1QOHA

A mutant shiga-like toxin iie
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
ADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTIISNTCSSGSGFAEVQFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN IIE B SUBUNIT
publication title A Mutant Shiga-Like Toxin Iie Bound to its Receptor Gb(3): Structure of a Group II Shiga-Like Toxin with Altered Binding Specificity
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qohA00
1R4QB 1D1IA 1CZGA 1QNUA 2C5CA 1D1KA 4ULLA 4M1UB 1CQFA 1CZWA 2BOSA 1DM0B 2XSCA 1QOHA 1C48A 2GA4B 1R4PB 1BOSA 4P2CB 3MXGA 1C4QA
chains in the Genus database with same CATH superfamily
1L1OC 1HR0W 4IUUA 2HCCA 2DY7A 4KMUC 2GVBA 1YJNA 4DU9A 5M9OA 4XTCS 2OTLA 4C3IB 1N36L 2JA8H 1SNCA 1PH7A 2HT1A 5JEAG 4DV6L 3GTKB 2AHOB 5EAYA 2YTYA 1YIJA 5C0XH 4RHRA 5I9PA 1A0IA 4BY7B 4C3IH 4C2MB 3RLFA 2FMCA 2OCEA 3BDLA 1HNXL 4GLXA 3T1HL 3GTKH 4L6TB 1G91A 3S17B 4QIWE 1PTOF 2A73B 4BY7H 1D1KA 1MIUA 4C2MH 5C4ZA 3QG1A 3PV0A 3K7AB 2E74C 5JJIA 3R3OA 1S72A 4OELB 4YCWA 1FNWA 4CJ2C 4IPDA 3HKZB 3F2BA 3S17H 5C4XB 3MXNA 3K7AH 2KOLA 2B63G 4K2LA 1PRTC 2GVAA 5K36H 2NN6H 1CZGA 1F9SA 2A6EC 3PIP3 3J7A5 1SEBD 2KCCA 4AQYQ 5IP7H 4LF4L 2WACA 4C3JB 4YHHL 3DLLA 3HFZB 3L0OA 2NBFA 3SK4A 1SDFA 1VCIA 2EZVA 3CCLA 2Q2TA 5D3DA 4C3JH 1PH5A 1HNWQ 1Q1EA 2L9HA 4PV1C 2EDGA 2G9DA 2CCZA 3BZDB 3KLWA 4JI6L 2XWJB 1JWMD 4JPBW 2JQOA 3IRBA 3A56A 1PH2A 1YNNC 4BWGB 1M4VA 2UUAQ 1KXLA 4UDUC 2KECA 4A4IA 5CV4A 3A7LA 2B29A 4LFCL 1KQSA 2N78A 3QJYA 2DJGC 4JI1Q 2A5HA 4B3MQ 3LWEA 4DV4Q 1CQVA 3L7ZC 4A3LG 1AFPA 3BDOA 3I8ZA 3I4OA 3LX0A 4DV7L 3H0GB 1PTOD 4PG3A 4KN4C 1GUGA 2RA4A 1GUNA 4OWWB 5JOBA 1IZ6A 2K5WA 2EYOA 1TWGB 1WOCA 1GUWA 3H0GH 1SE4A 1Y8NB 5IGCA 2QEXA 2F0DA 3CC7A 1Q81C 3KLSX 3OSOA 4I65A 1G291 3VDYA 1TWGH 3E0EA 3RZOB 3VA5A 2D9UA 3PO3B 1XMOL 2RDHA 1L1OB 4JI5Q 2XGTA 3NQIA 1CM9A 4KKUA 1PH3A 1HUNA 5JVG3 5G3LD 4UP9A 3NTHA 3RZOH 1GXDC 3T4AC 3I70A 3PO3H 1RF2D 4O2DA 4RA8A 5H1SE 1EY9A 2Z6KC 1I50B 2EE1A 4JI0L 1CKOA 1SNQA 1Q8IA 3VR2A 2Z9HA 4B9XA 3JC66 1A62A 1I50H 4NB3A 3GTLB 2J4XA 2E2IB 1RJTA 1SYGA 3EA6A 2LXKA 2F0LA 5C5MA 2XWBB 2R93G 1KLGD 2EYHA 2SEBD 1EZ8A 1YNJC 1S5CD 1C0AA 5C3EB 3GTLH 1W3SA 5C6AA 2E2IH 2VQEQ 4A3MB 4L63B 2Z6KA 4QMGA 4CKCA 1GOZA 4JBJA 4Y7NB 4A3KB 1UNSA 4KK7A 4Y52H 4LMQD 4G7ZC 5C3EH 1LM0A 3I91A 1V1PB 4DV5Q 1QUQA 4A3MH 3OMCA 1RCVD 1PRTB 2EY6A 4Y7NH 4DUZQ 4A3KH 2BH2A 3PO2B 2ALYB 1GHKA 4ZQ3A 2A69C 3HEJA 5L37A 2RQXA 1MKHA 1VQOA 4YCUA 3CHBD 3QR8A 4FF1A 3PO2H 3K5MA 2K32A 4HSPA 1WTQA 4XQNA 5DNFA 3KF6B 2WKDA 3J7ZC 1HH2P 2RCFA 4F8MA 3T16A 4B3SQ 2OQ0A 2A6HD 1IBML 3AEVA 2P5ZX 4K8IA 3HOVB 3DUZA 3D4DA 5M3FG 2JK8A 3BZKA 1K28A 3CMEA 1C4QA 5KYIA 2ZTEA 2L5TA 1VQPA 1BBWA 3HOVH 2PQAB 4G7OC 1WCMB 2R7DA 1SLJA 1IBKQ 4GKKL 1EY8A 1TKWB 3BVMA 1L0WA 1XJVA 4LUZA 3QB3A 4X66L 3PIPA 3GQBA 4DR2L 4OX9L 5IYDH 1A6XA 2E8GA 1DOLA 3K80C 4MIUA 1WCMH 3NBHB 1F2MA 1D7QA 4A3EB 4RH6A 2N88A 3U9OA 2F3VA 4NMZA 1AP0A 1LV9A 3TQYA 1W2BA 3PUZA 1HFNA 4X62Q 1B9NA 4A3EH 1LLRD 5DEHA 3A0JA 1G8ZD 4ZUIA 5C3WA 4DNRB 3G4SA 2Y0SE 2QW7A 3S1NB 3CRLC 1VQ6A 4RCNA 1HA6A 3I4MG 3TZDA 1ILPA 1GM5A 2XRQD 4DR5L 1VQHA 2F0GA 1HPCA 3S1NH 2K7VA 2BE5C 3E9IA 3VYRA 5E4WC 1QCBD 2F0NA 3K5OA 1O7LA 4AYBG 5IYBG 2X69A 1KLUD 1E24A 1VF7A 1XXGA 1UE6A 3A55A 2F1MA 3P75A 4QIWB 1LYLA 4LK1C 4LF5L 1K8AC 5BR8Q 2ZJRA 4IUTA 1IHZA 3I3CA 1GUOA 2VQFL 1S5ED 3J7AF 2AQ3B 5TSSA 5JEAH 1AE2A 4A3JB 3K58A 4DV2L 3R93A 4U673 5FKAC 3S1MH 5I4DA 2WB1G 4C3HB 3OW2A 2O5IC 3IFDA 4X64L 5DM73 5I6WA 2C5CA 4LFBL 1XMQQ 1HNZL 2L55A 4KHPQ 4A3JH 4DAPA 4JBKA 1O7IA 1J9OA 1CUKA 4C3HH 1AZQA 1V1QA 2O2LD 3FKIB 2FINB 1WTPA 3MFGA 3OHXC 2J0TD 2ZTDA 3CRKC 3UE0A 2Q8TA 4JK1C 4F88A 3FKIH 3J81E 3H09A 2K5DA 2JA6G 4BBRG 3CCMA 2CQOA 3K57A 1F9PA 3ERQA 4YIJA 1LTTD 1EY5A 1S5DD 4N9PA 3K5LA 3I4NG 1TXYA 4RAUC 3PUWA 1IBLL 3OMGA 2JA7B 4OL7A 3MXUA 3EFXD 5FLXE 5D3IB 2ENBA 2EY5A 1K8GA 1NJIC 2WAQB 1BXTA 1Y1VG 4PZ6A 5D14A 4DNIA 5FO9B 2IY5B 3NHHA 4Z9CB 2JA7H 3HP3A 3CCRA 1V9PA 3KDFA 3HOUB 2MHVA 4R8IA 2E5LL 5M5XB 3E5SA 1HTPA 2BDOA 4DAVA 4YY3Q 1NY4A 2ZT9C 3HKZE 2VXWA 1D8LA 3HOUH 3M3YH 3KK7A 4LF6L 2IHFA 1TS3A 5C4JB 5M5XH 1WI5A 3TBIB 3J7AV 3CAMA 3PIO3 2KHIA 4NDXA 3TP5A 3I90A 4RCOA 2R92G 5C0XI 1Q82C 5C4JH 1D1IA 2SNMA 5FLMH 3K81C 2UUCQ 5IP9G 5C0XJ 2EYLA 4NKLA 3QOJA 1XNRQ 4J6HA 3J80c 5IT9E 4JCVE 2UXDQ 3CC4A 1YJWA 2BDNA 1RTNA 1G6ZA 1PYSB 4L5QA 2K14A 4DR1L 5CV7A 2CW0C 1UEAB 2PNRC 5KNBA 5KNDA 2FXQA 4KY5A 2PI2A 1FGUA 3R2IA 3GTOB 2DUDA 3W1GA 3KF8A 3N52A 1IW7C 2F03A 3UDGA 2UU9L 1X54A 2RSNA 5FO8B 4L5SA 5KRUA 2HCIA 3GTOH 2R7ZB 1GKHA 3EBEA 4JV5L 1LTSD 1O78A 1VDZA 2ID0A 3C3LA 1JT8A 2K50A 3I56A 4C1NK 3W1BA 2PZTA 3TZUA 1Y1WG 3HOYG 2R7ZH 4A3BG 1JJCB 3TMEA 3EIVA 1O7ZA 3OTOQ 3GTGB 1UE5A 3ND8A 3CMAA 3IKJA 2B8FA 3I72A 3VR4A 1H9SA 3GTGH 1HR0L 5HGQA 3EJIA 1QZHA 1BQQT 2MNAA 1KDBA 1D5MC 4HCEA 2EYJA 1Y69U 4NXML 4O0AA 5GROA 1WFQA 1OXXK 1X3GA 2WV6D 3LWUA 2QKIC 2LS01 1FGBD 3F2CA 4OONA 3I73A 1ZEQX 2FJ2A 4DAYB 4PZ8A 2BOSA 4A3CG 1ET6A 2J7ZA 3J80i 3DM3A 2E76C 1GUSA 1LACA 2Z8LA 4EQPA 4GNXA 5M3FB 1S40A 1EWCA 4A3DG 3E6ZX 1PMRA 1TWFH 1MSGA 2IX0A 4DK3C 1SMYD 4KY6A 4N8FA 1R4QB 5M3FH 1QNUA 4ZKCB 5IYCG 3EROA 4RG1A 4HJ7A 1SNPA 5LMNL 1N33L 5E4XA 5F2DA 4DR4Q 1ENCA 1VQDA 3GP7A 1XYIA 2ZXPA 1ZKOA 2GA4B 3BYTB 4KN7C 3S15B 1YNND 2F0WA 4K0KL 1HCZA 4HIKA 1N32L 2DY8A 4JC0A 4UHVA 3HGBA 5GAGC 3LGJA 1ZYRC 4OHJA 4IJHA 1Q8KA 3AFQA 1FL0A 1DYQA 3KJPA 1HRJA 2BA1A 3I4MB 4GOPB 4IJLA 2ES2A 1C9OA 4JW0A 1STBA 1XTCD 1YHQA 1JOKA 1EYGA 3RLNA 4JI3Q 1F2ZA 4AYBB 3I4MH 2NZHA 2RHQB 3ER0A 4EQ5A 3PIOA 4IFDG 3CPWA 1RTOA 1BO0A 3S9WA 4GKJL 3KBGA 2JA5B 3KOJA 2MUYA 5ELOA 2F52A 5IODA 4HJ5A 1H9MA 4HJAA 1A63A 1EU3A 4JBWA 3AB9A 2JA5H 3S1QB 3NK9A 1F77A 3VR3A 3CU7A 2JXMB 4MZ9A 1RL2A 4KV6A 1XNQQ 2BH8A 2WB1B 3BZCA 1O80A 1YNXA 3NTIA 1JR0D 3QWNA 3S1QH 2Q8IB 2F0QA 1FNVA 1Q7YC 2EXZA 2JA8B 3H94A 3Q6SA 3OIPA 3DEOA 1U4PA 4KJNA 4GN4B 1SE8A 3GD7A 3X3NA 1TQOA 2AKWB 1T5EA 3J81L 1C48A 1JJGA 1JC7A 1YNJD 2QF7A 3TS2A 1ESFA 2OT2A 1I3QB 2EPBA 4X65Q 1EUJA 1N8RC 3Q22A 3Q24A 1STGA 1L1OA 4DUYL 1VQ5A 4IN3A 2F4VL 4DF7A 3QIAA 1VQ4A 1CTMA 1I3QH 4BBRH 2F0UA 4JI8Q 4DV1Q 1KRTA 5KGUA 3MAQA 3ZYYX 1IL2A 4DAMA 1VQBA 5FLXL 2YTVA 1KD1C 4DR7L 4K5VA 3HOZG 3STBC 4LW1A 3JAMc 5CGKA 2A69D 4K14A 4GZYC 3P20A 4OIKA 1WTVA 4QQBX 1E2VA 4ID6A 4JI1L 1H95A 2G5DA 4B3ML 3DWAA 1CA5A 4DV4L 5LMNW 2EVBA 5LMUL 1JMCA 1O7YA 4XXEA 4PMCA 5G3LF 1PVOA 4HIMA 3VR5A 1EQTA 4GS3A 2WIIB 2F0VA 1H9JA 3TP8A 1JE4A 1V1PA 3SHLA 4JYAL 2IT1A 5FO7B 4TKOB 3SGIA 1YBYA 1S4ZA 4JBMA 2OEOA 5IT9L 2VB2X 1N36Q 2N3SA 4K6LA 4MNOA 4C1NI 4G7HC 4JI5L 5JEAJ 4M1UB 4LF7Q 4DKAC 3WDNA 3PGZA 3OIQA 4GLVB 3NWTA 2B2UC 3Q23A 3KF6A 4K2KA 4BY1B 1HNXQ 4YWKA 3T1HQ 2A19A 5EPJA 2WAQE 2L1BA 1VQ8A 3M4OB 4ZUJA 3M9BA 1B2TA 2EXDA 3GTPB 3H3VH 4B3RQ 4X3UA 2IW3A 4OWTB 5M3MB 2MP1A 4OGQC 3TN2A 4BY1H 3U9SA 2N55A 1KRSA 2NB0A 3G48A 3M4OH 4XT3B 4B3TL 1NTGA 1K73C 2PZWA 4IUQA 3GTPH 2PQAA 5M3MH 4KD3A 1CKNB 3S24A 1ASYA 2N49A 1TWAB 2LY7A 3PSIA 2VQEL 4A3BB 2NVTB 2BE5D 3URYA 3CCEA 1W6KA 3DM1A 4L5RC 1E2WA 3JAMi 4JOIC 1X3EA 1TWAH 4IUVA 5IOCA 3BYYB 4DV5L 4QL5A 2D0OA 4A3BH 4LNQA 1ENAA 2EYPA 3EVQA 2NVTH 1B70B 4ZLTF 2E2JB 3CKIB 4DUZL 3GDEA 4FO2A 3RN2A 4YWLA 5KEEA 1V8QA 2BCOA 4A3IG 2DGYA 4ABNA 2VY3A 2E2JH 3GV3A 4CJ0B 1ILQA 5J22A 3HS0C 1TS5A 3C1FA 4BBSG 3ULPA 3TEHB 3KLRA 1STYA 4OXPA 3MXGA 1LTGD 2CHBD 1LUZA 4LFCQ 2QGQA 2TSSA 1DD2A 2IL8A 3A8IE 3TSSA 5FJ8H 3PCOB 2IHEA 4RWSC 1PYWD 5EKLA 1UEBA 1I4GA 4CDDC 1JORA 1VQKA 3MC0B 1B3AA 4O1NA 1S5BD 3D4RA 4BXXH 4DV7Q 2NUCA 1N34Q 2Q2UA 4A3CH 3BS1A 2F0SA 2RDFA 1A3TA 1HQMC 3A8JE 3L9AX 1OXUA 4DA2A 1X32A 1PH9A 2HDLA 1DCZA 1AW7A 2WKCA 4ZK9B 1D6EC 1XPRA 2I07B 3VYTA 5IYCH 2UUBQ 1ZXTA 4JG2A 3M4YA 1QVFA 1GO3E 3RMHA 5KIXA 1Z6HA 1VS0A 4HIDA 3FEWX 2B2TC 1KTKA 5E1FA 3MWYW 4XQJA 4LF8L 3D4WA 4WJWA 2H4OA 3T51B 1AE3A 1I94L 1NMGA 2KUMA 1ICFB 5EKIA 4Q0FA 3A5ZB 4KY7A 5AJ3L 3CW2C 1PH4A 2VUMG 5IGGA 1X55A 1RKNA 1XPOA 3CC2A 5ELDA 1II3A 1CQFA 3K0XA 1EIHA 3I7FA 4QUCA 2HQEA 1X65A 3DMUA 2EJMA 3Q8DA 2KHJA 1HZBA 1Z47A 4JI2Q 5JPMC 4R8NA 3MEFA 1FJGQ 1RD9D 1VF5C 4PMBA 4KJOA 3M4PA 4A3FG 1PH8A 2CFMA 1J8IA 1YHAA 4IOCA 4RGTA 1J6QA 4IFDH 4K8JA 5C44G 2IX1A 2DNEA 4POGA 4MTNA 4LF9L 3RUZA 1FR3A 2BA0A 1E22A 1GJXA 4DK1A 4KHPL 2LXJA 2Y0SG 1D5ZC 1UE1A 2AQ2B 1K3BC 1I6VC 1SBBB 3MXPA 5CV6A 1I5FA 2KEDA 4HJ8A 1JE5A 4QJFA 1VQ9A 1PTOC 4IPCA 2XN9C 1J5EL 1IBMQ 1CK1A 3SEBA 1F9QA 2UXBL 1KIXA 5I9OA 2IX3A 1BCPD 1VMPA 3TP7A 2OQKA 2HIXA 3S1MB 5CV5A 1G2TA 2ZTCA 4CGYB 5M5WB 1BOSA 2CWAA 2QCPX 3N6RA 2I5LX 4AYBE 1SMXA 2K03A 2QILA 4H02A 1NR4A 4LUOA 2E2DC 4ZAIA 4DR2Q 4OX9Q 1G6PA 5M5WH 3NBIA 3NPPA 1K9MC 1HZAA 3HOXG 1SYFA 3R8BA 1Z7TA 4CBVA 4R4QA 1Q12A 1JQYD 2JEAI 1HZCA 3MZ5A 1EY7A 3AFPA 4QF4A 5LHY1 2LMCB 5CV9A 3TP6A 2QA4A 2B63B 2WB1E 1DONA 3CCUA 3FHWA 4FNFA 1HXYD 1XWEA 3W2DA 2OWOA 2MJ8A 1TS4A 3WOFA 1JB7A 2A68D 1F9RA 3U50C 5C4HA 4BA1I 3ERSX 2B63H 1K0RA 1TR5A 1LTBD 2TMPA 4UAIA 1EQQA 2HD3A 3A8KE 1U0LA 2UUCL 5C0XG 1VQNA 2XNAC 4K6DA 1XNRL 4F87A 1I4XA 3T1YL 1HHVA 5IGBA 2D2CC 5CV8A 1I4RA 1GHJA 4KHVA 5HY6A 3BG3A 3HZXA 3FDTA 3NELA 3MEHA 4BY7G 2QDLA 3OWFA 5IGEA 4LF5Q 3M3YB 4MN3A 2XIWA 3TRZA 2NVXB 2VQFQ 4JVZA 2NWGA 3R2TA 4GN5A 2K1BA 4X6AH 5CMDA 2DJFC 4IZ8A 3FPPA 4ZCKA 2CVRA 2ICIA 4DV2Q 4DR6Q 3B6YA 2CQAA 2B2WC 2NVXH 1ENFA 4G4KA 5K36G 3HKZG 3GV6A 2NN6G 5C4XG 1ZYRD 1HNZQ 1RDPD 3V2TA 5IP7G 2A6HC 2Q2HA 2PPBC 1H9KA 4L5TA 4A3LH 1I6HB 3SK6A 1PXUA 1OO9B 2V4DA 1EY4A 5ELNA 5IE8A 2VS1A 1NR2A 4EVOA 2HQLA 2PO4A 4ME5A 3OTOL 1E3PA 4OO1G 3F1ZA 1SNDA 1I6HH 3A74A 2PMZB 1YZ6A 1PZKD 3CQZB 3HRZC 1VQ7A 1SNOA 4GOPC 1QG7A 1PRTF 2QDBA 4UPAA 4QY7A 3CQZH 5A2QE 1PTOB 1N9WA 1SYCA 2I46A 2D5DA 5CBAE 4HR7B 3TDQA 1Q1BA 2ZXOA 4IUNA 2PW5A 1FD7D 1PTOH 1EFWA 3RR5A 3AU7A 4RHSA 1U4MA 1HTLD 2IWHA 4GLAC 2ZM6L 4N9TA 3GTQB 1LT6D 1H9RA 4CHTB 4GOPA 4NXNQ 2R93B 4NP5A 1WD0A 3GTQH 3H0GG 5ELFA 4LF6Q 2K75A 1S3OA 4MHEA 2E75C 2R93H 3FVQA 1WVLA 1E7ZA 1SFOB 4HN7A 3EQLC 1QVGA 3F2DA 3RD4A 3VYSA 3EN2A 3S14B 2Q8RE 2RCNA 2PQEA 4PNYA 1SFOH 1JCKB 4A76A 1EL0A 4DR4L 3PO3G 3C2PA 1SSOA 3S14H 1DJRD 2LFNA 1PFNA 3H3VI 5KYLA 4DPGA 1HUMA 1Y14B 4DV3Q 3STBD 4EQOA 1EZ6A 3NTKA 4IUPA 4N8X1 3I4LA 1EIFA 1DM0B 4V0BA 4QB4A 3A5UA 4DR3L 4B9WA 1NSNS 1MHWC 1OXVA 1TWFB 5JPNC 1PRTD 4DV0Q 2R6GA 3KDFB 4IALA 2A6ED 5CR3A 4S3SA 3W3AA 2B39A 2VUMB 1EIYB 4NPSA 5HGTA 3SVMA 4UY8C 4OEMB 2ZXRA 4JI3L 3V05A 4P71A 4XQQA 4DK0A 2K01A 2SNSA 2VUMH 5K5PA 1EWIA 4A3MG 5EQ0A 3OPOA 5FOBB 3H91A 4CJ1B 4RKLA 5IWAL 3G6EA 4JI4Q 2PZUA 4A3KG 1LTLA 4E6IA 5E3FA 2R3ZA 2Z6BA 2KQ3A 1K83B 4IPHA 3L3OC 2JA9A 2LKVA 2YYZA 2F0OA 1EWHA 4G57A 4K5WA 2RSOA 2F0TA 4TQUS 4MTKA 2F0PA 1TT2A 1HR0Q 3PO2G 4H7BA 1EY6A 1K83H 1K8MA 2Z4HA 4NXMQ 1EOVA 2M2LA 4FF2A 4V190 2MO1A 2F0JA 1YVCA 2B8GA 4I7AA 4PQXA 3D6WA 4IPGA 3H3VC 3S16B 2WINB 4J1MA 4HCSA 1BF4A 3H6MA 3HOVG 1B53A 5LL6X 1A3VA 1TS2A 3SE0A 4JI7Q 4WORA 3S16H 3SK8A 4LFAQ 3KYHC 5EPLA 3S1RB 3VA7A 1GUTA 5J39A 1PHJA 3NSWA 5EJWA 3UDFA 1KHIA 1WCMG 4A93G 3WOEA 5IYBH 1STNA 2EQSA 4H0LC 3BVZA 1KC8C 1JJ2A 2B2YC 3S1RH 2D0PA 2M00A 3VYUA 1A2UA 2JN4A 4HJ9A 2ATWA 2EYFA 4JI8L 4DV1L 1VQGA 1SE2A 3HG9A 4KTAA 4A3EG 3FPUB 3K0YA 1C8CA 2DNCA 1M8AA 4OIJA 3VR6A 1SJED 1VQMA 5BN5A 1IYVA 3D6CA 4F7XA 3A54A 5HURA 4UP7A 5ELCA 3BU2A 3BVGA 4AQYL 1CKNA 2MO0A 2R7FA 4KHZA 4P75A 1X6OA 4X3KA 1A2TA 3G71A 3CP0A 5LL6S 2JA6B 4BBRB 4ILWA 1HNWL 4XDXA 1QWYA 1SROA 1RHPA 5J3BA 4P72A 3I4NB 2JA6H 1HJPA 5KNCA 4GNXB 1IYJB 4HMJA 3CPFA 3D31A 4IFDI 3UDXA 2UUAL 2HHHQ 1TWCB 1TVXA 1LT4D 3H15A 3I4NH 4LF7L 4IFDJ 1P16A 1Y1VB 4A3GG 4GKJQ 4RGNA 1TWCH 3ND9A 1CA6A 2OXPA 2XVSA 5ELEA 4A3JG 1L2FA 3U4VA 1Y1VH 2O5JC 1BVSA 4C3HG 2V1CC 4B3RL 2UXCQ 1BR9A 3M4QA 2HDMA 4DFAA 3ONAB 1LTID 1IKLA 1LABA 1YEZA 2AWNA 2SOBA 2F3IA 2XSCA 1U4LA 4XIGS 3GO5A 4R9WA 3FKIG 2R92B 1PLFA 4XYOA 3F2UA 2Z1CA 3ZJYC 4TRDA 5C4XH 3DHQA 4LWCA 1Y8OB 1D2BA 5E7NA 2ZJPA 2R92H 5JJLA 1SMYC 4DV6Q 1U9RA 1LTRD 4H13C 5IP9H 4FF4A 5EBDA 1IL8A 2K4KA 4OO1H 2CWPA 1SJHD 1PZID 1WTOA 2JA7G 2H5XA 4DUYQ 3PUYA 1KABA 5D65A 2F4VQ 3PMFA 2JJQA 5A2QL 1M1KC 3K6OA 3IAYA 4APVA 1PYBA 2WAQG 4DR7Q 1EFID 1SYEA 4M8AA 4PZ7A 3HOUG 4LUVA 1WTXA 4HTHA 1S5FD 2SDFA 1X56A 4EX5A 1BBXC 1IKMA 1B8AA 1Y1WB 3HOYB 3KFUA 2B2UA 3Q0AA 2AUKA 1QOHA 5LMUQ 3W5OA 3PUVA 5FLMG 1TWHB 2B2VC 2RDGA 4LF4Q 4YHHQ 3NBHA 1N34L 1ET9A 1Y1WH 2ZJQA 3HOYH 2F4IA 1LT5D 2VNUD 1E2ZA 1PFMA 1TWHH 2MQHA 2XTIA 4KI0A 2PMZE 1KDCA 1CI3M 1B3QA 4JYAQ 4WRDA 3OW7A 4HSVA 4P73A 4JI6Q 1NAPA 2UUBL 3AYHB 1K8OA 1RIPA 1GVPA 3GTMB 3HOWG 2B2VA 4JOIA 4H44C 1BNZA 1PFBA 5A35A 4B3SL 3S2HB 2KA7A 1V43A 1B4OA 4RGOS 4J8QA 3GTMH 2YU9B 1PFSA 4DXGA 2LSSA 4I7ZC 1PDQA 1STHA 3S2HH 3NQTA 2R7ZG 2JP1A 3MXNB 1FYCA 2KCTA 3K7UC 4A3DB 1IBKL 2YU9H 4FP5D 3J81c 2IJ0A 3QOLA 1E1TA 1VQIA 4B3TQ 2KEEA 2F0IA 4AIMA 4FYDA 4A3DH 3CCJA 3CXCA 1CT1D 4JI2L 1FJGL 1F2YA 4FXDA 1YHBA 1B9MA 2RF4A 1NBWA 1XMOQ 5FLXc 4X62L 4B08A 3U58A 2F0FA 1HFGA 4WJ3M 1NE3A 1EEFD 1DZ1A 1R4PB 2I5HA 3S2DB 3NP8A 3MVVA 3JAME 3TREA 1BCPF 1DGSA 1WTHA 5IGDA 1GD7A 1QJOA 1K3RA 1Q90A 4JI0Q 1Z9FA 3S2DH 1QNKA 1VQLA 1FNUA 2KBNA 1X9NA 3MHBA 1XPUA 3SXHA 4HMIA 2Z4IA 1WTRA 1F2LA 4DXFA 1SNMA 2B2TA 4ZYSA 4TVAB 2Z0SA 2CH4W 5EBCA 4P2CB 5BR8L 1B50A 1EOTA 3U4ZA 5C3XA 2X6GA 2MPMA 5IT9c 1JB3A 4A93B 3NE5B 4X3SA 3J80L 3FRPB 2ASBA 5C5LA 2CW0D 1I4HA 4OWXB 1EEID 1A3UA 1T9HA 3IL8A 4IURA 4FF3A 4A93H 3G6JB 5NUCA 1XMQL 3SDZA 2KCMA 2NZ1D 1SN8A 2X6LA 1IW7D 4CDFC 5I2YA 3J81i 2G9HD 1TU2B 4QUFA 4HAEA 2NTTA 1OXTA 5JJKA 5CYUA 1VQAA 2F0MA 4ULLA 1R9TB 1QILA 4RGMA 5EGTA 1CFMA 4LF8Q 2AUJD 3NENA 2PI2E 5GAEC 1I94Q 2EIFA 2VB3X 1I4QA 5BN3A 5AJ3Q 4DGZA 1R9TH 1JWUD 1T5XD 1PH6A 4GKKQ 5JVH3 3ULJA 1D5XC 3F8TA 2VZAA 1MI2A 1QE6A 4X66Q 2K05A 1EY0A 2NZOA 4ODGA 5DLQE 1Y8PB 2Q2IA 1MJCA 2JA5G 2FHTA 3HOZB 4R1JA 3I55A 1QUQB 1CHQD 4A3GB 1EU4A 1ICWA 5BN4A 2K5HA 3HOZH 4YY3L 1B1ZA 2FMMA 4DR6L 4A3GH 4FXKC 3AMUA 4LF9Q 2QEJC 2NVQB 2MFIA 2JA8G 1KDAA 1PZJD 1X3FA 2K52A 3G7LA 2NVQH 2HIVA 1K0SA 2A1AA 4DR5Q 3MA2B 4C3IG 4BS9A 2UXDL 1Q3LA 3WWVA 2RBMA 3K5NA 4FVMA 1J5EQ 5J1ZA 5I2XA 2PCFB 1FVIA 2UXBQ 1ML0D 3CCSA 3D0FA 4GN3B 1YITA 3KUPA 1B44D 5FK9C 4O42A 1EQVA 4FXGC 1EYAA 1CZWA 1JICA 3OYYA 3MFYA 2VW9A 2YTXA 4CDEC 3D8GA 4ALPA 4XYQA 2K6AA 4DAYA 3ITPA 2ICEC 4EGVA 2RVLA 1KNAA 2HUGA 1HA5A 1SYBA 3M7GA 1MGSA 4KD4A 4X64Q 4KKTA 4LFBQ 3D3RA 3CD6A 3PUXA 2L15A 3P1HA 5GAHC 1DOMA 2O4XA 3RZDB 4NXNL 3PF4A 1L0XB 1UUPA 2A8VA 1OTCA 4R4CA 4C3JG 1PV4A 1V1OA 2CKZB 4C56C 2NTSA 3RZDH 2MGSA 3C46A 1A8VA 3P7JA 2JE6I 2A74C 3T53B 2B2WA 1AZPA 4K5XA 3RNUA 3SR1A 1VQCA 4QGUA 2WP8J 2DN8A 1ASZA 3T13A 2OTJA 2GN5A 3L2PA 3CCQA 1MD2D 5AFWA 1STEA 1E0BA 1IBLQ 1DXMA 4A3IB 1MSHA 1RODA 3RN5A 5DM63 3T1YQ 1W6JA 4ME3A 2AQ1B 1CHPD 2L12A 4IO9A 1HQRD 2K28A 2EOTA 2IPKD 4HIOA 2B3GA 1X3QA 3UDIA 4DV3L 4BBSB 4A3IH 3HOWB 5JJZA 4DNTB 4CKEA 4XT1B 4POFA 1UWVA 3J7YW 1BKBA 2F0EA 4BY1G 3DWPA 1U5KA 1VQEA 1NNXA 2E5LQ 3K8AA 2K5NA 4BBSH 2R61A 4DV0L 3M85A 3HOWH 3TS0A 5M3MG 2OF1A 1IYUA 2NN6I 1EYDA 4A75A 1OXSC 1Q46A 3LNNA 5M5YB 1YJ9A 2C9OA 1WD1A 1KNEA 1WJJA 2KCNA 2EYMA 5I6YA 3AQQA 1XX8A 3E0JA 3CCVA 2K5QA 2H1EA 5JAVA 1LT3D 4OO1I 1NCVA 1BCPC 5T1GA 3KBXA 5M5YH 4JI4L 1AN8A 1Q86C 3GTJB 3DEPA 4TSSA 2XRSD 1ESRA 3NWSA 4DR1Q 1VQJA 5EKKA 3O13A 2YV5A 3A7AB 1STAA 3GTJH 3V96A 1CSPA 2C35B 1LTAD 1BBUA 4GNXC 3JAML 2PNHA 3M7NA 2JSOA 4LJZC 1SR3A 4Q5VA 1G2SA 4UP8A 4EQNA 3SK5A 2UU9Q 5FJ8G 3E9HA 2RKSA 4R4IA 1TIID 1KAWA 4P74A 2PW7A 2FFKB 3CF5A 2JYOA 3NXWA 2WFWA 4IOAA 4JV5Q 3BJUA 3NEMA 5COYA 4R4TA 2A68C 3DXJC 1WTWA 3T56B 4BXXG 3E3XA 2EJFC 2ZM6Q 1NUCA 5C3EG 4JI7L 3NUCA 1EIGA 4L8JA 4LFAL 2PYKA 4IQZA 4LAAA 3C1EA 2I0QA 2KHSA 1DOKA 5CBEE 4AH6A 2VL6A 1MBYA 1TY0A 3DWQA 1KAAA 2M9VA 3BDCA 1UAPA 3J81j 2F3WA 3KJOA 2N8NA 5GADC 4A3FB 5IGFA 1PH1A 2EY2A 4QCLA 1QVCA 1BUVT 2I5MX 3UE1A 2KJXA 5T1IA 1EYCA 1X3PA 5C44B 5ISRA 1L0YB 4YWMA 1XNQL 4A3FH 1SRUA 3ULLA 5ELBA 3FP9A 4WJ4A 1SXTA 2K04A 4RFBA 3HKSA 1PA6A 3PF5A 1ONLA 2K33A 5C44H 5IIFA 3OOCA 2Y0SB 3IFTA 2AMCB 3QO2A 4WFN3 1JOOA 3I2ZA 3KF8B 1WYDA 2AWOA 4HEDA 1BDOA 3K59A 4X3TA 4DR3Q 1TY2A 3S15H 1AH9A 4YCVA 1KL9A 2KENA 1NMFA 2JEBI 3UI2A 5IYDG 1VMCA 3PQIA 1UE7A 4KKSA 4DN4M 3ICEA 1B7YB 1MJEA 2RHSB 4X65L 5EPKA 2L0CA 3FMCA 4RKBA 2EY1A 2L4NA 4U68A 3J80E 5DAUA 2F0KA 2F0HA 4CDCC 1YI2A 1JWSD 1A15A 3MTSA 2E2HB 1C7YA 2CH4A 1SE3A 1SYDA 3KLSA 2KVMA 1CKMA 2NVYB 2HHHL 4BA2I 1VQFA 1LO5D 1AEXA 3HOXB 5LMNQ 1N33Q 5IWAQ 2E2HH 1QB5D 1H9SB 1SAPA 5CC4A 1IXRA 4KLKA 2NVYH 4ZKBB 4R4OA 1E1OA 3OWEB 2NYZD 1CSQA 3X3MA 3HOXH 1XTDA 4K0KQ 4CKBA 2B2YA 2L11A 1EQRA 1P8LA 1N32Q 3RLOA 2UXCL 5CORA 4J15A 1M90C 5GQOA 4NW2A 1I4PA 1U4RA 4PMWA 1BCPB 4RMFA 5IY0A 1HZ9A 2D62A 1JOQA 1QZGA 4DK6C 2K5VA 4ZRZA 4FDBA 1G51A 2EJGC
chains in the Genus database with same CATH topology
4IUUA 2HCCA 2DY7A 4KMUC 4DU9A 5M9OA 4XTCS 4C3IB 1SNCA 5JEAG 3GTKB 5C0XH 4RHRA 5I9PA 4BY7B 4C2MB 3RLFA 2FMCA 3BDLA 1G91A 4L6TB 3S17B 1PTOF 2A73B 1D1KA 5C4ZA 3PV0A 3QG1A 3K7AB 2E74C 3R3OA 1FNWA 4CJ2C 3HKZB 5C4XB 3MXNA 2KOLA 4K2LA 1PRTC 5K36H 2NN6H 1CZGA 1F9SA 2A6EC 3PIP3 1SEBD 2KCCA 2WACA 4C3JB 2NBFA 3SK4A 1SDFA 1VCIA 2EZVA 5D3DA 1Q1EA 2L9HA 4PV1C 2EDGA 2G9DA 3BZDB 2XWJB 1JWMD 3A56A 1YNNC 4BWGB 1M4VA 4UDUC 2KECA 5CV4A 3A7LA 3QJYA 2A5HA 3LWEA 1CQVA 3L7ZC 1AFPA 3BDOA 3I8ZA 3LX0A 3H0GB 1PTOD 4KN4C 1GUGA 2RA4A 1GUNA 5JOBA 2K5WA 2EYOA 1TWGB 1GUWA 1SE4A 1Y8NB 5IGCA 2F0DA 3KLSX 3OSOA 4I65A 1G291 3RZOB 3VA5A 2D9UA 3PO3B 2RDHA 3NQIA 1CM9A 4KKUA 1HUNA 5JVG3 5G3LD 3NTHA 1GXDC 3T4AC 3I70A 1RF2D 4RA8A 1EY9A 1I50B 2EE1A 1SNQA 1Q8IA 3VR2A 4B9XA 3GTLB 2J4XA 2E2IB 1RJTA 1SYGA 3EA6A 2F0LA 5C5MA 2XWBB 1KLGD 2EYHA 2SEBD 1EZ8A 1YNJC 1S5CD 5C3EB 5C6AA 4A3MB 4L63B 4QMGA 4CKCA 1GOZA 4Y7NB 4A3KB 1UNSA 4KK7A 4LMQD 4G7ZC 3I91A 1V1PB 3OMCA 1RCVD 1PRTB 2EY6A 3PO2B 1GHKA 4ZQ3A 2A69C 3HEJA 2RQXA 3CHBD 4FF1A 3K5MA 2K32A 4HSPA 1WTQA 4XQNA 5DNFA 2WKDA 4F8MA 3T16A 2A6HD 4K8IA 3HOVB 3DUZA 3D4DA 1C4QA 5KYIA 2L5TA 4G7OC 1WCMB 1EY8A 1TKWB 3BVMA 3QB3A 3GQBA 1A6XA 1DOLA 4MIUA 1F2MA 4A3EB 4RH6A 2N88A 3U9OA 2F3VA 4NMZA 1AP0A 1LV9A 3PUZA 1HFNA 1B9NA 1LLRD 5DEHA 1G8ZD 4ZUIA 5C3WA 4DNRB 3S1NB 3CRLC 4RCNA 1HA6A 3TZDA 1ILPA 2XRQD 2F0GA 1HPCA 2K7VA 2BE5C 3VYRA 5E4WC 1QCBD 2F0NA 3K5OA 1O7LA 2X69A 1KLUD 1VF7A 1XXGA 3A55A 2F1MA 3P75A 4QIWB 4LK1C 4IUTA 1IHZA 3I3CA 1GUOA 3J7AF 1S5ED 2AQ3B 5TSSA 5JEAH 4A3JB 3K58A 3R93A 4U673 5FKAC 5I4DA 4C3HB 2O5IC 3IFDA 5DM73 5I6WA 2C5CA 2L55A 4DAPA 1J9OA 1AZQA 2O2LD 3FKIB 2FINB 1WTPA 3MFGA 3OHXC 2J0TD 3CRKC 2Q8TA 4JK1C 4F88A 3J81E 3H09A 2K5DA 3K57A 1F9PA 3ERQA 4YIJA 1LTTD 1EY5A 1S5DD 4N9PA 3K5LA 4RAUC 3PUWA 3OMGA 2JA7B 4OL7A 3MXUA 3EFXD 5FLXE 5D3IB 2ENBA 2EY5A 2WAQB 1BXTA 5D14A 5FO9B 3NHHA 4Z9CB 3HP3A 3HOUB 2MHVA 4R8IA 5M5XB 3E5SA 1HTPA 2BDOA 4DAVA 2ZT9C 2VXWA 3KK7A 1TS3A 5C4JB 3TBIB 3J7AV 3PIO3 4NDXA 3TP5A 3I90A 4RCOA 5C0XI 1D1IA 2SNMA 5C0XJ 2EYLA 4NKLA 3QOJA 4J6HA 5IT9E 2BDNA 1RTNA 1G6ZA 5CV7A 2CW0C 1UEAB 2PNRC 5KNBA 5KNDA 4KY5A 3R2IA 3GTOB 3KF8A 3N52A 1IW7C 2F03A 2RSNA 5FO8B 5KRUA 2HCIA 2R7ZB 1LTSD 1O78A 1VDZA 2ID0A 3C3LA 4C1NK 2PZTA 3TZUA 3TMEA 1O7ZA 3GTGB 3ND8A 3IKJA 2B8FA 3I72A 3VR4A 1H9SA 3EJIA 1BQQT 1KDBA 1D5MC 4HCEA 2EYJA 1Y69U 1OXXK 2WV6D 3LWUA 2QKIC 2LS01 1FGBD 3I73A 1ZEQX 2FJ2A 2BOSA 1ET6A 2J7ZA 2E76C 1GUSA 1LACA 2Z8LA 4EQPA 5M3FB 1EWCA 3E6ZX 1PMRA 1MSGA 2IX0A 1SMYD 4KY6A 1R4QB 1QNUA 4ZKCB 3EROA 1SNPA 5E4XA 5F2DA 1ENCA 3GP7A 1XYIA 2ZXPA 1ZKOA 2GA4B 3BYTB 4KN7C 3S15B 1YNND 2F0WA 1HCZA 2DY8A 3HGBA 1ZYRC 4OHJA 1DYQA 1HRJA 2BA1A 3I4MB 1STBA 1XTCD 1JOKA 1F2ZA 4AYBB 4IFDG 1RTOA 1BO0A 3S9WA 2JA5B 3KBGA 2MUYA 5IODA 1H9MA 1EU3A 4JBWA 3AB9A 3S1QB 3NK9A 1F77A 3VR3A 3CU7A 2JXMB 4KV6A 2WB1B 1O80A 3NTIA 1JR0D 3QWNA 2Q8IB 2F0QA 1FNVA 2EXZA 2JA8B 3H94A 3Q6SA 3OIPA 3DEOA 1U4PA 4KJNA 3GD7A 3X3NA 1TQOA 1T5EA 3J81L 1C48A 1JC7A 1YNJD 2QF7A 1ESFA 2OT2A 1I3QB 2EPBA 3Q22A 3Q24A 1STGA 4IN3A 4DF7A 3QIAA 1CTMA 2F0UA 5KGUA 3MAQA 3ZYYX 5FLXL 4K5VA 5CGKA 2A69D 4K14A 4GZYC 3P20A 4OIKA 1WTVA 1E2VA 4ID6A 3DWAA 1CA5A 2EVBA 1O7YA 4XXEA 4PMCA 5G3LF 3VR5A 1EQTA 2WIIB 2F0VA 1H9JA 3TP8A 1JE4A 1V1PA 3SHLA 2IT1A 5FO7B 4TKOB 1S4ZA 2OEOA 5IT9L 2VB2X 4K6LA 4C1NI 4G7HC 5JEAJ 4M1UB 3WDNA 3OIQA 3NWTA 2B2UC 3Q23A 4K2KA 4BY1B 5EPJA 2L1BA 3M4OB 4ZUJA 1B2TA 3GTPB 4X3UA 2IW3A 5M3MB 2MP1A 4OGQC 3TN2A 3U9SA 2N55A 2NB0A 4XT3B 2PZWA 4IUQA 4KD3A 1TWAB 2LY7A 4A3BB 2NVTB 2BE5D 3URYA 1W6KA 3DM1A 1E2WA 4IUVA 5IOCA 3BYYB 1ENAA 2EYPA 3EVQA 4ZLTF 2E2JB 3CKIB 4FO2A 5KEEA 1V8QA 2BCOA 4ABNA 3GV3A 4CJ0B 1ILQA 5J22A 3HS0C 1TS5A 3C1FA 3KLRA 1STYA 3MXGA 1LTGD 2CHBD 2TSSA 1DD2A 2IL8A 3A8IE 3TSSA 4RWSC 1PYWD 5EKLA 1I4GA 1JORA 3MC0B 1B3AA 4O1NA 1S5BD 3D4RA 2NUCA 3BS1A 2F0SA 2RDFA 1A3TA 1HQMC 3A8JE 3L9AX 1OXUA 4DA2A 1X32A 2HDLA 1DCZA 1AW7A 2WKCA 4ZK9B 1D6EC 2I07B 3VYTA 1ZXTA 3M4YA 3RMHA 5KIXA 1Z6HA 3FEWX 2B2TC 5E1FA 1KTKA 3MWYW 4XQJA 3D4WA 4WJWA 2H4OA 3T51B 2KUMA 5EKIA 4Q0FA 4KY7A 5IGGA 1RKNA 5ELDA 1II3A 1CQFA 1EIHA 4QUCA 2HQEA 3DMUA 2EJMA 1Z47A 5JPMC 4R8NA 1RD9D 1VF5C 4PMBA 4KJOA 1J8IA 4RGTA 4IFDH 4K8JA 2IX1A 2DNEA 3RUZA 1FR3A 2BA0A 1GJXA 4DK1A 1D5ZC 2AQ2B 1I6VC 1SBBB 3MXPA 5CV6A 2KEDA 1PTOC 2XN9C 1CK1A 3SEBA 1F9QA 5I9OA 2IX3A 1BCPD 1VMPA 3TP7A 1G2TA 3S1MB 5CV5A 4CGYB 5M5WB 1BOSA 2QCPX 3N6RA 2K03A 2QILA 1NR4A 2E2DC 4ZAIA 3NBIA 3NPPA 1SYFA 3R8BA 1Z7TA 4CBVA 1Q12A 1JQYD 2JEAI 3MZ5A 1EY7A 4QF4A 5LHY1 2LMCB 5CV9A 3TP6A 2B63B 1DONA 4FNFA 1HXYD 1XWEA 3W2DA 2MJ8A 1TS4A 3WOFA 2A68D 1F9RA 5C4HA 4BA1I 1TR5A 1LTBD 2TMPA 4UAIA 3A8KE 5C0XG 2XNAC 4K6DA 4F87A 1I4XA 1HHVA 5IGBA 2D2CC 5CV8A 1I4RA 1GHJA 4KHVA 3BG3A 3HZXA 3FDTA 3MEHA 3OWFA 5IGEA 3M3YB 4MN3A 2XIWA 2NVXB 2NWGA 3R2TA 2K1BA 5CMDA 4IZ8A 3FPPA 2CVRA 2ICIA 2CQAA 2B2WC 1ENFA 4G4KA 5K36G 3GV6A 2NN6G 1ZYRD 1RDPD 3V2TA 2A6HC 2PPBC 1H9KA 1I6HB 3SK6A 1PXUA 1OO9B 2V4DA 1EY4A 1NR2A 4EVOA 4ME5A 2PO4A 4OO1G 1SNDA 2PMZB 1PZKD 3CQZB 3HRZC 1SNOA 1QG7A 1PRTF 2QDBA 5A2QE 1PTOB 1SYCA 2I46A 5CBAE 2D5DA 4HR7B 3TDQA 1Q1BA 2ZXOA 4IUNA 2PW5A 1FD7D 1PTOH 3AU7A 4RHSA 1U4MA 1HTLD 2IWHA 3GTQB 4N9TA 1LT6D 1H9RA 4CHTB 2R93B 4NP5A 1WD0A 5ELFA 4MHEA 2E75C 3FVQA 1WVLA 1SFOB 4HN7A 3EQLC 3RD4A 3VYSA 3S14B 2Q8RE 2PQEA 4PNYA 1JCKB 1EL0A 3C2PA 1SSOA 1DJRD 2LFNA 1PFNA 5KYLA 1HUMA 4EQOA 1EZ6A 3NTKA 4IUPA 3I4LA 1DM0B 4V0BA 4QB4A 4B9WA 1NSNS 1TWFB 1OXVA 5JPNC 1PRTD 2R6GA 4IALA 2A6ED 5CR3A 4S3SA 3W3AA 2B39A 2VUMB 5HGTA 3SVMA 2ZXRA 3V05A 4XQQA 4DK0A 2K01A 2SNSA 5K5PA 5EQ0A 3OPOA 5FOBB 3H91A 4CJ1B 4RKLA 2PZUA 4E6IA 5E3FA 2R3ZA 2KQ3A 1K83B 3L3OC 2LKVA 4K5WA 2YYZA 2F0OA 1EWHA 4G57A 2RSOA 2F0TA 4TQUS 2F0PA 1TT2A 4H7BA 1EY6A 1K8MA 2Z4HA 2M2LA 4FF2A 4V190 2F0JA 2B8GA 4PQXA 3D6WA 3H3VC 3S16B 2WINB 4J1MA 4HCSA 1BF4A 3H6MA 1B53A 5LL6X 1A3VA 1TS2A 3SE0A 4WORA 3SK8A 5EPLA 3S1RB 3VA7A 1GUTA 5J39A 3NSWA 5EJWA 3WOEA 1STNA 4H0LC 3BVZA 2B2YC 2M00A 3VYUA 1A2UA 2EYFA 1SE2A 3HG9A 4KTAA 3FPUB 3K0YA 1C8CA 2DNCA 1M8AA 4OIJA 3VR6A 1SJED 5BN5A 1IYVA 3D6CA 4F7XA 3A54A 5HURA 5ELCA 3BVGA 4KHZA 4X3KA 1A2TA 5LL6S 2JA6B 4BBRB 4ILWA 4XDXA 1QWYA 1RHPA 3I4NB 5KNCA 4HMJA 3D31A 4IFDI 1TWCB 1TVXA 1LT4D 4IFDJ 1Y1VB 4RGNA 3ND9A 1CA6A 2OXPA 2XVSA 5ELEA 2O5JC 4C3HG 1BR9A 2HDMA 4DFAA 3ONAB 1LTID 1IKLA 1LABA 2AWNA 2SOBA 2XSCA 4XIGS 1U4LA 3GO5A 4R9WA 2R92B 1PLFA 4XYOA 3F2UA 2Z1CA 4TRDA 3DHQA 1Y8OB 1D2BA 1SMYC 1U9RA 1LTRD 4H13C 4FF4A 5EBDA 1IL8A 4OO1H 1SJHD 1PZID 1WTOA 3PUYA 1KABA 5D65A 3PMFA 5A2QL 3K6OA 3IAYA 1EFID 1SYEA 4M8AA 1WTXA 4HTHA 1S5FD 2SDFA 1IKMA 1BBXC 1Y1WB 3HOYB 2B2UA 3Q0AA 2AUKA 1QOHA 3PUVA 1TWHB 2B2VC 2RDGA 3NBHA 1ET9A 2F4IA 1LT5D 2VNUD 1E2ZA 1PFMA 4KI0A 1KDCA 1CI3M 4WRDA 3OW7A 4HSVA 1NAPA 1K8OA 3GTMB 2B2VA 1BNZA 4H44C 1PFBA 5A35A 3S2HB 2KA7A 1V43A 1B4OA 4RGOS 4J8QA 2YU9B 4DXGA 4I7ZC 1PDQA 1STHA 3NQTA 2JP1A 1FYCA 4A3DB 4FP5D 2IJ0A 3QOLA 2KEEA 2F0IA 4FYDA 1CT1D 1F2YA 4FXDA 1B9MA 4B08A 2F0FA 1HFGA 1EEFD 1DZ1A 1R4PB 3S2DB 3NP8A 3MVVA 3JAME 1BCPF 5IGDA 1QJOA 1Q90A 1QNKA 1FNUA 3MHBA 3SXHA 4HMIA 2Z4IA 1WTRA 1F2LA 4DXFA 1SNMA 2B2TA 4ZYSA 5EBCA 4P2CB 1B50A 1EOTA 5C3XA 2X6GA 2MPMA 1JB3A 4A93B 3NE5B 4X3SA 3J80L 3FRPB 5C5LA 2CW0D 1I4HA 1EEID 1A3UA 3IL8A 4IURA 4FF3A 3G6JB 5NUCA 3SDZA 2NZ1D 2X6LA 1IW7D 5I2YA 2G9HD 1TU2B 4QUFA 4HAEA 2NTTA 1OXTA 5CYUA 2F0MA 4ULLA 1R9TB 1QILA 4RGMA 5EGTA 1CFMA 2AUJD 2VB3X 1I4QA 5BN3A 4DGZA 1JWUD 1T5XD 5JVH3 1D5XC 1MI2A 1QE6A 2K05A 1EY0A 4ODGA 1Y8PB 2FHTA 3HOZB 1CHQD 4A3GB 1EU4A 1ICWA 5BN4A 1B1ZA 2FMMA 4FXKC 3AMUA 2QEJC 2NVQB 1KDAA 1PZJD 3G7LA 3MA2B 4C3IG 4BS9A 1Q3LA 2RBMA 3K5NA 4FVMA 5J1ZA 5I2XA 2PCFB 1ML0D 3KUPA 1B44D 5FK9C 4O42A 1EQVA 4FXGC 1EYAA 1CZWA 1JICA 3MFYA 3D8GA 4XYQA 2K6AA 4DAYA 3ITPA 2ICEC 4EGVA 2RVLA 1KNAA 2HUGA 1HA5A 1SYBA 3M7GA 1MGSA 4KD4A 4KKTA 3D3RA 3PUXA 3P1HA 1DOMA 2O4XA 3RZDB 1L0XB 1UUPA 4C3JG 1V1OA 4C56C 2NTSA 2MGSA 3C46A 2JE6I 3P7JA 3T53B 2A74C 2B2WA 1AZPA 4K5XA 3SR1A 2WP8J 2DN8A 3T13A 1MD2D 5AFWA 1STEA 1E0BA 1DXMA 4A3IB 1MSHA 1RODA 5DM63 1W6JA 2AQ1B 1CHPD 2L12A 1HQRD 2K28A 2EOTA 2IPKD 1X3QA 4BBSB 3HOWB 5JJZA 4DNTB 4CKEA 4XT1B 3J7YW 2F0EA 3DWPA 2R61A 3M85A 2OF1A 1IYUA 2NN6I 1EYDA 1OXSC 3LNNA 5M5YB 2C9OA 1WD1A 1KNEA 2KCNA 2EYMA 5I6YA 3E0JA 1XX8A 2K5QA 2H1EA 5JAVA 1LT3D 4OO1I 1NCVA 1BCPC 5T1GA 3KBXA 1AN8A 3GTJB 3DEPA 4TSSA 2XRSD 1ESRA 3NWSA 5EKKA 3O13A 3A7AB 1STAA 3V96A 1LTAD 3JAML 3M7NA 2JSOA 4LJZC 4Q5VA 1G2SA 4EQNA 3SK5A 2RKSA 1TIID 2PW7A 2FFKB 2JYOA 3NXWA 5COYA 2A68C 3DXJC 1WTWA 3T56B 2EJFC 1NUCA 3NUCA 1EIGA 4L8JA 2PYKA 4IQZA 4LAAA 3C1EA 2KHSA 1DOKA 5CBEE 1MBYA 1TY0A 3DWQA 1KAAA 2M9VA 3BDCA 1UAPA 2F3WA 4A3FB 5IGFA 2EY2A 4QCLA 1BUVT 2KJXA 5T1IA 1EYCA 1X3PA 5C44B 5ISRA 1L0YB 5ELBA 1SXTA 2K04A 4RFBA 1ONLA 2K33A 5IIFA 3OOCA 2Y0SB 3IFTA 3QO2A 4WFN3 1JOOA 2AWOA 4HEDA 1BDOA 3K59A 4X3TA 1TY2A 3UI2A 2JEBI 1VMCA 4KKSA 4DN4M 5EPKA 2L0CA 3FMCA 4RKBA 2EY1A 2L4NA 4U68A 3J80E 5DAUA 2F0KA 2F0HA 1JWSD 1A15A 3MTSA 2E2HB 1SE3A 1SYDA 3KLSA 2KVMA 2NVYB 4BA2I 1LO5D 1AEXA 3HOXB 1QB5D 1H9SB 1SAPA 5CC4A 4ZKBB 3OWEB 2NYZD 3X3MA 4CKBA 2B2YA 2L11A 5CORA 4PMWA 4NW2A 1I4PA 1U4RA 1BCPB 2D62A 1JOQA 4ZRZA 2EJGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Q B;  1D1I A;  1CZG A;  1QNU A;  2C5C A;  1D1K A;  4ULL A;  4M1U B;  1CQF A;  1CZW A;  2BOS A;  1DM0 B;  2XSC A;  1QOH A;  1C48 A;  2GA4 B;  1R4P B;  1BOS A;  4P2C B;  3MXG A;  1C4Q A; 
#chains in the Genus database with same CATH topology
 1L1O C;  1HR0 W;  4IUU A;  2HCC A;  2DY7 A;  4KMU C;  2GVB A;  1YJN A;  4DU9 A;  5M9O A;  4XTC S;  2OTL A;  4C3I B;  1N36 L;  2JA8 H;  1SNC A;  1PH7 A;  2HT1 A;  5JEA G;  4DV6 L;  3GTK B;  2AHO B;  5EAY A;  2YTY A;  1YIJ A;  5C0X H;  4RHR A;  5I9P A;  1A0I A;  4BY7 B;  4C3I H;  4C2M B;  3RLF A;  2FMC A;  2OCE A;  3BDL A;  1HNX L;  4GLX A;  3T1H L;  3GTK H;  4L6T B;  1G91 A;  3S17 B;  4QIW E;  1PTO F;  2A73 B;  4BY7 H;  1D1K A;  1MIU A;  4C2M H;  5C4Z A;  3QG1 A;  3PV0 A;  3K7A B;  2E74 C;  5JJI A;  3R3O A;  1S72 A;  4OEL B;  4YCW A;  1FNW A;  4CJ2 C;  4IPD A;  3HKZ B;  3F2B A;  3S17 H;  5C4X B;  3MXN A;  3K7A H;  2KOL A;  2B63 G;  4K2L A;  1PRT C;  2GVA A;  5K36 H;  2NN6 H;  1CZG A;  1F9S A;  2A6E C;  3PIP 3;  3J7A 5;  1SEB D;  2KCC A;  4AQY Q;  5IP7 H;  4LF4 L;  2WAC A;  4C3J B;  4YHH L;  3DLL A;  3HFZ B;  3L0O A;  2NBF A;  3SK4 A;  1SDF A;  1VCI A;  2EZV A;  3CCL A;  2Q2T A;  5D3D A;  4C3J H;  1PH5 A;  1HNW Q;  1Q1E A;  2L9H A;  4PV1 C;  2EDG A;  2G9D A;  2CCZ A;  3BZD B;  3KLW A;  4JI6 L;  2XWJ B;  1JWM D;  4JPB W;  2JQO A;  3IRB A;  3A56 A;  1PH2 A;  1YNN C;  4BWG B;  1M4V A;  2UUA Q;  1KXL A;  4UDU C;  2KEC A;  4A4I A;  5CV4 A;  3A7L A;  2B29 A;  4LFC L;  1KQS A;  2N78 A;  3QJY A;  2DJG C;  4JI1 Q;  2A5H A;  4B3M Q;  3LWE A;  4DV4 Q;  1CQV A;  3L7Z C;  4A3L G;  1AFP A;  3BDO A;  3I8Z A;  3I4O A;  3LX0 A;  4DV7 L;  3H0G B;  1PTO D;  4PG3 A;  4KN4 C;  1GUG A;  2RA4 A;  1GUN A;  4OWW B;  5JOB A;  1IZ6 A;  2K5W A;  2EYO A;  1TWG B;  1WOC A;  1GUW A;  3H0G H;  1SE4 A;  1Y8N B;  5IGC A;  2QEX A;  2F0D A;  3CC7 A;  1Q81 C;  3KLS X;  3OSO A;  4I65 A;  1G29 1;  3VDY A;  1TWG H;  3E0E A;  3RZO B;  3VA5 A;  2D9U A;  3PO3 B;  1XMO L;  2RDH A;  1L1O B;  4JI5 Q;  2XGT A;  3NQI A;  1CM9 A;  4KKU A;  1PH3 A;  1HUN A;  5JVG 3;  5G3L D;  4UP9 A;  3NTH A;  3RZO H;  1GXD C;  3T4A C;  3I70 A;  3PO3 H;  1RF2 D;  4O2D A;  4RA8 A;  5H1S E;  1EY9 A;  2Z6K C;  1I50 B;  2EE1 A;  4JI0 L;  1CKO A;  1SNQ A;  1Q8I A;  3VR2 A;  2Z9H A;  4B9X A;  3JC6 6;  1A62 A;  1I50 H;  4NB3 A;  3GTL B;  2J4X A;  2E2I B;  1RJT A;  1SYG A;  3EA6 A;  2LXK A;  2F0L A;  5C5M A;  2XWB B;  2R93 G;  1KLG D;  2EYH A;  2SEB D;  1EZ8 A;  1YNJ C;  1S5C D;  1C0A A;  5C3E B;  3GTL H;  1W3S A;  5C6A A;  2E2I H;  2VQE Q;  4A3M B;  4L63 B;  2Z6K A;  4QMG A;  4CKC A;  1GOZ A;  4JBJ A;  4Y7N B;  4A3K B;  1UNS A;  4KK7 A;  4Y52 H;  4LMQ D;  4G7Z C;  5C3E H;  1LM0 A;  3I91 A;  1V1P B;  4DV5 Q;  1QUQ A;  4A3M H;  3OMC A;  1RCV D;  1PRT B;  2EY6 A;  4Y7N H;  4DUZ Q;  4A3K H;  2BH2 A;  3PO2 B;  2ALY B;  1GHK A;  4ZQ3 A;  2A69 C;  3HEJ A;  5L37 A;  2RQX A;  1MKH A;  1VQO A;  4YCU A;  3CHB D;  3QR8 A;  4FF1 A;  3PO2 H;  3K5M A;  2K32 A;  4HSP A;  1WTQ A;  4XQN A;  5DNF A;  3KF6 B;  2WKD A;  3J7Z C;  1HH2 P;  2RCF A;  4F8M A;  3T16 A;  4B3S Q;  2OQ0 A;  2A6H D;  1IBM L;  3AEV A;  2P5Z X;  4K8I A;  3HOV B;  3DUZ A;  3D4D A;  5M3F G;  2JK8 A;  3BZK A;  1K28 A;  3CME A;  1C4Q A;  5KYI A;  2ZTE A;  2L5T A;  1VQP A;  1BBW A;  3HOV H;  2PQA B;  4G7O C;  1WCM B;  2R7D A;  1SLJ A;  1IBK Q;  4GKK L;  1EY8 A;  1TKW B;  3BVM A;  1L0W A;  1XJV A;  4LUZ A;  3QB3 A;  4X66 L;  3PIP A;  3GQB A;  4DR2 L;  4OX9 L;  5IYD H;  1A6X A;  2E8G A;  1DOL A;  3K80 C;  4MIU A;  1WCM H;  3NBH B;  1F2M A;  1D7Q A;  4A3E B;  4RH6 A;  2N88 A;  3U9O A;  2F3V A;  4NMZ A;  1AP0 A;  1LV9 A;  3TQY A;  1W2B A;  3PUZ A;  1HFN A;  4X62 Q;  1B9N A;  4A3E H;  1LLR D;  5DEH A;  3A0J A;  1G8Z D;  4ZUI A;  5C3W A;  4DNR B;  3G4S A;  2Y0S E;  2QW7 A;  3S1N B;  3CRL C;  1VQ6 A;  4RCN A;  1HA6 A;  3I4M G;  3TZD A;  1ILP A;  1GM5 A;  2XRQ D;  4DR5 L;  1VQH A;  2F0G A;  1HPC A;  3S1N H;  2K7V A;  2BE5 C;  3E9I A;  3VYR A;  5E4W C;  1QCB D;  2F0N A;  3K5O A;  1O7L A;  4AYB G;  5IYB G;  2X69 A;  1KLU D;  1E24 A;  1VF7 A;  1XXG A;  1UE6 A;  3A55 A;  2F1M A;  3P75 A;  4QIW B;  1LYL A;  4LK1 C;  4LF5 L;  1K8A C;  5BR8 Q;  2ZJR A;  4IUT A;  1IHZ A;  3I3C A;  1GUO A;  2VQF L;  1S5E D;  3J7A F;  2AQ3 B;  5TSS A;  5JEA H;  1AE2 A;  4A3J B;  3K58 A;  4DV2 L;  3R93 A;  4U67 3;  5FKA C;  3S1M H;  5I4D A;  2WB1 G;  4C3H B;  3OW2 A;  2O5I C;  3IFD A;  4X64 L;  5DM7 3;  5I6W A;  2C5C A;  4LFB L;  1XMQ Q;  1HNZ L;  2L55 A;  4KHP Q;  4A3J H;  4DAP A;  4JBK A;  1O7I A;  1J9O A;  1CUK A;  4C3H H;  1AZQ A;  1V1Q A;  2O2L D;  3FKI B;  2FIN B;  1WTP A;  3MFG A;  3OHX C;  2J0T D;  2ZTD A;  3CRK C;  3UE0 A;  2Q8T A;  4JK1 C;  4F88 A;  3FKI H;  3J81 E;  3H09 A;  2K5D A;  2JA6 G;  4BBR G;  3CCM A;  2CQO A;  3K57 A;  1F9P A;  3ERQ A;  4YIJ A;  1LTT D;  1EY5 A;  1S5D D;  4N9P A;  3K5L A;  3I4N G;  1TXY A;  4RAU C;  3PUW A;  1IBL L;  3OMG A;  2JA7 B;  4OL7 A;  3MXU A;  3EFX D;  5FLX E;  5D3I B;  2ENB A;  2EY5 A;  1K8G A;  1NJI C;  2WAQ B;  1BXT A;  1Y1V G;  4PZ6 A;  5D14 A;  4DNI A;  5FO9 B;  2IY5 B;  3NHH A;  4Z9C B;  2JA7 H;  3HP3 A;  3CCR A;  1V9P A;  3KDF A;  3HOU B;  2MHV A;  4R8I A;  2E5L L;  5M5X B;  3E5S A;  1HTP A;  2BDO A;  4DAV A;  4YY3 Q;  1NY4 A;  2ZT9 C;  3HKZ E;  2VXW A;  1D8L A;  3HOU H;  3M3Y H;  3KK7 A;  4LF6 L;  2IHF A;  1TS3 A;  5C4J B;  5M5X H;  1WI5 A;  3TBI B;  3J7A V;  3CAM A;  3PIO 3;  2KHI A;  4NDX A;  3TP5 A;  3I90 A;  4RCO A;  2R92 G;  5C0X I;  1Q82 C;  5C4J H;  1D1I A;  2SNM A;  5FLM H;  3K81 C;  2UUC Q;  5IP9 G;  5C0X J;  2EYL A;  4NKL A;  3QOJ A;  1XNR Q;  4J6H A;  3J80 c;  5IT9 E;  4JCV E;  2UXD Q;  3CC4 A;  1YJW A;  2BDN A;  1RTN A;  1G6Z A;  1PYS B;  4L5Q A;  2K14 A;  4DR1 L;  5CV7 A;  2CW0 C;  1UEA B;  2PNR C;  5KNB A;  5KND A;  2FXQ A;  4KY5 A;  2PI2 A;  1FGU A;  3R2I A;  3GTO B;  2DUD A;  3W1G A;  3KF8 A;  3N52 A;  1IW7 C;  2F03 A;  3UDG A;  2UU9 L;  1X54 A;  2RSN A;  5FO8 B;  4L5S A;  5KRU A;  2HCI A;  3GTO H;  2R7Z B;  1GKH A;  3EBE A;  4JV5 L;  1LTS D;  1O78 A;  1VDZ A;  2ID0 A;  3C3L A;  1JT8 A;  2K50 A;  3I56 A;  4C1N K;  3W1B A;  2PZT A;  3TZU A;  1Y1W G;  3HOY G;  2R7Z H;  4A3B G;  1JJC B;  3TME A;  3EIV A;  1O7Z A;  3OTO Q;  3GTG B;  1UE5 A;  3ND8 A;  3CMA A;  3IKJ A;  2B8F A;  3I72 A;  3VR4 A;  1H9S A;  3GTG H;  1HR0 L;  5HGQ A;  3EJI A;  1QZH A;  1BQQ T;  2MNA A;  1KDB A;  1D5M C;  4HCE A;  2EYJ A;  1Y69 U;  4NXM L;  4O0A A;  5GRO A;  1WFQ A;  1OXX K;  1X3G A;  2WV6 D;  3LWU A;  2QKI C;  2LS0 1;  1FGB D;  3F2C A;  4OON A;  3I73 A;  1ZEQ X;  2FJ2 A;  4DAY B;  4PZ8 A;  2BOS A;  4A3C G;  1ET6 A;  2J7Z A;  3J80 i;  3DM3 A;  2E76 C;  1GUS A;  1LAC A;  2Z8L A;  4EQP A;  4GNX A;  5M3F B;  1S40 A;  1EWC A;  4A3D G;  3E6Z X;  1PMR A;  1TWF H;  1MSG A;  2IX0 A;  4DK3 C;  1SMY D;  4KY6 A;  4N8F A;  1R4Q B;  5M3F H;  1QNU A;  4ZKC B;  5IYC G;  3ERO A;  4RG1 A;  4HJ7 A;  1SNP A;  5LMN L;  1N33 L;  5E4X A;  5F2D A;  4DR4 Q;  1ENC A;  1VQD A;  3GP7 A;  1XYI A;  2ZXP A;  1ZKO A;  2GA4 B;  3BYT B;  4KN7 C;  3S15 B;  1YNN D;  2F0W A;  4K0K L;  1HCZ A;  4HIK A;  1N32 L;  2DY8 A;  4JC0 A;  4UHV A;  3HGB A;  5GAG C;  3LGJ A;  1ZYR C;  4OHJ A;  4IJH A;  1Q8K A;  3AFQ A;  1FL0 A;  1DYQ A;  3KJP A;  1HRJ A;  2BA1 A;  3I4M B;  4GOP B;  4IJL A;  2ES2 A;  1C9O A;  4JW0 A;  1STB A;  1XTC D;  1YHQ A;  1JOK A;  1EYG A;  3RLN A;  4JI3 Q;  1F2Z A;  4AYB B;  3I4M H;  2NZH A;  2RHQ B;  3ER0 A;  4EQ5 A;  3PIO A;  4IFD G;  3CPW A;  1RTO A;  1BO0 A;  3S9W A;  4GKJ L;  3KBG A;  2JA5 B;  3KOJ A;  2MUY A;  5ELO A;  2F52 A;  5IOD A;  4HJ5 A;  1H9M A;  4HJA A;  1A63 A;  1EU3 A;  4JBW A;  3AB9 A;  2JA5 H;  3S1Q B;  3NK9 A;  1F77 A;  3VR3 A;  3CU7 A;  2JXM B;  4MZ9 A;  1RL2 A;  4KV6 A;  1XNQ Q;  2BH8 A;  2WB1 B;  3BZC A;  1O80 A;  1YNX A;  3NTI A;  1JR0 D;  3QWN A;  3S1Q H;  2Q8I B;  2F0Q A;  1FNV A;  1Q7Y C;  2EXZ A;  2JA8 B;  3H94 A;  3Q6S A;  3OIP A;  3DEO A;  1U4P A;  4KJN A;  4GN4 B;  1SE8 A;  3GD7 A;  3X3N A;  1TQO A;  2AKW B;  1T5E A;  3J81 L;  1C48 A;  1JJG A;  1JC7 A;  1YNJ D;  2QF7 A;  3TS2 A;  1ESF A;  2OT2 A;  1I3Q B;  2EPB A;  4X65 Q;  1EUJ A;  1N8R C;  3Q22 A;  3Q24 A;  1STG A;  1L1O A;  4DUY L;  1VQ5 A;  4IN3 A;  2F4V L;  4DF7 A;  3QIA A;  1VQ4 A;  1CTM A;  1I3Q H;  4BBR H;  2F0U A;  4JI8 Q;  4DV1 Q;  1KRT A;  5KGU A;  3MAQ A;  3ZYY X;  1IL2 A;  4DAM A;  1VQB A;  5FLX L;  2YTV A;  1KD1 C;  4DR7 L;  4K5V A;  3HOZ G;  3STB C;  4LW1 A;  3JAM c;  5CGK A;  2A69 D;  4K14 A;  4GZY C;  3P20 A;  4OIK A;  1WTV A;  4QQB X;  1E2V A;  4ID6 A;  4JI1 L;  1H95 A;  2G5D A;  4B3M L;  3DWA A;  1CA5 A;  4DV4 L;  5LMN W;  2EVB A;  5LMU L;  1JMC A;  1O7Y A;  4XXE A;  4PMC A;  5G3L F;  1PVO A;  4HIM A;  3VR5 A;  1EQT A;  4GS3 A;  2WII B;  2F0V A;  1H9J A;  3TP8 A;  1JE4 A;  1V1P A;  3SHL A;  4JYA L;  2IT1 A;  5FO7 B;  4TKO B;  3SGI A;  1YBY A;  1S4Z A;  4JBM A;  2OEO A;  5IT9 L;  2VB2 X;  1N36 Q;  2N3S A;  4K6L A;  4MNO A;  4C1N I;  4G7H C;  4JI5 L;  5JEA J;  4M1U B;  4LF7 Q;  4DKA C;  3WDN A;  3PGZ A;  3OIQ A;  4GLV B;  3NWT A;  2B2U C;  3Q23 A;  3KF6 A;  4K2K A;  4BY1 B;  1HNX Q;  4YWK A;  3T1H Q;  2A19 A;  5EPJ A;  2WAQ E;  2L1B A;  1VQ8 A;  3M4O B;  4ZUJ A;  3M9B A;  1B2T A;  2EXD A;  3GTP B;  3H3V H;  4B3R Q;  4X3U A;  2IW3 A;  4OWT B;  5M3M B;  2MP1 A;  4OGQ C;  3TN2 A;  4BY1 H;  3U9S A;  2N55 A;  1KRS A;  2NB0 A;  3G48 A;  3M4O H;  4XT3 B;  4B3T L;  1NTG A;  1K73 C;  2PZW A;  4IUQ A;  3GTP H;  2PQA A;  5M3M H;  4KD3 A;  1CKN B;  3S24 A;  1ASY A;  2N49 A;  1TWA B;  2LY7 A;  3PSI A;  2VQE L;  4A3B B;  2NVT B;  2BE5 D;  3URY A;  3CCE A;  1W6K A;  3DM1 A;  4L5R C;  1E2W A;  3JAM i;  4JOI C;  1X3E A;  1TWA H;  4IUV A;  5IOC A;  3BYY B;  4DV5 L;  4QL5 A;  2D0O A;  4A3B H;  4LNQ A;  1ENA A;  2EYP A;  3EVQ A;  2NVT H;  1B70 B;  4ZLT F;  2E2J B;  3CKI B;  4DUZ L;  3GDE A;  4FO2 A;  3RN2 A;  4YWL A;  5KEE A;  1V8Q A;  2BCO A;  4A3I G;  2DGY A;  4ABN A;  2VY3 A;  2E2J H;  3GV3 A;  4CJ0 B;  1ILQ A;  5J22 A;  3HS0 C;  1TS5 A;  3C1F A;  4BBS G;  3ULP A;  3TEH B;  3KLR A;  1STY A;  4OXP A;  3MXG A;  1LTG D;  2CHB D;  1LUZ A;  4LFC Q;  2QGQ A;  2TSS A;  1DD2 A;  2IL8 A;  3A8I E;  3TSS A;  5FJ8 H;  3PCO B;  2IHE A;  4RWS C;  1PYW D;  5EKL A;  1UEB A;  1I4G A;  4CDD C;  1JOR A;  1VQK A;  3MC0 B;  1B3A A;  4O1N A;  1S5B D;  3D4R A;  4BXX H;  4DV7 Q;  2NUC A;  1N34 Q;  2Q2U A;  4A3C H;  3BS1 A;  2F0S A;  2RDF A;  1A3T A;  1HQM C;  3A8J E;  3L9A X;  1OXU A;  4DA2 A;  1X32 A;  1PH9 A;  2HDL A;  1DCZ A;  1AW7 A;  2WKC A;  4ZK9 B;  1D6E C;  1XPR A;  2I07 B;  3VYT A;  5IYC H;  2UUB Q;  1ZXT A;  4JG2 A;  3M4Y A;  1QVF A;  1GO3 E;  3RMH A;  5KIX A;  1Z6H A;  1VS0 A;  4HID A;  3FEW X;  2B2T C;  1KTK A;  5E1F A;  3MWY W;  4XQJ A;  4LF8 L;  3D4W A;  4WJW A;  2H4O A;  3T51 B;  1AE3 A;  1I94 L;  1NMG A;  2KUM A;  1ICF B;  5EKI A;  4Q0F A;  3A5Z B;  4KY7 A;  5AJ3 L;  3CW2 C;  1PH4 A;  2VUM G;  5IGG A;  1X55 A;  1RKN A;  1XPO A;  3CC2 A;  5ELD A;  1II3 A;  1CQF A;  3K0X A;  1EIH A;  3I7F A;  4QUC A;  2HQE A;  1X65 A;  3DMU A;  2EJM A;  3Q8D A;  2KHJ A;  1HZB A;  1Z47 A;  4JI2 Q;  5JPM C;  4R8N A;  3MEF A;  1FJG Q;  1RD9 D;  1VF5 C;  4PMB A;  4KJO A;  3M4P A;  4A3F G;  1PH8 A;  2CFM A;  1J8I A;  1YHA A;  4IOC A;  4RGT A;  1J6Q A;  4IFD H;  4K8J A;  5C44 G;  2IX1 A;  2DNE A;  4POG A;  4MTN A;  4LF9 L;  3RUZ A;  1FR3 A;  2BA0 A;  1E22 A;  1GJX A;  4DK1 A;  4KHP L;  2LXJ A;  2Y0S G;  1D5Z C;  1UE1 A;  2AQ2 B;  1K3B C;  1I6V C;  1SBB B;  3MXP A;  5CV6 A;  1I5F A;  2KED A;  4HJ8 A;  1JE5 A;  4QJF A;  1VQ9 A;  1PTO C;  4IPC A;  2XN9 C;  1J5E L;  1IBM Q;  1CK1 A;  3SEB A;  1F9Q A;  2UXB L;  1KIX A;  5I9O A;  2IX3 A;  1BCP D;  1VMP A;  3TP7 A;  2OQK A;  2HIX A;  3S1M B;  5CV5 A;  1G2T A;  2ZTC A;  4CGY B;  5M5W B;  1BOS A;  2CWA A;  2QCP X;  3N6R A;  2I5L X;  4AYB E;  1SMX A;  2K03 A;  2QIL A;  4H02 A;  1NR4 A;  4LUO A;  2E2D C;  4ZAI A;  4DR2 Q;  4OX9 Q;  1G6P A;  5M5W H;  3NBI A;  3NPP A;  1K9M C;  1HZA A;  3HOX G;  1SYF A;  3R8B A;  1Z7T A;  4CBV A;  4R4Q A;  1Q12 A;  1JQY D;  2JEA I;  1HZC A;  3MZ5 A;  1EY7 A;  3AFP A;  4QF4 A;  5LHY 1;  2LMC B;  5CV9 A;  3TP6 A;  2QA4 A;  2B63 B;  2WB1 E;  1DON A;  3CCU A;  3FHW A;  4FNF A;  1HXY D;  1XWE A;  3W2D A;  2OWO A;  2MJ8 A;  1TS4 A;  3WOF A;  1JB7 A;  2A68 D;  1F9R A;  3U50 C;  5C4H A;  4BA1 I;  3ERS X;  2B63 H;  1K0R A;  1TR5 A;  1LTB D;  2TMP A;  4UAI A;  1EQQ A;  2HD3 A;  3A8K E;  1U0L A;  2UUC L;  5C0X G;  1VQN A;  2XNA C;  4K6D A;  1XNR L;  4F87 A;  1I4X A;  3T1Y L;  1HHV A;  5IGB A;  2D2C C;  5CV8 A;  1I4R A;  1GHJ A;  4KHV A;  5HY6 A;  3BG3 A;  3HZX A;  3FDT A;  3NEL A;  3MEH A;  4BY7 G;  2QDL A;  3OWF A;  5IGE A;  4LF5 Q;  3M3Y B;  4MN3 A;  2XIW A;  3TRZ A;  2NVX B;  2VQF Q;  4JVZ A;  2NWG A;  3R2T A;  4GN5 A;  2K1B A;  4X6A H;  5CMD A;  2DJF C;  4IZ8 A;  3FPP A;  4ZCK A;  2CVR A;  2ICI A;  4DV2 Q;  4DR6 Q;  3B6Y A;  2CQA A;  2B2W C;  2NVX H;  1ENF A;  4G4K A;  5K36 G;  3HKZ G;  3GV6 A;  2NN6 G;  5C4X G;  1ZYR D;  1HNZ Q;  1RDP D;  3V2T A;  5IP7 G;  2A6H C;  2Q2H A;  2PPB C;  1H9K A;  4L5T A;  4A3L H;  1I6H B;  3SK6 A;  1PXU A;  1OO9 B;  2V4D A;  1EY4 A;  5ELN A;  5IE8 A;  2VS1 A;  1NR2 A;  4EVO A;  2HQL A;  2PO4 A;  4ME5 A;  3OTO L;  1E3P A;  4OO1 G;  3F1Z A;  1SND A;  1I6H H;  3A74 A;  2PMZ B;  1YZ6 A;  1PZK D;  3CQZ B;  3HRZ C;  1VQ7 A;  1SNO A;  4GOP C;  1QG7 A;  1PRT F;  2QDB A;  4UPA A;  4QY7 A;  3CQZ H;  5A2Q E;  1PTO B;  1N9W A;  1SYC A;  2I46 A;  2D5D A;  5CBA E;  4HR7 B;  3TDQ A;  1Q1B A;  2ZXO A;  4IUN A;  2PW5 A;  1FD7 D;  1PTO H;  1EFW A;  3RR5 A;  3AU7 A;  4RHS A;  1U4M A;  1HTL D;  2IWH A;  4GLA C;  2ZM6 L;  4N9T A;  3GTQ B;  1LT6 D;  1H9R A;  4CHT B;  4GOP A;  4NXN Q;  2R93 B;  4NP5 A;  1WD0 A;  3GTQ H;  3H0G G;  5ELF A;  4LF6 Q;  2K75 A;  1S3O A;  4MHE A;  2E75 C;  2R93 H;  3FVQ A;  1WVL A;  1E7Z A;  1SFO B;  4HN7 A;  3EQL C;  1QVG A;  3F2D A;  3RD4 A;  3VYS A;  3EN2 A;  3S14 B;  2Q8R E;  2RCN A;  2PQE A;  4PNY A;  1SFO H;  1JCK B;  4A76 A;  1EL0 A;  4DR4 L;  3PO3 G;  3C2P A;  1SSO A;  3S14 H;  1DJR D;  2LFN A;  1PFN A;  3H3V I;  5KYL A;  4DPG A;  1HUM A;  1Y14 B;  4DV3 Q;  3STB D;  4EQO A;  1EZ6 A;  3NTK A;  4IUP A;  4N8X 1;  3I4L A;  1EIF A;  1DM0 B;  4V0B A;  4QB4 A;  3A5U A;  4DR3 L;  4B9W A;  1NSN S;  1MHW C;  1OXV A;  1TWF B;  5JPN C;  1PRT D;  4DV0 Q;  2R6G A;  3KDF B;  4IAL A;  2A6E D;  5CR3 A;  4S3S A;  3W3A A;  2B39 A;  2VUM B;  1EIY B;  4NPS A;  5HGT A;  3SVM A;  4UY8 C;  4OEM B;  2ZXR A;  4JI3 L;  3V05 A;  4P71 A;  4XQQ A;  4DK0 A;  2K01 A;  2SNS A;  2VUM H;  5K5P A;  1EWI A;  4A3M G;  5EQ0 A;  3OPO A;  5FOB B;  3H91 A;  4CJ1 B;  4RKL A;  5IWA L;  3G6E A;  4JI4 Q;  2PZU A;  4A3K G;  1LTL A;  4E6I A;  5E3F A;  2R3Z A;  2Z6B A;  2KQ3 A;  1K83 B;  4IPH A;  3L3O C;  2JA9 A;  2LKV A;  2YYZ A;  2F0O A;  1EWH A;  4G57 A;  4K5W A;  2RSO A;  2F0T A;  4TQU S;  4MTK A;  2F0P A;  1TT2 A;  1HR0 Q;  3PO2 G;  4H7B A;  1EY6 A;  1K83 H;  1K8M A;  2Z4H A;  4NXM Q;  1EOV A;  2M2L A;  4FF2 A;  4V19 0;  2MO1 A;  2F0J A;  1YVC A;  2B8G A;  4I7A A;  4PQX A;  3D6W A;  4IPG A;  3H3V C;  3S16 B;  2WIN B;  4J1M A;  4HCS A;  1BF4 A;  3H6M A;  3HOV G;  1B53 A;  5LL6 X;  1A3V A;  1TS2 A;  3SE0 A;  4JI7 Q;  4WOR A;  3S16 H;  3SK8 A;  4LFA Q;  3KYH C;  5EPL A;  3S1R B;  3VA7 A;  1GUT A;  5J39 A;  1PHJ A;  3NSW A;  5EJW A;  3UDF A;  1KHI A;  1WCM G;  4A93 G;  3WOE A;  5IYB H;  1STN A;  2EQS A;  4H0L C;  3BVZ A;  1KC8 C;  1JJ2 A;  2B2Y C;  3S1R H;  2D0P A;  2M00 A;  3VYU A;  1A2U A;  2JN4 A;  4HJ9 A;  2ATW A;  2EYF A;  4JI8 L;  4DV1 L;  1VQG A;  1SE2 A;  3HG9 A;  4KTA A;  4A3E G;  3FPU B;  3K0Y A;  1C8C A;  2DNC A;  1M8A A;  4OIJ A;  3VR6 A;  1SJE D;  1VQM A;  5BN5 A;  1IYV A;  3D6C A;  4F7X A;  3A54 A;  5HUR A;  4UP7 A;  5ELC A;  3BU2 A;  3BVG A;  4AQY L;  1CKN A;  2MO0 A;  2R7F A;  4KHZ A;  4P75 A;  1X6O A;  4X3K A;  1A2T A;  3G71 A;  3CP0 A;  5LL6 S;  2JA6 B;  4BBR B;  4ILW A;  1HNW L;  4XDX A;  1QWY A;  1SRO A;  1RHP A;  5J3B A;  4P72 A;  3I4N B;  2JA6 H;  1HJP A;  5KNC A;  4GNX B;  1IYJ B;  4HMJ A;  3CPF A;  3D31 A;  4IFD I;  3UDX A;  2UUA L;  2HHH Q;  1TWC B;  1TVX A;  1LT4 D;  3H15 A;  3I4N H;  4LF7 L;  4IFD J;  1P16 A;  1Y1V B;  4A3G G;  4GKJ Q;  4RGN A;  1TWC H;  3ND9 A;  1CA6 A;  2OXP A;  2XVS A;  5ELE A;  4A3J G;  1L2F A;  3U4V A;  1Y1V H;  2O5J C;  1BVS A;  4C3H G;  2V1C C;  4B3R L;  2UXC Q;  1BR9 A;  3M4Q A;  2HDM A;  4DFA A;  3ONA B;  1LTI D;  1IKL A;  1LAB A;  1YEZ A;  2AWN A;  2SOB A;  2F3I A;  2XSC A;  1U4L A;  4XIG S;  3GO5 A;  4R9W A;  3FKI G;  2R92 B;  1PLF A;  4XYO A;  3F2U A;  2Z1C A;  3ZJY C;  4TRD A;  5C4X H;  3DHQ A;  4LWC A;  1Y8O B;  1D2B A;  5E7N A;  2ZJP A;  2R92 H;  5JJL A;  1SMY C;  4DV6 Q;  1U9R A;  1LTR D;  4H13 C;  5IP9 H;  4FF4 A;  5EBD A;  1IL8 A;  2K4K A;  4OO1 H;  2CWP A;  1SJH D;  1PZI D;  1WTO A;  2JA7 G;  2H5X A;  4DUY Q;  3PUY A;  1KAB A;  5D65 A;  2F4V Q;  3PMF A;  2JJQ A;  5A2Q L;  1M1K C;  3K6O A;  3IAY A;  4APV A;  1PYB A;  2WAQ G;  4DR7 Q;  1EFI D;  1SYE A;  4M8A A;  4PZ7 A;  3HOU G;  4LUV A;  1WTX A;  4HTH A;  1S5F D;  2SDF A;  1X56 A;  4EX5 A;  1BBX C;  1IKM A;  1B8A A;  1Y1W B;  3HOY B;  3KFU A;  2B2U A;  3Q0A A;  2AUK A;  1QOH A;  5LMU Q;  3W5O A;  3PUV A;  5FLM G;  1TWH B;  2B2V C;  2RDG A;  4LF4 Q;  4YHH Q;  3NBH A;  1N34 L;  1ET9 A;  1Y1W H;  2ZJQ A;  3HOY H;  2F4I A;  1LT5 D;  2VNU D;  1E2Z A;  1PFM A;  1TWH H;  2MQH A;  2XTI A;  4KI0 A;  2PMZ E;  1KDC A;  1CI3 M;  1B3Q A;  4JYA Q;  4WRD A;  3OW7 A;  4HSV A;  4P73 A;  4JI6 Q;  1NAP A;  2UUB L;  3AYH B;  1K8O A;  1RIP A;  1GVP A;  3GTM B;  3HOW G;  2B2V A;  4JOI A;  4H44 C;  1BNZ A;  1PFB A;  5A35 A;  4B3S L;  3S2H B;  2KA7 A;  1V43 A;  1B4O A;  4RGO S;  4J8Q A;  3GTM H;  2YU9 B;  1PFS A;  4DXG A;  2LSS A;  4I7Z C;  1PDQ A;  1STH A;  3S2H H;  3NQT A;  2R7Z G;  2JP1 A;  3MXN B;  1FYC A;  2KCT A;  3K7U C;  4A3D B;  1IBK L;  2YU9 H;  4FP5 D;  3J81 c;  2IJ0 A;  3QOL A;  1E1T A;  1VQI A;  4B3T Q;  2KEE A;  2F0I A;  4AIM A;  4FYD A;  4A3D H;  3CCJ A;  3CXC A;  1CT1 D;  4JI2 L;  1FJG L;  1F2Y A;  4FXD A;  1YHB A;  1B9M A;  2RF4 A;  1NBW A;  1XMO Q;  5FLX c;  4X62 L;  4B08 A;  3U58 A;  2F0F A;  1HFG A;  4WJ3 M;  1NE3 A;  1EEF D;  1DZ1 A;  1R4P B;  2I5H A;  3S2D B;  3NP8 A;  3MVV A;  3JAM E;  3TRE A;  1BCP F;  1DGS A;  1WTH A;  5IGD A;  1GD7 A;  1QJO A;  1K3R A;  1Q90 A;  4JI0 Q;  1Z9F A;  3S2D H;  1QNK A;  1VQL A;  1FNU A;  2KBN A;  1X9N A;  3MHB A;  1XPU A;  3SXH A;  4HMI A;  2Z4I A;  1WTR A;  1F2L A;  4DXF A;  1SNM A;  2B2T A;  4ZYS A;  4TVA B;  2Z0S A;  2CH4 W;  5EBC A;  4P2C B;  5BR8 L;  1B50 A;  1EOT A;  3U4Z A;  5C3X A;  2X6G A;  2MPM A;  5IT9 c;  1JB3 A;  4A93 B;  3NE5 B;  4X3S A;  3J80 L;  3FRP B;  2ASB A;  5C5L A;  2CW0 D;  1I4H A;  4OWX B;  1EEI D;  1A3U A;  1T9H A;  3IL8 A;  4IUR A;  4FF3 A;  4A93 H;  3G6J B;  5NUC A;  1XMQ L;  3SDZ A;  2KCM A;  2NZ1 D;  1SN8 A;  2X6L A;  1IW7 D;  4CDF C;  5I2Y A;  3J81 i;  2G9H D;  1TU2 B;  4QUF A;  4HAE A;  2NTT A;  1OXT A;  5JJK A;  5CYU A;  1VQA A;  2F0M A;  4ULL A;  1R9T B;  1QIL A;  4RGM A;  5EGT A;  1CFM A;  4LF8 Q;  2AUJ D;  3NEN A;  2PI2 E;  5GAE C;  1I94 Q;  2EIF A;  2VB3 X;  1I4Q A;  5BN3 A;  5AJ3 Q;  4DGZ A;  1R9T H;  1JWU D;  1T5X D;  1PH6 A;  4GKK Q;  5JVH 3;  3ULJ A;  1D5X C;  3F8T A;  2VZA A;  1MI2 A;  1QE6 A;  4X66 Q;  2K05 A;  1EY0 A;  2NZO A;  4ODG A;  5DLQ E;  1Y8P B;  2Q2I A;  1MJC A;  2JA5 G;  2FHT A;  3HOZ B;  4R1J A;  3I55 A;  1QUQ B;  1CHQ D;  4A3G B;  1EU4 A;  1ICW A;  5BN4 A;  2K5H A;  3HOZ H;  4YY3 L;  1B1Z A;  2FMM A;  4DR6 L;  4A3G H;  4FXK C;  3AMU A;  4LF9 Q;  2QEJ C;  2NVQ B;  2MFI A;  2JA8 G;  1KDA A;  1PZJ D;  1X3F A;  2K52 A;  3G7L A;  2NVQ H;  2HIV A;  1K0S A;  2A1A A;  4DR5 Q;  3MA2 B;  4C3I G;  4BS9 A;  2UXD L;  1Q3L A;  3WWV A;  2RBM A;  3K5N A;  4FVM A;  1J5E Q;  5J1Z A;  5I2X A;  2PCF B;  1FVI A;  2UXB Q;  1ML0 D;  3CCS A;  3D0F A;  4GN3 B;  1YIT A;  3KUP A;  1B44 D;  5FK9 C;  4O42 A;  1EQV A;  4FXG C;  1EYA A;  1CZW A;  1JIC A;  3OYY A;  3MFY A;  2VW9 A;  2YTX A;  4CDE C;  3D8G A;  4ALP A;  4XYQ A;  2K6A A;  4DAY A;  3ITP A;  2ICE C;  4EGV A;  2RVL A;  1KNA A;  2HUG A;  1HA5 A;  1SYB A;  3M7G A;  1MGS A;  4KD4 A;  4X64 Q;  4KKT A;  4LFB Q;  3D3R A;  3CD6 A;  3PUX A;  2L15 A;  3P1H A;  5GAH C;  1DOM A;  2O4X A;  3RZD B;  4NXN L;  3PF4 A;  1L0X B;  1UUP A;  2A8V A;  1OTC A;  4R4C A;  4C3J G;  1PV4 A;  1V1O A;  2CKZ B;  4C56 C;  2NTS A;  3RZD H;  2MGS A;  3C46 A;  1A8V A;  3P7J A;  2JE6 I;  2A74 C;  3T53 B;  2B2W A;  1AZP A;  4K5X A;  3RNU A;  3SR1 A;  1VQC A;  4QGU A;  2WP8 J;  2DN8 A;  1ASZ A;  3T13 A;  2OTJ A;  2GN5 A;  3L2P A;  3CCQ A;  1MD2 D;  5AFW A;  1STE A;  1E0B A;  1IBL Q;  1DXM A;  4A3I B;  1MSH A;  1ROD A;  3RN5 A;  5DM6 3;  3T1Y Q;  1W6J A;  4ME3 A;  2AQ1 B;  1CHP D;  2L12 A;  4IO9 A;  1HQR D;  2K28 A;  2EOT A;  2IPK D;  4HIO A;  2B3G A;  1X3Q A;  3UDI A;  4DV3 L;  4BBS B;  4A3I H;  3HOW B;  5JJZ A;  4DNT B;  4CKE A;  4XT1 B;  4POF A;  1UWV A;  3J7Y W;  1BKB A;  2F0E A;  4BY1 G;  3DWP A;  1U5K A;  1VQE A;  1NNX A;  2E5L Q;  3K8A A;  2K5N A;  4BBS H;  2R61 A;  4DV0 L;  3M85 A;  3HOW H;  3TS0 A;  5M3M G;  2OF1 A;  1IYU A;  2NN6 I;  1EYD A;  4A75 A;  1OXS C;  1Q46 A;  3LNN A;  5M5Y B;  1YJ9 A;  2C9O A;  1WD1 A;  1KNE A;  1WJJ A;  2KCN A;  2EYM A;  5I6Y A;  3AQQ A;  1XX8 A;  3E0J A;  3CCV A;  2K5Q A;  2H1E A;  5JAV A;  1LT3 D;  4OO1 I;  1NCV A;  1BCP C;  5T1G A;  3KBX A;  5M5Y H;  4JI4 L;  1AN8 A;  1Q86 C;  3GTJ B;  3DEP A;  4TSS A;  2XRS D;  1ESR A;  3NWS A;  4DR1 Q;  1VQJ A;  5EKK A;  3O13 A;  2YV5 A;  3A7A B;  1STA A;  3GTJ H;  3V96 A;  1CSP A;  2C35 B;  1LTA D;  1BBU A;  4GNX C;  3JAM L;  2PNH A;  3M7N A;  2JSO A;  4LJZ C;  1SR3 A;  4Q5V A;  1G2S A;  4UP8 A;  4EQN A;  3SK5 A;  2UU9 Q;  5FJ8 G;  3E9H A;  2RKS A;  4R4I A;  1TII D;  1KAW A;  4P74 A;  2PW7 A;  2FFK B;  3CF5 A;  2JYO A;  3NXW A;  2WFW A;  4IOA A;  4JV5 Q;  3BJU A;  3NEM A;  5COY A;  4R4T A;  2A68 C;  3DXJ C;  1WTW A;  3T56 B;  4BXX G;  3E3X A;  2EJF C;  2ZM6 Q;  1NUC A;  5C3E G;  4JI7 L;  3NUC A;  1EIG A;  4L8J A;  4LFA L;  2PYK A;  4IQZ A;  4LAA A;  3C1E A;  2I0Q A;  2KHS A;  1DOK A;  5CBE E;  4AH6 A;  2VL6 A;  1MBY A;  1TY0 A;  3DWQ A;  1KAA A;  2M9V A;  3BDC A;  1UAP A;  3J81 j;  2F3W A;  3KJO A;  2N8N A;  5GAD C;  4A3F B;  5IGF A;  1PH1 A;  2EY2 A;  4QCL A;  1QVC A;  1BUV T;  2I5M X;  3UE1 A;  2KJX A;  5T1I A;  1EYC A;  1X3P A;  5C44 B;  5ISR A;  1L0Y B;  4YWM A;  1XNQ L;  4A3F H;  1SRU A;  3ULL A;  5ELB A;  3FP9 A;  4WJ4 A;  1SXT A;  2K04 A;  4RFB A;  3HKS A;  1PA6 A;  3PF5 A;  1ONL A;  2K33 A;  5C44 H;  5IIF A;  3OOC A;  2Y0S B;  3IFT A;  2AMC B;  3QO2 A;  4WFN 3;  1JOO A;  3I2Z A;  3KF8 B;  1WYD A;  2AWO A;  4HED A;  1BDO A;  3K59 A;  4X3T A;  4DR3 Q;  1TY2 A;  3S15 H;  1AH9 A;  4YCV A;  1KL9 A;  2KEN A;  1NMF A;  2JEB I;  3UI2 A;  5IYD G;  1VMC A;  3PQI A;  1UE7 A;  4KKS A;  4DN4 M;  3ICE A;  1B7Y B;  1MJE A;  2RHS B;  4X65 L;  5EPK A;  2L0C A;  3FMC A;  4RKB A;  2EY1 A;  2L4N A;  4U68 A;  3J80 E;  5DAU A;  2F0K A;  2F0H A;  4CDC C;  1YI2 A;  1JWS D;  1A15 A;  3MTS A;  2E2H B;  1C7Y A;  2CH4 A;  1SE3 A;  1SYD A;  3KLS A;  2KVM A;  1CKM A;  2NVY B;  2HHH L;  4BA2 I;  1VQF A;  1LO5 D;  1AEX A;  3HOX B;  5LMN Q;  1N33 Q;  5IWA Q;  2E2H H;  1QB5 D;  1H9S B;  1SAP A;  5CC4 A;  1IXR A;  4KLK A;  2NVY H;  4ZKB B;  4R4O A;  1E1O A;  3OWE B;  2NYZ D;  1CSQ A;  3X3M A;  3HOX H;  1XTD A;  4K0K Q;  4CKB A;  2B2Y A;  2L11 A;  1EQR A;  1P8L A;  1N32 Q;  3RLO A;  2UXC L;  5COR A;  4J15 A;  1M90 C;  5GQO A;  4NW2 A;  1I4P A;  1U4R A;  4PMW A;  1BCP B;  4RMF A;  5IY0 A;  1HZ9 A;  2D62 A;  1JOQ A;  1QZG A;  4DK6 C;  2K5V A;  4ZRZ A;  4FDB A;  1G51 A;  2EJG C; 
#chains in the Genus database with same CATH homology
 4IUU A;  2HCC A;  2DY7 A;  4KMU C;  4DU9 A;  5M9O A;  4XTC S;  4C3I B;  1SNC A;  5JEA G;  3GTK B;  5C0X H;  4RHR A;  5I9P A;  4BY7 B;  4C2M B;  3RLF A;  2FMC A;  3BDL A;  1G91 A;  4L6T B;  3S17 B;  1PTO F;  2A73 B;  1D1K A;  5C4Z A;  3PV0 A;  3QG1 A;  3K7A B;  2E74 C;  3R3O A;  1FNW A;  4CJ2 C;  3HKZ B;  5C4X B;  3MXN A;  2KOL A;  4K2L A;  1PRT C;  5K36 H;  2NN6 H;  1CZG A;  1F9S A;  2A6E C;  3PIP 3;  1SEB D;  2KCC A;  2WAC A;  4C3J B;  2NBF A;  3SK4 A;  1SDF A;  1VCI A;  2EZV A;  5D3D A;  1Q1E A;  2L9H A;  4PV1 C;  2EDG A;  2G9D A;  3BZD B;  2XWJ B;  1JWM D;  3A56 A;  1YNN C;  4BWG B;  1M4V A;  4UDU C;  2KEC A;  5CV4 A;  3A7L A;  3QJY A;  2A5H A;  3LWE A;  1CQV A;  3L7Z C;  1AFP A;  3BDO A;  3I8Z A;  3LX0 A;  3H0G B;  1PTO D;  4KN4 C;  1GUG A;  2RA4 A;  1GUN A;  5JOB A;  2K5W A;  2EYO A;  1TWG B;  1GUW A;  1SE4 A;  1Y8N B;  5IGC A;  2F0D A;  3KLS X;  3OSO A;  4I65 A;  1G29 1;  3RZO B;  3VA5 A;  2D9U A;  3PO3 B;  2RDH A;  3NQI A;  1CM9 A;  4KKU A;  1HUN A;  5JVG 3;  5G3L D;  3NTH A;  1GXD C;  3T4A C;  3I70 A;  1RF2 D;  4RA8 A;  1EY9 A;  1I50 B;  2EE1 A;  1SNQ A;  1Q8I A;  3VR2 A;  4B9X A;  3GTL B;  2J4X A;  2E2I B;  1RJT A;  1SYG A;  3EA6 A;  2F0L A;  5C5M A;  2XWB B;  1KLG D;  2EYH A;  2SEB D;  1EZ8 A;  1YNJ C;  1S5C D;  5C3E B;  5C6A A;  4A3M B;  4L63 B;  4QMG A;  4CKC A;  1GOZ A;  4Y7N B;  4A3K B;  1UNS A;  4KK7 A;  4LMQ D;  4G7Z C;  3I91 A;  1V1P B;  3OMC A;  1RCV D;  1PRT B;  2EY6 A;  3PO2 B;  1GHK A;  4ZQ3 A;  2A69 C;  3HEJ A;  2RQX A;  3CHB D;  4FF1 A;  3K5M A;  2K32 A;  4HSP A;  1WTQ A;  4XQN A;  5DNF A;  2WKD A;  4F8M A;  3T16 A;  2A6H D;  4K8I A;  3HOV B;  3DUZ A;  3D4D A;  1C4Q A;  5KYI A;  2L5T A;  4G7O C;  1WCM B;  1EY8 A;  1TKW B;  3BVM A;  3QB3 A;  3GQB A;  1A6X A;  1DOL A;  4MIU A;  1F2M A;  4A3E B;  4RH6 A;  2N88 A;  3U9O A;  2F3V A;  4NMZ A;  1AP0 A;  1LV9 A;  3PUZ A;  1HFN A;  1B9N A;  1LLR D;  5DEH A;  1G8Z D;  4ZUI A;  5C3W A;  4DNR B;  3S1N B;  3CRL C;  4RCN A;  1HA6 A;  3TZD A;  1ILP A;  2XRQ D;  2F0G A;  1HPC A;  2K7V A;  2BE5 C;  3VYR A;  5E4W C;  1QCB D;  2F0N A;  3K5O A;  1O7L A;  2X69 A;  1KLU D;  1VF7 A;  1XXG A;  3A55 A;  2F1M A;  3P75 A;  4QIW B;  4LK1 C;  4IUT A;  1IHZ A;  3I3C A;  1GUO A;  3J7A F;  1S5E D;  2AQ3 B;  5TSS A;  5JEA H;  4A3J B;  3K58 A;  3R93 A;  4U67 3;  5FKA C;  5I4D A;  4C3H B;  2O5I C;  3IFD A;  5DM7 3;  5I6W A;  2C5C A;  2L55 A;  4DAP A;  1J9O A;  1AZQ A;  2O2L D;  3FKI B;  2FIN B;  1WTP A;  3MFG A;  3OHX C;  2J0T D;  3CRK C;  2Q8T A;  4JK1 C;  4F88 A;  3J81 E;  3H09 A;  2K5D A;  3K57 A;  1F9P A;  3ERQ A;  4YIJ A;  1LTT D;  1EY5 A;  1S5D D;  4N9P A;  3K5L A;  4RAU C;  3PUW A;  3OMG A;  2JA7 B;  4OL7 A;  3MXU A;  3EFX D;  5FLX E;  5D3I B;  2ENB A;  2EY5 A;  2WAQ B;  1BXT A;  5D14 A;  5FO9 B;  3NHH A;  4Z9C B;  3HP3 A;  3HOU B;  2MHV A;  4R8I A;  5M5X B;  3E5S A;  1HTP A;  2BDO A;  4DAV A;  2ZT9 C;  2VXW A;  3KK7 A;  1TS3 A;  5C4J B;  3TBI B;  3J7A V;  3PIO 3;  4NDX A;  3TP5 A;  3I90 A;  4RCO A;  5C0X I;  1D1I A;  2SNM A;  5C0X J;  2EYL A;  4NKL A;  3QOJ A;  4J6H A;  5IT9 E;  2BDN A;  1RTN A;  1G6Z A;  5CV7 A;  2CW0 C;  1UEA B;  2PNR C;  5KNB A;  5KND A;  4KY5 A;  3R2I A;  3GTO B;  3KF8 A;  3N52 A;  1IW7 C;  2F03 A;  2RSN A;  5FO8 B;  5KRU A;  2HCI A;  2R7Z B;  1LTS D;  1O78 A;  1VDZ A;  2ID0 A;  3C3L A;  4C1N K;  2PZT A;  3TZU A;  3TME A;  1O7Z A;  3GTG B;  3ND8 A;  3IKJ A;  2B8F A;  3I72 A;  3VR4 A;  1H9S A;  3EJI A;  1BQQ T;  1KDB A;  1D5M C;  4HCE A;  2EYJ A;  1Y69 U;  1OXX K;  2WV6 D;  3LWU A;  2QKI C;  2LS0 1;  1FGB D;  3I73 A;  1ZEQ X;  2FJ2 A;  2BOS A;  1ET6 A;  2J7Z A;  2E76 C;  1GUS A;  1LAC A;  2Z8L A;  4EQP A;  5M3F B;  1EWC A;  3E6Z X;  1PMR A;  1MSG A;  2IX0 A;  1SMY D;  4KY6 A;  1R4Q B;  1QNU A;  4ZKC B;  3ERO A;  1SNP A;  5E4X A;  5F2D A;  1ENC A;  3GP7 A;  1XYI A;  2ZXP A;  1ZKO A;  2GA4 B;  3BYT B;  4KN7 C;  3S15 B;  1YNN D;  2F0W A;  1HCZ A;  2DY8 A;  3HGB A;  1ZYR C;  4OHJ A;  1DYQ A;  1HRJ A;  2BA1 A;  3I4M B;  1STB A;  1XTC D;  1JOK A;  1F2Z A;  4AYB B;  4IFD G;  1RTO A;  1BO0 A;  3S9W A;  2JA5 B;  3KBG A;  2MUY A;  5IOD A;  1H9M A;  1EU3 A;  4JBW A;  3AB9 A;  3S1Q B;  3NK9 A;  1F77 A;  3VR3 A;  3CU7 A;  2JXM B;  4KV6 A;  2WB1 B;  1O80 A;  3NTI A;  1JR0 D;  3QWN A;  2Q8I B;  2F0Q A;  1FNV A;  2EXZ A;  2JA8 B;  3H94 A;  3Q6S A;  3OIP A;  3DEO A;  1U4P A;  4KJN A;  3GD7 A;  3X3N A;  1TQO A;  1T5E A;  3J81 L;  1C48 A;  1JC7 A;  1YNJ D;  2QF7 A;  1ESF A;  2OT2 A;  1I3Q B;  2EPB A;  3Q22 A;  3Q24 A;  1STG A;  4IN3 A;  4DF7 A;  3QIA A;  1CTM A;  2F0U A;  5KGU A;  3MAQ A;  3ZYY X;  5FLX L;  4K5V A;  5CGK A;  2A69 D;  4K14 A;  4GZY C;  3P20 A;  4OIK A;  1WTV A;  1E2V A;  4ID6 A;  3DWA A;  1CA5 A;  2EVB A;  1O7Y A;  4XXE A;  4PMC A;  5G3L F;  3VR5 A;  1EQT A;  2WII B;  2F0V A;  1H9J A;  3TP8 A;  1JE4 A;  1V1P A;  3SHL A;  2IT1 A;  5FO7 B;  4TKO B;  1S4Z A;  2OEO A;  5IT9 L;  2VB2 X;  4K6L A;  4C1N I;  4G7H C;  5JEA J;  4M1U B;  3WDN A;  3OIQ A;  3NWT A;  2B2U C;  3Q23 A;  4K2K A;  4BY1 B;  5EPJ A;  2L1B A;  3M4O B;  4ZUJ A;  1B2T A;  3GTP B;  4X3U A;  2IW3 A;  5M3M B;  2MP1 A;  4OGQ C;  3TN2 A;  3U9S A;  2N55 A;  2NB0 A;  4XT3 B;  2PZW A;  4IUQ A;  4KD3 A;  1TWA B;  2LY7 A;  4A3B B;  2NVT B;  2BE5 D;  3URY A;  1W6K A;  3DM1 A;  1E2W A;  4IUV A;  5IOC A;  3BYY B;  1ENA A;  2EYP A;  3EVQ A;  4ZLT F;  2E2J B;  3CKI B;  4FO2 A;  5KEE A;  1V8Q A;  2BCO A;  4ABN A;  3GV3 A;  4CJ0 B;  1ILQ A;  5J22 A;  3HS0 C;  1TS5 A;  3C1F A;  3KLR A;  1STY A;  3MXG A;  1LTG D;  2CHB D;  2TSS A;  1DD2 A;  2IL8 A;  3A8I E;  3TSS A;  4RWS C;  1PYW D;  5EKL A;  1I4G A;  1JOR A;  3MC0 B;  1B3A A;  4O1N A;  1S5B D;  3D4R A;  2NUC A;  3BS1 A;  2F0S A;  2RDF A;  1A3T A;  1HQM C;  3A8J E;  3L9A X;  1OXU A;  4DA2 A;  1X32 A;  2HDL A;  1DCZ A;  1AW7 A;  2WKC A;  4ZK9 B;  1D6E C;  2I07 B;  3VYT A;  1ZXT A;  3M4Y A;  3RMH A;  5KIX A;  1Z6H A;  3FEW X;  2B2T C;  5E1F A;  1KTK A;  3MWY W;  4XQJ A;  3D4W A;  4WJW A;  2H4O A;  3T51 B;  2KUM A;  5EKI A;  4Q0F A;  4KY7 A;  5IGG A;  1RKN A;  5ELD A;  1II3 A;  1CQF A;  1EIH A;  4QUC A;  2HQE A;  3DMU A;  2EJM A;  1Z47 A;  5JPM C;  4R8N A;  1RD9 D;  1VF5 C;  4PMB A;  4KJO A;  1J8I A;  4RGT A;  4IFD H;  4K8J A;  2IX1 A;  2DNE A;  3RUZ A;  1FR3 A;  2BA0 A;  1GJX A;  4DK1 A;  1D5Z C;  2AQ2 B;  1I6V C;  1SBB B;  3MXP A;  5CV6 A;  2KED A;  1PTO C;  2XN9 C;  1CK1 A;  3SEB A;  1F9Q A;  5I9O A;  2IX3 A;  1BCP D;  1VMP A;  3TP7 A;  1G2T A;  3S1M B;  5CV5 A;  4CGY B;  5M5W B;  1BOS A;  2QCP X;  3N6R A;  2K03 A;  2QIL A;  1NR4 A;  2E2D C;  4ZAI A;  3NBI A;  3NPP A;  1SYF A;  3R8B A;  1Z7T A;  4CBV A;  1Q12 A;  1JQY D;  2JEA I;  3MZ5 A;  1EY7 A;  4QF4 A;  5LHY 1;  2LMC B;  5CV9 A;  3TP6 A;  2B63 B;  1DON A;  4FNF A;  1HXY D;  1XWE A;  3W2D A;  2MJ8 A;  1TS4 A;  3WOF A;  2A68 D;  1F9R A;  5C4H A;  4BA1 I;  1TR5 A;  1LTB D;  2TMP A;  4UAI A;  3A8K E;  5C0X G;  2XNA C;  4K6D A;  4F87 A;  1I4X A;  1HHV A;  5IGB A;  2D2C C;  5CV8 A;  1I4R A;  1GHJ A;  4KHV A;  3BG3 A;  3HZX A;  3FDT A;  3MEH A;  3OWF A;  5IGE A;  3M3Y B;  4MN3 A;  2XIW A;  2NVX B;  2NWG A;  3R2T A;  2K1B A;  5CMD A;  4IZ8 A;  3FPP A;  2CVR A;  2ICI A;  2CQA A;  2B2W C;  1ENF A;  4G4K A;  5K36 G;  3GV6 A;  2NN6 G;  1ZYR D;  1RDP D;  3V2T A;  2A6H C;  2PPB C;  1H9K A;  1I6H B;  3SK6 A;  1PXU A;  1OO9 B;  2V4D A;  1EY4 A;  1NR2 A;  4EVO A;  4ME5 A;  2PO4 A;  4OO1 G;  1SND A;  2PMZ B;  1PZK D;  3CQZ B;  3HRZ C;  1SNO A;  1QG7 A;  1PRT F;  2QDB A;  5A2Q E;  1PTO B;  1SYC A;  2I46 A;  5CBA E;  2D5D A;  4HR7 B;  3TDQ A;  1Q1B A;  2ZXO A;  4IUN A;  2PW5 A;  1FD7 D;  1PTO H;  3AU7 A;  4RHS A;  1U4M A;  1HTL D;  2IWH A;  3GTQ B;  4N9T A;  1LT6 D;  1H9R A;  4CHT B;  2R93 B;  4NP5 A;  1WD0 A;  5ELF A;  4MHE A;  2E75 C;  3FVQ A;  1WVL A;  1SFO B;  4HN7 A;  3EQL C;  3RD4 A;  3VYS A;  3S14 B;  2Q8R E;  2PQE A;  4PNY A;  1JCK B;  1EL0 A;  3C2P A;  1SSO A;  1DJR D;  2LFN A;  1PFN A;  5KYL A;  1HUM A;  4EQO A;  1EZ6 A;  3NTK A;  4IUP A;  3I4L A;  1DM0 B;  4V0B A;  4QB4 A;  4B9W A;  1NSN S;  1TWF B;  1OXV A;  5JPN C;  1PRT D;  2R6G A;  4IAL A;  2A6E D;  5CR3 A;  4S3S A;  3W3A A;  2B39 A;  2VUM B;  5HGT A;  3SVM A;  2ZXR A;  3V05 A;  4XQQ A;  4DK0 A;  2K01 A;  2SNS A;  5K5P A;  5EQ0 A;  3OPO A;  5FOB B;  3H91 A;  4CJ1 B;  4RKL A;  2PZU A;  4E6I A;  5E3F A;  2R3Z A;  2KQ3 A;  1K83 B;  3L3O C;  2LKV A;  4K5W A;  2YYZ A;  2F0O A;  1EWH A;  4G57 A;  2RSO A;  2F0T A;  4TQU S;  2F0P A;  1TT2 A;  4H7B A;  1EY6 A;  1K8M A;  2Z4H A;  2M2L A;  4FF2 A;  4V19 0;  2F0J A;  2B8G A;  4PQX A;  3D6W A;  3H3V C;  3S16 B;  2WIN B;  4J1M A;  4HCS A;  1BF4 A;  3H6M A;  1B53 A;  5LL6 X;  1A3V A;  1TS2 A;  3SE0 A;  4WOR A;  3SK8 A;  5EPL A;  3S1R B;  3VA7 A;  1GUT A;  5J39 A;  3NSW A;  5EJW A;  3WOE A;  1STN A;  4H0L C;  3BVZ A;  2B2Y C;  2M00 A;  3VYU A;  1A2U A;  2EYF A;  1SE2 A;  3HG9 A;  4KTA A;  3FPU B;  3K0Y A;  1C8C A;  2DNC A;  1M8A A;  4OIJ A;  3VR6 A;  1SJE D;  5BN5 A;  1IYV A;  3D6C A;  4F7X A;  3A54 A;  5HUR A;  5ELC A;  3BVG A;  4KHZ A;  4X3K A;  1A2T A;  5LL6 S;  2JA6 B;  4BBR B;  4ILW A;  4XDX A;  1QWY A;  1RHP A;  3I4N B;  5KNC A;  4HMJ A;  3D31 A;  4IFD I;  1TWC B;  1TVX A;  1LT4 D;  4IFD J;  1Y1V B;  4RGN A;  3ND9 A;  1CA6 A;  2OXP A;  2XVS A;  5ELE A;  2O5J C;  4C3H G;  1BR9 A;  2HDM A;  4DFA A;  3ONA B;  1LTI D;  1IKL A;  1LAB A;  2AWN A;  2SOB A;  2XSC A;  4XIG S;  1U4L A;  3GO5 A;  4R9W A;  2R92 B;  1PLF A;  4XYO A;  3F2U A;  2Z1C A;  4TRD A;  3DHQ A;  1Y8O B;  1D2B A;  1SMY C;  1U9R A;  1LTR D;  4H13 C;  4FF4 A;  5EBD A;  1IL8 A;  4OO1 H;  1SJH D;  1PZI D;  1WTO A;  3PUY A;  1KAB A;  5D65 A;  3PMF A;  5A2Q L;  3K6O A;  3IAY A;  1EFI D;  1SYE A;  4M8A A;  1WTX A;  4HTH A;  1S5F D;  2SDF A;  1IKM A;  1BBX C;  1Y1W B;  3HOY B;  2B2U A;  3Q0A A;  2AUK A;  1QOH A;  3PUV A;  1TWH B;  2B2V C;  2RDG A;  3NBH A;  1ET9 A;  2F4I A;  1LT5 D;  2VNU D;  1E2Z A;  1PFM A;  4KI0 A;  1KDC A;  1CI3 M;  4WRD A;  3OW7 A;  4HSV A;  1NAP A;  1K8O A;  3GTM B;  2B2V A;  1BNZ A;  4H44 C;  1PFB A;  5A35 A;  3S2H B;  2KA7 A;  1V43 A;  1B4O A;  4RGO S;  4J8Q A;  2YU9 B;  4DXG A;  4I7Z C;  1PDQ A;  1STH A;  3NQT A;  2JP1 A;  1FYC A;  4A3D B;  4FP5 D;  2IJ0 A;  3QOL A;  2KEE A;  2F0I A;  4FYD A;  1CT1 D;  1F2Y A;  4FXD A;  1B9M A;  4B08 A;  2F0F A;  1HFG A;  1EEF D;  1DZ1 A;  1R4P B;  3S2D B;  3NP8 A;  3MVV A;  3JAM E;  1BCP F;  5IGD A;  1QJO A;  1Q90 A;  1QNK A;  1FNU A;  3MHB A;  3SXH A;  4HMI A;  2Z4I A;  1WTR A;  1F2L A;  4DXF A;  1SNM A;  2B2T A;  4ZYS A;  5EBC A;  4P2C B;  1B50 A;  1EOT A;  5C3X A;  2X6G A;  2MPM A;  1JB3 A;  4A93 B;  3NE5 B;  4X3S A;  3J80 L;  3FRP B;  5C5L A;  2CW0 D;  1I4H A;  1EEI D;  1A3U A;  3IL8 A;  4IUR A;  4FF3 A;  3G6J B;  5NUC A;  3SDZ A;  2NZ1 D;  2X6L A;  1IW7 D;  5I2Y A;  2G9H D;  1TU2 B;  4QUF A;  4HAE A;  2NTT A;  1OXT A;  5CYU A;  2F0M A;  4ULL A;  1R9T B;  1QIL A;  4RGM A;  5EGT A;  1CFM A;  2AUJ D;  2VB3 X;  1I4Q A;  5BN3 A;  4DGZ A;  1JWU D;  1T5X D;  5JVH 3;  1D5X C;  1MI2 A;  1QE6 A;  2K05 A;  1EY0 A;  4ODG A;  1Y8P B;  2FHT A;  3HOZ B;  1CHQ D;  4A3G B;  1EU4 A;  1ICW A;  5BN4 A;  1B1Z A;  2FMM A;  4FXK C;  3AMU A;  2QEJ C;  2NVQ B;  1KDA A;  1PZJ D;  3G7L A;  3MA2 B;  4C3I G;  4BS9 A;  1Q3L A;  2RBM A;  3K5N A;  4FVM A;  5J1Z A;  5I2X A;  2PCF B;  1ML0 D;  3KUP A;  1B44 D;  5FK9 C;  4O42 A;  1EQV A;  4FXG C;  1EYA A;  1CZW A;  1JIC A;  3MFY A;  3D8G A;  4XYQ A;  2K6A A;  4DAY A;  3ITP A;  2ICE C;  4EGV A;  2RVL A;  1KNA A;  2HUG A;  1HA5 A;  1SYB A;  3M7G A;  1MGS A;  4KD4 A;  4KKT A;  3D3R A;  3PUX A;  3P1H A;  1DOM A;  2O4X A;  3RZD B;  1L0X B;  1UUP A;  4C3J G;  1V1O A;  4C56 C;  2NTS A;  2MGS A;  3C46 A;  2JE6 I;  3P7J A;  3T53 B;  2A74 C;  2B2W A;  1AZP A;  4K5X A;  3SR1 A;  2WP8 J;  2DN8 A;  3T13 A;  1MD2 D;  5AFW A;  1STE A;  1E0B A;  1DXM A;  4A3I B;  1MSH A;  1ROD A;  5DM6 3;  1W6J A;  2AQ1 B;  1CHP D;  2L12 A;  1HQR D;  2K28 A;  2EOT A;  2IPK D;  1X3Q A;  4BBS B;  3HOW B;  5JJZ A;  4DNT B;  4CKE A;  4XT1 B;  3J7Y W;  2F0E A;  3DWP A;  2R61 A;  3M85 A;  2OF1 A;  1IYU A;  2NN6 I;  1EYD A;  1OXS C;  3LNN A;  5M5Y B;  2C9O A;  1WD1 A;  1KNE A;  2KCN A;  2EYM A;  5I6Y A;  3E0J A;  1XX8 A;  2K5Q A;  2H1E A;  5JAV A;  1LT3 D;  4OO1 I;  1NCV A;  1BCP C;  5T1G A;  3KBX A;  1AN8 A;  3GTJ B;  3DEP A;  4TSS A;  2XRS D;  1ESR A;  3NWS A;  5EKK A;  3O13 A;  3A7A B;  1STA A;  3V96 A;  1LTA D;  3JAM L;  3M7N A;  2JSO A;  4LJZ C;  4Q5V A;  1G2S A;  4EQN A;  3SK5 A;  2RKS A;  1TII D;  2PW7 A;  2FFK B;  2JYO A;  3NXW A;  5COY A;  2A68 C;  3DXJ C;  1WTW A;  3T56 B;  2EJF C;  1NUC A;  3NUC A;  1EIG A;  4L8J A;  2PYK A;  4IQZ A;  4LAA A;  3C1E A;  2KHS A;  1DOK A;  5CBE E;  1MBY A;  1TY0 A;  3DWQ A;  1KAA A;  2M9V A;  3BDC A;  1UAP A;  2F3W A;  4A3F B;  5IGF A;  2EY2 A;  4QCL A;  1BUV T;  2KJX A;  5T1I A;  1EYC A;  1X3P A;  5C44 B;  5ISR A;  1L0Y B;  5ELB A;  1SXT A;  2K04 A;  4RFB A;  1ONL A;  2K33 A;  5IIF A;  3OOC A;  2Y0S B;  3IFT A;  3QO2 A;  4WFN 3;  1JOO A;  2AWO A;  4HED A;  1BDO A;  3K59 A;  4X3T A;  1TY2 A;  3UI2 A;  2JEB I;  1VMC A;  4KKS A;  4DN4 M;  5EPK A;  2L0C A;  3FMC A;  4RKB A;  2EY1 A;  2L4N A;  4U68 A;  3J80 E;  5DAU A;  2F0K A;  2F0H A;  1JWS D;  1A15 A;  3MTS A;  2E2H B;  1SE3 A;  1SYD A;  3KLS A;  2KVM A;  2NVY B;  4BA2 I;  1LO5 D;  1AEX A;  3HOX B;  1QB5 D;  1H9S B;  1SAP A;  5CC4 A;  4ZKB B;  3OWE B;  2NYZ D;  3X3M A;  4CKB A;  2B2Y A;  2L11 A;  5COR A;  4PMW A;  4NW2 A;  1I4P A;  1U4R A;  1BCP B;  2D62 A;  1JOQ A;  4ZRZ A;  2EJG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...