4LF8Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8Q00
1KQSA 1IL2A 2YTVA 3E0EA 4DV5Q 2DGYA 4HIKA 3HOVH 2MO0A 2YTXA 4LNQA 4B3TQ 3RLFA 4GKJQ 5J3BA 5AJ3L 3KJOA 4O0AA 2K5VA 4C3HH 2Q2HA 4DR5L 1YJ9A 1J5EQ 1TWFH 3L0OA 3E9IA 1PA6A 1PH8A 4A3EG 3S14H 2JA5G 3KYHC 1KC8C 1GKHA 2KBNA 3B6YA 3U4ZA 2MNAA 1XMQL 1LM0A 2AMCB 1PH5A 4NXNQ 4R1JA 4DR1Q 3I4NH 3PV0A 1K8AC 1V1QA 2ZJQA 1NBWA 4L5SA 1MJCA 1X65A 2UXCL 3UDIA 1FJGL 3KF8B 1Q81C 2E2IH 4A3BH 3CMAA 4JV5Q 3S1RH 5BR8Q 3W5OA 5C3EH 4HJ7A 4B3RL 4B3ML 3OTOL 3M85A 4DAMA 5JJIA 1KHIA 1DGSA 2JE6I 4ALPA 4EQ5A 4JBWA 2NVYH 3H0GG 4DK6C 4JI1L 5JJLA 1SRUA 1VQNA 3CCMA 3M9BA 4H02A 4DV0L 1MIUA 4AYBG 3UE1A 1GM5A 4JI4L 1XNRQ 4GOPA 5IE8A 1I6HH 1Z47A 1E1OA 2UUCL 3PO3G 5JJKA 4UY8C 3I4MH 1Q8KA 4MTNA 2NVTH 5K36G 1LYLA 3CF5A 4JI3L 3JAMc 5LMNW 1LUZA 2QA4A 3GTLH 5GAHC 5C3EG 2ZJPA 2Q2TA 2YU9H 1HNZL 2PQAA 1FL0A 2ID0A 4DV7Q 3TS2A 4IPGA 4LF7L 3I4NG 4J15A 3S1NH 4P71A 1ASYA 2RHSB 3GD7A 4DUZQ 3K81C 4JI7L 3HOXH 4YCWA 2F4VQ 3K80C 3U58A 4DR6L 1S72A 4BA2I 1OXSC 3F1ZA 3AFPA 2RF4A 3G4SA 4DV4Q 1R9TH 1VQ9A 4JI2L 5C0XI 3S16H 1CKMA 3J7A5 1VQJA 4LFBL 1Q7YC 1PFSA 3PUZA 1K73C 4X62Q 2WFWA 3GTJH 3E9HA 1EIFA 4LF4L 2HHHL 3S15H 2PMZE 1PH4A 1SMXA 1LTLA 4HIMA 4PG3A 1ASZA 2IT1A 2KCMA 4IFDJ 1HZBA 2VNUD 2B29A 2ZTCA 2HIXA 3JC66 2JQOA 4JYAL 1U0LA 2XTIA 4BBSG 1G291 3I7FA 1OXXK 3I4MG 1QZHA 2GVAA 1N33L 3A5UA 4A75A 1KL9A 1L1OC 4DR7L 1E7ZA 2NZOA 4AH6A 3TREA 1PHJA 2AKWB 1M1KC 1Q1EA 2R93H 3KF6A 1X55A 1XTDA 4GN3B 3PSIA 3S24A 4ME3A 1L1OA 2VQFL 1YNXA 4IFDG 3K7UC 1EIYB 1KAWA 4GKKL 4K0KQ 4BA1I 2PI2E 3HFZB 3TS0A 1HNWL 3PF5A 3D0FA 5H1SE 1RL2A 1Q82C 1SLJA 2VL6A 3J80i 4DUYQ 2I0QA 4P75A 2VQEQ 3WWVA 3CCRA 4HJ8A 1S40A 3F2BA 3HOZH 4A3IG 1XPUA 4R4QA 2K14A 2I5MX 3RN5A 1SN8A 1BVSA 2YTYA 4DV1L 2NZHA 1X6OA 1TWHH 1TWCH 1VQOA 4BBRH 3PF4A 5M5YH 4AQYL 2AHOB 4X6AH 2Z6KA 3K8AA 4P74A 2K50A 4YWKA 4BY1H 4JI0L 5IYBH 5FLMH 3PO2G 4DR2L 2CWAA 1M90C 2F3IA 3NELA 1E24A 4GNXB 4DR3Q 3W1BA 1XJVA 3ICEA 2K5HA 5M3FH 4C2MH 4JI8L 1Q12A 3J7ZC 4DV2L 1N36L 1YJNA 2R7DA 4C3JH 5JEAJ 4LFAQ 5FJ8G 1JT8A 4QY7A 2ZM6Q 4KHPQ 5C0XJ 4UP7A 1RIPA 4YHHQ 4PZ6A 4X66L 4A3KG 1YI2A 2UXDL 4JCVE 3S1QH 2H5XA 4A3MH 4DV6L 5LMNQ 4JI6Q 3PGZA 4BXXH 4X64L 5IP7H 2VS1A 1PH7A 1UE5A 3DLLA 1B7YB 1VCIA 4XIGS 1IYJB 3ULLA 3G6EA 1N8RC 1N34L 3NENA 1I94Q 2UUBL 2JA8H 1VQ8A 1D8LA 4MNOA 1HR0Q 5IT9c 3Q8DA 4GLVB 2ZJRA 1XPRA 1P16A 1I5FA 5GROA 5FJ8H 1PH3A 3CMEA 1PH6A 2N3SA 3A74A 4WJ3M 1A0IA 3CC2A 4YWMA 4LFCL 3KDFB 3UDGA 4A3LH 3G71A 5IWAL 1YJWA 2PNHA 4JC0A 4OX9Q 1K83H 1CKNB 2JA5H 2UU9Q 4IFDI 2CCZA 2AWNA 1HNXQ 2JK8A 4DNIA 2Z6KC 4IPHA 1CKOA 3FKIH 3BZCA 3PUWA 4TQUS 3CPWA 3S2HH 2LXKA 1A62A 1TXYA 4JI5L 2QGQA 4X65L 3I55A 5M5WH 3ULJA 4HJ9A 4A3KH 2E2HH 1VQ4A 1XNQQ 1EFWA 5JEAG 3KOJA 1PH9A 4PMWA 1IBMQ 2GN5A 3CAMA 3M4PA 4JOIA 1IBKL 4B3SL 3T1YQ 2ASBA 3M4QA 4LF8Q 3U50C 1Y1WH 2UXBQ 3CCSA 3AYHB 5IP7G 3F2DA 1PH2A 1N32Q 4LF6Q 1H95A 1WOCA 5LMUQ 1G6PA 4LF5L 2Q2IA 4JOIC 2R92H 4DR4Q 4R4OA 1OXTA 1KD1C 2JEAI 2CFMA 1XMOL 4YY3Q 2UUAQ 1N9WA 4RMFA 4A3CG 1B8AA 1V43A 3PIPA 1WI5A 1IBLQ 1VQLA 3RLOA 2KCTA 1BKBA 2N78A 4XTCS 4OONA 5GAGC 3CPFA 1IXRA 3H15A 2R7ZH 4DV3Q 3G48A 2WB1E 4A3GG 5M5XH 4LF9Q 4A4IA 3S2DH 4NB3A 3RN2A 1HZCA 3T1HL 5C44H 1VQPA 1TWGH 1NY4A 1HZAA 1OXVA 4R4CA 5C0XG 1PH1A 1I3QH 4A3LG 3MEFA 4YCVA 4NXML 4QIWE 2E5LQ 3IRBA 3W1GA 5IYDG 1Y1WG 2Q2UA 3HKZE 2A8VA 2RHQB 2VUMH 2IHEA 3ZJYC 3GDEA 1QZGA 4DV5L 1AH9A 4IOCA 1NJIC 3HOUH 1JJCB 3KJPA 5GQOA 2I5HA 3PUXA 1HR0W 4B3TL 4OXPA 3FHWA 4IJLA 5AJ3Q 4DR5Q 1JB7A 4GKJL 1J5EL 5IYBG 5FLMG 1VQKA 4L5QA 2LSSA 2R7ZG 4TVAB 4JG2A 1XMQQ 4UP8A 1BBUA 2R7FA 4NXNL 5M3FG 4A3FG 5C44G 4RG1A 2WB1G 4DR1L 2IY5B 4A3JG 4A3EH 1WCMG 4A3IH 4LW1A 3NEMA 4AYBE 2UXCQ 2K5NA 1FJGQ 1UE1A 3TQYA 4JV5L 4Y52H 1EQRA 4IPDA 5BR8L 4B3RQ 2BA1A 3PCOB 1PVOA 2DUDA 3OTOQ 3UDFA 4B3MQ 3ER0A 4JBKA 2WAQG 3CXCA 2ZTEA 1AE3A 3HOUG 3HOWH 3RZOH 4OO1I 2K75A 4A3MG 3GTPH 4JI1Q 4A93H 3RR5A 3D31A 3K0XA 3BJUA 4YCUA 2KHJA 3J81i 4DV0Q 4JI4Q 5ELOA 1XNRL 2YYZA 3M4OH 3TRZA 5M3MH 2EXDA 3L2PA 4OO1G 1HH2P 1OTCA 1V9PA 2YV5A 3CW2C 3NBHB 2CQOA 4LUZA 2F52A 3UDXA 1D7QA 3HKSA 2UUCQ 1J6QA 2WP8J 1YHQA 4JBMA 3GTOH 3I2ZA 3HKZG 4JI3Q 2R6GA 1VS0A 1Y14B 4HIOA 3TEHB 2ALYB 5GAEC 4A3DH 1VQAA 1HNZQ 4LUVA 3HOXG 5FLXc 4BXXG 4DV7L 3M7NA 4GS3A 3I56A 4LF7Q 1C0AA 1QUQB 1BBWA 4POGA 3H3VH 1KRTA 4A3FH 4DUZL 2E2JH 4JI7Q 4DPGA 4L5RC 4BBSH 1I50H 1VQDA 2F4VL 3KFUA 4DR6Q 1EYGA 1YITA 3KF6B 1OXUA 1S3OA 1X3GA 2V1CC 4FDBA 3GTMH 2N49A 3S1MH 2HQLA 2HIVA 3PUYA 4DV4L 4JI2Q 3RZDH 1SFOH 3CCLA 2VY3A 1Z9FA 1UWVA 2ES2A 4WJ4A 3CP0A 2B63G 4LFBQ 3I4OA 1X56A 3CCEA 4X62L 4A93G 1CSPA 4LF4Q 2HHHQ 3HOWG 5GADC 4JBJA 1O7IA 3OYYA 2JA6G 1NE3A 5C4JH 2D62A 1QUQA 4P73A 1VQ6A 1UE7A 3SGIA 4JYAQ 3CCUA 1X3EA 1YHBA 3CC7A 1N33Q 4LWCA 5C4XG 4PZ8A 1VQGA 3HOZG 4A3CH 4DR7Q 3GTKH 2GVBA 1FVIA 1UEBA 2N8NA 4NPSA 1WYDA 2ATWA 2JA7G 1E3PA 1CKNA 3H3VI 2VZAA 4BBRG 2LXJA 4KI0A 4GNXC 3DM3A 2NN6G 2VW9A 2VQFQ 3PO2H 1HZ9A 3U4VA 1L2FA 1T9HA 3FP9A 4KLKA 1A8VA 1L0WA 4GKKQ 3J81j 3A5ZB 4K0KL 1EUJA 3S17H 2IHFA 3F8TA 1HNWQ 2EQSA 1EOVA 4R4IA 4BY1G 1VQBA 1U5KA 4IPCA 2RCNA 4P72A 1WJJA 2NN6I 4DUYL 4GN4B 5EAYA 1XPOA 2VQEL 1P8LA 4MZ9A 3CCVA 2K52A 3GTQH 2K4KA 5IYDH 4HIDA 3HOYG 1JJGA 5IYCG 4DV1Q 1VQ5A 1KRSA 1SE8A 3VDYA 3RLNA 4OWWB 4IOAA 4QJFA 4UP9A 4AQYQ 2KENA 3FKIG 3PUVA 1YBYA 4JI0Q 2JA7H 4GOPB 1G51A 4DR2Q 2NVXH 3GO5A 3OW2A 1Q46A 1Q1BA 2I5LX 3MXNB 4IJHA 1JE5A 1YEZA 3AFQA 2FXQA 5HY6A 4DR3L 1JMCA 1VQEA 3BZKA 1YVCA 1L1OB 2OCEA 1K0RA 1PYBA 5C4XH 2JA8G 2BA0A 4JI8Q 2VUMG 2C35B 2Y0SE 4DV2Q 1N36Q 1CSQA 2R92G 1MJEA 4LFAL 2EIFA 1HJPA 3CQZH 1K3RA 4R4TA 2ZM6L 4KHPL 2JA9A 4A76A 1E22A 4QGUA 4O2DA 1YHAA 4AIMA 4YHHL 2OQKA 2ZTDA 4UPAA 4X66Q 4GLXA 2UXDQ 1GVPA 3H0GH 4DV6Q 2D0PA 5LMNL 2E8GA 2PQAB 1UE6A 4JI6L 3CCJA 3ULPA 4GLAC 4A3GH 5E7NA 1EWIA 3STBC 1B70B 1MKHA 1NMGA 4GN5A 4X64Q 1C9OA 2OTLA 2HT1A 3KDFA 1N34Q 2MFIA 1WFQA 1Q86C 1X54A 1EQQA 1I94L 2CKZB 4APVA 2UUBQ 5IYCH 4L5TA 4GNXA 3HOYH 1TWAH 3PO3H 2JJQA 1HR0L 2OQ0A 2MQHA 2BH2A 4DKAC 4HJ5A 2AWOA 2B63H 2KHIA 1YZ6A 4A3DG 1SR3A 4PZ7A 4EX5A 5ELNA 3A0JA 2MO1A 4OWTB 3K7AH 3AEVA 4LFCQ 1QVGA 1QVCA 3AQQA 4HJAA 1VQCA 5M3MG 5IWAQ 1Y1VG 4Y7NH 2BH8A 4OX9L 2IX0A 1IZ6A 2QEXA 2UU9L 2XGTA 3J81c 4KHZA 5IP9G 1HNXL 1FGUA 3EBEA 4A3JH 1VQMA 1SROA 1WCMH 4OWXB 4LUOA 4X65Q 1PV4A 4JI5Q 2Y0SG 4IO9A 3M3YH 4BY7H 1XNQL 1JJ2A 4C3IH 1C7YA 1IBML 3HOVG 3RNUA 2WAQE 1IBKQ 4B3SQ 3T1YL 4POFA 1VQ7A 1CUKA 1QVFA 1E1TA 3CC4A 4LF8L 1GO3E 1VQFA 1N32L 3J80c 2CWPA 2UXBL 1VQHA 4LF6L 5LMUL 4LF5Q 4DR4L 2Z0SA 1W3SA 2L15A 1NTGA 3UE0A 4QL5A 1NMFA 3PIOA 1XMOQ 4YY3L 5DLQE 3L7ZC 2UUAL 3CCQA 1YIJA 2D0OA 2PI2A 4DAYB 1IBLL 3CD6A 4GOPC 1AE2A 1X3FA 3F2CA 2R93G 4A3BG 4DV3L 1GD7A 3JAMi 4DK3C 3STBD 4LF9L 2JA6H 1VQIA 2A19A 3KLWA 5HGQA 3T1HQ 3BU2A 4BY7G 3EIVA 5IY0A 1Y1VH 1X9NA 1KIXA 3LGJA 3EN2A 1PYSB 1K9MC 2OWOA 2NVQH 3GTGH 2OTJA 2JEBI 2B3GA 3ERSX 2E5LL 4NXMQ 2A1AA 2IX1A 1W2BA 4QQBX 4YWLA 5IP9H 1K8GA 1A63A 1KXLA
chains in the Genus database with same CATH superfamily
3HP3A 2ICEC 4C1NK 2YTVA 3E0EA 1XXGA 3KLRA 4HIKA 5CBAE 1EEFD 3PQIA 3RLFA 4DK0A 5J3BA 5AJ3L 1STHA 4GKJQ 1HFNA 2CQAA 3S14H 2F0UA 3KYHC 4BY1H 1GKHA 2KBNA 3B6YA 3OSOA 3I4NH 4ZUIA 2KA7A 4F88A 2UXCL 2LMCB 2E2IH 5BR8Q 4B3ML 3M85A 4DAMA 4FF3A 4K6LA 2NUCA 3NHHA 4QUCA 1K83B 4JBWA 4DA2A 3NWTA 4JI1L 1FNVA 3R8BA 1VQNA 4O1NA 5M3MB 3GTPB 2KJXA 1V8QA 3UE1A 1RKNA 2A73B 4IUTA 4KKTA 1E1OA 1Q8KA 3J7YW 2NTTA 1SE2A 5GAHC 2F0WA 1E2VA 2Q2TA 2YU9H 3JAML 3TS2A 2XRQD 3I4NG 2C5CA 2K1BA 3GD7A 4DUZQ 2EY2A 3R93A 2F4VQ 3URYA 3F1ZA 2F0DA 2RF4A 1R9TH 2CH4A 4ZKBB 3S15H 3HOYB 3GTLB 1JR0D 4HIMA 1HZBA 2VNUD 5CC4A 4OHJA 5EPJA 1W6KA 4JYAL 2V4DA 1G291 3I7FA 1ZYRD 1TVXA 4XDXA 1QZHA 1N33L 2B2TA 4A75A 5EPKA 4AH6A 4Y7NB 2R93H 2JA8B 4ZUJA 3VR4A 4L6TB 4HEDA 1B3AA 1S5DD 1L1OA 1YNXA 4PNYA 4KD4A 1EIYB 4IURA 1EOTA 1X3PA 4C3IB 1Q82C 2VL6A 4LJZC 2DY7A 4A3IG 2M9VA 1HFGA 1BVSA 2WINB 4ZRZA 3EROA 1S4ZA 3SK8A 1T5EA 1TWCH 1G8ZD 4BBRH 3S1NB 2AHOB 3K5NA 4X6AH 3K8AA 4JI0L 1KNEA 5IYBH 3A8KE 1JWSD 2KEEA 4I7AA 2F4IA 1H9MA 1BCPD 1XJVA 1LTGD 1STEA 1UUPA 1XWEA 1EY0A 1SE3A 4C3JH 1CHQD 4KHPQ 1LTID 2F0LA 4YHHQ 4JCVE 1CFMA 4DV6L 3PGZA 4BXXH 2D9UA 3HS0C 4XYQA 4X64L 1PH7A 2Z8LA 1B7YB 4RHSA 1KDAA 3O13A 4JVZA 4XT1B 1I94Q 1VQ8A 5BN3A 1JOOA 1STNA 2K6AA 1BUVT 4ID6A 4N9TA 1S5ED 1KDBA 4U68A 4G57A 2KQ3A 1P16A 5GROA 1PH6A 3HOUB 1AW7A 1NCVA 3G6JB 1A2TA 4YWMA 2R92B 4MHEA 1SJHD 1EIHA 3DWPA 2JA5H 2QF7A 4U673 3LWUA 1SSOA 5LL6S 2JK8A 1I4PA 3PUWA 1HRJA 2O4XA 1CK1A 3I55A 4A3KH 2QGQA 5C3WA 4RWSC 2UXBQ 3CCSA 5IP7G 4R8IA 1BO0A 4QCLA 2Q2IA 4DR4Q 4R4OA 1OXTA 2CFMA 1Y8PB 2NZ1D 1PYWD 4L8JA 1V43A 4LMQD 1VQLA 3RLOA 3FRPB 3H15A 3CPFA 2R7ZH 3G48A 3S2DH 5CYUA 3RN2A 5C44H 1VQPA 4Q5VA 1DJRD 5C0XG 4YCVA 1ET9A 3VA5A 1AEXA 1PZKD 2IWHA 3MEHA 3QO2A 5T1GA 1DXMA 3K59A 4EQOA 1NJIC 1SYCA 2SNMA 3PUXA 2XNAC 4CKEA 3NTKA 2MUYA 4IJLA 1JWUD 1QNKA 2LSSA 3EQLC 4H13C 5G3LD 5A2QL 1O80A 4A3FG 1SMYD 4DR1L 4A3EH 5JJZA 4A3BB 3C1FA 3S1RB 2K5NA 1FJGQ 5KYIA 1EQRA 4B3RQ 2BA1A 4JBKA 5EPLA 2XIWA 4A3MG 3GTPH 3RR5A 2TSSA 1AN8A 3VYTA 4JI4Q 3M4OH 2YYZA 1GHKA 1HH2P 5IGBA 1V9PA 2YV5A 3S17B 2CQOA 4LUZA 2F52A 3UDXA 5EKKA 3HKSA 3S9WA 4JBMA 3I2ZA 1TQOA 3BDOA 3SK4A 5KEEA 3TEHB 3GTQB 1LT5D 4A3DH 1HNZQ 3V2TA 4XQNA 1H9SA 1C0AA 1QUQB 1GHJA 1KRTA 1B4OA 4L5RC 1I50H 1QOHA 4DR6Q 2RDHA 1EYGA 1YITA 3HEJA 1S3OA 3GTKB 4FP5D 2G5DA 2N49A 5J22A 3ZYYX 1TKWB 3PUYA 1SFOH 1D2BA 3CCLA 1PTOC 2ES2A 4K2LA 2B63G 1PDQA 4X62L 3U9SA 3VA7A 4LF4Q 3HOWG 5K5PA 1O7IA 3OYYA 5C4JH 3GTJB 2D62A 2Q8IB 5I9OA 2EOTA 5IGCA 1VQ6A 3T56B 1ESFA 4K2KA 3KBGA 1YHBA 1JCKB 3CC7A 4LWCA 1VQGA 2MPMA 2N8NA 4NPSA 1J9OA 3T53B 3H3VI 2B2VC 2LXJA 3DM3A 1Z7TA 4TSSA 2VW9A 1HZ9A 3FKIB 4KLKA 2HQEA 4K0KL 3J81j 2IHFA 2FHTA 1EOVA 4R4IA 4BY1G 4P72A 1XPOA 1STBA 1WTPA 2H1EA 3CCVA 3K57A 3HOYG 2K33A 2NWGA 1VQ5A 3RLNA 4IOAA 4AQYQ 2E2JB 4GOPB 4DR2Q 3AFQA 4BY7B 1VQEA 3RZDB 3BZKA 4KTAA 3FPPA 2JA8G 3BDCA 2Y0SE 1N36Q 2HCCA 4LFAL 2EIFA 4RCOA 2F0VA 2OQKA 2ZTDA 4X66Q 4CKBA 1GVPA 4BWGB 1H9JA 5LMNL 1UE6A 4JI6L 3CCJA 3IFTA 3ULPA 4A3GH 1B70B 4GN5A 3MXUA 2F0MA 3SK5A 2HT1A 1A3VA 1CZGA 1MSGA 2EYJA 1SYEA 4GNXA 3S15B 1S5FD 2EDGA 4KY7A 2AWOA 3NPPA 3QR8A 1G6ZA 4OWTB 4DFAA 4G4KA 4MIUA 5M3MG 4OX9L 2UU9L 2A6ED 4KHZA 3TP8A 5D14A 1FGUA 4A3KB 1GJXA 2WKDA 5E1FA 4X65Q 4K5WA 3J81E 4IO9A 1XNQL 1JJ2A 1C7YA 2K28A 1IBML 2F0TA 3C1EA 1CUKA 1QVFA 1GO3E 1N32L 5D3DA 2N55A 2F1MA 4I7ZC 1RHPA 5LMUL 1BBXC 4LF5Q 3J80L 1NTGA 3NK9A 2UUAL 3KLSX 2IW3A 2QKIC 2SNSA 1FYCA 2R93G 3ONAB 5C44B 4LF9L 1VQIA 2R61A 3OHXC 4QF4A 5DM63 1WD1A 4BY7G 1Y1VH 1K9MC 1PYSB 3EN2A 2WIIB 3NXWA 4PMBA 2B3GA 2A1AA 4QQBX 1SAPA 1A63A 1KXLA 2M2LA 3W2DA 3ITPA 1IL2A 5IT9L 4LNQA 1JOQA 4DR5L 3A8JE 1TWFH 1QB5D 3E9IA 3IKJA 1PA6A 4A3EG 4ABNA 1ZYRC 2AMCB 4K5VA 1WTWA 1K8AC 3NQTA 2XWJB 1X65A 3L3OC 3KF8B 4C3JG 4JV5Q 3CMAA 4FVMA 2QILA 3Q22A 5C3EH 2AUKA 4XQQA 2Z9HA 5CORA 3QG1A 2MGSA 2JA5B 3AB9A 3DXJC 1VF7A 3H0GG 3Q0AA 2CHBD 3CCMA 4DV0L 1MIUA 1GM5A 1XNRQ 1F9PA 2EYLA 1I6HH 1Z47A 2UUCL 2L12A 4UY8C 3I4MH 4FXDA 3MA2B 1EY5A 2NVQB 5IGDA 1K3BC 1ENFA 1FL0A 2HDMA 2ID0A 4MTKA 4DV7Q 4IPGA 1STGA 1EYAA 1J8IA 3S1NH 1ASYA 4KMUC 4XXEA 4JI7L 2B2YA 3HOXH 3K80C 1DOLA 3AFPA 4JI2L 3S16H 5KRUA 3J7A5 3S14B 2Z4IA 4LFBL 1PFSA 1K73C 3GTJH 3E9HA 3BVMA 2PMZE 1CA6A 3N6RA 4PG3A 4IFDJ 2B29A 3A55A 2HIXA 4KKUA 3DUZA 3JC66 4BBSG 1L0XB 3DWAA 5JPMC 1OXXK 3ND9A 3I4MG 2GVAA 4DR7L 1U4PA 4F87A 1UAPA 5I2YA 1RODA 3TZUA 5M5YB 1LACA 1BCPB 3KF6A 4H0LC 2F0IA 1LTRD 2VQFL 4IFDG 4A3EB 2CH4W 4YIJA 4EQNA 5C3XA 1KAWA 4GKKL 5C4HA 2PI2E 5H1SE 1NSNS 1RL2A 1SLJA 4HJ8A 1TS3A 3GQBA 3HOWB 4R4QA 2I5MX 4IUPA 1SN8A 1U4MA 1X6OA 1EIGA 3PF4A 2I07B 2EYHA 1SE4A 4YWKA 1Z6HA 2A74C 1PTOD 2RBMA 4HSPA 4FYDA 3SR1A 1B53A 3NELA 5M5WB 4DR3Q 1DONA 3ICEA 5M3FH 3K0YA 4IUVA 4JPBW 3RMHA 3QB3A 3WOFA 3DHQA 1C48A 2RDGA 5ELBA 4JI8L 4OO1H 4DV2L 1YJNA 2R7DA 3EA6A 4A3DB 1BDOA 5JEAJ 1JT8A 4KJNA 4QY7A 4LK1C 4RGNA 2ZM6Q 3FVQA 1C4QA 5C0XJ 4UP7A 1RIPA 2EPBA 2H5XA 3Q23A 2F3VA 1IYVA 4QIWB 4IN3A 2VS1A 3DLLA 1IYJB 1E2WA 2K03A 2E76C 2KECA 2UUBL 2JA8H 4MNOA 1PTOH 3MFGA 5E4WC 1HR0Q 2F3WA 1SYFA 4GLVB 1AZQA 3CMEA 1HUNA 1HA5A 1HQRD 5A2QE 1Q3LA 3UDGA 3KDFB 4A3LH 5IWAL 1FD7D 4JC0A 2VB2X 1K83H 1CKNB 1HHVA 2CCZA 2AWNA 2PO4A 1GUSA 4DNIA 3CKIB 3FKIH 3NE5B 3S2HH 4JI5L 3ULJA 1B44D 1L0YB 1EFWA 5JEAG 1PH9A 4PMWA 3CAMA 1IBKL 3T1YQ 2Q8TA 3U50C 3K5LA 1Y1WH 3F2DA 1MSHA 2FMCA 4WFN3 4HMIA 1PFBA 3E3XA 3SHLA 2Q8RE 4RFBA 1XMOL 1N9WA 1KDCA 1B8AA 3L9AX 1WI5A 1IBLQ 1ESRA 2KCTA 1PTOF 4XTCS 4F8MA 5GAGC 1IXRA 3TDQA 5CGKA 4DV3Q 1A2UA 3SXHA 4A4IA 4HMJA 4NB3A 4QB4A 2JA6B 4J6HA 1O78A 1TWGH 1NY4A 1PH1A 1I3QH 5HGTA 3H94A 4NXML 2E5LQ 1JB3A 2DNCA 3IRBA 4L63B 1Y1WG 2A8VA 5DAUA 1O7YA 4F7XA 2IHEA 1YNNC 3ZJYC 3GDEA 1QZGA 4DV5L 5JEAH 3HOUH 1F9SA 5GQOA 2I5HA 3CRLC 1HR0W 3BS1A 2K5QA 4B3TL 4GKJL 1J5EL 2BDOA 5FLMG 1IKMA 1VQKA 3S2DB 2R7ZG 1PXUA 2SDFA 2A6EC 3PO3B 1BBUA 2R7FA 4NXNL 4DNRB 5C44G 4IUUA 4RG1A 4TRDA 2IY5B 3NEMA 4AYBE 1M4VA 3PCOB 2Z4HA 4B3MQ 2MJ8A 5DM73 3CXCA 1AE3A 1RF2D 1XX8A 3RZOH 2K75A 1PZID 4JI1Q 4A93H 2PYKA 3D31A 2FMMA 3QOLA 3OIQA 3QWNA 5M3MH 2F0JA 3L2PA 3X3NA 1YHQA 2RCFA 4N8X1 3TBIB 3NWSA 4JI3Q 1JORA 2ALYB 2DNEA 3D6CA 4QUFA 4C3JB 1JOKA 4LUVA 4ODGA 3HOXG 5E3FA 3M7NA 4LF7Q 1H9RA 1BBWA 2EE1A 4POGA 4DUZL 2E2JH 4BBSH 2F4VL 3D3RA 2GA4B 2L0CA 5AFWA 3KF6B 1OXUA 2L4NA 4FDBA 1BCPC 4RKBA 2HQLA 1UWVA 2X69A 3H6MA 2AQ2B 3P7JA 3CCEA 4A93G 1CSPA 2EXZA 5ELDA 4FNFA 2HHHQ 2JA6G 1DYQA 2X6GA 1V1OA 5M9OA 3E6ZX 1F9QA 1R4PB 4OL7A 5C4XG 3HOZG 1MD2D 4A3CH 1FVIA 1EZ6A 1UEBA 1WYDA 1E3PA 1CKNA 2VZAA 2NN6G 3M4OB 3PO2H 2NVXB 3U4VA 1T9HA 4JK1C 3FP9A 1VMCA 2A69C 1EUJA 1A3UA 1NAPA 3A8IE 1VQBA 2RCNA 2NN6I 4UDUC 5EAYA 2VQEL 1G91A 2Z6BA 1EY4A 4B9XA 4IQZA 5IYCG 2A6HD 3I8ZA 4QJFA 1HPCA 1O7LA 5FLXL 3PUVA 1YBYA 4DAYA 3GV3A 3OW2A 1YEZA 2ZXRA 1RCVD 1K0RA 1PYBA 2VUMG 3MVVA 1SNMA 1RTNA 2C9OA 1AZPA 2R92G 1MJEA 5CV4A 1V1PA 1K3RA 5C4JB 4KHPL 2JA9A 1D5MC 1PFMA 1YHAA 2DJFC 4YHHL 4GLXA 5EBDA 1TU2B 1GXDC 1ILQA 3H0GH 1K0SA 4DV6Q 2D0PA 1BNZA 4GLAC 1MKHA 1H9SB 2MP1A 3KDFA 1WVLA 1N34Q 1WFQA 1Q86C 1PTOB 1I94L 4M8AA 3X3MA 5IYCH 4L5TA 3WOEA 1MBYA 1TWAH 1PLFA 5DEHA 2OQ0A 3NTHA 3M3YB 2KVMA 2BH2A 4DKAC 4DN4M 5JVG3 1SXTA 1YZ6A 4PZ7A 1EY8A 3NTIA 3A0JA 2MO1A 3AEVA 3K7AH 4LFCQ 1QVGA 1QVCA 2JXMB 4UAIA 4CDEC 1EU3A 4CJ0B 1SDFA 2BH8A 4AYBB 5IP9G 1HNXL 2E2HB 3EBEA 1DD2A 2B8GA 1YNND 1SYBA 4B3SQ 2KUMA 4POFA 1Y1WB 1E1TA 2UXBL 3J80c 4LF6L 1CZWA 3N52A 2EVBA 1LABA 4DR4L 1DOMA 5IGFA 4QL5A 1NMFA 3BYTB 2XRSD 4V0BA 3CCQA 1YIJA 2ICIA 3A56A 2J7ZA 2JYOA 2Y0SB 4GOPC 1CTMA 1I50B 4A3BG 5M3FB 4IUQA 1D6EC 4RH6A 3T1HQ 2RQXA 1I3QB 1CHPD 3MXGA 5FO8B 1X3QA 2OWOA 4IALA 3ERSX 2IX1A 1LT3D 3Q24A 2EJMA 1W2BA 4YWLA 3H91A 2Z1CA 2B2UA 1PFNA 2MO0A 5C5MA 2YTXA 3GTMH 3KJOA 1SNOA 4O0AA 2K5VA 3VR6A 1YJ9A 1PH8A 3BZDB 2SOBA 1EEID 2JN4A 1KC8C 1PH5A 2MNAA 1XMQL 2H4OA 4ILWA 4R1JA 3PV0A 1V1QA 1F9RA 2ZJQA 3MHBA 3I4LA 1SBBB 1FJGL 1Q81C 4A3BH 3S1RH 2HUGA 4HAEA 2X6LA 2K05A 3OTOL 1HA6A 2IL8A 3I91A 1KHIA 1PRTB 1QILA 1B1ZA 1SRUA 4XYOA 2RSNA 1ET6A 4EQPA 1LLRD 3M9BA 4H02A 1BCPF 3TP6A 3CRKC 3KF8A 2AQ1B 3PO3G 5JJKA 2EYOA 4MTNA 2NVTH 1IW7C 1LYLA 3CF5A 2EJGC 4R9WA 3JAMc 5LMNW 2QA4A 4DNTB 5C3EG 3EJIA 1HNZL 2PQAA 2F0GA 3MXPA 4KKSA 2ENBA 1II3A 3NUCA 4P71A 3K81C 1B3QA 1CM9A 4YCWA 1F2LA 1TR5A 4RGTA 3U58A 1OXSC 4DV4Q 5C0XI 2VXWA 1CKMA 4KY6A 1VQJA 1Q7YC 2L9HA 3PUZA 5COYA 4X62Q 2WFWA 1EIFA 4LF4L 1ASZA 2IT1A 2KCMA 1EWHA 2OXPA 2ZTCA 5E4XA 2PW7A 1ICWA 1EQTA 1ZKOA 2XTIA 3HZXA 1QCBD 5ISRA 3A5UA 1WTQA 1L1OC 3MWYW 3NBIA 4FF1A 1E7ZA 2NZOA 2NN6H 1PHJA 2NTSA 2AKWB 3VYUA 1Q1EA 1E0BA 1X55A 1F2MA 1TY2A 4GN3B 4NMZA 4WJWA 3PSIA 1HTLD 3K7UC 2O5JC 1Y69U 1I6HB 4BA1I 1CA5A 5FOBB 3PF5A 1HNWL 3D0FA 3FEWX 3I4MB 1V1PB 2K04A 3FMCA 3J80i 4DUYQ 1A6XA 3BVZA 3QOJA 3WWVA 3CCRA 4ME5A 3F2BA 5CV5A 3HOZH 1XPUA 2K14A 1UEAB 2L5TA 2TMPA 1O7ZA 4ZAIA 3RN5A 4DV1L 1VQOA 1TWHH 3AU7A 5M5YH 4AQYL 2PQEA 2Z6KA 4P74A 2K50A 3PO2G 3BYYB 5FLMH 4DR2L 2CWAA 1E24A 4RA8A 3W1BA 2K5HA 3S16B 5ELFA 1T5XD 1RTOA 1Q12A 2RA4A 4GZYC 4HSVA 5I6YA 5FJ8G 4ZKCB 1MGSA 2HD3A 2A5HA 4PZ6A 4CHTB 1YI2A 2UXDL 3HG9A 4X3TA 5LHY1 4A3MH 5LMNQ 2XN9C 2PMZB 2OEOA 3S1MB 5IP7H 3RD4A 3ULLA 4EGVA 1PZJD 3NENA 1MHWC 4C2MB 1TWFB 3UI2A 4DAVA 3TP7A 1D8LA 1NUCA 1EYCA 1BQQT 1IHZA 2ZJRA 2F0NA 2AUJD 3VYSA 1XPRA 1I5FA 2F03A 3PIO3 2EY6A 1PH3A 2VUMB 1RD9D 2N3SA 1YNJD 1FR3A 3A74A 3OMCA 5A35A 5C5LA 2LY7A 3CC2A 1LTAD 4RCNA 4UHVA 1EY9A 2PNHA 3T4AC 2UU9Q 4ULLA 4IFDI 3MFYA 4IPHA 3MZ5A 1CKOA 4TQUS 3BZCA 2LXKA 1A62A 1TXYA 3SVMA 4X65L 2B63H 5M5WH 1VQ4A 1D5ZC 1XNQQ 3KOJA 2GN5A 1TWGB 3M4QA 4LF8Q 1N32Q 1H95A 3OPOA 3T16A 1Q90A 4RAUC 3D8GA 5LMUQ 1G6PA 4LF5L 4KV6A 4YY3Q 4A3CG 5J39A 5CV7A 2N78A 4OONA 2RSOA 2WB1E 4A3GG 3VR5A 2HCIA 1HZCA 1KABA 2BE5D 3J7AF 4R4CA 1OXVA 5KNCA 2O2LD 3MEFA 2F0HA 5L37A 5FO7B 3OIPA 3SEBA 3W1GA 2Q2UA 3HKZE 1TS2A 3HRZC 2RHQB 3PIP3 3H0GB 1JJCB 3QJYA 3KJPA 4TKOB 4OELB 2HDLA 1WTOA 3FHWA 5AJ3Q 3RZOB 2PZUA 4L5QA 1DCZA 3AMUA 2B2WC 1TWAB 4JG2A 5FKAC 3S2HB 3A54A 4A3JG 2PPBC 1WCMG 2JSOA 4LW1A 2UXCQ 1UE1A 4JV5L 1VF5C 2R3ZA 4Y52H 5BR8L 4IPDA 2BDNA 2DUDA 1TS5A 3UDFA 2WAQG 3HOUG 3HOWH 2NVYB 3K0XA 4YCUA 1K8MA 4DV0Q 1XNRL 5ELOA 1WCMB 3TRZA 2EXDA 1OTCA 3NBHB 3R2TA 1D7QA 2UUCQ 2B8FA 4DF7A 4OGQC 2WP8J 3TMEA 3GTOH 2R6GA 2PZWA 3K58A 5HURA 1VQAA 1IW7D 5FLXc 4BXXG 4GS3A 3SK6A 4A3FH 2P5ZX 2EYFA 1UNSA 1I4QA 3OWEB 2V1CC 5CBEE 1G2TA 2HIVA 5KNDA 1WTXA 4LAAA 2EJFC 4DAPA 2VY3A 1SYDA 3CP0A 4LFBQ 5JAVA 2KHSA 1X56A 1SNDA 5CR3A 5DNFA 4X3UA 5KIXA 4G7OC 1UE7A 2KCCA 4XQJA 3SGIA 1PMRA 4JYAQ 1N33Q 3BDLA 4DR7Q 2GVBA 1W6JA 4ZK9B 2ATWA 2JA7G 4A93B 4B9WA 2PCFB 4KI0A 1LT6D 2VQFQ 1B50A 1L0WA 3C2PA 4GKKQ 3A5ZB 3MAQA 2B2VA 3F8TA 2EQSA 1YNJC 3EVQA 1U5KA 2OT2A 4IPCA 1WJJA 1STYA 1P8LA 4MZ9A 2BE5C 1S5CD 2K52A 3C3LA 1FNUA 2K4KA 5ELCA 1JJGA 2WV6D 1TWHB 4BBRB 5IGEA 4CJ1B 1B2TA 2WAQB 4OWWB 2ZXOA 2KENA 4JI0Q 2E2DC 4KY5A 1EL0A 2NVXH 2QW7A 3GO5A 4J8QA 1Q46A 1Q1BA 2I5LX 5LL6X 4DXGA 1JMCA 2F0OA 2FXQA 5EKLA 2LKVA 4KN7C 5C4XH 2BA0A 3DMUA 2C35B 5D3IB 4DV2Q 2EY1A 3CQZH 2ZM6L 4R4TA 4OEMB 2FFKB 4RGOS 2K5WA 4E6IA 2F0EA 4QGUA 4AIMA 4UPAA 2E8GA 4ZQ3A 1WTRA 1EU4A 1NNXA 3S1QB 5CMDA 1EWIA 3STBC 4X64Q 2OTLA 1C9OA 3KLSA 1LTSD 2MFIA 1F77A 2D2CC 1X54A 1OO9B 2PW5A 1EQQA 2UUBQ 4ZYSA 5CV8A 3HOYH 3PO3H 2JJQA 3ND8A 3PO2B 4CDDC 4XT3B 4IFDH 3TZDA 1D1KA 1BOSA 3VR3A 2KHIA 2JP1A 3AQQA 4HJAA 3GTMB 4Y7NH 2E74C 4CBVA 1DOKA 2QEXA 5I2XA 2D5DA 2XGTA 3G7LA 3C46A 3BG3A 5T1IA 2JA7B 3A7AB 4EVOA 2RKSA 1SYGA 4NKLA 1WTVA 1SROA 1PV4A 4JI5Q 4WJ3M 3M3YH 3J7AV 2CW0C 4C3IH 4X3KA 3HOVG 3IAYA 1IBKQ 3OWFA 2PZTA 4H44C 1VQ7A 1KNAA 1EY6A 1D5XC 2CWPA 1VQHA 1Y8NB 2Z0SA 3UE0A 2A68D 3HGBA 3PIOA 1ML0D 5KNBA 5DLQE 3L7ZC 1QWYA 1XMOQ 4HR7B 3VYRA 2SEBD 3OOCA 2D0OA 1IBLL 2R7ZB 1GUGA 3NSWA 4A3JB 1AE2A 3M7GA 3F2CA 2F0KA 1C8CA 1D1IA 1GD7A 3OMGA 3JAMi 1QNUA 4FF2A 1GOZA 2A19A 1CI3M 3KLWA 4K8IA 5JOBA 3EFXD 5BN5A 5M5XB 3EIVA 5IY0A 1KIXA 4O42A 3LGJA 2OTJA 2E5LL 1I4HA 4DU9A 5IP9H 1K8GA 4Z9CB 3T13A 2KCNA 4A3MB 1KQSA 4DV5Q 2DGYA 3HOVH 3D4RA 4FO2A 1FGBD 4P2CB 4B3TQ 4NDXA 4C3HH 2Q2HA 1J5EQ 4ZCKA 3L0OA 3DEOA 3WDNA 4IZ8A 5KYLA 2JA5G 1LO5D 3U4ZA 5IT9E 1LM0A 4NXNQ 4DR1Q 1B9NA 2EYMA 1IYUA 1I4XA 1NBWA 4L5SA 1MJCA 1EWCA 3UDIA 1IKLA 4A3IB 3W5OA 4B3RL 4HJ7A 3E0JA 5JJIA 1U4LA 1DGSA 2JE6I 1SJED 1TY0A 2F0FA 4ALPA 3RUZA 4EQ5A 1KLGD 2NVYH 4FXGC 1A3TA 4DK6C 5G3LF 5JJLA 1I4GA 4B08A 3P20A 4JI4L 4AYBG 5TSSA 2B63B 4GOPA 5IE8A 1R9TB 3J80E 2J0TD 5K36G 2E2IB 4JI3L 3GTGB 1LUZA 2IJ0A 3HOZB 3GTLH 2K01A 4RKLA 2ZJPA 3CHBD 2EYPA 4KK7A 2WB1B 1WTHA 1S5BD 2OF1A 5EKIA 4LF7L 4J15A 1M8AA 2VB3X 2RDFA 2LFNA 2RHSB 4DR6L 1HCZA 3M4YA 1S72A 4BA2I 2F0PA 5FO9B 1KAAA 4BBSB 3K5MA 3G4SA 1VQ9A 2B2YC 1GUOA 2B2WA 4X3SA 1ZXTA 4BY1B 5K36H 2HHHL 1PH4A 1SMXA 1LTLA 5IGGA 1B9MA 3I4NB 1IL8A 3LX0A 5EQ0A 1MI2A 3NQIA 2JQOA 1U0LA 1TT2A 3K5OA 1HTPA 1KL9A 2L1BA 4HCEA 3TREA 1LT4D 2E75C 1BXTA 1FNWA 1M1KC 2BOSA 1SEBD 1XTDA 1F2YA 5IOCA 3T51B 3S24A 1RJTA 4ME3A 4NW2A 1WD0A 5EGTA 3GV6A 4K0KQ 3LNNA 1SNCA 3HFZB 5JPNC 3TS0A 2NVTB 2I0QA 4P75A 2VQEQ 1S40A 2K5DA 3D4WA 3CU7A 1K8OA 1PRTC 2MHVA 2YTYA 2L55A 2NZHA 1EFID 4KN4C 2BCOA 1VMPA 1H9KA 3FPUB 3I3CA 3IFDA 4G7ZC 1M90C 2F3IA 4GNXB 4CGYB 4C2MH 3J7ZC 1N36L 4LFAQ 3MC0B 2B39A 1NR4A 4V190 2DJGC 4X66L 4A3KG 3S1QH 3MXNA 1JQYD 3SDZA 3BVGA 4JI6Q 1F2ZA 1UE5A 1VCIA 4XIGS 1N8RC 3G6EA 1N34L 4DK1A 3QIAA 2A6HC 2FINB 3Q8DA 1PRTF 2NBFA 2ZXPA 5FJ8H 2B2UC 4QMGA 1QJOA 2O5IC 1A0IA 3A7LA 4FF4A 4MN3A 5JVH3 4LFCL 3G71A 1YJWA 3K7AB 4OX9Q 2CW0D 2KOLA 1TIID 4K5XA 1HNXQ 2LS01 2Z6KC 3IL8A 1CQVA 1ZEQX 3CPWA 2E2HH 4HJ9A 1IBMQ 3DWQA 3MTSA 3M4PA 3P1HA 4JOIA 4B3SL 2ASBA 4K14A 3GP7A 3I73A 1PH2A 3AYHB 5ELEA 4LF6Q 1WOCA 4JOIC 1KLUD 2R92H 3I70A 1KD1C 2JEAI 1DZ1A 2UUAQ 4RMFA 3PIPA 3PMFA 1BKBA 1HXYD 1EYDA 5I9PA 4K6DA 5M5XH 4LF9Q 1Q8IA 1LTBD 4C3HG 1Y8OB 3T1HL 1RDPD 1HZAA 4A3LG 2PNRC 4HN7A 1X32A 4QIWE 5CV6A 5IYDG 1R4QB 2A69D 2VUMH 1AH9A 3J81L 4IOCA 4CJ2C 4C3HB 1BF4A 4OXPA 4DR5Q 2G9HD 1JB7A 5IYBG 3D4DA 4TVAB 2R93B 1XMQQ 4UP8A 5M3FG 1XYIA 2WB1G 1PRTD 4A3IH 4BS9A 4N9PA 2J4XA 3R2IA 3TQYA 4N8FA 5IYDH 1XTCD 1PVOA 3OTOQ 1EQVA 1E2ZA 3ER0A 2NB0A 2L11A 1QG7A 4C56C 2B2TC 3I72A 2ZTEA 1STAA 1U4RA 4OIJA 1ILPA 5CV9A 4OO1I 2K32A 1SMYC 2F0SA 3BJUA 4WORA 2KHJA 4J1MA 3J81i 2EZVA 4C1NI 4NP5A 4OO1G 3CW2C 1I6VC 2DN8A 4M1UB 2I46A 1J6QA 4HTHA 3HKZG 1ENCA 1VS0A 5EJWA 1Y14B 1HUMA 2QCPX 4HIOA 4KHVA 5GAEC 3K6OA 2F0QA 4DV7L 3DM1A 2YU9B 3I56A 4RHRA 3H3VH 4JI7Q 4DPGA 1VQDA 3KFUA 1I4RA 3NP8A 3NBHA 4R8NA 2QDLA 1X3GA 4PV1C 2KEDA 3S1MH 2NYZD 3HKZB 3SE0A 4FXKC 1EY7A 1JWMD 4JI2Q 1GUNA 2FJ2A 4DGZA 1GUTA 4DV4L 3RZDH 1Z9FA 5C4ZA 4WJ4A 3GTOB 3I4OA 2AQ3B 4C3IG 4K8JA 1JC7A 1SNPA 5GADC 4JBJA 1NE3A 2ZT9C 1QUQA 1CT1D 1JICA 4P73A 3H09A 3V96A 5I6WA 4CDFC 2QEJC 3CCUA 1X3EA 2M00A 4PZ8A 3P75A 3GTKH 1GUWA 1U9RA 1SFOB 3F2UA 4BBRG 4GNXC 5IIFA 1L2FA 1A8VA 1BR9A 1AP0A 3S17H 1HNWQ 1A15A 4G7HC 4H7BA 1KTKA 4KD3A 4DUYL 4GN4B 5C4XB 1ICFB 3OW7A 3GTQH 4HIDA 3E5SA 3W3AA 2XWBB 5J1ZA 4DV1Q 1KRSA 1SE8A 3VDYA 4UP9A 3FKIG 2JA7H 1TWCB 1G51A 3TP5A 1LTTD 1K28A 3MXNB 4IJHA 1JE5A 5HY6A 4DR3L 1YVCA 1L1OB 2OCEA 3KBXA 2WACA 4JI8Q 4HCSA 1CSQA 1HJPA 4CDCC 5I4DA 2G9DA 4A76A 1E22A 4O2DA 1DM0B 2UXDQ 1ONLA 3HOXB 3LWEA 4RGMA 2IX3A 2PQAB 5NUCA 3TN2A 5E7NA 1NMGA 3I90A 4WRDA 5F2DA 4ZLTF 2XSCA 2XVSA 3FDTA 5KGUA 2CKZB 1Y1VB 2WKCA 4APVA 1HR0L 2A68C 2MQHA 4Q0FA 4HJ5A 1AFPA 4A3DG 3DEPA 3HOVB 1SR3A 4EX5A 3H3VC 5ELNA 2K7VA 4S3SA 4A3GB 1QE6A 3ERQA 1VQCA 5IWAQ 2N88A 1Y1VG 5FK9C 4PQXA 1NR2A 2IX0A 1IZ6A 1G2SA 3J81c 2RVLA 4A3JH 1VQMA 4DXFA 1ENAA 1LV9A 1WCMH 4OWXB 4LUOA 5FLXE 2Y0SG 4BY7H 4IUNA 4JW0A 2WAQE 3RNUA 1EZ8A 3JAME 3D6WA 3T1YL 5C3EB 3TSSA 4CKCA 3CC4A 1CQFA 4LF8L 1VQFA 3CQZB 1W3SA 2L15A 2EY5A 2IPKD 2CVRA 4KJOA 4YY3L 4I65A 1VDZA 5C6AA 5BN4A 2PI2A 4DAYB 4A3FB 3CD6A 1JE4A 3Q6SA 1HQMC 1X3FA 4OIKA 4DV3L 4DK3C 3STBD 2JA6H 3R3OA 1SNQA 5D65A 2DY8A 3V05A 5HGQA 3KK7A 3BU2A 3KUPA 5IODA 1X9NA 2NVQH 3GTGH 1TS4A 3VR2A 2QDBA 5EBCA 2JEBI 3U9OA 4NXMQ 5C0XH 5IT9c 4PMCA
chains in the Genus database with same CATH topology
1KQSA 1IL2A 2YTVA 3E0EA 4DV5Q 2DGYA 4HIKA 3HOVH 2MO0A 2YTXA 4LNQA 4B3TQ 3RLFA 4GKJQ 5J3BA 5AJ3L 3KJOA 4O0AA 2K5VA 4C3HH 2Q2HA 4DR5L 1YJ9A 1J5EQ 1TWFH 3L0OA 3E9IA 1PA6A 1PH8A 4A3EG 3S14H 2JA5G 3KYHC 1KC8C 1GKHA 2KBNA 3B6YA 3U4ZA 2MNAA 1XMQL 1LM0A 2AMCB 1PH5A 4NXNQ 4R1JA 4DR1Q 3I4NH 3PV0A 1K8AC 1V1QA 2ZJQA 1NBWA 4L5SA 1MJCA 1X65A 2UXCL 3UDIA 1FJGL 3KF8B 1Q81C 2E2IH 4A3BH 3CMAA 4JV5Q 3S1RH 5BR8Q 3W5OA 5C3EH 4HJ7A 4B3RL 4B3ML 3OTOL 3M85A 4DAMA 5JJIA 1KHIA 1DGSA 2JE6I 4ALPA 4EQ5A 4JBWA 2NVYH 3H0GG 4DK6C 4JI1L 5JJLA 1SRUA 1VQNA 3CCMA 3M9BA 4H02A 4DV0L 1MIUA 4AYBG 3UE1A 1GM5A 4JI4L 1XNRQ 4GOPA 5IE8A 1I6HH 1Z47A 1E1OA 2UUCL 3PO3G 5JJKA 4UY8C 3I4MH 1Q8KA 4MTNA 2NVTH 5K36G 1LYLA 3CF5A 4JI3L 3JAMc 5LMNW 1LUZA 2QA4A 3GTLH 5GAHC 5C3EG 2ZJPA 2Q2TA 2YU9H 1HNZL 2PQAA 1FL0A 2ID0A 4DV7Q 3TS2A 4IPGA 4LF7L 3I4NG 4J15A 3S1NH 4P71A 1ASYA 2RHSB 3GD7A 4DUZQ 3K81C 4JI7L 3HOXH 4YCWA 2F4VQ 3K80C 3U58A 4DR6L 1S72A 4BA2I 1OXSC 3F1ZA 3AFPA 2RF4A 3G4SA 4DV4Q 1R9TH 1VQ9A 4JI2L 5C0XI 3S16H 1CKMA 3J7A5 1VQJA 4LFBL 1Q7YC 1PFSA 3PUZA 1K73C 4X62Q 2WFWA 3GTJH 3E9HA 1EIFA 4LF4L 2HHHL 3S15H 2PMZE 1PH4A 1SMXA 1LTLA 4HIMA 4PG3A 1ASZA 2IT1A 2KCMA 4IFDJ 1HZBA 2VNUD 2B29A 2ZTCA 2HIXA 3JC66 2JQOA 4JYAL 1U0LA 2XTIA 4BBSG 1G291 3I7FA 1OXXK 3I4MG 1QZHA 2GVAA 1N33L 3A5UA 4A75A 1KL9A 1L1OC 4DR7L 1E7ZA 2NZOA 4AH6A 3TREA 1PHJA 2AKWB 1M1KC 1Q1EA 2R93H 3KF6A 1X55A 1XTDA 4GN3B 3PSIA 3S24A 4ME3A 1L1OA 2VQFL 1YNXA 4IFDG 3K7UC 1EIYB 1KAWA 4GKKL 4K0KQ 4BA1I 2PI2E 3HFZB 3TS0A 1HNWL 3PF5A 3D0FA 5H1SE 1RL2A 1Q82C 1SLJA 2VL6A 3J80i 4DUYQ 2I0QA 4P75A 2VQEQ 3WWVA 3CCRA 4HJ8A 1S40A 3F2BA 3HOZH 4A3IG 1XPUA 4R4QA 2K14A 2I5MX 3RN5A 1SN8A 1BVSA 2YTYA 4DV1L 2NZHA 1X6OA 1TWHH 1TWCH 1VQOA 4BBRH 3PF4A 5M5YH 4AQYL 2AHOB 4X6AH 2Z6KA 3K8AA 4P74A 2K50A 4YWKA 4BY1H 4JI0L 5IYBH 5FLMH 3PO2G 4DR2L 2CWAA 1M90C 2F3IA 3NELA 1E24A 4GNXB 4DR3Q 3W1BA 1XJVA 3ICEA 2K5HA 5M3FH 4C2MH 4JI8L 1Q12A 3J7ZC 4DV2L 1N36L 1YJNA 2R7DA 4C3JH 5JEAJ 4LFAQ 5FJ8G 1JT8A 4QY7A 2ZM6Q 4KHPQ 5C0XJ 4UP7A 1RIPA 4YHHQ 4PZ6A 4X66L 4A3KG 1YI2A 2UXDL 4JCVE 3S1QH 2H5XA 4A3MH 4DV6L 5LMNQ 4JI6Q 3PGZA 4BXXH 4X64L 5IP7H 2VS1A 1PH7A 1UE5A 3DLLA 1B7YB 1VCIA 4XIGS 1IYJB 3ULLA 3G6EA 1N8RC 1N34L 3NENA 1I94Q 2UUBL 2JA8H 1VQ8A 1D8LA 4MNOA 1HR0Q 5IT9c 3Q8DA 4GLVB 2ZJRA 1XPRA 1P16A 1I5FA 5GROA 5FJ8H 1PH3A 3CMEA 1PH6A 2N3SA 3A74A 4WJ3M 1A0IA 3CC2A 4YWMA 4LFCL 3KDFB 3UDGA 4A3LH 3G71A 5IWAL 1YJWA 2PNHA 4JC0A 4OX9Q 1K83H 1CKNB 2JA5H 2UU9Q 4IFDI 2CCZA 2AWNA 1HNXQ 2JK8A 4DNIA 2Z6KC 4IPHA 1CKOA 3FKIH 3BZCA 3PUWA 4TQUS 3CPWA 3S2HH 2LXKA 1A62A 1TXYA 4JI5L 2QGQA 4X65L 3I55A 5M5WH 3ULJA 4HJ9A 4A3KH 2E2HH 1VQ4A 1XNQQ 1EFWA 5JEAG 3KOJA 1PH9A 4PMWA 1IBMQ 2GN5A 3CAMA 3M4PA 4JOIA 1IBKL 4B3SL 3T1YQ 2ASBA 3M4QA 4LF8Q 3U50C 1Y1WH 2UXBQ 3CCSA 3AYHB 5IP7G 3F2DA 1PH2A 1N32Q 4LF6Q 1H95A 1WOCA 5LMUQ 1G6PA 4LF5L 2Q2IA 4JOIC 2R92H 4DR4Q 4R4OA 1OXTA 1KD1C 2JEAI 2CFMA 1XMOL 4YY3Q 2UUAQ 1N9WA 4RMFA 4A3CG 1B8AA 1V43A 3PIPA 1WI5A 1IBLQ 1VQLA 3RLOA 2KCTA 1BKBA 2N78A 4XTCS 4OONA 5GAGC 3CPFA 1IXRA 3H15A 2R7ZH 4DV3Q 3G48A 2WB1E 4A3GG 5M5XH 4LF9Q 4A4IA 3S2DH 4NB3A 3RN2A 1HZCA 3T1HL 5C44H 1VQPA 1TWGH 1NY4A 1HZAA 1OXVA 4R4CA 5C0XG 1PH1A 1I3QH 4A3LG 3MEFA 4YCVA 4NXML 4QIWE 2E5LQ 3IRBA 3W1GA 5IYDG 1Y1WG 2Q2UA 3HKZE 2A8VA 2RHQB 2VUMH 2IHEA 3ZJYC 3GDEA 1QZGA 4DV5L 1AH9A 4IOCA 1NJIC 3HOUH 1JJCB 3KJPA 5GQOA 2I5HA 3PUXA 1HR0W 4B3TL 4OXPA 3FHWA 4IJLA 5AJ3Q 4DR5Q 1JB7A 4GKJL 1J5EL 5IYBG 5FLMG 1VQKA 4L5QA 2LSSA 2R7ZG 4TVAB 4JG2A 1XMQQ 4UP8A 1BBUA 2R7FA 4NXNL 5M3FG 4A3FG 5C44G 4RG1A 2WB1G 4DR1L 2IY5B 4A3JG 4A3EH 1WCMG 4A3IH 4LW1A 3NEMA 4AYBE 2UXCQ 2K5NA 1FJGQ 1UE1A 3TQYA 4JV5L 4Y52H 1EQRA 4IPDA 5BR8L 4B3RQ 2BA1A 3PCOB 1PVOA 2DUDA 3OTOQ 3UDFA 4B3MQ 3ER0A 4JBKA 2WAQG 3CXCA 2ZTEA 1AE3A 3HOUG 3HOWH 3RZOH 4OO1I 2K75A 4A3MG 3GTPH 4JI1Q 4A93H 3RR5A 3D31A 3K0XA 3BJUA 4YCUA 2KHJA 3J81i 4DV0Q 4JI4Q 5ELOA 1XNRL 2YYZA 3M4OH 3TRZA 5M3MH 2EXDA 3L2PA 4OO1G 1HH2P 1OTCA 1V9PA 2YV5A 3CW2C 3NBHB 2CQOA 4LUZA 2F52A 3UDXA 1D7QA 3HKSA 2UUCQ 1J6QA 2WP8J 1YHQA 4JBMA 3GTOH 3I2ZA 3HKZG 4JI3Q 2R6GA 1VS0A 1Y14B 4HIOA 3TEHB 2ALYB 5GAEC 4A3DH 1VQAA 1HNZQ 4LUVA 3HOXG 5FLXc 4BXXG 4DV7L 3M7NA 4GS3A 3I56A 4LF7Q 1C0AA 1QUQB 1BBWA 4POGA 3H3VH 1KRTA 4A3FH 4DUZL 2E2JH 4JI7Q 4DPGA 4L5RC 4BBSH 1I50H 1VQDA 2F4VL 3KFUA 4DR6Q 1EYGA 1YITA 3KF6B 1OXUA 1S3OA 1X3GA 2V1CC 4FDBA 3GTMH 2N49A 3S1MH 2HQLA 2HIVA 3PUYA 4DV4L 4JI2Q 3RZDH 1SFOH 3CCLA 2VY3A 1Z9FA 1UWVA 2ES2A 4WJ4A 3CP0A 2B63G 4LFBQ 3I4OA 1X56A 3CCEA 4X62L 4A93G 1CSPA 4LF4Q 2HHHQ 3HOWG 5GADC 4JBJA 1O7IA 3OYYA 2JA6G 1NE3A 5C4JH 2D62A 1QUQA 4P73A 1VQ6A 1UE7A 3SGIA 4JYAQ 3CCUA 1X3EA 1YHBA 3CC7A 1N33Q 4LWCA 5C4XG 4PZ8A 1VQGA 3HOZG 4A3CH 4DR7Q 3GTKH 2GVBA 1FVIA 1UEBA 2N8NA 4NPSA 1WYDA 2ATWA 2JA7G 1E3PA 1CKNA 3H3VI 2VZAA 4BBRG 2LXJA 4KI0A 4GNXC 3DM3A 2NN6G 2VW9A 2VQFQ 3PO2H 1HZ9A 3U4VA 1L2FA 1T9HA 3FP9A 4KLKA 1A8VA 1L0WA 4GKKQ 3J81j 3A5ZB 4K0KL 1EUJA 3S17H 2IHFA 3F8TA 1HNWQ 2EQSA 1EOVA 4R4IA 4BY1G 1VQBA 1U5KA 4IPCA 2RCNA 4P72A 1WJJA 2NN6I 4DUYL 4GN4B 5EAYA 1XPOA 2VQEL 1P8LA 4MZ9A 3CCVA 2K52A 3GTQH 2K4KA 5IYDH 4HIDA 3HOYG 1JJGA 5IYCG 4DV1Q 1VQ5A 1KRSA 1SE8A 3VDYA 3RLNA 4OWWB 4IOAA 4QJFA 4UP9A 4AQYQ 2KENA 3FKIG 3PUVA 1YBYA 4JI0Q 2JA7H 4GOPB 1G51A 4DR2Q 2NVXH 3GO5A 3OW2A 1Q46A 1Q1BA 2I5LX 3MXNB 4IJHA 1JE5A 1YEZA 3AFQA 2FXQA 5HY6A 4DR3L 1JMCA 1VQEA 3BZKA 1YVCA 1L1OB 2OCEA 1K0RA 1PYBA 5C4XH 2JA8G 2BA0A 4JI8Q 2VUMG 2C35B 2Y0SE 4DV2Q 1N36Q 1CSQA 2R92G 1MJEA 4LFAL 2EIFA 1HJPA 3CQZH 1K3RA 4R4TA 2ZM6L 4KHPL 2JA9A 4A76A 1E22A 4QGUA 4O2DA 1YHAA 4AIMA 4YHHL 2OQKA 2ZTDA 4UPAA 4X66Q 4GLXA 2UXDQ 1GVPA 3H0GH 4DV6Q 2D0PA 5LMNL 2E8GA 2PQAB 1UE6A 4JI6L 3CCJA 3ULPA 4GLAC 4A3GH 5E7NA 1EWIA 3STBC 1B70B 1MKHA 1NMGA 4GN5A 4X64Q 1C9OA 2OTLA 2HT1A 3KDFA 1N34Q 2MFIA 1WFQA 1Q86C 1X54A 1EQQA 1I94L 2CKZB 4APVA 2UUBQ 5IYCH 4L5TA 4GNXA 3HOYH 1TWAH 3PO3H 2JJQA 1HR0L 2OQ0A 2MQHA 2BH2A 4DKAC 4HJ5A 2AWOA 2B63H 2KHIA 1YZ6A 4A3DG 1SR3A 4PZ7A 4EX5A 5ELNA 3A0JA 2MO1A 4OWTB 3K7AH 3AEVA 4LFCQ 1QVGA 1QVCA 3AQQA 4HJAA 1VQCA 5M3MG 5IWAQ 1Y1VG 4Y7NH 2BH8A 4OX9L 2IX0A 1IZ6A 2QEXA 2UU9L 2XGTA 3J81c 4KHZA 5IP9G 1HNXL 1FGUA 3EBEA 4A3JH 1VQMA 1SROA 1WCMH 4OWXB 4LUOA 4X65Q 1PV4A 4JI5Q 2Y0SG 4IO9A 3M3YH 4BY7H 1XNQL 1JJ2A 4C3IH 1C7YA 1IBML 3HOVG 3RNUA 2WAQE 1IBKQ 4B3SQ 3T1YL 4POFA 1VQ7A 1CUKA 1QVFA 1E1TA 3CC4A 4LF8L 1GO3E 1VQFA 1N32L 3J80c 2CWPA 2UXBL 1VQHA 4LF6L 5LMUL 4LF5Q 4DR4L 2Z0SA 1W3SA 2L15A 1NTGA 3UE0A 4QL5A 1NMFA 3PIOA 1XMOQ 4YY3L 5DLQE 3L7ZC 2UUAL 3CCQA 1YIJA 2D0OA 2PI2A 4DAYB 1IBLL 3CD6A 4GOPC 1AE2A 1X3FA 3F2CA 2R93G 4A3BG 4DV3L 1GD7A 3JAMi 4DK3C 3STBD 4LF9L 2JA6H 1VQIA 2A19A 3KLWA 5HGQA 3T1HQ 3BU2A 4BY7G 3EIVA 5IY0A 1Y1VH 1X9NA 1KIXA 3LGJA 3EN2A 1PYSB 1K9MC 2OWOA 2NVQH 3GTGH 2OTJA 2JEBI 2B3GA 3ERSX 2E5LL 4NXMQ 2A1AA 2IX1A 1W2BA 4QQBX 4YWLA 5IP9H 1K8GA 1A63A 1KXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS A;  1IL2 A;  2YTV A;  3E0E A;  4DV5 Q;  2DGY A;  4HIK A;  3HOV H;  2MO0 A;  2YTX A;  4LNQ A;  4B3T Q;  3RLF A;  4GKJ Q;  5J3B A;  5AJ3 L;  3KJO A;  4O0A A;  2K5V A;  4C3H H;  2Q2H A;  4DR5 L;  1YJ9 A;  1J5E Q;  1TWF H;  3L0O A;  3E9I A;  1PA6 A;  1PH8 A;  4A3E G;  3S14 H;  2JA5 G;  3KYH C;  1KC8 C;  1GKH A;  2KBN A;  3B6Y A;  3U4Z A;  2MNA A;  1XMQ L;  1LM0 A;  2AMC B;  1PH5 A;  4NXN Q;  4R1J A;  4DR1 Q;  3I4N H;  3PV0 A;  1K8A C;  1V1Q A;  2ZJQ A;  1NBW A;  4L5S A;  1MJC A;  1X65 A;  2UXC L;  3UDI A;  1FJG L;  3KF8 B;  1Q81 C;  2E2I H;  4A3B H;  3CMA A;  4JV5 Q;  3S1R H;  5BR8 Q;  3W5O A;  5C3E H;  4HJ7 A;  4B3R L;  4B3M L;  3OTO L;  3M85 A;  4DAM A;  5JJI A;  1KHI A;  1DGS A;  2JE6 I;  4ALP A;  4EQ5 A;  4JBW A;  2NVY H;  3H0G G;  4DK6 C;  4JI1 L;  5JJL A;  1SRU A;  1VQN A;  3CCM A;  3M9B A;  4H02 A;  4DV0 L;  1MIU A;  4AYB G;  3UE1 A;  1GM5 A;  4JI4 L;  1XNR Q;  4GOP A;  5IE8 A;  1I6H H;  1Z47 A;  1E1O A;  2UUC L;  3PO3 G;  5JJK A;  4UY8 C;  3I4M H;  1Q8K A;  4MTN A;  2NVT H;  5K36 G;  1LYL A;  3CF5 A;  4JI3 L;  3JAM c;  5LMN W;  1LUZ A;  2QA4 A;  3GTL H;  5GAH C;  5C3E G;  2ZJP A;  2Q2T A;  2YU9 H;  1HNZ L;  2PQA A;  1FL0 A;  2ID0 A;  4DV7 Q;  3TS2 A;  4IPG A;  4LF7 L;  3I4N G;  4J15 A;  3S1N H;  4P71 A;  1ASY A;  2RHS B;  3GD7 A;  4DUZ Q;  3K81 C;  4JI7 L;  3HOX H;  4YCW A;  2F4V Q;  3K80 C;  3U58 A;  4DR6 L;  1S72 A;  4BA2 I;  1OXS C;  3F1Z A;  3AFP A;  2RF4 A;  3G4S A;  4DV4 Q;  1R9T H;  1VQ9 A;  4JI2 L;  5C0X I;  3S16 H;  1CKM A;  3J7A 5;  1VQJ A;  4LFB L;  1Q7Y C;  1PFS A;  3PUZ A;  1K73 C;  4X62 Q;  2WFW A;  3GTJ H;  3E9H A;  1EIF A;  4LF4 L;  2HHH L;  3S15 H;  2PMZ E;  1PH4 A;  1SMX A;  1LTL A;  4HIM A;  4PG3 A;  1ASZ A;  2IT1 A;  2KCM A;  4IFD J;  1HZB A;  2VNU D;  2B29 A;  2ZTC A;  2HIX A;  3JC6 6;  2JQO A;  4JYA L;  1U0L A;  2XTI A;  4BBS G;  1G29 1;  3I7F A;  1OXX K;  3I4M G;  1QZH A;  2GVA A;  1N33 L;  3A5U A;  4A75 A;  1KL9 A;  1L1O C;  4DR7 L;  1E7Z A;  2NZO A;  4AH6 A;  3TRE A;  1PHJ A;  2AKW B;  1M1K C;  1Q1E A;  2R93 H;  3KF6 A;  1X55 A;  1XTD A;  4GN3 B;  3PSI A;  3S24 A;  4ME3 A;  1L1O A;  2VQF L;  1YNX A;  4IFD G;  3K7U C;  1EIY B;  1KAW A;  4GKK L;  4K0K Q;  4BA1 I;  2PI2 E;  3HFZ B;  3TS0 A;  1HNW L;  3PF5 A;  3D0F A;  5H1S E;  1RL2 A;  1Q82 C;  1SLJ A;  2VL6 A;  3J80 i;  4DUY Q;  2I0Q A;  4P75 A;  2VQE Q;  3WWV A;  3CCR A;  4HJ8 A;  1S40 A;  3F2B A;  3HOZ H;  4A3I G;  1XPU A;  4R4Q A;  2K14 A;  2I5M X;  3RN5 A;  1SN8 A;  1BVS A;  2YTY A;  4DV1 L;  2NZH A;  1X6O A;  1TWH H;  1TWC H;  1VQO A;  4BBR H;  3PF4 A;  5M5Y H;  4AQY L;  2AHO B;  4X6A H;  2Z6K A;  3K8A A;  4P74 A;  2K50 A;  4YWK A;  4BY1 H;  4JI0 L;  5IYB H;  5FLM H;  3PO2 G;  4DR2 L;  2CWA A;  1M90 C;  2F3I A;  3NEL A;  1E24 A;  4GNX B;  4DR3 Q;  3W1B A;  1XJV A;  3ICE A;  2K5H A;  5M3F H;  4C2M H;  4JI8 L;  1Q12 A;  3J7Z C;  4DV2 L;  1N36 L;  1YJN A;  2R7D A;  4C3J H;  5JEA J;  4LFA Q;  5FJ8 G;  1JT8 A;  4QY7 A;  2ZM6 Q;  4KHP Q;  5C0X J;  4UP7 A;  1RIP A;  4YHH Q;  4PZ6 A;  4X66 L;  4A3K G;  1YI2 A;  2UXD L;  4JCV E;  3S1Q H;  2H5X A;  4A3M H;  4DV6 L;  5LMN Q;  4JI6 Q;  3PGZ A;  4BXX H;  4X64 L;  5IP7 H;  2VS1 A;  1PH7 A;  1UE5 A;  3DLL A;  1B7Y B;  1VCI A;  4XIG S;  1IYJ B;  3ULL A;  3G6E A;  1N8R C;  1N34 L;  3NEN A;  1I94 Q;  2UUB L;  2JA8 H;  1VQ8 A;  1D8L A;  4MNO A;  1HR0 Q;  5IT9 c;  3Q8D A;  4GLV B;  2ZJR A;  1XPR A;  1P16 A;  1I5F A;  5GRO A;  5FJ8 H;  1PH3 A;  3CME A;  1PH6 A;  2N3S A;  3A74 A;  4WJ3 M;  1A0I A;  3CC2 A;  4YWM A;  4LFC L;  3KDF B;  3UDG A;  4A3L H;  3G71 A;  5IWA L;  1YJW A;  2PNH A;  4JC0 A;  4OX9 Q;  1K83 H;  1CKN B;  2JA5 H;  2UU9 Q;  4IFD I;  2CCZ A;  2AWN A;  1HNX Q;  2JK8 A;  4DNI A;  2Z6K C;  4IPH A;  1CKO A;  3FKI H;  3BZC A;  3PUW A;  4TQU S;  3CPW A;  3S2H H;  2LXK A;  1A62 A;  1TXY A;  4JI5 L;  2QGQ A;  4X65 L;  3I55 A;  5M5W H;  3ULJ A;  4HJ9 A;  4A3K H;  2E2H H;  1VQ4 A;  1XNQ Q;  1EFW A;  5JEA G;  3KOJ A;  1PH9 A;  4PMW A;  1IBM Q;  2GN5 A;  3CAM A;  3M4P A;  4JOI A;  1IBK L;  4B3S L;  3T1Y Q;  2ASB A;  3M4Q A;  4LF8 Q;  3U50 C;  1Y1W H;  2UXB Q;  3CCS A;  3AYH B;  5IP7 G;  3F2D A;  1PH2 A;  1N32 Q;  4LF6 Q;  1H95 A;  1WOC A;  5LMU Q;  1G6P A;  4LF5 L;  2Q2I A;  4JOI C;  2R92 H;  4DR4 Q;  4R4O A;  1OXT A;  1KD1 C;  2JEA I;  2CFM A;  1XMO L;  4YY3 Q;  2UUA Q;  1N9W A;  4RMF A;  4A3C G;  1B8A A;  1V43 A;  3PIP A;  1WI5 A;  1IBL Q;  1VQL A;  3RLO A;  2KCT A;  1BKB A;  2N78 A;  4XTC S;  4OON A;  5GAG C;  3CPF A;  1IXR A;  3H15 A;  2R7Z H;  4DV3 Q;  3G48 A;  2WB1 E;  4A3G G;  5M5X H;  4LF9 Q;  4A4I A;  3S2D H;  4NB3 A;  3RN2 A;  1HZC A;  3T1H L;  5C44 H;  1VQP A;  1TWG H;  1NY4 A;  1HZA A;  1OXV A;  4R4C A;  5C0X G;  1PH1 A;  1I3Q H;  4A3L G;  3MEF A;  4YCV A;  4NXM L;  4QIW E;  2E5L Q;  3IRB A;  3W1G A;  5IYD G;  1Y1W G;  2Q2U A;  3HKZ E;  2A8V A;  2RHQ B;  2VUM H;  2IHE A;  3ZJY C;  3GDE A;  1QZG A;  4DV5 L;  1AH9 A;  4IOC A;  1NJI C;  3HOU H;  1JJC B;  3KJP A;  5GQO A;  2I5H A;  3PUX A;  1HR0 W;  4B3T L;  4OXP A;  3FHW A;  4IJL A;  5AJ3 Q;  4DR5 Q;  1JB7 A;  4GKJ L;  1J5E L;  5IYB G;  5FLM G;  1VQK A;  4L5Q A;  2LSS A;  2R7Z G;  4TVA B;  4JG2 A;  1XMQ Q;  4UP8 A;  1BBU A;  2R7F A;  4NXN L;  5M3F G;  4A3F G;  5C44 G;  4RG1 A;  2WB1 G;  4DR1 L;  2IY5 B;  4A3J G;  4A3E H;  1WCM G;  4A3I H;  4LW1 A;  3NEM A;  4AYB E;  2UXC Q;  2K5N A;  1FJG Q;  1UE1 A;  3TQY A;  4JV5 L;  4Y52 H;  1EQR A;  4IPD A;  5BR8 L;  4B3R Q;  2BA1 A;  3PCO B;  1PVO A;  2DUD A;  3OTO Q;  3UDF A;  4B3M Q;  3ER0 A;  4JBK A;  2WAQ G;  3CXC A;  2ZTE A;  1AE3 A;  3HOU G;  3HOW H;  3RZO H;  4OO1 I;  2K75 A;  4A3M G;  3GTP H;  4JI1 Q;  4A93 H;  3RR5 A;  3D31 A;  3K0X A;  3BJU A;  4YCU A;  2KHJ A;  3J81 i;  4DV0 Q;  4JI4 Q;  5ELO A;  1XNR L;  2YYZ A;  3M4O H;  3TRZ A;  5M3M H;  2EXD A;  3L2P A;  4OO1 G;  1HH2 P;  1OTC A;  1V9P A;  2YV5 A;  3CW2 C;  3NBH B;  2CQO A;  4LUZ A;  2F52 A;  3UDX A;  1D7Q A;  3HKS A;  2UUC Q;  1J6Q A;  2WP8 J;  1YHQ A;  4JBM A;  3GTO H;  3I2Z A;  3HKZ G;  4JI3 Q;  2R6G A;  1VS0 A;  1Y14 B;  4HIO A;  3TEH B;  2ALY B;  5GAE C;  4A3D H;  1VQA A;  1HNZ Q;  4LUV A;  3HOX G;  5FLX c;  4BXX G;  4DV7 L;  3M7N A;  4GS3 A;  3I56 A;  4LF7 Q;  1C0A A;  1QUQ B;  1BBW A;  4POG A;  3H3V H;  1KRT A;  4A3F H;  4DUZ L;  2E2J H;  4JI7 Q;  4DPG A;  4L5R C;  4BBS H;  1I50 H;  1VQD A;  2F4V L;  3KFU A;  4DR6 Q;  1EYG A;  1YIT A;  3KF6 B;  1OXU A;  1S3O A;  1X3G A;  2V1C C;  4FDB A;  3GTM H;  2N49 A;  3S1M H;  2HQL A;  2HIV A;  3PUY A;  4DV4 L;  4JI2 Q;  3RZD H;  1SFO H;  3CCL A;  2VY3 A;  1Z9F A;  1UWV A;  2ES2 A;  4WJ4 A;  3CP0 A;  2B63 G;  4LFB Q;  3I4O A;  1X56 A;  3CCE A;  4X62 L;  4A93 G;  1CSP A;  4LF4 Q;  2HHH Q;  3HOW G;  5GAD C;  4JBJ A;  1O7I A;  3OYY A;  2JA6 G;  1NE3 A;  5C4J H;  2D62 A;  1QUQ A;  4P73 A;  1VQ6 A;  1UE7 A;  3SGI A;  4JYA Q;  3CCU A;  1X3E A;  1YHB A;  3CC7 A;  1N33 Q;  4LWC A;  5C4X G;  4PZ8 A;  1VQG A;  3HOZ G;  4A3C H;  4DR7 Q;  3GTK H;  2GVB A;  1FVI A;  1UEB A;  2N8N A;  4NPS A;  1WYD A;  2ATW A;  2JA7 G;  1E3P A;  1CKN A;  3H3V I;  2VZA A;  4BBR G;  2LXJ A;  4KI0 A;  4GNX C;  3DM3 A;  2NN6 G;  2VW9 A;  2VQF Q;  3PO2 H;  1HZ9 A;  3U4V A;  1L2F A;  1T9H A;  3FP9 A;  4KLK A;  1A8V A;  1L0W A;  4GKK Q;  3J81 j;  3A5Z B;  4K0K L;  1EUJ A;  3S17 H;  2IHF A;  3F8T A;  1HNW Q;  2EQS A;  1EOV A;  4R4I A;  4BY1 G;  1VQB A;  1U5K A;  4IPC A;  2RCN A;  4P72 A;  1WJJ A;  2NN6 I;  4DUY L;  4GN4 B;  5EAY A;  1XPO A;  2VQE L;  1P8L A;  4MZ9 A;  3CCV A;  2K52 A;  3GTQ H;  2K4K A;  5IYD H;  4HID A;  3HOY G;  1JJG A;  5IYC G;  4DV1 Q;  1VQ5 A;  1KRS A;  1SE8 A;  3VDY A;  3RLN A;  4OWW B;  4IOA A;  4QJF A;  4UP9 A;  4AQY Q;  2KEN A;  3FKI G;  3PUV A;  1YBY A;  4JI0 Q;  2JA7 H;  4GOP B;  1G51 A;  4DR2 Q;  2NVX H;  3GO5 A;  3OW2 A;  1Q46 A;  1Q1B A;  2I5L X;  3MXN B;  4IJH A;  1JE5 A;  1YEZ A;  3AFQ A;  2FXQ A;  5HY6 A;  4DR3 L;  1JMC A;  1VQE A;  3BZK A;  1YVC A;  1L1O B;  2OCE A;  1K0R A;  1PYB A;  5C4X H;  2JA8 G;  2BA0 A;  4JI8 Q;  2VUM G;  2C35 B;  2Y0S E;  4DV2 Q;  1N36 Q;  1CSQ A;  2R92 G;  1MJE A;  4LFA L;  2EIF A;  1HJP A;  3CQZ H;  1K3R A;  4R4T A;  2ZM6 L;  4KHP L;  2JA9 A;  4A76 A;  1E22 A;  4QGU A;  4O2D A;  1YHA A;  4AIM A;  4YHH L;  2OQK A;  2ZTD A;  4UPA A;  4X66 Q;  4GLX A;  2UXD Q;  1GVP A;  3H0G H;  4DV6 Q;  2D0P A;  5LMN L;  2E8G A;  2PQA B;  1UE6 A;  4JI6 L;  3CCJ A;  3ULP A;  4GLA C;  4A3G H;  5E7N A;  1EWI A;  3STB C;  1B70 B;  1MKH A;  1NMG A;  4GN5 A;  4X64 Q;  1C9O A;  2OTL A;  2HT1 A;  3KDF A;  1N34 Q;  2MFI A;  1WFQ A;  1Q86 C;  1X54 A;  1EQQ A;  1I94 L;  2CKZ B;  4APV A;  2UUB Q;  5IYC H;  4L5T A;  4GNX A;  3HOY H;  1TWA H;  3PO3 H;  2JJQ A;  1HR0 L;  2OQ0 A;  2MQH A;  2BH2 A;  4DKA C;  4HJ5 A;  2AWO A;  2B63 H;  2KHI A;  1YZ6 A;  4A3D G;  1SR3 A;  4PZ7 A;  4EX5 A;  5ELN A;  3A0J A;  2MO1 A;  4OWT B;  3K7A H;  3AEV A;  4LFC Q;  1QVG A;  1QVC A;  3AQQ A;  4HJA A;  1VQC A;  5M3M G;  5IWA Q;  1Y1V G;  4Y7N H;  2BH8 A;  4OX9 L;  2IX0 A;  1IZ6 A;  2QEX A;  2UU9 L;  2XGT A;  3J81 c;  4KHZ A;  5IP9 G;  1HNX L;  1FGU A;  3EBE A;  4A3J H;  1VQM A;  1SRO A;  1WCM H;  4OWX B;  4LUO A;  4X65 Q;  1PV4 A;  4JI5 Q;  2Y0S G;  4IO9 A;  3M3Y H;  4BY7 H;  1XNQ L;  1JJ2 A;  4C3I H;  1C7Y A;  1IBM L;  3HOV G;  3RNU A;  2WAQ E;  1IBK Q;  4B3S Q;  3T1Y L;  4POF A;  1VQ7 A;  1CUK A;  1QVF A;  1E1T A;  3CC4 A;  4LF8 L;  1GO3 E;  1VQF A;  1N32 L;  3J80 c;  2CWP A;  2UXB L;  1VQH A;  4LF6 L;  5LMU L;  4LF5 Q;  4DR4 L;  2Z0S A;  1W3S A;  2L15 A;  1NTG A;  3UE0 A;  4QL5 A;  1NMF A;  3PIO A;  1XMO Q;  4YY3 L;  5DLQ E;  3L7Z C;  2UUA L;  3CCQ A;  1YIJ A;  2D0O A;  2PI2 A;  4DAY B;  1IBL L;  3CD6 A;  4GOP C;  1AE2 A;  1X3F A;  3F2C A;  2R93 G;  4A3B G;  4DV3 L;  1GD7 A;  3JAM i;  4DK3 C;  3STB D;  4LF9 L;  2JA6 H;  1VQI A;  2A19 A;  3KLW A;  5HGQ A;  3T1H Q;  3BU2 A;  4BY7 G;  3EIV A;  5IY0 A;  1Y1V H;  1X9N A;  1KIX A;  3LGJ A;  3EN2 A;  1PYS B;  1K9M C;  2OWO A;  2NVQ H;  3GTG H;  2OTJ A;  2JEB I;  2B3G A;  3ERS X;  2E5L L;  4NXM Q;  2A1A A;  2IX1 A;  1W2B A;  4QQB X;  4YWL A;  5IP9 H;  1K8G A;  1A63 A;  1KXL A; 
#chains in the Genus database with same CATH topology
 3HP3 A;  2ICE C;  4C1N K;  2YTV A;  3E0E A;  1XXG A;  3KLR A;  4HIK A;  5CBA E;  1EEF D;  3PQI A;  3RLF A;  4DK0 A;  5J3B A;  5AJ3 L;  1STH A;  4GKJ Q;  1HFN A;  2CQA A;  3S14 H;  2F0U A;  3KYH C;  4BY1 H;  1GKH A;  2KBN A;  3B6Y A;  3OSO A;  3I4N H;  4ZUI A;  2KA7 A;  4F88 A;  2UXC L;  2LMC B;  2E2I H;  5BR8 Q;  4B3M L;  3M85 A;  4DAM A;  4FF3 A;  4K6L A;  2NUC A;  3NHH A;  4QUC A;  1K83 B;  4JBW A;  4DA2 A;  3NWT A;  4JI1 L;  1FNV A;  3R8B A;  1VQN A;  4O1N A;  5M3M B;  3GTP B;  2KJX A;  1V8Q A;  3UE1 A;  1RKN A;  2A73 B;  4IUT A;  4KKT A;  1E1O A;  1Q8K A;  3J7Y W;  2NTT A;  1SE2 A;  5GAH C;  2F0W A;  1E2V A;  2Q2T A;  2YU9 H;  3JAM L;  3TS2 A;  2XRQ D;  3I4N G;  2C5C A;  2K1B A;  3GD7 A;  4DUZ Q;  2EY2 A;  3R93 A;  2F4V Q;  3URY A;  3F1Z A;  2F0D A;  2RF4 A;  1R9T H;  2CH4 A;  4ZKB B;  3S15 H;  3HOY B;  3GTL B;  1JR0 D;  4HIM A;  1HZB A;  2VNU D;  5CC4 A;  4OHJ A;  5EPJ A;  1W6K A;  4JYA L;  2V4D A;  1G29 1;  3I7F A;  1ZYR D;  1TVX A;  4XDX A;  1QZH A;  1N33 L;  2B2T A;  4A75 A;  5EPK A;  4AH6 A;  4Y7N B;  2R93 H;  2JA8 B;  4ZUJ A;  3VR4 A;  4L6T B;  4HED A;  1B3A A;  1S5D D;  1L1O A;  1YNX A;  4PNY A;  4KD4 A;  1EIY B;  4IUR A;  1EOT A;  1X3P A;  4C3I B;  1Q82 C;  2VL6 A;  4LJZ C;  2DY7 A;  4A3I G;  2M9V A;  1HFG A;  1BVS A;  2WIN B;  4ZRZ A;  3ERO A;  1S4Z A;  3SK8 A;  1T5E A;  1TWC H;  1G8Z D;  4BBR H;  3S1N B;  2AHO B;  3K5N A;  4X6A H;  3K8A A;  4JI0 L;  1KNE A;  5IYB H;  3A8K E;  1JWS D;  2KEE A;  4I7A A;  2F4I A;  1H9M A;  1BCP D;  1XJV A;  1LTG D;  1STE A;  1UUP A;  1XWE A;  1EY0 A;  1SE3 A;  4C3J H;  1CHQ D;  4KHP Q;  1LTI D;  2F0L A;  4YHH Q;  4JCV E;  1CFM A;  4DV6 L;  3PGZ A;  4BXX H;  2D9U A;  3HS0 C;  4XYQ A;  4X64 L;  1PH7 A;  2Z8L A;  1B7Y B;  4RHS A;  1KDA A;  3O13 A;  4JVZ A;  4XT1 B;  1I94 Q;  1VQ8 A;  5BN3 A;  1JOO A;  1STN A;  2K6A A;  1BUV T;  4ID6 A;  4N9T A;  1S5E D;  1KDB A;  4U68 A;  4G57 A;  2KQ3 A;  1P16 A;  5GRO A;  1PH6 A;  3HOU B;  1AW7 A;  1NCV A;  3G6J B;  1A2T A;  4YWM A;  2R92 B;  4MHE A;  1SJH D;  1EIH A;  3DWP A;  2JA5 H;  2QF7 A;  4U67 3;  3LWU A;  1SSO A;  5LL6 S;  2JK8 A;  1I4P A;  3PUW A;  1HRJ A;  2O4X A;  1CK1 A;  3I55 A;  4A3K H;  2QGQ A;  5C3W A;  4RWS C;  2UXB Q;  3CCS A;  5IP7 G;  4R8I A;  1BO0 A;  4QCL A;  2Q2I A;  4DR4 Q;  4R4O A;  1OXT A;  2CFM A;  1Y8P B;  2NZ1 D;  1PYW D;  4L8J A;  1V43 A;  4LMQ D;  1VQL A;  3RLO A;  3FRP B;  3H15 A;  3CPF A;  2R7Z H;  3G48 A;  3S2D H;  5CYU A;  3RN2 A;  5C44 H;  1VQP A;  4Q5V A;  1DJR D;  5C0X G;  4YCV A;  1ET9 A;  3VA5 A;  1AEX A;  1PZK D;  2IWH A;  3MEH A;  3QO2 A;  5T1G A;  1DXM A;  3K59 A;  4EQO A;  1NJI C;  1SYC A;  2SNM A;  3PUX A;  2XNA C;  4CKE A;  3NTK A;  2MUY A;  4IJL A;  1JWU D;  1QNK A;  2LSS A;  3EQL C;  4H13 C;  5G3L D;  5A2Q L;  1O80 A;  4A3F G;  1SMY D;  4DR1 L;  4A3E H;  5JJZ A;  4A3B B;  3C1F A;  3S1R B;  2K5N A;  1FJG Q;  5KYI A;  1EQR A;  4B3R Q;  2BA1 A;  4JBK A;  5EPL A;  2XIW A;  4A3M G;  3GTP H;  3RR5 A;  2TSS A;  1AN8 A;  3VYT A;  4JI4 Q;  3M4O H;  2YYZ A;  1GHK A;  1HH2 P;  5IGB A;  1V9P A;  2YV5 A;  3S17 B;  2CQO A;  4LUZ A;  2F52 A;  3UDX A;  5EKK A;  3HKS A;  3S9W A;  4JBM A;  3I2Z A;  1TQO A;  3BDO A;  3SK4 A;  5KEE A;  3TEH B;  3GTQ B;  1LT5 D;  4A3D H;  1HNZ Q;  3V2T A;  4XQN A;  1H9S A;  1C0A A;  1QUQ B;  1GHJ A;  1KRT A;  1B4O A;  4L5R C;  1I50 H;  1QOH A;  4DR6 Q;  2RDH A;  1EYG A;  1YIT A;  3HEJ A;  1S3O A;  3GTK B;  4FP5 D;  2G5D A;  2N49 A;  5J22 A;  3ZYY X;  1TKW B;  3PUY A;  1SFO H;  1D2B A;  3CCL A;  1PTO C;  2ES2 A;  4K2L A;  2B63 G;  1PDQ A;  4X62 L;  3U9S A;  3VA7 A;  4LF4 Q;  3HOW G;  5K5P A;  1O7I A;  3OYY A;  5C4J H;  3GTJ B;  2D62 A;  2Q8I B;  5I9O A;  2EOT A;  5IGC A;  1VQ6 A;  3T56 B;  1ESF A;  4K2K A;  3KBG A;  1YHB A;  1JCK B;  3CC7 A;  4LWC A;  1VQG A;  2MPM A;  2N8N A;  4NPS A;  1J9O A;  3T53 B;  3H3V I;  2B2V C;  2LXJ A;  3DM3 A;  1Z7T A;  4TSS A;  2VW9 A;  1HZ9 A;  3FKI B;  4KLK A;  2HQE A;  4K0K L;  3J81 j;  2IHF A;  2FHT A;  1EOV A;  4R4I A;  4BY1 G;  4P72 A;  1XPO A;  1STB A;  1WTP A;  2H1E A;  3CCV A;  3K57 A;  3HOY G;  2K33 A;  2NWG A;  1VQ5 A;  3RLN A;  4IOA A;  4AQY Q;  2E2J B;  4GOP B;  4DR2 Q;  3AFQ A;  4BY7 B;  1VQE A;  3RZD B;  3BZK A;  4KTA A;  3FPP A;  2JA8 G;  3BDC A;  2Y0S E;  1N36 Q;  2HCC A;  4LFA L;  2EIF A;  4RCO A;  2F0V A;  2OQK A;  2ZTD A;  4X66 Q;  4CKB A;  1GVP A;  4BWG B;  1H9J A;  5LMN L;  1UE6 A;  4JI6 L;  3CCJ A;  3IFT A;  3ULP A;  4A3G H;  1B70 B;  4GN5 A;  3MXU A;  2F0M A;  3SK5 A;  2HT1 A;  1A3V A;  1CZG A;  1MSG A;  2EYJ A;  1SYE A;  4GNX A;  3S15 B;  1S5F D;  2EDG A;  4KY7 A;  2AWO A;  3NPP A;  3QR8 A;  1G6Z A;  4OWT B;  4DFA A;  4G4K A;  4MIU A;  5M3M G;  4OX9 L;  2UU9 L;  2A6E D;  4KHZ A;  3TP8 A;  5D14 A;  1FGU A;  4A3K B;  1GJX A;  2WKD A;  5E1F A;  4X65 Q;  4K5W A;  3J81 E;  4IO9 A;  1XNQ L;  1JJ2 A;  1C7Y A;  2K28 A;  1IBM L;  2F0T A;  3C1E A;  1CUK A;  1QVF A;  1GO3 E;  1N32 L;  5D3D A;  2N55 A;  2F1M A;  4I7Z C;  1RHP A;  5LMU L;  1BBX C;  4LF5 Q;  3J80 L;  1NTG A;  3NK9 A;  2UUA L;  3KLS X;  2IW3 A;  2QKI C;  2SNS A;  1FYC A;  2R93 G;  3ONA B;  5C44 B;  4LF9 L;  1VQI A;  2R61 A;  3OHX C;  4QF4 A;  5DM6 3;  1WD1 A;  4BY7 G;  1Y1V H;  1K9M C;  1PYS B;  3EN2 A;  2WII B;  3NXW A;  4PMB A;  2B3G A;  2A1A A;  4QQB X;  1SAP A;  1A63 A;  1KXL A;  2M2L A;  3W2D A;  3ITP A;  1IL2 A;  5IT9 L;  4LNQ A;  1JOQ A;  4DR5 L;  3A8J E;  1TWF H;  1QB5 D;  3E9I A;  3IKJ A;  1PA6 A;  4A3E G;  4ABN A;  1ZYR C;  2AMC B;  4K5V A;  1WTW A;  1K8A C;  3NQT A;  2XWJ B;  1X65 A;  3L3O C;  3KF8 B;  4C3J G;  4JV5 Q;  3CMA A;  4FVM A;  2QIL A;  3Q22 A;  5C3E H;  2AUK A;  4XQQ A;  2Z9H A;  5COR A;  3QG1 A;  2MGS A;  2JA5 B;  3AB9 A;  3DXJ C;  1VF7 A;  3H0G G;  3Q0A A;  2CHB D;  3CCM A;  4DV0 L;  1MIU A;  1GM5 A;  1XNR Q;  1F9P A;  2EYL A;  1I6H H;  1Z47 A;  2UUC L;  2L12 A;  4UY8 C;  3I4M H;  4FXD A;  3MA2 B;  1EY5 A;  2NVQ B;  5IGD A;  1K3B C;  1ENF A;  1FL0 A;  2HDM A;  2ID0 A;  4MTK A;  4DV7 Q;  4IPG A;  1STG A;  1EYA A;  1J8I A;  3S1N H;  1ASY A;  4KMU C;  4XXE A;  4JI7 L;  2B2Y A;  3HOX H;  3K80 C;  1DOL A;  3AFP A;  4JI2 L;  3S16 H;  5KRU A;  3J7A 5;  3S14 B;  2Z4I A;  4LFB L;  1PFS A;  1K73 C;  3GTJ H;  3E9H A;  3BVM A;  2PMZ E;  1CA6 A;  3N6R A;  4PG3 A;  4IFD J;  2B29 A;  3A55 A;  2HIX A;  4KKU A;  3DUZ A;  3JC6 6;  4BBS G;  1L0X B;  3DWA A;  5JPM C;  1OXX K;  3ND9 A;  3I4M G;  2GVA A;  4DR7 L;  1U4P A;  4F87 A;  1UAP A;  5I2Y A;  1ROD A;  3TZU A;  5M5Y B;  1LAC A;  1BCP B;  3KF6 A;  4H0L C;  2F0I A;  1LTR D;  2VQF L;  4IFD G;  4A3E B;  2CH4 W;  4YIJ A;  4EQN A;  5C3X A;  1KAW A;  4GKK L;  5C4H A;  2PI2 E;  5H1S E;  1NSN S;  1RL2 A;  1SLJ A;  4HJ8 A;  1TS3 A;  3GQB A;  3HOW B;  4R4Q A;  2I5M X;  4IUP A;  1SN8 A;  1U4M A;  1X6O A;  1EIG A;  3PF4 A;  2I07 B;  2EYH A;  1SE4 A;  4YWK A;  1Z6H A;  2A74 C;  1PTO D;  2RBM A;  4HSP A;  4FYD A;  3SR1 A;  1B53 A;  3NEL A;  5M5W B;  4DR3 Q;  1DON A;  3ICE A;  5M3F H;  3K0Y A;  4IUV A;  4JPB W;  3RMH A;  3QB3 A;  3WOF A;  3DHQ A;  1C48 A;  2RDG A;  5ELB A;  4JI8 L;  4OO1 H;  4DV2 L;  1YJN A;  2R7D A;  3EA6 A;  4A3D B;  1BDO A;  5JEA J;  1JT8 A;  4KJN A;  4QY7 A;  4LK1 C;  4RGN A;  2ZM6 Q;  3FVQ A;  1C4Q A;  5C0X J;  4UP7 A;  1RIP A;  2EPB A;  2H5X A;  3Q23 A;  2F3V A;  1IYV A;  4QIW B;  4IN3 A;  2VS1 A;  3DLL A;  1IYJ B;  1E2W A;  2K03 A;  2E76 C;  2KEC A;  2UUB L;  2JA8 H;  4MNO A;  1PTO H;  3MFG A;  5E4W C;  1HR0 Q;  2F3W A;  1SYF A;  4GLV B;  1AZQ A;  3CME A;  1HUN A;  1HA5 A;  1HQR D;  5A2Q E;  1Q3L A;  3UDG A;  3KDF B;  4A3L H;  5IWA L;  1FD7 D;  4JC0 A;  2VB2 X;  1K83 H;  1CKN B;  1HHV A;  2CCZ A;  2AWN A;  2PO4 A;  1GUS A;  4DNI A;  3CKI B;  3FKI H;  3NE5 B;  3S2H H;  4JI5 L;  3ULJ A;  1B44 D;  1L0Y B;  1EFW A;  5JEA G;  1PH9 A;  4PMW A;  3CAM A;  1IBK L;  3T1Y Q;  2Q8T A;  3U50 C;  3K5L A;  1Y1W H;  3F2D A;  1MSH A;  2FMC A;  4WFN 3;  4HMI A;  1PFB A;  3E3X A;  3SHL A;  2Q8R E;  4RFB A;  1XMO L;  1N9W A;  1KDC A;  1B8A A;  3L9A X;  1WI5 A;  1IBL Q;  1ESR A;  2KCT A;  1PTO F;  4XTC S;  4F8M A;  5GAG C;  1IXR A;  3TDQ A;  5CGK A;  4DV3 Q;  1A2U A;  3SXH A;  4A4I A;  4HMJ A;  4NB3 A;  4QB4 A;  2JA6 B;  4J6H A;  1O78 A;  1TWG H;  1NY4 A;  1PH1 A;  1I3Q H;  5HGT A;  3H94 A;  4NXM L;  2E5L Q;  1JB3 A;  2DNC A;  3IRB A;  4L63 B;  1Y1W G;  2A8V A;  5DAU A;  1O7Y A;  4F7X A;  2IHE A;  1YNN C;  3ZJY C;  3GDE A;  1QZG A;  4DV5 L;  5JEA H;  3HOU H;  1F9S A;  5GQO A;  2I5H A;  3CRL C;  1HR0 W;  3BS1 A;  2K5Q A;  4B3T L;  4GKJ L;  1J5E L;  2BDO A;  5FLM G;  1IKM A;  1VQK A;  3S2D B;  2R7Z G;  1PXU A;  2SDF A;  2A6E C;  3PO3 B;  1BBU A;  2R7F A;  4NXN L;  4DNR B;  5C44 G;  4IUU A;  4RG1 A;  4TRD A;  2IY5 B;  3NEM A;  4AYB E;  1M4V A;  3PCO B;  2Z4H A;  4B3M Q;  2MJ8 A;  5DM7 3;  3CXC A;  1AE3 A;  1RF2 D;  1XX8 A;  3RZO H;  2K75 A;  1PZI D;  4JI1 Q;  4A93 H;  2PYK A;  3D31 A;  2FMM A;  3QOL A;  3OIQ A;  3QWN A;  5M3M H;  2F0J A;  3L2P A;  3X3N A;  1YHQ A;  2RCF A;  4N8X 1;  3TBI B;  3NWS A;  4JI3 Q;  1JOR A;  2ALY B;  2DNE A;  3D6C A;  4QUF A;  4C3J B;  1JOK A;  4LUV A;  4ODG A;  3HOX G;  5E3F A;  3M7N A;  4LF7 Q;  1H9R A;  1BBW A;  2EE1 A;  4POG A;  4DUZ L;  2E2J H;  4BBS H;  2F4V L;  3D3R A;  2GA4 B;  2L0C A;  5AFW A;  3KF6 B;  1OXU A;  2L4N A;  4FDB A;  1BCP C;  4RKB A;  2HQL A;  1UWV A;  2X69 A;  3H6M A;  2AQ2 B;  3P7J A;  3CCE A;  4A93 G;  1CSP A;  2EXZ A;  5ELD A;  4FNF A;  2HHH Q;  2JA6 G;  1DYQ A;  2X6G A;  1V1O A;  5M9O A;  3E6Z X;  1F9Q A;  1R4P B;  4OL7 A;  5C4X G;  3HOZ G;  1MD2 D;  4A3C H;  1FVI A;  1EZ6 A;  1UEB A;  1WYD A;  1E3P A;  1CKN A;  2VZA A;  2NN6 G;  3M4O B;  3PO2 H;  2NVX B;  3U4V A;  1T9H A;  4JK1 C;  3FP9 A;  1VMC A;  2A69 C;  1EUJ A;  1A3U A;  1NAP A;  3A8I E;  1VQB A;  2RCN A;  2NN6 I;  4UDU C;  5EAY A;  2VQE L;  1G91 A;  2Z6B A;  1EY4 A;  4B9X A;  4IQZ A;  5IYC G;  2A6H D;  3I8Z A;  4QJF A;  1HPC A;  1O7L A;  5FLX L;  3PUV A;  1YBY A;  4DAY A;  3GV3 A;  3OW2 A;  1YEZ A;  2ZXR A;  1RCV D;  1K0R A;  1PYB A;  2VUM G;  3MVV A;  1SNM A;  1RTN A;  2C9O A;  1AZP A;  2R92 G;  1MJE A;  5CV4 A;  1V1P A;  1K3R A;  5C4J B;  4KHP L;  2JA9 A;  1D5M C;  1PFM A;  1YHA A;  2DJF C;  4YHH L;  4GLX A;  5EBD A;  1TU2 B;  1GXD C;  1ILQ A;  3H0G H;  1K0S A;  4DV6 Q;  2D0P A;  1BNZ A;  4GLA C;  1MKH A;  1H9S B;  2MP1 A;  3KDF A;  1WVL A;  1N34 Q;  1WFQ A;  1Q86 C;  1PTO B;  1I94 L;  4M8A A;  3X3M A;  5IYC H;  4L5T A;  3WOE A;  1MBY A;  1TWA H;  1PLF A;  5DEH A;  2OQ0 A;  3NTH A;  3M3Y B;  2KVM A;  2BH2 A;  4DKA C;  4DN4 M;  5JVG 3;  1SXT A;  1YZ6 A;  4PZ7 A;  1EY8 A;  3NTI A;  3A0J A;  2MO1 A;  3AEV A;  3K7A H;  4LFC Q;  1QVG A;  1QVC A;  2JXM B;  4UAI A;  4CDE C;  1EU3 A;  4CJ0 B;  1SDF A;  2BH8 A;  4AYB B;  5IP9 G;  1HNX L;  2E2H B;  3EBE A;  1DD2 A;  2B8G A;  1YNN D;  1SYB A;  4B3S Q;  2KUM A;  4POF A;  1Y1W B;  1E1T A;  2UXB L;  3J80 c;  4LF6 L;  1CZW A;  3N52 A;  2EVB A;  1LAB A;  4DR4 L;  1DOM A;  5IGF A;  4QL5 A;  1NMF A;  3BYT B;  2XRS D;  4V0B A;  3CCQ A;  1YIJ A;  2ICI A;  3A56 A;  2J7Z A;  2JYO A;  2Y0S B;  4GOP C;  1CTM A;  1I50 B;  4A3B G;  5M3F B;  4IUQ A;  1D6E C;  4RH6 A;  3T1H Q;  2RQX A;  1I3Q B;  1CHP D;  3MXG A;  5FO8 B;  1X3Q A;  2OWO A;  4IAL A;  3ERS X;  2IX1 A;  1LT3 D;  3Q24 A;  2EJM A;  1W2B A;  4YWL A;  3H91 A;  2Z1C A;  2B2U A;  1PFN A;  2MO0 A;  5C5M A;  2YTX A;  3GTM H;  3KJO A;  1SNO A;  4O0A A;  2K5V A;  3VR6 A;  1YJ9 A;  1PH8 A;  3BZD B;  2SOB A;  1EEI D;  2JN4 A;  1KC8 C;  1PH5 A;  2MNA A;  1XMQ L;  2H4O A;  4ILW A;  4R1J A;  3PV0 A;  1V1Q A;  1F9R A;  2ZJQ A;  3MHB A;  3I4L A;  1SBB B;  1FJG L;  1Q81 C;  4A3B H;  3S1R H;  2HUG A;  4HAE A;  2X6L A;  2K05 A;  3OTO L;  1HA6 A;  2IL8 A;  3I91 A;  1KHI A;  1PRT B;  1QIL A;  1B1Z A;  1SRU A;  4XYO A;  2RSN A;  1ET6 A;  4EQP A;  1LLR D;  3M9B A;  4H02 A;  1BCP F;  3TP6 A;  3CRK C;  3KF8 A;  2AQ1 B;  3PO3 G;  5JJK A;  2EYO A;  4MTN A;  2NVT H;  1IW7 C;  1LYL A;  3CF5 A;  2EJG C;  4R9W A;  3JAM c;  5LMN W;  2QA4 A;  4DNT B;  5C3E G;  3EJI A;  1HNZ L;  2PQA A;  2F0G A;  3MXP A;  4KKS A;  2ENB A;  1II3 A;  3NUC A;  4P71 A;  3K81 C;  1B3Q A;  1CM9 A;  4YCW A;  1F2L A;  1TR5 A;  4RGT A;  3U58 A;  1OXS C;  4DV4 Q;  5C0X I;  2VXW A;  1CKM A;  4KY6 A;  1VQJ A;  1Q7Y C;  2L9H A;  3PUZ A;  5COY A;  4X62 Q;  2WFW A;  1EIF A;  4LF4 L;  1ASZ A;  2IT1 A;  2KCM A;  1EWH A;  2OXP A;  2ZTC A;  5E4X A;  2PW7 A;  1ICW A;  1EQT A;  1ZKO A;  2XTI A;  3HZX A;  1QCB D;  5ISR A;  3A5U A;  1WTQ A;  1L1O C;  3MWY W;  3NBI A;  4FF1 A;  1E7Z A;  2NZO A;  2NN6 H;  1PHJ A;  2NTS A;  2AKW B;  3VYU A;  1Q1E A;  1E0B A;  1X55 A;  1F2M A;  1TY2 A;  4GN3 B;  4NMZ A;  4WJW A;  3PSI A;  1HTL D;  3K7U C;  2O5J C;  1Y69 U;  1I6H B;  4BA1 I;  1CA5 A;  5FOB B;  3PF5 A;  1HNW L;  3D0F A;  3FEW X;  3I4M B;  1V1P B;  2K04 A;  3FMC A;  3J80 i;  4DUY Q;  1A6X A;  3BVZ A;  3QOJ A;  3WWV A;  3CCR A;  4ME5 A;  3F2B A;  5CV5 A;  3HOZ H;  1XPU A;  2K14 A;  1UEA B;  2L5T A;  2TMP A;  1O7Z A;  4ZAI A;  3RN5 A;  4DV1 L;  1VQO A;  1TWH H;  3AU7 A;  5M5Y H;  4AQY L;  2PQE A;  2Z6K A;  4P74 A;  2K50 A;  3PO2 G;  3BYY B;  5FLM H;  4DR2 L;  2CWA A;  1E24 A;  4RA8 A;  3W1B A;  2K5H A;  3S16 B;  5ELF A;  1T5X D;  1RTO A;  1Q12 A;  2RA4 A;  4GZY C;  4HSV A;  5I6Y A;  5FJ8 G;  4ZKC B;  1MGS A;  2HD3 A;  2A5H A;  4PZ6 A;  4CHT B;  1YI2 A;  2UXD L;  3HG9 A;  4X3T A;  5LHY 1;  4A3M H;  5LMN Q;  2XN9 C;  2PMZ B;  2OEO A;  3S1M B;  5IP7 H;  3RD4 A;  3ULL A;  4EGV A;  1PZJ D;  3NEN A;  1MHW C;  4C2M B;  1TWF B;  3UI2 A;  4DAV A;  3TP7 A;  1D8L A;  1NUC A;  1EYC A;  1BQQ T;  1IHZ A;  2ZJR A;  2F0N A;  2AUJ D;  3VYS A;  1XPR A;  1I5F A;  2F03 A;  3PIO 3;  2EY6 A;  1PH3 A;  2VUM B;  1RD9 D;  2N3S A;  1YNJ D;  1FR3 A;  3A74 A;  3OMC A;  5A35 A;  5C5L A;  2LY7 A;  3CC2 A;  1LTA D;  4RCN A;  4UHV A;  1EY9 A;  2PNH A;  3T4A C;  2UU9 Q;  4ULL A;  4IFD I;  3MFY A;  4IPH A;  3MZ5 A;  1CKO A;  4TQU S;  3BZC A;  2LXK A;  1A62 A;  1TXY A;  3SVM A;  4X65 L;  2B63 H;  5M5W H;  1VQ4 A;  1D5Z C;  1XNQ Q;  3KOJ A;  2GN5 A;  1TWG B;  3M4Q A;  4LF8 Q;  1N32 Q;  1H95 A;  3OPO A;  3T16 A;  1Q90 A;  4RAU C;  3D8G A;  5LMU Q;  1G6P A;  4LF5 L;  4KV6 A;  4YY3 Q;  4A3C G;  5J39 A;  5CV7 A;  2N78 A;  4OON A;  2RSO A;  2WB1 E;  4A3G G;  3VR5 A;  2HCI A;  1HZC A;  1KAB A;  2BE5 D;  3J7A F;  4R4C A;  1OXV A;  5KNC A;  2O2L D;  3MEF A;  2F0H A;  5L37 A;  5FO7 B;  3OIP A;  3SEB A;  3W1G A;  2Q2U A;  3HKZ E;  1TS2 A;  3HRZ C;  2RHQ B;  3PIP 3;  3H0G B;  1JJC B;  3QJY A;  3KJP A;  4TKO B;  4OEL B;  2HDL A;  1WTO A;  3FHW A;  5AJ3 Q;  3RZO B;  2PZU A;  4L5Q A;  1DCZ A;  3AMU A;  2B2W C;  1TWA B;  4JG2 A;  5FKA C;  3S2H B;  3A54 A;  4A3J G;  2PPB C;  1WCM G;  2JSO A;  4LW1 A;  2UXC Q;  1UE1 A;  4JV5 L;  1VF5 C;  2R3Z A;  4Y52 H;  5BR8 L;  4IPD A;  2BDN A;  2DUD A;  1TS5 A;  3UDF A;  2WAQ G;  3HOU G;  3HOW H;  2NVY B;  3K0X A;  4YCU A;  1K8M A;  4DV0 Q;  1XNR L;  5ELO A;  1WCM B;  3TRZ A;  2EXD A;  1OTC A;  3NBH B;  3R2T A;  1D7Q A;  2UUC Q;  2B8F A;  4DF7 A;  4OGQ C;  2WP8 J;  3TME A;  3GTO H;  2R6G A;  2PZW A;  3K58 A;  5HUR A;  1VQA A;  1IW7 D;  5FLX c;  4BXX G;  4GS3 A;  3SK6 A;  4A3F H;  2P5Z X;  2EYF A;  1UNS A;  1I4Q A;  3OWE B;  2V1C C;  5CBE E;  1G2T A;  2HIV A;  5KND A;  1WTX A;  4LAA A;  2EJF C;  4DAP A;  2VY3 A;  1SYD A;  3CP0 A;  4LFB Q;  5JAV A;  2KHS A;  1X56 A;  1SND A;  5CR3 A;  5DNF A;  4X3U A;  5KIX A;  4G7O C;  1UE7 A;  2KCC A;  4XQJ A;  3SGI A;  1PMR A;  4JYA Q;  1N33 Q;  3BDL A;  4DR7 Q;  2GVB A;  1W6J A;  4ZK9 B;  2ATW A;  2JA7 G;  4A93 B;  4B9W A;  2PCF B;  4KI0 A;  1LT6 D;  2VQF Q;  1B50 A;  1L0W A;  3C2P A;  4GKK Q;  3A5Z B;  3MAQ A;  2B2V A;  3F8T A;  2EQS A;  1YNJ C;  3EVQ A;  1U5K A;  2OT2 A;  4IPC A;  1WJJ A;  1STY A;  1P8L A;  4MZ9 A;  2BE5 C;  1S5C D;  2K52 A;  3C3L A;  1FNU A;  2K4K A;  5ELC A;  1JJG A;  2WV6 D;  1TWH B;  4BBR B;  5IGE A;  4CJ1 B;  1B2T A;  2WAQ B;  4OWW B;  2ZXO A;  2KEN A;  4JI0 Q;  2E2D C;  4KY5 A;  1EL0 A;  2NVX H;  2QW7 A;  3GO5 A;  4J8Q A;  1Q46 A;  1Q1B A;  2I5L X;  5LL6 X;  4DXG A;  1JMC A;  2F0O A;  2FXQ A;  5EKL A;  2LKV A;  4KN7 C;  5C4X H;  2BA0 A;  3DMU A;  2C35 B;  5D3I B;  4DV2 Q;  2EY1 A;  3CQZ H;  2ZM6 L;  4R4T A;  4OEM B;  2FFK B;  4RGO S;  2K5W A;  4E6I A;  2F0E A;  4QGU A;  4AIM A;  4UPA A;  2E8G A;  4ZQ3 A;  1WTR A;  1EU4 A;  1NNX A;  3S1Q B;  5CMD A;  1EWI A;  3STB C;  4X64 Q;  2OTL A;  1C9O A;  3KLS A;  1LTS D;  2MFI A;  1F77 A;  2D2C C;  1X54 A;  1OO9 B;  2PW5 A;  1EQQ A;  2UUB Q;  4ZYS A;  5CV8 A;  3HOY H;  3PO3 H;  2JJQ A;  3ND8 A;  3PO2 B;  4CDD C;  4XT3 B;  4IFD H;  3TZD A;  1D1K A;  1BOS A;  3VR3 A;  2KHI A;  2JP1 A;  3AQQ A;  4HJA A;  3GTM B;  4Y7N H;  2E74 C;  4CBV A;  1DOK A;  2QEX A;  5I2X A;  2D5D A;  2XGT A;  3G7L A;  3C46 A;  3BG3 A;  5T1I A;  2JA7 B;  3A7A B;  4EVO A;  2RKS A;  1SYG A;  4NKL A;  1WTV A;  1SRO A;  1PV4 A;  4JI5 Q;  4WJ3 M;  3M3Y H;  3J7A V;  2CW0 C;  4C3I H;  4X3K A;  3HOV G;  3IAY A;  1IBK Q;  3OWF A;  2PZT A;  4H44 C;  1VQ7 A;  1KNA A;  1EY6 A;  1D5X C;  2CWP A;  1VQH A;  1Y8N B;  2Z0S A;  3UE0 A;  2A68 D;  3HGB A;  3PIO A;  1ML0 D;  5KNB A;  5DLQ E;  3L7Z C;  1QWY A;  1XMO Q;  4HR7 B;  3VYR A;  2SEB D;  3OOC A;  2D0O A;  1IBL L;  2R7Z B;  1GUG A;  3NSW A;  4A3J B;  1AE2 A;  3M7G A;  3F2C A;  2F0K A;  1C8C A;  1D1I A;  1GD7 A;  3OMG A;  3JAM i;  1QNU A;  4FF2 A;  1GOZ A;  2A19 A;  1CI3 M;  3KLW A;  4K8I A;  5JOB A;  3EFX D;  5BN5 A;  5M5X B;  3EIV A;  5IY0 A;  1KIX A;  4O42 A;  3LGJ A;  2OTJ A;  2E5L L;  1I4H A;  4DU9 A;  5IP9 H;  1K8G A;  4Z9C B;  3T13 A;  2KCN A;  4A3M B;  1KQS A;  4DV5 Q;  2DGY A;  3HOV H;  3D4R A;  4FO2 A;  1FGB D;  4P2C B;  4B3T Q;  4NDX A;  4C3H H;  2Q2H A;  1J5E Q;  4ZCK A;  3L0O A;  3DEO A;  3WDN A;  4IZ8 A;  5KYL A;  2JA5 G;  1LO5 D;  3U4Z A;  5IT9 E;  1LM0 A;  4NXN Q;  4DR1 Q;  1B9N A;  2EYM A;  1IYU A;  1I4X A;  1NBW A;  4L5S A;  1MJC A;  1EWC A;  3UDI A;  1IKL A;  4A3I B;  3W5O A;  4B3R L;  4HJ7 A;  3E0J A;  5JJI A;  1U4L A;  1DGS A;  2JE6 I;  1SJE D;  1TY0 A;  2F0F A;  4ALP A;  3RUZ A;  4EQ5 A;  1KLG D;  2NVY H;  4FXG C;  1A3T A;  4DK6 C;  5G3L F;  5JJL A;  1I4G A;  4B08 A;  3P20 A;  4JI4 L;  4AYB G;  5TSS A;  2B63 B;  4GOP A;  5IE8 A;  1R9T B;  3J80 E;  2J0T D;  5K36 G;  2E2I B;  4JI3 L;  3GTG B;  1LUZ A;  2IJ0 A;  3HOZ B;  3GTL H;  2K01 A;  4RKL A;  2ZJP A;  3CHB D;  2EYP A;  4KK7 A;  2WB1 B;  1WTH A;  1S5B D;  2OF1 A;  5EKI A;  4LF7 L;  4J15 A;  1M8A A;  2VB3 X;  2RDF A;  2LFN A;  2RHS B;  4DR6 L;  1HCZ A;  3M4Y A;  1S72 A;  4BA2 I;  2F0P A;  5FO9 B;  1KAA A;  4BBS B;  3K5M A;  3G4S A;  1VQ9 A;  2B2Y C;  1GUO A;  2B2W A;  4X3S A;  1ZXT A;  4BY1 B;  5K36 H;  2HHH L;  1PH4 A;  1SMX A;  1LTL A;  5IGG A;  1B9M A;  3I4N B;  1IL8 A;  3LX0 A;  5EQ0 A;  1MI2 A;  3NQI A;  2JQO A;  1U0L A;  1TT2 A;  3K5O A;  1HTP A;  1KL9 A;  2L1B A;  4HCE A;  3TRE A;  1LT4 D;  2E75 C;  1BXT A;  1FNW A;  1M1K C;  2BOS A;  1SEB D;  1XTD A;  1F2Y A;  5IOC A;  3T51 B;  3S24 A;  1RJT A;  4ME3 A;  4NW2 A;  1WD0 A;  5EGT A;  3GV6 A;  4K0K Q;  3LNN A;  1SNC A;  3HFZ B;  5JPN C;  3TS0 A;  2NVT B;  2I0Q A;  4P75 A;  2VQE Q;  1S40 A;  2K5D A;  3D4W A;  3CU7 A;  1K8O A;  1PRT C;  2MHV A;  2YTY A;  2L55 A;  2NZH A;  1EFI D;  4KN4 C;  2BCO A;  1VMP A;  1H9K A;  3FPU B;  3I3C A;  3IFD A;  4G7Z C;  1M90 C;  2F3I A;  4GNX B;  4CGY B;  4C2M H;  3J7Z C;  1N36 L;  4LFA Q;  3MC0 B;  2B39 A;  1NR4 A;  4V19 0;  2DJG C;  4X66 L;  4A3K G;  3S1Q H;  3MXN A;  1JQY D;  3SDZ A;  3BVG A;  4JI6 Q;  1F2Z A;  1UE5 A;  1VCI A;  4XIG S;  1N8R C;  3G6E A;  1N34 L;  4DK1 A;  3QIA A;  2A6H C;  2FIN B;  3Q8D A;  1PRT F;  2NBF A;  2ZXP A;  5FJ8 H;  2B2U C;  4QMG A;  1QJO A;  2O5I C;  1A0I A;  3A7L A;  4FF4 A;  4MN3 A;  5JVH 3;  4LFC L;  3G71 A;  1YJW A;  3K7A B;  4OX9 Q;  2CW0 D;  2KOL A;  1TII D;  4K5X A;  1HNX Q;  2LS0 1;  2Z6K C;  3IL8 A;  1CQV A;  1ZEQ X;  3CPW A;  2E2H H;  4HJ9 A;  1IBM Q;  3DWQ A;  3MTS A;  3M4P A;  3P1H A;  4JOI A;  4B3S L;  2ASB A;  4K14 A;  3GP7 A;  3I73 A;  1PH2 A;  3AYH B;  5ELE A;  4LF6 Q;  1WOC A;  4JOI C;  1KLU D;  2R92 H;  3I70 A;  1KD1 C;  2JEA I;  1DZ1 A;  2UUA Q;  4RMF A;  3PIP A;  3PMF A;  1BKB A;  1HXY D;  1EYD A;  5I9P A;  4K6D A;  5M5X H;  4LF9 Q;  1Q8I A;  1LTB D;  4C3H G;  1Y8O B;  3T1H L;  1RDP D;  1HZA A;  4A3L G;  2PNR C;  4HN7 A;  1X32 A;  4QIW E;  5CV6 A;  5IYD G;  1R4Q B;  2A69 D;  2VUM H;  1AH9 A;  3J81 L;  4IOC A;  4CJ2 C;  4C3H B;  1BF4 A;  4OXP A;  4DR5 Q;  2G9H D;  1JB7 A;  5IYB G;  3D4D A;  4TVA B;  2R93 B;  1XMQ Q;  4UP8 A;  5M3F G;  1XYI A;  2WB1 G;  1PRT D;  4A3I H;  4BS9 A;  4N9P A;  2J4X A;  3R2I A;  3TQY A;  4N8F A;  5IYD H;  1XTC D;  1PVO A;  3OTO Q;  1EQV A;  1E2Z A;  3ER0 A;  2NB0 A;  2L11 A;  1QG7 A;  4C56 C;  2B2T C;  3I72 A;  2ZTE A;  1STA A;  1U4R A;  4OIJ A;  1ILP A;  5CV9 A;  4OO1 I;  2K32 A;  1SMY C;  2F0S A;  3BJU A;  4WOR A;  2KHJ A;  4J1M A;  3J81 i;  2EZV A;  4C1N I;  4NP5 A;  4OO1 G;  3CW2 C;  1I6V C;  2DN8 A;  4M1U B;  2I46 A;  1J6Q A;  4HTH A;  3HKZ G;  1ENC A;  1VS0 A;  5EJW A;  1Y14 B;  1HUM A;  2QCP X;  4HIO A;  4KHV A;  5GAE C;  3K6O A;  2F0Q A;  4DV7 L;  3DM1 A;  2YU9 B;  3I56 A;  4RHR A;  3H3V H;  4JI7 Q;  4DPG A;  1VQD A;  3KFU A;  1I4R A;  3NP8 A;  3NBH A;  4R8N A;  2QDL A;  1X3G A;  4PV1 C;  2KED A;  3S1M H;  2NYZ D;  3HKZ B;  3SE0 A;  4FXK C;  1EY7 A;  1JWM D;  4JI2 Q;  1GUN A;  2FJ2 A;  4DGZ A;  1GUT A;  4DV4 L;  3RZD H;  1Z9F A;  5C4Z A;  4WJ4 A;  3GTO B;  3I4O A;  2AQ3 B;  4C3I G;  4K8J A;  1JC7 A;  1SNP A;  5GAD C;  4JBJ A;  1NE3 A;  2ZT9 C;  1QUQ A;  1CT1 D;  1JIC A;  4P73 A;  3H09 A;  3V96 A;  5I6W A;  4CDF C;  2QEJ C;  3CCU A;  1X3E A;  2M00 A;  4PZ8 A;  3P75 A;  3GTK H;  1GUW A;  1U9R A;  1SFO B;  3F2U A;  4BBR G;  4GNX C;  5IIF A;  1L2F A;  1A8V A;  1BR9 A;  1AP0 A;  3S17 H;  1HNW Q;  1A15 A;  4G7H C;  4H7B A;  1KTK A;  4KD3 A;  4DUY L;  4GN4 B;  5C4X B;  1ICF B;  3OW7 A;  3GTQ H;  4HID A;  3E5S A;  3W3A A;  2XWB B;  5J1Z A;  4DV1 Q;  1KRS A;  1SE8 A;  3VDY A;  4UP9 A;  3FKI G;  2JA7 H;  1TWC B;  1G51 A;  3TP5 A;  1LTT D;  1K28 A;  3MXN B;  4IJH A;  1JE5 A;  5HY6 A;  4DR3 L;  1YVC A;  1L1O B;  2OCE A;  3KBX A;  2WAC A;  4JI8 Q;  4HCS A;  1CSQ A;  1HJP A;  4CDC C;  5I4D A;  2G9D A;  4A76 A;  1E22 A;  4O2D A;  1DM0 B;  2UXD Q;  1ONL A;  3HOX B;  3LWE A;  4RGM A;  2IX3 A;  2PQA B;  5NUC A;  3TN2 A;  5E7N A;  1NMG A;  3I90 A;  4WRD A;  5F2D A;  4ZLT F;  2XSC A;  2XVS A;  3FDT A;  5KGU A;  2CKZ B;  1Y1V B;  2WKC A;  4APV A;  1HR0 L;  2A68 C;  2MQH A;  4Q0F A;  4HJ5 A;  1AFP A;  4A3D G;  3DEP A;  3HOV B;  1SR3 A;  4EX5 A;  3H3V C;  5ELN A;  2K7V A;  4S3S A;  4A3G B;  1QE6 A;  3ERQ A;  1VQC A;  5IWA Q;  2N88 A;  1Y1V G;  5FK9 C;  4PQX A;  1NR2 A;  2IX0 A;  1IZ6 A;  1G2S A;  3J81 c;  2RVL A;  4A3J H;  1VQM A;  4DXF A;  1ENA A;  1LV9 A;  1WCM H;  4OWX B;  4LUO A;  5FLX E;  2Y0S G;  4BY7 H;  4IUN A;  4JW0 A;  2WAQ E;  3RNU A;  1EZ8 A;  3JAM E;  3D6W A;  3T1Y L;  5C3E B;  3TSS A;  4CKC A;  3CC4 A;  1CQF A;  4LF8 L;  1VQF A;  3CQZ B;  1W3S A;  2L15 A;  2EY5 A;  2IPK D;  2CVR A;  4KJO A;  4YY3 L;  4I65 A;  1VDZ A;  5C6A A;  5BN4 A;  2PI2 A;  4DAY B;  4A3F B;  3CD6 A;  1JE4 A;  3Q6S A;  1HQM C;  1X3F A;  4OIK A;  4DV3 L;  4DK3 C;  3STB D;  2JA6 H;  3R3O A;  1SNQ A;  5D65 A;  2DY8 A;  3V05 A;  5HGQ A;  3KK7 A;  3BU2 A;  3KUP A;  5IOD A;  1X9N A;  2NVQ H;  3GTG H;  1TS4 A;  3VR2 A;  2QDB A;  5EBC A;  2JEB I;  3U9O A;  4NXM Q;  5C0X H;  5IT9 c;  4PMC A; 
#chains in the Genus database with same CATH homology
 1KQS A;  1IL2 A;  2YTV A;  3E0E A;  4DV5 Q;  2DGY A;  4HIK A;  3HOV H;  2MO0 A;  2YTX A;  4LNQ A;  4B3T Q;  3RLF A;  4GKJ Q;  5J3B A;  5AJ3 L;  3KJO A;  4O0A A;  2K5V A;  4C3H H;  2Q2H A;  4DR5 L;  1YJ9 A;  1J5E Q;  1TWF H;  3L0O A;  3E9I A;  1PA6 A;  1PH8 A;  4A3E G;  3S14 H;  2JA5 G;  3KYH C;  1KC8 C;  1GKH A;  2KBN A;  3B6Y A;  3U4Z A;  2MNA A;  1XMQ L;  1LM0 A;  2AMC B;  1PH5 A;  4NXN Q;  4R1J A;  4DR1 Q;  3I4N H;  3PV0 A;  1K8A C;  1V1Q A;  2ZJQ A;  1NBW A;  4L5S A;  1MJC A;  1X65 A;  2UXC L;  3UDI A;  1FJG L;  3KF8 B;  1Q81 C;  2E2I H;  4A3B H;  3CMA A;  4JV5 Q;  3S1R H;  5BR8 Q;  3W5O A;  5C3E H;  4HJ7 A;  4B3R L;  4B3M L;  3OTO L;  3M85 A;  4DAM A;  5JJI A;  1KHI A;  1DGS A;  2JE6 I;  4ALP A;  4EQ5 A;  4JBW A;  2NVY H;  3H0G G;  4DK6 C;  4JI1 L;  5JJL A;  1SRU A;  1VQN A;  3CCM A;  3M9B A;  4H02 A;  4DV0 L;  1MIU A;  4AYB G;  3UE1 A;  1GM5 A;  4JI4 L;  1XNR Q;  4GOP A;  5IE8 A;  1I6H H;  1Z47 A;  1E1O A;  2UUC L;  3PO3 G;  5JJK A;  4UY8 C;  3I4M H;  1Q8K A;  4MTN A;  2NVT H;  5K36 G;  1LYL A;  3CF5 A;  4JI3 L;  3JAM c;  5LMN W;  1LUZ A;  2QA4 A;  3GTL H;  5GAH C;  5C3E G;  2ZJP A;  2Q2T A;  2YU9 H;  1HNZ L;  2PQA A;  1FL0 A;  2ID0 A;  4DV7 Q;  3TS2 A;  4IPG A;  4LF7 L;  3I4N G;  4J15 A;  3S1N H;  4P71 A;  1ASY A;  2RHS B;  3GD7 A;  4DUZ Q;  3K81 C;  4JI7 L;  3HOX H;  4YCW A;  2F4V Q;  3K80 C;  3U58 A;  4DR6 L;  1S72 A;  4BA2 I;  1OXS C;  3F1Z A;  3AFP A;  2RF4 A;  3G4S A;  4DV4 Q;  1R9T H;  1VQ9 A;  4JI2 L;  5C0X I;  3S16 H;  1CKM A;  3J7A 5;  1VQJ A;  4LFB L;  1Q7Y C;  1PFS A;  3PUZ A;  1K73 C;  4X62 Q;  2WFW A;  3GTJ H;  3E9H A;  1EIF A;  4LF4 L;  2HHH L;  3S15 H;  2PMZ E;  1PH4 A;  1SMX A;  1LTL A;  4HIM A;  4PG3 A;  1ASZ A;  2IT1 A;  2KCM A;  4IFD J;  1HZB A;  2VNU D;  2B29 A;  2ZTC A;  2HIX A;  3JC6 6;  2JQO A;  4JYA L;  1U0L A;  2XTI A;  4BBS G;  1G29 1;  3I7F A;  1OXX K;  3I4M G;  1QZH A;  2GVA A;  1N33 L;  3A5U A;  4A75 A;  1KL9 A;  1L1O C;  4DR7 L;  1E7Z A;  2NZO A;  4AH6 A;  3TRE A;  1PHJ A;  2AKW B;  1M1K C;  1Q1E A;  2R93 H;  3KF6 A;  1X55 A;  1XTD A;  4GN3 B;  3PSI A;  3S24 A;  4ME3 A;  1L1O A;  2VQF L;  1YNX A;  4IFD G;  3K7U C;  1EIY B;  1KAW A;  4GKK L;  4K0K Q;  4BA1 I;  2PI2 E;  3HFZ B;  3TS0 A;  1HNW L;  3PF5 A;  3D0F A;  5H1S E;  1RL2 A;  1Q82 C;  1SLJ A;  2VL6 A;  3J80 i;  4DUY Q;  2I0Q A;  4P75 A;  2VQE Q;  3WWV A;  3CCR A;  4HJ8 A;  1S40 A;  3F2B A;  3HOZ H;  4A3I G;  1XPU A;  4R4Q A;  2K14 A;  2I5M X;  3RN5 A;  1SN8 A;  1BVS A;  2YTY A;  4DV1 L;  2NZH A;  1X6O A;  1TWH H;  1TWC H;  1VQO A;  4BBR H;  3PF4 A;  5M5Y H;  4AQY L;  2AHO B;  4X6A H;  2Z6K A;  3K8A A;  4P74 A;  2K50 A;  4YWK A;  4BY1 H;  4JI0 L;  5IYB H;  5FLM H;  3PO2 G;  4DR2 L;  2CWA A;  1M90 C;  2F3I A;  3NEL A;  1E24 A;  4GNX B;  4DR3 Q;  3W1B A;  1XJV A;  3ICE A;  2K5H A;  5M3F H;  4C2M H;  4JI8 L;  1Q12 A;  3J7Z C;  4DV2 L;  1N36 L;  1YJN A;  2R7D A;  4C3J H;  5JEA J;  4LFA Q;  5FJ8 G;  1JT8 A;  4QY7 A;  2ZM6 Q;  4KHP Q;  5C0X J;  4UP7 A;  1RIP A;  4YHH Q;  4PZ6 A;  4X66 L;  4A3K G;  1YI2 A;  2UXD L;  4JCV E;  3S1Q H;  2H5X A;  4A3M H;  4DV6 L;  5LMN Q;  4JI6 Q;  3PGZ A;  4BXX H;  4X64 L;  5IP7 H;  2VS1 A;  1PH7 A;  1UE5 A;  3DLL A;  1B7Y B;  1VCI A;  4XIG S;  1IYJ B;  3ULL A;  3G6E A;  1N8R C;  1N34 L;  3NEN A;  1I94 Q;  2UUB L;  2JA8 H;  1VQ8 A;  1D8L A;  4MNO A;  1HR0 Q;  5IT9 c;  3Q8D A;  4GLV B;  2ZJR A;  1XPR A;  1P16 A;  1I5F A;  5GRO A;  5FJ8 H;  1PH3 A;  3CME A;  1PH6 A;  2N3S A;  3A74 A;  4WJ3 M;  1A0I A;  3CC2 A;  4YWM A;  4LFC L;  3KDF B;  3UDG A;  4A3L H;  3G71 A;  5IWA L;  1YJW A;  2PNH A;  4JC0 A;  4OX9 Q;  1K83 H;  1CKN B;  2JA5 H;  2UU9 Q;  4IFD I;  2CCZ A;  2AWN A;  1HNX Q;  2JK8 A;  4DNI A;  2Z6K C;  4IPH A;  1CKO A;  3FKI H;  3BZC A;  3PUW A;  4TQU S;  3CPW A;  3S2H H;  2LXK A;  1A62 A;  1TXY A;  4JI5 L;  2QGQ A;  4X65 L;  3I55 A;  5M5W H;  3ULJ A;  4HJ9 A;  4A3K H;  2E2H H;  1VQ4 A;  1XNQ Q;  1EFW A;  5JEA G;  3KOJ A;  1PH9 A;  4PMW A;  1IBM Q;  2GN5 A;  3CAM A;  3M4P A;  4JOI A;  1IBK L;  4B3S L;  3T1Y Q;  2ASB A;  3M4Q A;  4LF8 Q;  3U50 C;  1Y1W H;  2UXB Q;  3CCS A;  3AYH B;  5IP7 G;  3F2D A;  1PH2 A;  1N32 Q;  4LF6 Q;  1H95 A;  1WOC A;  5LMU Q;  1G6P A;  4LF5 L;  2Q2I A;  4JOI C;  2R92 H;  4DR4 Q;  4R4O A;  1OXT A;  1KD1 C;  2JEA I;  2CFM A;  1XMO L;  4YY3 Q;  2UUA Q;  1N9W A;  4RMF A;  4A3C G;  1B8A A;  1V43 A;  3PIP A;  1WI5 A;  1IBL Q;  1VQL A;  3RLO A;  2KCT A;  1BKB A;  2N78 A;  4XTC S;  4OON A;  5GAG C;  3CPF A;  1IXR A;  3H15 A;  2R7Z H;  4DV3 Q;  3G48 A;  2WB1 E;  4A3G G;  5M5X H;  4LF9 Q;  4A4I A;  3S2D H;  4NB3 A;  3RN2 A;  1HZC A;  3T1H L;  5C44 H;  1VQP A;  1TWG H;  1NY4 A;  1HZA A;  1OXV A;  4R4C A;  5C0X G;  1PH1 A;  1I3Q H;  4A3L G;  3MEF A;  4YCV A;  4NXM L;  4QIW E;  2E5L Q;  3IRB A;  3W1G A;  5IYD G;  1Y1W G;  2Q2U A;  3HKZ E;  2A8V A;  2RHQ B;  2VUM H;  2IHE A;  3ZJY C;  3GDE A;  1QZG A;  4DV5 L;  1AH9 A;  4IOC A;  1NJI C;  3HOU H;  1JJC B;  3KJP A;  5GQO A;  2I5H A;  3PUX A;  1HR0 W;  4B3T L;  4OXP A;  3FHW A;  4IJL A;  5AJ3 Q;  4DR5 Q;  1JB7 A;  4GKJ L;  1J5E L;  5IYB G;  5FLM G;  1VQK A;  4L5Q A;  2LSS A;  2R7Z G;  4TVA B;  4JG2 A;  1XMQ Q;  4UP8 A;  1BBU A;  2R7F A;  4NXN L;  5M3F G;  4A3F G;  5C44 G;  4RG1 A;  2WB1 G;  4DR1 L;  2IY5 B;  4A3J G;  4A3E H;  1WCM G;  4A3I H;  4LW1 A;  3NEM A;  4AYB E;  2UXC Q;  2K5N A;  1FJG Q;  1UE1 A;  3TQY A;  4JV5 L;  4Y52 H;  1EQR A;  4IPD A;  5BR8 L;  4B3R Q;  2BA1 A;  3PCO B;  1PVO A;  2DUD A;  3OTO Q;  3UDF A;  4B3M Q;  3ER0 A;  4JBK A;  2WAQ G;  3CXC A;  2ZTE A;  1AE3 A;  3HOU G;  3HOW H;  3RZO H;  4OO1 I;  2K75 A;  4A3M G;  3GTP H;  4JI1 Q;  4A93 H;  3RR5 A;  3D31 A;  3K0X A;  3BJU A;  4YCU A;  2KHJ A;  3J81 i;  4DV0 Q;  4JI4 Q;  5ELO A;  1XNR L;  2YYZ A;  3M4O H;  3TRZ A;  5M3M H;  2EXD A;  3L2P A;  4OO1 G;  1HH2 P;  1OTC A;  1V9P A;  2YV5 A;  3CW2 C;  3NBH B;  2CQO A;  4LUZ A;  2F52 A;  3UDX A;  1D7Q A;  3HKS A;  2UUC Q;  1J6Q A;  2WP8 J;  1YHQ A;  4JBM A;  3GTO H;  3I2Z A;  3HKZ G;  4JI3 Q;  2R6G A;  1VS0 A;  1Y14 B;  4HIO A;  3TEH B;  2ALY B;  5GAE C;  4A3D H;  1VQA A;  1HNZ Q;  4LUV A;  3HOX G;  5FLX c;  4BXX G;  4DV7 L;  3M7N A;  4GS3 A;  3I56 A;  4LF7 Q;  1C0A A;  1QUQ B;  1BBW A;  4POG A;  3H3V H;  1KRT A;  4A3F H;  4DUZ L;  2E2J H;  4JI7 Q;  4DPG A;  4L5R C;  4BBS H;  1I50 H;  1VQD A;  2F4V L;  3KFU A;  4DR6 Q;  1EYG A;  1YIT A;  3KF6 B;  1OXU A;  1S3O A;  1X3G A;  2V1C C;  4FDB A;  3GTM H;  2N49 A;  3S1M H;  2HQL A;  2HIV A;  3PUY A;  4DV4 L;  4JI2 Q;  3RZD H;  1SFO H;  3CCL A;  2VY3 A;  1Z9F A;  1UWV A;  2ES2 A;  4WJ4 A;  3CP0 A;  2B63 G;  4LFB Q;  3I4O A;  1X56 A;  3CCE A;  4X62 L;  4A93 G;  1CSP A;  4LF4 Q;  2HHH Q;  3HOW G;  5GAD C;  4JBJ A;  1O7I A;  3OYY A;  2JA6 G;  1NE3 A;  5C4J H;  2D62 A;  1QUQ A;  4P73 A;  1VQ6 A;  1UE7 A;  3SGI A;  4JYA Q;  3CCU A;  1X3E A;  1YHB A;  3CC7 A;  1N33 Q;  4LWC A;  5C4X G;  4PZ8 A;  1VQG A;  3HOZ G;  4A3C H;  4DR7 Q;  3GTK H;  2GVB A;  1FVI A;  1UEB A;  2N8N A;  4NPS A;  1WYD A;  2ATW A;  2JA7 G;  1E3P A;  1CKN A;  3H3V I;  2VZA A;  4BBR G;  2LXJ A;  4KI0 A;  4GNX C;  3DM3 A;  2NN6 G;  2VW9 A;  2VQF Q;  3PO2 H;  1HZ9 A;  3U4V A;  1L2F A;  1T9H A;  3FP9 A;  4KLK A;  1A8V A;  1L0W A;  4GKK Q;  3J81 j;  3A5Z B;  4K0K L;  1EUJ A;  3S17 H;  2IHF A;  3F8T A;  1HNW Q;  2EQS A;  1EOV A;  4R4I A;  4BY1 G;  1VQB A;  1U5K A;  4IPC A;  2RCN A;  4P72 A;  1WJJ A;  2NN6 I;  4DUY L;  4GN4 B;  5EAY A;  1XPO A;  2VQE L;  1P8L A;  4MZ9 A;  3CCV A;  2K52 A;  3GTQ H;  2K4K A;  5IYD H;  4HID A;  3HOY G;  1JJG A;  5IYC G;  4DV1 Q;  1VQ5 A;  1KRS A;  1SE8 A;  3VDY A;  3RLN A;  4OWW B;  4IOA A;  4QJF A;  4UP9 A;  4AQY Q;  2KEN A;  3FKI G;  3PUV A;  1YBY A;  4JI0 Q;  2JA7 H;  4GOP B;  1G51 A;  4DR2 Q;  2NVX H;  3GO5 A;  3OW2 A;  1Q46 A;  1Q1B A;  2I5L X;  3MXN B;  4IJH A;  1JE5 A;  1YEZ A;  3AFQ A;  2FXQ A;  5HY6 A;  4DR3 L;  1JMC A;  1VQE A;  3BZK A;  1YVC A;  1L1O B;  2OCE A;  1K0R A;  1PYB A;  5C4X H;  2JA8 G;  2BA0 A;  4JI8 Q;  2VUM G;  2C35 B;  2Y0S E;  4DV2 Q;  1N36 Q;  1CSQ A;  2R92 G;  1MJE A;  4LFA L;  2EIF A;  1HJP A;  3CQZ H;  1K3R A;  4R4T A;  2ZM6 L;  4KHP L;  2JA9 A;  4A76 A;  1E22 A;  4QGU A;  4O2D A;  1YHA A;  4AIM A;  4YHH L;  2OQK A;  2ZTD A;  4UPA A;  4X66 Q;  4GLX A;  2UXD Q;  1GVP A;  3H0G H;  4DV6 Q;  2D0P A;  5LMN L;  2E8G A;  2PQA B;  1UE6 A;  4JI6 L;  3CCJ A;  3ULP A;  4GLA C;  4A3G H;  5E7N A;  1EWI A;  3STB C;  1B70 B;  1MKH A;  1NMG A;  4GN5 A;  4X64 Q;  1C9O A;  2OTL A;  2HT1 A;  3KDF A;  1N34 Q;  2MFI A;  1WFQ A;  1Q86 C;  1X54 A;  1EQQ A;  1I94 L;  2CKZ B;  4APV A;  2UUB Q;  5IYC H;  4L5T A;  4GNX A;  3HOY H;  1TWA H;  3PO3 H;  2JJQ A;  1HR0 L;  2OQ0 A;  2MQH A;  2BH2 A;  4DKA C;  4HJ5 A;  2AWO A;  2B63 H;  2KHI A;  1YZ6 A;  4A3D G;  1SR3 A;  4PZ7 A;  4EX5 A;  5ELN A;  3A0J A;  2MO1 A;  4OWT B;  3K7A H;  3AEV A;  4LFC Q;  1QVG A;  1QVC A;  3AQQ A;  4HJA A;  1VQC A;  5M3M G;  5IWA Q;  1Y1V G;  4Y7N H;  2BH8 A;  4OX9 L;  2IX0 A;  1IZ6 A;  2QEX A;  2UU9 L;  2XGT A;  3J81 c;  4KHZ A;  5IP9 G;  1HNX L;  1FGU A;  3EBE A;  4A3J H;  1VQM A;  1SRO A;  1WCM H;  4OWX B;  4LUO A;  4X65 Q;  1PV4 A;  4JI5 Q;  2Y0S G;  4IO9 A;  3M3Y H;  4BY7 H;  1XNQ L;  1JJ2 A;  4C3I H;  1C7Y A;  1IBM L;  3HOV G;  3RNU A;  2WAQ E;  1IBK Q;  4B3S Q;  3T1Y L;  4POF A;  1VQ7 A;  1CUK A;  1QVF A;  1E1T A;  3CC4 A;  4LF8 L;  1GO3 E;  1VQF A;  1N32 L;  3J80 c;  2CWP A;  2UXB L;  1VQH A;  4LF6 L;  5LMU L;  4LF5 Q;  4DR4 L;  2Z0S A;  1W3S A;  2L15 A;  1NTG A;  3UE0 A;  4QL5 A;  1NMF A;  3PIO A;  1XMO Q;  4YY3 L;  5DLQ E;  3L7Z C;  2UUA L;  3CCQ A;  1YIJ A;  2D0O A;  2PI2 A;  4DAY B;  1IBL L;  3CD6 A;  4GOP C;  1AE2 A;  1X3F A;  3F2C A;  2R93 G;  4A3B G;  4DV3 L;  1GD7 A;  3JAM i;  4DK3 C;  3STB D;  4LF9 L;  2JA6 H;  1VQI A;  2A19 A;  3KLW A;  5HGQ A;  3T1H Q;  3BU2 A;  4BY7 G;  3EIV A;  5IY0 A;  1Y1V H;  1X9N A;  1KIX A;  3LGJ A;  3EN2 A;  1PYS B;  1K9M C;  2OWO A;  2NVQ H;  3GTG H;  2OTJ A;  2JEB I;  2B3G A;  3ERS X;  2E5L L;  4NXM Q;  2A1A A;  2IX1 A;  1W2B A;  4QQB X;  4YWL A;  5IP9 H;  1K8G A;  1A63 A;  1KXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...