3I8ZA

Crystal structure of human chromobox homolog 4 (cbx4)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
FAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords E3 SUMO-protein ligase CBX4
publication title Crystal structure of human chromobox homolog 4 (CBX4)
rcsb
source organism Homo sapiens
total genus 8
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i8zA00
1WD0A 1IKMA 1C8CA 1U4LA 1SAPA 2K04A 1NAPA 1AP0A 2JYOA 1X32A 1WTXA 3N52A 2B2WC 2NZ1D 2X6GA 5E4WC 3KBXA 1B50A 1EQTA 1PLFA 1AZQA 1DZ1A 4QUCA 2JP1A 1KNEA 2L9HA 2KEEA 1VMPA 3FDTA 1J8IA 5EPKA 1LV9A 2MGSA 4XT1B 3I91A 2IL8A 2B2TA 2J7ZA 3Q6SA 1M8AA 3ONAB 4HAEA 3MTSA 4IUPA 5T1IA 2KOLA 2K05A 5EQ0A 2DY8A 2B2UC 1MI2A 1EOTA 2XIWA 3UI2A 3QO2A 4X3SA 5EPJA 2HCIA 2R3ZA 1ILQA 3HP3A 1BBXC 1KNAA 1DOMA 1NR4A 2VXWA 4ZLTF 2FMMA 1CA6A 2B2VC 1NCVA 2SDFA 3P7JA 4R9WA 4ZKBB 1A15A 1J9OA 1PFBA 1RJTA 1B4OA 4MN3A 1WVLA 4NW2A 5AFWA 4RAUC 1G2TA 1DOKA 5D14A 1G6ZA 2L11A 2N88A 1BO0A 1B2TA 2KVMA 4HSVA 4DN4M 3I3CA 5DNFA 1ILPA 1B53A 1ICWA 1MSHA 5CMDA 3SVMA 1Q3LA 1QE6A 1WTPA 1JE4A 2MJ8A 4LMQD 5JJZA 1MGSA 1GUWA 1F9QA 1WTRA 3GV3A 4XT3B 1F9PA 1CA5A 1BNZA 1RHPA 1RTNA 1O7ZA 1PFNA 1PFMA 1QNKA 1QG7A 2EPBA 1ML0D 2FHTA 2FFKB 5E4XA 3TN2A 2B2YA 2DY7A 4QUFA 2H1EA 1SSOA 2N55A 4CJ2C 3GV6A 1B3AA 1S4ZA 2HDLA 1WTVA 2X6LA 4RWSC 1HFGA 1WTOA 1U4RA 2B2TC 3I8ZA 1HUMA 2X69A 3G7LA 4ZKCB 4HEDA 1X3QA 1ZXTA 2KUMA 1AZPA 1X3PA 4CJ1B 1DOLA 4UAIA 2K1BA 4OIKA 2KECA 2RA4A 3H91A 3FPUB 3IL8A 3KUPA 1RTOA 4X3KA 4HCSA 1PDQA 5CORA 5EKIA 1HRJA 2BDNA 4IUUA 4CJ0B 2FJ2A 2Q8RE 4IUQA 1O80A 2L4NA 1RODA 4X3TA 5COYA 2B2WA 1CM9A 4RA8A 5T1GA 1IL8A 4ZK9B 4ZAIA 1HHVA 2K01A 2CVRA 3F2UA 1G2SA 1F2LA 2MPMA 2K28A 2NWGA 4IUVA 4R8IA 1EIHA 2EE1A 1HA6A 3D6WA 3R93A 3TZDA 1U4PA 1DONA 3MWYW 1JICA 5EPLA 2HCCA 1U4MA 4IUTA 2Q8TA 2NYZD 4O42A 2EOTA 2M2LA 1VMCA 2L1BA 2MP1A 2B2UA 2K03A 2FINB 2RSNA 4X3UA 1WTQA 2B2YC 1ESRA 4MHEA 5CBEE 4XDXA 1F9SA 1EIGA 1XX8A 1HFNA 2HUGA 5D65A 1MSGA 3LWEA 4U68A 1WTWA 2B2VA 1F9RA 2RSOA 3DEOA 3DM1A 5CBAE 1XYIA 1WD1A 1BF4A 4IURA 1EL0A 1HUNA 1G91A 2D9UA 1NR2A 3IFDA 1O7YA 3DEPA 2KEDA 2RVLA 5EJWA 2L12A 2HDMA 3I90A 1TVXA 1SDFA 4OIJA 1IKLA 1E0BA
chains in the Genus database with same CATH superfamily
2UXCQ 4KTAA 3S16B 3NSWA 4CBVA 4M8AA 1ASYA 2UUCL 3J7YW 4R4IA 4LF5Q 4DV7Q 3CCMA 3WOEA 1B50A 3VR5A 4PV1C 3FVQA 1EZ8A 4KY6A 1OXVA 4BY1B 3S2HH 4B3RL 1XTCD 1TIID 3Q6SA 2F3WA 2QEXA 5IYBG 4HN7A 4A75A 5T1IA 2DY8A 1L1OA 4KHPL 3BS1A 4CKBA 3NUCA 4KJNA 4K6LA 1NR4A 1ET6A 1FNVA 2XVSA 4DV2Q 1K3RA 3S2DB 2RKSA 4JI5L 5C44G 1JB7A 4ZQ3A 1AH9A 1EFID 4DV5Q 3KLRA 1RF2D 3OWFA 2IX1A 1H9MA 5CV8A 4HIOA 4XT3B 2I5MX 4A3DH 3TZUA 1A3VA 4IOCA 2ID0A 2ZXOA 1XMQL 1D5ZC 3FHWA 2O5IC 1SNPA 2XN9C 3EA6A 2Q2UA 1CFMA 4MTNA 1QILA 2B8FA 4CKEA 1X9NA 2AQ1B 1WTOA 4DXFA 2OTLA 4Q5VA 4H02A 1E1TA 4CDEC 4DR1Q 1KHIA 1Y1WB 2I07B 1E2WA 3KLSX 1AZPA 2NTTA 2YV5A 4OIKA 2KECA 2E5LL 1TWGH 5JEAG 1V1PB 5G3LD 5IGEA 4JI1Q 2CWPA 5DLQE 1RKNA 3ITPA 2EYFA 1KAAA 4X3TA 2F0UA 3NBHB 3ULPA 4C3HG 1HHVA 2D0PA 4XIGS 4OELB 1CQFA 5JJIA 3IRBA 3NXWA 4DV3Q 1STHA 5ISRA 2M2LA 2IY5B 2I46A 1CTMA 4DGZA 1UNSA 4NXML 3H09A 3UDGA 3LWEA 3CMEA 1C9OA 4A3EB 3E9IA 1KIXA 2RDGA 1KABA 2D9UA 4AIMA 2K5WA 1STBA 5E1FA 2A74C 3KDFB 1N36L 1H9RA 4RFBA 4GLXA 5E4WC 3VYRA 1PLFA 2WB1E 4OO1G 1KNEA 1YNXA 4ZUIA 5M3FH 3M4OH 2ZJPA 3ND9A 4DUYQ 3BZCA 1SN8A 5FLXE 1EFWA 3HOVH 1B70B 2NZHA 5KGUA 3NHHA 2F4VL 2XIWA 2A69C 3QIAA 4GNXA 1SRUA 2F0FA 3EIVA 1JC7A 1PH4A 1XTDA 4A3DG 2R93G 1PH2A 1LT6D 3H0GB 4DR6Q 1LTRD 3NELA 3RR5A 3U9OA 4POGA 4R1JA 5CR3A 3QG1A 4IFDH 4BY7B 3CRKC 1H9JA 4FXGC 2A69D 3K5NA 1B53A 2O4XA 1AFPA 2DNCA 3GD7A 1W2BA 2I5LX 2MJ8A 3QR8A 4C1NK 4WFN3 1XJVA 1CA5A 1BXTA 2KBNA 1LTGD 1RTNA 1PFNA 2DJGC 2PW5A 4YHHL 2F0LA 2BDOA 3CQZB 3J81L 3TP5A 1N33L 4RCOA 1ET9A 4KY7A 4E6IA 5C0XJ 1K0RA 1KDAA 3URYA 2Q2IA 2PPBC 5M5WB 1WCMH 3K5MA 1EWCA 4RGTA 3A5UA 1JWSD 1DOLA 1MJCA 1ESFA 1SROA 3ULLA 2WKCA 1JR0D 4KD3A 4FF3A 4JI3L 3FPUB 5CORA 4IUUA 4DR7Q 3HOYB 1CSPA 3GO5A 2A68C 2VQFL 1Q1BA 1Y14B 2B63B 2AKWB 3PV0A 5F2DA 4DUZQ 4JI2Q 3M9BA 4B9XA 3D6WA 5IWAQ 1JJGA 3DLLA 3R2IA 1EWHA 1STNA 2TMPA 4YCVA 2A68D 3S1QH 2MP1A 2NB0A 3A0JA 2IX0A 3CXCA 4KN4C 1VQDA 1FR3A 5I2YA 5IYDH 1WTQA 2EJFC 3X3NA 5GAEC 2WB1G 4OO1I 2LY7A 1BF4A 3OWEB 2G5DA 2NZOA 4NXNL 5C4JB 4QY7A 2CFMA 3IFDA 4RKLA 5IP7H 2ZM6L 4R8NA 1KD1C 4LK1C 3MHBA 1XNRQ 3PUXA 1SAPA 4U673 5IOCA 4JI8Q 1WTXA 2H5XA 2LS01 4KJOA 2ALYB 2J4XA 3O13A 3F8TA 4YWKA 4IFDG 4NMZA 5C4XB 1HTPA 3D4WA 5EQ0A 2NN6H 1DYQA 1KAWA 3LGJA 2KHSA 4HJ9A 3CF5A 5GQOA 2EYMA 5EPJA 2HCIA 4UP9A 2OXPA 1XNQQ 3S2HB 1CA6A 4F88A 1F2MA 1H9SB 3QJYA 2Z6BA 2R7ZG 1IL2A 1YNNC 3T1YQ 1BR9A 4N8FA 5AFWA 4J6HA 2L11A 5FLMH 2KVMA 4LFBL 1SE8A 3OMGA 5CV9A 3HOWH 1Q3LA 1WCMG 1K3BC 3VR2A 5KNDA 1F9PA 4A3MG 1BOSA 3SE0A 3A8KE 4IUNA 4OHJA 5E4XA 3TN2A 2B2YA 2DY7A 4DK0A 1LTID 5C3WA 2H1EA 3I72A 4CJ2C 1KC8C 2VNUD 1EYCA 4JK1C 2HDLA 2HHHQ 1K8OA 1CHPD 3TDQA 1YNJC 4HEDA 2RQXA 3RMHA 3A54A 3AB9A 2VQEL 2R92B 1VQGA 2PZWA 1Q82C 4G7ZC 2BH2A 4QQBX 2GN5A 2UXCL 1UWVA 1G6PA 3OOCA 4LF5L 2FJ2A 4DV7L 1EY4A 5G3LF 1TWAB 3WOFA 3C2PA 3MFGA 4A3GH 2HIVA 3MVVA 3VA7A 4X62Q 4EQ5A 3VR4A 1PH5A 2VZAA 3EFXD 3H3VH 3M3YH 1VQ6A 2E75C 1BKBA 3S1RB 2VUMH 4EVOA 3I56A 1SNCA 3AMUA 4DV2L 1WFQA 2NVTH 4CDCC 4AQYQ 1TU2B 2B2VA 1I50B 1TS2A 1GUTA 2AWNA 3G4SA 5M3MB 3KF8A 4IFDI 4DV5L 3PQIA 1L0YB 2PYKA 3AFPA 5LMUQ 4FXDA 5HGTA 4KHZA 2NN6G 4A3JB 4PZ8A 3TQYA 1S5ED 4HR7B 1EQRA 4EX5A 2QEJC 1B1ZA 2EVBA 1YVCA 2X6GA 1S3OA 4QUCA 1NMFA 4JI0Q 3D0FA 2B39A 3UDIA 4DR1L 3ONAB 1IW7C 1Q46A 2MQHA 2JEAI 1JOOA 4B3TQ 3HOWG 2SEBD 1Y69U 1LABA 2NVYH 2XSCA 4JI1L 5FO8B 5IT9E 1H95A 3PO2B 1LLRD 1S5CD 3HOVB 1HPCA 1IW7D 1QWYA 1RJTA 2MHVA 4RMFA 3TREA 3DXJC 3L3OC 1X3FA 5FLXc 1VQEA 4A93G 4DV3L 4K6DA 2OTJA 3SGIA 4G57A 5C5LA 2M9VA 2FXQA 2K5NA 1PH3A 1E22A 2K52A 5BN4A 3AYHB 4DV0Q 3SR1A 1SYGA 1ASZA 4WRDA 1UE7A 4RWSC 3EROA 1EWIA 4QJFA 1IZ6A 2A1AA 5DEHA 3Q24A 4A3GG 5M5YH 2IPKD 4S3SA 1KXLA 1VF5C 1X54A 5J22A 1EU4A 4NB3A 3HOXB 5IY0A 2D0OA 4C3JB 2JA8G 1W3SA 1IYVA 4OONA 1B44D 2B2WA 1B3QA 4RA8A 1R4PB 1OTCA 1OXTA 4J8QA 4DK3C 3NQTA 3EN2A 2A8VA 4DUYL 4BBSB 4G4KA 3GTQB 2IWHA 1T5XD 5CV7A 4OEMB 2NN6I 2M00A 3HFZB 4IJHA 2JA5H 2F0JA 2K03A 4A3CG 5IODA 4Y7NB 4X3UA 5CBEE 1XX8A 4DNIA 1VQNA 4DR6L 1TS4A 3RLFA 3DM1A 3EBEA 3S1QB 4WJ4A 4WJ3M 2SOBA 3G71A 5AJ3Q 1CKOA 1GUOA 1I5FA 4RHSA 3R8BA 1PZID 4LNQA 3AEVA 3CMAA 3DWAA 3BDOA 1JJ2A 1VQFA 3JAMi 1X32A 3HOZG 3Q22A 3S17H 1LYLA 3CCLA 2JP1A 2L9HA 2V1CC 5EPKA 3I4NH 1JWMD 1QVCA 3BVZA 4QIWE 1IHZA 2BA0A 3PCOB 2WIIB 1C4QA 1TXYA 4PQXA 4Q0FA 1SNOA 3X3MA 1F2YA 1SLJA 2EY6A 3IKJA 2XGTA 1OXUA 1R4QB 4MTKA 4DR7L 4ZLTF 1SEBD 2WFWA 1Z6HA 4DUZL 3OIQA 1SYFA 4JI2L 5I9OA 2OQKA 3MFYA 5IWAL 2EJMA 1ILPA 1H9KA 1PZJD 4LW1A 4IPGA 3K6OA 5A2QE 1QE6A 2WAQE 4LMQD 3H3VI 3J81j 2JXMB 2JA6G 1K83H 2Q8IB 3VA5A 2ZJRA 1LUZA 2RHSB 1WYDA 4TRDA 3M4PA 3R3OA 1SMYD 4DFAA 1KRTA 3S1NH 1PV4A 2Z0SA 3PO3B 2K6AA 4DR5Q 2QW7A 4I65A 2KUMA 1SJED 4RKBA 5ELBA 1K0SA 2K1BA 1VQKA 1Z9FA 1XNRL 1AE3A 5D3DA 4A3BB 1RD9D 1RTOA 4GS3A 3CKIB 4JI8L 1FGUA 4HIDA 3KF6A 4OWWB 2PCFB 3GTGH 3M4YA 2C35B 1G2SA 3RZDH 2EE1A 4DR4Q 2F0DA 3R93A 1QVFA 2EYJA 1JICA 4ZCKA 2N78A 3KK7A 4LF4Q 2EOTA 4GOPC 3A7AB 1XNQL 4MHEA 3U4ZA 4C56C 4IO9A 1LM0A 3M3YB 3T1YL 3RN2A 3K7AB 2VUMB 2ENBA 1TY0A 3I4NG 3GTLB 1SNMA 2F0WA 2BOSA 4XXEA 5A35A 3P1HA 1XMOQ 3V05A 2MNAA 3J80L 2L55A 1WD0A 2MFIA 3CPFA 2IJ0A 3A74A 4JBWA 2IT1A 1NAPA 3J80i 2LFNA 3A5ZB 3RD4A 1NY4A 4JVZA 4KKUA 4GZYC 1I94Q 4A3EG 4YCWA 2HHHL 2KEEA 2E2HH 5KIXA 4DR3Q 2OQ0A 5BR8Q 1SFOB 4LUVA 4BWGB 2WAQG 3MXPA 2EYLA 1CZWA 4C2MH 1BVSA 4IUPA 2JN4A 3F2DA 1HZCA 1N8RC 1EOTA 2EY2A 2OCEA 3IFTA 3GTKH 1BBUA 3HGBA 3QB3A 2CW0D 2K5DA 3AFQA 3GQBA 4FYDA 2XNAC 1M1KC 4X62L 4LUOA 3SK5A 1LT3D 2JA7H 2XWJB 3CCEA 2NTSA 1CKNB 3K80C 5I6YA 1FVIA 1DJRD 3U58A 3S15B 1RHPA 1FNWA 4CKCA 1STYA 4OWXB 4AQYL 3C46A 2RCFA 3PGZA 3GV6A 4WORA 2N49A 3U4VA 3NTHA 3LWUA 1VQPA 3FEWX 4OO1H 2IHFA 4R4OA 5J3BA 5JJLA 4DU9A 1L1OC 5I4DA 3LX0A 3K57A 1SYDA 2EYPA 3D8GA 3L9AX 2F0PA 3HKZB 4DNTB 3KUPA 1PDQA 1BDOA 4LAAA 5H1SE 2K7VA 5K5PA 2AUJD 5E3FA 4A3KB 1DXMA 2R93H 1O7IA 4HTHA 5E7NA 1PVOA 1RIPA 4JI0L 1LT5D 1EIHA 3K59A 5J39A 2YTXA 2WKDA 3T13A 3OW2A 3K8AA 4L5SA 2ZTEA 3T1HQ 4B3TL 2JK8A 2HCCA 1Y8OB 2L0CA 1LO5D 4KN7C 2E2DC 3ER0A 4DAYB 4ME5A 1HZBA 5FJ8H 2K5QA 2UU9L 5CV4A 3PF5A 2E2JH 4JI7Q 4DPGA 1G291 3G6JB 2PQAA 3GTPH 5EBCA 1VQMA 1J5EQ 4A3IG 1IKMA 1E1OA 4P74A 3CCJA 4DV0L 2EQSA 4YWMA 1I6HH 1EQTA 1DZ1A 1I4XA 3ICEA 3FDTA 1UEAB 1JT8A 3NWTA 1J6QA 3FKIB 3HZXA 2B2TA 4DV4Q 4JW0A 1B9NA 1SYBA 5ELOA 4K2KA 2JA7G 1R9TB 1I4GA 2XWBB 2R3ZA 3CCSA 1FYCA 1DOMA 1YHBA 4K2LA 5CV5A 4HMJA 1WTVA 1KQSA 1Y1VB 3OHXC 1J9OA 4L5TA 4X66Q 1GVPA 4BBRB 4RAUC 3GTJH 1DOKA 4FO2A 4GOPB 4A3FG 4HSVA 5FKAC 3NK9A 5ELFA 1U5KA 1GUSA 5C4HA 2PMZB 4DK6C 3PSIA 2FMCA 3MC0B 1X3EA 2GA4B 5IGCA 1VQHA 2FHTA 2FFKB 3NPPA 1Q81C 2PNRC 3JC66 4LF7Q 2O5JC 3J7AF 3J81i 1SMXA 4AYBE 2E76C 5LHY1 1NUCA 3G7LA 2EY5A 1F77A 5AJ3L 2VW9A 1KTKA 4IOAA 4GNXC 1AN8A 3MEFA 2JJQA 1N34Q 1QUQB 1RODA 4KK7A 1CM9A 4IN3A 3NWSA 1C7YA 1F2LA 3JAME 5FJ8G 2R7ZH 1HA5A 3CU7A 2Y0SE 2BCOA 2JQOA 4FP5D 2K14A 5J1ZA 2WP8J 3ERQA 3D6CA 1HNZQ 2L1BA 2WACA 3TRZA 1VQ8A 2K33A 3I4MG 1FJGQ 1YJ9A 1GJXA 4OWTB 4A3MH 5C44B 4K5WA 1QZGA 3RZOH 1EEID 1F9RA 1I6VC 3PUWA 2K4KA 1QCBD 1XYIA 1G8ZD 1K8MA 1I3QH 4UP7A 2EXZA 2L12A 3KJOA 4UHVA 4DR2L 3Q23A 4K0KQ 1HZAA 2F0QA 4RGOS 4K14A 5C3EG 3KBXA 1L1OB 1V9PA 1JORA 3A55A 1TR5A 3BZDB 5M3MG 2F0NA 1LT4D 1RDPD 3E0JA 4DR5L 2QF7A 2I5HA 3T16A 2GVAA 1BQQT 3W5OA 1IBLQ 4KV6A 2SNSA 3T51B 1MI2A 4NP5A 1JOKA 3U50C 3HP3A 2VS1A 4C3HB 3D31A 4HJ8A 2FMMA 1GOZA 3PUVA 1PFBA 4AYBG 1KLGD 4NW2A 3E3XA 1PFSA 4DR4L 5DNFA 1Q86C 3QOLA 4XQQA 4LF4L 1A8VA 1VQAA 1FD7D 2NVXH 1PTOH 2MUYA 1AEXA 2KCCA 4CHTB 1S4ZA 1TWHH 2Y0SG 3I8ZA 4HIMA 4DXGA 1XMOL 3BVMA 1A63A 4A76A 5FO7B 3RLOA 1PRTD 1B9MA 1Z7TA 1HNXQ 4G7OC 4HMIA 3CP0A 1K8AC 2BDNA 1TKWB 3QOJA 4N8X1 4IUQA 1ZEQX 2EY1A 1VQJA 2YU9H 1I94L 4GN4B 2OT2A 1Q90A 5M5XH 4B3MQ 4DR3L 4H0LC 1D7QA 3J80E 5BR8L 1LTLA 2AMCB 4APVA 3L0OA 1HJPA 3K81C 1V1OA 4A3DB 4A93H 2Q8TA 2R93B 2B2UA 1EZ6A 3E6ZX 2B2YC 2B3GA 4IALA 1PA6A 3MA2B 2Q2HA 2F0KA 2HUGA 3K5OA 1MSGA 5CBAE 4IJLA 3I7FA 1PH7A 4Y52H 1G91A 1X56A 5GAHC 4DV1Q 4X6AH 5EGTA 3DEPA 5BN3A 1PH1A 1TWGB 3SK6A 5HURA 2HDMA 1HXYD 3TEHB 2E2JB 2CQAA 1DM0B 1UUPA 3FP9A 3W1BA 2JA8H 3KYHC 1YZ6A 3DWQA 3E9HA 4HSPA 3VR6A 1V43A 1VQ9A 2MGSA 4XT1B 4GNXB 4RCNA 3PIPA 2Z6KA 2LXJA 1Y8PB 3E0EA 1I6HB 1KDCA 1V8QA 4ZRZA 4X3SA 3NTIA 3FPPA 1TWFH 4O2DA 2VXWA 1EY6A 1W6KA 5BN5A 4PZ6A 4A3CH 1F2ZA 2B2VC 4HJ7A 5KNCA 3CC4A 3SK4A 4B08A 1ENFA 3I3CA 1GXDC 3S9WA 1PH6A 3NEMA 3T1HL 3K7UC 3HOUH 5C3XA 3OW7A 3LNNA 3GTJB 3I70A 4KHVA 2DUDA 2WB1B 1AW7A 4A3LH 1ML0D 1NE3A 1D5MC 1VDZA 1S5FD 1LTAD 3HOZH 5M3FB 1VF7A 1SJHD 4A4IA 3F2CA 1Z47A 1NJIC 4B9WA 3M4OB 4C3IG 2E2IH 2UXBQ 4OX9Q 2F1MA 5DAUA 1Q12A 5JVG3 2JA9A 5IIFA 1J5EL 2HIXA 2PI2E 3MXNA 3MAQA 4FF1A 1MIUA 1S5BD 3H3VC 4XQNA 3S16H 3UDXA 1X65A 3TS2A 5COYA 1EY9A 5T1GA 3DMUA 1JCKB 4K8JA 4FNFA 4FVMA 4DV4L 1SNDA 2F0HA 3DWPA 4BY1H 2A5HA 4O42A 2LSSA 4Z9CB 1BUVT 2JA6H 1A3UA 3CD6A 4QL5A 2KA7A 1YIJA 4X66L 1TQOA 4PMBA 3WDNA 3JAMc 1EL0A 3BYTB 1WCMB 2QCPX 3S2DH 3AQQA 2HQLA 1U0LA 4A3MB 1CQVA 3PMFA 3RZOB 2JEBI 3I90A 2AQ3B 1JWUD 1IKLA 3H94A 1DD2A 2PI2A 1LTBD 2F0OA 3VYSA 2B2WC 4LF7L 1ZKOA 2F0IA 1VMPA 4F87A 2OEOA 1EY7A 3W1GA 3SXHA 1N36Q 1STGA 3J81E 1Y1WH 1PYWD 4IQZA 3HOUG 1N34L 2AQ2B 2K5VA 2R7DA 4A3LG 4K8IA 5IE8A 1VQIA 1EIYB 1A0IA 4N9TA 5EKKA 5C5MA 2J0TD 2Q2TA 3CCVA 1EQVA 1S72A 4V0BA 5DM63 2E8GA 1HNZL 1YBYA 3MZ5A 1F9QA 2RDFA 1BNZA 1FJGL 5FLXL 4OXPA 3CCRA 1IYUA 2XRSD 3K0YA 2D62A 2N55A 1A2UA 2JSOA 3DUZA 4TQUS 4A3EH 2X69A 1PZKD 4QMGA 1SE2A 1X3PA 4ID6A 5C4ZA 4BY1G 4RG1A 2WINB 2B29A 1SMYC 1TWHB 3OTOQ 1HRJA 2PZTA 1PRTF 3HRZC 1Q8KA 4ZK9B 1V1PA 4R8IA 4H44C 3HOWB 1CSQA 4MIUA 4DV6Q 1IBLL 1B8AA 4EQOA 2ZXRA 2EYHA 3NBHA 3HKZG 3F1ZA 1MD2D 4ODGA 1VQ5A 1GUNA 4BA1I 2RSNA 3KF8B 2ZTDA 4ZYSA 4XDXA 1VQBA 4JOIA 2XTIA 4ZUJA 4JBMA 3H0GH 3J80c 1QJOA 2UUBQ 4BY7H 4LF8Q 1GD7A 1PH8A 3A7LA 3I4LA 4KMUC 4R4QA 4OIJA 5KNBA 1Y1WG 2DGYA 1D2BA 3Q0AA 2K04A 2JYOA 5EKLA 1YJWA 2PQEA 1SYCA 4A3GB 1O7LA 3KDFA 1GHJA 1J8IA 2NVQH 2E74C 3ND8A 2J7ZA 5JAVA 4GLVB 5M5WH 2BE5C 1GHKA 2K05A 4UPAA 2JA8B 4QF4A 2H4OA 2RF4A 3BG3A 3BVGA 1PTOF 3CCUA 2HQEA 1HNXL 3ZJYC 4IPHA 3I4OA 2NVTB 4HIKA 5I2XA 2CHBD 2R6GA 3OYYA 1HR0Q 1YI2A 4R9WA 2SDFA 4FDBA 2R61A 3HOYH 1A15A 3H6MA 2BE5D 4QGUA 2B63H 4B3ML 1G2TA 3CPWA 3RN5A 5JPNC 2DN8A 2F0TA 3HKSA 3T53B 4P75A 5CMDA 1WTPA 2CW0C 1C0AA 1LACA 2RHQB 1O7ZA 3TBIB 4AH6A 4A3IH 3MXUA 4QUFA 4L5RC 2AHOB 3GTOH 5IGGA 3STBD 1B3AA 5IYCH 1K9MC 1HFGA 1BCPF 4X65Q 1WTHA 5C4JH 1ENCA 4ZKCB 4LF6Q 4GN3B 2NVYB 3PIP3 1CZGA 4LFAQ 3HOZB 3H91A 2IHEA 1CK1A 1ENAA 3EJIA 2L4NA 1MKHA 2O2LD 5IT9c 3D4RA 3FRPB 3H0GG 1B7YB 4IUVA 1VCIA 4JYAQ 1X55A 1QNUA 1XPRA 2PO4A 4A3FH 4BY7G 3C1EA 4FXKC 3OMCA 5C4XH 2ZXPA 5KEEA 3J7ZC 4N9PA 3SDZA 1V1QA 5LMUL 3CC7A 4EGVA 1EIGA 1VS0A 2KCMA 5M5YB 3UDFA 1XXGA 3MXGA 1SR3A 2JA6B 4YWLA 1E3PA 1IYJB 2DNEA 1CUKA 4XTCS 2A6EC 1SE3A 5JVH3 2Z8LA 4JBJA 4CDFC 1TWCH 3WWVA 5JEAJ 3HOYG 3TMEA 5LMNQ 3IAYA 2B63G 4OX9L 2UXBL 1N9WA 2A6ED 1ONLA 1WJJA 2DJFC 1U9RA 1X3GA 2KOLA 4LJZC 4F7XA 4FF4A 2JA5B 1E7ZA 2R92H 5EAYA 4EQPA 5ELNA 4YY3Q 5LL6X 1ILQA 4KLKA 3VYUA 3A8IE 3I4MH 3S1MH 4F8MA 2AUKA 1TWAH 5IYCG 1XPOA 5CC4A 1EEFD 3S14H 3VDYA 2Z9HA 1H9SA 3B6YA 3J81c 5M9OA 1N32Q 3PUYA 2EZVA 3S1RH 4JG2A 5C0XH 5KYIA 1IBMQ 4YIJA 3S17B 4QIWB 3UE1A 1VQ7A 1SSOA 1X6OA 2JE6I 3W2DA 4LWCA 3I4NB 1HR0W 3GDEA 1I50H 1I4HA 2PNHA 5C3EH 2B2TC 5IT9L 5LL6S 5HY6A 1C48A 5M3MH 1ZXTA 4RH6A 3KF6B 2D5DA 2F0EA 1GO3E 5C4XG 2F3VA 5HGQA 5ELDA 3IL8A 4RGNA 4A3JH 2XRQD 1JB3A 3I73A 1A3TA 1OO9B 4ZAIA 4JI6Q 2WAQB 3SHLA 3W3AA 4G7HC 2D2CC 4GKKQ 2EYOA 1BBWA 1STAA 1K83B 3PUZA 3DHQA 2G9HD 4TVAB 2K5HA 2A6HC 1VMCA 1CI3M 1MJEA 1PYBA 3K58A 3NBIA 1IBKQ 4BXXH 1T9HA 1F9SA 1CT1D 3S1NB 3PO2H 1WTWA 3P75A 3RNUA 2F52A 4NPSA 3TP8A 2A6HD 2RVLA 3M7GA 1TVXA 1SYEA 4L63B 2UXDQ 4MZ9A 2R92G 1U4LA 2ES2A 3GTMH 2IX3A 1E24A 4PNYA 4UDUC 5ELEA 3GTGB 1JJCB 4X64Q 3RZDB 1I4RA 3Q8DA 4PMWA 3PF4A 4I7AA 1KDBA 1EOVA 2R7FA 4HJ5A 1NSNS 3MTSA 1OXSC 1UEBA 5JPMC 3UI2A 5K36H 4P71A 1EYGA 1K8GA 3OTOL 3HOXH 1BBXC 2WV6D 2NVQB 5IP9H 5C0XG 4C3JH 1EUJA 1XWEA 1B4OA 1WVLA 4XYOA 1KL9A 4CGYB 2K32A 1TY2A 4DN4M 4PG3A 4DV6L 5LMNW 4DAVA 4BBSH 3GTQH 1GUWA 3C3LA 3ERSX 2YYZA 3A8JE 4LUZA 1EY5A 4A3JG 4Y7NH 3RLNA 2F3IA 2LKVA 2ZTCA 2E2HB 4IPCA 2AWOA 4BA2I 2UUBL 4C2MB 4LF8L 1JQYD 2F0VA 3C1FA 3NE5B 4A3IB 3GTKB 3GTOB 5TSSA 1MHWC 2EJGC 3D4DA 2ICIA 2ASBA 2F03A 4IFDJ 5A2QL 2Q8RE 4B3SQ 1O80A 3UE0A 3BJUA 4BXXG 5M3FG 1M90C 1EIFA 3BDLA 3PO2G 2KENA 3TP7A 1VQCA 3HOVG 3NQIA 1TS3A 1PRTC 3EQLC 2RDHA 3J7A5 1HH2P 1SNQA 2JA7B 3TZDA 1CHQD 4O0AA 5EPLA 2P5ZX 5CV6A 1U4MA 1EYDA 4LFCQ 4DKAC 3VYTA 5IGDA 1HNWQ 1YHAA 2C5CA 2FINB 4M1UB 2PQAB 3KOJA 4JV5Q 3T4AC 1HR0L 2QILA 4C1NI 1SE4A 1YITA 4A3FB 2RSOA 4KKTA 3E5SA 2KQ3A 4GKJQ 1DGSA 2L15A 4OL7A 5EBDA 4K5VA 4C3IH 3M85A 1TS5A 2K75A 2Z4IA 3D3RA 1GUGA 1E2ZA 1MBYA 1L0WA 1C8CA 5K36G 1HZ9A 4JI4Q 4IZ8A 1DCZA 3QWNA 5C0XI 3HOXG 2RBMA 1YJNA 5IP9G 3BDCA 4C3JG 5JOBA 4BS9A 1LV9A 4X65L 2IL8A 3PO3H 4LF6L 1P16A 1M8AA 1YNND 4L6TB 4HAEA 2PZUA 5GAGC 3GP7A 2B2UC 1TWCB 4LFAL 4BBSG 2F4IA 3QO2A 3DM3A 2EIFA 2OWOA 3KFUA 1HCZA 4A3BH 2MO1A 1GKHA 2KCTA 4JBKA 4MN3A 3F2BA 1PTOC 4NKLA 2UUAQ 2A73B 3SK8A 3HEJA 4JYAL 3GTPB 1UE1A 3KLSA 4KD4A 3TP6A 1ICWA 3SVMA 3PIOA 4LF9Q 3S1MB 3I4MB 2KHIA 1PXUA 2F0SA 1SXTA 4RGMA 5IYDG 2YTYA 3FMCA 3G6EA 2A19A 1YNJD 2BA1A 1PTOD 1AE2A 3S14B 1A6XA 1PH9A 3OSOA 2UUCQ 2KJXA 1KLUD 4DAPA 5IP7G 2X6LA 4P73A 4CDDC 2QKIC 1IXRA 3K7AH 2Z6KC 4B3RQ 4NDXA 2ZT9C 3J7AV 3GTLH 1QOHA 5CGKA 4L8JA 2CH4A 2RA4A 1BCPC 4KHPQ 1K73C 5C3EB 4HCSA 2N3SA 1A62A 1IL8A 2K01A 2CVRA 2SNMA 5LMNL 2LXKA 4JI5Q 1BCPD 2Z1CA 4TSSA 4XQJA 2IW3A 2CQOA 4H7BA 3MWYW 1SFOH 4JI7L 3MEHA 5C6AA 3KJPA 1EQQA 4YY3L 4K5XA 1XMQQ 4AYBB 1HFNA 1YEZA 4U68A 5KYLA 5FLMG 2EDGA 2C9OA 1SBBB 4IURA 2YTVA 4HCEA 1CKMA 4ME3A 3H15A 1NR2A 3EVQA 1II3A 3PO3G 5EJWA 1N32L 2E5LQ 1D1IA 3KLWA 3I55A 1UAPA 4J1MA 1IBML 2UU9Q 3S15H 4ABNA 4A3BG 4OGQC 2NZ1D 2Y0SB 3BYYB 1AZQA 1WOCA 2R7ZB 3RUZA 3L2PA 3NTKA 3GTMB 3R2TA 1JE5A 1QZHA 4DK1A 2ICEC 3KBGA 5DM73 4HJAA 1L0XB 2F0MA 4I7ZC 1QVGA 3CHBD 5ELCA 1PRTB 4NXMQ 1LTTD 1NCVA 3HKZE 3SEBA 4ZKBB 5IGFA 1S5DD 5GROA 4JI6L 4A3KH 2MO0A 1I3QB 2CKZB 2NUCA 3I2ZA 1NMGA 1B2TA 2NBFA 4GKKL 4H13C 4ALPA 2VUMG 1MGSA 1PMRA 1L2FA 1WTRA 1LTSD 2ATWA 1I4QA 3NP8A 1PFMA 1IBKL 3CRLC 1QG7A 3L7ZC 1KRSA 2QGQA 1Q1EA 1Q8IA 1CKNA 2QDBA 4R4TA 3S24A 4J15A 1X3QA 2GVBA 2K50A 4P2CB 3U9SA 2V4DA 4CJ1B 3CC2A 4UAIA 4QCLA 1VQ4A 2F4VQ 2UXDL 1G51A 1TT2A 4TKOB 3NENA 5CYUA 1FNUA 4CJ0B 4FF2A 5IGBA 4X64L 2HD3A 1HTLD 1W6JA 4KY5A 1T5EA 3F2UA 3N6RA 1HA6A 4DAMA 3M7NA 3FKIH 4KI0A 1U4PA 1DONA 2QA4A 5NUCA 3BU2A 2NVXB 1PTOB 2CH4W 3K5LA 4UP8A 4RHRA 1R9TH 2LMCB 1XPUA 4O1NA 2HT1A 1STEA 1HQMC 4YHHQ 3TSSA 4YCUA 3A56A 4PMCA 5D65A 1PYSB 3HS0C 1N33Q 4KKSA 4K0KL 1Y1VH 3BZKA 2VL6A 1HUNA 4BBRH 3HG9A 1PHJA 2CWAA 2EXDA 4L5QA 4DAYA 1GM5A 1YHQA 1D5XC 2RCNA 1SDFA 3JAML 2KEDA 4DNRB 4IPDA 4JI3Q 2PMZE 2VB3X 1AP0A 5FK9C 1FGBD 3N52A 5I6WA 2YU9B 1OXXK 2F0GA 4C3IB 2VQFQ 5M5XB 1Y8NB 4V190 1BCPB 2KCNA 3T56B 1EYAA 2PW7A 3I91A 4A3KG 1D8LA 1UE5A 2Z4HA 1O78A 4A93B 4DR2Q 5JJKA 4ULLA 1VQOA 4POFA 3ULJA 1NTGA 1EY8A 4DF7A 1NBWA 1KNAA 3OIPA 1D1KA 4JOIC 4B3SL 3P7JA 2TSSA 2G9DA 1RL2A 2N8NA 1WI5A 1M4VA 1G6ZA 5D14A 2N88A 1BO0A 2ZJQA 4NXNQ 5IYBH 3CQZH 2ZM6Q 1MSHA 2JA5G 1JE4A 5JJZA 3AU7A 4LFCL 4UY8C 1S40A 4JPBW 3GV3A 1HNWL 2CCZA 4GOPA 5GADC 1EU3A 1QNKA 2EPBA 4JV5L 2L5TA 2QDLA 3VR3A 3OPOA 4JC0A 1K28A 3CW2C 3CCQA 5C44H 3MXNB 4GKJL 1HQRD 1U4RA 1ZYRC 3V96A 5FO9B 1QB5D 1HUMA 4XYQA 1A2TA 2BH8A 3FKIG 4QB4A 1FL0A 1TWFB 1RCVD 2OF1A 2I0QA 3M4QA 3STBC 2VY3A 4X3KA 4JI4L 4MNOA 5EKIA 3K0XA 5D3IB 1ZYRD 1JMCA 4DA2A 4ILWA 2NWGA 2MPMA 2K28A 4P72A 4EQNA 1Y1VG 4BBRG 2VB2X 3V2TA 4LFBQ 1QUQA 1ICFB 3HOUB 1D6EC 1NNXA 5L37A 5JEAH 2KHJA 1VQLA 1JOQA 4IUTA 4PZ7A 2NYZD 4DV1L 3CAMA 3PIO3 3G48A 4JCVE 5KRUA 1ESRA 3P20A 4C3HH 1UE6A 4WJWA 1I4PA 2UUAL 3DEOA 1Q7YC 3TS0A 1WD1A 1P8LA 5I9PA 2E2IB 1E2VA 4GLAC 1O7YA 3ZYYX 4LF9L 2VQEQ 4GN5A 1EY0A 4R4CA 2B8GA 5FOBB 1E0BA
chains in the Genus database with same CATH topology
4KTAA 3S16B 3NSWA 4CBVA 4M8AA 3J7YW 3WOEA 1B50A 3VR5A 4PV1C 3FVQA 1EZ8A 4KY6A 1OXVA 4BY1B 1XTCD 1TIID 3Q6SA 2F3WA 4HN7A 5T1IA 2DY8A 3BS1A 4CKBA 3NUCA 4KJNA 4K6LA 1NR4A 1ET6A 1FNVA 2XVSA 3S2DB 2RKSA 4ZQ3A 1EFID 3KLRA 1RF2D 3OWFA 2IX1A 1H9MA 5CV8A 4XT3B 3TZUA 1A3VA 2ID0A 2ZXOA 1D5ZC 2O5IC 1SNPA 2XN9C 3EA6A 1CFMA 1QILA 2B8FA 4CKEA 2AQ1B 1WTOA 4DXFA 4Q5VA 1AZPA 1Y1WB 2I07B 1E2WA 3KLSX 2NTTA 4OIKA 2KECA 5JEAG 1V1PB 5G3LD 5IGEA 1RKNA 3ITPA 2EYFA 1KAAA 4X3TA 2F0UA 4C3HG 1HHVA 4XIGS 1CQFA 3NXWA 1STHA 5ISRA 2M2LA 2I46A 1CTMA 4DGZA 1UNSA 3H09A 3LWEA 4A3EB 2RDGA 1KABA 2D9UA 2K5WA 1STBA 5E1FA 2A74C 1H9RA 4RFBA 5E4WC 3VYRA 1PLFA 4OO1G 1KNEA 4ZUIA 3ND9A 5FLXE 5KGUA 3NHHA 2XIWA 2A69C 3QIAA 2F0FA 1JC7A 1LT6D 3H0GB 1LTRD 3U9OA 5CR3A 3QG1A 4IFDH 4BY7B 3CRKC 1H9JA 4FXGC 2A69D 3K5NA 1B53A 2O4XA 1AFPA 2DNCA 3GD7A 2MJ8A 4C1NK 4WFN3 1CA5A 1BXTA 1LTGD 1RTNA 1PFNA 2PW5A 2F0LA 2BDOA 3CQZB 3J81L 3TP5A 4RCOA 1ET9A 4KY7A 4E6IA 5C0XJ 1KDAA 3URYA 2PPBC 5M5WB 3K5MA 1EWCA 4RGTA 1JWSD 1DOLA 1ESFA 2WKCA 1JR0D 4KD3A 4FF3A 3FPUB 5CORA 4IUUA 3HOYB 3GO5A 2A68C 1Q1BA 2B63B 3PV0A 5F2DA 4B9XA 3D6WA 3R2IA 1EWHA 1STNA 2TMPA 2A68D 2MP1A 2NB0A 2IX0A 4KN4C 5I2YA 1FR3A 1WTQA 2EJFC 3X3NA 4OO1I 2LY7A 1BF4A 3OWEB 5C4JB 3IFDA 4RKLA 4R8NA 4LK1C 3MHBA 3PUXA 1SAPA 4U673 5IOCA 1WTXA 2LS01 4KJOA 2J4XA 3O13A 4IFDG 4NMZA 5C4XB 1HTPA 3D4WA 5EQ0A 2NN6H 1DYQA 2KHSA 2EYMA 5EPJA 2HCIA 2OXPA 3S2HB 1CA6A 4F88A 1F2MA 1H9SB 3QJYA 1YNNC 1BR9A 5AFWA 4J6HA 2L11A 2KVMA 3OMGA 5CV9A 1Q3LA 3VR2A 5KNDA 1F9PA 1BOSA 3SE0A 3A8KE 4IUNA 4OHJA 5E4XA 3TN2A 2B2YA 2DY7A 4DK0A 1LTID 5C3WA 2H1EA 3I72A 4CJ2C 2VNUD 1EYCA 4JK1C 2HDLA 1K8OA 1CHPD 3TDQA 1YNJC 4HEDA 2RQXA 3RMHA 3A54A 3AB9A 2R92B 2PZWA 4G7ZC 3OOCA 2FJ2A 1EY4A 5G3LF 1TWAB 3WOFA 3C2PA 3MFGA 3MVVA 3VA7A 3VR4A 3EFXD 2E75C 3S1RB 4EVOA 1SNCA 3AMUA 1TU2B 2B2VA 1I50B 1TS2A 1GUTA 2AWNA 5M3MB 3KF8A 4IFDI 1L0YB 2PYKA 4FXDA 5HGTA 4KHZA 2NN6G 4A3JB 1S5ED 4HR7B 2QEJC 1B1ZA 2EVBA 2X6GA 4QUCA 2B39A 1IW7C 3ONAB 2JEAI 1JOOA 2SEBD 1Y69U 1LABA 2XSCA 5FO8B 5IT9E 3PO2B 1LLRD 1S5CD 3HOVB 1HPCA 1IW7D 1QWYA 1RJTA 2MHVA 3DXJC 3L3OC 4K6DA 4G57A 5C5LA 2M9VA 5BN4A 3SR1A 1SYGA 4WRDA 4RWSC 3EROA 3Q24A 5DEHA 2IPKD 4S3SA 1VF5C 5J22A 1EU4A 3HOXB 4C3JB 1IYVA 1B44D 2B2WA 4RA8A 1R4PB 1OXTA 4J8QA 3NQTA 4BBSB 4G4KA 3GTQB 2IWHA 1T5XD 5CV7A 2NN6I 2M00A 2F0JA 2K03A 5IODA 4Y7NB 4X3UA 5CBEE 1XX8A 1TS4A 3RLFA 3DM1A 3S1QB 2SOBA 1GUOA 3R8BA 4RHSA 1PZID 3DWAA 3BDOA 1X32A 3Q22A 2JP1A 2L9HA 5EPKA 1JWMD 3BVZA 1IHZA 2BA0A 2WIIB 1C4QA 4PQXA 4Q0FA 1SNOA 3X3MA 1F2YA 2EY6A 3IKJA 1OXUA 1R4QB 4ZLTF 1SEBD 1Z6HA 3OIQA 1SYFA 5I9OA 3MFYA 2EJMA 1ILPA 1H9KA 1PZJD 3K6OA 5A2QE 1QE6A 4LMQD 2JXMB 2Q8IB 3VA5A 4TRDA 3R3OA 1SMYD 4DFAA 3PO3B 2K6AA 4I65A 2KUMA 1SJED 4RKBA 5ELBA 2K1BA 5D3DA 4A3BB 1RD9D 1RTOA 3CKIB 2PCFB 3M4YA 1G2SA 2EE1A 2F0DA 3R93A 2EYJA 1JICA 3KK7A 2EOTA 3A7AB 4MHEA 4C56C 3M3YB 3K7AB 2VUMB 2ENBA 1TY0A 3GTLB 1SNMA 2F0WA 2BOSA 4XXEA 5A35A 3P1HA 3V05A 3J80L 2L55A 1WD0A 2IJ0A 4JBWA 2IT1A 1NAPA 2LFNA 3RD4A 4KKUA 4GZYC 2KEEA 5KIXA 1SFOB 4BWGB 3MXPA 2EYLA 1CZWA 4IUPA 1EOTA 2EY2A 3IFTA 3HGBA 3QB3A 2CW0D 2K5DA 3GQBA 4FYDA 2XNAC 3SK5A 1LT3D 2XWJB 2NTSA 5I6YA 1DJRD 3S15B 1RHPA 1FNWA 4CKCA 1STYA 3C46A 3GV6A 4WORA 3NTHA 3LWUA 3FEWX 4OO1H 4DU9A 5I4DA 3LX0A 3K57A 1SYDA 2EYPA 3D8GA 3L9AX 2F0PA 3HKZB 4DNTB 3KUPA 1PDQA 1BDOA 4LAAA 2K7VA 5K5PA 2AUJD 5E3FA 4A3KB 1DXMA 4HTHA 1LT5D 1EIHA 3K59A 5J39A 2WKDA 3T13A 2HCCA 1Y8OB 2L0CA 1LO5D 4KN7C 2E2DC 4ME5A 2K5QA 5CV4A 1G291 3G6JB 5EBCA 1IKMA 1EQTA 1DZ1A 1I4XA 3FDTA 1UEAB 3NWTA 3FKIB 3HZXA 2B2TA 1B9NA 1SYBA 4K2KA 1R9TB 1I4GA 2XWBB 2R3ZA 1FYCA 1DOMA 4K2LA 5CV5A 4HMJA 1WTVA 1Y1VB 3OHXC 1J9OA 4BBRB 4RAUC 1DOKA 4FO2A 4HSVA 5FKAC 3NK9A 5ELFA 1GUSA 5C4HA 2PMZB 2FMCA 3MC0B 2GA4B 5IGCA 2FHTA 2FFKB 3NPPA 2PNRC 2O5JC 3J7AF 2E76C 5LHY1 1NUCA 3G7LA 2EY5A 1F77A 1KTKA 1AN8A 1RODA 4KK7A 1CM9A 4IN3A 3NWSA 1F2LA 3JAME 1HA5A 3CU7A 2BCOA 4FP5D 5J1ZA 2WP8J 3ERQA 3D6CA 2L1BA 2WACA 2K33A 1GJXA 5C44B 4K5WA 1EEID 1F9RA 1I6VC 3PUWA 1XYIA 1QCBD 1G8ZD 1K8MA 2EXZA 2L12A 3Q23A 2F0QA 4RGOS 4K14A 3KBXA 1JORA 3A55A 1TR5A 3BZDB 2F0NA 1LT4D 1RDPD 3E0JA 2QF7A 3T16A 1BQQT 4KV6A 2SNSA 3T51B 1MI2A 4NP5A 1JOKA 3HP3A 4C3HB 3D31A 2FMMA 1GOZA 3PUVA 1PFBA 1KLGD 4NW2A 5DNFA 3QOLA 4XQQA 1FD7D 1PTOH 2MUYA 1AEXA 2KCCA 4CHTB 1S4ZA 3I8ZA 4DXGA 3BVMA 5FO7B 1PRTD 1B9MA 1Z7TA 4G7OC 4HMIA 2BDNA 1TKWB 3QOJA 4IUQA 1ZEQX 2EY1A 2OT2A 1Q90A 4H0LC 3J80E 1V1OA 4A3DB 2Q8TA 2R93B 2B2UA 1EZ6A 3E6ZX 2B2YC 4IALA 3MA2B 2F0KA 2HUGA 3K5OA 1MSGA 5CBAE 1G91A 5EGTA 3DEPA 5BN3A 1TWGB 3SK6A 5HURA 2HDMA 1HXYD 2E2JB 2CQAA 1DM0B 1UUPA 3DWQA 4HSPA 3VR6A 1V43A 2MGSA 4XT1B 4RCNA 1Y8PB 1I6HB 1KDCA 1V8QA 4ZRZA 4X3SA 3NTIA 3FPPA 2VXWA 1EY6A 1W6KA 5BN5A 1F2ZA 2B2VC 5KNCA 3SK4A 4B08A 1ENFA 3I3CA 1GXDC 3S9WA 5C3XA 3OW7A 3LNNA 3GTJB 3I70A 4KHVA 2WB1B 1AW7A 1ML0D 1D5MC 1VDZA 1S5FD 1LTAD 5M3FB 1VF7A 1SJHD 3M4OB 1Z47A 4B9WA 4C3IG 2F1MA 5DAUA 1Q12A 5JVG3 5IIFA 3MXNA 3MAQA 4FF1A 1S5BD 3H3VC 4XQNA 5COYA 1EY9A 5T1GA 3DMUA 1JCKB 4K8JA 4FNFA 4FVMA 1SNDA 2F0HA 3DWPA 2A5HA 4O42A 4Z9CB 1BUVT 1A3UA 2KA7A 1TQOA 4PMBA 3WDNA 1EL0A 3BYTB 1WCMB 2QCPX 4A3MB 1CQVA 3PMFA 3RZOB 2JEBI 3I90A 2AQ3B 1JWUD 1IKLA 3H94A 1DD2A 1LTBD 2F0OA 3VYSA 2B2WC 1ZKOA 2F0IA 1VMPA 4F87A 2OEOA 1EY7A 3SXHA 1STGA 3J81E 1PYWD 4IQZA 2AQ2B 4K8IA 4N9TA 5EKKA 5C5MA 2J0TD 1EQVA 4V0BA 5DM63 3MZ5A 1F9QA 2RDFA 1BNZA 5FLXL 1IYUA 2XRSD 3K0YA 2D62A 2N55A 1A2UA 2JSOA 3DUZA 4TQUS 2X69A 1PZKD 4QMGA 1SE2A 1X3PA 4ID6A 5C4ZA 2WINB 1SMYC 1TWHB 1HRJA 2PZTA 1PRTF 3HRZC 4ZK9B 1V1PA 4R8IA 4H44C 3HOWB 4MIUA 4EQOA 2ZXRA 2EYHA 3NBHA 1MD2D 4ODGA 1GUNA 4BA1I 2RSNA 4ZYSA 4XDXA 4ZUJA 1QJOA 3A7LA 3I4LA 4KMUC 4OIJA 5KNBA 1D2BA 3Q0AA 2K04A 2JYOA 5EKLA 2PQEA 1SYCA 4A3GB 1O7LA 1GHJA 1J8IA 2E74C 3ND8A 2J7ZA 5JAVA 2BE5C 1GHKA 2K05A 2JA8B 4QF4A 2H4OA 3BG3A 3BVGA 1PTOF 2HQEA 2NVTB 5I2XA 2CHBD 2R6GA 4R9WA 2SDFA 2R61A 1A15A 3H6MA 2BE5D 1G2TA 5JPNC 2DN8A 2F0TA 3T53B 5CMDA 1WTPA 2CW0C 1LACA 3TBIB 1O7ZA 3MXUA 4QUFA 5IGGA 1B3AA 1HFGA 1BCPF 1ENCA 4ZKCB 2NVYB 3PIP3 1CZGA 3HOZB 3H91A 1CK1A 1ENAA 3EJIA 2L4NA 2O2LD 3D4RA 3FRPB 4IUVA 1VCIA 1QNUA 2PO4A 3C1EA 4FXKC 3OMCA 2ZXPA 5KEEA 4N9PA 3SDZA 4EGVA 1EIGA 5M5YB 1XXGA 3MXGA 2JA6B 2DNEA 4XTCS 2A6EC 1SE3A 5JVH3 2Z8LA 5JEAJ 3TMEA 3IAYA 2A6ED 1ONLA 1U9RA 2KOLA 4LJZC 4F7XA 4FF4A 2JA5B 4EQPA 5LL6X 1ILQA 3VYUA 3A8IE 4F8MA 2AUKA 5CC4A 1EEFD 1H9SA 5M9OA 3PUYA 2EZVA 5C0XH 5KYIA 4YIJA 3S17B 4QIWB 1SSOA 2JE6I 3W2DA 3I4NB 1I4HA 2B2TC 5IT9L 5LL6S 1C48A 1ZXTA 4RH6A 2D5DA 2F0EA 2F3VA 5ELDA 3IL8A 4RGNA 2XRQD 1JB3A 3I73A 1A3TA 1OO9B 4ZAIA 2WAQB 3SHLA 3W3AA 4G7HC 2D2CC 2EYOA 1STAA 1K83B 3PUZA 3DHQA 2G9HD 2A6HC 1VMCA 1CI3M 3K58A 3NBIA 1F9SA 1CT1D 3S1NB 1WTWA 3P75A 3TP8A 2A6HD 2RVLA 3M7GA 1TVXA 1SYEA 4L63B 1U4LA 2IX3A 4PNYA 4UDUC 5ELEA 3GTGB 3RZDB 1I4RA 4PMWA 1KDBA 1NSNS 3MTSA 1OXSC 5JPMC 3UI2A 5K36H 1BBXC 2WV6D 2NVQB 5C0XG 1XWEA 1B4OA 1WVLA 4XYOA 4CGYB 2K32A 1TY2A 4DN4M 4DAVA 1GUWA 3C3LA 2YYZA 3A8JE 1EY5A 2LKVA 2E2HB 2AWOA 4BA2I 4C2MB 1JQYD 2F0VA 3C1FA 3NE5B 4A3IB 3GTKB 3GTOB 5TSSA 2EJGC 3D4DA 2ICIA 2F03A 4IFDJ 5A2QL 2Q8RE 1O80A 3BDLA 3TP7A 3NQIA 1TS3A 1PRTC 3EQLC 2RDHA 1SNQA 2JA7B 3TZDA 1CHQD 5EPLA 5CV6A 1U4MA 1EYDA 3VYTA 5IGDA 2C5CA 2FINB 4M1UB 3T4AC 2QILA 4C1NI 1SE4A 4A3FB 2RSOA 4KKTA 3E5SA 2KQ3A 4OL7A 5EBDA 4K5VA 3M85A 1TS5A 2Z4IA 3D3RA 1GUGA 1E2ZA 1MBYA 1C8CA 5K36G 4IZ8A 1DCZA 3QWNA 5C0XI 2RBMA 3BDCA 4C3JG 5JOBA 4BS9A 1LV9A 2IL8A 1M8AA 1YNND 4L6TB 4HAEA 2PZUA 3GP7A 2B2UC 1TWCB 2F4IA 3QO2A 1HCZA 4MN3A 1PTOC 4NKLA 2A73B 3SK8A 3HEJA 3GTPB 3KLSA 4KD4A 3TP6A 1ICWA 3SVMA 3S1MB 3I4MB 1PXUA 2F0SA 1SXTA 4RGMA 3FMCA 1YNJD 2BA1A 1PTOD 3S14B 1A6XA 3OSOA 2KJXA 1KLUD 4DAPA 2X6LA 2QKIC 4NDXA 2ZT9C 3J7AV 1QOHA 5CGKA 4L8JA 2RA4A 1BCPC 5C3EB 4HCSA 1IL8A 2K01A 2CVRA 2SNMA 1BCPD 2Z1CA 4TSSA 4XQJA 2IW3A 4H7BA 3MWYW 3MEHA 5C6AA 4K5XA 4AYBB 1HFNA 4U68A 5KYLA 2EDGA 2C9OA 1SBBB 4IURA 4HCEA 1NR2A 3EVQA 1II3A 5EJWA 1D1IA 1UAPA 4J1MA 4ABNA 4OGQC 2NZ1D 2Y0SB 3BYYB 1AZQA 2R7ZB 3RUZA 3NTKA 3GTMB 3R2TA 4DK1A 2ICEC 3KBGA 5DM73 1L0XB 2F0MA 4I7ZC 3CHBD 5ELCA 1PRTB 3SEBA 5IGFA 4ZKBB 1LTTD 1NCVA 1S5DD 1I3QB 2NUCA 1B2TA 2NBFA 4H13C 1MGSA 1PMRA 1WTRA 1LTSD 1I4QA 3NP8A 1PFMA 3CRLC 1QG7A 3L7ZC 1Q1EA 1Q8IA 2QDBA 1X3QA 4P2CB 3U9SA 2V4DA 4CJ1B 4UAIA 4QCLA 1TT2A 4TKOB 5CYUA 1FNUA 4CJ0B 4FF2A 5IGBA 1HTLD 1W6JA 4KY5A 1T5EA 3F2UA 3N6RA 1HA6A 3M7NA 4KI0A 1U4PA 1DONA 5NUCA 2NVXB 1PTOB 3K5LA 4RHRA 2LMCB 4O1NA 1STEA 1HQMC 3TSSA 3A56A 4PMCA 5D65A 3HS0C 4KKSA 1HUNA 3HG9A 4DAYA 1D5XC 1SDFA 3JAML 2KEDA 4DNRB 2VB3X 1AP0A 5FK9C 1FGBD 3N52A 5I6WA 2YU9B 1OXXK 2F0GA 4C3IB 5M5XB 1Y8NB 4V190 1BCPB 2KCNA 3T56B 1EYAA 2PW7A 3I91A 2Z4HA 1O78A 4A93B 4ULLA 1EY8A 4DF7A 1KNAA 3OIPA 1D1KA 3P7JA 2TSSA 2G9DA 1M4VA 1G6ZA 5D14A 2N88A 1BO0A 1MSHA 1JE4A 5JJZA 3AU7A 3GV3A 1EU3A 1QNKA 2EPBA 2L5TA 3VR3A 3OPOA 1HQRD 1U4RA 1ZYRC 3V96A 5FO9B 1QB5D 1HUMA 4XYQA 1A2TA 4QB4A 1TWFB 1RCVD 2OF1A 4X3KA 5EKIA 5D3IB 1ZYRD 4DA2A 4ILWA 2NWGA 2MPMA 2K28A 4EQNA 2VB2X 3V2TA 3HOUB 1D6EC 5JEAH 1JOQA 4IUTA 2NYZD 3PIO3 5KRUA 1ESRA 3P20A 4WJWA 1I4PA 3DEOA 1WD1A 5I9PA 2E2IB 1E2VA 1O7YA 3ZYYX 1EY0A 2B8GA 5FOBB 1E0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  1IKM A;  1C8C A;  1U4L A;  1SAP A;  2K04 A;  1NAP A;  1AP0 A;  2JYO A;  1X32 A;  1WTX A;  3N52 A;  2B2W C;  2NZ1 D;  2X6G A;  5E4W C;  3KBX A;  1B50 A;  1EQT A;  1PLF A;  1AZQ A;  1DZ1 A;  4QUC A;  2JP1 A;  1KNE A;  2L9H A;  2KEE A;  1VMP A;  3FDT A;  1J8I A;  5EPK A;  1LV9 A;  2MGS A;  4XT1 B;  3I91 A;  2IL8 A;  2B2T A;  2J7Z A;  3Q6S A;  1M8A A;  3ONA B;  4HAE A;  3MTS A;  4IUP A;  5T1I A;  2KOL A;  2K05 A;  5EQ0 A;  2DY8 A;  2B2U C;  1MI2 A;  1EOT A;  2XIW A;  3UI2 A;  3QO2 A;  4X3S A;  5EPJ A;  2HCI A;  2R3Z A;  1ILQ A;  3HP3 A;  1BBX C;  1KNA A;  1DOM A;  1NR4 A;  2VXW A;  4ZLT F;  2FMM A;  1CA6 A;  2B2V C;  1NCV A;  2SDF A;  3P7J A;  4R9W A;  4ZKB B;  1A15 A;  1J9O A;  1PFB A;  1RJT A;  1B4O A;  4MN3 A;  1WVL A;  4NW2 A;  5AFW A;  4RAU C;  1G2T A;  1DOK A;  5D14 A;  1G6Z A;  2L11 A;  2N88 A;  1BO0 A;  1B2T A;  2KVM A;  4HSV A;  4DN4 M;  3I3C A;  5DNF A;  1ILP A;  1B53 A;  1ICW A;  1MSH A;  5CMD A;  3SVM A;  1Q3L A;  1QE6 A;  1WTP A;  1JE4 A;  2MJ8 A;  4LMQ D;  5JJZ A;  1MGS A;  1GUW A;  1F9Q A;  1WTR A;  3GV3 A;  4XT3 B;  1F9P A;  1CA5 A;  1BNZ A;  1RHP A;  1RTN A;  1O7Z A;  1PFN A;  1PFM A;  1QNK A;  1QG7 A;  2EPB A;  1ML0 D;  2FHT A;  2FFK B;  5E4X A;  3TN2 A;  2B2Y A;  2DY7 A;  4QUF A;  2H1E A;  1SSO A;  2N55 A;  4CJ2 C;  3GV6 A;  1B3A A;  1S4Z A;  2HDL A;  1WTV A;  2X6L A;  4RWS C;  1HFG A;  1WTO A;  1U4R A;  2B2T C;  3I8Z A;  1HUM A;  2X69 A;  3G7L A;  4ZKC B;  4HED A;  1X3Q A;  1ZXT A;  2KUM A;  1AZP A;  1X3P A;  4CJ1 B;  1DOL A;  4UAI A;  2K1B A;  4OIK A;  2KEC A;  2RA4 A;  3H91 A;  3FPU B;  3IL8 A;  3KUP A;  1RTO A;  4X3K A;  4HCS A;  1PDQ A;  5COR A;  5EKI A;  1HRJ A;  2BDN A;  4IUU A;  4CJ0 B;  2FJ2 A;  2Q8R E;  4IUQ A;  1O80 A;  2L4N A;  1ROD A;  4X3T A;  5COY A;  2B2W A;  1CM9 A;  4RA8 A;  5T1G A;  1IL8 A;  4ZK9 B;  4ZAI A;  1HHV A;  2K01 A;  2CVR A;  3F2U A;  1G2S A;  1F2L A;  2MPM A;  2K28 A;  2NWG A;  4IUV A;  4R8I A;  1EIH A;  2EE1 A;  1HA6 A;  3D6W A;  3R93 A;  3TZD A;  1U4P A;  1DON A;  3MWY W;  1JIC A;  5EPL A;  2HCC A;  1U4M A;  4IUT A;  2Q8T A;  2NYZ D;  4O42 A;  2EOT A;  2M2L A;  1VMC A;  2L1B A;  2MP1 A;  2B2U A;  2K03 A;  2FIN B;  2RSN A;  4X3U A;  1WTQ A;  2B2Y C;  1ESR A;  4MHE A;  5CBE E;  4XDX A;  1F9S A;  1EIG A;  1XX8 A;  1HFN A;  2HUG A;  5D65 A;  1MSG A;  3LWE A;  4U68 A;  1WTW A;  2B2V A;  1F9R A;  2RSO A;  3DEO A;  3DM1 A;  5CBA E;  1XYI A;  1WD1 A;  1BF4 A;  4IUR A;  1EL0 A;  1HUN A;  1G91 A;  2D9U A;  1NR2 A;  3IFD A;  1O7Y A;  3DEP A;  2KED A;  2RVL A;  5EJW A;  2L12 A;  2HDM A;  3I90 A;  1TVX A;  1SDF A;  4OIJ A;  1IKL A;  1E0B A; 
#chains in the Genus database with same CATH topology
 2UXC Q;  4KTA A;  3S16 B;  3NSW A;  4CBV A;  4M8A A;  1ASY A;  2UUC L;  3J7Y W;  4R4I A;  4LF5 Q;  4DV7 Q;  3CCM A;  3WOE A;  1B50 A;  3VR5 A;  4PV1 C;  3FVQ A;  1EZ8 A;  4KY6 A;  1OXV A;  4BY1 B;  3S2H H;  4B3R L;  1XTC D;  1TII D;  3Q6S A;  2F3W A;  2QEX A;  5IYB G;  4HN7 A;  4A75 A;  5T1I A;  2DY8 A;  1L1O A;  4KHP L;  3BS1 A;  4CKB A;  3NUC A;  4KJN A;  4K6L A;  1NR4 A;  1ET6 A;  1FNV A;  2XVS A;  4DV2 Q;  1K3R A;  3S2D B;  2RKS A;  4JI5 L;  5C44 G;  1JB7 A;  4ZQ3 A;  1AH9 A;  1EFI D;  4DV5 Q;  3KLR A;  1RF2 D;  3OWF A;  2IX1 A;  1H9M A;  5CV8 A;  4HIO A;  4XT3 B;  2I5M X;  4A3D H;  3TZU A;  1A3V A;  4IOC A;  2ID0 A;  2ZXO A;  1XMQ L;  1D5Z C;  3FHW A;  2O5I C;  1SNP A;  2XN9 C;  3EA6 A;  2Q2U A;  1CFM A;  4MTN A;  1QIL A;  2B8F A;  4CKE A;  1X9N A;  2AQ1 B;  1WTO A;  4DXF A;  2OTL A;  4Q5V A;  4H02 A;  1E1T A;  4CDE C;  4DR1 Q;  1KHI A;  1Y1W B;  2I07 B;  1E2W A;  3KLS X;  1AZP A;  2NTT A;  2YV5 A;  4OIK A;  2KEC A;  2E5L L;  1TWG H;  5JEA G;  1V1P B;  5G3L D;  5IGE A;  4JI1 Q;  2CWP A;  5DLQ E;  1RKN A;  3ITP A;  2EYF A;  1KAA A;  4X3T A;  2F0U A;  3NBH B;  3ULP A;  4C3H G;  1HHV A;  2D0P A;  4XIG S;  4OEL B;  1CQF A;  5JJI A;  3IRB A;  3NXW A;  4DV3 Q;  1STH A;  5ISR A;  2M2L A;  2IY5 B;  2I46 A;  1CTM A;  4DGZ A;  1UNS A;  4NXM L;  3H09 A;  3UDG A;  3LWE A;  3CME A;  1C9O A;  4A3E B;  3E9I A;  1KIX A;  2RDG A;  1KAB A;  2D9U A;  4AIM A;  2K5W A;  1STB A;  5E1F A;  2A74 C;  3KDF B;  1N36 L;  1H9R A;  4RFB A;  4GLX A;  5E4W C;  3VYR A;  1PLF A;  2WB1 E;  4OO1 G;  1KNE A;  1YNX A;  4ZUI A;  5M3F H;  3M4O H;  2ZJP A;  3ND9 A;  4DUY Q;  3BZC A;  1SN8 A;  5FLX E;  1EFW A;  3HOV H;  1B70 B;  2NZH A;  5KGU A;  3NHH A;  2F4V L;  2XIW A;  2A69 C;  3QIA A;  4GNX A;  1SRU A;  2F0F A;  3EIV A;  1JC7 A;  1PH4 A;  1XTD A;  4A3D G;  2R93 G;  1PH2 A;  1LT6 D;  3H0G B;  4DR6 Q;  1LTR D;  3NEL A;  3RR5 A;  3U9O A;  4POG A;  4R1J A;  5CR3 A;  3QG1 A;  4IFD H;  4BY7 B;  3CRK C;  1H9J A;  4FXG C;  2A69 D;  3K5N A;  1B53 A;  2O4X A;  1AFP A;  2DNC A;  3GD7 A;  1W2B A;  2I5L X;  2MJ8 A;  3QR8 A;  4C1N K;  4WFN 3;  1XJV A;  1CA5 A;  1BXT A;  2KBN A;  1LTG D;  1RTN A;  1PFN A;  2DJG C;  2PW5 A;  4YHH L;  2F0L A;  2BDO A;  3CQZ B;  3J81 L;  3TP5 A;  1N33 L;  4RCO A;  1ET9 A;  4KY7 A;  4E6I A;  5C0X J;  1K0R A;  1KDA A;  3URY A;  2Q2I A;  2PPB C;  5M5W B;  1WCM H;  3K5M A;  1EWC A;  4RGT A;  3A5U A;  1JWS D;  1DOL A;  1MJC A;  1ESF A;  1SRO A;  3ULL A;  2WKC A;  1JR0 D;  4KD3 A;  4FF3 A;  4JI3 L;  3FPU B;  5COR A;  4IUU A;  4DR7 Q;  3HOY B;  1CSP A;  3GO5 A;  2A68 C;  2VQF L;  1Q1B A;  1Y14 B;  2B63 B;  2AKW B;  3PV0 A;  5F2D A;  4DUZ Q;  4JI2 Q;  3M9B A;  4B9X A;  3D6W A;  5IWA Q;  1JJG A;  3DLL A;  3R2I A;  1EWH A;  1STN A;  2TMP A;  4YCV A;  2A68 D;  3S1Q H;  2MP1 A;  2NB0 A;  3A0J A;  2IX0 A;  3CXC A;  4KN4 C;  1VQD A;  1FR3 A;  5I2Y A;  5IYD H;  1WTQ A;  2EJF C;  3X3N A;  5GAE C;  2WB1 G;  4OO1 I;  2LY7 A;  1BF4 A;  3OWE B;  2G5D A;  2NZO A;  4NXN L;  5C4J B;  4QY7 A;  2CFM A;  3IFD A;  4RKL A;  5IP7 H;  2ZM6 L;  4R8N A;  1KD1 C;  4LK1 C;  3MHB A;  1XNR Q;  3PUX A;  1SAP A;  4U67 3;  5IOC A;  4JI8 Q;  1WTX A;  2H5X A;  2LS0 1;  4KJO A;  2ALY B;  2J4X A;  3O13 A;  3F8T A;  4YWK A;  4IFD G;  4NMZ A;  5C4X B;  1HTP A;  3D4W A;  5EQ0 A;  2NN6 H;  1DYQ A;  1KAW A;  3LGJ A;  2KHS A;  4HJ9 A;  3CF5 A;  5GQO A;  2EYM A;  5EPJ A;  2HCI A;  4UP9 A;  2OXP A;  1XNQ Q;  3S2H B;  1CA6 A;  4F88 A;  1F2M A;  1H9S B;  3QJY A;  2Z6B A;  2R7Z G;  1IL2 A;  1YNN C;  3T1Y Q;  1BR9 A;  4N8F A;  5AFW A;  4J6H A;  2L11 A;  5FLM H;  2KVM A;  4LFB L;  1SE8 A;  3OMG A;  5CV9 A;  3HOW H;  1Q3L A;  1WCM G;  1K3B C;  3VR2 A;  5KND A;  1F9P A;  4A3M G;  1BOS A;  3SE0 A;  3A8K E;  4IUN A;  4OHJ A;  5E4X A;  3TN2 A;  2B2Y A;  2DY7 A;  4DK0 A;  1LTI D;  5C3W A;  2H1E A;  3I72 A;  4CJ2 C;  1KC8 C;  2VNU D;  1EYC A;  4JK1 C;  2HDL A;  2HHH Q;  1K8O A;  1CHP D;  3TDQ A;  1YNJ C;  4HED A;  2RQX A;  3RMH A;  3A54 A;  3AB9 A;  2VQE L;  2R92 B;  1VQG A;  2PZW A;  1Q82 C;  4G7Z C;  2BH2 A;  4QQB X;  2GN5 A;  2UXC L;  1UWV A;  1G6P A;  3OOC A;  4LF5 L;  2FJ2 A;  4DV7 L;  1EY4 A;  5G3L F;  1TWA B;  3WOF A;  3C2P A;  3MFG A;  4A3G H;  2HIV A;  3MVV A;  3VA7 A;  4X62 Q;  4EQ5 A;  3VR4 A;  1PH5 A;  2VZA A;  3EFX D;  3H3V H;  3M3Y H;  1VQ6 A;  2E75 C;  1BKB A;  3S1R B;  2VUM H;  4EVO A;  3I56 A;  1SNC A;  3AMU A;  4DV2 L;  1WFQ A;  2NVT H;  4CDC C;  4AQY Q;  1TU2 B;  2B2V A;  1I50 B;  1TS2 A;  1GUT A;  2AWN A;  3G4S A;  5M3M B;  3KF8 A;  4IFD I;  4DV5 L;  3PQI A;  1L0Y B;  2PYK A;  3AFP A;  5LMU Q;  4FXD A;  5HGT A;  4KHZ A;  2NN6 G;  4A3J B;  4PZ8 A;  3TQY A;  1S5E D;  4HR7 B;  1EQR A;  4EX5 A;  2QEJ C;  1B1Z A;  2EVB A;  1YVC A;  2X6G A;  1S3O A;  4QUC A;  1NMF A;  4JI0 Q;  3D0F A;  2B39 A;  3UDI A;  4DR1 L;  3ONA B;  1IW7 C;  1Q46 A;  2MQH A;  2JEA I;  1JOO A;  4B3T Q;  3HOW G;  2SEB D;  1Y69 U;  1LAB A;  2NVY H;  2XSC A;  4JI1 L;  5FO8 B;  5IT9 E;  1H95 A;  3PO2 B;  1LLR D;  1S5C D;  3HOV B;  1HPC A;  1IW7 D;  1QWY A;  1RJT A;  2MHV A;  4RMF A;  3TRE A;  3DXJ C;  3L3O C;  1X3F A;  5FLX c;  1VQE A;  4A93 G;  4DV3 L;  4K6D A;  2OTJ A;  3SGI A;  4G57 A;  5C5L A;  2M9V A;  2FXQ A;  2K5N A;  1PH3 A;  1E22 A;  2K52 A;  5BN4 A;  3AYH B;  4DV0 Q;  3SR1 A;  1SYG A;  1ASZ A;  4WRD A;  1UE7 A;  4RWS C;  3ERO A;  1EWI A;  4QJF A;  1IZ6 A;  2A1A A;  5DEH A;  3Q24 A;  4A3G G;  5M5Y H;  2IPK D;  4S3S A;  1KXL A;  1VF5 C;  1X54 A;  5J22 A;  1EU4 A;  4NB3 A;  3HOX B;  5IY0 A;  2D0O A;  4C3J B;  2JA8 G;  1W3S A;  1IYV A;  4OON A;  1B44 D;  2B2W A;  1B3Q A;  4RA8 A;  1R4P B;  1OTC A;  1OXT A;  4J8Q A;  4DK3 C;  3NQT A;  3EN2 A;  2A8V A;  4DUY L;  4BBS B;  4G4K A;  3GTQ B;  2IWH A;  1T5X D;  5CV7 A;  4OEM B;  2NN6 I;  2M00 A;  3HFZ B;  4IJH A;  2JA5 H;  2F0J A;  2K03 A;  4A3C G;  5IOD A;  4Y7N B;  4X3U A;  5CBE E;  1XX8 A;  4DNI A;  1VQN A;  4DR6 L;  1TS4 A;  3RLF A;  3DM1 A;  3EBE A;  3S1Q B;  4WJ4 A;  4WJ3 M;  2SOB A;  3G71 A;  5AJ3 Q;  1CKO A;  1GUO A;  1I5F A;  4RHS A;  3R8B A;  1PZI D;  4LNQ A;  3AEV A;  3CMA A;  3DWA A;  3BDO A;  1JJ2 A;  1VQF A;  3JAM i;  1X32 A;  3HOZ G;  3Q22 A;  3S17 H;  1LYL A;  3CCL A;  2JP1 A;  2L9H A;  2V1C C;  5EPK A;  3I4N H;  1JWM D;  1QVC A;  3BVZ A;  4QIW E;  1IHZ A;  2BA0 A;  3PCO B;  2WII B;  1C4Q A;  1TXY A;  4PQX A;  4Q0F A;  1SNO A;  3X3M A;  1F2Y A;  1SLJ A;  2EY6 A;  3IKJ A;  2XGT A;  1OXU A;  1R4Q B;  4MTK A;  4DR7 L;  4ZLT F;  1SEB D;  2WFW A;  1Z6H A;  4DUZ L;  3OIQ A;  1SYF A;  4JI2 L;  5I9O A;  2OQK A;  3MFY A;  5IWA L;  2EJM A;  1ILP A;  1H9K A;  1PZJ D;  4LW1 A;  4IPG A;  3K6O A;  5A2Q E;  1QE6 A;  2WAQ E;  4LMQ D;  3H3V I;  3J81 j;  2JXM B;  2JA6 G;  1K83 H;  2Q8I B;  3VA5 A;  2ZJR A;  1LUZ A;  2RHS B;  1WYD A;  4TRD A;  3M4P A;  3R3O A;  1SMY D;  4DFA A;  1KRT A;  3S1N H;  1PV4 A;  2Z0S A;  3PO3 B;  2K6A A;  4DR5 Q;  2QW7 A;  4I65 A;  2KUM A;  1SJE D;  4RKB A;  5ELB A;  1K0S A;  2K1B A;  1VQK A;  1Z9F A;  1XNR L;  1AE3 A;  5D3D A;  4A3B B;  1RD9 D;  1RTO A;  4GS3 A;  3CKI B;  4JI8 L;  1FGU A;  4HID A;  3KF6 A;  4OWW B;  2PCF B;  3GTG H;  3M4Y A;  2C35 B;  1G2S A;  3RZD H;  2EE1 A;  4DR4 Q;  2F0D A;  3R93 A;  1QVF A;  2EYJ A;  1JIC A;  4ZCK A;  2N78 A;  3KK7 A;  4LF4 Q;  2EOT A;  4GOP C;  3A7A B;  1XNQ L;  4MHE A;  3U4Z A;  4C56 C;  4IO9 A;  1LM0 A;  3M3Y B;  3T1Y L;  3RN2 A;  3K7A B;  2VUM B;  2ENB A;  1TY0 A;  3I4N G;  3GTL B;  1SNM A;  2F0W A;  2BOS A;  4XXE A;  5A35 A;  3P1H A;  1XMO Q;  3V05 A;  2MNA A;  3J80 L;  2L55 A;  1WD0 A;  2MFI A;  3CPF A;  2IJ0 A;  3A74 A;  4JBW A;  2IT1 A;  1NAP A;  3J80 i;  2LFN A;  3A5Z B;  3RD4 A;  1NY4 A;  4JVZ A;  4KKU A;  4GZY C;  1I94 Q;  4A3E G;  4YCW A;  2HHH L;  2KEE A;  2E2H H;  5KIX A;  4DR3 Q;  2OQ0 A;  5BR8 Q;  1SFO B;  4LUV A;  4BWG B;  2WAQ G;  3MXP A;  2EYL A;  1CZW A;  4C2M H;  1BVS A;  4IUP A;  2JN4 A;  3F2D A;  1HZC A;  1N8R C;  1EOT A;  2EY2 A;  2OCE A;  3IFT A;  3GTK H;  1BBU A;  3HGB A;  3QB3 A;  2CW0 D;  2K5D A;  3AFQ A;  3GQB A;  4FYD A;  2XNA C;  1M1K C;  4X62 L;  4LUO A;  3SK5 A;  1LT3 D;  2JA7 H;  2XWJ B;  3CCE A;  2NTS A;  1CKN B;  3K80 C;  5I6Y A;  1FVI A;  1DJR D;  3U58 A;  3S15 B;  1RHP A;  1FNW A;  4CKC A;  1STY A;  4OWX B;  4AQY L;  3C46 A;  2RCF A;  3PGZ A;  3GV6 A;  4WOR A;  2N49 A;  3U4V A;  3NTH A;  3LWU A;  1VQP A;  3FEW X;  4OO1 H;  2IHF A;  4R4O A;  5J3B A;  5JJL A;  4DU9 A;  1L1O C;  5I4D A;  3LX0 A;  3K57 A;  1SYD A;  2EYP A;  3D8G A;  3L9A X;  2F0P A;  3HKZ B;  4DNT B;  3KUP A;  1PDQ A;  1BDO A;  4LAA A;  5H1S E;  2K7V A;  5K5P A;  2AUJ D;  5E3F A;  4A3K B;  1DXM A;  2R93 H;  1O7I A;  4HTH A;  5E7N A;  1PVO A;  1RIP A;  4JI0 L;  1LT5 D;  1EIH A;  3K59 A;  5J39 A;  2YTX A;  2WKD A;  3T13 A;  3OW2 A;  3K8A A;  4L5S A;  2ZTE A;  3T1H Q;  4B3T L;  2JK8 A;  2HCC A;  1Y8O B;  2L0C A;  1LO5 D;  4KN7 C;  2E2D C;  3ER0 A;  4DAY B;  4ME5 A;  1HZB A;  5FJ8 H;  2K5Q A;  2UU9 L;  5CV4 A;  3PF5 A;  2E2J H;  4JI7 Q;  4DPG A;  1G29 1;  3G6J B;  2PQA A;  3GTP H;  5EBC A;  1VQM A;  1J5E Q;  4A3I G;  1IKM A;  1E1O A;  4P74 A;  3CCJ A;  4DV0 L;  2EQS A;  4YWM A;  1I6H H;  1EQT A;  1DZ1 A;  1I4X A;  3ICE A;  3FDT A;  1UEA B;  1JT8 A;  3NWT A;  1J6Q A;  3FKI B;  3HZX A;  2B2T A;  4DV4 Q;  4JW0 A;  1B9N A;  1SYB A;  5ELO A;  4K2K A;  2JA7 G;  1R9T B;  1I4G A;  2XWB B;  2R3Z A;  3CCS A;  1FYC A;  1DOM A;  1YHB A;  4K2L A;  5CV5 A;  4HMJ A;  1WTV A;  1KQS A;  1Y1V B;  3OHX C;  1J9O A;  4L5T A;  4X66 Q;  1GVP A;  4BBR B;  4RAU C;  3GTJ H;  1DOK A;  4FO2 A;  4GOP B;  4A3F G;  4HSV A;  5FKA C;  3NK9 A;  5ELF A;  1U5K A;  1GUS A;  5C4H A;  2PMZ B;  4DK6 C;  3PSI A;  2FMC A;  3MC0 B;  1X3E A;  2GA4 B;  5IGC A;  1VQH A;  2FHT A;  2FFK B;  3NPP A;  1Q81 C;  2PNR C;  3JC6 6;  4LF7 Q;  2O5J C;  3J7A F;  3J81 i;  1SMX A;  4AYB E;  2E76 C;  5LHY 1;  1NUC A;  3G7L A;  2EY5 A;  1F77 A;  5AJ3 L;  2VW9 A;  1KTK A;  4IOA A;  4GNX C;  1AN8 A;  3MEF A;  2JJQ A;  1N34 Q;  1QUQ B;  1ROD A;  4KK7 A;  1CM9 A;  4IN3 A;  3NWS A;  1C7Y A;  1F2L A;  3JAM E;  5FJ8 G;  2R7Z H;  1HA5 A;  3CU7 A;  2Y0S E;  2BCO A;  2JQO A;  4FP5 D;  2K14 A;  5J1Z A;  2WP8 J;  3ERQ A;  3D6C A;  1HNZ Q;  2L1B A;  2WAC A;  3TRZ A;  1VQ8 A;  2K33 A;  3I4M G;  1FJG Q;  1YJ9 A;  1GJX A;  4OWT B;  4A3M H;  5C44 B;  4K5W A;  1QZG A;  3RZO H;  1EEI D;  1F9R A;  1I6V C;  3PUW A;  2K4K A;  1QCB D;  1XYI A;  1G8Z D;  1K8M A;  1I3Q H;  4UP7 A;  2EXZ A;  2L12 A;  3KJO A;  4UHV A;  4DR2 L;  3Q23 A;  4K0K Q;  1HZA A;  2F0Q A;  4RGO S;  4K14 A;  5C3E G;  3KBX A;  1L1O B;  1V9P A;  1JOR A;  3A55 A;  1TR5 A;  3BZD B;  5M3M G;  2F0N A;  1LT4 D;  1RDP D;  3E0J A;  4DR5 L;  2QF7 A;  2I5H A;  3T16 A;  2GVA A;  1BQQ T;  3W5O A;  1IBL Q;  4KV6 A;  2SNS A;  3T51 B;  1MI2 A;  4NP5 A;  1JOK A;  3U50 C;  3HP3 A;  2VS1 A;  4C3H B;  3D31 A;  4HJ8 A;  2FMM A;  1GOZ A;  3PUV A;  1PFB A;  4AYB G;  1KLG D;  4NW2 A;  3E3X A;  1PFS A;  4DR4 L;  5DNF A;  1Q86 C;  3QOL A;  4XQQ A;  4LF4 L;  1A8V A;  1VQA A;  1FD7 D;  2NVX H;  1PTO H;  2MUY A;  1AEX A;  2KCC A;  4CHT B;  1S4Z A;  1TWH H;  2Y0S G;  3I8Z A;  4HIM A;  4DXG A;  1XMO L;  3BVM A;  1A63 A;  4A76 A;  5FO7 B;  3RLO A;  1PRT D;  1B9M A;  1Z7T A;  1HNX Q;  4G7O C;  4HMI A;  3CP0 A;  1K8A C;  2BDN A;  1TKW B;  3QOJ A;  4N8X 1;  4IUQ A;  1ZEQ X;  2EY1 A;  1VQJ A;  2YU9 H;  1I94 L;  4GN4 B;  2OT2 A;  1Q90 A;  5M5X H;  4B3M Q;  4DR3 L;  4H0L C;  1D7Q A;  3J80 E;  5BR8 L;  1LTL A;  2AMC B;  4APV A;  3L0O A;  1HJP A;  3K81 C;  1V1O A;  4A3D B;  4A93 H;  2Q8T A;  2R93 B;  2B2U A;  1EZ6 A;  3E6Z X;  2B2Y C;  2B3G A;  4IAL A;  1PA6 A;  3MA2 B;  2Q2H A;  2F0K A;  2HUG A;  3K5O A;  1MSG A;  5CBA E;  4IJL A;  3I7F A;  1PH7 A;  4Y52 H;  1G91 A;  1X56 A;  5GAH C;  4DV1 Q;  4X6A H;  5EGT A;  3DEP A;  5BN3 A;  1PH1 A;  1TWG B;  3SK6 A;  5HUR A;  2HDM A;  1HXY D;  3TEH B;  2E2J B;  2CQA A;  1DM0 B;  1UUP A;  3FP9 A;  3W1B A;  2JA8 H;  3KYH C;  1YZ6 A;  3DWQ A;  3E9H A;  4HSP A;  3VR6 A;  1V43 A;  1VQ9 A;  2MGS A;  4XT1 B;  4GNX B;  4RCN A;  3PIP A;  2Z6K A;  2LXJ A;  1Y8P B;  3E0E A;  1I6H B;  1KDC A;  1V8Q A;  4ZRZ A;  4X3S A;  3NTI A;  3FPP A;  1TWF H;  4O2D A;  2VXW A;  1EY6 A;  1W6K A;  5BN5 A;  4PZ6 A;  4A3C H;  1F2Z A;  2B2V C;  4HJ7 A;  5KNC A;  3CC4 A;  3SK4 A;  4B08 A;  1ENF A;  3I3C A;  1GXD C;  3S9W A;  1PH6 A;  3NEM A;  3T1H L;  3K7U C;  3HOU H;  5C3X A;  3OW7 A;  3LNN A;  3GTJ B;  3I70 A;  4KHV A;  2DUD A;  2WB1 B;  1AW7 A;  4A3L H;  1ML0 D;  1NE3 A;  1D5M C;  1VDZ A;  1S5F D;  1LTA D;  3HOZ H;  5M3F B;  1VF7 A;  1SJH D;  4A4I A;  3F2C A;  1Z47 A;  1NJI C;  4B9W A;  3M4O B;  4C3I G;  2E2I H;  2UXB Q;  4OX9 Q;  2F1M A;  5DAU A;  1Q12 A;  5JVG 3;  2JA9 A;  5IIF A;  1J5E L;  2HIX A;  2PI2 E;  3MXN A;  3MAQ A;  4FF1 A;  1MIU A;  1S5B D;  3H3V C;  4XQN A;  3S16 H;  3UDX A;  1X65 A;  3TS2 A;  5COY A;  1EY9 A;  5T1G A;  3DMU A;  1JCK B;  4K8J A;  4FNF A;  4FVM A;  4DV4 L;  1SND A;  2F0H A;  3DWP A;  4BY1 H;  2A5H A;  4O42 A;  2LSS A;  4Z9C B;  1BUV T;  2JA6 H;  1A3U A;  3CD6 A;  4QL5 A;  2KA7 A;  1YIJ A;  4X66 L;  1TQO A;  4PMB A;  3WDN A;  3JAM c;  1EL0 A;  3BYT B;  1WCM B;  2QCP X;  3S2D H;  3AQQ A;  2HQL A;  1U0L A;  4A3M B;  1CQV A;  3PMF A;  3RZO B;  2JEB I;  3I90 A;  2AQ3 B;  1JWU D;  1IKL A;  3H94 A;  1DD2 A;  2PI2 A;  1LTB D;  2F0O A;  3VYS A;  2B2W C;  4LF7 L;  1ZKO A;  2F0I A;  1VMP A;  4F87 A;  2OEO A;  1EY7 A;  3W1G A;  3SXH A;  1N36 Q;  1STG A;  3J81 E;  1Y1W H;  1PYW D;  4IQZ A;  3HOU G;  1N34 L;  2AQ2 B;  2K5V A;  2R7D A;  4A3L G;  4K8I A;  5IE8 A;  1VQI A;  1EIY B;  1A0I A;  4N9T A;  5EKK A;  5C5M A;  2J0T D;  2Q2T A;  3CCV A;  1EQV A;  1S72 A;  4V0B A;  5DM6 3;  2E8G A;  1HNZ L;  1YBY A;  3MZ5 A;  1F9Q A;  2RDF A;  1BNZ A;  1FJG L;  5FLX L;  4OXP A;  3CCR A;  1IYU A;  2XRS D;  3K0Y A;  2D62 A;  2N55 A;  1A2U A;  2JSO A;  3DUZ A;  4TQU S;  4A3E H;  2X69 A;  1PZK D;  4QMG A;  1SE2 A;  1X3P A;  4ID6 A;  5C4Z A;  4BY1 G;  4RG1 A;  2WIN B;  2B29 A;  1SMY C;  1TWH B;  3OTO Q;  1HRJ A;  2PZT A;  1PRT F;  3HRZ C;  1Q8K A;  4ZK9 B;  1V1P A;  4R8I A;  4H44 C;  3HOW B;  1CSQ A;  4MIU A;  4DV6 Q;  1IBL L;  1B8A A;  4EQO A;  2ZXR A;  2EYH A;  3NBH A;  3HKZ G;  3F1Z A;  1MD2 D;  4ODG A;  1VQ5 A;  1GUN A;  4BA1 I;  2RSN A;  3KF8 B;  2ZTD A;  4ZYS A;  4XDX A;  1VQB A;  4JOI A;  2XTI A;  4ZUJ A;  4JBM A;  3H0G H;  3J80 c;  1QJO A;  2UUB Q;  4BY7 H;  4LF8 Q;  1GD7 A;  1PH8 A;  3A7L A;  3I4L A;  4KMU C;  4R4Q A;  4OIJ A;  5KNB A;  1Y1W G;  2DGY A;  1D2B A;  3Q0A A;  2K04 A;  2JYO A;  5EKL A;  1YJW A;  2PQE A;  1SYC A;  4A3G B;  1O7L A;  3KDF A;  1GHJ A;  1J8I A;  2NVQ H;  2E74 C;  3ND8 A;  2J7Z A;  5JAV A;  4GLV B;  5M5W H;  2BE5 C;  1GHK A;  2K05 A;  4UPA A;  2JA8 B;  4QF4 A;  2H4O A;  2RF4 A;  3BG3 A;  3BVG A;  1PTO F;  3CCU A;  2HQE A;  1HNX L;  3ZJY C;  4IPH A;  3I4O A;  2NVT B;  4HIK A;  5I2X A;  2CHB D;  2R6G A;  3OYY A;  1HR0 Q;  1YI2 A;  4R9W A;  2SDF A;  4FDB A;  2R61 A;  3HOY H;  1A15 A;  3H6M A;  2BE5 D;  4QGU A;  2B63 H;  4B3M L;  1G2T A;  3CPW A;  3RN5 A;  5JPN C;  2DN8 A;  2F0T A;  3HKS A;  3T53 B;  4P75 A;  5CMD A;  1WTP A;  2CW0 C;  1C0A A;  1LAC A;  2RHQ B;  1O7Z A;  3TBI B;  4AH6 A;  4A3I H;  3MXU A;  4QUF A;  4L5R C;  2AHO B;  3GTO H;  5IGG A;  3STB D;  1B3A A;  5IYC H;  1K9M C;  1HFG A;  1BCP F;  4X65 Q;  1WTH A;  5C4J H;  1ENC A;  4ZKC B;  4LF6 Q;  4GN3 B;  2NVY B;  3PIP 3;  1CZG A;  4LFA Q;  3HOZ B;  3H91 A;  2IHE A;  1CK1 A;  1ENA A;  3EJI A;  2L4N A;  1MKH A;  2O2L D;  5IT9 c;  3D4R A;  3FRP B;  3H0G G;  1B7Y B;  4IUV A;  1VCI A;  4JYA Q;  1X55 A;  1QNU A;  1XPR A;  2PO4 A;  4A3F H;  4BY7 G;  3C1E A;  4FXK C;  3OMC A;  5C4X H;  2ZXP A;  5KEE A;  3J7Z C;  4N9P A;  3SDZ A;  1V1Q A;  5LMU L;  3CC7 A;  4EGV A;  1EIG A;  1VS0 A;  2KCM A;  5M5Y B;  3UDF A;  1XXG A;  3MXG A;  1SR3 A;  2JA6 B;  4YWL A;  1E3P A;  1IYJ B;  2DNE A;  1CUK A;  4XTC S;  2A6E C;  1SE3 A;  5JVH 3;  2Z8L A;  4JBJ A;  4CDF C;  1TWC H;  3WWV A;  5JEA J;  3HOY G;  3TME A;  5LMN Q;  3IAY A;  2B63 G;  4OX9 L;  2UXB L;  1N9W A;  2A6E D;  1ONL A;  1WJJ A;  2DJF C;  1U9R A;  1X3G A;  2KOL A;  4LJZ C;  4F7X A;  4FF4 A;  2JA5 B;  1E7Z A;  2R92 H;  5EAY A;  4EQP A;  5ELN A;  4YY3 Q;  5LL6 X;  1ILQ A;  4KLK A;  3VYU A;  3A8I E;  3I4M H;  3S1M H;  4F8M A;  2AUK A;  1TWA H;  5IYC G;  1XPO A;  5CC4 A;  1EEF D;  3S14 H;  3VDY A;  2Z9H A;  1H9S A;  3B6Y A;  3J81 c;  5M9O A;  1N32 Q;  3PUY A;  2EZV A;  3S1R H;  4JG2 A;  5C0X H;  5KYI A;  1IBM Q;  4YIJ A;  3S17 B;  4QIW B;  3UE1 A;  1VQ7 A;  1SSO A;  1X6O A;  2JE6 I;  3W2D A;  4LWC A;  3I4N B;  1HR0 W;  3GDE A;  1I50 H;  1I4H A;  2PNH A;  5C3E H;  2B2T C;  5IT9 L;  5LL6 S;  5HY6 A;  1C48 A;  5M3M H;  1ZXT A;  4RH6 A;  3KF6 B;  2D5D A;  2F0E A;  1GO3 E;  5C4X G;  2F3V A;  5HGQ A;  5ELD A;  3IL8 A;  4RGN A;  4A3J H;  2XRQ D;  1JB3 A;  3I73 A;  1A3T A;  1OO9 B;  4ZAI A;  4JI6 Q;  2WAQ B;  3SHL A;  3W3A A;  4G7H C;  2D2C C;  4GKK Q;  2EYO A;  1BBW A;  1STA A;  1K83 B;  3PUZ A;  3DHQ A;  2G9H D;  4TVA B;  2K5H A;  2A6H C;  1VMC A;  1CI3 M;  1MJE A;  1PYB A;  3K58 A;  3NBI A;  1IBK Q;  4BXX H;  1T9H A;  1F9S A;  1CT1 D;  3S1N B;  3PO2 H;  1WTW A;  3P75 A;  3RNU A;  2F52 A;  4NPS A;  3TP8 A;  2A6H D;  2RVL A;  3M7G A;  1TVX A;  1SYE A;  4L63 B;  2UXD Q;  4MZ9 A;  2R92 G;  1U4L A;  2ES2 A;  3GTM H;  2IX3 A;  1E24 A;  4PNY A;  4UDU C;  5ELE A;  3GTG B;  1JJC B;  4X64 Q;  3RZD B;  1I4R A;  3Q8D A;  4PMW A;  3PF4 A;  4I7A A;  1KDB A;  1EOV A;  2R7F A;  4HJ5 A;  1NSN S;  3MTS A;  1OXS C;  1UEB A;  5JPM C;  3UI2 A;  5K36 H;  4P71 A;  1EYG A;  1K8G A;  3OTO L;  3HOX H;  1BBX C;  2WV6 D;  2NVQ B;  5IP9 H;  5C0X G;  4C3J H;  1EUJ A;  1XWE A;  1B4O A;  1WVL A;  4XYO A;  1KL9 A;  4CGY B;  2K32 A;  1TY2 A;  4DN4 M;  4PG3 A;  4DV6 L;  5LMN W;  4DAV A;  4BBS H;  3GTQ H;  1GUW A;  3C3L A;  3ERS X;  2YYZ A;  3A8J E;  4LUZ A;  1EY5 A;  4A3J G;  4Y7N H;  3RLN A;  2F3I A;  2LKV A;  2ZTC A;  2E2H B;  4IPC A;  2AWO A;  4BA2 I;  2UUB L;  4C2M B;  4LF8 L;  1JQY D;  2F0V A;  3C1F A;  3NE5 B;  4A3I B;  3GTK B;  3GTO B;  5TSS A;  1MHW C;  2EJG C;  3D4D A;  2ICI A;  2ASB A;  2F03 A;  4IFD J;  5A2Q L;  2Q8R E;  4B3S Q;  1O80 A;  3UE0 A;  3BJU A;  4BXX G;  5M3F G;  1M90 C;  1EIF A;  3BDL A;  3PO2 G;  2KEN A;  3TP7 A;  1VQC A;  3HOV G;  3NQI A;  1TS3 A;  1PRT C;  3EQL C;  2RDH A;  3J7A 5;  1HH2 P;  1SNQ A;  2JA7 B;  3TZD A;  1CHQ D;  4O0A A;  5EPL A;  2P5Z X;  5CV6 A;  1U4M A;  1EYD A;  4LFC Q;  4DKA C;  3VYT A;  5IGD A;  1HNW Q;  1YHA A;  2C5C A;  2FIN B;  4M1U B;  2PQA B;  3KOJ A;  4JV5 Q;  3T4A C;  1HR0 L;  2QIL A;  4C1N I;  1SE4 A;  1YIT A;  4A3F B;  2RSO A;  4KKT A;  3E5S A;  2KQ3 A;  4GKJ Q;  1DGS A;  2L15 A;  4OL7 A;  5EBD A;  4K5V A;  4C3I H;  3M85 A;  1TS5 A;  2K75 A;  2Z4I A;  3D3R A;  1GUG A;  1E2Z A;  1MBY A;  1L0W A;  1C8C A;  5K36 G;  1HZ9 A;  4JI4 Q;  4IZ8 A;  1DCZ A;  3QWN A;  5C0X I;  3HOX G;  2RBM A;  1YJN A;  5IP9 G;  3BDC A;  4C3J G;  5JOB A;  4BS9 A;  1LV9 A;  4X65 L;  2IL8 A;  3PO3 H;  4LF6 L;  1P16 A;  1M8A A;  1YNN D;  4L6T B;  4HAE A;  2PZU A;  5GAG C;  3GP7 A;  2B2U C;  1TWC B;  4LFA L;  4BBS G;  2F4I A;  3QO2 A;  3DM3 A;  2EIF A;  2OWO A;  3KFU A;  1HCZ A;  4A3B H;  2MO1 A;  1GKH A;  2KCT A;  4JBK A;  4MN3 A;  3F2B A;  1PTO C;  4NKL A;  2UUA Q;  2A73 B;  3SK8 A;  3HEJ A;  4JYA L;  3GTP B;  1UE1 A;  3KLS A;  4KD4 A;  3TP6 A;  1ICW A;  3SVM A;  3PIO A;  4LF9 Q;  3S1M B;  3I4M B;  2KHI A;  1PXU A;  2F0S A;  1SXT A;  4RGM A;  5IYD G;  2YTY A;  3FMC A;  3G6E A;  2A19 A;  1YNJ D;  2BA1 A;  1PTO D;  1AE2 A;  3S14 B;  1A6X A;  1PH9 A;  3OSO A;  2UUC Q;  2KJX A;  1KLU D;  4DAP A;  5IP7 G;  2X6L A;  4P73 A;  4CDD C;  2QKI C;  1IXR A;  3K7A H;  2Z6K C;  4B3R Q;  4NDX A;  2ZT9 C;  3J7A V;  3GTL H;  1QOH A;  5CGK A;  4L8J A;  2CH4 A;  2RA4 A;  1BCP C;  4KHP Q;  1K73 C;  5C3E B;  4HCS A;  2N3S A;  1A62 A;  1IL8 A;  2K01 A;  2CVR A;  2SNM A;  5LMN L;  2LXK A;  4JI5 Q;  1BCP D;  2Z1C A;  4TSS A;  4XQJ A;  2IW3 A;  2CQO A;  4H7B A;  3MWY W;  1SFO H;  4JI7 L;  3MEH A;  5C6A A;  3KJP A;  1EQQ A;  4YY3 L;  4K5X A;  1XMQ Q;  4AYB B;  1HFN A;  1YEZ A;  4U68 A;  5KYL A;  5FLM G;  2EDG A;  2C9O A;  1SBB B;  4IUR A;  2YTV A;  4HCE A;  1CKM A;  4ME3 A;  3H15 A;  1NR2 A;  3EVQ A;  1II3 A;  3PO3 G;  5EJW A;  1N32 L;  2E5L Q;  1D1I A;  3KLW A;  3I55 A;  1UAP A;  4J1M A;  1IBM L;  2UU9 Q;  3S15 H;  4ABN A;  4A3B G;  4OGQ C;  2NZ1 D;  2Y0S B;  3BYY B;  1AZQ A;  1WOC A;  2R7Z B;  3RUZ A;  3L2P A;  3NTK A;  3GTM B;  3R2T A;  1JE5 A;  1QZH A;  4DK1 A;  2ICE C;  3KBG A;  5DM7 3;  4HJA A;  1L0X B;  2F0M A;  4I7Z C;  1QVG A;  3CHB D;  5ELC A;  1PRT B;  4NXM Q;  1LTT D;  1NCV A;  3HKZ E;  3SEB A;  4ZKB B;  5IGF A;  1S5D D;  5GRO A;  4JI6 L;  4A3K H;  2MO0 A;  1I3Q B;  2CKZ B;  2NUC A;  3I2Z A;  1NMG A;  1B2T A;  2NBF A;  4GKK L;  4H13 C;  4ALP A;  2VUM G;  1MGS A;  1PMR A;  1L2F A;  1WTR A;  1LTS D;  2ATW A;  1I4Q A;  3NP8 A;  1PFM A;  1IBK L;  3CRL C;  1QG7 A;  3L7Z C;  1KRS A;  2QGQ A;  1Q1E A;  1Q8I A;  1CKN A;  2QDB A;  4R4T A;  3S24 A;  4J15 A;  1X3Q A;  2GVB A;  2K50 A;  4P2C B;  3U9S A;  2V4D A;  4CJ1 B;  3CC2 A;  4UAI A;  4QCL A;  1VQ4 A;  2F4V Q;  2UXD L;  1G51 A;  1TT2 A;  4TKO B;  3NEN A;  5CYU A;  1FNU A;  4CJ0 B;  4FF2 A;  5IGB A;  4X64 L;  2HD3 A;  1HTL D;  1W6J A;  4KY5 A;  1T5E A;  3F2U A;  3N6R A;  1HA6 A;  4DAM A;  3M7N A;  3FKI H;  4KI0 A;  1U4P A;  1DON A;  2QA4 A;  5NUC A;  3BU2 A;  2NVX B;  1PTO B;  2CH4 W;  3K5L A;  4UP8 A;  4RHR A;  1R9T H;  2LMC B;  1XPU A;  4O1N A;  2HT1 A;  1STE A;  1HQM C;  4YHH Q;  3TSS A;  4YCU A;  3A56 A;  4PMC A;  5D65 A;  1PYS B;  3HS0 C;  1N33 Q;  4KKS A;  4K0K L;  1Y1V H;  3BZK A;  2VL6 A;  1HUN A;  4BBR H;  3HG9 A;  1PHJ A;  2CWA A;  2EXD A;  4L5Q A;  4DAY A;  1GM5 A;  1YHQ A;  1D5X C;  2RCN A;  1SDF A;  3JAM L;  2KED A;  4DNR B;  4IPD A;  4JI3 Q;  2PMZ E;  2VB3 X;  1AP0 A;  5FK9 C;  1FGB D;  3N52 A;  5I6W A;  2YU9 B;  1OXX K;  2F0G A;  4C3I B;  2VQF Q;  5M5X B;  1Y8N B;  4V19 0;  1BCP B;  2KCN A;  3T56 B;  1EYA A;  2PW7 A;  3I91 A;  4A3K G;  1D8L A;  1UE5 A;  2Z4H A;  1O78 A;  4A93 B;  4DR2 Q;  5JJK A;  4ULL A;  1VQO A;  4POF A;  3ULJ A;  1NTG A;  1EY8 A;  4DF7 A;  1NBW A;  1KNA A;  3OIP A;  1D1K A;  4JOI C;  4B3S L;  3P7J A;  2TSS A;  2G9D A;  1RL2 A;  2N8N A;  1WI5 A;  1M4V A;  1G6Z A;  5D14 A;  2N88 A;  1BO0 A;  2ZJQ A;  4NXN Q;  5IYB H;  3CQZ H;  2ZM6 Q;  1MSH A;  2JA5 G;  1JE4 A;  5JJZ A;  3AU7 A;  4LFC L;  4UY8 C;  1S40 A;  4JPB W;  3GV3 A;  1HNW L;  2CCZ A;  4GOP A;  5GAD C;  1EU3 A;  1QNK A;  2EPB A;  4JV5 L;  2L5T A;  2QDL A;  3VR3 A;  3OPO A;  4JC0 A;  1K28 A;  3CW2 C;  3CCQ A;  5C44 H;  3MXN B;  4GKJ L;  1HQR D;  1U4R A;  1ZYR C;  3V96 A;  5FO9 B;  1QB5 D;  1HUM A;  4XYQ A;  1A2T A;  2BH8 A;  3FKI G;  4QB4 A;  1FL0 A;  1TWF B;  1RCV D;  2OF1 A;  2I0Q A;  3M4Q A;  3STB C;  2VY3 A;  4X3K A;  4JI4 L;  4MNO A;  5EKI A;  3K0X A;  5D3I B;  1ZYR D;  1JMC A;  4DA2 A;  4ILW A;  2NWG A;  2MPM A;  2K28 A;  4P72 A;  4EQN A;  1Y1V G;  4BBR G;  2VB2 X;  3V2T A;  4LFB Q;  1QUQ A;  1ICF B;  3HOU B;  1D6E C;  1NNX A;  5L37 A;  5JEA H;  2KHJ A;  1VQL A;  1JOQ A;  4IUT A;  4PZ7 A;  2NYZ D;  4DV1 L;  3CAM A;  3PIO 3;  3G48 A;  4JCV E;  5KRU A;  1ESR A;  3P20 A;  4C3H H;  1UE6 A;  4WJW A;  1I4P A;  2UUA L;  3DEO A;  1Q7Y C;  3TS0 A;  1WD1 A;  1P8L A;  5I9P A;  2E2I B;  1E2V A;  4GLA C;  1O7Y A;  3ZYY X;  4LF9 L;  2VQE Q;  4GN5 A;  1EY0 A;  4R4C A;  2B8G A;  5FOB B;  1E0B A; 
#chains in the Genus database with same CATH homology
 4KTA A;  3S16 B;  3NSW A;  4CBV A;  4M8A A;  3J7Y W;  3WOE A;  1B50 A;  3VR5 A;  4PV1 C;  3FVQ A;  1EZ8 A;  4KY6 A;  1OXV A;  4BY1 B;  1XTC D;  1TII D;  3Q6S A;  2F3W A;  4HN7 A;  5T1I A;  2DY8 A;  3BS1 A;  4CKB A;  3NUC A;  4KJN A;  4K6L A;  1NR4 A;  1ET6 A;  1FNV A;  2XVS A;  3S2D B;  2RKS A;  4ZQ3 A;  1EFI D;  3KLR A;  1RF2 D;  3OWF A;  2IX1 A;  1H9M A;  5CV8 A;  4XT3 B;  3TZU A;  1A3V A;  2ID0 A;  2ZXO A;  1D5Z C;  2O5I C;  1SNP A;  2XN9 C;  3EA6 A;  1CFM A;  1QIL A;  2B8F A;  4CKE A;  2AQ1 B;  1WTO A;  4DXF A;  4Q5V A;  1AZP A;  1Y1W B;  2I07 B;  1E2W A;  3KLS X;  2NTT A;  4OIK A;  2KEC A;  5JEA G;  1V1P B;  5G3L D;  5IGE A;  1RKN A;  3ITP A;  2EYF A;  1KAA A;  4X3T A;  2F0U A;  4C3H G;  1HHV A;  4XIG S;  1CQF A;  3NXW A;  1STH A;  5ISR A;  2M2L A;  2I46 A;  1CTM A;  4DGZ A;  1UNS A;  3H09 A;  3LWE A;  4A3E B;  2RDG A;  1KAB A;  2D9U A;  2K5W A;  1STB A;  5E1F A;  2A74 C;  1H9R A;  4RFB A;  5E4W C;  3VYR A;  1PLF A;  4OO1 G;  1KNE A;  4ZUI A;  3ND9 A;  5FLX E;  5KGU A;  3NHH A;  2XIW A;  2A69 C;  3QIA A;  2F0F A;  1JC7 A;  1LT6 D;  3H0G B;  1LTR D;  3U9O A;  5CR3 A;  3QG1 A;  4IFD H;  4BY7 B;  3CRK C;  1H9J A;  4FXG C;  2A69 D;  3K5N A;  1B53 A;  2O4X A;  1AFP A;  2DNC A;  3GD7 A;  2MJ8 A;  4C1N K;  4WFN 3;  1CA5 A;  1BXT A;  1LTG D;  1RTN A;  1PFN A;  2PW5 A;  2F0L A;  2BDO A;  3CQZ B;  3J81 L;  3TP5 A;  4RCO A;  1ET9 A;  4KY7 A;  4E6I A;  5C0X J;  1KDA A;  3URY A;  2PPB C;  5M5W B;  3K5M A;  1EWC A;  4RGT A;  1JWS D;  1DOL A;  1ESF A;  2WKC A;  1JR0 D;  4KD3 A;  4FF3 A;  3FPU B;  5COR A;  4IUU A;  3HOY B;  3GO5 A;  2A68 C;  1Q1B A;  2B63 B;  3PV0 A;  5F2D A;  4B9X A;  3D6W A;  3R2I A;  1EWH A;  1STN A;  2TMP A;  2A68 D;  2MP1 A;  2NB0 A;  2IX0 A;  4KN4 C;  5I2Y A;  1FR3 A;  1WTQ A;  2EJF C;  3X3N A;  4OO1 I;  2LY7 A;  1BF4 A;  3OWE B;  5C4J B;  3IFD A;  4RKL A;  4R8N A;  4LK1 C;  3MHB A;  3PUX A;  1SAP A;  4U67 3;  5IOC A;  1WTX A;  2LS0 1;  4KJO A;  2J4X A;  3O13 A;  4IFD G;  4NMZ A;  5C4X B;  1HTP A;  3D4W A;  5EQ0 A;  2NN6 H;  1DYQ A;  2KHS A;  2EYM A;  5EPJ A;  2HCI A;  2OXP A;  3S2H B;  1CA6 A;  4F88 A;  1F2M A;  1H9S B;  3QJY A;  1YNN C;  1BR9 A;  5AFW A;  4J6H A;  2L11 A;  2KVM A;  3OMG A;  5CV9 A;  1Q3L A;  3VR2 A;  5KND A;  1F9P A;  1BOS A;  3SE0 A;  3A8K E;  4IUN A;  4OHJ A;  5E4X A;  3TN2 A;  2B2Y A;  2DY7 A;  4DK0 A;  1LTI D;  5C3W A;  2H1E A;  3I72 A;  4CJ2 C;  2VNU D;  1EYC A;  4JK1 C;  2HDL A;  1K8O A;  1CHP D;  3TDQ A;  1YNJ C;  4HED A;  2RQX A;  3RMH A;  3A54 A;  3AB9 A;  2R92 B;  2PZW A;  4G7Z C;  3OOC A;  2FJ2 A;  1EY4 A;  5G3L F;  1TWA B;  3WOF A;  3C2P A;  3MFG A;  3MVV A;  3VA7 A;  3VR4 A;  3EFX D;  2E75 C;  3S1R B;  4EVO A;  1SNC A;  3AMU A;  1TU2 B;  2B2V A;  1I50 B;  1TS2 A;  1GUT A;  2AWN A;  5M3M B;  3KF8 A;  4IFD I;  1L0Y B;  2PYK A;  4FXD A;  5HGT A;  4KHZ A;  2NN6 G;  4A3J B;  1S5E D;  4HR7 B;  2QEJ C;  1B1Z A;  2EVB A;  2X6G A;  4QUC A;  2B39 A;  1IW7 C;  3ONA B;  2JEA I;  1JOO A;  2SEB D;  1Y69 U;  1LAB A;  2XSC A;  5FO8 B;  5IT9 E;  3PO2 B;  1LLR D;  1S5C D;  3HOV B;  1HPC A;  1IW7 D;  1QWY A;  1RJT A;  2MHV A;  3DXJ C;  3L3O C;  4K6D A;  4G57 A;  5C5L A;  2M9V A;  5BN4 A;  3SR1 A;  1SYG A;  4WRD A;  4RWS C;  3ERO A;  3Q24 A;  5DEH A;  2IPK D;  4S3S A;  1VF5 C;  5J22 A;  1EU4 A;  3HOX B;  4C3J B;  1IYV A;  1B44 D;  2B2W A;  4RA8 A;  1R4P B;  1OXT A;  4J8Q A;  3NQT A;  4BBS B;  4G4K A;  3GTQ B;  2IWH A;  1T5X D;  5CV7 A;  2NN6 I;  2M00 A;  2F0J A;  2K03 A;  5IOD A;  4Y7N B;  4X3U A;  5CBE E;  1XX8 A;  1TS4 A;  3RLF A;  3DM1 A;  3S1Q B;  2SOB A;  1GUO A;  3R8B A;  4RHS A;  1PZI D;  3DWA A;  3BDO A;  1X32 A;  3Q22 A;  2JP1 A;  2L9H A;  5EPK A;  1JWM D;  3BVZ A;  1IHZ A;  2BA0 A;  2WII B;  1C4Q A;  4PQX A;  4Q0F A;  1SNO A;  3X3M A;  1F2Y A;  2EY6 A;  3IKJ A;  1OXU A;  1R4Q B;  4ZLT F;  1SEB D;  1Z6H A;  3OIQ A;  1SYF A;  5I9O A;  3MFY A;  2EJM A;  1ILP A;  1H9K A;  1PZJ D;  3K6O A;  5A2Q E;  1QE6 A;  4LMQ D;  2JXM B;  2Q8I B;  3VA5 A;  4TRD A;  3R3O A;  1SMY D;  4DFA A;  3PO3 B;  2K6A A;  4I65 A;  2KUM A;  1SJE D;  4RKB A;  5ELB A;  2K1B A;  5D3D A;  4A3B B;  1RD9 D;  1RTO A;  3CKI B;  2PCF B;  3M4Y A;  1G2S A;  2EE1 A;  2F0D A;  3R93 A;  2EYJ A;  1JIC A;  3KK7 A;  2EOT A;  3A7A B;  4MHE A;  4C56 C;  3M3Y B;  3K7A B;  2VUM B;  2ENB A;  1TY0 A;  3GTL B;  1SNM A;  2F0W A;  2BOS A;  4XXE A;  5A35 A;  3P1H A;  3V05 A;  3J80 L;  2L55 A;  1WD0 A;  2IJ0 A;  4JBW A;  2IT1 A;  1NAP A;  2LFN A;  3RD4 A;  4KKU A;  4GZY C;  2KEE A;  5KIX A;  1SFO B;  4BWG B;  3MXP A;  2EYL A;  1CZW A;  4IUP A;  1EOT A;  2EY2 A;  3IFT A;  3HGB A;  3QB3 A;  2CW0 D;  2K5D A;  3GQB A;  4FYD A;  2XNA C;  3SK5 A;  1LT3 D;  2XWJ B;  2NTS A;  5I6Y A;  1DJR D;  3S15 B;  1RHP A;  1FNW A;  4CKC A;  1STY A;  3C46 A;  3GV6 A;  4WOR A;  3NTH A;  3LWU A;  3FEW X;  4OO1 H;  4DU9 A;  5I4D A;  3LX0 A;  3K57 A;  1SYD A;  2EYP A;  3D8G A;  3L9A X;  2F0P A;  3HKZ B;  4DNT B;  3KUP A;  1PDQ A;  1BDO A;  4LAA A;  2K7V A;  5K5P A;  2AUJ D;  5E3F A;  4A3K B;  1DXM A;  4HTH A;  1LT5 D;  1EIH A;  3K59 A;  5J39 A;  2WKD A;  3T13 A;  2HCC A;  1Y8O B;  2L0C A;  1LO5 D;  4KN7 C;  2E2D C;  4ME5 A;  2K5Q A;  5CV4 A;  1G29 1;  3G6J B;  5EBC A;  1IKM A;  1EQT A;  1DZ1 A;  1I4X A;  3FDT A;  1UEA B;  3NWT A;  3FKI B;  3HZX A;  2B2T A;  1B9N A;  1SYB A;  4K2K A;  1R9T B;  1I4G A;  2XWB B;  2R3Z A;  1FYC A;  1DOM A;  4K2L A;  5CV5 A;  4HMJ A;  1WTV A;  1Y1V B;  3OHX C;  1J9O A;  4BBR B;  4RAU C;  1DOK A;  4FO2 A;  4HSV A;  5FKA C;  3NK9 A;  5ELF A;  1GUS A;  5C4H A;  2PMZ B;  2FMC A;  3MC0 B;  2GA4 B;  5IGC A;  2FHT A;  2FFK B;  3NPP A;  2PNR C;  2O5J C;  3J7A F;  2E76 C;  5LHY 1;  1NUC A;  3G7L A;  2EY5 A;  1F77 A;  1KTK A;  1AN8 A;  1ROD A;  4KK7 A;  1CM9 A;  4IN3 A;  3NWS A;  1F2L A;  3JAM E;  1HA5 A;  3CU7 A;  2BCO A;  4FP5 D;  5J1Z A;  2WP8 J;  3ERQ A;  3D6C A;  2L1B A;  2WAC A;  2K33 A;  1GJX A;  5C44 B;  4K5W A;  1EEI D;  1F9R A;  1I6V C;  3PUW A;  1XYI A;  1QCB D;  1G8Z D;  1K8M A;  2EXZ A;  2L12 A;  3Q23 A;  2F0Q A;  4RGO S;  4K14 A;  3KBX A;  1JOR A;  3A55 A;  1TR5 A;  3BZD B;  2F0N A;  1LT4 D;  1RDP D;  3E0J A;  2QF7 A;  3T16 A;  1BQQ T;  4KV6 A;  2SNS A;  3T51 B;  1MI2 A;  4NP5 A;  1JOK A;  3HP3 A;  4C3H B;  3D31 A;  2FMM A;  1GOZ A;  3PUV A;  1PFB A;  1KLG D;  4NW2 A;  5DNF A;  3QOL A;  4XQQ A;  1FD7 D;  1PTO H;  2MUY A;  1AEX A;  2KCC A;  4CHT B;  1S4Z A;  3I8Z A;  4DXG A;  3BVM A;  5FO7 B;  1PRT D;  1B9M A;  1Z7T A;  4G7O C;  4HMI A;  2BDN A;  1TKW B;  3QOJ A;  4IUQ A;  1ZEQ X;  2EY1 A;  2OT2 A;  1Q90 A;  4H0L C;  3J80 E;  1V1O A;  4A3D B;  2Q8T A;  2R93 B;  2B2U A;  1EZ6 A;  3E6Z X;  2B2Y C;  4IAL A;  3MA2 B;  2F0K A;  2HUG A;  3K5O A;  1MSG A;  5CBA E;  1G91 A;  5EGT A;  3DEP A;  5BN3 A;  1TWG B;  3SK6 A;  5HUR A;  2HDM A;  1HXY D;  2E2J B;  2CQA A;  1DM0 B;  1UUP A;  3DWQ A;  4HSP A;  3VR6 A;  1V43 A;  2MGS A;  4XT1 B;  4RCN A;  1Y8P B;  1I6H B;  1KDC A;  1V8Q A;  4ZRZ A;  4X3S A;  3NTI A;  3FPP A;  2VXW A;  1EY6 A;  1W6K A;  5BN5 A;  1F2Z A;  2B2V C;  5KNC A;  3SK4 A;  4B08 A;  1ENF A;  3I3C A;  1GXD C;  3S9W A;  5C3X A;  3OW7 A;  3LNN A;  3GTJ B;  3I70 A;  4KHV A;  2WB1 B;  1AW7 A;  1ML0 D;  1D5M C;  1VDZ A;  1S5F D;  1LTA D;  5M3F B;  1VF7 A;  1SJH D;  3M4O B;  1Z47 A;  4B9W A;  4C3I G;  2F1M A;  5DAU A;  1Q12 A;  5JVG 3;  5IIF A;  3MXN A;  3MAQ A;  4FF1 A;  1S5B D;  3H3V C;  4XQN A;  5COY A;  1EY9 A;  5T1G A;  3DMU A;  1JCK B;  4K8J A;  4FNF A;  4FVM A;  1SND A;  2F0H A;  3DWP A;  2A5H A;  4O42 A;  4Z9C B;  1BUV T;  1A3U A;  2KA7 A;  1TQO A;  4PMB A;  3WDN A;  1EL0 A;  3BYT B;  1WCM B;  2QCP X;  4A3M B;  1CQV A;  3PMF A;  3RZO B;  2JEB I;  3I90 A;  2AQ3 B;  1JWU D;  1IKL A;  3H94 A;  1DD2 A;  1LTB D;  2F0O A;  3VYS A;  2B2W C;  1ZKO A;  2F0I A;  1VMP A;  4F87 A;  2OEO A;  1EY7 A;  3SXH A;  1STG A;  3J81 E;  1PYW D;  4IQZ A;  2AQ2 B;  4K8I A;  4N9T A;  5EKK A;  5C5M A;  2J0T D;  1EQV A;  4V0B A;  5DM6 3;  3MZ5 A;  1F9Q A;  2RDF A;  1BNZ A;  5FLX L;  1IYU A;  2XRS D;  3K0Y A;  2D62 A;  2N55 A;  1A2U A;  2JSO A;  3DUZ A;  4TQU S;  2X69 A;  1PZK D;  4QMG A;  1SE2 A;  1X3P A;  4ID6 A;  5C4Z A;  2WIN B;  1SMY C;  1TWH B;  1HRJ A;  2PZT A;  1PRT F;  3HRZ C;  4ZK9 B;  1V1P A;  4R8I A;  4H44 C;  3HOW B;  4MIU A;  4EQO A;  2ZXR A;  2EYH A;  3NBH A;  1MD2 D;  4ODG A;  1GUN A;  4BA1 I;  2RSN A;  4ZYS A;  4XDX A;  4ZUJ A;  1QJO A;  3A7L A;  3I4L A;  4KMU C;  4OIJ A;  5KNB A;  1D2B A;  3Q0A A;  2K04 A;  2JYO A;  5EKL A;  2PQE A;  1SYC A;  4A3G B;  1O7L A;  1GHJ A;  1J8I A;  2E74 C;  3ND8 A;  2J7Z A;  5JAV A;  2BE5 C;  1GHK A;  2K05 A;  2JA8 B;  4QF4 A;  2H4O A;  3BG3 A;  3BVG A;  1PTO F;  2HQE A;  2NVT B;  5I2X A;  2CHB D;  2R6G A;  4R9W A;  2SDF A;  2R61 A;  1A15 A;  3H6M A;  2BE5 D;  1G2T A;  5JPN C;  2DN8 A;  2F0T A;  3T53 B;  5CMD A;  1WTP A;  2CW0 C;  1LAC A;  3TBI B;  1O7Z A;  3MXU A;  4QUF A;  5IGG A;  1B3A A;  1HFG A;  1BCP F;  1ENC A;  4ZKC B;  2NVY B;  3PIP 3;  1CZG A;  3HOZ B;  3H91 A;  1CK1 A;  1ENA A;  3EJI A;  2L4N A;  2O2L D;  3D4R A;  3FRP B;  4IUV A;  1VCI A;  1QNU A;  2PO4 A;  3C1E A;  4FXK C;  3OMC A;  2ZXP A;  5KEE A;  4N9P A;  3SDZ A;  4EGV A;  1EIG A;  5M5Y B;  1XXG A;  3MXG A;  2JA6 B;  2DNE A;  4XTC S;  2A6E C;  1SE3 A;  5JVH 3;  2Z8L A;  5JEA J;  3TME A;  3IAY A;  2A6E D;  1ONL A;  1U9R A;  2KOL A;  4LJZ C;  4F7X A;  4FF4 A;  2JA5 B;  4EQP A;  5LL6 X;  1ILQ A;  3VYU A;  3A8I E;  4F8M A;  2AUK A;  5CC4 A;  1EEF D;  1H9S A;  5M9O A;  3PUY A;  2EZV A;  5C0X H;  5KYI A;  4YIJ A;  3S17 B;  4QIW B;  1SSO A;  2JE6 I;  3W2D A;  3I4N B;  1I4H A;  2B2T C;  5IT9 L;  5LL6 S;  1C48 A;  1ZXT A;  4RH6 A;  2D5D A;  2F0E A;  2F3V A;  5ELD A;  3IL8 A;  4RGN A;  2XRQ D;  1JB3 A;  3I73 A;  1A3T A;  1OO9 B;  4ZAI A;  2WAQ B;  3SHL A;  3W3A A;  4G7H C;  2D2C C;  2EYO A;  1STA A;  1K83 B;  3PUZ A;  3DHQ A;  2G9H D;  2A6H C;  1VMC A;  1CI3 M;  3K58 A;  3NBI A;  1F9S A;  1CT1 D;  3S1N B;  1WTW A;  3P75 A;  3TP8 A;  2A6H D;  2RVL A;  3M7G A;  1TVX A;  1SYE A;  4L63 B;  1U4L A;  2IX3 A;  4PNY A;  4UDU C;  5ELE A;  3GTG B;  3RZD B;  1I4R A;  4PMW A;  1KDB A;  1NSN S;  3MTS A;  1OXS C;  5JPM C;  3UI2 A;  5K36 H;  1BBX C;  2WV6 D;  2NVQ B;  5C0X G;  1XWE A;  1B4O A;  1WVL A;  4XYO A;  4CGY B;  2K32 A;  1TY2 A;  4DN4 M;  4DAV A;  1GUW A;  3C3L A;  2YYZ A;  3A8J E;  1EY5 A;  2LKV A;  2E2H B;  2AWO A;  4BA2 I;  4C2M B;  1JQY D;  2F0V A;  3C1F A;  3NE5 B;  4A3I B;  3GTK B;  3GTO B;  5TSS A;  2EJG C;  3D4D A;  2ICI A;  2F03 A;  4IFD J;  5A2Q L;  2Q8R E;  1O80 A;  3BDL A;  3TP7 A;  3NQI A;  1TS3 A;  1PRT C;  3EQL C;  2RDH A;  1SNQ A;  2JA7 B;  3TZD A;  1CHQ D;  5EPL A;  5CV6 A;  1U4M A;  1EYD A;  3VYT A;  5IGD A;  2C5C A;  2FIN B;  4M1U B;  3T4A C;  2QIL A;  4C1N I;  1SE4 A;  4A3F B;  2RSO A;  4KKT A;  3E5S A;  2KQ3 A;  4OL7 A;  5EBD A;  4K5V A;  3M85 A;  1TS5 A;  2Z4I A;  3D3R A;  1GUG A;  1E2Z A;  1MBY A;  1C8C A;  5K36 G;  4IZ8 A;  1DCZ A;  3QWN A;  5C0X I;  2RBM A;  3BDC A;  4C3J G;  5JOB A;  4BS9 A;  1LV9 A;  2IL8 A;  1M8A A;  1YNN D;  4L6T B;  4HAE A;  2PZU A;  3GP7 A;  2B2U C;  1TWC B;  2F4I A;  3QO2 A;  1HCZ A;  4MN3 A;  1PTO C;  4NKL A;  2A73 B;  3SK8 A;  3HEJ A;  3GTP B;  3KLS A;  4KD4 A;  3TP6 A;  1ICW A;  3SVM A;  3S1M B;  3I4M B;  1PXU A;  2F0S A;  1SXT A;  4RGM A;  3FMC A;  1YNJ D;  2BA1 A;  1PTO D;  3S14 B;  1A6X A;  3OSO A;  2KJX A;  1KLU D;  4DAP A;  2X6L A;  2QKI C;  4NDX A;  2ZT9 C;  3J7A V;  1QOH A;  5CGK A;  4L8J A;  2RA4 A;  1BCP C;  5C3E B;  4HCS A;  1IL8 A;  2K01 A;  2CVR A;  2SNM A;  1BCP D;  2Z1C A;  4TSS A;  4XQJ A;  2IW3 A;  4H7B A;  3MWY W;  3MEH A;  5C6A A;  4K5X A;  4AYB B;  1HFN A;  4U68 A;  5KYL A;  2EDG A;  2C9O A;  1SBB B;  4IUR A;  4HCE A;  1NR2 A;  3EVQ A;  1II3 A;  5EJW A;  1D1I A;  1UAP A;  4J1M A;  4ABN A;  4OGQ C;  2NZ1 D;  2Y0S B;  3BYY B;  1AZQ A;  2R7Z B;  3RUZ A;  3NTK A;  3GTM B;  3R2T A;  4DK1 A;  2ICE C;  3KBG A;  5DM7 3;  1L0X B;  2F0M A;  4I7Z C;  3CHB D;  5ELC A;  1PRT B;  3SEB A;  5IGF A;  4ZKB B;  1LTT D;  1NCV A;  1S5D D;  1I3Q B;  2NUC A;  1B2T A;  2NBF A;  4H13 C;  1MGS A;  1PMR A;  1WTR A;  1LTS D;  1I4Q A;  3NP8 A;  1PFM A;  3CRL C;  1QG7 A;  3L7Z C;  1Q1E A;  1Q8I A;  2QDB A;  1X3Q A;  4P2C B;  3U9S A;  2V4D A;  4CJ1 B;  4UAI A;  4QCL A;  1TT2 A;  4TKO B;  5CYU A;  1FNU A;  4CJ0 B;  4FF2 A;  5IGB A;  1HTL D;  1W6J A;  4KY5 A;  1T5E A;  3F2U A;  3N6R A;  1HA6 A;  3M7N A;  4KI0 A;  1U4P A;  1DON A;  5NUC A;  2NVX B;  1PTO B;  3K5L A;  4RHR A;  2LMC B;  4O1N A;  1STE A;  1HQM C;  3TSS A;  3A56 A;  4PMC A;  5D65 A;  3HS0 C;  4KKS A;  1HUN A;  3HG9 A;  4DAY A;  1D5X C;  1SDF A;  3JAM L;  2KED A;  4DNR B;  2VB3 X;  1AP0 A;  5FK9 C;  1FGB D;  3N52 A;  5I6W A;  2YU9 B;  1OXX K;  2F0G A;  4C3I B;  5M5X B;  1Y8N B;  4V19 0;  1BCP B;  2KCN A;  3T56 B;  1EYA A;  2PW7 A;  3I91 A;  2Z4H A;  1O78 A;  4A93 B;  4ULL A;  1EY8 A;  4DF7 A;  1KNA A;  3OIP A;  1D1K A;  3P7J A;  2TSS A;  2G9D A;  1M4V A;  1G6Z A;  5D14 A;  2N88 A;  1BO0 A;  1MSH A;  1JE4 A;  5JJZ A;  3AU7 A;  3GV3 A;  1EU3 A;  1QNK A;  2EPB A;  2L5T A;  3VR3 A;  3OPO A;  1HQR D;  1U4R A;  1ZYR C;  3V96 A;  5FO9 B;  1QB5 D;  1HUM A;  4XYQ A;  1A2T A;  4QB4 A;  1TWF B;  1RCV D;  2OF1 A;  4X3K A;  5EKI A;  5D3I B;  1ZYR D;  4DA2 A;  4ILW A;  2NWG A;  2MPM A;  2K28 A;  4EQN A;  2VB2 X;  3V2T A;  3HOU B;  1D6E C;  5JEA H;  1JOQ A;  4IUT A;  2NYZ D;  3PIO 3;  5KRU A;  1ESR A;  3P20 A;  4WJW A;  1I4P A;  3DEO A;  1WD1 A;  5I9P A;  2E2I B;  1E2V A;  1O7Y A;  3ZYY X;  1EY0 A;  2B8G A;  5FOB B;  1E0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...