1JORA

Ensemble structures for unligated staphylococcal nuclease-h124l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
total genus 25
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jorA00
2PZTA 1STHA 1NSNS 3P75A 4E6IA 4LAAA 4EQPA 3D6CA 5CV6A 5ISRA 2PZUA 5CV8A 4KV6A 1EY7A 1SYBA 1A3TA 4K2LA 1JOKA 1NUCA 3D4WA 2PZWA 3HEJA 5E1FA 3TP5A 5IGCA 2M00A 5C5LA 2F0PA 2F0UA 2F0IA 5C4ZA 3MXPA 1EYCA 5IODA 2F0OA 2KQ3A 1SNCA 4PMCA 1ENAA 2EYHA 2F0EA 4ID6A 5HURA 5KYLA 1SYFA 2EYOA 3NUCA 4S3SA 2HQEA 3MZ5A 3SR1A 2WACA 3TMEA 2PYKA 1SYCA 1SYGA 1EZ6A 2KHSA 2LKVA 3OMGA 5CR3A 4ZUJA 4IALA 3TP7A 5KRUA 2F0HA 4KHVA 4DFAA 2F0JA 2F0KA 4YIJA 2F0MA 4QF4A 3NHHA 3MHBA 4ODGA 4B9XA 2F0TA 1SNQA 3BDLA 3EVQA 4ZQ3A 2EY1A 5J22A 5I6WA 5NUCA 3NP8A 1STBA 1EY4A 1KDCA 3VA5A 5I9PA 3RUZA 3T13A 3QOLA 1KDBA 3DMUA 4IUNA 4DF7A 4NP5A 3D8GA 4G57A 5IGDA 1EYAA 3P1HA 4K6DA 5I9OA 3SXHA 4RKLA 1EY5A 4H7BA 2OF1A 2EYJA 2SOBA 3BDCA 4MIUA 2F0LA 2F0GA 4KD3A 3S9WA 3D4DA 5JAVA 4EVOA 4WORA 3QB3A 4J1MA 2F3WA 4EQOA 2EYLA 3TP8A 5CV7A 1A2UA 1SNPA 4KY7A 3U9OA 5C3XA 3OSOA 4KD4A 1IHZA 3EJIA 4KJOA 3ITPA 5KYIA 3V2TA 5JOBA 2RBMA 2SNMA 4KY6A 4NMZA 5EKLA 4WRDA 4IZ8A 5C3WA 5IGBA 5IOCA 1JOQA 1TT2A 1SYEA 4NKLA 4N9PA 1RKNA 2F0WA 2PQEA 3NQTA 1ENCA 1STGA 2F0VA 1TQOA 3R3OA 3SK6A 4K2KA 2EY5A 4RKBA 4HMIA 4QB4A 3C1FA 5C5MA 2RKSA 1EY6A 3NK9A 4OL7A 1STAA 2RDFA 4KJNA 4DU9A 5KGUA 1A3UA 4ZUIA 2OXPA 3SK8A 4PNYA 2QDBA 3TP6A 2O4XA 2EXZA 5DEHA 1SYDA 2EYFA 4PMBA 5F2DA 2F0DA 5EKKA 3HZXA 3H6MA 2EYPA 2SNSA 5CV9A 2EY2A 2F3VA 4KTAA 4QMGA 5CV4A 1JORA 2PW5A 1EY0A 5CGKA 4K8JA 1KABA 1EZ8A 2F0QA 3EROA 1F2MA 4DGZA 1II3A 4NDXA 5IIFA 1AEXA 1STNA 1KDAA 1TR5A 3PMFA 4HMJA 5IGEA 5K5PA 1F2ZA 1U9RA 3SK4A 3MEHA 3C1EA 1EQVA 5J1ZA 4ME5A 3MVVA 1A3VA 4K14A 4R8NA 1SNDA 2NUCA 1SNOA 1EY8A 4HTHA 5J39A 3T16A 2PW7A 3E5SA 5DAUA 4B9WA 4F8MA 2EYMA 3DHQA 3OMCA 5C6AA 5EGTA 4K5XA 5IGGA 1EY9A 4K5VA 3ERQA 4KY5A 5HGTA 2F0NA 5I6YA 5KIXA 3LX0A 3OWFA 5E3FA 4EQNA 5M9OA 3NXWA 1SNMA 4J6HA 4N9TA 4F7XA 2F0SA 4I65A 2F0FA 5CV5A 4K5WA 1JOOA 5IGFA 1A2TA 4K8IA 5CC4A 5KEEA 2ENBA 1F2YA 5C4HA 1STYA 1EYDA 1KAAA 2EY6A 3QOJA 4TRDA 3SHLA 3SK5A 2OEOA
chains in the Genus database with same CATH superfamily
1BR9A 3D6CA 4DV4Q 5CV8A 3CCUA 2O2LD 2R93B 4FF1A 4ZAIA 1X6OA 4JCVE 1ICFB 2M00A 1W6KA 3NTHA 1CK1A 1N33Q 4BY1H 2GA4B 4L5RC 3UE1A 4KN7C 1ENAA 5C4XB 5EQ0A 1S5DD 2A74C 2F4IA 1R9TB 4NXML 4DFAA 3A5UA 1WCMH 1F77A 1B50A 1EU4A 2K5HA 5J22A 1PRTF 5KNBA 1PDQA 2DUDA 1WTWA 1BBXC 4DAPA 1UUPA 3RN5A 1RJTA 4IUNA 1QG7A 3VYRA 3KOJA 2X6GA 2J7ZA 4MIUA 1HFGA 3PCOB 4A3GB 4WORA 2HCIA 3SE0A 5C3EG 4DR3Q 3FPPA 5CV7A 5M5WH 3FEWX 1NMGA 4TKOB 4Z9CB 1ZKOA 1QZGA 1G51A 4NMZA 3AU7A 2L15A 4U68A 1TWAH 2N3SA 1TT2A 3HOUH 3EBEA 2BE5C 3CCSA 4B3RQ 5C44G 3HOZH 1TQOA 2BH8A 3VDYA 2R7ZG 4K2KA 5D3IB 2RCFA 1H9MA 4QB4A 3PIOA 3SK8A 1H9KA 2B2UA 1SYDA 3M9BA 2B2UC 4A3FH 3V05A 2JJQA 1B9MA 2EXDA 3RMHA 1TWHH 1XTDA 1MSHA 1S5CD 4IJHA 1EIYB 5IYBH 4NDXA 1TR5A 5IGEA 1PYSB 2UUBL 4A3FB 2JA6H 5I2XA 3S17H 1S40A 4ZYSA 1TS5A 3I72A 4DR1Q 1EY8A 1TXYA 1VQGA 4DV2L 4HCEA 3K7AH 4CDEC 3PO2G 2CW0C 1VQDA 4QUCA 4JI1Q 1VMPA 3S1RB 3J7A5 2JA7B 1AP0A 2ENBA 2Z6BA 3QJYA 2Y0SG 1I6HB 2D0PA 1G6ZA 2UXDQ 4DR6Q 1PMRA 4BBSB 3PQIA 4IPDA 1TS3A 4AH6A 2L5TA 3X3NA 2WAQB 2KEDA 5IODA 1GOZA 1U5KA 4JI3L 4ZCKA 2B63H 3MZ5A 3SR1A 1KNEA 3J7ZC 2SEBD 3I4OA 1SYGA 1PH7A 4A75A 1HHVA 3OW7A 4DV5L 1XXGA 4P75A 4B08A 4AQYQ 2IWHA 4OIJA 2L55A 1K3BC 1L0WA 4GKJL 1VQ8A 3MTSA 4KI0A 3S2HB 1B8AA 2B29A 1PVOA 3PF5A 2K32A 3WOEA 3HP3A 2KHIA 1HNXL 1KQSA 3HOYH 4DUZQ 2BOSA 4DV6L 2F52A 1HUNA 5EBCA 2G5DA 2R6GA 5JJIA 5IYCG 3OPOA 2B2TA 1CHQD 3GTJH 2E2IH 2QCPX 5A35A 2XSCA 3BG3A 1JB7A 1DYQA 4CKCA 2BA1A 3DWAA 1LTLA 2FMCA 4ABNA 3MXGA 1IBLQ 1UE1A 3HKZB 2RDFA 3CW2C 3IAYA 1C48A 4ZUIA 2CH4A 2XTIA 2NVQB 1HZBA 3NWTA 1TWCB 4PMBA 1EOTA 5FJ8G 2N78A 2SNSA 1W6JA 1UE5A 1BCPF 2A68D 1EY0A 3RZDH 1XMQQ 3CCLA 3AFPA 5K36H 1OXVA 5ELCA 1U4RA 2AUJD 1TS4A 3MVVA 4DR5L 4HIDA 3VR6A 1ZYRC 4R4TA 5CYUA 3KFUA 4A3GG 1X55A 4FF3A 4LF8L 3J7AV 1FR3A 4MTKA 1Q82C 3OWFA 3F1ZA 3TN2A 1KNAA 4GZYC 4F87A 1JMCA 4KHPQ 1F2YA 2EY6A 1Z9FA 3JAMi 1HR0L 2K75A 1WTRA 5AFWA 2WKCA 1PFSA 1WOCA 3O13A 1HR0Q 5ISRA 2ICIA 4BBSH 4FVMA 2LXJA 2JA5G 3CPFA 3KDFA 1XNRL 1K73C 1D7QA 1STEA 1KIXA 3JC66 3S14B 1LABA 4X65Q 1N36Q 3H09A 1N33L 4LK1C 2X69A 3TREA 2VZAA 3NUCA 4HJ9A 3P20A 1EZ6A 2KHSA 1N9WA 5D65A 1G2TA 4IALA 2R93G 1EU3A 1ML0D 2K5WA 5IYDH 1STBA 3HFZB 3VA5A 4QL5A 5C4XG 2FJ2A 4DF7A 2I0QA 1D8LA 4DK3C 4YCUA 3V96A 1YBYA 1V43A 4C3HH 4IUUA 2GN5A 3GTPH 2A5HA 2F0GA 1YITA 3CCQA 1PH8A 3S1NH 4FXKC 3K0XA 1SNPA 4LF6L 1Q81C 3L0OA 5C3XA 4BA1I 1R9TH 3V2TA 1LTBD 2Z8LA 2KEEA 2K7VA 2EZVA 4X62Q 2DNEA 2K04A 1F2LA 3P7JA 2BA0A 4N9PA 2F0WA 1RCVD 1ENCA 2EY5A 4RKBA 1L2FA 3GQBA 2RCNA 3DEPA 2HQLA 1STAA 4PNYA 3GTGB 2EPBA 1B7YB 3A8KE 2EXZA 5IT9E 4TVAB 3CMAA 4TSSA 4KTAA 3RZDB 4QCLA 4BY7H 3S1MB 3NE5B 5IYDG 1XX8A 2M2LA 5IE8A 5K5PA 2BH2A 4DK0A 4OIKA 2ZM6L 4R8NA 3EA6A 2YU9H 3A56A 5IP7H 4K6LA 4AQYL 4YHHQ 2AQ3B 2PNHA 1QZHA 2FXQA 3CCMA 1PA6A 1IW7C 2XWJB 1BKBA 4PQXA 4LF7Q 2IPKD 4A4IA 4J6HA 2RDHA 2NTSA 1H9SB 4DR4L 1N34Q 4JI8L 1PYWD 4XYOA 1AW7A 1NSNS 1TKWB 2CQAA 1N32Q 3A54A 4KV6A 2H5XA 1N32L 1XYIA 3A55A 4YWKA 5C0XI 3C2PA 2CW0D 5EKIA 3I56A 1EYCA 4TQUS 1SNCA 4PMCA 2CKZB 3BZDB 1R4QB 4GKKL 1RIPA 3AEVA 4UDUC 2OT2A 3S2DB 4NW2A 1DOLA 3NBHA 5M5XB 2E2DC 2ZT9C 4ODGA 1SE2A 3MHBA 4ZQ3A 1Q8IA 4L8JA 5ELDA 3IL8A 4ALPA 1Q86C 2R92H 1GUOA 1C8CA 1SMXA 5IP9G 3GDEA 3BVZA 4XQNA 1YNJC 3A7LA 1FJGL 1E2VA 4A3IH 4JI6L 1HQRD 5IGDA 2UUBQ 2E2JB 5I9OA 3SXHA 4C3HG 1VQMA 1T9HA 2F0LA 5JAVA 2QKIC 3NSWA 1CA6A 4I7ZC 2KENA 2BE5D 3CQZB 5FJ8H 1Q1EA 4DAVA 3CCRA 1IHZA 3EJIA 5DM63 1I50B 3M3YH 4C56C 1S5FD 1TY0A 3J81i 2UU9L 3S2HH 2L12A 3VR4A 3H15A 2IL8A 5A2QL 1XMOQ 4QGUA 4KK7A 1XMOL 3HOYG 1ONLA 2CH4W 3K5OA 3TP6A 1PFMA 2VS1A 2I5MX 1O7LA 2KECA 3I4MG 3AB9A 1K3RA 3UI2A 1C9OA 2AWOA 3R2IA 2K28A 1STNA 4HAEA 4A3DH 1D2BA 1CSQA 3HGBA 1F2ZA 2D9UA 3SK4A 3C1EA 1K8GA 4IUPA 3NBIA 5C44H 3HOZG 2L0CA 4R4QA 5M5YB 3KK7A 2EJGC 1GM5A 3E5SA 5FLXE 2EYMA 3E9HA 3HOYB 5I6YA 5HGTA 1IL2A 5KIXA 2P5ZX 3LX0A 1A15A 4LFCL 2H1EA 3J80i 2RQXA 3OYYA 4K8IA 1GUGA 3STBC 1EYDA 3QOJA 3SK5A 4LF9L 2IW3A 2A19A 1STHA 1JC7A 1JJCB 1D6EC 4LF6Q 4K2LA 5FKAC 3CRKC 2G9DA 3Q24A 1XNRQ 1I4QA 5DNFA 4GNXC 3LGJA 2F0OA 4DUYL 2VUMG 5LMNQ 2WACA 2KCMA 1ZXTA 2DY7A 5LMUL 1Q46A 1DM0B 1H9SA 4C2MH 5NUCA 3NP8A 3T51B 4GOPB 4A3MH 1XPUA 4MN3A 3S1QB 1I4PA 2WIIB 1Z7TA 2OCEA 3PIO3 1TIID 3PV0A 3DMUA 2XN9C 5ELEA 4BBSG 3CCVA 4BA2I 2Z1CA 3AQQA 3I4NG 1VS0A 4O1NA 3U50C 2GVAA 3ERSX 3K59A 4A3KB 4IO9A 1DOKA 1FD7D 5FLXL 2UUAL 1A2UA 1B53A 4IPHA 4ZKBB 1PV4A 1VQEA 1PH4A 4A3EH 5EKLA 4A3KH 4LFAL 4LF7L 5C3WA 3CXCA 1HTLD 1TVXA 3F8TA 4A3CH 2PQEA 3NQTA 3U58A 1D5XC 3PSIA 1X3GA 3D3RA 4DV1L 3FKIH 2B3GA 4RHSA 3ZYYX 1PRTB 3PGZA 4OELB 2IT1A 2PCFB 4AYBB 4C1NK 1IL8A 2BDOA 3S1NB 4DPGA 2AQ2B 5CV4A 4WJ3M 4KHZA 4POFA 4DGZA 3PO3G 3OIQA 2JA9A 2KA7A 2L11A 5C0XG 3H0GG 2PMZB 1EQVA 3D0FA 4DA2A 2TMPA 5D14A 3T16A 2PW7A 3J81c 2Q2TA 4P72A 1IKMA 5C6AA 4K5XA 4BY1G 1AFPA 3K8AA 1G2SA 3NPPA 4QJFA 5EPKA 4HN7A 3DM3A 5LL6X 4UAIA 3KBXA 4KN4C 4RMFA 1CQVA 1SNMA 2KOLA 2F0SA 1VQ4A 1EUJA 4CBVA 5CV5A 2E2JH 1OXTA 4CJ0B 1CTMA 4IQZA 1V1PB 4RHRA 3JAML 1UNSA 4DXFA 1SXTA 1I94Q 3UE0A 3CC2A 3FHWA 2ZJQA 1GUTA 4BY7G 1EQTA 4GNXB 2B63G 1JT8A 2VQEQ 3KF6A 2K03A 5IGCA 1K9MC 1UE7A 3G71A 1KTKA 2Q8IB 2F4VL 4JI6Q 4A3BB 1PTOH 4QQBX 1Q3LA 1HCZA 4JI4Q 4C3JH 1MJCA 4S3SA 2SDFA 2DN8A 2D5DA 4GOPC 1B3QA 3GP7A 4L6TB 1WTVA 2IX3A 3GTLH 4QF4A 2EVBA 2IX0A 4XQJA 4C2MB 3UDXA 3KLSA 3H91A 4EGVA 3LWEA 1JJGA 4IPGA 5FO7B 1LT3D 2JA8H 3ICEA 4V190 3DWQA 2HT1A 3M4YA 5COYA 4PMWA 4N8FA 2DNCA 3AMUA 2NB0A 3DUZA 4FO2A 4K6DA 1EY5A 1HNWQ 3BDCA 5C44B 1E24A 1DCZA 4OO1I 2N55A 2F3WA 5GAHC 4EQOA 2JP1A 3I4MH 1IYVA 3OSOA 1SJHD 5JPNC 2SNMA 2K14A 2I07B 3BS1A 2F3IA 5BN5A 1HTPA 5T1GA 3R3OA 3SK6A 3PO3B 5BN3A 1WTOA 3J7YW 1YNJD 3NK9A 3R2TA 4UPAA 3WWVA 3S16H 3NTKA 3NWSA 2NZOA 2EYFA 5F2DA 1E1TA 1VQAA 1U0LA 3FP9A 1ICWA 2EYPA 1LTSD 4DUYQ 1SE4A 1E3PA 2FFKB 4WJWA 1ET9A 4P73A 1IBMQ 3HOXB 5M3MB 3GTQB 3G6EA 3OTOL 4G7OC 2KJXA 4OGQC 2MJ8A 4APVA 2E5LQ 3I73A 3L3OC 1TWFH 4FNFA 2Z0SA 2IX1A 1CKMA 3B6YA 2JSOA 3HKSA 3VA7A 4F7XA 2HCCA 4A3MG 1YNXA 5EAYA 1I50H 4DK6C 3EN2A 2HIXA 4TRDA 1Q1BA 4LF5Q 3A8IE 1EWHA 4A3JG 2PZTA 4OEMB 4XYQA 1NR4A 2Z6KC 2E5LL 1NUCA 3D4WA 1PH3A 4ZKCB 4LW1A 4MZ9A 1BO0A 5ELOA 1I4XA 1U4MA 3STBD 1WCMG 3E3XA 1HA5A 2QF7A 1JE4A 1CZWA 4CKEA 2GVBA 2KCNA 5C0XH 1V1PA 1NAPA 4NXNQ 1YHBA 1Q12A 3CPWA 4YWLA 3GTOB 4DV2Q 2NN6I 3A7AB 4LJZC 4LFBQ 4A3JB 3ER0A 5IP7G 2UXCQ 2JA8G 3VR5A 2KCTA 1LTAD 2NTTA 3ONAB 1AZQA 1ILPA 3KLWA 3P1HA 3I8ZA 2PQAB 1BDOA 4B3ML 4JI8Q 1W3SA 1MKHA 3K57A 4OWWB 1B1ZA 1QOHA 1ET6A 2RBMA 5JEAH 4KMUC 4B3RL 1RKNA 1STGA 1U4LA 1AE2A 2G9HD 3E0EA 4HEDA 1I94L 2RKSA 4IN3A 1IYJB 2OXPA 2QDBA 1ILQA 2O4XA 4JI7L 3UDFA 3HZXA 2F3VA 1JORA 4JI5L 1JJ2A 4A93G 5M3FB 1OXXK 1AN8A 2KUMA 1F2MA 3KF6B 4X64Q 5DLQE 1SMYC 3M4OB 3ULPA 4DR2Q 1LM0A 2AQ1B 4ME5A 2WAQE 5M3FH 1YIJA 1A3VA 3NEMA 1CSPA 4M8AA 5J39A 3IKJA 2F1MA 1XPOA 2VQEL 1QB5D 2A6EC 1KRTA 3T56B 4L5TA 4IUTA 4HR7B 2B2WA 5E7NA 1I6VC 3BYTB 1EEID 1HA6A 4QY7A 1JOOA 1E0BA 2QILA 4RCOA 5KEEA 1PZID 2MPMA 4X64L 4JBKA 3VR3A 4UP7A 4CDCC 5IOCA 4IFDH 1F9QA 1TWAB 4GS3A 1PTOF 2RDGA 4HSPA 1DJRD 3FKIB 3S17B 5IY0A 2JEAI 2H4OA 4X66L 4LFAQ 1I3QB 2F0PA 1LV9A 2F0UA 2YYZA 1RF2D 2CQOA 5C4ZA 3MXPA 4BWGB 2KQ3A 3VYUA 2A68C 1Z6HA 2HQEA 2R92B 3HOVB 1LT5D 4DR7Q 2LKVA 2HUGA 2A69D 1PZJD 4KLKA 2F0JA 2ZTCA 4DR7L 3E0JA 2UUCL 3PUZA 3HOVH 2IHFA 3Q6SA 3HKZE 3RUZA 3T13A 5C3EH 2WB1E 2HD3A 3HOXH 3CC7A 3S24A 2K5NA 1Z47A 4H7BA 2EYJA 2R93H 4ULLA 1X65A 2UXDL 2UUCQ 3JAME 3K5MA 3KBGA 2K5DA 3U9OA 5KNDA 4KD4A 1B9NA 1VQ9A 4IFDI 4IZ8A 4WJ4A 3MC0B 3CKIB 3Q8DA 1ZEQX 5T1IA 1H9JA 4HMIA 1S5ED 3CP0A 2FMMA 4KKTA 2O5JC 1ESRA 3HOXG 3H3VC 1NR2A 4RGMA 1PRTD 2K1BA 5LMUQ 1TWGH 1Y1WG 2A73B 3MEFA 4K8JA 1Y69U 1GD7A 1IKLA 1VQLA 4NB3A 1HNXQ 1YNNC 2JA8B 1C4QA 2MO1A 2R3ZA 1J5EQ 1HPCA 1E22A 2Q2IA 3K80C 2EE1A 2VQFQ 4JI0L 1SNDA 2NVTB 3GTOH 3OMCA 1EQQA 4JOIA 1CT1D 2XWBB 1LYLA 1D5ZC 1Y1WH 3KYHC 3PUXA 1X3EA 1B44D 1F9RA 1KAAA 2ATWA 1EQRA 1WCMB 1RL2A 4KKSA 1EOVA 2XGTA 3BZKA 4DV3Q 4EQPA 4IOAA 3S16B 2E75C 2A6HC 4LFBL 1SROA 1NY4A 2K50A 1AH9A 5JJKA 3H3VI 4CHTB 5A2QE 5ELBA 4BBRB 1XMQL 2J0TD 2YTVA 1SYFA 1DXMA 1D5MC 3TEHB 4A93B 1IXRA 3TP7A 2YTXA 1E2WA 3GTKH 4KHVA 3RN2A 3RLNA 3NHHA 2L1BA 1GUNA 2F0TA 4JPBW 3G4SA 5M3MH 3GTQH 2Y0SB 4LNQA 4JYAL 4YCVA 2K33A 4A3FG 1CKNA 4JVZA 2B63B 3D4RA 2MUYA 5AJ3L 3MWYW 3PUYA 2KVMA 2R7ZH 3JAMc 3NENA 4A3EB 1P8LA 3LWUA 1VMCA 1S72A 2EYLA 4X3KA 3RLOA 4DR3L 4KY6A 1EL0A 4L63B 3FKIG 4DN4M 2B2VA 4Q0FA 4C3IH 4PZ6A 4LF4Q 1UE6A 2RHQB 4GKKQ 1T5EA 2N49A 4CGYB 2DGYA 1RHPA 3CRLC 5C5MA 1EY6A 1G8ZD 1RTNA 3DXJC 1KRSA 1S4ZA 3VYTA 4XTCS 5TSSA 1DZ1A 1QILA 2RSNA 3E9IA 5CV9A 2RVLA 4RAUC 3G7LA 4DNRB 2F0QA 3RNUA 1EEFD 1WYDA 3GO5A 2HDLA 3I4MB 4GN4B 1S5BD 4Y7NH 4BY1B 3IFDA 4HIOA 4DR1L 3VR2A 2I5HA 1EWCA 4R1JA 4RA8A 3PIP3 2UXBQ 4GLAC 4F8MA 2E76C 4RCNA 1LUZA 4X62L 4EQNA 4FF4A 2EQSA 2L4NA 3LNNA 4I65A 1GXDC 4A76A 5CC4A 1TWHB 1WVLA 3K58A 1KLGD 1CQFA 2EJMA 2V1CC 4GLXA 3DLLA 4H0LC 4NPSA 1EY7A 4QIWE 1SR3A 2B8GA 1A3TA 4GKJQ 4RFBA 3I70A 1IW7D 2YU9B 4OWTB 1X3FA 1VQ6A 3F2DA 1YZ6A 1Y8PB 1L1OA 3HKZG 3BDOA 3M7GA 1JICA 3TMEA 3J7AF 2WAQG 5CR3A 2F0HA 4DNIA 3G6JB 4B9XA 1TWGB 3GV6A 1NTGA 2HDMA 4A3KG 2VXWA 1PH2A 3TS0A 3T1YQ 2A6HD 2LSSA 3WOFA 3R93A 5IT9c 1KDBA 1V1QA 1EYAA 3HOUB 2J4XA 1MD2D 5ELFA 2NVTH 1ZYRD 3D4DA 4EVOA 2KCCA 1GHJA 2D62A 2LMCB 4GN5A 1ASYA 5FLXc 4P71A 1X3QA 1S3OA 3F2BA 4YWMA 3ITPA 4XIGS 3HOWB 1PH9A 3PO3H 3T1HQ 4AYBG 1Y1WB 5IGBA 1XNQL 4O2DA 2E74C 4YY3Q 2ZJRA 1KL9A 1J5EL 1SLJA 1I3QH 2Q8RE 3KJPA 1O7ZA 3J81j 1A3UA 2FHTA 2RSOA 5L37A 5DM73 5IT9L 2BCOA 2JA7G 3HG9A 2XRSD 3I2ZA 2LFNA 5EKKA 1L1OC 4BS9A 3DEOA 1FYCA 4BBRH 1CHPD 3GTJB 4L5QA 4PZ7A 3C3LA 3Q0AA 3PMFA 4HMJA 2C35B 4H13C 4DV0Q 1SSOA 3EIVA 4OXPA 4CDDC 4A3IB 4B3MQ 5HGQA 2NUCA 1WD0A 5J3BA 1I6HH 3BVMA 4LF8Q 1IBKQ 1JWMD 4A3EG 3ERQA 1X32A 1YI2A 2OTLA 2AUKA 2UXCL 2VB2X 2R7DA 5IGFA 1SE3A 1QVGA 2V4DA 2B2VC 1N8RC 2MHVA 3S15H 1YJ9A 4UHVA 1Y14B 3EFXD 1WTXA 1SYBA 2PQAA 5BR8Q 4JI7Q 4V0BA 5E1FA 3TP5A 3KF8B 4X3TA 1HXYD 1ESFA 2F0IA 4DAYB 5LMNL 1CFMA 1G291 2JA5B 4C3JB 2WINB 2EYHA 2F0EA 5HURA 3U4ZA 1Y1VB 1PHJA 2QEXA 1QVCA 1SYCA 1BCPD 1RD9D 3N6RA 4BXXH 3TS2A 2ASBA 1HJPA 1JE5A 2EY1A 2KHJA 1BCPC 4UY8C 3I3CA 2ZJPA 5CBEE 1R4PB 1VQHA 3CMEA 3CCJA 4AYBE 2JE6I 4RKLA 2X6LA 4LUZA 2CCZA 2Z9HA 1TS2A 2OF1A 3RLFA 1LTID 3GTMB 2NN6H 3S9WA 2UUAQ 3CAMA 3GV3A 1CKOA 2QA4A 2HHHQ 1Y1VG 4UP9A 1VQBA 3Q22A 1JWSD 2NVQH 2PMZE 2AKWB 2XVSA 1JOQA 1KHIA 2K6AA 5LL6S 1E7ZA 2K01A 3SDZA 1SYEA 1I4HA 2R7FA 1V9PA 1W2BA 3TZUA 1H9RA 2ZM6Q 4DV1Q 3K7AB 3CQZH 4DU9A 1CI3M 3MA2B 1K0RA 3CHBD 4JOIC 3GTKB 1Y8OB 2NYZD 5IWAL 4HSVA 1TWFB 2K52A 1XPRA 4JI1L 3U9SA 3H6MA 1QWYA 1JB3A 1E1OA 1X56A 5IIFA 3M4QA 4JI3Q 4A3MB 1FGUA 3FDTA 5J1ZA 1MJEA 4NXMQ 1WD1A 2RHSB 3MAQA 1SNOA 4MTNA 4XXEA 2WFWA 2YTYA 5IGGA 1EY9A 1BNZA 4KY5A 4R8IA 1LTTD 3L9AX 4IFDJ 1CUKA 2B2YC 4B3SL 2JQOA 1J6QA 4DV7L 1A2TA 2EDGA 1NBWA 4C3IB 2A1AA 5M5XH 2PO4A 5M5YH 2MO0A 2PI2A 1SBBB 3J80E 1BBWA 3D6WA 2NVXH 4N8X1 3BZCA 2VUMB 2QEJC 3I55A 4YHHL 4H44C 4DNTB 4A3DB 4X6AH 2R92G 3BJUA 1DOMA 1PLFA 2LY7A 4HJ7A 4J15A 1RODA 4I7AA 2C5CA 3MXUA 4JG2A 3MXNB 3URYA 1VQNA 4A3CG 2F0KA 1KXLA 2F0MA 2EIFA 1B2TA 3I4NH 1L0YB 1UAPA 1Q7YC 1QUQA 1LTGD 4FDBA 5FLMG 5KNCA 4Y7NB 2VNUD 1KDCA 2Z6KA 1LT6D 1I4RA 4NP5A 4RGOS 1IYUA 1EFID 2DJFC 3CD6A 1DD2A 4A3DG 2NBFA 4A3BH 1PTOB 4KD3A 1Y8NB 1C7YA 3PO2B 5E4XA 4FP5D 3N52A 1EYGA 4EX5A 3SVMA 2NVYH 1PZKD 3KLRA 3PO2H 2WV6D 1JR0D 3KF8A 4LUVA 5JVH3 1FNWA 2B2YA 3QWNA 4XT1B 4IUQA 1VQFA 3G48A 5M3FG 2R61A 1VF7A 5EPJA 1V1OA 3J80L 2PPBC 3TZDA 1GUSA 2JA6G 2B2WC 3DM1A 4DV3L 2O5IC 1NNXA 2VW9A 2VB3X 4G4KA 3RZOB 1YVCA 1SFOB 2F0DA 3ULJA 2JA5H 2EY2A 2OTJA 4R9WA 2MP1A 2R7ZB 4IPCA 5FLMH 3EROA 1MHWC 1N36L 3HOZB 1PFNA 4KHPL 1K83H 1JCKB 1OO9B 5E4WC 4DAYA 1SRUA 4ME3A 3MFYA 1HNZQ 3UDGA 1QE6A 3ZJYC 3NQIA 1EWIA 1UWVA 5JJZA 1GVPA 3ND8A 4R4CA 2DY8A 2JYOA 3A74A 2KBNA 3IRBA 5M9OA 4LFCQ 1C0AA 2F0FA 1SE8A 3K5NA 1SJED 1STYA 1QNUA 2XIWA 3SHLA 2AMCB 2PI2E 4PZ8A 4DUZL 4J8QA 5CORA 1OTCA 2HHHL 3EQLC 1K0SA 3F2UA 2AWNA 1VDZA 3I90A 5GAEC 2PZWA 4DXGA 5BR8L 4C3HB 3I4LA 3M7NA 1O78A 4JI5Q 3D31A 5C3EB 2A8VA 4FXDA 3L7ZC 3PUWA 2K4KA 1IBLL 1HH2P 2JXMB 4BXXG 2PYKA 4LF9Q 1QCBD 3F2CA 1BUVT 2FINB 1SN8A 4DR2L 4LF5L 1YNND 4JI2Q 1WTHA 3MFGA 1SNQA 1LLRD 4JI2L 1TY2A 2I46A 5IWAQ 1PH6A 1EY4A 3W5OA 1H95A 2EOTA 2QGQA 1K8AC 4HCSA 5EPLA 1PRTC 3D8GA 5BN4A 4G57A 4OO1G 4R4IA 1A6XA 1Q90A 1X3PA 3OWEB 1HFNA 3KUPA 3BYYB 4Q5VA 2WP8J 2B39A 3FMCA 4G7ZC 3NELA 2CHBD 2N8NA 4J1MA 1G6PA 4C3IG 4DR6L 4KY7A 3W3AA 3PIPA 5JOBA 4A3GH 4GN3B 4HJ8A 1VF5C 1VCIA 3A0JA 4B3SQ 2F0VA 1RTOA 1U4PA 3H3VH 1IZ6A 1DGSA 1PXUA 2C9OA 5KGUA 4NXNL 1HQMC 1FNUA 5JPMC 2MGSA 3HRZC 1XTCD 3C46A 1O7IA 5GADC 4JYAQ 5M5WB 3RR5A 4CJ1B 3SEBA 5M3MG 1CZGA 1EIHA 4X65L 2PW5A 1KABA 1EZ8A 3L2PA 1O80A 1OXUA 1II3A 2E8GA 4IURA 5CBAE 1KDAA 1N34L 3ND9A 1UEBA 1ENFA 4O42A 2L9HA 1WTQA 1A8VA 1TU2B 1YJWA 1PH5A 3I4NB 5FK9C 3J80c 4HTHA 2JK8A 4B9WA 5DAUA 4U673 3MXNA 4POGA 3GTMH 5GAGC 1PTOD 1X54A 2AHOB 5D3DA 1SEBD 2JN4A 2TSSA 1O7YA 1BXTA 1XNQQ 5IP9H 4JV5Q 1VQ7A 4LF4L 4YY3L 4DR4Q 2IHEA 4XT3B 4JC0A 1A62A 2WB1B 1HUMA 4LAAA 2WKDA 1L0XB 2PZUA 3GD7A 1NE3A 3A8JE 2ES2A 2NVYB 2ZXPA 2F4VQ 2Q8TA 1I5FA 4MNOA 4FXGC 3S1QH 4ID6A 4Y52H 3S1RH 2MNAA 4K0KQ 5FOBB 4DV0L 4F88A 3TSSA 2JEBI 4YIJA 1GUWA 1BOSA 3TQYA 5C4JH 3BDLA 1YJNA 3RZOH 1LT4D 2A69C 1CA5A 1M8AA 2RA4A 3UDIA 3S15B 3QR8A 4WFN3 2NN6G 1BCPB 2CFMA 5HY6A 4L5SA 1QNKA 1Q8KA 3H94A 5I2YA 2ZTDA 4JI4L 1L1OB 5JEAJ 2Q2UA 3R8BA 3DWPA 4QUFA 1HR0W 2JA6B 3GTLB 2CWAA 4AIMA 4HJAA 2VUMH 5IYBG 3H0GB 2D2CC 4WRDA 1BVSA 1SAPA 4RGTA 1EIFA 4DV7Q 1SDFA 1D1KA 1I4GA 3H0GH 1FNVA 4A3BG 5ELNA 3FVQA 1HNWL 4B3TQ 4A3JH 4KJNA 3T4AC 2VL6A 1GO3E 3W1GA 1NJIC 3RD4A 1M90C 1P16A 2OQ0A 1SMYD 3NBHB 4G7HC 5G3LF 1YEZA 4BY7B 3Q23A 4JBMA 1AEXA 2K5QA 4R4OA 1QUQB 3HOWG 4PV1C 3J81L 4EQ5A 1MIUA 1HZ9A 1MBYA 3HOUG 5H1SE 4IJLA 1LACA 2RF4A 2VY3A 5LHY1 1WFQA 2WB1G 3M4PA 3DHQA 4GLVB 3J81E 1KLUD 1BQQT 2F0NA 2Q2HA 5C4XH 1FJGQ 4DAMA 1Y1VH 3T53B 3SGIA 2CVRA 4CKBA 1KC8C 3PF4A 1B70B 3NTIA 1WI5A 2LS01 2Y0SE 3OHXC 1WJJA 3X3MA 3P75A 4JW0A 4E6IA 4FYDA 3QIAA 1PFBA 3ULLA 4A3LG 4HIMA 3PUVA 1VQ5A 1A0IA 2M9VA 1K28A 5KYLA 1VQJA 1JQYD 4ZUJA 4YCWA 3OMGA 5KRUA 1UEAB 3EVQA 3TBIB 3CC4A 4P74A 3HS0C 5I6WA 2NZ1D 2BDNA 1VQIA 4A3LH 1MSGA 4XDXA 4OHJA 1VQCA 2A6ED 4C1NI 1CM9A 4DR5Q 5JVG3 3VYSA 5I4DA 4OX9Q 3U4VA 1VQPA 1PYBA 4OX9L 4ZRZA 2N88A 3HOVG 2QW7A 1EFWA 3OOCA 2Z4HA 3QO2A 2IJ0A 5JJLA 5AJ3Q 2NZHA 3C1FA 4OL7A 2HIVA 2K05A 3CCEA 4DV5Q 2OQKA 3BVGA 1MI2A 4DKAC 3M3YB 1LTRD 1NMFA 3I91A 4JBJA 4UP8A 1QVFA 2DJGC 1WTPA 4JBWA 1YHAA 5FO8B 4RG1A 3T1YL 4QMGA 5CMDA 4GNXA 5CGKA 4QIWB 1K8MA 1RDPD 5IYCH 4K0KL 1U9RA 1AE3A 1HRJA 1HZCA 3S14H 2QDLA 2D0OA 1V8QA 1EIGA 5C4JB 3M85A 4LMQD 3WDNA 3A5ZB 1BBUA 2MFIA 5EGTA 4O0AA 3GTGH 2PNRC 4H02A 1YHQA 4A3IG 4DK1A 1JWUD 2B2TC 3NXWA 3OIPA 4N9TA 3AFQA 1PH1A 3S1MH 3FRPB 4JV5L 2ID0A 2OEOA 1SFOH 2E2IB 1M4VA 2I5LX 5CV6A 4HJ5A 2UXBL 4X66Q 3TDQA 1JOKA 1CKNB 3HEJA 1K83B 1F9PA 2K5VA 1PTOC 5C5LA 1BF4A 5G3LD 3QG1A 1J9OA 2NWGA 1G91A 4OWXB 1X9NA 1MGSA 2UU9Q 1GKHA 3KJOA 1E2ZA 2EYOA 4ZK9B 3K0YA 3K7UC 2LXKA 4MHEA 1B3AA 2B8FA 2F03A 1FGBD 1QJOA 1HNZL 2EJFC 4C3JG 1M1KC 1TWCH 3OW2A 4ZLTF 4OO1H 2IY5B 5FO9B 1IBKL 5I9PA 4IOCA 3QOLA 3K5LA 4P2CB 5C0XJ 1LO5D 2JA7H 2MQHA 3AYHB 4X3UA 1IBML 2Z4IA 4IFDG 4JK1C 2SOBA 2ALYB 3K81C 4X3SA 1AZPA 3K6OA 1XWEA 1KD1C 3QB3A 4BBRG 4IUVA 3TP8A 3M4OH 1A63A 4PG3A 1NCVA 5KYIA 4KJOA 1K8OA 5EBDA 1VQOA 4M1UB 4KKUA 5GROA 4A93H 2ZTEA 1KAWA 2CWPA 1XJVA 4HIKA 1VQKA 3KDFB 4NKLA 3KLSX 1T5XD 5LMNW 4OONA 1F9SA 1B4OA 3IFTA 2E2HH 1GHKA 4B3TL 3CU7A 3W1BA 5DEHA 2YV5A 1OXSC 1GJXA 2E2HB 3I7FA 3BU2A 5EJWA 3FPUB 4GOPA 2ZXRA 4FF2A 4JI0Q 1D1IA 3MEHA 3W2DA 2OWOA 2XRQD 4CDFC 4K14A 4DV4L 4DV6Q 3OTOQ 4LUOA 2VQFL 1ASZA 1J8IA 1FVIA 5JEAG 3CF5A 2NVXB 3S2DH 4K5VA 4RWSC 1DONA 3T1HL 3GTPB 4RH6A 1FL0A 5E3FA 4RGNA 2ZXOA 3TRZA 4K5WA 4CJ2C 5GQOA 2XNAC 4XQQA 5C4HA 3HOWH 3E6ZX 2ICEC 4ILWA 4LWCA 1HZAA 5K36G
chains in the Genus database with same CATH topology
1BR9A 3D6CA 5CV8A 2O2LD 2R93B 4FF1A 4ZAIA 2M00A 1W6KA 3NTHA 1CK1A 2GA4B 4KN7C 1ENAA 5C4XB 5EQ0A 1S5DD 2A74C 2F4IA 1R9TB 4DFAA 1F77A 1B50A 1EU4A 5J22A 1PRTF 5KNBA 1PDQA 1WTWA 1BBXC 4DAPA 1UUPA 1RJTA 4IUNA 1QG7A 3VYRA 2X6GA 2J7ZA 4MIUA 1HFGA 4A3GB 4WORA 2HCIA 3SE0A 3FPPA 5CV7A 3FEWX 4TKOB 4Z9CB 1ZKOA 4NMZA 3AU7A 4U68A 1TT2A 2BE5C 1TQOA 4K2KA 5D3IB 1H9MA 4QB4A 3SK8A 1H9KA 2B2UA 1SYDA 2B2UC 3V05A 1B9MA 3RMHA 1MSHA 1S5CD 4NDXA 1TR5A 5IGEA 4A3FB 5I2XA 4ZYSA 1TS5A 3I72A 1EY8A 4HCEA 2CW0C 4QUCA 1VMPA 3S1RB 2JA7B 1AP0A 2ENBA 3QJYA 1I6HB 1G6ZA 1PMRA 4BBSB 1TS3A 2L5TA 3X3NA 2WAQB 2KEDA 5IODA 1GOZA 3MZ5A 3SR1A 1KNEA 2SEBD 1SYGA 1HHVA 3OW7A 1XXGA 4B08A 2IWHA 4OIJA 2L55A 3MTSA 4KI0A 3S2HB 2K32A 3WOEA 3HP3A 2BOSA 1HUNA 5EBCA 2R6GA 3OPOA 2B2TA 1CHQD 2QCPX 5A35A 2XSCA 3BG3A 1DYQA 4CKCA 2BA1A 3DWAA 2FMCA 4ABNA 3MXGA 3HKZB 2RDFA 3IAYA 1C48A 4ZUIA 2NVQB 3NWTA 1TWCB 4PMBA 1EOTA 2SNSA 1W6JA 1BCPF 2A68D 1EY0A 5K36H 1OXVA 5ELCA 1U4RA 2AUJD 1TS4A 3MVVA 3VR6A 1ZYRC 5CYUA 4FF3A 3J7AV 1FR3A 3OWFA 3TN2A 1KNAA 4GZYC 4F87A 1F2YA 2EY6A 1WTRA 5AFWA 2WKCA 3O13A 5ISRA 2ICIA 4FVMA 1STEA 3S14B 1LABA 3H09A 4LK1C 2X69A 3NUCA 3P20A 1EZ6A 2KHSA 5D65A 1G2TA 4IALA 1EU3A 1ML0D 2K5WA 1STBA 3VA5A 2FJ2A 4DF7A 3V96A 1V43A 4IUUA 2A5HA 2F0GA 4FXKC 1SNPA 5C3XA 4BA1I 3V2TA 1LTBD 2Z8LA 2KEEA 2K7VA 2EZVA 2DNEA 2K04A 1F2LA 3P7JA 2BA0A 4N9PA 2F0WA 1RCVD 1ENCA 2EY5A 4RKBA 3GQBA 3DEPA 1STAA 4PNYA 3GTGB 2EPBA 3A8KE 2EXZA 5IT9E 4TSSA 4KTAA 3RZDB 4QCLA 3S1MB 3NE5B 1XX8A 2M2LA 5K5PA 4DK0A 4OIKA 4R8NA 3EA6A 3A56A 4K6LA 2AQ3B 1IW7C 2XWJB 4PQXA 2IPKD 4J6HA 2RDHA 2NTSA 1H9SB 1PYWD 4XYOA 1AW7A 1NSNS 1TKWB 2CQAA 3A54A 4KV6A 1XYIA 3A55A 5C0XI 3C2PA 2CW0D 5EKIA 1EYCA 4TQUS 1SNCA 4PMCA 3BZDB 1R4QB 4UDUC 2OT2A 3S2DB 4NW2A 1DOLA 3NBHA 5M5XB 2E2DC 2ZT9C 4ODGA 1SE2A 3MHBA 4ZQ3A 1Q8IA 4L8JA 5ELDA 3IL8A 1GUOA 1C8CA 4XQNA 3BVZA 1YNJC 3A7LA 1E2VA 1HQRD 5IGDA 2E2JB 5I9OA 3SXHA 4C3HG 2F0LA 5JAVA 2QKIC 3NSWA 1CA6A 4I7ZC 2BE5D 3CQZB 1Q1EA 4DAVA 1IHZA 3EJIA 5DM63 1I50B 4C56C 1S5FD 1TY0A 2L12A 3VR4A 2IL8A 5A2QL 4KK7A 1ONLA 3K5OA 3TP6A 1PFMA 1O7LA 2KECA 3AB9A 3UI2A 3R2IA 2AWOA 2K28A 1STNA 4HAEA 1D2BA 1F2ZA 3HGBA 2D9UA 3SK4A 3C1EA 4IUPA 3NBIA 2L0CA 5M5YB 3KK7A 2EJGC 3E5SA 5FLXE 2EYMA 3HOYB 5I6YA 5HGTA 5KIXA 3LX0A 1A15A 2H1EA 2RQXA 4K8IA 1GUGA 3SK5A 1EYDA 3QOJA 2IW3A 1STHA 1JC7A 1D6EC 4K2LA 5FKAC 3CRKC 2G9DA 3Q24A 1I4QA 5DNFA 2F0OA 2WACA 1ZXTA 2DY7A 1DM0B 1H9SA 5NUCA 3NP8A 3T51B 4MN3A 3S1QB 1I4PA 2WIIB 1Z7TA 3PIO3 1TIID 3PV0A 3DMUA 2XN9C 5ELEA 4BA2I 2Z1CA 4O1NA 3K59A 4A3KB 1DOKA 1FD7D 5FLXL 1A2UA 1B53A 4ZKBB 5EKLA 5C3WA 1HTLD 1TVXA 2PQEA 3NQTA 1D5XC 3D3RA 4RHSA 3ZYYX 1PRTB 2IT1A 2PCFB 4AYBB 4C1NK 1IL8A 2BDOA 3S1NB 2AQ2B 5CV4A 4KHZA 4DGZA 3OIQA 2KA7A 2L11A 5C0XG 2PMZB 1EQVA 4DA2A 2TMPA 5D14A 3T16A 2PW7A 1IKMA 5C6AA 4K5XA 1AFPA 5EPKA 1G2SA 3NPPA 4HN7A 5LL6X 4UAIA 3KBXA 4KN4C 1CQVA 1SNMA 2KOLA 2F0SA 4CBVA 5CV5A 1OXTA 4CJ0B 1CTMA 4IQZA 1V1PB 4RHRA 3JAML 1UNSA 4DXFA 1SXTA 1GUTA 1EQTA 2K03A 5IGCA 1KTKA 2Q8IB 4A3BB 1PTOH 1Q3LA 1HCZA 4S3SA 2SDFA 2DN8A 2D5DA 3GP7A 4L6TB 1WTVA 2IX3A 4QF4A 2EVBA 2IX0A 4XQJA 4C2MB 3KLSA 3H91A 4EGVA 3LWEA 5FO7B 1LT3D 4V190 3DWQA 3M4YA 5COYA 4PMWA 2DNCA 3AMUA 2NB0A 3DUZA 4FO2A 4K6DA 1EY5A 3BDCA 5C44B 1DCZA 4OO1I 2N55A 2F3WA 4EQOA 2JP1A 1IYVA 3OSOA 1SJHD 5JPNC 2SNMA 2I07B 3BS1A 5BN5A 1HTPA 5T1GA 3R3OA 3SK6A 3PO3B 5BN3A 1WTOA 3J7YW 1YNJD 3NK9A 3R2TA 3NTKA 3NWSA 2EYFA 5F2DA 1ICWA 2EYPA 1LTSD 1SE4A 4WJWA 2FFKB 1ET9A 3HOXB 5M3MB 3GTQB 4G7OC 2KJXA 4OGQC 2MJ8A 3I73A 3L3OC 4FNFA 2IX1A 2JSOA 3VA7A 4F7XA 2HCCA 4TRDA 1Q1BA 3A8IE 1EWHA 2PZTA 4XYQA 1NR4A 1NUCA 3D4WA 4ZKCB 1BO0A 1I4XA 1U4MA 1HA5A 2QF7A 1JE4A 4CKEA 1CZWA 2KCNA 5C0XH 1V1PA 1NAPA 1Q12A 3GTOB 2NN6I 3A7AB 4LJZC 4A3JB 3VR5A 1LTAD 2NTTA 3ONAB 1AZQA 1ILPA 3P1HA 3I8ZA 1BDOA 3K57A 1B1ZA 1QOHA 1ET6A 2RBMA 5JEAH 4KMUC 1RKNA 1STGA 1U4LA 2G9HD 4HEDA 2RKSA 4IN3A 2OXPA 2QDBA 1ILQA 2O4XA 3HZXA 2F3VA 1JORA 5M3FB 1OXXK 1AN8A 2KUMA 1F2MA 1SMYC 3M4OB 2AQ1B 4ME5A 1A3VA 4M8AA 5J39A 3IKJA 2F1MA 1QB5D 2A6EC 3T56B 4IUTA 4HR7B 2B2WA 1I6VC 3BYTB 1EEID 1HA6A 1JOOA 1E0BA 2QILA 4RCOA 5KEEA 1PZID 2MPMA 3VR3A 5IOCA 4IFDH 1F9QA 1TWAB 1PTOF 2RDGA 4HSPA 1DJRD 3FKIB 3S17B 2JEAI 2H4OA 1I3QB 2F0PA 1LV9A 2F0UA 2YYZA 1RF2D 5C4ZA 3MXPA 4BWGB 2KQ3A 3VYUA 2A68C 1Z6HA 2HQEA 2R92B 3HOVB 1LT5D 2LKVA 2HUGA 2A69D 1PZJD 2F0JA 3E0JA 3PUZA 3Q6SA 3RUZA 3T13A 1Z47A 4H7BA 2EYJA 4ULLA 3JAME 3K5MA 3KBGA 2K5DA 3U9OA 5KNDA 4KD4A 1B9NA 4IFDI 4IZ8A 3MC0B 3CKIB 1ZEQX 5T1IA 1H9JA 4HMIA 1S5ED 2O5JC 2FMMA 4KKTA 1ESRA 3H3VC 1NR2A 4RGMA 1PRTD 2K1BA 2A73B 4K8JA 1Y69U 1IKLA 1YNNC 2JA8B 1C4QA 2R3ZA 1HPCA 2EE1A 1SNDA 2NVTB 3OMCA 1CT1D 2XWBB 1D5ZC 3PUXA 1B44D 1F9RA 1KAAA 1WCMB 4KKSA 4EQPA 3S16B 2E75C 2A6HC 4CHTB 5A2QE 5ELBA 4BBRB 2J0TD 1SYFA 1DXMA 1D5MC 4A93B 3TP7A 1E2WA 4KHVA 3NHHA 2L1BA 1GUNA 2F0TA 2Y0SB 2K33A 2B63B 3D4RA 2MUYA 3MWYW 3PUYA 2KVMA 4A3EB 3LWUA 1VMCA 2EYLA 4X3KA 4KY6A 1EL0A 4L63B 4DN4M 2B2VA 4Q0FA 1T5EA 4CGYB 1RHPA 3CRLC 5C5MA 1EY6A 1G8ZD 1RTNA 3DXJC 1S4ZA 3VYTA 4XTCS 5TSSA 1DZ1A 1QILA 2RSNA 5CV9A 2RVLA 4RAUC 4DNRB 3G7LA 2F0QA 1EEFD 3GO5A 2HDLA 3I4MB 1S5BD 4BY1B 3IFDA 3VR2A 1EWCA 4RA8A 3PIP3 4F8MA 2E76C 4RCNA 4EQNA 4FF4A 2L4NA 3LNNA 4I65A 1GXDC 5CC4A 1TWHB 1WVLA 3K58A 1KLGD 1CQFA 2EJMA 4H0LC 1EY7A 2B8GA 1A3TA 4RFBA 3I70A 1IW7D 2YU9B 1Y8PB 3BDOA 3M7GA 1JICA 3TMEA 3J7AF 5CR3A 2F0HA 3G6JB 4B9XA 1TWGB 3GV6A 2HDMA 2VXWA 2A6HD 3WOFA 3R93A 1KDBA 1EYAA 3HOUB 2J4XA 1MD2D 5ELFA 1ZYRD 3D4DA 4EVOA 2KCCA 1GHJA 2D62A 2LMCB 1X3QA 3ITPA 4XIGS 3HOWB 1Y1WB 5IGBA 2E74C 2Q8RE 1O7ZA 1A3UA 2FHTA 2RSOA 5DM73 5IT9L 2BCOA 3HG9A 2XRSD 2LFNA 5EKKA 4BS9A 3DEOA 1FYCA 1CHPD 3GTJB 3C3LA 3Q0AA 3PMFA 4HMJA 4H13C 1SSOA 4A3IB 2NUCA 1WD0A 3BVMA 1JWMD 3ERQA 1X32A 2AUKA 2VB2X 5IGFA 1SE3A 2V4DA 2B2VC 2MHVA 3EFXD 1WTXA 1SYBA 4V0BA 5E1FA 3TP5A 4X3TA 1HXYD 1ESFA 2F0IA 1CFMA 1G291 2JA5B 4C3JB 2WINB 2EYHA 2F0EA 5HURA 1Y1VB 1SYCA 1BCPD 1RD9D 3N6RA 2EY1A 1BCPC 3I3CA 5CBEE 1R4PB 2JE6I 4RKLA 2X6LA 3RLFA 1TS2A 2OF1A 1LTID 3GTMB 2NN6H 3S9WA 3GV3A 3Q22A 1JWSD 2XVSA 1JOQA 2K6AA 5LL6S 3SDZA 2K01A 1SYEA 1I4HA 3TZUA 1H9RA 3K7AB 4DU9A 1CI3M 3MA2B 3CHBD 3GTKB 1Y8OB 2NYZD 4HSVA 1TWFB 3U9SA 3H6MA 1QWYA 1JB3A 5IIFA 4A3MB 3FDTA 5J1ZA 1WD1A 3MAQA 1SNOA 4XXEA 5IGGA 1EY9A 1BNZA 4KY5A 4R8IA 1LTTD 3L9AX 4IFDJ 2B2YC 1A2TA 2EDGA 4C3IB 2PO4A 1SBBB 3J80E 3D6WA 2VUMB 2QEJC 4H44C 4DNTB 4A3DB 1DOMA 1PLFA 2LY7A 1RODA 2C5CA 3MXUA 3URYA 2F0KA 2F0MA 1B2TA 1L0YB 1UAPA 1LTGD 5KNCA 4Y7NB 2VNUD 1KDCA 1LT6D 1I4RA 4NP5A 4RGOS 1IYUA 1EFID 1DD2A 2NBFA 1PTOB 4KD3A 1Y8NB 3PO2B 5E4XA 4FP5D 3N52A 3SVMA 1PZKD 3KLRA 2WV6D 1JR0D 3KF8A 5JVH3 1FNWA 2B2YA 3QWNA 4XT1B 4IUQA 2R61A 1VF7A 5EPJA 1V1OA 3J80L 2PPBC 3TZDA 1GUSA 2B2WC 3DM1A 2O5IC 2VB3X 4G4KA 3RZOB 1SFOB 2F0DA 2EY2A 4R9WA 2MP1A 2R7ZB 3HOZB 3EROA 1PFNA 1JCKB 1OO9B 5E4WC 4DAYA 3MFYA 1QE6A 3NQIA 5JJZA 3ND8A 2DY8A 2JYOA 5M9OA 2F0FA 3K5NA 1SJED 1STYA 1QNUA 2XIWA 3SHLA 4J8QA 5CORA 3EQLC 3F2UA 2AWNA 1VDZA 3I90A 2PZWA 4DXGA 4C3HB 3I4LA 3M7NA 1O78A 3D31A 5C3EB 4FXDA 3L7ZC 3PUWA 2JXMB 2PYKA 1QCBD 1BUVT 2FINB 1YNND 3MFGA 1SNQA 1LLRD 1TY2A 2I46A 1EY4A 2EOTA 4HCSA 5EPLA 1PRTC 3D8GA 5BN4A 4G57A 4OO1G 1A6XA 1Q90A 1X3PA 3OWEB 1HFNA 3KUPA 3BYYB 4Q5VA 2WP8J 2B39A 3FMCA 4G7ZC 2CHBD 4J1MA 4C3IG 4KY7A 3W3AA 5JOBA 1VF5C 1VCIA 2F0VA 1RTOA 1U4PA 1PXUA 2C9OA 5KGUA 1HQMC 1FNUA 5JPMC 2MGSA 3HRZC 1XTCD 3C46A 5M5WB 4CJ1B 3SEBA 1CZGA 1EIHA 2PW5A 1KABA 1EZ8A 1O80A 1OXUA 1II3A 4IURA 5CBAE 1KDAA 3ND9A 1ENFA 4O42A 2L9HA 1WTQA 1TU2B 3I4NB 5FK9C 4HTHA 4B9WA 5DAUA 4U673 3MXNA 1PTOD 5D3DA 1SEBD 2TSSA 1O7YA 1BXTA 4XT3B 2WB1B 1HUMA 4LAAA 2WKDA 1L0XB 2PZUA 3GD7A 3A8JE 2NVYB 2ZXPA 2Q8TA 4FXGC 4ID6A 5FOBB 4F88A 3TSSA 2JEBI 4YIJA 1GUWA 1BOSA 3BDLA 1LT4D 2A69C 1CA5A 1M8AA 2RA4A 3S15B 4WFN3 2NN6G 1BCPB 1QNKA 5I2YA 3H94A 5JEAJ 3R8BA 3DWPA 4QUFA 2JA6B 3GTLB 3H0GB 2D2CC 4WRDA 1SAPA 4RGTA 1SDFA 1D1KA 1I4GA 1FNVA 3FVQA 4KJNA 3T4AC 3RD4A 1SMYD 4G7HC 5G3LF 4BY7B 3Q23A 1AEXA 2K5QA 4PV1C 3J81L 1MBYA 1LACA 5LHY1 3DHQA 3J81E 1KLUD 1BQQT 2F0NA 3T53B 2CVRA 4CKBA 3NTIA 2LS01 3OHXC 3X3MA 3P75A 4FYDA 4E6IA 3QIAA 1PFBA 3PUVA 2M9VA 5KYLA 1JQYD 4ZUJA 3OMGA 5KRUA 1UEAB 3EVQA 3TBIB 3HS0C 5I6WA 2NZ1D 2BDNA 1MSGA 4XDXA 4OHJA 2A6ED 4C1NI 1CM9A 5JVG3 3VYSA 5I4DA 4ZRZA 2N88A 3OOCA 2Z4HA 3QO2A 2IJ0A 3C1FA 4OL7A 2K05A 3BVGA 1MI2A 3M3YB 1LTRD 3I91A 1WTPA 4JBWA 5FO8B 4QMGA 5CMDA 5CGKA 4QIWB 1RDPD 1K8MA 1U9RA 1HRJA 1V8QA 1EIGA 5C4JB 3M85A 4LMQD 3WDNA 5EGTA 2PNRC 4DK1A 1JWUD 2B2TC 3NXWA 3OIPA 4N9TA 3FRPB 2ID0A 2OEOA 2E2IB 1M4VA 5CV6A 3TDQA 1JOKA 3HEJA 1K83B 1F9PA 1PTOC 5C5LA 1BF4A 5G3LD 3QG1A 1J9OA 2NWGA 1G91A 1MGSA 1E2ZA 2EYOA 4ZK9B 3K0YA 4MHEA 1B3AA 2B8FA 2F03A 1FGBD 1QJOA 4C3JG 2EJFC 4ZLTF 4OO1H 5FO9B 5I9PA 3QOLA 3K5LA 4P2CB 5C0XJ 1LO5D 4X3UA 2Z4IA 4IFDG 2SOBA 4JK1C 4X3SA 1AZPA 3K6OA 1XWEA 3QB3A 4IUVA 3TP8A 1NCVA 5KYIA 4KJOA 1K8OA 5EBDA 4M1UB 4KKUA 4NKLA 3KLSX 1T5XD 1F9SA 1B4OA 3IFTA 1GHKA 3CU7A 5DEHA 1OXSC 1GJXA 2E2HB 5EJWA 3FPUB 2ZXRA 4FF2A 1D1IA 3MEHA 3W2DA 2XRQD 4K14A 1J8IA 5JEAG 2NVXB 4K5VA 4RWSC 1DONA 3GTPB 4RH6A 5E3FA 4RGNA 2ZXOA 4K5WA 4CJ2C 2XNAC 4XQQA 5C4HA 3E6ZX 2ICEC 4ILWA 5K36G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZT A;  1STH A;  1NSN S;  3P75 A;  4E6I A;  4LAA A;  4EQP A;  3D6C A;  5CV6 A;  5ISR A;  2PZU A;  5CV8 A;  4KV6 A;  1EY7 A;  1SYB A;  1A3T A;  4K2L A;  1JOK A;  1NUC A;  3D4W A;  2PZW A;  3HEJ A;  5E1F A;  3TP5 A;  5IGC A;  2M00 A;  5C5L A;  2F0P A;  2F0U A;  2F0I A;  5C4Z A;  3MXP A;  1EYC A;  5IOD A;  2F0O A;  2KQ3 A;  1SNC A;  4PMC A;  1ENA A;  2EYH A;  2F0E A;  4ID6 A;  5HUR A;  5KYL A;  1SYF A;  2EYO A;  3NUC A;  4S3S A;  2HQE A;  3MZ5 A;  3SR1 A;  2WAC A;  3TME A;  2PYK A;  1SYC A;  1SYG A;  1EZ6 A;  2KHS A;  2LKV A;  3OMG A;  5CR3 A;  4ZUJ A;  4IAL A;  3TP7 A;  5KRU A;  2F0H A;  4KHV A;  4DFA A;  2F0J A;  2F0K A;  4YIJ A;  2F0M A;  4QF4 A;  3NHH A;  3MHB A;  4ODG A;  4B9X A;  2F0T A;  1SNQ A;  3BDL A;  3EVQ A;  4ZQ3 A;  2EY1 A;  5J22 A;  5I6W A;  5NUC A;  3NP8 A;  1STB A;  1EY4 A;  1KDC A;  3VA5 A;  5I9P A;  3RUZ A;  3T13 A;  3QOL A;  1KDB A;  3DMU A;  4IUN A;  4DF7 A;  4NP5 A;  3D8G A;  4G57 A;  5IGD A;  1EYA A;  3P1H A;  4K6D A;  5I9O A;  3SXH A;  4RKL A;  1EY5 A;  4H7B A;  2OF1 A;  2EYJ A;  2SOB A;  3BDC A;  4MIU A;  2F0L A;  2F0G A;  4KD3 A;  3S9W A;  3D4D A;  5JAV A;  4EVO A;  4WOR A;  3QB3 A;  4J1M A;  2F3W A;  4EQO A;  2EYL A;  3TP8 A;  5CV7 A;  1A2U A;  1SNP A;  4KY7 A;  3U9O A;  5C3X A;  3OSO A;  4KD4 A;  1IHZ A;  3EJI A;  4KJO A;  3ITP A;  5KYI A;  3V2T A;  5JOB A;  2RBM A;  2SNM A;  4KY6 A;  4NMZ A;  5EKL A;  4WRD A;  4IZ8 A;  5C3W A;  5IGB A;  5IOC A;  1JOQ A;  1TT2 A;  1SYE A;  4NKL A;  4N9P A;  1RKN A;  2F0W A;  2PQE A;  3NQT A;  1ENC A;  1STG A;  2F0V A;  1TQO A;  3R3O A;  3SK6 A;  4K2K A;  2EY5 A;  4RKB A;  4HMI A;  4QB4 A;  3C1F A;  5C5M A;  2RKS A;  1EY6 A;  3NK9 A;  4OL7 A;  1STA A;  2RDF A;  4KJN A;  4DU9 A;  5KGU A;  1A3U A;  4ZUI A;  2OXP A;  3SK8 A;  4PNY A;  2QDB A;  3TP6 A;  2O4X A;  2EXZ A;  5DEH A;  1SYD A;  2EYF A;  4PMB A;  5F2D A;  2F0D A;  5EKK A;  3HZX A;  3H6M A;  2EYP A;  2SNS A;  5CV9 A;  2EY2 A;  2F3V A;  4KTA A;  4QMG A;  5CV4 A;  1JOR A;  2PW5 A;  1EY0 A;  5CGK A;  4K8J A;  1KAB A;  1EZ8 A;  2F0Q A;  3ERO A;  1F2M A;  4DGZ A;  1II3 A;  4NDX A;  5IIF A;  1AEX A;  1STN A;  1KDA A;  1TR5 A;  3PMF A;  4HMJ A;  5IGE A;  5K5P A;  1F2Z A;  1U9R A;  3SK4 A;  3MEH A;  3C1E A;  1EQV A;  5J1Z A;  4ME5 A;  3MVV A;  1A3V A;  4K14 A;  4R8N A;  1SND A;  2NUC A;  1SNO A;  1EY8 A;  4HTH A;  5J39 A;  3T16 A;  2PW7 A;  3E5S A;  5DAU A;  4B9W A;  4F8M A;  2EYM A;  3DHQ A;  3OMC A;  5C6A A;  5EGT A;  4K5X A;  5IGG A;  1EY9 A;  4K5V A;  3ERQ A;  4KY5 A;  5HGT A;  2F0N A;  5I6Y A;  5KIX A;  3LX0 A;  3OWF A;  5E3F A;  4EQN A;  5M9O A;  3NXW A;  1SNM A;  4J6H A;  4N9T A;  4F7X A;  2F0S A;  4I65 A;  2F0F A;  5CV5 A;  4K5W A;  1JOO A;  5IGF A;  1A2T A;  4K8I A;  5CC4 A;  5KEE A;  2ENB A;  1F2Y A;  5C4H A;  1STY A;  1EYD A;  1KAA A;  2EY6 A;  3QOJ A;  4TRD A;  3SHL A;  3SK5 A;  2OEO A; 
#chains in the Genus database with same CATH topology
 1BR9 A;  3D6C A;  4DV4 Q;  5CV8 A;  3CCU A;  2O2L D;  2R93 B;  4FF1 A;  4ZAI A;  1X6O A;  4JCV E;  1ICF B;  2M00 A;  1W6K A;  3NTH A;  1CK1 A;  1N33 Q;  4BY1 H;  2GA4 B;  4L5R C;  3UE1 A;  4KN7 C;  1ENA A;  5C4X B;  5EQ0 A;  1S5D D;  2A74 C;  2F4I A;  1R9T B;  4NXM L;  4DFA A;  3A5U A;  1WCM H;  1F77 A;  1B50 A;  1EU4 A;  2K5H A;  5J22 A;  1PRT F;  5KNB A;  1PDQ A;  2DUD A;  1WTW A;  1BBX C;  4DAP A;  1UUP A;  3RN5 A;  1RJT A;  4IUN A;  1QG7 A;  3VYR A;  3KOJ A;  2X6G A;  2J7Z A;  4MIU A;  1HFG A;  3PCO B;  4A3G B;  4WOR A;  2HCI A;  3SE0 A;  5C3E G;  4DR3 Q;  3FPP A;  5CV7 A;  5M5W H;  3FEW X;  1NMG A;  4TKO B;  4Z9C B;  1ZKO A;  1QZG A;  1G51 A;  4NMZ A;  3AU7 A;  2L15 A;  4U68 A;  1TWA H;  2N3S A;  1TT2 A;  3HOU H;  3EBE A;  2BE5 C;  3CCS A;  4B3R Q;  5C44 G;  3HOZ H;  1TQO A;  2BH8 A;  3VDY A;  2R7Z G;  4K2K A;  5D3I B;  2RCF A;  1H9M A;  4QB4 A;  3PIO A;  3SK8 A;  1H9K A;  2B2U A;  1SYD A;  3M9B A;  2B2U C;  4A3F H;  3V05 A;  2JJQ A;  1B9M A;  2EXD A;  3RMH A;  1TWH H;  1XTD A;  1MSH A;  1S5C D;  4IJH A;  1EIY B;  5IYB H;  4NDX A;  1TR5 A;  5IGE A;  1PYS B;  2UUB L;  4A3F B;  2JA6 H;  5I2X A;  3S17 H;  1S40 A;  4ZYS A;  1TS5 A;  3I72 A;  4DR1 Q;  1EY8 A;  1TXY A;  1VQG A;  4DV2 L;  4HCE A;  3K7A H;  4CDE C;  3PO2 G;  2CW0 C;  1VQD A;  4QUC A;  4JI1 Q;  1VMP A;  3S1R B;  3J7A 5;  2JA7 B;  1AP0 A;  2ENB A;  2Z6B A;  3QJY A;  2Y0S G;  1I6H B;  2D0P A;  1G6Z A;  2UXD Q;  4DR6 Q;  1PMR A;  4BBS B;  3PQI A;  4IPD A;  1TS3 A;  4AH6 A;  2L5T A;  3X3N A;  2WAQ B;  2KED A;  5IOD A;  1GOZ A;  1U5K A;  4JI3 L;  4ZCK A;  2B63 H;  3MZ5 A;  3SR1 A;  1KNE A;  3J7Z C;  2SEB D;  3I4O A;  1SYG A;  1PH7 A;  4A75 A;  1HHV A;  3OW7 A;  4DV5 L;  1XXG A;  4P75 A;  4B08 A;  4AQY Q;  2IWH A;  4OIJ A;  2L55 A;  1K3B C;  1L0W A;  4GKJ L;  1VQ8 A;  3MTS A;  4KI0 A;  3S2H B;  1B8A A;  2B29 A;  1PVO A;  3PF5 A;  2K32 A;  3WOE A;  3HP3 A;  2KHI A;  1HNX L;  1KQS A;  3HOY H;  4DUZ Q;  2BOS A;  4DV6 L;  2F52 A;  1HUN A;  5EBC A;  2G5D A;  2R6G A;  5JJI A;  5IYC G;  3OPO A;  2B2T A;  1CHQ D;  3GTJ H;  2E2I H;  2QCP X;  5A35 A;  2XSC A;  3BG3 A;  1JB7 A;  1DYQ A;  4CKC A;  2BA1 A;  3DWA A;  1LTL A;  2FMC A;  4ABN A;  3MXG A;  1IBL Q;  1UE1 A;  3HKZ B;  2RDF A;  3CW2 C;  3IAY A;  1C48 A;  4ZUI A;  2CH4 A;  2XTI A;  2NVQ B;  1HZB A;  3NWT A;  1TWC B;  4PMB A;  1EOT A;  5FJ8 G;  2N78 A;  2SNS A;  1W6J A;  1UE5 A;  1BCP F;  2A68 D;  1EY0 A;  3RZD H;  1XMQ Q;  3CCL A;  3AFP A;  5K36 H;  1OXV A;  5ELC A;  1U4R A;  2AUJ D;  1TS4 A;  3MVV A;  4DR5 L;  4HID A;  3VR6 A;  1ZYR C;  4R4T A;  5CYU A;  3KFU A;  4A3G G;  1X55 A;  4FF3 A;  4LF8 L;  3J7A V;  1FR3 A;  4MTK A;  1Q82 C;  3OWF A;  3F1Z A;  3TN2 A;  1KNA A;  4GZY C;  4F87 A;  1JMC A;  4KHP Q;  1F2Y A;  2EY6 A;  1Z9F A;  3JAM i;  1HR0 L;  2K75 A;  1WTR A;  5AFW A;  2WKC A;  1PFS A;  1WOC A;  3O13 A;  1HR0 Q;  5ISR A;  2ICI A;  4BBS H;  4FVM A;  2LXJ A;  2JA5 G;  3CPF A;  3KDF A;  1XNR L;  1K73 C;  1D7Q A;  1STE A;  1KIX A;  3JC6 6;  3S14 B;  1LAB A;  4X65 Q;  1N36 Q;  3H09 A;  1N33 L;  4LK1 C;  2X69 A;  3TRE A;  2VZA A;  3NUC A;  4HJ9 A;  3P20 A;  1EZ6 A;  2KHS A;  1N9W A;  5D65 A;  1G2T A;  4IAL A;  2R93 G;  1EU3 A;  1ML0 D;  2K5W A;  5IYD H;  1STB A;  3HFZ B;  3VA5 A;  4QL5 A;  5C4X G;  2FJ2 A;  4DF7 A;  2I0Q A;  1D8L A;  4DK3 C;  4YCU A;  3V96 A;  1YBY A;  1V43 A;  4C3H H;  4IUU A;  2GN5 A;  3GTP H;  2A5H A;  2F0G A;  1YIT A;  3CCQ A;  1PH8 A;  3S1N H;  4FXK C;  3K0X A;  1SNP A;  4LF6 L;  1Q81 C;  3L0O A;  5C3X A;  4BA1 I;  1R9T H;  3V2T A;  1LTB D;  2Z8L A;  2KEE A;  2K7V A;  2EZV A;  4X62 Q;  2DNE A;  2K04 A;  1F2L A;  3P7J A;  2BA0 A;  4N9P A;  2F0W A;  1RCV D;  1ENC A;  2EY5 A;  4RKB A;  1L2F A;  3GQB A;  2RCN A;  3DEP A;  2HQL A;  1STA A;  4PNY A;  3GTG B;  2EPB A;  1B7Y B;  3A8K E;  2EXZ A;  5IT9 E;  4TVA B;  3CMA A;  4TSS A;  4KTA A;  3RZD B;  4QCL A;  4BY7 H;  3S1M B;  3NE5 B;  5IYD G;  1XX8 A;  2M2L A;  5IE8 A;  5K5P A;  2BH2 A;  4DK0 A;  4OIK A;  2ZM6 L;  4R8N A;  3EA6 A;  2YU9 H;  3A56 A;  5IP7 H;  4K6L A;  4AQY L;  4YHH Q;  2AQ3 B;  2PNH A;  1QZH A;  2FXQ A;  3CCM A;  1PA6 A;  1IW7 C;  2XWJ B;  1BKB A;  4PQX A;  4LF7 Q;  2IPK D;  4A4I A;  4J6H A;  2RDH A;  2NTS A;  1H9S B;  4DR4 L;  1N34 Q;  4JI8 L;  1PYW D;  4XYO A;  1AW7 A;  1NSN S;  1TKW B;  2CQA A;  1N32 Q;  3A54 A;  4KV6 A;  2H5X A;  1N32 L;  1XYI A;  3A55 A;  4YWK A;  5C0X I;  3C2P A;  2CW0 D;  5EKI A;  3I56 A;  1EYC A;  4TQU S;  1SNC A;  4PMC A;  2CKZ B;  3BZD B;  1R4Q B;  4GKK L;  1RIP A;  3AEV A;  4UDU C;  2OT2 A;  3S2D B;  4NW2 A;  1DOL A;  3NBH A;  5M5X B;  2E2D C;  2ZT9 C;  4ODG A;  1SE2 A;  3MHB A;  4ZQ3 A;  1Q8I A;  4L8J A;  5ELD A;  3IL8 A;  4ALP A;  1Q86 C;  2R92 H;  1GUO A;  1C8C A;  1SMX A;  5IP9 G;  3GDE A;  3BVZ A;  4XQN A;  1YNJ C;  3A7L A;  1FJG L;  1E2V A;  4A3I H;  4JI6 L;  1HQR D;  5IGD A;  2UUB Q;  2E2J B;  5I9O A;  3SXH A;  4C3H G;  1VQM A;  1T9H A;  2F0L A;  5JAV A;  2QKI C;  3NSW A;  1CA6 A;  4I7Z C;  2KEN A;  2BE5 D;  3CQZ B;  5FJ8 H;  1Q1E A;  4DAV A;  3CCR A;  1IHZ A;  3EJI A;  5DM6 3;  1I50 B;  3M3Y H;  4C56 C;  1S5F D;  1TY0 A;  3J81 i;  2UU9 L;  3S2H H;  2L12 A;  3VR4 A;  3H15 A;  2IL8 A;  5A2Q L;  1XMO Q;  4QGU A;  4KK7 A;  1XMO L;  3HOY G;  1ONL A;  2CH4 W;  3K5O A;  3TP6 A;  1PFM A;  2VS1 A;  2I5M X;  1O7L A;  2KEC A;  3I4M G;  3AB9 A;  1K3R A;  3UI2 A;  1C9O A;  2AWO A;  3R2I A;  2K28 A;  1STN A;  4HAE A;  4A3D H;  1D2B A;  1CSQ A;  3HGB A;  1F2Z A;  2D9U A;  3SK4 A;  3C1E A;  1K8G A;  4IUP A;  3NBI A;  5C44 H;  3HOZ G;  2L0C A;  4R4Q A;  5M5Y B;  3KK7 A;  2EJG C;  1GM5 A;  3E5S A;  5FLX E;  2EYM A;  3E9H A;  3HOY B;  5I6Y A;  5HGT A;  1IL2 A;  5KIX A;  2P5Z X;  3LX0 A;  1A15 A;  4LFC L;  2H1E A;  3J80 i;  2RQX A;  3OYY A;  4K8I A;  1GUG A;  3STB C;  1EYD A;  3QOJ A;  3SK5 A;  4LF9 L;  2IW3 A;  2A19 A;  1STH A;  1JC7 A;  1JJC B;  1D6E C;  4LF6 Q;  4K2L A;  5FKA C;  3CRK C;  2G9D A;  3Q24 A;  1XNR Q;  1I4Q A;  5DNF A;  4GNX C;  3LGJ A;  2F0O A;  4DUY L;  2VUM G;  5LMN Q;  2WAC A;  2KCM A;  1ZXT A;  2DY7 A;  5LMU L;  1Q46 A;  1DM0 B;  1H9S A;  4C2M H;  5NUC A;  3NP8 A;  3T51 B;  4GOP B;  4A3M H;  1XPU A;  4MN3 A;  3S1Q B;  1I4P A;  2WII B;  1Z7T A;  2OCE A;  3PIO 3;  1TII D;  3PV0 A;  3DMU A;  2XN9 C;  5ELE A;  4BBS G;  3CCV A;  4BA2 I;  2Z1C A;  3AQQ A;  3I4N G;  1VS0 A;  4O1N A;  3U50 C;  2GVA A;  3ERS X;  3K59 A;  4A3K B;  4IO9 A;  1DOK A;  1FD7 D;  5FLX L;  2UUA L;  1A2U A;  1B53 A;  4IPH A;  4ZKB B;  1PV4 A;  1VQE A;  1PH4 A;  4A3E H;  5EKL A;  4A3K H;  4LFA L;  4LF7 L;  5C3W A;  3CXC A;  1HTL D;  1TVX A;  3F8T A;  4A3C H;  2PQE A;  3NQT A;  3U58 A;  1D5X C;  3PSI A;  1X3G A;  3D3R A;  4DV1 L;  3FKI H;  2B3G A;  4RHS A;  3ZYY X;  1PRT B;  3PGZ A;  4OEL B;  2IT1 A;  2PCF B;  4AYB B;  4C1N K;  1IL8 A;  2BDO A;  3S1N B;  4DPG A;  2AQ2 B;  5CV4 A;  4WJ3 M;  4KHZ A;  4POF A;  4DGZ A;  3PO3 G;  3OIQ A;  2JA9 A;  2KA7 A;  2L11 A;  5C0X G;  3H0G G;  2PMZ B;  1EQV A;  3D0F A;  4DA2 A;  2TMP A;  5D14 A;  3T16 A;  2PW7 A;  3J81 c;  2Q2T A;  4P72 A;  1IKM A;  5C6A A;  4K5X A;  4BY1 G;  1AFP A;  3K8A A;  1G2S A;  3NPP A;  4QJF A;  5EPK A;  4HN7 A;  3DM3 A;  5LL6 X;  4UAI A;  3KBX A;  4KN4 C;  4RMF A;  1CQV A;  1SNM A;  2KOL A;  2F0S A;  1VQ4 A;  1EUJ A;  4CBV A;  5CV5 A;  2E2J H;  1OXT A;  4CJ0 B;  1CTM A;  4IQZ A;  1V1P B;  4RHR A;  3JAM L;  1UNS A;  4DXF A;  1SXT A;  1I94 Q;  3UE0 A;  3CC2 A;  3FHW A;  2ZJQ A;  1GUT A;  4BY7 G;  1EQT A;  4GNX B;  2B63 G;  1JT8 A;  2VQE Q;  3KF6 A;  2K03 A;  5IGC A;  1K9M C;  1UE7 A;  3G71 A;  1KTK A;  2Q8I B;  2F4V L;  4JI6 Q;  4A3B B;  1PTO H;  4QQB X;  1Q3L A;  1HCZ A;  4JI4 Q;  4C3J H;  1MJC A;  4S3S A;  2SDF A;  2DN8 A;  2D5D A;  4GOP C;  1B3Q A;  3GP7 A;  4L6T B;  1WTV A;  2IX3 A;  3GTL H;  4QF4 A;  2EVB A;  2IX0 A;  4XQJ A;  4C2M B;  3UDX A;  3KLS A;  3H91 A;  4EGV A;  3LWE A;  1JJG A;  4IPG A;  5FO7 B;  1LT3 D;  2JA8 H;  3ICE A;  4V19 0;  3DWQ A;  2HT1 A;  3M4Y A;  5COY A;  4PMW A;  4N8F A;  2DNC A;  3AMU A;  2NB0 A;  3DUZ A;  4FO2 A;  4K6D A;  1EY5 A;  1HNW Q;  3BDC A;  5C44 B;  1E24 A;  1DCZ A;  4OO1 I;  2N55 A;  2F3W A;  5GAH C;  4EQO A;  2JP1 A;  3I4M H;  1IYV A;  3OSO A;  1SJH D;  5JPN C;  2SNM A;  2K14 A;  2I07 B;  3BS1 A;  2F3I A;  5BN5 A;  1HTP A;  5T1G A;  3R3O A;  3SK6 A;  3PO3 B;  5BN3 A;  1WTO A;  3J7Y W;  1YNJ D;  3NK9 A;  3R2T A;  4UPA A;  3WWV A;  3S16 H;  3NTK A;  3NWS A;  2NZO A;  2EYF A;  5F2D A;  1E1T A;  1VQA A;  1U0L A;  3FP9 A;  1ICW A;  2EYP A;  1LTS D;  4DUY Q;  1SE4 A;  1E3P A;  2FFK B;  4WJW A;  1ET9 A;  4P73 A;  1IBM Q;  3HOX B;  5M3M B;  3GTQ B;  3G6E A;  3OTO L;  4G7O C;  2KJX A;  4OGQ C;  2MJ8 A;  4APV A;  2E5L Q;  3I73 A;  3L3O C;  1TWF H;  4FNF A;  2Z0S A;  2IX1 A;  1CKM A;  3B6Y A;  2JSO A;  3HKS A;  3VA7 A;  4F7X A;  2HCC A;  4A3M G;  1YNX A;  5EAY A;  1I50 H;  4DK6 C;  3EN2 A;  2HIX A;  4TRD A;  1Q1B A;  4LF5 Q;  3A8I E;  1EWH A;  4A3J G;  2PZT A;  4OEM B;  4XYQ A;  1NR4 A;  2Z6K C;  2E5L L;  1NUC A;  3D4W A;  1PH3 A;  4ZKC B;  4LW1 A;  4MZ9 A;  1BO0 A;  5ELO A;  1I4X A;  1U4M A;  3STB D;  1WCM G;  3E3X A;  1HA5 A;  2QF7 A;  1JE4 A;  1CZW A;  4CKE A;  2GVB A;  2KCN A;  5C0X H;  1V1P A;  1NAP A;  4NXN Q;  1YHB A;  1Q12 A;  3CPW A;  4YWL A;  3GTO B;  4DV2 Q;  2NN6 I;  3A7A B;  4LJZ C;  4LFB Q;  4A3J B;  3ER0 A;  5IP7 G;  2UXC Q;  2JA8 G;  3VR5 A;  2KCT A;  1LTA D;  2NTT A;  3ONA B;  1AZQ A;  1ILP A;  3KLW A;  3P1H A;  3I8Z A;  2PQA B;  1BDO A;  4B3M L;  4JI8 Q;  1W3S A;  1MKH A;  3K57 A;  4OWW B;  1B1Z A;  1QOH A;  1ET6 A;  2RBM A;  5JEA H;  4KMU C;  4B3R L;  1RKN A;  1STG A;  1U4L A;  1AE2 A;  2G9H D;  3E0E A;  4HED A;  1I94 L;  2RKS A;  4IN3 A;  1IYJ B;  2OXP A;  2QDB A;  1ILQ A;  2O4X A;  4JI7 L;  3UDF A;  3HZX A;  2F3V A;  1JOR A;  4JI5 L;  1JJ2 A;  4A93 G;  5M3F B;  1OXX K;  1AN8 A;  2KUM A;  1F2M A;  3KF6 B;  4X64 Q;  5DLQ E;  1SMY C;  3M4O B;  3ULP A;  4DR2 Q;  1LM0 A;  2AQ1 B;  4ME5 A;  2WAQ E;  5M3F H;  1YIJ A;  1A3V A;  3NEM A;  1CSP A;  4M8A A;  5J39 A;  3IKJ A;  2F1M A;  1XPO A;  2VQE L;  1QB5 D;  2A6E C;  1KRT A;  3T56 B;  4L5T A;  4IUT A;  4HR7 B;  2B2W A;  5E7N A;  1I6V C;  3BYT B;  1EEI D;  1HA6 A;  4QY7 A;  1JOO A;  1E0B A;  2QIL A;  4RCO A;  5KEE A;  1PZI D;  2MPM A;  4X64 L;  4JBK A;  3VR3 A;  4UP7 A;  4CDC C;  5IOC A;  4IFD H;  1F9Q A;  1TWA B;  4GS3 A;  1PTO F;  2RDG A;  4HSP A;  1DJR D;  3FKI B;  3S17 B;  5IY0 A;  2JEA I;  2H4O A;  4X66 L;  4LFA Q;  1I3Q B;  2F0P A;  1LV9 A;  2F0U A;  2YYZ A;  1RF2 D;  2CQO A;  5C4Z A;  3MXP A;  4BWG B;  2KQ3 A;  3VYU A;  2A68 C;  1Z6H A;  2HQE A;  2R92 B;  3HOV B;  1LT5 D;  4DR7 Q;  2LKV A;  2HUG A;  2A69 D;  1PZJ D;  4KLK A;  2F0J A;  2ZTC A;  4DR7 L;  3E0J A;  2UUC L;  3PUZ A;  3HOV H;  2IHF A;  3Q6S A;  3HKZ E;  3RUZ A;  3T13 A;  5C3E H;  2WB1 E;  2HD3 A;  3HOX H;  3CC7 A;  3S24 A;  2K5N A;  1Z47 A;  4H7B A;  2EYJ A;  2R93 H;  4ULL A;  1X65 A;  2UXD L;  2UUC Q;  3JAM E;  3K5M A;  3KBG A;  2K5D A;  3U9O A;  5KND A;  4KD4 A;  1B9N A;  1VQ9 A;  4IFD I;  4IZ8 A;  4WJ4 A;  3MC0 B;  3CKI B;  3Q8D A;  1ZEQ X;  5T1I A;  1H9J A;  4HMI A;  1S5E D;  3CP0 A;  2FMM A;  4KKT A;  2O5J C;  1ESR A;  3HOX G;  3H3V C;  1NR2 A;  4RGM A;  1PRT D;  2K1B A;  5LMU Q;  1TWG H;  1Y1W G;  2A73 B;  3MEF A;  4K8J A;  1Y69 U;  1GD7 A;  1IKL A;  1VQL A;  4NB3 A;  1HNX Q;  1YNN C;  2JA8 B;  1C4Q A;  2MO1 A;  2R3Z A;  1J5E Q;  1HPC A;  1E22 A;  2Q2I A;  3K80 C;  2EE1 A;  2VQF Q;  4JI0 L;  1SND A;  2NVT B;  3GTO H;  3OMC A;  1EQQ A;  4JOI A;  1CT1 D;  2XWB B;  1LYL A;  1D5Z C;  1Y1W H;  3KYH C;  3PUX A;  1X3E A;  1B44 D;  1F9R A;  1KAA A;  2ATW A;  1EQR A;  1WCM B;  1RL2 A;  4KKS A;  1EOV A;  2XGT A;  3BZK A;  4DV3 Q;  4EQP A;  4IOA A;  3S16 B;  2E75 C;  2A6H C;  4LFB L;  1SRO A;  1NY4 A;  2K50 A;  1AH9 A;  5JJK A;  3H3V I;  4CHT B;  5A2Q E;  5ELB A;  4BBR B;  1XMQ L;  2J0T D;  2YTV A;  1SYF A;  1DXM A;  1D5M C;  3TEH B;  4A93 B;  1IXR A;  3TP7 A;  2YTX A;  1E2W A;  3GTK H;  4KHV A;  3RN2 A;  3RLN A;  3NHH A;  2L1B A;  1GUN A;  2F0T A;  4JPB W;  3G4S A;  5M3M H;  3GTQ H;  2Y0S B;  4LNQ A;  4JYA L;  4YCV A;  2K33 A;  4A3F G;  1CKN A;  4JVZ A;  2B63 B;  3D4R A;  2MUY A;  5AJ3 L;  3MWY W;  3PUY A;  2KVM A;  2R7Z H;  3JAM c;  3NEN A;  4A3E B;  1P8L A;  3LWU A;  1VMC A;  1S72 A;  2EYL A;  4X3K A;  3RLO A;  4DR3 L;  4KY6 A;  1EL0 A;  4L63 B;  3FKI G;  4DN4 M;  2B2V A;  4Q0F A;  4C3I H;  4PZ6 A;  4LF4 Q;  1UE6 A;  2RHQ B;  4GKK Q;  1T5E A;  2N49 A;  4CGY B;  2DGY A;  1RHP A;  3CRL C;  5C5M A;  1EY6 A;  1G8Z D;  1RTN A;  3DXJ C;  1KRS A;  1S4Z A;  3VYT A;  4XTC S;  5TSS A;  1DZ1 A;  1QIL A;  2RSN A;  3E9I A;  5CV9 A;  2RVL A;  4RAU C;  3G7L A;  4DNR B;  2F0Q A;  3RNU A;  1EEF D;  1WYD A;  3GO5 A;  2HDL A;  3I4M B;  4GN4 B;  1S5B D;  4Y7N H;  4BY1 B;  3IFD A;  4HIO A;  4DR1 L;  3VR2 A;  2I5H A;  1EWC A;  4R1J A;  4RA8 A;  3PIP 3;  2UXB Q;  4GLA C;  4F8M A;  2E76 C;  4RCN A;  1LUZ A;  4X62 L;  4EQN A;  4FF4 A;  2EQS A;  2L4N A;  3LNN A;  4I65 A;  1GXD C;  4A76 A;  5CC4 A;  1TWH B;  1WVL A;  3K58 A;  1KLG D;  1CQF A;  2EJM A;  2V1C C;  4GLX A;  3DLL A;  4H0L C;  4NPS A;  1EY7 A;  4QIW E;  1SR3 A;  2B8G A;  1A3T A;  4GKJ Q;  4RFB A;  3I70 A;  1IW7 D;  2YU9 B;  4OWT B;  1X3F A;  1VQ6 A;  3F2D A;  1YZ6 A;  1Y8P B;  1L1O A;  3HKZ G;  3BDO A;  3M7G A;  1JIC A;  3TME A;  3J7A F;  2WAQ G;  5CR3 A;  2F0H A;  4DNI A;  3G6J B;  4B9X A;  1TWG B;  3GV6 A;  1NTG A;  2HDM A;  4A3K G;  2VXW A;  1PH2 A;  3TS0 A;  3T1Y Q;  2A6H D;  2LSS A;  3WOF A;  3R93 A;  5IT9 c;  1KDB A;  1V1Q A;  1EYA A;  3HOU B;  2J4X A;  1MD2 D;  5ELF A;  2NVT H;  1ZYR D;  3D4D A;  4EVO A;  2KCC A;  1GHJ A;  2D62 A;  2LMC B;  4GN5 A;  1ASY A;  5FLX c;  4P71 A;  1X3Q A;  1S3O A;  3F2B A;  4YWM A;  3ITP A;  4XIG S;  3HOW B;  1PH9 A;  3PO3 H;  3T1H Q;  4AYB G;  1Y1W B;  5IGB A;  1XNQ L;  4O2D A;  2E74 C;  4YY3 Q;  2ZJR A;  1KL9 A;  1J5E L;  1SLJ A;  1I3Q H;  2Q8R E;  3KJP A;  1O7Z A;  3J81 j;  1A3U A;  2FHT A;  2RSO A;  5L37 A;  5DM7 3;  5IT9 L;  2BCO A;  2JA7 G;  3HG9 A;  2XRS D;  3I2Z A;  2LFN A;  5EKK A;  1L1O C;  4BS9 A;  3DEO A;  1FYC A;  4BBR H;  1CHP D;  3GTJ B;  4L5Q A;  4PZ7 A;  3C3L A;  3Q0A A;  3PMF A;  4HMJ A;  2C35 B;  4H13 C;  4DV0 Q;  1SSO A;  3EIV A;  4OXP A;  4CDD C;  4A3I B;  4B3M Q;  5HGQ A;  2NUC A;  1WD0 A;  5J3B A;  1I6H H;  3BVM A;  4LF8 Q;  1IBK Q;  1JWM D;  4A3E G;  3ERQ A;  1X32 A;  1YI2 A;  2OTL A;  2AUK A;  2UXC L;  2VB2 X;  2R7D A;  5IGF A;  1SE3 A;  1QVG A;  2V4D A;  2B2V C;  1N8R C;  2MHV A;  3S15 H;  1YJ9 A;  4UHV A;  1Y14 B;  3EFX D;  1WTX A;  1SYB A;  2PQA A;  5BR8 Q;  4JI7 Q;  4V0B A;  5E1F A;  3TP5 A;  3KF8 B;  4X3T A;  1HXY D;  1ESF A;  2F0I A;  4DAY B;  5LMN L;  1CFM A;  1G29 1;  2JA5 B;  4C3J B;  2WIN B;  2EYH A;  2F0E A;  5HUR A;  3U4Z A;  1Y1V B;  1PHJ A;  2QEX A;  1QVC A;  1SYC A;  1BCP D;  1RD9 D;  3N6R A;  4BXX H;  3TS2 A;  2ASB A;  1HJP A;  1JE5 A;  2EY1 A;  2KHJ A;  1BCP C;  4UY8 C;  3I3C A;  2ZJP A;  5CBE E;  1R4P B;  1VQH A;  3CME A;  3CCJ A;  4AYB E;  2JE6 I;  4RKL A;  2X6L A;  4LUZ A;  2CCZ A;  2Z9H A;  1TS2 A;  2OF1 A;  3RLF A;  1LTI D;  3GTM B;  2NN6 H;  3S9W A;  2UUA Q;  3CAM A;  3GV3 A;  1CKO A;  2QA4 A;  2HHH Q;  1Y1V G;  4UP9 A;  1VQB A;  3Q22 A;  1JWS D;  2NVQ H;  2PMZ E;  2AKW B;  2XVS A;  1JOQ A;  1KHI A;  2K6A A;  5LL6 S;  1E7Z A;  2K01 A;  3SDZ A;  1SYE A;  1I4H A;  2R7F A;  1V9P A;  1W2B A;  3TZU A;  1H9R A;  2ZM6 Q;  4DV1 Q;  3K7A B;  3CQZ H;  4DU9 A;  1CI3 M;  3MA2 B;  1K0R A;  3CHB D;  4JOI C;  3GTK B;  1Y8O B;  2NYZ D;  5IWA L;  4HSV A;  1TWF B;  2K52 A;  1XPR A;  4JI1 L;  3U9S A;  3H6M A;  1QWY A;  1JB3 A;  1E1O A;  1X56 A;  5IIF A;  3M4Q A;  4JI3 Q;  4A3M B;  1FGU A;  3FDT A;  5J1Z A;  1MJE A;  4NXM Q;  1WD1 A;  2RHS B;  3MAQ A;  1SNO A;  4MTN A;  4XXE A;  2WFW A;  2YTY A;  5IGG A;  1EY9 A;  1BNZ A;  4KY5 A;  4R8I A;  1LTT D;  3L9A X;  4IFD J;  1CUK A;  2B2Y C;  4B3S L;  2JQO A;  1J6Q A;  4DV7 L;  1A2T A;  2EDG A;  1NBW A;  4C3I B;  2A1A A;  5M5X H;  2PO4 A;  5M5Y H;  2MO0 A;  2PI2 A;  1SBB B;  3J80 E;  1BBW A;  3D6W A;  2NVX H;  4N8X 1;  3BZC A;  2VUM B;  2QEJ C;  3I55 A;  4YHH L;  4H44 C;  4DNT B;  4A3D B;  4X6A H;  2R92 G;  3BJU A;  1DOM A;  1PLF A;  2LY7 A;  4HJ7 A;  4J15 A;  1ROD A;  4I7A A;  2C5C A;  3MXU A;  4JG2 A;  3MXN B;  3URY A;  1VQN A;  4A3C G;  2F0K A;  1KXL A;  2F0M A;  2EIF A;  1B2T A;  3I4N H;  1L0Y B;  1UAP A;  1Q7Y C;  1QUQ A;  1LTG D;  4FDB A;  5FLM G;  5KNC A;  4Y7N B;  2VNU D;  1KDC A;  2Z6K A;  1LT6 D;  1I4R A;  4NP5 A;  4RGO S;  1IYU A;  1EFI D;  2DJF C;  3CD6 A;  1DD2 A;  4A3D G;  2NBF A;  4A3B H;  1PTO B;  4KD3 A;  1Y8N B;  1C7Y A;  3PO2 B;  5E4X A;  4FP5 D;  3N52 A;  1EYG A;  4EX5 A;  3SVM A;  2NVY H;  1PZK D;  3KLR A;  3PO2 H;  2WV6 D;  1JR0 D;  3KF8 A;  4LUV A;  5JVH 3;  1FNW A;  2B2Y A;  3QWN A;  4XT1 B;  4IUQ A;  1VQF A;  3G48 A;  5M3F G;  2R61 A;  1VF7 A;  5EPJ A;  1V1O A;  3J80 L;  2PPB C;  3TZD A;  1GUS A;  2JA6 G;  2B2W C;  3DM1 A;  4DV3 L;  2O5I C;  1NNX A;  2VW9 A;  2VB3 X;  4G4K A;  3RZO B;  1YVC A;  1SFO B;  2F0D A;  3ULJ A;  2JA5 H;  2EY2 A;  2OTJ A;  4R9W A;  2MP1 A;  2R7Z B;  4IPC A;  5FLM H;  3ERO A;  1MHW C;  1N36 L;  3HOZ B;  1PFN A;  4KHP L;  1K83 H;  1JCK B;  1OO9 B;  5E4W C;  4DAY A;  1SRU A;  4ME3 A;  3MFY A;  1HNZ Q;  3UDG A;  1QE6 A;  3ZJY C;  3NQI A;  1EWI A;  1UWV A;  5JJZ A;  1GVP A;  3ND8 A;  4R4C A;  2DY8 A;  2JYO A;  3A74 A;  2KBN A;  3IRB A;  5M9O A;  4LFC Q;  1C0A A;  2F0F A;  1SE8 A;  3K5N A;  1SJE D;  1STY A;  1QNU A;  2XIW A;  3SHL A;  2AMC B;  2PI2 E;  4PZ8 A;  4DUZ L;  4J8Q A;  5COR A;  1OTC A;  2HHH L;  3EQL C;  1K0S A;  3F2U A;  2AWN A;  1VDZ A;  3I90 A;  5GAE C;  2PZW A;  4DXG A;  5BR8 L;  4C3H B;  3I4L A;  3M7N A;  1O78 A;  4JI5 Q;  3D31 A;  5C3E B;  2A8V A;  4FXD A;  3L7Z C;  3PUW A;  2K4K A;  1IBL L;  1HH2 P;  2JXM B;  4BXX G;  2PYK A;  4LF9 Q;  1QCB D;  3F2C A;  1BUV T;  2FIN B;  1SN8 A;  4DR2 L;  4LF5 L;  1YNN D;  4JI2 Q;  1WTH A;  3MFG A;  1SNQ A;  1LLR D;  4JI2 L;  1TY2 A;  2I46 A;  5IWA Q;  1PH6 A;  1EY4 A;  3W5O A;  1H95 A;  2EOT A;  2QGQ A;  1K8A C;  4HCS A;  5EPL A;  1PRT C;  3D8G A;  5BN4 A;  4G57 A;  4OO1 G;  4R4I A;  1A6X A;  1Q90 A;  1X3P A;  3OWE B;  1HFN A;  3KUP A;  3BYY B;  4Q5V A;  2WP8 J;  2B39 A;  3FMC A;  4G7Z C;  3NEL A;  2CHB D;  2N8N A;  4J1M A;  1G6P A;  4C3I G;  4DR6 L;  4KY7 A;  3W3A A;  3PIP A;  5JOB A;  4A3G H;  4GN3 B;  4HJ8 A;  1VF5 C;  1VCI A;  3A0J A;  4B3S Q;  2F0V A;  1RTO A;  1U4P A;  3H3V H;  1IZ6 A;  1DGS A;  1PXU A;  2C9O A;  5KGU A;  4NXN L;  1HQM C;  1FNU A;  5JPM C;  2MGS A;  3HRZ C;  1XTC D;  3C46 A;  1O7I A;  5GAD C;  4JYA Q;  5M5W B;  3RR5 A;  4CJ1 B;  3SEB A;  5M3M G;  1CZG A;  1EIH A;  4X65 L;  2PW5 A;  1KAB A;  1EZ8 A;  3L2P A;  1O80 A;  1OXU A;  1II3 A;  2E8G A;  4IUR A;  5CBA E;  1KDA A;  1N34 L;  3ND9 A;  1UEB A;  1ENF A;  4O42 A;  2L9H A;  1WTQ A;  1A8V A;  1TU2 B;  1YJW A;  1PH5 A;  3I4N B;  5FK9 C;  3J80 c;  4HTH A;  2JK8 A;  4B9W A;  5DAU A;  4U67 3;  3MXN A;  4POG A;  3GTM H;  5GAG C;  1PTO D;  1X54 A;  2AHO B;  5D3D A;  1SEB D;  2JN4 A;  2TSS A;  1O7Y A;  1BXT A;  1XNQ Q;  5IP9 H;  4JV5 Q;  1VQ7 A;  4LF4 L;  4YY3 L;  4DR4 Q;  2IHE A;  4XT3 B;  4JC0 A;  1A62 A;  2WB1 B;  1HUM A;  4LAA A;  2WKD A;  1L0X B;  2PZU A;  3GD7 A;  1NE3 A;  3A8J E;  2ES2 A;  2NVY B;  2ZXP A;  2F4V Q;  2Q8T A;  1I5F A;  4MNO A;  4FXG C;  3S1Q H;  4ID6 A;  4Y52 H;  3S1R H;  2MNA A;  4K0K Q;  5FOB B;  4DV0 L;  4F88 A;  3TSS A;  2JEB I;  4YIJ A;  1GUW A;  1BOS A;  3TQY A;  5C4J H;  3BDL A;  1YJN A;  3RZO H;  1LT4 D;  2A69 C;  1CA5 A;  1M8A A;  2RA4 A;  3UDI A;  3S15 B;  3QR8 A;  4WFN 3;  2NN6 G;  1BCP B;  2CFM A;  5HY6 A;  4L5S A;  1QNK A;  1Q8K A;  3H94 A;  5I2Y A;  2ZTD A;  4JI4 L;  1L1O B;  5JEA J;  2Q2U A;  3R8B A;  3DWP A;  4QUF A;  1HR0 W;  2JA6 B;  3GTL B;  2CWA A;  4AIM A;  4HJA A;  2VUM H;  5IYB G;  3H0G B;  2D2C C;  4WRD A;  1BVS A;  1SAP A;  4RGT A;  1EIF A;  4DV7 Q;  1SDF A;  1D1K A;  1I4G A;  3H0G H;  1FNV A;  4A3B G;  5ELN A;  3FVQ A;  1HNW L;  4B3T Q;  4A3J H;  4KJN A;  3T4A C;  2VL6 A;  1GO3 E;  3W1G A;  1NJI C;  3RD4 A;  1M90 C;  1P16 A;  2OQ0 A;  1SMY D;  3NBH B;  4G7H C;  5G3L F;  1YEZ A;  4BY7 B;  3Q23 A;  4JBM A;  1AEX A;  2K5Q A;  4R4O A;  1QUQ B;  3HOW G;  4PV1 C;  3J81 L;  4EQ5 A;  1MIU A;  1HZ9 A;  1MBY A;  3HOU G;  5H1S E;  4IJL A;  1LAC A;  2RF4 A;  2VY3 A;  5LHY 1;  1WFQ A;  2WB1 G;  3M4P A;  3DHQ A;  4GLV B;  3J81 E;  1KLU D;  1BQQ T;  2F0N A;  2Q2H A;  5C4X H;  1FJG Q;  4DAM A;  1Y1V H;  3T53 B;  3SGI A;  2CVR A;  4CKB A;  1KC8 C;  3PF4 A;  1B70 B;  3NTI A;  1WI5 A;  2LS0 1;  2Y0S E;  3OHX C;  1WJJ A;  3X3M A;  3P75 A;  4JW0 A;  4E6I A;  4FYD A;  3QIA A;  1PFB A;  3ULL A;  4A3L G;  4HIM A;  3PUV A;  1VQ5 A;  1A0I A;  2M9V A;  1K28 A;  5KYL A;  1VQJ A;  1JQY D;  4ZUJ A;  4YCW A;  3OMG A;  5KRU A;  1UEA B;  3EVQ A;  3TBI B;  3CC4 A;  4P74 A;  3HS0 C;  5I6W A;  2NZ1 D;  2BDN A;  1VQI A;  4A3L H;  1MSG A;  4XDX A;  4OHJ A;  1VQC A;  2A6E D;  4C1N I;  1CM9 A;  4DR5 Q;  5JVG 3;  3VYS A;  5I4D A;  4OX9 Q;  3U4V A;  1VQP A;  1PYB A;  4OX9 L;  4ZRZ A;  2N88 A;  3HOV G;  2QW7 A;  1EFW A;  3OOC A;  2Z4H A;  3QO2 A;  2IJ0 A;  5JJL A;  5AJ3 Q;  2NZH A;  3C1F A;  4OL7 A;  2HIV A;  2K05 A;  3CCE A;  4DV5 Q;  2OQK A;  3BVG A;  1MI2 A;  4DKA C;  3M3Y B;  1LTR D;  1NMF A;  3I91 A;  4JBJ A;  4UP8 A;  1QVF A;  2DJG C;  1WTP A;  4JBW A;  1YHA A;  5FO8 B;  4RG1 A;  3T1Y L;  4QMG A;  5CMD A;  4GNX A;  5CGK A;  4QIW B;  1K8M A;  1RDP D;  5IYC H;  4K0K L;  1U9R A;  1AE3 A;  1HRJ A;  1HZC A;  3S14 H;  2QDL A;  2D0O A;  1V8Q A;  1EIG A;  5C4J B;  3M85 A;  4LMQ D;  3WDN A;  3A5Z B;  1BBU A;  2MFI A;  5EGT A;  4O0A A;  3GTG H;  2PNR C;  4H02 A;  1YHQ A;  4A3I G;  4DK1 A;  1JWU D;  2B2T C;  3NXW A;  3OIP A;  4N9T A;  3AFQ A;  1PH1 A;  3S1M H;  3FRP B;  4JV5 L;  2ID0 A;  2OEO A;  1SFO H;  2E2I B;  1M4V A;  2I5L X;  5CV6 A;  4HJ5 A;  2UXB L;  4X66 Q;  3TDQ A;  1JOK A;  1CKN B;  3HEJ A;  1K83 B;  1F9P A;  2K5V A;  1PTO C;  5C5L A;  1BF4 A;  5G3L D;  3QG1 A;  1J9O A;  2NWG A;  1G91 A;  4OWX B;  1X9N A;  1MGS A;  2UU9 Q;  1GKH A;  3KJO A;  1E2Z A;  2EYO A;  4ZK9 B;  3K0Y A;  3K7U C;  2LXK A;  4MHE A;  1B3A A;  2B8F A;  2F03 A;  1FGB D;  1QJO A;  1HNZ L;  2EJF C;  4C3J G;  1M1K C;  1TWC H;  3OW2 A;  4ZLT F;  4OO1 H;  2IY5 B;  5FO9 B;  1IBK L;  5I9P A;  4IOC A;  3QOL A;  3K5L A;  4P2C B;  5C0X J;  1LO5 D;  2JA7 H;  2MQH A;  3AYH B;  4X3U A;  1IBM L;  2Z4I A;  4IFD G;  4JK1 C;  2SOB A;  2ALY B;  3K81 C;  4X3S A;  1AZP A;  3K6O A;  1XWE A;  1KD1 C;  3QB3 A;  4BBR G;  4IUV A;  3TP8 A;  3M4O H;  1A63 A;  4PG3 A;  1NCV A;  5KYI A;  4KJO A;  1K8O A;  5EBD A;  1VQO A;  4M1U B;  4KKU A;  5GRO A;  4A93 H;  2ZTE A;  1KAW A;  2CWP A;  1XJV A;  4HIK A;  1VQK A;  3KDF B;  4NKL A;  3KLS X;  1T5X D;  5LMN W;  4OON A;  1F9S A;  1B4O A;  3IFT A;  2E2H H;  1GHK A;  4B3T L;  3CU7 A;  3W1B A;  5DEH A;  2YV5 A;  1OXS C;  1GJX A;  2E2H B;  3I7F A;  3BU2 A;  5EJW A;  3FPU B;  4GOP A;  2ZXR A;  4FF2 A;  4JI0 Q;  1D1I A;  3MEH A;  3W2D A;  2OWO A;  2XRQ D;  4CDF C;  4K14 A;  4DV4 L;  4DV6 Q;  3OTO Q;  4LUO A;  2VQF L;  1ASZ A;  1J8I A;  1FVI A;  5JEA G;  3CF5 A;  2NVX B;  3S2D H;  4K5V A;  4RWS C;  1DON A;  3T1H L;  3GTP B;  4RH6 A;  1FL0 A;  5E3F A;  4RGN A;  2ZXO A;  3TRZ A;  4K5W A;  4CJ2 C;  5GQO A;  2XNA C;  4XQQ A;  5C4H A;  3HOW H;  3E6Z X;  2ICE C;  4ILW A;  4LWC A;  1HZA A;  5K36 G; 
#chains in the Genus database with same CATH homology
 1BR9 A;  3D6C A;  5CV8 A;  2O2L D;  2R93 B;  4FF1 A;  4ZAI A;  2M00 A;  1W6K A;  3NTH A;  1CK1 A;  2GA4 B;  4KN7 C;  1ENA A;  5C4X B;  5EQ0 A;  1S5D D;  2A74 C;  2F4I A;  1R9T B;  4DFA A;  1F77 A;  1B50 A;  1EU4 A;  5J22 A;  1PRT F;  5KNB A;  1PDQ A;  1WTW A;  1BBX C;  4DAP A;  1UUP A;  1RJT A;  4IUN A;  1QG7 A;  3VYR A;  2X6G A;  2J7Z A;  4MIU A;  1HFG A;  4A3G B;  4WOR A;  2HCI A;  3SE0 A;  3FPP A;  5CV7 A;  3FEW X;  4TKO B;  4Z9C B;  1ZKO A;  4NMZ A;  3AU7 A;  4U68 A;  1TT2 A;  2BE5 C;  1TQO A;  4K2K A;  5D3I B;  1H9M A;  4QB4 A;  3SK8 A;  1H9K A;  2B2U A;  1SYD A;  2B2U C;  3V05 A;  1B9M A;  3RMH A;  1MSH A;  1S5C D;  4NDX A;  1TR5 A;  5IGE A;  4A3F B;  5I2X A;  4ZYS A;  1TS5 A;  3I72 A;  1EY8 A;  4HCE A;  2CW0 C;  4QUC A;  1VMP A;  3S1R B;  2JA7 B;  1AP0 A;  2ENB A;  3QJY A;  1I6H B;  1G6Z A;  1PMR A;  4BBS B;  1TS3 A;  2L5T A;  3X3N A;  2WAQ B;  2KED A;  5IOD A;  1GOZ A;  3MZ5 A;  3SR1 A;  1KNE A;  2SEB D;  1SYG A;  1HHV A;  3OW7 A;  1XXG A;  4B08 A;  2IWH A;  4OIJ A;  2L55 A;  3MTS A;  4KI0 A;  3S2H B;  2K32 A;  3WOE A;  3HP3 A;  2BOS A;  1HUN A;  5EBC A;  2R6G A;  3OPO A;  2B2T A;  1CHQ D;  2QCP X;  5A35 A;  2XSC A;  3BG3 A;  1DYQ A;  4CKC A;  2BA1 A;  3DWA A;  2FMC A;  4ABN A;  3MXG A;  3HKZ B;  2RDF A;  3IAY A;  1C48 A;  4ZUI A;  2NVQ B;  3NWT A;  1TWC B;  4PMB A;  1EOT A;  2SNS A;  1W6J A;  1BCP F;  2A68 D;  1EY0 A;  5K36 H;  1OXV A;  5ELC A;  1U4R A;  2AUJ D;  1TS4 A;  3MVV A;  3VR6 A;  1ZYR C;  5CYU A;  4FF3 A;  3J7A V;  1FR3 A;  3OWF A;  3TN2 A;  1KNA A;  4GZY C;  4F87 A;  1F2Y A;  2EY6 A;  1WTR A;  5AFW A;  2WKC A;  3O13 A;  5ISR A;  2ICI A;  4FVM A;  1STE A;  3S14 B;  1LAB A;  3H09 A;  4LK1 C;  2X69 A;  3NUC A;  3P20 A;  1EZ6 A;  2KHS A;  5D65 A;  1G2T A;  4IAL A;  1EU3 A;  1ML0 D;  2K5W A;  1STB A;  3VA5 A;  2FJ2 A;  4DF7 A;  3V96 A;  1V43 A;  4IUU A;  2A5H A;  2F0G A;  4FXK C;  1SNP A;  5C3X A;  4BA1 I;  3V2T A;  1LTB D;  2Z8L A;  2KEE A;  2K7V A;  2EZV A;  2DNE A;  2K04 A;  1F2L A;  3P7J A;  2BA0 A;  4N9P A;  2F0W A;  1RCV D;  1ENC A;  2EY5 A;  4RKB A;  3GQB A;  3DEP A;  1STA A;  4PNY A;  3GTG B;  2EPB A;  3A8K E;  2EXZ A;  5IT9 E;  4TSS A;  4KTA A;  3RZD B;  4QCL A;  3S1M B;  3NE5 B;  1XX8 A;  2M2L A;  5K5P A;  4DK0 A;  4OIK A;  4R8N A;  3EA6 A;  3A56 A;  4K6L A;  2AQ3 B;  1IW7 C;  2XWJ B;  4PQX A;  2IPK D;  4J6H A;  2RDH A;  2NTS A;  1H9S B;  1PYW D;  4XYO A;  1AW7 A;  1NSN S;  1TKW B;  2CQA A;  3A54 A;  4KV6 A;  1XYI A;  3A55 A;  5C0X I;  3C2P A;  2CW0 D;  5EKI A;  1EYC A;  4TQU S;  1SNC A;  4PMC A;  3BZD B;  1R4Q B;  4UDU C;  2OT2 A;  3S2D B;  4NW2 A;  1DOL A;  3NBH A;  5M5X B;  2E2D C;  2ZT9 C;  4ODG A;  1SE2 A;  3MHB A;  4ZQ3 A;  1Q8I A;  4L8J A;  5ELD A;  3IL8 A;  1GUO A;  1C8C A;  4XQN A;  3BVZ A;  1YNJ C;  3A7L A;  1E2V A;  1HQR D;  5IGD A;  2E2J B;  5I9O A;  3SXH A;  4C3H G;  2F0L A;  5JAV A;  2QKI C;  3NSW A;  1CA6 A;  4I7Z C;  2BE5 D;  3CQZ B;  1Q1E A;  4DAV A;  1IHZ A;  3EJI A;  5DM6 3;  1I50 B;  4C56 C;  1S5F D;  1TY0 A;  2L12 A;  3VR4 A;  2IL8 A;  5A2Q L;  4KK7 A;  1ONL A;  3K5O A;  3TP6 A;  1PFM A;  1O7L A;  2KEC A;  3AB9 A;  3UI2 A;  3R2I A;  2AWO A;  2K28 A;  1STN A;  4HAE A;  1D2B A;  1F2Z A;  3HGB A;  2D9U A;  3SK4 A;  3C1E A;  4IUP A;  3NBI A;  2L0C A;  5M5Y B;  3KK7 A;  2EJG C;  3E5S A;  5FLX E;  2EYM A;  3HOY B;  5I6Y A;  5HGT A;  5KIX A;  3LX0 A;  1A15 A;  2H1E A;  2RQX A;  4K8I A;  1GUG A;  3SK5 A;  1EYD A;  3QOJ A;  2IW3 A;  1STH A;  1JC7 A;  1D6E C;  4K2L A;  5FKA C;  3CRK C;  2G9D A;  3Q24 A;  1I4Q A;  5DNF A;  2F0O A;  2WAC A;  1ZXT A;  2DY7 A;  1DM0 B;  1H9S A;  5NUC A;  3NP8 A;  3T51 B;  4MN3 A;  3S1Q B;  1I4P A;  2WII B;  1Z7T A;  3PIO 3;  1TII D;  3PV0 A;  3DMU A;  2XN9 C;  5ELE A;  4BA2 I;  2Z1C A;  4O1N A;  3K59 A;  4A3K B;  1DOK A;  1FD7 D;  5FLX L;  1A2U A;  1B53 A;  4ZKB B;  5EKL A;  5C3W A;  1HTL D;  1TVX A;  2PQE A;  3NQT A;  1D5X C;  3D3R A;  4RHS A;  3ZYY X;  1PRT B;  2IT1 A;  2PCF B;  4AYB B;  4C1N K;  1IL8 A;  2BDO A;  3S1N B;  2AQ2 B;  5CV4 A;  4KHZ A;  4DGZ A;  3OIQ A;  2KA7 A;  2L11 A;  5C0X G;  2PMZ B;  1EQV A;  4DA2 A;  2TMP A;  5D14 A;  3T16 A;  2PW7 A;  1IKM A;  5C6A A;  4K5X A;  1AFP A;  5EPK A;  1G2S A;  3NPP A;  4HN7 A;  5LL6 X;  4UAI A;  3KBX A;  4KN4 C;  1CQV A;  1SNM A;  2KOL A;  2F0S A;  4CBV A;  5CV5 A;  1OXT A;  4CJ0 B;  1CTM A;  4IQZ A;  1V1P B;  4RHR A;  3JAM L;  1UNS A;  4DXF A;  1SXT A;  1GUT A;  1EQT A;  2K03 A;  5IGC A;  1KTK A;  2Q8I B;  4A3B B;  1PTO H;  1Q3L A;  1HCZ A;  4S3S A;  2SDF A;  2DN8 A;  2D5D A;  3GP7 A;  4L6T B;  1WTV A;  2IX3 A;  4QF4 A;  2EVB A;  2IX0 A;  4XQJ A;  4C2M B;  3KLS A;  3H91 A;  4EGV A;  3LWE A;  5FO7 B;  1LT3 D;  4V19 0;  3DWQ A;  3M4Y A;  5COY A;  4PMW A;  2DNC A;  3AMU A;  2NB0 A;  3DUZ A;  4FO2 A;  4K6D A;  1EY5 A;  3BDC A;  5C44 B;  1DCZ A;  4OO1 I;  2N55 A;  2F3W A;  4EQO A;  2JP1 A;  1IYV A;  3OSO A;  1SJH D;  5JPN C;  2SNM A;  2I07 B;  3BS1 A;  5BN5 A;  1HTP A;  5T1G A;  3R3O A;  3SK6 A;  3PO3 B;  5BN3 A;  1WTO A;  3J7Y W;  1YNJ D;  3NK9 A;  3R2T A;  3NTK A;  3NWS A;  2EYF A;  5F2D A;  1ICW A;  2EYP A;  1LTS D;  1SE4 A;  4WJW A;  2FFK B;  1ET9 A;  3HOX B;  5M3M B;  3GTQ B;  4G7O C;  2KJX A;  4OGQ C;  2MJ8 A;  3I73 A;  3L3O C;  4FNF A;  2IX1 A;  2JSO A;  3VA7 A;  4F7X A;  2HCC A;  4TRD A;  1Q1B A;  3A8I E;  1EWH A;  2PZT A;  4XYQ A;  1NR4 A;  1NUC A;  3D4W A;  4ZKC B;  1BO0 A;  1I4X A;  1U4M A;  1HA5 A;  2QF7 A;  1JE4 A;  4CKE A;  1CZW A;  2KCN A;  5C0X H;  1V1P A;  1NAP A;  1Q12 A;  3GTO B;  2NN6 I;  3A7A B;  4LJZ C;  4A3J B;  3VR5 A;  1LTA D;  2NTT A;  3ONA B;  1AZQ A;  1ILP A;  3P1H A;  3I8Z A;  1BDO A;  3K57 A;  1B1Z A;  1QOH A;  1ET6 A;  2RBM A;  5JEA H;  4KMU C;  1RKN A;  1STG A;  1U4L A;  2G9H D;  4HED A;  2RKS A;  4IN3 A;  2OXP A;  2QDB A;  1ILQ A;  2O4X A;  3HZX A;  2F3V A;  1JOR A;  5M3F B;  1OXX K;  1AN8 A;  2KUM A;  1F2M A;  1SMY C;  3M4O B;  2AQ1 B;  4ME5 A;  1A3V A;  4M8A A;  5J39 A;  3IKJ A;  2F1M A;  1QB5 D;  2A6E C;  3T56 B;  4IUT A;  4HR7 B;  2B2W A;  1I6V C;  3BYT B;  1EEI D;  1HA6 A;  1JOO A;  1E0B A;  2QIL A;  4RCO A;  5KEE A;  1PZI D;  2MPM A;  3VR3 A;  5IOC A;  4IFD H;  1F9Q A;  1TWA B;  1PTO F;  2RDG A;  4HSP A;  1DJR D;  3FKI B;  3S17 B;  2JEA I;  2H4O A;  1I3Q B;  2F0P A;  1LV9 A;  2F0U A;  2YYZ A;  1RF2 D;  5C4Z A;  3MXP A;  4BWG B;  2KQ3 A;  3VYU A;  2A68 C;  1Z6H A;  2HQE A;  2R92 B;  3HOV B;  1LT5 D;  2LKV A;  2HUG A;  2A69 D;  1PZJ D;  2F0J A;  3E0J A;  3PUZ A;  3Q6S A;  3RUZ A;  3T13 A;  1Z47 A;  4H7B A;  2EYJ A;  4ULL A;  3JAM E;  3K5M A;  3KBG A;  2K5D A;  3U9O A;  5KND A;  4KD4 A;  1B9N A;  4IFD I;  4IZ8 A;  3MC0 B;  3CKI B;  1ZEQ X;  5T1I A;  1H9J A;  4HMI A;  1S5E D;  2O5J C;  2FMM A;  4KKT A;  1ESR A;  3H3V C;  1NR2 A;  4RGM A;  1PRT D;  2K1B A;  2A73 B;  4K8J A;  1Y69 U;  1IKL A;  1YNN C;  2JA8 B;  1C4Q A;  2R3Z A;  1HPC A;  2EE1 A;  1SND A;  2NVT B;  3OMC A;  1CT1 D;  2XWB B;  1D5Z C;  3PUX A;  1B44 D;  1F9R A;  1KAA A;  1WCM B;  4KKS A;  4EQP A;  3S16 B;  2E75 C;  2A6H C;  4CHT B;  5A2Q E;  5ELB A;  4BBR B;  2J0T D;  1SYF A;  1DXM A;  1D5M C;  4A93 B;  3TP7 A;  1E2W A;  4KHV A;  3NHH A;  2L1B A;  1GUN A;  2F0T A;  2Y0S B;  2K33 A;  2B63 B;  3D4R A;  2MUY A;  3MWY W;  3PUY A;  2KVM A;  4A3E B;  3LWU A;  1VMC A;  2EYL A;  4X3K A;  4KY6 A;  1EL0 A;  4L63 B;  4DN4 M;  2B2V A;  4Q0F A;  1T5E A;  4CGY B;  1RHP A;  3CRL C;  5C5M A;  1EY6 A;  1G8Z D;  1RTN A;  3DXJ C;  1S4Z A;  3VYT A;  4XTC S;  5TSS A;  1DZ1 A;  1QIL A;  2RSN A;  5CV9 A;  2RVL A;  4RAU C;  4DNR B;  3G7L A;  2F0Q A;  1EEF D;  3GO5 A;  2HDL A;  3I4M B;  1S5B D;  4BY1 B;  3IFD A;  3VR2 A;  1EWC A;  4RA8 A;  3PIP 3;  4F8M A;  2E76 C;  4RCN A;  4EQN A;  4FF4 A;  2L4N A;  3LNN A;  4I65 A;  1GXD C;  5CC4 A;  1TWH B;  1WVL A;  3K58 A;  1KLG D;  1CQF A;  2EJM A;  4H0L C;  1EY7 A;  2B8G A;  1A3T A;  4RFB A;  3I70 A;  1IW7 D;  2YU9 B;  1Y8P B;  3BDO A;  3M7G A;  1JIC A;  3TME A;  3J7A F;  5CR3 A;  2F0H A;  3G6J B;  4B9X A;  1TWG B;  3GV6 A;  2HDM A;  2VXW A;  2A6H D;  3WOF A;  3R93 A;  1KDB A;  1EYA A;  3HOU B;  2J4X A;  1MD2 D;  5ELF A;  1ZYR D;  3D4D A;  4EVO A;  2KCC A;  1GHJ A;  2D62 A;  2LMC B;  1X3Q A;  3ITP A;  4XIG S;  3HOW B;  1Y1W B;  5IGB A;  2E74 C;  2Q8R E;  1O7Z A;  1A3U A;  2FHT A;  2RSO A;  5DM7 3;  5IT9 L;  2BCO A;  3HG9 A;  2XRS D;  2LFN A;  5EKK A;  4BS9 A;  3DEO A;  1FYC A;  1CHP D;  3GTJ B;  3C3L A;  3Q0A A;  3PMF A;  4HMJ A;  4H13 C;  1SSO A;  4A3I B;  2NUC A;  1WD0 A;  3BVM A;  1JWM D;  3ERQ A;  1X32 A;  2AUK A;  2VB2 X;  5IGF A;  1SE3 A;  2V4D A;  2B2V C;  2MHV A;  3EFX D;  1WTX A;  1SYB A;  4V0B A;  5E1F A;  3TP5 A;  4X3T A;  1HXY D;  1ESF A;  2F0I A;  1CFM A;  1G29 1;  2JA5 B;  4C3J B;  2WIN B;  2EYH A;  2F0E A;  5HUR A;  1Y1V B;  1SYC A;  1BCP D;  1RD9 D;  3N6R A;  2EY1 A;  1BCP C;  3I3C A;  5CBE E;  1R4P B;  2JE6 I;  4RKL A;  2X6L A;  3RLF A;  1TS2 A;  2OF1 A;  1LTI D;  3GTM B;  2NN6 H;  3S9W A;  3GV3 A;  3Q22 A;  1JWS D;  2XVS A;  1JOQ A;  2K6A A;  5LL6 S;  3SDZ A;  2K01 A;  1SYE A;  1I4H A;  3TZU A;  1H9R A;  3K7A B;  4DU9 A;  1CI3 M;  3MA2 B;  3CHB D;  3GTK B;  1Y8O B;  2NYZ D;  4HSV A;  1TWF B;  3U9S A;  3H6M A;  1QWY A;  1JB3 A;  5IIF A;  4A3M B;  3FDT A;  5J1Z A;  1WD1 A;  3MAQ A;  1SNO A;  4XXE A;  5IGG A;  1EY9 A;  1BNZ A;  4KY5 A;  4R8I A;  1LTT D;  3L9A X;  4IFD J;  2B2Y C;  1A2T A;  2EDG A;  4C3I B;  2PO4 A;  1SBB B;  3J80 E;  3D6W A;  2VUM B;  2QEJ C;  4H44 C;  4DNT B;  4A3D B;  1DOM A;  1PLF A;  2LY7 A;  1ROD A;  2C5C A;  3MXU A;  3URY A;  2F0K A;  2F0M A;  1B2T A;  1L0Y B;  1UAP A;  1LTG D;  5KNC A;  4Y7N B;  2VNU D;  1KDC A;  1LT6 D;  1I4R A;  4NP5 A;  4RGO S;  1IYU A;  1EFI D;  1DD2 A;  2NBF A;  1PTO B;  4KD3 A;  1Y8N B;  3PO2 B;  5E4X A;  4FP5 D;  3N52 A;  3SVM A;  1PZK D;  3KLR A;  2WV6 D;  1JR0 D;  3KF8 A;  5JVH 3;  1FNW A;  2B2Y A;  3QWN A;  4XT1 B;  4IUQ A;  2R61 A;  1VF7 A;  5EPJ A;  1V1O A;  3J80 L;  2PPB C;  3TZD A;  1GUS A;  2B2W C;  3DM1 A;  2O5I C;  2VB3 X;  4G4K A;  3RZO B;  1SFO B;  2F0D A;  2EY2 A;  4R9W A;  2MP1 A;  2R7Z B;  3HOZ B;  3ERO A;  1PFN A;  1JCK B;  1OO9 B;  5E4W C;  4DAY A;  3MFY A;  1QE6 A;  3NQI A;  5JJZ A;  3ND8 A;  2DY8 A;  2JYO A;  5M9O A;  2F0F A;  3K5N A;  1SJE D;  1STY A;  1QNU A;  2XIW A;  3SHL A;  4J8Q A;  5COR A;  3EQL C;  3F2U A;  2AWN A;  1VDZ A;  3I90 A;  2PZW A;  4DXG A;  4C3H B;  3I4L A;  3M7N A;  1O78 A;  3D31 A;  5C3E B;  4FXD A;  3L7Z C;  3PUW A;  2JXM B;  2PYK A;  1QCB D;  1BUV T;  2FIN B;  1YNN D;  3MFG A;  1SNQ A;  1LLR D;  1TY2 A;  2I46 A;  1EY4 A;  2EOT A;  4HCS A;  5EPL A;  1PRT C;  3D8G A;  5BN4 A;  4G57 A;  4OO1 G;  1A6X A;  1Q90 A;  1X3P A;  3OWE B;  1HFN A;  3KUP A;  3BYY B;  4Q5V A;  2WP8 J;  2B39 A;  3FMC A;  4G7Z C;  2CHB D;  4J1M A;  4C3I G;  4KY7 A;  3W3A A;  5JOB A;  1VF5 C;  1VCI A;  2F0V A;  1RTO A;  1U4P A;  1PXU A;  2C9O A;  5KGU A;  1HQM C;  1FNU A;  5JPM C;  2MGS A;  3HRZ C;  1XTC D;  3C46 A;  5M5W B;  4CJ1 B;  3SEB A;  1CZG A;  1EIH A;  2PW5 A;  1KAB A;  1EZ8 A;  1O80 A;  1OXU A;  1II3 A;  4IUR A;  5CBA E;  1KDA A;  3ND9 A;  1ENF A;  4O42 A;  2L9H A;  1WTQ A;  1TU2 B;  3I4N B;  5FK9 C;  4HTH A;  4B9W A;  5DAU A;  4U67 3;  3MXN A;  1PTO D;  5D3D A;  1SEB D;  2TSS A;  1O7Y A;  1BXT A;  4XT3 B;  2WB1 B;  1HUM A;  4LAA A;  2WKD A;  1L0X B;  2PZU A;  3GD7 A;  3A8J E;  2NVY B;  2ZXP A;  2Q8T A;  4FXG C;  4ID6 A;  5FOB B;  4F88 A;  3TSS A;  2JEB I;  4YIJ A;  1GUW A;  1BOS A;  3BDL A;  1LT4 D;  2A69 C;  1CA5 A;  1M8A A;  2RA4 A;  3S15 B;  4WFN 3;  2NN6 G;  1BCP B;  1QNK A;  5I2Y A;  3H94 A;  5JEA J;  3R8B A;  3DWP A;  4QUF A;  2JA6 B;  3GTL B;  3H0G B;  2D2C C;  4WRD A;  1SAP A;  4RGT A;  1SDF A;  1D1K A;  1I4G A;  1FNV A;  3FVQ A;  4KJN A;  3T4A C;  3RD4 A;  1SMY D;  4G7H C;  5G3L F;  4BY7 B;  3Q23 A;  1AEX A;  2K5Q A;  4PV1 C;  3J81 L;  1MBY A;  1LAC A;  5LHY 1;  3DHQ A;  3J81 E;  1KLU D;  1BQQ T;  2F0N A;  3T53 B;  2CVR A;  4CKB A;  3NTI A;  2LS0 1;  3OHX C;  3X3M A;  3P75 A;  4FYD A;  4E6I A;  3QIA A;  1PFB A;  3PUV A;  2M9V A;  5KYL A;  1JQY D;  4ZUJ A;  3OMG A;  5KRU A;  1UEA B;  3EVQ A;  3TBI B;  3HS0 C;  5I6W A;  2NZ1 D;  2BDN A;  1MSG A;  4XDX A;  4OHJ A;  2A6E D;  4C1N I;  1CM9 A;  5JVG 3;  3VYS A;  5I4D A;  4ZRZ A;  2N88 A;  3OOC A;  2Z4H A;  3QO2 A;  2IJ0 A;  3C1F A;  4OL7 A;  2K05 A;  3BVG A;  1MI2 A;  3M3Y B;  1LTR D;  3I91 A;  1WTP A;  4JBW A;  5FO8 B;  4QMG A;  5CMD A;  5CGK A;  4QIW B;  1RDP D;  1K8M A;  1U9R A;  1HRJ A;  1V8Q A;  1EIG A;  5C4J B;  3M85 A;  4LMQ D;  3WDN A;  5EGT A;  2PNR C;  4DK1 A;  1JWU D;  2B2T C;  3NXW A;  3OIP A;  4N9T A;  3FRP B;  2ID0 A;  2OEO A;  2E2I B;  1M4V A;  5CV6 A;  3TDQ A;  1JOK A;  3HEJ A;  1K83 B;  1F9P A;  1PTO C;  5C5L A;  1BF4 A;  5G3L D;  3QG1 A;  1J9O A;  2NWG A;  1G91 A;  1MGS A;  1E2Z A;  2EYO A;  4ZK9 B;  3K0Y A;  4MHE A;  1B3A A;  2B8F A;  2F03 A;  1FGB D;  1QJO A;  4C3J G;  2EJF C;  4ZLT F;  4OO1 H;  5FO9 B;  5I9P A;  3QOL A;  3K5L A;  4P2C B;  5C0X J;  1LO5 D;  4X3U A;  2Z4I A;  4IFD G;  2SOB A;  4JK1 C;  4X3S A;  1AZP A;  3K6O A;  1XWE A;  3QB3 A;  4IUV A;  3TP8 A;  1NCV A;  5KYI A;  4KJO A;  1K8O A;  5EBD A;  4M1U B;  4KKU A;  4NKL A;  3KLS X;  1T5X D;  1F9S A;  1B4O A;  3IFT A;  1GHK A;  3CU7 A;  5DEH A;  1OXS C;  1GJX A;  2E2H B;  5EJW A;  3FPU B;  2ZXR A;  4FF2 A;  1D1I A;  3MEH A;  3W2D A;  2XRQ D;  4K14 A;  1J8I A;  5JEA G;  2NVX B;  4K5V A;  4RWS C;  1DON A;  3GTP B;  4RH6 A;  5E3F A;  4RGN A;  2ZXO A;  4K5W A;  4CJ2 C;  2XNA C;  4XQQ A;  5C4H A;  3E6Z X;  2ICE C;  4ILW A;  5K36 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...