4ZRZA

Plycb mutant r66e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
62
structure length
62
Chain Sequence
b'NVSGVQGFLFHTDGKESYGYRAFINGVEIGIKDIETVQGFQQIIPSINISKSDVEAIEKAMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PlyCB
publication title A bacteriophage endolysin that eliminates intracellular streptococci.
pubmed doi rcsb
source organism Streptococcus phage c1
molecule tags Antimicrobial protein, viral protein
total genus 15
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.850 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zrzA00
4F88A 4ZRZA 4F87A
chains in the Genus database with same CATH superfamily
4AYBE 2VNUD 3PCOB 3PGZA 3S16H 1HQRD 3L9AX 3K8AA 1KAAA 3DEPA 1CKMA 3FDTA 1STNA 5C0XH 2JJQA 3J80L 3CCLA 1NMGA 4ID6A 3M85A 3HOVH 3ICEA 1FJGL 1YHBA 1ZYRC 4IO9A 4CJ0B 2AQ3B 2VQEQ 2K50A 1BOSA 3PMFA 4Z9CB 4A3BH 3CMEA 1ILQA 1M90C 4K0KL 1CSQA 4YWMA 1XYIA 1WOCA 1R4QB 1XJVA 5EAYA 1JWUD 1I6HH 4LUZA 2K03A 3VR3A 3HOWH 2BE5C 3HEJA 1BBXC 1EFWA 1DYQA 1WD0A 4FP5D 3GTGB 1EIFA 2CW0D 3NELA 2PZWA 3UDGA 4XQJA 2JA8B 2OQ0A 1I6VC 1SNCA 4AQYQ 1T9HA 1PFNA 3OOCA 1JCKB 2QCPX 4OEMB 1SSOA 3A8JE 4P71A 1VQHA 5T1GA 3CCEA 1WYDA 3LX0A 4KY6A 1O7ZA 3ERSX 2F4IA 3D4WA 1WTHA 3V05A 4KMUC 1M4VA 2A6ED 3JAME 3CAMA 4FF3A 1YIJA 1U4LA 1V9PA 4IUVA 3SXHA 3EA6A 4PQXA 2D5DA 4DV1Q 4X3SA 2Z6KC 1EEFD 4DR4Q 1EQTA 2ZT9C 1O80A 3DWPA 3I4MH 1GO3E 1IHZA 2UUCL 4NW2A 4AH6A 4LF6Q 3KJPA 1AE3A 1D1KA 1DGSA 5D14A 1F77A 4K5XA 3I70A 3DWQA 2ZTCA 2L55A 1AEXA 3HOUG 2EJFC 3MAQA 3GTQH 3GTKB 3IAYA 1O78A 1PZKD 4A3IB 2B8FA 1UEBA 1YVCA 1LACA 1U0LA 3DUZA 1G91A 3M3YB 2EOTA 4ODGA 3LNNA 1VQIA 1K73C 2ZM6Q 2NB0A 1AN8A 1PH3A 1PH9A 4KJNA 2NWGA 1KRTA 2EDGA 4S3SA 5FLXc 1CZGA 3RZDH 1BQQT 3I4NG 2JA8H 5IGDA 2HHHL 3TZUA 2EY2A 5DAUA 4X62Q 2F0NA 1FGUA 1TIID 1X65A 2HDMA 4OWXB 3BVZA 4X66Q 3N6RA 5J39A 3S1NH 3GTOH 1Z47A 4A3MG 1WCMB 4ZYSA 3K59A 1EFID 1U4MA 1JJGA 3FPPA 2HCCA 1OXVA 2IPKD 3D31A 1V8QA 3H3VC 1LYLA 1EIHA 3T4AC 4JI4Q 2Y0SG 3G71A 5C3WA 4LF5Q 2EQSA 2F0KA 1NBWA 1IYJB 3QOJA 4JBJA 2I0QA 3S1MB 4KLKA 3RLOA 1PTOF 3SVMA 4BY7G 4GN4B 2Y0SE 5LMUL 3NE5B 1NMFA 2ZTEA 3SHLA 3NQTA 1VQBA 2R93H 1KDBA 4BS9A 4DV4L 4JI5Q 1IKMA 1SYCA 1XXGA 1HFNA 3TS0A 2ID0A 3QIAA 1Y8NB 5ELDA 2BA1A 2VUMG 4XTCS 1N33L 1HTPA 4JI6L 4BBRB 1FNUA 5M5WH 2Z6KA 3M4OH 4A3DG 2OQKA 1SMYC 3BJUA 5M5XB 2IHEA 1P16A 2HD3A 1IBMQ 3S15H 1EZ6A 4DUYL 3FMCA 3TSSA 3I91A 3PUXA 5C44H 1E0BA 1EU3A 4R1JA 4CGYB 4C3JB 2R7ZH 1DZ1A 4X64L 2UXDQ 2PMZB 4OELB 1JJCB 1CZWA 3GDEA 1HNZQ 3A54A 2CWPA 4C1NK 1DM0B 4HJAA 4QIWB 1U4PA 1DONA 3D6WA 4Y52H 1ONLA 1S40A 3H0GB 3KF6B 4DFAA 4L5SA 4R4CA 3F1ZA 4L5RC 3KF6A 4IUNA 1BDOA 2F0FA 5IGCA 2B2YC 4MTNA 1F2ZA 1YNJC 3DM3A 1TY0A 4DAYB 4LFBL 2E2HB 3F2UA 4DAYA 4LF4Q 3A8KE 3BDCA 2JA7H 2B8GA 1X3QA 1HXYD 3I2ZA 3OTOQ 3CCMA 2FXQA 1LT5D 2N55A 4KK7A 4EQOA 1QVFA 3MXNB 5EKLA 4DK0A 4L5TA 4EVOA 1A3VA 2M9VA 1TS2A 3FKIG 2KEEA 3CRLC 4WFN3 3NWSA 3MXPA 3Q8DA 3K80C 1XNRL 3GTMB 1WFQA 2FINB 3NK9A 4P2CB 2RKSA 1RDPD 2RF4A 2A6HD 3R2TA 2QDLA 1K3BC 2K01A 5CV6A 3S17B 3CMAA 3X3NA 1K8MA 1WTVA 5LL6S 3J80i 1MGSA 4ME3A 2ENBA 2RCNA 3H0GH 4PZ7A 5IYCH 5DNFA 4DXGA 4JV5L 1V43A 3PIO3 2MPMA 1VQ7A 1EU4A 1XNQL 2YTVA 2XVSA 4JPBW 3D0FA 1KC8C 3RN5A 5JEAG 1RODA 1N34L 1RL2A 1A2TA 5FJ8H 3CU7A 4X65L 2ICIA 5C0XJ 1UE1A 3H94A 5KYLA 2YU9B 1E1TA 3HS0C 4A3KB 2KECA 1OO9B 1D1IA 4YY3Q 1A6XA 4E6IA 1TWGH 1OXXK 5D3IB 1TWHH 2KHJA 5IWAL 5FLMH 1LTTD 5HGTA 3NWTA 4ZRZA 3TS2A 3HOXG 2J4XA 1EIYB 2A69C 2B2YA 2F0OA 2NZOA 4ZUJA 1IZ6A 3DMUA 2AWOA 2Q2TA 1SNPA 1K0SA 1U5KA 5NUCA 2AHOB 5G3LD 2Z0SA 4CDCC 4I7AA 2F52A 2JA6B 2RCFA 2XIWA 3W2DA 3HKZB 2R61A 4H0LC 3BU2A 1BCPF 3OMCA 4HIMA 4DR1L 3CP0A 2MJ8A 1F2MA 3GV6A 4A3CH 2Q2HA 2RHSB 2K1BA 3T1HQ 2RQXA 4B3SQ 4X6AH 1SE4A 5G3LF 3ONAB 4QMGA 2N8NA 4AIMA 1SNQA 3A74A 1TQOA 4PV1C 2F0IA 2KOLA 3R2IA 5J3BA 1IBLL 1PHJA 1TWFH 1BR9A 1UEAB 5FLXL 3OPOA 3KLSX 4LF7L 5FO9B 3PO3B 2OF1A 3QR8A 3K57A 4UP8A 1AFPA 1HR0Q 2CWAA 1KDCA 1I94L 2NYZD 4GS3A 4RG1A 1A8VA 5LMNW 1AZPA 2E2JB 5IT9c 1ASZA 4IJHA 3Q6SA 4TRDA 5FLXE 2NN6G 1SRUA 3CQZB 1STYA 2OCEA 1F2LA 4HR7B 3A7AB 5EGTA 1TS4A 4Q0FA 4H02A 1C7YA 1Y1VH 3D4RA 4BXXH 3M4YA 1IW7C 3E9IA 1PH7A 4A3IG 3C46A 5ELEA 4IFDI 4OO1I 2G5DA 5FOBB 4HSPA 2NVYH 4OWTB 2BDNA 3DWAA 1SYEA 1MBYA 1W3SA 4XT3B 1PYSB 2K32A 2F0LA 4CDDC 5IIFA 2NBFA 4UY8C 3T1YQ 4JVZA 3S1QB 1HNXL 3A5ZB 5IGFA 1HNWQ 5M3MH 2J7ZA 2KJXA 3PV0A 1Y1WH 3KLWA 4RKBA 2VQFQ 3G48A 3CPFA 3F2DA 1YITA 2B2TA 1NSNS 1DOLA 3ULPA 4GLAC 4P74A 4RCNA 3PO3H 1WD1A 2HIVA 4A3GB 2UUAL 3MZ5A 4LMQD 3S2DH 3R3OA 1WCMG 3S9WA 3OIQA 3VR6A 3SE0A 2O5JC 3EIVA 2MGSA 3L7ZC 2UU9Q 4L6TB 3I72A 1GD7A 3PF4A 1TKWB 2P5ZX 1Z9FA 3MXGA 5FO8B 3NEMA 2BH8A 1QOHA 1IYVA 3JC66 2KCCA 4YCWA 2Z6BA 3R93A 5C4XG 1H9SA 1NY4A 3CQZH 4NXNQ 3CRKC 1QG7A 4OIKA 2F3WA 2K33A 5CV5A 4QB4A 3CF5A 2A68D 1Q90A 4HJ5A 3KF8B 3VA5A 2RDHA 1Q7YC 4DR4L 3L0OA 2H1EA 1L1OC 2KVMA 2F0MA 3W1GA 3KF8A 4DR3Q 4FF4A 3WOFA 5E7NA 4JOIA 1Q1BA 1T5XD 2B63B 1CI3M 4C2MB 4BBRG 4A3FB 3RD4A 2LMCB 2X6GA 1CK1A 4DV5L 4DV2L 3PUWA 5C3XA 3K81C 2UXBL 1EWHA 4IFDJ 1IL2A 4IURA 3PO2B 1O7LA 2O4XA 4C3JG 1LABA 1FVIA 4TVAB 2RVLA 2NZHA 1BUVT 3U58A 5CC4A 3GQBA 4A3MH 4A3GH 5I6WA 4PNYA 3GV3A 5E4XA 1CFMA 2B39A 3U9OA 2PMZE 1ASYA 4KHPQ 3QO2A 4RCOA 4WJ3M 4UHVA 5M5YB 4CBVA 2C5CA 1LT4D 4MN3A 1GUGA 1S5FD 3URYA 2ZJRA 5CGKA 4QIWE 1E7ZA 5ELBA 3U4VA 1F9RA 3F2BA 2AUKA 2E5LQ 1RF2D 5IOCA 3S16B 3T13A 4N8X1 1RIPA 2A6HC 4HEDA 4K6LA 2X69A 5C4HA 3HOZH 1VQMA 3FEWX 4B08A 4BY7H 4JI1Q 1IBKL 3I4OA 3CCQA 2H5XA 1LV9A 3CCVA 1EY6A 1EY8A 1FNWA 3HOVB 4LF5L 2OTJA 1G6PA 1MIUA 4DR5L 4UP9A 3S24A 3NBHB 2DNEA 1B70B 2IT1A 3OHXC 2QDBA 1TU2B 4DKAC 4DV7Q 1STAA 4JI2L 2KCNA 4A3BB 3NBHA 3UDFA 1PH1A 1A15A 1YJWA 4A3JG 1PTOH 5ELFA 4JI5L 3NPPA 1GM5A 3Q24A 2UXCQ 1UUPA 3DEOA 4XQQA 2A19A 1I6HB 1TXYA 4LWCA 1TS5A 3HOWB 3B6YA 2JA9A 1EWCA 2G9HD 2MO1A 5D65A 1S3OA 1SE2A 5IYDG 2QA4A 3PO2H 1TWAH 1LM0A 2SDFA 1G2SA 4HMIA 1OXSC 2EJMA 4HIOA 1QVGA 3E5SA 4HTHA 1A2UA 1JB7A 4U68A 1BBUA 1D7QA 1Q1EA 5M5YH 1Y8OB 4B3TQ 3IL8A 2VS1A 3WDNA 4LFAL 5ELOA 3GP7A 3AYHB 4TKOB 3CD6A 4A3LG 1PYWD 4FXDA 1RHPA 5C4ZA 4YCUA 4DR6Q 2ZXPA 3STBC 1RKNA 3L2PA 5IYBG 2PI2A 1A62A 4LUVA 3TDQA 2CQOA 4A3KG 3I4MB 3P7JA 2EYMA 3U9SA 2GVAA 4OHJA 3QB3A 2OXPA 4K6DA 4PMCA 4JBWA 1LTSD 5E4WC 3CCSA 4JI0Q 4LJZC 2EXDA 4LF4L 1EY5A 3U4ZA 2O2LD 3GTQB 3MFYA 4GKKL 1SNOA 2XGTA 1I3QH 1VQFA 3BYYB 4JI3L 3J80E 4HCSA 4DNIA 4B3RL 3FPUB 2L9HA 2PW7A 2ZJPA 3K5OA 4OL7A 3CW2C 1ET6A 4ZUIA 4DR2Q 1W6JA 5IT9L 3PSIA 1Q81C 3HKZG 1VQNA 1XMQQ 4JBMA 1D6EC 4PZ6A 3QG1A 3RZDB 2E2IH 3S2HH 1A3UA 3VR2A 3HKZE 1WTXA 4RHSA 2RSOA 4M8AA 4IUQA 1H9RA 4R4OA 4HAEA 4B3ML 3S1NB 4BWGB 3GTOB 4HIDA 4A76A 5F2DA 2AUJD 4IUUA 1K8OA 2IY5B 3J7YW 4QGUA 5BN5A 3GTLH 4LF8L 5KYIA 3ZJYC 3DXJC 4IZ8A 3PF5A 2Q2UA 1OXUA 2JA5G 2DJGC 1XTDA 2LXKA 4JI8Q 4GKJQ 5CMDA 4H44C 3KYHC 2NTSA 1FYCA 3M4PA 1B3QA 3M4QA 4ME5A 4FF1A 2QKIC 2CCZA 4C3IH 4C3HH 3HOXH 4LW1A 1EYAA 1DJRD 5FKAC 4A3EG 2AQ1B 3T53B 1LT6D 2PZTA 2ZXRA 4DUZQ 2R93B 2F0HA 4YY3L 4EGVA 3OWEB 2JXMB 4CKCA 4L8JA 3VR5A 2MFIA 3MTSA 5C4JB 4O0AA 1PH6A 1JB3A 5COYA 1A0IA 3G7LA 4QJFA 3I4LA 3IRBA 2KQ3A 1ESFA 5M5WB 2DNCA 2L11A 4XIGS 3M4OB 4FO2A 1N36Q 3CKIB 1WTRA 1D5ZC 1I5FA 3J7AV 3AFQA 3KLSA 5JAVA 3S15B 2NVTH 5EQ0A 4FDBA 1J5EQ 2EYPA 1I4HA 2SOBA 2XNAC 4RGMA 5GQOA 5C44B 2F4VL 2PQEA 2PPBC 3FP9A 3Q22A 4IALA 1PRTF 2R7ZB 1O7YA 1PTOD 2LFNA 3EFXD 1S5DD 4HMJA 1JOQA 3ND8A 4EQNA 1VF5C 3I3CA 1SXTA 4GNXB 2ATWA 1J6QA 2HQLA 5T1IA 1YNXA 1GXDC 2I5HA 1Q8KA 4OGQC 1VQ6A 3A5UA 1C48A 1ICFB 3A8IE 3OYYA 4GNXA 1VQ9A 4A93H 1LTBD 2SNMA 5E1FA 4CHTB 1ILPA 4GN3B 3AEVA 2JSOA 1XMOQ 1DOMA 1ET9A 2ICEC 2F0SA 1N8RC 1SJED 5C6AA 2MO0A 4FNFA 1WTQA 1EOTA 2NVXH 1QVCA 2EYHA 4DV3L 2EYOA 1K8AC 3ERQA 4LF9Q 1DD2A 3A7LA 3UDIA 2D2CC 2LSSA 1RTNA 2JA7B 4CDEC 1RTOA 2A8VA 3TBIB 3VYSA 2QILA 5C4JH 4IUPA 2B3GA 2F0GA 1B3AA 1CT1D 1HZBA 2M2LA 4POGA 5K36G 1C9OA 2V4DA 4P75A 3RLNA 4A75A 1BXTA 4DR7Q 4JG2A 5C5MA 3J7AF 2XSCA 5GAGC 1VQCA 4BA1I 3P20A 3D8GA 3NQIA 2I5MX 2PYKA 5BR8Q 1SYGA 2CVRA 5LMNL 3G4SA 2NUCA 1G51A 3EVQA 2B63G 1SFOH 3TZDA 4FXGC 1JT8A 1YNND 4ULLA 4IPHA 4A3FG 3HOYB 1MKHA 3KFUA 1F9QA 1Q86C 1AP0A 5C0XI 1Y69U 2YV5A 3ZYYX 4H13C 1MSGA 3T1YL 1HNWL 2F0UA 2XWJB 3NHHA 5AJ3L 4KKUA 3HG9A 5GADC 5M3FH 1GJXA 4BY1H 4OONA 5IP9H 4NB3A 1K0RA 3MXUA 3SK4A 1N32L 3C3LA 5EBCA 5J1ZA 1KDAA 1TWGB 4DV0Q 1HQMC 5IP7G 1TWHB 1XPRA 1FD7D 3O13A 1B9MA 2K52A 5C4XH 2WB1B 4NMZA 4YHHL 4QF4A 3MXNA 4KHVA 3R8BA 3I56A 3J81c 4K8IA 3Q0AA 5C0XG 3BZCA 3TQYA 1UWVA 5IE8A 3A56A 1SNDA 5KNCA 1S72A 3HOVG 2DY8A 4NDXA 4NXNL 3T16A 1QZGA 4WJWA 3OSOA 3S14H 1L0WA 3DM1A 1ESRA 3L3OC 5JPNC 3A0JA 3BYTB 4A3BG 4BBSH 2NTTA 2EVBA 3BDOA 5IODA 1NTGA 1X3FA 2R92H 3HOYH 1PZJD 1YHQA 2K05A 3BZKA 4JYAL 1STHA 3VR4A 2F0TA 5KEEA 3GO5A 1K9MC 3C1EA 2DJFC 1QJOA 1NCVA 2F0WA 2AKWB 4HCEA 4R4TA 4AYBB 1GHKA 5HURA 1NNXA 1EUJA 4C1NI 1WTOA 1SYBA 3I7FA 1TWFB 1JOKA 2EJGC 2WV6D 5CBAE 3SEBA 1JE4A 1J8IA 1BCPD 3E9HA 3H09A 1PVOA 1MJEA 1VQDA 2HIXA 2UUBQ 2K75A 3N52A 1XX8A 1VQGA 4R8NA 4KHPL 1NR4A 2R3ZA 3FVQA 3MA2B 1Q3LA 3TRZA 3CC4A 1Q82C 1SE8A 4QUFA 3M7NA 2CW0C 2ASBA 2WINB 1XWEA 2RA4A 2YTXA 4DK1A 2PI2E 3C2PA 3I4MG 5BN3A 2Q8IB 2A73B 1LT3D 3D3RA 1JQYD 2B2TC 2WAQB 3TP7A 1CA6A 1Y1VB 4CJ2C 1JMCA 1SJHD 4A3JH 4NXML 4XQNA 1E2VA 2A6EC 2PCFB 4G7HC 1BBWA 2FFKB 4TQUS 5C3EH 2TMPA 2NVYB 4A4IA 2HHHQ 1PH5A 2D0PA 4RKLA 5M3MB 3MHBA 3AB9A 1KNEA 1Y1WB 4FF2A 1HR0W 2JA8G 1E2ZA 1UE6A 2AWNA 3CC2A 1B1ZA 1ZYRD 2K5NA 1GUWA 1GHJA 3HGBA 3AMUA 4XT1B 3S2DB 4G7ZC 1GUNA 2JEAI 1Y14B 1YZ6A 1V1PB 4DNTB 1NE3A 3QOLA 4JOIC 1AH9A 4B3TL 2E2DC 1PXUA 2RDFA 2VB3X 3PIP3 1STEA 1V1PA 3K5LA 2K14A 4IPDA 2LS01 2BE5D 1PA6A 5LL6X 2HDLA 4DXFA 4DV4Q 1EYGA 1LLRD 4QY7A 5KGUA 1PTOC 1CUKA 2AQ2B 2AMCB 3NXWA 4DK6C 1F9SA 1VQEA 1N33Q 3NENA 5CV8A 3VYTA 1WVLA 4G7OC 4I7ZC 2R93G 4CDFC 2FHTA 4IOAA 4L63B 5CBEE 2VQEL 3JAMc 3TP5A 1I4QA 2NZ1D 4UP7A 2G9DA 4X64Q 5GROA 4PG3A 1SMXA 5I2XA 2C9OA 4J8QA 3K7AH 1S5BD 1U9RA 2KENA 3I4NB 3PIOA 2KA7A 3KLRA 2F0QA 3E6ZX 3TREA 1UE7A 2Z1CA 4DNRB 4JC0A 2VY3A 1WJJA 3WWVA 2CHBD 4R8IA 1PH8A 4A3MB 1YEZA 3RNUA 1HH2P 1EY7A 4AQYL 2JK8A 2JA5H 4IFDG 4OO1G 1B4OA 3CCUA 2LXJA 1AE2A 3J81j 2VXWA 3VDYA 3HFZB 2BH2A 2Y0SB 2RBMA 3HOZB 2VB2X 4MTKA 1C8CA 1L2FA 2B29A 2Q8TA 4BY7B 3KBGA 4DV6Q 4A3EH 3HOUH 4DU9A 1SYFA 4DV1L 1VQAA 4QL5A 1VQ4A 1YNNC 2MUYA 2JA7G 2R7DA 1QCBD 2R7FA 4LF6L 1KQSA 4WORA 4ZAIA 1SLJA 5CR3A 4OXPA 5EPJA 2XN9C 1QNUA 4DUZL 1PTOB 5TSSA 5KNBA 2QW7A 4WRDA 3I4NH 5JVH3 1ML0D 2CH4W 2Q8RE 1LTLA 3ULJA 3GTPB 3NBIA 3J81L 2ZM6L 2L1BA 4X3UA 3HZXA 2ALYB 4JV5Q 4ZQ3A 1TWAB 4LFCQ 3RN2A 1ZXTA 1XNQQ 1K8GA 2Z8LA 4KY7A 4APVA 4O2DA 5KIXA 4X62L 3H0GG 2JQOA 1E3PA 3I8ZA 2F0PA 4RGTA 4X66L 2F3VA 3Q23A 4X65Q 4ZLTF 3CC7A 1HRJA 5EBDA 4NPSA 5CV7A 1SMYD 1JICA 4ALPA 2IHFA 5A35A 4B9XA 2E76C 1HA6A 4XYQA 4KHZA 5FJ8G 2ZTDA 4O1NA 4JI4L 1MI2A 1FR3A 3J7ZC 3TN2A 3UDXA 5GAHC 1QE6A 2K6AA 2B2VA 2VUMH 4GOPB 5FLMG 2MHVA 4YWLA 3P1HA 2K5HA 4H7BA 1QUQB 2WB1G 4GOPA 4A3DH 4GLXA 3A55A 5D3DA 1I3QB 3IFDA 2DGYA 3UE1A 3BDLA 1JJ2A 2WB1E 1I4XA 1ENFA 4TSSA 5CV9A 1JC7A 4DR1Q 4L5QA 2WACA 3X3MA 3CCJA 3GTPH 4KN7C 4R4IA 3J7A5 2F0DA 4K5WA 4IQZA 1Z6HA 2PNRC 5ISRA 4DGZA 1IBML 2E2IB 1K3RA 1VDZA 1EZ8A 3LGJA 3S2HB 3NTIA 4K14A 1UAPA 3HP3A 4A3CG 1BO0A 3MVVA 2QGQA 2UXDL 1ZKOA 1GKHA 1PH4A 1HNZL 3MFGA 1YHAA 2B2WA 1IBLQ 3CPWA 1ENAA 1DCZA 3KUPA 3GTLB 1H9MA 1D5MC 4LF7Q 1SR3A 2D9UA 5HGQA 2IX1A 1S5ED 2D0OA 4PMWA 4QQBX 1CQFA 1HZCA 1I94Q 2XTIA 1HA5A 2CH4A 2K5VA 5HY6A 2HT1A 4C3HB 3EQLC 4C3IB 3HOXB 3FKIH 1B9NA 2IJ0A 5A2QL 3VYRA 2K7VA 3OTOL 1HTLD 1X3PA 3FRPB 1BKBA 1Q12A 1EY0A 3OMGA 4DV0L 2FMMA 3IKJA 4J6HA 4DAVA 4P72A 1OTCA 4GNXC 5EKKA 1K83H 3F2CA 2EY5A 1SBBB 3UI2A 2JA6G 1V1OA 5IP7H 4U673 5M9OA 3SGIA 2MNAA 5ELCA 3LWEA 4EX5A 4IOCA 1SEBD 2NVTB 2WAQG 1HZAA 1Y1VG 5DM63 1QWYA 2CKZB 4PMBA 4BXXG 2E75C 5A2QE 1HNXQ 5EKIA 1G6ZA 1M8AA 1PZID 2K4KA 1Q8IA 1T5EA 2WAQE 5E3FA 3OW7A 3QWNA 2L0CA 3GTJH 2NVQH 1Y8PB 2A69D 5I4DA 2I5LX 5IT9E 3MC0B 1CHQD 2OEOA 4N8FA 5JEAH 1G8ZD 4A93B 3JAML 2EY1A 1BCPB 2WIIB 5M3MG 2GA4B 1JWSD 2UUAQ 1EQQA 1Y1WG 1FNVA 2NVXB 3WOEA 5JJKA 3SK6A 3RZOB 4GLVB 4NKLA 1VQKA 3MEHA 1LTRD 3PO3G 1PV4A 2N49A 1JOOA 4KV6A 4RGNA 1PRTD 5GAEC 3DLLA 4JI7Q 1VCIA 2V1CC 2GN5A 5JOBA 3TMEA 2ES2A 1O7IA 2EE1A 2PZUA 1CQVA 5DM73 3CCRA 2UUBL 5IGBA 3BVMA 2I46A 3E3XA 4M1UB 1Q46A 4P73A 1PFBA 1V1QA 4LAAA 4GN5A 1YJ9A 3FHWA 2SNSA 3I90A 1EQVA 2JN4A 4IN3A 1BF4A 1EYDA 4BA2I 5CYUA 1W2BA 1CHPD 4KY5A 4DV5Q 4DV2Q 1P8LA 1SN8A 4K5VA 2UXBQ 5JJLA 3D6CA 1CM9A 3I73A 1SFOB 1GOZA 3RUZA 2K28A 4R9WA 1G291 3GTGH 1RCVD 2Q2IA 4F7XA 3T1HL 1VF7A 1XTCD 4B3SL 2A68C 1I4GA 2F0EA 3DHQA 3KBXA 3RZOH 1W6KA 1B8AA 3H15A 1GUTA 1E24A 5M3FB 4BY1B 2PNHA 5C5LA 4A3GG 3F8TA 3KK7A 1VQJA 1IW7D 2WKDA 5H1SE 5CORA 3J81i 1VQLA 1IBKQ 5IGGA 1EYCA 1MD2D 1ICWA 1GUOA 3OW2A 1KNAA 1PLFA 1SDFA 1HR0L 2NN6H 1DXMA 5C4XB 2YTYA 4DR5Q 2K5WA 3HOZG 2E8GA 1SNMA 2C35B 4JI2Q 1X55A 4KTAA 5ELNA 2D62A 3GTKH 1SYDA 4A3IH 2Z4HA 2WFWA 5KNDA 3S14B 2XRSD 4O42A 3AFPA 3T56B 2QEXA 3M3YH 4J1MA 4ILWA 4OX9Q 4DAPA 4RAUC 3ULLA 1STGA 3M7GA 1A3TA 4BBSB 1HZ9A 3NSWA 4G4KA 2O5IC 2R92B 2KBNA 2EY6A 2L15A 3ND9A 3W3AA 3TEHB 4Y7NB 3G6EA 1R4PB 1L0XB 2XWBB 1VQPA 4RHRA 3PO2G 1G2TA 4Q5VA 3HKSA 4LFAQ 1PH2A 5JJIA 1WCMH 3PUYA 1VMPA 2K04A 2VQFL 2F0VA 1S4ZA 4JBKA 4KD4A 1KLGD 4IFDH 4OO1H 4UDUC 4R4QA 2EPBA 2YYZA 1NUCA 2GVBA 1YJNA 1HJPA 2WKCA 3HRZC 4FXKC 1II3A 2L12A 3G6JB 1FJGQ 3S1MH 3BG3A 2PQAB 2IL8A 2UU9L 2F1MA 2KEDA 4LUOA 3ER0A 2PQAA 4K0KQ 1Z7TA 4GKKQ 2F03A 1VQOA 4JI3Q 5JVG3 4UPAA 4B3RQ 1B44D 4ZCKA 1WTPA 4N9TA 4DV6L 3RLFA 3KDFB 4BBRH 1IKLA 1F9PA 4A3JB 4LK1C 1A63A 1ENCA 3KDFA 4KI0A 5M5XH 1CSPA 4DR3L 5EJWA 5C3EB 4DAMA 1S5CD 1EY4A 1H95A 4Y7NH 2Z4IA 3C1FA 2E74C 1JORA 2N3SA 4C3JH 1TT2A 3HOWG 3W1BA 1F2YA 2XRQD 4CJ1B 4I65A 4KJOA 4CKEA 3K58A 4B3MQ 1PMRA 3SK8A 4RWSC 2IX3A 3RMHA 2DY7A 1NAPA 4LF8Q 3EN2A 4DN4M 2CQAA 4LFCL 2L5TA 4HJ8A 2OT2A 1TS3A 2F0JA 1I50B 4PZ8A 4RGOS 2N88A 2UUCQ 1TWCB 2JE6I 3UE0A 1LTID 2A5HA 1FGBD 4FVMA 4IUTA 2E2HH 3K0XA 1TVXA 2E5LL 2JYOA 2IWHA 2KCMA 1EY9A 1I4RA 4MIUA 2M00A 2A1AA 1QZHA 1UNSA 3H3VH 4YIJA 4JI1L 3JAMi 4J15A 4N9PA 2L4NA 1VMCA 4C3HG 4C3IG 4F87A 2RSNA 5LHY1 4C56C 3BVGA 1YBYA 3GTMH 2FJ2A 2FMCA 1EWIA 1PFSA 3VYUA 3CXCA 4F88A 2OTLA 4KKSA 4MZ9A 4DV7L 1UE5A 5DLQE 2F4VQ 1X3EA 5IYDH 1KD1C 2ZXOA 3OIPA 3S17H 4JK1C 3LWUA 2UXCL 2F3IA 3K7AB 3STBD 1OXTA 4RFBA 1JR0D 5JEAJ 2MP1A 1QB5D 3SK5A 1TR5A 3MEFA 2HUGA 1PRTC 2HQEA 1LTGD 1LUZA 3OWFA 5EPKA 3K5NA 1D5XC 1PFMA 1DOKA 5JJZA 1I50H 3J80c 2EZVA 2NN6I 4DV3Q 1CKOA 4A3LH 2TSSA 5I6YA 4JCVE 1WTWA 1RD9D 1TWCH 4A93G 2JA5B 5DEHA 4EQ5A 5I9OA 5IYBH 5LMUQ 3V2TA 1AZQA 1BNZA 2BOSA 2YU9H 4A3KH 4KN4C 1X9NA 5I9PA 1AW7A 1EOVA 2BDOA 4IPCA 3U50C 2K5QA 3QJYA 4DPGA 1IXRA 4KD3A 4A3EB 3HOUB 4DR6L 2EXZA 3D4DA 1HUMA 1VQ8A 4JI6Q 1MJCA 3MWYW 1KABA 1MHWC 4OIJA 4RMFA 3NTHA 1SROA 1C0AA 2VL6A 4K2KA 4DUYQ 1SAPA 2PO4A 2EYJA 2Z9HA 2DN8A 1EIGA 4JI0L 1HFGA 2JA6H 3SDZA 3M9BA 4K8JA 5LMNQ 1C4QA 1RJTA 4B9WA 1HHVA 3K6OA 1PYBA 4LNQA 2VW9A 4ABNA 2EYFA 4MHEA 5C44G 2A74C 2HCIA 2I07B 3PUZA 5EPLA 4DR2L 3KJOA 2R7ZG 1B2TA 4YCVA 4EQPA 1XMQL 1LO5D 1NR2A 5CV4A 3S1RB 4XXEA 4IPGA 4ZKBB 1STBA 1EQRA 2WP8J 4KKTA 5AJ3Q 2B2VC 4RH6A 4RA8A 2LY7A 4LFBQ 4GZYC 2BA0A 5FO7B 4MNOA 4GOPC 1N32Q 1PRTB 1JWMD 5L37A 4IJLA 4HJ9A 5AFWA 1EEID 4G57A 1D8LA 4DK3C 3K7UC 1X54A 2RHQB 2RDGA 4FYDA 1HCZA 2KHIA 4XYOA 5M3FG 4BY1G 1R9TB 4OWWB 4JI8L 5I2YA 5IP9G 1WI5A 2BCOA 4YHHQ 4GKJL 1EL0A 2QEJC 1HUNA 3NTKA 4V0BA 1SE3A 2IX0A 3K5MA 1XNRQ 5KRUA 2QF7A 3H6MA 2E2JH 1H9SB 2VUMB 1YI2A 1QNKA 1I4PA 1GUSA 4A3DB 3BZDB 3V96A 4JI7L 1ZEQX 1XPOA 3T51B 3CHBD 1KXLA 1B7YB 1L0YB 2B2WC 1B50A 3IFTA 3PQIA 1CTMA 4WJ4A 5IY0A 1VS0A 4DF7A 5IGEA 4ZKCB 1KLUD 1NJIC 1X6OA 4HSVA 2JP1A 1N36L 4JYAQ 2KUMA 2MQHA 3H91A 2B2UC 3K0YA 3NP8A 4XDXA 1VQ5A 3S1RH 2OWOA 2KCTA 1J5EL 3S1QH 4BBSG 2H4OA 1CKNB 2JEBI 1N34Q 2R92G 2X6LA 3HOYG 5IYCG 1E1OA 2IW3A 1CKNA 2R6GA 4CKBA 1BVSA 3I55A 3RR5A 3J81E 1X32A 4HIKA 1E22A 4DA2A 1GVPA 3H3VI 3PIPA 5IWAQ 1XMOL 2KHSA 3EBEA 4JW0A 3KOJA 1R9TH 1K28A 1KTKA 1XPUA 1H9JA 2DUDA 1H9KA 1X3GA 4YWKA 1IYUA 4LF9L 5FK9C 2SEBD 4K2LA 3BS1A 5K36H 5JPMC 3EROA 1KL9A 3FKIB 3TP8A 1U4RA 1JE5A 4NP5A 2EIFA 4X3KA 3W5OA 2VZAA 1J9OA 1QUQA 4UAIA 1LTAD 1MSHA 2CFMA 3E0JA 1KHIA 4NXMQ 1YNJD 1K83B 3AQQA 3E0EA 4POFA 4DR7L 1BCPC 2B63H 1D2BA 1N9WA 3EJIA 1M1KC 4C2MH 4A3FH 3P75A 2N78A 5BR8L 3TP6A 4HN7A 5C3EG 1IL8A 3ITPA 5J22A 4QCLA 4OX9L 4ZK9B 1L1OB 3GTJB 2NVQB 4F8MA 3PUVA 1X56A 2LKVA 3AU7A 2J0TD 1L1OA 2PW5A 2EYLA 1KRSA 1TY2A 1KIXA 1FL0A 1E2WA 1KAWA 5BN4A 3VA7A 1HPCA 4AYBG 2B2UA 4X3TA 3SR1A 4QUCA 2ZJQA 4V190 3NUCA 4HJ7A 1CA5A 2K5DA 5K5PA 3GD7A 1PDQA 1QILA 1B53A
chains in the Genus database with same CATH topology
2VNUD 1HQRD 3L9AX 1KAAA 3DEPA 3FDTA 1STNA 5C0XH 3J80L 4ID6A 3M85A 1ZYRC 4CJ0B 2AQ3B 3PMFA 1BOSA 4Z9CB 1ILQA 1XYIA 1R4QB 1JWUD 2K03A 3VR3A 2BE5C 3HEJA 1BBXC 1DYQA 1WD0A 4FP5D 3GTGB 2CW0D 2PZWA 2JA8B 4XQJA 1I6VC 1SNCA 1PFNA 3OOCA 1JCKB 2QCPX 1SSOA 3A8JE 5T1GA 3LX0A 4KY6A 1O7ZA 2F4IA 3D4WA 3V05A 4KMUC 1M4VA 2A6ED 3JAME 4FF3A 1U4LA 4IUVA 3SXHA 3EA6A 4PQXA 2D5DA 4X3SA 1EEFD 1EQTA 2ZT9C 1O80A 3DWPA 1IHZA 4NW2A 1D1KA 5D14A 1F77A 4K5XA 3I70A 3DWQA 2L55A 1AEXA 2EJFC 3MAQA 3GTKB 3IAYA 1O78A 1PZKD 4A3IB 2B8FA 1LACA 3DUZA 1G91A 3M3YB 2EOTA 4ODGA 3LNNA 2NB0A 1AN8A 4KJNA 2NWGA 2EDGA 4S3SA 1CZGA 1BQQT 5IGDA 3TZUA 2EY2A 5DAUA 2F0NA 1TIID 2HDMA 3BVZA 3N6RA 5J39A 1Z47A 1WCMB 4ZYSA 3K59A 1EFID 1U4MA 3FPPA 2HCCA 1OXVA 2IPKD 3D31A 1V8QA 3H3VC 1EIHA 3T4AC 5C3WA 2F0KA 3QOJA 3S1MB 1PTOF 3SVMA 3NE5B 3SHLA 3NQTA 1KDBA 4BS9A 1IKMA 1SYCA 1XXGA 1HFNA 2ID0A 3QIAA 1Y8NB 5ELDA 2BA1A 4XTCS 1HTPA 4BBRB 1FNUA 1SMYC 5M5XB 1EZ6A 3FMCA 3TSSA 3I91A 3PUXA 1E0BA 1EU3A 4CGYB 4C3JB 1DZ1A 2PMZB 1CZWA 3A54A 4C1NK 1DM0B 4QIWB 1U4PA 1DONA 3D6WA 1ONLA 3H0GB 4DFAA 4IUNA 1BDOA 2F0FA 5IGCA 2B2YC 1F2ZA 1YNJC 1TY0A 2E2HB 3F2UA 4DAYA 3A8KE 3BDCA 2B8GA 1X3QA 1HXYD 1LT5D 2N55A 4KK7A 4EQOA 5EKLA 4DK0A 4EVOA 1A3VA 2M9VA 1TS2A 2KEEA 3CRLC 4WFN3 3NWSA 3MXPA 3GTMB 2FINB 3NK9A 4P2CB 2RKSA 1RDPD 2A6HD 3R2TA 2K01A 5CV6A 3S17B 3X3NA 1K8MA 1WTVA 5LL6S 1MGSA 2ENBA 5DNFA 4DXGA 1V43A 3PIO3 2MPMA 1EU4A 2XVSA 5JEAG 1RODA 1A2TA 3CU7A 2ICIA 5C0XJ 3H94A 5KYLA 2YU9B 3HS0C 4A3KB 2KECA 1OO9B 1D1IA 1A6XA 4E6IA 1OXXK 5D3IB 1LTTD 5HGTA 3NWTA 4ZRZA 2J4XA 2A69C 2B2YA 2F0OA 4ZUJA 3DMUA 2AWOA 1SNPA 5NUCA 5G3LD 2JA6B 2XIWA 3W2DA 3HKZB 2R61A 4H0LC 1BCPF 3OMCA 2MJ8A 1F2MA 3GV6A 2K1BA 2RQXA 1SE4A 5G3LF 3ONAB 4QMGA 1SNQA 1TQOA 4PV1C 2F0IA 2KOLA 3R2IA 1BR9A 1UEAB 5FLXL 3OPOA 3KLSX 5FO9B 3PO3B 2OF1A 3K57A 1AFPA 1KDCA 2NYZD 1AZPA 2E2JB 3Q6SA 4TRDA 5FLXE 2NN6G 3CQZB 1STYA 1F2LA 4HR7B 3A7AB 5EGTA 1TS4A 4Q0FA 3D4RA 3M4YA 1IW7C 3C46A 5ELEA 4IFDI 4OO1I 5FOBB 4HSPA 2BDNA 3DWAA 1SYEA 1MBYA 4XT3B 2K32A 2F0LA 5IIFA 2NBFA 3S1QB 5IGFA 2J7ZA 2KJXA 3PV0A 4RKBA 2B2TA 1NSNS 1DOLA 4RCNA 1WD1A 4A3GB 3MZ5A 4LMQD 3R3OA 3S9WA 3OIQA 3VR6A 3SE0A 2O5JC 2MGSA 3L7ZC 4L6TB 3I72A 1TKWB 3MXGA 5FO8B 1IYVA 1QOHA 2KCCA 3R93A 1H9SA 3CRKC 1QG7A 4OIKA 2F3WA 2K33A 5CV5A 4QB4A 2A68D 1Q90A 3VA5A 2RDHA 2H1EA 2KVMA 2F0MA 3KF8A 4FF4A 3WOFA 1Q1BA 1T5XD 2B63B 1CI3M 4C2MB 4A3FB 3RD4A 2LMCB 2X6GA 1CK1A 3PUWA 5C3XA 1EWHA 4IFDJ 4IURA 3PO2B 1O7LA 2O4XA 4C3JG 1LABA 2RVLA 1BUVT 5CC4A 3GQBA 5I6WA 4PNYA 3GV3A 5E4XA 1CFMA 2B39A 3U9OA 5M5YB 3QO2A 4RCOA 4CBVA 2C5CA 1LT4D 4MN3A 1GUGA 1S5FD 3URYA 5CGKA 5ELBA 1F9RA 2AUKA 1RF2D 5IOCA 3S16B 3T13A 2A6HC 4HEDA 4K6LA 2X69A 5C4HA 3FEWX 4B08A 1LV9A 1EY6A 1EY8A 1FNWA 3HOVB 2DNEA 2IT1A 3OHXC 2QDBA 1TU2B 1STAA 2KCNA 4A3BB 3NBHA 1A15A 1PTOH 5ELFA 3NPPA 3Q24A 1UUPA 3DEOA 4XQQA 1I6HB 1TS5A 3HOWB 1EWCA 2G9HD 5D65A 1SE2A 2SDFA 4HMIA 1G2SA 1OXSC 2EJMA 3E5SA 4HTHA 1A2UA 4U68A 1Q1EA 1Y8OB 3IL8A 3WDNA 3GP7A 4TKOB 1PYWD 4FXDA 1RHPA 5C4ZA 2ZXPA 1RKNA 3TDQA 3I4MB 3P7JA 2EYMA 3U9SA 4OHJA 3QB3A 2OXPA 4K6DA 4PMCA 4JBWA 1LTSD 5E4WC 4LJZC 1EY5A 2O2LD 3GTQB 3MFYA 1SNOA 3BYYB 3J80E 4HCSA 3FPUB 2L9HA 2PW7A 3K5OA 4OL7A 1ET6A 4ZUIA 1W6JA 5IT9L 1D6EC 3QG1A 3RZDB 1A3UA 3VR2A 1WTXA 4RHSA 2RSOA 4M8AA 4IUQA 1H9RA 4HAEA 3S1NB 4BWGB 3GTOB 5F2DA 2AUJD 4IUUA 1K8OA 3J7YW 5BN5A 5KYIA 3DXJC 4IZ8A 1OXUA 5CMDA 4H44C 2NTSA 1FYCA 4ME5A 4FF1A 2QKIC 1EYAA 1DJRD 5FKAC 2AQ1B 3T53B 1LT6D 2PZTA 2ZXRA 2R93B 2F0HA 4EGVA 3OWEB 2JXMB 4CKCA 4L8JA 3VR5A 3MTSA 5C4JB 1JB3A 5COYA 3G7LA 3I4LA 2KQ3A 1ESFA 5M5WB 2DNCA 2L11A 4XIGS 3M4OB 4FO2A 3CKIB 1WTRA 1D5ZC 3J7AV 3KLSA 5JAVA 3S15B 5EQ0A 2EYPA 1I4HA 2SOBA 2XNAC 4RGMA 5C44B 2PQEA 2PPBC 3Q22A 4IALA 1PRTF 2R7ZB 1O7YA 1PTOD 2LFNA 3EFXD 1S5DD 4HMJA 1JOQA 3ND8A 4EQNA 1VF5C 3I3CA 1SXTA 5T1IA 1GXDC 4OGQC 1C48A 3A8IE 1LTBD 2SNMA 5E1FA 4CHTB 1ILPA 2JSOA 1DOMA 1ET9A 2ICEC 2F0SA 1SJED 5C6AA 4FNFA 1WTQA 1EOTA 2EYHA 2EYOA 3ERQA 1DD2A 3A7LA 2D2CC 1RTNA 2JA7B 1RTOA 3TBIB 3VYSA 2QILA 4IUPA 2F0GA 1B3AA 1CT1D 2M2LA 5K36G 2V4DA 1BXTA 5C5MA 3J7AF 2XSCA 4BA1I 3P20A 3D8GA 3NQIA 2PYKA 1SYGA 2CVRA 2NUCA 3EVQA 3TZDA 4FXGC 1YNND 4ULLA 3HOYB 1F9QA 1AP0A 5C0XI 1Y69U 3ZYYX 4H13C 1MSGA 2F0UA 2XWJB 3NHHA 4KKUA 3HG9A 1GJXA 3MXUA 3SK4A 3C3LA 5EBCA 5J1ZA 1KDAA 1TWGB 1HQMC 1TWHB 1FD7D 3O13A 1B9MA 2WB1B 4NMZA 4QF4A 3MXNA 4KHVA 3R8BA 4K8IA 3Q0AA 5C0XG 3A56A 1SNDA 5KNCA 2DY8A 4NDXA 3T16A 4WJWA 3OSOA 3DM1A 1ESRA 3L3OC 5JPNC 3BYTB 2NTTA 2EVBA 3BDOA 5IODA 1PZJD 2K05A 1STHA 3VR4A 2F0TA 5KEEA 3GO5A 3C1EA 1QJOA 1NCVA 2F0WA 4HCEA 4AYBB 1GHKA 5HURA 4C1NI 1WTOA 1SYBA 1TWFB 1JOKA 2EJGC 2WV6D 5CBAE 3SEBA 1JE4A 1J8IA 1BCPD 3H09A 1XX8A 3N52A 4R8NA 1NR4A 2R3ZA 3FVQA 3MA2B 1Q3LA 3M7NA 4QUFA 2CW0C 2WINB 1XWEA 2RA4A 4DK1A 3C2PA 5BN3A 2Q8IB 2A73B 1LT3D 3D3RA 1JQYD 2B2TC 2WAQB 3TP7A 1CA6A 1Y1VB 4CJ2C 1SJHD 4XQNA 1E2VA 2A6EC 2PCFB 4G7HC 2FFKB 4TQUS 2TMPA 2NVYB 4RKLA 5M3MB 3MHBA 3AB9A 1KNEA 1Y1WB 4FF2A 1E2ZA 2AWNA 1B1ZA 1ZYRD 1GUWA 1GHJA 3HGBA 3AMUA 4XT1B 3S2DB 4G7ZC 1GUNA 2JEAI 1V1PB 4DNTB 3QOLA 2E2DC 1PXUA 2RDFA 2VB3X 3PIP3 1STEA 1V1PA 3K5LA 2LS01 2BE5D 5LL6X 2HDLA 4DXFA 1LLRD 5KGUA 1PTOC 2AQ2B 3NXWA 1F9SA 5CV8A 3VYTA 1WVLA 4G7OC 4I7ZC 2FHTA 4L63B 5CBEE 3TP5A 1I4QA 2NZ1D 2G9DA 5I2XA 2C9OA 4J8QA 1S5BD 1U9RA 3I4NB 2KA7A 3KLRA 2F0QA 3E6ZX 4DNRB 2Z1CA 2CHBD 4R8IA 4A3MB 1EY7A 4IFDG 4OO1G 1B4OA 2VXWA 2Y0SB 2RBMA 3HOZB 2VB2X 1C8CA 2Q8TA 4BY7B 3KBGA 4DU9A 1SYFA 1YNNC 2MUYA 1QCBD 4WORA 4ZAIA 5CR3A 5EPJA 2XN9C 1QNUA 1PTOB 5TSSA 5KNBA 4WRDA 5JVH3 1ML0D 2Q8RE 3GTPB 3NBIA 3J81L 2L1BA 4X3UA 3HZXA 4ZQ3A 1TWAB 1ZXTA 2Z8LA 4KY7A 5KIXA 3I8ZA 2F0PA 4RGTA 2F3VA 3Q23A 4ZLTF 1HRJA 5EBDA 5CV7A 1SMYD 1JICA 5A35A 4B9XA 2E76C 1HA6A 4XYQA 4KHZA 4O1NA 1MI2A 1FR3A 3TN2A 1QE6A 2K6AA 2B2VA 2MHVA 3P1HA 4H7BA 3A55A 5D3DA 1I3QB 3IFDA 3BDLA 1I4XA 1ENFA 4TSSA 5CV9A 1JC7A 2WACA 3X3MA 4KN7C 2F0DA 4K5WA 4IQZA 1Z6HA 2PNRC 5ISRA 4DGZA 2E2IB 1VDZA 1EZ8A 3S2HB 3NTIA 4K14A 1UAPA 3HP3A 1BO0A 3MVVA 1ZKOA 3MFGA 2B2WA 1ENAA 1DCZA 3KUPA 3GTLB 1H9MA 1D5MC 2D9UA 2IX1A 1S5ED 4PMWA 1CQFA 1HA5A 4C3HB 3EQLC 4C3IB 3HOXB 1B9NA 2IJ0A 5A2QL 3VYRA 2K7VA 1HTLD 1X3PA 3FRPB 1Q12A 1EY0A 3OMGA 2FMMA 3IKJA 4J6HA 4DAVA 5EKKA 2EY5A 1SBBB 3UI2A 1V1OA 4U673 5M9OA 5ELCA 3LWEA 1SEBD 2NVTB 5DM63 1QWYA 4PMBA 2E75C 5A2QE 5EKIA 1G6ZA 1M8AA 1PZID 1Q8IA 1T5EA 5E3FA 3OW7A 3QWNA 2L0CA 1Y8PB 2A69D 5I4DA 5IT9E 3MC0B 1CHQD 2OEOA 5JEAH 1G8ZD 4A93B 3JAML 2EY1A 1BCPB 2WIIB 2GA4B 1JWSD 1FNVA 2NVXB 3WOEA 3SK6A 3RZOB 4NKLA 3MEHA 1LTRD 1JOOA 4KV6A 4RGNA 1PRTD 1VCIA 5JOBA 3TMEA 2EE1A 2PZUA 1CQVA 5DM73 5IGBA 3BVMA 2I46A 4M1UB 1PFBA 4LAAA 1BF4A 2SNSA 3I90A 1EQVA 4IN3A 1EYDA 4BA2I 5CYUA 1CHPD 4KY5A 4K5VA 3D6CA 1CM9A 3I73A 1SFOB 1GOZA 3RUZA 2K28A 4R9WA 1G291 1RCVD 4F7XA 1VF7A 1XTCD 2A68C 1I4GA 2F0EA 3DHQA 3KBXA 1W6KA 1GUTA 5M3FB 4BY1B 5C5LA 3KK7A 1IW7D 2WKDA 5CORA 5IGGA 1EYCA 1MD2D 1ICWA 1GUOA 1KNAA 1PLFA 1SDFA 2NN6H 1DXMA 5C4XB 2K5WA 1SNMA 4KTAA 2D62A 1SYDA 2Z4HA 3S14B 5KNDA 2XRSD 4O42A 3T56B 4J1MA 4ILWA 4DAPA 4RAUC 1STGA 3M7GA 1A3TA 4BBSB 3NSWA 4G4KA 2O5IC 2R92B 2EY6A 3ND9A 3W3AA 4Y7NB 1R4PB 1L0XB 2XWBB 4RHRA 1G2TA 4Q5VA 3PUYA 1VMPA 2K04A 2F0VA 1S4ZA 4IFDH 4KD4A 1KLGD 4OO1H 4UDUC 2EPBA 2YYZA 1NUCA 2WKCA 3HRZC 4FXKC 1II3A 2L12A 3G6JB 3BG3A 2IL8A 2F1MA 2KEDA 1Z7TA 2F03A 5JVG3 1B44D 1WTPA 4N9TA 3RLFA 1IKLA 1F9PA 4A3JB 4LK1C 1ENCA 4KI0A 5EJWA 5C3EB 1S5CD 1EY4A 2Z4IA 3C1FA 2E74C 1JORA 1TT2A 1F2YA 2XRQD 4CJ1B 4I65A 4KJOA 4CKEA 3K58A 1PMRA 3SK8A 4RWSC 2IX3A 3RMHA 2DY7A 1NAPA 4DN4M 2CQAA 2L5TA 2OT2A 1TS3A 2F0JA 1I50B 4RGOS 2N88A 1TWCB 2JE6I 1LTID 2A5HA 1FGBD 4FVMA 4IUTA 1TVXA 2JYOA 2IWHA 1EY9A 1I4RA 4MIUA 2M00A 1UNSA 4YIJA 4N9PA 2L4NA 1VMCA 4C3HG 4C3IG 4F87A 2RSNA 5LHY1 4C56C 3BVGA 2FJ2A 2FMCA 3VYUA 4F88A 4KKSA 2ZXOA 3OIPA 4JK1C 3LWUA 3K7AB 1OXTA 4RFBA 1JR0D 5JEAJ 2MP1A 1QB5D 3SK5A 1TR5A 2HUGA 1PRTC 2HQEA 1LTGD 3OWFA 5EPKA 3K5NA 1D5XC 1PFMA 1DOKA 5JJZA 2EZVA 2NN6I 2TSSA 5I6YA 1WTWA 1RD9D 2JA5B 5DEHA 5I9OA 3V2TA 1AZQA 1BNZA 2BOSA 4KN4C 5I9PA 1AW7A 2BDOA 2K5QA 3QJYA 4KD3A 4A3EB 3HOUB 2EXZA 3D4DA 1HUMA 3MWYW 1KABA 4OIJA 3NTHA 4K2KA 1SAPA 2PO4A 2EYJA 2DN8A 1EIGA 1HFGA 3SDZA 4K8JA 1C4QA 1RJTA 4B9WA 1HHVA 3K6OA 4ABNA 2EYFA 4MHEA 2A74C 2HCIA 2I07B 3PUZA 5EPLA 1B2TA 4EQPA 1LO5D 1NR2A 5CV4A 3S1RB 4XXEA 4ZKBB 1STBA 2WP8J 4KKTA 2B2VC 4RH6A 4RA8A 2LY7A 4GZYC 2BA0A 5FO7B 1PRTB 1JWMD 5AFWA 1EEID 4G57A 2RDGA 4FYDA 1HCZA 4XYOA 1R9TB 5I2YA 2BCOA 1EL0A 2QEJC 1HUNA 3NTKA 4V0BA 1SE3A 2IX0A 3K5MA 5KRUA 2QF7A 3H6MA 1H9SB 2VUMB 1QNKA 1I4PA 1GUSA 4A3DB 3BZDB 3V96A 1ZEQX 3T51B 3CHBD 1L0YB 2B2WC 1B50A 3IFTA 1CTMA 5IGEA 4DF7A 4ZKCB 1KLUD 4HSVA 2JP1A 2KUMA 3H91A 2B2UC 3K0YA 3NP8A 4XDXA 2H4OA 2JEBI 2X6LA 2IW3A 2R6GA 4CKBA 3J81E 1X32A 4DA2A 2KHSA 1KTKA 1H9JA 1H9KA 1IYUA 5FK9C 2SEBD 4K2LA 3BS1A 5K36H 5JPMC 3EROA 3FKIB 3TP8A 1U4RA 4NP5A 4X3KA 1J9OA 4UAIA 1LTAD 1MSHA 3E0JA 1YNJD 1K83B 1BCPC 1D2BA 3EJIA 3P75A 3TP6A 4HN7A 1IL8A 3ITPA 5J22A 4QCLA 4ZK9B 3GTJB 2NVQB 4F8MA 3PUVA 2LKVA 3AU7A 2J0TD 2PW5A 2EYLA 1TY2A 1E2WA 5BN4A 3VA7A 1HPCA 2B2UA 4X3TA 3SR1A 4QUCA 4V190 3NUCA 1CA5A 2K5DA 5K5PA 3GD7A 1PDQA 1QILA 1B53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F88 A;  4ZRZ A;  4F87 A; 
#chains in the Genus database with same CATH topology
 4AYB E;  2VNU D;  3PCO B;  3PGZ A;  3S16 H;  1HQR D;  3L9A X;  3K8A A;  1KAA A;  3DEP A;  1CKM A;  3FDT A;  1STN A;  5C0X H;  2JJQ A;  3J80 L;  3CCL A;  1NMG A;  4ID6 A;  3M85 A;  3HOV H;  3ICE A;  1FJG L;  1YHB A;  1ZYR C;  4IO9 A;  4CJ0 B;  2AQ3 B;  2VQE Q;  2K50 A;  1BOS A;  3PMF A;  4Z9C B;  4A3B H;  3CME A;  1ILQ A;  1M90 C;  4K0K L;  1CSQ A;  4YWM A;  1XYI A;  1WOC A;  1R4Q B;  1XJV A;  5EAY A;  1JWU D;  1I6H H;  4LUZ A;  2K03 A;  3VR3 A;  3HOW H;  2BE5 C;  3HEJ A;  1BBX C;  1EFW A;  1DYQ A;  1WD0 A;  4FP5 D;  3GTG B;  1EIF A;  2CW0 D;  3NEL A;  2PZW A;  3UDG A;  4XQJ A;  2JA8 B;  2OQ0 A;  1I6V C;  1SNC A;  4AQY Q;  1T9H A;  1PFN A;  3OOC A;  1JCK B;  2QCP X;  4OEM B;  1SSO A;  3A8J E;  4P71 A;  1VQH A;  5T1G A;  3CCE A;  1WYD A;  3LX0 A;  4KY6 A;  1O7Z A;  3ERS X;  2F4I A;  3D4W A;  1WTH A;  3V05 A;  4KMU C;  1M4V A;  2A6E D;  3JAM E;  3CAM A;  4FF3 A;  1YIJ A;  1U4L A;  1V9P A;  4IUV A;  3SXH A;  3EA6 A;  4PQX A;  2D5D A;  4DV1 Q;  4X3S A;  2Z6K C;  1EEF D;  4DR4 Q;  1EQT A;  2ZT9 C;  1O80 A;  3DWP A;  3I4M H;  1GO3 E;  1IHZ A;  2UUC L;  4NW2 A;  4AH6 A;  4LF6 Q;  3KJP A;  1AE3 A;  1D1K A;  1DGS A;  5D14 A;  1F77 A;  4K5X A;  3I70 A;  3DWQ A;  2ZTC A;  2L55 A;  1AEX A;  3HOU G;  2EJF C;  3MAQ A;  3GTQ H;  3GTK B;  3IAY A;  1O78 A;  1PZK D;  4A3I B;  2B8F A;  1UEB A;  1YVC A;  1LAC A;  1U0L A;  3DUZ A;  1G91 A;  3M3Y B;  2EOT A;  4ODG A;  3LNN A;  1VQI A;  1K73 C;  2ZM6 Q;  2NB0 A;  1AN8 A;  1PH3 A;  1PH9 A;  4KJN A;  2NWG A;  1KRT A;  2EDG A;  4S3S A;  5FLX c;  1CZG A;  3RZD H;  1BQQ T;  3I4N G;  2JA8 H;  5IGD A;  2HHH L;  3TZU A;  2EY2 A;  5DAU A;  4X62 Q;  2F0N A;  1FGU A;  1TII D;  1X65 A;  2HDM A;  4OWX B;  3BVZ A;  4X66 Q;  3N6R A;  5J39 A;  3S1N H;  3GTO H;  1Z47 A;  4A3M G;  1WCM B;  4ZYS A;  3K59 A;  1EFI D;  1U4M A;  1JJG A;  3FPP A;  2HCC A;  1OXV A;  2IPK D;  3D31 A;  1V8Q A;  3H3V C;  1LYL A;  1EIH A;  3T4A C;  4JI4 Q;  2Y0S G;  3G71 A;  5C3W A;  4LF5 Q;  2EQS A;  2F0K A;  1NBW A;  1IYJ B;  3QOJ A;  4JBJ A;  2I0Q A;  3S1M B;  4KLK A;  3RLO A;  1PTO F;  3SVM A;  4BY7 G;  4GN4 B;  2Y0S E;  5LMU L;  3NE5 B;  1NMF A;  2ZTE A;  3SHL A;  3NQT A;  1VQB A;  2R93 H;  1KDB A;  4BS9 A;  4DV4 L;  4JI5 Q;  1IKM A;  1SYC A;  1XXG A;  1HFN A;  3TS0 A;  2ID0 A;  3QIA A;  1Y8N B;  5ELD A;  2BA1 A;  2VUM G;  4XTC S;  1N33 L;  1HTP A;  4JI6 L;  4BBR B;  1FNU A;  5M5W H;  2Z6K A;  3M4O H;  4A3D G;  2OQK A;  1SMY C;  3BJU A;  5M5X B;  2IHE A;  1P16 A;  2HD3 A;  1IBM Q;  3S15 H;  1EZ6 A;  4DUY L;  3FMC A;  3TSS A;  3I91 A;  3PUX A;  5C44 H;  1E0B A;  1EU3 A;  4R1J A;  4CGY B;  4C3J B;  2R7Z H;  1DZ1 A;  4X64 L;  2UXD Q;  2PMZ B;  4OEL B;  1JJC B;  1CZW A;  3GDE A;  1HNZ Q;  3A54 A;  2CWP A;  4C1N K;  1DM0 B;  4HJA A;  4QIW B;  1U4P A;  1DON A;  3D6W A;  4Y52 H;  1ONL A;  1S40 A;  3H0G B;  3KF6 B;  4DFA A;  4L5S A;  4R4C A;  3F1Z A;  4L5R C;  3KF6 A;  4IUN A;  1BDO A;  2F0F A;  5IGC A;  2B2Y C;  4MTN A;  1F2Z A;  1YNJ C;  3DM3 A;  1TY0 A;  4DAY B;  4LFB L;  2E2H B;  3F2U A;  4DAY A;  4LF4 Q;  3A8K E;  3BDC A;  2JA7 H;  2B8G A;  1X3Q A;  1HXY D;  3I2Z A;  3OTO Q;  3CCM A;  2FXQ A;  1LT5 D;  2N55 A;  4KK7 A;  4EQO A;  1QVF A;  3MXN B;  5EKL A;  4DK0 A;  4L5T A;  4EVO A;  1A3V A;  2M9V A;  1TS2 A;  3FKI G;  2KEE A;  3CRL C;  4WFN 3;  3NWS A;  3MXP A;  3Q8D A;  3K80 C;  1XNR L;  3GTM B;  1WFQ A;  2FIN B;  3NK9 A;  4P2C B;  2RKS A;  1RDP D;  2RF4 A;  2A6H D;  3R2T A;  2QDL A;  1K3B C;  2K01 A;  5CV6 A;  3S17 B;  3CMA A;  3X3N A;  1K8M A;  1WTV A;  5LL6 S;  3J80 i;  1MGS A;  4ME3 A;  2ENB A;  2RCN A;  3H0G H;  4PZ7 A;  5IYC H;  5DNF A;  4DXG A;  4JV5 L;  1V43 A;  3PIO 3;  2MPM A;  1VQ7 A;  1EU4 A;  1XNQ L;  2YTV A;  2XVS A;  4JPB W;  3D0F A;  1KC8 C;  3RN5 A;  5JEA G;  1ROD A;  1N34 L;  1RL2 A;  1A2T A;  5FJ8 H;  3CU7 A;  4X65 L;  2ICI A;  5C0X J;  1UE1 A;  3H94 A;  5KYL A;  2YU9 B;  1E1T A;  3HS0 C;  4A3K B;  2KEC A;  1OO9 B;  1D1I A;  4YY3 Q;  1A6X A;  4E6I A;  1TWG H;  1OXX K;  5D3I B;  1TWH H;  2KHJ A;  5IWA L;  5FLM H;  1LTT D;  5HGT A;  3NWT A;  4ZRZ A;  3TS2 A;  3HOX G;  2J4X A;  1EIY B;  2A69 C;  2B2Y A;  2F0O A;  2NZO A;  4ZUJ A;  1IZ6 A;  3DMU A;  2AWO A;  2Q2T A;  1SNP A;  1K0S A;  1U5K A;  5NUC A;  2AHO B;  5G3L D;  2Z0S A;  4CDC C;  4I7A A;  2F52 A;  2JA6 B;  2RCF A;  2XIW A;  3W2D A;  3HKZ B;  2R61 A;  4H0L C;  3BU2 A;  1BCP F;  3OMC A;  4HIM A;  4DR1 L;  3CP0 A;  2MJ8 A;  1F2M A;  3GV6 A;  4A3C H;  2Q2H A;  2RHS B;  2K1B A;  3T1H Q;  2RQX A;  4B3S Q;  4X6A H;  1SE4 A;  5G3L F;  3ONA B;  4QMG A;  2N8N A;  4AIM A;  1SNQ A;  3A74 A;  1TQO A;  4PV1 C;  2F0I A;  2KOL A;  3R2I A;  5J3B A;  1IBL L;  1PHJ A;  1TWF H;  1BR9 A;  1UEA B;  5FLX L;  3OPO A;  3KLS X;  4LF7 L;  5FO9 B;  3PO3 B;  2OF1 A;  3QR8 A;  3K57 A;  4UP8 A;  1AFP A;  1HR0 Q;  2CWA A;  1KDC A;  1I94 L;  2NYZ D;  4GS3 A;  4RG1 A;  1A8V A;  5LMN W;  1AZP A;  2E2J B;  5IT9 c;  1ASZ A;  4IJH A;  3Q6S A;  4TRD A;  5FLX E;  2NN6 G;  1SRU A;  3CQZ B;  1STY A;  2OCE A;  1F2L A;  4HR7 B;  3A7A B;  5EGT A;  1TS4 A;  4Q0F A;  4H02 A;  1C7Y A;  1Y1V H;  3D4R A;  4BXX H;  3M4Y A;  1IW7 C;  3E9I A;  1PH7 A;  4A3I G;  3C46 A;  5ELE A;  4IFD I;  4OO1 I;  2G5D A;  5FOB B;  4HSP A;  2NVY H;  4OWT B;  2BDN A;  3DWA A;  1SYE A;  1MBY A;  1W3S A;  4XT3 B;  1PYS B;  2K32 A;  2F0L A;  4CDD C;  5IIF A;  2NBF A;  4UY8 C;  3T1Y Q;  4JVZ A;  3S1Q B;  1HNX L;  3A5Z B;  5IGF A;  1HNW Q;  5M3M H;  2J7Z A;  2KJX A;  3PV0 A;  1Y1W H;  3KLW A;  4RKB A;  2VQF Q;  3G48 A;  3CPF A;  3F2D A;  1YIT A;  2B2T A;  1NSN S;  1DOL A;  3ULP A;  4GLA C;  4P74 A;  4RCN A;  3PO3 H;  1WD1 A;  2HIV A;  4A3G B;  2UUA L;  3MZ5 A;  4LMQ D;  3S2D H;  3R3O A;  1WCM G;  3S9W A;  3OIQ A;  3VR6 A;  3SE0 A;  2O5J C;  3EIV A;  2MGS A;  3L7Z C;  2UU9 Q;  4L6T B;  3I72 A;  1GD7 A;  3PF4 A;  1TKW B;  2P5Z X;  1Z9F A;  3MXG A;  5FO8 B;  3NEM A;  2BH8 A;  1QOH A;  1IYV A;  3JC6 6;  2KCC A;  4YCW A;  2Z6B A;  3R93 A;  5C4X G;  1H9S A;  1NY4 A;  3CQZ H;  4NXN Q;  3CRK C;  1QG7 A;  4OIK A;  2F3W A;  2K33 A;  5CV5 A;  4QB4 A;  3CF5 A;  2A68 D;  1Q90 A;  4HJ5 A;  3KF8 B;  3VA5 A;  2RDH A;  1Q7Y C;  4DR4 L;  3L0O A;  2H1E A;  1L1O C;  2KVM A;  2F0M A;  3W1G A;  3KF8 A;  4DR3 Q;  4FF4 A;  3WOF A;  5E7N A;  4JOI A;  1Q1B A;  1T5X D;  2B63 B;  1CI3 M;  4C2M B;  4BBR G;  4A3F B;  3RD4 A;  2LMC B;  2X6G A;  1CK1 A;  4DV5 L;  4DV2 L;  3PUW A;  5C3X A;  3K81 C;  2UXB L;  1EWH A;  4IFD J;  1IL2 A;  4IUR A;  3PO2 B;  1O7L A;  2O4X A;  4C3J G;  1LAB A;  1FVI A;  4TVA B;  2RVL A;  2NZH A;  1BUV T;  3U58 A;  5CC4 A;  3GQB A;  4A3M H;  4A3G H;  5I6W A;  4PNY A;  3GV3 A;  5E4X A;  1CFM A;  2B39 A;  3U9O A;  2PMZ E;  1ASY A;  4KHP Q;  3QO2 A;  4RCO A;  4WJ3 M;  4UHV A;  5M5Y B;  4CBV A;  2C5C A;  1LT4 D;  4MN3 A;  1GUG A;  1S5F D;  3URY A;  2ZJR A;  5CGK A;  4QIW E;  1E7Z A;  5ELB A;  3U4V A;  1F9R A;  3F2B A;  2AUK A;  2E5L Q;  1RF2 D;  5IOC A;  3S16 B;  3T13 A;  4N8X 1;  1RIP A;  2A6H C;  4HED A;  4K6L A;  2X69 A;  5C4H A;  3HOZ H;  1VQM A;  3FEW X;  4B08 A;  4BY7 H;  4JI1 Q;  1IBK L;  3I4O A;  3CCQ A;  2H5X A;  1LV9 A;  3CCV A;  1EY6 A;  1EY8 A;  1FNW A;  3HOV B;  4LF5 L;  2OTJ A;  1G6P A;  1MIU A;  4DR5 L;  4UP9 A;  3S24 A;  3NBH B;  2DNE A;  1B70 B;  2IT1 A;  3OHX C;  2QDB A;  1TU2 B;  4DKA C;  4DV7 Q;  1STA A;  4JI2 L;  2KCN A;  4A3B B;  3NBH A;  3UDF A;  1PH1 A;  1A15 A;  1YJW A;  4A3J G;  1PTO H;  5ELF A;  4JI5 L;  3NPP A;  1GM5 A;  3Q24 A;  2UXC Q;  1UUP A;  3DEO A;  4XQQ A;  2A19 A;  1I6H B;  1TXY A;  4LWC A;  1TS5 A;  3HOW B;  3B6Y A;  2JA9 A;  1EWC A;  2G9H D;  2MO1 A;  5D65 A;  1S3O A;  1SE2 A;  5IYD G;  2QA4 A;  3PO2 H;  1TWA H;  1LM0 A;  2SDF A;  1G2S A;  4HMI A;  1OXS C;  2EJM A;  4HIO A;  1QVG A;  3E5S A;  4HTH A;  1A2U A;  1JB7 A;  4U68 A;  1BBU A;  1D7Q A;  1Q1E A;  5M5Y H;  1Y8O B;  4B3T Q;  3IL8 A;  2VS1 A;  3WDN A;  4LFA L;  5ELO A;  3GP7 A;  3AYH B;  4TKO B;  3CD6 A;  4A3L G;  1PYW D;  4FXD A;  1RHP A;  5C4Z A;  4YCU A;  4DR6 Q;  2ZXP A;  3STB C;  1RKN A;  3L2P A;  5IYB G;  2PI2 A;  1A62 A;  4LUV A;  3TDQ A;  2CQO A;  4A3K G;  3I4M B;  3P7J A;  2EYM A;  3U9S A;  2GVA A;  4OHJ A;  3QB3 A;  2OXP A;  4K6D A;  4PMC A;  4JBW A;  1LTS D;  5E4W C;  3CCS A;  4JI0 Q;  4LJZ C;  2EXD A;  4LF4 L;  1EY5 A;  3U4Z A;  2O2L D;  3GTQ B;  3MFY A;  4GKK L;  1SNO A;  2XGT A;  1I3Q H;  1VQF A;  3BYY B;  4JI3 L;  3J80 E;  4HCS A;  4DNI A;  4B3R L;  3FPU B;  2L9H A;  2PW7 A;  2ZJP A;  3K5O A;  4OL7 A;  3CW2 C;  1ET6 A;  4ZUI A;  4DR2 Q;  1W6J A;  5IT9 L;  3PSI A;  1Q81 C;  3HKZ G;  1VQN A;  1XMQ Q;  4JBM A;  1D6E C;  4PZ6 A;  3QG1 A;  3RZD B;  2E2I H;  3S2H H;  1A3U A;  3VR2 A;  3HKZ E;  1WTX A;  4RHS A;  2RSO A;  4M8A A;  4IUQ A;  1H9R A;  4R4O A;  4HAE A;  4B3M L;  3S1N B;  4BWG B;  3GTO B;  4HID A;  4A76 A;  5F2D A;  2AUJ D;  4IUU A;  1K8O A;  2IY5 B;  3J7Y W;  4QGU A;  5BN5 A;  3GTL H;  4LF8 L;  5KYI A;  3ZJY C;  3DXJ C;  4IZ8 A;  3PF5 A;  2Q2U A;  1OXU A;  2JA5 G;  2DJG C;  1XTD A;  2LXK A;  4JI8 Q;  4GKJ Q;  5CMD A;  4H44 C;  3KYH C;  2NTS A;  1FYC A;  3M4P A;  1B3Q A;  3M4Q A;  4ME5 A;  4FF1 A;  2QKI C;  2CCZ A;  4C3I H;  4C3H H;  3HOX H;  4LW1 A;  1EYA A;  1DJR D;  5FKA C;  4A3E G;  2AQ1 B;  3T53 B;  1LT6 D;  2PZT A;  2ZXR A;  4DUZ Q;  2R93 B;  2F0H A;  4YY3 L;  4EGV A;  3OWE B;  2JXM B;  4CKC A;  4L8J A;  3VR5 A;  2MFI A;  3MTS A;  5C4J B;  4O0A A;  1PH6 A;  1JB3 A;  5COY A;  1A0I A;  3G7L A;  4QJF A;  3I4L A;  3IRB A;  2KQ3 A;  1ESF A;  5M5W B;  2DNC A;  2L11 A;  4XIG S;  3M4O B;  4FO2 A;  1N36 Q;  3CKI B;  1WTR A;  1D5Z C;  1I5F A;  3J7A V;  3AFQ A;  3KLS A;  5JAV A;  3S15 B;  2NVT H;  5EQ0 A;  4FDB A;  1J5E Q;  2EYP A;  1I4H A;  2SOB A;  2XNA C;  4RGM A;  5GQO A;  5C44 B;  2F4V L;  2PQE A;  2PPB C;  3FP9 A;  3Q22 A;  4IAL A;  1PRT F;  2R7Z B;  1O7Y A;  1PTO D;  2LFN A;  3EFX D;  1S5D D;  4HMJ A;  1JOQ A;  3ND8 A;  4EQN A;  1VF5 C;  3I3C A;  1SXT A;  4GNX B;  2ATW A;  1J6Q A;  2HQL A;  5T1I A;  1YNX A;  1GXD C;  2I5H A;  1Q8K A;  4OGQ C;  1VQ6 A;  3A5U A;  1C48 A;  1ICF B;  3A8I E;  3OYY A;  4GNX A;  1VQ9 A;  4A93 H;  1LTB D;  2SNM A;  5E1F A;  4CHT B;  1ILP A;  4GN3 B;  3AEV A;  2JSO A;  1XMO Q;  1DOM A;  1ET9 A;  2ICE C;  2F0S A;  1N8R C;  1SJE D;  5C6A A;  2MO0 A;  4FNF A;  1WTQ A;  1EOT A;  2NVX H;  1QVC A;  2EYH A;  4DV3 L;  2EYO A;  1K8A C;  3ERQ A;  4LF9 Q;  1DD2 A;  3A7L A;  3UDI A;  2D2C C;  2LSS A;  1RTN A;  2JA7 B;  4CDE C;  1RTO A;  2A8V A;  3TBI B;  3VYS A;  2QIL A;  5C4J H;  4IUP A;  2B3G A;  2F0G A;  1B3A A;  1CT1 D;  1HZB A;  2M2L A;  4POG A;  5K36 G;  1C9O A;  2V4D A;  4P75 A;  3RLN A;  4A75 A;  1BXT A;  4DR7 Q;  4JG2 A;  5C5M A;  3J7A F;  2XSC A;  5GAG C;  1VQC A;  4BA1 I;  3P20 A;  3D8G A;  3NQI A;  2I5M X;  2PYK A;  5BR8 Q;  1SYG A;  2CVR A;  5LMN L;  3G4S A;  2NUC A;  1G51 A;  3EVQ A;  2B63 G;  1SFO H;  3TZD A;  4FXG C;  1JT8 A;  1YNN D;  4ULL A;  4IPH A;  4A3F G;  3HOY B;  1MKH A;  3KFU A;  1F9Q A;  1Q86 C;  1AP0 A;  5C0X I;  1Y69 U;  2YV5 A;  3ZYY X;  4H13 C;  1MSG A;  3T1Y L;  1HNW L;  2F0U A;  2XWJ B;  3NHH A;  5AJ3 L;  4KKU A;  3HG9 A;  5GAD C;  5M3F H;  1GJX A;  4BY1 H;  4OON A;  5IP9 H;  4NB3 A;  1K0R A;  3MXU A;  3SK4 A;  1N32 L;  3C3L A;  5EBC A;  5J1Z A;  1KDA A;  1TWG B;  4DV0 Q;  1HQM C;  5IP7 G;  1TWH B;  1XPR A;  1FD7 D;  3O13 A;  1B9M A;  2K52 A;  5C4X H;  2WB1 B;  4NMZ A;  4YHH L;  4QF4 A;  3MXN A;  4KHV A;  3R8B A;  3I56 A;  3J81 c;  4K8I A;  3Q0A A;  5C0X G;  3BZC A;  3TQY A;  1UWV A;  5IE8 A;  3A56 A;  1SND A;  5KNC A;  1S72 A;  3HOV G;  2DY8 A;  4NDX A;  4NXN L;  3T16 A;  1QZG A;  4WJW A;  3OSO A;  3S14 H;  1L0W A;  3DM1 A;  1ESR A;  3L3O C;  5JPN C;  3A0J A;  3BYT B;  4A3B G;  4BBS H;  2NTT A;  2EVB A;  3BDO A;  5IOD A;  1NTG A;  1X3F A;  2R92 H;  3HOY H;  1PZJ D;  1YHQ A;  2K05 A;  3BZK A;  4JYA L;  1STH A;  3VR4 A;  2F0T A;  5KEE A;  3GO5 A;  1K9M C;  3C1E A;  2DJF C;  1QJO A;  1NCV A;  2F0W A;  2AKW B;  4HCE A;  4R4T A;  4AYB B;  1GHK A;  5HUR A;  1NNX A;  1EUJ A;  4C1N I;  1WTO A;  1SYB A;  3I7F A;  1TWF B;  1JOK A;  2EJG C;  2WV6 D;  5CBA E;  3SEB A;  1JE4 A;  1J8I A;  1BCP D;  3E9H A;  3H09 A;  1PVO A;  1MJE A;  1VQD A;  2HIX A;  2UUB Q;  2K75 A;  3N52 A;  1XX8 A;  1VQG A;  4R8N A;  4KHP L;  1NR4 A;  2R3Z A;  3FVQ A;  3MA2 B;  1Q3L A;  3TRZ A;  3CC4 A;  1Q82 C;  1SE8 A;  4QUF A;  3M7N A;  2CW0 C;  2ASB A;  2WIN B;  1XWE A;  2RA4 A;  2YTX A;  4DK1 A;  2PI2 E;  3C2P A;  3I4M G;  5BN3 A;  2Q8I B;  2A73 B;  1LT3 D;  3D3R A;  1JQY D;  2B2T C;  2WAQ B;  3TP7 A;  1CA6 A;  1Y1V B;  4CJ2 C;  1JMC A;  1SJH D;  4A3J H;  4NXM L;  4XQN A;  1E2V A;  2A6E C;  2PCF B;  4G7H C;  1BBW A;  2FFK B;  4TQU S;  5C3E H;  2TMP A;  2NVY B;  4A4I A;  2HHH Q;  1PH5 A;  2D0P A;  4RKL A;  5M3M B;  3MHB A;  3AB9 A;  1KNE A;  1Y1W B;  4FF2 A;  1HR0 W;  2JA8 G;  1E2Z A;  1UE6 A;  2AWN A;  3CC2 A;  1B1Z A;  1ZYR D;  2K5N A;  1GUW A;  1GHJ A;  3HGB A;  3AMU A;  4XT1 B;  3S2D B;  4G7Z C;  1GUN A;  2JEA I;  1Y14 B;  1YZ6 A;  1V1P B;  4DNT B;  1NE3 A;  3QOL A;  4JOI C;  1AH9 A;  4B3T L;  2E2D C;  1PXU A;  2RDF A;  2VB3 X;  3PIP 3;  1STE A;  1V1P A;  3K5L A;  2K14 A;  4IPD A;  2LS0 1;  2BE5 D;  1PA6 A;  5LL6 X;  2HDL A;  4DXF A;  4DV4 Q;  1EYG A;  1LLR D;  4QY7 A;  5KGU A;  1PTO C;  1CUK A;  2AQ2 B;  2AMC B;  3NXW A;  4DK6 C;  1F9S A;  1VQE A;  1N33 Q;  3NEN A;  5CV8 A;  3VYT A;  1WVL A;  4G7O C;  4I7Z C;  2R93 G;  4CDF C;  2FHT A;  4IOA A;  4L63 B;  5CBE E;  2VQE L;  3JAM c;  3TP5 A;  1I4Q A;  2NZ1 D;  4UP7 A;  2G9D A;  4X64 Q;  5GRO A;  4PG3 A;  1SMX A;  5I2X A;  2C9O A;  4J8Q A;  3K7A H;  1S5B D;  1U9R A;  2KEN A;  3I4N B;  3PIO A;  2KA7 A;  3KLR A;  2F0Q A;  3E6Z X;  3TRE A;  1UE7 A;  2Z1C A;  4DNR B;  4JC0 A;  2VY3 A;  1WJJ A;  3WWV A;  2CHB D;  4R8I A;  1PH8 A;  4A3M B;  1YEZ A;  3RNU A;  1HH2 P;  1EY7 A;  4AQY L;  2JK8 A;  2JA5 H;  4IFD G;  4OO1 G;  1B4O A;  3CCU A;  2LXJ A;  1AE2 A;  3J81 j;  2VXW A;  3VDY A;  3HFZ B;  2BH2 A;  2Y0S B;  2RBM A;  3HOZ B;  2VB2 X;  4MTK A;  1C8C A;  1L2F A;  2B29 A;  2Q8T A;  4BY7 B;  3KBG A;  4DV6 Q;  4A3E H;  3HOU H;  4DU9 A;  1SYF A;  4DV1 L;  1VQA A;  4QL5 A;  1VQ4 A;  1YNN C;  2MUY A;  2JA7 G;  2R7D A;  1QCB D;  2R7F A;  4LF6 L;  1KQS A;  4WOR A;  4ZAI A;  1SLJ A;  5CR3 A;  4OXP A;  5EPJ A;  2XN9 C;  1QNU A;  4DUZ L;  1PTO B;  5TSS A;  5KNB A;  2QW7 A;  4WRD A;  3I4N H;  5JVH 3;  1ML0 D;  2CH4 W;  2Q8R E;  1LTL A;  3ULJ A;  3GTP B;  3NBI A;  3J81 L;  2ZM6 L;  2L1B A;  4X3U A;  3HZX A;  2ALY B;  4JV5 Q;  4ZQ3 A;  1TWA B;  4LFC Q;  3RN2 A;  1ZXT A;  1XNQ Q;  1K8G A;  2Z8L A;  4KY7 A;  4APV A;  4O2D A;  5KIX A;  4X62 L;  3H0G G;  2JQO A;  1E3P A;  3I8Z A;  2F0P A;  4RGT A;  4X66 L;  2F3V A;  3Q23 A;  4X65 Q;  4ZLT F;  3CC7 A;  1HRJ A;  5EBD A;  4NPS A;  5CV7 A;  1SMY D;  1JIC A;  4ALP A;  2IHF A;  5A35 A;  4B9X A;  2E76 C;  1HA6 A;  4XYQ A;  4KHZ A;  5FJ8 G;  2ZTD A;  4O1N A;  4JI4 L;  1MI2 A;  1FR3 A;  3J7Z C;  3TN2 A;  3UDX A;  5GAH C;  1QE6 A;  2K6A A;  2B2V A;  2VUM H;  4GOP B;  5FLM G;  2MHV A;  4YWL A;  3P1H A;  2K5H A;  4H7B A;  1QUQ B;  2WB1 G;  4GOP A;  4A3D H;  4GLX A;  3A55 A;  5D3D A;  1I3Q B;  3IFD A;  2DGY A;  3UE1 A;  3BDL A;  1JJ2 A;  2WB1 E;  1I4X A;  1ENF A;  4TSS A;  5CV9 A;  1JC7 A;  4DR1 Q;  4L5Q A;  2WAC A;  3X3M A;  3CCJ A;  3GTP H;  4KN7 C;  4R4I A;  3J7A 5;  2F0D A;  4K5W A;  4IQZ A;  1Z6H A;  2PNR C;  5ISR A;  4DGZ A;  1IBM L;  2E2I B;  1K3R A;  1VDZ A;  1EZ8 A;  3LGJ A;  3S2H B;  3NTI A;  4K14 A;  1UAP A;  3HP3 A;  4A3C G;  1BO0 A;  3MVV A;  2QGQ A;  2UXD L;  1ZKO A;  1GKH A;  1PH4 A;  1HNZ L;  3MFG A;  1YHA A;  2B2W A;  1IBL Q;  3CPW A;  1ENA A;  1DCZ A;  3KUP A;  3GTL B;  1H9M A;  1D5M C;  4LF7 Q;  1SR3 A;  2D9U A;  5HGQ A;  2IX1 A;  1S5E D;  2D0O A;  4PMW A;  4QQB X;  1CQF A;  1HZC A;  1I94 Q;  2XTI A;  1HA5 A;  2CH4 A;  2K5V A;  5HY6 A;  2HT1 A;  4C3H B;  3EQL C;  4C3I B;  3HOX B;  3FKI H;  1B9N A;  2IJ0 A;  5A2Q L;  3VYR A;  2K7V A;  3OTO L;  1HTL D;  1X3P A;  3FRP B;  1BKB A;  1Q12 A;  1EY0 A;  3OMG A;  4DV0 L;  2FMM A;  3IKJ A;  4J6H A;  4DAV A;  4P72 A;  1OTC A;  4GNX C;  5EKK A;  1K83 H;  3F2C A;  2EY5 A;  1SBB B;  3UI2 A;  2JA6 G;  1V1O A;  5IP7 H;  4U67 3;  5M9O A;  3SGI A;  2MNA A;  5ELC A;  3LWE A;  4EX5 A;  4IOC A;  1SEB D;  2NVT B;  2WAQ G;  1HZA A;  1Y1V G;  5DM6 3;  1QWY A;  2CKZ B;  4PMB A;  4BXX G;  2E75 C;  5A2Q E;  1HNX Q;  5EKI A;  1G6Z A;  1M8A A;  1PZI D;  2K4K A;  1Q8I A;  1T5E A;  2WAQ E;  5E3F A;  3OW7 A;  3QWN A;  2L0C A;  3GTJ H;  2NVQ H;  1Y8P B;  2A69 D;  5I4D A;  2I5L X;  5IT9 E;  3MC0 B;  1CHQ D;  2OEO A;  4N8F A;  5JEA H;  1G8Z D;  4A93 B;  3JAM L;  2EY1 A;  1BCP B;  2WII B;  5M3M G;  2GA4 B;  1JWS D;  2UUA Q;  1EQQ A;  1Y1W G;  1FNV A;  2NVX B;  3WOE A;  5JJK A;  3SK6 A;  3RZO B;  4GLV B;  4NKL A;  1VQK A;  3MEH A;  1LTR D;  3PO3 G;  1PV4 A;  2N49 A;  1JOO A;  4KV6 A;  4RGN A;  1PRT D;  5GAE C;  3DLL A;  4JI7 Q;  1VCI A;  2V1C C;  2GN5 A;  5JOB A;  3TME A;  2ES2 A;  1O7I A;  2EE1 A;  2PZU A;  1CQV A;  5DM7 3;  3CCR A;  2UUB L;  5IGB A;  3BVM A;  2I46 A;  3E3X A;  4M1U B;  1Q46 A;  4P73 A;  1PFB A;  1V1Q A;  4LAA A;  4GN5 A;  1YJ9 A;  3FHW A;  2SNS A;  3I90 A;  1EQV A;  2JN4 A;  4IN3 A;  1BF4 A;  1EYD A;  4BA2 I;  5CYU A;  1W2B A;  1CHP D;  4KY5 A;  4DV5 Q;  4DV2 Q;  1P8L A;  1SN8 A;  4K5V A;  2UXB Q;  5JJL A;  3D6C A;  1CM9 A;  3I73 A;  1SFO B;  1GOZ A;  3RUZ A;  2K28 A;  4R9W A;  1G29 1;  3GTG H;  1RCV D;  2Q2I A;  4F7X A;  3T1H L;  1VF7 A;  1XTC D;  4B3S L;  2A68 C;  1I4G A;  2F0E A;  3DHQ A;  3KBX A;  3RZO H;  1W6K A;  1B8A A;  3H15 A;  1GUT A;  1E24 A;  5M3F B;  4BY1 B;  2PNH A;  5C5L A;  4A3G G;  3F8T A;  3KK7 A;  1VQJ A;  1IW7 D;  2WKD A;  5H1S E;  5COR A;  3J81 i;  1VQL A;  1IBK Q;  5IGG A;  1EYC A;  1MD2 D;  1ICW A;  1GUO A;  3OW2 A;  1KNA A;  1PLF A;  1SDF A;  1HR0 L;  2NN6 H;  1DXM A;  5C4X B;  2YTY A;  4DR5 Q;  2K5W A;  3HOZ G;  2E8G A;  1SNM A;  2C35 B;  4JI2 Q;  1X55 A;  4KTA A;  5ELN A;  2D62 A;  3GTK H;  1SYD A;  4A3I H;  2Z4H A;  2WFW A;  5KND A;  3S14 B;  2XRS D;  4O42 A;  3AFP A;  3T56 B;  2QEX A;  3M3Y H;  4J1M A;  4ILW A;  4OX9 Q;  4DAP A;  4RAU C;  3ULL A;  1STG A;  3M7G A;  1A3T A;  4BBS B;  1HZ9 A;  3NSW A;  4G4K A;  2O5I C;  2R92 B;  2KBN A;  2EY6 A;  2L15 A;  3ND9 A;  3W3A A;  3TEH B;  4Y7N B;  3G6E A;  1R4P B;  1L0X B;  2XWB B;  1VQP A;  4RHR A;  3PO2 G;  1G2T A;  4Q5V A;  3HKS A;  4LFA Q;  1PH2 A;  5JJI A;  1WCM H;  3PUY A;  1VMP A;  2K04 A;  2VQF L;  2F0V A;  1S4Z A;  4JBK A;  4KD4 A;  1KLG D;  4IFD H;  4OO1 H;  4UDU C;  4R4Q A;  2EPB A;  2YYZ A;  1NUC A;  2GVB A;  1YJN A;  1HJP A;  2WKC A;  3HRZ C;  4FXK C;  1II3 A;  2L12 A;  3G6J B;  1FJG Q;  3S1M H;  3BG3 A;  2PQA B;  2IL8 A;  2UU9 L;  2F1M A;  2KED A;  4LUO A;  3ER0 A;  2PQA A;  4K0K Q;  1Z7T A;  4GKK Q;  2F03 A;  1VQO A;  4JI3 Q;  5JVG 3;  4UPA A;  4B3R Q;  1B44 D;  4ZCK A;  1WTP A;  4N9T A;  4DV6 L;  3RLF A;  3KDF B;  4BBR H;  1IKL A;  1F9P A;  4A3J B;  4LK1 C;  1A63 A;  1ENC A;  3KDF A;  4KI0 A;  5M5X H;  1CSP A;  4DR3 L;  5EJW A;  5C3E B;  4DAM A;  1S5C D;  1EY4 A;  1H95 A;  4Y7N H;  2Z4I A;  3C1F A;  2E74 C;  1JOR A;  2N3S A;  4C3J H;  1TT2 A;  3HOW G;  3W1B A;  1F2Y A;  2XRQ D;  4CJ1 B;  4I65 A;  4KJO A;  4CKE A;  3K58 A;  4B3M Q;  1PMR A;  3SK8 A;  4RWS C;  2IX3 A;  3RMH A;  2DY7 A;  1NAP A;  4LF8 Q;  3EN2 A;  4DN4 M;  2CQA A;  4LFC L;  2L5T A;  4HJ8 A;  2OT2 A;  1TS3 A;  2F0J A;  1I50 B;  4PZ8 A;  4RGO S;  2N88 A;  2UUC Q;  1TWC B;  2JE6 I;  3UE0 A;  1LTI D;  2A5H A;  1FGB D;  4FVM A;  4IUT A;  2E2H H;  3K0X A;  1TVX A;  2E5L L;  2JYO A;  2IWH A;  2KCM A;  1EY9 A;  1I4R A;  4MIU A;  2M00 A;  2A1A A;  1QZH A;  1UNS A;  3H3V H;  4YIJ A;  4JI1 L;  3JAM i;  4J15 A;  4N9P A;  2L4N A;  1VMC A;  4C3H G;  4C3I G;  4F87 A;  2RSN A;  5LHY 1;  4C56 C;  3BVG A;  1YBY A;  3GTM H;  2FJ2 A;  2FMC A;  1EWI A;  1PFS A;  3VYU A;  3CXC A;  4F88 A;  2OTL A;  4KKS A;  4MZ9 A;  4DV7 L;  1UE5 A;  5DLQ E;  2F4V Q;  1X3E A;  5IYD H;  1KD1 C;  2ZXO A;  3OIP A;  3S17 H;  4JK1 C;  3LWU A;  2UXC L;  2F3I A;  3K7A B;  3STB D;  1OXT A;  4RFB A;  1JR0 D;  5JEA J;  2MP1 A;  1QB5 D;  3SK5 A;  1TR5 A;  3MEF A;  2HUG A;  1PRT C;  2HQE A;  1LTG D;  1LUZ A;  3OWF A;  5EPK A;  3K5N A;  1D5X C;  1PFM A;  1DOK A;  5JJZ A;  1I50 H;  3J80 c;  2EZV A;  2NN6 I;  4DV3 Q;  1CKO A;  4A3L H;  2TSS A;  5I6Y A;  4JCV E;  1WTW A;  1RD9 D;  1TWC H;  4A93 G;  2JA5 B;  5DEH A;  4EQ5 A;  5I9O A;  5IYB H;  5LMU Q;  3V2T A;  1AZQ A;  1BNZ A;  2BOS A;  2YU9 H;  4A3K H;  4KN4 C;  1X9N A;  5I9P A;  1AW7 A;  1EOV A;  2BDO A;  4IPC A;  3U50 C;  2K5Q A;  3QJY A;  4DPG A;  1IXR A;  4KD3 A;  4A3E B;  3HOU B;  4DR6 L;  2EXZ A;  3D4D A;  1HUM A;  1VQ8 A;  4JI6 Q;  1MJC A;  3MWY W;  1KAB A;  1MHW C;  4OIJ A;  4RMF A;  3NTH A;  1SRO A;  1C0A A;  2VL6 A;  4K2K A;  4DUY Q;  1SAP A;  2PO4 A;  2EYJ A;  2Z9H A;  2DN8 A;  1EIG A;  4JI0 L;  1HFG A;  2JA6 H;  3SDZ A;  3M9B A;  4K8J A;  5LMN Q;  1C4Q A;  1RJT A;  4B9W A;  1HHV A;  3K6O A;  1PYB A;  4LNQ A;  2VW9 A;  4ABN A;  2EYF A;  4MHE A;  5C44 G;  2A74 C;  2HCI A;  2I07 B;  3PUZ A;  5EPL A;  4DR2 L;  3KJO A;  2R7Z G;  1B2T A;  4YCV A;  4EQP A;  1XMQ L;  1LO5 D;  1NR2 A;  5CV4 A;  3S1R B;  4XXE A;  4IPG A;  4ZKB B;  1STB A;  1EQR A;  2WP8 J;  4KKT A;  5AJ3 Q;  2B2V C;  4RH6 A;  4RA8 A;  2LY7 A;  4LFB Q;  4GZY C;  2BA0 A;  5FO7 B;  4MNO A;  4GOP C;  1N32 Q;  1PRT B;  1JWM D;  5L37 A;  4IJL A;  4HJ9 A;  5AFW A;  1EEI D;  4G57 A;  1D8L A;  4DK3 C;  3K7U C;  1X54 A;  2RHQ B;  2RDG A;  4FYD A;  1HCZ A;  2KHI A;  4XYO A;  5M3F G;  4BY1 G;  1R9T B;  4OWW B;  4JI8 L;  5I2Y A;  5IP9 G;  1WI5 A;  2BCO A;  4YHH Q;  4GKJ L;  1EL0 A;  2QEJ C;  1HUN A;  3NTK A;  4V0B A;  1SE3 A;  2IX0 A;  3K5M A;  1XNR Q;  5KRU A;  2QF7 A;  3H6M A;  2E2J H;  1H9S B;  2VUM B;  1YI2 A;  1QNK A;  1I4P A;  1GUS A;  4A3D B;  3BZD B;  3V96 A;  4JI7 L;  1ZEQ X;  1XPO A;  3T51 B;  3CHB D;  1KXL A;  1B7Y B;  1L0Y B;  2B2W C;  1B50 A;  3IFT A;  3PQI A;  1CTM A;  4WJ4 A;  5IY0 A;  1VS0 A;  4DF7 A;  5IGE A;  4ZKC B;  1KLU D;  1NJI C;  1X6O A;  4HSV A;  2JP1 A;  1N36 L;  4JYA Q;  2KUM A;  2MQH A;  3H91 A;  2B2U C;  3K0Y A;  3NP8 A;  4XDX A;  1VQ5 A;  3S1R H;  2OWO A;  2KCT A;  1J5E L;  3S1Q H;  4BBS G;  2H4O A;  1CKN B;  2JEB I;  1N34 Q;  2R92 G;  2X6L A;  3HOY G;  5IYC G;  1E1O A;  2IW3 A;  1CKN A;  2R6G A;  4CKB A;  1BVS A;  3I55 A;  3RR5 A;  3J81 E;  1X32 A;  4HIK A;  1E22 A;  4DA2 A;  1GVP A;  3H3V I;  3PIP A;  5IWA Q;  1XMO L;  2KHS A;  3EBE A;  4JW0 A;  3KOJ A;  1R9T H;  1K28 A;  1KTK A;  1XPU A;  1H9J A;  2DUD A;  1H9K A;  1X3G A;  4YWK A;  1IYU A;  4LF9 L;  5FK9 C;  2SEB D;  4K2L A;  3BS1 A;  5K36 H;  5JPM C;  3ERO A;  1KL9 A;  3FKI B;  3TP8 A;  1U4R A;  1JE5 A;  4NP5 A;  2EIF A;  4X3K A;  3W5O A;  2VZA A;  1J9O A;  1QUQ A;  4UAI A;  1LTA D;  1MSH A;  2CFM A;  3E0J A;  1KHI A;  4NXM Q;  1YNJ D;  1K83 B;  3AQQ A;  3E0E A;  4POF A;  4DR7 L;  1BCP C;  2B63 H;  1D2B A;  1N9W A;  3EJI A;  1M1K C;  4C2M H;  4A3F H;  3P75 A;  2N78 A;  5BR8 L;  3TP6 A;  4HN7 A;  5C3E G;  1IL8 A;  3ITP A;  5J22 A;  4QCL A;  4OX9 L;  4ZK9 B;  1L1O B;  3GTJ B;  2NVQ B;  4F8M A;  3PUV A;  1X56 A;  2LKV A;  3AU7 A;  2J0T D;  1L1O A;  2PW5 A;  2EYL A;  1KRS A;  1TY2 A;  1KIX A;  1FL0 A;  1E2W A;  1KAW A;  5BN4 A;  3VA7 A;  1HPC A;  4AYB G;  2B2U A;  4X3T A;  3SR1 A;  4QUC A;  2ZJQ A;  4V19 0;  3NUC A;  4HJ7 A;  1CA5 A;  2K5D A;  5K5P A;  3GD7 A;  1PDQ A;  1QIL A;  1B53 A; 
#chains in the Genus database with same CATH homology
 2VNU D;  1HQR D;  3L9A X;  1KAA A;  3DEP A;  3FDT A;  1STN A;  5C0X H;  3J80 L;  4ID6 A;  3M85 A;  1ZYR C;  4CJ0 B;  2AQ3 B;  3PMF A;  1BOS A;  4Z9C B;  1ILQ A;  1XYI A;  1R4Q B;  1JWU D;  2K03 A;  3VR3 A;  2BE5 C;  3HEJ A;  1BBX C;  1DYQ A;  1WD0 A;  4FP5 D;  3GTG B;  2CW0 D;  2PZW A;  2JA8 B;  4XQJ A;  1I6V C;  1SNC A;  1PFN A;  3OOC A;  1JCK B;  2QCP X;  1SSO A;  3A8J E;  5T1G A;  3LX0 A;  4KY6 A;  1O7Z A;  2F4I A;  3D4W A;  3V05 A;  4KMU C;  1M4V A;  2A6E D;  3JAM E;  4FF3 A;  1U4L A;  4IUV A;  3SXH A;  3EA6 A;  4PQX A;  2D5D A;  4X3S A;  1EEF D;  1EQT A;  2ZT9 C;  1O80 A;  3DWP A;  1IHZ A;  4NW2 A;  1D1K A;  5D14 A;  1F77 A;  4K5X A;  3I70 A;  3DWQ A;  2L55 A;  1AEX A;  2EJF C;  3MAQ A;  3GTK B;  3IAY A;  1O78 A;  1PZK D;  4A3I B;  2B8F A;  1LAC A;  3DUZ A;  1G91 A;  3M3Y B;  2EOT A;  4ODG A;  3LNN A;  2NB0 A;  1AN8 A;  4KJN A;  2NWG A;  2EDG A;  4S3S A;  1CZG A;  1BQQ T;  5IGD A;  3TZU A;  2EY2 A;  5DAU A;  2F0N A;  1TII D;  2HDM A;  3BVZ A;  3N6R A;  5J39 A;  1Z47 A;  1WCM B;  4ZYS A;  3K59 A;  1EFI D;  1U4M A;  3FPP A;  2HCC A;  1OXV A;  2IPK D;  3D31 A;  1V8Q A;  3H3V C;  1EIH A;  3T4A C;  5C3W A;  2F0K A;  3QOJ A;  3S1M B;  1PTO F;  3SVM A;  3NE5 B;  3SHL A;  3NQT A;  1KDB A;  4BS9 A;  1IKM A;  1SYC A;  1XXG A;  1HFN A;  2ID0 A;  3QIA A;  1Y8N B;  5ELD A;  2BA1 A;  4XTC S;  1HTP A;  4BBR B;  1FNU A;  1SMY C;  5M5X B;  1EZ6 A;  3FMC A;  3TSS A;  3I91 A;  3PUX A;  1E0B A;  1EU3 A;  4CGY B;  4C3J B;  1DZ1 A;  2PMZ B;  1CZW A;  3A54 A;  4C1N K;  1DM0 B;  4QIW B;  1U4P A;  1DON A;  3D6W A;  1ONL A;  3H0G B;  4DFA A;  4IUN A;  1BDO A;  2F0F A;  5IGC A;  2B2Y C;  1F2Z A;  1YNJ C;  1TY0 A;  2E2H B;  3F2U A;  4DAY A;  3A8K E;  3BDC A;  2B8G A;  1X3Q A;  1HXY D;  1LT5 D;  2N55 A;  4KK7 A;  4EQO A;  5EKL A;  4DK0 A;  4EVO A;  1A3V A;  2M9V A;  1TS2 A;  2KEE A;  3CRL C;  4WFN 3;  3NWS A;  3MXP A;  3GTM B;  2FIN B;  3NK9 A;  4P2C B;  2RKS A;  1RDP D;  2A6H D;  3R2T A;  2K01 A;  5CV6 A;  3S17 B;  3X3N A;  1K8M A;  1WTV A;  5LL6 S;  1MGS A;  2ENB A;  5DNF A;  4DXG A;  1V43 A;  3PIO 3;  2MPM A;  1EU4 A;  2XVS A;  5JEA G;  1ROD A;  1A2T A;  3CU7 A;  2ICI A;  5C0X J;  3H94 A;  5KYL A;  2YU9 B;  3HS0 C;  4A3K B;  2KEC A;  1OO9 B;  1D1I A;  1A6X A;  4E6I A;  1OXX K;  5D3I B;  1LTT D;  5HGT A;  3NWT A;  4ZRZ A;  2J4X A;  2A69 C;  2B2Y A;  2F0O A;  4ZUJ A;  3DMU A;  2AWO A;  1SNP A;  5NUC A;  5G3L D;  2JA6 B;  2XIW A;  3W2D A;  3HKZ B;  2R61 A;  4H0L C;  1BCP F;  3OMC A;  2MJ8 A;  1F2M A;  3GV6 A;  2K1B A;  2RQX A;  1SE4 A;  5G3L F;  3ONA B;  4QMG A;  1SNQ A;  1TQO A;  4PV1 C;  2F0I A;  2KOL A;  3R2I A;  1BR9 A;  1UEA B;  5FLX L;  3OPO A;  3KLS X;  5FO9 B;  3PO3 B;  2OF1 A;  3K57 A;  1AFP A;  1KDC A;  2NYZ D;  1AZP A;  2E2J B;  3Q6S A;  4TRD A;  5FLX E;  2NN6 G;  3CQZ B;  1STY A;  1F2L A;  4HR7 B;  3A7A B;  5EGT A;  1TS4 A;  4Q0F A;  3D4R A;  3M4Y A;  1IW7 C;  3C46 A;  5ELE A;  4IFD I;  4OO1 I;  5FOB B;  4HSP A;  2BDN A;  3DWA A;  1SYE A;  1MBY A;  4XT3 B;  2K32 A;  2F0L A;  5IIF A;  2NBF A;  3S1Q B;  5IGF A;  2J7Z A;  2KJX A;  3PV0 A;  4RKB A;  2B2T A;  1NSN S;  1DOL A;  4RCN A;  1WD1 A;  4A3G B;  3MZ5 A;  4LMQ D;  3R3O A;  3S9W A;  3OIQ A;  3VR6 A;  3SE0 A;  2O5J C;  2MGS A;  3L7Z C;  4L6T B;  3I72 A;  1TKW B;  3MXG A;  5FO8 B;  1IYV A;  1QOH A;  2KCC A;  3R93 A;  1H9S A;  3CRK C;  1QG7 A;  4OIK A;  2F3W A;  2K33 A;  5CV5 A;  4QB4 A;  2A68 D;  1Q90 A;  3VA5 A;  2RDH A;  2H1E A;  2KVM A;  2F0M A;  3KF8 A;  4FF4 A;  3WOF A;  1Q1B A;  1T5X D;  2B63 B;  1CI3 M;  4C2M B;  4A3F B;  3RD4 A;  2LMC B;  2X6G A;  1CK1 A;  3PUW A;  5C3X A;  1EWH A;  4IFD J;  4IUR A;  3PO2 B;  1O7L A;  2O4X A;  4C3J G;  1LAB A;  2RVL A;  1BUV T;  5CC4 A;  3GQB A;  5I6W A;  4PNY A;  3GV3 A;  5E4X A;  1CFM A;  2B39 A;  3U9O A;  5M5Y B;  3QO2 A;  4RCO A;  4CBV A;  2C5C A;  1LT4 D;  4MN3 A;  1GUG A;  1S5F D;  3URY A;  5CGK A;  5ELB A;  1F9R A;  2AUK A;  1RF2 D;  5IOC A;  3S16 B;  3T13 A;  2A6H C;  4HED A;  4K6L A;  2X69 A;  5C4H A;  3FEW X;  4B08 A;  1LV9 A;  1EY6 A;  1EY8 A;  1FNW A;  3HOV B;  2DNE A;  2IT1 A;  3OHX C;  2QDB A;  1TU2 B;  1STA A;  2KCN A;  4A3B B;  3NBH A;  1A15 A;  1PTO H;  5ELF A;  3NPP A;  3Q24 A;  1UUP A;  3DEO A;  4XQQ A;  1I6H B;  1TS5 A;  3HOW B;  1EWC A;  2G9H D;  5D65 A;  1SE2 A;  2SDF A;  4HMI A;  1G2S A;  1OXS C;  2EJM A;  3E5S A;  4HTH A;  1A2U A;  4U68 A;  1Q1E A;  1Y8O B;  3IL8 A;  3WDN A;  3GP7 A;  4TKO B;  1PYW D;  4FXD A;  1RHP A;  5C4Z A;  2ZXP A;  1RKN A;  3TDQ A;  3I4M B;  3P7J A;  2EYM A;  3U9S A;  4OHJ A;  3QB3 A;  2OXP A;  4K6D A;  4PMC A;  4JBW A;  1LTS D;  5E4W C;  4LJZ C;  1EY5 A;  2O2L D;  3GTQ B;  3MFY A;  1SNO A;  3BYY B;  3J80 E;  4HCS A;  3FPU B;  2L9H A;  2PW7 A;  3K5O A;  4OL7 A;  1ET6 A;  4ZUI A;  1W6J A;  5IT9 L;  1D6E C;  3QG1 A;  3RZD B;  1A3U A;  3VR2 A;  1WTX A;  4RHS A;  2RSO A;  4M8A A;  4IUQ A;  1H9R A;  4HAE A;  3S1N B;  4BWG B;  3GTO B;  5F2D A;  2AUJ D;  4IUU A;  1K8O A;  3J7Y W;  5BN5 A;  5KYI A;  3DXJ C;  4IZ8 A;  1OXU A;  5CMD A;  4H44 C;  2NTS A;  1FYC A;  4ME5 A;  4FF1 A;  2QKI C;  1EYA A;  1DJR D;  5FKA C;  2AQ1 B;  3T53 B;  1LT6 D;  2PZT A;  2ZXR A;  2R93 B;  2F0H A;  4EGV A;  3OWE B;  2JXM B;  4CKC A;  4L8J A;  3VR5 A;  3MTS A;  5C4J B;  1JB3 A;  5COY A;  3G7L A;  3I4L A;  2KQ3 A;  1ESF A;  5M5W B;  2DNC A;  2L11 A;  4XIG S;  3M4O B;  4FO2 A;  3CKI B;  1WTR A;  1D5Z C;  3J7A V;  3KLS A;  5JAV A;  3S15 B;  5EQ0 A;  2EYP A;  1I4H A;  2SOB A;  2XNA C;  4RGM A;  5C44 B;  2PQE A;  2PPB C;  3Q22 A;  4IAL A;  1PRT F;  2R7Z B;  1O7Y A;  1PTO D;  2LFN A;  3EFX D;  1S5D D;  4HMJ A;  1JOQ A;  3ND8 A;  4EQN A;  1VF5 C;  3I3C A;  1SXT A;  5T1I A;  1GXD C;  4OGQ C;  1C48 A;  3A8I E;  1LTB D;  2SNM A;  5E1F A;  4CHT B;  1ILP A;  2JSO A;  1DOM A;  1ET9 A;  2ICE C;  2F0S A;  1SJE D;  5C6A A;  4FNF A;  1WTQ A;  1EOT A;  2EYH A;  2EYO A;  3ERQ A;  1DD2 A;  3A7L A;  2D2C C;  1RTN A;  2JA7 B;  1RTO A;  3TBI B;  3VYS A;  2QIL A;  4IUP A;  2F0G A;  1B3A A;  1CT1 D;  2M2L A;  5K36 G;  2V4D A;  1BXT A;  5C5M A;  3J7A F;  2XSC A;  4BA1 I;  3P20 A;  3D8G A;  3NQI A;  2PYK A;  1SYG A;  2CVR A;  2NUC A;  3EVQ A;  3TZD A;  4FXG C;  1YNN D;  4ULL A;  3HOY B;  1F9Q A;  1AP0 A;  5C0X I;  1Y69 U;  3ZYY X;  4H13 C;  1MSG A;  2F0U A;  2XWJ B;  3NHH A;  4KKU A;  3HG9 A;  1GJX A;  3MXU A;  3SK4 A;  3C3L A;  5EBC A;  5J1Z A;  1KDA A;  1TWG B;  1HQM C;  1TWH B;  1FD7 D;  3O13 A;  1B9M A;  2WB1 B;  4NMZ A;  4QF4 A;  3MXN A;  4KHV A;  3R8B A;  4K8I A;  3Q0A A;  5C0X G;  3A56 A;  1SND A;  5KNC A;  2DY8 A;  4NDX A;  3T16 A;  4WJW A;  3OSO A;  3DM1 A;  1ESR A;  3L3O C;  5JPN C;  3BYT B;  2NTT A;  2EVB A;  3BDO A;  5IOD A;  1PZJ D;  2K05 A;  1STH A;  3VR4 A;  2F0T A;  5KEE A;  3GO5 A;  3C1E A;  1QJO A;  1NCV A;  2F0W A;  4HCE A;  4AYB B;  1GHK A;  5HUR A;  4C1N I;  1WTO A;  1SYB A;  1TWF B;  1JOK A;  2EJG C;  2WV6 D;  5CBA E;  3SEB A;  1JE4 A;  1J8I A;  1BCP D;  3H09 A;  1XX8 A;  3N52 A;  4R8N A;  1NR4 A;  2R3Z A;  3FVQ A;  3MA2 B;  1Q3L A;  3M7N A;  4QUF A;  2CW0 C;  2WIN B;  1XWE A;  2RA4 A;  4DK1 A;  3C2P A;  5BN3 A;  2Q8I B;  2A73 B;  1LT3 D;  3D3R A;  1JQY D;  2B2T C;  2WAQ B;  3TP7 A;  1CA6 A;  1Y1V B;  4CJ2 C;  1SJH D;  4XQN A;  1E2V A;  2A6E C;  2PCF B;  4G7H C;  2FFK B;  4TQU S;  2TMP A;  2NVY B;  4RKL A;  5M3M B;  3MHB A;  3AB9 A;  1KNE A;  1Y1W B;  4FF2 A;  1E2Z A;  2AWN A;  1B1Z A;  1ZYR D;  1GUW A;  1GHJ A;  3HGB A;  3AMU A;  4XT1 B;  3S2D B;  4G7Z C;  1GUN A;  2JEA I;  1V1P B;  4DNT B;  3QOL A;  2E2D C;  1PXU A;  2RDF A;  2VB3 X;  3PIP 3;  1STE A;  1V1P A;  3K5L A;  2LS0 1;  2BE5 D;  5LL6 X;  2HDL A;  4DXF A;  1LLR D;  5KGU A;  1PTO C;  2AQ2 B;  3NXW A;  1F9S A;  5CV8 A;  3VYT A;  1WVL A;  4G7O C;  4I7Z C;  2FHT A;  4L63 B;  5CBE E;  3TP5 A;  1I4Q A;  2NZ1 D;  2G9D A;  5I2X A;  2C9O A;  4J8Q A;  1S5B D;  1U9R A;  3I4N B;  2KA7 A;  3KLR A;  2F0Q A;  3E6Z X;  4DNR B;  2Z1C A;  2CHB D;  4R8I A;  4A3M B;  1EY7 A;  4IFD G;  4OO1 G;  1B4O A;  2VXW A;  2Y0S B;  2RBM A;  3HOZ B;  2VB2 X;  1C8C A;  2Q8T A;  4BY7 B;  3KBG A;  4DU9 A;  1SYF A;  1YNN C;  2MUY A;  1QCB D;  4WOR A;  4ZAI A;  5CR3 A;  5EPJ A;  2XN9 C;  1QNU A;  1PTO B;  5TSS A;  5KNB A;  4WRD A;  5JVH 3;  1ML0 D;  2Q8R E;  3GTP B;  3NBI A;  3J81 L;  2L1B A;  4X3U A;  3HZX A;  4ZQ3 A;  1TWA B;  1ZXT A;  2Z8L A;  4KY7 A;  5KIX A;  3I8Z A;  2F0P A;  4RGT A;  2F3V A;  3Q23 A;  4ZLT F;  1HRJ A;  5EBD A;  5CV7 A;  1SMY D;  1JIC A;  5A35 A;  4B9X A;  2E76 C;  1HA6 A;  4XYQ A;  4KHZ A;  4O1N A;  1MI2 A;  1FR3 A;  3TN2 A;  1QE6 A;  2K6A A;  2B2V A;  2MHV A;  3P1H A;  4H7B A;  3A55 A;  5D3D A;  1I3Q B;  3IFD A;  3BDL A;  1I4X A;  1ENF A;  4TSS A;  5CV9 A;  1JC7 A;  2WAC A;  3X3M A;  4KN7 C;  2F0D A;  4K5W A;  4IQZ A;  1Z6H A;  2PNR C;  5ISR A;  4DGZ A;  2E2I B;  1VDZ A;  1EZ8 A;  3S2H B;  3NTI A;  4K14 A;  1UAP A;  3HP3 A;  1BO0 A;  3MVV A;  1ZKO A;  3MFG A;  2B2W A;  1ENA A;  1DCZ A;  3KUP A;  3GTL B;  1H9M A;  1D5M C;  2D9U A;  2IX1 A;  1S5E D;  4PMW A;  1CQF A;  1HA5 A;  4C3H B;  3EQL C;  4C3I B;  3HOX B;  1B9N A;  2IJ0 A;  5A2Q L;  3VYR A;  2K7V A;  1HTL D;  1X3P A;  3FRP B;  1Q12 A;  1EY0 A;  3OMG A;  2FMM A;  3IKJ A;  4J6H A;  4DAV A;  5EKK A;  2EY5 A;  1SBB B;  3UI2 A;  1V1O A;  4U67 3;  5M9O A;  5ELC A;  3LWE A;  1SEB D;  2NVT B;  5DM6 3;  1QWY A;  4PMB A;  2E75 C;  5A2Q E;  5EKI A;  1G6Z A;  1M8A A;  1PZI D;  1Q8I A;  1T5E A;  5E3F A;  3OW7 A;  3QWN A;  2L0C A;  1Y8P B;  2A69 D;  5I4D A;  5IT9 E;  3MC0 B;  1CHQ D;  2OEO A;  5JEA H;  1G8Z D;  4A93 B;  3JAM L;  2EY1 A;  1BCP B;  2WII B;  2GA4 B;  1JWS D;  1FNV A;  2NVX B;  3WOE A;  3SK6 A;  3RZO B;  4NKL A;  3MEH A;  1LTR D;  1JOO A;  4KV6 A;  4RGN A;  1PRT D;  1VCI A;  5JOB A;  3TME A;  2EE1 A;  2PZU A;  1CQV A;  5DM7 3;  5IGB A;  3BVM A;  2I46 A;  4M1U B;  1PFB A;  4LAA A;  1BF4 A;  2SNS A;  3I90 A;  1EQV A;  4IN3 A;  1EYD A;  4BA2 I;  5CYU A;  1CHP D;  4KY5 A;  4K5V A;  3D6C A;  1CM9 A;  3I73 A;  1SFO B;  1GOZ A;  3RUZ A;  2K28 A;  4R9W A;  1G29 1;  1RCV D;  4F7X A;  1VF7 A;  1XTC D;  2A68 C;  1I4G A;  2F0E A;  3DHQ A;  3KBX A;  1W6K A;  1GUT A;  5M3F B;  4BY1 B;  5C5L A;  3KK7 A;  1IW7 D;  2WKD A;  5COR A;  5IGG A;  1EYC A;  1MD2 D;  1ICW A;  1GUO A;  1KNA A;  1PLF A;  1SDF A;  2NN6 H;  1DXM A;  5C4X B;  2K5W A;  1SNM A;  4KTA A;  2D62 A;  1SYD A;  2Z4H A;  3S14 B;  5KND A;  2XRS D;  4O42 A;  3T56 B;  4J1M A;  4ILW A;  4DAP A;  4RAU C;  1STG A;  3M7G A;  1A3T A;  4BBS B;  3NSW A;  4G4K A;  2O5I C;  2R92 B;  2EY6 A;  3ND9 A;  3W3A A;  4Y7N B;  1R4P B;  1L0X B;  2XWB B;  4RHR A;  1G2T A;  4Q5V A;  3PUY A;  1VMP A;  2K04 A;  2F0V A;  1S4Z A;  4IFD H;  4KD4 A;  1KLG D;  4OO1 H;  4UDU C;  2EPB A;  2YYZ A;  1NUC A;  2WKC A;  3HRZ C;  4FXK C;  1II3 A;  2L12 A;  3G6J B;  3BG3 A;  2IL8 A;  2F1M A;  2KED A;  1Z7T A;  2F03 A;  5JVG 3;  1B44 D;  1WTP A;  4N9T A;  3RLF A;  1IKL A;  1F9P A;  4A3J B;  4LK1 C;  1ENC A;  4KI0 A;  5EJW A;  5C3E B;  1S5C D;  1EY4 A;  2Z4I A;  3C1F A;  2E74 C;  1JOR A;  1TT2 A;  1F2Y A;  2XRQ D;  4CJ1 B;  4I65 A;  4KJO A;  4CKE A;  3K58 A;  1PMR A;  3SK8 A;  4RWS C;  2IX3 A;  3RMH A;  2DY7 A;  1NAP A;  4DN4 M;  2CQA A;  2L5T A;  2OT2 A;  1TS3 A;  2F0J A;  1I50 B;  4RGO S;  2N88 A;  1TWC B;  2JE6 I;  1LTI D;  2A5H A;  1FGB D;  4FVM A;  4IUT A;  1TVX A;  2JYO A;  2IWH A;  1EY9 A;  1I4R A;  4MIU A;  2M00 A;  1UNS A;  4YIJ A;  4N9P A;  2L4N A;  1VMC A;  4C3H G;  4C3I G;  4F87 A;  2RSN A;  5LHY 1;  4C56 C;  3BVG A;  2FJ2 A;  2FMC A;  3VYU A;  4F88 A;  4KKS A;  2ZXO A;  3OIP A;  4JK1 C;  3LWU A;  3K7A B;  1OXT A;  4RFB A;  1JR0 D;  5JEA J;  2MP1 A;  1QB5 D;  3SK5 A;  1TR5 A;  2HUG A;  1PRT C;  2HQE A;  1LTG D;  3OWF A;  5EPK A;  3K5N A;  1D5X C;  1PFM A;  1DOK A;  5JJZ A;  2EZV A;  2NN6 I;  2TSS A;  5I6Y A;  1WTW A;  1RD9 D;  2JA5 B;  5DEH A;  5I9O A;  3V2T A;  1AZQ A;  1BNZ A;  2BOS A;  4KN4 C;  5I9P A;  1AW7 A;  2BDO A;  2K5Q A;  3QJY A;  4KD3 A;  4A3E B;  3HOU B;  2EXZ A;  3D4D A;  1HUM A;  3MWY W;  1KAB A;  4OIJ A;  3NTH A;  4K2K A;  1SAP A;  2PO4 A;  2EYJ A;  2DN8 A;  1EIG A;  1HFG A;  3SDZ A;  4K8J A;  1C4Q A;  1RJT A;  4B9W A;  1HHV A;  3K6O A;  4ABN A;  2EYF A;  4MHE A;  2A74 C;  2HCI A;  2I07 B;  3PUZ A;  5EPL A;  1B2T A;  4EQP A;  1LO5 D;  1NR2 A;  5CV4 A;  3S1R B;  4XXE A;  4ZKB B;  1STB A;  2WP8 J;  4KKT A;  2B2V C;  4RH6 A;  4RA8 A;  2LY7 A;  4GZY C;  2BA0 A;  5FO7 B;  1PRT B;  1JWM D;  5AFW A;  1EEI D;  4G57 A;  2RDG A;  4FYD A;  1HCZ A;  4XYO A;  1R9T B;  5I2Y A;  2BCO A;  1EL0 A;  2QEJ C;  1HUN A;  3NTK A;  4V0B A;  1SE3 A;  2IX0 A;  3K5M A;  5KRU A;  2QF7 A;  3H6M A;  1H9S B;  2VUM B;  1QNK A;  1I4P A;  1GUS A;  4A3D B;  3BZD B;  3V96 A;  1ZEQ X;  3T51 B;  3CHB D;  1L0Y B;  2B2W C;  1B50 A;  3IFT A;  1CTM A;  5IGE A;  4DF7 A;  4ZKC B;  1KLU D;  4HSV A;  2JP1 A;  2KUM A;  3H91 A;  2B2U C;  3K0Y A;  3NP8 A;  4XDX A;  2H4O A;  2JEB I;  2X6L A;  2IW3 A;  2R6G A;  4CKB A;  3J81 E;  1X32 A;  4DA2 A;  2KHS A;  1KTK A;  1H9J A;  1H9K A;  1IYU A;  5FK9 C;  2SEB D;  4K2L A;  3BS1 A;  5K36 H;  5JPM C;  3ERO A;  3FKI B;  3TP8 A;  1U4R A;  4NP5 A;  4X3K A;  1J9O A;  4UAI A;  1LTA D;  1MSH A;  3E0J A;  1YNJ D;  1K83 B;  1BCP C;  1D2B A;  3EJI A;  3P75 A;  3TP6 A;  4HN7 A;  1IL8 A;  3ITP A;  5J22 A;  4QCL A;  4ZK9 B;  3GTJ B;  2NVQ B;  4F8M A;  3PUV A;  2LKV A;  3AU7 A;  2J0T D;  2PW5 A;  2EYL A;  1TY2 A;  1E2W A;  5BN4 A;  3VA7 A;  1HPC A;  2B2U A;  4X3T A;  3SR1 A;  4QUC A;  4V19 0;  3NUC A;  1CA5 A;  2K5D A;  5K5P A;  3GD7 A;  1PDQ A;  1QIL A;  1B53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...