4ZRZA

Plycb mutant r66e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
NVSGVQGFLFHTDGKESYGYRAFINGVEIGIKDIETVQGFQQIIPSINISKSDVEAIEKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein, viral protein
molecule keywords PlyCB
publication title A bacteriophage endolysin that eliminates intracellular streptococci.
pubmed doi rcsb
source organism Streptococcus phage c1
total genus 15
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.850 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zrzA00
4F87A 4ZRZA 4F88A
chains in the Genus database with same CATH superfamily
1HR0L 3J80E 4ZYSA 4JI2Q 4BBRB 2XTIA 4RCOA 5EPLA 1SSOA 2RBMA 5I6YA 1AFPA 5IT9c 1ZKOA 4GN4B 3A54A 2R7ZB 2N78A 5JJZA 2HHHQ 5J1ZA 1SYGA 3LX0A 1OO9B 4JK1C 3K57A 3H94A 1S5ED 3K5OA 3M4OB 4G4KA 2F0HA 3STBD 1XMOQ 2B3GA 2VUMB 3TEHB 4AIMA 1H95A 2UUBQ 1PV4A 2K04A 5C4JB 4JW0A 3NHHA 5IP9H 1VQFA 4RG1A 1VQEA 4IPCA 5C4XG 5KIXA 4EQPA 2I5HA 4HJAA 1S3OA 1SMXA 4JVZA 3SHLA 1IBLL 5C4HA 3PO2H 1IYUA 1CTMA 1WTPA 2ZJQA 4I7ZC 1D5ZC 1NMGA 5CYUA 1Y1VB 1EFID 1JC7A 3MXGA 4GKKQ 3J81i 4Y52H 5CMDA 1VQOA 1PZKD 4HEDA 1FGBD 1TVXA 5C3EG 3QWNA 4OIKA 2K33A 3I55A 4O42A 4G7OC 1JB7A 3MVVA 1SEBD 1JWMD 4PMWA 4DAVA 1KAWA 2RVLA 4IUPA 2E5LL 1N8RC 4IOAA 1K3BC 1VQKA 4OO1H 4NP5A 3T1HL 2BA0A 4B3RL 2CCZA 3DWPA 2K5WA 2J4XA 2R6GA 2I0QA 1PFNA 2IWHA 4C3IB 4A3MG 3PO3G 1AZQA 2AWNA 1EYDA 2FMCA 3PCOB 1B8AA 4DV4L 1EWCA 2NVXH 4UY8C 5CR3A 3NSWA 2DJGC 1N36Q 3A5ZB 4H0LC 4MIUA 1S4ZA 3FKIB 1HNXQ 1CKNA 1AN8A 4IFDG 1SBBB 4KTAA 3F2DA 2VQFQ 1K8GA 5LMNQ 4A3EG 4F88A 1YITA 1EIHA 1MGSA 3RZDH 2LXKA 1F2LA 4A93B 4KJNA 1K9MC 2HDMA 1TU2B 5D3DA 2QF7A 1TQOA 5M5XH 2NVTH 2MJ8A 2MO1A 4IN3A 3EVQA 5D65A 3VA5A 1GD7A 1SMYD 1DM0B 1HFNA 1EEFD 5JJKA 1EY9A 1PZID 4PMBA 3VR4A 4WFN3 3JAME 3UDGA 5FLXc 3S14B 2A6HD 2VL6A 1C9OA 3TP6A 4DR1Q 3P7JA 3VDYA 1SN8A 2F3VA 5FLMG 2KQ3A 1VQCA 3A74A 5IWAQ 5CV5A 4DKAC 1I5FA 5ELFA 4A3DH 4DAMA 3VYRA 3GQBA 2CW0D 1F9PA 2ATWA 2UUAQ 4HCEA 1QNKA 1QOHA 5IT9E 1W3SA 5FO7B 4IJLA 3HOXB 3NE5B 5IYBG 4O1NA 4LW1A 3F2BA 3TRZA 4JV5Q 2RA4A 2XWJB 4JCVE 3VYUA 2PPBC 5EGTA 5GADC 2QCPX 3OMGA 4V190 1EY7A 1JICA 4RGOS 4BY7B 2BH2A 4BBSB 3KFUA 3GTPB 1CQVA 2B8GA 1WCMG 1ICWA 1QB5D 3GTGB 1HHVA 1O7LA 2PQAB 1VMCA 3H15A 4K8JA 1PMRA 2L12A 3OW2A 2BA1A 2RSOA 2LY7A 1LACA 5KRUA 4DR6L 3I3CA 1BBXC 2I07B 3S16H 4Y7NB 1VQ6A 3NTIA 1B3QA 4KKTA 1YNXA 4JI1L 4ZKBB 4JYAL 5CBEE 1UWVA 1CKNB 3C3LA 2JA7B 2LMCB 5KNDA 1HTPA 3K81C 2NZ1D 1YHQA 1E24A 4KLKA 2IX1A 5JPMC 5KNBA 3NBIA 5EAYA 4DV1L 2DUDA 5H1SE 1SJHD 3I90A 5M3MG 4KD3A 5F2DA 1CHQD 1TWAH 1U4PA 5CBAE 4OWTB 1VQGA 2WINB 2LXJA 4DV0L 5M3FG 2IJ0A 1SNOA 1A2TA 1OXXK 2L0CA 2WV6D 3CPFA 1LTBD 1B53A 1Z9FA 1SXTA 3A0JA 3SR1A 1HQRD 1TY2A 2F0LA 4OHJA 2K52A 2F0SA 3HOZB 4K5XA 5IYCG 4J1MA 4BBRH 4F7XA 1W2BA 4DGZA 1BBUA 2C9OA 3E9HA 3G6EA 1GHJA 4RWSC 3IL8A 5DLQE 1SJED 1CT1D 5BN3A 1PH7A 4L5TA 4A3IG 1GUNA 2KCTA 2IPKD 5E7NA 4LAAA 4OWWB 4R4QA 3K5LA 3M4OH 2A6EC 5C0XG 1T9HA 2VUMH 5HY6A 1HUNA 4HJ8A 2K5QA 1X9NA 2LS01 1TIID 5C4JH 2FFKB 1YNND 4NXMQ 3M4QA 4XQNA 2KEEA 5CGKA 1VCIA 1WYDA 3AQQA 4UP8A 3NENA 4LF7L 4DK3C 2BDNA 1I4PA 4DAYA 4C2MB 1UAPA 2N88A 1E2WA 1A62A 2IY5B 1Y1VH 1PDQA 1S5DD 4R8IA 2UU9Q 1I4HA 3ZYYX 1CA6A 1QVGA 3M4PA 3UDFA 1LT3D 4OIJA 5IGCA 4K14A 3R8BA 1TT2A 5J3BA 4KY6A 4POGA 2EDGA 3T53B 3BYYB 1IBKL 1L2FA 3I73A 2XGTA 5M5YB 4ME3A 1I6HH 4ZUIA 3MFYA 4X3SA 5DEHA 3W1BA 5FJ8G 1BKBA 1EYGA 2FHTA 5A2QL 1T5EA 1VDZA 2VQEL 4BY1B 2HCCA 1EOVA 4JOIA 4YHHQ 2HCIA 5FO9B 3NTKA 3WOFA 3U4VA 4P71A 1OXUA 1TWCB 4NXNL 1MSGA 4P2CB 4YCVA 4QF4A 1F9QA 4C3IH 5JPNC 1V1QA 3MFGA 4DR2Q 3QOLA 4APVA 1SYCA 2ZJPA 3RN5A 2MUYA 2OQKA 1LO5D 2PZTA 4IPDA 2K03A 2IHEA 1E2ZA 3PIP3 2R61A 1QJOA 1X65A 1GUGA 2SNSA 4DNRB 3FPUB 3DUZA 3CCMA 2OCEA 1QCBD 2UUCQ 1NE3A 4JI5L 4J8QA 3MZ5A 4A93H 2JYOA 1G91A 2AQ1B 2NUCA 3LWEA 3VA7A 2K5DA 3U58A 3M7GA 4QUFA 2MPMA 1UE6A 1Q86C 4A3GB 4B3TL 1JQYD 2CWPA 2SEBD 1VF7A 4GOPC 2YV5A 1E3PA 2ZTCA 3AB9A 3D4WA 4TSSA 3S14H 1HQMC 3MHBA 3CCUA 4A3JG 1WTRA 4G57A 1ASYA 4DUYL 4PZ8A 2P5ZX 1SE4A 1QG7A 1R4PB 1EU4A 3S1QB 1BDOA 3SDZA 3SE0A 2NZOA 1E2VA 1V1PA 4M1UB 2F0FA 3PUWA 1ASZA 4DAYB 2A68C 2BDOA 3LNNA 3HOXH 2KECA 1BF4A 2WB1B 1YI2A 2VW9A 1N34Q 2WP8J 3SK8A 4PV1C 4LF6Q 1B3AA 5LHY1 5EPKA 3H3VH 3D4DA 1TWFB 1S5CD 2IT1A 3CCQA 3WDNA 4DUZL 1NAPA 3E3XA 3ND8A 4BY7H 1LT6D 4BBSH 5EKLA 2F1MA 3GTPH 1WTVA 3HS0C 4LFAL 1ENFA 1RL2A 4IFDI 1PYSB 4FXGC 2ZTEA 4ABNA 4LF9L 3GTLB 4QQBX 4KHPL 5C44G 3OWEB 1BCPF 4LFBQ 3S1MB 1B4OA 4DV6Q 1A15A 1H9RA 4R4IA 4RH6A 4Y7NH 2WAQE 1X3FA 3HOVB 4L8JA 3GTJB 1X56A 2K75A 3J81L 2JA7H 2NN6H 3KBXA 1OXVA 2ID0A 3KK7A 3HOUH 3KLSA 3EBEA 1XMQL 4MNOA 2MO0A 1SE8A 3TZUA 1E0BA 1X3EA 1PRTF 2GA4B 2K7VA 1K8MA 1D7QA 1LT5D 4K0KQ 4LJZC 1BVSA 5D3IB 2YTXA 1F2MA 1B9NA 3J80c 2XRSD 4XT3B 4K5WA 4QB4A 3L2PA 3S17H 4A3CG 2HQLA 2Z8LA 2Y0SG 2JSOA 1VQBA 2PZUA 3E6ZX 4JI8Q 2HT1A 1KD1C 4TVAB 2KHSA 1NBWA 2L9HA 2ENBA 4O2DA 2F3IA 4CDCC 3HOZH 3SK6A 2ICEC 2B2WA 5M5XB 1NR4A 5DNFA 1GUWA 5AJ3Q 3PMFA 2HIVA 2V1CC 2OEOA 1ZYRD 2JA5B 2KOLA 1ENCA 3L9AX 1G6PA 2EIFA 4YY3Q 1I4QA 2D9UA 2F0PA 2Z6BA 5LL6X 1NJIC 5BR8Q 3UE1A 1LT4D 2ZM6L 3A56A 1H9JA 1R9TH 3KLWA 1G2TA 1Q1EA 3GTOB 1WI5A 1AE3A 1I3QB 3I7FA 1EIYB 4LUZA 3IAYA 4JI7L 3HFZB 4DV5Q 1G6ZA 3MA2B 2K14A 3TBIB 2OQ0A 1HZAA 3I91A 2EXZA 1HNZQ 4X64Q 3HKSA 4I65A 4UDUC 4C2MH 4C1NI 3DLLA 5IE8A 2KA7A 3RZOB 1ILQA 4GLXA 1SLJA 2F4VL 2PMZE 2BCOA 4DV3Q 5C4XB 4JI0L 1SNPA 4IFDJ 2PZWA 3BG3A 5BN4A 2JXMB 2A69C 1W6KA 2R92G 3PUVA 3ULLA 4RKBA 1U4RA 3RUZA 4POFA 4GKJL 3CCLA 1A3UA 1B44D 1PFSA 1JR0D 2OXPA 4AYBG 5C3EB 1XPOA 1STNA 2KENA 1SNQA 2OF1A 2KVMA 1JOKA 4BY1H 5I2YA 5DM73 3L7ZC 4RGNA 4JI4Q 1S5BD 1SAPA 5JJIA 3M85A 3R2IA 3CQZB 1G291 4QIWE 2NZHA 2WACA 2E74C 3J7AF 4JI2L 4HJ5A 4OX9Q 2TMPA 3OIPA 2L1BA 4YCWA 1Y1WH 1C8CA 3BZKA 3HKZE 3CHBD 3STBC 2HHHL 4GN5A 4H7BA 2JA8G 2UXDQ 4NPSA 4P74A 1C4QA 3CCJA 4FF1A 4DXGA 5M5WB 1NUCA 3A8KE 3IKJA 2QEXA 4A3MB 4LF8Q 2DN8A 4QY7A 1XMOL 3H3VI 3NEMA 4GNXA 1G8ZD 1QUQA 5D14A 3JAMc 2PNRC 2UUBL 1FVIA 4KKSA 1KNEA 2RCNA 1HFGA 2GN5A 1IKMA 4XYQA 2F0OA 2K4KA 5LMNW 3RLNA 4A3GH 3AFPA 5GROA 3X3NA 1EY6A 1CK1A 2B63G 3CCVA 4TKOB 2G9DA 3D6WA 1N9WA 3EIVA 4LFCL 2PNHA 4GKKL 3CCRA 3U4ZA 3S1QH 3SK5A 3BZCA 3CRKC 3H0GG 2DNEA 3G4SA 4KHZA 1A3TA 2R93H 4CBVA 4DAPA 1CSPA 2L4NA 4WJ3M 3CXCA 5GAGC 3KF6B 2A19A 1CKOA 2HQEA 1NR2A 4A3KG 1PTOF 2NN6I 3A55A 3K80C 4AQYQ 2K5NA 1TWFH 3AEVA 3TN2A 4Q5VA 1SFOB 3HKZG 1KAAA 3ND9A 1JB3A 1QZGA 1U0LA 3FEWX 2RCFA 1VQAA 5C6AA 4DV2Q 2HIXA 1BCPB 4JOIC 1O7YA 1V8QA 3DMUA 3FRPB 4B9WA 3PIPA 4FF3A 2A73B 1N36L 1VQLA 4YWMA 2B2UA 4XIGS 4DK0A 5J39A 4JI3Q 1HNXL 4NKLA 3GTLH 4B9XA 2F0WA 4Q0FA 2VQFL 3S1MH 5LMNL 4WJWA 4JC0A 3HRZC 4A3LH 1AP0A 3O13A 3HOWG 3TDQA 1I6HB 1SMYC 4O0AA 1L1OA 2DNCA 2JA6B 3MXPA 4C56C 3CAMA 4A3FG 1PRTB 1PYBA 1VS0A 2A6HC 3HOVH 1J8IA 3PIOA 3GTJH 2PQAA 3AYHB 1VQ7A 4N9TA 1A6XA 1IZ6A 2NTTA 4XQJA 3RMHA 1TR5A 1YNJD 1F2YA 5ELDA 2BOSA 4GNXB 2CW0C 3T56B 1QUQB 2Z6KA 1D6EC 1TWGH 4DXFA 3TMEA 4DR1L 2KHIA 1RODA 3KYHC 5ELCA 5IWAL 1KDAA 1LTID 1CI3M 3KLRA 1BR9A 2L5TA 1WD0A 1EUJA 2I5MX 3S1NH 1LM0A 2UUAL 3K58A 2K50A 3T1YQ 2WFWA 3ERSX 5M3MB 2GVBA 1PH2A 1YJ9A 1NMFA 1VMPA 5IT9L 5HURA 1K0RA 1KLGD 5M3FB 4JV5L 3K6OA 1J5EQ 2OTLA 3ITPA 2PO4A 1N32L 1KRSA 3RR5A 4JBKA 1RTOA 3BYTB 1K8AC 4OWXB 4LWCA 2JA5H 3FP9A 4EX5A 3S15B 2DJFC 2E8GA 3K7AB 4E6IA 2YTVA 4BXXG 2E5LQ 5CORA 2CHBD 3EN2A 1IL8A 2R7ZG 5K36G 1MSHA 3GTOH 3NQIA 1WTQA 4BA2I 1I3QH 3ZJYC 2F0EA 1IBMQ 2VY3A 2IW3A 1UE7A 2B8FA 1B70B 3C2PA 3K5NA 3GTQH 3S2HB 5DAUA 4HSPA 4L63B 1LYLA 3RZOH 1U9RA 1HZCA 5C4XH 2ZJRA 3NXWA 4DR4Q 1ILPA 1JOQA 4XYOA 3Q22A 2ZT9C 2AQ2B 3W1GA 1L1OB 3K59A 3J80i 3QR8A 2YYZA 3T16A 1SROA 2N8NA 1Y1VG 5C3EH 2Q2TA 1J6QA 3WWVA 3FPPA 3H6MA 2L55A 4KN7C 4K6LA 4JPBW 2QW7A 1PH4A 1QWYA 3DXJC 3CQZH 4HIKA 1Q8KA 1TKWB 1DOKA 2VB2X 3HOYG 4NW2A 1BO0A 2M00A 3BVGA 3I4LA 2CQOA 4J6HA 3A8JE 1KC8C 4JG2A 5JEAJ 3HOUB 1GUTA 1GO3E 2EYPA 4FF2A 2O2LD 4A3BG 4EQNA 5FOBB 1YNNC 5M5WH 4DV7Q 4DU9A 1UUPA 1GVPA 1Q8IA 4A3MH 3PO3H 1B9MA 4LF5Q 1IXRA 1UE5A 5JJLA 3S17B 4GLAC 2TSSA 2JEAI 4NXML 1FJGQ 4IUUA 4IFDH 1HCZA 3FKIG 2SNMA 2E75C 5FLXL 1E22A 3MWYW 2EXDA 1KTKA 4C3JG 1II3A 5A35A 2IL8A 3QJYA 2VZAA 1AW7A 1IL2A 4A93G 4QCLA 3NQTA 2UU9L 3H91A 1IW7D 3AFQA 2MP1A 1PTOB 3RLFA 3VR5A 2ZXRA 1WTWA 2F0UA 2O4XA 2WKCA 1K28A 4KY5A 1YHBA 4DR3L 4DR6Q 3DHQA 5NUCA 4C3HB 3T13A 4A3JB 4YIJA 1TY0A 5IYDH 3SXHA 1E1TA 1K83B 4JBJA 1R9TB 1Q1BA 4UP9A 1YHAA 3CKIB 4UP7A 3TS2A 3VYSA 4YHHL 1JOOA 4IOCA 1SFOH 4P75A 1ONLA 4ULLA 3TS0A 1BBWA 4DV1Q 2IX3A 4ODGA 2CVRA 3HOXG 1PH8A 1RKNA 3C46A 1XPRA 1SR3A 2EYJA 1B1ZA 1EQQA 1HUMA 1VQ5A 3I4NB 1FYCA 1ESRA 2WKDA 1AH9A 4PG3A 3FMCA 3JAMi 3E9IA 1PH9A 1TS4A 1F9RA 2UUCL 4PQXA 1U5KA 5FK9C 1WCMH 2AHOB 2JA6H 2L11A 1I4GA 3G71A 3HGBA 2B2YC 4UAIA 1EIGA 1XTDA 3EA6A 5C44B 2EYLA 3NBHB 2C5CA 3F8TA 1SE3A 1MHWC 2K01A 1RTNA 2EE1A 2D0OA 2SOBA 5G3LF 1XNRQ 3OTOQ 2RHSB 3E5SA 1RIPA 2HDLA 3TP8A 1Y1WB 1GM5A 4CDEC 1H9MA 3A7AB 4JI6Q 2MQHA 1BCPD 2F0JA 4B08A 2O5JC 5GQOA 1GXDC 2J0TD 1E1OA 5EJWA 1ET9A 3Q24A 5JVG3 4DA2A 2NWGA 1EYCA 4K6DA 1XX8A 3MEFA 1ET6A 2RQXA 5M3MH 4RGMA 4K5VA 2NVYB 3GD7A 4B3SQ 1Z47A 1N34L 5JAVA 5M3FH 3GO5A 3DM3A 1K3RA 4LF6L 3TQYA 3MAQA 3FDTA 3HZXA 2Y0SB 4DN4M 3D8GA 1JORA 1PRTD 4GN3B 1K0SA 3I72A 3PUZA 2F52A 4J15A 4RA8A 2EYMA 2FJ2A 3PIO3 3K0YA 4OL7A 1EY8A 2KCNA 2QEJC 5IYCH 3S15H 2EJFC 5A2QE 1TS3A 3K7AH 4KD4A 1QZHA 3DM1A 3QIAA 2RDHA 1V1OA 3CD6A 3CMAA 5CV9A 4A3IH 2Z1CA 1E7ZA 1A0IA 3ER0A 2EY6A 4QL5A 2M2LA 4TQUS 1DYQA 4LFBL 2R93B 4DV6L 2EOTA 4U673 1D1IA 1H9SA 1DZ1A 4F8MA 4YWLA 2B2UC 4XQQA 3S2HH 1KABA 3I4MG 1B7YB 4X3UA 2ICIA 2EYOA 1KQSA 5EBCA 4U68A 4R9WA 1LTTD 3P20A 3TZDA 5ELBA 3R93A 3A5UA 1M90C 4DPGA 3DEOA 1Y8NB 4JI5Q 1RDPD 4K0KL 3S24A 4OXPA 1I6VC 3PGZA 1X3QA 2EYFA 3M9BA 1EY5A 3D31A 3BVZA 4MTNA 3M3YB 2F03A 3NTHA 2N3SA 4B3TQ 2R92B 4BS9A 4JI8L 1IHZA 1EQTA 1Q81C 2KUMA 3AMUA 1ZYRC 5EPJA 3OIQA 3MXNB 4ZK9B 1HA6A 4G7ZC 5CC4A 4AYBB 2X69A 5FJ8H 3CC2A 1QILA 5AJ3L 4KI0A 1MI2A 1NNXA 2JN4A 1K73C 4BY1G 1P16A 3OYYA 3N52A 1XTCD 2WB1E 1L0YB 1TWGB 3PSIA 2PI2A 1FR3A 5BR8L 1PFBA 3GDEA 4H13C 2BE5D 5FKAC 4DNIA 2A74C 1TWHB 3GTMB 1YBYA 3S1NB 4BA1I 2JA8B 1STGA 5LMUQ 5FO8B 4V0BA 1FGUA 1SNCA 2XNAC 4DV5L 4LF4Q 5LL6S 4RHSA 3G48A 4R4OA 1FD7D 2DGYA 4EGVA 5C4ZA 1HNZL 4HN7A 4ID6A 4X64L 2UXCQ 1KDCA 1YZ6A 5EBDA 2B2TA 2F4IA 3H09A 1P8LA 1D2BA 1M4VA 1DOLA 1J9OA 1PTOH 1F77A 2LFNA 1HNWQ 1H9SB 2B63B 3S2DH 4WORA 2XIWA 1HJPA 1JJ2A 4C3HH 3TP7A 2C35B 4A3JH 2ZXOA 3CW2C 3EROA 1K83H 1Q7YC 4B3MQ 2WAQG 3HP3A 2GVAA 5JEAH 3H0GB 3KLSX 3BJUA 2XVSA 1N33Q 2KEDA 4JI4L 1EEID 3G7LA 1XMQQ 1OXTA 4CDFC 2VXWA 3GTQB 4QGUA 2PQEA 2JJQA 1Z6HA 3I70A 4R4TA 4N8X1 4A3KB 3GP7A 4OX9L 2WB1G 4IQZA 3KF6A 3M7NA 5IP9G 3NWTA 1AE2A 3J7A5 2UXDL 4FDBA 3I4NH 2UXBQ 1PTOD 5M9OA 3PO2G 1C0AA 2PCFB 5IGGA 4ZKCB 2H5XA 4RGTA 2CFMA 3E0EA 4IO9A 2RF4A 2DY7A 4CKEA 1CFMA 1VQIA 4PMCA 1PA6A 1LTAD 4NMZA 4X65Q 5HGTA 2RKSA 2VS1A 5C44H 1WJJA 4ILWA 1HR0W 1PH3A 4RCNA 2Z4HA 4DF7A 3NPPA 3HOWB 2PW7A 4WRDA 1L0WA 5C3XA 3CP0A 5IP7H 3J80L 1XNQQ 1RHPA 1SYDA 3KJPA 3IFTA 1LTSD 4OO1G 4HJ7A 1M8AA 1I94Q 1Y8OB 1I4RA 1CM9A 4R4CA 4R8NA 3OHXC 1S40A 3ULJA 1EY0A 1STYA 4GS3A 1X3PA 5C0XI 1JJGA 1VQ9A 3PO3B 2EQSA 4FO2A 2NVYH 1U4MA 2F0VA 2XWBB 2H4OA 3KUPA 2KCCA 4AQYL 4A3CH 3G6JB 5E4XA 1A3VA 5CV6A 3K7UC 4A3EB 1AEXA 4DV2L 1IYJB 1IYVA 4GKJQ 4A75A 2K5VA 4K2LA 3CC4A 2V4DA 2JEBI 3VR6A 3L3OC 1T5XD 4X66Q 3ULPA 3PUYA 1PH5A 3CCSA 1WOCA 3U9OA 4DR7Q 4IUVA 2JQOA 4ZRZA 2AUKA 3EQLC 1YIJA 4JI3L 1QVCA 2H1EA 2CH4W 2PI2E 5KNCA 1SRUA 1O7IA 4X62Q 3ICEA 1GUSA 4DR5Q 1AZPA 3OPOA 4LNQA 1CZGA 1BQQT 2OTJA 2E2JB 1Q82C 1YNJC 4CJ2C 3BVMA 1EOTA 4X6AH 4WJ4A 3OW7A 4A3DG 4CJ1B 1SYFA 5EQ0A 5DM63 1X3GA 1X6OA 1KDBA 4IUQA 3OSOA 1CZWA 3QO2A 3GV6A 1A63A 4KJOA 2QGQA 1YJNA 3WOEA 1VQJA 4M8AA 4GOPA 5CV4A 3KDFB 2DY8A 3P75A 1WTHA 4DK1A 1JWSD 3R2TA 1MD2D 3M3YH 3CCEA 5I6WA 2R92H 1RJTA 3T1YL 3SVMA 1HR0Q 5HGQA 2NVQB 2XRQD 4A4IA 1DJRD 4NB3A 2QA4A 4I7AA 1WCMB 1D5XC 3CC7A 3TSSA 1DGSA 1W6JA 5KEEA 1KRTA 1J5EL 4LFCQ 1SNDA 1ICFB 5E3FA 2AWOA 2X6GA 1HZ9A 4L5RC 2D5DA 2Q2HA 4KY7A 4ZLTF 3UI2A 2YU9B 2I46A 5KYLA 5KYIA 3DEPA 1C48A 2EY1A 3HOYB 3F2UA 3D4RA 3JAML 5C5MA 1LUZA 5C0XJ 3NELA 1KIXA 4RFBA 4FYDA 1CUKA 3RD4A 3Q0AA 1Y8PB 1PZJD 1TWHH 3GTMH 1VQ4A 2JA8H 2QDBA 2MHVA 4RAUC 4DK6C 2EY5A 4A3BB 1IBLQ 1PYWD 3M4YA 1IBML 4IALA 1Q12A 3B6YA 1VQPA 4X3TA 4OONA 4JBMA 1L0XB 2FXQA 1A8VA 2D2CC 2EY2A 1EQVA 1VQMA 4PZ7A 2Q8IB 3KBGA 1PLFA 4TRDA 3W3AA 4DR4L 2K5HA 5L37A 4C3JB 1SDFA 2B63H 2R7FA 2MFIA 3DWQA 4EQ5A 1UEAB 1VQNA 2E2HB 4BBRG 2Q8TA 3K5MA 3SEBA 3UDXA 3T1HQ 4A3IB 2KJXA 5ELEA 3VYTA 4B3RQ 3T51B 1G51A 2HD3A 2M9VA 3H0GH 5IGFA 1V9PA 2HUGA 1HZBA 2L15A 1B50A 3J7AV 1STBA 3S1RH 3KOJA 3F2CA 3NK9A 5ISRA 2A1AA 2X6LA 1A2UA 4GOPB 1DCZA 5IYDG 2VUMG 4A3KH 4DV4Q 1EIFA 1SYEA 1WD1A 3DWAA 2F0QA 2VB3X 4MHEA 1K8OA 4KK7A 4FXKC 2CKZB 2YTYA 5I9PA 2ASBA 4H02A 2B2VA 4DV7L 4YCUA 3UDIA 3UE0A 1KNAA 2F0MA 3A7LA 1G2SA 3I56A 3GTKB 4KN4C 4LF5L 1N32Q 1HA5A 1H9KA 2PW5A 1YEZA 3MXUA 2RHQB 3K0XA 3T4AC 1MKHA 1FJGL 1QVFA 3HEJA 3I8ZA 4GLVB 3CPWA 1EU3A 2ZTDA 1IW7C 1HXYD 4GZYC 4C1NK 1CHPD 3HOWH 5C5LA 1EWHA 5TSSA 4A3FH 3TREA 2JA6G 4MZ9A 2XN9C 1MJEA 2RSNA 4KV6A 1ZXTA 1GOZA 3NP8A 4OGQC 2B2WC 1O78A 1NSNS 3TP5A 2B2TC 4CJ0B 3NBHA 1VQHA 2KCMA 2OT2A 2AQ3B 4R1JA 4C3IG 2E76C 4CGYB 4OELB 2AUJD 5G3LD 4HR7B 1I50H 2Z4IA 2IHFA 1GJXA 4A3EH 1LTLA 1XXGA 4HSVA 1FNWA 2FINB 1ENAA 2A5HA 4ME5A 2AKWB 3KF8A 1D8LA 1Q90A 2AMCB 3D6CA 2F0NA 5GAHC 3BDCA 3S2DB 2FMMA 3J81j 2K6AA 4BXXH 4N9PA 4MTKA 1LABA 1R4QB 5FLMH 4JI1Q 4JYAQ 2J7ZA 4X3KA 2E2JH 2ALYB 2OWOA 2R7ZH 1SYBA 5K36H 1S5FD 1PH1A 4IPGA 5IGBA 1XJVA 1BCPC 4IURA 2QKIC 1EY4A 1B2TA 3CF5A 3RN2A 5IYBH 2F0GA 2JP1A 1SE2A 1XNRL 2Q2IA 3OTOL 1FNVA 4DV0Q 4OO1I 3I4MB 5J22A 4JI6L 3ERQA 3PF4A 4DR2L 5ELNA 3K8AA 5FLXE 1C7YA 1DD2A 2K28A 1STEA 2MGSA 4ZQ3A 1Q46A 1JCKB 2NVQH 1PRTC 4BY7G 4FNFA 4BBSG 4B3SL 4HIOA 1FL0A 2B39A 1D1KA 4PNYA 1EYAA 1LLRD 2LSSA 1UNSA 1LTGD 3LWUA 2E2DC 2PYKA 4GNXC 4HIMA 1HH2P 3HG9A 1U4LA 4DR3Q 2YU9H 2VNUD 1RD9D 3HOYH 3MXNA 1F2ZA 1NY4A 5IIFA 3SK4A 1VQ8A 2JA7G 2NN6G 3URYA 1CSQA 1JE5A 1O80A 2A6ED 3RNUA 4HMJA 3HOUG 4A3BH 4L5QA 4LF7Q 3I2ZA 1GKHA 3PF5A 1PH6A 3KF8B 3W2DA 2RDGA 2E2IB 3EJIA 4CHTB 3NWSA 4HJ9A 4EQOA 2Q8RE 5T1GA 1LTRD 2EVBA 2N49A 3FKIH 4XTCS 4YWKA 3J81c 3NUCA 4RKLA 1EZ8A 3GV3A 4KHVA 4C3JH 1F9SA 1IBKQ 1RCVD 3HOZG 2E2HH 3FHWA 3PUXA 2NBFA 3CRLC 3VR3A 2F0KA 2VQEQ 4OEMB 1KHIA 5C3WA 3QOJA 3PQIA 2EYHA 3VR2A 4LUOA 1DOMA 4NXNQ 1GHKA 3JC66 5EKKA 3C1FA 2Q2UA 3H3VC 2EPBA 4HTHA 2EJMA 2B29A 4C3HG 2JE6I 5C0XH 3BU2A 4IUTA 4RHRA 4HIDA 5IODA 3IRBA 1PHJA 2WAQB 3S9WA 5IY0A 1KLUD 4IZ8A 5JEAG 2BE5C 1QNUA 1L1OC 3V96A 3CMEA 3U50C 5GAEC 3BS1A 4MN3A 3D3RA 5IGEA 1M1KC 4XT1B 1ML0D 5CV7A 1EQRA 1NTGA 3Q8DA 3U9SA 1TS2A 1BOSA 2Y0SE 3GTKH 3BZDB 2IX0A 5LMUL 1O7ZA 2Z6KC 4K8IA 5BN5A 3OWFA 3PO2B 2CQAA 4LF4L 3I4NG 2N55A 1X32A 3RLOA 2CWAA 1NCVA 1EL0A 4LMQD 4ALPA 1UE1A 2EJGC 4H44C 1CA5A 2UXCL 4DUYQ 1JWUD 1KL9A 1HTLD 4KKUA 4F87A 4IUNA 4LUVA 1SNMA 1X54A 3GTGH 2ZXPA 1KXLA 1ESFA 1MIUA 4IPHA 1LV9A 1HNWL 2MNAA 3N6RA 2R3ZA 2RDFA 4YY3L 4S3SA 1OXSC 5KGUA 1I4XA 4ZAIA 2Z0SA 5IP7G 4RMFA 1Y1WG 3LGJA 2A68D 4B3ML 3EFXD 4DUZQ 1WTXA 1JT8A 1WFQA 2SDFA 5ELOA 5I4DA 2A8VA 4PZ6A 1N33L 1QE6A 3OMCA 2K05A 4IJHA 4EVOA 1D5MC 3D0FA 4CKCA 4G7HC 1PTOC 2NVXB 4LFAQ 2QILA 3MC0B 1ZEQX 5K5PA 3ONAB 2WIIB 4UHVA 4LF9Q 4DV3L 2PMZB 4KHPQ 4A3GG 4KMUC 4UPAA 2UXBL 5IOCA 1Y69U 1YVCA 1JMCA 3RZDB 1CKMA 4AYBE 3BDOA 2XSCA 1IKLA 3J81E 3QB3A 4LK1C 2LKVA 5CV8A 2NVTB 4HCSA 4QUCA 2B2VC 3IFDA 3I4OA 1FNUA 5IGDA 1V1PB 4X65L 5JOBA 3PV0A 4N8FA 2O5IC 1PFMA 3X3MA 2EZVA 2QDLA 4DFAA 1Z7TA 1MJCA 2F0DA 3S1RB 3C1EA 2R93G 1JE4A 4L6TB 5E1FA 1EZ6A 3W5OA 4QIWB 2D0PA 2NTSA 5I9OA 1XNQL 3MTSA 3I4MH 1TXYA 3A8IE 4A3DB 1VQDA 3J7YW 1I94L 3HKZB 1XYIA 4ZUJA 4CKBA 4FVMA 4JBWA 3FVQA 4L5SA 2JA9A 4AH6A 2I5LX 3MEHA 1WTOA 1HRJA 2ES2A 1XPUA 2KBNA 3V05A 4LF8L 4QJFA 1PVOA 3BDLA 1CQFA 5T1IA 4FXDA 1DONA 1Q3LA 3P1HA 1YJWA 3QG1A 5I2XA 1X55A 3KDFA 1BXTA 4FF4A 4DNTB 1BUVT 1HPCA 4A76A 1EWIA 4A3LG 2JK8A 3CU7A 4Z9CB 2G9HD 4A3FB 4P73A 5M5YH 1DXMA 2ZM6Q 4X66L 4BWGB 3HOVG 4DR7L 3AU7A 1S72A 2NYZD 4P72A 2K32A 3L0OA 4JI7Q 4HMIA 2KHJA 4ZCKA 1STHA 2D62A 3Q23A 4X62L 3S16B 4DR5L 1WVLA 2CH4A 3V2TA 1TWCH 5EKIA 1XWEA 4XXEA 1BNZA 2Z9HA 2R7DA 1MBYA 1PXUA 1UEBA 2E2IH 2F4VQ 1RF2D 5JVH3 1I50B 2K1BA 4JI0Q 4FP5D 2BH8A 3E0JA 4K2KA 5E4WC 3Q6SA 3R3OA 4HAEA 1JJCB 3KJOA 3SGIA 1VF5C 1EFWA 1TWAB 2F3WA 2B2YA 2NB0A 4QMGA 5COYA 4XDXA 4NDXA 3F1ZA 1Y14B 2G5DA 2A69D 1V43A 3OOCA 4CDDC 3J7ZC 1STAA 1TS5A 1OTCA 2JA5G 2F0TA 2F0IA 5AFWA 1GUOA
chains in the Genus database with same CATH topology
3J80E 4ZYSA 4BBRB 4RCOA 5EPLA 1SSOA 2RBMA 5I6YA 1AFPA 1ZKOA 3A54A 2R7ZB 5JJZA 5J1ZA 1SYGA 3LX0A 1OO9B 4JK1C 3K57A 3H94A 1S5ED 3K5OA 3M4OB 4G4KA 2F0HA 2VUMB 2K04A 5C4JB 3NHHA 5KIXA 4EQPA 3SHLA 5C4HA 1IYUA 1CTMA 1WTPA 4I7ZC 1D5ZC 5CYUA 1Y1VB 1EFID 1JC7A 3MXGA 5CMDA 1PZKD 4HEDA 1FGBD 1TVXA 3QWNA 4OIKA 2K33A 4O42A 4G7OC 3MVVA 1SEBD 1JWMD 4PMWA 4DAVA 2RVLA 4IUPA 4OO1H 4NP5A 2BA0A 3DWPA 2K5WA 2J4XA 2R6GA 1PFNA 2IWHA 4C3IB 1AZQA 2AWNA 1EYDA 2FMCA 1EWCA 5CR3A 3NSWA 4H0LC 4MIUA 1S4ZA 3FKIB 1AN8A 4IFDG 1SBBB 4KTAA 4F88A 1EIHA 1MGSA 1F2LA 4A93B 4KJNA 2HDMA 1TU2B 5D3DA 2QF7A 1TQOA 2MJ8A 4IN3A 3EVQA 5D65A 3VA5A 1SMYD 1DM0B 1HFNA 1EEFD 1EY9A 1PZID 4PMBA 3VR4A 4WFN3 3JAME 3S14B 2A6HD 3TP6A 3P7JA 2F3VA 2KQ3A 5CV5A 5ELFA 3VYRA 3GQBA 2CW0D 1F9PA 4HCEA 1QNKA 1QOHA 5IT9E 5FO7B 3HOXB 3NE5B 4O1NA 2RA4A 2XWJB 3VYUA 2PPBC 5EGTA 2QCPX 3OMGA 4V190 1EY7A 1JICA 4RGOS 4BY7B 4BBSB 3GTPB 1CQVA 2B8GA 1ICWA 1QB5D 3GTGB 1HHVA 1O7LA 1VMCA 4K8JA 1PMRA 2L12A 2BA1A 2RSOA 2LY7A 1LACA 5KRUA 3I3CA 1BBXC 2I07B 4Y7NB 3NTIA 4KKTA 4ZKBB 5CBEE 3C3LA 2JA7B 2LMCB 5KNDA 1HTPA 2NZ1D 2IX1A 5JPMC 5KNBA 3NBIA 1SJHD 3I90A 4KD3A 5F2DA 1CHQD 5CBAE 1U4PA 2WINB 2IJ0A 1SNOA 1A2TA 1OXXK 2L0CA 2WV6D 1LTBD 1B53A 1SXTA 3SR1A 1HQRD 1TY2A 2F0LA 4OHJA 2F0SA 3HOZB 4K5XA 4J1MA 4F7XA 4DGZA 2C9OA 1GHJA 4RWSC 3IL8A 1SJED 1CT1D 5BN3A 1GUNA 2IPKD 4LAAA 3K5LA 2A6EC 5C0XG 1HUNA 2K5QA 2LS01 1TIID 2FFKB 1YNND 4XQNA 2KEEA 5CGKA 1VCIA 2BDNA 1I4PA 4DAYA 4C2MB 1UAPA 2N88A 1E2WA 1PDQA 1S5DD 4R8IA 1I4HA 3ZYYX 1CA6A 1LT3D 4OIJA 5IGCA 4K14A 3R8BA 1TT2A 4KY6A 2EDGA 3T53B 3BYYB 5M5YB 3I73A 4ZUIA 3MFYA 4X3SA 5DEHA 2FHTA 5A2QL 1T5EA 1VDZA 4BY1B 2HCCA 2HCIA 5FO9B 3NTKA 3WOFA 1OXUA 1TWCB 1MSGA 4P2CB 4QF4A 1F9QA 5JPNC 3MFGA 3QOLA 1SYCA 2MUYA 1LO5D 2PZTA 2K03A 1E2ZA 3PIP3 2R61A 1QJOA 1GUGA 4DNRB 2SNSA 3DUZA 3FPUB 1QCBD 4J8QA 3MZ5A 1G91A 2JYOA 2AQ1B 2NUCA 3LWEA 3VA7A 2K5DA 3M7GA 4QUFA 2MPMA 4A3GB 1JQYD 2SEBD 1VF7A 3AB9A 3D4WA 4TSSA 1HQMC 3MHBA 1WTRA 4G57A 1SE4A 1QG7A 1R4PB 1EU4A 3S1QB 1BDOA 3SDZA 3SE0A 1E2VA 1V1PA 4M1UB 2F0FA 3PUWA 2A68C 2BDOA 3LNNA 2KECA 1BF4A 2WB1B 3SK8A 2WP8J 4PV1C 1B3AA 5LHY1 5EPKA 3D4DA 1TWFB 1S5CD 2IT1A 3WDNA 1NAPA 3ND8A 1LT6D 5EKLA 2F1MA 1WTVA 3HS0C 1ENFA 4IFDI 4FXGC 4ABNA 3GTLB 3OWEB 1BCPF 3S1MB 1B4OA 1A15A 1H9RA 4RH6A 3HOVB 4L8JA 3GTJB 3J81L 2NN6H 3KBXA 1OXVA 2ID0A 3KK7A 3KLSA 3TZUA 1E0BA 1PRTF 2GA4B 2K7VA 1K8MA 1LT5D 4LJZC 5D3IB 1F2MA 1B9NA 2XRSD 4XT3B 4K5WA 4QB4A 2Z8LA 2JSOA 2PZUA 3E6ZX 2KHSA 2L9HA 2ENBA 3SK6A 2ICEC 2B2WA 5M5XB 1NR4A 5DNFA 1GUWA 3PMFA 2OEOA 1ZYRD 2JA5B 2KOLA 1ENCA 3L9AX 1I4QA 2D9UA 2F0PA 5LL6X 1LT4D 3A56A 1H9JA 1G2TA 1Q1EA 3GTOB 1I3QB 3IAYA 1G6ZA 3MA2B 3TBIB 3I91A 2EXZA 4I65A 4UDUC 4C1NI 2KA7A 3RZOB 1ILQA 2BCOA 5C4XB 1SNPA 4IFDJ 2PZWA 3BG3A 5BN4A 2JXMB 2A69C 1W6KA 3PUVA 4RKBA 1U4RA 3RUZA 1A3UA 1B44D 1JR0D 2OXPA 5C3EB 1STNA 1SNQA 2OF1A 2KVMA 1JOKA 5I2YA 5DM73 3L7ZC 4RGNA 1S5BD 1SAPA 3M85A 3R2IA 3CQZB 1G291 2WACA 2E74C 3J7AF 2TMPA 3OIPA 2L1BA 1C8CA 3CHBD 4H7BA 1C4QA 4FF1A 4DXGA 5M5WB 1NUCA 3A8KE 3IKJA 4A3MB 2DN8A 1G8ZD 5D14A 2PNRC 4KKSA 1KNEA 1HFGA 1IKMA 4XYQA 2F0OA 3X3NA 1EY6A 1CK1A 4TKOB 2G9DA 3D6WA 3SK5A 3CRKC 2DNEA 4KHZA 1A3TA 4CBVA 4DAPA 2L4NA 2HQEA 1NR2A 1PTOF 2NN6I 3A55A 3TN2A 4Q5VA 1SFOB 1KAAA 3ND9A 1JB3A 3FEWX 5C6AA 1BCPB 1O7YA 1V8QA 3DMUA 3FRPB 4B9WA 4FF3A 2A73B 2B2UA 4XIGS 4DK0A 5J39A 4NKLA 4B9XA 2F0WA 4Q0FA 4WJWA 1AP0A 3HRZC 3O13A 3TDQA 1I6HB 1SMYC 2DNCA 2JA6B 3MXPA 4C56C 1PRTB 2A6HC 1J8IA 4N9TA 1A6XA 2NTTA 4XQJA 3RMHA 1TR5A 1YNJD 1F2YA 5ELDA 2BOSA 2CW0C 3T56B 1D6EC 4DXFA 3TMEA 5ELCA 1RODA 1KDAA 1LTID 1CI3M 3KLRA 1BR9A 2L5TA 1WD0A 3K58A 5M3MB 1VMPA 5IT9L 5HURA 1KLGD 5M3FB 3K6OA 3ITPA 2PO4A 1RTOA 3BYTB 3S15B 3K7AB 4E6IA 5CORA 2CHBD 1IL8A 5K36G 1MSHA 3NQIA 1WTQA 4BA2I 2F0EA 2IW3A 2B8FA 3C2PA 3K5NA 3S2HB 5DAUA 4HSPA 4L63B 1U9RA 3NXWA 1ILPA 1JOQA 4XYOA 3Q22A 2ZT9C 2AQ2B 3K59A 2YYZA 3T16A 3FPPA 3H6MA 2L55A 4KN7C 4K6LA 1QWYA 3DXJC 1TKWB 1DOKA 2VB2X 4NW2A 1BO0A 2M00A 3BVGA 3I4LA 4J6HA 3A8JE 5JEAJ 3HOUB 1GUTA 2EYPA 4FF2A 2O2LD 4EQNA 5FOBB 1YNNC 4DU9A 1UUPA 1Q8IA 1B9MA 3S17B 2TSSA 2JEAI 4IUUA 4IFDH 1HCZA 2SNMA 2E75C 5FLXL 3MWYW 1KTKA 4C3JG 1II3A 5A35A 2IL8A 3QJYA 1AW7A 4QCLA 3NQTA 1IW7D 3H91A 2MP1A 1PTOB 3RLFA 3VR5A 2ZXRA 1WTWA 2F0UA 2O4XA 2WKCA 4KY5A 3DHQA 5NUCA 4C3HB 3T13A 4A3JB 4YIJA 1TY0A 3SXHA 1K83B 1R9TB 1Q1BA 3CKIB 3VYSA 1JOOA 1ONLA 4ULLA 2IX3A 4ODGA 2CVRA 1RKNA 3C46A 2EYJA 1B1ZA 1HUMA 3I4NB 1FYCA 1ESRA 2WKDA 3FMCA 1TS4A 1F9RA 4PQXA 5FK9C 2L11A 1I4GA 3HGBA 2B2YC 4UAIA 1EIGA 3EA6A 5C44B 2EYLA 2C5CA 1SE3A 2K01A 1RTNA 2EE1A 2SOBA 5G3LF 3E5SA 2HDLA 3TP8A 1Y1WB 1H9MA 3A7AB 2O5JC 1BCPD 2F0JA 4B08A 1GXDC 2J0TD 5EJWA 1ET9A 3Q24A 5JVG3 4DA2A 2NWGA 1EYCA 4K6DA 1XX8A 1ET6A 2RQXA 4RGMA 4K5VA 2NVYB 3GD7A 1Z47A 5JAVA 3GO5A 3MAQA 3FDTA 3HZXA 2Y0SB 4DN4M 3D8GA 1JORA 1PRTD 3I72A 3PUZA 4RA8A 2EYMA 2FJ2A 3PIO3 3K0YA 4OL7A 1EY8A 2KCNA 2QEJC 2EJFC 5A2QE 1TS3A 4KD4A 3DM1A 3QIAA 2RDHA 1V1OA 5CV9A 2Z1CA 2EY6A 4TQUS 2M2LA 2R93B 1DYQA 2EOTA 4U673 1D1IA 1H9SA 1DZ1A 4F8MA 2B2UC 4XQQA 1KABA 4X3UA 2ICIA 2EYOA 5EBCA 4U68A 4R9WA 1LTTD 3P20A 3TZDA 5ELBA 3R93A 3DEOA 1Y8NB 1RDPD 1I6VC 1X3QA 2EYFA 1EY5A 3D31A 3BVZA 3M3YB 2F03A 3NTHA 2R92B 4BS9A 1IHZA 1EQTA 2KUMA 3AMUA 1ZYRC 5EPJA 3OIQA 4ZK9B 1HA6A 4G7ZC 5CC4A 4AYBB 2X69A 1QILA 4KI0A 1MI2A 3N52A 1XTCD 1L0YB 1TWGB 1FR3A 1PFBA 4H13C 2BE5D 5FKAC 2A74C 1TWHB 3GTMB 3S1NB 4BA1I 2JA8B 1STGA 5FO8B 4V0BA 1SNCA 2XNAC 5LL6S 4RHSA 1FD7D 4EGVA 5C4ZA 4HN7A 4ID6A 1KDCA 5EBDA 2B2TA 2F4IA 3H09A 1D2BA 1M4VA 1DOLA 1J9OA 1PTOH 1F77A 2LFNA 1H9SB 2B63B 4WORA 2XIWA 3TP7A 2ZXOA 3EROA 3HP3A 5JEAH 3H0GB 3KLSX 2XVSA 2KEDA 1EEID 3G7LA 3GTQB 1OXTA 2VXWA 2PQEA 1Z6HA 3I70A 4A3KB 3GP7A 4IQZA 3M7NA 3NWTA 1PTOD 5M9OA 2PCFB 5IGGA 4ZKCB 4RGTA 2DY7A 4CKEA 1CFMA 4PMCA 1LTAD 4NMZA 5HGTA 2RKSA 4ILWA 4RCNA 2Z4HA 4DF7A 3NPPA 3HOWB 2PW7A 4WRDA 5C3XA 3J80L 1RHPA 1SYDA 3IFTA 1LTSD 4OO1G 1M8AA 1Y8OB 1I4RA 1CM9A 4R8NA 3OHXC 1EY0A 1STYA 1X3PA 5C0XI 3PO3B 4FO2A 1U4MA 2F0VA 2XWBB 2H4OA 3KUPA 2KCCA 3G6JB 5E4XA 1A3VA 5CV6A 4A3EB 1AEXA 1IYVA 4K2LA 2V4DA 2JEBI 3VR6A 3L3OC 1T5XD 3PUYA 3U9OA 4IUVA 4ZRZA 2AUKA 3EQLC 2H1EA 5KNCA 1GUSA 1AZPA 3OPOA 1CZGA 1BQQT 2E2JB 1YNJC 4CJ2C 3BVMA 1EOTA 3OW7A 4CJ1B 1SYFA 5EQ0A 5DM63 1KDBA 4IUQA 3OSOA 1CZWA 3QO2A 3GV6A 4KJOA 3WOEA 4M8AA 5CV4A 2DY8A 4DK1A 3P75A 1JWSD 3R2TA 1MD2D 5I6WA 1RJTA 3SVMA 2NVQB 2XRQD 1DJRD 1WCMB 1D5XC 3TSSA 1W6JA 5KEEA 1SNDA 5E3FA 2AWOA 2X6GA 2D5DA 4KY7A 4ZLTF 3UI2A 2YU9B 2I46A 5KYLA 5KYIA 3DEPA 1C48A 2EY1A 3HOYB 3F2UA 3D4RA 3JAML 5C5MA 5C0XJ 4RFBA 4FYDA 3RD4A 3Q0AA 1Y8PB 1PZJD 2QDBA 2MHVA 4RAUC 2EY5A 4A3BB 1PYWD 3M4YA 4IALA 1Q12A 4X3TA 1L0XB 2D2CC 2EY2A 1EQVA 2Q8IB 3KBGA 1PLFA 4TRDA 3W3AA 4C3JB 1SDFA 3DWQA 1UEAB 2E2HB 2Q8TA 3K5MA 3SEBA 4A3IB 2KJXA 5ELEA 3VYTA 3T51B 2M9VA 5IGFA 2HUGA 1B50A 3J7AV 1STBA 3NK9A 5ISRA 2X6LA 1A2UA 1DCZA 1SYEA 1WD1A 3DWAA 2F0QA 2VB3X 4MHEA 1K8OA 4KK7A 4FXKC 5I9PA 2B2VA 1KNAA 2F0MA 3A7LA 1G2SA 3GTKB 4KN4C 1HA5A 1H9KA 2PW5A 3MXUA 3T4AC 3HEJA 3I8ZA 1EU3A 1IW7C 1HXYD 4GZYC 4C1NK 1CHPD 5C5LA 1EWHA 5TSSA 2XN9C 2RSNA 4KV6A 1ZXTA 1GOZA 3NP8A 4OGQC 2B2WC 1O78A 1NSNS 3TP5A 2B2TC 4CJ0B 3NBHA 2OT2A 2AQ3B 4C3IG 2E76C 4CGYB 2AUJD 5G3LD 4HR7B 2Z4IA 1GJXA 1XXGA 4HSVA 1FNWA 2FINB 1ENAA 2A5HA 4ME5A 3KF8A 1Q90A 3D6CA 2F0NA 3BDCA 3S2DB 2FMMA 2K6AA 4N9PA 1LABA 1R4QB 2J7ZA 4X3KA 5K36H 1SYBA 1S5FD 5IGBA 1BCPC 4IURA 2QKIC 1EY4A 1B2TA 2F0GA 2JP1A 1SE2A 1FNVA 4OO1I 3I4MB 5J22A 3ERQA 5FLXE 1DD2A 2K28A 1STEA 2MGSA 4ZQ3A 1JCKB 1PRTC 4FNFA 2B39A 1D1KA 4PNYA 1EYAA 1LLRD 1UNSA 1LTGD 3LWUA 2E2DC 2PYKA 3HG9A 1U4LA 2VNUD 1RD9D 3MXNA 1F2ZA 5IIFA 3SK4A 2NN6G 3URYA 1O80A 2A6ED 4HMJA 3W2DA 2RDGA 2E2IB 3EJIA 4CHTB 3NWSA 4EQOA 2Q8RE 5T1GA 1LTRD 2EVBA 4XTCS 3NUCA 4RKLA 1EZ8A 3GV3A 4KHVA 1F9SA 1RCVD 3PUXA 2NBFA 3CRLC 3VR3A 2F0KA 5C3WA 3QOJA 2EYHA 3VR2A 1DOMA 1GHKA 3H3VC 5EKKA 3C1FA 2EPBA 4HTHA 2EJMA 4C3HG 2JE6I 5C0XH 4IUTA 4RHRA 5IODA 2WAQB 3S9WA 1KLUD 4IZ8A 5JEAG 2BE5C 1QNUA 3V96A 3BS1A 4MN3A 3D3RA 5IGEA 4XT1B 1ML0D 5CV7A 3U9SA 1TS2A 1BOSA 3BZDB 2IX0A 1O7ZA 4K8IA 5BN5A 3OWFA 3PO2B 2CQAA 2N55A 1X32A 1NCVA 1EL0A 4LMQD 2EJGC 4H44C 1CA5A 1JWUD 1HTLD 4KKUA 4F87A 4IUNA 1SNMA 2ZXPA 1ESFA 1LV9A 3N6RA 2R3ZA 2RDFA 4S3SA 1OXSC 5KGUA 1I4XA 4ZAIA 2A68D 3EFXD 1WTXA 2SDFA 5I4DA 1QE6A 3OMCA 2K05A 4EVOA 1D5MC 4CKCA 4G7HC 1PTOC 2NVXB 2QILA 3MC0B 1ZEQX 5K5PA 3ONAB 2WIIB 2PMZB 4KMUC 5IOCA 1Y69U 3RZDB 3BDOA 2XSCA 1IKLA 3J81E 3QB3A 4LK1C 2LKVA 5CV8A 2NVTB 4HCSA 4QUCA 2B2VC 3IFDA 1FNUA 5IGDA 1V1PB 5JOBA 3PV0A 2O5IC 1PFMA 3X3MA 2EZVA 4DFAA 1Z7TA 3S1RB 2F0DA 3C1EA 1JE4A 4L6TB 5E1FA 1EZ6A 4QIWB 2NTSA 5I9OA 3MTSA 3A8IE 4A3DB 3J7YW 3HKZB 1XYIA 4ZUJA 4CKBA 4FVMA 4JBWA 3FVQA 3MEHA 1WTOA 1HRJA 3V05A 3BDLA 1CQFA 5T1IA 4FXDA 1DONA 1Q3LA 3P1HA 3QG1A 5I2XA 1BXTA 4FF4A 4DNTB 1BUVT 1HPCA 3CU7A 4Z9CB 2G9HD 4A3FB 1DXMA 4BWGB 3AU7A 2NYZD 2K32A 4HMIA 1STHA 2D62A 3Q23A 3S16B 1WVLA 3V2TA 5EKIA 1XWEA 4XXEA 1BNZA 1MBYA 1PXUA 1RF2D 5JVH3 1I50B 2K1BA 4FP5D 5E4WC 3E0JA 4K2KA 3Q6SA 3R3OA 4HAEA 1VF5C 1TWAB 2F3WA 2B2YA 2NB0A 4QMGA 5COYA 4XDXA 4NDXA 2A69D 1V43A 3OOCA 1STAA 1TS5A 2F0TA 2F0IA 5AFWA 1GUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F87 A;  4ZRZ A;  4F88 A; 
#chains in the Genus database with same CATH topology
 1HR0 L;  3J80 E;  4ZYS A;  4JI2 Q;  4BBR B;  2XTI A;  4RCO A;  5EPL A;  1SSO A;  2RBM A;  5I6Y A;  1AFP A;  5IT9 c;  1ZKO A;  4GN4 B;  3A54 A;  2R7Z B;  2N78 A;  5JJZ A;  2HHH Q;  5J1Z A;  1SYG A;  3LX0 A;  1OO9 B;  4JK1 C;  3K57 A;  3H94 A;  1S5E D;  3K5O A;  3M4O B;  4G4K A;  2F0H A;  3STB D;  1XMO Q;  2B3G A;  2VUM B;  3TEH B;  4AIM A;  1H95 A;  2UUB Q;  1PV4 A;  2K04 A;  5C4J B;  4JW0 A;  3NHH A;  5IP9 H;  1VQF A;  4RG1 A;  1VQE A;  4IPC A;  5C4X G;  5KIX A;  4EQP A;  2I5H A;  4HJA A;  1S3O A;  1SMX A;  4JVZ A;  3SHL A;  1IBL L;  5C4H A;  3PO2 H;  1IYU A;  1CTM A;  1WTP A;  2ZJQ A;  4I7Z C;  1D5Z C;  1NMG A;  5CYU A;  1Y1V B;  1EFI D;  1JC7 A;  3MXG A;  4GKK Q;  3J81 i;  4Y52 H;  5CMD A;  1VQO A;  1PZK D;  4HED A;  1FGB D;  1TVX A;  5C3E G;  3QWN A;  4OIK A;  2K33 A;  3I55 A;  4O42 A;  4G7O C;  1JB7 A;  3MVV A;  1SEB D;  1JWM D;  4PMW A;  4DAV A;  1KAW A;  2RVL A;  4IUP A;  2E5L L;  1N8R C;  4IOA A;  1K3B C;  1VQK A;  4OO1 H;  4NP5 A;  3T1H L;  2BA0 A;  4B3R L;  2CCZ A;  3DWP A;  2K5W A;  2J4X A;  2R6G A;  2I0Q A;  1PFN A;  2IWH A;  4C3I B;  4A3M G;  3PO3 G;  1AZQ A;  2AWN A;  1EYD A;  2FMC A;  3PCO B;  1B8A A;  4DV4 L;  1EWC A;  2NVX H;  4UY8 C;  5CR3 A;  3NSW A;  2DJG C;  1N36 Q;  3A5Z B;  4H0L C;  4MIU A;  1S4Z A;  3FKI B;  1HNX Q;  1CKN A;  1AN8 A;  4IFD G;  1SBB B;  4KTA A;  3F2D A;  2VQF Q;  1K8G A;  5LMN Q;  4A3E G;  4F88 A;  1YIT A;  1EIH A;  1MGS A;  3RZD H;  2LXK A;  1F2L A;  4A93 B;  4KJN A;  1K9M C;  2HDM A;  1TU2 B;  5D3D A;  2QF7 A;  1TQO A;  5M5X H;  2NVT H;  2MJ8 A;  2MO1 A;  4IN3 A;  3EVQ A;  5D65 A;  3VA5 A;  1GD7 A;  1SMY D;  1DM0 B;  1HFN A;  1EEF D;  5JJK A;  1EY9 A;  1PZI D;  4PMB A;  3VR4 A;  4WFN 3;  3JAM E;  3UDG A;  5FLX c;  3S14 B;  2A6H D;  2VL6 A;  1C9O A;  3TP6 A;  4DR1 Q;  3P7J A;  3VDY A;  1SN8 A;  2F3V A;  5FLM G;  2KQ3 A;  1VQC A;  3A74 A;  5IWA Q;  5CV5 A;  4DKA C;  1I5F A;  5ELF A;  4A3D H;  4DAM A;  3VYR A;  3GQB A;  2CW0 D;  1F9P A;  2ATW A;  2UUA Q;  4HCE A;  1QNK A;  1QOH A;  5IT9 E;  1W3S A;  5FO7 B;  4IJL A;  3HOX B;  3NE5 B;  5IYB G;  4O1N A;  4LW1 A;  3F2B A;  3TRZ A;  4JV5 Q;  2RA4 A;  2XWJ B;  4JCV E;  3VYU A;  2PPB C;  5EGT A;  5GAD C;  2QCP X;  3OMG A;  4V19 0;  1EY7 A;  1JIC A;  4RGO S;  4BY7 B;  2BH2 A;  4BBS B;  3KFU A;  3GTP B;  1CQV A;  2B8G A;  1WCM G;  1ICW A;  1QB5 D;  3GTG B;  1HHV A;  1O7L A;  2PQA B;  1VMC A;  3H15 A;  4K8J A;  1PMR A;  2L12 A;  3OW2 A;  2BA1 A;  2RSO A;  2LY7 A;  1LAC A;  5KRU A;  4DR6 L;  3I3C A;  1BBX C;  2I07 B;  3S16 H;  4Y7N B;  1VQ6 A;  3NTI A;  1B3Q A;  4KKT A;  1YNX A;  4JI1 L;  4ZKB B;  4JYA L;  5CBE E;  1UWV A;  1CKN B;  3C3L A;  2JA7 B;  2LMC B;  5KND A;  1HTP A;  3K81 C;  2NZ1 D;  1YHQ A;  1E24 A;  4KLK A;  2IX1 A;  5JPM C;  5KNB A;  3NBI A;  5EAY A;  4DV1 L;  2DUD A;  5H1S E;  1SJH D;  3I90 A;  5M3M G;  4KD3 A;  5F2D A;  1CHQ D;  1TWA H;  1U4P A;  5CBA E;  4OWT B;  1VQG A;  2WIN B;  2LXJ A;  4DV0 L;  5M3F G;  2IJ0 A;  1SNO A;  1A2T A;  1OXX K;  2L0C A;  2WV6 D;  3CPF A;  1LTB D;  1B53 A;  1Z9F A;  1SXT A;  3A0J A;  3SR1 A;  1HQR D;  1TY2 A;  2F0L A;  4OHJ A;  2K52 A;  2F0S A;  3HOZ B;  4K5X A;  5IYC G;  4J1M A;  4BBR H;  4F7X A;  1W2B A;  4DGZ A;  1BBU A;  2C9O A;  3E9H A;  3G6E A;  1GHJ A;  4RWS C;  3IL8 A;  5DLQ E;  1SJE D;  1CT1 D;  5BN3 A;  1PH7 A;  4L5T A;  4A3I G;  1GUN A;  2KCT A;  2IPK D;  5E7N A;  4LAA A;  4OWW B;  4R4Q A;  3K5L A;  3M4O H;  2A6E C;  5C0X G;  1T9H A;  2VUM H;  5HY6 A;  1HUN A;  4HJ8 A;  2K5Q A;  1X9N A;  2LS0 1;  1TII D;  5C4J H;  2FFK B;  1YNN D;  4NXM Q;  3M4Q A;  4XQN A;  2KEE A;  5CGK A;  1VCI A;  1WYD A;  3AQQ A;  4UP8 A;  3NEN A;  4LF7 L;  4DK3 C;  2BDN A;  1I4P A;  4DAY A;  4C2M B;  1UAP A;  2N88 A;  1E2W A;  1A62 A;  2IY5 B;  1Y1V H;  1PDQ A;  1S5D D;  4R8I A;  2UU9 Q;  1I4H A;  3ZYY X;  1CA6 A;  1QVG A;  3M4P A;  3UDF A;  1LT3 D;  4OIJ A;  5IGC A;  4K14 A;  3R8B A;  1TT2 A;  5J3B A;  4KY6 A;  4POG A;  2EDG A;  3T53 B;  3BYY B;  1IBK L;  1L2F A;  3I73 A;  2XGT A;  5M5Y B;  4ME3 A;  1I6H H;  4ZUI A;  3MFY A;  4X3S A;  5DEH A;  3W1B A;  5FJ8 G;  1BKB A;  1EYG A;  2FHT A;  5A2Q L;  1T5E A;  1VDZ A;  2VQE L;  4BY1 B;  2HCC A;  1EOV A;  4JOI A;  4YHH Q;  2HCI A;  5FO9 B;  3NTK A;  3WOF A;  3U4V A;  4P71 A;  1OXU A;  1TWC B;  4NXN L;  1MSG A;  4P2C B;  4YCV A;  4QF4 A;  1F9Q A;  4C3I H;  5JPN C;  1V1Q A;  3MFG A;  4DR2 Q;  3QOL A;  4APV A;  1SYC A;  2ZJP A;  3RN5 A;  2MUY A;  2OQK A;  1LO5 D;  2PZT A;  4IPD A;  2K03 A;  2IHE A;  1E2Z A;  3PIP 3;  2R61 A;  1QJO A;  1X65 A;  1GUG A;  2SNS A;  4DNR B;  3FPU B;  3DUZ A;  3CCM A;  2OCE A;  1QCB D;  2UUC Q;  1NE3 A;  4JI5 L;  4J8Q A;  3MZ5 A;  4A93 H;  2JYO A;  1G91 A;  2AQ1 B;  2NUC A;  3LWE A;  3VA7 A;  2K5D A;  3U58 A;  3M7G A;  4QUF A;  2MPM A;  1UE6 A;  1Q86 C;  4A3G B;  4B3T L;  1JQY D;  2CWP A;  2SEB D;  1VF7 A;  4GOP C;  2YV5 A;  1E3P A;  2ZTC A;  3AB9 A;  3D4W A;  4TSS A;  3S14 H;  1HQM C;  3MHB A;  3CCU A;  4A3J G;  1WTR A;  4G57 A;  1ASY A;  4DUY L;  4PZ8 A;  2P5Z X;  1SE4 A;  1QG7 A;  1R4P B;  1EU4 A;  3S1Q B;  1BDO A;  3SDZ A;  3SE0 A;  2NZO A;  1E2V A;  1V1P A;  4M1U B;  2F0F A;  3PUW A;  1ASZ A;  4DAY B;  2A68 C;  2BDO A;  3LNN A;  3HOX H;  2KEC A;  1BF4 A;  2WB1 B;  1YI2 A;  2VW9 A;  1N34 Q;  2WP8 J;  3SK8 A;  4PV1 C;  4LF6 Q;  1B3A A;  5LHY 1;  5EPK A;  3H3V H;  3D4D A;  1TWF B;  1S5C D;  2IT1 A;  3CCQ A;  3WDN A;  4DUZ L;  1NAP A;  3E3X A;  3ND8 A;  4BY7 H;  1LT6 D;  4BBS H;  5EKL A;  2F1M A;  3GTP H;  1WTV A;  3HS0 C;  4LFA L;  1ENF A;  1RL2 A;  4IFD I;  1PYS B;  4FXG C;  2ZTE A;  4ABN A;  4LF9 L;  3GTL B;  4QQB X;  4KHP L;  5C44 G;  3OWE B;  1BCP F;  4LFB Q;  3S1M B;  1B4O A;  4DV6 Q;  1A15 A;  1H9R A;  4R4I A;  4RH6 A;  4Y7N H;  2WAQ E;  1X3F A;  3HOV B;  4L8J A;  3GTJ B;  1X56 A;  2K75 A;  3J81 L;  2JA7 H;  2NN6 H;  3KBX A;  1OXV A;  2ID0 A;  3KK7 A;  3HOU H;  3KLS A;  3EBE A;  1XMQ L;  4MNO A;  2MO0 A;  1SE8 A;  3TZU A;  1E0B A;  1X3E A;  1PRT F;  2GA4 B;  2K7V A;  1K8M A;  1D7Q A;  1LT5 D;  4K0K Q;  4LJZ C;  1BVS A;  5D3I B;  2YTX A;  1F2M A;  1B9N A;  3J80 c;  2XRS D;  4XT3 B;  4K5W A;  4QB4 A;  3L2P A;  3S17 H;  4A3C G;  2HQL A;  2Z8L A;  2Y0S G;  2JSO A;  1VQB A;  2PZU A;  3E6Z X;  4JI8 Q;  2HT1 A;  1KD1 C;  4TVA B;  2KHS A;  1NBW A;  2L9H A;  2ENB A;  4O2D A;  2F3I A;  4CDC C;  3HOZ H;  3SK6 A;  2ICE C;  2B2W A;  5M5X B;  1NR4 A;  5DNF A;  1GUW A;  5AJ3 Q;  3PMF A;  2HIV A;  2V1C C;  2OEO A;  1ZYR D;  2JA5 B;  2KOL A;  1ENC A;  3L9A X;  1G6P A;  2EIF A;  4YY3 Q;  1I4Q A;  2D9U A;  2F0P A;  2Z6B A;  5LL6 X;  1NJI C;  5BR8 Q;  3UE1 A;  1LT4 D;  2ZM6 L;  3A56 A;  1H9J A;  1R9T H;  3KLW A;  1G2T A;  1Q1E A;  3GTO B;  1WI5 A;  1AE3 A;  1I3Q B;  3I7F A;  1EIY B;  4LUZ A;  3IAY A;  4JI7 L;  3HFZ B;  4DV5 Q;  1G6Z A;  3MA2 B;  2K14 A;  3TBI B;  2OQ0 A;  1HZA A;  3I91 A;  2EXZ A;  1HNZ Q;  4X64 Q;  3HKS A;  4I65 A;  4UDU C;  4C2M H;  4C1N I;  3DLL A;  5IE8 A;  2KA7 A;  3RZO B;  1ILQ A;  4GLX A;  1SLJ A;  2F4V L;  2PMZ E;  2BCO A;  4DV3 Q;  5C4X B;  4JI0 L;  1SNP A;  4IFD J;  2PZW A;  3BG3 A;  5BN4 A;  2JXM B;  2A69 C;  1W6K A;  2R92 G;  3PUV A;  3ULL A;  4RKB A;  1U4R A;  3RUZ A;  4POF A;  4GKJ L;  3CCL A;  1A3U A;  1B44 D;  1PFS A;  1JR0 D;  2OXP A;  4AYB G;  5C3E B;  1XPO A;  1STN A;  2KEN A;  1SNQ A;  2OF1 A;  2KVM A;  1JOK A;  4BY1 H;  5I2Y A;  5DM7 3;  3L7Z C;  4RGN A;  4JI4 Q;  1S5B D;  1SAP A;  5JJI A;  3M85 A;  3R2I A;  3CQZ B;  1G29 1;  4QIW E;  2NZH A;  2WAC A;  2E74 C;  3J7A F;  4JI2 L;  4HJ5 A;  4OX9 Q;  2TMP A;  3OIP A;  2L1B A;  4YCW A;  1Y1W H;  1C8C A;  3BZK A;  3HKZ E;  3CHB D;  3STB C;  2HHH L;  4GN5 A;  4H7B A;  2JA8 G;  2UXD Q;  4NPS A;  4P74 A;  1C4Q A;  3CCJ A;  4FF1 A;  4DXG A;  5M5W B;  1NUC A;  3A8K E;  3IKJ A;  2QEX A;  4A3M B;  4LF8 Q;  2DN8 A;  4QY7 A;  1XMO L;  3H3V I;  3NEM A;  4GNX A;  1G8Z D;  1QUQ A;  5D14 A;  3JAM c;  2PNR C;  2UUB L;  1FVI A;  4KKS A;  1KNE A;  2RCN A;  1HFG A;  2GN5 A;  1IKM A;  4XYQ A;  2F0O A;  2K4K A;  5LMN W;  3RLN A;  4A3G H;  3AFP A;  5GRO A;  3X3N A;  1EY6 A;  1CK1 A;  2B63 G;  3CCV A;  4TKO B;  2G9D A;  3D6W A;  1N9W A;  3EIV A;  4LFC L;  2PNH A;  4GKK L;  3CCR A;  3U4Z A;  3S1Q H;  3SK5 A;  3BZC A;  3CRK C;  3H0G G;  2DNE A;  3G4S A;  4KHZ A;  1A3T A;  2R93 H;  4CBV A;  4DAP A;  1CSP A;  2L4N A;  4WJ3 M;  3CXC A;  5GAG C;  3KF6 B;  2A19 A;  1CKO A;  2HQE A;  1NR2 A;  4A3K G;  1PTO F;  2NN6 I;  3A55 A;  3K80 C;  4AQY Q;  2K5N A;  1TWF H;  3AEV A;  3TN2 A;  4Q5V A;  1SFO B;  3HKZ G;  1KAA A;  3ND9 A;  1JB3 A;  1QZG A;  1U0L A;  3FEW X;  2RCF A;  1VQA A;  5C6A A;  4DV2 Q;  2HIX A;  1BCP B;  4JOI C;  1O7Y A;  1V8Q A;  3DMU A;  3FRP B;  4B9W A;  3PIP A;  4FF3 A;  2A73 B;  1N36 L;  1VQL A;  4YWM A;  2B2U A;  4XIG S;  4DK0 A;  5J39 A;  4JI3 Q;  1HNX L;  4NKL A;  3GTL H;  4B9X A;  2F0W A;  4Q0F A;  2VQF L;  3S1M H;  5LMN L;  4WJW A;  4JC0 A;  3HRZ C;  4A3L H;  1AP0 A;  3O13 A;  3HOW G;  3TDQ A;  1I6H B;  1SMY C;  4O0A A;  1L1O A;  2DNC A;  2JA6 B;  3MXP A;  4C56 C;  3CAM A;  4A3F G;  1PRT B;  1PYB A;  1VS0 A;  2A6H C;  3HOV H;  1J8I A;  3PIO A;  3GTJ H;  2PQA A;  3AYH B;  1VQ7 A;  4N9T A;  1A6X A;  1IZ6 A;  2NTT A;  4XQJ A;  3RMH A;  1TR5 A;  1YNJ D;  1F2Y A;  5ELD A;  2BOS A;  4GNX B;  2CW0 C;  3T56 B;  1QUQ B;  2Z6K A;  1D6E C;  1TWG H;  4DXF A;  3TME A;  4DR1 L;  2KHI A;  1ROD A;  3KYH C;  5ELC A;  5IWA L;  1KDA A;  1LTI D;  1CI3 M;  3KLR A;  1BR9 A;  2L5T A;  1WD0 A;  1EUJ A;  2I5M X;  3S1N H;  1LM0 A;  2UUA L;  3K58 A;  2K50 A;  3T1Y Q;  2WFW A;  3ERS X;  5M3M B;  2GVB A;  1PH2 A;  1YJ9 A;  1NMF A;  1VMP A;  5IT9 L;  5HUR A;  1K0R A;  1KLG D;  5M3F B;  4JV5 L;  3K6O A;  1J5E Q;  2OTL A;  3ITP A;  2PO4 A;  1N32 L;  1KRS A;  3RR5 A;  4JBK A;  1RTO A;  3BYT B;  1K8A C;  4OWX B;  4LWC A;  2JA5 H;  3FP9 A;  4EX5 A;  3S15 B;  2DJF C;  2E8G A;  3K7A B;  4E6I A;  2YTV A;  4BXX G;  2E5L Q;  5COR A;  2CHB D;  3EN2 A;  1IL8 A;  2R7Z G;  5K36 G;  1MSH A;  3GTO H;  3NQI A;  1WTQ A;  4BA2 I;  1I3Q H;  3ZJY C;  2F0E A;  1IBM Q;  2VY3 A;  2IW3 A;  1UE7 A;  2B8F A;  1B70 B;  3C2P A;  3K5N A;  3GTQ H;  3S2H B;  5DAU A;  4HSP A;  4L63 B;  1LYL A;  3RZO H;  1U9R A;  1HZC A;  5C4X H;  2ZJR A;  3NXW A;  4DR4 Q;  1ILP A;  1JOQ A;  4XYO A;  3Q22 A;  2ZT9 C;  2AQ2 B;  3W1G A;  1L1O B;  3K59 A;  3J80 i;  3QR8 A;  2YYZ A;  3T16 A;  1SRO A;  2N8N A;  1Y1V G;  5C3E H;  2Q2T A;  1J6Q A;  3WWV A;  3FPP A;  3H6M A;  2L55 A;  4KN7 C;  4K6L A;  4JPB W;  2QW7 A;  1PH4 A;  1QWY A;  3DXJ C;  3CQZ H;  4HIK A;  1Q8K A;  1TKW B;  1DOK A;  2VB2 X;  3HOY G;  4NW2 A;  1BO0 A;  2M00 A;  3BVG A;  3I4L A;  2CQO A;  4J6H A;  3A8J E;  1KC8 C;  4JG2 A;  5JEA J;  3HOU B;  1GUT A;  1GO3 E;  2EYP A;  4FF2 A;  2O2L D;  4A3B G;  4EQN A;  5FOB B;  1YNN C;  5M5W H;  4DV7 Q;  4DU9 A;  1UUP A;  1GVP A;  1Q8I A;  4A3M H;  3PO3 H;  1B9M A;  4LF5 Q;  1IXR A;  1UE5 A;  5JJL A;  3S17 B;  4GLA C;  2TSS A;  2JEA I;  4NXM L;  1FJG Q;  4IUU A;  4IFD H;  1HCZ A;  3FKI G;  2SNM A;  2E75 C;  5FLX L;  1E22 A;  3MWY W;  2EXD A;  1KTK A;  4C3J G;  1II3 A;  5A35 A;  2IL8 A;  3QJY A;  2VZA A;  1AW7 A;  1IL2 A;  4A93 G;  4QCL A;  3NQT A;  2UU9 L;  3H91 A;  1IW7 D;  3AFQ A;  2MP1 A;  1PTO B;  3RLF A;  3VR5 A;  2ZXR A;  1WTW A;  2F0U A;  2O4X A;  2WKC A;  1K28 A;  4KY5 A;  1YHB A;  4DR3 L;  4DR6 Q;  3DHQ A;  5NUC A;  4C3H B;  3T13 A;  4A3J B;  4YIJ A;  1TY0 A;  5IYD H;  3SXH A;  1E1T A;  1K83 B;  4JBJ A;  1R9T B;  1Q1B A;  4UP9 A;  1YHA A;  3CKI B;  4UP7 A;  3TS2 A;  3VYS A;  4YHH L;  1JOO A;  4IOC A;  1SFO H;  4P75 A;  1ONL A;  4ULL A;  3TS0 A;  1BBW A;  4DV1 Q;  2IX3 A;  4ODG A;  2CVR A;  3HOX G;  1PH8 A;  1RKN A;  3C46 A;  1XPR A;  1SR3 A;  2EYJ A;  1B1Z A;  1EQQ A;  1HUM A;  1VQ5 A;  3I4N B;  1FYC A;  1ESR A;  2WKD A;  1AH9 A;  4PG3 A;  3FMC A;  3JAM i;  3E9I A;  1PH9 A;  1TS4 A;  1F9R A;  2UUC L;  4PQX A;  1U5K A;  5FK9 C;  1WCM H;  2AHO B;  2JA6 H;  2L11 A;  1I4G A;  3G71 A;  3HGB A;  2B2Y C;  4UAI A;  1EIG A;  1XTD A;  3EA6 A;  5C44 B;  2EYL A;  3NBH B;  2C5C A;  3F8T A;  1SE3 A;  1MHW C;  2K01 A;  1RTN A;  2EE1 A;  2D0O A;  2SOB A;  5G3L F;  1XNR Q;  3OTO Q;  2RHS B;  3E5S A;  1RIP A;  2HDL A;  3TP8 A;  1Y1W B;  1GM5 A;  4CDE C;  1H9M A;  3A7A B;  4JI6 Q;  2MQH A;  1BCP D;  2F0J A;  4B08 A;  2O5J C;  5GQO A;  1GXD C;  2J0T D;  1E1O A;  5EJW A;  1ET9 A;  3Q24 A;  5JVG 3;  4DA2 A;  2NWG A;  1EYC A;  4K6D A;  1XX8 A;  3MEF A;  1ET6 A;  2RQX A;  5M3M H;  4RGM A;  4K5V A;  2NVY B;  3GD7 A;  4B3S Q;  1Z47 A;  1N34 L;  5JAV A;  5M3F H;  3GO5 A;  3DM3 A;  1K3R A;  4LF6 L;  3TQY A;  3MAQ A;  3FDT A;  3HZX A;  2Y0S B;  4DN4 M;  3D8G A;  1JOR A;  1PRT D;  4GN3 B;  1K0S A;  3I72 A;  3PUZ A;  2F52 A;  4J15 A;  4RA8 A;  2EYM A;  2FJ2 A;  3PIO 3;  3K0Y A;  4OL7 A;  1EY8 A;  2KCN A;  2QEJ C;  5IYC H;  3S15 H;  2EJF C;  5A2Q E;  1TS3 A;  3K7A H;  4KD4 A;  1QZH A;  3DM1 A;  3QIA A;  2RDH A;  1V1O A;  3CD6 A;  3CMA A;  5CV9 A;  4A3I H;  2Z1C A;  1E7Z A;  1A0I A;  3ER0 A;  2EY6 A;  4QL5 A;  2M2L A;  4TQU S;  1DYQ A;  4LFB L;  2R93 B;  4DV6 L;  2EOT A;  4U67 3;  1D1I A;  1H9S A;  1DZ1 A;  4F8M A;  4YWL A;  2B2U C;  4XQQ A;  3S2H H;  1KAB A;  3I4M G;  1B7Y B;  4X3U A;  2ICI A;  2EYO A;  1KQS A;  5EBC A;  4U68 A;  4R9W A;  1LTT D;  3P20 A;  3TZD A;  5ELB A;  3R93 A;  3A5U A;  1M90 C;  4DPG A;  3DEO A;  1Y8N B;  4JI5 Q;  1RDP D;  4K0K L;  3S24 A;  4OXP A;  1I6V C;  3PGZ A;  1X3Q A;  2EYF A;  3M9B A;  1EY5 A;  3D31 A;  3BVZ A;  4MTN A;  3M3Y B;  2F03 A;  3NTH A;  2N3S A;  4B3T Q;  2R92 B;  4BS9 A;  4JI8 L;  1IHZ A;  1EQT A;  1Q81 C;  2KUM A;  3AMU A;  1ZYR C;  5EPJ A;  3OIQ A;  3MXN B;  4ZK9 B;  1HA6 A;  4G7Z C;  5CC4 A;  4AYB B;  2X69 A;  5FJ8 H;  3CC2 A;  1QIL A;  5AJ3 L;  4KI0 A;  1MI2 A;  1NNX A;  2JN4 A;  1K73 C;  4BY1 G;  1P16 A;  3OYY A;  3N52 A;  1XTC D;  2WB1 E;  1L0Y B;  1TWG B;  3PSI A;  2PI2 A;  1FR3 A;  5BR8 L;  1PFB A;  3GDE A;  4H13 C;  2BE5 D;  5FKA C;  4DNI A;  2A74 C;  1TWH B;  3GTM B;  1YBY A;  3S1N B;  4BA1 I;  2JA8 B;  1STG A;  5LMU Q;  5FO8 B;  4V0B A;  1FGU A;  1SNC A;  2XNA C;  4DV5 L;  4LF4 Q;  5LL6 S;  4RHS A;  3G48 A;  4R4O A;  1FD7 D;  2DGY A;  4EGV A;  5C4Z A;  1HNZ L;  4HN7 A;  4ID6 A;  4X64 L;  2UXC Q;  1KDC A;  1YZ6 A;  5EBD A;  2B2T A;  2F4I A;  3H09 A;  1P8L A;  1D2B A;  1M4V A;  1DOL A;  1J9O A;  1PTO H;  1F77 A;  2LFN A;  1HNW Q;  1H9S B;  2B63 B;  3S2D H;  4WOR A;  2XIW A;  1HJP A;  1JJ2 A;  4C3H H;  3TP7 A;  2C35 B;  4A3J H;  2ZXO A;  3CW2 C;  3ERO A;  1K83 H;  1Q7Y C;  4B3M Q;  2WAQ G;  3HP3 A;  2GVA A;  5JEA H;  3H0G B;  3KLS X;  3BJU A;  2XVS A;  1N33 Q;  2KED A;  4JI4 L;  1EEI D;  3G7L A;  1XMQ Q;  1OXT A;  4CDF C;  2VXW A;  3GTQ B;  4QGU A;  2PQE A;  2JJQ A;  1Z6H A;  3I70 A;  4R4T A;  4N8X 1;  4A3K B;  3GP7 A;  4OX9 L;  2WB1 G;  4IQZ A;  3KF6 A;  3M7N A;  5IP9 G;  3NWT A;  1AE2 A;  3J7A 5;  2UXD L;  4FDB A;  3I4N H;  2UXB Q;  1PTO D;  5M9O A;  3PO2 G;  1C0A A;  2PCF B;  5IGG A;  4ZKC B;  2H5X A;  4RGT A;  2CFM A;  3E0E A;  4IO9 A;  2RF4 A;  2DY7 A;  4CKE A;  1CFM A;  1VQI A;  4PMC A;  1PA6 A;  1LTA D;  4NMZ A;  4X65 Q;  5HGT A;  2RKS A;  2VS1 A;  5C44 H;  1WJJ A;  4ILW A;  1HR0 W;  1PH3 A;  4RCN A;  2Z4H A;  4DF7 A;  3NPP A;  3HOW B;  2PW7 A;  4WRD A;  1L0W A;  5C3X A;  3CP0 A;  5IP7 H;  3J80 L;  1XNQ Q;  1RHP A;  1SYD A;  3KJP A;  3IFT A;  1LTS D;  4OO1 G;  4HJ7 A;  1M8A A;  1I94 Q;  1Y8O B;  1I4R A;  1CM9 A;  4R4C A;  4R8N A;  3OHX C;  1S40 A;  3ULJ A;  1EY0 A;  1STY A;  4GS3 A;  1X3P A;  5C0X I;  1JJG A;  1VQ9 A;  3PO3 B;  2EQS A;  4FO2 A;  2NVY H;  1U4M A;  2F0V A;  2XWB B;  2H4O A;  3KUP A;  2KCC A;  4AQY L;  4A3C H;  3G6J B;  5E4X A;  1A3V A;  5CV6 A;  3K7U C;  4A3E B;  1AEX A;  4DV2 L;  1IYJ B;  1IYV A;  4GKJ Q;  4A75 A;  2K5V A;  4K2L A;  3CC4 A;  2V4D A;  2JEB I;  3VR6 A;  3L3O C;  1T5X D;  4X66 Q;  3ULP A;  3PUY A;  1PH5 A;  3CCS A;  1WOC A;  3U9O A;  4DR7 Q;  4IUV A;  2JQO A;  4ZRZ A;  2AUK A;  3EQL C;  1YIJ A;  4JI3 L;  1QVC A;  2H1E A;  2CH4 W;  2PI2 E;  5KNC A;  1SRU A;  1O7I A;  4X62 Q;  3ICE A;  1GUS A;  4DR5 Q;  1AZP A;  3OPO A;  4LNQ A;  1CZG A;  1BQQ T;  2OTJ A;  2E2J B;  1Q82 C;  1YNJ C;  4CJ2 C;  3BVM A;  1EOT A;  4X6A H;  4WJ4 A;  3OW7 A;  4A3D G;  4CJ1 B;  1SYF A;  5EQ0 A;  5DM6 3;  1X3G A;  1X6O A;  1KDB A;  4IUQ A;  3OSO A;  1CZW A;  3QO2 A;  3GV6 A;  1A63 A;  4KJO A;  2QGQ A;  1YJN A;  3WOE A;  1VQJ A;  4M8A A;  4GOP A;  5CV4 A;  3KDF B;  2DY8 A;  3P75 A;  1WTH A;  4DK1 A;  1JWS D;  3R2T A;  1MD2 D;  3M3Y H;  3CCE A;  5I6W A;  2R92 H;  1RJT A;  3T1Y L;  3SVM A;  1HR0 Q;  5HGQ A;  2NVQ B;  2XRQ D;  4A4I A;  1DJR D;  4NB3 A;  2QA4 A;  4I7A A;  1WCM B;  1D5X C;  3CC7 A;  3TSS A;  1DGS A;  1W6J A;  5KEE A;  1KRT A;  1J5E L;  4LFC Q;  1SND A;  1ICF B;  5E3F A;  2AWO A;  2X6G A;  1HZ9 A;  4L5R C;  2D5D A;  2Q2H A;  4KY7 A;  4ZLT F;  3UI2 A;  2YU9 B;  2I46 A;  5KYL A;  5KYI A;  3DEP A;  1C48 A;  2EY1 A;  3HOY B;  3F2U A;  3D4R A;  3JAM L;  5C5M A;  1LUZ A;  5C0X J;  3NEL A;  1KIX A;  4RFB A;  4FYD A;  1CUK A;  3RD4 A;  3Q0A A;  1Y8P B;  1PZJ D;  1TWH H;  3GTM H;  1VQ4 A;  2JA8 H;  2QDB A;  2MHV A;  4RAU C;  4DK6 C;  2EY5 A;  4A3B B;  1IBL Q;  1PYW D;  3M4Y A;  1IBM L;  4IAL A;  1Q12 A;  3B6Y A;  1VQP A;  4X3T A;  4OON A;  4JBM A;  1L0X B;  2FXQ A;  1A8V A;  2D2C C;  2EY2 A;  1EQV A;  1VQM A;  4PZ7 A;  2Q8I B;  3KBG A;  1PLF A;  4TRD A;  3W3A A;  4DR4 L;  2K5H A;  5L37 A;  4C3J B;  1SDF A;  2B63 H;  2R7F A;  2MFI A;  3DWQ A;  4EQ5 A;  1UEA B;  1VQN A;  2E2H B;  4BBR G;  2Q8T A;  3K5M A;  3SEB A;  3UDX A;  3T1H Q;  4A3I B;  2KJX A;  5ELE A;  3VYT A;  4B3R Q;  3T51 B;  1G51 A;  2HD3 A;  2M9V A;  3H0G H;  5IGF A;  1V9P A;  2HUG A;  1HZB A;  2L15 A;  1B50 A;  3J7A V;  1STB A;  3S1R H;  3KOJ A;  3F2C A;  3NK9 A;  5ISR A;  2A1A A;  2X6L A;  1A2U A;  4GOP B;  1DCZ A;  5IYD G;  2VUM G;  4A3K H;  4DV4 Q;  1EIF A;  1SYE A;  1WD1 A;  3DWA A;  2F0Q A;  2VB3 X;  4MHE A;  1K8O A;  4KK7 A;  4FXK C;  2CKZ B;  2YTY A;  5I9P A;  2ASB A;  4H02 A;  2B2V A;  4DV7 L;  4YCU A;  3UDI A;  3UE0 A;  1KNA A;  2F0M A;  3A7L A;  1G2S A;  3I56 A;  3GTK B;  4KN4 C;  4LF5 L;  1N32 Q;  1HA5 A;  1H9K A;  2PW5 A;  1YEZ A;  3MXU A;  2RHQ B;  3K0X A;  3T4A C;  1MKH A;  1FJG L;  1QVF A;  3HEJ A;  3I8Z A;  4GLV B;  3CPW A;  1EU3 A;  2ZTD A;  1IW7 C;  1HXY D;  4GZY C;  4C1N K;  1CHP D;  3HOW H;  5C5L A;  1EWH A;  5TSS A;  4A3F H;  3TRE A;  2JA6 G;  4MZ9 A;  2XN9 C;  1MJE A;  2RSN A;  4KV6 A;  1ZXT A;  1GOZ A;  3NP8 A;  4OGQ C;  2B2W C;  1O78 A;  1NSN S;  3TP5 A;  2B2T C;  4CJ0 B;  3NBH A;  1VQH A;  2KCM A;  2OT2 A;  2AQ3 B;  4R1J A;  4C3I G;  2E76 C;  4CGY B;  4OEL B;  2AUJ D;  5G3L D;  4HR7 B;  1I50 H;  2Z4I A;  2IHF A;  1GJX A;  4A3E H;  1LTL A;  1XXG A;  4HSV A;  1FNW A;  2FIN B;  1ENA A;  2A5H A;  4ME5 A;  2AKW B;  3KF8 A;  1D8L A;  1Q90 A;  2AMC B;  3D6C A;  2F0N A;  5GAH C;  3BDC A;  3S2D B;  2FMM A;  3J81 j;  2K6A A;  4BXX H;  4N9P A;  4MTK A;  1LAB A;  1R4Q B;  5FLM H;  4JI1 Q;  4JYA Q;  2J7Z A;  4X3K A;  2E2J H;  2ALY B;  2OWO A;  2R7Z H;  1SYB A;  5K36 H;  1S5F D;  1PH1 A;  4IPG A;  5IGB A;  1XJV A;  1BCP C;  4IUR A;  2QKI C;  1EY4 A;  1B2T A;  3CF5 A;  3RN2 A;  5IYB H;  2F0G A;  2JP1 A;  1SE2 A;  1XNR L;  2Q2I A;  3OTO L;  1FNV A;  4DV0 Q;  4OO1 I;  3I4M B;  5J22 A;  4JI6 L;  3ERQ A;  3PF4 A;  4DR2 L;  5ELN A;  3K8A A;  5FLX E;  1C7Y A;  1DD2 A;  2K28 A;  1STE A;  2MGS A;  4ZQ3 A;  1Q46 A;  1JCK B;  2NVQ H;  1PRT C;  4BY7 G;  4FNF A;  4BBS G;  4B3S L;  4HIO A;  1FL0 A;  2B39 A;  1D1K A;  4PNY A;  1EYA A;  1LLR D;  2LSS A;  1UNS A;  1LTG D;  3LWU A;  2E2D C;  2PYK A;  4GNX C;  4HIM A;  1HH2 P;  3HG9 A;  1U4L A;  4DR3 Q;  2YU9 H;  2VNU D;  1RD9 D;  3HOY H;  3MXN A;  1F2Z A;  1NY4 A;  5IIF A;  3SK4 A;  1VQ8 A;  2JA7 G;  2NN6 G;  3URY A;  1CSQ A;  1JE5 A;  1O80 A;  2A6E D;  3RNU A;  4HMJ A;  3HOU G;  4A3B H;  4L5Q A;  4LF7 Q;  3I2Z A;  1GKH A;  3PF5 A;  1PH6 A;  3KF8 B;  3W2D A;  2RDG A;  2E2I B;  3EJI A;  4CHT B;  3NWS A;  4HJ9 A;  4EQO A;  2Q8R E;  5T1G A;  1LTR D;  2EVB A;  2N49 A;  3FKI H;  4XTC S;  4YWK A;  3J81 c;  3NUC A;  4RKL A;  1EZ8 A;  3GV3 A;  4KHV A;  4C3J H;  1F9S A;  1IBK Q;  1RCV D;  3HOZ G;  2E2H H;  3FHW A;  3PUX A;  2NBF A;  3CRL C;  3VR3 A;  2F0K A;  2VQE Q;  4OEM B;  1KHI A;  5C3W A;  3QOJ A;  3PQI A;  2EYH A;  3VR2 A;  4LUO A;  1DOM A;  4NXN Q;  1GHK A;  3JC6 6;  5EKK A;  3C1F A;  2Q2U A;  3H3V C;  2EPB A;  4HTH A;  2EJM A;  2B29 A;  4C3H G;  2JE6 I;  5C0X H;  3BU2 A;  4IUT A;  4RHR A;  4HID A;  5IOD A;  3IRB A;  1PHJ A;  2WAQ B;  3S9W A;  5IY0 A;  1KLU D;  4IZ8 A;  5JEA G;  2BE5 C;  1QNU A;  1L1O C;  3V96 A;  3CME A;  3U50 C;  5GAE C;  3BS1 A;  4MN3 A;  3D3R A;  5IGE A;  1M1K C;  4XT1 B;  1ML0 D;  5CV7 A;  1EQR A;  1NTG A;  3Q8D A;  3U9S A;  1TS2 A;  1BOS A;  2Y0S E;  3GTK H;  3BZD B;  2IX0 A;  5LMU L;  1O7Z A;  2Z6K C;  4K8I A;  5BN5 A;  3OWF A;  3PO2 B;  2CQA A;  4LF4 L;  3I4N G;  2N55 A;  1X32 A;  3RLO A;  2CWA A;  1NCV A;  1EL0 A;  4LMQ D;  4ALP A;  1UE1 A;  2EJG C;  4H44 C;  1CA5 A;  2UXC L;  4DUY Q;  1JWU D;  1KL9 A;  1HTL D;  4KKU A;  4F87 A;  4IUN A;  4LUV A;  1SNM A;  1X54 A;  3GTG H;  2ZXP A;  1KXL A;  1ESF A;  1MIU A;  4IPH A;  1LV9 A;  1HNW L;  2MNA A;  3N6R A;  2R3Z A;  2RDF A;  4YY3 L;  4S3S A;  1OXS C;  5KGU A;  1I4X A;  4ZAI A;  2Z0S A;  5IP7 G;  4RMF A;  1Y1W G;  3LGJ A;  2A68 D;  4B3M L;  3EFX D;  4DUZ Q;  1WTX A;  1JT8 A;  1WFQ A;  2SDF A;  5ELO A;  5I4D A;  2A8V A;  4PZ6 A;  1N33 L;  1QE6 A;  3OMC A;  2K05 A;  4IJH A;  4EVO A;  1D5M C;  3D0F A;  4CKC A;  4G7H C;  1PTO C;  2NVX B;  4LFA Q;  2QIL A;  3MC0 B;  1ZEQ X;  5K5P A;  3ONA B;  2WII B;  4UHV A;  4LF9 Q;  4DV3 L;  2PMZ B;  4KHP Q;  4A3G G;  4KMU C;  4UPA A;  2UXB L;  5IOC A;  1Y69 U;  1YVC A;  1JMC A;  3RZD B;  1CKM A;  4AYB E;  3BDO A;  2XSC A;  1IKL A;  3J81 E;  3QB3 A;  4LK1 C;  2LKV A;  5CV8 A;  2NVT B;  4HCS A;  4QUC A;  2B2V C;  3IFD A;  3I4O A;  1FNU A;  5IGD A;  1V1P B;  4X65 L;  5JOB A;  3PV0 A;  4N8F A;  2O5I C;  1PFM A;  3X3M A;  2EZV A;  2QDL A;  4DFA A;  1Z7T A;  1MJC A;  2F0D A;  3S1R B;  3C1E A;  2R93 G;  1JE4 A;  4L6T B;  5E1F A;  1EZ6 A;  3W5O A;  4QIW B;  2D0P A;  2NTS A;  5I9O A;  1XNQ L;  3MTS A;  3I4M H;  1TXY A;  3A8I E;  4A3D B;  1VQD A;  3J7Y W;  1I94 L;  3HKZ B;  1XYI A;  4ZUJ A;  4CKB A;  4FVM A;  4JBW A;  3FVQ A;  4L5S A;  2JA9 A;  4AH6 A;  2I5L X;  3MEH A;  1WTO A;  1HRJ A;  2ES2 A;  1XPU A;  2KBN A;  3V05 A;  4LF8 L;  4QJF A;  1PVO A;  3BDL A;  1CQF A;  5T1I A;  4FXD A;  1DON A;  1Q3L A;  3P1H A;  1YJW A;  3QG1 A;  5I2X A;  1X55 A;  3KDF A;  1BXT A;  4FF4 A;  4DNT B;  1BUV T;  1HPC A;  4A76 A;  1EWI A;  4A3L G;  2JK8 A;  3CU7 A;  4Z9C B;  2G9H D;  4A3F B;  4P73 A;  5M5Y H;  1DXM A;  2ZM6 Q;  4X66 L;  4BWG B;  3HOV G;  4DR7 L;  3AU7 A;  1S72 A;  2NYZ D;  4P72 A;  2K32 A;  3L0O A;  4JI7 Q;  4HMI A;  2KHJ A;  4ZCK A;  1STH A;  2D62 A;  3Q23 A;  4X62 L;  3S16 B;  4DR5 L;  1WVL A;  2CH4 A;  3V2T A;  1TWC H;  5EKI A;  1XWE A;  4XXE A;  1BNZ A;  2Z9H A;  2R7D A;  1MBY A;  1PXU A;  1UEB A;  2E2I H;  2F4V Q;  1RF2 D;  5JVH 3;  1I50 B;  2K1B A;  4JI0 Q;  4FP5 D;  2BH8 A;  3E0J A;  4K2K A;  5E4W C;  3Q6S A;  3R3O A;  4HAE A;  1JJC B;  3KJO A;  3SGI A;  1VF5 C;  1EFW A;  1TWA B;  2F3W A;  2B2Y A;  2NB0 A;  4QMG A;  5COY A;  4XDX A;  4NDX A;  3F1Z A;  1Y14 B;  2G5D A;  2A69 D;  1V43 A;  3OOC A;  4CDD C;  3J7Z C;  1STA A;  1TS5 A;  1OTC A;  2JA5 G;  2F0T A;  2F0I A;  5AFW A;  1GUO A; 
#chains in the Genus database with same CATH homology
 3J80 E;  4ZYS A;  4BBR B;  4RCO A;  5EPL A;  1SSO A;  2RBM A;  5I6Y A;  1AFP A;  1ZKO A;  3A54 A;  2R7Z B;  5JJZ A;  5J1Z A;  1SYG A;  3LX0 A;  1OO9 B;  4JK1 C;  3K57 A;  3H94 A;  1S5E D;  3K5O A;  3M4O B;  4G4K A;  2F0H A;  2VUM B;  2K04 A;  5C4J B;  3NHH A;  5KIX A;  4EQP A;  3SHL A;  5C4H A;  1IYU A;  1CTM A;  1WTP A;  4I7Z C;  1D5Z C;  5CYU A;  1Y1V B;  1EFI D;  1JC7 A;  3MXG A;  5CMD A;  1PZK D;  4HED A;  1FGB D;  1TVX A;  3QWN A;  4OIK A;  2K33 A;  4O42 A;  4G7O C;  3MVV A;  1SEB D;  1JWM D;  4PMW A;  4DAV A;  2RVL A;  4IUP A;  4OO1 H;  4NP5 A;  2BA0 A;  3DWP A;  2K5W A;  2J4X A;  2R6G A;  1PFN A;  2IWH A;  4C3I B;  1AZQ A;  2AWN A;  1EYD A;  2FMC A;  1EWC A;  5CR3 A;  3NSW A;  4H0L C;  4MIU A;  1S4Z A;  3FKI B;  1AN8 A;  4IFD G;  1SBB B;  4KTA A;  4F88 A;  1EIH A;  1MGS A;  1F2L A;  4A93 B;  4KJN A;  2HDM A;  1TU2 B;  5D3D A;  2QF7 A;  1TQO A;  2MJ8 A;  4IN3 A;  3EVQ A;  5D65 A;  3VA5 A;  1SMY D;  1DM0 B;  1HFN A;  1EEF D;  1EY9 A;  1PZI D;  4PMB A;  3VR4 A;  4WFN 3;  3JAM E;  3S14 B;  2A6H D;  3TP6 A;  3P7J A;  2F3V A;  2KQ3 A;  5CV5 A;  5ELF A;  3VYR A;  3GQB A;  2CW0 D;  1F9P A;  4HCE A;  1QNK A;  1QOH A;  5IT9 E;  5FO7 B;  3HOX B;  3NE5 B;  4O1N A;  2RA4 A;  2XWJ B;  3VYU A;  2PPB C;  5EGT A;  2QCP X;  3OMG A;  4V19 0;  1EY7 A;  1JIC A;  4RGO S;  4BY7 B;  4BBS B;  3GTP B;  1CQV A;  2B8G A;  1ICW A;  1QB5 D;  3GTG B;  1HHV A;  1O7L A;  1VMC A;  4K8J A;  1PMR A;  2L12 A;  2BA1 A;  2RSO A;  2LY7 A;  1LAC A;  5KRU A;  3I3C A;  1BBX C;  2I07 B;  4Y7N B;  3NTI A;  4KKT A;  4ZKB B;  5CBE E;  3C3L A;  2JA7 B;  2LMC B;  5KND A;  1HTP A;  2NZ1 D;  2IX1 A;  5JPM C;  5KNB A;  3NBI A;  1SJH D;  3I90 A;  4KD3 A;  5F2D A;  1CHQ D;  5CBA E;  1U4P A;  2WIN B;  2IJ0 A;  1SNO A;  1A2T A;  1OXX K;  2L0C A;  2WV6 D;  1LTB D;  1B53 A;  1SXT A;  3SR1 A;  1HQR D;  1TY2 A;  2F0L A;  4OHJ A;  2F0S A;  3HOZ B;  4K5X A;  4J1M A;  4F7X A;  4DGZ A;  2C9O A;  1GHJ A;  4RWS C;  3IL8 A;  1SJE D;  1CT1 D;  5BN3 A;  1GUN A;  2IPK D;  4LAA A;  3K5L A;  2A6E C;  5C0X G;  1HUN A;  2K5Q A;  2LS0 1;  1TII D;  2FFK B;  1YNN D;  4XQN A;  2KEE A;  5CGK A;  1VCI A;  2BDN A;  1I4P A;  4DAY A;  4C2M B;  1UAP A;  2N88 A;  1E2W A;  1PDQ A;  1S5D D;  4R8I A;  1I4H A;  3ZYY X;  1CA6 A;  1LT3 D;  4OIJ A;  5IGC A;  4K14 A;  3R8B A;  1TT2 A;  4KY6 A;  2EDG A;  3T53 B;  3BYY B;  5M5Y B;  3I73 A;  4ZUI A;  3MFY A;  4X3S A;  5DEH A;  2FHT A;  5A2Q L;  1T5E A;  1VDZ A;  4BY1 B;  2HCC A;  2HCI A;  5FO9 B;  3NTK A;  3WOF A;  1OXU A;  1TWC B;  1MSG A;  4P2C B;  4QF4 A;  1F9Q A;  5JPN C;  3MFG A;  3QOL A;  1SYC A;  2MUY A;  1LO5 D;  2PZT A;  2K03 A;  1E2Z A;  3PIP 3;  2R61 A;  1QJO A;  1GUG A;  4DNR B;  2SNS A;  3DUZ A;  3FPU B;  1QCB D;  4J8Q A;  3MZ5 A;  1G91 A;  2JYO A;  2AQ1 B;  2NUC A;  3LWE A;  3VA7 A;  2K5D A;  3M7G A;  4QUF A;  2MPM A;  4A3G B;  1JQY D;  2SEB D;  1VF7 A;  3AB9 A;  3D4W A;  4TSS A;  1HQM C;  3MHB A;  1WTR A;  4G57 A;  1SE4 A;  1QG7 A;  1R4P B;  1EU4 A;  3S1Q B;  1BDO A;  3SDZ A;  3SE0 A;  1E2V A;  1V1P A;  4M1U B;  2F0F A;  3PUW A;  2A68 C;  2BDO A;  3LNN A;  2KEC A;  1BF4 A;  2WB1 B;  3SK8 A;  2WP8 J;  4PV1 C;  1B3A A;  5LHY 1;  5EPK A;  3D4D A;  1TWF B;  1S5C D;  2IT1 A;  3WDN A;  1NAP A;  3ND8 A;  1LT6 D;  5EKL A;  2F1M A;  1WTV A;  3HS0 C;  1ENF A;  4IFD I;  4FXG C;  4ABN A;  3GTL B;  3OWE B;  1BCP F;  3S1M B;  1B4O A;  1A15 A;  1H9R A;  4RH6 A;  3HOV B;  4L8J A;  3GTJ B;  3J81 L;  2NN6 H;  3KBX A;  1OXV A;  2ID0 A;  3KK7 A;  3KLS A;  3TZU A;  1E0B A;  1PRT F;  2GA4 B;  2K7V A;  1K8M A;  1LT5 D;  4LJZ C;  5D3I B;  1F2M A;  1B9N A;  2XRS D;  4XT3 B;  4K5W A;  4QB4 A;  2Z8L A;  2JSO A;  2PZU A;  3E6Z X;  2KHS A;  2L9H A;  2ENB A;  3SK6 A;  2ICE C;  2B2W A;  5M5X B;  1NR4 A;  5DNF A;  1GUW A;  3PMF A;  2OEO A;  1ZYR D;  2JA5 B;  2KOL A;  1ENC A;  3L9A X;  1I4Q A;  2D9U A;  2F0P A;  5LL6 X;  1LT4 D;  3A56 A;  1H9J A;  1G2T A;  1Q1E A;  3GTO B;  1I3Q B;  3IAY A;  1G6Z A;  3MA2 B;  3TBI B;  3I91 A;  2EXZ A;  4I65 A;  4UDU C;  4C1N I;  2KA7 A;  3RZO B;  1ILQ A;  2BCO A;  5C4X B;  1SNP A;  4IFD J;  2PZW A;  3BG3 A;  5BN4 A;  2JXM B;  2A69 C;  1W6K A;  3PUV A;  4RKB A;  1U4R A;  3RUZ A;  1A3U A;  1B44 D;  1JR0 D;  2OXP A;  5C3E B;  1STN A;  1SNQ A;  2OF1 A;  2KVM A;  1JOK A;  5I2Y A;  5DM7 3;  3L7Z C;  4RGN A;  1S5B D;  1SAP A;  3M85 A;  3R2I A;  3CQZ B;  1G29 1;  2WAC A;  2E74 C;  3J7A F;  2TMP A;  3OIP A;  2L1B A;  1C8C A;  3CHB D;  4H7B A;  1C4Q A;  4FF1 A;  4DXG A;  5M5W B;  1NUC A;  3A8K E;  3IKJ A;  4A3M B;  2DN8 A;  1G8Z D;  5D14 A;  2PNR C;  4KKS A;  1KNE A;  1HFG A;  1IKM A;  4XYQ A;  2F0O A;  3X3N A;  1EY6 A;  1CK1 A;  4TKO B;  2G9D A;  3D6W A;  3SK5 A;  3CRK C;  2DNE A;  4KHZ A;  1A3T A;  4CBV A;  4DAP A;  2L4N A;  2HQE A;  1NR2 A;  1PTO F;  2NN6 I;  3A55 A;  3TN2 A;  4Q5V A;  1SFO B;  1KAA A;  3ND9 A;  1JB3 A;  3FEW X;  5C6A A;  1BCP B;  1O7Y A;  1V8Q A;  3DMU A;  3FRP B;  4B9W A;  4FF3 A;  2A73 B;  2B2U A;  4XIG S;  4DK0 A;  5J39 A;  4NKL A;  4B9X A;  2F0W A;  4Q0F A;  4WJW A;  1AP0 A;  3HRZ C;  3O13 A;  3TDQ A;  1I6H B;  1SMY C;  2DNC A;  2JA6 B;  3MXP A;  4C56 C;  1PRT B;  2A6H C;  1J8I A;  4N9T A;  1A6X A;  2NTT A;  4XQJ A;  3RMH A;  1TR5 A;  1YNJ D;  1F2Y A;  5ELD A;  2BOS A;  2CW0 C;  3T56 B;  1D6E C;  4DXF A;  3TME A;  5ELC A;  1ROD A;  1KDA A;  1LTI D;  1CI3 M;  3KLR A;  1BR9 A;  2L5T A;  1WD0 A;  3K58 A;  5M3M B;  1VMP A;  5IT9 L;  5HUR A;  1KLG D;  5M3F B;  3K6O A;  3ITP A;  2PO4 A;  1RTO A;  3BYT B;  3S15 B;  3K7A B;  4E6I A;  5COR A;  2CHB D;  1IL8 A;  5K36 G;  1MSH A;  3NQI A;  1WTQ A;  4BA2 I;  2F0E A;  2IW3 A;  2B8F A;  3C2P A;  3K5N A;  3S2H B;  5DAU A;  4HSP A;  4L63 B;  1U9R A;  3NXW A;  1ILP A;  1JOQ A;  4XYO A;  3Q22 A;  2ZT9 C;  2AQ2 B;  3K59 A;  2YYZ A;  3T16 A;  3FPP A;  3H6M A;  2L55 A;  4KN7 C;  4K6L A;  1QWY A;  3DXJ C;  1TKW B;  1DOK A;  2VB2 X;  4NW2 A;  1BO0 A;  2M00 A;  3BVG A;  3I4L A;  4J6H A;  3A8J E;  5JEA J;  3HOU B;  1GUT A;  2EYP A;  4FF2 A;  2O2L D;  4EQN A;  5FOB B;  1YNN C;  4DU9 A;  1UUP A;  1Q8I A;  1B9M A;  3S17 B;  2TSS A;  2JEA I;  4IUU A;  4IFD H;  1HCZ A;  2SNM A;  2E75 C;  5FLX L;  3MWY W;  1KTK A;  4C3J G;  1II3 A;  5A35 A;  2IL8 A;  3QJY A;  1AW7 A;  4QCL A;  3NQT A;  1IW7 D;  3H91 A;  2MP1 A;  1PTO B;  3RLF A;  3VR5 A;  2ZXR A;  1WTW A;  2F0U A;  2O4X A;  2WKC A;  4KY5 A;  3DHQ A;  5NUC A;  4C3H B;  3T13 A;  4A3J B;  4YIJ A;  1TY0 A;  3SXH A;  1K83 B;  1R9T B;  1Q1B A;  3CKI B;  3VYS A;  1JOO A;  1ONL A;  4ULL A;  2IX3 A;  4ODG A;  2CVR A;  1RKN A;  3C46 A;  2EYJ A;  1B1Z A;  1HUM A;  3I4N B;  1FYC A;  1ESR A;  2WKD A;  3FMC A;  1TS4 A;  1F9R A;  4PQX A;  5FK9 C;  2L11 A;  1I4G A;  3HGB A;  2B2Y C;  4UAI A;  1EIG A;  3EA6 A;  5C44 B;  2EYL A;  2C5C A;  1SE3 A;  2K01 A;  1RTN A;  2EE1 A;  2SOB A;  5G3L F;  3E5S A;  2HDL A;  3TP8 A;  1Y1W B;  1H9M A;  3A7A B;  2O5J C;  1BCP D;  2F0J A;  4B08 A;  1GXD C;  2J0T D;  5EJW A;  1ET9 A;  3Q24 A;  5JVG 3;  4DA2 A;  2NWG A;  1EYC A;  4K6D A;  1XX8 A;  1ET6 A;  2RQX A;  4RGM A;  4K5V A;  2NVY B;  3GD7 A;  1Z47 A;  5JAV A;  3GO5 A;  3MAQ A;  3FDT A;  3HZX A;  2Y0S B;  4DN4 M;  3D8G A;  1JOR A;  1PRT D;  3I72 A;  3PUZ A;  4RA8 A;  2EYM A;  2FJ2 A;  3PIO 3;  3K0Y A;  4OL7 A;  1EY8 A;  2KCN A;  2QEJ C;  2EJF C;  5A2Q E;  1TS3 A;  4KD4 A;  3DM1 A;  3QIA A;  2RDH A;  1V1O A;  5CV9 A;  2Z1C A;  2EY6 A;  4TQU S;  2M2L A;  2R93 B;  1DYQ A;  2EOT A;  4U67 3;  1D1I A;  1H9S A;  1DZ1 A;  4F8M A;  2B2U C;  4XQQ A;  1KAB A;  4X3U A;  2ICI A;  2EYO A;  5EBC A;  4U68 A;  4R9W A;  1LTT D;  3P20 A;  3TZD A;  5ELB A;  3R93 A;  3DEO A;  1Y8N B;  1RDP D;  1I6V C;  1X3Q A;  2EYF A;  1EY5 A;  3D31 A;  3BVZ A;  3M3Y B;  2F03 A;  3NTH A;  2R92 B;  4BS9 A;  1IHZ A;  1EQT A;  2KUM A;  3AMU A;  1ZYR C;  5EPJ A;  3OIQ A;  4ZK9 B;  1HA6 A;  4G7Z C;  5CC4 A;  4AYB B;  2X69 A;  1QIL A;  4KI0 A;  1MI2 A;  3N52 A;  1XTC D;  1L0Y B;  1TWG B;  1FR3 A;  1PFB A;  4H13 C;  2BE5 D;  5FKA C;  2A74 C;  1TWH B;  3GTM B;  3S1N B;  4BA1 I;  2JA8 B;  1STG A;  5FO8 B;  4V0B A;  1SNC A;  2XNA C;  5LL6 S;  4RHS A;  1FD7 D;  4EGV A;  5C4Z A;  4HN7 A;  4ID6 A;  1KDC A;  5EBD A;  2B2T A;  2F4I A;  3H09 A;  1D2B A;  1M4V A;  1DOL A;  1J9O A;  1PTO H;  1F77 A;  2LFN A;  1H9S B;  2B63 B;  4WOR A;  2XIW A;  3TP7 A;  2ZXO A;  3ERO A;  3HP3 A;  5JEA H;  3H0G B;  3KLS X;  2XVS A;  2KED A;  1EEI D;  3G7L A;  3GTQ B;  1OXT A;  2VXW A;  2PQE A;  1Z6H A;  3I70 A;  4A3K B;  3GP7 A;  4IQZ A;  3M7N A;  3NWT A;  1PTO D;  5M9O A;  2PCF B;  5IGG A;  4ZKC B;  4RGT A;  2DY7 A;  4CKE A;  1CFM A;  4PMC A;  1LTA D;  4NMZ A;  5HGT A;  2RKS A;  4ILW A;  4RCN A;  2Z4H A;  4DF7 A;  3NPP A;  3HOW B;  2PW7 A;  4WRD A;  5C3X A;  3J80 L;  1RHP A;  1SYD A;  3IFT A;  1LTS D;  4OO1 G;  1M8A A;  1Y8O B;  1I4R A;  1CM9 A;  4R8N A;  3OHX C;  1EY0 A;  1STY A;  1X3P A;  5C0X I;  3PO3 B;  4FO2 A;  1U4M A;  2F0V A;  2XWB B;  2H4O A;  3KUP A;  2KCC A;  3G6J B;  5E4X A;  1A3V A;  5CV6 A;  4A3E B;  1AEX A;  1IYV A;  4K2L A;  2V4D A;  2JEB I;  3VR6 A;  3L3O C;  1T5X D;  3PUY A;  3U9O A;  4IUV A;  4ZRZ A;  2AUK A;  3EQL C;  2H1E A;  5KNC A;  1GUS A;  1AZP A;  3OPO A;  1CZG A;  1BQQ T;  2E2J B;  1YNJ C;  4CJ2 C;  3BVM A;  1EOT A;  3OW7 A;  4CJ1 B;  1SYF A;  5EQ0 A;  5DM6 3;  1KDB A;  4IUQ A;  3OSO A;  1CZW A;  3QO2 A;  3GV6 A;  4KJO A;  3WOE A;  4M8A A;  5CV4 A;  2DY8 A;  4DK1 A;  3P75 A;  1JWS D;  3R2T A;  1MD2 D;  5I6W A;  1RJT A;  3SVM A;  2NVQ B;  2XRQ D;  1DJR D;  1WCM B;  1D5X C;  3TSS A;  1W6J A;  5KEE A;  1SND A;  5E3F A;  2AWO A;  2X6G A;  2D5D A;  4KY7 A;  4ZLT F;  3UI2 A;  2YU9 B;  2I46 A;  5KYL A;  5KYI A;  3DEP A;  1C48 A;  2EY1 A;  3HOY B;  3F2U A;  3D4R A;  3JAM L;  5C5M A;  5C0X J;  4RFB A;  4FYD A;  3RD4 A;  3Q0A A;  1Y8P B;  1PZJ D;  2QDB A;  2MHV A;  4RAU C;  2EY5 A;  4A3B B;  1PYW D;  3M4Y A;  4IAL A;  1Q12 A;  4X3T A;  1L0X B;  2D2C C;  2EY2 A;  1EQV A;  2Q8I B;  3KBG A;  1PLF A;  4TRD A;  3W3A A;  4C3J B;  1SDF A;  3DWQ A;  1UEA B;  2E2H B;  2Q8T A;  3K5M A;  3SEB A;  4A3I B;  2KJX A;  5ELE A;  3VYT A;  3T51 B;  2M9V A;  5IGF A;  2HUG A;  1B50 A;  3J7A V;  1STB A;  3NK9 A;  5ISR A;  2X6L A;  1A2U A;  1DCZ A;  1SYE A;  1WD1 A;  3DWA A;  2F0Q A;  2VB3 X;  4MHE A;  1K8O A;  4KK7 A;  4FXK C;  5I9P A;  2B2V A;  1KNA A;  2F0M A;  3A7L A;  1G2S A;  3GTK B;  4KN4 C;  1HA5 A;  1H9K A;  2PW5 A;  3MXU A;  3T4A C;  3HEJ A;  3I8Z A;  1EU3 A;  1IW7 C;  1HXY D;  4GZY C;  4C1N K;  1CHP D;  5C5L A;  1EWH A;  5TSS A;  2XN9 C;  2RSN A;  4KV6 A;  1ZXT A;  1GOZ A;  3NP8 A;  4OGQ C;  2B2W C;  1O78 A;  1NSN S;  3TP5 A;  2B2T C;  4CJ0 B;  3NBH A;  2OT2 A;  2AQ3 B;  4C3I G;  2E76 C;  4CGY B;  2AUJ D;  5G3L D;  4HR7 B;  2Z4I A;  1GJX A;  1XXG A;  4HSV A;  1FNW A;  2FIN B;  1ENA A;  2A5H A;  4ME5 A;  3KF8 A;  1Q90 A;  3D6C A;  2F0N A;  3BDC A;  3S2D B;  2FMM A;  2K6A A;  4N9P A;  1LAB A;  1R4Q B;  2J7Z A;  4X3K A;  5K36 H;  1SYB A;  1S5F D;  5IGB A;  1BCP C;  4IUR A;  2QKI C;  1EY4 A;  1B2T A;  2F0G A;  2JP1 A;  1SE2 A;  1FNV A;  4OO1 I;  3I4M B;  5J22 A;  3ERQ A;  5FLX E;  1DD2 A;  2K28 A;  1STE A;  2MGS A;  4ZQ3 A;  1JCK B;  1PRT C;  4FNF A;  2B39 A;  1D1K A;  4PNY A;  1EYA A;  1LLR D;  1UNS A;  1LTG D;  3LWU A;  2E2D C;  2PYK A;  3HG9 A;  1U4L A;  2VNU D;  1RD9 D;  3MXN A;  1F2Z A;  5IIF A;  3SK4 A;  2NN6 G;  3URY A;  1O80 A;  2A6E D;  4HMJ A;  3W2D A;  2RDG A;  2E2I B;  3EJI A;  4CHT B;  3NWS A;  4EQO A;  2Q8R E;  5T1G A;  1LTR D;  2EVB A;  4XTC S;  3NUC A;  4RKL A;  1EZ8 A;  3GV3 A;  4KHV A;  1F9S A;  1RCV D;  3PUX A;  2NBF A;  3CRL C;  3VR3 A;  2F0K A;  5C3W A;  3QOJ A;  2EYH A;  3VR2 A;  1DOM A;  1GHK A;  3H3V C;  5EKK A;  3C1F A;  2EPB A;  4HTH A;  2EJM A;  4C3H G;  2JE6 I;  5C0X H;  4IUT A;  4RHR A;  5IOD A;  2WAQ B;  3S9W A;  1KLU D;  4IZ8 A;  5JEA G;  2BE5 C;  1QNU A;  3V96 A;  3BS1 A;  4MN3 A;  3D3R A;  5IGE A;  4XT1 B;  1ML0 D;  5CV7 A;  3U9S A;  1TS2 A;  1BOS A;  3BZD B;  2IX0 A;  1O7Z A;  4K8I A;  5BN5 A;  3OWF A;  3PO2 B;  2CQA A;  2N55 A;  1X32 A;  1NCV A;  1EL0 A;  4LMQ D;  2EJG C;  4H44 C;  1CA5 A;  1JWU D;  1HTL D;  4KKU A;  4F87 A;  4IUN A;  1SNM A;  2ZXP A;  1ESF A;  1LV9 A;  3N6R A;  2R3Z A;  2RDF A;  4S3S A;  1OXS C;  5KGU A;  1I4X A;  4ZAI A;  2A68 D;  3EFX D;  1WTX A;  2SDF A;  5I4D A;  1QE6 A;  3OMC A;  2K05 A;  4EVO A;  1D5M C;  4CKC A;  4G7H C;  1PTO C;  2NVX B;  2QIL A;  3MC0 B;  1ZEQ X;  5K5P A;  3ONA B;  2WII B;  2PMZ B;  4KMU C;  5IOC A;  1Y69 U;  3RZD B;  3BDO A;  2XSC A;  1IKL A;  3J81 E;  3QB3 A;  4LK1 C;  2LKV A;  5CV8 A;  2NVT B;  4HCS A;  4QUC A;  2B2V C;  3IFD A;  1FNU A;  5IGD A;  1V1P B;  5JOB A;  3PV0 A;  2O5I C;  1PFM A;  3X3M A;  2EZV A;  4DFA A;  1Z7T A;  3S1R B;  2F0D A;  3C1E A;  1JE4 A;  4L6T B;  5E1F A;  1EZ6 A;  4QIW B;  2NTS A;  5I9O A;  3MTS A;  3A8I E;  4A3D B;  3J7Y W;  3HKZ B;  1XYI A;  4ZUJ A;  4CKB A;  4FVM A;  4JBW A;  3FVQ A;  3MEH A;  1WTO A;  1HRJ A;  3V05 A;  3BDL A;  1CQF A;  5T1I A;  4FXD A;  1DON A;  1Q3L A;  3P1H A;  3QG1 A;  5I2X A;  1BXT A;  4FF4 A;  4DNT B;  1BUV T;  1HPC A;  3CU7 A;  4Z9C B;  2G9H D;  4A3F B;  1DXM A;  4BWG B;  3AU7 A;  2NYZ D;  2K32 A;  4HMI A;  1STH A;  2D62 A;  3Q23 A;  3S16 B;  1WVL A;  3V2T A;  5EKI A;  1XWE A;  4XXE A;  1BNZ A;  1MBY A;  1PXU A;  1RF2 D;  5JVH 3;  1I50 B;  2K1B A;  4FP5 D;  5E4W C;  3E0J A;  4K2K A;  3Q6S A;  3R3O A;  4HAE A;  1VF5 C;  1TWA B;  2F3W A;  2B2Y A;  2NB0 A;  4QMG A;  5COY A;  4XDX A;  4NDX A;  2A69 D;  1V43 A;  3OOC A;  1STA A;  1TS5 A;  2F0T A;  2F0I A;  5AFW A;  1GUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...