1JORA

Ensemble structures for unligated staphylococcal nuclease-h124l
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 25
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jorA00
1IHZA 2F3WA 3SK4A 5CV8A 5IODA 2QDBA 1SYCA 4QMGA 2F3VA 4NKLA 4R8NA 5CGKA 4KV6A 1EY6A 2EYPA 4K14A 4KD4A 4RKBA 3BDCA 2F0SA 3H6MA 5JOBA 5E1FA 5KIXA 4J1MA 4EQNA 1JORA 3OMGA 4LAAA 2F0QA 4EQOA 1F2ZA 3D4WA 4HMIA 3TP6A 5C3WA 4K6DA 3D4DA 4K2KA 2F0TA 1STGA 2F0NA 4ID6A 1EY5A 1EQVA 1KDBA 2SNMA 1KDCA 2PZTA 4WRDA 5E3FA 1JOKA 5EKKA 1EY7A 1SNMA 1STYA 1EYDA 2RKSA 1EYAA 4KD3A 2RBMA 5EKLA 1U9RA 3OMCA 5C4ZA 1EY8A 4I65A 4IALA 1F2YA 3RUZA 4ZUIA 1RKNA 5CV7A 5K5PA 5EGTA 4EVOA 3D8GA 4OL7A 4E6IA 4G57A 2SOBA 1EY4A 2SNSA 3C1EA 2PW7A 2PW5A 3EVQA 3MVVA 3OWFA 4HMJA 4F7XA 1SYDA 4DGZA 3E5SA 3QOJA 4K8IA 4ME5A 1A3VA 1EZ6A 1NUCA 1KDAA 2EY5A 1EY0A 3NK9A 4S3SA 5CV6A 3TP7A 2ENBA 5I6WA 5IIFA 1STBA 4J6HA 1SYBA 4QF4A 5IOCA 5J39A 3NUCA 2HQEA 3D6CA 4ODGA 4RKLA 5CV5A 4DFAA 5ISRA 1SNPA 1SNCA 1SNQA 3BDLA 5IGEA 2F0DA 4K2LA 1EYCA 4PMBA 5NUCA 3SK5A 5KRUA 5JAVA 3PMFA 1JOOA 4IUNA 4B9WA 2F0HA 4PNYA 1STNA 3TP8A 2F0VA 3P75A 4DU9A 3T16A 1TQOA 3DHQA 2KQ3A 2M00A 5CR3A 2F0LA 4NDXA 4YIJA 4ZUJA 5IGDA 3DMUA 3EROA 1TT2A 3P1HA 5J22A 2EY6A 3QOLA 4TRDA 4ZQ3A 4B9XA 2F0IA 3NP8A 4IZ8A 2PQEA 1A2TA 3S9WA 1A3TA 1SYFA 2F0EA 3MHBA 4K5XA 1SYGA 4K8JA 4KY6A 2F0WA 2OF1A 5IGBA 1EY9A 3SK6A 3MZ5A 5HURA 3VA5A 5KYIA 2PYKA 1AEXA 1TR5A 3SK8A 5C4HA 2WACA 4N9TA 1KABA 2NUCA 2F0FA 2LKVA 1KAAA 4QB4A 4K5VA 1STAA 4EQPA 3NHHA 4F8MA 4NP5A 1A3UA 2EXZA 4HTHA 4PMCA 5C5LA 3ERQA 5C6AA 3U9OA 4K5WA 5I9OA 2F0OA 3ITPA 3TMEA 2F0KA 2F0GA 4H7BA 2EYMA 4MIUA 1F2MA 1NSNS 2PZUA 5DEHA 3OSOA 5DAUA 2EYOA 4KTAA 2F0JA 1SNOA 5CC4A 2OXPA 5J1ZA 5CV9A 3MEHA 5I9PA 2OEOA 5F2DA 1SNDA 3SHLA 4KY7A 2EYFA 2PZWA 3LX0A 3NXWA 5KYLA 5IGGA 2F0PA 5KGUA 3HEJA 1EZ8A 4WORA 4DF7A 4KJNA 5HGTA 2EYHA 3QB3A 2RDFA 5CV4A 5M9OA 4KJOA 3SXHA 2F0UA 2KHSA 4N9PA 4NMZA 2EY1A 5KEEA 5C5MA 5C3XA 3MXPA 2F0MA 3R3OA 3T13A 1ENAA 4KY5A 5IGFA 1ENCA 3EJIA 4KHVA 3TP5A 3HZXA 5I6YA 5IGCA 1JOQA 1A2UA 1II3A 3SR1A 1SYEA 2EY2A 3C1FA 2O4XA 1STHA 3V2TA 2EYLA 3NQTA 2EYJA
chains in the Genus database with same CATH superfamily
2L0CA 2OQ0A 3NWSA 2UUCQ 3QO2A 1EIFA 1NMGA 1BXTA 4L6TB 1RHPA 3OIPA 4R8NA 4JI4Q 1YIJA 3D6WA 1SMYC 2B2YC 3A8KE 3PF4A 3PF5A 5KIXA 2L1BA 4RCNA 3J7ZC 2K04A 4DR5Q 1AW7A 1UEAB 1SFOH 4HMIA 5HY6A 4DV7Q 3S1NH 2EJGC 4OHJA 1ZYRC 5CMDA 2FINB 4C56C 3PO3H 1YNXA 3CC2A 3S1RB 1C8CA 3TS0A 3GTQB 4DV5L 2WB1B 3BDLA 4H02A 1NR2A 4PMBA 1JB7A 3HOYG 3J7AV 4RH6A 4P72A 5ELDA 4YHHQ 2PMZB 5LMNQ 4TVAB 2F0EA 5C4JH 1PRTC 1BDOA 1O7YA 1S5BD 2A5HA 1GM5A 4IUTA 2A6EC 4GS3A 4LF8Q 2VQFQ 3HOZH 2R93G 1W3SA 4OIKA 1NE3A 1BOSA 2B2WC 2Y0SE 5IYBH 2ATWA 1XNQL 3GTOB 4KHPQ 4A93B 3OW2A 3GV3A 2NTSA 3IAYA 1IBKL 2I07B 1VQPA 4GOPA 3ONAB 1IZ6A 3HOWG 1WVLA 1Q8IA 3S2HB 4DXGA 3HS0C 2O2LD 2B2VC 2OWOA 4BBRB 4IFDI 4OWWB 4KMUC 2DY7A 5C3XA 2R7ZB 2K14A 3GD7A 2AMCB 3HRZC 4LF9Q 2JA7G 2G9DA 1WCMH 2RCFA 2F0IA 5T1GA 3CAMA 3RNUA 5IODA 1KC8C 5JJKA 1EUJA 4NKLA 1J5EL 2E2IH 1FJGQ 2L4NA 1AE2A 1X6OA 5FO9B 4L5RC 4JG2A 2UUCL 1O78A 2ZTCA 3G48A 4M8AA 4UP9A 4Q5VA 1I6HH 2OCEA 1A6XA 3RLFA 4KD3A 3R93A 3U50C 4A3BH 1GO3E 3BVGA 4DR5L 4LW1A 4DV7L 1HZAA 4R4CA 1BF4A 5BN4A 3QR8A 3AU7A 2VQEQ 3CPWA 3J81L 5C44B 3PSIA 3Q6SA 5IIFA 1FL0A 3HFZB 1XMQQ 3BZDB 4DA2A 2UXCL 5J39A 3NUCA 2HQEA 1LM0A 4PZ6A 1HTPA 3W5OA 3R2TA 3K58A 1PYBA 4A3CH 1HRJA 4APVA 4MN3A 2DY8A 2WKDA 2VXWA 4FVMA 1TQOA 1IKMA 1KRSA 1Q46A 1Y1VB 1MJEA 2HUGA 1PDQA 1AH9A 3T1HQ 3H3VH 1X54A 3GTGH 3MA2B 3UDFA 4OONA 2K6AA 2A68D 4GLXA 5IT9c 2F3IA 4YHHL 2PPBC 3MZ5A 1PFMA 3HKZG 5LMNL 1BKBA 1UAPA 1AEXA 1S3OA 4GN5A 4C3JH 2RSNA 2NUCA 4IN3A 3BDOA 5IWAQ 5IYDG 1A3UA 2EXZA 5C5LA 2JEBI 2Q8TA 3QWNA 3DLLA 3CCVA 1WD0A 5I9OA 2VQFL 3H94A 2QCPX 1PLFA 4UP7A 2QDLA 1XNRL 5JPMC 1D1KA 4X65Q 4KTAA 1QZGA 5JEAH 2OTJA 2PI2A 4KHPL 3NXWA 2QF7A 4WORA 3KBXA 1N33Q 2ZJRA 1TS2A 2EOTA 5FJ8H 1G6PA 5I4DA 1VQLA 4HR7B 3I55A 2E2DC 5LL6S 1EU4A 2NBFA 4DR1Q 5KEEA 1PFNA 2EPBA 1FR3A 4DKAC 2A8VA 3BYTB 1JOQA 1EEFD 1XPOA 1II3A 1QVGA 3DXJC 4BY7B 3A5ZB 4Q0FA 4DV2Q 1XTDA 1SE8A 5CV8A 1KD1C 1HXYD 3J81E 4JBMA 2A6HC 1S72A 1EWHA 3C46A 1VQKA 2B63G 1Q1EA 4DAMA 2WAQE 3TP6A 3D4DA 3F2UA 4PG3A 3OTOQ 1FJGL 3M9BA 1KDBA 1SR3A 5LHY1 2A1AA 5C4ZA 5GQOA 3Q8DA 1F2YA 1G51A 1RKNA 4IJHA 3CC4A 1EQRA 4DK6C 4X66L 4OO1I 1JT8A 2SNSA 3EVQA 3UDXA 3HG9A 3HOYB 1KNAA 1S4ZA 5GAHC 1EZ6A 1TWHB 2NB0A 4N8X1 3SDZA 5I6WA 5C0XG 1S5DD 1CQFA 2RF4A 2VQEL 3I70A 2RVLA 3A55A 1SNQA 1SROA 2K52A 4R4TA 4MTKA 3IKJA 1Y1WG 4DR3Q 2RSOA 1CQVA 3PGZA 4JCVE 4JI3Q 2NVQH 3ND8A 3O13A 1I3QH 1HZBA 4CKBA 4MHEA 3JAMc 1I50B 3NP8A 2R93B 1CK1A 3GV6A 2MFIA 4K5XA 2UXDQ 1NTGA 1EY9A 4JI7L 3T1HL 4A3FB 2JA8G 3DM3A 2JA6G 1VQEA 4JI2Q 2F0FA 4DNRB 4A3KH 1PXUA 1Y8NB 1BNZA 5E4XA 1D8LA 4HIKA 5IWAL 4UPAA 5ELNA 4LF7L 1TS3A 4A3IB 4IUUA 2ID0A 3V96A 5KYLA 1GUSA 2EJMA 3K5MA 2XN9C 4DF7A 2XVSA 1HNZQ 3MFYA 4JOIC 3V05A 3J81j 3FKIG 2JA7B 3SXHA 3BYYB 4N9PA 5EPLA 2FHTA 1ASZA 1UWVA 2KJXA 3BS1A 4K6LA 3W3AA 1B1ZA 1B9NA 1ENCA 3CD6A 3U4VA 1X32A 5M5WH 4DR1L 3R8BA 1M90C 1KQSA 2A69C 3BDCA 1HJPA 3NEMA 2F3WA 2IT1A 1SYCA 1C0AA 1GUGA 1AFPA 3CP0A 1KIXA 4DV2L 1DOKA 1EEID 1JWUD 1Y69U 1O7LA 3Q24A 4CBVA 3K7AH 2TSSA 4LUZA 3FHWA 4C1NK 4RWSC 1KXLA 1ZXTA 1EQVA 2PZTA 3RLNA 1EY7A 4IJLA 3GTKH 1DONA 3CC7A 3PIP3 5C3EG 1EY8A 2C9OA 2XTIA 1SAPA 3KK7A 4OX9Q 5BR8Q 1B44D 4HMJA 1SYDA 2D0OA 1KL9A 2EY5A 1S5FD 4A3MH 1WTWA 5M5YH 4DFAA 3HOWH 2JYOA 1PYWD 3VA7A 2Q2UA 1P16A 3M4OH 2F4VL 3OOCA 1BCPD 1SMXA 4UDUC 3A7AB 4RHRA 2YU9B 1HH2P 2E2HB 4IOAA 2G9HD 2L5TA 3MWYW 1YI2A 3EROA 1YJNA 3M7GA 4BBSB 2C5CA 2WAQB 4JI3L 2N3SA 4OWXB 3F1ZA 4HJ5A 2O5JC 1CA6A 4HCSA 4IPGA 2IL8A 2WKCA 4IUQA 1IBLQ 3K8AA 4JI2L 1YHQA 1SE2A 1F2MA 5DEHA 2PZUA 1U4LA 1C48A 2F0JA 5ELOA 1CT1D 2OXPA 5EPJA 5H1SE 1Y8PB 3STBC 4NXNQ 1WTOA 5KGUA 2KENA 1EZ8A 3HEJA 1Q82C 1PZKD 1IBMQ 3VYSA 3CMEA 1B8AA 1J9OA 4A3BG 2VNUD 1CKMA 3K6OA 3G4SA 4ZCKA 1AN8A 1TWCB 1B4OA 2NN6I 2B63B 5FLXL 4LUOA 1S5ED 3E9HA 1UE1A 2X6GA 1QZHA 1HQMC 1SSOA 1SJED 2DUDA 4P71A 4X3SA 5CBAE 4R4IA 1XX8A 4XT3B 1HZCA 2A19A 1XWEA 4POFA 3CKIB 2HDLA 4YWKA 5DLQE 1VQCA 1R9TB 4UAIA 4WRDA 1H9MA 2WB1E 1YZ6A 1E2ZA 3LGJA 3P7JA 4BWGB 2YYZA 3HGBA 3J80E 1BCPB 3KLRA 4LUVA 5CORA 1J8IA 3J7A5 5IOCA 2AUJD 4OX9L 5BR8L 5IYCG 2PMZE 2L9HA 2DN8A 3M4PA 5KRUA 4HJ7A 1S40A 2V4DA 3I91A 1HR0W 1KTKA 4HSPA 2HDMA 1U4RA 1SN8A 2DJFC 1RTOA 1PH2A 3M4QA 1VQNA 1HUNA 1MD2D 4P74A 1ZEQX 5JEAG 4CHTB 3FEWX 3OPOA 3QOLA 5FK9C 4QQBX 3NTKA 1A2TA 3BU2A 2JA5H 5ELEA 1BO0A 2Q8IB 1K83H 1PZID 3SK6A 5FJ8G 3PO2H 2PQAA 3H0GG 2YV5A 2WV6D 4RGTA 3TQYA 3U58A 2LXKA 4XTCS 4HJAA 2Q8RE 1PH5A 1QNKA 2OT2A 3TMEA 4BS9A 1HNXQ 1CSPA 2NZOA 2IWHA 1SFOB 1C4QA 3S1NB 3JAMi 4BA2I 4GKKQ 4AYBB 1SNDA 3SHLA 1A62A 4HAEA 1D5XC 2PZWA 3HP3A 4BY1G 1QUQA 4K0KQ 4O42A 4QCLA 1U4PA 3KLSA 3PO3B 5C0XH 1YNNC 5M9OA 4NXNL 1ILQA 2KVMA 3K5NA 4LFAQ 5FKAC 4PV1C 1H9KA 2Q2TA 1ENAA 1IBML 4NW2A 5JJLA 5LMUQ 4HIMA 1Y1WH 4A4IA 2IY5B 3H6MA 1GJXA 2XSCA 2JJQA 1VMPA 2EYJA 5EPKA 4RG1A 1IHZA 3L9AX 4JBKA 4QMGA 4CJ1B 3RN2A 2ICIA 1EY6A 2MGSA 3UI2A 4K14A 3AB9A 3CCEA 1IL2A 4ALPA 3E6ZX 2QA4A 2LFNA 2LSSA 4EQOA 3S1QH 4K2KA 4XT1B 2B2TC 3MEFA 4O0AA 3I72A 1X55A 5EAYA 4ZUJA 4TKOB 5I6YA 5C4JB 4B3SQ 2JA6H 2NVTH 3UDGA 1FGBD 1TWGH 3OMCA 4ZKBB 1UE5A 2PCFB 2GA4B 3T51B 3D8GA 3HOZB 4G57A 2SOBA 2QEXA 2PW7A 4DGZA 1JR0D 3S16H 5JJIA 2MPMA 2IHEA 2VB3X 2JXMB 4L5SA 1K8MA 3NENA 4A3KG 4JI1Q 3ULJA 3HOXG 2F03A 4RMFA 2RCNA 4PZ7A 4JBWA 2N78A 2Q2IA 1CA5A 1JE4A 1STNA 3FKIH 5HGQA 2N55A 3S17H 3VYUA 5DM73 4N8FA 3T1YL 1SLJA 4X3TA 3TSSA 1A8VA 1HFNA 1HUMA 4TRDA 1QOHA 2UXCQ 3IL8A 1DGSA 1WD1A 4L5QA 1Z6HA 2FXQA 3NBHA 1V43A 5IGBA 1W2BA 2KEEA 3VA5A 1WTQA 2H4OA 1STEA 5C4HA 2KEDA 1WCMB 1TS5A 1TS4A 1B9MA 3SGIA 3GTPH 3A8JE 3TZDA 5C6AA 2F1MA 4LJZC 2Y0SG 2E2IB 2K50A 3WWVA 4LF4L 1QUQB 3FDTA 4LF6Q 1JB3A 3H3VI 4MZ9A 4MIUA 1KHIA 1TWAH 2CH4A 2EYOA 5C3EH 4QL5A 2ALYB 2VB2X 4YCVA 1I6HB 1Q81C 3J81c 1YBYA 5E4WC 1HNXL 1LTLA 3SEBA 4KY7A 2EYFA 4A3BB 1K3BC 2LS01 4KJNA 4GKKL 1PH1A 4C2MH 3TZUA 2GVBA 1LTSD 4K0KL 1PTOH 4UP8A 5ELFA 1XNRQ 5GAEC 1LO5D 2IHFA 2F0MA 1S5CD 3F2DA 5M5XH 3AYHB 2E2JH 2D5DA 2J4XA 3HZXA 4YCWA 2M2LA 2VZAA 2NVXH 3C1FA 4EQNA 4LFAL 3V2TA 1RCVD 3NQTA 3K5OA 5FLMG 1WTRA 3KYHC 5LMUL 4A3MG 1MBYA 4CJ0B 3EN2A 3WDNA 1L0XB 5EBCA 4JI6Q 2BE5D 1T5XD 1GUWA 1DM0B 3FP9A 2EVBA 3GTGB 1FNWA 4OELB 3GTMH 5LL6X 2SNMA 3RMHA 4ULLA 3AFPA 2CQAA 3PCOB 3UE0A 2NWGA 4IALA 3RUZA 4ZUIA 3D4RA 3VR4A 1JMCA 4DR7L 4B3SL 4C3JB 4A3GG 4LNQA 1NBWA 4DV0Q 1PRTD 3G71A 3SVMA 1QNUA 1DZ1A 1V1PA 4B3TQ 4NPSA 2EDGA 2HIVA 4DV1Q 3M7NA 5TSSA 2LY7A 3UDIA 1ICFB 3SK5A 3PMFA 4UHVA 3OHXC 2YTVA 3NBHB 5LMNW 4X66Q 4IUPA 4JI1L 3NBIA 3RZOH 4YIJA 3I2ZA 3M85A 3DMUA 3X3NA 4ZRZA 1WTVA 5J22A 4DR2Q 2EY6A 2ICEC 4PQXA 3N52A 3KF8A 3I3CA 2ZJPA 5C4XG 1OTCA 2FFKB 1GHJA 2A68C 2KCMA 4L8JA 1SYFA 2PI2E 5COYA 4X6AH 2V1CC 2E8GA 1WOCA 2B2VA 4I7ZC 2KHJA 4DK0A 1WI5A 4A3DH 2B8GA 3HKSA 1STAA 1LABA 4RA8A 2MQHA 3CMAA 3QIAA 2RQXA 4OEMB 4R4OA 1N32Q 2D62A 1G91A 4B3RQ 1GUNA 5JVH3 5DAUA 3DUZA 4JI7Q 4LF6L 1B3QA 2D2CC 2K05A 4OGQC 3VR2A 2WIIB 2XIWA 1GXDC 3K59A 2EY1A 5IYCH 1I4RA 2K5QA 4LF7Q 2DNEA 1DYQA 1LTGD 3EA6A 5IGFA 3IRBA 1QVCA 4GOPB 1PA6A 1JWMD 1LTBD 1OXTA 2N88A 3TRZA 1FNVA 1RD9D 1ET6A 3NSWA 2K33A 1F9SA 3HOUH 2NVQB 3A54A 1EYGA 3W1GA 1I3QB 2BH8A 2K1BA 3DWPA 4LAAA 2R3ZA 2KOLA 4JYAQ 5C3WA 2L15A 4MTNA 4A75A 3H0GH 1PRTB 5E7NA 4JI6L 5T1IA 2RBMA 2K01A 4OWTB 1V1PB 3M4YA 4U673 3LNNA 5EGTA 4XIGS 3N6RA 2RHSB 4A3KB 2JA5G 3ICEA 4F7XA 1GUOA 1CSQA 2KCNA 1M8AA 1BCPF 3QOJA 1A3VA 3MAQA 1EY0A 3PO2G 1TVXA 2K5WA 4QF4A 2AHOB 2R7DA 1Q12A 3I4MG 4BY1H 4DV0L 2NTTA 1EYCA 2JP1A 3KF8B 2GN5A 4IUNA 4ZYSA 3L2PA 4B9WA 2K75A 4PNYA 4B3TL 1I4GA 4DV1L 1GVPA 3KBGA 1Z47A 4QIWB 3A0JA 2K5VA 2SDFA 1L0YB 3P1HA 5FOBB 2AWNA 4FXDA 3E9IA 3HOVG 2JN4A 4IZ8A 3S9WA 1UEBA 1O7ZA 1D7QA 2GVAA 5BN5A 5C0XJ 4DR2L 2ES2A 3TS2A 2F4VQ 5M5WB 2VL6A 2WACA 5A2QL 2B2UC 4P73A 3S2DH 2CWAA 2RA4A 1BVSA 1RDPD 1E2VA 1UE7A 4XQJA 4XYOA 1QCBD 1VQHA 1AZQA 1P8LA 3SE0A 3K7AB 4QJFA 1N32L 3BVZA 5IT9L 4B3RL 1M4VA 1ENFA 2DJGC 4H44C 3GTKB 4HIOA 4ZK9B 1I4QA 3H09A 3VR3A 1I4XA 3AEVA 1QE6A 4C3HH 3QB3A 3CF5A 2MNAA 5CV4A 1XPRA 1CM9A 4NMZA 5FO7B 2F52A 3HOXH 4KN4C 4A3MB 1TWFH 5M5YB 3E0EA 2AQ2B 2NN6G 2I5HA 4XQQA 4B3MQ 2AQ3B 3S14H 3HOWB 3GO5A 2O4XA 4NXMQ 1RJTA 1XPUA 1SXTA 3M4OB 4RCOA 4RKBA 4IO9A 2QILA 5JOBA 2DGYA 4J1MA 4C3IH 1MJCA 4K6DA 1EIYB 1LTRD 2HCCA 4P2CB 5E3FA 1JOKA 2N8NA 4JYAL 5M3MG 4ZLTF 2FJ2A 2R7FA 1XXGA 2BDOA 4A3JH 3PIPA 1NUCA 1G8ZD 3NELA 3I4NG 1TU2B 2K32A 3PV0A 1YNJC 2IJ0A 4DR4L 4K2LA 5A2QE 4LFCL 1BCPC 1JOOA 1LUZA 2F0HA 3KLWA 2JEAI 1A63A 3P75A 2G5DA 1NR4A 2ZTDA 4CGYB 1IW7C 2L11A 4PZ8A 3W1BA 5FLXc 3I8ZA 5KNDA 4LFBL 5FLMH 4L63B 3ZYYX 5AFWA 1SEBD 4K8JA 1FGUA 1HQRD 2F0WA 4KI0A 5IT9E 4PMWA 4CDFC 1X3QA 1TR5A 1A0IA 3K0YA 1M1KC 4POGA 2VUMH 1KABA 2IPKD 4AYBE 3PUVA 3CQZH 3H15A 5IP9G 4K5WA 1EQTA 2JK8A 3HKZB 3J80L 2KHIA 4GNXC 1EQQA 1WJJA 4OO1H 2BA0A 2R61A 1VMCA 4A3EH 1GKHA 4A3GH 3LX0A 5IGGA 3ND9A 3A74A 1KRTA 3U4ZA 4FF1A 3U9SA 1HTLD 3BZKA 2EYHA 2BCOA 1VQBA 2KHSA 1PZJD 3E0JA 4DK3C 2KBNA 1XYIA 4RGOS 1UNSA 4HCEA 4B3ML 4FF3A 1D6EC 5CYUA 5C4XH 4NXML 5C0XI 2F0SA 1WTHA 3OMGA 1EFID 1PVOA 1TXYA 1L1OC 3CHBD 1BR9A 2F0NA 2JA5B 4G7HC 2WB1G 5D3DA 1VQ7A 1K83B 1JJCB 4ZKCB 4JW0A 1X3FA 3PO2B 1V1OA 4I65A 5CV7A 3MTSA 1GHKA 4OL7A 4LMQD 3FPPA 4ME5A 3NK9A 4S3SA 4Y7NH 1FNUA 1TKWB 1Z9FA 2QW7A 4I7AA 4IPCA 3WOFA 4A3DG 2XWBB 3MFGA 3VR5A 1F9PA 3FMCA 4X62Q 5JAVA 3W2DA 1OXXK 4DV3Q 1X9NA 3KJPA 3DEPA 4UY8C 1G2TA 1CKOA 1LTTD 2M00A 3RD4A 5FO8B 1AE3A 3WOEA 3MXNA 2R6GA 4ZQ3A 3JAME 2PQEA 4R1JA 2IX3A 1LT5D 2NVYH 1Y8OB 4A76A 4A93G 4KKTA 4XYQA 1Y1WB 3I56A 2BA1A 1MSHA 4LF5Q 3CCLA 2BDNA 2X69A 2XGTA 3T1YQ 3GP7A 4XDXA 4EQPA 1EOTA 1PTOD 1KAWA 1VQ5A 3U9OA 3OSOA 5JEAJ 1HFGA 3NTHA 3S1QB 5ELCA 4H0LC 3RN5A 2JA8B 4CDCC 3CCSA 2R7ZG 1GD7A 2JA6B 2R92H 1HCZA 2CVRA 3HOUG 1V8QA 1TWGB 1SJHD 5GROA 1LYLA 2J7ZA 2XRSD 1VQ4A 4RGNA 3L3OC 3BZCA 4LF4Q 1CZGA 3Q23A 5ELBA 3I4MH 1I94L 3A5UA 1T5EA 3S1MH 3S16B 4IURA 3TREA 4DAPA 3M3YH 4JK1C 3DEOA 1EWIA 3NPPA 2Z4IA 1STHA 2KCCA 3C1EA 1K0SA 3TP7A 1A15A 2Z8LA 1TIID 1VF7A 2Z1CA 2L12A 3GDEA 3FKIB 1K8AC 4KV6A 3HOVH 3S17B 3PUXA 1VQ8A 1LT3D 5C44G 4R8IA 1K73C 3VYTA 5IP7G 4IFDG 2F0TA 1PRTF 1STYA 2Z6KA 1EYAA 3OW7A 1DD2A 3E3XA 2EZVA 5G3LD 3VYRA 3H91A 3LWEA 4DUYQ 4DV4Q 1EL0A 1EY4A 1VQGA 2XWJB 3H3VC 3GTPB 3MVVA 3EQLC 4Y52H 1LT6D 1EOVA 2K4KA 4F87A 1PH4A 5DM63 1STBA 4YWMA 1ICWA 3CCMA 1TWAB 5C3EB 1E7ZA 5K36H 2B29A 3FVQA 1K9MC 4FO2A 4DR7Q 1BBXC 1DOLA 3T16A 1YJWA 4LWCA 2KQ3A 4X62L 4NDXA 3FPUB 5EQ0A 4BXXH 1ZKOA 4C2MB 3GTJH 2NN6H 1GOZA 4DV3L 4WJ4A 1PTOB 3MC0B 2UXBL 1B50A 4ZAIA 5M5XB 3BG3A 2E2JB 1EIHA 1RL2A 4C3HG 5L37A 5KYIA 5IE8A 2NVXB 2KUMA 4X64Q 1AZPA 1YNND 1ILPA 1K8OA 2E74C 4YY3Q 3FRPB 2K7VA 5EKIA 4F8MA 1CTMA 4PMCA 1RF2D 1LTAD 2CW0D 4HIDA 1OXUA 4LF5L 2F0OA 3EBEA 3ITPA 4GN4B 4H7BA 1B7YB 2AUKA 3CRLC 1E22A 2MO0A 2PQAB 1SNOA 1TY0A 3GTMB 1R4PB 2WFWA 3MEHA 5M3MH 2OEOA 5F2DA 4DAVA 1OXVA 1JWSD 4WJ3M 3RZDH 1YJ9A 4C3IG 4BY7G 1F9RA 3I4NH 4FXGC 4KJOA 2B2TA 2F0UA 2E5LQ 5M3FH 5JJZA 2XRQD 1EU3A 3S15H 3TP5A 3EJIA 4KHVA 2J0TD 1I6VC 3SR1A 1IYJB 5CC4A 2IX0A 4A3JG 5A35A 4QGUA 1SBBB 2CCZA 2CFMA 4FF2A 2B2YA 1E0BA 4KD4A 3CCRA 4GOPC 2BE5C 4FF4A 1SMYD 3RZOB 2NYZD 2IX1A 4TQUS 3NQIA 1STGA 4CKCA 3CU7A 1ZYRD 2RKSA 2CWPA 4V190 5IP9H 3GTLH 4A3DB 4EVOA 3J7YW 4XXEA 2PW5A 2ZXRA 5D14A 2HIXA 2O5IC 4DV4L 4DUYL 2ENBA 1G6ZA 3UE1A 3EIVA 2VUMG 1EFWA 5ISRA 4QIWE 2N49A 1ESRA 2F0DA 2QKIC 3Q0AA 4G7OC 2F0VA 1NNXA 2H1EA 4A3FG 4DNIA 1VCIA 3CW2C 2I46A 4OO1G 3CCJA 4A3EG 3D0FA 4B9XA 2YTYA 5KNCA 1PH6A 1JJ2A 4KY6A 5HURA 1XMOL 4KN7C 4A3IG 2A6ED 1NMFA 3I73A 4N9TA 1JCKB 4X3KA 3P20A 1F9QA 2EIFA 2LKVA 4GLVB 2B2WA 4HJ8A 2QEJC 4NP5A 1UUPA 3S1RH 1VQJA 3NTIA 1F77A 3HOUB 4X64L 1N34L 3GTQH 4YWLA 3T53B 5I2YA 4YY3L 1LT4D 1DJRD 5JVG3 3Q22A 3H0GB 5J1ZA 2HD3A 1BUVT 1DCZA 4LK1C 4IQZA 2K03A 1B2TA 1HZ9A 1AP0A 4CDDC 4IUVA 4JI4L 1ESFA 1LACA 3MXPA 1CHPD 2D0PA 4KY5A 2UUAQ 4HSVA 4GLAC 1C7YA 2E5LL 4BY1B 4V0BA 5EJWA 3C2PA 1SYEA 2EY2A 2AWOA 4AH6A 4DR6Q 2EXDA 1SDFA 4O2DA 3A8IE 2CQOA 1E24A 5AJ3Q 5E1FA 1VDZA 3GTOH 4A93H 1JJGA 2HT1A 1CI3M 3BJUA 4ID6A 4GKJQ 1GUTA 2Q2HA 3L0OA 3QJYA 3OWEB 4AQYQ 3PUZA 3S2HH 2DNCA 4YCUA 1JICA 4CJ2C 3QG1A 4EQ5A 4R9WA 2ZT9C 3F2BA 4FP5D 3S2DB 1KLGD 1H95A 4BBRH 3E5SA 4K8IA 1WFQA 2CKZB 2R7ZH 2OQKA 4ODGA 5CV5A 1YITA 3TN2A 4BBSG 1N8RC 2WAQG 1G291 1PFBA 5IGEA 4J8QA 1X3PA 4JI8Q 5J3BA 4LF8L 1L0WA 4H13C 3VR6A 4QUCA 4HEDA 1E1TA 2F0LA 2WINB 2X6LA 4C3HB 2CHBD 4HN7A 1O80A 3JC66 2R92G 1E2WA 1V9PA 1W6KA 1V1QA 1A3TA 3PIOA 3HOXB 2EE1A 4DR4Q 4ME3A 3I4LA 1SYGA 1X65A 3TBIB 1TWFB 2MHVA 2RHQB 5GAGC 4LFCQ 3S14B 1N36Q 2PYKA 3I4OA 2QGQA 2VS1A 3HKZE 3CPFA 1KNEA 2P5ZX 1MKHA 2NZ1D 5C44H 4HTHA 3ERQA 5IP7H 4IFDH 1H9JA 4AIMA 4CKEA 2F0GA 3PIO3 1ET9A 4LFBQ 1NSNS 1UE6A 4C3IB 3A7LA 3F2CA 4C1NI 1K3RA 1D2BA 2BOSA 4BA1I 3KFUA 4LF9L 2AQ1B 1Q1BA 3KOJA 1MI2A 2Y0SB 1Y1VH 4QUFA 3AFQA 1ONLA 3IFTA 1SRUA 2EQSA 1Q8KA 4KK7A 4A3JB 1RODA 3RLOA 1VQOA 2B8FA 3K81C 1QWYA 3CXCA 1A2UA 2VW9A 1HPCA 1PV4A 3R2IA 4J6HA 1PYSB 4A3LH 4JV5Q 2UUAL 1Z7TA 2JSOA 1HA5A 5JPNC 1KLUD 2LXJA 1LV9A 1LLRD 1CFMA 2A6HD 1SE3A 3K5LA 5K36G 4WFN3 4DR6L 2F0QA 1X3EA 1XMQL 1XTCD 4J15A 2HQLA 1EY5A 5AJ3L 4DK1A 4WJWA 3CRKC 1U9RA 1BBWA 4KKSA 4BXXG 4O1NA 2VUMB 1QB5D 4E6IA 2A74C 3J80c 1H9RA 3D3RA 4JI0Q 4GKJL 4KLKA 4QY7A 4AQYL 1I4HA 3CQZB 1IYVA 1NCVA 4IPHA 3J81i 5CV6A 3AMUA 1BBUA 2K5HA 1PH9A 2B3GA 2ASBA 3D6CA 2B2UA 1SNCA 4ABNA 4BY7H 4FXKC 2ZJQA 4NB3A 1NJIC 4A3EB 1VF5C 1HA6A 1B3AA 4A3GB 1PMRA 3CCUA 4DU9A 1IKLA 1VQAA 5IGDA 5CR3A 4JI8L 1IXRA 3URYA 1JQYD 1O7IA 5EBDA 5CBEE 1PTOF 1B70B 4CDEC 1VS0A 4X65L 3ERSX 1X56A 1SE4A 4JBJA 5D3IB 2ZXOA 1K28A 2KECA 5M3FG 4AYBG 4JVZA 4GN3B 1MSGA 4QB4A 4B08A 2RDGA 3HOYH 2YTXA 1N33L 2PNRC 1N36L 1TWHH 5C4XB 3PO3G 1YEZA 1MHWC 2E76C 3X3MA 3KLSX 1JE5A 2JA9A 1QILA 3KF6A 3NWTA 5D65A 4KHZA 2JE6I 4IOCA 1Y14B 1K0RA 4JOIA 2UUBQ 2I5MX 4M1UB 1I50H 2R93H 1VQIA 1YHAA 2K5DA 2PO4A 3KDFA 3R3OA 4Y7NB 3T13A 1Q86C 1RTNA 4F88A 4DAYA 2FMCA 5IGCA 2BH2A 3OTOL 5DNFA 1FYCA 4A3FH 2EYLA 1D5ZC 2MP1A 3JAML 2A69D 1J6QA 5KNBA 3TDQA 1K8GA 2QDBA 2F3VA 1CKNA 2KCTA 5CGKA 2EYPA 1BQQT 2NZHA 5G3LF 1I94Q 2OTLA 4JI5Q 3HOZG 4JV5L 3ZJYC 1YNJD 1JORA 4DUZQ 3D4WA 2HHHQ 4A3IH 3L7ZC 1VQ9A 5IYBG 2NVYB 1T9HA 1KDCA 5EKLA 1EYDA 4DNTB 1IW7D 1PH7A 2A73B 4DR3L 2JA7H 3OWFA 1TY2A 2K5NA 1EWCA 1ML0D 4P75A 2ZM6Q 3G6JB 1SYBA 3NE5B 4JI0L 1SNPA 4MNOA 2UXDL 4RAUC 2R92B 3ULLA 3TP8A 2H5XA 3T4AC 1PH3A 2VY3A 1F2LA 1CUKA 1WCMG 2F4IA 2KA7A 1U0LA 4GNXA 2JQOA 1HR0Q 1HNWQ 1X3GA 1H9SA 3KJOA 1HHVA 2MJ8A 4L5TA 3I4MB 4IPDA 3OIQA 2B39A 3S1MB 3M3YB 3MHBA 3CCQA 3S24A 2CH4W 1NAPA 2OF1A 3T56B 1Q7YC 1Q3LA 3SK8A 2HCIA 1CZWA 1QJOA 3GQBA 2ZTEA 4DPGA 2K28A 1KAAA 4HJ9A 1PTOC 4OXPA 3KF6B 5BN3A 3J7AF 3RR5A 1HNZL 3HOVB 1LTID 4FYDA 2F0KA 1MGSA 4DV6Q 1MIUA 4OIJA 2UXBQ 4RGMA 5CV9A 3IFDA 5I9PA 4DN4M 2Z4HA 1L2FA 3STBD 3ULPA 3KDFB 1XJVA 4A3CG 2YU9H 3I90A 5GADC 2E2HH 4DAYB 1L1OA 3G6EA 2RDFA 2UU9Q 1CHQD 4BBSH 4JC0A 2UUBL 5I2XA 1CKNB 2LMCB 5IYDH 2I0QA 2TMPA 3G7LA 2IW3A 3MXGA 4BBRG 2FMMA 1VQDA 1ASYA 2ZXPA 3F8TA 3BVMA 3SK4A 2NVTB 2D9UA 1QG7A 4G7ZC 4C3JG 3OYYA 4EGVA 1R4QB 3GTJB 3ER0A 1F2ZA 1IL8A 4TSSA 1QVFA 3PQIA 4FNFA 5EKKA 4JPBW 4JI5L 1SNMA 3DWQA 1YHBA 5IY0A 4G4KA 1DXMA 2Z6KC 1NY4A 3K80C 4DUZL 2HHHL 3VDYA 2PNHA 1PFSA 1W6JA 5K5PA 1EIGA 2E75C 4RFBA 3K0XA 4DV5Q 1OXSC 3TEHB 4DXFA 1VQFA 4Z9CB 2C35B 1KDAA 4RHSA 1VQ6A 3EFXD 4X3UA 1U5KA 4U68A 2Z9HA 4RKLA 3K57A 1JC7A 1G2SA 1TWCH 4GNXB 4EX5A 2B63H 3PUYA 1H9SB 2ZM6L 5NUCA 4IFDJ 5M3MB 3DM1A 3KUPA 2MO1A 1PH8A 2I5LX 1PHJA 3RZDB 2Z6BA 3DHQA 1B53A 1WTPA 2MUYA 3I4NB 3A56A 1IBLL 1TT2A 5FLXE 2XNAC 3J80i 5M3FB 2M9VA 1R9TH 3C3LA 1U4MA 4ILWA 2SEBD 1HR0L 3S15B 1HNWL 1N9WA 1OO9B 1RIPA 1Y1VG 2Z0SA 4R4QA 3D31A 4GZYC 1IYUA 1WYDA 3DWAA 3I7FA 2RDHA 1XNQQ 4KKUA 3PUWA 1C9OA 4K5VA 3K7UC 3MXNB 3NHHA 2CW0C 4XQNA 2L55A 1IBKQ 3MXUA 2EJFC 1Q90A 1FVIA 2EYMA 1D1IA 1VQMA 4A3LG 1E1OA 3B6YA 1L1OB 1DOMA 1E3PA 1XMOQ 4FDBA 4DV6L 2F0PA 3AQQA 3LWUA 1I4PA 1WTXA 5HGTA 3GTLB 1N34Q 2JA8H 1I5FA 1YVCA 5C5MA 1D5MC 2WP8J 2AKWB 2UU9L 1FD7D 1J5EQ
chains in the Genus database with same CATH topology
2L0CA 3NWSA 3QO2A 4R8NA 1BXTA 4L6TB 1RHPA 3OIPA 3D6WA 1SMYC 2B2YC 3A8KE 5KIXA 2L1BA 4RCNA 2K04A 1AW7A 1UEAB 4HMIA 2EJGC 4OHJA 1ZYRC 5CMDA 2FINB 4C56C 3S1RB 1C8CA 3GTQB 2WB1B 3BDLA 1NR2A 4PMBA 3J7AV 4RH6A 5ELDA 2PMZB 2F0EA 1PRTC 1BDOA 1O7YA 1S5BD 2A5HA 4IUTA 2A6EC 4OIKA 1BOSA 2B2WC 3GTOB 4A93B 3GV3A 2NTSA 3IAYA 2I07B 3ONAB 1WVLA 1Q8IA 3S2HB 4DXGA 3HS0C 2O2LD 2B2VC 4BBRB 4IFDI 4KMUC 2DY7A 5C3XA 2R7ZB 3GD7A 3HRZC 2G9DA 2F0IA 5T1GA 5IODA 4NKLA 2L4NA 5FO9B 1O78A 4M8AA 4Q5VA 1A6XA 3RLFA 4KD3A 3R93A 3BVGA 1BF4A 5BN4A 3AU7A 3J81L 5C44B 3Q6SA 5IIFA 3BZDB 4DA2A 5J39A 3NUCA 2HQEA 1HTPA 3R2TA 3K58A 1HRJA 4MN3A 2DY8A 2WKDA 2VXWA 4FVMA 1TQOA 1IKMA 1Y1VB 2HUGA 1PDQA 3MA2B 2K6AA 2A68D 2PPBC 3MZ5A 1PFMA 1UAPA 1AEXA 2RSNA 2NUCA 4IN3A 3BDOA 1A3UA 2EXZA 5C5LA 2JEBI 2Q8TA 3QWNA 1WD0A 5I9OA 3H94A 2QCPX 1PLFA 5JPMC 1D1KA 4KTAA 5JEAH 3NXWA 2QF7A 4WORA 3KBXA 1TS2A 2EOTA 5I4DA 4HR7B 2E2DC 5LL6S 1EU4A 2NBFA 5KEEA 1PFNA 2EPBA 1FR3A 3BYTB 1JOQA 1EEFD 1II3A 3DXJC 4BY7B 4Q0FA 5CV8A 1HXYD 3J81E 2A6HC 3C46A 1EWHA 1Q1EA 3TP6A 3D4DA 3F2UA 1KDBA 5LHY1 5C4ZA 1F2YA 1RKNA 4OO1I 2SNSA 3EVQA 3HG9A 3HOYB 1KNAA 1S4ZA 1EZ6A 1TWHB 2NB0A 3SDZA 5I6WA 5C0XG 1S5DD 1CQFA 3I70A 2RVLA 3A55A 1SNQA 3IKJA 2RSOA 1CQVA 3ND8A 3O13A 4CKBA 4MHEA 1I50B 3NP8A 2R93B 1CK1A 3GV6A 4K5XA 1EY9A 4A3FB 2F0FA 4DNRB 1PXUA 1Y8NB 1BNZA 5E4XA 1TS3A 4A3IB 4IUUA 2ID0A 3V96A 5KYLA 1GUSA 2EJMA 3K5MA 2XN9C 4DF7A 2XVSA 3MFYA 3V05A 2JA7B 3SXHA 3BYYB 4N9PA 5EPLA 2FHTA 2KJXA 3BS1A 4K6LA 3W3AA 1B1ZA 1B9NA 1ENCA 1X32A 3R8BA 2A69C 3BDCA 2F3WA 2IT1A 1SYCA 1GUGA 1AFPA 1DOKA 1EEID 1JWUD 1Y69U 1O7LA 3Q24A 4CBVA 2TSSA 4C1NK 4RWSC 1ZXTA 1EQVA 2PZTA 1EY7A 1DONA 3PIP3 1EY8A 2C9OA 1SAPA 3KK7A 1B44D 4HMJA 1SYDA 2EY5A 1S5FD 1WTWA 4DFAA 2JYOA 1PYWD 3VA7A 3OOCA 1BCPD 4UDUC 3A7AB 4RHRA 2YU9B 2E2HB 2G9HD 2L5TA 3MWYW 3EROA 3M7GA 4BBSB 2C5CA 2WAQB 2O5JC 1CA6A 4HCSA 2IL8A 2WKCA 4IUQA 1SE2A 1F2MA 5DEHA 2PZUA 1U4LA 1C48A 2F0JA 1CT1D 2OXPA 5EPJA 1Y8PB 1WTOA 5KGUA 3HEJA 1EZ8A 1PZKD 3VYSA 1J9OA 2VNUD 3K6OA 1AN8A 1TWCB 1B4OA 2NN6I 2B63B 5FLXL 1S5ED 2X6GA 1HQMC 1SSOA 1SJED 4X3SA 5CBAE 1XX8A 4XT3B 1XWEA 3CKIB 2HDLA 1R9TB 4UAIA 4WRDA 1H9MA 1E2ZA 3P7JA 4BWGB 2YYZA 3HGBA 3J80E 1BCPB 3KLRA 5CORA 1J8IA 5IOCA 2AUJD 2L9HA 2DN8A 5KRUA 2V4DA 3I91A 1KTKA 4HSPA 2HDMA 1U4RA 1RTOA 1HUNA 1MD2D 1ZEQX 5JEAG 4CHTB 3FEWX 3OPOA 3QOLA 5FK9C 3NTKA 1A2TA 5ELEA 1BO0A 2Q8IB 1PZID 3SK6A 2WV6D 4RGTA 4XTCS 2Q8RE 1QNKA 2OT2A 3TMEA 4BS9A 2IWHA 1SFOB 1C4QA 3S1NB 4BA2I 4AYBB 1SNDA 3SHLA 4HAEA 1D5XC 2PZWA 3HP3A 4O42A 4QCLA 1U4PA 3KLSA 3PO3B 5C0XH 1YNNC 5M9OA 1ILQA 2KVMA 3K5NA 5FKAC 4PV1C 1H9KA 1ENAA 4NW2A 3H6MA 1GJXA 2XSCA 1VMPA 2EYJA 5EPKA 1IHZA 3L9AX 4QMGA 4CJ1B 2ICIA 1EY6A 2MGSA 3UI2A 4K14A 3AB9A 3E6ZX 2LFNA 4EQOA 4K2KA 4XT1B 2B2TC 5I6YA 3I72A 4ZUJA 5C4JB 4TKOB 1FGBD 3OMCA 4ZKBB 2PCFB 2GA4B 3T51B 3D8GA 3HOZB 4G57A 2SOBA 2PW7A 4DGZA 1JR0D 2MPMA 2VB3X 2JXMB 1K8MA 2F03A 4JBWA 1CA5A 1JE4A 1STNA 2N55A 3VYUA 5DM73 4X3TA 3TSSA 1HFNA 1HUMA 4TRDA 1QOHA 3IL8A 1WD1A 1Z6HA 3NBHA 1V43A 5IGBA 2KEEA 3VA5A 1WTQA 2H4OA 1STEA 5C4HA 2KEDA 1WCMB 1TS5A 1TS4A 1B9MA 3A8JE 3TZDA 5C6AA 2F1MA 4LJZC 2E2IB 3FDTA 1JB3A 4MIUA 2EYOA 2VB2X 1I6HB 5E4WC 3SEBA 4KY7A 2EYFA 4A3BB 2LS01 4KJNA 3TZUA 1LTSD 1PTOH 5ELFA 1LO5D 2F0MA 1S5CD 2D5DA 2J4XA 3HZXA 2M2LA 3C1FA 4EQNA 3V2TA 1RCVD 3NQTA 3K5OA 1WTRA 1MBYA 4CJ0B 3WDNA 1L0XB 5EBCA 2BE5D 1T5XD 1GUWA 1DM0B 2EVBA 3GTGB 1FNWA 5LL6X 2SNMA 3RMHA 4ULLA 2CQAA 2NWGA 4IALA 3RUZA 4ZUIA 3D4RA 3VR4A 4C3JB 1PRTD 3SVMA 1QNUA 1DZ1A 1V1PA 2EDGA 3M7NA 5TSSA 2LY7A 3SK5A 3PMFA 3OHXC 4IUPA 3NBIA 4YIJA 3M85A 3DMUA 3X3NA 4ZRZA 1WTVA 5J22A 2EY6A 2ICEC 4PQXA 3N52A 3KF8A 3I3CA 2FFKB 1GHJA 2A68C 4L8JA 1SYFA 5COYA 2B2VA 4I7ZC 4DK0A 2B8GA 1STAA 1LABA 4RA8A 3QIAA 2RQXA 2D62A 1G91A 1GUNA 5JVH3 5DAUA 3DUZA 2D2CC 2K05A 4OGQC 3VR2A 2WIIB 2XIWA 1GXDC 3K59A 2EY1A 1I4RA 2K5QA 2DNEA 1DYQA 1LTGD 3EA6A 5IGFA 1JWMD 1LTBD 1OXTA 2N88A 1FNVA 1RD9D 1ET6A 3NSWA 2K33A 1F9SA 2NVQB 3A54A 1I3QB 2K1BA 3DWPA 4LAAA 2R3ZA 2KOLA 5C3WA 1PRTB 5T1IA 2RBMA 2K01A 1V1PB 3M4YA 4U673 3LNNA 5EGTA 4XIGS 3N6RA 4A3KB 4F7XA 1GUOA 2KCNA 1M8AA 1BCPF 3QOJA 1A3VA 3MAQA 1EY0A 1TVXA 2K5WA 4QF4A 1Q12A 2NTTA 1EYCA 2JP1A 4IUNA 4ZYSA 4B9WA 4PNYA 1I4GA 3KBGA 1Z47A 4QIWB 2SDFA 1L0YB 3P1HA 5FOBB 2AWNA 4FXDA 4IZ8A 3S9WA 1O7ZA 5BN5A 5C0XJ 5M5WB 2WACA 5A2QL 2B2UC 2RA4A 1RDPD 1E2VA 4XQJA 4XYOA 1QCBD 1AZQA 3SE0A 3K7AB 3BVZA 5IT9L 1M4VA 1ENFA 4H44C 3GTKB 4ZK9B 1I4QA 3H09A 3VR3A 1I4XA 1QE6A 3QB3A 5CV4A 1CM9A 4NMZA 5FO7B 4KN4C 4A3MB 5M5YB 2AQ2B 2NN6G 4XQQA 2AQ3B 3HOWB 3GO5A 2O4XA 1RJTA 1SXTA 3M4OB 4RCOA 4RKBA 2QILA 5JOBA 4J1MA 4K6DA 1LTRD 2HCCA 4P2CB 5E3FA 1JOKA 4ZLTF 2FJ2A 1XXGA 2BDOA 1NUCA 1G8ZD 1TU2B 2K32A 3PV0A 1YNJC 2IJ0A 4K2LA 5A2QE 1BCPC 1JOOA 2F0HA 2JEAI 3P75A 1NR4A 4CGYB 1IW7C 2L11A 3I8ZA 5KNDA 4L63B 3ZYYX 5AFWA 1SEBD 4K8JA 5IT9E 1HQRD 2F0WA 4KI0A 4PMWA 1X3QA 1TR5A 3K0YA 1KABA 2IPKD 3PUVA 4K5WA 1EQTA 3HKZB 3J80L 4OO1H 2BA0A 2R61A 1VMCA 3LX0A 5IGGA 3ND9A 4FF1A 3U9SA 1HTLD 2EYHA 2BCOA 2KHSA 1PZJD 3E0JA 1XYIA 4RGOS 1UNSA 4HCEA 4FF3A 1D6EC 5CYUA 5C0XI 2F0SA 3OMGA 1EFID 3CHBD 1BR9A 2F0NA 2JA5B 4G7HC 5D3DA 1K83B 4ZKCB 3PO2B 1V1OA 4I65A 5CV7A 3MTSA 1GHKA 4OL7A 4LMQD 3FPPA 4ME5A 3NK9A 4S3SA 1FNUA 1TKWB 3WOFA 2XWBB 3MFGA 3VR5A 1F9PA 3FMCA 5JAVA 3W2DA 1OXXK 3DEPA 1G2TA 1LTTD 2M00A 3RD4A 5FO8B 3WOEA 3MXNA 2R6GA 4ZQ3A 3JAME 2PQEA 2IX3A 1LT5D 1Y8OB 4KKTA 4XYQA 1Y1WB 2BA1A 1MSHA 2BDNA 2X69A 3GP7A 4XDXA 4EQPA 1EOTA 1PTOD 3U9OA 3OSOA 5JEAJ 1HFGA 3NTHA 3S1QB 5ELCA 4H0LC 2JA8B 2JA6B 1HCZA 2CVRA 1V8QA 1TWGB 1SJHD 2J7ZA 2XRSD 4RGNA 3L3OC 1CZGA 3Q23A 5ELBA 1T5EA 3S16B 4IURA 4DAPA 4JK1C 3DEOA 3NPPA 2Z4IA 1STHA 2KCCA 3C1EA 3TP7A 1A15A 2Z8LA 1TIID 1VF7A 2Z1CA 2L12A 3FKIB 4KV6A 3S17B 3PUXA 1LT3D 4R8IA 3VYTA 4IFDG 2F0TA 1PRTF 1STYA 1EYAA 3OW7A 1DD2A 2EZVA 5G3LD 3VYRA 3H91A 3LWEA 1EL0A 1EY4A 2XWJB 3H3VC 3GTPB 3MVVA 3EQLC 1LT6D 4F87A 5DM63 1STBA 1ICWA 1TWAB 5C3EB 5K36H 3FVQA 4FO2A 1BBXC 1DOLA 3T16A 2KQ3A 4NDXA 3FPUB 5EQ0A 1ZKOA 4C2MB 2NN6H 1GOZA 1PTOB 3MC0B 1B50A 4ZAIA 5M5XB 3BG3A 2E2JB 1EIHA 4C3HG 5KYIA 2NVXB 2KUMA 1AZPA 1YNND 1ILPA 1K8OA 2E74C 3FRPB 2K7VA 5EKIA 4F8MA 1CTMA 4PMCA 1RF2D 1LTAD 2CW0D 1OXUA 2F0OA 3ITPA 4H7BA 2AUKA 3CRLC 1SNOA 1TY0A 3GTMB 1R4PB 3MEHA 2OEOA 5F2DA 4DAVA 1OXVA 1JWSD 4C3IG 1F9RA 4FXGC 4KJOA 2B2TA 2F0UA 5JJZA 2XRQD 1EU3A 3TP5A 3EJIA 4KHVA 2J0TD 1I6VC 3SR1A 5CC4A 2IX0A 5A35A 1SBBB 4FF2A 2B2YA 1E0BA 4KD4A 4FF4A 2BE5C 1SMYD 3RZOB 2NYZD 2IX1A 4TQUS 3NQIA 1STGA 4CKCA 3CU7A 1ZYRD 2RKSA 4V190 4A3DB 4EVOA 3J7YW 4XXEA 2PW5A 2ZXRA 5D14A 2O5IC 1G6ZA 2ENBA 5ISRA 1ESRA 2F0DA 2QKIC 3Q0AA 4G7OC 2F0VA 2H1EA 1VCIA 2I46A 4OO1G 4B9XA 5KNCA 4KY6A 5HURA 4KN7C 2A6ED 3I73A 4N9TA 1JCKB 4X3KA 3P20A 1F9QA 2LKVA 2B2WA 2QEJC 4NP5A 1UUPA 3NTIA 1F77A 3HOUB 3T53B 5I2YA 1LT4D 1DJRD 5JVG3 3Q22A 3H0GB 5J1ZA 1BUVT 1DCZA 4LK1C 4IQZA 2K03A 1B2TA 1AP0A 4IUVA 1ESFA 1LACA 3MXPA 1CHPD 4KY5A 4HSVA 4BY1B 4V0BA 5EJWA 3C2PA 1SYEA 2EY2A 2AWOA 1SDFA 3A8IE 5E1FA 1VDZA 1CI3M 4ID6A 1GUTA 3QJYA 3OWEB 3PUZA 2DNCA 1JICA 4CJ2C 3QG1A 4R9WA 2ZT9C 4FP5D 3S2DB 1KLGD 3E5SA 4K8IA 4ODGA 5CV5A 3TN2A 1G291 1PFBA 5IGEA 4J8QA 1X3PA 4H13C 3VR6A 4QUCA 4HEDA 2F0LA 2WINB 2X6LA 4C3HB 2CHBD 4HN7A 1O80A 1E2WA 1W6KA 3HOXB 1A3TA 2EE1A 3I4LA 1SYGA 3TBIB 1TWFB 2MHVA 3S14B 2PYKA 1KNEA 2NZ1D 4HTHA 3ERQA 4IFDH 1H9JA 4CKEA 2F0GA 3PIO3 1ET9A 1NSNS 4C3IB 3A7LA 4C1NI 1D2BA 2BOSA 4BA1I 2AQ1B 1Q1BA 1MI2A 2Y0SB 4QUFA 3IFTA 1ONLA 4KK7A 4A3JB 1RODA 2B8FA 1QWYA 1A2UA 1HPCA 3R2IA 4J6HA 1Z7TA 2JSOA 1HA5A 5JPNC 1KLUD 1LV9A 1LLRD 1CFMA 2A6HD 1SE3A 3K5LA 5K36G 4WFN3 2F0QA 1XTCD 1EY5A 4DK1A 4WJWA 3CRKC 1U9RA 4KKSA 4O1NA 2VUMB 1QB5D 4E6IA 2A74C 1H9RA 3D3RA 1I4HA 3CQZB 1IYVA 1NCVA 5CV6A 3AMUA 3D6CA 2B2UA 1SNCA 4ABNA 4FXKC 4A3EB 1VF5C 1HA6A 1B3AA 4A3GB 1PMRA 4DU9A 1IKLA 5IGDA 5CR3A 3URYA 1JQYD 5EBDA 5CBEE 1PTOF 1SE4A 5D3IB 2ZXOA 2KECA 1MSGA 4QB4A 4B08A 2RDGA 2PNRC 5C4XB 2E76C 3X3MA 3KLSX 1QILA 3NWTA 5D65A 4KHZA 2JE6I 4M1UB 2K5DA 2PO4A 4Y7NB 3R3OA 3T13A 1RTNA 4F88A 4DAYA 2FMCA 5IGCA 5DNFA 1FYCA 2EYLA 1D5ZC 2MP1A 3JAML 2A69D 5KNBA 3TDQA 2QDBA 2F3VA 5CGKA 2EYPA 1BQQT 5G3LF 1YNJD 1JORA 3D4WA 3L7ZC 2NVYB 1KDCA 5EKLA 1EYDA 4DNTB 1IW7D 2A73B 3OWFA 1TY2A 1EWCA 1ML0D 3G6JB 1SYBA 3NE5B 1SNPA 4RAUC 2R92B 3TP8A 3T4AC 1F2LA 2F4IA 2KA7A 1H9SA 1HHVA 2MJ8A 3I4MB 3OIQA 2B39A 3S1MB 3M3YB 3MHBA 1NAPA 2OF1A 3T56B 1Q3LA 3SK8A 2HCIA 1CZWA 1QJOA 3GQBA 2K28A 1KAAA 1PTOC 5BN3A 3J7AF 3HOVB 1LTID 4FYDA 2F0KA 1MGSA 4OIJA 4RGMA 5CV9A 3IFDA 5I9PA 4DN4M 2Z4HA 3I90A 2RDFA 1CHQD 5I2XA 2LMCB 2TMPA 3G7LA 2IW3A 3MXGA 2FMMA 2ZXPA 3BVMA 3SK4A 2NVTB 2D9UA 1QG7A 4G7ZC 4C3JG 4EGVA 1R4QB 3GTJB 1F2ZA 1IL8A 4TSSA 4FNFA 5EKKA 1SNMA 3DWQA 4G4KA 1DXMA 1W6JA 5K5PA 1EIGA 2E75C 4RFBA 1OXSC 4DXFA 4Z9CB 1KDAA 4RHSA 3EFXD 4X3UA 4U68A 4RKLA 3K57A 1JC7A 1G2SA 3PUYA 1H9SB 5NUCA 4IFDJ 5M3MB 3DM1A 3KUPA 3RZDB 3DHQA 1B53A 1WTPA 2MUYA 3I4NB 3A56A 1TT2A 5FLXE 2XNAC 5M3FB 2M9VA 3C3LA 1U4MA 4ILWA 2SEBD 3S15B 1OO9B 3D31A 4GZYC 1IYUA 3DWAA 2RDHA 4KKUA 3PUWA 4K5VA 3NHHA 2CW0C 4XQNA 2L55A 3MXUA 2EJFC 1Q90A 2EYMA 1D1IA 1DOMA 2F0PA 3LWUA 1I4PA 1WTXA 5HGTA 3GTLB 5C5MA 1D5MC 2WP8J 1FD7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  2F3W A;  3SK4 A;  5CV8 A;  5IOD A;  2QDB A;  1SYC A;  4QMG A;  2F3V A;  4NKL A;  4R8N A;  5CGK A;  4KV6 A;  1EY6 A;  2EYP A;  4K14 A;  4KD4 A;  4RKB A;  3BDC A;  2F0S A;  3H6M A;  5JOB A;  5E1F A;  5KIX A;  4J1M A;  4EQN A;  1JOR A;  3OMG A;  4LAA A;  2F0Q A;  4EQO A;  1F2Z A;  3D4W A;  4HMI A;  3TP6 A;  5C3W A;  4K6D A;  3D4D A;  4K2K A;  2F0T A;  1STG A;  2F0N A;  4ID6 A;  1EY5 A;  1EQV A;  1KDB A;  2SNM A;  1KDC A;  2PZT A;  4WRD A;  5E3F A;  1JOK A;  5EKK A;  1EY7 A;  1SNM A;  1STY A;  1EYD A;  2RKS A;  1EYA A;  4KD3 A;  2RBM A;  5EKL A;  1U9R A;  3OMC A;  5C4Z A;  1EY8 A;  4I65 A;  4IAL A;  1F2Y A;  3RUZ A;  4ZUI A;  1RKN A;  5CV7 A;  5K5P A;  5EGT A;  4EVO A;  3D8G A;  4OL7 A;  4E6I A;  4G57 A;  2SOB A;  1EY4 A;  2SNS A;  3C1E A;  2PW7 A;  2PW5 A;  3EVQ A;  3MVV A;  3OWF A;  4HMJ A;  4F7X A;  1SYD A;  4DGZ A;  3E5S A;  3QOJ A;  4K8I A;  4ME5 A;  1A3V A;  1EZ6 A;  1NUC A;  1KDA A;  2EY5 A;  1EY0 A;  3NK9 A;  4S3S A;  5CV6 A;  3TP7 A;  2ENB A;  5I6W A;  5IIF A;  1STB A;  4J6H A;  1SYB A;  4QF4 A;  5IOC A;  5J39 A;  3NUC A;  2HQE A;  3D6C A;  4ODG A;  4RKL A;  5CV5 A;  4DFA A;  5ISR A;  1SNP A;  1SNC A;  1SNQ A;  3BDL A;  5IGE A;  2F0D A;  4K2L A;  1EYC A;  4PMB A;  5NUC A;  3SK5 A;  5KRU A;  5JAV A;  3PMF A;  1JOO A;  4IUN A;  4B9W A;  2F0H A;  4PNY A;  1STN A;  3TP8 A;  2F0V A;  3P75 A;  4DU9 A;  3T16 A;  1TQO A;  3DHQ A;  2KQ3 A;  2M00 A;  5CR3 A;  2F0L A;  4NDX A;  4YIJ A;  4ZUJ A;  5IGD A;  3DMU A;  3ERO A;  1TT2 A;  3P1H A;  5J22 A;  2EY6 A;  3QOL A;  4TRD A;  4ZQ3 A;  4B9X A;  2F0I A;  3NP8 A;  4IZ8 A;  2PQE A;  1A2T A;  3S9W A;  1A3T A;  1SYF A;  2F0E A;  3MHB A;  4K5X A;  1SYG A;  4K8J A;  4KY6 A;  2F0W A;  2OF1 A;  5IGB A;  1EY9 A;  3SK6 A;  3MZ5 A;  5HUR A;  3VA5 A;  5KYI A;  2PYK A;  1AEX A;  1TR5 A;  3SK8 A;  5C4H A;  2WAC A;  4N9T A;  1KAB A;  2NUC A;  2F0F A;  2LKV A;  1KAA A;  4QB4 A;  4K5V A;  1STA A;  4EQP A;  3NHH A;  4F8M A;  4NP5 A;  1A3U A;  2EXZ A;  4HTH A;  4PMC A;  5C5L A;  3ERQ A;  5C6A A;  3U9O A;  4K5W A;  5I9O A;  2F0O A;  3ITP A;  3TME A;  2F0K A;  2F0G A;  4H7B A;  2EYM A;  4MIU A;  1F2M A;  1NSN S;  2PZU A;  5DEH A;  3OSO A;  5DAU A;  2EYO A;  4KTA A;  2F0J A;  1SNO A;  5CC4 A;  2OXP A;  5J1Z A;  5CV9 A;  3MEH A;  5I9P A;  2OEO A;  5F2D A;  1SND A;  3SHL A;  4KY7 A;  2EYF A;  2PZW A;  3LX0 A;  3NXW A;  5KYL A;  5IGG A;  2F0P A;  5KGU A;  3HEJ A;  1EZ8 A;  4WOR A;  4DF7 A;  4KJN A;  5HGT A;  2EYH A;  3QB3 A;  2RDF A;  5CV4 A;  5M9O A;  4KJO A;  3SXH A;  2F0U A;  2KHS A;  4N9P A;  4NMZ A;  2EY1 A;  5KEE A;  5C5M A;  5C3X A;  3MXP A;  2F0M A;  3R3O A;  3T13 A;  1ENA A;  4KY5 A;  5IGF A;  1ENC A;  3EJI A;  4KHV A;  3TP5 A;  3HZX A;  5I6Y A;  5IGC A;  1JOQ A;  1A2U A;  1II3 A;  3SR1 A;  1SYE A;  2EY2 A;  3C1F A;  2O4X A;  1STH A;  3V2T A;  2EYL A;  3NQT A;  2EYJ A; 
#chains in the Genus database with same CATH topology
 2L0C A;  2OQ0 A;  3NWS A;  2UUC Q;  3QO2 A;  1EIF A;  1NMG A;  1BXT A;  4L6T B;  1RHP A;  3OIP A;  4R8N A;  4JI4 Q;  1YIJ A;  3D6W A;  1SMY C;  2B2Y C;  3A8K E;  3PF4 A;  3PF5 A;  5KIX A;  2L1B A;  4RCN A;  3J7Z C;  2K04 A;  4DR5 Q;  1AW7 A;  1UEA B;  1SFO H;  4HMI A;  5HY6 A;  4DV7 Q;  3S1N H;  2EJG C;  4OHJ A;  1ZYR C;  5CMD A;  2FIN B;  4C56 C;  3PO3 H;  1YNX A;  3CC2 A;  3S1R B;  1C8C A;  3TS0 A;  3GTQ B;  4DV5 L;  2WB1 B;  3BDL A;  4H02 A;  1NR2 A;  4PMB A;  1JB7 A;  3HOY G;  3J7A V;  4RH6 A;  4P72 A;  5ELD A;  4YHH Q;  2PMZ B;  5LMN Q;  4TVA B;  2F0E A;  5C4J H;  1PRT C;  1BDO A;  1O7Y A;  1S5B D;  2A5H A;  1GM5 A;  4IUT A;  2A6E C;  4GS3 A;  4LF8 Q;  2VQF Q;  3HOZ H;  2R93 G;  1W3S A;  4OIK A;  1NE3 A;  1BOS A;  2B2W C;  2Y0S E;  5IYB H;  2ATW A;  1XNQ L;  3GTO B;  4KHP Q;  4A93 B;  3OW2 A;  3GV3 A;  2NTS A;  3IAY A;  1IBK L;  2I07 B;  1VQP A;  4GOP A;  3ONA B;  1IZ6 A;  3HOW G;  1WVL A;  1Q8I A;  3S2H B;  4DXG A;  3HS0 C;  2O2L D;  2B2V C;  2OWO A;  4BBR B;  4IFD I;  4OWW B;  4KMU C;  2DY7 A;  5C3X A;  2R7Z B;  2K14 A;  3GD7 A;  2AMC B;  3HRZ C;  4LF9 Q;  2JA7 G;  2G9D A;  1WCM H;  2RCF A;  2F0I A;  5T1G A;  3CAM A;  3RNU A;  5IOD A;  1KC8 C;  5JJK A;  1EUJ A;  4NKL A;  1J5E L;  2E2I H;  1FJG Q;  2L4N A;  1AE2 A;  1X6O A;  5FO9 B;  4L5R C;  4JG2 A;  2UUC L;  1O78 A;  2ZTC A;  3G48 A;  4M8A A;  4UP9 A;  4Q5V A;  1I6H H;  2OCE A;  1A6X A;  3RLF A;  4KD3 A;  3R93 A;  3U50 C;  4A3B H;  1GO3 E;  3BVG A;  4DR5 L;  4LW1 A;  4DV7 L;  1HZA A;  4R4C A;  1BF4 A;  5BN4 A;  3QR8 A;  3AU7 A;  2VQE Q;  3CPW A;  3J81 L;  5C44 B;  3PSI A;  3Q6S A;  5IIF A;  1FL0 A;  3HFZ B;  1XMQ Q;  3BZD B;  4DA2 A;  2UXC L;  5J39 A;  3NUC A;  2HQE A;  1LM0 A;  4PZ6 A;  1HTP A;  3W5O A;  3R2T A;  3K58 A;  1PYB A;  4A3C H;  1HRJ A;  4APV A;  4MN3 A;  2DY8 A;  2WKD A;  2VXW A;  4FVM A;  1TQO A;  1IKM A;  1KRS A;  1Q46 A;  1Y1V B;  1MJE A;  2HUG A;  1PDQ A;  1AH9 A;  3T1H Q;  3H3V H;  1X54 A;  3GTG H;  3MA2 B;  3UDF A;  4OON A;  2K6A A;  2A68 D;  4GLX A;  5IT9 c;  2F3I A;  4YHH L;  2PPB C;  3MZ5 A;  1PFM A;  3HKZ G;  5LMN L;  1BKB A;  1UAP A;  1AEX A;  1S3O A;  4GN5 A;  4C3J H;  2RSN A;  2NUC A;  4IN3 A;  3BDO A;  5IWA Q;  5IYD G;  1A3U A;  2EXZ A;  5C5L A;  2JEB I;  2Q8T A;  3QWN A;  3DLL A;  3CCV A;  1WD0 A;  5I9O A;  2VQF L;  3H94 A;  2QCP X;  1PLF A;  4UP7 A;  2QDL A;  1XNR L;  5JPM C;  1D1K A;  4X65 Q;  4KTA A;  1QZG A;  5JEA H;  2OTJ A;  2PI2 A;  4KHP L;  3NXW A;  2QF7 A;  4WOR A;  3KBX A;  1N33 Q;  2ZJR A;  1TS2 A;  2EOT A;  5FJ8 H;  1G6P A;  5I4D A;  1VQL A;  4HR7 B;  3I55 A;  2E2D C;  5LL6 S;  1EU4 A;  2NBF A;  4DR1 Q;  5KEE A;  1PFN A;  2EPB A;  1FR3 A;  4DKA C;  2A8V A;  3BYT B;  1JOQ A;  1EEF D;  1XPO A;  1II3 A;  1QVG A;  3DXJ C;  4BY7 B;  3A5Z B;  4Q0F A;  4DV2 Q;  1XTD A;  1SE8 A;  5CV8 A;  1KD1 C;  1HXY D;  3J81 E;  4JBM A;  2A6H C;  1S72 A;  1EWH A;  3C46 A;  1VQK A;  2B63 G;  1Q1E A;  4DAM A;  2WAQ E;  3TP6 A;  3D4D A;  3F2U A;  4PG3 A;  3OTO Q;  1FJG L;  3M9B A;  1KDB A;  1SR3 A;  5LHY 1;  2A1A A;  5C4Z A;  5GQO A;  3Q8D A;  1F2Y A;  1G51 A;  1RKN A;  4IJH A;  3CC4 A;  1EQR A;  4DK6 C;  4X66 L;  4OO1 I;  1JT8 A;  2SNS A;  3EVQ A;  3UDX A;  3HG9 A;  3HOY B;  1KNA A;  1S4Z A;  5GAH C;  1EZ6 A;  1TWH B;  2NB0 A;  4N8X 1;  3SDZ A;  5I6W A;  5C0X G;  1S5D D;  1CQF A;  2RF4 A;  2VQE L;  3I70 A;  2RVL A;  3A55 A;  1SNQ A;  1SRO A;  2K52 A;  4R4T A;  4MTK A;  3IKJ A;  1Y1W G;  4DR3 Q;  2RSO A;  1CQV A;  3PGZ A;  4JCV E;  4JI3 Q;  2NVQ H;  3ND8 A;  3O13 A;  1I3Q H;  1HZB A;  4CKB A;  4MHE A;  3JAM c;  1I50 B;  3NP8 A;  2R93 B;  1CK1 A;  3GV6 A;  2MFI A;  4K5X A;  2UXD Q;  1NTG A;  1EY9 A;  4JI7 L;  3T1H L;  4A3F B;  2JA8 G;  3DM3 A;  2JA6 G;  1VQE A;  4JI2 Q;  2F0F A;  4DNR B;  4A3K H;  1PXU A;  1Y8N B;  1BNZ A;  5E4X A;  1D8L A;  4HIK A;  5IWA L;  4UPA A;  5ELN A;  4LF7 L;  1TS3 A;  4A3I B;  4IUU A;  2ID0 A;  3V96 A;  5KYL A;  1GUS A;  2EJM A;  3K5M A;  2XN9 C;  4DF7 A;  2XVS A;  1HNZ Q;  3MFY A;  4JOI C;  3V05 A;  3J81 j;  3FKI G;  2JA7 B;  3SXH A;  3BYY B;  4N9P A;  5EPL A;  2FHT A;  1ASZ A;  1UWV A;  2KJX A;  3BS1 A;  4K6L A;  3W3A A;  1B1Z A;  1B9N A;  1ENC A;  3CD6 A;  3U4V A;  1X32 A;  5M5W H;  4DR1 L;  3R8B A;  1M90 C;  1KQS A;  2A69 C;  3BDC A;  1HJP A;  3NEM A;  2F3W A;  2IT1 A;  1SYC A;  1C0A A;  1GUG A;  1AFP A;  3CP0 A;  1KIX A;  4DV2 L;  1DOK A;  1EEI D;  1JWU D;  1Y69 U;  1O7L A;  3Q24 A;  4CBV A;  3K7A H;  2TSS A;  4LUZ A;  3FHW A;  4C1N K;  4RWS C;  1KXL A;  1ZXT A;  1EQV A;  2PZT A;  3RLN A;  1EY7 A;  4IJL A;  3GTK H;  1DON A;  3CC7 A;  3PIP 3;  5C3E G;  1EY8 A;  2C9O A;  2XTI A;  1SAP A;  3KK7 A;  4OX9 Q;  5BR8 Q;  1B44 D;  4HMJ A;  1SYD A;  2D0O A;  1KL9 A;  2EY5 A;  1S5F D;  4A3M H;  1WTW A;  5M5Y H;  4DFA A;  3HOW H;  2JYO A;  1PYW D;  3VA7 A;  2Q2U A;  1P16 A;  3M4O H;  2F4V L;  3OOC A;  1BCP D;  1SMX A;  4UDU C;  3A7A B;  4RHR A;  2YU9 B;  1HH2 P;  2E2H B;  4IOA A;  2G9H D;  2L5T A;  3MWY W;  1YI2 A;  3ERO A;  1YJN A;  3M7G A;  4BBS B;  2C5C A;  2WAQ B;  4JI3 L;  2N3S A;  4OWX B;  3F1Z A;  4HJ5 A;  2O5J C;  1CA6 A;  4HCS A;  4IPG A;  2IL8 A;  2WKC A;  4IUQ A;  1IBL Q;  3K8A A;  4JI2 L;  1YHQ A;  1SE2 A;  1F2M A;  5DEH A;  2PZU A;  1U4L A;  1C48 A;  2F0J A;  5ELO A;  1CT1 D;  2OXP A;  5EPJ A;  5H1S E;  1Y8P B;  3STB C;  4NXN Q;  1WTO A;  5KGU A;  2KEN A;  1EZ8 A;  3HEJ A;  1Q82 C;  1PZK D;  1IBM Q;  3VYS A;  3CME A;  1B8A A;  1J9O A;  4A3B G;  2VNU D;  1CKM A;  3K6O A;  3G4S A;  4ZCK A;  1AN8 A;  1TWC B;  1B4O A;  2NN6 I;  2B63 B;  5FLX L;  4LUO A;  1S5E D;  3E9H A;  1UE1 A;  2X6G A;  1QZH A;  1HQM C;  1SSO A;  1SJE D;  2DUD A;  4P71 A;  4X3S A;  5CBA E;  4R4I A;  1XX8 A;  4XT3 B;  1HZC A;  2A19 A;  1XWE A;  4POF A;  3CKI B;  2HDL A;  4YWK A;  5DLQ E;  1VQC A;  1R9T B;  4UAI A;  4WRD A;  1H9M A;  2WB1 E;  1YZ6 A;  1E2Z A;  3LGJ A;  3P7J A;  4BWG B;  2YYZ A;  3HGB A;  3J80 E;  1BCP B;  3KLR A;  4LUV A;  5COR A;  1J8I A;  3J7A 5;  5IOC A;  2AUJ D;  4OX9 L;  5BR8 L;  5IYC G;  2PMZ E;  2L9H A;  2DN8 A;  3M4P A;  5KRU A;  4HJ7 A;  1S40 A;  2V4D A;  3I91 A;  1HR0 W;  1KTK A;  4HSP A;  2HDM A;  1U4R A;  1SN8 A;  2DJF C;  1RTO A;  1PH2 A;  3M4Q A;  1VQN A;  1HUN A;  1MD2 D;  4P74 A;  1ZEQ X;  5JEA G;  4CHT B;  3FEW X;  3OPO A;  3QOL A;  5FK9 C;  4QQB X;  3NTK A;  1A2T A;  3BU2 A;  2JA5 H;  5ELE A;  1BO0 A;  2Q8I B;  1K83 H;  1PZI D;  3SK6 A;  5FJ8 G;  3PO2 H;  2PQA A;  3H0G G;  2YV5 A;  2WV6 D;  4RGT A;  3TQY A;  3U58 A;  2LXK A;  4XTC S;  4HJA A;  2Q8R E;  1PH5 A;  1QNK A;  2OT2 A;  3TME A;  4BS9 A;  1HNX Q;  1CSP A;  2NZO A;  2IWH A;  1SFO B;  1C4Q A;  3S1N B;  3JAM i;  4BA2 I;  4GKK Q;  4AYB B;  1SND A;  3SHL A;  1A62 A;  4HAE A;  1D5X C;  2PZW A;  3HP3 A;  4BY1 G;  1QUQ A;  4K0K Q;  4O42 A;  4QCL A;  1U4P A;  3KLS A;  3PO3 B;  5C0X H;  1YNN C;  5M9O A;  4NXN L;  1ILQ A;  2KVM A;  3K5N A;  4LFA Q;  5FKA C;  4PV1 C;  1H9K A;  2Q2T A;  1ENA A;  1IBM L;  4NW2 A;  5JJL A;  5LMU Q;  4HIM A;  1Y1W H;  4A4I A;  2IY5 B;  3H6M A;  1GJX A;  2XSC A;  2JJQ A;  1VMP A;  2EYJ A;  5EPK A;  4RG1 A;  1IHZ A;  3L9A X;  4JBK A;  4QMG A;  4CJ1 B;  3RN2 A;  2ICI A;  1EY6 A;  2MGS A;  3UI2 A;  4K14 A;  3AB9 A;  3CCE A;  1IL2 A;  4ALP A;  3E6Z X;  2QA4 A;  2LFN A;  2LSS A;  4EQO A;  3S1Q H;  4K2K A;  4XT1 B;  2B2T C;  3MEF A;  4O0A A;  3I72 A;  1X55 A;  5EAY A;  4ZUJ A;  4TKO B;  5I6Y A;  5C4J B;  4B3S Q;  2JA6 H;  2NVT H;  3UDG A;  1FGB D;  1TWG H;  3OMC A;  4ZKB B;  1UE5 A;  2PCF B;  2GA4 B;  3T51 B;  3D8G A;  3HOZ B;  4G57 A;  2SOB A;  2QEX A;  2PW7 A;  4DGZ A;  1JR0 D;  3S16 H;  5JJI A;  2MPM A;  2IHE A;  2VB3 X;  2JXM B;  4L5S A;  1K8M A;  3NEN A;  4A3K G;  4JI1 Q;  3ULJ A;  3HOX G;  2F03 A;  4RMF A;  2RCN A;  4PZ7 A;  4JBW A;  2N78 A;  2Q2I A;  1CA5 A;  1JE4 A;  1STN A;  3FKI H;  5HGQ A;  2N55 A;  3S17 H;  3VYU A;  5DM7 3;  4N8F A;  3T1Y L;  1SLJ A;  4X3T A;  3TSS A;  1A8V A;  1HFN A;  1HUM A;  4TRD A;  1QOH A;  2UXC Q;  3IL8 A;  1DGS A;  1WD1 A;  4L5Q A;  1Z6H A;  2FXQ A;  3NBH A;  1V43 A;  5IGB A;  1W2B A;  2KEE A;  3VA5 A;  1WTQ A;  2H4O A;  1STE A;  5C4H A;  2KED A;  1WCM B;  1TS5 A;  1TS4 A;  1B9M A;  3SGI A;  3GTP H;  3A8J E;  3TZD A;  5C6A A;  2F1M A;  4LJZ C;  2Y0S G;  2E2I B;  2K50 A;  3WWV A;  4LF4 L;  1QUQ B;  3FDT A;  4LF6 Q;  1JB3 A;  3H3V I;  4MZ9 A;  4MIU A;  1KHI A;  1TWA H;  2CH4 A;  2EYO A;  5C3E H;  4QL5 A;  2ALY B;  2VB2 X;  4YCV A;  1I6H B;  1Q81 C;  3J81 c;  1YBY A;  5E4W C;  1HNX L;  1LTL A;  3SEB A;  4KY7 A;  2EYF A;  4A3B B;  1K3B C;  2LS0 1;  4KJN A;  4GKK L;  1PH1 A;  4C2M H;  3TZU A;  2GVB A;  1LTS D;  4K0K L;  1PTO H;  4UP8 A;  5ELF A;  1XNR Q;  5GAE C;  1LO5 D;  2IHF A;  2F0M A;  1S5C D;  3F2D A;  5M5X H;  3AYH B;  2E2J H;  2D5D A;  2J4X A;  3HZX A;  4YCW A;  2M2L A;  2VZA A;  2NVX H;  3C1F A;  4EQN A;  4LFA L;  3V2T A;  1RCV D;  3NQT A;  3K5O A;  5FLM G;  1WTR A;  3KYH C;  5LMU L;  4A3M G;  1MBY A;  4CJ0 B;  3EN2 A;  3WDN A;  1L0X B;  5EBC A;  4JI6 Q;  2BE5 D;  1T5X D;  1GUW A;  1DM0 B;  3FP9 A;  2EVB A;  3GTG B;  1FNW A;  4OEL B;  3GTM H;  5LL6 X;  2SNM A;  3RMH A;  4ULL A;  3AFP A;  2CQA A;  3PCO B;  3UE0 A;  2NWG A;  4IAL A;  3RUZ A;  4ZUI A;  3D4R A;  3VR4 A;  1JMC A;  4DR7 L;  4B3S L;  4C3J B;  4A3G G;  4LNQ A;  1NBW A;  4DV0 Q;  1PRT D;  3G71 A;  3SVM A;  1QNU A;  1DZ1 A;  1V1P A;  4B3T Q;  4NPS A;  2EDG A;  2HIV A;  4DV1 Q;  3M7N A;  5TSS A;  2LY7 A;  3UDI A;  1ICF B;  3SK5 A;  3PMF A;  4UHV A;  3OHX C;  2YTV A;  3NBH B;  5LMN W;  4X66 Q;  4IUP A;  4JI1 L;  3NBI A;  3RZO H;  4YIJ A;  3I2Z A;  3M85 A;  3DMU A;  3X3N A;  4ZRZ A;  1WTV A;  5J22 A;  4DR2 Q;  2EY6 A;  2ICE C;  4PQX A;  3N52 A;  3KF8 A;  3I3C A;  2ZJP A;  5C4X G;  1OTC A;  2FFK B;  1GHJ A;  2A68 C;  2KCM A;  4L8J A;  1SYF A;  2PI2 E;  5COY A;  4X6A H;  2V1C C;  2E8G A;  1WOC A;  2B2V A;  4I7Z C;  2KHJ A;  4DK0 A;  1WI5 A;  4A3D H;  2B8G A;  3HKS A;  1STA A;  1LAB A;  4RA8 A;  2MQH A;  3CMA A;  3QIA A;  2RQX A;  4OEM B;  4R4O A;  1N32 Q;  2D62 A;  1G91 A;  4B3R Q;  1GUN A;  5JVH 3;  5DAU A;  3DUZ A;  4JI7 Q;  4LF6 L;  1B3Q A;  2D2C C;  2K05 A;  4OGQ C;  3VR2 A;  2WII B;  2XIW A;  1GXD C;  3K59 A;  2EY1 A;  5IYC H;  1I4R A;  2K5Q A;  4LF7 Q;  2DNE A;  1DYQ A;  1LTG D;  3EA6 A;  5IGF A;  3IRB A;  1QVC A;  4GOP B;  1PA6 A;  1JWM D;  1LTB D;  1OXT A;  2N88 A;  3TRZ A;  1FNV A;  1RD9 D;  1ET6 A;  3NSW A;  2K33 A;  1F9S A;  3HOU H;  2NVQ B;  3A54 A;  1EYG A;  3W1G A;  1I3Q B;  2BH8 A;  2K1B A;  3DWP A;  4LAA A;  2R3Z A;  2KOL A;  4JYA Q;  5C3W A;  2L15 A;  4MTN A;  4A75 A;  3H0G H;  1PRT B;  5E7N A;  4JI6 L;  5T1I A;  2RBM A;  2K01 A;  4OWT B;  1V1P B;  3M4Y A;  4U67 3;  3LNN A;  5EGT A;  4XIG S;  3N6R A;  2RHS B;  4A3K B;  2JA5 G;  3ICE A;  4F7X A;  1GUO A;  1CSQ A;  2KCN A;  1M8A A;  1BCP F;  3QOJ A;  1A3V A;  3MAQ A;  1EY0 A;  3PO2 G;  1TVX A;  2K5W A;  4QF4 A;  2AHO B;  2R7D A;  1Q12 A;  3I4M G;  4BY1 H;  4DV0 L;  2NTT A;  1EYC A;  2JP1 A;  3KF8 B;  2GN5 A;  4IUN A;  4ZYS A;  3L2P A;  4B9W A;  2K75 A;  4PNY A;  4B3T L;  1I4G A;  4DV1 L;  1GVP A;  3KBG A;  1Z47 A;  4QIW B;  3A0J A;  2K5V A;  2SDF A;  1L0Y B;  3P1H A;  5FOB B;  2AWN A;  4FXD A;  3E9I A;  3HOV G;  2JN4 A;  4IZ8 A;  3S9W A;  1UEB A;  1O7Z A;  1D7Q A;  2GVA A;  5BN5 A;  5C0X J;  4DR2 L;  2ES2 A;  3TS2 A;  2F4V Q;  5M5W B;  2VL6 A;  2WAC A;  5A2Q L;  2B2U C;  4P73 A;  3S2D H;  2CWA A;  2RA4 A;  1BVS A;  1RDP D;  1E2V A;  1UE7 A;  4XQJ A;  4XYO A;  1QCB D;  1VQH A;  1AZQ A;  1P8L A;  3SE0 A;  3K7A B;  4QJF A;  1N32 L;  3BVZ A;  5IT9 L;  4B3R L;  1M4V A;  1ENF A;  2DJG C;  4H44 C;  3GTK B;  4HIO A;  4ZK9 B;  1I4Q A;  3H09 A;  3VR3 A;  1I4X A;  3AEV A;  1QE6 A;  4C3H H;  3QB3 A;  3CF5 A;  2MNA A;  5CV4 A;  1XPR A;  1CM9 A;  4NMZ A;  5FO7 B;  2F52 A;  3HOX H;  4KN4 C;  4A3M B;  1TWF H;  5M5Y B;  3E0E A;  2AQ2 B;  2NN6 G;  2I5H A;  4XQQ A;  4B3M Q;  2AQ3 B;  3S14 H;  3HOW B;  3GO5 A;  2O4X A;  4NXM Q;  1RJT A;  1XPU A;  1SXT A;  3M4O B;  4RCO A;  4RKB A;  4IO9 A;  2QIL A;  5JOB A;  2DGY A;  4J1M A;  4C3I H;  1MJC A;  4K6D A;  1EIY B;  1LTR D;  2HCC A;  4P2C B;  5E3F A;  1JOK A;  2N8N A;  4JYA L;  5M3M G;  4ZLT F;  2FJ2 A;  2R7F A;  1XXG A;  2BDO A;  4A3J H;  3PIP A;  1NUC A;  1G8Z D;  3NEL A;  3I4N G;  1TU2 B;  2K32 A;  3PV0 A;  1YNJ C;  2IJ0 A;  4DR4 L;  4K2L A;  5A2Q E;  4LFC L;  1BCP C;  1JOO A;  1LUZ A;  2F0H A;  3KLW A;  2JEA I;  1A63 A;  3P75 A;  2G5D A;  1NR4 A;  2ZTD A;  4CGY B;  1IW7 C;  2L11 A;  4PZ8 A;  3W1B A;  5FLX c;  3I8Z A;  5KND A;  4LFB L;  5FLM H;  4L63 B;  3ZYY X;  5AFW A;  1SEB D;  4K8J A;  1FGU A;  1HQR D;  2F0W A;  4KI0 A;  5IT9 E;  4PMW A;  4CDF C;  1X3Q A;  1TR5 A;  1A0I A;  3K0Y A;  1M1K C;  4POG A;  2VUM H;  1KAB A;  2IPK D;  4AYB E;  3PUV A;  3CQZ H;  3H15 A;  5IP9 G;  4K5W A;  1EQT A;  2JK8 A;  3HKZ B;  3J80 L;  2KHI A;  4GNX C;  1EQQ A;  1WJJ A;  4OO1 H;  2BA0 A;  2R61 A;  1VMC A;  4A3E H;  1GKH A;  4A3G H;  3LX0 A;  5IGG A;  3ND9 A;  3A74 A;  1KRT A;  3U4Z A;  4FF1 A;  3U9S A;  1HTL D;  3BZK A;  2EYH A;  2BCO A;  1VQB A;  2KHS A;  1PZJ D;  3E0J A;  4DK3 C;  2KBN A;  1XYI A;  4RGO S;  1UNS A;  4HCE A;  4B3M L;  4FF3 A;  1D6E C;  5CYU A;  5C4X H;  4NXM L;  5C0X I;  2F0S A;  1WTH A;  3OMG A;  1EFI D;  1PVO A;  1TXY A;  1L1O C;  3CHB D;  1BR9 A;  2F0N A;  2JA5 B;  4G7H C;  2WB1 G;  5D3D A;  1VQ7 A;  1K83 B;  1JJC B;  4ZKC B;  4JW0 A;  1X3F A;  3PO2 B;  1V1O A;  4I65 A;  5CV7 A;  3MTS A;  1GHK A;  4OL7 A;  4LMQ D;  3FPP A;  4ME5 A;  3NK9 A;  4S3S A;  4Y7N H;  1FNU A;  1TKW B;  1Z9F A;  2QW7 A;  4I7A A;  4IPC A;  3WOF A;  4A3D G;  2XWB B;  3MFG A;  3VR5 A;  1F9P A;  3FMC A;  4X62 Q;  5JAV A;  3W2D A;  1OXX K;  4DV3 Q;  1X9N A;  3KJP A;  3DEP A;  4UY8 C;  1G2T A;  1CKO A;  1LTT D;  2M00 A;  3RD4 A;  5FO8 B;  1AE3 A;  3WOE A;  3MXN A;  2R6G A;  4ZQ3 A;  3JAM E;  2PQE A;  4R1J A;  2IX3 A;  1LT5 D;  2NVY H;  1Y8O B;  4A76 A;  4A93 G;  4KKT A;  4XYQ A;  1Y1W B;  3I56 A;  2BA1 A;  1MSH A;  4LF5 Q;  3CCL A;  2BDN A;  2X69 A;  2XGT A;  3T1Y Q;  3GP7 A;  4XDX A;  4EQP A;  1EOT A;  1PTO D;  1KAW A;  1VQ5 A;  3U9O A;  3OSO A;  5JEA J;  1HFG A;  3NTH A;  3S1Q B;  5ELC A;  4H0L C;  3RN5 A;  2JA8 B;  4CDC C;  3CCS A;  2R7Z G;  1GD7 A;  2JA6 B;  2R92 H;  1HCZ A;  2CVR A;  3HOU G;  1V8Q A;  1TWG B;  1SJH D;  5GRO A;  1LYL A;  2J7Z A;  2XRS D;  1VQ4 A;  4RGN A;  3L3O C;  3BZC A;  4LF4 Q;  1CZG A;  3Q23 A;  5ELB A;  3I4M H;  1I94 L;  3A5U A;  1T5E A;  3S1M H;  3S16 B;  4IUR A;  3TRE A;  4DAP A;  3M3Y H;  4JK1 C;  3DEO A;  1EWI A;  3NPP A;  2Z4I A;  1STH A;  2KCC A;  3C1E A;  1K0S A;  3TP7 A;  1A15 A;  2Z8L A;  1TII D;  1VF7 A;  2Z1C A;  2L12 A;  3GDE A;  3FKI B;  1K8A C;  4KV6 A;  3HOV H;  3S17 B;  3PUX A;  1VQ8 A;  1LT3 D;  5C44 G;  4R8I A;  1K73 C;  3VYT A;  5IP7 G;  4IFD G;  2F0T A;  1PRT F;  1STY A;  2Z6K A;  1EYA A;  3OW7 A;  1DD2 A;  3E3X A;  2EZV A;  5G3L D;  3VYR A;  3H91 A;  3LWE A;  4DUY Q;  4DV4 Q;  1EL0 A;  1EY4 A;  1VQG A;  2XWJ B;  3H3V C;  3GTP B;  3MVV A;  3EQL C;  4Y52 H;  1LT6 D;  1EOV A;  2K4K A;  4F87 A;  1PH4 A;  5DM6 3;  1STB A;  4YWM A;  1ICW A;  3CCM A;  1TWA B;  5C3E B;  1E7Z A;  5K36 H;  2B29 A;  3FVQ A;  1K9M C;  4FO2 A;  4DR7 Q;  1BBX C;  1DOL A;  3T16 A;  1YJW A;  4LWC A;  2KQ3 A;  4X62 L;  4NDX A;  3FPU B;  5EQ0 A;  4BXX H;  1ZKO A;  4C2M B;  3GTJ H;  2NN6 H;  1GOZ A;  4DV3 L;  4WJ4 A;  1PTO B;  3MC0 B;  2UXB L;  1B50 A;  4ZAI A;  5M5X B;  3BG3 A;  2E2J B;  1EIH A;  1RL2 A;  4C3H G;  5L37 A;  5KYI A;  5IE8 A;  2NVX B;  2KUM A;  4X64 Q;  1AZP A;  1YNN D;  1ILP A;  1K8O A;  2E74 C;  4YY3 Q;  3FRP B;  2K7V A;  5EKI A;  4F8M A;  1CTM A;  4PMC A;  1RF2 D;  1LTA D;  2CW0 D;  4HID A;  1OXU A;  4LF5 L;  2F0O A;  3EBE A;  3ITP A;  4GN4 B;  4H7B A;  1B7Y B;  2AUK A;  3CRL C;  1E22 A;  2MO0 A;  2PQA B;  1SNO A;  1TY0 A;  3GTM B;  1R4P B;  2WFW A;  3MEH A;  5M3M H;  2OEO A;  5F2D A;  4DAV A;  1OXV A;  1JWS D;  4WJ3 M;  3RZD H;  1YJ9 A;  4C3I G;  4BY7 G;  1F9R A;  3I4N H;  4FXG C;  4KJO A;  2B2T A;  2F0U A;  2E5L Q;  5M3F H;  5JJZ A;  2XRQ D;  1EU3 A;  3S15 H;  3TP5 A;  3EJI A;  4KHV A;  2J0T D;  1I6V C;  3SR1 A;  1IYJ B;  5CC4 A;  2IX0 A;  4A3J G;  5A35 A;  4QGU A;  1SBB B;  2CCZ A;  2CFM A;  4FF2 A;  2B2Y A;  1E0B A;  4KD4 A;  3CCR A;  4GOP C;  2BE5 C;  4FF4 A;  1SMY D;  3RZO B;  2NYZ D;  2IX1 A;  4TQU S;  3NQI A;  1STG A;  4CKC A;  3CU7 A;  1ZYR D;  2RKS A;  2CWP A;  4V19 0;  5IP9 H;  3GTL H;  4A3D B;  4EVO A;  3J7Y W;  4XXE A;  2PW5 A;  2ZXR A;  5D14 A;  2HIX A;  2O5I C;  4DV4 L;  4DUY L;  2ENB A;  1G6Z A;  3UE1 A;  3EIV A;  2VUM G;  1EFW A;  5ISR A;  4QIW E;  2N49 A;  1ESR A;  2F0D A;  2QKI C;  3Q0A A;  4G7O C;  2F0V A;  1NNX A;  2H1E A;  4A3F G;  4DNI A;  1VCI A;  3CW2 C;  2I46 A;  4OO1 G;  3CCJ A;  4A3E G;  3D0F A;  4B9X A;  2YTY A;  5KNC A;  1PH6 A;  1JJ2 A;  4KY6 A;  5HUR A;  1XMO L;  4KN7 C;  4A3I G;  2A6E D;  1NMF A;  3I73 A;  4N9T A;  1JCK B;  4X3K A;  3P20 A;  1F9Q A;  2EIF A;  2LKV A;  4GLV B;  2B2W A;  4HJ8 A;  2QEJ C;  4NP5 A;  1UUP A;  3S1R H;  1VQJ A;  3NTI A;  1F77 A;  3HOU B;  4X64 L;  1N34 L;  3GTQ H;  4YWL A;  3T53 B;  5I2Y A;  4YY3 L;  1LT4 D;  1DJR D;  5JVG 3;  3Q22 A;  3H0G B;  5J1Z A;  2HD3 A;  1BUV T;  1DCZ A;  4LK1 C;  4IQZ A;  2K03 A;  1B2T A;  1HZ9 A;  1AP0 A;  4CDD C;  4IUV A;  4JI4 L;  1ESF A;  1LAC A;  3MXP A;  1CHP D;  2D0P A;  4KY5 A;  2UUA Q;  4HSV A;  4GLA C;  1C7Y A;  2E5L L;  4BY1 B;  4V0B A;  5EJW A;  3C2P A;  1SYE A;  2EY2 A;  2AWO A;  4AH6 A;  4DR6 Q;  2EXD A;  1SDF A;  4O2D A;  3A8I E;  2CQO A;  1E24 A;  5AJ3 Q;  5E1F A;  1VDZ A;  3GTO H;  4A93 H;  1JJG A;  2HT1 A;  1CI3 M;  3BJU A;  4ID6 A;  4GKJ Q;  1GUT A;  2Q2H A;  3L0O A;  3QJY A;  3OWE B;  4AQY Q;  3PUZ A;  3S2H H;  2DNC A;  4YCU A;  1JIC A;  4CJ2 C;  3QG1 A;  4EQ5 A;  4R9W A;  2ZT9 C;  3F2B A;  4FP5 D;  3S2D B;  1KLG D;  1H95 A;  4BBR H;  3E5S A;  4K8I A;  1WFQ A;  2CKZ B;  2R7Z H;  2OQK A;  4ODG A;  5CV5 A;  1YIT A;  3TN2 A;  4BBS G;  1N8R C;  2WAQ G;  1G29 1;  1PFB A;  5IGE A;  4J8Q A;  1X3P A;  4JI8 Q;  5J3B A;  4LF8 L;  1L0W A;  4H13 C;  3VR6 A;  4QUC A;  4HED A;  1E1T A;  2F0L A;  2WIN B;  2X6L A;  4C3H B;  2CHB D;  4HN7 A;  1O80 A;  3JC6 6;  2R92 G;  1E2W A;  1V9P A;  1W6K A;  1V1Q A;  1A3T A;  3PIO A;  3HOX B;  2EE1 A;  4DR4 Q;  4ME3 A;  3I4L A;  1SYG A;  1X65 A;  3TBI B;  1TWF B;  2MHV A;  2RHQ B;  5GAG C;  4LFC Q;  3S14 B;  1N36 Q;  2PYK A;  3I4O A;  2QGQ A;  2VS1 A;  3HKZ E;  3CPF A;  1KNE A;  2P5Z X;  1MKH A;  2NZ1 D;  5C44 H;  4HTH A;  3ERQ A;  5IP7 H;  4IFD H;  1H9J A;  4AIM A;  4CKE A;  2F0G A;  3PIO 3;  1ET9 A;  4LFB Q;  1NSN S;  1UE6 A;  4C3I B;  3A7L A;  3F2C A;  4C1N I;  1K3R A;  1D2B A;  2BOS A;  4BA1 I;  3KFU A;  4LF9 L;  2AQ1 B;  1Q1B A;  3KOJ A;  1MI2 A;  2Y0S B;  1Y1V H;  4QUF A;  3AFQ A;  1ONL A;  3IFT A;  1SRU A;  2EQS A;  1Q8K A;  4KK7 A;  4A3J B;  1ROD A;  3RLO A;  1VQO A;  2B8F A;  3K81 C;  1QWY A;  3CXC A;  1A2U A;  2VW9 A;  1HPC A;  1PV4 A;  3R2I A;  4J6H A;  1PYS B;  4A3L H;  4JV5 Q;  2UUA L;  1Z7T A;  2JSO A;  1HA5 A;  5JPN C;  1KLU D;  2LXJ A;  1LV9 A;  1LLR D;  1CFM A;  2A6H D;  1SE3 A;  3K5L A;  5K36 G;  4WFN 3;  4DR6 L;  2F0Q A;  1X3E A;  1XMQ L;  1XTC D;  4J15 A;  2HQL A;  1EY5 A;  5AJ3 L;  4DK1 A;  4WJW A;  3CRK C;  1U9R A;  1BBW A;  4KKS A;  4BXX G;  4O1N A;  2VUM B;  1QB5 D;  4E6I A;  2A74 C;  3J80 c;  1H9R A;  3D3R A;  4JI0 Q;  4GKJ L;  4KLK A;  4QY7 A;  4AQY L;  1I4H A;  3CQZ B;  1IYV A;  1NCV A;  4IPH A;  3J81 i;  5CV6 A;  3AMU A;  1BBU A;  2K5H A;  1PH9 A;  2B3G A;  2ASB A;  3D6C A;  2B2U A;  1SNC A;  4ABN A;  4BY7 H;  4FXK C;  2ZJQ A;  4NB3 A;  1NJI C;  4A3E B;  1VF5 C;  1HA6 A;  1B3A A;  4A3G B;  1PMR A;  3CCU A;  4DU9 A;  1IKL A;  1VQA A;  5IGD A;  5CR3 A;  4JI8 L;  1IXR A;  3URY A;  1JQY D;  1O7I A;  5EBD A;  5CBE E;  1PTO F;  1B70 B;  4CDE C;  1VS0 A;  4X65 L;  3ERS X;  1X56 A;  1SE4 A;  4JBJ A;  5D3I B;  2ZXO A;  1K28 A;  2KEC A;  5M3F G;  4AYB G;  4JVZ A;  4GN3 B;  1MSG A;  4QB4 A;  4B08 A;  2RDG A;  3HOY H;  2YTX A;  1N33 L;  2PNR C;  1N36 L;  1TWH H;  5C4X B;  3PO3 G;  1YEZ A;  1MHW C;  2E76 C;  3X3M A;  3KLS X;  1JE5 A;  2JA9 A;  1QIL A;  3KF6 A;  3NWT A;  5D65 A;  4KHZ A;  2JE6 I;  4IOC A;  1Y14 B;  1K0R A;  4JOI A;  2UUB Q;  2I5M X;  4M1U B;  1I50 H;  2R93 H;  1VQI A;  1YHA A;  2K5D A;  2PO4 A;  3KDF A;  3R3O A;  4Y7N B;  3T13 A;  1Q86 C;  1RTN A;  4F88 A;  4DAY A;  2FMC A;  5IGC A;  2BH2 A;  3OTO L;  5DNF A;  1FYC A;  4A3F H;  2EYL A;  1D5Z C;  2MP1 A;  3JAM L;  2A69 D;  1J6Q A;  5KNB A;  3TDQ A;  1K8G A;  2QDB A;  2F3V A;  1CKN A;  2KCT A;  5CGK A;  2EYP A;  1BQQ T;  2NZH A;  5G3L F;  1I94 Q;  2OTL A;  4JI5 Q;  3HOZ G;  4JV5 L;  3ZJY C;  1YNJ D;  1JOR A;  4DUZ Q;  3D4W A;  2HHH Q;  4A3I H;  3L7Z C;  1VQ9 A;  5IYB G;  2NVY B;  1T9H A;  1KDC A;  5EKL A;  1EYD A;  4DNT B;  1IW7 D;  1PH7 A;  2A73 B;  4DR3 L;  2JA7 H;  3OWF A;  1TY2 A;  2K5N A;  1EWC A;  1ML0 D;  4P75 A;  2ZM6 Q;  3G6J B;  1SYB A;  3NE5 B;  4JI0 L;  1SNP A;  4MNO A;  2UXD L;  4RAU C;  2R92 B;  3ULL A;  3TP8 A;  2H5X A;  3T4A C;  1PH3 A;  2VY3 A;  1F2L A;  1CUK A;  1WCM G;  2F4I A;  2KA7 A;  1U0L A;  4GNX A;  2JQO A;  1HR0 Q;  1HNW Q;  1X3G A;  1H9S A;  3KJO A;  1HHV A;  2MJ8 A;  4L5T A;  3I4M B;  4IPD A;  3OIQ A;  2B39 A;  3S1M B;  3M3Y B;  3MHB A;  3CCQ A;  3S24 A;  2CH4 W;  1NAP A;  2OF1 A;  3T56 B;  1Q7Y C;  1Q3L A;  3SK8 A;  2HCI A;  1CZW A;  1QJO A;  3GQB A;  2ZTE A;  4DPG A;  2K28 A;  1KAA A;  4HJ9 A;  1PTO C;  4OXP A;  3KF6 B;  5BN3 A;  3J7A F;  3RR5 A;  1HNZ L;  3HOV B;  1LTI D;  4FYD A;  2F0K A;  1MGS A;  4DV6 Q;  1MIU A;  4OIJ A;  2UXB Q;  4RGM A;  5CV9 A;  3IFD A;  5I9P A;  4DN4 M;  2Z4H A;  1L2F A;  3STB D;  3ULP A;  3KDF B;  1XJV A;  4A3C G;  2YU9 H;  3I90 A;  5GAD C;  2E2H H;  4DAY B;  1L1O A;  3G6E A;  2RDF A;  2UU9 Q;  1CHQ D;  4BBS H;  4JC0 A;  2UUB L;  5I2X A;  1CKN B;  2LMC B;  5IYD H;  2I0Q A;  2TMP A;  3G7L A;  2IW3 A;  3MXG A;  4BBR G;  2FMM A;  1VQD A;  1ASY A;  2ZXP A;  3F8T A;  3BVM A;  3SK4 A;  2NVT B;  2D9U A;  1QG7 A;  4G7Z C;  4C3J G;  3OYY A;  4EGV A;  1R4Q B;  3GTJ B;  3ER0 A;  1F2Z A;  1IL8 A;  4TSS A;  1QVF A;  3PQI A;  4FNF A;  5EKK A;  4JPB W;  4JI5 L;  1SNM A;  3DWQ A;  1YHB A;  5IY0 A;  4G4K A;  1DXM A;  2Z6K C;  1NY4 A;  3K80 C;  4DUZ L;  2HHH L;  3VDY A;  2PNH A;  1PFS A;  1W6J A;  5K5P A;  1EIG A;  2E75 C;  4RFB A;  3K0X A;  4DV5 Q;  1OXS C;  3TEH B;  4DXF A;  1VQF A;  4Z9C B;  2C35 B;  1KDA A;  4RHS A;  1VQ6 A;  3EFX D;  4X3U A;  1U5K A;  4U68 A;  2Z9H A;  4RKL A;  3K57 A;  1JC7 A;  1G2S A;  1TWC H;  4GNX B;  4EX5 A;  2B63 H;  3PUY A;  1H9S B;  2ZM6 L;  5NUC A;  4IFD J;  5M3M B;  3DM1 A;  3KUP A;  2MO1 A;  1PH8 A;  2I5L X;  1PHJ A;  3RZD B;  2Z6B A;  3DHQ A;  1B53 A;  1WTP A;  2MUY A;  3I4N B;  3A56 A;  1IBL L;  1TT2 A;  5FLX E;  2XNA C;  3J80 i;  5M3F B;  2M9V A;  1R9T H;  3C3L A;  1U4M A;  4ILW A;  2SEB D;  1HR0 L;  3S15 B;  1HNW L;  1N9W A;  1OO9 B;  1RIP A;  1Y1V G;  2Z0S A;  4R4Q A;  3D31 A;  4GZY C;  1IYU A;  1WYD A;  3DWA A;  3I7F A;  2RDH A;  1XNQ Q;  4KKU A;  3PUW A;  1C9O A;  4K5V A;  3K7U C;  3MXN B;  3NHH A;  2CW0 C;  4XQN A;  2L55 A;  1IBK Q;  3MXU A;  2EJF C;  1Q90 A;  1FVI A;  2EYM A;  1D1I A;  1VQM A;  4A3L G;  1E1O A;  3B6Y A;  1L1O B;  1DOM A;  1E3P A;  1XMO Q;  4FDB A;  4DV6 L;  2F0P A;  3AQQ A;  3LWU A;  1I4P A;  1WTX A;  5HGT A;  3GTL B;  1N34 Q;  2JA8 H;  1I5F A;  1YVC A;  5C5M A;  1D5M C;  2WP8 J;  2AKW B;  2UU9 L;  1FD7 D;  1J5E Q; 
#chains in the Genus database with same CATH homology
 2L0C A;  3NWS A;  3QO2 A;  4R8N A;  1BXT A;  4L6T B;  1RHP A;  3OIP A;  3D6W A;  1SMY C;  2B2Y C;  3A8K E;  5KIX A;  2L1B A;  4RCN A;  2K04 A;  1AW7 A;  1UEA B;  4HMI A;  2EJG C;  4OHJ A;  1ZYR C;  5CMD A;  2FIN B;  4C56 C;  3S1R B;  1C8C A;  3GTQ B;  2WB1 B;  3BDL A;  1NR2 A;  4PMB A;  3J7A V;  4RH6 A;  5ELD A;  2PMZ B;  2F0E A;  1PRT C;  1BDO A;  1O7Y A;  1S5B D;  2A5H A;  4IUT A;  2A6E C;  4OIK A;  1BOS A;  2B2W C;  3GTO B;  4A93 B;  3GV3 A;  2NTS A;  3IAY A;  2I07 B;  3ONA B;  1WVL A;  1Q8I A;  3S2H B;  4DXG A;  3HS0 C;  2O2L D;  2B2V C;  4BBR B;  4IFD I;  4KMU C;  2DY7 A;  5C3X A;  2R7Z B;  3GD7 A;  3HRZ C;  2G9D A;  2F0I A;  5T1G A;  5IOD A;  4NKL A;  2L4N A;  5FO9 B;  1O78 A;  4M8A A;  4Q5V A;  1A6X A;  3RLF A;  4KD3 A;  3R93 A;  3BVG A;  1BF4 A;  5BN4 A;  3AU7 A;  3J81 L;  5C44 B;  3Q6S A;  5IIF A;  3BZD B;  4DA2 A;  5J39 A;  3NUC A;  2HQE A;  1HTP A;  3R2T A;  3K58 A;  1HRJ A;  4MN3 A;  2DY8 A;  2WKD A;  2VXW A;  4FVM A;  1TQO A;  1IKM A;  1Y1V B;  2HUG A;  1PDQ A;  3MA2 B;  2K6A A;  2A68 D;  2PPB C;  3MZ5 A;  1PFM A;  1UAP A;  1AEX A;  2RSN A;  2NUC A;  4IN3 A;  3BDO A;  1A3U A;  2EXZ A;  5C5L A;  2JEB I;  2Q8T A;  3QWN A;  1WD0 A;  5I9O A;  3H94 A;  2QCP X;  1PLF A;  5JPM C;  1D1K A;  4KTA A;  5JEA H;  3NXW A;  2QF7 A;  4WOR A;  3KBX A;  1TS2 A;  2EOT A;  5I4D A;  4HR7 B;  2E2D C;  5LL6 S;  1EU4 A;  2NBF A;  5KEE A;  1PFN A;  2EPB A;  1FR3 A;  3BYT B;  1JOQ A;  1EEF D;  1II3 A;  3DXJ C;  4BY7 B;  4Q0F A;  5CV8 A;  1HXY D;  3J81 E;  2A6H C;  3C46 A;  1EWH A;  1Q1E A;  3TP6 A;  3D4D A;  3F2U A;  1KDB A;  5LHY 1;  5C4Z A;  1F2Y A;  1RKN A;  4OO1 I;  2SNS A;  3EVQ A;  3HG9 A;  3HOY B;  1KNA A;  1S4Z A;  1EZ6 A;  1TWH B;  2NB0 A;  3SDZ A;  5I6W A;  5C0X G;  1S5D D;  1CQF A;  3I70 A;  2RVL A;  3A55 A;  1SNQ A;  3IKJ A;  2RSO A;  1CQV A;  3ND8 A;  3O13 A;  4CKB A;  4MHE A;  1I50 B;  3NP8 A;  2R93 B;  1CK1 A;  3GV6 A;  4K5X A;  1EY9 A;  4A3F B;  2F0F A;  4DNR B;  1PXU A;  1Y8N B;  1BNZ A;  5E4X A;  1TS3 A;  4A3I B;  4IUU A;  2ID0 A;  3V96 A;  5KYL A;  1GUS A;  2EJM A;  3K5M A;  2XN9 C;  4DF7 A;  2XVS A;  3MFY A;  3V05 A;  2JA7 B;  3SXH A;  3BYY B;  4N9P A;  5EPL A;  2FHT A;  2KJX A;  3BS1 A;  4K6L A;  3W3A A;  1B1Z A;  1B9N A;  1ENC A;  1X32 A;  3R8B A;  2A69 C;  3BDC A;  2F3W A;  2IT1 A;  1SYC A;  1GUG A;  1AFP A;  1DOK A;  1EEI D;  1JWU D;  1Y69 U;  1O7L A;  3Q24 A;  4CBV A;  2TSS A;  4C1N K;  4RWS C;  1ZXT A;  1EQV A;  2PZT A;  1EY7 A;  1DON A;  3PIP 3;  1EY8 A;  2C9O A;  1SAP A;  3KK7 A;  1B44 D;  4HMJ A;  1SYD A;  2EY5 A;  1S5F D;  1WTW A;  4DFA A;  2JYO A;  1PYW D;  3VA7 A;  3OOC A;  1BCP D;  4UDU C;  3A7A B;  4RHR A;  2YU9 B;  2E2H B;  2G9H D;  2L5T A;  3MWY W;  3ERO A;  3M7G A;  4BBS B;  2C5C A;  2WAQ B;  2O5J C;  1CA6 A;  4HCS A;  2IL8 A;  2WKC A;  4IUQ A;  1SE2 A;  1F2M A;  5DEH A;  2PZU A;  1U4L A;  1C48 A;  2F0J A;  1CT1 D;  2OXP A;  5EPJ A;  1Y8P B;  1WTO A;  5KGU A;  3HEJ A;  1EZ8 A;  1PZK D;  3VYS A;  1J9O A;  2VNU D;  3K6O A;  1AN8 A;  1TWC B;  1B4O A;  2NN6 I;  2B63 B;  5FLX L;  1S5E D;  2X6G A;  1HQM C;  1SSO A;  1SJE D;  4X3S A;  5CBA E;  1XX8 A;  4XT3 B;  1XWE A;  3CKI B;  2HDL A;  1R9T B;  4UAI A;  4WRD A;  1H9M A;  1E2Z A;  3P7J A;  4BWG B;  2YYZ A;  3HGB A;  3J80 E;  1BCP B;  3KLR A;  5COR A;  1J8I A;  5IOC A;  2AUJ D;  2L9H A;  2DN8 A;  5KRU A;  2V4D A;  3I91 A;  1KTK A;  4HSP A;  2HDM A;  1U4R A;  1RTO A;  1HUN A;  1MD2 D;  1ZEQ X;  5JEA G;  4CHT B;  3FEW X;  3OPO A;  3QOL A;  5FK9 C;  3NTK A;  1A2T A;  5ELE A;  1BO0 A;  2Q8I B;  1PZI D;  3SK6 A;  2WV6 D;  4RGT A;  4XTC S;  2Q8R E;  1QNK A;  2OT2 A;  3TME A;  4BS9 A;  2IWH A;  1SFO B;  1C4Q A;  3S1N B;  4BA2 I;  4AYB B;  1SND A;  3SHL A;  4HAE A;  1D5X C;  2PZW A;  3HP3 A;  4O42 A;  4QCL A;  1U4P A;  3KLS A;  3PO3 B;  5C0X H;  1YNN C;  5M9O A;  1ILQ A;  2KVM A;  3K5N A;  5FKA C;  4PV1 C;  1H9K A;  1ENA A;  4NW2 A;  3H6M A;  1GJX A;  2XSC A;  1VMP A;  2EYJ A;  5EPK A;  1IHZ A;  3L9A X;  4QMG A;  4CJ1 B;  2ICI A;  1EY6 A;  2MGS A;  3UI2 A;  4K14 A;  3AB9 A;  3E6Z X;  2LFN A;  4EQO A;  4K2K A;  4XT1 B;  2B2T C;  5I6Y A;  3I72 A;  4ZUJ A;  5C4J B;  4TKO B;  1FGB D;  3OMC A;  4ZKB B;  2PCF B;  2GA4 B;  3T51 B;  3D8G A;  3HOZ B;  4G57 A;  2SOB A;  2PW7 A;  4DGZ A;  1JR0 D;  2MPM A;  2VB3 X;  2JXM B;  1K8M A;  2F03 A;  4JBW A;  1CA5 A;  1JE4 A;  1STN A;  2N55 A;  3VYU A;  5DM7 3;  4X3T A;  3TSS A;  1HFN A;  1HUM A;  4TRD A;  1QOH A;  3IL8 A;  1WD1 A;  1Z6H A;  3NBH A;  1V43 A;  5IGB A;  2KEE A;  3VA5 A;  1WTQ A;  2H4O A;  1STE A;  5C4H A;  2KED A;  1WCM B;  1TS5 A;  1TS4 A;  1B9M A;  3A8J E;  3TZD A;  5C6A A;  2F1M A;  4LJZ C;  2E2I B;  3FDT A;  1JB3 A;  4MIU A;  2EYO A;  2VB2 X;  1I6H B;  5E4W C;  3SEB A;  4KY7 A;  2EYF A;  4A3B B;  2LS0 1;  4KJN A;  3TZU A;  1LTS D;  1PTO H;  5ELF A;  1LO5 D;  2F0M A;  1S5C D;  2D5D A;  2J4X A;  3HZX A;  2M2L A;  3C1F A;  4EQN A;  3V2T A;  1RCV D;  3NQT A;  3K5O A;  1WTR A;  1MBY A;  4CJ0 B;  3WDN A;  1L0X B;  5EBC A;  2BE5 D;  1T5X D;  1GUW A;  1DM0 B;  2EVB A;  3GTG B;  1FNW A;  5LL6 X;  2SNM A;  3RMH A;  4ULL A;  2CQA A;  2NWG A;  4IAL A;  3RUZ A;  4ZUI A;  3D4R A;  3VR4 A;  4C3J B;  1PRT D;  3SVM A;  1QNU A;  1DZ1 A;  1V1P A;  2EDG A;  3M7N A;  5TSS A;  2LY7 A;  3SK5 A;  3PMF A;  3OHX C;  4IUP A;  3NBI A;  4YIJ A;  3M85 A;  3DMU A;  3X3N A;  4ZRZ A;  1WTV A;  5J22 A;  2EY6 A;  2ICE C;  4PQX A;  3N52 A;  3KF8 A;  3I3C A;  2FFK B;  1GHJ A;  2A68 C;  4L8J A;  1SYF A;  5COY A;  2B2V A;  4I7Z C;  4DK0 A;  2B8G A;  1STA A;  1LAB A;  4RA8 A;  3QIA A;  2RQX A;  2D62 A;  1G91 A;  1GUN A;  5JVH 3;  5DAU A;  3DUZ A;  2D2C C;  2K05 A;  4OGQ C;  3VR2 A;  2WII B;  2XIW A;  1GXD C;  3K59 A;  2EY1 A;  1I4R A;  2K5Q A;  2DNE A;  1DYQ A;  1LTG D;  3EA6 A;  5IGF A;  1JWM D;  1LTB D;  1OXT A;  2N88 A;  1FNV A;  1RD9 D;  1ET6 A;  3NSW A;  2K33 A;  1F9S A;  2NVQ B;  3A54 A;  1I3Q B;  2K1B A;  3DWP A;  4LAA A;  2R3Z A;  2KOL A;  5C3W A;  1PRT B;  5T1I A;  2RBM A;  2K01 A;  1V1P B;  3M4Y A;  4U67 3;  3LNN A;  5EGT A;  4XIG S;  3N6R A;  4A3K B;  4F7X A;  1GUO A;  2KCN A;  1M8A A;  1BCP F;  3QOJ A;  1A3V A;  3MAQ A;  1EY0 A;  1TVX A;  2K5W A;  4QF4 A;  1Q12 A;  2NTT A;  1EYC A;  2JP1 A;  4IUN A;  4ZYS A;  4B9W A;  4PNY A;  1I4G A;  3KBG A;  1Z47 A;  4QIW B;  2SDF A;  1L0Y B;  3P1H A;  5FOB B;  2AWN A;  4FXD A;  4IZ8 A;  3S9W A;  1O7Z A;  5BN5 A;  5C0X J;  5M5W B;  2WAC A;  5A2Q L;  2B2U C;  2RA4 A;  1RDP D;  1E2V A;  4XQJ A;  4XYO A;  1QCB D;  1AZQ A;  3SE0 A;  3K7A B;  3BVZ A;  5IT9 L;  1M4V A;  1ENF A;  4H44 C;  3GTK B;  4ZK9 B;  1I4Q A;  3H09 A;  3VR3 A;  1I4X A;  1QE6 A;  3QB3 A;  5CV4 A;  1CM9 A;  4NMZ A;  5FO7 B;  4KN4 C;  4A3M B;  5M5Y B;  2AQ2 B;  2NN6 G;  4XQQ A;  2AQ3 B;  3HOW B;  3GO5 A;  2O4X A;  1RJT A;  1SXT A;  3M4O B;  4RCO A;  4RKB A;  2QIL A;  5JOB A;  4J1M A;  4K6D A;  1LTR D;  2HCC A;  4P2C B;  5E3F A;  1JOK A;  4ZLT F;  2FJ2 A;  1XXG A;  2BDO A;  1NUC A;  1G8Z D;  1TU2 B;  2K32 A;  3PV0 A;  1YNJ C;  2IJ0 A;  4K2L A;  5A2Q E;  1BCP C;  1JOO A;  2F0H A;  2JEA I;  3P75 A;  1NR4 A;  4CGY B;  1IW7 C;  2L11 A;  3I8Z A;  5KND A;  4L63 B;  3ZYY X;  5AFW A;  1SEB D;  4K8J A;  5IT9 E;  1HQR D;  2F0W A;  4KI0 A;  4PMW A;  1X3Q A;  1TR5 A;  3K0Y A;  1KAB A;  2IPK D;  3PUV A;  4K5W A;  1EQT A;  3HKZ B;  3J80 L;  4OO1 H;  2BA0 A;  2R61 A;  1VMC A;  3LX0 A;  5IGG A;  3ND9 A;  4FF1 A;  3U9S A;  1HTL D;  2EYH A;  2BCO A;  2KHS A;  1PZJ D;  3E0J A;  1XYI A;  4RGO S;  1UNS A;  4HCE A;  4FF3 A;  1D6E C;  5CYU A;  5C0X I;  2F0S A;  3OMG A;  1EFI D;  3CHB D;  1BR9 A;  2F0N A;  2JA5 B;  4G7H C;  5D3D A;  1K83 B;  4ZKC B;  3PO2 B;  1V1O A;  4I65 A;  5CV7 A;  3MTS A;  1GHK A;  4OL7 A;  4LMQ D;  3FPP A;  4ME5 A;  3NK9 A;  4S3S A;  1FNU A;  1TKW B;  3WOF A;  2XWB B;  3MFG A;  3VR5 A;  1F9P A;  3FMC A;  5JAV A;  3W2D A;  1OXX K;  3DEP A;  1G2T A;  1LTT D;  2M00 A;  3RD4 A;  5FO8 B;  3WOE A;  3MXN A;  2R6G A;  4ZQ3 A;  3JAM E;  2PQE A;  2IX3 A;  1LT5 D;  1Y8O B;  4KKT A;  4XYQ A;  1Y1W B;  2BA1 A;  1MSH A;  2BDN A;  2X69 A;  3GP7 A;  4XDX A;  4EQP A;  1EOT A;  1PTO D;  3U9O A;  3OSO A;  5JEA J;  1HFG A;  3NTH A;  3S1Q B;  5ELC A;  4H0L C;  2JA8 B;  2JA6 B;  1HCZ A;  2CVR A;  1V8Q A;  1TWG B;  1SJH D;  2J7Z A;  2XRS D;  4RGN A;  3L3O C;  1CZG A;  3Q23 A;  5ELB A;  1T5E A;  3S16 B;  4IUR A;  4DAP A;  4JK1 C;  3DEO A;  3NPP A;  2Z4I A;  1STH A;  2KCC A;  3C1E A;  3TP7 A;  1A15 A;  2Z8L A;  1TII D;  1VF7 A;  2Z1C A;  2L12 A;  3FKI B;  4KV6 A;  3S17 B;  3PUX A;  1LT3 D;  4R8I A;  3VYT A;  4IFD G;  2F0T A;  1PRT F;  1STY A;  1EYA A;  3OW7 A;  1DD2 A;  2EZV A;  5G3L D;  3VYR A;  3H91 A;  3LWE A;  1EL0 A;  1EY4 A;  2XWJ B;  3H3V C;  3GTP B;  3MVV A;  3EQL C;  1LT6 D;  4F87 A;  5DM6 3;  1STB A;  1ICW A;  1TWA B;  5C3E B;  5K36 H;  3FVQ A;  4FO2 A;  1BBX C;  1DOL A;  3T16 A;  2KQ3 A;  4NDX A;  3FPU B;  5EQ0 A;  1ZKO A;  4C2M B;  2NN6 H;  1GOZ A;  1PTO B;  3MC0 B;  1B50 A;  4ZAI A;  5M5X B;  3BG3 A;  2E2J B;  1EIH A;  4C3H G;  5KYI A;  2NVX B;  2KUM A;  1AZP A;  1YNN D;  1ILP A;  1K8O A;  2E74 C;  3FRP B;  2K7V A;  5EKI A;  4F8M A;  1CTM A;  4PMC A;  1RF2 D;  1LTA D;  2CW0 D;  1OXU A;  2F0O A;  3ITP A;  4H7B A;  2AUK A;  3CRL C;  1SNO A;  1TY0 A;  3GTM B;  1R4P B;  3MEH A;  2OEO A;  5F2D A;  4DAV A;  1OXV A;  1JWS D;  4C3I G;  1F9R A;  4FXG C;  4KJO A;  2B2T A;  2F0U A;  5JJZ A;  2XRQ D;  1EU3 A;  3TP5 A;  3EJI A;  4KHV A;  2J0T D;  1I6V C;  3SR1 A;  5CC4 A;  2IX0 A;  5A35 A;  1SBB B;  4FF2 A;  2B2Y A;  1E0B A;  4KD4 A;  4FF4 A;  2BE5 C;  1SMY D;  3RZO B;  2NYZ D;  2IX1 A;  4TQU S;  3NQI A;  1STG A;  4CKC A;  3CU7 A;  1ZYR D;  2RKS A;  4V19 0;  4A3D B;  4EVO A;  3J7Y W;  4XXE A;  2PW5 A;  2ZXR A;  5D14 A;  2O5I C;  1G6Z A;  2ENB A;  5ISR A;  1ESR A;  2F0D A;  2QKI C;  3Q0A A;  4G7O C;  2F0V A;  2H1E A;  1VCI A;  2I46 A;  4OO1 G;  4B9X A;  5KNC A;  4KY6 A;  5HUR A;  4KN7 C;  2A6E D;  3I73 A;  4N9T A;  1JCK B;  4X3K A;  3P20 A;  1F9Q A;  2LKV A;  2B2W A;  2QEJ C;  4NP5 A;  1UUP A;  3NTI A;  1F77 A;  3HOU B;  3T53 B;  5I2Y A;  1LT4 D;  1DJR D;  5JVG 3;  3Q22 A;  3H0G B;  5J1Z A;  1BUV T;  1DCZ A;  4LK1 C;  4IQZ A;  2K03 A;  1B2T A;  1AP0 A;  4IUV A;  1ESF A;  1LAC A;  3MXP A;  1CHP D;  4KY5 A;  4HSV A;  4BY1 B;  4V0B A;  5EJW A;  3C2P A;  1SYE A;  2EY2 A;  2AWO A;  1SDF A;  3A8I E;  5E1F A;  1VDZ A;  1CI3 M;  4ID6 A;  1GUT A;  3QJY A;  3OWE B;  3PUZ A;  2DNC A;  1JIC A;  4CJ2 C;  3QG1 A;  4R9W A;  2ZT9 C;  4FP5 D;  3S2D B;  1KLG D;  3E5S A;  4K8I A;  4ODG A;  5CV5 A;  3TN2 A;  1G29 1;  1PFB A;  5IGE A;  4J8Q A;  1X3P A;  4H13 C;  3VR6 A;  4QUC A;  4HED A;  2F0L A;  2WIN B;  2X6L A;  4C3H B;  2CHB D;  4HN7 A;  1O80 A;  1E2W A;  1W6K A;  3HOX B;  1A3T A;  2EE1 A;  3I4L A;  1SYG A;  3TBI B;  1TWF B;  2MHV A;  3S14 B;  2PYK A;  1KNE A;  2NZ1 D;  4HTH A;  3ERQ A;  4IFD H;  1H9J A;  4CKE A;  2F0G A;  3PIO 3;  1ET9 A;  1NSN S;  4C3I B;  3A7L A;  4C1N I;  1D2B A;  2BOS A;  4BA1 I;  2AQ1 B;  1Q1B A;  1MI2 A;  2Y0S B;  4QUF A;  3IFT A;  1ONL A;  4KK7 A;  4A3J B;  1ROD A;  2B8F A;  1QWY A;  1A2U A;  1HPC A;  3R2I A;  4J6H A;  1Z7T A;  2JSO A;  1HA5 A;  5JPN C;  1KLU D;  1LV9 A;  1LLR D;  1CFM A;  2A6H D;  1SE3 A;  3K5L A;  5K36 G;  4WFN 3;  2F0Q A;  1XTC D;  1EY5 A;  4DK1 A;  4WJW A;  3CRK C;  1U9R A;  4KKS A;  4O1N A;  2VUM B;  1QB5 D;  4E6I A;  2A74 C;  1H9R A;  3D3R A;  1I4H A;  3CQZ B;  1IYV A;  1NCV A;  5CV6 A;  3AMU A;  3D6C A;  2B2U A;  1SNC A;  4ABN A;  4FXK C;  4A3E B;  1VF5 C;  1HA6 A;  1B3A A;  4A3G B;  1PMR A;  4DU9 A;  1IKL A;  5IGD A;  5CR3 A;  3URY A;  1JQY D;  5EBD A;  5CBE E;  1PTO F;  1SE4 A;  5D3I B;  2ZXO A;  2KEC A;  1MSG A;  4QB4 A;  4B08 A;  2RDG A;  2PNR C;  5C4X B;  2E76 C;  3X3M A;  3KLS X;  1QIL A;  3NWT A;  5D65 A;  4KHZ A;  2JE6 I;  4M1U B;  2K5D A;  2PO4 A;  4Y7N B;  3R3O A;  3T13 A;  1RTN A;  4F88 A;  4DAY A;  2FMC A;  5IGC A;  5DNF A;  1FYC A;  2EYL A;  1D5Z C;  2MP1 A;  3JAM L;  2A69 D;  5KNB A;  3TDQ A;  2QDB A;  2F3V A;  5CGK A;  2EYP A;  1BQQ T;  5G3L F;  1YNJ D;  1JOR A;  3D4W A;  3L7Z C;  2NVY B;  1KDC A;  5EKL A;  1EYD A;  4DNT B;  1IW7 D;  2A73 B;  3OWF A;  1TY2 A;  1EWC A;  1ML0 D;  3G6J B;  1SYB A;  3NE5 B;  1SNP A;  4RAU C;  2R92 B;  3TP8 A;  3T4A C;  1F2L A;  2F4I A;  2KA7 A;  1H9S A;  1HHV A;  2MJ8 A;  3I4M B;  3OIQ A;  2B39 A;  3S1M B;  3M3Y B;  3MHB A;  1NAP A;  2OF1 A;  3T56 B;  1Q3L A;  3SK8 A;  2HCI A;  1CZW A;  1QJO A;  3GQB A;  2K28 A;  1KAA A;  1PTO C;  5BN3 A;  3J7A F;  3HOV B;  1LTI D;  4FYD A;  2F0K A;  1MGS A;  4OIJ A;  4RGM A;  5CV9 A;  3IFD A;  5I9P A;  4DN4 M;  2Z4H A;  3I90 A;  2RDF A;  1CHQ D;  5I2X A;  2LMC B;  2TMP A;  3G7L A;  2IW3 A;  3MXG A;  2FMM A;  2ZXP A;  3BVM A;  3SK4 A;  2NVT B;  2D9U A;  1QG7 A;  4G7Z C;  4C3J G;  4EGV A;  1R4Q B;  3GTJ B;  1F2Z A;  1IL8 A;  4TSS A;  4FNF A;  5EKK A;  1SNM A;  3DWQ A;  4G4K A;  1DXM A;  1W6J A;  5K5P A;  1EIG A;  2E75 C;  4RFB A;  1OXS C;  4DXF A;  4Z9C B;  1KDA A;  4RHS A;  3EFX D;  4X3U A;  4U68 A;  4RKL A;  3K57 A;  1JC7 A;  1G2S A;  3PUY A;  1H9S B;  5NUC A;  4IFD J;  5M3M B;  3DM1 A;  3KUP A;  3RZD B;  3DHQ A;  1B53 A;  1WTP A;  2MUY A;  3I4N B;  3A56 A;  1TT2 A;  5FLX E;  2XNA C;  5M3F B;  2M9V A;  3C3L A;  1U4M A;  4ILW A;  2SEB D;  3S15 B;  1OO9 B;  3D31 A;  4GZY C;  1IYU A;  3DWA A;  2RDH A;  4KKU A;  3PUW A;  4K5V A;  3NHH A;  2CW0 C;  4XQN A;  2L55 A;  3MXU A;  2EJF C;  1Q90 A;  2EYM A;  1D1I A;  1DOM A;  2F0P A;  3LWU A;  1I4P A;  1WTX A;  5HGT A;  3GTL B;  5C5M A;  1D5M C;  2WP8 J;  1FD7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...