1QOHA

A mutant shiga-like toxin iie
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
ADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTIISNTCSSGSGFAEVQFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Mutant Shiga-Like Toxin Iie Bound to its Receptor Gb(3): Structure of a Group II Shiga-Like Toxin with Altered Binding Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN IIE B SUBUNIT
total genus 20
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qohA00
2XSCA 1QNUA 1C48A 1DM0B 1D1KA 4P2CB 1R4QB 2BOSA 1BOSA 1C4QA 2C5CA 3MXGA 1CQFA 1CZWA 2GA4B 1D1IA 4ULLA 1CZGA 1R4PB 1QOHA 4M1UB
chains in the Genus database with same CATH superfamily
1E7ZA 4G57A 3W1GA 5JVH3 4A3EB 4C56C 3RZDH 4DR7Q 3K5NA 1PHJA 3K7AH 3U4ZA 2AUJD 1TWCH 4C3HG 2A68C 4B9XA 5T1IA 2QEXA 3MXUA 2K05A 3KK7A 3TBIB 1EQQA 3GTMH 2ASBA 4C2MB 1B7YB 4HMJA 5IOCA 1EFID 1ENCA 2OXPA 1B9NA 3FHWA 5CV5A 1VCIA 4C1NK 1PH7A 2MFIA 1QVCA 2VB3X 4HJ7A 1PH3A 2VNUD 2JA8G 2WKCA 4POGA 4BXXG 2MJ8A 2CQAA 3N52A 3PO3G 5C4JB 3MXNA 1YJNA 1PTOB 3L7ZC 3ULPA 1PH1A 1IBKL 1X6OA 3K81C 5KNDA 2XVSA 3J81i 2A6HC 1B53A 1F77A 4B3SQ 4EVOA 4LMQD 5E4WC 3S14H 1HQRD 1X3PA 3QOJA 1HR0W 2IJ0A 4L5SA 4AIMA 3S16H 4FF2A 2M00A 4IUTA 3HOXG 3S1MH 1VQNA 4A3DB 4J6HA 4A3FH 2F0DA 1KABA 1SN8A 5GAEC 1X65A 2JSOA 1Y1WH 3MC0B 1L0YB 5JVG3 4HAEA 1GHKA 4A3GG 2NZOA 2KA7A 1OXXK 3M4PA 1E0BA 1V1OA 3CPFA 1Q81C 2ZTDA 1AE3A 5C44H 4A4IA 2B3GA 3HKZB 3MEHA 2VXWA 3MTSA 5EGTA 5CBEE 4FF4A 3J7A5 4J8QA 3SDZA 2K5DA 2IX1A 2WAQB 1GXDC 1HNZL 1MBYA 2HHHQ 4KN7C 5M5XH 2LXKA 4OX9L 1TU2B 3D31A 1Y8NB 4DR5Q 4WJ4A 1AEXA 1KDCA 3S17B 3D4DA 4A3MG 2CH4A 1WYDA 1LTAD 1SYDA 2TSSA 4JI6Q 3D3RA 4JI3L 2NWGA 5E7NA 4ZAIA 3GTKB 4IUQA 4DV4Q 3RR5A 2E2DC 3A5ZB 1CT1D 1EYCA 4ME3A 1Q46A 4OO1I 4FXKC 3EBEA 3S2DB 1PA6A 3GQBA 3CC4A 5C3EB 3SGIA 3I4NG 3AMUA 2F1MA 2K33A 2K5NA 4DXFA 1XNRL 1AE2A 3S1NB 1F9QA 3SVMA 4A93H 1IBKQ 1TS2A 1O7YA 3GV3A 3H0GH 4C3HH 2X6GA 3B6YA 1N34Q 4YCVA 1BKBA 1SR3A 3L3OC 2NBFA 1TWHH 3S24A 2VUMG 5J3BA 5LL6S 4B3RQ 4DV1Q 2F4VL 1GJXA 1ET9A 3OTOL 4IOCA 2OQ0A 4BXXH 1RTOA 1K3RA 1YJ9A 4A3BG 3I91A 1STGA 1KRSA 3GTPB 2LS01 4DR7L 3BS1A 4LF9Q 3G6EA 2JN4A 3CRLC 3GV6A 4RG1A 1FNVA 5BN5A 2NVTH 5C4XB 2EYLA 4OWWB 2RHSB 1AN8A 3QOLA 4JI7Q 3AQQA 3HOWG 3VR6A 4UP7A 1EEFD 1RDPD 3A0JA 4HSPA 5JPMC 4A3FG 2Z1CA 1WTWA 5D14A 2L55A 4ZKBB 3OSOA 5I6YA 3PO3H 2OTLA 4LF5L 4KTAA 4JI3Q 4DR2L 4A3CH 1KNEA 1ASYA 4R8NA 3SK6A 2KVMA 2R7ZG 5C44G 3UDXA 4EQPA 1QB5D 1CM9A 4LW1A 4XYOA 1H9JA 4MTKA 3Q22A 4R4OA 4RH6A 5C3EH 2ZJRA 5D65A 5C0XJ 3HOUH 3KF8B 1VQ6A 3NTKA 5C5LA 1HNWQ 1VQIA 3A8JE 3SE0A 1CQFA 3TP8A 1J8IA 2G5DA 2BE5C 2ZXPA 5IGBA 2DN8A 3T1HQ 2F0LA 1Y1WG 4JV5L 1X3GA 4GKJL 3V2TA 5J39A 1B3QA 3HOWH 3A56A 4DV7Q 4QCLA 1LTLA 2XWBB 1F2LA 2ZTEA 1YHQA 2UUBL 1SMXA 2EY1A 1UEAB 5F2DA 2RA4A 4X66Q 5GQOA 1HNXQ 4A76A 1ICFB 3NBIA 3G71A 5EKKA 1N32Q 1O78A 5KNBA 1Y69U 5EKLA 4JC0A 1E2WA 3H0GG 2N3SA 2I07B 3OMGA 3C46A 3GTLB 1F2YA 1BVSA 1ET6A 1IKLA 4G4KA 4RHRA 2UUCL 4HJAA 1P16A 3NWTA 2Q8IB 1VQ9A 3KLSA 1EU4A 3KOJA 2PZWA 1OTCA 3WOEA 4UP9A 1YIJA 4O2DA 1RODA 4IFDH 1EWHA 3OW7A 5FK9C 2L0CA 1BR9A 1X56A 2K1BA 2K5VA 1UAPA 3C3LA 5JJZA 4R4QA 4NW2A 5M3FB 4A3BH 3LWUA 1YVCA 4A3EH 4K14A 4RMFA 4LF5Q 5ELBA 4DR3L 4A93B 5CV4A 4X66L 2AWOA 2K5WA 3D6WA 3UI2A 1TQOA 5IP9H 2AMCB 1GHJA 5DAUA 4RFBA 2ICIA 2O2LD 4QGUA 2RKSA 2E5LL 1A15A 4QB4A 3S1MB 3RMHA 2A5HA 4C2MH 1BCPC 2NVYB 4QIWB 1EZ6A 2QCPX 2I0QA 5LMUQ 1E3PA 4ILWA 1KDBA 1LO5D 3G6JB 4PZ8A 5FO7B 2F0WA 5KNCA 1JE4A 2D0OA 2KBNA 1EQRA 1AZQA 4Y7NB 1STHA 1TWAH 3HOYG 2NTSA 4BS9A 1JQYD 2AQ2B 3HOUB 3K0YA 4EQOA 3KBGA 2Q2TA 3ZYYX 3FKIH 4NKLA 4DV6L 2UUAL 3S16B 3J80i 3NELA 1WTOA 1S40A 5CBAE 3NXWA 2ES2A 1SE4A 2K6AA 3OMCA 2BH8A 4YHHQ 4ID6A 5FLXL 1WVLA 3OIQA 5FLXE 5JOBA 4IPCA 3KJPA 1STEA 3PUVA 1H9RA 5T1GA 4A3JH 2YYZA 5DLQE 1QVFA 4POFA 1IBLL 1PXUA 1UNSA 5J22A 5LMUL 2VQFQ 4MIUA 1JORA 3TRZA 1C4QA 3OWFA 3PUYA 3PUWA 2MO1A 4IJLA 3MXGA 4QY7A 1KTKA 2E74C 3UDGA 4GZYC 1I4XA 3ND9A 3I8ZA 4IFDI 2D62A 3F1ZA 1LTID 1BCPB 5HY6A 1YNND 2JA7B 1CKMA 1NE3A 3K5OA 1VQ5A 4JBMA 5HURA 4OGQC 5G3LD 3CKIB 3M7GA 4P2CB 3ZJYC 4LFBL 5M5XB 3OWEB 1WJJA 2GVBA 1L0WA 1ZKOA 1EY7A 1HNZQ 4QQBX 4JV5Q 4MNOA 5H1SE 5IYDG 4LFAL 2E2JH 1LACA 2SNMA 1YJWA 2L4NA 1EWCA 5JEAH 1U4PA 4DAYA 2KCNA 3QR8A 4DV1L 4DA2A 4TRDA 2F4VQ 1SNOA 4CKBA 2PQEA 4XTCS 5IYBG 2R6GA 3D4WA 4A3GH 4P75A 5FO8B 1O7ZA 1XPRA 2MHVA 2XGTA 5I4DA 1DD2A 2WV6D 4CJ2C 1T5XD 4GKKQ 1SNPA 2F0HA 1J9OA 1XMQQ 4HR7B 3T4AC 2ZJPA 4F88A 4GOPA 2JQOA 2F0IA 5TSSA 3S1QB 4KY5A 4YWMA 4UP8A 1K8AC 5JAVA 1I50H 1B44D 3K7UC 4PV1C 1TT2A 3H3VI 4ZQ3A 2F4IA 1F2ZA 4JI8Q 1GD7A 3ERQA 3OHXC 3RLOA 2I5MX 5NUCA 1BO0A 1CSPA 3FP9A 2IWHA 5CV8A 5LL6X 4GLVB 2RDHA 3R8BA 3A74A 1L0XB 4CHTB 4AYBG 1DOKA 5EBDA 1PFBA 4HTHA 5M5WH 3DUZA 2A19A 1GM5A 1Q82C 1R9TH 2WIIB 4IOAA 2K52A 4OO1G 5M9OA 3F8TA 1CQVA 3CCEA 5IP7G 1II3A 2XN9C 3TZUA 2R92B 2VQEQ 4ABNA 1YITA 1QCBD 4KK7A 4KD4A 1KLGD 3RUZA 1K8GA 4LFCQ 4XIGS 3S14B 2VZAA 1VQ4A 2Z4HA 2V4DA 1HNWL 3M3YH 4BBRH 1FYCA 2IL8A 2RDFA 5BN3A 3UE1A 3E3XA 1SRUA 3A8IE 1I4RA 5FLMH 1YEZA 4BY1G 2FMCA 1HR0Q 2F03A 4RKBA 5CGKA 3FMCA 3HRZC 2O5JC 5JPNC 3DWAA 4DK3C 1XMOL 2EDGA 1DXMA 3URYA 3SEBA 4KV6A 3J7YW 1EIGA 5LMNL 1CKNA 2PZUA 2DNCA 3RZDB 4JCVE 1I6VC 1I94L 2F0KA 3K7AB 5I9OA 2B2TC 2CH4W 4A3JG 3R2IA 5IP7H 3CF5A 5LMNW 4M8AA 3Q24A 3RZOH 1LTSD 4OIJA 3IRBA 2CKZB 4XDXA 4JI1Q 2WFWA 3CCMA 2WB1G 5ELFA 4B3TL 1IYVA 1NR4A 4L5TA 5GADC 1KC8C 3T16A 4DNTB 1Y1VB 1I3QB 1PFNA 4NB3A 1G6PA 1OO9B 4A3FB 1JB7A 4A3KG 2OWOA 3F2UA 4GNXB 2Q2HA 1IL8A 1D7QA 1O80A 2X6LA 4C3JB 3H3VH 4PZ7A 3Q23A 2PW7A 1TR5A 4DR3Q 4M1UB 1XPOA 3BZKA 3HOZH 4BY7H 1FNUA 1PRTB 3GDEA 5BR8Q 2BDNA 1NR2A 4ZCKA 5C3XA 4I7ZC 1PH6A 1V1PA 4P72A 3GTGB 2I5HA 1QG7A 2B2UC 3U9SA 1JJ2A 5M5WB 4J1MA 3HFZB 1HPCA 2QGQA 5IYBH 4JI4Q 1X3EA 3AB9A 2JEAI 1YNJD 4JPBW 1EOTA 1Y1WB 2MGSA 3BYYB 2E75C 1PYWD 1KRTA 1MSGA 4FNFA 5KIXA 1I4GA 3S2DH 3OYYA 5E3FA 2RSOA 4X3TA 1EYDA 4EQ5A 2F3IA 4RGNA 2B2YC 4CBVA 4ODGA 3PO2H 4KMUC 4JI8L 1Y1VH 2BE5D 3LWEA 4LJZC 4DV7L 1L1OB 2K32A 1MIUA 2F0EA 5E4XA 1PVOA 2F3VA 2XRQD 4DV0L 4X3UA 5FO9B 5C0XI 3BG3A 3VR2A 1ESFA 3DWQA 5KYLA 2EOTA 2SDFA 1R4QB 1ENAA 3E9HA 4QL5A 2Q8TA 1T5EA 4DR4L 1G2TA 2M2LA 4X3SA 2QA4A 1DOMA 4JI2L 1L1OA 4K0KL 1JWUD 2B63G 4K2KA 2O4XA 4P74A 4K8IA 3VYSA 1PH4A 1T9HA 3U4VA 4A93G 1K83B 5K36H 3VYTA 1D5XC 4GOPB 1I3QH 4A75A 4XYQA 1D5ZC 5C3WA 2ZM6L 1B9MA 2QILA 4H02A 3KF6B 3T1HL 1S5CD 1MKHA 2K5HA 1IKMA 4DV3Q 3L2PA 2N49A 4YWKA 5ISRA 4B9WA 3CXCA 4NDXA 2H1EA 5M3MB 2JA6H 4HCEA 1O7IA 1N36L 2N88A 1LT4D 3PO3B 1TXYA 3HOYH 4LK1C 3VA7A 2OEOA 2CWPA 1DM0B 5DM73 4BBSH 3EVQA 3R93A 2YV5A 2KENA 1EY6A 3S1RB 3J81c 3M4QA 5IE8A 4WORA 4FP5D 5IODA 2EJGC 2Z8LA 3C2PA 3SK8A 3QIAA 1MSHA 3GTJH 2LY7A 1RKNA 1PH8A 2IHFA 2IT1A 2NN6H 4DAMA 4IN3A 2EY2A 4O42A 4R4IA 4LFAQ 3TS0A 4BA2I 4OIKA 1N33L 1Z7TA 5IGGA 5I9PA 2QW7A 4KY6A 1VQJA 3Q8DA 2UU9Q 3H94A 2JJQA 2HDMA 3HKZG 1PTOH 1U9RA 1KL9A 2EPBA 1C7YA 1SNDA 3PQIA 2N78A 1TWGB 2H5XA 3Q6SA 4CJ0B 4C3IG 4CJ1B 5CV6A 3TS2A 2PI2A 4K2LA 2WACA 4JG2A 4JYAQ 1IBLQ 1M90C 1OXSC 1SMYC 3ITPA 3W3AA 2KJXA 3CC7A 2B29A 1PRTF 3F2BA 1BQQT 1IBMQ 4UPAA 4OL7A 1L2FA 2AQ3B 2B2VA 3WOFA 3K59A 3R3OA 4I7AA 2UUAQ 1EZ8A 4DN4M 5AJ3Q 3F2DA 1N9WA 3CW2C 3GTLH 4IUUA 3IKJA 1Q86C 1CSQA 3ICEA 1WFQA 1K8MA 5IT9E 3TN2A 2VQEL 5IT9L 2R7FA 1Q12A 4LF7Q 2OQKA 1GUGA 1XYIA 4GN5A 2GN5A 5CV7A 3KF8A 1JWMD 1TWHB 2A73B 2PNHA 4G7HC 3NUCA 4CDEC 2RQXA 2ZXOA 2F0OA 4Y7NH 3HKZE 1E1TA 2F0TA 4A3BB 1EY9A 4UHVA 1SDFA 3BJUA 2KOLA 1ILPA 1WD0A 1QZHA 2MNAA 3FKIB 1VQPA 1GVPA 3MXPA 5D3DA 4HJ8A 1MGSA 2G9DA 4KHZA 4ALPA 2Z6BA 1EYGA 4NXML 1DGSA 1IYJB 4PNYA 2L1BA 4BY7B 1U0LA 2B2WC 1NBWA 1U5KA 4U673 4IURA 3I56A 2CVRA 4KKTA 4N8FA 1IW7C 4O1NA 1QZGA 5C3EG 1HA6A 3I4NB 1S4ZA 5C4XH 1X3QA 1ZEQX 5EPLA 3MFYA 4B3ML 1BNZA 4JI5Q 2JA6G 4LNQA 1LT5D 4DV0Q 3K5MA 4DR5L 2NVQB 2BCOA 1RTNA 1RD9D 1BBUA 2K01A 3OTOQ 2E2JB 5ELEA 3KYHC 1JR0D 1HZCA 3EFXD 4IQZA 1CHQD 1RIPA 3JAME 4JI4L 2J7ZA 3J7ZC 2BDOA 3RNUA 1SFOB 3PIOA 1FJGL 3M4YA 2R7ZB 2LXJA 4XQNA 3JAMc 3STBC 1I4HA 4YIJA 2RBMA 3GTMB 3A5UA 3DEOA 2R3ZA 1E2VA 1SYCA 3NBHB 5C4JH 4KD3A 4X6AH 4WJWA 1TWFB 3W5OA 2NN6G 3IFTA 4YCUA 2OTJA 3AYHB 2HHHL 4YWLA 4A3JB 5JJKA 2AQ1B 5C4XG 3SHLA 3EN2A 4HIDA 3V05A 4B3MQ 1QE6A 2D5DA 4L5RC 1PTOF 1QNUA 5IIFA 4DFAA 1MJEA 2RHQB 1M4VA 2YU9H 1B1ZA 4AYBB 4A3DH 1IBML 1B8AA 4A3EG 4KKUA 2FHTA 4R4TA 3TQYA 4NPSA 1IL2A 1YI2A 2JA7H 3NWSA 2JA5H 4DAYB 4I65A 2B8GA 4DUZQ 1E24A 2Z4IA 3CCSA 1LM0A 3SR1A 3TREA 4JYAL 1V1QA 4C1NI 1GUSA 4E6IA 5EPJA 2Z9HA 4BBRB 3J80L 1FD7D 1SLJA 4U68A 3I4MG 2K03A 2HIXA 2JP1A 3ULLA 1B3AA 3I72A 2AWNA 4OHJA 4R9WA 3M9BA 1G291 3PSIA 2BA1A 2I5LX 3S2HH 1KDAA 1K28A 2EYMA 3A8KE 2QEJC 3G48A 3FVQA 1JB3A 1GO3E 4Z9CB 4GKKL 1C48A 3TEHB 1V8QA 4LF9L 1I5FA 3IAYA 4DK6C 1A62A 4KJNA 3HOXH 1ML0D 1O7LA 2AUKA 3S1NH 5E1FA 4B3TQ 1AW7A 1SFOH 3U50C 4R1JA 1K73C 2IY5B 2XRSD 1B70B 4JI0L 2FINB 3T13A 1GUNA 4PMCA 2N55A 4G7ZC 2HUGA 4G7OC 1S5BD 2ENBA 1WCMB 1OXTA 4K5VA 1VQAA 3VYUA 4DK1A 5IT9c 3X3NA 3HOYB 4F8MA 4GNXC 1X32A 2F0PA 2R93B 3UE0A 2GVAA 4X64Q 1STBA 3H6MA 1A3TA 5LHY1 3H09A 3CPWA 1VQ8A 1HNXL 1LTBD 2WAQG 3LNNA 4KKSA 2NN6I 2R92H 4F87A 1TWAB 5C6AA 1DCZA 1Q8IA 2C5CA 3D8GA 4DNIA 1VQOA 3DWPA 2CW0D 3CCJA 3FRPB 3M7NA 3T1YL 4TKOB 3WDNA 1EFWA 3J81E 2A74C 2PPBC 1WTPA 2YU9B 1KNAA 2B8FA 2F0GA 4RGMA 2XWJB 1H95A 2CQOA 2MUYA 1FJGQ 3KLRA 4HJ5A 1K3BC 1AP0A 2NVTB 3A55A 3KF6A 2E2IH 3CCRA 1HRJA 1EY8A 3S15H 4K6DA 5J1ZA 1HR0L 3S9WA 1SROA 1VS0A 4NMZA 1K0RA 1QUQA 3TP6A 3AFPA 3BVZA 2DNEA 5ELCA 2JA7G 3OPOA 3GP7A 1Z9FA 3ND8A 3GD7A 2MPMA 3GTPH 2UXDQ 3GTQH 2E76C 3T51B 2ZM6Q 1BBXC 5CR3A 2Z6KC 2TMPA 3BZCA 1K9MC 2HCIA 3AEVA 2R61A 1K0SA 3U58A 5GAHC 4ZUJA 1EY5A 1MHWC 4YY3L 1SE2A 2FMMA 4DXGA 2OF1A 2UXBQ 4DR2Q 1CTMA 4A3DG 1SAPA 3BZDB 4HCSA 3K8AA 3I73A 3CU7A 1V9PA 3X3MA 3JAMi 4ZK9B 3P20A 3VDYA 3A7LA 3BDCA 3CMAA 1XMQL 1U4LA 1JE5A 1STYA 3K80C 2JA5G 2SOBA 3ERSX 3N6RA 4X65Q 3T53B 1C8CA 2L9HA 4HEDA 3HOVG 1J5EQ 1UWVA 3HOWB 3PIP3 2NVXB 4O0AA 1D1IA 4JOIC 4DAPA 5BR8L 3GTGH 1A6XA 1AH9A 2UXCL 1QNKA 2SEBD 3T1YQ 1DJRD 4JVZA 1W2BA 5G3LF 1JJCB 2H4OA 4FDBA 1YZ6A 2R7ZH 5C4ZA 2N8NA 4Y52H 4GOPC 4BY1H 5C44B 1YNNC 2LMCB 2MP1A 2QF7A 3AU7A 1VQ7A 1D2BA 4KJOA 2EJFC 1R9TB 2CW0C 2Y0SB 2R92G 1CZGA 5KGUA 4A3LG 3NP8A 1PH5A 3HKSA 1NMFA 3FPPA 2KCCA 1UEBA 1AZPA 1Q1BA 4A3IH 2FXQA 1S3OA 4X62L 1DYQA 4DKAC 2F0QA 3NQTA 4L6TB 2JA8H 2BOSA 3H91A 2J4XA 1E22A 1PMRA 4AH6A 1SNCA 4B3RL 1XXGA 2A6EC 1U4RA 1QJOA 1HXYD 4H13C 4IUNA 2IX3A 1A2TA 5DNFA 1XMOQ 3RD4A 3CCQA 1BBWA 4BBSB 1PV4A 4HIMA 2ATWA 1EL0A 3H0GB 2HQLA 4L63B 3W2DA 2A68D 1XPUA 4QUCA 1KLUD 3FKIG 3MXNB 4PMBA 4JI2Q 3DLLA 2FJ2A 4IZ8A 1G2SA 1Q8KA 4YCWA 2CCZA 2E5LQ 1XNQQ 3STBD 4RGOS 5C0XH 3RZOB 4WJ3M 3GTOB 4FF1A 4A3MH 4MTNA 2A69D 2F0MA 4K5XA 2PNRC 5FKAC 5IGDA 2E2HB 4LF8Q 4X62Q 4QMGA 3CP0A 1G8ZD 3PCOB 5M3MH 2JA6B 4TSSA 4MZ9A 1PRTC 3K6OA 3K0XA 3CCVA 5JEAG 4C3HB 2B2TA 2RCNA 1EOVA 3JAML 2NVXH 1GOZA 4FXGC 1VQEA 2WP8J 5LMNQ 4A3CG 2KEDA 2PI2E 2Y0SE 1NSNS 4C3JH 3V96A 2PYKA 4ZYSA 4AQYL 1TY2A 3QWNA 4DUYL 3UDIA 2R7DA 3EIVA 2EYOA 3J81j 1IZ6A 1F9SA 1JOKA 2K5QA 3J80E 4HIKA 1ICWA 3KBXA 3O13A 4PG3A 2VUMH 4JI1L 3FEWX 1JMCA 1G51A 2EVBA 4DUZL 1LV9A 5COYA 3HG9A 2CFMA 4JI7L 1KQSA 3M4OB 2V1CC 2E8GA 1HH2P 2NZHA 4MHEA 3IFDA 1HZ9A 3U9OA 3D6CA 1PFMA 3TMEA 3K5LA 2F0JA 3KDFB 1STAA 2GA4B 2ZJQA 1EIYB 3K57A 3Q0AA 2A6ED 2HIVA 3CQZB 4DV6Q 4LUVA 1LT6D 2HDLA 5JEAJ 2A8VA 5C5MA 1EWIA 4XT1B 5EPKA 2UXDL 1G91A 5ELDA 1WTRA 3F2CA 2BA0A 1VQBA 4HN7A 4ZLTF 4NP5A 3K58A 4OO1H 3PO2B 3CMEA 4DUYQ 5K36G 1SE8A 1TIID 4CDDC 4PZ6A 1CA5A 1LT3D 4UY8C 1EEID 3PGZA 4OELB 3I3CA 2XNAC 3P75A 4DNRB 1B4OA 2EY6A 2KHJA 3PUXA 1PFSA 3G7LA 1X3FA 4IALA 4IUVA 1HQMC 5IWAQ 4DAVA 4HSVA 3D0FA 4JI0Q 4KHPQ 1HFGA 3HGBA 3I4MB 3KLSX 2K04A 2EYJA 2LSSA 4UAIA 3E9IA 2B2YA 5HGQA 1XNRQ 3QJYA 4HIOA 1HJPA 2B63B 2PCFB 2OCEA 5I2YA 1S5DD 5CMDA 1A0IA 4A3MB 1FGBD 1STNA 5EQ0A 4CGYB 3NTHA 1A63A 2ICEC 1YBYA 2KHIA 3C1EA 1NTGA 2EY5A 2SNSA 1Q3LA 3GO5A 1I94Q 3DM3A 1H9KA 3NHHA 3BDOA 3J7AV 3CAMA 3NEMA 4XQJA 2DUDA 1SYBA 3RLNA 2YTXA 1C9OA 1E1OA 2Z0SA 5M3MG 1F9PA 1RCVD 3GTKH 4H0LC 4JBWA 1E2ZA 2KQ3A 5DEHA 4JI6L 5IYCH 5FLMG 1X55A 3NENA 4LAAA 3L0OA 2KHSA 4KHPL 5JJIA 1JOOA 1PTOC 5EAYA 2MO0A 4H44C 3NSWA 1R4PB 1WCMG 3HEJA 1QILA 1PZJD 1D5MC 4MN3A 1CKOA 2EXDA 2RVLA 3P1HA 3HOUG 3TSSA 5C0XG 4P73A 1VQDA 2NVYH 5C4HA 4IFDJ 2F0NA 5EKIA 3NBHA 5FLXc 5A2QE 4DV5Q 2DY7A 5I2XA 3CCLA 4BA1I 5M5YB 4LF8L 1KIXA 5CORA 2F0UA 4V190 2QDLA 1WI5A 1YNXA 4FYDA 2CHBD 4N8X1 4UDUC 5CYUA 3TP7A 1EY4A 1QOHA 4K8JA 3CHBD 4OONA 3J81L 1TS3A 1JT8A 1VQCA 1TY0A 2ALYB 4Q5VA 4A3KH 1SSOA 2K50A 3BVMA 5K5PA 5ELNA 3SXHA 4KLKA 5IP9G 1CFMA 2BH2A 1PDQA 3PF4A 1LUZA 2NTTA 3S1RH 4A3IB 3A7AB 4DR1Q 4IFDG 2PMZE 1FR3A 1JICA 1UE5A 4GKJQ 1TWGH 1X54A 2Q2IA 1ILQA 3RN5A 4RA8A 4N9TA 4BY1B 4DV3L 1HUNA 4DV2L 1ASZA 3VR5A 2WB1E 3VYRA 4ZRZA 2LFNA 2UU9L 5A2QL 3CRKC 5IY0A 1XX8A 3TZDA 5JJLA 5KRUA 1HTPA 1TKWB 3DHQA 3I90A 1V43A 4GLAC 4LUZA 4EX5A 4DR6L 2F0SA 3QG1A 1IYUA 4L5QA 2EZVA 1Z47A 1BF4A 2JA5B 1C0AA 3SK5A 1H9MA 2K75A 1ENFA 1FVIA 4EQNA 4RWSC 1Q90A 4XT3B 3GTOH 4LUOA 1GKHA 2A1AA 2FFKB 4RCNA 2B2VC 2B39A 3OOCA 4CKEA 3QO2A 1Y1VG 1PZID 1XTDA 3E5SA 1M1KC 2UXBL 4WFN3 1HHVA 1NUCA 3J80c 4DV5L 3I55A 1ONLA 1UE1A 1VDZA 3ONAB 2NZ1D 5IYCG 1YNJC 3OIPA 1LTTD 2IW3A 5KYIA 1I6HH 1WTQA 3S2HB 1GUWA 3RLFA 3VR3A 1PRTD 3HOZG 2OT2A 4BY7G 4OWTB 1Y8OB 2D9UA 3S1QH 4A3LH 3A54A 1BOSA 2HQEA 4YHHL 2M9VA 2L15A 1I50B 1UUPA 2Y0SG 3GTQB 1KHIA 3EA6A 1SNMA 2JE6I 1QUQB 3MAQA 1KAAA 2DJGC 4JW0A 1PTOD 4NXNL 1WD1A 4YY3Q 1I4PA 3M4OH 3NQIA 3S17H 3J7AF 3CD6A 3FPUB 2WAQE 3QB3A 2EE1A 4AYBE 1WCMH 1KAWA 3NE5B 1SJHD 3H3VC 1K83H 2B2WA 1VQFA 1NJIC 4KHVA 4FXDA 4JK1C 1XTCD 4OXPA 2VB2X 5FJ8H 1Q7YC 3MA2B 1SYFA 1SJED 5AJ3L 3R2TA 4ZKCB 3H15A 1TWFH 1CUKA 1QVGA 2UXCQ 3VA5A 4JI5L 4QJFA 2Q2UA 3TDQA 3NPPA 2JA9A 1MI2A 4LF6L 2VS1A 3NK9A 1ZXTA 5IGFA 3I4MH 1Y8PB 1SYGA 4GLXA 1BCPD 5IWAL 3GTJB 1CA6A 3S15B 1RL2A 1SEBD 3M85A 1W6JA 1I4QA 3PMFA 1OXUA 2IHEA 1F2MA 3M3YB 5DM63 2EIFA 1H9SA 2ZXRA 3HZXA 2EYFA 1JOQA 2QDBA 1LTRD 1MD2D 1IW7D 1W3SA 4QUFA 3LX0A 4BBRG 2A69C 2IX0A 1Y14B 5HGTA 1IXRA 2EJMA 1SBBB 4HMIA 3WWVA 1SE3A 2JA8B 4GN3B 3TP5A 4CDFC 3MFGA 2PO4A 2KECA 1AFPA 1NCVA 1RF2D 4R4CA 3UDFA 3BYTB 4XQQA 1UE6A 4TQUS 1S5ED 3EJIA 2F3WA 1EIFA 1EQVA 4N9PA 4TVAB 4ULLA 2EQSA 3PIO3 3PF5A 4LFCL 2UUCQ 1EUJA 2X69A 2RF4A 1H9SB 2PW5A 5M5YH 3BVGA 1HCZA 4IPDA 4DGZA 3HOXB 5FOBB 1PYBA 1F9RA 3PO2G 4DV2Q 2DJFC 2RCFA 1HUMA 1FNWA 3C1FA 3I4OA 4A3GB 1VQKA 3DEPA 3I70A 1WTHA 1FL0A 3FDTA 5A35A 2KCTA 4DV4L 1NNXA 1MJCA 2VW9A 3JC66 1LLRD 1B50A 4P71A 1A3UA 2ZTCA 4RGTA 2DGYA 1DZ1A 2P5ZX 4C3IH 4K0KQ 1ZYRD 5CV9A 3KJOA 4PMWA 2WINB 4PQXA 3I7FA 2XIWA 3MVVA 1HFNA 1HTLD 3BU2A 1KXLA 1N34L 3I2ZA 2KCMA 1VMPA 4IUPA 3PIPA 5ELOA 4DR1L 1PH2A 2PMZB 1ESRA 4GNXA 2JK8A 2L12A 1CI3M 5EJWA 2YTYA 1DOLA 2E2HH 4KI0A 4CKCA 3CCUA 1BCPF 4KY7A 1VF7A 1N36Q 1TVXA 4IPGA 4FVMA 4IPHA 2K4KA 5FJ8G 1CK1A 3E0EA 1BDOA 5CC4A 2NB0A 4OEMB 3I4NH 4EGVA 2VL6A 1VQHA 4K5WA 3BDLA 4DR6Q 3MHBA 2EXZA 4LF4Q 4S3SA 1PYSB 2NVQH 3HOVH 1KD1C 1HA5A 2VUMB 1M8AA 1PLFA 2R93G 4BWGB 5AFWA 1CKNB 4LF6Q 3LGJA 2CWAA 5D3IB 1SNQA 2VY3A 5IYDH 4ZUIA 1G6ZA 1JCKB 4APVA 1RJTA 2C35B 4XXEA 2O5IC 3D4RA 5M3FH 2F0FA 1VQMA 3EQLC 1CZWA 1D6EC 1RHPA 4RHSA 4DU9A 3G4SA 2Z6KA 4QIWE 1EU3A 1UE7A 4K6LA 2B63H 2L11A 4OWXB 3RN2A 2L5TA 3HS0C 1NAPA 1WTVA 1PH9A 2WB1B 2JYOA 3L9AX 4LFBQ 2PZTA 1A2UA 1IHZA 2J0TD 2PQAB 1XJVA 1WOCA 4LF4L 2D0PA 4OX9Q 1YHAA 2D2CC 4JBKA 3KLWA 4NXNQ 4C3IB 5EBCA 4A3IG 1VQGA 1I6HB 2JEBI 1SYEA 2HT1A 3KDFA 4FO2A 4DR4Q 1JJGA 3KFUA 2WKDA 4HJ9A 1LABA 5GAGC 2K7VA 1D1KA 1P8LA 2Q8RE 4RKLA 2F52A 1PZKD 1SXTA 2K28A 2DY8A 4JOIA 1J5EL 1VQLA 1EYAA 4X3KA 3CC2A 3E0JA 3KUPA 2MQHA 2K14A 1OXVA 3SK4A 1N32L 4B3SL 1QWYA 5IGEA 1FGUA 1TS5A 2YTVA 3DM1A 4GN4B 1S72A 4IJHA 1ZYRC 1CHPD 4LF7L 3HOVB 1YHBA 3W1BA 1TWCB 1NMGA 2LKVA 1HZAA 2RDGA 4QF4A 1EY0A 4V0BA 4DPGA 4DK0A 1NY4A 3IL8A 2B2UA 4GS3A 2ID0A 4BBSG 3T56B 2IPKD 3EROA 4LWCA 4A3KB 2RSNA 4B08A 4H7BA 3MWYW 3HP3A 2HD3A 2XSCA 1VF5C 2A6HD 4C3JG 1XNQL 1Z6HA 1XWEA 4X65L 3HOZB 2EYPA 1K8OA 2R93H 2G9HD 1BUVT 2QKIC 5I6WA 4CDCC 1N8RC 1B2TA 5GROA 2I46A 3MZ5A 1J6QA 1LTGD 3MEFA 2JXMB 4Q0FA 1W6KA 4L8JA 1VMCA 2NYZD 5M3FG 2AKWB 3ER0A 4DF7A 1N33Q 3VR4A 3I4LA 1WTXA 1Q1EA 3DMUA 4WRDA 2VQFL 2C9OA 1GUOA 2HCCA 1BXTA 1JC7A 2PQAA 4F7XA 2XTIA 1A3VA 3AFQA 4R8IA 2AHOB 4JBJA 1LYLA 4NXMQ 2NUCA 5KEEA 1A8VA 1TS4A 4KN4C 3E6ZX 1X9NA 1HZBA 5L37A 4RCOA 5BN4A 1GUTA 4FF3A 3P7JA 1L1OC 2ZT9C 1U4MA 2E2IB 1EIHA 1SMYD 4ME5A 2EYHA 4IO9A 2KEEA 2KUMA 4J15A 1JWSD 1V1PB 2UUBQ 2F0VA 5IGCA 3PUZA 3NTIA 4X64L 1S5FD 1DONA 3DXJC 1EQTA 3PV0A 1D8LA 3ULJA 3CQZH 4RAUC 3OW2A 4AQYQ
chains in the Genus database with same CATH topology
4G57A 5JVH3 4A3EB 4C56C 3K5NA 2AUJD 4C3HG 2A68C 4B9XA 5T1IA 3MXUA 2K05A 3KK7A 3TBIB 4C2MB 4HMJA 5IOCA 1EFID 1ENCA 2OXPA 1B9NA 5CV5A 1VCIA 4C1NK 2VB3X 2VNUD 2WKCA 2MJ8A 2CQAA 3N52A 5C4JB 3MXNA 1PTOB 3L7ZC 5KNDA 2XVSA 2A6HC 1B53A 1F77A 4EVOA 4LMQD 5E4WC 1HQRD 1X3PA 3QOJA 2IJ0A 4FF2A 2M00A 4IUTA 4A3DB 4J6HA 2F0DA 1KABA 2JSOA 3MC0B 1L0YB 5JVG3 4HAEA 1GHKA 2KA7A 1OXXK 1E0BA 1V1OA 3HKZB 5EGTA 3MEHA 5CBEE 2VXWA 3MTSA 4FF4A 4J8QA 3SDZA 2K5DA 2IX1A 2WAQB 1GXDC 1MBYA 4KN7C 1TU2B 3D31A 1Y8NB 1AEXA 1KDCA 3S17B 3D4DA 1LTAD 1SYDA 2TSSA 3D3RA 2NWGA 4ZAIA 3GTKB 4IUQA 2E2DC 1CT1D 1EYCA 4OO1I 4FXKC 3S2DB 3GQBA 5C3EB 3AMUA 2F1MA 2K33A 4DXFA 3S1NB 1F9QA 3SVMA 1TS2A 1O7YA 3GV3A 2X6GA 3L3OC 2NBFA 5LL6S 1GJXA 1ET9A 1RTOA 3I91A 1STGA 3GTPB 2LS01 3BS1A 3CRLC 3GV6A 5BN5A 1FNVA 5C4XB 2EYLA 1AN8A 3QOLA 3VR6A 1EEFD 1RDPD 4HSPA 5JPMC 2Z1CA 1WTWA 5D14A 2L55A 4ZKBB 3OSOA 5I6YA 4KTAA 1KNEA 4R8NA 3SK6A 2KVMA 4EQPA 1QB5D 1CM9A 4XYOA 1H9JA 3Q22A 4RH6A 5D65A 5C0XJ 3NTKA 5C5LA 3A8JE 3SE0A 1CQFA 3TP8A 1J8IA 2BE5C 2ZXPA 5IGBA 2DN8A 2F0LA 3V2TA 5J39A 3A56A 4QCLA 2XWBB 1F2LA 2EY1A 1UEAB 5F2DA 2RA4A 3NBIA 5EKKA 1O78A 5KNBA 1Y69U 5EKLA 1E2WA 3OMGA 3C46A 2I07B 3GTLB 1F2YA 1ET6A 1IKLA 4G4KA 4RHRA 3NWTA 2Q8IB 3KLSA 1EU4A 2PZWA 3WOEA 1RODA 4IFDH 1EWHA 3OW7A 5FK9C 2L0CA 1BR9A 2K1BA 1UAPA 3C3LA 5JJZA 5M3FB 4NW2A 3LWUA 4K14A 5ELBA 4A93B 5CV4A 2AWOA 2K5WA 3D6WA 3UI2A 1TQOA 1GHJA 5DAUA 4RFBA 2ICIA 2O2LD 2RKSA 1A15A 4QB4A 3S1MB 3RMHA 2A5HA 1BCPC 2NVYB 4QIWB 1EZ6A 2QCPX 4ILWA 1KDBA 1LO5D 3G6JB 5FO7B 2F0WA 5KNCA 1JE4A 1AZQA 4Y7NB 1STHA 2NTSA 4BS9A 1JQYD 2AQ2B 3HOUB 3K0YA 4EQOA 3KBGA 3ZYYX 4NKLA 3S16B 1WTOA 5CBAE 3NXWA 1SE4A 2K6AA 3OMCA 4ID6A 5FLXL 1WVLA 3OIQA 5FLXE 5JOBA 1STEA 3PUVA 1H9RA 5T1GA 2YYZA 1PXUA 5J22A 1UNSA 4MIUA 1JORA 1C4QA 3OWFA 3PUYA 3PUWA 3MXGA 1KTKA 2E74C 4GZYC 1I4XA 3ND9A 3I8ZA 4IFDI 2D62A 1LTID 1BCPB 1YNND 2JA7B 3K5OA 5HURA 4OGQC 5G3LD 3CKIB 3M7GA 4P2CB 5M5XB 3OWEB 1ZKOA 1EY7A 1LACA 2SNMA 2L4NA 1EWCA 5JEAH 1U4PA 4DAYA 2KCNA 4DA2A 4TRDA 1SNOA 4CKBA 2PQEA 4XTCS 2R6GA 3D4WA 5FO8B 1O7ZA 2MHVA 5I4DA 1DD2A 2WV6D 4CJ2C 1T5XD 1SNPA 2F0HA 1J9OA 4HR7B 3T4AC 4F88A 2F0IA 5TSSA 3S1QB 4KY5A 5JAVA 1B44D 4PV1C 1TT2A 4ZQ3A 2F4IA 1F2ZA 3ERQA 3OHXC 5NUCA 1BO0A 2IWHA 5CV8A 5LL6X 2RDHA 3R8BA 1L0XB 4CHTB 1DOKA 5EBDA 1PFBA 4HTHA 3DUZA 2WIIB 4OO1G 5M9OA 1CQVA 1II3A 2XN9C 3TZUA 2R92B 4ABNA 1QCBD 4KK7A 4KD4A 1KLGD 3RUZA 3S14B 4XIGS 2Z4HA 2V4DA 1FYCA 2IL8A 2RDFA 5BN3A 3A8IE 1I4RA 2FMCA 2F03A 4RKBA 5CGKA 3FMCA 3HRZC 2O5JC 5JPNC 3DWAA 2EDGA 1DXMA 3URYA 3SEBA 4KV6A 3J7YW 1EIGA 2PZUA 3RZDB 2DNCA 1I6VC 2F0KA 3K7AB 5I9OA 2B2TC 3R2IA 4M8AA 3Q24A 1LTSD 4OIJA 4XDXA 5ELFA 1IYVA 1NR4A 3T16A 4DNTB 1Y1VB 1I3QB 1PFNA 1OO9B 4A3FB 3F2UA 1IL8A 1O80A 2X6LA 4C3JB 3Q23A 2PW7A 1TR5A 4M1UB 1FNUA 1PRTB 2BDNA 1NR2A 5C3XA 4I7ZC 1V1PA 3GTGB 3U9SA 1QG7A 2B2UC 5M5WB 4J1MA 1HPCA 3AB9A 2JEAI 1YNJD 1EOTA 1Y1WB 2MGSA 3BYYB 2E75C 1PYWD 1MSGA 4FNFA 5KIXA 1I4GA 5E3FA 2RSOA 4X3TA 1EYDA 4RGNA 2B2YC 4CBVA 4ODGA 4KMUC 2BE5D 3LWEA 4LJZC 2K32A 5E4XA 2F0EA 2F3VA 2XRQD 4X3UA 5FO9B 5C0XI 3BG3A 3VR2A 1ESFA 3DWQA 5KYLA 2EOTA 2SDFA 1R4QB 1ENAA 2Q8TA 1T5EA 1G2TA 2M2LA 4X3SA 1DOMA 1JWUD 4K2KA 2O4XA 4K8IA 3VYSA 1K83B 5K36H 3VYTA 1D5XC 4XYQA 1D5ZC 5C3WA 1B9MA 2QILA 1S5CD 1IKMA 5ISRA 4B9WA 4NDXA 2H1EA 5M3MB 4HCEA 2N88A 1LT4D 3PO3B 4LK1C 3VA7A 2OEOA 1DM0B 5DM73 3EVQA 3R93A 1EY6A 3S1RB 4WORA 4FP5D 5IODA 2EJGC 2Z8LA 3C2PA 3SK8A 3QIAA 1MSHA 2LY7A 1RKNA 2IT1A 2NN6H 4IN3A 2EY2A 4O42A 4BA2I 4OIKA 1Z7TA 5IGGA 5I9PA 4KY6A 3H94A 2HDMA 1PTOH 1U9RA 2EPBA 1SNDA 1TWGB 3Q6SA 4CJ0B 4C3IG 4CJ1B 5CV6A 4K2LA 2WACA 1OXSC 1SMYC 3ITPA 3W3AA 2KJXA 1PRTF 1BQQT 4OL7A 2AQ3B 2B2VA 3WOFA 3K59A 3R3OA 1EZ8A 4DN4M 4IUUA 3IKJA 1K8MA 5IT9E 3TN2A 5IT9L 1Q12A 1GUGA 1XYIA 5CV7A 3KF8A 1JWMD 1TWHB 2A73B 4G7HC 3NUCA 2RQXA 2ZXOA 2F0OA 2F0TA 4A3BB 1EY9A 1SDFA 2KOLA 1ILPA 1WD0A 3FKIB 5D3DA 3MXPA 1MGSA 2G9DA 4KHZA 4PNYA 2L1BA 4BY7B 2B2WC 4U673 4IURA 2CVRA 4KKTA 1IW7C 4O1NA 1HA6A 3I4NB 1S4ZA 1X3QA 1ZEQX 5EPLA 3MFYA 1BNZA 1LT5D 3K5MA 2NVQB 2BCOA 1RTNA 1RD9D 2K01A 2E2JB 5ELEA 1JR0D 3EFXD 3JAME 4IQZA 1CHQD 2J7ZA 2BDOA 1SFOB 3M4YA 2R7ZB 4XQNA 1I4HA 4YIJA 2RBMA 3GTMB 3DEOA 2R3ZA 1E2VA 1SYCA 4KD3A 4WJWA 1TWFB 2NN6G 3IFTA 4A3JB 2AQ1B 3SHLA 3V05A 1QE6A 2D5DA 1PTOF 1QNUA 5IIFA 4DFAA 1M4VA 1B1ZA 4AYBB 2FHTA 4KKUA 3NWSA 4I65A 2B8GA 2Z4IA 3SR1A 4C1NI 1GUSA 4E6IA 5EPJA 4BBRB 3J80L 1FD7D 4U68A 2K03A 2JP1A 1B3AA 3I72A 2AWNA 4OHJA 4R9WA 1G291 2BA1A 1KDAA 2EYMA 3A8KE 2QEJC 3FVQA 1JB3A 4Z9CB 1C48A 1V8QA 3IAYA 4KJNA 1ML0D 1O7LA 2AUKA 5E1FA 1AW7A 2XRSD 2FINB 3T13A 1GUNA 4PMCA 2N55A 4G7ZC 2HUGA 4G7OC 1S5BD 2ENBA 1WCMB 1OXTA 4K5VA 3VYUA 4DK1A 3X3NA 3HOYB 4F8MA 2R93B 1X32A 2F0PA 1STBA 3H6MA 1A3TA 5LHY1 3H09A 1LTBD 3LNNA 4KKSA 2NN6I 4F87A 1TWAB 5C6AA 1DCZA 1Q8IA 2C5CA 3D8GA 3DWPA 2CW0D 3FRPB 3M7NA 4TKOB 3WDNA 3J81E 2A74C 2PPBC 1WTPA 2YU9B 1KNAA 2B8FA 2F0GA 4RGMA 2XWJB 2MUYA 3KLRA 1AP0A 2NVTB 3A55A 1HRJA 1EY8A 4K6DA 5J1ZA 3S9WA 4NMZA 3TP6A 3BVZA 2DNEA 5ELCA 3OPOA 3GP7A 3ND8A 3GD7A 2MPMA 2E76C 3T51B 1BBXC 5CR3A 2TMPA 2HCIA 2R61A 4ZUJA 1EY5A 1SE2A 2FMMA 4DXGA 2OF1A 1CTMA 1SAPA 3BZDB 4HCSA 3I73A 3CU7A 3X3MA 4ZK9B 3P20A 3A7LA 3BDCA 1U4LA 1STYA 2SOBA 3N6RA 3T53B 1C8CA 2L9HA 4HEDA 3HOWB 3PIP3 2NVXB 1D1IA 4DAPA 1A6XA 1QNKA 2SEBD 1DJRD 5G3LF 2H4OA 5C4ZA 5C44B 1YNNC 2LMCB 2MP1A 2QF7A 3AU7A 1D2BA 4KJOA 2EJFC 1R9TB 2CW0C 2Y0SB 1CZGA 5KGUA 3NP8A 3FPPA 2KCCA 1AZPA 1Q1BA 1DYQA 2F0QA 3NQTA 4L6TB 2BOSA 3H91A 2J4XA 1PMRA 1SNCA 1XXGA 2A6EC 1U4RA 1QJOA 1HXYD 4H13C 4IUNA 2IX3A 1A2TA 5DNFA 3RD4A 4BBSB 1EL0A 3H0GB 4L63B 3W2DA 2A68D 4QUCA 1KLUD 4PMBA 2FJ2A 4IZ8A 1G2SA 4RGOS 5C0XH 3RZOB 3GTOB 4FF1A 2A69D 2F0MA 4K5XA 2PNRC 5FKAC 5IGDA 2E2HB 4QMGA 1G8ZD 2JA6B 4TSSA 1PRTC 3K6OA 5JEAG 4C3HB 2B2TA 3JAML 1GOZA 4FXGC 2WP8J 2KEDA 1NSNS 3V96A 2PYKA 4ZYSA 1TY2A 3QWNA 2EYOA 1F9SA 1JOKA 2K5QA 3J80E 1ICWA 3KBXA 3O13A 3FEWX 2EVBA 1LV9A 5COYA 3HG9A 3M4OB 4MHEA 3IFDA 3U9OA 3D6CA 1PFMA 3TMEA 3K5LA 2F0JA 1STAA 2GA4B 3K57A 3Q0AA 2A6ED 3CQZB 1LT6D 2HDLA 5JEAJ 5C5MA 4XT1B 5EPKA 1G91A 5ELDA 1WTRA 2BA0A 4HN7A 4ZLTF 4NP5A 3K58A 4OO1H 3PO2B 5K36G 1TIID 1CA5A 1LT3D 1EEID 3I3CA 2XNAC 3P75A 4DNRB 1B4OA 2EY6A 3PUXA 3G7LA 4IALA 4IUVA 1HQMC 4DAVA 4HSVA 1HFGA 3HGBA 3I4MB 3KLSX 2K04A 2EYJA 4UAIA 2B2YA 3QJYA 2B63B 2PCFB 5I2YA 1S5DD 4A3MB 5CMDA 1FGBD 1STNA 5EQ0A 4CGYB 3NTHA 2ICEC 3C1EA 2EY5A 2SNSA 1Q3LA 3GO5A 1H9KA 3NHHA 3BDOA 3J7AV 4XQJA 1SYBA 1F9PA 1RCVD 4H0LC 4JBWA 1E2ZA 2KQ3A 5DEHA 4LAAA 2KHSA 1JOOA 1PTOC 4H44C 1R4PB 3NSWA 3HEJA 1QILA 1PZJD 1D5MC 4MN3A 2RVLA 3P1HA 3TSSA 5C0XG 5C4HA 4IFDJ 2F0NA 5EKIA 3NBHA 5A2QE 5M5YB 2DY7A 5I2XA 4BA1I 5CORA 2F0UA 4V190 4FYDA 2CHBD 4UDUC 5CYUA 3TP7A 1EY4A 1QOHA 4K8JA 3CHBD 3J81L 1TS3A 1TY0A 4Q5VA 1SSOA 3BVMA 5K5PA 3SXHA 1CFMA 1PDQA 2NTTA 4A3IB 3A7AB 4IFDG 1FR3A 1JICA 1ILQA 4RA8A 4N9TA 4BY1B 1HUNA 3VR5A 3VYRA 4ZRZA 2LFNA 5A2QL 3CRKC 1XX8A 3TZDA 5KRUA 1HTPA 1TKWB 3DHQA 3I90A 1V43A 2F0SA 3QG1A 1IYUA 2EZVA 1Z47A 1BF4A 2JA5B 3SK5A 1H9MA 1ENFA 4EQNA 4RWSC 1Q90A 4XT3B 2FFKB 4RCNA 2B2VC 2B39A 3OOCA 4CKEA 3QO2A 1PZID 3E5SA 4WFN3 1HHVA 1NUCA 1ONLA 1VDZA 3ONAB 2NZ1D 1YNJC 3OIPA 1LTTD 2IW3A 5KYIA 1WTQA 3S2HB 1GUWA 3RLFA 3VR3A 1PRTD 2OT2A 1Y8OB 2D9UA 3A54A 1BOSA 2HQEA 2M9VA 1I50B 1UUPA 3GTQB 3EA6A 1SNMA 2JE6I 3MAQA 1KAAA 1PTOD 1WD1A 1I4PA 3NQIA 3J7AF 3FPUB 3QB3A 2EE1A 3NE5B 1SJHD 3H3VC 2B2WA 4KHVA 4FXDA 4JK1C 1XTCD 2VB2X 3MA2B 1SYFA 1SJED 3R2TA 4ZKCB 3VA5A 3TDQA 3NPPA 1MI2A 3NK9A 1ZXTA 5IGFA 1Y8PB 1SYGA 1BCPD 3GTJB 1CA6A 3S15B 1SEBD 3M85A 1W6JA 1I4QA 3PMFA 1OXUA 1F2MA 3M3YB 5DM63 1H9SA 2ZXRA 3HZXA 2EYFA 1JOQA 2QDBA 1LTRD 1MD2D 1IW7D 4QUFA 3LX0A 2A69C 2IX0A 5HGTA 2EJMA 1SBBB 4HMIA 1SE3A 2JA8B 3TP5A 3MFGA 2PO4A 2KECA 1AFPA 1NCVA 1RF2D 3BYTB 4XQQA 4TQUS 1S5ED 3EJIA 2F3WA 1EQVA 4N9PA 4ULLA 3PIO3 2X69A 1H9SB 2PW5A 3BVGA 1HCZA 4DGZA 3HOXB 5FOBB 1F9RA 1HUMA 1FNWA 3C1FA 4A3GB 3DEPA 3I70A 3FDTA 5A35A 1LLRD 1B50A 1A3UA 4RGTA 1DZ1A 1ZYRD 5CV9A 4PMWA 2WINB 4PQXA 2XIWA 3MVVA 1HFNA 1HTLD 1VMPA 4IUPA 2PMZB 1ESRA 2L12A 1CI3M 5EJWA 1DOLA 4KI0A 4CKCA 1BCPF 4KY7A 1VF7A 1TVXA 4FVMA 1CK1A 1BDOA 5CC4A 2NB0A 4EGVA 4K5WA 3BDLA 3MHBA 2EXZA 4S3SA 1HA5A 2VUMB 1M8AA 1PLFA 4BWGB 5AFWA 5D3IB 1SNQA 4ZUIA 1G6ZA 1JCKB 1RJTA 4XXEA 2O5IC 3D4RA 2F0FA 3EQLC 1CZWA 1D6EC 1RHPA 4RHSA 4DU9A 1EU3A 4K6LA 2L11A 2L5TA 3HS0C 1NAPA 1WTVA 2WB1B 2JYOA 3L9AX 2PZTA 1A2UA 1IHZA 2J0TD 2D2CC 4C3IB 5EBCA 1I6HB 2JEBI 1SYEA 4FO2A 2WKDA 1LABA 2K7VA 1D1KA 2Q8RE 4RKLA 1PZKD 1SXTA 2K28A 2DY8A 1EYAA 4X3KA 3E0JA 3KUPA 1OXVA 3SK4A 1QWYA 5IGEA 1TS5A 3DM1A 1ZYRC 1CHPD 3HOVB 1TWCB 2LKVA 2RDGA 4QF4A 1EY0A 4V0BA 4DK0A 3IL8A 2B2UA 2ID0A 3T56B 2IPKD 3EROA 4A3KB 2RSNA 4B08A 4H7BA 3MWYW 3HP3A 2XSCA 1VF5C 4C3JG 2A6HD 1Z6HA 1XWEA 3HOZB 2EYPA 1K8OA 2G9HD 1BUVT 2QKIC 5I6WA 1B2TA 2I46A 3MZ5A 1LTGD 2JXMB 4Q0FA 1W6KA 4L8JA 1VMCA 2NYZD 4DF7A 3VR4A 3I4LA 1WTXA 1Q1EA 3DMUA 4WRDA 2C9OA 1GUOA 2HCCA 1BXTA 1JC7A 4F7XA 1A3VA 4R8IA 2NUCA 5KEEA 1TS4A 4KN4C 3E6ZX 4RCOA 5BN4A 1GUTA 4FF3A 3P7JA 2ZT9C 1U4MA 2E2IB 1EIHA 1SMYD 4ME5A 2EYHA 2KEEA 2KUMA 1JWSD 1V1PB 2F0VA 5IGCA 3PUZA 3NTIA 1S5FD 1DONA 3DXJC 1EQTA 3PV0A 4RAUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSC A;  1QNU A;  1C48 A;  1DM0 B;  1D1K A;  4P2C B;  1R4Q B;  2BOS A;  1BOS A;  1C4Q A;  2C5C A;  3MXG A;  1CQF A;  1CZW A;  2GA4 B;  1D1I A;  4ULL A;  1CZG A;  1R4P B;  1QOH A;  4M1U B; 
#chains in the Genus database with same CATH topology
 1E7Z A;  4G57 A;  3W1G A;  5JVH 3;  4A3E B;  4C56 C;  3RZD H;  4DR7 Q;  3K5N A;  1PHJ A;  3K7A H;  3U4Z A;  2AUJ D;  1TWC H;  4C3H G;  2A68 C;  4B9X A;  5T1I A;  2QEX A;  3MXU A;  2K05 A;  3KK7 A;  3TBI B;  1EQQ A;  3GTM H;  2ASB A;  4C2M B;  1B7Y B;  4HMJ A;  5IOC A;  1EFI D;  1ENC A;  2OXP A;  1B9N A;  3FHW A;  5CV5 A;  1VCI A;  4C1N K;  1PH7 A;  2MFI A;  1QVC A;  2VB3 X;  4HJ7 A;  1PH3 A;  2VNU D;  2JA8 G;  2WKC A;  4POG A;  4BXX G;  2MJ8 A;  2CQA A;  3N52 A;  3PO3 G;  5C4J B;  3MXN A;  1YJN A;  1PTO B;  3L7Z C;  3ULP A;  1PH1 A;  1IBK L;  1X6O A;  3K81 C;  5KND A;  2XVS A;  3J81 i;  2A6H C;  1B53 A;  1F77 A;  4B3S Q;  4EVO A;  4LMQ D;  5E4W C;  3S14 H;  1HQR D;  1X3P A;  3QOJ A;  1HR0 W;  2IJ0 A;  4L5S A;  4AIM A;  3S16 H;  4FF2 A;  2M00 A;  4IUT A;  3HOX G;  3S1M H;  1VQN A;  4A3D B;  4J6H A;  4A3F H;  2F0D A;  1KAB A;  1SN8 A;  5GAE C;  1X65 A;  2JSO A;  1Y1W H;  3MC0 B;  1L0Y B;  5JVG 3;  4HAE A;  1GHK A;  4A3G G;  2NZO A;  2KA7 A;  1OXX K;  3M4P A;  1E0B A;  1V1O A;  3CPF A;  1Q81 C;  2ZTD A;  1AE3 A;  5C44 H;  4A4I A;  2B3G A;  3HKZ B;  3MEH A;  2VXW A;  3MTS A;  5EGT A;  5CBE E;  4FF4 A;  3J7A 5;  4J8Q A;  3SDZ A;  2K5D A;  2IX1 A;  2WAQ B;  1GXD C;  1HNZ L;  1MBY A;  2HHH Q;  4KN7 C;  5M5X H;  2LXK A;  4OX9 L;  1TU2 B;  3D31 A;  1Y8N B;  4DR5 Q;  4WJ4 A;  1AEX A;  1KDC A;  3S17 B;  3D4D A;  4A3M G;  2CH4 A;  1WYD A;  1LTA D;  1SYD A;  2TSS A;  4JI6 Q;  3D3R A;  4JI3 L;  2NWG A;  5E7N A;  4ZAI A;  3GTK B;  4IUQ A;  4DV4 Q;  3RR5 A;  2E2D C;  3A5Z B;  1CT1 D;  1EYC A;  4ME3 A;  1Q46 A;  4OO1 I;  4FXK C;  3EBE A;  3S2D B;  1PA6 A;  3GQB A;  3CC4 A;  5C3E B;  3SGI A;  3I4N G;  3AMU A;  2F1M A;  2K33 A;  2K5N A;  4DXF A;  1XNR L;  1AE2 A;  3S1N B;  1F9Q A;  3SVM A;  4A93 H;  1IBK Q;  1TS2 A;  1O7Y A;  3GV3 A;  3H0G H;  4C3H H;  2X6G A;  3B6Y A;  1N34 Q;  4YCV A;  1BKB A;  1SR3 A;  3L3O C;  2NBF A;  1TWH H;  3S24 A;  2VUM G;  5J3B A;  5LL6 S;  4B3R Q;  4DV1 Q;  2F4V L;  1GJX A;  1ET9 A;  3OTO L;  4IOC A;  2OQ0 A;  4BXX H;  1RTO A;  1K3R A;  1YJ9 A;  4A3B G;  3I91 A;  1STG A;  1KRS A;  3GTP B;  2LS0 1;  4DR7 L;  3BS1 A;  4LF9 Q;  3G6E A;  2JN4 A;  3CRL C;  3GV6 A;  4RG1 A;  1FNV A;  5BN5 A;  2NVT H;  5C4X B;  2EYL A;  4OWW B;  2RHS B;  1AN8 A;  3QOL A;  4JI7 Q;  3AQQ A;  3HOW G;  3VR6 A;  4UP7 A;  1EEF D;  1RDP D;  3A0J A;  4HSP A;  5JPM C;  4A3F G;  2Z1C A;  1WTW A;  5D14 A;  2L55 A;  4ZKB B;  3OSO A;  5I6Y A;  3PO3 H;  2OTL A;  4LF5 L;  4KTA A;  4JI3 Q;  4DR2 L;  4A3C H;  1KNE A;  1ASY A;  4R8N A;  3SK6 A;  2KVM A;  2R7Z G;  5C44 G;  3UDX A;  4EQP A;  1QB5 D;  1CM9 A;  4LW1 A;  4XYO A;  1H9J A;  4MTK A;  3Q22 A;  4R4O A;  4RH6 A;  5C3E H;  2ZJR A;  5D65 A;  5C0X J;  3HOU H;  3KF8 B;  1VQ6 A;  3NTK A;  5C5L A;  1HNW Q;  1VQI A;  3A8J E;  3SE0 A;  1CQF A;  3TP8 A;  1J8I A;  2G5D A;  2BE5 C;  2ZXP A;  5IGB A;  2DN8 A;  3T1H Q;  2F0L A;  1Y1W G;  4JV5 L;  1X3G A;  4GKJ L;  3V2T A;  5J39 A;  1B3Q A;  3HOW H;  3A56 A;  4DV7 Q;  4QCL A;  1LTL A;  2XWB B;  1F2L A;  2ZTE A;  1YHQ A;  2UUB L;  1SMX A;  2EY1 A;  1UEA B;  5F2D A;  2RA4 A;  4X66 Q;  5GQO A;  1HNX Q;  4A76 A;  1ICF B;  3NBI A;  3G71 A;  5EKK A;  1N32 Q;  1O78 A;  5KNB A;  1Y69 U;  5EKL A;  4JC0 A;  1E2W A;  3H0G G;  2N3S A;  2I07 B;  3OMG A;  3C46 A;  3GTL B;  1F2Y A;  1BVS A;  1ET6 A;  1IKL A;  4G4K A;  4RHR A;  2UUC L;  4HJA A;  1P16 A;  3NWT A;  2Q8I B;  1VQ9 A;  3KLS A;  1EU4 A;  3KOJ A;  2PZW A;  1OTC A;  3WOE A;  4UP9 A;  1YIJ A;  4O2D A;  1ROD A;  4IFD H;  1EWH A;  3OW7 A;  5FK9 C;  2L0C A;  1BR9 A;  1X56 A;  2K1B A;  2K5V A;  1UAP A;  3C3L A;  5JJZ A;  4R4Q A;  4NW2 A;  5M3F B;  4A3B H;  3LWU A;  1YVC A;  4A3E H;  4K14 A;  4RMF A;  4LF5 Q;  5ELB A;  4DR3 L;  4A93 B;  5CV4 A;  4X66 L;  2AWO A;  2K5W A;  3D6W A;  3UI2 A;  1TQO A;  5IP9 H;  2AMC B;  1GHJ A;  5DAU A;  4RFB A;  2ICI A;  2O2L D;  4QGU A;  2RKS A;  2E5L L;  1A15 A;  4QB4 A;  3S1M B;  3RMH A;  2A5H A;  4C2M H;  1BCP C;  2NVY B;  4QIW B;  1EZ6 A;  2QCP X;  2I0Q A;  5LMU Q;  1E3P A;  4ILW A;  1KDB A;  1LO5 D;  3G6J B;  4PZ8 A;  5FO7 B;  2F0W A;  5KNC A;  1JE4 A;  2D0O A;  2KBN A;  1EQR A;  1AZQ A;  4Y7N B;  1STH A;  1TWA H;  3HOY G;  2NTS A;  4BS9 A;  1JQY D;  2AQ2 B;  3HOU B;  3K0Y A;  4EQO A;  3KBG A;  2Q2T A;  3ZYY X;  3FKI H;  4NKL A;  4DV6 L;  2UUA L;  3S16 B;  3J80 i;  3NEL A;  1WTO A;  1S40 A;  5CBA E;  3NXW A;  2ES2 A;  1SE4 A;  2K6A A;  3OMC A;  2BH8 A;  4YHH Q;  4ID6 A;  5FLX L;  1WVL A;  3OIQ A;  5FLX E;  5JOB A;  4IPC A;  3KJP A;  1STE A;  3PUV A;  1H9R A;  5T1G A;  4A3J H;  2YYZ A;  5DLQ E;  1QVF A;  4POF A;  1IBL L;  1PXU A;  1UNS A;  5J22 A;  5LMU L;  2VQF Q;  4MIU A;  1JOR A;  3TRZ A;  1C4Q A;  3OWF A;  3PUY A;  3PUW A;  2MO1 A;  4IJL A;  3MXG A;  4QY7 A;  1KTK A;  2E74 C;  3UDG A;  4GZY C;  1I4X A;  3ND9 A;  3I8Z A;  4IFD I;  2D62 A;  3F1Z A;  1LTI D;  1BCP B;  5HY6 A;  1YNN D;  2JA7 B;  1CKM A;  1NE3 A;  3K5O A;  1VQ5 A;  4JBM A;  5HUR A;  4OGQ C;  5G3L D;  3CKI B;  3M7G A;  4P2C B;  3ZJY C;  4LFB L;  5M5X B;  3OWE B;  1WJJ A;  2GVB A;  1L0W A;  1ZKO A;  1EY7 A;  1HNZ Q;  4QQB X;  4JV5 Q;  4MNO A;  5H1S E;  5IYD G;  4LFA L;  2E2J H;  1LAC A;  2SNM A;  1YJW A;  2L4N A;  1EWC A;  5JEA H;  1U4P A;  4DAY A;  2KCN A;  3QR8 A;  4DV1 L;  4DA2 A;  4TRD A;  2F4V Q;  1SNO A;  4CKB A;  2PQE A;  4XTC S;  5IYB G;  2R6G A;  3D4W A;  4A3G H;  4P75 A;  5FO8 B;  1O7Z A;  1XPR A;  2MHV A;  2XGT A;  5I4D A;  1DD2 A;  2WV6 D;  4CJ2 C;  1T5X D;  4GKK Q;  1SNP A;  2F0H A;  1J9O A;  1XMQ Q;  4HR7 B;  3T4A C;  2ZJP A;  4F88 A;  4GOP A;  2JQO A;  2F0I A;  5TSS A;  3S1Q B;  4KY5 A;  4YWM A;  4UP8 A;  1K8A C;  5JAV A;  1I50 H;  1B44 D;  3K7U C;  4PV1 C;  1TT2 A;  3H3V I;  4ZQ3 A;  2F4I A;  1F2Z A;  4JI8 Q;  1GD7 A;  3ERQ A;  3OHX C;  3RLO A;  2I5M X;  5NUC A;  1BO0 A;  1CSP A;  3FP9 A;  2IWH A;  5CV8 A;  5LL6 X;  4GLV B;  2RDH A;  3R8B A;  3A74 A;  1L0X B;  4CHT B;  4AYB G;  1DOK A;  5EBD A;  1PFB A;  4HTH A;  5M5W H;  3DUZ A;  2A19 A;  1GM5 A;  1Q82 C;  1R9T H;  2WII B;  4IOA A;  2K52 A;  4OO1 G;  5M9O A;  3F8T A;  1CQV A;  3CCE A;  5IP7 G;  1II3 A;  2XN9 C;  3TZU A;  2R92 B;  2VQE Q;  4ABN A;  1YIT A;  1QCB D;  4KK7 A;  4KD4 A;  1KLG D;  3RUZ A;  1K8G A;  4LFC Q;  4XIG S;  3S14 B;  2VZA A;  1VQ4 A;  2Z4H A;  2V4D A;  1HNW L;  3M3Y H;  4BBR H;  1FYC A;  2IL8 A;  2RDF A;  5BN3 A;  3UE1 A;  3E3X A;  1SRU A;  3A8I E;  1I4R A;  5FLM H;  1YEZ A;  4BY1 G;  2FMC A;  1HR0 Q;  2F03 A;  4RKB A;  5CGK A;  3FMC A;  3HRZ C;  2O5J C;  5JPN C;  3DWA A;  4DK3 C;  1XMO L;  2EDG A;  1DXM A;  3URY A;  3SEB A;  4KV6 A;  3J7Y W;  1EIG A;  5LMN L;  1CKN A;  2PZU A;  2DNC A;  3RZD B;  4JCV E;  1I6V C;  1I94 L;  2F0K A;  3K7A B;  5I9O A;  2B2T C;  2CH4 W;  4A3J G;  3R2I A;  5IP7 H;  3CF5 A;  5LMN W;  4M8A A;  3Q24 A;  3RZO H;  1LTS D;  4OIJ A;  3IRB A;  2CKZ B;  4XDX A;  4JI1 Q;  2WFW A;  3CCM A;  2WB1 G;  5ELF A;  4B3T L;  1IYV A;  1NR4 A;  4L5T A;  5GAD C;  1KC8 C;  3T16 A;  4DNT B;  1Y1V B;  1I3Q B;  1PFN A;  4NB3 A;  1G6P A;  1OO9 B;  4A3F B;  1JB7 A;  4A3K G;  2OWO A;  3F2U A;  4GNX B;  2Q2H A;  1IL8 A;  1D7Q A;  1O80 A;  2X6L A;  4C3J B;  3H3V H;  4PZ7 A;  3Q23 A;  2PW7 A;  1TR5 A;  4DR3 Q;  4M1U B;  1XPO A;  3BZK A;  3HOZ H;  4BY7 H;  1FNU A;  1PRT B;  3GDE A;  5BR8 Q;  2BDN A;  1NR2 A;  4ZCK A;  5C3X A;  4I7Z C;  1PH6 A;  1V1P A;  4P72 A;  3GTG B;  2I5H A;  1QG7 A;  2B2U C;  3U9S A;  1JJ2 A;  5M5W B;  4J1M A;  3HFZ B;  1HPC A;  2QGQ A;  5IYB H;  4JI4 Q;  1X3E A;  3AB9 A;  2JEA I;  1YNJ D;  4JPB W;  1EOT A;  1Y1W B;  2MGS A;  3BYY B;  2E75 C;  1PYW D;  1KRT A;  1MSG A;  4FNF A;  5KIX A;  1I4G A;  3S2D H;  3OYY A;  5E3F A;  2RSO A;  4X3T A;  1EYD A;  4EQ5 A;  2F3I A;  4RGN A;  2B2Y C;  4CBV A;  4ODG A;  3PO2 H;  4KMU C;  4JI8 L;  1Y1V H;  2BE5 D;  3LWE A;  4LJZ C;  4DV7 L;  1L1O B;  2K32 A;  1MIU A;  2F0E A;  5E4X A;  1PVO A;  2F3V A;  2XRQ D;  4DV0 L;  4X3U A;  5FO9 B;  5C0X I;  3BG3 A;  3VR2 A;  1ESF A;  3DWQ A;  5KYL A;  2EOT A;  2SDF A;  1R4Q B;  1ENA A;  3E9H A;  4QL5 A;  2Q8T A;  1T5E A;  4DR4 L;  1G2T A;  2M2L A;  4X3S A;  2QA4 A;  1DOM A;  4JI2 L;  1L1O A;  4K0K L;  1JWU D;  2B63 G;  4K2K A;  2O4X A;  4P74 A;  4K8I A;  3VYS A;  1PH4 A;  1T9H A;  3U4V A;  4A93 G;  1K83 B;  5K36 H;  3VYT A;  1D5X C;  4GOP B;  1I3Q H;  4A75 A;  4XYQ A;  1D5Z C;  5C3W A;  2ZM6 L;  1B9M A;  2QIL A;  4H02 A;  3KF6 B;  3T1H L;  1S5C D;  1MKH A;  2K5H A;  1IKM A;  4DV3 Q;  3L2P A;  2N49 A;  4YWK A;  5ISR A;  4B9W A;  3CXC A;  4NDX A;  2H1E A;  5M3M B;  2JA6 H;  4HCE A;  1O7I A;  1N36 L;  2N88 A;  1LT4 D;  3PO3 B;  1TXY A;  3HOY H;  4LK1 C;  3VA7 A;  2OEO A;  2CWP A;  1DM0 B;  5DM7 3;  4BBS H;  3EVQ A;  3R93 A;  2YV5 A;  2KEN A;  1EY6 A;  3S1R B;  3J81 c;  3M4Q A;  5IE8 A;  4WOR A;  4FP5 D;  5IOD A;  2EJG C;  2Z8L A;  3C2P A;  3SK8 A;  3QIA A;  1MSH A;  3GTJ H;  2LY7 A;  1RKN A;  1PH8 A;  2IHF A;  2IT1 A;  2NN6 H;  4DAM A;  4IN3 A;  2EY2 A;  4O42 A;  4R4I A;  4LFA Q;  3TS0 A;  4BA2 I;  4OIK A;  1N33 L;  1Z7T A;  5IGG A;  5I9P A;  2QW7 A;  4KY6 A;  1VQJ A;  3Q8D A;  2UU9 Q;  3H94 A;  2JJQ A;  2HDM A;  3HKZ G;  1PTO H;  1U9R A;  1KL9 A;  2EPB A;  1C7Y A;  1SND A;  3PQI A;  2N78 A;  1TWG B;  2H5X A;  3Q6S A;  4CJ0 B;  4C3I G;  4CJ1 B;  5CV6 A;  3TS2 A;  2PI2 A;  4K2L A;  2WAC A;  4JG2 A;  4JYA Q;  1IBL Q;  1M90 C;  1OXS C;  1SMY C;  3ITP A;  3W3A A;  2KJX A;  3CC7 A;  2B29 A;  1PRT F;  3F2B A;  1BQQ T;  1IBM Q;  4UPA A;  4OL7 A;  1L2F A;  2AQ3 B;  2B2V A;  3WOF A;  3K59 A;  3R3O A;  4I7A A;  2UUA Q;  1EZ8 A;  4DN4 M;  5AJ3 Q;  3F2D A;  1N9W A;  3CW2 C;  3GTL H;  4IUU A;  3IKJ A;  1Q86 C;  1CSQ A;  3ICE A;  1WFQ A;  1K8M A;  5IT9 E;  3TN2 A;  2VQE L;  5IT9 L;  2R7F A;  1Q12 A;  4LF7 Q;  2OQK A;  1GUG A;  1XYI A;  4GN5 A;  2GN5 A;  5CV7 A;  3KF8 A;  1JWM D;  1TWH B;  2A73 B;  2PNH A;  4G7H C;  3NUC A;  4CDE C;  2RQX A;  2ZXO A;  2F0O A;  4Y7N H;  3HKZ E;  1E1T A;  2F0T A;  4A3B B;  1EY9 A;  4UHV A;  1SDF A;  3BJU A;  2KOL A;  1ILP A;  1WD0 A;  1QZH A;  2MNA A;  3FKI B;  1VQP A;  1GVP A;  3MXP A;  5D3D A;  4HJ8 A;  1MGS A;  2G9D A;  4KHZ A;  4ALP A;  2Z6B A;  1EYG A;  4NXM L;  1DGS A;  1IYJ B;  4PNY A;  2L1B A;  4BY7 B;  1U0L A;  2B2W C;  1NBW A;  1U5K A;  4U67 3;  4IUR A;  3I56 A;  2CVR A;  4KKT A;  4N8F A;  1IW7 C;  4O1N A;  1QZG A;  5C3E G;  1HA6 A;  3I4N B;  1S4Z A;  5C4X H;  1X3Q A;  1ZEQ X;  5EPL A;  3MFY A;  4B3M L;  1BNZ A;  4JI5 Q;  2JA6 G;  4LNQ A;  1LT5 D;  4DV0 Q;  3K5M A;  4DR5 L;  2NVQ B;  2BCO A;  1RTN A;  1RD9 D;  1BBU A;  2K01 A;  3OTO Q;  2E2J B;  5ELE A;  3KYH C;  1JR0 D;  1HZC A;  3EFX D;  4IQZ A;  1CHQ D;  1RIP A;  3JAM E;  4JI4 L;  2J7Z A;  3J7Z C;  2BDO A;  3RNU A;  1SFO B;  3PIO A;  1FJG L;  3M4Y A;  2R7Z B;  2LXJ A;  4XQN A;  3JAM c;  3STB C;  1I4H A;  4YIJ A;  2RBM A;  3GTM B;  3A5U A;  3DEO A;  2R3Z A;  1E2V A;  1SYC A;  3NBH B;  5C4J H;  4KD3 A;  4X6A H;  4WJW A;  1TWF B;  3W5O A;  2NN6 G;  3IFT A;  4YCU A;  2OTJ A;  3AYH B;  2HHH L;  4YWL A;  4A3J B;  5JJK A;  2AQ1 B;  5C4X G;  3SHL A;  3EN2 A;  4HID A;  3V05 A;  4B3M Q;  1QE6 A;  2D5D A;  4L5R C;  1PTO F;  1QNU A;  5IIF A;  4DFA A;  1MJE A;  2RHQ B;  1M4V A;  2YU9 H;  1B1Z A;  4AYB B;  4A3D H;  1IBM L;  1B8A A;  4A3E G;  4KKU A;  2FHT A;  4R4T A;  3TQY A;  4NPS A;  1IL2 A;  1YI2 A;  2JA7 H;  3NWS A;  2JA5 H;  4DAY B;  4I65 A;  2B8G A;  4DUZ Q;  1E24 A;  2Z4I A;  3CCS A;  1LM0 A;  3SR1 A;  3TRE A;  4JYA L;  1V1Q A;  4C1N I;  1GUS A;  4E6I A;  5EPJ A;  2Z9H A;  4BBR B;  3J80 L;  1FD7 D;  1SLJ A;  4U68 A;  3I4M G;  2K03 A;  2HIX A;  2JP1 A;  3ULL A;  1B3A A;  3I72 A;  2AWN A;  4OHJ A;  4R9W A;  3M9B A;  1G29 1;  3PSI A;  2BA1 A;  2I5L X;  3S2H H;  1KDA A;  1K28 A;  2EYM A;  3A8K E;  2QEJ C;  3G48 A;  3FVQ A;  1JB3 A;  1GO3 E;  4Z9C B;  4GKK L;  1C48 A;  3TEH B;  1V8Q A;  4LF9 L;  1I5F A;  3IAY A;  4DK6 C;  1A62 A;  4KJN A;  3HOX H;  1ML0 D;  1O7L A;  2AUK A;  3S1N H;  5E1F A;  4B3T Q;  1AW7 A;  1SFO H;  3U50 C;  4R1J A;  1K73 C;  2IY5 B;  2XRS D;  1B70 B;  4JI0 L;  2FIN B;  3T13 A;  1GUN A;  4PMC A;  2N55 A;  4G7Z C;  2HUG A;  4G7O C;  1S5B D;  2ENB A;  1WCM B;  1OXT A;  4K5V A;  1VQA A;  3VYU A;  4DK1 A;  5IT9 c;  3X3N A;  3HOY B;  4F8M A;  4GNX C;  1X32 A;  2F0P A;  2R93 B;  3UE0 A;  2GVA A;  4X64 Q;  1STB A;  3H6M A;  1A3T A;  5LHY 1;  3H09 A;  3CPW A;  1VQ8 A;  1HNX L;  1LTB D;  2WAQ G;  3LNN A;  4KKS A;  2NN6 I;  2R92 H;  4F87 A;  1TWA B;  5C6A A;  1DCZ A;  1Q8I A;  2C5C A;  3D8G A;  4DNI A;  1VQO A;  3DWP A;  2CW0 D;  3CCJ A;  3FRP B;  3M7N A;  3T1Y L;  4TKO B;  3WDN A;  1EFW A;  3J81 E;  2A74 C;  2PPB C;  1WTP A;  2YU9 B;  1KNA A;  2B8F A;  2F0G A;  4RGM A;  2XWJ B;  1H95 A;  2CQO A;  2MUY A;  1FJG Q;  3KLR A;  4HJ5 A;  1K3B C;  1AP0 A;  2NVT B;  3A55 A;  3KF6 A;  2E2I H;  3CCR A;  1HRJ A;  1EY8 A;  3S15 H;  4K6D A;  5J1Z A;  1HR0 L;  3S9W A;  1SRO A;  1VS0 A;  4NMZ A;  1K0R A;  1QUQ A;  3TP6 A;  3AFP A;  3BVZ A;  2DNE A;  5ELC A;  2JA7 G;  3OPO A;  3GP7 A;  1Z9F A;  3ND8 A;  3GD7 A;  2MPM A;  3GTP H;  2UXD Q;  3GTQ H;  2E76 C;  3T51 B;  2ZM6 Q;  1BBX C;  5CR3 A;  2Z6K C;  2TMP A;  3BZC A;  1K9M C;  2HCI A;  3AEV A;  2R61 A;  1K0S A;  3U58 A;  5GAH C;  4ZUJ A;  1EY5 A;  1MHW C;  4YY3 L;  1SE2 A;  2FMM A;  4DXG A;  2OF1 A;  2UXB Q;  4DR2 Q;  1CTM A;  4A3D G;  1SAP A;  3BZD B;  4HCS A;  3K8A A;  3I73 A;  3CU7 A;  1V9P A;  3X3M A;  3JAM i;  4ZK9 B;  3P20 A;  3VDY A;  3A7L A;  3BDC A;  3CMA A;  1XMQ L;  1U4L A;  1JE5 A;  1STY A;  3K80 C;  2JA5 G;  2SOB A;  3ERS X;  3N6R A;  4X65 Q;  3T53 B;  1C8C A;  2L9H A;  4HED A;  3HOV G;  1J5E Q;  1UWV A;  3HOW B;  3PIP 3;  2NVX B;  4O0A A;  1D1I A;  4JOI C;  4DAP A;  5BR8 L;  3GTG H;  1A6X A;  1AH9 A;  2UXC L;  1QNK A;  2SEB D;  3T1Y Q;  1DJR D;  4JVZ A;  1W2B A;  5G3L F;  1JJC B;  2H4O A;  4FDB A;  1YZ6 A;  2R7Z H;  5C4Z A;  2N8N A;  4Y52 H;  4GOP C;  4BY1 H;  5C44 B;  1YNN C;  2LMC B;  2MP1 A;  2QF7 A;  3AU7 A;  1VQ7 A;  1D2B A;  4KJO A;  2EJF C;  1R9T B;  2CW0 C;  2Y0S B;  2R92 G;  1CZG A;  5KGU A;  4A3L G;  3NP8 A;  1PH5 A;  3HKS A;  1NMF A;  3FPP A;  2KCC A;  1UEB A;  1AZP A;  1Q1B A;  4A3I H;  2FXQ A;  1S3O A;  4X62 L;  1DYQ A;  4DKA C;  2F0Q A;  3NQT A;  4L6T B;  2JA8 H;  2BOS A;  3H91 A;  2J4X A;  1E22 A;  1PMR A;  4AH6 A;  1SNC A;  4B3R L;  1XXG A;  2A6E C;  1U4R A;  1QJO A;  1HXY D;  4H13 C;  4IUN A;  2IX3 A;  1A2T A;  5DNF A;  1XMO Q;  3RD4 A;  3CCQ A;  1BBW A;  4BBS B;  1PV4 A;  4HIM A;  2ATW A;  1EL0 A;  3H0G B;  2HQL A;  4L63 B;  3W2D A;  2A68 D;  1XPU A;  4QUC A;  1KLU D;  3FKI G;  3MXN B;  4PMB A;  4JI2 Q;  3DLL A;  2FJ2 A;  4IZ8 A;  1G2S A;  1Q8K A;  4YCW A;  2CCZ A;  2E5L Q;  1XNQ Q;  3STB D;  4RGO S;  5C0X H;  3RZO B;  4WJ3 M;  3GTO B;  4FF1 A;  4A3M H;  4MTN A;  2A69 D;  2F0M A;  4K5X A;  2PNR C;  5FKA C;  5IGD A;  2E2H B;  4LF8 Q;  4X62 Q;  4QMG A;  3CP0 A;  1G8Z D;  3PCO B;  5M3M H;  2JA6 B;  4TSS A;  4MZ9 A;  1PRT C;  3K6O A;  3K0X A;  3CCV A;  5JEA G;  4C3H B;  2B2T A;  2RCN A;  1EOV A;  3JAM L;  2NVX H;  1GOZ A;  4FXG C;  1VQE A;  2WP8 J;  5LMN Q;  4A3C G;  2KED A;  2PI2 E;  2Y0S E;  1NSN S;  4C3J H;  3V96 A;  2PYK A;  4ZYS A;  4AQY L;  1TY2 A;  3QWN A;  4DUY L;  3UDI A;  2R7D A;  3EIV A;  2EYO A;  3J81 j;  1IZ6 A;  1F9S A;  1JOK A;  2K5Q A;  3J80 E;  4HIK A;  1ICW A;  3KBX A;  3O13 A;  4PG3 A;  2VUM H;  4JI1 L;  3FEW X;  1JMC A;  1G51 A;  2EVB A;  4DUZ L;  1LV9 A;  5COY A;  3HG9 A;  2CFM A;  4JI7 L;  1KQS A;  3M4O B;  2V1C C;  2E8G A;  1HH2 P;  2NZH A;  4MHE A;  3IFD A;  1HZ9 A;  3U9O A;  3D6C A;  1PFM A;  3TME A;  3K5L A;  2F0J A;  3KDF B;  1STA A;  2GA4 B;  2ZJQ A;  1EIY B;  3K57 A;  3Q0A A;  2A6E D;  2HIV A;  3CQZ B;  4DV6 Q;  4LUV A;  1LT6 D;  2HDL A;  5JEA J;  2A8V A;  5C5M A;  1EWI A;  4XT1 B;  5EPK A;  2UXD L;  1G91 A;  5ELD A;  1WTR A;  3F2C A;  2BA0 A;  1VQB A;  4HN7 A;  4ZLT F;  4NP5 A;  3K58 A;  4OO1 H;  3PO2 B;  3CME A;  4DUY Q;  5K36 G;  1SE8 A;  1TII D;  4CDD C;  4PZ6 A;  1CA5 A;  1LT3 D;  4UY8 C;  1EEI D;  3PGZ A;  4OEL B;  3I3C A;  2XNA C;  3P75 A;  4DNR B;  1B4O A;  2EY6 A;  2KHJ A;  3PUX A;  1PFS A;  3G7L A;  1X3F A;  4IAL A;  4IUV A;  1HQM C;  5IWA Q;  4DAV A;  4HSV A;  3D0F A;  4JI0 Q;  4KHP Q;  1HFG A;  3HGB A;  3I4M B;  3KLS X;  2K04 A;  2EYJ A;  2LSS A;  4UAI A;  3E9I A;  2B2Y A;  5HGQ A;  1XNR Q;  3QJY A;  4HIO A;  1HJP A;  2B63 B;  2PCF B;  2OCE A;  5I2Y A;  1S5D D;  5CMD A;  1A0I A;  4A3M B;  1FGB D;  1STN A;  5EQ0 A;  4CGY B;  3NTH A;  1A63 A;  2ICE C;  1YBY A;  2KHI A;  3C1E A;  1NTG A;  2EY5 A;  2SNS A;  1Q3L A;  3GO5 A;  1I94 Q;  3DM3 A;  1H9K A;  3NHH A;  3BDO A;  3J7A V;  3CAM A;  3NEM A;  4XQJ A;  2DUD A;  1SYB A;  3RLN A;  2YTX A;  1C9O A;  1E1O A;  2Z0S A;  5M3M G;  1F9P A;  1RCV D;  3GTK H;  4H0L C;  4JBW A;  1E2Z A;  2KQ3 A;  5DEH A;  4JI6 L;  5IYC H;  5FLM G;  1X55 A;  3NEN A;  4LAA A;  3L0O A;  2KHS A;  4KHP L;  5JJI A;  1JOO A;  1PTO C;  5EAY A;  2MO0 A;  4H44 C;  3NSW A;  1R4P B;  1WCM G;  3HEJ A;  1QIL A;  1PZJ D;  1D5M C;  4MN3 A;  1CKO A;  2EXD A;  2RVL A;  3P1H A;  3HOU G;  3TSS A;  5C0X G;  4P73 A;  1VQD A;  2NVY H;  5C4H A;  4IFD J;  2F0N A;  5EKI A;  3NBH A;  5FLX c;  5A2Q E;  4DV5 Q;  2DY7 A;  5I2X A;  3CCL A;  4BA1 I;  5M5Y B;  4LF8 L;  1KIX A;  5COR A;  2F0U A;  4V19 0;  2QDL A;  1WI5 A;  1YNX A;  4FYD A;  2CHB D;  4N8X 1;  4UDU C;  5CYU A;  3TP7 A;  1EY4 A;  1QOH A;  4K8J A;  3CHB D;  4OON A;  3J81 L;  1TS3 A;  1JT8 A;  1VQC A;  1TY0 A;  2ALY B;  4Q5V A;  4A3K H;  1SSO A;  2K50 A;  3BVM A;  5K5P A;  5ELN A;  3SXH A;  4KLK A;  5IP9 G;  1CFM A;  2BH2 A;  1PDQ A;  3PF4 A;  1LUZ A;  2NTT A;  3S1R H;  4A3I B;  3A7A B;  4DR1 Q;  4IFD G;  2PMZ E;  1FR3 A;  1JIC A;  1UE5 A;  4GKJ Q;  1TWG H;  1X54 A;  2Q2I A;  1ILQ A;  3RN5 A;  4RA8 A;  4N9T A;  4BY1 B;  4DV3 L;  1HUN A;  4DV2 L;  1ASZ A;  3VR5 A;  2WB1 E;  3VYR A;  4ZRZ A;  2LFN A;  2UU9 L;  5A2Q L;  3CRK C;  5IY0 A;  1XX8 A;  3TZD A;  5JJL A;  5KRU A;  1HTP A;  1TKW B;  3DHQ A;  3I90 A;  1V43 A;  4GLA C;  4LUZ A;  4EX5 A;  4DR6 L;  2F0S A;  3QG1 A;  1IYU A;  4L5Q A;  2EZV A;  1Z47 A;  1BF4 A;  2JA5 B;  1C0A A;  3SK5 A;  1H9M A;  2K75 A;  1ENF A;  1FVI A;  4EQN A;  4RWS C;  1Q90 A;  4XT3 B;  3GTO H;  4LUO A;  1GKH A;  2A1A A;  2FFK B;  4RCN A;  2B2V C;  2B39 A;  3OOC A;  4CKE A;  3QO2 A;  1Y1V G;  1PZI D;  1XTD A;  3E5S A;  1M1K C;  2UXB L;  4WFN 3;  1HHV A;  1NUC A;  3J80 c;  4DV5 L;  3I55 A;  1ONL A;  1UE1 A;  1VDZ A;  3ONA B;  2NZ1 D;  5IYC G;  1YNJ C;  3OIP A;  1LTT D;  2IW3 A;  5KYI A;  1I6H H;  1WTQ A;  3S2H B;  1GUW A;  3RLF A;  3VR3 A;  1PRT D;  3HOZ G;  2OT2 A;  4BY7 G;  4OWT B;  1Y8O B;  2D9U A;  3S1Q H;  4A3L H;  3A54 A;  1BOS A;  2HQE A;  4YHH L;  2M9V A;  2L15 A;  1I50 B;  1UUP A;  2Y0S G;  3GTQ B;  1KHI A;  3EA6 A;  1SNM A;  2JE6 I;  1QUQ B;  3MAQ A;  1KAA A;  2DJG C;  4JW0 A;  1PTO D;  4NXN L;  1WD1 A;  4YY3 Q;  1I4P A;  3M4O H;  3NQI A;  3S17 H;  3J7A F;  3CD6 A;  3FPU B;  2WAQ E;  3QB3 A;  2EE1 A;  4AYB E;  1WCM H;  1KAW A;  3NE5 B;  1SJH D;  3H3V C;  1K83 H;  2B2W A;  1VQF A;  1NJI C;  4KHV A;  4FXD A;  4JK1 C;  1XTC D;  4OXP A;  2VB2 X;  5FJ8 H;  1Q7Y C;  3MA2 B;  1SYF A;  1SJE D;  5AJ3 L;  3R2T A;  4ZKC B;  3H15 A;  1TWF H;  1CUK A;  1QVG A;  2UXC Q;  3VA5 A;  4JI5 L;  4QJF A;  2Q2U A;  3TDQ A;  3NPP A;  2JA9 A;  1MI2 A;  4LF6 L;  2VS1 A;  3NK9 A;  1ZXT A;  5IGF A;  3I4M H;  1Y8P B;  1SYG A;  4GLX A;  1BCP D;  5IWA L;  3GTJ B;  1CA6 A;  3S15 B;  1RL2 A;  1SEB D;  3M85 A;  1W6J A;  1I4Q A;  3PMF A;  1OXU A;  2IHE A;  1F2M A;  3M3Y B;  5DM6 3;  2EIF A;  1H9S A;  2ZXR A;  3HZX A;  2EYF A;  1JOQ A;  2QDB A;  1LTR D;  1MD2 D;  1IW7 D;  1W3S A;  4QUF A;  3LX0 A;  4BBR G;  2A69 C;  2IX0 A;  1Y14 B;  5HGT A;  1IXR A;  2EJM A;  1SBB B;  4HMI A;  3WWV A;  1SE3 A;  2JA8 B;  4GN3 B;  3TP5 A;  4CDF C;  3MFG A;  2PO4 A;  2KEC A;  1AFP A;  1NCV A;  1RF2 D;  4R4C A;  3UDF A;  3BYT B;  4XQQ A;  1UE6 A;  4TQU S;  1S5E D;  3EJI A;  2F3W A;  1EIF A;  1EQV A;  4N9P A;  4TVA B;  4ULL A;  2EQS A;  3PIO 3;  3PF5 A;  4LFC L;  2UUC Q;  1EUJ A;  2X69 A;  2RF4 A;  1H9S B;  2PW5 A;  5M5Y H;  3BVG A;  1HCZ A;  4IPD A;  4DGZ A;  3HOX B;  5FOB B;  1PYB A;  1F9R A;  3PO2 G;  4DV2 Q;  2DJF C;  2RCF A;  1HUM A;  1FNW A;  3C1F A;  3I4O A;  4A3G B;  1VQK A;  3DEP A;  3I70 A;  1WTH A;  1FL0 A;  3FDT A;  5A35 A;  2KCT A;  4DV4 L;  1NNX A;  1MJC A;  2VW9 A;  3JC6 6;  1LLR D;  1B50 A;  4P71 A;  1A3U A;  2ZTC A;  4RGT A;  2DGY A;  1DZ1 A;  2P5Z X;  4C3I H;  4K0K Q;  1ZYR D;  5CV9 A;  3KJO A;  4PMW A;  2WIN B;  4PQX A;  3I7F A;  2XIW A;  3MVV A;  1HFN A;  1HTL D;  3BU2 A;  1KXL A;  1N34 L;  3I2Z A;  2KCM A;  1VMP A;  4IUP A;  3PIP A;  5ELO A;  4DR1 L;  1PH2 A;  2PMZ B;  1ESR A;  4GNX A;  2JK8 A;  2L12 A;  1CI3 M;  5EJW A;  2YTY A;  1DOL A;  2E2H H;  4KI0 A;  4CKC A;  3CCU A;  1BCP F;  4KY7 A;  1VF7 A;  1N36 Q;  1TVX A;  4IPG A;  4FVM A;  4IPH A;  2K4K A;  5FJ8 G;  1CK1 A;  3E0E A;  1BDO A;  5CC4 A;  2NB0 A;  4OEM B;  3I4N H;  4EGV A;  2VL6 A;  1VQH A;  4K5W A;  3BDL A;  4DR6 Q;  3MHB A;  2EXZ A;  4LF4 Q;  4S3S A;  1PYS B;  2NVQ H;  3HOV H;  1KD1 C;  1HA5 A;  2VUM B;  1M8A A;  1PLF A;  2R93 G;  4BWG B;  5AFW A;  1CKN B;  4LF6 Q;  3LGJ A;  2CWA A;  5D3I B;  1SNQ A;  2VY3 A;  5IYD H;  4ZUI A;  1G6Z A;  1JCK B;  4APV A;  1RJT A;  2C35 B;  4XXE A;  2O5I C;  3D4R A;  5M3F H;  2F0F A;  1VQM A;  3EQL C;  1CZW A;  1D6E C;  1RHP A;  4RHS A;  4DU9 A;  3G4S A;  2Z6K A;  4QIW E;  1EU3 A;  1UE7 A;  4K6L A;  2B63 H;  2L11 A;  4OWX B;  3RN2 A;  2L5T A;  3HS0 C;  1NAP A;  1WTV A;  1PH9 A;  2WB1 B;  2JYO A;  3L9A X;  4LFB Q;  2PZT A;  1A2U A;  1IHZ A;  2J0T D;  2PQA B;  1XJV A;  1WOC A;  4LF4 L;  2D0P A;  4OX9 Q;  1YHA A;  2D2C C;  4JBK A;  3KLW A;  4NXN Q;  4C3I B;  5EBC A;  4A3I G;  1VQG A;  1I6H B;  2JEB I;  1SYE A;  2HT1 A;  3KDF A;  4FO2 A;  4DR4 Q;  1JJG A;  3KFU A;  2WKD A;  4HJ9 A;  1LAB A;  5GAG C;  2K7V A;  1D1K A;  1P8L A;  2Q8R E;  4RKL A;  2F52 A;  1PZK D;  1SXT A;  2K28 A;  2DY8 A;  4JOI A;  1J5E L;  1VQL A;  1EYA A;  4X3K A;  3CC2 A;  3E0J A;  3KUP A;  2MQH A;  2K14 A;  1OXV A;  3SK4 A;  1N32 L;  4B3S L;  1QWY A;  5IGE A;  1FGU A;  1TS5 A;  2YTV A;  3DM1 A;  4GN4 B;  1S72 A;  4IJH A;  1ZYR C;  1CHP D;  4LF7 L;  3HOV B;  1YHB A;  3W1B A;  1TWC B;  1NMG A;  2LKV A;  1HZA A;  2RDG A;  4QF4 A;  1EY0 A;  4V0B A;  4DPG A;  4DK0 A;  1NY4 A;  3IL8 A;  2B2U A;  4GS3 A;  2ID0 A;  4BBS G;  3T56 B;  2IPK D;  3ERO A;  4LWC A;  4A3K B;  2RSN A;  4B08 A;  4H7B A;  3MWY W;  3HP3 A;  2HD3 A;  2XSC A;  1VF5 C;  2A6H D;  4C3J G;  1XNQ L;  1Z6H A;  1XWE A;  4X65 L;  3HOZ B;  2EYP A;  1K8O A;  2R93 H;  2G9H D;  1BUV T;  2QKI C;  5I6W A;  4CDC C;  1N8R C;  1B2T A;  5GRO A;  2I46 A;  3MZ5 A;  1J6Q A;  1LTG D;  3MEF A;  2JXM B;  4Q0F A;  1W6K A;  4L8J A;  1VMC A;  2NYZ D;  5M3F G;  2AKW B;  3ER0 A;  4DF7 A;  1N33 Q;  3VR4 A;  3I4L A;  1WTX A;  1Q1E A;  3DMU A;  4WRD A;  2VQF L;  2C9O A;  1GUO A;  2HCC A;  1BXT A;  1JC7 A;  2PQA A;  4F7X A;  2XTI A;  1A3V A;  3AFQ A;  4R8I A;  2AHO B;  4JBJ A;  1LYL A;  4NXM Q;  2NUC A;  5KEE A;  1A8V A;  1TS4 A;  4KN4 C;  3E6Z X;  1X9N A;  1HZB A;  5L37 A;  4RCO A;  5BN4 A;  1GUT A;  4FF3 A;  3P7J A;  1L1O C;  2ZT9 C;  1U4M A;  2E2I B;  1EIH A;  1SMY D;  4ME5 A;  2EYH A;  4IO9 A;  2KEE A;  2KUM A;  4J15 A;  1JWS D;  1V1P B;  2UUB Q;  2F0V A;  5IGC A;  3PUZ A;  3NTI A;  4X64 L;  1S5F D;  1DON A;  3DXJ C;  1EQT A;  3PV0 A;  1D8L A;  3ULJ A;  3CQZ H;  4RAU C;  3OW2 A;  4AQY Q; 
#chains in the Genus database with same CATH homology
 4G57 A;  5JVH 3;  4A3E B;  4C56 C;  3K5N A;  2AUJ D;  4C3H G;  2A68 C;  4B9X A;  5T1I A;  3MXU A;  2K05 A;  3KK7 A;  3TBI B;  4C2M B;  4HMJ A;  5IOC A;  1EFI D;  1ENC A;  2OXP A;  1B9N A;  5CV5 A;  1VCI A;  4C1N K;  2VB3 X;  2VNU D;  2WKC A;  2MJ8 A;  2CQA A;  3N52 A;  5C4J B;  3MXN A;  1PTO B;  3L7Z C;  5KND A;  2XVS A;  2A6H C;  1B53 A;  1F77 A;  4EVO A;  4LMQ D;  5E4W C;  1HQR D;  1X3P A;  3QOJ A;  2IJ0 A;  4FF2 A;  2M00 A;  4IUT A;  4A3D B;  4J6H A;  2F0D A;  1KAB A;  2JSO A;  3MC0 B;  1L0Y B;  5JVG 3;  4HAE A;  1GHK A;  2KA7 A;  1OXX K;  1E0B A;  1V1O A;  3HKZ B;  5EGT A;  3MEH A;  5CBE E;  2VXW A;  3MTS A;  4FF4 A;  4J8Q A;  3SDZ A;  2K5D A;  2IX1 A;  2WAQ B;  1GXD C;  1MBY A;  4KN7 C;  1TU2 B;  3D31 A;  1Y8N B;  1AEX A;  1KDC A;  3S17 B;  3D4D A;  1LTA D;  1SYD A;  2TSS A;  3D3R A;  2NWG A;  4ZAI A;  3GTK B;  4IUQ A;  2E2D C;  1CT1 D;  1EYC A;  4OO1 I;  4FXK C;  3S2D B;  3GQB A;  5C3E B;  3AMU A;  2F1M A;  2K33 A;  4DXF A;  3S1N B;  1F9Q A;  3SVM A;  1TS2 A;  1O7Y A;  3GV3 A;  2X6G A;  3L3O C;  2NBF A;  5LL6 S;  1GJX A;  1ET9 A;  1RTO A;  3I91 A;  1STG A;  3GTP B;  2LS0 1;  3BS1 A;  3CRL C;  3GV6 A;  5BN5 A;  1FNV A;  5C4X B;  2EYL A;  1AN8 A;  3QOL A;  3VR6 A;  1EEF D;  1RDP D;  4HSP A;  5JPM C;  2Z1C A;  1WTW A;  5D14 A;  2L55 A;  4ZKB B;  3OSO A;  5I6Y A;  4KTA A;  1KNE A;  4R8N A;  3SK6 A;  2KVM A;  4EQP A;  1QB5 D;  1CM9 A;  4XYO A;  1H9J A;  3Q22 A;  4RH6 A;  5D65 A;  5C0X J;  3NTK A;  5C5L A;  3A8J E;  3SE0 A;  1CQF A;  3TP8 A;  1J8I A;  2BE5 C;  2ZXP A;  5IGB A;  2DN8 A;  2F0L A;  3V2T A;  5J39 A;  3A56 A;  4QCL A;  2XWB B;  1F2L A;  2EY1 A;  1UEA B;  5F2D A;  2RA4 A;  3NBI A;  5EKK A;  1O78 A;  5KNB A;  1Y69 U;  5EKL A;  1E2W A;  3OMG A;  3C46 A;  2I07 B;  3GTL B;  1F2Y A;  1ET6 A;  1IKL A;  4G4K A;  4RHR A;  3NWT A;  2Q8I B;  3KLS A;  1EU4 A;  2PZW A;  3WOE A;  1ROD A;  4IFD H;  1EWH A;  3OW7 A;  5FK9 C;  2L0C A;  1BR9 A;  2K1B A;  1UAP A;  3C3L A;  5JJZ A;  5M3F B;  4NW2 A;  3LWU A;  4K14 A;  5ELB A;  4A93 B;  5CV4 A;  2AWO A;  2K5W A;  3D6W A;  3UI2 A;  1TQO A;  1GHJ A;  5DAU A;  4RFB A;  2ICI A;  2O2L D;  2RKS A;  1A15 A;  4QB4 A;  3S1M B;  3RMH A;  2A5H A;  1BCP C;  2NVY B;  4QIW B;  1EZ6 A;  2QCP X;  4ILW A;  1KDB A;  1LO5 D;  3G6J B;  5FO7 B;  2F0W A;  5KNC A;  1JE4 A;  1AZQ A;  4Y7N B;  1STH A;  2NTS A;  4BS9 A;  1JQY D;  2AQ2 B;  3HOU B;  3K0Y A;  4EQO A;  3KBG A;  3ZYY X;  4NKL A;  3S16 B;  1WTO A;  5CBA E;  3NXW A;  1SE4 A;  2K6A A;  3OMC A;  4ID6 A;  5FLX L;  1WVL A;  3OIQ A;  5FLX E;  5JOB A;  1STE A;  3PUV A;  1H9R A;  5T1G A;  2YYZ A;  1PXU A;  5J22 A;  1UNS A;  4MIU A;  1JOR A;  1C4Q A;  3OWF A;  3PUY A;  3PUW A;  3MXG A;  1KTK A;  2E74 C;  4GZY C;  1I4X A;  3ND9 A;  3I8Z A;  4IFD I;  2D62 A;  1LTI D;  1BCP B;  1YNN D;  2JA7 B;  3K5O A;  5HUR A;  4OGQ C;  5G3L D;  3CKI B;  3M7G A;  4P2C B;  5M5X B;  3OWE B;  1ZKO A;  1EY7 A;  1LAC A;  2SNM A;  2L4N A;  1EWC A;  5JEA H;  1U4P A;  4DAY A;  2KCN A;  4DA2 A;  4TRD A;  1SNO A;  4CKB A;  2PQE A;  4XTC S;  2R6G A;  3D4W A;  5FO8 B;  1O7Z A;  2MHV A;  5I4D A;  1DD2 A;  2WV6 D;  4CJ2 C;  1T5X D;  1SNP A;  2F0H A;  1J9O A;  4HR7 B;  3T4A C;  4F88 A;  2F0I A;  5TSS A;  3S1Q B;  4KY5 A;  5JAV A;  1B44 D;  4PV1 C;  1TT2 A;  4ZQ3 A;  2F4I A;  1F2Z A;  3ERQ A;  3OHX C;  5NUC A;  1BO0 A;  2IWH A;  5CV8 A;  5LL6 X;  2RDH A;  3R8B A;  1L0X B;  4CHT B;  1DOK A;  5EBD A;  1PFB A;  4HTH A;  3DUZ A;  2WII B;  4OO1 G;  5M9O A;  1CQV A;  1II3 A;  2XN9 C;  3TZU A;  2R92 B;  4ABN A;  1QCB D;  4KK7 A;  4KD4 A;  1KLG D;  3RUZ A;  3S14 B;  4XIG S;  2Z4H A;  2V4D A;  1FYC A;  2IL8 A;  2RDF A;  5BN3 A;  3A8I E;  1I4R A;  2FMC A;  2F03 A;  4RKB A;  5CGK A;  3FMC A;  3HRZ C;  2O5J C;  5JPN C;  3DWA A;  2EDG A;  1DXM A;  3URY A;  3SEB A;  4KV6 A;  3J7Y W;  1EIG A;  2PZU A;  3RZD B;  2DNC A;  1I6V C;  2F0K A;  3K7A B;  5I9O A;  2B2T C;  3R2I A;  4M8A A;  3Q24 A;  1LTS D;  4OIJ A;  4XDX A;  5ELF A;  1IYV A;  1NR4 A;  3T16 A;  4DNT B;  1Y1V B;  1I3Q B;  1PFN A;  1OO9 B;  4A3F B;  3F2U A;  1IL8 A;  1O80 A;  2X6L A;  4C3J B;  3Q23 A;  2PW7 A;  1TR5 A;  4M1U B;  1FNU A;  1PRT B;  2BDN A;  1NR2 A;  5C3X A;  4I7Z C;  1V1P A;  3GTG B;  3U9S A;  1QG7 A;  2B2U C;  5M5W B;  4J1M A;  1HPC A;  3AB9 A;  2JEA I;  1YNJ D;  1EOT A;  1Y1W B;  2MGS A;  3BYY B;  2E75 C;  1PYW D;  1MSG A;  4FNF A;  5KIX A;  1I4G A;  5E3F A;  2RSO A;  4X3T A;  1EYD A;  4RGN A;  2B2Y C;  4CBV A;  4ODG A;  4KMU C;  2BE5 D;  3LWE A;  4LJZ C;  2K32 A;  5E4X A;  2F0E A;  2F3V A;  2XRQ D;  4X3U A;  5FO9 B;  5C0X I;  3BG3 A;  3VR2 A;  1ESF A;  3DWQ A;  5KYL A;  2EOT A;  2SDF A;  1R4Q B;  1ENA A;  2Q8T A;  1T5E A;  1G2T A;  2M2L A;  4X3S A;  1DOM A;  1JWU D;  4K2K A;  2O4X A;  4K8I A;  3VYS A;  1K83 B;  5K36 H;  3VYT A;  1D5X C;  4XYQ A;  1D5Z C;  5C3W A;  1B9M A;  2QIL A;  1S5C D;  1IKM A;  5ISR A;  4B9W A;  4NDX A;  2H1E A;  5M3M B;  4HCE A;  2N88 A;  1LT4 D;  3PO3 B;  4LK1 C;  3VA7 A;  2OEO A;  1DM0 B;  5DM7 3;  3EVQ A;  3R93 A;  1EY6 A;  3S1R B;  4WOR A;  4FP5 D;  5IOD A;  2EJG C;  2Z8L A;  3C2P A;  3SK8 A;  3QIA A;  1MSH A;  2LY7 A;  1RKN A;  2IT1 A;  2NN6 H;  4IN3 A;  2EY2 A;  4O42 A;  4BA2 I;  4OIK A;  1Z7T A;  5IGG A;  5I9P A;  4KY6 A;  3H94 A;  2HDM A;  1PTO H;  1U9R A;  2EPB A;  1SND A;  1TWG B;  3Q6S A;  4CJ0 B;  4C3I G;  4CJ1 B;  5CV6 A;  4K2L A;  2WAC A;  1OXS C;  1SMY C;  3ITP A;  3W3A A;  2KJX A;  1PRT F;  1BQQ T;  4OL7 A;  2AQ3 B;  2B2V A;  3WOF A;  3K59 A;  3R3O A;  1EZ8 A;  4DN4 M;  4IUU A;  3IKJ A;  1K8M A;  5IT9 E;  3TN2 A;  5IT9 L;  1Q12 A;  1GUG A;  1XYI A;  5CV7 A;  3KF8 A;  1JWM D;  1TWH B;  2A73 B;  4G7H C;  3NUC A;  2RQX A;  2ZXO A;  2F0O A;  2F0T A;  4A3B B;  1EY9 A;  1SDF A;  2KOL A;  1ILP A;  1WD0 A;  3FKI B;  5D3D A;  3MXP A;  1MGS A;  2G9D A;  4KHZ A;  4PNY A;  2L1B A;  4BY7 B;  2B2W C;  4U67 3;  4IUR A;  2CVR A;  4KKT A;  1IW7 C;  4O1N A;  1HA6 A;  3I4N B;  1S4Z A;  1X3Q A;  1ZEQ X;  5EPL A;  3MFY A;  1BNZ A;  1LT5 D;  3K5M A;  2NVQ B;  2BCO A;  1RTN A;  1RD9 D;  2K01 A;  2E2J B;  5ELE A;  1JR0 D;  3EFX D;  3JAM E;  4IQZ A;  1CHQ D;  2J7Z A;  2BDO A;  1SFO B;  3M4Y A;  2R7Z B;  4XQN A;  1I4H A;  4YIJ A;  2RBM A;  3GTM B;  3DEO A;  2R3Z A;  1E2V A;  1SYC A;  4KD3 A;  4WJW A;  1TWF B;  2NN6 G;  3IFT A;  4A3J B;  2AQ1 B;  3SHL A;  3V05 A;  1QE6 A;  2D5D A;  1PTO F;  1QNU A;  5IIF A;  4DFA A;  1M4V A;  1B1Z A;  4AYB B;  2FHT A;  4KKU A;  3NWS A;  4I65 A;  2B8G A;  2Z4I A;  3SR1 A;  4C1N I;  1GUS A;  4E6I A;  5EPJ A;  4BBR B;  3J80 L;  1FD7 D;  4U68 A;  2K03 A;  2JP1 A;  1B3A A;  3I72 A;  2AWN A;  4OHJ A;  4R9W A;  1G29 1;  2BA1 A;  1KDA A;  2EYM A;  3A8K E;  2QEJ C;  3FVQ A;  1JB3 A;  4Z9C B;  1C48 A;  1V8Q A;  3IAY A;  4KJN A;  1ML0 D;  1O7L A;  2AUK A;  5E1F A;  1AW7 A;  2XRS D;  2FIN B;  3T13 A;  1GUN A;  4PMC A;  2N55 A;  4G7Z C;  2HUG A;  4G7O C;  1S5B D;  2ENB A;  1WCM B;  1OXT A;  4K5V A;  3VYU A;  4DK1 A;  3X3N A;  3HOY B;  4F8M A;  2R93 B;  1X32 A;  2F0P A;  1STB A;  3H6M A;  1A3T A;  5LHY 1;  3H09 A;  1LTB D;  3LNN A;  4KKS A;  2NN6 I;  4F87 A;  1TWA B;  5C6A A;  1DCZ A;  1Q8I A;  2C5C A;  3D8G A;  3DWP A;  2CW0 D;  3FRP B;  3M7N A;  4TKO B;  3WDN A;  3J81 E;  2A74 C;  2PPB C;  1WTP A;  2YU9 B;  1KNA A;  2B8F A;  2F0G A;  4RGM A;  2XWJ B;  2MUY A;  3KLR A;  1AP0 A;  2NVT B;  3A55 A;  1HRJ A;  1EY8 A;  4K6D A;  5J1Z A;  3S9W A;  4NMZ A;  3TP6 A;  3BVZ A;  2DNE A;  5ELC A;  3OPO A;  3GP7 A;  3ND8 A;  3GD7 A;  2MPM A;  2E76 C;  3T51 B;  1BBX C;  5CR3 A;  2TMP A;  2HCI A;  2R61 A;  4ZUJ A;  1EY5 A;  1SE2 A;  2FMM A;  4DXG A;  2OF1 A;  1CTM A;  1SAP A;  3BZD B;  4HCS A;  3I73 A;  3CU7 A;  3X3M A;  4ZK9 B;  3P20 A;  3A7L A;  3BDC A;  1U4L A;  1STY A;  2SOB A;  3N6R A;  3T53 B;  1C8C A;  2L9H A;  4HED A;  3HOW B;  3PIP 3;  2NVX B;  1D1I A;  4DAP A;  1A6X A;  1QNK A;  2SEB D;  1DJR D;  5G3L F;  2H4O A;  5C4Z A;  5C44 B;  1YNN C;  2LMC B;  2MP1 A;  2QF7 A;  3AU7 A;  1D2B A;  4KJO A;  2EJF C;  1R9T B;  2CW0 C;  2Y0S B;  1CZG A;  5KGU A;  3NP8 A;  3FPP A;  2KCC A;  1AZP A;  1Q1B A;  1DYQ A;  2F0Q A;  3NQT A;  4L6T B;  2BOS A;  3H91 A;  2J4X A;  1PMR A;  1SNC A;  1XXG A;  2A6E C;  1U4R A;  1QJO A;  1HXY D;  4H13 C;  4IUN A;  2IX3 A;  1A2T A;  5DNF A;  3RD4 A;  4BBS B;  1EL0 A;  3H0G B;  4L63 B;  3W2D A;  2A68 D;  4QUC A;  1KLU D;  4PMB A;  2FJ2 A;  4IZ8 A;  1G2S A;  4RGO S;  5C0X H;  3RZO B;  3GTO B;  4FF1 A;  2A69 D;  2F0M A;  4K5X A;  2PNR C;  5FKA C;  5IGD A;  2E2H B;  4QMG A;  1G8Z D;  2JA6 B;  4TSS A;  1PRT C;  3K6O A;  5JEA G;  4C3H B;  2B2T A;  3JAM L;  1GOZ A;  4FXG C;  2WP8 J;  2KED A;  1NSN S;  3V96 A;  2PYK A;  4ZYS A;  1TY2 A;  3QWN A;  2EYO A;  1F9S A;  1JOK A;  2K5Q A;  3J80 E;  1ICW A;  3KBX A;  3O13 A;  3FEW X;  2EVB A;  1LV9 A;  5COY A;  3HG9 A;  3M4O B;  4MHE A;  3IFD A;  3U9O A;  3D6C A;  1PFM A;  3TME A;  3K5L A;  2F0J A;  1STA A;  2GA4 B;  3K57 A;  3Q0A A;  2A6E D;  3CQZ B;  1LT6 D;  2HDL A;  5JEA J;  5C5M A;  4XT1 B;  5EPK A;  1G91 A;  5ELD A;  1WTR A;  2BA0 A;  4HN7 A;  4ZLT F;  4NP5 A;  3K58 A;  4OO1 H;  3PO2 B;  5K36 G;  1TII D;  1CA5 A;  1LT3 D;  1EEI D;  3I3C A;  2XNA C;  3P75 A;  4DNR B;  1B4O A;  2EY6 A;  3PUX A;  3G7L A;  4IAL A;  4IUV A;  1HQM C;  4DAV A;  4HSV A;  1HFG A;  3HGB A;  3I4M B;  3KLS X;  2K04 A;  2EYJ A;  4UAI A;  2B2Y A;  3QJY A;  2B63 B;  2PCF B;  5I2Y A;  1S5D D;  4A3M B;  5CMD A;  1FGB D;  1STN A;  5EQ0 A;  4CGY B;  3NTH A;  2ICE C;  3C1E A;  2EY5 A;  2SNS A;  1Q3L A;  3GO5 A;  1H9K A;  3NHH A;  3BDO A;  3J7A V;  4XQJ A;  1SYB A;  1F9P A;  1RCV D;  4H0L C;  4JBW A;  1E2Z A;  2KQ3 A;  5DEH A;  4LAA A;  2KHS A;  1JOO A;  1PTO C;  4H44 C;  1R4P B;  3NSW A;  3HEJ A;  1QIL A;  1PZJ D;  1D5M C;  4MN3 A;  2RVL A;  3P1H A;  3TSS A;  5C0X G;  5C4H A;  4IFD J;  2F0N A;  5EKI A;  3NBH A;  5A2Q E;  5M5Y B;  2DY7 A;  5I2X A;  4BA1 I;  5COR A;  2F0U A;  4V19 0;  4FYD A;  2CHB D;  4UDU C;  5CYU A;  3TP7 A;  1EY4 A;  1QOH A;  4K8J A;  3CHB D;  3J81 L;  1TS3 A;  1TY0 A;  4Q5V A;  1SSO A;  3BVM A;  5K5P A;  3SXH A;  1CFM A;  1PDQ A;  2NTT A;  4A3I B;  3A7A B;  4IFD G;  1FR3 A;  1JIC A;  1ILQ A;  4RA8 A;  4N9T A;  4BY1 B;  1HUN A;  3VR5 A;  3VYR A;  4ZRZ A;  2LFN A;  5A2Q L;  3CRK C;  1XX8 A;  3TZD A;  5KRU A;  1HTP A;  1TKW B;  3DHQ A;  3I90 A;  1V43 A;  2F0S A;  3QG1 A;  1IYU A;  2EZV A;  1Z47 A;  1BF4 A;  2JA5 B;  3SK5 A;  1H9M A;  1ENF A;  4EQN A;  4RWS C;  1Q90 A;  4XT3 B;  2FFK B;  4RCN A;  2B2V C;  2B39 A;  3OOC A;  4CKE A;  3QO2 A;  1PZI D;  3E5S A;  4WFN 3;  1HHV A;  1NUC A;  1ONL A;  1VDZ A;  3ONA B;  2NZ1 D;  1YNJ C;  3OIP A;  1LTT D;  2IW3 A;  5KYI A;  1WTQ A;  3S2H B;  1GUW A;  3RLF A;  3VR3 A;  1PRT D;  2OT2 A;  1Y8O B;  2D9U A;  3A54 A;  1BOS A;  2HQE A;  2M9V A;  1I50 B;  1UUP A;  3GTQ B;  3EA6 A;  1SNM A;  2JE6 I;  3MAQ A;  1KAA A;  1PTO D;  1WD1 A;  1I4P A;  3NQI A;  3J7A F;  3FPU B;  3QB3 A;  2EE1 A;  3NE5 B;  1SJH D;  3H3V C;  2B2W A;  4KHV A;  4FXD A;  4JK1 C;  1XTC D;  2VB2 X;  3MA2 B;  1SYF A;  1SJE D;  3R2T A;  4ZKC B;  3VA5 A;  3TDQ A;  3NPP A;  1MI2 A;  3NK9 A;  1ZXT A;  5IGF A;  1Y8P B;  1SYG A;  1BCP D;  3GTJ B;  1CA6 A;  3S15 B;  1SEB D;  3M85 A;  1W6J A;  1I4Q A;  3PMF A;  1OXU A;  1F2M A;  3M3Y B;  5DM6 3;  1H9S A;  2ZXR A;  3HZX A;  2EYF A;  1JOQ A;  2QDB A;  1LTR D;  1MD2 D;  1IW7 D;  4QUF A;  3LX0 A;  2A69 C;  2IX0 A;  5HGT A;  2EJM A;  1SBB B;  4HMI A;  1SE3 A;  2JA8 B;  3TP5 A;  3MFG A;  2PO4 A;  2KEC A;  1AFP A;  1NCV A;  1RF2 D;  3BYT B;  4XQQ A;  4TQU S;  1S5E D;  3EJI A;  2F3W A;  1EQV A;  4N9P A;  4ULL A;  3PIO 3;  2X69 A;  1H9S B;  2PW5 A;  3BVG A;  1HCZ A;  4DGZ A;  3HOX B;  5FOB B;  1F9R A;  1HUM A;  1FNW A;  3C1F A;  4A3G B;  3DEP A;  3I70 A;  3FDT A;  5A35 A;  1LLR D;  1B50 A;  1A3U A;  4RGT A;  1DZ1 A;  1ZYR D;  5CV9 A;  4PMW A;  2WIN B;  4PQX A;  2XIW A;  3MVV A;  1HFN A;  1HTL D;  1VMP A;  4IUP A;  2PMZ B;  1ESR A;  2L12 A;  1CI3 M;  5EJW A;  1DOL A;  4KI0 A;  4CKC A;  1BCP F;  4KY7 A;  1VF7 A;  1TVX A;  4FVM A;  1CK1 A;  1BDO A;  5CC4 A;  2NB0 A;  4EGV A;  4K5W A;  3BDL A;  3MHB A;  2EXZ A;  4S3S A;  1HA5 A;  2VUM B;  1M8A A;  1PLF A;  4BWG B;  5AFW A;  5D3I B;  1SNQ A;  4ZUI A;  1G6Z A;  1JCK B;  1RJT A;  4XXE A;  2O5I C;  3D4R A;  2F0F A;  3EQL C;  1CZW A;  1D6E C;  1RHP A;  4RHS A;  4DU9 A;  1EU3 A;  4K6L A;  2L11 A;  2L5T A;  3HS0 C;  1NAP A;  1WTV A;  2WB1 B;  2JYO A;  3L9A X;  2PZT A;  1A2U A;  1IHZ A;  2J0T D;  2D2C C;  4C3I B;  5EBC A;  1I6H B;  2JEB I;  1SYE A;  4FO2 A;  2WKD A;  1LAB A;  2K7V A;  1D1K A;  2Q8R E;  4RKL A;  1PZK D;  1SXT A;  2K28 A;  2DY8 A;  1EYA A;  4X3K A;  3E0J A;  3KUP A;  1OXV A;  3SK4 A;  1QWY A;  5IGE A;  1TS5 A;  3DM1 A;  1ZYR C;  1CHP D;  3HOV B;  1TWC B;  2LKV A;  2RDG A;  4QF4 A;  1EY0 A;  4V0B A;  4DK0 A;  3IL8 A;  2B2U A;  2ID0 A;  3T56 B;  2IPK D;  3ERO A;  4A3K B;  2RSN A;  4B08 A;  4H7B A;  3MWY W;  3HP3 A;  2XSC A;  1VF5 C;  4C3J G;  2A6H D;  1Z6H A;  1XWE A;  3HOZ B;  2EYP A;  1K8O A;  2G9H D;  1BUV T;  2QKI C;  5I6W A;  1B2T A;  2I46 A;  3MZ5 A;  1LTG D;  2JXM B;  4Q0F A;  1W6K A;  4L8J A;  1VMC A;  2NYZ D;  4DF7 A;  3VR4 A;  3I4L A;  1WTX A;  1Q1E A;  3DMU A;  4WRD A;  2C9O A;  1GUO A;  2HCC A;  1BXT A;  1JC7 A;  4F7X A;  1A3V A;  4R8I A;  2NUC A;  5KEE A;  1TS4 A;  4KN4 C;  3E6Z X;  4RCO A;  5BN4 A;  1GUT A;  4FF3 A;  3P7J A;  2ZT9 C;  1U4M A;  2E2I B;  1EIH A;  1SMY D;  4ME5 A;  2EYH A;  2KEE A;  2KUM A;  1JWS D;  1V1P B;  2F0V A;  5IGC A;  3PUZ A;  3NTI A;  1S5F D;  1DON A;  3DXJ C;  1EQT A;  3PV0 A;  4RAU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...