3DWPA

Crystal structure of the b-subunit of the ab5 toxin from e. coli with neu5gc
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilase cytotoxin, subunit B
publication title Incorporation of a non-human glycan mediates human susceptibility to a bacterial toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dwpA00
1TS2A 3BVMA 3URYA 1V1PB 1LTBD 1BCPD 1FNVA 2XRSD 3O13A 1BXTA 1CT1D 1JCKB 1S5ED 2RDGA 5ELFA 4DXFA 1CQVA 1EWCA 1QILA 2AQ1B 1TS4A 3MFGA 1I4GA 1I4QA 1TS3A 1STEA 3BVZA 5ELDA 1EU4A 1JWSD 1PZID 3R2TA 2WV6D 1ET6A 3EA6A 1LTTD 1D5MC 1LTRD 5ELEA 2XRQD 3BZDB 1CK1A 2TSSA 1G8ZD 3EFXD 4L6TB 4L63B 1DJRD 1PRTC 2IJ0A 1SE3A 1UNSA 4TSSA 4RGMA 3BYTB 5D3IB 1M4VA 1S5FD 1D5ZC 4DXGA 2SEBD 1LT5D 1PRTB 2ICIA 4K6LA 2NTSA 5D3DA 1LO5D 1PZKD 4O1NA 1EEFD 1PTOC 1SE4A 1BCPF 3R8BA 2CHBD 5FK9C 1HA5A 1KLGD 1SJHD 2G9HD 1ET9A 1PTOB 3W2DA 3KLSX 1F77A 1PZJD 5ELBA 1LTID 3DWQA 5I4DA 4RCOA 1XXGA 1PTOH 3GP7A 3TSSA 1V1PA 1V1OA 1L0YB 1HTLD 2XN9C 1D5XC 1RD9D 4RHSA 1TS5A 1EFID 4RGOS 1MD2D 1JWMD 3BVGA 4UDUC 1PYWD 1KLUD 1JWUD 1SXTA 1CHQD 2AQ3B 2NTTA 1AN8A 4RFBA 1KTKA 5TSSA 1LTAD 3SEBA 1D6EC 1B1ZA 1S5DD 3DWAA 4C56C 1B44D 4OHJA 4RGTA 2R61A 1PRTD 3OWEB 4BWGB 1FNWA 1LT6D 4Z9CB 1LT4D 1SE2A 4RHRA 1GOZA 1JQYD 1S5BD 2XNAC 5FKAC 1I4HA 4RGNA 1PTOD 1FD7D 1LTGD 1TY2A 3CHBD 1I4XA 1I4PA 4ZYSA 1AW7A 1SJED 5ELCA 1I4RA 1T5XD 1BCPB 1UUPA 2IPKD 1ENFA 1S5CD 1XTCD 2QEJC 3R2IA 1CHPD 2Z8LA 1FNUA 1JR0D 3MC0B 1HQRD 1SEBD 1DYQA 2O2LD 1FGBD 1LLRD 1RDPD 2J4XA 1PRTF 1TY0A 3V05A 3DWPA 1SBBB 1LT3D 1L0XB 1EU3A 1RF2D 1HXYD 1RCVD 1PTOF 1ESFA 2QILA 1BCPC 3BYYB 4RH6A 1EEID 2AQ2B 1LTSD 2RDHA
chains in the Genus database with same CATH superfamily
1I94L 3D4WA 3MTSA 3E0JA 4R4QA 2NVXH 2CH4W 4DNRB 3CQZB 3UDFA 4B3SL 5FO8B 4FYDA 4DR5L 4A3KH 1KRTA 3STBD 4HJ7A 4K2LA 2R7DA 3X3MA 3H09A 2D0PA 1PH6A 4Q5VA 2N8NA 2LFNA 3HKZB 1JORA 3NSWA 4BY7B 5D3IB 4B3MQ 2R92B 1W3SA 2DJGC 2SEBD 4TKOB 4EVOA 4DNTB 2UXBQ 1L1OB 3TP5A 1VQLA 1VQGA 4I7AA 2G9HD 3WOFA 4BBRB 2ZTEA 3E0EA 5LMUQ 3RN2A 1B2TA 2A19A 3OIQA 1QUQB 2F0FA 1EY6A 3UE0A 1CA5A 4HJAA 2XN9C 3QG1A 4KKSA 4DV4Q 3SHLA 1VQ4A 3IAYA 1PYBA 4DR6L 4RGOS 3KLSA 5E4XA 2F03A 1KLUD 4IOAA 4KKUA 4K2KA 2C5CA 1SFOH 4AQYL 1VQPA 2JP1A 2EYPA 1TWAH 1B53A 1MHWC 2KEDA 2NN6G 2P5ZX 1QCBD 1SE2A 2H1EA 4A3FB 1I6HB 2RVLA 3NELA 1VQFA 1L2FA 4XYOA 1PA6A 1OTCA 1HZBA 4KLKA 5M3FB 1VQKA 1SDFA 4OIKA 3I73A 4X65Q 2R93H 3FEWX 4X62Q 3MXNA 4EQ5A 2QEJC 2VY3A 4QL5A 3J80E 2EJGC 4S3SA 3T16A 5IYBG 5C0XH 4CKCA 1VQHA 3LGJA 3HOYB 1VF7A 1Y8PB 4A3JB 2KQ3A 1A15A 1XWEA 1LT3D 1VQNA 3KDFA 1VS0A 1RCVD 1HR0W 2M00A 2QDLA 2YU9H 1SMYD 1EEID 1X56A 4LF7Q 3Q6SA 1PFMA 2JA6B 2KCNA 5FLMH 4K0KQ 1XMQL 1VQCA 3O13A 1RL2A 2HCCA 4OX9Q 1N36L 4AYBB 5IGEA 4EQPA 2QEXA 3PO3H 3I4NB 1UE7A 1JJCB 5IP7G 3SK5A 1Y1WH 3QWNA 1C4QA 2PI2E 2WINB 5IP9G 3U58A 1TWCH 2CWPA 3J81E 4IQZA 2JA5B 2DGYA 4JBKA 2RKSA 3HOUH 4GLXA 1KXLA 1E2ZA 2NVYB 3D8GA 1EZ6A 5A35A 5IOCA 1G6PA 1L1OC 3D4RA 3EVQA 2DNEA 3CF5A 4ZUJA 3HOZB 4A3KG 2IT1A 2ASBA 1HA5A 4A3MG 4J8QA 4LF8L 5HGTA 4MN3A 2A69D 4FO2A 1VCIA 4JC0A 4WJ3M 2OCEA 3OYYA 5C3EB 3SK8A 5JEAH 1FL0A 3GP7A 2A6HD 1T9HA 2EY2A 1HFGA 1I3QB 1OXVA 3M4PA 4JYAQ 1KRSA 3E9IA 4PZ6A 4DR4L 4JBJA 1OXSC 4BY7H 4FXDA 4RGTA 1NY4A 1TKWB 1WTVA 2WAQG 3I3CA 4DK0A 4CDDC 4DV2Q 1PH1A 3N6RA 1IHZA 1EY8A 5EGTA 1DONA 5CYUA 2UXDL 3KLRA 3PGZA 1TWGH 4HCSA 5HY6A 4F8MA 2VB2X 2VB3X 5LL6S 3HOWB 2Z4HA 4KY7A 4NXMQ 3CMEA 3BS1A 2IPKD 2C35B 1VF5C 3RZDH 4X3TA 4EQNA 4DA2A 2ZJQA 2L4NA 4ODGA 1LM0A 1WFQA 5AFWA 1SYCA 1U9RA 5JAVA 3CRLC 2HQEA 3Q22A 2BA0A 5LHY1 2R93G 4FNFA 3D31A 3FPPA 2TMPA 2F0WA 1K9MC 1ASYA 1ESFA 2F4VL 2YYZA 3T1HQ 3C1EA 3NEMA 3A5UA 1PVOA 3TS2A 4DV0Q 4NW2A 1P8LA 2F3IA 3TBIB 2PYKA 4A75A 2RDFA 4APVA 4WJ4A 5ELNA 1V1PB 1VQBA 4BA2I 2SDFA 4DV1Q 4HTHA 2E2DC 4JG2A 4FF1A 2RCNA 2PCFB 1SNDA 4Y7NH 2WB1B 1TS4A 1QVCA 2H5XA 4A3JH 4DV6Q 2XGTA 1AEXA 3EA6A 3PIP3 3OSOA 1F9SA 1VQ6A 4L63B 1HH2P 1DXMA 3T13A 2HD3A 4DUYL 3M9BA 4F87A 1PH7A 4B3RQ 2B39A 2ZTDA 3ER0A 2UUCQ 2GA4B 4PV1C 5ELBA 3WDNA 2AWNA 4KV6A 3I4NH 4CKEA 4JI4Q 1G6ZA 2KJXA 1STNA 2OQ0A 5KGUA 3RNUA 4OO1I 1PXUA 1SSOA 2JA5H 1QG7A 2JA8H 3S14B 5FO9B 1GKHA 1RODA 5DM73 1D6EC 1JOOA 3NE5B 1TT2A 4IUQA 4K14A 2NVYH 3TQYA 1XX8A 5C4HA 3R93A 5IGCA 1XPOA 4BXXH 3CMAA 3X3NA 1K8GA 3HOZH 1GOZA 1IBML 4V0BA 2XWBB 2K6AA 3GDEA 4C3HH 2F0LA 2I5MX 3ZYYX 2A68C 4H44C 3HKZG 4CKBA 4R1JA 3VYTA 1E3PA 3E5SA 4HJ5A 2R92G 3KF6B 1N9WA 3SE0A 4POGA 3DEPA 4QY7A 5CV7A 2K14A 5G3LD 4A3IB 4F7XA 4LNQA 4UAIA 3F2BA 3GO5A 4FDBA 3E6ZX 4BBRG 1BBXC 2K7VA 4G4KA 4ID6A 1VQMA 2VUMG 4OL7A 2JA8B 4KY5A 4JI5L 1LYLA 1DOKA 1SMXA 3VR3A 1XNRL 4IJLA 2ZTCA 1RF2D 1S3OA 1SNQA 1HA6A 2EYOA 4LFCQ 3W3AA 5KEEA 4BY1G 4CDCC 1RHPA 1WTQA 5GADC 4ZQ3A 4YWKA 2DY8A 3KLWA 1S5ED 3Q0AA 1BBWA 4HCEA 4A3FG 1N32L 3T1YL 2A73B 2PO4A 4JI0L 1H9KA 1LACA 1JB7A 2FMMA 1K28A 1BQQT 2Z6KC 5M3FG 1ET6A 5CBEE 3C3LA 1K3RA 3EFXD 4JOIA 4CJ0B 1XNQQ 1JE5A 1TWHB 1F2LA 4JBWA 1FJGL 2OT2A 1CI3M 3FHWA 4DKAC 2ZJPA 2OF1A 1CZWA 2G9DA 3HOYG 1YNJD 2B8GA 1SE4A 5GROA 1CKMA 3HZXA 4IUNA 4BA1I 1U5KA 4G57A 1U4LA 3E3XA 1EL0A 5I4DA 4JI1L 2R7FA 4R8IA 2AMCB 1VQOA 2L5TA 1B3AA 2RF4A 4V190 3ERSX 4RHSA 1VQ7A 5M5YB 3SGIA 2E2IH 2JA6G 1E7ZA 1JWUD 1CHQD 2Z9HA 4RFBA 3GTOB 2B2VA 1NUCA 3DEOA 3M4OB 1S5DD 3SK6A 1EUJA 1DZ1A 4JW0A 3TN2A 4RKBA 2JA7B 4AYBG 2NVQB 5KNCA 3I4NG 3MWYW 1J5EL 5M3MB 4RCNA 1S5BD 2X69A 1YZ6A 1TQOA 4LF5L 4JI2L 5A2QE 2WACA 5KNBA 1IW7C 5ELCA 1I4RA 4BXXG 4JI7L 3AU7A 2F1MA 2F0KA 3HOZG 1FNUA 4QCLA 4DPGA 2HDLA 5AJ3L 1RDPD 2NB0A 5CBAE 1H9SA 5C3EG 3KK7A 3FKIB 2BE5D 4HR7B 3RLNA 1ESRA 2AQ2B 3ND8A 2GVAA 1PH9A 4DR7Q 1TS2A 1GUNA 2OEOA 3C46A 1KNAA 3HOVH 4JOIC 1LTBD 4MIUA 1FNVA 4IPGA 3NP8A 3OOCA 1A2UA 4A3IH 4DXFA 2MFIA 2IW3A 3MHBA 4B3ML 5C3WA 3GTQB 2KCTA 2UXBL 2J7ZA 1EQTA 5C44B 3JAME 5BR8Q 1YJWA 2F3WA 2F3VA 1LTTD 3AYHB 3I8ZA 4IN3A 3H6MA 4LK1C 5ELEA 4L6TB 4N9TA 4KI0A 3HOWG 5CV5A 4CDEC 5LMUL 1SE3A 1UNSA 2FXQA 3I55A 3V2TA 1C0AA 4LF6Q 3CCVA 1AP0A 2F0NA 1G2TA 4DV4L 3RZOH 4Y52H 4O1NA 4PG3A 1HR0Q 2BA1A 5FK9C 1KLGD 2B2VC 1SJHD 1IL2A 2RSNA 3J7ZC 3DUZA 2AKWB 2XSCA 4B9XA 4DR1Q 2CQOA 3ERQA 1RTNA 1JOKA 2RBMA 1X54A 1XPUA 1HTLD 2K5VA 2NWGA 1SROA 1SFOB 3H3VC 3B6YA 3L0OA 3PUVA 2E8GA 2AQ3B 1TWAB 2F4IA 1TWHH 3T4AC 5FOBB 2L11A 1B1ZA 3DWAA 1EOVA 2EXZA 1F9QA 3QJYA 3OWEB 4X65L 4BWGB 2K04A 4Z9CB 2EDGA 2WB1G 2MGSA 4A3EB 1EFWA 4X62L 1G51A 1O7YA 1C9OA 2PMZE 3AFQA 4QB4A 2VQFQ 3I70A 5IWAQ 1JB3A 2K05A 1STBA 4OWTB 3S1RH 3AMUA 2JN4A 5J39A 4NMZA 2RHQB 4A4IA 1P16A 1K8MA 2F0MA 3VA5A 3OW2A 1VMPA 1TIID 3D3RA 3D0FA 1Q1BA 2B29A 3MXPA 4GN4B 2KCMA 1CHPD 5EKIA 4HEDA 1HQRD 4C1NI 3TMEA 3S15B 4LFAQ 3M4OH 1X65A 5C4ZA 4LF7L 4FF2A 2F0SA 4ZKBB 1B9MA 2NVQH 1VQJA 3FDTA 4QIWE 1YI2A 4K0KL 2MNAA 2K32A 3UI2A 4OO1H 1R9TB 3U4ZA 4OX9L 4K8IA 2YU9B 4M1UB 4R9WA 4NPSA 1I6VC 1Z9FA 3K58A 1D1IA 3KF8A 1NSNS 1XJVA 2HHHQ 4HSPA 2EJFC 5KRUA 2RDHA 1B7YB 4YY3Q 3A8IE 5E1FA 2UXCQ 3TZDA 1YIJA 1MIUA 3UE1A 3L2PA 1CQVA 2IHEA 3H0GG 5EAYA 1M8AA 2KVMA 1TWCB 5ELDA 1HZCA 1D8LA 5JOBA 5J22A 1KAAA 3TP8A 3Q24A 3HOUB 1QNKA 1X3EA 3FKIH 1IBLQ 1UWVA 5I6WA 2JQOA 3VYUA 1SYEA 4A3IG 1D2BA 4O42A 1N34Q 4J6HA 4JYAL 2E74C 4FF4A 3KLSX 1LTID 3J7AV 2PQEA 5D14A 4DAVA 3GTQH 5DLQE 1J8IA 1U4RA 3CP0A 4ZCKA 5K36G 4WRDA 4DV2L 2GVBA 5C44H 1CKNB 3EIVA 3AEVA 5IGGA 4UPAA 2LMCB 1JT8A 4GS3A 1SE8A 4IFDH 4B08A 1LTAD 4B3TQ 3K7AH 2N78A 5FJ8H 2HDMA 2V4DA 1E2VA 4NXML 5DEHA 3T51B 2PW5A 2VW9A 1Y1VG 4CHTB 2E2HB 5FKAC 2MQHA 2E5LQ 1TWGB 1SLJA 1CUKA 1A62A 1NAPA 5KIXA 4XT3B 1L1OA 4WJWA 4RWSC 2CW0C 3RZDB 4R4OA 1Z6HA 2PPBC 2VL6A 4DR2L 4R8NA 1YHAA 3HOXB 1QUQA 1SEBD 3C1FA 1V43A 3FPUB 4M8AA 4DV0L 1K8OA 1DOMA 4KD4A 4LF9Q 2KBNA 4A3EH 3K5LA 4DV1L 4HAEA 1ICWA 2EYLA 1SMYC 4IALA 1HTPA 3K81C 1HNXQ 1O7ZA 4G7HC 3HS0C 5LL6X 2UUBQ 1KDBA 3MFYA 4A3CH 2QKIC 3CCMA 1LTSD 3AB9A 4DV6L 1KHIA 2JEAI 4X6AH 4G7OC 4LF4Q 4P72A 1ENAA 2Z4IA 2JA7G 1WD0A 4Y7NB 2CW0D 2R7ZH 1EWIA 3UDIA 1EWCA 5M3MG 5EKKA 1SYGA 2PW7A 2WKCA 3S15H 3KJPA 2UU9Q 4L5SA 4B3RL 1STEA 2FHTA 2ZM6Q 4XIGS 3HFZB 3OWFA 2CH4A 2YV5A 4NKLA 1T5EA 1R9TH 1CK1A 2E2JH 3D4DA 1HFNA 4DV3Q 2UUCL 3VA7A 4G7ZC 2EIFA 1PMRA 4JI4L 3NHHA 3MEHA 2B8FA 1PHJA 4KJNA 5KYLA 2R6GA 4K6DA 2A69C 3S1NB 3VR5A 4A3LH 2QF7A 2A6HC 3QOLA 3FVQA 1ET9A 3LWUA 5CV9A 2KA7A 4ZLTF 4MHEA 2O4XA 2Q8IB 5C4XG 4ZAIA 1QZGA 2F0OA 1X9NA 4JI6Q 2AUKA 2SNSA 4OXPA 1TS5A 1MD2D 2ZXPA 4OELB 5TSSA 1WCMB 3S17B 3BG3A 2F0IA 1LT6D 1PH5A 4C3HB 3CD6A 1K0SA 4C2MH 1WTPA 4X66Q 1ZEQX 2XTIA 5C44G 3PO2H 3M4QA 1FD7D 1TY2A 1HQMC 3L7ZC 1X3QA 4YCWA 5M9OA 1Y69U 4IFDG 1U4PA 1A63A 3D6WA 1Q7YC 4A3BH 3K80C 5BN5A 4OWWB 1X3PA 5C5LA 2FINB 3I4OA 4KD3A 4A3GH 1PDQA 1DYQA 1DGSA 2BH2A 4LFCL 4LFBQ 4HIMA 4NB3A 1KD1C 3NXWA 3V05A 4IURA 3KJOA 1Q81C 2B2YA 1EYDA 3UDGA 4OWXB 2F0UA 3AQQA 3GTLB 2E2HH 4DAYA 1IZ6A 1SNCA 2AWOA 4EX5A 4C1NK 3CXCA 1WTWA 3RN5A 3Q8DA 3PUZA 1XNQL 3VYSA 5ELFA 5LMNW 3CCRA 1QILA 3HOXH 3LX0A 4H13C 3K0YA 5K5PA 3J7AF 2WV6D 4GN5A 3S2HB 1D5MC 5DNFA 1G8ZD 2Q2HA 3K8AA 3TREA 4GKKQ 2F0VA 5JJZA 5C5MA 1M4VA 3QR8A 1GUOA 1LT5D 2Z6BA 1IYUA 5C0XG 4YCVA 3NWSA 1E0BA 1YBYA 4Q0FA 2N49A 5HGQA 3F1ZA 4PNYA 5C3XA 5G3LF 2EYMA 2JA9A 1BNZA 4DNIA 2EVBA 3DWQA 4YCUA 4RCOA 3I7FA 5IYDH 3U50C 1TXYA 4DU9A 1VQIA 1V1PA 1PLFA 2ZXOA 3GTGH 1ENCA 3CC7A 2E2IB 1L0YB 5FLMG 1KDCA 4DUZL 1JWMD 4KKTA 2R3ZA 4KTAA 5FLXL 5FO7B 4CGYB 1TR5A 3HP3A 4LAAA 3SEBA 4R4TA 1BVSA 3TEHB 1SRUA 3PO3G 5CC4A 1HUNA 4A3DB 1NTGA 1Y1WG 4FP5D 4L5TA 2Z6KA 1JC7A 1WJJA 2PNHA 2A6ED 3M3YB 3S1NH 3NTHA 3VYRA 2D0OA 5E7NA 1H9MA 3HOUG 1RIPA 3K5OA 1EIHA 2NN6I 4ZYSA 2NYZD 3JAMc 2B2YC 4GNXB 5DAUA 5EQ0A 3RR5A 2B3GA 1S5CD 4NXNQ 1XTCD 1CQFA 4ZRZA 4KN4C 1QVGA 1PH8A 4K5XA 4MZ9A 1WCMH 3IRBA 3S17H 5IGBA 5JEAG 2I07B 3H3VI 4DR7L 3T56B 3DWPA 1LUZA 2IX3A 4A93H 3EN2A 3RMHA 1J9OA 1L0XB 3ZJYC 4RA8A 1MJEA 3A56A 4XDXA 4GKJQ 3HOVB 2BDNA 4BY7G 2CVRA 1PYSB 5BR8L 1Q82C 3PIOA 1CSQA 1MI2A 3QIAA 5C4JB 3R3OA 4DR3Q 1FVIA 5ISRA 4DV7Q 3MXUA 3GTJB 1I4GA 2N88A 4LF6L 4NDXA 3CC4A 2F52A 3KF6A 4MTNA 4DN4M 2EZVA 3CRKC 1B70B 1HR0L 1HZAA 1EY7A 2TSSA 1O80A 3WOEA 1YNXA 1DJRD 2IJ0A 3GTLH 1F9PA 5EPKA 1YNJC 2K5HA 4DR1L 3K57A 3ULPA 3W1GA 1PRTB 2Q2TA 1BOSA 1IXRA 3I91A 3RZOB 1WVLA 1IYJB 1V1QA 5NUCA 2K5DA 3OMCA 3ULLA 3VDYA 3KUPA 1U4MA 3J80i 1QNUA 4IUPA 2LSSA 3TP7A 4GLVB 1YHQA 1TWFB 4X3SA 3RLOA 2RCFA 2VQFL 4H7BA 2K1BA 5IWAL 1MSGA 1EIGA 2K50A 1TU2B 2CWAA 3S2HH 1X3GA 1R4QB 3GD7A 1B9NA 3NBHB 3GV6A 2PMZB 1YJNA 4IFDJ 3S1RB 2F0GA 1LT4D 2I46A 4A3JG 2LS01 5IT9L 1G2SA 4HSVA 2B2WC 4KMUC 5JJLA 1E22A 4H02A 3UDXA 2E76C 4LFAL 1QWYA 3I90A 1SJED 4FF3A 3J81i 1UUPA 2BCOA 1II3A 3P20A 3QB3A 1A2TA 5JVH3 3HKSA 4AH6A 1BF4A 3CPWA 1Q90A 3H94A 4QIWB 1EQQA 1SAPA 3J7A5 1FGBD 1GXDC 1NCVA 2B2TA 3MZ5A 1V9PA 4UP7A 2HHHL 1PRTF 4A3DH 2BE5C 4XQJA 4YY3L 1SBBB 1V8QA 5KNDA 4ABNA 2UXCL 3M3YH 3PIPA 1B8AA 3NUCA 2JA5G 2EYFA 2EY1A 2QDBA 2I0QA 2BH8A 2QILA 1LABA 4N8FA 5CV4A 4UP8A 4JK1C 5IYCH 5DM63 2VQEQ 2M2LA 3E9HA 1HCZA 4OGQC 2YTXA 1CSPA 2MO1A 1QE6A 2K75A 1C48A 1IBLL 4C3HG 4LWCA 1UEBA 5C0XJ 1N34L 1PFSA 4QQBX 1OXTA 1WTRA 3GTPH 3HRZC 3EBEA 1LTRD 2A5HA 3BZDB 5IIFA 1M90C 4YWMA 1NBWA 1PRTC 1ZXTA 2HIVA 4TSSA 1Y14B 4QGUA 4KN7C 1KAWA 3BDLA 1LO5D 1QOHA 3MA2B 4HIKA 4HJ9A 5GAGC 1BO0A 4DV5Q 3IFDA 4GOPB 1BBUA 3NK9A 1WTHA 3PQIA 3W2DA 3NWTA 5JPMC 5C4JH 1JJGA 4B3TL 1EY9A 3GTJH 5J3BA 4O0AA 2CCZA 4KHZA 4MTKA 2XWJB 1V1OA 3SK4A 4DGZA 4JBMA 1BR9A 1GUGA 2Y0SB 2EPBA 2JXMB 2NZHA 2YTYA 4UDUC 3PUYA 3K7AB 2E5LL 3NTIA 4XT1B 1KTKA 3PSIA 2YTVA 3BDOA 4C56C 1W2BA 1VMCA 1PRTD 3VR2A 5EKLA 2CKZB 5EBCA 2HUGA 2LY7A 1NNXA 1MKHA 4JI8Q 4DAMA 4L5RC 3A7LA 3GTKB 2I5LX 2NUCA 1Q3LA 2B2TC 3PMFA 3BJUA 5JEAJ 3CAMA 1TWFH 3NQIA 4GLAC 4CBVA 4LF9L 5BN3A 1BCPB 3QOJA 1ENFA 3IL8A 4RMFA 1STHA 1HNXL 5EPJA 3EJIA 2OXPA 1XNRQ 1GUSA 4LF4L 2MPMA 4IZ8A 5JJIA 1CFMA 4JV5Q 1GHJA 3PV0A 1C8CA 2ZT9C 3SXHA 2KHIA 2OTJA 1KABA 2B2UC 4IUUA 1CZGA 2SNMA 5COYA 2MHVA 2UU9L 1LV9A 2ZM6L 2JK8A 4KHPQ 2R7ZB 1A6XA 2HCIA 2RDGA 4DV3L 1Q8IA 1AFPA 1G291 3MFGA 4RG1A 3QO2A 3BVZA 1OXXK 1JWSD 2E2JB 1EWHA 4IUTA 2IX1A 3AFPA 1B3QA 4WORA 2ICEC 4OEMB 4RKLA 1VQ8A 1S5FD 4HMIA 1I50B 4JI1Q 2JJQA 1BKBA 4K6LA 4C3IB 3H3VH 4JI6L 1PZKD 4ZKCB 4XXEA 3R8BA 1BCPF 3TRZA 2CHBD 1EQRA 2UUAQ 3MEFA 5IYBH 3S16H 1BUVT 1PZJD 3TP6A 1PTOH 4TQUS 3A8JE 1N8RC 2PQAB 1YHBA 4F88A 3N52A 4XTCS 3F2UA 5LMNQ 4X66L 1MBYA 3HOVG 4E6IA 3D6CA 2PI2A 5E3FA 3G6EA 3BU2A 1YJ9A 2PZUA 4OHJA 3CU7A 4C2MB 2WP8J 4DFAA 2LXJA 3NQTA 3L9AX 4RHRA 1WTXA 3PO2B 5JPNC 1YEZA 1GHKA 2XNAC 2JA8G 1NJIC 4UP9A 4U673 5KYIA 4RGNA 2F0QA 3CHBD 3M7NA 3HGBA 1I4XA 2B63B 4XQNA 2FFKB 4LFBL 4A3BB 4J15A 2NZ1D 1HZ9A 1SNPA 4LUOA 1T5XD 5T1GA 2OTLA 3K59A 4C3JB 1J6QA 4A3GB 1W6JA 2Y0SE 1JR0D 4PMCA 1PFBA 1CKNA 2Q2IA 1GUTA 1KDAA 2CFMA 3RD4A 2NVTB 2EJMA 1N33Q 4A3MH 2EQSA 1JMCA 1K3BC 1EOTA 4P71A 3GTKH 2FJ2A 4ULLA 1JJ2A 3OTOQ 2F0JA 5I2XA 1YNNC 4A76A 1BCPD 1ICFB 2XRSD 3BDCA 1H95A 1FYCA 3CCEA 1STYA 4GKKL 2EE1A 4PZ7A 3T1HL 2L9HA 1E2WA 2K52A 3CCSA 3ICEA 2VUMB 1IBKQ 4QMGA 1AZPA 2JYOA 2WAQE 1PV4A 3DHQA 1Q12A 4ME3A 1HNWQ 1XYIA 2RA4A 1U0LA 3A54A 3HEJA 4XQQA 5CGKA 4DXGA 3J80L 4BY1B 4BBSB 1L0WA 4LMQD 4FXGC 5D3DA 2NTSA 5FLXc 2ENBA 4QUCA 2HIXA 4GZYC 2LXKA 1OO9B 4OO1G 2L1BA 3MXNB 3S1QH 3K6OA 3SR1A 4L8JA 1YNND 4X64Q 1XMOQ 4YHHQ 4N9PA 1W6KA 4HN7A 3GTGB 3I72A 3NTKA 5J1ZA 1GD7A 3S2DB 3U4VA 2JEBI 1UAPA 4EQOA 1EY4A 2J0TD 2MO0A 3DMUA 3PF5A 1GM5A 1SYDA 5I2YA 4JI3Q 1AN8A 1E24A 1ZKOA 2JE6I 3KDFB 3I4LA 5M5WH 1I50H 3KBXA 2KUMA 3NPPA 4C3IH 3H15A 1JQYD 4NXNL 1JE4A 2K5QA 3MAQA 3J81L 3FKIG 1LTGD 1H9RA 1IL8A 2H4OA 2IHFA 3OIPA 3JAMi 1EY0A 3PUWA 3BZKA 5F2DA 2WIIB 3HG9A 3I4MB 4LUZA 1QJOA 1EYCA 2RQXA 2A8VA 4GKJL 3S9WA 1LLRD 1HPCA 3GTMH 4A93B 4HIDA 1ILQA 4IJHA 1K8AC 5D65A 2Q8RE 3A5ZB 3U9OA 2Z0SA 3S1MH 4KY6A 4DR3L 4POFA 1RJTA 4DV7L 2Y0SG 1ASZA 1WYDA 1HNZQ 4UY8C 5IGDA 4X3KA 2B63H 5FJ8G 4ZK9B 5IE8A 3BVMA 3BZCA 4DK3C 3PIO3 1OXUA 4C3JH 2C9OA 3IKJA 4ME5A 1TS3A 3CQZH 3MVVA 2CQAA 3A8KE 1FR3A 3R2TA 1I94Q 3U9SA 5IY0A 2NVTH 5JVG3 2XRQD 1S72A 2D62A 1VQAA 1X55A 3PF4A 3BYTB 1PH3A 1D5ZC 4B3SQ 3HKZE 2QW7A 4DAYB 5HURA 1F9RA 4DR5Q 1NMGA 1RKNA 3CCLA 5I6YA 2R92H 4A3EG 1Q1EA 3KYHC 1PH2A 2I5HA 3RUZA 2DJFC 4JPBW 4BBRH 5L37A 5IT9c 1C7YA 4A3CG 1O7IA 2VUMH 2F0DA 3F2DA 1Y8OB 3A55A 4K5VA 1BDOA 5IODA 1H9JA 2R7ZG 1A3VA 2A6EC 1AH9A 3ND9A 4RAUC 3G71A 3C2PA 4BY1H 4BBSH 2L55A 2OQKA 2L12A 1E1OA 4DR6Q 2KHJA 4A3FH 1I6HH 3K0XA 4AQYQ 4DR2Q 3GQBA 3CCUA 1GO3E 1NR4A 1IYVA 5M3FH 3S2DH 5I9PA 4IPHA 2IL8A 4C3IG 4A3LG 3EROA 3A74A 1SYFA 3FRPB 1STGA 3MC0B 5CMDA 2O2LD 2KOLA 1O78A 3TDQA 2VQEL 4DK1A 4KHVA 1WD1A 3HOYH 3G6JB 1KQSA 4FVMA 1S4ZA 2K5NA 2D5DA 3F8TA 4I65A 1QZHA 1PH4A 1D1KA 2KEEA 2MP1A 4QUFA 1G91A 5FLXE 4N8X1 3URYA 1WOCA 5M5XB 2JA6H 3DXJC 1JCKB 2B2WA 1KNEA 3EQLC 5IGFA 3I4MH 4X3UA 2EYJA 3PO2G 5CV6A 3GTPB 2OWOA 1XTDA 4AYBE 4GNXA 1HHVA 2F0HA 4K8JA 2GN5A 3CPFA 1PZID 4DK6C 2B63G 2KHSA 4P73A 4DAPA 3S24A 4A3BG 4DV5L 1XMQQ 1EY5A 4ZUIA 2AUJD 1N36Q 1AE3A 2QGQA 2Q8TA 4RGMA 4U68A 4C3JG 3CCQA 4A3GG 1MGSA 3OPOA 2Q2UA 1Q46A 3P7JA 3H0GB 2BOSA 1A8VA 2V1CC 1A0IA 1F77A 1Q86C 2DN8A 3DM1A 3KOJA 1KIXA 5C6AA 3TSSA 3J81j 5C3EH 4TVAB 1SYBA 4JI8L 3A0JA 5BN4A 1I3QH 3BVGA 1PYWD 4UHVA 4LF8Q 1FGUA 1Z7TA 4L5QA 1SNMA 3HOXG 3J7YW 1FNWA 3VR6A 1MSHA 1DCZA 1WTOA 1HUMA 1GUWA 1X3FA 2A1AA 2DUDA 4DR4Q 1MJCA 2EYHA 2N3SA 1A3UA 1AW7A 3F2CA 1EQVA 4HJ8A 4B9WA 4BBSG 4JV5L 2A68D 4JVZA 1UEAB 4GN3B 3HOWH 2NBFA 2L15A 3ITPA 4LJZC 1VQ5A 1SN8A 2PZWA 4R4IA 3RLFA 2DNCA 3H91A 3NENA 1CA6A 4IFDI 2UXDQ 3FP9A 4HMJA 5IYDG 2J4XA 1TY0A 4J1MA 1Y1VB 4KHPL 3M85A 3PUXA 2ALYB 1X32A 2XIWA 1ONLA 1R4PB 4PMBA 1EU3A 4YWLA 3NBHA 1F2YA 2X6LA 4GNXC 4RH6A 2IX0A 1DOLA 2M9VA 1A3TA 5H1SE 1Q8KA 3K5NA 3I2ZA 2WKDA 3LNNA 3M4YA 4LUVA 3TS0A 2AQ1B 2F4VQ 5IT9E 2KCCA 1STAA 3G7LA 1I4QA 3P1HA 1VQEA 2WB1E 2IY5B 1UE1A 3ONAB 2O5JC 4WFN3 2E75C 1E1TA 5A2QL 1O7LA 3DM3A 4P74A 1S40A 3L3OC 1PFNA 2UUAL 3P75A 1QVFA 2QCPX 4HIOA 1ZYRC 1WCMG 2ICIA 3G4SA 3I4MG 2HQLA 4O2DA 1WI5A 5LMNL 2ZXRA 4P75A 1K83B 1RTOA 1EEFD 4IO9A 5M5XH 3S16B 4A93G 1VQDA 3IFTA 3OHXC 1F2MA 4DUZQ 1PTOB 3JC66 4CJ2C 2B2UA 3G48A 5C0XI 5CR3A 1EYGA 1EIFA 1HJPA 4DUYQ 2EOTA 2MUYA 3V96A 1IKMA 1Y8NB 2NZOA 1UE6A 1DD2A 1H9SB 4YIJA 4EGVA 2F0PA 3W5OA 1SXTA 1DM0B 1EZ8A 5CV8A 4BS9A 3S14H 3SVMA 1D7QA 2QA4A 2LKVA 1JOQA 3MXGA 1CTMA 1ZYRD 3FMCA 1SR3A 1GVPA 3H0GH 4PQXA 2D9UA 3JAML 1VQ9A 4CJ1B 5C4XB 1I4PA 3OMGA 3A7AB 3K5MA 1GJXA 2RSOA 1N33L 4GOPA 2F0TA 2K4KA 4LW1A 1IBMQ 2NVXB 2K33A 5EPLA 2RHSB 2Z8LA 5EJWA 4TRDA 1IW7D 2DY7A 3SDZA 1JICA 4QJFA 4A3KB 3OTOL 4AIMA 5JJKA 4A3MB 4H0LC 1F2ZA 4QF4A 1M1KC 3CKIB 2HT1A 2K03A 1AE2A 4MNOA 4PZ8A 1PTOF 3ULJA 3CCJA 3BYYB 1IBKL 1AZQA 5K36H 2EY6A 4PMWA 1ML0D 1QB5D 4NP5A 2G5DA 3PCOB 4IUVA 4JI5Q 1BXTA 1CT1D 4CDFC 1HNWL 3J80c 5T1IA 2UUBL 4IOCA 1EYAA 2WAQB 3Q23A 1ILPA 4I7ZC 1EU4A 3M7GA 4P2CB 1CKOA 1Y1VH 2ZJRA 1CM9A 4IPDA 2VNUD 1HRJA 4X64L 4KK7A 1XMOL 1KC8C 2KECA 5I9OA 2PZTA 4K5WA 4OONA 4YHHL 1N32Q 3T1YQ 2BDOA 1I5FA 4JI0Q 2D2CC 2A74C 1XPRA 3S1QB 4A3DG 2SOBA 2XVSA 1PTOC 3KBGA 3W1BA 4JCVE 4JI3L 2WFWA 1KL9A 2NN6H 1XXGA 2R93B 2X6GA 1YITA 1FJGQ 2EY5A 1B50A 1K0RA 4KJOA 5IYCG 3J81c 2N55A 1D5XC 1RD9D 1EFID 2EXDA 1NE3A 2VXWA 3CW2C 3KFUA 5M5YH 2NTTA 4ALPA 1NR2A 1NMFA 2FMCA 1K73C 5M5WB 3NBIA 1B44D 2K5WA 2AHOB 2R61A 3GTOH 4R4CA 4GOPC 3KF8B 3VR4A 1B4OA 3DLLA 2JA7H 1K83H 2ID0A 1SNOA 1X6OA 1I4HA 2JSOA 4ILWA 1EIYB 5M3MH 1PTOD 1YVCA 2K28A 4OIJA 5CORA 5E4WC 2KENA 4IPCA 4DF7A 2MJ8A 2VS1A 2K01A 1LTLA 2VZAA 2IWHA 5GAEC 1J5EQ 3R2IA 2Z1CA 3CC2A 5GAHC 3PO3B 4LF5Q 2ATWA 2PNRC 2L0CA 5GQOA 1HNZL 3STBC 3GTMB 2PQAA 1Y1WB 4JI2Q 3LWEA 5EBDA 3TZUA 4FXKC 2F0EA 2O5IC 2ES2A 3S1MB 1IKLA 4JI7Q 3GV3A 3OW7A 5IP7H 3I56A 1HXYD 3T53B 5C4XH 5IP9H 1UE5A 1BCPC 1TVXA 1Z47A 3K7UC 5AJ3Q 5ELOA 4XYQA 3WWVA 1VDZA
chains in the Genus database with same CATH topology
3D4WA 3MTSA 3E0JA 4DNRB 3CQZB 5FO8B 4FYDA 4K2LA 3X3MA 3H09A 4Q5VA 2LFNA 3HKZB 1JORA 3NSWA 4BY7B 5D3IB 2R92B 2SEBD 4TKOB 4EVOA 4DNTB 3TP5A 2G9HD 3WOFA 4BBRB 1B2TA 3OIQA 2F0FA 1EY6A 1CA5A 2XN9C 3QG1A 4KKSA 3IAYA 3SHLA 4RGOS 3KLSA 2F03A 1KLUD 4KKUA 4K2KA 2C5CA 2JP1A 2EYPA 1B53A 2KEDA 2NN6G 1QCBD 1SE2A 2H1EA 4A3FB 1I6HB 2RVLA 4XYOA 5M3FB 1SDFA 4OIKA 3I73A 3FEWX 3MXNA 2QEJC 3J80E 2EJGC 4S3SA 3T16A 5C0XH 4CKCA 3HOYB 1VF7A 1Y8PB 4A3JB 2KQ3A 1A15A 1XWEA 1LT3D 1RCVD 2M00A 1SMYD 1EEID 3Q6SA 1PFMA 2JA6B 2KCNA 3O13A 2HCCA 4AYBB 5IGEA 4EQPA 3I4NB 3SK5A 3QWNA 1C4QA 2WINB 3J81E 4IQZA 2JA5B 2RKSA 1E2ZA 2NVYB 3D8GA 1EZ6A 5A35A 5IOCA 3EVQA 3D4RA 2DNEA 4ZUJA 3HOZB 2IT1A 1HA5A 4J8QA 5HGTA 4MN3A 2A69D 4FO2A 1VCIA 5C3EB 3SK8A 5JEAH 3GP7A 2A6HD 2EY2A 1HFGA 1I3QB 1OXVA 1OXSC 4FXDA 4RGTA 1TKWB 1WTVA 3I3CA 4DK0A 3N6RA 1IHZA 1EY8A 5EGTA 1DONA 5CYUA 3KLRA 4HCSA 4F8MA 2VB2X 2VB3X 5LL6S 3HOWB 2Z4HA 4KY7A 3BS1A 2IPKD 1VF5C 4X3TA 4EQNA 4DA2A 2L4NA 4ODGA 5AFWA 1SYCA 1U9RA 5JAVA 3CRLC 2HQEA 3Q22A 2BA0A 5LHY1 4FNFA 3D31A 3FPPA 2TMPA 2F0WA 1ESFA 2YYZA 3C1EA 4NW2A 3TBIB 2PYKA 2RDFA 1V1PB 4BA2I 2SDFA 4HTHA 2E2DC 4FF1A 2PCFB 1SNDA 2WB1B 1TS4A 1AEXA 3EA6A 3PIP3 3OSOA 1F9SA 4L63B 1DXMA 3T13A 4F87A 2B39A 2GA4B 4PV1C 5ELBA 3WDNA 2AWNA 4KV6A 4CKEA 1G6ZA 2KJXA 1STNA 5KGUA 4OO1I 1PXUA 1SSOA 1QG7A 3S14B 5FO9B 1RODA 5DM73 1D6EC 1JOOA 3NE5B 1TT2A 4IUQA 4K14A 5C4HA 1XX8A 3R93A 5IGCA 3X3NA 1GOZA 4V0BA 2XWBB 2K6AA 2F0LA 3ZYYX 2A68C 4H44C 4CKBA 3VYTA 3E5SA 3SE0A 3DEPA 5CV7A 5G3LD 4A3IB 4F7XA 4UAIA 3GO5A 3E6ZX 1BBXC 2K7VA 4G4KA 4ID6A 4OL7A 2JA8B 4KY5A 1DOKA 3VR3A 1RF2D 1SNQA 1HA6A 2EYOA 3W3AA 5KEEA 1RHPA 1WTQA 4ZQ3A 2DY8A 1S5ED 3Q0AA 4HCEA 2A73B 2PO4A 1H9KA 1LACA 2FMMA 1BQQT 1ET6A 5CBEE 3C3LA 3EFXD 4CJ0B 1TWHB 1F2LA 4JBWA 2OT2A 1CI3M 2OF1A 1CZWA 2G9DA 1YNJD 2B8GA 1SE4A 3HZXA 4IUNA 4BA1I 4G57A 1U4LA 1EL0A 5I4DA 4R8IA 2L5TA 1B3AA 4V190 4RHSA 5M5YB 1JWUD 1CHQD 4RFBA 3GTOB 2B2VA 1NUCA 3DEOA 3M4OB 1S5DD 3SK6A 1DZ1A 3TN2A 4RKBA 2JA7B 2NVQB 5KNCA 3MWYW 5M3MB 4RCNA 1S5BD 2X69A 1TQOA 5A2QE 2WACA 5KNBA 1IW7C 5ELCA 1I4RA 3AU7A 2F1MA 2F0KA 1FNUA 4QCLA 2HDLA 1RDPD 2NB0A 5CBAE 1H9SA 3KK7A 3FKIB 2BE5D 4HR7B 1ESRA 2AQ2B 3ND8A 1TS2A 1GUNA 2OEOA 3C46A 1KNAA 1LTBD 4MIUA 1FNVA 3NP8A 3OOCA 1A2UA 4DXFA 2IW3A 3MHBA 5C3WA 3GTQB 2J7ZA 1EQTA 5C44B 3JAME 2F3WA 2F3VA 1LTTD 3I8ZA 4IN3A 3H6MA 4LK1C 5ELEA 4L6TB 4N9TA 4KI0A 5CV5A 1SE3A 1UNSA 3V2TA 1AP0A 2F0NA 1G2TA 4O1NA 2BA1A 5FK9C 1KLGD 2B2VC 1SJHD 2RSNA 3DUZA 4B9XA 2XSCA 3ERQA 1RTNA 1JOKA 2RBMA 1HTLD 2NWGA 1SFOB 3H3VC 3PUVA 2AQ3B 1TWAB 2F4IA 3T4AC 5FOBB 2L11A 1B1ZA 3DWAA 2EXZA 1F9QA 3QJYA 3OWEB 4BWGB 2K04A 4Z9CB 2EDGA 2MGSA 4A3EB 1O7YA 4QB4A 3I70A 1JB3A 2K05A 1STBA 3AMUA 5J39A 4NMZA 1K8MA 2F0MA 3VA5A 1VMPA 1TIID 3D3RA 1Q1BA 3MXPA 1CHPD 5EKIA 4HEDA 1HQRD 4C1NI 3TMEA 3S15B 5C4ZA 4FF2A 2F0SA 4ZKBB 1B9MA 3FDTA 2K32A 3UI2A 4OO1H 1R9TB 4K8IA 2YU9B 4M1UB 4R9WA 1I6VC 3K58A 1D1IA 3KF8A 1NSNS 4HSPA 2EJFC 5KRUA 2RDHA 3A8IE 5E1FA 3TZDA 1CQVA 1M8AA 2KVMA 1TWCB 5ELDA 5JOBA 5J22A 1KAAA 3TP8A 3Q24A 3HOUB 1QNKA 5I6WA 3VYUA 1SYEA 1D2BA 4O42A 4J6HA 2E74C 4FF4A 3KLSX 1LTID 3J7AV 2PQEA 5D14A 4DAVA 1J8IA 1U4RA 5K36G 4WRDA 5IGGA 2LMCB 4IFDH 4B08A 1LTAD 2HDMA 2V4DA 1E2VA 5DEHA 3T51B 2PW5A 4CHTB 2E2HB 5FKAC 1TWGB 1NAPA 5KIXA 4XT3B 4WJWA 4RWSC 2CW0C 3RZDB 1Z6HA 2PPBC 4R8NA 3HOXB 1SEBD 3C1FA 1V43A 3FPUB 4M8AA 1K8OA 1DOMA 4KD4A 3K5LA 4IALA 1ICWA 2EYLA 1SMYC 4HAEA 1HTPA 1O7ZA 4G7HC 3HS0C 5LL6X 1KDBA 3MFYA 2QKIC 1LTSD 3AB9A 2JEAI 4G7OC 1ENAA 2Z4IA 1WD0A 4Y7NB 2CW0D 1EWCA 5EKKA 1SYGA 2PW7A 2WKCA 1STEA 2FHTA 4XIGS 3OWFA 4NKLA 1T5EA 1CK1A 3D4DA 1HFNA 3VA7A 4G7ZC 1PMRA 3NHHA 3MEHA 2B8FA 4KJNA 5KYLA 2R6GA 4K6DA 2A69C 3S1NB 3VR5A 2QF7A 2A6HC 3FVQA 3QOLA 1ET9A 3LWUA 5CV9A 2KA7A 4ZLTF 4MHEA 2O4XA 2Q8IB 4ZAIA 2F0OA 2AUKA 2SNSA 1TS5A 1MD2D 2ZXPA 5TSSA 1WCMB 3S17B 3BG3A 2F0IA 1LT6D 4C3HB 1WTPA 1ZEQX 1FD7D 1TY2A 1HQMC 3L7ZC 1X3QA 5M9OA 1Y69U 4IFDG 1U4PA 3D6WA 5BN5A 1X3PA 5C5LA 2FINB 4KD3A 1PDQA 1DYQA 3NXWA 3V05A 4IURA 2B2YA 1EYDA 2F0UA 3GTLB 4DAYA 1SNCA 2AWOA 4C1NK 1WTWA 3PUZA 3VYSA 5ELFA 1QILA 3LX0A 4H13C 3K0YA 5K5PA 3J7AF 2WV6D 3S2HB 1D5MC 5DNFA 1G8ZD 2F0VA 5JJZA 5C5MA 1M4VA 1GUOA 1LT5D 1IYUA 5C0XG 3NWSA 1E0BA 4Q0FA 5C3XA 4PNYA 5G3LF 2EYMA 1BNZA 2EVBA 3DWQA 4RCOA 4DU9A 1V1PA 1PLFA 2ZXOA 1ENCA 2E2IB 1L0YB 1KDCA 1JWMD 4KKTA 2R3ZA 4KTAA 5FLXL 5FO7B 4CGYB 1TR5A 3HP3A 4LAAA 3SEBA 5CC4A 1HUNA 4A3DB 4FP5D 1JC7A 2A6ED 3M3YB 3NTHA 3VYRA 1H9MA 3K5OA 1EIHA 2NN6I 4ZYSA 2NYZD 2B2YC 5DAUA 5EQ0A 1S5CD 1XTCD 1CQFA 4ZRZA 4KN4C 4K5XA 5IGBA 5JEAG 2I07B 3T56B 3DWPA 2IX3A 3RMHA 1J9OA 1L0XB 4RA8A 3A56A 4XDXA 3HOVB 2BDNA 2CVRA 1MI2A 3QIAA 5C4JB 3R3OA 5ISRA 3MXUA 3GTJB 1I4GA 2N88A 4NDXA 4DN4M 2EZVA 3CRKC 1EY7A 2TSSA 1O80A 3WOEA 1DJRD 2IJ0A 1F9PA 5EPKA 1YNJC 3K57A 1PRTB 1BOSA 3RZOB 3I91A 1WVLA 5NUCA 2K5DA 3OMCA 3KUPA 1U4MA 1QNUA 4IUPA 3TP7A 1TWFB 4X3SA 4H7BA 2K1BA 1MSGA 1EIGA 1TU2B 1R4QB 3GD7A 1B9NA 3GV6A 2PMZB 4IFDJ 3S1RB 2F0GA 1LT4D 2I46A 2LS01 5IT9L 1G2SA 4HSVA 2B2WC 4KMUC 2E76C 1QWYA 3I90A 1SJED 4FF3A 1UUPA 2BCOA 1II3A 3P20A 3QB3A 1A2TA 5JVH3 1BF4A 1Q90A 3H94A 4QIWB 1SAPA 1FGBD 1GXDC 1NCVA 2B2TA 3MZ5A 1PRTF 2BE5C 4XQJA 1SBBB 1V8QA 5KNDA 4ABNA 3NUCA 2EYFA 2EY1A 2QDBA 2QILA 1LABA 5CV4A 4JK1C 5DM63 2M2LA 1HCZA 4OGQC 1QE6A 1C48A 4C3HG 5C0XJ 1OXTA 1WTRA 3HRZC 1LTRD 2A5HA 3BZDB 5IIFA 1PRTC 1ZXTA 4TSSA 4KN7C 3BDLA 1LO5D 1QOHA 3MA2B 1BO0A 3IFDA 3NK9A 3W2DA 3NWTA 5JPMC 1EY9A 4KHZA 2XWJB 1V1OA 3SK4A 4DGZA 1BR9A 1GUGA 2Y0SB 2EPBA 2JXMB 4UDUC 3PUYA 3K7AB 3NTIA 4XT1B 1KTKA 3BDOA 4C56C 1VMCA 1PRTD 3VR2A 5EKLA 5EBCA 2HUGA 2LY7A 3A7LA 3GTKB 2NUCA 1Q3LA 2B2TC 3PMFA 5JEAJ 3NQIA 4CBVA 5BN3A 1BCPB 3QOJA 1ENFA 3IL8A 1STHA 5EPJA 3EJIA 2OXPA 1GUSA 2MPMA 4IZ8A 1CFMA 1GHJA 3PV0A 1C8CA 2ZT9C 3SXHA 1KABA 2B2UC 4IUUA 1CZGA 2SNMA 5COYA 2MHVA 1LV9A 2R7ZB 1A6XA 2HCIA 2RDGA 1Q8IA 1AFPA 1G291 3MFGA 3QO2A 3BVZA 1OXXK 1JWSD 2E2JB 1EWHA 4IUTA 2IX1A 4WORA 2ICEC 4RKLA 1S5FD 4HMIA 1I50B 4K6LA 4C3IB 1PZKD 4ZKCB 4XXEA 3R8BA 1BCPF 2CHBD 1BUVT 1PZJD 3TP6A 1PTOH 4TQUS 3A8JE 4F88A 3N52A 4XTCS 3F2UA 1MBYA 4E6IA 3D6CA 5E3FA 2PZUA 4OHJA 3CU7A 4C2MB 2WP8J 4DFAA 3NQTA 3L9AX 4RHRA 1WTXA 3PO2B 5JPNC 1GHKA 2XNAC 4U673 5KYIA 4RGNA 2F0QA 3CHBD 3M7NA 3HGBA 1I4XA 2B63B 4XQNA 2FFKB 4A3BB 2NZ1D 1SNPA 1T5XD 5T1GA 3K59A 4C3JB 4A3GB 1W6JA 1JR0D 4PMCA 1PFBA 1GUTA 1KDAA 2NVTB 3RD4A 2EJMA 1EOTA 2FJ2A 4ULLA 2F0JA 5I2XA 1YNNC 1BCPD 2XRSD 3BDCA 1FYCA 1STYA 2EE1A 2L9HA 1E2WA 2VUMB 4QMGA 1AZPA 2JYOA 3DHQA 1Q12A 1XYIA 2RA4A 3A54A 3HEJA 4XQQA 5CGKA 4DXGA 3J80L 4BY1B 4BBSB 4LMQD 4FXGC 5D3DA 2NTSA 2ENBA 4QUCA 4GZYC 1OO9B 4OO1G 2L1BA 3K6OA 3SR1A 4L8JA 1YNND 4N9PA 1W6KA 4HN7A 3GTGB 3I72A 3NTKA 5J1ZA 3S2DB 2JEBI 1UAPA 4EQOA 1EY4A 2J0TD 3DMUA 5I2YA 1SYDA 1AN8A 1ZKOA 2JE6I 3I4LA 3KBXA 2KUMA 3NPPA 1JQYD 1JE4A 2K5QA 3MAQA 3J81L 1LTGD 1H9RA 1IL8A 2H4OA 3OIPA 1EY0A 3PUWA 5F2DA 2WIIB 3HG9A 3I4MB 1QJOA 1EYCA 2RQXA 3S9WA 1LLRD 1HPCA 4A93B 1ILQA 5D65A 2Q8RE 3U9OA 4KY6A 1RJTA 5IGDA 4X3KA 4ZK9B 3BVMA 3PIO3 1OXUA 2C9OA 3IKJA 4ME5A 1TS3A 3MVVA 2CQAA 3A8KE 1FR3A 3R2TA 3U9SA 5JVG3 2XRQD 2D62A 3BYTB 1D5ZC 5HURA 1F9RA 1RKNA 5I6YA 1Q1EA 3RUZA 2F0DA 1Y8OB 3A55A 4K5VA 1BDOA 5IODA 1H9JA 1A3VA 2A6EC 3ND9A 4RAUC 3C2PA 2L55A 2L12A 3GQBA 1NR4A 1IYVA 5I9PA 2IL8A 4C3IG 3EROA 1SYFA 3FRPB 1STGA 3MC0B 5CMDA 2O2LD 2KOLA 1O78A 3TDQA 4DK1A 4KHVA 1WD1A 3G6JB 4FVMA 1S4ZA 2D5DA 4I65A 1D1KA 1VDZA 2KEEA 2MP1A 4QUFA 1G91A 5FLXE 3URYA 5M5XB 3DXJC 1JCKB 2B2WA 1KNEA 3EQLC 5IGFA 4X3UA 2EYJA 5CV6A 3GTPB 1HHVA 2F0HA 4K8JA 1PZID 2KHSA 4DAPA 1EY5A 4ZUIA 2AUJD 2Q8TA 4RGMA 4U68A 4C3JG 1MGSA 3OPOA 3P7JA 3H0GB 2BOSA 1F77A 2DN8A 3DM1A 5C6AA 3TSSA 1SYBA 5BN4A 3BVGA 1PYWD 1Z7TA 1SNMA 3J7YW 1FNWA 3VR6A 1MSHA 1DCZA 1WTOA 1HUMA 1GUWA 2EYHA 1A3UA 1AW7A 1EQVA 4B9WA 2A68D 1UEAB 2NBFA 3ITPA 4LJZC 2PZWA 3RLFA 2DNCA 3H91A 4IFDI 1CA6A 4HMJA 2J4XA 1TY0A 4J1MA 1Y1VB 3M85A 3PUXA 1X32A 2XIWA 1ONLA 1R4PB 4PMBA 1EU3A 3NBHA 1F2YA 2X6LA 4RH6A 2IX0A 1DOLA 2M9VA 1A3TA 3K5NA 2WKDA 3LNNA 3M4YA 2AQ1B 5IT9E 2KCCA 1STAA 3G7LA 1I4QA 3P1HA 3ONAB 2O5JC 4WFN3 2E75C 5A2QL 1O7LA 3L3OC 1PFNA 3P75A 2QCPX 1ZYRC 2ICIA 2ZXRA 1K83B 1RTOA 1EEFD 3S16B 3IFTA 3OHXC 1F2MA 1PTOB 4CJ2C 2B2UA 5C0XI 5CR3A 2EOTA 2MUYA 3V96A 1IKMA 1Y8NB 1DD2A 1H9SB 4YIJA 4EGVA 2F0PA 1SXTA 1DM0B 1EZ8A 5CV8A 4BS9A 3SVMA 2LKVA 1JOQA 3MXGA 1CTMA 1ZYRD 3FMCA 4PQXA 2D9UA 3JAML 4CJ1B 5C4XB 1I4PA 3OMGA 3A7AB 3K5MA 1GJXA 2RSOA 2F0TA 2NVXB 2K33A 5EPLA 2Z8LA 5EJWA 4TRDA 1IW7D 2DY7A 3SDZA 1JICA 4A3KB 4A3MB 4H0LC 1F2ZA 4QF4A 3CKIB 2K03A 1PTOF 3BYYB 1AZQA 5K36H 2EY6A 4PMWA 1ML0D 1QB5D 4NP5A 4IUVA 1BXTA 1CT1D 5T1IA 1EYAA 2WAQB 3Q23A 1ILPA 4I7ZC 1EU4A 3M7GA 4P2CB 1CM9A 2VNUD 1HRJA 4KK7A 5I9OA 2KECA 2PZTA 4K5WA 2BDOA 2D2CC 2A74C 3S1QB 2SOBA 2XVSA 1PTOC 3KBGA 2NN6H 1XXGA 2R93B 2X6GA 2EY5A 1B50A 4KJOA 2N55A 1D5XC 1RD9D 1EFID 2VXWA 2NTTA 1NR2A 2FMCA 5M5WB 3NBIA 1B44D 2K5WA 2R61A 3VR4A 1B4OA 2ID0A 1SNOA 1I4HA 2JSOA 4ILWA 1PTOD 2K28A 4OIJA 5CORA 5E4WC 4DF7A 2MJ8A 2K01A 2IWHA 3R2IA 2Z1CA 3PO3B 2PNRC 2L0CA 3GTMB 1Y1WB 3LWEA 5EBDA 3TZUA 4FXKC 2F0EA 2O5IC 3S1MB 1IKLA 3GV3A 3OW7A 1HXYD 3T53B 1BCPC 1TVXA 1Z47A 4XYQA 5E4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS2 A;  3BVM A;  3URY A;  1V1P B;  1LTB D;  1BCP D;  1FNV A;  2XRS D;  3O13 A;  1BXT A;  1CT1 D;  1JCK B;  1S5E D;  2RDG A;  5ELF A;  4DXF A;  1CQV A;  1EWC A;  1QIL A;  2AQ1 B;  1TS4 A;  3MFG A;  1I4G A;  1I4Q A;  1TS3 A;  1STE A;  3BVZ A;  5ELD A;  1EU4 A;  1JWS D;  1PZI D;  3R2T A;  2WV6 D;  1ET6 A;  3EA6 A;  1LTT D;  1D5M C;  1LTR D;  5ELE A;  2XRQ D;  3BZD B;  1CK1 A;  2TSS A;  1G8Z D;  3EFX D;  4L6T B;  4L63 B;  1DJR D;  1PRT C;  2IJ0 A;  1SE3 A;  1UNS A;  4TSS A;  4RGM A;  3BYT B;  5D3I B;  1M4V A;  1S5F D;  1D5Z C;  4DXG A;  2SEB D;  1LT5 D;  1PRT B;  2ICI A;  4K6L A;  2NTS A;  5D3D A;  1LO5 D;  1PZK D;  4O1N A;  1EEF D;  1PTO C;  1SE4 A;  1BCP F;  3R8B A;  2CHB D;  5FK9 C;  1HA5 A;  1KLG D;  1SJH D;  2G9H D;  1ET9 A;  1PTO B;  3W2D A;  3KLS X;  1F77 A;  1PZJ D;  5ELB A;  1LTI D;  3DWQ A;  5I4D A;  4RCO A;  1XXG A;  1PTO H;  3GP7 A;  3TSS A;  1V1P A;  1V1O A;  1L0Y B;  1HTL D;  2XN9 C;  1D5X C;  1RD9 D;  4RHS A;  1TS5 A;  1EFI D;  4RGO S;  1MD2 D;  1JWM D;  3BVG A;  4UDU C;  1PYW D;  1KLU D;  1JWU D;  1SXT A;  1CHQ D;  2AQ3 B;  2NTT A;  1AN8 A;  4RFB A;  1KTK A;  5TSS A;  1LTA D;  3SEB A;  1D6E C;  1B1Z A;  1S5D D;  3DWA A;  4C56 C;  1B44 D;  4OHJ A;  4RGT A;  2R61 A;  1PRT D;  3OWE B;  4BWG B;  1FNW A;  1LT6 D;  4Z9C B;  1LT4 D;  1SE2 A;  4RHR A;  1GOZ A;  1JQY D;  1S5B D;  2XNA C;  5FKA C;  1I4H A;  4RGN A;  1PTO D;  1FD7 D;  1LTG D;  1TY2 A;  3CHB D;  1I4X A;  1I4P A;  4ZYS A;  1AW7 A;  1SJE D;  5ELC A;  1I4R A;  1T5X D;  1BCP B;  1UUP A;  2IPK D;  1ENF A;  1S5C D;  1XTC D;  2QEJ C;  3R2I A;  1CHP D;  2Z8L A;  1FNU A;  1JR0 D;  3MC0 B;  1HQR D;  1SEB D;  1DYQ A;  2O2L D;  1FGB D;  1LLR D;  1RDP D;  2J4X A;  1PRT F;  1TY0 A;  3V05 A;  3DWP A;  1SBB B;  1LT3 D;  1L0X B;  1EU3 A;  1RF2 D;  1HXY D;  1RCV D;  1PTO F;  1ESF A;  2QIL A;  1BCP C;  3BYY B;  4RH6 A;  1EEI D;  2AQ2 B;  1LTS D;  2RDH A; 
#chains in the Genus database with same CATH topology
 1I94 L;  3D4W A;  3MTS A;  3E0J A;  4R4Q A;  2NVX H;  2CH4 W;  4DNR B;  3CQZ B;  3UDF A;  4B3S L;  5FO8 B;  4FYD A;  4DR5 L;  4A3K H;  1KRT A;  3STB D;  4HJ7 A;  4K2L A;  2R7D A;  3X3M A;  3H09 A;  2D0P A;  1PH6 A;  4Q5V A;  2N8N A;  2LFN A;  3HKZ B;  1JOR A;  3NSW A;  4BY7 B;  5D3I B;  4B3M Q;  2R92 B;  1W3S A;  2DJG C;  2SEB D;  4TKO B;  4EVO A;  4DNT B;  2UXB Q;  1L1O B;  3TP5 A;  1VQL A;  1VQG A;  4I7A A;  2G9H D;  3WOF A;  4BBR B;  2ZTE A;  3E0E A;  5LMU Q;  3RN2 A;  1B2T A;  2A19 A;  3OIQ A;  1QUQ B;  2F0F A;  1EY6 A;  3UE0 A;  1CA5 A;  4HJA A;  2XN9 C;  3QG1 A;  4KKS A;  4DV4 Q;  3SHL A;  1VQ4 A;  3IAY A;  1PYB A;  4DR6 L;  4RGO S;  3KLS A;  5E4X A;  2F03 A;  1KLU D;  4IOA A;  4KKU A;  4K2K A;  2C5C A;  1SFO H;  4AQY L;  1VQP A;  2JP1 A;  2EYP A;  1TWA H;  1B53 A;  1MHW C;  2KED A;  2NN6 G;  2P5Z X;  1QCB D;  1SE2 A;  2H1E A;  4A3F B;  1I6H B;  2RVL A;  3NEL A;  1VQF A;  1L2F A;  4XYO A;  1PA6 A;  1OTC A;  1HZB A;  4KLK A;  5M3F B;  1VQK A;  1SDF A;  4OIK A;  3I73 A;  4X65 Q;  2R93 H;  3FEW X;  4X62 Q;  3MXN A;  4EQ5 A;  2QEJ C;  2VY3 A;  4QL5 A;  3J80 E;  2EJG C;  4S3S A;  3T16 A;  5IYB G;  5C0X H;  4CKC A;  1VQH A;  3LGJ A;  3HOY B;  1VF7 A;  1Y8P B;  4A3J B;  2KQ3 A;  1A15 A;  1XWE A;  1LT3 D;  1VQN A;  3KDF A;  1VS0 A;  1RCV D;  1HR0 W;  2M00 A;  2QDL A;  2YU9 H;  1SMY D;  1EEI D;  1X56 A;  4LF7 Q;  3Q6S A;  1PFM A;  2JA6 B;  2KCN A;  5FLM H;  4K0K Q;  1XMQ L;  1VQC A;  3O13 A;  1RL2 A;  2HCC A;  4OX9 Q;  1N36 L;  4AYB B;  5IGE A;  4EQP A;  2QEX A;  3PO3 H;  3I4N B;  1UE7 A;  1JJC B;  5IP7 G;  3SK5 A;  1Y1W H;  3QWN A;  1C4Q A;  2PI2 E;  2WIN B;  5IP9 G;  3U58 A;  1TWC H;  2CWP A;  3J81 E;  4IQZ A;  2JA5 B;  2DGY A;  4JBK A;  2RKS A;  3HOU H;  4GLX A;  1KXL A;  1E2Z A;  2NVY B;  3D8G A;  1EZ6 A;  5A35 A;  5IOC A;  1G6P A;  1L1O C;  3D4R A;  3EVQ A;  2DNE A;  3CF5 A;  4ZUJ A;  3HOZ B;  4A3K G;  2IT1 A;  2ASB A;  1HA5 A;  4A3M G;  4J8Q A;  4LF8 L;  5HGT A;  4MN3 A;  2A69 D;  4FO2 A;  1VCI A;  4JC0 A;  4WJ3 M;  2OCE A;  3OYY A;  5C3E B;  3SK8 A;  5JEA H;  1FL0 A;  3GP7 A;  2A6H D;  1T9H A;  2EY2 A;  1HFG A;  1I3Q B;  1OXV A;  3M4P A;  4JYA Q;  1KRS A;  3E9I A;  4PZ6 A;  4DR4 L;  4JBJ A;  1OXS C;  4BY7 H;  4FXD A;  4RGT A;  1NY4 A;  1TKW B;  1WTV A;  2WAQ G;  3I3C A;  4DK0 A;  4CDD C;  4DV2 Q;  1PH1 A;  3N6R A;  1IHZ A;  1EY8 A;  5EGT A;  1DON A;  5CYU A;  2UXD L;  3KLR A;  3PGZ A;  1TWG H;  4HCS A;  5HY6 A;  4F8M A;  2VB2 X;  2VB3 X;  5LL6 S;  3HOW B;  2Z4H A;  4KY7 A;  4NXM Q;  3CME A;  3BS1 A;  2IPK D;  2C35 B;  1VF5 C;  3RZD H;  4X3T A;  4EQN A;  4DA2 A;  2ZJQ A;  2L4N A;  4ODG A;  1LM0 A;  1WFQ A;  5AFW A;  1SYC A;  1U9R A;  5JAV A;  3CRL C;  2HQE A;  3Q22 A;  2BA0 A;  5LHY 1;  2R93 G;  4FNF A;  3D31 A;  3FPP A;  2TMP A;  2F0W A;  1K9M C;  1ASY A;  1ESF A;  2F4V L;  2YYZ A;  3T1H Q;  3C1E A;  3NEM A;  3A5U A;  1PVO A;  3TS2 A;  4DV0 Q;  4NW2 A;  1P8L A;  2F3I A;  3TBI B;  2PYK A;  4A75 A;  2RDF A;  4APV A;  4WJ4 A;  5ELN A;  1V1P B;  1VQB A;  4BA2 I;  2SDF A;  4DV1 Q;  4HTH A;  2E2D C;  4JG2 A;  4FF1 A;  2RCN A;  2PCF B;  1SND A;  4Y7N H;  2WB1 B;  1TS4 A;  1QVC A;  2H5X A;  4A3J H;  4DV6 Q;  2XGT A;  1AEX A;  3EA6 A;  3PIP 3;  3OSO A;  1F9S A;  1VQ6 A;  4L63 B;  1HH2 P;  1DXM A;  3T13 A;  2HD3 A;  4DUY L;  3M9B A;  4F87 A;  1PH7 A;  4B3R Q;  2B39 A;  2ZTD A;  3ER0 A;  2UUC Q;  2GA4 B;  4PV1 C;  5ELB A;  3WDN A;  2AWN A;  4KV6 A;  3I4N H;  4CKE A;  4JI4 Q;  1G6Z A;  2KJX A;  1STN A;  2OQ0 A;  5KGU A;  3RNU A;  4OO1 I;  1PXU A;  1SSO A;  2JA5 H;  1QG7 A;  2JA8 H;  3S14 B;  5FO9 B;  1GKH A;  1ROD A;  5DM7 3;  1D6E C;  1JOO A;  3NE5 B;  1TT2 A;  4IUQ A;  4K14 A;  2NVY H;  3TQY A;  1XX8 A;  5C4H A;  3R93 A;  5IGC A;  1XPO A;  4BXX H;  3CMA A;  3X3N A;  1K8G A;  3HOZ H;  1GOZ A;  1IBM L;  4V0B A;  2XWB B;  2K6A A;  3GDE A;  4C3H H;  2F0L A;  2I5M X;  3ZYY X;  2A68 C;  4H44 C;  3HKZ G;  4CKB A;  4R1J A;  3VYT A;  1E3P A;  3E5S A;  4HJ5 A;  2R92 G;  3KF6 B;  1N9W A;  3SE0 A;  4POG A;  3DEP A;  4QY7 A;  5CV7 A;  2K14 A;  5G3L D;  4A3I B;  4F7X A;  4LNQ A;  4UAI A;  3F2B A;  3GO5 A;  4FDB A;  3E6Z X;  4BBR G;  1BBX C;  2K7V A;  4G4K A;  4ID6 A;  1VQM A;  2VUM G;  4OL7 A;  2JA8 B;  4KY5 A;  4JI5 L;  1LYL A;  1DOK A;  1SMX A;  3VR3 A;  1XNR L;  4IJL A;  2ZTC A;  1RF2 D;  1S3O A;  1SNQ A;  1HA6 A;  2EYO A;  4LFC Q;  3W3A A;  5KEE A;  4BY1 G;  4CDC C;  1RHP A;  1WTQ A;  5GAD C;  4ZQ3 A;  4YWK A;  2DY8 A;  3KLW A;  1S5E D;  3Q0A A;  1BBW A;  4HCE A;  4A3F G;  1N32 L;  3T1Y L;  2A73 B;  2PO4 A;  4JI0 L;  1H9K A;  1LAC A;  1JB7 A;  2FMM A;  1K28 A;  1BQQ T;  2Z6K C;  5M3F G;  1ET6 A;  5CBE E;  3C3L A;  1K3R A;  3EFX D;  4JOI A;  4CJ0 B;  1XNQ Q;  1JE5 A;  1TWH B;  1F2L A;  4JBW A;  1FJG L;  2OT2 A;  1CI3 M;  3FHW A;  4DKA C;  2ZJP A;  2OF1 A;  1CZW A;  2G9D A;  3HOY G;  1YNJ D;  2B8G A;  1SE4 A;  5GRO A;  1CKM A;  3HZX A;  4IUN A;  4BA1 I;  1U5K A;  4G57 A;  1U4L A;  3E3X A;  1EL0 A;  5I4D A;  4JI1 L;  2R7F A;  4R8I A;  2AMC B;  1VQO A;  2L5T A;  1B3A A;  2RF4 A;  4V19 0;  3ERS X;  4RHS A;  1VQ7 A;  5M5Y B;  3SGI A;  2E2I H;  2JA6 G;  1E7Z A;  1JWU D;  1CHQ D;  2Z9H A;  4RFB A;  3GTO B;  2B2V A;  1NUC A;  3DEO A;  3M4O B;  1S5D D;  3SK6 A;  1EUJ A;  1DZ1 A;  4JW0 A;  3TN2 A;  4RKB A;  2JA7 B;  4AYB G;  2NVQ B;  5KNC A;  3I4N G;  3MWY W;  1J5E L;  5M3M B;  4RCN A;  1S5B D;  2X69 A;  1YZ6 A;  1TQO A;  4LF5 L;  4JI2 L;  5A2Q E;  2WAC A;  5KNB A;  1IW7 C;  5ELC A;  1I4R A;  4BXX G;  4JI7 L;  3AU7 A;  2F1M A;  2F0K A;  3HOZ G;  1FNU A;  4QCL A;  4DPG A;  2HDL A;  5AJ3 L;  1RDP D;  2NB0 A;  5CBA E;  1H9S A;  5C3E G;  3KK7 A;  3FKI B;  2BE5 D;  4HR7 B;  3RLN A;  1ESR A;  2AQ2 B;  3ND8 A;  2GVA A;  1PH9 A;  4DR7 Q;  1TS2 A;  1GUN A;  2OEO A;  3C46 A;  1KNA A;  3HOV H;  4JOI C;  1LTB D;  4MIU A;  1FNV A;  4IPG A;  3NP8 A;  3OOC A;  1A2U A;  4A3I H;  4DXF A;  2MFI A;  2IW3 A;  3MHB A;  4B3M L;  5C3W A;  3GTQ B;  2KCT A;  2UXB L;  2J7Z A;  1EQT A;  5C44 B;  3JAM E;  5BR8 Q;  1YJW A;  2F3W A;  2F3V A;  1LTT D;  3AYH B;  3I8Z A;  4IN3 A;  3H6M A;  4LK1 C;  5ELE A;  4L6T B;  4N9T A;  4KI0 A;  3HOW G;  5CV5 A;  4CDE C;  5LMU L;  1SE3 A;  1UNS A;  2FXQ A;  3I55 A;  3V2T A;  1C0A A;  4LF6 Q;  3CCV A;  1AP0 A;  2F0N A;  1G2T A;  4DV4 L;  3RZO H;  4Y52 H;  4O1N A;  4PG3 A;  1HR0 Q;  2BA1 A;  5FK9 C;  1KLG D;  2B2V C;  1SJH D;  1IL2 A;  2RSN A;  3J7Z C;  3DUZ A;  2AKW B;  2XSC A;  4B9X A;  4DR1 Q;  2CQO A;  3ERQ A;  1RTN A;  1JOK A;  2RBM A;  1X54 A;  1XPU A;  1HTL D;  2K5V A;  2NWG A;  1SRO A;  1SFO B;  3H3V C;  3B6Y A;  3L0O A;  3PUV A;  2E8G A;  2AQ3 B;  1TWA B;  2F4I A;  1TWH H;  3T4A C;  5FOB B;  2L11 A;  1B1Z A;  3DWA A;  1EOV A;  2EXZ A;  1F9Q A;  3QJY A;  3OWE B;  4X65 L;  4BWG B;  2K04 A;  4Z9C B;  2EDG A;  2WB1 G;  2MGS A;  4A3E B;  1EFW A;  4X62 L;  1G51 A;  1O7Y A;  1C9O A;  2PMZ E;  3AFQ A;  4QB4 A;  2VQF Q;  3I70 A;  5IWA Q;  1JB3 A;  2K05 A;  1STB A;  4OWT B;  3S1R H;  3AMU A;  2JN4 A;  5J39 A;  4NMZ A;  2RHQ B;  4A4I A;  1P16 A;  1K8M A;  2F0M A;  3VA5 A;  3OW2 A;  1VMP A;  1TII D;  3D3R A;  3D0F A;  1Q1B A;  2B29 A;  3MXP A;  4GN4 B;  2KCM A;  1CHP D;  5EKI A;  4HED A;  1HQR D;  4C1N I;  3TME A;  3S15 B;  4LFA Q;  3M4O H;  1X65 A;  5C4Z A;  4LF7 L;  4FF2 A;  2F0S A;  4ZKB B;  1B9M A;  2NVQ H;  1VQJ A;  3FDT A;  4QIW E;  1YI2 A;  4K0K L;  2MNA A;  2K32 A;  3UI2 A;  4OO1 H;  1R9T B;  3U4Z A;  4OX9 L;  4K8I A;  2YU9 B;  4M1U B;  4R9W A;  4NPS A;  1I6V C;  1Z9F A;  3K58 A;  1D1I A;  3KF8 A;  1NSN S;  1XJV A;  2HHH Q;  4HSP A;  2EJF C;  5KRU A;  2RDH A;  1B7Y B;  4YY3 Q;  3A8I E;  5E1F A;  2UXC Q;  3TZD A;  1YIJ A;  1MIU A;  3UE1 A;  3L2P A;  1CQV A;  2IHE A;  3H0G G;  5EAY A;  1M8A A;  2KVM A;  1TWC B;  5ELD A;  1HZC A;  1D8L A;  5JOB A;  5J22 A;  1KAA A;  3TP8 A;  3Q24 A;  3HOU B;  1QNK A;  1X3E A;  3FKI H;  1IBL Q;  1UWV A;  5I6W A;  2JQO A;  3VYU A;  1SYE A;  4A3I G;  1D2B A;  4O42 A;  1N34 Q;  4J6H A;  4JYA L;  2E74 C;  4FF4 A;  3KLS X;  1LTI D;  3J7A V;  2PQE A;  5D14 A;  4DAV A;  3GTQ H;  5DLQ E;  1J8I A;  1U4R A;  3CP0 A;  4ZCK A;  5K36 G;  4WRD A;  4DV2 L;  2GVB A;  5C44 H;  1CKN B;  3EIV A;  3AEV A;  5IGG A;  4UPA A;  2LMC B;  1JT8 A;  4GS3 A;  1SE8 A;  4IFD H;  4B08 A;  1LTA D;  4B3T Q;  3K7A H;  2N78 A;  5FJ8 H;  2HDM A;  2V4D A;  1E2V A;  4NXM L;  5DEH A;  3T51 B;  2PW5 A;  2VW9 A;  1Y1V G;  4CHT B;  2E2H B;  5FKA C;  2MQH A;  2E5L Q;  1TWG B;  1SLJ A;  1CUK A;  1A62 A;  1NAP A;  5KIX A;  4XT3 B;  1L1O A;  4WJW A;  4RWS C;  2CW0 C;  3RZD B;  4R4O A;  1Z6H A;  2PPB C;  2VL6 A;  4DR2 L;  4R8N A;  1YHA A;  3HOX B;  1QUQ A;  1SEB D;  3C1F A;  1V43 A;  3FPU B;  4M8A A;  4DV0 L;  1K8O A;  1DOM A;  4KD4 A;  4LF9 Q;  2KBN A;  4A3E H;  3K5L A;  4DV1 L;  4HAE A;  1ICW A;  2EYL A;  1SMY C;  4IAL A;  1HTP A;  3K81 C;  1HNX Q;  1O7Z A;  4G7H C;  3HS0 C;  5LL6 X;  2UUB Q;  1KDB A;  3MFY A;  4A3C H;  2QKI C;  3CCM A;  1LTS D;  3AB9 A;  4DV6 L;  1KHI A;  2JEA I;  4X6A H;  4G7O C;  4LF4 Q;  4P72 A;  1ENA A;  2Z4I A;  2JA7 G;  1WD0 A;  4Y7N B;  2CW0 D;  2R7Z H;  1EWI A;  3UDI A;  1EWC A;  5M3M G;  5EKK A;  1SYG A;  2PW7 A;  2WKC A;  3S15 H;  3KJP A;  2UU9 Q;  4L5S A;  4B3R L;  1STE A;  2FHT A;  2ZM6 Q;  4XIG S;  3HFZ B;  3OWF A;  2CH4 A;  2YV5 A;  4NKL A;  1T5E A;  1R9T H;  1CK1 A;  2E2J H;  3D4D A;  1HFN A;  4DV3 Q;  2UUC L;  3VA7 A;  4G7Z C;  2EIF A;  1PMR A;  4JI4 L;  3NHH A;  3MEH A;  2B8F A;  1PHJ A;  4KJN A;  5KYL A;  2R6G A;  4K6D A;  2A69 C;  3S1N B;  3VR5 A;  4A3L H;  2QF7 A;  2A6H C;  3QOL A;  3FVQ A;  1ET9 A;  3LWU A;  5CV9 A;  2KA7 A;  4ZLT F;  4MHE A;  2O4X A;  2Q8I B;  5C4X G;  4ZAI A;  1QZG A;  2F0O A;  1X9N A;  4JI6 Q;  2AUK A;  2SNS A;  4OXP A;  1TS5 A;  1MD2 D;  2ZXP A;  4OEL B;  5TSS A;  1WCM B;  3S17 B;  3BG3 A;  2F0I A;  1LT6 D;  1PH5 A;  4C3H B;  3CD6 A;  1K0S A;  4C2M H;  1WTP A;  4X66 Q;  1ZEQ X;  2XTI A;  5C44 G;  3PO2 H;  3M4Q A;  1FD7 D;  1TY2 A;  1HQM C;  3L7Z C;  1X3Q A;  4YCW A;  5M9O A;  1Y69 U;  4IFD G;  1U4P A;  1A63 A;  3D6W A;  1Q7Y C;  4A3B H;  3K80 C;  5BN5 A;  4OWW B;  1X3P A;  5C5L A;  2FIN B;  3I4O A;  4KD3 A;  4A3G H;  1PDQ A;  1DYQ A;  1DGS A;  2BH2 A;  4LFC L;  4LFB Q;  4HIM A;  4NB3 A;  1KD1 C;  3NXW A;  3V05 A;  4IUR A;  3KJO A;  1Q81 C;  2B2Y A;  1EYD A;  3UDG A;  4OWX B;  2F0U A;  3AQQ A;  3GTL B;  2E2H H;  4DAY A;  1IZ6 A;  1SNC A;  2AWO A;  4EX5 A;  4C1N K;  3CXC A;  1WTW A;  3RN5 A;  3Q8D A;  3PUZ A;  1XNQ L;  3VYS A;  5ELF A;  5LMN W;  3CCR A;  1QIL A;  3HOX H;  3LX0 A;  4H13 C;  3K0Y A;  5K5P A;  3J7A F;  2WV6 D;  4GN5 A;  3S2H B;  1D5M C;  5DNF A;  1G8Z D;  2Q2H A;  3K8A A;  3TRE A;  4GKK Q;  2F0V A;  5JJZ A;  5C5M A;  1M4V A;  3QR8 A;  1GUO A;  1LT5 D;  2Z6B A;  1IYU A;  5C0X G;  4YCV A;  3NWS A;  1E0B A;  1YBY A;  4Q0F A;  2N49 A;  5HGQ A;  3F1Z A;  4PNY A;  5C3X A;  5G3L F;  2EYM A;  2JA9 A;  1BNZ A;  4DNI A;  2EVB A;  3DWQ A;  4YCU A;  4RCO A;  3I7F A;  5IYD H;  3U50 C;  1TXY A;  4DU9 A;  1VQI A;  1V1P A;  1PLF A;  2ZXO A;  3GTG H;  1ENC A;  3CC7 A;  2E2I B;  1L0Y B;  5FLM G;  1KDC A;  4DUZ L;  1JWM D;  4KKT A;  2R3Z A;  4KTA A;  5FLX L;  5FO7 B;  4CGY B;  1TR5 A;  3HP3 A;  4LAA A;  3SEB A;  4R4T A;  1BVS A;  3TEH B;  1SRU A;  3PO3 G;  5CC4 A;  1HUN A;  4A3D B;  1NTG A;  1Y1W G;  4FP5 D;  4L5T A;  2Z6K A;  1JC7 A;  1WJJ A;  2PNH A;  2A6E D;  3M3Y B;  3S1N H;  3NTH A;  3VYR A;  2D0O A;  5E7N A;  1H9M A;  3HOU G;  1RIP A;  3K5O A;  1EIH A;  2NN6 I;  4ZYS A;  2NYZ D;  3JAM c;  2B2Y C;  4GNX B;  5DAU A;  5EQ0 A;  3RR5 A;  2B3G A;  1S5C D;  4NXN Q;  1XTC D;  1CQF A;  4ZRZ A;  4KN4 C;  1QVG A;  1PH8 A;  4K5X A;  4MZ9 A;  1WCM H;  3IRB A;  3S17 H;  5IGB A;  5JEA G;  2I07 B;  3H3V I;  4DR7 L;  3T56 B;  3DWP A;  1LUZ A;  2IX3 A;  4A93 H;  3EN2 A;  3RMH A;  1J9O A;  1L0X B;  3ZJY C;  4RA8 A;  1MJE A;  3A56 A;  4XDX A;  4GKJ Q;  3HOV B;  2BDN A;  4BY7 G;  2CVR A;  1PYS B;  5BR8 L;  1Q82 C;  3PIO A;  1CSQ A;  1MI2 A;  3QIA A;  5C4J B;  3R3O A;  4DR3 Q;  1FVI A;  5ISR A;  4DV7 Q;  3MXU A;  3GTJ B;  1I4G A;  2N88 A;  4LF6 L;  4NDX A;  3CC4 A;  2F52 A;  3KF6 A;  4MTN A;  4DN4 M;  2EZV A;  3CRK C;  1B70 B;  1HR0 L;  1HZA A;  1EY7 A;  2TSS A;  1O80 A;  3WOE A;  1YNX A;  1DJR D;  2IJ0 A;  3GTL H;  1F9P A;  5EPK A;  1YNJ C;  2K5H A;  4DR1 L;  3K57 A;  3ULP A;  3W1G A;  1PRT B;  2Q2T A;  1BOS A;  1IXR A;  3I91 A;  3RZO B;  1WVL A;  1IYJ B;  1V1Q A;  5NUC A;  2K5D A;  3OMC A;  3ULL A;  3VDY A;  3KUP A;  1U4M A;  3J80 i;  1QNU A;  4IUP A;  2LSS A;  3TP7 A;  4GLV B;  1YHQ A;  1TWF B;  4X3S A;  3RLO A;  2RCF A;  2VQF L;  4H7B A;  2K1B A;  5IWA L;  1MSG A;  1EIG A;  2K50 A;  1TU2 B;  2CWA A;  3S2H H;  1X3G A;  1R4Q B;  3GD7 A;  1B9N A;  3NBH B;  3GV6 A;  2PMZ B;  1YJN A;  4IFD J;  3S1R B;  2F0G A;  1LT4 D;  2I46 A;  4A3J G;  2LS0 1;  5IT9 L;  1G2S A;  4HSV A;  2B2W C;  4KMU C;  5JJL A;  1E22 A;  4H02 A;  3UDX A;  2E76 C;  4LFA L;  1QWY A;  3I90 A;  1SJE D;  4FF3 A;  3J81 i;  1UUP A;  2BCO A;  1II3 A;  3P20 A;  3QB3 A;  1A2T A;  5JVH 3;  3HKS A;  4AH6 A;  1BF4 A;  3CPW A;  1Q90 A;  3H94 A;  4QIW B;  1EQQ A;  1SAP A;  3J7A 5;  1FGB D;  1GXD C;  1NCV A;  2B2T A;  3MZ5 A;  1V9P A;  4UP7 A;  2HHH L;  1PRT F;  4A3D H;  2BE5 C;  4XQJ A;  4YY3 L;  1SBB B;  1V8Q A;  5KND A;  4ABN A;  2UXC L;  3M3Y H;  3PIP A;  1B8A A;  3NUC A;  2JA5 G;  2EYF A;  2EY1 A;  2QDB A;  2I0Q A;  2BH8 A;  2QIL A;  1LAB A;  4N8F A;  5CV4 A;  4UP8 A;  4JK1 C;  5IYC H;  5DM6 3;  2VQE Q;  2M2L A;  3E9H A;  1HCZ A;  4OGQ C;  2YTX A;  1CSP A;  2MO1 A;  1QE6 A;  2K75 A;  1C48 A;  1IBL L;  4C3H G;  4LWC A;  1UEB A;  5C0X J;  1N34 L;  1PFS A;  4QQB X;  1OXT A;  1WTR A;  3GTP H;  3HRZ C;  3EBE A;  1LTR D;  2A5H A;  3BZD B;  5IIF A;  1M90 C;  4YWM A;  1NBW A;  1PRT C;  1ZXT A;  2HIV A;  4TSS A;  1Y14 B;  4QGU A;  4KN7 C;  1KAW A;  3BDL A;  1LO5 D;  1QOH A;  3MA2 B;  4HIK A;  4HJ9 A;  5GAG C;  1BO0 A;  4DV5 Q;  3IFD A;  4GOP B;  1BBU A;  3NK9 A;  1WTH A;  3PQI A;  3W2D A;  3NWT A;  5JPM C;  5C4J H;  1JJG A;  4B3T L;  1EY9 A;  3GTJ H;  5J3B A;  4O0A A;  2CCZ A;  4KHZ A;  4MTK A;  2XWJ B;  1V1O A;  3SK4 A;  4DGZ A;  4JBM A;  1BR9 A;  1GUG A;  2Y0S B;  2EPB A;  2JXM B;  2NZH A;  2YTY A;  4UDU C;  3PUY A;  3K7A B;  2E5L L;  3NTI A;  4XT1 B;  1KTK A;  3PSI A;  2YTV A;  3BDO A;  4C56 C;  1W2B A;  1VMC A;  1PRT D;  3VR2 A;  5EKL A;  2CKZ B;  5EBC A;  2HUG A;  2LY7 A;  1NNX A;  1MKH A;  4JI8 Q;  4DAM A;  4L5R C;  3A7L A;  3GTK B;  2I5L X;  2NUC A;  1Q3L A;  2B2T C;  3PMF A;  3BJU A;  5JEA J;  3CAM A;  1TWF H;  3NQI A;  4GLA C;  4CBV A;  4LF9 L;  5BN3 A;  1BCP B;  3QOJ A;  1ENF A;  3IL8 A;  4RMF A;  1STH A;  1HNX L;  5EPJ A;  3EJI A;  2OXP A;  1XNR Q;  1GUS A;  4LF4 L;  2MPM A;  4IZ8 A;  5JJI A;  1CFM A;  4JV5 Q;  1GHJ A;  3PV0 A;  1C8C A;  2ZT9 C;  3SXH A;  2KHI A;  2OTJ A;  1KAB A;  2B2U C;  4IUU A;  1CZG A;  2SNM A;  5COY A;  2MHV A;  2UU9 L;  1LV9 A;  2ZM6 L;  2JK8 A;  4KHP Q;  2R7Z B;  1A6X A;  2HCI A;  2RDG A;  4DV3 L;  1Q8I A;  1AFP A;  1G29 1;  3MFG A;  4RG1 A;  3QO2 A;  3BVZ A;  1OXX K;  1JWS D;  2E2J B;  1EWH A;  4IUT A;  2IX1 A;  3AFP A;  1B3Q A;  4WOR A;  2ICE C;  4OEM B;  4RKL A;  1VQ8 A;  1S5F D;  4HMI A;  1I50 B;  4JI1 Q;  2JJQ A;  1BKB A;  4K6L A;  4C3I B;  3H3V H;  4JI6 L;  1PZK D;  4ZKC B;  4XXE A;  3R8B A;  1BCP F;  3TRZ A;  2CHB D;  1EQR A;  2UUA Q;  3MEF A;  5IYB H;  3S16 H;  1BUV T;  1PZJ D;  3TP6 A;  1PTO H;  4TQU S;  3A8J E;  1N8R C;  2PQA B;  1YHB A;  4F88 A;  3N52 A;  4XTC S;  3F2U A;  5LMN Q;  4X66 L;  1MBY A;  3HOV G;  4E6I A;  3D6C A;  2PI2 A;  5E3F A;  3G6E A;  3BU2 A;  1YJ9 A;  2PZU A;  4OHJ A;  3CU7 A;  4C2M B;  2WP8 J;  4DFA A;  2LXJ A;  3NQT A;  3L9A X;  4RHR A;  1WTX A;  3PO2 B;  5JPN C;  1YEZ A;  1GHK A;  2XNA C;  2JA8 G;  1NJI C;  4UP9 A;  4U67 3;  5KYI A;  4RGN A;  2F0Q A;  3CHB D;  3M7N A;  3HGB A;  1I4X A;  2B63 B;  4XQN A;  2FFK B;  4LFB L;  4A3B B;  4J15 A;  2NZ1 D;  1HZ9 A;  1SNP A;  4LUO A;  1T5X D;  5T1G A;  2OTL A;  3K59 A;  4C3J B;  1J6Q A;  4A3G B;  1W6J A;  2Y0S E;  1JR0 D;  4PMC A;  1PFB A;  1CKN A;  2Q2I A;  1GUT A;  1KDA A;  2CFM A;  3RD4 A;  2NVT B;  2EJM A;  1N33 Q;  4A3M H;  2EQS A;  1JMC A;  1K3B C;  1EOT A;  4P71 A;  3GTK H;  2FJ2 A;  4ULL A;  1JJ2 A;  3OTO Q;  2F0J A;  5I2X A;  1YNN C;  4A76 A;  1BCP D;  1ICF B;  2XRS D;  3BDC A;  1H95 A;  1FYC A;  3CCE A;  1STY A;  4GKK L;  2EE1 A;  4PZ7 A;  3T1H L;  2L9H A;  1E2W A;  2K52 A;  3CCS A;  3ICE A;  2VUM B;  1IBK Q;  4QMG A;  1AZP A;  2JYO A;  2WAQ E;  1PV4 A;  3DHQ A;  1Q12 A;  4ME3 A;  1HNW Q;  1XYI A;  2RA4 A;  1U0L A;  3A54 A;  3HEJ A;  4XQQ A;  5CGK A;  4DXG A;  3J80 L;  4BY1 B;  4BBS B;  1L0W A;  4LMQ D;  4FXG C;  5D3D A;  2NTS A;  5FLX c;  2ENB A;  4QUC A;  2HIX A;  4GZY C;  2LXK A;  1OO9 B;  4OO1 G;  2L1B A;  3MXN B;  3S1Q H;  3K6O A;  3SR1 A;  4L8J A;  1YNN D;  4X64 Q;  1XMO Q;  4YHH Q;  4N9P A;  1W6K A;  4HN7 A;  3GTG B;  3I72 A;  3NTK A;  5J1Z A;  1GD7 A;  3S2D B;  3U4V A;  2JEB I;  1UAP A;  4EQO A;  1EY4 A;  2J0T D;  2MO0 A;  3DMU A;  3PF5 A;  1GM5 A;  1SYD A;  5I2Y A;  4JI3 Q;  1AN8 A;  1E24 A;  1ZKO A;  2JE6 I;  3KDF B;  3I4L A;  5M5W H;  1I50 H;  3KBX A;  2KUM A;  3NPP A;  4C3I H;  3H15 A;  1JQY D;  4NXN L;  1JE4 A;  2K5Q A;  3MAQ A;  3J81 L;  3FKI G;  1LTG D;  1H9R A;  1IL8 A;  2H4O A;  2IHF A;  3OIP A;  3JAM i;  1EY0 A;  3PUW A;  3BZK A;  5F2D A;  2WII B;  3HG9 A;  3I4M B;  4LUZ A;  1QJO A;  1EYC A;  2RQX A;  2A8V A;  4GKJ L;  3S9W A;  1LLR D;  1HPC A;  3GTM H;  4A93 B;  4HID A;  1ILQ A;  4IJH A;  1K8A C;  5D65 A;  2Q8R E;  3A5Z B;  3U9O A;  2Z0S A;  3S1M H;  4KY6 A;  4DR3 L;  4POF A;  1RJT A;  4DV7 L;  2Y0S G;  1ASZ A;  1WYD A;  1HNZ Q;  4UY8 C;  5IGD A;  4X3K A;  2B63 H;  5FJ8 G;  4ZK9 B;  5IE8 A;  3BVM A;  3BZC A;  4DK3 C;  3PIO 3;  1OXU A;  4C3J H;  2C9O A;  3IKJ A;  4ME5 A;  1TS3 A;  3CQZ H;  3MVV A;  2CQA A;  3A8K E;  1FR3 A;  3R2T A;  1I94 Q;  3U9S A;  5IY0 A;  2NVT H;  5JVG 3;  2XRQ D;  1S72 A;  2D62 A;  1VQA A;  1X55 A;  3PF4 A;  3BYT B;  1PH3 A;  1D5Z C;  4B3S Q;  3HKZ E;  2QW7 A;  4DAY B;  5HUR A;  1F9R A;  4DR5 Q;  1NMG A;  1RKN A;  3CCL A;  5I6Y A;  2R92 H;  4A3E G;  1Q1E A;  3KYH C;  1PH2 A;  2I5H A;  3RUZ A;  2DJF C;  4JPB W;  4BBR H;  5L37 A;  5IT9 c;  1C7Y A;  4A3C G;  1O7I A;  2VUM H;  2F0D A;  3F2D A;  1Y8O B;  3A55 A;  4K5V A;  1BDO A;  5IOD A;  1H9J A;  2R7Z G;  1A3V A;  2A6E C;  1AH9 A;  3ND9 A;  4RAU C;  3G71 A;  3C2P A;  4BY1 H;  4BBS H;  2L55 A;  2OQK A;  2L12 A;  1E1O A;  4DR6 Q;  2KHJ A;  4A3F H;  1I6H H;  3K0X A;  4AQY Q;  4DR2 Q;  3GQB A;  3CCU A;  1GO3 E;  1NR4 A;  1IYV A;  5M3F H;  3S2D H;  5I9P A;  4IPH A;  2IL8 A;  4C3I G;  4A3L G;  3ERO A;  3A74 A;  1SYF A;  3FRP B;  1STG A;  3MC0 B;  5CMD A;  2O2L D;  2KOL A;  1O78 A;  3TDQ A;  2VQE L;  4DK1 A;  4KHV A;  1WD1 A;  3HOY H;  3G6J B;  1KQS A;  4FVM A;  1S4Z A;  2K5N A;  2D5D A;  3F8T A;  4I65 A;  1QZH A;  1PH4 A;  1D1K A;  2KEE A;  2MP1 A;  4QUF A;  1G91 A;  5FLX E;  4N8X 1;  3URY A;  1WOC A;  5M5X B;  2JA6 H;  3DXJ C;  1JCK B;  2B2W A;  1KNE A;  3EQL C;  5IGF A;  3I4M H;  4X3U A;  2EYJ A;  3PO2 G;  5CV6 A;  3GTP B;  2OWO A;  1XTD A;  4AYB E;  4GNX A;  1HHV A;  2F0H A;  4K8J A;  2GN5 A;  3CPF A;  1PZI D;  4DK6 C;  2B63 G;  2KHS A;  4P73 A;  4DAP A;  3S24 A;  4A3B G;  4DV5 L;  1XMQ Q;  1EY5 A;  4ZUI A;  2AUJ D;  1N36 Q;  1AE3 A;  2QGQ A;  2Q8T A;  4RGM A;  4U68 A;  4C3J G;  3CCQ A;  4A3G G;  1MGS A;  3OPO A;  2Q2U A;  1Q46 A;  3P7J A;  3H0G B;  2BOS A;  1A8V A;  2V1C C;  1A0I A;  1F77 A;  1Q86 C;  2DN8 A;  3DM1 A;  3KOJ A;  1KIX A;  5C6A A;  3TSS A;  3J81 j;  5C3E H;  4TVA B;  1SYB A;  4JI8 L;  3A0J A;  5BN4 A;  1I3Q H;  3BVG A;  1PYW D;  4UHV A;  4LF8 Q;  1FGU A;  1Z7T A;  4L5Q A;  1SNM A;  3HOX G;  3J7Y W;  1FNW A;  3VR6 A;  1MSH A;  1DCZ A;  1WTO A;  1HUM A;  1GUW A;  1X3F A;  2A1A A;  2DUD A;  4DR4 Q;  1MJC A;  2EYH A;  2N3S A;  1A3U A;  1AW7 A;  3F2C A;  1EQV A;  4HJ8 A;  4B9W A;  4BBS G;  4JV5 L;  2A68 D;  4JVZ A;  1UEA B;  4GN3 B;  3HOW H;  2NBF A;  2L15 A;  3ITP A;  4LJZ C;  1VQ5 A;  1SN8 A;  2PZW A;  4R4I A;  3RLF A;  2DNC A;  3H91 A;  3NEN A;  1CA6 A;  4IFD I;  2UXD Q;  3FP9 A;  4HMJ A;  5IYD G;  2J4X A;  1TY0 A;  4J1M A;  1Y1V B;  4KHP L;  3M85 A;  3PUX A;  2ALY B;  1X32 A;  2XIW A;  1ONL A;  1R4P B;  4PMB A;  1EU3 A;  4YWL A;  3NBH A;  1F2Y A;  2X6L A;  4GNX C;  4RH6 A;  2IX0 A;  1DOL A;  2M9V A;  1A3T A;  5H1S E;  1Q8K A;  3K5N A;  3I2Z A;  2WKD A;  3LNN A;  3M4Y A;  4LUV A;  3TS0 A;  2AQ1 B;  2F4V Q;  5IT9 E;  2KCC A;  1STA A;  3G7L A;  1I4Q A;  3P1H A;  1VQE A;  2WB1 E;  2IY5 B;  1UE1 A;  3ONA B;  2O5J C;  4WFN 3;  2E75 C;  1E1T A;  5A2Q L;  1O7L A;  3DM3 A;  4P74 A;  1S40 A;  3L3O C;  1PFN A;  2UUA L;  3P75 A;  1QVF A;  2QCP X;  4HIO A;  1ZYR C;  1WCM G;  2ICI A;  3G4S A;  3I4M G;  2HQL A;  4O2D A;  1WI5 A;  5LMN L;  2ZXR A;  4P75 A;  1K83 B;  1RTO A;  1EEF D;  4IO9 A;  5M5X H;  3S16 B;  4A93 G;  1VQD A;  3IFT A;  3OHX C;  1F2M A;  4DUZ Q;  1PTO B;  3JC6 6;  4CJ2 C;  2B2U A;  3G48 A;  5C0X I;  5CR3 A;  1EYG A;  1EIF A;  1HJP A;  4DUY Q;  2EOT A;  2MUY A;  3V96 A;  1IKM A;  1Y8N B;  2NZO A;  1UE6 A;  1DD2 A;  1H9S B;  4YIJ A;  4EGV A;  2F0P A;  3W5O A;  1SXT A;  1DM0 B;  1EZ8 A;  5CV8 A;  4BS9 A;  3S14 H;  3SVM A;  1D7Q A;  2QA4 A;  2LKV A;  1JOQ A;  3MXG A;  1CTM A;  1ZYR D;  3FMC A;  1SR3 A;  1GVP A;  3H0G H;  4PQX A;  2D9U A;  3JAM L;  1VQ9 A;  4CJ1 B;  5C4X B;  1I4P A;  3OMG A;  3A7A B;  3K5M A;  1GJX A;  2RSO A;  1N33 L;  4GOP A;  2F0T A;  2K4K A;  4LW1 A;  1IBM Q;  2NVX B;  2K33 A;  5EPL A;  2RHS B;  2Z8L A;  5EJW A;  4TRD A;  1IW7 D;  2DY7 A;  3SDZ A;  1JIC A;  4QJF A;  4A3K B;  3OTO L;  4AIM A;  5JJK A;  4A3M B;  4H0L C;  1F2Z A;  4QF4 A;  1M1K C;  3CKI B;  2HT1 A;  2K03 A;  1AE2 A;  4MNO A;  4PZ8 A;  1PTO F;  3ULJ A;  3CCJ A;  3BYY B;  1IBK L;  1AZQ A;  5K36 H;  2EY6 A;  4PMW A;  1ML0 D;  1QB5 D;  4NP5 A;  2G5D A;  3PCO B;  4IUV A;  4JI5 Q;  1BXT A;  1CT1 D;  4CDF C;  1HNW L;  3J80 c;  5T1I A;  2UUB L;  4IOC A;  1EYA A;  2WAQ B;  3Q23 A;  1ILP A;  4I7Z C;  1EU4 A;  3M7G A;  4P2C B;  1CKO A;  1Y1V H;  2ZJR A;  1CM9 A;  4IPD A;  2VNU D;  1HRJ A;  4X64 L;  4KK7 A;  1XMO L;  1KC8 C;  2KEC A;  5I9O A;  2PZT A;  4K5W A;  4OON A;  4YHH L;  1N32 Q;  3T1Y Q;  2BDO A;  1I5F A;  4JI0 Q;  2D2C C;  2A74 C;  1XPR A;  3S1Q B;  4A3D G;  2SOB A;  2XVS A;  1PTO C;  3KBG A;  3W1B A;  4JCV E;  4JI3 L;  2WFW A;  1KL9 A;  2NN6 H;  1XXG A;  2R93 B;  2X6G A;  1YIT A;  1FJG Q;  2EY5 A;  1B50 A;  1K0R A;  4KJO A;  5IYC G;  3J81 c;  2N55 A;  1D5X C;  1RD9 D;  1EFI D;  2EXD A;  1NE3 A;  2VXW A;  3CW2 C;  3KFU A;  5M5Y H;  2NTT A;  4ALP A;  1NR2 A;  1NMF A;  2FMC A;  1K73 C;  5M5W B;  3NBI A;  1B44 D;  2K5W A;  2AHO B;  2R61 A;  3GTO H;  4R4C A;  4GOP C;  3KF8 B;  3VR4 A;  1B4O A;  3DLL A;  2JA7 H;  1K83 H;  2ID0 A;  1SNO A;  1X6O A;  1I4H A;  2JSO A;  4ILW A;  1EIY B;  5M3M H;  1PTO D;  1YVC A;  2K28 A;  4OIJ A;  5COR A;  5E4W C;  2KEN A;  4IPC A;  4DF7 A;  2MJ8 A;  2VS1 A;  2K01 A;  1LTL A;  2VZA A;  2IWH A;  5GAE C;  1J5E Q;  3R2I A;  2Z1C A;  3CC2 A;  5GAH C;  3PO3 B;  4LF5 Q;  2ATW A;  2PNR C;  2L0C A;  5GQO A;  1HNZ L;  3STB C;  3GTM B;  2PQA A;  1Y1W B;  4JI2 Q;  3LWE A;  5EBD A;  3TZU A;  4FXK C;  2F0E A;  2O5I C;  2ES2 A;  3S1M B;  1IKL A;  4JI7 Q;  3GV3 A;  3OW7 A;  5IP7 H;  3I56 A;  1HXY D;  3T53 B;  5C4X H;  5IP9 H;  1UE5 A;  1BCP C;  1TVX A;  1Z47 A;  3K7U C;  5AJ3 Q;  5ELO A;  4XYQ A;  3WWV A;  1VDZ A; 
#chains in the Genus database with same CATH homology
 3D4W A;  3MTS A;  3E0J A;  4DNR B;  3CQZ B;  5FO8 B;  4FYD A;  4K2L A;  3X3M A;  3H09 A;  4Q5V A;  2LFN A;  3HKZ B;  1JOR A;  3NSW A;  4BY7 B;  5D3I B;  2R92 B;  2SEB D;  4TKO B;  4EVO A;  4DNT B;  3TP5 A;  2G9H D;  3WOF A;  4BBR B;  1B2T A;  3OIQ A;  2F0F A;  1EY6 A;  1CA5 A;  2XN9 C;  3QG1 A;  4KKS A;  3IAY A;  3SHL A;  4RGO S;  3KLS A;  2F03 A;  1KLU D;  4KKU A;  4K2K A;  2C5C A;  2JP1 A;  2EYP A;  1B53 A;  2KED A;  2NN6 G;  1QCB D;  1SE2 A;  2H1E A;  4A3F B;  1I6H B;  2RVL A;  4XYO A;  5M3F B;  1SDF A;  4OIK A;  3I73 A;  3FEW X;  3MXN A;  2QEJ C;  3J80 E;  2EJG C;  4S3S A;  3T16 A;  5C0X H;  4CKC A;  3HOY B;  1VF7 A;  1Y8P B;  4A3J B;  2KQ3 A;  1A15 A;  1XWE A;  1LT3 D;  1RCV D;  2M00 A;  1SMY D;  1EEI D;  3Q6S A;  1PFM A;  2JA6 B;  2KCN A;  3O13 A;  2HCC A;  4AYB B;  5IGE A;  4EQP A;  3I4N B;  3SK5 A;  3QWN A;  1C4Q A;  2WIN B;  3J81 E;  4IQZ A;  2JA5 B;  2RKS A;  1E2Z A;  2NVY B;  3D8G A;  1EZ6 A;  5A35 A;  5IOC A;  3EVQ A;  3D4R A;  2DNE A;  4ZUJ A;  3HOZ B;  2IT1 A;  1HA5 A;  4J8Q A;  5HGT A;  4MN3 A;  2A69 D;  4FO2 A;  1VCI A;  5C3E B;  3SK8 A;  5JEA H;  3GP7 A;  2A6H D;  2EY2 A;  1HFG A;  1I3Q B;  1OXV A;  1OXS C;  4FXD A;  4RGT A;  1TKW B;  1WTV A;  3I3C A;  4DK0 A;  3N6R A;  1IHZ A;  1EY8 A;  5EGT A;  1DON A;  5CYU A;  3KLR A;  4HCS A;  4F8M A;  2VB2 X;  2VB3 X;  5LL6 S;  3HOW B;  2Z4H A;  4KY7 A;  3BS1 A;  2IPK D;  1VF5 C;  4X3T A;  4EQN A;  4DA2 A;  2L4N A;  4ODG A;  5AFW A;  1SYC A;  1U9R A;  5JAV A;  3CRL C;  2HQE A;  3Q22 A;  2BA0 A;  5LHY 1;  4FNF A;  3D31 A;  3FPP A;  2TMP A;  2F0W A;  1ESF A;  2YYZ A;  3C1E A;  4NW2 A;  3TBI B;  2PYK A;  2RDF A;  1V1P B;  4BA2 I;  2SDF A;  4HTH A;  2E2D C;  4FF1 A;  2PCF B;  1SND A;  2WB1 B;  1TS4 A;  1AEX A;  3EA6 A;  3PIP 3;  3OSO A;  1F9S A;  4L63 B;  1DXM A;  3T13 A;  4F87 A;  2B39 A;  2GA4 B;  4PV1 C;  5ELB A;  3WDN A;  2AWN A;  4KV6 A;  4CKE A;  1G6Z A;  2KJX A;  1STN A;  5KGU A;  4OO1 I;  1PXU A;  1SSO A;  1QG7 A;  3S14 B;  5FO9 B;  1ROD A;  5DM7 3;  1D6E C;  1JOO A;  3NE5 B;  1TT2 A;  4IUQ A;  4K14 A;  5C4H A;  1XX8 A;  3R93 A;  5IGC A;  3X3N A;  1GOZ A;  4V0B A;  2XWB B;  2K6A A;  2F0L A;  3ZYY X;  2A68 C;  4H44 C;  4CKB A;  3VYT A;  3E5S A;  3SE0 A;  3DEP A;  5CV7 A;  5G3L D;  4A3I B;  4F7X A;  4UAI A;  3GO5 A;  3E6Z X;  1BBX C;  2K7V A;  4G4K A;  4ID6 A;  4OL7 A;  2JA8 B;  4KY5 A;  1DOK A;  3VR3 A;  1RF2 D;  1SNQ A;  1HA6 A;  2EYO A;  3W3A A;  5KEE A;  1RHP A;  1WTQ A;  4ZQ3 A;  2DY8 A;  1S5E D;  3Q0A A;  4HCE A;  2A73 B;  2PO4 A;  1H9K A;  1LAC A;  2FMM A;  1BQQ T;  1ET6 A;  5CBE E;  3C3L A;  3EFX D;  4CJ0 B;  1TWH B;  1F2L A;  4JBW A;  2OT2 A;  1CI3 M;  2OF1 A;  1CZW A;  2G9D A;  1YNJ D;  2B8G A;  1SE4 A;  3HZX A;  4IUN A;  4BA1 I;  4G57 A;  1U4L A;  1EL0 A;  5I4D A;  4R8I A;  2L5T A;  1B3A A;  4V19 0;  4RHS A;  5M5Y B;  1JWU D;  1CHQ D;  4RFB A;  3GTO B;  2B2V A;  1NUC A;  3DEO A;  3M4O B;  1S5D D;  3SK6 A;  1DZ1 A;  3TN2 A;  4RKB A;  2JA7 B;  2NVQ B;  5KNC A;  3MWY W;  5M3M B;  4RCN A;  1S5B D;  2X69 A;  1TQO A;  5A2Q E;  2WAC A;  5KNB A;  1IW7 C;  5ELC A;  1I4R A;  3AU7 A;  2F1M A;  2F0K A;  1FNU A;  4QCL A;  2HDL A;  1RDP D;  2NB0 A;  5CBA E;  1H9S A;  3KK7 A;  3FKI B;  2BE5 D;  4HR7 B;  1ESR A;  2AQ2 B;  3ND8 A;  1TS2 A;  1GUN A;  2OEO A;  3C46 A;  1KNA A;  1LTB D;  4MIU A;  1FNV A;  3NP8 A;  3OOC A;  1A2U A;  4DXF A;  2IW3 A;  3MHB A;  5C3W A;  3GTQ B;  2J7Z A;  1EQT A;  5C44 B;  3JAM E;  2F3W A;  2F3V A;  1LTT D;  3I8Z A;  4IN3 A;  3H6M A;  4LK1 C;  5ELE A;  4L6T B;  4N9T A;  4KI0 A;  5CV5 A;  1SE3 A;  1UNS A;  3V2T A;  1AP0 A;  2F0N A;  1G2T A;  4O1N A;  2BA1 A;  5FK9 C;  1KLG D;  2B2V C;  1SJH D;  2RSN A;  3DUZ A;  4B9X A;  2XSC A;  3ERQ A;  1RTN A;  1JOK A;  2RBM A;  1HTL D;  2NWG A;  1SFO B;  3H3V C;  3PUV A;  2AQ3 B;  1TWA B;  2F4I A;  3T4A C;  5FOB B;  2L11 A;  1B1Z A;  3DWA A;  2EXZ A;  1F9Q A;  3QJY A;  3OWE B;  4BWG B;  2K04 A;  4Z9C B;  2EDG A;  2MGS A;  4A3E B;  1O7Y A;  4QB4 A;  3I70 A;  1JB3 A;  2K05 A;  1STB A;  3AMU A;  5J39 A;  4NMZ A;  1K8M A;  2F0M A;  3VA5 A;  1VMP A;  1TII D;  3D3R A;  1Q1B A;  3MXP A;  1CHP D;  5EKI A;  4HED A;  1HQR D;  4C1N I;  3TME A;  3S15 B;  5C4Z A;  4FF2 A;  2F0S A;  4ZKB B;  1B9M A;  3FDT A;  2K32 A;  3UI2 A;  4OO1 H;  1R9T B;  4K8I A;  2YU9 B;  4M1U B;  4R9W A;  1I6V C;  3K58 A;  1D1I A;  3KF8 A;  1NSN S;  4HSP A;  2EJF C;  5KRU A;  2RDH A;  3A8I E;  5E1F A;  3TZD A;  1CQV A;  1M8A A;  2KVM A;  1TWC B;  5ELD A;  5JOB A;  5J22 A;  1KAA A;  3TP8 A;  3Q24 A;  3HOU B;  1QNK A;  5I6W A;  3VYU A;  1SYE A;  1D2B A;  4O42 A;  4J6H A;  2E74 C;  4FF4 A;  3KLS X;  1LTI D;  3J7A V;  2PQE A;  5D14 A;  4DAV A;  1J8I A;  1U4R A;  5K36 G;  4WRD A;  5IGG A;  2LMC B;  4IFD H;  4B08 A;  1LTA D;  2HDM A;  2V4D A;  1E2V A;  5DEH A;  3T51 B;  2PW5 A;  4CHT B;  2E2H B;  5FKA C;  1TWG B;  1NAP A;  5KIX A;  4XT3 B;  4WJW A;  4RWS C;  2CW0 C;  3RZD B;  1Z6H A;  2PPB C;  4R8N A;  3HOX B;  1SEB D;  3C1F A;  1V43 A;  3FPU B;  4M8A A;  1K8O A;  1DOM A;  4KD4 A;  3K5L A;  4IAL A;  1ICW A;  2EYL A;  1SMY C;  4HAE A;  1HTP A;  1O7Z A;  4G7H C;  3HS0 C;  5LL6 X;  1KDB A;  3MFY A;  2QKI C;  1LTS D;  3AB9 A;  2JEA I;  4G7O C;  1ENA A;  2Z4I A;  1WD0 A;  4Y7N B;  2CW0 D;  1EWC A;  5EKK A;  1SYG A;  2PW7 A;  2WKC A;  1STE A;  2FHT A;  4XIG S;  3OWF A;  4NKL A;  1T5E A;  1CK1 A;  3D4D A;  1HFN A;  3VA7 A;  4G7Z C;  1PMR A;  3NHH A;  3MEH A;  2B8F A;  4KJN A;  5KYL A;  2R6G A;  4K6D A;  2A69 C;  3S1N B;  3VR5 A;  2QF7 A;  2A6H C;  3FVQ A;  3QOL A;  1ET9 A;  3LWU A;  5CV9 A;  2KA7 A;  4ZLT F;  4MHE A;  2O4X A;  2Q8I B;  4ZAI A;  2F0O A;  2AUK A;  2SNS A;  1TS5 A;  1MD2 D;  2ZXP A;  5TSS A;  1WCM B;  3S17 B;  3BG3 A;  2F0I A;  1LT6 D;  4C3H B;  1WTP A;  1ZEQ X;  1FD7 D;  1TY2 A;  1HQM C;  3L7Z C;  1X3Q A;  5M9O A;  1Y69 U;  4IFD G;  1U4P A;  3D6W A;  5BN5 A;  1X3P A;  5C5L A;  2FIN B;  4KD3 A;  1PDQ A;  1DYQ A;  3NXW A;  3V05 A;  4IUR A;  2B2Y A;  1EYD A;  2F0U A;  3GTL B;  4DAY A;  1SNC A;  2AWO A;  4C1N K;  1WTW A;  3PUZ A;  3VYS A;  5ELF A;  1QIL A;  3LX0 A;  4H13 C;  3K0Y A;  5K5P A;  3J7A F;  2WV6 D;  3S2H B;  1D5M C;  5DNF A;  1G8Z D;  2F0V A;  5JJZ A;  5C5M A;  1M4V A;  1GUO A;  1LT5 D;  1IYU A;  5C0X G;  3NWS A;  1E0B A;  4Q0F A;  5C3X A;  4PNY A;  5G3L F;  2EYM A;  1BNZ A;  2EVB A;  3DWQ A;  4RCO A;  4DU9 A;  1V1P A;  1PLF A;  2ZXO A;  1ENC A;  2E2I B;  1L0Y B;  1KDC A;  1JWM D;  4KKT A;  2R3Z A;  4KTA A;  5FLX L;  5FO7 B;  4CGY B;  1TR5 A;  3HP3 A;  4LAA A;  3SEB A;  5CC4 A;  1HUN A;  4A3D B;  4FP5 D;  1JC7 A;  2A6E D;  3M3Y B;  3NTH A;  3VYR A;  1H9M A;  3K5O A;  1EIH A;  2NN6 I;  4ZYS A;  2NYZ D;  2B2Y C;  5DAU A;  5EQ0 A;  1S5C D;  1XTC D;  1CQF A;  4ZRZ A;  4KN4 C;  4K5X A;  5IGB A;  5JEA G;  2I07 B;  3T56 B;  3DWP A;  2IX3 A;  3RMH A;  1J9O A;  1L0X B;  4RA8 A;  3A56 A;  4XDX A;  3HOV B;  2BDN A;  2CVR A;  1MI2 A;  3QIA A;  5C4J B;  3R3O A;  5ISR A;  3MXU A;  3GTJ B;  1I4G A;  2N88 A;  4NDX A;  4DN4 M;  2EZV A;  3CRK C;  1EY7 A;  2TSS A;  1O80 A;  3WOE A;  1DJR D;  2IJ0 A;  1F9P A;  5EPK A;  1YNJ C;  3K57 A;  1PRT B;  1BOS A;  3RZO B;  3I91 A;  1WVL A;  5NUC A;  2K5D A;  3OMC A;  3KUP A;  1U4M A;  1QNU A;  4IUP A;  3TP7 A;  1TWF B;  4X3S A;  4H7B A;  2K1B A;  1MSG A;  1EIG A;  1TU2 B;  1R4Q B;  3GD7 A;  1B9N A;  3GV6 A;  2PMZ B;  4IFD J;  3S1R B;  2F0G A;  1LT4 D;  2I46 A;  2LS0 1;  5IT9 L;  1G2S A;  4HSV A;  2B2W C;  4KMU C;  2E76 C;  1QWY A;  3I90 A;  1SJE D;  4FF3 A;  1UUP A;  2BCO A;  1II3 A;  3P20 A;  3QB3 A;  1A2T A;  5JVH 3;  1BF4 A;  1Q90 A;  3H94 A;  4QIW B;  1SAP A;  1FGB D;  1GXD C;  1NCV A;  2B2T A;  3MZ5 A;  1PRT F;  2BE5 C;  4XQJ A;  1SBB B;  1V8Q A;  5KND A;  4ABN A;  3NUC A;  2EYF A;  2EY1 A;  2QDB A;  2QIL A;  1LAB A;  5CV4 A;  4JK1 C;  5DM6 3;  2M2L A;  1HCZ A;  4OGQ C;  1QE6 A;  1C48 A;  4C3H G;  5C0X J;  1OXT A;  1WTR A;  3HRZ C;  1LTR D;  2A5H A;  3BZD B;  5IIF A;  1PRT C;  1ZXT A;  4TSS A;  4KN7 C;  3BDL A;  1LO5 D;  1QOH A;  3MA2 B;  1BO0 A;  3IFD A;  3NK9 A;  3W2D A;  3NWT A;  5JPM C;  1EY9 A;  4KHZ A;  2XWJ B;  1V1O A;  3SK4 A;  4DGZ A;  1BR9 A;  1GUG A;  2Y0S B;  2EPB A;  2JXM B;  4UDU C;  3PUY A;  3K7A B;  3NTI A;  4XT1 B;  1KTK A;  3BDO A;  4C56 C;  1VMC A;  1PRT D;  3VR2 A;  5EKL A;  5EBC A;  2HUG A;  2LY7 A;  3A7L A;  3GTK B;  2NUC A;  1Q3L A;  2B2T C;  3PMF A;  5JEA J;  3NQI A;  4CBV A;  5BN3 A;  1BCP B;  3QOJ A;  1ENF A;  3IL8 A;  1STH A;  5EPJ A;  3EJI A;  2OXP A;  1GUS A;  2MPM A;  4IZ8 A;  1CFM A;  1GHJ A;  3PV0 A;  1C8C A;  2ZT9 C;  3SXH A;  1KAB A;  2B2U C;  4IUU A;  1CZG A;  2SNM A;  5COY A;  2MHV A;  1LV9 A;  2R7Z B;  1A6X A;  2HCI A;  2RDG A;  1Q8I A;  1AFP A;  1G29 1;  3MFG A;  3QO2 A;  3BVZ A;  1OXX K;  1JWS D;  2E2J B;  1EWH A;  4IUT A;  2IX1 A;  4WOR A;  2ICE C;  4RKL A;  1S5F D;  4HMI A;  1I50 B;  4K6L A;  4C3I B;  1PZK D;  4ZKC B;  4XXE A;  3R8B A;  1BCP F;  2CHB D;  1BUV T;  1PZJ D;  3TP6 A;  1PTO H;  4TQU S;  3A8J E;  4F88 A;  3N52 A;  4XTC S;  3F2U A;  1MBY A;  4E6I A;  3D6C A;  5E3F A;  2PZU A;  4OHJ A;  3CU7 A;  4C2M B;  2WP8 J;  4DFA A;  3NQT A;  3L9A X;  4RHR A;  1WTX A;  3PO2 B;  5JPN C;  1GHK A;  2XNA C;  4U67 3;  5KYI A;  4RGN A;  2F0Q A;  3CHB D;  3M7N A;  3HGB A;  1I4X A;  2B63 B;  4XQN A;  2FFK B;  4A3B B;  2NZ1 D;  1SNP A;  1T5X D;  5T1G A;  3K59 A;  4C3J B;  4A3G B;  1W6J A;  1JR0 D;  4PMC A;  1PFB A;  1GUT A;  1KDA A;  2NVT B;  3RD4 A;  2EJM A;  1EOT A;  2FJ2 A;  4ULL A;  2F0J A;  5I2X A;  1YNN C;  1BCP D;  2XRS D;  3BDC A;  1FYC A;  1STY A;  2EE1 A;  2L9H A;  1E2W A;  2VUM B;  4QMG A;  1AZP A;  2JYO A;  3DHQ A;  1Q12 A;  1XYI A;  2RA4 A;  3A54 A;  3HEJ A;  4XQQ A;  5CGK A;  4DXG A;  3J80 L;  4BY1 B;  4BBS B;  4LMQ D;  4FXG C;  5D3D A;  2NTS A;  2ENB A;  4QUC A;  4GZY C;  1OO9 B;  4OO1 G;  2L1B A;  3K6O A;  3SR1 A;  4L8J A;  1YNN D;  4N9P A;  1W6K A;  4HN7 A;  3GTG B;  3I72 A;  3NTK A;  5J1Z A;  3S2D B;  2JEB I;  1UAP A;  4EQO A;  1EY4 A;  2J0T D;  3DMU A;  5I2Y A;  1SYD A;  1AN8 A;  1ZKO A;  2JE6 I;  3I4L A;  3KBX A;  2KUM A;  3NPP A;  1JQY D;  1JE4 A;  2K5Q A;  3MAQ A;  3J81 L;  1LTG D;  1H9R A;  1IL8 A;  2H4O A;  3OIP A;  1EY0 A;  3PUW A;  5F2D A;  2WII B;  3HG9 A;  3I4M B;  1QJO A;  1EYC A;  2RQX A;  3S9W A;  1LLR D;  1HPC A;  4A93 B;  1ILQ A;  5D65 A;  2Q8R E;  3U9O A;  4KY6 A;  1RJT A;  5IGD A;  4X3K A;  4ZK9 B;  3BVM A;  3PIO 3;  1OXU A;  2C9O A;  3IKJ A;  4ME5 A;  1TS3 A;  3MVV A;  2CQA A;  3A8K E;  1FR3 A;  3R2T A;  3U9S A;  5JVG 3;  2XRQ D;  2D62 A;  3BYT B;  1D5Z C;  5HUR A;  1F9R A;  1RKN A;  5I6Y A;  1Q1E A;  3RUZ A;  2F0D A;  1Y8O B;  3A55 A;  4K5V A;  1BDO A;  5IOD A;  1H9J A;  1A3V A;  2A6E C;  3ND9 A;  4RAU C;  3C2P A;  2L55 A;  2L12 A;  3GQB A;  1NR4 A;  1IYV A;  5I9P A;  2IL8 A;  4C3I G;  3ERO A;  1SYF A;  3FRP B;  1STG A;  3MC0 B;  5CMD A;  2O2L D;  2KOL A;  1O78 A;  3TDQ A;  4DK1 A;  4KHV A;  1WD1 A;  3G6J B;  4FVM A;  1S4Z A;  2D5D A;  4I65 A;  1D1K A;  1VDZ A;  2KEE A;  2MP1 A;  4QUF A;  1G91 A;  5FLX E;  3URY A;  5M5X B;  3DXJ C;  1JCK B;  2B2W A;  1KNE A;  3EQL C;  5IGF A;  4X3U A;  2EYJ A;  5CV6 A;  3GTP B;  1HHV A;  2F0H A;  4K8J A;  1PZI D;  2KHS A;  4DAP A;  1EY5 A;  4ZUI A;  2AUJ D;  2Q8T A;  4RGM A;  4U68 A;  4C3J G;  1MGS A;  3OPO A;  3P7J A;  3H0G B;  2BOS A;  1F77 A;  2DN8 A;  3DM1 A;  5C6A A;  3TSS A;  1SYB A;  5BN4 A;  3BVG A;  1PYW D;  1Z7T A;  1SNM A;  3J7Y W;  1FNW A;  3VR6 A;  1MSH A;  1DCZ A;  1WTO A;  1HUM A;  1GUW A;  2EYH A;  1A3U A;  1AW7 A;  1EQV A;  4B9W A;  2A68 D;  1UEA B;  2NBF A;  3ITP A;  4LJZ C;  2PZW A;  3RLF A;  2DNC A;  3H91 A;  4IFD I;  1CA6 A;  4HMJ A;  2J4X A;  1TY0 A;  4J1M A;  1Y1V B;  3M85 A;  3PUX A;  1X32 A;  2XIW A;  1ONL A;  1R4P B;  4PMB A;  1EU3 A;  3NBH A;  1F2Y A;  2X6L A;  4RH6 A;  2IX0 A;  1DOL A;  2M9V A;  1A3T A;  3K5N A;  2WKD A;  3LNN A;  3M4Y A;  2AQ1 B;  5IT9 E;  2KCC A;  1STA A;  3G7L A;  1I4Q A;  3P1H A;  3ONA B;  2O5J C;  4WFN 3;  2E75 C;  5A2Q L;  1O7L A;  3L3O C;  1PFN A;  3P75 A;  2QCP X;  1ZYR C;  2ICI A;  2ZXR A;  1K83 B;  1RTO A;  1EEF D;  3S16 B;  3IFT A;  3OHX C;  1F2M A;  1PTO B;  4CJ2 C;  2B2U A;  5C0X I;  5CR3 A;  2EOT A;  2MUY A;  3V96 A;  1IKM A;  1Y8N B;  1DD2 A;  1H9S B;  4YIJ A;  4EGV A;  2F0P A;  1SXT A;  1DM0 B;  1EZ8 A;  5CV8 A;  4BS9 A;  3SVM A;  2LKV A;  1JOQ A;  3MXG A;  1CTM A;  1ZYR D;  3FMC A;  4PQX A;  2D9U A;  3JAM L;  4CJ1 B;  5C4X B;  1I4P A;  3OMG A;  3A7A B;  3K5M A;  1GJX A;  2RSO A;  2F0T A;  2NVX B;  2K33 A;  5EPL A;  2Z8L A;  5EJW A;  4TRD A;  1IW7 D;  2DY7 A;  3SDZ A;  1JIC A;  4A3K B;  4A3M B;  4H0L C;  1F2Z A;  4QF4 A;  3CKI B;  2K03 A;  1PTO F;  3BYY B;  1AZQ A;  5K36 H;  2EY6 A;  4PMW A;  1ML0 D;  1QB5 D;  4NP5 A;  4IUV A;  1BXT A;  1CT1 D;  5T1I A;  1EYA A;  2WAQ B;  3Q23 A;  1ILP A;  4I7Z C;  1EU4 A;  3M7G A;  4P2C B;  1CM9 A;  2VNU D;  1HRJ A;  4KK7 A;  5I9O A;  2KEC A;  2PZT A;  4K5W A;  2BDO A;  2D2C C;  2A74 C;  3S1Q B;  2SOB A;  2XVS A;  1PTO C;  3KBG A;  2NN6 H;  1XXG A;  2R93 B;  2X6G A;  2EY5 A;  1B50 A;  4KJO A;  2N55 A;  1D5X C;  1RD9 D;  1EFI D;  2VXW A;  2NTT A;  1NR2 A;  2FMC A;  5M5W B;  3NBI A;  1B44 D;  2K5W A;  2R61 A;  3VR4 A;  1B4O A;  2ID0 A;  1SNO A;  1I4H A;  2JSO A;  4ILW A;  1PTO D;  2K28 A;  4OIJ A;  5COR A;  5E4W C;  4DF7 A;  2MJ8 A;  2K01 A;  2IWH A;  3R2I A;  2Z1C A;  3PO3 B;  2PNR C;  2L0C A;  3GTM B;  1Y1W B;  3LWE A;  5EBD A;  3TZU A;  4FXK C;  2F0E A;  2O5I C;  3S1M B;  1IKL A;  3GV3 A;  3OW7 A;  1HXY D;  3T53 B;  1BCP C;  1TVX A;  1Z47 A;  4XYQ A;  5E4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...