1JORA

Ensemble structures for unligated staphylococcal nuclease-h124l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
total genus 25
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jorA00
1EY8A 1ENAA 4ID6A 4K14A 3PMFA 3C1FA 3BDCA 4K8IA 2PZUA 2F0UA 4H7BA 3SK8A 3TP6A 3MHBA 5CGKA 3TP5A 4DFAA 1EY4A 3ERQA 1SYBA 4J6HA 5KYIA 4KJOA 2F0SA 1EY9A 1U9RA 2ENBA 4IALA 5DEHA 1II3A 1EY0A 2PYKA 5CR3A 5KGUA 1STGA 2RDFA 4K5WA 1KDAA 2F0IA 5CV6A 4ZUJA 4QB4A 5C6AA 3SHLA 2O4XA 2PZTA 5IOCA 4IZ8A 2EYMA 2F0QA 2WACA 1TT2A 3D4DA 4DF7A 1RKNA 1SYFA 1EZ6A 3QB3A 5I6WA 4RKLA 4KHVA 5C4ZA 2EYOA 4DU9A 2PQEA 1STBA 5CV8A 1IHZA 2EY6A 2EYPA 3RUZA 4K2LA 2F0MA 2EYLA 5HGTA 4K5XA 2PZWA 5IGBA 5IGCA 4K5VA 2F0NA 3T13A 5E1FA 1EYAA 5ISRA 1A3TA 2SOBA 3EROA 5CV9A 5DAUA 5F2DA 5J22A 2F0OA 1F2YA 4K6DA 4B9WA 5I6YA 3DMUA 3MXPA 4ODGA 1ENCA 3SR1A 4B9XA 2F0HA 5KIXA 1SYCA 2F0KA 4NP5A 3TMEA 3U9OA 5J39A 1TQOA 2OEOA 2RBMA 4KV6A 4KY6A 3DHQA 2EYJA 4KJNA 4PNYA 4YIJA 5CV5A 2SNMA 4KY7A 1JORA 3NXWA 3D8GA 2LKVA 5C5LA 4KTAA 4F7XA 5EGTA 4I65A 3QOLA 5JOBA 2NUCA 2QDBA 1EZ8A 3P1HA 5EKKA 3NK9A 4OL7A 1STYA 2F0EA 5CC4A 1SYDA 5HURA 1SNDA 1KAAA 5JAVA 2RKSA 1A2UA 4QMGA 2EXZA 1EY5A 4KD4A 5EKLA 2SNSA 2F0FA 2KHSA 4QF4A 4HTHA 4ME5A 5I9PA 1EY6A 1EQVA 5IIFA 4EQPA 3TP7A 3E5SA 4RKBA 3S9WA 1TR5A 3R3OA 1AEXA 1NUCA 2M00A 4J1MA 4KY5A 3T16A 5CV7A 4F8MA 3NQTA 1JOKA 1EY7A 1STNA 5IGGA 3NP8A 4EQNA 4K2KA 3OMGA 5M9OA 2EY5A 2OXPA 1NSNS 4EVOA 3D4WA 1F2MA 5C3WA 5K5PA 1A3UA 3MEHA 1SNMA 2F0DA 4NMZA 3C1EA 3D6CA 5IGDA 2EY1A 1F2ZA 1SNOA 3TP8A 2F0VA 5C5MA 1STAA 4PMCA 2EYHA 1JOQA 4N9TA 5I9OA 1A3VA 1KDBA 1JOOA 4WRDA 4N9PA 3ITPA 1KDCA 3HZXA 3NHHA 5KYLA 4IUNA 4HMJA 5IGEA 2EY2A 1A2TA 3MVVA 4NKLA 2F3VA 2F3WA 3H6MA 3HEJA 3SK4A 2F0GA 4EQOA 4G57A 2KQ3A 4PMBA 5NUCA 1SNCA 2PW7A 3OWFA 5J1ZA 3EJIA 4ZQ3A 1SNQA 5KRUA 1KABA 3MZ5A 3P75A 3QOJA 1SNPA 3BDLA 4R8NA 5IGFA 4E6IA 3EVQA 2OF1A 3NUCA 1EYDA 2EYFA 5C4HA 5IODA 1EYCA 1SYGA 3OSOA 4K8JA 3SK5A 2F0LA 4NDXA 3VA5A 3V2TA 2F0PA 5E3FA 3OMCA 4WORA 4KD3A 2HQEA 1STHA 1SYEA 2PW5A 3SK6A 3SXHA 4TRDA 3LX0A 2F0JA 4ZUIA 5C3XA 4DGZA 2F0WA 4LAAA 4S3SA 5KEEA 2F0TA 5CV4A 4MIUA 4HMIA
chains in the Genus database with same CATH superfamily
4BA1I 3F2BA 1BCPF 2F0UA 1GOZA 4LFCL 2ID0A 4G7ZC 1H9MA 1PH7A 4GNXC 1II3A 4X65Q 3SEBA 2Z9HA 2K50A 2PZTA 3TSSA 3GTPB 2F3IA 4ZRZA 3NBHB 4OX9L 1SYFA 2EYPA 4GS3A 1PYSB 4H0LC 2WP8J 2BDOA 5IY0A 3C46A 4OO1H 1ZEQX 1EIFA 4RH6A 1AFPA 3DM3A 5C3EB 5F2DA 2K5QA 2XTIA 2A8VA 3M7GA 3T1YL 2O5IC 2NVXB 1XPUA 1LO5D 4DR2L 2B2TC 4ALPA 1SYCA 2A74C 3STBD 1ICFB 2ZM6L 4PNYA 2IX1A 5FK9C 5FJ8G 2NVYH 3GTQH 1A63A 3H3VI 4R1JA 2JN4A 4PG3A 3VA7A 3TP7A 5ELDA 2JA6B 2R93H 2MHVA 4UDUC 2WKCA 2ATWA 2ZXPA 5LHY1 1SE4A 4C3JH 4AQYQ 2ZT9C 1J5EL 1I6HB 2HD3A 1IL8A 5K5PA 1XNQQ 1Q1BA 1TS4A 3BYYB 3Q22A 1R4QB 1CKMA 2PI2A 2M2LA 1VDZA 2N78A 1CUKA 5BR8L 2UUAQ 3E0JA 4GZYC 2PQAA 1A3VA 3S2DB 1IKMA 4DR1L 2WFWA 3HZXA 1B3AA 3T56B 3HGBA 3HOUB 3G48A 3UDGA 2EPBA 1VQ9A 1U0LA 1GVPA 3J7AV 3TRZA 1ET9A 3RZDB 2PNHA 1V9PA 2YTYA 5C44G 4YHHQ 1O7ZA 2HCCA 1ZYRC 1XYIA 5GROA 1Q82C 2D2CC 1G2SA 2E74C 2I07B 4HAEA 4UP8A 4LUOA 1VQ7A 3OMCA 1KLGD 5BN3A 4A3GG 1PMRA 3KLWA 1KC8C 2F0JA 1K73C 2DJFC 3OTOL 2DUDA 2D62A 3J80c 4ID6A 4RHSA 2CKZB 1B1ZA 1I6VC 3O13A 4LK1C 3J80L 4DV2L 5FO9B 5C3EH 4FNFA 5AJ3Q 4A3DG 4X66Q 2KHJA 1SFOB 5KGUA 1PXUA 4OXPA 3FMCA 1EQRA 1JWSD 3I2ZA 1B50A 1OXUA 3ERSX 4NB3A 3PCOB 4DAYA 4K0KQ 1JE5A 1O7YA 2I5HA 3GTPH 3FEWX 1BVSA 1STBA 1WFQA 2AHOB 4JI3Q 2XIWA 2RDHA 3FKIG 1BBWA 3HP3A 3UDXA 4H02A 2KCNA 4ZLTF 4DPGA 2A68D 3STBC 5GAHC 1IBLL 3TMEA 4JC0A 3D6WA 5M5XB 1RTOA 3U50C 2JA8G 3H3VH 1H9RA 2EJFC 3RMHA 2NVYB 2Q2UA 2B2UC 4Q5VA 4GLXA 2B8GA 3P20A 3PO2G 1DOMA 4IUQA 1O78A 3GTOB 1LYLA 4DV4Q 1UE5A 1XTCD 3HOWG 3HOZG 3S9WA 3PSIA 4KY5A 3I8ZA 3K0YA 4TKOB 2HHHQ 3BDOA 1RODA 3NELA 1Q3LA 1STNA 4BY7G 4IFDI 1K3RA 3I3CA 3ZYYX 4O2DA 1HZCA 3QJYA 2L5TA 3C1EA 1Q8IA 3I4MB 4DNTB 5FO7B 1TWFH 1XXGA 1Z6HA 3HOXG 2Z0SA 1FD7D 1ILQA 4IQZA 4IUNA 3TZDA 4N8X1 1QE6A 4HJ5A 3A0JA 3TN2A 4EQOA 2Z1CA 1WCMB 3HOYG 4A76A 1SNCA 4FXDA 1CK1A 3HKZE 2JQOA 4HJ8A 2F4VQ 2DJGC 3QOJA 1MD2D 5IGFA 1K8OA 2E75C 1JCKB 4L5TA 5IODA 4QIWB 1EYCA 4A3MH 4NDXA 3ER0A 1HFNA 4RG1A 2KA7A 3A55A 3LX0A 2K14A 3GQBA 3HKSA 4BBRH 4A3LH 4KKSA 3W1GA 4LF4Q 2O5JC 2CFMA 3LNNA 1LABA 2K04A 1JE4A 1SLJA 1NTGA 3NPPA 5M5YH 3HS0C 2HIXA 3BJUA 3CCUA 2K7VA 5CR3A 1TWCH 2NYZD 1HR0L 1EWCA 3KYHC 3S2DH 4LF6Q 3TZUA 3PO3G 5C6AA 5C0XI 3MTSA 2XGTA 1NJIC 2B29A 4JV5L 4KKUA 1H95A 2H1EA 5M3FG 4K2LA 2AQ3B 3KF6B 1IYJB 1SJED 2IHFA 3NBHA 4I7AA 1JJCB 2VB2X 4TSSA 2E2IB 2Q8IB 1V43A 5I6YA 1WVLA 4ZYSA 1AE3A 1EWIA 4Y7NH 1VQ8A 5FLXc 4A3FG 4A3IG 3U4ZA 2A68C 4FDBA 4KY6A 2JK8A 1TIID 2NVQH 3CMAA 5I2YA 1GXDC 1MKHA 5C5LA 5EGTA 2B2TA 4HCSA 4XDXA 2QDBA 3CPWA 4CJ1B 1UEAB 2MJ8A 1N9WA 1PRTB 4HSPA 4HIKA 3RLFA 4LWCA 3CCQA 3HOVG 1VF7A 1KNAA 3OOCA 1GUOA 1TWAH 4X64Q 2BE5C 1R9TH 5C44B 5CV7A 1HZBA 2N55A 4CDCC 4JI0L 3KOJA 2OQ0A 1J6QA 4DV6Q 1F2ZA 2D0PA 2F4IA 5JPNC 1HQMC 1C9OA 1TY0A 1OO9B 1YHBA 2IY5B 2KHIA 3LWUA 4NPSA 5ELCA 1UUPA 3MVVA 1VQ4A 3DXJC 3CCJA 3AU7A 3IFDA 3RLNA 1I4RA 2LXJA 4C3HH 4DUZQ 4BBRG 4A3LG 2ZTCA 1XMOL 4LUZA 3PV0A 1IBMQ 4OWTB 1U4RA 4X62Q 1VQAA 2PCFB 4OHJA 2VQEL 2JE6I 2B63G 1ET6A 1F9RA 4C3JB 4R4IA 3KDFA 1E0BA 1TVXA 4JG2A 1YNXA 2MQHA 2VL6A 2WB1B 5TSSA 5C3XA 5IE8A 1EU4A 2F0TA 3S17B 2LMCB 1H9KA 4DR4L 2MFIA 1E2ZA 3C1FA 3FPUB 1KIXA 3BDCA 5D14A 4M8AA 4YY3Q 1EY4A 3S1MB 5IYBG 5KYIA 1XMOQ 2HDLA 3S24A 1Q81C 4UP9A 2X69A 4K5WA 2EJGC 4X62L 1L1OB 3SHLA 4CDDC 2JA7B 3H15A 3GV3A 5M3MH 1A15A 3OW7A 4YWLA 3J81c 1CHQD 1YVCA 3T1HQ 2J7ZA 1TU2B 2KCCA 4FP5D 3RNUA 1TS2A 3Q8DA 4CDFC 1G8ZD 4CKCA 3D31A 2PZWA 1FJGL 5JJIA 1HQRD 3K81C 1QZHA 3EROA 3DLLA 1HA6A 3MXPA 1E3PA 1PZID 1HUNA 2R92H 1A62A 1JJGA 1I6HH 3EBEA 2PMZE 1AZPA 2VUMB 1I5FA 4C56C 1KAAA 4GLAC 2DNEA 4LF7Q 1I4QA 5IYDG 4TQUS 5C3EG 2F0FA 4A3KB 2MGSA 4DK1A 2XVSA 3GD7A 1N36Q 3T16A 1OXSC 4P72A 4LF5L 4EQNA 3PIOA 2OXPA 4FO2A 1ILPA 2AKWB 2B2UA 1SE8A 2EE1A 3ULLA 1TXYA 1SJHD 1TS5A 1OXVA 4LF7L 2B2YA 5LMUQ 3M3YB 1JB7A 4LFAL 1JMCA 4V190 1L2FA 4I7ZC 1S72A 3CCRA 1KHIA 2F0GA 1SXTA 1WYDA 4JYAQ 3DM1A 2JJQA 1SE3A 5I4DA 1YHQA 1EYGA 2J0TD 2Z4HA 5KRUA 5GQOA 4DKAC 4ZKCB 4JI2L 4DV7Q 3NUCA 2KJXA 4F87A 2AQ1B 1B9NA 1Y14B 2ZXOA 4MN3A 1KD1C 2XWBB 3E9HA 1DXMA 1ENAA 2QEJC 4K8IA 1IXRA 1EIHA 1QVFA 3UE1A 4DXGA 3RZOH 3HOZB 1D5ZC 1EY9A 2EOTA 1Z7TA 3NTHA 2UUBL 4UY8C 2K5DA 1YHAA 2TMPA 4AYBG 2JA5B 1H9JA 1JICA 5C4ZA 3AFPA 4NXNQ 2Q2IA 4GN5A 3T51B 4HEDA 1RTNA 5M5XH 3PUYA 2B2WA 5IGBA 2IT1A 4LF9Q 2I0QA 2K03A 1YNJC 3A7LA 2GVAA 1UEBA 1G6PA 3MFYA 1TWHB 3K5MA 3K57A 3E3XA 1SROA 2EXDA 4GOPC 1RIPA 2YTVA 1EZ8A 1SSOA 1IW7D 3U58A 1SYDA 3HOWB 1HTPA 5JJKA 4JOIC 5EKLA 4YCWA 1XNQL 1VQMA 4ME5A 2KCMA 1G2TA 1PA6A 5KNDA 1U4MA 2K01A 1TR5A 2BCOA 1BO0A 4DV3Q 2UUAL 2XSCA 1BUVT 1BCPB 2A69C 4JBJA 4A3MB 3OIQA 1UE1A 2A6HD 1FGUA 3X3NA 1A3UA 3CC4A 4XTCS 2L9HA 4X3TA 4KK7A 5DM63 4GNXB 2B2VC 2K75A 3GTJB 2VW9A 2WIIB 1E1TA 4GKKL 1MI2A 5IP7G 4O0AA 1L0XB 5NUCA 3EIVA 2C9OA 2IJ0A 4A3BG 1PH8A 2Q8TA 3GTJH 1SNPA 3VYUA 1DJRD 3TREA 5ELBA 3J7A5 3SDZA 4H44C 3S1NH 1WD1A 4JVZA 1HZ9A 4GNXA 4HSVA 3H0GG 3S15B 1C4QA 4A3IB 2QA4A 1PH5A 2ASBA 1DOLA 2F0IA 4QB4A 3F2CA 3JC66 1FR3A 2IWHA 1LTTD 1MJCA 2EYMA 4JI1Q 2N8NA 2NWGA 1NNXA 3OWEB 3RUZA 1E7ZA 4IURA 1IW7C 2NN6G 1AE2A 3GTKB 2EDGA 3K5NA 1YBYA 3U4VA 2EQSA 5J22A 2A5HA 1Q12A 1HJPA 3CP0A 1SMXA 5CMDA 2YU9H 2C35B 4B9XA 5IWAL 1Q1EA 1N34Q 4A3MG 3VYSA 4A3EB 4PZ6A 3NWSA 1HNZL 1MIUA 4JI4Q 4B3ML 2CH4W 2LSSA 2UXBQ 1VQNA 4JI3L 4IFDJ 3HOYH 1EY5A 1RD9D 2SNSA 5IIFA 3R93A 5EQ0A 2RDGA 2E8GA 3GV6A 4JOIA 2K5VA 1NUCA 4GKJQ 3AQQA 2ZJQA 1CFMA 1Q7YC 3R8BA 1PRTD 1I4PA 1XNRL 4XYOA 3AMUA 3KUPA 1GHJA 4NMZA 3K6OA 2QDLA 3GTLB 3QIAA 2UXBL 2F0VA 1STAA 4R4TA 4IPDA 2QKIC 1KRSA 4N9PA 5ELEA 1HCZA 5IP7H 3I55A 3I4LA 1I50H 4HMJA 1F77A 2A6ED 4POGA 2UXCL 5GAEC 2HHHL 4NXMQ 2HIVA 2RSNA 4QY7A 4MZ9A 1EWHA 4DV6L 2A1AA 3MC0B 1X3EA 3KF8B 3UI2A 2RVLA 3R2IA 3BYTB 2Y0SE 3W3AA 2F0WA 1I50B 5CV4A 5C4XB 2JA8B 1DONA 3PMFA 4X3SA 1S40A 2PO4A 2FHTA 3CC2A 1QJOA 3HOXB 3HFZB 3KLSX 2NTSA 1PRTC 3PUVA 4OO1I 4ZUJA 1CI3M 3VR5A 2O4XA 2R7ZB 3F8TA 3I56A 1RKNA 3EN2A 2NVXH 3OW2A 4DV0L 1MGSA 4DK0A 2MP1A 3B6YA 4X3UA 5EKIA 1A0IA 1EOVA 1WCMH 4O42A 1EIGA 4ODGA 3SE0A 1RL2A 5J39A 2B63H 4GN4B 5CV5A 5G3LD 2QF7A 1W3SA 1DOKA 4L6TB 4F7XA 4A3EG 1Y1WH 2E2HB 2QILA 5E4WC 2F0EA 1TWGH 4LUVA 4QMGA 3GO5A 1CTMA 4KD4A 2RHQB 4DV5L 1S5ED 1B70B 4IFDG 1LTLA 2JEAI 4DR6Q 2LXKA 2RSOA 3MXNA 3FKIB 3UDFA 2UU9Q 4HN7A 2MUYA 2VUMG 1AEXA 4L5SA 3M4OB 4P71A 5IP9H 3KFUA 4TVAB 2R7ZH 1K0RA 1RF2D 4K2KA 3J80E 5M9OA 2EY5A 4QL5A 1PDQA 2BH8A 2WB1G 3CCEA 2KEDA 1O80A 4O1NA 1SNOA 3G6JB 5C5MA 4JI7L 3A8IE 2ZTEA 2JP1A 2VB3X 4WJWA 4JI8Q 5ELNA 2E2JB 1PH6A 1NMGA 1WTQA 1JOOA 4WRDA 1UE7A 4B08A 1JB3A 5BN4A 3HOVH 1VQKA 2EY2A 4DR5Q 4NW2A 1WTVA 2F3WA 1LT5D 4C2MB 4XQJA 1C7YA 4RAUC 3FKIH 5J1ZA 1E2WA 3J81L 1QZGA 1M90C 3A74A 1MSGA 2BOSA 3BDLA 2K5WA 3JAMi 2OF1A 1YNND 3KJOA 1GD7A 3OSOA 4JI7Q 1X65A 2Y0SB 1VQLA 3NQIA 1J8IA 1U5KA 1WTHA 5EJWA 2ZTDA 1HFGA 1PFMA 4PZ8A 2EZVA 4BY1H 2CWPA 4CGYB 1H9SB 4DR5L 1VS0A 4R4QA 2D0OA 3TDQA 3L3OC 4EX5A 1B9MA 4DUZL 2F0SA 4DUYQ 4IALA 1JWUD 1MJEA 4L5QA 1PZJD 4A3GH 4A3JB 2XWJB 4N8FA 4IZ8A 1ML0D 4EQ5A 5LMNL 3MWYW 3CRKC 1NMFA 5CV8A 1I3QH 5EAYA 3URYA 2F0MA 1B4OA 1H9SA 4K5XA 3IKJA 1I4HA 3T13A 4LFCQ 5ISRA 4B9WA 1NR2A 3PIO3 3K0XA 2DNCA 4OELB 4X65L 4BBSG 2F0HA 2UUBQ 1UNSA 2OEOA 3HOUH 4OEMB 2EYJA 4DXFA 2SNMA 2V1CC 3KF8A 2AMCB 3TEHB 3P1HA 1BCPD 4OL7A 3T1HL 1QUQA 2GA4B 2NTTA 2SEBD 3I4OA 2JA6H 2ICEC 4LF9L 2YTXA 1IKLA 4KHPL 4PMWA 2L55A 2UXDL 4J1MA 2M00A 1BBXC 5BR8Q 2NZ1D 2V4DA 1BR9A 1U4LA 4RMFA 1EY7A 3SVMA 3NP8A 2VY3A 3PO3H 1GUSA 1R4PB 3VDYA 1PH1A 2LS01 1SNMA 3D0FA 3D6CA 3BVZA 4RA8A 3J7ZC 2B2YC 1GJXA 3KLRA 4PV1C 2XN9C 2N88A 2GN5A 1B44D 3CRLC 5L37A 5C0XG 1PYWD 4YHHL 1E24A 1KDCA 3CCSA 1PTOH 2CW0C 2NZOA 3G71A 1WTPA 2J4XA 4LFBL 2KQ3A 2WKDA 4GOPB 3H09A 1KLUD 1WD0A 1Y1WB 2KENA 3Q0AA 3EJIA 3OTOQ 4HJAA 3QO2A 3KF6A 3GTGH 4E6IA 5E7NA 3I4MG 1PH9A 1UE6A 2Z6KA 1P8LA 1ZKOA 1OTCA 4FXGC 4B3SQ 3ND8A 1CM9A 1DCZA 2Q8RE 3CW2C 1X32A 1O7IA 4LFAQ 1Q86C 2K33A 1GUGA 4DAMA 2Q2HA 3TP6A 3MHBA 4ILWA 1F9QA 2PI2E 3ULPA 4IFDH 3F2UA 4J6HA 3M85A 1JC7A 4Y52H 2PYKA 1K8MA 2RDFA 2CH4A 1KXLA 1YEZA 2K28A 3K7AB 3TS2A 3K59A 2VZAA 2WACA 1X56A 2OWOA 4MHEA 1TT2A 3ULJA 1HNWL 5JEAJ 2FFKB 1IHZA 2VQFL 1I94Q 1EU3A 2WAQB 2DGYA 2X6LA 4IPGA 4R8IA 3CPFA 3L0OA 2JA7G 5IGCA 1YJWA 4BA2I 1J9OA 4A3JG 2NZHA 1I3QB 1ZXTA 1F2YA 2IPKD 4DA2A 4OX9Q 3CQZB 1JQYD 3IL8A 4X66L 1ENCA 1B8AA 2KEEA 3S15H 2ALYB 1TQOA 1RCVD 3AYHB 2RHSB 2P5ZX 3DHQA 4BY7B 4KY7A 1GUNA 2LKVA 4XIGS 3ICEA 4IUUA 4I65A 4IUPA 3TQYA 2NUCA 1WTWA 3JAML 5JAVA 1PV4A 2VQFQ 1I94L 2CCZA 2K5HA 2UUCQ 1B53A 2B63B 1XJVA 3PO2B 2YYZA 2L1BA 1W2BA 1FNUA 3NENA 4JCVE 4RGNA 2D9UA 2JA7H 4GLVB 4HIDA 1CKNB 1Y1VB 1HZAA 4UAIA 1HNZQ 1QB5D 4B3MQ 5IGDA 1PLFA 1NAPA 5IYBH 3TP8A 1AP0A 2KCTA 2Z4IA 4N9TA 1D5XC 2L15A 4CHTB 4AQYL 1S5CD 5KYLA 2MO1A 3K5OA 2CHBD 3HOXH 4RWSC 1EEID 3K80C 2Y0SG 1VQGA 1Z47A 3K8AA 4X3KA 2K6AA 2R3ZA 1X55A 4UPAA 3S1QB 4X6AH 3EVQA 1NR4A 2CWAA 4QIWE 4WORA 1M8AA 4ULLA 1K83B 2PW5A 4ZUIA 1Y1VG 4LAAA 5IT9E 1PTOF 1FGBD 2UXCQ 1I4GA 1CQVA 1D1IA 2PZUA 3A8KE 1X3GA 4P74A 3TP5A 5H1SE 3CF5A 3W1BA 5DEHA 3GP7A 1EY0A 4IJLA 3Q6SA 3K7UC 2BE5D 1EL0A 3RD4A 1KAWA 4FF1A 1B3QA 5EBDA 3I73A 2E5LL 3GTLH 3VR2A 4DV2Q 1DYQA 2VUMH 1Q46A 1YITA 1QOHA 5IWAQ 2EY6A 1PH3A 3RN5A 5E1FA 3X3MA 1L0YB 5CV9A 3RZOB 1L0WA 4HJ9A 4R9WA 3DMUA 3J81i 3PF4A 5KIXA 4IUVA 2F0KA 2WV6D 4B3TQ 3H0GH 1QNUA 3I72A 3DWPA 2K1BA 5I2XA 1BKBA 3CXCA 4XQQA 3C2PA 4KTAA 4QUFA 5FO8B 4X64L 5EKKA 3I4NG 3W2DA 4GOPA 1ENFA 2OCEA 3T1YQ 1A2UA 4XXEA 4JI0Q 4DR2Q 1HRJA 3PUWA 3FVQA 3M4PA 1LTGD 4HTHA 5IYCH 1X3QA 1TS3A 5C4XH 4DR1Q 1D8LA 4QJFA 2B39A 5M3FB 4L8JA 1X9NA 5A2QE 1D5MC 1WTOA 3VR4A 5IGGA 1K28A 2QGQA 1FNVA 3PO3B 5HGQA 3P7JA 3NEMA 1CHPD 5IT9L 1JWMD 1E2VA 1VMPA 2GVBA 4UHVA 3RLOA 4QCLA 2WAQG 4LW1A 3S1RH 1J5EQ 1S4ZA 1G6ZA 5C4XG 5CBAE 4NKLA 2RCNA 2DN8A 1VQCA 3K5LA 2HT1A 5FOBB 2PW7A 4BS9A 4B3RL 1A8VA 4KN7C 4CBVA 3QG1A 2CW0D 3NE5B 5C4HA 4GKKQ 2F0LA 3V2TA 5E3FA 5D65A 3AEVA 4JI8L 4K0KL 5LL6X 2AUJD 2R92B 4PZ7A 4ZK9B 4LF6L 4K14A 4KI0A 1TWFB 4DFAA 4AH6A 4JBMA 1S5DD 4KJOA 2EIFA 2ZJPA 1XWEA 3C3LA 4A3JH 2K05A 1IBML 1YZ6A 4KMUC 4QUCA 2JXMB 1XTDA 2F0QA 1BBUA 3D4DA 1N33Q 4C2MH 2EYOA 4DU9A 2CQOA 1YJNA 3A54A 3JAME 1G91A 2HQLA 3S17H 1GUWA 1NE3A 2EYLA 3E6ZX 4KLKA 3VR3A 1VQ6A 1A3TA 3EA6A 1X54A 1PFNA 5JJZA 3SR1A 4DV5Q 2PPBC 1MBYA 4LNQA 2D5DA 2EVBA 4KJNA 4C3IB 1G291 1XPRA 1SE2A 1N32Q 1N36L 2IW3A 3FRPB 5JEAH 3QOLA 2X6GA 4HR7B 1STYA 2OQKA 4WFN3 4CJ2C 2RKSA 1RDPD 1QVCA 3J81j 3L2PA 4DV0Q 3S2HH 4C3HG 2EXZA 3GTKH 2NN6H 1LTBD 4BY7H 1FJGQ 3DEOA 1EQVA 5GADC 4EQPA 1WJJA 1CZGA 3DUZA 4K6LA 2EJMA 4LF8L 3G6EA 2LFNA 4RKBA 3T53B 5T1GA 5ELFA 1BF4A 3M4YA 5D3IB 1HXYD 2E2HH 5FLMG 1V1PB 1F2MA 2KVMA 4DV4L 4BBSB 1A6XA 3E0EA 1UAPA 1HNXQ 4MNOA 3FP9A 3BVMA 1R9TB 4A3DB 2EYHA 1T5XD 2FMCA 4OIJA 5I9OA 3SGIA 2WB1E 4WJ3M 4BBRB 2BA1A 2IX0A 2RA4A 3H0GB 3BU2A 3S14H 1YNNC 4EGVA 1E22A 2H4OA 1EQTA 3H6MA 4U68A 5C44H 3S1NB 1SEBD 2E2DC 2Z6KC 4G57A 3AB9A 1ZYRD 3FPPA 1PFBA 1VQFA 4J15A 4HIOA 1HR0Q 3DEPA 3MFGA 1D6EC 1HNXL 5M3MG 1UWVA 2FMMA 5ELOA 1ONLA 4A3FH 1XMQQ 3UE0A 1HH2P 1KL9A 3HOUG 1ESRA 2JEBI 4H7BA 5LMNQ 1RHPA 2K4KA 3L7ZC 4JBWA 4IO9A 1IYVA 3WOFA 3RN2A 2R93G 4BY1G 4IOCA 3S1QH 5CV6A 2AUKA 1QNKA 1SDFA 3Q24A 5IT9c 1IBKL 2I5MX 3CQZH 2PMZB 4KHVA 5FJ8H 2PQEA 3CCVA 1VQHA 5JVH3 2IHEA 2L4NA 1YI2A 3CC7A 1CA6A 1SRUA 4C3IH 1VMCA 1GKHA 4K5VA 1V1OA 2KOLA 3M7NA 2KECA 1XX8A 3NSWA 4NP5A 3U9OA 3L9AX 4DNRB 4KV6A 4YIJA 1BXTA 1AH9A 4J8QA 4A3CG 4RGTA 2RCFA 1Y1VH 3NK9A 1X6OA 3KJPA 4OONA 1HTLD 4RCOA 4YCVA 4HCEA 1E1OA 4A75A 3E5SA 2B2VA 1AZQA 1NCVA 3R3OA 1VQIA 1EFWA 2OT2A 3NQTA 1JOKA 4C3IG 1DGSA 5C0XH 1SR3A 4AYBB 1VQ5A 2JA5G 5K36G 1VQOA 3D4WA 3V96A 3MEHA 2F0DA 2AWOA 1W6KA 4XQNA 4LFBQ 2F52A 2NBFA 3G7LA 5M5WB 4QQBX 4DV1L 1S5BD 5FLXL 2L11A 1VQBA 3N6RA 4JI2Q 4DAVA 3NHHA 1V1PA 1WCMG 3HOYB 3HEJA 5J3BA 3RZDH 4JI6L 2R7ZG 2ICIA 4B3SL 1VQDA 1PZKD 3A56A 3ND9A 4AYBE 4A93B 4JPBW 2WAQE 2PQAB 2OTLA 1D2BA 3I90A 1KABA 4IPHA 1Q90A 1G51A 2O2LD 3F1ZA 2M9VA 2Z6BA 4JK1C 4R8NA 4A3KG 3S16H 1EYDA 2AWNA 4Y7NB 3QR8A 2R6GA 4HIMA 3VYRA 5AJ3L 2YU9B 1B7YB 1Y1WG 3SK6A 3GTMB 4RCNA 2L12A 5KEEA 4DGZA 4A3EH 3I70A 4A3BH 1KRTA 4HMIA 2NN6I 2WINB 1LV9A 4F88A 4R4CA 5CGKA 4AIMA 4A4IA 2JA9A 1STEA 5JJLA 4FXKC 1DM0B 3KK7A 1HA5A 1EQQA 1U4PA 1PHJA 4DR4Q 2BH2A 1LACA 5C0XJ 4DR3L 3I4NB 4DR7L 5M5YB 1BNZA 1T5EA 5LL6S 3QB3A 4DAPA 4YY3L 4A3IH 3F2DA 3MXUA 1M4VA 2ZJRA 4DUYL 1PH4A 3K58A 3IRBA 1BCPC 3HG9A 1ESFA 1Y8NB 4IN3A 5M3FH 2F0OA 3CHBD 2AQ2B 3W5OA 5BN5A 1DD2A 4LMQD 1MHWC 5AFWA 2UUCL 3S14B 1PTOB 1VCIA 1C8CA 1LTRD 3H3VC 1JORA 5C4JH 3JAMc 3A7AB 2E5LQ 4JI1L 3J81E 3OHXC 2VXWA 3DWAA 3OIPA 5M5WH 1SMYC 1X3FA 3S1MH 2KBNA 1CZWA 1ASZA 2ES2A 2ZM6Q 1JT8A 3CCLA 1EUJA 4G7HC 1WTXA 1QWYA 4IUTA 3HOWH 4JYAL 1F9PA 1N34L 3M3YH 5C3WA 1O7LA 4BXXG 3IFTA 3WDNA 1SBBB 4DV7L 1VF5C 2R7DA 1K9MC 4PMCA 2R93B 5A35A 1N8RC 4FF4A 1NY4A 1AN8A 1WI5A 2K52A 1XPOA 3CMEA 3KLSA 4CJ0B 4A3BB 5IGEA 2F3VA 1LUZA 1PTOC 4A93H 4ME3A 4GKJL 3TBIB 2XRSD 4ZAIA 4DK6C 1LM0A 2Z8LA 3M4QA 2A73B 3IAYA 4LF4L 5JEAG 2QEXA 4DAYB 1FL0A 1CT1D 2FINB 2QCPX 4ZCKA 3SK5A 3VA5A 4C3HB 1V1QA 2F0PA 3DWQA 1W6JA 4KD3A 2HQEA 4FF3A 4QGUA 4FVMA 4FF2A 1DZ1A 3SXHA 1GHKA 2C5CA 4BXXH 4A3GB 1EY8A 1OXXK 1QG7A 1VQEA 3MXNB 3PIP3 2JA6G 1LT6D 1TWGB 4CKEA 4A3FB 4POFA 4P73A 3OYYA 1U9RA 4DN4M 2NVTH 3ZJYC 2B8FA 4P75A 2MO0A 3CU7A 1SFOH 3BZKA 1D7QA 1EFID 4DF7A 1GM5A 5I6WA 3MEFA 3D3RA 3MXGA 4RKLA 3AFQA 2QW7A 4B3TL 3FDTA 1CQFA 1SMYD 3U9SA 1HUMA 3QWNA 1AW7A 5HGTA 3HOVB 1K3BC 1S3OA 5DNFA 2RQXA 2SOBA 2DY8A 3OPOA 4BWGB 4K6DA 4OWWB 4DV3L 3A5ZB 3WWVA 1L1OA 2RBMA 4DR6L 1IZ6A 2K32A 3CD6A 4C1NI 1F9SA 4A3DH 1SNDA 2MNAA 1ASYA 3K7AH 3PUZA 4BBSH 2IL8A 3MAQA 1QILA 2R61A 1RJTA 2BDNA 1C0AA 2F1MA 1V8QA 2DY7A 1P16A 1EEFD 3NTIA 1M1KC 4C1NK 2OTJA 1NSNS 1N32L 5KNCA 1EIYB 4RFBA 3GTMH 2EY1A 3S2HB 2JA5H 5K36H 1K8GA 2HUGA 1S5FD 1X3PA 4A3KH 3I7FA 2FXQA 4A93G 2R7FA 3GTGB 5IYCG 3GTQB 1KTKA 4OO1G 3I4MH 5EPJA 3TS0A 1Z9FA 1IL2A 1F2LA 1B2TA 4OIKA 3KBGA 2RF4A 2A6EC 5CBEE 2VNUD 4G7OC 1SYGA 1PH2A 3J7AF 4IOAA 4IPCA 4OWXB 1BDOA 1STHA 3VYTA 2Q2TA 2KUMA 4TRDA 1QUQB 4S3SA 4MIUA 2H5XA 1L1OC 3CKIB 3SK8A 2NVTB 4FYDA 1N33L 3ERQA 4B3RQ 4RGOS 1HHVA 1IBLQ 3BZDB 1FYCA 3D4RA 3GDEA 4JW0A 3EQLC 4JI4L 1K83H 3FHWA 4GN3B 3V05A 4WJ4A 1EZ6A 1CKOA 4CKBA 1Y8OB 3HKZB 2A19A 5JVG3 1TWCB 2LY7A 3BZCA 3BG3A 3GTOH 2F0NA 1PRTF 2I5LX 5D3DA 3MA2B 1KQSA 4MTKA 2I46A 4MTNA 3UDIA 1VQPA 2JA8H 4R4OA 4M1UB 3PUXA 4Z9CB 4Q0FA 4KHPQ 2UXDQ 1TKWB 2FJ2A 3A5UA 1IBKQ 1T9HA 1K8AC 4OGQC 5CC4A 1LTSD 4LF5Q 1Q8KA 2B2WC 2E76C 2KHSA 2ZXRA 2TSSA 3WOEA 5I9PA 5JPMC 1EOTA 1HR0W 2XRQD 1CSQA 4JI5Q 2L0CA 3G4SA 2K5NA 1TY2A 3A8JE 4NXML 4JBKA 4F8MA 4P2CB 1LT4D 4KN4C 3OMGA 2G9DA 1QCBD 3CCMA 1K0SA 3ONAB 4EVOA 1LTAD 3Q23A 2F4VL 2IX3A 2UU9L 1I4XA 4KKTA 5M3MB 2VQEQ 1TWAB 5FLMH 1JOQA 4XT3B 1OXTA 2CQAA 2CVRA 3ITPA 1XNRQ 4JI5L 3N52A 1A2TA 2G5DA 5G3LF 1IYUA 4RGMA 3PIPA 5CYUA 3SK4A 1XMQL 4PMBA 2N3SA 1NBWA 5FKAC 4XYQA 1CKNA 2N49A 4ZQ3A 4V0BA 4BY1B 3MZ5A 3P75A 3S1RB 3CAMA 1PTOD 1WOCA 2JYOA 3PGZA 1WTRA 1ICWA 1YJ9A 1VQJA 3I4NH 1SYEA 4JV5Q 1BQQT 2PNRC 4HJ7A 3H94A 1CA5A 2NVQB 5DM73 3RR5A 4G4KA 4L63B 2HDMA 4C3JG 2HCIA 3BS1A 5CORA 2A6HC 1SYBA 4ZKBB 2E2IH 4NXNL 2ENBA 3T4AC 5COYA 1KNEA 2A69D 1STGA 1KDAA 2SDFA 1LLRD 4H13C 3J80i 2E2JH 5A2QL 4A3CH 1TWHH 5IOCA 1FVIA 2VS1A 3NTKA 5IP9G 2NB0A 3J7YW 5EBCA 2XNAC 3PF5A 3E9IA 1D1KA 3PQIA 3S16B 4L5RC 2MPMA 4DNIA 1LT3D 2YV5A 4YCUA 4U673 5HY6A 1BOSA 1EYAA 1GUTA 3NWTA 5DAUA 1HPCA 1QVGA 5EPKA 2B3GA 1JR0D 4YWKA 1PFSA 2G9HD 5C4JB 5FLXE 1YNJD 3NXWA 3D8GA 4DR3Q 4DR7Q 1JJ2A 5JOBA 4ABNA 1HNWQ 1CSPA 3NBIA 1YIJA 5HURA 3HOZH 4KHZA 4APVA 4QF4A 1EY6A 1SAPA 3PO2H 1MSHA 3EFXD 4RHRA 4DK3C 4XT1B 3HRZC 5GAGC 4CDEC 4IJHA 2R92G 2F03A 1SN8A 1LTID 5DLQE 1Y69U 3LWEA 4JI6Q 4LF8Q 4PQXA 1GO3E 5KNBA 3LGJA 3M9BA 1KDBA 3HKZG 1PYBA 1C48A 5E4XA 3KDFB 5IYDH 5LMNW 3OWFA 1FNWA 3KBXA 5T1IA 4UP7A 5LMUL 1SNQA 5EPLA 3VR6A 2EYFA 2JSOA 4YWMA 4K8JA 4DV1Q 4LJZC 3H91A 3I91A 1Y8PB 1PVOA 3M4OH 3BVGA 3R2TA 2BA0A
chains in the Genus database with same CATH topology
4BA1I 1BCPF 2F0UA 1GOZA 2ID0A 4G7ZC 1H9MA 1II3A 3SEBA 2PZTA 3TSSA 3GTPB 4ZRZA 1SYFA 2EYPA 4H0LC 2WP8J 2BDOA 3C46A 4OO1H 1ZEQX 4RH6A 1AFPA 5C3EB 5F2DA 2K5QA 2O5IC 3M7GA 2NVXB 1LO5D 2B2TC 1SYCA 2A74C 4PNYA 2IX1A 5FK9C 3VA7A 3TP7A 5ELDA 2JA6B 2MHVA 4UDUC 2WKCA 2ZXPA 5LHY1 1SE4A 2ZT9C 1I6HB 1IL8A 5K5PA 1Q1BA 1TS4A 3BYYB 3Q22A 1R4QB 2M2LA 1VDZA 3E0JA 4GZYC 1A3VA 3S2DB 1IKMA 3HZXA 1B3AA 3T56B 3HGBA 3HOUB 2EPBA 3J7AV 1ET9A 3RZDB 1O7ZA 2HCCA 1ZYRC 1XYIA 2D2CC 1G2SA 2E74C 2I07B 4HAEA 5BN3A 3OMCA 1KLGD 1PMRA 2F0JA 2D62A 4ID6A 4RHSA 1B1ZA 1I6VC 3O13A 4LK1C 3J80L 5FO9B 4FNFA 1SFOB 5KGUA 1PXUA 3FMCA 1JWSD 1B50A 1OXUA 4DAYA 1O7YA 3FEWX 1STBA 2XIWA 2RDHA 3HP3A 2KCNA 4ZLTF 2A68D 3TMEA 3D6WA 5M5XB 1RTOA 1H9RA 2EJFC 3RMHA 2NVYB 2B2UC 4Q5VA 2B8GA 3P20A 1DOMA 4IUQA 3GTOB 1O78A 1XTCD 3S9WA 4KY5A 3I8ZA 3K0YA 4TKOB 3BDOA 1RODA 1Q3LA 1STNA 4IFDI 3I3CA 3ZYYX 3QJYA 2L5TA 3C1EA 1Q8IA 3I4MB 4DNTB 5FO7B 1XXGA 1Z6HA 1FD7D 1ILQA 4IQZA 4IUNA 3TZDA 1QE6A 3TN2A 4EQOA 2Z1CA 1WCMB 1SNCA 4FXDA 1CK1A 3QOJA 1MD2D 5IGFA 1K8OA 2E75C 1JCKB 5IODA 4QIWB 1EYCA 4NDXA 1HFNA 2KA7A 3A55A 3LX0A 3GQBA 4KKSA 2O5JC 3LNNA 1LABA 2K04A 1JE4A 3NPPA 3HS0C 2K7VA 5CR3A 2NYZD 1EWCA 3TZUA 5C6AA 5C0XI 3MTSA 4KKUA 2H1EA 2AQ3B 4K2LA 1SJED 3NBHA 2VB2X 4TSSA 2E2IB 2Q8IB 1V43A 5I6YA 1WVLA 4ZYSA 2A68C 4KY6A 1TIID 5I2YA 1GXDC 5C5LA 5EGTA 2B2TA 4HCSA 4XDXA 2QDBA 4CJ1B 1UEAB 2MJ8A 1PRTB 4HSPA 3RLFA 1VF7A 1KNAA 3OOCA 1GUOA 2BE5C 5C44B 5CV7A 2N55A 1F2ZA 2F4IA 5JPNC 1HQMC 1TY0A 1OO9B 3LWUA 5ELCA 1UUPA 3MVVA 3DXJC 3AU7A 3IFDA 1I4RA 3PV0A 1U4RA 2PCFB 4OHJA 2JE6I 1ET6A 1F9RA 4C3JB 1E0BA 1TVXA 2WB1B 5TSSA 5C3XA 1EU4A 2F0TA 3S17B 2LMCB 1H9KA 1E2ZA 3C1FA 3FPUB 3BDCA 5D14A 4M8AA 1EY4A 3S1MB 5KYIA 2HDLA 2X69A 4K5WA 2EJGC 3SHLA 2JA7B 3GV3A 1A15A 3OW7A 1CHQD 2J7ZA 1TU2B 2KCCA 4FP5D 1TS2A 4CKCA 1G8ZD 3D31A 2PZWA 1HQRD 3EROA 1HA6A 3MXPA 1PZID 1HUNA 1AZPA 2VUMB 4C56C 1KAAA 2DNEA 1I4QA 4TQUS 2F0FA 4A3KB 2MGSA 4DK1A 2XVSA 3GD7A 3T16A 1OXSC 4EQNA 2OXPA 4FO2A 1ILPA 2B2UA 2EE1A 1SJHD 1TS5A 1OXVA 2B2YA 3M3YB 4V190 4I7ZC 2F0GA 1SXTA 3DM1A 1SE3A 5I4DA 2J0TD 2Z4HA 5KRUA 4ZKCB 3NUCA 2KJXA 4F87A 2AQ1B 1B9NA 2ZXOA 4MN3A 2XWBB 1DXMA 1ENAA 2QEJC 4K8IA 1EIHA 4DXGA 3HOZB 1D5ZC 1EY9A 2EOTA 1Z7TA 3NTHA 2K5DA 2TMPA 2JA5B 1H9JA 1JICA 5C4ZA 3T51B 4HEDA 1RTNA 3PUYA 2B2WA 5IGBA 2IT1A 2K03A 1YNJC 3A7LA 3MFYA 1TWHB 3K5MA 3K57A 1EZ8A 1SSOA 1IW7D 1SYDA 3HOWB 1HTPA 5EKLA 1G2TA 4ME5A 5KNDA 1U4MA 2K01A 1TR5A 2BCOA 1BO0A 2XSCA 1BUVT 1BCPB 2A69C 4A3MB 3OIQA 2A6HD 3X3NA 1A3UA 4XTCS 2L9HA 4X3TA 4KK7A 5DM63 2B2VC 3GTJB 2WIIB 1MI2A 1L0XB 5NUCA 2C9OA 2IJ0A 2Q8TA 1SNPA 3VYUA 1DJRD 5ELBA 3SDZA 4H44C 1WD1A 4HSVA 3S15B 1C4QA 4A3IB 1DOLA 2F0IA 4QB4A 1FR3A 2IWHA 1LTTD 2EYMA 2NWGA 3OWEB 3RUZA 4IURA 1IW7C 2NN6G 3GTKB 2EDGA 3K5NA 5J22A 2A5HA 1Q12A 5CMDA 4B9XA 1Q1EA 3VYSA 4A3EB 3NWSA 4IFDJ 1EY5A 1RD9D 2SNSA 5IIFA 3R93A 5EQ0A 2RDGA 3GV6A 1NUCA 1CFMA 3R8BA 1PRTD 1I4PA 4XYOA 3AMUA 3KUPA 1GHJA 4NMZA 3K6OA 3GTLB 3QIAA 2F0VA 1STAA 2QKIC 4N9PA 5ELEA 1HCZA 3I4LA 4HMJA 1F77A 2A6ED 2RSNA 1EWHA 3MC0B 3UI2A 2RVLA 3R2IA 3BYTB 3W3AA 2F0WA 1I50B 5CV4A 5C4XB 2JA8B 1DONA 3PMFA 4X3SA 2PO4A 2FHTA 3HOXB 1QJOA 3KLSX 2NTSA 1PRTC 3PUVA 4OO1I 4ZUJA 1CI3M 3VR5A 2O4XA 2R7ZB 1RKNA 1MGSA 4DK0A 2MP1A 4X3UA 5EKIA 4O42A 1EIGA 4ODGA 3SE0A 5J39A 5CV5A 5G3LD 2QF7A 1DOKA 4L6TB 4F7XA 2E2HB 2QILA 5E4WC 2F0EA 4QMGA 3GO5A 1CTMA 4KD4A 1S5ED 4IFDG 2JEAI 2RSOA 3MXNA 3FKIB 4HN7A 2MUYA 1AEXA 3M4OB 1RF2D 4K2KA 3J80E 5M9OA 2EY5A 1PDQA 2KEDA 1O80A 4O1NA 1SNOA 3G6JB 5C5MA 3A8IE 2JP1A 2VB3X 4WJWA 2E2JB 1WTQA 1JOOA 4WRDA 5BN4A 4B08A 1JB3A 2EY2A 4NW2A 1WTVA 2F3WA 1LT5D 4C2MB 4XQJA 4RAUC 5J1ZA 1E2WA 3J81L 1MSGA 2BOSA 3BDLA 2K5WA 2OF1A 1YNND 3OSOA 2Y0SB 3NQIA 1J8IA 5EJWA 1HFGA 1PFMA 2EZVA 4CGYB 1H9SB 3TDQA 3L3OC 1B9MA 2F0SA 4IALA 1JWUD 1PZJD 4A3JB 2XWJB 4IZ8A 1ML0D 3MWYW 3CRKC 5CV8A 3URYA 2F0MA 1B4OA 1H9SA 4K5XA 3IKJA 1I4HA 3T13A 5ISRA 4B9WA 1NR2A 3PIO3 2DNCA 2F0HA 1UNSA 2OEOA 2EYJA 4DXFA 2SNMA 3KF8A 3P1HA 1BCPD 4OL7A 2GA4B 2NTTA 2SEBD 2ICEC 1IKLA 4PMWA 2L55A 4J1MA 2M00A 1BBXC 2NZ1D 2V4DA 1BR9A 1U4LA 1EY7A 3SVMA 3NP8A 1GUSA 1R4PB 2LS01 1SNMA 3D6CA 3BVZA 4RA8A 1GJXA 2B2YC 3KLRA 4PV1C 2XN9C 2N88A 3CRLC 1B44D 5C0XG 1PYWD 1KDCA 1PTOH 2CW0C 1WTPA 2J4XA 2KQ3A 2WKDA 1Y1WB 3H09A 1WD0A 1KLUD 3Q0AA 3EJIA 3QO2A 4E6IA 1ZKOA 4FXGC 3ND8A 1CM9A 1DCZA 2Q8RE 1X32A 2K33A 1GUGA 3TP6A 3MHBA 4ILWA 1F9QA 4IFDH 3F2UA 4J6HA 3M85A 1JC7A 2PYKA 1K8MA 2RDFA 2K28A 3K7AB 3K59A 2WACA 4MHEA 1TT2A 5JEAJ 2FFKB 1IHZA 1EU3A 2WAQB 2X6LA 4R8IA 5IGCA 4BA2I 1J9OA 1I3QB 1ZXTA 1F2YA 2IPKD 4DA2A 3CQZB 1JQYD 3IL8A 1ENCA 2KEEA 1TQOA 1RCVD 3DHQA 4BY7B 4KY7A 1GUNA 2LKVA 4XIGS 4IUUA 4I65A 4IUPA 2NUCA 1WTWA 3JAML 5JAVA 1B53A 2B63B 3PO2B 2YYZA 2L1BA 1FNUA 4RGNA 2D9UA 1Y1VB 4UAIA 1QB5D 5IGDA 1PLFA 1NAPA 3TP8A 1AP0A 2Z4IA 4N9TA 1D5XC 4CHTB 1S5CD 5KYLA 3K5OA 2CHBD 4RWSC 1EEID 1Z47A 4X3KA 2K6AA 2R3ZA 3S1QB 3EVQA 1NR4A 4WORA 1M8AA 4ULLA 1K83B 2PW5A 4ZUIA 4LAAA 5IT9E 1PTOF 1FGBD 1I4GA 1CQVA 1D1IA 2PZUA 3A8KE 3TP5A 5DEHA 3GP7A 1EY0A 3Q6SA 2BE5D 1EL0A 3RD4A 4FF1A 5EBDA 3I73A 3VR2A 1DYQA 1QOHA 2EY6A 5E1FA 3X3MA 1L0YB 5CV9A 3RZOB 4R9WA 3DMUA 5KIXA 4IUVA 2F0KA 2WV6D 1QNUA 3I72A 3DWPA 2K1BA 5I2XA 3C2PA 4XQQA 4KTAA 4QUFA 5FO8B 5EKKA 3W2DA 1ENFA 1A2UA 4XXEA 1HRJA 3PUWA 3FVQA 4HTHA 1LTGD 1X3QA 1TS3A 2B39A 5M3FB 4L8JA 5A2QE 1D5MC 1WTOA 3VR4A 5IGGA 1FNVA 3PO3B 3P7JA 1CHPD 5IT9L 1JWMD 1E2VA 1VMPA 4QCLA 1S4ZA 1G6ZA 5CBAE 4NKLA 2DN8A 3K5LA 5FOBB 2PW7A 4BS9A 4KN7C 4CBVA 3QG1A 2CW0D 3NE5B 5C4HA 2F0LA 3V2TA 5E3FA 5D65A 5LL6X 2AUJD 2R92B 4ZK9B 4K14A 4KI0A 1TWFB 4DFAA 1S5DD 4KJOA 1XWEA 3C3LA 2K05A 4KMUC 4QUCA 2JXMB 2F0QA 3D4DA 2EYOA 4DU9A 3A54A 3JAME 1G91A 1GUWA 2EYLA 3E6ZX 3VR3A 1A3TA 3EA6A 1PFNA 5JJZA 3SR1A 2PPBC 1MBYA 2D5DA 2EVBA 4KJNA 4C3IB 1G291 1SE2A 2IW3A 3FRPB 5JEAH 3QOLA 2X6GA 4HR7B 1STYA 4WFN3 4CJ2C 2RKSA 1RDPD 4C3HG 2EXZA 2NN6H 1LTBD 3DEOA 1EQVA 4EQPA 1CZGA 3DUZA 4K6LA 2EJMA 2LFNA 4RKBA 3T53B 5T1GA 5ELFA 1BF4A 3M4YA 5D3IB 1HXYD 1V1PB 1F2MA 2KVMA 4BBSB 1A6XA 1UAPA 1R9TB 3BVMA 4A3DB 2EYHA 1T5XD 2FMCA 4OIJA 5I9OA 4BBRB 2BA1A 2IX0A 2RA4A 3H0GB 1YNNC 4EGVA 2H4OA 1EQTA 3H6MA 4U68A 3S1NB 1SEBD 2E2DC 4G57A 3AB9A 1ZYRD 3FPPA 1PFBA 3DEPA 3MFGA 1D6EC 2FMMA 1ONLA 1ESRA 2JEBI 4H7BA 1RHPA 3L7ZC 4JBWA 1IYVA 3WOFA 5CV6A 2AUKA 1QNKA 1SDFA 3Q24A 2PMZB 4KHVA 2PQEA 5JVH3 2L4NA 1CA6A 1VMCA 4K5VA 1V1OA 2KOLA 3M7NA 2KECA 1XX8A 3NSWA 4NP5A 3U9OA 3L9AX 4DNRB 4KV6A 4YIJA 1BXTA 4J8QA 4RGTA 3NK9A 1HTLD 4RCOA 4HCEA 1AZQA 3E5SA 2B2VA 1NCVA 3R3OA 2OT2A 3NQTA 1JOKA 4C3IG 5C0XH 4AYBB 5K36G 3D4WA 3V96A 3MEHA 2F0DA 2AWOA 1W6KA 4XQNA 2NBFA 3G7LA 5M5WB 1S5BD 5FLXL 2L11A 3N6RA 4DAVA 3NHHA 1V1PA 3HOYB 3HEJA 2ICIA 1PZKD 3A56A 3ND9A 4A93B 1D2BA 3I90A 1KABA 1Q90A 2O2LD 4JK1C 2M9VA 4R8NA 1EYDA 2AWNA 4Y7NB 2YU9B 2R6GA 3VYRA 3SK6A 3GTMB 4RCNA 2L12A 5KEEA 4DGZA 3I70A 4HMIA 2NN6I 2WINB 1LV9A 4F88A 5CGKA 1STEA 4FXKC 1DM0B 3KK7A 1HA5A 1U4PA 1LACA 5C0XJ 3I4NB 5M5YB 1BNZA 1T5EA 5LL6S 3QB3A 4DAPA 3MXUA 1M4VA 3K58A 1BCPC 3HG9A 1ESFA 1Y8NB 4IN3A 2F0OA 3CHBD 2AQ2B 5BN5A 1DD2A 4LMQD 5AFWA 3S14B 1PTOB 1VCIA 1C8CA 1LTRD 3H3VC 1JORA 3A7AB 3J81E 3OHXC 2VXWA 3DWAA 3OIPA 1SMYC 1CZWA 4G7HC 1WTXA 1QWYA 4IUTA 1F9PA 5C3WA 1O7LA 3IFTA 3WDNA 1SBBB 1VF5C 4PMCA 2R93B 5A35A 4FF4A 1AN8A 3KLSA 4CJ0B 4A3BB 5IGEA 2F3VA 1PTOC 3TBIB 2XRSD 4ZAIA 2Z8LA 2A73B 3IAYA 5JEAG 1CT1D 2FINB 2QCPX 3SK5A 3VA5A 4C3HB 2F0PA 3DWQA 1W6JA 4KD3A 2HQEA 4FF3A 4FF2A 4FVMA 1DZ1A 3SXHA 1GHKA 2C5CA 4A3GB 1EY8A 1OXXK 1QG7A 3PIP3 1LT6D 1TWGB 4CKEA 4A3FB 1U9RA 4DN4M 2B8FA 3CU7A 1EFID 4DF7A 5I6WA 3MXGA 3D3RA 4RKLA 3FDTA 1CQFA 1SMYD 3U9SA 1HUMA 3QWNA 1AW7A 5HGTA 3HOVB 5DNFA 2RQXA 2SOBA 2DY8A 3OPOA 4BWGB 4K6DA 2RBMA 2K32A 4C1NI 1F9SA 1SNDA 3PUZA 2IL8A 3MAQA 1QILA 2R61A 1RJTA 2BDNA 2F1MA 1V8QA 2DY7A 1EEFD 3NTIA 4C1NK 1NSNS 5KNCA 4RFBA 2EY1A 3S2HB 5K36H 2HUGA 1S5FD 1X3PA 3GTGB 3GTQB 1KTKA 4OO1G 5EPJA 1B2TA 1F2LA 4OIKA 3KBGA 2A6EC 5CBEE 2VNUD 4G7OC 1SYGA 3J7AF 1BDOA 1STHA 3VYTA 2KUMA 4TRDA 4S3SA 4MIUA 3CKIB 3SK8A 2NVTB 4FYDA 3ERQA 4RGOS 1HHVA 3BZDB 1FYCA 3D4RA 3EQLC 3V05A 1EZ6A 4CKBA 1Y8OB 3HKZB 5JVG3 1TWCB 2LY7A 3BG3A 2F0NA 1PRTF 5D3DA 3MA2B 2I46A 4M1UB 3PUXA 4Z9CB 4Q0FA 1TKWB 2FJ2A 4OGQC 5CC4A 1LTSD 2B2WC 2E76C 2KHSA 2ZXRA 2TSSA 3WOEA 5I9PA 5JPMC 1EOTA 2XRQD 2L0CA 1TY2A 3A8JE 4F8MA 4P2CB 1LT4D 4KN4C 3OMGA 2G9DA 1QCBD 3ONAB 4EVOA 1LTAD 3Q23A 2IX3A 1I4XA 4KKTA 5M3MB 1TWAB 1JOQA 4XT3B 1OXTA 2CQAA 2CVRA 3ITPA 3N52A 1A2TA 5G3LF 1IYUA 4RGMA 5CYUA 3SK4A 4PMBA 4XYQA 5FKAC 4ZQ3A 4V0BA 4BY1B 3MZ5A 3P75A 3S1RB 1PTOD 2JYOA 1WTRA 1ICWA 1SYEA 1BQQT 2PNRC 3H94A 1CA5A 2NVQB 5DM73 4G4KA 4L63B 2HDMA 4C3JG 2HCIA 3BS1A 5CORA 2A6HC 1SYBA 4ZKBB 2ENBA 3T4AC 5COYA 1KNEA 2A69D 1STGA 1KDAA 2SDFA 1LLRD 4H13C 5A2QL 5IOCA 3NTKA 2NB0A 3J7YW 5EBCA 2XNAC 3S16B 1D1KA 2MPMA 1LT3D 4U673 1BOSA 1EYAA 1GUTA 3NWTA 5DAUA 1HPCA 5EPKA 1JR0D 5C4JB 2G9HD 5FLXE 1YNJD 3NXWA 3D8GA 5JOBA 4ABNA 3NBIA 5HURA 4KHZA 4QF4A 1EY6A 1SAPA 1MSHA 3EFXD 4RHRA 4XT1B 3HRZC 2F03A 1LTID 1Y69U 3LWEA 4PQXA 5KNBA 1KDBA 1C48A 5E4XA 3OWFA 1FNWA 3KBXA 5T1IA 1SNQA 5EPLA 3VR6A 2EYFA 2JSOA 4K8JA 4LJZC 3H91A 3I91A 1Y8PB 3BVGA 3R2TA 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY8 A;  1ENA A;  4ID6 A;  4K14 A;  3PMF A;  3C1F A;  3BDC A;  4K8I A;  2PZU A;  2F0U A;  4H7B A;  3SK8 A;  3TP6 A;  3MHB A;  5CGK A;  3TP5 A;  4DFA A;  1EY4 A;  3ERQ A;  1SYB A;  4J6H A;  5KYI A;  4KJO A;  2F0S A;  1EY9 A;  1U9R A;  2ENB A;  4IAL A;  5DEH A;  1II3 A;  1EY0 A;  2PYK A;  5CR3 A;  5KGU A;  1STG A;  2RDF A;  4K5W A;  1KDA A;  2F0I A;  5CV6 A;  4ZUJ A;  4QB4 A;  5C6A A;  3SHL A;  2O4X A;  2PZT A;  5IOC A;  4IZ8 A;  2EYM A;  2F0Q A;  2WAC A;  1TT2 A;  3D4D A;  4DF7 A;  1RKN A;  1SYF A;  1EZ6 A;  3QB3 A;  5I6W A;  4RKL A;  4KHV A;  5C4Z A;  2EYO A;  4DU9 A;  2PQE A;  1STB A;  5CV8 A;  1IHZ A;  2EY6 A;  2EYP A;  3RUZ A;  4K2L A;  2F0M A;  2EYL A;  5HGT A;  4K5X A;  2PZW A;  5IGB A;  5IGC A;  4K5V A;  2F0N A;  3T13 A;  5E1F A;  1EYA A;  5ISR A;  1A3T A;  2SOB A;  3ERO A;  5CV9 A;  5DAU A;  5F2D A;  5J22 A;  2F0O A;  1F2Y A;  4K6D A;  4B9W A;  5I6Y A;  3DMU A;  3MXP A;  4ODG A;  1ENC A;  3SR1 A;  4B9X A;  2F0H A;  5KIX A;  1SYC A;  2F0K A;  4NP5 A;  3TME A;  3U9O A;  5J39 A;  1TQO A;  2OEO A;  2RBM A;  4KV6 A;  4KY6 A;  3DHQ A;  2EYJ A;  4KJN A;  4PNY A;  4YIJ A;  5CV5 A;  2SNM A;  4KY7 A;  1JOR A;  3NXW A;  3D8G A;  2LKV A;  5C5L A;  4KTA A;  4F7X A;  5EGT A;  4I65 A;  3QOL A;  5JOB A;  2NUC A;  2QDB A;  1EZ8 A;  3P1H A;  5EKK A;  3NK9 A;  4OL7 A;  1STY A;  2F0E A;  5CC4 A;  1SYD A;  5HUR A;  1SND A;  1KAA A;  5JAV A;  2RKS A;  1A2U A;  4QMG A;  2EXZ A;  1EY5 A;  4KD4 A;  5EKL A;  2SNS A;  2F0F A;  2KHS A;  4QF4 A;  4HTH A;  4ME5 A;  5I9P A;  1EY6 A;  1EQV A;  5IIF A;  4EQP A;  3TP7 A;  3E5S A;  4RKB A;  3S9W A;  1TR5 A;  3R3O A;  1AEX A;  1NUC A;  2M00 A;  4J1M A;  4KY5 A;  3T16 A;  5CV7 A;  4F8M A;  3NQT A;  1JOK A;  1EY7 A;  1STN A;  5IGG A;  3NP8 A;  4EQN A;  4K2K A;  3OMG A;  5M9O A;  2EY5 A;  2OXP A;  1NSN S;  4EVO A;  3D4W A;  1F2M A;  5C3W A;  5K5P A;  1A3U A;  3MEH A;  1SNM A;  2F0D A;  4NMZ A;  3C1E A;  3D6C A;  5IGD A;  2EY1 A;  1F2Z A;  1SNO A;  3TP8 A;  2F0V A;  5C5M A;  1STA A;  4PMC A;  2EYH A;  1JOQ A;  4N9T A;  5I9O A;  1A3V A;  1KDB A;  1JOO A;  4WRD A;  4N9P A;  3ITP A;  1KDC A;  3HZX A;  3NHH A;  5KYL A;  4IUN A;  4HMJ A;  5IGE A;  2EY2 A;  1A2T A;  3MVV A;  4NKL A;  2F3V A;  2F3W A;  3H6M A;  3HEJ A;  3SK4 A;  2F0G A;  4EQO A;  4G57 A;  2KQ3 A;  4PMB A;  5NUC A;  1SNC A;  2PW7 A;  3OWF A;  5J1Z A;  3EJI A;  4ZQ3 A;  1SNQ A;  5KRU A;  1KAB A;  3MZ5 A;  3P75 A;  3QOJ A;  1SNP A;  3BDL A;  4R8N A;  5IGF A;  4E6I A;  3EVQ A;  2OF1 A;  3NUC A;  1EYD A;  2EYF A;  5C4H A;  5IOD A;  1EYC A;  1SYG A;  3OSO A;  4K8J A;  3SK5 A;  2F0L A;  4NDX A;  3VA5 A;  3V2T A;  2F0P A;  5E3F A;  3OMC A;  4WOR A;  4KD3 A;  2HQE A;  1STH A;  1SYE A;  2PW5 A;  3SK6 A;  3SXH A;  4TRD A;  3LX0 A;  2F0J A;  4ZUI A;  5C3X A;  4DGZ A;  2F0W A;  4LAA A;  4S3S A;  5KEE A;  2F0T A;  5CV4 A;  4MIU A;  4HMI A; 
#chains in the Genus database with same CATH topology
 4BA1 I;  3F2B A;  1BCP F;  2F0U A;  1GOZ A;  4LFC L;  2ID0 A;  4G7Z C;  1H9M A;  1PH7 A;  4GNX C;  1II3 A;  4X65 Q;  3SEB A;  2Z9H A;  2K50 A;  2PZT A;  3TSS A;  3GTP B;  2F3I A;  4ZRZ A;  3NBH B;  4OX9 L;  1SYF A;  2EYP A;  4GS3 A;  1PYS B;  4H0L C;  2WP8 J;  2BDO A;  5IY0 A;  3C46 A;  4OO1 H;  1ZEQ X;  1EIF A;  4RH6 A;  1AFP A;  3DM3 A;  5C3E B;  5F2D A;  2K5Q A;  2XTI A;  2A8V A;  3M7G A;  3T1Y L;  2O5I C;  2NVX B;  1XPU A;  1LO5 D;  4DR2 L;  2B2T C;  4ALP A;  1SYC A;  2A74 C;  3STB D;  1ICF B;  2ZM6 L;  4PNY A;  2IX1 A;  5FK9 C;  5FJ8 G;  2NVY H;  3GTQ H;  1A63 A;  3H3V I;  4R1J A;  2JN4 A;  4PG3 A;  3VA7 A;  3TP7 A;  5ELD A;  2JA6 B;  2R93 H;  2MHV A;  4UDU C;  2WKC A;  2ATW A;  2ZXP A;  5LHY 1;  1SE4 A;  4C3J H;  4AQY Q;  2ZT9 C;  1J5E L;  1I6H B;  2HD3 A;  1IL8 A;  5K5P A;  1XNQ Q;  1Q1B A;  1TS4 A;  3BYY B;  3Q22 A;  1R4Q B;  1CKM A;  2PI2 A;  2M2L A;  1VDZ A;  2N78 A;  1CUK A;  5BR8 L;  2UUA Q;  3E0J A;  4GZY C;  2PQA A;  1A3V A;  3S2D B;  1IKM A;  4DR1 L;  2WFW A;  3HZX A;  1B3A A;  3T56 B;  3HGB A;  3HOU B;  3G48 A;  3UDG A;  2EPB A;  1VQ9 A;  1U0L A;  1GVP A;  3J7A V;  3TRZ A;  1ET9 A;  3RZD B;  2PNH A;  1V9P A;  2YTY A;  5C44 G;  4YHH Q;  1O7Z A;  2HCC A;  1ZYR C;  1XYI A;  5GRO A;  1Q82 C;  2D2C C;  1G2S A;  2E74 C;  2I07 B;  4HAE A;  4UP8 A;  4LUO A;  1VQ7 A;  3OMC A;  1KLG D;  5BN3 A;  4A3G G;  1PMR A;  3KLW A;  1KC8 C;  2F0J A;  1K73 C;  2DJF C;  3OTO L;  2DUD A;  2D62 A;  3J80 c;  4ID6 A;  4RHS A;  2CKZ B;  1B1Z A;  1I6V C;  3O13 A;  4LK1 C;  3J80 L;  4DV2 L;  5FO9 B;  5C3E H;  4FNF A;  5AJ3 Q;  4A3D G;  4X66 Q;  2KHJ A;  1SFO B;  5KGU A;  1PXU A;  4OXP A;  3FMC A;  1EQR A;  1JWS D;  3I2Z A;  1B50 A;  1OXU A;  3ERS X;  4NB3 A;  3PCO B;  4DAY A;  4K0K Q;  1JE5 A;  1O7Y A;  2I5H A;  3GTP H;  3FEW X;  1BVS A;  1STB A;  1WFQ A;  2AHO B;  4JI3 Q;  2XIW A;  2RDH A;  3FKI G;  1BBW A;  3HP3 A;  3UDX A;  4H02 A;  2KCN A;  4ZLT F;  4DPG A;  2A68 D;  3STB C;  5GAH C;  1IBL L;  3TME A;  4JC0 A;  3D6W A;  5M5X B;  1RTO A;  3U50 C;  2JA8 G;  3H3V H;  1H9R A;  2EJF C;  3RMH A;  2NVY B;  2Q2U A;  2B2U C;  4Q5V A;  4GLX A;  2B8G A;  3P20 A;  3PO2 G;  1DOM A;  4IUQ A;  1O78 A;  3GTO B;  1LYL A;  4DV4 Q;  1UE5 A;  1XTC D;  3HOW G;  3HOZ G;  3S9W A;  3PSI A;  4KY5 A;  3I8Z A;  3K0Y A;  4TKO B;  2HHH Q;  3BDO A;  1ROD A;  3NEL A;  1Q3L A;  1STN A;  4BY7 G;  4IFD I;  1K3R A;  3I3C A;  3ZYY X;  4O2D A;  1HZC A;  3QJY A;  2L5T A;  3C1E A;  1Q8I A;  3I4M B;  4DNT B;  5FO7 B;  1TWF H;  1XXG A;  1Z6H A;  3HOX G;  2Z0S A;  1FD7 D;  1ILQ A;  4IQZ A;  4IUN A;  3TZD A;  4N8X 1;  1QE6 A;  4HJ5 A;  3A0J A;  3TN2 A;  4EQO A;  2Z1C A;  1WCM B;  3HOY G;  4A76 A;  1SNC A;  4FXD A;  1CK1 A;  3HKZ E;  2JQO A;  4HJ8 A;  2F4V Q;  2DJG C;  3QOJ A;  1MD2 D;  5IGF A;  1K8O A;  2E75 C;  1JCK B;  4L5T A;  5IOD A;  4QIW B;  1EYC A;  4A3M H;  4NDX A;  3ER0 A;  1HFN A;  4RG1 A;  2KA7 A;  3A55 A;  3LX0 A;  2K14 A;  3GQB A;  3HKS A;  4BBR H;  4A3L H;  4KKS A;  3W1G A;  4LF4 Q;  2O5J C;  2CFM A;  3LNN A;  1LAB A;  2K04 A;  1JE4 A;  1SLJ A;  1NTG A;  3NPP A;  5M5Y H;  3HS0 C;  2HIX A;  3BJU A;  3CCU A;  2K7V A;  5CR3 A;  1TWC H;  2NYZ D;  1HR0 L;  1EWC A;  3KYH C;  3S2D H;  4LF6 Q;  3TZU A;  3PO3 G;  5C6A A;  5C0X I;  3MTS A;  2XGT A;  1NJI C;  2B29 A;  4JV5 L;  4KKU A;  1H95 A;  2H1E A;  5M3F G;  4K2L A;  2AQ3 B;  3KF6 B;  1IYJ B;  1SJE D;  2IHF A;  3NBH A;  4I7A A;  1JJC B;  2VB2 X;  4TSS A;  2E2I B;  2Q8I B;  1V43 A;  5I6Y A;  1WVL A;  4ZYS A;  1AE3 A;  1EWI A;  4Y7N H;  1VQ8 A;  5FLX c;  4A3F G;  4A3I G;  3U4Z A;  2A68 C;  4FDB A;  4KY6 A;  2JK8 A;  1TII D;  2NVQ H;  3CMA A;  5I2Y A;  1GXD C;  1MKH A;  5C5L A;  5EGT A;  2B2T A;  4HCS A;  4XDX A;  2QDB A;  3CPW A;  4CJ1 B;  1UEA B;  2MJ8 A;  1N9W A;  1PRT B;  4HSP A;  4HIK A;  3RLF A;  4LWC A;  3CCQ A;  3HOV G;  1VF7 A;  1KNA A;  3OOC A;  1GUO A;  1TWA H;  4X64 Q;  2BE5 C;  1R9T H;  5C44 B;  5CV7 A;  1HZB A;  2N55 A;  4CDC C;  4JI0 L;  3KOJ A;  2OQ0 A;  1J6Q A;  4DV6 Q;  1F2Z A;  2D0P A;  2F4I A;  5JPN C;  1HQM C;  1C9O A;  1TY0 A;  1OO9 B;  1YHB A;  2IY5 B;  2KHI A;  3LWU A;  4NPS A;  5ELC A;  1UUP A;  3MVV A;  1VQ4 A;  3DXJ C;  3CCJ A;  3AU7 A;  3IFD A;  3RLN A;  1I4R A;  2LXJ A;  4C3H H;  4DUZ Q;  4BBR G;  4A3L G;  2ZTC A;  1XMO L;  4LUZ A;  3PV0 A;  1IBM Q;  4OWT B;  1U4R A;  4X62 Q;  1VQA A;  2PCF B;  4OHJ A;  2VQE L;  2JE6 I;  2B63 G;  1ET6 A;  1F9R A;  4C3J B;  4R4I A;  3KDF A;  1E0B A;  1TVX A;  4JG2 A;  1YNX A;  2MQH A;  2VL6 A;  2WB1 B;  5TSS A;  5C3X A;  5IE8 A;  1EU4 A;  2F0T A;  3S17 B;  2LMC B;  1H9K A;  4DR4 L;  2MFI A;  1E2Z A;  3C1F A;  3FPU B;  1KIX A;  3BDC A;  5D14 A;  4M8A A;  4YY3 Q;  1EY4 A;  3S1M B;  5IYB G;  5KYI A;  1XMO Q;  2HDL A;  3S24 A;  1Q81 C;  4UP9 A;  2X69 A;  4K5W A;  2EJG C;  4X62 L;  1L1O B;  3SHL A;  4CDD C;  2JA7 B;  3H15 A;  3GV3 A;  5M3M H;  1A15 A;  3OW7 A;  4YWL A;  3J81 c;  1CHQ D;  1YVC A;  3T1H Q;  2J7Z A;  1TU2 B;  2KCC A;  4FP5 D;  3RNU A;  1TS2 A;  3Q8D A;  4CDF C;  1G8Z D;  4CKC A;  3D31 A;  2PZW A;  1FJG L;  5JJI A;  1HQR D;  3K81 C;  1QZH A;  3ERO A;  3DLL A;  1HA6 A;  3MXP A;  1E3P A;  1PZI D;  1HUN A;  2R92 H;  1A62 A;  1JJG A;  1I6H H;  3EBE A;  2PMZ E;  1AZP A;  2VUM B;  1I5F A;  4C56 C;  1KAA A;  4GLA C;  2DNE A;  4LF7 Q;  1I4Q A;  5IYD G;  4TQU S;  5C3E G;  2F0F A;  4A3K B;  2MGS A;  4DK1 A;  2XVS A;  3GD7 A;  1N36 Q;  3T16 A;  1OXS C;  4P72 A;  4LF5 L;  4EQN A;  3PIO A;  2OXP A;  4FO2 A;  1ILP A;  2AKW B;  2B2U A;  1SE8 A;  2EE1 A;  3ULL A;  1TXY A;  1SJH D;  1TS5 A;  1OXV A;  4LF7 L;  2B2Y A;  5LMU Q;  3M3Y B;  1JB7 A;  4LFA L;  1JMC A;  4V19 0;  1L2F A;  4I7Z C;  1S72 A;  3CCR A;  1KHI A;  2F0G A;  1SXT A;  1WYD A;  4JYA Q;  3DM1 A;  2JJQ A;  1SE3 A;  5I4D A;  1YHQ A;  1EYG A;  2J0T D;  2Z4H A;  5KRU A;  5GQO A;  4DKA C;  4ZKC B;  4JI2 L;  4DV7 Q;  3NUC A;  2KJX A;  4F87 A;  2AQ1 B;  1B9N A;  1Y14 B;  2ZXO A;  4MN3 A;  1KD1 C;  2XWB B;  3E9H A;  1DXM A;  1ENA A;  2QEJ C;  4K8I A;  1IXR A;  1EIH A;  1QVF A;  3UE1 A;  4DXG A;  3RZO H;  3HOZ B;  1D5Z C;  1EY9 A;  2EOT A;  1Z7T A;  3NTH A;  2UUB L;  4UY8 C;  2K5D A;  1YHA A;  2TMP A;  4AYB G;  2JA5 B;  1H9J A;  1JIC A;  5C4Z A;  3AFP A;  4NXN Q;  2Q2I A;  4GN5 A;  3T51 B;  4HED A;  1RTN A;  5M5X H;  3PUY A;  2B2W A;  5IGB A;  2IT1 A;  4LF9 Q;  2I0Q A;  2K03 A;  1YNJ C;  3A7L A;  2GVA A;  1UEB A;  1G6P A;  3MFY A;  1TWH B;  3K5M A;  3K57 A;  3E3X A;  1SRO A;  2EXD A;  4GOP C;  1RIP A;  2YTV A;  1EZ8 A;  1SSO A;  1IW7 D;  3U58 A;  1SYD A;  3HOW B;  1HTP A;  5JJK A;  4JOI C;  5EKL A;  4YCW A;  1XNQ L;  1VQM A;  4ME5 A;  2KCM A;  1G2T A;  1PA6 A;  5KND A;  1U4M A;  2K01 A;  1TR5 A;  2BCO A;  1BO0 A;  4DV3 Q;  2UUA L;  2XSC A;  1BUV T;  1BCP B;  2A69 C;  4JBJ A;  4A3M B;  3OIQ A;  1UE1 A;  2A6H D;  1FGU A;  3X3N A;  1A3U A;  3CC4 A;  4XTC S;  2L9H A;  4X3T A;  4KK7 A;  5DM6 3;  4GNX B;  2B2V C;  2K75 A;  3GTJ B;  2VW9 A;  2WII B;  1E1T A;  4GKK L;  1MI2 A;  5IP7 G;  4O0A A;  1L0X B;  5NUC A;  3EIV A;  2C9O A;  2IJ0 A;  4A3B G;  1PH8 A;  2Q8T A;  3GTJ H;  1SNP A;  3VYU A;  1DJR D;  3TRE A;  5ELB A;  3J7A 5;  3SDZ A;  4H44 C;  3S1N H;  1WD1 A;  4JVZ A;  1HZ9 A;  4GNX A;  4HSV A;  3H0G G;  3S15 B;  1C4Q A;  4A3I B;  2QA4 A;  1PH5 A;  2ASB A;  1DOL A;  2F0I A;  4QB4 A;  3F2C A;  3JC6 6;  1FR3 A;  2IWH A;  1LTT D;  1MJC A;  2EYM A;  4JI1 Q;  2N8N A;  2NWG A;  1NNX A;  3OWE B;  3RUZ A;  1E7Z A;  4IUR A;  1IW7 C;  2NN6 G;  1AE2 A;  3GTK B;  2EDG A;  3K5N A;  1YBY A;  3U4V A;  2EQS A;  5J22 A;  2A5H A;  1Q12 A;  1HJP A;  3CP0 A;  1SMX A;  5CMD A;  2YU9 H;  2C35 B;  4B9X A;  5IWA L;  1Q1E A;  1N34 Q;  4A3M G;  3VYS A;  4A3E B;  4PZ6 A;  3NWS A;  1HNZ L;  1MIU A;  4JI4 Q;  4B3M L;  2CH4 W;  2LSS A;  2UXB Q;  1VQN A;  4JI3 L;  4IFD J;  3HOY H;  1EY5 A;  1RD9 D;  2SNS A;  5IIF A;  3R93 A;  5EQ0 A;  2RDG A;  2E8G A;  3GV6 A;  4JOI A;  2K5V A;  1NUC A;  4GKJ Q;  3AQQ A;  2ZJQ A;  1CFM A;  1Q7Y C;  3R8B A;  1PRT D;  1I4P A;  1XNR L;  4XYO A;  3AMU A;  3KUP A;  1GHJ A;  4NMZ A;  3K6O A;  2QDL A;  3GTL B;  3QIA A;  2UXB L;  2F0V A;  1STA A;  4R4T A;  4IPD A;  2QKI C;  1KRS A;  4N9P A;  5ELE A;  1HCZ A;  5IP7 H;  3I55 A;  3I4L A;  1I50 H;  4HMJ A;  1F77 A;  2A6E D;  4POG A;  2UXC L;  5GAE C;  2HHH L;  4NXM Q;  2HIV A;  2RSN A;  4QY7 A;  4MZ9 A;  1EWH A;  4DV6 L;  2A1A A;  3MC0 B;  1X3E A;  3KF8 B;  3UI2 A;  2RVL A;  3R2I A;  3BYT B;  2Y0S E;  3W3A A;  2F0W A;  1I50 B;  5CV4 A;  5C4X B;  2JA8 B;  1DON A;  3PMF A;  4X3S A;  1S40 A;  2PO4 A;  2FHT A;  3CC2 A;  1QJO A;  3HOX B;  3HFZ B;  3KLS X;  2NTS A;  1PRT C;  3PUV A;  4OO1 I;  4ZUJ A;  1CI3 M;  3VR5 A;  2O4X A;  2R7Z B;  3F8T A;  3I56 A;  1RKN A;  3EN2 A;  2NVX H;  3OW2 A;  4DV0 L;  1MGS A;  4DK0 A;  2MP1 A;  3B6Y A;  4X3U A;  5EKI A;  1A0I A;  1EOV A;  1WCM H;  4O42 A;  1EIG A;  4ODG A;  3SE0 A;  1RL2 A;  5J39 A;  2B63 H;  4GN4 B;  5CV5 A;  5G3L D;  2QF7 A;  1W3S A;  1DOK A;  4L6T B;  4F7X A;  4A3E G;  1Y1W H;  2E2H B;  2QIL A;  5E4W C;  2F0E A;  1TWG H;  4LUV A;  4QMG A;  3GO5 A;  1CTM A;  4KD4 A;  2RHQ B;  4DV5 L;  1S5E D;  1B70 B;  4IFD G;  1LTL A;  2JEA I;  4DR6 Q;  2LXK A;  2RSO A;  3MXN A;  3FKI B;  3UDF A;  2UU9 Q;  4HN7 A;  2MUY A;  2VUM G;  1AEX A;  4L5S A;  3M4O B;  4P71 A;  5IP9 H;  3KFU A;  4TVA B;  2R7Z H;  1K0R A;  1RF2 D;  4K2K A;  3J80 E;  5M9O A;  2EY5 A;  4QL5 A;  1PDQ A;  2BH8 A;  2WB1 G;  3CCE A;  2KED A;  1O80 A;  4O1N A;  1SNO A;  3G6J B;  5C5M A;  4JI7 L;  3A8I E;  2ZTE A;  2JP1 A;  2VB3 X;  4WJW A;  4JI8 Q;  5ELN A;  2E2J B;  1PH6 A;  1NMG A;  1WTQ A;  1JOO A;  4WRD A;  1UE7 A;  4B08 A;  1JB3 A;  5BN4 A;  3HOV H;  1VQK A;  2EY2 A;  4DR5 Q;  4NW2 A;  1WTV A;  2F3W A;  1LT5 D;  4C2M B;  4XQJ A;  1C7Y A;  4RAU C;  3FKI H;  5J1Z A;  1E2W A;  3J81 L;  1QZG A;  1M90 C;  3A74 A;  1MSG A;  2BOS A;  3BDL A;  2K5W A;  3JAM i;  2OF1 A;  1YNN D;  3KJO A;  1GD7 A;  3OSO A;  4JI7 Q;  1X65 A;  2Y0S B;  1VQL A;  3NQI A;  1J8I A;  1U5K A;  1WTH A;  5EJW A;  2ZTD A;  1HFG A;  1PFM A;  4PZ8 A;  2EZV A;  4BY1 H;  2CWP A;  4CGY B;  1H9S B;  4DR5 L;  1VS0 A;  4R4Q A;  2D0O A;  3TDQ A;  3L3O C;  4EX5 A;  1B9M A;  4DUZ L;  2F0S A;  4DUY Q;  4IAL A;  1JWU D;  1MJE A;  4L5Q A;  1PZJ D;  4A3G H;  4A3J B;  2XWJ B;  4N8F A;  4IZ8 A;  1ML0 D;  4EQ5 A;  5LMN L;  3MWY W;  3CRK C;  1NMF A;  5CV8 A;  1I3Q H;  5EAY A;  3URY A;  2F0M A;  1B4O A;  1H9S A;  4K5X A;  3IKJ A;  1I4H A;  3T13 A;  4LFC Q;  5ISR A;  4B9W A;  1NR2 A;  3PIO 3;  3K0X A;  2DNC A;  4OEL B;  4X65 L;  4BBS G;  2F0H A;  2UUB Q;  1UNS A;  2OEO A;  3HOU H;  4OEM B;  2EYJ A;  4DXF A;  2SNM A;  2V1C C;  3KF8 A;  2AMC B;  3TEH B;  3P1H A;  1BCP D;  4OL7 A;  3T1H L;  1QUQ A;  2GA4 B;  2NTT A;  2SEB D;  3I4O A;  2JA6 H;  2ICE C;  4LF9 L;  2YTX A;  1IKL A;  4KHP L;  4PMW A;  2L55 A;  2UXD L;  4J1M A;  2M00 A;  1BBX C;  5BR8 Q;  2NZ1 D;  2V4D A;  1BR9 A;  1U4L A;  4RMF A;  1EY7 A;  3SVM A;  3NP8 A;  2VY3 A;  3PO3 H;  1GUS A;  1R4P B;  3VDY A;  1PH1 A;  2LS0 1;  1SNM A;  3D0F A;  3D6C A;  3BVZ A;  4RA8 A;  3J7Z C;  2B2Y C;  1GJX A;  3KLR A;  4PV1 C;  2XN9 C;  2N88 A;  2GN5 A;  1B44 D;  3CRL C;  5L37 A;  5C0X G;  1PYW D;  4YHH L;  1E24 A;  1KDC A;  3CCS A;  1PTO H;  2CW0 C;  2NZO A;  3G71 A;  1WTP A;  2J4X A;  4LFB L;  2KQ3 A;  2WKD A;  4GOP B;  3H09 A;  1KLU D;  1WD0 A;  1Y1W B;  2KEN A;  3Q0A A;  3EJI A;  3OTO Q;  4HJA A;  3QO2 A;  3KF6 A;  3GTG H;  4E6I A;  5E7N A;  3I4M G;  1PH9 A;  1UE6 A;  2Z6K A;  1P8L A;  1ZKO A;  1OTC A;  4FXG C;  4B3S Q;  3ND8 A;  1CM9 A;  1DCZ A;  2Q8R E;  3CW2 C;  1X32 A;  1O7I A;  4LFA Q;  1Q86 C;  2K33 A;  1GUG A;  4DAM A;  2Q2H A;  3TP6 A;  3MHB A;  4ILW A;  1F9Q A;  2PI2 E;  3ULP A;  4IFD H;  3F2U A;  4J6H A;  3M85 A;  1JC7 A;  4Y52 H;  2PYK A;  1K8M A;  2RDF A;  2CH4 A;  1KXL A;  1YEZ A;  2K28 A;  3K7A B;  3TS2 A;  3K59 A;  2VZA A;  2WAC A;  1X56 A;  2OWO A;  4MHE A;  1TT2 A;  3ULJ A;  1HNW L;  5JEA J;  2FFK B;  1IHZ A;  2VQF L;  1I94 Q;  1EU3 A;  2WAQ B;  2DGY A;  2X6L A;  4IPG A;  4R8I A;  3CPF A;  3L0O A;  2JA7 G;  5IGC A;  1YJW A;  4BA2 I;  1J9O A;  4A3J G;  2NZH A;  1I3Q B;  1ZXT A;  1F2Y A;  2IPK D;  4DA2 A;  4OX9 Q;  3CQZ B;  1JQY D;  3IL8 A;  4X66 L;  1ENC A;  1B8A A;  2KEE A;  3S15 H;  2ALY B;  1TQO A;  1RCV D;  3AYH B;  2RHS B;  2P5Z X;  3DHQ A;  4BY7 B;  4KY7 A;  1GUN A;  2LKV A;  4XIG S;  3ICE A;  4IUU A;  4I65 A;  4IUP A;  3TQY A;  2NUC A;  1WTW A;  3JAM L;  5JAV A;  1PV4 A;  2VQF Q;  1I94 L;  2CCZ A;  2K5H A;  2UUC Q;  1B53 A;  2B63 B;  1XJV A;  3PO2 B;  2YYZ A;  2L1B A;  1W2B A;  1FNU A;  3NEN A;  4JCV E;  4RGN A;  2D9U A;  2JA7 H;  4GLV B;  4HID A;  1CKN B;  1Y1V B;  1HZA A;  4UAI A;  1HNZ Q;  1QB5 D;  4B3M Q;  5IGD A;  1PLF A;  1NAP A;  5IYB H;  3TP8 A;  1AP0 A;  2KCT A;  2Z4I A;  4N9T A;  1D5X C;  2L15 A;  4CHT B;  4AQY L;  1S5C D;  5KYL A;  2MO1 A;  3K5O A;  2CHB D;  3HOX H;  4RWS C;  1EEI D;  3K80 C;  2Y0S G;  1VQG A;  1Z47 A;  3K8A A;  4X3K A;  2K6A A;  2R3Z A;  1X55 A;  4UPA A;  3S1Q B;  4X6A H;  3EVQ A;  1NR4 A;  2CWA A;  4QIW E;  4WOR A;  1M8A A;  4ULL A;  1K83 B;  2PW5 A;  4ZUI A;  1Y1V G;  4LAA A;  5IT9 E;  1PTO F;  1FGB D;  2UXC Q;  1I4G A;  1CQV A;  1D1I A;  2PZU A;  3A8K E;  1X3G A;  4P74 A;  3TP5 A;  5H1S E;  3CF5 A;  3W1B A;  5DEH A;  3GP7 A;  1EY0 A;  4IJL A;  3Q6S A;  3K7U C;  2BE5 D;  1EL0 A;  3RD4 A;  1KAW A;  4FF1 A;  1B3Q A;  5EBD A;  3I73 A;  2E5L L;  3GTL H;  3VR2 A;  4DV2 Q;  1DYQ A;  2VUM H;  1Q46 A;  1YIT A;  1QOH A;  5IWA Q;  2EY6 A;  1PH3 A;  3RN5 A;  5E1F A;  3X3M A;  1L0Y B;  5CV9 A;  3RZO B;  1L0W A;  4HJ9 A;  4R9W A;  3DMU A;  3J81 i;  3PF4 A;  5KIX A;  4IUV A;  2F0K A;  2WV6 D;  4B3T Q;  3H0G H;  1QNU A;  3I72 A;  3DWP A;  2K1B A;  5I2X A;  1BKB A;  3CXC A;  4XQQ A;  3C2P A;  4KTA A;  4QUF A;  5FO8 B;  4X64 L;  5EKK A;  3I4N G;  3W2D A;  4GOP A;  1ENF A;  2OCE A;  3T1Y Q;  1A2U A;  4XXE A;  4JI0 Q;  4DR2 Q;  1HRJ A;  3PUW A;  3FVQ A;  3M4P A;  1LTG D;  4HTH A;  5IYC H;  1X3Q A;  1TS3 A;  5C4X H;  4DR1 Q;  1D8L A;  4QJF A;  2B39 A;  5M3F B;  4L8J A;  1X9N A;  5A2Q E;  1D5M C;  1WTO A;  3VR4 A;  5IGG A;  1K28 A;  2QGQ A;  1FNV A;  3PO3 B;  5HGQ A;  3P7J A;  3NEM A;  1CHP D;  5IT9 L;  1JWM D;  1E2V A;  1VMP A;  2GVB A;  4UHV A;  3RLO A;  4QCL A;  2WAQ G;  4LW1 A;  3S1R H;  1J5E Q;  1S4Z A;  1G6Z A;  5C4X G;  5CBA E;  4NKL A;  2RCN A;  2DN8 A;  1VQC A;  3K5L A;  2HT1 A;  5FOB B;  2PW7 A;  4BS9 A;  4B3R L;  1A8V A;  4KN7 C;  4CBV A;  3QG1 A;  2CW0 D;  3NE5 B;  5C4H A;  4GKK Q;  2F0L A;  3V2T A;  5E3F A;  5D65 A;  3AEV A;  4JI8 L;  4K0K L;  5LL6 X;  2AUJ D;  2R92 B;  4PZ7 A;  4ZK9 B;  4LF6 L;  4K14 A;  4KI0 A;  1TWF B;  4DFA A;  4AH6 A;  4JBM A;  1S5D D;  4KJO A;  2EIF A;  2ZJP A;  1XWE A;  3C3L A;  4A3J H;  2K05 A;  1IBM L;  1YZ6 A;  4KMU C;  4QUC A;  2JXM B;  1XTD A;  2F0Q A;  1BBU A;  3D4D A;  1N33 Q;  4C2M H;  2EYO A;  4DU9 A;  2CQO A;  1YJN A;  3A54 A;  3JAM E;  1G91 A;  2HQL A;  3S17 H;  1GUW A;  1NE3 A;  2EYL A;  3E6Z X;  4KLK A;  3VR3 A;  1VQ6 A;  1A3T A;  3EA6 A;  1X54 A;  1PFN A;  5JJZ A;  3SR1 A;  4DV5 Q;  2PPB C;  1MBY A;  4LNQ A;  2D5D A;  2EVB A;  4KJN A;  4C3I B;  1G29 1;  1XPR A;  1SE2 A;  1N32 Q;  1N36 L;  2IW3 A;  3FRP B;  5JEA H;  3QOL A;  2X6G A;  4HR7 B;  1STY A;  2OQK A;  4WFN 3;  4CJ2 C;  2RKS A;  1RDP D;  1QVC A;  3J81 j;  3L2P A;  4DV0 Q;  3S2H H;  4C3H G;  2EXZ A;  3GTK H;  2NN6 H;  1LTB D;  4BY7 H;  1FJG Q;  3DEO A;  1EQV A;  5GAD C;  4EQP A;  1WJJ A;  1CZG A;  3DUZ A;  4K6L A;  2EJM A;  4LF8 L;  3G6E A;  2LFN A;  4RKB A;  3T53 B;  5T1G A;  5ELF A;  1BF4 A;  3M4Y A;  5D3I B;  1HXY D;  2E2H H;  5FLM G;  1V1P B;  1F2M A;  2KVM A;  4DV4 L;  4BBS B;  1A6X A;  3E0E A;  1UAP A;  1HNX Q;  4MNO A;  3FP9 A;  3BVM A;  1R9T B;  4A3D B;  2EYH A;  1T5X D;  2FMC A;  4OIJ A;  5I9O A;  3SGI A;  2WB1 E;  4WJ3 M;  4BBR B;  2BA1 A;  2IX0 A;  2RA4 A;  3H0G B;  3BU2 A;  3S14 H;  1YNN C;  4EGV A;  1E22 A;  2H4O A;  1EQT A;  3H6M A;  4U68 A;  5C44 H;  3S1N B;  1SEB D;  2E2D C;  2Z6K C;  4G57 A;  3AB9 A;  1ZYR D;  3FPP A;  1PFB A;  1VQF A;  4J15 A;  4HIO A;  1HR0 Q;  3DEP A;  3MFG A;  1D6E C;  1HNX L;  5M3M G;  1UWV A;  2FMM A;  5ELO A;  1ONL A;  4A3F H;  1XMQ Q;  3UE0 A;  1HH2 P;  1KL9 A;  3HOU G;  1ESR A;  2JEB I;  4H7B A;  5LMN Q;  1RHP A;  2K4K A;  3L7Z C;  4JBW A;  4IO9 A;  1IYV A;  3WOF A;  3RN2 A;  2R93 G;  4BY1 G;  4IOC A;  3S1Q H;  5CV6 A;  2AUK A;  1QNK A;  1SDF A;  3Q24 A;  5IT9 c;  1IBK L;  2I5M X;  3CQZ H;  2PMZ B;  4KHV A;  5FJ8 H;  2PQE A;  3CCV A;  1VQH A;  5JVH 3;  2IHE A;  2L4N A;  1YI2 A;  3CC7 A;  1CA6 A;  1SRU A;  4C3I H;  1VMC A;  1GKH A;  4K5V A;  1V1O A;  2KOL A;  3M7N A;  2KEC A;  1XX8 A;  3NSW A;  4NP5 A;  3U9O A;  3L9A X;  4DNR B;  4KV6 A;  4YIJ A;  1BXT A;  1AH9 A;  4J8Q A;  4A3C G;  4RGT A;  2RCF A;  1Y1V H;  3NK9 A;  1X6O A;  3KJP A;  4OON A;  1HTL D;  4RCO A;  4YCV A;  4HCE A;  1E1O A;  4A75 A;  3E5S A;  2B2V A;  1AZQ A;  1NCV A;  3R3O A;  1VQI A;  1EFW A;  2OT2 A;  3NQT A;  1JOK A;  4C3I G;  1DGS A;  5C0X H;  1SR3 A;  4AYB B;  1VQ5 A;  2JA5 G;  5K36 G;  1VQO A;  3D4W A;  3V96 A;  3MEH A;  2F0D A;  2AWO A;  1W6K A;  4XQN A;  4LFB Q;  2F52 A;  2NBF A;  3G7L A;  5M5W B;  4QQB X;  4DV1 L;  1S5B D;  5FLX L;  2L11 A;  1VQB A;  3N6R A;  4JI2 Q;  4DAV A;  3NHH A;  1V1P A;  1WCM G;  3HOY B;  3HEJ A;  5J3B A;  3RZD H;  4JI6 L;  2R7Z G;  2ICI A;  4B3S L;  1VQD A;  1PZK D;  3A56 A;  3ND9 A;  4AYB E;  4A93 B;  4JPB W;  2WAQ E;  2PQA B;  2OTL A;  1D2B A;  3I90 A;  1KAB A;  4IPH A;  1Q90 A;  1G51 A;  2O2L D;  3F1Z A;  2M9V A;  2Z6B A;  4JK1 C;  4R8N A;  4A3K G;  3S16 H;  1EYD A;  2AWN A;  4Y7N B;  3QR8 A;  2R6G A;  4HIM A;  3VYR A;  5AJ3 L;  2YU9 B;  1B7Y B;  1Y1W G;  3SK6 A;  3GTM B;  4RCN A;  2L12 A;  5KEE A;  4DGZ A;  4A3E H;  3I70 A;  4A3B H;  1KRT A;  4HMI A;  2NN6 I;  2WIN B;  1LV9 A;  4F88 A;  4R4C A;  5CGK A;  4AIM A;  4A4I A;  2JA9 A;  1STE A;  5JJL A;  4FXK C;  1DM0 B;  3KK7 A;  1HA5 A;  1EQQ A;  1U4P A;  1PHJ A;  4DR4 Q;  2BH2 A;  1LAC A;  5C0X J;  4DR3 L;  3I4N B;  4DR7 L;  5M5Y B;  1BNZ A;  1T5E A;  5LL6 S;  3QB3 A;  4DAP A;  4YY3 L;  4A3I H;  3F2D A;  3MXU A;  1M4V A;  2ZJR A;  4DUY L;  1PH4 A;  3K58 A;  3IRB A;  1BCP C;  3HG9 A;  1ESF A;  1Y8N B;  4IN3 A;  5M3F H;  2F0O A;  3CHB D;  2AQ2 B;  3W5O A;  5BN5 A;  1DD2 A;  4LMQ D;  1MHW C;  5AFW A;  2UUC L;  3S14 B;  1PTO B;  1VCI A;  1C8C A;  1LTR D;  3H3V C;  1JOR A;  5C4J H;  3JAM c;  3A7A B;  2E5L Q;  4JI1 L;  3J81 E;  3OHX C;  2VXW A;  3DWA A;  3OIP A;  5M5W H;  1SMY C;  1X3F A;  3S1M H;  2KBN A;  1CZW A;  1ASZ A;  2ES2 A;  2ZM6 Q;  1JT8 A;  3CCL A;  1EUJ A;  4G7H C;  1WTX A;  1QWY A;  4IUT A;  3HOW H;  4JYA L;  1F9P A;  1N34 L;  3M3Y H;  5C3W A;  1O7L A;  4BXX G;  3IFT A;  3WDN A;  1SBB B;  4DV7 L;  1VF5 C;  2R7D A;  1K9M C;  4PMC A;  2R93 B;  5A35 A;  1N8R C;  4FF4 A;  1NY4 A;  1AN8 A;  1WI5 A;  2K52 A;  1XPO A;  3CME A;  3KLS A;  4CJ0 B;  4A3B B;  5IGE A;  2F3V A;  1LUZ A;  1PTO C;  4A93 H;  4ME3 A;  4GKJ L;  3TBI B;  2XRS D;  4ZAI A;  4DK6 C;  1LM0 A;  2Z8L A;  3M4Q A;  2A73 B;  3IAY A;  4LF4 L;  5JEA G;  2QEX A;  4DAY B;  1FL0 A;  1CT1 D;  2FIN B;  2QCP X;  4ZCK A;  3SK5 A;  3VA5 A;  4C3H B;  1V1Q A;  2F0P A;  3DWQ A;  1W6J A;  4KD3 A;  2HQE A;  4FF3 A;  4QGU A;  4FVM A;  4FF2 A;  1DZ1 A;  3SXH A;  1GHK A;  2C5C A;  4BXX H;  4A3G B;  1EY8 A;  1OXX K;  1QG7 A;  1VQE A;  3MXN B;  3PIP 3;  2JA6 G;  1LT6 D;  1TWG B;  4CKE A;  4A3F B;  4POF A;  4P73 A;  3OYY A;  1U9R A;  4DN4 M;  2NVT H;  3ZJY C;  2B8F A;  4P75 A;  2MO0 A;  3CU7 A;  1SFO H;  3BZK A;  1D7Q A;  1EFI D;  4DF7 A;  1GM5 A;  5I6W A;  3MEF A;  3D3R A;  3MXG A;  4RKL A;  3AFQ A;  2QW7 A;  4B3T L;  3FDT A;  1CQF A;  1SMY D;  3U9S A;  1HUM A;  3QWN A;  1AW7 A;  5HGT A;  3HOV B;  1K3B C;  1S3O A;  5DNF A;  2RQX A;  2SOB A;  2DY8 A;  3OPO A;  4BWG B;  4K6D A;  4OWW B;  4DV3 L;  3A5Z B;  3WWV A;  1L1O A;  2RBM A;  4DR6 L;  1IZ6 A;  2K32 A;  3CD6 A;  4C1N I;  1F9S A;  4A3D H;  1SND A;  2MNA A;  1ASY A;  3K7A H;  3PUZ A;  4BBS H;  2IL8 A;  3MAQ A;  1QIL A;  2R61 A;  1RJT A;  2BDN A;  1C0A A;  2F1M A;  1V8Q A;  2DY7 A;  1P16 A;  1EEF D;  3NTI A;  1M1K C;  4C1N K;  2OTJ A;  1NSN S;  1N32 L;  5KNC A;  1EIY B;  4RFB A;  3GTM H;  2EY1 A;  3S2H B;  2JA5 H;  5K36 H;  1K8G A;  2HUG A;  1S5F D;  1X3P A;  4A3K H;  3I7F A;  2FXQ A;  4A93 G;  2R7F A;  3GTG B;  5IYC G;  3GTQ B;  1KTK A;  4OO1 G;  3I4M H;  5EPJ A;  3TS0 A;  1Z9F A;  1IL2 A;  1F2L A;  1B2T A;  4OIK A;  3KBG A;  2RF4 A;  2A6E C;  5CBE E;  2VNU D;  4G7O C;  1SYG A;  1PH2 A;  3J7A F;  4IOA A;  4IPC A;  4OWX B;  1BDO A;  1STH A;  3VYT A;  2Q2T A;  2KUM A;  4TRD A;  1QUQ B;  4S3S A;  4MIU A;  2H5X A;  1L1O C;  3CKI B;  3SK8 A;  2NVT B;  4FYD A;  1N33 L;  3ERQ A;  4B3R Q;  4RGO S;  1HHV A;  1IBL Q;  3BZD B;  1FYC A;  3D4R A;  3GDE A;  4JW0 A;  3EQL C;  4JI4 L;  1K83 H;  3FHW A;  4GN3 B;  3V05 A;  4WJ4 A;  1EZ6 A;  1CKO A;  4CKB A;  1Y8O B;  3HKZ B;  2A19 A;  5JVG 3;  1TWC B;  2LY7 A;  3BZC A;  3BG3 A;  3GTO H;  2F0N A;  1PRT F;  2I5L X;  5D3D A;  3MA2 B;  1KQS A;  4MTK A;  2I46 A;  4MTN A;  3UDI A;  1VQP A;  2JA8 H;  4R4O A;  4M1U B;  3PUX A;  4Z9C B;  4Q0F A;  4KHP Q;  2UXD Q;  1TKW B;  2FJ2 A;  3A5U A;  1IBK Q;  1T9H A;  1K8A C;  4OGQ C;  5CC4 A;  1LTS D;  4LF5 Q;  1Q8K A;  2B2W C;  2E76 C;  2KHS A;  2ZXR A;  2TSS A;  3WOE A;  5I9P A;  5JPM C;  1EOT A;  1HR0 W;  2XRQ D;  1CSQ A;  4JI5 Q;  2L0C A;  3G4S A;  2K5N A;  1TY2 A;  3A8J E;  4NXM L;  4JBK A;  4F8M A;  4P2C B;  1LT4 D;  4KN4 C;  3OMG A;  2G9D A;  1QCB D;  3CCM A;  1K0S A;  3ONA B;  4EVO A;  1LTA D;  3Q23 A;  2F4V L;  2IX3 A;  2UU9 L;  1I4X A;  4KKT A;  5M3M B;  2VQE Q;  1TWA B;  5FLM H;  1JOQ A;  4XT3 B;  1OXT A;  2CQA A;  2CVR A;  3ITP A;  1XNR Q;  4JI5 L;  3N52 A;  1A2T A;  2G5D A;  5G3L F;  1IYU A;  4RGM A;  3PIP A;  5CYU A;  3SK4 A;  1XMQ L;  4PMB A;  2N3S A;  1NBW A;  5FKA C;  4XYQ A;  1CKN A;  2N49 A;  4ZQ3 A;  4V0B A;  4BY1 B;  3MZ5 A;  3P75 A;  3S1R B;  3CAM A;  1PTO D;  1WOC A;  2JYO A;  3PGZ A;  1WTR A;  1ICW A;  1YJ9 A;  1VQJ A;  3I4N H;  1SYE A;  4JV5 Q;  1BQQ T;  2PNR C;  4HJ7 A;  3H94 A;  1CA5 A;  2NVQ B;  5DM7 3;  3RR5 A;  4G4K A;  4L63 B;  2HDM A;  4C3J G;  2HCI A;  3BS1 A;  5COR A;  2A6H C;  1SYB A;  4ZKB B;  2E2I H;  4NXN L;  2ENB A;  3T4A C;  5COY A;  1KNE A;  2A69 D;  1STG A;  1KDA A;  2SDF A;  1LLR D;  4H13 C;  3J80 i;  2E2J H;  5A2Q L;  4A3C H;  1TWH H;  5IOC A;  1FVI A;  2VS1 A;  3NTK A;  5IP9 G;  2NB0 A;  3J7Y W;  5EBC A;  2XNA C;  3PF5 A;  3E9I A;  1D1K A;  3PQI A;  3S16 B;  4L5R C;  2MPM A;  4DNI A;  1LT3 D;  2YV5 A;  4YCU A;  4U67 3;  5HY6 A;  1BOS A;  1EYA A;  1GUT A;  3NWT A;  5DAU A;  1HPC A;  1QVG A;  5EPK A;  2B3G A;  1JR0 D;  4YWK A;  1PFS A;  2G9H D;  5C4J B;  5FLX E;  1YNJ D;  3NXW A;  3D8G A;  4DR3 Q;  4DR7 Q;  1JJ2 A;  5JOB A;  4ABN A;  1HNW Q;  1CSP A;  3NBI A;  1YIJ A;  5HUR A;  3HOZ H;  4KHZ A;  4APV A;  4QF4 A;  1EY6 A;  1SAP A;  3PO2 H;  1MSH A;  3EFX D;  4RHR A;  4DK3 C;  4XT1 B;  3HRZ C;  5GAG C;  4CDE C;  4IJH A;  2R92 G;  2F03 A;  1SN8 A;  1LTI D;  5DLQ E;  1Y69 U;  3LWE A;  4JI6 Q;  4LF8 Q;  4PQX A;  1GO3 E;  5KNB A;  3LGJ A;  3M9B A;  1KDB A;  3HKZ G;  1PYB A;  1C48 A;  5E4X A;  3KDF B;  5IYD H;  5LMN W;  3OWF A;  1FNW A;  3KBX A;  5T1I A;  4UP7 A;  5LMU L;  1SNQ A;  5EPL A;  3VR6 A;  2EYF A;  2JSO A;  4YWM A;  4K8J A;  4DV1 Q;  4LJZ C;  3H91 A;  3I91 A;  1Y8P B;  1PVO A;  3M4O H;  3BVG A;  3R2T A;  2BA0 A; 
#chains in the Genus database with same CATH homology
 4BA1 I;  1BCP F;  2F0U A;  1GOZ A;  2ID0 A;  4G7Z C;  1H9M A;  1II3 A;  3SEB A;  2PZT A;  3TSS A;  3GTP B;  4ZRZ A;  1SYF A;  2EYP A;  4H0L C;  2WP8 J;  2BDO A;  3C46 A;  4OO1 H;  1ZEQ X;  4RH6 A;  1AFP A;  5C3E B;  5F2D A;  2K5Q A;  2O5I C;  3M7G A;  2NVX B;  1LO5 D;  2B2T C;  1SYC A;  2A74 C;  4PNY A;  2IX1 A;  5FK9 C;  3VA7 A;  3TP7 A;  5ELD A;  2JA6 B;  2MHV A;  4UDU C;  2WKC A;  2ZXP A;  5LHY 1;  1SE4 A;  2ZT9 C;  1I6H B;  1IL8 A;  5K5P A;  1Q1B A;  1TS4 A;  3BYY B;  3Q22 A;  1R4Q B;  2M2L A;  1VDZ A;  3E0J A;  4GZY C;  1A3V A;  3S2D B;  1IKM A;  3HZX A;  1B3A A;  3T56 B;  3HGB A;  3HOU B;  2EPB A;  3J7A V;  1ET9 A;  3RZD B;  1O7Z A;  2HCC A;  1ZYR C;  1XYI A;  2D2C C;  1G2S A;  2E74 C;  2I07 B;  4HAE A;  5BN3 A;  3OMC A;  1KLG D;  1PMR A;  2F0J A;  2D62 A;  4ID6 A;  4RHS A;  1B1Z A;  1I6V C;  3O13 A;  4LK1 C;  3J80 L;  5FO9 B;  4FNF A;  1SFO B;  5KGU A;  1PXU A;  3FMC A;  1JWS D;  1B50 A;  1OXU A;  4DAY A;  1O7Y A;  3FEW X;  1STB A;  2XIW A;  2RDH A;  3HP3 A;  2KCN A;  4ZLT F;  2A68 D;  3TME A;  3D6W A;  5M5X B;  1RTO A;  1H9R A;  2EJF C;  3RMH A;  2NVY B;  2B2U C;  4Q5V A;  2B8G A;  3P20 A;  1DOM A;  4IUQ A;  3GTO B;  1O78 A;  1XTC D;  3S9W A;  4KY5 A;  3I8Z A;  3K0Y A;  4TKO B;  3BDO A;  1ROD A;  1Q3L A;  1STN A;  4IFD I;  3I3C A;  3ZYY X;  3QJY A;  2L5T A;  3C1E A;  1Q8I A;  3I4M B;  4DNT B;  5FO7 B;  1XXG A;  1Z6H A;  1FD7 D;  1ILQ A;  4IQZ A;  4IUN A;  3TZD A;  1QE6 A;  3TN2 A;  4EQO A;  2Z1C A;  1WCM B;  1SNC A;  4FXD A;  1CK1 A;  3QOJ A;  1MD2 D;  5IGF A;  1K8O A;  2E75 C;  1JCK B;  5IOD A;  4QIW B;  1EYC A;  4NDX A;  1HFN A;  2KA7 A;  3A55 A;  3LX0 A;  3GQB A;  4KKS A;  2O5J C;  3LNN A;  1LAB A;  2K04 A;  1JE4 A;  3NPP A;  3HS0 C;  2K7V A;  5CR3 A;  2NYZ D;  1EWC A;  3TZU A;  5C6A A;  5C0X I;  3MTS A;  4KKU A;  2H1E A;  2AQ3 B;  4K2L A;  1SJE D;  3NBH A;  2VB2 X;  4TSS A;  2E2I B;  2Q8I B;  1V43 A;  5I6Y A;  1WVL A;  4ZYS A;  2A68 C;  4KY6 A;  1TII D;  5I2Y A;  1GXD C;  5C5L A;  5EGT A;  2B2T A;  4HCS A;  4XDX A;  2QDB A;  4CJ1 B;  1UEA B;  2MJ8 A;  1PRT B;  4HSP A;  3RLF A;  1VF7 A;  1KNA A;  3OOC A;  1GUO A;  2BE5 C;  5C44 B;  5CV7 A;  2N55 A;  1F2Z A;  2F4I A;  5JPN C;  1HQM C;  1TY0 A;  1OO9 B;  3LWU A;  5ELC A;  1UUP A;  3MVV A;  3DXJ C;  3AU7 A;  3IFD A;  1I4R A;  3PV0 A;  1U4R A;  2PCF B;  4OHJ A;  2JE6 I;  1ET6 A;  1F9R A;  4C3J B;  1E0B A;  1TVX A;  2WB1 B;  5TSS A;  5C3X A;  1EU4 A;  2F0T A;  3S17 B;  2LMC B;  1H9K A;  1E2Z A;  3C1F A;  3FPU B;  3BDC A;  5D14 A;  4M8A A;  1EY4 A;  3S1M B;  5KYI A;  2HDL A;  2X69 A;  4K5W A;  2EJG C;  3SHL A;  2JA7 B;  3GV3 A;  1A15 A;  3OW7 A;  1CHQ D;  2J7Z A;  1TU2 B;  2KCC A;  4FP5 D;  1TS2 A;  4CKC A;  1G8Z D;  3D31 A;  2PZW A;  1HQR D;  3ERO A;  1HA6 A;  3MXP A;  1PZI D;  1HUN A;  1AZP A;  2VUM B;  4C56 C;  1KAA A;  2DNE A;  1I4Q A;  4TQU S;  2F0F A;  4A3K B;  2MGS A;  4DK1 A;  2XVS A;  3GD7 A;  3T16 A;  1OXS C;  4EQN A;  2OXP A;  4FO2 A;  1ILP A;  2B2U A;  2EE1 A;  1SJH D;  1TS5 A;  1OXV A;  2B2Y A;  3M3Y B;  4V19 0;  4I7Z C;  2F0G A;  1SXT A;  3DM1 A;  1SE3 A;  5I4D A;  2J0T D;  2Z4H A;  5KRU A;  4ZKC B;  3NUC A;  2KJX A;  4F87 A;  2AQ1 B;  1B9N A;  2ZXO A;  4MN3 A;  2XWB B;  1DXM A;  1ENA A;  2QEJ C;  4K8I A;  1EIH A;  4DXG A;  3HOZ B;  1D5Z C;  1EY9 A;  2EOT A;  1Z7T A;  3NTH A;  2K5D A;  2TMP A;  2JA5 B;  1H9J A;  1JIC A;  5C4Z A;  3T51 B;  4HED A;  1RTN A;  3PUY A;  2B2W A;  5IGB A;  2IT1 A;  2K03 A;  1YNJ C;  3A7L A;  3MFY A;  1TWH B;  3K5M A;  3K57 A;  1EZ8 A;  1SSO A;  1IW7 D;  1SYD A;  3HOW B;  1HTP A;  5EKL A;  1G2T A;  4ME5 A;  5KND A;  1U4M A;  2K01 A;  1TR5 A;  2BCO A;  1BO0 A;  2XSC A;  1BUV T;  1BCP B;  2A69 C;  4A3M B;  3OIQ A;  2A6H D;  3X3N A;  1A3U A;  4XTC S;  2L9H A;  4X3T A;  4KK7 A;  5DM6 3;  2B2V C;  3GTJ B;  2WII B;  1MI2 A;  1L0X B;  5NUC A;  2C9O A;  2IJ0 A;  2Q8T A;  1SNP A;  3VYU A;  1DJR D;  5ELB A;  3SDZ A;  4H44 C;  1WD1 A;  4HSV A;  3S15 B;  1C4Q A;  4A3I B;  1DOL A;  2F0I A;  4QB4 A;  1FR3 A;  2IWH A;  1LTT D;  2EYM A;  2NWG A;  3OWE B;  3RUZ A;  4IUR A;  1IW7 C;  2NN6 G;  3GTK B;  2EDG A;  3K5N A;  5J22 A;  2A5H A;  1Q12 A;  5CMD A;  4B9X A;  1Q1E A;  3VYS A;  4A3E B;  3NWS A;  4IFD J;  1EY5 A;  1RD9 D;  2SNS A;  5IIF A;  3R93 A;  5EQ0 A;  2RDG A;  3GV6 A;  1NUC A;  1CFM A;  3R8B A;  1PRT D;  1I4P A;  4XYO A;  3AMU A;  3KUP A;  1GHJ A;  4NMZ A;  3K6O A;  3GTL B;  3QIA A;  2F0V A;  1STA A;  2QKI C;  4N9P A;  5ELE A;  1HCZ A;  3I4L A;  4HMJ A;  1F77 A;  2A6E D;  2RSN A;  1EWH A;  3MC0 B;  3UI2 A;  2RVL A;  3R2I A;  3BYT B;  3W3A A;  2F0W A;  1I50 B;  5CV4 A;  5C4X B;  2JA8 B;  1DON A;  3PMF A;  4X3S A;  2PO4 A;  2FHT A;  3HOX B;  1QJO A;  3KLS X;  2NTS A;  1PRT C;  3PUV A;  4OO1 I;  4ZUJ A;  1CI3 M;  3VR5 A;  2O4X A;  2R7Z B;  1RKN A;  1MGS A;  4DK0 A;  2MP1 A;  4X3U A;  5EKI A;  4O42 A;  1EIG A;  4ODG A;  3SE0 A;  5J39 A;  5CV5 A;  5G3L D;  2QF7 A;  1DOK A;  4L6T B;  4F7X A;  2E2H B;  2QIL A;  5E4W C;  2F0E A;  4QMG A;  3GO5 A;  1CTM A;  4KD4 A;  1S5E D;  4IFD G;  2JEA I;  2RSO A;  3MXN A;  3FKI B;  4HN7 A;  2MUY A;  1AEX A;  3M4O B;  1RF2 D;  4K2K A;  3J80 E;  5M9O A;  2EY5 A;  1PDQ A;  2KED A;  1O80 A;  4O1N A;  1SNO A;  3G6J B;  5C5M A;  3A8I E;  2JP1 A;  2VB3 X;  4WJW A;  2E2J B;  1WTQ A;  1JOO A;  4WRD A;  5BN4 A;  4B08 A;  1JB3 A;  2EY2 A;  4NW2 A;  1WTV A;  2F3W A;  1LT5 D;  4C2M B;  4XQJ A;  4RAU C;  5J1Z A;  1E2W A;  3J81 L;  1MSG A;  2BOS A;  3BDL A;  2K5W A;  2OF1 A;  1YNN D;  3OSO A;  2Y0S B;  3NQI A;  1J8I A;  5EJW A;  1HFG A;  1PFM A;  2EZV A;  4CGY B;  1H9S B;  3TDQ A;  3L3O C;  1B9M A;  2F0S A;  4IAL A;  1JWU D;  1PZJ D;  4A3J B;  2XWJ B;  4IZ8 A;  1ML0 D;  3MWY W;  3CRK C;  5CV8 A;  3URY A;  2F0M A;  1B4O A;  1H9S A;  4K5X A;  3IKJ A;  1I4H A;  3T13 A;  5ISR A;  4B9W A;  1NR2 A;  3PIO 3;  2DNC A;  2F0H A;  1UNS A;  2OEO A;  2EYJ A;  4DXF A;  2SNM A;  3KF8 A;  3P1H A;  1BCP D;  4OL7 A;  2GA4 B;  2NTT A;  2SEB D;  2ICE C;  1IKL A;  4PMW A;  2L55 A;  4J1M A;  2M00 A;  1BBX C;  2NZ1 D;  2V4D A;  1BR9 A;  1U4L A;  1EY7 A;  3SVM A;  3NP8 A;  1GUS A;  1R4P B;  2LS0 1;  1SNM A;  3D6C A;  3BVZ A;  4RA8 A;  1GJX A;  2B2Y C;  3KLR A;  4PV1 C;  2XN9 C;  2N88 A;  3CRL C;  1B44 D;  5C0X G;  1PYW D;  1KDC A;  1PTO H;  2CW0 C;  1WTP A;  2J4X A;  2KQ3 A;  2WKD A;  1Y1W B;  3H09 A;  1WD0 A;  1KLU D;  3Q0A A;  3EJI A;  3QO2 A;  4E6I A;  1ZKO A;  4FXG C;  3ND8 A;  1CM9 A;  1DCZ A;  2Q8R E;  1X32 A;  2K33 A;  1GUG A;  3TP6 A;  3MHB A;  4ILW A;  1F9Q A;  4IFD H;  3F2U A;  4J6H A;  3M85 A;  1JC7 A;  2PYK A;  1K8M A;  2RDF A;  2K28 A;  3K7A B;  3K59 A;  2WAC A;  4MHE A;  1TT2 A;  5JEA J;  2FFK B;  1IHZ A;  1EU3 A;  2WAQ B;  2X6L A;  4R8I A;  5IGC A;  4BA2 I;  1J9O A;  1I3Q B;  1ZXT A;  1F2Y A;  2IPK D;  4DA2 A;  3CQZ B;  1JQY D;  3IL8 A;  1ENC A;  2KEE A;  1TQO A;  1RCV D;  3DHQ A;  4BY7 B;  4KY7 A;  1GUN A;  2LKV A;  4XIG S;  4IUU A;  4I65 A;  4IUP A;  2NUC A;  1WTW A;  3JAM L;  5JAV A;  1B53 A;  2B63 B;  3PO2 B;  2YYZ A;  2L1B A;  1FNU A;  4RGN A;  2D9U A;  1Y1V B;  4UAI A;  1QB5 D;  5IGD A;  1PLF A;  1NAP A;  3TP8 A;  1AP0 A;  2Z4I A;  4N9T A;  1D5X C;  4CHT B;  1S5C D;  5KYL A;  3K5O A;  2CHB D;  4RWS C;  1EEI D;  1Z47 A;  4X3K A;  2K6A A;  2R3Z A;  3S1Q B;  3EVQ A;  1NR4 A;  4WOR A;  1M8A A;  4ULL A;  1K83 B;  2PW5 A;  4ZUI A;  4LAA A;  5IT9 E;  1PTO F;  1FGB D;  1I4G A;  1CQV A;  1D1I A;  2PZU A;  3A8K E;  3TP5 A;  5DEH A;  3GP7 A;  1EY0 A;  3Q6S A;  2BE5 D;  1EL0 A;  3RD4 A;  4FF1 A;  5EBD A;  3I73 A;  3VR2 A;  1DYQ A;  1QOH A;  2EY6 A;  5E1F A;  3X3M A;  1L0Y B;  5CV9 A;  3RZO B;  4R9W A;  3DMU A;  5KIX A;  4IUV A;  2F0K A;  2WV6 D;  1QNU A;  3I72 A;  3DWP A;  2K1B A;  5I2X A;  3C2P A;  4XQQ A;  4KTA A;  4QUF A;  5FO8 B;  5EKK A;  3W2D A;  1ENF A;  1A2U A;  4XXE A;  1HRJ A;  3PUW A;  3FVQ A;  4HTH A;  1LTG D;  1X3Q A;  1TS3 A;  2B39 A;  5M3F B;  4L8J A;  5A2Q E;  1D5M C;  1WTO A;  3VR4 A;  5IGG A;  1FNV A;  3PO3 B;  3P7J A;  1CHP D;  5IT9 L;  1JWM D;  1E2V A;  1VMP A;  4QCL A;  1S4Z A;  1G6Z A;  5CBA E;  4NKL A;  2DN8 A;  3K5L A;  5FOB B;  2PW7 A;  4BS9 A;  4KN7 C;  4CBV A;  3QG1 A;  2CW0 D;  3NE5 B;  5C4H A;  2F0L A;  3V2T A;  5E3F A;  5D65 A;  5LL6 X;  2AUJ D;  2R92 B;  4ZK9 B;  4K14 A;  4KI0 A;  1TWF B;  4DFA A;  1S5D D;  4KJO A;  1XWE A;  3C3L A;  2K05 A;  4KMU C;  4QUC A;  2JXM B;  2F0Q A;  3D4D A;  2EYO A;  4DU9 A;  3A54 A;  3JAM E;  1G91 A;  1GUW A;  2EYL A;  3E6Z X;  3VR3 A;  1A3T A;  3EA6 A;  1PFN A;  5JJZ A;  3SR1 A;  2PPB C;  1MBY A;  2D5D A;  2EVB A;  4KJN A;  4C3I B;  1G29 1;  1SE2 A;  2IW3 A;  3FRP B;  5JEA H;  3QOL A;  2X6G A;  4HR7 B;  1STY A;  4WFN 3;  4CJ2 C;  2RKS A;  1RDP D;  4C3H G;  2EXZ A;  2NN6 H;  1LTB D;  3DEO A;  1EQV A;  4EQP A;  1CZG A;  3DUZ A;  4K6L A;  2EJM A;  2LFN A;  4RKB A;  3T53 B;  5T1G A;  5ELF A;  1BF4 A;  3M4Y A;  5D3I B;  1HXY D;  1V1P B;  1F2M A;  2KVM A;  4BBS B;  1A6X A;  1UAP A;  1R9T B;  3BVM A;  4A3D B;  2EYH A;  1T5X D;  2FMC A;  4OIJ A;  5I9O A;  4BBR B;  2BA1 A;  2IX0 A;  2RA4 A;  3H0G B;  1YNN C;  4EGV A;  2H4O A;  1EQT A;  3H6M A;  4U68 A;  3S1N B;  1SEB D;  2E2D C;  4G57 A;  3AB9 A;  1ZYR D;  3FPP A;  1PFB A;  3DEP A;  3MFG A;  1D6E C;  2FMM A;  1ONL A;  1ESR A;  2JEB I;  4H7B A;  1RHP A;  3L7Z C;  4JBW A;  1IYV A;  3WOF A;  5CV6 A;  2AUK A;  1QNK A;  1SDF A;  3Q24 A;  2PMZ B;  4KHV A;  2PQE A;  5JVH 3;  2L4N A;  1CA6 A;  1VMC A;  4K5V A;  1V1O A;  2KOL A;  3M7N A;  2KEC A;  1XX8 A;  3NSW A;  4NP5 A;  3U9O A;  3L9A X;  4DNR B;  4KV6 A;  4YIJ A;  1BXT A;  4J8Q A;  4RGT A;  3NK9 A;  1HTL D;  4RCO A;  4HCE A;  1AZQ A;  3E5S A;  2B2V A;  1NCV A;  3R3O A;  2OT2 A;  3NQT A;  1JOK A;  4C3I G;  5C0X H;  4AYB B;  5K36 G;  3D4W A;  3V96 A;  3MEH A;  2F0D A;  2AWO A;  1W6K A;  4XQN A;  2NBF A;  3G7L A;  5M5W B;  1S5B D;  5FLX L;  2L11 A;  3N6R A;  4DAV A;  3NHH A;  1V1P A;  3HOY B;  3HEJ A;  2ICI A;  1PZK D;  3A56 A;  3ND9 A;  4A93 B;  1D2B A;  3I90 A;  1KAB A;  1Q90 A;  2O2L D;  4JK1 C;  2M9V A;  4R8N A;  1EYD A;  2AWN A;  4Y7N B;  2YU9 B;  2R6G A;  3VYR A;  3SK6 A;  3GTM B;  4RCN A;  2L12 A;  5KEE A;  4DGZ A;  3I70 A;  4HMI A;  2NN6 I;  2WIN B;  1LV9 A;  4F88 A;  5CGK A;  1STE A;  4FXK C;  1DM0 B;  3KK7 A;  1HA5 A;  1U4P A;  1LAC A;  5C0X J;  3I4N B;  5M5Y B;  1BNZ A;  1T5E A;  5LL6 S;  3QB3 A;  4DAP A;  3MXU A;  1M4V A;  3K58 A;  1BCP C;  3HG9 A;  1ESF A;  1Y8N B;  4IN3 A;  2F0O A;  3CHB D;  2AQ2 B;  5BN5 A;  1DD2 A;  4LMQ D;  5AFW A;  3S14 B;  1PTO B;  1VCI A;  1C8C A;  1LTR D;  3H3V C;  1JOR A;  3A7A B;  3J81 E;  3OHX C;  2VXW A;  3DWA A;  3OIP A;  1SMY C;  1CZW A;  4G7H C;  1WTX A;  1QWY A;  4IUT A;  1F9P A;  5C3W A;  1O7L A;  3IFT A;  3WDN A;  1SBB B;  1VF5 C;  4PMC A;  2R93 B;  5A35 A;  4FF4 A;  1AN8 A;  3KLS A;  4CJ0 B;  4A3B B;  5IGE A;  2F3V A;  1PTO C;  3TBI B;  2XRS D;  4ZAI A;  2Z8L A;  2A73 B;  3IAY A;  5JEA G;  1CT1 D;  2FIN B;  2QCP X;  3SK5 A;  3VA5 A;  4C3H B;  2F0P A;  3DWQ A;  1W6J A;  4KD3 A;  2HQE A;  4FF3 A;  4FF2 A;  4FVM A;  1DZ1 A;  3SXH A;  1GHK A;  2C5C A;  4A3G B;  1EY8 A;  1OXX K;  1QG7 A;  3PIP 3;  1LT6 D;  1TWG B;  4CKE A;  4A3F B;  1U9R A;  4DN4 M;  2B8F A;  3CU7 A;  1EFI D;  4DF7 A;  5I6W A;  3MXG A;  3D3R A;  4RKL A;  3FDT A;  1CQF A;  1SMY D;  3U9S A;  1HUM A;  3QWN A;  1AW7 A;  5HGT A;  3HOV B;  5DNF A;  2RQX A;  2SOB A;  2DY8 A;  3OPO A;  4BWG B;  4K6D A;  2RBM A;  2K32 A;  4C1N I;  1F9S A;  1SND A;  3PUZ A;  2IL8 A;  3MAQ A;  1QIL A;  2R61 A;  1RJT A;  2BDN A;  2F1M A;  1V8Q A;  2DY7 A;  1EEF D;  3NTI A;  4C1N K;  1NSN S;  5KNC A;  4RFB A;  2EY1 A;  3S2H B;  5K36 H;  2HUG A;  1S5F D;  1X3P A;  3GTG B;  3GTQ B;  1KTK A;  4OO1 G;  5EPJ A;  1B2T A;  1F2L A;  4OIK A;  3KBG A;  2A6E C;  5CBE E;  2VNU D;  4G7O C;  1SYG A;  3J7A F;  1BDO A;  1STH A;  3VYT A;  2KUM A;  4TRD A;  4S3S A;  4MIU A;  3CKI B;  3SK8 A;  2NVT B;  4FYD A;  3ERQ A;  4RGO S;  1HHV A;  3BZD B;  1FYC A;  3D4R A;  3EQL C;  3V05 A;  1EZ6 A;  4CKB A;  1Y8O B;  3HKZ B;  5JVG 3;  1TWC B;  2LY7 A;  3BG3 A;  2F0N A;  1PRT F;  5D3D A;  3MA2 B;  2I46 A;  4M1U B;  3PUX A;  4Z9C B;  4Q0F A;  1TKW B;  2FJ2 A;  4OGQ C;  5CC4 A;  1LTS D;  2B2W C;  2E76 C;  2KHS A;  2ZXR A;  2TSS A;  3WOE A;  5I9P A;  5JPM C;  1EOT A;  2XRQ D;  2L0C A;  1TY2 A;  3A8J E;  4F8M A;  4P2C B;  1LT4 D;  4KN4 C;  3OMG A;  2G9D A;  1QCB D;  3ONA B;  4EVO A;  1LTA D;  3Q23 A;  2IX3 A;  1I4X A;  4KKT A;  5M3M B;  1TWA B;  1JOQ A;  4XT3 B;  1OXT A;  2CQA A;  2CVR A;  3ITP A;  3N52 A;  1A2T A;  5G3L F;  1IYU A;  4RGM A;  5CYU A;  3SK4 A;  4PMB A;  4XYQ A;  5FKA C;  4ZQ3 A;  4V0B A;  4BY1 B;  3MZ5 A;  3P75 A;  3S1R B;  1PTO D;  2JYO A;  1WTR A;  1ICW A;  1SYE A;  1BQQ T;  2PNR C;  3H94 A;  1CA5 A;  2NVQ B;  5DM7 3;  4G4K A;  4L63 B;  2HDM A;  4C3J G;  2HCI A;  3BS1 A;  5COR A;  2A6H C;  1SYB A;  4ZKB B;  2ENB A;  3T4A C;  5COY A;  1KNE A;  2A69 D;  1STG A;  1KDA A;  2SDF A;  1LLR D;  4H13 C;  5A2Q L;  5IOC A;  3NTK A;  2NB0 A;  3J7Y W;  5EBC A;  2XNA C;  3S16 B;  1D1K A;  2MPM A;  1LT3 D;  4U67 3;  1BOS A;  1EYA A;  1GUT A;  3NWT A;  5DAU A;  1HPC A;  5EPK A;  1JR0 D;  5C4J B;  2G9H D;  5FLX E;  1YNJ D;  3NXW A;  3D8G A;  5JOB A;  4ABN A;  3NBI A;  5HUR A;  4KHZ A;  4QF4 A;  1EY6 A;  1SAP A;  1MSH A;  3EFX D;  4RHR A;  4XT1 B;  3HRZ C;  2F03 A;  1LTI D;  1Y69 U;  3LWE A;  4PQX A;  5KNB A;  1KDB A;  1C48 A;  5E4X A;  3OWF A;  1FNW A;  3KBX A;  5T1I A;  1SNQ A;  5EPL A;  3VR6 A;  2EYF A;  2JSO A;  4K8J A;  4LJZ C;  3H91 A;  3I91 A;  1Y8P B;  3BVG A;  3R2T A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...