4RHSA

Crystal structure of gd2 bound pltb
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVSKQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALVGLSSCSATQCFGPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host adaptation of a bacterial toxin from the human pathogen salmonella typhi.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Sugar binding protein
molecule keywords Putative pertussis-like toxin subunit
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rhsA00
1EU4A 2XRSD 1STEA 1JCKB 1FNUA 1M4VA 1SE2A 1ESFA 4C56C 1I4GA 1DYQA 2XNAC 1CK1A 1HA5A 1SXTA 5D3DA 1V1OA 2J4XA 4Z9CB 2NTTA 2RDHA 4L63B 3O13A 1I4RA 1PTOB 4RGOS 1KLGD 1PRTF 1LTGD 1PRTD 1TS3A 1TS2A 1FGBD 3OWEB 3SEBA 1JR0D 3KLSX 2IJ0A 1S5CD 4RGTA 2RDGA 4BWGB 1KTKA 3BVMA 1DJRD 1LLRD 2G9HD 2ICIA 3DWAA 1EWCA 4K6LA 5ELCA 1EU3A 3BYTB 2IPKD 4RH6A 2SEBD 1FD7D 1S5BD 5FKAC 4RHRA 1V1PB 4RCOA 5D3IB 4L6TB 4TSSA 1GOZA 1G8ZD 1L0XB 5ELDA 1TY2A 1PRTB 3BZDB 1LTRD 1BXTA 3V05A 2NTSA 1CHPD 1PZJD 1ET6A 1HXYD 1D5MC 1I4QA 1ET9A 1SEBD 4UDUC 5ELFA 1LT6D 1PRTC 4RGMA 1TS5A 1EFID 4ZYSA 1I4PA 1LTBD 4O1NA 1LTID 5ELBA 2AQ3B 1HQRD 5I4DA 1S5DD 2O2LD 1JWMD 1AW7A 5ELEA 1ENFA 1SE3A 1EEID 1PZID 1JWSD 3URYA 2QEJC 1AN8A 3MFGA 1HTLD 4DXFA 1RCVD 2R61A 5FK9C 1LTSD 1PYWD 1LTAD 3MC0B 2Z8LA 1T5XD 3DWQA 1F77A 1PTOH 1B1ZA 1PTOC 1CQVA 3GP7A 1CT1D 2CHBD 1V1PA 1BCPB 3EFXD 1EEFD 3BVZA 1I4HA 1TS4A 1UUPA 3R2TA 1SE4A 3BYYB 1SJED 1L0YB 1LT4D 1MD2D 1PZKD 2AQ1B 4RFBA 1TY0A 1LT5D 1BCPF 3R8BA 1B44D 2TSSA 1FNVA 1RF2D 3DWPA 1FNWA 4RHSA 1JWUD 1LTTD 1S5ED 1QILA 4DXGA 1S5FD 2XRQD 4RGNA 1D6EC 1BCPC 1RD9D 2QILA 1LT3D 2WV6D 1I4XA 4OHJA 1BCPD 1PTOD 1JQYD 3EA6A 3W2DA 5TSSA 2AQ2B 1D5XC 3R2IA 1XTCD 1SJHD 1SBBB 1D5ZC 1XXGA 1RDPD 1UNSA 1PTOF 3CHBD 1LO5D 1CHQD 1KLUD 3BVGA 2XN9C 3TSSA
chains in the Genus database with same CATH superfamily
5IGGA 1STHA 2F4IA 4MTNA 5FLMG 1F9PA 1O7IA 1QNUA 3S15B 1MSHA 2VY3A 4YY3L 4DUYL 4O2DA 4HJ7A 3RD4A 2NVYH 4H13C 1PRTF 4HJ9A 1Z9FA 4N9TA 4QY7A 2FHTA 3CCLA 1XPUA 1VQPA 1G6ZA 1NTGA 3U4VA 5LL6X 2G9HD 1VQCA 1ICWA 2PZTA 4A3KG 4TSSA 1HUNA 4KHPL 5ELDA 4DK0A 2RF4A 4APVA 1SDFA 3JAME 3HP3A 1X3PA 2KHJA 5JOBA 1GUOA 1S40A 3GTPB 1C7YA 2ZTEA 4BBSG 4LF7Q 3S1MH 2WINB 1BDOA 2Z4HA 5C0XI 1EIGA 4EQOA 4C2MB 4IOCA 1RL2A 4PV1C 2BOSA 3CCQA 1G91A 1L1OB 1TWGH 4B3MQ 1KDBA 1WCMG 4ME3A 5CBAE 2QEJC 1SFOB 1S4ZA 2K7VA 5I2XA 1B4OA 3PO3G 4KD3A 3KOJA 1YNNC 3J80i 2JA7G 1PHJA 2DNEA 1RIPA 1KL9A 1UUPA 4NB3A 2F3VA 5GAEC 2F03A 1K83H 3STBD 3GD7A 1A3TA 2KUMA 2PMZB 1PFMA 3CCMA 1V43A 1Y1WG 3KF8A 2JE6I 1TY0A 2R93B 1FYCA 2L4NA 1ILPA 5M3MB 1HNZL 1IL2A 5C0XG 1SLJA 1C4QA 4UAIA 2Z4IA 2QILA 2O4XA 4A3EG 4RWSC 2AMCB 4ILWA 2B2WC 4BY1G 1EIFA 3K80C 2MUYA 5JPMC 4X3UA 5JJLA 2I5HA 1XMOL 3I8ZA 1I50B 1GJXA 2EY5A 1XNQQ 1ZEQX 5G3LF 1XMQL 3TSSA 2ZXPA 4XXEA 4X66L 3QG1A 1A3UA 2B2TA 2ES2A 2NVTH 1VMCA 2VQFQ 2A6ED 1LYLA 2PNHA 2Q8RE 4LFBL 2IWHA 1SYEA 3FKIB 4AH6A 1O7LA 1L1OC 1X56A 5JJZA 2R3ZA 1FGBD 1X3GA 2XGTA 1ZKOA 4R9WA 4DV4L 1JR0D 5EKLA 2VS1A 4JI3Q 3TREA 2ASBA 3NELA 1KD1C 4EX5A 1EU3A 3FPUB 3SK6A 4RH6A 5FKAC 4A76A 4JW0A 2KEDA 3NTIA 3EIVA 2X6LA 1D1IA 2ZJRA 4H7BA 4K0KL 1JE4A 2KCTA 1NBWA 3CAMA 4A3LG 1BKBA 2M00A 4ULLA 5E3FA 4KHPQ 3K59A 3RLOA 1Z6HA 2C5CA 3CPFA 2JQOA 3K0YA 4BA1I 4JI4Q 4JV5L 5M5XH 1KXLA 1W6KA 3QWNA 3GTLH 5ELEA 4A3MH 4RMFA 1ENFA 5D65A 2B2VC 3HOZH 2EOTA 3GV3A 3DLLA 1AN8A 4LWCA 3F1ZA 1Q1EA 3FKIG 3OW7A 3I56A 4HIMA 4H02A 2L1BA 1KRSA 1SAPA 1KNEA 5I9OA 3CQZH 1CQVA 3IRBA 2CHBD 1M90C 3CCJA 2E2HB 4B9WA 2K33A 5IYDH 4X3SA 4MNOA 1IYUA 4I65A 3I4MH 3C2PA 2SOBA 4LFCL 3HKZE 3TP5A 1SNPA 4XYOA 5IYDG 4GNXB 1LT5D 2MJ8A 3PSIA 3R8BA 4JVZA 4UP9A 4JI1Q 3W1BA 4BY1B 1FNWA 2A8VA 1D2BA 1O78A 4A3EB 4CHTB 2LMCB 3BZCA 3KF8B 4OHJA 1Q82C 1UE7A 1K73C 3A7LA 5M3MG 1KAAA 4OX9Q 5JAVA 1YIJA 1ILQA 1AH9A 3V2TA 2R93G 2H1EA 2F0VA 1Y1WB 4IUTA 4FNFA 1TWAH 3CHBD 1X3EA 3P7JA 2XRSD 1DOKA 1WTHA 3ERSX 5IIFA 2JA7B 4IO9A 2A74C 5D3DA 1QVCA 3Q0AA 5ISRA 2IY5B 3PO3B 1XNQL 1XPOA 1LTGD 3HZXA 1WCMB 3SEBA 3CCUA 2B2UA 2BDOA 1F9SA 3HOVH 3I55A 2Q8IB 2SNSA 2K5WA 5LMUQ 4BWGB 3BDLA 1YHQA 1W6JA 2K5QA 2L15A 3GTJH 2K1BA 1N8RC 4BBSB 4LF9L 5I9PA 1QVFA 4EQNA 1TWCH 2JEAI 3C1FA 3UDGA 4HR7B 4NPSA 4I7AA 4ZAIA 1D5MC 3J81j 1GHJA 4A3KB 1N9WA 3NENA 1KAWA 3C46A 3MTSA 1LV9A 4FF2A 3S1NH 1LTID 3H3VI 1TKWB 1WJJA 3JC66 3OWFA 5EPKA 3HOWH 3OMCA 2BE5C 2L12A 4L5QA 1PYBA 5GQOA 2K50A 4Q5VA 1JMCA 5KRUA 2EE1A 5C0XJ 1PFNA 4HCSA 3PUZA 5IGDA 2CQOA 3T1YL 2AUKA 1JJCB 5FLXL 1PH2A 3FRPB 4JI0L 1CT1D 1V1PA 2NVQH 1E2WA 1Y69U 3KFUA 2LXJA 2F0IA 3A5ZB 1SE4A 1H9SB 1TWAB 5LL6S 4BY7H 2EYHA 1O7YA 1MD2D 1YZ6A 1HQMC 1DCZA 2Z6KC 1K0RA 3I73A 3TEHB 2TSSA 3EQLC 2VNUD 5EBDA 2WB1E 4DR4L 3KJPA 4IUNA 1X55A 4IFDH 4KN7C 4PZ8A 4LJZC 2BE5D 2RKSA 3U50C 4EQPA 4DR2Q 3GTQB 5KEEA 3GTGB 4FVMA 3I90A 1LABA 2UXCL 1SR3A 1IBKL 4N8X1 1YNND 5DLQE 2DJFC 1PV4A 4Y7NB 3OTOQ 3M3YB 1SBBB 4YY3Q 1YNJC 2B29A 3TP8A 2N78A 2R93H 3HOUG 1MHWC 4FO2A 2ICEC 2IW3A 3M7NA 2Q2HA 1OXUA 2EY2A 2XNAC 3RR5A 2WKDA 1GKHA 3KLSA 5CGKA 3KYHC 5A2QL 1PH5A 2UUAL 2Z6KA 3PUWA 4DK3C 1TS3A 2PQAA 5IP7G 1I94Q 4FF3A 1HA6A 1EWCA 2WIIB 4KJNA 2YU9H 3N52A 1CA5A 4JI6L 1HFGA 3WOEA 4XT3B 2H5XA 1RJTA 5IP9G 2CCZA 2BA0A 2E5LL 1SMYC 1P8LA 1HCZA 1BXTA 1LTRD 4A93H 1ET6A 1O7ZA 1P16A 4C1NI 2VUMH 1WTPA 2PQAB 2MHVA 5CYUA 2K05A 5BR8L 1Q8KA 1IYVA 4MN3A 2MGSA 2UXBL 4G57A 1IBLQ 2EYFA 1STAA 4QJFA 1G2SA 3IFTA 4B3RL 3ZYYX 4U68A 4NKLA 1G51A 1EL0A 3L3OC 3W1GA 1AZPA 2R61A 4WJ3M 1BUVT 3MC0B 1CTMA 1NE3A 4R4CA 4C3IG 1U4PA 2DJGC 1PTOH 1EQRA 3GTKH 3HOUH 5M5YB 5C5LA 3UE1A 2AWOA 2F0PA 3M3YH 3RZOH 1BNZA 2Y0SB 3DEPA 4L8JA 3HOYB 1EZ8A 2RDFA 4A3DB 4OWXB 4DR6Q 3J7YW 1G2TA 3M4QA 1PH9A 4WJ4A 4LAAA 3VYSA 1M1KC 4NDXA 3K7UC 3T51B 4DAMA 2XRQD 5LMNQ 3RZDH 3TQYA 1FGUA 2WV6D 4J15A 4OXPA 4DV6L 4BXXG 1QG7A 4DN4M 2DY8A 4DR7Q 2QGQA 5I6YA 3L9AX 2UXDL 4JC0A 1TIID 4DR4Q 2I07B 4POFA 1VQ7A 1XTCD 1XXGA 1UNSA 3TS2A 1E24A 4P2CB 1N33L 4ZK9B 1FNUA 4FP5D 3Q24A 3VYUA 2X69A 5LHY1 4UP8A 1V8QA 1SE8A 2A68C 1A63A 2E8GA 2F0UA 4JI3L 4OO1H 4NP5A 2NTTA 4JYAQ 1Y8NB 2QW7A 2ZXOA 1OXTA 3PIO3 5NUCA 1X3QA 1Y1WH 1EQQA 3U4ZA 1HR0L 4P71A 1JB7A 2D9UA 4K0KQ 1EIHA 1K9MC 3D4DA 2RCFA 1E1OA 2CW0C 2Q2TA 3NPPA 3FMCA 3TRZA 2WB1G 3I2ZA 4ALPA 1KC8C 4RCOA 4DGZA 4DR3Q 1C48A 3RN5A 2UUCL 2R7ZG 1NSNS 3GTPH 1B53A 3I70A 3U9SA 1HNWL 1SEBD 2RHQB 4QIWB 1IW7C 1EY8A 2K14A 1CUKA 2LFNA 5IT9E 3H3VC 2E2IB 5DNFA 1CSPA 3R93A 3PCOB 1B3AA 2F3IA 3S2DH 4X65Q 3DM3A 1F2YA 3H0GG 2UUBL 1L1OA 1JWMD 4CBVA 1OXSC 1XPRA 4A3BG 1BBUA 4DNRB 1ZYRC 1CA6A 1JB3A 1EY7A 2HQLA 2KCMA 2F0FA 5HY6A 4PZ6A 1XNRL 5FK9C 1VQ6A 1PYWD 4YCUA 1QJOA 3S15H 4A3KH 1NY4A 4DR5Q 1PTOC 2FMCA 3ULJA 3GTOB 4HIOA 4DA2A 3VR2A 3BYYB 4ZUIA 4G7HC 2JA8G 1SJED 1QUQB 4CKBA 4RFBA 2AQ1B 1HZAA 3I4MG 1BCPF 4JI7Q 1JC7A 2KQ3A 1UAPA 1OXXK 4KTAA 3I4NB 2L0CA 4OELB 2PYKA 3NWSA 1ESRA 2FJ2A 1HZBA 3CXCA 1FJGQ 2QDBA 2DNCA 1SJHD 3J7A5 2F0GA 4I7ZC 5DM73 1EYAA 1Z47A 1JCKB 3CU7A 4C3JH 1VQ4A 1SE2A 1YHBA 3M4OH 3CPWA 3BS1A 1HFNA 2RDHA 1CKOA 3Q22A 1YJ9A 3F8TA 3MWYW 1E7ZA 2Q2IA 1SRUA 3STBC 1J9OA 4OONA 4V0BA 3AFPA 5DAUA 3MZ5A 4IJHA 1E2VA 4F8MA 2N88A 2RDGA 3BVMA 1J5EL 2ICIA 3I91A 3SVMA 5M5XB 2A69C 2K5NA 4HAEA 2KVMA 5ELOA 1B9MA 1XTDA 5ELNA 1QNKA 5M5WH 4JI8Q 2M2LA 4TKOB 3VA5A 1TS5A 4X64Q 2ATWA 2ZTCA 1DD2A 2UUCQ 3J81E 4PMCA 2E2JH 4AQYQ 5M3FB 4HCEA 2N3SA 4X65L 2OTJA 2MP1A 1RCVD 4YWLA 4HJ8A 4PMWA 2Z8LA 1SROA 1Y8OB 4IFDI 3IFDA 5CC4A 1HTPA 5BN4A 4BBRB 5KIXA 4UPAA 1PH1A 2EIFA 3S1MB 1AFPA 1PZKD 4A3FH 2F0TA 1N32Q 2L55A 2F4VQ 1T5EA 4C2MH 1RF2D 1Q8IA 2F0NA 2LS01 1UWVA 4AYBE 3DXJC 4RCNA 4K5XA 3OSOA 4GS3A 4CJ1B 1U4RA 3T13A 1QWYA 4LF8L 4IFDG 4X66Q 2D62A 1TXYA 4XYQA 3A8KE 1RHPA 1Y8PB 2MQHA 3UDFA 5GADC 1DGSA 3HOXG 1B7YB 3RNUA 1ENCA 3VR5A 1WD0A 3AYHB 2KCNA 1FJGL 2LSSA 1VQOA 4BY7G 5C44H 1Q3LA 1ESFA 2ZJPA 4DV4Q 1HA5A 1GUSA 2IHFA 3T1YQ 3HFZB 5CMDA 5AJ3Q 2B63H 3BG3A 1CQFA 1PRTD 2M9VA 3J80c 3OWEB 1EIYB 3MEHA 1N36L 3KUPA 4NXNL 1B70B 4JI2L 4X62L 2K5HA 3OHXC 3D8GA 1Q46A 4A3JG 3IKJA 2A19A 3TDQA 3CF5A 4NW2A 3A0JA 1X32A 1V1PB 1GUWA 4P72A 1C9OA 4BY1H 1E22A 2NVTB 1TY2A 2YYZA 2YV5A 3VR3A 3GTMB 4DV6Q 1H95A 1IBKQ 2E76C 3BU2A 1SYDA 5C0XH 1VQJA 1JJ2A 4NXML 2NVQB 3AFQA 1YBYA 5EGTA 2JA5B 3EJIA 3HKZG 3E9IA 2AWNA 2ALYB 2PW5A 5C4HA 1NMFA 3PUXA 4IPCA 1N33Q 3HG9A 4C3HB 5DEHA 1A15A 2RHSB 5K36H 3URYA 4X3KA 5EBCA 4PNYA 4YWKA 3T1HL 3H91A 3J81i 1BR9A 5E4WC 3HOZG 4LFCQ 1SFOH 2R92B 4MHEA 3GTQH 5C44G 1EY4A 4HSVA 3ICEA 3ULPA 1TS4A 1CSQA 1QCBD 2NZ1D 5CV9A 1I6HH 3D4WA 3D31A 5LMNL 3MXGA 1AEXA 2D2CC 3K5LA 3NK9A 4DV5Q 4QB4A 1HZ9A 2EJMA 3L0OA 3F2BA 3S1RH 1BBXC 4BS9A 4GKKL 1S5ED 1ML0D 1EYDA 1Q81C 2HCCA 2PZUA 1VQ8A 5K36G 4OO1I 2K03A 2CW0D 1HNXL 3SE0A 5T1IA 5C3WA 1NJIC 1EY0A 1G291 1N34L 3GTLB 4CKEA 1IXRA 2Z6BA 4HEDA 4DNIA 3G7LA 4UHVA 4V190 1STGA 3SXHA 1WOCA 4KY5A 1EU4A 3OOCA 2VQEQ 3S2HB 4LF6Q 2ENBA 2F0JA 2A1AA 2JEBI 3DUZA 1GHKA 1K8MA 3K0XA 5LMUL 4L63B 3D0FA 4PG3A 2B63G 1JOOA 1IL8A 2PPBC 3HRZC 2OF1A 1F2LA 5EJWA 1TS2A 3MXUA 2MNAA 4QMGA 1DOMA 3JAMc 1HR0W 2PZWA 4DUYQ 3C1EA 4A3MG 2WACA 3NWTA 4KLKA 3CCVA 3M4OB 4GNXC 3SGIA 1N36Q 2WAQB 4L6TB 3KLWA 4YWMA 1G8ZD 5EPLA 4DV1L 1EQTA 1KIXA 4QUFA 3NEMA 2VUMB 1MJCA 2NTSA 2ID0A 1PZJD 2K32A 3Q8DA 3PO3H 1FVIA 5ELFA 1KRTA 1J6QA 3GTGH 1TQOA 3K5OA 5FJ8G 3K7AB 2OTLA 2TMPA 1XMOQ 1K8OA 2QDLA 2RQXA 5DM63 4QF4A 1DM0B 3RLFA 4FYDA 1EEID 4A3CG 1OO9B 4DV0L 4LFAL 4XTCS 2CKZB 5IWAL 3AEVA 3I4OA 4DK1A 2K5VA 4IQZA 2HDLA 4GNXA 2MPMA 3GP7A 2VB3X 4KI0A 4GZYC 1EY6A 3EFXD 4K2LA 4K6DA 2VXWA 2IT1A 2EZVA 4E6IA 1D7QA 1QUQA 2YTYA 2ZXRA 3OIPA 3ULLA 1XJVA 3HOWB 2NN6I 2PNRC 1TWCB 5CORA 4N9PA 2E75C 2HUGA 3P20A 3S17H 4GN4B 1L0WA 5A2QE 4RGNA 2EXDA 2F0QA 3MXNB 4DAPA 2A5HA 3S16B 4OWWB 3UI2A 3EA6A 2DN8A 3TMEA 2K75A 2PI2A 2Z9HA 2WP8J 3CW2C 3J81L 4A3FB 4CJ0B 3G48A 2EXZA 1KLUD 3BVGA 4B08A 1QVGA 3X3NA 4N8FA 1Q90A 2KECA 2V4DA 4GN5A 3PO2B 2EVBA 3GDEA 4WJWA 3TZUA 3IL8A 1H9SA 4KMUC 4KV6A 4PZ7A 2JP1A 2A69D 1XNRQ 3O13A 5KGUA 3MA2B 5FLMH 1XMQQ 3ND8A 2NVXB 2B39A 5J1ZA 4IURA 4ODGA 2IX1A 2CWAA 3K5NA 3H0GH 1XWEA 1NUCA 2PO4A 2EYPA 4RGTA 3DMUA 4M8AA 2GA4B 3HOVB 4H0LC 3PGZA 2UU9L 4K6LA 3NTHA 1K3RA 1BQQT 3A7AB 2I5LX 2SEBD 1MJEA 2QF7A 4RHRA 1HNZQ 1JJGA 4Y52H 5IYCH 4AYBG 1PRTB 3BZDB 4EVOA 2K04A 2Z1CA 4RAUC 3PF5A 1HXYD 1I4QA 4A3IB 3KBXA 4OWTB 4DV2L 1SYGA 4AQYL 1YITA 4RGMA 4C3JG 3QOLA 5HGQA 4DKAC 4O1NA 1PFBA 4DV1Q 5IOCA 5I4DA 1JT8A 1S5DD 2XWBB 1ASYA 5COYA 4IZ8A 3K6OA 4LF4L 1CZGA 3G6EA 2HIVA 3LX0A 4K14A 1PA6A 3QB3A 2ZT9C 2HQEA 2AHOB 5E1FA 4ZCKA 4DU9A 2CH4W 1B1ZA 2KENA 3K81C 2JA6B 5JPNC 3BVZA 4P75A 5IGBA 2JA5H 3D6WA 4HN7A 4C1NK 4IUVA 3A54A 2F0SA 5IGFA 3S1QH 2K28A 3BZKA 1WTVA 3HS0C 1CKMA 1VQNA 3SK8A 2XSCA 3NBIA 4J6HA 4A93B 1Y14B 2EYJA 2RSOA 1DXMA 1FL0A 2D0OA 5A35A 1OXVA 3UDXA 3T4AC 1HRJA 1PTOD 3CRLC 5IYBH 3RN2A 2L9HA 4NXMQ 4XT1B 2QKIC 3AU7A 5CR3A 3HOXH 4JYAL 1R4PB 2K5DA 1CM9A 1STEA 1II3A 3D3RA 2OXPA 4UY8C 2N49A 1Q86C 4Z9CB 1Y1VB 3ND9A 1NMGA 2KHSA 2NZOA 4X62Q 3PUYA 2XIWA 1KLGD 3T16A 5C3EB 5C4XB 4A3GG 2F0EA 3RUZA 2PMZE 1EWIA 4L5RC 4XQNA 1IYJB 4GLVB 4QQBX 3QOJA 2XVSA 1K8GA 4KN4C 4KD4A 3TN2A 1EYGA 1O80A 1CHPD 1VQDA 2ZTDA 2UXCQ 1UEAB 1Q12A 1K8AC 1TWFB 3FVQA 4J1MA 4ME5A 5ELBA 3WOFA 1GO3E 2FMMA 3F2CA 4A3GB 3HKSA 3R3OA 5C3EG 1MBYA 5C4XG 1R9TB 4ZLTF 1R4QB 3BDOA 4BXXH 2KOLA 1A62A 2K6AA 2F3WA 4HJAA 3FDTA 3PV0A 3D6CA 1LTAD 1Y1VG 1MI2A 4C3IH 3LNNA 1QE6A 3DWQA 4DAYA 1F77A 3A8JE 2EYOA 4DV5L 4ID6A 1BCPB 3NHHA 3CD6A 4JI2Q 1AE2A 2WKCA 4GKKQ 5IODA 1HPCA 5C5MA 2RA4A 1FR3A 1X65A 2OEOA 4O0AA 3K5MA 4RHSA 5GAHC 1K0SA 5EAYA 2SDFA 1TVXA 5IT9c 3J81c 1EZ6A 2JA9A 4F7XA 2PQEA 5EKIA 4A93G 2NUCA 5FO7B 1SNMA 4IALA 3ITPA 3RZDB 2J0TD 5KNBA 2BH2A 2L11A 4JK1C 4LF7L 3CC4A 2E74C 1D5XC 4LFBQ 4IFDJ 3H09A 4DR2L 1AP0A 2NZHA 3A8IE 4CKCA 2EJFC 4KK7A 3KDFB 2JA6G 3OPOA 1M4VA 2E2JB 3IAYA 4C56C 1E0BA 1I4GA 3BDCA 4OIKA 1RODA 1J5EQ 1I4RA 4DNTB 1VQFA 5K5PA 3VR6A 4POGA 1TWFH 4JI0Q 1V1QA 4LNQA 3NXWA 1PXUA 1H9JA 4IPHA 3FPPA 4JOIC 1HH2P 2Z0SA 3B6YA 4R8NA 5JVH3 3EVQA 2JYOA 5LMNW 2EJGC 2Y0SE 4GLXA 4C3JB 3S14B 1I5FA 4A3IG 1GUTA 1YEZA 2H4OA 2XTIA 3E0EA 4CJ2C 1H9KA 4DF7A 1CKNA 4AYBB 1J8IA 4IPDA 4A3BH 3NBHA 1HNXQ 4DV7L 4DR7L 2D0PA 1U4MA 1VQMA 1TT2A 1PH6A 1TWGB 2A6HD 4C3HH 1SSOA 4ZKCB 2QEXA 3HOVG 4PQXA 5AFWA 3KJOA 1SNQA 3DEOA 1ICFB 3J80E 5I2YA 3OYYA 4JBMA 2AKWB 3UE0A 5FLXc 3GQBA 4HJ5A 4JOIA 4P73A 4DR1L 2UXBQ 1LTSD 1STNA 3AQQA 2C9OA 1YJWA 1GD7A 3PIPA 1QOHA 2CVRA 1CKNB 4ZRZA 5M5WB 2RCNA 2NVYB 2VL6A 1K83B 3NE5B 5D14A 1EEFD 3PO2G 1S3OA 1CFMA 3LWEA 3TS0A 1HR0Q 4A3FG 5C4JH 4K8IA 1JICA 1QB5D 4KHZA 4JI6Q 4OX9L 1STBA 4IOAA 1PH3A 4F87A 4DUZL 1XYIA 5JJIA 1BVSA 4ABNA 4LUVA 4R1JA 4KHVA 4DXGA 4OO1G 3F2UA 4ZQ3A 3I4NH 1M8AA 1YHAA 4DR6L 3MEFA 2F0KA 4CDDC 2WAQE 5TSSA 3LWUA 1GXDC 1X3FA 5IGEA 4DK6C 1PH8A 1CI3M 3HOWG 3PUVA 2A6EC 4AIMA 1DONA 1LACA 2SNMA 3KDFA 3X3MA 2FXQA 4H44C 4YHHL 4A75A 2X6GA 4B3RQ 2NWGA 4HIKA 4LFAQ 4U673 4DV0Q 4CDEC 1CK1A 5GROA 1IBMQ 4BA2I 1OTCA 2P5ZX 5C6AA 4DR5L 2R92H 4Q0FA 1ENAA 3KLSX 1HJPA 1WTWA 3OMGA 2F0DA 5KYIA 5CV6A 3DWAA 3TP6A 4QL5A 2IPKD 3FP9A 1I6HB 1L2FA 3SK4A 3KF6B 4K2KA 2EY6A 4GN3B 1BO0A 1MSGA 2KHIA 1LTLA 3S1RB 2VUMG 3KK7A 2I46A 1C8CA 4UDUC 2WAQG 1WYDA 1PRTC 3VA7A 1TWHB 1K3BC 1EFID 4ZYSA 5IP9H 1LUZA 2JK8A 4B3TL 4IN3A 4NMZA 3SHLA 4A3MB 4DAVA 4B3SQ 4DV7Q 3CCRA 5C3XA 1SE3A 3VDYA 4XQQA 4DV3Q 1KQSA 2N8NA 1X6OA 2B63B 3T56B 3CQZB 2F0LA 4L5TA 5IY0A 2EDGA 3JAML 3A55A 2UUAQ 1T5XD 1SMXA 1JE5A 1EWHA 3UDIA 3GTMH 2BH8A 1I3QH 2QCPX 3K57A 4JBJA 2MFIA 1WI5A 2LY7A 1I50H 4OIJA 4BBRH 4A3JH 2KEEA 1UE1A 4A4IA 5IP7H 1B50A 2VB2X 2A68D 1AE3A 4G7OC 3OTOL 1BOSA 1N34Q 4GKJQ 4QCLA 3L2PA 2WFWA 4ZKBB 1LT3D 1I4XA 1BCPD 2KJXA 3I4LA 3CC7A 1H9RA 4JI8L 3A74A 2JXMB 3CCSA 1B3QA 3HEJA 5BR8Q 2DUDA 1DZ1A 3S9WA 4XDXA 4HTHA 4EGVA 5H1SE 2XN9C 4FF4A 5FJ8H 3M7GA 2EY1A 5HGTA 3CMEA 3MFYA 5C44B 4IPGA 1KNAA 2HIXA 2R92G 5CV4A 3HOZB 2JJQA 4RGOS 2RVLA 2CFMA 5FO8B 1MGSA 3I72A 2D5DA 4A3IH 4YCVA 4LF5Q 4K5VA 4C3HG 5CV8A 2IJ0A 2VQFL 1SYBA 3FEWX 1IBML 1DJRD 1NR4A 3HKZB 3NSWA 1EY9A 3G4SA 2JA5G 2MO0A 3N6RA 4CDCC 4IJLA 1NCVA 4LK1C 3GV6A 2B2UC 3QIAA 3MHBA 1MKHA 4J8QA 3Q6SA 3V05A 5CV5A 1GUNA 3OIQA 3U9OA 2HHHQ 2OWOA 1YNJD 1IBLL 2EPBA 1PFSA 2F1MA 2FFKB 1KDCA 4KY6A 3MAQA 2J7ZA 2DGYA 3LGJA 4YIJA 5KNCA 1I4PA 4A3JB 2HD3A 1ZXTA 4ZUJA 4RG1A 3S24A 3H3VH 5CBEE 3V96A 1UEBA 2O5IC 1JWSD 1A8VA 2F0MA 4TQUS 1MIUA 4DXFA 2ZJQA 2JA7H 2F0WA 1VQ9A 2IX3A 3PIP3 1WFQA 2R7FA 4JV5Q 2E2DC 2LXKA 1HUMA 1A6XA 3ERQA 4FF1A 5KYLA 1H9MA 4BY7B 1I4HA 4DV3L 2G5DA 3TZDA 2VZAA 1LT4D 1IHZA 3HOXB 2C35B 1B44D 4R4IA 1FNVA 1UE6A 3Q23A 2UXDQ 2E5LQ 4DR3L 1F9RA 5J22A 1N32L 1ONLA 1GVPA 3K7AH 1WTXA 1VQHA 1VF5C 4K8JA 3NTKA 5M9OA 4X64L 4XQJA 5FOBB 2AQ2B 2A73B 3R2IA 4JBWA 1IW7D 2F52A 5EPJA 1WTOA 5G3LD 2O5JC 4GOPC 1KABA 1EOTA 3I7FA 4RA8A 4BBRG 3DHQA 5M3MH 1Y1VH 4F88A 1DYQA 2JSOA 1JOKA 4R4QA 3T1HQ 3S2HH 4X3TA 2YTXA 3RMHA 4DR1Q 1KDAA 1ZYRD 4JCVE 1IKLA 2KBNA 1B9NA 5BN3A 1EQVA 5M3FG 2LKVA 1D8LA 1K28A 2DY7A 1KTKA 3D4RA 3MXNA 2ZM6L 3JAMi 1HNWQ 5AJ3L 2L5TA 4LW1A 2OCEA 4TVAB 1VF7A 2EQSA 3SR1A 4A3GH 1C0AA 3S17B 1FD7D 1S5BD 4NXNQ 2F0HA 2PW7A 5FO9B 4A3EH 2I5MX 1EOVA 1L0XB 4A3LH 1VQAA 3AB9A 1EFWA 4GOPA 2OT2A 2XWJB 2G9DA 4DFAA 4LF9Q 1U0LA 1IKMA 4WFN3 1UE5A 5JEAH 1LTBD 3MVVA 1EUJA 2AQ3B 3NQTA 5F2DA 1SNOA 4Y7NH 3OW2A 3E3XA 1R9TH 2B8FA 2B8GA 1Z7TA 1VQIA 3QR8A 4KKTA 1G6PA 3L7ZC 3H6MA 2HCIA 1PVOA 2NVXH 3CC2A 1WCMH 2PI2E 4EQ5A 1E1TA 2R7ZH 4IUQA 3NBHB 3HOYH 4JPBW 2B2TC 3QO2A 1WTQA 2IX0A 2NN6H 3EN2A 3CKIB 4R8IA 4BBSH 3NP8A 1T9HA 3DWPA 4G7ZC 1PDQA 5EKKA 4OGQC 1LTTD 3PMFA 5E7NA 1S5FD 2BDNA 4P74A 2B3GA 1D6EC 1BCPC 1RD9D 2BA1A 2V1CC 3I4NG 3S1NB 2JN4A 1TU2B 4YHHQ 4HMJA 4HMIA 3BJUA 1SN8A 3I4MB 2I0QA 3S16H 4CGYB 2JA6H 2GN5A 3SK5A 1W3SA 1PTOF 5I6WA 3HGBA 2JA8B 4JI4L 5JVG3 1F2ZA 1U4LA 1VQ5A 3S1QB 1VCIA 4B3ML 4FXKC 3GO5A 5IGCA 1NNXA 4RKLA 4RKBA 3PO2H 1SXTA 1V1OA 2OQKA 2B2WA 2K4KA 3I3CA 1I6VC 4R4OA 5E4XA 3KBGA 1YJNA 2YTVA 3G71A 2CQAA 4A3BB 5J3BA 2B2VA 3J7AV 1BBWA 4L5SA 3H0GB 4WORA 1SYFA 1WD1A 1Q7YC 1PYSB 5IT9L 3KF6A 2B2YA 1RTNA 4JI7L 4JI1L 1A3VA 2FINB 3VR4A 2KCCA 3U58A 2R7DA 3M4PA 4B3TQ 2IL8A 1DOLA 2ZM6Q 3WWVA 4LUZA 2E2IH 2R7ZB 3A56A 3GTKB 5BN5A 1ET9A 1S72A 1LT6D 2WB1B 4HIDA 1PH4A 1STYA 3FHWA 4KY7A 1A0IA 4S3SA 1RKNA 4MIUA 1V9PA 4K5WA 3W3AA 5C4XH 5C3EH 4MZ9A 1HQRD 2N55A 3J7AF 1YI2A 1AW7A 5CV7A 3H94A 4GLAC 1PZID 2EYMA 1BF4A 3MXPA 1QZHA 1HTLD 3M85A 4JI5L 3F2DA 4QUCA 2F4VL 2B2YC 3M9BA 1JOQA 4LF5L 2BCOA 2EYLA 5J39A 3EROA 5IWAQ 2Q8TA 3CCEA 2JA8H 2QA4A 1VQLA 3SDZA 1E3PA 4GOPB 4FDBA 4DAYB 1PH7A 4KKSA 1RTOA 1TR5A 4UP7A 1JWUD 3J7ZC 4QIWE 1D1KA 3NUCA 4IUUA 3VYRA 1VS0A 2NB0A 4LMQD 4OL7A 2PCFB 4O42A 3FKIH 2F0OA 2NBFA 1JQYD 1HZCA 1SMYD 4JG2A 1XX8A 3W2DA 3PIOA 2IHEA 4R4TA 1VQBA 1VDZA 4TRDA 1F2MA 3C3LA 4A3DG 1RDPD 2CWPA 1B8AA 1YVCA 1YNXA 1CHQD 3HOYG 4FXGC 2Y0SG 4B3SL 5IE8A 3G6JB 2HT1A 3VYTA 3H15A 1X9NA 3TP7A 2AUJD 4LF4Q 4WRDA 5IYBG 4M1UB 4C3IB 2J4XA 1U5KA 2NYZD 2R6GA 1PTOB 3RLNA 4A3CH 1ASZA 5FLXE 2Q2UA 1W2BA 5JEAJ 1EY5A 3CP0A 1VQKA 3PF4A 3S2DB 1LM0A 1A2UA 1S5CD 1SNDA 3KLRA 1VQEA 1U9RA 1VMPA 5JEAG 1B2TA 4KKUA 1LLRD 5ELCA 3T53B 3P1HA 4JBKA 1WTRA 2HHHL 2MO1A 3QJYA 2K01A 3BYTB 1JORA 1SNCA 3J80L 5C4JB 3ONAB 2GVAA 1PLFA 5KNDA 5EQ0A 4OEMB 5D3IB 5HURA 1VQGA 5L37A 1GOZA 2OQ0A 4PMBA 4GKJL 2HDMA 1X54A 4G4KA 3ER0A 1CZWA 2GVBA 4LF8Q 2RBMA 5T1GA 3GTOH 2CH4A 2E2HH 1QZGA 2VW9A 4HSPA 1KHIA 1SYCA 5M3FH 1GM5A 2YU9B 2O2LD 3P75A 5JJKA 4MTKA 2VQEL 4LF6L 4DPGA 3PQIA 2KA7A 3M4YA 1AZQA 3S14H 3MFGA 1NAPA 3ZJYC 1WVLA 4QGUA 5C4ZA 1I3QB 2UUBQ 3K8AA 5IYCG 3CMAA 4KJOA 3AMUA 1HHVA 4DUZQ 3DM1A 1I94L 3R2TA 3HOUB 1F9QA 5M5YH 5GAGC 3RZOB 2NN6G 2UU9Q 1L0YB 4JI5Q 1IZ6A 2A6HC 3NQIA 1E2ZA 1Q1BA 1NR2A 4XIGS 1EYCA 3E5SA 4A3DH 3WDNA 3K58A 4B9XA 1A2TA 4IUPA 1QILA 2RSNA 4YCWA 4DV2Q 4X6AH 4LUOA 3TBIB 3E9HA 3CRKC 1D5ZC 3E0JA 2K52A 1GUGA 4FXDA 1TWHH 3E6ZX 3W5OA 1LO5D 1PMRA 3EBEA 3GTJB 3A5UA 4CDFC
chains in the Genus database with same CATH topology
5IGGA 1STHA 2F4IA 1F9PA 1QNUA 3S15B 1MSHA 3RD4A 4H13C 1PRTF 4N9TA 2FHTA 1G6ZA 5LL6X 2G9HD 1ICWA 2PZTA 4TSSA 1HUNA 5ELDA 4DK0A 1SDFA 3JAME 3HP3A 1X3PA 5JOBA 1GUOA 3GTPB 2WINB 1BDOA 2Z4HA 5C0XI 1EIGA 4EQOA 4C2MB 4PV1C 2BOSA 1G91A 1KDBA 5CBAE 2QEJC 1SFOB 1S4ZA 2K7VA 5I2XA 1B4OA 4KD3A 1YNNC 2DNEA 1UUPA 2F3VA 2F03A 3GD7A 1A3TA 2KUMA 2PMZB 1PFMA 1V43A 3KF8A 2JE6I 1TY0A 2R93B 1FYCA 2L4NA 1ILPA 5M3MB 5C0XG 1C4QA 4UAIA 2Z4IA 2QILA 2O4XA 4RWSC 4ILWA 2B2WC 2MUYA 5JPMC 4X3UA 3I8ZA 1I50B 1GJXA 2EY5A 1ZEQX 5G3LF 3TSSA 2ZXPA 4XXEA 3QG1A 1A3UA 2B2TA 1VMCA 2A6ED 2Q8RE 2IWHA 1SYEA 3FKIB 1O7LA 5JJZA 2R3ZA 1FGBD 1ZKOA 4R9WA 1JR0D 5EKLA 1EU3A 3FPUB 3SK6A 4RH6A 5FKAC 2KEDA 3NTIA 2X6LA 1D1IA 4H7BA 1JE4A 2M00A 4ULLA 5E3FA 3K59A 1Z6HA 2C5CA 3K0YA 4BA1I 1W6KA 3QWNA 5ELEA 1ENFA 5D65A 2B2VC 2EOTA 3GV3A 1AN8A 1Q1EA 3OW7A 2L1BA 1SAPA 1KNEA 5I9OA 1CQVA 2CHBD 2E2HB 4B9WA 2K33A 4X3SA 1IYUA 4I65A 3C2PA 2SOBA 3TP5A 1SNPA 4XYOA 1LT5D 2MJ8A 3R8BA 4BY1B 1FNWA 1D2BA 1O78A 4A3EB 4CHTB 2LMCB 4OHJA 3A7LA 1KAAA 5JAVA 1ILQA 3V2TA 2H1EA 2F0VA 1Y1WB 4IUTA 4FNFA 3CHBD 3P7JA 2XRSD 1DOKA 5IIFA 2JA7B 2A74C 5D3DA 3Q0AA 5ISRA 3PO3B 1LTGD 3HZXA 1WCMB 3SEBA 2B2UA 2BDOA 1F9SA 2Q8IB 2SNSA 2K5WA 4BWGB 3BDLA 1W6JA 2K5QA 2K1BA 4BBSB 5I9PA 4EQNA 2JEAI 3C1FA 4HR7B 4ZAIA 1D5MC 1GHJA 4A3KB 3C46A 3MTSA 1LV9A 4FF2A 1LTID 1TKWB 5EPKA 3OWFA 3OMCA 2BE5C 2L12A 4Q5VA 5KRUA 2EE1A 5C0XJ 1PFNA 4HCSA 3PUZA 5IGDA 2AUKA 5FLXL 3FRPB 1CT1D 1V1PA 1E2WA 1Y69U 2F0IA 1SE4A 1H9SB 1TWAB 5LL6S 2EYHA 1O7YA 1MD2D 1HQMC 1DCZA 3I73A 2TSSA 3EQLC 2VNUD 5EBDA 4IUNA 4IFDH 3GTQB 4KN7C 4LJZC 4EQPA 2BE5D 2RKSA 3GTGB 5KEEA 4FVMA 3I90A 1LABA 1YNND 4Y7NB 3M3YB 1SBBB 1YNJC 3TP8A 4FO2A 2ICEC 2IW3A 3M7NA 1OXUA 2EY2A 2XNAC 2WKDA 3KLSA 5CGKA 5A2QL 3PUWA 1TS3A 4FF3A 1HA6A 1EWCA 2WIIB 4KJNA 3N52A 1CA5A 1HFGA 3WOEA 4XT3B 1RJTA 2BA0A 1SMYC 1HCZA 1BXTA 1LTRD 1ET6A 1O7ZA 4C1NI 1WTPA 2MHVA 5CYUA 2K05A 1IYVA 4MN3A 2MGSA 4G57A 2EYFA 1STAA 1G2SA 3IFTA 3ZYYX 4U68A 4NKLA 1EL0A 3L3OC 1AZPA 2R61A 1BUVT 3MC0B 1CTMA 4C3IG 1U4PA 1PTOH 5M5YB 5C5LA 2AWOA 2F0PA 1BNZA 2Y0SB 3DEPA 4L8JA 3HOYB 1EZ8A 2RDFA 4A3DB 3J7YW 1G2TA 4LAAA 3VYSA 4NDXA 3T51B 2XRQD 2WV6D 1QG7A 4DN4M 2DY8A 5I6YA 3L9AX 1TIID 2I07B 1XTCD 1XXGA 1UNSA 4P2CB 4ZK9B 1FNUA 4FP5D 3Q24A 3VYUA 2X69A 5LHY1 1V8QA 2A68C 2F0UA 4OO1H 4NP5A 2NTTA 1Y8NB 2ZXOA 1OXTA 3PIO3 5NUCA 1X3QA 2D9UA 1EIHA 3D4DA 2CW0C 3NPPA 3FMCA 4RCOA 4DGZA 1C48A 1NSNS 1B53A 3I70A 3U9SA 1SEBD 4QIWB 1IW7C 1EY8A 5IT9E 2LFNA 3H3VC 2E2IB 5DNFA 3R93A 1B3AA 1F2YA 1JWMD 4CBVA 1OXSC 4DNRB 1ZYRC 1CA6A 1JB3A 1EY7A 2F0FA 5FK9C 1PYWD 1QJOA 1PTOC 2FMCA 3GTOB 4DA2A 3VR2A 3BYYB 4ZUIA 4G7HC 1SJED 4CKBA 4RFBA 2AQ1B 1BCPF 1JC7A 2KQ3A 1UAPA 1OXXK 4KTAA 3I4NB 2L0CA 2PYKA 3NWSA 1ESRA 2FJ2A 2QDBA 2DNCA 1SJHD 2F0GA 4I7ZC 5DM73 1EYAA 1Z47A 1JCKB 3CU7A 1SE2A 3BS1A 1HFNA 2RDHA 3Q22A 3MWYW 1J9OA 4V0BA 5DAUA 3MZ5A 1E2VA 4F8MA 2N88A 2RDGA 3BVMA 2ICIA 3I91A 3SVMA 5M5XB 2A69C 4HAEA 2KVMA 1B9MA 1QNKA 2M2LA 4TKOB 3VA5A 1TS5A 1DD2A 3J81E 4PMCA 5M3FB 4HCEA 2MP1A 1RCVD 4PMWA 2Z8LA 1Y8OB 4IFDI 3IFDA 5CC4A 1HTPA 5BN4A 4BBRB 5KIXA 3S1MB 1AFPA 1PZKD 2F0TA 2L55A 1T5EA 1RF2D 1Q8IA 2F0NA 2LS01 3DXJC 4RCNA 4K5XA 3OSOA 4CJ1B 1U4RA 3T13A 1QWYA 4IFDG 2D62A 4XYQA 3A8KE 1RHPA 1Y8PB 1ENCA 3VR5A 1WD0A 2KCNA 1Q3LA 1ESFA 1HA5A 1GUSA 5CMDA 3BG3A 1CQFA 1PRTD 2M9VA 3OWEB 3MEHA 3KUPA 3OHXC 3D8GA 3IKJA 3TDQA 4NW2A 1X32A 1V1PB 1GUWA 2NVTB 1TY2A 2YYZA 3VR3A 3GTMB 2E76C 1SYDA 5C0XH 2NVQB 5EGTA 2JA5B 3EJIA 2AWNA 2PW5A 5C4HA 3PUXA 3HG9A 4C3HB 5DEHA 1A15A 5K36H 3URYA 4X3KA 5EBCA 4PNYA 3H91A 1BR9A 5E4WC 2R92B 4MHEA 1EY4A 4HSVA 1TS4A 1QCBD 2NZ1D 5CV9A 3D4WA 3D31A 3MXGA 1AEXA 2D2CC 3K5LA 3NK9A 1BBXC 4QB4A 2EJMA 4BS9A 1S5ED 1ML0D 1EYDA 2HCCA 2PZUA 5K36G 4OO1I 2K03A 2CW0D 3SE0A 5T1IA 5C3WA 1EY0A 1G291 3GTLB 4CKEA 4HEDA 4V190 3G7LA 1STGA 3SXHA 4KY5A 1EU4A 3OOCA 3S2HB 2ENBA 2F0JA 2JEBI 3DUZA 1GHKA 1K8MA 4L63B 1JOOA 1IL8A 2PPBC 3HRZC 2OF1A 1F2LA 5EJWA 1TS2A 3MXUA 4QMGA 1DOMA 2PZWA 3C1EA 2WACA 3NWTA 3M4OB 2WAQB 4L6TB 1G8ZD 5EPLA 1EQTA 4QUFA 2VUMB 2ID0A 2K32A 1PZJD 2NTSA 5ELFA 1TQOA 3K5OA 3K7AB 2TMPA 1K8OA 2RQXA 5DM63 4QF4A 1DM0B 3RLFA 4FYDA 1EEID 1OO9B 4XTCS 4DK1A 4IQZA 2HDLA 2MPMA 3GP7A 2VB3X 4KI0A 4GZYC 1EY6A 3EFXD 4K2LA 4K6DA 2VXWA 2IT1A 2EZVA 4E6IA 2ZXRA 3OIPA 3HOWB 2NN6I 2PNRC 1TWCB 5CORA 4N9PA 2E75C 2HUGA 3P20A 5A2QE 4RGNA 4DAPA 2F0QA 2A5HA 3S16B 3UI2A 3EA6A 2DN8A 3TMEA 2WP8J 3J81L 4A3FB 4CJ0B 2EXZA 4B08A 1KLUD 3BVGA 3X3NA 1Q90A 2KECA 2V4DA 3PO2B 2EVBA 4WJWA 3TZUA 3IL8A 1H9SA 4KV6A 4KMUC 2JP1A 2A69D 3O13A 5KGUA 3MA2B 3ND8A 2NVXB 2B39A 5J1ZA 4IURA 4ODGA 2IX1A 3K5NA 1XWEA 1NUCA 2PO4A 2EYPA 4RGTA 3DMUA 4M8AA 2GA4B 3HOVB 4H0LC 4K6LA 3NTHA 1BQQT 3A7AB 2SEBD 2QF7A 4RHRA 1PRTB 3BZDB 4EVOA 2K04A 2Z1CA 4RAUC 1HXYD 1I4QA 4A3IB 3KBXA 1SYGA 4RGMA 4C3JG 3QOLA 4O1NA 1PFBA 5IOCA 5I4DA 1S5DD 2XWBB 5COYA 4IZ8A 3K6OA 1CZGA 3LX0A 4K14A 3QB3A 2ZT9C 2HQEA 5E1FA 4DU9A 1B1ZA 2JA6B 5JPNC 3BVZA 5IGBA 3D6WA 4HN7A 4C1NK 4IUVA 3A54A 2F0SA 5IGFA 2K28A 1WTVA 3HS0C 3SK8A 2XSCA 3NBIA 4J6HA 4A93B 2EYJA 2RSOA 1DXMA 5A35A 1OXVA 3T4AC 1HRJA 1PTOD 3CRLC 2L9HA 4XT1B 2QKIC 3AU7A 5CR3A 1R4PB 2K5DA 1CM9A 1STEA 1II3A 3D3RA 2OXPA 4Z9CB 1Y1VB 3ND9A 2KHSA 3PUYA 2XIWA 1KLGD 3T16A 5C3EB 5C4XB 2F0EA 3RUZA 4XQNA 3QOJA 2XVSA 4KN4C 4KD4A 3TN2A 1O80A 1CHPD 1UEAB 1Q12A 1TWFB 3FVQA 4J1MA 4ME5A 3WOFA 5ELBA 2FMMA 4A3GB 3R3OA 1MBYA 1R9TB 4ZLTF 1R4QB 3BDOA 2KOLA 2K6AA 2F3WA 3FDTA 3PV0A 3D6CA 1LTAD 1MI2A 3LNNA 1QE6A 3DWQA 4DAYA 1F77A 3A8JE 2EYOA 4ID6A 1BCPB 3NHHA 2WKCA 5IODA 1HPCA 5C5MA 2RA4A 1FR3A 2OEOA 3K5MA 4RHSA 2SDFA 1TVXA 1EZ6A 4F7XA 2PQEA 5EKIA 2NUCA 5FO7B 1SNMA 4IALA 3ITPA 3RZDB 2J0TD 5KNBA 2L11A 4JK1C 2E74C 1D5XC 4IFDJ 3H09A 1AP0A 3A8IE 4CKCA 2EJFC 4KK7A 3OPOA 1M4VA 2E2JB 3IAYA 4C56C 1E0BA 1I4GA 3BDCA 4OIKA 1RODA 1I4RA 4DNTB 5K5PA 3VR6A 3NXWA 1PXUA 1H9JA 3FPPA 4R8NA 5JVH3 3EVQA 2JYOA 2EJGC 4C3JB 3S14B 1GUTA 2H4OA 4CJ2C 1H9KA 4DF7A 4AYBB 1J8IA 3NBHA 1U4MA 1TT2A 1TWGB 2A6HD 1SSOA 4ZKCB 4PQXA 5AFWA 1SNQA 3DEOA 3J80E 5I2YA 3GQBA 1LTSD 1STNA 2C9OA 1QOHA 2CVRA 4ZRZA 5M5WB 2NVYB 1K83B 3NE5B 5D14A 1EEFD 1CFMA 3LWEA 4K8IA 1JICA 1QB5D 4KHZA 1STBA 4F87A 1XYIA 4ABNA 4DXGA 4KHVA 4OO1G 4ZQ3A 3F2UA 1M8AA 2F0KA 5TSSA 3LWUA 1GXDC 5IGEA 1CI3M 3PUVA 2A6EC 1DONA 1LACA 2SNMA 3X3MA 4H44C 2X6GA 2NWGA 4U673 1CK1A 4BA2I 5C6AA 4Q0FA 1ENAA 3KLSX 1WTWA 3OMGA 2F0DA 5KYIA 5CV6A 3DWAA 3TP6A 2IPKD 1I6HB 3SK4A 4K2KA 2EY6A 1BO0A 1MSGA 3S1RB 3KK7A 2I46A 1C8CA 4UDUC 1PRTC 3VA7A 1TWHB 1EFID 4ZYSA 4IN3A 4NMZA 3SHLA 4A3MB 4DAVA 5C3XA 1SE3A 4XQQA 2B63B 3T56B 3CQZB 2F0LA 2EDGA 3JAML 3A55A 1T5XD 1EWHA 2QCPX 3K57A 2LY7A 4OIJA 2KEEA 1B50A 2VB2X 2A68D 4G7OC 1BOSA 4QCLA 4ZKBB 1LT3D 1I4XA 1BCPD 2KJXA 3I4LA 1H9RA 2JXMB 3HEJA 1DZ1A 3S9WA 4XDXA 4HTHA 4EGVA 2XN9C 4FF4A 3M7GA 2EY1A 5HGTA 3MFYA 5C44B 1KNAA 5CV4A 3HOZB 4RGOS 2RVLA 5FO8B 1MGSA 3I72A 2D5DA 4K5VA 4C3HG 5CV8A 2IJ0A 1SYBA 3FEWX 1DJRD 1NR4A 3HKZB 3NSWA 1EY9A 3N6RA 1NCVA 4LK1C 3GV6A 2B2UC 3QIAA 3MHBA 3Q6SA 4J8QA 3V05A 5CV5A 1GUNA 3OIQA 3U9OA 1YNJD 2EPBA 2F1MA 2FFKB 1KDCA 4KY6A 3MAQA 2J7ZA 4YIJA 5KNCA 1I4PA 4A3JB 1ZXTA 4ZUJA 5CBEE 3V96A 2O5IC 1JWSD 2F0MA 4TQUS 4DXFA 2F0WA 2IX3A 3PIP3 2E2DC 1HUMA 1A6XA 3ERQA 4FF1A 5KYLA 1H9MA 4BY7B 1I4HA 3TZDA 1LT4D 1IHZA 3HOXB 1B44D 1FNVA 3Q23A 1F9RA 5J22A 1ONLA 1WTXA 1VF5C 4K8JA 3NTKA 5M9OA 4XQJA 5FOBB 2AQ2B 2A73B 3R2IA 4JBWA 1IW7D 5EPJA 1WTOA 5G3LD 2O5JC 1KABA 1EOTA 4RA8A 3DHQA 4F88A 1DYQA 2JSOA 1JOKA 4X3TA 3RMHA 1KDAA 1ZYRD 1IKLA 5BN3A 1B9NA 1EQVA 2LKVA 2DY7A 1KTKA 3D4RA 3MXNA 2L5TA 3SR1A 1VF7A 3S17B 1FD7D 1S5BD 2F0HA 2PW7A 5FO9B 1L0XB 3AB9A 2OT2A 2XWJB 2G9DA 4DFAA 1IKMA 4WFN3 5JEAH 1LTBD 3MVVA 2AQ3B 3NQTA 5F2DA 1SNOA 2B8FA 2B8GA 1Z7TA 4KKTA 3L7ZC 3H6MA 2HCIA 4IUQA 2B2TC 3QO2A 1WTQA 2IX0A 2NN6H 3CKIB 4R8IA 3NP8A 3DWPA 4G7ZC 1PDQA 5EKKA 4OGQC 1LTTD 3PMFA 1S5FD 2BDNA 1D6EC 1BCPC 1RD9D 2BA1A 3S1NB 1TU2B 4HMJA 4HMIA 3I4MB 4CGYB 3SK5A 1PTOF 5I6WA 3HGBA 2JA8B 5JVG3 1F2ZA 1U4LA 3S1QB 1VCIA 4FXKC 3GO5A 5IGCA 4RKLA 4RKBA 1SXTA 1V1OA 2B2WA 3I3CA 1I6VC 5E4XA 3KBGA 2CQAA 4A3BB 2B2VA 3J7AV 3H0GB 4WORA 1SYFA 1WD1A 5IT9L 2B2YA 1RTNA 1A3VA 2FINB 3VR4A 2KCCA 2IL8A 1DOLA 2R7ZB 3A56A 3GTKB 5BN5A 1ET9A 1LT6D 2WB1B 1STYA 4KY7A 4S3SA 1RKNA 4MIUA 4K5WA 3W3AA 1HQRD 2N55A 3J7AF 1AW7A 5CV7A 3H94A 1PZID 2EYMA 1BF4A 3MXPA 1HTLD 3M85A 4QUCA 2B2YC 1JOQA 2BCOA 2EYLA 5J39A 3EROA 2Q8TA 3SDZA 4KKSA 1RTOA 1TR5A 1JWUD 1D1KA 3NUCA 4IUUA 3VYRA 2NB0A 4LMQD 4OL7A 2PCFB 4O42A 2F0OA 2NBFA 1JQYD 1SMYD 1XX8A 3W2DA 1VDZA 4TRDA 1F2MA 3C3LA 1RDPD 1CHQD 4FXGC 3G6JB 3VYTA 3TP7A 2AUJD 4WRDA 4M1UB 4C3IB 2J4XA 2NYZD 2R6GA 1PTOB 5FLXE 5JEAJ 1EY5A 3S2DB 1A2UA 1S5CD 1SNDA 3KLRA 1U9RA 1VMPA 5JEAG 1B2TA 4KKUA 1LLRD 5ELCA 3T53B 3P1HA 1WTRA 3BYTB 3QJYA 2K01A 1JORA 1SNCA 3J80L 5C4JB 3ONAB 1PLFA 5KNDA 5EQ0A 5D3IB 5HURA 1GOZA 4PMBA 2HDMA 4G4KA 1CZWA 2RBMA 5T1GA 4HSPA 1SYCA 2YU9B 2O2LD 3P75A 2KA7A 3M4YA 1AZQA 3MFGA 1NAPA 1WVLA 5C4ZA 1I3QB 4KJOA 3AMUA 1HHVA 3DM1A 3R2TA 3HOUB 1F9QA 3RZOB 2NN6G 1L0YB 2A6HC 3NQIA 1E2ZA 1Q1BA 1NR2A 4XIGS 1EYCA 3E5SA 3WDNA 3K58A 4B9XA 1A2TA 4IUPA 1QILA 2RSNA 3TBIB 3CRKC 1D5ZC 3E0JA 1GUGA 4FXDA 3E6ZX 1LO5D 1PMRA 3GTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EU4 A;  2XRS D;  1STE A;  1JCK B;  1FNU A;  1M4V A;  1SE2 A;  1ESF A;  4C56 C;  1I4G A;  1DYQ A;  2XNA C;  1CK1 A;  1HA5 A;  1SXT A;  5D3D A;  1V1O A;  2J4X A;  4Z9C B;  2NTT A;  2RDH A;  4L63 B;  3O13 A;  1I4R A;  1PTO B;  4RGO S;  1KLG D;  1PRT F;  1LTG D;  1PRT D;  1TS3 A;  1TS2 A;  1FGB D;  3OWE B;  3SEB A;  1JR0 D;  3KLS X;  2IJ0 A;  1S5C D;  4RGT A;  2RDG A;  4BWG B;  1KTK A;  3BVM A;  1DJR D;  1LLR D;  2G9H D;  2ICI A;  3DWA A;  1EWC A;  4K6L A;  5ELC A;  1EU3 A;  3BYT B;  2IPK D;  4RH6 A;  2SEB D;  1FD7 D;  1S5B D;  5FKA C;  4RHR A;  1V1P B;  4RCO A;  5D3I B;  4L6T B;  4TSS A;  1GOZ A;  1G8Z D;  1L0X B;  5ELD A;  1TY2 A;  1PRT B;  3BZD B;  1LTR D;  1BXT A;  3V05 A;  2NTS A;  1CHP D;  1PZJ D;  1ET6 A;  1HXY D;  1D5M C;  1I4Q A;  1ET9 A;  1SEB D;  4UDU C;  5ELF A;  1LT6 D;  1PRT C;  4RGM A;  1TS5 A;  1EFI D;  4ZYS A;  1I4P A;  1LTB D;  4O1N A;  1LTI D;  5ELB A;  2AQ3 B;  1HQR D;  5I4D A;  1S5D D;  2O2L D;  1JWM D;  1AW7 A;  5ELE A;  1ENF A;  1SE3 A;  1EEI D;  1PZI D;  1JWS D;  3URY A;  2QEJ C;  1AN8 A;  3MFG A;  1HTL D;  4DXF A;  1RCV D;  2R61 A;  5FK9 C;  1LTS D;  1PYW D;  1LTA D;  3MC0 B;  2Z8L A;  1T5X D;  3DWQ A;  1F77 A;  1PTO H;  1B1Z A;  1PTO C;  1CQV A;  3GP7 A;  1CT1 D;  2CHB D;  1V1P A;  1BCP B;  3EFX D;  1EEF D;  3BVZ A;  1I4H A;  1TS4 A;  1UUP A;  3R2T A;  1SE4 A;  3BYY B;  1SJE D;  1L0Y B;  1LT4 D;  1MD2 D;  1PZK D;  2AQ1 B;  4RFB A;  1TY0 A;  1LT5 D;  1BCP F;  3R8B A;  1B44 D;  2TSS A;  1FNV A;  1RF2 D;  3DWP A;  1FNW A;  4RHS A;  1JWU D;  1LTT D;  1S5E D;  1QIL A;  4DXG A;  1S5F D;  2XRQ D;  4RGN A;  1D6E C;  1BCP C;  1RD9 D;  2QIL A;  1LT3 D;  2WV6 D;  1I4X A;  4OHJ A;  1BCP D;  1PTO D;  1JQY D;  3EA6 A;  3W2D A;  5TSS A;  2AQ2 B;  1D5X C;  3R2I A;  1XTC D;  1SJH D;  1SBB B;  1D5Z C;  1XXG A;  1RDP D;  1UNS A;  1PTO F;  3CHB D;  1LO5 D;  1CHQ D;  1KLU D;  3BVG A;  2XN9 C;  3TSS A; 
#chains in the Genus database with same CATH topology
 5IGG A;  1STH A;  2F4I A;  4MTN A;  5FLM G;  1F9P A;  1O7I A;  1QNU A;  3S15 B;  1MSH A;  2VY3 A;  4YY3 L;  4DUY L;  4O2D A;  4HJ7 A;  3RD4 A;  2NVY H;  4H13 C;  1PRT F;  4HJ9 A;  1Z9F A;  4N9T A;  4QY7 A;  2FHT A;  3CCL A;  1XPU A;  1VQP A;  1G6Z A;  1NTG A;  3U4V A;  5LL6 X;  2G9H D;  1VQC A;  1ICW A;  2PZT A;  4A3K G;  4TSS A;  1HUN A;  4KHP L;  5ELD A;  4DK0 A;  2RF4 A;  4APV A;  1SDF A;  3JAM E;  3HP3 A;  1X3P A;  2KHJ A;  5JOB A;  1GUO A;  1S40 A;  3GTP B;  1C7Y A;  2ZTE A;  4BBS G;  4LF7 Q;  3S1M H;  2WIN B;  1BDO A;  2Z4H A;  5C0X I;  1EIG A;  4EQO A;  4C2M B;  4IOC A;  1RL2 A;  4PV1 C;  2BOS A;  3CCQ A;  1G91 A;  1L1O B;  1TWG H;  4B3M Q;  1KDB A;  1WCM G;  4ME3 A;  5CBA E;  2QEJ C;  1SFO B;  1S4Z A;  2K7V A;  5I2X A;  1B4O A;  3PO3 G;  4KD3 A;  3KOJ A;  1YNN C;  3J80 i;  2JA7 G;  1PHJ A;  2DNE A;  1RIP A;  1KL9 A;  1UUP A;  4NB3 A;  2F3V A;  5GAE C;  2F03 A;  1K83 H;  3STB D;  3GD7 A;  1A3T A;  2KUM A;  2PMZ B;  1PFM A;  3CCM A;  1V43 A;  1Y1W G;  3KF8 A;  2JE6 I;  1TY0 A;  2R93 B;  1FYC A;  2L4N A;  1ILP A;  5M3M B;  1HNZ L;  1IL2 A;  5C0X G;  1SLJ A;  1C4Q A;  4UAI A;  2Z4I A;  2QIL A;  2O4X A;  4A3E G;  4RWS C;  2AMC B;  4ILW A;  2B2W C;  4BY1 G;  1EIF A;  3K80 C;  2MUY A;  5JPM C;  4X3U A;  5JJL A;  2I5H A;  1XMO L;  3I8Z A;  1I50 B;  1GJX A;  2EY5 A;  1XNQ Q;  1ZEQ X;  5G3L F;  1XMQ L;  3TSS A;  2ZXP A;  4XXE A;  4X66 L;  3QG1 A;  1A3U A;  2B2T A;  2ES2 A;  2NVT H;  1VMC A;  2VQF Q;  2A6E D;  1LYL A;  2PNH A;  2Q8R E;  4LFB L;  2IWH A;  1SYE A;  3FKI B;  4AH6 A;  1O7L A;  1L1O C;  1X56 A;  5JJZ A;  2R3Z A;  1FGB D;  1X3G A;  2XGT A;  1ZKO A;  4R9W A;  4DV4 L;  1JR0 D;  5EKL A;  2VS1 A;  4JI3 Q;  3TRE A;  2ASB A;  3NEL A;  1KD1 C;  4EX5 A;  1EU3 A;  3FPU B;  3SK6 A;  4RH6 A;  5FKA C;  4A76 A;  4JW0 A;  2KED A;  3NTI A;  3EIV A;  2X6L A;  1D1I A;  2ZJR A;  4H7B A;  4K0K L;  1JE4 A;  2KCT A;  1NBW A;  3CAM A;  4A3L G;  1BKB A;  2M00 A;  4ULL A;  5E3F A;  4KHP Q;  3K59 A;  3RLO A;  1Z6H A;  2C5C A;  3CPF A;  2JQO A;  3K0Y A;  4BA1 I;  4JI4 Q;  4JV5 L;  5M5X H;  1KXL A;  1W6K A;  3QWN A;  3GTL H;  5ELE A;  4A3M H;  4RMF A;  1ENF A;  5D65 A;  2B2V C;  3HOZ H;  2EOT A;  3GV3 A;  3DLL A;  1AN8 A;  4LWC A;  3F1Z A;  1Q1E A;  3FKI G;  3OW7 A;  3I56 A;  4HIM A;  4H02 A;  2L1B A;  1KRS A;  1SAP A;  1KNE A;  5I9O A;  3CQZ H;  1CQV A;  3IRB A;  2CHB D;  1M90 C;  3CCJ A;  2E2H B;  4B9W A;  2K33 A;  5IYD H;  4X3S A;  4MNO A;  1IYU A;  4I65 A;  3I4M H;  3C2P A;  2SOB A;  4LFC L;  3HKZ E;  3TP5 A;  1SNP A;  4XYO A;  5IYD G;  4GNX B;  1LT5 D;  2MJ8 A;  3PSI A;  3R8B A;  4JVZ A;  4UP9 A;  4JI1 Q;  3W1B A;  4BY1 B;  1FNW A;  2A8V A;  1D2B A;  1O78 A;  4A3E B;  4CHT B;  2LMC B;  3BZC A;  3KF8 B;  4OHJ A;  1Q82 C;  1UE7 A;  1K73 C;  3A7L A;  5M3M G;  1KAA A;  4OX9 Q;  5JAV A;  1YIJ A;  1ILQ A;  1AH9 A;  3V2T A;  2R93 G;  2H1E A;  2F0V A;  1Y1W B;  4IUT A;  4FNF A;  1TWA H;  3CHB D;  1X3E A;  3P7J A;  2XRS D;  1DOK A;  1WTH A;  3ERS X;  5IIF A;  2JA7 B;  4IO9 A;  2A74 C;  5D3D A;  1QVC A;  3Q0A A;  5ISR A;  2IY5 B;  3PO3 B;  1XNQ L;  1XPO A;  1LTG D;  3HZX A;  1WCM B;  3SEB A;  3CCU A;  2B2U A;  2BDO A;  1F9S A;  3HOV H;  3I55 A;  2Q8I B;  2SNS A;  2K5W A;  5LMU Q;  4BWG B;  3BDL A;  1YHQ A;  1W6J A;  2K5Q A;  2L15 A;  3GTJ H;  2K1B A;  1N8R C;  4BBS B;  4LF9 L;  5I9P A;  1QVF A;  4EQN A;  1TWC H;  2JEA I;  3C1F A;  3UDG A;  4HR7 B;  4NPS A;  4I7A A;  4ZAI A;  1D5M C;  3J81 j;  1GHJ A;  4A3K B;  1N9W A;  3NEN A;  1KAW A;  3C46 A;  3MTS A;  1LV9 A;  4FF2 A;  3S1N H;  1LTI D;  3H3V I;  1TKW B;  1WJJ A;  3JC6 6;  3OWF A;  5EPK A;  3HOW H;  3OMC A;  2BE5 C;  2L12 A;  4L5Q A;  1PYB A;  5GQO A;  2K50 A;  4Q5V A;  1JMC A;  5KRU A;  2EE1 A;  5C0X J;  1PFN A;  4HCS A;  3PUZ A;  5IGD A;  2CQO A;  3T1Y L;  2AUK A;  1JJC B;  5FLX L;  1PH2 A;  3FRP B;  4JI0 L;  1CT1 D;  1V1P A;  2NVQ H;  1E2W A;  1Y69 U;  3KFU A;  2LXJ A;  2F0I A;  3A5Z B;  1SE4 A;  1H9S B;  1TWA B;  5LL6 S;  4BY7 H;  2EYH A;  1O7Y A;  1MD2 D;  1YZ6 A;  1HQM C;  1DCZ A;  2Z6K C;  1K0R A;  3I73 A;  3TEH B;  2TSS A;  3EQL C;  2VNU D;  5EBD A;  2WB1 E;  4DR4 L;  3KJP A;  4IUN A;  1X55 A;  4IFD H;  4KN7 C;  4PZ8 A;  4LJZ C;  2BE5 D;  2RKS A;  3U50 C;  4EQP A;  4DR2 Q;  3GTQ B;  5KEE A;  3GTG B;  4FVM A;  3I90 A;  1LAB A;  2UXC L;  1SR3 A;  1IBK L;  4N8X 1;  1YNN D;  5DLQ E;  2DJF C;  1PV4 A;  4Y7N B;  3OTO Q;  3M3Y B;  1SBB B;  4YY3 Q;  1YNJ C;  2B29 A;  3TP8 A;  2N78 A;  2R93 H;  3HOU G;  1MHW C;  4FO2 A;  2ICE C;  2IW3 A;  3M7N A;  2Q2H A;  1OXU A;  2EY2 A;  2XNA C;  3RR5 A;  2WKD A;  1GKH A;  3KLS A;  5CGK A;  3KYH C;  5A2Q L;  1PH5 A;  2UUA L;  2Z6K A;  3PUW A;  4DK3 C;  1TS3 A;  2PQA A;  5IP7 G;  1I94 Q;  4FF3 A;  1HA6 A;  1EWC A;  2WII B;  4KJN A;  2YU9 H;  3N52 A;  1CA5 A;  4JI6 L;  1HFG A;  3WOE A;  4XT3 B;  2H5X A;  1RJT A;  5IP9 G;  2CCZ A;  2BA0 A;  2E5L L;  1SMY C;  1P8L A;  1HCZ A;  1BXT A;  1LTR D;  4A93 H;  1ET6 A;  1O7Z A;  1P16 A;  4C1N I;  2VUM H;  1WTP A;  2PQA B;  2MHV A;  5CYU A;  2K05 A;  5BR8 L;  1Q8K A;  1IYV A;  4MN3 A;  2MGS A;  2UXB L;  4G57 A;  1IBL Q;  2EYF A;  1STA A;  4QJF A;  1G2S A;  3IFT A;  4B3R L;  3ZYY X;  4U68 A;  4NKL A;  1G51 A;  1EL0 A;  3L3O C;  3W1G A;  1AZP A;  2R61 A;  4WJ3 M;  1BUV T;  3MC0 B;  1CTM A;  1NE3 A;  4R4C A;  4C3I G;  1U4P A;  2DJG C;  1PTO H;  1EQR A;  3GTK H;  3HOU H;  5M5Y B;  5C5L A;  3UE1 A;  2AWO A;  2F0P A;  3M3Y H;  3RZO H;  1BNZ A;  2Y0S B;  3DEP A;  4L8J A;  3HOY B;  1EZ8 A;  2RDF A;  4A3D B;  4OWX B;  4DR6 Q;  3J7Y W;  1G2T A;  3M4Q A;  1PH9 A;  4WJ4 A;  4LAA A;  3VYS A;  1M1K C;  4NDX A;  3K7U C;  3T51 B;  4DAM A;  2XRQ D;  5LMN Q;  3RZD H;  3TQY A;  1FGU A;  2WV6 D;  4J15 A;  4OXP A;  4DV6 L;  4BXX G;  1QG7 A;  4DN4 M;  2DY8 A;  4DR7 Q;  2QGQ A;  5I6Y A;  3L9A X;  2UXD L;  4JC0 A;  1TII D;  4DR4 Q;  2I07 B;  4POF A;  1VQ7 A;  1XTC D;  1XXG A;  1UNS A;  3TS2 A;  1E24 A;  4P2C B;  1N33 L;  4ZK9 B;  1FNU A;  4FP5 D;  3Q24 A;  3VYU A;  2X69 A;  5LHY 1;  4UP8 A;  1V8Q A;  1SE8 A;  2A68 C;  1A63 A;  2E8G A;  2F0U A;  4JI3 L;  4OO1 H;  4NP5 A;  2NTT A;  4JYA Q;  1Y8N B;  2QW7 A;  2ZXO A;  1OXT A;  3PIO 3;  5NUC A;  1X3Q A;  1Y1W H;  1EQQ A;  3U4Z A;  1HR0 L;  4P71 A;  1JB7 A;  2D9U A;  4K0K Q;  1EIH A;  1K9M C;  3D4D A;  2RCF A;  1E1O A;  2CW0 C;  2Q2T A;  3NPP A;  3FMC A;  3TRZ A;  2WB1 G;  3I2Z A;  4ALP A;  1KC8 C;  4RCO A;  4DGZ A;  4DR3 Q;  1C48 A;  3RN5 A;  2UUC L;  2R7Z G;  1NSN S;  3GTP H;  1B53 A;  3I70 A;  3U9S A;  1HNW L;  1SEB D;  2RHQ B;  4QIW B;  1IW7 C;  1EY8 A;  2K14 A;  1CUK A;  2LFN A;  5IT9 E;  3H3V C;  2E2I B;  5DNF A;  1CSP A;  3R93 A;  3PCO B;  1B3A A;  2F3I A;  3S2D H;  4X65 Q;  3DM3 A;  1F2Y A;  3H0G G;  2UUB L;  1L1O A;  1JWM D;  4CBV A;  1OXS C;  1XPR A;  4A3B G;  1BBU A;  4DNR B;  1ZYR C;  1CA6 A;  1JB3 A;  1EY7 A;  2HQL A;  2KCM A;  2F0F A;  5HY6 A;  4PZ6 A;  1XNR L;  5FK9 C;  1VQ6 A;  1PYW D;  4YCU A;  1QJO A;  3S15 H;  4A3K H;  1NY4 A;  4DR5 Q;  1PTO C;  2FMC A;  3ULJ A;  3GTO B;  4HIO A;  4DA2 A;  3VR2 A;  3BYY B;  4ZUI A;  4G7H C;  2JA8 G;  1SJE D;  1QUQ B;  4CKB A;  4RFB A;  2AQ1 B;  1HZA A;  3I4M G;  1BCP F;  4JI7 Q;  1JC7 A;  2KQ3 A;  1UAP A;  1OXX K;  4KTA A;  3I4N B;  2L0C A;  4OEL B;  2PYK A;  3NWS A;  1ESR A;  2FJ2 A;  1HZB A;  3CXC A;  1FJG Q;  2QDB A;  2DNC A;  1SJH D;  3J7A 5;  2F0G A;  4I7Z C;  5DM7 3;  1EYA A;  1Z47 A;  1JCK B;  3CU7 A;  4C3J H;  1VQ4 A;  1SE2 A;  1YHB A;  3M4O H;  3CPW A;  3BS1 A;  1HFN A;  2RDH A;  1CKO A;  3Q22 A;  1YJ9 A;  3F8T A;  3MWY W;  1E7Z A;  2Q2I A;  1SRU A;  3STB C;  1J9O A;  4OON A;  4V0B A;  3AFP A;  5DAU A;  3MZ5 A;  4IJH A;  1E2V A;  4F8M A;  2N88 A;  2RDG A;  3BVM A;  1J5E L;  2ICI A;  3I91 A;  3SVM A;  5M5X B;  2A69 C;  2K5N A;  4HAE A;  2KVM A;  5ELO A;  1B9M A;  1XTD A;  5ELN A;  1QNK A;  5M5W H;  4JI8 Q;  2M2L A;  4TKO B;  3VA5 A;  1TS5 A;  4X64 Q;  2ATW A;  2ZTC A;  1DD2 A;  2UUC Q;  3J81 E;  4PMC A;  2E2J H;  4AQY Q;  5M3F B;  4HCE A;  2N3S A;  4X65 L;  2OTJ A;  2MP1 A;  1RCV D;  4YWL A;  4HJ8 A;  4PMW A;  2Z8L A;  1SRO A;  1Y8O B;  4IFD I;  3IFD A;  5CC4 A;  1HTP A;  5BN4 A;  4BBR B;  5KIX A;  4UPA A;  1PH1 A;  2EIF A;  3S1M B;  1AFP A;  1PZK D;  4A3F H;  2F0T A;  1N32 Q;  2L55 A;  2F4V Q;  1T5E A;  4C2M H;  1RF2 D;  1Q8I A;  2F0N A;  2LS0 1;  1UWV A;  4AYB E;  3DXJ C;  4RCN A;  4K5X A;  3OSO A;  4GS3 A;  4CJ1 B;  1U4R A;  3T13 A;  1QWY A;  4LF8 L;  4IFD G;  4X66 Q;  2D62 A;  1TXY A;  4XYQ A;  3A8K E;  1RHP A;  1Y8P B;  2MQH A;  3UDF A;  5GAD C;  1DGS A;  3HOX G;  1B7Y B;  3RNU A;  1ENC A;  3VR5 A;  1WD0 A;  3AYH B;  2KCN A;  1FJG L;  2LSS A;  1VQO A;  4BY7 G;  5C44 H;  1Q3L A;  1ESF A;  2ZJP A;  4DV4 Q;  1HA5 A;  1GUS A;  2IHF A;  3T1Y Q;  3HFZ B;  5CMD A;  5AJ3 Q;  2B63 H;  3BG3 A;  1CQF A;  1PRT D;  2M9V A;  3J80 c;  3OWE B;  1EIY B;  3MEH A;  1N36 L;  3KUP A;  4NXN L;  1B70 B;  4JI2 L;  4X62 L;  2K5H A;  3OHX C;  3D8G A;  1Q46 A;  4A3J G;  3IKJ A;  2A19 A;  3TDQ A;  3CF5 A;  4NW2 A;  3A0J A;  1X32 A;  1V1P B;  1GUW A;  4P72 A;  1C9O A;  4BY1 H;  1E22 A;  2NVT B;  1TY2 A;  2YYZ A;  2YV5 A;  3VR3 A;  3GTM B;  4DV6 Q;  1H95 A;  1IBK Q;  2E76 C;  3BU2 A;  1SYD A;  5C0X H;  1VQJ A;  1JJ2 A;  4NXM L;  2NVQ B;  3AFQ A;  1YBY A;  5EGT A;  2JA5 B;  3EJI A;  3HKZ G;  3E9I A;  2AWN A;  2ALY B;  2PW5 A;  5C4H A;  1NMF A;  3PUX A;  4IPC A;  1N33 Q;  3HG9 A;  4C3H B;  5DEH A;  1A15 A;  2RHS B;  5K36 H;  3URY A;  4X3K A;  5EBC A;  4PNY A;  4YWK A;  3T1H L;  3H91 A;  3J81 i;  1BR9 A;  5E4W C;  3HOZ G;  4LFC Q;  1SFO H;  2R92 B;  4MHE A;  3GTQ H;  5C44 G;  1EY4 A;  4HSV A;  3ICE A;  3ULP A;  1TS4 A;  1CSQ A;  1QCB D;  2NZ1 D;  5CV9 A;  1I6H H;  3D4W A;  3D31 A;  5LMN L;  3MXG A;  1AEX A;  2D2C C;  3K5L A;  3NK9 A;  4DV5 Q;  4QB4 A;  1HZ9 A;  2EJM A;  3L0O A;  3F2B A;  3S1R H;  1BBX C;  4BS9 A;  4GKK L;  1S5E D;  1ML0 D;  1EYD A;  1Q81 C;  2HCC A;  2PZU A;  1VQ8 A;  5K36 G;  4OO1 I;  2K03 A;  2CW0 D;  1HNX L;  3SE0 A;  5T1I A;  5C3W A;  1NJI C;  1EY0 A;  1G29 1;  1N34 L;  3GTL B;  4CKE A;  1IXR A;  2Z6B A;  4HED A;  4DNI A;  3G7L A;  4UHV A;  4V19 0;  1STG A;  3SXH A;  1WOC A;  4KY5 A;  1EU4 A;  3OOC A;  2VQE Q;  3S2H B;  4LF6 Q;  2ENB A;  2F0J A;  2A1A A;  2JEB I;  3DUZ A;  1GHK A;  1K8M A;  3K0X A;  5LMU L;  4L63 B;  3D0F A;  4PG3 A;  2B63 G;  1JOO A;  1IL8 A;  2PPB C;  3HRZ C;  2OF1 A;  1F2L A;  5EJW A;  1TS2 A;  3MXU A;  2MNA A;  4QMG A;  1DOM A;  3JAM c;  1HR0 W;  2PZW A;  4DUY Q;  3C1E A;  4A3M G;  2WAC A;  3NWT A;  4KLK A;  3CCV A;  3M4O B;  4GNX C;  3SGI A;  1N36 Q;  2WAQ B;  4L6T B;  3KLW A;  4YWM A;  1G8Z D;  5EPL A;  4DV1 L;  1EQT A;  1KIX A;  4QUF A;  3NEM A;  2VUM B;  1MJC A;  2NTS A;  2ID0 A;  1PZJ D;  2K32 A;  3Q8D A;  3PO3 H;  1FVI A;  5ELF A;  1KRT A;  1J6Q A;  3GTG H;  1TQO A;  3K5O A;  5FJ8 G;  3K7A B;  2OTL A;  2TMP A;  1XMO Q;  1K8O A;  2QDL A;  2RQX A;  5DM6 3;  4QF4 A;  1DM0 B;  3RLF A;  4FYD A;  1EEI D;  4A3C G;  1OO9 B;  4DV0 L;  4LFA L;  4XTC S;  2CKZ B;  5IWA L;  3AEV A;  3I4O A;  4DK1 A;  2K5V A;  4IQZ A;  2HDL A;  4GNX A;  2MPM A;  3GP7 A;  2VB3 X;  4KI0 A;  4GZY C;  1EY6 A;  3EFX D;  4K2L A;  4K6D A;  2VXW A;  2IT1 A;  2EZV A;  4E6I A;  1D7Q A;  1QUQ A;  2YTY A;  2ZXR A;  3OIP A;  3ULL A;  1XJV A;  3HOW B;  2NN6 I;  2PNR C;  1TWC B;  5COR A;  4N9P A;  2E75 C;  2HUG A;  3P20 A;  3S17 H;  4GN4 B;  1L0W A;  5A2Q E;  4RGN A;  2EXD A;  2F0Q A;  3MXN B;  4DAP A;  2A5H A;  3S16 B;  4OWW B;  3UI2 A;  3EA6 A;  2DN8 A;  3TME A;  2K75 A;  2PI2 A;  2Z9H A;  2WP8 J;  3CW2 C;  3J81 L;  4A3F B;  4CJ0 B;  3G48 A;  2EXZ A;  1KLU D;  3BVG A;  4B08 A;  1QVG A;  3X3N A;  4N8F A;  1Q90 A;  2KEC A;  2V4D A;  4GN5 A;  3PO2 B;  2EVB A;  3GDE A;  4WJW A;  3TZU A;  3IL8 A;  1H9S A;  4KMU C;  4KV6 A;  4PZ7 A;  2JP1 A;  2A69 D;  1XNR Q;  3O13 A;  5KGU A;  3MA2 B;  5FLM H;  1XMQ Q;  3ND8 A;  2NVX B;  2B39 A;  5J1Z A;  4IUR A;  4ODG A;  2IX1 A;  2CWA A;  3K5N A;  3H0G H;  1XWE A;  1NUC A;  2PO4 A;  2EYP A;  4RGT A;  3DMU A;  4M8A A;  2GA4 B;  3HOV B;  4H0L C;  3PGZ A;  2UU9 L;  4K6L A;  3NTH A;  1K3R A;  1BQQ T;  3A7A B;  2I5L X;  2SEB D;  1MJE A;  2QF7 A;  4RHR A;  1HNZ Q;  1JJG A;  4Y52 H;  5IYC H;  4AYB G;  1PRT B;  3BZD B;  4EVO A;  2K04 A;  2Z1C A;  4RAU C;  3PF5 A;  1HXY D;  1I4Q A;  4A3I B;  3KBX A;  4OWT B;  4DV2 L;  1SYG A;  4AQY L;  1YIT A;  4RGM A;  4C3J G;  3QOL A;  5HGQ A;  4DKA C;  4O1N A;  1PFB A;  4DV1 Q;  5IOC A;  5I4D A;  1JT8 A;  1S5D D;  2XWB B;  1ASY A;  5COY A;  4IZ8 A;  3K6O A;  4LF4 L;  1CZG A;  3G6E A;  2HIV A;  3LX0 A;  4K14 A;  1PA6 A;  3QB3 A;  2ZT9 C;  2HQE A;  2AHO B;  5E1F A;  4ZCK A;  4DU9 A;  2CH4 W;  1B1Z A;  2KEN A;  3K81 C;  2JA6 B;  5JPN C;  3BVZ A;  4P75 A;  5IGB A;  2JA5 H;  3D6W A;  4HN7 A;  4C1N K;  4IUV A;  3A54 A;  2F0S A;  5IGF A;  3S1Q H;  2K28 A;  3BZK A;  1WTV A;  3HS0 C;  1CKM A;  1VQN A;  3SK8 A;  2XSC A;  3NBI A;  4J6H A;  4A93 B;  1Y14 B;  2EYJ A;  2RSO A;  1DXM A;  1FL0 A;  2D0O A;  5A35 A;  1OXV A;  3UDX A;  3T4A C;  1HRJ A;  1PTO D;  3CRL C;  5IYB H;  3RN2 A;  2L9H A;  4NXM Q;  4XT1 B;  2QKI C;  3AU7 A;  5CR3 A;  3HOX H;  4JYA L;  1R4P B;  2K5D A;  1CM9 A;  1STE A;  1II3 A;  3D3R A;  2OXP A;  4UY8 C;  2N49 A;  1Q86 C;  4Z9C B;  1Y1V B;  3ND9 A;  1NMG A;  2KHS A;  2NZO A;  4X62 Q;  3PUY A;  2XIW A;  1KLG D;  3T16 A;  5C3E B;  5C4X B;  4A3G G;  2F0E A;  3RUZ A;  2PMZ E;  1EWI A;  4L5R C;  4XQN A;  1IYJ B;  4GLV B;  4QQB X;  3QOJ A;  2XVS A;  1K8G A;  4KN4 C;  4KD4 A;  3TN2 A;  1EYG A;  1O80 A;  1CHP D;  1VQD A;  2ZTD A;  2UXC Q;  1UEA B;  1Q12 A;  1K8A C;  1TWF B;  3FVQ A;  4J1M A;  4ME5 A;  5ELB A;  3WOF A;  1GO3 E;  2FMM A;  3F2C A;  4A3G B;  3HKS A;  3R3O A;  5C3E G;  1MBY A;  5C4X G;  1R9T B;  4ZLT F;  1R4Q B;  3BDO A;  4BXX H;  2KOL A;  1A62 A;  2K6A A;  2F3W A;  4HJA A;  3FDT A;  3PV0 A;  3D6C A;  1LTA D;  1Y1V G;  1MI2 A;  4C3I H;  3LNN A;  1QE6 A;  3DWQ A;  4DAY A;  1F77 A;  3A8J E;  2EYO A;  4DV5 L;  4ID6 A;  1BCP B;  3NHH A;  3CD6 A;  4JI2 Q;  1AE2 A;  2WKC A;  4GKK Q;  5IOD A;  1HPC A;  5C5M A;  2RA4 A;  1FR3 A;  1X65 A;  2OEO A;  4O0A A;  3K5M A;  4RHS A;  5GAH C;  1K0S A;  5EAY A;  2SDF A;  1TVX A;  5IT9 c;  3J81 c;  1EZ6 A;  2JA9 A;  4F7X A;  2PQE A;  5EKI A;  4A93 G;  2NUC A;  5FO7 B;  1SNM A;  4IAL A;  3ITP A;  3RZD B;  2J0T D;  5KNB A;  2BH2 A;  2L11 A;  4JK1 C;  4LF7 L;  3CC4 A;  2E74 C;  1D5X C;  4LFB Q;  4IFD J;  3H09 A;  4DR2 L;  1AP0 A;  2NZH A;  3A8I E;  4CKC A;  2EJF C;  4KK7 A;  3KDF B;  2JA6 G;  3OPO A;  1M4V A;  2E2J B;  3IAY A;  4C56 C;  1E0B A;  1I4G A;  3BDC A;  4OIK A;  1ROD A;  1J5E Q;  1I4R A;  4DNT B;  1VQF A;  5K5P A;  3VR6 A;  4POG A;  1TWF H;  4JI0 Q;  1V1Q A;  4LNQ A;  3NXW A;  1PXU A;  1H9J A;  4IPH A;  3FPP A;  4JOI C;  1HH2 P;  2Z0S A;  3B6Y A;  4R8N A;  5JVH 3;  3EVQ A;  2JYO A;  5LMN W;  2EJG C;  2Y0S E;  4GLX A;  4C3J B;  3S14 B;  1I5F A;  4A3I G;  1GUT A;  1YEZ A;  2H4O A;  2XTI A;  3E0E A;  4CJ2 C;  1H9K A;  4DF7 A;  1CKN A;  4AYB B;  1J8I A;  4IPD A;  4A3B H;  3NBH A;  1HNX Q;  4DV7 L;  4DR7 L;  2D0P A;  1U4M A;  1VQM A;  1TT2 A;  1PH6 A;  1TWG B;  2A6H D;  4C3H H;  1SSO A;  4ZKC B;  2QEX A;  3HOV G;  4PQX A;  5AFW A;  3KJO A;  1SNQ A;  3DEO A;  1ICF B;  3J80 E;  5I2Y A;  3OYY A;  4JBM A;  2AKW B;  3UE0 A;  5FLX c;  3GQB A;  4HJ5 A;  4JOI A;  4P73 A;  4DR1 L;  2UXB Q;  1LTS D;  1STN A;  3AQQ A;  2C9O A;  1YJW A;  1GD7 A;  3PIP A;  1QOH A;  2CVR A;  1CKN B;  4ZRZ A;  5M5W B;  2RCN A;  2NVY B;  2VL6 A;  1K83 B;  3NE5 B;  5D14 A;  1EEF D;  3PO2 G;  1S3O A;  1CFM A;  3LWE A;  3TS0 A;  1HR0 Q;  4A3F G;  5C4J H;  4K8I A;  1JIC A;  1QB5 D;  4KHZ A;  4JI6 Q;  4OX9 L;  1STB A;  4IOA A;  1PH3 A;  4F87 A;  4DUZ L;  1XYI A;  5JJI A;  1BVS A;  4ABN A;  4LUV A;  4R1J A;  4KHV A;  4DXG A;  4OO1 G;  3F2U A;  4ZQ3 A;  3I4N H;  1M8A A;  1YHA A;  4DR6 L;  3MEF A;  2F0K A;  4CDD C;  2WAQ E;  5TSS A;  3LWU A;  1GXD C;  1X3F A;  5IGE A;  4DK6 C;  1PH8 A;  1CI3 M;  3HOW G;  3PUV A;  2A6E C;  4AIM A;  1DON A;  1LAC A;  2SNM A;  3KDF A;  3X3M A;  2FXQ A;  4H44 C;  4YHH L;  4A75 A;  2X6G A;  4B3R Q;  2NWG A;  4HIK A;  4LFA Q;  4U67 3;  4DV0 Q;  4CDE C;  1CK1 A;  5GRO A;  1IBM Q;  4BA2 I;  1OTC A;  2P5Z X;  5C6A A;  4DR5 L;  2R92 H;  4Q0F A;  1ENA A;  3KLS X;  1HJP A;  1WTW A;  3OMG A;  2F0D A;  5KYI A;  5CV6 A;  3DWA A;  3TP6 A;  4QL5 A;  2IPK D;  3FP9 A;  1I6H B;  1L2F A;  3SK4 A;  3KF6 B;  4K2K A;  2EY6 A;  4GN3 B;  1BO0 A;  1MSG A;  2KHI A;  1LTL A;  3S1R B;  2VUM G;  3KK7 A;  2I46 A;  1C8C A;  4UDU C;  2WAQ G;  1WYD A;  1PRT C;  3VA7 A;  1TWH B;  1K3B C;  1EFI D;  4ZYS A;  5IP9 H;  1LUZ A;  2JK8 A;  4B3T L;  4IN3 A;  4NMZ A;  3SHL A;  4A3M B;  4DAV A;  4B3S Q;  4DV7 Q;  3CCR A;  5C3X A;  1SE3 A;  3VDY A;  4XQQ A;  4DV3 Q;  1KQS A;  2N8N A;  1X6O A;  2B63 B;  3T56 B;  3CQZ B;  2F0L A;  4L5T A;  5IY0 A;  2EDG A;  3JAM L;  3A55 A;  2UUA Q;  1T5X D;  1SMX A;  1JE5 A;  1EWH A;  3UDI A;  3GTM H;  2BH8 A;  1I3Q H;  2QCP X;  3K57 A;  4JBJ A;  2MFI A;  1WI5 A;  2LY7 A;  1I50 H;  4OIJ A;  4BBR H;  4A3J H;  2KEE A;  1UE1 A;  4A4I A;  5IP7 H;  1B50 A;  2VB2 X;  2A68 D;  1AE3 A;  4G7O C;  3OTO L;  1BOS A;  1N34 Q;  4GKJ Q;  4QCL A;  3L2P A;  2WFW A;  4ZKB B;  1LT3 D;  1I4X A;  1BCP D;  2KJX A;  3I4L A;  3CC7 A;  1H9R A;  4JI8 L;  3A74 A;  2JXM B;  3CCS A;  1B3Q A;  3HEJ A;  5BR8 Q;  2DUD A;  1DZ1 A;  3S9W A;  4XDX A;  4HTH A;  4EGV A;  5H1S E;  2XN9 C;  4FF4 A;  5FJ8 H;  3M7G A;  2EY1 A;  5HGT A;  3CME A;  3MFY A;  5C44 B;  4IPG A;  1KNA A;  2HIX A;  2R92 G;  5CV4 A;  3HOZ B;  2JJQ A;  4RGO S;  2RVL A;  2CFM A;  5FO8 B;  1MGS A;  3I72 A;  2D5D A;  4A3I H;  4YCV A;  4LF5 Q;  4K5V A;  4C3H G;  5CV8 A;  2IJ0 A;  2VQF L;  1SYB A;  3FEW X;  1IBM L;  1DJR D;  1NR4 A;  3HKZ B;  3NSW A;  1EY9 A;  3G4S A;  2JA5 G;  2MO0 A;  3N6R A;  4CDC C;  4IJL A;  1NCV A;  4LK1 C;  3GV6 A;  2B2U C;  3QIA A;  3MHB A;  1MKH A;  4J8Q A;  3Q6S A;  3V05 A;  5CV5 A;  1GUN A;  3OIQ A;  3U9O A;  2HHH Q;  2OWO A;  1YNJ D;  1IBL L;  2EPB A;  1PFS A;  2F1M A;  2FFK B;  1KDC A;  4KY6 A;  3MAQ A;  2J7Z A;  2DGY A;  3LGJ A;  4YIJ A;  5KNC A;  1I4P A;  4A3J B;  2HD3 A;  1ZXT A;  4ZUJ A;  4RG1 A;  3S24 A;  3H3V H;  5CBE E;  3V96 A;  1UEB A;  2O5I C;  1JWS D;  1A8V A;  2F0M A;  4TQU S;  1MIU A;  4DXF A;  2ZJQ A;  2JA7 H;  2F0W A;  1VQ9 A;  2IX3 A;  3PIP 3;  1WFQ A;  2R7F A;  4JV5 Q;  2E2D C;  2LXK A;  1HUM A;  1A6X A;  3ERQ A;  4FF1 A;  5KYL A;  1H9M A;  4BY7 B;  1I4H A;  4DV3 L;  2G5D A;  3TZD A;  2VZA A;  1LT4 D;  1IHZ A;  3HOX B;  2C35 B;  1B44 D;  4R4I A;  1FNV A;  1UE6 A;  3Q23 A;  2UXD Q;  2E5L Q;  4DR3 L;  1F9R A;  5J22 A;  1N32 L;  1ONL A;  1GVP A;  3K7A H;  1WTX A;  1VQH A;  1VF5 C;  4K8J A;  3NTK A;  5M9O A;  4X64 L;  4XQJ A;  5FOB B;  2AQ2 B;  2A73 B;  3R2I A;  4JBW A;  1IW7 D;  2F52 A;  5EPJ A;  1WTO A;  5G3L D;  2O5J C;  4GOP C;  1KAB A;  1EOT A;  3I7F A;  4RA8 A;  4BBR G;  3DHQ A;  5M3M H;  1Y1V H;  4F88 A;  1DYQ A;  2JSO A;  1JOK A;  4R4Q A;  3T1H Q;  3S2H H;  4X3T A;  2YTX A;  3RMH A;  4DR1 Q;  1KDA A;  1ZYR D;  4JCV E;  1IKL A;  2KBN A;  1B9N A;  5BN3 A;  1EQV A;  5M3F G;  2LKV A;  1D8L A;  1K28 A;  2DY7 A;  1KTK A;  3D4R A;  3MXN A;  2ZM6 L;  3JAM i;  1HNW Q;  5AJ3 L;  2L5T A;  4LW1 A;  2OCE A;  4TVA B;  1VF7 A;  2EQS A;  3SR1 A;  4A3G H;  1C0A A;  3S17 B;  1FD7 D;  1S5B D;  4NXN Q;  2F0H A;  2PW7 A;  5FO9 B;  4A3E H;  2I5M X;  1EOV A;  1L0X B;  4A3L H;  1VQA A;  3AB9 A;  1EFW A;  4GOP A;  2OT2 A;  2XWJ B;  2G9D A;  4DFA A;  4LF9 Q;  1U0L A;  1IKM A;  4WFN 3;  1UE5 A;  5JEA H;  1LTB D;  3MVV A;  1EUJ A;  2AQ3 B;  3NQT A;  5F2D A;  1SNO A;  4Y7N H;  3OW2 A;  3E3X A;  1R9T H;  2B8F A;  2B8G A;  1Z7T A;  1VQI A;  3QR8 A;  4KKT A;  1G6P A;  3L7Z C;  3H6M A;  2HCI A;  1PVO A;  2NVX H;  3CC2 A;  1WCM H;  2PI2 E;  4EQ5 A;  1E1T A;  2R7Z H;  4IUQ A;  3NBH B;  3HOY H;  4JPB W;  2B2T C;  3QO2 A;  1WTQ A;  2IX0 A;  2NN6 H;  3EN2 A;  3CKI B;  4R8I A;  4BBS H;  3NP8 A;  1T9H A;  3DWP A;  4G7Z C;  1PDQ A;  5EKK A;  4OGQ C;  1LTT D;  3PMF A;  5E7N A;  1S5F D;  2BDN A;  4P74 A;  2B3G A;  1D6E C;  1BCP C;  1RD9 D;  2BA1 A;  2V1C C;  3I4N G;  3S1N B;  2JN4 A;  1TU2 B;  4YHH Q;  4HMJ A;  4HMI A;  3BJU A;  1SN8 A;  3I4M B;  2I0Q A;  3S16 H;  4CGY B;  2JA6 H;  2GN5 A;  3SK5 A;  1W3S A;  1PTO F;  5I6W A;  3HGB A;  2JA8 B;  4JI4 L;  5JVG 3;  1F2Z A;  1U4L A;  1VQ5 A;  3S1Q B;  1VCI A;  4B3M L;  4FXK C;  3GO5 A;  5IGC A;  1NNX A;  4RKL A;  4RKB A;  3PO2 H;  1SXT A;  1V1O A;  2OQK A;  2B2W A;  2K4K A;  3I3C A;  1I6V C;  4R4O A;  5E4X A;  3KBG A;  1YJN A;  2YTV A;  3G71 A;  2CQA A;  4A3B B;  5J3B A;  2B2V A;  3J7A V;  1BBW A;  4L5S A;  3H0G B;  4WOR A;  1SYF A;  1WD1 A;  1Q7Y C;  1PYS B;  5IT9 L;  3KF6 A;  2B2Y A;  1RTN A;  4JI7 L;  4JI1 L;  1A3V A;  2FIN B;  3VR4 A;  2KCC A;  3U58 A;  2R7D A;  3M4P A;  4B3T Q;  2IL8 A;  1DOL A;  2ZM6 Q;  3WWV A;  4LUZ A;  2E2I H;  2R7Z B;  3A56 A;  3GTK B;  5BN5 A;  1ET9 A;  1S72 A;  1LT6 D;  2WB1 B;  4HID A;  1PH4 A;  1STY A;  3FHW A;  4KY7 A;  1A0I A;  4S3S A;  1RKN A;  4MIU A;  1V9P A;  4K5W A;  3W3A A;  5C4X H;  5C3E H;  4MZ9 A;  1HQR D;  2N55 A;  3J7A F;  1YI2 A;  1AW7 A;  5CV7 A;  3H94 A;  4GLA C;  1PZI D;  2EYM A;  1BF4 A;  3MXP A;  1QZH A;  1HTL D;  3M85 A;  4JI5 L;  3F2D A;  4QUC A;  2F4V L;  2B2Y C;  3M9B A;  1JOQ A;  4LF5 L;  2BCO A;  2EYL A;  5J39 A;  3ERO A;  5IWA Q;  2Q8T A;  3CCE A;  2JA8 H;  2QA4 A;  1VQL A;  3SDZ A;  1E3P A;  4GOP B;  4FDB A;  4DAY B;  1PH7 A;  4KKS A;  1RTO A;  1TR5 A;  4UP7 A;  1JWU D;  3J7Z C;  4QIW E;  1D1K A;  3NUC A;  4IUU A;  3VYR A;  1VS0 A;  2NB0 A;  4LMQ D;  4OL7 A;  2PCF B;  4O42 A;  3FKI H;  2F0O A;  2NBF A;  1JQY D;  1HZC A;  1SMY D;  4JG2 A;  1XX8 A;  3W2D A;  3PIO A;  2IHE A;  4R4T A;  1VQB A;  1VDZ A;  4TRD A;  1F2M A;  3C3L A;  4A3D G;  1RDP D;  2CWP A;  1B8A A;  1YVC A;  1YNX A;  1CHQ D;  3HOY G;  4FXG C;  2Y0S G;  4B3S L;  5IE8 A;  3G6J B;  2HT1 A;  3VYT A;  3H15 A;  1X9N A;  3TP7 A;  2AUJ D;  4LF4 Q;  4WRD A;  5IYB G;  4M1U B;  4C3I B;  2J4X A;  1U5K A;  2NYZ D;  2R6G A;  1PTO B;  3RLN A;  4A3C H;  1ASZ A;  5FLX E;  2Q2U A;  1W2B A;  5JEA J;  1EY5 A;  3CP0 A;  1VQK A;  3PF4 A;  3S2D B;  1LM0 A;  1A2U A;  1S5C D;  1SND A;  3KLR A;  1VQE A;  1U9R A;  1VMP A;  5JEA G;  1B2T A;  4KKU A;  1LLR D;  5ELC A;  3T53 B;  3P1H A;  4JBK A;  1WTR A;  2HHH L;  2MO1 A;  3QJY A;  2K01 A;  3BYT B;  1JOR A;  1SNC A;  3J80 L;  5C4J B;  3ONA B;  2GVA A;  1PLF A;  5KND A;  5EQ0 A;  4OEM B;  5D3I B;  5HUR A;  1VQG A;  5L37 A;  1GOZ A;  2OQ0 A;  4PMB A;  4GKJ L;  2HDM A;  1X54 A;  4G4K A;  3ER0 A;  1CZW A;  2GVB A;  4LF8 Q;  2RBM A;  5T1G A;  3GTO H;  2CH4 A;  2E2H H;  1QZG A;  2VW9 A;  4HSP A;  1KHI A;  1SYC A;  5M3F H;  1GM5 A;  2YU9 B;  2O2L D;  3P75 A;  5JJK A;  4MTK A;  2VQE L;  4LF6 L;  4DPG A;  3PQI A;  2KA7 A;  3M4Y A;  1AZQ A;  3S14 H;  3MFG A;  1NAP A;  3ZJY C;  1WVL A;  4QGU A;  5C4Z A;  1I3Q B;  2UUB Q;  3K8A A;  5IYC G;  3CMA A;  4KJO A;  3AMU A;  1HHV A;  4DUZ Q;  3DM1 A;  1I94 L;  3R2T A;  3HOU B;  1F9Q A;  5M5Y H;  5GAG C;  3RZO B;  2NN6 G;  2UU9 Q;  1L0Y B;  4JI5 Q;  1IZ6 A;  2A6H C;  3NQI A;  1E2Z A;  1Q1B A;  1NR2 A;  4XIG S;  1EYC A;  3E5S A;  4A3D H;  3WDN A;  3K58 A;  4B9X A;  1A2T A;  4IUP A;  1QIL A;  2RSN A;  4YCW A;  4DV2 Q;  4X6A H;  4LUO A;  3TBI B;  3E9H A;  3CRK C;  1D5Z C;  3E0J A;  2K52 A;  1GUG A;  4FXD A;  1TWH H;  3E6Z X;  3W5O A;  1LO5 D;  1PMR A;  3EBE A;  3GTJ B;  3A5U A;  4CDF C; 
#chains in the Genus database with same CATH homology
 5IGG A;  1STH A;  2F4I A;  1F9P A;  1QNU A;  3S15 B;  1MSH A;  3RD4 A;  4H13 C;  1PRT F;  4N9T A;  2FHT A;  1G6Z A;  5LL6 X;  2G9H D;  1ICW A;  2PZT A;  4TSS A;  1HUN A;  5ELD A;  4DK0 A;  1SDF A;  3JAM E;  3HP3 A;  1X3P A;  5JOB A;  1GUO A;  3GTP B;  2WIN B;  1BDO A;  2Z4H A;  5C0X I;  1EIG A;  4EQO A;  4C2M B;  4PV1 C;  2BOS A;  1G91 A;  1KDB A;  5CBA E;  2QEJ C;  1SFO B;  1S4Z A;  2K7V A;  5I2X A;  1B4O A;  4KD3 A;  1YNN C;  2DNE A;  1UUP A;  2F3V A;  2F03 A;  3GD7 A;  1A3T A;  2KUM A;  2PMZ B;  1PFM A;  1V43 A;  3KF8 A;  2JE6 I;  1TY0 A;  2R93 B;  1FYC A;  2L4N A;  1ILP A;  5M3M B;  5C0X G;  1C4Q A;  4UAI A;  2Z4I A;  2QIL A;  2O4X A;  4RWS C;  4ILW A;  2B2W C;  2MUY A;  5JPM C;  4X3U A;  3I8Z A;  1I50 B;  1GJX A;  2EY5 A;  1ZEQ X;  5G3L F;  3TSS A;  2ZXP A;  4XXE A;  3QG1 A;  1A3U A;  2B2T A;  1VMC A;  2A6E D;  2Q8R E;  2IWH A;  1SYE A;  3FKI B;  1O7L A;  5JJZ A;  2R3Z A;  1FGB D;  1ZKO A;  4R9W A;  1JR0 D;  5EKL A;  1EU3 A;  3FPU B;  3SK6 A;  4RH6 A;  5FKA C;  2KED A;  3NTI A;  2X6L A;  1D1I A;  4H7B A;  1JE4 A;  2M00 A;  4ULL A;  5E3F A;  3K59 A;  1Z6H A;  2C5C A;  3K0Y A;  4BA1 I;  1W6K A;  3QWN A;  5ELE A;  1ENF A;  5D65 A;  2B2V C;  2EOT A;  3GV3 A;  1AN8 A;  1Q1E A;  3OW7 A;  2L1B A;  1SAP A;  1KNE A;  5I9O A;  1CQV A;  2CHB D;  2E2H B;  4B9W A;  2K33 A;  4X3S A;  1IYU A;  4I65 A;  3C2P A;  2SOB A;  3TP5 A;  1SNP A;  4XYO A;  1LT5 D;  2MJ8 A;  3R8B A;  4BY1 B;  1FNW A;  1D2B A;  1O78 A;  4A3E B;  4CHT B;  2LMC B;  4OHJ A;  3A7L A;  1KAA A;  5JAV A;  1ILQ A;  3V2T A;  2H1E A;  2F0V A;  1Y1W B;  4IUT A;  4FNF A;  3CHB D;  3P7J A;  2XRS D;  1DOK A;  5IIF A;  2JA7 B;  2A74 C;  5D3D A;  3Q0A A;  5ISR A;  3PO3 B;  1LTG D;  3HZX A;  1WCM B;  3SEB A;  2B2U A;  2BDO A;  1F9S A;  2Q8I B;  2SNS A;  2K5W A;  4BWG B;  3BDL A;  1W6J A;  2K5Q A;  2K1B A;  4BBS B;  5I9P A;  4EQN A;  2JEA I;  3C1F A;  4HR7 B;  4ZAI A;  1D5M C;  1GHJ A;  4A3K B;  3C46 A;  3MTS A;  1LV9 A;  4FF2 A;  1LTI D;  1TKW B;  5EPK A;  3OWF A;  3OMC A;  2BE5 C;  2L12 A;  4Q5V A;  5KRU A;  2EE1 A;  5C0X J;  1PFN A;  4HCS A;  3PUZ A;  5IGD A;  2AUK A;  5FLX L;  3FRP B;  1CT1 D;  1V1P A;  1E2W A;  1Y69 U;  2F0I A;  1SE4 A;  1H9S B;  1TWA B;  5LL6 S;  2EYH A;  1O7Y A;  1MD2 D;  1HQM C;  1DCZ A;  3I73 A;  2TSS A;  3EQL C;  2VNU D;  5EBD A;  4IUN A;  4IFD H;  3GTQ B;  4KN7 C;  4LJZ C;  4EQP A;  2BE5 D;  2RKS A;  3GTG B;  5KEE A;  4FVM A;  3I90 A;  1LAB A;  1YNN D;  4Y7N B;  3M3Y B;  1SBB B;  1YNJ C;  3TP8 A;  4FO2 A;  2ICE C;  2IW3 A;  3M7N A;  1OXU A;  2EY2 A;  2XNA C;  2WKD A;  3KLS A;  5CGK A;  5A2Q L;  3PUW A;  1TS3 A;  4FF3 A;  1HA6 A;  1EWC A;  2WII B;  4KJN A;  3N52 A;  1CA5 A;  1HFG A;  3WOE A;  4XT3 B;  1RJT A;  2BA0 A;  1SMY C;  1HCZ A;  1BXT A;  1LTR D;  1ET6 A;  1O7Z A;  4C1N I;  1WTP A;  2MHV A;  5CYU A;  2K05 A;  1IYV A;  4MN3 A;  2MGS A;  4G57 A;  2EYF A;  1STA A;  1G2S A;  3IFT A;  3ZYY X;  4U68 A;  4NKL A;  1EL0 A;  3L3O C;  1AZP A;  2R61 A;  1BUV T;  3MC0 B;  1CTM A;  4C3I G;  1U4P A;  1PTO H;  5M5Y B;  5C5L A;  2AWO A;  2F0P A;  1BNZ A;  2Y0S B;  3DEP A;  4L8J A;  3HOY B;  1EZ8 A;  2RDF A;  4A3D B;  3J7Y W;  1G2T A;  4LAA A;  3VYS A;  4NDX A;  3T51 B;  2XRQ D;  2WV6 D;  1QG7 A;  4DN4 M;  2DY8 A;  5I6Y A;  3L9A X;  1TII D;  2I07 B;  1XTC D;  1XXG A;  1UNS A;  4P2C B;  4ZK9 B;  1FNU A;  4FP5 D;  3Q24 A;  3VYU A;  2X69 A;  5LHY 1;  1V8Q A;  2A68 C;  2F0U A;  4OO1 H;  4NP5 A;  2NTT A;  1Y8N B;  2ZXO A;  1OXT A;  3PIO 3;  5NUC A;  1X3Q A;  2D9U A;  1EIH A;  3D4D A;  2CW0 C;  3NPP A;  3FMC A;  4RCO A;  4DGZ A;  1C48 A;  1NSN S;  1B53 A;  3I70 A;  3U9S A;  1SEB D;  4QIW B;  1IW7 C;  1EY8 A;  5IT9 E;  2LFN A;  3H3V C;  2E2I B;  5DNF A;  3R93 A;  1B3A A;  1F2Y A;  1JWM D;  4CBV A;  1OXS C;  4DNR B;  1ZYR C;  1CA6 A;  1JB3 A;  1EY7 A;  2F0F A;  5FK9 C;  1PYW D;  1QJO A;  1PTO C;  2FMC A;  3GTO B;  4DA2 A;  3VR2 A;  3BYY B;  4ZUI A;  4G7H C;  1SJE D;  4CKB A;  4RFB A;  2AQ1 B;  1BCP F;  1JC7 A;  2KQ3 A;  1UAP A;  1OXX K;  4KTA A;  3I4N B;  2L0C A;  2PYK A;  3NWS A;  1ESR A;  2FJ2 A;  2QDB A;  2DNC A;  1SJH D;  2F0G A;  4I7Z C;  5DM7 3;  1EYA A;  1Z47 A;  1JCK B;  3CU7 A;  1SE2 A;  3BS1 A;  1HFN A;  2RDH A;  3Q22 A;  3MWY W;  1J9O A;  4V0B A;  5DAU A;  3MZ5 A;  1E2V A;  4F8M A;  2N88 A;  2RDG A;  3BVM A;  2ICI A;  3I91 A;  3SVM A;  5M5X B;  2A69 C;  4HAE A;  2KVM A;  1B9M A;  1QNK A;  2M2L A;  4TKO B;  3VA5 A;  1TS5 A;  1DD2 A;  3J81 E;  4PMC A;  5M3F B;  4HCE A;  2MP1 A;  1RCV D;  4PMW A;  2Z8L A;  1Y8O B;  4IFD I;  3IFD A;  5CC4 A;  1HTP A;  5BN4 A;  4BBR B;  5KIX A;  3S1M B;  1AFP A;  1PZK D;  2F0T A;  2L55 A;  1T5E A;  1RF2 D;  1Q8I A;  2F0N A;  2LS0 1;  3DXJ C;  4RCN A;  4K5X A;  3OSO A;  4CJ1 B;  1U4R A;  3T13 A;  1QWY A;  4IFD G;  2D62 A;  4XYQ A;  3A8K E;  1RHP A;  1Y8P B;  1ENC A;  3VR5 A;  1WD0 A;  2KCN A;  1Q3L A;  1ESF A;  1HA5 A;  1GUS A;  5CMD A;  3BG3 A;  1CQF A;  1PRT D;  2M9V A;  3OWE B;  3MEH A;  3KUP A;  3OHX C;  3D8G A;  3IKJ A;  3TDQ A;  4NW2 A;  1X32 A;  1V1P B;  1GUW A;  2NVT B;  1TY2 A;  2YYZ A;  3VR3 A;  3GTM B;  2E76 C;  1SYD A;  5C0X H;  2NVQ B;  5EGT A;  2JA5 B;  3EJI A;  2AWN A;  2PW5 A;  5C4H A;  3PUX A;  3HG9 A;  4C3H B;  5DEH A;  1A15 A;  5K36 H;  3URY A;  4X3K A;  5EBC A;  4PNY A;  3H91 A;  1BR9 A;  5E4W C;  2R92 B;  4MHE A;  1EY4 A;  4HSV A;  1TS4 A;  1QCB D;  2NZ1 D;  5CV9 A;  3D4W A;  3D31 A;  3MXG A;  1AEX A;  2D2C C;  3K5L A;  3NK9 A;  1BBX C;  4QB4 A;  2EJM A;  4BS9 A;  1S5E D;  1ML0 D;  1EYD A;  2HCC A;  2PZU A;  5K36 G;  4OO1 I;  2K03 A;  2CW0 D;  3SE0 A;  5T1I A;  5C3W A;  1EY0 A;  1G29 1;  3GTL B;  4CKE A;  4HED A;  4V19 0;  3G7L A;  1STG A;  3SXH A;  4KY5 A;  1EU4 A;  3OOC A;  3S2H B;  2ENB A;  2F0J A;  2JEB I;  3DUZ A;  1GHK A;  1K8M A;  4L63 B;  1JOO A;  1IL8 A;  2PPB C;  3HRZ C;  2OF1 A;  1F2L A;  5EJW A;  1TS2 A;  3MXU A;  4QMG A;  1DOM A;  2PZW A;  3C1E A;  2WAC A;  3NWT A;  3M4O B;  2WAQ B;  4L6T B;  1G8Z D;  5EPL A;  1EQT A;  4QUF A;  2VUM B;  2ID0 A;  2K32 A;  1PZJ D;  2NTS A;  5ELF A;  1TQO A;  3K5O A;  3K7A B;  2TMP A;  1K8O A;  2RQX A;  5DM6 3;  4QF4 A;  1DM0 B;  3RLF A;  4FYD A;  1EEI D;  1OO9 B;  4XTC S;  4DK1 A;  4IQZ A;  2HDL A;  2MPM A;  3GP7 A;  2VB3 X;  4KI0 A;  4GZY C;  1EY6 A;  3EFX D;  4K2L A;  4K6D A;  2VXW A;  2IT1 A;  2EZV A;  4E6I A;  2ZXR A;  3OIP A;  3HOW B;  2NN6 I;  2PNR C;  1TWC B;  5COR A;  4N9P A;  2E75 C;  2HUG A;  3P20 A;  5A2Q E;  4RGN A;  4DAP A;  2F0Q A;  2A5H A;  3S16 B;  3UI2 A;  3EA6 A;  2DN8 A;  3TME A;  2WP8 J;  3J81 L;  4A3F B;  4CJ0 B;  2EXZ A;  4B08 A;  1KLU D;  3BVG A;  3X3N A;  1Q90 A;  2KEC A;  2V4D A;  3PO2 B;  2EVB A;  4WJW A;  3TZU A;  3IL8 A;  1H9S A;  4KV6 A;  4KMU C;  2JP1 A;  2A69 D;  3O13 A;  5KGU A;  3MA2 B;  3ND8 A;  2NVX B;  2B39 A;  5J1Z A;  4IUR A;  4ODG A;  2IX1 A;  3K5N A;  1XWE A;  1NUC A;  2PO4 A;  2EYP A;  4RGT A;  3DMU A;  4M8A A;  2GA4 B;  3HOV B;  4H0L C;  4K6L A;  3NTH A;  1BQQ T;  3A7A B;  2SEB D;  2QF7 A;  4RHR A;  1PRT B;  3BZD B;  4EVO A;  2K04 A;  2Z1C A;  4RAU C;  1HXY D;  1I4Q A;  4A3I B;  3KBX A;  1SYG A;  4RGM A;  4C3J G;  3QOL A;  4O1N A;  1PFB A;  5IOC A;  5I4D A;  1S5D D;  2XWB B;  5COY A;  4IZ8 A;  3K6O A;  1CZG A;  3LX0 A;  4K14 A;  3QB3 A;  2ZT9 C;  2HQE A;  5E1F A;  4DU9 A;  1B1Z A;  2JA6 B;  5JPN C;  3BVZ A;  5IGB A;  3D6W A;  4HN7 A;  4C1N K;  4IUV A;  3A54 A;  2F0S A;  5IGF A;  2K28 A;  1WTV A;  3HS0 C;  3SK8 A;  2XSC A;  3NBI A;  4J6H A;  4A93 B;  2EYJ A;  2RSO A;  1DXM A;  5A35 A;  1OXV A;  3T4A C;  1HRJ A;  1PTO D;  3CRL C;  2L9H A;  4XT1 B;  2QKI C;  3AU7 A;  5CR3 A;  1R4P B;  2K5D A;  1CM9 A;  1STE A;  1II3 A;  3D3R A;  2OXP A;  4Z9C B;  1Y1V B;  3ND9 A;  2KHS A;  3PUY A;  2XIW A;  1KLG D;  3T16 A;  5C3E B;  5C4X B;  2F0E A;  3RUZ A;  4XQN A;  3QOJ A;  2XVS A;  4KN4 C;  4KD4 A;  3TN2 A;  1O80 A;  1CHP D;  1UEA B;  1Q12 A;  1TWF B;  3FVQ A;  4J1M A;  4ME5 A;  3WOF A;  5ELB A;  2FMM A;  4A3G B;  3R3O A;  1MBY A;  1R9T B;  4ZLT F;  1R4Q B;  3BDO A;  2KOL A;  2K6A A;  2F3W A;  3FDT A;  3PV0 A;  3D6C A;  1LTA D;  1MI2 A;  3LNN A;  1QE6 A;  3DWQ A;  4DAY A;  1F77 A;  3A8J E;  2EYO A;  4ID6 A;  1BCP B;  3NHH A;  2WKC A;  5IOD A;  1HPC A;  5C5M A;  2RA4 A;  1FR3 A;  2OEO A;  3K5M A;  4RHS A;  2SDF A;  1TVX A;  1EZ6 A;  4F7X A;  2PQE A;  5EKI A;  2NUC A;  5FO7 B;  1SNM A;  4IAL A;  3ITP A;  3RZD B;  2J0T D;  5KNB A;  2L11 A;  4JK1 C;  2E74 C;  1D5X C;  4IFD J;  3H09 A;  1AP0 A;  3A8I E;  4CKC A;  2EJF C;  4KK7 A;  3OPO A;  1M4V A;  2E2J B;  3IAY A;  4C56 C;  1E0B A;  1I4G A;  3BDC A;  4OIK A;  1ROD A;  1I4R A;  4DNT B;  5K5P A;  3VR6 A;  3NXW A;  1PXU A;  1H9J A;  3FPP A;  4R8N A;  5JVH 3;  3EVQ A;  2JYO A;  2EJG C;  4C3J B;  3S14 B;  1GUT A;  2H4O A;  4CJ2 C;  1H9K A;  4DF7 A;  4AYB B;  1J8I A;  3NBH A;  1U4M A;  1TT2 A;  1TWG B;  2A6H D;  1SSO A;  4ZKC B;  4PQX A;  5AFW A;  1SNQ A;  3DEO A;  3J80 E;  5I2Y A;  3GQB A;  1LTS D;  1STN A;  2C9O A;  1QOH A;  2CVR A;  4ZRZ A;  5M5W B;  2NVY B;  1K83 B;  3NE5 B;  5D14 A;  1EEF D;  1CFM A;  3LWE A;  4K8I A;  1JIC A;  1QB5 D;  4KHZ A;  1STB A;  4F87 A;  1XYI A;  4ABN A;  4DXG A;  4KHV A;  4OO1 G;  4ZQ3 A;  3F2U A;  1M8A A;  2F0K A;  5TSS A;  3LWU A;  1GXD C;  5IGE A;  1CI3 M;  3PUV A;  2A6E C;  1DON A;  1LAC A;  2SNM A;  3X3M A;  4H44 C;  2X6G A;  2NWG A;  4U67 3;  1CK1 A;  4BA2 I;  5C6A A;  4Q0F A;  1ENA A;  3KLS X;  1WTW A;  3OMG A;  2F0D A;  5KYI A;  5CV6 A;  3DWA A;  3TP6 A;  2IPK D;  1I6H B;  3SK4 A;  4K2K A;  2EY6 A;  1BO0 A;  1MSG A;  3S1R B;  3KK7 A;  2I46 A;  1C8C A;  4UDU C;  1PRT C;  3VA7 A;  1TWH B;  1EFI D;  4ZYS A;  4IN3 A;  4NMZ A;  3SHL A;  4A3M B;  4DAV A;  5C3X A;  1SE3 A;  4XQQ A;  2B63 B;  3T56 B;  3CQZ B;  2F0L A;  2EDG A;  3JAM L;  3A55 A;  1T5X D;  1EWH A;  2QCP X;  3K57 A;  2LY7 A;  4OIJ A;  2KEE A;  1B50 A;  2VB2 X;  2A68 D;  4G7O C;  1BOS A;  4QCL A;  4ZKB B;  1LT3 D;  1I4X A;  1BCP D;  2KJX A;  3I4L A;  1H9R A;  2JXM B;  3HEJ A;  1DZ1 A;  3S9W A;  4XDX A;  4HTH A;  4EGV A;  2XN9 C;  4FF4 A;  3M7G A;  2EY1 A;  5HGT A;  3MFY A;  5C44 B;  1KNA A;  5CV4 A;  3HOZ B;  4RGO S;  2RVL A;  5FO8 B;  1MGS A;  3I72 A;  2D5D A;  4K5V A;  4C3H G;  5CV8 A;  2IJ0 A;  1SYB A;  3FEW X;  1DJR D;  1NR4 A;  3HKZ B;  3NSW A;  1EY9 A;  3N6R A;  1NCV A;  4LK1 C;  3GV6 A;  2B2U C;  3QIA A;  3MHB A;  3Q6S A;  4J8Q A;  3V05 A;  5CV5 A;  1GUN A;  3OIQ A;  3U9O A;  1YNJ D;  2EPB A;  2F1M A;  2FFK B;  1KDC A;  4KY6 A;  3MAQ A;  2J7Z A;  4YIJ A;  5KNC A;  1I4P A;  4A3J B;  1ZXT A;  4ZUJ A;  5CBE E;  3V96 A;  2O5I C;  1JWS D;  2F0M A;  4TQU S;  4DXF A;  2F0W A;  2IX3 A;  3PIP 3;  2E2D C;  1HUM A;  1A6X A;  3ERQ A;  4FF1 A;  5KYL A;  1H9M A;  4BY7 B;  1I4H A;  3TZD A;  1LT4 D;  1IHZ A;  3HOX B;  1B44 D;  1FNV A;  3Q23 A;  1F9R A;  5J22 A;  1ONL A;  1WTX A;  1VF5 C;  4K8J A;  3NTK A;  5M9O A;  4XQJ A;  5FOB B;  2AQ2 B;  2A73 B;  3R2I A;  4JBW A;  1IW7 D;  5EPJ A;  1WTO A;  5G3L D;  2O5J C;  1KAB A;  1EOT A;  4RA8 A;  3DHQ A;  4F88 A;  1DYQ A;  2JSO A;  1JOK A;  4X3T A;  3RMH A;  1KDA A;  1ZYR D;  1IKL A;  5BN3 A;  1B9N A;  1EQV A;  2LKV A;  2DY7 A;  1KTK A;  3D4R A;  3MXN A;  2L5T A;  3SR1 A;  1VF7 A;  3S17 B;  1FD7 D;  1S5B D;  2F0H A;  2PW7 A;  5FO9 B;  1L0X B;  3AB9 A;  2OT2 A;  2XWJ B;  2G9D A;  4DFA A;  1IKM A;  4WFN 3;  5JEA H;  1LTB D;  3MVV A;  2AQ3 B;  3NQT A;  5F2D A;  1SNO A;  2B8F A;  2B8G A;  1Z7T A;  4KKT A;  3L7Z C;  3H6M A;  2HCI A;  4IUQ A;  2B2T C;  3QO2 A;  1WTQ A;  2IX0 A;  2NN6 H;  3CKI B;  4R8I A;  3NP8 A;  3DWP A;  4G7Z C;  1PDQ A;  5EKK A;  4OGQ C;  1LTT D;  3PMF A;  1S5F D;  2BDN A;  1D6E C;  1BCP C;  1RD9 D;  2BA1 A;  3S1N B;  1TU2 B;  4HMJ A;  4HMI A;  3I4M B;  4CGY B;  3SK5 A;  1PTO F;  5I6W A;  3HGB A;  2JA8 B;  5JVG 3;  1F2Z A;  1U4L A;  3S1Q B;  1VCI A;  4FXK C;  3GO5 A;  5IGC A;  4RKL A;  4RKB A;  1SXT A;  1V1O A;  2B2W A;  3I3C A;  1I6V C;  5E4X A;  3KBG A;  2CQA A;  4A3B B;  2B2V A;  3J7A V;  3H0G B;  4WOR A;  1SYF A;  1WD1 A;  5IT9 L;  2B2Y A;  1RTN A;  1A3V A;  2FIN B;  3VR4 A;  2KCC A;  2IL8 A;  1DOL A;  2R7Z B;  3A56 A;  3GTK B;  5BN5 A;  1ET9 A;  1LT6 D;  2WB1 B;  1STY A;  4KY7 A;  4S3S A;  1RKN A;  4MIU A;  4K5W A;  3W3A A;  1HQR D;  2N55 A;  3J7A F;  1AW7 A;  5CV7 A;  3H94 A;  1PZI D;  2EYM A;  1BF4 A;  3MXP A;  1HTL D;  3M85 A;  4QUC A;  2B2Y C;  1JOQ A;  2BCO A;  2EYL A;  5J39 A;  3ERO A;  2Q8T A;  3SDZ A;  4KKS A;  1RTO A;  1TR5 A;  1JWU D;  1D1K A;  3NUC A;  4IUU A;  3VYR A;  2NB0 A;  4LMQ D;  4OL7 A;  2PCF B;  4O42 A;  2F0O A;  2NBF A;  1JQY D;  1SMY D;  1XX8 A;  3W2D A;  1VDZ A;  4TRD A;  1F2M A;  3C3L A;  1RDP D;  1CHQ D;  4FXG C;  3G6J B;  3VYT A;  3TP7 A;  2AUJ D;  4WRD A;  4M1U B;  4C3I B;  2J4X A;  2NYZ D;  2R6G A;  1PTO B;  5FLX E;  5JEA J;  1EY5 A;  3S2D B;  1A2U A;  1S5C D;  1SND A;  3KLR A;  1U9R A;  1VMP A;  5JEA G;  1B2T A;  4KKU A;  1LLR D;  5ELC A;  3T53 B;  3P1H A;  1WTR A;  3BYT B;  3QJY A;  2K01 A;  1JOR A;  1SNC A;  3J80 L;  5C4J B;  3ONA B;  1PLF A;  5KND A;  5EQ0 A;  5D3I B;  5HUR A;  1GOZ A;  4PMB A;  2HDM A;  4G4K A;  1CZW A;  2RBM A;  5T1G A;  4HSP A;  1SYC A;  2YU9 B;  2O2L D;  3P75 A;  2KA7 A;  3M4Y A;  1AZQ A;  3MFG A;  1NAP A;  1WVL A;  5C4Z A;  1I3Q B;  4KJO A;  3AMU A;  1HHV A;  3DM1 A;  3R2T A;  3HOU B;  1F9Q A;  3RZO B;  2NN6 G;  1L0Y B;  2A6H C;  3NQI A;  1E2Z A;  1Q1B A;  1NR2 A;  4XIG S;  1EYC A;  3E5S A;  3WDN A;  3K58 A;  4B9X A;  1A2T A;  4IUP A;  1QIL A;  2RSN A;  3TBI B;  3CRK C;  1D5Z C;  3E0J A;  1GUG A;  4FXD A;  3E6Z X;  1LO5 D;  1PMR A;  3GTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...