5NUCA

Staphylococcal nuclease, 1-n-pentane thiol disulfide to v23c variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 36
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5nucA00
2LKVA 4ZQ3A 3SHLA 4IUNA 3SXHA 2F0JA 4ID6A 5CV5A 3MVVA 3NK9A 1SYFA 1SYDA 4E6IA 1TT2A 3SK6A 3MHBA 3NQTA 3OMCA 3SK5A 5I9OA 4RKBA 3R3OA 2PW7A 1EYAA 2RKSA 4ODGA 3TP7A 2PW5A 3C1EA 1RKNA 4WRDA 3S9WA 1ENAA 2PZUA 5J22A 1F2YA 3ERQA 3E5SA 4B9XA 5K5PA 2F0MA 2F0VA 2F0KA 2F0NA 2QDBA 4EQOA 1ENCA 4EVOA 5KIXA 3P75A 3BDLA 1A3VA 4ZUJA 4KJNA 5M9OA 1EY6A 5J39A 4HMJA 1KABA 1SNPA 1STYA 2ENBA 3D8GA 4KV6A 4K5WA 4N9TA 4NP5A 3RUZA 1JOKA 2EYLA 4J1MA 5CV8A 1SNOA 1KDCA 3HEJA 3NP8A 4PMBA 1SNDA 4YIJA 5JOBA 5NUCA 4F8MA 5F2DA 2SNSA 3MEHA 4DGZA 2F0GA 5IGEA 5KEEA 5EGTA 5KYLA 1EYCA 3OWFA 4K2LA 4KY7A 3MXPA 5IODA 5IGFA 4K5VA 3EJIA 1A2TA 2EY2A 2PYKA 2PZWA 4KJOA 4DFAA 5CV4A 1JORA 4K2KA 1F2ZA 3LX0A 5C3XA 4WORA 3TMEA 2OEOA 4I65A 4K5XA 5C6AA 1A2UA 3OMGA 1SNQA 3EVQA 1EY8A 5CV9A 2EXZA 2WACA 5J1ZA 1NSNS 1STBA 2F0EA 4KY6A 5CV6A 1SNCA 3H6MA 3BDCA 3EROA 3P1HA 3U9OA 3TP5A 3V2TA 4KY5A 5C4HA 5CC4A 3SK8A 1STNA 5I9PA 2EYJA 3ITPA 4J6HA 1EQVA 4K8IA 2EY6A 1JOOA 3QB3A 4F7XA 2O4XA 5IGDA 4KD3A 5CR3A 3TP8A 5HGTA 5JAVA 1U9RA 2OF1A 4EQPA 2F0TA 4LAAA 4PMCA 1KAAA 1EYDA 2F0DA 1STHA 3NUCA 4K6DA 5C4ZA 5KYIA 4R8NA 4KD4A 4HMIA 2F0PA 1EY4A 2EY5A 2F0OA 2SNMA 3NXWA 1STAA 1F2MA 3QOLA 3D4WA 4G57A 4MIUA 3D4DA 1TR5A 4RKLA 4DF7A 2F0FA 5I6WA 2F3WA 5E1FA 2F0WA 1EY7A 1SYBA 3NHHA 4ZUIA 4B9WA 2F0QA 2F0HA 3OSOA 2F0LA 1TQOA 2HQEA 5EKLA 4S3SA 4NKLA 5DAUA 1AEXA 3C1FA 5ISRA 3SR1A 2EYOA 1A3TA 4H7BA 4DU9A 4KHVA 3QOJA 3SK4A 5IGCA 1KDBA 2EYHA 4ME5A 5I6YA 2M00A 5KRUA 5E3FA 1EZ6A 1SYGA 3DHQA 5HURA 4K14A 5C3WA 4PNYA 1EZ8A 5EKKA 2F0IA 3HZXA 2EYFA 4KTAA 2SOBA 2PZTA 3D6CA 4NDXA 1A3UA 5CV7A 5CGKA 2KHSA 1JOQA 4K8JA 3TP6A 2EYMA 1SYCA 5IGGA 2EY1A 2F0UA 4OL7A 3T16A 1SYEA 3VA5A 1II3A 1KDAA 5IOCA 5IIFA 2RDFA 4QB4A 2F3VA 2OXPA 1EY0A 2F0SA 2PQEA 5C5LA 4HTHA 4IALA 4IZ8A 1EY9A 4QF4A 4QMGA 4TRDA 2NUCA 5C5MA 5KGUA 1NUCA 5DEHA 1IHZA 2RBMA 4N9PA 3DMUA 4NMZA 3T13A 4EQNA 1EY5A 2KQ3A 3MZ5A 1STGA 5IGBA 1SNMA 2EYPA 3PMFA
chains in the Genus database with same CATH superfamily
2GVAA 1DOKA 4YY3Q 1VF7A 2VQEL 4H02A 1R4QB 3MXGA 3GTKB 5IYBH 4E6IA 2RDHA 3OMCA 5GQOA 3X3NA 3M4OB 2EJMA 2NN6I 3RZDB 2Z8LA 2HD3A 4JG2A 4A4IA 2JYOA 1H9SB 1N32Q 2OCEA 2DY7A 2F0KA 4KHPQ 3EN2A 4A3DB 2P5ZX 4N9TA 4XQJA 1SNOA 1KDCA 3K5LA 4MTKA 1E2WA 5COYA 5KYLA 1TKWB 4BY1H 1YJNA 1PA6A 1A15A 1MD2D 4LFAL 3DUZA 3QJYA 5C3XA 4J8QA 3IAYA 1B53A 1E2ZA 3CD6A 3I4MH 2E2DC 1SNQA 1F9PA 2EXZA 2PO4A 3NENA 1JJ2A 2KVMA 2NYZD 2XTIA 3GTLH 2UXCQ 5JAVA 4CDEC 2ID0A 1BNZA 2H4OA 3G71A 4DV3L 3M3YH 5LMNQ 4ABNA 1I3QB 2YTYA 1YNND 2L15A 5ELCA 1EY4A 2F0OA 2WV6D 3PQIA 2N55A 2EZVA 1Q86C 5IYCG 1EQRA 2H5XA 2F0WA 1PZKD 5AJ3L 2Q8RE 1Z6HA 4UY8C 2TMPA 1NMGA 1NTGA 4S3SA 4BBSG 2E8GA 2UU9L 3D0FA 4JYAQ 1E24A 5ISRA 1K28A 3V05A 1PZJD 1CZGA 1V8QA 3F8TA 3U58A 1GM5A 1T9HA 1SRUA 3T4AC 3PF4A 3DHQA 4LF6Q 2A6HC 4DR3Q 3HZXA 5BR8L 2UXBL 2I5HA 1OTCA 1ZYRC 1Z47A 3WOFA 2K32A 3DM3A 2KHJA 4K8JA 1DZ1A 1SYEA 3MXNA 2IJ0A 2RDFA 1BQQT 5GROA 2AUKA 1FJGQ 3GTKH 4EQNA 2ZJQA 2R7DA 1EY5A 1DGSA 2RQXA 3TZUA 2UUCL 3M4OH 2B2WA 1KXLA 2EXDA 3W1BA 3RZDH 5EKIA 3CRKC 1H9MA 5CV5A 3K8AA 4LK1C 3TRZA 1ZXTA 1IW7D 4CDFC 1OXSC 3T1YQ 1NAPA 2C35B 4LFBQ 1NBWA 1VQHA 1IBLQ 2GN5A 2E2JH 1YITA 4A3DH 5C0XI 3E5SA 1HZBA 2F0VA 1B7YB 1VCIA 4EVOA 1NCVA 1DCZA 4IPCA 1DXMA 4IURA 1HTPA 2DUDA 4A3LH 3K5OA 4A3BG 2PNRC 4GNXC 2LMCB 1V1PB 2NN6H 1B44D 1QG7A 2AWNA 3OW7A 4WFN3 3S16B 4JBKA 3KFUA 1CUKA 4OELB 4ZRZA 1XMQQ 3LGJA 1PVOA 4K2KA 2DGYA 1F2ZA 2X6LA 4A75A 1HRJA 4GOPB 5FK9C 2B8FA 3TP7A 3HOVB 4BBRB 2UXDL 2ZJRA 4DK6C 2J4XA 2KEDA 1MJEA 3HOXB 1I3QH 3L2PA 2ICIA 2OQKA 2MQHA 4V0BA 3NBHA 4N8FA 1STHA 2RA4A 3FMCA 3A5UA 1PTOF 3R8BA 2QEXA 1MKHA 2NB0A 1F2MA 2I5MX 5LL6X 5GADC 3UDIA 1AH9A 3EBEA 1L0WA 4KN4C 3AB9A 1S4ZA 4JI0L 3CC2A 3MTSA 1XX8A 4IPGA 2RSNA 3ULPA 3SK4A 5I6YA 3KBXA 1X56A 3KBGA 2HHHL 1WI5A 2BH8A 3KLSX 4K0KL 1AFPA 1B50A 4B3SL 3HKZG 4LF8Q 3BS1A 1EIHA 1CHQD 3J7AF 5AFWA 3KLWA 3GTMB 1RHPA 2F3VA 4CKCA 2XGTA 4GN3B 1YZ6A 3HKZE 1XPRA 1YJWA 2KCMA 5JJKA 1IHZA 1TU2B 2KQ3A 2WIIB 4ZCKA 1YNJD 2Q2UA 1XNQL 3PF5A 2D62A 3FKIG 4V190 4JI7Q 2L5TA 2IPKD 1BBXC 2PW7A 1JWUD 1SXTA 1EQTA 4CBVA 1FL0A 5J22A 2EIFA 1RD9D 2NVYB 2Z9HA 4X65L 3FHWA 3X3MA 4LNQA 4NXNL 1KRSA 4A3KG 2LFNA 1A3VA 3MFYA 4KJNA 1B3AA 3S16H 1KABA 1WTHA 3RUZA 4JVZA 4J1MA 4LF4L 2BA1A 1H9JA 1TXYA 5CV8A 4F8MA 3BU2A 1KAWA 1PRTB 5EGTA 1VQGA 2F4VQ 4RGNA 1WTOA 4X3UA 4OX9L 4PG3A 3TQYA 3MEFA 3HOVH 4KHZA 4BBRH 5FLXc 5IE8A 4K5XA 3BYYB 1IL8A 1R4PB 3GV3A 3IRBA 1YI2A 4FF2A 1MBYA 4EX5A 1RTNA 2G9HD 1HA6A 1QOHA 4LF7L 3B6YA 1EYDA 1BR9A 3NUCA 4K6DA 2CQOA 2DNEA 2F0PA 1TWHB 4NW2A 1EIGA 2OTLA 1SYBA 3MC0B 2ZT9C 4IUPA 1GUOA 1FGBD 4EGVA 2VS1A 4NKLA 2HDMA 3U9SA 5JVH3 1ASZA 4FO2A 5JVG3 2I46A 3QOJA 2E2IB 2K28A 1G91A 3A0JA 4X64L 2K7VA 5C3WA 1I6HB 1B1ZA 1B4OA 1HFGA 1LT4D 3EA6A 3GTMH 3GTGB 1Q81C 1A3UA 1EFID 2K5VA 1CI3M 3TP6A 3T16A 4IFDH 3KDFB 4LUVA 2AQ2B 2AUJD 5ELEA 1QCBD 1QNKA 2ES2A 1D1KA 1C8CA 2NUCA 1GOZA 4A3IB 2RBMA 4JI1Q 1Y14B 2PI2A 1PV4A 1Y1VB 2GVBA 4DV1Q 2NVTB 1UE6A 1UE5A 2C5CA 3G7LA 1SN8A 3KF8A 2MP1A 1PH6A 5FO9B 3GTPB 2NVYH 2K5WA 2CW0D 4XIGS 5C4XH 1I4GA 3VA7A 2VZAA 2J0TD 2KUMA 3A8KE 2A1AA 1XMOL 3F2BA 1PFMA 3Q6SA 2QKIC 4X66L 1MHWC 4DXFA 2KCTA 1PMRA 1X54A 1S5ED 5ELDA 4BA2I 2A6EC 2HDLA 4HJ9A 1HNWQ 1S5BD 4XQNA 2G5DA 2N8NA 3DWPA 5ELNA 4A3CH 1R9TH 4DGZA 3JAML 4G7HC 4DR4Q 3PV0A 1G2TA 1X3GA 3OIPA 1JORA 3NQIA 5IP7G 3H09A 1VQMA 1EU3A 1EUJA 1N33Q 4DNRB 1CA5A 2O5JC 3PO3G 1AW7A 3K5MA 3RR5A 2Z0SA 1TWAB 3RN2A 3W1GA 5CR3A 1VMCA 2JN4A 4JI6L 1TWHH 3VDYA 5LMNW 3ZJYC 1VQJA 3M7GA 4DAVA 4DPGA 1JE5A 4JI5L 3QOLA 5IP9H 1E1TA 1LTSD 5FO7B 1YHBA 3NHHA 4RWSC 4ZUIA 3HOVG 5IYDH 1J5EQ 2E2IH 3TN2A 1C0AA 1JJGA 2K14A 4OWXB 2WFWA 2JA9A 3BZDB 3HOXG 1Q90A 1I6HH 1J9OA 1DYQA 4BBSB 1UEAB 3GTGH 2M00A 1U4LA 3JAME 3I7FA 5HURA 1PTOD 3GQBA 2QF7A 4LUOA 2SOBA 5I4DA 3M7NA 5IWAL 3UDXA 3JAMc 4L5SA 2L4NA 2KCCA 4A3IH 1CKOA 3J81j 1Y1VH 3VR3A 2NVTH 3QWNA 1SMYD 4TRDA 5EBCA 2BE5D 4JCVE 5M3MH 1IKLA 1ICWA 3BZKA 5HGQA 3GTPH 2OQ0A 3MZ5A 4GNXA 1SNMA 2L11A 2E75C 5JPMC 1QILA 2WP8J 1SLJA 4DR2L 2I5LX 3QG1A 2WINB 3NQTA 2Z1CA 4B3RL 2RSOA 3KUPA 4DN4M 3BVMA 1EYAA 1Q1BA 1I5FA 3PUXA 1QZHA 4JI3L 2PZUA 1N36L 1LUZA 2WB1B 1UNSA 3ZYYX 1G6PA 1A0IA 3AFQA 2QDBA 4OO1G 1VQCA 1VQ9A 4C2MB 4HMJA 4HR7B 1JWMD 4TVAB 4H13C 4TSSA 3Q23A 2B2UC 4Y7NB 2JXMB 1BCPD 5IGEA 4QY7A 1IBMQ 1XTCD 3OIQA 4K2LA 1W6KA 1HHVA 4A3BB 1LTID 1SBBB 1YBYA 4DR7Q 1OXTA 3TMEA 3CXCA 3T51B 1YHQA 1TWAH 3I4NB 1H9KA 1LV9A 4DR5Q 3U9OA 4DNIA 3RLOA 4JC0A 1Z7TA 1STNA 3HOYG 1NJIC 2I07B 3GTJB 5IGDA 4A3MB 4HJ5A 1WVLA 4WJ3M 3G48A 1K83B 1U9RA 4UP9A 4LAAA 4P75A 3CF5A 1CA6A 2JEBI 4R8NA 2ZJPA 2CH4A 5IYCH 3STBD 4RKLA 3S17B 1LABA 1TR5A 3J81c 2A68D 1HZAA 4QIWE 4BBSH 4IN3A 1TQOA 4DV0L 3GO5A 3LWEA 5JJIA 1I4QA 4LWCA 4UHVA 1EZ8A 4LMQD 3U4ZA 4CJ1B 4IOCA 5C44B 1HNXQ 2KHSA 3E9HA 2VQFL 2AWOA 1I50B 3HKZB 5IIFA 3KJOA 2FFKB 1EY9A 2RHQB 2CWAA 1PRTC 5I2XA 3NPPA 3GTQH 1UE7A 3AYHB 3QR8A 3GTOH 2XVSA 2MO1A 3SXHA 2E5LL 2NVQB 3QIAA 1SE2A 1HR0Q 1Q1EA 2X69A 3FKIB 4DKAC 5A35A 1S5FD 1Y69U 2Z6BA 4L5TA 4H44C 4O2DA 1K8AC 5M5WB 4DV6L 1I94L 2J7ZA 2B29A 3PIPA 3TZDA 4BXXG 2L12A 3RLNA 4ZKBB 2F0MA 5JEAJ 5ELOA 5KNBA 1ENCA 4IO9A 1QJOA 4Y7NH 1FD7D 3P75A 2UUAL 4OONA 4JI8L 3BDLA 4H0LC 5CYUA 5J39A 1Y1VG 1K8OA 3N52A 2YTVA 4A3BH 2EYLA 4RGMA 4A3KB 2UXBQ 4DV7L 1CKNB 3NP8A 2Q8IB 2JJQA 2RHSB 1TWGB 1CQFA 1HQRD 5KEEA 2WKCA 3I4NH 4N8X1 4K5VA 4XYOA 1A2TA 5CV4A 4GN4B 1CFMA 5G3LD 3RLFA 5CBAE 2XSCA 4QQBX 3PIO3 2K03A 1PTOB 3BZCA 1GKHA 2ZXOA 3GTJH 2PI2E 4DV2Q 4MHEA 3EVQA 3KF6A 1K83H 1T5XD 2F1MA 2FINB 1X3PA 4KI0A 2EYJA 3ITPA 5FJ8H 1WTPA 3HOWG 2N49A 3S17H 4CGYB 1KLGD 3DEPA 5D3DA 4RCNA 1V43A 1B8AA 1S3OA 4HIMA 5LMUL 4L63B 4MNOA 4DUZL 2QDLA 1HUNA 5E1FA 4B9WA 3OSOA 2FHTA 4DV4Q 3N6RA 3IL8A 4YCVA 2WKDA 1J6QA 1XPUA 2V1CC 2KEEA 1JR0D 2BCOA 3FPPA 4GS3A 5CBEE 4H7BA 4B3ML 4ZLTF 3CCQA 1KLUD 4LF9Q 2N3SA 5KRUA 5E3FA 3U50C 5C44H 1EZ6A 3S1NB 1I50H 3I4OA 3A74A 3M4YA 3P20A 4CDDC 1OXUA 1C4QA 2PZTA 1N8RC 2B63G 1BCPB 2EY1A 1KD1C 3VA5A 1DONA 3WOEA 2RCNA 1YEZA 2OXPA 5FOBB 1SEBD 4IALA 2Y0SE 1CZWA 2M9VA 3MWYW 4N9PA 4DV5L 4GKKL 5A2QL 3CCJA 3FKIH 3OTOL 1Q3LA 2K75A 5M5WH 1LT3D 4OHJA 1A62A 3S24A 3BG3A 4DAYA 4YWMA 2KJXA 4OWTB 4AQYL 5M5YB 3C1EA 2KECA 2VB3X 1V1QA 5ELFA 3SGIA 2BOSA 3H91A 1WFQA 4A3KH 1PHJA 3D4RA 1ZKOA 4ZKCB 1KC8C 1KL9A 1TWGH 5EQ0A 1VF5C 1HZCA 1N34Q 4DR1Q 1UWVA 3MXNB 1L2FA 4TQUS 1HXYD 4YIJA 4DR6L 2XWJB 2CHBD 3KOJA 2VUMG 4JV5L 1EYCA 4HN7A 2FJ2A 1PTOH 4YY3L 4CJ2C 3K7AB 2WB1G 1RTOA 1VQAA 4GKJQ 1XWEA 4FNFA 5C6AA 3R93A 1UE1A 1NSNS 3F2CA 5A2QE 2EPBA 1N32L 5C4HA 3SK8A 2WB1E 4J6HA 1RODA 3ONAB 4K8IA 4KHPL 5FKAC 3PO3B 1L1OC 2JE6I 2RCFA 3CCMA 3W2DA 2MHVA 2X6GA 2EY5A 2B2TC 4NXMQ 3I4NG 1BO0A 4QCLA 2KA7A 1D2BA 2F0LA 1VQFA 3CMEA 1D8LA 2CKZB 1KRTA 1VQNA 2VNUD 2XN9C 5DAUA 1AEXA 3GV6A 3S1NH 4X6AH 4A3MG 3IFTA 2EYOA 1Q7YC 1K0SA 4G7ZC 2A74C 1PH8A 3D6WA 5FJ8G 3GDEA 4RFBA 4A3GB 2UXCL 5EKKA 4AH6A 1SE8A 2QCPX 2B2YA 1HH2P 4LW1A 4JK1C 3M4PA 1YHAA 4M1UB 5LMNL 1KTKA 1JOQA 4QL5A 1HJPA 4X3SA 3NBHB 5BN3A 1PLFA 1CHPD 5C5LA 4QF4A 4IFDI 4OO1I 2B2UA 1O7LA 1JT8A 5EPLA 4ZQ3A 5M5YH 4CHTB 3NK9A 1SYFA 1DOMA 5C44G 4RKBA 5FLXL 4LF6L 2HIVA 2YU9B 1RKNA 4DAMA 4DR3L 4PMWA 2AHOB 1F2YA 4A3EB 1CKMA 2Q2HA 4IPHA 4EQOA 1GHKA 1JB7A 4X3KA 4P71A 4R1JA 4YWKA 5M9OA 1EY6A 4OWWB 1D6EC 1K8MA 2EDGA 4RGTA 2EVBA 2A6HD 1GHJA 4JI2Q 3K7AH 4U673 4Q0FA 1AN8A 1PH9A 1Y8NB 1ZYRD 5DNFA 1BCPF 4YCWA 5JJLA 5IP7H 2PQAA 4IUUA 1A8VA 2OEOA 1LM0A 3T1YL 3OMGA 2ICEC 3PO3H 1EY8A 1YNXA 4LFBL 4LF5Q 3P1HA 4KY5A 3K7UC 1L0XB 2JSOA 1BXTA 5KNCA 1K3RA 4DNTB 2CFMA 2QEJC 3TP8A 2OF1A 3HOYB 4BY7G 2IT1A 1WTQA 3L0OA 3S2DB 5FLXE 2F0DA 2KBNA 1SFOB 4HMIA 4QIWB 2SNMA 2HQLA 3ERSX 1Q8KA 4X66Q 4RG1A 3K81C 4C3HG 4QGUA 1EY7A 4NPSA 1XMQL 1TWCB 3HOXH 1WYDA 1K3BC 1EWHA 1Z9FA 3BVGA 3SR1A 4A3GH 3KYHC 4P73A 3HP3A 4ME5A 2K50A 5EJWA 1C48A 3S1RB 3CPWA 2O5IC 1U4PA 2G9DA 1X6OA 4CDCC 1VQPA 1M4VA 5IOCA 1KDAA 1KNAA 1EOVA 4IZ8A 2ZTDA 2DN8A 4A3JG 1AE2A 2Z4HA 3CPFA 4IUNA 2YU9H 3ICEA 4HJ8A 2ZTEA 4EQ5A 4A93G 1NE3A 2JK8A 4JBMA 1X55A 3CP0A 4ODGA 3K5NA 2K05A 3TBIB 3S2HB 1AE3A 3ERQA 1IBKQ 4QUCA 5C0XJ 4LF8L 4OO1H 4F88A 2Z6KC 3HOZG 2F0NA 1XNRQ 2NWGA 2IW3A 1O78A 4ZUJA 4L6TB 1BBUA 1SNPA 3PUYA 5DLQE 4IQZA 3CQZB 1WTXA 3CCLA 1GJXA 4R9WA 4YCUA 4AIMA 1LYLA 3CW2C 4DFAA 1K8GA 1MI2A 4JI7L 4F87A 3LX0A 4I65A 3KF8B 5G3LF 1E22A 4O1NA 3HOYH 5CV6A 1SNCA 3K0XA 3ND9A 3V2TA 2CH4W 3S2DH 2K04A 5L37A 1LTBD 1B9MA 2F0TA 1DM0B 1PYSB 3FDTA 3HOWB 4FDBA 2EOTA 1TWCH 4R4TA 1CSPA 4A3FB 3H3VI 3IFDA 3PUZA 2PPBC 2F4VL 1EWCA 2NTTA 4X62Q 3FP9A 4C1NI 2BH2A 1TY2A 3TSSA 3TDQA 1EEFD 1H95A 3F1ZA 3C1FA 1D7QA 3T1HQ 1F2LA 1NY4A 3S1RH 4P2CB 1A63A 1I4RA 2PNHA 1HNZQ 4LJZC 3PSIA 1SYGA 1VQIA 1HFNA 1NR4A 4KTAA 3BYTB 3LWUA 1EFWA 1Y1WG 3Q8DA 2DJGC 2D0OA 2Y0SB 4C3IB 2K6AA 4L5RC 1II3A 2B63B 3K58A 2D9UA 1IL2A 2PQEA 1QUQA 3KK7A 1B2TA 1U5KA 2JA7G 4YHHQ 2IX0A 1D5XC 2EYPA 3HRZC 2ZM6Q 5E4WC 1EOTA 3J80i 4A3GG 4B3TQ 5M3FB 2B3GA 4OIKA 4JI4Q 3S2HH 4PZ6A 4WJWA 4BXXH 2BDNA 5C0XG 2ZXRA 2JA8B 1ENAA 1D1IA 4B9XA 1LACA 3CQZH 4ME3A 2VY3A 2WAQG 1PH5A 1JICA 1IZ6A 1L1OA 1I4HA 1MSHA 1V9PA 2R93B 4R4OA 1K9MC 2RDGA 4RH6A 3FVQA 2MFIA 1PH1A 1TS4A 2IHFA 1OXVA 2WAQE 4JI1L 1WTVA 2B2TA 4JW0A 4XT1B 5EPKA 2VW9A 4DV1L 4FP5D 3W3AA 2PZWA 3J81L 2K5HA 4KJOA 4GNXB 1PFNA 4GOPC 2VUMB 2R61A 4WORA 4A3EG 1Y8PB 3CCSA 2ATWA 3HOUG 3OWEB 3Q0AA 1HZ9A 2PMZE 3MA2B 5CV9A 3V96A 2EE1A 4DXGA 4UP8A 1TS2A 2A69C 5CC4A 3HOWH 4R4IA 1C7YA 4O42A 1BOSA 5JPNC 3F2DA 1AP0A 1KAAA 1HNWL 3R2IA 1I94Q 5IT9L 5BN5A 1HA5A 5IY0A 4DR4L 2BA0A 2V4DA 4MIUA 4ZYSA 2A19A 5ELBA 1W6JA 2DNCA 4FXGC 1IYJB 1GUSA 1E1OA 1RF2D 5EKLA 1Y8OB 2A6ED 3J7A5 2VQEQ 1A3TA 1MGSA 1B9NA 2K4KA 1LTLA 3H3VH 4K14A 3J81E 2CQAA 5E7NA 2EYFA 4CKBA 1BBWA 2B63H 1EIFA 4XXEA 3CU7A 2IWHA 2NZ1D 1TS5A 2L0CA 1HPCA 1M8AA 2K5DA 4KKTA 1ONLA 2AQ1B 1OXXK 4HTHA 1FNVA 4GLXA 1NUCA 1JB3A 1J5EL 2R7ZG 1GXDC 1CTMA 2TSSA 2IY5B 4HJ7A 4LFAQ 4DUZQ 2LXKA 5CORA 1WD0A 4ID6A 5IT9E 2LXJA 3I72A 3U4VA 1SYDA 5FLMH 1PFSA 1SE3A 2JA8H 3SK5A 4HSVA 3KLSA 2NBFA 2KENA 3KLRA 3E6ZX 1B3QA 1YNNC 5DM63 5IT9c 3UDGA 3S1MB 4AYBG 4RMFA 3S14B 2R93H 2C9OA 3PO2G 1XJVA 4Z9CB 2K5QA 4ULLA 1GUWA 4RGOS 2MNAA 3WDNA 4U68A 1QNUA 1PH2A 3M4QA 4NP5A 1LT5D 1QVCA 4AYBE 4DV3Q 2VUMH 5DM73 1VQKA 2NZHA 4OGQC 4C1NK 5F2DA 2JA6B 4KY7A 1UEBA 3GTLB 1MIUA 5AJ3Q 1W2BA 1O7IA 1ET6A 1DJRD 2HCIA 3CKIB 5BN4A 2UU9Q 1UUPA 4C2MH 1A2UA 1I6VC 3A7AB 2D5DA 3FRPB 1S40A 3H6MA 2IL8A 4J15A 4F7XA 3H15A 1N9WA 5BR8Q 2I0QA 1VQEA 1X9NA 3PCOB 4BS9A 4I7ZC 1WTRA 5CMDA 2UUBL 1TVXA 4TKOB 4BY7B 4G57A 1STAA 1IW7C 1IBML 1ET9A 5H1SE 3TEHB 2F3WA 1VQLA 2Q8TA 4C3HB 1EWIA 1J8IA 3C2PA 4A3MH 1VQDA 2UUCQ 2JA5B 2XNAC 1O7ZA 3CCUA 1ML0D 3NTHA 1GVPA 4DR5L 4KHVA 5IGCA 1O80A 3PIOA 3RZOB 3H0GG 1KIXA 1IYVA 3KF6B 1RDPD 2ZTCA 1Q12A 1H9SA 2L9HA 4G7OC 3HKSA 1PYBA 3E9IA 4A3FG 2QGQA 3SEBA 4DUYL 2Z6KA 3K57A 3BVZA 2RF4A 3I55A 3FEWX 3PUWA 1WCMG 1WTWA 2R92B 1EY0A 2ALYB 4HSPA 5I2YA 5KGUA 5C5MA 2E2JB 4RA8A 5D3IB 3HG9A 4A3JB 3D3RA 1DD2A 3CCVA 2LKVA 3FPUB 4OIJA 4QJFA 2F0JA 3I91A 1P8LA 5C3EB 3S1MH 3UE0A 3A55A 3S14H 4ALPA 1HUMA 1H9RA 1LO5D 1LTAD 3CC4A 2Y0SG 4C3IG 4A93B 1TY0A 3D31A 4HIOA 2PW5A 3S9WA 2B39A 2UXDQ 1QWYA 3NEMA 5K5PA 1HNXL 3I3CA 1ZEQX 2AQ3B 3G4SA 1PYWD 2JA6H 3HOZB 3MFGA 2NVQH 3H94A 1UAPA 4K5WA 1GUGA 3C46A 2IHEA 5JOBA 1SNDA 5M3FG 1EEID 2EJGC 3OWFA 2VL6A 4G4KA 1WOCA 2JA8G 5FLMG 3A5ZB 1F9SA 1SE4A 3RD4A 1PH7A 1IKMA 1HR0L 1JC7A 4JI0Q 3CHBD 1BDOA 1GUNA 4GLVB 4UP7A 3J7AV 4ZK9B 2F3IA 1E2VA 4B08A 5JEAG 3M85A 3RMHA 4DAYB 1PRTD 4JBJA 1U4MA 2R93G 1NMFA 3TREA 4LFCL 5J3BA 5I9PA 2HHHQ 1JJCB 3F2UA 4BY7H 4K0KQ 3VR2A 1TWFB 4EQPA 4FXKC 1XPOA 4P72A 4B3SQ 1YNJC 3K59A 2NVXB 1RIPA 3SDZA 3H3VC 4KD4A 4C3HH 4BA1I 1VQ8A 2JA5H 2FXQA 2CCZA 1PFBA 4RCOA 1CQVA 3RZOH 4FF4A 2JEAI 1XNQQ 1M90C 2F4IA 3TS0A 4DV2L 2LSSA 1RCVD 4C3JG 4KN7C 1E0BA 1VQ6A 5K36G 2F0IA 1SAPA 3D6CA 2R92H 4X65Q 5CGKA 4NXNQ 2EYMA 1SYCA 1STEA 4JOIC 4OL7A 2CVRA 1Y1WB 1EIYB 4QB4A 4A3JH 2MGSA 4POGA 4QMGA 4LF4Q 1V1PA 2L55A 5C3EH 1WD1A 5DEHA 4DV4L 1GO3E 5IGBA 4IUTA 4RAUC 1BVSA 4POFA 2JA7B 1Q46A 4RHSA 4OX9Q 4A93H 4MN3A 4GOPA 1TT2A 3IKJA 4LF9L 4NB3A 3NWSA 5IYBG 2F03A 4ILWA 4XDXA 2RKSA 1S5DD 4OEMB 4MZ9A 1LTTD 2DY8A 2A73B 2XWBB 3HOZH 1U4RA 3K0YA 4FVMA 1IXRA 4M8AA 1IYUA 1PH3A 1RL2A 1NR2A 4LF7Q 2WAQB 1DOLA 2ZXPA 4PMBA 3HEJA 4HCEA 3CC7A 4HEDA 4JYAL 3MEHA 3I2ZA 2QW7A 1K73C 2PCFB 5IGFA 2XIWA 4BY1G 2PMZB 3NBIA 4XT3B 2OWOA 1FVIA 1SSOA 1B70B 2HIXA 4R4CA 1TWFH 3HOUB 2F0EA 3AEVA 3I4MG 1MJCA 1U0LA 2LS01 3P7JA 3OYYA 1AZQA 2NVXH 4X64Q 3ER0A 5GAHC 5HGTA 2JA6G 5T1GA 3EFXD 2OT2A 3QO2A 1FJGL 1P16A 1N34L 4DR1L 4UAIA 1I4PA 1TS3A 4FYDA 4R4QA 1SROA 2LY7A 4UPAA 4IOAA 3D4DA 4JPBW 4DA2A 2B2VC 2CW0C 3L7ZC 4QUFA 1FYCA 4FF3A 2AKWB 4GKJL 2PQAB 4KKSA 1IBLL 4DK3C 4HAEA 3W5OA 4IJHA 1X3EA 2EYHA 5EAYA 1GD7A 1VQBA 2HCCA 1HTLD 2K33A 3AU7A 2N78A 2E2HB 1NNXA 3A56A 1Y1WH 1OO9B 4WJ4A 4NDXA 4Q5VA 1XMOQ 1A6XA 1G6ZA 5IGGA 1K0RA 5C4XB 2JA5G 4NXML 3NWTA 3ULLA 2F0SA 2JA7H 3S15B 3HS0C 3L9AX 1PZID 3CAMA 3DXJC 1LT6D 3DWQA 4IPDA 3T13A 4DK0A 3UI2A 1LLRD 1STGA 4FXDA 2R7ZB 2YYZA 3SK6A 3MHBA 5I9OA 4YWLA 3O13A 3R3OA 5C0XH 4BWGB 4X3TA 1ENFA 1KNEA 1R9TB 2R92G 2ASBA 4AYBB 1L0YB 4HIKA 1VQ7A 4A3DG 1LTRD 3JC66 3T53B 2XRQD 4JI6Q 3PO2B 3I70A 2H1EA 1HQMC 2A8VA 1JOKA 3OW2A 5C3EG 5NUCA 4R8IA 2HUGA 4JI5Q 2SNSA 1ASYA 2F0GA 1HR0W 1RJTA 5IODA 2VXWA 4A3LG 5C4JB 1F9QA 4A3EH 2EY2A 1D5ZC 2NN6G 3HOUH 1PTOC 1PXUA 3K6OA 1WJJA 2B8GA 1VQ5A 3TS2A 3VR6A 1CSQA 5J1ZA 1STBA 1AZPA 3EROA 1SMYC 2EY6A 3Q24A 2BE5C 2O4XA 2JP1A 1GUTA 4P74A 4HJAA 1X3QA 2MPMA 3EIVA 5IWAQ 3KDFA 2E76C 1FGUA 1O7YA 1VQ4A 4ZAIA 3T56B 4JI2L 5CV7A 1YJ9A 3D4WA 3AMUA 2IX3A 5I6WA 3CCEA 2M2LA 4KLKA 4APVA 4A76A 3VYRA 3PGZA 3JAMi 1YIJA 2GA4B 1S72A 3A8JE 2E2HH 3VR5A 4DU9A 5E4XA 3RN5A 2SDFA 4DR2Q 4LF5L 1SFOH 5GAGC 2N88A 4B3RQ 3SE0A 3GD7A 5M3MB 1SMXA 2R3ZA 2F52A 3H0GB 4PNYA 1MSGA 4JI3Q 1BCPC 1JWSD 1N36Q 1HCZA 4GN5A 3EQLC 1CM9A 2JQOA 3S15H 2O2LD 3S1QB 1ESFA 4PZ7A 1VQOA 1EL0A 4GZYC 3CRLC 3CCRA 1FNWA 2R7ZH 1WCMB 3DWAA 4IFDJ 1JE4A 4NMZA 1YVCA 1PH4A 3C3LA 1QZGA 1JCKB 1V1OA 3SHLA 3MVVA 2R6GA 4K6LA 4UDUC 2MUYA 4WRDA 3G6EA 3PO2H 3STBC 1G8ZD 3KJPA 3VYUA 3UDFA 5M5XB 2K5NA 2A68C 2QA4A 1ILPA 1XYIA 5KIXA 1BKBA 2MO0A 3D8GA 1QB5D 1STYA 4KV6A 4XYQA 3I90A 5C4JH 2DJFC 1VDZA 1QUQB 3URYA 2B2WC 3VYSA 3MXPA 2BDOA 4DV0Q 4BBRG 1Q8IA 4HCSA 5C4ZA 1E3PA 1XTDA 3DEOA 1PRTF 1IBKL 3J81i 1JOOA 5FO8B 2FMMA 2K01A 4KD3A 4KK7A 1XNRL 3HFZB 4PMCA 3E3XA 2QILA 5KYIA 2VQFQ 1L1OB 4JOIA 1SDFA 1XXGA 3NXWA 4XQQA 1F9RA 1QVGA 3J80L 3NSWA 1TIID 2F0QA 3MAQA 3E0EA 3UE1A 3WWVA 5EBDA 3OPOA 2HQEA 1X65A 1ICFB 3ULJA 3L3OC 5KNDA 4IJLA 3H0GH 5TSSA 1E7ZA 2E5LQ 3BJUA 4DAPA 1EYGA 5HY6A 4A3FH 3VYTA 3S1QH 1ESRA 2KOLA 3VR4A 1CT1D 3GTQB 4DV6Q 1F77A 4C3JB 4HIDA 3GTOB 1LTGD 2K52A 2B2YC 1WCMH 3BDOA 2UUAQ 1X32A 1G2SA 4PQXA 4JI8Q 4CJ0B 4L5QA 1EU4A 4IFDG 1CK1A 3J7YW 4X62L 4DV7Q 1PDQA 3A54A 4MTNA 2OTJA 2MJ8A 2UUBQ 1N33L 3AFPA 3PMFA 3T1HL 4XTCS 3J7ZC 1QVFA 1KHIA 4OXPA 4C3IH 1HNZL 4PZ8A 3CMAA 5M5XH 2IX1A 3J80E 3A7LA 3HGBA 4IUVA 3SVMA 5C4XG 2D0PA 2EQSA 3NELA 5EPJA 1ILQA 2XRSD 3J80c 4FF1A 4I7AA 2R7FA 2AMCB 1D5MC 3M9BA 2CWPA 2Q2IA 4KKUA 4KMUC 2ENBA 3NTIA 5M3FH 1M1KC 4JBWA 2K1BA 4DUYQ 4YHHL 3A8IE 1FR3A 5LMUQ 3NTKA 4A3CG 2ZM6L 2RVLA 3K80C 2EJFC 2D2CC 2B2VA 3EJIA 2PYKA 5JJZA 1G291 4B3TL 3OOCA 1SJED 2YV5A 2E74C 1JMCA 5JEAH 4JI4L 3E0JA 3LNNA 4BY1B 4RHRA 1BUVT 2YTXA 5LHY1 1T5EA 3I56A 4C56C 1W3SA 4B3MQ 2WACA 4PV1C 2L1BA 4KY6A 5LL6S 2FMCA 3BDCA 5D14A 3TP5A 1JQYD 3I4MB 1EQVA 3QB3A 3DM1A 2SEBD 1VMPA 1QE6A 3OHXC 1EQQA 4DF7A 1SR3A 2F0FA 1X3FA 3M3YB 5GAEC 5IP9G 2KCNA 3I4LA 3MXUA 2F0HA 3I73A 1S5CD 4DV5Q 4GKKQ 4IUQA 5IYDG 3OTOQ 2A5HA 1KQSA 1KDBA 4C3JH 3AQQA 4DK1A 3RNUA 5K36H 3PIP3 4L8JA 2KHIA 3Q22A 3I8ZA 4LUZA 4AQYQ 4GLAC 2HT1A 2NTSA 3G6JB 3GP7A 2NZOA 3DLLA 1G51A 2F0UA 4LFCQ 1Q82C 1VS0A 2A69D 1CKNA 4O0AA 5D65A 1C9OA 1FNUA 5T1IA 3NE5B 4A3IG 4DR7L 1I4XA 3PUVA 2Q2TA 3ND8A 2Z4IA 1SJHD 4DR6Q 1BF4A 3DMUA 4CKEA 4JV5Q 2VB2X 4Y52H 5M3MG 3R2TA
chains in the Genus database with same CATH topology
1DOKA 1VF7A 1R4QB 3MXGA 3GTKB 4E6IA 2RDHA 3OMCA 3X3NA 3M4OB 2EJMA 2NN6I 3RZDB 2Z8LA 2JYOA 1H9SB 2DY7A 2F0KA 4A3DB 4N9TA 4XQJA 1SNOA 1KDCA 3K5LA 1E2WA 5COYA 5KYLA 1TKWB 1A15A 1MD2D 3DUZA 3QJYA 5C3XA 4J8QA 3IAYA 1B53A 1E2ZA 2E2DC 1SNQA 1F9PA 2EXZA 2PO4A 2KVMA 2NYZD 5JAVA 2ID0A 1BNZA 2H4OA 4ABNA 1I3QB 1YNND 5ELCA 1EY4A 2F0OA 2WV6D 2EZVA 2N55A 2F0WA 1PZKD 2Q8RE 1Z6HA 2TMPA 4S3SA 5ISRA 3V05A 1PZJD 1CZGA 1V8QA 3T4AC 3DHQA 2A6HC 3HZXA 1ZYRC 1Z47A 3WOFA 2K32A 4K8JA 1DZ1A 1SYEA 3MXNA 2IJ0A 2RDFA 1BQQT 2AUKA 4EQNA 3TZUA 1EY5A 2RQXA 2B2WA 5EKIA 3CRKC 1H9MA 5CV5A 4LK1C 1ZXTA 1IW7D 1OXSC 1NAPA 5C0XI 3E5SA 2F0VA 1VCIA 4EVOA 1NCVA 1DCZA 1DXMA 4IURA 1HTPA 3K5OA 2PNRC 2LMCB 1V1PB 2NN6H 1B44D 1QG7A 2AWNA 3OW7A 4WFN3 3S16B 4ZRZA 4K2KA 1F2ZA 2X6LA 1HRJA 5FK9C 2B8FA 3TP7A 3HOVB 4BBRB 2J4XA 2KEDA 3HOXB 2ICIA 4V0BA 3NBHA 1STHA 2RA4A 3FMCA 1PTOF 3R8BA 2NB0A 1F2MA 5LL6X 4KN4C 3AB9A 1S4ZA 3MTSA 1XX8A 2RSNA 3SK4A 5I6YA 3KBXA 3KBGA 3KLSX 1AFPA 1B50A 3BS1A 1EIHA 1CHQD 3J7AF 5AFWA 3GTMB 1RHPA 2F3VA 4CKCA 1IHZA 1TU2B 2KQ3A 2WIIB 1YNJD 2D62A 4V190 2L5TA 2IPKD 1BBXC 2PW7A 1JWUD 1SXTA 1EQTA 4CBVA 5J22A 1RD9D 2NVYB 3X3MA 2LFNA 1A3VA 3MFYA 4KJNA 1B3AA 1KABA 3RUZA 4J1MA 2BA1A 1H9JA 5CV8A 4F8MA 1PRTB 5EGTA 4RGNA 1WTOA 4X3UA 4KHZA 4K5XA 3BYYB 1IL8A 1R4PB 3GV3A 4FF2A 1MBYA 1RTNA 2G9HD 1HA6A 1QOHA 1EYDA 1BR9A 3NUCA 4K6DA 2DNEA 2F0PA 1TWHB 4NW2A 1EIGA 1SYBA 3MC0B 2ZT9C 4IUPA 1GUOA 1FGBD 4EGVA 4NKLA 2HDMA 3U9SA 5JVH3 4FO2A 5JVG3 2I46A 3QOJA 2E2IB 2K28A 1G91A 2K7VA 5C3WA 1I6HB 1B1ZA 1B4OA 1HFGA 1LT4D 3EA6A 3GTGB 1A3UA 1EFID 1CI3M 3TP6A 3T16A 4IFDH 2AQ2B 2AUJD 5ELEA 1QCBD 1QNKA 1D1KA 1C8CA 2NUCA 1GOZA 4A3IB 2RBMA 1Y1VB 2NVTB 2C5CA 3G7LA 3KF8A 2MP1A 5FO9B 3GTPB 2K5WA 2CW0D 4XIGS 1I4GA 3VA7A 2J0TD 2KUMA 3A8KE 1PFMA 3Q6SA 2QKIC 4DXFA 1PMRA 1S5ED 5ELDA 4BA2I 2A6EC 2HDLA 1S5BD 4XQNA 3DWPA 4DGZA 3JAML 4G7HC 3PV0A 1G2TA 3OIPA 1JORA 3NQIA 3H09A 1EU3A 4DNRB 1CA5A 2O5JC 1AW7A 3K5MA 1TWAB 5CR3A 1VMCA 3M7GA 4DAVA 3QOLA 1LTSD 5FO7B 3NHHA 4RWSC 4ZUIA 3TN2A 3BZDB 1Q90A 1J9OA 1DYQA 4BBSB 1UEAB 2M00A 1U4LA 3JAME 5HURA 1PTOD 3GQBA 2QF7A 2SOBA 5I4DA 3M7NA 2L4NA 2KCCA 3VR3A 1SMYD 3QWNA 4TRDA 5EBCA 2BE5D 1IKLA 1ICWA 3MZ5A 1SNMA 2L11A 2E75C 5JPMC 1QILA 2WP8J 3QG1A 2WINB 3NQTA 2Z1CA 2RSOA 3KUPA 4DN4M 3BVMA 1EYAA 1Q1BA 3PUXA 2PZUA 2WB1B 1UNSA 3ZYYX 2QDBA 4OO1G 4C2MB 4HMJA 4HR7B 1JWMD 4H13C 4TSSA 3Q23A 2B2UC 4Y7NB 2JXMB 1BCPD 5IGEA 1XTCD 3OIQA 4K2LA 1W6KA 1HHVA 4A3BB 1LTID 1SBBB 1OXTA 3TMEA 3T51B 3I4NB 1H9KA 1LV9A 3U9OA 1Z7TA 1STNA 2I07B 3GTJB 5IGDA 4A3MB 1WVLA 1K83B 1U9RA 4LAAA 1CA6A 2JEBI 4R8NA 4RKLA 3S17B 1LABA 1TR5A 2A68D 4IN3A 1TQOA 3GO5A 3LWEA 1I4QA 1EZ8A 4LMQD 4CJ1B 5C44B 2KHSA 2AWOA 1I50B 3HKZB 5IIFA 2FFKB 1EY9A 5I2XA 1PRTC 3NPPA 2XVSA 3SXHA 2NVQB 3QIAA 1SE2A 1Q1EA 2X69A 3FKIB 5A35A 1S5FD 1Y69U 4H44C 5M5WB 2J7ZA 3TZDA 2L12A 4ZKBB 2F0MA 5JEAJ 5KNBA 1ENCA 1QJOA 1FD7D 3P75A 3BDLA 4H0LC 5CYUA 5J39A 1K8OA 3N52A 2EYLA 4RGMA 4A3KB 3NP8A 2Q8IB 1TWGB 1CQFA 1HQRD 5KEEA 2WKCA 4K5VA 4XYOA 1A2TA 5CV4A 1CFMA 5G3LD 3RLFA 5CBAE 2XSCA 3PIO3 2K03A 1PTOB 2ZXOA 4MHEA 3EVQA 1T5XD 2F1MA 2FINB 1X3PA 4KI0A 2EYJA 3ITPA 1WTPA 4CGYB 1KLGD 3DEPA 5D3DA 4RCNA 1V43A 4L63B 1HUNA 5E1FA 4B9WA 3OSOA 2FHTA 3N6RA 3IL8A 2WKDA 2KEEA 1JR0D 2BCOA 3FPPA 5CBEE 4H7BA 4ZLTF 1KLUD 5KRUA 5E3FA 1EZ6A 3S1NB 3M4YA 3P20A 1OXUA 1C4QA 2PZTA 1BCPB 2EY1A 3VA5A 1DONA 3WOEA 5FOBB 2OXPA 1SEBD 4IALA 1CZWA 2M9VA 3MWYW 4N9PA 5A2QL 1Q3LA 1LT3D 4OHJA 3BG3A 4DAYA 2KJXA 5M5YB 3C1EA 2KECA 2VB3X 5ELFA 2BOSA 3H91A 3D4RA 1ZKOA 4ZKCB 5EQ0A 1VF5C 4TQUS 1HXYD 4YIJA 2XWJB 2CHBD 1EYCA 4HN7A 2FJ2A 1PTOH 4CJ2C 3K7AB 1RTOA 1XWEA 4FNFA 5C6AA 3R93A 1NSNS 5A2QE 2EPBA 5C4HA 3SK8A 4J6HA 1RODA 3ONAB 4K8IA 5FKAC 3PO3B 2JE6I 3W2DA 2MHVA 2X6GA 2EY5A 2B2TC 1BO0A 4QCLA 2KA7A 1D2BA 2F0LA 2VNUD 2XN9C 5DAUA 1AEXA 3GV6A 3IFTA 2EYOA 4G7ZC 2A74C 3D6WA 4RFBA 4A3GB 5EKKA 2QCPX 2B2YA 4JK1C 4M1UB 1JOQA 1KTKA 4X3SA 5BN3A 1PLFA 1CHPD 5C5LA 4QF4A 4IFDI 4OO1I 2B2UA 1O7LA 5EPLA 4ZQ3A 4CHTB 3NK9A 1SYFA 1DOMA 4RKBA 5FLXL 2YU9B 1RKNA 4PMWA 1F2YA 4A3EB 4EQOA 1GHKA 4X3KA 5M9OA 1EY6A 1D6EC 1K8MA 2EDGA 4RGTA 2EVBA 2A6HD 1GHJA 4U673 4Q0FA 1AN8A 1Y8NB 1ZYRD 5DNFA 1BCPF 4IUUA 2OEOA 3OMGA 2ICEC 1EY8A 3P1HA 4KY5A 1L0XB 2JSOA 1BXTA 5KNCA 4DNTB 2QEJC 3TP8A 2OF1A 3HOYB 2IT1A 1WTQA 3S2DB 5FLXE 2F0DA 1SFOB 4HMIA 4QIWB 2SNMA 4C3HG 1EY7A 1TWCB 1EWHA 3BVGA 3SR1A 3HP3A 4ME5A 5EJWA 1C48A 3S1RB 2O5IC 1U4PA 2G9DA 1M4VA 5IOCA 1KDAA 1KNAA 4IZ8A 2DN8A 2Z4HA 4IUNA 4ODGA 3K5NA 2K05A 3TBIB 3S2HB 3ERQA 4OO1H 4QUCA 5C0XJ 4F88A 2F0NA 2NWGA 2IW3A 1O78A 4ZUJA 4L6TB 1SNPA 3PUYA 4IQZA 3CQZB 1WTXA 1GJXA 4R9WA 4DFAA 1MI2A 4F87A 3LX0A 4I65A 5G3LF 4O1NA 5CV6A 1SNCA 3ND9A 3V2TA 2K04A 1LTBD 1B9MA 2F0TA 1DM0B 3FDTA 3HOWB 2EOTA 4A3FB 3IFDA 3PUZA 2PPBC 1EWCA 2NTTA 4C1NI 1TY2A 3TSSA 3TDQA 1EEFD 3C1FA 1F2LA 4P2CB 1I4RA 4LJZC 1SYGA 1HFNA 1NR4A 4KTAA 3BYTB 3LWUA 2Y0SB 4C3IB 2K6AA 1II3A 2B63B 3K58A 2D9UA 2PQEA 3KK7A 1B2TA 2IX0A 1D5XC 2EYPA 3HRZC 5E4WC 1EOTA 5M3FB 4OIKA 4WJWA 2BDNA 5C0XG 2ZXRA 2JA8B 1ENAA 1D1IA 4B9XA 1LACA 1JICA 1I4HA 1MSHA 2R93B 2RDGA 4RH6A 3FVQA 1TS4A 1WTVA 1OXVA 2B2TA 4XT1B 5EPKA 4FP5D 3W3AA 2PZWA 3J81L 4KJOA 2VUMB 1PFNA 2R61A 4WORA 1Y8PB 3OWEB 3Q0AA 3V96A 3MA2B 5CV9A 2EE1A 4DXGA 1TS2A 2A69C 5CC4A 4O42A 1BOSA 5JPNC 1AP0A 1KAAA 3R2IA 5IT9L 5BN5A 1HA5A 2BA0A 2V4DA 4MIUA 4ZYSA 5ELBA 1W6JA 2DNCA 4FXGC 1GUSA 1RF2D 5EKLA 1Y8OB 2A6ED 1A3TA 1MGSA 1B9NA 4K14A 3J81E 2CQAA 2EYFA 4CKBA 4XXEA 3CU7A 2IWHA 2NZ1D 1TS5A 2L0CA 1HPCA 1M8AA 2K5DA 4KKTA 1ONLA 2AQ1B 1OXXK 4HTHA 1FNVA 1NUCA 1JB3A 1GXDC 1CTMA 2TSSA 1WD0A 5CORA 4ID6A 5IT9E 3I72A 1SYDA 1SE3A 3SK5A 4HSVA 3KLSA 2NBFA 3KLRA 3E6ZX 1YNNC 5DM63 3S1MB 3S14B 2C9OA 4Z9CB 2K5QA 4ULLA 1GUWA 4RGOS 3WDNA 4U68A 1QNUA 4NP5A 1LT5D 5DM73 4OGQC 4C1NK 5F2DA 2JA6B 4KY7A 3GTLB 1ET6A 1DJRD 2HCIA 3CKIB 5BN4A 1UUPA 1A2UA 1I6VC 3A7AB 2D5DA 3FRPB 3H6MA 2IL8A 4F7XA 4BS9A 4I7ZC 1WTRA 5CMDA 4BY7B 1TVXA 4TKOB 4G57A 1STAA 1IW7C 1ET9A 2F3WA 2Q8TA 4C3HB 1J8IA 3C2PA 2JA5B 2XNAC 1O7ZA 1ML0D 3NTHA 4KHVA 5IGCA 1O80A 3RZOB 1IYVA 1RDPD 1Q12A 1H9SA 2L9HA 4G7OC 3SEBA 3K57A 3BVZA 3FEWX 3PUWA 1WTWA 2R92B 1EY0A 4HSPA 5I2YA 5KGUA 5C5MA 2E2JB 4RA8A 5D3IB 3HG9A 4A3JB 3D3RA 1DD2A 2LKVA 3FPUB 4OIJA 2F0JA 3I91A 5C3EB 3A55A 1HUMA 1H9RA 1LO5D 1LTAD 4C3IG 4A93B 1TY0A 3D31A 2PW5A 3S9WA 2B39A 1QWYA 5K5PA 3I3CA 1ZEQX 2AQ3B 1PYWD 3HOZB 3MFGA 3H94A 1UAPA 4K5WA 1GUGA 3C46A 5JOBA 1SNDA 1EEID 2EJGC 3OWFA 4G4KA 3RD4A 1F9SA 1SE4A 1IKMA 1JC7A 3CHBD 1BDOA 1GUNA 3J7AV 4ZK9B 1E2VA 4B08A 5JEAG 3M85A 3RMHA 1PRTD 1U4MA 5I9PA 3F2UA 3VR2A 1TWFB 4EQPA 4FXKC 1YNJC 3K59A 2NVXB 3SDZA 3H3VC 4KD4A 4BA1I 1PFBA 4RCOA 1CQVA 4FF4A 2JEAI 2F4IA 1RCVD 4C3JG 4KN7C 1E0BA 5K36G 2F0IA 1SAPA 3D6CA 5CGKA 2EYMA 1SYCA 1STEA 4OL7A 2CVRA 1Y1WB 4QB4A 2MGSA 4QMGA 1V1PA 2L55A 1WD1A 5DEHA 5IGBA 4IUTA 4RAUC 2JA7B 4RHSA 4MN3A 1TT2A 3IKJA 3NWSA 2F03A 4ILWA 4XDXA 2RKSA 1S5DD 1LTTD 2DY8A 2A73B 2XWBB 1U4RA 3K0YA 4FVMA 4M8AA 1IYUA 1NR2A 2WAQB 1DOLA 2ZXPA 4PMBA 3HEJA 4HCEA 4HEDA 3MEHA 2PCFB 5IGFA 2XIWA 2PMZB 3NBIA 4XT3B 1SSOA 3HOUB 2F0EA 2LS01 3P7JA 1AZQA 5HGTA 5T1GA 3EFXD 2OT2A 3QO2A 4UAIA 1I4PA 1TS3A 4FYDA 2LY7A 3D4DA 4DA2A 2B2VC 2CW0C 3L7ZC 4QUFA 1FYCA 4FF3A 4KKSA 4HAEA 2EYHA 2HCCA 1HTLD 2K33A 3AU7A 2E2HB 3A56A 1OO9B 4NDXA 4Q5VA 1A6XA 1G6ZA 5IGGA 5C4XB 3NWTA 2F0SA 3S15B 3HS0C 3L9AX 1PZID 3DXJC 1LT6D 3DWQA 3T13A 4DK0A 3UI2A 1LLRD 1STGA 4FXDA 2R7ZB 2YYZA 3SK6A 3MHBA 5I9OA 3O13A 3R3OA 5C0XH 4BWGB 4X3TA 1ENFA 1KNEA 1R9TB 4AYBB 1L0YB 1LTRD 3T53B 2XRQD 3PO2B 3I70A 2H1EA 1HQMC 1JOKA 5NUCA 4R8IA 2HUGA 2SNSA 2F0GA 1RJTA 5IODA 2VXWA 5C4JB 1F9QA 2EY2A 1D5ZC 2NN6G 1PTOC 1PXUA 3K6OA 2B8GA 3VR6A 5J1ZA 1STBA 1AZPA 3EROA 1SMYC 2EY6A 3Q24A 2BE5C 2O4XA 2JP1A 1GUTA 1X3QA 2MPMA 2E76C 1O7YA 4ZAIA 3T56B 5CV7A 3D4WA 3AMUA 2IX3A 5I6WA 2M2LA 3VYRA 2GA4B 3A8JE 3VR5A 4DU9A 5E4XA 2SDFA 2N88A 3SE0A 3GD7A 5M3MB 2R3ZA 3H0GB 4PNYA 1MSGA 1BCPC 1JWSD 1HCZA 3EQLC 1CM9A 2O2LD 3S1QB 1ESFA 1EL0A 4GZYC 3CRLC 1FNWA 1WCMB 3DWAA 4IFDJ 1JE4A 4NMZA 3C3LA 1JCKB 1V1OA 3SHLA 3MVVA 2R6GA 4K6LA 4UDUC 2MUYA 4WRDA 1G8ZD 3VYUA 5M5XB 2A68C 1ILPA 1XYIA 5KIXA 3D8GA 1QB5D 1STYA 4KV6A 4XYQA 3I90A 1VDZA 3URYA 2B2WC 3VYSA 3MXPA 2BDOA 1Q8IA 4HCSA 5C4ZA 3DEOA 1PRTF 1JOOA 5FO8B 2FMMA 2K01A 4KD3A 4KK7A 4PMCA 2QILA 5KYIA 1SDFA 1XXGA 3NXWA 4XQQA 1F9RA 3J80L 3NSWA 1TIID 2F0QA 3MAQA 5EBDA 3OPOA 2HQEA 3L3OC 5KNDA 5TSSA 4DAPA 3VYTA 1ESRA 2KOLA 3VR4A 1CT1D 3GTQB 1F77A 4C3JB 3GTOB 1LTGD 2B2YC 3BDOA 1X32A 1G2SA 4PQXA 4CJ0B 1EU4A 4IFDG 1CK1A 3J7YW 1PDQA 3A54A 2MJ8A 3PMFA 4XTCS 2IX1A 3J80E 3A7LA 3HGBA 4IUVA 3SVMA 5EPJA 1ILQA 2XRSD 4FF1A 1D5MC 4KKUA 4KMUC 2ENBA 3NTIA 4JBWA 2K1BA 3A8IE 1FR3A 3NTKA 2RVLA 2EJFC 2D2CC 2B2VA 3EJIA 2PYKA 5JJZA 1G291 3OOCA 1SJED 2E74C 5JEAH 3E0JA 3LNNA 4BY1B 4RHRA 1BUVT 5LHY1 1T5EA 4C56C 2WACA 4PV1C 2L1BA 4KY6A 5LL6S 2FMCA 3BDCA 5D14A 3TP5A 1JQYD 3I4MB 1EQVA 3QB3A 3DM1A 2SEBD 1VMPA 1QE6A 3OHXC 4DF7A 2F0FA 3M3YB 2KCNA 3I4LA 3MXUA 2F0HA 3I73A 1S5CD 4IUQA 2A5HA 1KDBA 4DK1A 5K36H 3PIP3 4L8JA 3Q22A 3I8ZA 2NTSA 3G6JB 3GP7A 2F0UA 2A69D 5T1IA 5D65A 1FNUA 3NE5B 1I4XA 3PUVA 3ND8A 2Z4IA 1SJHD 1BF4A 3DMUA 4CKEA 2VB2X 3R2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKV A;  4ZQ3 A;  3SHL A;  4IUN A;  3SXH A;  2F0J A;  4ID6 A;  5CV5 A;  3MVV A;  3NK9 A;  1SYF A;  1SYD A;  4E6I A;  1TT2 A;  3SK6 A;  3MHB A;  3NQT A;  3OMC A;  3SK5 A;  5I9O A;  4RKB A;  3R3O A;  2PW7 A;  1EYA A;  2RKS A;  4ODG A;  3TP7 A;  2PW5 A;  3C1E A;  1RKN A;  4WRD A;  3S9W A;  1ENA A;  2PZU A;  5J22 A;  1F2Y A;  3ERQ A;  3E5S A;  4B9X A;  5K5P A;  2F0M A;  2F0V A;  2F0K A;  2F0N A;  2QDB A;  4EQO A;  1ENC A;  4EVO A;  5KIX A;  3P75 A;  3BDL A;  1A3V A;  4ZUJ A;  4KJN A;  5M9O A;  1EY6 A;  5J39 A;  4HMJ A;  1KAB A;  1SNP A;  1STY A;  2ENB A;  3D8G A;  4KV6 A;  4K5W A;  4N9T A;  4NP5 A;  3RUZ A;  1JOK A;  2EYL A;  4J1M A;  5CV8 A;  1SNO A;  1KDC A;  3HEJ A;  3NP8 A;  4PMB A;  1SND A;  4YIJ A;  5JOB A;  5NUC A;  4F8M A;  5F2D A;  2SNS A;  3MEH A;  4DGZ A;  2F0G A;  5IGE A;  5KEE A;  5EGT A;  5KYL A;  1EYC A;  3OWF A;  4K2L A;  4KY7 A;  3MXP A;  5IOD A;  5IGF A;  4K5V A;  3EJI A;  1A2T A;  2EY2 A;  2PYK A;  2PZW A;  4KJO A;  4DFA A;  5CV4 A;  1JOR A;  4K2K A;  1F2Z A;  3LX0 A;  5C3X A;  4WOR A;  3TME A;  2OEO A;  4I65 A;  4K5X A;  5C6A A;  1A2U A;  3OMG A;  1SNQ A;  3EVQ A;  1EY8 A;  5CV9 A;  2EXZ A;  2WAC A;  5J1Z A;  1NSN S;  1STB A;  2F0E A;  4KY6 A;  5CV6 A;  1SNC A;  3H6M A;  3BDC A;  3ERO A;  3P1H A;  3U9O A;  3TP5 A;  3V2T A;  4KY5 A;  5C4H A;  5CC4 A;  3SK8 A;  1STN A;  5I9P A;  2EYJ A;  3ITP A;  4J6H A;  1EQV A;  4K8I A;  2EY6 A;  1JOO A;  3QB3 A;  4F7X A;  2O4X A;  5IGD A;  4KD3 A;  5CR3 A;  3TP8 A;  5HGT A;  5JAV A;  1U9R A;  2OF1 A;  4EQP A;  2F0T A;  4LAA A;  4PMC A;  1KAA A;  1EYD A;  2F0D A;  1STH A;  3NUC A;  4K6D A;  5C4Z A;  5KYI A;  4R8N A;  4KD4 A;  4HMI A;  2F0P A;  1EY4 A;  2EY5 A;  2F0O A;  2SNM A;  3NXW A;  1STA A;  1F2M A;  3QOL A;  3D4W A;  4G57 A;  4MIU A;  3D4D A;  1TR5 A;  4RKL A;  4DF7 A;  2F0F A;  5I6W A;  2F3W A;  5E1F A;  2F0W A;  1EY7 A;  1SYB A;  3NHH A;  4ZUI A;  4B9W A;  2F0Q A;  2F0H A;  3OSO A;  2F0L A;  1TQO A;  2HQE A;  5EKL A;  4S3S A;  4NKL A;  5DAU A;  1AEX A;  3C1F A;  5ISR A;  3SR1 A;  2EYO A;  1A3T A;  4H7B A;  4DU9 A;  4KHV A;  3QOJ A;  3SK4 A;  5IGC A;  1KDB A;  2EYH A;  4ME5 A;  5I6Y A;  2M00 A;  5KRU A;  5E3F A;  1EZ6 A;  1SYG A;  3DHQ A;  5HUR A;  4K14 A;  5C3W A;  4PNY A;  1EZ8 A;  5EKK A;  2F0I A;  3HZX A;  2EYF A;  4KTA A;  2SOB A;  2PZT A;  3D6C A;  4NDX A;  1A3U A;  5CV7 A;  5CGK A;  2KHS A;  1JOQ A;  4K8J A;  3TP6 A;  2EYM A;  1SYC A;  5IGG A;  2EY1 A;  2F0U A;  4OL7 A;  3T16 A;  1SYE A;  3VA5 A;  1II3 A;  1KDA A;  5IOC A;  5IIF A;  2RDF A;  4QB4 A;  2F3V A;  2OXP A;  1EY0 A;  2F0S A;  2PQE A;  5C5L A;  4HTH A;  4IAL A;  4IZ8 A;  1EY9 A;  4QF4 A;  4QMG A;  4TRD A;  2NUC A;  5C5M A;  5KGU A;  1NUC A;  5DEH A;  1IHZ A;  2RBM A;  4N9P A;  3DMU A;  4NMZ A;  3T13 A;  4EQN A;  1EY5 A;  2KQ3 A;  3MZ5 A;  1STG A;  5IGB A;  1SNM A;  2EYP A;  3PMF A; 
#chains in the Genus database with same CATH topology
 2GVA A;  1DOK A;  4YY3 Q;  1VF7 A;  2VQE L;  4H02 A;  1R4Q B;  3MXG A;  3GTK B;  5IYB H;  4E6I A;  2RDH A;  3OMC A;  5GQO A;  3X3N A;  3M4O B;  2EJM A;  2NN6 I;  3RZD B;  2Z8L A;  2HD3 A;  4JG2 A;  4A4I A;  2JYO A;  1H9S B;  1N32 Q;  2OCE A;  2DY7 A;  2F0K A;  4KHP Q;  3EN2 A;  4A3D B;  2P5Z X;  4N9T A;  4XQJ A;  1SNO A;  1KDC A;  3K5L A;  4MTK A;  1E2W A;  5COY A;  5KYL A;  1TKW B;  4BY1 H;  1YJN A;  1PA6 A;  1A15 A;  1MD2 D;  4LFA L;  3DUZ A;  3QJY A;  5C3X A;  4J8Q A;  3IAY A;  1B53 A;  1E2Z A;  3CD6 A;  3I4M H;  2E2D C;  1SNQ A;  1F9P A;  2EXZ A;  2PO4 A;  3NEN A;  1JJ2 A;  2KVM A;  2NYZ D;  2XTI A;  3GTL H;  2UXC Q;  5JAV A;  4CDE C;  2ID0 A;  1BNZ A;  2H4O A;  3G71 A;  4DV3 L;  3M3Y H;  5LMN Q;  4ABN A;  1I3Q B;  2YTY A;  1YNN D;  2L15 A;  5ELC A;  1EY4 A;  2F0O A;  2WV6 D;  3PQI A;  2N55 A;  2EZV A;  1Q86 C;  5IYC G;  1EQR A;  2H5X A;  2F0W A;  1PZK D;  5AJ3 L;  2Q8R E;  1Z6H A;  4UY8 C;  2TMP A;  1NMG A;  1NTG A;  4S3S A;  4BBS G;  2E8G A;  2UU9 L;  3D0F A;  4JYA Q;  1E24 A;  5ISR A;  1K28 A;  3V05 A;  1PZJ D;  1CZG A;  1V8Q A;  3F8T A;  3U58 A;  1GM5 A;  1T9H A;  1SRU A;  3T4A C;  3PF4 A;  3DHQ A;  4LF6 Q;  2A6H C;  4DR3 Q;  3HZX A;  5BR8 L;  2UXB L;  2I5H A;  1OTC A;  1ZYR C;  1Z47 A;  3WOF A;  2K32 A;  3DM3 A;  2KHJ A;  4K8J A;  1DZ1 A;  1SYE A;  3MXN A;  2IJ0 A;  2RDF A;  1BQQ T;  5GRO A;  2AUK A;  1FJG Q;  3GTK H;  4EQN A;  2ZJQ A;  2R7D A;  1EY5 A;  1DGS A;  2RQX A;  3TZU A;  2UUC L;  3M4O H;  2B2W A;  1KXL A;  2EXD A;  3W1B A;  3RZD H;  5EKI A;  3CRK C;  1H9M A;  5CV5 A;  3K8A A;  4LK1 C;  3TRZ A;  1ZXT A;  1IW7 D;  4CDF C;  1OXS C;  3T1Y Q;  1NAP A;  2C35 B;  4LFB Q;  1NBW A;  1VQH A;  1IBL Q;  2GN5 A;  2E2J H;  1YIT A;  4A3D H;  5C0X I;  3E5S A;  1HZB A;  2F0V A;  1B7Y B;  1VCI A;  4EVO A;  1NCV A;  1DCZ A;  4IPC A;  1DXM A;  4IUR A;  1HTP A;  2DUD A;  4A3L H;  3K5O A;  4A3B G;  2PNR C;  4GNX C;  2LMC B;  1V1P B;  2NN6 H;  1B44 D;  1QG7 A;  2AWN A;  3OW7 A;  4WFN 3;  3S16 B;  4JBK A;  3KFU A;  1CUK A;  4OEL B;  4ZRZ A;  1XMQ Q;  3LGJ A;  1PVO A;  4K2K A;  2DGY A;  1F2Z A;  2X6L A;  4A75 A;  1HRJ A;  4GOP B;  5FK9 C;  2B8F A;  3TP7 A;  3HOV B;  4BBR B;  2UXD L;  2ZJR A;  4DK6 C;  2J4X A;  2KED A;  1MJE A;  3HOX B;  1I3Q H;  3L2P A;  2ICI A;  2OQK A;  2MQH A;  4V0B A;  3NBH A;  4N8F A;  1STH A;  2RA4 A;  3FMC A;  3A5U A;  1PTO F;  3R8B A;  2QEX A;  1MKH A;  2NB0 A;  1F2M A;  2I5M X;  5LL6 X;  5GAD C;  3UDI A;  1AH9 A;  3EBE A;  1L0W A;  4KN4 C;  3AB9 A;  1S4Z A;  4JI0 L;  3CC2 A;  3MTS A;  1XX8 A;  4IPG A;  2RSN A;  3ULP A;  3SK4 A;  5I6Y A;  3KBX A;  1X56 A;  3KBG A;  2HHH L;  1WI5 A;  2BH8 A;  3KLS X;  4K0K L;  1AFP A;  1B50 A;  4B3S L;  3HKZ G;  4LF8 Q;  3BS1 A;  1EIH A;  1CHQ D;  3J7A F;  5AFW A;  3KLW A;  3GTM B;  1RHP A;  2F3V A;  4CKC A;  2XGT A;  4GN3 B;  1YZ6 A;  3HKZ E;  1XPR A;  1YJW A;  2KCM A;  5JJK A;  1IHZ A;  1TU2 B;  2KQ3 A;  2WII B;  4ZCK A;  1YNJ D;  2Q2U A;  1XNQ L;  3PF5 A;  2D62 A;  3FKI G;  4V19 0;  4JI7 Q;  2L5T A;  2IPK D;  1BBX C;  2PW7 A;  1JWU D;  1SXT A;  1EQT A;  4CBV A;  1FL0 A;  5J22 A;  2EIF A;  1RD9 D;  2NVY B;  2Z9H A;  4X65 L;  3FHW A;  3X3M A;  4LNQ A;  4NXN L;  1KRS A;  4A3K G;  2LFN A;  1A3V A;  3MFY A;  4KJN A;  1B3A A;  3S16 H;  1KAB A;  1WTH A;  3RUZ A;  4JVZ A;  4J1M A;  4LF4 L;  2BA1 A;  1H9J A;  1TXY A;  5CV8 A;  4F8M A;  3BU2 A;  1KAW A;  1PRT B;  5EGT A;  1VQG A;  2F4V Q;  4RGN A;  1WTO A;  4X3U A;  4OX9 L;  4PG3 A;  3TQY A;  3MEF A;  3HOV H;  4KHZ A;  4BBR H;  5FLX c;  5IE8 A;  4K5X A;  3BYY B;  1IL8 A;  1R4P B;  3GV3 A;  3IRB A;  1YI2 A;  4FF2 A;  1MBY A;  4EX5 A;  1RTN A;  2G9H D;  1HA6 A;  1QOH A;  4LF7 L;  3B6Y A;  1EYD A;  1BR9 A;  3NUC A;  4K6D A;  2CQO A;  2DNE A;  2F0P A;  1TWH B;  4NW2 A;  1EIG A;  2OTL A;  1SYB A;  3MC0 B;  2ZT9 C;  4IUP A;  1GUO A;  1FGB D;  4EGV A;  2VS1 A;  4NKL A;  2HDM A;  3U9S A;  5JVH 3;  1ASZ A;  4FO2 A;  5JVG 3;  2I46 A;  3QOJ A;  2E2I B;  2K28 A;  1G91 A;  3A0J A;  4X64 L;  2K7V A;  5C3W A;  1I6H B;  1B1Z A;  1B4O A;  1HFG A;  1LT4 D;  3EA6 A;  3GTM H;  3GTG B;  1Q81 C;  1A3U A;  1EFI D;  2K5V A;  1CI3 M;  3TP6 A;  3T16 A;  4IFD H;  3KDF B;  4LUV A;  2AQ2 B;  2AUJ D;  5ELE A;  1QCB D;  1QNK A;  2ES2 A;  1D1K A;  1C8C A;  2NUC A;  1GOZ A;  4A3I B;  2RBM A;  4JI1 Q;  1Y14 B;  2PI2 A;  1PV4 A;  1Y1V B;  2GVB A;  4DV1 Q;  2NVT B;  1UE6 A;  1UE5 A;  2C5C A;  3G7L A;  1SN8 A;  3KF8 A;  2MP1 A;  1PH6 A;  5FO9 B;  3GTP B;  2NVY H;  2K5W A;  2CW0 D;  4XIG S;  5C4X H;  1I4G A;  3VA7 A;  2VZA A;  2J0T D;  2KUM A;  3A8K E;  2A1A A;  1XMO L;  3F2B A;  1PFM A;  3Q6S A;  2QKI C;  4X66 L;  1MHW C;  4DXF A;  2KCT A;  1PMR A;  1X54 A;  1S5E D;  5ELD A;  4BA2 I;  2A6E C;  2HDL A;  4HJ9 A;  1HNW Q;  1S5B D;  4XQN A;  2G5D A;  2N8N A;  3DWP A;  5ELN A;  4A3C H;  1R9T H;  4DGZ A;  3JAM L;  4G7H C;  4DR4 Q;  3PV0 A;  1G2T A;  1X3G A;  3OIP A;  1JOR A;  3NQI A;  5IP7 G;  3H09 A;  1VQM A;  1EU3 A;  1EUJ A;  1N33 Q;  4DNR B;  1CA5 A;  2O5J C;  3PO3 G;  1AW7 A;  3K5M A;  3RR5 A;  2Z0S A;  1TWA B;  3RN2 A;  3W1G A;  5CR3 A;  1VMC A;  2JN4 A;  4JI6 L;  1TWH H;  3VDY A;  5LMN W;  3ZJY C;  1VQJ A;  3M7G A;  4DAV A;  4DPG A;  1JE5 A;  4JI5 L;  3QOL A;  5IP9 H;  1E1T A;  1LTS D;  5FO7 B;  1YHB A;  3NHH A;  4RWS C;  4ZUI A;  3HOV G;  5IYD H;  1J5E Q;  2E2I H;  3TN2 A;  1C0A A;  1JJG A;  2K14 A;  4OWX B;  2WFW A;  2JA9 A;  3BZD B;  3HOX G;  1Q90 A;  1I6H H;  1J9O A;  1DYQ A;  4BBS B;  1UEA B;  3GTG H;  2M00 A;  1U4L A;  3JAM E;  3I7F A;  5HUR A;  1PTO D;  3GQB A;  2QF7 A;  4LUO A;  2SOB A;  5I4D A;  3M7N A;  5IWA L;  3UDX A;  3JAM c;  4L5S A;  2L4N A;  2KCC A;  4A3I H;  1CKO A;  3J81 j;  1Y1V H;  3VR3 A;  2NVT H;  3QWN A;  1SMY D;  4TRD A;  5EBC A;  2BE5 D;  4JCV E;  5M3M H;  1IKL A;  1ICW A;  3BZK A;  5HGQ A;  3GTP H;  2OQ0 A;  3MZ5 A;  4GNX A;  1SNM A;  2L11 A;  2E75 C;  5JPM C;  1QIL A;  2WP8 J;  1SLJ A;  4DR2 L;  2I5L X;  3QG1 A;  2WIN B;  3NQT A;  2Z1C A;  4B3R L;  2RSO A;  3KUP A;  4DN4 M;  3BVM A;  1EYA A;  1Q1B A;  1I5F A;  3PUX A;  1QZH A;  4JI3 L;  2PZU A;  1N36 L;  1LUZ A;  2WB1 B;  1UNS A;  3ZYY X;  1G6P A;  1A0I A;  3AFQ A;  2QDB A;  4OO1 G;  1VQC A;  1VQ9 A;  4C2M B;  4HMJ A;  4HR7 B;  1JWM D;  4TVA B;  4H13 C;  4TSS A;  3Q23 A;  2B2U C;  4Y7N B;  2JXM B;  1BCP D;  5IGE A;  4QY7 A;  1IBM Q;  1XTC D;  3OIQ A;  4K2L A;  1W6K A;  1HHV A;  4A3B B;  1LTI D;  1SBB B;  1YBY A;  4DR7 Q;  1OXT A;  3TME A;  3CXC A;  3T51 B;  1YHQ A;  1TWA H;  3I4N B;  1H9K A;  1LV9 A;  4DR5 Q;  3U9O A;  4DNI A;  3RLO A;  4JC0 A;  1Z7T A;  1STN A;  3HOY G;  1NJI C;  2I07 B;  3GTJ B;  5IGD A;  4A3M B;  4HJ5 A;  1WVL A;  4WJ3 M;  3G48 A;  1K83 B;  1U9R A;  4UP9 A;  4LAA A;  4P75 A;  3CF5 A;  1CA6 A;  2JEB I;  4R8N A;  2ZJP A;  2CH4 A;  5IYC H;  3STB D;  4RKL A;  3S17 B;  1LAB A;  1TR5 A;  3J81 c;  2A68 D;  1HZA A;  4QIW E;  4BBS H;  4IN3 A;  1TQO A;  4DV0 L;  3GO5 A;  3LWE A;  5JJI A;  1I4Q A;  4LWC A;  4UHV A;  1EZ8 A;  4LMQ D;  3U4Z A;  4CJ1 B;  4IOC A;  5C44 B;  1HNX Q;  2KHS A;  3E9H A;  2VQF L;  2AWO A;  1I50 B;  3HKZ B;  5IIF A;  3KJO A;  2FFK B;  1EY9 A;  2RHQ B;  2CWA A;  1PRT C;  5I2X A;  3NPP A;  3GTQ H;  1UE7 A;  3AYH B;  3QR8 A;  3GTO H;  2XVS A;  2MO1 A;  3SXH A;  2E5L L;  2NVQ B;  3QIA A;  1SE2 A;  1HR0 Q;  1Q1E A;  2X69 A;  3FKI B;  4DKA C;  5A35 A;  1S5F D;  1Y69 U;  2Z6B A;  4L5T A;  4H44 C;  4O2D A;  1K8A C;  5M5W B;  4DV6 L;  1I94 L;  2J7Z A;  2B29 A;  3PIP A;  3TZD A;  4BXX G;  2L12 A;  3RLN A;  4ZKB B;  2F0M A;  5JEA J;  5ELO A;  5KNB A;  1ENC A;  4IO9 A;  1QJO A;  4Y7N H;  1FD7 D;  3P75 A;  2UUA L;  4OON A;  4JI8 L;  3BDL A;  4H0L C;  5CYU A;  5J39 A;  1Y1V G;  1K8O A;  3N52 A;  2YTV A;  4A3B H;  2EYL A;  4RGM A;  4A3K B;  2UXB Q;  4DV7 L;  1CKN B;  3NP8 A;  2Q8I B;  2JJQ A;  2RHS B;  1TWG B;  1CQF A;  1HQR D;  5KEE A;  2WKC A;  3I4N H;  4N8X 1;  4K5V A;  4XYO A;  1A2T A;  5CV4 A;  4GN4 B;  1CFM A;  5G3L D;  3RLF A;  5CBA E;  2XSC A;  4QQB X;  3PIO 3;  2K03 A;  1PTO B;  3BZC A;  1GKH A;  2ZXO A;  3GTJ H;  2PI2 E;  4DV2 Q;  4MHE A;  3EVQ A;  3KF6 A;  1K83 H;  1T5X D;  2F1M A;  2FIN B;  1X3P A;  4KI0 A;  2EYJ A;  3ITP A;  5FJ8 H;  1WTP A;  3HOW G;  2N49 A;  3S17 H;  4CGY B;  1KLG D;  3DEP A;  5D3D A;  4RCN A;  1V43 A;  1B8A A;  1S3O A;  4HIM A;  5LMU L;  4L63 B;  4MNO A;  4DUZ L;  2QDL A;  1HUN A;  5E1F A;  4B9W A;  3OSO A;  2FHT A;  4DV4 Q;  3N6R A;  3IL8 A;  4YCV A;  2WKD A;  1J6Q A;  1XPU A;  2V1C C;  2KEE A;  1JR0 D;  2BCO A;  3FPP A;  4GS3 A;  5CBE E;  4H7B A;  4B3M L;  4ZLT F;  3CCQ A;  1KLU D;  4LF9 Q;  2N3S A;  5KRU A;  5E3F A;  3U50 C;  5C44 H;  1EZ6 A;  3S1N B;  1I50 H;  3I4O A;  3A74 A;  3M4Y A;  3P20 A;  4CDD C;  1OXU A;  1C4Q A;  2PZT A;  1N8R C;  2B63 G;  1BCP B;  2EY1 A;  1KD1 C;  3VA5 A;  1DON A;  3WOE A;  2RCN A;  1YEZ A;  2OXP A;  5FOB B;  1SEB D;  4IAL A;  2Y0S E;  1CZW A;  2M9V A;  3MWY W;  4N9P A;  4DV5 L;  4GKK L;  5A2Q L;  3CCJ A;  3FKI H;  3OTO L;  1Q3L A;  2K75 A;  5M5W H;  1LT3 D;  4OHJ A;  1A62 A;  3S24 A;  3BG3 A;  4DAY A;  4YWM A;  2KJX A;  4OWT B;  4AQY L;  5M5Y B;  3C1E A;  2KEC A;  2VB3 X;  1V1Q A;  5ELF A;  3SGI A;  2BOS A;  3H91 A;  1WFQ A;  4A3K H;  1PHJ A;  3D4R A;  1ZKO A;  4ZKC B;  1KC8 C;  1KL9 A;  1TWG H;  5EQ0 A;  1VF5 C;  1HZC A;  1N34 Q;  4DR1 Q;  1UWV A;  3MXN B;  1L2F A;  4TQU S;  1HXY D;  4YIJ A;  4DR6 L;  2XWJ B;  2CHB D;  3KOJ A;  2VUM G;  4JV5 L;  1EYC A;  4HN7 A;  2FJ2 A;  1PTO H;  4YY3 L;  4CJ2 C;  3K7A B;  2WB1 G;  1RTO A;  1VQA A;  4GKJ Q;  1XWE A;  4FNF A;  5C6A A;  3R93 A;  1UE1 A;  1NSN S;  3F2C A;  5A2Q E;  2EPB A;  1N32 L;  5C4H A;  3SK8 A;  2WB1 E;  4J6H A;  1ROD A;  3ONA B;  4K8I A;  4KHP L;  5FKA C;  3PO3 B;  1L1O C;  2JE6 I;  2RCF A;  3CCM A;  3W2D A;  2MHV A;  2X6G A;  2EY5 A;  2B2T C;  4NXM Q;  3I4N G;  1BO0 A;  4QCL A;  2KA7 A;  1D2B A;  2F0L A;  1VQF A;  3CME A;  1D8L A;  2CKZ B;  1KRT A;  1VQN A;  2VNU D;  2XN9 C;  5DAU A;  1AEX A;  3GV6 A;  3S1N H;  4X6A H;  4A3M G;  3IFT A;  2EYO A;  1Q7Y C;  1K0S A;  4G7Z C;  2A74 C;  1PH8 A;  3D6W A;  5FJ8 G;  3GDE A;  4RFB A;  4A3G B;  2UXC L;  5EKK A;  4AH6 A;  1SE8 A;  2QCP X;  2B2Y A;  1HH2 P;  4LW1 A;  4JK1 C;  3M4P A;  1YHA A;  4M1U B;  5LMN L;  1KTK A;  1JOQ A;  4QL5 A;  1HJP A;  4X3S A;  3NBH B;  5BN3 A;  1PLF A;  1CHP D;  5C5L A;  4QF4 A;  4IFD I;  4OO1 I;  2B2U A;  1O7L A;  1JT8 A;  5EPL A;  4ZQ3 A;  5M5Y H;  4CHT B;  3NK9 A;  1SYF A;  1DOM A;  5C44 G;  4RKB A;  5FLX L;  4LF6 L;  2HIV A;  2YU9 B;  1RKN A;  4DAM A;  4DR3 L;  4PMW A;  2AHO B;  1F2Y A;  4A3E B;  1CKM A;  2Q2H A;  4IPH A;  4EQO A;  1GHK A;  1JB7 A;  4X3K A;  4P71 A;  4R1J A;  4YWK A;  5M9O A;  1EY6 A;  4OWW B;  1D6E C;  1K8M A;  2EDG A;  4RGT A;  2EVB A;  2A6H D;  1GHJ A;  4JI2 Q;  3K7A H;  4U67 3;  4Q0F A;  1AN8 A;  1PH9 A;  1Y8N B;  1ZYR D;  5DNF A;  1BCP F;  4YCW A;  5JJL A;  5IP7 H;  2PQA A;  4IUU A;  1A8V A;  2OEO A;  1LM0 A;  3T1Y L;  3OMG A;  2ICE C;  3PO3 H;  1EY8 A;  1YNX A;  4LFB L;  4LF5 Q;  3P1H A;  4KY5 A;  3K7U C;  1L0X B;  2JSO A;  1BXT A;  5KNC A;  1K3R A;  4DNT B;  2CFM A;  2QEJ C;  3TP8 A;  2OF1 A;  3HOY B;  4BY7 G;  2IT1 A;  1WTQ A;  3L0O A;  3S2D B;  5FLX E;  2F0D A;  2KBN A;  1SFO B;  4HMI A;  4QIW B;  2SNM A;  2HQL A;  3ERS X;  1Q8K A;  4X66 Q;  4RG1 A;  3K81 C;  4C3H G;  4QGU A;  1EY7 A;  4NPS A;  1XMQ L;  1TWC B;  3HOX H;  1WYD A;  1K3B C;  1EWH A;  1Z9F A;  3BVG A;  3SR1 A;  4A3G H;  3KYH C;  4P73 A;  3HP3 A;  4ME5 A;  2K50 A;  5EJW A;  1C48 A;  3S1R B;  3CPW A;  2O5I C;  1U4P A;  2G9D A;  1X6O A;  4CDC C;  1VQP A;  1M4V A;  5IOC A;  1KDA A;  1KNA A;  1EOV A;  4IZ8 A;  2ZTD A;  2DN8 A;  4A3J G;  1AE2 A;  2Z4H A;  3CPF A;  4IUN A;  2YU9 H;  3ICE A;  4HJ8 A;  2ZTE A;  4EQ5 A;  4A93 G;  1NE3 A;  2JK8 A;  4JBM A;  1X55 A;  3CP0 A;  4ODG A;  3K5N A;  2K05 A;  3TBI B;  3S2H B;  1AE3 A;  3ERQ A;  1IBK Q;  4QUC A;  5C0X J;  4LF8 L;  4OO1 H;  4F88 A;  2Z6K C;  3HOZ G;  2F0N A;  1XNR Q;  2NWG A;  2IW3 A;  1O78 A;  4ZUJ A;  4L6T B;  1BBU A;  1SNP A;  3PUY A;  5DLQ E;  4IQZ A;  3CQZ B;  1WTX A;  3CCL A;  1GJX A;  4R9W A;  4YCU A;  4AIM A;  1LYL A;  3CW2 C;  4DFA A;  1K8G A;  1MI2 A;  4JI7 L;  4F87 A;  3LX0 A;  4I65 A;  3KF8 B;  5G3L F;  1E22 A;  4O1N A;  3HOY H;  5CV6 A;  1SNC A;  3K0X A;  3ND9 A;  3V2T A;  2CH4 W;  3S2D H;  2K04 A;  5L37 A;  1LTB D;  1B9M A;  2F0T A;  1DM0 B;  1PYS B;  3FDT A;  3HOW B;  4FDB A;  2EOT A;  1TWC H;  4R4T A;  1CSP A;  4A3F B;  3H3V I;  3IFD A;  3PUZ A;  2PPB C;  2F4V L;  1EWC A;  2NTT A;  4X62 Q;  3FP9 A;  4C1N I;  2BH2 A;  1TY2 A;  3TSS A;  3TDQ A;  1EEF D;  1H95 A;  3F1Z A;  3C1F A;  1D7Q A;  3T1H Q;  1F2L A;  1NY4 A;  3S1R H;  4P2C B;  1A63 A;  1I4R A;  2PNH A;  1HNZ Q;  4LJZ C;  3PSI A;  1SYG A;  1VQI A;  1HFN A;  1NR4 A;  4KTA A;  3BYT B;  3LWU A;  1EFW A;  1Y1W G;  3Q8D A;  2DJG C;  2D0O A;  2Y0S B;  4C3I B;  2K6A A;  4L5R C;  1II3 A;  2B63 B;  3K58 A;  2D9U A;  1IL2 A;  2PQE A;  1QUQ A;  3KK7 A;  1B2T A;  1U5K A;  2JA7 G;  4YHH Q;  2IX0 A;  1D5X C;  2EYP A;  3HRZ C;  2ZM6 Q;  5E4W C;  1EOT A;  3J80 i;  4A3G G;  4B3T Q;  5M3F B;  2B3G A;  4OIK A;  4JI4 Q;  3S2H H;  4PZ6 A;  4WJW A;  4BXX H;  2BDN A;  5C0X G;  2ZXR A;  2JA8 B;  1ENA A;  1D1I A;  4B9X A;  1LAC A;  3CQZ H;  4ME3 A;  2VY3 A;  2WAQ G;  1PH5 A;  1JIC A;  1IZ6 A;  1L1O A;  1I4H A;  1MSH A;  1V9P A;  2R93 B;  4R4O A;  1K9M C;  2RDG A;  4RH6 A;  3FVQ A;  2MFI A;  1PH1 A;  1TS4 A;  2IHF A;  1OXV A;  2WAQ E;  4JI1 L;  1WTV A;  2B2T A;  4JW0 A;  4XT1 B;  5EPK A;  2VW9 A;  4DV1 L;  4FP5 D;  3W3A A;  2PZW A;  3J81 L;  2K5H A;  4KJO A;  4GNX B;  1PFN A;  4GOP C;  2VUM B;  2R61 A;  4WOR A;  4A3E G;  1Y8P B;  3CCS A;  2ATW A;  3HOU G;  3OWE B;  3Q0A A;  1HZ9 A;  2PMZ E;  3MA2 B;  5CV9 A;  3V96 A;  2EE1 A;  4DXG A;  4UP8 A;  1TS2 A;  2A69 C;  5CC4 A;  3HOW H;  4R4I A;  1C7Y A;  4O42 A;  1BOS A;  5JPN C;  3F2D A;  1AP0 A;  1KAA A;  1HNW L;  3R2I A;  1I94 Q;  5IT9 L;  5BN5 A;  1HA5 A;  5IY0 A;  4DR4 L;  2BA0 A;  2V4D A;  4MIU A;  4ZYS A;  2A19 A;  5ELB A;  1W6J A;  2DNC A;  4FXG C;  1IYJ B;  1GUS A;  1E1O A;  1RF2 D;  5EKL A;  1Y8O B;  2A6E D;  3J7A 5;  2VQE Q;  1A3T A;  1MGS A;  1B9N A;  2K4K A;  1LTL A;  3H3V H;  4K14 A;  3J81 E;  2CQA A;  5E7N A;  2EYF A;  4CKB A;  1BBW A;  2B63 H;  1EIF A;  4XXE A;  3CU7 A;  2IWH A;  2NZ1 D;  1TS5 A;  2L0C A;  1HPC A;  1M8A A;  2K5D A;  4KKT A;  1ONL A;  2AQ1 B;  1OXX K;  4HTH A;  1FNV A;  4GLX A;  1NUC A;  1JB3 A;  1J5E L;  2R7Z G;  1GXD C;  1CTM A;  2TSS A;  2IY5 B;  4HJ7 A;  4LFA Q;  4DUZ Q;  2LXK A;  5COR A;  1WD0 A;  4ID6 A;  5IT9 E;  2LXJ A;  3I72 A;  3U4V A;  1SYD A;  5FLM H;  1PFS A;  1SE3 A;  2JA8 H;  3SK5 A;  4HSV A;  3KLS A;  2NBF A;  2KEN A;  3KLR A;  3E6Z X;  1B3Q A;  1YNN C;  5DM6 3;  5IT9 c;  3UDG A;  3S1M B;  4AYB G;  4RMF A;  3S14 B;  2R93 H;  2C9O A;  3PO2 G;  1XJV A;  4Z9C B;  2K5Q A;  4ULL A;  1GUW A;  4RGO S;  2MNA A;  3WDN A;  4U68 A;  1QNU A;  1PH2 A;  3M4Q A;  4NP5 A;  1LT5 D;  1QVC A;  4AYB E;  4DV3 Q;  2VUM H;  5DM7 3;  1VQK A;  2NZH A;  4OGQ C;  4C1N K;  5F2D A;  2JA6 B;  4KY7 A;  1UEB A;  3GTL B;  1MIU A;  5AJ3 Q;  1W2B A;  1O7I A;  1ET6 A;  1DJR D;  2HCI A;  3CKI B;  5BN4 A;  2UU9 Q;  1UUP A;  4C2M H;  1A2U A;  1I6V C;  3A7A B;  2D5D A;  3FRP B;  1S40 A;  3H6M A;  2IL8 A;  4J15 A;  4F7X A;  3H15 A;  1N9W A;  5BR8 Q;  2I0Q A;  1VQE A;  1X9N A;  3PCO B;  4BS9 A;  4I7Z C;  1WTR A;  5CMD A;  2UUB L;  1TVX A;  4TKO B;  4BY7 B;  4G57 A;  1STA A;  1IW7 C;  1IBM L;  1ET9 A;  5H1S E;  3TEH B;  2F3W A;  1VQL A;  2Q8T A;  4C3H B;  1EWI A;  1J8I A;  3C2P A;  4A3M H;  1VQD A;  2UUC Q;  2JA5 B;  2XNA C;  1O7Z A;  3CCU A;  1ML0 D;  3NTH A;  1GVP A;  4DR5 L;  4KHV A;  5IGC A;  1O80 A;  3PIO A;  3RZO B;  3H0G G;  1KIX A;  1IYV A;  3KF6 B;  1RDP D;  2ZTC A;  1Q12 A;  1H9S A;  2L9H A;  4G7O C;  3HKS A;  1PYB A;  3E9I A;  4A3F G;  2QGQ A;  3SEB A;  4DUY L;  2Z6K A;  3K57 A;  3BVZ A;  2RF4 A;  3I55 A;  3FEW X;  3PUW A;  1WCM G;  1WTW A;  2R92 B;  1EY0 A;  2ALY B;  4HSP A;  5I2Y A;  5KGU A;  5C5M A;  2E2J B;  4RA8 A;  5D3I B;  3HG9 A;  4A3J B;  3D3R A;  1DD2 A;  3CCV A;  2LKV A;  3FPU B;  4OIJ A;  4QJF A;  2F0J A;  3I91 A;  1P8L A;  5C3E B;  3S1M H;  3UE0 A;  3A55 A;  3S14 H;  4ALP A;  1HUM A;  1H9R A;  1LO5 D;  1LTA D;  3CC4 A;  2Y0S G;  4C3I G;  4A93 B;  1TY0 A;  3D31 A;  4HIO A;  2PW5 A;  3S9W A;  2B39 A;  2UXD Q;  1QWY A;  3NEM A;  5K5P A;  1HNX L;  3I3C A;  1ZEQ X;  2AQ3 B;  3G4S A;  1PYW D;  2JA6 H;  3HOZ B;  3MFG A;  2NVQ H;  3H94 A;  1UAP A;  4K5W A;  1GUG A;  3C46 A;  2IHE A;  5JOB A;  1SND A;  5M3F G;  1EEI D;  2EJG C;  3OWF A;  2VL6 A;  4G4K A;  1WOC A;  2JA8 G;  5FLM G;  3A5Z B;  1F9S A;  1SE4 A;  3RD4 A;  1PH7 A;  1IKM A;  1HR0 L;  1JC7 A;  4JI0 Q;  3CHB D;  1BDO A;  1GUN A;  4GLV B;  4UP7 A;  3J7A V;  4ZK9 B;  2F3I A;  1E2V A;  4B08 A;  5JEA G;  3M85 A;  3RMH A;  4DAY B;  1PRT D;  4JBJ A;  1U4M A;  2R93 G;  1NMF A;  3TRE A;  4LFC L;  5J3B A;  5I9P A;  2HHH Q;  1JJC B;  3F2U A;  4BY7 H;  4K0K Q;  3VR2 A;  1TWF B;  4EQP A;  4FXK C;  1XPO A;  4P72 A;  4B3S Q;  1YNJ C;  3K59 A;  2NVX B;  1RIP A;  3SDZ A;  3H3V C;  4KD4 A;  4C3H H;  4BA1 I;  1VQ8 A;  2JA5 H;  2FXQ A;  2CCZ A;  1PFB A;  4RCO A;  1CQV A;  3RZO H;  4FF4 A;  2JEA I;  1XNQ Q;  1M90 C;  2F4I A;  3TS0 A;  4DV2 L;  2LSS A;  1RCV D;  4C3J G;  4KN7 C;  1E0B A;  1VQ6 A;  5K36 G;  2F0I A;  1SAP A;  3D6C A;  2R92 H;  4X65 Q;  5CGK A;  4NXN Q;  2EYM A;  1SYC A;  1STE A;  4JOI C;  4OL7 A;  2CVR A;  1Y1W B;  1EIY B;  4QB4 A;  4A3J H;  2MGS A;  4POG A;  4QMG A;  4LF4 Q;  1V1P A;  2L55 A;  5C3E H;  1WD1 A;  5DEH A;  4DV4 L;  1GO3 E;  5IGB A;  4IUT A;  4RAU C;  1BVS A;  4POF A;  2JA7 B;  1Q46 A;  4RHS A;  4OX9 Q;  4A93 H;  4MN3 A;  4GOP A;  1TT2 A;  3IKJ A;  4LF9 L;  4NB3 A;  3NWS A;  5IYB G;  2F03 A;  4ILW A;  4XDX A;  2RKS A;  1S5D D;  4OEM B;  4MZ9 A;  1LTT D;  2DY8 A;  2A73 B;  2XWB B;  3HOZ H;  1U4R A;  3K0Y A;  4FVM A;  1IXR A;  4M8A A;  1IYU A;  1PH3 A;  1RL2 A;  1NR2 A;  4LF7 Q;  2WAQ B;  1DOL A;  2ZXP A;  4PMB A;  3HEJ A;  4HCE A;  3CC7 A;  4HED A;  4JYA L;  3MEH A;  3I2Z A;  2QW7 A;  1K73 C;  2PCF B;  5IGF A;  2XIW A;  4BY1 G;  2PMZ B;  3NBI A;  4XT3 B;  2OWO A;  1FVI A;  1SSO A;  1B70 B;  2HIX A;  4R4C A;  1TWF H;  3HOU B;  2F0E A;  3AEV A;  3I4M G;  1MJC A;  1U0L A;  2LS0 1;  3P7J A;  3OYY A;  1AZQ A;  2NVX H;  4X64 Q;  3ER0 A;  5GAH C;  5HGT A;  2JA6 G;  5T1G A;  3EFX D;  2OT2 A;  3QO2 A;  1FJG L;  1P16 A;  1N34 L;  4DR1 L;  4UAI A;  1I4P A;  1TS3 A;  4FYD A;  4R4Q A;  1SRO A;  2LY7 A;  4UPA A;  4IOA A;  3D4D A;  4JPB W;  4DA2 A;  2B2V C;  2CW0 C;  3L7Z C;  4QUF A;  1FYC A;  4FF3 A;  2AKW B;  4GKJ L;  2PQA B;  4KKS A;  1IBL L;  4DK3 C;  4HAE A;  3W5O A;  4IJH A;  1X3E A;  2EYH A;  5EAY A;  1GD7 A;  1VQB A;  2HCC A;  1HTL D;  2K33 A;  3AU7 A;  2N78 A;  2E2H B;  1NNX A;  3A56 A;  1Y1W H;  1OO9 B;  4WJ4 A;  4NDX A;  4Q5V A;  1XMO Q;  1A6X A;  1G6Z A;  5IGG A;  1K0R A;  5C4X B;  2JA5 G;  4NXM L;  3NWT A;  3ULL A;  2F0S A;  2JA7 H;  3S15 B;  3HS0 C;  3L9A X;  1PZI D;  3CAM A;  3DXJ C;  1LT6 D;  3DWQ A;  4IPD A;  3T13 A;  4DK0 A;  3UI2 A;  1LLR D;  1STG A;  4FXD A;  2R7Z B;  2YYZ A;  3SK6 A;  3MHB A;  5I9O A;  4YWL A;  3O13 A;  3R3O A;  5C0X H;  4BWG B;  4X3T A;  1ENF A;  1KNE A;  1R9T B;  2R92 G;  2ASB A;  4AYB B;  1L0Y B;  4HIK A;  1VQ7 A;  4A3D G;  1LTR D;  3JC6 6;  3T53 B;  2XRQ D;  4JI6 Q;  3PO2 B;  3I70 A;  2H1E A;  1HQM C;  2A8V A;  1JOK A;  3OW2 A;  5C3E G;  5NUC A;  4R8I A;  2HUG A;  4JI5 Q;  2SNS A;  1ASY A;  2F0G A;  1HR0 W;  1RJT A;  5IOD A;  2VXW A;  4A3L G;  5C4J B;  1F9Q A;  4A3E H;  2EY2 A;  1D5Z C;  2NN6 G;  3HOU H;  1PTO C;  1PXU A;  3K6O A;  1WJJ A;  2B8G A;  1VQ5 A;  3TS2 A;  3VR6 A;  1CSQ A;  5J1Z A;  1STB A;  1AZP A;  3ERO A;  1SMY C;  2EY6 A;  3Q24 A;  2BE5 C;  2O4X A;  2JP1 A;  1GUT A;  4P74 A;  4HJA A;  1X3Q A;  2MPM A;  3EIV A;  5IWA Q;  3KDF A;  2E76 C;  1FGU A;  1O7Y A;  1VQ4 A;  4ZAI A;  3T56 B;  4JI2 L;  5CV7 A;  1YJ9 A;  3D4W A;  3AMU A;  2IX3 A;  5I6W A;  3CCE A;  2M2L A;  4KLK A;  4APV A;  4A76 A;  3VYR A;  3PGZ A;  3JAM i;  1YIJ A;  2GA4 B;  1S72 A;  3A8J E;  2E2H H;  3VR5 A;  4DU9 A;  5E4X A;  3RN5 A;  2SDF A;  4DR2 Q;  4LF5 L;  1SFO H;  5GAG C;  2N88 A;  4B3R Q;  3SE0 A;  3GD7 A;  5M3M B;  1SMX A;  2R3Z A;  2F52 A;  3H0G B;  4PNY A;  1MSG A;  4JI3 Q;  1BCP C;  1JWS D;  1N36 Q;  1HCZ A;  4GN5 A;  3EQL C;  1CM9 A;  2JQO A;  3S15 H;  2O2L D;  3S1Q B;  1ESF A;  4PZ7 A;  1VQO A;  1EL0 A;  4GZY C;  3CRL C;  3CCR A;  1FNW A;  2R7Z H;  1WCM B;  3DWA A;  4IFD J;  1JE4 A;  4NMZ A;  1YVC A;  1PH4 A;  3C3L A;  1QZG A;  1JCK B;  1V1O A;  3SHL A;  3MVV A;  2R6G A;  4K6L A;  4UDU C;  2MUY A;  4WRD A;  3G6E A;  3PO2 H;  3STB C;  1G8Z D;  3KJP A;  3VYU A;  3UDF A;  5M5X B;  2K5N A;  2A68 C;  2QA4 A;  1ILP A;  1XYI A;  5KIX A;  1BKB A;  2MO0 A;  3D8G A;  1QB5 D;  1STY A;  4KV6 A;  4XYQ A;  3I90 A;  5C4J H;  2DJF C;  1VDZ A;  1QUQ B;  3URY A;  2B2W C;  3VYS A;  3MXP A;  2BDO A;  4DV0 Q;  4BBR G;  1Q8I A;  4HCS A;  5C4Z A;  1E3P A;  1XTD A;  3DEO A;  1PRT F;  1IBK L;  3J81 i;  1JOO A;  5FO8 B;  2FMM A;  2K01 A;  4KD3 A;  4KK7 A;  1XNR L;  3HFZ B;  4PMC A;  3E3X A;  2QIL A;  5KYI A;  2VQF Q;  1L1O B;  4JOI A;  1SDF A;  1XXG A;  3NXW A;  4XQQ A;  1F9R A;  1QVG A;  3J80 L;  3NSW A;  1TII D;  2F0Q A;  3MAQ A;  3E0E A;  3UE1 A;  3WWV A;  5EBD A;  3OPO A;  2HQE A;  1X65 A;  1ICF B;  3ULJ A;  3L3O C;  5KND A;  4IJL A;  3H0G H;  5TSS A;  1E7Z A;  2E5L Q;  3BJU A;  4DAP A;  1EYG A;  5HY6 A;  4A3F H;  3VYT A;  3S1Q H;  1ESR A;  2KOL A;  3VR4 A;  1CT1 D;  3GTQ B;  4DV6 Q;  1F77 A;  4C3J B;  4HID A;  3GTO B;  1LTG D;  2K52 A;  2B2Y C;  1WCM H;  3BDO A;  2UUA Q;  1X32 A;  1G2S A;  4PQX A;  4JI8 Q;  4CJ0 B;  4L5Q A;  1EU4 A;  4IFD G;  1CK1 A;  3J7Y W;  4X62 L;  4DV7 Q;  1PDQ A;  3A54 A;  4MTN A;  2OTJ A;  2MJ8 A;  2UUB Q;  1N33 L;  3AFP A;  3PMF A;  3T1H L;  4XTC S;  3J7Z C;  1QVF A;  1KHI A;  4OXP A;  4C3I H;  1HNZ L;  4PZ8 A;  3CMA A;  5M5X H;  2IX1 A;  3J80 E;  3A7L A;  3HGB A;  4IUV A;  3SVM A;  5C4X G;  2D0P A;  2EQS A;  3NEL A;  5EPJ A;  1ILQ A;  2XRS D;  3J80 c;  4FF1 A;  4I7A A;  2R7F A;  2AMC B;  1D5M C;  3M9B A;  2CWP A;  2Q2I A;  4KKU A;  4KMU C;  2ENB A;  3NTI A;  5M3F H;  1M1K C;  4JBW A;  2K1B A;  4DUY Q;  4YHH L;  3A8I E;  1FR3 A;  5LMU Q;  3NTK A;  4A3C G;  2ZM6 L;  2RVL A;  3K80 C;  2EJF C;  2D2C C;  2B2V A;  3EJI A;  2PYK A;  5JJZ A;  1G29 1;  4B3T L;  3OOC A;  1SJE D;  2YV5 A;  2E74 C;  1JMC A;  5JEA H;  4JI4 L;  3E0J A;  3LNN A;  4BY1 B;  4RHR A;  1BUV T;  2YTX A;  5LHY 1;  1T5E A;  3I56 A;  4C56 C;  1W3S A;  4B3M Q;  2WAC A;  4PV1 C;  2L1B A;  4KY6 A;  5LL6 S;  2FMC A;  3BDC A;  5D14 A;  3TP5 A;  1JQY D;  3I4M B;  1EQV A;  3QB3 A;  3DM1 A;  2SEB D;  1VMP A;  1QE6 A;  3OHX C;  1EQQ A;  4DF7 A;  1SR3 A;  2F0F A;  1X3F A;  3M3Y B;  5GAE C;  5IP9 G;  2KCN A;  3I4L A;  3MXU A;  2F0H A;  3I73 A;  1S5C D;  4DV5 Q;  4GKK Q;  4IUQ A;  5IYD G;  3OTO Q;  2A5H A;  1KQS A;  1KDB A;  4C3J H;  3AQQ A;  4DK1 A;  3RNU A;  5K36 H;  3PIP 3;  4L8J A;  2KHI A;  3Q22 A;  3I8Z A;  4LUZ A;  4AQY Q;  4GLA C;  2HT1 A;  2NTS A;  3G6J B;  3GP7 A;  2NZO A;  3DLL A;  1G51 A;  2F0U A;  4LFC Q;  1Q82 C;  1VS0 A;  2A69 D;  1CKN A;  4O0A A;  5D65 A;  1C9O A;  1FNU A;  5T1I A;  3NE5 B;  4A3I G;  4DR7 L;  1I4X A;  3PUV A;  2Q2T A;  3ND8 A;  2Z4I A;  1SJH D;  4DR6 Q;  1BF4 A;  3DMU A;  4CKE A;  4JV5 Q;  2VB2 X;  4Y52 H;  5M3M G;  3R2T A; 
#chains in the Genus database with same CATH homology
 1DOK A;  1VF7 A;  1R4Q B;  3MXG A;  3GTK B;  4E6I A;  2RDH A;  3OMC A;  3X3N A;  3M4O B;  2EJM A;  2NN6 I;  3RZD B;  2Z8L A;  2JYO A;  1H9S B;  2DY7 A;  2F0K A;  4A3D B;  4N9T A;  4XQJ A;  1SNO A;  1KDC A;  3K5L A;  1E2W A;  5COY A;  5KYL A;  1TKW B;  1A15 A;  1MD2 D;  3DUZ A;  3QJY A;  5C3X A;  4J8Q A;  3IAY A;  1B53 A;  1E2Z A;  2E2D C;  1SNQ A;  1F9P A;  2EXZ A;  2PO4 A;  2KVM A;  2NYZ D;  5JAV A;  2ID0 A;  1BNZ A;  2H4O A;  4ABN A;  1I3Q B;  1YNN D;  5ELC A;  1EY4 A;  2F0O A;  2WV6 D;  2EZV A;  2N55 A;  2F0W A;  1PZK D;  2Q8R E;  1Z6H A;  2TMP A;  4S3S A;  5ISR A;  3V05 A;  1PZJ D;  1CZG A;  1V8Q A;  3T4A C;  3DHQ A;  2A6H C;  3HZX A;  1ZYR C;  1Z47 A;  3WOF A;  2K32 A;  4K8J A;  1DZ1 A;  1SYE A;  3MXN A;  2IJ0 A;  2RDF A;  1BQQ T;  2AUK A;  4EQN A;  3TZU A;  1EY5 A;  2RQX A;  2B2W A;  5EKI A;  3CRK C;  1H9M A;  5CV5 A;  4LK1 C;  1ZXT A;  1IW7 D;  1OXS C;  1NAP A;  5C0X I;  3E5S A;  2F0V A;  1VCI A;  4EVO A;  1NCV A;  1DCZ A;  1DXM A;  4IUR A;  1HTP A;  3K5O A;  2PNR C;  2LMC B;  1V1P B;  2NN6 H;  1B44 D;  1QG7 A;  2AWN A;  3OW7 A;  4WFN 3;  3S16 B;  4ZRZ A;  4K2K A;  1F2Z A;  2X6L A;  1HRJ A;  5FK9 C;  2B8F A;  3TP7 A;  3HOV B;  4BBR B;  2J4X A;  2KED A;  3HOX B;  2ICI A;  4V0B A;  3NBH A;  1STH A;  2RA4 A;  3FMC A;  1PTO F;  3R8B A;  2NB0 A;  1F2M A;  5LL6 X;  4KN4 C;  3AB9 A;  1S4Z A;  3MTS A;  1XX8 A;  2RSN A;  3SK4 A;  5I6Y A;  3KBX A;  3KBG A;  3KLS X;  1AFP A;  1B50 A;  3BS1 A;  1EIH A;  1CHQ D;  3J7A F;  5AFW A;  3GTM B;  1RHP A;  2F3V A;  4CKC A;  1IHZ A;  1TU2 B;  2KQ3 A;  2WII B;  1YNJ D;  2D62 A;  4V19 0;  2L5T A;  2IPK D;  1BBX C;  2PW7 A;  1JWU D;  1SXT A;  1EQT A;  4CBV A;  5J22 A;  1RD9 D;  2NVY B;  3X3M A;  2LFN A;  1A3V A;  3MFY A;  4KJN A;  1B3A A;  1KAB A;  3RUZ A;  4J1M A;  2BA1 A;  1H9J A;  5CV8 A;  4F8M A;  1PRT B;  5EGT A;  4RGN A;  1WTO A;  4X3U A;  4KHZ A;  4K5X A;  3BYY B;  1IL8 A;  1R4P B;  3GV3 A;  4FF2 A;  1MBY A;  1RTN A;  2G9H D;  1HA6 A;  1QOH A;  1EYD A;  1BR9 A;  3NUC A;  4K6D A;  2DNE A;  2F0P A;  1TWH B;  4NW2 A;  1EIG A;  1SYB A;  3MC0 B;  2ZT9 C;  4IUP A;  1GUO A;  1FGB D;  4EGV A;  4NKL A;  2HDM A;  3U9S A;  5JVH 3;  4FO2 A;  5JVG 3;  2I46 A;  3QOJ A;  2E2I B;  2K28 A;  1G91 A;  2K7V A;  5C3W A;  1I6H B;  1B1Z A;  1B4O A;  1HFG A;  1LT4 D;  3EA6 A;  3GTG B;  1A3U A;  1EFI D;  1CI3 M;  3TP6 A;  3T16 A;  4IFD H;  2AQ2 B;  2AUJ D;  5ELE A;  1QCB D;  1QNK A;  1D1K A;  1C8C A;  2NUC A;  1GOZ A;  4A3I B;  2RBM A;  1Y1V B;  2NVT B;  2C5C A;  3G7L A;  3KF8 A;  2MP1 A;  5FO9 B;  3GTP B;  2K5W A;  2CW0 D;  4XIG S;  1I4G A;  3VA7 A;  2J0T D;  2KUM A;  3A8K E;  1PFM A;  3Q6S A;  2QKI C;  4DXF A;  1PMR A;  1S5E D;  5ELD A;  4BA2 I;  2A6E C;  2HDL A;  1S5B D;  4XQN A;  3DWP A;  4DGZ A;  3JAM L;  4G7H C;  3PV0 A;  1G2T A;  3OIP A;  1JOR A;  3NQI A;  3H09 A;  1EU3 A;  4DNR B;  1CA5 A;  2O5J C;  1AW7 A;  3K5M A;  1TWA B;  5CR3 A;  1VMC A;  3M7G A;  4DAV A;  3QOL A;  1LTS D;  5FO7 B;  3NHH A;  4RWS C;  4ZUI A;  3TN2 A;  3BZD B;  1Q90 A;  1J9O A;  1DYQ A;  4BBS B;  1UEA B;  2M00 A;  1U4L A;  3JAM E;  5HUR A;  1PTO D;  3GQB A;  2QF7 A;  2SOB A;  5I4D A;  3M7N A;  2L4N A;  2KCC A;  3VR3 A;  1SMY D;  3QWN A;  4TRD A;  5EBC A;  2BE5 D;  1IKL A;  1ICW A;  3MZ5 A;  1SNM A;  2L11 A;  2E75 C;  5JPM C;  1QIL A;  2WP8 J;  3QG1 A;  2WIN B;  3NQT A;  2Z1C A;  2RSO A;  3KUP A;  4DN4 M;  3BVM A;  1EYA A;  1Q1B A;  3PUX A;  2PZU A;  2WB1 B;  1UNS A;  3ZYY X;  2QDB A;  4OO1 G;  4C2M B;  4HMJ A;  4HR7 B;  1JWM D;  4H13 C;  4TSS A;  3Q23 A;  2B2U C;  4Y7N B;  2JXM B;  1BCP D;  5IGE A;  1XTC D;  3OIQ A;  4K2L A;  1W6K A;  1HHV A;  4A3B B;  1LTI D;  1SBB B;  1OXT A;  3TME A;  3T51 B;  3I4N B;  1H9K A;  1LV9 A;  3U9O A;  1Z7T A;  1STN A;  2I07 B;  3GTJ B;  5IGD A;  4A3M B;  1WVL A;  1K83 B;  1U9R A;  4LAA A;  1CA6 A;  2JEB I;  4R8N A;  4RKL A;  3S17 B;  1LAB A;  1TR5 A;  2A68 D;  4IN3 A;  1TQO A;  3GO5 A;  3LWE A;  1I4Q A;  1EZ8 A;  4LMQ D;  4CJ1 B;  5C44 B;  2KHS A;  2AWO A;  1I50 B;  3HKZ B;  5IIF A;  2FFK B;  1EY9 A;  5I2X A;  1PRT C;  3NPP A;  2XVS A;  3SXH A;  2NVQ B;  3QIA A;  1SE2 A;  1Q1E A;  2X69 A;  3FKI B;  5A35 A;  1S5F D;  1Y69 U;  4H44 C;  5M5W B;  2J7Z A;  3TZD A;  2L12 A;  4ZKB B;  2F0M A;  5JEA J;  5KNB A;  1ENC A;  1QJO A;  1FD7 D;  3P75 A;  3BDL A;  4H0L C;  5CYU A;  5J39 A;  1K8O A;  3N52 A;  2EYL A;  4RGM A;  4A3K B;  3NP8 A;  2Q8I B;  1TWG B;  1CQF A;  1HQR D;  5KEE A;  2WKC A;  4K5V A;  4XYO A;  1A2T A;  5CV4 A;  1CFM A;  5G3L D;  3RLF A;  5CBA E;  2XSC A;  3PIO 3;  2K03 A;  1PTO B;  2ZXO A;  4MHE A;  3EVQ A;  1T5X D;  2F1M A;  2FIN B;  1X3P A;  4KI0 A;  2EYJ A;  3ITP A;  1WTP A;  4CGY B;  1KLG D;  3DEP A;  5D3D A;  4RCN A;  1V43 A;  4L63 B;  1HUN A;  5E1F A;  4B9W A;  3OSO A;  2FHT A;  3N6R A;  3IL8 A;  2WKD A;  2KEE A;  1JR0 D;  2BCO A;  3FPP A;  5CBE E;  4H7B A;  4ZLT F;  1KLU D;  5KRU A;  5E3F A;  1EZ6 A;  3S1N B;  3M4Y A;  3P20 A;  1OXU A;  1C4Q A;  2PZT A;  1BCP B;  2EY1 A;  3VA5 A;  1DON A;  3WOE A;  5FOB B;  2OXP A;  1SEB D;  4IAL A;  1CZW A;  2M9V A;  3MWY W;  4N9P A;  5A2Q L;  1Q3L A;  1LT3 D;  4OHJ A;  3BG3 A;  4DAY A;  2KJX A;  5M5Y B;  3C1E A;  2KEC A;  2VB3 X;  5ELF A;  2BOS A;  3H91 A;  3D4R A;  1ZKO A;  4ZKC B;  5EQ0 A;  1VF5 C;  4TQU S;  1HXY D;  4YIJ A;  2XWJ B;  2CHB D;  1EYC A;  4HN7 A;  2FJ2 A;  1PTO H;  4CJ2 C;  3K7A B;  1RTO A;  1XWE A;  4FNF A;  5C6A A;  3R93 A;  1NSN S;  5A2Q E;  2EPB A;  5C4H A;  3SK8 A;  4J6H A;  1ROD A;  3ONA B;  4K8I A;  5FKA C;  3PO3 B;  2JE6 I;  3W2D A;  2MHV A;  2X6G A;  2EY5 A;  2B2T C;  1BO0 A;  4QCL A;  2KA7 A;  1D2B A;  2F0L A;  2VNU D;  2XN9 C;  5DAU A;  1AEX A;  3GV6 A;  3IFT A;  2EYO A;  4G7Z C;  2A74 C;  3D6W A;  4RFB A;  4A3G B;  5EKK A;  2QCP X;  2B2Y A;  4JK1 C;  4M1U B;  1JOQ A;  1KTK A;  4X3S A;  5BN3 A;  1PLF A;  1CHP D;  5C5L A;  4QF4 A;  4IFD I;  4OO1 I;  2B2U A;  1O7L A;  5EPL A;  4ZQ3 A;  4CHT B;  3NK9 A;  1SYF A;  1DOM A;  4RKB A;  5FLX L;  2YU9 B;  1RKN A;  4PMW A;  1F2Y A;  4A3E B;  4EQO A;  1GHK A;  4X3K A;  5M9O A;  1EY6 A;  1D6E C;  1K8M A;  2EDG A;  4RGT A;  2EVB A;  2A6H D;  1GHJ A;  4U67 3;  4Q0F A;  1AN8 A;  1Y8N B;  1ZYR D;  5DNF A;  1BCP F;  4IUU A;  2OEO A;  3OMG A;  2ICE C;  1EY8 A;  3P1H A;  4KY5 A;  1L0X B;  2JSO A;  1BXT A;  5KNC A;  4DNT B;  2QEJ C;  3TP8 A;  2OF1 A;  3HOY B;  2IT1 A;  1WTQ A;  3S2D B;  5FLX E;  2F0D A;  1SFO B;  4HMI A;  4QIW B;  2SNM A;  4C3H G;  1EY7 A;  1TWC B;  1EWH A;  3BVG A;  3SR1 A;  3HP3 A;  4ME5 A;  5EJW A;  1C48 A;  3S1R B;  2O5I C;  1U4P A;  2G9D A;  1M4V A;  5IOC A;  1KDA A;  1KNA A;  4IZ8 A;  2DN8 A;  2Z4H A;  4IUN A;  4ODG A;  3K5N A;  2K05 A;  3TBI B;  3S2H B;  3ERQ A;  4OO1 H;  4QUC A;  5C0X J;  4F88 A;  2F0N A;  2NWG A;  2IW3 A;  1O78 A;  4ZUJ A;  4L6T B;  1SNP A;  3PUY A;  4IQZ A;  3CQZ B;  1WTX A;  1GJX A;  4R9W A;  4DFA A;  1MI2 A;  4F87 A;  3LX0 A;  4I65 A;  5G3L F;  4O1N A;  5CV6 A;  1SNC A;  3ND9 A;  3V2T A;  2K04 A;  1LTB D;  1B9M A;  2F0T A;  1DM0 B;  3FDT A;  3HOW B;  2EOT A;  4A3F B;  3IFD A;  3PUZ A;  2PPB C;  1EWC A;  2NTT A;  4C1N I;  1TY2 A;  3TSS A;  3TDQ A;  1EEF D;  3C1F A;  1F2L A;  4P2C B;  1I4R A;  4LJZ C;  1SYG A;  1HFN A;  1NR4 A;  4KTA A;  3BYT B;  3LWU A;  2Y0S B;  4C3I B;  2K6A A;  1II3 A;  2B63 B;  3K58 A;  2D9U A;  2PQE A;  3KK7 A;  1B2T A;  2IX0 A;  1D5X C;  2EYP A;  3HRZ C;  5E4W C;  1EOT A;  5M3F B;  4OIK A;  4WJW A;  2BDN A;  5C0X G;  2ZXR A;  2JA8 B;  1ENA A;  1D1I A;  4B9X A;  1LAC A;  1JIC A;  1I4H A;  1MSH A;  2R93 B;  2RDG A;  4RH6 A;  3FVQ A;  1TS4 A;  1WTV A;  1OXV A;  2B2T A;  4XT1 B;  5EPK A;  4FP5 D;  3W3A A;  2PZW A;  3J81 L;  4KJO A;  2VUM B;  1PFN A;  2R61 A;  4WOR A;  1Y8P B;  3OWE B;  3Q0A A;  3V96 A;  3MA2 B;  5CV9 A;  2EE1 A;  4DXG A;  1TS2 A;  2A69 C;  5CC4 A;  4O42 A;  1BOS A;  5JPN C;  1AP0 A;  1KAA A;  3R2I A;  5IT9 L;  5BN5 A;  1HA5 A;  2BA0 A;  2V4D A;  4MIU A;  4ZYS A;  5ELB A;  1W6J A;  2DNC A;  4FXG C;  1GUS A;  1RF2 D;  5EKL A;  1Y8O B;  2A6E D;  1A3T A;  1MGS A;  1B9N A;  4K14 A;  3J81 E;  2CQA A;  2EYF A;  4CKB A;  4XXE A;  3CU7 A;  2IWH A;  2NZ1 D;  1TS5 A;  2L0C A;  1HPC A;  1M8A A;  2K5D A;  4KKT A;  1ONL A;  2AQ1 B;  1OXX K;  4HTH A;  1FNV A;  1NUC A;  1JB3 A;  1GXD C;  1CTM A;  2TSS A;  1WD0 A;  5COR A;  4ID6 A;  5IT9 E;  3I72 A;  1SYD A;  1SE3 A;  3SK5 A;  4HSV A;  3KLS A;  2NBF A;  3KLR A;  3E6Z X;  1YNN C;  5DM6 3;  3S1M B;  3S14 B;  2C9O A;  4Z9C B;  2K5Q A;  4ULL A;  1GUW A;  4RGO S;  3WDN A;  4U68 A;  1QNU A;  4NP5 A;  1LT5 D;  5DM7 3;  4OGQ C;  4C1N K;  5F2D A;  2JA6 B;  4KY7 A;  3GTL B;  1ET6 A;  1DJR D;  2HCI A;  3CKI B;  5BN4 A;  1UUP A;  1A2U A;  1I6V C;  3A7A B;  2D5D A;  3FRP B;  3H6M A;  2IL8 A;  4F7X A;  4BS9 A;  4I7Z C;  1WTR A;  5CMD A;  4BY7 B;  1TVX A;  4TKO B;  4G57 A;  1STA A;  1IW7 C;  1ET9 A;  2F3W A;  2Q8T A;  4C3H B;  1J8I A;  3C2P A;  2JA5 B;  2XNA C;  1O7Z A;  1ML0 D;  3NTH A;  4KHV A;  5IGC A;  1O80 A;  3RZO B;  1IYV A;  1RDP D;  1Q12 A;  1H9S A;  2L9H A;  4G7O C;  3SEB A;  3K57 A;  3BVZ A;  3FEW X;  3PUW A;  1WTW A;  2R92 B;  1EY0 A;  4HSP A;  5I2Y A;  5KGU A;  5C5M A;  2E2J B;  4RA8 A;  5D3I B;  3HG9 A;  4A3J B;  3D3R A;  1DD2 A;  2LKV A;  3FPU B;  4OIJ A;  2F0J A;  3I91 A;  5C3E B;  3A55 A;  1HUM A;  1H9R A;  1LO5 D;  1LTA D;  4C3I G;  4A93 B;  1TY0 A;  3D31 A;  2PW5 A;  3S9W A;  2B39 A;  1QWY A;  5K5P A;  3I3C A;  1ZEQ X;  2AQ3 B;  1PYW D;  3HOZ B;  3MFG A;  3H94 A;  1UAP A;  4K5W A;  1GUG A;  3C46 A;  5JOB A;  1SND A;  1EEI D;  2EJG C;  3OWF A;  4G4K A;  3RD4 A;  1F9S A;  1SE4 A;  1IKM A;  1JC7 A;  3CHB D;  1BDO A;  1GUN A;  3J7A V;  4ZK9 B;  1E2V A;  4B08 A;  5JEA G;  3M85 A;  3RMH A;  1PRT D;  1U4M A;  5I9P A;  3F2U A;  3VR2 A;  1TWF B;  4EQP A;  4FXK C;  1YNJ C;  3K59 A;  2NVX B;  3SDZ A;  3H3V C;  4KD4 A;  4BA1 I;  1PFB A;  4RCO A;  1CQV A;  4FF4 A;  2JEA I;  2F4I A;  1RCV D;  4C3J G;  4KN7 C;  1E0B A;  5K36 G;  2F0I A;  1SAP A;  3D6C A;  5CGK A;  2EYM A;  1SYC A;  1STE A;  4OL7 A;  2CVR A;  1Y1W B;  4QB4 A;  2MGS A;  4QMG A;  1V1P A;  2L55 A;  1WD1 A;  5DEH A;  5IGB A;  4IUT A;  4RAU C;  2JA7 B;  4RHS A;  4MN3 A;  1TT2 A;  3IKJ A;  3NWS A;  2F03 A;  4ILW A;  4XDX A;  2RKS A;  1S5D D;  1LTT D;  2DY8 A;  2A73 B;  2XWB B;  1U4R A;  3K0Y A;  4FVM A;  4M8A A;  1IYU A;  1NR2 A;  2WAQ B;  1DOL A;  2ZXP A;  4PMB A;  3HEJ A;  4HCE A;  4HED A;  3MEH A;  2PCF B;  5IGF A;  2XIW A;  2PMZ B;  3NBI A;  4XT3 B;  1SSO A;  3HOU B;  2F0E A;  2LS0 1;  3P7J A;  1AZQ A;  5HGT A;  5T1G A;  3EFX D;  2OT2 A;  3QO2 A;  4UAI A;  1I4P A;  1TS3 A;  4FYD A;  2LY7 A;  3D4D A;  4DA2 A;  2B2V C;  2CW0 C;  3L7Z C;  4QUF A;  1FYC A;  4FF3 A;  4KKS A;  4HAE A;  2EYH A;  2HCC A;  1HTL D;  2K33 A;  3AU7 A;  2E2H B;  3A56 A;  1OO9 B;  4NDX A;  4Q5V A;  1A6X A;  1G6Z A;  5IGG A;  5C4X B;  3NWT A;  2F0S A;  3S15 B;  3HS0 C;  3L9A X;  1PZI D;  3DXJ C;  1LT6 D;  3DWQ A;  3T13 A;  4DK0 A;  3UI2 A;  1LLR D;  1STG A;  4FXD A;  2R7Z B;  2YYZ A;  3SK6 A;  3MHB A;  5I9O A;  3O13 A;  3R3O A;  5C0X H;  4BWG B;  4X3T A;  1ENF A;  1KNE A;  1R9T B;  4AYB B;  1L0Y B;  1LTR D;  3T53 B;  2XRQ D;  3PO2 B;  3I70 A;  2H1E A;  1HQM C;  1JOK A;  5NUC A;  4R8I A;  2HUG A;  2SNS A;  2F0G A;  1RJT A;  5IOD A;  2VXW A;  5C4J B;  1F9Q A;  2EY2 A;  1D5Z C;  2NN6 G;  1PTO C;  1PXU A;  3K6O A;  2B8G A;  3VR6 A;  5J1Z A;  1STB A;  1AZP A;  3ERO A;  1SMY C;  2EY6 A;  3Q24 A;  2BE5 C;  2O4X A;  2JP1 A;  1GUT A;  1X3Q A;  2MPM A;  2E76 C;  1O7Y A;  4ZAI A;  3T56 B;  5CV7 A;  3D4W A;  3AMU A;  2IX3 A;  5I6W A;  2M2L A;  3VYR A;  2GA4 B;  3A8J E;  3VR5 A;  4DU9 A;  5E4X A;  2SDF A;  2N88 A;  3SE0 A;  3GD7 A;  5M3M B;  2R3Z A;  3H0G B;  4PNY A;  1MSG A;  1BCP C;  1JWS D;  1HCZ A;  3EQL C;  1CM9 A;  2O2L D;  3S1Q B;  1ESF A;  1EL0 A;  4GZY C;  3CRL C;  1FNW A;  1WCM B;  3DWA A;  4IFD J;  1JE4 A;  4NMZ A;  3C3L A;  1JCK B;  1V1O A;  3SHL A;  3MVV A;  2R6G A;  4K6L A;  4UDU C;  2MUY A;  4WRD A;  1G8Z D;  3VYU A;  5M5X B;  2A68 C;  1ILP A;  1XYI A;  5KIX A;  3D8G A;  1QB5 D;  1STY A;  4KV6 A;  4XYQ A;  3I90 A;  1VDZ A;  3URY A;  2B2W C;  3VYS A;  3MXP A;  2BDO A;  1Q8I A;  4HCS A;  5C4Z A;  3DEO A;  1PRT F;  1JOO A;  5FO8 B;  2FMM A;  2K01 A;  4KD3 A;  4KK7 A;  4PMC A;  2QIL A;  5KYI A;  1SDF A;  1XXG A;  3NXW A;  4XQQ A;  1F9R A;  3J80 L;  3NSW A;  1TII D;  2F0Q A;  3MAQ A;  5EBD A;  3OPO A;  2HQE A;  3L3O C;  5KND A;  5TSS A;  4DAP A;  3VYT A;  1ESR A;  2KOL A;  3VR4 A;  1CT1 D;  3GTQ B;  1F77 A;  4C3J B;  3GTO B;  1LTG D;  2B2Y C;  3BDO A;  1X32 A;  1G2S A;  4PQX A;  4CJ0 B;  1EU4 A;  4IFD G;  1CK1 A;  3J7Y W;  1PDQ A;  3A54 A;  2MJ8 A;  3PMF A;  4XTC S;  2IX1 A;  3J80 E;  3A7L A;  3HGB A;  4IUV A;  3SVM A;  5EPJ A;  1ILQ A;  2XRS D;  4FF1 A;  1D5M C;  4KKU A;  4KMU C;  2ENB A;  3NTI A;  4JBW A;  2K1B A;  3A8I E;  1FR3 A;  3NTK A;  2RVL A;  2EJF C;  2D2C C;  2B2V A;  3EJI A;  2PYK A;  5JJZ A;  1G29 1;  3OOC A;  1SJE D;  2E74 C;  5JEA H;  3E0J A;  3LNN A;  4BY1 B;  4RHR A;  1BUV T;  5LHY 1;  1T5E A;  4C56 C;  2WAC A;  4PV1 C;  2L1B A;  4KY6 A;  5LL6 S;  2FMC A;  3BDC A;  5D14 A;  3TP5 A;  1JQY D;  3I4M B;  1EQV A;  3QB3 A;  3DM1 A;  2SEB D;  1VMP A;  1QE6 A;  3OHX C;  4DF7 A;  2F0F A;  3M3Y B;  2KCN A;  3I4L A;  3MXU A;  2F0H A;  3I73 A;  1S5C D;  4IUQ A;  2A5H A;  1KDB A;  4DK1 A;  5K36 H;  3PIP 3;  4L8J A;  3Q22 A;  3I8Z A;  2NTS A;  3G6J B;  3GP7 A;  2F0U A;  2A69 D;  5T1I A;  5D65 A;  1FNU A;  3NE5 B;  1I4X A;  3PUV A;  3ND8 A;  2Z4I A;  1SJH D;  1BF4 A;  3DMU A;  4CKE A;  2VB2 X;  3R2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...