3I8ZA

Crystal structure of human chromobox homolog 4 (cbx4)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
50
structure length
50
Chain Sequence
FAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase CBX4
publication title Crystal structure of human chromobox homolog 4 (CBX4)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i8zA00
1HFNA 2KECA 4ZLTF 2MJ8A 3DEPA 5COYA 1C8CA 1PFMA 3KBXA 3Q6SA 1BNZA 2EE1A 5E4WC 4CJ2C 4XT1B 1SDFA 4O42A 1G2SA 3GV6A 4R8IA 1BF4A 2N55A 1CA6A 2CVRA 1X3QA 1SSOA 1U4MA 4ZKBB 1F2LA 1IL8A 2SDFA 3H91A 2X6LA 2MGSA 2J7ZA 1F9QA 4X3SA 1MSGA 3HP3A 4OIJA 2K28A 2KEDA 2N88A 2DY7A 5JJZA 1U4LA 1XYIA 5CBAE 1BBXC 2L4NA 3TN2A 2KUMA 4IUPA 1PDQA 1GUWA 1EIHA 2IL8A 3D6WA 2HCCA 1G2TA 1G91A 1B3AA 1A15A 5E4XA 1PFNA 4QUCA 2Q8RE 2K01A 1U4PA 3I91A 1DOMA 1PLFA 1S4ZA 1WD1A 1EQTA 1G6ZA 1B4OA 1EOTA 2MP1A 2L9HA 5EKIA 3I90A 1AZPA 2RSOA 4ZKCB 2FINB 2MPMA 2RVLA 1EIGA 1RTOA 1WTWA 4RA8A 1RHPA 1NR4A 1NR2A 1QG7A 3DM1A 2B2UC 4IUTA 5T1GA 1BO0A 2R3ZA 3IFDA 1MI2A 1RODA 2JP1A 3QO2A 1ICWA 1CM9A 1B50A 1J9OA 4R9WA 4IURA 5EPKA 1WTQA 1B2TA 3TZDA 2K04A 1IKLA 2VXWA 1WTPA 1U4RA 2X6GA 2DY8A 4ZK9B 5D14A 1LV9A 1NCVA 5D65A 4OIKA 1MSHA 1WTXA 2EOTA 1AP0A 1ILPA 1WTVA 2B2TA 3FPUB 1WTOA 2L11A 1SAPA 1M8AA 2L1BA 4DN4M 2K05A 1JICA 1ZXTA 1XX8A 4RWSC 1KNEA 5EPLA 4HCSA 1X3PA 5EJWA 1F9PA 2BDNA 1ILQA 4MHEA 3SVMA 1QE6A 2B2WA 3FDTA 2FFKB 2D9UA 1DOKA 3ONAB 2RSNA 4HSVA 1HUNA 2K1BA 4CJ1B 2KVMA 2B2VA 1QNKA 4HEDA 1VMCA 4IUQA 3MTSA 3UI2A 1HFGA 2B2WC 4LMQD 1AZQA 5CBEE 1B53A 2M2LA 1DOLA 5EQ0A 3G7LA 3P7JA 3R93A 4QUFA 1WVLA 2K03A 2HCIA 1HA6A 1VMPA 2FJ2A 3KUPA 1O7ZA 4X3TA 5DNFA 1PFBA 2FMMA 1X32A 2NZ1D 3DEOA 3I8ZA 1HHVA 1HUMA 1Q3LA 3IL8A 3LWEA 4X3UA 1MGSA 2X69A 1DZ1A 1ESRA 2KEEA 1E0BA 1HRJA 3I3CA 4CJ0B 2RA4A 2HDLA 4MN3A 3F2UA 4NW2A 2B2TC 2NWGA 3N52A 2XIWA 5EPJA 3MWYW 1O80A 4IUVA 2JYOA 2HDMA 2Q8TA 1DONA 1F9SA 1F9RA 2B2YA 1WD0A 1J8IA 2KOLA 4XT3B 4RAUC 1ML0D 5CMDA 4XDXA 1EL0A 1O7YA 1NAPA 1RJTA 4HAEA 1IKMA 2H1EA 2HUGA 1KNAA 2NYZD 4ZAIA 2B2YC 1RTNA 2L12A 5AFWA 1WTRA 1CA5A 1TVXA 2EPBA 2B2VC 5T1IA 1JE4A 3GV3A 4X3KA 4IUUA 4UAIA 4U68A 5CORA 2FHTA 2B2UA
chains in the Genus database with same CATH superfamily
4A3BB 1BKBA 1I6HB 1IYUA 1CA6A 4BXXH 3WWVA 2N55A 1EQQA 2OQ0A 2KHJA 3JC66 3MXUA 1EWCA 4PMBA 4WJ3M 4OIJA 4CDCC 3PO3H 1BBXC 4DR2L 1FGUA 3K0YA 3MVVA 4EQNA 3J7A5 4HJ8A 1QWYA 1PFNA 1GUSA 4QGUA 5IP9H 3F2CA 3KJPA 3DUZA 2MNAA 1BR9A 2PI2A 3GTGB 1EYDA 1V1PB 4WORA 3K5MA 1SYDA 3PO2B 1LT4D 2SOBA 3M7GA 1SYBA 4IOCA 3D6CA 3ULPA 3I72A 3CCQA 1FR3A 1LTRD 1CKNB 3I4LA 2QILA 2O4XA 3P20A 4KN7C 4GNXA 1ICFB 1HXYD 1MIUA 3K7AH 4QIWB 1Z6HA 5L37A 1AP0A 1I4GA 2XSCA 4WRDA 2JEAI 4DFAA 1SAPA 1M8AA 4IO9A 1IBMQ 1N36L 1MBYA 5EJWA 1CUKA 5C4ZA 1HJPA 4MHEA 4H44C 4LF5L 2QEJC 4R4CA 4LFBQ 4BS9A 4LFAL 3GTOB 4R1JA 2E2JB 3U50C 4QUFA 2CH4W 1GUNA 5ELBA 3S1RH 2AHOB 2I5LX 1Y1WG 3MHBA 3D4RA 1XTDA 4JI5L 4JI3Q 2NVQB 4IZ8A 5C6AA 1XWEA 5M5XH 4K5WA 4A93G 4JI4L 2BDOA 1SNDA 5FO9B 1GJXA 1TWCB 4A3JG 3VR3A 3RMHA 1F9SA 5IGCA 5LHY1 2CHBD 4DPGA 3KBGA 2M9VA 3QB3A 4C3JH 1VQOA 1U0LA 1YHAA 5FK9C 1KNAA 1LUZA 1S5CD 1WTRA 2JE6I 2WB1G 3RN2A 2B2VC 3U9SA 3DEPA 2A6ED 3OTOQ 1XMOL 4WFN3 2IX0A 5C4JB 3GV6A 1KLGD 1C9OA 2ES2A 1EZ8A 3JAML 4JI1Q 1AE2A 3H91A 1VQCA 2X6LA 4OWXB 1A0IA 2YYZA 4N8X1 4X64Q 2ENBA 3NTKA 2D0OA 4GLVB 3HOXG 1KDBA 4GNXB 1H95A 3NTHA 1Y69U 1X56A 2D5DA 5JJZA 4KV6A 1PHJA 4LAAA 4R4OA 4DR5L 1S5ED 3OWEB 3L9AX 2KUMA 1PH5A 1LTAD 1H9KA 4RGNA 1B3AA 1HTLD 1STHA 4IPDA 1L1OC 4A3GG 2RHQB 4JBKA 1SYFA 3KLSA 2NVXH 3TRZA 1EOVA 4IOAA 4GKJQ 3S1MB 3ERSX 1KDCA 1RHPA 5C0XJ 1X54A 2R3ZA 1HQMC 2EYJA 3D0FA 3K7UC 1J9OA 3NUCA 5I4DA 1PV4A 2F0HA 1Q82C 5C0XI 1TS3A 4LUOA 1SNMA 2JA9A 3J7AF 4NXNL 1TR5A 1VQPA 2PPBC 2IX3A 1PYWD 3U58A 5ELDA 3MA2B 1K8MA 3IFTA 4OONA 3EA6A 5EGTA 1PTOF 4CDFC 4FNFA 5HGQA 1E7ZA 4DK1A 1FGBD 3PV0A 3A0JA 3G6JB 2ZXPA 1BVSA 3I4NB 4P71A 1KRSA 2AQ2B 2E2IB 4HEDA 4PMCA 3MTSA 3UI2A 1YNJD 1TS5A 3O13A 4DR2Q 3R93A 1SR3A 2FJ2A 3KUPA 1F77A 1PFBA 2AKWB 1HR0L 2F0LA 2JXMB 5KYIA 3CF5A 2X69A 4YCWA 3S1QB 1K83H 1UAPA 2N3SA 4EGVA 3RZOB 1QJOA 4JBMA 4F87A 1EU4A 2HDMA 3E9HA 3OW2A 1XMQL 1Y8NB 2B2YA 4G7ZC 5CV5A 1B3QA 2KOLA 5C3XA 1I5FA 2F0VA 1JCKB 1HR0W 4LFCL 4A3BG 3Q8DA 3J81j 5C4XB 4A3CH 4UHVA 1ET9A 2AWNA 1IXRA 2JA7B 3WOEA 3BYTB 3HFZB 5COYA 1N36Q 2KCCA 2NVTB 3CCMA 4UDUC 3AQQA 3NENA 3HG9A 1F9QA 4FVMA 4LF5Q 3EVQA 2NN6H 2XNAC 5M3MB 4J1MA 1B7YB 5CBAE 3TN2A 1RIPA 3S17B 3KYHC 5C5LA 3CMAA 1A2UA 1KC8C 4LF4L 4GN4B 3UDXA 2JEBI 1A15A 1NSNS 5A2QE 4QUCA 1WD1A 2E75C 4JI5Q 1CQVA 1TWFH 1S5DD 5IP7G 1WTWA 4OL7A 4JI4Q 1STYA 4N9PA 5JAVA 2XWJB 1VQDA 2AUJD 3E5SA 2NVYB 4L5TA 3PSIA 4R9WA 1B2TA 1KQSA 4JOIC 3CCJA 2PO4A 1I4PA 2PMZB 3NBIA 2DY8A 4KMUC 3H3VH 3QOLA 2K75A 2CH4A 2VB3X 1GUOA 1XMOQ 2Q8IB 1EFWA 2JA5H 1HNWL 4HCSA 5C0XG 2BDNA 1AE3A 1JOOA 1F2ZA 5KGUA 2K1BA 3CD6A 1Z9FA 5JEAJ 3TMEA 1C0AA 4APVA 4IUQA 4BBSH 2R7DA 4EVOA 1J5EL 2LKVA 5LL6S 4DR5Q 1N34L 1VQKA 1DOLA 3SHLA 5LMNL 1BCPC 1CKOA 2R93B 4K5VA 3DM3A 5IYBH 2A73B 3BZCA 3DEOA 5FLXc 1GHKA 1Q3LA 3IL8A 1SNCA 2K5NA 4C2MB 4DV7L 4NW2A 4JBJA 3R8BA 2XIWA 1E22A 5EPJA 2E74C 4IUVA 3T13A 1KDAA 3A8IE 5LMNW 1T9HA 3HOYG 5IT9E 2R61A 3FRPB 1J8IA 1DCZA 3NSWA 1GHJA 4NXNQ 2F4VL 2JA8B 3HEJA 4DNTB 4I65A 3CC2A 2ZT9C 1KXLA 2XTIA 2R7ZH 1G2SA 1LT6D 2ZM6L 4AQYL 2ASBA 1R9TH 2MGSA 3SGIA 1BDOA 4K2KA 2EYFA 2D2CC 2H4OA 3D3RA 3FKIH 3MEFA 3G4SA 4C3HB 2KCNA 4LNQA 1BXTA 3S24A 2ICIA 3HOWH 1BBUA 1DOMA 1QVCA 3I2ZA 1EOTA 3S1NH 1HR0Q 3CCSA 4TQUS 3J81E 2K52A 3QG1A 3LX0A 4C3IH 2MPMA 2YTYA 1D2BA 2CCZA 2Q2IA 1VCIA 1I50H 3BDCA 5KNCA 5H1SE 3IFDA 3K0XA 3I7FA 5K5PA 1JJGA 4KD3A 2RBMA 3IKJA 4ZRZA 4GN3B 2EVBA 4K6LA 5JOBA 1XMQQ 1I94L 4R4IA 5JPNC 4LFCQ 2WP8J 1EQVA 2VQFL 1S5FD 5BR8Q 1A8VA 3HOVG 1WTVA 4H7BA 5CV7A 1E2WA 2YV5A 3BJUA 4C56C 4IFDJ 3L0OA 4O1NA 4CDEC 2AQ1B 2QCPX 1I4XA 1HUNA 1KIXA 1PZID 4DV3L 2TSSA 4IFDI 3W2DA 4B3SL 1Q86C 4P74A 2E2HH 1VQGA 4LF4Q 3KF6A 2F0WA 4X3TA 5KNDA 1X65A 2OF1A 3PUVA 4PV1C 1EY4A 3M4OB 1CT1D 1SJED 4DK3C 1PH2A 3EBEA 4BY1H 1VQMA 3F2UA 5CV9A 5C4XG 1B8AA 5JEAG 2JA7G 3CC4A 3RN5A 2BH8A 4BY7G 4A3FB 1A3UA 3M4YA 2L12A 1VQEA 3A8KE 3GP7A 4GZYC 4R8NA 4ZLTF 4PZ8A 2F0MA 5F2DA 1SDFA 1D5ZC 5FKAC 4GKKL 2NZOA 1Y1WB 3H0GH 1IL8A 4DV0L 1HNWQ 4DAYA 2L0CA 1F2YA 2WB1E 2VUMH 4PG3A 2IHEA 1Q8IA 1ONLA 4A3JH 2QGQA 4JYAL 3E9IA 3T1YQ 1J5EQ 1N34Q 2CWAA 5LMNQ 2GVAA 1PFSA 4KKUA 2F0DA 2CW0D 3EROA 4HJAA 3NEMA 4JI7L 4K8IA 1FVIA 4DAVA 2RVLA 3HRZC 1E1OA 3AFPA 4BBRB 1NR2A 2PZWA 5IYCH 4DV7Q 5M5WB 4JG2A 1YJNA 1HNXL 2CQAA 1Q7YC 1X3FA 3NBHB 1TWAH 3TS2A 2IHFA 3NWTA 3Q22A 2D0PA 2Y0SB 4ZYSA 3HOXB 4DR1L 2F4VQ 5M5YH 2RKSA 3MXGA 1K3BC 3FP9A 2K50A 1JICA 3W3AA 4OGQC 3DMUA 3E0EA 2ZM6Q 3CQZB 3CCUA 4Y7NH 4AQYQ 3A5ZB 3L2PA 4A3GB 3GDEA 3TSSA 5C44B 1QNKA 4A3LG 2KCTA 3GTQB 1PH4A 1II3A 2RCFA 4JI2L 2EYMA 3D4DA 5BN5A 1PTOD 1NTGA 1O7ZA 1VQ8A 1X32A 2NZ1D 4G7OC 2OQKA 3JAMc 1HHVA 4IFDG 4DAYB 2E2DC 2IY5B 3R2TA 1LTTD 2HDLA 3I4MB 2NWGA 1VF5C 2EYOA 2Q8TA 3UDGA 4JI6Q 1GKHA 3E6ZX 4A3IB 2JA8G 1WD0A 3M7NA 1I94Q 3F2BA 1OXXK 3R2IA 4ILWA 1QCBD 3T4AC 2B2YC 1G291 5AFWA 5EAYA 2VQFQ 1TVXA 1UEAB 4OWTB 3T16A 3GV3A 2YU9H 3WDNA 2NB0A 1JC7A 1OO9B 4DAPA 2ZTDA 1V8QA 1PYSB 4XT1B 4O42A 4NKLA 1STNA 5IIFA 5FJ8G 4GKJL 1F2LA 5C5MA 1JJ2A 4C3HG 2PZUA 4AIMA 3STBC 1EIYB 3N6RA 1L0XB 4K2LA 4QQBX 4DV3Q 2K28A 1SFOH 4HMJA 1CSQA 1PH6A 3Q24A 4B3SQ 1STBA 4V0BA 1GUWA 2F0EA 2E5LL 4H02A 1QILA 1IBKL 3HGBA 2JQOA 4A3BH 2WAQG 1G6ZA 4J15A 5IODA 1AZPA 4ALPA 1EFID 4CKCA 1EIGA 1SYCA 2O5IC 1RTOA 4RA8A 1EU3A 1I4RA 4IUTA 4HIKA 1MI2A 2JP1A 1ICWA 3UE0A 2N49A 4HJ7A 5FLMG 2HD3A 1A63A 3TZDA 3F8TA 2UXCL 2EXZA 3D8GA 3VR5A 1WTXA 1MSHA 1PH9A 2ATWA 1EY9A 3GTGH 2L11A 3KDFA 3WOFA 5JJIA 4QIWE 3RZDB 3PO2H 1U5KA 1XX8A 2OWOA 1K0RA 4GKKQ 2ZTCA 3BZDB 4DV0Q 2D9UA 4X65L 4HSVA 5TSSA 1PTOC 3J80E 5EBDA 2IW3A 4FF3A 4JYAQ 1MD2D 1V43A 4A3KB 1KLUD 5EQ0A 4KLKA 2EY2A 4ABNA 2VY3A 2HCIA 1HTPA 3BYYB 5DNFA 3SEBA 2F0NA 3W1BA 1SYEA 1WCMB 1Q46A 4G57A 4KK7A 2JSOA 4JI7Q 3GTLH 1RDPD 4A3EH 1LTGD 2VB2X 2EYLA 3C3LA 4LUVA 1FNWA 3S2HB 1O80A 2JN4A 4A3FG 1HNXQ 1PXUA 3J7ZC 5M3FH 3GTOH 1A62A 4XYOA 2E2JH 1O7YA 1JOKA 2A74C 1ET6A 1M4VA 4ZAIA 3BVMA 4R4QA 2WIIB 3K7AB 4DV2L 4NPSA 4RGMA 5EBCA 3S16B 3MEHA 4DR1Q 2FHTA 3I55A 2UUCL 1PYBA 3S14B 3OIPA 1ENAA 1I4HA 2PI2E 2K6AA 1TWHB 4P72A 2MHVA 3HOZB 1BF4A 1TWCH 4LF9L 2SDFA 1E24A 4RKLA 1MJCA 4A4IA 5FO8B 3M85A 4A3DB 5DLQE 1U4LA 2EYHA 2L4NA 4LF6L 2PNHA 3J81i 4DR3L 3KDFB 2MQHA 2B3GA 4JI2Q 4N9TA 4L5RC 2BCOA 3VA5A 3HOYB 2UUBL 3S1RB 1S4ZA 5C3EG 1PH7A 4BBRG 2HT1A 2UUAQ 5C4JH 3PUXA 4TVAB 3GTKB 1ENFA 4GS3A 5M5XB 2DNEA 4FXGC 1XXGA 2MO1A 2B2UC 5HURA 1RODA 3V96A 2Y0SG 1O7IA 4P73A 4K0KL 2FMCA 5I6WA 2X6GA 3RD4A 2OCEA 3CPWA 2LXJA 4HN7A 1MJEA 5J22A 3MFGA 4RGOS 4GOPA 4KY5A 4DN4M 2K05A 1YIJA 3S1MH 1ZXTA 3GO5A 4OEMB 5C44G 1PRTF 1NUCA 3K6OA 1Z47A 5KIXA 2F0TA 2F03A 3NK9A 3EN2A 3CW2C 1B9MA 3DHQA 1A6XA 1HZAA 3DXJC 3G7LA 2E5LQ 2B8FA 2I07B 1IBKQ 4RH6A 1E2ZA 3I4MG 4RHSA 3SXHA 4A3IG 1MKHA 1B1ZA 2KEEA 3GTMB 2NVXB 4EX5A 3HOVB 3I4NH 2I46A 5HGTA 2DN8A 1FJGL 1Y8PB 5JPMC 3RLFA 3SK5A 2Q2UA 5D3DA 2UXCQ 1IKMA 4YWLA 1V1OA 3HOUB 4CKBA 4XTCS 3S2DH 1CFMA 2EPBA 2BA0A 4G4KA 1XNQL 1QUQA 1HFNA 2Z6KC 3S1QH 5K36G 4CBVA 3TQYA 3RZOH 1BCPD 2AUKA 5EKLA 5I6YA 4UY8C 1SSOA 1N33Q 3PQIA 3MC0B 4NB3A 1AEXA 4X3SA 1LYLA 1MSGA 2IWHA 4X65Q 2KCMA 3NTIA 5C4XH 1K73C 4HIMA 1YHQA 5JEAH 4FO2A 3D6WA 2HCCA 1VDZA 2A69C 3D4WA 4PZ6A 1LLRD 4DNRB 5BR8L 4GOPB 3VYRA 5IYDH 2Q8RE 2K01A 1PLFA 3I4OA 1IW7D 4KN4C 2L9HA 1EY7A 2NVTH 2HIXA 1EY5A 2A6HD 2ZJPA 4BY7B 1V9PA 1K0SA 4OELB 1K83B 1C48A 4A75A 3TDQA 2NTTA 3PF4A 1Q12A 2F0PA 4PZ7A 5M3MH 1XPUA 3K5OA 1WTQA 3S17H 2R92G 2F0OA 3CRKC 3PMFA 4OWWB 1UEBA 4YWMA 3S15B 1SEBD 3PIP3 2L55A 1STAA 2LFNA 5IGDA 5D65A 1NCVA 3PIPA 4DV2Q 3X3NA 4QCLA 3LNNA 1HNZL 4RG1A 1ASYA 4FYDA 1WTOA 2EJGC 2PMZE 2UUCQ 3OYYA 4QB4A 1TQOA 1HZCA 2K33A 2QKIC 5G3LD 1HH2P 1KAWA 3PO3G 1IYVA 4LF9Q 4A3KG 4DAMA 1DOKA 2Z4HA 3M4PA 4ZUJA 1SLJA 1SMYD 3NE5B 2Q2HA 2Q2TA 1L0YB 1QUQB 1RCVD 1WCMG 4LF6Q 1ZKOA 4DR3Q 3NELA 2KHSA 1X9NA 1VMPA 2HIVA 3K5NA 2UUBQ 3PUWA 1RD9D 4JBWA 2V4DA 5HY6A 3TBIB 4EQOA 1FL0A 1K8AC 2CQOA 1TIID 2GVBA 2KENA 2TMPA 1ESRA 1N8RC 1TWFB 1EWIA 1LTBD 4DR4L 2B2TC 1JB7A 1XNRL 4NMZA 2VS1A 5CC4A 1VQ6A 1D8LA 4M8AA 3CAMA 1AW7A 1EYCA 1YNXA 4K0KQ 3BVGA 2C35B 2Z4IA 3PCOB 3V2TA 4DR6L 3T1YL 1ENCA 4GLXA 2NYZD 1R4PB 3KF8A 3P75A 3HOZG 1UUPA 2R93H 3DWPA 1DGSA 3KLSX 4DK0A 2QEXA 3CXCA 2B63B 2GN5A 4C2MH 4DUZL 1KL9A 4A3DG 1OXVA 2RF4A 2JA6H 2IX1A 1EIFA 2F3VA 3PF5A 3BZKA 3GTPH 5NUCA 2SEBD 4IFDH 2VL6A 2J7ZA 2ICEC 4FF2A 4B3RL 2OTJA 4XQQA 1JR0D 4ZUIA 2N88A 1IW7C 4F7XA 4HJ5A 3OOCA 4BBSB 4K6DA 3T1HL 1E1TA 2A6HC 2OT2A 4L6TB 4CGYB 1SE3A 2KQ3A 4BWGB 5BN3A 2B29A 2MP1A 1Y1VH 1ZEQX 5ELNA 1DXMA 1PRTB 2L5TA 3QR8A 2J0TD 5T1GA 1FJGQ 3URYA 3ND9A 4AYBG 3D31A 1I4QA 4B3ML 3AYHB 4JW0A 1CK1A 1NNXA 4C3HH 5E1FA 2WAQE 1WYDA 4FF1A 3HKZG 1PTOH 4Z9CB 1EEID 4KJOA 4BA1I 3ICEA 3EIVA 1XNQQ 4YCUA 3J80i 3BDLA 1SMYC 2R7ZB 3V05A 4IJLA 3IAYA 3I73A 2WAQB 3FDTA 2O5JC 4F88A 4JI6L 5DM63 4ULLA 3KF8B 1I3QB 2B2VA 4S3SA 1TKWB 2I5MX 1HFGA 5CBEE 4L63B 2M00A 1WVLA 2CFMA 3MAQA 5GQOA 2SNMA 1W2BA 3HOWB 2WKDA 4X6AH 2EY6A 2NZHA 2L15A 4L5QA 3H3VI 3JAME 1KABA 3LWEA 3M3YB 4GNXC 4YHHL 2DJGC 4X3UA 5C4HA 4K14A 4C3IB 3OMCA 4IALA 1Q81C 3HOUG 4RHRA 1I50B 3VR4A 5M9OA 5CV8A 4L5SA 1QZHA 1EL0A 1GUTA 4HIOA 4OXPA 3KLWA 1X3EA 1VQAA 4P2CB 2RHSB 3VA7A 1HNZQ 3M4OH 3FVQA 1PVOA 5E4WC 3DWQA 4R8IA 2CVRA 4HR7B 4UP7A 1PZKD 2DNCA 4JK1C 4ZQ3A 3F2DA 1QZGA 1L0WA 2V1CC 3GTJH 5IWAL 3A54A 4A3FH 1H9RA 1FNVA 1PDQA 5DM73 1WTHA 2IPKD 1D6EC 4DV4L 3HZXA 3J7AV 1VQFA 4HSPA 4IN3A 1PH3A 3KK7A 2RSOA 3BG3A 4ZKCB 1Y1WH 1VQJA 4DR4Q 1RL2A 1YITA 1XNRQ 1BO0A 1YNNC 4A3CG 3QO2A 2A68C 4A93H 5GAGC 1CM9A 5J1ZA 3HS0C 3NWSA 3SDZA 4DR6Q 1W3SA 1K28A 5IOCA 3STBD 3P1HA 3M9BA 3A56A 3FPUB 3OMGA 1HPCA 1V1QA 4DUZQ 1JORA 4BBRH 2Y0SE 1KNEA 5M5WH 2K32A 5IGEA 3OPOA 4GN5A 5C3EB 1CHPD 3H0GB 1CI3M 1XPOA 4B3RQ 3TP6A 3A7LA 5IT9c 1W6KA 3K8AA 4C1NI 2KHIA 3KF6B 1VMCA 5GADC 1EYGA 4LMQD 1LT5D 2PW7A 3T1HQ 3HOXH 4DA2A 1STEA 3A8JE 1TWGB 3F1ZA 1VQIA 5GAHC 3RNUA 1PZJD 3CQZH 2QF7A 2ZTEA 4CJ0B 4A3GH 5LMUL 5D3IB 1HZ9A 2JYOA 3OIQA 1JB3A 2XRSD 4LUZA 4QL5A 4IPHA 4B3MQ 5CMDA 3B6YA 3NP8A 1VQLA 2DUDA 3MXPA 2B63G 2A19A 2OEOA 1PA6A 1C4QA 4XQJA 2K5QA 4X3KA 4OO1I 2VW9A 2KECA 3G48A 3QJYA 2UUAL 1C8CA 4NXML 2B39A 3J81c 2JJQA 2EE1A 2F0GA 2EY1A 3I4MH 4JOIA 1K9MC 4X62L 4BBSG 1JQYD 1YEZA 4Y7NB 4A3IH 3DWAA 3ZYYX 2F52A 4KHPL 1TS4A 1LM0A 4KD4A 4NDXA 2K7VA 2E8GA 3EFXD 2BOSA 3EQLC 1E3PA 4MTNA 3NPPA 4UP8A 1EWHA 1K3RA 1M90C 2D62A 2OXPA 4RCNA 3K58A 2F1MA 4A3MB 1X55A 3VDYA 2SNSA 4YHHQ 1DD2A 3LWUA 1ZYRD 4MIUA 1GO3E 1V1PA 5GROA 3ZJYC 1RKNA 3A5UA 1CZWA 2WFWA 3K80C 4E6IA 4IURA 3ER0A 1K8GA 1NY4A 2K04A 1U4RA 2QDLA 1CQFA 3CC7A 1J6QA 1O7LA 4WJWA 2R7ZG 5AJ3L 3CKIB 1ILPA 1JWUD 4K8JA 1IYJB 3OW7A 1EUJA 5A2QL 2YU9B 1YHBA 1I6HH 2MO0A 2NUCA 3K59A 3KJOA 2B2WA 1GXDC 4CJ1B 5EKKA 1JWMD 2KVMA 5IWAQ 3HOWG 2EYPA 4HMIA 1SYGA 1PRTC 3VR2A 2F0QA 2M2LA 1R4QB 4C3IG 4DV4Q 5KRUA 3CCRA 2R92B 3RZDH 5IY0A 1VQNA 1OTCA 2RA4A 5IGBA 1N33L 3TREA 3Q23A 2RQXA 2P5ZX 1AH9A 2BE5D 5IP7H 1Q90A 3I70A 4A3KH 4DU9A 3GD7A 1NAPA 3PO3B 1SNPA 4JVZA 3CCLA 1WCMH 3AEVA 5CORA 1HCZA 2DGYA 1KD1C 2VQEL 1BCPB 4H0LC 2CWPA 3SK4A 3S2HH 1S40A 2AMCB 1OXTA 1SE4A 1P8LA 4LF7Q 4OO1G 5C0XH 2DY7A 1ASZA 4IUPA 5IT9L 4KTAA 3S16H 2LMCB 5CGKA 1BOSA 1ZYRC 3SK6A 3OHXC 2NVQH 3S14H 2PYKA 1B4OA 4BY1G 4X66L 3X3MA 1TWHH 1DM0B 1HA5A 3HOZH 1D5MC 2ID0A 3VR6A 4NP5A 3GTLB 1SNQA 2J4XA 5CYUA 4CHTB 4A3EB 2F4IA 3L3OC 1QG7A 2RDHA 1G6PA 5LMUQ 2FXQA 1SNOA 4A3DH 1TU2B 1TY2A 5M3FB 3U4ZA 5FO7B 4XQNA 1UE5A 3HOYH 3TP7A 1VQ5A 2XWBB 4N8FA 1S3OA 2QDBA 4KI0A 2UU9L 1GUGA 3H0GG 2K4KA 2K5DA 3GTKH 2L1BA 5BN4A 4NXMQ 2K5HA 4KJNA 4AYBE 3TZUA 1WOCA 2ALYB 2A69D 2VUMG 1Z7TA 3J81L 4X62Q 3HKZE 4MTKA 3E3XA 1W6JA 4KHPQ 4JI8L 5ELFA 3JAMi 5DAUA 1VQ7A 4B08A 3RUZA 1TY0A 1BUVT 2GA4B 4C3JB 2A8VA 3CU7A 2VZAA 4AYBB 2XGTA 3TEHB 1WJJA 2WKCA 5CV6A 4L8JA 2BE5C 5IYCG 3I8ZA 1JOQA 1GD7A 3HKZB 1IBLQ 1UE7A 3A55A 4MN3A 1DJRD 4IJHA 2LSSA 3QWNA 4POFA 1O78A 3PGZA 1CA5A 5AJ3Q 2DJFC 1JE4A 4KKSA 4TKOB 5FLXE 4R4TA 1BNZA 3GTMH 3HOVH 2EXDA 2EY5A 4Q0FA 4QY7A 1U9RA 3CHBD 3HP3A 3SK8A 3ULJA 5KYLA 2E2IH 3NQTA 3VYUA 2KEDA 1FNUA 1NMGA 3HOUH 1A3VA 2EDGA 4A3MG 2G9DA 2IL8A 4LWCA 4OX9L 4B9XA 1G2TA 2NTSA 4KY7A 1AFPA 1LTLA 3U4VA 1KHIA 5EKIA 4ODGA 2OTLA 3HKSA 1YVCA 2ZJRA 2BA1A 3TS0A 2XN9C 2UXBL 1N32L 1NR4A 4YY3L 2LY7A 4DUYL 4FXKC 4LK1C 4JC0A 3J80c 5C3WA 1IKLA 1N9WA 1UWVA 4IPGA 1Q1EA 5DEHA 2JA7H 3OSOA 3S2DB 3K81C 2PZTA 4BY7H 3VYSA 2VQEQ 1LO5D 2KBNA 1UNSA 3ULLA 1VQHA 4IPCA 5JVH3 3CCVA 1ILQA 2PCFB 2FFKB 1YZ6A 2RSNA 2UXDL 1GOZA 3MXNA 3AFQA 2K14A 2A6EC 3I56A 3S15H 4RFBA 1D7QA 1YI2A 2HQEA 3U9OA 1VS0A 4IQZA 1UE6A 3KLRA 2Z9HA 5J39A 4DKAC 4BXXG 2FMMA 3L7ZC 5I2YA 4JV5L 4X66Q 1HUMA 1I6VC 5GAEC 1DZ1A 1BBWA 5KEEA 3I3CA 1D1IA 2JK8A 2YTVA 4RKBA 5E3FA 2G5DA 2F0FA 4U673 2NVYH 2R6GA 3AMUA 2F0UA 5IP9G 1A3TA 4LFAQ 4EQ5A 4DV6L 4HAEA 3RR5A 1YJWA 1D5XC 3PO2G 4DV5L 2WINB 5T1IA 1H9JA 2I5HA 2MFIA 4IUUA 4U68A 2UU9Q 2A1AA 4YWKA 1PFMA 5IGFA 2N78A 3MFYA 1BQQT 2O2LD 2A5HA 3QIAA 3SR1A 1WFQA 1JWSD 4JI8Q 1H9MA 3FMCA 1OXUA 3A7AB 5KNBA 1G91A 5E4XA 4A3LH 1ESFA 4A3EG 2HHHL 1QB5D 2Z1CA 2B63H 1PH1A 3DLLA 2WV6D 3I90A 2KA7A 4DR7L 5M3FG 3MXNB 1K8OA 3UDFA 1YNJC 4PNYA 2JA5B 3W1GA 2C9OA 5I2XA 3BS1A 5I9OA 1L2FA 3TP5A 1TXYA 4POGA 4O0AA 2I0QA 3T51B 1AN8A 1B44D 3CRLC 1WTPA 3C46A 4ZK9B 4ZCKA 2JA8H 1M1KC 2PNRC 1LV9A 2AWOA 4OIKA 1CZGA 2PQAA 2Z8LA 1LT3D 3MZ5A 4H13C 5EPLA 1XPRA 4UP9A 5ISRA 1F9PA 1LACA 2G9HD 2XRQD 3NQIA 2JA6B 3ONAB 3GTPB 1TT2A 1FD7D 3VYTA 4C3JG 1KTKA 1E2VA 5FJ8H 3C1FA 3PUZA 3CCEA 2B2WC 5CR3A 1AZQA 2VNUD 1B53A 4XXEA 3P7JA 3BDOA 2NN6I 4OX9Q 1YNND 1S5BD 2Z6BA 4FXDA 2A68D 1VQ9A 4HIDA 3H09A 1LTSD 5JJLA 1Y1VB 5IGGA 4P75A 4TRDA 1YBYA 1EY6A 1E0BA 1QOHA 4DV1L 2UXBQ 1N32Q 3N52A 5IE8A 4YY3Q 3K5LA 1R9TB 3UE1A 1I3QH 1QNUA 4DUYQ 1F9RA 1IL2A 3QOJA 1Q8KA 2EQSA 1RJTA 1H9SA 3FKIB 3R3OA 3J80L 2HUGA 1JMCA 1T5EA 3CMEA 1GM5A 1RTNA 3RLNA 2QA4A 1PTOB 5FLMH 5E7NA 1RF2D 1CSPA 5ELCA 4JI0L 1A2TA 3H15A 3M3YH 2B2UA 2WACA 1EEFD 4YCVA 3KBXA 3Q6SA 3S1NB 1LTID 4CJ2C 1X3QA 3W5OA 4DGZA 4ZKBB 1CHQD 1EQRA 4Q5VA 3KOJA 3T56B 4KY6A 1CTMA 2K5WA 1IZ6A 4B9WA 2EIFA 2UXDQ 2KJXA 3NHHA 4M1UB 4O2DA 1XYIA 1L1OA 2PQAB 1HZBA 3M4QA 4DXGA 1EIHA 1D1KA 4GLAC 1U4PA 3I91A 1SN8A 1EQTA 3I4NG 4B3TL 4JV5Q 4HTHA 1PH8A 1G51A 1SBBB 5JVG3 1NE3A 3K57A 1SJHD 3IRBA 3DM1A 4LF8L 1IHZA 1VF7A 1NMFA 3SE0A 1JJCB 2Z0SA 4QMGA 4KKTA 4DV6Q 3NBHA 4OO1H 3OWFA 4EQPA 1XJVA 4FP5D 1X3GA 4PQXA 2E2HB 4DV5Q 2ZJQA 1F2MA 4HCEA 4PMWA 4FF4A 1SXTA 4RGTA 3RLOA 1P16A 1X3PA 1QVGA 3SVMA 2NBFA 4BY1B 4DNIA 1H9SB 2F0SA 1BCPF 1HQRD 2LS01 3GTJB 5IYDG 5A35A 4JPBW 2AQ3B 2Z6KA 3AU7A 4J8QA 5FOBB 1Q1BA 2K03A 2K5VA 1HA6A 1G8ZD 1NBWA 3ND8A 2HHHQ 2PW5A 4DF7A 4UPAA 1MGSA 3H94A 3G71A 4DR7Q 5C3EH 5M3MG 1HRJA 1KRTA 1QVFA 2NN6G 3MWYW 3CPFA 1L1OB 1VQBA 3C2PA 4GOPC 1DONA 4LF7L 4A93B 2LXKA 4XDXA 4RMFA 2VUMB 1TS2A 1S72A 4A76A 4A3JB 3EJIA 2EZVA 2H1EA 4KHZA 3PUYA 4F8MA 3BVZA 1PMRA 1XTCD 2MUYA 1CKMA 2EJMA 1TWGH 4UAIA 2ZXRA 4I7AA 4MZ9A 1IBML 2MJ8A 1PRTD 2F3WA 2WB1B 5FLXL 1SRUA 4OHJA 4C1NK 4BA2I 1U4MA 1LABA 2XVSA 4LW1A 5G3LF 2EJFC 1C7YA 4LFBL 5C44H 3GTQH 2C5CA 3E0JA 5CV4A 4Y52H 3PIO3 4LJZC 1TWAB 5LL6X 3PIOA 4JI3L 3S9WA 1SE8A 2N8NA 3ITPA 2JA5G 1B9NA 5M5YB 2RCNA 1WI5A 2IJ0A 3UDIA 2FINB 4WJ4A 1OXSC 1SMXA 1EY0A 4DV1Q 2QW7A 1EY8A 4J6HA 1DYQA 1EYAA 4ME3A 2R93G 1B50A 5EPKA 1YJ9A 1UE1A 4XIGS 2ZXOA 4JCVE 2VXWA 3LGJA 4TSSA 5IYBG 4KHVA 2F0IA 4V190 2R7FA 5D14A 2EOTA 3TP8A 1VQ4A 2B8GA 2F0KA 2B2TA 4A3MH 1GVPA 2JA6G 3OTOL 4JI0Q 4K5XA 4FDBA 4CKEA 1JE5A 3ERQA 2IT1A 4XYQA 3J7YW 4CDDC 3G6EA 5J3BA 3AB9A 1IBLL 3C1EA 4RWSC 1NJIC 4QJFA 1Y8OB 4JI1L 3KFUA 1Y14B 3FHWA 1QE6A 4X64L 1X6OA 5K36H 3Q0AA 1MHWC 1EZ6A 3H3VC 4ID6A 1T5XD 1B70B 2E76C 1Y1VG 4ME5A 4HJ9A 3GQBA 1CKNA 4G7HC 1SROA 5I9PA 2F0JA 4B3TQ 3H6MA 3T53B 4MNOA 1SE2A 5ELEA 1FYCA 4I7ZC 2RDGA 4RCOA 2YTXA 5JJKA 2HQLA 3FKIG 2CKZB 2H5XA 4AH6A 4QF4A 4LF8Q 3BU2A 3NXWA 1JT8A 1KAAA 3A74A 2CW0C 4XT3B 4RAUC 1ML0D 1STGA 2PQEA 5ELOA 3CP0A 4DXFA 3FEWX 2RDFA 1SFOB 4IUNA 4DK6C 2R92H 4YIJA 2BH2A 3FPPA 2F3IA
chains in the Genus database with same CATH topology
4A3BB 1I6HB 1IYUA 1CA6A 2N55A 3MXUA 1EWCA 4PMBA 4OIJA 1BBXC 3K0YA 3MVVA 4EQNA 1QWYA 1PFNA 1GUSA 3DUZA 1BR9A 3GTGB 1EYDA 1V1PB 4WORA 3K5MA 1SYDA 3PO2B 1LT4D 2SOBA 3M7GA 1SYBA 3D6CA 3I72A 1FR3A 1LTRD 3I4LA 2QILA 2O4XA 3P20A 4KN7C 1HXYD 4QIWB 1Z6HA 1AP0A 1I4GA 2XSCA 4WRDA 2JEAI 4DFAA 1SAPA 1M8AA 1MBYA 5EJWA 5C4ZA 4MHEA 4H44C 2QEJC 4BS9A 3GTOB 2E2JB 4QUFA 1GUNA 5ELBA 3MHBA 3D4RA 2NVQB 4IZ8A 5C6AA 1XWEA 4K5WA 2BDOA 1SNDA 5FO9B 1GJXA 1TWCB 3VR3A 3RMHA 1F9SA 5IGCA 5LHY1 2CHBD 3KBGA 2M9VA 3QB3A 5FK9C 1KNAA 1S5CD 1WTRA 2JE6I 2B2VC 3U9SA 3DEPA 2A6ED 4WFN3 2IX0A 5C4JB 3GV6A 1KLGD 1EZ8A 3JAML 3H91A 2X6LA 2YYZA 2ENBA 3NTKA 1KDBA 3NTHA 1Y69U 2D5DA 5JJZA 4KV6A 4LAAA 1S5ED 3OWEB 3L9AX 2KUMA 1LTAD 1H9KA 4RGNA 1B3AA 1HTLD 1STHA 1SYFA 3KLSA 3S1MB 1KDCA 1RHPA 5C0XJ 2R3ZA 1HQMC 2EYJA 3NUCA 1J9OA 5I4DA 2F0HA 5C0XI 1TS3A 1SNMA 3J7AF 1TR5A 2PPBC 2IX3A 1PYWD 5ELDA 3MA2B 1K8MA 3IFTA 3EA6A 5EGTA 1PTOF 4FNFA 4DK1A 1FGBD 3PV0A 3G6JB 2ZXPA 3I4NB 2AQ2B 2E2IB 4HEDA 4PMCA 3MTSA 3UI2A 1YNJD 1TS5A 3O13A 3R93A 2FJ2A 3KUPA 1F77A 1PFBA 2F0LA 2JXMB 5KYIA 2X69A 3S1QB 1UAPA 4EGVA 3RZOB 1QJOA 4F87A 1EU4A 2HDMA 1Y8NB 2B2YA 4G7ZC 5CV5A 2KOLA 5C3XA 2F0VA 1JCKB 5C4XB 1ET9A 2AWNA 2JA7B 3WOEA 3BYTB 5COYA 2KCCA 2NVTB 4UDUC 3HG9A 1F9QA 4FVMA 3EVQA 2NN6H 2XNAC 5M3MB 4J1MA 5CBAE 3TN2A 3S17B 5C5LA 1A2UA 2JEBI 1A15A 1NSNS 5A2QE 4QUCA 1WD1A 2E75C 1CQVA 1S5DD 1WTWA 4OL7A 1STYA 4N9PA 5JAVA 2XWJB 2AUJD 3E5SA 2NVYB 4R9WA 1B2TA 2PO4A 1I4PA 2PMZB 3NBIA 2DY8A 4KMUC 3QOLA 2VB3X 1GUOA 2Q8IB 4HCSA 5C0XG 2BDNA 1JOOA 1F2ZA 5KGUA 2K1BA 3TMEA 5JEAJ 4IUQA 4EVOA 2LKVA 5LL6S 1DOLA 3SHLA 1BCPC 2R93B 4K5VA 2A73B 3DEOA 1GHKA 1Q3LA 3IL8A 1SNCA 4C2MB 4NW2A 3R8BA 2XIWA 5EPJA 3T13A 2E74C 4IUVA 1KDAA 3A8IE 5IT9E 2R61A 3FRPB 1J8IA 1DCZA 3NSWA 1GHJA 2JA8B 3HEJA 4DNTB 4I65A 2ZT9C 1G2SA 1LT6D 2MGSA 1BDOA 4K2KA 2EYFA 2D2CC 2H4OA 3D3RA 4C3HB 2KCNA 1BXTA 2ICIA 1DOMA 1EOTA 4TQUS 3J81E 3QG1A 3LX0A 1D2BA 2MPMA 1VCIA 3BDCA 5KNCA 3IFDA 5K5PA 4KD3A 5JOBA 4ZRZA 2RBMA 3IKJA 2EVBA 4K6LA 5JPNC 2WP8J 1EQVA 1S5FD 1WTVA 4H7BA 5CV7A 1E2WA 4C56C 4IFDJ 4O1NA 2AQ1B 2QCPX 1I4XA 1HUNA 1PZID 2TSSA 4IFDI 3W2DA 2F0WA 4X3TA 5KNDA 2OF1A 3PUVA 4PV1C 1EY4A 3M4OB 1CT1D 1SJED 3F2UA 5CV9A 5JEAG 4A3FB 1A3UA 3M4YA 2L12A 3A8KE 3GP7A 4GZYC 4R8NA 4ZLTF 5F2DA 2F0MA 1SDFA 1D5ZC 5FKAC 1Y1WB 1IL8A 4DAYA 2L0CA 1F2YA 1Q8IA 1ONLA 4KKUA 2F0DA 2CW0D 3EROA 4K8IA 4DAVA 2RVLA 3HRZC 4BBRB 1NR2A 2PZWA 5M5WB 2CQAA 3NWTA 3Q22A 4ZYSA 2Y0SB 3HOXB 2RKSA 3MXGA 1JICA 3W3AA 4OGQC 3DMUA 3CQZB 4A3GB 3TSSA 5C44B 1QNKA 3GTQB 1II3A 2EYMA 3D4DA 5BN5A 1PTOD 1O7ZA 1X32A 2NZ1D 4G7OC 1HHVA 4IFDG 2E2DC 3R2TA 1LTTD 2HDLA 3I4MB 2NWGA 1VF5C 2EYOA 2Q8TA 3E6ZX 4A3IB 1WD0A 3M7NA 1OXXK 3R2IA 4ILWA 1QCBD 3T4AC 2B2YC 1G291 5AFWA 1TVXA 1UEAB 3T16A 3GV3A 3WDNA 2NB0A 1JC7A 1OO9B 4DAPA 1V8QA 4XT1B 4O42A 4NKLA 1STNA 5IIFA 1F2LA 5C5MA 4C3HG 2PZUA 3N6RA 1L0XB 4K2LA 2K28A 4HMJA 3Q24A 1STBA 4V0BA 1GUWA 2F0EA 1QILA 3HGBA 1G6ZA 5IODA 1AZPA 1EFID 4CKCA 1EIGA 1SYCA 2O5IC 1RTOA 4RA8A 1EU3A 1I4RA 4IUTA 1MI2A 2JP1A 1ICWA 3TZDA 2EXZA 3D8GA 3VR5A 1WTXA 1MSHA 1EY9A 2L11A 3WOFA 3RZDB 1XX8A 3BZDB 2D9UA 4HSVA 5TSSA 1PTOC 3J80E 5EBDA 2IW3A 4FF3A 1MD2D 1V43A 4A3KB 1KLUD 5EQ0A 2EY2A 4ABNA 2HCIA 1HTPA 3BYYB 5DNFA 3SEBA 2F0NA 1SYEA 1WCMB 4G57A 4KK7A 2JSOA 1RDPD 1LTGD 2VB2X 2EYLA 3C3LA 1FNWA 3S2HB 1O80A 1PXUA 4XYOA 1O7YA 1JOKA 2A74C 1ET6A 1M4VA 4ZAIA 3BVMA 2WIIB 3K7AB 4RGMA 5EBCA 3S16B 3MEHA 2FHTA 3S14B 3OIPA 1ENAA 1I4HA 2K6AA 1TWHB 3HOZB 2MHVA 1BF4A 2SDFA 4RKLA 5FO8B 3M85A 4A3DB 1U4LA 2EYHA 2L4NA 4N9TA 2BCOA 3VA5A 3HOYB 3S1RB 1S4ZA 3PUXA 3GTKB 1ENFA 5M5XB 2DNEA 4FXGC 1XXGA 2B2UC 5HURA 1RODA 3V96A 2FMCA 5I6WA 3RD4A 2X6GA 4HN7A 5J22A 3MFGA 4RGOS 4KY5A 4DN4M 2K05A 1ZXTA 3GO5A 1PRTF 1NUCA 3K6OA 1Z47A 5KIXA 2F0TA 2F03A 3NK9A 1B9MA 3DHQA 1A6XA 3DXJC 3G7LA 2B8FA 2I07B 4RH6A 1E2ZA 4RHSA 3SXHA 1B1ZA 2KEEA 3GTMB 2NVXB 3HOVB 2I46A 5HGTA 2DN8A 1Y8PB 5JPMC 3RLFA 3SK5A 5D3DA 1IKMA 1V1OA 3HOUB 4CKBA 4XTCS 1CFMA 2EPBA 2BA0A 4G4KA 1HFNA 5K36G 4CBVA 1BCPD 2AUKA 5EKLA 5I6YA 1SSOA 3MC0B 1AEXA 4X3SA 1MSGA 2IWHA 3NTIA 5JEAH 4FO2A 3D6WA 2HCCA 1VDZA 2A69C 3D4WA 4DNRB 1LLRD 3VYRA 2Q8RE 2K01A 1PLFA 1IW7D 4KN4C 2L9HA 1EY7A 1EY5A 2A6HD 4BY7B 1K83B 1C48A 3TDQA 2NTTA 1Q12A 2F0PA 3K5OA 1WTQA 2F0OA 3CRKC 3PMFA 3S15B 1SEBD 3PIP3 2L55A 1STAA 2LFNA 5IGDA 5D65A 1NCVA 3X3NA 4QCLA 3LNNA 4FYDA 1WTOA 2EJGC 4QB4A 1TQOA 2K33A 2QKIC 5G3LD 1IYVA 1DOKA 2Z4HA 4ZUJA 1SMYD 3NE5B 1L0YB 1RCVD 1ZKOA 2KHSA 1VMPA 3K5NA 3PUWA 1RD9D 4JBWA 2V4DA 4EQOA 3TBIB 1TIID 2TMPA 1ESRA 1TWFB 1LTBD 2B2TC 4NMZA 5CC4A 4M8AA 1AW7A 1EYCA 3BVGA 2Z4IA 3V2TA 1ENCA 2NYZD 1R4PB 3KF8A 3P75A 1UUPA 3DWPA 3KLSX 4DK0A 2B63B 1OXVA 2IX1A 2F3VA 4IFDH 5NUCA 2SEBD 2J7ZA 2ICEC 4FF2A 4XQQA 1JR0D 4ZUIA 2N88A 1IW7C 4F7XA 3OOCA 4BBSB 4K6DA 2A6HC 2OT2A 4L6TB 4CGYB 1SE3A 2KQ3A 4BWGB 5BN3A 2MP1A 1ZEQX 1DXMA 1PRTB 2L5TA 2J0TD 5T1GA 3URYA 3ND9A 3D31A 1I4QA 1CK1A 5E1FA 4FF1A 1PTOH 4Z9CB 1EEID 4KJOA 4BA1I 3BDLA 1SMYC 2R7ZB 3V05A 3IAYA 3I73A 2WAQB 3FDTA 2O5JC 4F88A 5DM63 4ULLA 1I3QB 2B2VA 4S3SA 1TKWB 1HFGA 5CBEE 4L63B 2M00A 1WVLA 3MAQA 2SNMA 3HOWB 2WKDA 2EY6A 3JAME 1KABA 3LWEA 3M3YB 4X3UA 5C4HA 4K14A 4C3IB 3OMCA 4IALA 4RHRA 1I50B 3VR4A 5M9OA 5CV8A 1EL0A 1GUTA 4P2CB 3VA7A 3FVQA 5E4WC 3DWQA 4R8IA 2CVRA 4HR7B 1PZKD 2DNCA 4JK1C 4ZQ3A 3A54A 1H9RA 1FNVA 1PDQA 5DM73 2IPKD 1D6EC 3HZXA 3J7AV 4HSPA 4IN3A 3KK7A 2RSOA 3BG3A 4ZKCB 1BO0A 1YNNC 3QO2A 2A68C 1CM9A 5J1ZA 3HS0C 3NWSA 3SDZA 5IOCA 3P1HA 3A56A 3FPUB 3OMGA 1HPCA 1JORA 1KNEA 2K32A 5IGEA 3OPOA 5C3EB 1CHPD 3H0GB 1CI3M 3TP6A 3A7LA 1W6KA 4C1NI 1VMCA 4LMQD 1LT5D 2PW7A 4DA2A 1STEA 3A8JE 1TWGB 1PZJD 2QF7A 4CJ0B 5D3IB 2JYOA 1JB3A 2XRSD 3OIQA 5CMDA 3NP8A 3MXPA 2OEOA 1C4QA 4XQJA 2K5QA 4X3KA 4OO1I 2KECA 3QJYA 1C8CA 2B39A 2EE1A 2F0GA 2EY1A 1JQYD 4Y7NB 3DWAA 3ZYYX 1TS4A 4KD4A 4NDXA 2K7VA 3EFXD 2BOSA 3EQLC 3NPPA 1EWHA 2D62A 2OXPA 4RCNA 3K58A 2F1MA 4A3MB 2SNSA 1DD2A 3LWUA 1ZYRD 4MIUA 1V1PA 1RKNA 1CZWA 4E6IA 4IURA 2K04A 1U4RA 1CQFA 1O7LA 4WJWA 3CKIB 1ILPA 1JWUD 4K8JA 3OW7A 5A2QL 2YU9B 3K59A 2NUCA 2B2WA 1GXDC 4CJ1B 5EKKA 1JWMD 2KVMA 2EYPA 4HMIA 1SYGA 1PRTC 3VR2A 2F0QA 2M2LA 1R4QB 4C3IG 5KRUA 2R92B 2RA4A 5IGBA 3Q23A 2RQXA 2BE5D 1Q90A 3I70A 4DU9A 3GD7A 1NAPA 3PO3B 1SNPA 5CORA 1HCZA 1BCPB 4H0LC 3SK4A 1OXTA 1SE4A 4OO1G 5C0XH 2DY7A 4IUPA 5IT9L 4KTAA 2LMCB 5CGKA 1BOSA 1ZYRC 3SK6A 3OHXC 2PYKA 1B4OA 3X3MA 1DM0B 1HA5A 1D5MC 2ID0A 3VR6A 4NP5A 3GTLB 1SNQA 2J4XA 5CYUA 4CHTB 4A3EB 2F4IA 3L3OC 1QG7A 2RDHA 1SNOA 1TU2B 1TY2A 5M3FB 5FO7B 4XQNA 3TP7A 2XWBB 4KI0A 2QDBA 1GUGA 2K5DA 2L1BA 5BN4A 4KJNA 3TZUA 2A69D 1Z7TA 3J81L 1W6JA 5ELFA 5DAUA 4B08A 3RUZA 1TY0A 1BUVT 2GA4B 4C3JB 3CU7A 4AYBB 2WKCA 5CV6A 4L8JA 2BE5C 3I8ZA 1JOQA 3HKZB 3A55A 4MN3A 1DJRD 3QWNA 1O78A 1CA5A 1JE4A 4KKSA 4TKOB 5FLXE 1BNZA 2EY5A 4Q0FA 1U9RA 3CHBD 3HP3A 3SK8A 5KYLA 3NQTA 3VYUA 2KEDA 1FNUA 1A3VA 2EDGA 2G9DA 2IL8A 4B9XA 1G2TA 2NTSA 4KY7A 1AFPA 5EKIA 4ODGA 2BA1A 2XN9C 1NR4A 2LY7A 4FXKC 4LK1C 5C3WA 1IKLA 1Q1EA 5DEHA 3OSOA 3S2DB 2PZTA 3VYSA 1LO5D 1UNSA 5JVH3 1ILQA 2PCFB 2FFKB 2RSNA 1GOZA 3MXNA 2A6EC 4RFBA 2HQEA 3U9OA 4IQZA 3KLRA 5J39A 2FMMA 3L7ZC 5I2YA 1HUMA 1I6VC 1DZ1A 5KEEA 3I3CA 1D1IA 4RKBA 5E3FA 2F0FA 4U673 2R6GA 3AMUA 2F0UA 1A3TA 4HAEA 1D5XC 2WINB 5T1IA 1H9JA 4IUUA 4U68A 1PFMA 5IGFA 3MFYA 1BQQT 2O2LD 2A5HA 3QIAA 3SR1A 1JWSD 1H9MA 3FMCA 1OXUA 3A7AB 5KNBA 1G91A 5E4XA 1ESFA 1QB5D 2Z1CA 2WV6D 3I90A 2KA7A 1K8OA 1YNJC 4PNYA 2JA5B 2C9OA 5I2XA 3BS1A 5I9OA 3TP5A 3T51B 1AN8A 1B44D 3CRLC 1WTPA 3C46A 4ZK9B 2PNRC 1LV9A 2AWOA 4OIKA 1CZGA 2Z8LA 1LT3D 3MZ5A 4H13C 5EPLA 5ISRA 1F9PA 1LACA 2G9HD 2XRQD 3NQIA 2JA6B 3ONAB 3GTPB 1TT2A 1FD7D 3VYTA 4C3JG 1KTKA 1E2VA 3C1FA 3PUZA 2B2WC 5CR3A 1AZQA 2VNUD 1B53A 4XXEA 3P7JA 3BDOA 2NN6I 1YNND 1S5BD 4FXDA 2A68D 3H09A 1LTSD 1Y1VB 5IGGA 4TRDA 1EY6A 1E0BA 1QOHA 3N52A 3K5LA 1R9TB 1QNUA 1F9RA 3QOJA 1RJTA 1H9SA 3FKIB 3R3OA 3J80L 2HUGA 1T5EA 1RTNA 1PTOB 1RF2D 5ELCA 1A2TA 2B2UA 2WACA 1EEFD 3KBXA 3Q6SA 3S1NB 1LTID 4CJ2C 1X3QA 4DGZA 4ZKBB 1CHQD 4Q5VA 3T56B 4KY6A 1CTMA 2K5WA 4B9WA 2KJXA 3NHHA 4M1UB 1XYIA 4DXGA 1EIHA 1D1KA 1U4PA 3I91A 1EQTA 4HTHA 1SBBB 5JVG3 3K57A 1SJHD 3DM1A 1IHZA 1VF7A 3SE0A 4QMGA 4KKTA 3NBHA 4OO1H 3OWFA 4EQPA 4FP5D 4PQXA 2E2HB 1F2MA 4HCEA 4PMWA 4FF4A 1SXTA 4RGTA 1X3PA 3SVMA 2NBFA 4BY1B 1H9SB 2F0SA 1BCPF 1HQRD 2LS01 3GTJB 5A35A 2AQ3B 3AU7A 4J8QA 5FOBB 1Q1BA 2K03A 1HA6A 1G8ZD 3ND8A 2PW5A 4DF7A 1MGSA 3H94A 1HRJA 2NN6G 3MWYW 3C2PA 1DONA 4A93B 4XDXA 2VUMB 1TS2A 4A3JB 2EZVA 3EJIA 2H1EA 4KHZA 3PUYA 4F8MA 3BVZA 1PMRA 1XTCD 2MUYA 2EJMA 4UAIA 2ZXRA 2MJ8A 1PRTD 2F3WA 2WB1B 5FLXL 4BA2I 4OHJA 4C1NK 1U4MA 1LABA 2XVSA 5G3LF 2EJFC 2C5CA 3E0JA 5CV4A 3PIO3 4LJZC 1TWAB 5LL6X 3S9WA 3ITPA 1B9NA 5M5YB 2IJ0A 2FINB 1OXSC 1EY0A 1EY8A 4J6HA 1DYQA 1EYAA 1B50A 5EPKA 4XIGS 2ZXOA 2VXWA 4TSSA 4KHVA 2F0IA 4V190 5D14A 2EOTA 3TP8A 2B8GA 2F0KA 2B2TA 4K5XA 4CKEA 3ERQA 4XYQA 2IT1A 3J7YW 3AB9A 3C1EA 4RWSC 1Y8OB 1QE6A 5K36H 3Q0AA 1EZ6A 3H3VC 4ID6A 1T5XD 2E76C 4ME5A 3GQBA 4G7HC 5I9PA 2F0JA 3H6MA 3T53B 1SE2A 5ELEA 1FYCA 4I7ZC 2RDGA 4RCOA 4QF4A 3NXWA 1KAAA 2CW0C 4XT3B 4RAUC 1ML0D 1STGA 2PQEA 4DXFA 3FEWX 2RDFA 1SFOB 4IUNA 4YIJA 3FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFN A;  2KEC A;  4ZLT F;  2MJ8 A;  3DEP A;  5COY A;  1C8C A;  1PFM A;  3KBX A;  3Q6S A;  1BNZ A;  2EE1 A;  5E4W C;  4CJ2 C;  4XT1 B;  1SDF A;  4O42 A;  1G2S A;  3GV6 A;  4R8I A;  1BF4 A;  2N55 A;  1CA6 A;  2CVR A;  1X3Q A;  1SSO A;  1U4M A;  4ZKB B;  1F2L A;  1IL8 A;  2SDF A;  3H91 A;  2X6L A;  2MGS A;  2J7Z A;  1F9Q A;  4X3S A;  1MSG A;  3HP3 A;  4OIJ A;  2K28 A;  2KED A;  2N88 A;  2DY7 A;  5JJZ A;  1U4L A;  1XYI A;  5CBA E;  1BBX C;  2L4N A;  3TN2 A;  2KUM A;  4IUP A;  1PDQ A;  1GUW A;  1EIH A;  2IL8 A;  3D6W A;  2HCC A;  1G2T A;  1G91 A;  1B3A A;  1A15 A;  5E4X A;  1PFN A;  4QUC A;  2Q8R E;  2K01 A;  1U4P A;  3I91 A;  1DOM A;  1PLF A;  1S4Z A;  1WD1 A;  1EQT A;  1G6Z A;  1B4O A;  1EOT A;  2MP1 A;  2L9H A;  5EKI A;  3I90 A;  1AZP A;  2RSO A;  4ZKC B;  2FIN B;  2MPM A;  2RVL A;  1EIG A;  1RTO A;  1WTW A;  4RA8 A;  1RHP A;  1NR4 A;  1NR2 A;  1QG7 A;  3DM1 A;  2B2U C;  4IUT A;  5T1G A;  1BO0 A;  2R3Z A;  3IFD A;  1MI2 A;  1ROD A;  2JP1 A;  3QO2 A;  1ICW A;  1CM9 A;  1B50 A;  1J9O A;  4R9W A;  4IUR A;  5EPK A;  1WTQ A;  1B2T A;  3TZD A;  2K04 A;  1IKL A;  2VXW A;  1WTP A;  1U4R A;  2X6G A;  2DY8 A;  4ZK9 B;  5D14 A;  1LV9 A;  1NCV A;  5D65 A;  4OIK A;  1MSH A;  1WTX A;  2EOT A;  1AP0 A;  1ILP A;  1WTV A;  2B2T A;  3FPU B;  1WTO A;  2L11 A;  1SAP A;  1M8A A;  2L1B A;  4DN4 M;  2K05 A;  1JIC A;  1ZXT A;  1XX8 A;  4RWS C;  1KNE A;  5EPL A;  4HCS A;  1X3P A;  5EJW A;  1F9P A;  2BDN A;  1ILQ A;  4MHE A;  3SVM A;  1QE6 A;  2B2W A;  3FDT A;  2FFK B;  2D9U A;  1DOK A;  3ONA B;  2RSN A;  4HSV A;  1HUN A;  2K1B A;  4CJ1 B;  2KVM A;  2B2V A;  1QNK A;  4HED A;  1VMC A;  4IUQ A;  3MTS A;  3UI2 A;  1HFG A;  2B2W C;  4LMQ D;  1AZQ A;  5CBE E;  1B53 A;  2M2L A;  1DOL A;  5EQ0 A;  3G7L A;  3P7J A;  3R93 A;  4QUF A;  1WVL A;  2K03 A;  2HCI A;  1HA6 A;  1VMP A;  2FJ2 A;  3KUP A;  1O7Z A;  4X3T A;  5DNF A;  1PFB A;  2FMM A;  1X32 A;  2NZ1 D;  3DEO A;  3I8Z A;  1HHV A;  1HUM A;  1Q3L A;  3IL8 A;  3LWE A;  4X3U A;  1MGS A;  2X69 A;  1DZ1 A;  1ESR A;  2KEE A;  1E0B A;  1HRJ A;  3I3C A;  4CJ0 B;  2RA4 A;  2HDL A;  4MN3 A;  3F2U A;  4NW2 A;  2B2T C;  2NWG A;  3N52 A;  2XIW A;  5EPJ A;  3MWY W;  1O80 A;  4IUV A;  2JYO A;  2HDM A;  2Q8T A;  1DON A;  1F9S A;  1F9R A;  2B2Y A;  1WD0 A;  1J8I A;  2KOL A;  4XT3 B;  4RAU C;  1ML0 D;  5CMD A;  4XDX A;  1EL0 A;  1O7Y A;  1NAP A;  1RJT A;  4HAE A;  1IKM A;  2H1E A;  2HUG A;  1KNA A;  2NYZ D;  4ZAI A;  2B2Y C;  1RTN A;  2L12 A;  5AFW A;  1WTR A;  1CA5 A;  1TVX A;  2EPB A;  2B2V C;  5T1I A;  1JE4 A;  3GV3 A;  4X3K A;  4IUU A;  4UAI A;  4U68 A;  5COR A;  2FHT A;  2B2U A; 
#chains in the Genus database with same CATH topology
 4A3B B;  1BKB A;  1I6H B;  1IYU A;  1CA6 A;  4BXX H;  3WWV A;  2N55 A;  1EQQ A;  2OQ0 A;  2KHJ A;  3JC6 6;  3MXU A;  1EWC A;  4PMB A;  4WJ3 M;  4OIJ A;  4CDC C;  3PO3 H;  1BBX C;  4DR2 L;  1FGU A;  3K0Y A;  3MVV A;  4EQN A;  3J7A 5;  4HJ8 A;  1QWY A;  1PFN A;  1GUS A;  4QGU A;  5IP9 H;  3F2C A;  3KJP A;  3DUZ A;  2MNA A;  1BR9 A;  2PI2 A;  3GTG B;  1EYD A;  1V1P B;  4WOR A;  3K5M A;  1SYD A;  3PO2 B;  1LT4 D;  2SOB A;  3M7G A;  1SYB A;  4IOC A;  3D6C A;  3ULP A;  3I72 A;  3CCQ A;  1FR3 A;  1LTR D;  1CKN B;  3I4L A;  2QIL A;  2O4X A;  3P20 A;  4KN7 C;  4GNX A;  1ICF B;  1HXY D;  1MIU A;  3K7A H;  4QIW B;  1Z6H A;  5L37 A;  1AP0 A;  1I4G A;  2XSC A;  4WRD A;  2JEA I;  4DFA A;  1SAP A;  1M8A A;  4IO9 A;  1IBM Q;  1N36 L;  1MBY A;  5EJW A;  1CUK A;  5C4Z A;  1HJP A;  4MHE A;  4H44 C;  4LF5 L;  2QEJ C;  4R4C A;  4LFB Q;  4BS9 A;  4LFA L;  3GTO B;  4R1J A;  2E2J B;  3U50 C;  4QUF A;  2CH4 W;  1GUN A;  5ELB A;  3S1R H;  2AHO B;  2I5L X;  1Y1W G;  3MHB A;  3D4R A;  1XTD A;  4JI5 L;  4JI3 Q;  2NVQ B;  4IZ8 A;  5C6A A;  1XWE A;  5M5X H;  4K5W A;  4A93 G;  4JI4 L;  2BDO A;  1SND A;  5FO9 B;  1GJX A;  1TWC B;  4A3J G;  3VR3 A;  3RMH A;  1F9S A;  5IGC A;  5LHY 1;  2CHB D;  4DPG A;  3KBG A;  2M9V A;  3QB3 A;  4C3J H;  1VQO A;  1U0L A;  1YHA A;  5FK9 C;  1KNA A;  1LUZ A;  1S5C D;  1WTR A;  2JE6 I;  2WB1 G;  3RN2 A;  2B2V C;  3U9S A;  3DEP A;  2A6E D;  3OTO Q;  1XMO L;  4WFN 3;  2IX0 A;  5C4J B;  3GV6 A;  1KLG D;  1C9O A;  2ES2 A;  1EZ8 A;  3JAM L;  4JI1 Q;  1AE2 A;  3H91 A;  1VQC A;  2X6L A;  4OWX B;  1A0I A;  2YYZ A;  4N8X 1;  4X64 Q;  2ENB A;  3NTK A;  2D0O A;  4GLV B;  3HOX G;  1KDB A;  4GNX B;  1H95 A;  3NTH A;  1Y69 U;  1X56 A;  2D5D A;  5JJZ A;  4KV6 A;  1PHJ A;  4LAA A;  4R4O A;  4DR5 L;  1S5E D;  3OWE B;  3L9A X;  2KUM A;  1PH5 A;  1LTA D;  1H9K A;  4RGN A;  1B3A A;  1HTL D;  1STH A;  4IPD A;  1L1O C;  4A3G G;  2RHQ B;  4JBK A;  1SYF A;  3KLS A;  2NVX H;  3TRZ A;  1EOV A;  4IOA A;  4GKJ Q;  3S1M B;  3ERS X;  1KDC A;  1RHP A;  5C0X J;  1X54 A;  2R3Z A;  1HQM C;  2EYJ A;  3D0F A;  3K7U C;  1J9O A;  3NUC A;  5I4D A;  1PV4 A;  2F0H A;  1Q82 C;  5C0X I;  1TS3 A;  4LUO A;  1SNM A;  2JA9 A;  3J7A F;  4NXN L;  1TR5 A;  1VQP A;  2PPB C;  2IX3 A;  1PYW D;  3U58 A;  5ELD A;  3MA2 B;  1K8M A;  3IFT A;  4OON A;  3EA6 A;  5EGT A;  1PTO F;  4CDF C;  4FNF A;  5HGQ A;  1E7Z A;  4DK1 A;  1FGB D;  3PV0 A;  3A0J A;  3G6J B;  2ZXP A;  1BVS A;  3I4N B;  4P71 A;  1KRS A;  2AQ2 B;  2E2I B;  4HED A;  4PMC A;  3MTS A;  3UI2 A;  1YNJ D;  1TS5 A;  3O13 A;  4DR2 Q;  3R93 A;  1SR3 A;  2FJ2 A;  3KUP A;  1F77 A;  1PFB A;  2AKW B;  1HR0 L;  2F0L A;  2JXM B;  5KYI A;  3CF5 A;  2X69 A;  4YCW A;  3S1Q B;  1K83 H;  1UAP A;  2N3S A;  4EGV A;  3RZO B;  1QJO A;  4JBM A;  4F87 A;  1EU4 A;  2HDM A;  3E9H A;  3OW2 A;  1XMQ L;  1Y8N B;  2B2Y A;  4G7Z C;  5CV5 A;  1B3Q A;  2KOL A;  5C3X A;  1I5F A;  2F0V A;  1JCK B;  1HR0 W;  4LFC L;  4A3B G;  3Q8D A;  3J81 j;  5C4X B;  4A3C H;  4UHV A;  1ET9 A;  2AWN A;  1IXR A;  2JA7 B;  3WOE A;  3BYT B;  3HFZ B;  5COY A;  1N36 Q;  2KCC A;  2NVT B;  3CCM A;  4UDU C;  3AQQ A;  3NEN A;  3HG9 A;  1F9Q A;  4FVM A;  4LF5 Q;  3EVQ A;  2NN6 H;  2XNA C;  5M3M B;  4J1M A;  1B7Y B;  5CBA E;  3TN2 A;  1RIP A;  3S17 B;  3KYH C;  5C5L A;  3CMA A;  1A2U A;  1KC8 C;  4LF4 L;  4GN4 B;  3UDX A;  2JEB I;  1A15 A;  1NSN S;  5A2Q E;  4QUC A;  1WD1 A;  2E75 C;  4JI5 Q;  1CQV A;  1TWF H;  1S5D D;  5IP7 G;  1WTW A;  4OL7 A;  4JI4 Q;  1STY A;  4N9P A;  5JAV A;  2XWJ B;  1VQD A;  2AUJ D;  3E5S A;  2NVY B;  4L5T A;  3PSI A;  4R9W A;  1B2T A;  1KQS A;  4JOI C;  3CCJ A;  2PO4 A;  1I4P A;  2PMZ B;  3NBI A;  2DY8 A;  4KMU C;  3H3V H;  3QOL A;  2K75 A;  2CH4 A;  2VB3 X;  1GUO A;  1XMO Q;  2Q8I B;  1EFW A;  2JA5 H;  1HNW L;  4HCS A;  5C0X G;  2BDN A;  1AE3 A;  1JOO A;  1F2Z A;  5KGU A;  2K1B A;  3CD6 A;  1Z9F A;  5JEA J;  3TME A;  1C0A A;  4APV A;  4IUQ A;  4BBS H;  2R7D A;  4EVO A;  1J5E L;  2LKV A;  5LL6 S;  4DR5 Q;  1N34 L;  1VQK A;  1DOL A;  3SHL A;  5LMN L;  1BCP C;  1CKO A;  2R93 B;  4K5V A;  3DM3 A;  5IYB H;  2A73 B;  3BZC A;  3DEO A;  5FLX c;  1GHK A;  1Q3L A;  3IL8 A;  1SNC A;  2K5N A;  4C2M B;  4DV7 L;  4NW2 A;  4JBJ A;  3R8B A;  2XIW A;  1E22 A;  5EPJ A;  2E74 C;  4IUV A;  3T13 A;  1KDA A;  3A8I E;  5LMN W;  1T9H A;  3HOY G;  5IT9 E;  2R61 A;  3FRP B;  1J8I A;  1DCZ A;  3NSW A;  1GHJ A;  4NXN Q;  2F4V L;  2JA8 B;  3HEJ A;  4DNT B;  4I65 A;  3CC2 A;  2ZT9 C;  1KXL A;  2XTI A;  2R7Z H;  1G2S A;  1LT6 D;  2ZM6 L;  4AQY L;  2ASB A;  1R9T H;  2MGS A;  3SGI A;  1BDO A;  4K2K A;  2EYF A;  2D2C C;  2H4O A;  3D3R A;  3FKI H;  3MEF A;  3G4S A;  4C3H B;  2KCN A;  4LNQ A;  1BXT A;  3S24 A;  2ICI A;  3HOW H;  1BBU A;  1DOM A;  1QVC A;  3I2Z A;  1EOT A;  3S1N H;  1HR0 Q;  3CCS A;  4TQU S;  3J81 E;  2K52 A;  3QG1 A;  3LX0 A;  4C3I H;  2MPM A;  2YTY A;  1D2B A;  2CCZ A;  2Q2I A;  1VCI A;  1I50 H;  3BDC A;  5KNC A;  5H1S E;  3IFD A;  3K0X A;  3I7F A;  5K5P A;  1JJG A;  4KD3 A;  2RBM A;  3IKJ A;  4ZRZ A;  4GN3 B;  2EVB A;  4K6L A;  5JOB A;  1XMQ Q;  1I94 L;  4R4I A;  5JPN C;  4LFC Q;  2WP8 J;  1EQV A;  2VQF L;  1S5F D;  5BR8 Q;  1A8V A;  3HOV G;  1WTV A;  4H7B A;  5CV7 A;  1E2W A;  2YV5 A;  3BJU A;  4C56 C;  4IFD J;  3L0O A;  4O1N A;  4CDE C;  2AQ1 B;  2QCP X;  1I4X A;  1HUN A;  1KIX A;  1PZI D;  4DV3 L;  2TSS A;  4IFD I;  3W2D A;  4B3S L;  1Q86 C;  4P74 A;  2E2H H;  1VQG A;  4LF4 Q;  3KF6 A;  2F0W A;  4X3T A;  5KND A;  1X65 A;  2OF1 A;  3PUV A;  4PV1 C;  1EY4 A;  3M4O B;  1CT1 D;  1SJE D;  4DK3 C;  1PH2 A;  3EBE A;  4BY1 H;  1VQM A;  3F2U A;  5CV9 A;  5C4X G;  1B8A A;  5JEA G;  2JA7 G;  3CC4 A;  3RN5 A;  2BH8 A;  4BY7 G;  4A3F B;  1A3U A;  3M4Y A;  2L12 A;  1VQE A;  3A8K E;  3GP7 A;  4GZY C;  4R8N A;  4ZLT F;  4PZ8 A;  2F0M A;  5F2D A;  1SDF A;  1D5Z C;  5FKA C;  4GKK L;  2NZO A;  1Y1W B;  3H0G H;  1IL8 A;  4DV0 L;  1HNW Q;  4DAY A;  2L0C A;  1F2Y A;  2WB1 E;  2VUM H;  4PG3 A;  2IHE A;  1Q8I A;  1ONL A;  4A3J H;  2QGQ A;  4JYA L;  3E9I A;  3T1Y Q;  1J5E Q;  1N34 Q;  2CWA A;  5LMN Q;  2GVA A;  1PFS A;  4KKU A;  2F0D A;  2CW0 D;  3ERO A;  4HJA A;  3NEM A;  4JI7 L;  4K8I A;  1FVI A;  4DAV A;  2RVL A;  3HRZ C;  1E1O A;  3AFP A;  4BBR B;  1NR2 A;  2PZW A;  5IYC H;  4DV7 Q;  5M5W B;  4JG2 A;  1YJN A;  1HNX L;  2CQA A;  1Q7Y C;  1X3F A;  3NBH B;  1TWA H;  3TS2 A;  2IHF A;  3NWT A;  3Q22 A;  2D0P A;  2Y0S B;  4ZYS A;  3HOX B;  4DR1 L;  2F4V Q;  5M5Y H;  2RKS A;  3MXG A;  1K3B C;  3FP9 A;  2K50 A;  1JIC A;  3W3A A;  4OGQ C;  3DMU A;  3E0E A;  2ZM6 Q;  3CQZ B;  3CCU A;  4Y7N H;  4AQY Q;  3A5Z B;  3L2P A;  4A3G B;  3GDE A;  3TSS A;  5C44 B;  1QNK A;  4A3L G;  2KCT A;  3GTQ B;  1PH4 A;  1II3 A;  2RCF A;  4JI2 L;  2EYM A;  3D4D A;  5BN5 A;  1PTO D;  1NTG A;  1O7Z A;  1VQ8 A;  1X32 A;  2NZ1 D;  4G7O C;  2OQK A;  3JAM c;  1HHV A;  4IFD G;  4DAY B;  2E2D C;  2IY5 B;  3R2T A;  1LTT D;  2HDL A;  3I4M B;  2NWG A;  1VF5 C;  2EYO A;  2Q8T A;  3UDG A;  4JI6 Q;  1GKH A;  3E6Z X;  4A3I B;  2JA8 G;  1WD0 A;  3M7N A;  1I94 Q;  3F2B A;  1OXX K;  3R2I A;  4ILW A;  1QCB D;  3T4A C;  2B2Y C;  1G29 1;  5AFW A;  5EAY A;  2VQF Q;  1TVX A;  1UEA B;  4OWT B;  3T16 A;  3GV3 A;  2YU9 H;  3WDN A;  2NB0 A;  1JC7 A;  1OO9 B;  4DAP A;  2ZTD A;  1V8Q A;  1PYS B;  4XT1 B;  4O42 A;  4NKL A;  1STN A;  5IIF A;  5FJ8 G;  4GKJ L;  1F2L A;  5C5M A;  1JJ2 A;  4C3H G;  2PZU A;  4AIM A;  3STB C;  1EIY B;  3N6R A;  1L0X B;  4K2L A;  4QQB X;  4DV3 Q;  2K28 A;  1SFO H;  4HMJ A;  1CSQ A;  1PH6 A;  3Q24 A;  4B3S Q;  1STB A;  4V0B A;  1GUW A;  2F0E A;  2E5L L;  4H02 A;  1QIL A;  1IBK L;  3HGB A;  2JQO A;  4A3B H;  2WAQ G;  1G6Z A;  4J15 A;  5IOD A;  1AZP A;  4ALP A;  1EFI D;  4CKC A;  1EIG A;  1SYC A;  2O5I C;  1RTO A;  4RA8 A;  1EU3 A;  1I4R A;  4IUT A;  4HIK A;  1MI2 A;  2JP1 A;  1ICW A;  3UE0 A;  2N49 A;  4HJ7 A;  5FLM G;  2HD3 A;  1A63 A;  3TZD A;  3F8T A;  2UXC L;  2EXZ A;  3D8G A;  3VR5 A;  1WTX A;  1MSH A;  1PH9 A;  2ATW A;  1EY9 A;  3GTG H;  2L11 A;  3KDF A;  3WOF A;  5JJI A;  4QIW E;  3RZD B;  3PO2 H;  1U5K A;  1XX8 A;  2OWO A;  1K0R A;  4GKK Q;  2ZTC A;  3BZD B;  4DV0 Q;  2D9U A;  4X65 L;  4HSV A;  5TSS A;  1PTO C;  3J80 E;  5EBD A;  2IW3 A;  4FF3 A;  4JYA Q;  1MD2 D;  1V43 A;  4A3K B;  1KLU D;  5EQ0 A;  4KLK A;  2EY2 A;  4ABN A;  2VY3 A;  2HCI A;  1HTP A;  3BYY B;  5DNF A;  3SEB A;  2F0N A;  3W1B A;  1SYE A;  1WCM B;  1Q46 A;  4G57 A;  4KK7 A;  2JSO A;  4JI7 Q;  3GTL H;  1RDP D;  4A3E H;  1LTG D;  2VB2 X;  2EYL A;  3C3L A;  4LUV A;  1FNW A;  3S2H B;  1O80 A;  2JN4 A;  4A3F G;  1HNX Q;  1PXU A;  3J7Z C;  5M3F H;  3GTO H;  1A62 A;  4XYO A;  2E2J H;  1O7Y A;  1JOK A;  2A74 C;  1ET6 A;  1M4V A;  4ZAI A;  3BVM A;  4R4Q A;  2WII B;  3K7A B;  4DV2 L;  4NPS A;  4RGM A;  5EBC A;  3S16 B;  3MEH A;  4DR1 Q;  2FHT A;  3I55 A;  2UUC L;  1PYB A;  3S14 B;  3OIP A;  1ENA A;  1I4H A;  2PI2 E;  2K6A A;  1TWH B;  4P72 A;  2MHV A;  3HOZ B;  1BF4 A;  1TWC H;  4LF9 L;  2SDF A;  1E24 A;  4RKL A;  1MJC A;  4A4I A;  5FO8 B;  3M85 A;  4A3D B;  5DLQ E;  1U4L A;  2EYH A;  2L4N A;  4LF6 L;  2PNH A;  3J81 i;  4DR3 L;  3KDF B;  2MQH A;  2B3G A;  4JI2 Q;  4N9T A;  4L5R C;  2BCO A;  3VA5 A;  3HOY B;  2UUB L;  3S1R B;  1S4Z A;  5C3E G;  1PH7 A;  4BBR G;  2HT1 A;  2UUA Q;  5C4J H;  3PUX A;  4TVA B;  3GTK B;  1ENF A;  4GS3 A;  5M5X B;  2DNE A;  4FXG C;  1XXG A;  2MO1 A;  2B2U C;  5HUR A;  1ROD A;  3V96 A;  2Y0S G;  1O7I A;  4P73 A;  4K0K L;  2FMC A;  5I6W A;  2X6G A;  3RD4 A;  2OCE A;  3CPW A;  2LXJ A;  4HN7 A;  1MJE A;  5J22 A;  3MFG A;  4RGO S;  4GOP A;  4KY5 A;  4DN4 M;  2K05 A;  1YIJ A;  3S1M H;  1ZXT A;  3GO5 A;  4OEM B;  5C44 G;  1PRT F;  1NUC A;  3K6O A;  1Z47 A;  5KIX A;  2F0T A;  2F03 A;  3NK9 A;  3EN2 A;  3CW2 C;  1B9M A;  3DHQ A;  1A6X A;  1HZA A;  3DXJ C;  3G7L A;  2E5L Q;  2B8F A;  2I07 B;  1IBK Q;  4RH6 A;  1E2Z A;  3I4M G;  4RHS A;  3SXH A;  4A3I G;  1MKH A;  1B1Z A;  2KEE A;  3GTM B;  2NVX B;  4EX5 A;  3HOV B;  3I4N H;  2I46 A;  5HGT A;  2DN8 A;  1FJG L;  1Y8P B;  5JPM C;  3RLF A;  3SK5 A;  2Q2U A;  5D3D A;  2UXC Q;  1IKM A;  4YWL A;  1V1O A;  3HOU B;  4CKB A;  4XTC S;  3S2D H;  1CFM A;  2EPB A;  2BA0 A;  4G4K A;  1XNQ L;  1QUQ A;  1HFN A;  2Z6K C;  3S1Q H;  5K36 G;  4CBV A;  3TQY A;  3RZO H;  1BCP D;  2AUK A;  5EKL A;  5I6Y A;  4UY8 C;  1SSO A;  1N33 Q;  3PQI A;  3MC0 B;  4NB3 A;  1AEX A;  4X3S A;  1LYL A;  1MSG A;  2IWH A;  4X65 Q;  2KCM A;  3NTI A;  5C4X H;  1K73 C;  4HIM A;  1YHQ A;  5JEA H;  4FO2 A;  3D6W A;  2HCC A;  1VDZ A;  2A69 C;  3D4W A;  4PZ6 A;  1LLR D;  4DNR B;  5BR8 L;  4GOP B;  3VYR A;  5IYD H;  2Q8R E;  2K01 A;  1PLF A;  3I4O A;  1IW7 D;  4KN4 C;  2L9H A;  1EY7 A;  2NVT H;  2HIX A;  1EY5 A;  2A6H D;  2ZJP A;  4BY7 B;  1V9P A;  1K0S A;  4OEL B;  1K83 B;  1C48 A;  4A75 A;  3TDQ A;  2NTT A;  3PF4 A;  1Q12 A;  2F0P A;  4PZ7 A;  5M3M H;  1XPU A;  3K5O A;  1WTQ A;  3S17 H;  2R92 G;  2F0O A;  3CRK C;  3PMF A;  4OWW B;  1UEB A;  4YWM A;  3S15 B;  1SEB D;  3PIP 3;  2L55 A;  1STA A;  2LFN A;  5IGD A;  5D65 A;  1NCV A;  3PIP A;  4DV2 Q;  3X3N A;  4QCL A;  3LNN A;  1HNZ L;  4RG1 A;  1ASY A;  4FYD A;  1WTO A;  2EJG C;  2PMZ E;  2UUC Q;  3OYY A;  4QB4 A;  1TQO A;  1HZC A;  2K33 A;  2QKI C;  5G3L D;  1HH2 P;  1KAW A;  3PO3 G;  1IYV A;  4LF9 Q;  4A3K G;  4DAM A;  1DOK A;  2Z4H A;  3M4P A;  4ZUJ A;  1SLJ A;  1SMY D;  3NE5 B;  2Q2H A;  2Q2T A;  1L0Y B;  1QUQ B;  1RCV D;  1WCM G;  4LF6 Q;  1ZKO A;  4DR3 Q;  3NEL A;  2KHS A;  1X9N A;  1VMP A;  2HIV A;  3K5N A;  2UUB Q;  3PUW A;  1RD9 D;  4JBW A;  2V4D A;  5HY6 A;  3TBI B;  4EQO A;  1FL0 A;  1K8A C;  2CQO A;  1TII D;  2GVB A;  2KEN A;  2TMP A;  1ESR A;  1N8R C;  1TWF B;  1EWI A;  1LTB D;  4DR4 L;  2B2T C;  1JB7 A;  1XNR L;  4NMZ A;  2VS1 A;  5CC4 A;  1VQ6 A;  1D8L A;  4M8A A;  3CAM A;  1AW7 A;  1EYC A;  1YNX A;  4K0K Q;  3BVG A;  2C35 B;  2Z4I A;  3PCO B;  3V2T A;  4DR6 L;  3T1Y L;  1ENC A;  4GLX A;  2NYZ D;  1R4P B;  3KF8 A;  3P75 A;  3HOZ G;  1UUP A;  2R93 H;  3DWP A;  1DGS A;  3KLS X;  4DK0 A;  2QEX A;  3CXC A;  2B63 B;  2GN5 A;  4C2M H;  4DUZ L;  1KL9 A;  4A3D G;  1OXV A;  2RF4 A;  2JA6 H;  2IX1 A;  1EIF A;  2F3V A;  3PF5 A;  3BZK A;  3GTP H;  5NUC A;  2SEB D;  4IFD H;  2VL6 A;  2J7Z A;  2ICE C;  4FF2 A;  4B3R L;  2OTJ A;  4XQQ A;  1JR0 D;  4ZUI A;  2N88 A;  1IW7 C;  4F7X A;  4HJ5 A;  3OOC A;  4BBS B;  4K6D A;  3T1H L;  1E1T A;  2A6H C;  2OT2 A;  4L6T B;  4CGY B;  1SE3 A;  2KQ3 A;  4BWG B;  5BN3 A;  2B29 A;  2MP1 A;  1Y1V H;  1ZEQ X;  5ELN A;  1DXM A;  1PRT B;  2L5T A;  3QR8 A;  2J0T D;  5T1G A;  1FJG Q;  3URY A;  3ND9 A;  4AYB G;  3D31 A;  1I4Q A;  4B3M L;  3AYH B;  4JW0 A;  1CK1 A;  1NNX A;  4C3H H;  5E1F A;  2WAQ E;  1WYD A;  4FF1 A;  3HKZ G;  1PTO H;  4Z9C B;  1EEI D;  4KJO A;  4BA1 I;  3ICE A;  3EIV A;  1XNQ Q;  4YCU A;  3J80 i;  3BDL A;  1SMY C;  2R7Z B;  3V05 A;  4IJL A;  3IAY A;  3I73 A;  2WAQ B;  3FDT A;  2O5J C;  4F88 A;  4JI6 L;  5DM6 3;  4ULL A;  3KF8 B;  1I3Q B;  2B2V A;  4S3S A;  1TKW B;  2I5M X;  1HFG A;  5CBE E;  4L63 B;  2M00 A;  1WVL A;  2CFM A;  3MAQ A;  5GQO A;  2SNM A;  1W2B A;  3HOW B;  2WKD A;  4X6A H;  2EY6 A;  2NZH A;  2L15 A;  4L5Q A;  3H3V I;  3JAM E;  1KAB A;  3LWE A;  3M3Y B;  4GNX C;  4YHH L;  2DJG C;  4X3U A;  5C4H A;  4K14 A;  4C3I B;  3OMC A;  4IAL A;  1Q81 C;  3HOU G;  4RHR A;  1I50 B;  3VR4 A;  5M9O A;  5CV8 A;  4L5S A;  1QZH A;  1EL0 A;  1GUT A;  4HIO A;  4OXP A;  3KLW A;  1X3E A;  1VQA A;  4P2C B;  2RHS B;  3VA7 A;  1HNZ Q;  3M4O H;  3FVQ A;  1PVO A;  5E4W C;  3DWQ A;  4R8I A;  2CVR A;  4HR7 B;  4UP7 A;  1PZK D;  2DNC A;  4JK1 C;  4ZQ3 A;  3F2D A;  1QZG A;  1L0W A;  2V1C C;  3GTJ H;  5IWA L;  3A54 A;  4A3F H;  1H9R A;  1FNV A;  1PDQ A;  5DM7 3;  1WTH A;  2IPK D;  1D6E C;  4DV4 L;  3HZX A;  3J7A V;  1VQF A;  4HSP A;  4IN3 A;  1PH3 A;  3KK7 A;  2RSO A;  3BG3 A;  4ZKC B;  1Y1W H;  1VQJ A;  4DR4 Q;  1RL2 A;  1YIT A;  1XNR Q;  1BO0 A;  1YNN C;  4A3C G;  3QO2 A;  2A68 C;  4A93 H;  5GAG C;  1CM9 A;  5J1Z A;  3HS0 C;  3NWS A;  3SDZ A;  4DR6 Q;  1W3S A;  1K28 A;  5IOC A;  3STB D;  3P1H A;  3M9B A;  3A56 A;  3FPU B;  3OMG A;  1HPC A;  1V1Q A;  4DUZ Q;  1JOR A;  4BBR H;  2Y0S E;  1KNE A;  5M5W H;  2K32 A;  5IGE A;  3OPO A;  4GN5 A;  5C3E B;  1CHP D;  3H0G B;  1CI3 M;  1XPO A;  4B3R Q;  3TP6 A;  3A7L A;  5IT9 c;  1W6K A;  3K8A A;  4C1N I;  2KHI A;  3KF6 B;  1VMC A;  5GAD C;  1EYG A;  4LMQ D;  1LT5 D;  2PW7 A;  3T1H Q;  3HOX H;  4DA2 A;  1STE A;  3A8J E;  1TWG B;  3F1Z A;  1VQI A;  5GAH C;  3RNU A;  1PZJ D;  3CQZ H;  2QF7 A;  2ZTE A;  4CJ0 B;  4A3G H;  5LMU L;  5D3I B;  1HZ9 A;  2JYO A;  3OIQ A;  1JB3 A;  2XRS D;  4LUZ A;  4QL5 A;  4IPH A;  4B3M Q;  5CMD A;  3B6Y A;  3NP8 A;  1VQL A;  2DUD A;  3MXP A;  2B63 G;  2A19 A;  2OEO A;  1PA6 A;  1C4Q A;  4XQJ A;  2K5Q A;  4X3K A;  4OO1 I;  2VW9 A;  2KEC A;  3G48 A;  3QJY A;  2UUA L;  1C8C A;  4NXM L;  2B39 A;  3J81 c;  2JJQ A;  2EE1 A;  2F0G A;  2EY1 A;  3I4M H;  4JOI A;  1K9M C;  4X62 L;  4BBS G;  1JQY D;  1YEZ A;  4Y7N B;  4A3I H;  3DWA A;  3ZYY X;  2F52 A;  4KHP L;  1TS4 A;  1LM0 A;  4KD4 A;  4NDX A;  2K7V A;  2E8G A;  3EFX D;  2BOS A;  3EQL C;  1E3P A;  4MTN A;  3NPP A;  4UP8 A;  1EWH A;  1K3R A;  1M90 C;  2D62 A;  2OXP A;  4RCN A;  3K58 A;  2F1M A;  4A3M B;  1X55 A;  3VDY A;  2SNS A;  4YHH Q;  1DD2 A;  3LWU A;  1ZYR D;  4MIU A;  1GO3 E;  1V1P A;  5GRO A;  3ZJY C;  1RKN A;  3A5U A;  1CZW A;  2WFW A;  3K80 C;  4E6I A;  4IUR A;  3ER0 A;  1K8G A;  1NY4 A;  2K04 A;  1U4R A;  2QDL A;  1CQF A;  3CC7 A;  1J6Q A;  1O7L A;  4WJW A;  2R7Z G;  5AJ3 L;  3CKI B;  1ILP A;  1JWU D;  4K8J A;  1IYJ B;  3OW7 A;  1EUJ A;  5A2Q L;  2YU9 B;  1YHB A;  1I6H H;  2MO0 A;  2NUC A;  3K59 A;  3KJO A;  2B2W A;  1GXD C;  4CJ1 B;  5EKK A;  1JWM D;  2KVM A;  5IWA Q;  3HOW G;  2EYP A;  4HMI A;  1SYG A;  1PRT C;  3VR2 A;  2F0Q A;  2M2L A;  1R4Q B;  4C3I G;  4DV4 Q;  5KRU A;  3CCR A;  2R92 B;  3RZD H;  5IY0 A;  1VQN A;  1OTC A;  2RA4 A;  5IGB A;  1N33 L;  3TRE A;  3Q23 A;  2RQX A;  2P5Z X;  1AH9 A;  2BE5 D;  5IP7 H;  1Q90 A;  3I70 A;  4A3K H;  4DU9 A;  3GD7 A;  1NAP A;  3PO3 B;  1SNP A;  4JVZ A;  3CCL A;  1WCM H;  3AEV A;  5COR A;  1HCZ A;  2DGY A;  1KD1 C;  2VQE L;  1BCP B;  4H0L C;  2CWP A;  3SK4 A;  3S2H H;  1S40 A;  2AMC B;  1OXT A;  1SE4 A;  1P8L A;  4LF7 Q;  4OO1 G;  5C0X H;  2DY7 A;  1ASZ A;  4IUP A;  5IT9 L;  4KTA A;  3S16 H;  2LMC B;  5CGK A;  1BOS A;  1ZYR C;  3SK6 A;  3OHX C;  2NVQ H;  3S14 H;  2PYK A;  1B4O A;  4BY1 G;  4X66 L;  3X3M A;  1TWH H;  1DM0 B;  1HA5 A;  3HOZ H;  1D5M C;  2ID0 A;  3VR6 A;  4NP5 A;  3GTL B;  1SNQ A;  2J4X A;  5CYU A;  4CHT B;  4A3E B;  2F4I A;  3L3O C;  1QG7 A;  2RDH A;  1G6P A;  5LMU Q;  2FXQ A;  1SNO A;  4A3D H;  1TU2 B;  1TY2 A;  5M3F B;  3U4Z A;  5FO7 B;  4XQN A;  1UE5 A;  3HOY H;  3TP7 A;  1VQ5 A;  2XWB B;  4N8F A;  1S3O A;  2QDB A;  4KI0 A;  2UU9 L;  1GUG A;  3H0G G;  2K4K A;  2K5D A;  3GTK H;  2L1B A;  5BN4 A;  4NXM Q;  2K5H A;  4KJN A;  4AYB E;  3TZU A;  1WOC A;  2ALY B;  2A69 D;  2VUM G;  1Z7T A;  3J81 L;  4X62 Q;  3HKZ E;  4MTK A;  3E3X A;  1W6J A;  4KHP Q;  4JI8 L;  5ELF A;  3JAM i;  5DAU A;  1VQ7 A;  4B08 A;  3RUZ A;  1TY0 A;  1BUV T;  2GA4 B;  4C3J B;  2A8V A;  3CU7 A;  2VZA A;  4AYB B;  2XGT A;  3TEH B;  1WJJ A;  2WKC A;  5CV6 A;  4L8J A;  2BE5 C;  5IYC G;  3I8Z A;  1JOQ A;  1GD7 A;  3HKZ B;  1IBL Q;  1UE7 A;  3A55 A;  4MN3 A;  1DJR D;  4IJH A;  2LSS A;  3QWN A;  4POF A;  1O78 A;  3PGZ A;  1CA5 A;  5AJ3 Q;  2DJF C;  1JE4 A;  4KKS A;  4TKO B;  5FLX E;  4R4T A;  1BNZ A;  3GTM H;  3HOV H;  2EXD A;  2EY5 A;  4Q0F A;  4QY7 A;  1U9R A;  3CHB D;  3HP3 A;  3SK8 A;  3ULJ A;  5KYL A;  2E2I H;  3NQT A;  3VYU A;  2KED A;  1FNU A;  1NMG A;  3HOU H;  1A3V A;  2EDG A;  4A3M G;  2G9D A;  2IL8 A;  4LWC A;  4OX9 L;  4B9X A;  1G2T A;  2NTS A;  4KY7 A;  1AFP A;  1LTL A;  3U4V A;  1KHI A;  5EKI A;  4ODG A;  2OTL A;  3HKS A;  1YVC A;  2ZJR A;  2BA1 A;  3TS0 A;  2XN9 C;  2UXB L;  1N32 L;  1NR4 A;  4YY3 L;  2LY7 A;  4DUY L;  4FXK C;  4LK1 C;  4JC0 A;  3J80 c;  5C3W A;  1IKL A;  1N9W A;  1UWV A;  4IPG A;  1Q1E A;  5DEH A;  2JA7 H;  3OSO A;  3S2D B;  3K81 C;  2PZT A;  4BY7 H;  3VYS A;  2VQE Q;  1LO5 D;  2KBN A;  1UNS A;  3ULL A;  1VQH A;  4IPC A;  5JVH 3;  3CCV A;  1ILQ A;  2PCF B;  2FFK B;  1YZ6 A;  2RSN A;  2UXD L;  1GOZ A;  3MXN A;  3AFQ A;  2K14 A;  2A6E C;  3I56 A;  3S15 H;  4RFB A;  1D7Q A;  1YI2 A;  2HQE A;  3U9O A;  1VS0 A;  4IQZ A;  1UE6 A;  3KLR A;  2Z9H A;  5J39 A;  4DKA C;  4BXX G;  2FMM A;  3L7Z C;  5I2Y A;  4JV5 L;  4X66 Q;  1HUM A;  1I6V C;  5GAE C;  1DZ1 A;  1BBW A;  5KEE A;  3I3C A;  1D1I A;  2JK8 A;  2YTV A;  4RKB A;  5E3F A;  2G5D A;  2F0F A;  4U67 3;  2NVY H;  2R6G A;  3AMU A;  2F0U A;  5IP9 G;  1A3T A;  4LFA Q;  4EQ5 A;  4DV6 L;  4HAE A;  3RR5 A;  1YJW A;  1D5X C;  3PO2 G;  4DV5 L;  2WIN B;  5T1I A;  1H9J A;  2I5H A;  2MFI A;  4IUU A;  4U68 A;  2UU9 Q;  2A1A A;  4YWK A;  1PFM A;  5IGF A;  2N78 A;  3MFY A;  1BQQ T;  2O2L D;  2A5H A;  3QIA A;  3SR1 A;  1WFQ A;  1JWS D;  4JI8 Q;  1H9M A;  3FMC A;  1OXU A;  3A7A B;  5KNB A;  1G91 A;  5E4X A;  4A3L H;  1ESF A;  4A3E G;  2HHH L;  1QB5 D;  2Z1C A;  2B63 H;  1PH1 A;  3DLL A;  2WV6 D;  3I90 A;  2KA7 A;  4DR7 L;  5M3F G;  3MXN B;  1K8O A;  3UDF A;  1YNJ C;  4PNY A;  2JA5 B;  3W1G A;  2C9O A;  5I2X A;  3BS1 A;  5I9O A;  1L2F A;  3TP5 A;  1TXY A;  4POG A;  4O0A A;  2I0Q A;  3T51 B;  1AN8 A;  1B44 D;  3CRL C;  1WTP A;  3C46 A;  4ZK9 B;  4ZCK A;  2JA8 H;  1M1K C;  2PNR C;  1LV9 A;  2AWO A;  4OIK A;  1CZG A;  2PQA A;  2Z8L A;  1LT3 D;  3MZ5 A;  4H13 C;  5EPL A;  1XPR A;  4UP9 A;  5ISR A;  1F9P A;  1LAC A;  2G9H D;  2XRQ D;  3NQI A;  2JA6 B;  3ONA B;  3GTP B;  1TT2 A;  1FD7 D;  3VYT A;  4C3J G;  1KTK A;  1E2V A;  5FJ8 H;  3C1F A;  3PUZ A;  3CCE A;  2B2W C;  5CR3 A;  1AZQ A;  2VNU D;  1B53 A;  4XXE A;  3P7J A;  3BDO A;  2NN6 I;  4OX9 Q;  1YNN D;  1S5B D;  2Z6B A;  4FXD A;  2A68 D;  1VQ9 A;  4HID A;  3H09 A;  1LTS D;  5JJL A;  1Y1V B;  5IGG A;  4P75 A;  4TRD A;  1YBY A;  1EY6 A;  1E0B A;  1QOH A;  4DV1 L;  2UXB Q;  1N32 Q;  3N52 A;  5IE8 A;  4YY3 Q;  3K5L A;  1R9T B;  3UE1 A;  1I3Q H;  1QNU A;  4DUY Q;  1F9R A;  1IL2 A;  3QOJ A;  1Q8K A;  2EQS A;  1RJT A;  1H9S A;  3FKI B;  3R3O A;  3J80 L;  2HUG A;  1JMC A;  1T5E A;  3CME A;  1GM5 A;  1RTN A;  3RLN A;  2QA4 A;  1PTO B;  5FLM H;  5E7N A;  1RF2 D;  1CSP A;  5ELC A;  4JI0 L;  1A2T A;  3H15 A;  3M3Y H;  2B2U A;  2WAC A;  1EEF D;  4YCV A;  3KBX A;  3Q6S A;  3S1N B;  1LTI D;  4CJ2 C;  1X3Q A;  3W5O A;  4DGZ A;  4ZKB B;  1CHQ D;  1EQR A;  4Q5V A;  3KOJ A;  3T56 B;  4KY6 A;  1CTM A;  2K5W A;  1IZ6 A;  4B9W A;  2EIF A;  2UXD Q;  2KJX A;  3NHH A;  4M1U B;  4O2D A;  1XYI A;  1L1O A;  2PQA B;  1HZB A;  3M4Q A;  4DXG A;  1EIH A;  1D1K A;  4GLA C;  1U4P A;  3I91 A;  1SN8 A;  1EQT A;  3I4N G;  4B3T L;  4JV5 Q;  4HTH A;  1PH8 A;  1G51 A;  1SBB B;  5JVG 3;  1NE3 A;  3K57 A;  1SJH D;  3IRB A;  3DM1 A;  4LF8 L;  1IHZ A;  1VF7 A;  1NMF A;  3SE0 A;  1JJC B;  2Z0S A;  4QMG A;  4KKT A;  4DV6 Q;  3NBH A;  4OO1 H;  3OWF A;  4EQP A;  1XJV A;  4FP5 D;  1X3G A;  4PQX A;  2E2H B;  4DV5 Q;  2ZJQ A;  1F2M A;  4HCE A;  4PMW A;  4FF4 A;  1SXT A;  4RGT A;  3RLO A;  1P16 A;  1X3P A;  1QVG A;  3SVM A;  2NBF A;  4BY1 B;  4DNI A;  1H9S B;  2F0S A;  1BCP F;  1HQR D;  2LS0 1;  3GTJ B;  5IYD G;  5A35 A;  4JPB W;  2AQ3 B;  2Z6K A;  3AU7 A;  4J8Q A;  5FOB B;  1Q1B A;  2K03 A;  2K5V A;  1HA6 A;  1G8Z D;  1NBW A;  3ND8 A;  2HHH Q;  2PW5 A;  4DF7 A;  4UPA A;  1MGS A;  3H94 A;  3G71 A;  4DR7 Q;  5C3E H;  5M3M G;  1HRJ A;  1KRT A;  1QVF A;  2NN6 G;  3MWY W;  3CPF A;  1L1O B;  1VQB A;  3C2P A;  4GOP C;  1DON A;  4LF7 L;  4A93 B;  2LXK A;  4XDX A;  4RMF A;  2VUM B;  1TS2 A;  1S72 A;  4A76 A;  4A3J B;  3EJI A;  2EZV A;  2H1E A;  4KHZ A;  3PUY A;  4F8M A;  3BVZ A;  1PMR A;  1XTC D;  2MUY A;  1CKM A;  2EJM A;  1TWG H;  4UAI A;  2ZXR A;  4I7A A;  4MZ9 A;  1IBM L;  2MJ8 A;  1PRT D;  2F3W A;  2WB1 B;  5FLX L;  1SRU A;  4OHJ A;  4C1N K;  4BA2 I;  1U4M A;  1LAB A;  2XVS A;  4LW1 A;  5G3L F;  2EJF C;  1C7Y A;  4LFB L;  5C44 H;  3GTQ H;  2C5C A;  3E0J A;  5CV4 A;  4Y52 H;  3PIO 3;  4LJZ C;  1TWA B;  5LL6 X;  3PIO A;  4JI3 L;  3S9W A;  1SE8 A;  2N8N A;  3ITP A;  2JA5 G;  1B9N A;  5M5Y B;  2RCN A;  1WI5 A;  2IJ0 A;  3UDI A;  2FIN B;  4WJ4 A;  1OXS C;  1SMX A;  1EY0 A;  4DV1 Q;  2QW7 A;  1EY8 A;  4J6H A;  1DYQ A;  1EYA A;  4ME3 A;  2R93 G;  1B50 A;  5EPK A;  1YJ9 A;  1UE1 A;  4XIG S;  2ZXO A;  4JCV E;  2VXW A;  3LGJ A;  4TSS A;  5IYB G;  4KHV A;  2F0I A;  4V19 0;  2R7F A;  5D14 A;  2EOT A;  3TP8 A;  1VQ4 A;  2B8G A;  2F0K A;  2B2T A;  4A3M H;  1GVP A;  2JA6 G;  3OTO L;  4JI0 Q;  4K5X A;  4FDB A;  4CKE A;  1JE5 A;  3ERQ A;  2IT1 A;  4XYQ A;  3J7Y W;  4CDD C;  3G6E A;  5J3B A;  3AB9 A;  1IBL L;  3C1E A;  4RWS C;  1NJI C;  4QJF A;  1Y8O B;  4JI1 L;  3KFU A;  1Y14 B;  3FHW A;  1QE6 A;  4X64 L;  1X6O A;  5K36 H;  3Q0A A;  1MHW C;  1EZ6 A;  3H3V C;  4ID6 A;  1T5X D;  1B70 B;  2E76 C;  1Y1V G;  4ME5 A;  4HJ9 A;  3GQB A;  1CKN A;  4G7H C;  1SRO A;  5I9P A;  2F0J A;  4B3T Q;  3H6M A;  3T53 B;  4MNO A;  1SE2 A;  5ELE A;  1FYC A;  4I7Z C;  2RDG A;  4RCO A;  2YTX A;  5JJK A;  2HQL A;  3FKI G;  2CKZ B;  2H5X A;  4AH6 A;  4QF4 A;  4LF8 Q;  3BU2 A;  3NXW A;  1JT8 A;  1KAA A;  3A74 A;  2CW0 C;  4XT3 B;  4RAU C;  1ML0 D;  1STG A;  2PQE A;  5ELO A;  3CP0 A;  4DXF A;  3FEW X;  2RDF A;  1SFO B;  4IUN A;  4DK6 C;  2R92 H;  4YIJ A;  2BH2 A;  3FPP A;  2F3I A; 
#chains in the Genus database with same CATH homology
 4A3B B;  1I6H B;  1IYU A;  1CA6 A;  2N55 A;  3MXU A;  1EWC A;  4PMB A;  4OIJ A;  1BBX C;  3K0Y A;  3MVV A;  4EQN A;  1QWY A;  1PFN A;  1GUS A;  3DUZ A;  1BR9 A;  3GTG B;  1EYD A;  1V1P B;  4WOR A;  3K5M A;  1SYD A;  3PO2 B;  1LT4 D;  2SOB A;  3M7G A;  1SYB A;  3D6C A;  3I72 A;  1FR3 A;  1LTR D;  3I4L A;  2QIL A;  2O4X A;  3P20 A;  4KN7 C;  1HXY D;  4QIW B;  1Z6H A;  1AP0 A;  1I4G A;  2XSC A;  4WRD A;  2JEA I;  4DFA A;  1SAP A;  1M8A A;  1MBY A;  5EJW A;  5C4Z A;  4MHE A;  4H44 C;  2QEJ C;  4BS9 A;  3GTO B;  2E2J B;  4QUF A;  1GUN A;  5ELB A;  3MHB A;  3D4R A;  2NVQ B;  4IZ8 A;  5C6A A;  1XWE A;  4K5W A;  2BDO A;  1SND A;  5FO9 B;  1GJX A;  1TWC B;  3VR3 A;  3RMH A;  1F9S A;  5IGC A;  5LHY 1;  2CHB D;  3KBG A;  2M9V A;  3QB3 A;  5FK9 C;  1KNA A;  1S5C D;  1WTR A;  2JE6 I;  2B2V C;  3U9S A;  3DEP A;  2A6E D;  4WFN 3;  2IX0 A;  5C4J B;  3GV6 A;  1KLG D;  1EZ8 A;  3JAM L;  3H91 A;  2X6L A;  2YYZ A;  2ENB A;  3NTK A;  1KDB A;  3NTH A;  1Y69 U;  2D5D A;  5JJZ A;  4KV6 A;  4LAA A;  1S5E D;  3OWE B;  3L9A X;  2KUM A;  1LTA D;  1H9K A;  4RGN A;  1B3A A;  1HTL D;  1STH A;  1SYF A;  3KLS A;  3S1M B;  1KDC A;  1RHP A;  5C0X J;  2R3Z A;  1HQM C;  2EYJ A;  3NUC A;  1J9O A;  5I4D A;  2F0H A;  5C0X I;  1TS3 A;  1SNM A;  3J7A F;  1TR5 A;  2PPB C;  2IX3 A;  1PYW D;  5ELD A;  3MA2 B;  1K8M A;  3IFT A;  3EA6 A;  5EGT A;  1PTO F;  4FNF A;  4DK1 A;  1FGB D;  3PV0 A;  3G6J B;  2ZXP A;  3I4N B;  2AQ2 B;  2E2I B;  4HED A;  4PMC A;  3MTS A;  3UI2 A;  1YNJ D;  1TS5 A;  3O13 A;  3R93 A;  2FJ2 A;  3KUP A;  1F77 A;  1PFB A;  2F0L A;  2JXM B;  5KYI A;  2X69 A;  3S1Q B;  1UAP A;  4EGV A;  3RZO B;  1QJO A;  4F87 A;  1EU4 A;  2HDM A;  1Y8N B;  2B2Y A;  4G7Z C;  5CV5 A;  2KOL A;  5C3X A;  2F0V A;  1JCK B;  5C4X B;  1ET9 A;  2AWN A;  2JA7 B;  3WOE A;  3BYT B;  5COY A;  2KCC A;  2NVT B;  4UDU C;  3HG9 A;  1F9Q A;  4FVM A;  3EVQ A;  2NN6 H;  2XNA C;  5M3M B;  4J1M A;  5CBA E;  3TN2 A;  3S17 B;  5C5L A;  1A2U A;  2JEB I;  1A15 A;  1NSN S;  5A2Q E;  4QUC A;  1WD1 A;  2E75 C;  1CQV A;  1S5D D;  1WTW A;  4OL7 A;  1STY A;  4N9P A;  5JAV A;  2XWJ B;  2AUJ D;  3E5S A;  2NVY B;  4R9W A;  1B2T A;  2PO4 A;  1I4P A;  2PMZ B;  3NBI A;  2DY8 A;  4KMU C;  3QOL A;  2VB3 X;  1GUO A;  2Q8I B;  4HCS A;  5C0X G;  2BDN A;  1JOO A;  1F2Z A;  5KGU A;  2K1B A;  3TME A;  5JEA J;  4IUQ A;  4EVO A;  2LKV A;  5LL6 S;  1DOL A;  3SHL A;  1BCP C;  2R93 B;  4K5V A;  2A73 B;  3DEO A;  1GHK A;  1Q3L A;  3IL8 A;  1SNC A;  4C2M B;  4NW2 A;  3R8B A;  2XIW A;  5EPJ A;  3T13 A;  2E74 C;  4IUV A;  1KDA A;  3A8I E;  5IT9 E;  2R61 A;  3FRP B;  1J8I A;  1DCZ A;  3NSW A;  1GHJ A;  2JA8 B;  3HEJ A;  4DNT B;  4I65 A;  2ZT9 C;  1G2S A;  1LT6 D;  2MGS A;  1BDO A;  4K2K A;  2EYF A;  2D2C C;  2H4O A;  3D3R A;  4C3H B;  2KCN A;  1BXT A;  2ICI A;  1DOM A;  1EOT A;  4TQU S;  3J81 E;  3QG1 A;  3LX0 A;  1D2B A;  2MPM A;  1VCI A;  3BDC A;  5KNC A;  3IFD A;  5K5P A;  4KD3 A;  5JOB A;  4ZRZ A;  2RBM A;  3IKJ A;  2EVB A;  4K6L A;  5JPN C;  2WP8 J;  1EQV A;  1S5F D;  1WTV A;  4H7B A;  5CV7 A;  1E2W A;  4C56 C;  4IFD J;  4O1N A;  2AQ1 B;  2QCP X;  1I4X A;  1HUN A;  1PZI D;  2TSS A;  4IFD I;  3W2D A;  2F0W A;  4X3T A;  5KND A;  2OF1 A;  3PUV A;  4PV1 C;  1EY4 A;  3M4O B;  1CT1 D;  1SJE D;  3F2U A;  5CV9 A;  5JEA G;  4A3F B;  1A3U A;  3M4Y A;  2L12 A;  3A8K E;  3GP7 A;  4GZY C;  4R8N A;  4ZLT F;  5F2D A;  2F0M A;  1SDF A;  1D5Z C;  5FKA C;  1Y1W B;  1IL8 A;  4DAY A;  2L0C A;  1F2Y A;  1Q8I A;  1ONL A;  4KKU A;  2F0D A;  2CW0 D;  3ERO A;  4K8I A;  4DAV A;  2RVL A;  3HRZ C;  4BBR B;  1NR2 A;  2PZW A;  5M5W B;  2CQA A;  3NWT A;  3Q22 A;  4ZYS A;  2Y0S B;  3HOX B;  2RKS A;  3MXG A;  1JIC A;  3W3A A;  4OGQ C;  3DMU A;  3CQZ B;  4A3G B;  3TSS A;  5C44 B;  1QNK A;  3GTQ B;  1II3 A;  2EYM A;  3D4D A;  5BN5 A;  1PTO D;  1O7Z A;  1X32 A;  2NZ1 D;  4G7O C;  1HHV A;  4IFD G;  2E2D C;  3R2T A;  1LTT D;  2HDL A;  3I4M B;  2NWG A;  1VF5 C;  2EYO A;  2Q8T A;  3E6Z X;  4A3I B;  1WD0 A;  3M7N A;  1OXX K;  3R2I A;  4ILW A;  1QCB D;  3T4A C;  2B2Y C;  1G29 1;  5AFW A;  1TVX A;  1UEA B;  3T16 A;  3GV3 A;  3WDN A;  2NB0 A;  1JC7 A;  1OO9 B;  4DAP A;  1V8Q A;  4XT1 B;  4O42 A;  4NKL A;  1STN A;  5IIF A;  1F2L A;  5C5M A;  4C3H G;  2PZU A;  3N6R A;  1L0X B;  4K2L A;  2K28 A;  4HMJ A;  3Q24 A;  1STB A;  4V0B A;  1GUW A;  2F0E A;  1QIL A;  3HGB A;  1G6Z A;  5IOD A;  1AZP A;  1EFI D;  4CKC A;  1EIG A;  1SYC A;  2O5I C;  1RTO A;  4RA8 A;  1EU3 A;  1I4R A;  4IUT A;  1MI2 A;  2JP1 A;  1ICW A;  3TZD A;  2EXZ A;  3D8G A;  3VR5 A;  1WTX A;  1MSH A;  1EY9 A;  2L11 A;  3WOF A;  3RZD B;  1XX8 A;  3BZD B;  2D9U A;  4HSV A;  5TSS A;  1PTO C;  3J80 E;  5EBD A;  2IW3 A;  4FF3 A;  1MD2 D;  1V43 A;  4A3K B;  1KLU D;  5EQ0 A;  2EY2 A;  4ABN A;  2HCI A;  1HTP A;  3BYY B;  5DNF A;  3SEB A;  2F0N A;  1SYE A;  1WCM B;  4G57 A;  4KK7 A;  2JSO A;  1RDP D;  1LTG D;  2VB2 X;  2EYL A;  3C3L A;  1FNW A;  3S2H B;  1O80 A;  1PXU A;  4XYO A;  1O7Y A;  1JOK A;  2A74 C;  1ET6 A;  1M4V A;  4ZAI A;  3BVM A;  2WII B;  3K7A B;  4RGM A;  5EBC A;  3S16 B;  3MEH A;  2FHT A;  3S14 B;  3OIP A;  1ENA A;  1I4H A;  2K6A A;  1TWH B;  3HOZ B;  2MHV A;  1BF4 A;  2SDF A;  4RKL A;  5FO8 B;  3M85 A;  4A3D B;  1U4L A;  2EYH A;  2L4N A;  4N9T A;  2BCO A;  3VA5 A;  3HOY B;  3S1R B;  1S4Z A;  3PUX A;  3GTK B;  1ENF A;  5M5X B;  2DNE A;  4FXG C;  1XXG A;  2B2U C;  5HUR A;  1ROD A;  3V96 A;  2FMC A;  5I6W A;  3RD4 A;  2X6G A;  4HN7 A;  5J22 A;  3MFG A;  4RGO S;  4KY5 A;  4DN4 M;  2K05 A;  1ZXT A;  3GO5 A;  1PRT F;  1NUC A;  3K6O A;  1Z47 A;  5KIX A;  2F0T A;  2F03 A;  3NK9 A;  1B9M A;  3DHQ A;  1A6X A;  3DXJ C;  3G7L A;  2B8F A;  2I07 B;  4RH6 A;  1E2Z A;  4RHS A;  3SXH A;  1B1Z A;  2KEE A;  3GTM B;  2NVX B;  3HOV B;  2I46 A;  5HGT A;  2DN8 A;  1Y8P B;  5JPM C;  3RLF A;  3SK5 A;  5D3D A;  1IKM A;  1V1O A;  3HOU B;  4CKB A;  4XTC S;  1CFM A;  2EPB A;  2BA0 A;  4G4K A;  1HFN A;  5K36 G;  4CBV A;  1BCP D;  2AUK A;  5EKL A;  5I6Y A;  1SSO A;  3MC0 B;  1AEX A;  4X3S A;  1MSG A;  2IWH A;  3NTI A;  5JEA H;  4FO2 A;  3D6W A;  2HCC A;  1VDZ A;  2A69 C;  3D4W A;  4DNR B;  1LLR D;  3VYR A;  2Q8R E;  2K01 A;  1PLF A;  1IW7 D;  4KN4 C;  2L9H A;  1EY7 A;  1EY5 A;  2A6H D;  4BY7 B;  1K83 B;  1C48 A;  3TDQ A;  2NTT A;  1Q12 A;  2F0P A;  3K5O A;  1WTQ A;  2F0O A;  3CRK C;  3PMF A;  3S15 B;  1SEB D;  3PIP 3;  2L55 A;  1STA A;  2LFN A;  5IGD A;  5D65 A;  1NCV A;  3X3N A;  4QCL A;  3LNN A;  4FYD A;  1WTO A;  2EJG C;  4QB4 A;  1TQO A;  2K33 A;  2QKI C;  5G3L D;  1IYV A;  1DOK A;  2Z4H A;  4ZUJ A;  1SMY D;  3NE5 B;  1L0Y B;  1RCV D;  1ZKO A;  2KHS A;  1VMP A;  3K5N A;  3PUW A;  1RD9 D;  4JBW A;  2V4D A;  4EQO A;  3TBI B;  1TII D;  2TMP A;  1ESR A;  1TWF B;  1LTB D;  2B2T C;  4NMZ A;  5CC4 A;  4M8A A;  1AW7 A;  1EYC A;  3BVG A;  2Z4I A;  3V2T A;  1ENC A;  2NYZ D;  1R4P B;  3KF8 A;  3P75 A;  1UUP A;  3DWP A;  3KLS X;  4DK0 A;  2B63 B;  1OXV A;  2IX1 A;  2F3V A;  4IFD H;  5NUC A;  2SEB D;  2J7Z A;  2ICE C;  4FF2 A;  4XQQ A;  1JR0 D;  4ZUI A;  2N88 A;  1IW7 C;  4F7X A;  3OOC A;  4BBS B;  4K6D A;  2A6H C;  2OT2 A;  4L6T B;  4CGY B;  1SE3 A;  2KQ3 A;  4BWG B;  5BN3 A;  2MP1 A;  1ZEQ X;  1DXM A;  1PRT B;  2L5T A;  2J0T D;  5T1G A;  3URY A;  3ND9 A;  3D31 A;  1I4Q A;  1CK1 A;  5E1F A;  4FF1 A;  1PTO H;  4Z9C B;  1EEI D;  4KJO A;  4BA1 I;  3BDL A;  1SMY C;  2R7Z B;  3V05 A;  3IAY A;  3I73 A;  2WAQ B;  3FDT A;  2O5J C;  4F88 A;  5DM6 3;  4ULL A;  1I3Q B;  2B2V A;  4S3S A;  1TKW B;  1HFG A;  5CBE E;  4L63 B;  2M00 A;  1WVL A;  3MAQ A;  2SNM A;  3HOW B;  2WKD A;  2EY6 A;  3JAM E;  1KAB A;  3LWE A;  3M3Y B;  4X3U A;  5C4H A;  4K14 A;  4C3I B;  3OMC A;  4IAL A;  4RHR A;  1I50 B;  3VR4 A;  5M9O A;  5CV8 A;  1EL0 A;  1GUT A;  4P2C B;  3VA7 A;  3FVQ A;  5E4W C;  3DWQ A;  4R8I A;  2CVR A;  4HR7 B;  1PZK D;  2DNC A;  4JK1 C;  4ZQ3 A;  3A54 A;  1H9R A;  1FNV A;  1PDQ A;  5DM7 3;  2IPK D;  1D6E C;  3HZX A;  3J7A V;  4HSP A;  4IN3 A;  3KK7 A;  2RSO A;  3BG3 A;  4ZKC B;  1BO0 A;  1YNN C;  3QO2 A;  2A68 C;  1CM9 A;  5J1Z A;  3HS0 C;  3NWS A;  3SDZ A;  5IOC A;  3P1H A;  3A56 A;  3FPU B;  3OMG A;  1HPC A;  1JOR A;  1KNE A;  2K32 A;  5IGE A;  3OPO A;  5C3E B;  1CHP D;  3H0G B;  1CI3 M;  3TP6 A;  3A7L A;  1W6K A;  4C1N I;  1VMC A;  4LMQ D;  1LT5 D;  2PW7 A;  4DA2 A;  1STE A;  3A8J E;  1TWG B;  1PZJ D;  2QF7 A;  4CJ0 B;  5D3I B;  2JYO A;  1JB3 A;  2XRS D;  3OIQ A;  5CMD A;  3NP8 A;  3MXP A;  2OEO A;  1C4Q A;  4XQJ A;  2K5Q A;  4X3K A;  4OO1 I;  2KEC A;  3QJY A;  1C8C A;  2B39 A;  2EE1 A;  2F0G A;  2EY1 A;  1JQY D;  4Y7N B;  3DWA A;  3ZYY X;  1TS4 A;  4KD4 A;  4NDX A;  2K7V A;  3EFX D;  2BOS A;  3EQL C;  3NPP A;  1EWH A;  2D62 A;  2OXP A;  4RCN A;  3K58 A;  2F1M A;  4A3M B;  2SNS A;  1DD2 A;  3LWU A;  1ZYR D;  4MIU A;  1V1P A;  1RKN A;  1CZW A;  4E6I A;  4IUR A;  2K04 A;  1U4R A;  1CQF A;  1O7L A;  4WJW A;  3CKI B;  1ILP A;  1JWU D;  4K8J A;  3OW7 A;  5A2Q L;  2YU9 B;  3K59 A;  2NUC A;  2B2W A;  1GXD C;  4CJ1 B;  5EKK A;  1JWM D;  2KVM A;  2EYP A;  4HMI A;  1SYG A;  1PRT C;  3VR2 A;  2F0Q A;  2M2L A;  1R4Q B;  4C3I G;  5KRU A;  2R92 B;  2RA4 A;  5IGB A;  3Q23 A;  2RQX A;  2BE5 D;  1Q90 A;  3I70 A;  4DU9 A;  3GD7 A;  1NAP A;  3PO3 B;  1SNP A;  5COR A;  1HCZ A;  1BCP B;  4H0L C;  3SK4 A;  1OXT A;  1SE4 A;  4OO1 G;  5C0X H;  2DY7 A;  4IUP A;  5IT9 L;  4KTA A;  2LMC B;  5CGK A;  1BOS A;  1ZYR C;  3SK6 A;  3OHX C;  2PYK A;  1B4O A;  3X3M A;  1DM0 B;  1HA5 A;  1D5M C;  2ID0 A;  3VR6 A;  4NP5 A;  3GTL B;  1SNQ A;  2J4X A;  5CYU A;  4CHT B;  4A3E B;  2F4I A;  3L3O C;  1QG7 A;  2RDH A;  1SNO A;  1TU2 B;  1TY2 A;  5M3F B;  5FO7 B;  4XQN A;  3TP7 A;  2XWB B;  4KI0 A;  2QDB A;  1GUG A;  2K5D A;  2L1B A;  5BN4 A;  4KJN A;  3TZU A;  2A69 D;  1Z7T A;  3J81 L;  1W6J A;  5ELF A;  5DAU A;  4B08 A;  3RUZ A;  1TY0 A;  1BUV T;  2GA4 B;  4C3J B;  3CU7 A;  4AYB B;  2WKC A;  5CV6 A;  4L8J A;  2BE5 C;  3I8Z A;  1JOQ A;  3HKZ B;  3A55 A;  4MN3 A;  1DJR D;  3QWN A;  1O78 A;  1CA5 A;  1JE4 A;  4KKS A;  4TKO B;  5FLX E;  1BNZ A;  2EY5 A;  4Q0F A;  1U9R A;  3CHB D;  3HP3 A;  3SK8 A;  5KYL A;  3NQT A;  3VYU A;  2KED A;  1FNU A;  1A3V A;  2EDG A;  2G9D A;  2IL8 A;  4B9X A;  1G2T A;  2NTS A;  4KY7 A;  1AFP A;  5EKI A;  4ODG A;  2BA1 A;  2XN9 C;  1NR4 A;  2LY7 A;  4FXK C;  4LK1 C;  5C3W A;  1IKL A;  1Q1E A;  5DEH A;  3OSO A;  3S2D B;  2PZT A;  3VYS A;  1LO5 D;  1UNS A;  5JVH 3;  1ILQ A;  2PCF B;  2FFK B;  2RSN A;  1GOZ A;  3MXN A;  2A6E C;  4RFB A;  2HQE A;  3U9O A;  4IQZ A;  3KLR A;  5J39 A;  2FMM A;  3L7Z C;  5I2Y A;  1HUM A;  1I6V C;  1DZ1 A;  5KEE A;  3I3C A;  1D1I A;  4RKB A;  5E3F A;  2F0F A;  4U67 3;  2R6G A;  3AMU A;  2F0U A;  1A3T A;  4HAE A;  1D5X C;  2WIN B;  5T1I A;  1H9J A;  4IUU A;  4U68 A;  1PFM A;  5IGF A;  3MFY A;  1BQQ T;  2O2L D;  2A5H A;  3QIA A;  3SR1 A;  1JWS D;  1H9M A;  3FMC A;  1OXU A;  3A7A B;  5KNB A;  1G91 A;  5E4X A;  1ESF A;  1QB5 D;  2Z1C A;  2WV6 D;  3I90 A;  2KA7 A;  1K8O A;  1YNJ C;  4PNY A;  2JA5 B;  2C9O A;  5I2X A;  3BS1 A;  5I9O A;  3TP5 A;  3T51 B;  1AN8 A;  1B44 D;  3CRL C;  1WTP A;  3C46 A;  4ZK9 B;  2PNR C;  1LV9 A;  2AWO A;  4OIK A;  1CZG A;  2Z8L A;  1LT3 D;  3MZ5 A;  4H13 C;  5EPL A;  5ISR A;  1F9P A;  1LAC A;  2G9H D;  2XRQ D;  3NQI A;  2JA6 B;  3ONA B;  3GTP B;  1TT2 A;  1FD7 D;  3VYT A;  4C3J G;  1KTK A;  1E2V A;  3C1F A;  3PUZ A;  2B2W C;  5CR3 A;  1AZQ A;  2VNU D;  1B53 A;  4XXE A;  3P7J A;  3BDO A;  2NN6 I;  1YNN D;  1S5B D;  4FXD A;  2A68 D;  3H09 A;  1LTS D;  1Y1V B;  5IGG A;  4TRD A;  1EY6 A;  1E0B A;  1QOH A;  3N52 A;  3K5L A;  1R9T B;  1QNU A;  1F9R A;  3QOJ A;  1RJT A;  1H9S A;  3FKI B;  3R3O A;  3J80 L;  2HUG A;  1T5E A;  1RTN A;  1PTO B;  1RF2 D;  5ELC A;  1A2T A;  2B2U A;  2WAC A;  1EEF D;  3KBX A;  3Q6S A;  3S1N B;  1LTI D;  4CJ2 C;  1X3Q A;  4DGZ A;  4ZKB B;  1CHQ D;  4Q5V A;  3T56 B;  4KY6 A;  1CTM A;  2K5W A;  4B9W A;  2KJX A;  3NHH A;  4M1U B;  1XYI A;  4DXG A;  1EIH A;  1D1K A;  1U4P A;  3I91 A;  1EQT A;  4HTH A;  1SBB B;  5JVG 3;  3K57 A;  1SJH D;  3DM1 A;  1IHZ A;  1VF7 A;  3SE0 A;  4QMG A;  4KKT A;  3NBH A;  4OO1 H;  3OWF A;  4EQP A;  4FP5 D;  4PQX A;  2E2H B;  1F2M A;  4HCE A;  4PMW A;  4FF4 A;  1SXT A;  4RGT A;  1X3P A;  3SVM A;  2NBF A;  4BY1 B;  1H9S B;  2F0S A;  1BCP F;  1HQR D;  2LS0 1;  3GTJ B;  5A35 A;  2AQ3 B;  3AU7 A;  4J8Q A;  5FOB B;  1Q1B A;  2K03 A;  1HA6 A;  1G8Z D;  3ND8 A;  2PW5 A;  4DF7 A;  1MGS A;  3H94 A;  1HRJ A;  2NN6 G;  3MWY W;  3C2P A;  1DON A;  4A93 B;  4XDX A;  2VUM B;  1TS2 A;  4A3J B;  2EZV A;  3EJI A;  2H1E A;  4KHZ A;  3PUY A;  4F8M A;  3BVZ A;  1PMR A;  1XTC D;  2MUY A;  2EJM A;  4UAI A;  2ZXR A;  2MJ8 A;  1PRT D;  2F3W A;  2WB1 B;  5FLX L;  4BA2 I;  4OHJ A;  4C1N K;  1U4M A;  1LAB A;  2XVS A;  5G3L F;  2EJF C;  2C5C A;  3E0J A;  5CV4 A;  3PIO 3;  4LJZ C;  1TWA B;  5LL6 X;  3S9W A;  3ITP A;  1B9N A;  5M5Y B;  2IJ0 A;  2FIN B;  1OXS C;  1EY0 A;  1EY8 A;  4J6H A;  1DYQ A;  1EYA A;  1B50 A;  5EPK A;  4XIG S;  2ZXO A;  2VXW A;  4TSS A;  4KHV A;  2F0I A;  4V19 0;  5D14 A;  2EOT A;  3TP8 A;  2B8G A;  2F0K A;  2B2T A;  4K5X A;  4CKE A;  3ERQ A;  4XYQ A;  2IT1 A;  3J7Y W;  3AB9 A;  3C1E A;  4RWS C;  1Y8O B;  1QE6 A;  5K36 H;  3Q0A A;  1EZ6 A;  3H3V C;  4ID6 A;  1T5X D;  2E76 C;  4ME5 A;  3GQB A;  4G7H C;  5I9P A;  2F0J A;  3H6M A;  3T53 B;  1SE2 A;  5ELE A;  1FYC A;  4I7Z C;  2RDG A;  4RCO A;  4QF4 A;  3NXW A;  1KAA A;  2CW0 C;  4XT3 B;  4RAU C;  1ML0 D;  1STG A;  2PQE A;  4DXF A;  3FEW X;  2RDF A;  1SFO B;  4IUN A;  4YIJ A;  3FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...