4R8NA

Crystal structure of staphylococcal nuclease variant v23i/v66i/i72v/i92v at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4r8nA00
3V2TA 1EYAA 4K6DA 2OF1A 5C6AA 2F0UA 3OSOA 3SK4A 5C4HA 4WRDA 5I6WA 2F0OA 3HEJA 3T16A 5CR3A 4K14A 5J1ZA 3SK5A 1SNQA 4G57A 5EKKA 4B9WA 1A3UA 2F0TA 2F0VA 3LX0A 4KHVA 1SNOA 2HQEA 3NUCA 3TP6A 1ENAA 3TMEA 5IIFA 1SYCA 4ODGA 2RBMA 2SNSA 3NHHA 5JAVA 5C3XA 5I9OA 1STBA 2F0FA 5CV9A 5E3FA 5EKLA 1EY7A 2PQEA 2F0JA 3NP8A 4DU9A 1SNDA 1EQVA 2ENBA 3OMGA 3PMFA 4KTAA 4HMJA 1EY4A 4N9PA 2F0KA 2EYMA 1NSNS 3NK9A 4ZUIA 4F8MA 5E1FA 5KRUA 2PYKA 2F3VA 5J22A 4K5VA 3TP5A 1SYGA 3MEHA 4NDXA 2F0HA 4IUNA 5NUCA 1STAA 4J6HA 4WORA 5C4ZA 4KD3A 4K8IA 4K5WA 1STYA 1KAAA 4MIUA 4YIJA 2WACA 2EY6A 4KJOA 1KDCA 4OL7A 4TRDA 5C3WA 3P75A 2F0MA 3EROA 3C1FA 5CV5A 1F2MA 3H6MA 4QB4A 5C5MA 3TP7A 1EY8A 5CV8A 4PMCA 4KD4A 4KY6A 5KIXA 1JORA 4EQOA 3TP8A 5IGEA 5IGCA 5HURA 2F0IA 2F0LA 4E6IA 4N9TA 3OMCA 2F3WA 3OWFA 1II3A 3P1HA 1SNCA 1U9RA 2PW5A 3BDCA 4KY5A 4LAAA 5KEEA 4KY7A 4R8NA 2F0EA 3BDLA 5HGTA 1A3TA 3MZ5A 1SYDA 3NXWA 5J39A 5CV6A 4F7XA 5CC4A 4HMIA 4PNYA 3SK8A 1TR5A 2PZTA 5IODA 4I65A 4EQNA 5IOCA 2F0QA 2F0SA 2EY5A 4QF4A 1JOKA 3QOJA 4J1MA 5IGFA 1TQOA 2F0DA 3E5SA 1SYFA 5I9PA 2EY2A 4ZQ3A 3NQTA 1EZ6A 1EZ8A 2EYJA 4ZUJA 2F0WA 3T13A 4DFAA 2EYPA 1SNPA 2OEOA 4KV6A 3SR1A 1NUCA 4PMBA 4K5XA 1A2UA 1EY0A 3SXHA 5KYIA 3C1EA 4KJNA 1EY6A 2LKVA 5DEHA 3EJIA 4RKBA 4EVOA 5C5LA 2EXZA 5M9OA 3D4WA 2EYFA 5IGDA 4DGZA 1F2ZA 4EQPA 5EGTA 1F2YA 1TT2A 1EY5A 4ID6A 3D6CA 1AEXA 4NP5A 2EYHA 5KGUA 1KDAA 3R3OA 1JOQA 4RKLA 4S3SA 3S9WA 2OXPA 1IHZA 5I6YA 4IALA 4QMGA 4K2KA 2F0NA 3SK6A 5IGGA 2PZUA 4ME5A 2SOBA 1KABA 4B9XA 1A2TA 3MVVA 5ISRA 2F0PA 2O4XA 3QOLA 4IZ8A 2EYOA 3RUZA 3HZXA 5K5PA 2QDBA 3SHLA 3ERQA 2RKSA 1STHA 5KYLA 2F0GA 3D4DA 3U9OA 5CV4A 1KDBA 4HTHA 3MXPA 1SYBA 1STGA 1JOOA 2KHSA 2SNMA 3MHBA 4NKLA 3EVQA 1A3VA 5DAUA 1SYEA 4H7BA 4K2LA 3VA5A 2NUCA 3DHQA 5CV7A 5F2DA 5CGKA 5IGBA 1EYCA 4K8JA 1SNMA 2KQ3A 1RKNA 3ITPA 1EYDA 3DMUA 4NMZA 3QB3A 2EY1A 1STNA 2PW7A 1EY9A 2M00A 4DF7A 1ENCA 2PZWA 2RDFA 3D8GA 2EYLA 5JOBA
chains in the Genus database with same CATH superfamily
1EYAA 1QB5D 2PI2A 1ENFA 1MD2D 1C9OA 1IYUA 1EIFA 5ELEA 3SK5A 1UAPA 4B9WA 1PH3A 4A93G 4KHVA 4P2CB 2RA4A 4XQJA 1I50H 2WIIB 4JI7L 2C9OA 4UP7A 1K8AC 4DK1A 3K7AH 5K36G 4XYQA 3J7AV 1CKNB 1EQVA 1J6QA 1KL9A 1G8ZD 5GAGC 4ZUIA 2I5MX 5C4XH 2IX1A 5H1SE 4YCWA 1LV9A 2I5HA 1Q12A 3FEWX 1B53A 1IBMQ 2R7FA 3HG9A 2TSSA 4PMWA 4B3RL 2IJ0A 4JI2Q 5FO9B 4J15A 3W1BA 2CHBD 1XNQL 5LHY1 5C0XJ 1BXTA 3GO5A 1YNND 3FVQA 4C1NK 1II3A 3HOUH 3J7YW 5KEEA 4GNXC 1O7LA 1X3EA 1SROA 3D0FA 1YNNC 5C4JB 3TS0A 2DY7A 3MXNB 4ZLTF 1MSGA 2RCFA 1CUKA 1EQQA 2K5QA 2F0DA 4NXMQ 3PIOA 4ZAIA 5KNCA 3RZOB 3KF8A 4HSPA 3BU2A 4DR7Q 3S14B 2KCTA 4DR1Q 3E6ZX 2R3ZA 4B3SQ 1K0SA 1A63A 3WOEA 1O7ZA 1ZKOA 1PMRA 1VQ9A 4DGZA 1G91A 4HSVA 1JOQA 2A8VA 3ER0A 3DUZA 2MO0A 3QO2A 2IHEA 4L5QA 2UUCQ 2UXCQ 1WTOA 4IZ8A 4LFAQ 3BG3A 2JA5G 3HZXA 4DV3L 1TS3A 2F0GA 2KBNA 3MXPA 5FLXc 3W2DA 5HGQA 3PIO3 1HFGA 3S1MB 4DAYB 3M4OH 1RKNA 3DMUA 1U5KA 4FF1A 4YCUA 4LF5Q 1OTCA 1ILQA 1W2BA 3VDYA 2VY3A 4A3IG 4A4IA 4BBSH 4IFDI 4A93B 3BYYB 4K14A 3CCQA 3T1YQ 3KJPA 2NB0A 1YEZA 3EA6A 4OX9Q 2KEDA 1GD7A 3X3MA 3H91A 5IIFA 1DOLA 3W1GA 4DNIA 4OWTB 5JAVA 4DUYL 1HA5A 2NVXB 1EY7A 2B2VA 3ONAB 2NTSA 2A6ED 4JI5L 1LO5D 3AMUA 2F1MA 5J3BA 4GN5A 4IN3A 3G48A 4A75A 1E0BA 3IFDA 1XMOL 3HOWG 4H02A 5FK9C 1TXYA 2JA7G 2A6EC 2E5LL 2XRSD 3CF5A 2EJFC 2NVTH 5EPKA 1HUNA 1VQBA 4FDBA 4BS9A 3I4LA 1JE4A 3PUXA 1CA5A 3PO2B 2JA8B 5EPJA 2B2YA 4X62L 4O0AA 4PG3A 2PQAA 3U50C 4MNOA 1QNKA 4HN7A 5FJ8G 3NSWA 3A8KE 2Z4IA 1IBKL 3OPOA 1GUWA 3SGIA 4HMIA 3TDQA 1QUQA 1LABA 4EQNA 4BA2I 4IUTA 3GP7A 3Q8DA 4CBVA 3E5SA 3OWEB 4UAIA 2QEXA 2VNUD 4GKKL 1D5XC 1HNZL 3CQZH 2DGYA 3BZDB 2K7VA 1JJ2A 4RKBA 1JWSD 3AFQA 1X9NA 4JI8L 4ID6A 1Q46A 1KDAA 5JEAH 5IT9E 3S9WA 1PH8A 2OXPA 1IHZA 4JBWA 2AKWB 2SOBA 1VQIA 3NBHB 5LMNW 1P8LA 4ULLA 1HNXQ 1TS2A 2EYOA 5K5PA 2K04A 4OELB 2N49A 1GVPA 1NNXA 1LTSD 1VQAA 1C7YA 3Q6SA 4C1NI 1QVGA 2WFWA 3S16B 5GAEC 4A3GH 2A19A 2R93G 1EIHA 1VQ5A 4IFDH 2HIXA 4DN4M 1XMQL 1GKHA 1TU2B 2EOTA 1EEFD 5IODA 4F88A 1K83B 1HUMA 1N34Q 3DEPA 4IUUA 5IYBH 2YTXA 1YZ6A 1QZGA 2B63H 2ALYB 5LMNQ 5L37A 4NW2A 3CAMA 5E3FA 3S17H 1JC7A 5G3LD 4K0KQ 3BDOA 3E3XA 4FXKC 4DV7L 2A73B 2KENA 1TS5A 1YVCA 4JYAL 2GVAA 3PO3B 2MFIA 2JA7B 3RMHA 1BBUA 1WFQA 4FF3A 1J8IA 1HTPA 3GTJB 1OXTA 1U4PA 3H0GB 4DAVA 4A3BG 3AYHB 3S2DH 4XT1B 1Q86C 1A6XA 4H0LC 4JI0L 2F0LA 4F87A 4DR6L 4L5TA 4KY7A 1TWFH 3CCLA 2F3IA 3NXWA 1U4RA 4C3JH 2C35B 3IAYA 3GTLB 2HDLA 5M3MG 1QNUA 3GD7A 1X65A 3KF8B 1OXSC 5IP9H 4X64L 1KRSA 5GROA 4RA8A 2K14A 1KLGD 4CDCC 4BBRB 2ZM6L 1JT8A 1X3GA 2MNAA 1NMFA 4POGA 1GHKA 1A2UA 1FVIA 3UDFA 1E2ZA 5DEHA 3Q24A 1D2BA 2NVYB 1F2ZA 3G6JB 3D6CA 1WOCA 1KRTA 4QMGA 1YJNA 4Y7NB 1KABA 1IYVA 5LL6X 4IPDA 2WKCA 2K52A 3MHBA 1N33L 5EPLA 3I4MH 5EKIA 3QWNA 3CC7A 3GTQH 1EWIA 1NY4A 3P7JA 1PHJA 4PZ7A 4CGYB 3NBIA 3PUZA 3G6EA 5C6AA 1TWAH 3SE0A 1XPRA 3HOVB 2EQSA 1VQLA 2NVQB 4CDEC 3J81c 2K6AA 3GV6A 4LJZC 2SDFA 3IRBA 3PSIA 4JK1C 3TMEA 5GADC 2LXJA 2XN9C 1QVFA 1JJGA 2F0FA 3HOZG 1G2TA 4ALPA 3D31A 1Y1WG 1Y14B 4CJ1B 2NN6I 4L6TB 1TY0A 2MGSA 2NWGA 1TWHH 1PH6A 4K8IA 3RZDB 4DR5Q 4A3EG 1XJVA 5E4WC 4WFN3 4FF2A 3AU7A 2JA5H 1QG7A 4UDUC 2R7ZG 2PQAB 4JI1L 3FPUB 3G4SA 2A69D 5ELBA 1V1OA 2V4DA 3ND9A 3UDXA 3KDFA 4A3LG 1CFMA 1KQSA 3OMCA 2F3WA 3NWTA 5M5WB 1FNVA 1SNCA 2PW5A 2A69C 2MO1A 2LY7A 5A35A 1SFOH 2A74C 1QUQB 2KCNA 1R4QB 4PNYA 1LT3D 4A3DG 1A15A 4RH6A 2VL6A 3I4NH 1EWCA 1PXUA 2VQFL 2G5DA 2F4VQ 4ZQ3A 1EZ8A 4KLKA 1PYWD 3T13A 1Q82C 2BE5D 3E0EA 1I4HA 3SR1A 4A3MH 4UY8C 3C1EA 1Q1EA 2LKVA 4TQUS 1K3RA 1FYCA 2L9HA 3OW7A 2B8FA 1D1KA 4OONA 2BE5C 5I2XA 5KNBA 4JI0Q 3SK6A 4B9XA 2JA6B 4FYDA 4BXXG 1CT1D 3BZCA 1CKMA 1Q1BA 2RKSA 2MJ8A 3D4DA 3HOWH 3U9OA 4H44C 3OYYA 2XSCA 2CWPA 3PUVA 1PZID 4FF4A 4KHZA 1YBYA 1SNMA 2EPBA 2JE6I 3TSSA 1PTOH 4XYOA 4CDFC 2YTVA 2I0QA 4QL5A 4C3HG 2PMZE 4C56C 4IUQA 2WKDA 1N8RC 2CQAA 1W6KA 3K5MA 4LF6L 3ND8A 1VQGA 2VQEQ 1GUGA 1I50B 2F0UA 3VR2A 5FOBB 1K8MA 2D9UA 3VR6A 1HQMC 1BUVT 2HIVA 3EN2A 4GLXA 2AUJD 3K6OA 1IYJB 2IX3A 2FFKB 2NN6H 1LTGD 5C4XB 2QILA 4Z9CB 1PH2A 3NP8A 1N33Q 4M8AA 1SNDA 2CCZA 1H9RA 2EYMA 3NK9A 2EVBA 3CHBD 2PYKA 1RL2A 2XNAC 3CCJA 3M4QA 3TP5A 2RHSB 3RN2A 1TWCH 4NDXA 1FNUA 4R4OA 4AYBG 1IBML 2J4XA 4A3EB 4KD3A 2Z6BA 2EY6A 3SEBA 2EDGA 1HNWQ 2KCMA 1V8QA 4JI2L 2F0MA 5FLXE 2HCCA 3I2ZA 4MTNA 4QB4A 1ESRA 2Z1CA 4EQOA 4OO1G 3GTMH 2JQOA 1CM9A 5JVG3 3QR8A 1XXGA 2R93H 2E74C 1EUJA 2AQ1B 1EIYB 2DJFC 1K8GA 4A3DB 1I4PA 1SJHD 2UXBL 3M4YA 3A0JA 4NXML 1BR9A 2F0SA 4DR7L 4QF4A 4R9WA 5IGFA 2G9HD 4DR1L 1BOSA 4B3SL 4DFAA 2Z8LA 1VF7A 2Y0SE 4TSSA 3RN5A 2N8NA 3D4WA 3R93A 3FP9A 1X54A 3CKIB 4XIGS 5DLQE 1JWUD 4IPCA 1CKOA 3CCMA 2UUCL 2UXCL 4IJHA 2F0NA 4LFAL 2O5JC 3BYTB 1CI3M 4IO9A 1A2TA 3MVVA 2E2DC 2IW3A 4YY3Q 4DK0A 3KUPA 1CK1A 1KDBA 1AE2A 1STGA 4P75A 1V1QA 5IGBA 2E76C 3MFGA 5EBCA 5FLMG 2E2IB 5M3FH 1Q3LA 4A3BH 3F2DA 1S40A 1MKHA 4BBSB 4C3HB 1D7QA 5CBAE 3F1ZA 2BOSA 1AN8A 2MP1A 1TWGH 2D2CC 3NENA 4L5SA 4P74A 1ICWA 1XPUA 1EIGA 3T1YL 5C4HA 4HCSA 4OX9L 3I70A 1D6EC 1X3PA 2X69A 3S2HH 3TP6A 3NUCA 4C2MH 4FO2A 2EIFA 4RAUC 3IFTA 3OW2A 1HZAA 3D3RA 4RGOS 3FKIH 2CFMA 1JE5A 1RODA 5J22A 4LMQD 4J6HA 1CSPA 1SXTA 1JB7A 3QIAA 4LF6Q 3P20A 1LT4D 1W6JA 1E24A 3B6YA 1L0WA 1L0YB 4X66Q 5A2QE 1PH1A 5DM73 1YI2A 3EROA 1UUPA 2NYZD 3N52A 2R6GA 1F2MA 3CCSA 3I8ZA 1I3QH 3KDFB 4KKTA 4R4CA 5M5XH 1O78A 1QZHA 1KLUD 3CU7A 2JSOA 4E6IA 2EXDA 1BQQT 1HXYD 5HGTA 2QA4A 2Z6KA 1AZQA 5EBDA 4RHSA 3I7FA 2Z0SA 3H3VI 1Z6HA 2XVSA 5IP7G 4I65A 3CMEA 5CMDA 3J80E 1FNWA 1C0AA 3S1QB 2ZXRA 4HEDA 2K33A 3H15A 3I72A 2EYPA 4DK3C 4J8QA 3PO2G 1LUZA 2JA8G 1FR3A 2ID0A 4OIKA 1SMYD 1X6OA 5FO7B 1Q8KA 5EAYA 3JAME 2I5LX 4NXNQ 3OOCA 4IQZA 1MBYA 1SBBB 4BY7H 1SDFA 4YWKA 1HNXL 1ET9A 4Q0FA 1RCVD 1SMYC 2RSNA 2F0PA 3T51B 4A3GB 4CJ0B 4HIKA 5IT9L 2KOLA 4BY1G 3MA2B 4ZYSA 1S5CD 2UXBQ 3DEOA 2DJGC 2SNMA 1EYGA 1MGSA 2GN5A 2ZXPA 3DHQA 1Y69U 2E2HH 4LF9Q 1EYDA 4A3JH 1DCZA 2K5WA 3D6WA 1VMCA 4HJAA 5C0XH 2YTYA 4MZ9A 1N34L 2B63B 1VQ4A 1IXRA 4WRDA 3BVGA 3KF6A 5J1ZA 4GNXB 1R4PB 2DNEA 2F0VA 4A3KG 4OO1I 4C3IB 5LMNL 3HOXH 2SNSA 4K0KL 2IPKD 1BBXC 5C44G 3A54A 1GHJA 5I9OA 4IUVA 1KC8C 3D4RA 4OXPA 5IYDG 1R9TB 4HJ7A 2C5CA 3OMGA 4HMJA 3J7ZC 1WCMH 5LL6S 3NPPA 4F8MA 4AQYQ 2CKZB 1KXLA 1FGBD 5NUCA 4DXGA 2YU9B 3VA7A 1S4ZA 2R92H 3AQQA 3M9BA 4KMUC 1STYA 4ME3A 3GTKH 1WD0A 3K81C 5C3WA 3RLNA 2HHHQ 4GN3B 1EY8A 1LTLA 3HOYH 4RG1A 3HFZB 4MN3A 1CZGA 3H3VH 2Q2IA 4V0BA 4A3CH 2LSSA 1Q7YC 3PIP3 3S1NH 3KBGA 4YHHL 4HAEA 1A3TA 5JJIA 3QG1A 1TY2A 5C3EH 3J80i 4DR2Q 3PO3G 5IOCA 2K5VA 2JN4A 1ASYA 1SR3A 3H0GG 1M90C 1UE1A 3JAMi 1JCKB 1DONA 2D0OA 4A3FH 4EVOA 3EJIA 4UPAA 3M7GA 1K8OA 1HR0Q 2JEAI 4QQBX 1CHQD 1X32A 5IGGA 5LMUQ 1AFPA 3I4MB 1QOHA 4GZYC 3SHLA 3NTKA 4BY1B 2VB3X 4B08A 4Y52H 2WAQE 1Q81C 3KLWA 1X55A 3VA5A 2RDGA 3K57A 1Y1VH 4BBRG 2K05A 1M1KC 1XTCD 2ZXOA 4FXGC 2YYZA 3BVMA 3ULJA 1D5ZC 1STNA 4OO1H 4QIWE 3A74A 4DF7A 2K03A 2YV5A 2X6LA 5JOBA 5DM63 2VUMH 4A3KB 3RD4A 1VMPA 2F0TA 2K1BA 3BZKA 3LNNA 5C44B 2Q2TA 3K58A 4HJ5A 1RTOA 3MWYW 2ZT9C 2Z6KC 1TS4A 4GLAC 3CPWA 3K80C 1L1OA 5GAHC 1I6HH 1NSNS 1A8VA 5D14A 2A68C 5E1FA 1BBWA 3MEHA 4DR5L 4JG2A 1Y8OB 5I2YA 3CCUA 2RQXA 4O42A 1IL8A 4K5WA 4DUZQ 4MIUA 3HOVG 1V9PA 2QKIC 1DYQA 1AP0A 2CW0D 3KJOA 3J7A5 2TMPA 1XYIA 4DV4L 1ONLA 1KHIA 1PTOD 1AE3A 2CW0C 3RZOH 5FLMH 2F4IA 3S14H 2ES2A 3I4NB 1UEAB 4X3KA 3BDCA 3F2UA 1IL2A 1G6PA 2F0EA 4B3TQ 1I94Q 2PNRC 1NR2A 2KHIA 5CC4A 2PO4A 1PTOC 1LM0A 1SSOA 3CC4A 1QILA 2F4VL 3VYRA 3QOJA 1F9RA 3LWEA 2NBFA 4M1UB 4CKBA 4X3SA 4KV6A 3ULPA 3V96A 1VQKA 4UP9A 1EQRA 1ZEQX 1GXDC 2KECA 2PMZB 5T1IA 3S1MH 2B3GA 1TVXA 4TKOB 4DV1Q 1H9MA 1E2VA 4YHHQ 3K0YA 1F9QA 2KUMA 1SMXA 3GTGB 2F03A 5CV4A 1PTOF 1G2SA 2QDLA 4A93H 1YNXA 2ICEC 3Q22A 2KQ3A 3VYUA 1VQJA 5KNDA 3ITPA 2HUGA 1M4VA 1AH9A 4GLVB 1I4GA 2VQEL 2PW7A 3A8JE 1ENCA 1W3SA 5K36H 4DNTB 2NVXH 2D5DA 2EYLA 2GA4B 4DR3Q 1NE3A 5I6WA 1T9HA 2JA6G 5CR3A 3ZJYC 1E22A 1RD9D 1LTBD 1SNOA 3U4ZA 3TZDA 1Q8IA 5EKLA 4X65L 2I46A 2FXQA 2N3SA 4P72A 2XRQD 3PO2H 3S15B 2GVBA 4A76A 3S1RH 2UU9Q 1SYGA 3J7AF 4WORA 1HNWL 3HS0C 2RSOA 3CCEA 1G291 1E1TA 4KJOA 3GTMB 1Y8PB 3K5LA 1WTHA 4XTCS 4EGVA 2RVLA 2MQHA 2JA9A 4HCEA 2N55A 4QUFA 2Z9HA 4KKSA 2MHVA 1JORA 1O7YA 3K7UC 3VR4A 2Y0SB 4LW1A 5C4XG 3H09A 4JI3Q 5IYCG 1PH4A 4QGUA 4LAAA 2Q8TA 3TS2A 2CVRA 4U673 1SYDA 4XDXA 2OT2A 1HZ9A 1VQDA 3PQIA 1RDPD 1P16A 1BNZA 1BVSA 2Q2HA 5EJWA 3URYA 1ICFB 3HRZC 5I9PA 4KN7C 1YIJA 1EL0A 1PZJD 5D65A 4DV6Q 2KVMA 1UE7A 4DV4Q 1F2YA 1PLFA 1PH7A 4R4TA 5IYDH 5KGUA 1TIID 4IALA 4YY3L 2XTIA 3RUZA 5AJ3L 5M3FB 1PFMA 2Q2UA 4JBMA 1RHPA 3E9HA 3ERQA 2HCIA 3MXUA 1L1OC 4A3IH 1JOOA 1GUNA 3STBD 1K83H 1X3QA 3GTOB 1MJEA 1EYCA 2FMMA 3R8BA 1MJCA 2L12A 4OWXB 4LFCQ 1MSHA 2MUYA 2JEBI 2XIWA 3QB3A 3STBC 1FL0A 1KAWA 1ILPA 5CORA 2R7DA 3CMAA 1V1PA 3W3AA 3HGBA 1PYSB 2F0OA 3LWUA 4OHJA 4G57A 1A3UA 4XQQA 2AHOB 2JA7H 1K73C 1ML0D 5T1GA 1L1OB 3GTJH 2PQEA 1S5FD 2B2TC 2M9VA 1G51A 4BBSG 1IBLQ 1SEBD 2B2UC 1A62A 1HRJA 2ZTDA 4X66L 3AEVA 3HKSA 1I3QB 5FJ8H 2CH4A 1SE4A 3K7AB 1KIXA 5M5XB 4OL7A 4TRDA 5HY6A 4DNRB 1EEID 1HQRD 3FMCA 5CV5A 3EQLC 1LTTD 3GTLH 1ESFA 5CV8A 4P71A 4QCLA 5A2QL 4KY6A 5KIXA 3TP8A 5IGEA 1LACA 4OIJA 1CTMA 1H9SA 2LFNA 4X65Q 4KHPL 3P1HA 1MIUA 3X3NA 2IL8A 2H1EA 4ILWA 1WTVA 4FP5D 1TR5A 1C4QA 2PZTA 1N9WA 2A1AA 3SDZA 3CXCA 3GTPH 5M5YH 4POFA 1B9MA 1SYFA 4Y7NH 3PUYA 1WTQA 2K5DA 2WAQG 3I56A 3HOUB 4BY7B 5BN5A 4PMBA 4GKJQ 3J80L 3UDIA 2WINB 4NXNL 4KJNA 1WTPA 4DAMA 2EYFA 5IGDA 3I4OA 5ISRA 4DV2L 1EY5A 1GM5A 1ASZA 3KLRA 2ZTCA 4RKLA 1RJTA 5I6YA 4ME5A 2VB2X 4IURA 2WP8J 4EX5A 3EFXD 3JAML 1T5XD 3ZYYX 1BKBA 4RGNA 1JJCB 4JBJA 2H5XA 2QDBA 1XNRQ 3H94A 2VW9A 4X3UA 2ATWA 1B9NA 4XT3B 4IPHA 3KOJA 4QJFA 4H7BA 4LF9L 1IW7D 5JEAG 1K9MC 1K0RA 1WTWA 2UUAQ 2EY1A 5COYA 2DY8A 1X56A 1IW7C 3HOXB 4ABNA 4DV5Q 3DWAA 4LNQA 4DA2A 3H3VC 3K59A 1PFBA 2O2LD 4IJLA 3T16A 4ZK9B 1WJJA 4DV0Q 2EE1A 3M4OB 2ICIA 2WB1E 4A3GG 1WCMB 2F52A 5AJ3Q 4IFDG 4ODGA 1EU3A 2Q8RE 3RZDH 2L0CA 1N32Q 3W5OA 3UE1A 2R92B 3QJYA 4R1JA 2PCFB 4AQYL 2B2WC 4LF7L 2F0KA 1B8AA 2KJXA 1VQOA 1WD1A 3TRZA 2F3VA 1XPOA 5IYBG 2A5HA 4IUNA 2E2JH 3OTOQ 1X3FA 2B63G 1HPCA 2CWAA 2HHHL 3F2BA 4LUZA 3F8TA 4JI6Q 5M3MH 4C3IG 5TSSA 4IUPA 4KD4A 5ELFA 3M7NA 2EJGC 2BA0A 5C3EB 4CHTB 1Z7TA 2L1BA 4MTKA 3A8IE 2UUBQ 1B70B 4PZ6A 4KY5A 3CD6A 3BDLA 2NVTB 4DR2L 1NR4A 5J39A 2O5IC 2KA7A 1LT6D 1H9JA 3UE0A 4ZRZA 3F2CA 1GOZA 3UI2A 3EIVA 4XXEA 4HR7B 1TQOA 2WAQB 4HIDA 2K5NA 1GUTA 2K32A 2OEOA 1EY0A 2QCPX 2N88A 4C3JG 3CCVA 1HR0L 3HP3A 1Z9FA 1S5BD 4QIWB 2JK8A 1AEXA 5LMUL 2L11A 4O1NA 4AH6A 1MI2A 1F9PA 2LS01 4JBKA 4WJWA 5IP9G 4KHPQ 1UEBA 1J9OA 1Y1VB 3QOLA 2QF7A 3CQZB 2X6GA 2QEJC 4YWMA 1STHA 4CJ2C 2RHQB 4TVAB 1FJGL 4FVMA 1F2LA 4GN4B 4I7ZC 3A7LA 2I07B 4HJ9A 4QY7A 3R2IA 4DK6C 2AWOA 3EBEA 2VUMB 4O2DA 4BWGB 1EY9A 4LFBQ 1XTDA 2PZWA 1V1PB 3BS1A 1WTXA 3HOZH 2LMCB 3V2TA 5IYCH 1KTKA 4DV2Q 3HKZB 1Y1WH 5ELCA 1NMGA 2RF4A 2HD3A 5EKKA 1J5EQ 1VQNA 3I4MG 2VS1A 1CHPD 1I6HB 1EOVA 1HZBA 4GOPA 4JV5Q 4A3EH 3NQIA 2JXMB 4P73A 2DNCA 1TKWB 1SJED 2P5ZX 4G7HC 2R7ZH 1SE3A 2K75A 4Q5VA 1DM0B 1DOKA 4DXFA 3CPFA 3T56B 4K5VA 5IWAQ 4A3LH 5IE8A 4DUZL 1HHVA 4DPGA 1CZWA 5ELOA 3S17B 4JVZA 3ERSX 1HA6A 4HIMA 1GO3E 1DGSA 3C1FA 1O80A 3C3LA 5C5MA 1CA6A 4A3DH 4IOAA 4G7OC 1PYBA 1EWHA 1KNEA 3OIPA 3T1HQ 4LK1C 1H9SB 1A0IA 1VF5C 5HURA 3PIPA 1KD1C 2D62A 3OWFA 4RCNA 1I94L 4B3TL 3TQYA 4OWWB 3KK7A 4PV1C 1O7IA 4JOIA 3I91A 4K6LA 4BA1I 1NAPA 5CV6A 3M85A 4JI4Q 4LF7Q 3SK8A 2NZOA 3S2DB 1L0XB 1JOKA 2K01A 1SRUA 1FD7D 2NTTA 2EY2A 1C8CA 4BXXH 1EZ6A 1BO0A 3I90A 3IL8A 3K5OA 1YHAA 1HR0W 2F0WA 1TWFB 1S5DD 4C3JB 5ELNA 2G9DA 3KYHC 1H95A 1UE6A 4PQXA 4EQPA 3WWVA 4DV1L 2E2IH 3I4NG 3BJUA 4K2KA 4B3MQ 2K5HA 2D0PA 2PZUA 1XWEA 3PF4A 4C3HH 2QGQA 3DM3A 3RLOA 3NWSA 2EJMA 3J81E 3M3YH 4A3MG 1QVCA 3OHXC 3A5UA 2A6HD 3PV0A 2PNHA 3EVQA 5FO8B 4UP8A 2DUDA 5F2DA 4LF4Q 5E4XA 3GDEA 3TREA 4DR4Q 4CKCA 1B50A 2A6HC 3PGZA 4RCOA 2M00A 3NTHA 4DR3L 2HT1A 2RDFA 2K28A 1AW7A 2OCEA 2AMCB 1RTNA 5CBEE 4K6DA 1N36Q 3OSOA 4RHRA 1VCIA 1PH5A 3A7AB 2HQEA 2JYOA 3GTQB 2IWHA 1IZ6A 4L5RC 3S1RB 1STBA 3MEFA 5JEAJ 1FJGQ 4JI7Q 1YITA 1B2TA 1DD2A 1EFWA 1TWAB 4N9PA 2UU9L 1EY4A 1DZ1A 4KK7A 3C2PA 4AYBE 3TZUA 5BR8L 2BDOA 4H13C 1B3AA 3OIQA 1ZYRD 2NN6G 2WACA 1HZCA 1SLJA 2FJ2A 1C48A 2HQLA 4IFDJ 1HFNA 4PMCA 2AWNA 1ZYRC 1GUSA 1VDZA 2A68D 2N78A 4JI3L 4B3RQ 2AQ2B 2NZHA 3G71A 3Q23A 5D3IB 2Z4HA 1LTAD 1TWHB 1XNQQ 3S1QH 2ZJQA 5EQ0A 4YWLA 4LUVA 4WJ3M 5ELDA 2KEEA 1XX8A 2J7ZA 5BN3A 3BVZA 2JA5B 2CH4W 2JJQA 3K5NA 1F77A 3HKZE 3G7LA 2F0QA 2PPBC 1OXUA 4NB3A 4DV6L 3VR5A 2OTJA 4ZUJA 5C4JH 1SFOB 3FPPA 1JB3A 3I73A 2H4OA 2K4KA 2FHTA 3SXHA 4ZKBB 2L55A 4R4QA 1WVLA 2NZ1D 2Y0SG 3L9AX 1TT2A 1EFID 3R3OA 4I7AA 3I3CA 3CP0A 3J81i 4A3IB 4GOPC 2V1CC 2B2TA 3U58A 3TN2A 4A3MB 1OO9B 3J80c 1SN8A 2B2UA 2WB1G 2E75C 5I4DA 1PFSA 2KHSA 4DV3Q 4NKLA 5DAUA 1EQTA 1IKLA 2KCCA 2B8GA 5CV7A 1K3BC 4LFCL 1HJPA 4KI0A 2M2LA 1WYDA 4C3IH 4FNFA 2J0TD 1STEA 2L5TA 3JAMc 1VQMA 3HOWB 4WJ4A 3GV3A 1SAPA 3T53B 1R9TH 2OF1A 1Y8NB 1GUOA 2WV6D 3WOFA 4HJ8A 1PH9A 4MHEA 2BCOA 1I4XA 2JP1A 3JC66 2BA1A 5M3FG 4IOCA 4GOPB 2E8GA 1PTOB 1SYCA 1B4OA 2B29A 2YU9H 5JPMC 2Q8IB 1PFNA 3SVMA 3L3OC 4JOIC 3E9IA 4DU9A 1IBLL 4DUYQ 4KTAA 3PMFA 1B1ZA 1BDOA 1PRTD 3DM1A 1NBWA 4LWCA 3RLFA 5KRUA 1YJ9A 5CYUA 4JI5Q 4AIMA 2ZJPA 2F0HA 2CQOA 3E0JA 3KF6B 1E2WA 1GJXA 4DAPA 1PRTC 1KAAA 4RWSC 5G3LF 2FINB 3I55A 1XMOQ 1PDQA 2E5LQ 3H6MA 5E7NA 3FKIG 5IP7H 2ASBA 1QE6A 1TWCB 5IGCA 4X62Q 3GTPB 2F0IA 4N9TA 3V05A 4QUCA 5M5YB 2JA8H 3MZ5A 2QW7A 1IBKQ 1VQ7A 3CRLC 2B2VC 1WI5A 1VS0A 5BR8Q 4J1MA 2BDNA 2IHFA 4JPBW 1ZXTA 1K28A 1PRTB 4GKJL 3NQTA 3T4AC 1PRTF 2EYJA 3VYSA 1AZPA 3MXGA 2R93B 2BH2A 2XWJB 3GQBA 1B3QA 4BY1H 4GKKQ 4PZ8A 3NTIA 1EY6A 4LF8L 2AQ3B 4NPSA 5FLXL 1HNZQ 2EXZA 1VQ8A 3K0XA 5EGTA 4LUOA 1WTRA 3KFUA 4CKEA 1UNSA 4JI8Q 1DJRD 1XNRL 2B2YC 1PA6A 2B2WA 1CQFA 1E1OA 1D5MC 1HH2P 2WB1B 1SE2A 3A5ZB 1A3VA 3L0OA 4A3KH 3HOUG 4BY7G 2UUAL 2ZTEA 1D8LA 3CC2A 5C44H 4DV5L 1LT5D 3ULLA 3S16H 1QWYA 1XMQQ 3D8GA 4DV0L 1DOMA 3SK4A 3HEJA 1V43A 1VQEA 5JVH3 1D1IA 3NE5B 3N6RA 4A3BB 5JJKA 2UXDL 1NJIC 5JJZA 4V190 2RBMA 3NHHA 1N32L 4A3JG 4N8FA 1EOTA 1TWGB 3NELA 3CRKC 2VZAA 5CV9A 1I4QA 1JWMD 4RGMA 2E2JB 2F0JA 3Q0AA 5C0XG 2RCNA 4DV7Q 1CKNA 3ICEA 5IY0A 3OTOL 5M3MB 3S2HB 4C2MB 2PI2E 2R61A 5IT9c 2DN8A 2SEBD 1PVOA 3RR5A 3HOXG 1E3PA 4JYAQ 5C4ZA 2XWBB 4YIJA 4JI6L 5DNFA 1LLRD 3S24A 3FKIB 3TP7A 3PUWA 2BH8A 3PO3H 1WCMG 3M4PA 1PZKD 2OTLA 2UUBL 4KN4C 1QJOA 1F9SA 1PV4A 2FMCA 3H0GH 2R92G 3MFYA 2L4NA 1CQVA 3A55A 4R8NA 4DR6Q 1VQCA 3KLSX 4GS3A 2IY5B 1VQPA 3J81j 3CW2C 2K50A 4JC0A 5JJLA 3HOYG 1VQHA 2EY5A 4X6AH 3MXNA 4YCVA 3MTSA 1M8AA 2ZJRA 4A3CG 4R8IA 4X64Q 1IKMA 1SNPA 3GTGH 1Z47A 1NUCA 4RFBA 3PF5A 2ZM6Q 5C3EG 4NP5A 5AFWA 2EYHA 4OGQC 4BBRH 1HTLD 1S5ED 1EU4A 2VXWA 3IKJA 1CSQA 1YHQA 2NVYH 3O13A 4GNXA 5KYLA 1E7ZA 3MC0B 4HTHA 4A3FG 1SYBA 1HCZA 4ZKCB 1S3OA 4RMFA 1SYEA 3AB9A 4K2LA 4N8X1 3HOZB 1JMCA 3RNUA 3FDTA 1RF2D 4DAYA 1T5EA 4LFBL 1Y1WB 4NMZA 1YHBA 1U0LA 1VQFA 5BN4A 3VR3A 1JR0D 4LF8Q 2KHJA 2IT1A 1J5EL 1LYLA 3FRPB 1SNQA 3S15H 1Y1VG 3LX0A 4JV5L 3UDGA 2E2HB 2R7ZB 4CDDC 1UE5A 1I4RA 4R4IA 1ENAA 4HIOA 4A3JB 4UHVA 3DLLA 1NCVA 1I6VC 3TBIB 2AUKA 1G6ZA 1YNJD 2L15A 3A56A 2OWOA 5C3XA 3HOVH 2NVQH 1FGUA 2ENBA 3NEMA 3L2PA 1BCPD 3K8AA 1B7YB 4APVA 5IWAL 2VUMG 1LTID 1YNJC 4OEMB 3U4VA 1SE8A 4G7ZC 3FHWA 1NTGA 5GQOA 1STAA 3KBXA 1RIPA 2XGTA 1BCPC 5FKAC 1LTRD 3HKZG 1KDCA 1JQYD 1OXVA 3KLSA 4DKAC 1I5FA 1ET6A 3P75A 3T1HL 1MHWC 2UXDQ 1L2FA 4XQNA 1S72A 1KNAA 1YJWA 3R2TA 4JW0A 4JI1Q 2OQKA 3MAQA 3GTKB 4JI4L 1U9RA 3AFPA 5D3DA 3DWQA 3WDNA 4F7XA 3HOYB 3U9SA 1U4LA 5M5WH 3CCRA 3TEHB 1U4MA 3LGJA 1BCPB 1BCPF 3S1NB 2EZVA 4ZCKA 3DXJC 2VQFQ 5KYIA 4LF5L 4K5XA 2RDHA 2B39A 3L7ZC 4L8JA 1QCBD 4KKUA 5C5LA 4U68A 4EQ5A 1Q90A 5M9OA 3M3YB 4L63B 2LXKA 4B3ML 1H9KA 4S3SA 3GTOH 1UWVA 4X3TA 2IX0A 4JCVE 2O4XA 3NBHA 3C46A 4A3FB 1DXMA 5C0XI 4LF4L 4DR4L 3VYTA 2JA6H 4G4KA 3J81L 1VQ6A 2NUCA 5CGKA 1BF4A 1OXXK 2OQ0A 2HDMA 4K8JA 1B44D 2MPMA 4IPGA 3PCOB 4FXDA 4RGTA 3DWPA 5JPNC 1JICA 1N36L 4AYBB
chains in the Genus database with same CATH topology
1EYAA 1QB5D 1ENFA 1MD2D 1IYUA 5ELEA 3SK5A 1UAPA 4B9WA 4KHVA 4P2CB 2RA4A 4XQJA 2WIIB 2C9OA 4DK1A 5K36G 4XYQA 3J7AV 1EQVA 1G8ZD 4ZUIA 2IX1A 1LV9A 1Q12A 3FEWX 1B53A 3HG9A 2TSSA 4PMWA 2IJ0A 5FO9B 2CHBD 5LHY1 5C0XJ 1BXTA 3GO5A 1YNND 3FVQA 4C1NK 1II3A 3J7YW 5KEEA 1O7LA 1YNNC 5C4JB 2DY7A 4ZLTF 1MSGA 2K5QA 2F0DA 4ZAIA 5KNCA 3RZOB 3KF8A 4HSPA 3S14B 3E6ZX 2R3ZA 3WOEA 1O7ZA 1ZKOA 1PMRA 4DGZA 1G91A 4HSVA 1JOQA 3DUZA 3QO2A 1WTOA 4IZ8A 3BG3A 3HZXA 1TS3A 2F0GA 3MXPA 3W2DA 3PIO3 1HFGA 3S1MB 1RKNA 3DMUA 4FF1A 1ILQA 4IFDI 4A93B 3BYYB 4K14A 2NB0A 3EA6A 2KEDA 3X3MA 3H91A 5IIFA 1DOLA 5JAVA 1HA5A 2NVXB 1EY7A 2B2VA 3ONAB 2NTSA 2A6ED 3AMUA 1LO5D 2F1MA 4IN3A 1E0BA 3IFDA 5FK9C 2A6EC 2XRSD 2EJFC 5EPKA 1HUNA 4BS9A 3I4LA 1JE4A 3PUXA 1CA5A 3PO2B 2JA8B 5EPJA 2B2YA 1QNKA 4HN7A 3NSWA 3A8KE 2Z4IA 3OPOA 1GUWA 4HMIA 3TDQA 1LABA 4EQNA 4BA2I 4IUTA 3GP7A 4CBVA 3E5SA 3OWEB 4UAIA 2VNUD 1D5XC 3BZDB 2K7VA 4RKBA 1JWSD 4ID6A 1KDAA 5JEAH 5IT9E 3S9WA 2OXPA 1IHZA 4JBWA 2SOBA 4ULLA 1TS2A 2EYOA 5K5PA 2K04A 1LTSD 3Q6SA 4C1NI 3S16B 1EIHA 4IFDH 4DN4M 1TU2B 2EOTA 1EEFD 5IODA 4F88A 1K83B 1HUMA 3DEPA 4IUUA 4NW2A 5E3FA 1JC7A 5G3LD 3BDOA 4FXKC 2A73B 1TS5A 3PO3B 2JA7B 3RMHA 4FF3A 1J8IA 1HTPA 3GTJB 1OXTA 1U4PA 3H0GB 4DAVA 4XT1B 1A6XA 4H0LC 2F0LA 4F87A 4KY7A 3NXWA 1U4RA 3IAYA 3GTLB 2HDLA 1QNUA 3GD7A 1OXSC 4RA8A 1KLGD 4BBRB 1GHKA 1A2UA 1E2ZA 5DEHA 3Q24A 1D2BA 2NVYB 1F2ZA 3G6JB 3D6CA 4QMGA 4Y7NB 1KABA 1IYVA 5LL6X 2WKCA 3MHBA 5EPLA 5EKIA 3QWNA 3P7JA 4CGYB 3NBIA 3PUZA 5C6AA 3SE0A 3HOVB 2NVQB 2K6AA 3GV6A 4LJZC 2SDFA 4JK1C 3TMEA 2XN9C 2F0FA 1G2TA 3D31A 4CJ1B 2NN6I 4L6TB 1TY0A 2MGSA 2NWGA 4K8IA 3RZDB 5E4WC 4WFN3 4FF2A 3AU7A 1QG7A 4UDUC 3FPUB 2A69D 5ELBA 1V1OA 2V4DA 3ND9A 1CFMA 3OMCA 2F3WA 3NWTA 5M5WB 1FNVA 1SNCA 2PW5A 2A69C 2LY7A 5A35A 2A74C 2KCNA 1R4QB 4PNYA 1LT3D 1A15A 4RH6A 1EWCA 1PXUA 4ZQ3A 1EZ8A 1PYWD 3T13A 2BE5D 1I4HA 3SR1A 3C1EA 1Q1EA 2LKVA 4TQUS 1FYCA 2L9HA 3OW7A 2B8FA 1D1KA 2BE5C 5I2XA 5KNBA 3SK6A 4B9XA 2JA6B 4FYDA 1CT1D 1Q1BA 2RKSA 2MJ8A 3D4DA 3U9OA 4H44C 2XSCA 3PUVA 1PZID 4FF4A 4KHZA 1SNMA 2EPBA 2JE6I 3TSSA 1PTOH 4XYOA 4C3HG 4C56C 4IUQA 2WKDA 2CQAA 1W6KA 3K5MA 3ND8A 1GUGA 1I50B 2F0UA 3VR2A 5FOBB 1K8MA 2D9UA 3VR6A 1HQMC 1BUVT 2AUJD 3K6OA 2IX3A 2FFKB 2NN6H 1LTGD 5C4XB 2QILA 4Z9CB 3NP8A 4M8AA 1SNDA 1H9RA 2EYMA 3NK9A 2EVBA 3CHBD 2PYKA 2XNAC 3TP5A 4NDXA 1FNUA 2J4XA 4A3EB 4KD3A 2EY6A 3SEBA 2EDGA 1V8QA 2F0MA 5FLXE 2HCCA 4QB4A 1ESRA 2Z1CA 4EQOA 4OO1G 1CM9A 5JVG3 1XXGA 2E74C 2AQ1B 4A3DB 1I4PA 1SJHD 3M4YA 1BR9A 2F0SA 4QF4A 4R9WA 5IGFA 2G9HD 1BOSA 4DFAA 2Z8LA 1VF7A 4TSSA 3D4WA 3R93A 3CKIB 4XIGS 1JWUD 2O5JC 2F0NA 3BYTB 1CI3M 1A2TA 3MVVA 2E2DC 2IW3A 4DK0A 3KUPA 1CK1A 1KDBA 1STGA 5IGBA 2E76C 3MFGA 5EBCA 2E2IB 1Q3LA 4BBSB 4C3HB 5CBAE 2BOSA 1AN8A 2MP1A 2D2CC 1ICWA 1EIGA 5C4HA 4HCSA 3I70A 1D6EC 1X3PA 2X69A 3TP6A 3NUCA 4FO2A 4RAUC 3IFTA 3D3RA 4RGOS 1RODA 5J22A 4LMQD 4J6HA 1SXTA 3QIAA 1LT4D 1W6JA 3P20A 5A2QE 1L0YB 5DM73 3EROA 1UUPA 2NYZD 3N52A 2R6GA 1F2MA 3I8ZA 4KKTA 1O78A 1KLUD 3CU7A 2JSOA 4E6IA 1BQQT 1HXYD 5HGTA 1AZQA 5EBDA 4RHSA 1Z6HA 2XVSA 4I65A 5CMDA 3J80E 1FNWA 3S1QB 2ZXRA 4HEDA 2K33A 3I72A 2EYPA 4J8QA 1FR3A 2ID0A 4OIKA 1SMYD 5FO7B 3JAME 3OOCA 4IQZA 1MBYA 1SBBB 1SDFA 1ET9A 4Q0FA 1RCVD 1SMYC 2RSNA 2F0PA 3T51B 4A3GB 4CJ0B 5IT9L 2KOLA 3MA2B 4ZYSA 1S5CD 3DEOA 2SNMA 1MGSA 2ZXPA 3DHQA 1Y69U 1EYDA 1DCZA 2K5WA 3D6WA 1VMCA 5C0XH 2B63B 4WRDA 3BVGA 5J1ZA 1R4PB 2DNEA 2F0VA 4OO1I 4C3IB 2SNSA 2IPKD 1BBXC 3A54A 1GHJA 5I9OA 4IUVA 3D4RA 1R9TB 2C5CA 3OMGA 4HMJA 5LL6S 3NPPA 4F8MA 1FGBD 5NUCA 4DXGA 2YU9B 3VA7A 1S4ZA 4KMUC 1STYA 1WD0A 5C3WA 1EY8A 4MN3A 1CZGA 4V0BA 3PIP3 3KBGA 4HAEA 1A3TA 3QG1A 1TY2A 5IOCA 1JCKB 1DONA 4EVOA 3EJIA 3M7GA 1K8OA 2JEAI 1CHQD 1X32A 5IGGA 1AFPA 3I4MB 1QOHA 4GZYC 3SHLA 3NTKA 4BY1B 2VB3X 4B08A 3VA5A 2RDGA 3K57A 2K05A 1XTCD 2ZXOA 4FXGC 2YYZA 3BVMA 1D5ZC 1STNA 4OO1H 4DF7A 2K03A 2X6LA 5JOBA 5DM63 4A3KB 3RD4A 1VMPA 2F0TA 2K1BA 3LNNA 5C44B 3K58A 1RTOA 3MWYW 2ZT9C 1TS4A 1NSNS 5D14A 2A68C 5E1FA 3MEHA 1Y8OB 5I2YA 2RQXA 4O42A 1IL8A 4K5WA 4MIUA 2QKIC 1DYQA 1AP0A 2CW0D 2TMPA 1XYIA 1ONLA 1PTOD 2CW0C 2F4IA 3I4NB 1UEAB 4X3KA 3BDCA 3F2UA 2F0EA 2PNRC 1NR2A 5CC4A 2PO4A 1PTOC 1SSOA 1QILA 3VYRA 3QOJA 1F9RA 3LWEA 2NBFA 4CKBA 4M1UB 4X3SA 4KV6A 3V96A 1ZEQX 1GXDC 2KECA 2PMZB 5T1IA 1TVXA 4TKOB 1H9MA 1E2VA 3K0YA 1F9QA 2KUMA 3GTGB 2F03A 5CV4A 1PTOF 1G2SA 2ICEC 3Q22A 2KQ3A 3VYUA 5KNDA 3ITPA 2HUGA 1M4VA 1I4GA 2PW7A 3A8JE 1ENCA 5K36H 4DNTB 2D5DA 2EYLA 2GA4B 5I6WA 5CR3A 1RD9D 1LTBD 1SNOA 3TZDA 1Q8IA 5EKLA 2I46A 2XRQD 3S15B 1SYGA 3J7AF 4WORA 3HS0C 2RSOA 1G291 4KJOA 3GTMB 1Y8PB 3K5LA 4XTCS 4EGVA 2RVLA 4HCEA 2N55A 4QUFA 4KKSA 2MHVA 1JORA 1O7YA 3VR4A 2Y0SB 3H09A 4LAAA 2Q8TA 2CVRA 4U673 1SYDA 4XDXA 2OT2A 1RDPD 1BNZA 5EJWA 3URYA 3HRZC 5I9PA 4KN7C 1EL0A 1PZJD 5D65A 2KVMA 1F2YA 1PLFA 5KGUA 1TIID 4IALA 3RUZA 5M3FB 1PFMA 1RHPA 3ERQA 2HCIA 3MXUA 1JOOA 1GUNA 1X3QA 3GTOB 1EYCA 2FMMA 3R8BA 2L12A 1MSHA 2MUYA 2JEBI 2XIWA 3QB3A 1ILPA 5CORA 1V1PA 3W3AA 3HGBA 2F0OA 3LWUA 4OHJA 4G57A 1A3UA 4XQQA 1ML0D 5T1GA 2PQEA 1S5FD 2B2TC 2M9VA 1SEBD 2B2UC 1HRJA 1I3QB 1SE4A 3K7AB 5M5XB 4OL7A 4TRDA 4DNRB 1EEID 1HQRD 3FMCA 5CV5A 3EQLC 1LTTD 1ESFA 5CV8A 4QCLA 5A2QL 4KY6A 5KIXA 3TP8A 5IGEA 1LACA 4OIJA 1CTMA 1H9SA 2LFNA 3P1HA 3X3NA 2IL8A 2H1EA 4ILWA 1WTVA 4FP5D 1TR5A 1C4QA 2PZTA 3SDZA 1B9MA 1SYFA 3PUYA 1WTQA 2K5DA 3HOUB 4BY7B 5BN5A 4PMBA 3J80L 2WINB 1WTPA 4KJNA 2EYFA 5IGDA 5ISRA 1EY5A 3KLRA 4RKLA 1RJTA 5I6YA 4ME5A 2VB2X 4IURA 2WP8J 3EFXD 3JAML 1T5XD 3ZYYX 4RGNA 2QDBA 3H94A 4X3UA 1B9NA 4XT3B 4H7BA 1IW7D 5JEAG 1WTWA 2EY1A 5COYA 2DY8A 1IW7C 3HOXB 4ABNA 3DWAA 4DA2A 3H3VC 3K59A 1PFBA 2O2LD 4ZK9B 3T16A 2EE1A 3M4OB 2ICIA 1WCMB 4IFDG 4ODGA 1EU3A 2Q8RE 2L0CA 2R92B 3QJYA 2PCFB 2B2WC 2F0KA 2KJXA 1WD1A 2F3VA 2A5HA 4IUNA 1HPCA 4C3IG 5TSSA 4IUPA 4KD4A 5ELFA 3M7NA 2EJGC 2BA0A 5C3EB 4CHTB 1Z7TA 2L1BA 3A8IE 4KY5A 3BDLA 2NVTB 1NR4A 5J39A 2O5IC 2KA7A 1LT6D 1H9JA 4ZRZA 1GOZA 3UI2A 4XXEA 4HR7B 1TQOA 2WAQB 1GUTA 2K32A 2OEOA 1EY0A 2QCPX 2N88A 4C3JG 3HP3A 1S5BD 4QIWB 1AEXA 2L11A 4O1NA 1MI2A 1F9PA 2LS01 4WJWA 1J9OA 1Y1VB 3QOLA 2QF7A 3CQZB 2X6GA 2QEJC 1STHA 4CJ2C 4FVMA 1F2LA 4I7ZC 3A7LA 2I07B 3R2IA 2AWOA 2VUMB 4BWGB 1EY9A 2PZWA 1V1PB 3BS1A 1WTXA 2LMCB 3V2TA 1KTKA 3HKZB 5ELCA 5EKKA 1CHPD 1I6HB 3NQIA 2JXMB 2DNCA 1TKWB 1SJED 4G7HC 1SE3A 4Q5VA 1DM0B 1DOKA 4DXFA 3T56B 4K5VA 1HHVA 1CZWA 3S17B 1HA6A 3C1FA 1O80A 3C3LA 5C5MA 1CA6A 4G7OC 1EWHA 1KNEA 3OIPA 4LK1C 1H9SB 1VF5C 5HURA 2D62A 3OWFA 4RCNA 3KK7A 4PV1C 4BA1I 3I91A 4K6LA 3M85A 1NAPA 5CV6A 3SK8A 3S2DB 1L0XB 1JOKA 2K01A 1FD7D 2NTTA 2EY2A 1C8CA 1EZ6A 1BO0A 3I90A 3IL8A 3K5OA 2F0WA 1TWFB 1S5DD 4C3JB 2G9DA 4PQXA 4EQPA 4K2KA 2PZUA 1XWEA 3NWSA 2EJMA 3J81E 3OHXC 2A6HD 3PV0A 3EVQA 5FO8B 5F2DA 5E4XA 4CKCA 1B50A 2A6HC 4RCOA 2M00A 3NTHA 2RDFA 2K28A 1AW7A 1RTNA 5CBEE 4K6DA 3OSOA 4RHRA 1VCIA 3A7AB 2HQEA 2JYOA 3GTQB 2IWHA 3S1RB 1STBA 5JEAJ 1B2TA 1DD2A 1TWAB 4N9PA 1EY4A 1DZ1A 4KK7A 3C2PA 3TZUA 2BDOA 4H13C 1B3AA 3OIQA 1ZYRD 2NN6G 2WACA 2FJ2A 1C48A 4IFDJ 1HFNA 4PMCA 2AWNA 1ZYRC 1GUSA 1VDZA 2A68D 2AQ2B 3Q23A 5D3IB 2Z4HA 1LTAD 1TWHB 5EQ0A 5ELDA 2KEEA 1XX8A 2J7ZA 5BN3A 3BVZA 2JA5B 3K5NA 1F77A 3G7LA 2F0QA 2PPBC 1OXUA 3VR5A 4ZUJA 1SFOB 3FPPA 1JB3A 3I73A 2H4OA 4ZKBB 2FHTA 3SXHA 2L55A 1WVLA 2NZ1D 3L9AX 1TT2A 1EFID 3R3OA 3I3CA 4A3IB 2B2TA 3TN2A 4A3MB 1OO9B 2B2UA 2E75C 5I4DA 2KHSA 4NKLA 5DAUA 1EQTA 1IKLA 2KCCA 2B8GA 5CV7A 4KI0A 2M2LA 4FNFA 2J0TD 1STEA 2L5TA 3HOWB 3GV3A 1SAPA 3T53B 2OF1A 1Y8NB 1GUOA 2WV6D 3WOFA 4MHEA 2BCOA 1I4XA 2JP1A 2BA1A 1PTOB 1SYCA 1B4OA 5JPMC 2Q8IB 1PFNA 3SVMA 3L3OC 4DU9A 4KTAA 3PMFA 1B1ZA 1BDOA 1PRTD 3DM1A 3RLFA 5KRUA 5CYUA 2F0HA 3E0JA 1E2WA 1GJXA 4DAPA 1PRTC 1KAAA 4RWSC 5G3LF 2FINB 1PDQA 3H6MA 1QE6A 1TWCB 5IGCA 3GTPB 2F0IA 4N9TA 3V05A 4QUCA 5M5YB 3MZ5A 3CRLC 2B2VC 4J1MA 2BDNA 1ZXTA 1PRTB 3NQTA 3T4AC 1PRTF 2EYJA 3VYSA 1AZPA 3MXGA 2R93B 2XWJB 3GQBA 3NTIA 1EY6A 2AQ3B 5FLXL 2EXZA 5EGTA 1WTRA 4CKEA 1UNSA 1DJRD 2B2YC 2B2WA 1CQFA 1D5MC 2WB1B 1SE2A 1A3VA 1LT5D 1QWYA 3D8GA 1DOMA 3SK4A 3HEJA 1V43A 5JVH3 1D1IA 3NE5B 3N6RA 4A3BB 5JJZA 4V190 2RBMA 3NHHA 1EOTA 1TWGB 3CRKC 5CV9A 1I4QA 1JWMD 4RGMA 2E2JB 2F0JA 3Q0AA 5C0XG 3S2HB 5M3MB 4C2MB 2R61A 2DN8A 2SEBD 5C4ZA 2XWBB 4YIJA 5DNFA 1LLRD 3FKIB 3TP7A 3PUWA 1PZKD 4KN4C 1QJOA 1F9SA 2FMCA 3MFYA 2L4NA 1CQVA 3A55A 4R8NA 3KLSX 2EY5A 3MXNA 3MTSA 1M8AA 4R8IA 1IKMA 1SNPA 1Z47A 1NUCA 4RFBA 4NP5A 5AFWA 2EYHA 4OGQC 1HTLD 1S5ED 1EU4A 2VXWA 3IKJA 3O13A 5KYLA 3MC0B 4HTHA 1SYBA 1HCZA 4ZKCB 1SYEA 3AB9A 4K2LA 3HOZB 3FDTA 1RF2D 4DAYA 1T5EA 1Y1WB 4NMZA 5BN4A 3VR3A 1JR0D 2IT1A 3FRPB 1SNQA 3LX0A 2E2HB 2R7ZB 1I4RA 1ENAA 4A3JB 1NCVA 1I6VC 3TBIB 2AUKA 1G6ZA 1YNJD 3A56A 5C3XA 2ENBA 1BCPD 1LTID 1YNJC 4G7ZC 1STAA 3KBXA 1BCPC 5FKAC 1LTRD 1KDCA 1JQYD 1OXVA 3KLSA 1ET6A 3P75A 4XQNA 1KNAA 3R2TA 3MAQA 3GTKB 1U9RA 5D3DA 3DWQA 3WDNA 4F7XA 3HOYB 3U9SA 1U4LA 1U4MA 1BCPB 1BCPF 3S1NB 2EZVA 3DXJC 5KYIA 4K5XA 2RDHA 2B39A 3L7ZC 4L8JA 1QCBD 4KKUA 5C5LA 4U68A 5M9OA 1Q90A 3M3YB 4L63B 1H9KA 4S3SA 4X3TA 2IX0A 2O4XA 3NBHA 3C46A 4A3FB 1DXMA 5C0XI 3VYTA 4G4KA 3J81L 2NUCA 5CGKA 1BF4A 1OXXK 2HDMA 4K8JA 1B44D 2MPMA 4FXDA 4RGTA 3DWPA 5JPNC 1JICA 4AYBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2T A;  1EYA A;  4K6D A;  2OF1 A;  5C6A A;  2F0U A;  3OSO A;  3SK4 A;  5C4H A;  4WRD A;  5I6W A;  2F0O A;  3HEJ A;  3T16 A;  5CR3 A;  4K14 A;  5J1Z A;  3SK5 A;  1SNQ A;  4G57 A;  5EKK A;  4B9W A;  1A3U A;  2F0T A;  2F0V A;  3LX0 A;  4KHV A;  1SNO A;  2HQE A;  3NUC A;  3TP6 A;  1ENA A;  3TME A;  5IIF A;  1SYC A;  4ODG A;  2RBM A;  2SNS A;  3NHH A;  5JAV A;  5C3X A;  5I9O A;  1STB A;  2F0F A;  5CV9 A;  5E3F A;  5EKL A;  1EY7 A;  2PQE A;  2F0J A;  3NP8 A;  4DU9 A;  1SND A;  1EQV A;  2ENB A;  3OMG A;  3PMF A;  4KTA A;  4HMJ A;  1EY4 A;  4N9P A;  2F0K A;  2EYM A;  1NSN S;  3NK9 A;  4ZUI A;  4F8M A;  5E1F A;  5KRU A;  2PYK A;  2F3V A;  5J22 A;  4K5V A;  3TP5 A;  1SYG A;  3MEH A;  4NDX A;  2F0H A;  4IUN A;  5NUC A;  1STA A;  4J6H A;  4WOR A;  5C4Z A;  4KD3 A;  4K8I A;  4K5W A;  1STY A;  1KAA A;  4MIU A;  4YIJ A;  2WAC A;  2EY6 A;  4KJO A;  1KDC A;  4OL7 A;  4TRD A;  5C3W A;  3P75 A;  2F0M A;  3ERO A;  3C1F A;  5CV5 A;  1F2M A;  3H6M A;  4QB4 A;  5C5M A;  3TP7 A;  1EY8 A;  5CV8 A;  4PMC A;  4KD4 A;  4KY6 A;  5KIX A;  1JOR A;  4EQO A;  3TP8 A;  5IGE A;  5IGC A;  5HUR A;  2F0I A;  2F0L A;  4E6I A;  4N9T A;  3OMC A;  2F3W A;  3OWF A;  1II3 A;  3P1H A;  1SNC A;  1U9R A;  2PW5 A;  3BDC A;  4KY5 A;  4LAA A;  5KEE A;  4KY7 A;  4R8N A;  2F0E A;  3BDL A;  5HGT A;  1A3T A;  3MZ5 A;  1SYD A;  3NXW A;  5J39 A;  5CV6 A;  4F7X A;  5CC4 A;  4HMI A;  4PNY A;  3SK8 A;  1TR5 A;  2PZT A;  5IOD A;  4I65 A;  4EQN A;  5IOC A;  2F0Q A;  2F0S A;  2EY5 A;  4QF4 A;  1JOK A;  3QOJ A;  4J1M A;  5IGF A;  1TQO A;  2F0D A;  3E5S A;  1SYF A;  5I9P A;  2EY2 A;  4ZQ3 A;  3NQT A;  1EZ6 A;  1EZ8 A;  2EYJ A;  4ZUJ A;  2F0W A;  3T13 A;  4DFA A;  2EYP A;  1SNP A;  2OEO A;  4KV6 A;  3SR1 A;  1NUC A;  4PMB A;  4K5X A;  1A2U A;  1EY0 A;  3SXH A;  5KYI A;  3C1E A;  4KJN A;  1EY6 A;  2LKV A;  5DEH A;  3EJI A;  4RKB A;  4EVO A;  5C5L A;  2EXZ A;  5M9O A;  3D4W A;  2EYF A;  5IGD A;  4DGZ A;  1F2Z A;  4EQP A;  5EGT A;  1F2Y A;  1TT2 A;  1EY5 A;  4ID6 A;  3D6C A;  1AEX A;  4NP5 A;  2EYH A;  5KGU A;  1KDA A;  3R3O A;  1JOQ A;  4RKL A;  4S3S A;  3S9W A;  2OXP A;  1IHZ A;  5I6Y A;  4IAL A;  4QMG A;  4K2K A;  2F0N A;  3SK6 A;  5IGG A;  2PZU A;  4ME5 A;  2SOB A;  1KAB A;  4B9X A;  1A2T A;  3MVV A;  5ISR A;  2F0P A;  2O4X A;  3QOL A;  4IZ8 A;  2EYO A;  3RUZ A;  3HZX A;  5K5P A;  2QDB A;  3SHL A;  3ERQ A;  2RKS A;  1STH A;  5KYL A;  2F0G A;  3D4D A;  3U9O A;  5CV4 A;  1KDB A;  4HTH A;  3MXP A;  1SYB A;  1STG A;  1JOO A;  2KHS A;  2SNM A;  3MHB A;  4NKL A;  3EVQ A;  1A3V A;  5DAU A;  1SYE A;  4H7B A;  4K2L A;  3VA5 A;  2NUC A;  3DHQ A;  5CV7 A;  5F2D A;  5CGK A;  5IGB A;  1EYC A;  4K8J A;  1SNM A;  2KQ3 A;  1RKN A;  3ITP A;  1EYD A;  3DMU A;  4NMZ A;  3QB3 A;  2EY1 A;  1STN A;  2PW7 A;  1EY9 A;  2M00 A;  4DF7 A;  1ENC A;  2PZW A;  2RDF A;  3D8G A;  2EYL A;  5JOB A; 
#chains in the Genus database with same CATH topology
 1EYA A;  1QB5 D;  2PI2 A;  1ENF A;  1MD2 D;  1C9O A;  1IYU A;  1EIF A;  5ELE A;  3SK5 A;  1UAP A;  4B9W A;  1PH3 A;  4A93 G;  4KHV A;  4P2C B;  2RA4 A;  4XQJ A;  1I50 H;  2WII B;  4JI7 L;  2C9O A;  4UP7 A;  1K8A C;  4DK1 A;  3K7A H;  5K36 G;  4XYQ A;  3J7A V;  1CKN B;  1EQV A;  1J6Q A;  1KL9 A;  1G8Z D;  5GAG C;  4ZUI A;  2I5M X;  5C4X H;  2IX1 A;  5H1S E;  4YCW A;  1LV9 A;  2I5H A;  1Q12 A;  3FEW X;  1B53 A;  1IBM Q;  2R7F A;  3HG9 A;  2TSS A;  4PMW A;  4B3R L;  2IJ0 A;  4JI2 Q;  5FO9 B;  4J15 A;  3W1B A;  2CHB D;  1XNQ L;  5LHY 1;  5C0X J;  1BXT A;  3GO5 A;  1YNN D;  3FVQ A;  4C1N K;  1II3 A;  3HOU H;  3J7Y W;  5KEE A;  4GNX C;  1O7L A;  1X3E A;  1SRO A;  3D0F A;  1YNN C;  5C4J B;  3TS0 A;  2DY7 A;  3MXN B;  4ZLT F;  1MSG A;  2RCF A;  1CUK A;  1EQQ A;  2K5Q A;  2F0D A;  4NXM Q;  3PIO A;  4ZAI A;  5KNC A;  3RZO B;  3KF8 A;  4HSP A;  3BU2 A;  4DR7 Q;  3S14 B;  2KCT A;  4DR1 Q;  3E6Z X;  2R3Z A;  4B3S Q;  1K0S A;  1A63 A;  3WOE A;  1O7Z A;  1ZKO A;  1PMR A;  1VQ9 A;  4DGZ A;  1G91 A;  4HSV A;  1JOQ A;  2A8V A;  3ER0 A;  3DUZ A;  2MO0 A;  3QO2 A;  2IHE A;  4L5Q A;  2UUC Q;  2UXC Q;  1WTO A;  4IZ8 A;  4LFA Q;  3BG3 A;  2JA5 G;  3HZX A;  4DV3 L;  1TS3 A;  2F0G A;  2KBN A;  3MXP A;  5FLX c;  3W2D A;  5HGQ A;  3PIO 3;  1HFG A;  3S1M B;  4DAY B;  3M4O H;  1RKN A;  3DMU A;  1U5K A;  4FF1 A;  4YCU A;  4LF5 Q;  1OTC A;  1ILQ A;  1W2B A;  3VDY A;  2VY3 A;  4A3I G;  4A4I A;  4BBS H;  4IFD I;  4A93 B;  3BYY B;  4K14 A;  3CCQ A;  3T1Y Q;  3KJP A;  2NB0 A;  1YEZ A;  3EA6 A;  4OX9 Q;  2KED A;  1GD7 A;  3X3M A;  3H91 A;  5IIF A;  1DOL A;  3W1G A;  4DNI A;  4OWT B;  5JAV A;  4DUY L;  1HA5 A;  2NVX B;  1EY7 A;  2B2V A;  3ONA B;  2NTS A;  2A6E D;  4JI5 L;  1LO5 D;  3AMU A;  2F1M A;  5J3B A;  4GN5 A;  4IN3 A;  3G48 A;  4A75 A;  1E0B A;  3IFD A;  1XMO L;  3HOW G;  4H02 A;  5FK9 C;  1TXY A;  2JA7 G;  2A6E C;  2E5L L;  2XRS D;  3CF5 A;  2EJF C;  2NVT H;  5EPK A;  1HUN A;  1VQB A;  4FDB A;  4BS9 A;  3I4L A;  1JE4 A;  3PUX A;  1CA5 A;  3PO2 B;  2JA8 B;  5EPJ A;  2B2Y A;  4X62 L;  4O0A A;  4PG3 A;  2PQA A;  3U50 C;  4MNO A;  1QNK A;  4HN7 A;  5FJ8 G;  3NSW A;  3A8K E;  2Z4I A;  1IBK L;  3OPO A;  1GUW A;  3SGI A;  4HMI A;  3TDQ A;  1QUQ A;  1LAB A;  4EQN A;  4BA2 I;  4IUT A;  3GP7 A;  3Q8D A;  4CBV A;  3E5S A;  3OWE B;  4UAI A;  2QEX A;  2VNU D;  4GKK L;  1D5X C;  1HNZ L;  3CQZ H;  2DGY A;  3BZD B;  2K7V A;  1JJ2 A;  4RKB A;  1JWS D;  3AFQ A;  1X9N A;  4JI8 L;  4ID6 A;  1Q46 A;  1KDA A;  5JEA H;  5IT9 E;  3S9W A;  1PH8 A;  2OXP A;  1IHZ A;  4JBW A;  2AKW B;  2SOB A;  1VQI A;  3NBH B;  5LMN W;  1P8L A;  4ULL A;  1HNX Q;  1TS2 A;  2EYO A;  5K5P A;  2K04 A;  4OEL B;  2N49 A;  1GVP A;  1NNX A;  1LTS D;  1VQA A;  1C7Y A;  3Q6S A;  4C1N I;  1QVG A;  2WFW A;  3S16 B;  5GAE C;  4A3G H;  2A19 A;  2R93 G;  1EIH A;  1VQ5 A;  4IFD H;  2HIX A;  4DN4 M;  1XMQ L;  1GKH A;  1TU2 B;  2EOT A;  1EEF D;  5IOD A;  4F88 A;  1K83 B;  1HUM A;  1N34 Q;  3DEP A;  4IUU A;  5IYB H;  2YTX A;  1YZ6 A;  1QZG A;  2B63 H;  2ALY B;  5LMN Q;  5L37 A;  4NW2 A;  3CAM A;  5E3F A;  3S17 H;  1JC7 A;  5G3L D;  4K0K Q;  3BDO A;  3E3X A;  4FXK C;  4DV7 L;  2A73 B;  2KEN A;  1TS5 A;  1YVC A;  4JYA L;  2GVA A;  3PO3 B;  2MFI A;  2JA7 B;  3RMH A;  1BBU A;  1WFQ A;  4FF3 A;  1J8I A;  1HTP A;  3GTJ B;  1OXT A;  1U4P A;  3H0G B;  4DAV A;  4A3B G;  3AYH B;  3S2D H;  4XT1 B;  1Q86 C;  1A6X A;  4H0L C;  4JI0 L;  2F0L A;  4F87 A;  4DR6 L;  4L5T A;  4KY7 A;  1TWF H;  3CCL A;  2F3I A;  3NXW A;  1U4R A;  4C3J H;  2C35 B;  3IAY A;  3GTL B;  2HDL A;  5M3M G;  1QNU A;  3GD7 A;  1X65 A;  3KF8 B;  1OXS C;  5IP9 H;  4X64 L;  1KRS A;  5GRO A;  4RA8 A;  2K14 A;  1KLG D;  4CDC C;  4BBR B;  2ZM6 L;  1JT8 A;  1X3G A;  2MNA A;  1NMF A;  4POG A;  1GHK A;  1A2U A;  1FVI A;  3UDF A;  1E2Z A;  5DEH A;  3Q24 A;  1D2B A;  2NVY B;  1F2Z A;  3G6J B;  3D6C A;  1WOC A;  1KRT A;  4QMG A;  1YJN A;  4Y7N B;  1KAB A;  1IYV A;  5LL6 X;  4IPD A;  2WKC A;  2K52 A;  3MHB A;  1N33 L;  5EPL A;  3I4M H;  5EKI A;  3QWN A;  3CC7 A;  3GTQ H;  1EWI A;  1NY4 A;  3P7J A;  1PHJ A;  4PZ7 A;  4CGY B;  3NBI A;  3PUZ A;  3G6E A;  5C6A A;  1TWA H;  3SE0 A;  1XPR A;  3HOV B;  2EQS A;  1VQL A;  2NVQ B;  4CDE C;  3J81 c;  2K6A A;  3GV6 A;  4LJZ C;  2SDF A;  3IRB A;  3PSI A;  4JK1 C;  3TME A;  5GAD C;  2LXJ A;  2XN9 C;  1QVF A;  1JJG A;  2F0F A;  3HOZ G;  1G2T A;  4ALP A;  3D31 A;  1Y1W G;  1Y14 B;  4CJ1 B;  2NN6 I;  4L6T B;  1TY0 A;  2MGS A;  2NWG A;  1TWH H;  1PH6 A;  4K8I A;  3RZD B;  4DR5 Q;  4A3E G;  1XJV A;  5E4W C;  4WFN 3;  4FF2 A;  3AU7 A;  2JA5 H;  1QG7 A;  4UDU C;  2R7Z G;  2PQA B;  4JI1 L;  3FPU B;  3G4S A;  2A69 D;  5ELB A;  1V1O A;  2V4D A;  3ND9 A;  3UDX A;  3KDF A;  4A3L G;  1CFM A;  1KQS A;  3OMC A;  2F3W A;  3NWT A;  5M5W B;  1FNV A;  1SNC A;  2PW5 A;  2A69 C;  2MO1 A;  2LY7 A;  5A35 A;  1SFO H;  2A74 C;  1QUQ B;  2KCN A;  1R4Q B;  4PNY A;  1LT3 D;  4A3D G;  1A15 A;  4RH6 A;  2VL6 A;  3I4N H;  1EWC A;  1PXU A;  2VQF L;  2G5D A;  2F4V Q;  4ZQ3 A;  1EZ8 A;  4KLK A;  1PYW D;  3T13 A;  1Q82 C;  2BE5 D;  3E0E A;  1I4H A;  3SR1 A;  4A3M H;  4UY8 C;  3C1E A;  1Q1E A;  2LKV A;  4TQU S;  1K3R A;  1FYC A;  2L9H A;  3OW7 A;  2B8F A;  1D1K A;  4OON A;  2BE5 C;  5I2X A;  5KNB A;  4JI0 Q;  3SK6 A;  4B9X A;  2JA6 B;  4FYD A;  4BXX G;  1CT1 D;  3BZC A;  1CKM A;  1Q1B A;  2RKS A;  2MJ8 A;  3D4D A;  3HOW H;  3U9O A;  4H44 C;  3OYY A;  2XSC A;  2CWP A;  3PUV A;  1PZI D;  4FF4 A;  4KHZ A;  1YBY A;  1SNM A;  2EPB A;  2JE6 I;  3TSS A;  1PTO H;  4XYO A;  4CDF C;  2YTV A;  2I0Q A;  4QL5 A;  4C3H G;  2PMZ E;  4C56 C;  4IUQ A;  2WKD A;  1N8R C;  2CQA A;  1W6K A;  3K5M A;  4LF6 L;  3ND8 A;  1VQG A;  2VQE Q;  1GUG A;  1I50 B;  2F0U A;  3VR2 A;  5FOB B;  1K8M A;  2D9U A;  3VR6 A;  1HQM C;  1BUV T;  2HIV A;  3EN2 A;  4GLX A;  2AUJ D;  3K6O A;  1IYJ B;  2IX3 A;  2FFK B;  2NN6 H;  1LTG D;  5C4X B;  2QIL A;  4Z9C B;  1PH2 A;  3NP8 A;  1N33 Q;  4M8A A;  1SND A;  2CCZ A;  1H9R A;  2EYM A;  3NK9 A;  2EVB A;  3CHB D;  2PYK A;  1RL2 A;  2XNA C;  3CCJ A;  3M4Q A;  3TP5 A;  2RHS B;  3RN2 A;  1TWC H;  4NDX A;  1FNU A;  4R4O A;  4AYB G;  1IBM L;  2J4X A;  4A3E B;  4KD3 A;  2Z6B A;  2EY6 A;  3SEB A;  2EDG A;  1HNW Q;  2KCM A;  1V8Q A;  4JI2 L;  2F0M A;  5FLX E;  2HCC A;  3I2Z A;  4MTN A;  4QB4 A;  1ESR A;  2Z1C A;  4EQO A;  4OO1 G;  3GTM H;  2JQO A;  1CM9 A;  5JVG 3;  3QR8 A;  1XXG A;  2R93 H;  2E74 C;  1EUJ A;  2AQ1 B;  1EIY B;  2DJF C;  1K8G A;  4A3D B;  1I4P A;  1SJH D;  2UXB L;  3M4Y A;  3A0J A;  4NXM L;  1BR9 A;  2F0S A;  4DR7 L;  4QF4 A;  4R9W A;  5IGF A;  2G9H D;  4DR1 L;  1BOS A;  4B3S L;  4DFA A;  2Z8L A;  1VF7 A;  2Y0S E;  4TSS A;  3RN5 A;  2N8N A;  3D4W A;  3R93 A;  3FP9 A;  1X54 A;  3CKI B;  4XIG S;  5DLQ E;  1JWU D;  4IPC A;  1CKO A;  3CCM A;  2UUC L;  2UXC L;  4IJH A;  2F0N A;  4LFA L;  2O5J C;  3BYT B;  1CI3 M;  4IO9 A;  1A2T A;  3MVV A;  2E2D C;  2IW3 A;  4YY3 Q;  4DK0 A;  3KUP A;  1CK1 A;  1KDB A;  1AE2 A;  1STG A;  4P75 A;  1V1Q A;  5IGB A;  2E76 C;  3MFG A;  5EBC A;  5FLM G;  2E2I B;  5M3F H;  1Q3L A;  4A3B H;  3F2D A;  1S40 A;  1MKH A;  4BBS B;  4C3H B;  1D7Q A;  5CBA E;  3F1Z A;  2BOS A;  1AN8 A;  2MP1 A;  1TWG H;  2D2C C;  3NEN A;  4L5S A;  4P74 A;  1ICW A;  1XPU A;  1EIG A;  3T1Y L;  5C4H A;  4HCS A;  4OX9 L;  3I70 A;  1D6E C;  1X3P A;  2X69 A;  3S2H H;  3TP6 A;  3NUC A;  4C2M H;  4FO2 A;  2EIF A;  4RAU C;  3IFT A;  3OW2 A;  1HZA A;  3D3R A;  4RGO S;  3FKI H;  2CFM A;  1JE5 A;  1ROD A;  5J22 A;  4LMQ D;  4J6H A;  1CSP A;  1SXT A;  1JB7 A;  3QIA A;  4LF6 Q;  3P20 A;  1LT4 D;  1W6J A;  1E24 A;  3B6Y A;  1L0W A;  1L0Y B;  4X66 Q;  5A2Q E;  1PH1 A;  5DM7 3;  1YI2 A;  3ERO A;  1UUP A;  2NYZ D;  3N52 A;  2R6G A;  1F2M A;  3CCS A;  3I8Z A;  1I3Q H;  3KDF B;  4KKT A;  4R4C A;  5M5X H;  1O78 A;  1QZH A;  1KLU D;  3CU7 A;  2JSO A;  4E6I A;  2EXD A;  1BQQ T;  1HXY D;  5HGT A;  2QA4 A;  2Z6K A;  1AZQ A;  5EBD A;  4RHS A;  3I7F A;  2Z0S A;  3H3V I;  1Z6H A;  2XVS A;  5IP7 G;  4I65 A;  3CME A;  5CMD A;  3J80 E;  1FNW A;  1C0A A;  3S1Q B;  2ZXR A;  4HED A;  2K33 A;  3H15 A;  3I72 A;  2EYP A;  4DK3 C;  4J8Q A;  3PO2 G;  1LUZ A;  2JA8 G;  1FR3 A;  2ID0 A;  4OIK A;  1SMY D;  1X6O A;  5FO7 B;  1Q8K A;  5EAY A;  3JAM E;  2I5L X;  4NXN Q;  3OOC A;  4IQZ A;  1MBY A;  1SBB B;  4BY7 H;  1SDF A;  4YWK A;  1HNX L;  1ET9 A;  4Q0F A;  1RCV D;  1SMY C;  2RSN A;  2F0P A;  3T51 B;  4A3G B;  4CJ0 B;  4HIK A;  5IT9 L;  2KOL A;  4BY1 G;  3MA2 B;  4ZYS A;  1S5C D;  2UXB Q;  3DEO A;  2DJG C;  2SNM A;  1EYG A;  1MGS A;  2GN5 A;  2ZXP A;  3DHQ A;  1Y69 U;  2E2H H;  4LF9 Q;  1EYD A;  4A3J H;  1DCZ A;  2K5W A;  3D6W A;  1VMC A;  4HJA A;  5C0X H;  2YTY A;  4MZ9 A;  1N34 L;  2B63 B;  1VQ4 A;  1IXR A;  4WRD A;  3BVG A;  3KF6 A;  5J1Z A;  4GNX B;  1R4P B;  2DNE A;  2F0V A;  4A3K G;  4OO1 I;  4C3I B;  5LMN L;  3HOX H;  2SNS A;  4K0K L;  2IPK D;  1BBX C;  5C44 G;  3A54 A;  1GHJ A;  5I9O A;  4IUV A;  1KC8 C;  3D4R A;  4OXP A;  5IYD G;  1R9T B;  4HJ7 A;  2C5C A;  3OMG A;  4HMJ A;  3J7Z C;  1WCM H;  5LL6 S;  3NPP A;  4F8M A;  4AQY Q;  2CKZ B;  1KXL A;  1FGB D;  5NUC A;  4DXG A;  2YU9 B;  3VA7 A;  1S4Z A;  2R92 H;  3AQQ A;  3M9B A;  4KMU C;  1STY A;  4ME3 A;  3GTK H;  1WD0 A;  3K81 C;  5C3W A;  3RLN A;  2HHH Q;  4GN3 B;  1EY8 A;  1LTL A;  3HOY H;  4RG1 A;  3HFZ B;  4MN3 A;  1CZG A;  3H3V H;  2Q2I A;  4V0B A;  4A3C H;  2LSS A;  1Q7Y C;  3PIP 3;  3S1N H;  3KBG A;  4YHH L;  4HAE A;  1A3T A;  5JJI A;  3QG1 A;  1TY2 A;  5C3E H;  3J80 i;  4DR2 Q;  3PO3 G;  5IOC A;  2K5V A;  2JN4 A;  1ASY A;  1SR3 A;  3H0G G;  1M90 C;  1UE1 A;  3JAM i;  1JCK B;  1DON A;  2D0O A;  4A3F H;  4EVO A;  3EJI A;  4UPA A;  3M7G A;  1K8O A;  1HR0 Q;  2JEA I;  4QQB X;  1CHQ D;  1X32 A;  5IGG A;  5LMU Q;  1AFP A;  3I4M B;  1QOH A;  4GZY C;  3SHL A;  3NTK A;  4BY1 B;  2VB3 X;  4B08 A;  4Y52 H;  2WAQ E;  1Q81 C;  3KLW A;  1X55 A;  3VA5 A;  2RDG A;  3K57 A;  1Y1V H;  4BBR G;  2K05 A;  1M1K C;  1XTC D;  2ZXO A;  4FXG C;  2YYZ A;  3BVM A;  3ULJ A;  1D5Z C;  1STN A;  4OO1 H;  4QIW E;  3A74 A;  4DF7 A;  2K03 A;  2YV5 A;  2X6L A;  5JOB A;  5DM6 3;  2VUM H;  4A3K B;  3RD4 A;  1VMP A;  2F0T A;  2K1B A;  3BZK A;  3LNN A;  5C44 B;  2Q2T A;  3K58 A;  4HJ5 A;  1RTO A;  3MWY W;  2ZT9 C;  2Z6K C;  1TS4 A;  4GLA C;  3CPW A;  3K80 C;  1L1O A;  5GAH C;  1I6H H;  1NSN S;  1A8V A;  5D14 A;  2A68 C;  5E1F A;  1BBW A;  3MEH A;  4DR5 L;  4JG2 A;  1Y8O B;  5I2Y A;  3CCU A;  2RQX A;  4O42 A;  1IL8 A;  4K5W A;  4DUZ Q;  4MIU A;  3HOV G;  1V9P A;  2QKI C;  1DYQ A;  1AP0 A;  2CW0 D;  3KJO A;  3J7A 5;  2TMP A;  1XYI A;  4DV4 L;  1ONL A;  1KHI A;  1PTO D;  1AE3 A;  2CW0 C;  3RZO H;  5FLM H;  2F4I A;  3S14 H;  2ES2 A;  3I4N B;  1UEA B;  4X3K A;  3BDC A;  3F2U A;  1IL2 A;  1G6P A;  2F0E A;  4B3T Q;  1I94 Q;  2PNR C;  1NR2 A;  2KHI A;  5CC4 A;  2PO4 A;  1PTO C;  1LM0 A;  1SSO A;  3CC4 A;  1QIL A;  2F4V L;  3VYR A;  3QOJ A;  1F9R A;  3LWE A;  2NBF A;  4M1U B;  4CKB A;  4X3S A;  4KV6 A;  3ULP A;  3V96 A;  1VQK A;  4UP9 A;  1EQR A;  1ZEQ X;  1GXD C;  2KEC A;  2PMZ B;  5T1I A;  3S1M H;  2B3G A;  1TVX A;  4TKO B;  4DV1 Q;  1H9M A;  1E2V A;  4YHH Q;  3K0Y A;  1F9Q A;  2KUM A;  1SMX A;  3GTG B;  2F03 A;  5CV4 A;  1PTO F;  1G2S A;  2QDL A;  4A93 H;  1YNX A;  2ICE C;  3Q22 A;  2KQ3 A;  3VYU A;  1VQJ A;  5KND A;  3ITP A;  2HUG A;  1M4V A;  1AH9 A;  4GLV B;  1I4G A;  2VQE L;  2PW7 A;  3A8J E;  1ENC A;  1W3S A;  5K36 H;  4DNT B;  2NVX H;  2D5D A;  2EYL A;  2GA4 B;  4DR3 Q;  1NE3 A;  5I6W A;  1T9H A;  2JA6 G;  5CR3 A;  3ZJY C;  1E22 A;  1RD9 D;  1LTB D;  1SNO A;  3U4Z A;  3TZD A;  1Q8I A;  5EKL A;  4X65 L;  2I46 A;  2FXQ A;  2N3S A;  4P72 A;  2XRQ D;  3PO2 H;  3S15 B;  2GVB A;  4A76 A;  3S1R H;  2UU9 Q;  1SYG A;  3J7A F;  4WOR A;  1HNW L;  3HS0 C;  2RSO A;  3CCE A;  1G29 1;  1E1T A;  4KJO A;  3GTM B;  1Y8P B;  3K5L A;  1WTH A;  4XTC S;  4EGV A;  2RVL A;  2MQH A;  2JA9 A;  4HCE A;  2N55 A;  4QUF A;  2Z9H A;  4KKS A;  2MHV A;  1JOR A;  1O7Y A;  3K7U C;  3VR4 A;  2Y0S B;  4LW1 A;  5C4X G;  3H09 A;  4JI3 Q;  5IYC G;  1PH4 A;  4QGU A;  4LAA A;  2Q8T A;  3TS2 A;  2CVR A;  4U67 3;  1SYD A;  4XDX A;  2OT2 A;  1HZ9 A;  1VQD A;  3PQI A;  1RDP D;  1P16 A;  1BNZ A;  1BVS A;  2Q2H A;  5EJW A;  3URY A;  1ICF B;  3HRZ C;  5I9P A;  4KN7 C;  1YIJ A;  1EL0 A;  1PZJ D;  5D65 A;  4DV6 Q;  2KVM A;  1UE7 A;  4DV4 Q;  1F2Y A;  1PLF A;  1PH7 A;  4R4T A;  5IYD H;  5KGU A;  1TII D;  4IAL A;  4YY3 L;  2XTI A;  3RUZ A;  5AJ3 L;  5M3F B;  1PFM A;  2Q2U A;  4JBM A;  1RHP A;  3E9H A;  3ERQ A;  2HCI A;  3MXU A;  1L1O C;  4A3I H;  1JOO A;  1GUN A;  3STB D;  1K83 H;  1X3Q A;  3GTO B;  1MJE A;  1EYC A;  2FMM A;  3R8B A;  1MJC A;  2L12 A;  4OWX B;  4LFC Q;  1MSH A;  2MUY A;  2JEB I;  2XIW A;  3QB3 A;  3STB C;  1FL0 A;  1KAW A;  1ILP A;  5COR A;  2R7D A;  3CMA A;  1V1P A;  3W3A A;  3HGB A;  1PYS B;  2F0O A;  3LWU A;  4OHJ A;  4G57 A;  1A3U A;  4XQQ A;  2AHO B;  2JA7 H;  1K73 C;  1ML0 D;  5T1G A;  1L1O B;  3GTJ H;  2PQE A;  1S5F D;  2B2T C;  2M9V A;  1G51 A;  4BBS G;  1IBL Q;  1SEB D;  2B2U C;  1A62 A;  1HRJ A;  2ZTD A;  4X66 L;  3AEV A;  3HKS A;  1I3Q B;  5FJ8 H;  2CH4 A;  1SE4 A;  3K7A B;  1KIX A;  5M5X B;  4OL7 A;  4TRD A;  5HY6 A;  4DNR B;  1EEI D;  1HQR D;  3FMC A;  5CV5 A;  3EQL C;  1LTT D;  3GTL H;  1ESF A;  5CV8 A;  4P71 A;  4QCL A;  5A2Q L;  4KY6 A;  5KIX A;  3TP8 A;  5IGE A;  1LAC A;  4OIJ A;  1CTM A;  1H9S A;  2LFN A;  4X65 Q;  4KHP L;  3P1H A;  1MIU A;  3X3N A;  2IL8 A;  2H1E A;  4ILW A;  1WTV A;  4FP5 D;  1TR5 A;  1C4Q A;  2PZT A;  1N9W A;  2A1A A;  3SDZ A;  3CXC A;  3GTP H;  5M5Y H;  4POF A;  1B9M A;  1SYF A;  4Y7N H;  3PUY A;  1WTQ A;  2K5D A;  2WAQ G;  3I56 A;  3HOU B;  4BY7 B;  5BN5 A;  4PMB A;  4GKJ Q;  3J80 L;  3UDI A;  2WIN B;  4NXN L;  4KJN A;  1WTP A;  4DAM A;  2EYF A;  5IGD A;  3I4O A;  5ISR A;  4DV2 L;  1EY5 A;  1GM5 A;  1ASZ A;  3KLR A;  2ZTC A;  4RKL A;  1RJT A;  5I6Y A;  4ME5 A;  2VB2 X;  4IUR A;  2WP8 J;  4EX5 A;  3EFX D;  3JAM L;  1T5X D;  3ZYY X;  1BKB A;  4RGN A;  1JJC B;  4JBJ A;  2H5X A;  2QDB A;  1XNR Q;  3H94 A;  2VW9 A;  4X3U A;  2ATW A;  1B9N A;  4XT3 B;  4IPH A;  3KOJ A;  4QJF A;  4H7B A;  4LF9 L;  1IW7 D;  5JEA G;  1K9M C;  1K0R A;  1WTW A;  2UUA Q;  2EY1 A;  5COY A;  2DY8 A;  1X56 A;  1IW7 C;  3HOX B;  4ABN A;  4DV5 Q;  3DWA A;  4LNQ A;  4DA2 A;  3H3V C;  3K59 A;  1PFB A;  2O2L D;  4IJL A;  3T16 A;  4ZK9 B;  1WJJ A;  4DV0 Q;  2EE1 A;  3M4O B;  2ICI A;  2WB1 E;  4A3G G;  1WCM B;  2F52 A;  5AJ3 Q;  4IFD G;  4ODG A;  1EU3 A;  2Q8R E;  3RZD H;  2L0C A;  1N32 Q;  3W5O A;  3UE1 A;  2R92 B;  3QJY A;  4R1J A;  2PCF B;  4AQY L;  2B2W C;  4LF7 L;  2F0K A;  1B8A A;  2KJX A;  1VQO A;  1WD1 A;  3TRZ A;  2F3V A;  1XPO A;  5IYB G;  2A5H A;  4IUN A;  2E2J H;  3OTO Q;  1X3F A;  2B63 G;  1HPC A;  2CWA A;  2HHH L;  3F2B A;  4LUZ A;  3F8T A;  4JI6 Q;  5M3M H;  4C3I G;  5TSS A;  4IUP A;  4KD4 A;  5ELF A;  3M7N A;  2EJG C;  2BA0 A;  5C3E B;  4CHT B;  1Z7T A;  2L1B A;  4MTK A;  3A8I E;  2UUB Q;  1B70 B;  4PZ6 A;  4KY5 A;  3CD6 A;  3BDL A;  2NVT B;  4DR2 L;  1NR4 A;  5J39 A;  2O5I C;  2KA7 A;  1LT6 D;  1H9J A;  3UE0 A;  4ZRZ A;  3F2C A;  1GOZ A;  3UI2 A;  3EIV A;  4XXE A;  4HR7 B;  1TQO A;  2WAQ B;  4HID A;  2K5N A;  1GUT A;  2K32 A;  2OEO A;  1EY0 A;  2QCP X;  2N88 A;  4C3J G;  3CCV A;  1HR0 L;  3HP3 A;  1Z9F A;  1S5B D;  4QIW B;  2JK8 A;  1AEX A;  5LMU L;  2L11 A;  4O1N A;  4AH6 A;  1MI2 A;  1F9P A;  2LS0 1;  4JBK A;  4WJW A;  5IP9 G;  4KHP Q;  1UEB A;  1J9O A;  1Y1V B;  3QOL A;  2QF7 A;  3CQZ B;  2X6G A;  2QEJ C;  4YWM A;  1STH A;  4CJ2 C;  2RHQ B;  4TVA B;  1FJG L;  4FVM A;  1F2L A;  4GN4 B;  4I7Z C;  3A7L A;  2I07 B;  4HJ9 A;  4QY7 A;  3R2I A;  4DK6 C;  2AWO A;  3EBE A;  2VUM B;  4O2D A;  4BWG B;  1EY9 A;  4LFB Q;  1XTD A;  2PZW A;  1V1P B;  3BS1 A;  1WTX A;  3HOZ H;  2LMC B;  3V2T A;  5IYC H;  1KTK A;  4DV2 Q;  3HKZ B;  1Y1W H;  5ELC A;  1NMG A;  2RF4 A;  2HD3 A;  5EKK A;  1J5E Q;  1VQN A;  3I4M G;  2VS1 A;  1CHP D;  1I6H B;  1EOV A;  1HZB A;  4GOP A;  4JV5 Q;  4A3E H;  3NQI A;  2JXM B;  4P73 A;  2DNC A;  1TKW B;  1SJE D;  2P5Z X;  4G7H C;  2R7Z H;  1SE3 A;  2K75 A;  4Q5V A;  1DM0 B;  1DOK A;  4DXF A;  3CPF A;  3T56 B;  4K5V A;  5IWA Q;  4A3L H;  5IE8 A;  4DUZ L;  1HHV A;  4DPG A;  1CZW A;  5ELO A;  3S17 B;  4JVZ A;  3ERS X;  1HA6 A;  4HIM A;  1GO3 E;  1DGS A;  3C1F A;  1O80 A;  3C3L A;  5C5M A;  1CA6 A;  4A3D H;  4IOA A;  4G7O C;  1PYB A;  1EWH A;  1KNE A;  3OIP A;  3T1H Q;  4LK1 C;  1H9S B;  1A0I A;  1VF5 C;  5HUR A;  3PIP A;  1KD1 C;  2D62 A;  3OWF A;  4RCN A;  1I94 L;  4B3T L;  3TQY A;  4OWW B;  3KK7 A;  4PV1 C;  1O7I A;  4JOI A;  3I91 A;  4K6L A;  4BA1 I;  1NAP A;  5CV6 A;  3M85 A;  4JI4 Q;  4LF7 Q;  3SK8 A;  2NZO A;  3S2D B;  1L0X B;  1JOK A;  2K01 A;  1SRU A;  1FD7 D;  2NTT A;  2EY2 A;  1C8C A;  4BXX H;  1EZ6 A;  1BO0 A;  3I90 A;  3IL8 A;  3K5O A;  1YHA A;  1HR0 W;  2F0W A;  1TWF B;  1S5D D;  4C3J B;  5ELN A;  2G9D A;  3KYH C;  1H95 A;  1UE6 A;  4PQX A;  4EQP A;  3WWV A;  4DV1 L;  2E2I H;  3I4N G;  3BJU A;  4K2K A;  4B3M Q;  2K5H A;  2D0P A;  2PZU A;  1XWE A;  3PF4 A;  4C3H H;  2QGQ A;  3DM3 A;  3RLO A;  3NWS A;  2EJM A;  3J81 E;  3M3Y H;  4A3M G;  1QVC A;  3OHX C;  3A5U A;  2A6H D;  3PV0 A;  2PNH A;  3EVQ A;  5FO8 B;  4UP8 A;  2DUD A;  5F2D A;  4LF4 Q;  5E4X A;  3GDE A;  3TRE A;  4DR4 Q;  4CKC A;  1B50 A;  2A6H C;  3PGZ A;  4RCO A;  2M00 A;  3NTH A;  4DR3 L;  2HT1 A;  2RDF A;  2K28 A;  1AW7 A;  2OCE A;  2AMC B;  1RTN A;  5CBE E;  4K6D A;  1N36 Q;  3OSO A;  4RHR A;  1VCI A;  1PH5 A;  3A7A B;  2HQE A;  2JYO A;  3GTQ B;  2IWH A;  1IZ6 A;  4L5R C;  3S1R B;  1STB A;  3MEF A;  5JEA J;  1FJG Q;  4JI7 Q;  1YIT A;  1B2T A;  1DD2 A;  1EFW A;  1TWA B;  4N9P A;  2UU9 L;  1EY4 A;  1DZ1 A;  4KK7 A;  3C2P A;  4AYB E;  3TZU A;  5BR8 L;  2BDO A;  4H13 C;  1B3A A;  3OIQ A;  1ZYR D;  2NN6 G;  2WAC A;  1HZC A;  1SLJ A;  2FJ2 A;  1C48 A;  2HQL A;  4IFD J;  1HFN A;  4PMC A;  2AWN A;  1ZYR C;  1GUS A;  1VDZ A;  2A68 D;  2N78 A;  4JI3 L;  4B3R Q;  2AQ2 B;  2NZH A;  3G71 A;  3Q23 A;  5D3I B;  2Z4H A;  1LTA D;  1TWH B;  1XNQ Q;  3S1Q H;  2ZJQ A;  5EQ0 A;  4YWL A;  4LUV A;  4WJ3 M;  5ELD A;  2KEE A;  1XX8 A;  2J7Z A;  5BN3 A;  3BVZ A;  2JA5 B;  2CH4 W;  2JJQ A;  3K5N A;  1F77 A;  3HKZ E;  3G7L A;  2F0Q A;  2PPB C;  1OXU A;  4NB3 A;  4DV6 L;  3VR5 A;  2OTJ A;  4ZUJ A;  5C4J H;  1SFO B;  3FPP A;  1JB3 A;  3I73 A;  2H4O A;  2K4K A;  2FHT A;  3SXH A;  4ZKB B;  2L55 A;  4R4Q A;  1WVL A;  2NZ1 D;  2Y0S G;  3L9A X;  1TT2 A;  1EFI D;  3R3O A;  4I7A A;  3I3C A;  3CP0 A;  3J81 i;  4A3I B;  4GOP C;  2V1C C;  2B2T A;  3U58 A;  3TN2 A;  4A3M B;  1OO9 B;  3J80 c;  1SN8 A;  2B2U A;  2WB1 G;  2E75 C;  5I4D A;  1PFS A;  2KHS A;  4DV3 Q;  4NKL A;  5DAU A;  1EQT A;  1IKL A;  2KCC A;  2B8G A;  5CV7 A;  1K3B C;  4LFC L;  1HJP A;  4KI0 A;  2M2L A;  1WYD A;  4C3I H;  4FNF A;  2J0T D;  1STE A;  2L5T A;  3JAM c;  1VQM A;  3HOW B;  4WJ4 A;  3GV3 A;  1SAP A;  3T53 B;  1R9T H;  2OF1 A;  1Y8N B;  1GUO A;  2WV6 D;  3WOF A;  4HJ8 A;  1PH9 A;  4MHE A;  2BCO A;  1I4X A;  2JP1 A;  3JC6 6;  2BA1 A;  5M3F G;  4IOC A;  4GOP B;  2E8G A;  1PTO B;  1SYC A;  1B4O A;  2B29 A;  2YU9 H;  5JPM C;  2Q8I B;  1PFN A;  3SVM A;  3L3O C;  4JOI C;  3E9I A;  4DU9 A;  1IBL L;  4DUY Q;  4KTA A;  3PMF A;  1B1Z A;  1BDO A;  1PRT D;  3DM1 A;  1NBW A;  4LWC A;  3RLF A;  5KRU A;  1YJ9 A;  5CYU A;  4JI5 Q;  4AIM A;  2ZJP A;  2F0H A;  2CQO A;  3E0J A;  3KF6 B;  1E2W A;  1GJX A;  4DAP A;  1PRT C;  1KAA A;  4RWS C;  5G3L F;  2FIN B;  3I55 A;  1XMO Q;  1PDQ A;  2E5L Q;  3H6M A;  5E7N A;  3FKI G;  5IP7 H;  2ASB A;  1QE6 A;  1TWC B;  5IGC A;  4X62 Q;  3GTP B;  2F0I A;  4N9T A;  3V05 A;  4QUC A;  5M5Y B;  2JA8 H;  3MZ5 A;  2QW7 A;  1IBK Q;  1VQ7 A;  3CRL C;  2B2V C;  1WI5 A;  1VS0 A;  5BR8 Q;  4J1M A;  2BDN A;  2IHF A;  4JPB W;  1ZXT A;  1K28 A;  1PRT B;  4GKJ L;  3NQT A;  3T4A C;  1PRT F;  2EYJ A;  3VYS A;  1AZP A;  3MXG A;  2R93 B;  2BH2 A;  2XWJ B;  3GQB A;  1B3Q A;  4BY1 H;  4GKK Q;  4PZ8 A;  3NTI A;  1EY6 A;  4LF8 L;  2AQ3 B;  4NPS A;  5FLX L;  1HNZ Q;  2EXZ A;  1VQ8 A;  3K0X A;  5EGT A;  4LUO A;  1WTR A;  3KFU A;  4CKE A;  1UNS A;  4JI8 Q;  1DJR D;  1XNR L;  2B2Y C;  1PA6 A;  2B2W A;  1CQF A;  1E1O A;  1D5M C;  1HH2 P;  2WB1 B;  1SE2 A;  3A5Z B;  1A3V A;  3L0O A;  4A3K H;  3HOU G;  4BY7 G;  2UUA L;  2ZTE A;  1D8L A;  3CC2 A;  5C44 H;  4DV5 L;  1LT5 D;  3ULL A;  3S16 H;  1QWY A;  1XMQ Q;  3D8G A;  4DV0 L;  1DOM A;  3SK4 A;  3HEJ A;  1V43 A;  1VQE A;  5JVH 3;  1D1I A;  3NE5 B;  3N6R A;  4A3B B;  5JJK A;  2UXD L;  1NJI C;  5JJZ A;  4V19 0;  2RBM A;  3NHH A;  1N32 L;  4A3J G;  4N8F A;  1EOT A;  1TWG B;  3NEL A;  3CRK C;  2VZA A;  5CV9 A;  1I4Q A;  1JWM D;  4RGM A;  2E2J B;  2F0J A;  3Q0A A;  5C0X G;  2RCN A;  4DV7 Q;  1CKN A;  3ICE A;  5IY0 A;  3OTO L;  5M3M B;  3S2H B;  4C2M B;  2PI2 E;  2R61 A;  5IT9 c;  2DN8 A;  2SEB D;  1PVO A;  3RR5 A;  3HOX G;  1E3P A;  4JYA Q;  5C4Z A;  2XWB B;  4YIJ A;  4JI6 L;  5DNF A;  1LLR D;  3S24 A;  3FKI B;  3TP7 A;  3PUW A;  2BH8 A;  3PO3 H;  1WCM G;  3M4P A;  1PZK D;  2OTL A;  2UUB L;  4KN4 C;  1QJO A;  1F9S A;  1PV4 A;  2FMC A;  3H0G H;  2R92 G;  3MFY A;  2L4N A;  1CQV A;  3A55 A;  4R8N A;  4DR6 Q;  1VQC A;  3KLS X;  4GS3 A;  2IY5 B;  1VQP A;  3J81 j;  3CW2 C;  2K50 A;  4JC0 A;  5JJL A;  3HOY G;  1VQH A;  2EY5 A;  4X6A H;  3MXN A;  4YCV A;  3MTS A;  1M8A A;  2ZJR A;  4A3C G;  4R8I A;  4X64 Q;  1IKM A;  1SNP A;  3GTG H;  1Z47 A;  1NUC A;  4RFB A;  3PF5 A;  2ZM6 Q;  5C3E G;  4NP5 A;  5AFW A;  2EYH A;  4OGQ C;  4BBR H;  1HTL D;  1S5E D;  1EU4 A;  2VXW A;  3IKJ A;  1CSQ A;  1YHQ A;  2NVY H;  3O13 A;  4GNX A;  5KYL A;  1E7Z A;  3MC0 B;  4HTH A;  4A3F G;  1SYB A;  1HCZ A;  4ZKC B;  1S3O A;  4RMF A;  1SYE A;  3AB9 A;  4K2L A;  4N8X 1;  3HOZ B;  1JMC A;  3RNU A;  3FDT A;  1RF2 D;  4DAY A;  1T5E A;  4LFB L;  1Y1W B;  4NMZ A;  1YHB A;  1U0L A;  1VQF A;  5BN4 A;  3VR3 A;  1JR0 D;  4LF8 Q;  2KHJ A;  2IT1 A;  1J5E L;  1LYL A;  3FRP B;  1SNQ A;  3S15 H;  1Y1V G;  3LX0 A;  4JV5 L;  3UDG A;  2E2H B;  2R7Z B;  4CDD C;  1UE5 A;  1I4R A;  4R4I A;  1ENA A;  4HIO A;  4A3J B;  4UHV A;  3DLL A;  1NCV A;  1I6V C;  3TBI B;  2AUK A;  1G6Z A;  1YNJ D;  2L15 A;  3A56 A;  2OWO A;  5C3X A;  3HOV H;  2NVQ H;  1FGU A;  2ENB A;  3NEM A;  3L2P A;  1BCP D;  3K8A A;  1B7Y B;  4APV A;  5IWA L;  2VUM G;  1LTI D;  1YNJ C;  4OEM B;  3U4V A;  1SE8 A;  4G7Z C;  3FHW A;  1NTG A;  5GQO A;  1STA A;  3KBX A;  1RIP A;  2XGT A;  1BCP C;  5FKA C;  1LTR D;  3HKZ G;  1KDC A;  1JQY D;  1OXV A;  3KLS A;  4DKA C;  1I5F A;  1ET6 A;  3P75 A;  3T1H L;  1MHW C;  2UXD Q;  1L2F A;  4XQN A;  1S72 A;  1KNA A;  1YJW A;  3R2T A;  4JW0 A;  4JI1 Q;  2OQK A;  3MAQ A;  3GTK B;  4JI4 L;  1U9R A;  3AFP A;  5D3D A;  3DWQ A;  3WDN A;  4F7X A;  3HOY B;  3U9S A;  1U4L A;  5M5W H;  3CCR A;  3TEH B;  1U4M A;  3LGJ A;  1BCP B;  1BCP F;  3S1N B;  2EZV A;  4ZCK A;  3DXJ C;  2VQF Q;  5KYI A;  4LF5 L;  4K5X A;  2RDH A;  2B39 A;  3L7Z C;  4L8J A;  1QCB D;  4KKU A;  5C5L A;  4U68 A;  4EQ5 A;  1Q90 A;  5M9O A;  3M3Y B;  4L63 B;  2LXK A;  4B3M L;  1H9K A;  4S3S A;  3GTO H;  1UWV A;  4X3T A;  2IX0 A;  4JCV E;  2O4X A;  3NBH A;  3C46 A;  4A3F B;  1DXM A;  5C0X I;  4LF4 L;  4DR4 L;  3VYT A;  2JA6 H;  4G4K A;  3J81 L;  1VQ6 A;  2NUC A;  5CGK A;  1BF4 A;  1OXX K;  2OQ0 A;  2HDM A;  4K8J A;  1B44 D;  2MPM A;  4IPG A;  3PCO B;  4FXD A;  4RGT A;  3DWP A;  5JPN C;  1JIC A;  1N36 L;  4AYB B; 
#chains in the Genus database with same CATH homology
 1EYA A;  1QB5 D;  1ENF A;  1MD2 D;  1IYU A;  5ELE A;  3SK5 A;  1UAP A;  4B9W A;  4KHV A;  4P2C B;  2RA4 A;  4XQJ A;  2WII B;  2C9O A;  4DK1 A;  5K36 G;  4XYQ A;  3J7A V;  1EQV A;  1G8Z D;  4ZUI A;  2IX1 A;  1LV9 A;  1Q12 A;  3FEW X;  1B53 A;  3HG9 A;  2TSS A;  4PMW A;  2IJ0 A;  5FO9 B;  2CHB D;  5LHY 1;  5C0X J;  1BXT A;  3GO5 A;  1YNN D;  3FVQ A;  4C1N K;  1II3 A;  3J7Y W;  5KEE A;  1O7L A;  1YNN C;  5C4J B;  2DY7 A;  4ZLT F;  1MSG A;  2K5Q A;  2F0D A;  4ZAI A;  5KNC A;  3RZO B;  3KF8 A;  4HSP A;  3S14 B;  3E6Z X;  2R3Z A;  3WOE A;  1O7Z A;  1ZKO A;  1PMR A;  4DGZ A;  1G91 A;  4HSV A;  1JOQ A;  3DUZ A;  3QO2 A;  1WTO A;  4IZ8 A;  3BG3 A;  3HZX A;  1TS3 A;  2F0G A;  3MXP A;  3W2D A;  3PIO 3;  1HFG A;  3S1M B;  1RKN A;  3DMU A;  4FF1 A;  1ILQ A;  4IFD I;  4A93 B;  3BYY B;  4K14 A;  2NB0 A;  3EA6 A;  2KED A;  3X3M A;  3H91 A;  5IIF A;  1DOL A;  5JAV A;  1HA5 A;  2NVX B;  1EY7 A;  2B2V A;  3ONA B;  2NTS A;  2A6E D;  3AMU A;  1LO5 D;  2F1M A;  4IN3 A;  1E0B A;  3IFD A;  5FK9 C;  2A6E C;  2XRS D;  2EJF C;  5EPK A;  1HUN A;  4BS9 A;  3I4L A;  1JE4 A;  3PUX A;  1CA5 A;  3PO2 B;  2JA8 B;  5EPJ A;  2B2Y A;  1QNK A;  4HN7 A;  3NSW A;  3A8K E;  2Z4I A;  3OPO A;  1GUW A;  4HMI A;  3TDQ A;  1LAB A;  4EQN A;  4BA2 I;  4IUT A;  3GP7 A;  4CBV A;  3E5S A;  3OWE B;  4UAI A;  2VNU D;  1D5X C;  3BZD B;  2K7V A;  4RKB A;  1JWS D;  4ID6 A;  1KDA A;  5JEA H;  5IT9 E;  3S9W A;  2OXP A;  1IHZ A;  4JBW A;  2SOB A;  4ULL A;  1TS2 A;  2EYO A;  5K5P A;  2K04 A;  1LTS D;  3Q6S A;  4C1N I;  3S16 B;  1EIH A;  4IFD H;  4DN4 M;  1TU2 B;  2EOT A;  1EEF D;  5IOD A;  4F88 A;  1K83 B;  1HUM A;  3DEP A;  4IUU A;  4NW2 A;  5E3F A;  1JC7 A;  5G3L D;  3BDO A;  4FXK C;  2A73 B;  1TS5 A;  3PO3 B;  2JA7 B;  3RMH A;  4FF3 A;  1J8I A;  1HTP A;  3GTJ B;  1OXT A;  1U4P A;  3H0G B;  4DAV A;  4XT1 B;  1A6X A;  4H0L C;  2F0L A;  4F87 A;  4KY7 A;  3NXW A;  1U4R A;  3IAY A;  3GTL B;  2HDL A;  1QNU A;  3GD7 A;  1OXS C;  4RA8 A;  1KLG D;  4BBR B;  1GHK A;  1A2U A;  1E2Z A;  5DEH A;  3Q24 A;  1D2B A;  2NVY B;  1F2Z A;  3G6J B;  3D6C A;  4QMG A;  4Y7N B;  1KAB A;  1IYV A;  5LL6 X;  2WKC A;  3MHB A;  5EPL A;  5EKI A;  3QWN A;  3P7J A;  4CGY B;  3NBI A;  3PUZ A;  5C6A A;  3SE0 A;  3HOV B;  2NVQ B;  2K6A A;  3GV6 A;  4LJZ C;  2SDF A;  4JK1 C;  3TME A;  2XN9 C;  2F0F A;  1G2T A;  3D31 A;  4CJ1 B;  2NN6 I;  4L6T B;  1TY0 A;  2MGS A;  2NWG A;  4K8I A;  3RZD B;  5E4W C;  4WFN 3;  4FF2 A;  3AU7 A;  1QG7 A;  4UDU C;  3FPU B;  2A69 D;  5ELB A;  1V1O A;  2V4D A;  3ND9 A;  1CFM A;  3OMC A;  2F3W A;  3NWT A;  5M5W B;  1FNV A;  1SNC A;  2PW5 A;  2A69 C;  2LY7 A;  5A35 A;  2A74 C;  2KCN A;  1R4Q B;  4PNY A;  1LT3 D;  1A15 A;  4RH6 A;  1EWC A;  1PXU A;  4ZQ3 A;  1EZ8 A;  1PYW D;  3T13 A;  2BE5 D;  1I4H A;  3SR1 A;  3C1E A;  1Q1E A;  2LKV A;  4TQU S;  1FYC A;  2L9H A;  3OW7 A;  2B8F A;  1D1K A;  2BE5 C;  5I2X A;  5KNB A;  3SK6 A;  4B9X A;  2JA6 B;  4FYD A;  1CT1 D;  1Q1B A;  2RKS A;  2MJ8 A;  3D4D A;  3U9O A;  4H44 C;  2XSC A;  3PUV A;  1PZI D;  4FF4 A;  4KHZ A;  1SNM A;  2EPB A;  2JE6 I;  3TSS A;  1PTO H;  4XYO A;  4C3H G;  4C56 C;  4IUQ A;  2WKD A;  2CQA A;  1W6K A;  3K5M A;  3ND8 A;  1GUG A;  1I50 B;  2F0U A;  3VR2 A;  5FOB B;  1K8M A;  2D9U A;  3VR6 A;  1HQM C;  1BUV T;  2AUJ D;  3K6O A;  2IX3 A;  2FFK B;  2NN6 H;  1LTG D;  5C4X B;  2QIL A;  4Z9C B;  3NP8 A;  4M8A A;  1SND A;  1H9R A;  2EYM A;  3NK9 A;  2EVB A;  3CHB D;  2PYK A;  2XNA C;  3TP5 A;  4NDX A;  1FNU A;  2J4X A;  4A3E B;  4KD3 A;  2EY6 A;  3SEB A;  2EDG A;  1V8Q A;  2F0M A;  5FLX E;  2HCC A;  4QB4 A;  1ESR A;  2Z1C A;  4EQO A;  4OO1 G;  1CM9 A;  5JVG 3;  1XXG A;  2E74 C;  2AQ1 B;  4A3D B;  1I4P A;  1SJH D;  3M4Y A;  1BR9 A;  2F0S A;  4QF4 A;  4R9W A;  5IGF A;  2G9H D;  1BOS A;  4DFA A;  2Z8L A;  1VF7 A;  4TSS A;  3D4W A;  3R93 A;  3CKI B;  4XIG S;  1JWU D;  2O5J C;  2F0N A;  3BYT B;  1CI3 M;  1A2T A;  3MVV A;  2E2D C;  2IW3 A;  4DK0 A;  3KUP A;  1CK1 A;  1KDB A;  1STG A;  5IGB A;  2E76 C;  3MFG A;  5EBC A;  2E2I B;  1Q3L A;  4BBS B;  4C3H B;  5CBA E;  2BOS A;  1AN8 A;  2MP1 A;  2D2C C;  1ICW A;  1EIG A;  5C4H A;  4HCS A;  3I70 A;  1D6E C;  1X3P A;  2X69 A;  3TP6 A;  3NUC A;  4FO2 A;  4RAU C;  3IFT A;  3D3R A;  4RGO S;  1ROD A;  5J22 A;  4LMQ D;  4J6H A;  1SXT A;  3QIA A;  1LT4 D;  1W6J A;  3P20 A;  5A2Q E;  1L0Y B;  5DM7 3;  3ERO A;  1UUP A;  2NYZ D;  3N52 A;  2R6G A;  1F2M A;  3I8Z A;  4KKT A;  1O78 A;  1KLU D;  3CU7 A;  2JSO A;  4E6I A;  1BQQ T;  1HXY D;  5HGT A;  1AZQ A;  5EBD A;  4RHS A;  1Z6H A;  2XVS A;  4I65 A;  5CMD A;  3J80 E;  1FNW A;  3S1Q B;  2ZXR A;  4HED A;  2K33 A;  3I72 A;  2EYP A;  4J8Q A;  1FR3 A;  2ID0 A;  4OIK A;  1SMY D;  5FO7 B;  3JAM E;  3OOC A;  4IQZ A;  1MBY A;  1SBB B;  1SDF A;  1ET9 A;  4Q0F A;  1RCV D;  1SMY C;  2RSN A;  2F0P A;  3T51 B;  4A3G B;  4CJ0 B;  5IT9 L;  2KOL A;  3MA2 B;  4ZYS A;  1S5C D;  3DEO A;  2SNM A;  1MGS A;  2ZXP A;  3DHQ A;  1Y69 U;  1EYD A;  1DCZ A;  2K5W A;  3D6W A;  1VMC A;  5C0X H;  2B63 B;  4WRD A;  3BVG A;  5J1Z A;  1R4P B;  2DNE A;  2F0V A;  4OO1 I;  4C3I B;  2SNS A;  2IPK D;  1BBX C;  3A54 A;  1GHJ A;  5I9O A;  4IUV A;  3D4R A;  1R9T B;  2C5C A;  3OMG A;  4HMJ A;  5LL6 S;  3NPP A;  4F8M A;  1FGB D;  5NUC A;  4DXG A;  2YU9 B;  3VA7 A;  1S4Z A;  4KMU C;  1STY A;  1WD0 A;  5C3W A;  1EY8 A;  4MN3 A;  1CZG A;  4V0B A;  3PIP 3;  3KBG A;  4HAE A;  1A3T A;  3QG1 A;  1TY2 A;  5IOC A;  1JCK B;  1DON A;  4EVO A;  3EJI A;  3M7G A;  1K8O A;  2JEA I;  1CHQ D;  1X32 A;  5IGG A;  1AFP A;  3I4M B;  1QOH A;  4GZY C;  3SHL A;  3NTK A;  4BY1 B;  2VB3 X;  4B08 A;  3VA5 A;  2RDG A;  3K57 A;  2K05 A;  1XTC D;  2ZXO A;  4FXG C;  2YYZ A;  3BVM A;  1D5Z C;  1STN A;  4OO1 H;  4DF7 A;  2K03 A;  2X6L A;  5JOB A;  5DM6 3;  4A3K B;  3RD4 A;  1VMP A;  2F0T A;  2K1B A;  3LNN A;  5C44 B;  3K58 A;  1RTO A;  3MWY W;  2ZT9 C;  1TS4 A;  1NSN S;  5D14 A;  2A68 C;  5E1F A;  3MEH A;  1Y8O B;  5I2Y A;  2RQX A;  4O42 A;  1IL8 A;  4K5W A;  4MIU A;  2QKI C;  1DYQ A;  1AP0 A;  2CW0 D;  2TMP A;  1XYI A;  1ONL A;  1PTO D;  2CW0 C;  2F4I A;  3I4N B;  1UEA B;  4X3K A;  3BDC A;  3F2U A;  2F0E A;  2PNR C;  1NR2 A;  5CC4 A;  2PO4 A;  1PTO C;  1SSO A;  1QIL A;  3VYR A;  3QOJ A;  1F9R A;  3LWE A;  2NBF A;  4CKB A;  4M1U B;  4X3S A;  4KV6 A;  3V96 A;  1ZEQ X;  1GXD C;  2KEC A;  2PMZ B;  5T1I A;  1TVX A;  4TKO B;  1H9M A;  1E2V A;  3K0Y A;  1F9Q A;  2KUM A;  3GTG B;  2F03 A;  5CV4 A;  1PTO F;  1G2S A;  2ICE C;  3Q22 A;  2KQ3 A;  3VYU A;  5KND A;  3ITP A;  2HUG A;  1M4V A;  1I4G A;  2PW7 A;  3A8J E;  1ENC A;  5K36 H;  4DNT B;  2D5D A;  2EYL A;  2GA4 B;  5I6W A;  5CR3 A;  1RD9 D;  1LTB D;  1SNO A;  3TZD A;  1Q8I A;  5EKL A;  2I46 A;  2XRQ D;  3S15 B;  1SYG A;  3J7A F;  4WOR A;  3HS0 C;  2RSO A;  1G29 1;  4KJO A;  3GTM B;  1Y8P B;  3K5L A;  4XTC S;  4EGV A;  2RVL A;  4HCE A;  2N55 A;  4QUF A;  4KKS A;  2MHV A;  1JOR A;  1O7Y A;  3VR4 A;  2Y0S B;  3H09 A;  4LAA A;  2Q8T A;  2CVR A;  4U67 3;  1SYD A;  4XDX A;  2OT2 A;  1RDP D;  1BNZ A;  5EJW A;  3URY A;  3HRZ C;  5I9P A;  4KN7 C;  1EL0 A;  1PZJ D;  5D65 A;  2KVM A;  1F2Y A;  1PLF A;  5KGU A;  1TII D;  4IAL A;  3RUZ A;  5M3F B;  1PFM A;  1RHP A;  3ERQ A;  2HCI A;  3MXU A;  1JOO A;  1GUN A;  1X3Q A;  3GTO B;  1EYC A;  2FMM A;  3R8B A;  2L12 A;  1MSH A;  2MUY A;  2JEB I;  2XIW A;  3QB3 A;  1ILP A;  5COR A;  1V1P A;  3W3A A;  3HGB A;  2F0O A;  3LWU A;  4OHJ A;  4G57 A;  1A3U A;  4XQQ A;  1ML0 D;  5T1G A;  2PQE A;  1S5F D;  2B2T C;  2M9V A;  1SEB D;  2B2U C;  1HRJ A;  1I3Q B;  1SE4 A;  3K7A B;  5M5X B;  4OL7 A;  4TRD A;  4DNR B;  1EEI D;  1HQR D;  3FMC A;  5CV5 A;  3EQL C;  1LTT D;  1ESF A;  5CV8 A;  4QCL A;  5A2Q L;  4KY6 A;  5KIX A;  3TP8 A;  5IGE A;  1LAC A;  4OIJ A;  1CTM A;  1H9S A;  2LFN A;  3P1H A;  3X3N A;  2IL8 A;  2H1E A;  4ILW A;  1WTV A;  4FP5 D;  1TR5 A;  1C4Q A;  2PZT A;  3SDZ A;  1B9M A;  1SYF A;  3PUY A;  1WTQ A;  2K5D A;  3HOU B;  4BY7 B;  5BN5 A;  4PMB A;  3J80 L;  2WIN B;  1WTP A;  4KJN A;  2EYF A;  5IGD A;  5ISR A;  1EY5 A;  3KLR A;  4RKL A;  1RJT A;  5I6Y A;  4ME5 A;  2VB2 X;  4IUR A;  2WP8 J;  3EFX D;  3JAM L;  1T5X D;  3ZYY X;  4RGN A;  2QDB A;  3H94 A;  4X3U A;  1B9N A;  4XT3 B;  4H7B A;  1IW7 D;  5JEA G;  1WTW A;  2EY1 A;  5COY A;  2DY8 A;  1IW7 C;  3HOX B;  4ABN A;  3DWA A;  4DA2 A;  3H3V C;  3K59 A;  1PFB A;  2O2L D;  4ZK9 B;  3T16 A;  2EE1 A;  3M4O B;  2ICI A;  1WCM B;  4IFD G;  4ODG A;  1EU3 A;  2Q8R E;  2L0C A;  2R92 B;  3QJY A;  2PCF B;  2B2W C;  2F0K A;  2KJX A;  1WD1 A;  2F3V A;  2A5H A;  4IUN A;  1HPC A;  4C3I G;  5TSS A;  4IUP A;  4KD4 A;  5ELF A;  3M7N A;  2EJG C;  2BA0 A;  5C3E B;  4CHT B;  1Z7T A;  2L1B A;  3A8I E;  4KY5 A;  3BDL A;  2NVT B;  1NR4 A;  5J39 A;  2O5I C;  2KA7 A;  1LT6 D;  1H9J A;  4ZRZ A;  1GOZ A;  3UI2 A;  4XXE A;  4HR7 B;  1TQO A;  2WAQ B;  1GUT A;  2K32 A;  2OEO A;  1EY0 A;  2QCP X;  2N88 A;  4C3J G;  3HP3 A;  1S5B D;  4QIW B;  1AEX A;  2L11 A;  4O1N A;  1MI2 A;  1F9P A;  2LS0 1;  4WJW A;  1J9O A;  1Y1V B;  3QOL A;  2QF7 A;  3CQZ B;  2X6G A;  2QEJ C;  1STH A;  4CJ2 C;  4FVM A;  1F2L A;  4I7Z C;  3A7L A;  2I07 B;  3R2I A;  2AWO A;  2VUM B;  4BWG B;  1EY9 A;  2PZW A;  1V1P B;  3BS1 A;  1WTX A;  2LMC B;  3V2T A;  1KTK A;  3HKZ B;  5ELC A;  5EKK A;  1CHP D;  1I6H B;  3NQI A;  2JXM B;  2DNC A;  1TKW B;  1SJE D;  4G7H C;  1SE3 A;  4Q5V A;  1DM0 B;  1DOK A;  4DXF A;  3T56 B;  4K5V A;  1HHV A;  1CZW A;  3S17 B;  1HA6 A;  3C1F A;  1O80 A;  3C3L A;  5C5M A;  1CA6 A;  4G7O C;  1EWH A;  1KNE A;  3OIP A;  4LK1 C;  1H9S B;  1VF5 C;  5HUR A;  2D62 A;  3OWF A;  4RCN A;  3KK7 A;  4PV1 C;  4BA1 I;  3I91 A;  4K6L A;  3M85 A;  1NAP A;  5CV6 A;  3SK8 A;  3S2D B;  1L0X B;  1JOK A;  2K01 A;  1FD7 D;  2NTT A;  2EY2 A;  1C8C A;  1EZ6 A;  1BO0 A;  3I90 A;  3IL8 A;  3K5O A;  2F0W A;  1TWF B;  1S5D D;  4C3J B;  2G9D A;  4PQX A;  4EQP A;  4K2K A;  2PZU A;  1XWE A;  3NWS A;  2EJM A;  3J81 E;  3OHX C;  2A6H D;  3PV0 A;  3EVQ A;  5FO8 B;  5F2D A;  5E4X A;  4CKC A;  1B50 A;  2A6H C;  4RCO A;  2M00 A;  3NTH A;  2RDF A;  2K28 A;  1AW7 A;  1RTN A;  5CBE E;  4K6D A;  3OSO A;  4RHR A;  1VCI A;  3A7A B;  2HQE A;  2JYO A;  3GTQ B;  2IWH A;  3S1R B;  1STB A;  5JEA J;  1B2T A;  1DD2 A;  1TWA B;  4N9P A;  1EY4 A;  1DZ1 A;  4KK7 A;  3C2P A;  3TZU A;  2BDO A;  4H13 C;  1B3A A;  3OIQ A;  1ZYR D;  2NN6 G;  2WAC A;  2FJ2 A;  1C48 A;  4IFD J;  1HFN A;  4PMC A;  2AWN A;  1ZYR C;  1GUS A;  1VDZ A;  2A68 D;  2AQ2 B;  3Q23 A;  5D3I B;  2Z4H A;  1LTA D;  1TWH B;  5EQ0 A;  5ELD A;  2KEE A;  1XX8 A;  2J7Z A;  5BN3 A;  3BVZ A;  2JA5 B;  3K5N A;  1F77 A;  3G7L A;  2F0Q A;  2PPB C;  1OXU A;  3VR5 A;  4ZUJ A;  1SFO B;  3FPP A;  1JB3 A;  3I73 A;  2H4O A;  4ZKB B;  2FHT A;  3SXH A;  2L55 A;  1WVL A;  2NZ1 D;  3L9A X;  1TT2 A;  1EFI D;  3R3O A;  3I3C A;  4A3I B;  2B2T A;  3TN2 A;  4A3M B;  1OO9 B;  2B2U A;  2E75 C;  5I4D A;  2KHS A;  4NKL A;  5DAU A;  1EQT A;  1IKL A;  2KCC A;  2B8G A;  5CV7 A;  4KI0 A;  2M2L A;  4FNF A;  2J0T D;  1STE A;  2L5T A;  3HOW B;  3GV3 A;  1SAP A;  3T53 B;  2OF1 A;  1Y8N B;  1GUO A;  2WV6 D;  3WOF A;  4MHE A;  2BCO A;  1I4X A;  2JP1 A;  2BA1 A;  1PTO B;  1SYC A;  1B4O A;  5JPM C;  2Q8I B;  1PFN A;  3SVM A;  3L3O C;  4DU9 A;  4KTA A;  3PMF A;  1B1Z A;  1BDO A;  1PRT D;  3DM1 A;  3RLF A;  5KRU A;  5CYU A;  2F0H A;  3E0J A;  1E2W A;  1GJX A;  4DAP A;  1PRT C;  1KAA A;  4RWS C;  5G3L F;  2FIN B;  1PDQ A;  3H6M A;  1QE6 A;  1TWC B;  5IGC A;  3GTP B;  2F0I A;  4N9T A;  3V05 A;  4QUC A;  5M5Y B;  3MZ5 A;  3CRL C;  2B2V C;  4J1M A;  2BDN A;  1ZXT A;  1PRT B;  3NQT A;  3T4A C;  1PRT F;  2EYJ A;  3VYS A;  1AZP A;  3MXG A;  2R93 B;  2XWJ B;  3GQB A;  3NTI A;  1EY6 A;  2AQ3 B;  5FLX L;  2EXZ A;  5EGT A;  1WTR A;  4CKE A;  1UNS A;  1DJR D;  2B2Y C;  2B2W A;  1CQF A;  1D5M C;  2WB1 B;  1SE2 A;  1A3V A;  1LT5 D;  1QWY A;  3D8G A;  1DOM A;  3SK4 A;  3HEJ A;  1V43 A;  5JVH 3;  1D1I A;  3NE5 B;  3N6R A;  4A3B B;  5JJZ A;  4V19 0;  2RBM A;  3NHH A;  1EOT A;  1TWG B;  3CRK C;  5CV9 A;  1I4Q A;  1JWM D;  4RGM A;  2E2J B;  2F0J A;  3Q0A A;  5C0X G;  3S2H B;  5M3M B;  4C2M B;  2R61 A;  2DN8 A;  2SEB D;  5C4Z A;  2XWB B;  4YIJ A;  5DNF A;  1LLR D;  3FKI B;  3TP7 A;  3PUW A;  1PZK D;  4KN4 C;  1QJO A;  1F9S A;  2FMC A;  3MFY A;  2L4N A;  1CQV A;  3A55 A;  4R8N A;  3KLS X;  2EY5 A;  3MXN A;  3MTS A;  1M8A A;  4R8I A;  1IKM A;  1SNP A;  1Z47 A;  1NUC A;  4RFB A;  4NP5 A;  5AFW A;  2EYH A;  4OGQ C;  1HTL D;  1S5E D;  1EU4 A;  2VXW A;  3IKJ A;  3O13 A;  5KYL A;  3MC0 B;  4HTH A;  1SYB A;  1HCZ A;  4ZKC B;  1SYE A;  3AB9 A;  4K2L A;  3HOZ B;  3FDT A;  1RF2 D;  4DAY A;  1T5E A;  1Y1W B;  4NMZ A;  5BN4 A;  3VR3 A;  1JR0 D;  2IT1 A;  3FRP B;  1SNQ A;  3LX0 A;  2E2H B;  2R7Z B;  1I4R A;  1ENA A;  4A3J B;  1NCV A;  1I6V C;  3TBI B;  2AUK A;  1G6Z A;  1YNJ D;  3A56 A;  5C3X A;  2ENB A;  1BCP D;  1LTI D;  1YNJ C;  4G7Z C;  1STA A;  3KBX A;  1BCP C;  5FKA C;  1LTR D;  1KDC A;  1JQY D;  1OXV A;  3KLS A;  1ET6 A;  3P75 A;  4XQN A;  1KNA A;  3R2T A;  3MAQ A;  3GTK B;  1U9R A;  5D3D A;  3DWQ A;  3WDN A;  4F7X A;  3HOY B;  3U9S A;  1U4L A;  1U4M A;  1BCP B;  1BCP F;  3S1N B;  2EZV A;  3DXJ C;  5KYI A;  4K5X A;  2RDH A;  2B39 A;  3L7Z C;  4L8J A;  1QCB D;  4KKU A;  5C5L A;  4U68 A;  5M9O A;  1Q90 A;  3M3Y B;  4L63 B;  1H9K A;  4S3S A;  4X3T A;  2IX0 A;  2O4X A;  3NBH A;  3C46 A;  4A3F B;  1DXM A;  5C0X I;  3VYT A;  4G4K A;  3J81 L;  2NUC A;  5CGK A;  1BF4 A;  1OXX K;  2HDM A;  4K8J A;  1B44 D;  2MPM A;  4FXD A;  4RGT A;  3DWP A;  5JPN C;  1JIC A;  4AYB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...