5NUCA

Staphylococcal nuclease, 1-n-pentane thiol disulfide to v23c variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 36
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5nucA00
3OWFA 1EZ6A 2F0KA 2PW5A 3OSOA 4OL7A 1F2MA 1EYCA 5CV7A 2F0FA 2OXPA 5I6YA 1A3TA 2F0SA 5CGKA 3QOJA 2NUCA 5DAUA 5EKKA 5JAVA 4IUNA 2OEOA 4B9WA 3TP6A 3MEHA 1F2YA 3MXPA 1SNQA 2PQEA 5ISRA 5CV6A 5C5LA 1TT2A 2PZUA 2RDFA 2EY1A 3QOLA 4LAAA 5J1ZA 5CV5A 4K8IA 1SYBA 3VA5A 1NSNS 1JORA 4PNYA 1RKNA 5C4ZA 3D4WA 4KD4A 4MIUA 4NMZA 3P1HA 4WRDA 1SYEA 4RKLA 1EY5A 5KEEA 5IOCA 3C1EA 2M00A 1TQOA 5IGCA 4QMGA 1U9RA 2WACA 2EYFA 2QDBA 4K6DA 4S3SA 5CV4A 3SK4A 4K2KA 5E3FA 3TP8A 3T13A 4HTHA 2LKVA 1STYA 1STHA 4EVOA 3S9WA 1JOQA 2EY6A 2O4XA 3SHLA 4DFAA 3NHHA 1STBA 2F3VA 3NQTA 4HMIA 1SNMA 1STGA 3EROA 4K5XA 3EVQA 4H7BA 4KTAA 3TMEA 1SYCA 4KY7A 5C5MA 3ITPA 1EY6A 1SYGA 4F7XA 1SNCA 3QB3A 4KV6A 5C3WA 4EQNA 5HURA 5IGEA 2SNSA 3P75A 4KY5A 1II3A 3DMUA 4EQPA 4R8NA 5KRUA 1A2TA 4ZUJA 1ENCA 1SYFA 2F0PA 3MHBA 2F0MA 2RKSA 3SXHA 5CC4A 2EYPA 3SK5A 5KGUA 4QF4A 4N9PA 4IZ8A 1EZ8A 5C3XA 5NUCA 2SNMA 5IGGA 2PZWA 4J1MA 4ZQ3A 4YIJA 4DGZA 2SOBA 2EYHA 3D6CA 1KDCA 1SNOA 3BDLA 5IGBA 3TP7A 4DU9A 2EY5A 2HQEA 2PZTA 1NUCA 1EY8A 4G57A 1EY9A 2F0HA 4PMBA 5IGDA 1F2ZA 3BDCA 3SK8A 5F2DA 2F0WA 3V2TA 5KYLA 3NK9A 1SYDA 2F0NA 2EYLA 1A3VA 2EYJA 3H6MA 2F0TA 2F0UA 1STAA 2EYMA 3OMGA 4N9TA 5CV8A 4TRDA 4RKBA 5IIFA 4K5WA 2EYOA 1AEXA 4ID6A 5EGTA 3MZ5A 4PMCA 1KDAA 4J6HA 4NKLA 4KY6A 1EY0A 3U9OA 3MVVA 1ENAA 1EQVA 4KD3A 4IALA 5DEHA 4F8MA 1KDBA 2KHSA 4K2LA 5HGTA 3C1FA 4K8JA 2F0IA 4I65A 3NXWA 4HMJA 4KHVA 2F0DA 3EJIA 4ME5A 5E1FA 5I9PA 3T16A 5C6AA 2RBMA 1EY4A 1A3UA 2F3WA 5I9OA 2F0OA 4K14A 5C4HA 2F0QA 5CR3A 3HEJA 1SNDA 5CV9A 2EXZA 2OF1A 2PYKA 3D4DA 3OMCA 3D8GA 3PMFA 2F0JA 5K5PA 2F0EA 4ZUIA 3SK6A 3TP5A 5IODA 1KAAA 4NDXA 3ERQA 1EYAA 3R3OA 4QB4A 1EY7A 1JOKA 1SNPA 2KQ3A 5J22A 5JOBA 5KIXA 4NP5A 2EY2A 3RUZA 1STNA 5J39A 4B9XA 3SR1A 2ENBA 3E5SA 3NP8A 4EQOA 1JOOA 2F0VA 5M9OA 4KJOA 4E6IA 2F0GA 5KYIA 3LX0A 1KABA 1EYDA 4ODGA 1IHZA 4KJNA 4WORA 5I6WA 1TR5A 4DF7A 4K5VA 3HZXA 5IGFA 3DHQA 1A2UA 5EKLA 2PW7A 2F0LA 3NUCA
chains in the Genus database with same CATH superfamily
1XMOQ 1KHIA 3CC4A 3VR4A 3ZJYC 1PTOB 5CV7A 3VYUA 1RD9D 4LFCL 2YTVA 5IYBG 4JV5L 1SMYC 2Q8RE 4OELB 3W1BA 1DOKA 1SNQA 3OW7A 1EQQA 2ZXOA 4K8IA 3CCUA 3TDQA 4PNYA 1JWMD 3IFDA 5C4ZA 5IP7H 4GKJQ 2B2TA 5C0XI 2N3SA 2F03A 1MHWC 4GN3B 5KEEA 1OXVA 3FVQA 4S3SA 2WACA 4K6DA 2QDBA 5C4XG 1O7IA 1J8IA 4RGOS 2X6LA 4P75A 3HKZG 4AYBB 4A93B 3P7JA 2HUGA 3RR5A 4DAYB 1DCZA 4V190 4CBVA 4JI0L 3S17B 1YBYA 4O2DA 3HOYG 5C4XB 5GROA 3GTKB 3OYYA 4LUZA 2BE5C 4XQQA 2UXBQ 5KRUA 3GTGB 4ZUJA 1U4PA 4DV2Q 5ELBA 4U68A 5G3LF 5G3LD 1AZQA 1S5ED 1EU4A 1CSPA 1H9SA 2PZWA 1SLJA 2B63H 1A63A 3MXNA 2EYHA 4L63B 5JVG3 2D9UA 1KDCA 5D14A 4DR1L 4ZKCB 4IFDH 1TWGH 4G57A 2J7ZA 1CHQD 3O13A 3FDTA 4L5QA 2Y0SE 4MTKA 5E7NA 4RKBA 2JE6I 1RF2D 1MBYA 4C3IG 5K36H 5DEHA 4IALA 5FJ8H 5LMNW 4H02A 4A3GB 4A3MH 1FNUA 3RZDB 2A6EC 3NXWA 4AYBE 4DV5Q 4C3HG 3V05A 4DK6C 3U50C 2K52A 1NE3A 4DV4L 4KHPL 1DYQA 4LF9Q 1TS2A 2EXZA 5IYCH 2PYKA 4DV3Q 4FP5D 3J7A5 4A3FB 4X62Q 5FLXL 3PIP3 1CK1A 1B4OA 1K83H 4QB4A 2K28A 1E7ZA 3K57A 4A3IB 3NP8A 4DR7L 4N8FA 3ULPA 1KRTA 1LO5D 3KF6B 4JI1Q 1ML0D 4WORA 3HOVH 3NELA 2L12A 2CH4A 2JQOA 2F0LA 3VYRA 4C1NK 4HAEA 2PW5A 4R9WA 5C0XG 2AUJD 1PDQA 1TS4A 4A3BH 1K0RA 4NB3A 4BY7G 4B9WA 2Z6KA 1GUTA 4JI2Q 2E75C 2KVMA 1TWCH 5C5LA 2IJ0A 2VUMB 3TS0A 3VA5A 2HD3A 4ILWA 4MIUA 1K73C 1FYCA 1ASZA 2E2DC 4JV5Q 2M00A 4XYOA 3S15H 3GTLB 2LXJA 1XNQL 5FOBB 4BBSH 4OX9L 5E3FA 5A35A 1STYA 4LFBL 3JAMc 5M5XH 4YHHQ 2EY6A 1QNKA 4JI7L 2E2IB 3WOFA 3EVQA 4H7BA 1GXDC 4A3DH 5ELOA 3T4AC 3TRZA 1TWHB 4X64Q 3A55A 3DWAA 1HNWL 3SEBA 2O2LD 5CC4A 3J81i 4DR5L 5FK9C 2BH2A 4GKKL 5FLMG 1STEA 1TWFB 1VQCA 4KN4C 3PO3B 2ICIA 1QZHA 1E22A 5IE8A 3GTQH 3U4VA 4ALPA 3BJUA 1ET9A 4JBMA 3S1MB 1TY0A 1N33Q 2EYLA 1I94L 3H6MA 3Q6SA 4N9TA 1JE4A 3S14H 3KF8A 3D4RA 1Y69U 1F9PA 2L0CA 2RF4A 4B3TL 1S5DD 1B2TA 4ZYSA 4QCLA 3FKIH 3EJIA 3A0JA 1TY2A 4BA1I 3J7AV 1ESFA 5JVH3 1B1ZA 2PCFB 1Y1VG 5H1SE 1PH4A 2JA8G 3I4NH 1HJPA 2GN5A 3TP5A 4RCNA 2R61A 1S4ZA 2K5NA 1VQNA 5BR8L 4LFAL 1K0SA 4KHPQ 3LX0A 4A3LH 2NTTA 1SJHD 4K5VA 2X6GA 4GNXB 5LMNQ 1A2UA 2ICEC 1DM0B 3NUCA 1UAPA 3L9AX 1Z7TA 2BA0A 3Q0AA 2DJGC 1GUOA 5I6YA 5C44H 4DN4M 3A54A 5EKKA 1HNZQ 1BF4A 3I4MG 2RDFA 5D3DA 5M3MH 1G6PA 5C0XJ 3HOXB 1WD1A 1EY5A 1HZBA 1RODA 4TKOB 3KBXA 4QMGA 2K5VA 2K05A 4DK3C 5I9OA 3OIQA 4FF2A 1HFNA 1LM0A 2LKVA 3K0XA 2NVQB 4DFAA 1MIUA 4HMIA 4JG2A 3BU2A 2IX3A 3T1HL 5I4DA 1Q1BA 2UUCQ 1WD0A 1XNQQ 2QF7A 3J80L 3HOWG 4U673 3P75A 5ELNA 2KJXA 2K6AA 1YZ6A 1N34Q 2DJFC 1WTRA 3K5NA 2EXDA 1YJWA 4LNQA 3HOUH 5IWAL 4J1MA 4YIJA 2OWOA 3MWYW 2CQOA 4F88A 5IGBA 2Q8IB 1Y1WB 2HHHQ 2HIVA 1W6JA 1G91A 2H4OA 1LTTD 2F0WA 5EPKA 1I3QB 1SYDA 2UXDL 4QUCA 1PTOH 4GKKQ 1ENFA 3PUZA 5IP7G 1T5EA 1X55A 4UDUC 1YITA 1G8ZD 3TSSA 2Z6KC 4K8JA 5FO9B 2IHEA 5DLQE 4TQUS 1BR9A 1EY4A 3NWSA 4A76A 3PMFA 1R9TB 4X65Q 1P8LA 1A0IA 1EOVA 4XT3B 1D8LA 2B8GA 1SE2A 1IYUA 1NBWA 3PF5A 1CQVA 2M9VA 3FMCA 2RDGA 1CUKA 2NYZD 3L2PA 5J39A 4E6IA 3G6EA 3ND9A 1RL2A 5KYIA 3IFTA 1PH8A 3S17H 1SXTA 4DF7A 2P5ZX 2PW7A 4MN3A 2OEOA 3EN2A 3GTKH 2MJ8A 3CMEA 2B63G 2TSSA 1JC7A 5ELEA 1IBLL 1GUSA 3GTGH 2MQHA 1EIYB 4LF8L 1NR4A 2KENA 1QE6A 4R4CA 3MFGA 4X66Q 2DNCA 3Q23A 2ZJPA 4K0KL 4KD4A 4FXGC 4RKLA 4BY1G 1IL8A 3K5OA 4BXXH 4NXML 1VF7A 5K36G 4DUYL 1TQOA 1SBBB 4FF3A 1TU2B 2JEAI 1NTGA 4R1JA 4A3MG 3M7NA 5CV4A 2MGSA 3VDYA 2QCPX 4HCSA 1O7LA 3MXGA 3NEMA 2N8NA 5IYCG 4F87A 4A3GH 1HFGA 3RZDH 1UE6A 2BDOA 4KTAA 1Y8OB 1WYDA 2EVBA 3M4OB 1XNRL 5EAYA 4K6LA 4EX5A 2A69D 1EEID 1AZPA 4CDDC 4QUFA 3J81c 4HIDA 1BUVT 3GTJB 1EL0A 5EPJA 1A2TA 1QVGA 4A3FH 1HTPA 3MHBA 2QA4A 4N9PA 4IZ8A 3T1HQ 5FLXE 1YNNC 4A3IH 2SOBA 3WOEA 1SMYD 2DN8A 2WB1G 4UP9A 2KHIA 1EFID 3GV6A 4A3BG 1WOCA 3HP3A 2F0NA 3HOVB 2WINB 2SEBD 2B2VA 4TRDA 5EGTA 2IT1A 3T1YL 1HZAA 1S5BD 1IBMQ 5FO7B 2R7ZB 4JBJA 5FO8B 2VUMH 4K2LA 1PYSB 3NPPA 2JYOA 1L2FA 3I56A 2RBMA 3HFZB 2UXDQ 1HPCA 4BBSG 1YI2A 4XQJA 2F0OA 1JJ2A 2F0QA 1SNDA 4LW1A 2OF1A 5DNFA 2E8GA 5EQ0A 3BZDB 4OWXB 1M8AA 5IODA 3GTLH 4CKBA 2BE5D 3DM3A 3PQIA 3H3VI 4JI5L 2EY2A 5IT9c 4A3DG 2Q2UA 4BBSB 2HCCA 3CPWA 1F2LA 3KFUA 4KJOA 2E2IH 4Y7NH 3S16B 2Q8TA 1HNXL 3W2DA 3HGBA 1YJ9A 3KUPA 1EZ6A 2F0KA 4JI3L 4IUUA 4KK7A 1WTXA 1XMQL 1KIXA 3E9HA 3PIO3 1Z6HA 3I3CA 2XGTA 1QVFA 5JPNC 2PPBC 3RMHA 3AQQA 4C56C 2CWAA 1TWFH 2CWPA 1CSQA 5CYUA 1HXYD 1T9HA 3DXJC 2A6ED 3S1MH 1VQPA 2UU9Q 4LF8Q 3Q8DA 4GLXA 2ASBA 3CF5A 4FO2A 2E2HB 3FKIG 4K2KA 3TZDA 1STHA 3S9WA 3OW2A 2K5QA 2G9DA 2ZTDA 1X3GA 3PSIA 1D7QA 4QGUA 3X3MA 2B2UA 3I4NG 3ITPA 1QUQB 1V9PA 1I6VC 4OXPA 5J3BA 5HURA 3ERSX 4R8NA 2KHJA 1PH6A 2LXKA 3D6WA 4A3LG 4DV7L 1IYJB 2QEXA 2UXCL 4AQYQ 1XNRQ 1HHVA 2RHSB 3A7AB 4KMUC 2HQEA 4B08A 3M3YB 1NMGA 5KYLA 3R2IA 5LL6S 4LF5Q 1OXSC 1SN8A 4RG1A 3JC66 1FVIA 1A3VA 4NPSA 4K5WA 3RD4A 3DUZA 5M3MG 1VQ7A 3MZ5A 3S1NB 2L55A 1EIGA 1K28A 1DXMA 1PFNA 1W6KA 1N32L 5C44B 1EQVA 3I8ZA 2AWOA 2KHSA 2MUYA 2F0IA 2NZOA 5FKAC 1FD7D 3HOXH 5AFWA 1KLUD 1EQTA 4DAMA 1IKLA 5E4WC 5JPMC 1IKMA 1CKNA 1RTNA 2IHFA 1GVPA 2B29A 1CI3M 2FJ2A 5LHY1 1WCMH 4JI6L 3S24A 3PF4A 2NVQH 1F77A 3JAME 3J80i 5M5WH 2N78A 1C9OA 2IX1A 4A4IA 1KNAA 4JI5Q 3HOUG 2RCFA 1BOSA 2MPMA 2A5HA 5CGKA 4XQNA 2NUCA 1QNUA 5ISRA 1I4RA 3T51B 2AHOB 2PZUA 2AQ1B 3C3LA 4QQBX 2RQXA 1SYBA 3NBHA 1LTSD 1RKNA 1Y1WH 2DUDA 2Z0SA 1U5KA 4WRDA 1YIJA 2HCIA 3SGIA 1I3QH 4GN4B 2FMMA 3QO2A 3DLLA 4WJWA 1GHKA 1B8AA 3T13A 1WJJA 2B2VC 1IBKL 1KTKA 1Q1EA 4OIKA 1STBA 3P20A 2K04A 3VR2A 4OWWB 5C5MA 1PYBA 4CJ2C 2XSCA 2VL6A 2SNSA 3CC2A 3H09A 1PXUA 1R9TH 1MSHA 2Y0SB 4AYBG 4A93G 5C3EB 2F0PA 3R2TA 2ZJQA 3SK5A 3WDNA 4QF4A 3T53B 1EIHA 4KHZA 1OO9B 1AN8A 1H95A 1ONLA 2LFNA 1NAPA 4LUVA 5JJLA 2NVTB 4G4KA 4X3KA 1GUGA 4JI4L 5M5YB 2QILA 2F0TA 4LF6Q 4DV7Q 1STAA 4YY3L 1Z47A 2UXCQ 4ULLA 3RN5A 2UUBQ 4NKLA 4HIOA 4BXXG 1E1OA 1EEFD 1RIPA 2HT1A 2DY7A 4IOAA 4KHVA 1ZEQX 5I9PA 4FXKC 1Z9FA 4IQZA 1VQEA 2CFMA 4P2CB 4OO1H 2Q2IA 1Q86C 1V1OA 5CV9A 2JA5B 3ONAB 2ZTCA 2WP8J 4CHTB 3SK6A 4NDXA 1EYAA 4A3GG 1YHBA 5IYDH 1K3BC 1S40A 1S5CD 1Q12A 5T1GA 1STNA 3Q22A 3E5SA 1GOZA 2Z4IA 1L0WA 1XWEA 4HIKA 1RTOA 3NSWA 1KABA 1VQ6A 1LYLA 4A3FG 3KDFB 3HZXA 3M4OH 1PFSA 2B2UC 1NY4A 1VQDA 4A3IG 3GTJH 4JI6Q 4DR6L 1ET6A 2NVXB 3LWUA 5IY0A 1GUWA 3PIOA 4A3CH 4DA2A 1JORA 2WIIB 4BWGB 3D4WA 4NMZA 2NVYB 1SYEA 2KA7A 2L15A 4P71A 1PH5A 1XPUA 3H3VC 3IL8A 3A5UA 1V43A 2ZTEA 2VUMG 3CKIB 3VR3A 2Q2HA 3TP8A 1BCPC 2LMCB 4RMFA 5AJ3L 4HJ9A 2ZM6Q 1BBWA 5A2QE 2A73B 1J6QA 2R7ZH 2SDFA 1GM5A 2F3VA 3M4PA 3HKZE 1SNMA 3UDFA 4B3SQ 4DNRB 1X3EA 5C3WA 1HCZA 4A3JH 3UDXA 2RVLA 1IBKQ 4MNOA 4HJ7A 1PVOA 4LFCQ 1B3AA 1EZ8A 2B3GA 3OOCA 1QWYA 2JA6B 3H94A 1O80A 2L9HA 3S16H 4JC0A 1TVXA 1M90C 4Y7NB 2L11A 4P74A 2G9HD 1F9SA 1ZXTA 3PO3G 2EIFA 5IP9H 4KY6A 4M8AA 2E76C 3U9OA 3MVVA 1ENAA 4DAPA 4ZLTF 1HR0L 1BXTA 3BYYB 2F0DA 4JI0Q 4DKAC 1GUNA 4YY3Q 5BN5A 3M4QA 2E2HH 4YWMA 1SNPA 1NR2A 3CCEA 1UNSA 2AKWB 4DR2L 5EBDA 2V1CC 4DR1Q 1YNND 4GNXA 1QVCA 5I6WA 5EJWA 1VQGA 1KXLA 4RA8A 1KAWA 2VQFL 4C2MH 1LABA 1BNZA 3GTOB 1DJRD 2K5DA 3F2UA 3CMAA 1A3TA 4APVA 2B2TC 5JEAH 4DK1A 1V1QA 1WVLA 3CU7A 4PZ6A 2DGYA 3M4YA 1PA6A 3M3YH 4DV4Q 4XXEA 3QJYA 1F9RA 1Q8IA 3V96A 4DR4L 3VYSA 2EYFA 2J4XA 3SK4A 2YU9B 1VQBA 4HTHA 2D0PA 2NN6H 3S1NH 2G5DA 2X69A 3HOXG 3OTOL 1W2BA 4DNIA 4IUPA 1YVCA 4DR7Q 3CPFA 3G4SA 3QWNA 1SNCA 1D1KA 4JW0A 2UUAL 1VQIA 4P72A 4KY5A 2B8FA 1UE5A 4IOCA 4IJLA 1Y14B 5BN3A 1TKWB 4OO1I 3MEFA 4RFBA 2A8VA 1B44D 1SE3A 4IFDI 1J9OA 2Z4HA 4CKCA 2CW0D 2JP1A 2QDLA 3D6CA 4OGQC 3JAML 1WCMB 2NB0A 2E2JB 4XIGS 1YNXA 2LS01 1HQRD 5M3FB 5M5WB 3K0YA 4BS9A 3I72A 1E2ZA 1LT5D 1VQOA 1L1OB 4OX9Q 2RDHA 1Y1WG 3NTHA 4LFBQ 1EY0A 2B39A 4IPHA 4DR3L 4Y52H 1O7ZA 2JA7B 4JI7Q 4FXDA 3T16A 1ILQA 3GTPH 1X6OA 5CR3A 4GOPA 1JJCB 1HNWQ 1LTAD 1AE3A 5J22A 4DR5Q 1C0AA 4UP8A 5I2XA 4ZAIA 3SR1A 1HQMC 3A8JE 5M9OA 4ZK9B 4DV1L 3HKSA 3RLFA 1Q90A 1I50B 1FJGL 3H0GB 1DONA 2F4VL 1TR5A 4PZ8A 2R93B 4HCEA 2VW9A 2A68C 3OSOA 4OL7A 1EYCA 3CQZB 1I94Q 2F0FA 1OXUA 2I5HA 2OXPA 2ID0A 2ATWA 1YHAA 5C3EH 2K32A 3MEHA 4L6TB 1F2YA 4OONA 2DY8A 1YHQA 4LJZC 4B3TQ 3CP0A 1B70B 1PFMA 4H44C 2F4IA 4JOIA 3W3AA 4LK1C 4EGVA 1I6HH 3CCJA 2L5TA 4DAVA 4I7ZC 2K33A 2NVTH 2F1MA 5IGCA 5KNDA 5M5YH 3HG9A 3K5MA 3S1RH 1PFBA 1TXYA 3AEVA 1BBUA 4OO1G 1IYVA 5BR8Q 3NHHA 2CHBD 4LFAQ 4CDEC 4IFDG 4K5XA 4KLKA 3TMEA 3KJOA 1VMCA 1I4PA 1EY6A 5IYDG 1M1KC 3AFQA 1V8QA 2JA5H 1B9MA 3U4ZA 1WTPA 1SYFA 3OTOQ 1LACA 3G48A 3S1QH 2SNMA 5IGGA 5FJ8G 1RDPD 2WFWA 1SE8A 1SNOA 3OPOA 1CQFA 4FF1A 2VQEL 1SAPA 2WKCA 1QB5D 3OMGA 3L3OC 2R92H 5IIFA 2J0TD 5CV8A 4A3CG 1X3QA 1AE2A 4ID6A 4PMCA 5JJKA 4V0BA 2NVXH 4KD3A 3NBIA 1CA5A 4LF4L 1XXGA 2O5JC 4KN7C 5CMDA 4PMWA 3IAYA 3HOVG 2KBNA 1X65A 4EQ5A 4OEMB 3MC0B 2VY3A 4K14A 2NVYH 1FNWA 1RHPA 1VQFA 4HSVA 4UPAA 3D4DA 1YNJC 1XJVA 1K8MA 3CCLA 2R7ZG 1E1TA 1TWAB 1EY7A 1UE7A 1QCBD 4Q0FA 1N9WA 4B3ML 5A2QL 4L8JA 5IWAQ 3TZUA 2AWNA 3I90A 1JOOA 4C3HH 5IGFA 3I73A 5LMUL 3OHXC 2KECA 1I4XA 4FF4A 1P16A 3OWFA 2FHTA 5E4XA 5TSSA 3STBC 1JR0D 2PNHA 1X3PA 4R4QA 5GAGC 2MFIA 4A3JB 1XPOA 4DV1Q 4PZ7A 1CFMA 3BVZA 5CV6A 1JQYD 1NJIC 2XWBB 1NCVA 2WAQB 3M7GA 3GV3A 1EUJA 1UWVA 1JWUD 4JI8L 2JA6H 2CKZB 1CT1D 2XNAC 3J7YW 4ZCKA 2FFKB 4POFA 1EWCA 2BOSA 4H0LC 3SVMA 3BVMA 1VQJA 3BYTB 2VXWA 2O4XA 4OWTB 4HJ5A 4MZ9A 4PV1C 3GO5A 1ICWA 2Q2TA 4YCWA 3KOJA 1SYCA 3FEWX 1XTDA 4DUZL 4JYAL 3LNNA 2EJMA 1XX8A 1GKHA 4GOPC 2K5HA 1EQRA 1DGSA 1PZJD 2L1BA 1IBLQ 4IFDJ 4UAIA 3QIAA 1VQ4A 1D6EC 3CAMA 5C3XA 3OIPA 4LWCA 5NUCA 3RNUA 1C7YA 4KKTA 3BZKA 3F2CA 3TP7A 3S2DB 4K0KQ 2WAQE 2PZTA 2VB2X 3KYHC 1SFOH 3TS2A 1R4QB 4NXMQ 4QJFA 2ZJRA 4DUYQ 2EYMA 3GTOH 2CH4W 3M9BA 4C2MB 1H9KA 3VYTA 4BBRB 4CKEA 1JE5A 1KDAA 4J6HA 1SE4A 3PV0A 1BCPF 1PHJA 1L0XB 1BCPD 2K1BA 4ME5A 4GKJL 1D5XC 4RAUC 4ZRZA 5JJZA 1WTQA 4G7ZC 2NN6G 4JOIC 2VZAA 1V1PB 4IPDA 5C44G 3CRLC 3BVGA 3MAQA 4IPGA 4IUTA 1U0LA 1YEZA 4YWKA 2CCZA 1K8OA 4LF4Q 2YU9H 5KIXA 2LY7A 3RUZA 3H15A 3W5OA 4A3EB 4C3JB 1QZGA 2AUKA 1CKMA 3L0OA 1UEBA 4DV6L 3BS1A 4POGA 2VNUD 5KNCA 3FRPB 4R4TA 2JEBI 1S5FD 2JA8H 4DV2L 3JAMi 2I5MX 1KRSA 3T1YQ 1HH2P 3TQYA 3DM1A 1VS0A 2L4NA 5IT9L 3E0JA 3ICEA 2E2JH 2WV6D 5M3FH 3CW2C 4FNFA 3FPPA 3S2HB 3TREA 1D5ZC 1FL0A 4DV0L 1KD1C 4A3KB 1U9RA 2BDNA 2QEJC 3B6YA 3Q24A 1B3QA 4FDBA 2R3ZA 1GO3E 3K7AB 3MFYA 3IRBA 1X3FA 3PUVA 1JOQA 4UP7A 1G51A 4LF7L 1VQ8A 2JA7H 2JSOA 1HZ9A 2HDMA 1SMXA 1HNXQ 1BCPB 2OCEA 1WTVA 2IX0A 4EQNA 4DV3L 2ZXRA 4IUQA 3G7LA 4X62L 4HJ8A 3A8KE 4JI3Q 3GTPB 1XMQQ 3HOZB 2F0MA 3RZOB 5KGUA 4DK0A 2OT2A 3MA2B 3AMUA 1H9JA 1K8GA 1PYWD 4JI1L 1I50H 2Y0SG 3MXUA 3K59A 3H0GH 4DAYA 5C3EG 1EYGA 5EPLA 1CKNB 5FLXc 3I7FA 3V2TA 2R7DA 3NK9A 3PO2B 2NBFA 1QG7A 3CCMA 1PLFA 2R93H 2A19A 2EYJA 2WKDA 1G291 3G71A 2NZ1D 3CQZH 1AP0A 1LV9A 2JXMB 3FHWA 2KOLA 1PRTC 2A6HC 1CHPD 1GD7A 1SSOA 1VQHA 1Q82C 2PNRC 2F3WA 3F2DA 2A74C 3UDIA 4R8IA 3D8GA 5K5PA 1I6HB 2FINB 4KKUA 1D2BA 1BKBA 1ZKOA 3PUYA 5D3IB 1PH7A 2KQ3A 2OQKA 1JMCA 3NBHB 4NP5A 2GVBA 4YHHL 3S1RB 2EJGC 3PUXA 2PQAB 2JA5G 2FMCA 2F0GA 4IUVA 2IWHA 3KDFA 3SE0A 4M1UB 2GVAA 5EKLA 4X64L 1CM9A 4RCOA 4QIWB 5EKIA 3J7ZC 4H13C 4GLAC 4IPCA 4IUNA 2D62A 3J81j 4DV6Q 1TT2A 2K75A 2EY1A 1N32Q 4AIMA 2IY5B 2OTLA 3S1QB 2RCNA 1MI2A 1FGUA 1ZYRC 2YTXA 3HKZB 2R92G 3E3XA 1Q8KA 4MHEA 1SRUA 1MJCA 1N33L 3KF6A 4P73A 5IOCA 3I55A 4XT1B 3HOYB 5D65A 3ER0A 1LTID 4HJAA 1PV4A 1PMRA 2R92B 2ES2A 2IL8A 2MHVA 2JK8A 1AW7A 2K03A 1BBXC 1STGA 3EROA 1A62A 2E74C 4DV0Q 2O5IC 1C4QA 1OTCA 5CBEE 4BY1H 2Z6BA 3UI2A 3M85A 2KCMA 3G6JB 4TSSA 2RKSA 2A68D 1TWAH 2EYPA 4LF7Q 3K8AA 2K5WA 4QIWE 4QY7A 3GTMB 1GJXA 1CZGA 1E2WA 2XWJB 1H9SB 3MXNB 1OXTA 1L0YB 4C3IB 2JA9A 1I4GA 5LMNL 1F2ZA 3BDCA 3SK8A 1I5FA 2H1EA 1X54A 4WJ4A 2MP1A 4C3HB 2F3IA 2F0UA 1D1IA 4OHJA 1A6XA 2EYOA 2JA6G 1HNZL 3KLSA 4NXNL 3ZYYX 1KDBA 3A5ZB 3KLSX 4I65A 2E5LL 4HMJA 1R4PB 5KNBA 2D5DA 3X3NA 1FR3A 5ELFA 3CRKC 2B2YA 1K8AC 1PZID 3AB9A 1ILPA 2MNAA 1BQQT 1B7YB 2M2LA 2ZT9C 4UY8C 3AFPA 3R3OA 2CVRA 3HS0C 1HR0W 4KI0A 3D3RA 2GA4B 1X32A 3D31A 1PTOC 2ALYB 2BH8A 2F0VA 4BY7B 2HQLA 3MTSA 1HZCA 1EYDA 2NZHA 1SJED 3CD6A 2UUCL 1VQ5A 1Y8NB 5ELCA 4XDXA 5COYA 3U9SA 4DNTB 2RHQB 4JI4Q 1SR3A 1N34L 2CQAA 4RHSA 1SEBD 4HN7A 1M4VA 3CXCA 3MXPA 1VQAA 3QOLA 4RH6A 1EOTA 4HSPA 2PMZB 1Y8PB 4O42A 3UE0A 3J80c 1PZKD 2HHHL 1LT6D 4J8QA 3S2DH 3GQBA 3EBEA 2B2WA 2I5LX 2XRQD 2JN4A 2KEDA 3GP7A 1LT4D 1SFOB 1YNJD 4BBRH 1VCIA 3AYHB 2AQ3B 5EBCA 3K5LA 3PUWA 1IW7C 3I2ZA 3J81E 4O1NA 4KY7A 4WFN3 3BDOA 1YJNA 1WTHA 4X65L 4EQPA 3R93A 1JICA 2R6GA 1S72A 3WWVA 4DR6Q 3STBD 4A3EH 1G2SA 2TMPA 4C3JH 2MO0A 4GLVB 3BDLA 2QW7A 3BG3A 4DU9A 3KLWA 2PMZE 4PQXA 1PH2A 3K58A 1X56A 3I4OA 4RGNA 2D2CC 1CZWA 2I07B 4RHRA 1L1OA 4X3UA 5C4JB 2OQ0A 3KF8B 1Y1VB 1WCMG 2XN9C 4JBWA 1XTCD 1SROA 1RCVD 5AJ3Q 1JT8A 2JA8B 1JB7A 1XPRA 5M3FG 5GAEC 4F8MA 4X66L 3EFXD 3GDEA 2Z8LA 5E1FA 5C6AA 2V4DA 4L5RC 3DWQA 1B50A 2A1AA 5IT9E 3S2HH 3I4LA 1HUNA 1VDZA 2N49A 2F0JA 4NXNQ 4ZUIA 3EIVA 1CKOA 1KAAA 1T5XD 2QKIC 4GN5A 4A3KH 2JA7G 1MJEA 2IPKD 3EQLC 2E5LQ 1H9MA 5JOBA 3K7AH 1VF5C 4B9XA 2ENBA 4JVZA 5L37A 3H3VH 2D0OA 3KK7A 4ODGA 3J7AF 1IHZA 3I4MB 1C48A 2YTYA 1KQSA 1HTLD 4KV6A 4JK1C 1F2MA 2R7FA 3I91A 2KUMA 1HA6A 4RGMA 3HOZH 3RZOH 1B9NA 1W3SA 3ULLA 3H0GG 1VQ9A 1QOHA 5J1ZA 5CV5A 2MO1A 1HR0Q 4CJ0B 5HGQA 2R93G 1IXRA 1MGSA 1EWIA 2KEEA 4MTNA 1WTWA 1DD2A 1AFPA 1FNVA 4ABNA 3A74A 4N8X1 3PO2H 3BZCA 3DEPA 3A8IE 4I7AA 4RGTA 5BN4A 4B3RL 1E0BA 3HOWB 1IBML 5DM73 4EVOA 4HR7B 2F52A 3DWPA 3L7ZC 4DR2Q 1NNXA 1F9QA 4NW2A 4CDCC 1N36L 3KBGA 1VQKA 1I4HA 3I70A 3OWEB 3QB3A 5IGEA 4IURA 2VQFQ 2PI2A 2K7VA 2B2YC 1BO0A 4IN3A 1ENCA 1H9RA 4WJ3M 4GZYC 3SXHA 1O7YA 4IJHA 1OXXK 1J5EL 1WI5A 2I46A 3F1ZA 5IYBH 2BCOA 3IKJA 4YCUA 1GHJA 1NMFA 4GOPB 2EY5A 1X9NA 1NUCA 1EY8A 3CHBD 2F0HA 2EPBA 2N55A 5GAHC 3NTKA 3PIPA 4DR4Q 3F2BA 4A93H 1AH9A 2VB3X 4XYQA 1LTRD 4JCVE 4L5TA 1PH1A 3C1FA 1FGBD 5C4XH 3PCOB 4G7OC 3KLRA 2EJFC 2UU9L 2UUAQ 4ME3A 3RLNA 1I4QA 1LTGD 2B2WC 3OMCA 3RLOA 1DZ1A 3HOYH 3ERQA 2XIWA 2H5XA 4GNXC 1JOKA 2B63B 1Q81C 1CTMA 2QGQA 1U4LA 1VQLA 3R8BA 1TWGB 2XRSD 1IL2A 1UUPA 2Z9HA 5CORA 3NWTA 5HY6A 2C9OA 1TS5A 3A7LA 3ND8A 2F0SA 4BY1B 3QOJA 4ZKBB 5JAVA 2KCNA 4KKSA 3NQIA 4CDFC 3TN2A 1LTBD 4QL5A 3GTMH 4GS3A 4DR3Q 4AQYL 4A3MB 4BA2I 3AU7A 1IZ6A 2K4KA 1PRTF 2OTJA 1PRTD 2A6HD 4C3IH 4L5SA 4LF5L 4A3JG 4X6AH 2NN6I 2YV5A 3CCRA 1K83B 4DPGA 2LSSA 2WAQG 1TIID 2K01A 4JBKA 1L1OC 1C8CA 2JJQA 4IO9A 2AMCB 3H91A 1K3RA 3HRZC 2PI2E 1WTOA 4C1NI 3E6ZX 1FJGQ 2K50A 2F4VQ 4F7XA 4HEDA 2AQ2B 3NTIA 4B3RQ 2WB1B 1II3A 1EIFA 3DMUA 3LGJA 1G6ZA 1LLRD 2Z1CA 1K9MC 2PO4A 5LL6X 4A3BB 5IP9G 4PG3A 3CCSA 4R4IA 2EDGA 1D5MC 3T56B 1TWCB 4JPBW 3K7UC 1N36Q 5C0XH 3VR5A 1UEAB 4X3SA 2EE1A 4BY7H 4A75A 1EWHA 2DNEA 1EY9A 4PMBA 5IGDA 1EU3A 5F2DA 1ZYRD 4Z9CB 2HDLA 3FP9A 3S15B 2EQSA 1QUQA 1BDOA 1U4MA 4R4OA 2RSNA 4HIMA 1AEXA 1J5EQ 3DEOA 5M5XB 3W1GA 3UE1A 3F8TA 3QG1A 4UHVA 3CC7A 1TWHH 2EOTA 3N52A 4A3DB 1JJGA 4YWLA 5C4HA 4BBRG 2CW0C 4DXFA 1V1PA 1XYIA 1PRTB 1WFQA 1KLGD 4AH6A 1B53A 2WB1E 3EA6A 1QJOA 4LMQD 5JEAG 1VMPA 1QILA 4J15A 5GADC 1XMOL 1EFWA 3PO3H 1E3PA 2ZXPA 3RN2A 5ELDA 4EQOA 3J81L 3GTQB 3FPUB 3N6RA 1DOLA 1MSGA 2C35B 3DHQA 5FLMH 1ASYA 3C46A 3SDZA 1UE1A 2YYZA 4TVAB 2VQEQ 4G7HC 1HA5A 3VR6A 1MD2D 3S14B 4A3EG 4C3JG 4LUOA 2XTIA 3NE5B 5DAUA 3TP6A 2PQEA 4RWSC 1HUMA 3URYA 4LAAA 1TS3A 3FKIB 3VA7A 1NSNS 1HRJA 1Q3LA 1KL9A 3PGZA 1BVSA 3LWEA 1E24A 3P1HA 3D0FA 5GQOA 3C1EA 4LF6L 3I4NB 3ULJA 1VQMA 2BA1A 5C4JH 2UXBL 2UUBL 1Y1VH 1DOMA 3A56A 4B3MQ 3SHLA 4FVMA 3NQTA 4O0AA 3NENA 1PTOF 1JCKB 1PTOD 1LT3D 4DXGA 4A3KG 1G2TA 1SYGA 3K81C 5LMUQ 2HIXA 1U4RA 3UDGA 2VS1A 1E2VA 5CBAE 2NWGA 1Q46A 3TBIB 4CGYB 1KC8C 1JWSD 3C2PA 3CCVA 1JB3A 3E0EA 4ZQ3A 4X3TA 4DGZA 5M3MB 3GD7A 2NTSA 4JI8Q 5I2YA 2K14A 3K6OA 3HOZG 3I4MH 2EZVA 4DV5L 1MKHA 1ICFB 1PH3A 2RSOA 5DM63 2RA4A 1ESRA 3K80C 3CCQA 1A15A 4LF9L 1A8VA 1LUZA 3TEHB 1N8RC 1LTLA 2N88A 1KNEA 2C5CA 3KJPA 5HGTA 4OIJA 5JJIA 4XTCS 3PO2G 1A3UA 1IW7D 1RJTA 2IW3A 4DUZQ 4JYAQ 3J80E 3HEJA 4Q5VA 2KCTA 1Q7YC 2XVSA 1PH9A 2F0EA 4YCVA 3QR8A 2I0QA 1SDFA 2KCCA 2ZM6L 2FXQA 3HOWH 1CA6A 3E9IA 5T1IA 3HOUB 1S3OA 4FYDA 1O78A 2PQAA 4CJ1B 4JI2L 4B3SL 2A69C 4KJNA 3U58A 5JEAJ
chains in the Genus database with same CATH topology
3VR4A 1PTOB 5CV7A 3VYUA 1RD9D 1SMYC 2Q8RE 1DOKA 1SNQA 3OW7A 2ZXOA 4K8IA 3TDQA 4PNYA 1JWMD 3IFDA 5C4ZA 2B2TA 5C0XI 2F03A 5KEEA 1OXVA 3FVQA 4S3SA 2WACA 4K6DA 2QDBA 1J8IA 4RGOS 2X6LA 4AYBB 4A93B 3P7JA 2HUGA 1DCZA 4V190 4CBVA 3S17B 5C4XB 3GTKB 2BE5C 4XQQA 5KRUA 3GTGB 4ZUJA 1U4PA 5ELBA 4U68A 5G3LF 5G3LD 1AZQA 1S5ED 1EU4A 2PZWA 1H9SA 3MXNA 2EYHA 4L63B 5JVG3 2D9UA 1KDCA 5D14A 4ZKCB 4IFDH 4G57A 2J7ZA 1CHQD 3O13A 3FDTA 4RKBA 2JE6I 1RF2D 1MBYA 4C3IG 5K36H 5DEHA 4IALA 4A3GB 1FNUA 3RZDB 2A6EC 3NXWA 4C3HG 3V05A 1DYQA 1TS2A 2EXZA 2PYKA 4FP5D 4A3FB 5FLXL 3PIP3 1CK1A 1B4OA 4QB4A 2K28A 3K57A 4A3IB 3NP8A 1LO5D 1ML0D 4WORA 2L12A 2F0LA 3VYRA 4C1NK 4HAEA 2PW5A 4R9WA 5C0XG 2AUJD 1PDQA 1TS4A 4B9WA 1GUTA 2E75C 2KVMA 5C5LA 2VUMB 2IJ0A 3VA5A 4ILWA 4MIUA 1FYCA 2E2DC 2M00A 4XYOA 3GTLB 5FOBB 5E3FA 5A35A 1STYA 2EY6A 1QNKA 2E2IB 3WOFA 3EVQA 4H7BA 1GXDC 3T4AC 1TWHB 3A55A 3DWAA 3SEBA 2O2LD 5CC4A 5FK9C 1STEA 1TWFB 4KN4C 3PO3B 2ICIA 1ET9A 3S1MB 1TY0A 2EYLA 3H6MA 3Q6SA 4N9TA 1JE4A 3KF8A 3D4RA 1Y69U 1F9PA 2L0CA 1S5DD 1B2TA 4ZYSA 4QCLA 3EJIA 1TY2A 4BA1I 3J7AV 1ESFA 5JVH3 1B1ZA 2PCFB 3TP5A 4RCNA 2R61A 1S4ZA 3LX0A 2NTTA 1SJHD 4K5VA 2X6GA 1A2UA 2ICEC 1DM0B 1UAPA 3NUCA 3L9AX 1Z7TA 2BA0A 3Q0AA 1GUOA 5I6YA 4DN4M 3A54A 5EKKA 1BF4A 2RDFA 5D3DA 5C0XJ 3HOXB 1WD1A 1EY5A 1RODA 4TKOB 3KBXA 4QMGA 2K05A 5I9OA 3OIQA 4FF2A 1HFNA 2LKVA 2NVQB 4DFAA 4HMIA 2IX3A 5I4DA 1Q1BA 1WD0A 2QF7A 3J80L 4U673 3P75A 2KJXA 2K6AA 1WTRA 3K5NA 4J1MA 4YIJA 3MWYW 4F88A 5IGBA 2Q8IB 1Y1WB 1W6JA 1G91A 2H4OA 1LTTD 2F0WA 5EPKA 1I3QB 1SYDA 4QUCA 1PTOH 1ENFA 3PUZA 1T5EA 4UDUC 1G8ZD 3TSSA 5FO9B 4K8JA 4TQUS 1BR9A 1EY4A 3NWSA 3PMFA 1R9TB 4XT3B 2B8GA 1SE2A 1IYUA 1CQVA 2M9VA 3FMCA 2RDGA 2NYZD 5J39A 4E6IA 3ND9A 5KYIA 3IFTA 1SXTA 4DF7A 2PW7A 4MN3A 2OEOA 2MJ8A 2TSSA 1JC7A 5ELEA 1GUSA 1NR4A 1QE6A 3MFGA 3Q23A 2DNCA 4KD4A 4FXGC 4RKLA 1IL8A 3K5OA 1VF7A 5K36G 1TQOA 1SBBB 4FF3A 1TU2B 2JEAI 3M7NA 5CV4A 2MGSA 2QCPX 4HCSA 1O7LA 3MXGA 4F87A 1HFGA 2BDOA 4KTAA 1Y8OB 2EVBA 3M4OB 4K6LA 1AZPA 2A69D 1EEID 4QUFA 1EL0A 3GTJB 1BUVT 5EPJA 1A2TA 1HTPA 3MHBA 4N9PA 4IZ8A 5FLXE 1YNNC 2SOBA 3WOEA 1SMYD 2DN8A 1EFID 3GV6A 3HP3A 2F0NA 3HOVB 2WINB 2SEBD 2B2VA 4TRDA 5EGTA 2IT1A 1S5BD 5FO7B 2R7ZB 5FO8B 4K2LA 3NPPA 2JYOA 2RBMA 1HPCA 4XQJA 2F0OA 2F0QA 1SNDA 2OF1A 5DNFA 5EQ0A 3BZDB 5IODA 1M8AA 4CKBA 2BE5D 2EY2A 4BBSB 2HCCA 1F2LA 4KJOA 3S16B 2Q8TA 3W2DA 3HGBA 3KUPA 1EZ6A 2F0KA 4IUUA 4KK7A 1WTXA 3PIO3 1Z6HA 3I3CA 5JPNC 2PPBC 3RMHA 4C56C 5CYUA 1HXYD 3DXJC 2A6ED 4FO2A 2E2HB 4K2KA 3TZDA 1STHA 3S9WA 2K5QA 2G9DA 3X3MA 2B2UA 3ITPA 1I6VC 5HURA 4R8NA 3D6WA 1HHVA 3A7AB 4KMUC 2HQEA 4B08A 3M3YB 5KYLA 3R2IA 5LL6S 1OXSC 1A3VA 4K5WA 3RD4A 3DUZA 3MZ5A 3S1NB 2L55A 1EIGA 1DXMA 1PFNA 1W6KA 5C44B 1EQVA 3I8ZA 2AWOA 2KHSA 2MUYA 2F0IA 5FKAC 1FD7D 5AFWA 1KLUD 1EQTA 1IKLA 5E4WC 5JPMC 1IKMA 1RTNA 1CI3M 2FJ2A 5LHY1 1F77A 3JAME 2IX1A 1KNAA 1BOSA 2MPMA 2A5HA 5CGKA 4XQNA 2NUCA 1QNUA 5ISRA 1I4RA 3T51B 2PZUA 2AQ1B 3C3LA 2RQXA 1SYBA 3NBHA 1LTSD 1RKNA 4WRDA 2HCIA 2FMMA 3QO2A 4WJWA 1GHKA 3T13A 2B2VC 1KTKA 1Q1EA 4OIKA 1STBA 3P20A 2K04A 3VR2A 5C5MA 4CJ2C 2XSCA 2SNSA 3H09A 1PXUA 1MSHA 2Y0SB 5C3EB 2F0PA 3R2TA 3SK5A 3WDNA 4QF4A 3T53B 1EIHA 4KHZA 1OO9B 1AN8A 1ONLA 2LFNA 1NAPA 2NVTB 4G4KA 4X3KA 1GUGA 5M5YB 2QILA 2F0TA 1STAA 1Z47A 4ULLA 4NKLA 1EEFD 2DY7A 4KHVA 1ZEQX 5I9PA 4FXKC 4IQZA 4P2CB 4OO1H 1V1OA 5CV9A 2JA5B 3ONAB 2WP8J 4CHTB 3SK6A 4NDXA 1EYAA 1S5CD 1Q12A 5T1GA 1STNA 3Q22A 3E5SA 1GOZA 2Z4IA 1XWEA 1RTOA 3NSWA 1KABA 3HZXA 2B2UC 1ET6A 2NVXB 3LWUA 1GUWA 4DA2A 1JORA 2WIIB 4BWGB 3D4WA 4NMZA 2NVYB 1SYEA 2KA7A 3H3VC 3IL8A 1V43A 3CKIB 3VR3A 3TP8A 1BCPC 2LMCB 5A2QE 2A73B 2SDFA 2F3VA 1SNMA 4DNRB 5C3WA 1HCZA 2RVLA 1B3AA 1EZ8A 3OOCA 1QWYA 2JA6B 3H94A 1O80A 2L9HA 1TVXA 4Y7NB 2L11A 2G9HD 1F9SA 1ZXTA 4KY6A 4M8AA 2E76C 3U9OA 3MVVA 1ENAA 4DAPA 4ZLTF 1BXTA 3BYYB 2F0DA 1GUNA 5BN5A 1SNPA 1NR2A 1UNSA 5EBDA 1YNND 5I6WA 5EJWA 4RA8A 1LABA 1BNZA 3GTOB 1DJRD 2K5DA 3F2UA 1A3TA 2B2TC 5JEAH 4DK1A 1WVLA 3CU7A 3M4YA 4XXEA 3QJYA 1F9RA 1Q8IA 3V96A 3VYSA 2EYFA 2J4XA 3SK4A 2YU9B 4HTHA 2NN6H 2X69A 4IUPA 3QWNA 1SNCA 1D1KA 4KY5A 2B8FA 5BN3A 1TKWB 4OO1I 4RFBA 1B44D 1SE3A 4IFDI 1J9OA 2Z4HA 4CKCA 2CW0D 2JP1A 3D6CA 4OGQC 3JAML 1WCMB 2NB0A 2E2JB 4XIGS 2LS01 1HQRD 5M3FB 5M5WB 3K0YA 4BS9A 3I72A 1E2ZA 1LT5D 2RDHA 3NTHA 1EY0A 2B39A 1O7ZA 2JA7B 4FXDA 3T16A 1ILQA 5CR3A 1LTAD 5J22A 5I2XA 4ZAIA 3SR1A 1HQMC 3A8JE 5M9OA 4ZK9B 3RLFA 1Q90A 1I50B 3H0GB 1DONA 1TR5A 2R93B 4HCEA 2A68C 3OSOA 4OL7A 1EYCA 3CQZB 2F0FA 1OXUA 2OXPA 2ID0A 2K32A 3MEHA 4L6TB 1F2YA 2DY8A 4LJZC 1PFMA 4H44C 2F4IA 4LK1C 3W3AA 4EGVA 2L5TA 4DAVA 4I7ZC 2K33A 2F1MA 5IGCA 5KNDA 3HG9A 3K5MA 1PFBA 4OO1G 1IYVA 3NHHA 2CHBD 4IFDG 4K5XA 3TMEA 1VMCA 1I4PA 1EY6A 1V8QA 1B9MA 1WTPA 1SYFA 1LACA 2SNMA 5IGGA 1RDPD 1SNOA 3OPOA 1CQFA 4FF1A 1SAPA 2WKCA 1QB5D 3OMGA 3L3OC 5IIFA 2J0TD 5CV8A 1X3QA 4ID6A 4PMCA 4V0BA 4KD3A 3NBIA 1CA5A 1XXGA 2O5JC 4KN7C 5CMDA 4PMWA 3IAYA 3MC0B 4K14A 1FNWA 1RHPA 4HSVA 3D4DA 1YNJC 1K8MA 1TWAB 1EY7A 1QCBD 4Q0FA 5A2QL 4L8JA 3TZUA 2AWNA 3I90A 1JOOA 5IGFA 3I73A 3OHXC 2KECA 1I4XA 4FF4A 3OWFA 5E4XA 2FHTA 5TSSA 1JR0D 1X3PA 4A3JB 1CFMA 3BVZA 5CV6A 1JQYD 2XWBB 1NCVA 2WAQB 3M7GA 3GV3A 1JWUD 1CT1D 2XNAC 3J7YW 2FFKB 1EWCA 2BOSA 4H0LC 3SVMA 3BVMA 3BYTB 2VXWA 2O4XA 4PV1C 3GO5A 1ICWA 1SYCA 3FEWX 3LNNA 2EJMA 1XX8A 1PZJD 2L1BA 4IFDJ 4UAIA 3QIAA 1D6EC 5C3XA 3OIPA 5NUCA 4KKTA 3TP7A 3S2DB 2PZTA 2VB2X 1R4QB 2EYMA 4C2MB 1H9KA 3VYTA 4BBRB 4CKEA 1KDAA 4J6HA 1SE4A 3PV0A 1BCPF 1L0XB 1BCPD 2K1BA 4ME5A 1D5XC 4RAUC 4ZRZA 5JJZA 1WTQA 4G7ZC 2NN6G 1V1PB 3CRLC 3BVGA 3MAQA 4IUTA 1K8OA 5KIXA 2LY7A 3RUZA 4A3EB 4C3JB 2AUKA 3BS1A 2VNUD 5KNCA 3FRPB 2JEBI 1S5FD 3DM1A 2L4NA 5IT9L 3E0JA 2WV6D 4FNFA 3S2HB 3FPPA 1D5ZC 4A3KB 1U9RA 2BDNA 2QEJC 3Q24A 2R3ZA 3K7AB 3MFYA 3PUVA 1JOQA 2JSOA 2HDMA 1BCPB 1WTVA 2IX0A 4EQNA 2ZXRA 4IUQA 3G7LA 3A8KE 3GTPB 3HOZB 2F0MA 3RZOB 5KGUA 4DK0A 2OT2A 3MA2B 3AMUA 1H9JA 1PYWD 3MXUA 3K59A 4DAYA 5EPLA 3V2TA 3NK9A 3PO2B 2NBFA 1QG7A 1PLFA 2EYJA 2WKDA 1G291 2NZ1D 1AP0A 1LV9A 2JXMB 2KOLA 1PRTC 2A6HC 1CHPD 1SSOA 2PNRC 2F3WA 2A74C 4R8IA 3D8GA 5K5PA 1I6HB 2FINB 4KKUA 1D2BA 1ZKOA 3PUYA 5D3IB 2KQ3A 4NP5A 3S1RB 2EJGC 3PUXA 2FMCA 2F0GA 4IUVA 2IWHA 3SE0A 4M1UB 5EKLA 1CM9A 4RCOA 4QIWB 5EKIA 4H13C 4IUNA 2D62A 1TT2A 2EY1A 3S1QB 1MI2A 1ZYRC 3HKZB 4MHEA 5IOCA 4XT1B 3HOYB 5D65A 1LTID 1PMRA 2R92B 2IL8A 2MHVA 1AW7A 2K03A 1BBXC 1STGA 3EROA 2E74C 2O5IC 1C4QA 5CBEE 3UI2A 3M85A 3G6JB 4TSSA 2RKSA 2A68D 2EYPA 2K5WA 1GJXA 3GTMB 1CZGA 1E2WA 2XWJB 1H9SB 1OXTA 1L0YB 4C3IB 1I4GA 1F2ZA 3BDCA 3SK8A 2H1EA 2MP1A 4C3HB 2F0UA 1D1IA 4OHJA 1A6XA 2EYOA 3KLSA 3ZYYX 1KDBA 3KLSX 4I65A 4HMJA 1R4PB 5KNBA 2D5DA 3X3NA 1FR3A 5ELFA 3CRKC 2B2YA 1ILPA 1PZID 3AB9A 1BQQT 2M2LA 2ZT9C 3R3OA 2CVRA 3HS0C 4KI0A 3D3RA 2GA4B 1X32A 3D31A 1PTOC 2F0VA 4BY7B 3MTSA 1EYDA 1SJED 1Y8NB 5ELCA 5COYA 4XDXA 3U9SA 4DNTB 2CQAA 4RHSA 1SEBD 4HN7A 1M4VA 3MXPA 3QOLA 4RH6A 1EOTA 4HSPA 2PMZB 1Y8PB 4O42A 1PZKD 1LT6D 4J8QA 3GQBA 2B2WA 2XRQD 2KEDA 3GP7A 1LT4D 1SFOB 1YNJD 1VCIA 3K5LA 2AQ3B 5EBCA 3PUWA 1IW7C 3J81E 4O1NA 4KY7A 4WFN3 3BDOA 4EQPA 3R93A 1JICA 2R6GA 1G2SA 2TMPA 3BDLA 3BG3A 4DU9A 4PQXA 3K58A 4RGNA 2D2CC 1CZWA 2I07B 4RHRA 4X3UA 5C4JB 1Y1VB 2XN9C 4JBWA 1XTCD 1RCVD 2JA8B 4F8MA 3EFXD 2Z8LA 5E1FA 5C6AA 2V4DA 3DWQA 1B50A 5IT9E 3I4LA 1HUNA 1VDZA 2F0JA 4ZUIA 1T5XD 1KAAA 2QKIC 2IPKD 3EQLC 1H9MA 5JOBA 1VF5C 4B9XA 2ENBA 3KK7A 4ODGA 3J7AF 1IHZA 3I4MB 1C48A 1HTLD 4KV6A 4JK1C 1F2MA 3I91A 2KUMA 1HA6A 4RGMA 1B9NA 1QOHA 5J1ZA 5CV5A 4CJ0B 1MGSA 2KEEA 1WTWA 1DD2A 1AFPA 1FNVA 4ABNA 3DEPA 3A8IE 4RGTA 5BN4A 1E0BA 3HOWB 5DM73 4EVOA 4HR7B 3DWPA 3L7ZC 1F9QA 4NW2A 3KBGA 1I4HA 3I70A 3OWEB 3QB3A 5IGEA 4IURA 2K7VA 2B2YC 1BO0A 4IN3A 1ENCA 1H9RA 4GZYC 3SXHA 1O7YA 1OXXK 2I46A 2BCOA 3IKJA 1GHJA 2EY5A 1NUCA 1EY8A 3CHBD 2F0HA 2EPBA 2N55A 3NTKA 2VB3X 4XYQA 1LTRD 3C1FA 1FGBD 4G7OC 3KLRA 2EJFC 1I4QA 1LTGD 2B2WC 3OMCA 1DZ1A 3ERQA 2XIWA 1JOKA 2B63B 1CTMA 1U4LA 3R8BA 1TWGB 2XRSD 1UUPA 5CORA 3NWTA 2C9OA 1TS5A 3A7LA 3ND8A 2F0SA 4BY1B 3QOJA 4ZKBB 5JAVA 2KCNA 4KKSA 3NQIA 3TN2A 1LTBD 4A3MB 4BA2I 3AU7A 1PRTF 1PRTD 2A6HD 2NN6I 1K83B 1TIID 2K01A 1C8CA 3H91A 3HRZC 1WTOA 4C1NI 3E6ZX 4F7XA 4HEDA 2AQ2B 3NTIA 2WB1B 1II3A 1G6ZA 3DMUA 1LLRD 2Z1CA 4A3BB 2PO4A 5LL6X 2EDGA 1D5MC 3T56B 1TWCB 5C0XH 3VR5A 1UEAB 4X3SA 2EE1A 1EWHA 2DNEA 1EY9A 4PMBA 5IGDA 1EU3A 5F2DA 1ZYRD 4Z9CB 2HDLA 3S15B 1BDOA 1U4MA 2RSNA 1AEXA 3DEOA 5M5XB 3QG1A 2EOTA 3N52A 4A3DB 5C4HA 2CW0C 4DXFA 1V1PA 1XYIA 1PRTB 1KLGD 1B53A 3EA6A 1QJOA 4LMQD 5JEAG 1VMPA 1QILA 2ZXPA 5ELDA 4EQOA 3J81L 3GTQB 3FPUB 3N6RA 1DOLA 1MSGA 3DHQA 3C46A 3SDZA 2YYZA 4G7HC 1HA5A 3VR6A 1MD2D 3S14B 4C3JG 3NE5B 5DAUA 3TP6A 2PQEA 4RWSC 1HUMA 3URYA 4LAAA 1TS3A 3FKIB 3VA7A 1NSNS 1HRJA 1Q3LA 3LWEA 3P1HA 3C1EA 3I4NB 2BA1A 1DOMA 3A56A 3SHLA 4FVMA 3NQTA 1PTOF 1JCKB 1PTOD 1LT3D 4DXGA 1G2TA 1SYGA 1U4RA 1E2VA 5CBAE 2NWGA 3TBIB 4CGYB 1JWSD 3C2PA 1JB3A 4DGZA 4X3TA 4ZQ3A 5M3MB 3GD7A 2NTSA 5I2YA 3K6OA 2EZVA 2RSOA 5DM63 2RA4A 1ESRA 1A15A 2N88A 1KNEA 2C5CA 5HGTA 4OIJA 4XTCS 1A3UA 1IW7D 1RJTA 2IW3A 3J80E 3HEJA 4Q5VA 2XVSA 2F0EA 1SDFA 2KCCA 1CA6A 5T1IA 3HOUB 4FYDA 1O78A 4CJ1B 2A69C 4KJNA 5JEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWF A;  1EZ6 A;  2F0K A;  2PW5 A;  3OSO A;  4OL7 A;  1F2M A;  1EYC A;  5CV7 A;  2F0F A;  2OXP A;  5I6Y A;  1A3T A;  2F0S A;  5CGK A;  3QOJ A;  2NUC A;  5DAU A;  5EKK A;  5JAV A;  4IUN A;  2OEO A;  4B9W A;  3TP6 A;  3MEH A;  1F2Y A;  3MXP A;  1SNQ A;  2PQE A;  5ISR A;  5CV6 A;  5C5L A;  1TT2 A;  2PZU A;  2RDF A;  2EY1 A;  3QOL A;  4LAA A;  5J1Z A;  5CV5 A;  4K8I A;  1SYB A;  3VA5 A;  1NSN S;  1JOR A;  4PNY A;  1RKN A;  5C4Z A;  3D4W A;  4KD4 A;  4MIU A;  4NMZ A;  3P1H A;  4WRD A;  1SYE A;  4RKL A;  1EY5 A;  5KEE A;  5IOC A;  3C1E A;  2M00 A;  1TQO A;  5IGC A;  4QMG A;  1U9R A;  2WAC A;  2EYF A;  2QDB A;  4K6D A;  4S3S A;  5CV4 A;  3SK4 A;  4K2K A;  5E3F A;  3TP8 A;  3T13 A;  4HTH A;  2LKV A;  1STY A;  1STH A;  4EVO A;  3S9W A;  1JOQ A;  2EY6 A;  2O4X A;  3SHL A;  4DFA A;  3NHH A;  1STB A;  2F3V A;  3NQT A;  4HMI A;  1SNM A;  1STG A;  3ERO A;  4K5X A;  3EVQ A;  4H7B A;  4KTA A;  3TME A;  1SYC A;  4KY7 A;  5C5M A;  3ITP A;  1EY6 A;  1SYG A;  4F7X A;  1SNC A;  3QB3 A;  4KV6 A;  5C3W A;  4EQN A;  5HUR A;  5IGE A;  2SNS A;  3P75 A;  4KY5 A;  1II3 A;  3DMU A;  4EQP A;  4R8N A;  5KRU A;  1A2T A;  4ZUJ A;  1ENC A;  1SYF A;  2F0P A;  3MHB A;  2F0M A;  2RKS A;  3SXH A;  5CC4 A;  2EYP A;  3SK5 A;  5KGU A;  4QF4 A;  4N9P A;  4IZ8 A;  1EZ8 A;  5C3X A;  5NUC A;  2SNM A;  5IGG A;  2PZW A;  4J1M A;  4ZQ3 A;  4YIJ A;  4DGZ A;  2SOB A;  2EYH A;  3D6C A;  1KDC A;  1SNO A;  3BDL A;  5IGB A;  3TP7 A;  4DU9 A;  2EY5 A;  2HQE A;  2PZT A;  1NUC A;  1EY8 A;  4G57 A;  1EY9 A;  2F0H A;  4PMB A;  5IGD A;  1F2Z A;  3BDC A;  3SK8 A;  5F2D A;  2F0W A;  3V2T A;  5KYL A;  3NK9 A;  1SYD A;  2F0N A;  2EYL A;  1A3V A;  2EYJ A;  3H6M A;  2F0T A;  2F0U A;  1STA A;  2EYM A;  3OMG A;  4N9T A;  5CV8 A;  4TRD A;  4RKB A;  5IIF A;  4K5W A;  2EYO A;  1AEX A;  4ID6 A;  5EGT A;  3MZ5 A;  4PMC A;  1KDA A;  4J6H A;  4NKL A;  4KY6 A;  1EY0 A;  3U9O A;  3MVV A;  1ENA A;  1EQV A;  4KD3 A;  4IAL A;  5DEH A;  4F8M A;  1KDB A;  2KHS A;  4K2L A;  5HGT A;  3C1F A;  4K8J A;  2F0I A;  4I65 A;  3NXW A;  4HMJ A;  4KHV A;  2F0D A;  3EJI A;  4ME5 A;  5E1F A;  5I9P A;  3T16 A;  5C6A A;  2RBM A;  1EY4 A;  1A3U A;  2F3W A;  5I9O A;  2F0O A;  4K14 A;  5C4H A;  2F0Q A;  5CR3 A;  3HEJ A;  1SND A;  5CV9 A;  2EXZ A;  2OF1 A;  2PYK A;  3D4D A;  3OMC A;  3D8G A;  3PMF A;  2F0J A;  5K5P A;  2F0E A;  4ZUI A;  3SK6 A;  3TP5 A;  5IOD A;  1KAA A;  4NDX A;  3ERQ A;  1EYA A;  3R3O A;  4QB4 A;  1EY7 A;  1JOK A;  1SNP A;  2KQ3 A;  5J22 A;  5JOB A;  5KIX A;  4NP5 A;  2EY2 A;  3RUZ A;  1STN A;  5J39 A;  4B9X A;  3SR1 A;  2ENB A;  3E5S A;  3NP8 A;  4EQO A;  1JOO A;  2F0V A;  5M9O A;  4KJO A;  4E6I A;  2F0G A;  5KYI A;  3LX0 A;  1KAB A;  1EYD A;  4ODG A;  1IHZ A;  4KJN A;  4WOR A;  5I6W A;  1TR5 A;  4DF7 A;  4K5V A;  3HZX A;  5IGF A;  3DHQ A;  1A2U A;  5EKL A;  2PW7 A;  2F0L A;  3NUC A; 
#chains in the Genus database with same CATH topology
 1XMO Q;  1KHI A;  3CC4 A;  3VR4 A;  3ZJY C;  1PTO B;  5CV7 A;  3VYU A;  1RD9 D;  4LFC L;  2YTV A;  5IYB G;  4JV5 L;  1SMY C;  2Q8R E;  4OEL B;  3W1B A;  1DOK A;  1SNQ A;  3OW7 A;  1EQQ A;  2ZXO A;  4K8I A;  3CCU A;  3TDQ A;  4PNY A;  1JWM D;  3IFD A;  5C4Z A;  5IP7 H;  4GKJ Q;  2B2T A;  5C0X I;  2N3S A;  2F03 A;  1MHW C;  4GN3 B;  5KEE A;  1OXV A;  3FVQ A;  4S3S A;  2WAC A;  4K6D A;  2QDB A;  5C4X G;  1O7I A;  1J8I A;  4RGO S;  2X6L A;  4P75 A;  3HKZ G;  4AYB B;  4A93 B;  3P7J A;  2HUG A;  3RR5 A;  4DAY B;  1DCZ A;  4V19 0;  4CBV A;  4JI0 L;  3S17 B;  1YBY A;  4O2D A;  3HOY G;  5C4X B;  5GRO A;  3GTK B;  3OYY A;  4LUZ A;  2BE5 C;  4XQQ A;  2UXB Q;  5KRU A;  3GTG B;  4ZUJ A;  1U4P A;  4DV2 Q;  5ELB A;  4U68 A;  5G3L F;  5G3L D;  1AZQ A;  1S5E D;  1EU4 A;  1CSP A;  1H9S A;  2PZW A;  1SLJ A;  2B63 H;  1A63 A;  3MXN A;  2EYH A;  4L63 B;  5JVG 3;  2D9U A;  1KDC A;  5D14 A;  4DR1 L;  4ZKC B;  4IFD H;  1TWG H;  4G57 A;  2J7Z A;  1CHQ D;  3O13 A;  3FDT A;  4L5Q A;  2Y0S E;  4MTK A;  5E7N A;  4RKB A;  2JE6 I;  1RF2 D;  1MBY A;  4C3I G;  5K36 H;  5DEH A;  4IAL A;  5FJ8 H;  5LMN W;  4H02 A;  4A3G B;  4A3M H;  1FNU A;  3RZD B;  2A6E C;  3NXW A;  4AYB E;  4DV5 Q;  4C3H G;  3V05 A;  4DK6 C;  3U50 C;  2K52 A;  1NE3 A;  4DV4 L;  4KHP L;  1DYQ A;  4LF9 Q;  1TS2 A;  2EXZ A;  5IYC H;  2PYK A;  4DV3 Q;  4FP5 D;  3J7A 5;  4A3F B;  4X62 Q;  5FLX L;  3PIP 3;  1CK1 A;  1B4O A;  1K83 H;  4QB4 A;  2K28 A;  1E7Z A;  3K57 A;  4A3I B;  3NP8 A;  4DR7 L;  4N8F A;  3ULP A;  1KRT A;  1LO5 D;  3KF6 B;  4JI1 Q;  1ML0 D;  4WOR A;  3HOV H;  3NEL A;  2L12 A;  2CH4 A;  2JQO A;  2F0L A;  3VYR A;  4C1N K;  4HAE A;  2PW5 A;  4R9W A;  5C0X G;  2AUJ D;  1PDQ A;  1TS4 A;  4A3B H;  1K0R A;  4NB3 A;  4BY7 G;  4B9W A;  2Z6K A;  1GUT A;  4JI2 Q;  2E75 C;  2KVM A;  1TWC H;  5C5L A;  2IJ0 A;  2VUM B;  3TS0 A;  3VA5 A;  2HD3 A;  4ILW A;  4MIU A;  1K73 C;  1FYC A;  1ASZ A;  2E2D C;  4JV5 Q;  2M00 A;  4XYO A;  3S15 H;  3GTL B;  2LXJ A;  1XNQ L;  5FOB B;  4BBS H;  4OX9 L;  5E3F A;  5A35 A;  1STY A;  4LFB L;  3JAM c;  5M5X H;  4YHH Q;  2EY6 A;  1QNK A;  4JI7 L;  2E2I B;  3WOF A;  3EVQ A;  4H7B A;  1GXD C;  4A3D H;  5ELO A;  3T4A C;  3TRZ A;  1TWH B;  4X64 Q;  3A55 A;  3DWA A;  1HNW L;  3SEB A;  2O2L D;  5CC4 A;  3J81 i;  4DR5 L;  5FK9 C;  2BH2 A;  4GKK L;  5FLM G;  1STE A;  1TWF B;  1VQC A;  4KN4 C;  3PO3 B;  2ICI A;  1QZH A;  1E22 A;  5IE8 A;  3GTQ H;  3U4V A;  4ALP A;  3BJU A;  1ET9 A;  4JBM A;  3S1M B;  1TY0 A;  1N33 Q;  2EYL A;  1I94 L;  3H6M A;  3Q6S A;  4N9T A;  1JE4 A;  3S14 H;  3KF8 A;  3D4R A;  1Y69 U;  1F9P A;  2L0C A;  2RF4 A;  4B3T L;  1S5D D;  1B2T A;  4ZYS A;  4QCL A;  3FKI H;  3EJI A;  3A0J A;  1TY2 A;  4BA1 I;  3J7A V;  1ESF A;  5JVH 3;  1B1Z A;  2PCF B;  1Y1V G;  5H1S E;  1PH4 A;  2JA8 G;  3I4N H;  1HJP A;  2GN5 A;  3TP5 A;  4RCN A;  2R61 A;  1S4Z A;  2K5N A;  1VQN A;  5BR8 L;  4LFA L;  1K0S A;  4KHP Q;  3LX0 A;  4A3L H;  2NTT A;  1SJH D;  4K5V A;  2X6G A;  4GNX B;  5LMN Q;  1A2U A;  2ICE C;  1DM0 B;  3NUC A;  1UAP A;  3L9A X;  1Z7T A;  2BA0 A;  3Q0A A;  2DJG C;  1GUO A;  5I6Y A;  5C44 H;  4DN4 M;  3A54 A;  5EKK A;  1HNZ Q;  1BF4 A;  3I4M G;  2RDF A;  5D3D A;  5M3M H;  1G6P A;  5C0X J;  3HOX B;  1WD1 A;  1EY5 A;  1HZB A;  1ROD A;  4TKO B;  3KBX A;  4QMG A;  2K5V A;  2K05 A;  4DK3 C;  5I9O A;  3OIQ A;  4FF2 A;  1HFN A;  1LM0 A;  2LKV A;  3K0X A;  2NVQ B;  4DFA A;  1MIU A;  4HMI A;  4JG2 A;  3BU2 A;  2IX3 A;  3T1H L;  5I4D A;  1Q1B A;  2UUC Q;  1WD0 A;  1XNQ Q;  2QF7 A;  3J80 L;  3HOW G;  4U67 3;  3P75 A;  5ELN A;  2KJX A;  2K6A A;  1YZ6 A;  1N34 Q;  2DJF C;  1WTR A;  3K5N A;  2EXD A;  1YJW A;  4LNQ A;  3HOU H;  5IWA L;  4J1M A;  4YIJ A;  2OWO A;  3MWY W;  2CQO A;  4F88 A;  5IGB A;  2Q8I B;  1Y1W B;  2HHH Q;  2HIV A;  1W6J A;  1G91 A;  2H4O A;  1LTT D;  2F0W A;  5EPK A;  1I3Q B;  1SYD A;  2UXD L;  4QUC A;  1PTO H;  4GKK Q;  1ENF A;  3PUZ A;  5IP7 G;  1T5E A;  1X55 A;  4UDU C;  1YIT A;  1G8Z D;  3TSS A;  2Z6K C;  4K8J A;  5FO9 B;  2IHE A;  5DLQ E;  4TQU S;  1BR9 A;  1EY4 A;  3NWS A;  4A76 A;  3PMF A;  1R9T B;  4X65 Q;  1P8L A;  1A0I A;  1EOV A;  4XT3 B;  1D8L A;  2B8G A;  1SE2 A;  1IYU A;  1NBW A;  3PF5 A;  1CQV A;  2M9V A;  3FMC A;  2RDG A;  1CUK A;  2NYZ D;  3L2P A;  5J39 A;  4E6I A;  3G6E A;  3ND9 A;  1RL2 A;  5KYI A;  3IFT A;  1PH8 A;  3S17 H;  1SXT A;  4DF7 A;  2P5Z X;  2PW7 A;  4MN3 A;  2OEO A;  3EN2 A;  3GTK H;  2MJ8 A;  3CME A;  2B63 G;  2TSS A;  1JC7 A;  5ELE A;  1IBL L;  1GUS A;  3GTG H;  2MQH A;  1EIY B;  4LF8 L;  1NR4 A;  2KEN A;  1QE6 A;  4R4C A;  3MFG A;  4X66 Q;  2DNC A;  3Q23 A;  2ZJP A;  4K0K L;  4KD4 A;  4FXG C;  4RKL A;  4BY1 G;  1IL8 A;  3K5O A;  4BXX H;  4NXM L;  1VF7 A;  5K36 G;  4DUY L;  1TQO A;  1SBB B;  4FF3 A;  1TU2 B;  2JEA I;  1NTG A;  4R1J A;  4A3M G;  3M7N A;  5CV4 A;  2MGS A;  3VDY A;  2QCP X;  4HCS A;  1O7L A;  3MXG A;  3NEM A;  2N8N A;  5IYC G;  4F87 A;  4A3G H;  1HFG A;  3RZD H;  1UE6 A;  2BDO A;  4KTA A;  1Y8O B;  1WYD A;  2EVB A;  3M4O B;  1XNR L;  5EAY A;  4K6L A;  4EX5 A;  2A69 D;  1EEI D;  1AZP A;  4CDD C;  4QUF A;  3J81 c;  4HID A;  1BUV T;  3GTJ B;  1EL0 A;  5EPJ A;  1A2T A;  1QVG A;  4A3F H;  1HTP A;  3MHB A;  2QA4 A;  4N9P A;  4IZ8 A;  3T1H Q;  5FLX E;  1YNN C;  4A3I H;  2SOB A;  3WOE A;  1SMY D;  2DN8 A;  2WB1 G;  4UP9 A;  2KHI A;  1EFI D;  3GV6 A;  4A3B G;  1WOC A;  3HP3 A;  2F0N A;  3HOV B;  2WIN B;  2SEB D;  2B2V A;  4TRD A;  5EGT A;  2IT1 A;  3T1Y L;  1HZA A;  1S5B D;  1IBM Q;  5FO7 B;  2R7Z B;  4JBJ A;  5FO8 B;  2VUM H;  4K2L A;  1PYS B;  3NPP A;  2JYO A;  1L2F A;  3I56 A;  2RBM A;  3HFZ B;  2UXD Q;  1HPC A;  4BBS G;  1YI2 A;  4XQJ A;  2F0O A;  1JJ2 A;  2F0Q A;  1SND A;  4LW1 A;  2OF1 A;  5DNF A;  2E8G A;  5EQ0 A;  3BZD B;  4OWX B;  1M8A A;  5IOD A;  3GTL H;  4CKB A;  2BE5 D;  3DM3 A;  3PQI A;  3H3V I;  4JI5 L;  2EY2 A;  5IT9 c;  4A3D G;  2Q2U A;  4BBS B;  2HCC A;  3CPW A;  1F2L A;  3KFU A;  4KJO A;  2E2I H;  4Y7N H;  3S16 B;  2Q8T A;  1HNX L;  3W2D A;  3HGB A;  1YJ9 A;  3KUP A;  1EZ6 A;  2F0K A;  4JI3 L;  4IUU A;  4KK7 A;  1WTX A;  1XMQ L;  1KIX A;  3E9H A;  3PIO 3;  1Z6H A;  3I3C A;  2XGT A;  1QVF A;  5JPN C;  2PPB C;  3RMH A;  3AQQ A;  4C56 C;  2CWA A;  1TWF H;  2CWP A;  1CSQ A;  5CYU A;  1HXY D;  1T9H A;  3DXJ C;  2A6E D;  3S1M H;  1VQP A;  2UU9 Q;  4LF8 Q;  3Q8D A;  4GLX A;  2ASB A;  3CF5 A;  4FO2 A;  2E2H B;  3FKI G;  4K2K A;  3TZD A;  1STH A;  3S9W A;  3OW2 A;  2K5Q A;  2G9D A;  2ZTD A;  1X3G A;  3PSI A;  1D7Q A;  4QGU A;  3X3M A;  2B2U A;  3I4N G;  3ITP A;  1QUQ B;  1V9P A;  1I6V C;  4OXP A;  5J3B A;  5HUR A;  3ERS X;  4R8N A;  2KHJ A;  1PH6 A;  2LXK A;  3D6W A;  4A3L G;  4DV7 L;  1IYJ B;  2QEX A;  2UXC L;  4AQY Q;  1XNR Q;  1HHV A;  2RHS B;  3A7A B;  4KMU C;  2HQE A;  4B08 A;  3M3Y B;  1NMG A;  5KYL A;  3R2I A;  5LL6 S;  4LF5 Q;  1OXS C;  1SN8 A;  4RG1 A;  3JC6 6;  1FVI A;  1A3V A;  4NPS A;  4K5W A;  3RD4 A;  3DUZ A;  5M3M G;  1VQ7 A;  3MZ5 A;  3S1N B;  2L55 A;  1EIG A;  1K28 A;  1DXM A;  1PFN A;  1W6K A;  1N32 L;  5C44 B;  1EQV A;  3I8Z A;  2AWO A;  2KHS A;  2MUY A;  2F0I A;  2NZO A;  5FKA C;  1FD7 D;  3HOX H;  5AFW A;  1KLU D;  1EQT A;  4DAM A;  1IKL A;  5E4W C;  5JPM C;  1IKM A;  1CKN A;  1RTN A;  2IHF A;  1GVP A;  2B29 A;  1CI3 M;  2FJ2 A;  5LHY 1;  1WCM H;  4JI6 L;  3S24 A;  3PF4 A;  2NVQ H;  1F77 A;  3JAM E;  3J80 i;  5M5W H;  2N78 A;  1C9O A;  2IX1 A;  4A4I A;  1KNA A;  4JI5 Q;  3HOU G;  2RCF A;  1BOS A;  2MPM A;  2A5H A;  5CGK A;  4XQN A;  2NUC A;  1QNU A;  5ISR A;  1I4R A;  3T51 B;  2AHO B;  2PZU A;  2AQ1 B;  3C3L A;  4QQB X;  2RQX A;  1SYB A;  3NBH A;  1LTS D;  1RKN A;  1Y1W H;  2DUD A;  2Z0S A;  1U5K A;  4WRD A;  1YIJ A;  2HCI A;  3SGI A;  1I3Q H;  4GN4 B;  2FMM A;  3QO2 A;  3DLL A;  4WJW A;  1GHK A;  1B8A A;  3T13 A;  1WJJ A;  2B2V C;  1IBK L;  1KTK A;  1Q1E A;  4OIK A;  1STB A;  3P20 A;  2K04 A;  3VR2 A;  4OWW B;  5C5M A;  1PYB A;  4CJ2 C;  2XSC A;  2VL6 A;  2SNS A;  3CC2 A;  3H09 A;  1PXU A;  1R9T H;  1MSH A;  2Y0S B;  4AYB G;  4A93 G;  5C3E B;  2F0P A;  3R2T A;  2ZJQ A;  3SK5 A;  3WDN A;  4QF4 A;  3T53 B;  1EIH A;  4KHZ A;  1OO9 B;  1AN8 A;  1H95 A;  1ONL A;  2LFN A;  1NAP A;  4LUV A;  5JJL A;  2NVT B;  4G4K A;  4X3K A;  1GUG A;  4JI4 L;  5M5Y B;  2QIL A;  2F0T A;  4LF6 Q;  4DV7 Q;  1STA A;  4YY3 L;  1Z47 A;  2UXC Q;  4ULL A;  3RN5 A;  2UUB Q;  4NKL A;  4HIO A;  4BXX G;  1E1O A;  1EEF D;  1RIP A;  2HT1 A;  2DY7 A;  4IOA A;  4KHV A;  1ZEQ X;  5I9P A;  4FXK C;  1Z9F A;  4IQZ A;  1VQE A;  2CFM A;  4P2C B;  4OO1 H;  2Q2I A;  1Q86 C;  1V1O A;  5CV9 A;  2JA5 B;  3ONA B;  2ZTC A;  2WP8 J;  4CHT B;  3SK6 A;  4NDX A;  1EYA A;  4A3G G;  1YHB A;  5IYD H;  1K3B C;  1S40 A;  1S5C D;  1Q12 A;  5T1G A;  1STN A;  3Q22 A;  3E5S A;  1GOZ A;  2Z4I A;  1L0W A;  1XWE A;  4HIK A;  1RTO A;  3NSW A;  1KAB A;  1VQ6 A;  1LYL A;  4A3F G;  3KDF B;  3HZX A;  3M4O H;  1PFS A;  2B2U C;  1NY4 A;  1VQD A;  4A3I G;  3GTJ H;  4JI6 Q;  4DR6 L;  1ET6 A;  2NVX B;  3LWU A;  5IY0 A;  1GUW A;  3PIO A;  4A3C H;  4DA2 A;  1JOR A;  2WII B;  4BWG B;  3D4W A;  4NMZ A;  2NVY B;  1SYE A;  2KA7 A;  2L15 A;  4P71 A;  1PH5 A;  1XPU A;  3H3V C;  3IL8 A;  3A5U A;  1V43 A;  2ZTE A;  2VUM G;  3CKI B;  3VR3 A;  2Q2H A;  3TP8 A;  1BCP C;  2LMC B;  4RMF A;  5AJ3 L;  4HJ9 A;  2ZM6 Q;  1BBW A;  5A2Q E;  2A73 B;  1J6Q A;  2R7Z H;  2SDF A;  1GM5 A;  2F3V A;  3M4P A;  3HKZ E;  1SNM A;  3UDF A;  4B3S Q;  4DNR B;  1X3E A;  5C3W A;  1HCZ A;  4A3J H;  3UDX A;  2RVL A;  1IBK Q;  4MNO A;  4HJ7 A;  1PVO A;  4LFC Q;  1B3A A;  1EZ8 A;  2B3G A;  3OOC A;  1QWY A;  2JA6 B;  3H94 A;  1O80 A;  2L9H A;  3S16 H;  4JC0 A;  1TVX A;  1M90 C;  4Y7N B;  2L11 A;  4P74 A;  2G9H D;  1F9S A;  1ZXT A;  3PO3 G;  2EIF A;  5IP9 H;  4KY6 A;  4M8A A;  2E76 C;  3U9O A;  3MVV A;  1ENA A;  4DAP A;  4ZLT F;  1HR0 L;  1BXT A;  3BYY B;  2F0D A;  4JI0 Q;  4DKA C;  1GUN A;  4YY3 Q;  5BN5 A;  3M4Q A;  2E2H H;  4YWM A;  1SNP A;  1NR2 A;  3CCE A;  1UNS A;  2AKW B;  4DR2 L;  5EBD A;  2V1C C;  4DR1 Q;  1YNN D;  4GNX A;  1QVC A;  5I6W A;  5EJW A;  1VQG A;  1KXL A;  4RA8 A;  1KAW A;  2VQF L;  4C2M H;  1LAB A;  1BNZ A;  3GTO B;  1DJR D;  2K5D A;  3F2U A;  3CMA A;  1A3T A;  4APV A;  2B2T C;  5JEA H;  4DK1 A;  1V1Q A;  1WVL A;  3CU7 A;  4PZ6 A;  2DGY A;  3M4Y A;  1PA6 A;  3M3Y H;  4DV4 Q;  4XXE A;  3QJY A;  1F9R A;  1Q8I A;  3V96 A;  4DR4 L;  3VYS A;  2EYF A;  2J4X A;  3SK4 A;  2YU9 B;  1VQB A;  4HTH A;  2D0P A;  2NN6 H;  3S1N H;  2G5D A;  2X69 A;  3HOX G;  3OTO L;  1W2B A;  4DNI A;  4IUP A;  1YVC A;  4DR7 Q;  3CPF A;  3G4S A;  3QWN A;  1SNC A;  1D1K A;  4JW0 A;  2UUA L;  1VQI A;  4P72 A;  4KY5 A;  2B8F A;  1UE5 A;  4IOC A;  4IJL A;  1Y14 B;  5BN3 A;  1TKW B;  4OO1 I;  3MEF A;  4RFB A;  2A8V A;  1B44 D;  1SE3 A;  4IFD I;  1J9O A;  2Z4H A;  4CKC A;  2CW0 D;  2JP1 A;  2QDL A;  3D6C A;  4OGQ C;  3JAM L;  1WCM B;  2NB0 A;  2E2J B;  4XIG S;  1YNX A;  2LS0 1;  1HQR D;  5M3F B;  5M5W B;  3K0Y A;  4BS9 A;  3I72 A;  1E2Z A;  1LT5 D;  1VQO A;  1L1O B;  4OX9 Q;  2RDH A;  1Y1W G;  3NTH A;  4LFB Q;  1EY0 A;  2B39 A;  4IPH A;  4DR3 L;  4Y52 H;  1O7Z A;  2JA7 B;  4JI7 Q;  4FXD A;  3T16 A;  1ILQ A;  3GTP H;  1X6O A;  5CR3 A;  4GOP A;  1JJC B;  1HNW Q;  1LTA D;  1AE3 A;  5J22 A;  4DR5 Q;  1C0A A;  4UP8 A;  5I2X A;  4ZAI A;  3SR1 A;  1HQM C;  3A8J E;  5M9O A;  4ZK9 B;  4DV1 L;  3HKS A;  3RLF A;  1Q90 A;  1I50 B;  1FJG L;  3H0G B;  1DON A;  2F4V L;  1TR5 A;  4PZ8 A;  2R93 B;  4HCE A;  2VW9 A;  2A68 C;  3OSO A;  4OL7 A;  1EYC A;  3CQZ B;  1I94 Q;  2F0F A;  1OXU A;  2I5H A;  2OXP A;  2ID0 A;  2ATW A;  1YHA A;  5C3E H;  2K32 A;  3MEH A;  4L6T B;  1F2Y A;  4OON A;  2DY8 A;  1YHQ A;  4LJZ C;  4B3T Q;  3CP0 A;  1B70 B;  1PFM A;  4H44 C;  2F4I A;  4JOI A;  3W3A A;  4LK1 C;  4EGV A;  1I6H H;  3CCJ A;  2L5T A;  4DAV A;  4I7Z C;  2K33 A;  2NVT H;  2F1M A;  5IGC A;  5KND A;  5M5Y H;  3HG9 A;  3K5M A;  3S1R H;  1PFB A;  1TXY A;  3AEV A;  1BBU A;  4OO1 G;  1IYV A;  5BR8 Q;  3NHH A;  2CHB D;  4LFA Q;  4CDE C;  4IFD G;  4K5X A;  4KLK A;  3TME A;  3KJO A;  1VMC A;  1I4P A;  1EY6 A;  5IYD G;  1M1K C;  3AFQ A;  1V8Q A;  2JA5 H;  1B9M A;  3U4Z A;  1WTP A;  1SYF A;  3OTO Q;  1LAC A;  3G48 A;  3S1Q H;  2SNM A;  5IGG A;  5FJ8 G;  1RDP D;  2WFW A;  1SE8 A;  1SNO A;  3OPO A;  1CQF A;  4FF1 A;  2VQE L;  1SAP A;  2WKC A;  1QB5 D;  3OMG A;  3L3O C;  2R92 H;  5IIF A;  2J0T D;  5CV8 A;  4A3C G;  1X3Q A;  1AE2 A;  4ID6 A;  4PMC A;  5JJK A;  4V0B A;  2NVX H;  4KD3 A;  3NBI A;  1CA5 A;  4LF4 L;  1XXG A;  2O5J C;  4KN7 C;  5CMD A;  4PMW A;  3IAY A;  3HOV G;  2KBN A;  1X65 A;  4EQ5 A;  4OEM B;  3MC0 B;  2VY3 A;  4K14 A;  2NVY H;  1FNW A;  1RHP A;  1VQF A;  4HSV A;  4UPA A;  3D4D A;  1YNJ C;  1XJV A;  1K8M A;  3CCL A;  2R7Z G;  1E1T A;  1TWA B;  1EY7 A;  1UE7 A;  1QCB D;  4Q0F A;  1N9W A;  4B3M L;  5A2Q L;  4L8J A;  5IWA Q;  3TZU A;  2AWN A;  3I90 A;  1JOO A;  4C3H H;  5IGF A;  3I73 A;  5LMU L;  3OHX C;  2KEC A;  1I4X A;  4FF4 A;  1P16 A;  3OWF A;  2FHT A;  5E4X A;  5TSS A;  3STB C;  1JR0 D;  2PNH A;  1X3P A;  4R4Q A;  5GAG C;  2MFI A;  4A3J B;  1XPO A;  4DV1 Q;  4PZ7 A;  1CFM A;  3BVZ A;  5CV6 A;  1JQY D;  1NJI C;  2XWB B;  1NCV A;  2WAQ B;  3M7G A;  3GV3 A;  1EUJ A;  1UWV A;  1JWU D;  4JI8 L;  2JA6 H;  2CKZ B;  1CT1 D;  2XNA C;  3J7Y W;  4ZCK A;  2FFK B;  4POF A;  1EWC A;  2BOS A;  4H0L C;  3SVM A;  3BVM A;  1VQJ A;  3BYT B;  2VXW A;  2O4X A;  4OWT B;  4HJ5 A;  4MZ9 A;  4PV1 C;  3GO5 A;  1ICW A;  2Q2T A;  4YCW A;  3KOJ A;  1SYC A;  3FEW X;  1XTD A;  4DUZ L;  4JYA L;  3LNN A;  2EJM A;  1XX8 A;  1GKH A;  4GOP C;  2K5H A;  1EQR A;  1DGS A;  1PZJ D;  2L1B A;  1IBL Q;  4IFD J;  4UAI A;  3QIA A;  1VQ4 A;  1D6E C;  3CAM A;  5C3X A;  3OIP A;  4LWC A;  5NUC A;  3RNU A;  1C7Y A;  4KKT A;  3BZK A;  3F2C A;  3TP7 A;  3S2D B;  4K0K Q;  2WAQ E;  2PZT A;  2VB2 X;  3KYH C;  1SFO H;  3TS2 A;  1R4Q B;  4NXM Q;  4QJF A;  2ZJR A;  4DUY Q;  2EYM A;  3GTO H;  2CH4 W;  3M9B A;  4C2M B;  1H9K A;  3VYT A;  4BBR B;  4CKE A;  1JE5 A;  1KDA A;  4J6H A;  1SE4 A;  3PV0 A;  1BCP F;  1PHJ A;  1L0X B;  1BCP D;  2K1B A;  4ME5 A;  4GKJ L;  1D5X C;  4RAU C;  4ZRZ A;  5JJZ A;  1WTQ A;  4G7Z C;  2NN6 G;  4JOI C;  2VZA A;  1V1P B;  4IPD A;  5C44 G;  3CRL C;  3BVG A;  3MAQ A;  4IPG A;  4IUT A;  1U0L A;  1YEZ A;  4YWK A;  2CCZ A;  1K8O A;  4LF4 Q;  2YU9 H;  5KIX A;  2LY7 A;  3RUZ A;  3H15 A;  3W5O A;  4A3E B;  4C3J B;  1QZG A;  2AUK A;  1CKM A;  3L0O A;  1UEB A;  4DV6 L;  3BS1 A;  4POG A;  2VNU D;  5KNC A;  3FRP B;  4R4T A;  2JEB I;  1S5F D;  2JA8 H;  4DV2 L;  3JAM i;  2I5M X;  1KRS A;  3T1Y Q;  1HH2 P;  3TQY A;  3DM1 A;  1VS0 A;  2L4N A;  5IT9 L;  3E0J A;  3ICE A;  2E2J H;  2WV6 D;  5M3F H;  3CW2 C;  4FNF A;  3FPP A;  3S2H B;  3TRE A;  1D5Z C;  1FL0 A;  4DV0 L;  1KD1 C;  4A3K B;  1U9R A;  2BDN A;  2QEJ C;  3B6Y A;  3Q24 A;  1B3Q A;  4FDB A;  2R3Z A;  1GO3 E;  3K7A B;  3MFY A;  3IRB A;  1X3F A;  3PUV A;  1JOQ A;  4UP7 A;  1G51 A;  4LF7 L;  1VQ8 A;  2JA7 H;  2JSO A;  1HZ9 A;  2HDM A;  1SMX A;  1HNX Q;  1BCP B;  2OCE A;  1WTV A;  2IX0 A;  4EQN A;  4DV3 L;  2ZXR A;  4IUQ A;  3G7L A;  4X62 L;  4HJ8 A;  3A8K E;  4JI3 Q;  3GTP B;  1XMQ Q;  3HOZ B;  2F0M A;  3RZO B;  5KGU A;  4DK0 A;  2OT2 A;  3MA2 B;  3AMU A;  1H9J A;  1K8G A;  1PYW D;  4JI1 L;  1I50 H;  2Y0S G;  3MXU A;  3K59 A;  3H0G H;  4DAY A;  5C3E G;  1EYG A;  5EPL A;  1CKN B;  5FLX c;  3I7F A;  3V2T A;  2R7D A;  3NK9 A;  3PO2 B;  2NBF A;  1QG7 A;  3CCM A;  1PLF A;  2R93 H;  2A19 A;  2EYJ A;  2WKD A;  1G29 1;  3G71 A;  2NZ1 D;  3CQZ H;  1AP0 A;  1LV9 A;  2JXM B;  3FHW A;  2KOL A;  1PRT C;  2A6H C;  1CHP D;  1GD7 A;  1SSO A;  1VQH A;  1Q82 C;  2PNR C;  2F3W A;  3F2D A;  2A74 C;  3UDI A;  4R8I A;  3D8G A;  5K5P A;  1I6H B;  2FIN B;  4KKU A;  1D2B A;  1BKB A;  1ZKO A;  3PUY A;  5D3I B;  1PH7 A;  2KQ3 A;  2OQK A;  1JMC A;  3NBH B;  4NP5 A;  2GVB A;  4YHH L;  3S1R B;  2EJG C;  3PUX A;  2PQA B;  2JA5 G;  2FMC A;  2F0G A;  4IUV A;  2IWH A;  3KDF A;  3SE0 A;  4M1U B;  2GVA A;  5EKL A;  4X64 L;  1CM9 A;  4RCO A;  4QIW B;  5EKI A;  3J7Z C;  4H13 C;  4GLA C;  4IPC A;  4IUN A;  2D62 A;  3J81 j;  4DV6 Q;  1TT2 A;  2K75 A;  2EY1 A;  1N32 Q;  4AIM A;  2IY5 B;  2OTL A;  3S1Q B;  2RCN A;  1MI2 A;  1FGU A;  1ZYR C;  2YTX A;  3HKZ B;  2R92 G;  3E3X A;  1Q8K A;  4MHE A;  1SRU A;  1MJC A;  1N33 L;  3KF6 A;  4P73 A;  5IOC A;  3I55 A;  4XT1 B;  3HOY B;  5D65 A;  3ER0 A;  1LTI D;  4HJA A;  1PV4 A;  1PMR A;  2R92 B;  2ES2 A;  2IL8 A;  2MHV A;  2JK8 A;  1AW7 A;  2K03 A;  1BBX C;  1STG A;  3ERO A;  1A62 A;  2E74 C;  4DV0 Q;  2O5I C;  1C4Q A;  1OTC A;  5CBE E;  4BY1 H;  2Z6B A;  3UI2 A;  3M85 A;  2KCM A;  3G6J B;  4TSS A;  2RKS A;  2A68 D;  1TWA H;  2EYP A;  4LF7 Q;  3K8A A;  2K5W A;  4QIW E;  4QY7 A;  3GTM B;  1GJX A;  1CZG A;  1E2W A;  2XWJ B;  1H9S B;  3MXN B;  1OXT A;  1L0Y B;  4C3I B;  2JA9 A;  1I4G A;  5LMN L;  1F2Z A;  3BDC A;  3SK8 A;  1I5F A;  2H1E A;  1X54 A;  4WJ4 A;  2MP1 A;  4C3H B;  2F3I A;  2F0U A;  1D1I A;  4OHJ A;  1A6X A;  2EYO A;  2JA6 G;  1HNZ L;  3KLS A;  4NXN L;  3ZYY X;  1KDB A;  3A5Z B;  3KLS X;  4I65 A;  2E5L L;  4HMJ A;  1R4P B;  5KNB A;  2D5D A;  3X3N A;  1FR3 A;  5ELF A;  3CRK C;  2B2Y A;  1K8A C;  1PZI D;  3AB9 A;  1ILP A;  2MNA A;  1BQQ T;  1B7Y B;  2M2L A;  2ZT9 C;  4UY8 C;  3AFP A;  3R3O A;  2CVR A;  3HS0 C;  1HR0 W;  4KI0 A;  3D3R A;  2GA4 B;  1X32 A;  3D31 A;  1PTO C;  2ALY B;  2BH8 A;  2F0V A;  4BY7 B;  2HQL A;  3MTS A;  1HZC A;  1EYD A;  2NZH A;  1SJE D;  3CD6 A;  2UUC L;  1VQ5 A;  1Y8N B;  5ELC A;  4XDX A;  5COY A;  3U9S A;  4DNT B;  2RHQ B;  4JI4 Q;  1SR3 A;  1N34 L;  2CQA A;  4RHS A;  1SEB D;  4HN7 A;  1M4V A;  3CXC A;  3MXP A;  1VQA A;  3QOL A;  4RH6 A;  1EOT A;  4HSP A;  2PMZ B;  1Y8P B;  4O42 A;  3UE0 A;  3J80 c;  1PZK D;  2HHH L;  1LT6 D;  4J8Q A;  3S2D H;  3GQB A;  3EBE A;  2B2W A;  2I5L X;  2XRQ D;  2JN4 A;  2KED A;  3GP7 A;  1LT4 D;  1SFO B;  1YNJ D;  4BBR H;  1VCI A;  3AYH B;  2AQ3 B;  5EBC A;  3K5L A;  3PUW A;  1IW7 C;  3I2Z A;  3J81 E;  4O1N A;  4KY7 A;  4WFN 3;  3BDO A;  1YJN A;  1WTH A;  4X65 L;  4EQP A;  3R93 A;  1JIC A;  2R6G A;  1S72 A;  3WWV A;  4DR6 Q;  3STB D;  4A3E H;  1G2S A;  2TMP A;  4C3J H;  2MO0 A;  4GLV B;  3BDL A;  2QW7 A;  3BG3 A;  4DU9 A;  3KLW A;  2PMZ E;  4PQX A;  1PH2 A;  3K58 A;  1X56 A;  3I4O A;  4RGN A;  2D2C C;  1CZW A;  2I07 B;  4RHR A;  1L1O A;  4X3U A;  5C4J B;  2OQ0 A;  3KF8 B;  1Y1V B;  1WCM G;  2XN9 C;  4JBW A;  1XTC D;  1SRO A;  1RCV D;  5AJ3 Q;  1JT8 A;  2JA8 B;  1JB7 A;  1XPR A;  5M3F G;  5GAE C;  4F8M A;  4X66 L;  3EFX D;  3GDE A;  2Z8L A;  5E1F A;  5C6A A;  2V4D A;  4L5R C;  3DWQ A;  1B50 A;  2A1A A;  5IT9 E;  3S2H H;  3I4L A;  1HUN A;  1VDZ A;  2N49 A;  2F0J A;  4NXN Q;  4ZUI A;  3EIV A;  1CKO A;  1KAA A;  1T5X D;  2QKI C;  4GN5 A;  4A3K H;  2JA7 G;  1MJE A;  2IPK D;  3EQL C;  2E5L Q;  1H9M A;  5JOB A;  3K7A H;  1VF5 C;  4B9X A;  2ENB A;  4JVZ A;  5L37 A;  3H3V H;  2D0O A;  3KK7 A;  4ODG A;  3J7A F;  1IHZ A;  3I4M B;  1C48 A;  2YTY A;  1KQS A;  1HTL D;  4KV6 A;  4JK1 C;  1F2M A;  2R7F A;  3I91 A;  2KUM A;  1HA6 A;  4RGM A;  3HOZ H;  3RZO H;  1B9N A;  1W3S A;  3ULL A;  3H0G G;  1VQ9 A;  1QOH A;  5J1Z A;  5CV5 A;  2MO1 A;  1HR0 Q;  4CJ0 B;  5HGQ A;  2R93 G;  1IXR A;  1MGS A;  1EWI A;  2KEE A;  4MTN A;  1WTW A;  1DD2 A;  1AFP A;  1FNV A;  4ABN A;  3A74 A;  4N8X 1;  3PO2 H;  3BZC A;  3DEP A;  3A8I E;  4I7A A;  4RGT A;  5BN4 A;  4B3R L;  1E0B A;  3HOW B;  1IBM L;  5DM7 3;  4EVO A;  4HR7 B;  2F52 A;  3DWP A;  3L7Z C;  4DR2 Q;  1NNX A;  1F9Q A;  4NW2 A;  4CDC C;  1N36 L;  3KBG A;  1VQK A;  1I4H A;  3I70 A;  3OWE B;  3QB3 A;  5IGE A;  4IUR A;  2VQF Q;  2PI2 A;  2K7V A;  2B2Y C;  1BO0 A;  4IN3 A;  1ENC A;  1H9R A;  4WJ3 M;  4GZY C;  3SXH A;  1O7Y A;  4IJH A;  1OXX K;  1J5E L;  1WI5 A;  2I46 A;  3F1Z A;  5IYB H;  2BCO A;  3IKJ A;  4YCU A;  1GHJ A;  1NMF A;  4GOP B;  2EY5 A;  1X9N A;  1NUC A;  1EY8 A;  3CHB D;  2F0H A;  2EPB A;  2N55 A;  5GAH C;  3NTK A;  3PIP A;  4DR4 Q;  3F2B A;  4A93 H;  1AH9 A;  2VB3 X;  4XYQ A;  1LTR D;  4JCV E;  4L5T A;  1PH1 A;  3C1F A;  1FGB D;  5C4X H;  3PCO B;  4G7O C;  3KLR A;  2EJF C;  2UU9 L;  2UUA Q;  4ME3 A;  3RLN A;  1I4Q A;  1LTG D;  2B2W C;  3OMC A;  3RLO A;  1DZ1 A;  3HOY H;  3ERQ A;  2XIW A;  2H5X A;  4GNX C;  1JOK A;  2B63 B;  1Q81 C;  1CTM A;  2QGQ A;  1U4L A;  1VQL A;  3R8B A;  1TWG B;  2XRS D;  1IL2 A;  1UUP A;  2Z9H A;  5COR A;  3NWT A;  5HY6 A;  2C9O A;  1TS5 A;  3A7L A;  3ND8 A;  2F0S A;  4BY1 B;  3QOJ A;  4ZKB B;  5JAV A;  2KCN A;  4KKS A;  3NQI A;  4CDF C;  3TN2 A;  1LTB D;  4QL5 A;  3GTM H;  4GS3 A;  4DR3 Q;  4AQY L;  4A3M B;  4BA2 I;  3AU7 A;  1IZ6 A;  2K4K A;  1PRT F;  2OTJ A;  1PRT D;  2A6H D;  4C3I H;  4L5S A;  4LF5 L;  4A3J G;  4X6A H;  2NN6 I;  2YV5 A;  3CCR A;  1K83 B;  4DPG A;  2LSS A;  2WAQ G;  1TII D;  2K01 A;  4JBK A;  1L1O C;  1C8C A;  2JJQ A;  4IO9 A;  2AMC B;  3H91 A;  1K3R A;  3HRZ C;  2PI2 E;  1WTO A;  4C1N I;  3E6Z X;  1FJG Q;  2K50 A;  2F4V Q;  4F7X A;  4HED A;  2AQ2 B;  3NTI A;  4B3R Q;  2WB1 B;  1II3 A;  1EIF A;  3DMU A;  3LGJ A;  1G6Z A;  1LLR D;  2Z1C A;  1K9M C;  2PO4 A;  5LL6 X;  4A3B B;  5IP9 G;  4PG3 A;  3CCS A;  4R4I A;  2EDG A;  1D5M C;  3T56 B;  1TWC B;  4JPB W;  3K7U C;  1N36 Q;  5C0X H;  3VR5 A;  1UEA B;  4X3S A;  2EE1 A;  4BY7 H;  4A75 A;  1EWH A;  2DNE A;  1EY9 A;  4PMB A;  5IGD A;  1EU3 A;  5F2D A;  1ZYR D;  4Z9C B;  2HDL A;  3FP9 A;  3S15 B;  2EQS A;  1QUQ A;  1BDO A;  1U4M A;  4R4O A;  2RSN A;  4HIM A;  1AEX A;  1J5E Q;  3DEO A;  5M5X B;  3W1G A;  3UE1 A;  3F8T A;  3QG1 A;  4UHV A;  3CC7 A;  1TWH H;  2EOT A;  3N52 A;  4A3D B;  1JJG A;  4YWL A;  5C4H A;  4BBR G;  2CW0 C;  4DXF A;  1V1P A;  1XYI A;  1PRT B;  1WFQ A;  1KLG D;  4AH6 A;  1B53 A;  2WB1 E;  3EA6 A;  1QJO A;  4LMQ D;  5JEA G;  1VMP A;  1QIL A;  4J15 A;  5GAD C;  1XMO L;  1EFW A;  3PO3 H;  1E3P A;  2ZXP A;  3RN2 A;  5ELD A;  4EQO A;  3J81 L;  3GTQ B;  3FPU B;  3N6R A;  1DOL A;  1MSG A;  2C35 B;  3DHQ A;  5FLM H;  1ASY A;  3C46 A;  3SDZ A;  1UE1 A;  2YYZ A;  4TVA B;  2VQE Q;  4G7H C;  1HA5 A;  3VR6 A;  1MD2 D;  3S14 B;  4A3E G;  4C3J G;  4LUO A;  2XTI A;  3NE5 B;  5DAU A;  3TP6 A;  2PQE A;  4RWS C;  1HUM A;  3URY A;  4LAA A;  1TS3 A;  3FKI B;  3VA7 A;  1NSN S;  1HRJ A;  1Q3L A;  1KL9 A;  3PGZ A;  1BVS A;  3LWE A;  1E24 A;  3P1H A;  3D0F A;  5GQO A;  3C1E A;  4LF6 L;  3I4N B;  3ULJ A;  1VQM A;  2BA1 A;  5C4J H;  2UXB L;  2UUB L;  1Y1V H;  1DOM A;  3A56 A;  4B3M Q;  3SHL A;  4FVM A;  3NQT A;  4O0A A;  3NEN A;  1PTO F;  1JCK B;  1PTO D;  1LT3 D;  4DXG A;  4A3K G;  1G2T A;  1SYG A;  3K81 C;  5LMU Q;  2HIX A;  1U4R A;  3UDG A;  2VS1 A;  1E2V A;  5CBA E;  2NWG A;  1Q46 A;  3TBI B;  4CGY B;  1KC8 C;  1JWS D;  3C2P A;  3CCV A;  1JB3 A;  3E0E A;  4ZQ3 A;  4X3T A;  4DGZ A;  5M3M B;  3GD7 A;  2NTS A;  4JI8 Q;  5I2Y A;  2K14 A;  3K6O A;  3HOZ G;  3I4M H;  2EZV A;  4DV5 L;  1MKH A;  1ICF B;  1PH3 A;  2RSO A;  5DM6 3;  2RA4 A;  1ESR A;  3K80 C;  3CCQ A;  1A15 A;  4LF9 L;  1A8V A;  1LUZ A;  3TEH B;  1N8R C;  1LTL A;  2N88 A;  1KNE A;  2C5C A;  3KJP A;  5HGT A;  4OIJ A;  5JJI A;  4XTC S;  3PO2 G;  1A3U A;  1IW7 D;  1RJT A;  2IW3 A;  4DUZ Q;  4JYA Q;  3J80 E;  3HEJ A;  4Q5V A;  2KCT A;  1Q7Y C;  2XVS A;  1PH9 A;  2F0E A;  4YCV A;  3QR8 A;  2I0Q A;  1SDF A;  2KCC A;  2ZM6 L;  2FXQ A;  3HOW H;  1CA6 A;  3E9I A;  5T1I A;  3HOU B;  1S3O A;  4FYD A;  1O78 A;  2PQA A;  4CJ1 B;  4JI2 L;  4B3S L;  2A69 C;  4KJN A;  3U58 A;  5JEA J; 
#chains in the Genus database with same CATH homology
 3VR4 A;  1PTO B;  5CV7 A;  3VYU A;  1RD9 D;  1SMY C;  2Q8R E;  1DOK A;  1SNQ A;  3OW7 A;  2ZXO A;  4K8I A;  3TDQ A;  4PNY A;  1JWM D;  3IFD A;  5C4Z A;  2B2T A;  5C0X I;  2F03 A;  5KEE A;  1OXV A;  3FVQ A;  4S3S A;  2WAC A;  4K6D A;  2QDB A;  1J8I A;  4RGO S;  2X6L A;  4AYB B;  4A93 B;  3P7J A;  2HUG A;  1DCZ A;  4V19 0;  4CBV A;  3S17 B;  5C4X B;  3GTK B;  2BE5 C;  4XQQ A;  5KRU A;  3GTG B;  4ZUJ A;  1U4P A;  5ELB A;  4U68 A;  5G3L F;  5G3L D;  1AZQ A;  1S5E D;  1EU4 A;  2PZW A;  1H9S A;  3MXN A;  2EYH A;  4L63 B;  5JVG 3;  2D9U A;  1KDC A;  5D14 A;  4ZKC B;  4IFD H;  4G57 A;  2J7Z A;  1CHQ D;  3O13 A;  3FDT A;  4RKB A;  2JE6 I;  1RF2 D;  1MBY A;  4C3I G;  5K36 H;  5DEH A;  4IAL A;  4A3G B;  1FNU A;  3RZD B;  2A6E C;  3NXW A;  4C3H G;  3V05 A;  1DYQ A;  1TS2 A;  2EXZ A;  2PYK A;  4FP5 D;  4A3F B;  5FLX L;  3PIP 3;  1CK1 A;  1B4O A;  4QB4 A;  2K28 A;  3K57 A;  4A3I B;  3NP8 A;  1LO5 D;  1ML0 D;  4WOR A;  2L12 A;  2F0L A;  3VYR A;  4C1N K;  4HAE A;  2PW5 A;  4R9W A;  5C0X G;  2AUJ D;  1PDQ A;  1TS4 A;  4B9W A;  1GUT A;  2E75 C;  2KVM A;  5C5L A;  2VUM B;  2IJ0 A;  3VA5 A;  4ILW A;  4MIU A;  1FYC A;  2E2D C;  2M00 A;  4XYO A;  3GTL B;  5FOB B;  5E3F A;  5A35 A;  1STY A;  2EY6 A;  1QNK A;  2E2I B;  3WOF A;  3EVQ A;  4H7B A;  1GXD C;  3T4A C;  1TWH B;  3A55 A;  3DWA A;  3SEB A;  2O2L D;  5CC4 A;  5FK9 C;  1STE A;  1TWF B;  4KN4 C;  3PO3 B;  2ICI A;  1ET9 A;  3S1M B;  1TY0 A;  2EYL A;  3H6M A;  3Q6S A;  4N9T A;  1JE4 A;  3KF8 A;  3D4R A;  1Y69 U;  1F9P A;  2L0C A;  1S5D D;  1B2T A;  4ZYS A;  4QCL A;  3EJI A;  1TY2 A;  4BA1 I;  3J7A V;  1ESF A;  5JVH 3;  1B1Z A;  2PCF B;  3TP5 A;  4RCN A;  2R61 A;  1S4Z A;  3LX0 A;  2NTT A;  1SJH D;  4K5V A;  2X6G A;  1A2U A;  2ICE C;  1DM0 B;  1UAP A;  3NUC A;  3L9A X;  1Z7T A;  2BA0 A;  3Q0A A;  1GUO A;  5I6Y A;  4DN4 M;  3A54 A;  5EKK A;  1BF4 A;  2RDF A;  5D3D A;  5C0X J;  3HOX B;  1WD1 A;  1EY5 A;  1ROD A;  4TKO B;  3KBX A;  4QMG A;  2K05 A;  5I9O A;  3OIQ A;  4FF2 A;  1HFN A;  2LKV A;  2NVQ B;  4DFA A;  4HMI A;  2IX3 A;  5I4D A;  1Q1B A;  1WD0 A;  2QF7 A;  3J80 L;  4U67 3;  3P75 A;  2KJX A;  2K6A A;  1WTR A;  3K5N A;  4J1M A;  4YIJ A;  3MWY W;  4F88 A;  5IGB A;  2Q8I B;  1Y1W B;  1W6J A;  1G91 A;  2H4O A;  1LTT D;  2F0W A;  5EPK A;  1I3Q B;  1SYD A;  4QUC A;  1PTO H;  1ENF A;  3PUZ A;  1T5E A;  4UDU C;  1G8Z D;  3TSS A;  5FO9 B;  4K8J A;  4TQU S;  1BR9 A;  1EY4 A;  3NWS A;  3PMF A;  1R9T B;  4XT3 B;  2B8G A;  1SE2 A;  1IYU A;  1CQV A;  2M9V A;  3FMC A;  2RDG A;  2NYZ D;  5J39 A;  4E6I A;  3ND9 A;  5KYI A;  3IFT A;  1SXT A;  4DF7 A;  2PW7 A;  4MN3 A;  2OEO A;  2MJ8 A;  2TSS A;  1JC7 A;  5ELE A;  1GUS A;  1NR4 A;  1QE6 A;  3MFG A;  3Q23 A;  2DNC A;  4KD4 A;  4FXG C;  4RKL A;  1IL8 A;  3K5O A;  1VF7 A;  5K36 G;  1TQO A;  1SBB B;  4FF3 A;  1TU2 B;  2JEA I;  3M7N A;  5CV4 A;  2MGS A;  2QCP X;  4HCS A;  1O7L A;  3MXG A;  4F87 A;  1HFG A;  2BDO A;  4KTA A;  1Y8O B;  2EVB A;  3M4O B;  4K6L A;  1AZP A;  2A69 D;  1EEI D;  4QUF A;  1EL0 A;  3GTJ B;  1BUV T;  5EPJ A;  1A2T A;  1HTP A;  3MHB A;  4N9P A;  4IZ8 A;  5FLX E;  1YNN C;  2SOB A;  3WOE A;  1SMY D;  2DN8 A;  1EFI D;  3GV6 A;  3HP3 A;  2F0N A;  3HOV B;  2WIN B;  2SEB D;  2B2V A;  4TRD A;  5EGT A;  2IT1 A;  1S5B D;  5FO7 B;  2R7Z B;  5FO8 B;  4K2L A;  3NPP A;  2JYO A;  2RBM A;  1HPC A;  4XQJ A;  2F0O A;  2F0Q A;  1SND A;  2OF1 A;  5DNF A;  5EQ0 A;  3BZD B;  5IOD A;  1M8A A;  4CKB A;  2BE5 D;  2EY2 A;  4BBS B;  2HCC A;  1F2L A;  4KJO A;  3S16 B;  2Q8T A;  3W2D A;  3HGB A;  3KUP A;  1EZ6 A;  2F0K A;  4IUU A;  4KK7 A;  1WTX A;  3PIO 3;  1Z6H A;  3I3C A;  5JPN C;  2PPB C;  3RMH A;  4C56 C;  5CYU A;  1HXY D;  3DXJ C;  2A6E D;  4FO2 A;  2E2H B;  4K2K A;  3TZD A;  1STH A;  3S9W A;  2K5Q A;  2G9D A;  3X3M A;  2B2U A;  3ITP A;  1I6V C;  5HUR A;  4R8N A;  3D6W A;  1HHV A;  3A7A B;  4KMU C;  2HQE A;  4B08 A;  3M3Y B;  5KYL A;  3R2I A;  5LL6 S;  1OXS C;  1A3V A;  4K5W A;  3RD4 A;  3DUZ A;  3MZ5 A;  3S1N B;  2L55 A;  1EIG A;  1DXM A;  1PFN A;  1W6K A;  5C44 B;  1EQV A;  3I8Z A;  2AWO A;  2KHS A;  2MUY A;  2F0I A;  5FKA C;  1FD7 D;  5AFW A;  1KLU D;  1EQT A;  1IKL A;  5E4W C;  5JPM C;  1IKM A;  1RTN A;  1CI3 M;  2FJ2 A;  5LHY 1;  1F77 A;  3JAM E;  2IX1 A;  1KNA A;  1BOS A;  2MPM A;  2A5H A;  5CGK A;  4XQN A;  2NUC A;  1QNU A;  5ISR A;  1I4R A;  3T51 B;  2PZU A;  2AQ1 B;  3C3L A;  2RQX A;  1SYB A;  3NBH A;  1LTS D;  1RKN A;  4WRD A;  2HCI A;  2FMM A;  3QO2 A;  4WJW A;  1GHK A;  3T13 A;  2B2V C;  1KTK A;  1Q1E A;  4OIK A;  1STB A;  3P20 A;  2K04 A;  3VR2 A;  5C5M A;  4CJ2 C;  2XSC A;  2SNS A;  3H09 A;  1PXU A;  1MSH A;  2Y0S B;  5C3E B;  2F0P A;  3R2T A;  3SK5 A;  3WDN A;  4QF4 A;  3T53 B;  1EIH A;  4KHZ A;  1OO9 B;  1AN8 A;  1ONL A;  2LFN A;  1NAP A;  2NVT B;  4G4K A;  4X3K A;  1GUG A;  5M5Y B;  2QIL A;  2F0T A;  1STA A;  1Z47 A;  4ULL A;  4NKL A;  1EEF D;  2DY7 A;  4KHV A;  1ZEQ X;  5I9P A;  4FXK C;  4IQZ A;  4P2C B;  4OO1 H;  1V1O A;  5CV9 A;  2JA5 B;  3ONA B;  2WP8 J;  4CHT B;  3SK6 A;  4NDX A;  1EYA A;  1S5C D;  1Q12 A;  5T1G A;  1STN A;  3Q22 A;  3E5S A;  1GOZ A;  2Z4I A;  1XWE A;  1RTO A;  3NSW A;  1KAB A;  3HZX A;  2B2U C;  1ET6 A;  2NVX B;  3LWU A;  1GUW A;  4DA2 A;  1JOR A;  2WII B;  4BWG B;  3D4W A;  4NMZ A;  2NVY B;  1SYE A;  2KA7 A;  3H3V C;  3IL8 A;  1V43 A;  3CKI B;  3VR3 A;  3TP8 A;  1BCP C;  2LMC B;  5A2Q E;  2A73 B;  2SDF A;  2F3V A;  1SNM A;  4DNR B;  5C3W A;  1HCZ A;  2RVL A;  1B3A A;  1EZ8 A;  3OOC A;  1QWY A;  2JA6 B;  3H94 A;  1O80 A;  2L9H A;  1TVX A;  4Y7N B;  2L11 A;  2G9H D;  1F9S A;  1ZXT A;  4KY6 A;  4M8A A;  2E76 C;  3U9O A;  3MVV A;  1ENA A;  4DAP A;  4ZLT F;  1BXT A;  3BYY B;  2F0D A;  1GUN A;  5BN5 A;  1SNP A;  1NR2 A;  1UNS A;  5EBD A;  1YNN D;  5I6W A;  5EJW A;  4RA8 A;  1LAB A;  1BNZ A;  3GTO B;  1DJR D;  2K5D A;  3F2U A;  1A3T A;  2B2T C;  5JEA H;  4DK1 A;  1WVL A;  3CU7 A;  3M4Y A;  4XXE A;  3QJY A;  1F9R A;  1Q8I A;  3V96 A;  3VYS A;  2EYF A;  2J4X A;  3SK4 A;  2YU9 B;  4HTH A;  2NN6 H;  2X69 A;  4IUP A;  3QWN A;  1SNC A;  1D1K A;  4KY5 A;  2B8F A;  5BN3 A;  1TKW B;  4OO1 I;  4RFB A;  1B44 D;  1SE3 A;  4IFD I;  1J9O A;  2Z4H A;  4CKC A;  2CW0 D;  2JP1 A;  3D6C A;  4OGQ C;  3JAM L;  1WCM B;  2NB0 A;  2E2J B;  4XIG S;  2LS0 1;  1HQR D;  5M3F B;  5M5W B;  3K0Y A;  4BS9 A;  3I72 A;  1E2Z A;  1LT5 D;  2RDH A;  3NTH A;  1EY0 A;  2B39 A;  1O7Z A;  2JA7 B;  4FXD A;  3T16 A;  1ILQ A;  5CR3 A;  1LTA D;  5J22 A;  5I2X A;  4ZAI A;  3SR1 A;  1HQM C;  3A8J E;  5M9O A;  4ZK9 B;  3RLF A;  1Q90 A;  1I50 B;  3H0G B;  1DON A;  1TR5 A;  2R93 B;  4HCE A;  2A68 C;  3OSO A;  4OL7 A;  1EYC A;  3CQZ B;  2F0F A;  1OXU A;  2OXP A;  2ID0 A;  2K32 A;  3MEH A;  4L6T B;  1F2Y A;  2DY8 A;  4LJZ C;  1PFM A;  4H44 C;  2F4I A;  4LK1 C;  3W3A A;  4EGV A;  2L5T A;  4DAV A;  4I7Z C;  2K33 A;  2F1M A;  5IGC A;  5KND A;  3HG9 A;  3K5M A;  1PFB A;  4OO1 G;  1IYV A;  3NHH A;  2CHB D;  4IFD G;  4K5X A;  3TME A;  1VMC A;  1I4P A;  1EY6 A;  1V8Q A;  1B9M A;  1WTP A;  1SYF A;  1LAC A;  2SNM A;  5IGG A;  1RDP D;  1SNO A;  3OPO A;  1CQF A;  4FF1 A;  1SAP A;  2WKC A;  1QB5 D;  3OMG A;  3L3O C;  5IIF A;  2J0T D;  5CV8 A;  1X3Q A;  4ID6 A;  4PMC A;  4V0B A;  4KD3 A;  3NBI A;  1CA5 A;  1XXG A;  2O5J C;  4KN7 C;  5CMD A;  4PMW A;  3IAY A;  3MC0 B;  4K14 A;  1FNW A;  1RHP A;  4HSV A;  3D4D A;  1YNJ C;  1K8M A;  1TWA B;  1EY7 A;  1QCB D;  4Q0F A;  5A2Q L;  4L8J A;  3TZU A;  2AWN A;  3I90 A;  1JOO A;  5IGF A;  3I73 A;  3OHX C;  2KEC A;  1I4X A;  4FF4 A;  3OWF A;  5E4X A;  2FHT A;  5TSS A;  1JR0 D;  1X3P A;  4A3J B;  1CFM A;  3BVZ A;  5CV6 A;  1JQY D;  2XWB B;  1NCV A;  2WAQ B;  3M7G A;  3GV3 A;  1JWU D;  1CT1 D;  2XNA C;  3J7Y W;  2FFK B;  1EWC A;  2BOS A;  4H0L C;  3SVM A;  3BVM A;  3BYT B;  2VXW A;  2O4X A;  4PV1 C;  3GO5 A;  1ICW A;  1SYC A;  3FEW X;  3LNN A;  2EJM A;  1XX8 A;  1PZJ D;  2L1B A;  4IFD J;  4UAI A;  3QIA A;  1D6E C;  5C3X A;  3OIP A;  5NUC A;  4KKT A;  3TP7 A;  3S2D B;  2PZT A;  2VB2 X;  1R4Q B;  2EYM A;  4C2M B;  1H9K A;  3VYT A;  4BBR B;  4CKE A;  1KDA A;  4J6H A;  1SE4 A;  3PV0 A;  1BCP F;  1L0X B;  1BCP D;  2K1B A;  4ME5 A;  1D5X C;  4RAU C;  4ZRZ A;  5JJZ A;  1WTQ A;  4G7Z C;  2NN6 G;  1V1P B;  3CRL C;  3BVG A;  3MAQ A;  4IUT A;  1K8O A;  5KIX A;  2LY7 A;  3RUZ A;  4A3E B;  4C3J B;  2AUK A;  3BS1 A;  2VNU D;  5KNC A;  3FRP B;  2JEB I;  1S5F D;  3DM1 A;  2L4N A;  5IT9 L;  3E0J A;  2WV6 D;  4FNF A;  3S2H B;  3FPP A;  1D5Z C;  4A3K B;  1U9R A;  2BDN A;  2QEJ C;  3Q24 A;  2R3Z A;  3K7A B;  3MFY A;  3PUV A;  1JOQ A;  2JSO A;  2HDM A;  1BCP B;  1WTV A;  2IX0 A;  4EQN A;  2ZXR A;  4IUQ A;  3G7L A;  3A8K E;  3GTP B;  3HOZ B;  2F0M A;  3RZO B;  5KGU A;  4DK0 A;  2OT2 A;  3MA2 B;  3AMU A;  1H9J A;  1PYW D;  3MXU A;  3K59 A;  4DAY A;  5EPL A;  3V2T A;  3NK9 A;  3PO2 B;  2NBF A;  1QG7 A;  1PLF A;  2EYJ A;  2WKD A;  1G29 1;  2NZ1 D;  1AP0 A;  1LV9 A;  2JXM B;  2KOL A;  1PRT C;  2A6H C;  1CHP D;  1SSO A;  2PNR C;  2F3W A;  2A74 C;  4R8I A;  3D8G A;  5K5P A;  1I6H B;  2FIN B;  4KKU A;  1D2B A;  1ZKO A;  3PUY A;  5D3I B;  2KQ3 A;  4NP5 A;  3S1R B;  2EJG C;  3PUX A;  2FMC A;  2F0G A;  4IUV A;  2IWH A;  3SE0 A;  4M1U B;  5EKL A;  1CM9 A;  4RCO A;  4QIW B;  5EKI A;  4H13 C;  4IUN A;  2D62 A;  1TT2 A;  2EY1 A;  3S1Q B;  1MI2 A;  1ZYR C;  3HKZ B;  4MHE A;  5IOC A;  4XT1 B;  3HOY B;  5D65 A;  1LTI D;  1PMR A;  2R92 B;  2IL8 A;  2MHV A;  1AW7 A;  2K03 A;  1BBX C;  1STG A;  3ERO A;  2E74 C;  2O5I C;  1C4Q A;  5CBE E;  3UI2 A;  3M85 A;  3G6J B;  4TSS A;  2RKS A;  2A68 D;  2EYP A;  2K5W A;  1GJX A;  3GTM B;  1CZG A;  1E2W A;  2XWJ B;  1H9S B;  1OXT A;  1L0Y B;  4C3I B;  1I4G A;  1F2Z A;  3BDC A;  3SK8 A;  2H1E A;  2MP1 A;  4C3H B;  2F0U A;  1D1I A;  4OHJ A;  1A6X A;  2EYO A;  3KLS A;  3ZYY X;  1KDB A;  3KLS X;  4I65 A;  4HMJ A;  1R4P B;  5KNB A;  2D5D A;  3X3N A;  1FR3 A;  5ELF A;  3CRK C;  2B2Y A;  1ILP A;  1PZI D;  3AB9 A;  1BQQ T;  2M2L A;  2ZT9 C;  3R3O A;  2CVR A;  3HS0 C;  4KI0 A;  3D3R A;  2GA4 B;  1X32 A;  3D31 A;  1PTO C;  2F0V A;  4BY7 B;  3MTS A;  1EYD A;  1SJE D;  1Y8N B;  5ELC A;  5COY A;  4XDX A;  3U9S A;  4DNT B;  2CQA A;  4RHS A;  1SEB D;  4HN7 A;  1M4V A;  3MXP A;  3QOL A;  4RH6 A;  1EOT A;  4HSP A;  2PMZ B;  1Y8P B;  4O42 A;  1PZK D;  1LT6 D;  4J8Q A;  3GQB A;  2B2W A;  2XRQ D;  2KED A;  3GP7 A;  1LT4 D;  1SFO B;  1YNJ D;  1VCI A;  3K5L A;  2AQ3 B;  5EBC A;  3PUW A;  1IW7 C;  3J81 E;  4O1N A;  4KY7 A;  4WFN 3;  3BDO A;  4EQP A;  3R93 A;  1JIC A;  2R6G A;  1G2S A;  2TMP A;  3BDL A;  3BG3 A;  4DU9 A;  4PQX A;  3K58 A;  4RGN A;  2D2C C;  1CZW A;  2I07 B;  4RHR A;  4X3U A;  5C4J B;  1Y1V B;  2XN9 C;  4JBW A;  1XTC D;  1RCV D;  2JA8 B;  4F8M A;  3EFX D;  2Z8L A;  5E1F A;  5C6A A;  2V4D A;  3DWQ A;  1B50 A;  5IT9 E;  3I4L A;  1HUN A;  1VDZ A;  2F0J A;  4ZUI A;  1T5X D;  1KAA A;  2QKI C;  2IPK D;  3EQL C;  1H9M A;  5JOB A;  1VF5 C;  4B9X A;  2ENB A;  3KK7 A;  4ODG A;  3J7A F;  1IHZ A;  3I4M B;  1C48 A;  1HTL D;  4KV6 A;  4JK1 C;  1F2M A;  3I91 A;  2KUM A;  1HA6 A;  4RGM A;  1B9N A;  1QOH A;  5J1Z A;  5CV5 A;  4CJ0 B;  1MGS A;  2KEE A;  1WTW A;  1DD2 A;  1AFP A;  1FNV A;  4ABN A;  3DEP A;  3A8I E;  4RGT A;  5BN4 A;  1E0B A;  3HOW B;  5DM7 3;  4EVO A;  4HR7 B;  3DWP A;  3L7Z C;  1F9Q A;  4NW2 A;  3KBG A;  1I4H A;  3I70 A;  3OWE B;  3QB3 A;  5IGE A;  4IUR A;  2K7V A;  2B2Y C;  1BO0 A;  4IN3 A;  1ENC A;  1H9R A;  4GZY C;  3SXH A;  1O7Y A;  1OXX K;  2I46 A;  2BCO A;  3IKJ A;  1GHJ A;  2EY5 A;  1NUC A;  1EY8 A;  3CHB D;  2F0H A;  2EPB A;  2N55 A;  3NTK A;  2VB3 X;  4XYQ A;  1LTR D;  3C1F A;  1FGB D;  4G7O C;  3KLR A;  2EJF C;  1I4Q A;  1LTG D;  2B2W C;  3OMC A;  1DZ1 A;  3ERQ A;  2XIW A;  1JOK A;  2B63 B;  1CTM A;  1U4L A;  3R8B A;  1TWG B;  2XRS D;  1UUP A;  5COR A;  3NWT A;  2C9O A;  1TS5 A;  3A7L A;  3ND8 A;  2F0S A;  4BY1 B;  3QOJ A;  4ZKB B;  5JAV A;  2KCN A;  4KKS A;  3NQI A;  3TN2 A;  1LTB D;  4A3M B;  4BA2 I;  3AU7 A;  1PRT F;  1PRT D;  2A6H D;  2NN6 I;  1K83 B;  1TII D;  2K01 A;  1C8C A;  3H91 A;  3HRZ C;  1WTO A;  4C1N I;  3E6Z X;  4F7X A;  4HED A;  2AQ2 B;  3NTI A;  2WB1 B;  1II3 A;  1G6Z A;  3DMU A;  1LLR D;  2Z1C A;  4A3B B;  2PO4 A;  5LL6 X;  2EDG A;  1D5M C;  3T56 B;  1TWC B;  5C0X H;  3VR5 A;  1UEA B;  4X3S A;  2EE1 A;  1EWH A;  2DNE A;  1EY9 A;  4PMB A;  5IGD A;  1EU3 A;  5F2D A;  1ZYR D;  4Z9C B;  2HDL A;  3S15 B;  1BDO A;  1U4M A;  2RSN A;  1AEX A;  3DEO A;  5M5X B;  3QG1 A;  2EOT A;  3N52 A;  4A3D B;  5C4H A;  2CW0 C;  4DXF A;  1V1P A;  1XYI A;  1PRT B;  1KLG D;  1B53 A;  3EA6 A;  1QJO A;  4LMQ D;  5JEA G;  1VMP A;  1QIL A;  2ZXP A;  5ELD A;  4EQO A;  3J81 L;  3GTQ B;  3FPU B;  3N6R A;  1DOL A;  1MSG A;  3DHQ A;  3C46 A;  3SDZ A;  2YYZ A;  4G7H C;  1HA5 A;  3VR6 A;  1MD2 D;  3S14 B;  4C3J G;  3NE5 B;  5DAU A;  3TP6 A;  2PQE A;  4RWS C;  1HUM A;  3URY A;  4LAA A;  1TS3 A;  3FKI B;  3VA7 A;  1NSN S;  1HRJ A;  1Q3L A;  3LWE A;  3P1H A;  3C1E A;  3I4N B;  2BA1 A;  1DOM A;  3A56 A;  3SHL A;  4FVM A;  3NQT A;  1PTO F;  1JCK B;  1PTO D;  1LT3 D;  4DXG A;  1G2T A;  1SYG A;  1U4R A;  1E2V A;  5CBA E;  2NWG A;  3TBI B;  4CGY B;  1JWS D;  3C2P A;  1JB3 A;  4DGZ A;  4X3T A;  4ZQ3 A;  5M3M B;  3GD7 A;  2NTS A;  5I2Y A;  3K6O A;  2EZV A;  2RSO A;  5DM6 3;  2RA4 A;  1ESR A;  1A15 A;  2N88 A;  1KNE A;  2C5C A;  5HGT A;  4OIJ A;  4XTC S;  1A3U A;  1IW7 D;  1RJT A;  2IW3 A;  3J80 E;  3HEJ A;  4Q5V A;  2XVS A;  2F0E A;  1SDF A;  2KCC A;  1CA6 A;  5T1I A;  3HOU B;  4FYD A;  1O78 A;  4CJ1 B;  2A69 C;  4KJN A;  5JEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...