4JI4Q 2KCTA 4KHPQ 4B3ML 1SR3A 4OWXB 3HOVH 1TWCH 2HQLA 2JA9A 1CKMA 2QEXA 1YJNA 4GKKL 1B70B 2RHQB 1N32Q 5IYDH 3I2ZA 1I3QH 1G51A 1W3SA 3K7UC 4LF8L 4YHHL 4Y7NH 2JA6H 3KF8B 3CMAA 3U4VA 3RLOA 3S14H 2ATWA 3HKZG 2VZAA 4UP9A 1K8AC 4LF7L 4DR7Q 1VQEA 5IP9G 4WJ3M 4LUOA 4DV0L 1X3FA 1OTCA 2F4VL 2RHSB 2LXKA 1EFWA 1N8RC 3ICEA 1UE7A 1X56A 2UU9L 4L5SA 1UEBA 4B3MQ 4DV6Q 3GDEA 1FVIA 3I4OA 1WOCA 3GTLH 1MJEA 1G291 1NBWA 3UDFA 3NENA 2PI2E 2OTJA 2HT1A 2A19A 2I5HA 2KENA 4YCVA 3JC66 2Z6KC 3F2CA 1HZCA 1OXTA 1VQCA 1QVGA 4LF8Q 4DR4L 4DR5L 4JI5Q 3CC4A 2PQAB 4A3EH 1UE1A 1PH6A 2ZTCA 3CCJA 2E5LL 1Q12A 2CQOA 4LF7Q 4JV5L 4A3LH 4OONA 1EIYB 4RMFA 3F2DA 2VL6A 4DKAC 4BY1H 3S1MH 1QVFA 1LM0A 4GN4B 1VQ5A 4B3TQ 4K0KQ 1Z47A 1Y1WG 1NTGA 5IP7G 4A3GH 2K14A 1IXRA 1YHQA 3I4MG 4JYAL 2JA5G 3UE0A 4HIOA 1E7ZA 5IT9c 2D62A 3KDFA 4IJLA 3PCOB 5FLMH 1VQAA 1Q7YC 2K75A 3KYHC 3T1YL 1VQ9A 4AYBE 4DR4Q 2EXDA 4NXNL 1IBLL 1VQPA 4BA1I 3HKSA 4DR5Q 1PH5A 1ASZA 3PO2G 4MNOA 3PF5A 4QIWE 1KQSA 4KLKA 3F8TA 4XTCS 3GO5A 3L0OA 2CWPA 2JA5H 3HOYG 4JI8L 3W1GA 2E5LQ 5EAYA 4A93G 4JV5Q 3CPFA 3IRBA 3S1NH 2OTLA 4JI0L 1KRSA 4R1JA 1C9OA 3W5OA 1WCMH 2F3IA 2NVXH 2JK8A 5M3MH 2AKWB 4AQYL 4MZ9A 1HNXL 2XTIA 4HJ8A 3GTGH 1FJGL 3I7FA 3HOWG 4JYAQ 2BH2A 4HJAA 1G6PA 4LF6L 4QL5A 3BZKA 4X66Q 1Y1VH 2YV5A 4GLAC 4DUYL 2BA0A 1UWVA 2EIFA 2RF4A 3A5ZB 4O0AA 4P75A 3U58A 2NN6I 1Q81C 4UY8C 3M4OH 3TS2A 4PZ8A 3I56A 3K81C 2K5VA 3T1YQ 3TRZA 5IYCH 4L5TA 3CCQA 1YVCA 4NXNQ 1KXLA 3G71A 2B29A 5LMUL 1XTDA 1VQMA 1HNWL 1CKNB 4YWMA 4NPSA 3HOWH 2IHEA 4XIGS 4POGA 2VUMH 1U0LA 4PZ6A 3GTOH 4IFDJ 4JI8Q 4JI4L 1VQBA 4P74A 3S1RH 2UXDQ 4JBKA 3KOJA 4JI0Q 4GOPC 4A3IH 1V9PA 1HNZQ 4LF9Q 4IO9A 3CPWA 5FJ8G 4X62L 4DV4L 1N32L 4A3DG 4DV7Q 1NJIC 1GM5A 5M5XH 1KC8C 2UUAL 1HNXQ 3S17H 4GNXA 3JAMi 1FJGQ 1OXXK 3LGJA 2KHJA 1WYDA 2E2IH 4LF6Q 2N8NA 2MNAA 3VDYA 5JJLA 1EWIA 3ER0A 4DUYQ 3M7NA 3HOVG 1E24A 5IYDG 4DV3L 1VS0A 4B3SL 3S2HH 5C44H 4A3CG 5FJ8H 3AFPA 4APVA 2A8VA 3EBEA 3G6EA 4DR6L 3HKZE 1YHBA 2D0PA 4JI3Q 1KD1C 3AYHB 4JOIA 4WJ4A 2WFWA 3A0JA 1V1QA 1I94Q 1P16A 3WWVA 4YY3L 4DV6L 1JJ2A 3K80C 1EUJA 2WB1G 1L1OA 1JB7A 5ELNA 1EQRA 3J81i 1PYSB 1NE3A 1SN8A 2MFIA 4X62Q 1X3EA 4JI2Q 4DV4Q 1K9MC 1HJPA 2UUAQ 3RNUA 3H0GG 4A3CH 4JI7L 3M4PA 1VQHA 3EN2A 3OW2A 3RLFA 1IBKL 2JJQA 2WAQG 3BZCA 1M1KC 3A74A 3NELA 4A3BH 4JI5L 2L15A 4NXMQ 2VQEQ 1AE3A 4DV3Q 2YTYA 2K4KA 1PH7A 4B3SQ 1VQIA 4DR6Q 2I5MX 4UPAA 4P73A 3U4ZA 3G4SA 4JBJA 2PNHA 2Y0SE 3D31A 3H0GH 2IT1A 1HR0Q 2UUBL 1XJVA 1XPUA 1MKHA 1EOVA 4B3TL 4K0KL 3CQZH 2GVAA 1VQDA 4YY3Q 3KFUA 2QGQA 4IOAA 2N3SA 3PUYA 4A3EG 1EQQA 2HHHQ 1XMQQ 2K5HA 4A3LG 3PO3G 5IE8A 5J3BA 1TWAH 5LMNQ 4BY1G 1IBMQ 4JI7Q 3PV0A 4H02A 4JC0A 1IBKQ 3HOUH 1TWGH 2NVQH 3J7A5 4GKJL 1JT8A 3PUVA 4BBSH 4A3GG 4LFAQ 1R9TH 1E1OA 3NEMA 4KHZA 1BVSA 2NVTH 1X3GA 3ZJYC 1KHIA 3E9IA 1Q86C 2Q2TA 5C0XI 3JAMc 4PZ7A 4OXPA 1TXYA 2N49A 2NVYH 2NZHA 5FLMG 2ZJRA 4DAYB 1I6HH 3PO3H 3F1ZA 2YU9H 1LYLA 3BJUA 2Q2UA 1WJJA 1JE5A 1PA6A 2UUBQ 3CCSA 1YJ9A 1PH3A 1A0IA 1K0RA 4DR1Q 4JI6Q 2JQOA 3B6YA 1K83H 2A1AA 3HOXG 1XMOL 1N33Q 3T1HL 2KBNA 2B63G 2E2JH 1FL0A 1L0WA 5JEAG 4A3MH 4LFCQ 4X66L 3DLLA 3KF6B 2Q2IA 4C3IH 1XNRQ 3KJOA 2V1CC 3ERSX 3CCUA 1LUZA 1WCMG 1OXSC 2PQAA 4YCWA 2IX1A 5M3MG 1E22A 1FGUA 4GKJQ 5C4JH 1X54A 4DR3L 3CC7A 1LTLA 4HJ7A 3J81c 4GLVB 1C7YA 4IOCA 2JEAI 3HOXH 4DK3C 1Y1VG 2B63H 2VY3A 1VQ7A 4B3RL 1N36L 1TWHH 1PH1A 4LF4L 2UXDL 1VQJA 1W2BA 1EIFA 2AMCB 2KHIA 3GTQH 1GD7A 5IYCG 1HNZL 4LF9L 4NB3A 1T9HA 4JBMA 2JA8H 1OXVA 3CAMA 1BBWA 4DV7L 1WFQA 1SROA 4DV1L 1JJCB 1XMOQ 4A93H 2R7FA 2DUDA 4A75A 3T1HQ 4LF5Q 2VUMG 2ZTDA 3MXNB 5K36G 3OTOQ 4HIMA 1HR0W 1HZ9A 3L7ZC 5M5YH 3PIOA 4OX9L 1QUQB 1HZAA 4HIDA 1YZ6A 4A4IA 3FKIH 4QJFA 4GNXC 3RN2A 4A3IG 4L5RC 2R92H 4AH6A 3UDXA 3H15A 1VQLA 1U5KA 4ALPA 4DR3Q 2UUCQ 1OXUA 1J5EL 2FXQA 4JI3L 1VQKA 1H95A 2R93H 1E3PA 2NN6G 4R4CA 5LMNW 4DAMA 1PHJA 1N36Q 4LF4Q 5M3FH 4B3RQ 1I94L 2AHOB 2AWOA 3H3VI 2GVBA 4TQUS 1CKOA 4R4QA 2K5NA 4JOIC 5C44G 1XNQL 1QUQA 4DK6C 2ES2A 4JI2L 4DV1Q 5HY6A 4DNIA 1L1OC 1TWFH 4JCVE 3ULJA 3Q8DA 3UDIA 2XGTA 3AFQA 2ZM6Q 4A3JG 3K0XA 3M3YH 3OYYA 4OX9Q 1CKNA 3G48A 1AH9A 2WAQE
chains in the Genus database with same CATH superfamily
2VS1A 3Q6SA 3J81E 1HFNA 4ILWA 1CTMA 2QEJC 4R8NA 1QNUA 3GTJH 3CCVA 1J5EQ 2BDOA 1HR0L 4V0BA 3J81j 1PH2A 4AIMA 2MQHA 1ONLA 3AEVA 2O2LD 2K7VA 3QOLA 5H1SE 2NZOA 3S1QH 1XMQL 3QJYA 4OELB 3QWNA 3S1RB 1IBML 4NW2A 4ZAIA 2IL8A 4IUNA 5C5MA 2DGYA 1F9RA 3S17B 2LKVA 3NBHB 1QCBD 3PUXA 2FMMA 1MBYA 1J6QA 2H1EA 1M90C 3S16H 1U4RA 2OCEA 4BBSG 2SNMA 4DUZQ 4C2MH 1PLFA 5C44B 2A6EC 1I4QA 4OHJA 4JG2A 3K6OA 3CCRA 5L37A 4F87A 4IALA 4LFCL 1DXMA 2UXCQ 5JEAJ 1E0BA 1Q3LA 3ULLA 3C46A 3S15H 3MWYW 2X6LA 2JP1A 3VR2A 1C0AA 4X64Q 1G8ZD 4OWWB 3CW2C 4BXXH 5FLXc 4DA2A 4Q0FA 3NTIA 2JEBI 1GKHA 1PFSA 1Q8IA 2F3VA 1GOZA 2YTXA 4G57A 3ND9A 1GO3E 4IQZA 2JA7H 2F0KA 2B2VA 2EY2A 4RGTA 1K3BC 4EQPA 4S3SA 5IP9H 4FXDA 1IL8A 1I4RA 1A62A 2BA1A 2GA4B 3LWUA 1EWHA 1X9NA 3KDFB 2IPKD 5I4DA 2BOSA 1YNNC 2XVSA 3STBC 2NBFA 3URYA 2I0QA 2VNUD 3J7YW 3E0EA 2NVQB 4DN4M 4X65L 5DM63 3T51B 2J0TD 2UU9Q 5CV9A 5BN3A 2FHTA 5KNDA 3PGZA 3KF6A 2NVYB 2OXPA 2ZJPA 5BR8Q 1X65A 2SNSA 4K6LA 1JWUD 2YU9B 2RKSA 4IPHA 4R8IA 1H9MA 3FRPB 2EYPA 3BVZA 2EVBA 4X3UA 4IUTA 1SE8A 3ULPA 3BG3A 2I5LX 1F2MA 1NMGA 4QGUA 3GTPH 5C4JB 5CGKA 3E9HA 1JC7A 1RIPA 5ELCA 1EU4A 3TP8A 5HGQA 1QVCA 4B08A 5JPMC 1H9SB 1N9WA 2WB1E 4FXGC 1SBBB 3HOYH 2HCIA 1HUNA 3HEJA 1LLRD 5E7NA 1IBLQ 3M9BA 4PG3A 4PMWA 1SFOH 4IUVA 1RL2A 2FJ2A 1NUCA 2E76C 4LAAA 1HXYD 1STGA 2GN5A 1TIID 2F52A 1GUSA 5GAHC 5C3EH 1LT6D 3SGIA 2DNCA 3A5UA 1BXTA 4ZUIA 1EY8A 2KEDA 4A3FG 1S72A 5M3FB 3FMCA 3FDTA 5GAGC 1KRTA 3OIQA 5NUCA 5BN5A 1DGSA 4IPGA 3RZOH 1NMFA 4CDDC 1BQQT 2E8GA 1TWFB 1EU3A 3BDCA 3QG1A 4BBRH 1IL2A 1EY5A 2R7ZH 2F0TA 2L5TA 4FF3A 2KCTA 1MI2A 1CKMA 1EFID 1B70B 2RHQB 5IYDH 3GTJB 1PRTC 1I3QH 3TSSA 2F0UA 3HP3A 3K7UC 1EEFD 4AYBB 4UHVA 2HQEA 4XQJA 4LF8L 2IWHA 5D14A 3S1QB 3CMAA 4CDCC 3HKZG 1VQEA 5EPJA 1EFWA 1UE7A 1W6KA 1X56A 4L5SA 2K04A 4DV6Q 1FVIA 3NENA 2PI2E 4IUUA 3MC0B 2A73B 1SYEA 1VF5C 1OXTA 4OGQC 3M4YA 1QVGA 2NTSA 2M00A 2KJXA 3TDQA 3VR4A 5I2XA 1Q12A 3S15B 5EKKA 3F2DA 2KEEA 2KA7A 4DKAC 4BY1H 3NBIA 5JVH3 4GN4B 1RTNA 1VQ5A 4B3TQ 2K33A 1Z47A 1IHZA 1YHQA 1IXRA 1O7YA 1T5EA 1PTOH 3VR3A 3T13A 1GXDC 3J80L 5FLMH 3OIPA 1VQAA 1S4ZA 4G7ZC 1HPCA 2EXDA 2L1BA 4NXNL 4BA1I 3HKSA 4DR5Q 2ZXOA 2PZUA 4RGNA 2K5DA 4DF7A 4B9XA 3F8TA 3NTHA 2CWPA 1TS2A 3E6ZX 2E5LQ 4WFN3 2ICEC 4DK1A 4AQYL 2NB0A 3OWFA 4MZ9A 4DK0A 4DXGA 5LL6X 1BUVT 1JORA 1FJGL 3I7FA 4JYAQ 4QL5A 4RCOA 4P2CB 4RGOS 4X66Q 1Y1VH 2EIFA 1LT5D 3A5ZB 4O0AA 3TZDA 1LTGD 2NN6I 2PO4A 3TRZA 2K5VA 3T1YQ 4C3JG 3CCQA 1YVCA 4RCNA 1KAAA 3G71A 5LMUL 4JVZA 4KY5A 1HNWL 1DZ1A 5FKAC 4NPSA 2XWJB 2RCFA 4XIGS 4IFDJ 3GTOH 2E74C 1HHVA 4A3IH 1HNZQ 1JE4A 4IO9A 4X62L 3DUZA 4A3DG 4DV7Q 1GM5A 1IYVA 3OWEB 1WYDA 5CBAE 2N8NA 2MNAA 2NN6H 1LTRD 5EPKA 4B3SL 1R4PB 3DEPA 5C5LA 3BS1A 2A8VA 3HOYB 4DR6L 3HKZE 4XXEA 5TSSA 1KD1C 1HUMA 4ZCKA 3A0JA 1JJ2A 1ZKOA 3MVVA 1L1OA 1SFOB 5ELNA 1K8MA 5CMDA 1NE3A 4A3CH 1SMYD 3OPOA 1U4MA 3L9AX 5EGTA 4G4KA 3BZCA 2B8GA 3DWAA 4J8QA 1VF7A 4MTKA 4QCLA 4DV3Q 3G4SA 4JBJA 1HR0Q 2Y0SE 1D1IA 1NR2A 1F9SA 3D31A 2UUBL 5EBDA 3RZOB 2KECA 3CQZH 2B39A 1EY6A 3R8BA 2QGQA 3PUYA 1EQQA 1PRTB 1QNKA 1XMQQ 4A3LG 5IE8A 3MXPA 1TWAH 4JI7Q 1IBMQ 3C3LA 1SJHD 4JC0A 1TWGH 1STYA 4KKUA 1IW7D 3I91A 1I3QB 4Z9CB 1HA6A 5M9OA 1SNPA 2TMPA 3E9IA 1D7QA 2NZHA 3G6JB 1H9JA 1I6HH 1SE4A 4Q5VA 1WJJA 3CCSA 2WB1B 1A0IA 1I6VC 1K0RA 4KN7C 1AZPA 1ENAA 4MN3A 1YNJC 2KBNA 2B63G 1TY2A 2RDHA 4A3MH 4LFCQ 2F0DA 1WCMG 1OXSC 5M3MG 2E75C 4CJ1B 4ZUJA 1LTLA 5C3WA 2XNAC 1PRTF 2JEAI 1QILA 2LFNA 2VY3A 1S5CD 1U4LA 2AMCB 3VYRA 2JN4A 1TR5A 3NE5B 2F0VA 3DWPA 4LF9L 1SNMA 5FO9B 4JBMA 1JICA 2F0OA 1WFQA 2Z4HA 4DV1L 1JJCB 4DNTB 2DUDA 1Y69U 2VUMG 2ZTDA 4BY1B 5IGFA 2EJFC 1PZKD 5M5YH 5A2QE 4KD3A 5EQ0A 1YZ6A 4HIDA 2R92H 4L5RC 1II3A 4AH6A 2EYFA 1LV9A 3DMUA 1OXUA 1PMRA 3SXHA 1LTBD 3SK5A 1RDPD 4JI3L 1H95A 4CGYB 4R4CA 1DM0B 4DAMA 5LMNW 1KLUD 2AHOB 2GVBA 1CKOA 3HOXB 2K5NA 1XNQL 2ES2A 3T56B 3ULJA 3Q8DA 1PYWD 2AQ3B 3M3YH 1DONA 2WKCA 1CKNA 4RWSC 1QVFA 3ONAB 4NXML 2VQEL 3HOZH 1Y1VB 3SHLA 1KTKA 3CD6A 4U68A 4JI1L 5I6WA 1B4OA 2R6GA 4A3BG 4YWLA 2EYOA 4EQOA 1V1PA 1VQNA 2CFMA 5C4HA 3GTOB 4ME3A 4LUZA 2A6HD 1S40A 4A3IB 4N8FA 3PUWA 1K0SA 4LFAL 1DCZA 1ET9A 3MFGA 3X3MA 3BU2A 2RCNA 2Z0SA 4ZQ3A 3T53B 3CXCA 2QDLA 2L4NA 5M5WH 1TU2B 5K5PA 1BCPD 1GUNA 3HOUG 3TS0A 4K8IA 4OIJA 1MD2D 1V8QA 4BXXG 1HZBA 3D4DA 5T1GA 2D0OA 1NNXA 1DD2A 5A35A 1O7IA 3V96A 2ASBA 2XN9C 2E2HB 4RFBA 2KCCA 3NQTA 1XNRL 2JA7G 4E6IA 4KTAA 4OO1I 2EJGC 4UP8A 2MUYA 1B50A 1HTLD 3DM1A 1QWYA 3KLSA 4C3IG 4L5QA 2F0WA 3A7LA 1UEAB 2CKZB 2Z6BA 1SNCA 1A2UA 1YITA 1KNEA 3J80c 1HH2P 3TN2A 1E2ZA 3UE1A 1PFBA 1L2FA 1JOQA 3CQZB 4A3KB 5F2DA 3WOFA 4P72A 2JA8G 1B3AA 4O2DA 5IGDA 2KCMA 4OO1H 1DOMA 1PH8A 2F1MA 3KBGA 2XWBB 1TWAB 1PTOD 4LFBL 1O80A 4DR2L 1VQ6A 1Q82C 1TWGB 5I6YA 3FKIG 1KL9A 2ICIA 4I65A 2DJGC 2R7DA 4I7ZC 1I6HB 3K5NA 1FNUA 3MEFA 4JPBW 4HCSA 4G7OC 1WI5A 2OQKA 1N34Q 1F9PA 1PH9A 3M4QA 1ENFA 2EY6A 3PIP3 4A3MB 3C2PA 1M4VA 3LWEA 1CUKA 4MIUA 5KNBA 3FHWA 2F3WA 1S5ED 4FO2A 4IPCA 3RUZA 3EFXD 2VQFL 1WTWA 1G6ZA 2CW0C 2R93G 4NKLA 1NY4A 4BY7G 1K8OA 3PO2H 5C4XG 3K0YA 3PUZA 1QJOA 5C6AA 2HIXA 1Z6HA 1VQOA 5IYBH 4K5WA 5KGUA 2F0MA 4Y52H 3I70A 1K73C 1Q8KA 3CMEA 4MTNA 5C3EG 4FDBA 1A8VA 1I5FA 5IY0A 1MJCA 4WRDA 4IPDA 4DV5L 2HCCA 2KHSA 2Y0SB 3NTKA 3VA5A 4G7HC 4IZ8A 5M5YB 3DEOA 2R92B 2ID0A 3DWQA 3GTMH 2AUJD 2PYKA 2L9HA 3EIVA 2UXBQ 2I46A 3S2DH 4EQ5A 4AQYQ 4BBRG 3EQLC 1B9MA 2R7ZG 4HEDA 4DV2Q 5GROA 3PIPA 2M9VA 1BBUA 1EQTA 2M2LA 5HGTA 3E3XA 1RTOA 3V05A 1CQVA 3TEHB 1QZGA 2A69D 2B2TA 5LMUQ 1U4PA 3P75A 2WP8J 5IWAQ 2C35B 4LUVA 4GOPA 1HNWQ 4HSPA 3M3YB 2MO0A 5G3LF 1SAPA 4KHPQ 4B3ML 2KOLA 2V4DA 1EZ6A 3E5SA 3AMUA 3NP8A 5BN4A 3HOVH 2QEXA 3HS0C 3HOZB 4GKKL 3I2ZA 3DHQA 1XTCD 2K6AA 1LACA 1W3SA 5ELDA 3RZDB 4DFAA 4YIJA 2F4IA 2B2VC 1XX8A 2JA6H 2DN8A 5EJWA 1LT3D 3U4VA 3RLOA 2ATWA 1EYCA 4LF7L 4DR7Q 4LUOA 4XQNA 1W6JA 2RHSB 4HMJA 5ELFA 3BDLA 3NWTA 1UEBA 4ZKCB 5IIFA 1C8CA 1MJEA 5M5WB 1A3UA 4XT3B 1HCZA 4YCVA 2VXWA 4H13C 4BWGB 3F2CA 1HZCA 3QO2A 1VQCA 1UNSA 4HN7A 1UE1A 3K5MA 4JV5L 4HTHA 3S1MH 5I9OA 1LM0A 3NHHA 1SYDA 3T16A 1Y1WG 4NP5A 1NTGA 5IP7G 4A3GH 1CQFA 3I4MG 3UE0A 3MZ5A 5IGBA 5DEHA 1A15A 4IJLA 1S5DD 4HAEA 1Q7YC 5KYIA 3KYHC 2RBMA 4TKOB 2JXMB 1WTQA 4DR4Q 4C3HG 3W2DA 4QIWE 3PF5A 4XTCS 3GO5A 4H0LC 2EY5A 5EAYA 1STHA 3MA2B 1BDOA 4JI0L 2LY7A 2NVXH 2O5JC 2FMCA 1D6EC 4ZYSA 2AKWB 3K59A 4XYOA 2XTIA 4HJ8A 1SDFA 2DNEA 1G6PA 4HJAA 1PZID 4LF6L 1SE3A 1G2TA 2YV5A 3U58A 2RF4A 3TS2A 2K03A 3I56A 1QG7A 5IYCH 4L5TA 1R4QB 1XTDA 1VQMA 3F2UA 1U0LA 4JI8Q 5K36H 4P74A 1SNDA 3IAYA 4LF9Q 1KNAA 2JA5B 1C4QA 1NJIC 2UUAL 1HNXQ 4GNXA 4HR7B 5T1IA 2HUGA 2A68C 4CKCA 4CKEA 3VDYA 1B1ZA 3ER0A 4DUYQ 4R9WA 4QUCA 1F2YA 2RQXA 2Z9HA 3PO2B 3D4WA 1VS0A 3S2HH 1D5ZC 4A3CG 5FJ8H 4A93B 4FP5D 3M4OB 2D0PA 4JI3Q 1HFGA 1O7ZA 2OT2A 4JOIA 4ME5A 1STNA 2J7ZA 5COYA 2HD3A 1SN8A 2MFIA 4DV4Q 1H9KA 1K9MC 3K57A 3GTMB 3H3VC 1JR0D 1VQHA 2BE5C 5IOCA 1IBKL 1UAPA 1LT4D 3S2DB 2WAQG 1M1KC 5KIXA 2O4XA 3AB9A 4NXMQ 2VQEQ 1O7LA 2QDBA 1VQIA 2EYLA 1CT1D 2I5MX 4ULLA 4UPAA 2PNHA 1XPUA 1SEBD 2IT1A 1A6XA 1NAPA 1EZ8A 4YY3Q 1AZQA 3KFUA 2N3SA 4IOAA 1ENCA 4A3EG 4RHRA 1EY4A 1PFNA 3KF8A 1XWEA 2PW5A 5J3BA 3HOVB 3J7A5 4GKJL 1B53A 3PUVA 4BBSH 4LFAQ 1R9TH 3O13A 3H94A 4ZRZA 1G2SA 3A7AB 3ZJYC 3HZXA 1Q86C 4LJZC 3PIO3 2HDMA 2X69A 2ZJRA 2JA6B 3PO3H 4KY7A 4RA8A 1YJ9A 1PH3A 1K83H 1LTID 3T1HL 3G7LA 2C9OA 3H0GB 4FVMA 1WTVA 5CBEE 1L0WA 3KF6B 2Q2IA 1XNRQ 2V1CC 3CCUA 2PQAA 2DY7A 4YCWA 4F7XA 1E22A 2ZT9C 4HCEA 3CC7A 2QW7A 5D3IB 3HOXH 3R93A 4B3RL 1N36L 4LF4L 5D65A 5JEAH 1KDAA 2KHIA 3GTQH 2PZTA 5CYUA 1T9HA 1SSOA 4QB4A 4N8X1 1OXVA 1BBWA 5EPLA 4RH6A 1XMOQ 5CR3A 2L0CA 3VYUA 4A75A 2KVMA 2L11A 2N55A 3S1MB 2PQEA 4HIMA 5IT9L 4WJ3M 3PIOA 1HZAA 4QJFA 5I2YA 4A3GB 2E2JB 1VQLA 4DR3Q 2JYOA 2SOBA 4JW0A 3D3RA 1J5EL 1RCVD 1ZYRD 2FXQA 4DU9A 5HURA 1EYAA 1A3VA 4R4QA 5C44G 5C3XA 4JI2L 1VMPA 1GUTA 3UI2A 1Y8NB 1L1OC 3UDIA 2NVXB 3K0XA 3N52A 3OYYA 4OX9Q 4RG1A 1BBXC 2XSCA 1AH9A 2WAQE 3J80i 1FNWA 5D3DA 1JOOA 3UDGA 1FNVA 4OWTB 3C1FA 4DUZL 2E2HH 1I50H 3K8AA 1JB3A 4PMCA 3FP9A 5E1FA 2YYZA 1X55A 4L6TB 3KLSX 3HFZB 1X32A 2UXCL 4MHEA 4IJHA 3MEHA 2A6ED 1PH4A 5LMNL 3CC2A 3D6CA 3CCMA 1I4PA 2H5XA 4HJ9A 2LXJA 3I90A 2EY1A 1BO0A 2A5HA 1Z7TA 4DV5Q 1SYGA 3GQBA 1D1KA 1E1TA 2PMZE 3BVGA 2CH4W 4IURA 2O5IC 5E3FA 5ELBA 1AE2A 3D0FA 1EIGA 1EYDA 3A8KE 3N6RA 3S2HB 2K52A 4DR1L 4JI6L 4KY6A 2JSOA 4A3KH 1CSQA 2R61A 5C0XJ 1SE2A 4J6HA 2PPBC 4A3JB 4UP7A 2MO1A 3L2PA 5KRUA 4QIWB 1MGSA 5JJIA 1A3TA 1Q1EA 1K8GA 4K5XA 3I4NH 2EXZA 3D6WA 1WTOA 1H9RA 1YNND 3STBD 1YJWA 2E2DC 4OO1G 1IYJB 4GKKQ 4R4OA 5BR8L 1B8AA 1PDQA 1YEZA 5FO8B 5C0XG 1GUGA 1K3RA 2XRSD 2IX0A 5DLQE 4R4TA 3RLNA 4LF5L 4RKLA 2D9UA 1S3OA 3GD7A 4KD4A 4HIKA 3MHBA 4HJ5A 4A76A 1D8LA 1L0YB 2ZXPA 2HDLA 4DAYA 4KJNA 3DM3A 4YCUA 3GV6A 2EE1A 2B2YA 4BBSB 1TVXA 3JAML 1R9TB 4O42A 1JMCA 2Z6KA 5GADC 1ET6A 2G9HD 2K32A 1IZ6A 5ELEA 4DXFA 3PO3B 5M3FG 1E2VA 2AQ1B 1K83B 1YNXA 3NQIA 1QE6A 3FPPA 1HQRD 3PF4A 1JWSD 5AFWA 4X6AH 5AJ3L 5IYBG 5GQOA 3KK7A 1F2ZA 3J81L 3M85A 3SDZA 2J4XA 4LWCA 3LNNA 4X65Q 2RSNA 3CP0A 1EY7A 1SMXA 3J80E 1Y8PB 3MXNA 4ZK9B 1A63A 1MIUA 2ZTEA 4FF2A 3TP7A 4YWKA 1GHJA 3GTQB 4AYBG 1YBYA 2CCZA 2F0SA 2QKIC 3CRLC 2K1BA 2OWOA 3T4AC 3GTKH 2N78A 2IW3A 2HIVA 4JBWA 3RZDH 1PVOA 2F03A 1Q1BA 4C3JH 5IT9E 2D2CC 4X3KA 4GLXA 1SYFA 1L1OB 1CFMA 2BH8A 2IY5B 4C56C 1SNQA 1PRTD 2C5CA 4IFDI 4H7BA 1IYUA 1STEA 2LMCB 3SVMA 1HRJA 1CHQD 5GAEC 1T5XD 4A3DH 1HA5A 2SDFA 2EYHA 3CCLA 4GS3A 2JA6G 3RD4A 1ILQA 1SR3A 4OWXB 3NWSA 3Q22A 1G51A 4V190 3MFYA 2F0QA 1I50B 4IFDH 4YHHL 3NBHA 4BS9A 1GUOA 1OO9B 2L55A 3OHXC 1GJXA 3BYTB 4UP9A 1K8AC 2MPMA 5IP9G 4DV0L 1X3FA 3CRKC 1OTCA 2F4VL 3R2TA 2QF7A 5JPNC 3GTLH 3GP7A 3I4OA 1WOCA 1G291 3UDFA 4ID6A 2OTJA 4A3FB 2A19A 3JC66 3R2IA 1TS5A 4LF8Q 1AFPA 4DR5L 4OEMB 4TRDA 2Q8IB 2CH4A 1RKNA 1PH6A 3CCJA 2E5LL 4A3LH 3MXGA 5IODA 1EIYB 4RMFA 2B2WA 2VL6A 3HGBA 3I73A 3I4NB 2K14A 4JYAL 1TS4A 4HIOA 2XRQD 5IT9c 3KUPA 3KDFA 3QB3A 2K75A 3T1YL 3SK4A 1G91A 2X6GA 4AYBE 1VQPA 1PH5A 3IFTA 4MNOA 3HKZB 1KQSA 2DJFC 4KLKA 3SE0A 3L0OA 2K5QA 4RKBA 1V1OA 2JA5H 3HOYG 3AU7A 1XYIA 1WVLA 3S1NH 4R1JA 1C9OA 5FO7B 1TS3A 3W5OA 1WCMH 2F3IA 1KDCA 2JK8A 4K5VA 5M3MH 1ICWA 2A74C 1BNZA 2BH2A 3BZKA 4GLAC 2BA0A 1UWVA 1TY0A 3BVMA 4A93H 3M4OH 3K81C 4WORA 1A2TA 2PMZB 3RMHA 4NXNQ 3OMGA 3I4LA 2B29A 3JAME 1F77A 4CJ0B 1CKNB 1S5FD 3HOWH 4POGA 2F0NA 2VUMH 2B2UA 2B2TC 4JI4L 2K5WA 4JBKA 3KOJA 4GOPC 1V9PA 1H9SA 2QILA 5FJ8G 2G5DA 1N32L 3H09A 2G9DA 1QOHA 5IGCA 5M5XH 1FJGQ 1OXXK 3LGJA 5J39A 2KHJA 2E2IH 1V1PB 1B3QA 2D5DA 3MXUA 4WJWA 1EWIA 1XXGA 1AN8A 3GTGB 4GZYC 4PV1C 1WTXA 5CC4A 5IYDG 4DV3L 1TQOA 3IKJA 3AFPA 4APVA 3G6EA 4PNYA 2LS01 4NDXA 5DAUA 2F0PA 4F8MA 3PMFA 3AYHB 1SNOA 4RGMA 4IUQA 4KJOA 1P16A 3P20A 3WWVA 4XT1B 1EUJA 1RHPA 2WB1G 1EQRA 3GTKB 1TKWB 4X62Q 1O78A 1X3EA 4JI2Q 1HJPA 4JI7L 3FPUB 3OW2A 3EN2A 3RLFA 3X3NA 2JJQA 4C3JB 1PZJD 3A74A 4A3BH 4JI5L 2L15A 2KQ3A 2IJ0A 4B3SQ 1PH7A 4DR6Q 2ZJQA 1FD7D 3H0GH 4DGZA 1XJVA 1MKHA 4OL7A 3KLRA 4K0KL 4A3DB 1SMYC 1VMCA 1LTTD 2NYZD 2PZWA 3PO3G 3MTSA 1ILPA 3HG9A 5LMNQ 4BY1G 1YNJD 3PV0A 3HOUH 1JT8A 4ZLTF 1CI3M 3V2TA 4CBVA 2NVTH 1KHIA 2Q2TA 2CVRA 3D8GA 4OXPA 1TXYA 2N49A 4K6DA 4N9TA 1CZWA 5FLMG 3JAMc 2AUKA 1WD0A 3F1ZA 1LYLA 2EJMA 3BJUA 1EOTA 2UUBQ 1GHKA 4DR1Q 4JI6Q 3B6YA 3HOXG 2A1AA 2E2JH 4XQQA 5JEAG 3A55A 2H4OA 1IW7C 4L8JA 4C3IH 3GTLB 1IKLA 2IX1A 1FGUA 5G3LD 1X54A 3VA7A 1AEXA 3CHBD 3J81c 2EDGA 2EOTA 4IOCA 2AQ2B 1Y1VG 1VQ7A 2EYMA 1TWHH 1PH1A 2UXDL 1VQJA 2PW7A 2F0IA 3EVQA 1I4HA 1GD7A 3PQIA 4ABNA 4NB3A 2JA8H 3CAMA 2Q8TA 1SROA 4FYDA 2NWGA 2R7FA 1JCKB 3HRZC 3VYSA 4LF5Q 4KN4C 1HR0W 1HZ9A 1QUQB 4GNXC 3RN2A 4A3IG 4A4IA 3FKIH 4XDXA 4ALPA 3QOJA 3KBXA 1SXTA 2NN6G 2NUCA 3ZYYX 1I94L 2AWOA 3H3VI 1HQMC 4TQUS 4J1MA 4JOIC 2B63B 3A8IE 1U9RA 4DK6C 3K5LA 4DV1Q 5HY6A 3S1NB 4DNIA 3BZDB 2Q8RE 4JCVE 1EY0A 1CK1A 2DY8A 3AFQA 1WCMB 1MSGA 1WD1A 5M3MB 2R93H 2K50A 2Z8LA 4BY7H 3Q24A 5C4XH 5AJ3Q 2BDNA 1QZHA 3Q0AA 1DJRD 3KJPA 3U50C 1VCIA 4GOPB 4A3JH 3OMCA 1Z9FA 3H3VH 3MAQA 2AWNA 1YI2A 2PCFB 1EYGA 2HHHL 3HOWB 1XNQQ 2VUMB 5J1ZA 1P8LA 1C48A 4QUFA 2ALYB 4QY7A 3CF5A 2VB2X 1BKBA 2QA4A 4A3KG 1ESFA 5M5XB 2LSSA 2QCPX 2VW9A 1NR4A 3U9SA 5JJKA 2JE6I 2E2IB 4EQNA 5C4ZA 1Q46A 3CCEA 1JJGA 3EA6A 4IN3A 1Y14B 4JI1Q 3AQQA 4KI0A 4KHVA 3I4NG 3RN5A 1B2TA 2A6HC 3TP5A 1N33L 1M8AA 3DXJC 3BYYB 1JWMD 4N9PA 2MGSA 4F88A 1X6OA 1YHAA 3VR6A 4K2KA 1PV4A 2SEBD 1BCPC 3CKIB 3ITPA 4A3MG 4M1UB 4DPGA 5ELOA 2RDGA 1MSHA 2MP1A 4GN5A 4A3BB 4K14A 3J7ZC 3I72A 1VQGA 1CHPD 3TQYA 2Q2HA 2OF1A 1L0XB 1SLJA 3BDOA 3S16B 4POFA 1KIXA 3WOEA 5CV8A 3OTOL 3C1EA 4C2MB 1FGBD 4K8JA 4YHHQ 1UUPA 1N34L 2Z1CA 1LO5D 2UUCL 4KMUC 4QMGA 5A2QL 2Y0SG 1YIJA 4ODGA 4DV0Q 3HOUB 2F4VQ 3VYTA 3W1BA 2R92G 3NUCA 2YTVA 3H91A 3FEWX 2NVTB 3TREA 4R4IA 2CW0D 5CORA 1CA5A 3I55A 3FVQA 1EEID 4DNRB 2F0JA 3CU7A 1FR3A 2ZM6L 1V43A 1ZXTA 1D2BA 5E4XA 4OIKA 2JA7B 4J15A 1XPOA 1PTOC 1SRUA 2CQAA 1Y1WH 5IP7H 3PSIA 1VQ4A 2RDFA 3I4MH 4C3IB 4C1NK 4GN3B 1B7YB 4EGVA 4DR2Q 4LFBQ 2UXBL 1I4GA 2FFKB 1UE6A 2IHFA 3QR8A 1VQFA 4C3HH 3SK6A 4FF4A 3HOZG 4DV2L 4BA2I 1TWHB 3IL8A 1KABA 1XPRA 3F2BA 3EJIA 4TVAB 4GNXB 2RA4A 2JA8B 1CSPA 1B44D 2P5ZX 2WACA 1LTSD 1QB5D 5IWAL 1UE5A 4QQBX 1F9QA 2OQ0A 3K7AH 3KLWA 2EZVA 3S24A 5IGGA 3FKIB 4KHPL 1S5BD 2VQFQ 4LNQA 3U9OA 2EQSA 4RHSA 5JVG3 1GVPA 3GTPB 2CWAA 3ERQA 4LW1A 1EIHA 1ASYA 1CM9A 2NZ1D 4O1NA 2R3ZA 1AW7A 1ICFB 5DM73 1STAA 4FXKC 4X64L 4P71A 4EX5A 3RR5A 2B3GA 4DR7L 4PMBA 4K2LA 1KAWA 2PI2A 3OOCA 4IFDG 3L3OC 1BOSA 1VQ8A 1PYBA 1J8IA 5EKLA 5JAVA 4A3FH 4JI4Q 2R93B 4IUPA 4BY7B 1TWCH 2HQLA 2JA9A 2VB3X 1YJNA 5C4XB 5EBCA 2NTTA 1N32Q 3D4RA 3IFDA 2WKDA 4M8AA 1ML0D 1HTPA 3S9WA 3SR1A 5CV5A 3A56A 3EROA 4KK7A 4Y7NH 2A69C 5C3EB 3KF8B 4X3TA 2F0GA 3S14H 2VZAA 2WINB 2KUMA 2N88A 2LXKA 3A54A 1N8RC 1NSNS 3ICEA 1AP0A 2MHVA 2UU9L 4B3MQ 4BBRB 3GDEA 2K01A 1WTRA 2B2YC 2R7ZB 1NBWA 4L63B 2F0EA 3M7GA 1E2WA 2HT1A 2KENA 2I5HA 2Z6KC 3SK8A 3NXWA 4DR4L 5CV6A 2ENBA 2RSOA 4B9WA 1TT2A 4JI5Q 4KV6A 1BCPB 2RVLA 1SYCA 3CC4A 4KKSA 2PQAB 4A3EH 5KEEA 4I7AA 2ZTCA 4NMZA 2CQOA 4LF7Q 3LX0A 4OONA 5FLXL 4H44C 1DYQA 1RODA 4K0KQ 1CA6A 1ESRA 3NPPA 2JA5G 1E7ZA 2D62A 3J7AV 3PCOB 3NSWA 1VQ9A 3ND8A 1CZGA 1IBLL 1ASZA 5J22A 3PO2G 4DAPA 2K05A 4LK1C 4UAIA 4JI8L 3W1GA 4A93G 1FYCA 4JV5Q 2EYJA 3CPFA 3IRBA 2OTLA 1KRSA 4CJ2C 1I4XA 4PQXA 1EWCA 1BR9A 2IX3A 1HNXL 4X3SA 3GTGH 2FINB 1BCPF 5LL6S 1DOKA 3HOWG 2I07B 4JK1C 3R3OA 4DUYL 3QIAA 4P75A 2F0LA 1Q81C 4UY8C 3P1HA 4PZ8A 1PTOB 2A68D 2XIWA 1LABA 1KXLA 1WTPA 5ISRA 4LMQD 5EKIA 4YWMA 2IHEA 3I8ZA 4PZ6A 2UXDQ 1VQBA 3S1RH 4HSVA 4JI0Q 5KYLA 1Y1WB 5I9PA 3CPWA 1DOLA 1RJTA 3I4MB 4DV4L 2CHBD 1RF2D 1KC8C 3S17H 3JAMi 4LF6Q 5CV4A 5JJLA 3M7NA 4C3HB 3HOVG 1E24A 2BE5D 3VR5A 5C44H 1STBA 3EBEA 1X3PA 1YHBA 1BF4A 2EPBA 3J7AF 4WJ4A 2WFWA 1V1QA 1I94Q 4YY3L 2TSSA 4DV6L 3K80C 1PTOF 1JB7A 3J81i 3K7AB 2MJ8A 1PYSB 2B8FA 1SYBA 2UUAQ 3RNUA 1LTAD 3H0GG 3M4PA 3SEBA 3TZUA 3K58A 3NELA 1KLGD 1AE3A 2YTYA 2K4KA 4CHTB 1K28A 4P73A 3U4ZA 5LHY1 4U673 1D5XC 3NK9A 1EOVA 4B3TL 1B9NA 2GVAA 1VQDA 2WV6D 3TP6A 1IKMA 2B2WC 1J9OA 2HHHQ 1EL0A 5IGEA 2K5HA 3W3AA 2WIIB 5KNCA 4CDEC 1JOKA 4H02A 1TWCB 1IBKQ 5JJZA 2NVQH 1D5MC 2F0HA 3E0JA 1X3QA 4A3GG 1E1OA 3NEMA 4KHZA 1BVSA 3OW7A 1X3GA 4ZKBB 5C0XI 4PZ7A 2NVYH 4Y7NB 4DAYB 4TSSA 2YU9H 2Q2UA 1JE5A 1PA6A 3S14B 4CKBA 5FK9C 1MHWC 2JQOA 1XMOL 5DNFA 1N33Q 1FL0A 4C1NI 3A8JE 3OSOA 3H6MA 5CV7A 1EY9A 1WTHA 4X66L 3DLLA 1SJED 2WAQB 3KJOA 3ERSX 1LUZA 2Z4IA 1Q90A 1RD9D 4FF1A 1EQVA 2F0FA 5C4JH 4DR3L 4GKJQ 4HJ7A 1C7YA 4GLVB 1ZEQX 4DK3C 5C0XH 3I3CA 4UDUC 2B63H 4KKTA 1JQYD 2OEOA 2ZXRA 1VDZA 1W2BA 1EIFA 5FOBB 5IYCG 1HNZL 4A3EB 2B2UC 4DV7L 3Q23A 3K5OA 4XYQA 3TMEA 3T1HQ 3P7JA 2K28A 4EVOA 3MXNB 5K36G 3OTOQ 3L7ZC 4OX9L 2L12A 2BCOA 2PNRC 1Y8OB 5E4WC 5FLXE 3UDXA 3H15A 1U5KA 4CDFC 4HMIA 2UUCQ 3TBIB 3GV3A 4RAUC 1VQKA 1F2LA 1E3PA 4B3RQ 1PHJA 1N36Q 4LF4Q 5M3FH 2KCNA 5JOBA 4DAVA 1QUQA 1KDBA 3WDNA 1PFMA 1TWFH 1PXUA 1GUWA 2XGTA 4FNFA 2ZM6Q 4A3JG 4QF4A 1NCVA 3G48A 1ZYRC
chains in the Genus database with same CATH topology
2VS1A 4NXML 3J80i 2K50A 2VQEL 3UDGA 4BY7H 3HOZH 5C4XH 5AJ3Q 3CD6A 1QZHA 3GTJH 3CCVA 1J5EQ 3KJPA 3U50C 1HR0L 4OWTB 4JI1L 1VCIA 3J81j 1PH2A 2R6GA 2MQHA 4AIMA 1I50H 4DUZL 3K8AA 1Z9FA 4GOPB 4A3JH 2E2HH 4YWLA 3AEVA 3FP9A 3H3VH 4A3BG 1D7QA 2YYZA 1X55A 2AWNA 5H1SE 1YI2A 2NZOA 2CFMA 1EYGA 2HHHL 1XMQL 1VQNA 3S1QH 3HFZB 1XNQQ 2UXCL 4ME3A 4IJHA 1P8LA 4LUZA 1PH4A 1S40A 5LMNL 1IBML 2ALYB 3CC2A 4QY7A 3CF5A 3CCMA 1BKBA 2H5XA 3PUWA 2QA4A 4HJ9A 2DGYA 4A3KG 2LXJA 4LFAL 2LSSA 3BU2A 2RCNA 2VW9A 5JJKA 2Z0SA 4DV5Q 2JE6I 3NBHB 3CXCA 5M5WH 1E1TA 3PUXA 2PMZE 1Q46A 3CCEA 1JJGA 1J6QA 1M90C 3HOUG 3S16H 3TS0A 1AE2A 2OCEA 3D0FA 1Y14B 4JI1Q 4BBSG 3AQQA 4KI0A 4DUZQ 3I4NG 4BXXG 4C2MH 2K52A 3RN5A 4DR1L 4JI6L 1HZBA 4A3KH 2D0OA 4JG2A 1N33L 1CSQA 3CCRA 1O7IA 5C0XJ 4LFCL 2ASBA 2UXCQ 5JEAJ 4UP7A 2MO1A 3L2PA 1XNRL 1X6OA 1YHAA 3ULLA 3S15H 5JJIA 1Q1EA 1K8GA 2JA7G 1C0AA 4X64Q 4OWWB 3CW2C 1PV4A 3I4NH 4BXXH 4OO1I 4UP8A 5FLXc 4A3MG 4DPGA 2JEBI 1GKHA 5ELOA 1PFSA 3STBD 4GN5A 4L5QA 1YJWA 2YTXA 2CKZB 3J7ZC 1VQGA 4OO1G 1YITA 1IYJB 3TQYA 4GKKQ 1GO3E 2JA7H 2Q2HA 4R4OA 5BR8L 3J80c 1B8AA 1HH2P 1YEZA 5C0XG 1SLJA 1K3RA 3RLNA 2IX0A 5DLQE 4R4TA 3UE1A 4POFA 5IP9H 1KIXA 2ZJQA 3OTOL 1L2FA 1A62A 2BA1A 1S3OA 3GD7A 4YHHQ 4HIKA 1N34L 1X9NA 4HJ5A 4A76A 4P72A 3KDFB 2JA8G 1D8LA 4O2DA 2KCMA 2UUCL 3STBC 2I0QA 1PH8A 2VNUD 2Y0SG 3DM3A 1YIJA 4YCUA 4LFBL 4DR2L 4DV0Q 1VQ6A 3E0EA 1Q82C 2F4VQ 3W1BA 4X65L 2R92G 3FKIG 1KL9A 2YTVA 2UU9Q 3TREA 1JMCA 2Z6KA 4R4IA 3PGZA 3KF6A 2R7DA 5GADC 3I55A 2ZJPA 1IZ6A 5BR8Q 1X65A 4IPHA 2ZM6L 5M3FG 1V43A 3MEFA 4J15A 1WI5A 2OQKA 1XPOA 1N34Q 1YNXA 1SRUA 1PH9A 3M4QA 1Y1WH 1SE8A 5IP7H 3PSIA 3PF4A 3ULPA 1VQ4A 4X6AH 5AJ3L 3I4MH 1CUKA 5IYBG 4GN3B 2I5LX 5GQOA 1NMGA 3FHWA 2VQFL 1B7YB 4IPCA 3M85A 4QGUA 4DR2Q 4LFBQ 3GTPH 2UXBL 4X65Q 4LWCA 1UE6A 2IHFA 2R93G 1VQFA 3CP0A 3E9HA 1SMXA 1RIPA 4C3HH 5HGQA 1NY4A 4BY7G 3HOZG 1QVCA 3PO2H 4DV2L 5C4XG 4BA2I 3PUZA 4LF5L 1MIUA 1A63A 1N9WA 2WB1E 2ZTEA 2HIXA 4RG1A 4YWKA 1VQOA 5IYBH 3HOYH 1XPRA 4AYBG 1YBYA 3F2BA 2CCZA 4Y52H 4TVAB 4GNXB 1K73C 1Q8KA 3CMEA 5E7NA 1CSPA 4MTNA 5C3EG 4FDBA 1A8VA 3M9BA 1IBLQ 1I5FA 5IY0A 2OWOA 1MJCA 4IPDA 4DV5L 5IWAL 4PG3A 4PMWA 1UE5A 1SFOH 4QQBX 2OQ0A 3K7AH 2N78A 3KLWA 3GTKH 1RL2A 3S24A 2ID0A 3GTMH 4KHPL 2HIVA 4JBWA 2VQFQ 3RZDH 3EIVA 2UXBQ 1PVOA 2GN5A 4LNQA 1Q1BA 2F52A 4EQ5A 4C3JH 4AQYQ 2EQSA 3S2DH 4BBRG 1GVPA 5GAHC 5C3EH 3A5UA 3SGIA 4GLXA 2R7ZG 4DV2Q 5GROA 3PIPA 1L1OB 2CWAA 4A3FG 4LW1A 1S72A 2BH8A 2IY5B 1ASYA 1BBUA 5GAGC 4IFDI 1KRTA 1DGSA 4IPGA 4X64L 4P71A 4EX5A 3TEHB 3RR5A 3RZOH 1NMFA 2B3GA 5GAEC 1QZGA 4DR7L 5LMUQ 4A3DH 4BBRH 2E8GA 1HNWQ 1KAWA 2WP8J 5IWAQ 2C35B 2PI2A 4LUVA 4GOPA 1IL2A 2R7ZH 4IFDG 2MO0A 1PYBA 1VQ8A 3CCLA 4GS3A 2JA6G 4A3FH 4JI4Q 2KCTA 4KHPQ 4B3ML 1SR3A 4OWXB 3HOVH 1TWCH 2HQLA 2JA9A 1CKMA 2QEXA 1YJNA 4GKKL 1B70B 2RHQB 1N32Q 5IYDH 3I2ZA 1I3QH 1G51A 1W3SA 3K7UC 4LF8L 4YHHL 4Y7NH 2JA6H 3KF8B 3CMAA 3U4VA 3RLOA 3S14H 2ATWA 3HKZG 2VZAA 4UP9A 1K8AC 4LF7L 4DR7Q 1VQEA 5IP9G 4WJ3M 4LUOA 4DV0L 1X3FA 1OTCA 2F4VL 2RHSB 2LXKA 1EFWA 1N8RC 3ICEA 1UE7A 1X56A 2UU9L 4L5SA 1UEBA 4B3MQ 4DV6Q 3GDEA 1FVIA 3I4OA 1WOCA 3GTLH 1MJEA 1G291 1NBWA 3UDFA 3NENA 2PI2E 2OTJA 2HT1A 2A19A 2I5HA 2KENA 4YCVA 3JC66 2Z6KC 3F2CA 1HZCA 1OXTA 1VQCA 1QVGA 4LF8Q 4DR4L 4DR5L 4JI5Q 3CC4A 2PQAB 4A3EH 1UE1A 1PH6A 2ZTCA 3CCJA 2E5LL 1Q12A 2CQOA 4LF7Q 4JV5L 4A3LH 4OONA 1EIYB 4RMFA 3F2DA 2VL6A 4DKAC 4BY1H 3S1MH 1QVFA 1LM0A 4GN4B 1VQ5A 4B3TQ 4K0KQ 1Z47A 1Y1WG 1NTGA 5IP7G 4A3GH 2K14A 1IXRA 1YHQA 3I4MG 4JYAL 2JA5G 3UE0A 4HIOA 1E7ZA 5IT9c 2D62A 3KDFA 4IJLA 3PCOB 5FLMH 1VQAA 1Q7YC 2K75A 3KYHC 3T1YL 1VQ9A 4AYBE 4DR4Q 2EXDA 4NXNL 1IBLL 1VQPA 4BA1I 3HKSA 4DR5Q 1PH5A 1ASZA 3PO2G 4MNOA 3PF5A 4QIWE 1KQSA 4KLKA 3F8TA 4XTCS 3GO5A 3L0OA 2CWPA 2JA5H 3HOYG 4JI8L 3W1GA 2E5LQ 5EAYA 4A93G 4JV5Q 3CPFA 3IRBA 3S1NH 2OTLA 4JI0L 1KRSA 4R1JA 1C9OA 3W5OA 1WCMH 2F3IA 2NVXH 2JK8A 5M3MH 2AKWB 4AQYL 4MZ9A 1HNXL 2XTIA 4HJ8A 3GTGH 1FJGL 3I7FA 3HOWG 4JYAQ 2BH2A 4HJAA 1G6PA 4LF6L 4QL5A 3BZKA 4X66Q 1Y1VH 2YV5A 4GLAC 4DUYL 2BA0A 1UWVA 2EIFA 2RF4A 3A5ZB 4O0AA 4P75A 3U58A 2NN6I 1Q81C 4UY8C 3M4OH 3TS2A 4PZ8A 3I56A 3K81C 2K5VA 3T1YQ 3TRZA 5IYCH 4L5TA 3CCQA 1YVCA 4NXNQ 1KXLA 3G71A 2B29A 5LMUL 1XTDA 1VQMA 1HNWL 1CKNB 4YWMA 4NPSA 3HOWH 2IHEA 4XIGS 4POGA 2VUMH 1U0LA 4PZ6A 3GTOH 4IFDJ 4JI8Q 4JI4L 1VQBA 4P74A 3S1RH 2UXDQ 4JBKA 3KOJA 4JI0Q 4GOPC 4A3IH 1V9PA 1HNZQ 4LF9Q 4IO9A 3CPWA 5FJ8G 4X62L 4DV4L 1N32L 4A3DG 4DV7Q 1NJIC 1GM5A 5M5XH 1KC8C 2UUAL 1HNXQ 3S17H 4GNXA 3JAMi 1FJGQ 1OXXK 3LGJA 2KHJA 1WYDA 2E2IH 4LF6Q 2N8NA 2MNAA 3VDYA 5JJLA 1EWIA 3ER0A 4DUYQ 3M7NA 3HOVG 1E24A 5IYDG 4DV3L 1VS0A 4B3SL 3S2HH 5C44H 4A3CG 5FJ8H 3AFPA 4APVA 2A8VA 3EBEA 3G6EA 4DR6L 3HKZE 1YHBA 2D0PA 4JI3Q 1KD1C 3AYHB 4JOIA 4WJ4A 2WFWA 3A0JA 1V1QA 1I94Q 1P16A 3WWVA 4YY3L 4DV6L 1JJ2A 3K80C 1EUJA 2WB1G 1L1OA 1JB7A 5ELNA 1EQRA 3J81i 1PYSB 1NE3A 1SN8A 2MFIA 4X62Q 1X3EA 4JI2Q 4DV4Q 1K9MC 1HJPA 2UUAQ 3RNUA 3H0GG 4A3CH 4JI7L 3M4PA 1VQHA 3EN2A 3OW2A 3RLFA 1IBKL 2JJQA 2WAQG 3BZCA 1M1KC 3A74A 3NELA 4A3BH 4JI5L 2L15A 4NXMQ 2VQEQ 1AE3A 4DV3Q 2YTYA 2K4KA 1PH7A 4B3SQ 1VQIA 4DR6Q 2I5MX 4UPAA 4P73A 3U4ZA 3G4SA 4JBJA 2PNHA 2Y0SE 3D31A 3H0GH 2IT1A 1HR0Q 2UUBL 1XJVA 1XPUA 1MKHA 1EOVA 4B3TL 4K0KL 3CQZH 2GVAA 1VQDA 4YY3Q 3KFUA 2QGQA 4IOAA 2N3SA 3PUYA 4A3EG 1EQQA 2HHHQ 1XMQQ 2K5HA 4A3LG 3PO3G 5IE8A 5J3BA 1TWAH 5LMNQ 4BY1G 1IBMQ 4JI7Q 3PV0A 4H02A 4JC0A 1IBKQ 3HOUH 1TWGH 2NVQH 3J7A5 4GKJL 1JT8A 3PUVA 4BBSH 4A3GG 4LFAQ 1R9TH 1E1OA 3NEMA 4KHZA 1BVSA 2NVTH 1X3GA 3ZJYC 1KHIA 3E9IA 1Q86C 2Q2TA 5C0XI 3JAMc 4PZ7A 4OXPA 1TXYA 2N49A 2NVYH 2NZHA 5FLMG 2ZJRA 4DAYB 1I6HH 3PO3H 3F1ZA 2YU9H 1LYLA 3BJUA 2Q2UA 1WJJA 1JE5A 1PA6A 2UUBQ 3CCSA 1YJ9A 1PH3A 1A0IA 1K0RA 4DR1Q 4JI6Q 2JQOA 3B6YA 1K83H 2A1AA 3HOXG 1XMOL 1N33Q 3T1HL 2KBNA 2B63G 2E2JH 1FL0A 1L0WA 5JEAG 4A3MH 4LFCQ 4X66L 3DLLA 3KF6B 2Q2IA 4C3IH 1XNRQ 3KJOA 2V1CC 3ERSX 3CCUA 1LUZA 1WCMG 1OXSC 2PQAA 4YCWA 2IX1A 5M3MG 1E22A 1FGUA 4GKJQ 5C4JH 1X54A 4DR3L 3CC7A 1LTLA 4HJ7A 3J81c 4GLVB 1C7YA 4IOCA 2JEAI 3HOXH 4DK3C 1Y1VG 2B63H 2VY3A 1VQ7A 4B3RL 1N36L 1TWHH 1PH1A 4LF4L 2UXDL 1VQJA 1W2BA 1EIFA 2AMCB 2KHIA 3GTQH 1GD7A 5IYCG 1HNZL 4LF9L 4NB3A 1T9HA 4JBMA 2JA8H 1OXVA 3CAMA 1BBWA 4DV7L 1WFQA 1SROA 4DV1L 1JJCB 1XMOQ 4A93H 2R7FA 2DUDA 4A75A 3T1HQ 4LF5Q 2VUMG 2ZTDA 3MXNB 5K36G 3OTOQ 4HIMA 1HR0W 1HZ9A 3L7ZC 5M5YH 3PIOA 4OX9L 1QUQB 1HZAA 4HIDA 1YZ6A 4A4IA 3FKIH 4QJFA 4GNXC 3RN2A 4A3IG 4L5RC 2R92H 4AH6A 3UDXA 3H15A 1VQLA 1U5KA 4ALPA 4DR3Q 2UUCQ 1OXUA 1J5EL 2FXQA 4JI3L 1VQKA 1H95A 2R93H 1E3PA 2NN6G 4R4CA 5LMNW 4DAMA 1PHJA 1N36Q 4LF4Q 5M3FH 4B3RQ 1I94L 2AHOB 2AWOA 3H3VI 2GVBA 4TQUS 1CKOA 4R4QA 2K5NA 4JOIC 5C44G 1XNQL 1QUQA 4DK6C 2ES2A 4JI2L 4DV1Q 5HY6A 4DNIA 1L1OC 1TWFH 4JCVE 3ULJA 3Q8DA 3UDIA 2XGTA 3AFQA 2ZM6Q 4A3JG 3K0XA 3M3YH 3OYYA 4OX9Q 1CKNA 3G48A 1AH9A 2WAQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS1 A;  4NXM L;  3J80 i;  2K50 A;  2VQE L;  3UDG A;  4BY7 H;  3HOZ H;  5C4X H;  5AJ3 Q;  3CD6 A;  1QZH A;  3GTJ H;  3CCV A;  1J5E Q;  3KJP A;  3U50 C;  1HR0 L;  4OWT B;  4JI1 L;  1VCI A;  3J81 j;  1PH2 A;  2R6G A;  2MQH A;  4AIM A;  1I50 H;  4DUZ L;  3K8A A;  1Z9F A;  4GOP B;  4A3J H;  2E2H H;  4YWL A;  3AEV A;  3FP9 A;  3H3V H;  4A3B G;  1D7Q A;  2YYZ A;  1X55 A;  2AWN A;  5H1S E;  1YI2 A;  2NZO A;  2CFM A;  1EYG A;  2HHH L;  1XMQ L;  1VQN A;  3S1Q H;  3HFZ B;  1XNQ Q;  2UXC L;  4ME3 A;  4IJH A;  1P8L A;  4LUZ A;  1PH4 A;  1S40 A;  5LMN L;  1IBM L;  2ALY B;  3CC2 A;  4QY7 A;  3CF5 A;  3CCM A;  1BKB A;  2H5X A;  3PUW A;  2QA4 A;  4HJ9 A;  2DGY A;  4A3K G;  2LXJ A;  4LFA L;  2LSS A;  3BU2 A;  2RCN A;  2VW9 A;  5JJK A;  2Z0S A;  4DV5 Q;  2JE6 I;  3NBH B;  3CXC A;  5M5W H;  1E1T A;  3PUX A;  2PMZ E;  1Q46 A;  3CCE A;  1JJG A;  1J6Q A;  1M90 C;  3HOU G;  3S16 H;  3TS0 A;  1AE2 A;  2OCE A;  3D0F A;  1Y14 B;  4JI1 Q;  4BBS G;  3AQQ A;  4KI0 A;  4DUZ Q;  3I4N G;  4BXX G;  4C2M H;  2K52 A;  3RN5 A;  4DR1 L;  4JI6 L;  1HZB A;  4A3K H;  2D0O A;  4JG2 A;  1N33 L;  1CSQ A;  3CCR A;  1O7I A;  5C0X J;  4LFC L;  2ASB A;  2UXC Q;  5JEA J;  4UP7 A;  2MO1 A;  3L2P A;  1XNR L;  1X6O A;  1YHA A;  3ULL A;  3S15 H;  5JJI A;  1Q1E A;  1K8G A;  2JA7 G;  1C0A A;  4X64 Q;  4OWW B;  3CW2 C;  1PV4 A;  3I4N H;  4BXX H;  4OO1 I;  4UP8 A;  5FLX c;  4A3M G;  4DPG A;  2JEB I;  1GKH A;  5ELO A;  1PFS A;  3STB D;  4GN5 A;  4L5Q A;  1YJW A;  2YTX A;  2CKZ B;  3J7Z C;  1VQG A;  4OO1 G;  1YIT A;  1IYJ B;  3TQY A;  4GKK Q;  1GO3 E;  2JA7 H;  2Q2H A;  4R4O A;  5BR8 L;  3J80 c;  1B8A A;  1HH2 P;  1YEZ A;  5C0X G;  1SLJ A;  1K3R A;  3RLN A;  2IX0 A;  5DLQ E;  4R4T A;  3UE1 A;  4POF A;  5IP9 H;  1KIX A;  2ZJQ A;  3OTO L;  1L2F A;  1A62 A;  2BA1 A;  1S3O A;  3GD7 A;  4YHH Q;  4HIK A;  1N34 L;  1X9N A;  4HJ5 A;  4A76 A;  4P72 A;  3KDF B;  2JA8 G;  1D8L A;  4O2D A;  2KCM A;  2UUC L;  3STB C;  2I0Q A;  1PH8 A;  2VNU D;  2Y0S G;  3DM3 A;  1YIJ A;  4YCU A;  4LFB L;  4DR2 L;  4DV0 Q;  1VQ6 A;  3E0E A;  1Q82 C;  2F4V Q;  3W1B A;  4X65 L;  2R92 G;  3FKI G;  1KL9 A;  2YTV A;  2UU9 Q;  3TRE A;  1JMC A;  2Z6K A;  4R4I A;  3PGZ A;  3KF6 A;  2R7D A;  5GAD C;  3I55 A;  2ZJP A;  1IZ6 A;  5BR8 Q;  1X65 A;  4IPH A;  2ZM6 L;  5M3F G;  1V43 A;  3MEF A;  4J15 A;  1WI5 A;  2OQK A;  1XPO A;  1N34 Q;  1YNX A;  1SRU A;  1PH9 A;  3M4Q A;  1Y1W H;  1SE8 A;  5IP7 H;  3PSI A;  3PF4 A;  3ULP A;  1VQ4 A;  4X6A H;  5AJ3 L;  3I4M H;  1CUK A;  5IYB G;  4GN3 B;  2I5L X;  5GQO A;  1NMG A;  3FHW A;  2VQF L;  1B7Y B;  4IPC A;  3M85 A;  4QGU A;  4DR2 Q;  4LFB Q;  3GTP H;  2UXB L;  4X65 Q;  4LWC A;  1UE6 A;  2IHF A;  2R93 G;  1VQF A;  3CP0 A;  3E9H A;  1SMX A;  1RIP A;  4C3H H;  5HGQ A;  1NY4 A;  4BY7 G;  3HOZ G;  1QVC A;  3PO2 H;  4DV2 L;  5C4X G;  4BA2 I;  3PUZ A;  4LF5 L;  1MIU A;  1A63 A;  1N9W A;  2WB1 E;  2ZTE A;  2HIX A;  4RG1 A;  4YWK A;  1VQO A;  5IYB H;  3HOY H;  1XPR A;  4AYB G;  1YBY A;  3F2B A;  2CCZ A;  4Y52 H;  4TVA B;  4GNX B;  1K73 C;  1Q8K A;  3CME A;  5E7N A;  1CSP A;  4MTN A;  5C3E G;  4FDB A;  1A8V A;  3M9B A;  1IBL Q;  1I5F A;  5IY0 A;  2OWO A;  1MJC A;  4IPD A;  4DV5 L;  5IWA L;  4PG3 A;  4PMW A;  1UE5 A;  1SFO H;  4QQB X;  2OQ0 A;  3K7A H;  2N78 A;  3KLW A;  3GTK H;  1RL2 A;  3S24 A;  2ID0 A;  3GTM H;  4KHP L;  2HIV A;  4JBW A;  2VQF Q;  3RZD H;  3EIV A;  2UXB Q;  1PVO A;  2GN5 A;  4LNQ A;  1Q1B A;  2F52 A;  4EQ5 A;  4C3J H;  4AQY Q;  2EQS A;  3S2D H;  4BBR G;  1GVP A;  5GAH C;  5C3E H;  3A5U A;  3SGI A;  4GLX A;  2R7Z G;  4DV2 Q;  5GRO A;  3PIP A;  1L1O B;  2CWA A;  4A3F G;  4LW1 A;  1S72 A;  2BH8 A;  2IY5 B;  1ASY A;  1BBU A;  5GAG C;  4IFD I;  1KRT A;  1DGS A;  4IPG A;  4X64 L;  4P71 A;  4EX5 A;  3TEH B;  3RR5 A;  3RZO H;  1NMF A;  2B3G A;  5GAE C;  1QZG A;  4DR7 L;  5LMU Q;  4A3D H;  4BBR H;  2E8G A;  1HNW Q;  1KAW A;  2WP8 J;  5IWA Q;  2C35 B;  2PI2 A;  4LUV A;  4GOP A;  1IL2 A;  2R7Z H;  4IFD G;  2MO0 A;  1PYB A;  1VQ8 A;  3CCL A;  4GS3 A;  2JA6 G;  4A3F H;  4JI4 Q;  2KCT A;  4KHP Q;  4B3M L;  1SR3 A;  4OWX B;  3HOV H;  1TWC H;  2HQL A;  2JA9 A;  1CKM A;  2QEX A;  1YJN A;  4GKK L;  1B70 B;  2RHQ B;  1N32 Q;  5IYD H;  3I2Z A;  1I3Q H;  1G51 A;  1W3S A;  3K7U C;  4LF8 L;  4YHH L;  4Y7N H;  2JA6 H;  3KF8 B;  3CMA A;  3U4V A;  3RLO A;  3S14 H;  2ATW A;  3HKZ G;  2VZA A;  4UP9 A;  1K8A C;  4LF7 L;  4DR7 Q;  1VQE A;  5IP9 G;  4WJ3 M;  4LUO A;  4DV0 L;  1X3F A;  1OTC A;  2F4V L;  2RHS B;  2LXK A;  1EFW A;  1N8R C;  3ICE A;  1UE7 A;  1X56 A;  2UU9 L;  4L5S A;  1UEB A;  4B3M Q;  4DV6 Q;  3GDE A;  1FVI A;  3I4O A;  1WOC A;  3GTL H;  1MJE A;  1G29 1;  1NBW A;  3UDF A;  3NEN A;  2PI2 E;  2OTJ A;  2HT1 A;  2A19 A;  2I5H A;  2KEN A;  4YCV A;  3JC6 6;  2Z6K C;  3F2C A;  1HZC A;  1OXT A;  1VQC A;  1QVG A;  4LF8 Q;  4DR4 L;  4DR5 L;  4JI5 Q;  3CC4 A;  2PQA B;  4A3E H;  1UE1 A;  1PH6 A;  2ZTC A;  3CCJ A;  2E5L L;  1Q12 A;  2CQO A;  4LF7 Q;  4JV5 L;  4A3L H;  4OON A;  1EIY B;  4RMF A;  3F2D A;  2VL6 A;  4DKA C;  4BY1 H;  3S1M H;  1QVF A;  1LM0 A;  4GN4 B;  1VQ5 A;  4B3T Q;  4K0K Q;  1Z47 A;  1Y1W G;  1NTG A;  5IP7 G;  4A3G H;  2K14 A;  1IXR A;  1YHQ A;  3I4M G;  4JYA L;  2JA5 G;  3UE0 A;  4HIO A;  1E7Z A;  5IT9 c;  2D62 A;  3KDF A;  4IJL A;  3PCO B;  5FLM H;  1VQA A;  1Q7Y C;  2K75 A;  3KYH C;  3T1Y L;  1VQ9 A;  4AYB E;  4DR4 Q;  2EXD A;  4NXN L;  1IBL L;  1VQP A;  4BA1 I;  3HKS A;  4DR5 Q;  1PH5 A;  1ASZ A;  3PO2 G;  4MNO A;  3PF5 A;  4QIW E;  1KQS A;  4KLK A;  3F8T A;  4XTC S;  3GO5 A;  3L0O A;  2CWP A;  2JA5 H;  3HOY G;  4JI8 L;  3W1G A;  2E5L Q;  5EAY A;  4A93 G;  4JV5 Q;  3CPF A;  3IRB A;  3S1N H;  2OTL A;  4JI0 L;  1KRS A;  4R1J A;  1C9O A;  3W5O A;  1WCM H;  2F3I A;  2NVX H;  2JK8 A;  5M3M H;  2AKW B;  4AQY L;  4MZ9 A;  1HNX L;  2XTI A;  4HJ8 A;  3GTG H;  1FJG L;  3I7F A;  3HOW G;  4JYA Q;  2BH2 A;  4HJA A;  1G6P A;  4LF6 L;  4QL5 A;  3BZK A;  4X66 Q;  1Y1V H;  2YV5 A;  4GLA C;  4DUY L;  2BA0 A;  1UWV A;  2EIF A;  2RF4 A;  3A5Z B;  4O0A A;  4P75 A;  3U58 A;  2NN6 I;  1Q81 C;  4UY8 C;  3M4O H;  3TS2 A;  4PZ8 A;  3I56 A;  3K81 C;  2K5V A;  3T1Y Q;  3TRZ A;  5IYC H;  4L5T A;  3CCQ A;  1YVC A;  4NXN Q;  1KXL A;  3G71 A;  2B29 A;  5LMU L;  1XTD A;  1VQM A;  1HNW L;  1CKN B;  4YWM A;  4NPS A;  3HOW H;  2IHE A;  4XIG S;  4POG A;  2VUM H;  1U0L A;  4PZ6 A;  3GTO H;  4IFD J;  4JI8 Q;  4JI4 L;  1VQB A;  4P74 A;  3S1R H;  2UXD Q;  4JBK A;  3KOJ A;  4JI0 Q;  4GOP C;  4A3I H;  1V9P A;  1HNZ Q;  4LF9 Q;  4IO9 A;  3CPW A;  5FJ8 G;  4X62 L;  4DV4 L;  1N32 L;  4A3D G;  4DV7 Q;  1NJI C;  1GM5 A;  5M5X H;  1KC8 C;  2UUA L;  1HNX Q;  3S17 H;  4GNX A;  3JAM i;  1FJG Q;  1OXX K;  3LGJ A;  2KHJ A;  1WYD A;  2E2I H;  4LF6 Q;  2N8N A;  2MNA A;  3VDY A;  5JJL A;  1EWI A;  3ER0 A;  4DUY Q;  3M7N A;  3HOV G;  1E24 A;  5IYD G;  4DV3 L;  1VS0 A;  4B3S L;  3S2H H;  5C44 H;  4A3C G;  5FJ8 H;  3AFP A;  4APV A;  2A8V A;  3EBE A;  3G6E A;  4DR6 L;  3HKZ E;  1YHB A;  2D0P A;  4JI3 Q;  1KD1 C;  3AYH B;  4JOI A;  4WJ4 A;  2WFW A;  3A0J A;  1V1Q A;  1I94 Q;  1P16 A;  3WWV A;  4YY3 L;  4DV6 L;  1JJ2 A;  3K80 C;  1EUJ A;  2WB1 G;  1L1O A;  1JB7 A;  5ELN A;  1EQR A;  3J81 i;  1PYS B;  1NE3 A;  1SN8 A;  2MFI A;  4X62 Q;  1X3E A;  4JI2 Q;  4DV4 Q;  1K9M C;  1HJP A;  2UUA Q;  3RNU A;  3H0G G;  4A3C H;  4JI7 L;  3M4P A;  1VQH A;  3EN2 A;  3OW2 A;  3RLF A;  1IBK L;  2JJQ A;  2WAQ G;  3BZC A;  1M1K C;  3A74 A;  3NEL A;  4A3B H;  4JI5 L;  2L15 A;  4NXM Q;  2VQE Q;  1AE3 A;  4DV3 Q;  2YTY A;  2K4K A;  1PH7 A;  4B3S Q;  1VQI A;  4DR6 Q;  2I5M X;  4UPA A;  4P73 A;  3U4Z A;  3G4S A;  4JBJ A;  2PNH A;  2Y0S E;  3D31 A;  3H0G H;  2IT1 A;  1HR0 Q;  2UUB L;  1XJV A;  1XPU A;  1MKH A;  1EOV A;  4B3T L;  4K0K L;  3CQZ H;  2GVA A;  1VQD A;  4YY3 Q;  3KFU A;  2QGQ A;  4IOA A;  2N3S A;  3PUY A;  4A3E G;  1EQQ A;  2HHH Q;  1XMQ Q;  2K5H A;  4A3L G;  3PO3 G;  5IE8 A;  5J3B A;  1TWA H;  5LMN Q;  4BY1 G;  1IBM Q;  4JI7 Q;  3PV0 A;  4H02 A;  4JC0 A;  1IBK Q;  3HOU H;  1TWG H;  2NVQ H;  3J7A 5;  4GKJ L;  1JT8 A;  3PUV A;  4BBS H;  4A3G G;  4LFA Q;  1R9T H;  1E1O A;  3NEM A;  4KHZ A;  1BVS A;  2NVT H;  1X3G A;  3ZJY C;  1KHI A;  3E9I A;  1Q86 C;  2Q2T A;  5C0X I;  3JAM c;  4PZ7 A;  4OXP A;  1TXY A;  2N49 A;  2NVY H;  2NZH A;  5FLM G;  2ZJR A;  4DAY B;  1I6H H;  3PO3 H;  3F1Z A;  2YU9 H;  1LYL A;  3BJU A;  2Q2U A;  1WJJ A;  1JE5 A;  1PA6 A;  2UUB Q;  3CCS A;  1YJ9 A;  1PH3 A;  1A0I A;  1K0R A;  4DR1 Q;  4JI6 Q;  2JQO A;  3B6Y A;  1K83 H;  2A1A A;  3HOX G;  1XMO L;  1N33 Q;  3T1H L;  2KBN A;  2B63 G;  2E2J H;  1FL0 A;  1L0W A;  5JEA G;  4A3M H;  4LFC Q;  4X66 L;  3DLL A;  3KF6 B;  2Q2I A;  4C3I H;  1XNR Q;  3KJO A;  2V1C C;  3ERS X;  3CCU A;  1LUZ A;  1WCM G;  1OXS C;  2PQA A;  4YCW A;  2IX1 A;  5M3M G;  1E22 A;  1FGU A;  4GKJ Q;  5C4J H;  1X54 A;  4DR3 L;  3CC7 A;  1LTL A;  4HJ7 A;  3J81 c;  4GLV B;  1C7Y A;  4IOC A;  2JEA I;  3HOX H;  4DK3 C;  1Y1V G;  2B63 H;  2VY3 A;  1VQ7 A;  4B3R L;  1N36 L;  1TWH H;  1PH1 A;  4LF4 L;  2UXD L;  1VQJ A;  1W2B A;  1EIF A;  2AMC B;  2KHI A;  3GTQ H;  1GD7 A;  5IYC G;  1HNZ L;  4LF9 L;  4NB3 A;  1T9H A;  4JBM A;  2JA8 H;  1OXV A;  3CAM A;  1BBW A;  4DV7 L;  1WFQ A;  1SRO A;  4DV1 L;  1JJC B;  1XMO Q;  4A93 H;  2R7F A;  2DUD A;  4A75 A;  3T1H Q;  4LF5 Q;  2VUM G;  2ZTD A;  3MXN B;  5K36 G;  3OTO Q;  4HIM A;  1HR0 W;  1HZ9 A;  3L7Z C;  5M5Y H;  3PIO A;  4OX9 L;  1QUQ B;  1HZA A;  4HID A;  1YZ6 A;  4A4I A;  3FKI H;  4QJF A;  4GNX C;  3RN2 A;  4A3I G;  4L5R C;  2R92 H;  4AH6 A;  3UDX A;  3H15 A;  1VQL A;  1U5K A;  4ALP A;  4DR3 Q;  2UUC Q;  1OXU A;  1J5E L;  2FXQ A;  4JI3 L;  1VQK A;  1H95 A;  2R93 H;  1E3P A;  2NN6 G;  4R4C A;  5LMN W;  4DAM A;  1PHJ A;  1N36 Q;  4LF4 Q;  5M3F H;  4B3R Q;  1I94 L;  2AHO B;  2AWO A;  3H3V I;  2GVB A;  4TQU S;  1CKO A;  4R4Q A;  2K5N A;  4JOI C;  5C44 G;  1XNQ L;  1QUQ A;  4DK6 C;  2ES2 A;  4JI2 L;  4DV1 Q;  5HY6 A;  4DNI A;  1L1O C;  1TWF H;  4JCV E;  3ULJ A;  3Q8D A;  3UDI A;  2XGT A;  3AFQ A;  2ZM6 Q;  4A3J G;  3K0X A;  3M3Y H;  3OYY A;  4OX9 Q;  1CKN A;  3G48 A;  1AH9 A;  2WAQ E; 
#chains in the Genus database with same CATH topology
 2VS1 A;  3Q6S A;  3J81 E;  1HFN A;  4ILW A;  1CTM A;  2QEJ C;  4R8N A;  1QNU A;  3GTJ H;  3CCV A;  1J5E Q;  2BDO A;  1HR0 L;  4V0B A;  3J81 j;  1PH2 A;  4AIM A;  2MQH A;  1ONL A;  3AEV A;  2O2L D;  2K7V A;  3QOL A;  5H1S E;  2NZO A;  3S1Q H;  1XMQ L;  3QJY A;  4OEL B;  3QWN A;  3S1R B;  1IBM L;  4NW2 A;  4ZAI A;  2IL8 A;  4IUN A;  5C5M A;  2DGY A;  1F9R A;  3S17 B;  2LKV A;  3NBH B;  1QCB D;  3PUX A;  2FMM A;  1MBY A;  1J6Q A;  2H1E A;  1M90 C;  3S16 H;  1U4R A;  2OCE A;  4BBS G;  2SNM A;  4DUZ Q;  4C2M H;  1PLF A;  5C44 B;  2A6E C;  1I4Q A;  4OHJ A;  4JG2 A;  3K6O A;  3CCR A;  5L37 A;  4F87 A;  4IAL A;  4LFC L;  1DXM A;  2UXC Q;  5JEA J;  1E0B A;  1Q3L A;  3ULL A;  3C46 A;  3S15 H;  3MWY W;  2X6L A;  2JP1 A;  3VR2 A;  1C0A A;  4X64 Q;  1G8Z D;  4OWW B;  3CW2 C;  4BXX H;  5FLX c;  4DA2 A;  4Q0F A;  3NTI A;  2JEB I;  1GKH A;  1PFS A;  1Q8I A;  2F3V A;  1GOZ A;  2YTX A;  4G57 A;  3ND9 A;  1GO3 E;  4IQZ A;  2JA7 H;  2F0K A;  2B2V A;  2EY2 A;  4RGT A;  1K3B C;  4EQP A;  4S3S A;  5IP9 H;  4FXD A;  1IL8 A;  1I4R A;  1A62 A;  2BA1 A;  2GA4 B;  3LWU A;  1EWH A;  1X9N A;  3KDF B;  2IPK D;  5I4D A;  2BOS A;  1YNN C;  2XVS A;  3STB C;  2NBF A;  3URY A;  2I0Q A;  2VNU D;  3J7Y W;  3E0E A;  2NVQ B;  4DN4 M;  4X65 L;  5DM6 3;  3T51 B;  2J0T D;  2UU9 Q;  5CV9 A;  5BN3 A;  2FHT A;  5KND A;  3PGZ A;  3KF6 A;  2NVY B;  2OXP A;  2ZJP A;  5BR8 Q;  1X65 A;  2SNS A;  4K6L A;  1JWU D;  2YU9 B;  2RKS A;  4IPH A;  4R8I A;  1H9M A;  3FRP B;  2EYP A;  3BVZ A;  2EVB A;  4X3U A;  4IUT A;  1SE8 A;  3ULP A;  3BG3 A;  2I5L X;  1F2M A;  1NMG A;  4QGU A;  3GTP H;  5C4J B;  5CGK A;  3E9H A;  1JC7 A;  1RIP A;  5ELC A;  1EU4 A;  3TP8 A;  5HGQ A;  1QVC A;  4B08 A;  5JPM C;  1H9S B;  1N9W A;  2WB1 E;  4FXG C;  1SBB B;  3HOY H;  2HCI A;  1HUN A;  3HEJ A;  1LLR D;  5E7N A;  1IBL Q;  3M9B A;  4PG3 A;  4PMW A;  1SFO H;  4IUV A;  1RL2 A;  2FJ2 A;  1NUC A;  2E76 C;  4LAA A;  1HXY D;  1STG A;  2GN5 A;  1TII D;  2F52 A;  1GUS A;  5GAH C;  5C3E H;  1LT6 D;  3SGI A;  2DNC A;  3A5U A;  1BXT A;  4ZUI A;  1EY8 A;  2KED A;  4A3F G;  1S72 A;  5M3F B;  3FMC A;  3FDT A;  5GAG C;  1KRT A;  3OIQ A;  5NUC A;  5BN5 A;  1DGS A;  4IPG A;  3RZO H;  1NMF A;  4CDD C;  1BQQ T;  2E8G A;  1TWF B;  1EU3 A;  3BDC A;  3QG1 A;  4BBR H;  1IL2 A;  1EY5 A;  2R7Z H;  2F0T A;  2L5T A;  4FF3 A;  2KCT A;  1MI2 A;  1CKM A;  1EFI D;  1B70 B;  2RHQ B;  5IYD H;  3GTJ B;  1PRT C;  1I3Q H;  3TSS A;  2F0U A;  3HP3 A;  3K7U C;  1EEF D;  4AYB B;  4UHV A;  2HQE A;  4XQJ A;  4LF8 L;  2IWH A;  5D14 A;  3S1Q B;  3CMA A;  4CDC C;  3HKZ G;  1VQE A;  5EPJ A;  1EFW A;  1UE7 A;  1W6K A;  1X56 A;  4L5S A;  2K04 A;  4DV6 Q;  1FVI A;  3NEN A;  2PI2 E;  4IUU A;  3MC0 B;  2A73 B;  1SYE A;  1VF5 C;  1OXT A;  4OGQ C;  3M4Y A;  1QVG A;  2NTS A;  2M00 A;  2KJX A;  3TDQ A;  3VR4 A;  5I2X A;  1Q12 A;  3S15 B;  5EKK A;  3F2D A;  2KEE A;  2KA7 A;  4DKA C;  4BY1 H;  3NBI A;  5JVH 3;  4GN4 B;  1RTN A;  1VQ5 A;  4B3T Q;  2K33 A;  1Z47 A;  1IHZ A;  1YHQ A;  1IXR A;  1O7Y A;  1T5E A;  1PTO H;  3VR3 A;  3T13 A;  1GXD C;  3J80 L;  5FLM H;  3OIP A;  1VQA A;  1S4Z A;  4G7Z C;  1HPC A;  2EXD A;  2L1B A;  4NXN L;  4BA1 I;  3HKS A;  4DR5 Q;  2ZXO A;  2PZU A;  4RGN A;  2K5D A;  4DF7 A;  4B9X A;  3F8T A;  3NTH A;  2CWP A;  1TS2 A;  3E6Z X;  2E5L Q;  4WFN 3;  2ICE C;  4DK1 A;  4AQY L;  2NB0 A;  3OWF A;  4MZ9 A;  4DK0 A;  4DXG A;  5LL6 X;  1BUV T;  1JOR A;  1FJG L;  3I7F A;  4JYA Q;  4QL5 A;  4RCO A;  4P2C B;  4RGO S;  4X66 Q;  1Y1V H;  2EIF A;  1LT5 D;  3A5Z B;  4O0A A;  3TZD A;  1LTG D;  2NN6 I;  2PO4 A;  3TRZ A;  2K5V A;  3T1Y Q;  4C3J G;  3CCQ A;  1YVC A;  4RCN A;  1KAA A;  3G71 A;  5LMU L;  4JVZ A;  4KY5 A;  1HNW L;  1DZ1 A;  5FKA C;  4NPS A;  2XWJ B;  2RCF A;  4XIG S;  4IFD J;  3GTO H;  2E74 C;  1HHV A;  4A3I H;  1HNZ Q;  1JE4 A;  4IO9 A;  4X62 L;  3DUZ A;  4A3D G;  4DV7 Q;  1GM5 A;  1IYV A;  3OWE B;  1WYD A;  5CBA E;  2N8N A;  2MNA A;  2NN6 H;  1LTR D;  5EPK A;  4B3S L;  1R4P B;  3DEP A;  5C5L A;  3BS1 A;  2A8V A;  3HOY B;  4DR6 L;  3HKZ E;  4XXE A;  5TSS A;  1KD1 C;  1HUM A;  4ZCK A;  3A0J A;  1JJ2 A;  1ZKO A;  3MVV A;  1L1O A;  1SFO B;  5ELN A;  1K8M A;  5CMD A;  1NE3 A;  4A3C H;  1SMY D;  3OPO A;  1U4M A;  3L9A X;  5EGT A;  4G4K A;  3BZC A;  2B8G A;  3DWA A;  4J8Q A;  1VF7 A;  4MTK A;  4QCL A;  4DV3 Q;  3G4S A;  4JBJ A;  1HR0 Q;  2Y0S E;  1D1I A;  1NR2 A;  1F9S A;  3D31 A;  2UUB L;  5EBD A;  3RZO B;  2KEC A;  3CQZ H;  2B39 A;  1EY6 A;  3R8B A;  2QGQ A;  3PUY A;  1EQQ A;  1PRT B;  1QNK A;  1XMQ Q;  4A3L G;  5IE8 A;  3MXP A;  1TWA H;  4JI7 Q;  1IBM Q;  3C3L A;  1SJH D;  4JC0 A;  1TWG H;  1STY A;  4KKU A;  1IW7 D;  3I91 A;  1I3Q B;  4Z9C B;  1HA6 A;  5M9O A;  1SNP A;  2TMP A;  3E9I A;  1D7Q A;  2NZH A;  3G6J B;  1H9J A;  1I6H H;  1SE4 A;  4Q5V A;  1WJJ A;  3CCS A;  2WB1 B;  1A0I A;  1I6V C;  1K0R A;  4KN7 C;  1AZP A;  1ENA A;  4MN3 A;  1YNJ C;  2KBN A;  2B63 G;  1TY2 A;  2RDH A;  4A3M H;  4LFC Q;  2F0D A;  1WCM G;  1OXS C;  5M3M G;  2E75 C;  4CJ1 B;  4ZUJ A;  1LTL A;  5C3W A;  2XNA C;  1PRT F;  2JEA I;  1QIL A;  2LFN A;  2VY3 A;  1S5C D;  1U4L A;  2AMC B;  3VYR A;  2JN4 A;  1TR5 A;  3NE5 B;  2F0V A;  3DWP A;  4LF9 L;  1SNM A;  5FO9 B;  4JBM A;  1JIC A;  2F0O A;  1WFQ A;  2Z4H A;  4DV1 L;  1JJC B;  4DNT B;  2DUD A;  1Y69 U;  2VUM G;  2ZTD A;  4BY1 B;  5IGF A;  2EJF C;  1PZK D;  5M5Y H;  5A2Q E;  4KD3 A;  5EQ0 A;  1YZ6 A;  4HID A;  2R92 H;  4L5R C;  1II3 A;  4AH6 A;  2EYF A;  1LV9 A;  3DMU A;  1OXU A;  1PMR A;  3SXH A;  1LTB D;  3SK5 A;  1RDP D;  4JI3 L;  1H95 A;  4CGY B;  4R4C A;  1DM0 B;  4DAM A;  5LMN W;  1KLU D;  2AHO B;  2GVB A;  1CKO A;  3HOX B;  2K5N A;  1XNQ L;  2ES2 A;  3T56 B;  3ULJ A;  3Q8D A;  1PYW D;  2AQ3 B;  3M3Y H;  1DON A;  2WKC A;  1CKN A;  4RWS C;  1QVF A;  3ONA B;  4NXM L;  2VQE L;  3HOZ H;  1Y1V B;  3SHL A;  1KTK A;  3CD6 A;  4U68 A;  4JI1 L;  5I6W A;  1B4O A;  2R6G A;  4A3B G;  4YWL A;  2EYO A;  4EQO A;  1V1P A;  1VQN A;  2CFM A;  5C4H A;  3GTO B;  4ME3 A;  4LUZ A;  2A6H D;  1S40 A;  4A3I B;  4N8F A;  3PUW A;  1K0S A;  4LFA L;  1DCZ A;  1ET9 A;  3MFG A;  3X3M A;  3BU2 A;  2RCN A;  2Z0S A;  4ZQ3 A;  3T53 B;  3CXC A;  2QDL A;  2L4N A;  5M5W H;  1TU2 B;  5K5P A;  1BCP D;  1GUN A;  3HOU G;  3TS0 A;  4K8I A;  4OIJ A;  1MD2 D;  1V8Q A;  4BXX G;  1HZB A;  3D4D A;  5T1G A;  2D0O A;  1NNX A;  1DD2 A;  5A35 A;  1O7I A;  3V96 A;  2ASB A;  2XN9 C;  2E2H B;  4RFB A;  2KCC A;  3NQT A;  1XNR L;  2JA7 G;  4E6I A;  4KTA A;  4OO1 I;  2EJG C;  4UP8 A;  2MUY A;  1B50 A;  1HTL D;  3DM1 A;  1QWY A;  3KLS A;  4C3I G;  4L5Q A;  2F0W A;  3A7L A;  1UEA B;  2CKZ B;  2Z6B A;  1SNC A;  1A2U A;  1YIT A;  1KNE A;  3J80 c;  1HH2 P;  3TN2 A;  1E2Z A;  3UE1 A;  1PFB A;  1L2F A;  1JOQ A;  3CQZ B;  4A3K B;  5F2D A;  3WOF A;  4P72 A;  2JA8 G;  1B3A A;  4O2D A;  5IGD A;  2KCM A;  4OO1 H;  1DOM A;  1PH8 A;  2F1M A;  3KBG A;  2XWB B;  1TWA B;  1PTO D;  4LFB L;  1O80 A;  4DR2 L;  1VQ6 A;  1Q82 C;  1TWG B;  5I6Y A;  3FKI G;  1KL9 A;  2ICI A;  4I65 A;  2DJG C;  2R7D A;  4I7Z C;  1I6H B;  3K5N A;  1FNU A;  3MEF A;  4JPB W;  4HCS A;  4G7O C;  1WI5 A;  2OQK A;  1N34 Q;  1F9P A;  1PH9 A;  3M4Q A;  1ENF A;  2EY6 A;  3PIP 3;  4A3M B;  3C2P A;  1M4V A;  3LWE A;  1CUK A;  4MIU A;  5KNB A;  3FHW A;  2F3W A;  1S5E D;  4FO2 A;  4IPC A;  3RUZ A;  3EFX D;  2VQF L;  1WTW A;  1G6Z A;  2CW0 C;  2R93 G;  4NKL A;  1NY4 A;  4BY7 G;  1K8O A;  3PO2 H;  5C4X G;  3K0Y A;  3PUZ A;  1QJO A;  5C6A A;  2HIX A;  1Z6H A;  1VQO A;  5IYB H;  4K5W A;  5KGU A;  2F0M A;  4Y52 H;  3I70 A;  1K73 C;  1Q8K A;  3CME A;  4MTN A;  5C3E G;  4FDB A;  1A8V A;  1I5F A;  5IY0 A;  1MJC A;  4WRD A;  4IPD A;  4DV5 L;  2HCC A;  2KHS A;  2Y0S B;  3NTK A;  3VA5 A;  4G7H C;  4IZ8 A;  5M5Y B;  3DEO A;  2R92 B;  2ID0 A;  3DWQ A;  3GTM H;  2AUJ D;  2PYK A;  2L9H A;  3EIV A;  2UXB Q;  2I46 A;  3S2D H;  4EQ5 A;  4AQY Q;  4BBR G;  3EQL C;  1B9M A;  2R7Z G;  4HED A;  4DV2 Q;  5GRO A;  3PIP A;  2M9V A;  1BBU A;  1EQT A;  2M2L A;  5HGT A;  3E3X A;  1RTO A;  3V05 A;  1CQV A;  3TEH B;  1QZG A;  2A69 D;  2B2T A;  5LMU Q;  1U4P A;  3P75 A;  2WP8 J;  5IWA Q;  2C35 B;  4LUV A;  4GOP A;  1HNW Q;  4HSP A;  3M3Y B;  2MO0 A;  5G3L F;  1SAP A;  4KHP Q;  4B3M L;  2KOL A;  2V4D A;  1EZ6 A;  3E5S A;  3AMU A;  3NP8 A;  5BN4 A;  3HOV H;  2QEX A;  3HS0 C;  3HOZ B;  4GKK L;  3I2Z A;  3DHQ A;  1XTC D;  2K6A A;  1LAC A;  1W3S A;  5ELD A;  3RZD B;  4DFA A;  4YIJ A;  2F4I A;  2B2V C;  1XX8 A;  2JA6 H;  2DN8 A;  5EJW A;  1LT3 D;  3U4V A;  3RLO A;  2ATW A;  1EYC A;  4LF7 L;  4DR7 Q;  4LUO A;  4XQN A;  1W6J A;  2RHS B;  4HMJ A;  5ELF A;  3BDL A;  3NWT A;  1UEB A;  4ZKC B;  5IIF A;  1C8C A;  1MJE A;  5M5W B;  1A3U A;  4XT3 B;  1HCZ A;  4YCV A;  2VXW A;  4H13 C;  4BWG B;  3F2C A;  1HZC A;  3QO2 A;  1VQC A;  1UNS A;  4HN7 A;  1UE1 A;  3K5M A;  4JV5 L;  4HTH A;  3S1M H;  5I9O A;  1LM0 A;  3NHH A;  1SYD A;  3T16 A;  1Y1W G;  4NP5 A;  1NTG A;  5IP7 G;  4A3G H;  1CQF A;  3I4M G;  3UE0 A;  3MZ5 A;  5IGB A;  5DEH A;  1A15 A;  4IJL A;  1S5D D;  4HAE A;  1Q7Y C;  5KYI A;  3KYH C;  2RBM A;  4TKO B;  2JXM B;  1WTQ A;  4DR4 Q;  4C3H G;  3W2D A;  4QIW E;  3PF5 A;  4XTC S;  3GO5 A;  4H0L C;  2EY5 A;  5EAY A;  1STH A;  3MA2 B;  1BDO A;  4JI0 L;  2LY7 A;  2NVX H;  2O5J C;  2FMC A;  1D6E C;  4ZYS A;  2AKW B;  3K59 A;  4XYO A;  2XTI A;  4HJ8 A;  1SDF A;  2DNE A;  1G6P A;  4HJA A;  1PZI D;  4LF6 L;  1SE3 A;  1G2T A;  2YV5 A;  3U58 A;  2RF4 A;  3TS2 A;  2K03 A;  3I56 A;  1QG7 A;  5IYC H;  4L5T A;  1R4Q B;  1XTD A;  1VQM A;  3F2U A;  1U0L A;  4JI8 Q;  5K36 H;  4P74 A;  1SND A;  3IAY A;  4LF9 Q;  1KNA A;  2JA5 B;  1C4Q A;  1NJI C;  2UUA L;  1HNX Q;  4GNX A;  4HR7 B;  5T1I A;  2HUG A;  2A68 C;  4CKC A;  4CKE A;  3VDY A;  1B1Z A;  3ER0 A;  4DUY Q;  4R9W A;  4QUC A;  1F2Y A;  2RQX A;  2Z9H A;  3PO2 B;  3D4W A;  1VS0 A;  3S2H H;  1D5Z C;  4A3C G;  5FJ8 H;  4A93 B;  4FP5 D;  3M4O B;  2D0P A;  4JI3 Q;  1HFG A;  1O7Z A;  2OT2 A;  4JOI A;  4ME5 A;  1STN A;  2J7Z A;  5COY A;  2HD3 A;  1SN8 A;  2MFI A;  4DV4 Q;  1H9K A;  1K9M C;  3K57 A;  3GTM B;  3H3V C;  1JR0 D;  1VQH A;  2BE5 C;  5IOC A;  1IBK L;  1UAP A;  1LT4 D;  3S2D B;  2WAQ G;  1M1K C;  5KIX A;  2O4X A;  3AB9 A;  4NXM Q;  2VQE Q;  1O7L A;  2QDB A;  1VQI A;  2EYL A;  1CT1 D;  2I5M X;  4ULL A;  4UPA A;  2PNH A;  1XPU A;  1SEB D;  2IT1 A;  1A6X A;  1NAP A;  1EZ8 A;  4YY3 Q;  1AZQ A;  3KFU A;  2N3S A;  4IOA A;  1ENC A;  4A3E G;  4RHR A;  1EY4 A;  1PFN A;  3KF8 A;  1XWE A;  2PW5 A;  5J3B A;  3HOV B;  3J7A 5;  4GKJ L;  1B53 A;  3PUV A;  4BBS H;  4LFA Q;  1R9T H;  3O13 A;  3H94 A;  4ZRZ A;  1G2S A;  3A7A B;  3ZJY C;  3HZX A;  1Q86 C;  4LJZ C;  3PIO 3;  2HDM A;  2X69 A;  2ZJR A;  2JA6 B;  3PO3 H;  4KY7 A;  4RA8 A;  1YJ9 A;  1PH3 A;  1K83 H;  1LTI D;  3T1H L;  3G7L A;  2C9O A;  3H0G B;  4FVM A;  1WTV A;  5CBE E;  1L0W A;  3KF6 B;  2Q2I A;  1XNR Q;  2V1C C;  3CCU A;  2PQA A;  2DY7 A;  4YCW A;  4F7X A;  1E22 A;  2ZT9 C;  4HCE A;  3CC7 A;  2QW7 A;  5D3I B;  3HOX H;  3R93 A;  4B3R L;  1N36 L;  4LF4 L;  5D65 A;  5JEA H;  1KDA A;  2KHI A;  3GTQ H;  2PZT A;  5CYU A;  1T9H A;  1SSO A;  4QB4 A;  4N8X 1;  1OXV A;  1BBW A;  5EPL A;  4RH6 A;  1XMO Q;  5CR3 A;  2L0C A;  3VYU A;  4A75 A;  2KVM A;  2L11 A;  2N55 A;  3S1M B;  2PQE A;  4HIM A;  5IT9 L;  4WJ3 M;  3PIO A;  1HZA A;  4QJF A;  5I2Y A;  4A3G B;  2E2J B;  1VQL A;  4DR3 Q;  2JYO A;  2SOB A;  4JW0 A;  3D3R A;  1J5E L;  1RCV D;  1ZYR D;  2FXQ A;  4DU9 A;  5HUR A;  1EYA A;  1A3V A;  4R4Q A;  5C44 G;  5C3X A;  4JI2 L;  1VMP A;  1GUT A;  3UI2 A;  1Y8N B;  1L1O C;  3UDI A;  2NVX B;  3K0X A;  3N52 A;  3OYY A;  4OX9 Q;  4RG1 A;  1BBX C;  2XSC A;  1AH9 A;  2WAQ E;  3J80 i;  1FNW A;  5D3D A;  1JOO A;  3UDG A;  1FNV A;  4OWT B;  3C1F A;  4DUZ L;  2E2H H;  1I50 H;  3K8A A;  1JB3 A;  4PMC A;  3FP9 A;  5E1F A;  2YYZ A;  1X55 A;  4L6T B;  3KLS X;  3HFZ B;  1X32 A;  2UXC L;  4MHE A;  4IJH A;  3MEH A;  2A6E D;  1PH4 A;  5LMN L;  3CC2 A;  3D6C A;  3CCM A;  1I4P A;  2H5X A;  4HJ9 A;  2LXJ A;  3I90 A;  2EY1 A;  1BO0 A;  2A5H A;  1Z7T A;  4DV5 Q;  1SYG A;  3GQB A;  1D1K A;  1E1T A;  2PMZ E;  3BVG A;  2CH4 W;  4IUR A;  2O5I C;  5E3F A;  5ELB A;  1AE2 A;  3D0F A;  1EIG A;  1EYD A;  3A8K E;  3N6R A;  3S2H B;  2K52 A;  4DR1 L;  4JI6 L;  4KY6 A;  2JSO A;  4A3K H;  1CSQ A;  2R61 A;  5C0X J;  1SE2 A;  4J6H A;  2PPB C;  4A3J B;  4UP7 A;  2MO1 A;  3L2P A;  5KRU A;  4QIW B;  1MGS A;  5JJI A;  1A3T A;  1Q1E A;  1K8G A;  4K5X A;  3I4N H;  2EXZ A;  3D6W A;  1WTO A;  1H9R A;  1YNN D;  3STB D;  1YJW A;  2E2D C;  4OO1 G;  1IYJ B;  4GKK Q;  4R4O A;  5BR8 L;  1B8A A;  1PDQ A;  1YEZ A;  5FO8 B;  5C0X G;  1GUG A;  1K3R A;  2XRS D;  2IX0 A;  5DLQ E;  4R4T A;  3RLN A;  4LF5 L;  4RKL A;  2D9U A;  1S3O A;  3GD7 A;  4KD4 A;  4HIK A;  3MHB A;  4HJ5 A;  4A76 A;  1D8L A;  1L0Y B;  2ZXP A;  2HDL A;  4DAY A;  4KJN A;  3DM3 A;  4YCU A;  3GV6 A;  2EE1 A;  2B2Y A;  4BBS B;  1TVX A;  3JAM L;  1R9T B;  4O42 A;  1JMC A;  2Z6K A;  5GAD C;  1ET6 A;  2G9H D;  2K32 A;  1IZ6 A;  5ELE A;  4DXF A;  3PO3 B;  5M3F G;  1E2V A;  2AQ1 B;  1K83 B;  1YNX A;  3NQI A;  1QE6 A;  3FPP A;  1HQR D;  3PF4 A;  1JWS D;  5AFW A;  4X6A H;  5AJ3 L;  5IYB G;  5GQO A;  3KK7 A;  1F2Z A;  3J81 L;  3M85 A;  3SDZ A;  2J4X A;  4LWC A;  3LNN A;  4X65 Q;  2RSN A;  3CP0 A;  1EY7 A;  1SMX A;  3J80 E;  1Y8P B;  3MXN A;  4ZK9 B;  1A63 A;  1MIU A;  2ZTE A;  4FF2 A;  3TP7 A;  4YWK A;  1GHJ A;  3GTQ B;  4AYB G;  1YBY A;  2CCZ A;  2F0S A;  2QKI C;  3CRL C;  2K1B A;  2OWO A;  3T4A C;  3GTK H;  2N78 A;  2IW3 A;  2HIV A;  4JBW A;  3RZD H;  1PVO A;  2F03 A;  1Q1B A;  4C3J H;  5IT9 E;  2D2C C;  4X3K A;  4GLX A;  1SYF A;  1L1O B;  1CFM A;  2BH8 A;  2IY5 B;  4C56 C;  1SNQ A;  1PRT D;  2C5C A;  4IFD I;  4H7B A;  1IYU A;  1STE A;  2LMC B;  3SVM A;  1HRJ A;  1CHQ D;  5GAE C;  1T5X D;  4A3D H;  1HA5 A;  2SDF A;  2EYH A;  3CCL A;  4GS3 A;  2JA6 G;  3RD4 A;  1ILQ A;  1SR3 A;  4OWX B;  3NWS A;  3Q22 A;  1G51 A;  4V19 0;  3MFY A;  2F0Q A;  1I50 B;  4IFD H;  4YHH L;  3NBH A;  4BS9 A;  1GUO A;  1OO9 B;  2L55 A;  3OHX C;  1GJX A;  3BYT B;  4UP9 A;  1K8A C;  2MPM A;  5IP9 G;  4DV0 L;  1X3F A;  3CRK C;  1OTC A;  2F4V L;  3R2T A;  2QF7 A;  5JPN C;  3GTL H;  3GP7 A;  3I4O A;  1WOC A;  1G29 1;  3UDF A;  4ID6 A;  2OTJ A;  4A3F B;  2A19 A;  3JC6 6;  3R2I A;  1TS5 A;  4LF8 Q;  1AFP A;  4DR5 L;  4OEM B;  4TRD A;  2Q8I B;  2CH4 A;  1RKN A;  1PH6 A;  3CCJ A;  2E5L L;  4A3L H;  3MXG A;  5IOD A;  1EIY B;  4RMF A;  2B2W A;  2VL6 A;  3HGB A;  3I73 A;  3I4N B;  2K14 A;  4JYA L;  1TS4 A;  4HIO A;  2XRQ D;  5IT9 c;  3KUP A;  3KDF A;  3QB3 A;  2K75 A;  3T1Y L;  3SK4 A;  1G91 A;  2X6G A;  4AYB E;  1VQP A;  1PH5 A;  3IFT A;  4MNO A;  3HKZ B;  1KQS A;  2DJF C;  4KLK A;  3SE0 A;  3L0O A;  2K5Q A;  4RKB A;  1V1O A;  2JA5 H;  3HOY G;  3AU7 A;  1XYI A;  1WVL A;  3S1N H;  4R1J A;  1C9O A;  5FO7 B;  1TS3 A;  3W5O A;  1WCM H;  2F3I A;  1KDC A;  2JK8 A;  4K5V A;  5M3M H;  1ICW A;  2A74 C;  1BNZ A;  2BH2 A;  3BZK A;  4GLA C;  2BA0 A;  1UWV A;  1TY0 A;  3BVM A;  4A93 H;  3M4O H;  3K81 C;  4WOR A;  1A2T A;  2PMZ B;  3RMH A;  4NXN Q;  3OMG A;  3I4L A;  2B29 A;  3JAM E;  1F77 A;  4CJ0 B;  1CKN B;  1S5F D;  3HOW H;  4POG A;  2F0N A;  2VUM H;  2B2U A;  2B2T C;  4JI4 L;  2K5W A;  4JBK A;  3KOJ A;  4GOP C;  1V9P A;  1H9S A;  2QIL A;  5FJ8 G;  2G5D A;  1N32 L;  3H09 A;  2G9D A;  1QOH A;  5IGC A;  5M5X H;  1FJG Q;  1OXX K;  3LGJ A;  5J39 A;  2KHJ A;  2E2I H;  1V1P B;  1B3Q A;  2D5D A;  3MXU A;  4WJW A;  1EWI A;  1XXG A;  1AN8 A;  3GTG B;  4GZY C;  4PV1 C;  1WTX A;  5CC4 A;  5IYD G;  4DV3 L;  1TQO A;  3IKJ A;  3AFP A;  4APV A;  3G6E A;  4PNY A;  2LS0 1;  4NDX A;  5DAU A;  2F0P A;  4F8M A;  3PMF A;  3AYH B;  1SNO A;  4RGM A;  4IUQ A;  4KJO A;  1P16 A;  3P20 A;  3WWV A;  4XT1 B;  1EUJ A;  1RHP A;  2WB1 G;  1EQR A;  3GTK B;  1TKW B;  4X62 Q;  1O78 A;  1X3E A;  4JI2 Q;  1HJP A;  4JI7 L;  3FPU B;  3OW2 A;  3EN2 A;  3RLF A;  3X3N A;  2JJQ A;  4C3J B;  1PZJ D;  3A74 A;  4A3B H;  4JI5 L;  2L15 A;  2KQ3 A;  2IJ0 A;  4B3S Q;  1PH7 A;  4DR6 Q;  2ZJQ A;  1FD7 D;  3H0G H;  4DGZ A;  1XJV A;  1MKH A;  4OL7 A;  3KLR A;  4K0K L;  4A3D B;  1SMY C;  1VMC A;  1LTT D;  2NYZ D;  2PZW A;  3PO3 G;  3MTS A;  1ILP A;  3HG9 A;  5LMN Q;  4BY1 G;  1YNJ D;  3PV0 A;  3HOU H;  1JT8 A;  4ZLT F;  1CI3 M;  3V2T A;  4CBV A;  2NVT H;  1KHI A;  2Q2T A;  2CVR A;  3D8G A;  4OXP A;  1TXY A;  2N49 A;  4K6D A;  4N9T A;  1CZW A;  5FLM G;  3JAM c;  2AUK A;  1WD0 A;  3F1Z A;  1LYL A;  2EJM A;  3BJU A;  1EOT A;  2UUB Q;  1GHK A;  4DR1 Q;  4JI6 Q;  3B6Y A;  3HOX G;  2A1A A;  2E2J H;  4XQQ A;  5JEA G;  3A55 A;  2H4O A;  1IW7 C;  4L8J A;  4C3I H;  3GTL B;  1IKL A;  2IX1 A;  1FGU A;  5G3L D;  1X54 A;  3VA7 A;  1AEX A;  3CHB D;  3J81 c;  2EDG A;  2EOT A;  4IOC A;  2AQ2 B;  1Y1V G;  1VQ7 A;  2EYM A;  1TWH H;  1PH1 A;  2UXD L;  1VQJ A;  2PW7 A;  2F0I A;  3EVQ A;  1I4H A;  1GD7 A;  3PQI A;  4ABN A;  4NB3 A;  2JA8 H;  3CAM A;  2Q8T A;  1SRO A;  4FYD A;  2NWG A;  2R7F A;  1JCK B;  3HRZ C;  3VYS A;  4LF5 Q;  4KN4 C;  1HR0 W;  1HZ9 A;  1QUQ B;  4GNX C;  3RN2 A;  4A3I G;  4A4I A;  3FKI H;  4XDX A;  4ALP A;  3QOJ A;  3KBX A;  1SXT A;  2NN6 G;  2NUC A;  3ZYY X;  1I94 L;  2AWO A;  3H3V I;  1HQM C;  4TQU S;  4J1M A;  4JOI C;  2B63 B;  3A8I E;  1U9R A;  4DK6 C;  3K5L A;  4DV1 Q;  5HY6 A;  3S1N B;  4DNI A;  3BZD B;  2Q8R E;  4JCV E;  1EY0 A;  1CK1 A;  2DY8 A;  3AFQ A;  1WCM B;  1MSG A;  1WD1 A;  5M3M B;  2R93 H;  2K50 A;  2Z8L A;  4BY7 H;  3Q24 A;  5C4X H;  5AJ3 Q;  2BDN A;  1QZH A;  3Q0A A;  1DJR D;  3KJP A;  3U50 C;  1VCI A;  4GOP B;  4A3J H;  3OMC A;  1Z9F A;  3H3V H;  3MAQ A;  2AWN A;  1YI2 A;  2PCF B;  1EYG A;  2HHH L;  3HOW B;  1XNQ Q;  2VUM B;  5J1Z A;  1P8L A;  1C48 A;  4QUF A;  2ALY B;  4QY7 A;  3CF5 A;  2VB2 X;  1BKB A;  2QA4 A;  4A3K G;  1ESF A;  5M5X B;  2LSS A;  2QCP X;  2VW9 A;  1NR4 A;  3U9S A;  5JJK A;  2JE6 I;  2E2I B;  4EQN A;  5C4Z A;  1Q46 A;  3CCE A;  1JJG A;  3EA6 A;  4IN3 A;  1Y14 B;  4JI1 Q;  3AQQ A;  4KI0 A;  4KHV A;  3I4N G;  3RN5 A;  1B2T A;  2A6H C;  3TP5 A;  1N33 L;  1M8A A;  3DXJ C;  3BYY B;  1JWM D;  4N9P A;  2MGS A;  4F88 A;  1X6O A;  1YHA A;  3VR6 A;  4K2K A;  1PV4 A;  2SEB D;  1BCP C;  3CKI B;  3ITP A;  4A3M G;  4M1U B;  4DPG A;  5ELO A;  2RDG A;  1MSH A;  2MP1 A;  4GN5 A;  4A3B B;  4K14 A;  3J7Z C;  3I72 A;  1VQG A;  1CHP D;  3TQY A;  2Q2H A;  2OF1 A;  1L0X B;  1SLJ A;  3BDO A;  3S16 B;  4POF A;  1KIX A;  3WOE A;  5CV8 A;  3OTO L;  3C1E A;  4C2M B;  1FGB D;  4K8J A;  4YHH Q;  1UUP A;  1N34 L;  2Z1C A;  1LO5 D;  2UUC L;  4KMU C;  4QMG A;  5A2Q L;  2Y0S G;  1YIJ A;  4ODG A;  4DV0 Q;  3HOU B;  2F4V Q;  3VYT A;  3W1B A;  2R92 G;  3NUC A;  2YTV A;  3H91 A;  3FEW X;  2NVT B;  3TRE A;  4R4I A;  2CW0 D;  5COR A;  1CA5 A;  3I55 A;  3FVQ A;  1EEI D;  4DNR B;  2F0J A;  3CU7 A;  1FR3 A;  2ZM6 L;  1V43 A;  1ZXT A;  1D2B A;  5E4X A;  4OIK A;  2JA7 B;  4J15 A;  1XPO A;  1PTO C;  1SRU A;  2CQA A;  1Y1W H;  5IP7 H;  3PSI A;  1VQ4 A;  2RDF A;  3I4M H;  4C3I B;  4C1N K;  4GN3 B;  1B7Y B;  4EGV A;  4DR2 Q;  4LFB Q;  2UXB L;  1I4G A;  2FFK B;  1UE6 A;  2IHF A;  3QR8 A;  1VQF A;  4C3H H;  3SK6 A;  4FF4 A;  3HOZ G;  4DV2 L;  4BA2 I;  1TWH B;  3IL8 A;  1KAB A;  1XPR A;  3F2B A;  3EJI A;  4TVA B;  4GNX B;  2RA4 A;  2JA8 B;  1CSP A;  1B44 D;  2P5Z X;  2WAC A;  1LTS D;  1QB5 D;  5IWA L;  1UE5 A;  4QQB X;  1F9Q A;  2OQ0 A;  3K7A H;  3KLW A;  2EZV A;  3S24 A;  5IGG A;  3FKI B;  4KHP L;  1S5B D;  2VQF Q;  4LNQ A;  3U9O A;  2EQS A;  4RHS A;  5JVG 3;  1GVP A;  3GTP B;  2CWA A;  3ERQ A;  4LW1 A;  1EIH A;  1ASY A;  1CM9 A;  2NZ1 D;  4O1N A;  2R3Z A;  1AW7 A;  1ICF B;  5DM7 3;  1STA A;  4FXK C;  4X64 L;  4P71 A;  4EX5 A;  3RR5 A;  2B3G A;  4DR7 L;  4PMB A;  4K2L A;  1KAW A;  2PI2 A;  3OOC A;  4IFD G;  3L3O C;  1BOS A;  1VQ8 A;  1PYB A;  1J8I A;  5EKL A;  5JAV A;  4A3F H;  4JI4 Q;  2R93 B;  4IUP A;  4BY7 B;  1TWC H;  2HQL A;  2JA9 A;  2VB3 X;  1YJN A;  5C4X B;  5EBC A;  2NTT A;  1N32 Q;  3D4R A;  3IFD A;  2WKD A;  4M8A A;  1ML0 D;  1HTP A;  3S9W A;  3SR1 A;  5CV5 A;  3A56 A;  3ERO A;  4KK7 A;  4Y7N H;  2A69 C;  5C3E B;  3KF8 B;  4X3T A;  2F0G A;  3S14 H;  2VZA A;  2WIN B;  2KUM A;  2N88 A;  2LXK A;  3A54 A;  1N8R C;  1NSN S;  3ICE A;  1AP0 A;  2MHV A;  2UU9 L;  4B3M Q;  4BBR B;  3GDE A;  2K01 A;  1WTR A;  2B2Y C;  2R7Z B;  1NBW A;  4L63 B;  2F0E A;  3M7G A;  1E2W A;  2HT1 A;  2KEN A;  2I5H A;  2Z6K C;  3SK8 A;  3NXW A;  4DR4 L;  5CV6 A;  2ENB A;  2RSO A;  4B9W A;  1TT2 A;  4JI5 Q;  4KV6 A;  1BCP B;  2RVL A;  1SYC A;  3CC4 A;  4KKS A;  2PQA B;  4A3E H;  5KEE A;  4I7A A;  2ZTC A;  4NMZ A;  2CQO A;  4LF7 Q;  3LX0 A;  4OON A;  5FLX L;  4H44 C;  1DYQ A;  1ROD A;  4K0K Q;  1CA6 A;  1ESR A;  3NPP A;  2JA5 G;  1E7Z A;  2D62 A;  3J7A V;  3PCO B;  3NSW A;  1VQ9 A;  3ND8 A;  1CZG A;  1IBL L;  1ASZ A;  5J22 A;  3PO2 G;  4DAP A;  2K05 A;  4LK1 C;  4UAI A;  4JI8 L;  3W1G A;  4A93 G;  1FYC A;  4JV5 Q;  2EYJ A;  3CPF A;  3IRB A;  2OTL A;  1KRS A;  4CJ2 C;  1I4X A;  4PQX A;  1EWC A;  1BR9 A;  2IX3 A;  1HNX L;  4X3S A;  3GTG H;  2FIN B;  1BCP F;  5LL6 S;  1DOK A;  3HOW G;  2I07 B;  4JK1 C;  3R3O A;  4DUY L;  3QIA A;  4P75 A;  2F0L A;  1Q81 C;  4UY8 C;  3P1H A;  4PZ8 A;  1PTO B;  2A68 D;  2XIW A;  1LAB A;  1KXL A;  1WTP A;  5ISR A;  4LMQ D;  5EKI A;  4YWM A;  2IHE A;  3I8Z A;  4PZ6 A;  2UXD Q;  1VQB A;  3S1R H;  4HSV A;  4JI0 Q;  5KYL A;  1Y1W B;  5I9P A;  3CPW A;  1DOL A;  1RJT A;  3I4M B;  4DV4 L;  2CHB D;  1RF2 D;  1KC8 C;  3S17 H;  3JAM i;  4LF6 Q;  5CV4 A;  5JJL A;  3M7N A;  4C3H B;  3HOV G;  1E24 A;  2BE5 D;  3VR5 A;  5C44 H;  1STB A;  3EBE A;  1X3P A;  1YHB A;  1BF4 A;  2EPB A;  3J7A F;  4WJ4 A;  2WFW A;  1V1Q A;  1I94 Q;  4YY3 L;  2TSS A;  4DV6 L;  3K80 C;  1PTO F;  1JB7 A;  3J81 i;  3K7A B;  2MJ8 A;  1PYS B;  2B8F A;  1SYB A;  2UUA Q;  3RNU A;  1LTA D;  3H0G G;  3M4P A;  3SEB A;  3TZU A;  3K58 A;  3NEL A;  1KLG D;  1AE3 A;  2YTY A;  2K4K A;  4CHT B;  1K28 A;  4P73 A;  3U4Z A;  5LHY 1;  4U67 3;  1D5X C;  3NK9 A;  1EOV A;  4B3T L;  1B9N A;  2GVA A;  1VQD A;  2WV6 D;  3TP6 A;  1IKM A;  2B2W C;  1J9O A;  2HHH Q;  1EL0 A;  5IGE A;  2K5H A;  3W3A A;  2WII B;  5KNC A;  4CDE C;  1JOK A;  4H02 A;  1TWC B;  1IBK Q;  5JJZ A;  2NVQ H;  1D5M C;  2F0H A;  3E0J A;  1X3Q A;  4A3G G;  1E1O A;  3NEM A;  4KHZ A;  1BVS A;  3OW7 A;  1X3G A;  4ZKB B;  5C0X I;  4PZ7 A;  2NVY H;  4Y7N B;  4DAY B;  4TSS A;  2YU9 H;  2Q2U A;  1JE5 A;  1PA6 A;  3S14 B;  4CKB A;  5FK9 C;  1MHW C;  2JQO A;  1XMO L;  5DNF A;  1N33 Q;  1FL0 A;  4C1N I;  3A8J E;  3OSO A;  3H6M A;  5CV7 A;  1EY9 A;  1WTH A;  4X66 L;  3DLL A;  1SJE D;  2WAQ B;  3KJO A;  3ERS X;  1LUZ A;  2Z4I A;  1Q90 A;  1RD9 D;  4FF1 A;  1EQV A;  2F0F A;  5C4J H;  4DR3 L;  4GKJ Q;  4HJ7 A;  1C7Y A;  4GLV B;  1ZEQ X;  4DK3 C;  5C0X H;  3I3C A;  4UDU C;  2B63 H;  4KKT A;  1JQY D;  2OEO A;  2ZXR A;  1VDZ A;  1W2B A;  1EIF A;  5FOB B;  5IYC G;  1HNZ L;  4A3E B;  2B2U C;  4DV7 L;  3Q23 A;  3K5O A;  4XYQ A;  3TME A;  3T1H Q;  3P7J A;  2K28 A;  4EVO A;  3MXN B;  5K36 G;  3OTO Q;  3L7Z C;  4OX9 L;  2L12 A;  2BCO A;  2PNR C;  1Y8O B;  5E4W C;  5FLX E;  3UDX A;  3H15 A;  1U5K A;  4CDF C;  4HMI A;  2UUC Q;  3TBI B;  3GV3 A;  4RAU C;  1VQK A;  1F2L A;  1E3P A;  4B3R Q;  1PHJ A;  1N36 Q;  4LF4 Q;  5M3F H;  2KCN A;  5JOB A;  4DAV A;  1QUQ A;  1KDB A;  3WDN A;  1PFM A;  1TWF H;  1PXU A;  1GUW A;  2XGT A;  4FNF A;  2ZM6 Q;  4A3J G;  4QF4 A;  1NCV A;  3G48 A;  1ZYR C; 
#chains in the Genus database with same CATH homology
 2VS1 A;  4NXM L;  3J80 i;  2K50 A;  2VQE L;  3UDG A;  4BY7 H;  3HOZ H;  5C4X H;  5AJ3 Q;  3CD6 A;  1QZH A;  3GTJ H;  3CCV A;  1J5E Q;  3KJP A;  3U50 C;  1HR0 L;  4OWT B;  4JI1 L;  1VCI A;  3J81 j;  1PH2 A;  2R6G A;  2MQH A;  4AIM A;  1I50 H;  4DUZ L;  3K8A A;  1Z9F A;  4GOP B;  4A3J H;  2E2H H;  4YWL A;  3AEV A;  3FP9 A;  3H3V H;  4A3B G;  1D7Q A;  2YYZ A;  1X55 A;  2AWN A;  5H1S E;  1YI2 A;  2NZO A;  2CFM A;  1EYG A;  2HHH L;  1XMQ L;  1VQN A;  3S1Q H;  3HFZ B;  1XNQ Q;  2UXC L;  4ME3 A;  4IJH A;  1P8L A;  4LUZ A;  1PH4 A;  1S40 A;  5LMN L;  1IBM L;  2ALY B;  3CC2 A;  4QY7 A;  3CF5 A;  3CCM A;  1BKB A;  2H5X A;  3PUW A;  2QA4 A;  4HJ9 A;  2DGY A;  4A3K G;  2LXJ A;  4LFA L;  2LSS A;  3BU2 A;  2RCN A;  2VW9 A;  5JJK A;  2Z0S A;  4DV5 Q;  2JE6 I;  3NBH B;  3CXC A;  5M5W H;  1E1T A;  3PUX A;  2PMZ E;  1Q46 A;  3CCE A;  1JJG A;  1J6Q A;  1M90 C;  3HOU G;  3S16 H;  3TS0 A;  1AE2 A;  2OCE A;  3D0F A;  1Y14 B;  4JI1 Q;  4BBS G;  3AQQ A;  4KI0 A;  4DUZ Q;  3I4N G;  4BXX G;  4C2M H;  2K52 A;  3RN5 A;  4DR1 L;  4JI6 L;  1HZB A;  4A3K H;  2D0O A;  4JG2 A;  1N33 L;  1CSQ A;  3CCR A;  1O7I A;  5C0X J;  4LFC L;  2ASB A;  2UXC Q;  5JEA J;  4UP7 A;  2MO1 A;  3L2P A;  1XNR L;  1X6O A;  1YHA A;  3ULL A;  3S15 H;  5JJI A;  1Q1E A;  1K8G A;  2JA7 G;  1C0A A;  4X64 Q;  4OWW B;  3CW2 C;  1PV4 A;  3I4N H;  4BXX H;  4OO1 I;  4UP8 A;  5FLX c;  4A3M G;  4DPG A;  2JEB I;  1GKH A;  5ELO A;  1PFS A;  3STB D;  4GN5 A;  4L5Q A;  1YJW A;  2YTX A;  2CKZ B;  3J7Z C;  1VQG A;  4OO1 G;  1YIT A;  1IYJ B;  3TQY A;  4GKK Q;  1GO3 E;  2JA7 H;  2Q2H A;  4R4O A;  5BR8 L;  3J80 c;  1B8A A;  1HH2 P;  1YEZ A;  5C0X G;  1SLJ A;  1K3R A;  3RLN A;  2IX0 A;  5DLQ E;  4R4T A;  3UE1 A;  4POF A;  5IP9 H;  1KIX A;  2ZJQ A;  3OTO L;  1L2F A;  1A62 A;  2BA1 A;  1S3O A;  3GD7 A;  4YHH Q;  4HIK A;  1N34 L;  1X9N A;  4HJ5 A;  4A76 A;  4P72 A;  3KDF B;  2JA8 G;  1D8L A;  4O2D A;  2KCM A;  2UUC L;  3STB C;  2I0Q A;  1PH8 A;  2VNU D;  2Y0S G;  3DM3 A;  1YIJ A;  4YCU A;  4LFB L;  4DR2 L;  4DV0 Q;  1VQ6 A;  3E0E A;  1Q82 C;  2F4V Q;  3W1B A;  4X65 L;  2R92 G;  3FKI G;  1KL9 A;  2YTV A;  2UU9 Q;  3TRE A;  1JMC A;  2Z6K A;  4R4I A;  3PGZ A;  3KF6 A;  2R7D A;  5GAD C;  3I55 A;  2ZJP A;  1IZ6 A;  5BR8 Q;  1X65 A;  4IPH A;  2ZM6 L;  5M3F G;  1V43 A;  3MEF A;  4J15 A;  1WI5 A;  2OQK A;  1XPO A;  1N34 Q;  1YNX A;  1SRU A;  1PH9 A;  3M4Q A;  1Y1W H;  1SE8 A;  5IP7 H;  3PSI A;  3PF4 A;  3ULP A;  1VQ4 A;  4X6A H;  5AJ3 L;  3I4M H;  1CUK A;  5IYB G;  4GN3 B;  2I5L X;  5GQO A;  1NMG A;  3FHW A;  2VQF L;  1B7Y B;  4IPC A;  3M85 A;  4QGU A;  4DR2 Q;  4LFB Q;  3GTP H;  2UXB L;  4X65 Q;  4LWC A;  1UE6 A;  2IHF A;  2R93 G;  1VQF A;  3CP0 A;  3E9H A;  1SMX A;  1RIP A;  4C3H H;  5HGQ A;  1NY4 A;  4BY7 G;  3HOZ G;  1QVC A;  3PO2 H;  4DV2 L;  5C4X G;  4BA2 I;  3PUZ A;  4LF5 L;  1MIU A;  1A63 A;  1N9W A;  2WB1 E;  2ZTE A;  2HIX A;  4RG1 A;  4YWK A;  1VQO A;  5IYB H;  3HOY H;  1XPR A;  4AYB G;  1YBY A;  3F2B A;  2CCZ A;  4Y52 H;  4TVA B;  4GNX B;  1K73 C;  1Q8K A;  3CME A;  5E7N A;  1CSP A;  4MTN A;  5C3E G;  4FDB A;  1A8V A;  3M9B A;  1IBL Q;  1I5F A;  5IY0 A;  2OWO A;  1MJC A;  4IPD A;  4DV5 L;  5IWA L;  4PG3 A;  4PMW A;  1UE5 A;  1SFO H;  4QQB X;  2OQ0 A;  3K7A H;  2N78 A;  3KLW A;  3GTK H;  1RL2 A;  3S24 A;  2ID0 A;  3GTM H;  4KHP L;  2HIV A;  4JBW A;  2VQF Q;  3RZD H;  3EIV A;  2UXB Q;  1PVO A;  2GN5 A;  4LNQ A;  1Q1B A;  2F52 A;  4EQ5 A;  4C3J H;  4AQY Q;  2EQS A;  3S2D H;  4BBR G;  1GVP A;  5GAH C;  5C3E H;  3A5U A;  3SGI A;  4GLX A;  2R7Z G;  4DV2 Q;  5GRO A;  3PIP A;  1L1O B;  2CWA A;  4A3F G;  4LW1 A;  1S72 A;  2BH8 A;  2IY5 B;  1ASY A;  1BBU A;  5GAG C;  4IFD I;  1KRT A;  1DGS A;  4IPG A;  4X64 L;  4P71 A;  4EX5 A;  3TEH B;  3RR5 A;  3RZO H;  1NMF A;  2B3G A;  5GAE C;  1QZG A;  4DR7 L;  5LMU Q;  4A3D H;  4BBR H;  2E8G A;  1HNW Q;  1KAW A;  2WP8 J;  5IWA Q;  2C35 B;  2PI2 A;  4LUV A;  4GOP A;  1IL2 A;  2R7Z H;  4IFD G;  2MO0 A;  1PYB A;  1VQ8 A;  3CCL A;  4GS3 A;  2JA6 G;  4A3F H;  4JI4 Q;  2KCT A;  4KHP Q;  4B3M L;  1SR3 A;  4OWX B;  3HOV H;  1TWC H;  2HQL A;  2JA9 A;  1CKM A;  2QEX A;  1YJN A;  4GKK L;  1B70 B;  2RHQ B;  1N32 Q;  5IYD H;  3I2Z A;  1I3Q H;  1G51 A;  1W3S A;  3K7U C;  4LF8 L;  4YHH L;  4Y7N H;  2JA6 H;  3KF8 B;  3CMA A;  3U4V A;  3RLO A;  3S14 H;  2ATW A;  3HKZ G;  2VZA A;  4UP9 A;  1K8A C;  4LF7 L;  4DR7 Q;  1VQE A;  5IP9 G;  4WJ3 M;  4LUO A;  4DV0 L;  1X3F A;  1OTC A;  2F4V L;  2RHS B;  2LXK A;  1EFW A;  1N8R C;  3ICE A;  1UE7 A;  1X56 A;  2UU9 L;  4L5S A;  1UEB A;  4B3M Q;  4DV6 Q;  3GDE A;  1FVI A;  3I4O A;  1WOC A;  3GTL H;  1MJE A;  1G29 1;  1NBW A;  3UDF A;  3NEN A;  2PI2 E;  2OTJ A;  2HT1 A;  2A19 A;  2I5H A;  2KEN A;  4YCV A;  3JC6 6;  2Z6K C;  3F2C A;  1HZC A;  1OXT A;  1VQC A;  1QVG A;  4LF8 Q;  4DR4 L;  4DR5 L;  4JI5 Q;  3CC4 A;  2PQA B;  4A3E H;  1UE1 A;  1PH6 A;  2ZTC A;  3CCJ A;  2E5L L;  1Q12 A;  2CQO A;  4LF7 Q;  4JV5 L;  4A3L H;  4OON A;  1EIY B;  4RMF A;  3F2D A;  2VL6 A;  4DKA C;  4BY1 H;  3S1M H;  1QVF A;  1LM0 A;  4GN4 B;  1VQ5 A;  4B3T Q;  4K0K Q;  1Z47 A;  1Y1W G;  1NTG A;  5IP7 G;  4A3G H;  2K14 A;  1IXR A;  1YHQ A;  3I4M G;  4JYA L;  2JA5 G;  3UE0 A;  4HIO A;  1E7Z A;  5IT9 c;  2D62 A;  3KDF A;  4IJL A;  3PCO B;  5FLM H;  1VQA A;  1Q7Y C;  2K75 A;  3KYH C;  3T1Y L;  1VQ9 A;  4AYB E;  4DR4 Q;  2EXD A;  4NXN L;  1IBL L;  1VQP A;  4BA1 I;  3HKS A;  4DR5 Q;  1PH5 A;  1ASZ A;  3PO2 G;  4MNO A;  3PF5 A;  4QIW E;  1KQS A;  4KLK A;  3F8T A;  4XTC S;  3GO5 A;  3L0O A;  2CWP A;  2JA5 H;  3HOY G;  4JI8 L;  3W1G A;  2E5L Q;  5EAY A;  4A93 G;  4JV5 Q;  3CPF A;  3IRB A;  3S1N H;  2OTL A;  4JI0 L;  1KRS A;  4R1J A;  1C9O A;  3W5O A;  1WCM H;  2F3I A;  2NVX H;  2JK8 A;  5M3M H;  2AKW B;  4AQY L;  4MZ9 A;  1HNX L;  2XTI A;  4HJ8 A;  3GTG H;  1FJG L;  3I7F A;  3HOW G;  4JYA Q;  2BH2 A;  4HJA A;  1G6P A;  4LF6 L;  4QL5 A;  3BZK A;  4X66 Q;  1Y1V H;  2YV5 A;  4GLA C;  4DUY L;  2BA0 A;  1UWV A;  2EIF A;  2RF4 A;  3A5Z B;  4O0A A;  4P75 A;  3U58 A;  2NN6 I;  1Q81 C;  4UY8 C;  3M4O H;  3TS2 A;  4PZ8 A;  3I56 A;  3K81 C;  2K5V A;  3T1Y Q;  3TRZ A;  5IYC H;  4L5T A;  3CCQ A;  1YVC A;  4NXN Q;  1KXL A;  3G71 A;  2B29 A;  5LMU L;  1XTD A;  1VQM A;  1HNW L;  1CKN B;  4YWM A;  4NPS A;  3HOW H;  2IHE A;  4XIG S;  4POG A;  2VUM H;  1U0L A;  4PZ6 A;  3GTO H;  4IFD J;  4JI8 Q;  4JI4 L;  1VQB A;  4P74 A;  3S1R H;  2UXD Q;  4JBK A;  3KOJ A;  4JI0 Q;  4GOP C;  4A3I H;  1V9P A;  1HNZ Q;  4LF9 Q;  4IO9 A;  3CPW A;  5FJ8 G;  4X62 L;  4DV4 L;  1N32 L;  4A3D G;  4DV7 Q;  1NJI C;  1GM5 A;  5M5X H;  1KC8 C;  2UUA L;  1HNX Q;  3S17 H;  4GNX A;  3JAM i;  1FJG Q;  1OXX K;  3LGJ A;  2KHJ A;  1WYD A;  2E2I H;  4LF6 Q;  2N8N A;  2MNA A;  3VDY A;  5JJL A;  1EWI A;  3ER0 A;  4DUY Q;  3M7N A;  3HOV G;  1E24 A;  5IYD G;  4DV3 L;  1VS0 A;  4B3S L;  3S2H H;  5C44 H;  4A3C G;  5FJ8 H;  3AFP A;  4APV A;  2A8V A;  3EBE A;  3G6E A;  4DR6 L;  3HKZ E;  1YHB A;  2D0P A;  4JI3 Q;  1KD1 C;  3AYH B;  4JOI A;  4WJ4 A;  2WFW A;  3A0J A;  1V1Q A;  1I94 Q;  1P16 A;  3WWV A;  4YY3 L;  4DV6 L;  1JJ2 A;  3K80 C;  1EUJ A;  2WB1 G;  1L1O A;  1JB7 A;  5ELN A;  1EQR A;  3J81 i;  1PYS B;  1NE3 A;  1SN8 A;  2MFI A;  4X62 Q;  1X3E A;  4JI2 Q;  4DV4 Q;  1K9M C;  1HJP A;  2UUA Q;  3RNU A;  3H0G G;  4A3C H;  4JI7 L;  3M4P A;  1VQH A;  3EN2 A;  3OW2 A;  3RLF A;  1IBK L;  2JJQ A;  2WAQ G;  3BZC A;  1M1K C;  3A74 A;  3NEL A;  4A3B H;  4JI5 L;  2L15 A;  4NXM Q;  2VQE Q;  1AE3 A;  4DV3 Q;  2YTY A;  2K4K A;  1PH7 A;  4B3S Q;  1VQI A;  4DR6 Q;  2I5M X;  4UPA A;  4P73 A;  3U4Z A;  3G4S A;  4JBJ A;  2PNH A;  2Y0S E;  3D31 A;  3H0G H;  2IT1 A;  1HR0 Q;  2UUB L;  1XJV A;  1XPU A;  1MKH A;  1EOV A;  4B3T L;  4K0K L;  3CQZ H;  2GVA A;  1VQD A;  4YY3 Q;  3KFU A;  2QGQ A;  4IOA A;  2N3S A;  3PUY A;  4A3E G;  1EQQ A;  2HHH Q;  1XMQ Q;  2K5H A;  4A3L G;  3PO3 G;  5IE8 A;  5J3B A;  1TWA H;  5LMN Q;  4BY1 G;  1IBM Q;  4JI7 Q;  3PV0 A;  4H02 A;  4JC0 A;  1IBK Q;  3HOU H;  1TWG H;  2NVQ H;  3J7A 5;  4GKJ L;  1JT8 A;  3PUV A;  4BBS H;  4A3G G;  4LFA Q;  1R9T H;  1E1O A;  3NEM A;  4KHZ A;  1BVS A;  2NVT H;  1X3G A;  3ZJY C;  1KHI A;  3E9I A;  1Q86 C;  2Q2T A;  5C0X I;  3JAM c;  4PZ7 A;  4OXP A;  1TXY A;  2N49 A;  2NVY H;  2NZH A;  5FLM G;  2ZJR A;  4DAY B;  1I6H H;  3PO3 H;  3F1Z A;  2YU9 H;  1LYL A;  3BJU A;  2Q2U A;  1WJJ A;  1JE5 A;  1PA6 A;  2UUB Q;  3CCS A;  1YJ9 A;  1PH3 A;  1A0I A;  1K0R A;  4DR1 Q;  4JI6 Q;  2JQO A;  3B6Y A;  1K83 H;  2A1A A;  3HOX G;  1XMO L;  1N33 Q;  3T1H L;  2KBN A;  2B63 G;  2E2J H;  1FL0 A;  1L0W A;  5JEA G;  4A3M H;  4LFC Q;  4X66 L;  3DLL A;  3KF6 B;  2Q2I A;  4C3I H;  1XNR Q;  3KJO A;  2V1C C;  3ERS X;  3CCU A;  1LUZ A;  1WCM G;  1OXS C;  2PQA A;  4YCW A;  2IX1 A;  5M3M G;  1E22 A;  1FGU A;  4GKJ Q;  5C4J H;  1X54 A;  4DR3 L;  3CC7 A;  1LTL A;  4HJ7 A;  3J81 c;  4GLV B;  1C7Y A;  4IOC A;  2JEA I;  3HOX H;  4DK3 C;  1Y1V G;  2B63 H;  2VY3 A;  1VQ7 A;  4B3R L;  1N36 L;  1TWH H;  1PH1 A;  4LF4 L;  2UXD L;  1VQJ A;  1W2B A;  1EIF A;  2AMC B;  2KHI A;  3GTQ H;  1GD7 A;  5IYC G;  1HNZ L;  4LF9 L;  4NB3 A;  1T9H A;  4JBM A;  2JA8 H;  1OXV A;  3CAM A;  1BBW A;  4DV7 L;  1WFQ A;  1SRO A;  4DV1 L;  1JJC B;  1XMO Q;  4A93 H;  2R7F A;  2DUD A;  4A75 A;  3T1H Q;  4LF5 Q;  2VUM G;  2ZTD A;  3MXN B;  5K36 G;  3OTO Q;  4HIM A;  1HR0 W;  1HZ9 A;  3L7Z C;  5M5Y H;  3PIO A;  4OX9 L;  1QUQ B;  1HZA A;  4HID A;  1YZ6 A;  4A4I A;  3FKI H;  4QJF A;  4GNX C;  3RN2 A;  4A3I G;  4L5R C;  2R92 H;  4AH6 A;  3UDX A;  3H15 A;  1VQL A;  1U5K A;  4ALP A;  4DR3 Q;  2UUC Q;  1OXU A;  1J5E L;  2FXQ A;  4JI3 L;  1VQK A;  1H95 A;  2R93 H;  1E3P A;  2NN6 G;  4R4C A;  5LMN W;  4DAM A;  1PHJ A;  1N36 Q;  4LF4 Q;  5M3F H;  4B3R Q;  1I94 L;  2AHO B;  2AWO A;  3H3V I;  2GVB A;  4TQU S;  1CKO A;  4R4Q A;  2K5N A;  4JOI C;  5C44 G;  1XNQ L;  1QUQ A;  4DK6 C;  2ES2 A;  4JI2 L;  4DV1 Q;  5HY6 A;  4DNI A;  1L1O C;  1TWF H;  4JCV E;  3ULJ A;  3Q8D A;  3UDI A;  2XGT A;  3AFQ A;  2ZM6 Q;  4A3J G;  3K0X A;  3M3Y H;  3OYY A;  4OX9 Q;  1CKN A;  3G48 A;  1AH9 A;  2WAQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...