4LF8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8Q00
4QL5A 3UE1A 1I94Q 2EXDA 1K3RA 3K0XA 4XTCS 3HOWG 3KFUA 4GN3B 4C2MH 5IYDG 1SFOH 4UPAA 2I5HA 3HOZG 2H5XA 1BVSA 5C4XG 1IZ6A 4JBMA 3KDFA 4PG3A 3GDEA 1MIUA 1E1TA 5C44H 1KXLA 5M5WH 1EWIA 2YYZA 3PUVA 4IJHA 4A3IG 4JI3Q 4IJLA 4BY7H 3U4ZA 5IYBG 1UE7A 3I4MH 1XPUA 1IBMQ 2CFMA 2MO1A 1SMXA 2N49A 4P74A 5M3FH 3RZOH 1HNWL 1X6OA 2FXQA 5GAHC 3FKIG 2RCNA 1HZ9A 4X6AH 3LGJA 4J15A 1E1OA 1M1KC 2I0QA 4UY8C 2WFWA 4BBRH 4BA2I 3HKSA 4DR6L 4DV3L 2VS1A 1KC8C 3KOJA 2QA4A 2K50A 4DR3L 3CPFA 2E2JH 3GO5A 2JA7G 1N33Q 2YTXA 3RNUA 4K0KQ 4DV2L 4QJFA 3L2PA 1QZHA 4HJ7A 4JV5L 4DV1L 1B7YB 2VY3A 3MXNB 3PUZA 2Z6KA 3I56A 4X64Q 1M90C 4LUOA 2OQ0A 4JOIC 4YCVA 2ZM6Q 4POGA 2HIXA 1GKHA 1X3FA 3D0FA 2K4KA 3K7AH 3CCEA 3CCJA 1WCMH 4NB3A 3H3VH 5GADC 1QUQA 4TQUS 4JI4Q 4X66L 2NVXH 3AEVA 2YTVA 3UDFA 4B3MQ 3EBEA 2ASBA 1JT8A 2OQKA 3W1GA 4QGUA 3PIPA 4LF9Q 4A3LG 4A93G 1XJVA 2R7ZH 4DR4L 1IBLQ 1X56A 1VQIA 2R7FA 3MEFA 1L1OA 1AE2A 1BBUA 1B8AA 3M4OH 4QQBX 4DV5L 4GOPB 2DGYA 3CW2C 4JI1L 1P16A 1UE6A 5ELOA 1XNQQ 3S2DH 4IPHA 4APVA 3CMEA 4X62L 3RN5A 4X65Q 3RR5A 4JI2Q 1PH2A 4JI7Q 5JJIA 1K0RA 4PZ6A 2PMZE 4BBSG 1YJWA 1A8VA 1V43A 4JI5Q 1BBWA 2I5MX 4A4IA 4DR5L 2UU9Q 4B3SL 1QVFA 2LXJA 2RF4A 4JYAL 2GVBA 3T1YL 3KF6B 2VQEL 2PNHA 3CC4A 3CCLA 4DR1L 4QIWE 3OTOL 3S1RH 1YIJA 1IL2A 2Z0SA 5FLMH 4IFDG 3E9HA 2AMCB 1SE8A 4YY3Q 3CC7A 1Q81C 2JEBI 4PMWA 5JJLA 1VQLA 1L1OC 1AH9A 4WJ3M 1GD7A 1XMOQ 3OYYA 3L7ZC 4C3HH 2UUBL 3H0GH 1VQ5A 2UXBL 4OO1G 1D8LA 1N34Q 1X3GA 4R4OA 1FJGL 1JJCB 1PFSA 2R93H 2UXDQ 4WJ4A 2EQSA 1FVIA 1YITA 1J5EL 4LUZA 3J80i 2CWAA 2LXKA 4DUYQ 3CPWA 4OWWB 3GTPH 3HOVH 4MZ9A 1EIYB 1GM5A 1VS0A 1EFWA 4LNQA 1VCIA 3T1HQ 1TXYA 3S1NH 2JJQA 4LFCL 1BKBA 3ULJA 3KJOA 4DUZL 5C44G 4LF6Q 3GD7A 3HKZE 3STBD 1IXRA 4LF7L 1ASZA 2VZAA 1I3QH 1K73C 5FLXc 3I4MG 3M3YH 3GTKH 3HKZG 4R4QA 4DV6Q 2Q2UA 1IBKL 5M3FG 1CKNA 4NXML 3E9IA 3S16H 4B3RQ 4XIGS 3ER0A 2IHEA 1CUKA 1CKMA 3PIOA 1ASYA 2E2HH 3I4NH 4AH6A 4BY1H 3M9BA 3CXCA 4A3BG 1YJNA 1XMQL 4JI0Q 3S15H 2AHOB 4OX9L 2R6GA 4OXPA 4KI0A 3RLNA 5LMNL 1W2BA 1PV4A 5EAYA 3J81c 1QZGA 2AWOA 3HFZB 1Y14B 1NBWA 2NN6G 3CCVA 1PH6A 1WCMG 5LMNW 1Q86C 2K52A 1WYDA 4DK6C 3CCQA 4B3TL 1HNWQ 4RG1A 4LUVA 1OXUA 4DAMA 5C0XG 2GVAA 3AQQA 4LFBQ 1PVOA 5M3MH 1S72A 1GVPA 1D7QA 4UP7A 4DK3C 2E8GA 4AIMA 3NENA 2UUAL 4DV3Q 3K8AA 4KHZA 4IO9A 2K14A 1V9PA 4A3MG 4AYBG 2ZTCA 4DR3Q 2YTYA 4P71A 3D31A 1SROA 3BZCA 3ULPA 2R7ZG 4DV2Q 1G6PA 3U50C 3H15A 2AKWB 4DV4L 2OTJA 1K9MC 1HR0L 1X65A 1TWHH 1G51A 1UWVA 3I7FA 4NXNL 1Z47A 3STBC 4JG2A 1LUZA 4A3GG 3RN2A 2F4VQ 1MJCA 2JA5H 1MKHA 1HR0W 4GKJL 3U4VA 5C3EH 2JA9A 1HNZQ 2HIVA 5JJKA 3NEMA 2B3GA 4MNOA 5IP9H 1KL9A 3S24A 4DV0Q 2PI2A 4HJAA 3UDXA 4C3IH 2GN5A 3KLWA 1SN8A 4DR4Q 1RL2A 3S17H 2YV5A 4YHHL 5FLMG 3M85A 2UXCL 4IOAA 5GQOA 3CCUA 4HIOA 1Q46A 1VQMA 1RIPA 4GOPA 1VQFA 4X62Q 2D0OA 2JA6H 2NVQH 3UDGA 1SR3A 4A3MH 3Q8DA 3F2DA 3H0GG 1KIXA 3IRBA 1A0IA 3JC66 3CQZH 5LMUQ 2N78A 3J81j 4O0AA 2DUDA 1IBML 2R93G 1KAWA 2WP8J 2NZOA 4OWXB 4JYAQ 3NBHB 3JAMc 2JA8H 3T1YQ 5IE8A 3PO3H 4GKKL 2KCTA 2AWNA 2Q2HA 3OTOQ 4LF4Q 4LF8Q 3HOVG 2YU9H 2UXCQ 4A3GH 3KF6A 2Z6KC 4KLKA 3ULLA 3U58A 3PCOB 1NE3A 1UE5A 3CP0A 3CMAA 1N33L 4K0KL 1VQKA 1VQOA 3CCSA 1LYLA 5IWAQ 1YJ9A 1U0LA 2K75A 3M7NA 1NY4A 1H95A 2UXBQ 4GLXA 1FJGQ 2ZM6L 4YCWA 4A3FH 4KHPQ 2NVYH 4JC0A 5JEAJ 2XTIA 1CSQA 1KQSA 4IOCA 4JI4L 1JJ2A 2E5LQ 4IFDI 4JI6Q 4JCVE 4R4IA 5BR8L 2VL6A 1R9TH 1C9OA 3I4NG 3FHWA 4BY1G 4B3ML 1YHBA 3PUXA 3CAMA 2MNAA 1KRSA 4LF9L 5AJ3L 1PYSB 4HIMA 4L5TA 3KJPA 1IBLL 5IY0A 3CD6A 4LFCQ 4OO1I 2VNUD 4DNIA 4DUZQ 1N36L 3B6YA 5HGQA 4AQYL 4JI8Q 1E3PA 1J6QA 2ZJQA 2MFIA 2OCEA 4A3DH 4GNXB 2B29A 4OWTB 4P75A 4P73A 1XNQL 1K83H 4DPGA 2Q2TA 3CF5A 4X65L 3I55A 4JI2L 4NXMQ 4JI7L 4DR7Q 4FDBA 2CKZB 4A3KH 4H02A 2EIFA 1VQ9A 4JI5L 4GN4B 1KHIA 1N9WA 5M3MG 1HNXL 1B70B 1I50H 2KCMA 3J80c 2IX1A 3PGZA 2UU9L 4DR2Q 1VQJA 1NJIC 4JBKA 4R4TA 4QY7A 2K5VA 3DLLA 1Q1EA 4R1JA 3A5UA 2OTLA 4LFAQ 2VQFQ 3CCRA 4BXXH 5IYCG 3A74A 5LMNQ 1TWCH 1WI5A 2MO0A 2NVTH 4YY3L 1Y1WH 2C35B 4PZ8A 4YWMA 3S2HH 1PH3A 2KBNA 1PH9A 1E7ZA 2ALYB 3S1MH 1YNXA 4B3TQ 1NMGA 1VQGA 2JA5G 2B63H 4Y7NH 1OXSC 2BA1A 1W3SA 5C3EG 1N34L 4A3EG 1HJPA 1VQBA 4HJ8A 1YBYA 2UUAQ 5IP9G 3TQYA 3AFPA 1VQDA 3EN2A 2JEAI 3RZDH 1S40A 1JB7A 4P72A 3UE0A 4DUYL 2BH2A 5FJ8G 1VQ4A 3HOXH 1C7YA 4LWCA 4DKAC 2ES2A 2RHQB 1HR0Q 4A75A 1VQPA 1K8GA 4AYBE 1VQNA 1G291 3J7ZC 5C0XI 1XNRL 4JBWA 3BZKA 3PUYA 4NPSA 4LF6L 3J81i 2JA6G 4GS3A 3G6EA 3GTQH 3PF5A 3WWVA 2WB1E 1HH2P 1TWGH 1N32L 1JE5A 1WJJA 2JQOA 4DV6L 4JV5Q 5IYCH 2UUCL 3BU2A 4LF5L 2WB1G 4L5QA 3KYHC 1EQQA 2A1AA 3K80C 4B3RL 4DV1Q 3PSIA 3GTLH 2ZJRA 1LM0A 2JA8G 2VUMG 3PO3G 1X54A 2XGTA 3G71A 2N8NA 2ZTEA 2HHHL 1CSPA 2Q2IA 3F8TA 1P8LA 4YHHQ 5M5XH 1HZBA 1VQCA 1OXVA 3TRZA 1Y1VH 3M4QA 3GTOH 4X66Q 1HZAA 4DV7L 1YHQA 1XTDA 4EQ5A 4A3EH 2ZJPA 4JI0L 2PQAA 3AFQA 3K81C 4JOIA 1X55A 3PV0A 2R92H 1A62A 2IX0A 1IYJB 1I5FA 4ME3A 3A5ZB 1PH1A 1LTLA 1PH5A 1I94L 4YCUA 3PUWA 4A3FG 1Z9FA 5FJ8H 4HIDA 1PH8A 3KDFB 4GN5A 1VQEA 4JBJA 3KF8B 3TEHB 3TS0A 3BJUA 4IFDJ 4DV5Q 2PQAB 3CCMA 4JI1Q 4LFBL 2I5LX 3VDYA 3TS2A 4GKKQ 1UE1A 3F1ZA 2BH8A 1I6HH 4HJ9A 3A0JA 1YEZA 1VQ6A 4JI3L 1TWFH 1Q8KA 1TWAH 3K7UC 2N3SA 2D62A 1VQAA 1FGUA 1NTGA 3J7A5 5IP7G 2F3IA 5HY6A 4DR5Q 4B3SQ 3HOUH 4R4CA 1PHJA 3HOZH 1VQHA 5GROA 2QEXA 3RLFA 2VUMH 1SLJA 4LW1A 3PO2G 1YZ6A 4A3DG 2VQEQ 2BA0A 1FL0A 1QVCA 4DR1Q 3HOWH 3ICEA 1PH7A 1YVCA 1K8AC 5IYDH 2F4VL 2RHSB 4GLVB 3G4SA 5C4XH 2PI2E 4A3KG 1C0AA 1E24A 4C3JH 1PYBA 5BR8Q 1NMFA 1L0WA 1HNZL 4UP8A 1EIFA 4DV0L 3JAMi 4A3IH 2UUBQ 1CKOA 5DLQE 2Y0SE 5AJ3Q 2L15A 4X64L 4GOPC 4A3JG 3E0EA 1X9NA 5IYBH 4L5SA 1QUQB 4BXXG 1N36Q 2IT1A 2MQHA 2Y0SG 4IPCA 4AQYQ 3M4PA 4DR6Q 1OXTA 2R7DA 1J5EQ 1T9HA 4IPGA 3FKIH 1Y1WG 3GTGH 3F2CA 2OWOA 2IY5B 4GLAC 4A76A 2VW9A 4GNXA 3S1QH 4OONA 2B63G 4IPDA 2JA7H 1KD1C 1Q1BA 1L1OB 5LMUL 1HNXQ 3RLOA 1PA6A 3S14H 5M5YH 4ALPA 5IP7H 1XPRA 1A63A 2HT1A 1YHAA 4LF7Q 3W1BA 3PO2H 2ATWA 2E2IH 1EQRA 3I2ZA 3HOXG 4LF4L 4BA1I 1IBKQ 4LF8L 4A3BH 4A3CG 1UEBA 3AYHB 5GAGC 2NZHA 3SGIA 2LSSA 4POFA 1U5KA 5C0XJ 3PF4A 2F52A 2KHIA 5K36G 3G48A 3TREA 1HZCA 3FP9A 5IWAL 1AE3A 2A19A 3L0OA 4A3LH 2JE6I 1XMQQ 1PH4A 4A3JH 4KHPL 4OX9Q 4GNXC 2CWPA 2ID0A 2JK8A 3ZJYC 1E22A 1V1QA 3OW2A 1Q82C 5J3BA 3HOYG 1QVGA 2E5LL 4JI6L 1L2FA 1XPOA 3ERSX 1DGSA 2CQOA 1Q7YC 1S3OA 4DAYB 5C4JH 1XMOL 4BBSH 1EUJA 1Y1VG 3UDIA 3GTJH 3CC2A 3NELA 4L5RC 1XNRQ 1WOCA 1KRTA 1EYGA 2R92G 2UXDL 5E7NA 4HJ5A 4Y52H 2KENA 1MJEA 5GAEC 2WAQE 2K5NA 3I4OA 4TVAB 1EOVA 4JI8L 4BY7G 2V1CC 2IHFA 2HQLA 4UP9A 4HIKA 1N8RC 1VQ8A 4A93H 4YWKA 1N32Q 2WAQG 5JEAG 2UUCQ 4LF5Q 4A3CH 1O7IA 4YWLA 4DR7L 4DV4Q 1JJGA 2NN6I 4RMFA 3H3VI 5ELNA 2KHJA 1OTCA 3DM3A 4NXNQ 3T1HL 2A8VA 5H1SE 4BBRG 1VQ7A 1SRUA 2ZTDA 2HHHQ 2K5HA 4DR2L 4PZ7A 5IT9c 4O2DA 4GKJQ 4EX5A 1CKNB 4DV7Q 1YI2A 1WFQA 4LFAL 2D0PA 2VQFL 1GO3E 4MTNA 3HOUG 1Q12A 1X3EA 1OXXK 2QGQA 3EIVA 3HOYH 1JMCA 2CCZA 3F2BA 3W5OA 3GTMH
chains in the Genus database with same CATH superfamily
2EXDA 4O1NA 3KFUA 1ICWA 4GN3B 4ZKCB 2LY7A 3V2TA 1IHZA 1FR3A 1STYA 3KF8A 3I73A 5M5WH 1EWIA 1SJED 2AQ1B 4BY7H 2N55A 1UE7A 1XPUA 1IBMQ 5M9OA 1SMXA 2LKVA 5M3FH 1HNWL 1X6OA 4O42A 4X6AH 1SJHD 4J15A 1M1KC 4FF1A 3KOJA 2QA4A 1HXYD 4DR3L 2E2JH 2JA7G 2EYOA 4K0KQ 3URYA 4XQQA 4CBVA 1B7YB 4RFBA 3I56A 4PQXA 3LWEA 1GKHA 2KHSA 3D0FA 3K7AH 3CCEA 3VA7A 5GADC 4JI4Q 1S5ED 2A6HD 3AEVA 3EBEA 4R8NA 5EPKA 3EJIA 1JT8A 2B2VA 3G7LA 4OGQC 4A3LG 3T16A 1EQVA 1IBLQ 4JW0A 1EEFD 2R7FA 3FPUB 3BVGA 1L1OA 1BBUA 1CFMA 1I4QA 4DF7A 2EY1A 1P16A 5ELOA 5I9OA 3T13A 1YNJC 4APVA 1SYDA 2B63B 4JI2Q 5JJIA 2Q8IB 1FNVA 5JPMC 2EDGA 2LXJA 2RF4A 1BDOA 3CCLA 1JC7A 1IL2A 2A73B 3X3NA 3SEBA 4QIWB 1SE8A 2B2YC 2Z8LA 2JEBI 2RVLA 4PMWA 1VQLA 1D1KA 4NW2A 1MGSA 3L7ZC 1VQ5A 3J7AF 4DAYA 1JJCB 1PFSA 2RDFA 2WV6D 1WVLA 3OMGA 1H9KA 4MZ9A 1EIYB 3KUPA 3A8JE 4LNQA 1TVXA 1VCIA 3D4RA 1BKBA 5C44G 3F2UA 4BY7B 1BCPC 2VZAA 1K73C 3M3YH 4R4QA 2B8GA 4F8MA 1F2ZA 1IBKL 2F0VA 1CKNA 2XRSD 4H13C 3P75A 4XIGS 1WD1A 1CUKA 1ZYRC 2PZWA 5FLXL 3I4NH 4AH6A 4NKLA 1UUPA 5I4DA 3I8ZA 1U4MA 2AHOB 3HOUB 2EYHA 4OXPA 3HOZB 4KI0A 1W2BA 2AUKA 2F0KA 1HCZA 5EAYA 2R61A 3N6RA 4KV6A 4ZCKA 2AWOA 3TP6A 1NBWA 2NN6G 5C4XB 4DK6C 1U9RA 3CCQA 4B3TL 1CM9A 2ICEC 2F0IA 5M3MH 4DK3C 1KLUD 2BH2A 4A3IB 3K8AA 4KHZA 1UEAB 2K14A 4AYBG 2ZTCA 1FNUA 1JWMD 3ULPA 2R7ZG 4DV2Q 1G6PA 2WINB 3LNNA 3VYTA 3H15A 1FNWA 3CRLC 3FKIB 4NXNL 1DM0B 1Z47A 3TZUA 1LUZA 1BO0A 2D5DA 3S1QB 2F4VQ 1A3UA 1MKHA 1RODA 3U4VA 1EIHA 2EYPA 1R4QB 3PIP3 5JJKA 2K32A 3NEMA 3ERQA 2NWGA 4KKSA 3E3XA 2PI2A 1XX8A 3UDXA 4C3IH 3KLWA 1RL2A 2YV5A 1WTRA 4KTAA 4TSSA 4G57A 4GOPA 2JA6H 1SDFA 3UDGA 3F2DA 1G8ZD 5TSSA 4H7BA 3CQZH 1VMCA 2DUDA 1IBML 4RAUC 5DEHA 4JVZA 5E3FA 1EIGA 2KCTA 2AWNA 2EPBA 2Q2HA 3HOVG 3BZDB 3KF6A 3ULLA 3GTJB 2O5JC 2V4DA 4K0KL 3TP5A 1EYDA 5LHY1 1PTOH 4DK1A 3CU7A 1M8AA 5FO9B 4GLXA 1FJGQ 3S9WA 4A3FH 2PYKA 5JEAJ 2XTIA 1KQSA 4IOCA 4JI4L 2XSCA 1JJ2A 4KK7A 1SMYD 4OIKA 4JI6Q 1XTCD 2X6LA 4R4IA 3FHWA 4BY1G 3CAMA 3LWUA 1IBLL 5IY0A 1N36L 3OIPA 4AQYL 3GTMB 1E3PA 2ZJQA 1Y69U 3J81E 4A3DH 4GNXB 4P75A 1SFOB 1K83H 4DPGA 3W2DA 3CF5A 4DR7Q 3I55A 4JI2L 1DCZA 5D14A 1L0YB 1PDQA 4H02A 4A3KH 2EIFA 1VQ9A 4GN4B 1K8OA 1B70B 2KCMA 2MP1A 4DR2Q 2NBFA 3DLLA 3I4MB 3A5UA 3CCRA 2ZXPA 3PMFA 4K5XA 1NCVA 2ZXOA 1Y1WH 1F9PA 3T4AC 5CYUA 2C35B 1E7ZA 2ALYB 1KABA 3K6OA 2QILA 1H9SB 2CH4A 1QCBD 4LJZC 4X3UA 5C3EG 3OWEB 4C1NK 1YBYA 2UUAQ 2LS01 1BCPF 2PPBC 4R8IA 2G5DA 5FJ8G 1C7YA 3HOXH 2Q8TA 1RKNA 1HR0Q 2NVXB 4DAPA 1G291 1QJOA 5C0XI 1TY0A 1QILA 3J81i 3GTQH 2PZTA 1H9RA 1G2TA 3N52A 1WJJA 1J8IA 3P1HA 2B2UC 3M4OB 4L5QA 3QO2A 2K28A 5C3WA 4DV1Q 3PSIA 4V190 3GTLH 4G7HC 2E2DC 4RGOS 3RMHA 1STGA 2X69A 3S2DB 2N8NA 2JSOA 1TQOA 1GXDC 2IX3A 4B9WA 2RDHA 1OXVA 3IL8A 3C1EA 3GTOH 4K8JA 4X66Q 1YHQA 4EQ5A 4U673 4A3EH 2ZJPA 3C46A 4JOIA 3NP8A 4NMZA 3PV0A 2EY6A 5KNBA 1A62A 2EVBA 5FK9C 5CV7A 3A5ZB 4RGMA 1LTLA 5CBAE 1PH5A 4YCUA 1AN8A 2X6GA 1PRTC 2K5QA 4HIDA 1PH8A 2F4IA 2JYOA 3KDFB 3TS0A 4IUNA 2I5LX 2M2LA 3VDYA 3TS2A 2O5IC 1CQVA 3H0GB 2F0DA 1Q8KA 1NNXA 1YNNC 2B2WC 2D62A 1CQFA 3J7A5 4ODGA 4DR5Q 2I07B 3RLFA 2VUMH 3GTPB 1K83B 3ICEA 3HOWH 2OT2A 2RHSB 3MXGA 3G4SA 2F4VL 1C0AA 3S1NB 4C3JH 1LTRD 1NMFA 1L0WA 4UP8A 4RCNA 2L0CA 2F3WA 1STHA 1I4PA 1EYCA 1I3QB 2CH4W 1WTVA 2UUBQ 4FF4A 4X64L 1X9NA 4BXXG 1I6VC 1QUQB 1GUTA 2F0OA 4L5SA 1BXTA 1S5FD 3K0YA 2HCCA 3SR1A 3TBIB 1Y8OB 3GTGH 2IY5B 4GLAC 1JE4A 4A76A 2B63G 4RA8A 3HRZC 4IUTA 3S15B 1C4QA 1Q1BA 3AU7A 4HMIA 3RLOA 3R93A 2ENBA 4LK1C 1A63A 2HT1A 1EQRA 3MTSA 5GAGC 3DXJC 1DXMA 4IQZA 4KJOA 1JR0D 2F52A 3TREA 1HHVA 3HP3A 2A19A 3L0OA 4OX9Q 1D6EC 1BCPB 1E22A 4KKTA 4JI6L 1L2FA 1CK1A 1XPOA 4QCLA 5C4JH 1XMOL 4ZAIA 4A3EB 1AFPA 2KCNA 5A2QE 2UXDL 4BY7G 3H09A 5ELCA 1PYWD 4QMGA 4HIKA 1TS3A 1BBXC 4A93H 2PQEA 1N32Q 4K2LA 5C4ZA 4YWLA 4DR7L 2I46A 4RMFA 2K5DA 3A55A 4DR2L 4PZ7A 1DOLA 1EYAA 4DV7Q 1YI2A 1KDCA 2WB1B 1WTQA 3HOUG 1X3EA 1OXXK 2QGQA 3Q22A 3HOZG 2CCZA 2JA8B 3PO3B 2VUMB 1I94Q 1K3RA 3K0XA 1SYGA 1ONLA 2I5HA 1DOKA 1BVSA 2H5XA 1U4PA 5C4XG 3J81L 3EFXD 4R9WA 2B2TC 3R2TA 3GDEA 1BOSA 1E1TA 1IYVA 2YYZA 3PUVA 4A3IG 4JI3Q 3C1FA 2BE5D 2CFMA 2MO1A 3BYTB 4P74A 4ZUJA 3RZOH 3ND8A 3FKIG 2RCNA 5CBEE 3LGJA 4UY8C 1E1OA 4BA2I 3ND9A 4DR6L 1KC8C 1C8CA 3RNUA 1IKMA 4QJFA 4HJ7A 1ZEQX 1Z7TA 3A54A 4DV1L 4ZRZA 3LX0A 3MXNB 3PUZA 1RD9D 2NUCA 3DEOA 3VYSA 2OQ0A 1GHKA 1CZGA 4YCVA 2ZM6Q 1X3FA 4CHTB 1PRTF 1WCMH 2HUGA 1VDZA 4TQUS 4X3TA 5C0XH 4X66L 1SNPA 2OQKA 2MJ8A 4QGUA 1OO9B 1XJVA 1I4GA 2HQEA 3K5MA 4DFAA 4M8AA 2SDFA 4QQBX 4KD4A 3CW2C 2OXPA 3S2HB 1XNQQ 4L6TB 4F88A 2L1BA 3RN5A 4EQOA 3RR5A 1PH2A 4JI7Q 2PMZE 4OL7A 5KNCA 4DR5L 1QVFA 4X3KA 4JK1C 4JYAL 2GVBA 1G2SA 5EBDA 3D6CA 4J1MA 1B4OA 1YIJA 1WD0A 5FLMH 4IFDG 4OHJA 1GUGA 3CC7A 3O13A 1L1OC 4CDDC 3DMUA 4WJ3M 1GD7A 2AQ2B 4C3HH 2UUBL 3E6ZX 2UXBL 1I4HA 2R93H 4WJ4A 2EQSA 1IW7C 1I4XA 4K5WA 1WTPA 3OSOA 1EU4A 2LXKA 3I70A 1EFWA 1Y1VB 1STAA 1RDPD 3T1HQ 2JJQA 4IUQA 3EQLC 3ULJA 4DUZL 1EY9A 4LF6Q 3GD7A 4G7ZC 3STBD 1ASZA 3VA5A 3DWPA 2WAQB 3I4MG 1Q90A 4NXML 2IHEA 5I6YA 1CKMA 1ASYA 2E2HH 4OELB 3M9BA 1H9JA 3H91A 4OX9L 2R6GA 2EXZA 3J81c 3I72A 1DONA 4XYOA 2RA4A 1WYDA 3NTHA 4RG1A 2GVAA 1S72A 4UP7A 2XVSA 4AIMA 4CKCA 3NENA 4DV3Q 4IO9A 3D31A 3U9SA 3VR4A 4ZLTF 4IUVA 1YNJD 4EQNA 3QG1A 2AKWB 1GJXA 2HDLA 2KECA 3NQIA 4S3SA 3STBC 1PRTB 2EY2A 1D2BA 1SE2A 3R2IA 2FHTA 2KVMA 3SE0A 2JA5H 1PMRA 4HSVA 5KEEA 5M5YB 2H1EA 4HSPA 2VB3X 1QG7A 1UNSA 3S24A 3I91A 2GN5A 4RGNA 4DR4Q 5D3IB 4A3BB 2F0QA 4Q0FA 1SNDA 3X3MA 5A2QL 2KQ3A 5C5LA 3M85A 4FXDA 2MGSA 5GQOA 3CCUA 4HIOA 5IGFA 4B9XA 1B50A 1SAPA 2XWBB 4ZKBB 5ELDA 2NTTA 4X62Q 1PZID 2O4XA 1KIXA 3H0GG 5A35A 3GP7A 3JC66 4L8JA 3J81j 3T53B 3T1YQ 4GKKL 3DHQA 4K6DA 4OEMB 3OTOQ 4LF4Q 1BCPD 2YU9H 4A3GH 2RSNA 3DWAA 4BBSB 2Z6KC 3T56B 3A8IE 2K1BA 2SNSA 3CMAA 1B44D 1VQOA 3CCSA 1ZYRD 4BS9A 3M7NA 4K6LA 4ZYSA 2VXWA 5CV4A 2ZM6L 4KHPQ 2NVYH 1R4PB 2F0FA 4N8FA 1CSQA 2EYJA 2F0TA 2E5LQ 2BOSA 3R8BA 2VL6A 3PUXA 3UI2A 5AJ3L 4HIMA 3KJPA 1V1PB 3CD6A 4DA2A 4LFCQ 4DNIA 3B6YA 5HGQA 4I65A 3BYYB 2LMCB 4JI8Q 1HUNA 1O7ZA 1J6QA 1AZQA 5FKAC 2MFIA 2B29A 4OWTB 1XNQL 3SVMA 3RD4A 1KDBA 3ONAB 4JI7L 1KTKA 2DY8A 2CW0D 3FRPB 1GUNA 1I50H 2IX1A 5M5WB 1II3A 3PGZA 1STBA 2KOLA 3CKIB 1NJIC 4JBKA 2K5VA 1Q1EA 4LFAQ 3VR2A 5M3FB 3OW7A 5LMNQ 1TWCH 2MO0A 2NVTH 1HA5A 4ZK9B 5L37A 5J22A 4YWMA 5ISRA 1PH9A 2RBMA 1TT2A 2E2JB 1VQGA 4Y7NH 4A3EG 1VQBA 4FP5D 5IP9G 3TQYA 3KK7A 3OWFA 2JEAI 3RZDH 1S40A 1JB7A 4GZYC 4P72A 4DNTB 1JORA 1EU3A 3K7AB 3UE0A 1Y8PB 1K3BC 4LWCA 2ES2A 5K5PA 2RHQB 2Q8RE 5EKKA 1F2YA 4G7OC 1SBBB 1DOMA 1VQPA 1K8GA 2A69C 4AYBE 1XNRL 1SYFA 4XT1B 2WKCA 4LF6L 4GS3A 2SEBD 3WWVA 2WB1E 2E76C 2CW0C 2UUCL 4LF5L 3BU2A 2WB1G 1EQQA 3K80C 4DXFA 5T1GA 3VR5A 2JA8G 2VUMG 3PO3G 2XGTA 4KD3A 5KNDA 1AZPA 3JAME 1QOHA 4A3GB 2Q2IA 4YHHQ 3NTIA 1HZBA 1V8QA 1VQCA 4UHVA 5M5XH 2XIWA 4NP5A 3D3RA 3AFQA 3K81C 4ZQ3A 1KNEA 3SDZA 2R92H 1IYJB 2FJ2A 2F0JA 1Z9FA 3H94A 5JEAH 1AP0A 5EKIA 3KF8B 3TEHB 4IFDJ 1G91A 1QE6A 2EOTA 4LMQD 3DUZA 1LT4D 3NBHA 1EWCA 4IURA 1CA5A 2BH8A 4DGZA 4HJ9A 1VQ6A 1YEZA 1TWFH 1TWAH 3MFGA 1NAPA 1VQAA 2F0LA 1TS2A 5I6WA 3A7LA 1PHJA 1VQHA 1B1ZA 2QEXA 1O80A 4HCEA 4LW1A 1YZ6A 2VQEQ 2BA0A 1FL0A 1PH7A 1K8AC 5CV9A 4GLVB 4RKBA 2Z4HA 3HEJA 5BR8Q 4ZUIA 1WTWA 3J80E 1EIFA 5KYLA 3JAMi 1CI3M 3M3YB 3E0EA 2NB0A 1HQRD 2NVTB 5CMDA 4XQNA 2ZT9C 4HN7A 1B3QA 3VR6A 3I4NB 3OPOA 2OWOA 3D4WA 2F0SA 3SK4A 2VW9A 4HR7B 3HGBA 2JA7H 2OEOA 1L1OB 1HNXQ 3S14H 3MXUA 2H4OA 4ALPA 1PFNA 5DM63 1YHAA 5CR3A 1E2WA 2L11A 4K8IA 3SXHA 4LF4L 1QB5D 5M3MB 3PF4A 1DD2A 5EGTA 5K36G 2N88A 3E0JA 1MSHA 1HZCA 1AE3A 2J0TD 4A3LH 1ZXTA 4A3JH 4KHPL 2JXMB 2ID0A 1V1QA 5CGKA 3W3AA 1QVGA 2E5LL 3FPPA 1F9SA 2O2LD 1LT6D 3E5SA 1NSNS 4DAYB 1GHJA 1Y1VG 4L63B 1PRTD 2NYZD 2Z1CA 1KRTA 1O78A 1EYGA 4C3IB 2KENA 1MJEA 5GAEC 2WAQE 4JI8L 3I4OA 1EFID 1EOVA 4TVAB 5DM73 5JJZA 2IHFA 2A5HA 2HQLA 3M7GA 4UP9A 1WTOA 1N8RC 4YWKA 2WAQG 1ENCA 4DV4Q 1YNND 1VMPA 3FVQA 1OTCA 3DM3A 4QB4A 2JA6B 2DY7A 5H1SE 1LACA 4K14A 1SRUA 3GQBA 5T1IA 5IGGA 1VQ7A 2HHHQ 1TWFB 3IAYA 1TWAB 2QDLA 4J6HA 4QUCA 3CQZB 4O2DA 3IKJA 4GKJQ 1CKNB 4KJNA 4LFAL 2D0PA 4MTNA 4CJ0B 3NWSA 1ENFA 4QL5A 4XTCS 4C2MH 5IYDG 2MUYA 4UPAA 2F03A 1IZ6A 4JBMA 3KBGA 5NUCA 1ZKOA 1PTOB 1Q8IA 1A2UA 5C44H 3SHLA 1F9QA 2IPKD 4IJLA 3U4ZA 2PNRC 4F7XA 4A3FB 5IYBG 5G3LF 4HTHA 1MHWC 1F9RA 2FXQA 1HQMC 4EGVA 1LV9A 2WACA 5CORA 4BBRH 3HKSA 3IFTA 1BR9A 3V05A 2L4NA 2VS1A 3CPFA 2OF1A 1LTGD 2IWHA 4DV2L 1QZHA 3L2PA 1HTLD 1ILPA 3G6JB 4WORA 4A3DB 3NE5B 2HIXA 4A3BG 5BN4A 3QB3A 3CCJA 3H3VH 4A3KB 3MWYW 2YTVA 3VYUA 1A2TA 3C2PA 3UDFA 4B3MQ 4MIUA 5HGTA 3W1GA 3A8KE 4CDCC 4A3JB 3V96A 2R7ZH 1X56A 3MEFA 3I3CA 1B8AA 5I2XA 1Y1WB 4GOPB 2DGYA 3IFDA 1V1OA 1UE6A 4X65Q 4PZ6A 4BBSG 1YJWA 3JAML 5KYIA 2RSOA 4CGYB 1L0XB 1PZKD 3KF6B 3HOXB 2VQEL 3S1RH 4QIWE 2Z0SA 3EA6A 3E9HA 2AMCB 2C9OA 2RDGA 4YY3Q 1Q81C 1AH9A 3GTQB 5D65A 4IUPA 3D6WA 5IT9E 4OO1G 1D8LA 1N34Q 1X3GA 4R4OA 1FJGL 1K28A 2FMCA 3GTLB 1JOQA 1YITA 5IIFA 2MPMA 4C2MB 4Q5VA 3CPWA 3HOVH 3GTOB 1GOZA 1TXYA 4TKOB 4RHSA 1RHPA 1AEXA 3BVMA 1IXRA 3A56A 2HD3A 4ABNA 2RCFA 1F77A 3GTKH 2Q2UA 3TN2A 5M3FG 3S16H 3J7YW 2F1MA 3E9IA 4B3RQ 1ICFB 3ER0A 1O7YA 4BBRB 4BY1H 2B2UA 3QR8A 1X3QA 1YJNA 3MAQA 2L9HA 4JI0Q 3BDCA 1JQYD 2C5CA 1PV4A 2FINB 5C3XA 1A3TA 1B53A 1QZGA 3HOWB 1LT3D 2HDMA 1JWSD 1CA6A 3ZYYX 5E4XA 2K52A 4C3JB 1HNWQ 4XT3B 4H0LC 4LFBQ 3AQQA 1G6ZA 4XXEA 2E8GA 2UUAL 1S5CD 4DR3Q 4P71A 1SROA 2KJXA 4JPBW 3U50C 3K57A 4DV4L 2J4XA 2OTJA 1K9MC 1HR0L 3GTGB 1UWVA 2B2WA 4JG2A 3EVQA 4A3GG 1QNKA 3RN2A 5AFWA 1MJCA 1HR0W 3CRKC 3D4DA 4GKJL 5C3EH 2JA9A 2HIVA 4XQJA 2B3GA 2QCPX 1KL9A 3BG3A 4DV0Q 4HJAA 5CC4A 1SE4A 2XNAC 3S1RB 2K7VA 2VB2X 3S17H 1NR2A 1E2ZA 2K33A 1S5BD 1Q46A 3VR3A 4IUUA 1IW7D 1VQFA 2F0EA 1SEBD 2D0OA 3VYRA 1SR3A 4A3MH 4LAAA 3Q8DA 2A6EC 1EQTA 2CHBD 1A0IA 2GA4B 4DAVA 4PMCA 2D9UA 3JAMc 2EY5A 3MC0B 4ULLA 4LF8Q 2UXCQ 1KNAA 5C4JB 1Z6HA 3U58A 3PCOB 4V0BA 1UE5A 1HTPA 2SOBA 2XRQD 2TSSA 3P20A 1LYLA 2BDNA 1ILQA 1KLGD 1U0LA 2K75A 1H95A 4A93B 5JPNC 2XN9C 3W5OA 3L3OC 4FXKC 4YCWA 2XWJB 4JC0A 5FLXE 1T5EA 2B2VC 2PCFB 4IFDI 3K59A 3C3LA 4ID6A 1R9TH 3I4NG 1C9OA 3K5OA 3T51B 4B3ML 1YHBA 2EYLA 2MNAA 1KRSA 3Q23A 4L5TA 2R3ZA 2B39A 2OCEA 4P73A 4X65L 5EJWA 4KMUC 4FDBA 3GV6A 4ILWA 3U9OA 1N9WA 5M3MG 3J80c 2ZXRA 1F2MA 4DNRB 4R4TA 3I4LA 4R1JA 3HKZB 1PZJD 5FOBB 2VQFQ 4BXXH 3RZOB 1DJRD 3A74A 2JP1A 1E0BA 1TIID 1GUWA 1VF5C 2G9HD 3QJYA 4YY3L 4IZ8A 1PH3A 2KBNA 3S1MH 4RHRA 5IGBA 4B3TQ 1NMGA 2B63H 2M00A 3ITPA 1OXSC 1W3SA 1N34L 1HJPA 4HJ8A 3FEWX 1VQDA 3HZXA 4C3IG 2B2TA 2L55A 4CKBA 1WCMB 1VQ4A 2EYMA 4A75A 3J7ZC 4JBWA 3BZKA 3PUYA 4Z9CB 4A3MB 2JA6G 3G6EA 3PF5A 2DJFC 1HH2P 1TWGH 1N32L 4JV5Q 5IYCH 3KYHC 4B3RL 2A1AA 4N8X1 2P5ZX 1X54A 1SXTA 3G71A 1EZ8A 1UAPA 1CSPA 3F8TA 1P8LA 1PTOC 2F0UA 4EVOA 5EPJA 1HZAA 4DV7L 1XTDA 4JI0L 1X55A 3I90A 2IX0A 1LTTD 1PH1A 1I94L 4A3FG 2EJFC 2F0MA 4GN5A 5KIXA 5JVH3 4DV5Q 2PQAB 4JI1Q 1B3AA 1R9TB 4LFBL 4NDXA 1UE1A 1QWYA 1I6HH 4C3HB 4JI3L 1JCKB 2N3SA 2AUJD 1FGUA 1NTGA 2R93B 4RGTA 2F3IA 5HY6A 4B3SQ 3HOUH 4R4CA 4MN3A 3HOZH 5GROA 3L9AX 1DYQA 1K0SA 4A3DG 3QIAA 2QKIC 4DR1Q 1YVCA 4J8QA 1LTBD 2KUMA 5C4XH 2PI2E 4A3KG 1E24A 1BF4A 4DXGA 4G4KA 1IL8A 2K03A 4DV0L 4A3IH 5DLQE 3DM1A 4GOPC 3D8GA 4A3JG 1N36Q 2IT1A 2MQHA 4IPCA 4AQYQ 3M4PA 3QOJA 1OXTA 1J5EQ 1SYBA 4IPGA 1Y1WG 3FKIH 1HPCA 4FF2A 2E2HB 3MXPA 3F2CA 3S1MB 4GNXA 3NHHA 3S1QH 1KD1C 1A6XA 1C48A 1PA6A 4K2KA 1STNA 4RWSC 5IP7H 1XPRA 4ME5A 3NWTA 4LF7Q 3NTKA 2A69D 3W1BA 5IODA 3PO2H 2ATWA 2E2IH 4LF8L 3I2ZA 3HOXG 2UXCL 4BA1I 1UEBA 3AYHB 3KLSA 2NZHA 1CTMA 3SGIA 5G3LD 2LSSA 1S5DD 1U5KA 2KHIA 5E4WC 1SNOA 3SK8A 3QOLA 4I7ZC 3FP9A 1TS5A 5ELEA 1TWGB 2JE6I 1XMQQ 3MFYA 1H9SA 2A6HC 2CWPA 3TDQA 3ZJYC 1RTOA 3OW2A 1Q82C 4F87A 1BUVT 1Q7YC 3ERSX 2CQOA 1S3OA 3KBXA 2JA5B 1ML0D 1EUJA 5LL6X 5I9PA 3UDIA 3GTJH 4U68A 3NSWA 1WOCA 5E7NA 4Y52H 1S4ZA 3J7AV 5KGUA 1VQ8A 4IN3A 4A3CH 1O7IA 1B9MA 2NZ1D 1JJGA 2NN6I 4IFDH 3FDTA 3H3VI 1RCVD 2KA7A 3T1HL 4B08A 1I6HB 3FMCA 4BBRG 1K8MA 1CZWA 2F0NA 5IT9c 4FVMA 1D5ZC 4EX5A 3TP7A 1WFQA 2VQFL 1GO3E 1Q12A 3H3VC 2A68D 3HOYH 3DEPA 1JMCA 3GTMH 3UE1A 2F0WA 3R3OA 4HMJA 5C6AA 2YU9B 3HOWG 1SFOH 2L5TA 4C3JG 3KDFA 4PG3A 4CKEA 1IYUA 1MIUA 1TKWB 4HAEA 1KXLA 1ET9A 4IJHA 5I2YA 5EPLA 1T5XD 2NVYB 3I4MH 1LTSD 1I4RA 2N49A 1HFGA 5GAHC 3A7AB 1HZ9A 2CVRA 1W6KA 4FXGC 2I0QA 2WFWA 1U4RA 4DV3L 3BVZA 2K50A 1PTOF 3GO5A 1N33Q 2QDBA 1FGBD 2YTXA 5C4HA 2K05A 4JV5L 4RCOA 2VY3A 2D2CC 4OIJA 2Z6KA 1M90C 4X64Q 3PO2B 4LUOA 4JOIC 2E2IB 4POGA 2K4KA 4NB3A 1SNCA 3GV3A 1QUQA 2EZVA 2A68C 1I50B 2NVXH 2ASBA 4KHVA 1MD2D 3PIPA 4LF9Q 2TMPA 1EY6A 2IL8A 2Z4IA 4DR4L 4X3SA 2B2YA 1VQIA 1VF7A 2Y0SB 3TMEA 1TWCB 1AE2A 3M4OH 1EEID 4DV5L 5KRUA 4KKUA 4JI1L 4DN4M 3S2DH 4IPHA 3CMEA 4X62L 1NR4A 4QUFA 4Y7NB 1K0RA 1J9OA 1NUCA 1A8VA 1V43A 4JI5Q 4TRDA 2EE1A 1BBWA 2PMZB 5EQ0A 4KY6A 2I5MX 4A4IA 2UU9Q 4B3SL 3RZDB 2B8FA 2G9DA 3T1YL 1SYCA 4A93G 2DNEA 2PNHA 5C5MA 4DR1L 2BCOA 3OTOL 3CC4A 2E74C 1FD7D 2F0GA 5JJLA 1XMOQ 3OYYA 3H0GH 2MHVA 3BDOA 1TY2A 3HOYB 2UXDQ 1FVIA 5LL6S 2F0HA 5COYA 2RQXA 1J5EL 4LUZA 5DNFA 1WTHA 3H6MA 1SSOA 3J80i 2CWAA 4CDEC 4DUYQ 4OWWB 3GTPH 5M5XB 4PV1C 1GM5A 1VS0A 3PIO3 5IGDA 3HG9A 2Z9HA 2KEEA 1AW7A 3S1NH 1MBYA 4CJ2C 2R92B 4PNYA 4LFCL 1U4LA 3KJOA 2EJMA 3HKZE 1CHQD 4LF7L 3PQIA 2SNMA 5CV6A 1I3QH 5FLXc 1CHPD 3HKZG 4DV6Q 3NQTA 2JN4A 4KY5A 1ET6A 3PIOA 3TZDA 5BN3A 1KAAA 3NPPA 3CXCA 1SYEA 5J1ZA 1XMQL 4P2CB 3S15H 1SMYC 1PLFA 1ENAA 3RLNA 5LMNL 1KDAA 3HFZB 1Y14B 3TSSA 4RH6A 3CCVA 1PH6A 1WCMG 5LMNW 4FYDA 1Q86C 1A3VA 4LUVA 1OXUA 4DAMA 5C0XG 1PVOA 2PO4A 1GVPA 1D7QA 4DR6Q 4EQPA 1MI2A 1V9PA 2DNCA 5CV5A 2M9VA 4A3MG 2YTYA 3BZCA 1W6JA 1MSGA 5IGCA 1LABA 1HFNA 3Q0AA 1SE3A 3RUZA 1O7LA 3DWQA 1X65A 1TWHH 1G51A 3I7FA 2KCCA 2Z6BA 3MXNA 2BDOA 1PXUA 2JA7B 3S14B 3CHBD 1HNZQ 4MNOA 5IP9H 4YIJA 1SN8A 5FO8B 2NN6H 4YHHL 3K58A 5FLMG 2QEJC 4IOAA 1VQMA 1RIPA 2NVQH 3SK5A 3OHXC 1B9NA 1HUMA 4C3HG 2K01A 3MZ5A 3IRBA 4UDUC 5LMUQ 2N78A 4O0AA 2R93G 5BN5A 1KAWA 2WP8J 2NZOA 4OWXB 4JYAQ 3NBHB 4C1NI 2JA8H 5IE8A 3OMCA 3PO3H 5IGEA 1JOOA 4KLKA 2F0PA 1NE3A 3CP0A 1ESFA 3MHBA 1N33L 2IW3A 4M1UB 1VQKA 1LTID 3SK6A 5IWAQ 3QWNA 1YJ9A 4DK0A 1NY4A 2UXBQ 2K6AA 1XYIA 3WOEA 4WFN3 3BS1A 2LFNA 4JCVE 5BR8L 5DAUA 4MTKA 4C56C 2QW7A 1D1IA 4LF9L 1PYSB 3BDLA 5JVG3 1EY8A 4OO1I 1CT1D 2VNUD 4DUZQ 2K5WA 1HA6A 3MEHA 2A74C 1D5MC 3NBIA 4RKLA 2Q2TA 4NXMQ 4E6IA 1H9MA 2CKZB 2RKSA 4JI5L 1KHIA 1SNQA 1HNXL 5C44B 1PFBA 4PMBA 2UU9L 1VQJA 3KLRA 5HURA 1GUOA 4QY7A 1HRJA 3TP8A 2OTLA 4KN4C 5IYCG 3J80L 4N9TA 1LT5D 1TWHB 1WI5A 1LO5D 5F2DA 1F2LA 4PZ8A 3S2HH 1RF2D 1EZ6A 2AQ3B 1YNXA 1XWEA 2JA5G 3NXWA 2BA1A 2PW5A 2QF7A 3AFPA 2EJGC 3EN2A 4FO2A 2WKDA 1D5XC 4DUYL 1RJTA 3HS0C 2FMMA 4DKAC 2KEDA 2A6ED 1JOKA 4FF3A 1VQNA 2NVQB 1FYCA 1E2VA 4NPSA 4AYBB 5JAVA 5K36H 4KN7C 3EROA 2R7ZB 1ESRA 4CJ1B 2J7ZA 1JE5A 2JQOA 4DV6L 3AMUA 1EL0A 1TU2B 2NTSA 2ZJRA 1EY5A 1LM0A 3WDNA 3MVVA 4IALA 2ZTEA 4UAIA 2HHHL 4K5VA 1LLRD 5ELBA 3TRZA 1Y1VH 3M4QA 1WTXA 1DZ1A 3KLSX 2PQAA 1Q3LA 2DJGC 3MA2B 1I5FA 4ME3A 2PZUA 3PUWA 2E75C 5FJ8H 1JB3A 4JBJA 1VQEA 1XXGA 2ICIA 3BJUA 5D3DA 3CCMA 3K5LA 4GKKQ 2FFKB 3F1ZA 3A0JA 4WJWA 3K7UC 1X3PA 5IP7G 3M4YA 2DN8A 3NUCA 1EY4A 1SNMA 1SLJA 3PO2G 1GUSA 3HOVB 1QVCA 5IYDH 1EOTA 5FO7B 2IJ0A 5JOBA 4BWGB 4XDXA 1PYBA 1X32A 1HNZL 1JICA 1TR5A 1CKOA 2Y0SE 5AJ3Q 2L15A 3GTKB 5IYBH 3Q24A 3S16B 1EY7A 4I7AA 2Y0SG 4DU9A 1V1PA 1M4VA 4WRDA 2R7DA 3K5NA 1T9HA 3AB9A 4BY1B 2BE5C 2EYFA 4OONA 4IPDA 1BNZA 1A15A 5LMUL 1EY0A 5M5YH 5E1FA 1Y8NB 2PW7A 4QF4A 4A3CG 5CV8A 1IBKQ 4A3BH 4POFA 5J39A 5C0XJ 1PFMA 1LTAD 3G48A 4CDFC 1TS4A 5IOCA 5IWAL 4FNFA 2CQAA 2WIIB 4KY7A 1PH4A 2F3VA 4XYQA 1PTOD 3WOFA 4GNXC 3HOYG 2JK8A 1RTNA 5J3BA 5ELFA 1IKLA 1EWHA 2L12A 1DGSA 1JWUD 2HCIA 5EKLA 4BBSH 5C3EB 3CC2A 3NELA 4L5RC 1XNRQ 1BQQT 2R92G 4H44C 4HJ5A 2K5NA 3NK9A 2V1CC 3S17B 1QNUA 5JEAG 2UUCQ 4LF5Q 3Q6SA 4MHEA 5ELNA 2KHJA 4NXNQ 4HCSA 1B2TA 3P7JA 2A8VA 2ZTDA 3OOCA 3OIQA 2K5HA 4HEDA 4OO1H 2K04A 3EIVA 4N9PA 5EBCA 1STEA 3F2BA 5IT9L
chains in the Genus database with same CATH topology
4QL5A 3UE1A 1I94Q 2EXDA 1K3RA 3K0XA 4XTCS 3HOWG 3KFUA 4GN3B 4C2MH 5IYDG 1SFOH 4UPAA 2I5HA 3HOZG 2H5XA 1BVSA 5C4XG 1IZ6A 4JBMA 3KDFA 4PG3A 3GDEA 1MIUA 1E1TA 5C44H 1KXLA 5M5WH 1EWIA 2YYZA 3PUVA 4IJHA 4A3IG 4JI3Q 4IJLA 4BY7H 3U4ZA 5IYBG 1UE7A 3I4MH 1XPUA 1IBMQ 2CFMA 2MO1A 1SMXA 2N49A 4P74A 5M3FH 3RZOH 1HNWL 1X6OA 2FXQA 5GAHC 3FKIG 2RCNA 1HZ9A 4X6AH 3LGJA 4J15A 1E1OA 1M1KC 2I0QA 4UY8C 2WFWA 4BBRH 4BA2I 3HKSA 4DR6L 4DV3L 2VS1A 1KC8C 3KOJA 2QA4A 2K50A 4DR3L 3CPFA 2E2JH 3GO5A 2JA7G 1N33Q 2YTXA 3RNUA 4K0KQ 4DV2L 4QJFA 3L2PA 1QZHA 4HJ7A 4JV5L 4DV1L 1B7YB 2VY3A 3MXNB 3PUZA 2Z6KA 3I56A 4X64Q 1M90C 4LUOA 2OQ0A 4JOIC 4YCVA 2ZM6Q 4POGA 2HIXA 1GKHA 1X3FA 3D0FA 2K4KA 3K7AH 3CCEA 3CCJA 1WCMH 4NB3A 3H3VH 5GADC 1QUQA 4TQUS 4JI4Q 4X66L 2NVXH 3AEVA 2YTVA 3UDFA 4B3MQ 3EBEA 2ASBA 1JT8A 2OQKA 3W1GA 4QGUA 3PIPA 4LF9Q 4A3LG 4A93G 1XJVA 2R7ZH 4DR4L 1IBLQ 1X56A 1VQIA 2R7FA 3MEFA 1L1OA 1AE2A 1BBUA 1B8AA 3M4OH 4QQBX 4DV5L 4GOPB 2DGYA 3CW2C 4JI1L 1P16A 1UE6A 5ELOA 1XNQQ 3S2DH 4IPHA 4APVA 3CMEA 4X62L 3RN5A 4X65Q 3RR5A 4JI2Q 1PH2A 4JI7Q 5JJIA 1K0RA 4PZ6A 2PMZE 4BBSG 1YJWA 1A8VA 1V43A 4JI5Q 1BBWA 2I5MX 4A4IA 4DR5L 2UU9Q 4B3SL 1QVFA 2LXJA 2RF4A 4JYAL 2GVBA 3T1YL 3KF6B 2VQEL 2PNHA 3CC4A 3CCLA 4DR1L 4QIWE 3OTOL 3S1RH 1YIJA 1IL2A 2Z0SA 5FLMH 4IFDG 3E9HA 2AMCB 1SE8A 4YY3Q 3CC7A 1Q81C 2JEBI 4PMWA 5JJLA 1VQLA 1L1OC 1AH9A 4WJ3M 1GD7A 1XMOQ 3OYYA 3L7ZC 4C3HH 2UUBL 3H0GH 1VQ5A 2UXBL 4OO1G 1D8LA 1N34Q 1X3GA 4R4OA 1FJGL 1JJCB 1PFSA 2R93H 2UXDQ 4WJ4A 2EQSA 1FVIA 1YITA 1J5EL 4LUZA 3J80i 2CWAA 2LXKA 4DUYQ 3CPWA 4OWWB 3GTPH 3HOVH 4MZ9A 1EIYB 1GM5A 1VS0A 1EFWA 4LNQA 1VCIA 3T1HQ 1TXYA 3S1NH 2JJQA 4LFCL 1BKBA 3ULJA 3KJOA 4DUZL 5C44G 4LF6Q 3GD7A 3HKZE 3STBD 1IXRA 4LF7L 1ASZA 2VZAA 1I3QH 1K73C 5FLXc 3I4MG 3M3YH 3GTKH 3HKZG 4R4QA 4DV6Q 2Q2UA 1IBKL 5M3FG 1CKNA 4NXML 3E9IA 3S16H 4B3RQ 4XIGS 3ER0A 2IHEA 1CUKA 1CKMA 3PIOA 1ASYA 2E2HH 3I4NH 4AH6A 4BY1H 3M9BA 3CXCA 4A3BG 1YJNA 1XMQL 4JI0Q 3S15H 2AHOB 4OX9L 2R6GA 4OXPA 4KI0A 3RLNA 5LMNL 1W2BA 1PV4A 5EAYA 3J81c 1QZGA 2AWOA 3HFZB 1Y14B 1NBWA 2NN6G 3CCVA 1PH6A 1WCMG 5LMNW 1Q86C 2K52A 1WYDA 4DK6C 3CCQA 4B3TL 1HNWQ 4RG1A 4LUVA 1OXUA 4DAMA 5C0XG 2GVAA 3AQQA 4LFBQ 1PVOA 5M3MH 1S72A 1GVPA 1D7QA 4UP7A 4DK3C 2E8GA 4AIMA 3NENA 2UUAL 4DV3Q 3K8AA 4KHZA 4IO9A 2K14A 1V9PA 4A3MG 4AYBG 2ZTCA 4DR3Q 2YTYA 4P71A 3D31A 1SROA 3BZCA 3ULPA 2R7ZG 4DV2Q 1G6PA 3U50C 3H15A 2AKWB 4DV4L 2OTJA 1K9MC 1HR0L 1X65A 1TWHH 1G51A 1UWVA 3I7FA 4NXNL 1Z47A 3STBC 4JG2A 1LUZA 4A3GG 3RN2A 2F4VQ 1MJCA 2JA5H 1MKHA 1HR0W 4GKJL 3U4VA 5C3EH 2JA9A 1HNZQ 2HIVA 5JJKA 3NEMA 2B3GA 4MNOA 5IP9H 1KL9A 3S24A 4DV0Q 2PI2A 4HJAA 3UDXA 4C3IH 2GN5A 3KLWA 1SN8A 4DR4Q 1RL2A 3S17H 2YV5A 4YHHL 5FLMG 3M85A 2UXCL 4IOAA 5GQOA 3CCUA 4HIOA 1Q46A 1VQMA 1RIPA 4GOPA 1VQFA 4X62Q 2D0OA 2JA6H 2NVQH 3UDGA 1SR3A 4A3MH 3Q8DA 3F2DA 3H0GG 1KIXA 3IRBA 1A0IA 3JC66 3CQZH 5LMUQ 2N78A 3J81j 4O0AA 2DUDA 1IBML 2R93G 1KAWA 2WP8J 2NZOA 4OWXB 4JYAQ 3NBHB 3JAMc 2JA8H 3T1YQ 5IE8A 3PO3H 4GKKL 2KCTA 2AWNA 2Q2HA 3OTOQ 4LF4Q 4LF8Q 3HOVG 2YU9H 2UXCQ 4A3GH 3KF6A 2Z6KC 4KLKA 3ULLA 3U58A 3PCOB 1NE3A 1UE5A 3CP0A 3CMAA 1N33L 4K0KL 1VQKA 1VQOA 3CCSA 1LYLA 5IWAQ 1YJ9A 1U0LA 2K75A 3M7NA 1NY4A 1H95A 2UXBQ 4GLXA 1FJGQ 2ZM6L 4YCWA 4A3FH 4KHPQ 2NVYH 4JC0A 5JEAJ 2XTIA 1CSQA 1KQSA 4IOCA 4JI4L 1JJ2A 2E5LQ 4IFDI 4JI6Q 4JCVE 4R4IA 5BR8L 2VL6A 1R9TH 1C9OA 3I4NG 3FHWA 4BY1G 4B3ML 1YHBA 3PUXA 3CAMA 2MNAA 1KRSA 4LF9L 5AJ3L 1PYSB 4HIMA 4L5TA 3KJPA 1IBLL 5IY0A 3CD6A 4LFCQ 4OO1I 2VNUD 4DNIA 4DUZQ 1N36L 3B6YA 5HGQA 4AQYL 4JI8Q 1E3PA 1J6QA 2ZJQA 2MFIA 2OCEA 4A3DH 4GNXB 2B29A 4OWTB 4P75A 4P73A 1XNQL 1K83H 4DPGA 2Q2TA 3CF5A 4X65L 3I55A 4JI2L 4NXMQ 4JI7L 4DR7Q 4FDBA 2CKZB 4A3KH 4H02A 2EIFA 1VQ9A 4JI5L 4GN4B 1KHIA 1N9WA 5M3MG 1HNXL 1B70B 1I50H 2KCMA 3J80c 2IX1A 3PGZA 2UU9L 4DR2Q 1VQJA 1NJIC 4JBKA 4R4TA 4QY7A 2K5VA 3DLLA 1Q1EA 4R1JA 3A5UA 2OTLA 4LFAQ 2VQFQ 3CCRA 4BXXH 5IYCG 3A74A 5LMNQ 1TWCH 1WI5A 2MO0A 2NVTH 4YY3L 1Y1WH 2C35B 4PZ8A 4YWMA 3S2HH 1PH3A 2KBNA 1PH9A 1E7ZA 2ALYB 3S1MH 1YNXA 4B3TQ 1NMGA 1VQGA 2JA5G 2B63H 4Y7NH 1OXSC 2BA1A 1W3SA 5C3EG 1N34L 4A3EG 1HJPA 1VQBA 4HJ8A 1YBYA 2UUAQ 5IP9G 3TQYA 3AFPA 1VQDA 3EN2A 2JEAI 3RZDH 1S40A 1JB7A 4P72A 3UE0A 4DUYL 2BH2A 5FJ8G 1VQ4A 3HOXH 1C7YA 4LWCA 4DKAC 2ES2A 2RHQB 1HR0Q 4A75A 1VQPA 1K8GA 4AYBE 1VQNA 1G291 3J7ZC 5C0XI 1XNRL 4JBWA 3BZKA 3PUYA 4NPSA 4LF6L 3J81i 2JA6G 4GS3A 3G6EA 3GTQH 3PF5A 3WWVA 2WB1E 1HH2P 1TWGH 1N32L 1JE5A 1WJJA 2JQOA 4DV6L 4JV5Q 5IYCH 2UUCL 3BU2A 4LF5L 2WB1G 4L5QA 3KYHC 1EQQA 2A1AA 3K80C 4B3RL 4DV1Q 3PSIA 3GTLH 2ZJRA 1LM0A 2JA8G 2VUMG 3PO3G 1X54A 2XGTA 3G71A 2N8NA 2ZTEA 2HHHL 1CSPA 2Q2IA 3F8TA 1P8LA 4YHHQ 5M5XH 1HZBA 1VQCA 1OXVA 3TRZA 1Y1VH 3M4QA 3GTOH 4X66Q 1HZAA 4DV7L 1YHQA 1XTDA 4EQ5A 4A3EH 2ZJPA 4JI0L 2PQAA 3AFQA 3K81C 4JOIA 1X55A 3PV0A 2R92H 1A62A 2IX0A 1IYJB 1I5FA 4ME3A 3A5ZB 1PH1A 1LTLA 1PH5A 1I94L 4YCUA 3PUWA 4A3FG 1Z9FA 5FJ8H 4HIDA 1PH8A 3KDFB 4GN5A 1VQEA 4JBJA 3KF8B 3TEHB 3TS0A 3BJUA 4IFDJ 4DV5Q 2PQAB 3CCMA 4JI1Q 4LFBL 2I5LX 3VDYA 3TS2A 4GKKQ 1UE1A 3F1ZA 2BH8A 1I6HH 4HJ9A 3A0JA 1YEZA 1VQ6A 4JI3L 1TWFH 1Q8KA 1TWAH 3K7UC 2N3SA 2D62A 1VQAA 1FGUA 1NTGA 3J7A5 5IP7G 2F3IA 5HY6A 4DR5Q 4B3SQ 3HOUH 4R4CA 1PHJA 3HOZH 1VQHA 5GROA 2QEXA 3RLFA 2VUMH 1SLJA 4LW1A 3PO2G 1YZ6A 4A3DG 2VQEQ 2BA0A 1FL0A 1QVCA 4DR1Q 3HOWH 3ICEA 1PH7A 1YVCA 1K8AC 5IYDH 2F4VL 2RHSB 4GLVB 3G4SA 5C4XH 2PI2E 4A3KG 1C0AA 1E24A 4C3JH 1PYBA 5BR8Q 1NMFA 1L0WA 1HNZL 4UP8A 1EIFA 4DV0L 3JAMi 4A3IH 2UUBQ 1CKOA 5DLQE 2Y0SE 5AJ3Q 2L15A 4X64L 4GOPC 4A3JG 3E0EA 1X9NA 5IYBH 4L5SA 1QUQB 4BXXG 1N36Q 2IT1A 2MQHA 2Y0SG 4IPCA 4AQYQ 3M4PA 4DR6Q 1OXTA 2R7DA 1J5EQ 1T9HA 4IPGA 3FKIH 1Y1WG 3GTGH 3F2CA 2OWOA 2IY5B 4GLAC 4A76A 2VW9A 4GNXA 3S1QH 4OONA 2B63G 4IPDA 2JA7H 1KD1C 1Q1BA 1L1OB 5LMUL 1HNXQ 3RLOA 1PA6A 3S14H 5M5YH 4ALPA 5IP7H 1XPRA 1A63A 2HT1A 1YHAA 4LF7Q 3W1BA 3PO2H 2ATWA 2E2IH 1EQRA 3I2ZA 3HOXG 4LF4L 4BA1I 1IBKQ 4LF8L 4A3BH 4A3CG 1UEBA 3AYHB 5GAGC 2NZHA 3SGIA 2LSSA 4POFA 1U5KA 5C0XJ 3PF4A 2F52A 2KHIA 5K36G 3G48A 3TREA 1HZCA 3FP9A 5IWAL 1AE3A 2A19A 3L0OA 4A3LH 2JE6I 1XMQQ 1PH4A 4A3JH 4KHPL 4OX9Q 4GNXC 2CWPA 2ID0A 2JK8A 3ZJYC 1E22A 1V1QA 3OW2A 1Q82C 5J3BA 3HOYG 1QVGA 2E5LL 4JI6L 1L2FA 1XPOA 3ERSX 1DGSA 2CQOA 1Q7YC 1S3OA 4DAYB 5C4JH 1XMOL 4BBSH 1EUJA 1Y1VG 3UDIA 3GTJH 3CC2A 3NELA 4L5RC 1XNRQ 1WOCA 1KRTA 1EYGA 2R92G 2UXDL 5E7NA 4HJ5A 4Y52H 2KENA 1MJEA 5GAEC 2WAQE 2K5NA 3I4OA 4TVAB 1EOVA 4JI8L 4BY7G 2V1CC 2IHFA 2HQLA 4UP9A 4HIKA 1N8RC 1VQ8A 4A93H 4YWKA 1N32Q 2WAQG 5JEAG 2UUCQ 4LF5Q 4A3CH 1O7IA 4YWLA 4DR7L 4DV4Q 1JJGA 2NN6I 4RMFA 3H3VI 5ELNA 2KHJA 1OTCA 3DM3A 4NXNQ 3T1HL 2A8VA 5H1SE 4BBRG 1VQ7A 1SRUA 2ZTDA 2HHHQ 2K5HA 4DR2L 4PZ7A 5IT9c 4O2DA 4GKJQ 4EX5A 1CKNB 4DV7Q 1YI2A 1WFQA 4LFAL 2D0PA 2VQFL 1GO3E 4MTNA 3HOUG 1Q12A 1X3EA 1OXXK 2QGQA 3EIVA 3HOYH 1JMCA 2CCZA 3F2BA 3W5OA 3GTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL5 A;  3UE1 A;  1I94 Q;  2EXD A;  1K3R A;  3K0X A;  4XTC S;  3HOW G;  3KFU A;  4GN3 B;  4C2M H;  5IYD G;  1SFO H;  4UPA A;  2I5H A;  3HOZ G;  2H5X A;  1BVS A;  5C4X G;  1IZ6 A;  4JBM A;  3KDF A;  4PG3 A;  3GDE A;  1MIU A;  1E1T A;  5C44 H;  1KXL A;  5M5W H;  1EWI A;  2YYZ A;  3PUV A;  4IJH A;  4A3I G;  4JI3 Q;  4IJL A;  4BY7 H;  3U4Z A;  5IYB G;  1UE7 A;  3I4M H;  1XPU A;  1IBM Q;  2CFM A;  2MO1 A;  1SMX A;  2N49 A;  4P74 A;  5M3F H;  3RZO H;  1HNW L;  1X6O A;  2FXQ A;  5GAH C;  3FKI G;  2RCN A;  1HZ9 A;  4X6A H;  3LGJ A;  4J15 A;  1E1O A;  1M1K C;  2I0Q A;  4UY8 C;  2WFW A;  4BBR H;  4BA2 I;  3HKS A;  4DR6 L;  4DV3 L;  2VS1 A;  1KC8 C;  3KOJ A;  2QA4 A;  2K50 A;  4DR3 L;  3CPF A;  2E2J H;  3GO5 A;  2JA7 G;  1N33 Q;  2YTX A;  3RNU A;  4K0K Q;  4DV2 L;  4QJF A;  3L2P A;  1QZH A;  4HJ7 A;  4JV5 L;  4DV1 L;  1B7Y B;  2VY3 A;  3MXN B;  3PUZ A;  2Z6K A;  3I56 A;  4X64 Q;  1M90 C;  4LUO A;  2OQ0 A;  4JOI C;  4YCV A;  2ZM6 Q;  4POG A;  2HIX A;  1GKH A;  1X3F A;  3D0F A;  2K4K A;  3K7A H;  3CCE A;  3CCJ A;  1WCM H;  4NB3 A;  3H3V H;  5GAD C;  1QUQ A;  4TQU S;  4JI4 Q;  4X66 L;  2NVX H;  3AEV A;  2YTV A;  3UDF A;  4B3M Q;  3EBE A;  2ASB A;  1JT8 A;  2OQK A;  3W1G A;  4QGU A;  3PIP A;  4LF9 Q;  4A3L G;  4A93 G;  1XJV A;  2R7Z H;  4DR4 L;  1IBL Q;  1X56 A;  1VQI A;  2R7F A;  3MEF A;  1L1O A;  1AE2 A;  1BBU A;  1B8A A;  3M4O H;  4QQB X;  4DV5 L;  4GOP B;  2DGY A;  3CW2 C;  4JI1 L;  1P16 A;  1UE6 A;  5ELO A;  1XNQ Q;  3S2D H;  4IPH A;  4APV A;  3CME A;  4X62 L;  3RN5 A;  4X65 Q;  3RR5 A;  4JI2 Q;  1PH2 A;  4JI7 Q;  5JJI A;  1K0R A;  4PZ6 A;  2PMZ E;  4BBS G;  1YJW A;  1A8V A;  1V43 A;  4JI5 Q;  1BBW A;  2I5M X;  4A4I A;  4DR5 L;  2UU9 Q;  4B3S L;  1QVF A;  2LXJ A;  2RF4 A;  4JYA L;  2GVB A;  3T1Y L;  3KF6 B;  2VQE L;  2PNH A;  3CC4 A;  3CCL A;  4DR1 L;  4QIW E;  3OTO L;  3S1R H;  1YIJ A;  1IL2 A;  2Z0S A;  5FLM H;  4IFD G;  3E9H A;  2AMC B;  1SE8 A;  4YY3 Q;  3CC7 A;  1Q81 C;  2JEB I;  4PMW A;  5JJL A;  1VQL A;  1L1O C;  1AH9 A;  4WJ3 M;  1GD7 A;  1XMO Q;  3OYY A;  3L7Z C;  4C3H H;  2UUB L;  3H0G H;  1VQ5 A;  2UXB L;  4OO1 G;  1D8L A;  1N34 Q;  1X3G A;  4R4O A;  1FJG L;  1JJC B;  1PFS A;  2R93 H;  2UXD Q;  4WJ4 A;  2EQS A;  1FVI A;  1YIT A;  1J5E L;  4LUZ A;  3J80 i;  2CWA A;  2LXK A;  4DUY Q;  3CPW A;  4OWW B;  3GTP H;  3HOV H;  4MZ9 A;  1EIY B;  1GM5 A;  1VS0 A;  1EFW A;  4LNQ A;  1VCI A;  3T1H Q;  1TXY A;  3S1N H;  2JJQ A;  4LFC L;  1BKB A;  3ULJ A;  3KJO A;  4DUZ L;  5C44 G;  4LF6 Q;  3GD7 A;  3HKZ E;  3STB D;  1IXR A;  4LF7 L;  1ASZ A;  2VZA A;  1I3Q H;  1K73 C;  5FLX c;  3I4M G;  3M3Y H;  3GTK H;  3HKZ G;  4R4Q A;  4DV6 Q;  2Q2U A;  1IBK L;  5M3F G;  1CKN A;  4NXM L;  3E9I A;  3S16 H;  4B3R Q;  4XIG S;  3ER0 A;  2IHE A;  1CUK A;  1CKM A;  3PIO A;  1ASY A;  2E2H H;  3I4N H;  4AH6 A;  4BY1 H;  3M9B A;  3CXC A;  4A3B G;  1YJN A;  1XMQ L;  4JI0 Q;  3S15 H;  2AHO B;  4OX9 L;  2R6G A;  4OXP A;  4KI0 A;  3RLN A;  5LMN L;  1W2B A;  1PV4 A;  5EAY A;  3J81 c;  1QZG A;  2AWO A;  3HFZ B;  1Y14 B;  1NBW A;  2NN6 G;  3CCV A;  1PH6 A;  1WCM G;  5LMN W;  1Q86 C;  2K52 A;  1WYD A;  4DK6 C;  3CCQ A;  4B3T L;  1HNW Q;  4RG1 A;  4LUV A;  1OXU A;  4DAM A;  5C0X G;  2GVA A;  3AQQ A;  4LFB Q;  1PVO A;  5M3M H;  1S72 A;  1GVP A;  1D7Q A;  4UP7 A;  4DK3 C;  2E8G A;  4AIM A;  3NEN A;  2UUA L;  4DV3 Q;  3K8A A;  4KHZ A;  4IO9 A;  2K14 A;  1V9P A;  4A3M G;  4AYB G;  2ZTC A;  4DR3 Q;  2YTY A;  4P71 A;  3D31 A;  1SRO A;  3BZC A;  3ULP A;  2R7Z G;  4DV2 Q;  1G6P A;  3U50 C;  3H15 A;  2AKW B;  4DV4 L;  2OTJ A;  1K9M C;  1HR0 L;  1X65 A;  1TWH H;  1G51 A;  1UWV A;  3I7F A;  4NXN L;  1Z47 A;  3STB C;  4JG2 A;  1LUZ A;  4A3G G;  3RN2 A;  2F4V Q;  1MJC A;  2JA5 H;  1MKH A;  1HR0 W;  4GKJ L;  3U4V A;  5C3E H;  2JA9 A;  1HNZ Q;  2HIV A;  5JJK A;  3NEM A;  2B3G A;  4MNO A;  5IP9 H;  1KL9 A;  3S24 A;  4DV0 Q;  2PI2 A;  4HJA A;  3UDX A;  4C3I H;  2GN5 A;  3KLW A;  1SN8 A;  4DR4 Q;  1RL2 A;  3S17 H;  2YV5 A;  4YHH L;  5FLM G;  3M85 A;  2UXC L;  4IOA A;  5GQO A;  3CCU A;  4HIO A;  1Q46 A;  1VQM A;  1RIP A;  4GOP A;  1VQF A;  4X62 Q;  2D0O A;  2JA6 H;  2NVQ H;  3UDG A;  1SR3 A;  4A3M H;  3Q8D A;  3F2D A;  3H0G G;  1KIX A;  3IRB A;  1A0I A;  3JC6 6;  3CQZ H;  5LMU Q;  2N78 A;  3J81 j;  4O0A A;  2DUD A;  1IBM L;  2R93 G;  1KAW A;  2WP8 J;  2NZO A;  4OWX B;  4JYA Q;  3NBH B;  3JAM c;  2JA8 H;  3T1Y Q;  5IE8 A;  3PO3 H;  4GKK L;  2KCT A;  2AWN A;  2Q2H A;  3OTO Q;  4LF4 Q;  4LF8 Q;  3HOV G;  2YU9 H;  2UXC Q;  4A3G H;  3KF6 A;  2Z6K C;  4KLK A;  3ULL A;  3U58 A;  3PCO B;  1NE3 A;  1UE5 A;  3CP0 A;  3CMA A;  1N33 L;  4K0K L;  1VQK A;  1VQO A;  3CCS A;  1LYL A;  5IWA Q;  1YJ9 A;  1U0L A;  2K75 A;  3M7N A;  1NY4 A;  1H95 A;  2UXB Q;  4GLX A;  1FJG Q;  2ZM6 L;  4YCW A;  4A3F H;  4KHP Q;  2NVY H;  4JC0 A;  5JEA J;  2XTI A;  1CSQ A;  1KQS A;  4IOC A;  4JI4 L;  1JJ2 A;  2E5L Q;  4IFD I;  4JI6 Q;  4JCV E;  4R4I A;  5BR8 L;  2VL6 A;  1R9T H;  1C9O A;  3I4N G;  3FHW A;  4BY1 G;  4B3M L;  1YHB A;  3PUX A;  3CAM A;  2MNA A;  1KRS A;  4LF9 L;  5AJ3 L;  1PYS B;  4HIM A;  4L5T A;  3KJP A;  1IBL L;  5IY0 A;  3CD6 A;  4LFC Q;  4OO1 I;  2VNU D;  4DNI A;  4DUZ Q;  1N36 L;  3B6Y A;  5HGQ A;  4AQY L;  4JI8 Q;  1E3P A;  1J6Q A;  2ZJQ A;  2MFI A;  2OCE A;  4A3D H;  4GNX B;  2B29 A;  4OWT B;  4P75 A;  4P73 A;  1XNQ L;  1K83 H;  4DPG A;  2Q2T A;  3CF5 A;  4X65 L;  3I55 A;  4JI2 L;  4NXM Q;  4JI7 L;  4DR7 Q;  4FDB A;  2CKZ B;  4A3K H;  4H02 A;  2EIF A;  1VQ9 A;  4JI5 L;  4GN4 B;  1KHI A;  1N9W A;  5M3M G;  1HNX L;  1B70 B;  1I50 H;  2KCM A;  3J80 c;  2IX1 A;  3PGZ A;  2UU9 L;  4DR2 Q;  1VQJ A;  1NJI C;  4JBK A;  4R4T A;  4QY7 A;  2K5V A;  3DLL A;  1Q1E A;  4R1J A;  3A5U A;  2OTL A;  4LFA Q;  2VQF Q;  3CCR A;  4BXX H;  5IYC G;  3A74 A;  5LMN Q;  1TWC H;  1WI5 A;  2MO0 A;  2NVT H;  4YY3 L;  1Y1W H;  2C35 B;  4PZ8 A;  4YWM A;  3S2H H;  1PH3 A;  2KBN A;  1PH9 A;  1E7Z A;  2ALY B;  3S1M H;  1YNX A;  4B3T Q;  1NMG A;  1VQG A;  2JA5 G;  2B63 H;  4Y7N H;  1OXS C;  2BA1 A;  1W3S A;  5C3E G;  1N34 L;  4A3E G;  1HJP A;  1VQB A;  4HJ8 A;  1YBY A;  2UUA Q;  5IP9 G;  3TQY A;  3AFP A;  1VQD A;  3EN2 A;  2JEA I;  3RZD H;  1S40 A;  1JB7 A;  4P72 A;  3UE0 A;  4DUY L;  2BH2 A;  5FJ8 G;  1VQ4 A;  3HOX H;  1C7Y A;  4LWC A;  4DKA C;  2ES2 A;  2RHQ B;  1HR0 Q;  4A75 A;  1VQP A;  1K8G A;  4AYB E;  1VQN A;  1G29 1;  3J7Z C;  5C0X I;  1XNR L;  4JBW A;  3BZK A;  3PUY A;  4NPS A;  4LF6 L;  3J81 i;  2JA6 G;  4GS3 A;  3G6E A;  3GTQ H;  3PF5 A;  3WWV A;  2WB1 E;  1HH2 P;  1TWG H;  1N32 L;  1JE5 A;  1WJJ A;  2JQO A;  4DV6 L;  4JV5 Q;  5IYC H;  2UUC L;  3BU2 A;  4LF5 L;  2WB1 G;  4L5Q A;  3KYH C;  1EQQ A;  2A1A A;  3K80 C;  4B3R L;  4DV1 Q;  3PSI A;  3GTL H;  2ZJR A;  1LM0 A;  2JA8 G;  2VUM G;  3PO3 G;  1X54 A;  2XGT A;  3G71 A;  2N8N A;  2ZTE A;  2HHH L;  1CSP A;  2Q2I A;  3F8T A;  1P8L A;  4YHH Q;  5M5X H;  1HZB A;  1VQC A;  1OXV A;  3TRZ A;  1Y1V H;  3M4Q A;  3GTO H;  4X66 Q;  1HZA A;  4DV7 L;  1YHQ A;  1XTD A;  4EQ5 A;  4A3E H;  2ZJP A;  4JI0 L;  2PQA A;  3AFQ A;  3K81 C;  4JOI A;  1X55 A;  3PV0 A;  2R92 H;  1A62 A;  2IX0 A;  1IYJ B;  1I5F A;  4ME3 A;  3A5Z B;  1PH1 A;  1LTL A;  1PH5 A;  1I94 L;  4YCU A;  3PUW A;  4A3F G;  1Z9F A;  5FJ8 H;  4HID A;  1PH8 A;  3KDF B;  4GN5 A;  1VQE A;  4JBJ A;  3KF8 B;  3TEH B;  3TS0 A;  3BJU A;  4IFD J;  4DV5 Q;  2PQA B;  3CCM A;  4JI1 Q;  4LFB L;  2I5L X;  3VDY A;  3TS2 A;  4GKK Q;  1UE1 A;  3F1Z A;  2BH8 A;  1I6H H;  4HJ9 A;  3A0J A;  1YEZ A;  1VQ6 A;  4JI3 L;  1TWF H;  1Q8K A;  1TWA H;  3K7U C;  2N3S A;  2D62 A;  1VQA A;  1FGU A;  1NTG A;  3J7A 5;  5IP7 G;  2F3I A;  5HY6 A;  4DR5 Q;  4B3S Q;  3HOU H;  4R4C A;  1PHJ A;  3HOZ H;  1VQH A;  5GRO A;  2QEX A;  3RLF A;  2VUM H;  1SLJ A;  4LW1 A;  3PO2 G;  1YZ6 A;  4A3D G;  2VQE Q;  2BA0 A;  1FL0 A;  1QVC A;  4DR1 Q;  3HOW H;  3ICE A;  1PH7 A;  1YVC A;  1K8A C;  5IYD H;  2F4V L;  2RHS B;  4GLV B;  3G4S A;  5C4X H;  2PI2 E;  4A3K G;  1C0A A;  1E24 A;  4C3J H;  1PYB A;  5BR8 Q;  1NMF A;  1L0W A;  1HNZ L;  4UP8 A;  1EIF A;  4DV0 L;  3JAM i;  4A3I H;  2UUB Q;  1CKO A;  5DLQ E;  2Y0S E;  5AJ3 Q;  2L15 A;  4X64 L;  4GOP C;  4A3J G;  3E0E A;  1X9N A;  5IYB H;  4L5S A;  1QUQ B;  4BXX G;  1N36 Q;  2IT1 A;  2MQH A;  2Y0S G;  4IPC A;  4AQY Q;  3M4P A;  4DR6 Q;  1OXT A;  2R7D A;  1J5E Q;  1T9H A;  4IPG A;  3FKI H;  1Y1W G;  3GTG H;  3F2C A;  2OWO A;  2IY5 B;  4GLA C;  4A76 A;  2VW9 A;  4GNX A;  3S1Q H;  4OON A;  2B63 G;  4IPD A;  2JA7 H;  1KD1 C;  1Q1B A;  1L1O B;  5LMU L;  1HNX Q;  3RLO A;  1PA6 A;  3S14 H;  5M5Y H;  4ALP A;  5IP7 H;  1XPR A;  1A63 A;  2HT1 A;  1YHA A;  4LF7 Q;  3W1B A;  3PO2 H;  2ATW A;  2E2I H;  1EQR A;  3I2Z A;  3HOX G;  4LF4 L;  4BA1 I;  1IBK Q;  4LF8 L;  4A3B H;  4A3C G;  1UEB A;  3AYH B;  5GAG C;  2NZH A;  3SGI A;  2LSS A;  4POF A;  1U5K A;  5C0X J;  3PF4 A;  2F52 A;  2KHI A;  5K36 G;  3G48 A;  3TRE A;  1HZC A;  3FP9 A;  5IWA L;  1AE3 A;  2A19 A;  3L0O A;  4A3L H;  2JE6 I;  1XMQ Q;  1PH4 A;  4A3J H;  4KHP L;  4OX9 Q;  4GNX C;  2CWP A;  2ID0 A;  2JK8 A;  3ZJY C;  1E22 A;  1V1Q A;  3OW2 A;  1Q82 C;  5J3B A;  3HOY G;  1QVG A;  2E5L L;  4JI6 L;  1L2F A;  1XPO A;  3ERS X;  1DGS A;  2CQO A;  1Q7Y C;  1S3O A;  4DAY B;  5C4J H;  1XMO L;  4BBS H;  1EUJ A;  1Y1V G;  3UDI A;  3GTJ H;  3CC2 A;  3NEL A;  4L5R C;  1XNR Q;  1WOC A;  1KRT A;  1EYG A;  2R92 G;  2UXD L;  5E7N A;  4HJ5 A;  4Y52 H;  2KEN A;  1MJE A;  5GAE C;  2WAQ E;  2K5N A;  3I4O A;  4TVA B;  1EOV A;  4JI8 L;  4BY7 G;  2V1C C;  2IHF A;  2HQL A;  4UP9 A;  4HIK A;  1N8R C;  1VQ8 A;  4A93 H;  4YWK A;  1N32 Q;  2WAQ G;  5JEA G;  2UUC Q;  4LF5 Q;  4A3C H;  1O7I A;  4YWL A;  4DR7 L;  4DV4 Q;  1JJG A;  2NN6 I;  4RMF A;  3H3V I;  5ELN A;  2KHJ A;  1OTC A;  3DM3 A;  4NXN Q;  3T1H L;  2A8V A;  5H1S E;  4BBR G;  1VQ7 A;  1SRU A;  2ZTD A;  2HHH Q;  2K5H A;  4DR2 L;  4PZ7 A;  5IT9 c;  4O2D A;  4GKJ Q;  4EX5 A;  1CKN B;  4DV7 Q;  1YI2 A;  1WFQ A;  4LFA L;  2D0P A;  2VQF L;  1GO3 E;  4MTN A;  3HOU G;  1Q12 A;  1X3E A;  1OXX K;  2QGQ A;  3EIV A;  3HOY H;  1JMC A;  2CCZ A;  3F2B A;  3W5O A;  3GTM H; 
#chains in the Genus database with same CATH topology
 2EXD A;  4O1N A;  3KFU A;  1ICW A;  4GN3 B;  4ZKC B;  2LY7 A;  3V2T A;  1IHZ A;  1FR3 A;  1STY A;  3KF8 A;  3I73 A;  5M5W H;  1EWI A;  1SJE D;  2AQ1 B;  4BY7 H;  2N55 A;  1UE7 A;  1XPU A;  1IBM Q;  5M9O A;  1SMX A;  2LKV A;  5M3F H;  1HNW L;  1X6O A;  4O42 A;  4X6A H;  1SJH D;  4J15 A;  1M1K C;  4FF1 A;  3KOJ A;  2QA4 A;  1HXY D;  4DR3 L;  2E2J H;  2JA7 G;  2EYO A;  4K0K Q;  3URY A;  4XQQ A;  4CBV A;  1B7Y B;  4RFB A;  3I56 A;  4PQX A;  3LWE A;  1GKH A;  2KHS A;  3D0F A;  3K7A H;  3CCE A;  3VA7 A;  5GAD C;  4JI4 Q;  1S5E D;  2A6H D;  3AEV A;  3EBE A;  4R8N A;  5EPK A;  3EJI A;  1JT8 A;  2B2V A;  3G7L A;  4OGQ C;  4A3L G;  3T16 A;  1EQV A;  1IBL Q;  4JW0 A;  1EEF D;  2R7F A;  3FPU B;  3BVG A;  1L1O A;  1BBU A;  1CFM A;  1I4Q A;  4DF7 A;  2EY1 A;  1P16 A;  5ELO A;  5I9O A;  3T13 A;  1YNJ C;  4APV A;  1SYD A;  2B63 B;  4JI2 Q;  5JJI A;  2Q8I B;  1FNV A;  5JPM C;  2EDG A;  2LXJ A;  2RF4 A;  1BDO A;  3CCL A;  1JC7 A;  1IL2 A;  2A73 B;  3X3N A;  3SEB A;  4QIW B;  1SE8 A;  2B2Y C;  2Z8L A;  2JEB I;  2RVL A;  4PMW A;  1VQL A;  1D1K A;  4NW2 A;  1MGS A;  3L7Z C;  1VQ5 A;  3J7A F;  4DAY A;  1JJC B;  1PFS A;  2RDF A;  2WV6 D;  1WVL A;  3OMG A;  1H9K A;  4MZ9 A;  1EIY B;  3KUP A;  3A8J E;  4LNQ A;  1TVX A;  1VCI A;  3D4R A;  1BKB A;  5C44 G;  3F2U A;  4BY7 B;  1BCP C;  2VZA A;  1K73 C;  3M3Y H;  4R4Q A;  2B8G A;  4F8M A;  1F2Z A;  1IBK L;  2F0V A;  1CKN A;  2XRS D;  4H13 C;  3P75 A;  4XIG S;  1WD1 A;  1CUK A;  1ZYR C;  2PZW A;  5FLX L;  3I4N H;  4AH6 A;  4NKL A;  1UUP A;  5I4D A;  3I8Z A;  1U4M A;  2AHO B;  3HOU B;  2EYH A;  4OXP A;  3HOZ B;  4KI0 A;  1W2B A;  2AUK A;  2F0K A;  1HCZ A;  5EAY A;  2R61 A;  3N6R A;  4KV6 A;  4ZCK A;  2AWO A;  3TP6 A;  1NBW A;  2NN6 G;  5C4X B;  4DK6 C;  1U9R A;  3CCQ A;  4B3T L;  1CM9 A;  2ICE C;  2F0I A;  5M3M H;  4DK3 C;  1KLU D;  2BH2 A;  4A3I B;  3K8A A;  4KHZ A;  1UEA B;  2K14 A;  4AYB G;  2ZTC A;  1FNU A;  1JWM D;  3ULP A;  2R7Z G;  4DV2 Q;  1G6P A;  2WIN B;  3LNN A;  3VYT A;  3H15 A;  1FNW A;  3CRL C;  3FKI B;  4NXN L;  1DM0 B;  1Z47 A;  3TZU A;  1LUZ A;  1BO0 A;  2D5D A;  3S1Q B;  2F4V Q;  1A3U A;  1MKH A;  1ROD A;  3U4V A;  1EIH A;  2EYP A;  1R4Q B;  3PIP 3;  5JJK A;  2K32 A;  3NEM A;  3ERQ A;  2NWG A;  4KKS A;  3E3X A;  2PI2 A;  1XX8 A;  3UDX A;  4C3I H;  3KLW A;  1RL2 A;  2YV5 A;  1WTR A;  4KTA A;  4TSS A;  4G57 A;  4GOP A;  2JA6 H;  1SDF A;  3UDG A;  3F2D A;  1G8Z D;  5TSS A;  4H7B A;  3CQZ H;  1VMC A;  2DUD A;  1IBM L;  4RAU C;  5DEH A;  4JVZ A;  5E3F A;  1EIG A;  2KCT A;  2AWN A;  2EPB A;  2Q2H A;  3HOV G;  3BZD B;  3KF6 A;  3ULL A;  3GTJ B;  2O5J C;  2V4D A;  4K0K L;  3TP5 A;  1EYD A;  5LHY 1;  1PTO H;  4DK1 A;  3CU7 A;  1M8A A;  5FO9 B;  4GLX A;  1FJG Q;  3S9W A;  4A3F H;  2PYK A;  5JEA J;  2XTI A;  1KQS A;  4IOC A;  4JI4 L;  2XSC A;  1JJ2 A;  4KK7 A;  1SMY D;  4OIK A;  4JI6 Q;  1XTC D;  2X6L A;  4R4I A;  3FHW A;  4BY1 G;  3CAM A;  3LWU A;  1IBL L;  5IY0 A;  1N36 L;  3OIP A;  4AQY L;  3GTM B;  1E3P A;  2ZJQ A;  1Y69 U;  3J81 E;  4A3D H;  4GNX B;  4P75 A;  1SFO B;  1K83 H;  4DPG A;  3W2D A;  3CF5 A;  4DR7 Q;  3I55 A;  4JI2 L;  1DCZ A;  5D14 A;  1L0Y B;  1PDQ A;  4H02 A;  4A3K H;  2EIF A;  1VQ9 A;  4GN4 B;  1K8O A;  1B70 B;  2KCM A;  2MP1 A;  4DR2 Q;  2NBF A;  3DLL A;  3I4M B;  3A5U A;  3CCR A;  2ZXP A;  3PMF A;  4K5X A;  1NCV A;  2ZXO A;  1Y1W H;  1F9P A;  3T4A C;  5CYU A;  2C35 B;  1E7Z A;  2ALY B;  1KAB A;  3K6O A;  2QIL A;  1H9S B;  2CH4 A;  1QCB D;  4LJZ C;  4X3U A;  5C3E G;  3OWE B;  4C1N K;  1YBY A;  2UUA Q;  2LS0 1;  1BCP F;  2PPB C;  4R8I A;  2G5D A;  5FJ8 G;  1C7Y A;  3HOX H;  2Q8T A;  1RKN A;  1HR0 Q;  2NVX B;  4DAP A;  1G29 1;  1QJO A;  5C0X I;  1TY0 A;  1QIL A;  3J81 i;  3GTQ H;  2PZT A;  1H9R A;  1G2T A;  3N52 A;  1WJJ A;  1J8I A;  3P1H A;  2B2U C;  3M4O B;  4L5Q A;  3QO2 A;  2K28 A;  5C3W A;  4DV1 Q;  3PSI A;  4V19 0;  3GTL H;  4G7H C;  2E2D C;  4RGO S;  3RMH A;  1STG A;  2X69 A;  3S2D B;  2N8N A;  2JSO A;  1TQO A;  1GXD C;  2IX3 A;  4B9W A;  2RDH A;  1OXV A;  3IL8 A;  3C1E A;  3GTO H;  4K8J A;  4X66 Q;  1YHQ A;  4EQ5 A;  4U67 3;  4A3E H;  2ZJP A;  3C46 A;  4JOI A;  3NP8 A;  4NMZ A;  3PV0 A;  2EY6 A;  5KNB A;  1A62 A;  2EVB A;  5FK9 C;  5CV7 A;  3A5Z B;  4RGM A;  1LTL A;  5CBA E;  1PH5 A;  4YCU A;  1AN8 A;  2X6G A;  1PRT C;  2K5Q A;  4HID A;  1PH8 A;  2F4I A;  2JYO A;  3KDF B;  3TS0 A;  4IUN A;  2I5L X;  2M2L A;  3VDY A;  3TS2 A;  2O5I C;  1CQV A;  3H0G B;  2F0D A;  1Q8K A;  1NNX A;  1YNN C;  2B2W C;  2D62 A;  1CQF A;  3J7A 5;  4ODG A;  4DR5 Q;  2I07 B;  3RLF A;  2VUM H;  3GTP B;  1K83 B;  3ICE A;  3HOW H;  2OT2 A;  2RHS B;  3MXG A;  3G4S A;  2F4V L;  1C0A A;  3S1N B;  4C3J H;  1LTR D;  1NMF A;  1L0W A;  4UP8 A;  4RCN A;  2L0C A;  2F3W A;  1STH A;  1I4P A;  1EYC A;  1I3Q B;  2CH4 W;  1WTV A;  2UUB Q;  4FF4 A;  4X64 L;  1X9N A;  4BXX G;  1I6V C;  1QUQ B;  1GUT A;  2F0O A;  4L5S A;  1BXT A;  1S5F D;  3K0Y A;  2HCC A;  3SR1 A;  3TBI B;  1Y8O B;  3GTG H;  2IY5 B;  4GLA C;  1JE4 A;  4A76 A;  2B63 G;  4RA8 A;  3HRZ C;  4IUT A;  3S15 B;  1C4Q A;  1Q1B A;  3AU7 A;  4HMI A;  3RLO A;  3R93 A;  2ENB A;  4LK1 C;  1A63 A;  2HT1 A;  1EQR A;  3MTS A;  5GAG C;  3DXJ C;  1DXM A;  4IQZ A;  4KJO A;  1JR0 D;  2F52 A;  3TRE A;  1HHV A;  3HP3 A;  2A19 A;  3L0O A;  4OX9 Q;  1D6E C;  1BCP B;  1E22 A;  4KKT A;  4JI6 L;  1L2F A;  1CK1 A;  1XPO A;  4QCL A;  5C4J H;  1XMO L;  4ZAI A;  4A3E B;  1AFP A;  2KCN A;  5A2Q E;  2UXD L;  4BY7 G;  3H09 A;  5ELC A;  1PYW D;  4QMG A;  4HIK A;  1TS3 A;  1BBX C;  4A93 H;  2PQE A;  1N32 Q;  4K2L A;  5C4Z A;  4YWL A;  4DR7 L;  2I46 A;  4RMF A;  2K5D A;  3A55 A;  4DR2 L;  4PZ7 A;  1DOL A;  1EYA A;  4DV7 Q;  1YI2 A;  1KDC A;  2WB1 B;  1WTQ A;  3HOU G;  1X3E A;  1OXX K;  2QGQ A;  3Q22 A;  3HOZ G;  2CCZ A;  2JA8 B;  3PO3 B;  2VUM B;  1I94 Q;  1K3R A;  3K0X A;  1SYG A;  1ONL A;  2I5H A;  1DOK A;  1BVS A;  2H5X A;  1U4P A;  5C4X G;  3J81 L;  3EFX D;  4R9W A;  2B2T C;  3R2T A;  3GDE A;  1BOS A;  1E1T A;  1IYV A;  2YYZ A;  3PUV A;  4A3I G;  4JI3 Q;  3C1F A;  2BE5 D;  2CFM A;  2MO1 A;  3BYT B;  4P74 A;  4ZUJ A;  3RZO H;  3ND8 A;  3FKI G;  2RCN A;  5CBE E;  3LGJ A;  4UY8 C;  1E1O A;  4BA2 I;  3ND9 A;  4DR6 L;  1KC8 C;  1C8C A;  3RNU A;  1IKM A;  4QJF A;  4HJ7 A;  1ZEQ X;  1Z7T A;  3A54 A;  4DV1 L;  4ZRZ A;  3LX0 A;  3MXN B;  3PUZ A;  1RD9 D;  2NUC A;  3DEO A;  3VYS A;  2OQ0 A;  1GHK A;  1CZG A;  4YCV A;  2ZM6 Q;  1X3F A;  4CHT B;  1PRT F;  1WCM H;  2HUG A;  1VDZ A;  4TQU S;  4X3T A;  5C0X H;  4X66 L;  1SNP A;  2OQK A;  2MJ8 A;  4QGU A;  1OO9 B;  1XJV A;  1I4G A;  2HQE A;  3K5M A;  4DFA A;  4M8A A;  2SDF A;  4QQB X;  4KD4 A;  3CW2 C;  2OXP A;  3S2H B;  1XNQ Q;  4L6T B;  4F88 A;  2L1B A;  3RN5 A;  4EQO A;  3RR5 A;  1PH2 A;  4JI7 Q;  2PMZ E;  4OL7 A;  5KNC A;  4DR5 L;  1QVF A;  4X3K A;  4JK1 C;  4JYA L;  2GVB A;  1G2S A;  5EBD A;  3D6C A;  4J1M A;  1B4O A;  1YIJ A;  1WD0 A;  5FLM H;  4IFD G;  4OHJ A;  1GUG A;  3CC7 A;  3O13 A;  1L1O C;  4CDD C;  3DMU A;  4WJ3 M;  1GD7 A;  2AQ2 B;  4C3H H;  2UUB L;  3E6Z X;  2UXB L;  1I4H A;  2R93 H;  4WJ4 A;  2EQS A;  1IW7 C;  1I4X A;  4K5W A;  1WTP A;  3OSO A;  1EU4 A;  2LXK A;  3I70 A;  1EFW A;  1Y1V B;  1STA A;  1RDP D;  3T1H Q;  2JJQ A;  4IUQ A;  3EQL C;  3ULJ A;  4DUZ L;  1EY9 A;  4LF6 Q;  3GD7 A;  4G7Z C;  3STB D;  1ASZ A;  3VA5 A;  3DWP A;  2WAQ B;  3I4M G;  1Q90 A;  4NXM L;  2IHE A;  5I6Y A;  1CKM A;  1ASY A;  2E2H H;  4OEL B;  3M9B A;  1H9J A;  3H91 A;  4OX9 L;  2R6G A;  2EXZ A;  3J81 c;  3I72 A;  1DON A;  4XYO A;  2RA4 A;  1WYD A;  3NTH A;  4RG1 A;  2GVA A;  1S72 A;  4UP7 A;  2XVS A;  4AIM A;  4CKC A;  3NEN A;  4DV3 Q;  4IO9 A;  3D31 A;  3U9S A;  3VR4 A;  4ZLT F;  4IUV A;  1YNJ D;  4EQN A;  3QG1 A;  2AKW B;  1GJX A;  2HDL A;  2KEC A;  3NQI A;  4S3S A;  3STB C;  1PRT B;  2EY2 A;  1D2B A;  1SE2 A;  3R2I A;  2FHT A;  2KVM A;  3SE0 A;  2JA5 H;  1PMR A;  4HSV A;  5KEE A;  5M5Y B;  2H1E A;  4HSP A;  2VB3 X;  1QG7 A;  1UNS A;  3S24 A;  3I91 A;  2GN5 A;  4RGN A;  4DR4 Q;  5D3I B;  4A3B B;  2F0Q A;  4Q0F A;  1SND A;  3X3M A;  5A2Q L;  2KQ3 A;  5C5L A;  3M85 A;  4FXD A;  2MGS A;  5GQO A;  3CCU A;  4HIO A;  5IGF A;  4B9X A;  1B50 A;  1SAP A;  2XWB B;  4ZKB B;  5ELD A;  2NTT A;  4X62 Q;  1PZI D;  2O4X A;  1KIX A;  3H0G G;  5A35 A;  3GP7 A;  3JC6 6;  4L8J A;  3J81 j;  3T53 B;  3T1Y Q;  4GKK L;  3DHQ A;  4K6D A;  4OEM B;  3OTO Q;  4LF4 Q;  1BCP D;  2YU9 H;  4A3G H;  2RSN A;  3DWA A;  4BBS B;  2Z6K C;  3T56 B;  3A8I E;  2K1B A;  2SNS A;  3CMA A;  1B44 D;  1VQO A;  3CCS A;  1ZYR D;  4BS9 A;  3M7N A;  4K6L A;  4ZYS A;  2VXW A;  5CV4 A;  2ZM6 L;  4KHP Q;  2NVY H;  1R4P B;  2F0F A;  4N8F A;  1CSQ A;  2EYJ A;  2F0T A;  2E5L Q;  2BOS A;  3R8B A;  2VL6 A;  3PUX A;  3UI2 A;  5AJ3 L;  4HIM A;  3KJP A;  1V1P B;  3CD6 A;  4DA2 A;  4LFC Q;  4DNI A;  3B6Y A;  5HGQ A;  4I65 A;  3BYY B;  2LMC B;  4JI8 Q;  1HUN A;  1O7Z A;  1J6Q A;  1AZQ A;  5FKA C;  2MFI A;  2B29 A;  4OWT B;  1XNQ L;  3SVM A;  3RD4 A;  1KDB A;  3ONA B;  4JI7 L;  1KTK A;  2DY8 A;  2CW0 D;  3FRP B;  1GUN A;  1I50 H;  2IX1 A;  5M5W B;  1II3 A;  3PGZ A;  1STB A;  2KOL A;  3CKI B;  1NJI C;  4JBK A;  2K5V A;  1Q1E A;  4LFA Q;  3VR2 A;  5M3F B;  3OW7 A;  5LMN Q;  1TWC H;  2MO0 A;  2NVT H;  1HA5 A;  4ZK9 B;  5L37 A;  5J22 A;  4YWM A;  5ISR A;  1PH9 A;  2RBM A;  1TT2 A;  2E2J B;  1VQG A;  4Y7N H;  4A3E G;  1VQB A;  4FP5 D;  5IP9 G;  3TQY A;  3KK7 A;  3OWF A;  2JEA I;  3RZD H;  1S40 A;  1JB7 A;  4GZY C;  4P72 A;  4DNT B;  1JOR A;  1EU3 A;  3K7A B;  3UE0 A;  1Y8P B;  1K3B C;  4LWC A;  2ES2 A;  5K5P A;  2RHQ B;  2Q8R E;  5EKK A;  1F2Y A;  4G7O C;  1SBB B;  1DOM A;  1VQP A;  1K8G A;  2A69 C;  4AYB E;  1XNR L;  1SYF A;  4XT1 B;  2WKC A;  4LF6 L;  4GS3 A;  2SEB D;  3WWV A;  2WB1 E;  2E76 C;  2CW0 C;  2UUC L;  4LF5 L;  3BU2 A;  2WB1 G;  1EQQ A;  3K80 C;  4DXF A;  5T1G A;  3VR5 A;  2JA8 G;  2VUM G;  3PO3 G;  2XGT A;  4KD3 A;  5KND A;  1AZP A;  3JAM E;  1QOH A;  4A3G B;  2Q2I A;  4YHH Q;  3NTI A;  1HZB A;  1V8Q A;  1VQC A;  4UHV A;  5M5X H;  2XIW A;  4NP5 A;  3D3R A;  3AFQ A;  3K81 C;  4ZQ3 A;  1KNE A;  3SDZ A;  2R92 H;  1IYJ B;  2FJ2 A;  2F0J A;  1Z9F A;  3H94 A;  5JEA H;  1AP0 A;  5EKI A;  3KF8 B;  3TEH B;  4IFD J;  1G91 A;  1QE6 A;  2EOT A;  4LMQ D;  3DUZ A;  1LT4 D;  3NBH A;  1EWC A;  4IUR A;  1CA5 A;  2BH8 A;  4DGZ A;  4HJ9 A;  1VQ6 A;  1YEZ A;  1TWF H;  1TWA H;  3MFG A;  1NAP A;  1VQA A;  2F0L A;  1TS2 A;  5I6W A;  3A7L A;  1PHJ A;  1VQH A;  1B1Z A;  2QEX A;  1O80 A;  4HCE A;  4LW1 A;  1YZ6 A;  2VQE Q;  2BA0 A;  1FL0 A;  1PH7 A;  1K8A C;  5CV9 A;  4GLV B;  4RKB A;  2Z4H A;  3HEJ A;  5BR8 Q;  4ZUI A;  1WTW A;  3J80 E;  1EIF A;  5KYL A;  3JAM i;  1CI3 M;  3M3Y B;  3E0E A;  2NB0 A;  1HQR D;  2NVT B;  5CMD A;  4XQN A;  2ZT9 C;  4HN7 A;  1B3Q A;  3VR6 A;  3I4N B;  3OPO A;  2OWO A;  3D4W A;  2F0S A;  3SK4 A;  2VW9 A;  4HR7 B;  3HGB A;  2JA7 H;  2OEO A;  1L1O B;  1HNX Q;  3S14 H;  3MXU A;  2H4O A;  4ALP A;  1PFN A;  5DM6 3;  1YHA A;  5CR3 A;  1E2W A;  2L11 A;  4K8I A;  3SXH A;  4LF4 L;  1QB5 D;  5M3M B;  3PF4 A;  1DD2 A;  5EGT A;  5K36 G;  2N88 A;  3E0J A;  1MSH A;  1HZC A;  1AE3 A;  2J0T D;  4A3L H;  1ZXT A;  4A3J H;  4KHP L;  2JXM B;  2ID0 A;  1V1Q A;  5CGK A;  3W3A A;  1QVG A;  2E5L L;  3FPP A;  1F9S A;  2O2L D;  1LT6 D;  3E5S A;  1NSN S;  4DAY B;  1GHJ A;  1Y1V G;  4L63 B;  1PRT D;  2NYZ D;  2Z1C A;  1KRT A;  1O78 A;  1EYG A;  4C3I B;  2KEN A;  1MJE A;  5GAE C;  2WAQ E;  4JI8 L;  3I4O A;  1EFI D;  1EOV A;  4TVA B;  5DM7 3;  5JJZ A;  2IHF A;  2A5H A;  2HQL A;  3M7G A;  4UP9 A;  1WTO A;  1N8R C;  4YWK A;  2WAQ G;  1ENC A;  4DV4 Q;  1YNN D;  1VMP A;  3FVQ A;  1OTC A;  3DM3 A;  4QB4 A;  2JA6 B;  2DY7 A;  5H1S E;  1LAC A;  4K14 A;  1SRU A;  3GQB A;  5T1I A;  5IGG A;  1VQ7 A;  2HHH Q;  1TWF B;  3IAY A;  1TWA B;  2QDL A;  4J6H A;  4QUC A;  3CQZ B;  4O2D A;  3IKJ A;  4GKJ Q;  1CKN B;  4KJN A;  4LFA L;  2D0P A;  4MTN A;  4CJ0 B;  3NWS A;  1ENF A;  4QL5 A;  4XTC S;  4C2M H;  5IYD G;  2MUY A;  4UPA A;  2F03 A;  1IZ6 A;  4JBM A;  3KBG A;  5NUC A;  1ZKO A;  1PTO B;  1Q8I A;  1A2U A;  5C44 H;  3SHL A;  1F9Q A;  2IPK D;  4IJL A;  3U4Z A;  2PNR C;  4F7X A;  4A3F B;  5IYB G;  5G3L F;  4HTH A;  1MHW C;  1F9R A;  2FXQ A;  1HQM C;  4EGV A;  1LV9 A;  2WAC A;  5COR A;  4BBR H;  3HKS A;  3IFT A;  1BR9 A;  3V05 A;  2L4N A;  2VS1 A;  3CPF A;  2OF1 A;  1LTG D;  2IWH A;  4DV2 L;  1QZH A;  3L2P A;  1HTL D;  1ILP A;  3G6J B;  4WOR A;  4A3D B;  3NE5 B;  2HIX A;  4A3B G;  5BN4 A;  3QB3 A;  3CCJ A;  3H3V H;  4A3K B;  3MWY W;  2YTV A;  3VYU A;  1A2T A;  3C2P A;  3UDF A;  4B3M Q;  4MIU A;  5HGT A;  3W1G A;  3A8K E;  4CDC C;  4A3J B;  3V96 A;  2R7Z H;  1X56 A;  3MEF A;  3I3C A;  1B8A A;  5I2X A;  1Y1W B;  4GOP B;  2DGY A;  3IFD A;  1V1O A;  1UE6 A;  4X65 Q;  4PZ6 A;  4BBS G;  1YJW A;  3JAM L;  5KYI A;  2RSO A;  4CGY B;  1L0X B;  1PZK D;  3KF6 B;  3HOX B;  2VQE L;  3S1R H;  4QIW E;  2Z0S A;  3EA6 A;  3E9H A;  2AMC B;  2C9O A;  2RDG A;  4YY3 Q;  1Q81 C;  1AH9 A;  3GTQ B;  5D65 A;  4IUP A;  3D6W A;  5IT9 E;  4OO1 G;  1D8L A;  1N34 Q;  1X3G A;  4R4O A;  1FJG L;  1K28 A;  2FMC A;  3GTL B;  1JOQ A;  1YIT A;  5IIF A;  2MPM A;  4C2M B;  4Q5V A;  3CPW A;  3HOV H;  3GTO B;  1GOZ A;  1TXY A;  4TKO B;  4RHS A;  1RHP A;  1AEX A;  3BVM A;  1IXR A;  3A56 A;  2HD3 A;  4ABN A;  2RCF A;  1F77 A;  3GTK H;  2Q2U A;  3TN2 A;  5M3F G;  3S16 H;  3J7Y W;  2F1M A;  3E9I A;  4B3R Q;  1ICF B;  3ER0 A;  1O7Y A;  4BBR B;  4BY1 H;  2B2U A;  3QR8 A;  1X3Q A;  1YJN A;  3MAQ A;  2L9H A;  4JI0 Q;  3BDC A;  1JQY D;  2C5C A;  1PV4 A;  2FIN B;  5C3X A;  1A3T A;  1B53 A;  1QZG A;  3HOW B;  1LT3 D;  2HDM A;  1JWS D;  1CA6 A;  3ZYY X;  5E4X A;  2K52 A;  4C3J B;  1HNW Q;  4XT3 B;  4H0L C;  4LFB Q;  3AQQ A;  1G6Z A;  4XXE A;  2E8G A;  2UUA L;  1S5C D;  4DR3 Q;  4P71 A;  1SRO A;  2KJX A;  4JPB W;  3U50 C;  3K57 A;  4DV4 L;  2J4X A;  2OTJ A;  1K9M C;  1HR0 L;  3GTG B;  1UWV A;  2B2W A;  4JG2 A;  3EVQ A;  4A3G G;  1QNK A;  3RN2 A;  5AFW A;  1MJC A;  1HR0 W;  3CRK C;  3D4D A;  4GKJ L;  5C3E H;  2JA9 A;  2HIV A;  4XQJ A;  2B3G A;  2QCP X;  1KL9 A;  3BG3 A;  4DV0 Q;  4HJA A;  5CC4 A;  1SE4 A;  2XNA C;  3S1R B;  2K7V A;  2VB2 X;  3S17 H;  1NR2 A;  1E2Z A;  2K33 A;  1S5B D;  1Q46 A;  3VR3 A;  4IUU A;  1IW7 D;  1VQF A;  2F0E A;  1SEB D;  2D0O A;  3VYR A;  1SR3 A;  4A3M H;  4LAA A;  3Q8D A;  2A6E C;  1EQT A;  2CHB D;  1A0I A;  2GA4 B;  4DAV A;  4PMC A;  2D9U A;  3JAM c;  2EY5 A;  3MC0 B;  4ULL A;  4LF8 Q;  2UXC Q;  1KNA A;  5C4J B;  1Z6H A;  3U58 A;  3PCO B;  4V0B A;  1UE5 A;  1HTP A;  2SOB A;  2XRQ D;  2TSS A;  3P20 A;  1LYL A;  2BDN A;  1ILQ A;  1KLG D;  1U0L A;  2K75 A;  1H95 A;  4A93 B;  5JPN C;  2XN9 C;  3W5O A;  3L3O C;  4FXK C;  4YCW A;  2XWJ B;  4JC0 A;  5FLX E;  1T5E A;  2B2V C;  2PCF B;  4IFD I;  3K59 A;  3C3L A;  4ID6 A;  1R9T H;  3I4N G;  1C9O A;  3K5O A;  3T51 B;  4B3M L;  1YHB A;  2EYL A;  2MNA A;  1KRS A;  3Q23 A;  4L5T A;  2R3Z A;  2B39 A;  2OCE A;  4P73 A;  4X65 L;  5EJW A;  4KMU C;  4FDB A;  3GV6 A;  4ILW A;  3U9O A;  1N9W A;  5M3M G;  3J80 c;  2ZXR A;  1F2M A;  4DNR B;  4R4T A;  3I4L A;  4R1J A;  3HKZ B;  1PZJ D;  5FOB B;  2VQF Q;  4BXX H;  3RZO B;  1DJR D;  3A74 A;  2JP1 A;  1E0B A;  1TII D;  1GUW A;  1VF5 C;  2G9H D;  3QJY A;  4YY3 L;  4IZ8 A;  1PH3 A;  2KBN A;  3S1M H;  4RHR A;  5IGB A;  4B3T Q;  1NMG A;  2B63 H;  2M00 A;  3ITP A;  1OXS C;  1W3S A;  1N34 L;  1HJP A;  4HJ8 A;  3FEW X;  1VQD A;  3HZX A;  4C3I G;  2B2T A;  2L55 A;  4CKB A;  1WCM B;  1VQ4 A;  2EYM A;  4A75 A;  3J7Z C;  4JBW A;  3BZK A;  3PUY A;  4Z9C B;  4A3M B;  2JA6 G;  3G6E A;  3PF5 A;  2DJF C;  1HH2 P;  1TWG H;  1N32 L;  4JV5 Q;  5IYC H;  3KYH C;  4B3R L;  2A1A A;  4N8X 1;  2P5Z X;  1X54 A;  1SXT A;  3G71 A;  1EZ8 A;  1UAP A;  1CSP A;  3F8T A;  1P8L A;  1PTO C;  2F0U A;  4EVO A;  5EPJ A;  1HZA A;  4DV7 L;  1XTD A;  4JI0 L;  1X55 A;  3I90 A;  2IX0 A;  1LTT D;  1PH1 A;  1I94 L;  4A3F G;  2EJF C;  2F0M A;  4GN5 A;  5KIX A;  5JVH 3;  4DV5 Q;  2PQA B;  4JI1 Q;  1B3A A;  1R9T B;  4LFB L;  4NDX A;  1UE1 A;  1QWY A;  1I6H H;  4C3H B;  4JI3 L;  1JCK B;  2N3S A;  2AUJ D;  1FGU A;  1NTG A;  2R93 B;  4RGT A;  2F3I A;  5HY6 A;  4B3S Q;  3HOU H;  4R4C A;  4MN3 A;  3HOZ H;  5GRO A;  3L9A X;  1DYQ A;  1K0S A;  4A3D G;  3QIA A;  2QKI C;  4DR1 Q;  1YVC A;  4J8Q A;  1LTB D;  2KUM A;  5C4X H;  2PI2 E;  4A3K G;  1E24 A;  1BF4 A;  4DXG A;  4G4K A;  1IL8 A;  2K03 A;  4DV0 L;  4A3I H;  5DLQ E;  3DM1 A;  4GOP C;  3D8G A;  4A3J G;  1N36 Q;  2IT1 A;  2MQH A;  4IPC A;  4AQY Q;  3M4P A;  3QOJ A;  1OXT A;  1J5E Q;  1SYB A;  4IPG A;  1Y1W G;  3FKI H;  1HPC A;  4FF2 A;  2E2H B;  3MXP A;  3F2C A;  3S1M B;  4GNX A;  3NHH A;  3S1Q H;  1KD1 C;  1A6X A;  1C48 A;  1PA6 A;  4K2K A;  1STN A;  4RWS C;  5IP7 H;  1XPR A;  4ME5 A;  3NWT A;  4LF7 Q;  3NTK A;  2A69 D;  3W1B A;  5IOD A;  3PO2 H;  2ATW A;  2E2I H;  4LF8 L;  3I2Z A;  3HOX G;  2UXC L;  4BA1 I;  1UEB A;  3AYH B;  3KLS A;  2NZH A;  1CTM A;  3SGI A;  5G3L D;  2LSS A;  1S5D D;  1U5K A;  2KHI A;  5E4W C;  1SNO A;  3SK8 A;  3QOL A;  4I7Z C;  3FP9 A;  1TS5 A;  5ELE A;  1TWG B;  2JE6 I;  1XMQ Q;  3MFY A;  1H9S A;  2A6H C;  2CWP A;  3TDQ A;  3ZJY C;  1RTO A;  3OW2 A;  1Q82 C;  4F87 A;  1BUV T;  1Q7Y C;  3ERS X;  2CQO A;  1S3O A;  3KBX A;  2JA5 B;  1ML0 D;  1EUJ A;  5LL6 X;  5I9P A;  3UDI A;  3GTJ H;  4U68 A;  3NSW A;  1WOC A;  5E7N A;  4Y52 H;  1S4Z A;  3J7A V;  5KGU A;  1VQ8 A;  4IN3 A;  4A3C H;  1O7I A;  1B9M A;  2NZ1 D;  1JJG A;  2NN6 I;  4IFD H;  3FDT A;  3H3V I;  1RCV D;  2KA7 A;  3T1H L;  4B08 A;  1I6H B;  3FMC A;  4BBR G;  1K8M A;  1CZW A;  2F0N A;  5IT9 c;  4FVM A;  1D5Z C;  4EX5 A;  3TP7 A;  1WFQ A;  2VQF L;  1GO3 E;  1Q12 A;  3H3V C;  2A68 D;  3HOY H;  3DEP A;  1JMC A;  3GTM H;  3UE1 A;  2F0W A;  3R3O A;  4HMJ A;  5C6A A;  2YU9 B;  3HOW G;  1SFO H;  2L5T A;  4C3J G;  3KDF A;  4PG3 A;  4CKE A;  1IYU A;  1MIU A;  1TKW B;  4HAE A;  1KXL A;  1ET9 A;  4IJH A;  5I2Y A;  5EPL A;  1T5X D;  2NVY B;  3I4M H;  1LTS D;  1I4R A;  2N49 A;  1HFG A;  5GAH C;  3A7A B;  1HZ9 A;  2CVR A;  1W6K A;  4FXG C;  2I0Q A;  2WFW A;  1U4R A;  4DV3 L;  3BVZ A;  2K50 A;  1PTO F;  3GO5 A;  1N33 Q;  2QDB A;  1FGB D;  2YTX A;  5C4H A;  2K05 A;  4JV5 L;  4RCO A;  2VY3 A;  2D2C C;  4OIJ A;  2Z6K A;  1M90 C;  4X64 Q;  3PO2 B;  4LUO A;  4JOI C;  2E2I B;  4POG A;  2K4K A;  4NB3 A;  1SNC A;  3GV3 A;  1QUQ A;  2EZV A;  2A68 C;  1I50 B;  2NVX H;  2ASB A;  4KHV A;  1MD2 D;  3PIP A;  4LF9 Q;  2TMP A;  1EY6 A;  2IL8 A;  2Z4I A;  4DR4 L;  4X3S A;  2B2Y A;  1VQI A;  1VF7 A;  2Y0S B;  3TME A;  1TWC B;  1AE2 A;  3M4O H;  1EEI D;  4DV5 L;  5KRU A;  4KKU A;  4JI1 L;  4DN4 M;  3S2D H;  4IPH A;  3CME A;  4X62 L;  1NR4 A;  4QUF A;  4Y7N B;  1K0R A;  1J9O A;  1NUC A;  1A8V A;  1V43 A;  4JI5 Q;  4TRD A;  2EE1 A;  1BBW A;  2PMZ B;  5EQ0 A;  4KY6 A;  2I5M X;  4A4I A;  2UU9 Q;  4B3S L;  3RZD B;  2B8F A;  2G9D A;  3T1Y L;  1SYC A;  4A93 G;  2DNE A;  2PNH A;  5C5M A;  4DR1 L;  2BCO A;  3OTO L;  3CC4 A;  2E74 C;  1FD7 D;  2F0G A;  5JJL A;  1XMO Q;  3OYY A;  3H0G H;  2MHV A;  3BDO A;  1TY2 A;  3HOY B;  2UXD Q;  1FVI A;  5LL6 S;  2F0H A;  5COY A;  2RQX A;  1J5E L;  4LUZ A;  5DNF A;  1WTH A;  3H6M A;  1SSO A;  3J80 i;  2CWA A;  4CDE C;  4DUY Q;  4OWW B;  3GTP H;  5M5X B;  4PV1 C;  1GM5 A;  1VS0 A;  3PIO 3;  5IGD A;  3HG9 A;  2Z9H A;  2KEE A;  1AW7 A;  3S1N H;  1MBY A;  4CJ2 C;  2R92 B;  4PNY A;  4LFC L;  1U4L A;  3KJO A;  2EJM A;  3HKZ E;  1CHQ D;  4LF7 L;  3PQI A;  2SNM A;  5CV6 A;  1I3Q H;  5FLX c;  1CHP D;  3HKZ G;  4DV6 Q;  3NQT A;  2JN4 A;  4KY5 A;  1ET6 A;  3PIO A;  3TZD A;  5BN3 A;  1KAA A;  3NPP A;  3CXC A;  1SYE A;  5J1Z A;  1XMQ L;  4P2C B;  3S15 H;  1SMY C;  1PLF A;  1ENA A;  3RLN A;  5LMN L;  1KDA A;  3HFZ B;  1Y14 B;  3TSS A;  4RH6 A;  3CCV A;  1PH6 A;  1WCM G;  5LMN W;  4FYD A;  1Q86 C;  1A3V A;  4LUV A;  1OXU A;  4DAM A;  5C0X G;  1PVO A;  2PO4 A;  1GVP A;  1D7Q A;  4DR6 Q;  4EQP A;  1MI2 A;  1V9P A;  2DNC A;  5CV5 A;  2M9V A;  4A3M G;  2YTY A;  3BZC A;  1W6J A;  1MSG A;  5IGC A;  1LAB A;  1HFN A;  3Q0A A;  1SE3 A;  3RUZ A;  1O7L A;  3DWQ A;  1X65 A;  1TWH H;  1G51 A;  3I7F A;  2KCC A;  2Z6B A;  3MXN A;  2BDO A;  1PXU A;  2JA7 B;  3S14 B;  3CHB D;  1HNZ Q;  4MNO A;  5IP9 H;  4YIJ A;  1SN8 A;  5FO8 B;  2NN6 H;  4YHH L;  3K58 A;  5FLM G;  2QEJ C;  4IOA A;  1VQM A;  1RIP A;  2NVQ H;  3SK5 A;  3OHX C;  1B9N A;  1HUM A;  4C3H G;  2K01 A;  3MZ5 A;  3IRB A;  4UDU C;  5LMU Q;  2N78 A;  4O0A A;  2R93 G;  5BN5 A;  1KAW A;  2WP8 J;  2NZO A;  4OWX B;  4JYA Q;  3NBH B;  4C1N I;  2JA8 H;  5IE8 A;  3OMC A;  3PO3 H;  5IGE A;  1JOO A;  4KLK A;  2F0P A;  1NE3 A;  3CP0 A;  1ESF A;  3MHB A;  1N33 L;  2IW3 A;  4M1U B;  1VQK A;  1LTI D;  3SK6 A;  5IWA Q;  3QWN A;  1YJ9 A;  4DK0 A;  1NY4 A;  2UXB Q;  2K6A A;  1XYI A;  3WOE A;  4WFN 3;  3BS1 A;  2LFN A;  4JCV E;  5BR8 L;  5DAU A;  4MTK A;  4C56 C;  2QW7 A;  1D1I A;  4LF9 L;  1PYS B;  3BDL A;  5JVG 3;  1EY8 A;  4OO1 I;  1CT1 D;  2VNU D;  4DUZ Q;  2K5W A;  1HA6 A;  3MEH A;  2A74 C;  1D5M C;  3NBI A;  4RKL A;  2Q2T A;  4NXM Q;  4E6I A;  1H9M A;  2CKZ B;  2RKS A;  4JI5 L;  1KHI A;  1SNQ A;  1HNX L;  5C44 B;  1PFB A;  4PMB A;  2UU9 L;  1VQJ A;  3KLR A;  5HUR A;  1GUO A;  4QY7 A;  1HRJ A;  3TP8 A;  2OTL A;  4KN4 C;  5IYC G;  3J80 L;  4N9T A;  1LT5 D;  1TWH B;  1WI5 A;  1LO5 D;  5F2D A;  1F2L A;  4PZ8 A;  3S2H H;  1RF2 D;  1EZ6 A;  2AQ3 B;  1YNX A;  1XWE A;  2JA5 G;  3NXW A;  2BA1 A;  2PW5 A;  2QF7 A;  3AFP A;  2EJG C;  3EN2 A;  4FO2 A;  2WKD A;  1D5X C;  4DUY L;  1RJT A;  3HS0 C;  2FMM A;  4DKA C;  2KED A;  2A6E D;  1JOK A;  4FF3 A;  1VQN A;  2NVQ B;  1FYC A;  1E2V A;  4NPS A;  4AYB B;  5JAV A;  5K36 H;  4KN7 C;  3ERO A;  2R7Z B;  1ESR A;  4CJ1 B;  2J7Z A;  1JE5 A;  2JQO A;  4DV6 L;  3AMU A;  1EL0 A;  1TU2 B;  2NTS A;  2ZJR A;  1EY5 A;  1LM0 A;  3WDN A;  3MVV A;  4IAL A;  2ZTE A;  4UAI A;  2HHH L;  4K5V A;  1LLR D;  5ELB A;  3TRZ A;  1Y1V H;  3M4Q A;  1WTX A;  1DZ1 A;  3KLS X;  2PQA A;  1Q3L A;  2DJG C;  3MA2 B;  1I5F A;  4ME3 A;  2PZU A;  3PUW A;  2E75 C;  5FJ8 H;  1JB3 A;  4JBJ A;  1VQE A;  1XXG A;  2ICI A;  3BJU A;  5D3D A;  3CCM A;  3K5L A;  4GKK Q;  2FFK B;  3F1Z A;  3A0J A;  4WJW A;  3K7U C;  1X3P A;  5IP7 G;  3M4Y A;  2DN8 A;  3NUC A;  1EY4 A;  1SNM A;  1SLJ A;  3PO2 G;  1GUS A;  3HOV B;  1QVC A;  5IYD H;  1EOT A;  5FO7 B;  2IJ0 A;  5JOB A;  4BWG B;  4XDX A;  1PYB A;  1X32 A;  1HNZ L;  1JIC A;  1TR5 A;  1CKO A;  2Y0S E;  5AJ3 Q;  2L15 A;  3GTK B;  5IYB H;  3Q24 A;  3S16 B;  1EY7 A;  4I7A A;  2Y0S G;  4DU9 A;  1V1P A;  1M4V A;  4WRD A;  2R7D A;  3K5N A;  1T9H A;  3AB9 A;  4BY1 B;  2BE5 C;  2EYF A;  4OON A;  4IPD A;  1BNZ A;  1A15 A;  5LMU L;  1EY0 A;  5M5Y H;  5E1F A;  1Y8N B;  2PW7 A;  4QF4 A;  4A3C G;  5CV8 A;  1IBK Q;  4A3B H;  4POF A;  5J39 A;  5C0X J;  1PFM A;  1LTA D;  3G48 A;  4CDF C;  1TS4 A;  5IOC A;  5IWA L;  4FNF A;  2CQA A;  2WII B;  4KY7 A;  1PH4 A;  2F3V A;  4XYQ A;  1PTO D;  3WOF A;  4GNX C;  3HOY G;  2JK8 A;  1RTN A;  5J3B A;  5ELF A;  1IKL A;  1EWH A;  2L12 A;  1DGS A;  1JWU D;  2HCI A;  5EKL A;  4BBS H;  5C3E B;  3CC2 A;  3NEL A;  4L5R C;  1XNR Q;  1BQQ T;  2R92 G;  4H44 C;  4HJ5 A;  2K5N A;  3NK9 A;  2V1C C;  3S17 B;  1QNU A;  5JEA G;  2UUC Q;  4LF5 Q;  3Q6S A;  4MHE A;  5ELN A;  2KHJ A;  4NXN Q;  4HCS A;  1B2T A;  3P7J A;  2A8V A;  2ZTD A;  3OOC A;  3OIQ A;  2K5H A;  4HED A;  4OO1 H;  2K04 A;  3EIV A;  4N9P A;  5EBC A;  1STE A;  3F2B A;  5IT9 L; 
#chains in the Genus database with same CATH homology
 4QL5 A;  3UE1 A;  1I94 Q;  2EXD A;  1K3R A;  3K0X A;  4XTC S;  3HOW G;  3KFU A;  4GN3 B;  4C2M H;  5IYD G;  1SFO H;  4UPA A;  2I5H A;  3HOZ G;  2H5X A;  1BVS A;  5C4X G;  1IZ6 A;  4JBM A;  3KDF A;  4PG3 A;  3GDE A;  1MIU A;  1E1T A;  5C44 H;  1KXL A;  5M5W H;  1EWI A;  2YYZ A;  3PUV A;  4IJH A;  4A3I G;  4JI3 Q;  4IJL A;  4BY7 H;  3U4Z A;  5IYB G;  1UE7 A;  3I4M H;  1XPU A;  1IBM Q;  2CFM A;  2MO1 A;  1SMX A;  2N49 A;  4P74 A;  5M3F H;  3RZO H;  1HNW L;  1X6O A;  2FXQ A;  5GAH C;  3FKI G;  2RCN A;  1HZ9 A;  4X6A H;  3LGJ A;  4J15 A;  1E1O A;  1M1K C;  2I0Q A;  4UY8 C;  2WFW A;  4BBR H;  4BA2 I;  3HKS A;  4DR6 L;  4DV3 L;  2VS1 A;  1KC8 C;  3KOJ A;  2QA4 A;  2K50 A;  4DR3 L;  3CPF A;  2E2J H;  3GO5 A;  2JA7 G;  1N33 Q;  2YTX A;  3RNU A;  4K0K Q;  4DV2 L;  4QJF A;  3L2P A;  1QZH A;  4HJ7 A;  4JV5 L;  4DV1 L;  1B7Y B;  2VY3 A;  3MXN B;  3PUZ A;  2Z6K A;  3I56 A;  4X64 Q;  1M90 C;  4LUO A;  2OQ0 A;  4JOI C;  4YCV A;  2ZM6 Q;  4POG A;  2HIX A;  1GKH A;  1X3F A;  3D0F A;  2K4K A;  3K7A H;  3CCE A;  3CCJ A;  1WCM H;  4NB3 A;  3H3V H;  5GAD C;  1QUQ A;  4TQU S;  4JI4 Q;  4X66 L;  2NVX H;  3AEV A;  2YTV A;  3UDF A;  4B3M Q;  3EBE A;  2ASB A;  1JT8 A;  2OQK A;  3W1G A;  4QGU A;  3PIP A;  4LF9 Q;  4A3L G;  4A93 G;  1XJV A;  2R7Z H;  4DR4 L;  1IBL Q;  1X56 A;  1VQI A;  2R7F A;  3MEF A;  1L1O A;  1AE2 A;  1BBU A;  1B8A A;  3M4O H;  4QQB X;  4DV5 L;  4GOP B;  2DGY A;  3CW2 C;  4JI1 L;  1P16 A;  1UE6 A;  5ELO A;  1XNQ Q;  3S2D H;  4IPH A;  4APV A;  3CME A;  4X62 L;  3RN5 A;  4X65 Q;  3RR5 A;  4JI2 Q;  1PH2 A;  4JI7 Q;  5JJI A;  1K0R A;  4PZ6 A;  2PMZ E;  4BBS G;  1YJW A;  1A8V A;  1V43 A;  4JI5 Q;  1BBW A;  2I5M X;  4A4I A;  4DR5 L;  2UU9 Q;  4B3S L;  1QVF A;  2LXJ A;  2RF4 A;  4JYA L;  2GVB A;  3T1Y L;  3KF6 B;  2VQE L;  2PNH A;  3CC4 A;  3CCL A;  4DR1 L;  4QIW E;  3OTO L;  3S1R H;  1YIJ A;  1IL2 A;  2Z0S A;  5FLM H;  4IFD G;  3E9H A;  2AMC B;  1SE8 A;  4YY3 Q;  3CC7 A;  1Q81 C;  2JEB I;  4PMW A;  5JJL A;  1VQL A;  1L1O C;  1AH9 A;  4WJ3 M;  1GD7 A;  1XMO Q;  3OYY A;  3L7Z C;  4C3H H;  2UUB L;  3H0G H;  1VQ5 A;  2UXB L;  4OO1 G;  1D8L A;  1N34 Q;  1X3G A;  4R4O A;  1FJG L;  1JJC B;  1PFS A;  2R93 H;  2UXD Q;  4WJ4 A;  2EQS A;  1FVI A;  1YIT A;  1J5E L;  4LUZ A;  3J80 i;  2CWA A;  2LXK A;  4DUY Q;  3CPW A;  4OWW B;  3GTP H;  3HOV H;  4MZ9 A;  1EIY B;  1GM5 A;  1VS0 A;  1EFW A;  4LNQ A;  1VCI A;  3T1H Q;  1TXY A;  3S1N H;  2JJQ A;  4LFC L;  1BKB A;  3ULJ A;  3KJO A;  4DUZ L;  5C44 G;  4LF6 Q;  3GD7 A;  3HKZ E;  3STB D;  1IXR A;  4LF7 L;  1ASZ A;  2VZA A;  1I3Q H;  1K73 C;  5FLX c;  3I4M G;  3M3Y H;  3GTK H;  3HKZ G;  4R4Q A;  4DV6 Q;  2Q2U A;  1IBK L;  5M3F G;  1CKN A;  4NXM L;  3E9I A;  3S16 H;  4B3R Q;  4XIG S;  3ER0 A;  2IHE A;  1CUK A;  1CKM A;  3PIO A;  1ASY A;  2E2H H;  3I4N H;  4AH6 A;  4BY1 H;  3M9B A;  3CXC A;  4A3B G;  1YJN A;  1XMQ L;  4JI0 Q;  3S15 H;  2AHO B;  4OX9 L;  2R6G A;  4OXP A;  4KI0 A;  3RLN A;  5LMN L;  1W2B A;  1PV4 A;  5EAY A;  3J81 c;  1QZG A;  2AWO A;  3HFZ B;  1Y14 B;  1NBW A;  2NN6 G;  3CCV A;  1PH6 A;  1WCM G;  5LMN W;  1Q86 C;  2K52 A;  1WYD A;  4DK6 C;  3CCQ A;  4B3T L;  1HNW Q;  4RG1 A;  4LUV A;  1OXU A;  4DAM A;  5C0X G;  2GVA A;  3AQQ A;  4LFB Q;  1PVO A;  5M3M H;  1S72 A;  1GVP A;  1D7Q A;  4UP7 A;  4DK3 C;  2E8G A;  4AIM A;  3NEN A;  2UUA L;  4DV3 Q;  3K8A A;  4KHZ A;  4IO9 A;  2K14 A;  1V9P A;  4A3M G;  4AYB G;  2ZTC A;  4DR3 Q;  2YTY A;  4P71 A;  3D31 A;  1SRO A;  3BZC A;  3ULP A;  2R7Z G;  4DV2 Q;  1G6P A;  3U50 C;  3H15 A;  2AKW B;  4DV4 L;  2OTJ A;  1K9M C;  1HR0 L;  1X65 A;  1TWH H;  1G51 A;  1UWV A;  3I7F A;  4NXN L;  1Z47 A;  3STB C;  4JG2 A;  1LUZ A;  4A3G G;  3RN2 A;  2F4V Q;  1MJC A;  2JA5 H;  1MKH A;  1HR0 W;  4GKJ L;  3U4V A;  5C3E H;  2JA9 A;  1HNZ Q;  2HIV A;  5JJK A;  3NEM A;  2B3G A;  4MNO A;  5IP9 H;  1KL9 A;  3S24 A;  4DV0 Q;  2PI2 A;  4HJA A;  3UDX A;  4C3I H;  2GN5 A;  3KLW A;  1SN8 A;  4DR4 Q;  1RL2 A;  3S17 H;  2YV5 A;  4YHH L;  5FLM G;  3M85 A;  2UXC L;  4IOA A;  5GQO A;  3CCU A;  4HIO A;  1Q46 A;  1VQM A;  1RIP A;  4GOP A;  1VQF A;  4X62 Q;  2D0O A;  2JA6 H;  2NVQ H;  3UDG A;  1SR3 A;  4A3M H;  3Q8D A;  3F2D A;  3H0G G;  1KIX A;  3IRB A;  1A0I A;  3JC6 6;  3CQZ H;  5LMU Q;  2N78 A;  3J81 j;  4O0A A;  2DUD A;  1IBM L;  2R93 G;  1KAW A;  2WP8 J;  2NZO A;  4OWX B;  4JYA Q;  3NBH B;  3JAM c;  2JA8 H;  3T1Y Q;  5IE8 A;  3PO3 H;  4GKK L;  2KCT A;  2AWN A;  2Q2H A;  3OTO Q;  4LF4 Q;  4LF8 Q;  3HOV G;  2YU9 H;  2UXC Q;  4A3G H;  3KF6 A;  2Z6K C;  4KLK A;  3ULL A;  3U58 A;  3PCO B;  1NE3 A;  1UE5 A;  3CP0 A;  3CMA A;  1N33 L;  4K0K L;  1VQK A;  1VQO A;  3CCS A;  1LYL A;  5IWA Q;  1YJ9 A;  1U0L A;  2K75 A;  3M7N A;  1NY4 A;  1H95 A;  2UXB Q;  4GLX A;  1FJG Q;  2ZM6 L;  4YCW A;  4A3F H;  4KHP Q;  2NVY H;  4JC0 A;  5JEA J;  2XTI A;  1CSQ A;  1KQS A;  4IOC A;  4JI4 L;  1JJ2 A;  2E5L Q;  4IFD I;  4JI6 Q;  4JCV E;  4R4I A;  5BR8 L;  2VL6 A;  1R9T H;  1C9O A;  3I4N G;  3FHW A;  4BY1 G;  4B3M L;  1YHB A;  3PUX A;  3CAM A;  2MNA A;  1KRS A;  4LF9 L;  5AJ3 L;  1PYS B;  4HIM A;  4L5T A;  3KJP A;  1IBL L;  5IY0 A;  3CD6 A;  4LFC Q;  4OO1 I;  2VNU D;  4DNI A;  4DUZ Q;  1N36 L;  3B6Y A;  5HGQ A;  4AQY L;  4JI8 Q;  1E3P A;  1J6Q A;  2ZJQ A;  2MFI A;  2OCE A;  4A3D H;  4GNX B;  2B29 A;  4OWT B;  4P75 A;  4P73 A;  1XNQ L;  1K83 H;  4DPG A;  2Q2T A;  3CF5 A;  4X65 L;  3I55 A;  4JI2 L;  4NXM Q;  4JI7 L;  4DR7 Q;  4FDB A;  2CKZ B;  4A3K H;  4H02 A;  2EIF A;  1VQ9 A;  4JI5 L;  4GN4 B;  1KHI A;  1N9W A;  5M3M G;  1HNX L;  1B70 B;  1I50 H;  2KCM A;  3J80 c;  2IX1 A;  3PGZ A;  2UU9 L;  4DR2 Q;  1VQJ A;  1NJI C;  4JBK A;  4R4T A;  4QY7 A;  2K5V A;  3DLL A;  1Q1E A;  4R1J A;  3A5U A;  2OTL A;  4LFA Q;  2VQF Q;  3CCR A;  4BXX H;  5IYC G;  3A74 A;  5LMN Q;  1TWC H;  1WI5 A;  2MO0 A;  2NVT H;  4YY3 L;  1Y1W H;  2C35 B;  4PZ8 A;  4YWM A;  3S2H H;  1PH3 A;  2KBN A;  1PH9 A;  1E7Z A;  2ALY B;  3S1M H;  1YNX A;  4B3T Q;  1NMG A;  1VQG A;  2JA5 G;  2B63 H;  4Y7N H;  1OXS C;  2BA1 A;  1W3S A;  5C3E G;  1N34 L;  4A3E G;  1HJP A;  1VQB A;  4HJ8 A;  1YBY A;  2UUA Q;  5IP9 G;  3TQY A;  3AFP A;  1VQD A;  3EN2 A;  2JEA I;  3RZD H;  1S40 A;  1JB7 A;  4P72 A;  3UE0 A;  4DUY L;  2BH2 A;  5FJ8 G;  1VQ4 A;  3HOX H;  1C7Y A;  4LWC A;  4DKA C;  2ES2 A;  2RHQ B;  1HR0 Q;  4A75 A;  1VQP A;  1K8G A;  4AYB E;  1VQN A;  1G29 1;  3J7Z C;  5C0X I;  1XNR L;  4JBW A;  3BZK A;  3PUY A;  4NPS A;  4LF6 L;  3J81 i;  2JA6 G;  4GS3 A;  3G6E A;  3GTQ H;  3PF5 A;  3WWV A;  2WB1 E;  1HH2 P;  1TWG H;  1N32 L;  1JE5 A;  1WJJ A;  2JQO A;  4DV6 L;  4JV5 Q;  5IYC H;  2UUC L;  3BU2 A;  4LF5 L;  2WB1 G;  4L5Q A;  3KYH C;  1EQQ A;  2A1A A;  3K80 C;  4B3R L;  4DV1 Q;  3PSI A;  3GTL H;  2ZJR A;  1LM0 A;  2JA8 G;  2VUM G;  3PO3 G;  1X54 A;  2XGT A;  3G71 A;  2N8N A;  2ZTE A;  2HHH L;  1CSP A;  2Q2I A;  3F8T A;  1P8L A;  4YHH Q;  5M5X H;  1HZB A;  1VQC A;  1OXV A;  3TRZ A;  1Y1V H;  3M4Q A;  3GTO H;  4X66 Q;  1HZA A;  4DV7 L;  1YHQ A;  1XTD A;  4EQ5 A;  4A3E H;  2ZJP A;  4JI0 L;  2PQA A;  3AFQ A;  3K81 C;  4JOI A;  1X55 A;  3PV0 A;  2R92 H;  1A62 A;  2IX0 A;  1IYJ B;  1I5F A;  4ME3 A;  3A5Z B;  1PH1 A;  1LTL A;  1PH5 A;  1I94 L;  4YCU A;  3PUW A;  4A3F G;  1Z9F A;  5FJ8 H;  4HID A;  1PH8 A;  3KDF B;  4GN5 A;  1VQE A;  4JBJ A;  3KF8 B;  3TEH B;  3TS0 A;  3BJU A;  4IFD J;  4DV5 Q;  2PQA B;  3CCM A;  4JI1 Q;  4LFB L;  2I5L X;  3VDY A;  3TS2 A;  4GKK Q;  1UE1 A;  3F1Z A;  2BH8 A;  1I6H H;  4HJ9 A;  3A0J A;  1YEZ A;  1VQ6 A;  4JI3 L;  1TWF H;  1Q8K A;  1TWA H;  3K7U C;  2N3S A;  2D62 A;  1VQA A;  1FGU A;  1NTG A;  3J7A 5;  5IP7 G;  2F3I A;  5HY6 A;  4DR5 Q;  4B3S Q;  3HOU H;  4R4C A;  1PHJ A;  3HOZ H;  1VQH A;  5GRO A;  2QEX A;  3RLF A;  2VUM H;  1SLJ A;  4LW1 A;  3PO2 G;  1YZ6 A;  4A3D G;  2VQE Q;  2BA0 A;  1FL0 A;  1QVC A;  4DR1 Q;  3HOW H;  3ICE A;  1PH7 A;  1YVC A;  1K8A C;  5IYD H;  2F4V L;  2RHS B;  4GLV B;  3G4S A;  5C4X H;  2PI2 E;  4A3K G;  1C0A A;  1E24 A;  4C3J H;  1PYB A;  5BR8 Q;  1NMF A;  1L0W A;  1HNZ L;  4UP8 A;  1EIF A;  4DV0 L;  3JAM i;  4A3I H;  2UUB Q;  1CKO A;  5DLQ E;  2Y0S E;  5AJ3 Q;  2L15 A;  4X64 L;  4GOP C;  4A3J G;  3E0E A;  1X9N A;  5IYB H;  4L5S A;  1QUQ B;  4BXX G;  1N36 Q;  2IT1 A;  2MQH A;  2Y0S G;  4IPC A;  4AQY Q;  3M4P A;  4DR6 Q;  1OXT A;  2R7D A;  1J5E Q;  1T9H A;  4IPG A;  3FKI H;  1Y1W G;  3GTG H;  3F2C A;  2OWO A;  2IY5 B;  4GLA C;  4A76 A;  2VW9 A;  4GNX A;  3S1Q H;  4OON A;  2B63 G;  4IPD A;  2JA7 H;  1KD1 C;  1Q1B A;  1L1O B;  5LMU L;  1HNX Q;  3RLO A;  1PA6 A;  3S14 H;  5M5Y H;  4ALP A;  5IP7 H;  1XPR A;  1A63 A;  2HT1 A;  1YHA A;  4LF7 Q;  3W1B A;  3PO2 H;  2ATW A;  2E2I H;  1EQR A;  3I2Z A;  3HOX G;  4LF4 L;  4BA1 I;  1IBK Q;  4LF8 L;  4A3B H;  4A3C G;  1UEB A;  3AYH B;  5GAG C;  2NZH A;  3SGI A;  2LSS A;  4POF A;  1U5K A;  5C0X J;  3PF4 A;  2F52 A;  2KHI A;  5K36 G;  3G48 A;  3TRE A;  1HZC A;  3FP9 A;  5IWA L;  1AE3 A;  2A19 A;  3L0O A;  4A3L H;  2JE6 I;  1XMQ Q;  1PH4 A;  4A3J H;  4KHP L;  4OX9 Q;  4GNX C;  2CWP A;  2ID0 A;  2JK8 A;  3ZJY C;  1E22 A;  1V1Q A;  3OW2 A;  1Q82 C;  5J3B A;  3HOY G;  1QVG A;  2E5L L;  4JI6 L;  1L2F A;  1XPO A;  3ERS X;  1DGS A;  2CQO A;  1Q7Y C;  1S3O A;  4DAY B;  5C4J H;  1XMO L;  4BBS H;  1EUJ A;  1Y1V G;  3UDI A;  3GTJ H;  3CC2 A;  3NEL A;  4L5R C;  1XNR Q;  1WOC A;  1KRT A;  1EYG A;  2R92 G;  2UXD L;  5E7N A;  4HJ5 A;  4Y52 H;  2KEN A;  1MJE A;  5GAE C;  2WAQ E;  2K5N A;  3I4O A;  4TVA B;  1EOV A;  4JI8 L;  4BY7 G;  2V1C C;  2IHF A;  2HQL A;  4UP9 A;  4HIK A;  1N8R C;  1VQ8 A;  4A93 H;  4YWK A;  1N32 Q;  2WAQ G;  5JEA G;  2UUC Q;  4LF5 Q;  4A3C H;  1O7I A;  4YWL A;  4DR7 L;  4DV4 Q;  1JJG A;  2NN6 I;  4RMF A;  3H3V I;  5ELN A;  2KHJ A;  1OTC A;  3DM3 A;  4NXN Q;  3T1H L;  2A8V A;  5H1S E;  4BBR G;  1VQ7 A;  1SRU A;  2ZTD A;  2HHH Q;  2K5H A;  4DR2 L;  4PZ7 A;  5IT9 c;  4O2D A;  4GKJ Q;  4EX5 A;  1CKN B;  4DV7 Q;  1YI2 A;  1WFQ A;  4LFA L;  2D0P A;  2VQF L;  1GO3 E;  4MTN A;  3HOU G;  1Q12 A;  1X3E A;  1OXX K;  2QGQ A;  3EIV A;  3HOY H;  1JMC A;  2CCZ A;  3F2B A;  3W5O A;  3GTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...