1JORA

Ensemble structures for unligated staphylococcal nuclease-h124l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
total genus 25
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jorA00
2F0HA 2SNSA 4H7BA 5IGCA 1EZ6A 1KDCA 5HGTA 4N9PA 2PQEA 3P75A 1EY8A 2F0VA 4K5VA 3SR1A 5EKLA 4ZUIA 2EY5A 3SK8A 2F0NA 2RBMA 2EY1A 2F3VA 4NMZA 3SK6A 1SNDA 5C3XA 3D4DA 4B9XA 5NUCA 3TP8A 1SYEA 5CGKA 2EY6A 3TP7A 3MXPA 5I6WA 1EYCA 1KABA 2KHSA 2OXPA 3MVVA 3BDCA 1A3UA 1EY7A 4IALA 2F0FA 2WACA 4K8IA 4KTAA 4TRDA 4WORA 4WRDA 3SHLA 4KJNA 1KDBA 2QDBA 4K8JA 2NUCA 1NUCA 4K14A 4QMGA 2F0MA 5IGBA 5DEHA 5M9OA 1SNOA 3T16A 4K2LA 2KQ3A 2PW7A 4NKLA 1STGA 2EYHA 4RKLA 5EKKA 2EYMA 1TR5A 2LKVA 3H6MA 5K5PA 2F0UA 1AEXA 1RKNA 3MHBA 5ISRA 2F0LA 3QB3A 1SNMA 2F0SA 3E5SA 5CV8A 2F0KA 4K5WA 4ZQ3A 3TP6A 4EQOA 5KEEA 3QOJA 4F8MA 4PMCA 2RKSA 1II3A 1A3VA 1SYFA 1EY6A 3ERQA 1KDAA 2SNMA 4HMIA 4IUNA 4KD3A 1A2UA 3D4WA 1F2ZA 3OMCA 2OEOA 4YIJA 2PZUA 1EY0A 5CV4A 5F2DA 3C1FA 4KY7A 4OL7A 4ZUJA 3SK5A 4S3SA 2F0DA 3S9WA 4J1MA 3OWFA 1EY9A 2F0PA 4EQNA 5C6AA 3QOLA 3PMFA 2OF1A 5IODA 4N9TA 3D6CA 5CV5A 5IGDA 3NK9A 2EYFA 1F2MA 4EVOA 4R8NA 3TP5A 4B9WA 4KY5A 4IZ8A 5KIXA 1STYA 1ENCA 2O4XA 3D8GA 3HEJA 1JOQA 1SYBA 2PZWA 4EQPA 5E3FA 3P1HA 3EJIA 3C1EA 5EGTA 1EYAA 3DMUA 5KYIA 3NHHA 3MZ5A 5C4HA 1U9RA 3NUCA 3TMEA 4QF4A 4HMJA 2EY2A 5KGUA 4DF7A 2SOBA 3MEHA 1TT2A 3V2TA 4QB4A 4DGZA 5IIFA 4KJOA 5J39A 4PNYA 1STBA 4G57A 4NP5A 1SYGA 2F0QA 5DAUA 1ENAA 1IHZA 1SNCA 3T13A 3LX0A 1EQVA 5IOCA 2PYKA 4RKBA 3BDLA 4J6HA 1SYDA 3RUZA 1A3TA 4MIUA 5I9OA 5C4ZA 3R3OA 3EVQA 4LAAA 1JORA 5KRUA 5KYLA 5CR3A 2EYLA 2F3WA 4E6IA 3NQTA 3HZXA 1JOKA 1STAA 5E1FA 2PW5A 3DHQA 3NP8A 4I65A 5C3WA 2HQEA 2M00A 1EZ8A 3OSOA 1EYDA 2ENBA 5C5LA 4K6DA 1SNPA 2EYPA 2F0WA 4KD4A 2F0GA 4KV6A 3SK4A 2RDFA 3NXWA 4DU9A 5IGFA 2F0EA 3ITPA 3EROA 2PZTA 1F2YA 1STHA 2EYJA 4HTHA 3U9OA 3SXHA 5HURA 4K5XA 1NSNS 5J1ZA 4NDXA 5CV6A 4K2KA 4ID6A 1TQOA 2F0JA 5CV9A 5C5MA 5IGEA 2F0IA 2F0OA 3OMGA 1JOOA 5CC4A 1STNA 5IGGA 1SNQA 2EYOA 5J22A 5I9PA 3VA5A 1A2TA 2EXZA 5JOBA 4KHVA 4F7XA 4DFAA 5JAVA 1EY4A 4ODGA 1SYCA 4PMBA 5I6YA 4ME5A 5CV7A 2F0TA 1EY5A 4KY6A 1KAAA
chains in the Genus database with same CATH superfamily
5E4XA 4CDEC 2F0HA 2BH8A 3DWAA 1EZ6A 4NXNQ 3S15B 2YV5A 3P75A 1CM9A 3CMAA 4GKJL 1LTBD 4ZUIA 2MGSA 2K14A 3SK6A 3K57A 3MWYW 4PV1C 1QOHA 3HOUB 2BDOA 4K8IA 3VA7A 2F0FA 1PZKD 3S17H 3RZDB 1GO3E 1SNOA 2VNUD 4CJ2C 4JYAQ 1TR5A 3H6MA 5AFWA 4YCVA 2AQ2B 1I5FA 2JN4A 2K03A 4YWKA 2PQAA 4IURA 5G3LD 1LYLA 1MBYA 2OQKA 4L6TB 2VZAA 3KLRA 1EY6A 5CYUA 3G71A 1WTOA 1CQVA 4JI4Q 4RWSC 3M4YA 3NEMA 4UP9A 2O5IC 3OMCA 3K5NA 2HHHQ 5C4JH 2XWJB 1BCPD 4MN3A 4A3KG 3OWFA 4MTKA 4BBSB 2ZTEA 2LXJA 4JG2A 5IODA 4A3GG 4A3MG 1ET9A 1FJGL 2IX1A 3AEVA 4LFBQ 4R8NA 3BVGA 2O4XA 3RZDH 5LMUL 2EZVA 2NVQH 2F03A 4HJ7A 2QEJC 3NHHA 4LF6Q 3E0EA 3NUCA 1GUOA 1GOZA 3KF6B 1K8AC 4CHTB 2K01A 3T1HL 1XPRA 3CCRA 1S72A 1ENAA 2Z4IA 4DK6C 3A0JA 4LF7Q 4KN4C 1BCPF 3S15H 4MIUA 2R92G 2LFNA 5GAEC 2V1CC 5CR3A 1ILPA 3KUPA 1C48A 2WFWA 3NQTA 3Q23A 3J81L 3T1YQ 1QVCA 2VW9A 1ICFB 4HSPA 4P71A 3OWEB 1E2ZA 1XPUA 1HPCA 4APVA 4A3CH 2H4OA 4X62Q 1EWCA 4KV6A 1AH9A 3VR4A 1GVPA 2PNHA 4CDDC 5IGFA 2CH4A 3IFDA 1I3QH 4GOPB 2A6EC 3J81c 4K5XA 4IUTA 1RTNA 4NDXA 2F0JA 4OO1I 1M4VA 3J80i 1ILQA 4G7HC 3PUYA 3K7AH 4OXPA 3GD7A 2E5LQ 1OTCA 4RA8A 3FHWA 3H3VI 2Z0SA 1SYCA 3W3AA 1A0IA 5LMNL 2CH4W 2K7VA 1FR3A 5M3MG 3A7AB 4L5RC 4BY7H 1IZ6A 3CF5A 1BF4A 1D6EC 1RDPD 1I4RA 4YWLA 4B3MQ 1WCMG 1Y1WB 4FYDA 1PH5A 5GAHC 3H0GB 5I6WA 4HSVA 1HNZL 4DU9A 4OHJA 2QDLA 1JT8A 3S1RB 1EYGA 2QCPX 1IL8A 1JWSD 4KI0A 4RKLA 1STGA 2MHVA 1WTRA 2FXQA 1Q7YC 4HIOA 4EQOA 2XRQD 3KLSX 4X62L 2HDMA 4O2DA 4F8MA 2LXKA 4C3HB 4ME3A 1SYFA 4HJ8A 1C0AA 4HMIA 4DNTB 2J0TD 5F2DA 1V9PA 4OL7A 4RMFA 1I4XA 3I55A 1EY9A 2F0PA 1YNJC 3UDIA 1J5EQ 5CV5A 4LWCA 1LO5D 3HOYG 2BH2A 2B8FA 3G4SA 2A6ED 1YBYA 2RCFA 2X69A 1SYBA 1YIJA 1EQRA 1H9MA 5KYIA 4LF6L 1NJIC 2ID0A 1P8LA 2KOLA 4J15A 1XNRQ 1YNJD 1U9RA 1X6OA 1HFGA 3FP9A 3M4PA 3OW7A 4UY8C 1SDFA 1IHZA 2B63B 4LFBL 3I4MG 2PYKA 1FJGQ 2VB3X 3MFYA 3TZDA 5C4ZA 4M8AA 2VQEQ 1WJJA 1B2TA 2IHEA 2N88A 1G6PA 4GN3B 3WDNA 4KK7A 3GDEA 2OTLA 4DAPA 1JOKA 1K0SA 3F2BA 2B2YA 1SR3A 3GP7A 2R7ZG 3HKZG 3BZDB 4C3HG 2UU9Q 1O7ZA 4A3JB 1C4QA 4LFCQ 3ITPA 2E2JB 3AFPA 4A3GH 3MXNA 3M9BA 2Z4HA 4L5SA 1BQQT 4X64L 5GAGC 1X3FA 1XWEA 2AHOB 3VYUA 3IFTA 5I6YA 1LM0A 4XXEA 5JPNC 2R93B 1KAAA 4GKJQ 1CI3M 2A19A 2I0QA 1EY8A 3G6EA 1NMGA 5EKIA 2MO0A 1HUMA 4C3IG 3K80C 5FJ8H 4KKSA 1B7YB 1S5BD 3TDQA 4OIJA 3RN2A 1SE2A 3K5LA 4GOPA 2YTVA 1QZGA 3GTQB 2LKVA 2B2YC 5C0XH 1PDQA 1B8AA 1TWGB 4YWMA 4DUZQ 4O0AA 4DR1L 2EIFA 1O7YA 5EPLA 1NE3A 5T1GA 1K8GA 2QILA 3SK5A 4AIMA 1LTLA 2R61A 2MNAA 2KHIA 1VQ9A 3EA6A 3BYTB 4RGNA 4CKBA 2VXWA 4JBMA 5KIXA 2LY7A 1LTID 1PZJD 3D8GA 1VQ6A 4DR5Q 2ALYB 1AP0A 3K8AA 1VF7A 4H0LC 2RSOA 5KGUA 2K04A 3PUVA 1P16A 4AYBB 4PNYA 1Q3LA 4MZ9A 2IX3A 4LF7L 3GTJH 3Q0AA 1SN8A 4P75A 5KRUA 2R93H 4E6IA 3ONAB 2OTJA 4FNFA 4TKOB 2ENBA 3RD4A 3KBXA 3K0XA 4A3EG 3B6YA 2YTXA 3X3MA 1CHQD 1NMFA 1ESFA 2PI2E 1PZID 1CSPA 4RH6A 1VCIA 3KBGA 1CQFA 1B3AA 3BZCA 4OWTB 5J1ZA 1SMYC 1TQOA 2E2JH 3IAYA 2CWAA 4A3JH 5IP7G 1NY4A 2DY7A 1E3PA 1KTKA 3I7FA 1HTPA 4ABNA 4WFN3 1F9QA 1HZCA 4HJ5A 4X6AH 3S2DB 1J6QA 1W6KA 2IW3A 2B63G 1IYJB 3GTLB 1KNEA 2HQLA 2Z6BA 2N55A 3J81E 1VQMA 2ZM6Q 3AFQA 2FMMA 2F0NA 1M8AA 5FO7B 4BBRH 5FLMG 1YNXA 5IY0A 1RIPA 1BXTA 2YYZA 4XT3B 4BS9A 3QJYA 2AWNA 1CA5A 5FKAC 4KTAA 3TREA 1OXVA 3SHLA 1G6ZA 1I6VC 4RAUC 1JCKB 1KD1C 3I90A 4JI6Q 3T16A 1YJWA 4WJWA 1HNWQ 4FXKC 1KAWA 2UUCL 2F0UA 4CJ0B 4LMQD 3ER0A 3NTIA 3E5SA 1XJVA 5M3FG 1MI2A 1EIFA 1Z47A 4QIWB 2RKSA 1D5MC 2JEBI 1BNZA 1HFNA 1YHAA 2SNMA 1I50B 3IRBA 4A93H 2KBNA 3UDFA 4GLXA 1I4GA 5JEAG 1MHWC 3TRZA 3S9WA 3H94A 4DR3Q 4OELB 4DV0L 2E74C 1VQPA 4DR4Q 1N8RC 1ASYA 2K1BA 2E2HH 5C0XJ 2MP1A 5GROA 2O5JC 4HJ9A 1FGBD 3H0GH 3UI2A 5C4HA 2KEEA 3S24A 3S1NH 1Y1WH 5FOBB 5JJIA 3V2TA 4DGZA 1EFWA 2N49A 4HIMA 2JEAI 4UP8A 1PTOC 4DR7L 1VF5C 4A3BG 3GQBA 2SDFA 1X56A 3CCVA 2DJFC 4P2CB 3HOZG 4OWWB 1STAA 2ZJRA 3I70A 1PA6A 1U4RA 5D3DA 5G3LF 3DM3A 1E24A 1EZ8A 1K73C 4HIDA 2HUGA 1ZYRD 3K7AB 2F0GA 2GN5A 4PZ7A 5ELFA 4IUQA 2Y0SB 2EYJA 5HURA 1I4QA 1QZHA 1I3QB 2JA8G 1HHVA 5C5MA 2Z8LA 1N9WA 1GUTA 1T5EA 5DM73 4KHPL 3OMGA 1SFOH 1G91A 5COYA 2HCCA 1TVXA 3I4LA 1UEBA 5DNFA 4IFDG 1JE4A 5D14A 1B53A 5IWAQ 1EY5A 4KKUA 4KY6A 4DAYB 3VR3A 3Q22A 1M1KC 1CA6A 4JI0L 4CKCA 3S2HH 1JWMD 4MHEA 2NVYB 2Q2HA 1VQLA 1G8ZD 4JI3Q 1ASZA 4AYBG 1S4ZA 4YHHL 2UXCL 3K0YA 4P74A 4QUFA 3BG3A 2NVQB 1YEZA 2A5HA 4XTCS 4K8JA 1SJED 2K5VA 2F0MA 2PCFB 5DEHA 5M9OA 4A3MH 4NKLA 2NN6G 4BBSH 3QB3A 3A5UA 1HQRD 3HKZE 5C4JB 2B2UC 3CAMA 3I91A 1PH9A 5FJ8G 4IUNA 2EJMA 3HOVG 4YIJA 4DV4L 1FL0A 1HR0W 3CRLC 3PO3B 3HP3A 2B2TA 4G4KA 3J80L 1IKLA 2O2LD 3BVZA 1TKWB 5A35A 3PF5A 3T56B 3EFXD 1SE8A 4KY5A 3I4NB 1XYIA 1N34Q 3HEJA 2ASBA 3S17B 1WFQA 2I5LX 1HA6A 4JCVE 3HOUH 3A8JE 2J7ZA 1EEFD 5AJ3Q 3J80c 1DJRD 4I7AA 4QF4A 1S5CD 1TT2A 1K3BC 1TS4A 2NWGA 4HJAA 1V1PB 3PUXA 5IOCA 2ZJPA 1ZYRC 1YI2A 4DV2Q 4K0KQ 2WKDA 2KECA 1BOSA 1Q82C 3PO3G 4DV1Q 3N6RA 1KHIA 3S1MB 5LL6X 2PI2A 1F77A 3KF6A 3NP8A 1HNXL 5C3WA 4LFAQ 3STBC 1MJCA 3OSOA 1VS0A 5CORA 3A55A 3OW2A 3CCQA 3NE5B 3AYHB 3EROA 4LF9L 1TS5A 4HTHA 3KF8B 3OYYA 3NBHA 5CV9A 3EIVA 1HQMC 4X65Q 5JOBA 2HDLA 2K6AA 4XQJA 1V8QA 2K05A 4IUUA 2KCMA 3NPPA 4R4IA 3ERSX 2YU9B 4DAMA 3S14H 1WTVA 2NVTB 3K5OA 3SK8A 2F3VA 2EJGC 1CHPD 1JJCB 1N33Q 5NUCA 2Z1CA 3SVMA 4XT1B 5IT9E 4WJ4A 1GJXA 3MVVA 2RHSB 1EQTA 1X32A 1HH2P 4DV5L 4F87A 4G7ZC 1STEA 4QMGA 1NUCA 4DV3Q 2KQ3A 1TS3A 2PW7A 2EDGA 5M5XH 4ZYSA 2Y0SG 2DJGC 4YY3L 2RA4A 4JI1L 4A3JG 3J81j 4JI2L 2ZT9C 4MNOA 1Q86C 1A3VA 2NTSA 2R3ZA 4LFAL 2I46A 2E2IB 5IYBG 3GTOH 4QCLA 4HEDA 2OWOA 3VYRA 4NXMQ 4X3KA 1E7ZA 4DV2L 3S16H 4N9TA 1B4OA 3NK9A 4EVOA 1RJTA 1QJOA 2HIXA 1VQKA 5FLMH 3C1EA 1KRSA 1MIUA 1QE6A 1L2FA 5AJ3L 4LF4L 1Q1BA 4A3IB 2HIVA 1SEBD 3QR8A 4HCSA 2QKIC 4KLKA 4KJOA 1IXRA 3VR2A 4QY7A 1E1TA 1D5XC 1IKMA 1CSQA 4JPBW 3HOWH 3M7GA 5M3FH 4C56C 3S1QH 1JICA 1U5KA 3A5ZB 5H1SE 1ET6A 4IJLA 1FNVA 1RD9D 1H9RA 3CXCA 3NXWA 3ULPA 1Q8KA 3A56A 2Q2TA 1K83B 5I2YA 1BVSA 5DLQE 5IGEA 5BR8Q 2D62A 5IT9c 4X3SA 3ULLA 1K8MA 1STNA 5I4DA 1E0BA 5EAYA 1PTOF 5EPJA 5C44G 3H0GG 2KCCA 5BN3A 1PH3A 4DFAA 1JR0D 2WAQG 1Y8OB 2CW0D 3N52A 4PMBA 1AFPA 4IPCA 1XXGA 2IWHA 4JI1Q 1E22A 5ELOA 4YY3Q 4BY1H 2PQEA 3UDXA 4JI0Q 5IWAL 3CC7A 2XN9C 3HOXB 4B3SQ 2RBMA 2HD3A 3E6ZX 4DV5Q 2K50A 1MKHA 3KFUA 2KHSA 4TRDA 2OQ0A 2RSNA 4JBWA 2CWPA 2CFMA 2ICEC 5C4XG 2RQXA 4DV7Q 5K5PA 5T1IA 3O13A 3QWNA 4ZRZA 4MTNA 4DR6Q 1H9SB 4A3EB 3QOJA 2JQOA 5KNDA 4PMCA 4JOIC 3CD6A 2VY3A 3CCSA 1XMQL 3L3OC 3D4WA 3U4VA 4C3IB 1Z7TA 3NWTA 1KLUD 1ML0D 5CV4A 2WB1E 3RZOH 3CCJA 4IOCA 5I2XA 5D3IB 2KA7A 5FK9C 3TP5A 2NN6H 4G7OC 4UHVA 1JOQA 4A3FH 2QA4A 3W1BA 4Q0FA 2R7FA 5E3FA 2R7ZB 4DK3C 4UP7A 1JJGA 1VMCA 4HN7A 5EPKA 4HMJA 3WOFA 1HNXQ 2TSSA 1QUQA 1NTGA 4R4QA 4TVAB 4QB4A 4A3DG 1TWCH 3PUZA 3FPUB 4WJ3M 3FMCA 1SYDA 1VQOA 2RDHA 3K58A 4A3DB 2K5WA 1EWHA 2A6HD 1Y69U 2L11A 2N8NA 1RF2D 1QVGA 1DOLA 3HZXA 2VUMB 1A63A 3FKIH 5BN4A 3DHQA 3CC2A 1KXLA 2B39A 3V96A 1U4MA 5EQ0A 5IYBH 1O80A 1Y8NB 2NB0A 3BYYB 3SK4A 1SROA 2A1AA 1N34L 1DM0B 2F0EA 5E7NA 2IX0A 1LABA 2ES2A 4IJHA 4KN7C 1HNWL 1PRTF 2MQHA 1TWAH 5M5WH 1VQIA 4X66Q 4CJ1B 1T9HA 2YTYA 4BBRG 2K5NA 5EBCA 5IGGA 1U4PA 4DV4Q 4U68A 5IT9L 4OX9Q 2UXBQ 4R4TA 3GTPH 1NR4A 4A3BB 2C35B 1Y1VB 4XYOA 4ZAIA 2N3SA 1I6HB 3PF4A 3JAMc 1XMOL 5IGCA 5ELDA 1Q12A 3CP0A 5HGTA 1R9TH 4K5VA 4LUVA 3MXNB 5TSSA 2G9HD 4YCUA 2QF7A 4QJFA 4ZKBB 4P73A 1HA5A 2K75A 4K14A 4BXXH 2KCTA 2KCNA 3TP6A 3TN2A 3E0JA 4A93G 4L63B 4JV5L 2JSOA 5FLXE 2AMCB 1WTWA 2JE6I 1VDZA 2PZUA 3M3YB 2AQ1B 1TWHH 4IPGA 2F0DA 1TWFH 1F2MA 4UAIA 4L8JA 1BKBA 1AE3A 3D6WA 5JPMC 2BE5D 3HOZH 1W2BA 1CT1D 1B3QA 2B2VA 2A6HC 4C3JH 5ELCA 1HZBA 3T4AC 4C1NK 2FINB 3KF8A 2L5TA 4G57A 2F0QA 2DNEA 4DR7Q 2R92B 2BE5C 3CQZB 2NVXB 3G7LA 4JBKA 1A62A 1H9SA 3DEPA 4LAAA 2GA4B 1AN8A 4GLVB 1FNWA 1F9PA 1HRJA 5LMNW 3K6OA 4FP5D 2D9UA 1PYWD 4IUPA 2B8GA 2MFIA 4DR1Q 3R8BA 2MJ8A 1GD7A 4I7ZC 1FGUA 1QWYA 2CVRA 1X54A 1EIGA 2F0OA 5CC4A 3TBIB 2EOTA 2V4DA 3VA5A 4IFDH 3QG1A 5IP9G 2CKZB 1SMYD 3PIOA 2E75C 4A3LH 3LWEA 2QEXA 2JA7B 2EXDA 3SR1A 3ULJA 1JJ2A 3VR6A 2Z9HA 2BOSA 4IN3A 1X3QA 3FPPA 4C1NI 4P72A 3Q6SA 3TSSA 1J8IA 3NBHB 3BS1A 2JP1A 2EY6A 1KABA 4X64Q 3BDCA 4IALA 4BA1I 1DOKA 3AB9A 3CU7A 1KDBA 2QDBA 3W5OA 2QGQA 5IGBA 4C2MH 1FYCA 1SSOA 3J7A5 2IL8A 5JVG3 1SE3A 1C9OA 4LFCL 5ISRA 3GTGB 1Q8IA 1HR0L 2UU9L 5KEEA 3EQLC 1II3A 4DPGA 3HOVB 3HOVH 1LTRD 3AU7A 2MPMA 4NB3A 2R6GA 1RTOA 1CFMA 2CHBD 2VQEL 1N36L 3GTGH 3DUZA 1C7YA 4BA2I 3GV3A 2RF4A 4ZCKA 4BY1G 3F2UA 4XYQA 5C4XH 2BA1A 2K5HA 4A4IA 4B9WA 2JA5B 3SEBA 4J8QA 3WWVA 4C2MB 4AQYQ 1R4PB 3ZJYC 1XTCD 2XSCA 2XWBB 1VQAA 1L1OC 1H95A 2L15A 3H15A 5C0XI 4POFA 2FJ2A 2NTTA 4V190 2DGYA 2WV6D 1J9OA 2NZHA 1SYGA 3T13A 2JA7H 3RLFA 1VQJA 4RKBA 1J5EL 3JAML 1D2BA 5I9OA 4NPSA 4DR2L 4LF5L 2EYLA 1PXUA 5M5YH 1VMPA 2I5HA 1QB5D 3PIO3 1UE5A 1NCVA 5C44B 3PO2H 5GADC 2JJQA 2F0WA 4DR5L 4A3KH 4LF8L 4GS3A 1STHA 2GVAA 3AQQA 1D1IA 3LNNA 4Q5VA 4DUYQ 3HOYH 4FF3A 1WTHA 1Q90A 3SE0A 4B3TQ 1O7IA 5IYCG 1N32Q 4HIKA 1IBLQ 3QIAA 2B2TC 1HNZQ 4HAEA 1A2TA 2NBFA 1DOMA 2ZXRA 3KYHC 1ONLA 4ME5A 1NBWA 1F2LA 2K32A 3RLNA 1DCZA 4Y7NH 2NVXH 1B1ZA 2B2WA 5EJWA 1X55A 2R92H 2NN6I 5LMNQ 2MO1A 4FF2A 2EY5A 5C3XA 2JA9A 4DV6L 1AW7A 1SYEA 4C3JB 2IPKD 5CGKA 2A69C 1GHJA 1YVCA 3I2ZA 1PYSB 1IBLL 2A8VA 3TQYA 3HOZB 2B29A 5E4WC 1WTXA 3CRKC 3CCEA 2AUJD 4JK1C 3IKJA 3MXUA 2JK8A 3RLOA 4LF8Q 1AEXA 4RGTA 2VQFQ 3PQIA 4ZQ3A 4K5WA 1K28A 1TWHB 1LT6D 2JA6B 3M3YH 3I8ZA 4U673 4R4CA 2Q2UA 1GXDC 3U9SA 4KD3A 1A2UA 1A8VA 1S3OA 5IP9H 3C1FA 1VQ4A 4RGOS 5ELEA 5M3MH 1KQSA 1QCBD 3QOLA 3OIPA 4DNRB 4KMUC 3H3VC 3T1HQ 1QUQB 3SDZA 2FFKB 2Q2IA 3TEHB 1WCMH 1Y8PB 3P1HA 1RCVD 3GTKB 1S5DD 2B2WC 2CQOA 3NBIA 4B3RQ 2H1EA 2XTIA 3L9AX 4DF7A 5LMUQ 1LT5D 1DZ1A 3BZKA 2FMCA 4AQYL 3W2DA 3LX0A 1EQVA 2PPBC 3WOEA 1R9TB 4IFDI 5L37A 3RUZA 4QL5A 3EVQA 1I6HH 4OO1H 1ESRA 2Q8IB 2OCEA 5ELNA 4ALPA 4A3BH 1Y1VG 1EQQA 1XX8A 4JI4L 1PTOH 4B3RL 1XNRL 4CGYB 4K6DA 1L1OB 1HR0Q 3PCOB 1KL9A 2D2CC 4DN4M 4IFDJ 2LSSA 2XGTA 5CBAE 2PZTA 3CMEA 2KJXA 4JYAL 1TWAB 5M5WB 4TQUS 2RDGA 4ID6A 2JA8H 1WD0A 1YITA 4CDFC 2PMZE 1PFMA 4F7XA 3FKIB 2VUMH 2JA6G 4QQBX 4DXFA 1CKNB 1K3RA 3GV6A 2VQFL 2RVLA 1O7LA 4NXNL 3V05A 1B70B 2A74C 1MJEA 1TWCB 1RHPA 1BCPB 1SE4A 2R7ZH 1OO9B 2EE1A 3M4OH 3GTMB 1EY7A 2M2LA 4WORA 5FLXL 4DV6Q 5CMDA 4A3FB 1YJNA 4KJNA 1K9MC 4B3ML 4IOAA 5C3EB 1EFID 1UAPA 2L0CA 3I4MH 1TY2A 2DUDA 3KDFB 1RKNA 1BO0A 3EBEA 4YCWA 1JORA 2F0KA 2R93G 1FD7D 1PTOD 5IYCH 2N78A 2WP8J 3C2PA 4LUZA 1BBUA 2HCIA 1D8LA 3CPWA 1EIYB 1EIHA 2E5LL 1CKMA 1CZGA 3NENA 4GZYC 4OIKA 3CCLA 4A3EH 4B3TL 1N32L 4TSSA 4DUYL 3JAME 3F2DA 2E8GA 2EJFC 2OF1A 2FHTA 3NSWA 4JI7Q 2EYFA 2BA0A 1W3SA 3I4MB 1OXTA 1YZ6A 5C3EH 2ZTDA 4M1UB 1NNXA 3FKIG 3GTMH 1M90C 3EJIA 4LJZC 3M4OB 3MZ5A 3T1YL 3U58A 3MEHA 3JC66 5IIFA 4CBVA 1STBA 3VYTA 1VQ7A 4DR2Q 4LF5Q 1SNCA 3M4QA 1SRUA 1F9RA 4BWGB 1JMCA 3G48A 3JAMi 1U4LA 1QILA 2CW0C 1PFBA 1UNSA 4JV5Q 2A68D 3RN5A 1CKNA 1GUWA 1EYDA 4DK1A 3BJUA 4FF4A 3I4NG 3HOXG 2ZXOA 2JA8B 3G6JB 2JXMB 3VYSA 3OTOL 3KJOA 4K2KA 2E76C 1N36Q 1F9SA 1UEAB 4X3TA 2EYOA 1TIID 2HHHL 1EOVA 1PTOB 3T51B 1KNAA 4RHRA 3NELA 4ODGA 2X6GA 4K6LA 4UPAA 2BCOA 2F0TA 3S1QB 3E9IA 1X65A 4JVZA 5M3FB 1UE7A 4QIWE 1AZPA 1XMOQ 1X3PA 2C5CA 4O1NA 1HUNA 1TS2A 2WB1G 1I94L 1G2TA 4ZK9B 1DXMA 3OOCA 3D4DA 5A2QL 1RL2A 4B9XA 4GNXC 3TP8A 1PRTC 1VQ5A 4OX9L 2UXBL 3GTKH 4RCOA 2QW7A 1WCMB 2WACA 1PVOA 2J4XA 1VQDA 2K33A 4KKTA 3ND9A 4OONA 1IW7C 3ND8A 3S16B 1T5XD 1B9MA 1LTAD 5M3MB 2F0SA 3KLWA 2L4NA 3PV0A 1ZXTA 1V1OA 1JWUD 5A2QE 3GTOB 3ERQA 4R9WA 2E2IH 1R4QB 1F2ZA 2OEOA 2NYZD 2JA6H 4ZUJA 2A68C 3J80E 4PMWA 3STBD 3HG9A 1AZQA 2P5ZX 1LTSD 4IZ8A 1STYA 3PIPA 2EVBA 2PZWA 1H9JA 5EGTA 5CBEE 1WTQA 1QNKA 3D31A 3HGBA 2EY2A 2XIWA 1Z9FA 2Y0SE 1UUPA 3H3VH 1EWIA 1VQCA 2ZTCA 4PZ6A 3DWPA 1IBKQ 1A15A 1H9KA 1I4PA 1Q1EA 1XTDA 2MUYA 3DWQA 2XVSA 3I3CA 3S14B 1A3TA 4Y7NB 1KC8C 2F4VQ 3U4ZA 2D0OA 2YU9H 2VS1A 4GN4B 1HZAA 4Z9CB 2ICIA 1X3GA 4OEMB 1XMQQ 1D1KA 1DGSA 4RG1A 3A7LA 1G51A 2EYPA 4GLAC 5JEAH 2K4KA 3HOYB 4DR6L 3UE1A 1VQBA 2IHFA 1F2YA 3J7AV 2M9VA 1NSNS 1PRTB 1WTPA 1UE1A 2D5DA 2RCNA 4A3KB 5C3EG 2DN8A 2TMPA 1HTLD 3C46A 1CK1A 1HJPA 1IBMQ 3UDGA 3TS0A 5C44H 3PO2B 1BDOA 1S5ED 2VB2X 3S1MH 2KUMA 3MC0B 5M5YB 1PRTD 1V1PA 2AUKA 3Q24A 1GHKA 3DM1A 4OO1G 3D4RA 1MGSA 4NMZA 1ZKOA 3HOUG 1D5ZC 1Y1WG 4IPDA 2PQAB 2LS01 3E9HA 1IYVA 2VUMG 1MSHA 2ZXPA 5BR8L 3I4NH 4XDXA 1LACA 2DNCA 3D3RA 2C9OA 2JA5H 2L12A 5C4XB 2AWOA 1KRTA 4HCEA 3I73A 1HZ9A 3I4OA 1PH8A 3PO3H 1XPOA 1PLFA 3H91A 1YHQA 3P20A 2GVBA 3CHBD 3BVMA 4ZLTF 3MAQA 3C3LA 1PYBA 2F4IA 1QG7A 3I56A 3J7AF 4RGMA 4X66L 4A3MB 4IUVA 3DXJC 1MD2D 3W1GA 3P7JA 5GQOA 4L5QA 3MXGA 4LF4Q 3FVQA 3NTHA 2SOBA 3PSIA 4IO9A 4GKKL 1I4HA 3L0OA 4EQNA 1ZEQX 1XNQQ 4DAYA 4EX5A 2UXDQ 2RHQB 3L7ZC 2NVYH 4J6HA 5DM63 4UDUC 3X3NA 3D0FA 3S2HB 3FDTA 1X9NA 5KYLA 4ILWA 5IYDH 3A8IE 4I65A 1GM5A 2HQEA 5K36G 1GUNA 1Z6HA 1EEID 1SFOB 1PH7A 1WYDA 4GN5A 2IJ0A 4NW2A 1WD1A 4RCNA 4BBSG 5CV6A 4DV3L 1L0YB 1UE6A 2DY8A 3CKIB 4EGVA 5FLXc 4FXDA 2CCZA 4A3IG 1EUJA 1SNQA 4KHVA 1N33L 1EOTA 3R93A 4LW1A 1S5FD 4A3CG 1D7QA 4JI8L 2H5XA 2SNSA 5JEAJ 5J3BA 2B2VC 1KDCA 3H09A 3CQZH 5HY6A 4HR7B 4DV7L 3DLLA 2F0VA 4JI8Q 4CDCC 5EKLA 5ELBA 3UE0A 1GKHA 1SNDA 3S1NB 1QNUA 3MEFA 3TP7A 3PIP3 1Q81C 4ZKCB 1LV9A 2XNAC 3OIQA 3A8KE 1WI5A 3J81i 1TU2B 4N8FA 1DONA 2AQ3B 4JOIA 2E2HB 1GUGA 4B3SL 3ICEA 1EL0A 4XQQA 1YHBA 1PFSA 2EYHA 4B08A 2EYMA 2K52A 2Z6KC 3MA2B 1TWFB 2F0LA 4JI5Q 3F2CA 3KJPA 1BUVT 3PGZA 4IQZA 4DK0A 4PG3A 4Y52H 3RNUA 1I50H 1U0LA 1K0RA 4A93B 3KK7A 5LHY1 3TZUA 4DV1L 1G2SA 1JQYD 2G9DA 2KENA 1Q46A 4H13C 4J1MA 1BBXC 3OHXC 4CKEA 4DA2A 5IGDA 1OXUA 1XNQL 2KVMA 2K5DA 3RMHA 3NWSA 5JJKA 3HKZB 4EQPA 1SBBB 2UUAL 3TS2A 1FNUA 4DAVA 3TMEA 1C8CA 1VQ8A 1OXXK 1YJ9A 4BBRB 5J39A 4H02A 2UUBL 1OXSC 5FO8B 5JAVA 1Y14B 3GTLH 2JA5G 1L1OA 2PMZB 1DD2A 1UWVA 2L1BA 2UUBQ 1Y1VH 1B44D 3S2DH 1AE2A 4OWXB 4GOPC 1VQGA 3GTPB 2B3GA 1JC7A 1PFNA 1G291 2UUAQ 4PQXA 1SMXA 1DYQA 2RDFA 1TY0A 3HRZC 4LUOA 1LT4D 3CW2C 1NAPA 2Q8TA 1V43A 4H44C 1PV4A 1L0WA 1GUSA 2G5DA 4NXML 3VDYA 3FEWX 4QUCA 3SGIA 5I9PA 5JJZA 2EXZA 1EU3A 3R2TA 3CCMA 2X6LA 1PH1A 5CV7A 4JI3L 2WB1B 4JI2Q 4A3DH 4JI5L 2SEBD 3GTJB 3I72A 5IE8A 4N9PA 3M7NA 3R2IA 3HOWG 4A76A 2EY1A 2BDNA 4AH6A 5IYDG 4A75A 5EBDA 1EYCA 2OXPA 3IL8A 5JVH3 1A3UA 2ATWA 1CTMA 4KHPQ 1BR9A 2NUCA 3KOJA 2JYOA 4X3UA 4K2LA 1TXYA 2HT1A 4EQ5A 4QGUA 2WAQE 2PNRC 3MHBA 2I07B 1YNND 3GO5A 4RFBA 3RZOB 4POGA 1FVIA 4C3IH 1LUZA 3CC4A 1SAPA 1HCZA 1VQNA 1EY0A 4XQNA 4X65L 1YNNC 1TWGH 5C6AA 1WOCA 3PMFA 2EPBA 3GTQH 1VQEA 3A74A 1ENCA 4LF9Q 1S40A 4FDBA 2WAQB 1CZWA 1EYAA 2L55A 2NZ1D 2R7DA 3MTSA 4FXGC 3EN2A 3HOXH 1JB7A 5DAUA 4DV0Q 4BY7G 2WIIB 3BDLA 4K0KL 4BXXG 2JA7G 2K5QA 4BY1B 1E2VA 4DKAC 2F3IA 3URYA 3L2PA 2UXDL 4JC0A 1JE5A 4GKKQ 4DNIA 2WKCA 3Q8DA 2PW5A 2Z6KA 3PO2G 2M00A 1ENFA 5C5LA 1SNPA 4KD4A 2Q8RE 4OGQC 1K83H 2UUCQ 2B2UA 4A3GB 1JB3A 4JI6L 3K59A 1E2WA 1JOOA 1WVLA 4A3FG 4FF1A 3LWUA 1QVFA 4JBJA 4LK1C 1LLRD 3KLSA 1MSGA 1V1QA 2F52A 1I94Q 2A73B 2ZM6L 4LNQA 3HOWB 1IL2A 2XRSD 3MFGA 4H7BA 2B63H 3AMUA 3U50C 4RHSA 5FO9B 3K81C 2LMCB 1RODA 3HS0C 5IP7H 1KLGD 1SLJA 3VR5A 3BDOA 4A3IH 2IT1A 1CKOA 2K28A 2ZJQA 3MXPA 2OT2A 4C3JG 3CCUA 2I5MX 5K36H 1SXTA 4WRDA 3F1ZA 4YHHQ 2UXCQ 1PMRA 2AKWB 3T53B 1PH4A 1VQHA 2L9HA 4R1JA 5EKKA 1HXYD 4DXGA 3OTOQ 1W6JA 3ZYYX 1SNMA 2A69D 3OPOA 5CV8A 4L5TA 2CQAA 5HGQA 5BN5A 1ICWA 5KNCA 1NR2A 3A54A 4O42A 1KDAA 3QO2A 4N8X1 1LT3D 1IBML 2EQSA 3HFZB 3M85A 4C3HH 3RR5A 2E2DC 4KY7A 3J7ZC 4S3SA 1E1OA 4FVMA 3D6CA 3HKSA 2WINB 3CPFA 5M5XB 3E3XA 1PHJA 1LTGD 4A3LG 2VL6A 2PO4A 4GNXB 1SJHD 3S1RH 3K7UC 3J7YW 4JW0A 1L0XB 3DMUA 4ULLA 2F1MA 3K5MA 4V0BA 2IY5B 4IPHA 2KEDA 4NP5A 4F88A 2NVTH 1BBWA 4GNXA 4JI7L 2F4VL 1B50A 4XIGS 4BY7B 3R3OA 1VQFA 2F3WA 1K8OA 2KHJA 1IBKL 1EU4A 1IW7D 5E1FA 4FO2A 3NTKA 5JJLA 1LTTD 1BCPC 3KDFA 3FRPB 5LL6S 4DUZL 3DEOA 3LGJA 5D65A 3NQIA 4PZ8A 4AYBE 2NZOA 4DR4L 5KNBA 4KHZA 3U9OA 3SXHA 5C0XG 3F8TA 1PH2A 2F0IA 4DR3L 4R4OA 5J22A 4R8IA 1IYUA 2D0PA 3BU2A 3PUWA 1O78A 1B9NA 1EY4A 1KIXA 1PH6A 1A6XA 1CUKA 1X3EA
chains in the Genus database with same CATH topology
5E4XA 2F0HA 3DWAA 1EZ6A 3S15B 3P75A 1CM9A 1LTBD 4ZUIA 2MGSA 3SK6A 3K57A 3MWYW 4PV1C 1QOHA 3HOUB 2BDOA 4K8IA 3VA7A 2F0FA 1PZKD 3RZDB 1SNOA 2VNUD 4CJ2C 1TR5A 3H6MA 5AFWA 2AQ2B 2K03A 4IURA 5G3LD 1MBYA 4L6TB 3KLRA 1EY6A 5CYUA 1WTOA 1CQVA 4RWSC 3M4YA 2O5IC 3OMCA 3K5NA 2XWJB 1BCPD 4MN3A 3OWFA 4BBSB 5IODA 1ET9A 2IX1A 4R8NA 3BVGA 2O4XA 2EZVA 2F03A 2QEJC 3NHHA 3NUCA 1GUOA 1GOZA 4CHTB 2K01A 1ENAA 2Z4IA 4KN4C 1BCPF 4MIUA 2LFNA 5CR3A 1ILPA 3KUPA 1C48A 3NQTA 3Q23A 3J81L 4HSPA 3OWEB 1E2ZA 1HPCA 2H4OA 1EWCA 4KV6A 3VR4A 5IGFA 3IFDA 2A6EC 4K5XA 4IUTA 1RTNA 4NDXA 2F0JA 4OO1I 1M4VA 1ILQA 4G7HC 3PUYA 3GD7A 4RA8A 1SYCA 3W3AA 2K7VA 1FR3A 3A7AB 1BF4A 1D6EC 1RDPD 1I4RA 1Y1WB 4FYDA 3H0GB 5I6WA 4HSVA 4DU9A 4OHJA 3S1RB 2QCPX 1IL8A 1JWSD 4KI0A 4RKLA 1STGA 2MHVA 1WTRA 4EQOA 2XRQD 3KLSX 2HDMA 4F8MA 4C3HB 1SYFA 4HMIA 4DNTB 2J0TD 5F2DA 4OL7A 1I4XA 1EY9A 2F0PA 1YNJC 5CV5A 1LO5D 2B8FA 2A6ED 2X69A 1SYBA 1H9MA 5KYIA 2ID0A 2KOLA 1YNJD 1U9RA 1HFGA 3OW7A 1SDFA 1IHZA 2B63B 2PYKA 2VB3X 3MFYA 3TZDA 5C4ZA 4M8AA 1B2TA 2N88A 3WDNA 4KK7A 4DAPA 1JOKA 2B2YA 3GP7A 3BZDB 4C3HG 1O7ZA 4A3JB 1C4QA 3ITPA 2E2JB 3MXNA 2Z4HA 1BQQT 1XWEA 3VYUA 3IFTA 5I6YA 4XXEA 5JPNC 2R93B 1KAAA 1CI3M 1EY8A 5EKIA 1HUMA 4C3IG 4KKSA 1S5BD 3TDQA 4OIJA 1SE2A 3K5LA 3GTQB 2LKVA 2B2YC 5C0XH 1PDQA 1TWGB 1O7YA 5EPLA 5T1GA 2QILA 3SK5A 2R61A 3EA6A 3BYTB 4RGNA 4CKBA 2VXWA 5KIXA 2LY7A 1LTID 1PZJD 3D8GA 1AP0A 1VF7A 4H0LC 2RSOA 5KGUA 2K04A 3PUVA 4AYBB 4PNYA 1Q3LA 2IX3A 3Q0AA 5KRUA 4E6IA 3ONAB 4FNFA 4TKOB 2ENBA 3RD4A 3KBXA 3X3MA 1CHQD 1ESFA 1PZID 4RH6A 1VCIA 3KBGA 1CQFA 1B3AA 5J1ZA 1SMYC 1TQOA 3IAYA 2DY7A 1KTKA 1HTPA 4ABNA 4WFN3 1F9QA 3S2DB 1W6KA 2IW3A 3GTLB 1KNEA 2N55A 3J81E 5FO7B 2FMMA 1M8AA 2F0NA 1BXTA 2YYZA 4XT3B 4BS9A 3QJYA 2AWNA 1CA5A 5FKAC 4KTAA 1OXVA 3SHLA 1G6ZA 1I6VC 4RAUC 1JCKB 3I90A 3T16A 4WJWA 4FXKC 2F0UA 4CJ0B 4LMQD 3NTIA 3E5SA 1MI2A 1Z47A 4QIWB 2RKSA 1D5MC 2JEBI 1BNZA 1HFNA 2SNMA 1I50B 1I4GA 5JEAG 3S9WA 3H94A 2E74C 2K1BA 5C0XJ 2MP1A 2O5JC 1FGBD 3UI2A 5C4HA 2KEEA 5FOBB 3V2TA 4DGZA 2JEAI 1PTOC 1VF5C 3GQBA 2SDFA 4P2CB 1STAA 3I70A 1U4RA 5D3DA 5G3LF 1EZ8A 2HUGA 1ZYRD 3K7AB 2F0GA 5ELFA 4IUQA 2Y0SB 2EYJA 5HURA 1I4QA 1HHVA 1I3QB 5C5MA 2Z8LA 1GUTA 1T5EA 5DM73 3OMGA 1G91A 5COYA 2HCCA 1TVXA 3I4LA 5DNFA 4IFDG 1JE4A 5D14A 1B53A 1EY5A 4KKUA 4KY6A 3VR3A 3Q22A 1CA6A 4CKCA 1JWMD 4MHEA 2NVYB 1G8ZD 1S4ZA 3K0YA 4QUFA 3BG3A 2NVQB 2A5HA 4XTCS 4K8JA 1SJED 2F0MA 2PCFB 5DEHA 5M9OA 4NKLA 2NN6G 3QB3A 1HQRD 5C4JB 2B2UC 3I91A 4IUNA 2EJMA 4YIJA 3CRLC 3PO3B 3HP3A 2B2TA 4G4KA 3J80L 1IKLA 2O2LD 3BVZA 1TKWB 5A35A 3T56B 3EFXD 4KY5A 3I4NB 1XYIA 3HEJA 3S17B 1HA6A 3A8JE 2J7ZA 1EEFD 1DJRD 4QF4A 1S5CD 1TT2A 1TS4A 2NWGA 1V1PB 3PUXA 5IOCA 1ZYRC 2WKDA 2KECA 1BOSA 3N6RA 3S1MB 5LL6X 1F77A 3NP8A 5C3WA 3OSOA 5CORA 3A55A 3NE5B 3EROA 1TS5A 4HTHA 3NBHA 5CV9A 1HQMC 5JOBA 2HDLA 2K6AA 4XQJA 1V8QA 2K05A 4IUUA 3NPPA 2YU9B 1WTVA 2NVTB 3K5OA 3SK8A 2F3VA 2EJGC 1CHPD 5NUCA 2Z1CA 3SVMA 4XT1B 5IT9E 1GJXA 3MVVA 1EQTA 1X32A 4F87A 4G7ZC 1STEA 4QMGA 1NUCA 2KQ3A 1TS3A 2PW7A 2EDGA 4ZYSA 2RA4A 2ZT9C 1A3VA 2NTSA 2R3ZA 2I46A 2E2IB 4QCLA 4HEDA 3VYRA 4X3KA 4N9TA 1B4OA 3NK9A 4EVOA 1RJTA 1QJOA 3C1EA 1QE6A 1Q1BA 4A3IB 4HCSA 1SEBD 2QKIC 4KJOA 3VR2A 1D5XC 1IKMA 3M7GA 4C56C 1JICA 1ET6A 1FNVA 1RD9D 1H9RA 3NXWA 3A56A 1K83B 5I2YA 5IGEA 2D62A 4X3SA 1K8MA 1STNA 5I4DA 1E0BA 1PTOF 5EPJA 2KCCA 5BN3A 4DFAA 1JR0D 1Y8OB 2CW0D 3N52A 4PMBA 1AFPA 1XXGA 2IWHA 2PQEA 2XN9C 3HOXB 2RBMA 3E6ZX 2KHSA 4TRDA 2RSNA 4JBWA 2ICEC 2RQXA 5K5PA 5T1IA 3O13A 3QWNA 4ZRZA 1H9SB 4A3EB 3QOJA 5KNDA 4PMCA 3L3OC 3D4WA 4C3IB 1Z7TA 3NWTA 1KLUD 1ML0D 5CV4A 5I2XA 5D3IB 2KA7A 5FK9C 3TP5A 2NN6H 4G7OC 1JOQA 4Q0FA 5E3FA 2R7ZB 1VMCA 4HN7A 5EPKA 4HMJA 3WOFA 2TSSA 4QB4A 3PUZA 3FPUB 3FMCA 1SYDA 2RDHA 3K58A 4A3DB 2K5WA 1EWHA 2A6HD 1Y69U 2L11A 1RF2D 1DOLA 3HZXA 2VUMB 5BN4A 3DHQA 2B39A 3V96A 1U4MA 5EQ0A 1O80A 1Y8NB 2NB0A 3BYYB 3SK4A 1DM0B 2F0EA 2IX0A 1LABA 4KN7C 1PRTF 4CJ1B 5EBCA 5IGGA 1U4PA 4U68A 5IT9L 1NR4A 4A3BB 1Y1VB 4XYOA 4ZAIA 1I6HB 5IGCA 5ELDA 1Q12A 5HGTA 4K5VA 5TSSA 2G9HD 2QF7A 4ZKBB 1HA5A 4K14A 2KCNA 3TP6A 3TN2A 3E0JA 4L63B 2JSOA 5FLXE 1WTWA 2JE6I 1VDZA 2PZUA 3M3YB 2AQ1B 2F0DA 1F2MA 4UAIA 4L8JA 3D6WA 5JPMC 2BE5D 1CT1D 2B2VA 2A6HC 5ELCA 3T4AC 4C1NK 2FINB 3KF8A 2L5TA 4G57A 2F0QA 2DNEA 2R92B 2BE5C 3CQZB 2NVXB 3G7LA 1H9SA 3DEPA 4LAAA 2GA4B 1AN8A 1FNWA 1F9PA 1HRJA 3K6OA 4FP5D 2D9UA 1PYWD 4IUPA 2B8GA 3R8BA 2MJ8A 4I7ZC 1QWYA 2CVRA 1EIGA 2F0OA 5CC4A 3TBIB 2EOTA 2V4DA 3VA5A 4IFDH 3QG1A 1SMYD 2E75C 3LWEA 2JA7B 3SR1A 3VR6A 2BOSA 4IN3A 1X3QA 3FPPA 4C1NI 3Q6SA 3TSSA 1J8IA 3BS1A 2JP1A 2EY6A 1KABA 3BDCA 4IALA 4BA1I 1DOKA 3AB9A 3CU7A 1KDBA 2QDBA 5IGBA 1FYCA 1SSOA 2IL8A 5JVG3 1SE3A 5ISRA 3GTGB 1Q8IA 5KEEA 3EQLC 1II3A 3HOVB 1LTRD 3AU7A 2MPMA 2R6GA 1RTOA 1CFMA 2CHBD 3DUZA 4BA2I 3GV3A 3F2UA 4XYQA 2BA1A 2JA5B 4B9WA 3SEBA 4J8QA 4C2MB 1R4PB 1XTCD 2XSCA 2XWBB 5C0XI 2FJ2A 2NTTA 4V190 2WV6D 1J9OA 3T13A 1SYGA 3RLFA 4RKBA 3JAML 1D2BA 5I9OA 2EYLA 1PXUA 1VMPA 1QB5D 3PIO3 1NCVA 5C44B 2F0WA 1STHA 1D1IA 3LNNA 4Q5VA 4FF3A 1Q90A 3SE0A 3QIAA 2B2TC 4HAEA 1A2TA 2NBFA 1DOMA 2ZXRA 1ONLA 4ME5A 1F2LA 2K32A 1DCZA 1B1ZA 2B2WA 5EJWA 2NN6I 4FF2A 2EY5A 5C3XA 1AW7A 1SYEA 4C3JB 2IPKD 5CGKA 2A69C 1GHJA 3HOZB 5E4WC 1WTXA 3CRKC 2AUJD 4JK1C 3IKJA 3MXUA 1AEXA 4RGTA 4ZQ3A 4K5WA 1TWHB 1LT6D 2JA6B 3I8ZA 4U673 1GXDC 3U9SA 4KD3A 1A2UA 3C1FA 4RGOS 5ELEA 1QCBD 3QOLA 3OIPA 4DNRB 4KMUC 3H3VC 3SDZA 2FFKB 1Y8PB 3P1HA 1RCVD 3GTKB 1S5DD 2B2WC 3NBIA 2H1EA 3L9AX 4DF7A 1LT5D 1DZ1A 2FMCA 3W2DA 3LX0A 1EQVA 2PPBC 3WOEA 1R9TB 4IFDI 3RUZA 3EVQA 4OO1H 1ESRA 2Q8IB 1XX8A 1PTOH 4CGYB 4K6DA 2D2CC 4DN4M 4IFDJ 5CBAE 2PZTA 2KJXA 1TWAB 5M5WB 4TQUS 2RDGA 4ID6A 1WD0A 1PFMA 4F7XA 3FKIB 4DXFA 3GV6A 2RVLA 1O7LA 3V05A 2A74C 1TWCB 1RHPA 1BCPB 1SE4A 1OO9B 2EE1A 3GTMB 1EY7A 2M2LA 4WORA 5FLXL 5CMDA 4A3FB 4KJNA 5C3EB 1EFID 1UAPA 2L0CA 1TY2A 1RKNA 1BO0A 1JORA 2F0KA 1FD7D 1PTOD 2WP8J 3C2PA 2HCIA 1EIHA 1CZGA 4GZYC 4OIKA 4TSSA 3JAME 2OF1A 2EJFC 3NSWA 2FHTA 2EYFA 2BA0A 3I4MB 1OXTA 4M1UB 3M4OB 3EJIA 4LJZC 3MZ5A 3MEHA 5IIFA 4CBVA 1STBA 3VYTA 1SNCA 1F9RA 4BWGB 1U4LA 1QILA 2CW0C 1PFBA 1UNSA 2A68D 1GUWA 1EYDA 4DK1A 4FF4A 2JA8B 2ZXOA 3G6JB 2JXMB 3VYSA 4K2KA 2E76C 1F9SA 1UEAB 4X3TA 2EYOA 1TIID 1PTOB 3T51B 1KNAA 4RHRA 4ODGA 2X6GA 4K6LA 2BCOA 2F0TA 3S1QB 5M3FB 1AZPA 1X3PA 2C5CA 4O1NA 1HUNA 1TS2A 1G2TA 4ZK9B 1DXMA 3OOCA 3D4DA 5A2QL 4B9XA 3TP8A 1PRTC 4RCOA 1WCMB 2WACA 2J4XA 2K33A 4KKTA 3ND9A 1IW7C 3ND8A 3S16B 1T5XD 1B9MA 1LTAD 5M3MB 2F0SA 2L4NA 3PV0A 1ZXTA 1V1OA 1JWUD 5A2QE 3GTOB 3ERQA 4R9WA 1R4QB 1F2ZA 2OEOA 2NYZD 4ZUJA 2A68C 3J80E 4PMWA 1AZQA 3HG9A 1LTSD 4IZ8A 1STYA 2EVBA 2PZWA 1H9JA 5EGTA 5CBEE 1WTQA 1QNKA 3D31A 3HGBA 2EY2A 2XIWA 1UUPA 3DWPA 1A15A 1H9KA 1I4PA 1Q1EA 2MUYA 3DWQA 2XVSA 3I3CA 3S14B 1A3TA 4Y7NB 4Z9CB 2ICIA 1D1KA 3A7LA 2EYPA 5JEAH 3HOYB 3J7AV 1F2YA 2M9VA 1NSNS 1PRTB 1WTPA 2D5DA 4A3KB 2DN8A 2TMPA 1HTLD 3C46A 1CK1A 3PO2B 1BDOA 1S5ED 2VB2X 2KUMA 3MC0B 5M5YB 1PRTD 1V1PA 2AUKA 3Q24A 1GHKA 3DM1A 4OO1G 3D4RA 1MGSA 4NMZA 1ZKOA 1D5ZC 2LS01 1IYVA 1MSHA 2ZXPA 4XDXA 1LACA 2DNCA 3D3RA 2C9OA 2L12A 5C4XB 2AWOA 4HCEA 3I73A 1PLFA 3H91A 3P20A 3CHBD 3BVMA 4ZLTF 3MAQA 3C3LA 2F4IA 1QG7A 3J7AF 4RGMA 4A3MB 4IUVA 3DXJC 1MD2D 3P7JA 3MXGA 3FVQA 3NTHA 2SOBA 1I4HA 4EQNA 1ZEQX 4DAYA 3L7ZC 4J6HA 5DM63 4UDUC 3X3NA 3S2HB 3FDTA 5KYLA 4ILWA 3A8IE 4I65A 2HQEA 5K36G 1GUNA 1Z6HA 1EEID 1SFOB 4NW2A 2IJ0A 1WD1A 4RCNA 5CV6A 1L0YB 2DY8A 3CKIB 4EGVA 4FXDA 1SNQA 4KHVA 1EOTA 3R93A 1S5FD 2SNSA 5JEAJ 2B2VC 1KDCA 3H09A 4HR7B 2F0VA 5EKLA 5ELBA 1SNDA 3S1NB 1QNUA 3TP7A 3PIP3 4ZKCB 1LV9A 2XNAC 3OIQA 3A8KE 1TU2B 1DONA 2AQ3B 2E2HB 1GUGA 1EL0A 4XQQA 2EYHA 4B08A 2EYMA 3MA2B 1TWFB 2F0LA 1BUVT 4IQZA 4DK0A 4A93B 3KK7A 5LHY1 3TZUA 1G2SA 1JQYD 2G9DA 4H13C 4J1MA 1BBXC 3OHXC 4CKEA 4DA2A 5IGDA 1OXUA 2KVMA 2K5DA 3RMHA 3NWSA 3HKZB 4EQPA 1SBBB 1FNUA 4DAVA 3TMEA 1C8CA 1OXXK 4BBRB 5J39A 1OXSC 5FO8B 5JAVA 2PMZB 1DD2A 2L1BA 1B44D 3GTPB 1JC7A 1PFNA 1G291 4PQXA 1DYQA 2RDFA 1TY0A 3HRZC 1LT4D 1NAPA 2Q8TA 1V43A 4H44C 1GUSA 3FEWX 4QUCA 5I9PA 5JJZA 2EXZA 1EU3A 3R2TA 2X6LA 5CV7A 2WB1B 2SEBD 3GTJB 3I72A 4N9PA 3M7NA 3R2IA 2EY1A 2BDNA 5EBDA 1EYCA 2OXPA 3IL8A 5JVH3 1A3UA 1CTMA 1BR9A 2NUCA 2JYOA 4X3UA 4K2LA 2PNRC 3MHBA 2I07B 1YNND 3GO5A 4RFBA 3RZOB 1SAPA 1HCZA 1EY0A 4XQNA 1YNNC 5C6AA 3PMFA 2EPBA 1ENCA 2WAQB 1CZWA 1EYAA 2L55A 2NZ1D 3MTSA 4FXGC 5DAUA 2WIIB 3BDLA 2K5QA 4BY1B 1E2VA 3URYA 2WKCA 2PW5A 2M00A 1ENFA 5C5LA 1SNPA 4KD4A 2Q8RE 4OGQC 2B2UA 4A3GB 1JB3A 3K59A 1E2WA 1JOOA 1WVLA 4FF1A 3LWUA 4LK1C 1LLRD 3KLSA 1MSGA 2A73B 3HOWB 2XRSD 3MFGA 4H7BA 3AMUA 4RHSA 5FO9B 2LMCB 1RODA 3HS0C 1KLGD 3VR5A 3BDOA 2IT1A 2K28A 3MXPA 2OT2A 4C3JG 5K36H 1SXTA 4WRDA 1PMRA 3T53B 2L9HA 5EKKA 4DXGA 1HXYD 1W6JA 3ZYYX 1SNMA 2A69D 3OPOA 5CV8A 2CQAA 5BN5A 1ICWA 5KNCA 1NR2A 3A54A 4O42A 1KDAA 3QO2A 1LT3D 3M85A 2E2DC 4KY7A 4S3SA 4FVMA 3D6CA 2WINB 5M5XB 1LTGD 2PO4A 1SJHD 3J7YW 1L0XB 3DMUA 4ULLA 2F1MA 3K5MA 4V0BA 2KEDA 4NP5A 4F88A 1B50A 4XIGS 4BY7B 3R3OA 2F3WA 1K8OA 1EU4A 1IW7D 5E1FA 4FO2A 3NTKA 1LTTD 1BCPC 3FRPB 5LL6S 3DEOA 5D65A 3NQIA 5KNBA 4KHZA 3U9OA 3SXHA 5C0XG 2F0IA 5J22A 4R8IA 1IYUA 3PUWA 1O78A 1B9NA 1EY4A 1A6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0H A;  2SNS A;  4H7B A;  5IGC A;  1EZ6 A;  1KDC A;  5HGT A;  4N9P A;  2PQE A;  3P75 A;  1EY8 A;  2F0V A;  4K5V A;  3SR1 A;  5EKL A;  4ZUI A;  2EY5 A;  3SK8 A;  2F0N A;  2RBM A;  2EY1 A;  2F3V A;  4NMZ A;  3SK6 A;  1SND A;  5C3X A;  3D4D A;  4B9X A;  5NUC A;  3TP8 A;  1SYE A;  5CGK A;  2EY6 A;  3TP7 A;  3MXP A;  5I6W A;  1EYC A;  1KAB A;  2KHS A;  2OXP A;  3MVV A;  3BDC A;  1A3U A;  1EY7 A;  4IAL A;  2F0F A;  2WAC A;  4K8I A;  4KTA A;  4TRD A;  4WOR A;  4WRD A;  3SHL A;  4KJN A;  1KDB A;  2QDB A;  4K8J A;  2NUC A;  1NUC A;  4K14 A;  4QMG A;  2F0M A;  5IGB A;  5DEH A;  5M9O A;  1SNO A;  3T16 A;  4K2L A;  2KQ3 A;  2PW7 A;  4NKL A;  1STG A;  2EYH A;  4RKL A;  5EKK A;  2EYM A;  1TR5 A;  2LKV A;  3H6M A;  5K5P A;  2F0U A;  1AEX A;  1RKN A;  3MHB A;  5ISR A;  2F0L A;  3QB3 A;  1SNM A;  2F0S A;  3E5S A;  5CV8 A;  2F0K A;  4K5W A;  4ZQ3 A;  3TP6 A;  4EQO A;  5KEE A;  3QOJ A;  4F8M A;  4PMC A;  2RKS A;  1II3 A;  1A3V A;  1SYF A;  1EY6 A;  3ERQ A;  1KDA A;  2SNM A;  4HMI A;  4IUN A;  4KD3 A;  1A2U A;  3D4W A;  1F2Z A;  3OMC A;  2OEO A;  4YIJ A;  2PZU A;  1EY0 A;  5CV4 A;  5F2D A;  3C1F A;  4KY7 A;  4OL7 A;  4ZUJ A;  3SK5 A;  4S3S A;  2F0D A;  3S9W A;  4J1M A;  3OWF A;  1EY9 A;  2F0P A;  4EQN A;  5C6A A;  3QOL A;  3PMF A;  2OF1 A;  5IOD A;  4N9T A;  3D6C A;  5CV5 A;  5IGD A;  3NK9 A;  2EYF A;  1F2M A;  4EVO A;  4R8N A;  3TP5 A;  4B9W A;  4KY5 A;  4IZ8 A;  5KIX A;  1STY A;  1ENC A;  2O4X A;  3D8G A;  3HEJ A;  1JOQ A;  1SYB A;  2PZW A;  4EQP A;  5E3F A;  3P1H A;  3EJI A;  3C1E A;  5EGT A;  1EYA A;  3DMU A;  5KYI A;  3NHH A;  3MZ5 A;  5C4H A;  1U9R A;  3NUC A;  3TME A;  4QF4 A;  4HMJ A;  2EY2 A;  5KGU A;  4DF7 A;  2SOB A;  3MEH A;  1TT2 A;  3V2T A;  4QB4 A;  4DGZ A;  5IIF A;  4KJO A;  5J39 A;  4PNY A;  1STB A;  4G57 A;  4NP5 A;  1SYG A;  2F0Q A;  5DAU A;  1ENA A;  1IHZ A;  1SNC A;  3T13 A;  3LX0 A;  1EQV A;  5IOC A;  2PYK A;  4RKB A;  3BDL A;  4J6H A;  1SYD A;  3RUZ A;  1A3T A;  4MIU A;  5I9O A;  5C4Z A;  3R3O A;  3EVQ A;  4LAA A;  1JOR A;  5KRU A;  5KYL A;  5CR3 A;  2EYL A;  2F3W A;  4E6I A;  3NQT A;  3HZX A;  1JOK A;  1STA A;  5E1F A;  2PW5 A;  3DHQ A;  3NP8 A;  4I65 A;  5C3W A;  2HQE A;  2M00 A;  1EZ8 A;  3OSO A;  1EYD A;  2ENB A;  5C5L A;  4K6D A;  1SNP A;  2EYP A;  2F0W A;  4KD4 A;  2F0G A;  4KV6 A;  3SK4 A;  2RDF A;  3NXW A;  4DU9 A;  5IGF A;  2F0E A;  3ITP A;  3ERO A;  2PZT A;  1F2Y A;  1STH A;  2EYJ A;  4HTH A;  3U9O A;  3SXH A;  5HUR A;  4K5X A;  1NSN S;  5J1Z A;  4NDX A;  5CV6 A;  4K2K A;  4ID6 A;  1TQO A;  2F0J A;  5CV9 A;  5C5M A;  5IGE A;  2F0I A;  2F0O A;  3OMG A;  1JOO A;  5CC4 A;  1STN A;  5IGG A;  1SNQ A;  2EYO A;  5J22 A;  5I9P A;  3VA5 A;  1A2T A;  2EXZ A;  5JOB A;  4KHV A;  4F7X A;  4DFA A;  5JAV A;  1EY4 A;  4ODG A;  1SYC A;  4PMB A;  5I6Y A;  4ME5 A;  5CV7 A;  2F0T A;  1EY5 A;  4KY6 A;  1KAA A; 
#chains in the Genus database with same CATH topology
 5E4X A;  4CDE C;  2F0H A;  2BH8 A;  3DWA A;  1EZ6 A;  4NXN Q;  3S15 B;  2YV5 A;  3P75 A;  1CM9 A;  3CMA A;  4GKJ L;  1LTB D;  4ZUI A;  2MGS A;  2K14 A;  3SK6 A;  3K57 A;  3MWY W;  4PV1 C;  1QOH A;  3HOU B;  2BDO A;  4K8I A;  3VA7 A;  2F0F A;  1PZK D;  3S17 H;  3RZD B;  1GO3 E;  1SNO A;  2VNU D;  4CJ2 C;  4JYA Q;  1TR5 A;  3H6M A;  5AFW A;  4YCV A;  2AQ2 B;  1I5F A;  2JN4 A;  2K03 A;  4YWK A;  2PQA A;  4IUR A;  5G3L D;  1LYL A;  1MBY A;  2OQK A;  4L6T B;  2VZA A;  3KLR A;  1EY6 A;  5CYU A;  3G71 A;  1WTO A;  1CQV A;  4JI4 Q;  4RWS C;  3M4Y A;  3NEM A;  4UP9 A;  2O5I C;  3OMC A;  3K5N A;  2HHH Q;  5C4J H;  2XWJ B;  1BCP D;  4MN3 A;  4A3K G;  3OWF A;  4MTK A;  4BBS B;  2ZTE A;  2LXJ A;  4JG2 A;  5IOD A;  4A3G G;  4A3M G;  1ET9 A;  1FJG L;  2IX1 A;  3AEV A;  4LFB Q;  4R8N A;  3BVG A;  2O4X A;  3RZD H;  5LMU L;  2EZV A;  2NVQ H;  2F03 A;  4HJ7 A;  2QEJ C;  3NHH A;  4LF6 Q;  3E0E A;  3NUC A;  1GUO A;  1GOZ A;  3KF6 B;  1K8A C;  4CHT B;  2K01 A;  3T1H L;  1XPR A;  3CCR A;  1S72 A;  1ENA A;  2Z4I A;  4DK6 C;  3A0J A;  4LF7 Q;  4KN4 C;  1BCP F;  3S15 H;  4MIU A;  2R92 G;  2LFN A;  5GAE C;  2V1C C;  5CR3 A;  1ILP A;  3KUP A;  1C48 A;  2WFW A;  3NQT A;  3Q23 A;  3J81 L;  3T1Y Q;  1QVC A;  2VW9 A;  1ICF B;  4HSP A;  4P71 A;  3OWE B;  1E2Z A;  1XPU A;  1HPC A;  4APV A;  4A3C H;  2H4O A;  4X62 Q;  1EWC A;  4KV6 A;  1AH9 A;  3VR4 A;  1GVP A;  2PNH A;  4CDD C;  5IGF A;  2CH4 A;  3IFD A;  1I3Q H;  4GOP B;  2A6E C;  3J81 c;  4K5X A;  4IUT A;  1RTN A;  4NDX A;  2F0J A;  4OO1 I;  1M4V A;  3J80 i;  1ILQ A;  4G7H C;  3PUY A;  3K7A H;  4OXP A;  3GD7 A;  2E5L Q;  1OTC A;  4RA8 A;  3FHW A;  3H3V I;  2Z0S A;  1SYC A;  3W3A A;  1A0I A;  5LMN L;  2CH4 W;  2K7V A;  1FR3 A;  5M3M G;  3A7A B;  4L5R C;  4BY7 H;  1IZ6 A;  3CF5 A;  1BF4 A;  1D6E C;  1RDP D;  1I4R A;  4YWL A;  4B3M Q;  1WCM G;  1Y1W B;  4FYD A;  1PH5 A;  5GAH C;  3H0G B;  5I6W A;  4HSV A;  1HNZ L;  4DU9 A;  4OHJ A;  2QDL A;  1JT8 A;  3S1R B;  1EYG A;  2QCP X;  1IL8 A;  1JWS D;  4KI0 A;  4RKL A;  1STG A;  2MHV A;  1WTR A;  2FXQ A;  1Q7Y C;  4HIO A;  4EQO A;  2XRQ D;  3KLS X;  4X62 L;  2HDM A;  4O2D A;  4F8M A;  2LXK A;  4C3H B;  4ME3 A;  1SYF A;  4HJ8 A;  1C0A A;  4HMI A;  4DNT B;  2J0T D;  5F2D A;  1V9P A;  4OL7 A;  4RMF A;  1I4X A;  3I55 A;  1EY9 A;  2F0P A;  1YNJ C;  3UDI A;  1J5E Q;  5CV5 A;  4LWC A;  1LO5 D;  3HOY G;  2BH2 A;  2B8F A;  3G4S A;  2A6E D;  1YBY A;  2RCF A;  2X69 A;  1SYB A;  1YIJ A;  1EQR A;  1H9M A;  5KYI A;  4LF6 L;  1NJI C;  2ID0 A;  1P8L A;  2KOL A;  4J15 A;  1XNR Q;  1YNJ D;  1U9R A;  1X6O A;  1HFG A;  3FP9 A;  3M4P A;  3OW7 A;  4UY8 C;  1SDF A;  1IHZ A;  2B63 B;  4LFB L;  3I4M G;  2PYK A;  1FJG Q;  2VB3 X;  3MFY A;  3TZD A;  5C4Z A;  4M8A A;  2VQE Q;  1WJJ A;  1B2T A;  2IHE A;  2N88 A;  1G6P A;  4GN3 B;  3WDN A;  4KK7 A;  3GDE A;  2OTL A;  4DAP A;  1JOK A;  1K0S A;  3F2B A;  2B2Y A;  1SR3 A;  3GP7 A;  2R7Z G;  3HKZ G;  3BZD B;  4C3H G;  2UU9 Q;  1O7Z A;  4A3J B;  1C4Q A;  4LFC Q;  3ITP A;  2E2J B;  3AFP A;  4A3G H;  3MXN A;  3M9B A;  2Z4H A;  4L5S A;  1BQQ T;  4X64 L;  5GAG C;  1X3F A;  1XWE A;  2AHO B;  3VYU A;  3IFT A;  5I6Y A;  1LM0 A;  4XXE A;  5JPN C;  2R93 B;  1KAA A;  4GKJ Q;  1CI3 M;  2A19 A;  2I0Q A;  1EY8 A;  3G6E A;  1NMG A;  5EKI A;  2MO0 A;  1HUM A;  4C3I G;  3K80 C;  5FJ8 H;  4KKS A;  1B7Y B;  1S5B D;  3TDQ A;  4OIJ A;  3RN2 A;  1SE2 A;  3K5L A;  4GOP A;  2YTV A;  1QZG A;  3GTQ B;  2LKV A;  2B2Y C;  5C0X H;  1PDQ A;  1B8A A;  1TWG B;  4YWM A;  4DUZ Q;  4O0A A;  4DR1 L;  2EIF A;  1O7Y A;  5EPL A;  1NE3 A;  5T1G A;  1K8G A;  2QIL A;  3SK5 A;  4AIM A;  1LTL A;  2R61 A;  2MNA A;  2KHI A;  1VQ9 A;  3EA6 A;  3BYT B;  4RGN A;  4CKB A;  2VXW A;  4JBM A;  5KIX A;  2LY7 A;  1LTI D;  1PZJ D;  3D8G A;  1VQ6 A;  4DR5 Q;  2ALY B;  1AP0 A;  3K8A A;  1VF7 A;  4H0L C;  2RSO A;  5KGU A;  2K04 A;  3PUV A;  1P16 A;  4AYB B;  4PNY A;  1Q3L A;  4MZ9 A;  2IX3 A;  4LF7 L;  3GTJ H;  3Q0A A;  1SN8 A;  4P75 A;  5KRU A;  2R93 H;  4E6I A;  3ONA B;  2OTJ A;  4FNF A;  4TKO B;  2ENB A;  3RD4 A;  3KBX A;  3K0X A;  4A3E G;  3B6Y A;  2YTX A;  3X3M A;  1CHQ D;  1NMF A;  1ESF A;  2PI2 E;  1PZI D;  1CSP A;  4RH6 A;  1VCI A;  3KBG A;  1CQF A;  1B3A A;  3BZC A;  4OWT B;  5J1Z A;  1SMY C;  1TQO A;  2E2J H;  3IAY A;  2CWA A;  4A3J H;  5IP7 G;  1NY4 A;  2DY7 A;  1E3P A;  1KTK A;  3I7F A;  1HTP A;  4ABN A;  4WFN 3;  1F9Q A;  1HZC A;  4HJ5 A;  4X6A H;  3S2D B;  1J6Q A;  1W6K A;  2IW3 A;  2B63 G;  1IYJ B;  3GTL B;  1KNE A;  2HQL A;  2Z6B A;  2N55 A;  3J81 E;  1VQM A;  2ZM6 Q;  3AFQ A;  2FMM A;  2F0N A;  1M8A A;  5FO7 B;  4BBR H;  5FLM G;  1YNX A;  5IY0 A;  1RIP A;  1BXT A;  2YYZ A;  4XT3 B;  4BS9 A;  3QJY A;  2AWN A;  1CA5 A;  5FKA C;  4KTA A;  3TRE A;  1OXV A;  3SHL A;  1G6Z A;  1I6V C;  4RAU C;  1JCK B;  1KD1 C;  3I90 A;  4JI6 Q;  3T16 A;  1YJW A;  4WJW A;  1HNW Q;  4FXK C;  1KAW A;  2UUC L;  2F0U A;  4CJ0 B;  4LMQ D;  3ER0 A;  3NTI A;  3E5S A;  1XJV A;  5M3F G;  1MI2 A;  1EIF A;  1Z47 A;  4QIW B;  2RKS A;  1D5M C;  2JEB I;  1BNZ A;  1HFN A;  1YHA A;  2SNM A;  1I50 B;  3IRB A;  4A93 H;  2KBN A;  3UDF A;  4GLX A;  1I4G A;  5JEA G;  1MHW C;  3TRZ A;  3S9W A;  3H94 A;  4DR3 Q;  4OEL B;  4DV0 L;  2E74 C;  1VQP A;  4DR4 Q;  1N8R C;  1ASY A;  2K1B A;  2E2H H;  5C0X J;  2MP1 A;  5GRO A;  2O5J C;  4HJ9 A;  1FGB D;  3H0G H;  3UI2 A;  5C4H A;  2KEE A;  3S24 A;  3S1N H;  1Y1W H;  5FOB B;  5JJI A;  3V2T A;  4DGZ A;  1EFW A;  2N49 A;  4HIM A;  2JEA I;  4UP8 A;  1PTO C;  4DR7 L;  1VF5 C;  4A3B G;  3GQB A;  2SDF A;  1X56 A;  3CCV A;  2DJF C;  4P2C B;  3HOZ G;  4OWW B;  1STA A;  2ZJR A;  3I70 A;  1PA6 A;  1U4R A;  5D3D A;  5G3L F;  3DM3 A;  1E24 A;  1EZ8 A;  1K73 C;  4HID A;  2HUG A;  1ZYR D;  3K7A B;  2F0G A;  2GN5 A;  4PZ7 A;  5ELF A;  4IUQ A;  2Y0S B;  2EYJ A;  5HUR A;  1I4Q A;  1QZH A;  1I3Q B;  2JA8 G;  1HHV A;  5C5M A;  2Z8L A;  1N9W A;  1GUT A;  1T5E A;  5DM7 3;  4KHP L;  3OMG A;  1SFO H;  1G91 A;  5COY A;  2HCC A;  1TVX A;  3I4L A;  1UEB A;  5DNF A;  4IFD G;  1JE4 A;  5D14 A;  1B53 A;  5IWA Q;  1EY5 A;  4KKU A;  4KY6 A;  4DAY B;  3VR3 A;  3Q22 A;  1M1K C;  1CA6 A;  4JI0 L;  4CKC A;  3S2H H;  1JWM D;  4MHE A;  2NVY B;  2Q2H A;  1VQL A;  1G8Z D;  4JI3 Q;  1ASZ A;  4AYB G;  1S4Z A;  4YHH L;  2UXC L;  3K0Y A;  4P74 A;  4QUF A;  3BG3 A;  2NVQ B;  1YEZ A;  2A5H A;  4XTC S;  4K8J A;  1SJE D;  2K5V A;  2F0M A;  2PCF B;  5DEH A;  5M9O A;  4A3M H;  4NKL A;  2NN6 G;  4BBS H;  3QB3 A;  3A5U A;  1HQR D;  3HKZ E;  5C4J B;  2B2U C;  3CAM A;  3I91 A;  1PH9 A;  5FJ8 G;  4IUN A;  2EJM A;  3HOV G;  4YIJ A;  4DV4 L;  1FL0 A;  1HR0 W;  3CRL C;  3PO3 B;  3HP3 A;  2B2T A;  4G4K A;  3J80 L;  1IKL A;  2O2L D;  3BVZ A;  1TKW B;  5A35 A;  3PF5 A;  3T56 B;  3EFX D;  1SE8 A;  4KY5 A;  3I4N B;  1XYI A;  1N34 Q;  3HEJ A;  2ASB A;  3S17 B;  1WFQ A;  2I5L X;  1HA6 A;  4JCV E;  3HOU H;  3A8J E;  2J7Z A;  1EEF D;  5AJ3 Q;  3J80 c;  1DJR D;  4I7A A;  4QF4 A;  1S5C D;  1TT2 A;  1K3B C;  1TS4 A;  2NWG A;  4HJA A;  1V1P B;  3PUX A;  5IOC A;  2ZJP A;  1ZYR C;  1YI2 A;  4DV2 Q;  4K0K Q;  2WKD A;  2KEC A;  1BOS A;  1Q82 C;  3PO3 G;  4DV1 Q;  3N6R A;  1KHI A;  3S1M B;  5LL6 X;  2PI2 A;  1F77 A;  3KF6 A;  3NP8 A;  1HNX L;  5C3W A;  4LFA Q;  3STB C;  1MJC A;  3OSO A;  1VS0 A;  5COR A;  3A55 A;  3OW2 A;  3CCQ A;  3NE5 B;  3AYH B;  3ERO A;  4LF9 L;  1TS5 A;  4HTH A;  3KF8 B;  3OYY A;  3NBH A;  5CV9 A;  3EIV A;  1HQM C;  4X65 Q;  5JOB A;  2HDL A;  2K6A A;  4XQJ A;  1V8Q A;  2K05 A;  4IUU A;  2KCM A;  3NPP A;  4R4I A;  3ERS X;  2YU9 B;  4DAM A;  3S14 H;  1WTV A;  2NVT B;  3K5O A;  3SK8 A;  2F3V A;  2EJG C;  1CHP D;  1JJC B;  1N33 Q;  5NUC A;  2Z1C A;  3SVM A;  4XT1 B;  5IT9 E;  4WJ4 A;  1GJX A;  3MVV A;  2RHS B;  1EQT A;  1X32 A;  1HH2 P;  4DV5 L;  4F87 A;  4G7Z C;  1STE A;  4QMG A;  1NUC A;  4DV3 Q;  2KQ3 A;  1TS3 A;  2PW7 A;  2EDG A;  5M5X H;  4ZYS A;  2Y0S G;  2DJG C;  4YY3 L;  2RA4 A;  4JI1 L;  4A3J G;  3J81 j;  4JI2 L;  2ZT9 C;  4MNO A;  1Q86 C;  1A3V A;  2NTS A;  2R3Z A;  4LFA L;  2I46 A;  2E2I B;  5IYB G;  3GTO H;  4QCL A;  4HED A;  2OWO A;  3VYR A;  4NXM Q;  4X3K A;  1E7Z A;  4DV2 L;  3S16 H;  4N9T A;  1B4O A;  3NK9 A;  4EVO A;  1RJT A;  1QJO A;  2HIX A;  1VQK A;  5FLM H;  3C1E A;  1KRS A;  1MIU A;  1QE6 A;  1L2F A;  5AJ3 L;  4LF4 L;  1Q1B A;  4A3I B;  2HIV A;  1SEB D;  3QR8 A;  4HCS A;  2QKI C;  4KLK A;  4KJO A;  1IXR A;  3VR2 A;  4QY7 A;  1E1T A;  1D5X C;  1IKM A;  1CSQ A;  4JPB W;  3HOW H;  3M7G A;  5M3F H;  4C56 C;  3S1Q H;  1JIC A;  1U5K A;  3A5Z B;  5H1S E;  1ET6 A;  4IJL A;  1FNV A;  1RD9 D;  1H9R A;  3CXC A;  3NXW A;  3ULP A;  1Q8K A;  3A56 A;  2Q2T A;  1K83 B;  5I2Y A;  1BVS A;  5DLQ E;  5IGE A;  5BR8 Q;  2D62 A;  5IT9 c;  4X3S A;  3ULL A;  1K8M A;  1STN A;  5I4D A;  1E0B A;  5EAY A;  1PTO F;  5EPJ A;  5C44 G;  3H0G G;  2KCC A;  5BN3 A;  1PH3 A;  4DFA A;  1JR0 D;  2WAQ G;  1Y8O B;  2CW0 D;  3N52 A;  4PMB A;  1AFP A;  4IPC A;  1XXG A;  2IWH A;  4JI1 Q;  1E22 A;  5ELO A;  4YY3 Q;  4BY1 H;  2PQE A;  3UDX A;  4JI0 Q;  5IWA L;  3CC7 A;  2XN9 C;  3HOX B;  4B3S Q;  2RBM A;  2HD3 A;  3E6Z X;  4DV5 Q;  2K50 A;  1MKH A;  3KFU A;  2KHS A;  4TRD A;  2OQ0 A;  2RSN A;  4JBW A;  2CWP A;  2CFM A;  2ICE C;  5C4X G;  2RQX A;  4DV7 Q;  5K5P A;  5T1I A;  3O13 A;  3QWN A;  4ZRZ A;  4MTN A;  4DR6 Q;  1H9S B;  4A3E B;  3QOJ A;  2JQO A;  5KND A;  4PMC A;  4JOI C;  3CD6 A;  2VY3 A;  3CCS A;  1XMQ L;  3L3O C;  3D4W A;  3U4V A;  4C3I B;  1Z7T A;  3NWT A;  1KLU D;  1ML0 D;  5CV4 A;  2WB1 E;  3RZO H;  3CCJ A;  4IOC A;  5I2X A;  5D3I B;  2KA7 A;  5FK9 C;  3TP5 A;  2NN6 H;  4G7O C;  4UHV A;  1JOQ A;  4A3F H;  2QA4 A;  3W1B A;  4Q0F A;  2R7F A;  5E3F A;  2R7Z B;  4DK3 C;  4UP7 A;  1JJG A;  1VMC A;  4HN7 A;  5EPK A;  4HMJ A;  3WOF A;  1HNX Q;  2TSS A;  1QUQ A;  1NTG A;  4R4Q A;  4TVA B;  4QB4 A;  4A3D G;  1TWC H;  3PUZ A;  3FPU B;  4WJ3 M;  3FMC A;  1SYD A;  1VQO A;  2RDH A;  3K58 A;  4A3D B;  2K5W A;  1EWH A;  2A6H D;  1Y69 U;  2L11 A;  2N8N A;  1RF2 D;  1QVG A;  1DOL A;  3HZX A;  2VUM B;  1A63 A;  3FKI H;  5BN4 A;  3DHQ A;  3CC2 A;  1KXL A;  2B39 A;  3V96 A;  1U4M A;  5EQ0 A;  5IYB H;  1O80 A;  1Y8N B;  2NB0 A;  3BYY B;  3SK4 A;  1SRO A;  2A1A A;  1N34 L;  1DM0 B;  2F0E A;  5E7N A;  2IX0 A;  1LAB A;  2ES2 A;  4IJH A;  4KN7 C;  1HNW L;  1PRT F;  2MQH A;  1TWA H;  5M5W H;  1VQI A;  4X66 Q;  4CJ1 B;  1T9H A;  2YTY A;  4BBR G;  2K5N A;  5EBC A;  5IGG A;  1U4P A;  4DV4 Q;  4U68 A;  5IT9 L;  4OX9 Q;  2UXB Q;  4R4T A;  3GTP H;  1NR4 A;  4A3B B;  2C35 B;  1Y1V B;  4XYO A;  4ZAI A;  2N3S A;  1I6H B;  3PF4 A;  3JAM c;  1XMO L;  5IGC A;  5ELD A;  1Q12 A;  3CP0 A;  5HGT A;  1R9T H;  4K5V A;  4LUV A;  3MXN B;  5TSS A;  2G9H D;  4YCU A;  2QF7 A;  4QJF A;  4ZKB B;  4P73 A;  1HA5 A;  2K75 A;  4K14 A;  4BXX H;  2KCT A;  2KCN A;  3TP6 A;  3TN2 A;  3E0J A;  4A93 G;  4L63 B;  4JV5 L;  2JSO A;  5FLX E;  2AMC B;  1WTW A;  2JE6 I;  1VDZ A;  2PZU A;  3M3Y B;  2AQ1 B;  1TWH H;  4IPG A;  2F0D A;  1TWF H;  1F2M A;  4UAI A;  4L8J A;  1BKB A;  1AE3 A;  3D6W A;  5JPM C;  2BE5 D;  3HOZ H;  1W2B A;  1CT1 D;  1B3Q A;  2B2V A;  2A6H C;  4C3J H;  5ELC A;  1HZB A;  3T4A C;  4C1N K;  2FIN B;  3KF8 A;  2L5T A;  4G57 A;  2F0Q A;  2DNE A;  4DR7 Q;  2R92 B;  2BE5 C;  3CQZ B;  2NVX B;  3G7L A;  4JBK A;  1A62 A;  1H9S A;  3DEP A;  4LAA A;  2GA4 B;  1AN8 A;  4GLV B;  1FNW A;  1F9P A;  1HRJ A;  5LMN W;  3K6O A;  4FP5 D;  2D9U A;  1PYW D;  4IUP A;  2B8G A;  2MFI A;  4DR1 Q;  3R8B A;  2MJ8 A;  1GD7 A;  4I7Z C;  1FGU A;  1QWY A;  2CVR A;  1X54 A;  1EIG A;  2F0O A;  5CC4 A;  3TBI B;  2EOT A;  2V4D A;  3VA5 A;  4IFD H;  3QG1 A;  5IP9 G;  2CKZ B;  1SMY D;  3PIO A;  2E75 C;  4A3L H;  3LWE A;  2QEX A;  2JA7 B;  2EXD A;  3SR1 A;  3ULJ A;  1JJ2 A;  3VR6 A;  2Z9H A;  2BOS A;  4IN3 A;  1X3Q A;  3FPP A;  4C1N I;  4P72 A;  3Q6S A;  3TSS A;  1J8I A;  3NBH B;  3BS1 A;  2JP1 A;  2EY6 A;  1KAB A;  4X64 Q;  3BDC A;  4IAL A;  4BA1 I;  1DOK A;  3AB9 A;  3CU7 A;  1KDB A;  2QDB A;  3W5O A;  2QGQ A;  5IGB A;  4C2M H;  1FYC A;  1SSO A;  3J7A 5;  2IL8 A;  5JVG 3;  1SE3 A;  1C9O A;  4LFC L;  5ISR A;  3GTG B;  1Q8I A;  1HR0 L;  2UU9 L;  5KEE A;  3EQL C;  1II3 A;  4DPG A;  3HOV B;  3HOV H;  1LTR D;  3AU7 A;  2MPM A;  4NB3 A;  2R6G A;  1RTO A;  1CFM A;  2CHB D;  2VQE L;  1N36 L;  3GTG H;  3DUZ A;  1C7Y A;  4BA2 I;  3GV3 A;  2RF4 A;  4ZCK A;  4BY1 G;  3F2U A;  4XYQ A;  5C4X H;  2BA1 A;  2K5H A;  4A4I A;  4B9W A;  2JA5 B;  3SEB A;  4J8Q A;  3WWV A;  4C2M B;  4AQY Q;  1R4P B;  3ZJY C;  1XTC D;  2XSC A;  2XWB B;  1VQA A;  1L1O C;  1H95 A;  2L15 A;  3H15 A;  5C0X I;  4POF A;  2FJ2 A;  2NTT A;  4V19 0;  2DGY A;  2WV6 D;  1J9O A;  2NZH A;  1SYG A;  3T13 A;  2JA7 H;  3RLF A;  1VQJ A;  4RKB A;  1J5E L;  3JAM L;  1D2B A;  5I9O A;  4NPS A;  4DR2 L;  4LF5 L;  2EYL A;  1PXU A;  5M5Y H;  1VMP A;  2I5H A;  1QB5 D;  3PIO 3;  1UE5 A;  1NCV A;  5C44 B;  3PO2 H;  5GAD C;  2JJQ A;  2F0W A;  4DR5 L;  4A3K H;  4LF8 L;  4GS3 A;  1STH A;  2GVA A;  3AQQ A;  1D1I A;  3LNN A;  4Q5V A;  4DUY Q;  3HOY H;  4FF3 A;  1WTH A;  1Q90 A;  3SE0 A;  4B3T Q;  1O7I A;  5IYC G;  1N32 Q;  4HIK A;  1IBL Q;  3QIA A;  2B2T C;  1HNZ Q;  4HAE A;  1A2T A;  2NBF A;  1DOM A;  2ZXR A;  3KYH C;  1ONL A;  4ME5 A;  1NBW A;  1F2L A;  2K32 A;  3RLN A;  1DCZ A;  4Y7N H;  2NVX H;  1B1Z A;  2B2W A;  5EJW A;  1X55 A;  2R92 H;  2NN6 I;  5LMN Q;  2MO1 A;  4FF2 A;  2EY5 A;  5C3X A;  2JA9 A;  4DV6 L;  1AW7 A;  1SYE A;  4C3J B;  2IPK D;  5CGK A;  2A69 C;  1GHJ A;  1YVC A;  3I2Z A;  1PYS B;  1IBL L;  2A8V A;  3TQY A;  3HOZ B;  2B29 A;  5E4W C;  1WTX A;  3CRK C;  3CCE A;  2AUJ D;  4JK1 C;  3IKJ A;  3MXU A;  2JK8 A;  3RLO A;  4LF8 Q;  1AEX A;  4RGT A;  2VQF Q;  3PQI A;  4ZQ3 A;  4K5W A;  1K28 A;  1TWH B;  1LT6 D;  2JA6 B;  3M3Y H;  3I8Z A;  4U67 3;  4R4C A;  2Q2U A;  1GXD C;  3U9S A;  4KD3 A;  1A2U A;  1A8V A;  1S3O A;  5IP9 H;  3C1F A;  1VQ4 A;  4RGO S;  5ELE A;  5M3M H;  1KQS A;  1QCB D;  3QOL A;  3OIP A;  4DNR B;  4KMU C;  3H3V C;  3T1H Q;  1QUQ B;  3SDZ A;  2FFK B;  2Q2I A;  3TEH B;  1WCM H;  1Y8P B;  3P1H A;  1RCV D;  3GTK B;  1S5D D;  2B2W C;  2CQO A;  3NBI A;  4B3R Q;  2H1E A;  2XTI A;  3L9A X;  4DF7 A;  5LMU Q;  1LT5 D;  1DZ1 A;  3BZK A;  2FMC A;  4AQY L;  3W2D A;  3LX0 A;  1EQV A;  2PPB C;  3WOE A;  1R9T B;  4IFD I;  5L37 A;  3RUZ A;  4QL5 A;  3EVQ A;  1I6H H;  4OO1 H;  1ESR A;  2Q8I B;  2OCE A;  5ELN A;  4ALP A;  4A3B H;  1Y1V G;  1EQQ A;  1XX8 A;  4JI4 L;  1PTO H;  4B3R L;  1XNR L;  4CGY B;  4K6D A;  1L1O B;  1HR0 Q;  3PCO B;  1KL9 A;  2D2C C;  4DN4 M;  4IFD J;  2LSS A;  2XGT A;  5CBA E;  2PZT A;  3CME A;  2KJX A;  4JYA L;  1TWA B;  5M5W B;  4TQU S;  2RDG A;  4ID6 A;  2JA8 H;  1WD0 A;  1YIT A;  4CDF C;  2PMZ E;  1PFM A;  4F7X A;  3FKI B;  2VUM H;  2JA6 G;  4QQB X;  4DXF A;  1CKN B;  1K3R A;  3GV6 A;  2VQF L;  2RVL A;  1O7L A;  4NXN L;  3V05 A;  1B70 B;  2A74 C;  1MJE A;  1TWC B;  1RHP A;  1BCP B;  1SE4 A;  2R7Z H;  1OO9 B;  2EE1 A;  3M4O H;  3GTM B;  1EY7 A;  2M2L A;  4WOR A;  5FLX L;  4DV6 Q;  5CMD A;  4A3F B;  1YJN A;  4KJN A;  1K9M C;  4B3M L;  4IOA A;  5C3E B;  1EFI D;  1UAP A;  2L0C A;  3I4M H;  1TY2 A;  2DUD A;  3KDF B;  1RKN A;  1BO0 A;  3EBE A;  4YCW A;  1JOR A;  2F0K A;  2R93 G;  1FD7 D;  1PTO D;  5IYC H;  2N78 A;  2WP8 J;  3C2P A;  4LUZ A;  1BBU A;  2HCI A;  1D8L A;  3CPW A;  1EIY B;  1EIH A;  2E5L L;  1CKM A;  1CZG A;  3NEN A;  4GZY C;  4OIK A;  3CCL A;  4A3E H;  4B3T L;  1N32 L;  4TSS A;  4DUY L;  3JAM E;  3F2D A;  2E8G A;  2EJF C;  2OF1 A;  2FHT A;  3NSW A;  4JI7 Q;  2EYF A;  2BA0 A;  1W3S A;  3I4M B;  1OXT A;  1YZ6 A;  5C3E H;  2ZTD A;  4M1U B;  1NNX A;  3FKI G;  3GTM H;  1M90 C;  3EJI A;  4LJZ C;  3M4O B;  3MZ5 A;  3T1Y L;  3U58 A;  3MEH A;  3JC6 6;  5IIF A;  4CBV A;  1STB A;  3VYT A;  1VQ7 A;  4DR2 Q;  4LF5 Q;  1SNC A;  3M4Q A;  1SRU A;  1F9R A;  4BWG B;  1JMC A;  3G48 A;  3JAM i;  1U4L A;  1QIL A;  2CW0 C;  1PFB A;  1UNS A;  4JV5 Q;  2A68 D;  3RN5 A;  1CKN A;  1GUW A;  1EYD A;  4DK1 A;  3BJU A;  4FF4 A;  3I4N G;  3HOX G;  2ZXO A;  2JA8 B;  3G6J B;  2JXM B;  3VYS A;  3OTO L;  3KJO A;  4K2K A;  2E76 C;  1N36 Q;  1F9S A;  1UEA B;  4X3T A;  2EYO A;  1TII D;  2HHH L;  1EOV A;  1PTO B;  3T51 B;  1KNA A;  4RHR A;  3NEL A;  4ODG A;  2X6G A;  4K6L A;  4UPA A;  2BCO A;  2F0T A;  3S1Q B;  3E9I A;  1X65 A;  4JVZ A;  5M3F B;  1UE7 A;  4QIW E;  1AZP A;  1XMO Q;  1X3P A;  2C5C A;  4O1N A;  1HUN A;  1TS2 A;  2WB1 G;  1I94 L;  1G2T A;  4ZK9 B;  1DXM A;  3OOC A;  3D4D A;  5A2Q L;  1RL2 A;  4B9X A;  4GNX C;  3TP8 A;  1PRT C;  1VQ5 A;  4OX9 L;  2UXB L;  3GTK H;  4RCO A;  2QW7 A;  1WCM B;  2WAC A;  1PVO A;  2J4X A;  1VQD A;  2K33 A;  4KKT A;  3ND9 A;  4OON A;  1IW7 C;  3ND8 A;  3S16 B;  1T5X D;  1B9M A;  1LTA D;  5M3M B;  2F0S A;  3KLW A;  2L4N A;  3PV0 A;  1ZXT A;  1V1O A;  1JWU D;  5A2Q E;  3GTO B;  3ERQ A;  4R9W A;  2E2I H;  1R4Q B;  1F2Z A;  2OEO A;  2NYZ D;  2JA6 H;  4ZUJ A;  2A68 C;  3J80 E;  4PMW A;  3STB D;  3HG9 A;  1AZQ A;  2P5Z X;  1LTS D;  4IZ8 A;  1STY A;  3PIP A;  2EVB A;  2PZW A;  1H9J A;  5EGT A;  5CBE E;  1WTQ A;  1QNK A;  3D31 A;  3HGB A;  2EY2 A;  2XIW A;  1Z9F A;  2Y0S E;  1UUP A;  3H3V H;  1EWI A;  1VQC A;  2ZTC A;  4PZ6 A;  3DWP A;  1IBK Q;  1A15 A;  1H9K A;  1I4P A;  1Q1E A;  1XTD A;  2MUY A;  3DWQ A;  2XVS A;  3I3C A;  3S14 B;  1A3T A;  4Y7N B;  1KC8 C;  2F4V Q;  3U4Z A;  2D0O A;  2YU9 H;  2VS1 A;  4GN4 B;  1HZA A;  4Z9C B;  2ICI A;  1X3G A;  4OEM B;  1XMQ Q;  1D1K A;  1DGS A;  4RG1 A;  3A7L A;  1G51 A;  2EYP A;  4GLA C;  5JEA H;  2K4K A;  3HOY B;  4DR6 L;  3UE1 A;  1VQB A;  2IHF A;  1F2Y A;  3J7A V;  2M9V A;  1NSN S;  1PRT B;  1WTP A;  1UE1 A;  2D5D A;  2RCN A;  4A3K B;  5C3E G;  2DN8 A;  2TMP A;  1HTL D;  3C46 A;  1CK1 A;  1HJP A;  1IBM Q;  3UDG A;  3TS0 A;  5C44 H;  3PO2 B;  1BDO A;  1S5E D;  2VB2 X;  3S1M H;  2KUM A;  3MC0 B;  5M5Y B;  1PRT D;  1V1P A;  2AUK A;  3Q24 A;  1GHK A;  3DM1 A;  4OO1 G;  3D4R A;  1MGS A;  4NMZ A;  1ZKO A;  3HOU G;  1D5Z C;  1Y1W G;  4IPD A;  2PQA B;  2LS0 1;  3E9H A;  1IYV A;  2VUM G;  1MSH A;  2ZXP A;  5BR8 L;  3I4N H;  4XDX A;  1LAC A;  2DNC A;  3D3R A;  2C9O A;  2JA5 H;  2L12 A;  5C4X B;  2AWO A;  1KRT A;  4HCE A;  3I73 A;  1HZ9 A;  3I4O A;  1PH8 A;  3PO3 H;  1XPO A;  1PLF A;  3H91 A;  1YHQ A;  3P20 A;  2GVB A;  3CHB D;  3BVM A;  4ZLT F;  3MAQ A;  3C3L A;  1PYB A;  2F4I A;  1QG7 A;  3I56 A;  3J7A F;  4RGM A;  4X66 L;  4A3M B;  4IUV A;  3DXJ C;  1MD2 D;  3W1G A;  3P7J A;  5GQO A;  4L5Q A;  3MXG A;  4LF4 Q;  3FVQ A;  3NTH A;  2SOB A;  3PSI A;  4IO9 A;  4GKK L;  1I4H A;  3L0O A;  4EQN A;  1ZEQ X;  1XNQ Q;  4DAY A;  4EX5 A;  2UXD Q;  2RHQ B;  3L7Z C;  2NVY H;  4J6H A;  5DM6 3;  4UDU C;  3X3N A;  3D0F A;  3S2H B;  3FDT A;  1X9N A;  5KYL A;  4ILW A;  5IYD H;  3A8I E;  4I65 A;  1GM5 A;  2HQE A;  5K36 G;  1GUN A;  1Z6H A;  1EEI D;  1SFO B;  1PH7 A;  1WYD A;  4GN5 A;  2IJ0 A;  4NW2 A;  1WD1 A;  4RCN A;  4BBS G;  5CV6 A;  4DV3 L;  1L0Y B;  1UE6 A;  2DY8 A;  3CKI B;  4EGV A;  5FLX c;  4FXD A;  2CCZ A;  4A3I G;  1EUJ A;  1SNQ A;  4KHV A;  1N33 L;  1EOT A;  3R93 A;  4LW1 A;  1S5F D;  4A3C G;  1D7Q A;  4JI8 L;  2H5X A;  2SNS A;  5JEA J;  5J3B A;  2B2V C;  1KDC A;  3H09 A;  3CQZ H;  5HY6 A;  4HR7 B;  4DV7 L;  3DLL A;  2F0V A;  4JI8 Q;  4CDC C;  5EKL A;  5ELB A;  3UE0 A;  1GKH A;  1SND A;  3S1N B;  1QNU A;  3MEF A;  3TP7 A;  3PIP 3;  1Q81 C;  4ZKC B;  1LV9 A;  2XNA C;  3OIQ A;  3A8K E;  1WI5 A;  3J81 i;  1TU2 B;  4N8F A;  1DON A;  2AQ3 B;  4JOI A;  2E2H B;  1GUG A;  4B3S L;  3ICE A;  1EL0 A;  4XQQ A;  1YHB A;  1PFS A;  2EYH A;  4B08 A;  2EYM A;  2K52 A;  2Z6K C;  3MA2 B;  1TWF B;  2F0L A;  4JI5 Q;  3F2C A;  3KJP A;  1BUV T;  3PGZ A;  4IQZ A;  4DK0 A;  4PG3 A;  4Y52 H;  3RNU A;  1I50 H;  1U0L A;  1K0R A;  4A93 B;  3KK7 A;  5LHY 1;  3TZU A;  4DV1 L;  1G2S A;  1JQY D;  2G9D A;  2KEN A;  1Q46 A;  4H13 C;  4J1M A;  1BBX C;  3OHX C;  4CKE A;  4DA2 A;  5IGD A;  1OXU A;  1XNQ L;  2KVM A;  2K5D A;  3RMH A;  3NWS A;  5JJK A;  3HKZ B;  4EQP A;  1SBB B;  2UUA L;  3TS2 A;  1FNU A;  4DAV A;  3TME A;  1C8C A;  1VQ8 A;  1OXX K;  1YJ9 A;  4BBR B;  5J39 A;  4H02 A;  2UUB L;  1OXS C;  5FO8 B;  5JAV A;  1Y14 B;  3GTL H;  2JA5 G;  1L1O A;  2PMZ B;  1DD2 A;  1UWV A;  2L1B A;  2UUB Q;  1Y1V H;  1B44 D;  3S2D H;  1AE2 A;  4OWX B;  4GOP C;  1VQG A;  3GTP B;  2B3G A;  1JC7 A;  1PFN A;  1G29 1;  2UUA Q;  4PQX A;  1SMX A;  1DYQ A;  2RDF A;  1TY0 A;  3HRZ C;  4LUO A;  1LT4 D;  3CW2 C;  1NAP A;  2Q8T A;  1V43 A;  4H44 C;  1PV4 A;  1L0W A;  1GUS A;  2G5D A;  4NXM L;  3VDY A;  3FEW X;  4QUC A;  3SGI A;  5I9P A;  5JJZ A;  2EXZ A;  1EU3 A;  3R2T A;  3CCM A;  2X6L A;  1PH1 A;  5CV7 A;  4JI3 L;  2WB1 B;  4JI2 Q;  4A3D H;  4JI5 L;  2SEB D;  3GTJ B;  3I72 A;  5IE8 A;  4N9P A;  3M7N A;  3R2I A;  3HOW G;  4A76 A;  2EY1 A;  2BDN A;  4AH6 A;  5IYD G;  4A75 A;  5EBD A;  1EYC A;  2OXP A;  3IL8 A;  5JVH 3;  1A3U A;  2ATW A;  1CTM A;  4KHP Q;  1BR9 A;  2NUC A;  3KOJ A;  2JYO A;  4X3U A;  4K2L A;  1TXY A;  2HT1 A;  4EQ5 A;  4QGU A;  2WAQ E;  2PNR C;  3MHB A;  2I07 B;  1YNN D;  3GO5 A;  4RFB A;  3RZO B;  4POG A;  1FVI A;  4C3I H;  1LUZ A;  3CC4 A;  1SAP A;  1HCZ A;  1VQN A;  1EY0 A;  4XQN A;  4X65 L;  1YNN C;  1TWG H;  5C6A A;  1WOC A;  3PMF A;  2EPB A;  3GTQ H;  1VQE A;  3A74 A;  1ENC A;  4LF9 Q;  1S40 A;  4FDB A;  2WAQ B;  1CZW A;  1EYA A;  2L55 A;  2NZ1 D;  2R7D A;  3MTS A;  4FXG C;  3EN2 A;  3HOX H;  1JB7 A;  5DAU A;  4DV0 Q;  4BY7 G;  2WII B;  3BDL A;  4K0K L;  4BXX G;  2JA7 G;  2K5Q A;  4BY1 B;  1E2V A;  4DKA C;  2F3I A;  3URY A;  3L2P A;  2UXD L;  4JC0 A;  1JE5 A;  4GKK Q;  4DNI A;  2WKC A;  3Q8D A;  2PW5 A;  2Z6K A;  3PO2 G;  2M00 A;  1ENF A;  5C5L A;  1SNP A;  4KD4 A;  2Q8R E;  4OGQ C;  1K83 H;  2UUC Q;  2B2U A;  4A3G B;  1JB3 A;  4JI6 L;  3K59 A;  1E2W A;  1JOO A;  1WVL A;  4A3F G;  4FF1 A;  3LWU A;  1QVF A;  4JBJ A;  4LK1 C;  1LLR D;  3KLS A;  1MSG A;  1V1Q A;  2F52 A;  1I94 Q;  2A73 B;  2ZM6 L;  4LNQ A;  3HOW B;  1IL2 A;  2XRS D;  3MFG A;  4H7B A;  2B63 H;  3AMU A;  3U50 C;  4RHS A;  5FO9 B;  3K81 C;  2LMC B;  1ROD A;  3HS0 C;  5IP7 H;  1KLG D;  1SLJ A;  3VR5 A;  3BDO A;  4A3I H;  2IT1 A;  1CKO A;  2K28 A;  2ZJQ A;  3MXP A;  2OT2 A;  4C3J G;  3CCU A;  2I5M X;  5K36 H;  1SXT A;  4WRD A;  3F1Z A;  4YHH Q;  2UXC Q;  1PMR A;  2AKW B;  3T53 B;  1PH4 A;  1VQH A;  2L9H A;  4R1J A;  5EKK A;  1HXY D;  4DXG A;  3OTO Q;  1W6J A;  3ZYY X;  1SNM A;  2A69 D;  3OPO A;  5CV8 A;  4L5T A;  2CQA A;  5HGQ A;  5BN5 A;  1ICW A;  5KNC A;  1NR2 A;  3A54 A;  4O42 A;  1KDA A;  3QO2 A;  4N8X 1;  1LT3 D;  1IBM L;  2EQS A;  3HFZ B;  3M85 A;  4C3H H;  3RR5 A;  2E2D C;  4KY7 A;  3J7Z C;  4S3S A;  1E1O A;  4FVM A;  3D6C A;  3HKS A;  2WIN B;  3CPF A;  5M5X B;  3E3X A;  1PHJ A;  1LTG D;  4A3L G;  2VL6 A;  2PO4 A;  4GNX B;  1SJH D;  3S1R H;  3K7U C;  3J7Y W;  4JW0 A;  1L0X B;  3DMU A;  4ULL A;  2F1M A;  3K5M A;  4V0B A;  2IY5 B;  4IPH A;  2KED A;  4NP5 A;  4F88 A;  2NVT H;  1BBW A;  4GNX A;  4JI7 L;  2F4V L;  1B50 A;  4XIG S;  4BY7 B;  3R3O A;  1VQF A;  2F3W A;  1K8O A;  2KHJ A;  1IBK L;  1EU4 A;  1IW7 D;  5E1F A;  4FO2 A;  3NTK A;  5JJL A;  1LTT D;  1BCP C;  3KDF A;  3FRP B;  5LL6 S;  4DUZ L;  3DEO A;  3LGJ A;  5D65 A;  3NQI A;  4PZ8 A;  4AYB E;  2NZO A;  4DR4 L;  5KNB A;  4KHZ A;  3U9O A;  3SXH A;  5C0X G;  3F8T A;  1PH2 A;  2F0I A;  4DR3 L;  4R4O A;  5J22 A;  4R8I A;  1IYU A;  2D0P A;  3BU2 A;  3PUW A;  1O78 A;  1B9N A;  1EY4 A;  1KIX A;  1PH6 A;  1A6X A;  1CUK A;  1X3E A; 
#chains in the Genus database with same CATH homology
 5E4X A;  2F0H A;  3DWA A;  1EZ6 A;  3S15 B;  3P75 A;  1CM9 A;  1LTB D;  4ZUI A;  2MGS A;  3SK6 A;  3K57 A;  3MWY W;  4PV1 C;  1QOH A;  3HOU B;  2BDO A;  4K8I A;  3VA7 A;  2F0F A;  1PZK D;  3RZD B;  1SNO A;  2VNU D;  4CJ2 C;  1TR5 A;  3H6M A;  5AFW A;  2AQ2 B;  2K03 A;  4IUR A;  5G3L D;  1MBY A;  4L6T B;  3KLR A;  1EY6 A;  5CYU A;  1WTO A;  1CQV A;  4RWS C;  3M4Y A;  2O5I C;  3OMC A;  3K5N A;  2XWJ B;  1BCP D;  4MN3 A;  3OWF A;  4BBS B;  5IOD A;  1ET9 A;  2IX1 A;  4R8N A;  3BVG A;  2O4X A;  2EZV A;  2F03 A;  2QEJ C;  3NHH A;  3NUC A;  1GUO A;  1GOZ A;  4CHT B;  2K01 A;  1ENA A;  2Z4I A;  4KN4 C;  1BCP F;  4MIU A;  2LFN A;  5CR3 A;  1ILP A;  3KUP A;  1C48 A;  3NQT A;  3Q23 A;  3J81 L;  4HSP A;  3OWE B;  1E2Z A;  1HPC A;  2H4O A;  1EWC A;  4KV6 A;  3VR4 A;  5IGF A;  3IFD A;  2A6E C;  4K5X A;  4IUT A;  1RTN A;  4NDX A;  2F0J A;  4OO1 I;  1M4V A;  1ILQ A;  4G7H C;  3PUY A;  3GD7 A;  4RA8 A;  1SYC A;  3W3A A;  2K7V A;  1FR3 A;  3A7A B;  1BF4 A;  1D6E C;  1RDP D;  1I4R A;  1Y1W B;  4FYD A;  3H0G B;  5I6W A;  4HSV A;  4DU9 A;  4OHJ A;  3S1R B;  2QCP X;  1IL8 A;  1JWS D;  4KI0 A;  4RKL A;  1STG A;  2MHV A;  1WTR A;  4EQO A;  2XRQ D;  3KLS X;  2HDM A;  4F8M A;  4C3H B;  1SYF A;  4HMI A;  4DNT B;  2J0T D;  5F2D A;  4OL7 A;  1I4X A;  1EY9 A;  2F0P A;  1YNJ C;  5CV5 A;  1LO5 D;  2B8F A;  2A6E D;  2X69 A;  1SYB A;  1H9M A;  5KYI A;  2ID0 A;  2KOL A;  1YNJ D;  1U9R A;  1HFG A;  3OW7 A;  1SDF A;  1IHZ A;  2B63 B;  2PYK A;  2VB3 X;  3MFY A;  3TZD A;  5C4Z A;  4M8A A;  1B2T A;  2N88 A;  3WDN A;  4KK7 A;  4DAP A;  1JOK A;  2B2Y A;  3GP7 A;  3BZD B;  4C3H G;  1O7Z A;  4A3J B;  1C4Q A;  3ITP A;  2E2J B;  3MXN A;  2Z4H A;  1BQQ T;  1XWE A;  3VYU A;  3IFT A;  5I6Y A;  4XXE A;  5JPN C;  2R93 B;  1KAA A;  1CI3 M;  1EY8 A;  5EKI A;  1HUM A;  4C3I G;  4KKS A;  1S5B D;  3TDQ A;  4OIJ A;  1SE2 A;  3K5L A;  3GTQ B;  2LKV A;  2B2Y C;  5C0X H;  1PDQ A;  1TWG B;  1O7Y A;  5EPL A;  5T1G A;  2QIL A;  3SK5 A;  2R61 A;  3EA6 A;  3BYT B;  4RGN A;  4CKB A;  2VXW A;  5KIX A;  2LY7 A;  1LTI D;  1PZJ D;  3D8G A;  1AP0 A;  1VF7 A;  4H0L C;  2RSO A;  5KGU A;  2K04 A;  3PUV A;  4AYB B;  4PNY A;  1Q3L A;  2IX3 A;  3Q0A A;  5KRU A;  4E6I A;  3ONA B;  4FNF A;  4TKO B;  2ENB A;  3RD4 A;  3KBX A;  3X3M A;  1CHQ D;  1ESF A;  1PZI D;  4RH6 A;  1VCI A;  3KBG A;  1CQF A;  1B3A A;  5J1Z A;  1SMY C;  1TQO A;  3IAY A;  2DY7 A;  1KTK A;  1HTP A;  4ABN A;  4WFN 3;  1F9Q A;  3S2D B;  1W6K A;  2IW3 A;  3GTL B;  1KNE A;  2N55 A;  3J81 E;  5FO7 B;  2FMM A;  1M8A A;  2F0N A;  1BXT A;  2YYZ A;  4XT3 B;  4BS9 A;  3QJY A;  2AWN A;  1CA5 A;  5FKA C;  4KTA A;  1OXV A;  3SHL A;  1G6Z A;  1I6V C;  4RAU C;  1JCK B;  3I90 A;  3T16 A;  4WJW A;  4FXK C;  2F0U A;  4CJ0 B;  4LMQ D;  3NTI A;  3E5S A;  1MI2 A;  1Z47 A;  4QIW B;  2RKS A;  1D5M C;  2JEB I;  1BNZ A;  1HFN A;  2SNM A;  1I50 B;  1I4G A;  5JEA G;  3S9W A;  3H94 A;  2E74 C;  2K1B A;  5C0X J;  2MP1 A;  2O5J C;  1FGB D;  3UI2 A;  5C4H A;  2KEE A;  5FOB B;  3V2T A;  4DGZ A;  2JEA I;  1PTO C;  1VF5 C;  3GQB A;  2SDF A;  4P2C B;  1STA A;  3I70 A;  1U4R A;  5D3D A;  5G3L F;  1EZ8 A;  2HUG A;  1ZYR D;  3K7A B;  2F0G A;  5ELF A;  4IUQ A;  2Y0S B;  2EYJ A;  5HUR A;  1I4Q A;  1HHV A;  1I3Q B;  5C5M A;  2Z8L A;  1GUT A;  1T5E A;  5DM7 3;  3OMG A;  1G91 A;  5COY A;  2HCC A;  1TVX A;  3I4L A;  5DNF A;  4IFD G;  1JE4 A;  5D14 A;  1B53 A;  1EY5 A;  4KKU A;  4KY6 A;  3VR3 A;  3Q22 A;  1CA6 A;  4CKC A;  1JWM D;  4MHE A;  2NVY B;  1G8Z D;  1S4Z A;  3K0Y A;  4QUF A;  3BG3 A;  2NVQ B;  2A5H A;  4XTC S;  4K8J A;  1SJE D;  2F0M A;  2PCF B;  5DEH A;  5M9O A;  4NKL A;  2NN6 G;  3QB3 A;  1HQR D;  5C4J B;  2B2U C;  3I91 A;  4IUN A;  2EJM A;  4YIJ A;  3CRL C;  3PO3 B;  3HP3 A;  2B2T A;  4G4K A;  3J80 L;  1IKL A;  2O2L D;  3BVZ A;  1TKW B;  5A35 A;  3T56 B;  3EFX D;  4KY5 A;  3I4N B;  1XYI A;  3HEJ A;  3S17 B;  1HA6 A;  3A8J E;  2J7Z A;  1EEF D;  1DJR D;  4QF4 A;  1S5C D;  1TT2 A;  1TS4 A;  2NWG A;  1V1P B;  3PUX A;  5IOC A;  1ZYR C;  2WKD A;  2KEC A;  1BOS A;  3N6R A;  3S1M B;  5LL6 X;  1F77 A;  3NP8 A;  5C3W A;  3OSO A;  5COR A;  3A55 A;  3NE5 B;  3ERO A;  1TS5 A;  4HTH A;  3NBH A;  5CV9 A;  1HQM C;  5JOB A;  2HDL A;  2K6A A;  4XQJ A;  1V8Q A;  2K05 A;  4IUU A;  3NPP A;  2YU9 B;  1WTV A;  2NVT B;  3K5O A;  3SK8 A;  2F3V A;  2EJG C;  1CHP D;  5NUC A;  2Z1C A;  3SVM A;  4XT1 B;  5IT9 E;  1GJX A;  3MVV A;  1EQT A;  1X32 A;  4F87 A;  4G7Z C;  1STE A;  4QMG A;  1NUC A;  2KQ3 A;  1TS3 A;  2PW7 A;  2EDG A;  4ZYS A;  2RA4 A;  2ZT9 C;  1A3V A;  2NTS A;  2R3Z A;  2I46 A;  2E2I B;  4QCL A;  4HED A;  3VYR A;  4X3K A;  4N9T A;  1B4O A;  3NK9 A;  4EVO A;  1RJT A;  1QJO A;  3C1E A;  1QE6 A;  1Q1B A;  4A3I B;  4HCS A;  1SEB D;  2QKI C;  4KJO A;  3VR2 A;  1D5X C;  1IKM A;  3M7G A;  4C56 C;  1JIC A;  1ET6 A;  1FNV A;  1RD9 D;  1H9R A;  3NXW A;  3A56 A;  1K83 B;  5I2Y A;  5IGE A;  2D62 A;  4X3S A;  1K8M A;  1STN A;  5I4D A;  1E0B A;  1PTO F;  5EPJ A;  2KCC A;  5BN3 A;  4DFA A;  1JR0 D;  1Y8O B;  2CW0 D;  3N52 A;  4PMB A;  1AFP A;  1XXG A;  2IWH A;  2PQE A;  2XN9 C;  3HOX B;  2RBM A;  3E6Z X;  2KHS A;  4TRD A;  2RSN A;  4JBW A;  2ICE C;  2RQX A;  5K5P A;  5T1I A;  3O13 A;  3QWN A;  4ZRZ A;  1H9S B;  4A3E B;  3QOJ A;  5KND A;  4PMC A;  3L3O C;  3D4W A;  4C3I B;  1Z7T A;  3NWT A;  1KLU D;  1ML0 D;  5CV4 A;  5I2X A;  5D3I B;  2KA7 A;  5FK9 C;  3TP5 A;  2NN6 H;  4G7O C;  1JOQ A;  4Q0F A;  5E3F A;  2R7Z B;  1VMC A;  4HN7 A;  5EPK A;  4HMJ A;  3WOF A;  2TSS A;  4QB4 A;  3PUZ A;  3FPU B;  3FMC A;  1SYD A;  2RDH A;  3K58 A;  4A3D B;  2K5W A;  1EWH A;  2A6H D;  1Y69 U;  2L11 A;  1RF2 D;  1DOL A;  3HZX A;  2VUM B;  5BN4 A;  3DHQ A;  2B39 A;  3V96 A;  1U4M A;  5EQ0 A;  1O80 A;  1Y8N B;  2NB0 A;  3BYY B;  3SK4 A;  1DM0 B;  2F0E A;  2IX0 A;  1LAB A;  4KN7 C;  1PRT F;  4CJ1 B;  5EBC A;  5IGG A;  1U4P A;  4U68 A;  5IT9 L;  1NR4 A;  4A3B B;  1Y1V B;  4XYO A;  4ZAI A;  1I6H B;  5IGC A;  5ELD A;  1Q12 A;  5HGT A;  4K5V A;  5TSS A;  2G9H D;  2QF7 A;  4ZKB B;  1HA5 A;  4K14 A;  2KCN A;  3TP6 A;  3TN2 A;  3E0J A;  4L63 B;  2JSO A;  5FLX E;  1WTW A;  2JE6 I;  1VDZ A;  2PZU A;  3M3Y B;  2AQ1 B;  2F0D A;  1F2M A;  4UAI A;  4L8J A;  3D6W A;  5JPM C;  2BE5 D;  1CT1 D;  2B2V A;  2A6H C;  5ELC A;  3T4A C;  4C1N K;  2FIN B;  3KF8 A;  2L5T A;  4G57 A;  2F0Q A;  2DNE A;  2R92 B;  2BE5 C;  3CQZ B;  2NVX B;  3G7L A;  1H9S A;  3DEP A;  4LAA A;  2GA4 B;  1AN8 A;  1FNW A;  1F9P A;  1HRJ A;  3K6O A;  4FP5 D;  2D9U A;  1PYW D;  4IUP A;  2B8G A;  3R8B A;  2MJ8 A;  4I7Z C;  1QWY A;  2CVR A;  1EIG A;  2F0O A;  5CC4 A;  3TBI B;  2EOT A;  2V4D A;  3VA5 A;  4IFD H;  3QG1 A;  1SMY D;  2E75 C;  3LWE A;  2JA7 B;  3SR1 A;  3VR6 A;  2BOS A;  4IN3 A;  1X3Q A;  3FPP A;  4C1N I;  3Q6S A;  3TSS A;  1J8I A;  3BS1 A;  2JP1 A;  2EY6 A;  1KAB A;  3BDC A;  4IAL A;  4BA1 I;  1DOK A;  3AB9 A;  3CU7 A;  1KDB A;  2QDB A;  5IGB A;  1FYC A;  1SSO A;  2IL8 A;  5JVG 3;  1SE3 A;  5ISR A;  3GTG B;  1Q8I A;  5KEE A;  3EQL C;  1II3 A;  3HOV B;  1LTR D;  3AU7 A;  2MPM A;  2R6G A;  1RTO A;  1CFM A;  2CHB D;  3DUZ A;  4BA2 I;  3GV3 A;  3F2U A;  4XYQ A;  2BA1 A;  2JA5 B;  4B9W A;  3SEB A;  4J8Q A;  4C2M B;  1R4P B;  1XTC D;  2XSC A;  2XWB B;  5C0X I;  2FJ2 A;  2NTT A;  4V19 0;  2WV6 D;  1J9O A;  3T13 A;  1SYG A;  3RLF A;  4RKB A;  3JAM L;  1D2B A;  5I9O A;  2EYL A;  1PXU A;  1VMP A;  1QB5 D;  3PIO 3;  1NCV A;  5C44 B;  2F0W A;  1STH A;  1D1I A;  3LNN A;  4Q5V A;  4FF3 A;  1Q90 A;  3SE0 A;  3QIA A;  2B2T C;  4HAE A;  1A2T A;  2NBF A;  1DOM A;  2ZXR A;  1ONL A;  4ME5 A;  1F2L A;  2K32 A;  1DCZ A;  1B1Z A;  2B2W A;  5EJW A;  2NN6 I;  4FF2 A;  2EY5 A;  5C3X A;  1AW7 A;  1SYE A;  4C3J B;  2IPK D;  5CGK A;  2A69 C;  1GHJ A;  3HOZ B;  5E4W C;  1WTX A;  3CRK C;  2AUJ D;  4JK1 C;  3IKJ A;  3MXU A;  1AEX A;  4RGT A;  4ZQ3 A;  4K5W A;  1TWH B;  1LT6 D;  2JA6 B;  3I8Z A;  4U67 3;  1GXD C;  3U9S A;  4KD3 A;  1A2U A;  3C1F A;  4RGO S;  5ELE A;  1QCB D;  3QOL A;  3OIP A;  4DNR B;  4KMU C;  3H3V C;  3SDZ A;  2FFK B;  1Y8P B;  3P1H A;  1RCV D;  3GTK B;  1S5D D;  2B2W C;  3NBI A;  2H1E A;  3L9A X;  4DF7 A;  1LT5 D;  1DZ1 A;  2FMC A;  3W2D A;  3LX0 A;  1EQV A;  2PPB C;  3WOE A;  1R9T B;  4IFD I;  3RUZ A;  3EVQ A;  4OO1 H;  1ESR A;  2Q8I B;  1XX8 A;  1PTO H;  4CGY B;  4K6D A;  2D2C C;  4DN4 M;  4IFD J;  5CBA E;  2PZT A;  2KJX A;  1TWA B;  5M5W B;  4TQU S;  2RDG A;  4ID6 A;  1WD0 A;  1PFM A;  4F7X A;  3FKI B;  4DXF A;  3GV6 A;  2RVL A;  1O7L A;  3V05 A;  2A74 C;  1TWC B;  1RHP A;  1BCP B;  1SE4 A;  1OO9 B;  2EE1 A;  3GTM B;  1EY7 A;  2M2L A;  4WOR A;  5FLX L;  5CMD A;  4A3F B;  4KJN A;  5C3E B;  1EFI D;  1UAP A;  2L0C A;  1TY2 A;  1RKN A;  1BO0 A;  1JOR A;  2F0K A;  1FD7 D;  1PTO D;  2WP8 J;  3C2P A;  2HCI A;  1EIH A;  1CZG A;  4GZY C;  4OIK A;  4TSS A;  3JAM E;  2OF1 A;  2EJF C;  3NSW A;  2FHT A;  2EYF A;  2BA0 A;  3I4M B;  1OXT A;  4M1U B;  3M4O B;  3EJI A;  4LJZ C;  3MZ5 A;  3MEH A;  5IIF A;  4CBV A;  1STB A;  3VYT A;  1SNC A;  1F9R A;  4BWG B;  1U4L A;  1QIL A;  2CW0 C;  1PFB A;  1UNS A;  2A68 D;  1GUW A;  1EYD A;  4DK1 A;  4FF4 A;  2JA8 B;  2ZXO A;  3G6J B;  2JXM B;  3VYS A;  4K2K A;  2E76 C;  1F9S A;  1UEA B;  4X3T A;  2EYO A;  1TII D;  1PTO B;  3T51 B;  1KNA A;  4RHR A;  4ODG A;  2X6G A;  4K6L A;  2BCO A;  2F0T A;  3S1Q B;  5M3F B;  1AZP A;  1X3P A;  2C5C A;  4O1N A;  1HUN A;  1TS2 A;  1G2T A;  4ZK9 B;  1DXM A;  3OOC A;  3D4D A;  5A2Q L;  4B9X A;  3TP8 A;  1PRT C;  4RCO A;  1WCM B;  2WAC A;  2J4X A;  2K33 A;  4KKT A;  3ND9 A;  1IW7 C;  3ND8 A;  3S16 B;  1T5X D;  1B9M A;  1LTA D;  5M3M B;  2F0S A;  2L4N A;  3PV0 A;  1ZXT A;  1V1O A;  1JWU D;  5A2Q E;  3GTO B;  3ERQ A;  4R9W A;  1R4Q B;  1F2Z A;  2OEO A;  2NYZ D;  4ZUJ A;  2A68 C;  3J80 E;  4PMW A;  1AZQ A;  3HG9 A;  1LTS D;  4IZ8 A;  1STY A;  2EVB A;  2PZW A;  1H9J A;  5EGT A;  5CBE E;  1WTQ A;  1QNK A;  3D31 A;  3HGB A;  2EY2 A;  2XIW A;  1UUP A;  3DWP A;  1A15 A;  1H9K A;  1I4P A;  1Q1E A;  2MUY A;  3DWQ A;  2XVS A;  3I3C A;  3S14 B;  1A3T A;  4Y7N B;  4Z9C B;  2ICI A;  1D1K A;  3A7L A;  2EYP A;  5JEA H;  3HOY B;  3J7A V;  1F2Y A;  2M9V A;  1NSN S;  1PRT B;  1WTP A;  2D5D A;  4A3K B;  2DN8 A;  2TMP A;  1HTL D;  3C46 A;  1CK1 A;  3PO2 B;  1BDO A;  1S5E D;  2VB2 X;  2KUM A;  3MC0 B;  5M5Y B;  1PRT D;  1V1P A;  2AUK A;  3Q24 A;  1GHK A;  3DM1 A;  4OO1 G;  3D4R A;  1MGS A;  4NMZ A;  1ZKO A;  1D5Z C;  2LS0 1;  1IYV A;  1MSH A;  2ZXP A;  4XDX A;  1LAC A;  2DNC A;  3D3R A;  2C9O A;  2L12 A;  5C4X B;  2AWO A;  4HCE A;  3I73 A;  1PLF A;  3H91 A;  3P20 A;  3CHB D;  3BVM A;  4ZLT F;  3MAQ A;  3C3L A;  2F4I A;  1QG7 A;  3J7A F;  4RGM A;  4A3M B;  4IUV A;  3DXJ C;  1MD2 D;  3P7J A;  3MXG A;  3FVQ A;  3NTH A;  2SOB A;  1I4H A;  4EQN A;  1ZEQ X;  4DAY A;  3L7Z C;  4J6H A;  5DM6 3;  4UDU C;  3X3N A;  3S2H B;  3FDT A;  5KYL A;  4ILW A;  3A8I E;  4I65 A;  2HQE A;  5K36 G;  1GUN A;  1Z6H A;  1EEI D;  1SFO B;  4NW2 A;  2IJ0 A;  1WD1 A;  4RCN A;  5CV6 A;  1L0Y B;  2DY8 A;  3CKI B;  4EGV A;  4FXD A;  1SNQ A;  4KHV A;  1EOT A;  3R93 A;  1S5F D;  2SNS A;  5JEA J;  2B2V C;  1KDC A;  3H09 A;  4HR7 B;  2F0V A;  5EKL A;  5ELB A;  1SND A;  3S1N B;  1QNU A;  3TP7 A;  3PIP 3;  4ZKC B;  1LV9 A;  2XNA C;  3OIQ A;  3A8K E;  1TU2 B;  1DON A;  2AQ3 B;  2E2H B;  1GUG A;  1EL0 A;  4XQQ A;  2EYH A;  4B08 A;  2EYM A;  3MA2 B;  1TWF B;  2F0L A;  1BUV T;  4IQZ A;  4DK0 A;  4A93 B;  3KK7 A;  5LHY 1;  3TZU A;  1G2S A;  1JQY D;  2G9D A;  4H13 C;  4J1M A;  1BBX C;  3OHX C;  4CKE A;  4DA2 A;  5IGD A;  1OXU A;  2KVM A;  2K5D A;  3RMH A;  3NWS A;  3HKZ B;  4EQP A;  1SBB B;  1FNU A;  4DAV A;  3TME A;  1C8C A;  1OXX K;  4BBR B;  5J39 A;  1OXS C;  5FO8 B;  5JAV A;  2PMZ B;  1DD2 A;  2L1B A;  1B44 D;  3GTP B;  1JC7 A;  1PFN A;  1G29 1;  4PQX A;  1DYQ A;  2RDF A;  1TY0 A;  3HRZ C;  1LT4 D;  1NAP A;  2Q8T A;  1V43 A;  4H44 C;  1GUS A;  3FEW X;  4QUC A;  5I9P A;  5JJZ A;  2EXZ A;  1EU3 A;  3R2T A;  2X6L A;  5CV7 A;  2WB1 B;  2SEB D;  3GTJ B;  3I72 A;  4N9P A;  3M7N A;  3R2I A;  2EY1 A;  2BDN A;  5EBD A;  1EYC A;  2OXP A;  3IL8 A;  5JVH 3;  1A3U A;  1CTM A;  1BR9 A;  2NUC A;  2JYO A;  4X3U A;  4K2L A;  2PNR C;  3MHB A;  2I07 B;  1YNN D;  3GO5 A;  4RFB A;  3RZO B;  1SAP A;  1HCZ A;  1EY0 A;  4XQN A;  1YNN C;  5C6A A;  3PMF A;  2EPB A;  1ENC A;  2WAQ B;  1CZW A;  1EYA A;  2L55 A;  2NZ1 D;  3MTS A;  4FXG C;  5DAU A;  2WII B;  3BDL A;  2K5Q A;  4BY1 B;  1E2V A;  3URY A;  2WKC A;  2PW5 A;  2M00 A;  1ENF A;  5C5L A;  1SNP A;  4KD4 A;  2Q8R E;  4OGQ C;  2B2U A;  4A3G B;  1JB3 A;  3K59 A;  1E2W A;  1JOO A;  1WVL A;  4FF1 A;  3LWU A;  4LK1 C;  1LLR D;  3KLS A;  1MSG A;  2A73 B;  3HOW B;  2XRS D;  3MFG A;  4H7B A;  3AMU A;  4RHS A;  5FO9 B;  2LMC B;  1ROD A;  3HS0 C;  1KLG D;  3VR5 A;  3BDO A;  2IT1 A;  2K28 A;  3MXP A;  2OT2 A;  4C3J G;  5K36 H;  1SXT A;  4WRD A;  1PMR A;  3T53 B;  2L9H A;  5EKK A;  4DXG A;  1HXY D;  1W6J A;  3ZYY X;  1SNM A;  2A69 D;  3OPO A;  5CV8 A;  2CQA A;  5BN5 A;  1ICW A;  5KNC A;  1NR2 A;  3A54 A;  4O42 A;  1KDA A;  3QO2 A;  1LT3 D;  3M85 A;  2E2D C;  4KY7 A;  4S3S A;  4FVM A;  3D6C A;  2WIN B;  5M5X B;  1LTG D;  2PO4 A;  1SJH D;  3J7Y W;  1L0X B;  3DMU A;  4ULL A;  2F1M A;  3K5M A;  4V0B A;  2KED A;  4NP5 A;  4F88 A;  1B50 A;  4XIG S;  4BY7 B;  3R3O A;  2F3W A;  1K8O A;  1EU4 A;  1IW7 D;  5E1F A;  4FO2 A;  3NTK A;  1LTT D;  1BCP C;  3FRP B;  5LL6 S;  3DEO A;  5D65 A;  3NQI A;  5KNB A;  4KHZ A;  3U9O A;  3SXH A;  5C0X G;  2F0I A;  5J22 A;  4R8I A;  1IYU A;  3PUW A;  1O78 A;  1B9N A;  1EY4 A;  1A6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...