4RHSA

Crystal structure of gd2 bound pltb
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVSKQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALVGLSSCSATQCFGPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative pertussis-like toxin subunit
publication title Host adaptation of a bacterial toxin from the human pathogen salmonella typhi.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Sugar binding protein
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rhsA00
1S5CD 1ET6A 1G8ZD 5FK9C 5I4DA 1PTOF 2G9HD 3SEBA 4Z9CB 1HA5A 1ET9A 1HTLD 1EU4A 1KLGD 4L6TB 3DWAA 1D5XC 1BCPD 1RD9D 3DWPA 1V1PB 1HXYD 1L0XB 1LTAD 1B1ZA 1JCKB 1LTID 1FD7D 4O1NA 1PRTC 1JWMD 1T5XD 1LT3D 1XXGA 1D5MC 1ENFA 1I4QA 1SE3A 3EA6A 2XRSD 3BYYB 4RH6A 1I4HA 1EU3A 1LTRD 2ICIA 2O2LD 4RGMA 1PZID 1TS3A 4RCOA 1SE2A 1PZJD 1LTBD 1PTOC 1FGBD 2XNAC 1S5ED 1JWUD 1PTOH 1XTCD 1TY2A 2XRQD 3BVZA 1PRTB 2RDHA 3DWQA 4RHSA 1V1PA 1HQRD 5ELDA 4DXFA 3BVGA 1FNUA 4BWGB 3BZDB 1LO5D 5D3DA 1SJHD 5FKAC 3MC0B 1LTTD 1EFID 1TS2A 1DYQA 3O13A 1CK1A 1RDPD 3R2TA 1BCPC 1PTOB 1SJED 1SXTA 1I4RA 3R8BA 4RGNA 1BCPF 2AQ2B 1D5ZC 1L0YB 1AW7A 1JQYD 1S5DD 2IJ0A 2WV6D 3URYA 1LTSD 5ELCA 2QILA 5ELBA 3MFGA 1FNWA 1LT5D 1SBBB 1LTGD 1UUPA 1KLUD 2QEJC 3OWEB 1BCPB 4ZYSA 1GOZA 1CHQD 1BXTA 2IPKD 3CHBD 1EEFD 1TS4A 1D6EC 1QILA 1KTKA 5ELEA 4RGOS 1TY0A 3EFXD 4DXGA 1LT6D 2SEBD 4RGTA 3BYTB 4UDUC 1LLRD 1V1OA 4L63B 3TSSA 1EWCA 2J4XA 4K6LA 1JWSD 2R61A 4RHRA 3V05A 2AQ1B 2NTSA 1B44D 1CHPD 1CQVA 1SE4A 1I4GA 1I4PA 1LT4D 3R2IA 2CHBD 1MD2D 1F77A 2XN9C 1PRTD 5D3IB 4OHJA 1M4VA 1SEBD 1RF2D 3GP7A 4TSSA 1TS5A 3BVMA 3KLSX 5ELFA 1RCVD 2Z8LA 1STEA 1PRTF 1S5BD 2RDGA 2NTTA 1AN8A 5TSSA 1PZKD 3W2DA 1PTOD 1FNVA 1I4XA 1JR0D 1PYWD 2TSSA 1S5FD 4C56C 2AQ3B 1CT1D 1DJRD 4RFBA 1ESFA 1UNSA 1EEID
chains in the Genus database with same CATH superfamily
2K4KA 1VS0A 3J80i 4Z9CB 3D6CA 2VZAA 1VQNA 3RD4A 1XMOL 4Q0FA 2R7ZH 1V1PB 1TWGB 5CC4A 2N49A 2Z0SA 1IZ6A 4HSPA 2E74C 4UAIA 3ERQA 4P75A 1ESRA 1SE3A 2B2UC 2K14A 1EY4A 5LHY1 1QOHA 1LTRD 4QQBX 2N88A 1PZID 1CQFA 4KD4A 1OTCA 2OTJA 1T5EA 1PLFA 4MIUA 1PRTB 3N52A 2K28A 3DM3A 1C7YA 4NW2A 1IBML 1AE2A 1QVCA 2UXCL 5IP9G 3C3LA 5M3MB 1EY9A 1BCPC 1EFWA 3HOUH 4NMZA 3PO3G 2Y0SB 4C2MH 2HIVA 1S5DD 4A3BB 3CAMA 3MFGA 1K0RA 3D3RA 4A3DG 2MUYA 4ZYSA 2B2VC 4HIDA 1TS4A 1PH1A 2F52A 3A56A 2A6ED 4FF2A 4O42A 3ER0A 2OCEA 1G291 1LM0A 4KJNA 4IUTA 3VR6A 3HOXH 1LT6D 4LNQA 4IJHA 1CUKA 4Q5VA 2F0IA 1U4MA 4CJ0B 3BYTB 1NY4A 3NSWA 1SNCA 4L63B 1EQRA 2PQAA 4H44C 1W3SA 1JWSD 2F0SA 3V05A 5C5MA 5C3EB 3F2BA 4CHTB 1IYVA 1Z7TA 2KEEA 2NTSA 2AMCB 1TXYA 3U58A 4UPAA 2F0FA 3E9HA 4GNXC 4OO1I 2O5JC 5BR8Q 1B3QA 4BBRG 4ID6A 1F9PA 1CI3M 3RR5A 4PZ8A 1BVSA 4YIJA 2CCZA 1FVIA 2YTYA 4TSSA 2Q8TA 1S5BD 2NTTA 5C0XI 3TZDA 4BBSG 3UE1A 2AUJD 2UXBL 1I50B 1ZYRD 3QOLA 1QJOA 1UNSA 5CV5A 1L2FA 1ET6A 4IUPA 1Y8NB 1KAAA 2SNSA 2H5XA 4CKCA 4POGA 1ICWA 2H1EA 3DWAA 1N36Q 1CKNB 2IHEA 4KKSA 4OX9L 1B7YB 3U50C 1VQ9A 2A6HC 3MXUA 1JB7A 2UXDL 1EWHA 4JI4Q 1PRTC 4B3TQ 4A3KH 4KN4C 2LXJA 3RN5A 3TEHB 1XNRQ 4JI5L 4JV5Q 2O2LD 3J81E 2JEBI 2JJQA 4JI2L 2NYZD 3K80C 4RHSA 3G4SA 4LJZC 1FNUA 5ELNA 3D8GA 4QUCA 3KF6A 4A3JB 4DA2A 1TWFB 2X6GA 4S3SA 4DAMA 1DXMA 1HNWL 3K7UC 1HUNA 2EY6A 5M3FH 1M1KC 2ZM6Q 1BCPF 2AQ2B 1Q81C 4FXDA 1HZCA 2JA5B 1LTSD 3SDZA 2E75C 2KUMA 1N34Q 3HKZB 5I9PA 1SNQA 1EUJA 2PZWA 3PMFA 2BA0A 3M85A 2LFNA 2Z6BA 3C2PA 2VXWA 2JA7H 5ELOA 5C0XG 1HNXL 1PH8A 4CKEA 1KTKA 2E76C 4IPCA 1HR0W 4GN4B 2AHOB 1Y1WG 1A0IA 1TWCB 1V9PA 2FMMA 1OXVA 4DV7L 4DAYA 2PNHA 2QF7A 3GDEA 1J8IA 3I70A 3UDIA 2KCMA 4U68A 3NENA 3VYTA 2JA9A 1JJGA 4ZCKA 1QVGA 2JA6H 3DEOA 1S4ZA 5IYCG 1EIFA 3R2IA 4C3JG 1A2UA 4V0BA 4QY7A 1YI2A 1QVFA 4HR7B 2F0KA 3CD6A 4GLAC 2MO1A 1I6HH 4XQJA 2FHTA 4C3HB 3CCQA 3GTKB 1Y14B 3K7AB 3OWFA 4P72A 4UY8C 2FMCA 1HZBA 2IT1A 2Z8LA 5JEAH 5TSSA 3JAMi 3T13A 1I4XA 4XQQA 2RHQB 3H3VH 1DJRD 4HAEA 5L37A 3FPUB 2Z6KC 2NN6I 3P20A 4GN5A 1L1OC 3SK6A 1PTOF 3NEMA 2OT2A 1X3EA 2VUMH 5JPNC 1SMYC 3I90A 5KGUA 3HG9A 3GTGH 3AYHB 1KDAA 1LTAD 4TKOB 5IWAQ 1QB5D 1EZ8A 1MHWC 3OMGA 4DNIA 1NJIC 5IGCA 3TRZA 4DV0Q 4FXKC 4FF3A 1HHVA 1N32Q 2F0VA 2JQOA 2YTVA 1SE2A 4LF6Q 2XNAC 1PTOH 1STAA 1VQMA 5EKLA 3S15B 3GTMB 1JE4A 3M4QA 3TMEA 3I4MB 3HRZC 1NCVA 2OQ0A 3NUCA 3T1HQ 4XXEA 1YHBA 3H09A 4R8IA 2DY8A 4IPGA 2NVYB 4HMJA 3CPWA 2JA8G 4A3EH 4A3FG 1VQOA 1D5ZC 1L0YB 4JI1L 3S14B 4X64L 1VQEA 1H9MA 1JJCB 2HCIA 4KD3A 4DR1Q 4A3LH 1LT5D 1IBKL 4LF8Q 5CBEE 5M5WH 3MXGA 2EPBA 4C3IB 3S1RH 5FO9B 5JVG3 1LV9A 1F9QA 4A3IH 3HOYG 5JJKA 4DAPA 2IWHA 3Q0AA 2ZXRA 1CKMA 4AYBE 1W6KA 3J80c 2M00A 1KNEA 2NN6G 4K0KL 4QB4A 2ZJRA 4PG3A 3I56A 1S3OA 4RWSC 2EYPA 4RKLA 1RL2A 3EVQA 1J9OA 3Q24A 4LF4L 1KXLA 5CMDA 2KENA 1K9MC 4GKJQ 3VA5A 4J1MA 5IYBG 3KBXA 1GVPA 4O2DA 4DUYQ 2R92G 1VQ8A 3PF4A 4X3KA 1C4QA 5G3LD 1X65A 3BVMA 2F4IA 1OXTA 1RCVD 2R3ZA 4XQNA 4DV7Q 4FF1A 2WINB 1YBYA 3TQYA 1PH9A 2XTIA 2A69D 2VB2X 2ID0A 2EJGC 1A3TA 4L8JA 5CV7A 3MA2B 2E8GA 1DOMA 2K01A 3P7JA 5IIFA 3NK9A 2K5NA 1X55A 5IP9H 1BQQT 4B9WA 1Q82C 3S2DH 3DWPA 3PO3H 1QNKA 1DZ1A 3GO5A 4R4QA 3HOVB 1WTRA 3FVQA 1LTID 4ZRZA 3OMCA 4DNTB 3B6YA 3LGJA 2A74C 3J7YW 1I4QA 2EYHA 3E6ZX 1SFOB 3D4RA 3UDXA 5KNBA 4DKAC 3HOXG 2N55A 2R7ZB 3MTSA 1X3FA 5FLXE 2K5HA 4H0LC 4KHZA 4CDDC 4DF7A 4ZQ3A 2HT1A 2VL6A 4I7ZC 4LW1A 3BVGA 3TP5A 3LWEA 2XIWA 1GHJA 4JI8Q 2H4OA 1VQ5A 4DV3L 1LTTD 1MJCA 3JC66 3MXNA 2PMZE 4ABNA 3HOZH 2F0WA 4N8X1 4KHPL 5LL6X 4LMQD 2IX3A 4DV6Q 2CKZB 1IHZA 5M5XH 3NPPA 2IJ0A 3A7AB 4HJAA 1C48A 4HEDA 1HNZQ 4O0AA 4OXPA 2DJFC 2K33A 4BBRH 4TRDA 1TWAH 4LFBQ 1Q86C 1OXXK 1K73C 1QUQA 1NBWA 3VYRA 1UAPA 3OTOQ 4DXGA 5COYA 4BBSH 3KBGA 4IFDJ 4EGVA 1QUQB 1JOQA 5JJLA 1PMRA 2F0LA 5J1ZA 5HURA 3OIPA 4YY3L 3PUYA 1EY6A 4RCNA 2XWBB 4JVZA 1IBLL 3AU7A 4A3KG 4IALA 2GVBA 2UUBL 5JVH3 2HD3A 1U9RA 1YIJA 1WTHA 2F0HA 1E2VA 2K5WA 3Q6SA 2OXPA 1BUVT 1JOOA 2L4NA 4OEMB 2F0DA 2EYFA 3S1NH 4KTAA 3EROA 3WOFA 4BA2I 1ENCA 2QDBA 3CMEA 4JCVE 4LK1C 2PYKA 3L0OA 2FFKB 1JE5A 1KC8C 1B4OA 1EY8A 2WAQE 5M3FG 1B9NA 3I73A 3H6MA 1PH5A 1B50A 1YNJC 1G8ZD 5EGTA 1K3BC 2YTXA 3I4NB 2C5CA 1PYBA 1UEBA 1YHAA 1XWEA 1WVLA 2LKVA 1RD9D 2B8FA 1UWVA 3A74A 1EYGA 4OO1H 2EYMA 2RKSA 1D8LA 1X6OA 1E22A 3NQIA 1JICA 1EU3A 3FKIG 5IODA 4B3SQ 4GZYC 2X69A 4B08A 1WTXA 1VQDA 4Y52H 1PZJD 5IE8A 1ZXTA 1XPOA 3U9SA 5C0XH 3CU7A 1XTCD 4HJ8A 3DWQA 4A3GH 1UE5A 2ZXOA 1HFGA 4QF4A 1Y1WH 4XT1B 2EOTA 1VQKA 4Y7NH 1NR4A 5LMNQ 4ILWA 1RIPA 3C1EA 2SNMA 5IT9E 2L15A 1CZWA 4K5WA 3R8BA 1U4PA 3CQZH 5KYIA 3TREA 2WAQG 1WTPA 1YNND 1V1QA 3QIAA 4UP9A 4H02A 1OO9B 1D7QA 3OSOA 5IGDA 4DK6C 3PSIA 3NTKA 3MVVA 1FNWA 4XYQA 5IYCH 4C3JH 3P75A 3OWEB 1GOZA 2IPKD 5C44B 3OW2A 3EIVA 1E1OA 2CFMA 1HTPA 4B9XA 2MO0A 5EPKA 3EFXD 2EQSA 2YV5A 4JI6Q 3PIP3 4L5TA 2RHSB 1E3PA 1LLRD 1EWCA 1EQTA 2JN4A 1B70B 2R61A 2HDLA 1K8AC 4PZ7A 4P2CB 1K28A 2OQKA 4RG1A 2F3IA 4FYDA 2EXZA 2DUDA 2NZHA 4HSVA 5BR8L 2KA7A 3QOJA 3UDFA 5EPLA 2XN9C 5CGKA 4K2LA 4OHJA 2PZUA 2MFIA 1EY5A 1XMQQ 3DEPA 1G2TA 2JA6B 2JK8A 2JP1A 5DM63 2F0EA 2KOLA 1A6XA 5G3LF 3KF8A 4OWWB 4GOPB 3J81L 1PYWD 1FNVA 1EYAA 3HZXA 4NXNQ 3DMUA 4U673 4H13C 2K52A 1HTLD 4A3LG 4KMUC 1IW7D 4KJOA 1VCIA 4XIGS 1N36L 4GNXA 1HXYD 4A3FH 2F0OA 5DLQE 3H0GB 5C4JH 3GTPB 4DR5Q 2BDNA 4A3IG 1ENFA 4JI4L 2VUMB 4DR6Q 1TVXA 4B3TL 3GTJH 5E7NA 4JOIC 3LWUA 1XNRL 4CJ1B 4JV5L 3RLOA 1CKOA 3I55A 1Y1VG 3HOYH 1V1PA 1DOKA 4WJ4A 4IUNA 1PFBA 2NN6H 2Q8IB 3PO2B 1FJGL 3FP9A 1PTOB 3STBC 1IL8A 1K8OA 4F8MA 2ZM6L 3MAQA 4R4IA 1EY7A 1HCZA 1XPRA 2K5QA 3S1MH 2QILA 1PH7A 4HCEA 1SBBB 3ONAB 2RQXA 5IYBH 1GUNA 1N34L 2R92H 1B2TA 4A3EB 4LUVA 1QILA 2KHJA 4ME5A 2AUKA 4KN7C 5A35A 1DONA 4RMFA 2Q8RE 3V96A 1KDCA 1CM9A 3M3YH 1PV4A 3KYHC 2B2TC 1YEZA 1WTWA 1K83H 4UP7A 5M5YB 3W1BA 3EJIA 4GOPC 2F0MA 1Y8OB 4X3UA 2ZXPA 1M4VA 5KYLA 3FPPA 2JE6I 3NTIA 4IO9A 1STEA 1P16A 5F2DA 3CXCA 3HOZG 3HKZE 4DAVA 3CCVA 3H3VC 3CRLC 1T5XD 3A0JA 3HEJA 1O7ZA 3E9IA 1HA5A 3MWYW 1ET9A 3A7LA 2L11A 1N8RC 1J5EQ 2D62A 3NBIA 4DUZQ 1EIYB 1JCKB 2KCNA 3W5OA 3M4YA 5GADC 2OTLA 1N33Q 5IWAL 2F0QA 4K5XA 3PQIA 2NVQH 5E4XA 3EBEA 2AWOA 2RCFA 3BYYB 4OL7A 1HRJA 1VQIA 3S2DB 1ENAA 1JJ2A 2C35B 4DV0L 3F8TA 2IW3A 3AB9A 1N32L 1HQMC 1PTOC 1SNMA 2D0OA 1Q3LA 1VQLA 1CKNA 4P74A 1YITA 4LF6L 1CSPA 2L9HA 3ULJA 5IY0A 1I3QH 1VQBA 2Z6KA 4BWGB 4DR3Q 2EZVA 4A3DB 1GUWA 5BN3A 2D5DA 3T1HL 1H9RA 1CSQA 3R2TA 1RDPD 1FL0A 1SXTA 1L1OB 3HKZG 4FXGC 2QW7A 1AE3A 2RSOA 5KRUA 1F9SA 4CDFC 1H9SB 3CC2A 2QDLA 4BY7H 1Q8KA 2CW0D 3SR1A 5C5LA 3LNNA 3J81i 2EY5A 2J0TD 2WB1B 3BS1A 1WCMG 4DR1L 1WD1A 2NVXH 5IGBA 2QEJC 4QJFA 1G2SA 2HHHL 4LF8L 1EEFD 3E0EA 1GUTA 3PIPA 5FOBB 3BDOA 1D6EC 1CA5A 5ELEA 1UE6A 2EDGA 1YJWA 1FJGQ 2KBNA 3ERSX 4BBRB 4HJ5A 3J7AV 1NNXA 1TWAB 3VR2A 2RVLA 3KJPA 3OOCA 4F88A 3ND9A 3GTLH 3U4ZA 4UDUC 3TSSA 4OO1G 3F2DA 1A3VA 2B63G 3H91A 2R7FA 2GN5A 3IFDA 1IYJB 2KCCA 5I2XA 4BBSB 1B44D 3SE0A 3ZJYC 4C1NK 3GTOB 4F87A 2E2IH 4GKJL 4DV1Q 4AIMA 4PQXA 2EYJA 4DUYL 4E6IA 3RNUA 2VS1A 3RZOB 1VQCA 1SEBD 3BU2A 4A3GG 1TS5A 2A6EC 1GO3E 3FKIH 2F0JA 2J7ZA 4DR2Q 2EYOA 1UE1A 4LWCA 1BOSA 3CCMA 2F0NA 1CT1D 1XYIA 3RLNA 1HPCA 2KEDA 4GLVB 3OYYA 3IKJA 2G5DA 2VB3X 4KLKA 3VYSA 5EBCA 2K03A 1A8VA 2WKCA 4HTHA 1R9TH 3M9BA 3C1FA 1E0BA 2XWJB 3BDCA 4P73A 4LF9Q 1VF5C 2F0PA 4N8FA 4FF4A 3RMHA 3J7ZC 4R4TA 2RA4A 2K05A 4OWTB 1F2ZA 1ZYRC 3A8KE 1KQSA 4LFAQ 3UDGA 1BDOA 1NTGA 1SJHD 4JI8L 1KRTA 1CK1A 1SN8A 3AEVA 1SYFA 5FLMG 4RGNA 2G9DA 3OPOA 4DV6L 2NBFA 1JQYD 2WV6D 4RKBA 4J8QA 2E2JB 4TVAB 3Q8DA 5ELBA 1C9OA 1HNZL 4HIMA 4EQNA 4R9WA 3GV6A 2M9VA 4IFDI 4LFBL 4GKKQ 1HH2P 1VQGA 4NXMQ 1BBWA 2HQEA 3NP8A 3CW2C 3X3MA 4ME3A 1IKLA 4QIWB 4C3JB 4GS3A 4X65Q 3OTOL 1WFQA 4G4KA 4AQYQ 3D4WA 1VQ6A 1TWHH 3T56B 1XX8A 2L12A 5IYDG 4LFCL 4NP5A 1CQVA 2HHHQ 4JBWA 2K7VA 5C4HA 3PUVA 1I4PA 2XSCA 2K75A 1VQ7A 5CR3A 4IURA 3TS2A 5D3IB 3CC4A 1GUSA 3DXJC 1M8AA 1PH6A 5DEHA 2YU9H 2F3VA 2M2LA 4M8AA 3CRKC 1K0SA 2RSNA 3PIO3 4YCUA 5I9OA 1Y1VH 2B8GA 3WDNA 3T16A 1QCBD 3RZDH 3S2HH 4AH6A 3TP8A 1WOCA 4A3BH 4DV5Q 4MN3A 1BO0A 3I4LA 1EZ6A 3CF5A 4FP5D 2IX1A 4L5SA 1CFMA 5JJZA 5IOCA 3M4OB 3S16B 4O1NA 3TZUA 2K5DA 4IUVA 2VY3A 4RH6A 4K6DA 2JA8B 3NELA 4B3SL 3VDYA 2BE5D 1DCZA 4CDEC 3KUPA 4A3FB 3TP7A 1LTBD 1BNZA 1FGBD 1ZKOA 1RKNA 4CGYB 3S17B 4QMGA 4L5RC 4F7XA 3NWTA 3GTQB 3GTJB 3BZDB 5FKAC 4AYBG 1HZ9A 1SYDA 1LACA 1SNOA 5LMNL 4YWLA 3TP6A 5J3BA 3HOYB 1SAPA 1Q1EA 3PV0A 2D0PA 2RF4A 5BN4A 5FO8B 2LXKA 3KDFB 5GAHC 1EIHA 4KKTA 4PNYA 5C6AA 1XPUA 2IY5B 1TIID 4KY5A 1MGSA 1RTOA 4OELB 1X32A 4YCWA 4J15A 4ZLTF 4IPDA 3EQLC 2R92B 5E4WC 3HP3A 3QWNA 4MHEA 4JI6L 3G6EA 4ZAIA 2WKDA 2RCNA 5BN5A 2Z4HA 1LYLA 5AJ3Q 1BR9A 4BA1I 3HOUB 4X66Q 2DJGC 2NZOA 4C2MB 1F77A 1SE8A 2PZTA 1STBA 4LAAA 1HA6A 3M3YB 1RF2D 2HCCA 5HY6A 1XMQL 2D2CC 1K83B 5CYUA 5ELFA 4ZK9B 5I6YA 2RDGA 3DLLA 1A3UA 1VMPA 1PZKD 1UE7A 4DR7Q 4LFCQ 1SNPA 1EEID 4X62Q 3HOXB 4OIKA 4ZUJA 4HIOA 4GN3B 2JEAI 2IX0A 4NXNL 4BY7G 4IOCA 1VF7A 3K0YA 4EQOA 1S40A 2SDFA 2HUGA 3D31A 2ZTEA 3J81c 1VQFA 3HOWG 1EYCA 4NB3A 5C4XG 4YHHL 1NSNS 4DR5L 5IGGA 1Q8IA 1WCMH 2I5LX 4DR6L 1GUGA 5FO7B 3HS0C 2PQEA 1R4PB 2F0UA 1TWCH 2A69C 1S5ED 5CV4A 2I5MX 3X3NA 5DM73 4NPSA 5ELDA 4QUFA 2E5LQ 2EIFA 5EPJA 3MC0B 5HGTA 1LTLA 2RBMA 4BY1G 3C46A 4A75A 2B63H 1I4RA 2HQLA 4I7AA 4HIKA 1GHKA 1X56A 5IP7G 5JJIA 3PUXA 1Q7YC 1SYGA 5ELCA 3NXWA 4C3HH 1VQHA 1YVCA 4LUOA 1RTNA 1LTGD 2HDMA 2B2WC 2RDFA 4L5QA 1OXUA 4KI0A 3J80L 3H94A 1A2TA 1SMXA 4JOIA 4A3KB 2Q2TA 1GKHA 2L55A 5DNFA 5CV6A 1SNDA 1TU2B 3A5UA 2TMPA 4A3MG 3L9AX 4M1UB 3S1QH 4DV2Q 3FHWA 2NVXB 2A68D 1F2MA 4DR4Q 2K50A 4XT3B 3T51B 5KIXA 4A76A 5KEEA 1QWYA 4K6LA 1DGSA 4A93G 1KHIA 2PNRC 2B2UA 2QGQA 2OF1A 3VA7A 2R93G 3CKIB 5M3FB 2Z1CA 1CZGA 3GTLB 3JAMc 3SGIA 3KLWA 2OWOA 1PH4A 3PIOA 3CCJA 5DAUA 4HJ7A 4DK3C 3HFZB 5T1IA 3GTMH 2E2IB 2JA7B 2MP1A 3UI2A 3I4MH 1ASZA 1MI2A 2ENBA 1L0WA 1S5FD 2F0TA 4RFBA 4DV4Q 2NVYH 2I0QA 3FKIB 1A63A 1I5FA 5I4DA 4YCVA 1E2WA 2E2DC 4P71A 1IYUA 4HMIA 1KLGD 2N8NA 2B2TA 1BCPD 4N9PA 5FLMH 3P1HA 1J5EL 4MTKA 4MZ9A 3DUZA 2B2VA 4DUZL 4GOPA 1F2LA 1PHJA 2Y0SE 1XXGA 1LUZA 3GQBA 1N33L 4B3RQ 1EOVA 4OGQC 3SK4A 4DGZA 4G7OC 2MQHA 4RGMA 3ND8A 4G7HC 1QZHA 4RCOA 1ONLA 1I6HB 3S24A 4OIJA 3BVZA 5JAVA 4IN3A 2A73B 2ICEC 1HR0Q 2PW5A 1X54A 2MGSA 1A62A 1B9MA 2UU9Q 4DR3L 1EQVA 1SDFA 2VQEQ 1TS2A 4FVMA 3L7ZC 1NUCA 2VQFQ 4LF7Q 5AFWA 4YHHQ 2A8VA 2Z4IA 1O78A 1BBUA 1B53A 2BCOA 5IYDH 2ES2A 2BH2A 3A5ZB 1AW7A 2EY2A 3CMAA 3GTGB 3A8IE 2UUAQ 2DNEA 2MPMA 5EQ0A 3K5NA 2O4XA 3FEWX 4A3CH 1Q90A 5M3MG 3Q22A 2R6GA 3PGZA 4LF5Q 4RGOS 3T53B 2Y0SG 4BXXG 4A3BG 4JYAQ 4APVA 4K8JA 1YHQA 2BH8A 5JEAJ 4LUZA 4IJLA 4JI0Q 2J4XA 2IHFA 1XNQQ 4XYOA 3HOVH 1AEXA 1YNNC 3J80E 5J22A 1AZQA 1I4GA 1SFOH 1AZPA 2A6HD 3V2TA 1TWHB 1ILQA 1JB3A 4UP8A 1PRTD 5GROA 4DV1L 4TQUS 4FDBA 3QB3A 5T1GA 2B2YC 1I94Q 1G91A 1SYBA 4IFDH 4JI3Q 1GD7A 1H9JA 3KLSX 4XTCS 1PFMA 1SROA 5M5WB 1C8CA 5C3EG 4POFA 4DFAA 1P8LA 3S1RB 1K8MA 2MHVA 3DM1A 4JBJA 3MEFA 1KRSA 4DR2L 4C56C 2WB1E 1O80A 4A3IB 2I5HA 3TDQA 4KV6A 3OW7A 1IL2A 2YU9B 1SYEA 2UUCQ 1D5XC 1NAPA 4JBMA 1SR3A 1Y1VB 2JSOA 2Q2IA 1ML0D 4HCSA 1L0XB 5FLXc 2KECA 4G7ZC 3RZDB 3S2HB 3F2CA 1DOLA 3J7AF 3IFTA 1LT3D 2D9UA 3FRPB 3K81C 3VR5A 1KDBA 4G57A 3D4DA 4LF9L 4RA8A 3AQQA 4RGTA 2L5TA 3NTHA 3MFYA 1STGA 2KJXA 1X3GA 5D3DA 1SRUA 3W1GA 4LFAL 1RODA 2I46A 4JK1C 1IW7C 1LABA 2F4VL 3VR3A 3K58A 4JW0A 1KAWA 2WB1G 3E5SA 3JAML 2VNUD 3I3CA 4HN7A 1K8GA 3PO3B 1QE6A 4JPBW 2NZ1D 2PQAB 1UUPA 4A3JG 4B3MQ 1PA6A 1BF4A 4ALPA 4JI7Q 1PXUA 2WACA 4GKKL 1U0LA 2KVMA 1L1OA 4NXML 3I4NH 2B29A 5JPMC 2JA5G 1H9SA 4X65L 5LMNW 1TR5A 2L0CA 1V1OA 1OXSC 1STYA 4AQYL 4RHRA 1KABA 2NVTH 1CHPD 1SMYD 1HJPA 3HOZB 4HJ9A 1STHA 1EWIA 3HOWH 5EKKA 1MD2D 2SOBA 3K6OA 5C4XH 5M5XB 3SHLA 1EQQA 3T1YQ 3MHBA 3J81j 1AN8A 1JC7A 1QZGA 1X3PA 2AQ3B 1CTMA 2P5ZX 3K5OA 3KK7A 1S5CD 5FK9C 2G9HD 4ZUIA 1II3A 3GV3A 4C3HG 1XMOQ 4ZKCB 4BY1H 3BZCA 4DV5L 4QIWE 1TKWB 3TS0A 1F9RA 1X9NA 5IP7H 1WTQA 3KF6B 1VDZA 3IL8A 5C44H 1F2YA 4X3TA 4IOAA 4KKUA 3NQTA 3I72A 2KCTA 3CP0A 2X6LA 2E2HH 3N6RA 2BA1A 1D1IA 5IT9c 2XRQD 3KFUA 2ZJQA 4A3MH 3BG3A 2A1AA 3S1NB 1HQRD 1WCMB 1IBMQ 1B3AA 1IXRA 2B39A 3CCUA 1PVOA 2ATWA 5K36H 1LO5D 4OONA 2UXCQ 3PCOB 3KJOA 2PCFB 3UE0A 2K1BA 4XDXA 3SVMA 3A55A 4A93H 3IAYA 1YJ9A 1YZ6A 2R93H 3A54A 4PMWA 4DAYB 3J7A5 3I4MG 3QR8A 2B63B 2CWAA 4RAUC 1BXTA 3CHBD 1XTDA 1ZEQX 4WJ3M 5IGFA 5JOBA 3I4OA 2FINB 3WOEA 1NMFA 4K14A 2F4VQ 1M90C 1BKBA 2Q2UA 1DM0B 1GJXA 3ITPA 3JAME 4A3GB 3CCRA 1Q12A 3PF5A 3ICEA 1Y1WB 3K0XA 3S1QB 4Y7NB 3K5MA 4NKLA 4WRDA 4C3IG 4CDCC 3H0GH 5FLXL 3SXHA 2CVRA 2AKWB 3GTPH 4V190 2CW0C 5AJ3L 5I6WA 1Y69U 1SE4A 1Z9FA 1C0AA 3CQZB 1FR3A 5GAEC 4X66L 1MBYA 2QA4A 2K5VA 2V1CC 4IQZA 2EJFC 4FNFA 4PV1C 3BDLA 3OHXC 2F0GA 4JC0A 1PRTF 2EVBA 2AWNA 2UXBQ 4EQ5A 1G6PA 2QKIC 3PO2H 2MJ8A 2HIXA 1TWGH 5E1FA 1E7ZA 4PMBA 4BS9A 4DR7L 1FGUA 5CV8A 4R8NA 5KNDA 5C0XJ 4X62L 1CA6A 1NMGA 5FJ8G 3M7GA 1A15A 1ICFB 3D0FA 4KHVA 2EE1A 4OX9Q 1RHPA 2BDOA 3PUZA 1QG7A 1EOTA 3I2ZA 2UXDQ 4R1JA 4A3CG 1KL9A 1JWMD 4EVOA 1EYDA 3L3OC 5ISRA 3GD7A 1JOKA 4JI5Q 1TQOA 2ICIA 1TS3A 4JI2Q 4ZKBB 2F3WA 1U5KA 3OIQA 3HGBA 5M3MH 5IGEA 2XVSA 3EN2A 4DXFA 3HOVG 2LSSA 4BXXH 4KY6A 2F1MA 1HNWQ 2V4DA 2E5LL 1PFNA 3L2PA 2LS01 1W2BA 4EX5A 5M5YH 3I91A 1VQPA 2R7ZG 1SYCA 1PH2A 4IFDG 4ODGA 1D1KA 2N3SA 2PI2E 5EAYA 3R93A 2PW7A 1GM5A 2EXDA 5GQOA 3M7NA 2DGYA 5C4JB 3CCLA 1HNXQ 2BOSA 1GXDC 4PMCA 3T4AC 4DU9A 3U9OA 2O5IC 5C3EH 2ALYB 1WTVA 2Z9HA 3KDFA 2CH4A 1O7IA 4DV2L 3G7LA 1FYCA 4NDXA 5GAGC 3R3OA 4DR4L 4FO2A 1VQAA 1DD2A 1YNJD 3HOUG 3H15A 3KLSA 1MSHA 2LMCB 4DPGA 3D6WA 2AQ1B 1J6QA 1UEAB 1EY0A 4WORA 1LT4D 2WIIB 2ZT9C 3M4PA 2B2WA 1V8QA 3S1MB 1I50H 1G6ZA 2LY7A 5IT9L 1H9KA 2KHIA 1HUMA 4A4IA 5C3XA 2ASBA 4X6AH 2ZTCA 1JT8A 4A3DH 2DN8A 5HGQA 3IRBA 1JORA 1O7LA 1U4RA 4MNOA 2K32A 4PZ6A 3PUWA 4DV4L 3MEHA 5D65A 4H7BA 4IZ8A 1YJNA 1VQJA 1R4QB 4C1NI 3BZKA 5E3FA 1B1ZA 1SSOA 1JMCA 1AH9A 4AYBB 2C9OA 1HZAA 2JYOA 1D5MC 3MXNB 3EA6A 2XRSD 4ULLA 2PI2A 2QCPX 4B3RL 4IUQA 4A3JH 3I4NG 2GVAA 3MXPA 4JG2A 1TWFH 5C3WA 2NWGA 3NHHA 4DNRB 1ASYA 1JWUD 1TY2A 3NWSA 5EJWA 2RDHA 2NB0A 3E3XA 1D2BA 1TT2A 1YNXA 2B3GA 1HR0L 2JA5H 5D14A 1PDQA 5LMUL 4WJWA 3CCEA 2UU9L 1WTOA 1DYQA 3QJYA 2VQEL 3GTOH 1WYDA 2WFWA 2VQFL 1KIXA 4LF7L 1SJED 1PH3A 3SK5A 3AMUA 4K5VA 2FJ2A 2KQ3A 2XGTA 4JI1Q 4CBVA 4DN4M 4X64Q 1XJVA 3G71A 3URYA 3K57A 1MJEA 1IKMA 1IBKQ 5A2QL 3RZOH 2IL8A 1WI5A 4YWMA 3RN2A 2UUAL 4X3SA 3TBIB 2DNCA 3FMCA 1NR2A 2BE5C 3LX0A 3TN2A 2NVQB 4QGUA 4CKBA 2I07B 1MIUA 2K6AA 1X3QA 4LF5L 3SK8A 3K59A 4GLXA 2WP8J 3H3VI 2SEBD 2A5HA 4K0KQ 4JYAL 1KD1C 1KNAA 1PFSA 3RLFA 3MZ5A 2GA4B 1N9WA 4QCLA 1I3QB 4JI0L 5C44G 4LF4Q 3KOJA 2EJMA 1XNQL 3DHQA 3ULLA 3GTKH 3K7AH 4YWKA 2ZJPA 5CV9A 1BBXC 3NBHA 3S9WA 1S72A 2CHBD 5I2YA 2L1BA 1WD0A 5LL6S 3NE5B 2JA7G 4BY7B 3G6JB 2N78A 4IUUA 3BJUA 3NBHB 3E0JA 2NVTB 3GP7A 1I94L 3VYUA 2PMZB 5K36G 5EKIA 4JI3L 5EBDA 3FDTA 1G51A 3WWVA 1QNUA 4KY7A 2PPBC 3W2DA 3HOWB 5C4XB 2CH4W 2CQOA 2TSSA 4R4CA 4J6HA 1JR0D 1AFPA 4OWXB 4N9TA 1Q46A 3I7FA 3AFPA 1SLJA 2FXQA 1Z47A 1I6VC 3SEBA 1E2ZA 2CWPA 4R4OA 2PO4A 5KNCA 1ILPA 1HFNA 1EU4A 5K5PA 4L6TB 2E2JH 3K8AA 2JA6G 3STBD 2UUCL 1NE3A 2KHSA 1FD7D 3F2UA 3F1ZA 3KLRA 3S15H 2B2YA 1I4HA 1T9HA 4BY1B 5H1SE 1K3RA 5JEAG 1AP0A 2VW9A 3Q23A 2EYLA 5C4ZA 3CPFA 3QO2A 2OEOA 4CJ2C 3H0GG 3S14H 4DV3Q 4MTNA 2YYZA 4K2KA 3CC7A 2E2HB 2JXMB 1EFID 2VUMG 2NUCA 3O13A 4KHPQ 1V43A 4A3MB 1B8AA 4C3IH 3RUZA 1O7YA 1ESFA 3G48A 1R9TB 2EY1A 4QL5A 1GUOA 3I8ZA 4UHVA 4DK0A 2WAQB 1E24A 1KLUD 1BCPB 4WFN3 4B3ML 1CHQD 3PO2G 2R7DA 3W3AA 4A93B 1PYSB 3ZYYX 5LMUQ 4I65A 4JI7L 1H95A 1VMCA 2R93B 1Q1BA 2F03A 4JBKA 3VR4A 1TY0A 1STNA 2CQAA 1RJTA 1EIGA 2K04A 4DK1A 4YY3Q 3K5LA 1MKHA 2QEXA 2A19A 1IBLQ 2Q2HA 1Y8PB 5A2QE 4A3EG 5FJ8H 3M4OH 3KF8B 1EL0A 4IPHA 5M9OA 5J39A 3S16H 4KK7A 5NUCA 2UUBQ 1MSGA 3U4VA 3CCSA 3HKSA 2JA8H 4EQPA 3A8JE 2DY7A 3T1YL 3ULPA 3QG1A 2MNAA 3S17H 3AFQA 4GNXB 4K8IA 3GTQH 1Z6HA 1W6JA 2A68C 5CBAE 2ZTDA 1VQ4A 1PTOD 1U4LA 5CORA 1E1TA 1WJJA
chains in the Genus database with same CATH topology
4Z9CB 3D6CA 3RD4A 4Q0FA 1V1PB 1TWGB 5CC4A 4HSPA 2E74C 4UAIA 3ERQA 1ESRA 1SE3A 2B2UC 1EY4A 5LHY1 1QOHA 1LTRD 2N88A 1PZID 1CQFA 4KD4A 1T5EA 1PLFA 4MIUA 1PRTB 3N52A 2K28A 4NW2A 3C3LA 5M3MB 1EY9A 1BCPC 4NMZA 2Y0SB 1S5DD 4A3BB 3MFGA 3D3RA 2MUYA 4ZYSA 2B2VC 1TS4A 3A56A 2A6ED 4FF2A 4O42A 1G291 4KJNA 4IUTA 3VR6A 1LT6D 4Q5VA 2F0IA 1U4MA 4CJ0B 3BYTB 3NSWA 1SNCA 4L63B 4H44C 2F0SA 1JWSD 3V05A 5C5MA 5C3EB 4CHTB 1IYVA 1Z7TA 2KEEA 2NTSA 2F0FA 4OO1I 2O5JC 4ID6A 1F9PA 1CI3M 4YIJA 4TSSA 2Q8TA 1S5BD 2NTTA 5C0XI 3TZDA 2AUJD 1I50B 1ZYRD 3QOLA 1QJOA 1UNSA 5CV5A 1ET6A 4IUPA 1Y8NB 1KAAA 2SNSA 4CKCA 1ICWA 2H1EA 3DWAA 4KKSA 2A6HC 3MXUA 1EWHA 1PRTC 4KN4C 2O2LD 3J81E 2JEBI 2NYZD 4RHSA 4LJZC 1FNUA 3D8GA 4QUCA 4A3JB 4DA2A 1TWFB 2X6GA 4S3SA 1DXMA 1HUNA 2EY6A 1BCPF 2AQ2B 4FXDA 2JA5B 1LTSD 3SDZA 2E75C 2KUMA 3HKZB 5I9PA 1SNQA 2PZWA 3PMFA 2BA0A 3M85A 2LFNA 3C2PA 2VXWA 5C0XG 4CKEA 1KTKA 2E76C 1TWCB 2FMMA 1OXVA 4DAYA 2QF7A 1J8IA 3I70A 4U68A 3VYTA 3DEOA 1S4ZA 3R2IA 4C3JG 1A2UA 4V0BA 4HR7B 2F0KA 4XQJA 2FHTA 4C3HB 3GTKB 3K7AB 3OWFA 2FMCA 2IT1A 2Z8LA 5JEAH 5TSSA 3T13A 1I4XA 4XQQA 1DJRD 4HAEA 3FPUB 2NN6I 3P20A 3SK6A 1PTOF 2OT2A 5JPNC 1SMYC 3I90A 5KGUA 3HG9A 1KDAA 1LTAD 4TKOB 1QB5D 1EZ8A 3OMGA 5IGCA 4FXKC 4FF3A 1HHVA 2F0VA 1SE2A 2XNAC 1PTOH 1STAA 5EKLA 3S15B 3GTMB 1JE4A 3TMEA 3I4MB 3HRZC 1NCVA 3NUCA 4XXEA 3H09A 4R8IA 2DY8A 2NVYB 4HMJA 1D5ZC 1L0YB 3S14B 1H9MA 2HCIA 4KD3A 1LT5D 5CBEE 3MXGA 2EPBA 4C3IB 5FO9B 5JVG3 1LV9A 1F9QA 4DAPA 2IWHA 3Q0AA 2ZXRA 1W6KA 2M00A 1KNEA 2NN6G 4QB4A 4RWSC 2EYPA 4RKLA 3EVQA 1J9OA 3Q24A 5CMDA 3VA5A 4J1MA 3KBXA 4X3KA 1C4QA 5G3LD 3BVMA 2F4IA 1OXTA 1RCVD 2R3ZA 4XQNA 4FF1A 2WINB 2A69D 2VB2X 2ID0A 2EJGC 1A3TA 4L8JA 5CV7A 3MA2B 1DOMA 2K01A 3P7JA 5IIFA 3NK9A 1BQQT 4B9WA 3DWPA 1QNKA 1DZ1A 3GO5A 3HOVB 1WTRA 3FVQA 1LTID 4ZRZA 3OMCA 4DNTB 2A74C 3J7YW 1I4QA 2EYHA 3E6ZX 1SFOB 3D4RA 5KNBA 2N55A 2R7ZB 3MTSA 5FLXE 4H0LC 4KHZA 4DF7A 4ZQ3A 4I7ZC 3BVGA 3TP5A 3LWEA 2XIWA 1GHJA 2H4OA 1LTTD 3MXNA 4ABNA 2F0WA 5LL6X 4LMQD 2IX3A 1IHZA 3NPPA 2IJ0A 3A7AB 1C48A 4HEDA 2K33A 4TRDA 1OXXK 3VYRA 1UAPA 4DXGA 5COYA 3KBGA 4IFDJ 4EGVA 1JOQA 1PMRA 2F0LA 5J1ZA 5HURA 3OIPA 3PUYA 1EY6A 4RCNA 2XWBB 3AU7A 4IALA 5JVH3 1U9RA 2F0HA 1E2VA 2K5WA 3Q6SA 2OXPA 1BUVT 1JOOA 2L4NA 2F0DA 2EYFA 4KTAA 3EROA 3WOFA 4BA2I 1ENCA 2QDBA 4LK1C 2PYKA 2FFKB 1B4OA 1EY8A 1B9NA 3I73A 3H6MA 1B50A 1YNJC 1G8ZD 5EGTA 3I4NB 2C5CA 1XWEA 1WVLA 2LKVA 1RD9D 2B8FA 4OO1H 2EYMA 2RKSA 3NQIA 1JICA 1EU3A 5IODA 4GZYC 2X69A 4B08A 1WTXA 1PZJD 1ZXTA 3U9SA 5C0XH 3CU7A 1XTCD 3DWQA 2ZXOA 1HFGA 4QF4A 4XT1B 2EOTA 1NR4A 4ILWA 3C1EA 2SNMA 5IT9E 1CZWA 4K5WA 3R8BA 1U4PA 5KYIA 1WTPA 1YNND 3QIAA 1OO9B 3OSOA 5IGDA 3NTKA 3MVVA 1FNWA 4XYQA 3P75A 3OWEB 1GOZA 2IPKD 5C44B 1HTPA 4B9XA 5EPKA 3EFXD 3PIP3 1LLRD 1EWCA 1EQTA 2R61A 2HDLA 4P2CB 4FYDA 2EXZA 4HSVA 2KA7A 3QOJA 5EPLA 2XN9C 5CGKA 4K2LA 4OHJA 2PZUA 1EY5A 3DEPA 1G2TA 2JA6B 2JP1A 5DM63 2F0EA 2KOLA 1A6XA 5G3LF 3KF8A 1PYWD 1FNVA 1EYAA 3HZXA 3DMUA 4U673 4H13C 1HTLD 4KMUC 1IW7D 4KJOA 1VCIA 4XIGS 1HXYD 2F0OA 3H0GB 3GTPB 2BDNA 1ENFA 2VUMB 1TVXA 3LWUA 4CJ1B 1V1PA 1DOKA 4IUNA 1PFBA 2NN6H 2Q8IB 3PO2B 1PTOB 1IL8A 1K8OA 4F8MA 3MAQA 1EY7A 1HCZA 2K5QA 2QILA 4HCEA 1SBBB 3ONAB 2RQXA 1GUNA 1B2TA 4A3EB 1QILA 4ME5A 2AUKA 4KN7C 5A35A 1DONA 2Q8RE 3V96A 1KDCA 1CM9A 2B2TC 1WTWA 5M5YB 3EJIA 2F0MA 1Y8OB 4X3UA 2ZXPA 1M4VA 5KYLA 3FPPA 2JE6I 3NTIA 1STEA 5F2DA 3H3VC 4DAVA 3CRLC 1T5XD 3HEJA 1O7ZA 1HA5A 3MWYW 1ET9A 3A7LA 2L11A 2D62A 3NBIA 1JCKB 2KCNA 3M4YA 2F0QA 4K5XA 5E4XA 2AWOA 4OL7A 3BYYB 1HRJA 3S2DB 1ENAA 2IW3A 3AB9A 1HQMC 1PTOC 1SNMA 1Q3LA 2L9HA 4BWGB 4A3DB 2EZVA 1GUWA 5BN3A 2D5DA 1H9RA 1RDPD 3R2TA 1SXTA 4FXGC 5KRUA 2RSOA 1F9SA 1H9SB 2CW0D 3SR1A 5C5LA 3LNNA 3BS1A 2EY5A 2J0TD 2WB1B 1WD1A 5IGBA 2QEJC 1G2SA 1EEFD 1GUTA 5FOBB 3BDOA 1D6EC 1CA5A 5ELEA 2EDGA 4BBRB 3J7AV 1TWAB 3VR2A 2RVLA 3OOCA 4F88A 3ND9A 4UDUC 3TSSA 4OO1G 1A3VA 3H91A 3IFDA 2KCCA 5I2XA 4BBSB 1B44D 3SE0A 4C1NK 3GTOB 4F87A 4PQXA 2EYJA 4E6IA 3RZOB 1SEBD 1TS5A 2A6EC 2F0JA 2J7ZA 2EYOA 1BOSA 2F0NA 1CT1D 1XYIA 1HPCA 2KEDA 3IKJA 2VB3X 3VYSA 5EBCA 2K03A 2WKCA 4HTHA 3C1FA 1E0BA 2XWJB 3BDCA 1VF5C 2F0PA 4FF4A 3RMHA 2RA4A 2K05A 1F2ZA 1ZYRC 3A8KE 1BDOA 1SJHD 1CK1A 1SYFA 4RGNA 2G9DA 3OPOA 2NBFA 1JQYD 2WV6D 4RKBA 4J8QA 2E2JB 5ELBA 4EQNA 4R9WA 3GV6A 2M9VA 4IFDI 2HQEA 3NP8A 3X3MA 1IKLA 4QIWB 4C3JB 4G4KA 3D4WA 3T56B 1XX8A 2L12A 4NP5A 1CQVA 4JBWA 2K7VA 5C4HA 3PUVA 1I4PA 2XSCA 5CR3A 4IURA 5D3IB 1GUSA 3DXJC 1M8AA 5DEHA 2F3VA 2M2LA 4M8AA 3CRKC 2RSNA 3PIO3 5I9OA 2B8GA 3WDNA 3T16A 1QCBD 3TP8A 4MN3A 1BO0A 3I4LA 1EZ6A 4FP5D 2IX1A 1CFMA 5JJZA 5IOCA 3M4OB 3S16B 4O1NA 3TZUA 2K5DA 4IUVA 4RH6A 4K6DA 2JA8B 2BE5D 1DCZA 4A3FB 3KUPA 3TP7A 1LTBD 1BNZA 1FGBD 1ZKOA 1RKNA 4CGYB 3S17B 4QMGA 4F7XA 3NWTA 3GTQB 3GTJB 3BZDB 5FKAC 1SYDA 1LACA 1SNOA 3TP6A 3HOYB 1SAPA 1Q1EA 3PV0A 5FO8B 5BN4A 1EIHA 4KKTA 4PNYA 5C6AA 1TIID 4KY5A 1MGSA 1RTOA 1X32A 4ZLTF 3EQLC 2R92B 5E4WC 3HP3A 3QWNA 4MHEA 4ZAIA 2WKDA 5BN5A 2Z4HA 1BR9A 4BA1I 3HOUB 4C2MB 1F77A 2PZTA 1STBA 4LAAA 1HA6A 3M3YB 1RF2D 2HCCA 2D2CC 1K83B 5CYUA 5ELFA 4ZK9B 5I6YA 2RDGA 1A3UA 1VMPA 1PZKD 1SNPA 1EEID 3HOXB 4OIKA 4ZUJA 2JEAI 2IX0A 1VF7A 3K0YA 4EQOA 2SDFA 2HUGA 3D31A 1EYCA 1NSNS 5IGGA 1Q8IA 1GUGA 5FO7B 3HS0C 2PQEA 1R4PB 2F0UA 2A69C 1S5ED 5CV4A 3X3NA 5DM73 5ELDA 4QUFA 5EPJA 3MC0B 5HGTA 2RBMA 3C46A 1I4RA 1GHKA 3PUXA 1SYGA 5ELCA 3NXWA 1RTNA 1LTGD 2HDMA 2B2WC 2RDFA 1OXUA 4KI0A 3J80L 3H94A 1A2TA 4A3KB 2L55A 5DNFA 5CV6A 1SNDA 1TU2B 2TMPA 3L9AX 4M1UB 2NVXB 2A68D 1F2MA 4XT3B 3T51B 5KIXA 5KEEA 1QWYA 4K6LA 2PNRC 2B2UA 2OF1A 3VA7A 3CKIB 5M3FB 2Z1CA 1CZGA 3GTLB 5DAUA 5T1IA 2E2IB 2JA7B 2MP1A 3UI2A 1MI2A 2ENBA 1S5FD 2F0TA 4RFBA 3FKIB 5I4DA 1E2WA 2E2DC 1IYUA 4HMIA 1KLGD 2B2TA 1BCPD 4N9PA 3P1HA 3DUZA 2B2VA 1F2LA 3GQBA 1XXGA 4OGQC 3SK4A 4DGZA 4G7OC 4RGMA 3ND8A 4G7HC 4RCOA 1ONLA 1I6HB 4OIJA 3BVZA 5JAVA 4IN3A 2A73B 2ICEC 2PW5A 2MGSA 1B9MA 1EQVA 1SDFA 1TS2A 4FVMA 3L7ZC 1NUCA 5AFWA 2Z4IA 1O78A 1B53A 2BCOA 1AW7A 2EY2A 3GTGB 3A8IE 2DNEA 2MPMA 5EQ0A 3K5NA 2O4XA 3FEWX 1Q90A 3Q22A 2R6GA 4RGOS 3T53B 4K8JA 5JEAJ 2J4XA 4XYOA 1AEXA 1YNNC 3J80E 5J22A 1AZQA 1I4GA 1AZPA 2A6HD 3V2TA 1TWHB 1ILQA 1JB3A 1PRTD 4TQUS 3QB3A 5T1GA 2B2YC 1G91A 1SYBA 4IFDH 3KLSX 1H9JA 4XTCS 1PFMA 5M5WB 1C8CA 4DFAA 3S1RB 1K8MA 2MHVA 3DM1A 4C56C 1O80A 4A3IB 3TDQA 4KV6A 3OW7A 2YU9B 1SYEA 1D5XC 1NAPA 1Y1VB 2JSOA 4G7ZC 1ML0D 4HCSA 1L0XB 2KECA 3RZDB 3S2HB 1DOLA 3J7AF 3IFTA 1LT3D 2D9UA 3FRPB 3VR5A 1KDBA 4G57A 3D4DA 4RA8A 4RGTA 2L5TA 3NTHA 3MFYA 1STGA 2KJXA 5D3DA 1RODA 2I46A 4JK1C 1IW7C 1LABA 3VR3A 3K58A 3E5SA 3JAML 2VNUD 3I3CA 4HN7A 3PO3B 1QE6A 2NZ1D 1UUPA 1BF4A 1PXUA 2WACA 2KVMA 5JPMC 1H9SA 1TR5A 2L0CA 1V1OA 1OXSC 1STYA 4RHRA 1KABA 1CHPD 1SMYD 3HOZB 1STHA 5EKKA 1MD2D 2SOBA 3K6OA 5M5XB 3SHLA 3MHBA 1AN8A 1JC7A 1X3PA 2AQ3B 1CTMA 3K5OA 3KK7A 1S5CD 5FK9C 2G9HD 4ZUIA 1II3A 3GV3A 4C3HG 4ZKCB 1TKWB 1F9RA 1WTQA 1VDZA 3IL8A 1F2YA 4X3TA 4KKUA 3NQTA 3I72A 2X6LA 3N6RA 2BA1A 1D1IA 2XRQD 3BG3A 3S1NB 1HQRD 1WCMB 1B3AA 2B39A 5K36H 1LO5D 2PCFB 2K1BA 4XDXA 3SVMA 3A55A 3IAYA 3A54A 4PMWA 2B63B 4RAUC 1BXTA 3CHBD 1ZEQX 5IGFA 5JOBA 2FINB 3WOEA 4K14A 1DM0B 1GJXA 3ITPA 3JAME 4A3GB 1Q12A 1Y1WB 3S1QB 4Y7NB 3K5MA 4NKLA 4WRDA 4C3IG 5FLXL 3SXHA 2CVRA 4V190 2CW0C 1Y69U 5I6WA 1SE4A 3CQZB 1FR3A 1MBYA 4IQZA 2EJFC 4FNFA 4PV1C 3BDLA 3OHXC 2F0GA 1PRTF 2EVBA 2AWNA 2QKIC 2MJ8A 5E1FA 4PMBA 4BS9A 5CV8A 4R8NA 5KNDA 5C0XJ 1CA6A 3M7GA 1A15A 4KHVA 2EE1A 1RHPA 2BDOA 3PUZA 1QG7A 1EOTA 1JWMD 4EVOA 1EYDA 3L3OC 5ISRA 3GD7A 1JOKA 1TQOA 2ICIA 1TS3A 4ZKBB 2F3WA 3OIQA 3HGBA 5IGEA 2XVSA 4DXFA 4KY6A 2F1MA 2V4DA 1PFNA 2LS01 3I91A 1SYCA 4IFDG 4ODGA 1D1KA 3R93A 2PW7A 3M7NA 5C4JB 2BOSA 1GXDC 4PMCA 3T4AC 4DU9A 3U9OA 2O5IC 1WTVA 3G7LA 1FYCA 4NDXA 3R3OA 4FO2A 1DD2A 1YNJD 3KLSA 1MSHA 2LMCB 3D6WA 2AQ1B 1UEAB 1EY0A 4WORA 1LT4D 2WIIB 2ZT9C 2B2WA 1V8QA 3S1MB 1G6ZA 2LY7A 5IT9L 1H9KA 5C3XA 1HUMA 2DN8A 1JORA 1O7LA 1U4RA 2K32A 3PUWA 3MEHA 5D65A 4H7BA 4IZ8A 1R4QB 4C1NI 5E3FA 1B1ZA 1SSOA 4AYBB 2C9OA 2JYOA 1D5MC 3EA6A 2XRSD 4ULLA 2QCPX 4IUQA 3MXPA 5C3WA 2NWGA 3NHHA 4DNRB 1JWUD 1TY2A 3NWSA 5EJWA 2RDHA 2NB0A 1D2BA 1TT2A 5D14A 1PDQA 4WJWA 1WTOA 1DYQA 3QJYA 1SJED 3SK5A 3AMUA 4K5VA 2FJ2A 2KQ3A 4CBVA 4DN4M 3URYA 3K57A 1IKMA 5A2QL 2IL8A 4X3SA 3TBIB 2DNCA 3FMCA 1NR2A 2BE5C 3LX0A 3TN2A 2NVQB 4CKBA 2I07B 2K6AA 1X3QA 3SK8A 3K59A 2WP8J 2SEBD 2A5HA 1KNAA 3RLFA 3MZ5A 2GA4B 4QCLA 1I3QB 2EJMA 3DHQA 5CV9A 1BBXC 3NBHA 3S9WA 2CHBD 5I2YA 2L1BA 1WD0A 5LL6S 3NE5B 4BY7B 3G6JB 4IUUA 3E0JA 2NVTB 3GP7A 3VYUA 2PMZB 5K36G 5EKIA 5EBDA 3FDTA 2PPBC 1QNUA 4KY7A 3HOWB 3W2DA 5C4XB 1AFPA 2TSSA 4J6HA 1JR0D 4N9TA 1Z47A 1I6VC 3SEBA 1E2ZA 2PO4A 5KNCA 1ILPA 1HFNA 1EU4A 5K5PA 4L6TB 2KHSA 1FD7D 3F2UA 3KLRA 2B2YA 1I4HA 4BY1B 5JEAG 1AP0A 3Q23A 2EYLA 5C4ZA 3QO2A 2OEOA 4CJ2C 2YYZA 4K2KA 2E2HB 2JXMB 1EFID 2NUCA 3O13A 1V43A 4A3MB 3RUZA 1O7YA 1R9TB 2EY1A 1GUOA 3I8ZA 4DK0A 2WAQB 1KLUD 1BCPB 4WFN3 1CHQD 3W3AA 4A93B 3ZYYX 4I65A 1VMCA 2R93B 1Q1BA 2F03A 3VR4A 1TY0A 1STNA 2CQAA 1RJTA 1EIGA 2K04A 4DK1A 3K5LA 1Y8PB 5A2QE 1EL0A 5M9OA 5J39A 4KK7A 5NUCA 1MSGA 4EQPA 3A8JE 2DY7A 3QG1A 4K8IA 1Z6HA 1W6JA 2A68C 5CBAE 1PTOD 1U4LA 5CORA 3J81L 1ESFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5C D;  1ET6 A;  1G8Z D;  5FK9 C;  5I4D A;  1PTO F;  2G9H D;  3SEB A;  4Z9C B;  1HA5 A;  1ET9 A;  1HTL D;  1EU4 A;  1KLG D;  4L6T B;  3DWA A;  1D5X C;  1BCP D;  1RD9 D;  3DWP A;  1V1P B;  1HXY D;  1L0X B;  1LTA D;  1B1Z A;  1JCK B;  1LTI D;  1FD7 D;  4O1N A;  1PRT C;  1JWM D;  1T5X D;  1LT3 D;  1XXG A;  1D5M C;  1ENF A;  1I4Q A;  1SE3 A;  3EA6 A;  2XRS D;  3BYY B;  4RH6 A;  1I4H A;  1EU3 A;  1LTR D;  2ICI A;  2O2L D;  4RGM A;  1PZI D;  1TS3 A;  4RCO A;  1SE2 A;  1PZJ D;  1LTB D;  1PTO C;  1FGB D;  2XNA C;  1S5E D;  1JWU D;  1PTO H;  1XTC D;  1TY2 A;  2XRQ D;  3BVZ A;  1PRT B;  2RDH A;  3DWQ A;  4RHS A;  1V1P A;  1HQR D;  5ELD A;  4DXF A;  3BVG A;  1FNU A;  4BWG B;  3BZD B;  1LO5 D;  5D3D A;  1SJH D;  5FKA C;  3MC0 B;  1LTT D;  1EFI D;  1TS2 A;  1DYQ A;  3O13 A;  1CK1 A;  1RDP D;  3R2T A;  1BCP C;  1PTO B;  1SJE D;  1SXT A;  1I4R A;  3R8B A;  4RGN A;  1BCP F;  2AQ2 B;  1D5Z C;  1L0Y B;  1AW7 A;  1JQY D;  1S5D D;  2IJ0 A;  2WV6 D;  3URY A;  1LTS D;  5ELC A;  2QIL A;  5ELB A;  3MFG A;  1FNW A;  1LT5 D;  1SBB B;  1LTG D;  1UUP A;  1KLU D;  2QEJ C;  3OWE B;  1BCP B;  4ZYS A;  1GOZ A;  1CHQ D;  1BXT A;  2IPK D;  3CHB D;  1EEF D;  1TS4 A;  1D6E C;  1QIL A;  1KTK A;  5ELE A;  4RGO S;  1TY0 A;  3EFX D;  4DXG A;  1LT6 D;  2SEB D;  4RGT A;  3BYT B;  4UDU C;  1LLR D;  1V1O A;  4L63 B;  3TSS A;  1EWC A;  2J4X A;  4K6L A;  1JWS D;  2R61 A;  4RHR A;  3V05 A;  2AQ1 B;  2NTS A;  1B44 D;  1CHP D;  1CQV A;  1SE4 A;  1I4G A;  1I4P A;  1LT4 D;  3R2I A;  2CHB D;  1MD2 D;  1F77 A;  2XN9 C;  1PRT D;  5D3I B;  4OHJ A;  1M4V A;  1SEB D;  1RF2 D;  3GP7 A;  4TSS A;  1TS5 A;  3BVM A;  3KLS X;  5ELF A;  1RCV D;  2Z8L A;  1STE A;  1PRT F;  1S5B D;  2RDG A;  2NTT A;  1AN8 A;  5TSS A;  1PZK D;  3W2D A;  1PTO D;  1FNV A;  1I4X A;  1JR0 D;  1PYW D;  2TSS A;  1S5F D;  4C56 C;  2AQ3 B;  1CT1 D;  1DJR D;  4RFB A;  1ESF A;  1UNS A;  1EEI D; 
#chains in the Genus database with same CATH topology
 2K4K A;  1VS0 A;  3J80 i;  4Z9C B;  3D6C A;  2VZA A;  1VQN A;  3RD4 A;  1XMO L;  4Q0F A;  2R7Z H;  1V1P B;  1TWG B;  5CC4 A;  2N49 A;  2Z0S A;  1IZ6 A;  4HSP A;  2E74 C;  4UAI A;  3ERQ A;  4P75 A;  1ESR A;  1SE3 A;  2B2U C;  2K14 A;  1EY4 A;  5LHY 1;  1QOH A;  1LTR D;  4QQB X;  2N88 A;  1PZI D;  1CQF A;  4KD4 A;  1OTC A;  2OTJ A;  1T5E A;  1PLF A;  4MIU A;  1PRT B;  3N52 A;  2K28 A;  3DM3 A;  1C7Y A;  4NW2 A;  1IBM L;  1AE2 A;  1QVC A;  2UXC L;  5IP9 G;  3C3L A;  5M3M B;  1EY9 A;  1BCP C;  1EFW A;  3HOU H;  4NMZ A;  3PO3 G;  2Y0S B;  4C2M H;  2HIV A;  1S5D D;  4A3B B;  3CAM A;  3MFG A;  1K0R A;  3D3R A;  4A3D G;  2MUY A;  4ZYS A;  2B2V C;  4HID A;  1TS4 A;  1PH1 A;  2F52 A;  3A56 A;  2A6E D;  4FF2 A;  4O42 A;  3ER0 A;  2OCE A;  1G29 1;  1LM0 A;  4KJN A;  4IUT A;  3VR6 A;  3HOX H;  1LT6 D;  4LNQ A;  4IJH A;  1CUK A;  4Q5V A;  2F0I A;  1U4M A;  4CJ0 B;  3BYT B;  1NY4 A;  3NSW A;  1SNC A;  4L63 B;  1EQR A;  2PQA A;  4H44 C;  1W3S A;  1JWS D;  2F0S A;  3V05 A;  5C5M A;  5C3E B;  3F2B A;  4CHT B;  1IYV A;  1Z7T A;  2KEE A;  2NTS A;  2AMC B;  1TXY A;  3U58 A;  4UPA A;  2F0F A;  3E9H A;  4GNX C;  4OO1 I;  2O5J C;  5BR8 Q;  1B3Q A;  4BBR G;  4ID6 A;  1F9P A;  1CI3 M;  3RR5 A;  4PZ8 A;  1BVS A;  4YIJ A;  2CCZ A;  1FVI A;  2YTY A;  4TSS A;  2Q8T A;  1S5B D;  2NTT A;  5C0X I;  3TZD A;  4BBS G;  3UE1 A;  2AUJ D;  2UXB L;  1I50 B;  1ZYR D;  3QOL A;  1QJO A;  1UNS A;  5CV5 A;  1L2F A;  1ET6 A;  4IUP A;  1Y8N B;  1KAA A;  2SNS A;  2H5X A;  4CKC A;  4POG A;  1ICW A;  2H1E A;  3DWA A;  1N36 Q;  1CKN B;  2IHE A;  4KKS A;  4OX9 L;  1B7Y B;  3U50 C;  1VQ9 A;  2A6H C;  3MXU A;  1JB7 A;  2UXD L;  1EWH A;  4JI4 Q;  1PRT C;  4B3T Q;  4A3K H;  4KN4 C;  2LXJ A;  3RN5 A;  3TEH B;  1XNR Q;  4JI5 L;  4JV5 Q;  2O2L D;  3J81 E;  2JEB I;  2JJQ A;  4JI2 L;  2NYZ D;  3K80 C;  4RHS A;  3G4S A;  4LJZ C;  1FNU A;  5ELN A;  3D8G A;  4QUC A;  3KF6 A;  4A3J B;  4DA2 A;  1TWF B;  2X6G A;  4S3S A;  4DAM A;  1DXM A;  1HNW L;  3K7U C;  1HUN A;  2EY6 A;  5M3F H;  1M1K C;  2ZM6 Q;  1BCP F;  2AQ2 B;  1Q81 C;  4FXD A;  1HZC A;  2JA5 B;  1LTS D;  3SDZ A;  2E75 C;  2KUM A;  1N34 Q;  3HKZ B;  5I9P A;  1SNQ A;  1EUJ A;  2PZW A;  3PMF A;  2BA0 A;  3M85 A;  2LFN A;  2Z6B A;  3C2P A;  2VXW A;  2JA7 H;  5ELO A;  5C0X G;  1HNX L;  1PH8 A;  4CKE A;  1KTK A;  2E76 C;  4IPC A;  1HR0 W;  4GN4 B;  2AHO B;  1Y1W G;  1A0I A;  1TWC B;  1V9P A;  2FMM A;  1OXV A;  4DV7 L;  4DAY A;  2PNH A;  2QF7 A;  3GDE A;  1J8I A;  3I70 A;  3UDI A;  2KCM A;  4U68 A;  3NEN A;  3VYT A;  2JA9 A;  1JJG A;  4ZCK A;  1QVG A;  2JA6 H;  3DEO A;  1S4Z A;  5IYC G;  1EIF A;  3R2I A;  4C3J G;  1A2U A;  4V0B A;  4QY7 A;  1YI2 A;  1QVF A;  4HR7 B;  2F0K A;  3CD6 A;  4GLA C;  2MO1 A;  1I6H H;  4XQJ A;  2FHT A;  4C3H B;  3CCQ A;  3GTK B;  1Y14 B;  3K7A B;  3OWF A;  4P72 A;  4UY8 C;  2FMC A;  1HZB A;  2IT1 A;  2Z8L A;  5JEA H;  5TSS A;  3JAM i;  3T13 A;  1I4X A;  4XQQ A;  2RHQ B;  3H3V H;  1DJR D;  4HAE A;  5L37 A;  3FPU B;  2Z6K C;  2NN6 I;  3P20 A;  4GN5 A;  1L1O C;  3SK6 A;  1PTO F;  3NEM A;  2OT2 A;  1X3E A;  2VUM H;  5JPN C;  1SMY C;  3I90 A;  5KGU A;  3HG9 A;  3GTG H;  3AYH B;  1KDA A;  1LTA D;  4TKO B;  5IWA Q;  1QB5 D;  1EZ8 A;  1MHW C;  3OMG A;  4DNI A;  1NJI C;  5IGC A;  3TRZ A;  4DV0 Q;  4FXK C;  4FF3 A;  1HHV A;  1N32 Q;  2F0V A;  2JQO A;  2YTV A;  1SE2 A;  4LF6 Q;  2XNA C;  1PTO H;  1STA A;  1VQM A;  5EKL A;  3S15 B;  3GTM B;  1JE4 A;  3M4Q A;  3TME A;  3I4M B;  3HRZ C;  1NCV A;  2OQ0 A;  3NUC A;  3T1H Q;  4XXE A;  1YHB A;  3H09 A;  4R8I A;  2DY8 A;  4IPG A;  2NVY B;  4HMJ A;  3CPW A;  2JA8 G;  4A3E H;  4A3F G;  1VQO A;  1D5Z C;  1L0Y B;  4JI1 L;  3S14 B;  4X64 L;  1VQE A;  1H9M A;  1JJC B;  2HCI A;  4KD3 A;  4DR1 Q;  4A3L H;  1LT5 D;  1IBK L;  4LF8 Q;  5CBE E;  5M5W H;  3MXG A;  2EPB A;  4C3I B;  3S1R H;  5FO9 B;  5JVG 3;  1LV9 A;  1F9Q A;  4A3I H;  3HOY G;  5JJK A;  4DAP A;  2IWH A;  3Q0A A;  2ZXR A;  1CKM A;  4AYB E;  1W6K A;  3J80 c;  2M00 A;  1KNE A;  2NN6 G;  4K0K L;  4QB4 A;  2ZJR A;  4PG3 A;  3I56 A;  1S3O A;  4RWS C;  2EYP A;  4RKL A;  1RL2 A;  3EVQ A;  1J9O A;  3Q24 A;  4LF4 L;  1KXL A;  5CMD A;  2KEN A;  1K9M C;  4GKJ Q;  3VA5 A;  4J1M A;  5IYB G;  3KBX A;  1GVP A;  4O2D A;  4DUY Q;  2R92 G;  1VQ8 A;  3PF4 A;  4X3K A;  1C4Q A;  5G3L D;  1X65 A;  3BVM A;  2F4I A;  1OXT A;  1RCV D;  2R3Z A;  4XQN A;  4DV7 Q;  4FF1 A;  2WIN B;  1YBY A;  3TQY A;  1PH9 A;  2XTI A;  2A69 D;  2VB2 X;  2ID0 A;  2EJG C;  1A3T A;  4L8J A;  5CV7 A;  3MA2 B;  2E8G A;  1DOM A;  2K01 A;  3P7J A;  5IIF A;  3NK9 A;  2K5N A;  1X55 A;  5IP9 H;  1BQQ T;  4B9W A;  1Q82 C;  3S2D H;  3DWP A;  3PO3 H;  1QNK A;  1DZ1 A;  3GO5 A;  4R4Q A;  3HOV B;  1WTR A;  3FVQ A;  1LTI D;  4ZRZ A;  3OMC A;  4DNT B;  3B6Y A;  3LGJ A;  2A74 C;  3J7Y W;  1I4Q A;  2EYH A;  3E6Z X;  1SFO B;  3D4R A;  3UDX A;  5KNB A;  4DKA C;  3HOX G;  2N55 A;  2R7Z B;  3MTS A;  1X3F A;  5FLX E;  2K5H A;  4H0L C;  4KHZ A;  4CDD C;  4DF7 A;  4ZQ3 A;  2HT1 A;  2VL6 A;  4I7Z C;  4LW1 A;  3BVG A;  3TP5 A;  3LWE A;  2XIW A;  1GHJ A;  4JI8 Q;  2H4O A;  1VQ5 A;  4DV3 L;  1LTT D;  1MJC A;  3JC6 6;  3MXN A;  2PMZ E;  4ABN A;  3HOZ H;  2F0W A;  4N8X 1;  4KHP L;  5LL6 X;  4LMQ D;  2IX3 A;  4DV6 Q;  2CKZ B;  1IHZ A;  5M5X H;  3NPP A;  2IJ0 A;  3A7A B;  4HJA A;  1C48 A;  4HED A;  1HNZ Q;  4O0A A;  4OXP A;  2DJF C;  2K33 A;  4BBR H;  4TRD A;  1TWA H;  4LFB Q;  1Q86 C;  1OXX K;  1K73 C;  1QUQ A;  1NBW A;  3VYR A;  1UAP A;  3OTO Q;  4DXG A;  5COY A;  4BBS H;  3KBG A;  4IFD J;  4EGV A;  1QUQ B;  1JOQ A;  5JJL A;  1PMR A;  2F0L A;  5J1Z A;  5HUR A;  3OIP A;  4YY3 L;  3PUY A;  1EY6 A;  4RCN A;  2XWB B;  4JVZ A;  1IBL L;  3AU7 A;  4A3K G;  4IAL A;  2GVB A;  2UUB L;  5JVH 3;  2HD3 A;  1U9R A;  1YIJ A;  1WTH A;  2F0H A;  1E2V A;  2K5W A;  3Q6S A;  2OXP A;  1BUV T;  1JOO A;  2L4N A;  4OEM B;  2F0D A;  2EYF A;  3S1N H;  4KTA A;  3ERO A;  3WOF A;  4BA2 I;  1ENC A;  2QDB A;  3CME A;  4JCV E;  4LK1 C;  2PYK A;  3L0O A;  2FFK B;  1JE5 A;  1KC8 C;  1B4O A;  1EY8 A;  2WAQ E;  5M3F G;  1B9N A;  3I73 A;  3H6M A;  1PH5 A;  1B50 A;  1YNJ C;  1G8Z D;  5EGT A;  1K3B C;  2YTX A;  3I4N B;  2C5C A;  1PYB A;  1UEB A;  1YHA A;  1XWE A;  1WVL A;  2LKV A;  1RD9 D;  2B8F A;  1UWV A;  3A74 A;  1EYG A;  4OO1 H;  2EYM A;  2RKS A;  1D8L A;  1X6O A;  1E22 A;  3NQI A;  1JIC A;  1EU3 A;  3FKI G;  5IOD A;  4B3S Q;  4GZY C;  2X69 A;  4B08 A;  1WTX A;  1VQD A;  4Y52 H;  1PZJ D;  5IE8 A;  1ZXT A;  1XPO A;  3U9S A;  5C0X H;  3CU7 A;  1XTC D;  4HJ8 A;  3DWQ A;  4A3G H;  1UE5 A;  2ZXO A;  1HFG A;  4QF4 A;  1Y1W H;  4XT1 B;  2EOT A;  1VQK A;  4Y7N H;  1NR4 A;  5LMN Q;  4ILW A;  1RIP A;  3C1E A;  2SNM A;  5IT9 E;  2L15 A;  1CZW A;  4K5W A;  3R8B A;  1U4P A;  3CQZ H;  5KYI A;  3TRE A;  2WAQ G;  1WTP A;  1YNN D;  1V1Q A;  3QIA A;  4UP9 A;  4H02 A;  1OO9 B;  1D7Q A;  3OSO A;  5IGD A;  4DK6 C;  3PSI A;  3NTK A;  3MVV A;  1FNW A;  4XYQ A;  5IYC H;  4C3J H;  3P75 A;  3OWE B;  1GOZ A;  2IPK D;  5C44 B;  3OW2 A;  3EIV A;  1E1O A;  2CFM A;  1HTP A;  4B9X A;  2MO0 A;  5EPK A;  3EFX D;  2EQS A;  2YV5 A;  4JI6 Q;  3PIP 3;  4L5T A;  2RHS B;  1E3P A;  1LLR D;  1EWC A;  1EQT A;  2JN4 A;  1B70 B;  2R61 A;  2HDL A;  1K8A C;  4PZ7 A;  4P2C B;  1K28 A;  2OQK A;  4RG1 A;  2F3I A;  4FYD A;  2EXZ A;  2DUD A;  2NZH A;  4HSV A;  5BR8 L;  2KA7 A;  3QOJ A;  3UDF A;  5EPL A;  2XN9 C;  5CGK A;  4K2L A;  4OHJ A;  2PZU A;  2MFI A;  1EY5 A;  1XMQ Q;  3DEP A;  1G2T A;  2JA6 B;  2JK8 A;  2JP1 A;  5DM6 3;  2F0E A;  2KOL A;  1A6X A;  5G3L F;  3KF8 A;  4OWW B;  4GOP B;  3J81 L;  1PYW D;  1FNV A;  1EYA A;  3HZX A;  4NXN Q;  3DMU A;  4U67 3;  4H13 C;  2K52 A;  1HTL D;  4A3L G;  4KMU C;  1IW7 D;  4KJO A;  1VCI A;  4XIG S;  1N36 L;  4GNX A;  1HXY D;  4A3F H;  2F0O A;  5DLQ E;  3H0G B;  5C4J H;  3GTP B;  4DR5 Q;  2BDN A;  4A3I G;  1ENF A;  4JI4 L;  2VUM B;  4DR6 Q;  1TVX A;  4B3T L;  3GTJ H;  5E7N A;  4JOI C;  3LWU A;  1XNR L;  4CJ1 B;  4JV5 L;  3RLO A;  1CKO A;  3I55 A;  1Y1V G;  3HOY H;  1V1P A;  1DOK A;  4WJ4 A;  4IUN A;  1PFB A;  2NN6 H;  2Q8I B;  3PO2 B;  1FJG L;  3FP9 A;  1PTO B;  3STB C;  1IL8 A;  1K8O A;  4F8M A;  2ZM6 L;  3MAQ A;  4R4I A;  1EY7 A;  1HCZ A;  1XPR A;  2K5Q A;  3S1M H;  2QIL A;  1PH7 A;  4HCE A;  1SBB B;  3ONA B;  2RQX A;  5IYB H;  1GUN A;  1N34 L;  2R92 H;  1B2T A;  4A3E B;  4LUV A;  1QIL A;  2KHJ A;  4ME5 A;  2AUK A;  4KN7 C;  5A35 A;  1DON A;  4RMF A;  2Q8R E;  3V96 A;  1KDC A;  1CM9 A;  3M3Y H;  1PV4 A;  3KYH C;  2B2T C;  1YEZ A;  1WTW A;  1K83 H;  4UP7 A;  5M5Y B;  3W1B A;  3EJI A;  4GOP C;  2F0M A;  1Y8O B;  4X3U A;  2ZXP A;  1M4V A;  5KYL A;  3FPP A;  2JE6 I;  3NTI A;  4IO9 A;  1STE A;  1P16 A;  5F2D A;  3CXC A;  3HOZ G;  3HKZ E;  4DAV A;  3CCV A;  3H3V C;  3CRL C;  1T5X D;  3A0J A;  3HEJ A;  1O7Z A;  3E9I A;  1HA5 A;  3MWY W;  1ET9 A;  3A7L A;  2L11 A;  1N8R C;  1J5E Q;  2D62 A;  3NBI A;  4DUZ Q;  1EIY B;  1JCK B;  2KCN A;  3W5O A;  3M4Y A;  5GAD C;  2OTL A;  1N33 Q;  5IWA L;  2F0Q A;  4K5X A;  3PQI A;  2NVQ H;  5E4X A;  3EBE A;  2AWO A;  2RCF A;  3BYY B;  4OL7 A;  1HRJ A;  1VQI A;  3S2D B;  1ENA A;  1JJ2 A;  2C35 B;  4DV0 L;  3F8T A;  2IW3 A;  3AB9 A;  1N32 L;  1HQM C;  1PTO C;  1SNM A;  2D0O A;  1Q3L A;  1VQL A;  1CKN A;  4P74 A;  1YIT A;  4LF6 L;  1CSP A;  2L9H A;  3ULJ A;  5IY0 A;  1I3Q H;  1VQB A;  2Z6K A;  4BWG B;  4DR3 Q;  2EZV A;  4A3D B;  1GUW A;  5BN3 A;  2D5D A;  3T1H L;  1H9R A;  1CSQ A;  3R2T A;  1RDP D;  1FL0 A;  1SXT A;  1L1O B;  3HKZ G;  4FXG C;  2QW7 A;  1AE3 A;  2RSO A;  5KRU A;  1F9S A;  4CDF C;  1H9S B;  3CC2 A;  2QDL A;  4BY7 H;  1Q8K A;  2CW0 D;  3SR1 A;  5C5L A;  3LNN A;  3J81 i;  2EY5 A;  2J0T D;  2WB1 B;  3BS1 A;  1WCM G;  4DR1 L;  1WD1 A;  2NVX H;  5IGB A;  2QEJ C;  4QJF A;  1G2S A;  2HHH L;  4LF8 L;  1EEF D;  3E0E A;  1GUT A;  3PIP A;  5FOB B;  3BDO A;  1D6E C;  1CA5 A;  5ELE A;  1UE6 A;  2EDG A;  1YJW A;  1FJG Q;  2KBN A;  3ERS X;  4BBR B;  4HJ5 A;  3J7A V;  1NNX A;  1TWA B;  3VR2 A;  2RVL A;  3KJP A;  3OOC A;  4F88 A;  3ND9 A;  3GTL H;  3U4Z A;  4UDU C;  3TSS A;  4OO1 G;  3F2D A;  1A3V A;  2B63 G;  3H91 A;  2R7F A;  2GN5 A;  3IFD A;  1IYJ B;  2KCC A;  5I2X A;  4BBS B;  1B44 D;  3SE0 A;  3ZJY C;  4C1N K;  3GTO B;  4F87 A;  2E2I H;  4GKJ L;  4DV1 Q;  4AIM A;  4PQX A;  2EYJ A;  4DUY L;  4E6I A;  3RNU A;  2VS1 A;  3RZO B;  1VQC A;  1SEB D;  3BU2 A;  4A3G G;  1TS5 A;  2A6E C;  1GO3 E;  3FKI H;  2F0J A;  2J7Z A;  4DR2 Q;  2EYO A;  1UE1 A;  4LWC A;  1BOS A;  3CCM A;  2F0N A;  1CT1 D;  1XYI A;  3RLN A;  1HPC A;  2KED A;  4GLV B;  3OYY A;  3IKJ A;  2G5D A;  2VB3 X;  4KLK A;  3VYS A;  5EBC A;  2K03 A;  1A8V A;  2WKC A;  4HTH A;  1R9T H;  3M9B A;  3C1F A;  1E0B A;  2XWJ B;  3BDC A;  4P73 A;  4LF9 Q;  1VF5 C;  2F0P A;  4N8F A;  4FF4 A;  3RMH A;  3J7Z C;  4R4T A;  2RA4 A;  2K05 A;  4OWT B;  1F2Z A;  1ZYR C;  3A8K E;  1KQS A;  4LFA Q;  3UDG A;  1BDO A;  1NTG A;  1SJH D;  4JI8 L;  1KRT A;  1CK1 A;  1SN8 A;  3AEV A;  1SYF A;  5FLM G;  4RGN A;  2G9D A;  3OPO A;  4DV6 L;  2NBF A;  1JQY D;  2WV6 D;  4RKB A;  4J8Q A;  2E2J B;  4TVA B;  3Q8D A;  5ELB A;  1C9O A;  1HNZ L;  4HIM A;  4EQN A;  4R9W A;  3GV6 A;  2M9V A;  4IFD I;  4LFB L;  4GKK Q;  1HH2 P;  1VQG A;  4NXM Q;  1BBW A;  2HQE A;  3NP8 A;  3CW2 C;  3X3M A;  4ME3 A;  1IKL A;  4QIW B;  4C3J B;  4GS3 A;  4X65 Q;  3OTO L;  1WFQ A;  4G4K A;  4AQY Q;  3D4W A;  1VQ6 A;  1TWH H;  3T56 B;  1XX8 A;  2L12 A;  5IYD G;  4LFC L;  4NP5 A;  1CQV A;  2HHH Q;  4JBW A;  2K7V A;  5C4H A;  3PUV A;  1I4P A;  2XSC A;  2K75 A;  1VQ7 A;  5CR3 A;  4IUR A;  3TS2 A;  5D3I B;  3CC4 A;  1GUS A;  3DXJ C;  1M8A A;  1PH6 A;  5DEH A;  2YU9 H;  2F3V A;  2M2L A;  4M8A A;  3CRK C;  1K0S A;  2RSN A;  3PIO 3;  4YCU A;  5I9O A;  1Y1V H;  2B8G A;  3WDN A;  3T16 A;  1QCB D;  3RZD H;  3S2H H;  4AH6 A;  3TP8 A;  1WOC A;  4A3B H;  4DV5 Q;  4MN3 A;  1BO0 A;  3I4L A;  1EZ6 A;  3CF5 A;  4FP5 D;  2IX1 A;  4L5S A;  1CFM A;  5JJZ A;  5IOC A;  3M4O B;  3S16 B;  4O1N A;  3TZU A;  2K5D A;  4IUV A;  2VY3 A;  4RH6 A;  4K6D A;  2JA8 B;  3NEL A;  4B3S L;  3VDY A;  2BE5 D;  1DCZ A;  4CDE C;  3KUP A;  4A3F B;  3TP7 A;  1LTB D;  1BNZ A;  1FGB D;  1ZKO A;  1RKN A;  4CGY B;  3S17 B;  4QMG A;  4L5R C;  4F7X A;  3NWT A;  3GTQ B;  3GTJ B;  3BZD B;  5FKA C;  4AYB G;  1HZ9 A;  1SYD A;  1LAC A;  1SNO A;  5LMN L;  4YWL A;  3TP6 A;  5J3B A;  3HOY B;  1SAP A;  1Q1E A;  3PV0 A;  2D0P A;  2RF4 A;  5BN4 A;  5FO8 B;  2LXK A;  3KDF B;  5GAH C;  1EIH A;  4KKT A;  4PNY A;  5C6A A;  1XPU A;  2IY5 B;  1TII D;  4KY5 A;  1MGS A;  1RTO A;  4OEL B;  1X32 A;  4YCW A;  4J15 A;  4ZLT F;  4IPD A;  3EQL C;  2R92 B;  5E4W C;  3HP3 A;  3QWN A;  4MHE A;  4JI6 L;  3G6E A;  4ZAI A;  2WKD A;  2RCN A;  5BN5 A;  2Z4H A;  1LYL A;  5AJ3 Q;  1BR9 A;  4BA1 I;  3HOU B;  4X66 Q;  2DJG C;  2NZO A;  4C2M B;  1F77 A;  1SE8 A;  2PZT A;  1STB A;  4LAA A;  1HA6 A;  3M3Y B;  1RF2 D;  2HCC A;  5HY6 A;  1XMQ L;  2D2C C;  1K83 B;  5CYU A;  5ELF A;  4ZK9 B;  5I6Y A;  2RDG A;  3DLL A;  1A3U A;  1VMP A;  1PZK D;  1UE7 A;  4DR7 Q;  4LFC Q;  1SNP A;  1EEI D;  4X62 Q;  3HOX B;  4OIK A;  4ZUJ A;  4HIO A;  4GN3 B;  2JEA I;  2IX0 A;  4NXN L;  4BY7 G;  4IOC A;  1VF7 A;  3K0Y A;  4EQO A;  1S40 A;  2SDF A;  2HUG A;  3D31 A;  2ZTE A;  3J81 c;  1VQF A;  3HOW G;  1EYC A;  4NB3 A;  5C4X G;  4YHH L;  1NSN S;  4DR5 L;  5IGG A;  1Q8I A;  1WCM H;  2I5L X;  4DR6 L;  1GUG A;  5FO7 B;  3HS0 C;  2PQE A;  1R4P B;  2F0U A;  1TWC H;  2A69 C;  1S5E D;  5CV4 A;  2I5M X;  3X3N A;  5DM7 3;  4NPS A;  5ELD A;  4QUF A;  2E5L Q;  2EIF A;  5EPJ A;  3MC0 B;  5HGT A;  1LTL A;  2RBM A;  4BY1 G;  3C46 A;  4A75 A;  2B63 H;  1I4R A;  2HQL A;  4I7A A;  4HIK A;  1GHK A;  1X56 A;  5IP7 G;  5JJI A;  3PUX A;  1Q7Y C;  1SYG A;  5ELC A;  3NXW A;  4C3H H;  1VQH A;  1YVC A;  4LUO A;  1RTN A;  1LTG D;  2HDM A;  2B2W C;  2RDF A;  4L5Q A;  1OXU A;  4KI0 A;  3J80 L;  3H94 A;  1A2T A;  1SMX A;  4JOI A;  4A3K B;  2Q2T A;  1GKH A;  2L55 A;  5DNF A;  5CV6 A;  1SND A;  1TU2 B;  3A5U A;  2TMP A;  4A3M G;  3L9A X;  4M1U B;  3S1Q H;  4DV2 Q;  3FHW A;  2NVX B;  2A68 D;  1F2M A;  4DR4 Q;  2K50 A;  4XT3 B;  3T51 B;  5KIX A;  4A76 A;  5KEE A;  1QWY A;  4K6L A;  1DGS A;  4A93 G;  1KHI A;  2PNR C;  2B2U A;  2QGQ A;  2OF1 A;  3VA7 A;  2R93 G;  3CKI B;  5M3F B;  2Z1C A;  1CZG A;  3GTL B;  3JAM c;  3SGI A;  3KLW A;  2OWO A;  1PH4 A;  3PIO A;  3CCJ A;  5DAU A;  4HJ7 A;  4DK3 C;  3HFZ B;  5T1I A;  3GTM H;  2E2I B;  2JA7 B;  2MP1 A;  3UI2 A;  3I4M H;  1ASZ A;  1MI2 A;  2ENB A;  1L0W A;  1S5F D;  2F0T A;  4RFB A;  4DV4 Q;  2NVY H;  2I0Q A;  3FKI B;  1A63 A;  1I5F A;  5I4D A;  4YCV A;  1E2W A;  2E2D C;  4P71 A;  1IYU A;  4HMI A;  1KLG D;  2N8N A;  2B2T A;  1BCP D;  4N9P A;  5FLM H;  3P1H A;  1J5E L;  4MTK A;  4MZ9 A;  3DUZ A;  2B2V A;  4DUZ L;  4GOP A;  1F2L A;  1PHJ A;  2Y0S E;  1XXG A;  1LUZ A;  3GQB A;  1N33 L;  4B3R Q;  1EOV A;  4OGQ C;  3SK4 A;  4DGZ A;  4G7O C;  2MQH A;  4RGM A;  3ND8 A;  4G7H C;  1QZH A;  4RCO A;  1ONL A;  1I6H B;  3S24 A;  4OIJ A;  3BVZ A;  5JAV A;  4IN3 A;  2A73 B;  2ICE C;  1HR0 Q;  2PW5 A;  1X54 A;  2MGS A;  1A62 A;  1B9M A;  2UU9 Q;  4DR3 L;  1EQV A;  1SDF A;  2VQE Q;  1TS2 A;  4FVM A;  3L7Z C;  1NUC A;  2VQF Q;  4LF7 Q;  5AFW A;  4YHH Q;  2A8V A;  2Z4I A;  1O78 A;  1BBU A;  1B53 A;  2BCO A;  5IYD H;  2ES2 A;  2BH2 A;  3A5Z B;  1AW7 A;  2EY2 A;  3CMA A;  3GTG B;  3A8I E;  2UUA Q;  2DNE A;  2MPM A;  5EQ0 A;  3K5N A;  2O4X A;  3FEW X;  4A3C H;  1Q90 A;  5M3M G;  3Q22 A;  2R6G A;  3PGZ A;  4LF5 Q;  4RGO S;  3T53 B;  2Y0S G;  4BXX G;  4A3B G;  4JYA Q;  4APV A;  4K8J A;  1YHQ A;  2BH8 A;  5JEA J;  4LUZ A;  4IJL A;  4JI0 Q;  2J4X A;  2IHF A;  1XNQ Q;  4XYO A;  3HOV H;  1AEX A;  1YNN C;  3J80 E;  5J22 A;  1AZQ A;  1I4G A;  1SFO H;  1AZP A;  2A6H D;  3V2T A;  1TWH B;  1ILQ A;  1JB3 A;  4UP8 A;  1PRT D;  5GRO A;  4DV1 L;  4TQU S;  4FDB A;  3QB3 A;  5T1G A;  2B2Y C;  1I94 Q;  1G91 A;  1SYB A;  4IFD H;  4JI3 Q;  1GD7 A;  1H9J A;  3KLS X;  4XTC S;  1PFM A;  1SRO A;  5M5W B;  1C8C A;  5C3E G;  4POF A;  4DFA A;  1P8L A;  3S1R B;  1K8M A;  2MHV A;  3DM1 A;  4JBJ A;  3MEF A;  1KRS A;  4DR2 L;  4C56 C;  2WB1 E;  1O80 A;  4A3I B;  2I5H A;  3TDQ A;  4KV6 A;  3OW7 A;  1IL2 A;  2YU9 B;  1SYE A;  2UUC Q;  1D5X C;  1NAP A;  4JBM A;  1SR3 A;  1Y1V B;  2JSO A;  2Q2I A;  1ML0 D;  4HCS A;  1L0X B;  5FLX c;  2KEC A;  4G7Z C;  3RZD B;  3S2H B;  3F2C A;  1DOL A;  3J7A F;  3IFT A;  1LT3 D;  2D9U A;  3FRP B;  3K81 C;  3VR5 A;  1KDB A;  4G57 A;  3D4D A;  4LF9 L;  4RA8 A;  3AQQ A;  4RGT A;  2L5T A;  3NTH A;  3MFY A;  1STG A;  2KJX A;  1X3G A;  5D3D A;  1SRU A;  3W1G A;  4LFA L;  1ROD A;  2I46 A;  4JK1 C;  1IW7 C;  1LAB A;  2F4V L;  3VR3 A;  3K58 A;  4JW0 A;  1KAW A;  2WB1 G;  3E5S A;  3JAM L;  2VNU D;  3I3C A;  4HN7 A;  1K8G A;  3PO3 B;  1QE6 A;  4JPB W;  2NZ1 D;  2PQA B;  1UUP A;  4A3J G;  4B3M Q;  1PA6 A;  1BF4 A;  4ALP A;  4JI7 Q;  1PXU A;  2WAC A;  4GKK L;  1U0L A;  2KVM A;  1L1O A;  4NXM L;  3I4N H;  2B29 A;  5JPM C;  2JA5 G;  1H9S A;  4X65 L;  5LMN W;  1TR5 A;  2L0C A;  1V1O A;  1OXS C;  1STY A;  4AQY L;  4RHR A;  1KAB A;  2NVT H;  1CHP D;  1SMY D;  1HJP A;  3HOZ B;  4HJ9 A;  1STH A;  1EWI A;  3HOW H;  5EKK A;  1MD2 D;  2SOB A;  3K6O A;  5C4X H;  5M5X B;  3SHL A;  1EQQ A;  3T1Y Q;  3MHB A;  3J81 j;  1AN8 A;  1JC7 A;  1QZG A;  1X3P A;  2AQ3 B;  1CTM A;  2P5Z X;  3K5O A;  3KK7 A;  1S5C D;  5FK9 C;  2G9H D;  4ZUI A;  1II3 A;  3GV3 A;  4C3H G;  1XMO Q;  4ZKC B;  4BY1 H;  3BZC A;  4DV5 L;  4QIW E;  1TKW B;  3TS0 A;  1F9R A;  1X9N A;  5IP7 H;  1WTQ A;  3KF6 B;  1VDZ A;  3IL8 A;  5C44 H;  1F2Y A;  4X3T A;  4IOA A;  4KKU A;  3NQT A;  3I72 A;  2KCT A;  3CP0 A;  2X6L A;  2E2H H;  3N6R A;  2BA1 A;  1D1I A;  5IT9 c;  2XRQ D;  3KFU A;  2ZJQ A;  4A3M H;  3BG3 A;  2A1A A;  3S1N B;  1HQR D;  1WCM B;  1IBM Q;  1B3A A;  1IXR A;  2B39 A;  3CCU A;  1PVO A;  2ATW A;  5K36 H;  1LO5 D;  4OON A;  2UXC Q;  3PCO B;  3KJO A;  2PCF B;  3UE0 A;  2K1B A;  4XDX A;  3SVM A;  3A55 A;  4A93 H;  3IAY A;  1YJ9 A;  1YZ6 A;  2R93 H;  3A54 A;  4PMW A;  4DAY B;  3J7A 5;  3I4M G;  3QR8 A;  2B63 B;  2CWA A;  4RAU C;  1BXT A;  3CHB D;  1XTD A;  1ZEQ X;  4WJ3 M;  5IGF A;  5JOB A;  3I4O A;  2FIN B;  3WOE A;  1NMF A;  4K14 A;  2F4V Q;  1M90 C;  1BKB A;  2Q2U A;  1DM0 B;  1GJX A;  3ITP A;  3JAM E;  4A3G B;  3CCR A;  1Q12 A;  3PF5 A;  3ICE A;  1Y1W B;  3K0X A;  3S1Q B;  4Y7N B;  3K5M A;  4NKL A;  4WRD A;  4C3I G;  4CDC C;  3H0G H;  5FLX L;  3SXH A;  2CVR A;  2AKW B;  3GTP H;  4V19 0;  2CW0 C;  5AJ3 L;  5I6W A;  1Y69 U;  1SE4 A;  1Z9F A;  1C0A A;  3CQZ B;  1FR3 A;  5GAE C;  4X66 L;  1MBY A;  2QA4 A;  2K5V A;  2V1C C;  4IQZ A;  2EJF C;  4FNF A;  4PV1 C;  3BDL A;  3OHX C;  2F0G A;  4JC0 A;  1PRT F;  2EVB A;  2AWN A;  2UXB Q;  4EQ5 A;  1G6P A;  2QKI C;  3PO2 H;  2MJ8 A;  2HIX A;  1TWG H;  5E1F A;  1E7Z A;  4PMB A;  4BS9 A;  4DR7 L;  1FGU A;  5CV8 A;  4R8N A;  5KND A;  5C0X J;  4X62 L;  1CA6 A;  1NMG A;  5FJ8 G;  3M7G A;  1A15 A;  1ICF B;  3D0F A;  4KHV A;  2EE1 A;  4OX9 Q;  1RHP A;  2BDO A;  3PUZ A;  1QG7 A;  1EOT A;  3I2Z A;  2UXD Q;  4R1J A;  4A3C G;  1KL9 A;  1JWM D;  4EVO A;  1EYD A;  3L3O C;  5ISR A;  3GD7 A;  1JOK A;  4JI5 Q;  1TQO A;  2ICI A;  1TS3 A;  4JI2 Q;  4ZKB B;  2F3W A;  1U5K A;  3OIQ A;  3HGB A;  5M3M H;  5IGE A;  2XVS A;  3EN2 A;  4DXF A;  3HOV G;  2LSS A;  4BXX H;  4KY6 A;  2F1M A;  1HNW Q;  2V4D A;  2E5L L;  1PFN A;  3L2P A;  2LS0 1;  1W2B A;  4EX5 A;  5M5Y H;  3I91 A;  1VQP A;  2R7Z G;  1SYC A;  1PH2 A;  4IFD G;  4ODG A;  1D1K A;  2N3S A;  2PI2 E;  5EAY A;  3R93 A;  2PW7 A;  1GM5 A;  2EXD A;  5GQO A;  3M7N A;  2DGY A;  5C4J B;  3CCL A;  1HNX Q;  2BOS A;  1GXD C;  4PMC A;  3T4A C;  4DU9 A;  3U9O A;  2O5I C;  5C3E H;  2ALY B;  1WTV A;  2Z9H A;  3KDF A;  2CH4 A;  1O7I A;  4DV2 L;  3G7L A;  1FYC A;  4NDX A;  5GAG C;  3R3O A;  4DR4 L;  4FO2 A;  1VQA A;  1DD2 A;  1YNJ D;  3HOU G;  3H15 A;  3KLS A;  1MSH A;  2LMC B;  4DPG A;  3D6W A;  2AQ1 B;  1J6Q A;  1UEA B;  1EY0 A;  4WOR A;  1LT4 D;  2WII B;  2ZT9 C;  3M4P A;  2B2W A;  1V8Q A;  3S1M B;  1I50 H;  1G6Z A;  2LY7 A;  5IT9 L;  1H9K A;  2KHI A;  1HUM A;  4A4I A;  5C3X A;  2ASB A;  4X6A H;  2ZTC A;  1JT8 A;  4A3D H;  2DN8 A;  5HGQ A;  3IRB A;  1JOR A;  1O7L A;  1U4R A;  4MNO A;  2K32 A;  4PZ6 A;  3PUW A;  4DV4 L;  3MEH A;  5D65 A;  4H7B A;  4IZ8 A;  1YJN A;  1VQJ A;  1R4Q B;  4C1N I;  3BZK A;  5E3F A;  1B1Z A;  1SSO A;  1JMC A;  1AH9 A;  4AYB B;  2C9O A;  1HZA A;  2JYO A;  1D5M C;  3MXN B;  3EA6 A;  2XRS D;  4ULL A;  2PI2 A;  2QCP X;  4B3R L;  4IUQ A;  4A3J H;  3I4N G;  2GVA A;  3MXP A;  4JG2 A;  1TWF H;  5C3W A;  2NWG A;  3NHH A;  4DNR B;  1ASY A;  1JWU D;  1TY2 A;  3NWS A;  5EJW A;  2RDH A;  2NB0 A;  3E3X A;  1D2B A;  1TT2 A;  1YNX A;  2B3G A;  1HR0 L;  2JA5 H;  5D14 A;  1PDQ A;  5LMU L;  4WJW A;  3CCE A;  2UU9 L;  1WTO A;  1DYQ A;  3QJY A;  2VQE L;  3GTO H;  1WYD A;  2WFW A;  2VQF L;  1KIX A;  4LF7 L;  1SJE D;  1PH3 A;  3SK5 A;  3AMU A;  4K5V A;  2FJ2 A;  2KQ3 A;  2XGT A;  4JI1 Q;  4CBV A;  4DN4 M;  4X64 Q;  1XJV A;  3G71 A;  3URY A;  3K57 A;  1MJE A;  1IKM A;  1IBK Q;  5A2Q L;  3RZO H;  2IL8 A;  1WI5 A;  4YWM A;  3RN2 A;  2UUA L;  4X3S A;  3TBI B;  2DNC A;  3FMC A;  1NR2 A;  2BE5 C;  3LX0 A;  3TN2 A;  2NVQ B;  4QGU A;  4CKB A;  2I07 B;  1MIU A;  2K6A A;  1X3Q A;  4LF5 L;  3SK8 A;  3K59 A;  4GLX A;  2WP8 J;  3H3V I;  2SEB D;  2A5H A;  4K0K Q;  4JYA L;  1KD1 C;  1KNA A;  1PFS A;  3RLF A;  3MZ5 A;  2GA4 B;  1N9W A;  4QCL A;  1I3Q B;  4JI0 L;  5C44 G;  4LF4 Q;  3KOJ A;  2EJM A;  1XNQ L;  3DHQ A;  3ULL A;  3GTK H;  3K7A H;  4YWK A;  2ZJP A;  5CV9 A;  1BBX C;  3NBH A;  3S9W A;  1S72 A;  2CHB D;  5I2Y A;  2L1B A;  1WD0 A;  5LL6 S;  3NE5 B;  2JA7 G;  4BY7 B;  3G6J B;  2N78 A;  4IUU A;  3BJU A;  3NBH B;  3E0J A;  2NVT B;  3GP7 A;  1I94 L;  3VYU A;  2PMZ B;  5K36 G;  5EKI A;  4JI3 L;  5EBD A;  3FDT A;  1G51 A;  3WWV A;  1QNU A;  4KY7 A;  2PPB C;  3W2D A;  3HOW B;  5C4X B;  2CH4 W;  2CQO A;  2TSS A;  4R4C A;  4J6H A;  1JR0 D;  1AFP A;  4OWX B;  4N9T A;  1Q46 A;  3I7F A;  3AFP A;  1SLJ A;  2FXQ A;  1Z47 A;  1I6V C;  3SEB A;  1E2Z A;  2CWP A;  4R4O A;  2PO4 A;  5KNC A;  1ILP A;  1HFN A;  1EU4 A;  5K5P A;  4L6T B;  2E2J H;  3K8A A;  2JA6 G;  3STB D;  2UUC L;  1NE3 A;  2KHS A;  1FD7 D;  3F2U A;  3F1Z A;  3KLR A;  3S15 H;  2B2Y A;  1I4H A;  1T9H A;  4BY1 B;  5H1S E;  1K3R A;  5JEA G;  1AP0 A;  2VW9 A;  3Q23 A;  2EYL A;  5C4Z A;  3CPF A;  3QO2 A;  2OEO A;  4CJ2 C;  3H0G G;  3S14 H;  4DV3 Q;  4MTN A;  2YYZ A;  4K2K A;  3CC7 A;  2E2H B;  2JXM B;  1EFI D;  2VUM G;  2NUC A;  3O13 A;  4KHP Q;  1V43 A;  4A3M B;  1B8A A;  4C3I H;  3RUZ A;  1O7Y A;  1ESF A;  3G48 A;  1R9T B;  2EY1 A;  4QL5 A;  1GUO A;  3I8Z A;  4UHV A;  4DK0 A;  2WAQ B;  1E24 A;  1KLU D;  1BCP B;  4WFN 3;  4B3M L;  1CHQ D;  3PO2 G;  2R7D A;  3W3A A;  4A93 B;  1PYS B;  3ZYY X;  5LMU Q;  4I65 A;  4JI7 L;  1H95 A;  1VMC A;  2R93 B;  1Q1B A;  2F03 A;  4JBK A;  3VR4 A;  1TY0 A;  1STN A;  2CQA A;  1RJT A;  1EIG A;  2K04 A;  4DK1 A;  4YY3 Q;  3K5L A;  1MKH A;  2QEX A;  2A19 A;  1IBL Q;  2Q2H A;  1Y8P B;  5A2Q E;  4A3E G;  5FJ8 H;  3M4O H;  3KF8 B;  1EL0 A;  4IPH A;  5M9O A;  5J39 A;  3S16 H;  4KK7 A;  5NUC A;  2UUB Q;  1MSG A;  3U4V A;  3CCS A;  3HKS A;  2JA8 H;  4EQP A;  3A8J E;  2DY7 A;  3T1Y L;  3ULP A;  3QG1 A;  2MNA A;  3S17 H;  3AFQ A;  4GNX B;  4K8I A;  3GTQ H;  1Z6H A;  1W6J A;  2A68 C;  5CBA E;  2ZTD A;  1VQ4 A;  1PTO D;  1U4L A;  5COR A;  1E1T A;  1WJJ A; 
#chains in the Genus database with same CATH homology
 4Z9C B;  3D6C A;  3RD4 A;  4Q0F A;  1V1P B;  1TWG B;  5CC4 A;  4HSP A;  2E74 C;  4UAI A;  3ERQ A;  1ESR A;  1SE3 A;  2B2U C;  1EY4 A;  5LHY 1;  1QOH A;  1LTR D;  2N88 A;  1PZI D;  1CQF A;  4KD4 A;  1T5E A;  1PLF A;  4MIU A;  1PRT B;  3N52 A;  2K28 A;  4NW2 A;  3C3L A;  5M3M B;  1EY9 A;  1BCP C;  4NMZ A;  2Y0S B;  1S5D D;  4A3B B;  3MFG A;  3D3R A;  2MUY A;  4ZYS A;  2B2V C;  1TS4 A;  3A56 A;  2A6E D;  4FF2 A;  4O42 A;  1G29 1;  4KJN A;  4IUT A;  3VR6 A;  1LT6 D;  4Q5V A;  2F0I A;  1U4M A;  4CJ0 B;  3BYT B;  3NSW A;  1SNC A;  4L63 B;  4H44 C;  2F0S A;  1JWS D;  3V05 A;  5C5M A;  5C3E B;  4CHT B;  1IYV A;  1Z7T A;  2KEE A;  2NTS A;  2F0F A;  4OO1 I;  2O5J C;  4ID6 A;  1F9P A;  1CI3 M;  4YIJ A;  4TSS A;  2Q8T A;  1S5B D;  2NTT A;  5C0X I;  3TZD A;  2AUJ D;  1I50 B;  1ZYR D;  3QOL A;  1QJO A;  1UNS A;  5CV5 A;  1ET6 A;  4IUP A;  1Y8N B;  1KAA A;  2SNS A;  4CKC A;  1ICW A;  2H1E A;  3DWA A;  4KKS A;  2A6H C;  3MXU A;  1EWH A;  1PRT C;  4KN4 C;  2O2L D;  3J81 E;  2JEB I;  2NYZ D;  4RHS A;  4LJZ C;  1FNU A;  3D8G A;  4QUC A;  4A3J B;  4DA2 A;  1TWF B;  2X6G A;  4S3S A;  1DXM A;  1HUN A;  2EY6 A;  1BCP F;  2AQ2 B;  4FXD A;  2JA5 B;  1LTS D;  3SDZ A;  2E75 C;  2KUM A;  3HKZ B;  5I9P A;  1SNQ A;  2PZW A;  3PMF A;  2BA0 A;  3M85 A;  2LFN A;  3C2P A;  2VXW A;  5C0X G;  4CKE A;  1KTK A;  2E76 C;  1TWC B;  2FMM A;  1OXV A;  4DAY A;  2QF7 A;  1J8I A;  3I70 A;  4U68 A;  3VYT A;  3DEO A;  1S4Z A;  3R2I A;  4C3J G;  1A2U A;  4V0B A;  4HR7 B;  2F0K A;  4XQJ A;  2FHT A;  4C3H B;  3GTK B;  3K7A B;  3OWF A;  2FMC A;  2IT1 A;  2Z8L A;  5JEA H;  5TSS A;  3T13 A;  1I4X A;  4XQQ A;  1DJR D;  4HAE A;  3FPU B;  2NN6 I;  3P20 A;  3SK6 A;  1PTO F;  2OT2 A;  5JPN C;  1SMY C;  3I90 A;  5KGU A;  3HG9 A;  1KDA A;  1LTA D;  4TKO B;  1QB5 D;  1EZ8 A;  3OMG A;  5IGC A;  4FXK C;  4FF3 A;  1HHV A;  2F0V A;  1SE2 A;  2XNA C;  1PTO H;  1STA A;  5EKL A;  3S15 B;  3GTM B;  1JE4 A;  3TME A;  3I4M B;  3HRZ C;  1NCV A;  3NUC A;  4XXE A;  3H09 A;  4R8I A;  2DY8 A;  2NVY B;  4HMJ A;  1D5Z C;  1L0Y B;  3S14 B;  1H9M A;  2HCI A;  4KD3 A;  1LT5 D;  5CBE E;  3MXG A;  2EPB A;  4C3I B;  5FO9 B;  5JVG 3;  1LV9 A;  1F9Q A;  4DAP A;  2IWH A;  3Q0A A;  2ZXR A;  1W6K A;  2M00 A;  1KNE A;  2NN6 G;  4QB4 A;  4RWS C;  2EYP A;  4RKL A;  3EVQ A;  1J9O A;  3Q24 A;  5CMD A;  3VA5 A;  4J1M A;  3KBX A;  4X3K A;  1C4Q A;  5G3L D;  3BVM A;  2F4I A;  1OXT A;  1RCV D;  2R3Z A;  4XQN A;  4FF1 A;  2WIN B;  2A69 D;  2VB2 X;  2ID0 A;  2EJG C;  1A3T A;  4L8J A;  5CV7 A;  3MA2 B;  1DOM A;  2K01 A;  3P7J A;  5IIF A;  3NK9 A;  1BQQ T;  4B9W A;  3DWP A;  1QNK A;  1DZ1 A;  3GO5 A;  3HOV B;  1WTR A;  3FVQ A;  1LTI D;  4ZRZ A;  3OMC A;  4DNT B;  2A74 C;  3J7Y W;  1I4Q A;  2EYH A;  3E6Z X;  1SFO B;  3D4R A;  5KNB A;  2N55 A;  2R7Z B;  3MTS A;  5FLX E;  4H0L C;  4KHZ A;  4DF7 A;  4ZQ3 A;  4I7Z C;  3BVG A;  3TP5 A;  3LWE A;  2XIW A;  1GHJ A;  2H4O A;  1LTT D;  3MXN A;  4ABN A;  2F0W A;  5LL6 X;  4LMQ D;  2IX3 A;  1IHZ A;  3NPP A;  2IJ0 A;  3A7A B;  1C48 A;  4HED A;  2K33 A;  4TRD A;  1OXX K;  3VYR A;  1UAP A;  4DXG A;  5COY A;  3KBG A;  4IFD J;  4EGV A;  1JOQ A;  1PMR A;  2F0L A;  5J1Z A;  5HUR A;  3OIP A;  3PUY A;  1EY6 A;  4RCN A;  2XWB B;  3AU7 A;  4IAL A;  5JVH 3;  1U9R A;  2F0H A;  1E2V A;  2K5W A;  3Q6S A;  2OXP A;  1BUV T;  1JOO A;  2L4N A;  2F0D A;  2EYF A;  4KTA A;  3ERO A;  3WOF A;  4BA2 I;  1ENC A;  2QDB A;  4LK1 C;  2PYK A;  2FFK B;  1B4O A;  1EY8 A;  1B9N A;  3I73 A;  3H6M A;  1B50 A;  1YNJ C;  1G8Z D;  5EGT A;  3I4N B;  2C5C A;  1XWE A;  1WVL A;  2LKV A;  1RD9 D;  2B8F A;  4OO1 H;  2EYM A;  2RKS A;  3NQI A;  1JIC A;  1EU3 A;  5IOD A;  4GZY C;  2X69 A;  4B08 A;  1WTX A;  1PZJ D;  1ZXT A;  3U9S A;  5C0X H;  3CU7 A;  1XTC D;  3DWQ A;  2ZXO A;  1HFG A;  4QF4 A;  4XT1 B;  2EOT A;  1NR4 A;  4ILW A;  3C1E A;  2SNM A;  5IT9 E;  1CZW A;  4K5W A;  3R8B A;  1U4P A;  5KYI A;  1WTP A;  1YNN D;  3QIA A;  1OO9 B;  3OSO A;  5IGD A;  3NTK A;  3MVV A;  1FNW A;  4XYQ A;  3P75 A;  3OWE B;  1GOZ A;  2IPK D;  5C44 B;  1HTP A;  4B9X A;  5EPK A;  3EFX D;  3PIP 3;  1LLR D;  1EWC A;  1EQT A;  2R61 A;  2HDL A;  4P2C B;  4FYD A;  2EXZ A;  4HSV A;  2KA7 A;  3QOJ A;  5EPL A;  2XN9 C;  5CGK A;  4K2L A;  4OHJ A;  2PZU A;  1EY5 A;  3DEP A;  1G2T A;  2JA6 B;  2JP1 A;  5DM6 3;  2F0E A;  2KOL A;  1A6X A;  5G3L F;  3KF8 A;  1PYW D;  1FNV A;  1EYA A;  3HZX A;  3DMU A;  4U67 3;  4H13 C;  1HTL D;  4KMU C;  1IW7 D;  4KJO A;  1VCI A;  4XIG S;  1HXY D;  2F0O A;  3H0G B;  3GTP B;  2BDN A;  1ENF A;  2VUM B;  1TVX A;  3LWU A;  4CJ1 B;  1V1P A;  1DOK A;  4IUN A;  1PFB A;  2NN6 H;  2Q8I B;  3PO2 B;  1PTO B;  1IL8 A;  1K8O A;  4F8M A;  3MAQ A;  1EY7 A;  1HCZ A;  2K5Q A;  2QIL A;  4HCE A;  1SBB B;  3ONA B;  2RQX A;  1GUN A;  1B2T A;  4A3E B;  1QIL A;  4ME5 A;  2AUK A;  4KN7 C;  5A35 A;  1DON A;  2Q8R E;  3V96 A;  1KDC A;  1CM9 A;  2B2T C;  1WTW A;  5M5Y B;  3EJI A;  2F0M A;  1Y8O B;  4X3U A;  2ZXP A;  1M4V A;  5KYL A;  3FPP A;  2JE6 I;  3NTI A;  1STE A;  5F2D A;  3H3V C;  4DAV A;  3CRL C;  1T5X D;  3HEJ A;  1O7Z A;  1HA5 A;  3MWY W;  1ET9 A;  3A7L A;  2L11 A;  2D62 A;  3NBI A;  1JCK B;  2KCN A;  3M4Y A;  2F0Q A;  4K5X A;  5E4X A;  2AWO A;  4OL7 A;  3BYY B;  1HRJ A;  3S2D B;  1ENA A;  2IW3 A;  3AB9 A;  1HQM C;  1PTO C;  1SNM A;  1Q3L A;  2L9H A;  4BWG B;  4A3D B;  2EZV A;  1GUW A;  5BN3 A;  2D5D A;  1H9R A;  1RDP D;  3R2T A;  1SXT A;  4FXG C;  5KRU A;  2RSO A;  1F9S A;  1H9S B;  2CW0 D;  3SR1 A;  5C5L A;  3LNN A;  3BS1 A;  2EY5 A;  2J0T D;  2WB1 B;  1WD1 A;  5IGB A;  2QEJ C;  1G2S A;  1EEF D;  1GUT A;  5FOB B;  3BDO A;  1D6E C;  1CA5 A;  5ELE A;  2EDG A;  4BBR B;  3J7A V;  1TWA B;  3VR2 A;  2RVL A;  3OOC A;  4F88 A;  3ND9 A;  4UDU C;  3TSS A;  4OO1 G;  1A3V A;  3H91 A;  3IFD A;  2KCC A;  5I2X A;  4BBS B;  1B44 D;  3SE0 A;  4C1N K;  3GTO B;  4F87 A;  4PQX A;  2EYJ A;  4E6I A;  3RZO B;  1SEB D;  1TS5 A;  2A6E C;  2F0J A;  2J7Z A;  2EYO A;  1BOS A;  2F0N A;  1CT1 D;  1XYI A;  1HPC A;  2KED A;  3IKJ A;  2VB3 X;  3VYS A;  5EBC A;  2K03 A;  2WKC A;  4HTH A;  3C1F A;  1E0B A;  2XWJ B;  3BDC A;  1VF5 C;  2F0P A;  4FF4 A;  3RMH A;  2RA4 A;  2K05 A;  1F2Z A;  1ZYR C;  3A8K E;  1BDO A;  1SJH D;  1CK1 A;  1SYF A;  4RGN A;  2G9D A;  3OPO A;  2NBF A;  1JQY D;  2WV6 D;  4RKB A;  4J8Q A;  2E2J B;  5ELB A;  4EQN A;  4R9W A;  3GV6 A;  2M9V A;  4IFD I;  2HQE A;  3NP8 A;  3X3M A;  1IKL A;  4QIW B;  4C3J B;  4G4K A;  3D4W A;  3T56 B;  1XX8 A;  2L12 A;  4NP5 A;  1CQV A;  4JBW A;  2K7V A;  5C4H A;  3PUV A;  1I4P A;  2XSC A;  5CR3 A;  4IUR A;  5D3I B;  1GUS A;  3DXJ C;  1M8A A;  5DEH A;  2F3V A;  2M2L A;  4M8A A;  3CRK C;  2RSN A;  3PIO 3;  5I9O A;  2B8G A;  3WDN A;  3T16 A;  1QCB D;  3TP8 A;  4MN3 A;  1BO0 A;  3I4L A;  1EZ6 A;  4FP5 D;  2IX1 A;  1CFM A;  5JJZ A;  5IOC A;  3M4O B;  3S16 B;  4O1N A;  3TZU A;  2K5D A;  4IUV A;  4RH6 A;  4K6D A;  2JA8 B;  2BE5 D;  1DCZ A;  4A3F B;  3KUP A;  3TP7 A;  1LTB D;  1BNZ A;  1FGB D;  1ZKO A;  1RKN A;  4CGY B;  3S17 B;  4QMG A;  4F7X A;  3NWT A;  3GTQ B;  3GTJ B;  3BZD B;  5FKA C;  1SYD A;  1LAC A;  1SNO A;  3TP6 A;  3HOY B;  1SAP A;  1Q1E A;  3PV0 A;  5FO8 B;  5BN4 A;  1EIH A;  4KKT A;  4PNY A;  5C6A A;  1TII D;  4KY5 A;  1MGS A;  1RTO A;  1X32 A;  4ZLT F;  3EQL C;  2R92 B;  5E4W C;  3HP3 A;  3QWN A;  4MHE A;  4ZAI A;  2WKD A;  5BN5 A;  2Z4H A;  1BR9 A;  4BA1 I;  3HOU B;  4C2M B;  1F77 A;  2PZT A;  1STB A;  4LAA A;  1HA6 A;  3M3Y B;  1RF2 D;  2HCC A;  2D2C C;  1K83 B;  5CYU A;  5ELF A;  4ZK9 B;  5I6Y A;  2RDG A;  1A3U A;  1VMP A;  1PZK D;  1SNP A;  1EEI D;  3HOX B;  4OIK A;  4ZUJ A;  2JEA I;  2IX0 A;  1VF7 A;  3K0Y A;  4EQO A;  2SDF A;  2HUG A;  3D31 A;  1EYC A;  1NSN S;  5IGG A;  1Q8I A;  1GUG A;  5FO7 B;  3HS0 C;  2PQE A;  1R4P B;  2F0U A;  2A69 C;  1S5E D;  5CV4 A;  3X3N A;  5DM7 3;  5ELD A;  4QUF A;  5EPJ A;  3MC0 B;  5HGT A;  2RBM A;  3C46 A;  1I4R A;  1GHK A;  3PUX A;  1SYG A;  5ELC A;  3NXW A;  1RTN A;  1LTG D;  2HDM A;  2B2W C;  2RDF A;  1OXU A;  4KI0 A;  3J80 L;  3H94 A;  1A2T A;  4A3K B;  2L55 A;  5DNF A;  5CV6 A;  1SND A;  1TU2 B;  2TMP A;  3L9A X;  4M1U B;  2NVX B;  2A68 D;  1F2M A;  4XT3 B;  3T51 B;  5KIX A;  5KEE A;  1QWY A;  4K6L A;  2PNR C;  2B2U A;  2OF1 A;  3VA7 A;  3CKI B;  5M3F B;  2Z1C A;  1CZG A;  3GTL B;  5DAU A;  5T1I A;  2E2I B;  2JA7 B;  2MP1 A;  3UI2 A;  1MI2 A;  2ENB A;  1S5F D;  2F0T A;  4RFB A;  3FKI B;  5I4D A;  1E2W A;  2E2D C;  1IYU A;  4HMI A;  1KLG D;  2B2T A;  1BCP D;  4N9P A;  3P1H A;  3DUZ A;  2B2V A;  1F2L A;  3GQB A;  1XXG A;  4OGQ C;  3SK4 A;  4DGZ A;  4G7O C;  4RGM A;  3ND8 A;  4G7H C;  4RCO A;  1ONL A;  1I6H B;  4OIJ A;  3BVZ A;  5JAV A;  4IN3 A;  2A73 B;  2ICE C;  2PW5 A;  2MGS A;  1B9M A;  1EQV A;  1SDF A;  1TS2 A;  4FVM A;  3L7Z C;  1NUC A;  5AFW A;  2Z4I A;  1O78 A;  1B53 A;  2BCO A;  1AW7 A;  2EY2 A;  3GTG B;  3A8I E;  2DNE A;  2MPM A;  5EQ0 A;  3K5N A;  2O4X A;  3FEW X;  1Q90 A;  3Q22 A;  2R6G A;  4RGO S;  3T53 B;  4K8J A;  5JEA J;  2J4X A;  4XYO A;  1AEX A;  1YNN C;  3J80 E;  5J22 A;  1AZQ A;  1I4G A;  1AZP A;  2A6H D;  3V2T A;  1TWH B;  1ILQ A;  1JB3 A;  1PRT D;  4TQU S;  3QB3 A;  5T1G A;  2B2Y C;  1G91 A;  1SYB A;  4IFD H;  3KLS X;  1H9J A;  4XTC S;  1PFM A;  5M5W B;  1C8C A;  4DFA A;  3S1R B;  1K8M A;  2MHV A;  3DM1 A;  4C56 C;  1O80 A;  4A3I B;  3TDQ A;  4KV6 A;  3OW7 A;  2YU9 B;  1SYE A;  1D5X C;  1NAP A;  1Y1V B;  2JSO A;  4G7Z C;  1ML0 D;  4HCS A;  1L0X B;  2KEC A;  3RZD B;  3S2H B;  1DOL A;  3J7A F;  3IFT A;  1LT3 D;  2D9U A;  3FRP B;  3VR5 A;  1KDB A;  4G57 A;  3D4D A;  4RA8 A;  4RGT A;  2L5T A;  3NTH A;  3MFY A;  1STG A;  2KJX A;  5D3D A;  1ROD A;  2I46 A;  4JK1 C;  1IW7 C;  1LAB A;  3VR3 A;  3K58 A;  3E5S A;  3JAM L;  2VNU D;  3I3C A;  4HN7 A;  3PO3 B;  1QE6 A;  2NZ1 D;  1UUP A;  1BF4 A;  1PXU A;  2WAC A;  2KVM A;  5JPM C;  1H9S A;  1TR5 A;  2L0C A;  1V1O A;  1OXS C;  1STY A;  4RHR A;  1KAB A;  1CHP D;  1SMY D;  3HOZ B;  1STH A;  5EKK A;  1MD2 D;  2SOB A;  3K6O A;  5M5X B;  3SHL A;  3MHB A;  1AN8 A;  1JC7 A;  1X3P A;  2AQ3 B;  1CTM A;  3K5O A;  3KK7 A;  1S5C D;  5FK9 C;  2G9H D;  4ZUI A;  1II3 A;  3GV3 A;  4C3H G;  4ZKC B;  1TKW B;  1F9R A;  1WTQ A;  1VDZ A;  3IL8 A;  1F2Y A;  4X3T A;  4KKU A;  3NQT A;  3I72 A;  2X6L A;  3N6R A;  2BA1 A;  1D1I A;  2XRQ D;  3BG3 A;  3S1N B;  1HQR D;  1WCM B;  1B3A A;  2B39 A;  5K36 H;  1LO5 D;  2PCF B;  2K1B A;  4XDX A;  3SVM A;  3A55 A;  3IAY A;  3A54 A;  4PMW A;  2B63 B;  4RAU C;  1BXT A;  3CHB D;  1ZEQ X;  5IGF A;  5JOB A;  2FIN B;  3WOE A;  4K14 A;  1DM0 B;  1GJX A;  3ITP A;  3JAM E;  4A3G B;  1Q12 A;  1Y1W B;  3S1Q B;  4Y7N B;  3K5M A;  4NKL A;  4WRD A;  4C3I G;  5FLX L;  3SXH A;  2CVR A;  4V19 0;  2CW0 C;  1Y69 U;  5I6W A;  1SE4 A;  3CQZ B;  1FR3 A;  1MBY A;  4IQZ A;  2EJF C;  4FNF A;  4PV1 C;  3BDL A;  3OHX C;  2F0G A;  1PRT F;  2EVB A;  2AWN A;  2QKI C;  2MJ8 A;  5E1F A;  4PMB A;  4BS9 A;  5CV8 A;  4R8N A;  5KND A;  5C0X J;  1CA6 A;  3M7G A;  1A15 A;  4KHV A;  2EE1 A;  1RHP A;  2BDO A;  3PUZ A;  1QG7 A;  1EOT A;  1JWM D;  4EVO A;  1EYD A;  3L3O C;  5ISR A;  3GD7 A;  1JOK A;  1TQO A;  2ICI A;  1TS3 A;  4ZKB B;  2F3W A;  3OIQ A;  3HGB A;  5IGE A;  2XVS A;  4DXF A;  4KY6 A;  2F1M A;  2V4D A;  1PFN A;  2LS0 1;  3I91 A;  1SYC A;  4IFD G;  4ODG A;  1D1K A;  3R93 A;  2PW7 A;  3M7N A;  5C4J B;  2BOS A;  1GXD C;  4PMC A;  3T4A C;  4DU9 A;  3U9O A;  2O5I C;  1WTV A;  3G7L A;  1FYC A;  4NDX A;  3R3O A;  4FO2 A;  1DD2 A;  1YNJ D;  3KLS A;  1MSH A;  2LMC B;  3D6W A;  2AQ1 B;  1UEA B;  1EY0 A;  4WOR A;  1LT4 D;  2WII B;  2ZT9 C;  2B2W A;  1V8Q A;  3S1M B;  1G6Z A;  2LY7 A;  5IT9 L;  1H9K A;  5C3X A;  1HUM A;  2DN8 A;  1JOR A;  1O7L A;  1U4R A;  2K32 A;  3PUW A;  3MEH A;  5D65 A;  4H7B A;  4IZ8 A;  1R4Q B;  4C1N I;  5E3F A;  1B1Z A;  1SSO A;  4AYB B;  2C9O A;  2JYO A;  1D5M C;  3EA6 A;  2XRS D;  4ULL A;  2QCP X;  4IUQ A;  3MXP A;  5C3W A;  2NWG A;  3NHH A;  4DNR B;  1JWU D;  1TY2 A;  3NWS A;  5EJW A;  2RDH A;  2NB0 A;  1D2B A;  1TT2 A;  5D14 A;  1PDQ A;  4WJW A;  1WTO A;  1DYQ A;  3QJY A;  1SJE D;  3SK5 A;  3AMU A;  4K5V A;  2FJ2 A;  2KQ3 A;  4CBV A;  4DN4 M;  3URY A;  3K57 A;  1IKM A;  5A2Q L;  2IL8 A;  4X3S A;  3TBI B;  2DNC A;  3FMC A;  1NR2 A;  2BE5 C;  3LX0 A;  3TN2 A;  2NVQ B;  4CKB A;  2I07 B;  2K6A A;  1X3Q A;  3SK8 A;  3K59 A;  2WP8 J;  2SEB D;  2A5H A;  1KNA A;  3RLF A;  3MZ5 A;  2GA4 B;  4QCL A;  1I3Q B;  2EJM A;  3DHQ A;  5CV9 A;  1BBX C;  3NBH A;  3S9W A;  2CHB D;  5I2Y A;  2L1B A;  1WD0 A;  5LL6 S;  3NE5 B;  4BY7 B;  3G6J B;  4IUU A;  3E0J A;  2NVT B;  3GP7 A;  3VYU A;  2PMZ B;  5K36 G;  5EKI A;  5EBD A;  3FDT A;  2PPB C;  1QNU A;  4KY7 A;  3HOW B;  3W2D A;  5C4X B;  1AFP A;  2TSS A;  4J6H A;  1JR0 D;  4N9T A;  1Z47 A;  1I6V C;  3SEB A;  1E2Z A;  2PO4 A;  5KNC A;  1ILP A;  1HFN A;  1EU4 A;  5K5P A;  4L6T B;  2KHS A;  1FD7 D;  3F2U A;  3KLR A;  2B2Y A;  1I4H A;  4BY1 B;  5JEA G;  1AP0 A;  3Q23 A;  2EYL A;  5C4Z A;  3QO2 A;  2OEO A;  4CJ2 C;  2YYZ A;  4K2K A;  2E2H B;  2JXM B;  1EFI D;  2NUC A;  3O13 A;  1V43 A;  4A3M B;  3RUZ A;  1O7Y A;  1R9T B;  2EY1 A;  1GUO A;  3I8Z A;  4DK0 A;  2WAQ B;  1KLU D;  1BCP B;  4WFN 3;  1CHQ D;  3W3A A;  4A93 B;  3ZYY X;  4I65 A;  1VMC A;  2R93 B;  1Q1B A;  2F03 A;  3VR4 A;  1TY0 A;  1STN A;  2CQA A;  1RJT A;  1EIG A;  2K04 A;  4DK1 A;  3K5L A;  1Y8P B;  5A2Q E;  1EL0 A;  5M9O A;  5J39 A;  4KK7 A;  5NUC A;  1MSG A;  4EQP A;  3A8J E;  2DY7 A;  3QG1 A;  4K8I A;  1Z6H A;  1W6J A;  2A68 C;  5CBA E;  1PTO D;  1U4L A;  5COR A;  3J81 L;  1ESF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...