1QOHA

A mutant shiga-like toxin iie
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
ADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTIISNTCSSGSGFAEVQFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SHIGA-LIKE TOXIN IIE B SUBUNIT
publication title A Mutant Shiga-Like Toxin Iie Bound to its Receptor Gb(3): Structure of a Group II Shiga-Like Toxin with Altered Binding Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 20
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qohA00
2GA4B 1CZWA 1BOSA 1R4QB 1D1IA 1R4PB 1DM0B 1CQFA 4M1UB 1QNUA 1C4QA 1QOHA 4ULLA 4P2CB 2XSCA 2BOSA 1CZGA 3MXGA 1C48A 1D1KA 2C5CA
chains in the Genus database with same CATH superfamily
3HOUG 2EYMA 4C3IG 4ZUIA 4LAAA 3M7NA 3J81E 5ELBA 1YHBA 4IOAA 2Y0SB 2AWOA 3W5OA 5IYCG 1K8AC 1TWHH 1FL0A 2K1BA 1PV4A 3J80E 3BVZA 3GTLB 2UUBQ 1EQRA 2OF1A 3S15B 4HEDA 4ABNA 2JN4A 3J80c 4LF9L 2KECA 3K81C 1JE4A 3KLRA 5HURA 3Q6SA 4JI2L 1TY2A 5M5XB 2K14A 4FVMA 4R1JA 2JA6G 2ZJPA 1PH3A 1EY6A 1HTPA 4AIMA 3GTJB 4A93G 1HPCA 3GTOH 3OYYA 4N9PA 3I72A 4GN4B 4RGTA 4CDDC 4DK6C 1ESFA 4G7HC 2B2YC 3W2DA 1SE2A 3K59A 2BE5C 3BDOA 2ZXPA 4NMZA 4DXFA 3PUVA 4LFCQ 2CFMA 1IBML 4OO1G 4G57A 3I4NB 4A3EH 4UP9A 3HOZB 2BH2A 1T5EA 2I46A 2VXWA 2K32A 1XMOQ 3CCQA 4JYAQ 5AFWA 2EVBA 5CV5A 3IL8A 1HR0W 3TREA 5JJLA 3M4YA 2JQOA 1M4VA 2ICIA 4DV5Q 1M1KC 3FEWX 3A8KE 4A3IG 1QUQB 5L37A 2EE1A 5G3LD 3V05A 5C4XG 5KNCA 3SVMA 1HNZL 5ELOA 5D65A 5FO9B 1FJGL 3C46A 2J4XA 1SMYD 1STYA 3HRZC 1AH9A 3PO3H 1E1OA 3ER0A 4OWXB 4B08A 1ONLA 3S17H 2EYPA 3GTKB 4QJFA 3SXHA 3FKIH 1PTOB 1EFID 3G4SA 5HY6A 4XQQA 3GDEA 4JI4L 4RH6A 1RTNA 4XT3B 2RVLA 1PYSB 4KV6A 4L8JA 4DNTB 1NCVA 4YHHL 3PO2B 2Z6KC 2F0JA 2BH8A 5C0XJ 4ODGA 1B7YB 4GLAC 1KL9A 1PH4A 4OL7A 1JMCA 3MTSA 5BR8L 3HOVB 3D4DA 4B3SQ 4DR2Q 1WTXA 1Y8PB 2AMCB 3NK9A 2XWBB 3D6WA 2IX1A 4DR3Q 3I4OA 1RJTA 1JE5A 1HRJA 2DY8A 3GTPH 5E7NA 5LMNL 2PW5A 4NXMQ 1TKWB 3Q22A 5IY0A 4ALPA 3L3OC 4G7ZC 1XX8A 5EBDA 1LYLA 3FDTA 2ZM6L 4NB3A 1PYWD 3SGIA 3WOEA 3I55A 3NSWA 4GN5A 1OXVA 2Q2UA 1SYBA 3QOJA 1G2SA 5EKKA 2VY3A 4DXGA 1LTRD 3C2PA 1YBYA 3J7A5 2FMCA 1KLGD 1HJPA 3J80L 4CGYB 5IGGA 2UXCQ 4S3SA 4DV0L 4NW2A 4DAMA 3RZOB 2CHBD 1S3OA 4JBMA 2F0HA 5JVH3 5KYIA 4L63B 1VQ6A 4DUZL 4HSVA 1TVXA 2A73B 5JOBA 1Y1VB 1L1OC 1U9RA 1G291 1HZ9A 2QA4A 3CPFA 1GUOA 4A3KH 4OWWB 2NVYH 3PUZA 2HCCA 3MFYA 5C5LA 1BF4A 4CJ2C 3HOWH 5KEEA 1IZ6A 2CH4W 1Q1EA 2SNSA 4OEMB 3VR4A 2F4VQ 4LFAQ 2L9HA 2RHQB 5IE8A 1WTPA 1EU4A 4X66Q 4JV5L 2VB2X 2F1MA 1QG7A 3RR5A 2M00A 4QGUA 1BCPB 3VA5A 1PZID 3I4MB 3DEOA 2E8GA 4LUVA 1SFOH 3A5UA 4IJHA 1DONA 2OTJA 3K8AA 2Q2IA 4A3LH 4HJAA 2Z9HA 2K75A 1CA6A 1E22A 3EA6A 1MJEA 3KDFB 3S14B 1VMCA 2JA5H 5IGBA 1EEFD 1A0IA 1E24A 3P75A 1V1PB 4TRDA 4RHRA 2JSOA 4AH6A 3E0EA 5C44H 4JI6Q 1G2TA 2UXDL 4ZK9B 4H44C 4QIWB 1SE4A 1JR0D 4RCOA 3NELA 4GNXB 2K5NA 3E5SA 4MZ9A 2CW0C 1DJRD 4DV4L 1JC7A 4OIKA 4ZUJA 1WJJA 2F03A 1KDBA 4ME5A 5ELNA 1JORA 3PUWA 1Q3LA 2AHOB 1SYDA 5EBCA 5IWAQ 1EZ6A 5IYBG 2C35B 4X62L 1EQQA 5AJ3Q 4BY1B 1R9TB 4LF8Q 1ZKOA 3U4VA 1KRTA 1G6PA 4A3MG 1QUQA 1SNOA 4KD3A 1STAA 4IFDI 1CQVA 1WTHA 4APVA 4RHSA 3GTLH 3K5NA 4ZKBB 4DAYB 3M4OH 1S72A 1B53A 1Q8IA 4ULLA 3J7YW 2MUYA 4MTKA 1EWHA 3QWNA 1B1ZA 5CBAE 3CU7A 3OW7A 5JJKA 3JAMc 2AUKA 1RF2D 5M5XH 4IUTA 5JVG3 1QB5D 3V96A 4PV1C 2EYFA 1BBUA 4A3FB 5M3FB 4OWTB 3OOCA 4KN4C 5FLXE 4Y52H 2WFWA 1EQTA 4DV2L 4TVAB 3T1YL 3K5OA 1K0RA 1K0SA 4QL5A 4V190 1YZ6A 5TSSA 4FP5D 3MXUA 4KMUC 5IYDG 1GUWA 3HGBA 1CM9A 2B39A 1VQDA 4UAIA 3I4NH 1JT8A 3HOZH 1O7YA 1CKOA 5IP9G 4R4IA 2F0PA 3BZDB 2E2JH 2I07B 3C3LA 4GKKQ 4YWKA 4UP8A 2IJ0A 2PQAB 4DAVA 3KFUA 1STNA 2KHJA 2Z0SA 1DYQA 1KQSA 2D5DA 1FVIA 4DU9A 4GKJL 2JJQA 2EPBA 4J1MA 1N34L 4KD4A 4YY3L 1M90C 1VQCA 2PI2A 3R2IA 1I4RA 4A4IA 1Q12A 3KJOA 2UU9Q 4POFA 4LF7Q 5E3FA 4LJZC 3ULJA 3A74A 1PXUA 2R7DA 1F2ZA 2N55A 2I5LX 3NE5B 4YIJA 2H4OA 3NPPA 2IHFA 4AQYL 3GTKH 4DV6L 1PTOH 1UEAB 2KHSA 4EQNA 4A3EG 3I8ZA 4K5XA 2FJ2A 4RGOS 3OTOQ 1KTKA 3HFZB 3PO2H 2XIWA 3A56A 5JEAJ 4G4KA 3KBGA 3GTMB 1SMYC 1EL0A 4H02A 1EYGA 3CAMA 3HOVH 1J6QA 1U4LA 4DR1Q 1LT4D 1C7YA 2NVXB 3A7LA 1G51A 4J6HA 1BKBA 4DNRB 1Y1WG 4A3BG 1LT6D 4A3DG 3L9AX 4C3HG 4DUYQ 1EY9A 4ZLTF 3H6MA 1YNJD 2BCOA 3VYSA 3D6CA 5CR3A 2G5DA 3CQZB 4LF4L 2YTVA 3AU7A 4OXPA 3KUPA 4Q5VA 1U4RA 4A3DB 2Z8LA 3SK8A 1D1IA 3VYUA 1D5MC 1QE6A 3KDFA 4K2LA 3JAMi 4JI7L 1HNWL 2DUDA 1PH7A 2UUCQ 2B2UA 2N88A 3E6ZX 1BUVT 1GM5A 1V1PA 2HIXA 4BA2I 4Y7NB 1VQIA 2KCCA 2X69A 1E7ZA 3A5ZB 1F2YA 3DMUA 4KHPQ 2YU9B 2EJFC 4ZRZA 1PVOA 1A8VA 1A3UA 1AW7A 2GVBA 5C0XG 1OO9B 2A19A 2J0TD 1X65A 4OX9L 3M3YB 2UUAQ 4BBRB 4GNXA 1K3RA 3IKJA 5COYA 3N6RA 2KCTA 2XWJB 4DK0A 4G7OC 3S2DH 1EYCA 3FHWA 4K0KQ 4DV1Q 5M5YH 3ITPA 2D2CC 3DLLA 1Y1VH 3K5MA 3NTKA 1GD7A 2RDHA 2FMMA 2HQLA 2VUMG 1IBLL 1L0YB 2PNRC 4XXEA 2CQAA 1MJCA 2AQ3B 1SR3A 5EJWA 1GVPA 1A15A 3CC2A 4LF6L 3CF5A 3HOYG 1CQFA 1Y69U 4L5TA 2LXJA 3EROA 3BDCA 1HR0Q 3I4MH 1QOHA 4DAYA 2G9HD 1SNPA 1F9RA 3K58A 2R92G 4L5SA 1DD2A 1PFMA 1GKHA 2NN6I 1SLJA 2WAQG 3S14H 4P75A 4C3JB 1EYDA 2DY7A 3A7AB 2K04A 1HNXQ 2QCPX 3GO5A 3SK4A 4BY7B 3LWEA 4A3KG 1SYGA 4C2MH 1BO0A 4KJOA 5M5WB 1WI5A 2LSSA 3K7AB 1TWCB 2LKVA 3LX0A 3OSOA 1BNZA 2R93B 5KNBA 3KK7A 3MHBA 5GQOA 1I6VC 2ZTCA 4RWSC 1EOTA 3KBXA 4CKCA 2UUBL 1I6HH 2PCFB 1XJVA 5GAEC 4CHTB 4FXDA 4QCLA 4B3TQ 1PRTD 1YJ9A 3E0JA 1SN8A 4KK7A 5CV4A 2JA8H 1DCZA 4IURA 1GJXA 1PRTB 4RG1A 2B63B 2PQAA 4A3LG 4HIOA 1CUKA 1F2LA 1N33Q 3NWTA 3DXJC 4BY1H 1BR9A 1M8AA 1UE7A 1H95A 1JB7A 5IT9E 1XMQL 3UDIA 2AQ2B 2JA7G 1ASYA 4PMCA 1SBBB 5K36H 3NP8A 1L0WA 1SSOA 3GTGH 4CDCC 4LFCL 2Q8IB 1TWGB 2E5LQ 2EY2A 1X3QA 5M9OA 4A3GG 1B9MA 4JYAL 2PYKA 2Z4IA 1EEID 3HOXG 1UE6A 3EN2A 5D14A 3CCEA 2ICEC 5G3LF 1CFMA 3E3XA 3TMEA 3UDXA 3I3CA 2QEXA 2EYLA 3ERSX 4K6LA 1SMXA 2F4IA 3TP8A 3CCJA 2QDLA 5FJ8G 4DV5L 4KLKA 4I7AA 2IWHA 3VA7A 1DXMA 4A3FH 2K7VA 3HEJA 4L5RC 3IFTA 5FK9C 3U4ZA 5ELEA 1YIJA 3IFDA 3IAYA 3BZCA 1JOQA 2JEBI 4JI5L 5IGEA 3H3VC 2K4KA 1PA6A 1B50A 2L1BA 3A54A 2PZWA 2XRQD 5C6AA 1EFWA 3HOUB 4C3IB 3J81c 4X3UA 4ZCKA 1FYCA 4IUNA 4KN7C 4O0AA 4F88A 1I3QB 4R4OA 4P74A 1SXTA 5A2QL 4DR6Q 4IUVA 1E0BA 4DR5L 4M8AA 3OMCA 1JWSD 4KY6A 3W1GA 1Q86C 3TZUA 1ENAA 3W1BA 1EY4A 4IJLA 2B2TA 2IL8A 5JAVA 1ZXTA 1HFGA 1NUCA 3VYRA 1XNRL 2R61A 4B3SL 1GOZA 2JE6I 3SR1A 4DR2L 3FMCA 1OXSC 1RCVD 2CQOA 2B2VA 2JA6B 4DR3L 2ZXRA 4A93B 2PQEA 2O4XA 1E1TA 1HTLD 4NXML 1UUPA 2QGQA 4JOIA 2A68D 3H94A 5M3MH 3KF6B 1I94L 2QW7A 4A3CG 2MFIA 2B2WC 1IL8A 3CCSA 2BDNA 1AE3A 1QCBD 4F8MA 4QY7A 1N9WA 1PLFA 2NVXH 4XIGS 1N8RC 5E4XA 2UXCL 5GAHC 3EBEA 4HSPA 3PIPA 1PTOD 1ML0D 2WACA 4A3IB 1J5EQ 3AEVA 1JJGA 1VS0A 4IPGA 1N36Q 5C4XB 1GHKA 5C4JB 2NN6H 3T1HQ 5DM63 3CQZH 3O13A 1K9MC 2O5JC 4FF2A 5I6YA 3MFGA 3NUCA 4JCVE 4BA1I 3RLOA 3H09A 3P20A 1EIGA 2Q2HA 1K73C 1PYBA 4HN7A 1B4OA 3GTQB 4IQZA 2VW9A 1KD1C 3KLSA 3RLFA 4FXGC 3L7ZC 4JVZA 4Y7NH 2N78A 3MA2B 5IT9L 1RD9D 1K28A 1HZBA 1I50B 2YU9H 4LF9Q 2F4VL 4JI1Q 4LFAL 1V9PA 2WB1G 3DUZA 2B2TC 2LMCB 1YNJC 4X66L 5J22A 4WFN3 5JEAG 3EVQA 3RZDB 4BBSG 1K83B 3FPPA 4BBRH 1VQMA 2L15A 2WKDA 2RBMA 1IHZA 3J81i 5ELFA 1WFQA 3A55A 1K8OA 2MPMA 2UXBQ 5IP7H 2R7ZH 3HS0C 1F77A 4A3JG 1CK1A 1VQHA 3J80i 4K6DA 4OO1I 1GO3E 1EY0A 1W2BA 1A62A 3J81L 5C3EG 2BA1A 4R4CA 3Q23A 4JI6L 3D31A 1B3QA 1KABA 1YHQA 3W3AA 4JOIC 3NTHA 4JC0A 5NUCA 4NPSA 1LM0A 4DN4M 3OWEB 5IGDA 3J7AV 2E2IB 1U4PA 3GV6A 3KF8B 5C3EB 4HAEA 1ZYRD 1Y8OB 5E1FA 1O78A 2L4NA 4H13C 1SNQA 5JPNC 4GZYC 1FNWA 2F0KA 4JPBW 4PZ6A 4F87A 4C3JH 5IWAL 2WAQE 3GD7A 3BZKA 4HMIA 5AJ3L 5KIXA 3MZ5A 4LF8L 4BY7H 2I0QA 3H0GG 5M5WH 4K14A 3K7AH 1TWCH 4KKUA 1BCPD 2F0VA 3SEBA 3RLNA 3J7AF 3DWQA 1VQ7A 2PO4A 3PIP3 3A8JE 4YHHQ 1YHAA 2XVSA 3HZXA 1XTDA 3T13A 2HT1A 4DR7Q 4IN3A 1BXTA 1RTOA 4PZ8A 2B63H 3NQIA 5LMUQ 2K6AA 1Z9FA 3S24A 1HHVA 4UHVA 2MNAA 3EJIA 5HGTA 1NMGA 3QB3A 2EJGC 2K03A 1MBYA 4M1UB 1KXLA 1QVFA 1P8LA 1V1OA 1LO5D 2NWGA 4QUFA 4WJ4A 1IYJB 3LGJA 4ZQ3A 2OEOA 3EIVA 1PRTC 1X56A 3K0XA 2XTIA 2F3WA 3JC66 3PF5A 1TWGH 4BS9A 3A8IE 1X9NA 4MN3A 2RA4A 1C0AA 1TWAH 4KKSA 4EQ5A 5I4DA 4GKKL 4PG3A 3F2DA 1VQ5A 1O7IA 2VL6A 4DV7Q 2P5ZX 4KHVA 3MC0B 5F2DA 2JA8G 4H0LC 3R2TA 4MHEA 3M7GA 1KRSA 4UP7A 2OQ0A 3KF6A 1GUSA 1KC8C 3SE0A 5FOBB 1CKMA 4ME3A 1YITA 2SDFA 2QF7A 4HJ9A 2EOTA 2F0IA 3G7LA 3CC7A 4LF7L 4AYBG 3RNUA 5CV8A 4OGQC 5I2XA 1SNDA 1MKHA 1CA5A 3GQBA 1FNVA 2ZJQA 2BDOA 2E2HB 5J39A 3HOUH 5CV9A 2KENA 2K50A 1RDPD 1H9MA 1NJIC 3S15H 1NY4A 1WCMG 5C4HA 1I3QH 5DLQE 5IYCH 4A3MB 1LTTD 4B3MQ 1B8AA 1LT5D 3CPWA 3OTOL 1AZPA 1NSNS 2TSSA 5EAYA 3J81j 4LK1C 1VQPA 5BN4A 2H5XA 2RSOA 4K8IA 3GTJH 2LS01 1TY0A 5BN3A 3G71A 3T4AC 2A6ED 4PQXA 4DR4Q 4CDFC 4DR1L 1IKMA 1F9SA 4NXNQ 3OW2A 3BJUA 4DV3L 2CH4A 3AQQA 1KNAA 2IX0A 3S16B 2HD3A 3M4QA 4DUYL 4P72A 2KVMA 5FLXc 1QILA 3OHXC 3NEMA 3ULPA 3CXCA 1RIPA 3NENA 4JBWA 4C56C 4O2DA 2A6HD 2QILA 1WTRA 2HQEA 1KNEA 4X3KA 1TWHB 1WYDA 4GOPB 4OO1H 1V43A 3S1QB 1RKNA 4IUQA 2I5MX 4TQUS 1JB3A 5C3XA 2F0DA 3HKZG 4XQJA 3L2PA 1NTGA 2MJ8A 3RN2A 2A69D 2ZT9C 2D9UA 2PPBC 1VDZA 1D7QA 1C9OA 2MO0A 4MNOA 5J3BA 4QMGA 4DV4Q 1VQEA 1T5XD 3NBHB 1S5DD 4KHPL 2VNUD 3BVMA 3F2CA 5C4ZA 1VQNA 2RCFA 4JBKA 4A3IH 1B9NA 2F3VA 1VQOA 3CCUA 1Z47A 2UUAL 2A68C 5C4XH 4R8NA 2FXQA 4LNQA 1JOOA 4X62Q 3KF8A 3SDZA 5K5PA 4K0KL 4R4QA 1KLUD 3AMUA 4DV1L 1E2ZA 2VQFQ 1PZKD 2MO1A 1NR4A 1S5CD 4QUCA 3DWPA 4JBJA 2NVTB 3VDYA 1VCIA 4LFBQ 1UNSA 3K0YA 4A3EB 2MQHA 1H9RA 3VR6A 1PTOC 2N3SA 3U50C 5FO8B 4WJ3M 3HP3A 1I50H 2L11A 1ZEQX 4FO2A 1X6OA 4DNIA 1N32Q 3U9OA 3T16A 5CC4A 2ZJRA 2WB1E 2HHHL 4HIKA 3RZDH 1K83H 5LMNW 1HR0L 2KEDA 3PO3G 1EIFA 3OMGA 5EPLA 4DA2A 5HGQA 3I73A 3CP0A 3N52A 3FKIG 5JJIA 4B9WA 1Y1WB 4A3BB 4K5VA 3R93A 5GROA 5EQ0A 4C3HB 1HNXL 5CV6A 3S17B 2F0SA 2VZAA 5CV7A 4JI0Q 1VQLA 2F3IA 2ES2A 1FR3A 2DJFC 3C1EA 2GVAA 1JWUD 2I5HA 3F2UA 2PNHA 2O2LD 4RFBA 3RZOH 2Q8RE 2F0QA 5ISRA 2E2IH 1PH2A 5EKIA 4B3TL 1NNXA 2YYZA 1N34Q 4YY3Q 2E76C 3OIPA 1XYIA 4LMQD 4KY5A 5ELCA 4FYDA 5LL6X 4IFDJ 3UE1A 1EY7A 2MP1A 1N33L 3TEHB 1QNKA 3D0FA 5T1GA 5IP7G 2R7ZG 1S5ED 3MEFA 1XNQQ 3KYHC 5IGFA 1D1KA 1I4PA 3AFQA 1WD1A 2CKZB 2WKCA 3R3OA 1G8ZD 1SJED 4K2KA 5EGTA 4IFDH 1AE2A 5FLXL 1P16A 2Q8TA 4UDUC 1ZYRC 5FKAC 4YCWA 1PMRA 2F0WA 4YCVA 3S2HB 4JG2A 5CMDA 1VQGA 4O1NA 2E5LL 3LNNA 2VUMB 2EXDA 2KCMA 1SNCA 2OXPA 5I6WA 3RD4A 3OIQA 4IPCA 1X3EA 4X64Q 3NQTA 1JJ2A 1XPRA 3KLWA 2JP1A 3HOYB 2N49A 2E74C 1HCZA 3B6YA 3H91A 3F2BA 1L1OB 2AKWB 1BCPC 4JI8Q 2R92B 4PMBA 1AZQA 1CT1D 2NBFA 1TQOA 2EXZA 3MEHA 1U4MA 2L0CA 2WAQB 1KDCA 4LF4Q 3HOWG 1NAPA 1TS2A 1BDOA 1BBWA 2A1AA 1V1QA 3ND9A 1B3AA 4FF4A 1JWMD 2DNEA 2B2UC 4X3TA 3CCMA 4HIMA 3TS0A 1WTOA 3FPUB 5CYUA 2R3ZA 1DGSA 3ND8A 5DAUA 4A3KB 4DR6L 2NVYB 4N8FA 1WTQA 1JOKA 3QG1A 1ENFA 2R6GA 4RMFA 3VR3A 1E3PA 1K8MA 4R4TA 2EZVA 2EYOA 1MSHA 4GOPA 1EIHA 3NWSA 2Z6BA 5C0XI 1I4XA 1R9TH 4GNXC 1A2TA 4OONA 4IO9A 4A75A 2JA5G 5LHY1 2KA7A 1VQAA 3IRBA 1ILPA 1FGBD 3BYTB 1CKNB 4JI3Q 2HIVA 3S1NB 1CTMA 1B70B 4AYBE 5C44G 2B2YA 2E2HH 3AYHB 3NBHA 4EVOA 5IYBH 4HJ7A 1PDQA 1O7LA 1MD2D 5IT9c 4CKBA 3TRZA 2JA5B 1XMOL 1RL2A 3PF4A 1KAAA 3TP7A 4GS3A 2EYJA 3CCRA 2JA7B 1Q82C 1IXRA 3FVQA 1HA6A 3K7UC 4C1NI 2ZTDA 3R8BA 4OIJA 1YVCA 4LF6Q 5M3FH 4J15A 4A3GB 4LF5Q 1PTOF 1J9OA 3HOXB 1YNND 1SE8A 4FDBA 1QVCA 1S5FD 3TP5A 4CJ0B 1WTWA 2Y0SG 4FF3A 1W3SA 2QKIC 1PH9A 4R8IA 4KKTA 3CD6A 1EUJA 2L12A 1VMPA 1J5EL 2Z1CA 2WP8J 2YTXA 3G6EA 5DEHA 2DNCA 5CORA 1IBKQ 1N36L 3ZJYC 3A0JA 2NYZD 3LWUA 1K3BC 3T1HL 1LTLA 1WOCA 3PMFA 4HCSA 1XPUA 1CZWA 5IYDH 4N8X1 3S1QH 2A6EC 3CMAA 5IP9H 3FRPB 1NBWA 4X6AH 3HKZE 4KTAA 2Z6KA 3D3RA 1LTBD 1WTVA 3M4OB 1JQYD 1SEBD 1HQRD 5JPMC 1HZAA 4TKOB 1STBA 1PH6A 2IY5B 2MHVA 2CWAA 1AFPA 4JI1L 2ZTEA 4B3RQ 1GUTA 4XYOA 4GOPC 4E6IA 4K8JA 3CHBD 1VQBA 1ENCA 2A6HC 3UI2A 1E2WA 2N8NA 2VQEQ 3I4NG 3HOZG 1OXTA 4IUUA 2ID0A 1LUZA 2A69C 4EQPA 1HQMC 2UXBL 1JICA 1XMQQ 3I70A 1TS4A 1AP0A 4I65A 1KAWA 2HDLA 1W6JA 4QB4A 1QVGA 1CZGA 2OWOA 2NVTH 1E2VA 3D4RA 1VQKA 3GTMH 1A3VA 1PHJA 1EY5A 4MTNA 3CMEA 4RKLA 4ID6A 3U9SA 2NTTA 1UEBA 5DNFA 5C5MA 2E2JB 1OXUA 4ZAIA 1FD7D 2XN9C 3DHQA 2LY7A 1ET9A 3NTIA 3MWYW 1DOKA 4EQOA 4CDEC 3SK6A 2NVQB 4X65Q 2YV5A 1HUNA 1EWCA 2B8FA 1PFBA 3CCVA 3M4PA 4ZKCB 1KIXA 4DK3C 2CCZA 1DZ1A 1S5BD 3T56B 2ATWA 3P7JA 1GUGA 4F7XA 1Y14B 5KNDA 2JXMB 1Y1WH 4JI5Q 4A3BH 4A3DH 3HKSA 2NUCA 4C3HH 2D0PA 1BCPF 2F0EA 2K5WA 4C1NK 1XXGA 3PO2G 1STHA 1L1OA 2SEBD 1GXDC 2RHSB 1TWFB 1J8IA 4IZ8A 4YWMA 5EPKA 2F0OA 1CSQA 1F2MA 3E9IA 4DGZA 1PH5A 2VS1A 1B44D 3HOVG 4DR5Q 2NZ1D 2DN8A 1AEXA 3Q24A 1Q7YC 1HFNA 2KBNA 4JI2Q 3M3YH 1V8QA 1ICFB 1HZCA 4EX5A 1SYFA 3RN5A 4DR7L 4WJWA 2CWPA 2BA0A 4KI0A 1NR2A 5LMUL 2EY6A 2FFKB 2B2VC 2WB1B 1XNRQ 1VF7A 3OWFA 5KYLA 2EIFA 1Q8KA 5C0XH 3KJPA 3I7FA 4BBSB 1UAPA 4XDXA 3ICEA 1D6EC 3HG9A 1QZGA 1BVSA 4CJ1B 1IW7D 1IBMQ 4EGVA 5IGCA 3BVGA 1DOLA 2F0NA 2L55A 2LXKA 2B8GA 3DEPA 1CKNA 4DFAA 2PMZE 4QQBX 4A3JB 5T1IA 3S2HH 3ERQA 2KQ3A 4L5QA 2VUMH 1D8LA 1OXXK 2RSNA 3UDGA 1SYEA 1I94Q 3CW2C 3TS2A 2QDBA 4DV7L 1I4QA 1HXYD 1HNZQ 1UE1A 3HOYH 1FJGQ 2AUJD 1D5ZC 1SE3A 1Y8NB 4JW0A 3CKIB 4BXXH 5IIFA 2KHIA 2RDFA 1R4QB 1Y1VG 2R92H 3TP6A 4UY8C 3G48A 4XT1B 1YNXA 4DAPA 4JI4Q 4IFDG 1C4QA 1L0XB 4HTHA 3S2DB 2R93H 4DKAC 5KGUA 5J1ZA 4IPDA 2ENBA 4WORA 5M5YB 1B2TA 2XSCA 4L6TB 3Q8DA 1EWIA 3STBD 1MIUA 2C5CA 3TDQA 1QWYA 4B3ML 1CI3M 3PIOA 3KOJA 1IYUA 3H0GB 3I4MG 4LUOA 1IL2A 5LL6S 1A3TA 5CBEE 5BR8Q 5FLMH 2K52A 4K5WA 2L5TA 1X3GA 1I4GA 3WWVA 1FNUA 1TIID 2TMPA 1BQQT 1K8GA 2NTSA 1G6ZA 2EY1A 3K5LA 3CCLA 3OPOA 4YWLA 1X3FA 4DR4L 1LLRD 5LMNQ 1EIYB 4NDXA 1VQ8A 3S1NH 4NXNL 2PZTA 3MXNB 3PV0A 2ZM6Q 4IOCA 3PSIA 4V0BA 1MSGA 3T53B 4GN3B 1VQ9A 3CRLC 1ET6A 1TU2B 2A74C 5I2YA 4RGNA 2XGTA 2JA7H 3S1RB 1SJHD 3X3NA 1FGUA 3E9HA 5KRUA 1LT3D 4C2MB 3I56A 3CRKC 4FNFA 4LWCA 5E4WC 2K5HA 1TS5A 2JYOA 4X3SA 4A3GH 1SAPA 4Z9CB 4DV0Q 2JA9A 1D2BA 1LV9A 4B9XA 3HOXH 2RF4A 1I6HB 2FHTA 2UU9L 2KUMA 4BY1G 3EFXD 1I4HA 3ONAB 3Q0AA 2AQ1B 4CKEA 2Y0SE 4DUZQ 5FJ8H 2JA8B 3DWAA 2F0FA 4NKLA 4KHZA 4XTCS 1II3A 1H9KA 4C3IH 4U68A 5K36G 5CGKA 2SOBA 2YTYA 3MVVA 3BYYB 3K57A 4HIDA 5ELDA 2B3GA 2V1CC 2M2LA 1C48A 4AYBB 3S1MB 2K28A 1Q1BA 2C9OA 2VQFL 2HDMA 4XQNA 2O5IC 1Q46A 1YNNC 5EPJA 2XRSD 1HH2P 3URYA 1SRUA 3F8TA 3JAME 2LFNA 1U0LA 3I4LA 3GTGB 1WCMB 4JV5Q 3KLSX 4LFBL 1U5KA 1VQFA 1O7ZA 5GADC 4O42A 1RODA 4A3FG 5M3FG 1W6KA 3AB9A 2ALYB 1CHQD 2EDGA 5JJZA 3QR8A 1N32L 2JA6H 3VR5A 4A93H 1STEA 1CHPD 4P71A 3DM3A 4JK1C 4I7ZC 1S40A 1GUNA 1D5XC 2JK8A 2M9VA 2R7FA 1KHIA 4RA8A 3PIO3 1DOMA 3QJYA 2Q2TA 3PGZA 3RMHA 3BS1A 2UXDQ 4QF4A 4A76A 5IODA 3BG3A 1SROA 1X3PA 3UDFA 2UUCL 4RKBA 1TR5A 1O80A 4JI0L 4HR7B 1HA5A 2BE5D 2K05A 2CVRA 4OHJA 1H9SB 3ZYYX 2NB0A 1MGSA 5D3DA 5FO7B 4HJ8A 1L2FA 1EYAA 1F9PA 2IW3A 3HKZB 2EQSA 4TSSA 4A3CH 2NVQH 5C3WA 2NZOA 3I2ZA 4H7BA 2F0TA 4N9TA 4BWGB 1SDFA 1HUMA 5C4JH 3GTOB 4IPHA 1IKLA 2OT2A 3TSSA 3GV3A 1XNQL 1A63A 2B29A 2EJMA 3ULLA 2PZUA 1RHPA 3GTQH 1QJOA 2SNMA 3WDNA 5M3MG 5H1SE 2FINB 1H9JA 1TWFH 1SYCA 1ILQA 1DM0B 2ASBA 5EKLA 3TZDA 3J7ZC 4HMJA 1YEZA 4KY7A 3H3VI 2JEAI 3U58A 4ILWA 3MXGA 2PW7A 1PZJD 3PCOB 5M3MB 1VF5C 4KJNA 3UE0A 2IT1A 3I91A 4X64L 2GA4B 2X6LA 5IOCA 1BOSA 1MHWC 3M85A 1Q81C 4DV2Q 5GAGC 3T1YQ 2KJXA 2NN6G 2A8VA 5JEAH 2Z4HA 2ZXOA 4DV3Q 4BBSH 1C8CA 1EQVA 1EZ8A 3PO3B 1OTCA 4JI8L 1UE5A 1X55A 2BOSA 3C1FA 2PI2E 1PRTF 2NZHA 3FKIB 1NE3A 4J8QA 1PFSA 1PH1A 4A3JH 2F52A 4MIUA 2KEEA 3M9BA 1NMFA 3AFPA 3D4WA 4RAUC 1VQ4A 3MXNA 4LW1A 2DGYA 1JCKB 1KDAA 4DK1A 2IX3A 4GKJQ 3PQIA 5C3EH 1YI2A 2F0LA 3NBIA 2WV6D 4RCNA 2RKSA 1A6XA 4BBRG 5DM73 1IW7C 1MI2A 1A2UA 1AN8A 5D3IB 1F9QA 1G91A 4P2CB 3MXPA 4U673 1S4ZA 2HCIA 2DJGC 3G6JB 3JAML 2D62A 4GLXA 1T9HA 4YCUA 2IHEA 4AQYQ 4DV6Q 4JI3L 5A2QE 3GTPB 1CSPA 4P73A 2QEJC 2RQXA 1WD0A 3H15A 1LTGD 2GN5A 2K5QA 1WVLA 2R7ZB 1TXYA 1LABA 3SK5A 4HCEA 3L0OA 1VQJA 2X6GA 1YJWA 3QO2A 1I5FA 4CBVA 3H0GH 2K01A 2PMZB 1EOVA 4DF7A 4FXKC 2A5HA 2VB3X 4NP5A 4FF1A 2D0OA 3VR2A 3RUZA 3T51B 4LF5L 3D8GA 1R4PB 2HHHQ 2EY5A 4C3JG 3K80C 1JJCB 2EYHA 5I9PA 1QNUA 2G9DA 4BXXG 3STBC 2E75C 4BY7G 2J7ZA 1QZHA 4GLVB 3QOLA 4HJ5A 2KCNA 4XYQA 1X54A 3NHHA 3TBIB 1EU3A 3MAQA 2R93G 4RGMA 1ESRA 2WIIB 1IBKL 3P1HA 4QIWE 1Z6HA 5I9OA 4PNYA 3TQYA 4JI7Q 1HNWQ 3S1RH 3TN2A 1GHJA 3DM1A 3CC4A 1LTAD 2OQKA 3HOWB 1ICWA 2RCNA 1Q90A 2B63G 1BBXC 5FLMG 2OCEA 5BN5A 3K6OA 3I90A 2E2DC 4OX9Q 4OELB 4POGA 2MGSA 1SFOB 1H9SA 2XNAC 3NXWA 4Q0FA 4B3RL 2K5VA 1UWVA 4UPAA 2V4DA 4PZ7A 3X3MA 2CW0D 3EQLC 4DPGA 4PMWA 3BU2A 2KOLA 2VQEL 3FP9A 4A3MH 1TT2A 1IBLQ 3V2TA 2F0MA 3QIAA 3S1MH 1ASZA 2F0GA 3SHLA 4LUZA 5C44B 4ZYSA 1X32A 1STGA 3GP7A 1EY8A 1Z7TA 4IUPA 3WOFA 1LTSD 2F0UA 4IALA 1WCMH 1XPOA 2H1EA 2OTLA 4R9WA 1SNMA 1XWEA 3S9WA 1PH8A 3PUXA 1TWAB 2K5DA 2RDGA 2HUGA 1YJNA 2B2WA 1XTCD 1IYVA 3H3VH 1PFNA 1LACA 5A35A 1TS3A 4WRDA 2K33A 3PUYA 2WINB 3S16H 2AWNA 1LTID 2IPKD 4X65L 3F1ZA 3VYTA 3BDLA
chains in the Genus database with same CATH topology
2EYMA 4C3IG 4ZUIA 4LAAA 3M7NA 3J81E 5ELBA 2Y0SB 2AWOA 2K1BA 3J80E 3BVZA 3GTLB 2OF1A 3S15B 4HEDA 4ABNA 2KECA 1JE4A 3KLRA 5HURA 3Q6SA 1TY2A 5M5XB 4FVMA 1EY6A 1HTPA 3GTJB 1HPCA 4N9PA 3I72A 4RGTA 1ESFA 4G7HC 2B2YC 3W2DA 1SE2A 3K59A 2BE5C 3BDOA 2ZXPA 4NMZA 4DXFA 3PUVA 4OO1G 4G57A 3I4NB 3HOZB 1T5EA 2I46A 2VXWA 2K32A 5AFWA 2EVBA 5CV5A 3IL8A 3M4YA 1M4VA 2ICIA 3FEWX 3A8KE 2EE1A 5G3LD 3V05A 5KNCA 3SVMA 5D65A 5FO9B 3C46A 2J4XA 1SMYD 1STYA 3HRZC 4B08A 1ONLA 2EYPA 3GTKB 3SXHA 1PTOB 1EFID 4XQQA 4RH6A 1RTNA 4XT3B 2RVLA 4L8JA 4KV6A 4DNTB 1NCVA 3PO2B 2F0JA 5C0XJ 4ODGA 4OL7A 3MTSA 3HOVB 3D4DA 1WTXA 1Y8PB 3NK9A 2XWBB 3D6WA 2IX1A 1RJTA 1HRJA 2DY8A 2PW5A 1TKWB 3Q22A 3L3OC 4G7ZC 1XX8A 5EBDA 3FDTA 1PYWD 3WOEA 3NSWA 1OXVA 1SYBA 3QOJA 1G2SA 5EKKA 4DXGA 1LTRD 3C2PA 2FMCA 1KLGD 3J80L 4CGYB 5IGGA 4S3SA 4NW2A 3RZOB 2CHBD 2F0HA 5JVH3 5KYIA 4L63B 4HSVA 1TVXA 2A73B 5JOBA 1Y1VB 1U9RA 1G291 1GUOA 3PUZA 2HCCA 3MFYA 5C5LA 1BF4A 4CJ2C 5KEEA 1Q1EA 2SNSA 3VR4A 2L9HA 1WTPA 1EU4A 2VB2X 2F1MA 1QG7A 2M00A 1BCPB 3VA5A 1PZID 3I4MB 3DEOA 1DONA 1CA6A 3EA6A 3S14B 1VMCA 5IGBA 1EEFD 3P75A 1V1PB 4TRDA 4RHRA 2JSOA 1G2TA 4ZK9B 4H44C 4QIWB 1SE4A 1JR0D 4RCOA 3E5SA 2CW0C 1DJRD 1JC7A 4OIKA 4ZUJA 2F03A 1KDBA 4ME5A 1JORA 3PUWA 1Q3LA 1SYDA 5EBCA 1EZ6A 4BY1B 1R9TB 1ZKOA 1SNOA 4KD3A 1STAA 4IFDI 1CQVA 4RHSA 3K5NA 4ZKBB 1B53A 1Q8IA 4ULLA 3J7YW 2MUYA 1EWHA 3QWNA 1B1ZA 5CBAE 3CU7A 3OW7A 2AUKA 1RF2D 4IUTA 5JVG3 1QB5D 3V96A 4PV1C 2EYFA 4A3FB 5M3FB 3OOCA 4KN4C 5FLXE 1EQTA 3K5OA 4V190 5TSSA 4FP5D 3MXUA 4KMUC 1GUWA 3HGBA 1CM9A 2B39A 4UAIA 1O7YA 2F0PA 3BZDB 2I07B 3C3LA 2IJ0A 4DAVA 1STNA 1DYQA 2D5DA 4DU9A 2EPBA 4J1MA 4KD4A 3R2IA 1I4RA 1Q12A 5E3FA 4LJZC 1PXUA 1F2ZA 2N55A 3NE5B 4YIJA 2H4OA 3NPPA 1PTOH 1UEAB 2KHSA 4EQNA 3I8ZA 4K5XA 2FJ2A 4RGOS 1KTKA 2XIWA 3A56A 5JEAJ 4G4KA 3KBGA 3GTMB 1SMYC 1EL0A 1U4LA 1LT4D 2NVXB 3A7LA 4J6HA 4DNRB 1LT6D 3L9AX 4C3HG 1EY9A 4ZLTF 3H6MA 1YNJD 2BCOA 3VYSA 3D6CA 5CR3A 3CQZB 3AU7A 3KUPA 4Q5VA 1U4RA 4A3DB 2Z8LA 3SK8A 1D1IA 3VYUA 1D5MC 1QE6A 4K2LA 2B2UA 2N88A 3E6ZX 1BUVT 1V1PA 4BA2I 4Y7NB 2KCCA 2X69A 3DMUA 1F2YA 2YU9B 2EJFC 4ZRZA 1A3UA 1AW7A 5C0XG 1OO9B 2J0TD 3M3YB 4BBRB 3IKJA 5COYA 3N6RA 2XWJB 4DK0A 4G7OC 1EYCA 3ITPA 2D2CC 3K5MA 3NTKA 2RDHA 2FMMA 1L0YB 2PNRC 4XXEA 2CQAA 2AQ3B 5EJWA 1A15A 1CQFA 1Y69U 3EROA 3BDCA 1QOHA 4DAYA 2G9HD 1SNPA 1F9RA 3K58A 1DD2A 1PFMA 2NN6I 4C3JB 1EYDA 2DY7A 3A7AB 2K04A 2QCPX 3GO5A 3SK4A 4BY7B 3LWEA 1SYGA 1BO0A 4KJOA 5M5WB 3K7AB 1TWCB 2LKVA 3LX0A 3OSOA 1BNZA 2R93B 5KNBA 3KK7A 3MHBA 4CKCA 1I6VC 4RWSC 1EOTA 3KBXA 2PCFB 4CHTB 4FXDA 4QCLA 1PRTD 3E0JA 4KK7A 5CV4A 1DCZA 4IURA 1GJXA 1PRTB 2B63B 1F2LA 3NWTA 3DXJC 1BR9A 1M8AA 5IT9E 2AQ2B 4PMCA 1SBBB 5K36H 3NP8A 1SSOA 2Q8IB 1TWGB 2EY2A 1X3QA 5M9OA 1B9MA 2PYKA 2Z4IA 1EEID 5D14A 2ICEC 5G3LF 1CFMA 3TMEA 3I3CA 2EYLA 4K6LA 2F4IA 3TP8A 2IWHA 3VA7A 1DXMA 2K7VA 3HEJA 3IFTA 5FK9C 5ELEA 3IFDA 3IAYA 1JOQA 2JEBI 5IGEA 3H3VC 1B50A 2L1BA 3A54A 2PZWA 2XRQD 5C6AA 3HOUB 4C3IB 4X3UA 1FYCA 4IUNA 4KN7C 4F88A 1I3QB 1SXTA 5A2QL 4IUVA 1E0BA 4M8AA 3OMCA 1JWSD 4KY6A 3TZUA 1ENAA 1EY4A 2B2TA 2IL8A 5JAVA 1ZXTA 1HFGA 1NUCA 3VYRA 2R61A 1GOZA 2JE6I 3SR1A 3FMCA 1OXSC 1RCVD 2B2VA 2JA6B 2ZXRA 4A93B 2PQEA 2O4XA 1HTLD 1UUPA 2A68D 3H94A 2B2WC 1IL8A 2BDNA 1QCBD 4F8MA 1PLFA 4XIGS 5E4XA 4HSPA 1PTOD 1ML0D 2WACA 4A3IB 5C4XB 1GHKA 5C4JB 2NN6H 5DM63 3O13A 2O5JC 4FF2A 5I6YA 3MFGA 3NUCA 4BA1I 3H09A 3P20A 1EIGA 4HN7A 1B4OA 3GTQB 4IQZA 3KLSA 3RLFA 4FXGC 3L7ZC 3MA2B 5IT9L 1RD9D 1I50B 3DUZA 2B2TC 2LMCB 1YNJC 5J22A 4WFN3 5JEAG 3EVQA 3RZDB 1K83B 3FPPA 2WKDA 2RBMA 1IHZA 5ELFA 3A55A 1K8OA 2MPMA 3HS0C 1F77A 1CK1A 4K6DA 4OO1I 1EY0A 3J81L 2BA1A 3Q23A 3D31A 1KABA 3W3AA 3NTHA 5NUCA 4DN4M 3OWEB 5IGDA 3J7AV 2E2IB 1U4PA 3GV6A 5C3EB 4HAEA 1ZYRD 1Y8OB 5E1FA 1O78A 2L4NA 4H13C 1SNQA 5JPNC 4GZYC 1FNWA 2F0KA 4F87A 3GD7A 4HMIA 5KIXA 3MZ5A 4K14A 4KKUA 1BCPD 2F0VA 3SEBA 3J7AF 3DWQA 2PO4A 3PIP3 3A8JE 2XVSA 3HZXA 3T13A 4IN3A 1BXTA 1RTOA 3NQIA 2K6AA 1HHVA 3EJIA 5HGTA 3QB3A 2EJGC 2K03A 1MBYA 4M1UB 1V1OA 1LO5D 2NWGA 4QUFA 4ZQ3A 2OEOA 1PRTC 2F3WA 4BS9A 3A8IE 4MN3A 2RA4A 4KKSA 5I4DA 4KHVA 3MC0B 5F2DA 4H0LC 3R2TA 4MHEA 3M7GA 1GUSA 3SE0A 5FOBB 2SDFA 2QF7A 2EOTA 2F0IA 3G7LA 5CV8A 4OGQC 5I2XA 1SNDA 1CA5A 3GQBA 1FNVA 2BDOA 2E2HB 5J39A 5CV9A 1RDPD 1H9MA 5C4HA 4A3MB 1LTTD 1LT5D 1AZPA 1NSNS 2TSSA 4LK1C 5BN4A 2RSOA 4K8IA 2LS01 1TY0A 5BN3A 3T4AC 2A6ED 4PQXA 1IKMA 1F9SA 1KNAA 2IX0A 3S16B 2KVMA 1QILA 3OHXC 4JBWA 4C56C 2A6HD 2QILA 1WTRA 2HQEA 1KNEA 4X3KA 1TWHB 4OO1H 1V43A 3S1QB 1RKNA 4IUQA 4TQUS 1JB3A 5C3XA 2F0DA 4XQJA 2MJ8A 2A69D 2ZT9C 2D9UA 2PPBC 1VDZA 4QMGA 1T5XD 1S5DD 2VNUD 3BVMA 5C4ZA 1B9NA 2F3VA 1Z47A 2A68C 4R8NA 1JOOA 3KF8A 3SDZA 5K5PA 3AMUA 1KLUD 1E2ZA 1PZKD 1NR4A 1S5CD 4QUCA 3DWPA 2NVTB 1VCIA 1UNSA 3K0YA 4A3EB 1H9RA 3VR6A 1PTOC 5FO8B 3HP3A 2L11A 1ZEQX 4FO2A 3U9OA 3T16A 5CC4A 2KEDA 3OMGA 5EPLA 4DA2A 3I73A 3N52A 4B9WA 1Y1WB 4A3BB 4K5VA 3R93A 5EQ0A 4C3HB 5CV6A 3S17B 2F0SA 5CV7A 1FR3A 3C1EA 1JWUD 3F2UA 2O2LD 4RFBA 2Q8RE 2F0QA 5ISRA 5EKIA 2YYZA 2E76C 3OIPA 1XYIA 4LMQD 4KY5A 5ELCA 4FYDA 5LL6X 4IFDJ 1EY7A 2MP1A 1QNKA 5T1GA 1S5ED 5IGFA 1D1KA 1I4PA 1WD1A 2WKCA 3R3OA 1G8ZD 1SJED 4K2KA 5EGTA 4IFDH 5FLXL 2Q8TA 4UDUC 1ZYRC 5FKAC 1PMRA 2F0WA 3S2HB 5CMDA 4O1NA 3LNNA 2VUMB 1SNCA 2OXPA 5I6WA 3RD4A 3OIQA 3NQTA 2JP1A 3HOYB 2E74C 1HCZA 3H91A 1BCPC 2R92B 4PMBA 1AZQA 1CT1D 2NBFA 1TQOA 2EXZA 3MEHA 1U4MA 2L0CA 2WAQB 1KDCA 1NAPA 1TS2A 1BDOA 3ND9A 1B3AA 4FF4A 1JWMD 2DNEA 2B2UC 4X3TA 1WTOA 3FPUB 5CYUA 2R3ZA 3ND8A 4A3KB 5DAUA 2NVYB 1WTQA 1JOKA 3QG1A 1ENFA 2R6GA 3VR3A 1K8MA 2EZVA 2EYOA 1MSHA 1EIHA 3NWSA 5C0XI 1I4XA 1A2TA 5LHY1 2KA7A 1ILPA 1FGBD 3BYTB 3S1NB 1CTMA 2B2YA 3NBHA 4EVOA 1PDQA 1O7LA 1MD2D 4CKBA 2JA5B 1KAAA 3TP7A 2EYJA 2JA7B 3FVQA 1HA6A 4C1NI 3R8BA 4OIJA 4A3GB 1PTOF 1J9OA 3HOXB 1YNND 1S5FD 3TP5A 4CJ0B 1WTWA 4FF3A 2QKIC 4R8IA 4KKTA 2L12A 1VMPA 2Z1CA 2WP8J 5DEHA 2DNCA 5CORA 2NYZD 3LWUA 3PMFA 4HCSA 1CZWA 2A6EC 3FRPB 4KTAA 3D3RA 1LTBD 1WTVA 3M4OB 1JQYD 1SEBD 1HQRD 5JPMC 4TKOB 1STBA 2MHVA 1AFPA 1GUTA 4XYOA 4E6IA 4K8JA 3CHBD 2A6HC 1ENCA 3UI2A 1E2WA 1OXTA 4IUUA 2ID0A 2A69C 4EQPA 1HQMC 1JICA 3I70A 1TS4A 1AP0A 4I65A 2HDLA 1W6JA 4QB4A 1CZGA 1E2VA 3D4RA 1A3VA 1EY5A 4RKLA 4ID6A 3U9SA 2NTTA 5DNFA 5C5MA 2E2JB 1OXUA 4ZAIA 1FD7D 2XN9C 3DHQA 2LY7A 1ET9A 3NTIA 3MWYW 1DOKA 4EQOA 2NVQB 3SK6A 1HUNA 1EWCA 2B8FA 1PFBA 4ZKCB 1DZ1A 1S5BD 3T56B 3P7JA 1GUGA 4F7XA 5KNDA 2JXMB 2NUCA 1BCPF 2F0EA 2K5WA 4C1NK 1XXGA 1STHA 2SEBD 1GXDC 1TWFB 1J8IA 4IZ8A 5EPKA 2F0OA 1F2MA 4DGZA 1B44D 2NZ1D 2DN8A 1AEXA 3Q24A 1HFNA 1V8QA 1SYFA 4WJWA 2BA0A 4KI0A 1NR2A 2EY6A 2FFKB 2B2VC 2WB1B 1VF7A 3OWFA 5KYLA 5C0XH 4BBSB 1UAPA 4XDXA 1D6EC 3HG9A 4CJ1B 1IW7D 4EGVA 5IGCA 3BVGA 1DOLA 2F0NA 2L55A 2B8GA 3DEPA 4DFAA 4A3JB 5T1IA 3ERQA 2KQ3A 1OXXK 2RSNA 1SYEA 2QDBA 1I4QA 1HXYD 2AUJD 1D5ZC 1SE3A 1Y8NB 3CKIB 5IIFA 2RDFA 1R4QB 3TP6A 4XT1B 4DAPA 4IFDG 1C4QA 1L0XB 4HTHA 3S2DB 5KGUA 5J1ZA 5M5YB 2ENBA 4WORA 1B2TA 2XSCA 4L6TB 3TDQA 2C5CA 1QWYA 1CI3M 1IYUA 3H0GB 5LL6S 1A3TA 5CBEE 4K5WA 2L5TA 1I4GA 1FNUA 1TIID 2TMPA 1BQQT 2NTSA 1G6ZA 2EY1A 3K5LA 3OPOA 1LLRD 4NDXA 2PZTA 3PV0A 4V0BA 1MSGA 3T53B 3CRLC 1ET6A 1TU2B 2A74C 5I2YA 4RGNA 3S1RB 1SJHD 3X3NA 5KRUA 1LT3D 4C2MB 3CRKC 4FNFA 5E4WC 1TS5A 2JYOA 4X3SA 1SAPA 4Z9CB 1D2BA 1LV9A 4B9XA 1I6HB 2FHTA 2KUMA 3EFXD 1I4HA 3ONAB 3Q0AA 2AQ1B 4CKEA 2JA8B 3DWAA 2F0FA 4NKLA 4KHZA 4XTCS 1II3A 1H9KA 4U68A 5K36G 5CGKA 2SOBA 3MVVA 3BYYB 3K57A 5ELDA 2M2LA 1C48A 4AYBB 3S1MB 2K28A 1Q1BA 2C9OA 2HDMA 4XQNA 2O5IC 1YNNC 5EPJA 2XRSD 3URYA 3JAME 2LFNA 3I4LA 3GTGB 1WCMB 3KLSX 1O7ZA 4O42A 1RODA 1W6KA 3AB9A 1CHQD 2EDGA 5JJZA 3VR5A 1STEA 1CHPD 4JK1C 4I7ZC 1GUNA 1D5XC 2M9VA 4RA8A 3PIO3 1DOMA 3QJYA 3RMHA 3BS1A 4QF4A 5IODA 3BG3A 1X3PA 4RKBA 1TR5A 1O80A 4HR7B 1HA5A 2BE5D 2K05A 2CVRA 3ZYYX 4OHJA 1H9SB 2NB0A 1MGSA 5D3DA 5FO7B 1EYAA 1F9PA 2IW3A 3HKZB 4TSSA 5C3WA 4H7BA 2F0TA 4N9TA 4BWGB 1SDFA 1HUMA 3GTOB 1IKLA 2OT2A 3TSSA 3GV3A 2EJMA 2PZUA 1RHPA 1QJOA 2SNMA 3WDNA 2FINB 1H9JA 1SYCA 1ILQA 1DM0B 5EKLA 3TZDA 4HMJA 4KY7A 2JEAI 4ILWA 3MXGA 2PW7A 1PZJD 5M3MB 1VF5C 4KJNA 2IT1A 3I91A 2GA4B 2X6LA 5IOCA 1BOSA 3M85A 2KJXA 2NN6G 5JEAH 2Z4HA 2ZXOA 1C8CA 1EQVA 1EZ8A 3PO3B 2BOSA 3C1FA 1PRTF 3FKIB 4J8QA 4MIUA 2KEEA 3D4WA 4RAUC 3MXNA 1JCKB 1KDAA 4DK1A 2IX3A 2F0LA 3NBIA 2WV6D 4RCNA 2RKSA 1A6XA 5DM73 1IW7C 1MI2A 1A2UA 1AN8A 5D3IB 1F9QA 1G91A 4P2CB 3MXPA 4U673 1S4ZA 2HCIA 3G6JB 3JAML 2D62A 5A2QE 3GTPB 2QEJC 2RQXA 1WD0A 1LTGD 2K5QA 1WVLA 2R7ZB 1LABA 3SK5A 4HCEA 2X6GA 3QO2A 4CBVA 2K01A 2PMZB 4DF7A 4FXKC 2A5HA 2VB3X 4NP5A 4FF1A 3VR2A 3RUZA 3T51B 3D8GA 1R4PB 2EY5A 4C3JG 2EYHA 5I9PA 1QNUA 2G9DA 2E75C 2J7ZA 3QOLA 2KCNA 4XYQA 3NHHA 3TBIB 1EU3A 3MAQA 4RGMA 1ESRA 2WIIB 3P1HA 1Z6HA 5I9OA 4PNYA 3TN2A 1GHJA 3DM1A 1LTAD 3HOWB 1ICWA 1Q90A 1BBXC 5BN5A 3K6OA 3I90A 2E2DC 2MGSA 1SFOB 1H9SA 2XNAC 3NXWA 4Q0FA 2V4DA 3X3MA 2CW0D 3EQLC 4PMWA 2KOLA 1TT2A 3V2TA 2F0MA 3QIAA 2F0GA 3SHLA 5C44B 4ZYSA 1X32A 1STGA 3GP7A 1EY8A 1Z7TA 4IUPA 3WOFA 1LTSD 2F0UA 4IALA 2H1EA 4R9WA 1SNMA 1XWEA 3S9WA 3PUXA 1TWAB 2RDGA 2HUGA 2K5DA 2B2WA 1XTCD 1IYVA 1PFNA 1LACA 5A35A 1TS3A 4WRDA 2K33A 3PUYA 2WINB 2AWNA 1LTID 2IPKD 3VYTA 3BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA4 B;  1CZW A;  1BOS A;  1R4Q B;  1D1I A;  1R4P B;  1DM0 B;  1CQF A;  4M1U B;  1QNU A;  1C4Q A;  1QOH A;  4ULL A;  4P2C B;  2XSC A;  2BOS A;  1CZG A;  3MXG A;  1C48 A;  1D1K A;  2C5C A; 
#chains in the Genus database with same CATH topology
 3HOU G;  2EYM A;  4C3I G;  4ZUI A;  4LAA A;  3M7N A;  3J81 E;  5ELB A;  1YHB A;  4IOA A;  2Y0S B;  2AWO A;  3W5O A;  5IYC G;  1K8A C;  1TWH H;  1FL0 A;  2K1B A;  1PV4 A;  3J80 E;  3BVZ A;  3GTL B;  2UUB Q;  1EQR A;  2OF1 A;  3S15 B;  4HED A;  4ABN A;  2JN4 A;  3J80 c;  4LF9 L;  2KEC A;  3K81 C;  1JE4 A;  3KLR A;  5HUR A;  3Q6S A;  4JI2 L;  1TY2 A;  5M5X B;  2K14 A;  4FVM A;  4R1J A;  2JA6 G;  2ZJP A;  1PH3 A;  1EY6 A;  1HTP A;  4AIM A;  3GTJ B;  4A93 G;  1HPC A;  3GTO H;  3OYY A;  4N9P A;  3I72 A;  4GN4 B;  4RGT A;  4CDD C;  4DK6 C;  1ESF A;  4G7H C;  2B2Y C;  3W2D A;  1SE2 A;  3K59 A;  2BE5 C;  3BDO A;  2ZXP A;  4NMZ A;  4DXF A;  3PUV A;  4LFC Q;  2CFM A;  1IBM L;  4OO1 G;  4G57 A;  3I4N B;  4A3E H;  4UP9 A;  3HOZ B;  2BH2 A;  1T5E A;  2I46 A;  2VXW A;  2K32 A;  1XMO Q;  3CCQ A;  4JYA Q;  5AFW A;  2EVB A;  5CV5 A;  3IL8 A;  1HR0 W;  3TRE A;  5JJL A;  3M4Y A;  2JQO A;  1M4V A;  2ICI A;  4DV5 Q;  1M1K C;  3FEW X;  3A8K E;  4A3I G;  1QUQ B;  5L37 A;  2EE1 A;  5G3L D;  3V05 A;  5C4X G;  5KNC A;  3SVM A;  1HNZ L;  5ELO A;  5D65 A;  5FO9 B;  1FJG L;  3C46 A;  2J4X A;  1SMY D;  1STY A;  3HRZ C;  1AH9 A;  3PO3 H;  1E1O A;  3ER0 A;  4OWX B;  4B08 A;  1ONL A;  3S17 H;  2EYP A;  3GTK B;  4QJF A;  3SXH A;  3FKI H;  1PTO B;  1EFI D;  3G4S A;  5HY6 A;  4XQQ A;  3GDE A;  4JI4 L;  4RH6 A;  1RTN A;  4XT3 B;  2RVL A;  1PYS B;  4KV6 A;  4L8J A;  4DNT B;  1NCV A;  4YHH L;  3PO2 B;  2Z6K C;  2F0J A;  2BH8 A;  5C0X J;  4ODG A;  1B7Y B;  4GLA C;  1KL9 A;  1PH4 A;  4OL7 A;  1JMC A;  3MTS A;  5BR8 L;  3HOV B;  3D4D A;  4B3S Q;  4DR2 Q;  1WTX A;  1Y8P B;  2AMC B;  3NK9 A;  2XWB B;  3D6W A;  2IX1 A;  4DR3 Q;  3I4O A;  1RJT A;  1JE5 A;  1HRJ A;  2DY8 A;  3GTP H;  5E7N A;  5LMN L;  2PW5 A;  4NXM Q;  1TKW B;  3Q22 A;  5IY0 A;  4ALP A;  3L3O C;  4G7Z C;  1XX8 A;  5EBD A;  1LYL A;  3FDT A;  2ZM6 L;  4NB3 A;  1PYW D;  3SGI A;  3WOE A;  3I55 A;  3NSW A;  4GN5 A;  1OXV A;  2Q2U A;  1SYB A;  3QOJ A;  1G2S A;  5EKK A;  2VY3 A;  4DXG A;  1LTR D;  3C2P A;  1YBY A;  3J7A 5;  2FMC A;  1KLG D;  1HJP A;  3J80 L;  4CGY B;  5IGG A;  2UXC Q;  4S3S A;  4DV0 L;  4NW2 A;  4DAM A;  3RZO B;  2CHB D;  1S3O A;  4JBM A;  2F0H A;  5JVH 3;  5KYI A;  4L63 B;  1VQ6 A;  4DUZ L;  4HSV A;  1TVX A;  2A73 B;  5JOB A;  1Y1V B;  1L1O C;  1U9R A;  1G29 1;  1HZ9 A;  2QA4 A;  3CPF A;  1GUO A;  4A3K H;  4OWW B;  2NVY H;  3PUZ A;  2HCC A;  3MFY A;  5C5L A;  1BF4 A;  4CJ2 C;  3HOW H;  5KEE A;  1IZ6 A;  2CH4 W;  1Q1E A;  2SNS A;  4OEM B;  3VR4 A;  2F4V Q;  4LFA Q;  2L9H A;  2RHQ B;  5IE8 A;  1WTP A;  1EU4 A;  4X66 Q;  4JV5 L;  2VB2 X;  2F1M A;  1QG7 A;  3RR5 A;  2M00 A;  4QGU A;  1BCP B;  3VA5 A;  1PZI D;  3I4M B;  3DEO A;  2E8G A;  4LUV A;  1SFO H;  3A5U A;  4IJH A;  1DON A;  2OTJ A;  3K8A A;  2Q2I A;  4A3L H;  4HJA A;  2Z9H A;  2K75 A;  1CA6 A;  1E22 A;  3EA6 A;  1MJE A;  3KDF B;  3S14 B;  1VMC A;  2JA5 H;  5IGB A;  1EEF D;  1A0I A;  1E24 A;  3P75 A;  1V1P B;  4TRD A;  4RHR A;  2JSO A;  4AH6 A;  3E0E A;  5C44 H;  4JI6 Q;  1G2T A;  2UXD L;  4ZK9 B;  4H44 C;  4QIW B;  1SE4 A;  1JR0 D;  4RCO A;  3NEL A;  4GNX B;  2K5N A;  3E5S A;  4MZ9 A;  2CW0 C;  1DJR D;  4DV4 L;  1JC7 A;  4OIK A;  4ZUJ A;  1WJJ A;  2F03 A;  1KDB A;  4ME5 A;  5ELN A;  1JOR A;  3PUW A;  1Q3L A;  2AHO B;  1SYD A;  5EBC A;  5IWA Q;  1EZ6 A;  5IYB G;  2C35 B;  4X62 L;  1EQQ A;  5AJ3 Q;  4BY1 B;  1R9T B;  4LF8 Q;  1ZKO A;  3U4V A;  1KRT A;  1G6P A;  4A3M G;  1QUQ A;  1SNO A;  4KD3 A;  1STA A;  4IFD I;  1CQV A;  1WTH A;  4APV A;  4RHS A;  3GTL H;  3K5N A;  4ZKB B;  4DAY B;  3M4O H;  1S72 A;  1B53 A;  1Q8I A;  4ULL A;  3J7Y W;  2MUY A;  4MTK A;  1EWH A;  3QWN A;  1B1Z A;  5CBA E;  3CU7 A;  3OW7 A;  5JJK A;  3JAM c;  2AUK A;  1RF2 D;  5M5X H;  4IUT A;  5JVG 3;  1QB5 D;  3V96 A;  4PV1 C;  2EYF A;  1BBU A;  4A3F B;  5M3F B;  4OWT B;  3OOC A;  4KN4 C;  5FLX E;  4Y52 H;  2WFW A;  1EQT A;  4DV2 L;  4TVA B;  3T1Y L;  3K5O A;  1K0R A;  1K0S A;  4QL5 A;  4V19 0;  1YZ6 A;  5TSS A;  4FP5 D;  3MXU A;  4KMU C;  5IYD G;  1GUW A;  3HGB A;  1CM9 A;  2B39 A;  1VQD A;  4UAI A;  3I4N H;  1JT8 A;  3HOZ H;  1O7Y A;  1CKO A;  5IP9 G;  4R4I A;  2F0P A;  3BZD B;  2E2J H;  2I07 B;  3C3L A;  4GKK Q;  4YWK A;  4UP8 A;  2IJ0 A;  2PQA B;  4DAV A;  3KFU A;  1STN A;  2KHJ A;  2Z0S A;  1DYQ A;  1KQS A;  2D5D A;  1FVI A;  4DU9 A;  4GKJ L;  2JJQ A;  2EPB A;  4J1M A;  1N34 L;  4KD4 A;  4YY3 L;  1M90 C;  1VQC A;  2PI2 A;  3R2I A;  1I4R A;  4A4I A;  1Q12 A;  3KJO A;  2UU9 Q;  4POF A;  4LF7 Q;  5E3F A;  4LJZ C;  3ULJ A;  3A74 A;  1PXU A;  2R7D A;  1F2Z A;  2N55 A;  2I5L X;  3NE5 B;  4YIJ A;  2H4O A;  3NPP A;  2IHF A;  4AQY L;  3GTK H;  4DV6 L;  1PTO H;  1UEA B;  2KHS A;  4EQN A;  4A3E G;  3I8Z A;  4K5X A;  2FJ2 A;  4RGO S;  3OTO Q;  1KTK A;  3HFZ B;  3PO2 H;  2XIW A;  3A56 A;  5JEA J;  4G4K A;  3KBG A;  3GTM B;  1SMY C;  1EL0 A;  4H02 A;  1EYG A;  3CAM A;  3HOV H;  1J6Q A;  1U4L A;  4DR1 Q;  1LT4 D;  1C7Y A;  2NVX B;  3A7L A;  1G51 A;  4J6H A;  1BKB A;  4DNR B;  1Y1W G;  4A3B G;  1LT6 D;  4A3D G;  3L9A X;  4C3H G;  4DUY Q;  1EY9 A;  4ZLT F;  3H6M A;  1YNJ D;  2BCO A;  3VYS A;  3D6C A;  5CR3 A;  2G5D A;  3CQZ B;  4LF4 L;  2YTV A;  3AU7 A;  4OXP A;  3KUP A;  4Q5V A;  1U4R A;  4A3D B;  2Z8L A;  3SK8 A;  1D1I A;  3VYU A;  1D5M C;  1QE6 A;  3KDF A;  4K2L A;  3JAM i;  4JI7 L;  1HNW L;  2DUD A;  1PH7 A;  2UUC Q;  2B2U A;  2N88 A;  3E6Z X;  1BUV T;  1GM5 A;  1V1P A;  2HIX A;  4BA2 I;  4Y7N B;  1VQI A;  2KCC A;  2X69 A;  1E7Z A;  3A5Z B;  1F2Y A;  3DMU A;  4KHP Q;  2YU9 B;  2EJF C;  4ZRZ A;  1PVO A;  1A8V A;  1A3U A;  1AW7 A;  2GVB A;  5C0X G;  1OO9 B;  2A19 A;  2J0T D;  1X65 A;  4OX9 L;  3M3Y B;  2UUA Q;  4BBR B;  4GNX A;  1K3R A;  3IKJ A;  5COY A;  3N6R A;  2KCT A;  2XWJ B;  4DK0 A;  4G7O C;  3S2D H;  1EYC A;  3FHW A;  4K0K Q;  4DV1 Q;  5M5Y H;  3ITP A;  2D2C C;  3DLL A;  1Y1V H;  3K5M A;  3NTK A;  1GD7 A;  2RDH A;  2FMM A;  2HQL A;  2VUM G;  1IBL L;  1L0Y B;  2PNR C;  4XXE A;  2CQA A;  1MJC A;  2AQ3 B;  1SR3 A;  5EJW A;  1GVP A;  1A15 A;  3CC2 A;  4LF6 L;  3CF5 A;  3HOY G;  1CQF A;  1Y69 U;  4L5T A;  2LXJ A;  3ERO A;  3BDC A;  1HR0 Q;  3I4M H;  1QOH A;  4DAY A;  2G9H D;  1SNP A;  1F9R A;  3K58 A;  2R92 G;  4L5S A;  1DD2 A;  1PFM A;  1GKH A;  2NN6 I;  1SLJ A;  2WAQ G;  3S14 H;  4P75 A;  4C3J B;  1EYD A;  2DY7 A;  3A7A B;  2K04 A;  1HNX Q;  2QCP X;  3GO5 A;  3SK4 A;  4BY7 B;  3LWE A;  4A3K G;  1SYG A;  4C2M H;  1BO0 A;  4KJO A;  5M5W B;  1WI5 A;  2LSS A;  3K7A B;  1TWC B;  2LKV A;  3LX0 A;  3OSO A;  1BNZ A;  2R93 B;  5KNB A;  3KK7 A;  3MHB A;  5GQO A;  1I6V C;  2ZTC A;  4RWS C;  1EOT A;  3KBX A;  4CKC A;  2UUB L;  1I6H H;  2PCF B;  1XJV A;  5GAE C;  4CHT B;  4FXD A;  4QCL A;  4B3T Q;  1PRT D;  1YJ9 A;  3E0J A;  1SN8 A;  4KK7 A;  5CV4 A;  2JA8 H;  1DCZ A;  4IUR A;  1GJX A;  1PRT B;  4RG1 A;  2B63 B;  2PQA A;  4A3L G;  4HIO A;  1CUK A;  1F2L A;  1N33 Q;  3NWT A;  3DXJ C;  4BY1 H;  1BR9 A;  1M8A A;  1UE7 A;  1H95 A;  1JB7 A;  5IT9 E;  1XMQ L;  3UDI A;  2AQ2 B;  2JA7 G;  1ASY A;  4PMC A;  1SBB B;  5K36 H;  3NP8 A;  1L0W A;  1SSO A;  3GTG H;  4CDC C;  4LFC L;  2Q8I B;  1TWG B;  2E5L Q;  2EY2 A;  1X3Q A;  5M9O A;  4A3G G;  1B9M A;  4JYA L;  2PYK A;  2Z4I A;  1EEI D;  3HOX G;  1UE6 A;  3EN2 A;  5D14 A;  3CCE A;  2ICE C;  5G3L F;  1CFM A;  3E3X A;  3TME A;  3UDX A;  3I3C A;  2QEX A;  2EYL A;  3ERS X;  4K6L A;  1SMX A;  2F4I A;  3TP8 A;  3CCJ A;  2QDL A;  5FJ8 G;  4DV5 L;  4KLK A;  4I7A A;  2IWH A;  3VA7 A;  1DXM A;  4A3F H;  2K7V A;  3HEJ A;  4L5R C;  3IFT A;  5FK9 C;  3U4Z A;  5ELE A;  1YIJ A;  3IFD A;  3IAY A;  3BZC A;  1JOQ A;  2JEB I;  4JI5 L;  5IGE A;  3H3V C;  2K4K A;  1PA6 A;  1B50 A;  2L1B A;  3A54 A;  2PZW A;  2XRQ D;  5C6A A;  1EFW A;  3HOU B;  4C3I B;  3J81 c;  4X3U A;  4ZCK A;  1FYC A;  4IUN A;  4KN7 C;  4O0A A;  4F88 A;  1I3Q B;  4R4O A;  4P74 A;  1SXT A;  5A2Q L;  4DR6 Q;  4IUV A;  1E0B A;  4DR5 L;  4M8A A;  3OMC A;  1JWS D;  4KY6 A;  3W1G A;  1Q86 C;  3TZU A;  1ENA A;  3W1B A;  1EY4 A;  4IJL A;  2B2T A;  2IL8 A;  5JAV A;  1ZXT A;  1HFG A;  1NUC A;  3VYR A;  1XNR L;  2R61 A;  4B3S L;  1GOZ A;  2JE6 I;  3SR1 A;  4DR2 L;  3FMC A;  1OXS C;  1RCV D;  2CQO A;  2B2V A;  2JA6 B;  4DR3 L;  2ZXR A;  4A93 B;  2PQE A;  2O4X A;  1E1T A;  1HTL D;  4NXM L;  1UUP A;  2QGQ A;  4JOI A;  2A68 D;  3H94 A;  5M3M H;  3KF6 B;  1I94 L;  2QW7 A;  4A3C G;  2MFI A;  2B2W C;  1IL8 A;  3CCS A;  2BDN A;  1AE3 A;  1QCB D;  4F8M A;  4QY7 A;  1N9W A;  1PLF A;  2NVX H;  4XIG S;  1N8R C;  5E4X A;  2UXC L;  5GAH C;  3EBE A;  4HSP A;  3PIP A;  1PTO D;  1ML0 D;  2WAC A;  4A3I B;  1J5E Q;  3AEV A;  1JJG A;  1VS0 A;  4IPG A;  1N36 Q;  5C4X B;  1GHK A;  5C4J B;  2NN6 H;  3T1H Q;  5DM6 3;  3CQZ H;  3O13 A;  1K9M C;  2O5J C;  4FF2 A;  5I6Y A;  3MFG A;  3NUC A;  4JCV E;  4BA1 I;  3RLO A;  3H09 A;  3P20 A;  1EIG A;  2Q2H A;  1K73 C;  1PYB A;  4HN7 A;  1B4O A;  3GTQ B;  4IQZ A;  2VW9 A;  1KD1 C;  3KLS A;  3RLF A;  4FXG C;  3L7Z C;  4JVZ A;  4Y7N H;  2N78 A;  3MA2 B;  5IT9 L;  1RD9 D;  1K28 A;  1HZB A;  1I50 B;  2YU9 H;  4LF9 Q;  2F4V L;  4JI1 Q;  4LFA L;  1V9P A;  2WB1 G;  3DUZ A;  2B2T C;  2LMC B;  1YNJ C;  4X66 L;  5J22 A;  4WFN 3;  5JEA G;  3EVQ A;  3RZD B;  4BBS G;  1K83 B;  3FPP A;  4BBR H;  1VQM A;  2L15 A;  2WKD A;  2RBM A;  1IHZ A;  3J81 i;  5ELF A;  1WFQ A;  3A55 A;  1K8O A;  2MPM A;  2UXB Q;  5IP7 H;  2R7Z H;  3HS0 C;  1F77 A;  4A3J G;  1CK1 A;  1VQH A;  3J80 i;  4K6D A;  4OO1 I;  1GO3 E;  1EY0 A;  1W2B A;  1A62 A;  3J81 L;  5C3E G;  2BA1 A;  4R4C A;  3Q23 A;  4JI6 L;  3D31 A;  1B3Q A;  1KAB A;  1YHQ A;  3W3A A;  4JOI C;  3NTH A;  4JC0 A;  5NUC A;  4NPS A;  1LM0 A;  4DN4 M;  3OWE B;  5IGD A;  3J7A V;  2E2I B;  1U4P A;  3GV6 A;  3KF8 B;  5C3E B;  4HAE A;  1ZYR D;  1Y8O B;  5E1F A;  1O78 A;  2L4N A;  4H13 C;  1SNQ A;  5JPN C;  4GZY C;  1FNW A;  2F0K A;  4JPB W;  4PZ6 A;  4F87 A;  4C3J H;  5IWA L;  2WAQ E;  3GD7 A;  3BZK A;  4HMI A;  5AJ3 L;  5KIX A;  3MZ5 A;  4LF8 L;  4BY7 H;  2I0Q A;  3H0G G;  5M5W H;  4K14 A;  3K7A H;  1TWC H;  4KKU A;  1BCP D;  2F0V A;  3SEB A;  3RLN A;  3J7A F;  3DWQ A;  1VQ7 A;  2PO4 A;  3PIP 3;  3A8J E;  4YHH Q;  1YHA A;  2XVS A;  3HZX A;  1XTD A;  3T13 A;  2HT1 A;  4DR7 Q;  4IN3 A;  1BXT A;  1RTO A;  4PZ8 A;  2B63 H;  3NQI A;  5LMU Q;  2K6A A;  1Z9F A;  3S24 A;  1HHV A;  4UHV A;  2MNA A;  3EJI A;  5HGT A;  1NMG A;  3QB3 A;  2EJG C;  2K03 A;  1MBY A;  4M1U B;  1KXL A;  1QVF A;  1P8L A;  1V1O A;  1LO5 D;  2NWG A;  4QUF A;  4WJ4 A;  1IYJ B;  3LGJ A;  4ZQ3 A;  2OEO A;  3EIV A;  1PRT C;  1X56 A;  3K0X A;  2XTI A;  2F3W A;  3JC6 6;  3PF5 A;  1TWG H;  4BS9 A;  3A8I E;  1X9N A;  4MN3 A;  2RA4 A;  1C0A A;  1TWA H;  4KKS A;  4EQ5 A;  5I4D A;  4GKK L;  4PG3 A;  3F2D A;  1VQ5 A;  1O7I A;  2VL6 A;  4DV7 Q;  2P5Z X;  4KHV A;  3MC0 B;  5F2D A;  2JA8 G;  4H0L C;  3R2T A;  4MHE A;  3M7G A;  1KRS A;  4UP7 A;  2OQ0 A;  3KF6 A;  1GUS A;  1KC8 C;  3SE0 A;  5FOB B;  1CKM A;  4ME3 A;  1YIT A;  2SDF A;  2QF7 A;  4HJ9 A;  2EOT A;  2F0I A;  3G7L A;  3CC7 A;  4LF7 L;  4AYB G;  3RNU A;  5CV8 A;  4OGQ C;  5I2X A;  1SND A;  1MKH A;  1CA5 A;  3GQB A;  1FNV A;  2ZJQ A;  2BDO A;  2E2H B;  5J39 A;  3HOU H;  5CV9 A;  2KEN A;  2K50 A;  1RDP D;  1H9M A;  1NJI C;  3S15 H;  1NY4 A;  1WCM G;  5C4H A;  1I3Q H;  5DLQ E;  5IYC H;  4A3M B;  1LTT D;  4B3M Q;  1B8A A;  1LT5 D;  3CPW A;  3OTO L;  1AZP A;  1NSN S;  2TSS A;  5EAY A;  3J81 j;  4LK1 C;  1VQP A;  5BN4 A;  2H5X A;  2RSO A;  4K8I A;  3GTJ H;  2LS0 1;  1TY0 A;  5BN3 A;  3G71 A;  3T4A C;  2A6E D;  4PQX A;  4DR4 Q;  4CDF C;  4DR1 L;  1IKM A;  1F9S A;  4NXN Q;  3OW2 A;  3BJU A;  4DV3 L;  2CH4 A;  3AQQ A;  1KNA A;  2IX0 A;  3S16 B;  2HD3 A;  3M4Q A;  4DUY L;  4P72 A;  2KVM A;  5FLX c;  1QIL A;  3OHX C;  3NEM A;  3ULP A;  3CXC A;  1RIP A;  3NEN A;  4JBW A;  4C56 C;  4O2D A;  2A6H D;  2QIL A;  1WTR A;  2HQE A;  1KNE A;  4X3K A;  1TWH B;  1WYD A;  4GOP B;  4OO1 H;  1V43 A;  3S1Q B;  1RKN A;  4IUQ A;  2I5M X;  4TQU S;  1JB3 A;  5C3X A;  2F0D A;  3HKZ G;  4XQJ A;  3L2P A;  1NTG A;  2MJ8 A;  3RN2 A;  2A69 D;  2ZT9 C;  2D9U A;  2PPB C;  1VDZ A;  1D7Q A;  1C9O A;  2MO0 A;  4MNO A;  5J3B A;  4QMG A;  4DV4 Q;  1VQE A;  1T5X D;  3NBH B;  1S5D D;  4KHP L;  2VNU D;  3BVM A;  3F2C A;  5C4Z A;  1VQN A;  2RCF A;  4JBK A;  4A3I H;  1B9N A;  2F3V A;  1VQO A;  3CCU A;  1Z47 A;  2UUA L;  2A68 C;  5C4X H;  4R8N A;  2FXQ A;  4LNQ A;  1JOO A;  4X62 Q;  3KF8 A;  3SDZ A;  5K5P A;  4K0K L;  4R4Q A;  1KLU D;  3AMU A;  4DV1 L;  1E2Z A;  2VQF Q;  1PZK D;  2MO1 A;  1NR4 A;  1S5C D;  4QUC A;  3DWP A;  4JBJ A;  2NVT B;  3VDY A;  1VCI A;  4LFB Q;  1UNS A;  3K0Y A;  4A3E B;  2MQH A;  1H9R A;  3VR6 A;  1PTO C;  2N3S A;  3U50 C;  5FO8 B;  4WJ3 M;  3HP3 A;  1I50 H;  2L11 A;  1ZEQ X;  4FO2 A;  1X6O A;  4DNI A;  1N32 Q;  3U9O A;  3T16 A;  5CC4 A;  2ZJR A;  2WB1 E;  2HHH L;  4HIK A;  3RZD H;  1K83 H;  5LMN W;  1HR0 L;  2KED A;  3PO3 G;  1EIF A;  3OMG A;  5EPL A;  4DA2 A;  5HGQ A;  3I73 A;  3CP0 A;  3N52 A;  3FKI G;  5JJI A;  4B9W A;  1Y1W B;  4A3B B;  4K5V A;  3R93 A;  5GRO A;  5EQ0 A;  4C3H B;  1HNX L;  5CV6 A;  3S17 B;  2F0S A;  2VZA A;  5CV7 A;  4JI0 Q;  1VQL A;  2F3I A;  2ES2 A;  1FR3 A;  2DJF C;  3C1E A;  2GVA A;  1JWU D;  2I5H A;  3F2U A;  2PNH A;  2O2L D;  4RFB A;  3RZO H;  2Q8R E;  2F0Q A;  5ISR A;  2E2I H;  1PH2 A;  5EKI A;  4B3T L;  1NNX A;  2YYZ A;  1N34 Q;  4YY3 Q;  2E76 C;  3OIP A;  1XYI A;  4LMQ D;  4KY5 A;  5ELC A;  4FYD A;  5LL6 X;  4IFD J;  3UE1 A;  1EY7 A;  2MP1 A;  1N33 L;  3TEH B;  1QNK A;  3D0F A;  5T1G A;  5IP7 G;  2R7Z G;  1S5E D;  3MEF A;  1XNQ Q;  3KYH C;  5IGF A;  1D1K A;  1I4P A;  3AFQ A;  1WD1 A;  2CKZ B;  2WKC A;  3R3O A;  1G8Z D;  1SJE D;  4K2K A;  5EGT A;  4IFD H;  1AE2 A;  5FLX L;  1P16 A;  2Q8T A;  4UDU C;  1ZYR C;  5FKA C;  4YCW A;  1PMR A;  2F0W A;  4YCV A;  3S2H B;  4JG2 A;  5CMD A;  1VQG A;  4O1N A;  2E5L L;  3LNN A;  2VUM B;  2EXD A;  2KCM A;  1SNC A;  2OXP A;  5I6W A;  3RD4 A;  3OIQ A;  4IPC A;  1X3E A;  4X64 Q;  3NQT A;  1JJ2 A;  1XPR A;  3KLW A;  2JP1 A;  3HOY B;  2N49 A;  2E74 C;  1HCZ A;  3B6Y A;  3H91 A;  3F2B A;  1L1O B;  2AKW B;  1BCP C;  4JI8 Q;  2R92 B;  4PMB A;  1AZQ A;  1CT1 D;  2NBF A;  1TQO A;  2EXZ A;  3MEH A;  1U4M A;  2L0C A;  2WAQ B;  1KDC A;  4LF4 Q;  3HOW G;  1NAP A;  1TS2 A;  1BDO A;  1BBW A;  2A1A A;  1V1Q A;  3ND9 A;  1B3A A;  4FF4 A;  1JWM D;  2DNE A;  2B2U C;  4X3T A;  3CCM A;  4HIM A;  3TS0 A;  1WTO A;  3FPU B;  5CYU A;  2R3Z A;  1DGS A;  3ND8 A;  5DAU A;  4A3K B;  4DR6 L;  2NVY B;  4N8F A;  1WTQ A;  1JOK A;  3QG1 A;  1ENF A;  2R6G A;  4RMF A;  3VR3 A;  1E3P A;  1K8M A;  4R4T A;  2EZV A;  2EYO A;  1MSH A;  4GOP A;  1EIH A;  3NWS A;  2Z6B A;  5C0X I;  1I4X A;  1R9T H;  4GNX C;  1A2T A;  4OON A;  4IO9 A;  4A75 A;  2JA5 G;  5LHY 1;  2KA7 A;  1VQA A;  3IRB A;  1ILP A;  1FGB D;  3BYT B;  1CKN B;  4JI3 Q;  2HIV A;  3S1N B;  1CTM A;  1B70 B;  4AYB E;  5C44 G;  2B2Y A;  2E2H H;  3AYH B;  3NBH A;  4EVO A;  5IYB H;  4HJ7 A;  1PDQ A;  1O7L A;  1MD2 D;  5IT9 c;  4CKB A;  3TRZ A;  2JA5 B;  1XMO L;  1RL2 A;  3PF4 A;  1KAA A;  3TP7 A;  4GS3 A;  2EYJ A;  3CCR A;  2JA7 B;  1Q82 C;  1IXR A;  3FVQ A;  1HA6 A;  3K7U C;  4C1N I;  2ZTD A;  3R8B A;  4OIJ A;  1YVC A;  4LF6 Q;  5M3F H;  4J15 A;  4A3G B;  4LF5 Q;  1PTO F;  1J9O A;  3HOX B;  1YNN D;  1SE8 A;  4FDB A;  1QVC A;  1S5F D;  3TP5 A;  4CJ0 B;  1WTW A;  2Y0S G;  4FF3 A;  1W3S A;  2QKI C;  1PH9 A;  4R8I A;  4KKT A;  3CD6 A;  1EUJ A;  2L12 A;  1VMP A;  1J5E L;  2Z1C A;  2WP8 J;  2YTX A;  3G6E A;  5DEH A;  2DNC A;  5COR A;  1IBK Q;  1N36 L;  3ZJY C;  3A0J A;  2NYZ D;  3LWU A;  1K3B C;  3T1H L;  1LTL A;  1WOC A;  3PMF A;  4HCS A;  1XPU A;  1CZW A;  5IYD H;  4N8X 1;  3S1Q H;  2A6E C;  3CMA A;  5IP9 H;  3FRP B;  1NBW A;  4X6A H;  3HKZ E;  4KTA A;  2Z6K A;  3D3R A;  1LTB D;  1WTV A;  3M4O B;  1JQY D;  1SEB D;  1HQR D;  5JPM C;  1HZA A;  4TKO B;  1STB A;  1PH6 A;  2IY5 B;  2MHV A;  2CWA A;  1AFP A;  4JI1 L;  2ZTE A;  4B3R Q;  1GUT A;  4XYO A;  4GOP C;  4E6I A;  4K8J A;  3CHB D;  1VQB A;  1ENC A;  2A6H C;  3UI2 A;  1E2W A;  2N8N A;  2VQE Q;  3I4N G;  3HOZ G;  1OXT A;  4IUU A;  2ID0 A;  1LUZ A;  2A69 C;  4EQP A;  1HQM C;  2UXB L;  1JIC A;  1XMQ Q;  3I70 A;  1TS4 A;  1AP0 A;  4I65 A;  1KAW A;  2HDL A;  1W6J A;  4QB4 A;  1QVG A;  1CZG A;  2OWO A;  2NVT H;  1E2V A;  3D4R A;  1VQK A;  3GTM H;  1A3V A;  1PHJ A;  1EY5 A;  4MTN A;  3CME A;  4RKL A;  4ID6 A;  3U9S A;  2NTT A;  1UEB A;  5DNF A;  5C5M A;  2E2J B;  1OXU A;  4ZAI A;  1FD7 D;  2XN9 C;  3DHQ A;  2LY7 A;  1ET9 A;  3NTI A;  3MWY W;  1DOK A;  4EQO A;  4CDE C;  3SK6 A;  2NVQ B;  4X65 Q;  2YV5 A;  1HUN A;  1EWC A;  2B8F A;  1PFB A;  3CCV A;  3M4P A;  4ZKC B;  1KIX A;  4DK3 C;  2CCZ A;  1DZ1 A;  1S5B D;  3T56 B;  2ATW A;  3P7J A;  1GUG A;  4F7X A;  1Y14 B;  5KND A;  2JXM B;  1Y1W H;  4JI5 Q;  4A3B H;  4A3D H;  3HKS A;  2NUC A;  4C3H H;  2D0P A;  1BCP F;  2F0E A;  2K5W A;  4C1N K;  1XXG A;  3PO2 G;  1STH A;  1L1O A;  2SEB D;  1GXD C;  2RHS B;  1TWF B;  1J8I A;  4IZ8 A;  4YWM A;  5EPK A;  2F0O A;  1CSQ A;  1F2M A;  3E9I A;  4DGZ A;  1PH5 A;  2VS1 A;  1B44 D;  3HOV G;  4DR5 Q;  2NZ1 D;  2DN8 A;  1AEX A;  3Q24 A;  1Q7Y C;  1HFN A;  2KBN A;  4JI2 Q;  3M3Y H;  1V8Q A;  1ICF B;  1HZC A;  4EX5 A;  1SYF A;  3RN5 A;  4DR7 L;  4WJW A;  2CWP A;  2BA0 A;  4KI0 A;  1NR2 A;  5LMU L;  2EY6 A;  2FFK B;  2B2V C;  2WB1 B;  1XNR Q;  1VF7 A;  3OWF A;  5KYL A;  2EIF A;  1Q8K A;  5C0X H;  3KJP A;  3I7F A;  4BBS B;  1UAP A;  4XDX A;  3ICE A;  1D6E C;  3HG9 A;  1QZG A;  1BVS A;  4CJ1 B;  1IW7 D;  1IBM Q;  4EGV A;  5IGC A;  3BVG A;  1DOL A;  2F0N A;  2L55 A;  2LXK A;  2B8G A;  3DEP A;  1CKN A;  4DFA A;  2PMZ E;  4QQB X;  4A3J B;  5T1I A;  3S2H H;  3ERQ A;  2KQ3 A;  4L5Q A;  2VUM H;  1D8L A;  1OXX K;  2RSN A;  3UDG A;  1SYE A;  1I94 Q;  3CW2 C;  3TS2 A;  2QDB A;  4DV7 L;  1I4Q A;  1HXY D;  1HNZ Q;  1UE1 A;  3HOY H;  1FJG Q;  2AUJ D;  1D5Z C;  1SE3 A;  1Y8N B;  4JW0 A;  3CKI B;  4BXX H;  5IIF A;  2KHI A;  2RDF A;  1R4Q B;  1Y1V G;  2R92 H;  3TP6 A;  4UY8 C;  3G48 A;  4XT1 B;  1YNX A;  4DAP A;  4JI4 Q;  4IFD G;  1C4Q A;  1L0X B;  4HTH A;  3S2D B;  2R93 H;  4DKA C;  5KGU A;  5J1Z A;  4IPD A;  2ENB A;  4WOR A;  5M5Y B;  1B2T A;  2XSC A;  4L6T B;  3Q8D A;  1EWI A;  3STB D;  1MIU A;  2C5C A;  3TDQ A;  1QWY A;  4B3M L;  1CI3 M;  3PIO A;  3KOJ A;  1IYU A;  3H0G B;  3I4M G;  4LUO A;  1IL2 A;  5LL6 S;  1A3T A;  5CBE E;  5BR8 Q;  5FLM H;  2K52 A;  4K5W A;  2L5T A;  1X3G A;  1I4G A;  3WWV A;  1FNU A;  1TII D;  2TMP A;  1BQQ T;  1K8G A;  2NTS A;  1G6Z A;  2EY1 A;  3K5L A;  3CCL A;  3OPO A;  4YWL A;  1X3F A;  4DR4 L;  1LLR D;  5LMN Q;  1EIY B;  4NDX A;  1VQ8 A;  3S1N H;  4NXN L;  2PZT A;  3MXN B;  3PV0 A;  2ZM6 Q;  4IOC A;  3PSI A;  4V0B A;  1MSG A;  3T53 B;  4GN3 B;  1VQ9 A;  3CRL C;  1ET6 A;  1TU2 B;  2A74 C;  5I2Y A;  4RGN A;  2XGT A;  2JA7 H;  3S1R B;  1SJH D;  3X3N A;  1FGU A;  3E9H A;  5KRU A;  1LT3 D;  4C2M B;  3I56 A;  3CRK C;  4FNF A;  4LWC A;  5E4W C;  2K5H A;  1TS5 A;  2JYO A;  4X3S A;  4A3G H;  1SAP A;  4Z9C B;  4DV0 Q;  2JA9 A;  1D2B A;  1LV9 A;  4B9X A;  3HOX H;  2RF4 A;  1I6H B;  2FHT A;  2UU9 L;  2KUM A;  4BY1 G;  3EFX D;  1I4H A;  3ONA B;  3Q0A A;  2AQ1 B;  4CKE A;  2Y0S E;  4DUZ Q;  5FJ8 H;  2JA8 B;  3DWA A;  2F0F A;  4NKL A;  4KHZ A;  4XTC S;  1II3 A;  1H9K A;  4C3I H;  4U68 A;  5K36 G;  5CGK A;  2SOB A;  2YTY A;  3MVV A;  3BYY B;  3K57 A;  4HID A;  5ELD A;  2B3G A;  2V1C C;  2M2L A;  1C48 A;  4AYB B;  3S1M B;  2K28 A;  1Q1B A;  2C9O A;  2VQF L;  2HDM A;  4XQN A;  2O5I C;  1Q46 A;  1YNN C;  5EPJ A;  2XRS D;  1HH2 P;  3URY A;  1SRU A;  3F8T A;  3JAM E;  2LFN A;  1U0L A;  3I4L A;  3GTG B;  1WCM B;  4JV5 Q;  3KLS X;  4LFB L;  1U5K A;  1VQF A;  1O7Z A;  5GAD C;  4O42 A;  1ROD A;  4A3F G;  5M3F G;  1W6K A;  3AB9 A;  2ALY B;  1CHQ D;  2EDG A;  5JJZ A;  3QR8 A;  1N32 L;  2JA6 H;  3VR5 A;  4A93 H;  1STE A;  1CHP D;  4P71 A;  3DM3 A;  4JK1 C;  4I7Z C;  1S40 A;  1GUN A;  1D5X C;  2JK8 A;  2M9V A;  2R7F A;  1KHI A;  4RA8 A;  3PIO 3;  1DOM A;  3QJY A;  2Q2T A;  3PGZ A;  3RMH A;  3BS1 A;  2UXD Q;  4QF4 A;  4A76 A;  5IOD A;  3BG3 A;  1SRO A;  1X3P A;  3UDF A;  2UUC L;  4RKB A;  1TR5 A;  1O80 A;  4JI0 L;  4HR7 B;  1HA5 A;  2BE5 D;  2K05 A;  2CVR A;  4OHJ A;  1H9S B;  3ZYY X;  2NB0 A;  1MGS A;  5D3D A;  5FO7 B;  4HJ8 A;  1L2F A;  1EYA A;  1F9P A;  2IW3 A;  3HKZ B;  2EQS A;  4TSS A;  4A3C H;  2NVQ H;  5C3W A;  2NZO A;  3I2Z A;  4H7B A;  2F0T A;  4N9T A;  4BWG B;  1SDF A;  1HUM A;  5C4J H;  3GTO B;  4IPH A;  1IKL A;  2OT2 A;  3TSS A;  3GV3 A;  1XNQ L;  1A63 A;  2B29 A;  2EJM A;  3ULL A;  2PZU A;  1RHP A;  3GTQ H;  1QJO A;  2SNM A;  3WDN A;  5M3M G;  5H1S E;  2FIN B;  1H9J A;  1TWF H;  1SYC A;  1ILQ A;  1DM0 B;  2ASB A;  5EKL A;  3TZD A;  3J7Z C;  4HMJ A;  1YEZ A;  4KY7 A;  3H3V I;  2JEA I;  3U58 A;  4ILW A;  3MXG A;  2PW7 A;  1PZJ D;  3PCO B;  5M3M B;  1VF5 C;  4KJN A;  3UE0 A;  2IT1 A;  3I91 A;  4X64 L;  2GA4 B;  2X6L A;  5IOC A;  1BOS A;  1MHW C;  3M85 A;  1Q81 C;  4DV2 Q;  5GAG C;  3T1Y Q;  2KJX A;  2NN6 G;  2A8V A;  5JEA H;  2Z4H A;  2ZXO A;  4DV3 Q;  4BBS H;  1C8C A;  1EQV A;  1EZ8 A;  3PO3 B;  1OTC A;  4JI8 L;  1UE5 A;  1X55 A;  2BOS A;  3C1F A;  2PI2 E;  1PRT F;  2NZH A;  3FKI B;  1NE3 A;  4J8Q A;  1PFS A;  1PH1 A;  4A3J H;  2F52 A;  4MIU A;  2KEE A;  3M9B A;  1NMF A;  3AFP A;  3D4W A;  4RAU C;  1VQ4 A;  3MXN A;  4LW1 A;  2DGY A;  1JCK B;  1KDA A;  4DK1 A;  2IX3 A;  4GKJ Q;  3PQI A;  5C3E H;  1YI2 A;  2F0L A;  3NBI A;  2WV6 D;  4RCN A;  2RKS A;  1A6X A;  4BBR G;  5DM7 3;  1IW7 C;  1MI2 A;  1A2U A;  1AN8 A;  5D3I B;  1F9Q A;  1G91 A;  4P2C B;  3MXP A;  4U67 3;  1S4Z A;  2HCI A;  2DJG C;  3G6J B;  3JAM L;  2D62 A;  4GLX A;  1T9H A;  4YCU A;  2IHE A;  4AQY Q;  4DV6 Q;  4JI3 L;  5A2Q E;  3GTP B;  1CSP A;  4P73 A;  2QEJ C;  2RQX A;  1WD0 A;  3H15 A;  1LTG D;  2GN5 A;  2K5Q A;  1WVL A;  2R7Z B;  1TXY A;  1LAB A;  3SK5 A;  4HCE A;  3L0O A;  1VQJ A;  2X6G A;  1YJW A;  3QO2 A;  1I5F A;  4CBV A;  3H0G H;  2K01 A;  2PMZ B;  1EOV A;  4DF7 A;  4FXK C;  2A5H A;  2VB3 X;  4NP5 A;  4FF1 A;  2D0O A;  3VR2 A;  3RUZ A;  3T51 B;  4LF5 L;  3D8G A;  1R4P B;  2HHH Q;  2EY5 A;  4C3J G;  3K80 C;  1JJC B;  2EYH A;  5I9P A;  1QNU A;  2G9D A;  4BXX G;  3STB C;  2E75 C;  4BY7 G;  2J7Z A;  1QZH A;  4GLV B;  3QOL A;  4HJ5 A;  2KCN A;  4XYQ A;  1X54 A;  3NHH A;  3TBI B;  1EU3 A;  3MAQ A;  2R93 G;  4RGM A;  1ESR A;  2WII B;  1IBK L;  3P1H A;  4QIW E;  1Z6H A;  5I9O A;  4PNY A;  3TQY A;  4JI7 Q;  1HNW Q;  3S1R H;  3TN2 A;  1GHJ A;  3DM1 A;  3CC4 A;  1LTA D;  2OQK A;  3HOW B;  1ICW A;  2RCN A;  1Q90 A;  2B63 G;  1BBX C;  5FLM G;  2OCE A;  5BN5 A;  3K6O A;  3I90 A;  2E2D C;  4OX9 Q;  4OEL B;  4POG A;  2MGS A;  1SFO B;  1H9S A;  2XNA C;  3NXW A;  4Q0F A;  4B3R L;  2K5V A;  1UWV A;  4UPA A;  2V4D A;  4PZ7 A;  3X3M A;  2CW0 D;  3EQL C;  4DPG A;  4PMW A;  3BU2 A;  2KOL A;  2VQE L;  3FP9 A;  4A3M H;  1TT2 A;  1IBL Q;  3V2T A;  2F0M A;  3QIA A;  3S1M H;  1ASZ A;  2F0G A;  3SHL A;  4LUZ A;  5C44 B;  4ZYS A;  1X32 A;  1STG A;  3GP7 A;  1EY8 A;  1Z7T A;  4IUP A;  3WOF A;  1LTS D;  2F0U A;  4IAL A;  1WCM H;  1XPO A;  2H1E A;  2OTL A;  4R9W A;  1SNM A;  1XWE A;  3S9W A;  1PH8 A;  3PUX A;  1TWA B;  2K5D A;  2RDG A;  2HUG A;  1YJN A;  2B2W A;  1XTC D;  1IYV A;  3H3V H;  1PFN A;  1LAC A;  5A35 A;  1TS3 A;  4WRD A;  2K33 A;  3PUY A;  2WIN B;  3S16 H;  2AWN A;  1LTI D;  2IPK D;  4X65 L;  3F1Z A;  3VYT A;  3BDL A; 
#chains in the Genus database with same CATH homology
 2EYM A;  4C3I G;  4ZUI A;  4LAA A;  3M7N A;  3J81 E;  5ELB A;  2Y0S B;  2AWO A;  2K1B A;  3J80 E;  3BVZ A;  3GTL B;  2OF1 A;  3S15 B;  4HED A;  4ABN A;  2KEC A;  1JE4 A;  3KLR A;  5HUR A;  3Q6S A;  1TY2 A;  5M5X B;  4FVM A;  1EY6 A;  1HTP A;  3GTJ B;  1HPC A;  4N9P A;  3I72 A;  4RGT A;  1ESF A;  4G7H C;  2B2Y C;  3W2D A;  1SE2 A;  3K59 A;  2BE5 C;  3BDO A;  2ZXP A;  4NMZ A;  4DXF A;  3PUV A;  4OO1 G;  4G57 A;  3I4N B;  3HOZ B;  1T5E A;  2I46 A;  2VXW A;  2K32 A;  5AFW A;  2EVB A;  5CV5 A;  3IL8 A;  3M4Y A;  1M4V A;  2ICI A;  3FEW X;  3A8K E;  2EE1 A;  5G3L D;  3V05 A;  5KNC A;  3SVM A;  5D65 A;  5FO9 B;  3C46 A;  2J4X A;  1SMY D;  1STY A;  3HRZ C;  4B08 A;  1ONL A;  2EYP A;  3GTK B;  3SXH A;  1PTO B;  1EFI D;  4XQQ A;  4RH6 A;  1RTN A;  4XT3 B;  2RVL A;  4L8J A;  4KV6 A;  4DNT B;  1NCV A;  3PO2 B;  2F0J A;  5C0X J;  4ODG A;  4OL7 A;  3MTS A;  3HOV B;  3D4D A;  1WTX A;  1Y8P B;  3NK9 A;  2XWB B;  3D6W A;  2IX1 A;  1RJT A;  1HRJ A;  2DY8 A;  2PW5 A;  1TKW B;  3Q22 A;  3L3O C;  4G7Z C;  1XX8 A;  5EBD A;  3FDT A;  1PYW D;  3WOE A;  3NSW A;  1OXV A;  1SYB A;  3QOJ A;  1G2S A;  5EKK A;  4DXG A;  1LTR D;  3C2P A;  2FMC A;  1KLG D;  3J80 L;  4CGY B;  5IGG A;  4S3S A;  4NW2 A;  3RZO B;  2CHB D;  2F0H A;  5JVH 3;  5KYI A;  4L63 B;  4HSV A;  1TVX A;  2A73 B;  5JOB A;  1Y1V B;  1U9R A;  1G29 1;  1GUO A;  3PUZ A;  2HCC A;  3MFY A;  5C5L A;  1BF4 A;  4CJ2 C;  5KEE A;  1Q1E A;  2SNS A;  3VR4 A;  2L9H A;  1WTP A;  1EU4 A;  2VB2 X;  2F1M A;  1QG7 A;  2M00 A;  1BCP B;  3VA5 A;  1PZI D;  3I4M B;  3DEO A;  1DON A;  1CA6 A;  3EA6 A;  3S14 B;  1VMC A;  5IGB A;  1EEF D;  3P75 A;  1V1P B;  4TRD A;  4RHR A;  2JSO A;  1G2T A;  4ZK9 B;  4H44 C;  4QIW B;  1SE4 A;  1JR0 D;  4RCO A;  3E5S A;  2CW0 C;  1DJR D;  1JC7 A;  4OIK A;  4ZUJ A;  2F03 A;  1KDB A;  4ME5 A;  1JOR A;  3PUW A;  1Q3L A;  1SYD A;  5EBC A;  1EZ6 A;  4BY1 B;  1R9T B;  1ZKO A;  1SNO A;  4KD3 A;  1STA A;  4IFD I;  1CQV A;  4RHS A;  3K5N A;  4ZKB B;  1B53 A;  1Q8I A;  4ULL A;  3J7Y W;  2MUY A;  1EWH A;  3QWN A;  1B1Z A;  5CBA E;  3CU7 A;  3OW7 A;  2AUK A;  1RF2 D;  4IUT A;  5JVG 3;  1QB5 D;  3V96 A;  4PV1 C;  2EYF A;  4A3F B;  5M3F B;  3OOC A;  4KN4 C;  5FLX E;  1EQT A;  3K5O A;  4V19 0;  5TSS A;  4FP5 D;  3MXU A;  4KMU C;  1GUW A;  3HGB A;  1CM9 A;  2B39 A;  4UAI A;  1O7Y A;  2F0P A;  3BZD B;  2I07 B;  3C3L A;  2IJ0 A;  4DAV A;  1STN A;  1DYQ A;  2D5D A;  4DU9 A;  2EPB A;  4J1M A;  4KD4 A;  3R2I A;  1I4R A;  1Q12 A;  5E3F A;  4LJZ C;  1PXU A;  1F2Z A;  2N55 A;  3NE5 B;  4YIJ A;  2H4O A;  3NPP A;  1PTO H;  1UEA B;  2KHS A;  4EQN A;  3I8Z A;  4K5X A;  2FJ2 A;  4RGO S;  1KTK A;  2XIW A;  3A56 A;  5JEA J;  4G4K A;  3KBG A;  3GTM B;  1SMY C;  1EL0 A;  1U4L A;  1LT4 D;  2NVX B;  3A7L A;  4J6H A;  4DNR B;  1LT6 D;  3L9A X;  4C3H G;  1EY9 A;  4ZLT F;  3H6M A;  1YNJ D;  2BCO A;  3VYS A;  3D6C A;  5CR3 A;  3CQZ B;  3AU7 A;  3KUP A;  4Q5V A;  1U4R A;  4A3D B;  2Z8L A;  3SK8 A;  1D1I A;  3VYU A;  1D5M C;  1QE6 A;  4K2L A;  2B2U A;  2N88 A;  3E6Z X;  1BUV T;  1V1P A;  4BA2 I;  4Y7N B;  2KCC A;  2X69 A;  3DMU A;  1F2Y A;  2YU9 B;  2EJF C;  4ZRZ A;  1A3U A;  1AW7 A;  5C0X G;  1OO9 B;  2J0T D;  3M3Y B;  4BBR B;  3IKJ A;  5COY A;  3N6R A;  2XWJ B;  4DK0 A;  4G7O C;  1EYC A;  3ITP A;  2D2C C;  3K5M A;  3NTK A;  2RDH A;  2FMM A;  1L0Y B;  2PNR C;  4XXE A;  2CQA A;  2AQ3 B;  5EJW A;  1A15 A;  1CQF A;  1Y69 U;  3ERO A;  3BDC A;  1QOH A;  4DAY A;  2G9H D;  1SNP A;  1F9R A;  3K58 A;  1DD2 A;  1PFM A;  2NN6 I;  4C3J B;  1EYD A;  2DY7 A;  3A7A B;  2K04 A;  2QCP X;  3GO5 A;  3SK4 A;  4BY7 B;  3LWE A;  1SYG A;  1BO0 A;  4KJO A;  5M5W B;  3K7A B;  1TWC B;  2LKV A;  3LX0 A;  3OSO A;  1BNZ A;  2R93 B;  5KNB A;  3KK7 A;  3MHB A;  4CKC A;  1I6V C;  4RWS C;  1EOT A;  3KBX A;  2PCF B;  4CHT B;  4FXD A;  4QCL A;  1PRT D;  3E0J A;  4KK7 A;  5CV4 A;  1DCZ A;  4IUR A;  1GJX A;  1PRT B;  2B63 B;  1F2L A;  3NWT A;  3DXJ C;  1BR9 A;  1M8A A;  5IT9 E;  2AQ2 B;  4PMC A;  1SBB B;  5K36 H;  3NP8 A;  1SSO A;  2Q8I B;  1TWG B;  2EY2 A;  1X3Q A;  5M9O A;  1B9M A;  2PYK A;  2Z4I A;  1EEI D;  5D14 A;  2ICE C;  5G3L F;  1CFM A;  3TME A;  3I3C A;  2EYL A;  4K6L A;  2F4I A;  3TP8 A;  2IWH A;  3VA7 A;  1DXM A;  2K7V A;  3HEJ A;  3IFT A;  5FK9 C;  5ELE A;  3IFD A;  3IAY A;  1JOQ A;  2JEB I;  5IGE A;  3H3V C;  1B50 A;  2L1B A;  3A54 A;  2PZW A;  2XRQ D;  5C6A A;  3HOU B;  4C3I B;  4X3U A;  1FYC A;  4IUN A;  4KN7 C;  4F88 A;  1I3Q B;  1SXT A;  5A2Q L;  4IUV A;  1E0B A;  4M8A A;  3OMC A;  1JWS D;  4KY6 A;  3TZU A;  1ENA A;  1EY4 A;  2B2T A;  2IL8 A;  5JAV A;  1ZXT A;  1HFG A;  1NUC A;  3VYR A;  2R61 A;  1GOZ A;  2JE6 I;  3SR1 A;  3FMC A;  1OXS C;  1RCV D;  2B2V A;  2JA6 B;  2ZXR A;  4A93 B;  2PQE A;  2O4X A;  1HTL D;  1UUP A;  2A68 D;  3H94 A;  2B2W C;  1IL8 A;  2BDN A;  1QCB D;  4F8M A;  1PLF A;  4XIG S;  5E4X A;  4HSP A;  1PTO D;  1ML0 D;  2WAC A;  4A3I B;  5C4X B;  1GHK A;  5C4J B;  2NN6 H;  5DM6 3;  3O13 A;  2O5J C;  4FF2 A;  5I6Y A;  3MFG A;  3NUC A;  4BA1 I;  3H09 A;  3P20 A;  1EIG A;  4HN7 A;  1B4O A;  3GTQ B;  4IQZ A;  3KLS A;  3RLF A;  4FXG C;  3L7Z C;  3MA2 B;  5IT9 L;  1RD9 D;  1I50 B;  3DUZ A;  2B2T C;  2LMC B;  1YNJ C;  5J22 A;  4WFN 3;  5JEA G;  3EVQ A;  3RZD B;  1K83 B;  3FPP A;  2WKD A;  2RBM A;  1IHZ A;  5ELF A;  3A55 A;  1K8O A;  2MPM A;  3HS0 C;  1F77 A;  1CK1 A;  4K6D A;  4OO1 I;  1EY0 A;  3J81 L;  2BA1 A;  3Q23 A;  3D31 A;  1KAB A;  3W3A A;  3NTH A;  5NUC A;  4DN4 M;  3OWE B;  5IGD A;  3J7A V;  2E2I B;  1U4P A;  3GV6 A;  5C3E B;  4HAE A;  1ZYR D;  1Y8O B;  5E1F A;  1O78 A;  2L4N A;  4H13 C;  1SNQ A;  5JPN C;  4GZY C;  1FNW A;  2F0K A;  4F87 A;  3GD7 A;  4HMI A;  5KIX A;  3MZ5 A;  4K14 A;  4KKU A;  1BCP D;  2F0V A;  3SEB A;  3J7A F;  3DWQ A;  2PO4 A;  3PIP 3;  3A8J E;  2XVS A;  3HZX A;  3T13 A;  4IN3 A;  1BXT A;  1RTO A;  3NQI A;  2K6A A;  1HHV A;  3EJI A;  5HGT A;  3QB3 A;  2EJG C;  2K03 A;  1MBY A;  4M1U B;  1V1O A;  1LO5 D;  2NWG A;  4QUF A;  4ZQ3 A;  2OEO A;  1PRT C;  2F3W A;  4BS9 A;  3A8I E;  4MN3 A;  2RA4 A;  4KKS A;  5I4D A;  4KHV A;  3MC0 B;  5F2D A;  4H0L C;  3R2T A;  4MHE A;  3M7G A;  1GUS A;  3SE0 A;  5FOB B;  2SDF A;  2QF7 A;  2EOT A;  2F0I A;  3G7L A;  5CV8 A;  4OGQ C;  5I2X A;  1SND A;  1CA5 A;  3GQB A;  1FNV A;  2BDO A;  2E2H B;  5J39 A;  5CV9 A;  1RDP D;  1H9M A;  5C4H A;  4A3M B;  1LTT D;  1LT5 D;  1AZP A;  1NSN S;  2TSS A;  4LK1 C;  5BN4 A;  2RSO A;  4K8I A;  2LS0 1;  1TY0 A;  5BN3 A;  3T4A C;  2A6E D;  4PQX A;  1IKM A;  1F9S A;  1KNA A;  2IX0 A;  3S16 B;  2KVM A;  1QIL A;  3OHX C;  4JBW A;  4C56 C;  2A6H D;  2QIL A;  1WTR A;  2HQE A;  1KNE A;  4X3K A;  1TWH B;  4OO1 H;  1V43 A;  3S1Q B;  1RKN A;  4IUQ A;  4TQU S;  1JB3 A;  5C3X A;  2F0D A;  4XQJ A;  2MJ8 A;  2A69 D;  2ZT9 C;  2D9U A;  2PPB C;  1VDZ A;  4QMG A;  1T5X D;  1S5D D;  2VNU D;  3BVM A;  5C4Z A;  1B9N A;  2F3V A;  1Z47 A;  2A68 C;  4R8N A;  1JOO A;  3KF8 A;  3SDZ A;  5K5P A;  3AMU A;  1KLU D;  1E2Z A;  1PZK D;  1NR4 A;  1S5C D;  4QUC A;  3DWP A;  2NVT B;  1VCI A;  1UNS A;  3K0Y A;  4A3E B;  1H9R A;  3VR6 A;  1PTO C;  5FO8 B;  3HP3 A;  2L11 A;  1ZEQ X;  4FO2 A;  3U9O A;  3T16 A;  5CC4 A;  2KED A;  3OMG A;  5EPL A;  4DA2 A;  3I73 A;  3N52 A;  4B9W A;  1Y1W B;  4A3B B;  4K5V A;  3R93 A;  5EQ0 A;  4C3H B;  5CV6 A;  3S17 B;  2F0S A;  5CV7 A;  1FR3 A;  3C1E A;  1JWU D;  3F2U A;  2O2L D;  4RFB A;  2Q8R E;  2F0Q A;  5ISR A;  5EKI A;  2YYZ A;  2E76 C;  3OIP A;  1XYI A;  4LMQ D;  4KY5 A;  5ELC A;  4FYD A;  5LL6 X;  4IFD J;  1EY7 A;  2MP1 A;  1QNK A;  5T1G A;  1S5E D;  5IGF A;  1D1K A;  1I4P A;  1WD1 A;  2WKC A;  3R3O A;  1G8Z D;  1SJE D;  4K2K A;  5EGT A;  4IFD H;  5FLX L;  2Q8T A;  4UDU C;  1ZYR C;  5FKA C;  1PMR A;  2F0W A;  3S2H B;  5CMD A;  4O1N A;  3LNN A;  2VUM B;  1SNC A;  2OXP A;  5I6W A;  3RD4 A;  3OIQ A;  3NQT A;  2JP1 A;  3HOY B;  2E74 C;  1HCZ A;  3H91 A;  1BCP C;  2R92 B;  4PMB A;  1AZQ A;  1CT1 D;  2NBF A;  1TQO A;  2EXZ A;  3MEH A;  1U4M A;  2L0C A;  2WAQ B;  1KDC A;  1NAP A;  1TS2 A;  1BDO A;  3ND9 A;  1B3A A;  4FF4 A;  1JWM D;  2DNE A;  2B2U C;  4X3T A;  1WTO A;  3FPU B;  5CYU A;  2R3Z A;  3ND8 A;  4A3K B;  5DAU A;  2NVY B;  1WTQ A;  1JOK A;  3QG1 A;  1ENF A;  2R6G A;  3VR3 A;  1K8M A;  2EZV A;  2EYO A;  1MSH A;  1EIH A;  3NWS A;  5C0X I;  1I4X A;  1A2T A;  5LHY 1;  2KA7 A;  1ILP A;  1FGB D;  3BYT B;  3S1N B;  1CTM A;  2B2Y A;  3NBH A;  4EVO A;  1PDQ A;  1O7L A;  1MD2 D;  4CKB A;  2JA5 B;  1KAA A;  3TP7 A;  2EYJ A;  2JA7 B;  3FVQ A;  1HA6 A;  4C1N I;  3R8B A;  4OIJ A;  4A3G B;  1PTO F;  1J9O A;  3HOX B;  1YNN D;  1S5F D;  3TP5 A;  4CJ0 B;  1WTW A;  4FF3 A;  2QKI C;  4R8I A;  4KKT A;  2L12 A;  1VMP A;  2Z1C A;  2WP8 J;  5DEH A;  2DNC A;  5COR A;  2NYZ D;  3LWU A;  3PMF A;  4HCS A;  1CZW A;  2A6E C;  3FRP B;  4KTA A;  3D3R A;  1LTB D;  1WTV A;  3M4O B;  1JQY D;  1SEB D;  1HQR D;  5JPM C;  4TKO B;  1STB A;  2MHV A;  1AFP A;  1GUT A;  4XYO A;  4E6I A;  4K8J A;  3CHB D;  2A6H C;  1ENC A;  3UI2 A;  1E2W A;  1OXT A;  4IUU A;  2ID0 A;  2A69 C;  4EQP A;  1HQM C;  1JIC A;  3I70 A;  1TS4 A;  1AP0 A;  4I65 A;  2HDL A;  1W6J A;  4QB4 A;  1CZG A;  1E2V A;  3D4R A;  1A3V A;  1EY5 A;  4RKL A;  4ID6 A;  3U9S A;  2NTT A;  5DNF A;  5C5M A;  2E2J B;  1OXU A;  4ZAI A;  1FD7 D;  2XN9 C;  3DHQ A;  2LY7 A;  1ET9 A;  3NTI A;  3MWY W;  1DOK A;  4EQO A;  2NVQ B;  3SK6 A;  1HUN A;  1EWC A;  2B8F A;  1PFB A;  4ZKC B;  1DZ1 A;  1S5B D;  3T56 B;  3P7J A;  1GUG A;  4F7X A;  5KND A;  2JXM B;  2NUC A;  1BCP F;  2F0E A;  2K5W A;  4C1N K;  1XXG A;  1STH A;  2SEB D;  1GXD C;  1TWF B;  1J8I A;  4IZ8 A;  5EPK A;  2F0O A;  1F2M A;  4DGZ A;  1B44 D;  2NZ1 D;  2DN8 A;  1AEX A;  3Q24 A;  1HFN A;  1V8Q A;  1SYF A;  4WJW A;  2BA0 A;  4KI0 A;  1NR2 A;  2EY6 A;  2FFK B;  2B2V C;  2WB1 B;  1VF7 A;  3OWF A;  5KYL A;  5C0X H;  4BBS B;  1UAP A;  4XDX A;  1D6E C;  3HG9 A;  4CJ1 B;  1IW7 D;  4EGV A;  5IGC A;  3BVG A;  1DOL A;  2F0N A;  2L55 A;  2B8G A;  3DEP A;  4DFA A;  4A3J B;  5T1I A;  3ERQ A;  2KQ3 A;  1OXX K;  2RSN A;  1SYE A;  2QDB A;  1I4Q A;  1HXY D;  2AUJ D;  1D5Z C;  1SE3 A;  1Y8N B;  3CKI B;  5IIF A;  2RDF A;  1R4Q B;  3TP6 A;  4XT1 B;  4DAP A;  4IFD G;  1C4Q A;  1L0X B;  4HTH A;  3S2D B;  5KGU A;  5J1Z A;  5M5Y B;  2ENB A;  4WOR A;  1B2T A;  2XSC A;  4L6T B;  3TDQ A;  2C5C A;  1QWY A;  1CI3 M;  1IYU A;  3H0G B;  5LL6 S;  1A3T A;  5CBE E;  4K5W A;  2L5T A;  1I4G A;  1FNU A;  1TII D;  2TMP A;  1BQQ T;  2NTS A;  1G6Z A;  2EY1 A;  3K5L A;  3OPO A;  1LLR D;  4NDX A;  2PZT A;  3PV0 A;  4V0B A;  1MSG A;  3T53 B;  3CRL C;  1ET6 A;  1TU2 B;  2A74 C;  5I2Y A;  4RGN A;  3S1R B;  1SJH D;  3X3N A;  5KRU A;  1LT3 D;  4C2M B;  3CRK C;  4FNF A;  5E4W C;  1TS5 A;  2JYO A;  4X3S A;  1SAP A;  4Z9C B;  1D2B A;  1LV9 A;  4B9X A;  1I6H B;  2FHT A;  2KUM A;  3EFX D;  1I4H A;  3ONA B;  3Q0A A;  2AQ1 B;  4CKE A;  2JA8 B;  3DWA A;  2F0F A;  4NKL A;  4KHZ A;  4XTC S;  1II3 A;  1H9K A;  4U68 A;  5K36 G;  5CGK A;  2SOB A;  3MVV A;  3BYY B;  3K57 A;  5ELD A;  2M2L A;  1C48 A;  4AYB B;  3S1M B;  2K28 A;  1Q1B A;  2C9O A;  2HDM A;  4XQN A;  2O5I C;  1YNN C;  5EPJ A;  2XRS D;  3URY A;  3JAM E;  2LFN A;  3I4L A;  3GTG B;  1WCM B;  3KLS X;  1O7Z A;  4O42 A;  1ROD A;  1W6K A;  3AB9 A;  1CHQ D;  2EDG A;  5JJZ A;  3VR5 A;  1STE A;  1CHP D;  4JK1 C;  4I7Z C;  1GUN A;  1D5X C;  2M9V A;  4RA8 A;  3PIO 3;  1DOM A;  3QJY A;  3RMH A;  3BS1 A;  4QF4 A;  5IOD A;  3BG3 A;  1X3P A;  4RKB A;  1TR5 A;  1O80 A;  4HR7 B;  1HA5 A;  2BE5 D;  2K05 A;  2CVR A;  3ZYY X;  4OHJ A;  1H9S B;  2NB0 A;  1MGS A;  5D3D A;  5FO7 B;  1EYA A;  1F9P A;  2IW3 A;  3HKZ B;  4TSS A;  5C3W A;  4H7B A;  2F0T A;  4N9T A;  4BWG B;  1SDF A;  1HUM A;  3GTO B;  1IKL A;  2OT2 A;  3TSS A;  3GV3 A;  2EJM A;  2PZU A;  1RHP A;  1QJO A;  2SNM A;  3WDN A;  2FIN B;  1H9J A;  1SYC A;  1ILQ A;  1DM0 B;  5EKL A;  3TZD A;  4HMJ A;  4KY7 A;  2JEA I;  4ILW A;  3MXG A;  2PW7 A;  1PZJ D;  5M3M B;  1VF5 C;  4KJN A;  2IT1 A;  3I91 A;  2GA4 B;  2X6L A;  5IOC A;  1BOS A;  3M85 A;  2KJX A;  2NN6 G;  5JEA H;  2Z4H A;  2ZXO A;  1C8C A;  1EQV A;  1EZ8 A;  3PO3 B;  2BOS A;  3C1F A;  1PRT F;  3FKI B;  4J8Q A;  4MIU A;  2KEE A;  3D4W A;  4RAU C;  3MXN A;  1JCK B;  1KDA A;  4DK1 A;  2IX3 A;  2F0L A;  3NBI A;  2WV6 D;  4RCN A;  2RKS A;  1A6X A;  5DM7 3;  1IW7 C;  1MI2 A;  1A2U A;  1AN8 A;  5D3I B;  1F9Q A;  1G91 A;  4P2C B;  3MXP A;  4U67 3;  1S4Z A;  2HCI A;  3G6J B;  3JAM L;  2D62 A;  5A2Q E;  3GTP B;  2QEJ C;  2RQX A;  1WD0 A;  1LTG D;  2K5Q A;  1WVL A;  2R7Z B;  1LAB A;  3SK5 A;  4HCE A;  2X6G A;  3QO2 A;  4CBV A;  2K01 A;  2PMZ B;  4DF7 A;  4FXK C;  2A5H A;  2VB3 X;  4NP5 A;  4FF1 A;  3VR2 A;  3RUZ A;  3T51 B;  3D8G A;  1R4P B;  2EY5 A;  4C3J G;  2EYH A;  5I9P A;  1QNU A;  2G9D A;  2E75 C;  2J7Z A;  3QOL A;  2KCN A;  4XYQ A;  3NHH A;  3TBI B;  1EU3 A;  3MAQ A;  4RGM A;  1ESR A;  2WII B;  3P1H A;  1Z6H A;  5I9O A;  4PNY A;  3TN2 A;  1GHJ A;  3DM1 A;  1LTA D;  3HOW B;  1ICW A;  1Q90 A;  1BBX C;  5BN5 A;  3K6O A;  3I90 A;  2E2D C;  2MGS A;  1SFO B;  1H9S A;  2XNA C;  3NXW A;  4Q0F A;  2V4D A;  3X3M A;  2CW0 D;  3EQL C;  4PMW A;  2KOL A;  1TT2 A;  3V2T A;  2F0M A;  3QIA A;  2F0G A;  3SHL A;  5C44 B;  4ZYS A;  1X32 A;  1STG A;  3GP7 A;  1EY8 A;  1Z7T A;  4IUP A;  3WOF A;  1LTS D;  2F0U A;  4IAL A;  2H1E A;  4R9W A;  1SNM A;  1XWE A;  3S9W A;  3PUX A;  1TWA B;  2RDG A;  2HUG A;  2K5D A;  2B2W A;  1XTC D;  1IYV A;  1PFN A;  1LAC A;  5A35 A;  1TS3 A;  4WRD A;  2K33 A;  3PUY A;  2WIN B;  2AWN A;  1LTI D;  2IPK D;  3VYT A;  3BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...