4LF8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8Q00
5LMUQ 5J3BA 4A3BH 1QZHA 4LUVA 2Z6KC 3I4NH 3HOVG 1W2BA 2VZAA 4YY3Q 1SFOH 2YV5A 1XNRQ 4OXPA 3M85A 1QVCA 4LF9Q 2F4VL 2MQHA 1K8AC 1JE5A 2GN5A 4A3GH 4DV4Q 1VQ6A 3CCQA 1PYBA 4DV1L 4DR3L 3J81j 1B7YB 5C3EG 3CXCA 5LMNL 2R7DA 1VQAA 3CC4A 1HNWL 1HZ9A 4OO1I 1N32Q 1B70B 1L0WA 3D31A 4X66L 1G291 1I5FA 1ASZA 2F4VQ 1TWCH 1CSPA 3T1YL 4DV1Q 4DR3Q 3S1MH 4JI2L 1VQ5A 1PHJA 3UDXA 4X65L 1K0RA 1X3GA 5LMNQ 1KAWA 3RZDH 1PH7A 3TRZA 4QQBX 1HNWQ 1NMFA 3PO2H 5C44G 1QVFA 3RN5A 3J80c 1Q81C 1C9OA 1SN8A 3PIPA 2R93G 3UE0A 2D0OA 3GDEA 4K0KQ 4IJHA 3T1YQ 1HZBA 1VQBA 2LSSA 2NVYH 4JBWA 4JI2Q 3F2CA 1XMOL 1MJEA 2UUBQ 4X65Q 1PH3A 2I0QA 2R7FA 2A1AA 3KJOA 3EIVA 3ZJYC 4LF5Q 3I7FA 4OWWB 1X3EA 4IFDJ 2NN6G 4DR4L 3OW2A 2AMCB 1J6QA 1X56A 2WAQE 3PIOA 1QVGA 1WCMH 3FKIG 1CUKA 2L15A 4UPAA 4HJ9A 1XMOQ 3K80C 2MNAA 1SRUA 2R92G 1WJJA 2Q2UA 4X6AH 2N49A 4DR4Q 4QL5A 1CKNA 3KOJA 1P8LA 1DGSA 4DV6L 4GN4B 4R1JA 3W5OA 3CCJA 3CCMA 1VQPA 1N33L 2HHHL 4GKJL 1FGUA 3S2HH 1D7QA 4MZ9A 5E7NA 1PVOA 4BBSH 2AWOA 5BR8Q 1Y1WH 1JT8A 1S72A 2XGTA 1E1TA 1LTLA 2IX1A 2ES2A 1YHBA 5AJ3L 4OWTB 5GAEC 1S40A 2A19A 3FHWA 5GROA 2ZJRA 5M3FH 1VQIA 2A8VA 3STBC 1N33Q 2HHHQ 1EOVA 3AFQA 4GKJQ 1IBKL 5IYCH 3CCEA 4A3LG 2NVTH 3H0GG 5FJ8G 2CKZB 4X62Q 5ELNA 1E7ZA 1KHIA 2LXKA 3A0JA 1E3PA 4BA1I 5AJ3Q 3HOVH 3G6EA 5JEAG 4IFDI 3W1GA 4GLXA 5GQOA 3PV0A 4KHZA 3W1BA 1UE7A 2ZM6L 1PH9A 1IBKQ 1IZ6A 3S1NH 1KXLA 3F8TA 4YHHL 1T9HA 2YTVA 2JE6I 1N36Q 5C3EH 4HJ5A 3U50C 1YI2A 4DR6Q 1NJIC 3PCOB 3HOXH 3HKSA 3S1QH 4L5TA 3RR5A 2CQOA 3M4QA 2JA9A 4JOIA 1OXTA 4LUOA 2ZM6Q 1X9NA 1PH1A 3F2BA 1Z9FA 2I5HA 1WYDA 1MIUA 1L1OA 3S14H 4LFBL 1UE6A 1WOCA 4JI1L 3AQQA 1SLJA 3K7AH 3ICEA 1YIJA 1NMGA 4JYAL 2UXBL 3UDFA 1LM0A 5C44H 4DR2Q 1BKBA 3MXNB 2WAQG 4GOPC 4HIKA 2MO1A 3AEVA 2R93H 4O0AA 5FLMG 1S3OA 4LFBQ 1M1KC 1VQKA 2K14A 4J15A 4LF6L 1FJGL 1QUQA 2JEBI 4GS3A 1Y14B 2Q2IA 4KHPL 4PZ6A 1CKMA 4JI1Q 1VCIA 2KBNA 2FXQA 5C4JH 4MTNA 1X3FA 3WWVA 2OTLA 4JYAQ 2UXBQ 1C7YA 1MJCA 3HFZB 3GTPH 1HJPA 1TXYA 5IT9c 2YYZA 4QY7A 4OX9L 2NVQH 4UP7A 4HJAA 3KF6B 2CCZA 2VQFQ 5K36G 4GKKQ 4OONA 2EQSA 2R7ZG 1XPUA 1UEBA 1YVCA 4JI3Q 2JEAI 2R92H 3KF8B 4A3DG 2UXCQ 1KQSA 3M7NA 1JJ2A 3GTLH 5C0XJ 1XNRL 4DK3C 1BVSA 3OTOL 3I55A 1I6HH 3E9IA 4LF9L 4NXNL 5IP7G 2K50A 2JA5G 3I56A 2VW9A 4DV4L 1Y1VG 4DUYL 1TWGH 3H3VI 4OWXB 4JI6L 2LXJA 4GNXA 1VQCA 1ASYA 1RIPA 4DNIA 1YEZA 3NELA 4TVAB 4A4IA 3G48A 3OTOQ 4A3EG 2Z6KA 3RLNA 2YU9H 2UUCQ 3GTGH 1N32L 1N9WA 4NXNQ 1HZAA 2WB1E 1VQ8A 3HKZE 1IBMQ 3K81C 3B6YA 4DUYQ 4OO1G 1A8VA 2C35B 2R6GA 1PH4A 3PUZA 4C3JH 3PUXA 3CMEA 4JI6Q 3PO3G 2AHOB 3H0GH 5FJ8H 4A3LH 1E24A 2N3SA 5DLQE 3PUWA 1GO3E 4JG2A 1FL0A 1YJWA 3ULPA 4K0KL 1GKHA 4RMFA 2UUBL 1YITA 1AE3A 2PQAB 1W3SA 4KI0A 3JAMi 1KL9A 2ID0A 3I2ZA 3UDGA 5EAYA 2DGYA 1Q86C 1HNZL 4LF5L 4XTCS 4IPHA 1VQGA 3KDFB 3CCLA 4LUZA 1I94L 3PSIA 4AYBE 1M90C 1KC8C 4C2MH 2IHEA 4DV3L 4P74A 5C0XI 3RNUA 1PH2A 2D0PA 3RLFA 1YHAA 5HGQA 1K3RA 4A3IG 5HY6A 2I5MX 4R4QA 4JI8L 1HNZQ 1EIYB 4LF8L 1PA6A 3EN2A 1JMCA 1I94Q 2E8GA 1UE5A 4IO9A 4A3KG 5ELOA 1VQLA 2JA8G 2ASBA 5IYDG 1YZ6A 4A76A 4DV3Q 4DR5Q 1KIXA 4UY8C 3PUYA 4APVA 2VUMG 1RL2A 4IJLA 1XTDA 4PG3A 4PZ7A 1EQQA 1VQHA 4JI8Q 2E5LL 4LF8Q 5BR8L 5FLMH 3L2PA 2N8NA 2JQOA 2VS1A 1OTCA 3A5UA 3U4ZA 3HOWG 4WJ3M 2V1CC 2N78A 1U5KA 4A3CG 4FDBA 2JJQA 4DUZL 5IP9G 3ER0A 4LFAQ 1IBLL 2E5LQ 1V43A 4X62L 1TWHH 1A63A 3S16H 2IX0A 2R7ZH 1PFSA 3U4VA 5LMNW 3CF5A 4BY7G 3S15H 1EUJA 4A3DH 2BA1A 1EWIA 4B3SL 3BZKA 3OYYA 2QA4A 1IXRA 1YJ9A 2ATWA 2HQLA 4DUZQ 1SE8A 4IFDG 2OQ0A 1IBLQ 4KLKA 1XPRA 1K83H 2WB1G 3RZOH 5IP7H 1SR3A 2K5HA 3HKZG 2JA5H 2QEXA 1N36L 2K52A 3GTMH 1JJGA 3D0FA 1Q1EA 1K73C 3GTOH 4DR6L 3AYHB 4B3SQ 3CC2A 1PH8A 4BA2I 4JV5L 1EIFA 4A75A 1B8AA 4A3EH 3SGIA 5M5XH 1UWVA 1E22A 3GO5A 5C4XG 4QIWE 3GTJH 5M5WH 4JBJA 2B63G 3M4PA 1X6OA 4P73A 3PO3H 4BXXH 3J7ZC 1WFQA 1IYJB 2CWAA 1GVPA 3JAMc 3HOZG 4A93G 4DR2L 2YTYA 4AYBG 4C3HH 4B3TQ 2E2JH 2JA6G 1E1OA 1VS0A 4JBKA 4IPGA 3CPWA 1I50H 3UDIA 2RHSB 3HOUG 1QZGA 4BXXG 2K5NA 2RHQB 3VDYA 3I4MG 3M4OH 2VQEL 4DV5Q 3CC7A 2KCTA 4JI7Q 3STBD 2EXDA 3G4SA 4JI0Q 3BJUA 2HT1A 4WJ4A 4IPCA 4DR7L 1Z47A 4MNOA 2Q2HA 4AIMA 2VQFL 4GKKL 1V9PA 4RG1A 4JI3L 5GAGC 3PF5A 3FP9A 1N34L 3G71A 4GOPA 4BY1G 2UXCL 1L2FA 2VQEQ 3U58A 4Y52H 2PNHA 3M9BA 1O7IA 3J81i 2JA8H 4A3KH 1YBYA 4JI5L 2XTIA 5IYDH 3FKIH 1MKHA 2VUMH 4DR7Q 2IHFA 3CD6A 1OXSC 1YJNA 1VQ7A 3ERSX 3IRBA 1N34Q 3TQYA 1YHQA 2VY3A 4DAYB 1JB7A 5FLXc 3S2DH 3H15A 1HZCA 4YWLA 4JI4L 4JI5Q 4BBRG 2UUCL 3HOWH 3JC66 3NEMA 2B29A 1IBML 1R9TH 4A3CH 5IYBG 2OTJA 4R4IA 5IP9H 5JJIA 2IY5B 2HIXA 3ULJA 1H95A 5M3MG 3J7A5 4LF7L 1EYGA 4JI4Q 4GN3B 4BY7H 3MEFA 4NB3A 3RLOA 2OCEA 1V1QA 1HR0W 1XJVA 4L5SA 2ZJPA 1VQJA 3CCUA 4A93H 1I3QH 4R4OA 2K75A 3TS0A 4LF7Q 3PF4A 3KF6A 2UUAL 1XMQQ 4LWCA 1X54A 3CPFA 1PH5A 2VL6A 1PYSB 2AWNA 2ALYB 4POGA 4HJ7A 4O2DA 4Y7NH 4C3IH 5C4XH 5C0XG 3DM3A 2Z0SA 2IT1A 3GTKH 1NE3A 2B63H 3T1HQ 3F2DA 4JV5Q 2UUAQ 4X66Q 4L5QA 4YCVA 1JJCB 3E0EA 3L0OA 3CMAA 2DUDA 4DR5L 4A3MG 1GM5A 4HJ8A 3HOZH 2Y0SE 2KHJA 4NXML 3CW2C 3CCVA 1K9MC 2NZOA 1Q46A 3HOXG 2JA6H 2BH2A 4YCWA 5JJKA 4R4TA 3HOUH 3BU2A 2GVAA 1D8LA 1N8RC 4A3FG 1Q7YC 3I4MH 4HIOA 1CKNB 2KENA 4DV0L 2JA7G 1C0AA 3A74A 2OWOA 5IY0A 4NXMQ 4LFAL 2WP8J 2MFIA 3J81c 4GLVB 2VNUD 2BA0A 3NENA 3A5ZB 4DV7L 3KYHC 2PQAA 1VQDA 4AQYL 1VQNA 1GD7A 4BY1H 1AH9A 4DV0Q 4LF4L 4LFCL 1VQEA 1YNXA 3KDFA 2I5LX 1TWAH 4LW1A 1NBWA 4R4CA 4B3RL 4ALPA 5M5YH 1BBUA 1CSQA 1KRSA 1Q12A 3GD7A 2Q2TA 3I4OA 4JC0A 5GAHC 4A3JG 4DV7Q 3M3YH 3S17H 3ULLA 4AQYQ 4IOAA 4AH6A 4TQUS 4X64L 5JEAJ 3H3VH 4LF4Q 4LFCQ 2F52A 2CFMA 2NN6I 4GN5A 3L7ZC 3CQZH 3UE1A 4LNQA 3KJPA 1VQMA 2K5VA 3S1RH 4BBRH 1EFWA 4B3ML 4B3RQ 2CWPA 4XIGS 3HOYG 1Y1VH 3K0XA 3NBHB 5IYBH 4DR1L 5IWAL 1PH6A 2D62A 1XNQL 5JJLA 2PI2E 3TEHB 5M3MH 4X64Q 4A3BG 3I4NG 2UU9L 4EQ5A 2PI2A 1VQ9A 4B3TL 4HIDA 4B3MQ 3E9HA 1VQOA 2HIVA 1PV4A 1LYLA 1CKOA 1LUZA 2ZTDA 3TS2A 2ZTEA 3KLWA 1J5EL 2KHIA 2F3IA 2KCMA 1VQ4A 4POFA 4GLAC 5IWAQ 4DR1Q 1BBWA 1XNQQ 4DV6Q 4A3GG 1L1OB 4DKAC 1OXVA 4DV5L 2E2IH 2EIFA 2UU9Q 4JI7L 4DV2L 3GTQH 3F1ZA 1FVIA 3TREA 4P71A 2BH8A 4EX5A 3DLLA 4JI0L 1OXUA 4JBMA 2NZHA 4NPSA 2Y0SG 3BZCA 1J5EQ 2UXDL 2AKWB 4PMWA 3RN2A 4YCUA 1KD1C 1A0IA 1G6PA 1TWFH 1QUQB 2GVBA 3LGJA 1G51A 1SMXA 4DV2Q 4GOPB 3EBEA 4YWKA 1UE1A 3Q8DA 4HIMA 2E2HH 4A3MH 3PO2G 4JOIC 3CCSA 2UXDQ 4A3IH 1AE2A 2QGQA 1HR0L 1L1OC 3AFPA 2B3GA 1IL2A 1NTGA 1WI5A 1EQRA 2NVXH 3J80i 5GADC 4A3FH 1Q82C 1HNXL 1NY4A 4YHHQ 3CP0A 2JA7H 4DPGA 4IOCA 1X55A 3PGZA 1WCMG 4UP8A 4DK6C 4UP9A 1HR0Q 3KFUA 1VQFA 5IE8A 4QGUA 4GNXB 4P72A 2ZJQA 1HNXQ 3CCRA 4JCVE 2RCNA 3K7UC 4DAMA 2PMZE 2YTXA 1K8GA 3CAMA 1KRTA 4P75A 4IPDA 3PUVA 5H1SE 4QJFA 1U0LA 1XPOA 1Q8KA 2JK8A 4A3JH 1XMQL 4L5RC 4PZ8A 4BBSG 3K8AA 1Y1WG 1Q1BA 2OQKA 4YWMA 1SROA 5LMUL 2MO0A 1OXXK 1HH2P 1FJGQ 2K4KA 4LF6Q 4ME3A 4YY3L 4KHPQ 2WFWA 4H02A 1P16A 5M3FG 1A62A 3HOYH 1X65A 3S24A 3T1HL 2RF4A 5IYCG 2H5XA 2ZTCA 4OX9Q 4GNXC
chains in the Genus database with same CATH superfamily
4C1NI 5KRUA 1D2BA 4A3BH 5E1FA 1AN8A 1WTHA 4YY3Q 1ET6A 3GP7A 1BXTA 2JSOA 3QWNA 4OXPA 5IGCA 4EQNA 4LF9Q 2Z1CA 2MQHA 3NWSA 2GN5A 1VQ6A 2B2YC 1PYBA 3J81E 1B7YB 5D3DA 3J80E 5LMNL 2R7DA 4I7ZC 1VQAA 3CC4A 2KECA 2XN9C 1CSPA 1QNKA 1BCPB 3NK9A 3S1MH 4KY6A 1X3QA 1ZYRD 4K2LA 5LMNQ 4QQBX 1KAWA 3RZDH 1PDQA 3M4YA 5C44G 1QVFA 3K5LA 3RN5A 2Z8LA 1C48A 1C9OA 2NTTA 3UE0A 2D0OA 2PZTA 1XMOL 2J0TD 1BF4A 1H9SB 1PH3A 2B8FA 3A8IE 2NN6G 4DR4L 2EYOA 1LTSD 2AMCB 3GTMB 1EWCA 1SMYC 1I4QA 1EY4A 4HJ9A 1XMOQ 2I07B 4L6TB 4WFN3 5M5XB 2Q2UA 4NDXA 4DR4Q 3GTJB 2CH4A 3A8KE 3W5OA 1W6JA 2Z4HA 5D3IB 2HHHL 2AUKA 2NWGA 2K03A 1Y1WH 1JE4A 1STEA 1E1TA 1LTLA 2X69A 1I50B 4DA2A 2F3VA 3SEBA 4L63B 5GROA 4IUUA 2HHHQ 5FO8B 1JOOA 2CKZB 4X62Q 2BDNA 1U4MA 1E7ZA 1KHIA 1EOTA 5C5MA 3HOVH 5FOBB 1IW7C 1FYCA 3G6EA 4X3SA 4A3IB 4CJ0B 4KHZA 5JAVA 2ZM6L 3BVZA 1IZ6A 1KXLA 1EZ6A 4YHHL 2YTVA 1IKMA 2JE6I 1N36Q 1SXTA 3TZUA 3VA5A 2EYLA 4DR6Q 3PIP3 2WKDA 3HKSA 3T51B 1DM0B 3S1QH 4WJWA 2ZM6Q 1PH1A 1X9NA 3PMFA 4DK1A 1Z9FA 5CV8A 3J80L 1KDAA 3PIO3 2IW3A 2XSCA 1B44D 3CU7A 1SYCA 1D1IA 5EJWA 4BY7B 4DF7A 5FLMG 1ESRA 1S3OA 1M1KC 5C5LA 2K14A 3FRPB 1MSGA 3ZYYX 2M2LA 3WWVA 1C7YA 1HJPA 2D2CC 4QY7A 1MGSA 4HJAA 5K36G 4GKKQ 4OONA 2EQSA 1UEBA 2R92H 3KF8B 4KN7C 3E0JA 1XNRL 1BVSA 3DM1A 1I6HH 2E76C 2VXWA 4FO2A 2VW9A 1UAPA 4PNYA 1TQOA 2E2DC 3HOZB 3MZ5A 4GNXA 1VQCA 2L4NA 3SK6A 1ASYA 1RF2D 1RIPA 2JP1A 1N32L 3V96A 2UUCQ 3T53B 1UUPA 3NE5B 4OO1G 4C3JH 3CMEA 2AHOB 2IL8A 3FEWX 2B2YA 4R9WA 2NYZD 4JVZA 1KLGD 2N3SA 3PUWA 3GQBA 1GO3E 3ULPA 1WTWA 2EJFC 4K0KL 3JAMi 2KQ3A 3UDGA 1PZID 3KDFB 1NSNS 4HR7B 1A3TA 4ZLTF 3S17B 3H91A 5CGKA 1GUGA 4C2MH 1U4LA 1B53A 4DV3L 3M3YB 1O7LA 3E5SA 4HMJA 1PH2A 3RLFA 1D5XC 3DHQA 4A3IG 4JI8L 1PA6A 4BBRB 1D1KA 2F0FA 1UE5A 4IO9A 1SNMA 1E2ZA 1DONA 4DV3Q 1RTNA 4APVA 1RL2A 4JI8Q 5BR8L 1Y1WB 1VMCA 3OHXC 3OWEB 3NQTA 2JQOA 1PZKD 1PLFA 2N78A 1IKLA 3D6CA 1U5KA 2E2IB 3DMUA 4DUZL 4LFAQ 2LKVA 1A63A 3QIAA 2IX0A 2R7ZH 4BY7G 1PFMA 2BA1A 2CVRA 2F03A 2ZXRA 1XYIA 4RCOA 1HA6A 2QA4A 1IXRA 2EJGC 1YJ9A 2ATWA 2HQLA 4DUZQ 2PZUA 4H13C 2K5HA 2JA5H 4QUCA 4XQQA 2QEXA 2K52A 5J1ZA 4DNTB 1Q1EA 1TU2B 1G8ZD 3E6ZX 4X3UA 4H7BA 1EIFA 2NTSA 1B8AA 4A3EH 1EU4A 3KBGA 2GA4B 2DNEA 4RAUC 1CQVA 1X6OA 3NTKA 1LT3D 5IGEA 3HOZG 4B3TQ 4C3HH 2AUJD 1E1OA 1VS0A 3CPWA 2K32A 1QZGA 4KJOA 1A3VA 3M4OH 1YNNC 2PW7A 3E3XA 2EXDA 4KTAA 5IOCA 4IPCA 2VQFL 1PRTF 1Z7TA 4JI3L 3PF5A 5GAGC 2B2UC 3G71A 3QO2A 2PNHA 1O7IA 4NP5A 4JI5L 1I6HB 5IYDH 3FKIH 3DWAA 3CD6A 1A2UA 4S3SA 1ZEQX 2G9HD 2M9VA 1YHQA 4G4KA 2VY3A 3EFXD 4DAYB 5FLXc 3ITPA 4JI4L 4JI5Q 4BBRG 3O13A 1I4PA 4A3GB 1IBML 2RVLA 3AU7A 2OTJA 5IP9H 3ULJA 1SNQA 4JI4Q 4GN3B 4NB3A 4QB4A 4L5SA 4KKTA 3FVQA 1VQJA 2NZ1D 4OIJA 4IFDH 4A93H 3K57A 3A55A 3TN2A 4DU9A 3PO2B 1AP0A 4LWCA 1LTBD 1X54A 4N9PA 4CDDC 4POGA 2BDOA 4O2DA 2NVYB 1PTOH 4KJNA 4C3IH 1AZPA 1EEFD 2B63H 4CDEC 4X66Q 1Q8IA 4YCVA 4Q5VA 1NR4A 4G57A 1WCMB 3L0OA 3CMAA 4DR5L 1X32A 1PYWD 3HRZC 4NXML 2WAQB 5CV5A 2NUCA 5G3LD 2JA6H 1SYEA 1JWUD 2HCCA 4IUVA 1N8RC 1STBA 3I4MH 1SJHD 3MXGA 2EJMA 1CKNB 4DV0L 1JOKA 3TP8A 3T56B 2WINB 3A74A 4NXMQ 4IUNA 4CKCA 2BE5C 2MFIA 1CZWA 3Q22A 4DV7L 3KYHC 1VQDA 2ZXPA 3MEHA 4AQYL 1GD7A 1D5ZC 4IN3A 4DV0Q 3L3OC 1I4RA 1QG7A 5M3FB 1YNXA 3TBIB 4G7ZC 5JVG3 1E2WA 1CSQA 1SBBB 4V0BA 3T13A 4FF4A 3GD7A 1VF5C 5EBDA 4DV7Q 4AQYQ 4IOAA 4QF4A 3R93A 3H3VH 5FO9B 1U4PA 1H9JA 1VQMA 2K5VA 4A3EB 3LWEA 4ZKBB 2F0VA 3CHBD 4X3TA 1EY6A 2DY7A 2F0WA 3HOYG 1PH6A 3KK7A 1Y8NB 5IWAL 1E0BA 2PI2E 2AQ3B 5M3MH 2KHSA 2L9HA 2Z4IA 1PFNA 4C3HB 3K59A 1EY9A 1VQOA 2HIVA 1LUZA 1VQ4A 2F3IA 2KCMA 4GLAC 5IWAQ 1BBWA 4DV6Q 4A3GG 2LMCB 3K7AB 3FPPA 2K5DA 1KNEA 4R8IA 2TSSA 3U9OA 1TKWB 3A56A 5CV6A 3I72A 1OXUA 3I3CA 5E3FA 4NPSA 3BZCA 2F0UA 4PMWA 3RN2A 5C0XH 1VDZA 1A0IA 1TWFH 5C4JB 4G7HC 2L5TA 1G51A 1KAAA 4YWKA 2E2HH 3FKIB 4A3MH 3PO2G 1EZ8A 1CHQD 5T1GA 1HR0L 1RTOA 1L1OC 1XTCD 3GTLB 3TP7A 1NTGA 1RHPA 2NVXH 4DN4M 4A3FH 3SK8A 1H9MA 1M4VA 2B2UA 1HNXL 4RGNA 2JA7H 4DK6C 3PGZA 1WCMG 1LACA 1HR0Q 1V1PB 3C46A 1TR5A 3Q24A 3NQIA 3GTGB 4ME5A 1HNXQ 4DAMA 3D4WA 3K0YA 1TY2A 4A93B 3H0GB 2WB1B 4IPDA 5H1SE 4QJFA 1JB3A 5T1IA 4A3JH 4UAIA 4L5RC 1ENFA 3I4LA 2MO0A 2DNCA 3DXJC 1DOKA 3GV6A 1FJGQ 4KHPQ 2F0HA 3S9WA 4C3IB 1D5MC 5M3FG 2P5ZX 1X65A 3TSSA 5IYCG 4JV5L 1W6KA 5J3BA 4LUVA 2K01A 2VZAA 1AW7A 1TT2A 3M85A 1JE5A 5I9PA 1A2TA 4DV4Q 3CCQA 4DV1L 3MWYW 2QCPX 3N6RA 1MD2D 1B70B 1L0WA 3EROA 1HQRD 4DV1Q 2M00A 1TIID 1K0RA 4CDCC 2RKSA 4ODGA 2WKCA 3K5NA 3FMCA 3MAQA 3S16B 3J80c 1PFBA 3S15B 1ZKOA 4A3DB 1SE3A 2A5HA 1HZBA 2UUBQ 1B2TA 3V2TA 5IGDA 1JORA 2I0QA 2R7FA 1A6XA 3KJOA 3EIVA 4OWWB 4IFDJ 3I7FA 3RD4A 1FNWA 3OW2A 1QVGA 2WAQE 3FKIG 4RCNA 1NR2A 1CUKA 5M3MB 4UPAA 3K80C 1BCPC 5EPKA 5FK9C 1WJJA 1TVXA 2N49A 5C3XA 2OT2A 5IT9L 4QL5A 5M5WB 3KOJA 2LS01 1CM9A 1DGSA 4R1JA 3C3LA 2AQ1B 4MZ9A 1Y69U 1PVOA 4BBSH 1S72A 2XGTA 4H0LC 4JK1C 4CKBA 5GAEC 1YNJD 3FHWA 2A8VA 1VQIA 1TWFB 3STBC 3AFQA 3Q6SA 1IBKL 4A3LG 2QKIC 3H0GG 2NVTH 5FJ8G 4P2CB 1LV9A 4A3MB 2LXKA 3A0JA 1E3PA 3MC0B 4K5WA 5JEAG 1CQFA 4IFDI 2KCCA 1CTMA 5GQOA 3PV0A 1UE7A 1IBKQ 4F88A 5E4WC 3S1NH 3NBHA 4A3FB 2VUMB 4C56C 1STYA 4CJ1B 5C3EH 4HJ5A 1YI2A 1WTOA 5M9OA 2IPKD 4L5TA 2CQOA 3M4QA 4EVOA 1FNUA 1NAPA 3HOWB 1L1OA 3S14H 1R9TB 1SLJA 2WV6D 4JYAL 3BVMA 2BCOA 4DR2Q 1BKBA 3MXNB 4GOPC 2HUGA 3P1HA 2R93H 4O0AA 4LF6L 2JEBI 4GS3A 2Q2IA 4PZ6A 4JYAQ 4MTNA 3D4RA 2OTLA 1EY0A 1TS3A 3HFZB 1LT4D 4DFAA 1TXYA 4OX9L 1SNCA 4UP7A 3KF6B 2CCZA 5KNCA 2NBFA 1XPUA 2UXCQ 4A3DG 4Y7NB 1WTXA 2TMPA 3SDZA 1JJ2A 5C0XJ 1I6VC 4KMUC 5DM73 4LF9L 2FMMA 4DUYL 3H3VI 3R2TA 4OWXB 4JI6L 4DNIA 4DAVA 4TVAB 3HOUB 1K0SA 1B1ZA 1N9WA 2WB1E 3OMGA 1GUWA 1VQ8A 4I7AA 3HKZE 5ELCA 4DUYQ 1A8VA 2C35B 2A69C 3PUZA 1PH4A 4JI6Q 4BXXG 2H1EA 3AB9A 1CHPD 2O5JC 1S4ZA 1GKHA 4IUQA 1I4XA 1YITA 2PQAB 2ID0A 3I2ZA 3EA6A 5EAYA 1TWAB 2DGYA 1Q86C 1SE4A 4IPHA 1VQGA 4M8AA 1JWMD 1JWSD 4AYBE 1RDPD 3KUPA 5L37A 4QUFA 2IHEA 1O78A 2G5DA 4LMQD 5C0XI 1NCVA 2D0PA 1MBYA 2I5MX 2F0TA 4R4QA 4HEDA 3S1RB 1PTOF 1JMCA 3Q0AA 2PW5A 4A3KG 1VQLA 5ELOA 2ASBA 3TMEA 1KIXA 1BBXC 2VUMG 2FHTA 4PMBA 1DZ1A 4IJLA 3ONAB 4PZ7A 5E4XA 1NUCA 3KLSX 1EQQA 1VQHA 3TZDA 2B2WC 2ICEC 2A6HD 4BBSB 4F7XA 3L2PA 5KYIA 5JJZA 3A5UA 2EDGA 1A15A 5A35A 3HOWG 1LTTD 4WJ3M 2V1CC 4A3CG 3GTQB 3TDQA 4HMIA 1IBLL 1V43A 4X62L 1PRTB 1SYGA 1EFID 3RUZA 3CF5A 5LMNW 1H9SA 4B3SL 1DYQA 3OYYA 2L0CA 4FF2A 1IBLQ 4KLKA 1XPRA 5DNFA 3S1NB 5IP7H 3JAME 1JJGA 1N36L 2EY5A 3D0FA 1K73C 3OPOA 5A2QL 3GTOH 4DR6L 2D9UA 4B3SQ 1PH8A 2RSOA 2F0GA 1BOSA 2KJXA 1DOLA 1MSHA 3DWPA 4KY7A 3M4PA 2N55A 3PO3H 3J7ZC 4WRDA 1WFQA 1IYJB 3QR8A 1GVPA 3CRKC 3HS0C 5ISRA 3OMCA 4EQOA 4JBKA 4KK7A 5CV7A 1AZQA 1G6ZA 3HOUG 1EY8A 2KVMA 2RHSB 4HSPA 2F4IA 2K5NA 3VDYA 4PQXA 4DV5Q 4XDXA 4JI7Q 1ICFB 3GV3A 4FF3A 4GKKL 3QG1A 2ENBA 4O1NA 4GOPA 4Y52H 3M9BA 3J81i 2JA8H 1H9RA 2XTIA 4A3BB 1OXSC 3ERSX 4J6HA 1EIHA 1C4QA 1JB7A 1LTRD 3S2DH 5CR3A 5I9OA 2UUCL 5EKIA 3JC66 5BN3A 3NEMA 2B8GA 5IYBG 1EYDA 5JJIA 1HXYD 1LT6D 2HIXA 1H95A 5BN5A 1JQYD 1F2YA 1YNND 1EYGA 2OCEA 1ZYRC 4EGVA 3S1MB 4XYQA 1HRJA 4R4OA 2K75A 3RZDB 1XMQQ 2B2TC 2RBMA 2VL6A 5C4HA 4ID6A 2AWNA 2ALYB 3I8ZA 3KF8A 4HJ7A 3OW7A 2WACA 1FR3A 5EGTA 5C4XH 5G3LF 3JAML 3QJYA 1IHZA 1ML0D 3T1HQ 3F2DA 2F1MA 1XX8A 2OEOA 3VR2A 3E0EA 2DUDA 5NUCA 4BWGB 3T16A 2KHJA 1HTLD 3CCVA 2NZOA 3G6JB 1K9MC 2BH2A 4YCWA 3VYUA 5JJKA 4R4TA 3BU2A 3BDOA 5IY0A 1WVLA 4LFAL 2WP8J 2AQ2B 1PTOD 1F9SA 1KDCA 2BA0A 4DNRB 2DJFC 3LNNA 3F2UA 1C8CA 2B2WA 4BY1H 3R2IA 1B9MA 3KDFA 1NBWA 4B3RL 4FXDA 4ALPA 3DUZA 1BBUA 4HAEA 3J7AV 2Q2TA 3I4OA 3HOVB 3GTOB 4AH6A 4X64L 3I73A 4GN5A 4K6LA 3L7ZC 3CQZH 4LNQA 4B3RQ 1EFWA 4B3ML 3D4DA 3P75A 3CRLC 3C2PA 2CWPA 1SYDA 2A68C 1O80A 4DXGA 4XQNA 3K0XA 5D14A 5JJLA 1XNQL 4LJZC 4X64Q 4A3BG 4ZUJA 5J22A 4EQ5A 2PI2A 3S1QB 2I46A 4B3TL 4B3MQ 3E9HA 1PV4A 1LYLA 1CKOA 1U4RA 2BE5D 3X3NA 3D8GA 2ZTEA 2F0OA 3KLWA 2KHIA 3C1FA 1XNQQ 4DKAC 4IZ8A 4EX5A 2BH8A 3MA2B 1LTID 2EYFA 1SNPA 4FYDA 2A73B 1QUQB 3LGJA 1Y8OB 1UE1A 3Q8DA 1B3AA 4RGTA 5HGTA 5DAUA 3CCSA 1AE2A 1PXUA 3P20A 2R92B 2QGQA 3M7GA 2QEJC 3DEOA 1IL2A 3ND9A 1WI5A 1MHWC 1EQRA 1Q82C 5I6WA 2K6AA 4DPGA 4IOCA 1X55A 4IUTA 4MIUA 1OO9B 1HQMC 4QGUA 1HHVA 1UEAB 1QCBD 3CCRA 4JCVE 4WORA 1KABA 3BVGA 3CAMA 1RCVD 4C3JB 3PUVA 1EIGA 1Q8KA 2J4XA 4IURA 4I65A 1Y1WG 4E6IA 5LMUL 5HURA 1SROA 4KN4C 1AFPA 4LAAA 4H02A 1EYAA 3A7LA 2H5XA 2HD3A 4X66L 1E2VA 4C2MB 5LMUQ 1QZHA 2Z6KC 4DAYA 3I4NH 3HOVG 3VR4A 1LTGD 1W2BA 2B2TA 2YV5A 2PCFB 2QDBA 1QVCA 4N9TA 3K6OA 2EE1A 2F4VL 1K8AC 4DR3L 3K5OA 3J81j 3NSWA 1HZ9A 1QNUA 1I5FA 2B39A 1ASZA 2F4VQ 1TWCH 3MVVA 1B50A 3UI2A 4DR3Q 1WTPA 4C1NK 4RGMA 1PHJA 4JI2L 2JXMB 5COYA 4X65L 1X3GA 1PH7A 5CV4A 1NMFA 3BG3A 4U68A 1Q81C 2R7ZB 3GDEA 1RD9D 1L0XB 4IJHA 3F2CA 4JI2Q 1MJEA 2HDLA 4X65Q 2X6GA 4Z9CB 4LF5Q 4RGOS 1PMRA 1X3EA 5K5PA 2JA5B 5LHY1 2QILA 1B9NA 2L15A 1SNOA 2MNAA 1SRUA 2R92G 4KV6A 4ZAIA 2EYHA 4X6AH 1EL0A 1CKNA 1P8LA 2A6ED 4DV6L 4QIWB 5KYLA 4CDFC 1VQPA 4GKJL 1G2TA 1FGUA 3BYYB 3S2HH 5E7NA 1JT8A 4N8FA 2ES2A 1S40A 5AJ3L 5ELBA 3M4OB 4GKJQ 1EOVA 1EYCA 4C3JG 3R3OA 2RA4A 5ELNA 3W2DA 5BN4A 4N8X1 3T4AC 2XNAC 5AJ3Q 1D6EC 5CV9A 2F0DA 2RDGA 1PH9A 3F8TA 3NWTA 1VMPA 1T9HA 2B2VC 1BO0A 4RWSC 1EEID 1CA5A 4K5XA 3RR5A 2EY6A 3SE0A 1ZXTA 1BQQT 2IX3A 2I5HA 2XRSD 4LFBL 4DAPA 3VYTA 1UE6A 1WOCA 2KCNA 5IT9E 4HSVA 1YIJA 3ICEA 2ZT9C 5C44H 1JCKB 1GUTA 2WAQG 5LL6S 4HIKA 1SAPA 2MO1A 3I70A 5EPLA 4NW2A 4LFBQ 1FJGL 1VQKA 2O2LD 4J15A 4KHPL 1Y14B 4ABNA 1CKMA 1VCIA 2KBNA 2NN6H 2CW0D 3HKZB 1MJCA 3GTPH 2YYZA 1F2LA 2NVQH 2F3WA 4L8JA 2R7ZG 5AFWA 3I4NB 1TS5A 1YVCA 1PTOB 3M7NA 3IFDA 4DK3C 2JN4A 4ZKCB 2B63B 4ZQ3A 3E9IA 5KNDA 4NXNL 2F0KA 2K50A 2JA5G 1Q90A 4DV4L 4JW0A 4OGQC 1V1PA 5KIXA 4AYBB 5TSSA 2JA6B 2RDFA 1YEZA 3NELA 4ZUIA 4A4IA 3G48A 4IQZA 2XWBB 2Z6KA 2Y0SB 3RLNA 4A3EG 2YU9H 4NXNQ 1HZAA 3I4MB 4M1UB 3B6YA 2LY7A 1S5CD 2R6GA 3K58A 4C3HG 4TKOB 1IYUA 1YJWA 3BYTB 2UUBL 1AE3A 2MP1A 1HNZL 1K8MA 1GUOA 3BS1A 3CCLA 3MTSA 1LT5D 2XVSA 3PSIA 1KC8C 1VF7A 1NNXA 2EXZA 4P74A 3RNUA 2L55A 5HGQA 1YHAA 3HEJA 5HY6A 3A8JE 1HNZQ 4LF8L 5IGFA 1EIYB 3NTHA 2OF1A 2E8GA 1ICWA 5IYDG 1YZ6A 3H94A 4UY8C 2K1BA 3PUYA 1XTDA 4PG3A 1QE6A 2A69D 2E74C 2E5LL 4LF8Q 5FLMH 2N8NA 2VS1A 3W3AA 3J7AF 2EPBA 1BR9A 3NP8A 4FDBA 3NPPA 5IP9G 3ER0A 5FLXL 2IJ0A 2E5LQ 3R8BA 2VB3X 5JPNC 5K36H 2CHBD 1PFSA 3U4VA 1IYVA 1SSOA 3BZKA 4BS9A 4YIJA 2HQEA 3KLRA 1SE8A 4IFDG 2OQ0A 2K5WA 4A93G 2WB1G 5I4DA 3RZOH 2E2HB 3HKZG 1GUNA 4FXKC 2FFKB 3GTMH 3G7LA 4OEMB 3CC2A 1SMYD 3J7YW 2XIWA 1TY0A 5M5XH 2R3ZA 1E22A 3GO5A 4C3IG 4QIWE 2NVXB 3GTJH 1PRTC 4DXFA 3CKIB 3OIPA 4NKLA 2B63G 4OO1H 5ELFA 5JOBA 2JA7B 2RSNA 4MHEA 1K3BC 3JAMc 4XT1B 3HGBA 5C44B 4DR2L 2B2VA 3NXWA 4AYBG 2E2JH 2JA6G 4CJ2C 3MFGA 4IPGA 4KD3A 1I50H 3UDIA 4HTHA 4OL7A 3BDCA 2RHQB 3I4MG 2VQEL 1L0YB 1V8QA 3ND8A 3G4SA 4JI0Q 2QF7A 4A3JB 2HT1A 3GTPB 4WJ4A 1STNA 4MNOA 4AIMA 3ERQA 4KD4A 1V9PA 4RG1A 2E75C 2UXCL 1IW7D 2VQEQ 3U58A 1YBYA 4IALA 1Z6HA 2IHFA 1SYBA 1LTAD 3TQYA 5I6YA 5A2QE 2FJ2A 4B08A 3EVQA 3H15A 1FD7D 1HZCA 4PV1C 2F0LA 4K14A 3WOFA 3MXNA 2IY5B 1I4GA 5M3MG 1ENCA 1SDFA 4BY7H 2MUYA 3MEFA 5ELEA 4RKLA 1G2SA 1HPCA 1ILPA 4TRDA 1I3QH 4XYOA 4GZYC 3PF4A 3KF6A 3K5MA 2UUAL 4CKEA 1PH5A 2K33A 2JYOA 1STHA 1STGA 5C0XG 3OOCA 3DM3A 2Z0SA 5JVH3 3GTKH 1NE3A 2Q8RE 4J1MA 4U673 4QMGA 2UUAQ 3NTIA 4L5QA 3IKJA 4A3MG 3SR1A 1GM5A 2Q8IB 4HJ8A 3HOZH 2Y0SE 2EYJA 2BOSA 4KKSA 2Z6BA 3SK4A 1D8LA 4A3FG 4K8IA 2F0EA 4HIOA 2JA7G 1LABA 2OWOA 4K8JA 4OIKA 1DD2A 4NMZA 3VR3A 1K8OA 2VNUD 2D5DA 3NENA 1JOQA 1YNJC 2PQAA 1VQNA 1AH9A 4LF4L 1QWYA 4LFCL 4LW1A 4R4CA 5M5YH 2NVTB 3RZOB 2V4DA 1KRSA 4OHJA 1EWHA 1Q12A 3S17H 4A3JG 3M3YH 1B4OA 3LX0A 1DCZA 2KEDA 2F52A 2CFMA 2NN6I 4LF4Q 4LFCQ 3UE1A 3KJPA 1FGBD 4BBRH 4XIGS 1GHKA 1Y1VH 3EJIA 4DR1L 1T5EA 5C3EB 3H6MA 2UU9L 4HIDA 2E2JB 3TS2A 4G7OC 3HG9A 2ZTDA 1J5EL 3S14B 4DR1Q 3L9AX 4FP5D 4DV5L 2EY1A 2ICIA 3VYRA 2E2IH 2UU9Q 4JI7L 4DV2L 3FDTA 3TREA 4P71A 1WTQA 3Q23A 2R93B 2LFNA 2NZHA 4ZYSA 4JBMA 1J5EQ 4GNXC 3HP3A 1G6PA 2GVBA 1SMXA 4DV2Q 4GOPB 1A3UA 3EBEA 4HIMA 1IL8A 1DXMA 4KHVA 1ESFA 2PQEA 4H44C 4JOIC 1J8IA 2A68D 5JPMC 4K5VA 3HZXA 1V1OA 1BNZA 3AFPA 3J80i 3J81L 4YHHQ 2F0QA 4UP8A 4UP9A 3KFUA 1VQFA 2L11A 1S5BD 3IFTA 4GNXB 1O7ZA 2ZJQA 3VA7A 3U9SA 1UNSA 3K7UC 2PMZE 2YTXA 1K8GA 1CZGA 3SHLA 2DJGC 5D65A 1I3QB 1U0LA 2JK8A 1XMQL 4PZ8A 4BBSG 3K8AA 4YWMA 1CI3M 1HH2P 2K4KA 1JC7A 4ME3A 1F9RA 1P16A 2PNRC 1A62A 3HOYH 3GTKB 3T1HL 2WIIB 1EY7A 4FXGC 1SFOH 1SE2A 1XNRQ 1BUVT 4ZCKA 2PYKA 4A3GH 3OIQA 4RHRA 5C3EG 3CXCA 3WDNA 2A6HC 1HNWL 4OO1I 1N32Q 2R61A 3D31A 1G291 4J8QA 3T1YL 2DY8A 2K04A 1VQ5A 3NBIA 3SK5A 3UDXA 3TRZA 3V05A 5CMDA 1HNWQ 5M5YB 4LK1C 3PO2H 1Q3LA 3C1EA 2H4OA 4KY5A 4JPBW 3LWUA 4IUPA 1SN8A 3PIPA 2R93G 4K0KQ 3T1YQ 2LSSA 1VQBA 2VB2X 2NVYH 1EQVA 4JBWA 1II3A 5LL6X 2A1AA 3ZJYC 1Y1VB 2OXPA 1J6QA 1X56A 3PIOA 1WCMH 1QILA 4K2KA 2FINB 5DEHA 3A7AB 2A74C 4FF1A 1F77A 3PO3B 2G9DA 4GN4B 3CCJA 5FO7B 3CCMA 1EQTA 1N33L 1D7QA 5J39A 2AWOA 5BR8Q 2IX1A 1S5ED 4FNFA 5KEEA 1YHBA 5CC4A 4OWTB 5C3WA 2A19A 3N52A 2ZJRA 1Y8PB 5M3FH 1N33Q 5I2XA 5IYCH 3CCEA 1BCPF 4BA1I 2FMCA 1HFGA 3W1GA 4GLXA 3QOLA 3W1BA 3P7JA 1RODA 2JA8B 3MFYA 1CFMA 4B9XA 4FVMA 3U50C 1NJIC 3PCOB 3HOXH 2ZXOA 2F0SA 2F0JA 2JA9A 1U9RA 1OXTA 2F0MA 4JOIA 2MPMA 4LUOA 3S2DB 5EPJA 3F2BA 1WYDA 1MIUA 2HDMA 3KLSA 4JI1L 3AQQA 3K7AH 1NMGA 2UXBL 3UDFA 1LM0A 3MHBA 3AEVA 2O4XA 3VYSA 2KOLA 1B3QA 1QUQA 1T5XD 3I90A 4JI1Q 4F8MA 5C4JH 4V190 2FXQA 2UXBQ 4CHTB 1X3FA 1TS4A 3HOYB 3SXHA 3BZDB 5IT9c 1ENAA 2VQFQ 5EBCA 2JEAI 4JI3Q 1KQSA 5C4XB 1GXDC 1SFOB 3GTLH 4Q0FA 3OTOL 3I55A 3DEPA 2SOBA 5IP7G 3I56A 1Y1VG 1TWGH 3RMHA 1CT1D 4QCLA 1PZJD 2LXJA 2EOTA 3VR6A 3OTOQ 2PO4A 3BDLA 3GTGH 2PZWA 1IBMQ 3K81C 3FPUB 4EQPA 3PO3G 3D3RA 3PUXA 4A3LH 4HN7A 3H0GH 4X3KA 5FJ8H 1PTOC 1E24A 1SJED 2QW7A 5DLQE 4CGYB 4JG2A 5JEAH 5KGUA 1FL0A 4TSSA 5ELDA 2KA7A 4RMFA 4BY1B 1J9OA 1H9KA 1W3SA 4KI0A 1KL9A 2K7VA 5C4ZA 1WD1A 4LF5L 4XTCS 4LUZA 1I94L 1M90C 3NUCA 1K3RA 2MJ8A 2J7ZA 1F9PA 3CQZB 4KKUA 4RH6A 3EN2A 5CORA 3EQLC 1I94Q 2JA8G 1HA5A 2HCIA 4A76A 4XT3B 4DR5Q 2Z9HA 2K5QA 1WTRA 2CH4W 1K28A 2CQAA 1OTCA 3U4ZA 2L1BA 4UDUC 5I2YA 2JJQA 3H3VC 1TWHH 1WD0A 2DN8A 1HUNA 3S16H 4R8NA 3S15H 1EUJA 4A3DH 1EWIA 5DM63 4O42A 1ILQA 1K83H 1LLRD 4B9WA 1SR3A 3TP6A 3VR5A 4DK0A 4CBVA 3H09A 1ONLA 3AYHB 1CA6A 3HOXB 4BA2I 4A75A 1GHJA 1JR0D 3DWQA 1HFNA 1BCPD 3SGIA 1UWVA 5C4XG 3QB3A 1BDOA 2SNSA 5M5WH 4JBJA 3QOJA 4P73A 4XQJA 4BXXH 1CK1A 2CWAA 2YTYA 1DOMA 3OWFA 4RFBA 1R4PB 2EZVA 4PMCA 3CC7A 2KCTA 5IGBA 5EKKA 3STBD 1HCZA 3BJUA 4DR7L 5FLXE 4MTKA 1Z47A 2Q2HA 1N34L 3FP9A 4BY1G 1L2FA 2F0IA 1WTVA 4A3KH 1MKHA 1F9QA 2VUMH 4DR7Q 1QJOA 5IGGA 1YJNA 1PRTD 1TWGB 1VQ7A 3IRBA 1N34Q 2QDLA 4HCSA 2XWJB 1I4HA 5FKAC 5IODA 1AEXA 1QB5D 4YWLA 3X3MA 3WOEA 3HOWH 5F2DA 2KEEA 2B29A 4OELB 1X3PA 2SEBD 4RHSA 5KNBA 1R9TH 4A3CH 4R4IA 1XXGA 3J7A5 4LF7L 3RLOA 1EU3A 4RA8A 1V1QA 1HR0W 1XJVA 1TWCB 2ZJPA 2C9OA 1QOHA 2SNMA 3CCUA 1KDBA 1M8AA 3TS0A 5EKLA 4LF7Q 1G91A 1S5DD 1R4QB 3CPFA 1PYSB 1F2MA 2Q8TA 1ET9A 2K28A 4Y7NH 1XWEA 1RJTA 4F87A 2IT1A 5C6AA 2F0PA 4JV5Q 1JJCB 5EQ0A 1DJRD 3CW2C 1GOZA 1Q46A 3HOXG 2SDFA 3HOUH 3A54A 4DGZA 2A6EC 2GVAA 4MN3A 1Q7YC 1SEBD 2KENA 3IAYA 1C0AA 3D6WA 3S2HB 1GJXA 2N88A 1HUMA 1TS2A 1TWHB 3J81c 4GLVB 1STAA 3A5ZB 3SVMA 2EYPA 3PQIA 1VQEA 2I5LX 1TWAH 3I91A 3MXUA 1K83B 1KLUD 1JICA 4JC0A 5GAHC 3KBXA 3ULLA 4TQUS 5JEAJ 1RKNA 1LO5D 1EY5A 3S1RH 4ZK9B 4RKBA 3NBHB 5IYBH 4UHVA 4ULLA 2D62A 3TEHB 3OSOA 2PPBC 1KTKA 3I4NG 2X6LA 1VQ9A 2F0NA 1GUSA 4ZRZA 4POFA 1S5FD 1L1OB 1SNDA 1OXVA 2EIFA 3GTQH 2EY2A 3F1ZA 1FVIA 4JI0L 3DLLA 1HTPA 2UXDL 2Y0SG 2AKWB 1F2ZA 4YCUA 3URYA 1KD1C 2RCFA 2CW0C 3AMUA 2PMZB 4A3KB 3MXPA 2NVQB 4XXEA 2UXDQ 4A3IH 2MHVA 2RQXA 2RDHA 2B3GA 2L12A 5GADC 3IL8A 1O7YA 1NY4A 2IWHA 2EYMA 3CP0A 4HCEA 2NB0A 2XRQD 3NHHA 2EVBA 5IE8A 1MI2A 4P72A 5IIFA 2YU9B 2MGSA 2RCNA 2KUMA 4K6DA 1FNVA 3TP5A 1KRTA 4P75A 1XPOA 2K05A 4ILWA 1KNAA 1Q1BA 2OQKA 1OXXK 4LF6Q 2O5IC 4YY3L 2WFWA 5CYUA 5CBAE 3S24A 2RF4A 1SYFA 5CBEE 2ZTCA 4OX9Q 2C5CA
chains in the Genus database with same CATH topology
5LMUQ 5J3BA 4A3BH 1QZHA 4LUVA 2Z6KC 3I4NH 3HOVG 1W2BA 2VZAA 4YY3Q 1SFOH 2YV5A 1XNRQ 4OXPA 3M85A 1QVCA 4LF9Q 2F4VL 2MQHA 1K8AC 1JE5A 2GN5A 4A3GH 4DV4Q 1VQ6A 3CCQA 1PYBA 4DV1L 4DR3L 3J81j 1B7YB 5C3EG 3CXCA 5LMNL 2R7DA 1VQAA 3CC4A 1HNWL 1HZ9A 4OO1I 1N32Q 1B70B 1L0WA 3D31A 4X66L 1G291 1I5FA 1ASZA 2F4VQ 1TWCH 1CSPA 3T1YL 4DV1Q 4DR3Q 3S1MH 4JI2L 1VQ5A 1PHJA 3UDXA 4X65L 1K0RA 1X3GA 5LMNQ 1KAWA 3RZDH 1PH7A 3TRZA 4QQBX 1HNWQ 1NMFA 3PO2H 5C44G 1QVFA 3RN5A 3J80c 1Q81C 1C9OA 1SN8A 3PIPA 2R93G 3UE0A 2D0OA 3GDEA 4K0KQ 4IJHA 3T1YQ 1HZBA 1VQBA 2LSSA 2NVYH 4JBWA 4JI2Q 3F2CA 1XMOL 1MJEA 2UUBQ 4X65Q 1PH3A 2I0QA 2R7FA 2A1AA 3KJOA 3EIVA 3ZJYC 4LF5Q 3I7FA 4OWWB 1X3EA 4IFDJ 2NN6G 4DR4L 3OW2A 2AMCB 1J6QA 1X56A 2WAQE 3PIOA 1QVGA 1WCMH 3FKIG 1CUKA 2L15A 4UPAA 4HJ9A 1XMOQ 3K80C 2MNAA 1SRUA 2R92G 1WJJA 2Q2UA 4X6AH 2N49A 4DR4Q 4QL5A 1CKNA 3KOJA 1P8LA 1DGSA 4DV6L 4GN4B 4R1JA 3W5OA 3CCJA 3CCMA 1VQPA 1N33L 2HHHL 4GKJL 1FGUA 3S2HH 1D7QA 4MZ9A 5E7NA 1PVOA 4BBSH 2AWOA 5BR8Q 1Y1WH 1JT8A 1S72A 2XGTA 1E1TA 1LTLA 2IX1A 2ES2A 1YHBA 5AJ3L 4OWTB 5GAEC 1S40A 2A19A 3FHWA 5GROA 2ZJRA 5M3FH 1VQIA 2A8VA 3STBC 1N33Q 2HHHQ 1EOVA 3AFQA 4GKJQ 1IBKL 5IYCH 3CCEA 4A3LG 2NVTH 3H0GG 5FJ8G 2CKZB 4X62Q 5ELNA 1E7ZA 1KHIA 2LXKA 3A0JA 1E3PA 4BA1I 5AJ3Q 3HOVH 3G6EA 5JEAG 4IFDI 3W1GA 4GLXA 5GQOA 3PV0A 4KHZA 3W1BA 1UE7A 2ZM6L 1PH9A 1IBKQ 1IZ6A 3S1NH 1KXLA 3F8TA 4YHHL 1T9HA 2YTVA 2JE6I 1N36Q 5C3EH 4HJ5A 3U50C 1YI2A 4DR6Q 1NJIC 3PCOB 3HOXH 3HKSA 3S1QH 4L5TA 3RR5A 2CQOA 3M4QA 2JA9A 4JOIA 1OXTA 4LUOA 2ZM6Q 1X9NA 1PH1A 3F2BA 1Z9FA 2I5HA 1WYDA 1MIUA 1L1OA 3S14H 4LFBL 1UE6A 1WOCA 4JI1L 3AQQA 1SLJA 3K7AH 3ICEA 1YIJA 1NMGA 4JYAL 2UXBL 3UDFA 1LM0A 5C44H 4DR2Q 1BKBA 3MXNB 2WAQG 4GOPC 4HIKA 2MO1A 3AEVA 2R93H 4O0AA 5FLMG 1S3OA 4LFBQ 1M1KC 1VQKA 2K14A 4J15A 4LF6L 1FJGL 1QUQA 2JEBI 4GS3A 1Y14B 2Q2IA 4KHPL 4PZ6A 1CKMA 4JI1Q 1VCIA 2KBNA 2FXQA 5C4JH 4MTNA 1X3FA 3WWVA 2OTLA 4JYAQ 2UXBQ 1C7YA 1MJCA 3HFZB 3GTPH 1HJPA 1TXYA 5IT9c 2YYZA 4QY7A 4OX9L 2NVQH 4UP7A 4HJAA 3KF6B 2CCZA 2VQFQ 5K36G 4GKKQ 4OONA 2EQSA 2R7ZG 1XPUA 1UEBA 1YVCA 4JI3Q 2JEAI 2R92H 3KF8B 4A3DG 2UXCQ 1KQSA 3M7NA 1JJ2A 3GTLH 5C0XJ 1XNRL 4DK3C 1BVSA 3OTOL 3I55A 1I6HH 3E9IA 4LF9L 4NXNL 5IP7G 2K50A 2JA5G 3I56A 2VW9A 4DV4L 1Y1VG 4DUYL 1TWGH 3H3VI 4OWXB 4JI6L 2LXJA 4GNXA 1VQCA 1ASYA 1RIPA 4DNIA 1YEZA 3NELA 4TVAB 4A4IA 3G48A 3OTOQ 4A3EG 2Z6KA 3RLNA 2YU9H 2UUCQ 3GTGH 1N32L 1N9WA 4NXNQ 1HZAA 2WB1E 1VQ8A 3HKZE 1IBMQ 3K81C 3B6YA 4DUYQ 4OO1G 1A8VA 2C35B 2R6GA 1PH4A 3PUZA 4C3JH 3PUXA 3CMEA 4JI6Q 3PO3G 2AHOB 3H0GH 5FJ8H 4A3LH 1E24A 2N3SA 5DLQE 3PUWA 1GO3E 4JG2A 1FL0A 1YJWA 3ULPA 4K0KL 1GKHA 4RMFA 2UUBL 1YITA 1AE3A 2PQAB 1W3SA 4KI0A 3JAMi 1KL9A 2ID0A 3I2ZA 3UDGA 5EAYA 2DGYA 1Q86C 1HNZL 4LF5L 4XTCS 4IPHA 1VQGA 3KDFB 3CCLA 4LUZA 1I94L 3PSIA 4AYBE 1M90C 1KC8C 4C2MH 2IHEA 4DV3L 4P74A 5C0XI 3RNUA 1PH2A 2D0PA 3RLFA 1YHAA 5HGQA 1K3RA 4A3IG 5HY6A 2I5MX 4R4QA 4JI8L 1HNZQ 1EIYB 4LF8L 1PA6A 3EN2A 1JMCA 1I94Q 2E8GA 1UE5A 4IO9A 4A3KG 5ELOA 1VQLA 2JA8G 2ASBA 5IYDG 1YZ6A 4A76A 4DV3Q 4DR5Q 1KIXA 4UY8C 3PUYA 4APVA 2VUMG 1RL2A 4IJLA 1XTDA 4PG3A 4PZ7A 1EQQA 1VQHA 4JI8Q 2E5LL 4LF8Q 5BR8L 5FLMH 3L2PA 2N8NA 2JQOA 2VS1A 1OTCA 3A5UA 3U4ZA 3HOWG 4WJ3M 2V1CC 2N78A 1U5KA 4A3CG 4FDBA 2JJQA 4DUZL 5IP9G 3ER0A 4LFAQ 1IBLL 2E5LQ 1V43A 4X62L 1TWHH 1A63A 3S16H 2IX0A 2R7ZH 1PFSA 3U4VA 5LMNW 3CF5A 4BY7G 3S15H 1EUJA 4A3DH 2BA1A 1EWIA 4B3SL 3BZKA 3OYYA 2QA4A 1IXRA 1YJ9A 2ATWA 2HQLA 4DUZQ 1SE8A 4IFDG 2OQ0A 1IBLQ 4KLKA 1XPRA 1K83H 2WB1G 3RZOH 5IP7H 1SR3A 2K5HA 3HKZG 2JA5H 2QEXA 1N36L 2K52A 3GTMH 1JJGA 3D0FA 1Q1EA 1K73C 3GTOH 4DR6L 3AYHB 4B3SQ 3CC2A 1PH8A 4BA2I 4JV5L 1EIFA 4A75A 1B8AA 4A3EH 3SGIA 5M5XH 1UWVA 1E22A 3GO5A 5C4XG 4QIWE 3GTJH 5M5WH 4JBJA 2B63G 3M4PA 1X6OA 4P73A 3PO3H 4BXXH 3J7ZC 1WFQA 1IYJB 2CWAA 1GVPA 3JAMc 3HOZG 4A93G 4DR2L 2YTYA 4AYBG 4C3HH 4B3TQ 2E2JH 2JA6G 1E1OA 1VS0A 4JBKA 4IPGA 3CPWA 1I50H 3UDIA 2RHSB 3HOUG 1QZGA 4BXXG 2K5NA 2RHQB 3VDYA 3I4MG 3M4OH 2VQEL 4DV5Q 3CC7A 2KCTA 4JI7Q 3STBD 2EXDA 3G4SA 4JI0Q 3BJUA 2HT1A 4WJ4A 4IPCA 4DR7L 1Z47A 4MNOA 2Q2HA 4AIMA 2VQFL 4GKKL 1V9PA 4RG1A 4JI3L 5GAGC 3PF5A 3FP9A 1N34L 3G71A 4GOPA 4BY1G 2UXCL 1L2FA 2VQEQ 3U58A 4Y52H 2PNHA 3M9BA 1O7IA 3J81i 2JA8H 4A3KH 1YBYA 4JI5L 2XTIA 5IYDH 3FKIH 1MKHA 2VUMH 4DR7Q 2IHFA 3CD6A 1OXSC 1YJNA 1VQ7A 3ERSX 3IRBA 1N34Q 3TQYA 1YHQA 2VY3A 4DAYB 1JB7A 5FLXc 3S2DH 3H15A 1HZCA 4YWLA 4JI4L 4JI5Q 4BBRG 2UUCL 3HOWH 3JC66 3NEMA 2B29A 1IBML 1R9TH 4A3CH 5IYBG 2OTJA 4R4IA 5IP9H 5JJIA 2IY5B 2HIXA 3ULJA 1H95A 5M3MG 3J7A5 4LF7L 1EYGA 4JI4Q 4GN3B 4BY7H 3MEFA 4NB3A 3RLOA 2OCEA 1V1QA 1HR0W 1XJVA 4L5SA 2ZJPA 1VQJA 3CCUA 4A93H 1I3QH 4R4OA 2K75A 3TS0A 4LF7Q 3PF4A 3KF6A 2UUAL 1XMQQ 4LWCA 1X54A 3CPFA 1PH5A 2VL6A 1PYSB 2AWNA 2ALYB 4POGA 4HJ7A 4O2DA 4Y7NH 4C3IH 5C4XH 5C0XG 3DM3A 2Z0SA 2IT1A 3GTKH 1NE3A 2B63H 3T1HQ 3F2DA 4JV5Q 2UUAQ 4X66Q 4L5QA 4YCVA 1JJCB 3E0EA 3L0OA 3CMAA 2DUDA 4DR5L 4A3MG 1GM5A 4HJ8A 3HOZH 2Y0SE 2KHJA 4NXML 3CW2C 3CCVA 1K9MC 2NZOA 1Q46A 3HOXG 2JA6H 2BH2A 4YCWA 5JJKA 4R4TA 3HOUH 3BU2A 2GVAA 1D8LA 1N8RC 4A3FG 1Q7YC 3I4MH 4HIOA 1CKNB 2KENA 4DV0L 2JA7G 1C0AA 3A74A 2OWOA 5IY0A 4NXMQ 4LFAL 2WP8J 2MFIA 3J81c 4GLVB 2VNUD 2BA0A 3NENA 3A5ZB 4DV7L 3KYHC 2PQAA 1VQDA 4AQYL 1VQNA 1GD7A 4BY1H 1AH9A 4DV0Q 4LF4L 4LFCL 1VQEA 1YNXA 3KDFA 2I5LX 1TWAH 4LW1A 1NBWA 4R4CA 4B3RL 4ALPA 5M5YH 1BBUA 1CSQA 1KRSA 1Q12A 3GD7A 2Q2TA 3I4OA 4JC0A 5GAHC 4A3JG 4DV7Q 3M3YH 3S17H 3ULLA 4AQYQ 4IOAA 4AH6A 4TQUS 4X64L 5JEAJ 3H3VH 4LF4Q 4LFCQ 2F52A 2CFMA 2NN6I 4GN5A 3L7ZC 3CQZH 3UE1A 4LNQA 3KJPA 1VQMA 2K5VA 3S1RH 4BBRH 1EFWA 4B3ML 4B3RQ 2CWPA 4XIGS 3HOYG 1Y1VH 3K0XA 3NBHB 5IYBH 4DR1L 5IWAL 1PH6A 2D62A 1XNQL 5JJLA 2PI2E 3TEHB 5M3MH 4X64Q 4A3BG 3I4NG 2UU9L 4EQ5A 2PI2A 1VQ9A 4B3TL 4HIDA 4B3MQ 3E9HA 1VQOA 2HIVA 1PV4A 1LYLA 1CKOA 1LUZA 2ZTDA 3TS2A 2ZTEA 3KLWA 1J5EL 2KHIA 2F3IA 2KCMA 1VQ4A 4POFA 4GLAC 5IWAQ 4DR1Q 1BBWA 1XNQQ 4DV6Q 4A3GG 1L1OB 4DKAC 1OXVA 4DV5L 2E2IH 2EIFA 2UU9Q 4JI7L 4DV2L 3GTQH 3F1ZA 1FVIA 3TREA 4P71A 2BH8A 4EX5A 3DLLA 4JI0L 1OXUA 4JBMA 2NZHA 4NPSA 2Y0SG 3BZCA 1J5EQ 2UXDL 2AKWB 4PMWA 3RN2A 4YCUA 1KD1C 1A0IA 1G6PA 1TWFH 1QUQB 2GVBA 3LGJA 1G51A 1SMXA 4DV2Q 4GOPB 3EBEA 4YWKA 1UE1A 3Q8DA 4HIMA 2E2HH 4A3MH 3PO2G 4JOIC 3CCSA 2UXDQ 4A3IH 1AE2A 2QGQA 1HR0L 1L1OC 3AFPA 2B3GA 1IL2A 1NTGA 1WI5A 1EQRA 2NVXH 3J80i 5GADC 4A3FH 1Q82C 1HNXL 1NY4A 4YHHQ 3CP0A 2JA7H 4DPGA 4IOCA 1X55A 3PGZA 1WCMG 4UP8A 4DK6C 4UP9A 1HR0Q 3KFUA 1VQFA 5IE8A 4QGUA 4GNXB 4P72A 2ZJQA 1HNXQ 3CCRA 4JCVE 2RCNA 3K7UC 4DAMA 2PMZE 2YTXA 1K8GA 3CAMA 1KRTA 4P75A 4IPDA 3PUVA 5H1SE 4QJFA 1U0LA 1XPOA 1Q8KA 2JK8A 4A3JH 1XMQL 4L5RC 4PZ8A 4BBSG 3K8AA 1Y1WG 1Q1BA 2OQKA 4YWMA 1SROA 5LMUL 2MO0A 1OXXK 1HH2P 1FJGQ 2K4KA 4LF6Q 4ME3A 4YY3L 4KHPQ 2WFWA 4H02A 1P16A 5M3FG 1A62A 3HOYH 1X65A 3S24A 3T1HL 2RF4A 5IYCG 2H5XA 2ZTCA 4OX9Q 4GNXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU Q;  5J3B A;  4A3B H;  1QZH A;  4LUV A;  2Z6K C;  3I4N H;  3HOV G;  1W2B A;  2VZA A;  4YY3 Q;  1SFO H;  2YV5 A;  1XNR Q;  4OXP A;  3M85 A;  1QVC A;  4LF9 Q;  2F4V L;  2MQH A;  1K8A C;  1JE5 A;  2GN5 A;  4A3G H;  4DV4 Q;  1VQ6 A;  3CCQ A;  1PYB A;  4DV1 L;  4DR3 L;  3J81 j;  1B7Y B;  5C3E G;  3CXC A;  5LMN L;  2R7D A;  1VQA A;  3CC4 A;  1HNW L;  1HZ9 A;  4OO1 I;  1N32 Q;  1B70 B;  1L0W A;  3D31 A;  4X66 L;  1G29 1;  1I5F A;  1ASZ A;  2F4V Q;  1TWC H;  1CSP A;  3T1Y L;  4DV1 Q;  4DR3 Q;  3S1M H;  4JI2 L;  1VQ5 A;  1PHJ A;  3UDX A;  4X65 L;  1K0R A;  1X3G A;  5LMN Q;  1KAW A;  3RZD H;  1PH7 A;  3TRZ A;  4QQB X;  1HNW Q;  1NMF A;  3PO2 H;  5C44 G;  1QVF A;  3RN5 A;  3J80 c;  1Q81 C;  1C9O A;  1SN8 A;  3PIP A;  2R93 G;  3UE0 A;  2D0O A;  3GDE A;  4K0K Q;  4IJH A;  3T1Y Q;  1HZB A;  1VQB A;  2LSS A;  2NVY H;  4JBW A;  4JI2 Q;  3F2C A;  1XMO L;  1MJE A;  2UUB Q;  4X65 Q;  1PH3 A;  2I0Q A;  2R7F A;  2A1A A;  3KJO A;  3EIV A;  3ZJY C;  4LF5 Q;  3I7F A;  4OWW B;  1X3E A;  4IFD J;  2NN6 G;  4DR4 L;  3OW2 A;  2AMC B;  1J6Q A;  1X56 A;  2WAQ E;  3PIO A;  1QVG A;  1WCM H;  3FKI G;  1CUK A;  2L15 A;  4UPA A;  4HJ9 A;  1XMO Q;  3K80 C;  2MNA A;  1SRU A;  2R92 G;  1WJJ A;  2Q2U A;  4X6A H;  2N49 A;  4DR4 Q;  4QL5 A;  1CKN A;  3KOJ A;  1P8L A;  1DGS A;  4DV6 L;  4GN4 B;  4R1J A;  3W5O A;  3CCJ A;  3CCM A;  1VQP A;  1N33 L;  2HHH L;  4GKJ L;  1FGU A;  3S2H H;  1D7Q A;  4MZ9 A;  5E7N A;  1PVO A;  4BBS H;  2AWO A;  5BR8 Q;  1Y1W H;  1JT8 A;  1S72 A;  2XGT A;  1E1T A;  1LTL A;  2IX1 A;  2ES2 A;  1YHB A;  5AJ3 L;  4OWT B;  5GAE C;  1S40 A;  2A19 A;  3FHW A;  5GRO A;  2ZJR A;  5M3F H;  1VQI A;  2A8V A;  3STB C;  1N33 Q;  2HHH Q;  1EOV A;  3AFQ A;  4GKJ Q;  1IBK L;  5IYC H;  3CCE A;  4A3L G;  2NVT H;  3H0G G;  5FJ8 G;  2CKZ B;  4X62 Q;  5ELN A;  1E7Z A;  1KHI A;  2LXK A;  3A0J A;  1E3P A;  4BA1 I;  5AJ3 Q;  3HOV H;  3G6E A;  5JEA G;  4IFD I;  3W1G A;  4GLX A;  5GQO A;  3PV0 A;  4KHZ A;  3W1B A;  1UE7 A;  2ZM6 L;  1PH9 A;  1IBK Q;  1IZ6 A;  3S1N H;  1KXL A;  3F8T A;  4YHH L;  1T9H A;  2YTV A;  2JE6 I;  1N36 Q;  5C3E H;  4HJ5 A;  3U50 C;  1YI2 A;  4DR6 Q;  1NJI C;  3PCO B;  3HOX H;  3HKS A;  3S1Q H;  4L5T A;  3RR5 A;  2CQO A;  3M4Q A;  2JA9 A;  4JOI A;  1OXT A;  4LUO A;  2ZM6 Q;  1X9N A;  1PH1 A;  3F2B A;  1Z9F A;  2I5H A;  1WYD A;  1MIU A;  1L1O A;  3S14 H;  4LFB L;  1UE6 A;  1WOC A;  4JI1 L;  3AQQ A;  1SLJ A;  3K7A H;  3ICE A;  1YIJ A;  1NMG A;  4JYA L;  2UXB L;  3UDF A;  1LM0 A;  5C44 H;  4DR2 Q;  1BKB A;  3MXN B;  2WAQ G;  4GOP C;  4HIK A;  2MO1 A;  3AEV A;  2R93 H;  4O0A A;  5FLM G;  1S3O A;  4LFB Q;  1M1K C;  1VQK A;  2K14 A;  4J15 A;  4LF6 L;  1FJG L;  1QUQ A;  2JEB I;  4GS3 A;  1Y14 B;  2Q2I A;  4KHP L;  4PZ6 A;  1CKM A;  4JI1 Q;  1VCI A;  2KBN A;  2FXQ A;  5C4J H;  4MTN A;  1X3F A;  3WWV A;  2OTL A;  4JYA Q;  2UXB Q;  1C7Y A;  1MJC A;  3HFZ B;  3GTP H;  1HJP A;  1TXY A;  5IT9 c;  2YYZ A;  4QY7 A;  4OX9 L;  2NVQ H;  4UP7 A;  4HJA A;  3KF6 B;  2CCZ A;  2VQF Q;  5K36 G;  4GKK Q;  4OON A;  2EQS A;  2R7Z G;  1XPU A;  1UEB A;  1YVC A;  4JI3 Q;  2JEA I;  2R92 H;  3KF8 B;  4A3D G;  2UXC Q;  1KQS A;  3M7N A;  1JJ2 A;  3GTL H;  5C0X J;  1XNR L;  4DK3 C;  1BVS A;  3OTO L;  3I55 A;  1I6H H;  3E9I A;  4LF9 L;  4NXN L;  5IP7 G;  2K50 A;  2JA5 G;  3I56 A;  2VW9 A;  4DV4 L;  1Y1V G;  4DUY L;  1TWG H;  3H3V I;  4OWX B;  4JI6 L;  2LXJ A;  4GNX A;  1VQC A;  1ASY A;  1RIP A;  4DNI A;  1YEZ A;  3NEL A;  4TVA B;  4A4I A;  3G48 A;  3OTO Q;  4A3E G;  2Z6K A;  3RLN A;  2YU9 H;  2UUC Q;  3GTG H;  1N32 L;  1N9W A;  4NXN Q;  1HZA A;  2WB1 E;  1VQ8 A;  3HKZ E;  1IBM Q;  3K81 C;  3B6Y A;  4DUY Q;  4OO1 G;  1A8V A;  2C35 B;  2R6G A;  1PH4 A;  3PUZ A;  4C3J H;  3PUX A;  3CME A;  4JI6 Q;  3PO3 G;  2AHO B;  3H0G H;  5FJ8 H;  4A3L H;  1E24 A;  2N3S A;  5DLQ E;  3PUW A;  1GO3 E;  4JG2 A;  1FL0 A;  1YJW A;  3ULP A;  4K0K L;  1GKH A;  4RMF A;  2UUB L;  1YIT A;  1AE3 A;  2PQA B;  1W3S A;  4KI0 A;  3JAM i;  1KL9 A;  2ID0 A;  3I2Z A;  3UDG A;  5EAY A;  2DGY A;  1Q86 C;  1HNZ L;  4LF5 L;  4XTC S;  4IPH A;  1VQG A;  3KDF B;  3CCL A;  4LUZ A;  1I94 L;  3PSI A;  4AYB E;  1M90 C;  1KC8 C;  4C2M H;  2IHE A;  4DV3 L;  4P74 A;  5C0X I;  3RNU A;  1PH2 A;  2D0P A;  3RLF A;  1YHA A;  5HGQ A;  1K3R A;  4A3I G;  5HY6 A;  2I5M X;  4R4Q A;  4JI8 L;  1HNZ Q;  1EIY B;  4LF8 L;  1PA6 A;  3EN2 A;  1JMC A;  1I94 Q;  2E8G A;  1UE5 A;  4IO9 A;  4A3K G;  5ELO A;  1VQL A;  2JA8 G;  2ASB A;  5IYD G;  1YZ6 A;  4A76 A;  4DV3 Q;  4DR5 Q;  1KIX A;  4UY8 C;  3PUY A;  4APV A;  2VUM G;  1RL2 A;  4IJL A;  1XTD A;  4PG3 A;  4PZ7 A;  1EQQ A;  1VQH A;  4JI8 Q;  2E5L L;  4LF8 Q;  5BR8 L;  5FLM H;  3L2P A;  2N8N A;  2JQO A;  2VS1 A;  1OTC A;  3A5U A;  3U4Z A;  3HOW G;  4WJ3 M;  2V1C C;  2N78 A;  1U5K A;  4A3C G;  4FDB A;  2JJQ A;  4DUZ L;  5IP9 G;  3ER0 A;  4LFA Q;  1IBL L;  2E5L Q;  1V43 A;  4X62 L;  1TWH H;  1A63 A;  3S16 H;  2IX0 A;  2R7Z H;  1PFS A;  3U4V A;  5LMN W;  3CF5 A;  4BY7 G;  3S15 H;  1EUJ A;  4A3D H;  2BA1 A;  1EWI A;  4B3S L;  3BZK A;  3OYY A;  2QA4 A;  1IXR A;  1YJ9 A;  2ATW A;  2HQL A;  4DUZ Q;  1SE8 A;  4IFD G;  2OQ0 A;  1IBL Q;  4KLK A;  1XPR A;  1K83 H;  2WB1 G;  3RZO H;  5IP7 H;  1SR3 A;  2K5H A;  3HKZ G;  2JA5 H;  2QEX A;  1N36 L;  2K52 A;  3GTM H;  1JJG A;  3D0F A;  1Q1E A;  1K73 C;  3GTO H;  4DR6 L;  3AYH B;  4B3S Q;  3CC2 A;  1PH8 A;  4BA2 I;  4JV5 L;  1EIF A;  4A75 A;  1B8A A;  4A3E H;  3SGI A;  5M5X H;  1UWV A;  1E22 A;  3GO5 A;  5C4X G;  4QIW E;  3GTJ H;  5M5W H;  4JBJ A;  2B63 G;  3M4P A;  1X6O A;  4P73 A;  3PO3 H;  4BXX H;  3J7Z C;  1WFQ A;  1IYJ B;  2CWA A;  1GVP A;  3JAM c;  3HOZ G;  4A93 G;  4DR2 L;  2YTY A;  4AYB G;  4C3H H;  4B3T Q;  2E2J H;  2JA6 G;  1E1O A;  1VS0 A;  4JBK A;  4IPG A;  3CPW A;  1I50 H;  3UDI A;  2RHS B;  3HOU G;  1QZG A;  4BXX G;  2K5N A;  2RHQ B;  3VDY A;  3I4M G;  3M4O H;  2VQE L;  4DV5 Q;  3CC7 A;  2KCT A;  4JI7 Q;  3STB D;  2EXD A;  3G4S A;  4JI0 Q;  3BJU A;  2HT1 A;  4WJ4 A;  4IPC A;  4DR7 L;  1Z47 A;  4MNO A;  2Q2H A;  4AIM A;  2VQF L;  4GKK L;  1V9P A;  4RG1 A;  4JI3 L;  5GAG C;  3PF5 A;  3FP9 A;  1N34 L;  3G71 A;  4GOP A;  4BY1 G;  2UXC L;  1L2F A;  2VQE Q;  3U58 A;  4Y52 H;  2PNH A;  3M9B A;  1O7I A;  3J81 i;  2JA8 H;  4A3K H;  1YBY A;  4JI5 L;  2XTI A;  5IYD H;  3FKI H;  1MKH A;  2VUM H;  4DR7 Q;  2IHF A;  3CD6 A;  1OXS C;  1YJN A;  1VQ7 A;  3ERS X;  3IRB A;  1N34 Q;  3TQY A;  1YHQ A;  2VY3 A;  4DAY B;  1JB7 A;  5FLX c;  3S2D H;  3H15 A;  1HZC A;  4YWL A;  4JI4 L;  4JI5 Q;  4BBR G;  2UUC L;  3HOW H;  3JC6 6;  3NEM A;  2B29 A;  1IBM L;  1R9T H;  4A3C H;  5IYB G;  2OTJ A;  4R4I A;  5IP9 H;  5JJI A;  2IY5 B;  2HIX A;  3ULJ A;  1H95 A;  5M3M G;  3J7A 5;  4LF7 L;  1EYG A;  4JI4 Q;  4GN3 B;  4BY7 H;  3MEF A;  4NB3 A;  3RLO A;  2OCE A;  1V1Q A;  1HR0 W;  1XJV A;  4L5S A;  2ZJP A;  1VQJ A;  3CCU A;  4A93 H;  1I3Q H;  4R4O A;  2K75 A;  3TS0 A;  4LF7 Q;  3PF4 A;  3KF6 A;  2UUA L;  1XMQ Q;  4LWC A;  1X54 A;  3CPF A;  1PH5 A;  2VL6 A;  1PYS B;  2AWN A;  2ALY B;  4POG A;  4HJ7 A;  4O2D A;  4Y7N H;  4C3I H;  5C4X H;  5C0X G;  3DM3 A;  2Z0S A;  2IT1 A;  3GTK H;  1NE3 A;  2B63 H;  3T1H Q;  3F2D A;  4JV5 Q;  2UUA Q;  4X66 Q;  4L5Q A;  4YCV A;  1JJC B;  3E0E A;  3L0O A;  3CMA A;  2DUD A;  4DR5 L;  4A3M G;  1GM5 A;  4HJ8 A;  3HOZ H;  2Y0S E;  2KHJ A;  4NXM L;  3CW2 C;  3CCV A;  1K9M C;  2NZO A;  1Q46 A;  3HOX G;  2JA6 H;  2BH2 A;  4YCW A;  5JJK A;  4R4T A;  3HOU H;  3BU2 A;  2GVA A;  1D8L A;  1N8R C;  4A3F G;  1Q7Y C;  3I4M H;  4HIO A;  1CKN B;  2KEN A;  4DV0 L;  2JA7 G;  1C0A A;  3A74 A;  2OWO A;  5IY0 A;  4NXM Q;  4LFA L;  2WP8 J;  2MFI A;  3J81 c;  4GLV B;  2VNU D;  2BA0 A;  3NEN A;  3A5Z B;  4DV7 L;  3KYH C;  2PQA A;  1VQD A;  4AQY L;  1VQN A;  1GD7 A;  4BY1 H;  1AH9 A;  4DV0 Q;  4LF4 L;  4LFC L;  1VQE A;  1YNX A;  3KDF A;  2I5L X;  1TWA H;  4LW1 A;  1NBW A;  4R4C A;  4B3R L;  4ALP A;  5M5Y H;  1BBU A;  1CSQ A;  1KRS A;  1Q12 A;  3GD7 A;  2Q2T A;  3I4O A;  4JC0 A;  5GAH C;  4A3J G;  4DV7 Q;  3M3Y H;  3S17 H;  3ULL A;  4AQY Q;  4IOA A;  4AH6 A;  4TQU S;  4X64 L;  5JEA J;  3H3V H;  4LF4 Q;  4LFC Q;  2F52 A;  2CFM A;  2NN6 I;  4GN5 A;  3L7Z C;  3CQZ H;  3UE1 A;  4LNQ A;  3KJP A;  1VQM A;  2K5V A;  3S1R H;  4BBR H;  1EFW A;  4B3M L;  4B3R Q;  2CWP A;  4XIG S;  3HOY G;  1Y1V H;  3K0X A;  3NBH B;  5IYB H;  4DR1 L;  5IWA L;  1PH6 A;  2D62 A;  1XNQ L;  5JJL A;  2PI2 E;  3TEH B;  5M3M H;  4X64 Q;  4A3B G;  3I4N G;  2UU9 L;  4EQ5 A;  2PI2 A;  1VQ9 A;  4B3T L;  4HID A;  4B3M Q;  3E9H A;  1VQO A;  2HIV A;  1PV4 A;  1LYL A;  1CKO A;  1LUZ A;  2ZTD A;  3TS2 A;  2ZTE A;  3KLW A;  1J5E L;  2KHI A;  2F3I A;  2KCM A;  1VQ4 A;  4POF A;  4GLA C;  5IWA Q;  4DR1 Q;  1BBW A;  1XNQ Q;  4DV6 Q;  4A3G G;  1L1O B;  4DKA C;  1OXV A;  4DV5 L;  2E2I H;  2EIF A;  2UU9 Q;  4JI7 L;  4DV2 L;  3GTQ H;  3F1Z A;  1FVI A;  3TRE A;  4P71 A;  2BH8 A;  4EX5 A;  3DLL A;  4JI0 L;  1OXU A;  4JBM A;  2NZH A;  4NPS A;  2Y0S G;  3BZC A;  1J5E Q;  2UXD L;  2AKW B;  4PMW A;  3RN2 A;  4YCU A;  1KD1 C;  1A0I A;  1G6P A;  1TWF H;  1QUQ B;  2GVB A;  3LGJ A;  1G51 A;  1SMX A;  4DV2 Q;  4GOP B;  3EBE A;  4YWK A;  1UE1 A;  3Q8D A;  4HIM A;  2E2H H;  4A3M H;  3PO2 G;  4JOI C;  3CCS A;  2UXD Q;  4A3I H;  1AE2 A;  2QGQ A;  1HR0 L;  1L1O C;  3AFP A;  2B3G A;  1IL2 A;  1NTG A;  1WI5 A;  1EQR A;  2NVX H;  3J80 i;  5GAD C;  4A3F H;  1Q82 C;  1HNX L;  1NY4 A;  4YHH Q;  3CP0 A;  2JA7 H;  4DPG A;  4IOC A;  1X55 A;  3PGZ A;  1WCM G;  4UP8 A;  4DK6 C;  4UP9 A;  1HR0 Q;  3KFU A;  1VQF A;  5IE8 A;  4QGU A;  4GNX B;  4P72 A;  2ZJQ A;  1HNX Q;  3CCR A;  4JCV E;  2RCN A;  3K7U C;  4DAM A;  2PMZ E;  2YTX A;  1K8G A;  3CAM A;  1KRT A;  4P75 A;  4IPD A;  3PUV A;  5H1S E;  4QJF A;  1U0L A;  1XPO A;  1Q8K A;  2JK8 A;  4A3J H;  1XMQ L;  4L5R C;  4PZ8 A;  4BBS G;  3K8A A;  1Y1W G;  1Q1B A;  2OQK A;  4YWM A;  1SRO A;  5LMU L;  2MO0 A;  1OXX K;  1HH2 P;  1FJG Q;  2K4K A;  4LF6 Q;  4ME3 A;  4YY3 L;  4KHP Q;  2WFW A;  4H02 A;  1P16 A;  5M3F G;  1A62 A;  3HOY H;  1X65 A;  3S24 A;  3T1H L;  2RF4 A;  5IYC G;  2H5X A;  2ZTC A;  4OX9 Q;  4GNX C; 
#chains in the Genus database with same CATH topology
 4C1N I;  5KRU A;  1D2B A;  4A3B H;  5E1F A;  1AN8 A;  1WTH A;  4YY3 Q;  1ET6 A;  3GP7 A;  1BXT A;  2JSO A;  3QWN A;  4OXP A;  5IGC A;  4EQN A;  4LF9 Q;  2Z1C A;  2MQH A;  3NWS A;  2GN5 A;  1VQ6 A;  2B2Y C;  1PYB A;  3J81 E;  1B7Y B;  5D3D A;  3J80 E;  5LMN L;  2R7D A;  4I7Z C;  1VQA A;  3CC4 A;  2KEC A;  2XN9 C;  1CSP A;  1QNK A;  1BCP B;  3NK9 A;  3S1M H;  4KY6 A;  1X3Q A;  1ZYR D;  4K2L A;  5LMN Q;  4QQB X;  1KAW A;  3RZD H;  1PDQ A;  3M4Y A;  5C44 G;  1QVF A;  3K5L A;  3RN5 A;  2Z8L A;  1C48 A;  1C9O A;  2NTT A;  3UE0 A;  2D0O A;  2PZT A;  1XMO L;  2J0T D;  1BF4 A;  1H9S B;  1PH3 A;  2B8F A;  3A8I E;  2NN6 G;  4DR4 L;  2EYO A;  1LTS D;  2AMC B;  3GTM B;  1EWC A;  1SMY C;  1I4Q A;  1EY4 A;  4HJ9 A;  1XMO Q;  2I07 B;  4L6T B;  4WFN 3;  5M5X B;  2Q2U A;  4NDX A;  4DR4 Q;  3GTJ B;  2CH4 A;  3A8K E;  3W5O A;  1W6J A;  2Z4H A;  5D3I B;  2HHH L;  2AUK A;  2NWG A;  2K03 A;  1Y1W H;  1JE4 A;  1STE A;  1E1T A;  1LTL A;  2X69 A;  1I50 B;  4DA2 A;  2F3V A;  3SEB A;  4L63 B;  5GRO A;  4IUU A;  2HHH Q;  5FO8 B;  1JOO A;  2CKZ B;  4X62 Q;  2BDN A;  1U4M A;  1E7Z A;  1KHI A;  1EOT A;  5C5M A;  3HOV H;  5FOB B;  1IW7 C;  1FYC A;  3G6E A;  4X3S A;  4A3I B;  4CJ0 B;  4KHZ A;  5JAV A;  2ZM6 L;  3BVZ A;  1IZ6 A;  1KXL A;  1EZ6 A;  4YHH L;  2YTV A;  1IKM A;  2JE6 I;  1N36 Q;  1SXT A;  3TZU A;  3VA5 A;  2EYL A;  4DR6 Q;  3PIP 3;  2WKD A;  3HKS A;  3T51 B;  1DM0 B;  3S1Q H;  4WJW A;  2ZM6 Q;  1PH1 A;  1X9N A;  3PMF A;  4DK1 A;  1Z9F A;  5CV8 A;  3J80 L;  1KDA A;  3PIO 3;  2IW3 A;  2XSC A;  1B44 D;  3CU7 A;  1SYC A;  1D1I A;  5EJW A;  4BY7 B;  4DF7 A;  5FLM G;  1ESR A;  1S3O A;  1M1K C;  5C5L A;  2K14 A;  3FRP B;  1MSG A;  3ZYY X;  2M2L A;  3WWV A;  1C7Y A;  1HJP A;  2D2C C;  4QY7 A;  1MGS A;  4HJA A;  5K36 G;  4GKK Q;  4OON A;  2EQS A;  1UEB A;  2R92 H;  3KF8 B;  4KN7 C;  3E0J A;  1XNR L;  1BVS A;  3DM1 A;  1I6H H;  2E76 C;  2VXW A;  4FO2 A;  2VW9 A;  1UAP A;  4PNY A;  1TQO A;  2E2D C;  3HOZ B;  3MZ5 A;  4GNX A;  1VQC A;  2L4N A;  3SK6 A;  1ASY A;  1RF2 D;  1RIP A;  2JP1 A;  1N32 L;  3V96 A;  2UUC Q;  3T53 B;  1UUP A;  3NE5 B;  4OO1 G;  4C3J H;  3CME A;  2AHO B;  2IL8 A;  3FEW X;  2B2Y A;  4R9W A;  2NYZ D;  4JVZ A;  1KLG D;  2N3S A;  3PUW A;  3GQB A;  1GO3 E;  3ULP A;  1WTW A;  2EJF C;  4K0K L;  3JAM i;  2KQ3 A;  3UDG A;  1PZI D;  3KDF B;  1NSN S;  4HR7 B;  1A3T A;  4ZLT F;  3S17 B;  3H91 A;  5CGK A;  1GUG A;  4C2M H;  1U4L A;  1B53 A;  4DV3 L;  3M3Y B;  1O7L A;  3E5S A;  4HMJ A;  1PH2 A;  3RLF A;  1D5X C;  3DHQ A;  4A3I G;  4JI8 L;  1PA6 A;  4BBR B;  1D1K A;  2F0F A;  1UE5 A;  4IO9 A;  1SNM A;  1E2Z A;  1DON A;  4DV3 Q;  1RTN A;  4APV A;  1RL2 A;  4JI8 Q;  5BR8 L;  1Y1W B;  1VMC A;  3OHX C;  3OWE B;  3NQT A;  2JQO A;  1PZK D;  1PLF A;  2N78 A;  1IKL A;  3D6C A;  1U5K A;  2E2I B;  3DMU A;  4DUZ L;  4LFA Q;  2LKV A;  1A63 A;  3QIA A;  2IX0 A;  2R7Z H;  4BY7 G;  1PFM A;  2BA1 A;  2CVR A;  2F03 A;  2ZXR A;  1XYI A;  4RCO A;  1HA6 A;  2QA4 A;  1IXR A;  2EJG C;  1YJ9 A;  2ATW A;  2HQL A;  4DUZ Q;  2PZU A;  4H13 C;  2K5H A;  2JA5 H;  4QUC A;  4XQQ A;  2QEX A;  2K52 A;  5J1Z A;  4DNT B;  1Q1E A;  1TU2 B;  1G8Z D;  3E6Z X;  4X3U A;  4H7B A;  1EIF A;  2NTS A;  1B8A A;  4A3E H;  1EU4 A;  3KBG A;  2GA4 B;  2DNE A;  4RAU C;  1CQV A;  1X6O A;  3NTK A;  1LT3 D;  5IGE A;  3HOZ G;  4B3T Q;  4C3H H;  2AUJ D;  1E1O A;  1VS0 A;  3CPW A;  2K32 A;  1QZG A;  4KJO A;  1A3V A;  3M4O H;  1YNN C;  2PW7 A;  3E3X A;  2EXD A;  4KTA A;  5IOC A;  4IPC A;  2VQF L;  1PRT F;  1Z7T A;  4JI3 L;  3PF5 A;  5GAG C;  2B2U C;  3G71 A;  3QO2 A;  2PNH A;  1O7I A;  4NP5 A;  4JI5 L;  1I6H B;  5IYD H;  3FKI H;  3DWA A;  3CD6 A;  1A2U A;  4S3S A;  1ZEQ X;  2G9H D;  2M9V A;  1YHQ A;  4G4K A;  2VY3 A;  3EFX D;  4DAY B;  5FLX c;  3ITP A;  4JI4 L;  4JI5 Q;  4BBR G;  3O13 A;  1I4P A;  4A3G B;  1IBM L;  2RVL A;  3AU7 A;  2OTJ A;  5IP9 H;  3ULJ A;  1SNQ A;  4JI4 Q;  4GN3 B;  4NB3 A;  4QB4 A;  4L5S A;  4KKT A;  3FVQ A;  1VQJ A;  2NZ1 D;  4OIJ A;  4IFD H;  4A93 H;  3K57 A;  3A55 A;  3TN2 A;  4DU9 A;  3PO2 B;  1AP0 A;  4LWC A;  1LTB D;  1X54 A;  4N9P A;  4CDD C;  4POG A;  2BDO A;  4O2D A;  2NVY B;  1PTO H;  4KJN A;  4C3I H;  1AZP A;  1EEF D;  2B63 H;  4CDE C;  4X66 Q;  1Q8I A;  4YCV A;  4Q5V A;  1NR4 A;  4G57 A;  1WCM B;  3L0O A;  3CMA A;  4DR5 L;  1X32 A;  1PYW D;  3HRZ C;  4NXM L;  2WAQ B;  5CV5 A;  2NUC A;  5G3L D;  2JA6 H;  1SYE A;  1JWU D;  2HCC A;  4IUV A;  1N8R C;  1STB A;  3I4M H;  1SJH D;  3MXG A;  2EJM A;  1CKN B;  4DV0 L;  1JOK A;  3TP8 A;  3T56 B;  2WIN B;  3A74 A;  4NXM Q;  4IUN A;  4CKC A;  2BE5 C;  2MFI A;  1CZW A;  3Q22 A;  4DV7 L;  3KYH C;  1VQD A;  2ZXP A;  3MEH A;  4AQY L;  1GD7 A;  1D5Z C;  4IN3 A;  4DV0 Q;  3L3O C;  1I4R A;  1QG7 A;  5M3F B;  1YNX A;  3TBI B;  4G7Z C;  5JVG 3;  1E2W A;  1CSQ A;  1SBB B;  4V0B A;  3T13 A;  4FF4 A;  3GD7 A;  1VF5 C;  5EBD A;  4DV7 Q;  4AQY Q;  4IOA A;  4QF4 A;  3R93 A;  3H3V H;  5FO9 B;  1U4P A;  1H9J A;  1VQM A;  2K5V A;  4A3E B;  3LWE A;  4ZKB B;  2F0V A;  3CHB D;  4X3T A;  1EY6 A;  2DY7 A;  2F0W A;  3HOY G;  1PH6 A;  3KK7 A;  1Y8N B;  5IWA L;  1E0B A;  2PI2 E;  2AQ3 B;  5M3M H;  2KHS A;  2L9H A;  2Z4I A;  1PFN A;  4C3H B;  3K59 A;  1EY9 A;  1VQO A;  2HIV A;  1LUZ A;  1VQ4 A;  2F3I A;  2KCM A;  4GLA C;  5IWA Q;  1BBW A;  4DV6 Q;  4A3G G;  2LMC B;  3K7A B;  3FPP A;  2K5D A;  1KNE A;  4R8I A;  2TSS A;  3U9O A;  1TKW B;  3A56 A;  5CV6 A;  3I72 A;  1OXU A;  3I3C A;  5E3F A;  4NPS A;  3BZC A;  2F0U A;  4PMW A;  3RN2 A;  5C0X H;  1VDZ A;  1A0I A;  1TWF H;  5C4J B;  4G7H C;  2L5T A;  1G51 A;  1KAA A;  4YWK A;  2E2H H;  3FKI B;  4A3M H;  3PO2 G;  1EZ8 A;  1CHQ D;  5T1G A;  1HR0 L;  1RTO A;  1L1O C;  1XTC D;  3GTL B;  3TP7 A;  1NTG A;  1RHP A;  2NVX H;  4DN4 M;  4A3F H;  3SK8 A;  1H9M A;  1M4V A;  2B2U A;  1HNX L;  4RGN A;  2JA7 H;  4DK6 C;  3PGZ A;  1WCM G;  1LAC A;  1HR0 Q;  1V1P B;  3C46 A;  1TR5 A;  3Q24 A;  3NQI A;  3GTG B;  4ME5 A;  1HNX Q;  4DAM A;  3D4W A;  3K0Y A;  1TY2 A;  4A93 B;  3H0G B;  2WB1 B;  4IPD A;  5H1S E;  4QJF A;  1JB3 A;  5T1I A;  4A3J H;  4UAI A;  4L5R C;  1ENF A;  3I4L A;  2MO0 A;  2DNC A;  3DXJ C;  1DOK A;  3GV6 A;  1FJG Q;  4KHP Q;  2F0H A;  3S9W A;  4C3I B;  1D5M C;  5M3F G;  2P5Z X;  1X65 A;  3TSS A;  5IYC G;  4JV5 L;  1W6K A;  5J3B A;  4LUV A;  2K01 A;  2VZA A;  1AW7 A;  1TT2 A;  3M85 A;  1JE5 A;  5I9P A;  1A2T A;  4DV4 Q;  3CCQ A;  4DV1 L;  3MWY W;  2QCP X;  3N6R A;  1MD2 D;  1B70 B;  1L0W A;  3ERO A;  1HQR D;  4DV1 Q;  2M00 A;  1TII D;  1K0R A;  4CDC C;  2RKS A;  4ODG A;  2WKC A;  3K5N A;  3FMC A;  3MAQ A;  3S16 B;  3J80 c;  1PFB A;  3S15 B;  1ZKO A;  4A3D B;  1SE3 A;  2A5H A;  1HZB A;  2UUB Q;  1B2T A;  3V2T A;  5IGD A;  1JOR A;  2I0Q A;  2R7F A;  1A6X A;  3KJO A;  3EIV A;  4OWW B;  4IFD J;  3I7F A;  3RD4 A;  1FNW A;  3OW2 A;  1QVG A;  2WAQ E;  3FKI G;  4RCN A;  1NR2 A;  1CUK A;  5M3M B;  4UPA A;  3K80 C;  1BCP C;  5EPK A;  5FK9 C;  1WJJ A;  1TVX A;  2N49 A;  5C3X A;  2OT2 A;  5IT9 L;  4QL5 A;  5M5W B;  3KOJ A;  2LS0 1;  1CM9 A;  1DGS A;  4R1J A;  3C3L A;  2AQ1 B;  4MZ9 A;  1Y69 U;  1PVO A;  4BBS H;  1S72 A;  2XGT A;  4H0L C;  4JK1 C;  4CKB A;  5GAE C;  1YNJ D;  3FHW A;  2A8V A;  1VQI A;  1TWF B;  3STB C;  3AFQ A;  3Q6S A;  1IBK L;  4A3L G;  2QKI C;  3H0G G;  2NVT H;  5FJ8 G;  4P2C B;  1LV9 A;  4A3M B;  2LXK A;  3A0J A;  1E3P A;  3MC0 B;  4K5W A;  5JEA G;  1CQF A;  4IFD I;  2KCC A;  1CTM A;  5GQO A;  3PV0 A;  1UE7 A;  1IBK Q;  4F88 A;  5E4W C;  3S1N H;  3NBH A;  4A3F B;  2VUM B;  4C56 C;  1STY A;  4CJ1 B;  5C3E H;  4HJ5 A;  1YI2 A;  1WTO A;  5M9O A;  2IPK D;  4L5T A;  2CQO A;  3M4Q A;  4EVO A;  1FNU A;  1NAP A;  3HOW B;  1L1O A;  3S14 H;  1R9T B;  1SLJ A;  2WV6 D;  4JYA L;  3BVM A;  2BCO A;  4DR2 Q;  1BKB A;  3MXN B;  4GOP C;  2HUG A;  3P1H A;  2R93 H;  4O0A A;  4LF6 L;  2JEB I;  4GS3 A;  2Q2I A;  4PZ6 A;  4JYA Q;  4MTN A;  3D4R A;  2OTL A;  1EY0 A;  1TS3 A;  3HFZ B;  1LT4 D;  4DFA A;  1TXY A;  4OX9 L;  1SNC A;  4UP7 A;  3KF6 B;  2CCZ A;  5KNC A;  2NBF A;  1XPU A;  2UXC Q;  4A3D G;  4Y7N B;  1WTX A;  2TMP A;  3SDZ A;  1JJ2 A;  5C0X J;  1I6V C;  4KMU C;  5DM7 3;  4LF9 L;  2FMM A;  4DUY L;  3H3V I;  3R2T A;  4OWX B;  4JI6 L;  4DNI A;  4DAV A;  4TVA B;  3HOU B;  1K0S A;  1B1Z A;  1N9W A;  2WB1 E;  3OMG A;  1GUW A;  1VQ8 A;  4I7A A;  3HKZ E;  5ELC A;  4DUY Q;  1A8V A;  2C35 B;  2A69 C;  3PUZ A;  1PH4 A;  4JI6 Q;  4BXX G;  2H1E A;  3AB9 A;  1CHP D;  2O5J C;  1S4Z A;  1GKH A;  4IUQ A;  1I4X A;  1YIT A;  2PQA B;  2ID0 A;  3I2Z A;  3EA6 A;  5EAY A;  1TWA B;  2DGY A;  1Q86 C;  1SE4 A;  4IPH A;  1VQG A;  4M8A A;  1JWM D;  1JWS D;  4AYB E;  1RDP D;  3KUP A;  5L37 A;  4QUF A;  2IHE A;  1O78 A;  2G5D A;  4LMQ D;  5C0X I;  1NCV A;  2D0P A;  1MBY A;  2I5M X;  2F0T A;  4R4Q A;  4HED A;  3S1R B;  1PTO F;  1JMC A;  3Q0A A;  2PW5 A;  4A3K G;  1VQL A;  5ELO A;  2ASB A;  3TME A;  1KIX A;  1BBX C;  2VUM G;  2FHT A;  4PMB A;  1DZ1 A;  4IJL A;  3ONA B;  4PZ7 A;  5E4X A;  1NUC A;  3KLS X;  1EQQ A;  1VQH A;  3TZD A;  2B2W C;  2ICE C;  2A6H D;  4BBS B;  4F7X A;  3L2P A;  5KYI A;  5JJZ A;  3A5U A;  2EDG A;  1A15 A;  5A35 A;  3HOW G;  1LTT D;  4WJ3 M;  2V1C C;  4A3C G;  3GTQ B;  3TDQ A;  4HMI A;  1IBL L;  1V43 A;  4X62 L;  1PRT B;  1SYG A;  1EFI D;  3RUZ A;  3CF5 A;  5LMN W;  1H9S A;  4B3S L;  1DYQ A;  3OYY A;  2L0C A;  4FF2 A;  1IBL Q;  4KLK A;  1XPR A;  5DNF A;  3S1N B;  5IP7 H;  3JAM E;  1JJG A;  1N36 L;  2EY5 A;  3D0F A;  1K73 C;  3OPO A;  5A2Q L;  3GTO H;  4DR6 L;  2D9U A;  4B3S Q;  1PH8 A;  2RSO A;  2F0G A;  1BOS A;  2KJX A;  1DOL A;  1MSH A;  3DWP A;  4KY7 A;  3M4P A;  2N55 A;  3PO3 H;  3J7Z C;  4WRD A;  1WFQ A;  1IYJ B;  3QR8 A;  1GVP A;  3CRK C;  3HS0 C;  5ISR A;  3OMC A;  4EQO A;  4JBK A;  4KK7 A;  5CV7 A;  1AZQ A;  1G6Z A;  3HOU G;  1EY8 A;  2KVM A;  2RHS B;  4HSP A;  2F4I A;  2K5N A;  3VDY A;  4PQX A;  4DV5 Q;  4XDX A;  4JI7 Q;  1ICF B;  3GV3 A;  4FF3 A;  4GKK L;  3QG1 A;  2ENB A;  4O1N A;  4GOP A;  4Y52 H;  3M9B A;  3J81 i;  2JA8 H;  1H9R A;  2XTI A;  4A3B B;  1OXS C;  3ERS X;  4J6H A;  1EIH A;  1C4Q A;  1JB7 A;  1LTR D;  3S2D H;  5CR3 A;  5I9O A;  2UUC L;  5EKI A;  3JC6 6;  5BN3 A;  3NEM A;  2B8G A;  5IYB G;  1EYD A;  5JJI A;  1HXY D;  1LT6 D;  2HIX A;  1H95 A;  5BN5 A;  1JQY D;  1F2Y A;  1YNN D;  1EYG A;  2OCE A;  1ZYR C;  4EGV A;  3S1M B;  4XYQ A;  1HRJ A;  4R4O A;  2K75 A;  3RZD B;  1XMQ Q;  2B2T C;  2RBM A;  2VL6 A;  5C4H A;  4ID6 A;  2AWN A;  2ALY B;  3I8Z A;  3KF8 A;  4HJ7 A;  3OW7 A;  2WAC A;  1FR3 A;  5EGT A;  5C4X H;  5G3L F;  3JAM L;  3QJY A;  1IHZ A;  1ML0 D;  3T1H Q;  3F2D A;  2F1M A;  1XX8 A;  2OEO A;  3VR2 A;  3E0E A;  2DUD A;  5NUC A;  4BWG B;  3T16 A;  2KHJ A;  1HTL D;  3CCV A;  2NZO A;  3G6J B;  1K9M C;  2BH2 A;  4YCW A;  3VYU A;  5JJK A;  4R4T A;  3BU2 A;  3BDO A;  5IY0 A;  1WVL A;  4LFA L;  2WP8 J;  2AQ2 B;  1PTO D;  1F9S A;  1KDC A;  2BA0 A;  4DNR B;  2DJF C;  3LNN A;  3F2U A;  1C8C A;  2B2W A;  4BY1 H;  3R2I A;  1B9M A;  3KDF A;  1NBW A;  4B3R L;  4FXD A;  4ALP A;  3DUZ A;  1BBU A;  4HAE A;  3J7A V;  2Q2T A;  3I4O A;  3HOV B;  3GTO B;  4AH6 A;  4X64 L;  3I73 A;  4GN5 A;  4K6L A;  3L7Z C;  3CQZ H;  4LNQ A;  4B3R Q;  1EFW A;  4B3M L;  3D4D A;  3P75 A;  3CRL C;  3C2P A;  2CWP A;  1SYD A;  2A68 C;  1O80 A;  4DXG A;  4XQN A;  3K0X A;  5D14 A;  5JJL A;  1XNQ L;  4LJZ C;  4X64 Q;  4A3B G;  4ZUJ A;  5J22 A;  4EQ5 A;  2PI2 A;  3S1Q B;  2I46 A;  4B3T L;  4B3M Q;  3E9H A;  1PV4 A;  1LYL A;  1CKO A;  1U4R A;  2BE5 D;  3X3N A;  3D8G A;  2ZTE A;  2F0O A;  3KLW A;  2KHI A;  3C1F A;  1XNQ Q;  4DKA C;  4IZ8 A;  4EX5 A;  2BH8 A;  3MA2 B;  1LTI D;  2EYF A;  1SNP A;  4FYD A;  2A73 B;  1QUQ B;  3LGJ A;  1Y8O B;  1UE1 A;  3Q8D A;  1B3A A;  4RGT A;  5HGT A;  5DAU A;  3CCS A;  1AE2 A;  1PXU A;  3P20 A;  2R92 B;  2QGQ A;  3M7G A;  2QEJ C;  3DEO A;  1IL2 A;  3ND9 A;  1WI5 A;  1MHW C;  1EQR A;  1Q82 C;  5I6W A;  2K6A A;  4DPG A;  4IOC A;  1X55 A;  4IUT A;  4MIU A;  1OO9 B;  1HQM C;  4QGU A;  1HHV A;  1UEA B;  1QCB D;  3CCR A;  4JCV E;  4WOR A;  1KAB A;  3BVG A;  3CAM A;  1RCV D;  4C3J B;  3PUV A;  1EIG A;  1Q8K A;  2J4X A;  4IUR A;  4I65 A;  1Y1W G;  4E6I A;  5LMU L;  5HUR A;  1SRO A;  4KN4 C;  1AFP A;  4LAA A;  4H02 A;  1EYA A;  3A7L A;  2H5X A;  2HD3 A;  4X66 L;  1E2V A;  4C2M B;  5LMU Q;  1QZH A;  2Z6K C;  4DAY A;  3I4N H;  3HOV G;  3VR4 A;  1LTG D;  1W2B A;  2B2T A;  2YV5 A;  2PCF B;  2QDB A;  1QVC A;  4N9T A;  3K6O A;  2EE1 A;  2F4V L;  1K8A C;  4DR3 L;  3K5O A;  3J81 j;  3NSW A;  1HZ9 A;  1QNU A;  1I5F A;  2B39 A;  1ASZ A;  2F4V Q;  1TWC H;  3MVV A;  1B50 A;  3UI2 A;  4DR3 Q;  1WTP A;  4C1N K;  4RGM A;  1PHJ A;  4JI2 L;  2JXM B;  5COY A;  4X65 L;  1X3G A;  1PH7 A;  5CV4 A;  1NMF A;  3BG3 A;  4U68 A;  1Q81 C;  2R7Z B;  3GDE A;  1RD9 D;  1L0X B;  4IJH A;  3F2C A;  4JI2 Q;  1MJE A;  2HDL A;  4X65 Q;  2X6G A;  4Z9C B;  4LF5 Q;  4RGO S;  1PMR A;  1X3E A;  5K5P A;  2JA5 B;  5LHY 1;  2QIL A;  1B9N A;  2L15 A;  1SNO A;  2MNA A;  1SRU A;  2R92 G;  4KV6 A;  4ZAI A;  2EYH A;  4X6A H;  1EL0 A;  1CKN A;  1P8L A;  2A6E D;  4DV6 L;  4QIW B;  5KYL A;  4CDF C;  1VQP A;  4GKJ L;  1G2T A;  1FGU A;  3BYY B;  3S2H H;  5E7N A;  1JT8 A;  4N8F A;  2ES2 A;  1S40 A;  5AJ3 L;  5ELB A;  3M4O B;  4GKJ Q;  1EOV A;  1EYC A;  4C3J G;  3R3O A;  2RA4 A;  5ELN A;  3W2D A;  5BN4 A;  4N8X 1;  3T4A C;  2XNA C;  5AJ3 Q;  1D6E C;  5CV9 A;  2F0D A;  2RDG A;  1PH9 A;  3F8T A;  3NWT A;  1VMP A;  1T9H A;  2B2V C;  1BO0 A;  4RWS C;  1EEI D;  1CA5 A;  4K5X A;  3RR5 A;  2EY6 A;  3SE0 A;  1ZXT A;  1BQQ T;  2IX3 A;  2I5H A;  2XRS D;  4LFB L;  4DAP A;  3VYT A;  1UE6 A;  1WOC A;  2KCN A;  5IT9 E;  4HSV A;  1YIJ A;  3ICE A;  2ZT9 C;  5C44 H;  1JCK B;  1GUT A;  2WAQ G;  5LL6 S;  4HIK A;  1SAP A;  2MO1 A;  3I70 A;  5EPL A;  4NW2 A;  4LFB Q;  1FJG L;  1VQK A;  2O2L D;  4J15 A;  4KHP L;  1Y14 B;  4ABN A;  1CKM A;  1VCI A;  2KBN A;  2NN6 H;  2CW0 D;  3HKZ B;  1MJC A;  3GTP H;  2YYZ A;  1F2L A;  2NVQ H;  2F3W A;  4L8J A;  2R7Z G;  5AFW A;  3I4N B;  1TS5 A;  1YVC A;  1PTO B;  3M7N A;  3IFD A;  4DK3 C;  2JN4 A;  4ZKC B;  2B63 B;  4ZQ3 A;  3E9I A;  5KND A;  4NXN L;  2F0K A;  2K50 A;  2JA5 G;  1Q90 A;  4DV4 L;  4JW0 A;  4OGQ C;  1V1P A;  5KIX A;  4AYB B;  5TSS A;  2JA6 B;  2RDF A;  1YEZ A;  3NEL A;  4ZUI A;  4A4I A;  3G48 A;  4IQZ A;  2XWB B;  2Z6K A;  2Y0S B;  3RLN A;  4A3E G;  2YU9 H;  4NXN Q;  1HZA A;  3I4M B;  4M1U B;  3B6Y A;  2LY7 A;  1S5C D;  2R6G A;  3K58 A;  4C3H G;  4TKO B;  1IYU A;  1YJW A;  3BYT B;  2UUB L;  1AE3 A;  2MP1 A;  1HNZ L;  1K8M A;  1GUO A;  3BS1 A;  3CCL A;  3MTS A;  1LT5 D;  2XVS A;  3PSI A;  1KC8 C;  1VF7 A;  1NNX A;  2EXZ A;  4P74 A;  3RNU A;  2L55 A;  5HGQ A;  1YHA A;  3HEJ A;  5HY6 A;  3A8J E;  1HNZ Q;  4LF8 L;  5IGF A;  1EIY B;  3NTH A;  2OF1 A;  2E8G A;  1ICW A;  5IYD G;  1YZ6 A;  3H94 A;  4UY8 C;  2K1B A;  3PUY A;  1XTD A;  4PG3 A;  1QE6 A;  2A69 D;  2E74 C;  2E5L L;  4LF8 Q;  5FLM H;  2N8N A;  2VS1 A;  3W3A A;  3J7A F;  2EPB A;  1BR9 A;  3NP8 A;  4FDB A;  3NPP A;  5IP9 G;  3ER0 A;  5FLX L;  2IJ0 A;  2E5L Q;  3R8B A;  2VB3 X;  5JPN C;  5K36 H;  2CHB D;  1PFS A;  3U4V A;  1IYV A;  1SSO A;  3BZK A;  4BS9 A;  4YIJ A;  2HQE A;  3KLR A;  1SE8 A;  4IFD G;  2OQ0 A;  2K5W A;  4A93 G;  2WB1 G;  5I4D A;  3RZO H;  2E2H B;  3HKZ G;  1GUN A;  4FXK C;  2FFK B;  3GTM H;  3G7L A;  4OEM B;  3CC2 A;  1SMY D;  3J7Y W;  2XIW A;  1TY0 A;  5M5X H;  2R3Z A;  1E22 A;  3GO5 A;  4C3I G;  4QIW E;  2NVX B;  3GTJ H;  1PRT C;  4DXF A;  3CKI B;  3OIP A;  4NKL A;  2B63 G;  4OO1 H;  5ELF A;  5JOB A;  2JA7 B;  2RSN A;  4MHE A;  1K3B C;  3JAM c;  4XT1 B;  3HGB A;  5C44 B;  4DR2 L;  2B2V A;  3NXW A;  4AYB G;  2E2J H;  2JA6 G;  4CJ2 C;  3MFG A;  4IPG A;  4KD3 A;  1I50 H;  3UDI A;  4HTH A;  4OL7 A;  3BDC A;  2RHQ B;  3I4M G;  2VQE L;  1L0Y B;  1V8Q A;  3ND8 A;  3G4S A;  4JI0 Q;  2QF7 A;  4A3J B;  2HT1 A;  3GTP B;  4WJ4 A;  1STN A;  4MNO A;  4AIM A;  3ERQ A;  4KD4 A;  1V9P A;  4RG1 A;  2E75 C;  2UXC L;  1IW7 D;  2VQE Q;  3U58 A;  1YBY A;  4IAL A;  1Z6H A;  2IHF A;  1SYB A;  1LTA D;  3TQY A;  5I6Y A;  5A2Q E;  2FJ2 A;  4B08 A;  3EVQ A;  3H15 A;  1FD7 D;  1HZC A;  4PV1 C;  2F0L A;  4K14 A;  3WOF A;  3MXN A;  2IY5 B;  1I4G A;  5M3M G;  1ENC A;  1SDF A;  4BY7 H;  2MUY A;  3MEF A;  5ELE A;  4RKL A;  1G2S A;  1HPC A;  1ILP A;  4TRD A;  1I3Q H;  4XYO A;  4GZY C;  3PF4 A;  3KF6 A;  3K5M A;  2UUA L;  4CKE A;  1PH5 A;  2K33 A;  2JYO A;  1STH A;  1STG A;  5C0X G;  3OOC A;  3DM3 A;  2Z0S A;  5JVH 3;  3GTK H;  1NE3 A;  2Q8R E;  4J1M A;  4U67 3;  4QMG A;  2UUA Q;  3NTI A;  4L5Q A;  3IKJ A;  4A3M G;  3SR1 A;  1GM5 A;  2Q8I B;  4HJ8 A;  3HOZ H;  2Y0S E;  2EYJ A;  2BOS A;  4KKS A;  2Z6B A;  3SK4 A;  1D8L A;  4A3F G;  4K8I A;  2F0E A;  4HIO A;  2JA7 G;  1LAB A;  2OWO A;  4K8J A;  4OIK A;  1DD2 A;  4NMZ A;  3VR3 A;  1K8O A;  2VNU D;  2D5D A;  3NEN A;  1JOQ A;  1YNJ C;  2PQA A;  1VQN A;  1AH9 A;  4LF4 L;  1QWY A;  4LFC L;  4LW1 A;  4R4C A;  5M5Y H;  2NVT B;  3RZO B;  2V4D A;  1KRS A;  4OHJ A;  1EWH A;  1Q12 A;  3S17 H;  4A3J G;  3M3Y H;  1B4O A;  3LX0 A;  1DCZ A;  2KED A;  2F52 A;  2CFM A;  2NN6 I;  4LF4 Q;  4LFC Q;  3UE1 A;  3KJP A;  1FGB D;  4BBR H;  4XIG S;  1GHK A;  1Y1V H;  3EJI A;  4DR1 L;  1T5E A;  5C3E B;  3H6M A;  2UU9 L;  4HID A;  2E2J B;  3TS2 A;  4G7O C;  3HG9 A;  2ZTD A;  1J5E L;  3S14 B;  4DR1 Q;  3L9A X;  4FP5 D;  4DV5 L;  2EY1 A;  2ICI A;  3VYR A;  2E2I H;  2UU9 Q;  4JI7 L;  4DV2 L;  3FDT A;  3TRE A;  4P71 A;  1WTQ A;  3Q23 A;  2R93 B;  2LFN A;  2NZH A;  4ZYS A;  4JBM A;  1J5E Q;  4GNX C;  3HP3 A;  1G6P A;  2GVB A;  1SMX A;  4DV2 Q;  4GOP B;  1A3U A;  3EBE A;  4HIM A;  1IL8 A;  1DXM A;  4KHV A;  1ESF A;  2PQE A;  4H44 C;  4JOI C;  1J8I A;  2A68 D;  5JPM C;  4K5V A;  3HZX A;  1V1O A;  1BNZ A;  3AFP A;  3J80 i;  3J81 L;  4YHH Q;  2F0Q A;  4UP8 A;  4UP9 A;  3KFU A;  1VQF A;  2L11 A;  1S5B D;  3IFT A;  4GNX B;  1O7Z A;  2ZJQ A;  3VA7 A;  3U9S A;  1UNS A;  3K7U C;  2PMZ E;  2YTX A;  1K8G A;  1CZG A;  3SHL A;  2DJG C;  5D65 A;  1I3Q B;  1U0L A;  2JK8 A;  1XMQ L;  4PZ8 A;  4BBS G;  3K8A A;  4YWM A;  1CI3 M;  1HH2 P;  2K4K A;  1JC7 A;  4ME3 A;  1F9R A;  1P16 A;  2PNR C;  1A62 A;  3HOY H;  3GTK B;  3T1H L;  2WII B;  1EY7 A;  4FXG C;  1SFO H;  1SE2 A;  1XNR Q;  1BUV T;  4ZCK A;  2PYK A;  4A3G H;  3OIQ A;  4RHR A;  5C3E G;  3CXC A;  3WDN A;  2A6H C;  1HNW L;  4OO1 I;  1N32 Q;  2R61 A;  3D31 A;  1G29 1;  4J8Q A;  3T1Y L;  2DY8 A;  2K04 A;  1VQ5 A;  3NBI A;  3SK5 A;  3UDX A;  3TRZ A;  3V05 A;  5CMD A;  1HNW Q;  5M5Y B;  4LK1 C;  3PO2 H;  1Q3L A;  3C1E A;  2H4O A;  4KY5 A;  4JPB W;  3LWU A;  4IUP A;  1SN8 A;  3PIP A;  2R93 G;  4K0K Q;  3T1Y Q;  2LSS A;  1VQB A;  2VB2 X;  2NVY H;  1EQV A;  4JBW A;  1II3 A;  5LL6 X;  2A1A A;  3ZJY C;  1Y1V B;  2OXP A;  1J6Q A;  1X56 A;  3PIO A;  1WCM H;  1QIL A;  4K2K A;  2FIN B;  5DEH A;  3A7A B;  2A74 C;  4FF1 A;  1F77 A;  3PO3 B;  2G9D A;  4GN4 B;  3CCJ A;  5FO7 B;  3CCM A;  1EQT A;  1N33 L;  1D7Q A;  5J39 A;  2AWO A;  5BR8 Q;  2IX1 A;  1S5E D;  4FNF A;  5KEE A;  1YHB A;  5CC4 A;  4OWT B;  5C3W A;  2A19 A;  3N52 A;  2ZJR A;  1Y8P B;  5M3F H;  1N33 Q;  5I2X A;  5IYC H;  3CCE A;  1BCP F;  4BA1 I;  2FMC A;  1HFG A;  3W1G A;  4GLX A;  3QOL A;  3W1B A;  3P7J A;  1ROD A;  2JA8 B;  3MFY A;  1CFM A;  4B9X A;  4FVM A;  3U50 C;  1NJI C;  3PCO B;  3HOX H;  2ZXO A;  2F0S A;  2F0J A;  2JA9 A;  1U9R A;  1OXT A;  2F0M A;  4JOI A;  2MPM A;  4LUO A;  3S2D B;  5EPJ A;  3F2B A;  1WYD A;  1MIU A;  2HDM A;  3KLS A;  4JI1 L;  3AQQ A;  3K7A H;  1NMG A;  2UXB L;  3UDF A;  1LM0 A;  3MHB A;  3AEV A;  2O4X A;  3VYS A;  2KOL A;  1B3Q A;  1QUQ A;  1T5X D;  3I90 A;  4JI1 Q;  4F8M A;  5C4J H;  4V19 0;  2FXQ A;  2UXB Q;  4CHT B;  1X3F A;  1TS4 A;  3HOY B;  3SXH A;  3BZD B;  5IT9 c;  1ENA A;  2VQF Q;  5EBC A;  2JEA I;  4JI3 Q;  1KQS A;  5C4X B;  1GXD C;  1SFO B;  3GTL H;  4Q0F A;  3OTO L;  3I55 A;  3DEP A;  2SOB A;  5IP7 G;  3I56 A;  1Y1V G;  1TWG H;  3RMH A;  1CT1 D;  4QCL A;  1PZJ D;  2LXJ A;  2EOT A;  3VR6 A;  3OTO Q;  2PO4 A;  3BDL A;  3GTG H;  2PZW A;  1IBM Q;  3K81 C;  3FPU B;  4EQP A;  3PO3 G;  3D3R A;  3PUX A;  4A3L H;  4HN7 A;  3H0G H;  4X3K A;  5FJ8 H;  1PTO C;  1E24 A;  1SJE D;  2QW7 A;  5DLQ E;  4CGY B;  4JG2 A;  5JEA H;  5KGU A;  1FL0 A;  4TSS A;  5ELD A;  2KA7 A;  4RMF A;  4BY1 B;  1J9O A;  1H9K A;  1W3S A;  4KI0 A;  1KL9 A;  2K7V A;  5C4Z A;  1WD1 A;  4LF5 L;  4XTC S;  4LUZ A;  1I94 L;  1M90 C;  3NUC A;  1K3R A;  2MJ8 A;  2J7Z A;  1F9P A;  3CQZ B;  4KKU A;  4RH6 A;  3EN2 A;  5COR A;  3EQL C;  1I94 Q;  2JA8 G;  1HA5 A;  2HCI A;  4A76 A;  4XT3 B;  4DR5 Q;  2Z9H A;  2K5Q A;  1WTR A;  2CH4 W;  1K28 A;  2CQA A;  1OTC A;  3U4Z A;  2L1B A;  4UDU C;  5I2Y A;  2JJQ A;  3H3V C;  1TWH H;  1WD0 A;  2DN8 A;  1HUN A;  3S16 H;  4R8N A;  3S15 H;  1EUJ A;  4A3D H;  1EWI A;  5DM6 3;  4O42 A;  1ILQ A;  1K83 H;  1LLR D;  4B9W A;  1SR3 A;  3TP6 A;  3VR5 A;  4DK0 A;  4CBV A;  3H09 A;  1ONL A;  3AYH B;  1CA6 A;  3HOX B;  4BA2 I;  4A75 A;  1GHJ A;  1JR0 D;  3DWQ A;  1HFN A;  1BCP D;  3SGI A;  1UWV A;  5C4X G;  3QB3 A;  1BDO A;  2SNS A;  5M5W H;  4JBJ A;  3QOJ A;  4P73 A;  4XQJ A;  4BXX H;  1CK1 A;  2CWA A;  2YTY A;  1DOM A;  3OWF A;  4RFB A;  1R4P B;  2EZV A;  4PMC A;  3CC7 A;  2KCT A;  5IGB A;  5EKK A;  3STB D;  1HCZ A;  3BJU A;  4DR7 L;  5FLX E;  4MTK A;  1Z47 A;  2Q2H A;  1N34 L;  3FP9 A;  4BY1 G;  1L2F A;  2F0I A;  1WTV A;  4A3K H;  1MKH A;  1F9Q A;  2VUM H;  4DR7 Q;  1QJO A;  5IGG A;  1YJN A;  1PRT D;  1TWG B;  1VQ7 A;  3IRB A;  1N34 Q;  2QDL A;  4HCS A;  2XWJ B;  1I4H A;  5FKA C;  5IOD A;  1AEX A;  1QB5 D;  4YWL A;  3X3M A;  3WOE A;  3HOW H;  5F2D A;  2KEE A;  2B29 A;  4OEL B;  1X3P A;  2SEB D;  4RHS A;  5KNB A;  1R9T H;  4A3C H;  4R4I A;  1XXG A;  3J7A 5;  4LF7 L;  3RLO A;  1EU3 A;  4RA8 A;  1V1Q A;  1HR0 W;  1XJV A;  1TWC B;  2ZJP A;  2C9O A;  1QOH A;  2SNM A;  3CCU A;  1KDB A;  1M8A A;  3TS0 A;  5EKL A;  4LF7 Q;  1G91 A;  1S5D D;  1R4Q B;  3CPF A;  1PYS B;  1F2M A;  2Q8T A;  1ET9 A;  2K28 A;  4Y7N H;  1XWE A;  1RJT A;  4F87 A;  2IT1 A;  5C6A A;  2F0P A;  4JV5 Q;  1JJC B;  5EQ0 A;  1DJR D;  3CW2 C;  1GOZ A;  1Q46 A;  3HOX G;  2SDF A;  3HOU H;  3A54 A;  4DGZ A;  2A6E C;  2GVA A;  4MN3 A;  1Q7Y C;  1SEB D;  2KEN A;  3IAY A;  1C0A A;  3D6W A;  3S2H B;  1GJX A;  2N88 A;  1HUM A;  1TS2 A;  1TWH B;  3J81 c;  4GLV B;  1STA A;  3A5Z B;  3SVM A;  2EYP A;  3PQI A;  1VQE A;  2I5L X;  1TWA H;  3I91 A;  3MXU A;  1K83 B;  1KLU D;  1JIC A;  4JC0 A;  5GAH C;  3KBX A;  3ULL A;  4TQU S;  5JEA J;  1RKN A;  1LO5 D;  1EY5 A;  3S1R H;  4ZK9 B;  4RKB A;  3NBH B;  5IYB H;  4UHV A;  4ULL A;  2D62 A;  3TEH B;  3OSO A;  2PPB C;  1KTK A;  3I4N G;  2X6L A;  1VQ9 A;  2F0N A;  1GUS A;  4ZRZ A;  4POF A;  1S5F D;  1L1O B;  1SND A;  1OXV A;  2EIF A;  3GTQ H;  2EY2 A;  3F1Z A;  1FVI A;  4JI0 L;  3DLL A;  1HTP A;  2UXD L;  2Y0S G;  2AKW B;  1F2Z A;  4YCU A;  3URY A;  1KD1 C;  2RCF A;  2CW0 C;  3AMU A;  2PMZ B;  4A3K B;  3MXP A;  2NVQ B;  4XXE A;  2UXD Q;  4A3I H;  2MHV A;  2RQX A;  2RDH A;  2B3G A;  2L12 A;  5GAD C;  3IL8 A;  1O7Y A;  1NY4 A;  2IWH A;  2EYM A;  3CP0 A;  4HCE A;  2NB0 A;  2XRQ D;  3NHH A;  2EVB A;  5IE8 A;  1MI2 A;  4P72 A;  5IIF A;  2YU9 B;  2MGS A;  2RCN A;  2KUM A;  4K6D A;  1FNV A;  3TP5 A;  1KRT A;  4P75 A;  1XPO A;  2K05 A;  4ILW A;  1KNA A;  1Q1B A;  2OQK A;  1OXX K;  4LF6 Q;  2O5I C;  4YY3 L;  2WFW A;  5CYU A;  5CBA E;  3S24 A;  2RF4 A;  1SYF A;  5CBE E;  2ZTC A;  4OX9 Q;  2C5C A; 
#chains in the Genus database with same CATH homology
 5LMU Q;  5J3B A;  4A3B H;  1QZH A;  4LUV A;  2Z6K C;  3I4N H;  3HOV G;  1W2B A;  2VZA A;  4YY3 Q;  1SFO H;  2YV5 A;  1XNR Q;  4OXP A;  3M85 A;  1QVC A;  4LF9 Q;  2F4V L;  2MQH A;  1K8A C;  1JE5 A;  2GN5 A;  4A3G H;  4DV4 Q;  1VQ6 A;  3CCQ A;  1PYB A;  4DV1 L;  4DR3 L;  3J81 j;  1B7Y B;  5C3E G;  3CXC A;  5LMN L;  2R7D A;  1VQA A;  3CC4 A;  1HNW L;  1HZ9 A;  4OO1 I;  1N32 Q;  1B70 B;  1L0W A;  3D31 A;  4X66 L;  1G29 1;  1I5F A;  1ASZ A;  2F4V Q;  1TWC H;  1CSP A;  3T1Y L;  4DV1 Q;  4DR3 Q;  3S1M H;  4JI2 L;  1VQ5 A;  1PHJ A;  3UDX A;  4X65 L;  1K0R A;  1X3G A;  5LMN Q;  1KAW A;  3RZD H;  1PH7 A;  3TRZ A;  4QQB X;  1HNW Q;  1NMF A;  3PO2 H;  5C44 G;  1QVF A;  3RN5 A;  3J80 c;  1Q81 C;  1C9O A;  1SN8 A;  3PIP A;  2R93 G;  3UE0 A;  2D0O A;  3GDE A;  4K0K Q;  4IJH A;  3T1Y Q;  1HZB A;  1VQB A;  2LSS A;  2NVY H;  4JBW A;  4JI2 Q;  3F2C A;  1XMO L;  1MJE A;  2UUB Q;  4X65 Q;  1PH3 A;  2I0Q A;  2R7F A;  2A1A A;  3KJO A;  3EIV A;  3ZJY C;  4LF5 Q;  3I7F A;  4OWW B;  1X3E A;  4IFD J;  2NN6 G;  4DR4 L;  3OW2 A;  2AMC B;  1J6Q A;  1X56 A;  2WAQ E;  3PIO A;  1QVG A;  1WCM H;  3FKI G;  1CUK A;  2L15 A;  4UPA A;  4HJ9 A;  1XMO Q;  3K80 C;  2MNA A;  1SRU A;  2R92 G;  1WJJ A;  2Q2U A;  4X6A H;  2N49 A;  4DR4 Q;  4QL5 A;  1CKN A;  3KOJ A;  1P8L A;  1DGS A;  4DV6 L;  4GN4 B;  4R1J A;  3W5O A;  3CCJ A;  3CCM A;  1VQP A;  1N33 L;  2HHH L;  4GKJ L;  1FGU A;  3S2H H;  1D7Q A;  4MZ9 A;  5E7N A;  1PVO A;  4BBS H;  2AWO A;  5BR8 Q;  1Y1W H;  1JT8 A;  1S72 A;  2XGT A;  1E1T A;  1LTL A;  2IX1 A;  2ES2 A;  1YHB A;  5AJ3 L;  4OWT B;  5GAE C;  1S40 A;  2A19 A;  3FHW A;  5GRO A;  2ZJR A;  5M3F H;  1VQI A;  2A8V A;  3STB C;  1N33 Q;  2HHH Q;  1EOV A;  3AFQ A;  4GKJ Q;  1IBK L;  5IYC H;  3CCE A;  4A3L G;  2NVT H;  3H0G G;  5FJ8 G;  2CKZ B;  4X62 Q;  5ELN A;  1E7Z A;  1KHI A;  2LXK A;  3A0J A;  1E3P A;  4BA1 I;  5AJ3 Q;  3HOV H;  3G6E A;  5JEA G;  4IFD I;  3W1G A;  4GLX A;  5GQO A;  3PV0 A;  4KHZ A;  3W1B A;  1UE7 A;  2ZM6 L;  1PH9 A;  1IBK Q;  1IZ6 A;  3S1N H;  1KXL A;  3F8T A;  4YHH L;  1T9H A;  2YTV A;  2JE6 I;  1N36 Q;  5C3E H;  4HJ5 A;  3U50 C;  1YI2 A;  4DR6 Q;  1NJI C;  3PCO B;  3HOX H;  3HKS A;  3S1Q H;  4L5T A;  3RR5 A;  2CQO A;  3M4Q A;  2JA9 A;  4JOI A;  1OXT A;  4LUO A;  2ZM6 Q;  1X9N A;  1PH1 A;  3F2B A;  1Z9F A;  2I5H A;  1WYD A;  1MIU A;  1L1O A;  3S14 H;  4LFB L;  1UE6 A;  1WOC A;  4JI1 L;  3AQQ A;  1SLJ A;  3K7A H;  3ICE A;  1YIJ A;  1NMG A;  4JYA L;  2UXB L;  3UDF A;  1LM0 A;  5C44 H;  4DR2 Q;  1BKB A;  3MXN B;  2WAQ G;  4GOP C;  4HIK A;  2MO1 A;  3AEV A;  2R93 H;  4O0A A;  5FLM G;  1S3O A;  4LFB Q;  1M1K C;  1VQK A;  2K14 A;  4J15 A;  4LF6 L;  1FJG L;  1QUQ A;  2JEB I;  4GS3 A;  1Y14 B;  2Q2I A;  4KHP L;  4PZ6 A;  1CKM A;  4JI1 Q;  1VCI A;  2KBN A;  2FXQ A;  5C4J H;  4MTN A;  1X3F A;  3WWV A;  2OTL A;  4JYA Q;  2UXB Q;  1C7Y A;  1MJC A;  3HFZ B;  3GTP H;  1HJP A;  1TXY A;  5IT9 c;  2YYZ A;  4QY7 A;  4OX9 L;  2NVQ H;  4UP7 A;  4HJA A;  3KF6 B;  2CCZ A;  2VQF Q;  5K36 G;  4GKK Q;  4OON A;  2EQS A;  2R7Z G;  1XPU A;  1UEB A;  1YVC A;  4JI3 Q;  2JEA I;  2R92 H;  3KF8 B;  4A3D G;  2UXC Q;  1KQS A;  3M7N A;  1JJ2 A;  3GTL H;  5C0X J;  1XNR L;  4DK3 C;  1BVS A;  3OTO L;  3I55 A;  1I6H H;  3E9I A;  4LF9 L;  4NXN L;  5IP7 G;  2K50 A;  2JA5 G;  3I56 A;  2VW9 A;  4DV4 L;  1Y1V G;  4DUY L;  1TWG H;  3H3V I;  4OWX B;  4JI6 L;  2LXJ A;  4GNX A;  1VQC A;  1ASY A;  1RIP A;  4DNI A;  1YEZ A;  3NEL A;  4TVA B;  4A4I A;  3G48 A;  3OTO Q;  4A3E G;  2Z6K A;  3RLN A;  2YU9 H;  2UUC Q;  3GTG H;  1N32 L;  1N9W A;  4NXN Q;  1HZA A;  2WB1 E;  1VQ8 A;  3HKZ E;  1IBM Q;  3K81 C;  3B6Y A;  4DUY Q;  4OO1 G;  1A8V A;  2C35 B;  2R6G A;  1PH4 A;  3PUZ A;  4C3J H;  3PUX A;  3CME A;  4JI6 Q;  3PO3 G;  2AHO B;  3H0G H;  5FJ8 H;  4A3L H;  1E24 A;  2N3S A;  5DLQ E;  3PUW A;  1GO3 E;  4JG2 A;  1FL0 A;  1YJW A;  3ULP A;  4K0K L;  1GKH A;  4RMF A;  2UUB L;  1YIT A;  1AE3 A;  2PQA B;  1W3S A;  4KI0 A;  3JAM i;  1KL9 A;  2ID0 A;  3I2Z A;  3UDG A;  5EAY A;  2DGY A;  1Q86 C;  1HNZ L;  4LF5 L;  4XTC S;  4IPH A;  1VQG A;  3KDF B;  3CCL A;  4LUZ A;  1I94 L;  3PSI A;  4AYB E;  1M90 C;  1KC8 C;  4C2M H;  2IHE A;  4DV3 L;  4P74 A;  5C0X I;  3RNU A;  1PH2 A;  2D0P A;  3RLF A;  1YHA A;  5HGQ A;  1K3R A;  4A3I G;  5HY6 A;  2I5M X;  4R4Q A;  4JI8 L;  1HNZ Q;  1EIY B;  4LF8 L;  1PA6 A;  3EN2 A;  1JMC A;  1I94 Q;  2E8G A;  1UE5 A;  4IO9 A;  4A3K G;  5ELO A;  1VQL A;  2JA8 G;  2ASB A;  5IYD G;  1YZ6 A;  4A76 A;  4DV3 Q;  4DR5 Q;  1KIX A;  4UY8 C;  3PUY A;  4APV A;  2VUM G;  1RL2 A;  4IJL A;  1XTD A;  4PG3 A;  4PZ7 A;  1EQQ A;  1VQH A;  4JI8 Q;  2E5L L;  4LF8 Q;  5BR8 L;  5FLM H;  3L2P A;  2N8N A;  2JQO A;  2VS1 A;  1OTC A;  3A5U A;  3U4Z A;  3HOW G;  4WJ3 M;  2V1C C;  2N78 A;  1U5K A;  4A3C G;  4FDB A;  2JJQ A;  4DUZ L;  5IP9 G;  3ER0 A;  4LFA Q;  1IBL L;  2E5L Q;  1V43 A;  4X62 L;  1TWH H;  1A63 A;  3S16 H;  2IX0 A;  2R7Z H;  1PFS A;  3U4V A;  5LMN W;  3CF5 A;  4BY7 G;  3S15 H;  1EUJ A;  4A3D H;  2BA1 A;  1EWI A;  4B3S L;  3BZK A;  3OYY A;  2QA4 A;  1IXR A;  1YJ9 A;  2ATW A;  2HQL A;  4DUZ Q;  1SE8 A;  4IFD G;  2OQ0 A;  1IBL Q;  4KLK A;  1XPR A;  1K83 H;  2WB1 G;  3RZO H;  5IP7 H;  1SR3 A;  2K5H A;  3HKZ G;  2JA5 H;  2QEX A;  1N36 L;  2K52 A;  3GTM H;  1JJG A;  3D0F A;  1Q1E A;  1K73 C;  3GTO H;  4DR6 L;  3AYH B;  4B3S Q;  3CC2 A;  1PH8 A;  4BA2 I;  4JV5 L;  1EIF A;  4A75 A;  1B8A A;  4A3E H;  3SGI A;  5M5X H;  1UWV A;  1E22 A;  3GO5 A;  5C4X G;  4QIW E;  3GTJ H;  5M5W H;  4JBJ A;  2B63 G;  3M4P A;  1X6O A;  4P73 A;  3PO3 H;  4BXX H;  3J7Z C;  1WFQ A;  1IYJ B;  2CWA A;  1GVP A;  3JAM c;  3HOZ G;  4A93 G;  4DR2 L;  2YTY A;  4AYB G;  4C3H H;  4B3T Q;  2E2J H;  2JA6 G;  1E1O A;  1VS0 A;  4JBK A;  4IPG A;  3CPW A;  1I50 H;  3UDI A;  2RHS B;  3HOU G;  1QZG A;  4BXX G;  2K5N A;  2RHQ B;  3VDY A;  3I4M G;  3M4O H;  2VQE L;  4DV5 Q;  3CC7 A;  2KCT A;  4JI7 Q;  3STB D;  2EXD A;  3G4S A;  4JI0 Q;  3BJU A;  2HT1 A;  4WJ4 A;  4IPC A;  4DR7 L;  1Z47 A;  4MNO A;  2Q2H A;  4AIM A;  2VQF L;  4GKK L;  1V9P A;  4RG1 A;  4JI3 L;  5GAG C;  3PF5 A;  3FP9 A;  1N34 L;  3G71 A;  4GOP A;  4BY1 G;  2UXC L;  1L2F A;  2VQE Q;  3U58 A;  4Y52 H;  2PNH A;  3M9B A;  1O7I A;  3J81 i;  2JA8 H;  4A3K H;  1YBY A;  4JI5 L;  2XTI A;  5IYD H;  3FKI H;  1MKH A;  2VUM H;  4DR7 Q;  2IHF A;  3CD6 A;  1OXS C;  1YJN A;  1VQ7 A;  3ERS X;  3IRB A;  1N34 Q;  3TQY A;  1YHQ A;  2VY3 A;  4DAY B;  1JB7 A;  5FLX c;  3S2D H;  3H15 A;  1HZC A;  4YWL A;  4JI4 L;  4JI5 Q;  4BBR G;  2UUC L;  3HOW H;  3JC6 6;  3NEM A;  2B29 A;  1IBM L;  1R9T H;  4A3C H;  5IYB G;  2OTJ A;  4R4I A;  5IP9 H;  5JJI A;  2IY5 B;  2HIX A;  3ULJ A;  1H95 A;  5M3M G;  3J7A 5;  4LF7 L;  1EYG A;  4JI4 Q;  4GN3 B;  4BY7 H;  3MEF A;  4NB3 A;  3RLO A;  2OCE A;  1V1Q A;  1HR0 W;  1XJV A;  4L5S A;  2ZJP A;  1VQJ A;  3CCU A;  4A93 H;  1I3Q H;  4R4O A;  2K75 A;  3TS0 A;  4LF7 Q;  3PF4 A;  3KF6 A;  2UUA L;  1XMQ Q;  4LWC A;  1X54 A;  3CPF A;  1PH5 A;  2VL6 A;  1PYS B;  2AWN A;  2ALY B;  4POG A;  4HJ7 A;  4O2D A;  4Y7N H;  4C3I H;  5C4X H;  5C0X G;  3DM3 A;  2Z0S A;  2IT1 A;  3GTK H;  1NE3 A;  2B63 H;  3T1H Q;  3F2D A;  4JV5 Q;  2UUA Q;  4X66 Q;  4L5Q A;  4YCV A;  1JJC B;  3E0E A;  3L0O A;  3CMA A;  2DUD A;  4DR5 L;  4A3M G;  1GM5 A;  4HJ8 A;  3HOZ H;  2Y0S E;  2KHJ A;  4NXM L;  3CW2 C;  3CCV A;  1K9M C;  2NZO A;  1Q46 A;  3HOX G;  2JA6 H;  2BH2 A;  4YCW A;  5JJK A;  4R4T A;  3HOU H;  3BU2 A;  2GVA A;  1D8L A;  1N8R C;  4A3F G;  1Q7Y C;  3I4M H;  4HIO A;  1CKN B;  2KEN A;  4DV0 L;  2JA7 G;  1C0A A;  3A74 A;  2OWO A;  5IY0 A;  4NXM Q;  4LFA L;  2WP8 J;  2MFI A;  3J81 c;  4GLV B;  2VNU D;  2BA0 A;  3NEN A;  3A5Z B;  4DV7 L;  3KYH C;  2PQA A;  1VQD A;  4AQY L;  1VQN A;  1GD7 A;  4BY1 H;  1AH9 A;  4DV0 Q;  4LF4 L;  4LFC L;  1VQE A;  1YNX A;  3KDF A;  2I5L X;  1TWA H;  4LW1 A;  1NBW A;  4R4C A;  4B3R L;  4ALP A;  5M5Y H;  1BBU A;  1CSQ A;  1KRS A;  1Q12 A;  3GD7 A;  2Q2T A;  3I4O A;  4JC0 A;  5GAH C;  4A3J G;  4DV7 Q;  3M3Y H;  3S17 H;  3ULL A;  4AQY Q;  4IOA A;  4AH6 A;  4TQU S;  4X64 L;  5JEA J;  3H3V H;  4LF4 Q;  4LFC Q;  2F52 A;  2CFM A;  2NN6 I;  4GN5 A;  3L7Z C;  3CQZ H;  3UE1 A;  4LNQ A;  3KJP A;  1VQM A;  2K5V A;  3S1R H;  4BBR H;  1EFW A;  4B3M L;  4B3R Q;  2CWP A;  4XIG S;  3HOY G;  1Y1V H;  3K0X A;  3NBH B;  5IYB H;  4DR1 L;  5IWA L;  1PH6 A;  2D62 A;  1XNQ L;  5JJL A;  2PI2 E;  3TEH B;  5M3M H;  4X64 Q;  4A3B G;  3I4N G;  2UU9 L;  4EQ5 A;  2PI2 A;  1VQ9 A;  4B3T L;  4HID A;  4B3M Q;  3E9H A;  1VQO A;  2HIV A;  1PV4 A;  1LYL A;  1CKO A;  1LUZ A;  2ZTD A;  3TS2 A;  2ZTE A;  3KLW A;  1J5E L;  2KHI A;  2F3I A;  2KCM A;  1VQ4 A;  4POF A;  4GLA C;  5IWA Q;  4DR1 Q;  1BBW A;  1XNQ Q;  4DV6 Q;  4A3G G;  1L1O B;  4DKA C;  1OXV A;  4DV5 L;  2E2I H;  2EIF A;  2UU9 Q;  4JI7 L;  4DV2 L;  3GTQ H;  3F1Z A;  1FVI A;  3TRE A;  4P71 A;  2BH8 A;  4EX5 A;  3DLL A;  4JI0 L;  1OXU A;  4JBM A;  2NZH A;  4NPS A;  2Y0S G;  3BZC A;  1J5E Q;  2UXD L;  2AKW B;  4PMW A;  3RN2 A;  4YCU A;  1KD1 C;  1A0I A;  1G6P A;  1TWF H;  1QUQ B;  2GVB A;  3LGJ A;  1G51 A;  1SMX A;  4DV2 Q;  4GOP B;  3EBE A;  4YWK A;  1UE1 A;  3Q8D A;  4HIM A;  2E2H H;  4A3M H;  3PO2 G;  4JOI C;  3CCS A;  2UXD Q;  4A3I H;  1AE2 A;  2QGQ A;  1HR0 L;  1L1O C;  3AFP A;  2B3G A;  1IL2 A;  1NTG A;  1WI5 A;  1EQR A;  2NVX H;  3J80 i;  5GAD C;  4A3F H;  1Q82 C;  1HNX L;  1NY4 A;  4YHH Q;  3CP0 A;  2JA7 H;  4DPG A;  4IOC A;  1X55 A;  3PGZ A;  1WCM G;  4UP8 A;  4DK6 C;  4UP9 A;  1HR0 Q;  3KFU A;  1VQF A;  5IE8 A;  4QGU A;  4GNX B;  4P72 A;  2ZJQ A;  1HNX Q;  3CCR A;  4JCV E;  2RCN A;  3K7U C;  4DAM A;  2PMZ E;  2YTX A;  1K8G A;  3CAM A;  1KRT A;  4P75 A;  4IPD A;  3PUV A;  5H1S E;  4QJF A;  1U0L A;  1XPO A;  1Q8K A;  2JK8 A;  4A3J H;  1XMQ L;  4L5R C;  4PZ8 A;  4BBS G;  3K8A A;  1Y1W G;  1Q1B A;  2OQK A;  4YWM A;  1SRO A;  5LMU L;  2MO0 A;  1OXX K;  1HH2 P;  1FJG Q;  2K4K A;  4LF6 Q;  4ME3 A;  4YY3 L;  4KHP Q;  2WFW A;  4H02 A;  1P16 A;  5M3F G;  1A62 A;  3HOY H;  1X65 A;  3S24 A;  3T1H L;  2RF4 A;  5IYC G;  2H5X A;  2ZTC A;  4OX9 Q;  4GNX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...