4RHSA

Crystal structure of gd2 bound pltb
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVSKQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALVGLSSCSATQCFGPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative pertussis-like toxin subunit
publication title Host adaptation of a bacterial toxin from the human pathogen salmonella typhi.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rhsA00
1PRTD 1SBBB 4UDUC 5TSSA 2O2LD 4RHRA 1I4XA 1SJHD 1S5ED 4DXGA 2XRSD 1LTTD 1HQRD 1G8ZD 1QILA 2WV6D 1HA5A 3MC0B 4TSSA 1RCVD 1PRTC 3EFXD 2R61A 3BYYB 1CQVA 2SEBD 1I4RA 2RDHA 1ENFA 4Z9CB 1B44D 1PZJD 1TY0A 1JQYD 2TSSA 2AQ2B 1I4HA 3MFGA 1PZID 3EA6A 1T5XD 1JWSD 5I4DA 5ELDA 3CHBD 1LT6D 3W2DA 5ELFA 1ET9A 1EU3A 2Z8LA 3BYTB 1ESFA 1JWMD 1XTCD 1FNVA 2IPKD 1DJRD 4RGNA 3TSSA 1TS5A 1PTOF 1LTID 1BXTA 1JCKB 4RFBA 1LLRD 1DYQA 1LTSD 1PTOB 1SEBD 1LT5D 1V1PB 5FKAC 4BWGB 1D5ZC 3R8BA 3URYA 1TS2A 3DWAA 1SE4A 1V1OA 1PTOD 1KLUD 2AQ1B 4K6LA 1PZKD 1L0YB 1RD9D 2G9HD 5FK9C 4RGTA 5D3IB 1TS4A 1CHPD 1TS3A 1FNWA 1TY2A 1HXYD 1F77A 1B1ZA 1SE3A 3BVGA 1EEID 1BCPF 4C56C 5ELBA 1AN8A 1PTOC 1UUPA 1JR0D 1STEA 1BCPB 1KTKA 2J4XA 2QEJC 3O13A 1RDPD 1LT3D 1GOZA 1I4GA 2NTTA 1SE2A 1LO5D 1S5BD 4ZYSA 1BCPD 1PRTF 4DXFA 1S5CD 3BVMA 4RHSA 1FNUA 1LTGD 1PYWD 3OWEB 5D3DA 5ELEA 1CT1D 1LTRD 3GP7A 1SJED 1JWUD 1S5DD 4OHJA 2XRQD 2IJ0A 3BZDB 2XN9C 1CK1A 1I4PA 2CHBD 4O1NA 1BCPC 4RH6A 4RGMA 1D5MC 1FD7D 1FGBD 3KLSX 1S5FD 3BVZA 2RDGA 3DWPA 1KLGD 1LTAD 2QILA 4L6TB 1EWCA 1HTLD 1SXTA 1MD2D 1M4VA 1I4QA 1ET6A 1LTBD 5ELCA 1AW7A 3R2IA 4RGOS 2AQ3B 1V1PA 3V05A 4RCOA 1RF2D 1D5XC 1EEFD 1D6EC 2ICIA 1CHQD 2XNAC 2NTSA 1XXGA 1PRTB 1EU4A 1EFID 1LT4D 3R2TA 1PTOH 1L0XB 4L63B 3DWQA 3SEBA 1UNSA
chains in the Genus database with same CATH superfamily
1KXLA 5JJKA 5M5WB 1Y1WH 2JA7B 1F2ZA 1QUQB 5CV7A 4DNRB 2I5HA 2JN4A 1QVGA 1KRTA 3OMCA 1E1TA 2BH8A 3S15B 4I7ZC 1OXUA 1KRSA 3FP9A 4C2MB 5KYLA 3STBD 3GTMB 4FNFA 2A73B 1EQTA 3TP6A 3OW7A 1YHQA 1TWHH 4MIUA 2PO4A 2WIIB 2WINB 3TREA 1BF4A 3I4OA 1OXXK 1STGA 5IE8A 5FLXL 1PHJA 3CRKC 5J1ZA 4XTCS 3NBHA 2QCPX 1N32Q 3NUCA 1I94Q 4M1UB 4DR7Q 2KENA 2KECA 4JBKA 1YNJC 2K32A 1ZXTA 2SOBA 4DFAA 2DNCA 1EFWA 5BN4A 3GD7A 5DEHA 4EQOA 3GTGH 2YTYA 2RSOA 5LHY1 4FF3A 3TEHB 3TDQA 2K14A 2YYZA 4S3SA 5GROA 2ZTEA 2UU9Q 3ITPA 2NN6I 4FVMA 3CQZB 2VS1A 2F0PA 4DNIA 4IFDI 2VUMH 4DV3L 2EIFA 2PQAA 2HQEA 4AQYL 4A3JG 5DAUA 1R9TB 4IQZA 3MHBA 2IY5B 2CWAA 1HR0W 3VYTA 4A3LH 4ZKCB 3K8AA 4Y52H 4JOIA 1T5EA 3NEMA 4O1NA 4QIWB 2I46A 2XSCA 3TP8A 5M3FB 3DWPA 2L12A 1C4QA 1CKNB 5JEAG 2J0TD 3HOYG 2I5MX 2K75A 1TWGH 1PDQA 1XX8A 2RA4A 2X6GA 2G9DA 1KIXA 1Q46A 4C1NI 5JJZA 4QGUA 1HZAA 2Y0SE 4RCOA 3QIAA 1IBLQ 3KJOA 1S4ZA 2NUCA 1S3OA 1Q1EA 2R93H 4JC0A 3F2BA 2L15A 4QIWE 1PH8A 5IYCG 2A68C 3R2TA 2EXZA 4YHHL 3I2ZA 1IW7C 3PCOB 3TP5A 5IT9L 3CF5A 3GTLH 4UDUC 2VQEL 1FJGQ 4RHRA 3I4NB 2KCTA 5JEAJ 4B3TL 1K8OA 4C3HG 2A74C 1DONA 1JE5A 1VQFA 4QF4A 1KNEA 1DGSA 2EZVA 3MC0B 3JAMc 2B8FA 1NMFA 3VR6A 4JI0Q 4IOAA 5C0XI 2R61A 3ND8A 1WCMH 4DPGA 2NB0A 4DV2Q 3C1FA 4DAVA 1O7YA 2FHTA 3E5SA 1Y8PB 2PNRC 1LACA 4U673 4A3BG 2IX3A 1PH9A 3L9AX 4C3IB 2Q2TA 3OPOA 1QZHA 4OO1I 3SK4A 1HJPA 1VQJA 1YZ6A 1JCKB 5IYBH 1OXSC 1LLRD 1SEBD 1A2UA 3QJYA 1LT5D 2N55A 3CCQA 2LXKA 2UUBL 1UAPA 2A5HA 2B2YA 3NTKA 1Z9FA 2F0HA 2Q2IA 5M3MH 4J6HA 4HJ9A 3HOVG 3IFTA 2ZXOA 5E4WC 1XWEA 4FXKC 1TY2A 5T1IA 1WTHA 1WTVA 1V9PA 5C4HA 5K5PA 4IN3A 4DR2Q 1PTOC 3RZDH 3PSIA 1QOHA 2YTVA 3AFPA 4CHTB 4IJLA 5C4JH 3G71A 3CU7A 1BVSA 2F0QA 2WAQG 4JI6Q 5KNBA 3C2PA 1VQAA 1Y1VB 2XWJB 1ML0D 1A3VA 3IAYA 2PCFB 4BBSH 1VQ4A 1BDOA 1L1OA 3UI2A 1PV4A 4RH6A 4LF6L 3W1GA 3W3AA 3FRPB 3KF8A 5COYA 4B3RQ 1WCMB 4P2CB 2ENBA 1LTAD 2EY5A 2A69D 1Q3LA 1B4OA 3CCLA 3QOLA 3T56B 5T1GA 1DD2A 1WTRA 1MIUA 4RGOS 1GUWA 1RTNA 1XMOL 5EAYA 2D2CC 3DMUA 4QCLA 1XXGA 3QG1A 1SYFA 1G6PA 2ID0A 5AJ3L 1VQEA 3CC2A 4HCSA 3PV0A 2F0IA 1K83H 5M5YH 2WKCA 4K6DA 4XT1B 3J80E 1VQ6A 2O2LD 2NN6H 1SJHD 1S5ED 5E3FA 4IFDH 3SK8A 3NSWA 4ZKBB 2B2YC 5HGTA 1SNPA 3MAQA 4GOPA 4HMIA 1SNCA 3E9IA 1RCVD 3HOUB 2K04A 4DK6C 1EIHA 3GDEA 2B3GA 2CVRA 2RDHA 2MQHA 4DKAC 2HT1A 1Z6HA 2JA8B 3S1MB 4OEMB 1D8LA 1FGUA 5CV9A 1UEAB 1EY0A 1SLJA 3HOWB 4X6AH 2CW0C 3W2DA 3KOJA 1NJIC 1JWMD 4DA2A 4JV5Q 2K5DA 4AH6A 4UAIA 2MGSA 5GAGC 4R8NA 1EYAA 4DV3Q 2QGQA 5C3EB 3PUZA 1L1OC 1F9PA 4AQYQ 1EY4A 4LFBL 4Y7NB 1J9OA 5C4XG 1QCBD 2F0GA 3A8IE 1L0YB 1I5FA 2IX1A 2NVTH 4F87A 1G291 4RGTA 5D3IB 1E3PA 5KIXA 2E74C 4KKUA 2E2IH 2MO0A 4GNXA 2VY3A 2JQOA 1QWYA 3I72A 2F03A 2DN8A 2YU9H 2JSOA 5C0XH 1KTKA 4G7ZC 1CA6A 2A6EC 3J7AV 4HAEA 2R7ZH 2K4KA 4C3JG 3HGBA 4F8MA 4HTHA 2KCNA 5KGUA 3OWEB 5ELEA 1B70B 3K5NA 3G6JB 5IYDG 1G2SA 2K6AA 2KEDA 4YHHQ 2MHVA 1TKWB 3Q24A 2HCIA 4XT3B 4GOPC 4OO1H 2VQEQ 4B3TQ 1H9RA 1QVFA 3KLRA 3JAMi 3GTJB 2A6HC 2QA4A 3D6WA 3H94A 3CXCA 1AZPA 3R2IA 5J22A 4FF1A 5IP9H 5HURA 1SDFA 1HTPA 5JAVA 2R7DA 4DU9A 4A3EG 4WRDA 5BR8L 3RZOH 4XQNA 1HZBA 1RIPA 3PUVA 4ODGA 1K9MC 4JBMA 3EJIA 5I6WA 4ULLA 3CMEA 3KF6B 4XIGS 4A3FG 2K28A 1HQRD 3FKIH 4A75A 3MXUA 1H9SB 1HFNA 1O80A 4N9TA 1GVPA 4IO9A 3RNUA 2NVYB 2UUBQ 2E2IB 4A4IA 1JMCA 4HEDA 4GNXC 1EIFA 1I4HA 1TT2A 2MUYA 1T5XD 5K36G 1C9OA 3Q8DA 1GHKA 1ET9A 1QJOA 4KD4A 4ABNA 4I65A 1STBA 1X32A 4X66L 3D31A 1PTOF 1BXTA 5FO7B 2DUDA 3Q6SA 5C44B 4IPDA 4A3KB 2EYJA 2CWPA 1DYQA 1ZYRD 3Q22A 4BY7H 1D5ZC 3URYA 4R4OA 1A3UA 2XVSA 3GQBA 4N8X1 1MKHA 4NP5A 1EY9A 2G9HD 5FK9C 4A3CH 3F2CA 3LX0A 1PYBA 1YITA 4JG2A 3GV3A 4LF6Q 4GS3A 1JC7A 2B2TA 1EEID 4C56C 2Q8TA 2TMPA 2R7ZG 3S2HH 3KLSA 4MHEA 1U4RA 4KK7A 3O13A 4HIMA 1YNXA 2R92H 4F88A 2HDMA 2NTTA 4ZYSA 3BZKA 2ZT9C 3CD6A 1SYCA 1XMOQ 3BVMA 3NTHA 4RHSA 5L37A 1LTGD 5JPMC 2ATWA 1G2TA 1K8AC 5AJ3Q 1QNKA 3PO3B 3FKIB 1GUNA 4JBJA 4YY3L 2KBNA 2OTLA 5KNDA 2BE5D 4MNOA 3K57A 3RN2A 1GM5A 4LF9L 1SXTA 1GHJA 1MD2D 4OIKA 4K14A 4ZAIA 1B9NA 1SFOB 3AQQA 5A2QL 2JA6B 3V05A 1EY7A 3J7YW 3NPPA 3BZCA 4EQ5A 5F2DA 3EBEA 1PRTB 2ALYB 1MJEA 2NVXH 4RKBA 1JJCB 1PRTD 2FFKB 4JI1L 3UDIA 2PW5A 5DNFA 1B7YB 1O78A 3PO2H 1WD1A 1PXUA 2HD3A 3FMCA 4JPBW 3SK5A 2KOLA 3FHWA 1IL8A 1OXTA 3CRLC 4FDBA 1ENFA 4LFBQ 1YJWA 3OMGA 4UY8C 2B2TC 1DOLA 2F0EA 1NTGA 2F3WA 3J81L 4LUOA 2R92B 1MSHA 1YBYA 1X3PA 3NWSA 1CTMA 2F0NA 2XGTA 2FJ2A 3MXNA 3S9WA 1TS5A 1AE3A 3ULLA 3TQYA 1VF5C 4A3MG 4BA1I 3T53B 3I8ZA 2CQOA 1K0SA 1CA5A 2OEOA 3K7AH 1Y69U 4J15A 4OL7A 3HOXH 2J7ZA 4IPHA 4J1MA 1NY4A 1FYCA 2OF1A 1UUPA 3A56A 2EYHA 1E2WA 4QL5A 5J3BA 2A68D 1BCPB 4R4CA 4U68A 4LUZA 5JJIA 3M3YB 4ZCKA 1W2BA 2C35B 3DXJC 3SGIA 4AYBG 4XXEA 1BCPD 3F1ZA 3M4QA 2JA7H 1SAPA 4OGQC 5FLXc 3OTOL 4B08A 3K81C 1PVOA 2E2JB 3EROA 1CT1D 1LTRD 2F4VL 3IRBA 5ELOA 3U58A 4ZLTF 1SNQA 4BY1G 1CFMA 5BR8Q 1CK1A 2C5CA 1U4LA 3GTPH 4O0AA 4C2MH 3S1RB 1Q81C 2PZTA 3KLSX 3GTMH 2WKDA 4PNYA 3M7NA 3MZ5A 1U0LA 4L6TB 1EOVA 4A76A 5FLMH 2F1MA 4N9PA 1KAWA 1ASZA 1A62A 2AUJD 3EN2A 3HKZG 2EJFC 1YNND 5EPKA 4JW0A 4NXML 3QOJA 1J8IA 1Y14B 2MFIA 2ICIA 1CHQD 4BBRG 3DUZA 3K80C 1VQGA 1UEBA 3P20A 2VW9A 3OW2A 4X62L 5IGBA 1KABA 3G6EA 1Y8OB 4X3SA 3GTKB 1WI5A 1MJCA 3J81i 3I91A 4ILWA 2XRSD 4X66Q 2DGYA 3F2UA 4APVA 3HOZH 3EFXD 1C48A 1VQ5A 4LNQA 4J8QA 1F9RA 1KDBA 2QDBA 2R7FA 4JBWA 1K3BC 3CQZH 3H0GH 2SNSA 5DM63 1VQLA 1FL0A 1PH3A 5LMUL 1R9TH 4GZYC 2KUMA 2NWGA 1RL2A 1XTCD 3S1QB 4YWKA 3MEHA 2ZTDA 4WJ4A 2RHSB 1F9SA 1WFQA 4OONA 4DR6L 3DEOA 1V1PB 5FKAC 5M3FH 1H95A 1HR0L 3GTPB 1EIGA 4M8AA 5ELNA 1GJXA 4OWXB 4RG1A 5CC4A 3CC7A 1BKBA 3S24A 3MA2B 1RTOA 4KTAA 4YY3Q 4CGYB 5ELBA 2Z4IA 1HFGA 1STEA 1A3TA 3M9BA 4R4TA 4LF9Q 1LT3D 2BH2A 2EYFA 1SSOA 2JJQA 4A3DG 3I4NH 4LF5L 3C3LA 2LY7A 3SVMA 3FEWX 3AB9A 2KQ3A 1GUGA 4ALPA 2OQKA 1JWUD 3U4VA 5LL6X 1XPRA 5JOBA 4LFCL 4JI1Q 5KYIA 3J7AF 4ZUJA 4FO2A 1I6VC 1VQNA 1U5KA 1ASYA 2RDGA 2AWOA 3HOZB 1IKMA 1PH4A 4LJZC 4H02A 3WOFA 4KI0A 4RCNA 4A3JB 1ESRA 2Z4HA 3L0OA 2RVLA 3H0GB 1TWFB 1X6OA 4A3IH 4C3IH 3MVVA 3MFYA 5HY6A 3ZJYC 3G48A 4DAMA 4A3GG 1AE2A 3TN2A 1STYA 3DWQA 3L3OC 2F0TA 2E75C 3HOYB 1VQMA 3X3MA 1C0AA 4DXGA 1VMPA 4QY7A 1PH6A 1AH9A 3SHLA 1GUSA 1L0WA 3N6RA 4H7BA 3KFUA 2JA5G 1YIJA 4JI5L 1N9WA 2Q8RE 2QDLA 3K0YA 1S40A 2Q2UA 5G3LD 1X3FA 1F2MA 2O4XA 1PZJD 2GVBA 2E76C 3RN5A 1XPOA 2Y0SG 1NSNS 3MXGA 1Y1WG 3GTOB 4B9XA 4POGA 2MO1A 4C3HB 1STHA 1Y1VH 2Z8LA 3DHQA 4LF8Q 2JP1A 1BBUA 1EWHA 5FO8B 4OWWB 2A8VA 1I50H 1NAPA 5IGEA 4RKLA 4BWGB 1UE5A 2K5VA 4JVZA 3OTOQ 2H4OA 1QVCA 3HZXA 2F4VQ 2ZM6L 1A2TA 3S16B 4A3BB 2IWHA 1TS3A 1HXYD 3H09A 4IUVA 2RSNA 1BR9A 1F77A 1Q8IA 3Q23A 1H9JA 2WP8J 4A3IB 5EKKA 1I6HB 3D4DA 1QUQA 4IJHA 4DV7L 5E7NA 2F0WA 2PMZB 4DV1L 3FPPA 1F9QA 4P75A 3HOVB 4NXMQ 4HSVA 3CPFA 1JE4A 1XMQL 2JE6I 1S5DD 3PUYA 4I7AA 3HOUH 3KDFB 5C6AA 4X62Q 3J80L 2JA8H 3S1MH 3RD4A 3N52A 1EYDA 3I90A 4NMZA 2MNAA 4PQXA 2JEAI 2VUMG 1EWCA 4MZ9A 3HOWH 4IPGA 3CP0A 4LK1C 1Q8KA 5CV5A 1TR5A 5BN5A 3I4MH 3SR1A 1B50A 4K5XA 2RCFA 2Z0SA 3TP7A 3AYHB 4KJNA 4A3LG 1D6EC 2XNAC 1EY5A 1MHWC 1EU4A 4L5QA 4L63B 5C3EH 3HS0C 3V96A 4G7OC 2ZJPA 4Y7NH 1I50B 5LMUQ 4RA8A 4YCVA 3H91A 1AFPA 2QF7A 1BO0A 2EQSA 3NWTA 1EQRA 1YHAA 3SK6A 3L2PA 1XNRL 4DR6Q 2R93G 1SNOA 3UDGA 1DZ1A 1N8RC 1U9RA 4CKBA 4RMFA 3VDYA 3NELA 2N78A 4TQUS 1KNAA 1C8CA 2O5JC 1YHBA 2OQ0A 1ILPA 2L0CA 3VA5A 1B3AA 1EQQA 4KHVA 5C5LA 1CKNA 1QE6A 3K5OA 4QQBX 3STBC 2D0PA 5FJ8H 1FVIA 2PZUA 1WCMG 2HQLA 2UUCL 2F0KA 2EXDA 4LF7L 2K5WA 2RF4A 3HG9A 1EYCA 3GTJH 3KYHC 1V1QA 2EVBA 1B2TA 4K6LA 1RODA 3WOEA 5I9PA 4A93H 1U4PA 4P72A 1CHPD 1FNWA 3UDXA 1JICA 1K28A 2ZJRA 1UE7A 4CKEA 4MN3A 1TWAB 1HRJA 4LFCQ 4FF4A 3I4MB 1TWCB 3S2DB 2JK8A 5A35A 5IYBG 4IUPA 2DY8A 3PGZA 1SE2A 2F0JA 1LO5D 4K0KL 3NBIA 5C4XB 5M3MG 1PRTF 3CCVA 4YCUA 4EQNA 2NYZD 2I07B 1DCZA 3S14B 2XRQD 4X3TA 1G51A 2Z1CA 3VR4A 2NVYH 4BXXH 2N49A 5EBDA 1IZ6A 4K2LA 3I73A 1A6XA 1NR2A 2NZ1D 2K52A 1Y8NB 1HQMC 3VR3A 4X64L 4HR7B 2EYLA 1LYLA 4ZK9B 2AQ3B 3I55A 4BBSG 1D5XC 1HUMA 2F0VA 3BDOA 3NP8A 2CKZB 4NKLA 4WFN3 5C44H 4A3KH 3ULPA 1SMYD 5CGKA 5AFWA 4GN4B 3V2TA 1H9KA 3GTQB 1K8GA 4IUQA 5TSSA 3JAME 1KL9A 1SROA 5I2YA 2OCEA 4G7HC 1WTQA 1LTTD 4DV4L 3U9OA 2ICEC 1M90C 1J5EL 2FXQA 1HNZL 5IP7H 4A93B 1OXVA 1QB5D 3BU2A 1I4RA 5CMDA 2UUAL 2Z6BA 4A3EB 1MI2A 4C1NK 2ZM6Q 3NE5B 2WFWA 1JWSD 2NN6G 5ELDA 5I4DA 4A3FB 4IFDG 2GVAA 3TS0A 4LWCA 1HH2P 1ESFA 2B29A 2HIXA 3MXPA 5LMNL 4DV7Q 3PO3H 2R3ZA 2EY6A 4DK0A 4DV1Q 3HKSA 2DY7A 2BA0A 1DOKA 3TBIB 4ZQ3A 1KLUD 2NZHA 4H0LC 1XMQQ 1SFOH 3KUPA 2JA6H 4IFDJ 2WACA 3G7LA 5NUCA 1IYJB 1NE3A 4POFA 3W1BA 1VQ7A 1K8MA 3PUWA 5IGDA 3J81c 4FXDA 1OTCA 3CAMA 1L2FA 1S5BD 3LGJA 2KEEA 2L1BA 4IALA 2PYKA 1VQKA 3UDFA 5D3DA 3I3CA 3OHXC 4NW2A 4BXXG 1Q7YC 3BS1A 1TQOA 2CHBD 3S1NB 3T16A 2Q2HA 1NMGA 1TVXA 1DOMA 5D14A 5C0XG 4IUNA 2K03A 1VQ9A 4UPAA 1VQHA 3T1HL 4CJ0B 1O7LA 5CBEE 2YV5A 5E1FA 1LTBD 2ZXPA 1XNRQ 4E6IA 4R4IA 3IFDA 1SYEA 2M9VA 4HJ5A 1A0IA 1JOQA 1HHVA 4DAPA 1PFMA 2A69C 4JI8L 4CJ1B 3PF5A 1E24A 4JI4L 1W6KA 3JC66 1Q86C 3BJUA 4OO1G 4FYDA 2F0OA 1BUVT 4JYAL 1R4PB 2GA4B 1SBBB 2NVQB 2Z6KA 2ZXRA 3TZUA 2B2WA 3EVQA 5CORA 2H1EA 2WV6D 3G4SA 5IP9G 3DEPA 4LF7Q 1CQVA 5CV6A 1IXRA 3M3YH 2VB2X 1JQYD 2RBMA 1S72A 1SRUA 3FDTA 1I3QB 4EGVA 2EY2A 5CYUA 4OIJA 2X69A 3ICEA 2PZWA 3FKIG 3MWYW 1YNJD 4AIMA 2E2JH 3RLOA 1EZ6A 2F0UA 3K59A 2DJFC 3T1YL 2EY1A 3OYYA 1HPCA 1GUTA 3CW2C 5IGFA 4X3KA 3S1RH 4L5RC 4K0KQ 1JJ2A 1SYBA 3KBGA 2AQ1B 2V1CC 1D1KA 1PZKD 3R93A 4DAYB 1N34L 4V190 2KA7A 2B63B 1TS4A 4DK1A 5CV4A 3TZDA 2VL6A 1E2VA 1PFSA 1A15A 2KHJA 1X56A 2K7VA 3KF6A 1E7ZA 1VQ8A 4A3MB 2CH4W 4BY7G 2EE1A 2QEJC 4V0BA 4X64Q 1B3QA 1H9SA 4LF4L 4GLVB 5JJLA 2OWOA 1N36L 3GTKH 1CZGA 1SMXA 4A3CG 2RCNA 5EGTA 4MTNA 1SJED 2Z6KC 2AWNA 2B2WC 1II3A 2WB1B 1ENAA 4TRDA 2HIVA 1Z47A 1DM0B 1CSPA 2R92G 1VQIA 2IT1A 4B3SL 4AYBB 3DLLA 3OIQA 2LMCB 4DV4Q 3NBHB 1J5EQ 4HIOA 5KRUA 3KLWA 1HNZQ 1IW7D 4KY5A 5A2QE 1RF2D 2UUAQ 4B3ML 3S1QH 1WD0A 4PG3A 4BY1B 4LFAL 3GO5A 3EQLC 2WB1E 2EPBA 2NBFA 5I6YA 3MTSA 5GADC 4R1JA 1SE8A 1GUOA 1L0XB 3AMUA 1T9HA 3H15A 5D65A 4KN4C 4AYBE 5KNCA 2LSSA 3A55A 2CCZA 1ZKOA 2F4IA 2FMMA 1SNDA 5EJWA 4UHVA 1KDCA 4NXNL 5M9OA 5LMNQ 4DR4L 1IYVA 5CR3A 2B2UA 2PQAB 4BBRB 3RLFA 2KVMA 1FR3A 3EA6A 4IOCA 4R4QA 2D62A 1LTLA 3PO2G 3C1EA 1X3QA 3J81E 1CSQA 4KMUC 4HIKA 3VYRA 1B53A 2PW7A 2N88A 1DJRD 4LMQD 2BDOA 3VYUA 3CKIB 2BCOA 4DR1L 4K5WA 1PTOB 3DWAA 4GKKL 1RJTA 3R3OA 2X6LA 1PTOD 1W3SA 3J7ZC 2F0FA 4A3JH 1YI2A 1HNXL 4ID6A 1EUJA 1TWFH 3SE0A 1ZYRC 2GN5A 5M5XB 3BVGA 4N8FA 3EIVA 4DV0L 1Q1BA 3B6YA 1B9MA 3T1HQ 1EWIA 5IIFA 1U4MA 1VCIA 2LS01 2SDFA 2KHSA 1RDPD 3QB3A 5JEAH 1KC8C 4G57A 5IT9c 3HOYH 2OTJA 2HDLA 1PH5A 4JI6L 4QUCA 2RQXA 4JK1C 1BBXC 3M4OB 4JI4Q 2K05A 2B2VA 4LW1A 3IKJA 3HOXG 4DV5L 1PH2A 1CKMA 2CFMA 3I70A 2D0OA 3WDNA 4JYAQ 5IYCH 2LKVA 1FD7D 4JI2L 4B3RL 3CCUA 1S5FD 1HNWL 3A8JE 2JYOA 1KLGD 2F52A 2B2UC 5IGGA 2JA7G 4A3DB 3GTOH 1NCVA 4KY6A 4C3HH 2AHOB 1PLFA 2ES2A 3PQIA 2JA9A 2BE5C 3NHHA 5I2XA 1JJGA 1X3EA 3CPWA 5JPNC 1AP0A 1TU2B 1WTOA 5EKLA 2F3VA 1O7ZA 4PZ6A 2AUKA 3S17B 1E1OA 5FLMG 2L11A 1QZGA 3ERSX 4EQPA 3S16H 3E9HA 4A3BH 4RAUC 3J80c 4IUUA 3T1YQ 2BOSA 1HA5A 3J81j 5E4XA 1PRTC 3TRZA 3ND9A 2CW0D 4A3GB 1WVLA 1IKLA 3BG3A 4HIDA 1I6HH 1EY6A 1ILQA 1JB3A 1M8AA 1N34Q 1CKOA 2RHQB 1L1OB 3CHBD 1VDZA 3HOVH 2K50A 2N3SA 3KF8B 1EU3A 2AKWB 3OWFA 4JV5L 3QR8A 3A74A 4Q5VA 2AMCB 1G91A 4X65L 3HOZG 1AEXA 2JA5B 1LTID 5BN3A 4OXPA 4LF4Q 1LTSD 2L4NA 2B2VC 5IY0A 1GO3E 1N36Q 5GAEC 3H0GG 1A8VA 2KCMA 2Y0SB 3LWEA 1WYDA 3HRZC 2VQFL 4QMGA 4JCVE 1Y1WB 2A6ED 3ULJA 4HN7A 1WTPA 5LL6S 1IBML 1WOCA 4B9WA 4UP7A 2HCCA 5FLXE 4B3SQ 3H3VI 1N33L 2K1BA 5M3FG 3C46A 4GOPB 2L55A 4RWSC 1I4GA 4GLAC 4OELB 1K73C 4DF7A 5EBCA 1TWHB 4PZ7A 1WTWA 4GKJL 3OSOA 3CCJA 1FNUA 4R8IA 4B3MQ 1CM9A 4LFAQ 3WWVA 2A6HD 2I5LX 3T51B 2IJ0A 2E5LL 2D9UA 2UXBL 3BZDB 2B39A 2F0SA 1BCPC 5CV8A 3K58A 3AEVA 3A0JA 3M85A 2JEBI 3U9SA 3K5LA 1J6QA 2M2LA 3AFQA 3GV6A 1IL2A 2OXPA 4YIJA 4X3UA 3E6ZX 4KD3A 3ONAB 3I4NG 5GQOA 4NXNQ 1STAA 1CQFA 3NTIA 4DR4Q 1P16A 5FOBB 3GTGB 1V43A 1RHPA 1V1PA 1M1KC 1JOKA 1D7QA 2KJXA 4FP5D 4ME3A 4GLXA 4KY7A 1VQBA 3OOCA 1PH7A 3RLNA 4JI3L 2XIWA 1VMCA 2KCCA 5IOCA 2L5TA 1BNZA 4L5SA 4GNXB 3K6OA 1YNNC 2VUMB 1I4XA 4NPSA 1BQQT 2PMZE 1PH1A 3I4LA 4A3IG 4K8IA 4C3IG 2WAQB 1TWAH 3LNNA 1DXMA 4TSSA 4CDCC 4HSPA 2IHFA 1EYGA 4DR1Q 1TWCH 3S2DH 2Q8IB 4JOIC 3W5OA 2LFNA 2RDFA 2EYOA 3TMEA 2C9OA 5IODA 4GKKQ 4CDDC 1TY0A 2IHEA 2TSSA 1TWGB 1HNXQ 5C4XH 4PZ8A 1AZQA 1LT6D 3ER0A 1D1IA 3P1HA 1QG7A 5IT9E 2BDNA 4DV0Q 2WAQE 3S14H 1FNVA 2IPKD 1VQPA 2R93B 3SXHA 4XQJA 2B8GA 3M4YA 3PIPA 4KV6A 4LAAA 1SE4A 4DR3L 1HR0Q 2IW3A 4C3JH 3GTLB 1C7YA 5EQ0A 1F2LA 1RD9D 2XTIA 1LM0A 4F7XA 1Y1VG 2F0LA 4DV5Q 1IYUA 3QWNA 4H13C 4JI2Q 2A19A 2QW7A 5EPJA 1SE3A 5IYDH 1KQSA 3VR5A 4PMBA 1HNWQ 5H1SE 1JORA 1XTDA 2K5NA 2IL8A 2VZAA 5IGCA 3CCMA 1VQOA 1CZWA 3GTQH 1ICFB 4JI7L 4LF5Q 1JOOA 1PYSB 4TKOB 1KAAA 3D0FA 3GP7A 2K5QA 1MBYA 2V4DA 4PMCA 2F0DA 2K33A 1EQVA 1CUKA 4DV6L 4HMJA 4RGMA 3JAML 4A3EH 2EJGC 1IHZA 5FO9B 3CMAA 3BVZA 4DNTB 1XYIA 3J80i 2D5DA 4LUVA 4K8JA 2K5HA 3M7GA 3IL8A 5M3MB 4DUYL 4A3FH 1X9NA 3A5UA 1I4QA 1QNUA 1ET6A 3PMFA 3D4WA 3HOUG 1YEZA 2JA8G 3RZDB 3PIP3 4CKCA 1EFID 5IWAL 5C3XA 2DJGC 5EPLA 1KDAA 3A54A 5C4JB 3H3VH 3HOWG 5K36H 1IBKL 2QKIC 4X65Q 1TIID 3I4MG 3HEJA 1QILA 4C3JB 1X54A 3Q0AA 1X3GA 4BBSB 2EJMA 1D2BA 4HCEA 3A5ZB 3BYYB 2SEBD 3PF4A 2RKSA 4JI5Q 3DM1A 1SR3A 5C3EG 2VQFQ 2AQ2B 3MFGA 4UP8A 3KDFA 1H9MA 3E3XA 2KHIA 2O5IC 3D3RA 1IBMQ 3ERQA 1N33Q 1XPUA 3S1NH 4PMWA 4QJFA 4IURA 2UXDL 1K83B 5M5YB 3R8BA 4GKJQ 3A7AB 1JB7A 3VR2A 3PUXA 4DR5L 3I56A 3P75A 2E2HH 2E5LQ 4WJ3M 2UXBQ 1Z7TA 4KLKA 2ASBA 2A1AA 1B1ZA 4CDFC 3A8KE 5FJ8G 4YWMA 1BCPF 1YJ9A 1LABA 2NZOA 4DUZL 3VA7A 3RUZA 1YVCA 3K5MA 1EL0A 1E22A 4EVOA 2NVQH 4UP9A 4KHZA 2HUGA 4A93G 4H44C 4ME5A 1A63A 3H6MA 2UXCL 4JI3Q 4BS9A 2XN9C 4WORA 1TXYA 1FGBD 4PV1C 4WJWA 5DM73 4R9WA 1ONLA 1GD7A 1PFNA 3RMHA 3MXNB 3RR5A 1I3QH 4QUFA 1MGSA 2CQAA 2N8NA 3VYSA 3NK9A 2MP1A 3BDCA 2YTXA 4HJ7A 2NVTB 2SNMA 5ELCA 3TS2A 1AW7A 4NDXA 1ICWA 2EOTA 4IPCA 4O42A 1STNA 1UE6A 1WTXA 1K3RA 2H5XA 2HHHL 2NTSA 1LT4D 3D6CA 2YU9B 1UNSA 2OT2A 3NXWA 3J7A5 4OX9L 4KHPL 1BOSA 3P7JA 2R7ZB 2PPBC 1VQCA 4TVAB 2VNUD 2B63H 4IZ8A 4YCWA 1XNQL 3MEFA 2P5ZX 4KJOA 2E2HB 4DGZA 4K2KA 5C44G 4DN4M 4A3KG 4A3MH 4DR3Q 1B44D 3K7UC 1Q90A 3KBXA 1CI3M 3T13A 1HUNA 3F8TA 4L5TA 1SYDA 4G4KA 2VXWA 4CJ2C 1SN8A 5C0XJ 3FPUB 2EYMA 3E0JA 3TSSA 5IP7G 3CCSA 4RGNA 3NQTA 1W6JA 4CBVA 3RZOB 3CCRA 4RFBA 2UUCQ 4FXGC 4JI7Q 2EYPA 1EZ8A 5LMNW 3BDLA 1OO9B 3L7ZC 3A7LA 1HZ9A 4EX5A 2ZTCA 1UWVA 1VF7A 4DV6Q 1G6ZA 1GKHA 2I0QA 4BY1H 1R4QB 3PO3G 1LUZA 1V8QA 3D8GA 2R6GA 1JR0D 4L8JA 1PA6A 2E2DC 2G5DA 2JXMB 2J4XA 4QB4A 1N32L 1I94L 4DUYQ 5ISRA 4DR7L 2MJ8A 2XWBB 3I7FA 4DXFA 1NNXA 1S5CD 5C3WA 3CC4A 2JA6G 1EIYB 5JVH3 1P8LA 1WJJA 5IWAQ 4BBRH 4XQQA 3PIOA 4MTKA 4HJAA 4ZUIA 3NQIA 4BY7B 2DNEA 2UU9L 1EY8A 1SNMA 1GXDC 2E8GA 3AU7A 4OWTB 2QILA 1IBKQ 3UE1A 2ZJQA 1HTLD 4BA2I 2QEXA 3U4ZA 3E0EA 3U50C 5DLQE 1E0BA 2F3IA 4IUTA 1HZCA 1MSGA 3X3NA 5EKIA 3T4AC 1NUCA 2PNHA 2PI2E 3S2HB 3F2DA 1PTOH 2EDGA 3NENA 3SEBA 3OIPA 5GAHC 1RKNA 4Q0FA 4GN3B 2B63G 1VS0A 4K5VA 1K0RA 1O7IA 1JT8A 4XDXA 2VB3X 1G8ZD 2L9HA 5G3LF 4YWLA 1SMYC 5M5XH 2UXDQ 3K0XA 1B8AA 3D4RA 3M4PA 5C5MA 2MPMA 1IBLL 3LWUA 5J39A 4Z9CB 4HJ8A 4XYQA 2IX0A 4DR5Q 5C4ZA 1PZID 5CBAE 1XJVA 3KJPA 4P73A 5I9OA 4P74A 5ELFA 2WB1G 1FJGL 1LV9A 1PMRA 3BYTB 4LF8L 3M4OH 1NR4A 4NB3A 3PIO3 1BBWA 1Q12A 4KKSA 3HKZB 4DUZQ 5M5WH 4JI0L 4DK3C 2NVXB 1TS2A 5JVG3 4KKTA 1V1OA 4DV2L 4A3DH 3PO2B 3S15H 2UXCQ 1YJNA 1X65A 1PFBA 3HFZB 3HKZE 1AN8A 1Q82C 1KD1C 1ENCA 3CCEA 3H3VC 1F2YA 1GOZA 2FMCA 3KK7A 1EOTA 2PQEA 2K01A 4XYOA 4FF2A 2F0MA 3S17H 2Z9HA 1UE1A 1PYWD 2FINB 2HHHQ 1HCZA 3QO2A 3SDZA 4OHJA 4KN7C 3DM3A 1VQDA 4A3GH 1I4PA 1D5MC 1ZEQX 5KEEA 4OX9Q 4KHPQ 4GN5A 1KHIA 4DR2L 2M00A 3HP3A 4O2DA 4P71A 2CH4A 3ZYYX 1M4VA 3FVQA 1XNQQ 2LXJA 1NBWA 3K7AB 1SYGA 3HOXB 1EEFD 1E2ZA 5HGQA 1HA6A 2JA5H 1X55A 4DAYA 2BA1A 4JI8Q 3UE0A 4CDEC 4ZRZA 2PI2A
chains in the Genus database with same CATH topology
5M5WB 2JA7B 1F2ZA 5CV7A 4DNRB 3OMCA 3S15B 4I7ZC 1OXUA 5KYLA 4C2MB 3GTMB 4FNFA 2A73B 1EQTA 3TP6A 3OW7A 4MIUA 2PO4A 2WIIB 2WINB 1BF4A 1OXXK 1STGA 5FLXL 3CRKC 5J1ZA 4XTCS 3NBHA 2QCPX 3NUCA 4M1UB 2KECA 1YNJC 2K32A 1ZXTA 2SOBA 4DFAA 2DNCA 5BN4A 3GD7A 5DEHA 4EQOA 2RSOA 5LHY1 4FF3A 3TDQA 2YYZA 4S3SA 3ITPA 2NN6I 4FVMA 3CQZB 2F0PA 4IFDI 2HQEA 5DAUA 1R9TB 4IQZA 3MHBA 3VYTA 4ZKCB 1T5EA 4O1NA 4QIWB 2I46A 2XSCA 3TP8A 5M3FB 3DWPA 2L12A 1C4QA 5JEAG 2J0TD 1PDQA 1XX8A 2RA4A 2X6GA 2G9DA 4C1NI 5JJZA 4RCOA 3QIAA 1S4ZA 2NUCA 1Q1EA 2A68C 3R2TA 2EXZA 1IW7C 5IT9L 3TP5A 4UDUC 4RHRA 3I4NB 5JEAJ 1K8OA 4C3HG 2A74C 1DONA 4QF4A 1KNEA 2EZVA 3MC0B 2B8FA 3VR6A 5C0XI 2R61A 3ND8A 2NB0A 3C1FA 4DAVA 1O7YA 2FHTA 3E5SA 1Y8PB 2PNRC 1LACA 4U673 2IX3A 3L9AX 4C3IB 3OPOA 4OO1I 3SK4A 1JCKB 1OXSC 1LLRD 1SEBD 1A2UA 3QJYA 1LT5D 2N55A 1UAPA 2A5HA 2B2YA 3NTKA 2F0HA 4J6HA 3IFTA 2ZXOA 5E4WC 1XWEA 4FXKC 1TY2A 5T1IA 1WTVA 5C4HA 5K5PA 4IN3A 1PTOC 1QOHA 4CHTB 3CU7A 2F0QA 5KNBA 3C2PA 1Y1VB 2XWJB 1ML0D 1A3VA 3IAYA 2PCFB 1BDOA 3UI2A 4RH6A 3W3AA 3FRPB 3KF8A 5COYA 1WCMB 4P2CB 2ENBA 1LTAD 2EY5A 2A69D 1Q3LA 1B4OA 3QOLA 3T56B 5T1GA 1DD2A 1WTRA 4RGOS 1GUWA 1RTNA 2D2CC 3DMUA 4QCLA 1XXGA 3QG1A 1SYFA 2ID0A 4HCSA 3PV0A 2F0IA 2WKCA 4K6DA 4XT1B 3J80E 2O2LD 2NN6H 1SJHD 1S5ED 5E3FA 4IFDH 3SK8A 3NSWA 4ZKBB 2B2YC 5HGTA 1SNPA 3MAQA 4HMIA 1SNCA 1RCVD 3HOUB 2K04A 1EIHA 2CVRA 2RDHA 2JA8B 3S1MB 1Z6HA 5CV9A 1UEAB 1EY0A 3HOWB 2CW0C 3W2DA 1JWMD 4DA2A 2K5DA 4UAIA 2MGSA 4R8NA 1EYAA 5C3EB 3PUZA 1F9PA 1EY4A 4Y7NB 1J9OA 1QCBD 2F0GA 3A8IE 1L0YB 2IX1A 4F87A 1G291 4RGTA 5D3IB 5KIXA 2E74C 4KKUA 1QWYA 3I72A 2F03A 2DN8A 2JSOA 5C0XH 1KTKA 4G7ZC 1CA6A 2A6EC 3J7AV 4HAEA 4C3JG 3HGBA 4F8MA 4HTHA 2KCNA 5KGUA 3OWEB 5ELEA 3K5NA 3G6JB 1G2SA 2K6AA 2KEDA 2MHVA 1TKWB 3Q24A 2HCIA 4XT3B 4OO1H 1H9RA 3KLRA 3GTJB 2A6HC 3D6WA 3H94A 1AZPA 3R2IA 5J22A 4FF1A 5HURA 1SDFA 1HTPA 5JAVA 4DU9A 4WRDA 4XQNA 3PUVA 4ODGA 3EJIA 5I6WA 4ULLA 4XIGS 2K28A 1HQRD 3MXUA 1H9SB 1HFNA 1O80A 4N9TA 2NVYB 2E2IB 4HEDA 1I4HA 1TT2A 2MUYA 1T5XD 5K36G 1GHKA 1ET9A 1QJOA 4KD4A 4ABNA 4I65A 1STBA 1X32A 3D31A 1PTOF 1BXTA 5FO7B 3Q6SA 5C44B 4A3KB 2EYJA 1DYQA 1ZYRD 3Q22A 1D5ZC 3URYA 1A3UA 2XVSA 3GQBA 4NP5A 1EY9A 2G9HD 5FK9C 3LX0A 3GV3A 1JC7A 2B2TA 1EEID 4C56C 2Q8TA 2TMPA 3KLSA 4MHEA 1U4RA 4KK7A 3O13A 4F88A 2HDMA 2NTTA 4ZYSA 2ZT9C 1SYCA 3BVMA 3NTHA 4RHSA 1LTGD 5JPMC 1G2TA 1QNKA 3PO3B 3FKIB 1GUNA 5KNDA 2BE5D 3K57A 1SXTA 1GHJA 1MD2D 4OIKA 4K14A 4ZAIA 1B9NA 1SFOB 5A2QL 2JA6B 3V05A 1EY7A 3J7YW 3NPPA 5F2DA 1PRTB 4RKBA 1PRTD 2FFKB 2PW5A 5DNFA 1O78A 1WD1A 1PXUA 3FMCA 3SK5A 2KOLA 1IL8A 1OXTA 3CRLC 1ENFA 3OMGA 2B2TC 1DOLA 2F0EA 2F3WA 3J81L 2R92B 1MSHA 1X3PA 3NWSA 1CTMA 2F0NA 3S9WA 2FJ2A 3MXNA 1TS5A 1VF5C 4BA1I 3T53B 3I8ZA 1CA5A 2OEOA 1Y69U 4OL7A 2J7ZA 4J1MA 1FYCA 2OF1A 1UUPA 3A56A 2EYHA 1E2WA 2A68D 1BCPB 4U68A 3M3YB 3DXJC 4XXEA 1BCPD 1SAPA 4OGQC 4B08A 2E2JB 3EROA 1CT1D 1LTRD 4ZLTF 1SNQA 1CFMA 1CK1A 2C5CA 1U4LA 3S1RB 2PZTA 3KLSX 2WKDA 4PNYA 3M7NA 3MZ5A 4L6TB 2F1MA 4N9PA 2AUJD 2EJFC 1YNND 5EPKA 3QOJA 1J8IA 2ICIA 1CHQD 3DUZA 3P20A 5IGBA 1KABA 1Y8OB 4X3SA 3GTKB 3I91A 4ILWA 2XRSD 3F2UA 3EFXD 1C48A 4J8QA 1F9RA 1KDBA 2QDBA 4JBWA 2SNSA 5DM63 4GZYC 2KUMA 2NWGA 1XTCD 3S1QB 3MEHA 1F9SA 3DEOA 1V1PB 5FKAC 3GTPB 1EIGA 4M8AA 1GJXA 5CC4A 3MA2B 1RTOA 4KTAA 4CGYB 5ELBA 2Z4IA 1HFGA 1STEA 1A3TA 1LT3D 2EYFA 1SSOA 3C3LA 2LY7A 3SVMA 3FEWX 3AB9A 2KQ3A 1GUGA 1JWUD 5LL6X 5JOBA 5KYIA 3J7AF 4ZUJA 4FO2A 1I6VC 3HOZB 2RDGA 2AWOA 1IKMA 4LJZC 3WOFA 4KI0A 4RCNA 4A3JB 1ESRA 2Z4HA 2RVLA 3H0GB 1TWFB 3MVVA 3MFYA 3TN2A 1STYA 3DWQA 3L3OC 2F0TA 2E75C 3HOYB 3X3MA 4DXGA 1VMPA 3SHLA 1GUSA 3N6RA 4H7BA 2Q8RE 3K0YA 5G3LD 2O4XA 1F2MA 1PZJD 2E76C 1NSNS 3MXGA 3GTOB 4B9XA 4C3HB 1STHA 2Z8LA 3DHQA 2JP1A 1EWHA 5FO8B 1NAPA 5IGEA 4RKLA 4BWGB 2H4OA 3HZXA 1A2TA 3S16B 4A3BB 2IWHA 1TS3A 1HXYD 3H09A 4IUVA 2RSNA 1BR9A 1F77A 1Q8IA 3Q23A 1H9JA 2WP8J 4A3IB 5EKKA 1I6HB 3D4DA 2F0WA 2PMZB 3FPPA 1F9QA 3HOVB 4HSVA 1JE4A 2JE6I 1S5DD 3PUYA 5C6AA 3J80L 3RD4A 3N52A 1EYDA 3I90A 4NMZA 4PQXA 2JEAI 1EWCA 4LK1C 5CV5A 1TR5A 5BN5A 3SR1A 1B50A 4K5XA 3TP7A 4KJNA 1D6EC 2XNAC 1EY5A 1EU4A 4L63B 3HS0C 3V96A 4G7OC 1I50B 4RA8A 3H91A 1AFPA 2QF7A 1BO0A 3NWTA 3SK6A 1SNOA 1DZ1A 1U9RA 4CKBA 4TQUS 1KNAA 1C8CA 2O5JC 1ILPA 2L0CA 3VA5A 1B3AA 4KHVA 5C5LA 3K5OA 1QE6A 2PZUA 2F0KA 2K5WA 3HG9A 1EYCA 2EVBA 1B2TA 4K6LA 1RODA 3WOEA 5I9PA 1U4PA 1CHPD 1FNWA 1JICA 4CKEA 4MN3A 1TWAB 1HRJA 4FF4A 3I4MB 1TWCB 3S2DB 5A35A 4IUPA 2DY8A 1SE2A 2F0JA 1LO5D 3NBIA 5C4XB 1PRTF 4EQNA 2NYZD 2I07B 1DCZA 3S14B 2XRQD 4X3TA 2Z1CA 3VR4A 5EBDA 4K2LA 3I73A 1A6XA 1NR2A 2NZ1D 1Y8NB 1HQMC 3VR3A 4HR7B 2EYLA 4ZK9B 2AQ3B 1D5XC 1HUMA 2F0VA 3BDOA 3NP8A 4NKLA 4WFN3 5CGKA 1SMYD 5AFWA 3V2TA 1H9KA 3GTQB 4IUQA 5TSSA 3JAME 5I2YA 4G7HC 1WTQA 1LTTD 3U9OA 2ICEC 4A93B 1OXVA 1QB5D 1I4RA 5CMDA 4A3EB 1MI2A 4C1NK 3NE5B 1JWSD 2NN6G 5ELDA 5I4DA 4A3FB 4IFDG 1ESFA 3MXPA 2R3ZA 2EY6A 4DK0A 2DY7A 2BA0A 1DOKA 3TBIB 4ZQ3A 1KLUD 4H0LC 3KUPA 4IFDJ 2WACA 3G7LA 5NUCA 1K8MA 3PUWA 5IGDA 4FXDA 1S5BD 2KEEA 2L1BA 4IALA 2PYKA 5D3DA 3I3CA 3OHXC 4NW2A 3BS1A 1TQOA 2CHBD 3S1NB 3T16A 1TVXA 1DOMA 5D14A 5C0XG 4IUNA 2K03A 4CJ0B 1O7LA 5CBEE 5E1FA 1LTBD 2ZXPA 4E6IA 3IFDA 1SYEA 2M9VA 1JOQA 1HHVA 4DAPA 1PFMA 2A69C 4CJ1B 1W6KA 4OO1G 4FYDA 2F0OA 1BUVT 1R4PB 2GA4B 1SBBB 2NVQB 2ZXRA 3TZUA 2B2WA 3EVQA 5CORA 2H1EA 2WV6D 3DEPA 1CQVA 5CV6A 2VB2X 1JQYD 2RBMA 3FDTA 1I3QB 4EGVA 2EY2A 5CYUA 4OIJA 2X69A 2PZWA 3MWYW 1YNJD 1EZ6A 2F0UA 3K59A 2EY1A 1HPCA 1GUTA 5IGFA 4X3KA 1SYBA 3KBGA 2AQ1B 1D1KA 1PZKD 3R93A 4V190 2KA7A 2B63B 1TS4A 4DK1A 5CV4A 3TZDA 1E2VA 1A15A 2K7VA 4A3MB 2EE1A 2QEJC 4V0BA 1H9SA 1CZGA 5EGTA 1SJED 2AWNA 2B2WC 1II3A 2WB1B 1ENAA 4TRDA 1Z47A 1DM0B 2IT1A 4AYBB 3OIQA 2LMCB 5KRUA 1IW7D 4KY5A 5A2QE 1RF2D 1WD0A 4BY1B 3GO5A 3EQLC 2EPBA 2NBFA 5I6YA 3MTSA 1GUOA 1L0XB 3AMUA 5D65A 4KN4C 5KNCA 3A55A 1ZKOA 2F4IA 2FMMA 1SNDA 5EJWA 1KDCA 5M9OA 1IYVA 5CR3A 2B2UA 4BBRB 3RLFA 2KVMA 1FR3A 3EA6A 2D62A 3C1EA 1X3QA 3J81E 4KMUC 3VYRA 1B53A 2PW7A 2N88A 1DJRD 4LMQD 2BDOA 3VYUA 3CKIB 2BCOA 4K5WA 1PTOB 3DWAA 1RJTA 3R3OA 2X6LA 1PTOD 2F0FA 4ID6A 3SE0A 1ZYRC 5M5XB 3BVGA 1Q1BA 1B9MA 5IIFA 1U4MA 1VCIA 2LS01 2SDFA 2KHSA 1RDPD 3QB3A 5JEAH 4G57A 2HDLA 4QUCA 2RQXA 4JK1C 1BBXC 3M4OB 2K05A 2B2VA 3IKJA 3I70A 3WDNA 2LKVA 1FD7D 1S5FD 3A8JE 2JYOA 1KLGD 2B2UC 5IGGA 4A3DB 1NCVA 4KY6A 1PLFA 3NHHA 2BE5C 5I2XA 5JPNC 1AP0A 1TU2B 1WTOA 5EKLA 2F3VA 1O7ZA 2AUKA 3S17B 2L11A 4EQPA 4RAUC 4IUUA 2BOSA 1HA5A 5E4XA 1PRTC 3ND9A 2CW0D 4A3GB 1WVLA 1IKLA 3BG3A 1EY6A 1ILQA 1JB3A 1M8AA 3CHBD 1VDZA 1EU3A 3OWFA 4Q5VA 1G91A 1AEXA 2JA5B 1LTID 5BN3A 1LTSD 2L4NA 2B2VC 2Y0SB 3LWEA 3HRZC 1Y1WB 4QMGA 2A6ED 4HN7A 1WTPA 5LL6S 4B9WA 2HCCA 5FLXE 2K1BA 3C46A 4RWSC 2L55A 1I4GA 4DF7A 5EBCA 1TWHB 1WTWA 3OSOA 1FNUA 4R8IA 1CM9A 2A6HD 3T51B 2IJ0A 2D9UA 3BZDB 2B39A 2F0SA 1BCPC 5CV8A 3K58A 3M85A 2JEBI 3U9SA 3K5LA 2M2LA 3GV6A 2OXPA 4YIJA 4X3UA 3E6ZX 4KD3A 3ONAB 1STAA 1CQFA 3NTIA 5FOBB 3GTGB 1V43A 1RHPA 1V1PA 1JOKA 2KJXA 4FP5D 4KY7A 3OOCA 2XIWA 1VMCA 2KCCA 5IOCA 2L5TA 1BNZA 3K6OA 1YNNC 2VUMB 1I4XA 1BQQT 3I4LA 4K8IA 4C3IG 2WAQB 3LNNA 1DXMA 4TSSA 4HSPA 2Q8IB 2LFNA 2RDFA 2EYOA 3TMEA 2C9OA 5IODA 1TY0A 2TSSA 1TWGB 1AZQA 1LT6D 1D1IA 3P1HA 1QG7A 5IT9E 2BDNA 1FNVA 2IPKD 2R93B 3SXHA 4XQJA 2B8GA 3M4YA 4KV6A 4LAAA 1SE4A 3GTLB 2IW3A 5EQ0A 1F2LA 1RD9D 4F7XA 2F0LA 1IYUA 3QWNA 4H13C 5EPJA 1SE3A 3VR5A 4PMBA 1JORA 2IL8A 5IGCA 1CZWA 1JOOA 4TKOB 1KAAA 3GP7A 2K5QA 1MBYA 2V4DA 4PMCA 2F0DA 2K33A 1EQVA 4HMJA 4RGMA 3JAML 2EJGC 1IHZA 5FO9B 3BVZA 4DNTB 1XYIA 2D5DA 4K8JA 3M7GA 5M3MB 3IL8A 1I4QA 1QNUA 1ET6A 3PMFA 3D4WA 3RZDB 3PIP3 4CKCA 1EFID 5C3XA 5EPLA 1KDAA 3A54A 5C4JB 5K36H 2QKIC 1TIID 3HEJA 1QILA 4C3JB 3Q0AA 4BBSB 2EJMA 1D2BA 4HCEA 3BYYB 2SEBD 2RKSA 3DM1A 2AQ2B 3MFGA 1H9MA 2O5IC 3D3RA 3ERQA 4PMWA 4IURA 1K83B 5M5YB 3R8BA 3A7AB 3VR2A 3PUXA 3P75A 1Z7TA 1B1ZA 3A8KE 1BCPF 1LABA 3VA7A 3RUZA 3K5MA 1EL0A 4EVOA 4KHZA 2HUGA 4H44C 4ME5A 3H6MA 4BS9A 2XN9C 4WORA 1FGBD 4PV1C 4WJWA 5DM73 4R9WA 1ONLA 1PFNA 3RMHA 4QUFA 1MGSA 2CQAA 3VYSA 3NK9A 2MP1A 3BDCA 2NVTB 2SNMA 5ELCA 1AW7A 4NDXA 1ICWA 2EOTA 4O42A 1STNA 1WTXA 2NTSA 1LT4D 3D6CA 2YU9B 1UNSA 2OT2A 3NXWA 1BOSA 3P7JA 2R7ZB 2PPBC 2VNUD 4IZ8A 4KJOA 2E2HB 4DGZA 4K2KA 4DN4M 1B44D 1Q90A 3KBXA 1CI3M 3T13A 1HUNA 1SYDA 4G4KA 2VXWA 4CJ2C 5C0XJ 3FPUB 2EYMA 3E0JA 3TSSA 4RGNA 3NQTA 1W6JA 4CBVA 3RZOB 4RFBA 4FXGC 2EYPA 1EZ8A 3BDLA 1OO9B 3L7ZC 3A7LA 1VF7A 1G6ZA 1R4QB 3D8GA 1V8QA 2R6GA 1JR0D 4L8JA 2E2DC 2JXMB 2J4XA 4QB4A 5ISRA 2MJ8A 2XWBB 4DXFA 1S5CD 5C3WA 5JVH3 4XQQA 4ZUIA 3NQIA 4BY7B 2DNEA 1EY8A 1SNMA 1GXDC 3AU7A 2QILA 1HTLD 4BA2I 1E0BA 4IUTA 1MSGA 3X3NA 5EKIA 3T4AC 1NUCA 3S2HB 1PTOH 2EDGA 3SEBA 3OIPA 1RKNA 4Q0FA 4K5VA 4XDXA 2VB3X 1G8ZD 2L9HA 5G3LF 1SMYC 3D4RA 5C5MA 2MPMA 3LWUA 5J39A 4Z9CB 4XYQA 2IX0A 5C4ZA 1PZID 5CBAE 5I9OA 5ELFA 1LV9A 1PMRA 3BYTB 1NR4A 3PIO3 1Q12A 4KKSA 3HKZB 2NVXB 1TS2A 5JVG3 4KKTA 1V1OA 3PO2B 1PFBA 1AN8A 1ENCA 3H3VC 1F2YA 1GOZA 2FMCA 3KK7A 1EOTA 2PQEA 2K01A 4XYOA 4FF2A 2F0MA 1PYWD 2FINB 1HCZA 3QO2A 3SDZA 4OHJA 4KN7C 1I4PA 1D5MC 1ZEQX 5KEEA 2M00A 3HP3A 3ZYYX 1M4VA 3FVQA 3K7AB 1SYGA 3HOXB 1EEFD 1E2ZA 1HA6A 4DAYA 2BA1A 4ZRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT D;  1SBB B;  4UDU C;  5TSS A;  2O2L D;  4RHR A;  1I4X A;  1SJH D;  1S5E D;  4DXG A;  2XRS D;  1LTT D;  1HQR D;  1G8Z D;  1QIL A;  2WV6 D;  1HA5 A;  3MC0 B;  4TSS A;  1RCV D;  1PRT C;  3EFX D;  2R61 A;  3BYY B;  1CQV A;  2SEB D;  1I4R A;  2RDH A;  1ENF A;  4Z9C B;  1B44 D;  1PZJ D;  1TY0 A;  1JQY D;  2TSS A;  2AQ2 B;  1I4H A;  3MFG A;  1PZI D;  3EA6 A;  1T5X D;  1JWS D;  5I4D A;  5ELD A;  3CHB D;  1LT6 D;  3W2D A;  5ELF A;  1ET9 A;  1EU3 A;  2Z8L A;  3BYT B;  1ESF A;  1JWM D;  1XTC D;  1FNV A;  2IPK D;  1DJR D;  4RGN A;  3TSS A;  1TS5 A;  1PTO F;  1LTI D;  1BXT A;  1JCK B;  4RFB A;  1LLR D;  1DYQ A;  1LTS D;  1PTO B;  1SEB D;  1LT5 D;  1V1P B;  5FKA C;  4BWG B;  1D5Z C;  3R8B A;  3URY A;  1TS2 A;  3DWA A;  1SE4 A;  1V1O A;  1PTO D;  1KLU D;  2AQ1 B;  4K6L A;  1PZK D;  1L0Y B;  1RD9 D;  2G9H D;  5FK9 C;  4RGT A;  5D3I B;  1TS4 A;  1CHP D;  1TS3 A;  1FNW A;  1TY2 A;  1HXY D;  1F77 A;  1B1Z A;  1SE3 A;  3BVG A;  1EEI D;  1BCP F;  4C56 C;  5ELB A;  1AN8 A;  1PTO C;  1UUP A;  1JR0 D;  1STE A;  1BCP B;  1KTK A;  2J4X A;  2QEJ C;  3O13 A;  1RDP D;  1LT3 D;  1GOZ A;  1I4G A;  2NTT A;  1SE2 A;  1LO5 D;  1S5B D;  4ZYS A;  1BCP D;  1PRT F;  4DXF A;  1S5C D;  3BVM A;  4RHS A;  1FNU A;  1LTG D;  1PYW D;  3OWE B;  5D3D A;  5ELE A;  1CT1 D;  1LTR D;  3GP7 A;  1SJE D;  1JWU D;  1S5D D;  4OHJ A;  2XRQ D;  2IJ0 A;  3BZD B;  2XN9 C;  1CK1 A;  1I4P A;  2CHB D;  4O1N A;  1BCP C;  4RH6 A;  4RGM A;  1D5M C;  1FD7 D;  1FGB D;  3KLS X;  1S5F D;  3BVZ A;  2RDG A;  3DWP A;  1KLG D;  1LTA D;  2QIL A;  4L6T B;  1EWC A;  1HTL D;  1SXT A;  1MD2 D;  1M4V A;  1I4Q A;  1ET6 A;  1LTB D;  5ELC A;  1AW7 A;  3R2I A;  4RGO S;  2AQ3 B;  1V1P A;  3V05 A;  4RCO A;  1RF2 D;  1D5X C;  1EEF D;  1D6E C;  2ICI A;  1CHQ D;  2XNA C;  2NTS A;  1XXG A;  1PRT B;  1EU4 A;  1EFI D;  1LT4 D;  3R2T A;  1PTO H;  1L0X B;  4L63 B;  3DWQ A;  3SEB A;  1UNS A; 
#chains in the Genus database with same CATH topology
 1KXL A;  5JJK A;  5M5W B;  1Y1W H;  2JA7 B;  1F2Z A;  1QUQ B;  5CV7 A;  4DNR B;  2I5H A;  2JN4 A;  1QVG A;  1KRT A;  3OMC A;  1E1T A;  2BH8 A;  3S15 B;  4I7Z C;  1OXU A;  1KRS A;  3FP9 A;  4C2M B;  5KYL A;  3STB D;  3GTM B;  4FNF A;  2A73 B;  1EQT A;  3TP6 A;  3OW7 A;  1YHQ A;  1TWH H;  4MIU A;  2PO4 A;  2WII B;  2WIN B;  3TRE A;  1BF4 A;  3I4O A;  1OXX K;  1STG A;  5IE8 A;  5FLX L;  1PHJ A;  3CRK C;  5J1Z A;  4XTC S;  3NBH A;  2QCP X;  1N32 Q;  3NUC A;  1I94 Q;  4M1U B;  4DR7 Q;  2KEN A;  2KEC A;  4JBK A;  1YNJ C;  2K32 A;  1ZXT A;  2SOB A;  4DFA A;  2DNC A;  1EFW A;  5BN4 A;  3GD7 A;  5DEH A;  4EQO A;  3GTG H;  2YTY A;  2RSO A;  5LHY 1;  4FF3 A;  3TEH B;  3TDQ A;  2K14 A;  2YYZ A;  4S3S A;  5GRO A;  2ZTE A;  2UU9 Q;  3ITP A;  2NN6 I;  4FVM A;  3CQZ B;  2VS1 A;  2F0P A;  4DNI A;  4IFD I;  2VUM H;  4DV3 L;  2EIF A;  2PQA A;  2HQE A;  4AQY L;  4A3J G;  5DAU A;  1R9T B;  4IQZ A;  3MHB A;  2IY5 B;  2CWA A;  1HR0 W;  3VYT A;  4A3L H;  4ZKC B;  3K8A A;  4Y52 H;  4JOI A;  1T5E A;  3NEM A;  4O1N A;  4QIW B;  2I46 A;  2XSC A;  3TP8 A;  5M3F B;  3DWP A;  2L12 A;  1C4Q A;  1CKN B;  5JEA G;  2J0T D;  3HOY G;  2I5M X;  2K75 A;  1TWG H;  1PDQ A;  1XX8 A;  2RA4 A;  2X6G A;  2G9D A;  1KIX A;  1Q46 A;  4C1N I;  5JJZ A;  4QGU A;  1HZA A;  2Y0S E;  4RCO A;  3QIA A;  1IBL Q;  3KJO A;  1S4Z A;  2NUC A;  1S3O A;  1Q1E A;  2R93 H;  4JC0 A;  3F2B A;  2L15 A;  4QIW E;  1PH8 A;  5IYC G;  2A68 C;  3R2T A;  2EXZ A;  4YHH L;  3I2Z A;  1IW7 C;  3PCO B;  3TP5 A;  5IT9 L;  3CF5 A;  3GTL H;  4UDU C;  2VQE L;  1FJG Q;  4RHR A;  3I4N B;  2KCT A;  5JEA J;  4B3T L;  1K8O A;  4C3H G;  2A74 C;  1DON A;  1JE5 A;  1VQF A;  4QF4 A;  1KNE A;  1DGS A;  2EZV A;  3MC0 B;  3JAM c;  2B8F A;  1NMF A;  3VR6 A;  4JI0 Q;  4IOA A;  5C0X I;  2R61 A;  3ND8 A;  1WCM H;  4DPG A;  2NB0 A;  4DV2 Q;  3C1F A;  4DAV A;  1O7Y A;  2FHT A;  3E5S A;  1Y8P B;  2PNR C;  1LAC A;  4U67 3;  4A3B G;  2IX3 A;  1PH9 A;  3L9A X;  4C3I B;  2Q2T A;  3OPO A;  1QZH A;  4OO1 I;  3SK4 A;  1HJP A;  1VQJ A;  1YZ6 A;  1JCK B;  5IYB H;  1OXS C;  1LLR D;  1SEB D;  1A2U A;  3QJY A;  1LT5 D;  2N55 A;  3CCQ A;  2LXK A;  2UUB L;  1UAP A;  2A5H A;  2B2Y A;  3NTK A;  1Z9F A;  2F0H A;  2Q2I A;  5M3M H;  4J6H A;  4HJ9 A;  3HOV G;  3IFT A;  2ZXO A;  5E4W C;  1XWE A;  4FXK C;  1TY2 A;  5T1I A;  1WTH A;  1WTV A;  1V9P A;  5C4H A;  5K5P A;  4IN3 A;  4DR2 Q;  1PTO C;  3RZD H;  3PSI A;  1QOH A;  2YTV A;  3AFP A;  4CHT B;  4IJL A;  5C4J H;  3G71 A;  3CU7 A;  1BVS A;  2F0Q A;  2WAQ G;  4JI6 Q;  5KNB A;  3C2P A;  1VQA A;  1Y1V B;  2XWJ B;  1ML0 D;  1A3V A;  3IAY A;  2PCF B;  4BBS H;  1VQ4 A;  1BDO A;  1L1O A;  3UI2 A;  1PV4 A;  4RH6 A;  4LF6 L;  3W1G A;  3W3A A;  3FRP B;  3KF8 A;  5COY A;  4B3R Q;  1WCM B;  4P2C B;  2ENB A;  1LTA D;  2EY5 A;  2A69 D;  1Q3L A;  1B4O A;  3CCL A;  3QOL A;  3T56 B;  5T1G A;  1DD2 A;  1WTR A;  1MIU A;  4RGO S;  1GUW A;  1RTN A;  1XMO L;  5EAY A;  2D2C C;  3DMU A;  4QCL A;  1XXG A;  3QG1 A;  1SYF A;  1G6P A;  2ID0 A;  5AJ3 L;  1VQE A;  3CC2 A;  4HCS A;  3PV0 A;  2F0I A;  1K83 H;  5M5Y H;  2WKC A;  4K6D A;  4XT1 B;  3J80 E;  1VQ6 A;  2O2L D;  2NN6 H;  1SJH D;  1S5E D;  5E3F A;  4IFD H;  3SK8 A;  3NSW A;  4ZKB B;  2B2Y C;  5HGT A;  1SNP A;  3MAQ A;  4GOP A;  4HMI A;  1SNC A;  3E9I A;  1RCV D;  3HOU B;  2K04 A;  4DK6 C;  1EIH A;  3GDE A;  2B3G A;  2CVR A;  2RDH A;  2MQH A;  4DKA C;  2HT1 A;  1Z6H A;  2JA8 B;  3S1M B;  4OEM B;  1D8L A;  1FGU A;  5CV9 A;  1UEA B;  1EY0 A;  1SLJ A;  3HOW B;  4X6A H;  2CW0 C;  3W2D A;  3KOJ A;  1NJI C;  1JWM D;  4DA2 A;  4JV5 Q;  2K5D A;  4AH6 A;  4UAI A;  2MGS A;  5GAG C;  4R8N A;  1EYA A;  4DV3 Q;  2QGQ A;  5C3E B;  3PUZ A;  1L1O C;  1F9P A;  4AQY Q;  1EY4 A;  4LFB L;  4Y7N B;  1J9O A;  5C4X G;  1QCB D;  2F0G A;  3A8I E;  1L0Y B;  1I5F A;  2IX1 A;  2NVT H;  4F87 A;  1G29 1;  4RGT A;  5D3I B;  1E3P A;  5KIX A;  2E74 C;  4KKU A;  2E2I H;  2MO0 A;  4GNX A;  2VY3 A;  2JQO A;  1QWY A;  3I72 A;  2F03 A;  2DN8 A;  2YU9 H;  2JSO A;  5C0X H;  1KTK A;  4G7Z C;  1CA6 A;  2A6E C;  3J7A V;  4HAE A;  2R7Z H;  2K4K A;  4C3J G;  3HGB A;  4F8M A;  4HTH A;  2KCN A;  5KGU A;  3OWE B;  5ELE A;  1B70 B;  3K5N A;  3G6J B;  5IYD G;  1G2S A;  2K6A A;  2KED A;  4YHH Q;  2MHV A;  1TKW B;  3Q24 A;  2HCI A;  4XT3 B;  4GOP C;  4OO1 H;  2VQE Q;  4B3T Q;  1H9R A;  1QVF A;  3KLR A;  3JAM i;  3GTJ B;  2A6H C;  2QA4 A;  3D6W A;  3H94 A;  3CXC A;  1AZP A;  3R2I A;  5J22 A;  4FF1 A;  5IP9 H;  5HUR A;  1SDF A;  1HTP A;  5JAV A;  2R7D A;  4DU9 A;  4A3E G;  4WRD A;  5BR8 L;  3RZO H;  4XQN A;  1HZB A;  1RIP A;  3PUV A;  4ODG A;  1K9M C;  4JBM A;  3EJI A;  5I6W A;  4ULL A;  3CME A;  3KF6 B;  4XIG S;  4A3F G;  2K28 A;  1HQR D;  3FKI H;  4A75 A;  3MXU A;  1H9S B;  1HFN A;  1O80 A;  4N9T A;  1GVP A;  4IO9 A;  3RNU A;  2NVY B;  2UUB Q;  2E2I B;  4A4I A;  1JMC A;  4HED A;  4GNX C;  1EIF A;  1I4H A;  1TT2 A;  2MUY A;  1T5X D;  5K36 G;  1C9O A;  3Q8D A;  1GHK A;  1ET9 A;  1QJO A;  4KD4 A;  4ABN A;  4I65 A;  1STB A;  1X32 A;  4X66 L;  3D31 A;  1PTO F;  1BXT A;  5FO7 B;  2DUD A;  3Q6S A;  5C44 B;  4IPD A;  4A3K B;  2EYJ A;  2CWP A;  1DYQ A;  1ZYR D;  3Q22 A;  4BY7 H;  1D5Z C;  3URY A;  4R4O A;  1A3U A;  2XVS A;  3GQB A;  4N8X 1;  1MKH A;  4NP5 A;  1EY9 A;  2G9H D;  5FK9 C;  4A3C H;  3F2C A;  3LX0 A;  1PYB A;  1YIT A;  4JG2 A;  3GV3 A;  4LF6 Q;  4GS3 A;  1JC7 A;  2B2T A;  1EEI D;  4C56 C;  2Q8T A;  2TMP A;  2R7Z G;  3S2H H;  3KLS A;  4MHE A;  1U4R A;  4KK7 A;  3O13 A;  4HIM A;  1YNX A;  2R92 H;  4F88 A;  2HDM A;  2NTT A;  4ZYS A;  3BZK A;  2ZT9 C;  3CD6 A;  1SYC A;  1XMO Q;  3BVM A;  3NTH A;  4RHS A;  5L37 A;  1LTG D;  5JPM C;  2ATW A;  1G2T A;  1K8A C;  5AJ3 Q;  1QNK A;  3PO3 B;  3FKI B;  1GUN A;  4JBJ A;  4YY3 L;  2KBN A;  2OTL A;  5KND A;  2BE5 D;  4MNO A;  3K57 A;  3RN2 A;  1GM5 A;  4LF9 L;  1SXT A;  1GHJ A;  1MD2 D;  4OIK A;  4K14 A;  4ZAI A;  1B9N A;  1SFO B;  3AQQ A;  5A2Q L;  2JA6 B;  3V05 A;  1EY7 A;  3J7Y W;  3NPP A;  3BZC A;  4EQ5 A;  5F2D A;  3EBE A;  1PRT B;  2ALY B;  1MJE A;  2NVX H;  4RKB A;  1JJC B;  1PRT D;  2FFK B;  4JI1 L;  3UDI A;  2PW5 A;  5DNF A;  1B7Y B;  1O78 A;  3PO2 H;  1WD1 A;  1PXU A;  2HD3 A;  3FMC A;  4JPB W;  3SK5 A;  2KOL A;  3FHW A;  1IL8 A;  1OXT A;  3CRL C;  4FDB A;  1ENF A;  4LFB Q;  1YJW A;  3OMG A;  4UY8 C;  2B2T C;  1DOL A;  2F0E A;  1NTG A;  2F3W A;  3J81 L;  4LUO A;  2R92 B;  1MSH A;  1YBY A;  1X3P A;  3NWS A;  1CTM A;  2F0N A;  2XGT A;  2FJ2 A;  3MXN A;  3S9W A;  1TS5 A;  1AE3 A;  3ULL A;  3TQY A;  1VF5 C;  4A3M G;  4BA1 I;  3T53 B;  3I8Z A;  2CQO A;  1K0S A;  1CA5 A;  2OEO A;  3K7A H;  1Y69 U;  4J15 A;  4OL7 A;  3HOX H;  2J7Z A;  4IPH A;  4J1M A;  1NY4 A;  1FYC A;  2OF1 A;  1UUP A;  3A56 A;  2EYH A;  1E2W A;  4QL5 A;  5J3B A;  2A68 D;  1BCP B;  4R4C A;  4U68 A;  4LUZ A;  5JJI A;  3M3Y B;  4ZCK A;  1W2B A;  2C35 B;  3DXJ C;  3SGI A;  4AYB G;  4XXE A;  1BCP D;  3F1Z A;  3M4Q A;  2JA7 H;  1SAP A;  4OGQ C;  5FLX c;  3OTO L;  4B08 A;  3K81 C;  1PVO A;  2E2J B;  3ERO A;  1CT1 D;  1LTR D;  2F4V L;  3IRB A;  5ELO A;  3U58 A;  4ZLT F;  1SNQ A;  4BY1 G;  1CFM A;  5BR8 Q;  1CK1 A;  2C5C A;  1U4L A;  3GTP H;  4O0A A;  4C2M H;  3S1R B;  1Q81 C;  2PZT A;  3KLS X;  3GTM H;  2WKD A;  4PNY A;  3M7N A;  3MZ5 A;  1U0L A;  4L6T B;  1EOV A;  4A76 A;  5FLM H;  2F1M A;  4N9P A;  1KAW A;  1ASZ A;  1A62 A;  2AUJ D;  3EN2 A;  3HKZ G;  2EJF C;  1YNN D;  5EPK A;  4JW0 A;  4NXM L;  3QOJ A;  1J8I A;  1Y14 B;  2MFI A;  2ICI A;  1CHQ D;  4BBR G;  3DUZ A;  3K80 C;  1VQG A;  1UEB A;  3P20 A;  2VW9 A;  3OW2 A;  4X62 L;  5IGB A;  1KAB A;  3G6E A;  1Y8O B;  4X3S A;  3GTK B;  1WI5 A;  1MJC A;  3J81 i;  3I91 A;  4ILW A;  2XRS D;  4X66 Q;  2DGY A;  3F2U A;  4APV A;  3HOZ H;  3EFX D;  1C48 A;  1VQ5 A;  4LNQ A;  4J8Q A;  1F9R A;  1KDB A;  2QDB A;  2R7F A;  4JBW A;  1K3B C;  3CQZ H;  3H0G H;  2SNS A;  5DM6 3;  1VQL A;  1FL0 A;  1PH3 A;  5LMU L;  1R9T H;  4GZY C;  2KUM A;  2NWG A;  1RL2 A;  1XTC D;  3S1Q B;  4YWK A;  3MEH A;  2ZTD A;  4WJ4 A;  2RHS B;  1F9S A;  1WFQ A;  4OON A;  4DR6 L;  3DEO A;  1V1P B;  5FKA C;  5M3F H;  1H95 A;  1HR0 L;  3GTP B;  1EIG A;  4M8A A;  5ELN A;  1GJX A;  4OWX B;  4RG1 A;  5CC4 A;  3CC7 A;  1BKB A;  3S24 A;  3MA2 B;  1RTO A;  4KTA A;  4YY3 Q;  4CGY B;  5ELB A;  2Z4I A;  1HFG A;  1STE A;  1A3T A;  3M9B A;  4R4T A;  4LF9 Q;  1LT3 D;  2BH2 A;  2EYF A;  1SSO A;  2JJQ A;  4A3D G;  3I4N H;  4LF5 L;  3C3L A;  2LY7 A;  3SVM A;  3FEW X;  3AB9 A;  2KQ3 A;  1GUG A;  4ALP A;  2OQK A;  1JWU D;  3U4V A;  5LL6 X;  1XPR A;  5JOB A;  4LFC L;  4JI1 Q;  5KYI A;  3J7A F;  4ZUJ A;  4FO2 A;  1I6V C;  1VQN A;  1U5K A;  1ASY A;  2RDG A;  2AWO A;  3HOZ B;  1IKM A;  1PH4 A;  4LJZ C;  4H02 A;  3WOF A;  4KI0 A;  4RCN A;  4A3J B;  1ESR A;  2Z4H A;  3L0O A;  2RVL A;  3H0G B;  1TWF B;  1X6O A;  4A3I H;  4C3I H;  3MVV A;  3MFY A;  5HY6 A;  3ZJY C;  3G48 A;  4DAM A;  4A3G G;  1AE2 A;  3TN2 A;  1STY A;  3DWQ A;  3L3O C;  2F0T A;  2E75 C;  3HOY B;  1VQM A;  3X3M A;  1C0A A;  4DXG A;  1VMP A;  4QY7 A;  1PH6 A;  1AH9 A;  3SHL A;  1GUS A;  1L0W A;  3N6R A;  4H7B A;  3KFU A;  2JA5 G;  1YIJ A;  4JI5 L;  1N9W A;  2Q8R E;  2QDL A;  3K0Y A;  1S40 A;  2Q2U A;  5G3L D;  1X3F A;  1F2M A;  2O4X A;  1PZJ D;  2GVB A;  2E76 C;  3RN5 A;  1XPO A;  2Y0S G;  1NSN S;  3MXG A;  1Y1W G;  3GTO B;  4B9X A;  4POG A;  2MO1 A;  4C3H B;  1STH A;  1Y1V H;  2Z8L A;  3DHQ A;  4LF8 Q;  2JP1 A;  1BBU A;  1EWH A;  5FO8 B;  4OWW B;  2A8V A;  1I50 H;  1NAP A;  5IGE A;  4RKL A;  4BWG B;  1UE5 A;  2K5V A;  4JVZ A;  3OTO Q;  2H4O A;  1QVC A;  3HZX A;  2F4V Q;  2ZM6 L;  1A2T A;  3S16 B;  4A3B B;  2IWH A;  1TS3 A;  1HXY D;  3H09 A;  4IUV A;  2RSN A;  1BR9 A;  1F77 A;  1Q8I A;  3Q23 A;  1H9J A;  2WP8 J;  4A3I B;  5EKK A;  1I6H B;  3D4D A;  1QUQ A;  4IJH A;  4DV7 L;  5E7N A;  2F0W A;  2PMZ B;  4DV1 L;  3FPP A;  1F9Q A;  4P75 A;  3HOV B;  4NXM Q;  4HSV A;  3CPF A;  1JE4 A;  1XMQ L;  2JE6 I;  1S5D D;  3PUY A;  4I7A A;  3HOU H;  3KDF B;  5C6A A;  4X62 Q;  3J80 L;  2JA8 H;  3S1M H;  3RD4 A;  3N52 A;  1EYD A;  3I90 A;  4NMZ A;  2MNA A;  4PQX A;  2JEA I;  2VUM G;  1EWC A;  4MZ9 A;  3HOW H;  4IPG A;  3CP0 A;  4LK1 C;  1Q8K A;  5CV5 A;  1TR5 A;  5BN5 A;  3I4M H;  3SR1 A;  1B50 A;  4K5X A;  2RCF A;  2Z0S A;  3TP7 A;  3AYH B;  4KJN A;  4A3L G;  1D6E C;  2XNA C;  1EY5 A;  1MHW C;  1EU4 A;  4L5Q A;  4L63 B;  5C3E H;  3HS0 C;  3V96 A;  4G7O C;  2ZJP A;  4Y7N H;  1I50 B;  5LMU Q;  4RA8 A;  4YCV A;  3H91 A;  1AFP A;  2QF7 A;  1BO0 A;  2EQS A;  3NWT A;  1EQR A;  1YHA A;  3SK6 A;  3L2P A;  1XNR L;  4DR6 Q;  2R93 G;  1SNO A;  3UDG A;  1DZ1 A;  1N8R C;  1U9R A;  4CKB A;  4RMF A;  3VDY A;  3NEL A;  2N78 A;  4TQU S;  1KNA A;  1C8C A;  2O5J C;  1YHB A;  2OQ0 A;  1ILP A;  2L0C A;  3VA5 A;  1B3A A;  1EQQ A;  4KHV A;  5C5L A;  1CKN A;  1QE6 A;  3K5O A;  4QQB X;  3STB C;  2D0P A;  5FJ8 H;  1FVI A;  2PZU A;  1WCM G;  2HQL A;  2UUC L;  2F0K A;  2EXD A;  4LF7 L;  2K5W A;  2RF4 A;  3HG9 A;  1EYC A;  3GTJ H;  3KYH C;  1V1Q A;  2EVB A;  1B2T A;  4K6L A;  1ROD A;  3WOE A;  5I9P A;  4A93 H;  1U4P A;  4P72 A;  1CHP D;  1FNW A;  3UDX A;  1JIC A;  1K28 A;  2ZJR A;  1UE7 A;  4CKE A;  4MN3 A;  1TWA B;  1HRJ A;  4LFC Q;  4FF4 A;  3I4M B;  1TWC B;  3S2D B;  2JK8 A;  5A35 A;  5IYB G;  4IUP A;  2DY8 A;  3PGZ A;  1SE2 A;  2F0J A;  1LO5 D;  4K0K L;  3NBI A;  5C4X B;  5M3M G;  1PRT F;  3CCV A;  4YCU A;  4EQN A;  2NYZ D;  2I07 B;  1DCZ A;  3S14 B;  2XRQ D;  4X3T A;  1G51 A;  2Z1C A;  3VR4 A;  2NVY H;  4BXX H;  2N49 A;  5EBD A;  1IZ6 A;  4K2L A;  3I73 A;  1A6X A;  1NR2 A;  2NZ1 D;  2K52 A;  1Y8N B;  1HQM C;  3VR3 A;  4X64 L;  4HR7 B;  2EYL A;  1LYL A;  4ZK9 B;  2AQ3 B;  3I55 A;  4BBS G;  1D5X C;  1HUM A;  2F0V A;  3BDO A;  3NP8 A;  2CKZ B;  4NKL A;  4WFN 3;  5C44 H;  4A3K H;  3ULP A;  1SMY D;  5CGK A;  5AFW A;  4GN4 B;  3V2T A;  1H9K A;  3GTQ B;  1K8G A;  4IUQ A;  5TSS A;  3JAM E;  1KL9 A;  1SRO A;  5I2Y A;  2OCE A;  4G7H C;  1WTQ A;  1LTT D;  4DV4 L;  3U9O A;  2ICE C;  1M90 C;  1J5E L;  2FXQ A;  1HNZ L;  5IP7 H;  4A93 B;  1OXV A;  1QB5 D;  3BU2 A;  1I4R A;  5CMD A;  2UUA L;  2Z6B A;  4A3E B;  1MI2 A;  4C1N K;  2ZM6 Q;  3NE5 B;  2WFW A;  1JWS D;  2NN6 G;  5ELD A;  5I4D A;  4A3F B;  4IFD G;  2GVA A;  3TS0 A;  4LWC A;  1HH2 P;  1ESF A;  2B29 A;  2HIX A;  3MXP A;  5LMN L;  4DV7 Q;  3PO3 H;  2R3Z A;  2EY6 A;  4DK0 A;  4DV1 Q;  3HKS A;  2DY7 A;  2BA0 A;  1DOK A;  3TBI B;  4ZQ3 A;  1KLU D;  2NZH A;  4H0L C;  1XMQ Q;  1SFO H;  3KUP A;  2JA6 H;  4IFD J;  2WAC A;  3G7L A;  5NUC A;  1IYJ B;  1NE3 A;  4POF A;  3W1B A;  1VQ7 A;  1K8M A;  3PUW A;  5IGD A;  3J81 c;  4FXD A;  1OTC A;  3CAM A;  1L2F A;  1S5B D;  3LGJ A;  2KEE A;  2L1B A;  4IAL A;  2PYK A;  1VQK A;  3UDF A;  5D3D A;  3I3C A;  3OHX C;  4NW2 A;  4BXX G;  1Q7Y C;  3BS1 A;  1TQO A;  2CHB D;  3S1N B;  3T16 A;  2Q2H A;  1NMG A;  1TVX A;  1DOM A;  5D14 A;  5C0X G;  4IUN A;  2K03 A;  1VQ9 A;  4UPA A;  1VQH A;  3T1H L;  4CJ0 B;  1O7L A;  5CBE E;  2YV5 A;  5E1F A;  1LTB D;  2ZXP A;  1XNR Q;  4E6I A;  4R4I A;  3IFD A;  1SYE A;  2M9V A;  4HJ5 A;  1A0I A;  1JOQ A;  1HHV A;  4DAP A;  1PFM A;  2A69 C;  4JI8 L;  4CJ1 B;  3PF5 A;  1E24 A;  4JI4 L;  1W6K A;  3JC6 6;  1Q86 C;  3BJU A;  4OO1 G;  4FYD A;  2F0O A;  1BUV T;  4JYA L;  1R4P B;  2GA4 B;  1SBB B;  2NVQ B;  2Z6K A;  2ZXR A;  3TZU A;  2B2W A;  3EVQ A;  5COR A;  2H1E A;  2WV6 D;  3G4S A;  5IP9 G;  3DEP A;  4LF7 Q;  1CQV A;  5CV6 A;  1IXR A;  3M3Y H;  2VB2 X;  1JQY D;  2RBM A;  1S72 A;  1SRU A;  3FDT A;  1I3Q B;  4EGV A;  2EY2 A;  5CYU A;  4OIJ A;  2X69 A;  3ICE A;  2PZW A;  3FKI G;  3MWY W;  1YNJ D;  4AIM A;  2E2J H;  3RLO A;  1EZ6 A;  2F0U A;  3K59 A;  2DJF C;  3T1Y L;  2EY1 A;  3OYY A;  1HPC A;  1GUT A;  3CW2 C;  5IGF A;  4X3K A;  3S1R H;  4L5R C;  4K0K Q;  1JJ2 A;  1SYB A;  3KBG A;  2AQ1 B;  2V1C C;  1D1K A;  1PZK D;  3R93 A;  4DAY B;  1N34 L;  4V19 0;  2KA7 A;  2B63 B;  1TS4 A;  4DK1 A;  5CV4 A;  3TZD A;  2VL6 A;  1E2V A;  1PFS A;  1A15 A;  2KHJ A;  1X56 A;  2K7V A;  3KF6 A;  1E7Z A;  1VQ8 A;  4A3M B;  2CH4 W;  4BY7 G;  2EE1 A;  2QEJ C;  4V0B A;  4X64 Q;  1B3Q A;  1H9S A;  4LF4 L;  4GLV B;  5JJL A;  2OWO A;  1N36 L;  3GTK H;  1CZG A;  1SMX A;  4A3C G;  2RCN A;  5EGT A;  4MTN A;  1SJE D;  2Z6K C;  2AWN A;  2B2W C;  1II3 A;  2WB1 B;  1ENA A;  4TRD A;  2HIV A;  1Z47 A;  1DM0 B;  1CSP A;  2R92 G;  1VQI A;  2IT1 A;  4B3S L;  4AYB B;  3DLL A;  3OIQ A;  2LMC B;  4DV4 Q;  3NBH B;  1J5E Q;  4HIO A;  5KRU A;  3KLW A;  1HNZ Q;  1IW7 D;  4KY5 A;  5A2Q E;  1RF2 D;  2UUA Q;  4B3M L;  3S1Q H;  1WD0 A;  4PG3 A;  4BY1 B;  4LFA L;  3GO5 A;  3EQL C;  2WB1 E;  2EPB A;  2NBF A;  5I6Y A;  3MTS A;  5GAD C;  4R1J A;  1SE8 A;  1GUO A;  1L0X B;  3AMU A;  1T9H A;  3H15 A;  5D65 A;  4KN4 C;  4AYB E;  5KNC A;  2LSS A;  3A55 A;  2CCZ A;  1ZKO A;  2F4I A;  2FMM A;  1SND A;  5EJW A;  4UHV A;  1KDC A;  4NXN L;  5M9O A;  5LMN Q;  4DR4 L;  1IYV A;  5CR3 A;  2B2U A;  2PQA B;  4BBR B;  3RLF A;  2KVM A;  1FR3 A;  3EA6 A;  4IOC A;  4R4Q A;  2D62 A;  1LTL A;  3PO2 G;  3C1E A;  1X3Q A;  3J81 E;  1CSQ A;  4KMU C;  4HIK A;  3VYR A;  1B53 A;  2PW7 A;  2N88 A;  1DJR D;  4LMQ D;  2BDO A;  3VYU A;  3CKI B;  2BCO A;  4DR1 L;  4K5W A;  1PTO B;  3DWA A;  4GKK L;  1RJT A;  3R3O A;  2X6L A;  1PTO D;  1W3S A;  3J7Z C;  2F0F A;  4A3J H;  1YI2 A;  1HNX L;  4ID6 A;  1EUJ A;  1TWF H;  3SE0 A;  1ZYR C;  2GN5 A;  5M5X B;  3BVG A;  4N8F A;  3EIV A;  4DV0 L;  1Q1B A;  3B6Y A;  1B9M A;  3T1H Q;  1EWI A;  5IIF A;  1U4M A;  1VCI A;  2LS0 1;  2SDF A;  2KHS A;  1RDP D;  3QB3 A;  5JEA H;  1KC8 C;  4G57 A;  5IT9 c;  3HOY H;  2OTJ A;  2HDL A;  1PH5 A;  4JI6 L;  4QUC A;  2RQX A;  4JK1 C;  1BBX C;  3M4O B;  4JI4 Q;  2K05 A;  2B2V A;  4LW1 A;  3IKJ A;  3HOX G;  4DV5 L;  1PH2 A;  1CKM A;  2CFM A;  3I70 A;  2D0O A;  3WDN A;  4JYA Q;  5IYC H;  2LKV A;  1FD7 D;  4JI2 L;  4B3R L;  3CCU A;  1S5F D;  1HNW L;  3A8J E;  2JYO A;  1KLG D;  2F52 A;  2B2U C;  5IGG A;  2JA7 G;  4A3D B;  3GTO H;  1NCV A;  4KY6 A;  4C3H H;  2AHO B;  1PLF A;  2ES2 A;  3PQI A;  2JA9 A;  2BE5 C;  3NHH A;  5I2X A;  1JJG A;  1X3E A;  3CPW A;  5JPN C;  1AP0 A;  1TU2 B;  1WTO A;  5EKL A;  2F3V A;  1O7Z A;  4PZ6 A;  2AUK A;  3S17 B;  1E1O A;  5FLM G;  2L11 A;  1QZG A;  3ERS X;  4EQP A;  3S16 H;  3E9H A;  4A3B H;  4RAU C;  3J80 c;  4IUU A;  3T1Y Q;  2BOS A;  1HA5 A;  3J81 j;  5E4X A;  1PRT C;  3TRZ A;  3ND9 A;  2CW0 D;  4A3G B;  1WVL A;  1IKL A;  3BG3 A;  4HID A;  1I6H H;  1EY6 A;  1ILQ A;  1JB3 A;  1M8A A;  1N34 Q;  1CKO A;  2RHQ B;  1L1O B;  3CHB D;  1VDZ A;  3HOV H;  2K50 A;  2N3S A;  3KF8 B;  1EU3 A;  2AKW B;  3OWF A;  4JV5 L;  3QR8 A;  3A74 A;  4Q5V A;  2AMC B;  1G91 A;  4X65 L;  3HOZ G;  1AEX A;  2JA5 B;  1LTI D;  5BN3 A;  4OXP A;  4LF4 Q;  1LTS D;  2L4N A;  2B2V C;  5IY0 A;  1GO3 E;  1N36 Q;  5GAE C;  3H0G G;  1A8V A;  2KCM A;  2Y0S B;  3LWE A;  1WYD A;  3HRZ C;  2VQF L;  4QMG A;  4JCV E;  1Y1W B;  2A6E D;  3ULJ A;  4HN7 A;  1WTP A;  5LL6 S;  1IBM L;  1WOC A;  4B9W A;  4UP7 A;  2HCC A;  5FLX E;  4B3S Q;  3H3V I;  1N33 L;  2K1B A;  5M3F G;  3C46 A;  4GOP B;  2L55 A;  4RWS C;  1I4G A;  4GLA C;  4OEL B;  1K73 C;  4DF7 A;  5EBC A;  1TWH B;  4PZ7 A;  1WTW A;  4GKJ L;  3OSO A;  3CCJ A;  1FNU A;  4R8I A;  4B3M Q;  1CM9 A;  4LFA Q;  3WWV A;  2A6H D;  2I5L X;  3T51 B;  2IJ0 A;  2E5L L;  2D9U A;  2UXB L;  3BZD B;  2B39 A;  2F0S A;  1BCP C;  5CV8 A;  3K58 A;  3AEV A;  3A0J A;  3M85 A;  2JEB I;  3U9S A;  3K5L A;  1J6Q A;  2M2L A;  3AFQ A;  3GV6 A;  1IL2 A;  2OXP A;  4YIJ A;  4X3U A;  3E6Z X;  4KD3 A;  3ONA B;  3I4N G;  5GQO A;  4NXN Q;  1STA A;  1CQF A;  3NTI A;  4DR4 Q;  1P16 A;  5FOB B;  3GTG B;  1V43 A;  1RHP A;  1V1P A;  1M1K C;  1JOK A;  1D7Q A;  2KJX A;  4FP5 D;  4ME3 A;  4GLX A;  4KY7 A;  1VQB A;  3OOC A;  1PH7 A;  3RLN A;  4JI3 L;  2XIW A;  1VMC A;  2KCC A;  5IOC A;  2L5T A;  1BNZ A;  4L5S A;  4GNX B;  3K6O A;  1YNN C;  2VUM B;  1I4X A;  4NPS A;  1BQQ T;  2PMZ E;  1PH1 A;  3I4L A;  4A3I G;  4K8I A;  4C3I G;  2WAQ B;  1TWA H;  3LNN A;  1DXM A;  4TSS A;  4CDC C;  4HSP A;  2IHF A;  1EYG A;  4DR1 Q;  1TWC H;  3S2D H;  2Q8I B;  4JOI C;  3W5O A;  2LFN A;  2RDF A;  2EYO A;  3TME A;  2C9O A;  5IOD A;  4GKK Q;  4CDD C;  1TY0 A;  2IHE A;  2TSS A;  1TWG B;  1HNX Q;  5C4X H;  4PZ8 A;  1AZQ A;  1LT6 D;  3ER0 A;  1D1I A;  3P1H A;  1QG7 A;  5IT9 E;  2BDN A;  4DV0 Q;  2WAQ E;  3S14 H;  1FNV A;  2IPK D;  1VQP A;  2R93 B;  3SXH A;  4XQJ A;  2B8G A;  3M4Y A;  3PIP A;  4KV6 A;  4LAA A;  1SE4 A;  4DR3 L;  1HR0 Q;  2IW3 A;  4C3J H;  3GTL B;  1C7Y A;  5EQ0 A;  1F2L A;  1RD9 D;  2XTI A;  1LM0 A;  4F7X A;  1Y1V G;  2F0L A;  4DV5 Q;  1IYU A;  3QWN A;  4H13 C;  4JI2 Q;  2A19 A;  2QW7 A;  5EPJ A;  1SE3 A;  5IYD H;  1KQS A;  3VR5 A;  4PMB A;  1HNW Q;  5H1S E;  1JOR A;  1XTD A;  2K5N A;  2IL8 A;  2VZA A;  5IGC A;  3CCM A;  1VQO A;  1CZW A;  3GTQ H;  1ICF B;  4JI7 L;  4LF5 Q;  1JOO A;  1PYS B;  4TKO B;  1KAA A;  3D0F A;  3GP7 A;  2K5Q A;  1MBY A;  2V4D A;  4PMC A;  2F0D A;  2K33 A;  1EQV A;  1CUK A;  4DV6 L;  4HMJ A;  4RGM A;  3JAM L;  4A3E H;  2EJG C;  1IHZ A;  5FO9 B;  3CMA A;  3BVZ A;  4DNT B;  1XYI A;  3J80 i;  2D5D A;  4LUV A;  4K8J A;  2K5H A;  3M7G A;  3IL8 A;  5M3M B;  4DUY L;  4A3F H;  1X9N A;  3A5U A;  1I4Q A;  1QNU A;  1ET6 A;  3PMF A;  3D4W A;  3HOU G;  1YEZ A;  2JA8 G;  3RZD B;  3PIP 3;  4CKC A;  1EFI D;  5IWA L;  5C3X A;  2DJG C;  5EPL A;  1KDA A;  3A54 A;  5C4J B;  3H3V H;  3HOW G;  5K36 H;  1IBK L;  2QKI C;  4X65 Q;  1TII D;  3I4M G;  3HEJ A;  1QIL A;  4C3J B;  1X54 A;  3Q0A A;  1X3G A;  4BBS B;  2EJM A;  1D2B A;  4HCE A;  3A5Z B;  3BYY B;  2SEB D;  3PF4 A;  2RKS A;  4JI5 Q;  3DM1 A;  1SR3 A;  5C3E G;  2VQF Q;  2AQ2 B;  3MFG A;  4UP8 A;  3KDF A;  1H9M A;  3E3X A;  2KHI A;  2O5I C;  3D3R A;  1IBM Q;  3ERQ A;  1N33 Q;  1XPU A;  3S1N H;  4PMW A;  4QJF A;  4IUR A;  2UXD L;  1K83 B;  5M5Y B;  3R8B A;  4GKJ Q;  3A7A B;  1JB7 A;  3VR2 A;  3PUX A;  4DR5 L;  3I56 A;  3P75 A;  2E2H H;  2E5L Q;  4WJ3 M;  2UXB Q;  1Z7T A;  4KLK A;  2ASB A;  2A1A A;  1B1Z A;  4CDF C;  3A8K E;  5FJ8 G;  4YWM A;  1BCP F;  1YJ9 A;  1LAB A;  2NZO A;  4DUZ L;  3VA7 A;  3RUZ A;  1YVC A;  3K5M A;  1EL0 A;  1E22 A;  4EVO A;  2NVQ H;  4UP9 A;  4KHZ A;  2HUG A;  4A93 G;  4H44 C;  4ME5 A;  1A63 A;  3H6M A;  2UXC L;  4JI3 Q;  4BS9 A;  2XN9 C;  4WOR A;  1TXY A;  1FGB D;  4PV1 C;  4WJW A;  5DM7 3;  4R9W A;  1ONL A;  1GD7 A;  1PFN A;  3RMH A;  3MXN B;  3RR5 A;  1I3Q H;  4QUF A;  1MGS A;  2CQA A;  2N8N A;  3VYS A;  3NK9 A;  2MP1 A;  3BDC A;  2YTX A;  4HJ7 A;  2NVT B;  2SNM A;  5ELC A;  3TS2 A;  1AW7 A;  4NDX A;  1ICW A;  2EOT A;  4IPC A;  4O42 A;  1STN A;  1UE6 A;  1WTX A;  1K3R A;  2H5X A;  2HHH L;  2NTS A;  1LT4 D;  3D6C A;  2YU9 B;  1UNS A;  2OT2 A;  3NXW A;  3J7A 5;  4OX9 L;  4KHP L;  1BOS A;  3P7J A;  2R7Z B;  2PPB C;  1VQC A;  4TVA B;  2VNU D;  2B63 H;  4IZ8 A;  4YCW A;  1XNQ L;  3MEF A;  2P5Z X;  4KJO A;  2E2H B;  4DGZ A;  4K2K A;  5C44 G;  4DN4 M;  4A3K G;  4A3M H;  4DR3 Q;  1B44 D;  3K7U C;  1Q90 A;  3KBX A;  1CI3 M;  3T13 A;  1HUN A;  3F8T A;  4L5T A;  1SYD A;  4G4K A;  2VXW A;  4CJ2 C;  1SN8 A;  5C0X J;  3FPU B;  2EYM A;  3E0J A;  3TSS A;  5IP7 G;  3CCS A;  4RGN A;  3NQT A;  1W6J A;  4CBV A;  3RZO B;  3CCR A;  4RFB A;  2UUC Q;  4FXG C;  4JI7 Q;  2EYP A;  1EZ8 A;  5LMN W;  3BDL A;  1OO9 B;  3L7Z C;  3A7L A;  1HZ9 A;  4EX5 A;  2ZTC A;  1UWV A;  1VF7 A;  4DV6 Q;  1G6Z A;  1GKH A;  2I0Q A;  4BY1 H;  1R4Q B;  3PO3 G;  1LUZ A;  1V8Q A;  3D8G A;  2R6G A;  1JR0 D;  4L8J A;  1PA6 A;  2E2D C;  2G5D A;  2JXM B;  2J4X A;  4QB4 A;  1N32 L;  1I94 L;  4DUY Q;  5ISR A;  4DR7 L;  2MJ8 A;  2XWB B;  3I7F A;  4DXF A;  1NNX A;  1S5C D;  5C3W A;  3CC4 A;  2JA6 G;  1EIY B;  5JVH 3;  1P8L A;  1WJJ A;  5IWA Q;  4BBR H;  4XQQ A;  3PIO A;  4MTK A;  4HJA A;  4ZUI A;  3NQI A;  4BY7 B;  2DNE A;  2UU9 L;  1EY8 A;  1SNM A;  1GXD C;  2E8G A;  3AU7 A;  4OWT B;  2QIL A;  1IBK Q;  3UE1 A;  2ZJQ A;  1HTL D;  4BA2 I;  2QEX A;  3U4Z A;  3E0E A;  3U50 C;  5DLQ E;  1E0B A;  2F3I A;  4IUT A;  1HZC A;  1MSG A;  3X3N A;  5EKI A;  3T4A C;  1NUC A;  2PNH A;  2PI2 E;  3S2H B;  3F2D A;  1PTO H;  2EDG A;  3NEN A;  3SEB A;  3OIP A;  5GAH C;  1RKN A;  4Q0F A;  4GN3 B;  2B63 G;  1VS0 A;  4K5V A;  1K0R A;  1O7I A;  1JT8 A;  4XDX A;  2VB3 X;  1G8Z D;  2L9H A;  5G3L F;  4YWL A;  1SMY C;  5M5X H;  2UXD Q;  3K0X A;  1B8A A;  3D4R A;  3M4P A;  5C5M A;  2MPM A;  1IBL L;  3LWU A;  5J39 A;  4Z9C B;  4HJ8 A;  4XYQ A;  2IX0 A;  4DR5 Q;  5C4Z A;  1PZI D;  5CBA E;  1XJV A;  3KJP A;  4P73 A;  5I9O A;  4P74 A;  5ELF A;  2WB1 G;  1FJG L;  1LV9 A;  1PMR A;  3BYT B;  4LF8 L;  3M4O H;  1NR4 A;  4NB3 A;  3PIO 3;  1BBW A;  1Q12 A;  4KKS A;  3HKZ B;  4DUZ Q;  5M5W H;  4JI0 L;  4DK3 C;  2NVX B;  1TS2 A;  5JVG 3;  4KKT A;  1V1O A;  4DV2 L;  4A3D H;  3PO2 B;  3S15 H;  2UXC Q;  1YJN A;  1X65 A;  1PFB A;  3HFZ B;  3HKZ E;  1AN8 A;  1Q82 C;  1KD1 C;  1ENC A;  3CCE A;  3H3V C;  1F2Y A;  1GOZ A;  2FMC A;  3KK7 A;  1EOT A;  2PQE A;  2K01 A;  4XYO A;  4FF2 A;  2F0M A;  3S17 H;  2Z9H A;  1UE1 A;  1PYW D;  2FIN B;  2HHH Q;  1HCZ A;  3QO2 A;  3SDZ A;  4OHJ A;  4KN7 C;  3DM3 A;  1VQD A;  4A3G H;  1I4P A;  1D5M C;  1ZEQ X;  5KEE A;  4OX9 Q;  4KHP Q;  4GN5 A;  1KHI A;  4DR2 L;  2M00 A;  3HP3 A;  4O2D A;  4P71 A;  2CH4 A;  3ZYY X;  1M4V A;  3FVQ A;  1XNQ Q;  2LXJ A;  1NBW A;  3K7A B;  1SYG A;  3HOX B;  1EEF D;  1E2Z A;  5HGQ A;  1HA6 A;  2JA5 H;  1X55 A;  4DAY A;  2BA1 A;  4JI8 Q;  3UE0 A;  4CDE C;  4ZRZ A;  2PI2 A; 
#chains in the Genus database with same CATH homology
 5M5W B;  2JA7 B;  1F2Z A;  5CV7 A;  4DNR B;  3OMC A;  3S15 B;  4I7Z C;  1OXU A;  5KYL A;  4C2M B;  3GTM B;  4FNF A;  2A73 B;  1EQT A;  3TP6 A;  3OW7 A;  4MIU A;  2PO4 A;  2WII B;  2WIN B;  1BF4 A;  1OXX K;  1STG A;  5FLX L;  3CRK C;  5J1Z A;  4XTC S;  3NBH A;  2QCP X;  3NUC A;  4M1U B;  2KEC A;  1YNJ C;  2K32 A;  1ZXT A;  2SOB A;  4DFA A;  2DNC A;  5BN4 A;  3GD7 A;  5DEH A;  4EQO A;  2RSO A;  5LHY 1;  4FF3 A;  3TDQ A;  2YYZ A;  4S3S A;  3ITP A;  2NN6 I;  4FVM A;  3CQZ B;  2F0P A;  4IFD I;  2HQE A;  5DAU A;  1R9T B;  4IQZ A;  3MHB A;  3VYT A;  4ZKC B;  1T5E A;  4O1N A;  4QIW B;  2I46 A;  2XSC A;  3TP8 A;  5M3F B;  3DWP A;  2L12 A;  1C4Q A;  5JEA G;  2J0T D;  1PDQ A;  1XX8 A;  2RA4 A;  2X6G A;  2G9D A;  4C1N I;  5JJZ A;  4RCO A;  3QIA A;  1S4Z A;  2NUC A;  1Q1E A;  2A68 C;  3R2T A;  2EXZ A;  1IW7 C;  5IT9 L;  3TP5 A;  4UDU C;  4RHR A;  3I4N B;  5JEA J;  1K8O A;  4C3H G;  2A74 C;  1DON A;  4QF4 A;  1KNE A;  2EZV A;  3MC0 B;  2B8F A;  3VR6 A;  5C0X I;  2R61 A;  3ND8 A;  2NB0 A;  3C1F A;  4DAV A;  1O7Y A;  2FHT A;  3E5S A;  1Y8P B;  2PNR C;  1LAC A;  4U67 3;  2IX3 A;  3L9A X;  4C3I B;  3OPO A;  4OO1 I;  3SK4 A;  1JCK B;  1OXS C;  1LLR D;  1SEB D;  1A2U A;  3QJY A;  1LT5 D;  2N55 A;  1UAP A;  2A5H A;  2B2Y A;  3NTK A;  2F0H A;  4J6H A;  3IFT A;  2ZXO A;  5E4W C;  1XWE A;  4FXK C;  1TY2 A;  5T1I A;  1WTV A;  5C4H A;  5K5P A;  4IN3 A;  1PTO C;  1QOH A;  4CHT B;  3CU7 A;  2F0Q A;  5KNB A;  3C2P A;  1Y1V B;  2XWJ B;  1ML0 D;  1A3V A;  3IAY A;  2PCF B;  1BDO A;  3UI2 A;  4RH6 A;  3W3A A;  3FRP B;  3KF8 A;  5COY A;  1WCM B;  4P2C B;  2ENB A;  1LTA D;  2EY5 A;  2A69 D;  1Q3L A;  1B4O A;  3QOL A;  3T56 B;  5T1G A;  1DD2 A;  1WTR A;  4RGO S;  1GUW A;  1RTN A;  2D2C C;  3DMU A;  4QCL A;  1XXG A;  3QG1 A;  1SYF A;  2ID0 A;  4HCS A;  3PV0 A;  2F0I A;  2WKC A;  4K6D A;  4XT1 B;  3J80 E;  2O2L D;  2NN6 H;  1SJH D;  1S5E D;  5E3F A;  4IFD H;  3SK8 A;  3NSW A;  4ZKB B;  2B2Y C;  5HGT A;  1SNP A;  3MAQ A;  4HMI A;  1SNC A;  1RCV D;  3HOU B;  2K04 A;  1EIH A;  2CVR A;  2RDH A;  2JA8 B;  3S1M B;  1Z6H A;  5CV9 A;  1UEA B;  1EY0 A;  3HOW B;  2CW0 C;  3W2D A;  1JWM D;  4DA2 A;  2K5D A;  4UAI A;  2MGS A;  4R8N A;  1EYA A;  5C3E B;  3PUZ A;  1F9P A;  1EY4 A;  4Y7N B;  1J9O A;  1QCB D;  2F0G A;  3A8I E;  1L0Y B;  2IX1 A;  4F87 A;  1G29 1;  4RGT A;  5D3I B;  5KIX A;  2E74 C;  4KKU A;  1QWY A;  3I72 A;  2F03 A;  2DN8 A;  2JSO A;  5C0X H;  1KTK A;  4G7Z C;  1CA6 A;  2A6E C;  3J7A V;  4HAE A;  4C3J G;  3HGB A;  4F8M A;  4HTH A;  2KCN A;  5KGU A;  3OWE B;  5ELE A;  3K5N A;  3G6J B;  1G2S A;  2K6A A;  2KED A;  2MHV A;  1TKW B;  3Q24 A;  2HCI A;  4XT3 B;  4OO1 H;  1H9R A;  3KLR A;  3GTJ B;  2A6H C;  3D6W A;  3H94 A;  1AZP A;  3R2I A;  5J22 A;  4FF1 A;  5HUR A;  1SDF A;  1HTP A;  5JAV A;  4DU9 A;  4WRD A;  4XQN A;  3PUV A;  4ODG A;  3EJI A;  5I6W A;  4ULL A;  4XIG S;  2K28 A;  1HQR D;  3MXU A;  1H9S B;  1HFN A;  1O80 A;  4N9T A;  2NVY B;  2E2I B;  4HED A;  1I4H A;  1TT2 A;  2MUY A;  1T5X D;  5K36 G;  1GHK A;  1ET9 A;  1QJO A;  4KD4 A;  4ABN A;  4I65 A;  1STB A;  1X32 A;  3D31 A;  1PTO F;  1BXT A;  5FO7 B;  3Q6S A;  5C44 B;  4A3K B;  2EYJ A;  1DYQ A;  1ZYR D;  3Q22 A;  1D5Z C;  3URY A;  1A3U A;  2XVS A;  3GQB A;  4NP5 A;  1EY9 A;  2G9H D;  5FK9 C;  3LX0 A;  3GV3 A;  1JC7 A;  2B2T A;  1EEI D;  4C56 C;  2Q8T A;  2TMP A;  3KLS A;  4MHE A;  1U4R A;  4KK7 A;  3O13 A;  4F88 A;  2HDM A;  2NTT A;  4ZYS A;  2ZT9 C;  1SYC A;  3BVM A;  3NTH A;  4RHS A;  1LTG D;  5JPM C;  1G2T A;  1QNK A;  3PO3 B;  3FKI B;  1GUN A;  5KND A;  2BE5 D;  3K57 A;  1SXT A;  1GHJ A;  1MD2 D;  4OIK A;  4K14 A;  4ZAI A;  1B9N A;  1SFO B;  5A2Q L;  2JA6 B;  3V05 A;  1EY7 A;  3J7Y W;  3NPP A;  5F2D A;  1PRT B;  4RKB A;  1PRT D;  2FFK B;  2PW5 A;  5DNF A;  1O78 A;  1WD1 A;  1PXU A;  3FMC A;  3SK5 A;  2KOL A;  1IL8 A;  1OXT A;  3CRL C;  1ENF A;  3OMG A;  2B2T C;  1DOL A;  2F0E A;  2F3W A;  3J81 L;  2R92 B;  1MSH A;  1X3P A;  3NWS A;  1CTM A;  2F0N A;  3S9W A;  2FJ2 A;  3MXN A;  1TS5 A;  1VF5 C;  4BA1 I;  3T53 B;  3I8Z A;  1CA5 A;  2OEO A;  1Y69 U;  4OL7 A;  2J7Z A;  4J1M A;  1FYC A;  2OF1 A;  1UUP A;  3A56 A;  2EYH A;  1E2W A;  2A68 D;  1BCP B;  4U68 A;  3M3Y B;  3DXJ C;  4XXE A;  1BCP D;  1SAP A;  4OGQ C;  4B08 A;  2E2J B;  3ERO A;  1CT1 D;  1LTR D;  4ZLT F;  1SNQ A;  1CFM A;  1CK1 A;  2C5C A;  1U4L A;  3S1R B;  2PZT A;  3KLS X;  2WKD A;  4PNY A;  3M7N A;  3MZ5 A;  4L6T B;  2F1M A;  4N9P A;  2AUJ D;  2EJF C;  1YNN D;  5EPK A;  3QOJ A;  1J8I A;  2ICI A;  1CHQ D;  3DUZ A;  3P20 A;  5IGB A;  1KAB A;  1Y8O B;  4X3S A;  3GTK B;  3I91 A;  4ILW A;  2XRS D;  3F2U A;  3EFX D;  1C48 A;  4J8Q A;  1F9R A;  1KDB A;  2QDB A;  4JBW A;  2SNS A;  5DM6 3;  4GZY C;  2KUM A;  2NWG A;  1XTC D;  3S1Q B;  3MEH A;  1F9S A;  3DEO A;  1V1P B;  5FKA C;  3GTP B;  1EIG A;  4M8A A;  1GJX A;  5CC4 A;  3MA2 B;  1RTO A;  4KTA A;  4CGY B;  5ELB A;  2Z4I A;  1HFG A;  1STE A;  1A3T A;  1LT3 D;  2EYF A;  1SSO A;  3C3L A;  2LY7 A;  3SVM A;  3FEW X;  3AB9 A;  2KQ3 A;  1GUG A;  1JWU D;  5LL6 X;  5JOB A;  5KYI A;  3J7A F;  4ZUJ A;  4FO2 A;  1I6V C;  3HOZ B;  2RDG A;  2AWO A;  1IKM A;  4LJZ C;  3WOF A;  4KI0 A;  4RCN A;  4A3J B;  1ESR A;  2Z4H A;  2RVL A;  3H0G B;  1TWF B;  3MVV A;  3MFY A;  3TN2 A;  1STY A;  3DWQ A;  3L3O C;  2F0T A;  2E75 C;  3HOY B;  3X3M A;  4DXG A;  1VMP A;  3SHL A;  1GUS A;  3N6R A;  4H7B A;  2Q8R E;  3K0Y A;  5G3L D;  2O4X A;  1F2M A;  1PZJ D;  2E76 C;  1NSN S;  3MXG A;  3GTO B;  4B9X A;  4C3H B;  1STH A;  2Z8L A;  3DHQ A;  2JP1 A;  1EWH A;  5FO8 B;  1NAP A;  5IGE A;  4RKL A;  4BWG B;  2H4O A;  3HZX A;  1A2T A;  3S16 B;  4A3B B;  2IWH A;  1TS3 A;  1HXY D;  3H09 A;  4IUV A;  2RSN A;  1BR9 A;  1F77 A;  1Q8I A;  3Q23 A;  1H9J A;  2WP8 J;  4A3I B;  5EKK A;  1I6H B;  3D4D A;  2F0W A;  2PMZ B;  3FPP A;  1F9Q A;  3HOV B;  4HSV A;  1JE4 A;  2JE6 I;  1S5D D;  3PUY A;  5C6A A;  3J80 L;  3RD4 A;  3N52 A;  1EYD A;  3I90 A;  4NMZ A;  4PQX A;  2JEA I;  1EWC A;  4LK1 C;  5CV5 A;  1TR5 A;  5BN5 A;  3SR1 A;  1B50 A;  4K5X A;  3TP7 A;  4KJN A;  1D6E C;  2XNA C;  1EY5 A;  1EU4 A;  4L63 B;  3HS0 C;  3V96 A;  4G7O C;  1I50 B;  4RA8 A;  3H91 A;  1AFP A;  2QF7 A;  1BO0 A;  3NWT A;  3SK6 A;  1SNO A;  1DZ1 A;  1U9R A;  4CKB A;  4TQU S;  1KNA A;  1C8C A;  2O5J C;  1ILP A;  2L0C A;  3VA5 A;  1B3A A;  4KHV A;  5C5L A;  3K5O A;  1QE6 A;  2PZU A;  2F0K A;  2K5W A;  3HG9 A;  1EYC A;  2EVB A;  1B2T A;  4K6L A;  1ROD A;  3WOE A;  5I9P A;  1U4P A;  1CHP D;  1FNW A;  1JIC A;  4CKE A;  4MN3 A;  1TWA B;  1HRJ A;  4FF4 A;  3I4M B;  1TWC B;  3S2D B;  5A35 A;  4IUP A;  2DY8 A;  1SE2 A;  2F0J A;  1LO5 D;  3NBI A;  5C4X B;  1PRT F;  4EQN A;  2NYZ D;  2I07 B;  1DCZ A;  3S14 B;  2XRQ D;  4X3T A;  2Z1C A;  3VR4 A;  5EBD A;  4K2L A;  3I73 A;  1A6X A;  1NR2 A;  2NZ1 D;  1Y8N B;  1HQM C;  3VR3 A;  4HR7 B;  2EYL A;  4ZK9 B;  2AQ3 B;  1D5X C;  1HUM A;  2F0V A;  3BDO A;  3NP8 A;  4NKL A;  4WFN 3;  5CGK A;  1SMY D;  5AFW A;  3V2T A;  1H9K A;  3GTQ B;  4IUQ A;  5TSS A;  3JAM E;  5I2Y A;  4G7H C;  1WTQ A;  1LTT D;  3U9O A;  2ICE C;  4A93 B;  1OXV A;  1QB5 D;  1I4R A;  5CMD A;  4A3E B;  1MI2 A;  4C1N K;  3NE5 B;  1JWS D;  2NN6 G;  5ELD A;  5I4D A;  4A3F B;  4IFD G;  1ESF A;  3MXP A;  2R3Z A;  2EY6 A;  4DK0 A;  2DY7 A;  2BA0 A;  1DOK A;  3TBI B;  4ZQ3 A;  1KLU D;  4H0L C;  3KUP A;  4IFD J;  2WAC A;  3G7L A;  5NUC A;  1K8M A;  3PUW A;  5IGD A;  4FXD A;  1S5B D;  2KEE A;  2L1B A;  4IAL A;  2PYK A;  5D3D A;  3I3C A;  3OHX C;  4NW2 A;  3BS1 A;  1TQO A;  2CHB D;  3S1N B;  3T16 A;  1TVX A;  1DOM A;  5D14 A;  5C0X G;  4IUN A;  2K03 A;  4CJ0 B;  1O7L A;  5CBE E;  5E1F A;  1LTB D;  2ZXP A;  4E6I A;  3IFD A;  1SYE A;  2M9V A;  1JOQ A;  1HHV A;  4DAP A;  1PFM A;  2A69 C;  4CJ1 B;  1W6K A;  4OO1 G;  4FYD A;  2F0O A;  1BUV T;  1R4P B;  2GA4 B;  1SBB B;  2NVQ B;  2ZXR A;  3TZU A;  2B2W A;  3EVQ A;  5COR A;  2H1E A;  2WV6 D;  3DEP A;  1CQV A;  5CV6 A;  2VB2 X;  1JQY D;  2RBM A;  3FDT A;  1I3Q B;  4EGV A;  2EY2 A;  5CYU A;  4OIJ A;  2X69 A;  2PZW A;  3MWY W;  1YNJ D;  1EZ6 A;  2F0U A;  3K59 A;  2EY1 A;  1HPC A;  1GUT A;  5IGF A;  4X3K A;  1SYB A;  3KBG A;  2AQ1 B;  1D1K A;  1PZK D;  3R93 A;  4V19 0;  2KA7 A;  2B63 B;  1TS4 A;  4DK1 A;  5CV4 A;  3TZD A;  1E2V A;  1A15 A;  2K7V A;  4A3M B;  2EE1 A;  2QEJ C;  4V0B A;  1H9S A;  1CZG A;  5EGT A;  1SJE D;  2AWN A;  2B2W C;  1II3 A;  2WB1 B;  1ENA A;  4TRD A;  1Z47 A;  1DM0 B;  2IT1 A;  4AYB B;  3OIQ A;  2LMC B;  5KRU A;  1IW7 D;  4KY5 A;  5A2Q E;  1RF2 D;  1WD0 A;  4BY1 B;  3GO5 A;  3EQL C;  2EPB A;  2NBF A;  5I6Y A;  3MTS A;  1GUO A;  1L0X B;  3AMU A;  5D65 A;  4KN4 C;  5KNC A;  3A55 A;  1ZKO A;  2F4I A;  2FMM A;  1SND A;  5EJW A;  1KDC A;  5M9O A;  1IYV A;  5CR3 A;  2B2U A;  4BBR B;  3RLF A;  2KVM A;  1FR3 A;  3EA6 A;  2D62 A;  3C1E A;  1X3Q A;  3J81 E;  4KMU C;  3VYR A;  1B53 A;  2PW7 A;  2N88 A;  1DJR D;  4LMQ D;  2BDO A;  3VYU A;  3CKI B;  2BCO A;  4K5W A;  1PTO B;  3DWA A;  1RJT A;  3R3O A;  2X6L A;  1PTO D;  2F0F A;  4ID6 A;  3SE0 A;  1ZYR C;  5M5X B;  3BVG A;  1Q1B A;  1B9M A;  5IIF A;  1U4M A;  1VCI A;  2LS0 1;  2SDF A;  2KHS A;  1RDP D;  3QB3 A;  5JEA H;  4G57 A;  2HDL A;  4QUC A;  2RQX A;  4JK1 C;  1BBX C;  3M4O B;  2K05 A;  2B2V A;  3IKJ A;  3I70 A;  3WDN A;  2LKV A;  1FD7 D;  1S5F D;  3A8J E;  2JYO A;  1KLG D;  2B2U C;  5IGG A;  4A3D B;  1NCV A;  4KY6 A;  1PLF A;  3NHH A;  2BE5 C;  5I2X A;  5JPN C;  1AP0 A;  1TU2 B;  1WTO A;  5EKL A;  2F3V A;  1O7Z A;  2AUK A;  3S17 B;  2L11 A;  4EQP A;  4RAU C;  4IUU A;  2BOS A;  1HA5 A;  5E4X A;  1PRT C;  3ND9 A;  2CW0 D;  4A3G B;  1WVL A;  1IKL A;  3BG3 A;  1EY6 A;  1ILQ A;  1JB3 A;  1M8A A;  3CHB D;  1VDZ A;  1EU3 A;  3OWF A;  4Q5V A;  1G91 A;  1AEX A;  2JA5 B;  1LTI D;  5BN3 A;  1LTS D;  2L4N A;  2B2V C;  2Y0S B;  3LWE A;  3HRZ C;  1Y1W B;  4QMG A;  2A6E D;  4HN7 A;  1WTP A;  5LL6 S;  4B9W A;  2HCC A;  5FLX E;  2K1B A;  3C46 A;  4RWS C;  2L55 A;  1I4G A;  4DF7 A;  5EBC A;  1TWH B;  1WTW A;  3OSO A;  1FNU A;  4R8I A;  1CM9 A;  2A6H D;  3T51 B;  2IJ0 A;  2D9U A;  3BZD B;  2B39 A;  2F0S A;  1BCP C;  5CV8 A;  3K58 A;  3M85 A;  2JEB I;  3U9S A;  3K5L A;  2M2L A;  3GV6 A;  2OXP A;  4YIJ A;  4X3U A;  3E6Z X;  4KD3 A;  3ONA B;  1STA A;  1CQF A;  3NTI A;  5FOB B;  3GTG B;  1V43 A;  1RHP A;  1V1P A;  1JOK A;  2KJX A;  4FP5 D;  4KY7 A;  3OOC A;  2XIW A;  1VMC A;  2KCC A;  5IOC A;  2L5T A;  1BNZ A;  3K6O A;  1YNN C;  2VUM B;  1I4X A;  1BQQ T;  3I4L A;  4K8I A;  4C3I G;  2WAQ B;  3LNN A;  1DXM A;  4TSS A;  4HSP A;  2Q8I B;  2LFN A;  2RDF A;  2EYO A;  3TME A;  2C9O A;  5IOD A;  1TY0 A;  2TSS A;  1TWG B;  1AZQ A;  1LT6 D;  1D1I A;  3P1H A;  1QG7 A;  5IT9 E;  2BDN A;  1FNV A;  2IPK D;  2R93 B;  3SXH A;  4XQJ A;  2B8G A;  3M4Y A;  4KV6 A;  4LAA A;  1SE4 A;  3GTL B;  2IW3 A;  5EQ0 A;  1F2L A;  1RD9 D;  4F7X A;  2F0L A;  1IYU A;  3QWN A;  4H13 C;  5EPJ A;  1SE3 A;  3VR5 A;  4PMB A;  1JOR A;  2IL8 A;  5IGC A;  1CZW A;  1JOO A;  4TKO B;  1KAA A;  3GP7 A;  2K5Q A;  1MBY A;  2V4D A;  4PMC A;  2F0D A;  2K33 A;  1EQV A;  4HMJ A;  4RGM A;  3JAM L;  2EJG C;  1IHZ A;  5FO9 B;  3BVZ A;  4DNT B;  1XYI A;  2D5D A;  4K8J A;  3M7G A;  5M3M B;  3IL8 A;  1I4Q A;  1QNU A;  1ET6 A;  3PMF A;  3D4W A;  3RZD B;  3PIP 3;  4CKC A;  1EFI D;  5C3X A;  5EPL A;  1KDA A;  3A54 A;  5C4J B;  5K36 H;  2QKI C;  1TII D;  3HEJ A;  1QIL A;  4C3J B;  3Q0A A;  4BBS B;  2EJM A;  1D2B A;  4HCE A;  3BYY B;  2SEB D;  2RKS A;  3DM1 A;  2AQ2 B;  3MFG A;  1H9M A;  2O5I C;  3D3R A;  3ERQ A;  4PMW A;  4IUR A;  1K83 B;  5M5Y B;  3R8B A;  3A7A B;  3VR2 A;  3PUX A;  3P75 A;  1Z7T A;  1B1Z A;  3A8K E;  1BCP F;  1LAB A;  3VA7 A;  3RUZ A;  3K5M A;  1EL0 A;  4EVO A;  4KHZ A;  2HUG A;  4H44 C;  4ME5 A;  3H6M A;  4BS9 A;  2XN9 C;  4WOR A;  1FGB D;  4PV1 C;  4WJW A;  5DM7 3;  4R9W A;  1ONL A;  1PFN A;  3RMH A;  4QUF A;  1MGS A;  2CQA A;  3VYS A;  3NK9 A;  2MP1 A;  3BDC A;  2NVT B;  2SNM A;  5ELC A;  1AW7 A;  4NDX A;  1ICW A;  2EOT A;  4O42 A;  1STN A;  1WTX A;  2NTS A;  1LT4 D;  3D6C A;  2YU9 B;  1UNS A;  2OT2 A;  3NXW A;  1BOS A;  3P7J A;  2R7Z B;  2PPB C;  2VNU D;  4IZ8 A;  4KJO A;  2E2H B;  4DGZ A;  4K2K A;  4DN4 M;  1B44 D;  1Q90 A;  3KBX A;  1CI3 M;  3T13 A;  1HUN A;  1SYD A;  4G4K A;  2VXW A;  4CJ2 C;  5C0X J;  3FPU B;  2EYM A;  3E0J A;  3TSS A;  4RGN A;  3NQT A;  1W6J A;  4CBV A;  3RZO B;  4RFB A;  4FXG C;  2EYP A;  1EZ8 A;  3BDL A;  1OO9 B;  3L7Z C;  3A7L A;  1VF7 A;  1G6Z A;  1R4Q B;  3D8G A;  1V8Q A;  2R6G A;  1JR0 D;  4L8J A;  2E2D C;  2JXM B;  2J4X A;  4QB4 A;  5ISR A;  2MJ8 A;  2XWB B;  4DXF A;  1S5C D;  5C3W A;  5JVH 3;  4XQQ A;  4ZUI A;  3NQI A;  4BY7 B;  2DNE A;  1EY8 A;  1SNM A;  1GXD C;  3AU7 A;  2QIL A;  1HTL D;  4BA2 I;  1E0B A;  4IUT A;  1MSG A;  3X3N A;  5EKI A;  3T4A C;  1NUC A;  3S2H B;  1PTO H;  2EDG A;  3SEB A;  3OIP A;  1RKN A;  4Q0F A;  4K5V A;  4XDX A;  2VB3 X;  1G8Z D;  2L9H A;  5G3L F;  1SMY C;  3D4R A;  5C5M A;  2MPM A;  3LWU A;  5J39 A;  4Z9C B;  4XYQ A;  2IX0 A;  5C4Z A;  1PZI D;  5CBA E;  5I9O A;  5ELF A;  1LV9 A;  1PMR A;  3BYT B;  1NR4 A;  3PIO 3;  1Q12 A;  4KKS A;  3HKZ B;  2NVX B;  1TS2 A;  5JVG 3;  4KKT A;  1V1O A;  3PO2 B;  1PFB A;  1AN8 A;  1ENC A;  3H3V C;  1F2Y A;  1GOZ A;  2FMC A;  3KK7 A;  1EOT A;  2PQE A;  2K01 A;  4XYO A;  4FF2 A;  2F0M A;  1PYW D;  2FIN B;  1HCZ A;  3QO2 A;  3SDZ A;  4OHJ A;  4KN7 C;  1I4P A;  1D5M C;  1ZEQ X;  5KEE A;  2M00 A;  3HP3 A;  3ZYY X;  1M4V A;  3FVQ A;  3K7A B;  1SYG A;  3HOX B;  1EEF D;  1E2Z A;  1HA6 A;  4DAY A;  2BA1 A;  4ZRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...