3I8ZA

Crystal structure of human chromobox homolog 4 (cbx4)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
FAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human chromobox homolog 4 (CBX4)
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 SUMO-protein ligase CBX4
total genus 8
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i8zA00
1IKLA 1QG7A 1X3QA 3SVMA 4IUUA 4IUVA 2H1EA 2RSNA 2B2UA 1NCVA 1F2LA 3I90A 5DNFA 1SDFA 1O7YA 2K01A 1Q3LA 5EPJA 2DY7A 2SDFA 1BNZA 3I8ZA 2FJ2A 3KUPA 1M8AA 5EKIA 3KBXA 3I91A 2JP1A 1HFNA 2DY8A 1DOLA 2HCCA 2HCIA 2FFKB 1EOTA 4QUFA 1WTQA 1F9PA 1MSGA 1C8CA 2B2UC 2B2VA 4MHEA 2NZ1D 5COYA 4X3TA 2MPMA 3TZDA 1U4MA 2K03A 1G6ZA 2B2WA 2K05A 1G91A 2RA4A 1PFBA 1VMPA 3G7LA 1U4RA 4OIKA 1NR4A 4ZAIA 1AZQA 4NW2A 3TN2A 1AP0A 2KEDA 2FMMA 4U68A 1HHVA 1O7ZA 1NAPA 4MN3A 3R93A 2HDLA 4CJ2C 1U4LA 5D14A 5EPKA 2KECA 2J7ZA 1X3PA 2HDMA 2FHTA 5T1IA 4RA8A 1CM9A 4X3SA 1PFMA 2CVRA 4ZKCB 1PDQA 1BO0A 1ICWA 2D9UA 2L1BA 3P7JA 1S4ZA 2K04A 4DN4M 4IUPA 1F9QA 1XX8A 2KOLA 1AZPA 1MSHA 2L9HA 4HSVA 2MJ8A 2X69A 3LWEA 1WTWA 1F9SA 4CJ0B 1J8IA 3MTSA 4RAUC 5CBAE 2L11A 3DEOA 3N52A 2B2WC 3MWYW 4O42A 4X3UA 2RSOA 1F9RA 4CJ1B 1HUMA 3IFDA 1VMCA 1EL0A 4IURA 3UI2A 1EIGA 2NYZD 2N55A 3IL8A 5CORA 1RJTA 2X6GA 4LMQD 2B2TC 3D6WA 2HUGA 2IL8A 1A15A 3DM1A 1X32A 3F2UA 1XYIA 1QNKA 4ZLTF 1CA5A 5E4XA 1HFGA 1SSOA 3ONAB 4HCSA 5T1GA 1BBXC 2KVMA 1WTRA 1G2TA 1DZ1A 1MI2A 1MGSA 1B50A 1ESRA 2B2YA 1U4PA 2M2LA 3Q6SA 5CBEE 2N88A 5JJZA 3H91A 2BDNA 4R9WA 2JYOA 4OIJA 1JICA 1KNEA 2Q8TA 1WVLA 1WTPA 1ZXTA 2L12A 1WD0A 3FPUB 3QO2A 4XT3B 5E4WC 1WTVA 4UAIA 4ZKBB 5D65A 1NR2A 1PLFA 1BF4A 1KNAA 2VXWA 4ZK9B 1DOMA 2EPBA 2RVLA 2XIWA 4XT1B 2B2YC 1ILQA 1DONA 2FINB 1WTOA 1J9OA 1RTNA 1WTXA 1GUWA 2K1BA 1SAPA 1IL8A 4HAEA 2MGSA 1B3AA 1IKMA 1E0BA 2B2VC 2R3ZA 3GV6A 1PFNA 1HA6A 2X6LA 5CMDA 1TVXA 2EOTA 1O80A 1EQTA 1RHPA 1JE4A 2KEEA 1ML0D 1QE6A 1B53A 2MP1A 2NWGA 3DEPA 4X3KA 5EPLA 1RODA 4R8IA 1B2TA 1LV9A 1HRJA 4IUQA 4RWSC 3HP3A 1DOKA 2L4NA 1WD1A 1EIHA 1RTOA 4XDXA 3FDTA 5EQ0A 2Q8RE 1ILPA 1G2SA 3I3CA 4QUCA 1B4OA 2EE1A 1CA6A 5AFWA 3GV3A 4IUTA 1HUNA 2B2TA 4HEDA 2KUMA 2K28A 5EJWA
chains in the Genus database with same CATH superfamily
1PA6A 2CHBD 3H0GB 1F2LA 2KBNA 1QVGA 1I6HB 4IJLA 5M5XB 3BS1A 3SE0A 2AUJD 2QKIC 3CCMA 1S5FD 1STEA 3HOVG 2VNUD 2NZ1D 5IT9L 2FXQA 4A3JH 5AJ3L 3KFUA 1UE1A 4BA1I 1I4PA 3CHBD 1K3BC 4YCVA 4Y7NB 1U0LA 2ASBA 4IJHA 1X3PA 4BXXH 5T1IA 4JV5Q 5C0XH 2VZAA 4MTNA 4DV5Q 1TWHB 3HOYG 4A3CG 4HSPA 2F3VA 2UUCQ 3HOYB 4X65Q 2B63G 1S5CD 1OO9B 1F9RA 1T5EA 3ERSX 1VMCA 2N55A 3T1HQ 2TMPA 4ZLTF 1TQOA 1XNQQ 3ONAB 2NB0A 3HEJA 4DNTB 2EYFA 5KEEA 5G3LD 4FXGC 3J7ZC 4DR5Q 1RIPA 5FLMG 4NXMQ 1YZ6A 1KABA 2A6HD 5CV7A 4DR3Q 4R4QA 2NZOA 3FMCA 2VXWA 2B8FA 3OW7A 1PH9A 1PFSA 1GUWA 1WTOA 4C3HH 1CKMA 5IGCA 1B3AA 2E2JB 3MAQA 1YHAA 4K5XA 5CMDA 1TVXA 4UY8C 2MO1A 3CQZH 2DGYA 2A73B 1SFOH 2IJ0A 2R92G 4BBSH 1HQMC 3DM3A 1R4QB 1EQRA 4PZ6A 4JI6Q 3S1NH 3M4PA 2UUCL 2L4NA 4KN7C 4DF7A 3I4LA 4KTAA 4LF7L 3HOWH 1AE3A 2PZTA 1IL2A 4DNRB 2AHOB 5AFWA 1ENCA 1PTOH 4RCNA 2WACA 5JAVA 3CC7A 1EL0A 1X3FA 1B1ZA 2PCFB 3SVMA 3BYTB 2H1EA 4B3ML 3BDOA 1G6PA 2F3IA 4BY1B 2AQ3B 3CW2C 3S1RH 2LFNA 3GD7A 3JAMi 1SYDA 5BN5A 3ICEA 2JA7B 3GQBA 4DR3L 3KF6B 1N33L 3FEWX 2A6HC 3K0XA 4B3TQ 1UNSA 2B2UC 3CPWA 5COYA 1N32L 2MPMA 2JA8B 2RA4A 1I3QB 3HOZH 4BY1G 3TS2A 1HCZA 2NVYB 1EWHA 1KRTA 1XXGA 3FKIB 3DLLA 4ALPA 1NNXA 4DK0A 2QDBA 2BE5C 1Y69U 4ME5A 3PUYA 3KLSA 1IYUA 4GOPA 1B8AA 1DM0B 1SYEA 3CXCA 3T56B 4IALA 5K36H 4R4TA 2A68D 2E75C 1SROA 2B2WC 4FF2A 3U58A 2R92B 1HUMA 2L5TA 1HJPA 2CW0D 2YTVA 4JI1Q 2HUGA 4FO2A 1A15A 5BN4A 4G7OC 1I4GA 1Z7TA 3S15B 4P71A 3K7AH 1WTRA 4DU9A 1SJED 2K33A 3PMFA 3K5OA 4KI0A 1R9TB 5C4HA 5JJLA 1L1OA 2BA0A 4KHVA 4I7AA 1EWIA 4OIJA 5IYCG 1KNEA 1I4QA 3QO2A 1D6EC 2M9VA 4ZKBB 1TWFB 3K5LA 1Y8NB 4G4KA 1BCPF 4JBJA 2PNRC 3SDZA 1D5XC 1PRTD 1K0SA 5IYBG 5IWAQ 1YHQA 4X65L 1E1OA 1I5FA 2QA4A 1SYCA 1TR5A 1NJIC 1DYQA 4DV4L 1S40A 5C6AA 3F2BA 1FJGL 4FF1A 1E22A 1KAAA 5CV6A 4X66L 1RTOA 1MKHA 4C1NI 1OTCA 4DUZL 5FLXc 3TP5A 1FR3A 1JWSD 5T1GA 3X3MA 5ELNA 2WAQB 2JQOA 1VQLA 2DY7A 4A3FG 2E5LL 3BDCA 5J39A 1KXLA 3KF8A 4WJ4A 1PRTF 1DOLA 1STAA 1J5EQ 5J3BA 2AKWB 3HOXH 1MJCA 1JR0D 2A19A 3DUZA 2HHHL 4IPDA 2F0GA 1G6ZA 1EY9A 1U4RA 4MN3A 2WIIB 1SLJA 3BG3A 4KD3A 4DAYB 1S5BD 2AWNA 1LTBD 4IUNA 4X3SA 3PO2G 3CCRA 1XPUA 2PQEA 4PV1C 2OEOA 2A6EC 1V8QA 1FL0A 1X54A 4EQ5A 2X69A 1J8IA 2K52A 4QGUA 2JA5H 1TY2A 1KDBA 1PTOC 1V1PA 1EIGA 1EZ8A 3I72A 3SHLA 3WWVA 1TWGB 1WCMG 1NE3A 4A3MB 1YJ9A 2ATWA 4UPAA 1Q86C 5E4XA 4P2CB 2VUMH 3CAMA 2WKCA 1HPCA 3FPPA 1H9SB 4R9WA 4BBRG 1XPRA 1KLUD 3GTPH 1WTVA 1NR2A 3EJIA 5E7NA 1K73C 5EGTA 4ZK9B 4Q0FA 2RVLA 2J4XA 1I50B 1G8ZD 3S2HB 3F2DA 2Z9HA 2VQEQ 2BOSA 3I4NG 3PUVA 4KD4A 4TSSA 5M5WH 4KHPQ 2I0QA 4RHSA 1EY6A 1I94L 1TS2A 2A74C 2PI2E 4E6IA 1PMRA 1PYSB 3EA6A 4U673 5IT9E 2R7DA 3D4RA 4JYAQ 2VQEL 1WCMB 1YIJA 3KOJA 4NDXA 1BUVT 2D5DA 4OL7A 5FJ8H 1A62A 2OQKA 3HS0C 2KHSA 2B2TA 3LNNA 1CZWA 1T9HA 2F0DA 2NVXB 3L2PA 1I3QH 3OMCA 4K5WA 1TS4A 2B2UA 3HOUG 4AYBB 1O7YA 3H0GG 4ZCKA 4EQNA 2FJ2A 4IN3A 1WJJA 2CH4A 4H7BA 1AFPA 5M5YB 2J0TD 1PHJA 4IZ8A 2K32A 4Q5VA 3S1QB 2WAQE 3BDLA 5IE8A 3CCQA 5GAGC 4JI1L 5EKKA 2G9HD 3KBGA 3TEHB 4LFCL 2A1AA 5KGUA 1SYGA 1LT5D 2Z1CA 1L1OC 1X3EA 2L0CA 2EYHA 4OIKA 1G51A 1AP0A 2PQAB 1UE5A 4YWLA 3U9OA 4CJ2C 1ET9A 3I70A 5G3LF 4IO9A 1Y8PB 1UWVA 2ZM6L 1KIXA 5CR3A 3A56A 3HKSA 4QL5A 3MXNB 1LTID 1EFWA 3VR4A 4JYAL 3OMGA 1VQHA 3Q8DA 5M3FB 4XXEA 1F9SA 3J7AF 1VQCA 3N52A 1CFMA 1TS5A 2VUMG 1Q1EA 2R61A 5C4ZA 4CKEA 1N34L 4NXNQ 1PH1A 2K6AA 2B3GA 3M4OH 1UAPA 3KF6A 4UDUC 2KVMA 3MC0B 4LW1A 1JOQA 1DZ1A 3K5MA 1CSQA 4JI5Q 4DR7Q 1HR0L 3TBIB 2B8GA 4IFDJ 4H0LC 1BBWA 2CQOA 3JAML 1GO3E 1RKNA 3RN5A 1ET6A 5CV4A 4P72A 4C3IG 4KK7A 1DONA 4P74A 1X6OA 3KF8B 1PRTC 3NTKA 3R3OA 2XTIA 3NBHA 1SRUA 2B2VC 4JK1C 3K81C 1JORA 2V4DA 4QY7A 1XWEA 1B9MA 3NPPA 1HHVA 1K28A 3C2PA 3M9BA 4WORA 3BVMA 1QILA 5ELBA 1STHA 4R4CA 2F4VQ 4LF6Q 1MBYA 1RDPD 1EIHA 5JOBA 4XDXA 2UXCL 1NSNS 3FDTA 4X64Q 3HZXA 3CCSA 2XNAC 5A35A 3A0JA 1B4OA 4DA2A 3GP7A 4IUTA 4O1NA 2O4XA 3GTOH 2DN8A 3UDFA 5EJWA 2IW3A 3G6EA 2PO4A 5LL6S 4J8QA 1GUSA 3KJOA 4C2MH 1IW7D 4TVAB 5EPJA 1K83B 3KUPA 4A3LG 4DR6Q 3RLOA 5FOBB 1VQMA 1A2UA 1GD7A 2UXBQ 4QIWE 4POGA 1C7YA 1IBKQ 2F0EA 1JJGA 2VB2X 4APVA 3I4NB 4J15A 2F0JA 4X3TA 1SNPA 4N9TA 3J80E 1S72A 5JEAG 4HMJA 1LTTD 3TN2A 4X62Q 2D0PA 4OO1G 2UXBL 1O7ZA 1IBMQ 1VQPA 1M4VA 4JCVE 3NWTA 4CBVA 5FK9C 3GDEA 1CM9A 4FF4A 3M3YB 2F52A 1JOOA 2K04A 4R1JA 4L5RC 1D1IA 3W5OA 1E7ZA 1MSHA 4HSVA 4N9PA 3H3VI 2H5XA 4K8JA 1EY7A 1WTWA 4A3DB 1W6JA 3AFPA 1AW7A 1CKNA 1KAWA 2E74C 1MJEA 5CORA 4JI4Q 3D6WA 1QUQA 5JPMC 3S9WA 1XYIA 4OWXB 1XNRL 4R4IA 5C4XH 1EY5A 2EYPA 4OWWB 3EIVA 3S14B 4BBRB 2LMCB 1O7IA 3E5SA 2N88A 3H91A 1N33Q 2EY1A 1XMOQ 1F2MA 2JYOA 2N78A 1A3UA 1KDCA 1HH2P 2L12A 2XWJB 3KLRA 3M7GA 2I5HA 1A6XA 5D65A 2OXPA 4MNOA 1YHBA 2EYLA 1RCVD 4X62L 1XPOA 1STNA 1FNVA 2F0TA 4HAEA 3ZJYC 3I2ZA 2F0NA 2VQFQ 2D62A 3G4SA 1JWUD 4EQPA 3VYRA 1RHPA 1QE6A 2EVBA 4X3KA 3S1NB 4YHHL 1WOCA 2F0MA 3K7AB 4PZ7A 5D3DA 1HRJA 2PNHA 1OXSC 2O5JC 5J22A 3S14H 4JOIA 2GVAA 1SFOB 3E9HA 3NP8A 2NVXH 1D2BA 4A3LH 2TSSA 2A68C 4JI4L 1F77A 5BN3A 3H3VH 2KUMA 4GKKL 1ENFA 2F0KA 4P73A 3CCEA 1QB5D 5FLXE 3HOYH 1A3VA 3MZ5A 1QUQB 3V05A 2QDLA 1HNWQ 1Q3LA 2JA6G 4C56C 5IIFA 3I8ZA 3I91A 1SE2A 3RMHA 2UUAQ 3B6YA 3NBIA 2HCCA 4NPSA 2UUBL 3SK8A 3G48A 1OXXK 4OX9L 1MSGA 4NXNL 3BZCA 1J5EL 3ZYYX 1VQKA 3TSSA 2MO0A 2B2WA 3U50C 1T5XD 4ZAIA 4NP5A 1ZKOA 3RR5A 1K8OA 1UEAB 5ELCA 2KECA 2J7ZA 1NTGA 2NTTA 3LGJA 5I6WA 3H15A 2D0OA 3R8BA 4FF3A 1KHIA 4C3IH 1PFMA 1WCMH 3VYSA 1ICWA 2JN4A 4MTKA 1EFID 3NTHA 3H09A 4BWGB 2KCNA 1Q12A 1AZPA 2EYJA 3KDFA 3TREA 3S24A 1EY8A 1BCPC 1CQVA 4IPHA 1HNZL 4JVZA 4RGNA 5IGBA 3H0GH 4PG3A 3GTQB 2QGQA 2RSOA 1CKNB 3I4MH 1E2WA 3UDXA 3OWFA 1PH2A 1H9RA 2R92H 4GKJQ 1XNQL 1X32A 1XTCD 5LL6X 1F2ZA 5L37A 2ZT9C 1C9OA 1HQRD 4A75A 4IFDI 5KYIA 1EIFA 3T16A 4DV6L 3DWQA 1SMXA 3KLSX 3TP6A 1EEFD 5LHY1 1E2ZA 4KKTA 3X3NA 1D8LA 3U9SA 1WVLA 4R8NA 1SBBB 3AMUA 1FNUA 3STBD 3VR2A 3I73A 4L6TB 4O2DA 1S3OA 1IL8A 1UUPA 1TWCH 2JEBI 3DWPA 5EKLA 2EXZA 3QOLA 2JA5B 2KCTA 2F0OA 1HA6A 2X6LA 2XRQD 1FNWA 2BE5D 2R93B 2WFWA 2KEEA 1B53A 3AU7A 2UXDQ 1PH3A 2RDHA 2VY3A 2CWPA 3S1RB 3J81L 3SK6A 4BY7B 1JB3A 1EIYB 2F4IA 4A3GB 2B63H 4KHPL 4V190 2BA1A 1BKBA 2EYOA 1ILPA 3MXPA 4UHVA 2EE1A 1CKOA 1RD9D 2NVTB 1GKHA 2JA6B 1SYBA 1H9JA 1L0YB 2KCMA 2WB1E 4IOAA 1VQEA 2Z6KA 3I55A 3Q22A 5IODA 1TWHH 3AFQA 4YY3L 4LF9L 2XVSA 4A3IB 1X55A 4TRDA 1A63A 1HFNA 5DM63 2C35B 1JB7A 2FFKB 3GTMH 1AE2A 1M1KC 2F0VA 3M4QA 1VQDA 2Z6KC 4YCUA 2E2JH 3F1ZA 2OWOA 3RLNA 3PUWA 4HTHA 4KJOA 1VS0A 3HG9A 2MUYA 2UU9L 2BH2A 4UP8A 5BR8L 4AYBE 1EY0A 1N9WA 2D2CC 3BYYB 5LMNL 2EJGC 3BZDB 4MZ9A 1PDQA 4GOPB 1FVIA 3QWNA 1QZGA 3PO3B 5EAYA 5M5XH 1F9QA 3I4OA 3BVGA 2GA4B 2RF4A 3BVZA 1I6VC 5I9OA 2JXMB 1VQ6A 2XN9C 3J80L 1BXTA 3HGBA 1L1OB 1ZYRD 4LFBQ 2HT1A 2E8GA 3L3OC 2JSOA 1JOKA 2WV6D 1AN8A 5AJ3Q 3CC2A 5A2QL 1ESRA 2F0WA 2B29A 1Y1WH 1HR0W 2E5LQ 5M3MG 4POFA 5IWAL 4MIUA 2L15A 1HR0Q 4A3DG 4RG1A 3C1EA 4QMGA 1BF4A 1ASZA 3DXJC 4KLKA 5IP7H 5CV9A 4EVOA 2OCEA 5BR8Q 1HTPA 2MHVA 1JJCB 2LS01 2ZM6Q 1SMYD 3HOVB 1FJGQ 3J81j 4M1UB 5EPLA 2EIFA 3VA5A 4DV7L 3NELA 3D4DA 3R2TA 3HOXG 2HIXA 3PIOA 3K58A 1PXUA 2CH4W 2ES2A 2VUMB 1DOKA 2BCOA 2K5QA 3CF5A 4YWMA 1WD1A 5EQ0A 3WOFA 1STGA 4L5TA 2ENBA 3UDGA 5C4XG 3MXUA 4ODGA 1CQFA 1PTOD 3T1YL 4KKUA 1CA6A 4J6HA 5GAEC 3CRLC 1C0AA 1GHKA 2N49A 4DR1Q 4B3MQ 1XMQL 4DXFA 4A3BH 4DR7L 1M8AA 2VL6A 2E76C 3ULLA 4FYDA 3T1YQ 3RZOB 2R7ZB 1EOTA 1NBWA 1IBKL 4JI2Q 2KQ3A 3OTOL 2ZJRA 4GS3A 1N32Q 1G91A 4RMFA 3FHWA 3EN2A 1AZQA 5M3MH 2KEDA 2YYZA 1PH8A 5C44B 2C5CA 4OWTB 4I65A 3CCLA 3HOXB 5F2DA 4ZRZA 3E0EA 2E2DC 1ONLA 4BBRH 1PH4A 1S5ED 1TXYA 1N36L 3P7JA 3QG1A 1CT1D 2UXCQ 1EYCA 4X64L 2A6ED 1H9MA 2ZXRA 3OHXC 4LF5L 3W2DA 5NUCA 4XYQA 3DEOA 2NN6I 1PRTB 2EY2A 1MD2D 1EYGA 3NSWA 3QJYA 1YEZA 2IL8A 4LF4Q 3I4MG 4A93B 3UDIA 3V2TA 1EWCA 4K0KL 4IPCA 1E3PA 4G7ZC 4WRDA 1G2TA 1FYCA 5LMUL 1I4RA 4GLAC 4QCLA 2AWOA 3S15H 2L55A 3T4AC 1PTOF 1G291 4OO1I 5JJKA 4ME3A 3PO2H 4XT3B 3RNUA 4IFDH 3KK7A 4JPBW 1XNRQ 3A8IE 1DCZA 2YTYA 3Q23A 5C4JB 4XYOA 4YY3Q 4LF9Q 2NVQB 3MXGA 3RZDH 4KV6A 4H44C 1SAPA 2CWAA 1FGUA 3UE0A 4DUYL 1XMOL 1YNNC 1SNCA 1E0BA 3JC66 5KRUA 2K5WA 5IT9c 1X3GA 1STYA 1HZAA 3J81i 2WP8J 1EQTA 1YJNA 4A3FH 2F0PA 2K14A 1LV9A 2ICEC 4YHHQ 1X56A 3HOZB 1P8LA 1PYWD 2YV5A 2VQFL 1ASYA 4A76A 1HZCA 2DJGC 3V96A 1QOHA 1VF5C 1LUZA 4LK1C 3QOJA 1X3QA 1DGSA 2OF1A 2EJFC 3LWUA 2WB1B 3ULPA 3CP0A 3K80C 5C0XG 2EXDA 2RKSA 1QVFA 4JI3Q 5EKIA 1WTHA 3C46A 3PO3G 4FVMA 5K5PA 2A5HA 4A93G 4LUZA 5IP9H 2QILA 2RDGA 2UUBQ 2AQ1B 3URYA 4JG2A 4C2MB 2NVYH 1L2FA 1TWAB 4YWKA 3MVVA 3MHBA 1LACA 4JBKA 3G7LA 1STBA 2KCCA 3W3AA 4XQJA 3CKIB 5LMNQ 1KL9A 1IHZA 4X6AH 5JPNC 4Y52H 2A69C 2IX0A 3IKJA 3CPFA 3T1HL 4RFBA 2RHQB 1Y1WB 2PMZB 4H13C 4DR1L 4HJ8A 2F0SA 4ZQ3A 1XMQQ 1S5DD 1X65A 5FO9B 3FKIH 1KC8C 4EGVA 2HD3A 2SNMA 1PZID 3TRZA 4GKKQ 4B3RQ 3T13A 2CCZA 1O78A 2RQXA 1CHQD 4PMWA 2HHHQ 3TQYA 5M5YH 5C3WA 1SSOA 1II3A 4NKLA 4KMUC 5TSSA 2IX1A 4IQZA 4DR6L 3NBHB 2E2IB 3J81c 2FMCA 3A55A 2GN5A 1ZXTA 2Z8LA 1WD0A 2Y0SG 4BY1H 1PZJD 3ND8A 1A2TA 4IPGA 1LABA 4A3DH 3SK4A 3CMAA 1JJ2A 3WOEA 1HNXQ 1J6QA 3D8GA 3OIQA 1Q7YC 2ALYB 4DV5L 3WDNA 3DEPA 1I94Q 1SNDA 4JI7L 4G7HC 5IYDG 3MEHA 1U5KA 1LYLA 2QCPX 3HRZC 1B9NA 5ELDA 1BCPD 2Q8RE 1SE8A 1G2SA 1QVCA 3SK5A 5JVH3 1N8RC 4K8IA 2K5DA 4DV1L 2DNEA 4NMZA 2I5MX 2ZJPA 3I90A 1IXRA 1YVCA 1HTLD 4J1MA 1DD2A 4KY7A 3ULJA 3KBXA 5IYBH 4PMBA 1I6HH 3RD4A 3A74A 1SEBD 2R93H 1F2YA 1K3RA 1B7YB 3EFXD 2PI2A 3TZDA 1ESFA 4QIWB 3NQIA 1O7LA 4O0AA 3J7AV 1ENAA 1GM5A 2CKZB 3MEFA 5FO7B 4C3JG 5A2QE 4OO1H 1NAPA 2NZHA 1TWFH 2K50A 2ZTDA 4HR7B 2LXKA 5IP9G 3J7A5 2UXDL 4V0BA 1B44D 1FD7D 1X9NA 2D9UA 4RGMA 1VQ4A 1K0RA 1EZ6A 2Q2HA 1K83H 4CDCC 2MJ8A 1SN8A 3KYHC 4CJ0B 2NVQH 3PCOB 3J80c 4QJFA 4AQYQ 1I4HA 3MWYW 4CJ1B 3D31A 1U9RA 3GTOB 4JW0A 2F0QA 2VB3X 3LX0A 3PO2B 1SNMA 2B2TC 1V1PB 3HKZB 3VR5A 4LFCQ 3T53B 4QF4A 5IYDH 1HFGA 3ERQA 1CHPD 3CD6A 4DFAA 5FLXL 3TS0A 1U4PA 2K7VA 3CQZB 5JJZA 1EUJA 4GN4B 4DV2L 1GXDC 2Y0SB 1PH7A 4WJ3M 3AEVA 3NK9A 1CI3M 2UU9Q 2RHSB 1SXTA 1DOMA 1Y1VB 1D7QA 1ILQA 4GZYC 3PIP3 3FRPB 3A8JE 4K6LA 2K1BA 2XWBB 1VF7A 5HY6A 5JVG3 2MGSA 2SNSA 3FVQA 1Z9FA 3S1MB 3H3VC 2WAQG 4A3JG 2Z0SA 1VQ8A 2GVBA 2R7FA 2SEBD 5J1ZA 5IP7G 2IHEA 5ELFA 1ICFB 2R93G 3L7ZC 3HOUH 4DV7Q 5C4XB 1HA5A 1SNQA 3VDYA 2BH8A 1C48A 4A3KB 4GLVB 4N8X1 1Y1WG 1V1OA 3Q24A 2F0HA 3M7NA 4IOCA 4OX9Q 3J80i 1RF2D 4OXPA 4IUVA 4K2LA 5DNFA 2YTXA 5DM73 4DGZA 5FKAC 2JP1A 2LKVA 3EROA 1SNOA 4ID6A 1SJHD 4C1NK 4GNXB 2N8NA 2RCNA 4A3CH 1NMFA 1LO5D 4G57A 4L8JA 4Y7NH 1L0WA 1Q8KA 3OYYA 5M3MB 1JCKB 3GTQH 1I4XA 4BXXG 1NR4A 1JE5A 4DR5L 1VQGA 4HIOA 2HDLA 4HJ9A 1CUKA 3GTKH 1NMGA 2MFIA 4AH6A 3QB3A 4GNXC 2A69D 2CVRA 5M3FH 3MXNA 5KNBA 2L1BA 3KDFB 4NB3A 4IUPA 1DXMA 3HOVH 4CGYB 1CK1A 1NUCA 1HNXL 2PQAA 1XTDA 3MTSA 4RAUC 3K57A 2CFMA 4JI0Q 4X3UA 1VQ9A 3TDQA 2G9DA 1RJTA 4LMQD 3F2UA 1EU3A 3NHHA 2NUCA 4FDBA 3FKIG 1QCBD 4JI6L 4LF4L 4H02A 4CDEC 2PZWA 5GAHC 1MGSA 3Q6SA 1VQAA 3EQLC 5CBEE 3OW2A 2KHIA 2BDNA 1CZGA 5IY0A 4BBSG 1IYVA 4HN7A 4C3HG 3FPUB 4A3KG 1UE7A 1PLFA 2NN6H 4L5QA 3RZDB 3TZUA 5M5WB 4OONA 5I2YA 1E1TA 3PSIA 3STBC 3GTLH 1E2VA 5HGQA 4A3EH 1J9OA 1LLRD 3BU2A 1YNND 2AQ2B 2Q2TA 3QR8A 1IKMA 4A3JB 3I4NH 4BBSB 1VQFA 3D4WA 4I7ZC 1EYDA 3L9AX 1YBYA 1EYAA 2O5IC 4DV0L 2MQHA 3NQTA 2ID0A 2JA9A 3Q0AA 1UEBA 4ZUIA 4KJNA 5GQOA 1LTRD 3I3CA 3H6MA 4LFAQ 3AB9A 4RGOS 4CDDC 2K28A 1JT8A 1IKLA 2YU9B 4IUUA 5ELEA 3GTLB 3QIAA 5KYLA 1KTKA 2K01A 2F3WA 3S17H 1YNJD 1VQOA 2EDGA 2EY5A 4GN5A 3RN2A 1LTAD 1DJRD 3ER0A 5ISRA 2LY7A 3S2DH 2I5LX 5FO8B 1W6KA 3BJUA 1W3SA 3SR1A 1VMPA 4A3GH 3D3RA 3E0JA 3I56A 4U68A 2XSCA 4L5SA 1LM0A 4DV3Q 4Z9CB 3H94A 5EPKA 4LF8L 3JAMc 1VQJA 2FHTA 2E2IH 2XRSD 4RA8A 4F8MA 1H9KA 3VR6A 1GUTA 4ZKCB 4RKBA 4F87A 2IY5B 4A3BB 4DN4M 3S1MH 4JC0A 1XX8A 2F03A 2N3SA 1PH6A 4ZYSA 3S16B 2EY6A 4AYBG 4LAAA 5FLMH 2F4VL 4P75A 1Q1BA 4O42A 4RKLA 3G71A 1YI2A 2NVTH 3EVQA 5K36G 2E2HH 4K5VA 1EQQA 1SYFA 1TS3A 4RGTA 4LUVA 3P1HA 1BBXC 3TP8A 4DPGA 1VQBA 1JC7A 2QEJC 4HJ5A 1TKWB 3DWAA 3A7LA 1YNJC 4FXKC 1P16A 4DR2Q 4PQXA 2QW7A 2Q8TA 1Z6HA 2ZTCA 2HIVA 3SGIA 1HZBA 3GTGB 5E3FA 1Y1VG 3OOCA 1TWCB 1JQYD 2K5NA 4TKOB 5KNCA 1YITA 2FINB 4UP9A 1IBLQ 4PNYA 4DK3C 3GV6A 3SXHA 3NENA 2EOTA 2IPKD 2NWGA 4M8AA 1BDOA 5EBDA 3RUZA 3PUXA 4HIMA 1EQVA 1W2BA 3VYUA 1TWGH 3HKZG 5KIXA 1Y8OB 3DHQA 1BBUA 1KRSA 2EJMA 5C5MA 4DKAC 4TQUS 1B70B 2R7ZG 2DNCA 1QJOA 4JBWA 1N34Q 2IX3A 4GLXA 3GTJH 1D5MC 5CV8A 1VQ7A 2DUDA 1C4QA 2F0UA 2ZXPA 2XGTA 5IGDA 2EZVA 3GO5A 2SDFA 4NXML 2RCFA 4JI0L 1ZEQX 1TU2B 2DY8A 3G6JB 1R9TH 2HCIA 4GOPC 4JI2L 1VQ5A 4KY5A 2KHJA 2B2VA 4ABNA 1U4MA 5JJIA 1BR9A 1Q8IA 5CC4A 3HOWB 1PFBA 1SE3A 4NW2A 4OELB 3S16H 1LT6D 1L0XB 1V9PA 4YCWA 3RLFA 1FGBD 4DUYQ 2BDOA 1PVOA 4LFAL 1LTGD 1Z47A 3CU7A 2JA7H 3F2CA 4KY6A 2M00A 2KOLA 3M4OB 4CHTB 2Q8IB 5C5LA 3NEMA 1ZYRC 3P20A 1OXUA 3A8KE 4AQYL 2NYZD 3NUCA 4K0KQ 3DM1A 4K6DA 2R7ZH 3RZOH 2OQ0A 3AYHB 3E3XA 5M3FG 1A8VA 1HNWL 1B50A 3O13A 4L63B 1K8AC 2KENA 1TT2A 3CRKC 1JMCA 3AQQA 2G5DA 3NXWA 4KN4C 1Y1VH 3TMEA 1A3TA 5C3EB 3K6OA 1QZHA 3PF4A 1WFQA 2DJFC 2R3ZA 4ILWA 2F0FA 1PFNA 3S1QH 3NWSA 3CCJA 3GTMB 4LFBL 2EYMA 4R8IA 3N6RA 1K9MC 4DV4Q 5DEHA 4KHZA 4RWSC 4QB4A 2IWHA 4FXDA 4DV3L 4X66Q 4EQOA 4XTCS 4QUCA 5C44H 2JA8G 3GV3A 3GTPB 2WKDA 2JEAI 1PV4A 3ITPA 4B3RL 2ZXOA 2VS1A 1QG7A 2CW0C 2RSNA 1NCVA 1BVSA 2Q2IA 4DK6C 5FJ8G 2NBFA 1Q82C 3OWEB 4LNQA 5CV5A 3R2IA 3K59A 4C3IB 1XJVA 4XIGS 5JEAJ 5ELOA 4A3MH 4XQNA 3JAME 1A0IA 3K0YA 4QUFA 3IFTA 4JV5L 1HZ9A 2ZTEA 4BA2I 4PMCA 4A3EB 5CYUA 1GHJA 2K05A 1H95A 5I4DA 1YJWA 4LF6L 1OXVA 2H4OA 4OEMB 1GUGA 3R93A 2LSSA 4OHJA 4JI8L 3PO3H 1MHWC 5M9OA 3PQIA 1EU4A 2V1CC 4DK1A 1TIID 3K8AA 3M3YH 4DUZQ 5CGKA 5CBAE 3IAYA 2PPBC 4JI8Q 3CCUA 4B08A 3J7YW 4LF7Q 4CKBA 3IFDA 4DAYA 5GROA 5I9PA 3UI2A 2F1MA 2ZJQA 1PZKD 4FNFA 3I7FA 1BCPB 2X6GA 4JOIC 3S2HH 1JWMD 1QNKA 1TWAH 3KLWA 1CA5A 5I2XA 2Z6BA 1MI2A 2UUAL 3PGZA 1BQQT 3C1FA 4HIDA 1IBML 1JICA 2C9OA 4C3JB 4GKJL 4DR4L 5IOCA 4FP5D 2OTLA 4B3TL 4GN3B 1KNAA 2XIWA 3MFYA 1OXTA 4IFDG 1RTNA 4S3SA 2CQAA 4LJZC 2IT1A 5IGFA 1V43A 3P75A 5D3IB 2Y0SE 1JE4A 1K8MA 2MP1A 1GUOA 4KKSA 3IRBA 1R4PB 1RODA 2I07B 4HJ7A 4IUQA 1EEID 1QNUA 3HP3A 5C0XJ 1HNZQ 4JBMA 4A3FB 5DLQE 4AIMA 4LWCA 2JA6H 4RCOA 1GVPA 1RL2A 2PYKA 2Q2UA 2WINB 3S2DB 1PTOB 4CKCA 4LUOA 4HEDA 4DXGA 1AH9A 1VCIA 5C4JH 4HJAA 2QEXA 4XQQA 4RH6A 1SDFA 4B9WA 1VQNA 4B3SQ 5I6YA 1BNZA 3S17B 3E9IA 3OSOA 3SEBA 3DMUA 4RHRA 2SOBA 3F8TA 3A5UA 4JI3L 1TY0A 3MA2B 1WTQA 3W1BA 1F9PA 2KA7A 2Z4IA 1C8CA 4DAPA 4BS9A 3PIO3 3KJPA 2K03A 1PYBA 1Q81C 4A93H 2F0LA 3PUZA 1SMYC 2FMMA 4C3JH 1U4LA 4A3MG 4YIJA 1KD1C 5C3EG 4BY7H 1BO0A 3D0FA 5IYCH 1V1QA 4WJWA 1D1KA 3D6CA 1EOVA 2HQLA 2JE6I 4F7XA 2L9HA 1IZ6A 1VQIA 3PIPA 1I50H 5C44G 2JA8H 4LF8Q 3OPOA 4IURA 2K5HA 4F88A 3M4YA 1YNXA 1SE4A 3HKZE 1WI5A 3CC4A 2M2LA 4DV2Q 3EBEA 5HGTA 2PZUA 2PW5A 4JI5L 4A3EG 1EY4A 1M90C 1WTPA 5E4WC 5H1SE 4A3GG 3NE5B 1SR3A 4QQBX 4XT1B 5IGEA 5DAUA 1LTSD 1WTXA 3GTGH 3T51B 2VW9A 2JJQA 1D5ZC 1IBLL 1KLGD 1O80A 5HURA 1ML0D 4B9XA 1B2TA 2WB1G 3FP9A 3K7UC 1Y14B 1N36Q 1GUNA 4C3HB 1E24A 3VA7A 2IHFA 2MNAA 1B3QA 2P5ZX 4A3BG 1PH5A 4OGQC 3U4VA 4DAMA 3A5ZB 4ULLA 2AMCB 3OTOQ 3CMEA 2EQSA 1LTLA 2PW7A 3BZKA 4PZ8A 4HCEA 4DR2L 2R6GA 2ICIA 2F0IA 2K4KA 2K5VA 1LT4D 3PV0A 3VR3A 1UE6A 4MHEA 5C3EH 5KNDA 3W1GA 1NY4A 4JI7Q 2LXJA 3TP7A 2B63B 4A3KH 2QF7A 3M85A 1QWYA 4K2KA 3HOUB 3OIPA 5D14A 1GOZA 3HOZG 4K14A 4ZUJA 2HDMA 4DAVA 1Q90A 3A54A 2I46A 2K75A 1K8GA 3J81E 1AEXA 1S4ZA 3VYTA 2RDFA 4A3IH 4B3SL 2A8VA 3LWEA 4N8FA 2L11A 3GTKB 3E6ZX 2E2HB 3NTIA 1BOSA 3IL8A 1KDAA 1VDZA 4BY7G 5C3XA 1IYJB 4HCSA 4DV6Q 3PF5A 1IW7C 1CSPA 2B2YA 2KJXA 1H9SA 4WFN3 3HOWG 4DNIA 3U4ZA 4DR4Q 4A3IG 2JK8A 3CCVA 5JEAH 4DV1Q 4UAIA 3ND9A 4DV0Q 5LMNW 2JA7G 3I4MB 2PMZE 3A7AB 4UP7A 1GJXA 2EPBA 2B2YC 5LMUQ 4EX5A 5E1FA 2RBMA 3L0OA 4A4IA 3C3LA 5EBCA 3HFZB 1LT3D 4GNXA 2AUKA 4CDFC 5GADC 1MIUA 2OT2A 3K5NA 5C0XI 2NN6G 3MFGA 5IGGA 4LF5Q 2HQEA 4HIKA 1HXYD 3GTJB 2JA5G 2YU9H 1CTMA 4R4OA 1KQSA 2OTJA 1WYDA 1Q46A 2Z4HA 1HUNA 3UE1A 2O2LD 4HMIA 2B39A 2NTSA
chains in the Genus database with same CATH topology
2CHBD 3H0GB 1F2LA 1I6HB 5M5XB 3BS1A 3SE0A 2AUJD 2QKIC 1S5FD 1STEA 2VNUD 2NZ1D 5IT9L 4BA1I 1I4PA 3CHBD 4Y7NB 1X3PA 5T1IA 5C0XH 1TWHB 4HSPA 2F3VA 3HOYB 1S5CD 1OO9B 1F9RA 1T5EA 1VMCA 2N55A 2TMPA 4ZLTF 1TQOA 3ONAB 2NB0A 3HEJA 4DNTB 2EYFA 5KEEA 5G3LD 4FXGC 1KABA 2A6HD 5CV7A 3FMCA 2VXWA 2B8FA 3OW7A 1GUWA 1WTOA 5IGCA 1B3AA 2E2JB 3MAQA 4K5XA 5CMDA 1TVXA 2A73B 2IJ0A 1HQMC 1R4QB 2L4NA 4KN7C 4DF7A 3I4LA 4KTAA 2PZTA 4DNRB 5AFWA 1ENCA 1PTOH 4RCNA 2WACA 5JAVA 1EL0A 1B1ZA 3SVMA 2PCFB 3BYTB 2H1EA 3BDOA 4BY1B 2AQ3B 2LFNA 3GD7A 1SYDA 5BN5A 2JA7B 3GQBA 3FEWX 2A6HC 1UNSA 2B2UC 5COYA 2MPMA 2JA8B 2RA4A 1I3QB 1HCZA 2NVYB 1EWHA 1XXGA 3FKIB 4DK0A 2QDBA 2BE5C 1Y69U 4ME5A 3PUYA 3KLSA 1IYUA 1DM0B 1SYEA 3T56B 4IALA 5K36H 2A68D 2E75C 4FF2A 2B2WC 2R92B 1HUMA 2L5TA 2CW0D 2HUGA 4FO2A 1A15A 5BN4A 4G7OC 1I4GA 1Z7TA 3S15B 1WTRA 4DU9A 1SJED 2K33A 3PMFA 3K5OA 4KI0A 1R9TB 5C4HA 2BA0A 4KHVA 4OIJA 1KNEA 1I4QA 3QO2A 1D6EC 2M9VA 4ZKBB 1TWFB 3K5LA 1Y8NB 4G4KA 1BCPF 2PNRC 3SDZA 1D5XC 1PRTD 1SYCA 1TR5A 1DYQA 5C6AA 4FF1A 1KAAA 5CV6A 1RTOA 4C1NI 3TP5A 1FR3A 1JWSD 5T1GA 3X3MA 2WAQB 2DY7A 3BDCA 5J39A 3KF8A 1PRTF 1DOLA 1STAA 1JR0D 3DUZA 2F0GA 1G6ZA 1EY9A 1U4RA 4MN3A 2WIIB 3BG3A 4KD3A 1S5BD 2AWNA 1LTBD 4IUNA 4X3SA 2PQEA 4PV1C 2OEOA 2A6EC 1V8QA 2X69A 1J8IA 1TY2A 1KDBA 1PTOC 1V1PA 1EIGA 1EZ8A 3I72A 3SHLA 1TWGB 4A3MB 5E4XA 4P2CB 2WKCA 1HPCA 3FPPA 1H9SB 4R9WA 1KLUD 1WTVA 1NR2A 3EJIA 5EGTA 4ZK9B 4Q0FA 2RVLA 2J4XA 1I50B 1G8ZD 3S2HB 2BOSA 3PUVA 4KD4A 4TSSA 4RHSA 1EY6A 1TS2A 2A74C 4E6IA 1PMRA 3EA6A 4U673 5IT9E 3D4RA 1WCMB 4NDXA 1BUVT 2D5DA 4OL7A 3HS0C 2KHSA 2B2TA 3LNNA 1CZWA 2F0DA 2NVXB 3OMCA 4K5WA 1TS4A 2B2UA 4AYBB 1O7YA 4EQNA 2FJ2A 4IN3A 4H7BA 1AFPA 5M5YB 2J0TD 4IZ8A 2K32A 4Q5VA 3S1QB 3BDLA 5EKKA 2G9HD 3KBGA 5KGUA 1SYGA 1LT5D 2Z1CA 2L0CA 2EYHA 4OIKA 1AP0A 3U9OA 4CJ2C 5G3LF 1ET9A 3I70A 1Y8PB 5CR3A 3A56A 1LTID 3VR4A 3OMGA 5M3FB 4XXEA 1F9SA 3J7AF 3N52A 1CFMA 1TS5A 1Q1EA 2R61A 5C4ZA 4CKEA 2K6AA 1UAPA 4UDUC 2KVMA 3MC0B 1JOQA 1DZ1A 3K5MA 3TBIB 2B8GA 4IFDJ 4H0LC 3JAML 1RKNA 1ET6A 5CV4A 4C3IG 4KK7A 1DONA 1PRTC 3NTKA 3R3OA 3NBHA 2B2VC 4JK1C 1JORA 2V4DA 1XWEA 1B9MA 3NPPA 1HHVA 3C2PA 4WORA 3BVMA 1QILA 5ELBA 1STHA 1MBYA 1RDPD 1EIHA 5JOBA 4XDXA 1NSNS 3FDTA 3HZXA 2XNAC 5A35A 1B4OA 4DA2A 3GP7A 4IUTA 4O1NA 2O4XA 2DN8A 5EJWA 2IW3A 2PO4A 5LL6S 4J8QA 1GUSA 1IW7D 5EPJA 1K83B 3KUPA 5FOBB 1A2UA 2F0EA 2VB2X 3I4NB 4X3TA 2F0JA 1SNPA 4N9TA 3J80E 5JEAG 4HMJA 1LTTD 3TN2A 4OO1G 1O7ZA 1M4VA 3NWTA 4CBVA 5FK9C 1CM9A 4FF4A 3M3YB 1JOOA 2K04A 1D1IA 1MSHA 4N9PA 4HSVA 4K8JA 1EY7A 1WTWA 4A3DB 1W6JA 1AW7A 2E74C 5CORA 3D6WA 5JPMC 3S9WA 1XYIA 1EY5A 2EYPA 3S14B 4BBRB 2LMCB 3E5SA 2N88A 3H91A 2EY1A 1F2MA 2JYOA 1A3UA 1KDCA 2L12A 2XWJB 3KLRA 3M7GA 1A6XA 5D65A 2OXPA 2EYLA 1RCVD 1STNA 1FNVA 2F0TA 4HAEA 2F0NA 2D62A 1JWUD 4EQPA 3VYRA 1RHPA 1QE6A 2EVBA 4X3KA 3S1NB 2F0MA 3K7AB 1HRJA 5D3DA 1OXSC 2O5JC 5J22A 1SFOB 3NP8A 1D2BA 2TSSA 2A68C 1F77A 5BN3A 2KUMA 1ENFA 2F0KA 1QB5D 5FLXE 1A3VA 3MZ5A 3V05A 1Q3LA 4C56C 5IIFA 3I8ZA 3I91A 1SE2A 3RMHA 3NBIA 2HCCA 3SK8A 1OXXK 1MSGA 3ZYYX 3TSSA 2B2WA 1T5XD 4ZAIA 4NP5A 1ZKOA 1K8OA 1UEAB 5ELCA 2KECA 2J7ZA 2NTTA 5I6WA 3R8BA 4FF3A 1PFMA 3VYSA 1ICWA 1EFID 3NTHA 3H09A 4BWGB 2KCNA 1Q12A 1AZPA 2EYJA 1EY8A 1BCPC 1CQVA 4RGNA 5IGBA 3GTQB 2RSOA 1E2WA 3OWFA 1H9RA 5LL6X 1X32A 1XTCD 1F2ZA 2ZT9C 1HQRD 4IFDI 5KYIA 3T16A 3DWQA 3KLSX 3TP6A 1EEFD 5LHY1 1E2ZA 4KKTA 3X3NA 3U9SA 1WVLA 4R8NA 1SBBB 3AMUA 1FNUA 3VR2A 3I73A 4L6TB 1IL8A 1UUPA 2JEBI 3DWPA 5EKLA 2EXZA 3QOLA 2JA5B 2F0OA 1HA6A 2X6LA 2XRQD 1FNWA 2BE5D 2R93B 2KEEA 1B53A 3AU7A 2RDHA 3S1RB 3J81L 3SK6A 4BY7B 1JB3A 4A3GB 2F4IA 4V190 2BA1A 2EYOA 1ILPA 3MXPA 2EE1A 1RD9D 2NVTB 2JA6B 1SYBA 1H9JA 1L0YB 3Q22A 5IODA 2XVSA 4A3IB 4TRDA 1HFNA 5DM63 2FFKB 2F0VA 3PUWA 4HTHA 4KJOA 3HG9A 2MUYA 1EY0A 2D2CC 3BYYB 2EJGC 3BZDB 1PDQA 3QWNA 3PO3B 1F9QA 3BVGA 2GA4B 3BVZA 1I6VC 5I9OA 2JXMB 2XN9C 3J80L 1BXTA 3HGBA 1ZYRD 3L3OC 2JSOA 1JOKA 2WV6D 1AN8A 5A2QL 1ESRA 2F0WA 4MIUA 3C1EA 4QMGA 1BF4A 3DXJC 5CV9A 4EVOA 1HTPA 2MHVA 2LS01 1SMYD 3HOVB 4M1UB 5EPLA 3VA5A 3D4DA 3R2TA 3K58A 1PXUA 2VUMB 1DOKA 2BCOA 2K5QA 1WD1A 5EQ0A 3WOFA 1STGA 2ENBA 3MXUA 4ODGA 1CQFA 1PTOD 4KKUA 1CA6A 4J6HA 3CRLC 1GHKA 4DXFA 1M8AA 2E76C 4FYDA 3RZOB 2R7ZB 1EOTA 2KQ3A 1G91A 1AZQA 2KEDA 2YYZA 5C44B 2C5CA 4I65A 3HOXB 5F2DA 4ZRZA 2E2DC 1ONLA 1S5ED 3P7JA 3QG1A 1CT1D 1EYCA 2A6ED 1H9MA 2ZXRA 3OHXC 3W2DA 5NUCA 4XYQA 3DEOA 2NN6I 1PRTB 2EY2A 1MD2D 3NSWA 3QJYA 2IL8A 4A93B 3V2TA 1EWCA 4G7ZC 4WRDA 1G2TA 1FYCA 1I4RA 4QCLA 2AWOA 2L55A 3T4AC 1PTOF 1G291 4OO1I 4XT3B 4IFDH 3KK7A 3A8IE 1DCZA 3Q23A 5C4JB 4XYOA 2NVQB 3MXGA 4KV6A 4H44C 1SAPA 1YNNC 1SNCA 1E0BA 5KRUA 2K5WA 1STYA 2WP8J 1EQTA 2F0PA 1LV9A 2ICEC 3HOZB 1PYWD 3V96A 1QOHA 1VF5C 4LK1C 3QOJA 1X3QA 2OF1A 2EJFC 3LWUA 2WB1B 5C0XG 2RKSA 5EKIA 3C46A 4FVMA 5K5PA 2A5HA 2QILA 2RDGA 2AQ1B 3URYA 4C2MB 1TWAB 3MVVA 3MHBA 1LACA 3G7LA 1STBA 2KCCA 3W3AA 4XQJA 3CKIB 1IHZA 5JPNC 2A69C 2IX0A 3IKJA 4RFBA 1Y1WB 2PMZB 4H13C 2F0SA 4ZQ3A 1S5DD 5FO9B 4EGVA 2SNMA 1PZID 3T13A 1O78A 2RQXA 1CHQD 4PMWA 5C3WA 1SSOA 1II3A 4NKLA 4KMUC 5TSSA 2IX1A 4IQZA 2E2IB 2FMCA 3A55A 1ZXTA 2Z8LA 1WD0A 1PZJD 3ND8A 1A2TA 1LABA 3SK4A 3WOEA 3D8GA 3OIQA 3WDNA 3DEPA 1SNDA 4G7HC 3MEHA 2QCPX 3HRZC 1B9NA 5ELDA 1BCPD 2Q8RE 1G2SA 3SK5A 5JVH3 4K8IA 2K5DA 2DNEA 4NMZA 3I90A 1HTLD 4J1MA 1DD2A 4KY7A 3KBXA 4PMBA 3RD4A 1SEBD 1F2YA 3EFXD 3TZDA 1ESFA 4QIWB 3NQIA 1O7LA 3J7AV 1ENAA 5FO7B 4C3JG 5A2QE 4OO1H 1NAPA 4HR7B 4V0BA 1B44D 1FD7D 2D9UA 4RGMA 1EZ6A 2MJ8A 4CJ0B 1I4HA 4CJ1B 3MWYW 3D31A 1U9RA 3GTOB 2F0QA 2VB3X 3LX0A 3PO2B 1SNMA 2B2TC 1V1PB 3HKZB 3VR5A 3T53B 4QF4A 1HFGA 3ERQA 1CHPD 4DFAA 5FLXL 1U4PA 2K7VA 3CQZB 5JJZA 1GXDC 2Y0SB 3NK9A 1CI3M 1SXTA 1DOMA 1Y1VB 1ILQA 4GZYC 3PIP3 3FRPB 3A8JE 4K6LA 2K1BA 5JVG3 2XWBB 1VF7A 2MGSA 2SNSA 3FVQA 3S1MB 3H3VC 2SEBD 5J1ZA 5ELFA 3L7ZC 5C4XB 1HA5A 1SNQA 1C48A 4A3KB 1V1OA 3Q24A 2F0HA 3M7NA 1RF2D 4IUVA 4K2LA 5DNFA 5DM73 4DGZA 5FKAC 2JP1A 2LKVA 3EROA 1SNOA 4ID6A 1SJHD 4C1NK 1LO5D 4G57A 4L8JA 5M3MB 1JCKB 1I4XA 1NR4A 2HDLA 3QB3A 2A69D 2CVRA 3MXNA 5KNBA 2L1BA 4IUPA 1DXMA 4CGYB 1CK1A 1NUCA 3MTSA 4RAUC 3K57A 4X3UA 3TDQA 2G9DA 1RJTA 4LMQD 3F2UA 1EU3A 3NHHA 2NUCA 1QCBD 2PZWA 1MGSA 3Q6SA 3EQLC 5CBEE 2BDNA 1CZGA 1IYVA 4HN7A 4C3HG 3FPUB 1PLFA 2NN6H 3RZDB 3TZUA 5M5WB 5I2YA 1E2VA 1J9OA 1LLRD 1YNND 2AQ2B 1IKMA 4A3JB 4BBSB 3D4WA 4I7ZC 1EYDA 3L9AX 1EYAA 2O5IC 3NQTA 2ID0A 3Q0AA 4ZUIA 4KJNA 1LTRD 3I3CA 3H6MA 3AB9A 4RGOS 2K28A 1IKLA 2YU9B 4IUUA 5ELEA 3GTLB 3QIAA 5KYLA 1KTKA 2K01A 2F3WA 1YNJD 2EDGA 2EY5A 1LTAD 1DJRD 5ISRA 2LY7A 5FO8B 1W6KA 3SR1A 1VMPA 3D3RA 3E0JA 4U68A 2XSCA 4Z9CB 3H94A 5EPKA 2FHTA 2XRSD 4RA8A 4F8MA 1H9KA 3VR6A 1GUTA 4ZKCB 4RKBA 4F87A 4A3BB 4DN4M 1XX8A 2F03A 4ZYSA 3S16B 2EY6A 4LAAA 1Q1BA 4O42A 4RKLA 3EVQA 5K36G 4K5VA 1SYFA 1TS3A 4RGTA 3P1HA 1BBXC 3TP8A 1JC7A 2QEJC 1TKWB 3DWAA 3A7LA 1YNJC 4FXKC 4PQXA 2Q8TA 1Z6HA 3GTGB 5E3FA 3OOCA 1TWCB 1JQYD 4TKOB 5KNCA 2FINB 4PNYA 3GV6A 3SXHA 2EOTA 2IPKD 2NWGA 4M8AA 1BDOA 5EBDA 3RUZA 3PUXA 1EQVA 3VYUA 5KIXA 1Y8OB 3DHQA 2EJMA 5C5MA 4TQUS 2DNCA 1QJOA 4JBWA 2IX3A 5CV8A 1D5MC 1C4QA 2F0UA 2ZXPA 5IGDA 2EZVA 3GO5A 2SDFA 1ZEQX 1TU2B 2DY8A 3G6JB 2HCIA 4KY5A 2B2VA 4ABNA 1U4MA 1BR9A 1Q8IA 5CC4A 3HOWB 1PFBA 1SE3A 4NW2A 1LT6D 1L0XB 3RLFA 1FGBD 2BDOA 1LTGD 1Z47A 3CU7A 4KY6A 2M00A 2KOLA 3M4OB 4CHTB 2Q8IB 5C5LA 1ZYRC 3P20A 1OXUA 3A8KE 2NYZD 3NUCA 3DM1A 4K6DA 1B50A 3O13A 4L63B 1TT2A 3CRKC 3NXWA 4KN4C 3TMEA 1A3TA 5C3EB 3K6OA 2R3ZA 4ILWA 2F0FA 1PFNA 3NWSA 3GTMB 2EYMA 4R8IA 3N6RA 5DEHA 4KHZA 4RWSC 4QB4A 2IWHA 4FXDA 4EQOA 4XTCS 4QUCA 3GV3A 3GTPB 2WKDA 2JEAI 3ITPA 2ZXOA 1QG7A 2CW0C 2RSNA 1NCVA 2NBFA 3OWEB 5CV5A 3R2IA 3K59A 4C3IB 4XIGS 5JEAJ 4XQNA 3JAME 3K0YA 4QUFA 3IFTA 4BA2I 4PMCA 4A3EB 5CYUA 1GHJA 2K05A 5I4DA 1OXVA 2H4OA 1GUGA 3R93A 4OHJA 5M9OA 1EU4A 4DK1A 1TIID 5CGKA 5CBAE 3IAYA 2PPBC 4B08A 3J7YW 4CKBA 3IFDA 4DAYA 5I9PA 3UI2A 2F1MA 1PZKD 4FNFA 1BCPB 2X6GA 1JWMD 1QNKA 1CA5A 5I2XA 1MI2A 1BQQT 3C1FA 1JICA 2C9OA 4C3JB 5IOCA 4FP5D 1KNAA 2XIWA 3MFYA 1OXTA 4IFDG 1RTNA 4S3SA 2CQAA 4LJZC 2IT1A 5IGFA 1V43A 3P75A 5D3IB 1JE4A 1K8MA 2MP1A 1GUOA 4KKSA 1R4PB 1RODA 2I07B 4IUQA 1EEID 1QNUA 3HP3A 5C0XJ 4A3FB 4RCOA 2PYKA 3S2DB 2WINB 1PTOB 4CKCA 4HEDA 4DXGA 1VCIA 4XQQA 4RH6A 1SDFA 4B9WA 5I6YA 1BNZA 3S17B 3OSOA 3SEBA 3DMUA 4RHRA 2SOBA 1TY0A 3MA2B 1WTQA 1F9PA 2KA7A 2Z4IA 1C8CA 4DAPA 4BS9A 3PIO3 2K03A 2F0LA 3PUZA 1SMYC 2FMMA 1U4LA 4YIJA 1BO0A 4WJWA 1D1KA 3D6CA 2JE6I 4F7XA 2L9HA 3OPOA 4IURA 4F88A 3M4YA 1SE4A 2M2LA 5HGTA 2PZUA 2PW5A 1EY4A 1WTPA 5E4WC 3NE5B 4XT1B 5IGEA 5DAUA 1LTSD 1WTXA 3T51B 1D5ZC 1KLGD 1O80A 5HURA 1ML0D 4B9XA 1B2TA 1GUNA 4C3HB 3VA7A 4OGQC 4ULLA 2PW7A 4HCEA 2R6GA 2ICIA 2F0IA 1LT4D 3PV0A 3VR3A 4MHEA 5KNDA 3TP7A 2B63B 2QF7A 3M85A 1QWYA 4K2KA 3HOUB 3OIPA 5D14A 1GOZA 4K14A 4ZUJA 2HDMA 4DAVA 1Q90A 3A54A 2I46A 3J81E 1AEXA 1S4ZA 3VYTA 2RDFA 3LWEA 3GTKB 2L11A 3E6ZX 2E2HB 3NTIA 1BOSA 3IL8A 1KDAA 1VDZA 5C3XA 4HCSA 1IW7C 2B2YA 2KJXA 1H9SA 4WFN3 5JEAH 4UAIA 3ND9A 3I4MB 3A7AB 1GJXA 2EPBA 2B2YC 5E1FA 2RBMA 3C3LA 5EBCA 1LT3D 2AUKA 2OT2A 3K5NA 5C0XI 2NN6G 3MFGA 5IGGA 2HQEA 1HXYD 3GTJB 1CTMA 2Z4HA 1HUNA 2O2LD 4HMIA 2B39A 2NTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKL A;  1QG7 A;  1X3Q A;  3SVM A;  4IUU A;  4IUV A;  2H1E A;  2RSN A;  2B2U A;  1NCV A;  1F2L A;  3I90 A;  5DNF A;  1SDF A;  1O7Y A;  2K01 A;  1Q3L A;  5EPJ A;  2DY7 A;  2SDF A;  1BNZ A;  3I8Z A;  2FJ2 A;  3KUP A;  1M8A A;  5EKI A;  3KBX A;  3I91 A;  2JP1 A;  1HFN A;  2DY8 A;  1DOL A;  2HCC A;  2HCI A;  2FFK B;  1EOT A;  4QUF A;  1WTQ A;  1F9P A;  1MSG A;  1C8C A;  2B2U C;  2B2V A;  4MHE A;  2NZ1 D;  5COY A;  4X3T A;  2MPM A;  3TZD A;  1U4M A;  2K03 A;  1G6Z A;  2B2W A;  2K05 A;  1G91 A;  2RA4 A;  1PFB A;  1VMP A;  3G7L A;  1U4R A;  4OIK A;  1NR4 A;  4ZAI A;  1AZQ A;  4NW2 A;  3TN2 A;  1AP0 A;  2KED A;  2FMM A;  4U68 A;  1HHV A;  1O7Z A;  1NAP A;  4MN3 A;  3R93 A;  2HDL A;  4CJ2 C;  1U4L A;  5D14 A;  5EPK A;  2KEC A;  2J7Z A;  1X3P A;  2HDM A;  2FHT A;  5T1I A;  4RA8 A;  1CM9 A;  4X3S A;  1PFM A;  2CVR A;  4ZKC B;  1PDQ A;  1BO0 A;  1ICW A;  2D9U A;  2L1B A;  3P7J A;  1S4Z A;  2K04 A;  4DN4 M;  4IUP A;  1F9Q A;  1XX8 A;  2KOL A;  1AZP A;  1MSH A;  2L9H A;  4HSV A;  2MJ8 A;  2X69 A;  3LWE A;  1WTW A;  1F9S A;  4CJ0 B;  1J8I A;  3MTS A;  4RAU C;  5CBA E;  2L11 A;  3DEO A;  3N52 A;  2B2W C;  3MWY W;  4O42 A;  4X3U A;  2RSO A;  1F9R A;  4CJ1 B;  1HUM A;  3IFD A;  1VMC A;  1EL0 A;  4IUR A;  3UI2 A;  1EIG A;  2NYZ D;  2N55 A;  3IL8 A;  5COR A;  1RJT A;  2X6G A;  4LMQ D;  2B2T C;  3D6W A;  2HUG A;  2IL8 A;  1A15 A;  3DM1 A;  1X32 A;  3F2U A;  1XYI A;  1QNK A;  4ZLT F;  1CA5 A;  5E4X A;  1HFG A;  1SSO A;  3ONA B;  4HCS A;  5T1G A;  1BBX C;  2KVM A;  1WTR A;  1G2T A;  1DZ1 A;  1MI2 A;  1MGS A;  1B50 A;  1ESR A;  2B2Y A;  1U4P A;  2M2L A;  3Q6S A;  5CBE E;  2N88 A;  5JJZ A;  3H91 A;  2BDN A;  4R9W A;  2JYO A;  4OIJ A;  1JIC A;  1KNE A;  2Q8T A;  1WVL A;  1WTP A;  1ZXT A;  2L12 A;  1WD0 A;  3FPU B;  3QO2 A;  4XT3 B;  5E4W C;  1WTV A;  4UAI A;  4ZKB B;  5D65 A;  1NR2 A;  1PLF A;  1BF4 A;  1KNA A;  2VXW A;  4ZK9 B;  1DOM A;  2EPB A;  2RVL A;  2XIW A;  4XT1 B;  2B2Y C;  1ILQ A;  1DON A;  2FIN B;  1WTO A;  1J9O A;  1RTN A;  1WTX A;  1GUW A;  2K1B A;  1SAP A;  1IL8 A;  4HAE A;  2MGS A;  1B3A A;  1IKM A;  1E0B A;  2B2V C;  2R3Z A;  3GV6 A;  1PFN A;  1HA6 A;  2X6L A;  5CMD A;  1TVX A;  2EOT A;  1O80 A;  1EQT A;  1RHP A;  1JE4 A;  2KEE A;  1ML0 D;  1QE6 A;  1B53 A;  2MP1 A;  2NWG A;  3DEP A;  4X3K A;  5EPL A;  1ROD A;  4R8I A;  1B2T A;  1LV9 A;  1HRJ A;  4IUQ A;  4RWS C;  3HP3 A;  1DOK A;  2L4N A;  1WD1 A;  1EIH A;  1RTO A;  4XDX A;  3FDT A;  5EQ0 A;  2Q8R E;  1ILP A;  1G2S A;  3I3C A;  4QUC A;  1B4O A;  2EE1 A;  1CA6 A;  5AFW A;  3GV3 A;  4IUT A;  1HUN A;  2B2T A;  4HED A;  2KUM A;  2K28 A;  5EJW A; 
#chains in the Genus database with same CATH topology
 1PA6 A;  2CHB D;  3H0G B;  1F2L A;  2KBN A;  1QVG A;  1I6H B;  4IJL A;  5M5X B;  3BS1 A;  3SE0 A;  2AUJ D;  2QKI C;  3CCM A;  1S5F D;  1STE A;  3HOV G;  2VNU D;  2NZ1 D;  5IT9 L;  2FXQ A;  4A3J H;  5AJ3 L;  3KFU A;  1UE1 A;  4BA1 I;  1I4P A;  3CHB D;  1K3B C;  4YCV A;  4Y7N B;  1U0L A;  2ASB A;  4IJH A;  1X3P A;  4BXX H;  5T1I A;  4JV5 Q;  5C0X H;  2VZA A;  4MTN A;  4DV5 Q;  1TWH B;  3HOY G;  4A3C G;  4HSP A;  2F3V A;  2UUC Q;  3HOY B;  4X65 Q;  2B63 G;  1S5C D;  1OO9 B;  1F9R A;  1T5E A;  3ERS X;  1VMC A;  2N55 A;  3T1H Q;  2TMP A;  4ZLT F;  1TQO A;  1XNQ Q;  3ONA B;  2NB0 A;  3HEJ A;  4DNT B;  2EYF A;  5KEE A;  5G3L D;  4FXG C;  3J7Z C;  4DR5 Q;  1RIP A;  5FLM G;  4NXM Q;  1YZ6 A;  1KAB A;  2A6H D;  5CV7 A;  4DR3 Q;  4R4Q A;  2NZO A;  3FMC A;  2VXW A;  2B8F A;  3OW7 A;  1PH9 A;  1PFS A;  1GUW A;  1WTO A;  4C3H H;  1CKM A;  5IGC A;  1B3A A;  2E2J B;  3MAQ A;  1YHA A;  4K5X A;  5CMD A;  1TVX A;  4UY8 C;  2MO1 A;  3CQZ H;  2DGY A;  2A73 B;  1SFO H;  2IJ0 A;  2R92 G;  4BBS H;  1HQM C;  3DM3 A;  1R4Q B;  1EQR A;  4PZ6 A;  4JI6 Q;  3S1N H;  3M4P A;  2UUC L;  2L4N A;  4KN7 C;  4DF7 A;  3I4L A;  4KTA A;  4LF7 L;  3HOW H;  1AE3 A;  2PZT A;  1IL2 A;  4DNR B;  2AHO B;  5AFW A;  1ENC A;  1PTO H;  4RCN A;  2WAC A;  5JAV A;  3CC7 A;  1EL0 A;  1X3F A;  1B1Z A;  2PCF B;  3SVM A;  3BYT B;  2H1E A;  4B3M L;  3BDO A;  1G6P A;  2F3I A;  4BY1 B;  2AQ3 B;  3CW2 C;  3S1R H;  2LFN A;  3GD7 A;  3JAM i;  1SYD A;  5BN5 A;  3ICE A;  2JA7 B;  3GQB A;  4DR3 L;  3KF6 B;  1N33 L;  3FEW X;  2A6H C;  3K0X A;  4B3T Q;  1UNS A;  2B2U C;  3CPW A;  5COY A;  1N32 L;  2MPM A;  2JA8 B;  2RA4 A;  1I3Q B;  3HOZ H;  4BY1 G;  3TS2 A;  1HCZ A;  2NVY B;  1EWH A;  1KRT A;  1XXG A;  3FKI B;  3DLL A;  4ALP A;  1NNX A;  4DK0 A;  2QDB A;  2BE5 C;  1Y69 U;  4ME5 A;  3PUY A;  3KLS A;  1IYU A;  4GOP A;  1B8A A;  1DM0 B;  1SYE A;  3CXC A;  3T56 B;  4IAL A;  5K36 H;  4R4T A;  2A68 D;  2E75 C;  1SRO A;  2B2W C;  4FF2 A;  3U58 A;  2R92 B;  1HUM A;  2L5T A;  1HJP A;  2CW0 D;  2YTV A;  4JI1 Q;  2HUG A;  4FO2 A;  1A15 A;  5BN4 A;  4G7O C;  1I4G A;  1Z7T A;  3S15 B;  4P71 A;  3K7A H;  1WTR A;  4DU9 A;  1SJE D;  2K33 A;  3PMF A;  3K5O A;  4KI0 A;  1R9T B;  5C4H A;  5JJL A;  1L1O A;  2BA0 A;  4KHV A;  4I7A A;  1EWI A;  4OIJ A;  5IYC G;  1KNE A;  1I4Q A;  3QO2 A;  1D6E C;  2M9V A;  4ZKB B;  1TWF B;  3K5L A;  1Y8N B;  4G4K A;  1BCP F;  4JBJ A;  2PNR C;  3SDZ A;  1D5X C;  1PRT D;  1K0S A;  5IYB G;  5IWA Q;  1YHQ A;  4X65 L;  1E1O A;  1I5F A;  2QA4 A;  1SYC A;  1TR5 A;  1NJI C;  1DYQ A;  4DV4 L;  1S40 A;  5C6A A;  3F2B A;  1FJG L;  4FF1 A;  1E22 A;  1KAA A;  5CV6 A;  4X66 L;  1RTO A;  1MKH A;  4C1N I;  1OTC A;  4DUZ L;  5FLX c;  3TP5 A;  1FR3 A;  1JWS D;  5T1G A;  3X3M A;  5ELN A;  2WAQ B;  2JQO A;  1VQL A;  2DY7 A;  4A3F G;  2E5L L;  3BDC A;  5J39 A;  1KXL A;  3KF8 A;  4WJ4 A;  1PRT F;  1DOL A;  1STA A;  1J5E Q;  5J3B A;  2AKW B;  3HOX H;  1MJC A;  1JR0 D;  2A19 A;  3DUZ A;  2HHH L;  4IPD A;  2F0G A;  1G6Z A;  1EY9 A;  1U4R A;  4MN3 A;  2WII B;  1SLJ A;  3BG3 A;  4KD3 A;  4DAY B;  1S5B D;  2AWN A;  1LTB D;  4IUN A;  4X3S A;  3PO2 G;  3CCR A;  1XPU A;  2PQE A;  4PV1 C;  2OEO A;  2A6E C;  1V8Q A;  1FL0 A;  1X54 A;  4EQ5 A;  2X69 A;  1J8I A;  2K52 A;  4QGU A;  2JA5 H;  1TY2 A;  1KDB A;  1PTO C;  1V1P A;  1EIG A;  1EZ8 A;  3I72 A;  3SHL A;  3WWV A;  1TWG B;  1WCM G;  1NE3 A;  4A3M B;  1YJ9 A;  2ATW A;  4UPA A;  1Q86 C;  5E4X A;  4P2C B;  2VUM H;  3CAM A;  2WKC A;  1HPC A;  3FPP A;  1H9S B;  4R9W A;  4BBR G;  1XPR A;  1KLU D;  3GTP H;  1WTV A;  1NR2 A;  3EJI A;  5E7N A;  1K73 C;  5EGT A;  4ZK9 B;  4Q0F A;  2RVL A;  2J4X A;  1I50 B;  1G8Z D;  3S2H B;  3F2D A;  2Z9H A;  2VQE Q;  2BOS A;  3I4N G;  3PUV A;  4KD4 A;  4TSS A;  5M5W H;  4KHP Q;  2I0Q A;  4RHS A;  1EY6 A;  1I94 L;  1TS2 A;  2A74 C;  2PI2 E;  4E6I A;  1PMR A;  1PYS B;  3EA6 A;  4U67 3;  5IT9 E;  2R7D A;  3D4R A;  4JYA Q;  2VQE L;  1WCM B;  1YIJ A;  3KOJ A;  4NDX A;  1BUV T;  2D5D A;  4OL7 A;  5FJ8 H;  1A62 A;  2OQK A;  3HS0 C;  2KHS A;  2B2T A;  3LNN A;  1CZW A;  1T9H A;  2F0D A;  2NVX B;  3L2P A;  1I3Q H;  3OMC A;  4K5W A;  1TS4 A;  2B2U A;  3HOU G;  4AYB B;  1O7Y A;  3H0G G;  4ZCK A;  4EQN A;  2FJ2 A;  4IN3 A;  1WJJ A;  2CH4 A;  4H7B A;  1AFP A;  5M5Y B;  2J0T D;  1PHJ A;  4IZ8 A;  2K32 A;  4Q5V A;  3S1Q B;  2WAQ E;  3BDL A;  5IE8 A;  3CCQ A;  5GAG C;  4JI1 L;  5EKK A;  2G9H D;  3KBG A;  3TEH B;  4LFC L;  2A1A A;  5KGU A;  1SYG A;  1LT5 D;  2Z1C A;  1L1O C;  1X3E A;  2L0C A;  2EYH A;  4OIK A;  1G51 A;  1AP0 A;  2PQA B;  1UE5 A;  4YWL A;  3U9O A;  4CJ2 C;  1ET9 A;  3I70 A;  5G3L F;  4IO9 A;  1Y8P B;  1UWV A;  2ZM6 L;  1KIX A;  5CR3 A;  3A56 A;  3HKS A;  4QL5 A;  3MXN B;  1LTI D;  1EFW A;  3VR4 A;  4JYA L;  3OMG A;  1VQH A;  3Q8D A;  5M3F B;  4XXE A;  1F9S A;  3J7A F;  1VQC A;  3N52 A;  1CFM A;  1TS5 A;  2VUM G;  1Q1E A;  2R61 A;  5C4Z A;  4CKE A;  1N34 L;  4NXN Q;  1PH1 A;  2K6A A;  2B3G A;  3M4O H;  1UAP A;  3KF6 A;  4UDU C;  2KVM A;  3MC0 B;  4LW1 A;  1JOQ A;  1DZ1 A;  3K5M A;  1CSQ A;  4JI5 Q;  4DR7 Q;  1HR0 L;  3TBI B;  2B8G A;  4IFD J;  4H0L C;  1BBW A;  2CQO A;  3JAM L;  1GO3 E;  1RKN A;  3RN5 A;  1ET6 A;  5CV4 A;  4P72 A;  4C3I G;  4KK7 A;  1DON A;  4P74 A;  1X6O A;  3KF8 B;  1PRT C;  3NTK A;  3R3O A;  2XTI A;  3NBH A;  1SRU A;  2B2V C;  4JK1 C;  3K81 C;  1JOR A;  2V4D A;  4QY7 A;  1XWE A;  1B9M A;  3NPP A;  1HHV A;  1K28 A;  3C2P A;  3M9B A;  4WOR A;  3BVM A;  1QIL A;  5ELB A;  1STH A;  4R4C A;  2F4V Q;  4LF6 Q;  1MBY A;  1RDP D;  1EIH A;  5JOB A;  4XDX A;  2UXC L;  1NSN S;  3FDT A;  4X64 Q;  3HZX A;  3CCS A;  2XNA C;  5A35 A;  3A0J A;  1B4O A;  4DA2 A;  3GP7 A;  4IUT A;  4O1N A;  2O4X A;  3GTO H;  2DN8 A;  3UDF A;  5EJW A;  2IW3 A;  3G6E A;  2PO4 A;  5LL6 S;  4J8Q A;  1GUS A;  3KJO A;  4C2M H;  1IW7 D;  4TVA B;  5EPJ A;  1K83 B;  3KUP A;  4A3L G;  4DR6 Q;  3RLO A;  5FOB B;  1VQM A;  1A2U A;  1GD7 A;  2UXB Q;  4QIW E;  4POG A;  1C7Y A;  1IBK Q;  2F0E A;  1JJG A;  2VB2 X;  4APV A;  3I4N B;  4J15 A;  2F0J A;  4X3T A;  1SNP A;  4N9T A;  3J80 E;  1S72 A;  5JEA G;  4HMJ A;  1LTT D;  3TN2 A;  4X62 Q;  2D0P A;  4OO1 G;  2UXB L;  1O7Z A;  1IBM Q;  1VQP A;  1M4V A;  4JCV E;  3NWT A;  4CBV A;  5FK9 C;  3GDE A;  1CM9 A;  4FF4 A;  3M3Y B;  2F52 A;  1JOO A;  2K04 A;  4R1J A;  4L5R C;  1D1I A;  3W5O A;  1E7Z A;  1MSH A;  4HSV A;  4N9P A;  3H3V I;  2H5X A;  4K8J A;  1EY7 A;  1WTW A;  4A3D B;  1W6J A;  3AFP A;  1AW7 A;  1CKN A;  1KAW A;  2E74 C;  1MJE A;  5COR A;  4JI4 Q;  3D6W A;  1QUQ A;  5JPM C;  3S9W A;  1XYI A;  4OWX B;  1XNR L;  4R4I A;  5C4X H;  1EY5 A;  2EYP A;  4OWW B;  3EIV A;  3S14 B;  4BBR B;  2LMC B;  1O7I A;  3E5S A;  2N88 A;  3H91 A;  1N33 Q;  2EY1 A;  1XMO Q;  1F2M A;  2JYO A;  2N78 A;  1A3U A;  1KDC A;  1HH2 P;  2L12 A;  2XWJ B;  3KLR A;  3M7G A;  2I5H A;  1A6X A;  5D65 A;  2OXP A;  4MNO A;  1YHB A;  2EYL A;  1RCV D;  4X62 L;  1XPO A;  1STN A;  1FNV A;  2F0T A;  4HAE A;  3ZJY C;  3I2Z A;  2F0N A;  2VQF Q;  2D62 A;  3G4S A;  1JWU D;  4EQP A;  3VYR A;  1RHP A;  1QE6 A;  2EVB A;  4X3K A;  3S1N B;  4YHH L;  1WOC A;  2F0M A;  3K7A B;  4PZ7 A;  5D3D A;  1HRJ A;  2PNH A;  1OXS C;  2O5J C;  5J22 A;  3S14 H;  4JOI A;  2GVA A;  1SFO B;  3E9H A;  3NP8 A;  2NVX H;  1D2B A;  4A3L H;  2TSS A;  2A68 C;  4JI4 L;  1F77 A;  5BN3 A;  3H3V H;  2KUM A;  4GKK L;  1ENF A;  2F0K A;  4P73 A;  3CCE A;  1QB5 D;  5FLX E;  3HOY H;  1A3V A;  3MZ5 A;  1QUQ B;  3V05 A;  2QDL A;  1HNW Q;  1Q3L A;  2JA6 G;  4C56 C;  5IIF A;  3I8Z A;  3I91 A;  1SE2 A;  3RMH A;  2UUA Q;  3B6Y A;  3NBI A;  2HCC A;  4NPS A;  2UUB L;  3SK8 A;  3G48 A;  1OXX K;  4OX9 L;  1MSG A;  4NXN L;  3BZC A;  1J5E L;  3ZYY X;  1VQK A;  3TSS A;  2MO0 A;  2B2W A;  3U50 C;  1T5X D;  4ZAI A;  4NP5 A;  1ZKO A;  3RR5 A;  1K8O A;  1UEA B;  5ELC A;  2KEC A;  2J7Z A;  1NTG A;  2NTT A;  3LGJ A;  5I6W A;  3H15 A;  2D0O A;  3R8B A;  4FF3 A;  1KHI A;  4C3I H;  1PFM A;  1WCM H;  3VYS A;  1ICW A;  2JN4 A;  4MTK A;  1EFI D;  3NTH A;  3H09 A;  4BWG B;  2KCN A;  1Q12 A;  1AZP A;  2EYJ A;  3KDF A;  3TRE A;  3S24 A;  1EY8 A;  1BCP C;  1CQV A;  4IPH A;  1HNZ L;  4JVZ A;  4RGN A;  5IGB A;  3H0G H;  4PG3 A;  3GTQ B;  2QGQ A;  2RSO A;  1CKN B;  3I4M H;  1E2W A;  3UDX A;  3OWF A;  1PH2 A;  1H9R A;  2R92 H;  4GKJ Q;  1XNQ L;  1X32 A;  1XTC D;  5LL6 X;  1F2Z A;  5L37 A;  2ZT9 C;  1C9O A;  1HQR D;  4A75 A;  4IFD I;  5KYI A;  1EIF A;  3T16 A;  4DV6 L;  3DWQ A;  1SMX A;  3KLS X;  3TP6 A;  1EEF D;  5LHY 1;  1E2Z A;  4KKT A;  3X3N A;  1D8L A;  3U9S A;  1WVL A;  4R8N A;  1SBB B;  3AMU A;  1FNU A;  3STB D;  3VR2 A;  3I73 A;  4L6T B;  4O2D A;  1S3O A;  1IL8 A;  1UUP A;  1TWC H;  2JEB I;  3DWP A;  5EKL A;  2EXZ A;  3QOL A;  2JA5 B;  2KCT A;  2F0O A;  1HA6 A;  2X6L A;  2XRQ D;  1FNW A;  2BE5 D;  2R93 B;  2WFW A;  2KEE A;  1B53 A;  3AU7 A;  2UXD Q;  1PH3 A;  2RDH A;  2VY3 A;  2CWP A;  3S1R B;  3J81 L;  3SK6 A;  4BY7 B;  1JB3 A;  1EIY B;  2F4I A;  4A3G B;  2B63 H;  4KHP L;  4V19 0;  2BA1 A;  1BKB A;  2EYO A;  1ILP A;  3MXP A;  4UHV A;  2EE1 A;  1CKO A;  1RD9 D;  2NVT B;  1GKH A;  2JA6 B;  1SYB A;  1H9J A;  1L0Y B;  2KCM A;  2WB1 E;  4IOA A;  1VQE A;  2Z6K A;  3I55 A;  3Q22 A;  5IOD A;  1TWH H;  3AFQ A;  4YY3 L;  4LF9 L;  2XVS A;  4A3I B;  1X55 A;  4TRD A;  1A63 A;  1HFN A;  5DM6 3;  2C35 B;  1JB7 A;  2FFK B;  3GTM H;  1AE2 A;  1M1K C;  2F0V A;  3M4Q A;  1VQD A;  2Z6K C;  4YCU A;  2E2J H;  3F1Z A;  2OWO A;  3RLN A;  3PUW A;  4HTH A;  4KJO A;  1VS0 A;  3HG9 A;  2MUY A;  2UU9 L;  2BH2 A;  4UP8 A;  5BR8 L;  4AYB E;  1EY0 A;  1N9W A;  2D2C C;  3BYY B;  5LMN L;  2EJG C;  3BZD B;  4MZ9 A;  1PDQ A;  4GOP B;  1FVI A;  3QWN A;  1QZG A;  3PO3 B;  5EAY A;  5M5X H;  1F9Q A;  3I4O A;  3BVG A;  2GA4 B;  2RF4 A;  3BVZ A;  1I6V C;  5I9O A;  2JXM B;  1VQ6 A;  2XN9 C;  3J80 L;  1BXT A;  3HGB A;  1L1O B;  1ZYR D;  4LFB Q;  2HT1 A;  2E8G A;  3L3O C;  2JSO A;  1JOK A;  2WV6 D;  1AN8 A;  5AJ3 Q;  3CC2 A;  5A2Q L;  1ESR A;  2F0W A;  2B29 A;  1Y1W H;  1HR0 W;  2E5L Q;  5M3M G;  4POF A;  5IWA L;  4MIU A;  2L15 A;  1HR0 Q;  4A3D G;  4RG1 A;  3C1E A;  4QMG A;  1BF4 A;  1ASZ A;  3DXJ C;  4KLK A;  5IP7 H;  5CV9 A;  4EVO A;  2OCE A;  5BR8 Q;  1HTP A;  2MHV A;  1JJC B;  2LS0 1;  2ZM6 Q;  1SMY D;  3HOV B;  1FJG Q;  3J81 j;  4M1U B;  5EPL A;  2EIF A;  3VA5 A;  4DV7 L;  3NEL A;  3D4D A;  3R2T A;  3HOX G;  2HIX A;  3PIO A;  3K58 A;  1PXU A;  2CH4 W;  2ES2 A;  2VUM B;  1DOK A;  2BCO A;  2K5Q A;  3CF5 A;  4YWM A;  1WD1 A;  5EQ0 A;  3WOF A;  1STG A;  4L5T A;  2ENB A;  3UDG A;  5C4X G;  3MXU A;  4ODG A;  1CQF A;  1PTO D;  3T1Y L;  4KKU A;  1CA6 A;  4J6H A;  5GAE C;  3CRL C;  1C0A A;  1GHK A;  2N49 A;  4DR1 Q;  4B3M Q;  1XMQ L;  4DXF A;  4A3B H;  4DR7 L;  1M8A A;  2VL6 A;  2E76 C;  3ULL A;  4FYD A;  3T1Y Q;  3RZO B;  2R7Z B;  1EOT A;  1NBW A;  1IBK L;  4JI2 Q;  2KQ3 A;  3OTO L;  2ZJR A;  4GS3 A;  1N32 Q;  1G91 A;  4RMF A;  3FHW A;  3EN2 A;  1AZQ A;  5M3M H;  2KED A;  2YYZ A;  1PH8 A;  5C44 B;  2C5C A;  4OWT B;  4I65 A;  3CCL A;  3HOX B;  5F2D A;  4ZRZ A;  3E0E A;  2E2D C;  1ONL A;  4BBR H;  1PH4 A;  1S5E D;  1TXY A;  1N36 L;  3P7J A;  3QG1 A;  1CT1 D;  2UXC Q;  1EYC A;  4X64 L;  2A6E D;  1H9M A;  2ZXR A;  3OHX C;  4LF5 L;  3W2D A;  5NUC A;  4XYQ A;  3DEO A;  2NN6 I;  1PRT B;  2EY2 A;  1MD2 D;  1EYG A;  3NSW A;  3QJY A;  1YEZ A;  2IL8 A;  4LF4 Q;  3I4M G;  4A93 B;  3UDI A;  3V2T A;  1EWC A;  4K0K L;  4IPC A;  1E3P A;  4G7Z C;  4WRD A;  1G2T A;  1FYC A;  5LMU L;  1I4R A;  4GLA C;  4QCL A;  2AWO A;  3S15 H;  2L55 A;  3T4A C;  1PTO F;  1G29 1;  4OO1 I;  5JJK A;  4ME3 A;  3PO2 H;  4XT3 B;  3RNU A;  4IFD H;  3KK7 A;  4JPB W;  1XNR Q;  3A8I E;  1DCZ A;  2YTY A;  3Q23 A;  5C4J B;  4XYO A;  4YY3 Q;  4LF9 Q;  2NVQ B;  3MXG A;  3RZD H;  4KV6 A;  4H44 C;  1SAP A;  2CWA A;  1FGU A;  3UE0 A;  4DUY L;  1XMO L;  1YNN C;  1SNC A;  1E0B A;  3JC6 6;  5KRU A;  2K5W A;  5IT9 c;  1X3G A;  1STY A;  1HZA A;  3J81 i;  2WP8 J;  1EQT A;  1YJN A;  4A3F H;  2F0P A;  2K14 A;  1LV9 A;  2ICE C;  4YHH Q;  1X56 A;  3HOZ B;  1P8L A;  1PYW D;  2YV5 A;  2VQF L;  1ASY A;  4A76 A;  1HZC A;  2DJG C;  3V96 A;  1QOH A;  1VF5 C;  1LUZ A;  4LK1 C;  3QOJ A;  1X3Q A;  1DGS A;  2OF1 A;  2EJF C;  3LWU A;  2WB1 B;  3ULP A;  3CP0 A;  3K80 C;  5C0X G;  2EXD A;  2RKS A;  1QVF A;  4JI3 Q;  5EKI A;  1WTH A;  3C46 A;  3PO3 G;  4FVM A;  5K5P A;  2A5H A;  4A93 G;  4LUZ A;  5IP9 H;  2QIL A;  2RDG A;  2UUB Q;  2AQ1 B;  3URY A;  4JG2 A;  4C2M B;  2NVY H;  1L2F A;  1TWA B;  4YWK A;  3MVV A;  3MHB A;  1LAC A;  4JBK A;  3G7L A;  1STB A;  2KCC A;  3W3A A;  4XQJ A;  3CKI B;  5LMN Q;  1KL9 A;  1IHZ A;  4X6A H;  5JPN C;  4Y52 H;  2A69 C;  2IX0 A;  3IKJ A;  3CPF A;  3T1H L;  4RFB A;  2RHQ B;  1Y1W B;  2PMZ B;  4H13 C;  4DR1 L;  4HJ8 A;  2F0S A;  4ZQ3 A;  1XMQ Q;  1S5D D;  1X65 A;  5FO9 B;  3FKI H;  1KC8 C;  4EGV A;  2HD3 A;  2SNM A;  1PZI D;  3TRZ A;  4GKK Q;  4B3R Q;  3T13 A;  2CCZ A;  1O78 A;  2RQX A;  1CHQ D;  4PMW A;  2HHH Q;  3TQY A;  5M5Y H;  5C3W A;  1SSO A;  1II3 A;  4NKL A;  4KMU C;  5TSS A;  2IX1 A;  4IQZ A;  4DR6 L;  3NBH B;  2E2I B;  3J81 c;  2FMC A;  3A55 A;  2GN5 A;  1ZXT A;  2Z8L A;  1WD0 A;  2Y0S G;  4BY1 H;  1PZJ D;  3ND8 A;  1A2T A;  4IPG A;  1LAB A;  4A3D H;  3SK4 A;  3CMA A;  1JJ2 A;  3WOE A;  1HNX Q;  1J6Q A;  3D8G A;  3OIQ A;  1Q7Y C;  2ALY B;  4DV5 L;  3WDN A;  3DEP A;  1I94 Q;  1SND A;  4JI7 L;  4G7H C;  5IYD G;  3MEH A;  1U5K A;  1LYL A;  2QCP X;  3HRZ C;  1B9N A;  5ELD A;  1BCP D;  2Q8R E;  1SE8 A;  1G2S A;  1QVC A;  3SK5 A;  5JVH 3;  1N8R C;  4K8I A;  2K5D A;  4DV1 L;  2DNE A;  4NMZ A;  2I5M X;  2ZJP A;  3I90 A;  1IXR A;  1YVC A;  1HTL D;  4J1M A;  1DD2 A;  4KY7 A;  3ULJ A;  3KBX A;  5IYB H;  4PMB A;  1I6H H;  3RD4 A;  3A74 A;  1SEB D;  2R93 H;  1F2Y A;  1K3R A;  1B7Y B;  3EFX D;  2PI2 A;  3TZD A;  1ESF A;  4QIW B;  3NQI A;  1O7L A;  4O0A A;  3J7A V;  1ENA A;  1GM5 A;  2CKZ B;  3MEF A;  5FO7 B;  4C3J G;  5A2Q E;  4OO1 H;  1NAP A;  2NZH A;  1TWF H;  2K50 A;  2ZTD A;  4HR7 B;  2LXK A;  5IP9 G;  3J7A 5;  2UXD L;  4V0B A;  1B44 D;  1FD7 D;  1X9N A;  2D9U A;  4RGM A;  1VQ4 A;  1K0R A;  1EZ6 A;  2Q2H A;  1K83 H;  4CDC C;  2MJ8 A;  1SN8 A;  3KYH C;  4CJ0 B;  2NVQ H;  3PCO B;  3J80 c;  4QJF A;  4AQY Q;  1I4H A;  3MWY W;  4CJ1 B;  3D31 A;  1U9R A;  3GTO B;  4JW0 A;  2F0Q A;  2VB3 X;  3LX0 A;  3PO2 B;  1SNM A;  2B2T C;  1V1P B;  3HKZ B;  3VR5 A;  4LFC Q;  3T53 B;  4QF4 A;  5IYD H;  1HFG A;  3ERQ A;  1CHP D;  3CD6 A;  4DFA A;  5FLX L;  3TS0 A;  1U4P A;  2K7V A;  3CQZ B;  5JJZ A;  1EUJ A;  4GN4 B;  4DV2 L;  1GXD C;  2Y0S B;  1PH7 A;  4WJ3 M;  3AEV A;  3NK9 A;  1CI3 M;  2UU9 Q;  2RHS B;  1SXT A;  1DOM A;  1Y1V B;  1D7Q A;  1ILQ A;  4GZY C;  3PIP 3;  3FRP B;  3A8J E;  4K6L A;  2K1B A;  2XWB B;  1VF7 A;  5HY6 A;  5JVG 3;  2MGS A;  2SNS A;  3FVQ A;  1Z9F A;  3S1M B;  3H3V C;  2WAQ G;  4A3J G;  2Z0S A;  1VQ8 A;  2GVB A;  2R7F A;  2SEB D;  5J1Z A;  5IP7 G;  2IHE A;  5ELF A;  1ICF B;  2R93 G;  3L7Z C;  3HOU H;  4DV7 Q;  5C4X B;  1HA5 A;  1SNQ A;  3VDY A;  2BH8 A;  1C48 A;  4A3K B;  4GLV B;  4N8X 1;  1Y1W G;  1V1O A;  3Q24 A;  2F0H A;  3M7N A;  4IOC A;  4OX9 Q;  3J80 i;  1RF2 D;  4OXP A;  4IUV A;  4K2L A;  5DNF A;  2YTX A;  5DM7 3;  4DGZ A;  5FKA C;  2JP1 A;  2LKV A;  3ERO A;  1SNO A;  4ID6 A;  1SJH D;  4C1N K;  4GNX B;  2N8N A;  2RCN A;  4A3C H;  1NMF A;  1LO5 D;  4G57 A;  4L8J A;  4Y7N H;  1L0W A;  1Q8K A;  3OYY A;  5M3M B;  1JCK B;  3GTQ H;  1I4X A;  4BXX G;  1NR4 A;  1JE5 A;  4DR5 L;  1VQG A;  4HIO A;  2HDL A;  4HJ9 A;  1CUK A;  3GTK H;  1NMG A;  2MFI A;  4AH6 A;  3QB3 A;  4GNX C;  2A69 D;  2CVR A;  5M3F H;  3MXN A;  5KNB A;  2L1B A;  3KDF B;  4NB3 A;  4IUP A;  1DXM A;  3HOV H;  4CGY B;  1CK1 A;  1NUC A;  1HNX L;  2PQA A;  1XTD A;  3MTS A;  4RAU C;  3K57 A;  2CFM A;  4JI0 Q;  4X3U A;  1VQ9 A;  3TDQ A;  2G9D A;  1RJT A;  4LMQ D;  3F2U A;  1EU3 A;  3NHH A;  2NUC A;  4FDB A;  3FKI G;  1QCB D;  4JI6 L;  4LF4 L;  4H02 A;  4CDE C;  2PZW A;  5GAH C;  1MGS A;  3Q6S A;  1VQA A;  3EQL C;  5CBE E;  3OW2 A;  2KHI A;  2BDN A;  1CZG A;  5IY0 A;  4BBS G;  1IYV A;  4HN7 A;  4C3H G;  3FPU B;  4A3K G;  1UE7 A;  1PLF A;  2NN6 H;  4L5Q A;  3RZD B;  3TZU A;  5M5W B;  4OON A;  5I2Y A;  1E1T A;  3PSI A;  3STB C;  3GTL H;  1E2V A;  5HGQ A;  4A3E H;  1J9O A;  1LLR D;  3BU2 A;  1YNN D;  2AQ2 B;  2Q2T A;  3QR8 A;  1IKM A;  4A3J B;  3I4N H;  4BBS B;  1VQF A;  3D4W A;  4I7Z C;  1EYD A;  3L9A X;  1YBY A;  1EYA A;  2O5I C;  4DV0 L;  2MQH A;  3NQT A;  2ID0 A;  2JA9 A;  3Q0A A;  1UEB A;  4ZUI A;  4KJN A;  5GQO A;  1LTR D;  3I3C A;  3H6M A;  4LFA Q;  3AB9 A;  4RGO S;  4CDD C;  2K28 A;  1JT8 A;  1IKL A;  2YU9 B;  4IUU A;  5ELE A;  3GTL B;  3QIA A;  5KYL A;  1KTK A;  2K01 A;  2F3W A;  3S17 H;  1YNJ D;  1VQO A;  2EDG A;  2EY5 A;  4GN5 A;  3RN2 A;  1LTA D;  1DJR D;  3ER0 A;  5ISR A;  2LY7 A;  3S2D H;  2I5L X;  5FO8 B;  1W6K A;  3BJU A;  1W3S A;  3SR1 A;  1VMP A;  4A3G H;  3D3R A;  3E0J A;  3I56 A;  4U68 A;  2XSC A;  4L5S A;  1LM0 A;  4DV3 Q;  4Z9C B;  3H94 A;  5EPK A;  4LF8 L;  3JAM c;  1VQJ A;  2FHT A;  2E2I H;  2XRS D;  4RA8 A;  4F8M A;  1H9K A;  3VR6 A;  1GUT A;  4ZKC B;  4RKB A;  4F87 A;  2IY5 B;  4A3B B;  4DN4 M;  3S1M H;  4JC0 A;  1XX8 A;  2F03 A;  2N3S A;  1PH6 A;  4ZYS A;  3S16 B;  2EY6 A;  4AYB G;  4LAA A;  5FLM H;  2F4V L;  4P75 A;  1Q1B A;  4O42 A;  4RKL A;  3G71 A;  1YI2 A;  2NVT H;  3EVQ A;  5K36 G;  2E2H H;  4K5V A;  1EQQ A;  1SYF A;  1TS3 A;  4RGT A;  4LUV A;  3P1H A;  1BBX C;  3TP8 A;  4DPG A;  1VQB A;  1JC7 A;  2QEJ C;  4HJ5 A;  1TKW B;  3DWA A;  3A7L A;  1YNJ C;  4FXK C;  1P16 A;  4DR2 Q;  4PQX A;  2QW7 A;  2Q8T A;  1Z6H A;  2ZTC A;  2HIV A;  3SGI A;  1HZB A;  3GTG B;  5E3F A;  1Y1V G;  3OOC A;  1TWC B;  1JQY D;  2K5N A;  4TKO B;  5KNC A;  1YIT A;  2FIN B;  4UP9 A;  1IBL Q;  4PNY A;  4DK3 C;  3GV6 A;  3SXH A;  3NEN A;  2EOT A;  2IPK D;  2NWG A;  4M8A A;  1BDO A;  5EBD A;  3RUZ A;  3PUX A;  4HIM A;  1EQV A;  1W2B A;  3VYU A;  1TWG H;  3HKZ G;  5KIX A;  1Y8O B;  3DHQ A;  1BBU A;  1KRS A;  2EJM A;  5C5M A;  4DKA C;  4TQU S;  1B70 B;  2R7Z G;  2DNC A;  1QJO A;  4JBW A;  1N34 Q;  2IX3 A;  4GLX A;  3GTJ H;  1D5M C;  5CV8 A;  1VQ7 A;  2DUD A;  1C4Q A;  2F0U A;  2ZXP A;  2XGT A;  5IGD A;  2EZV A;  3GO5 A;  2SDF A;  4NXM L;  2RCF A;  4JI0 L;  1ZEQ X;  1TU2 B;  2DY8 A;  3G6J B;  1R9T H;  2HCI A;  4GOP C;  4JI2 L;  1VQ5 A;  4KY5 A;  2KHJ A;  2B2V A;  4ABN A;  1U4M A;  5JJI A;  1BR9 A;  1Q8I A;  5CC4 A;  3HOW B;  1PFB A;  1SE3 A;  4NW2 A;  4OEL B;  3S16 H;  1LT6 D;  1L0X B;  1V9P A;  4YCW A;  3RLF A;  1FGB D;  4DUY Q;  2BDO A;  1PVO A;  4LFA L;  1LTG D;  1Z47 A;  3CU7 A;  2JA7 H;  3F2C A;  4KY6 A;  2M00 A;  2KOL A;  3M4O B;  4CHT B;  2Q8I B;  5C5L A;  3NEM A;  1ZYR C;  3P20 A;  1OXU A;  3A8K E;  4AQY L;  2NYZ D;  3NUC A;  4K0K Q;  3DM1 A;  4K6D A;  2R7Z H;  3RZO H;  2OQ0 A;  3AYH B;  3E3X A;  5M3F G;  1A8V A;  1HNW L;  1B50 A;  3O13 A;  4L63 B;  1K8A C;  2KEN A;  1TT2 A;  3CRK C;  1JMC A;  3AQQ A;  2G5D A;  3NXW A;  4KN4 C;  1Y1V H;  3TME A;  1A3T A;  5C3E B;  3K6O A;  1QZH A;  3PF4 A;  1WFQ A;  2DJF C;  2R3Z A;  4ILW A;  2F0F A;  1PFN A;  3S1Q H;  3NWS A;  3CCJ A;  3GTM B;  4LFB L;  2EYM A;  4R8I A;  3N6R A;  1K9M C;  4DV4 Q;  5DEH A;  4KHZ A;  4RWS C;  4QB4 A;  2IWH A;  4FXD A;  4DV3 L;  4X66 Q;  4EQO A;  4XTC S;  4QUC A;  5C44 H;  2JA8 G;  3GV3 A;  3GTP B;  2WKD A;  2JEA I;  1PV4 A;  3ITP A;  4B3R L;  2ZXO A;  2VS1 A;  1QG7 A;  2CW0 C;  2RSN A;  1NCV A;  1BVS A;  2Q2I A;  4DK6 C;  5FJ8 G;  2NBF A;  1Q82 C;  3OWE B;  4LNQ A;  5CV5 A;  3R2I A;  3K59 A;  4C3I B;  1XJV A;  4XIG S;  5JEA J;  5ELO A;  4A3M H;  4XQN A;  3JAM E;  1A0I A;  3K0Y A;  4QUF A;  3IFT A;  4JV5 L;  1HZ9 A;  2ZTE A;  4BA2 I;  4PMC A;  4A3E B;  5CYU A;  1GHJ A;  2K05 A;  1H95 A;  5I4D A;  1YJW A;  4LF6 L;  1OXV A;  2H4O A;  4OEM B;  1GUG A;  3R93 A;  2LSS A;  4OHJ A;  4JI8 L;  3PO3 H;  1MHW C;  5M9O A;  3PQI A;  1EU4 A;  2V1C C;  4DK1 A;  1TII D;  3K8A A;  3M3Y H;  4DUZ Q;  5CGK A;  5CBA E;  3IAY A;  2PPB C;  4JI8 Q;  3CCU A;  4B08 A;  3J7Y W;  4LF7 Q;  4CKB A;  3IFD A;  4DAY A;  5GRO A;  5I9P A;  3UI2 A;  2F1M A;  2ZJQ A;  1PZK D;  4FNF A;  3I7F A;  1BCP B;  2X6G A;  4JOI C;  3S2H H;  1JWM D;  1QNK A;  1TWA H;  3KLW A;  1CA5 A;  5I2X A;  2Z6B A;  1MI2 A;  2UUA L;  3PGZ A;  1BQQ T;  3C1F A;  4HID A;  1IBM L;  1JIC A;  2C9O A;  4C3J B;  4GKJ L;  4DR4 L;  5IOC A;  4FP5 D;  2OTL A;  4B3T L;  4GN3 B;  1KNA A;  2XIW A;  3MFY A;  1OXT A;  4IFD G;  1RTN A;  4S3S A;  2CQA A;  4LJZ C;  2IT1 A;  5IGF A;  1V43 A;  3P75 A;  5D3I B;  2Y0S E;  1JE4 A;  1K8M A;  2MP1 A;  1GUO A;  4KKS A;  3IRB A;  1R4P B;  1ROD A;  2I07 B;  4HJ7 A;  4IUQ A;  1EEI D;  1QNU A;  3HP3 A;  5C0X J;  1HNZ Q;  4JBM A;  4A3F B;  5DLQ E;  4AIM A;  4LWC A;  2JA6 H;  4RCO A;  1GVP A;  1RL2 A;  2PYK A;  2Q2U A;  2WIN B;  3S2D B;  1PTO B;  4CKC A;  4LUO A;  4HED A;  4DXG A;  1AH9 A;  1VCI A;  5C4J H;  4HJA A;  2QEX A;  4XQQ A;  4RH6 A;  1SDF A;  4B9W A;  1VQN A;  4B3S Q;  5I6Y A;  1BNZ A;  3S17 B;  3E9I A;  3OSO A;  3SEB A;  3DMU A;  4RHR A;  2SOB A;  3F8T A;  3A5U A;  4JI3 L;  1TY0 A;  3MA2 B;  1WTQ A;  3W1B A;  1F9P A;  2KA7 A;  2Z4I A;  1C8C A;  4DAP A;  4BS9 A;  3PIO 3;  3KJP A;  2K03 A;  1PYB A;  1Q81 C;  4A93 H;  2F0L A;  3PUZ A;  1SMY C;  2FMM A;  4C3J H;  1U4L A;  4A3M G;  4YIJ A;  1KD1 C;  5C3E G;  4BY7 H;  1BO0 A;  3D0F A;  5IYC H;  1V1Q A;  4WJW A;  1D1K A;  3D6C A;  1EOV A;  2HQL A;  2JE6 I;  4F7X A;  2L9H A;  1IZ6 A;  1VQI A;  3PIP A;  1I50 H;  5C44 G;  2JA8 H;  4LF8 Q;  3OPO A;  4IUR A;  2K5H A;  4F88 A;  3M4Y A;  1YNX A;  1SE4 A;  3HKZ E;  1WI5 A;  3CC4 A;  2M2L A;  4DV2 Q;  3EBE A;  5HGT A;  2PZU A;  2PW5 A;  4JI5 L;  4A3E G;  1EY4 A;  1M90 C;  1WTP A;  5E4W C;  5H1S E;  4A3G G;  3NE5 B;  1SR3 A;  4QQB X;  4XT1 B;  5IGE A;  5DAU A;  1LTS D;  1WTX A;  3GTG H;  3T51 B;  2VW9 A;  2JJQ A;  1D5Z C;  1IBL L;  1KLG D;  1O80 A;  5HUR A;  1ML0 D;  4B9X A;  1B2T A;  2WB1 G;  3FP9 A;  3K7U C;  1Y14 B;  1N36 Q;  1GUN A;  4C3H B;  1E24 A;  3VA7 A;  2IHF A;  2MNA A;  1B3Q A;  2P5Z X;  4A3B G;  1PH5 A;  4OGQ C;  3U4V A;  4DAM A;  3A5Z B;  4ULL A;  2AMC B;  3OTO Q;  3CME A;  2EQS A;  1LTL A;  2PW7 A;  3BZK A;  4PZ8 A;  4HCE A;  4DR2 L;  2R6G A;  2ICI A;  2F0I A;  2K4K A;  2K5V A;  1LT4 D;  3PV0 A;  3VR3 A;  1UE6 A;  4MHE A;  5C3E H;  5KND A;  3W1G A;  1NY4 A;  4JI7 Q;  2LXJ A;  3TP7 A;  2B63 B;  4A3K H;  2QF7 A;  3M85 A;  1QWY A;  4K2K A;  3HOU B;  3OIP A;  5D14 A;  1GOZ A;  3HOZ G;  4K14 A;  4ZUJ A;  2HDM A;  4DAV A;  1Q90 A;  3A54 A;  2I46 A;  2K75 A;  1K8G A;  3J81 E;  1AEX A;  1S4Z A;  3VYT A;  2RDF A;  4A3I H;  4B3S L;  2A8V A;  3LWE A;  4N8F A;  2L11 A;  3GTK B;  3E6Z X;  2E2H B;  3NTI A;  1BOS A;  3IL8 A;  1KDA A;  1VDZ A;  4BY7 G;  5C3X A;  1IYJ B;  4HCS A;  4DV6 Q;  3PF5 A;  1IW7 C;  1CSP A;  2B2Y A;  2KJX A;  1H9S A;  4WFN 3;  3HOW G;  4DNI A;  3U4Z A;  4DR4 Q;  4A3I G;  2JK8 A;  3CCV A;  5JEA H;  4DV1 Q;  4UAI A;  3ND9 A;  4DV0 Q;  5LMN W;  2JA7 G;  3I4M B;  2PMZ E;  3A7A B;  4UP7 A;  1GJX A;  2EPB A;  2B2Y C;  5LMU Q;  4EX5 A;  5E1F A;  2RBM A;  3L0O A;  4A4I A;  3C3L A;  5EBC A;  3HFZ B;  1LT3 D;  4GNX A;  2AUK A;  4CDF C;  5GAD C;  1MIU A;  2OT2 A;  3K5N A;  5C0X I;  2NN6 G;  3MFG A;  5IGG A;  4LF5 Q;  2HQE A;  4HIK A;  1HXY D;  3GTJ B;  2JA5 G;  2YU9 H;  1CTM A;  4R4O A;  1KQS A;  2OTJ A;  1WYD A;  1Q46 A;  2Z4H A;  1HUN A;  3UE1 A;  2O2L D;  4HMI A;  2B39 A;  2NTS A; 
#chains in the Genus database with same CATH homology
 2CHB D;  3H0G B;  1F2L A;  1I6H B;  5M5X B;  3BS1 A;  3SE0 A;  2AUJ D;  2QKI C;  1S5F D;  1STE A;  2VNU D;  2NZ1 D;  5IT9 L;  4BA1 I;  1I4P A;  3CHB D;  4Y7N B;  1X3P A;  5T1I A;  5C0X H;  1TWH B;  4HSP A;  2F3V A;  3HOY B;  1S5C D;  1OO9 B;  1F9R A;  1T5E A;  1VMC A;  2N55 A;  2TMP A;  4ZLT F;  1TQO A;  3ONA B;  2NB0 A;  3HEJ A;  4DNT B;  2EYF A;  5KEE A;  5G3L D;  4FXG C;  1KAB A;  2A6H D;  5CV7 A;  3FMC A;  2VXW A;  2B8F A;  3OW7 A;  1GUW A;  1WTO A;  5IGC A;  1B3A A;  2E2J B;  3MAQ A;  4K5X A;  5CMD A;  1TVX A;  2A73 B;  2IJ0 A;  1HQM C;  1R4Q B;  2L4N A;  4KN7 C;  4DF7 A;  3I4L A;  4KTA A;  2PZT A;  4DNR B;  5AFW A;  1ENC A;  1PTO H;  4RCN A;  2WAC A;  5JAV A;  1EL0 A;  1B1Z A;  3SVM A;  2PCF B;  3BYT B;  2H1E A;  3BDO A;  4BY1 B;  2AQ3 B;  2LFN A;  3GD7 A;  1SYD A;  5BN5 A;  2JA7 B;  3GQB A;  3FEW X;  2A6H C;  1UNS A;  2B2U C;  5COY A;  2MPM A;  2JA8 B;  2RA4 A;  1I3Q B;  1HCZ A;  2NVY B;  1EWH A;  1XXG A;  3FKI B;  4DK0 A;  2QDB A;  2BE5 C;  1Y69 U;  4ME5 A;  3PUY A;  3KLS A;  1IYU A;  1DM0 B;  1SYE A;  3T56 B;  4IAL A;  5K36 H;  2A68 D;  2E75 C;  4FF2 A;  2B2W C;  2R92 B;  1HUM A;  2L5T A;  2CW0 D;  2HUG A;  4FO2 A;  1A15 A;  5BN4 A;  4G7O C;  1I4G A;  1Z7T A;  3S15 B;  1WTR A;  4DU9 A;  1SJE D;  2K33 A;  3PMF A;  3K5O A;  4KI0 A;  1R9T B;  5C4H A;  2BA0 A;  4KHV A;  4OIJ A;  1KNE A;  1I4Q A;  3QO2 A;  1D6E C;  2M9V A;  4ZKB B;  1TWF B;  3K5L A;  1Y8N B;  4G4K A;  1BCP F;  2PNR C;  3SDZ A;  1D5X C;  1PRT D;  1SYC A;  1TR5 A;  1DYQ A;  5C6A A;  4FF1 A;  1KAA A;  5CV6 A;  1RTO A;  4C1N I;  3TP5 A;  1FR3 A;  1JWS D;  5T1G A;  3X3M A;  2WAQ B;  2DY7 A;  3BDC A;  5J39 A;  3KF8 A;  1PRT F;  1DOL A;  1STA A;  1JR0 D;  3DUZ A;  2F0G A;  1G6Z A;  1EY9 A;  1U4R A;  4MN3 A;  2WII B;  3BG3 A;  4KD3 A;  1S5B D;  2AWN A;  1LTB D;  4IUN A;  4X3S A;  2PQE A;  4PV1 C;  2OEO A;  2A6E C;  1V8Q A;  2X69 A;  1J8I A;  1TY2 A;  1KDB A;  1PTO C;  1V1P A;  1EIG A;  1EZ8 A;  3I72 A;  3SHL A;  1TWG B;  4A3M B;  5E4X A;  4P2C B;  2WKC A;  1HPC A;  3FPP A;  1H9S B;  4R9W A;  1KLU D;  1WTV A;  1NR2 A;  3EJI A;  5EGT A;  4ZK9 B;  4Q0F A;  2RVL A;  2J4X A;  1I50 B;  1G8Z D;  3S2H B;  2BOS A;  3PUV A;  4KD4 A;  4TSS A;  4RHS A;  1EY6 A;  1TS2 A;  2A74 C;  4E6I A;  1PMR A;  3EA6 A;  4U67 3;  5IT9 E;  3D4R A;  1WCM B;  4NDX A;  1BUV T;  2D5D A;  4OL7 A;  3HS0 C;  2KHS A;  2B2T A;  3LNN A;  1CZW A;  2F0D A;  2NVX B;  3OMC A;  4K5W A;  1TS4 A;  2B2U A;  4AYB B;  1O7Y A;  4EQN A;  2FJ2 A;  4IN3 A;  4H7B A;  1AFP A;  5M5Y B;  2J0T D;  4IZ8 A;  2K32 A;  4Q5V A;  3S1Q B;  3BDL A;  5EKK A;  2G9H D;  3KBG A;  5KGU A;  1SYG A;  1LT5 D;  2Z1C A;  2L0C A;  2EYH A;  4OIK A;  1AP0 A;  3U9O A;  4CJ2 C;  5G3L F;  1ET9 A;  3I70 A;  1Y8P B;  5CR3 A;  3A56 A;  1LTI D;  3VR4 A;  3OMG A;  5M3F B;  4XXE A;  1F9S A;  3J7A F;  3N52 A;  1CFM A;  1TS5 A;  1Q1E A;  2R61 A;  5C4Z A;  4CKE A;  2K6A A;  1UAP A;  4UDU C;  2KVM A;  3MC0 B;  1JOQ A;  1DZ1 A;  3K5M A;  3TBI B;  2B8G A;  4IFD J;  4H0L C;  3JAM L;  1RKN A;  1ET6 A;  5CV4 A;  4C3I G;  4KK7 A;  1DON A;  1PRT C;  3NTK A;  3R3O A;  3NBH A;  2B2V C;  4JK1 C;  1JOR A;  2V4D A;  1XWE A;  1B9M A;  3NPP A;  1HHV A;  3C2P A;  4WOR A;  3BVM A;  1QIL A;  5ELB A;  1STH A;  1MBY A;  1RDP D;  1EIH A;  5JOB A;  4XDX A;  1NSN S;  3FDT A;  3HZX A;  2XNA C;  5A35 A;  1B4O A;  4DA2 A;  3GP7 A;  4IUT A;  4O1N A;  2O4X A;  2DN8 A;  5EJW A;  2IW3 A;  2PO4 A;  5LL6 S;  4J8Q A;  1GUS A;  1IW7 D;  5EPJ A;  1K83 B;  3KUP A;  5FOB B;  1A2U A;  2F0E A;  2VB2 X;  3I4N B;  4X3T A;  2F0J A;  1SNP A;  4N9T A;  3J80 E;  5JEA G;  4HMJ A;  1LTT D;  3TN2 A;  4OO1 G;  1O7Z A;  1M4V A;  3NWT A;  4CBV A;  5FK9 C;  1CM9 A;  4FF4 A;  3M3Y B;  1JOO A;  2K04 A;  1D1I A;  1MSH A;  4N9P A;  4HSV A;  4K8J A;  1EY7 A;  1WTW A;  4A3D B;  1W6J A;  1AW7 A;  2E74 C;  5COR A;  3D6W A;  5JPM C;  3S9W A;  1XYI A;  1EY5 A;  2EYP A;  3S14 B;  4BBR B;  2LMC B;  3E5S A;  2N88 A;  3H91 A;  2EY1 A;  1F2M A;  2JYO A;  1A3U A;  1KDC A;  2L12 A;  2XWJ B;  3KLR A;  3M7G A;  1A6X A;  5D65 A;  2OXP A;  2EYL A;  1RCV D;  1STN A;  1FNV A;  2F0T A;  4HAE A;  2F0N A;  2D62 A;  1JWU D;  4EQP A;  3VYR A;  1RHP A;  1QE6 A;  2EVB A;  4X3K A;  3S1N B;  2F0M A;  3K7A B;  1HRJ A;  5D3D A;  1OXS C;  2O5J C;  5J22 A;  1SFO B;  3NP8 A;  1D2B A;  2TSS A;  2A68 C;  1F77 A;  5BN3 A;  2KUM A;  1ENF A;  2F0K A;  1QB5 D;  5FLX E;  1A3V A;  3MZ5 A;  3V05 A;  1Q3L A;  4C56 C;  5IIF A;  3I8Z A;  3I91 A;  1SE2 A;  3RMH A;  3NBI A;  2HCC A;  3SK8 A;  1OXX K;  1MSG A;  3ZYY X;  3TSS A;  2B2W A;  1T5X D;  4ZAI A;  4NP5 A;  1ZKO A;  1K8O A;  1UEA B;  5ELC A;  2KEC A;  2J7Z A;  2NTT A;  5I6W A;  3R8B A;  4FF3 A;  1PFM A;  3VYS A;  1ICW A;  1EFI D;  3NTH A;  3H09 A;  4BWG B;  2KCN A;  1Q12 A;  1AZP A;  2EYJ A;  1EY8 A;  1BCP C;  1CQV A;  4RGN A;  5IGB A;  3GTQ B;  2RSO A;  1E2W A;  3OWF A;  1H9R A;  5LL6 X;  1X32 A;  1XTC D;  1F2Z A;  2ZT9 C;  1HQR D;  4IFD I;  5KYI A;  3T16 A;  3DWQ A;  3KLS X;  3TP6 A;  1EEF D;  5LHY 1;  1E2Z A;  4KKT A;  3X3N A;  3U9S A;  1WVL A;  4R8N A;  1SBB B;  3AMU A;  1FNU A;  3VR2 A;  3I73 A;  4L6T B;  1IL8 A;  1UUP A;  2JEB I;  3DWP A;  5EKL A;  2EXZ A;  3QOL A;  2JA5 B;  2F0O A;  1HA6 A;  2X6L A;  2XRQ D;  1FNW A;  2BE5 D;  2R93 B;  2KEE A;  1B53 A;  3AU7 A;  2RDH A;  3S1R B;  3J81 L;  3SK6 A;  4BY7 B;  1JB3 A;  4A3G B;  2F4I A;  4V19 0;  2BA1 A;  2EYO A;  1ILP A;  3MXP A;  2EE1 A;  1RD9 D;  2NVT B;  2JA6 B;  1SYB A;  1H9J A;  1L0Y B;  3Q22 A;  5IOD A;  2XVS A;  4A3I B;  4TRD A;  1HFN A;  5DM6 3;  2FFK B;  2F0V A;  3PUW A;  4HTH A;  4KJO A;  3HG9 A;  2MUY A;  1EY0 A;  2D2C C;  3BYY B;  2EJG C;  3BZD B;  1PDQ A;  3QWN A;  3PO3 B;  1F9Q A;  3BVG A;  2GA4 B;  3BVZ A;  1I6V C;  5I9O A;  2JXM B;  2XN9 C;  3J80 L;  1BXT A;  3HGB A;  1ZYR D;  3L3O C;  2JSO A;  1JOK A;  2WV6 D;  1AN8 A;  5A2Q L;  1ESR A;  2F0W A;  4MIU A;  3C1E A;  4QMG A;  1BF4 A;  3DXJ C;  5CV9 A;  4EVO A;  1HTP A;  2MHV A;  2LS0 1;  1SMY D;  3HOV B;  4M1U B;  5EPL A;  3VA5 A;  3D4D A;  3R2T A;  3K58 A;  1PXU A;  2VUM B;  1DOK A;  2BCO A;  2K5Q A;  1WD1 A;  5EQ0 A;  3WOF A;  1STG A;  2ENB A;  3MXU A;  4ODG A;  1CQF A;  1PTO D;  4KKU A;  1CA6 A;  4J6H A;  3CRL C;  1GHK A;  4DXF A;  1M8A A;  2E76 C;  4FYD A;  3RZO B;  2R7Z B;  1EOT A;  2KQ3 A;  1G91 A;  1AZQ A;  2KED A;  2YYZ A;  5C44 B;  2C5C A;  4I65 A;  3HOX B;  5F2D A;  4ZRZ A;  2E2D C;  1ONL A;  1S5E D;  3P7J A;  3QG1 A;  1CT1 D;  1EYC A;  2A6E D;  1H9M A;  2ZXR A;  3OHX C;  3W2D A;  5NUC A;  4XYQ A;  3DEO A;  2NN6 I;  1PRT B;  2EY2 A;  1MD2 D;  3NSW A;  3QJY A;  2IL8 A;  4A93 B;  3V2T A;  1EWC A;  4G7Z C;  4WRD A;  1G2T A;  1FYC A;  1I4R A;  4QCL A;  2AWO A;  2L55 A;  3T4A C;  1PTO F;  1G29 1;  4OO1 I;  4XT3 B;  4IFD H;  3KK7 A;  3A8I E;  1DCZ A;  3Q23 A;  5C4J B;  4XYO A;  2NVQ B;  3MXG A;  4KV6 A;  4H44 C;  1SAP A;  1YNN C;  1SNC A;  1E0B A;  5KRU A;  2K5W A;  1STY A;  2WP8 J;  1EQT A;  2F0P A;  1LV9 A;  2ICE C;  3HOZ B;  1PYW D;  3V96 A;  1QOH A;  1VF5 C;  4LK1 C;  3QOJ A;  1X3Q A;  2OF1 A;  2EJF C;  3LWU A;  2WB1 B;  5C0X G;  2RKS A;  5EKI A;  3C46 A;  4FVM A;  5K5P A;  2A5H A;  2QIL A;  2RDG A;  2AQ1 B;  3URY A;  4C2M B;  1TWA B;  3MVV A;  3MHB A;  1LAC A;  3G7L A;  1STB A;  2KCC A;  3W3A A;  4XQJ A;  3CKI B;  1IHZ A;  5JPN C;  2A69 C;  2IX0 A;  3IKJ A;  4RFB A;  1Y1W B;  2PMZ B;  4H13 C;  2F0S A;  4ZQ3 A;  1S5D D;  5FO9 B;  4EGV A;  2SNM A;  1PZI D;  3T13 A;  1O78 A;  2RQX A;  1CHQ D;  4PMW A;  5C3W A;  1SSO A;  1II3 A;  4NKL A;  4KMU C;  5TSS A;  2IX1 A;  4IQZ A;  2E2I B;  2FMC A;  3A55 A;  1ZXT A;  2Z8L A;  1WD0 A;  1PZJ D;  3ND8 A;  1A2T A;  1LAB A;  3SK4 A;  3WOE A;  3D8G A;  3OIQ A;  3WDN A;  3DEP A;  1SND A;  4G7H C;  3MEH A;  2QCP X;  3HRZ C;  1B9N A;  5ELD A;  1BCP D;  2Q8R E;  1G2S A;  3SK5 A;  5JVH 3;  4K8I A;  2K5D A;  2DNE A;  4NMZ A;  3I90 A;  1HTL D;  4J1M A;  1DD2 A;  4KY7 A;  3KBX A;  4PMB A;  3RD4 A;  1SEB D;  1F2Y A;  3EFX D;  3TZD A;  1ESF A;  4QIW B;  3NQI A;  1O7L A;  3J7A V;  1ENA A;  5FO7 B;  4C3J G;  5A2Q E;  4OO1 H;  1NAP A;  4HR7 B;  4V0B A;  1B44 D;  1FD7 D;  2D9U A;  4RGM A;  1EZ6 A;  2MJ8 A;  4CJ0 B;  1I4H A;  4CJ1 B;  3MWY W;  3D31 A;  1U9R A;  3GTO B;  2F0Q A;  2VB3 X;  3LX0 A;  3PO2 B;  1SNM A;  2B2T C;  1V1P B;  3HKZ B;  3VR5 A;  3T53 B;  4QF4 A;  1HFG A;  3ERQ A;  1CHP D;  4DFA A;  5FLX L;  1U4P A;  2K7V A;  3CQZ B;  5JJZ A;  1GXD C;  2Y0S B;  3NK9 A;  1CI3 M;  1SXT A;  1DOM A;  1Y1V B;  1ILQ A;  4GZY C;  3PIP 3;  3FRP B;  3A8J E;  4K6L A;  2K1B A;  5JVG 3;  2XWB B;  1VF7 A;  2MGS A;  2SNS A;  3FVQ A;  3S1M B;  3H3V C;  2SEB D;  5J1Z A;  5ELF A;  3L7Z C;  5C4X B;  1HA5 A;  1SNQ A;  1C48 A;  4A3K B;  1V1O A;  3Q24 A;  2F0H A;  3M7N A;  1RF2 D;  4IUV A;  4K2L A;  5DNF A;  5DM7 3;  4DGZ A;  5FKA C;  2JP1 A;  2LKV A;  3ERO A;  1SNO A;  4ID6 A;  1SJH D;  4C1N K;  1LO5 D;  4G57 A;  4L8J A;  5M3M B;  1JCK B;  1I4X A;  1NR4 A;  2HDL A;  3QB3 A;  2A69 D;  2CVR A;  3MXN A;  5KNB A;  2L1B A;  4IUP A;  1DXM A;  4CGY B;  1CK1 A;  1NUC A;  3MTS A;  4RAU C;  3K57 A;  4X3U A;  3TDQ A;  2G9D A;  1RJT A;  4LMQ D;  3F2U A;  1EU3 A;  3NHH A;  2NUC A;  1QCB D;  2PZW A;  1MGS A;  3Q6S A;  3EQL C;  5CBE E;  2BDN A;  1CZG A;  1IYV A;  4HN7 A;  4C3H G;  3FPU B;  1PLF A;  2NN6 H;  3RZD B;  3TZU A;  5M5W B;  5I2Y A;  1E2V A;  1J9O A;  1LLR D;  1YNN D;  2AQ2 B;  1IKM A;  4A3J B;  4BBS B;  3D4W A;  4I7Z C;  1EYD A;  3L9A X;  1EYA A;  2O5I C;  3NQT A;  2ID0 A;  3Q0A A;  4ZUI A;  4KJN A;  1LTR D;  3I3C A;  3H6M A;  3AB9 A;  4RGO S;  2K28 A;  1IKL A;  2YU9 B;  4IUU A;  5ELE A;  3GTL B;  3QIA A;  5KYL A;  1KTK A;  2K01 A;  2F3W A;  1YNJ D;  2EDG A;  2EY5 A;  1LTA D;  1DJR D;  5ISR A;  2LY7 A;  5FO8 B;  1W6K A;  3SR1 A;  1VMP A;  3D3R A;  3E0J A;  4U68 A;  2XSC A;  4Z9C B;  3H94 A;  5EPK A;  2FHT A;  2XRS D;  4RA8 A;  4F8M A;  1H9K A;  3VR6 A;  1GUT A;  4ZKC B;  4RKB A;  4F87 A;  4A3B B;  4DN4 M;  1XX8 A;  2F03 A;  4ZYS A;  3S16 B;  2EY6 A;  4LAA A;  1Q1B A;  4O42 A;  4RKL A;  3EVQ A;  5K36 G;  4K5V A;  1SYF A;  1TS3 A;  4RGT A;  3P1H A;  1BBX C;  3TP8 A;  1JC7 A;  2QEJ C;  1TKW B;  3DWA A;  3A7L A;  1YNJ C;  4FXK C;  4PQX A;  2Q8T A;  1Z6H A;  3GTG B;  5E3F A;  3OOC A;  1TWC B;  1JQY D;  4TKO B;  5KNC A;  2FIN B;  4PNY A;  3GV6 A;  3SXH A;  2EOT A;  2IPK D;  2NWG A;  4M8A A;  1BDO A;  5EBD A;  3RUZ A;  3PUX A;  1EQV A;  3VYU A;  5KIX A;  1Y8O B;  3DHQ A;  2EJM A;  5C5M A;  4TQU S;  2DNC A;  1QJO A;  4JBW A;  2IX3 A;  5CV8 A;  1D5M C;  1C4Q A;  2F0U A;  2ZXP A;  5IGD A;  2EZV A;  3GO5 A;  2SDF A;  1ZEQ X;  1TU2 B;  2DY8 A;  3G6J B;  2HCI A;  4KY5 A;  2B2V A;  4ABN A;  1U4M A;  1BR9 A;  1Q8I A;  5CC4 A;  3HOW B;  1PFB A;  1SE3 A;  4NW2 A;  1LT6 D;  1L0X B;  3RLF A;  1FGB D;  2BDO A;  1LTG D;  1Z47 A;  3CU7 A;  4KY6 A;  2M00 A;  2KOL A;  3M4O B;  4CHT B;  2Q8I B;  5C5L A;  1ZYR C;  3P20 A;  1OXU A;  3A8K E;  2NYZ D;  3NUC A;  3DM1 A;  4K6D A;  1B50 A;  3O13 A;  4L63 B;  1TT2 A;  3CRK C;  3NXW A;  4KN4 C;  3TME A;  1A3T A;  5C3E B;  3K6O A;  2R3Z A;  4ILW A;  2F0F A;  1PFN A;  3NWS A;  3GTM B;  2EYM A;  4R8I A;  3N6R A;  5DEH A;  4KHZ A;  4RWS C;  4QB4 A;  2IWH A;  4FXD A;  4EQO A;  4XTC S;  4QUC A;  3GV3 A;  3GTP B;  2WKD A;  2JEA I;  3ITP A;  2ZXO A;  1QG7 A;  2CW0 C;  2RSN A;  1NCV A;  2NBF A;  3OWE B;  5CV5 A;  3R2I A;  3K59 A;  4C3I B;  4XIG S;  5JEA J;  4XQN A;  3JAM E;  3K0Y A;  4QUF A;  3IFT A;  4BA2 I;  4PMC A;  4A3E B;  5CYU A;  1GHJ A;  2K05 A;  5I4D A;  1OXV A;  2H4O A;  1GUG A;  3R93 A;  4OHJ A;  5M9O A;  1EU4 A;  4DK1 A;  1TII D;  5CGK A;  5CBA E;  3IAY A;  2PPB C;  4B08 A;  3J7Y W;  4CKB A;  3IFD A;  4DAY A;  5I9P A;  3UI2 A;  2F1M A;  1PZK D;  4FNF A;  1BCP B;  2X6G A;  1JWM D;  1QNK A;  1CA5 A;  5I2X A;  1MI2 A;  1BQQ T;  3C1F A;  1JIC A;  2C9O A;  4C3J B;  5IOC A;  4FP5 D;  1KNA A;  2XIW A;  3MFY A;  1OXT A;  4IFD G;  1RTN A;  4S3S A;  2CQA A;  4LJZ C;  2IT1 A;  5IGF A;  1V43 A;  3P75 A;  5D3I B;  1JE4 A;  1K8M A;  2MP1 A;  1GUO A;  4KKS A;  1R4P B;  1ROD A;  2I07 B;  4IUQ A;  1EEI D;  1QNU A;  3HP3 A;  5C0X J;  4A3F B;  4RCO A;  2PYK A;  3S2D B;  2WIN B;  1PTO B;  4CKC A;  4HED A;  4DXG A;  1VCI A;  4XQQ A;  4RH6 A;  1SDF A;  4B9W A;  5I6Y A;  1BNZ A;  3S17 B;  3OSO A;  3SEB A;  3DMU A;  4RHR A;  2SOB A;  1TY0 A;  3MA2 B;  1WTQ A;  1F9P A;  2KA7 A;  2Z4I A;  1C8C A;  4DAP A;  4BS9 A;  3PIO 3;  2K03 A;  2F0L A;  3PUZ A;  1SMY C;  2FMM A;  1U4L A;  4YIJ A;  1BO0 A;  4WJW A;  1D1K A;  3D6C A;  2JE6 I;  4F7X A;  2L9H A;  3OPO A;  4IUR A;  4F88 A;  3M4Y A;  1SE4 A;  2M2L A;  5HGT A;  2PZU A;  2PW5 A;  1EY4 A;  1WTP A;  5E4W C;  3NE5 B;  4XT1 B;  5IGE A;  5DAU A;  1LTS D;  1WTX A;  3T51 B;  1D5Z C;  1KLG D;  1O80 A;  5HUR A;  1ML0 D;  4B9X A;  1B2T A;  1GUN A;  4C3H B;  3VA7 A;  4OGQ C;  4ULL A;  2PW7 A;  4HCE A;  2R6G A;  2ICI A;  2F0I A;  1LT4 D;  3PV0 A;  3VR3 A;  4MHE A;  5KND A;  3TP7 A;  2B63 B;  2QF7 A;  3M85 A;  1QWY A;  4K2K A;  3HOU B;  3OIP A;  5D14 A;  1GOZ A;  4K14 A;  4ZUJ A;  2HDM A;  4DAV A;  1Q90 A;  3A54 A;  2I46 A;  3J81 E;  1AEX A;  1S4Z A;  3VYT A;  2RDF A;  3LWE A;  3GTK B;  2L11 A;  3E6Z X;  2E2H B;  3NTI A;  1BOS A;  3IL8 A;  1KDA A;  1VDZ A;  5C3X A;  4HCS A;  1IW7 C;  2B2Y A;  2KJX A;  1H9S A;  4WFN 3;  5JEA H;  4UAI A;  3ND9 A;  3I4M B;  3A7A B;  1GJX A;  2EPB A;  2B2Y C;  5E1F A;  2RBM A;  3C3L A;  5EBC A;  1LT3 D;  2AUK A;  2OT2 A;  3K5N A;  5C0X I;  2NN6 G;  3MFG A;  5IGG A;  2HQE A;  1HXY D;  3GTJ B;  1CTM A;  2Z4H A;  1HUN A;  2O2L D;  4HMI A;  2B39 A;  2NTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...