4R8NA

Crystal structure of staphylococcal nuclease variant v23i/v66i/i72v/i92v at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4r8nA00
3S9WA 1U9RA 4KJOA 2EY1A 2EYJA 1EY9A 1IHZA 4DF7A 5IGEA 5CV6A 5KIXA 4HMIA 4KD4A 5IGGA 3E5SA 2F0SA 3PMFA 3TP7A 1EY4A 1RKNA 1A3TA 1EYAA 1SYBA 4K5XA 3SK6A 5IODA 3DMUA 4ZQ3A 2PW7A 5E3FA 2SOBA 1TT2A 4KJNA 2M00A 4DGZA 5I6WA 5C5MA 5KYIA 2F0TA 3NHHA 4I65A 5C4ZA 3NQTA 4J1MA 5HGTA 2NUCA 1EYDA 3DHQA 1SNOA 3OSOA 5KEEA 3MHBA 5KRUA 3D8GA 1KDAA 3TP5A 4PMBA 4RKBA 5C4HA 4DU9A 3P75A 1KAAA 5CC4A 4E6IA 5CV5A 3H6MA 2F3VA 4MIUA 1NSNS 1EZ6A 3OMGA 5J39A 2OF1A 5ISRA 5C5LA 1A2UA 5C3XA 3D4WA 2F3WA 3MEHA 3D4DA 3OMCA 5I9OA 4NKLA 1TQOA 4B9XA 1EY7A 2F0UA 3LX0A 5I6YA 5C6AA 1KDBA 1STAA 5C3WA 4K8IA 2KHSA 5CV8A 4IALA 2EYLA 3HZXA 4NDXA 5CV9A 4EQNA 2ENBA 2F0JA 4IUNA 4K8JA 4NP5A 4WRDA 3P1HA 3QOJA 2F0DA 5EKKA 2F0HA 3VA5A 1A2TA 4KV6A 5DEHA 4K2KA 4ZUJA 2EY2A 2RKSA 1EQVA 1II3A 4N9TA 3SR1A 4HMJA 3OWFA 2F0WA 4R8NA 5J1ZA 3SK8A 1A3VA 3NP8A 2EY6A 4KY7A 4QF4A 2F0NA 5IGCA 2RBMA 2F0QA 4KHVA 2F0KA 1TR5A 3HEJA 3SK4A 2OEOA 5KGUA 5JOBA 2HQEA 1SYDA 1STHA 3EROA 3MXPA 1ENCA 3NXWA 3QB3A 3ERQA 1F2YA 3NK9A 4ZUIA 4EQOA 1EY8A 3TP8A 2F0EA 2EYFA 2SNMA 1EZ8A 4NMZA 2WACA 1NUCA 5DAUA 1F2ZA 3SXHA 4WORA 4DFAA 4EVOA 2PYKA 1STBA 2PZUA 2LKVA 2F0LA 3TP6A 4TRDA 2EYMA 2PW5A 4KY5A 5CV4A 1EY0A 1EY5A 5F2DA 5NUCA 1EY6A 4QB4A 2F0PA 4ODGA 5IGFA 2PZWA 1SYCA 1ENAA 2O4XA 3BDCA 1SNDA 4K6DA 2OXPA 4H7BA 5E1FA 3MVVA 1JOOA 3V2TA 3SK5A 1A3UA 2F0IA 4K2LA 5IIFA 2PZTA 4F7XA 5IOCA 1SNCA 4K14A 1STYA 2RDFA 1STNA 4YIJA 4PMCA 5HURA 3C1FA 4KY6A 3BDLA 2EYOA 3T13A 4PNYA 4N9PA 4OL7A 4ID6A 5J22A 3EJIA 4G57A 3ITPA 5CR3A 3MZ5A 1SNMA 1JOKA 2F0MA 3D6CA 2EXZA 4K5VA 4KTAA 4RKLA 5IGBA 1AEXA 3SHLA 4IZ8A 2F0GA 4J6HA 3TMEA 1JOQA 3EVQA 1JORA 3QOLA 5JAVA 1KDCA 3R3OA 2EYHA 2F0VA 2EYPA 3RUZA 4B9WA 4QMGA 2EY5A 5CV7A 4K5WA 5KYLA 1SNPA 3C1EA 4F8MA 5I9PA 3T16A 1STGA 4HTHA 5EGTA 4S3SA 4EQPA 2F0FA 4ME5A 2PQEA 5CGKA 5IGDA 2F0OA 2KQ3A 2QDBA 4LAAA 1F2MA 1SNQA 1SYFA 2SNSA 3U9OA 3NUCA 4KD3A 5EKLA 5K5PA 1KABA 1SYEA 5M9OA 1SYGA 1EYCA
chains in the Genus database with same CATH superfamily
1Q46A 1ESRA 1EQQA 1AE3A 4BY7G 3KOJA 3I4NH 3TP7A 1EY4A 1XWEA 3A8KE 5E3FA 2H1EA 1LTAD 5GAHC 5A35A 1GVPA 3SEBA 3GTKB 2OCEA 2UXBL 5KEEA 4LWCA 4A3FH 5FLXc 2AUJD 1EOTA 4XQQA 4AQYL 2XIWA 1Z9FA 5M5WB 2GVAA 1IBLQ 4HR7B 1EU4A 1NSNS 4DAVA 2OF1A 2QILA 4C3HH 3G7LA 1SE4A 1S5BD 1VQEA 3NWSA 1A62A 4DK6C 2LXKA 2HDMA 3E3XA 3IL8A 3HOUB 3STBC 3VYSA 1LABA 3I7FA 1DCZA 2F4VL 1HNXL 2EY6A 1IYUA 1JC7A 2UXDQ 2E2IB 2E75C 2AMCB 2RBMA 2G9HD 2I5LX 4A93G 1S40A 3BYTB 1CM9A 1ENCA 3NENA 4DV4Q 4IFDG 3CC4A 5T1GA 4B3RL 3I2ZA 4XQJA 2E2JB 3J80E 2EIFA 4GLAC 1EEFD 5JEAJ 4L63B 2I46A 5DAUA 1VDZA 1B7YB 2WFWA 3GV6A 1KL9A 1DGSA 2EYMA 2VXWA 3KK7A 1YNNC 1EOVA 2PZWA 2EDGA 3EA6A 5AJ3L 4YY3Q 3OHXC 3MVVA 4IPHA 3SK5A 3CMEA 1PFBA 1A15A 2N3SA 3PQIA 4HJAA 2KEEA 2E8GA 1VQFA 3CCEA 1SEBD 1LT6D 4OO1G 3E9IA 3P7JA 1UEAB 3CCVA 2JA9A 2EOTA 5HY6A 2MPMA 3BVGA 1LTID 3FRPB 1TS2A 4K5VA 2JA7G 2LSSA 2UXBQ 1N33L 2QKIC 1QB5D 1PTOC 3MXUA 3VR6A 4AQYQ 4DUYL 3GTPH 1H95A 1SJHD 5C44G 1KLUD 1L1OB 4A3CG 2ATWA 4M1UB 1SR3A 4A3MH 1IYJB 1SSOA 4X6AH 1V1PB 2DN8A 1I5FA 1BUVT 3U9OA 3URYA 2UU9L 3PIO3 1KTKA 4DUZL 2A19A 4LF5L 1CTMA 1LTSD 4HCEA 1U4MA 4X3KA 2SOBA 5IP9G 1UE6A 4OIJA 4DGZA 1HNXQ 3NHHA 2L55A 4KHZA 3DHQA 2YYZA 2WINB 3D8GA 3TS2A 2R93B 2K5WA 1Z7TA 1JT8A 4YWMA 5LMNQ 4A3EG 3NWTA 2D2CC 1A2UA 3BZCA 4FF4A 1MGSA 1JB7A 4LF7L 2AHOB 4BXXH 5A2QL 1V1QA 4RWSC 2R7DA 5AJ3Q 1UNSA 1I4GA 1MBYA 3HOYB 3KUPA 3PO2B 4QUFA 3G4SA 1HCZA 1ZYRC 4A3GH 1N8RC 2B63G 4R8NA 1GD7A 4G7HC 1WVLA 4KY7A 2F0NA 4O2DA 4IUUA 1AZQA 2X6LA 5KGUA 1TVXA 1SYDA 2JSOA 3AFPA 1RD9D 1JE4A 3RD4A 3A74A 1N33Q 1EQTA 2RCFA 4DUYQ 3GTJH 3ND8A 4XDXA 1G2SA 5M5XH 3TP6A 5FLMG 4K6DA 4DUZQ 4H7BA 5DLQE 4LF5Q 3A7LA 1BCPB 3N6RA 1PDQA 4RFBA 4DV6L 5C4JB 2XSCA 2HCIA 3ULPA 1GUNA 4PMCA 4YIJA 4FYDA 4Z9CB 4KY6A 3S2DB 2RQXA 4IOCA 1IKMA 4CKCA 1C7YA 1MSHA 3PUVA 2R7ZH 2XGTA 3X3NA 4G7ZC 3HOUG 1O80A 2F0GA 1JORA 3K81C 4C2MB 5GAGC 3WDNA 5JJZA 4XIGS 2DY8A 2BE5D 1JWSD 2EY5A 5CV7A 4LF6Q 5K36H 2B2UA 4HSPA 4S3SA 2E74C 2KHJA 3FPUB 1SYEA 4LF7Q 4X66L 2WB1E 1QCBD 2Y0SE 1GHKA 5CBAE 3I4NB 1FYCA 1B2TA 2BOSA 5IYBG 2CQOA 1GO3E 4RGNA 4ZLTF 1XPOA 2L11A 3QO2A 2B2UC 2CQAA 4A75A 1AZPA 4J1MA 5DNFA 4M8AA 5M3FH 1I4QA 4KN7C 3L7ZC 4DA2A 3GDEA 1ICFB 5E4XA 2KUMA 3FKIG 2V4DA 2MQHA 2PNRC 2L5TA 1CHPD 2K4KA 3E6ZX 3L2PA 1HA6A 1HFGA 3VR2A 1HA5A 4KKUA 4DAPA 2YTYA 2E76C 1W3SA 5JVG3 3NPPA 1GXDC 3O13A 1GM5A 1PH7A 3T53B 1SROA 3A56A 4JBMA 4UPAA 4IURA 4ZYSA 1A2TA 1Y1WG 5ELEA 4H0LC 4DV6Q 1KAWA 2PQAB 3T1HQ 1I4XA 1GHJA 1NMGA 5M3MH 2VUMG 1BNZA 2OTJA 5IGCA 1XX8A 4DAYB 3I4MH 3PCOB 1DXMA 3QR8A 1G6ZA 2E2DC 3E0EA 5IT9c 2DGYA 1FGUA 3SXHA 2PYKA 4FO2A 2R93G 2Q8RE 3UE0A 3A7AB 1CFMA 1NBWA 1QILA 4GKJL 3MFGA 2PI2A 1S5FD 3G6JB 3AYHB 1I94L 3Q24A 3MC0B 1QZHA 4X64Q 2KCNA 3T13A 3S17H 2I5HA 1QVGA 5A2QE 4RA8A 1DJRD 1SMXA 2B8GA 1D5MC 4QL5A 3HOYG 3A5ZB 3PO2G 1Y69U 1FL0A 5M5YH 2K5NA 3M4OB 4MNOA 4R4OA 3R3OA 4C3IG 2K52A 4BBSH 4Y7NB 3S2HH 1P16A 1R9TB 1Q86C 3TSSA 4JI0L 1HZAA 3PIP3 1BCPF 4UP9A 1PHJA 1TWHH 3GTOB 2F4IA 3BVMA 3HOWH 1OXSC 3S9WA 1QNUA 1GOZA 2B29A 2K14A 1D5ZC 4X3TA 1VQNA 3NTHA 3J81i 3K8AA 2BDNA 1E22A 4LW1A 4KJNA 2YU9H 4FVMA 1XNQQ 2UUAL 1MJCA 4AYBG 5BN5A 4DV5Q 4LF8Q 2HIXA 4TQUS 2SEBD 4DR3L 4IUPA 2R3ZA 2D62A 4WFN3 1GUGA 4YCUA 2AQ2B 5GQOA 5IYDG 2XTIA 4IFDJ 1TU2B 4E6IA 1YHBA 3OIQA 3I56A 1Y8PB 2HT1A 1UAPA 2JP1A 3MTSA 2BCOA 2GA4B 2AWOA 4IALA 4GKJQ 2RHQB 4IUTA 1V1OA 1BQQT 5EBCA 4C3JH 4HJ5A 1TWAB 2Q2HA 1Y1VB 1L2FA 1JMCA 3CCJA 1O7LA 4CGYB 4DKAC 1D8LA 1A0IA 2IL8A 3TZUA 4NXNL 3ER0A 4KHVA 3I4NG 4R4CA 2DJFC 1DOKA 3ERQA 2BE5C 2OT2A 2WB1B 1WD1A 2Y0SB 3NEMA 1K83H 1B1ZA 2NZOA 4CKBA 1CA5A 1CK1A 1JE5A 5FOBB 3M4QA 3HRZC 1SLJA 3SVMA 4A3FG 1NCVA 3CW2C 2Z6KC 2XRQD 4DR5L 1GJXA 4DNTB 1TY2A 3BDCA 2B2VA 4JCVE 2F0IA 2OQ0A 2DNEA 3GTLH 1EIGA 3U9SA 2K75A 1PH8A 3FDTA 3H15A 1FNWA 2UUAQ 3F2BA 3EJIA 4R1JA 2R7ZB 1LT5D 3CPFA 1JJGA 3P20A 4TKOB 2NZ1D 2EXZA 3W3AA 3OTOQ 3SHLA 2VB3X 1FNUA 4J6HA 2Q8IB 1NY4A 3S1MH 1CKMA 2B2VC 5C0XI 1MJEA 2CHBD 1L0XB 2OTLA 3FPPA 3T1YQ 2F0FA 1IYVA 5ELCA 4N8X1 1O7ZA 1SJED 3LWUA 2IHEA 3JAML 3DWAA 2F3IA 3V05A 1V43A 1LTLA 1J8IA 1TWCH 4KJOA 5FLXL 3T51B 1EY9A 2EJGC 3GTMH 1G91A 3PIOA 2OWOA 4ZKBB 3PMFA 3STBD 1KIXA 2Z1CA 2VZAA 1TT2A 1DYQA 2KECA 2R61A 3J80i 5LL6S 4NXNQ 5EAYA 4DXFA 4DXGA 3K7AB 5KRUA 1B4OA 4XTCS 5C3EH 4A3JB 1VQ5A 2EXDA 2DJGC 1ZEQX 1OXUA 5COYA 1E7ZA 5ELBA 3KLSA 1G291 2BDOA 1BBXC 3NTIA 1VQ6A 2I0QA 1PRTB 4DR2L 4OELB 4JYAL 1QVFA 4C56C 2NWGA 4RCOA 2E2HB 2B8FA 2RKSA 1H9SA 1P8LA 5M3MB 3GQBA 3GV3A 4J8QA 3GTQB 1XMOL 2IW3A 2TMPA 2K5HA 5G3LD 4LFAL 3F2DA 1D5XC 1PTOD 1VQAA 1STHA 4A76A 4Y52H 4HJ9A 3AU7A 1ZKOA 3F1ZA 3UI2A 3NQIA 2SNMA 1E3PA 2WACA 1F2ZA 4EVOA 1KHIA 3MWYW 2WAQE 4CHTB 3OOCA 5CV4A 5F2DA 1RHPA 2ID0A 4DR1L 1V9PA 2N78A 4F7XA 4K14A 1ASZA 3M7NA 2CVRA 1STNA 1HNWQ 3CCUA 4BXXG 4N9PA 3UDXA 3PF4A 1Y1VG 1PH9A 1AEXA 5M5YB 1VMCA 2PNHA 1UE7A 3I3CA 4KMUC 3HOXB 3RUZA 4QMGA 3RLFA 3D4RA 3C46A 4GOPB 4JPBW 1EU3A 2VQFL 2Y0SG 2FJ2A 4H13C 2DY7A 1G8ZD 4DR2Q 3K59A 2FMMA 5TSSA 1D7QA 3A54A 4L6TB 5CV6A 3K0YA 2Z4HA 1D6EC 4A3EB 3K57A 3SK6A 3JC66 5IODA 2NVTB 2IPKD 4A3DH 2YU9B 3L9AX 4YCVA 1HZ9A 2GVBA 1XMOQ 2NUCA 4BBRB 4XYOA 4EQ5A 1TIID 2A6ED 4RKBA 5C4HA 3S1RH 1HQRD 1ET6A 4DR7L 3P75A 1KAAA 4IJHA 3DLLA 5CV5A 2R7ZG 1U5KA 1TS3A 3PSIA 1O7IA 1J5EQ 3H3VC 1HXYD 3K0XA 4DV0L 3RZDB 1SRUA 3RZOB 5C3WA 4DR1Q 4K8IA 3H94A 5J3BA 1LYLA 4EQNA 1QUQB 4JI3L 4JI7L 3QOJA 1WI5A 2F0DA 3K5MA 1AN8A 3S14B 4JV5L 3VDYA 3CRLC 2EY2A 4F87A 1PYWD 3I55A 3EQLC 3JAME 1PH5A 2B2YA 3OIPA 1PZJD 4OWXB 4AYBE 2MNAA 2MGSA 2WP8J 1TR5A 5IY0A 2R92H 4C1NI 1MKHA 1DOMA 4ZUIA 2WKDA 3BZKA 3CKIB 4DV7L 2EYFA 2JA5B 1PRTF 1BCPD 4BWGB 4ZK9B 2PZUA 4A3JG 2PW5A 4AH6A 2VQFQ 2ASBA 2XVSA 2B2YC 1E24A 2O5JC 1NTGA 2ZT9C 5E7NA 3HOVH 3MFYA 5JPMC 4DPGA 2G5DA 1KXLA 1STYA 2L0CA 3GTLB 4LF4L 1WCMH 2D9UA 4CDDC 2J7ZA 3CAMA 3FEWX 1YVCA 4P71A 1W2BA 2F0MA 5IGBA 1PH3A 3CU7A 1HNZL 5JJKA 2XWBB 1B9MA 4R4TA 1DD2A 2X69A 3Q6SA 1I4RA 3PUWA 2HDLA 2EYHA 4DK1A 5M3MG 4DR7Q 4QQBX 2UUBQ 4IOAA 3G48A 3I4MG 5CGKA 5IGDA 2F0OA 1EL0A 2YTXA 2Q2IA 4JW0A 4CDCC 3PIPA 1X32A 3IKJA 3J80c 2JA6H 5DM73 1EEID 3SDZA 5KIXA 3HKZB 3FKIB 1GUWA 2F0SA 4KKTA 4OIKA 1JWUD 4H02A 4JV5Q 1EYAA 3DMUA 4GKKL 1JB3A 1Q1BA 2WAQB 5H1SE 2F0TA 1AP0A 2K1BA 2ZJQA 1WTPA 1L1OA 2QW7A 3W1GA 5C3EB 1VQBA 5BR8L 1X56A 1Y1WB 1B50A 2DUDA 1VS0A 1V1PA 2CKZB 2F3VA 4JC0A 5D3IB 1EZ6A 2KJXA 4LMQD 5C0XG 2Q2UA 2VUMB 1BKBA 4XYQA 4G4KA 2YV5A 1JJ2A 3HOXG 4JI5L 1D2BA 4DV3L 5CV8A 3KDFA 1NNXA 1ASYA 2F4VQ 4KV6A 1L1OC 5IT9L 4ABNA 5IE8A 4GN3B 4LF4Q 1EWCA 2ZTDA 3OWFA 1K28A 1B53A 1VF7A 1S72A 4OGQC 2JA8B 1C4QA 4B3RQ 4GLXA 4V0BA 1HNZQ 3EROA 1BO0A 1E1OA 1FVIA 3D0FA 2NB0A 4A3BH 1SE8A 1HTPA 2F0EA 1RIPA 2Q8TA 2WKCA 2SDFA 2ZTCA 3K58A 4BBRG 1K0RA 1VQPA 3TQYA 1YIJA 1LTRD 3TBIB 1EY6A 2IT1A 1FJGL 2Z4IA 3AB9A 5LL6X 3RN2A 1KC8C 1Y8NB 4DR6L 1LLRD 4EGVA 4C3IB 3LNNA 1T5EA 5LMUL 2JEBI 2F03A 2Z9HA 1EFWA 2EYOA 2L12A 1Z47A 1U0LA 2RHSB 4OL7A 1U4PA 2NVYH 1QJOA 2A6EC 4LK1C 4XQNA 2H5XA 5KNBA 5JAVA 1YZ6A 2IWHA 2F0VA 3RLNA 2MUYA 4WJ4A 3M85A 3CQZH 1TWFH 3S1NH 1STGA 2UU9Q 2HHHL 2V1CC 3TREA 2M9VA 4A3IB 4AYBB 5BN3A 2ZJRA 3K7UC 4JI5Q 4A3KH 2JA5G 1EYCA 2EY1A 3KF8B 2NZHA 2QF7A 4J15A 3I4LA 4CJ0B 4QCLA 3WOFA 4IQZA 1EQRA 2A74C 2M00A 3W5OA 3BG3A 3NBIA 1D1IA 3OPOA 1GKHA 4YHHL 3Q23A 1CZWA 2A1AA 4XT3B 3I8ZA 1OXTA 5KNDA 4ZRZA 2VY3A 4P73A 1BCPC 3S1RB 4IO9A 2K28A 4JVZA 3HKSA 1BBUA 2ES2A 1I50H 3OW7A 2PCFB 5C6AA 2CWAA 3TEHB 1FJGQ 1TY0A 2KHSA 3PUXA 1VCIA 4NDXA 2ENBA 5EKKA 3RLOA 2JEAI 1K3BC 4ILWA 4P72A 5LMUQ 4UP8A 2F1MA 4A3FB 3WWVA 3HKZG 3NE5B 4FXKC 1VQ8A 1WOCA 4B3SL 2K01A 1VQ7A 1GUOA 1ILQA 5T1IA 1EY8A 2WAQG 2FFKB 3VR5A 4R4QA 4C3HB 1HQMC 1YNXA 1WTRA 3PO3H 3ICEA 3Q22A 1UWVA 1STBA 3NBHB 5C3EG 2UXCL 1EY5A 1PZID 2XN9C 3KJOA 4A3LH 3PGZA 4N8FA 2RDGA 1N9WA 3UDFA 3TS0A 2PQAA 1JOOA 1E2ZA 3HOVB 4K2LA 1IL2A 3DUZA 2Z6BA 2B2WA 2NTTA 2IHFA 4UDUC 4BA1I 4GNXA 5HURA 2N49A 3BDLA 2JQOA 1UEBA 1WCMB 4DAYA 4PNYA 3GTGH 3FVQA 3C3LA 2J0TD 5ELOA 4IFDH 5CR3A 2MO1A 2RF4A 1EIFA 4KTAA 4RKLA 1JQYD 5GAEC 4YHHQ 4WJWA 1B44D 3G71A 1HR0L 5GROA 1CSPA 2JA8G 5EGTA 2B2WC 4X66Q 5EKIA 4U673 4GNXC 3QJYA 4LAAA 1SYFA 4KD3A 3ONAB 2F52A 2JYOA 4RCNA 1H9RA 2JA6B 3HOZH 1IHZA 1MHWC 1SMYD 4KD4A 2N55A 3QWNA 2IY5B 2OQKA 4OO1H 5FJ8H 4GN5A 1RJTA 1MI2A 5KYIA 3BJUA 3CPWA 1PFNA 1VQDA 3GTPB 4OWTB 4LFBL 4B3SQ 4A3MB 4A3CH 4JG2A 3X3MA 1IW7D 2RVLA 4H44C 1WTQA 3D3RA 4PZ8A 3OMGA 1WTWA 1CKOA 3A8IE 3PF5A 4B9XA 2UXCQ 1EY7A 1C8CA 5I6YA 5IP7H 4JBKA 4IUNA 4LNQA 4YCWA 4A3IG 1RTNA 4ZUJA 2VQEL 1EQVA 4BY1H 2FHTA 1BXTA 2PMZE 1FR3A 2C5CA 4HJ7A 2K7VA 2F0QA 1Q12A 1WYDA 4K6LA 2OEOA 2K5VA 3QB3A 3H3VH 3NK9A 3EFXD 3QIAA 1HR0Q 4CJ1B 1JWMD 4A3BB 4JBWA 1LTBD 2EPBA 1F9SA 3VR3A 4WORA 2ZXRA 2QCPX 5NUCA 1O78A 1I94Q 2MHVA 2F0PA 1M4VA 1SYCA 5IWAL 1PH6A 2Z0SA 1X9NA 3V2TA 4A3GB 1A3UA 2PZTA 2B63H 1SNCA 3UDIA 2ICIA 1RODA 2CH4W 3C1FA 3TZDA 4JI1L 3J81L 1EWHA 3TDQA 2HIVA 1I6VC 1YNJD 1JOKA 3GTJB 1KNAA 1X54A 4LFBQ 1RDPD 2EJMA 2MJ8A 1D1KA 1VQ4A 4JI0Q 1CKNB 5M5XB 4K0KL 3C1EA 1JR0D 5M5WH 2D0OA 3S1NB 5FLMH 2R92G 4O42A 2PQEA 3NELA 5C0XJ 1SE3A 3RR5A 1KABA 4C3HG 4A3KB 2EYJA 3D31A 2QGQA 2NTSA 5IGGA 2VQEQ 1KQSA 1C9OA 4DR3Q 3HS0C 4A4IA 4MTNA 5I6WA 4OXPA 3VYUA 3HOVG 1WTOA 1QZGA 2ICEC 5HGTA 4HIKA 2FMCA 3OSOA 3L3OC 1WFQA 3PV0A 3IFTA 4FXDA 1WCMG 1BR9A 3CCRA 1ONLA 3KLSX 1X55A 5ISRA 2MO0A 1I50B 3OMCA 5BN4A 4JI2L 1QWYA 3LWEA 3I90A 1EIYB 1IXRA 3FMCA 5IWAQ 1PTOH 1Y8OB 5CV9A 4WRDA 1ILPA 3VA5A 2A68D 1N36L 1TS4A 5M3FB 4FDBA 1I3QH 4RMFA 1OTCA 4JI1Q 4APVA 2JA6G 1S5CD 2XNAC 2QEJC 3MXPA 2K6AA 3HG9A 3NXWA 1S4ZA 2AQ3B 4X3SA 3K5OA 1E1TA 4NW2A 3H3VI 1PYBA 3PO3B 4DR5Q 4WJ3M 4K0KQ 1E2WA 1U4RA 2AQ1B 4A3MG 4HN7A 4KKSA 4QB4A 1SMYC 3T56B 4KHPL 4ODGA 4LUZA 1ENAA 3KF6B 4IN3A 3CCLA 1FD7D 4TSSA 3EBEA 1EWIA 4HIMA 2QEXA 2CW0D 3DM1A 1LO5D 3B6YA 1FNVA 3I4MB 1I4PA 1J6QA 2WV6D 3HKZE 3V96A 1IW7C 2CWPA 4R4IA 3J80L 4RGOS 4NB3A 3UDGA 3EIVA 3U4VA 4LUVA 1N34L 2K5QA 3OW2A 2JXMB 2NYZD 4YWKA 4KI0A 2D0PA 2E5LL 3I91A 3BYYB 2PMZB 3DWPA 5C4XH 1SE2A 2KVMA 1F9RA 1ML0D 4JI2Q 3S16H 1B3AA 1NMFA 2EJFC 4Q5VA 4A3BG 1LM0A 4KK7A 2NVXH 3HOZB 4HMIA 1HZCA 4IPGA 3UE1A 3S17B 1HRJA 1N36Q 1SYBA 4FP5D 2PW7A 3A5UA 1LT3D 1BVSA 3HOYH 1NE3A 3PO2H 4I65A 2B2TA 4A3GG 3CCQA 3F2CA 3S2HB 4BBSB 2PPBC 2I5MX 4HCSA 4PMBA 1K8AC 3S1QH 3W1BA 3MXNB 4XT1B 1DOLA 4GOPA 4GN4B 3OYYA 1TWHB 3H6MA 3J81E 1XTCD 4MIUA 3HOWB 2R7FA 3D4DA 1IBLL 4JYAQ 5ELNA 1HFNA 3DXJC 1VQKA 4L5RC 4KHPQ 4UY8C 2B2TC 1NJIC 2EYLA 4F88A 4NP5A 2G9DA 4N9TA 4BY1B 1J9OA 4HMJA 1YNJC 1M8AA 4LFAQ 4EX5A 4A3KG 5JEAH 3M7GA 1DZ1A 2K04A 5I4DA 4X62L 3AMUA 3ZYYX 5IYDH 5JOBA 1E0BA 3Q8DA 1B9NA 4RHRA 1WTXA 1N34Q 3KJPA 1TS5A 1NUCA 4NPSA 1R4PB 5K36G 5JVH3 1QUQA 1T5XD 4GLVB 4POFA 4C3JB 3U58A 4FF2A 1XTDA 1MD2D 1X3GA 5CYUA 1XJVA 4UP7A 1TWGH 3SE0A 5FLXE 4B08A 2EVBA 1W6JA 1S3OA 4DK3C 3PUYA 3T4AC 4G57A 4QGUA 4RHSA 1K83B 3FHWA 5M3FG 1LUZA 2K32A 3JAMc 1WJJA 3ZJYC 4XXEA 2EYPA 1SDFA 2A5HA 1CI3M 5I9PA 1QVCA 4EQPA 3CMAA 2BH2A 2BH8A 1IL8A 1UE5A 2C9OA 2YTVA 5EKLA 4L5TA 5AFWA 5LHY1 2IJ0A 1A8VA 2A68C 2ZJPA 4JI4L 3PO3G 1WTHA 1ZXTA 5D65A 3WOEA 3S15H 2L9HA 3BDOA 2JE6I 1XPUA 4A3LG 1PV4A 5EPJA 4YWLA 4PMWA 1UUPA 2NBFA 5C4ZA 3KYHC 1ET9A 2JJQA 1T9HA 2KCTA 1EYDA 3S1MB 4X62Q 2AUKA 4FNFA 1HH2P 1YJWA 2A6HD 1U4LA 3L0OA 2C35B 4DV0Q 5JJLA 2KCMA 1VQIA 1VMPA 1VQCA 5LMNL 3D4WA 3A8JE 1TWCB 5I9OA 3GTMB 4JI3Q 4JI7Q 1WD0A 1W6KA 2CW0C 3BS1A 3W2DA 2ALYB 2F0JA 1PTOB 3CP0A 3VYRA 4L8JA 3F2UA 4K2KA 2HD3A 3SR1A 5J1ZA 3SK8A 1I3QB 5IYCH 3IAYA 3HOZG 3I70A 4YY3L 4DV7Q 1PH4A 1Q82C 2HQLA 5FJ8G 1PLFA 1AE2A 1Q81C 3CRKC 2X6GA 1Q3LA 2K5DA 1PFSA 3M4OH 1HTLD 4MTKA 4R8IA 4BBSG 4Y7NH 3E9HA 1R9TH 4POGA 5IGFA 5EBDA 4NXML 4RH6A 1VQ9A 1JICA 5E1FA 4JI4Q 3GTOH 3MA2B 3HOWG 4C1NK 4HSVA 1MIUA 2RDFA 1WTVA 4RAUC 4HJ8A 1F2LA 2ZM6L 5IP7G 3J7AV 2VNUD 3KDFB 3ITPA 4G7OC 4BY1G 3G6EA 1X3QA 1VQMA 2M2LA 2PI2E 3GO5A 4FF3A 1QNKA 1EYGA 3NTKA 4IPCA 5C4XB 1SNQA 3AFQA 4QY7A 4LF6L 2SNSA 2J4XA 3S16B 4HIOA 1PVOA 3KBXA 1BOSA 3KLWA 1A6XA 3F8TA 5IGEA 4GKKQ 3E0JA 2NVXB 4UHVA 1HR0W 3H0GH 2I07B 4PZ6A 2L15A 1RTOA 3ULLA 3MEFA 4O0AA 4C3JG 1K0SA 4LF9L 2K05A 3J7YW 1TWAH 1Y1VH 5BR8Q 2K03A 1VQGA 4DV2L 2MP1A 3TP5A 2NN6H 1C0AA 2KENA 3S1QB 3CCSA 4OEMB 1K9MC 4PQXA 1AH9A 1K8GA 3K80C 4DV3Q 3Q0AA 1SXTA 2F3WA 3CD6A 3KF8A 5EPKA 2F0UA 1YHAA 1Q1EA 3KLRA 1M1KC 2KA7A 1JJCB 4NXMQ 1Z6HA 3P1HA 4A3DB 2B3GA 2K50A 4I7AA 2ZM6Q 1Q90A 1GUTA 3R2IA 1A3VA 1PA6A 1I4HA 5I2YA 1TXYA 1R4QB 3T1HL 4QJFA 2JK8A 1IBKL 5EJWA 3SK4A 4P74A 3CHBD 1AW7A 1Q8IA 2LMCB 3IRBA 4BS9A 1VQHA 4NMZA 1A63A 4BY7H 1PH1A 5G3LF 1PTOF 4OX9L 4DR6Q 4KY5A 1EY0A 1SFOH 2O4XA 4DNRB 4ALPA 1RF2D 1KRSA 1TWGB 3KFUA 1K3RA 4ZAIA 4LF9Q 2RSNA 3QG1A 2WIIB 2R92B 4L5SA 2R6GA 3M3YH 1HJPA 4AIMA 2CH4A 4JK1C 1PXUA 2IX3A 3MZ5A 4X64L 2A6HC 4CBVA 4DV2Q 2N8NA 2KHIA 1SBBB 1LV9A 4ZKCB 2RCNA 2RSOA 1JOQA 1C48A 3TN2A 1KDCA 2IX1A 2HHHQ 3K7AH 4DK0A 3NBHA 4A3JH 2BA1A 1SNPA 3H09A 5E4WC 1X3PA 2NVQH 3RNUA 1BBWA 3C2PA 2PO4A 5D14A 4I7ZC 3E5SA 4CJ2C 1RKNA 4A93H 1IKLA 3S15B 4K5XA 4HIDA 4ZQ3A 3K5LA 4RGMA 2E2HH 2A69D 1XNRL 5IT9E 1S5DD 2O5IC 1VQLA 1XNQL 1IBKQ 3R93A 3GTQH 4GNXB 4FF1A 4DV5L 3DWQA 4LF8L 2NN6I 1ICWA 1CSQA 5J39A 5CBEE 1NAPA 1ENFA 2Z8LA 3MEHA 4OX9Q 1N32L 3U50C 1TQOA 1NR4A 1STAA 4KN4C 1X3FA 1I6HH 4OWWB 2CFMA 5FO9B 2JN4A 1G6PA 2VB2X 2F0HA 5KNCA 2JA7H 5C4XG 2AKWB 5DEHA 4R9WA 5EPLA 1IBML 3K5NA 4V190 1B8AA 5C44H 3J7A5 1PRTD 4JI8L 4LFCL 1DM0B 3I72A 4JI6L 1F2YA 3A0JA 4U68A 1H9JA 1CT1D 3VR4A 3RMHA 3AQQA 5C0XH 1EZ8A 4B3ML 5GADC 2BA0A 1X3EA 2FXQA 1LTGD 3HOXH 4ULLA 1K8OA 4PV1C 1VF5C 1L0YB 5CMDA 3R2TA 4GZYC 5IP9H 3CF5A 2L4NA 3M4YA 1FGBD 5JJIA 5J22A 3A55A 3GP7A 4PG3A 3FP9A 2KCCA 1B70B 3M9BA 4MHEA 2B39A 4IJLA 4A3EH 1EUJA 4Q0FA 1XNRQ 4ID6A 4OHJA 2NVTH 4A3DG 1SNMA 2L1BA 1AFPA 1MSGA 5CORA 4BBRH 2LXJA 5JEAG 3OTOL 2VL6A 2KBNA 4K5WA 4P2CB 4TVAB 5DM63 1L0WA 2RDHA 1XYIA 1ESFA 2QDBA 4HAEA 1HUMA 1N32Q 1YJNA 5D3DA 3T1YL 3U4ZA 4IUVA 3RZDH 1QOHA 3N52A 3RZOH 3H0GB 3AEVA 1A3TA 1CHQD 2NVYB 3GD7A 1IBMQ 3S14H 1K8MA 2RA4A 3GTKH 3J7AF 4IFDI 1F77A 2Z6KA 4LJZC 4JI8Q 4CDEC 3J7ZC 1SNOA 1CKNA 3MHBA 4QIWE 1PYSB 4LFCQ 1KDAA 3H91A 4JI6Q 1STEA 3CQZB 1YI2A 1TWFB 4DU9A 1X65A 5FO7B 5CC4A 2P5ZX 4IUQA 4B3MQ 2FINB 1VQOA 2VS1A 2LS01 3JAMi 5C3XA 2XWJB 4HEDA 1EFID 4NKLA 4X3UA 1CA6A 2JA5H 2Q2TA 1CZGA 3LX0A 1KDBA 4IPDA 3OWEB 1QE6A 3HZXA 5FKAC 1CQVA 1S5ED 4OO1I 2KEDA 3HOUH 1PH2A 1II3A 1YHQA 3BU2A 3NSWA 2LFNA 3MXGA 2E2IH 4DV1L 3CC2A 4DR4L 3HGBA 4GS3A 3HEJA 5I2XA 1VQJA 2UUCL 4EQOA 3VYTA 2KOLA 1OXVA 3K6OA 2E2JH 3TP8A 1YITA 1PMRA 2QDLA 4RGTA 4OONA 1LACA 3EN2A 3I4OA 4BY7B 1CQFA 1KD1C 2LKVA 2CCZA 4JBJA 1HPCA 3SGIA 2K33A 2MFIA 1HUNA 4JOIA 5IYBH 1SFOB 1SNDA 4RG1A 1H9MA 1KNEA 4PZ7A 2A69C 1G2TA 3FKIH 3CCMA 5EQ0A 4UAIA 1GUSA 1HNWL 3M3YB 5HGQA 4LUOA 1O7YA 1XXGA 3D6CA 3KBGA 1RCVD 2AWNA 2HUGA 4IZ8A 1BDOA 3TMEA 1K73C 4JOIC 2HCCA 5IYCG 5KYLA 1TKWB 4F8MA 3T16A 1IZ6A 4ME3A 4ME5A 3MAQA 1NR2A 1LTTD 3KF6A 1Y1WH 1Q7YC 1BF4A 2NVQB 1OXXK 3I73A 3NUCA 5M9OA 2KQ3A 1SYGA 2GN5A 1U9RA 2VUMH 4X65L 1YNND 4DF7A 2N88A 3HP3A 3GTGB 4A93B 4FXGC 1PRTC 2EZVA 1X6OA 3M4PA 1KLGD 5C5MA 1H9SB 3HFZB 3NQTA 4CKEA 4DV1Q 3PUZA 4DR4Q 1Q8KA 2H4OA 2R93H 3DEPA 5L37A 1XMQL 4B3TL 2UUCQ 2JA8H 1E2VA 5FK9C 5C5LA 1G51A 3BVZA 5JPNC 1F9PA 3TRZA 1J5EL 4K8JA 1I6HB 1RL2A 3R8BA 2VW9A 2JA7B 4ZCKA 1YJ9A 2F0WA 4DN4M 4C3IH 2XRSD 4BA2I 3NP8A 5C44B 5LMNW 4QF4A 4DNIA 2F0KA 3MXNA 3H0GG 1OO9B 1UE1A 2HQEA 3D6WA 3S24A 2DNCA 1DONA 1YBYA 2ZXPA 2ZXOA 3CXCA 1JCKB 1PZKD 4DFAA 1EIHA 1XPRA 2F0LA 2O2LD 2NN6G 4O1NA 4TRDA 3VA7A 2TSSA 2D5DA 1CUKA 3ULJA 4QIWB 3J81c 5ELFA 2OXPA 4L5QA 4A3IH 3ERSX 4X65Q 4GOPC 2WB1G 4DAMA 5IOCA 1HZBA 2EE1A 5IIFA 5C4JH 5FO8B 3DM3A 4MZ9A 3RN5A 1H9KA 3S2DH 4MN3A 1YEZA 2IX0A 3LGJA 1ZYRD 2UXDL 1V8QA 2QA4A 3ND9A 1HHVA 2E5LQ 1SAPA 4DV4L 1XMQQ 4P75A 1Y14B 4B3TQ 3BZDB 4C2MH 3EVQA 2LY7A 3QOLA 1B3QA 4B9WA 2ZTEA 1M90C 3CC7A 4HTHA 2A8VA 1PFMA 1QG7A 3J81j 2A73B 4QUCA 3IFDA 1KRTA 3DEOA 2UUBL 1F2MA 4CDFC 2EQSA 5ELDA 5K5PA 1SN8A 4KLKA 2B63B 1LT4D 1F9QA
chains in the Genus database with same CATH topology
1ESRA 3TP7A 1EY4A 1XWEA 3A8KE 5E3FA 2H1EA 1LTAD 5A35A 3SEBA 3GTKB 5KEEA 2AUJD 1EOTA 4XQQA 2XIWA 5M5WB 4HR7B 1EU4A 1NSNS 4DAVA 2OF1A 2QILA 3G7LA 1SE4A 1S5BD 3NWSA 2HDMA 3IL8A 3HOUB 3VYSA 1LABA 1DCZA 2EY6A 1IYUA 1JC7A 2E2IB 2E75C 2RBMA 2G9HD 3BYTB 1CM9A 1ENCA 4IFDG 5T1GA 2E2JB 4XQJA 3J80E 1EEFD 5JEAJ 4L63B 2I46A 5DAUA 1VDZA 3GV6A 2EYMA 2VXWA 3KK7A 1YNNC 2PZWA 2EDGA 3EA6A 3OHXC 3MVVA 3SK5A 1PFBA 1A15A 2KEEA 1SEBD 1LT6D 4OO1G 3P7JA 1UEAB 2EOTA 2MPMA 3BVGA 1LTID 1TS2A 3FRPB 4K5VA 2QKIC 1QB5D 1PTOC 3MXUA 3VR6A 1SJHD 1KLUD 4M1UB 1SSOA 1V1PB 2DN8A 1BUVT 3U9OA 3URYA 3PIO3 1KTKA 1CTMA 1LTSD 4HCEA 1U4MA 4X3KA 2SOBA 4OIJA 4DGZA 3NHHA 2L55A 4KHZA 3DHQA 2YYZA 2WINB 3D8GA 2R93B 2K5WA 1Z7TA 3NWTA 2D2CC 1A2UA 4FF4A 1MGSA 5A2QL 4RWSC 1UNSA 1I4GA 1MBYA 3HOYB 3KUPA 3PO2B 4QUFA 1HCZA 1ZYRC 4R8NA 4G7HC 1WVLA 4KY7A 2F0NA 4IUUA 1AZQA 2X6LA 5KGUA 1TVXA 1SYDA 2JSOA 1RD9D 1JE4A 3RD4A 1EQTA 3ND8A 4XDXA 1G2SA 3TP6A 4K6DA 4H7BA 3A7LA 1BCPB 3N6RA 1PDQA 4RFBA 5C4JB 2XSCA 2HCIA 1GUNA 4PMCA 4YIJA 4FYDA 4Z9CB 4KY6A 3S2DB 2RQXA 1IKMA 4CKCA 1MSHA 3PUVA 3X3NA 4G7ZC 1O80A 2F0GA 1JORA 4C2MB 3WDNA 5JJZA 4XIGS 2DY8A 2BE5D 1JWSD 2EY5A 5CV7A 5K36H 2B2UA 4HSPA 4S3SA 2E74C 3FPUB 1SYEA 1QCBD 1GHKA 5CBAE 3I4NB 1FYCA 1B2TA 2BOSA 4RGNA 4ZLTF 2L11A 3QO2A 2B2UC 2CQAA 1AZPA 4J1MA 5DNFA 4M8AA 1I4QA 4KN7C 3L7ZC 4DA2A 5E4XA 2KUMA 2V4DA 2PNRC 2L5TA 1CHPD 3E6ZX 1HA6A 1HFGA 3VR2A 1HA5A 4KKUA 4DAPA 2E76C 5JVG3 3NPPA 1GXDC 3O13A 3T53B 3A56A 4IURA 4ZYSA 1A2TA 5ELEA 4H0LC 1I4XA 1GHJA 1BNZA 5IGCA 1XX8A 1DXMA 1G6ZA 2E2DC 3SXHA 2PYKA 4FO2A 2Q8RE 3A7AB 1CFMA 1QILA 3MFGA 1S5FD 3G6JB 3Q24A 3MC0B 2KCNA 3T13A 5A2QE 4RA8A 1DJRD 2B8GA 1D5MC 1Y69U 3M4OB 3R3OA 4C3IG 4Y7NB 1R9TB 3TSSA 3PIP3 1BCPF 3GTOB 2F4IA 3BVMA 1OXSC 3S9WA 1QNUA 1GOZA 1D5ZC 4X3TA 3NTHA 2BDNA 4KJNA 4FVMA 5BN5A 4TQUS 2SEBD 4IUPA 2R3ZA 2D62A 4WFN3 1GUGA 4IFDJ 2AQ2B 1TU2B 4E6IA 3OIQA 1Y8PB 1UAPA 2JP1A 3MTSA 2BCOA 2GA4B 2AWOA 4IALA 4IUTA 1V1OA 1BQQT 5EBCA 1TWAB 1Y1VB 1O7LA 4CGYB 2IL8A 3TZUA 4KHVA 1DOKA 2BE5C 2OT2A 2WB1B 3ERQA 1WD1A 2Y0SB 1B1ZA 4CKBA 1CA5A 1CK1A 5FOBB 3HRZC 3SVMA 1NCVA 2XRQD 1GJXA 4DNTB 1TY2A 3BDCA 2B2VA 2F0IA 2DNEA 1EIGA 3U9SA 3FDTA 1FNWA 3EJIA 2R7ZB 1LT5D 3P20A 4TKOB 2NZ1D 2EXZA 3W3AA 3SHLA 2VB3X 1FNUA 4J6HA 2Q8IB 2B2VC 5C0XI 2CHBD 1L0XB 3FPPA 2F0FA 1IYVA 5ELCA 1O7ZA 1SJED 3LWUA 3JAML 3DWAA 3V05A 1V43A 1J8IA 4KJOA 5FLXL 3T51B 1EY9A 2EJGC 1G91A 4ZKBB 3PMFA 2Z1CA 1TT2A 1DYQA 2KECA 2R61A 5LL6S 4DXFA 4DXGA 3K7AB 5KRUA 1B4OA 4XTCS 4A3JB 1ZEQX 1OXUA 5COYA 5ELBA 3KLSA 1G291 2BDOA 1BBXC 3NTIA 1PRTB 4C56C 2NWGA 4RCOA 2E2HB 2B8FA 2RKSA 1H9SA 5M3MB 3GQBA 3GV3A 4J8QA 3GTQB 2IW3A 2TMPA 5G3LD 1D5XC 1PTOD 1STHA 3AU7A 1ZKOA 3UI2A 3NQIA 2SNMA 2WACA 1F2ZA 4EVOA 3MWYW 4CHTB 5CV4A 3OOCA 5F2DA 1RHPA 2ID0A 4F7XA 4K14A 3M7NA 2CVRA 1STNA 4N9PA 1AEXA 5M5YB 1VMCA 3I3CA 4KMUC 3HOXB 3RUZA 4QMGA 3RLFA 3D4RA 3C46A 1EU3A 2FJ2A 4H13C 2DY7A 1G8ZD 3K59A 2FMMA 5TSSA 3A54A 4L6TB 5CV6A 3K0YA 2Z4HA 1D6EC 4A3EB 3K57A 3SK6A 5IODA 2NVTB 2IPKD 2YU9B 3L9AX 2NUCA 4BBRB 4XYOA 1TIID 2A6ED 4RKBA 5C4HA 1HQRD 1ET6A 3P75A 1KAAA 5CV5A 1TS3A 3H3VC 1HXYD 3RZDB 3RZOB 5C3WA 4K8IA 3H94A 4EQNA 3QOJA 2F0DA 3K5MA 1AN8A 3S14B 3CRLC 2EY2A 4F87A 1PYWD 3EQLC 3JAME 2B2YA 3OIPA 1PZJD 2MGSA 2WP8J 1TR5A 4C1NI 4ZUIA 1DOMA 2WKDA 3CKIB 2EYFA 2JA5B 1PRTF 1BCPD 4BWGB 4ZK9B 2PZUA 2PW5A 2XVSA 2B2YC 2O5JC 2ZT9C 3MFYA 5JPMC 1STYA 2L0CA 3GTLB 2D9UA 2J7ZA 3FEWX 2F0MA 5IGBA 3CU7A 2XWBB 1B9MA 1DD2A 2X69A 3Q6SA 1I4RA 3PUWA 2HDLA 2EYHA 4DK1A 5CGKA 5IGDA 2F0OA 1EL0A 1X32A 3IKJA 5DM73 1EEID 3SDZA 5KIXA 3HKZB 3FKIB 1GUWA 2F0SA 4KKTA 4OIKA 1JWUD 1EYAA 3DMUA 1JB3A 1Q1BA 2WAQB 2F0TA 1AP0A 2K1BA 1WTPA 5C3EB 1Y1WB 1B50A 5D3IB 1V1PA 2F3VA 1EZ6A 2KJXA 4LMQD 5C0XG 2VUMB 4XYQA 4G4KA 1D2BA 5CV8A 4KV6A 5IT9L 4ABNA 1EWCA 3OWFA 1B53A 1VF7A 4OGQC 2JA8B 1C4QA 4V0BA 3EROA 1BO0A 2NB0A 1HTPA 2F0EA 2Q8TA 2WKCA 2SDFA 3K58A 1LTRD 3TBIB 1EY6A 2IT1A 2Z4IA 3AB9A 5LL6X 1Y8NB 1LLRD 4EGVA 4C3IB 3LNNA 1T5EA 2JEBI 2F03A 2EYOA 2L12A 1Z47A 4OL7A 1U4PA 1QJOA 2A6EC 4LK1C 4XQNA 5KNBA 5JAVA 2IWHA 2F0VA 2MUYA 3M85A 1STGA 2M9VA 4A3IB 4AYBB 5BN3A 1EYCA 2EY1A 2QF7A 3I4LA 4CJ0B 4QCLA 3WOFA 4IQZA 2A74C 2M00A 3BG3A 3NBIA 1D1IA 3OPOA 3Q23A 1CZWA 4XT3B 3I8ZA 1OXTA 5KNDA 4ZRZA 1BCPC 3S1RB 2K28A 3OW7A 2PCFB 5C6AA 1TY0A 2KHSA 3PUXA 1VCIA 4NDXA 2ENBA 5EKKA 2JEAI 4ILWA 2F1MA 4A3FB 3NE5B 4FXKC 2K01A 1GUOA 1ILQA 5T1IA 1EY8A 2FFKB 3VR5A 4C3HB 1WTRA 1HQMC 3Q22A 1STBA 1EY5A 1PZID 2XN9C 2RDGA 1JOOA 1E2ZA 3HOVB 4K2LA 3DUZA 2B2WA 2NTTA 4UDUC 4BA1I 5HURA 3BDLA 1WCMB 4DAYA 4PNYA 3FVQA 3C3LA 2J0TD 4IFDH 5CR3A 4RKLA 4KTAA 1JQYD 4WJWA 1B44D 5EGTA 2B2WC 5EKIA 4U673 3QJYA 4LAAA 1SYFA 4KD3A 3ONAB 4RCNA 2JYOA 1H9RA 2JA6B 1IHZA 1SMYD 4KD4A 2N55A 3QWNA 4OO1H 1RJTA 1MI2A 5KYIA 1PFNA 3GTPB 4A3MB 3X3MA 1IW7D 2RVLA 4H44C 1WTQA 3D3RA 3OMGA 1WTWA 3A8IE 4B9XA 1EY7A 1C8CA 5I6YA 4IUNA 1RTNA 4ZUJA 1EQVA 2FHTA 1BXTA 1FR3A 2C5CA 2K7VA 2F0QA 1Q12A 4K6LA 2OEOA 3QB3A 3NK9A 3EFXD 3QIAA 4CJ1B 1JWMD 4A3BB 4JBWA 1LTBD 2EPBA 1F9SA 3VR3A 4WORA 2ZXRA 2QCPX 5NUCA 1O78A 2MHVA 2F0PA 1M4VA 1SYCA 3V2TA 4A3GB 1A3UA 2PZTA 1SNCA 2ICIA 1RODA 3C1FA 3TZDA 3J81L 1EWHA 3TDQA 1I6VC 1YNJD 1JOKA 3GTJB 1KNAA 1RDPD 2EJMA 2MJ8A 1D1KA 5M5XB 3C1EA 1JR0D 3S1NB 4O42A 2PQEA 5C0XJ 1SE3A 1KABA 4C3HG 4A3KB 2EYJA 3D31A 2NTSA 5IGGA 3HS0C 5I6WA 3VYUA 1WTOA 2ICEC 5HGTA 2FMCA 3OSOA 3L3OC 3PV0A 3IFTA 4FXDA 1BR9A 1ONLA 3KLSX 5ISRA 1I50B 3OMCA 5BN4A 1QWYA 3LWEA 3I90A 3FMCA 1PTOH 1Y8OB 5CV9A 4WRDA 1ILPA 3VA5A 2A68D 1TS4A 5M3FB 1S5CD 2XNAC 2QEJC 3MXPA 2K6AA 3HG9A 3NXWA 1S4ZA 2AQ3B 4X3SA 3K5OA 4NW2A 3PO3B 1E2WA 1U4RA 2AQ1B 4HN7A 4KKSA 4QB4A 1SMYC 3T56B 4ODGA 1ENAA 4IN3A 1FD7D 4TSSA 2CW0D 3DM1A 1LO5D 1FNVA 3I4MB 1I4PA 2WV6D 3V96A 1IW7C 3J80L 4RGOS 2K5QA 2JXMB 2NYZD 4KI0A 3I91A 3BYYB 2PMZB 3DWPA 1SE2A 2KVMA 1F9RA 1ML0D 1B3AA 2EJFC 4Q5VA 4KK7A 3HOZB 4HMIA 3S17B 1HRJA 1SYBA 4FP5D 2PW7A 1LT3D 4I65A 2B2TA 3S2HB 4BBSB 2PPBC 4HCSA 4PMBA 4XT1B 1DOLA 1TWHB 3H6MA 3J81E 1XTCD 4MIUA 3HOWB 3D4DA 1HFNA 3DXJC 2B2TC 2EYLA 4F88A 4NP5A 2G9DA 4N9TA 4BY1B 1J9OA 4HMJA 1YNJC 1M8AA 5JEAH 3M7GA 1DZ1A 2K04A 5I4DA 3AMUA 3ZYYX 5JOBA 1E0BA 1B9NA 4RHRA 1WTXA 1TS5A 1NUCA 1R4PB 5K36G 5JVH3 1T5XD 4C3JB 4FF2A 1MD2D 5CYUA 3SE0A 5FLXE 4B08A 2EVBA 1W6JA 3PUYA 3T4AC 4G57A 4RHSA 1K83B 2K32A 4XXEA 2EYPA 1SDFA 2A5HA 1CI3M 5I9PA 4EQPA 1IL8A 2C9OA 5EKLA 5AFWA 5LHY1 2IJ0A 2A68C 1ZXTA 5D65A 3WOEA 2L9HA 3BDOA 2JE6I 5EPJA 4PMWA 1UUPA 2NBFA 5C4ZA 1ET9A 1EYDA 3S1MB 2AUKA 4FNFA 2A6HD 1U4LA 1VMPA 3D4WA 3A8JE 1TWCB 5I9OA 3GTMB 1WD0A 1W6KA 2CW0C 3BS1A 3W2DA 2F0JA 1PTOB 3VYRA 4L8JA 3F2UA 4K2KA 3SR1A 5J1ZA 3SK8A 1I3QB 3IAYA 3I70A 1PLFA 3CRKC 2X6GA 1Q3LA 2K5DA 1HTLD 4R8IA 5IGFA 5EBDA 4RH6A 1JICA 5E1FA 3MA2B 4C1NK 4HSVA 2RDFA 1WTVA 4RAUC 1F2LA 3J7AV 2VNUD 3ITPA 4G7OC 1X3QA 2M2LA 3GO5A 4FF3A 1QNKA 3NTKA 5C4XB 1SNQA 2SNSA 2J4XA 3S16B 3KBXA 1BOSA 1A6XA 5IGEA 3E0JA 2NVXB 2I07B 1RTOA 4C3JG 2K05A 3J7YW 2K03A 2MP1A 3TP5A 2NN6H 3S1QB 4PQXA 3Q0AA 1SXTA 2F3WA 3KF8A 5EPKA 2F0UA 1Q1EA 3KLRA 2KA7A 1Z6HA 3P1HA 4A3DB 1Q90A 1GUTA 3R2IA 1A3VA 1I4HA 5I2YA 1R4QB 5EJWA 3SK4A 3CHBD 1AW7A 1Q8IA 2LMCB 4BS9A 4NMZA 5G3LF 1PTOF 4KY5A 1EY0A 2O4XA 4DNRB 1RF2D 1TWGB 4ZAIA 2RSNA 3QG1A 2WIIB 2R92B 2R6GA 4JK1C 1PXUA 2IX3A 3MZ5A 2A6HC 4CBVA 1SBBB 1LV9A 4ZKCB 2RSOA 1JOQA 1C48A 3TN2A 1KDCA 2IX1A 4DK0A 3NBHA 2BA1A 1SNPA 3H09A 5E4WC 1X3PA 3C2PA 2PO4A 5D14A 4I7ZC 3E5SA 4CJ2C 1RKNA 1IKLA 3S15B 4K5XA 4ZQ3A 3K5LA 4RGMA 2A69D 5IT9E 1S5DD 2O5IC 3R93A 4FF1A 3DWQA 2NN6I 1ICWA 5J39A 5CBEE 1NAPA 1ENFA 2Z8LA 3MEHA 1TQOA 1NR4A 1STAA 4KN4C 5FO9B 2VB2X 2F0HA 5KNCA 5DEHA 4R9WA 5EPLA 3K5NA 4V190 1PRTD 1DM0B 3I72A 1F2YA 4U68A 1H9JA 1CT1D 3VR4A 3RMHA 5C0XH 1EZ8A 2BA0A 1LTGD 4ULLA 1K8OA 4PV1C 1VF5C 1L0YB 5CMDA 3R2TA 4GZYC 2L4NA 3M4YA 1FGBD 5J22A 3A55A 3GP7A 2KCCA 4MHEA 2B39A 4Q0FA 4ID6A 4OHJA 1SNMA 2L1BA 1AFPA 1MSGA 5CORA 5JEAG 4P2CB 4K5WA 5DM63 2RDHA 1XYIA 1ESFA 2QDBA 4HAEA 1HUMA 5D3DA 4IUVA 1QOHA 3N52A 3H0GB 1A3TA 1CHQD 2NVYB 3GD7A 1K8MA 2RA4A 3J7AF 4IFDI 1F77A 4LJZC 1SNOA 3MHBA 1KDAA 3H91A 1STEA 3CQZB 1TWFB 4DU9A 5FO7B 5CC4A 4IUQA 2FINB 2LS01 5C3XA 2XWJB 4HEDA 1EFID 4NKLA 4X3UA 1CA6A 1CZGA 3LX0A 1KDBA 3OWEB 1QE6A 3HZXA 5FKAC 1CQVA 1S5ED 4OO1I 2KEDA 1II3A 3NSWA 2LFNA 3MXGA 3HGBA 3HEJA 5I2XA 4EQOA 3VYTA 2KOLA 1OXVA 3K6OA 3TP8A 1PMRA 4RGTA 1LACA 4BY7B 1CQFA 2LKVA 1HPCA 2K33A 1HUNA 1SFOB 1SNDA 1H9MA 1KNEA 2A69C 1G2TA 5EQ0A 4UAIA 1GUSA 3M3YB 1O7YA 1XXGA 3D6CA 3KBGA 1RCVD 2AWNA 2HUGA 4IZ8A 1BDOA 3TMEA 2HCCA 5KYLA 1TKWB 4F8MA 3T16A 3MAQA 4ME5A 1NR2A 1LTTD 2NVQB 1BF4A 1OXXK 3I73A 3NUCA 5M9OA 1SYGA 2KQ3A 1U9RA 1YNND 4DF7A 2N88A 3HP3A 3GTGB 4A93B 4FXGC 1PRTC 2EZVA 1KLGD 5C5MA 1H9SB 3NQTA 4CKEA 3PUZA 2H4OA 3DEPA 1E2VA 5FK9C 5C5LA 3BVZA 5JPNC 1F9PA 4K8JA 1I6HB 3R8BA 2JA7B 2F0WA 4DN4M 2XRSD 4BA2I 3NP8A 5C44B 4QF4A 2F0KA 3MXNA 1OO9B 2HQEA 3D6WA 2DNCA 1DONA 2ZXPA 2ZXOA 1JCKB 1PZKD 4DFAA 1EIHA 2F0LA 2O2LD 2NN6G 4O1NA 4TRDA 3VA7A 2TSSA 2D5DA 4QIWB 5ELFA 2OXPA 5IOCA 5IIFA 2EE1A 5FO8B 1H9KA 4MN3A 2IX0A 1ZYRD 1V8QA 3ND9A 1HHVA 1SAPA 3BZDB 3EVQA 2LY7A 3QOLA 4B9WA 4HTHA 1PFMA 1QG7A 2A73B 4QUCA 3IFDA 3DEOA 1F2MA 5ELDA 5K5PA 2B63B 1LT4D 1F9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9W A;  1U9R A;  4KJO A;  2EY1 A;  2EYJ A;  1EY9 A;  1IHZ A;  4DF7 A;  5IGE A;  5CV6 A;  5KIX A;  4HMI A;  4KD4 A;  5IGG A;  3E5S A;  2F0S A;  3PMF A;  3TP7 A;  1EY4 A;  1RKN A;  1A3T A;  1EYA A;  1SYB A;  4K5X A;  3SK6 A;  5IOD A;  3DMU A;  4ZQ3 A;  2PW7 A;  5E3F A;  2SOB A;  1TT2 A;  4KJN A;  2M00 A;  4DGZ A;  5I6W A;  5C5M A;  5KYI A;  2F0T A;  3NHH A;  4I65 A;  5C4Z A;  3NQT A;  4J1M A;  5HGT A;  2NUC A;  1EYD A;  3DHQ A;  1SNO A;  3OSO A;  5KEE A;  3MHB A;  5KRU A;  3D8G A;  1KDA A;  3TP5 A;  4PMB A;  4RKB A;  5C4H A;  4DU9 A;  3P75 A;  1KAA A;  5CC4 A;  4E6I A;  5CV5 A;  3H6M A;  2F3V A;  4MIU A;  1NSN S;  1EZ6 A;  3OMG A;  5J39 A;  2OF1 A;  5ISR A;  5C5L A;  1A2U A;  5C3X A;  3D4W A;  2F3W A;  3MEH A;  3D4D A;  3OMC A;  5I9O A;  4NKL A;  1TQO A;  4B9X A;  1EY7 A;  2F0U A;  3LX0 A;  5I6Y A;  5C6A A;  1KDB A;  1STA A;  5C3W A;  4K8I A;  2KHS A;  5CV8 A;  4IAL A;  2EYL A;  3HZX A;  4NDX A;  5CV9 A;  4EQN A;  2ENB A;  2F0J A;  4IUN A;  4K8J A;  4NP5 A;  4WRD A;  3P1H A;  3QOJ A;  2F0D A;  5EKK A;  2F0H A;  3VA5 A;  1A2T A;  4KV6 A;  5DEH A;  4K2K A;  4ZUJ A;  2EY2 A;  2RKS A;  1EQV A;  1II3 A;  4N9T A;  3SR1 A;  4HMJ A;  3OWF A;  2F0W A;  4R8N A;  5J1Z A;  3SK8 A;  1A3V A;  3NP8 A;  2EY6 A;  4KY7 A;  4QF4 A;  2F0N A;  5IGC A;  2RBM A;  2F0Q A;  4KHV A;  2F0K A;  1TR5 A;  3HEJ A;  3SK4 A;  2OEO A;  5KGU A;  5JOB A;  2HQE A;  1SYD A;  1STH A;  3ERO A;  3MXP A;  1ENC A;  3NXW A;  3QB3 A;  3ERQ A;  1F2Y A;  3NK9 A;  4ZUI A;  4EQO A;  1EY8 A;  3TP8 A;  2F0E A;  2EYF A;  2SNM A;  1EZ8 A;  4NMZ A;  2WAC A;  1NUC A;  5DAU A;  1F2Z A;  3SXH A;  4WOR A;  4DFA A;  4EVO A;  2PYK A;  1STB A;  2PZU A;  2LKV A;  2F0L A;  3TP6 A;  4TRD A;  2EYM A;  2PW5 A;  4KY5 A;  5CV4 A;  1EY0 A;  1EY5 A;  5F2D A;  5NUC A;  1EY6 A;  4QB4 A;  2F0P A;  4ODG A;  5IGF A;  2PZW A;  1SYC A;  1ENA A;  2O4X A;  3BDC A;  1SND A;  4K6D A;  2OXP A;  4H7B A;  5E1F A;  3MVV A;  1JOO A;  3V2T A;  3SK5 A;  1A3U A;  2F0I A;  4K2L A;  5IIF A;  2PZT A;  4F7X A;  5IOC A;  1SNC A;  4K14 A;  1STY A;  2RDF A;  1STN A;  4YIJ A;  4PMC A;  5HUR A;  3C1F A;  4KY6 A;  3BDL A;  2EYO A;  3T13 A;  4PNY A;  4N9P A;  4OL7 A;  4ID6 A;  5J22 A;  3EJI A;  4G57 A;  3ITP A;  5CR3 A;  3MZ5 A;  1SNM A;  1JOK A;  2F0M A;  3D6C A;  2EXZ A;  4K5V A;  4KTA A;  4RKL A;  5IGB A;  1AEX A;  3SHL A;  4IZ8 A;  2F0G A;  4J6H A;  3TME A;  1JOQ A;  3EVQ A;  1JOR A;  3QOL A;  5JAV A;  1KDC A;  3R3O A;  2EYH A;  2F0V A;  2EYP A;  3RUZ A;  4B9W A;  4QMG A;  2EY5 A;  5CV7 A;  4K5W A;  5KYL A;  1SNP A;  3C1E A;  4F8M A;  5I9P A;  3T16 A;  1STG A;  4HTH A;  5EGT A;  4S3S A;  4EQP A;  2F0F A;  4ME5 A;  2PQE A;  5CGK A;  5IGD A;  2F0O A;  2KQ3 A;  2QDB A;  4LAA A;  1F2M A;  1SNQ A;  1SYF A;  2SNS A;  3U9O A;  3NUC A;  4KD3 A;  5EKL A;  5K5P A;  1KAB A;  1SYE A;  5M9O A;  1SYG A;  1EYC A; 
#chains in the Genus database with same CATH topology
 1Q46 A;  1ESR A;  1EQQ A;  1AE3 A;  4BY7 G;  3KOJ A;  3I4N H;  3TP7 A;  1EY4 A;  1XWE A;  3A8K E;  5E3F A;  2H1E A;  1LTA D;  5GAH C;  5A35 A;  1GVP A;  3SEB A;  3GTK B;  2OCE A;  2UXB L;  5KEE A;  4LWC A;  4A3F H;  5FLX c;  2AUJ D;  1EOT A;  4XQQ A;  4AQY L;  2XIW A;  1Z9F A;  5M5W B;  2GVA A;  1IBL Q;  4HR7 B;  1EU4 A;  1NSN S;  4DAV A;  2OF1 A;  2QIL A;  4C3H H;  3G7L A;  1SE4 A;  1S5B D;  1VQE A;  3NWS A;  1A62 A;  4DK6 C;  2LXK A;  2HDM A;  3E3X A;  3IL8 A;  3HOU B;  3STB C;  3VYS A;  1LAB A;  3I7F A;  1DCZ A;  2F4V L;  1HNX L;  2EY6 A;  1IYU A;  1JC7 A;  2UXD Q;  2E2I B;  2E75 C;  2AMC B;  2RBM A;  2G9H D;  2I5L X;  4A93 G;  1S40 A;  3BYT B;  1CM9 A;  1ENC A;  3NEN A;  4DV4 Q;  4IFD G;  3CC4 A;  5T1G A;  4B3R L;  3I2Z A;  4XQJ A;  2E2J B;  3J80 E;  2EIF A;  4GLA C;  1EEF D;  5JEA J;  4L63 B;  2I46 A;  5DAU A;  1VDZ A;  1B7Y B;  2WFW A;  3GV6 A;  1KL9 A;  1DGS A;  2EYM A;  2VXW A;  3KK7 A;  1YNN C;  1EOV A;  2PZW A;  2EDG A;  3EA6 A;  5AJ3 L;  4YY3 Q;  3OHX C;  3MVV A;  4IPH A;  3SK5 A;  3CME A;  1PFB A;  1A15 A;  2N3S A;  3PQI A;  4HJA A;  2KEE A;  2E8G A;  1VQF A;  3CCE A;  1SEB D;  1LT6 D;  4OO1 G;  3E9I A;  3P7J A;  1UEA B;  3CCV A;  2JA9 A;  2EOT A;  5HY6 A;  2MPM A;  3BVG A;  1LTI D;  3FRP B;  1TS2 A;  4K5V A;  2JA7 G;  2LSS A;  2UXB Q;  1N33 L;  2QKI C;  1QB5 D;  1PTO C;  3MXU A;  3VR6 A;  4AQY Q;  4DUY L;  3GTP H;  1H95 A;  1SJH D;  5C44 G;  1KLU D;  1L1O B;  4A3C G;  2ATW A;  4M1U B;  1SR3 A;  4A3M H;  1IYJ B;  1SSO A;  4X6A H;  1V1P B;  2DN8 A;  1I5F A;  1BUV T;  3U9O A;  3URY A;  2UU9 L;  3PIO 3;  1KTK A;  4DUZ L;  2A19 A;  4LF5 L;  1CTM A;  1LTS D;  4HCE A;  1U4M A;  4X3K A;  2SOB A;  5IP9 G;  1UE6 A;  4OIJ A;  4DGZ A;  1HNX Q;  3NHH A;  2L55 A;  4KHZ A;  3DHQ A;  2YYZ A;  2WIN B;  3D8G A;  3TS2 A;  2R93 B;  2K5W A;  1Z7T A;  1JT8 A;  4YWM A;  5LMN Q;  4A3E G;  3NWT A;  2D2C C;  1A2U A;  3BZC A;  4FF4 A;  1MGS A;  1JB7 A;  4LF7 L;  2AHO B;  4BXX H;  5A2Q L;  1V1Q A;  4RWS C;  2R7D A;  5AJ3 Q;  1UNS A;  1I4G A;  1MBY A;  3HOY B;  3KUP A;  3PO2 B;  4QUF A;  3G4S A;  1HCZ A;  1ZYR C;  4A3G H;  1N8R C;  2B63 G;  4R8N A;  1GD7 A;  4G7H C;  1WVL A;  4KY7 A;  2F0N A;  4O2D A;  4IUU A;  1AZQ A;  2X6L A;  5KGU A;  1TVX A;  1SYD A;  2JSO A;  3AFP A;  1RD9 D;  1JE4 A;  3RD4 A;  3A74 A;  1N33 Q;  1EQT A;  2RCF A;  4DUY Q;  3GTJ H;  3ND8 A;  4XDX A;  1G2S A;  5M5X H;  3TP6 A;  5FLM G;  4K6D A;  4DUZ Q;  4H7B A;  5DLQ E;  4LF5 Q;  3A7L A;  1BCP B;  3N6R A;  1PDQ A;  4RFB A;  4DV6 L;  5C4J B;  2XSC A;  2HCI A;  3ULP A;  1GUN A;  4PMC A;  4YIJ A;  4FYD A;  4Z9C B;  4KY6 A;  3S2D B;  2RQX A;  4IOC A;  1IKM A;  4CKC A;  1C7Y A;  1MSH A;  3PUV A;  2R7Z H;  2XGT A;  3X3N A;  4G7Z C;  3HOU G;  1O80 A;  2F0G A;  1JOR A;  3K81 C;  4C2M B;  5GAG C;  3WDN A;  5JJZ A;  4XIG S;  2DY8 A;  2BE5 D;  1JWS D;  2EY5 A;  5CV7 A;  4LF6 Q;  5K36 H;  2B2U A;  4HSP A;  4S3S A;  2E74 C;  2KHJ A;  3FPU B;  1SYE A;  4LF7 Q;  4X66 L;  2WB1 E;  1QCB D;  2Y0S E;  1GHK A;  5CBA E;  3I4N B;  1FYC A;  1B2T A;  2BOS A;  5IYB G;  2CQO A;  1GO3 E;  4RGN A;  4ZLT F;  1XPO A;  2L11 A;  3QO2 A;  2B2U C;  2CQA A;  4A75 A;  1AZP A;  4J1M A;  5DNF A;  4M8A A;  5M3F H;  1I4Q A;  4KN7 C;  3L7Z C;  4DA2 A;  3GDE A;  1ICF B;  5E4X A;  2KUM A;  3FKI G;  2V4D A;  2MQH A;  2PNR C;  2L5T A;  1CHP D;  2K4K A;  3E6Z X;  3L2P A;  1HA6 A;  1HFG A;  3VR2 A;  1HA5 A;  4KKU A;  4DAP A;  2YTY A;  2E76 C;  1W3S A;  5JVG 3;  3NPP A;  1GXD C;  3O13 A;  1GM5 A;  1PH7 A;  3T53 B;  1SRO A;  3A56 A;  4JBM A;  4UPA A;  4IUR A;  4ZYS A;  1A2T A;  1Y1W G;  5ELE A;  4H0L C;  4DV6 Q;  1KAW A;  2PQA B;  3T1H Q;  1I4X A;  1GHJ A;  1NMG A;  5M3M H;  2VUM G;  1BNZ A;  2OTJ A;  5IGC A;  1XX8 A;  4DAY B;  3I4M H;  3PCO B;  1DXM A;  3QR8 A;  1G6Z A;  2E2D C;  3E0E A;  5IT9 c;  2DGY A;  1FGU A;  3SXH A;  2PYK A;  4FO2 A;  2R93 G;  2Q8R E;  3UE0 A;  3A7A B;  1CFM A;  1NBW A;  1QIL A;  4GKJ L;  3MFG A;  2PI2 A;  1S5F D;  3G6J B;  3AYH B;  1I94 L;  3Q24 A;  3MC0 B;  1QZH A;  4X64 Q;  2KCN A;  3T13 A;  3S17 H;  2I5H A;  1QVG A;  5A2Q E;  4RA8 A;  1DJR D;  1SMX A;  2B8G A;  1D5M C;  4QL5 A;  3HOY G;  3A5Z B;  3PO2 G;  1Y69 U;  1FL0 A;  5M5Y H;  2K5N A;  3M4O B;  4MNO A;  4R4O A;  3R3O A;  4C3I G;  2K52 A;  4BBS H;  4Y7N B;  3S2H H;  1P16 A;  1R9T B;  1Q86 C;  3TSS A;  4JI0 L;  1HZA A;  3PIP 3;  1BCP F;  4UP9 A;  1PHJ A;  1TWH H;  3GTO B;  2F4I A;  3BVM A;  3HOW H;  1OXS C;  3S9W A;  1QNU A;  1GOZ A;  2B29 A;  2K14 A;  1D5Z C;  4X3T A;  1VQN A;  3NTH A;  3J81 i;  3K8A A;  2BDN A;  1E22 A;  4LW1 A;  4KJN A;  2YU9 H;  4FVM A;  1XNQ Q;  2UUA L;  1MJC A;  4AYB G;  5BN5 A;  4DV5 Q;  4LF8 Q;  2HIX A;  4TQU S;  2SEB D;  4DR3 L;  4IUP A;  2R3Z A;  2D62 A;  4WFN 3;  1GUG A;  4YCU A;  2AQ2 B;  5GQO A;  5IYD G;  2XTI A;  4IFD J;  1TU2 B;  4E6I A;  1YHB A;  3OIQ A;  3I56 A;  1Y8P B;  2HT1 A;  1UAP A;  2JP1 A;  3MTS A;  2BCO A;  2GA4 B;  2AWO A;  4IAL A;  4GKJ Q;  2RHQ B;  4IUT A;  1V1O A;  1BQQ T;  5EBC A;  4C3J H;  4HJ5 A;  1TWA B;  2Q2H A;  1Y1V B;  1L2F A;  1JMC A;  3CCJ A;  1O7L A;  4CGY B;  4DKA C;  1D8L A;  1A0I A;  2IL8 A;  3TZU A;  4NXN L;  3ER0 A;  4KHV A;  3I4N G;  4R4C A;  2DJF C;  1DOK A;  3ERQ A;  2BE5 C;  2OT2 A;  2WB1 B;  1WD1 A;  2Y0S B;  3NEM A;  1K83 H;  1B1Z A;  2NZO A;  4CKB A;  1CA5 A;  1CK1 A;  1JE5 A;  5FOB B;  3M4Q A;  3HRZ C;  1SLJ A;  3SVM A;  4A3F G;  1NCV A;  3CW2 C;  2Z6K C;  2XRQ D;  4DR5 L;  1GJX A;  4DNT B;  1TY2 A;  3BDC A;  2B2V A;  4JCV E;  2F0I A;  2OQ0 A;  2DNE A;  3GTL H;  1EIG A;  3U9S A;  2K75 A;  1PH8 A;  3FDT A;  3H15 A;  1FNW A;  2UUA Q;  3F2B A;  3EJI A;  4R1J A;  2R7Z B;  1LT5 D;  3CPF A;  1JJG A;  3P20 A;  4TKO B;  2NZ1 D;  2EXZ A;  3W3A A;  3OTO Q;  3SHL A;  2VB3 X;  1FNU A;  4J6H A;  2Q8I B;  1NY4 A;  3S1M H;  1CKM A;  2B2V C;  5C0X I;  1MJE A;  2CHB D;  1L0X B;  2OTL A;  3FPP A;  3T1Y Q;  2F0F A;  1IYV A;  5ELC A;  4N8X 1;  1O7Z A;  1SJE D;  3LWU A;  2IHE A;  3JAM L;  3DWA A;  2F3I A;  3V05 A;  1V43 A;  1LTL A;  1J8I A;  1TWC H;  4KJO A;  5FLX L;  3T51 B;  1EY9 A;  2EJG C;  3GTM H;  1G91 A;  3PIO A;  2OWO A;  4ZKB B;  3PMF A;  3STB D;  1KIX A;  2Z1C A;  2VZA A;  1TT2 A;  1DYQ A;  2KEC A;  2R61 A;  3J80 i;  5LL6 S;  4NXN Q;  5EAY A;  4DXF A;  4DXG A;  3K7A B;  5KRU A;  1B4O A;  4XTC S;  5C3E H;  4A3J B;  1VQ5 A;  2EXD A;  2DJG C;  1ZEQ X;  1OXU A;  5COY A;  1E7Z A;  5ELB A;  3KLS A;  1G29 1;  2BDO A;  1BBX C;  3NTI A;  1VQ6 A;  2I0Q A;  1PRT B;  4DR2 L;  4OEL B;  4JYA L;  1QVF A;  4C56 C;  2NWG A;  4RCO A;  2E2H B;  2B8F A;  2RKS A;  1H9S A;  1P8L A;  5M3M B;  3GQB A;  3GV3 A;  4J8Q A;  3GTQ B;  1XMO L;  2IW3 A;  2TMP A;  2K5H A;  5G3L D;  4LFA L;  3F2D A;  1D5X C;  1PTO D;  1VQA A;  1STH A;  4A76 A;  4Y52 H;  4HJ9 A;  3AU7 A;  1ZKO A;  3F1Z A;  3UI2 A;  3NQI A;  2SNM A;  1E3P A;  2WAC A;  1F2Z A;  4EVO A;  1KHI A;  3MWY W;  2WAQ E;  4CHT B;  3OOC A;  5CV4 A;  5F2D A;  1RHP A;  2ID0 A;  4DR1 L;  1V9P A;  2N78 A;  4F7X A;  4K14 A;  1ASZ A;  3M7N A;  2CVR A;  1STN A;  1HNW Q;  3CCU A;  4BXX G;  4N9P A;  3UDX A;  3PF4 A;  1Y1V G;  1PH9 A;  1AEX A;  5M5Y B;  1VMC A;  2PNH A;  1UE7 A;  3I3C A;  4KMU C;  3HOX B;  3RUZ A;  4QMG A;  3RLF A;  3D4R A;  3C46 A;  4GOP B;  4JPB W;  1EU3 A;  2VQF L;  2Y0S G;  2FJ2 A;  4H13 C;  2DY7 A;  1G8Z D;  4DR2 Q;  3K59 A;  2FMM A;  5TSS A;  1D7Q A;  3A54 A;  4L6T B;  5CV6 A;  3K0Y A;  2Z4H A;  1D6E C;  4A3E B;  3K57 A;  3SK6 A;  3JC6 6;  5IOD A;  2NVT B;  2IPK D;  4A3D H;  2YU9 B;  3L9A X;  4YCV A;  1HZ9 A;  2GVB A;  1XMO Q;  2NUC A;  4BBR B;  4XYO A;  4EQ5 A;  1TII D;  2A6E D;  4RKB A;  5C4H A;  3S1R H;  1HQR D;  1ET6 A;  4DR7 L;  3P75 A;  1KAA A;  4IJH A;  3DLL A;  5CV5 A;  2R7Z G;  1U5K A;  1TS3 A;  3PSI A;  1O7I A;  1J5E Q;  3H3V C;  1HXY D;  3K0X A;  4DV0 L;  3RZD B;  1SRU A;  3RZO B;  5C3W A;  4DR1 Q;  4K8I A;  3H94 A;  5J3B A;  1LYL A;  4EQN A;  1QUQ B;  4JI3 L;  4JI7 L;  3QOJ A;  1WI5 A;  2F0D A;  3K5M A;  1AN8 A;  3S14 B;  4JV5 L;  3VDY A;  3CRL C;  2EY2 A;  4F87 A;  1PYW D;  3I55 A;  3EQL C;  3JAM E;  1PH5 A;  2B2Y A;  3OIP A;  1PZJ D;  4OWX B;  4AYB E;  2MNA A;  2MGS A;  2WP8 J;  1TR5 A;  5IY0 A;  2R92 H;  4C1N I;  1MKH A;  1DOM A;  4ZUI A;  2WKD A;  3BZK A;  3CKI B;  4DV7 L;  2EYF A;  2JA5 B;  1PRT F;  1BCP D;  4BWG B;  4ZK9 B;  2PZU A;  4A3J G;  2PW5 A;  4AH6 A;  2VQF Q;  2ASB A;  2XVS A;  2B2Y C;  1E24 A;  2O5J C;  1NTG A;  2ZT9 C;  5E7N A;  3HOV H;  3MFY A;  5JPM C;  4DPG A;  2G5D A;  1KXL A;  1STY A;  2L0C A;  3GTL B;  4LF4 L;  1WCM H;  2D9U A;  4CDD C;  2J7Z A;  3CAM A;  3FEW X;  1YVC A;  4P71 A;  1W2B A;  2F0M A;  5IGB A;  1PH3 A;  3CU7 A;  1HNZ L;  5JJK A;  2XWB B;  1B9M A;  4R4T A;  1DD2 A;  2X69 A;  3Q6S A;  1I4R A;  3PUW A;  2HDL A;  2EYH A;  4DK1 A;  5M3M G;  4DR7 Q;  4QQB X;  2UUB Q;  4IOA A;  3G48 A;  3I4M G;  5CGK A;  5IGD A;  2F0O A;  1EL0 A;  2YTX A;  2Q2I A;  4JW0 A;  4CDC C;  3PIP A;  1X32 A;  3IKJ A;  3J80 c;  2JA6 H;  5DM7 3;  1EEI D;  3SDZ A;  5KIX A;  3HKZ B;  3FKI B;  1GUW A;  2F0S A;  4KKT A;  4OIK A;  1JWU D;  4H02 A;  4JV5 Q;  1EYA A;  3DMU A;  4GKK L;  1JB3 A;  1Q1B A;  2WAQ B;  5H1S E;  2F0T A;  1AP0 A;  2K1B A;  2ZJQ A;  1WTP A;  1L1O A;  2QW7 A;  3W1G A;  5C3E B;  1VQB A;  5BR8 L;  1X56 A;  1Y1W B;  1B50 A;  2DUD A;  1VS0 A;  1V1P A;  2CKZ B;  2F3V A;  4JC0 A;  5D3I B;  1EZ6 A;  2KJX A;  4LMQ D;  5C0X G;  2Q2U A;  2VUM B;  1BKB A;  4XYQ A;  4G4K A;  2YV5 A;  1JJ2 A;  3HOX G;  4JI5 L;  1D2B A;  4DV3 L;  5CV8 A;  3KDF A;  1NNX A;  1ASY A;  2F4V Q;  4KV6 A;  1L1O C;  5IT9 L;  4ABN A;  5IE8 A;  4GN3 B;  4LF4 Q;  1EWC A;  2ZTD A;  3OWF A;  1K28 A;  1B53 A;  1VF7 A;  1S72 A;  4OGQ C;  2JA8 B;  1C4Q A;  4B3R Q;  4GLX A;  4V0B A;  1HNZ Q;  3ERO A;  1BO0 A;  1E1O A;  1FVI A;  3D0F A;  2NB0 A;  4A3B H;  1SE8 A;  1HTP A;  2F0E A;  1RIP A;  2Q8T A;  2WKC A;  2SDF A;  2ZTC A;  3K58 A;  4BBR G;  1K0R A;  1VQP A;  3TQY A;  1YIJ A;  1LTR D;  3TBI B;  1EY6 A;  2IT1 A;  1FJG L;  2Z4I A;  3AB9 A;  5LL6 X;  3RN2 A;  1KC8 C;  1Y8N B;  4DR6 L;  1LLR D;  4EGV A;  4C3I B;  3LNN A;  1T5E A;  5LMU L;  2JEB I;  2F03 A;  2Z9H A;  1EFW A;  2EYO A;  2L12 A;  1Z47 A;  1U0L A;  2RHS B;  4OL7 A;  1U4P A;  2NVY H;  1QJO A;  2A6E C;  4LK1 C;  4XQN A;  2H5X A;  5KNB A;  5JAV A;  1YZ6 A;  2IWH A;  2F0V A;  3RLN A;  2MUY A;  4WJ4 A;  3M85 A;  3CQZ H;  1TWF H;  3S1N H;  1STG A;  2UU9 Q;  2HHH L;  2V1C C;  3TRE A;  2M9V A;  4A3I B;  4AYB B;  5BN3 A;  2ZJR A;  3K7U C;  4JI5 Q;  4A3K H;  2JA5 G;  1EYC A;  2EY1 A;  3KF8 B;  2NZH A;  2QF7 A;  4J15 A;  3I4L A;  4CJ0 B;  4QCL A;  3WOF A;  4IQZ A;  1EQR A;  2A74 C;  2M00 A;  3W5O A;  3BG3 A;  3NBI A;  1D1I A;  3OPO A;  1GKH A;  4YHH L;  3Q23 A;  1CZW A;  2A1A A;  4XT3 B;  3I8Z A;  1OXT A;  5KND A;  4ZRZ A;  2VY3 A;  4P73 A;  1BCP C;  3S1R B;  4IO9 A;  2K28 A;  4JVZ A;  3HKS A;  1BBU A;  2ES2 A;  1I50 H;  3OW7 A;  2PCF B;  5C6A A;  2CWA A;  3TEH B;  1FJG Q;  1TY0 A;  2KHS A;  3PUX A;  1VCI A;  4NDX A;  2ENB A;  5EKK A;  3RLO A;  2JEA I;  1K3B C;  4ILW A;  4P72 A;  5LMU Q;  4UP8 A;  2F1M A;  4A3F B;  3WWV A;  3HKZ G;  3NE5 B;  4FXK C;  1VQ8 A;  1WOC A;  4B3S L;  2K01 A;  1VQ7 A;  1GUO A;  1ILQ A;  5T1I A;  1EY8 A;  2WAQ G;  2FFK B;  3VR5 A;  4R4Q A;  4C3H B;  1HQM C;  1YNX A;  1WTR A;  3PO3 H;  3ICE A;  3Q22 A;  1UWV A;  1STB A;  3NBH B;  5C3E G;  2UXC L;  1EY5 A;  1PZI D;  2XN9 C;  3KJO A;  4A3L H;  3PGZ A;  4N8F A;  2RDG A;  1N9W A;  3UDF A;  3TS0 A;  2PQA A;  1JOO A;  1E2Z A;  3HOV B;  4K2L A;  1IL2 A;  3DUZ A;  2Z6B A;  2B2W A;  2NTT A;  2IHF A;  4UDU C;  4BA1 I;  4GNX A;  5HUR A;  2N49 A;  3BDL A;  2JQO A;  1UEB A;  1WCM B;  4DAY A;  4PNY A;  3GTG H;  3FVQ A;  3C3L A;  2J0T D;  5ELO A;  4IFD H;  5CR3 A;  2MO1 A;  2RF4 A;  1EIF A;  4KTA A;  4RKL A;  1JQY D;  5GAE C;  4YHH Q;  4WJW A;  1B44 D;  3G71 A;  1HR0 L;  5GRO A;  1CSP A;  2JA8 G;  5EGT A;  2B2W C;  4X66 Q;  5EKI A;  4U67 3;  4GNX C;  3QJY A;  4LAA A;  1SYF A;  4KD3 A;  3ONA B;  2F52 A;  2JYO A;  4RCN A;  1H9R A;  2JA6 B;  3HOZ H;  1IHZ A;  1MHW C;  1SMY D;  4KD4 A;  2N55 A;  3QWN A;  2IY5 B;  2OQK A;  4OO1 H;  5FJ8 H;  4GN5 A;  1RJT A;  1MI2 A;  5KYI A;  3BJU A;  3CPW A;  1PFN A;  1VQD A;  3GTP B;  4OWT B;  4LFB L;  4B3S Q;  4A3M B;  4A3C H;  4JG2 A;  3X3M A;  1IW7 D;  2RVL A;  4H44 C;  1WTQ A;  3D3R A;  4PZ8 A;  3OMG A;  1WTW A;  1CKO A;  3A8I E;  3PF5 A;  4B9X A;  2UXC Q;  1EY7 A;  1C8C A;  5I6Y A;  5IP7 H;  4JBK A;  4IUN A;  4LNQ A;  4YCW A;  4A3I G;  1RTN A;  4ZUJ A;  2VQE L;  1EQV A;  4BY1 H;  2FHT A;  1BXT A;  2PMZ E;  1FR3 A;  2C5C A;  4HJ7 A;  2K7V A;  2F0Q A;  1Q12 A;  1WYD A;  4K6L A;  2OEO A;  2K5V A;  3QB3 A;  3H3V H;  3NK9 A;  3EFX D;  3QIA A;  1HR0 Q;  4CJ1 B;  1JWM D;  4A3B B;  4JBW A;  1LTB D;  2EPB A;  1F9S A;  3VR3 A;  4WOR A;  2ZXR A;  2QCP X;  5NUC A;  1O78 A;  1I94 Q;  2MHV A;  2F0P A;  1M4V A;  1SYC A;  5IWA L;  1PH6 A;  2Z0S A;  1X9N A;  3V2T A;  4A3G B;  1A3U A;  2PZT A;  2B63 H;  1SNC A;  3UDI A;  2ICI A;  1ROD A;  2CH4 W;  3C1F A;  3TZD A;  4JI1 L;  3J81 L;  1EWH A;  3TDQ A;  2HIV A;  1I6V C;  1YNJ D;  1JOK A;  3GTJ B;  1KNA A;  1X54 A;  4LFB Q;  1RDP D;  2EJM A;  2MJ8 A;  1D1K A;  1VQ4 A;  4JI0 Q;  1CKN B;  5M5X B;  4K0K L;  3C1E A;  1JR0 D;  5M5W H;  2D0O A;  3S1N B;  5FLM H;  2R92 G;  4O42 A;  2PQE A;  3NEL A;  5C0X J;  1SE3 A;  3RR5 A;  1KAB A;  4C3H G;  4A3K B;  2EYJ A;  3D31 A;  2QGQ A;  2NTS A;  5IGG A;  2VQE Q;  1KQS A;  1C9O A;  4DR3 Q;  3HS0 C;  4A4I A;  4MTN A;  5I6W A;  4OXP A;  3VYU A;  3HOV G;  1WTO A;  1QZG A;  2ICE C;  5HGT A;  4HIK A;  2FMC A;  3OSO A;  3L3O C;  1WFQ A;  3PV0 A;  3IFT A;  4FXD A;  1WCM G;  1BR9 A;  3CCR A;  1ONL A;  3KLS X;  1X55 A;  5ISR A;  2MO0 A;  1I50 B;  3OMC A;  5BN4 A;  4JI2 L;  1QWY A;  3LWE A;  3I90 A;  1EIY B;  1IXR A;  3FMC A;  5IWA Q;  1PTO H;  1Y8O B;  5CV9 A;  4WRD A;  1ILP A;  3VA5 A;  2A68 D;  1N36 L;  1TS4 A;  5M3F B;  4FDB A;  1I3Q H;  4RMF A;  1OTC A;  4JI1 Q;  4APV A;  2JA6 G;  1S5C D;  2XNA C;  2QEJ C;  3MXP A;  2K6A A;  3HG9 A;  3NXW A;  1S4Z A;  2AQ3 B;  4X3S A;  3K5O A;  1E1T A;  4NW2 A;  3H3V I;  1PYB A;  3PO3 B;  4DR5 Q;  4WJ3 M;  4K0K Q;  1E2W A;  1U4R A;  2AQ1 B;  4A3M G;  4HN7 A;  4KKS A;  4QB4 A;  1SMY C;  3T56 B;  4KHP L;  4ODG A;  4LUZ A;  1ENA A;  3KF6 B;  4IN3 A;  3CCL A;  1FD7 D;  4TSS A;  3EBE A;  1EWI A;  4HIM A;  2QEX A;  2CW0 D;  3DM1 A;  1LO5 D;  3B6Y A;  1FNV A;  3I4M B;  1I4P A;  1J6Q A;  2WV6 D;  3HKZ E;  3V96 A;  1IW7 C;  2CWP A;  4R4I A;  3J80 L;  4RGO S;  4NB3 A;  3UDG A;  3EIV A;  3U4V A;  4LUV A;  1N34 L;  2K5Q A;  3OW2 A;  2JXM B;  2NYZ D;  4YWK A;  4KI0 A;  2D0P A;  2E5L L;  3I91 A;  3BYY B;  2PMZ B;  3DWP A;  5C4X H;  1SE2 A;  2KVM A;  1F9R A;  1ML0 D;  4JI2 Q;  3S16 H;  1B3A A;  1NMF A;  2EJF C;  4Q5V A;  4A3B G;  1LM0 A;  4KK7 A;  2NVX H;  3HOZ B;  4HMI A;  1HZC A;  4IPG A;  3UE1 A;  3S17 B;  1HRJ A;  1N36 Q;  1SYB A;  4FP5 D;  2PW7 A;  3A5U A;  1LT3 D;  1BVS A;  3HOY H;  1NE3 A;  3PO2 H;  4I65 A;  2B2T A;  4A3G G;  3CCQ A;  3F2C A;  3S2H B;  4BBS B;  2PPB C;  2I5M X;  4HCS A;  4PMB A;  1K8A C;  3S1Q H;  3W1B A;  3MXN B;  4XT1 B;  1DOL A;  4GOP A;  4GN4 B;  3OYY A;  1TWH B;  3H6M A;  3J81 E;  1XTC D;  4MIU A;  3HOW B;  2R7F A;  3D4D A;  1IBL L;  4JYA Q;  5ELN A;  1HFN A;  3DXJ C;  1VQK A;  4L5R C;  4KHP Q;  4UY8 C;  2B2T C;  1NJI C;  2EYL A;  4F88 A;  4NP5 A;  2G9D A;  4N9T A;  4BY1 B;  1J9O A;  4HMJ A;  1YNJ C;  1M8A A;  4LFA Q;  4EX5 A;  4A3K G;  5JEA H;  3M7G A;  1DZ1 A;  2K04 A;  5I4D A;  4X62 L;  3AMU A;  3ZYY X;  5IYD H;  5JOB A;  1E0B A;  3Q8D A;  1B9N A;  4RHR A;  1WTX A;  1N34 Q;  3KJP A;  1TS5 A;  1NUC A;  4NPS A;  1R4P B;  5K36 G;  5JVH 3;  1QUQ A;  1T5X D;  4GLV B;  4POF A;  4C3J B;  3U58 A;  4FF2 A;  1XTD A;  1MD2 D;  1X3G A;  5CYU A;  1XJV A;  4UP7 A;  1TWG H;  3SE0 A;  5FLX E;  4B08 A;  2EVB A;  1W6J A;  1S3O A;  4DK3 C;  3PUY A;  3T4A C;  4G57 A;  4QGU A;  4RHS A;  1K83 B;  3FHW A;  5M3F G;  1LUZ A;  2K32 A;  3JAM c;  1WJJ A;  3ZJY C;  4XXE A;  2EYP A;  1SDF A;  2A5H A;  1CI3 M;  5I9P A;  1QVC A;  4EQP A;  3CMA A;  2BH2 A;  2BH8 A;  1IL8 A;  1UE5 A;  2C9O A;  2YTV A;  5EKL A;  4L5T A;  5AFW A;  5LHY 1;  2IJ0 A;  1A8V A;  2A68 C;  2ZJP A;  4JI4 L;  3PO3 G;  1WTH A;  1ZXT A;  5D65 A;  3WOE A;  3S15 H;  2L9H A;  3BDO A;  2JE6 I;  1XPU A;  4A3L G;  1PV4 A;  5EPJ A;  4YWL A;  4PMW A;  1UUP A;  2NBF A;  5C4Z A;  3KYH C;  1ET9 A;  2JJQ A;  1T9H A;  2KCT A;  1EYD A;  3S1M B;  4X62 Q;  2AUK A;  4FNF A;  1HH2 P;  1YJW A;  2A6H D;  1U4L A;  3L0O A;  2C35 B;  4DV0 Q;  5JJL A;  2KCM A;  1VQI A;  1VMP A;  1VQC A;  5LMN L;  3D4W A;  3A8J E;  1TWC B;  5I9O A;  3GTM B;  4JI3 Q;  4JI7 Q;  1WD0 A;  1W6K A;  2CW0 C;  3BS1 A;  3W2D A;  2ALY B;  2F0J A;  1PTO B;  3CP0 A;  3VYR A;  4L8J A;  3F2U A;  4K2K A;  2HD3 A;  3SR1 A;  5J1Z A;  3SK8 A;  1I3Q B;  5IYC H;  3IAY A;  3HOZ G;  3I70 A;  4YY3 L;  4DV7 Q;  1PH4 A;  1Q82 C;  2HQL A;  5FJ8 G;  1PLF A;  1AE2 A;  1Q81 C;  3CRK C;  2X6G A;  1Q3L A;  2K5D A;  1PFS A;  3M4O H;  1HTL D;  4MTK A;  4R8I A;  4BBS G;  4Y7N H;  3E9H A;  1R9T H;  4POG A;  5IGF A;  5EBD A;  4NXM L;  4RH6 A;  1VQ9 A;  1JIC A;  5E1F A;  4JI4 Q;  3GTO H;  3MA2 B;  3HOW G;  4C1N K;  4HSV A;  1MIU A;  2RDF A;  1WTV A;  4RAU C;  4HJ8 A;  1F2L A;  2ZM6 L;  5IP7 G;  3J7A V;  2VNU D;  3KDF B;  3ITP A;  4G7O C;  4BY1 G;  3G6E A;  1X3Q A;  1VQM A;  2M2L A;  2PI2 E;  3GO5 A;  4FF3 A;  1QNK A;  1EYG A;  3NTK A;  4IPC A;  5C4X B;  1SNQ A;  3AFQ A;  4QY7 A;  4LF6 L;  2SNS A;  2J4X A;  3S16 B;  4HIO A;  1PVO A;  3KBX A;  1BOS A;  3KLW A;  1A6X A;  3F8T A;  5IGE A;  4GKK Q;  3E0J A;  2NVX B;  4UHV A;  1HR0 W;  3H0G H;  2I07 B;  4PZ6 A;  2L15 A;  1RTO A;  3ULL A;  3MEF A;  4O0A A;  4C3J G;  1K0S A;  4LF9 L;  2K05 A;  3J7Y W;  1TWA H;  1Y1V H;  5BR8 Q;  2K03 A;  1VQG A;  4DV2 L;  2MP1 A;  3TP5 A;  2NN6 H;  1C0A A;  2KEN A;  3S1Q B;  3CCS A;  4OEM B;  1K9M C;  4PQX A;  1AH9 A;  1K8G A;  3K80 C;  4DV3 Q;  3Q0A A;  1SXT A;  2F3W A;  3CD6 A;  3KF8 A;  5EPK A;  2F0U A;  1YHA A;  1Q1E A;  3KLR A;  1M1K C;  2KA7 A;  1JJC B;  4NXM Q;  1Z6H A;  3P1H A;  4A3D B;  2B3G A;  2K50 A;  4I7A A;  2ZM6 Q;  1Q90 A;  1GUT A;  3R2I A;  1A3V A;  1PA6 A;  1I4H A;  5I2Y A;  1TXY A;  1R4Q B;  3T1H L;  4QJF A;  2JK8 A;  1IBK L;  5EJW A;  3SK4 A;  4P74 A;  3CHB D;  1AW7 A;  1Q8I A;  2LMC B;  3IRB A;  4BS9 A;  1VQH A;  4NMZ A;  1A63 A;  4BY7 H;  1PH1 A;  5G3L F;  1PTO F;  4OX9 L;  4DR6 Q;  4KY5 A;  1EY0 A;  1SFO H;  2O4X A;  4DNR B;  4ALP A;  1RF2 D;  1KRS A;  1TWG B;  3KFU A;  1K3R A;  4ZAI A;  4LF9 Q;  2RSN A;  3QG1 A;  2WII B;  2R92 B;  4L5S A;  2R6G A;  3M3Y H;  1HJP A;  4AIM A;  2CH4 A;  4JK1 C;  1PXU A;  2IX3 A;  3MZ5 A;  4X64 L;  2A6H C;  4CBV A;  4DV2 Q;  2N8N A;  2KHI A;  1SBB B;  1LV9 A;  4ZKC B;  2RCN A;  2RSO A;  1JOQ A;  1C48 A;  3TN2 A;  1KDC A;  2IX1 A;  2HHH Q;  3K7A H;  4DK0 A;  3NBH A;  4A3J H;  2BA1 A;  1SNP A;  3H09 A;  5E4W C;  1X3P A;  2NVQ H;  3RNU A;  1BBW A;  3C2P A;  2PO4 A;  5D14 A;  4I7Z C;  3E5S A;  4CJ2 C;  1RKN A;  4A93 H;  1IKL A;  3S15 B;  4K5X A;  4HID A;  4ZQ3 A;  3K5L A;  4RGM A;  2E2H H;  2A69 D;  1XNR L;  5IT9 E;  1S5D D;  2O5I C;  1VQL A;  1XNQ L;  1IBK Q;  3R93 A;  3GTQ H;  4GNX B;  4FF1 A;  4DV5 L;  3DWQ A;  4LF8 L;  2NN6 I;  1ICW A;  1CSQ A;  5J39 A;  5CBE E;  1NAP A;  1ENF A;  2Z8L A;  3MEH A;  4OX9 Q;  1N32 L;  3U50 C;  1TQO A;  1NR4 A;  1STA A;  4KN4 C;  1X3F A;  1I6H H;  4OWW B;  2CFM A;  5FO9 B;  2JN4 A;  1G6P A;  2VB2 X;  2F0H A;  5KNC A;  2JA7 H;  5C4X G;  2AKW B;  5DEH A;  4R9W A;  5EPL A;  1IBM L;  3K5N A;  4V19 0;  1B8A A;  5C44 H;  3J7A 5;  1PRT D;  4JI8 L;  4LFC L;  1DM0 B;  3I72 A;  4JI6 L;  1F2Y A;  3A0J A;  4U68 A;  1H9J A;  1CT1 D;  3VR4 A;  3RMH A;  3AQQ A;  5C0X H;  1EZ8 A;  4B3M L;  5GAD C;  2BA0 A;  1X3E A;  2FXQ A;  1LTG D;  3HOX H;  4ULL A;  1K8O A;  4PV1 C;  1VF5 C;  1L0Y B;  5CMD A;  3R2T A;  4GZY C;  5IP9 H;  3CF5 A;  2L4N A;  3M4Y A;  1FGB D;  5JJI A;  5J22 A;  3A55 A;  3GP7 A;  4PG3 A;  3FP9 A;  2KCC A;  1B70 B;  3M9B A;  4MHE A;  2B39 A;  4IJL A;  4A3E H;  1EUJ A;  4Q0F A;  1XNR Q;  4ID6 A;  4OHJ A;  2NVT H;  4A3D G;  1SNM A;  2L1B A;  1AFP A;  1MSG A;  5COR A;  4BBR H;  2LXJ A;  5JEA G;  3OTO L;  2VL6 A;  2KBN A;  4K5W A;  4P2C B;  4TVA B;  5DM6 3;  1L0W A;  2RDH A;  1XYI A;  1ESF A;  2QDB A;  4HAE A;  1HUM A;  1N32 Q;  1YJN A;  5D3D A;  3T1Y L;  3U4Z A;  4IUV A;  3RZD H;  1QOH A;  3N52 A;  3RZO H;  3H0G B;  3AEV A;  1A3T A;  1CHQ D;  2NVY B;  3GD7 A;  1IBM Q;  3S14 H;  1K8M A;  2RA4 A;  3GTK H;  3J7A F;  4IFD I;  1F77 A;  2Z6K A;  4LJZ C;  4JI8 Q;  4CDE C;  3J7Z C;  1SNO A;  1CKN A;  3MHB A;  4QIW E;  1PYS B;  4LFC Q;  1KDA A;  3H91 A;  4JI6 Q;  1STE A;  3CQZ B;  1YI2 A;  1TWF B;  4DU9 A;  1X65 A;  5FO7 B;  5CC4 A;  2P5Z X;  4IUQ A;  4B3M Q;  2FIN B;  1VQO A;  2VS1 A;  2LS0 1;  3JAM i;  5C3X A;  2XWJ B;  4HED A;  1EFI D;  4NKL A;  4X3U A;  1CA6 A;  2JA5 H;  2Q2T A;  1CZG A;  3LX0 A;  1KDB A;  4IPD A;  3OWE B;  1QE6 A;  3HZX A;  5FKA C;  1CQV A;  1S5E D;  4OO1 I;  2KED A;  3HOU H;  1PH2 A;  1II3 A;  1YHQ A;  3BU2 A;  3NSW A;  2LFN A;  3MXG A;  2E2I H;  4DV1 L;  3CC2 A;  4DR4 L;  3HGB A;  4GS3 A;  3HEJ A;  5I2X A;  1VQJ A;  2UUC L;  4EQO A;  3VYT A;  2KOL A;  1OXV A;  3K6O A;  2E2J H;  3TP8 A;  1YIT A;  1PMR A;  2QDL A;  4RGT A;  4OON A;  1LAC A;  3EN2 A;  3I4O A;  4BY7 B;  1CQF A;  1KD1 C;  2LKV A;  2CCZ A;  4JBJ A;  1HPC A;  3SGI A;  2K33 A;  2MFI A;  1HUN A;  4JOI A;  5IYB H;  1SFO B;  1SND A;  4RG1 A;  1H9M A;  1KNE A;  4PZ7 A;  2A69 C;  1G2T A;  3FKI H;  3CCM A;  5EQ0 A;  4UAI A;  1GUS A;  1HNW L;  3M3Y B;  5HGQ A;  4LUO A;  1O7Y A;  1XXG A;  3D6C A;  3KBG A;  1RCV D;  2AWN A;  2HUG A;  4IZ8 A;  1BDO A;  3TME A;  1K73 C;  4JOI C;  2HCC A;  5IYC G;  5KYL A;  1TKW B;  4F8M A;  3T16 A;  1IZ6 A;  4ME3 A;  4ME5 A;  3MAQ A;  1NR2 A;  1LTT D;  3KF6 A;  1Y1W H;  1Q7Y C;  1BF4 A;  2NVQ B;  1OXX K;  3I73 A;  3NUC A;  5M9O A;  2KQ3 A;  1SYG A;  2GN5 A;  1U9R A;  2VUM H;  4X65 L;  1YNN D;  4DF7 A;  2N88 A;  3HP3 A;  3GTG B;  4A93 B;  4FXG C;  1PRT C;  2EZV A;  1X6O A;  3M4P A;  1KLG D;  5C5M A;  1H9S B;  3HFZ B;  3NQT A;  4CKE A;  4DV1 Q;  3PUZ A;  4DR4 Q;  1Q8K A;  2H4O A;  2R93 H;  3DEP A;  5L37 A;  1XMQ L;  4B3T L;  2UUC Q;  2JA8 H;  1E2V A;  5FK9 C;  5C5L A;  1G51 A;  3BVZ A;  5JPN C;  1F9P A;  3TRZ A;  1J5E L;  4K8J A;  1I6H B;  1RL2 A;  3R8B A;  2VW9 A;  2JA7 B;  4ZCK A;  1YJ9 A;  2F0W A;  4DN4 M;  4C3I H;  2XRS D;  4BA2 I;  3NP8 A;  5C44 B;  5LMN W;  4QF4 A;  4DNI A;  2F0K A;  3MXN A;  3H0G G;  1OO9 B;  1UE1 A;  2HQE A;  3D6W A;  3S24 A;  2DNC A;  1DON A;  1YBY A;  2ZXP A;  2ZXO A;  3CXC A;  1JCK B;  1PZK D;  4DFA A;  1EIH A;  1XPR A;  2F0L A;  2O2L D;  2NN6 G;  4O1N A;  4TRD A;  3VA7 A;  2TSS A;  2D5D A;  1CUK A;  3ULJ A;  4QIW B;  3J81 c;  5ELF A;  2OXP A;  4L5Q A;  4A3I H;  3ERS X;  4X65 Q;  4GOP C;  2WB1 G;  4DAM A;  5IOC A;  1HZB A;  2EE1 A;  5IIF A;  5C4J H;  5FO8 B;  3DM3 A;  4MZ9 A;  3RN5 A;  1H9K A;  3S2D H;  4MN3 A;  1YEZ A;  2IX0 A;  3LGJ A;  1ZYR D;  2UXD L;  1V8Q A;  2QA4 A;  3ND9 A;  1HHV A;  2E5L Q;  1SAP A;  4DV4 L;  1XMQ Q;  4P75 A;  1Y14 B;  4B3T Q;  3BZD B;  4C2M H;  3EVQ A;  2LY7 A;  3QOL A;  1B3Q A;  4B9W A;  2ZTE A;  1M90 C;  3CC7 A;  4HTH A;  2A8V A;  1PFM A;  1QG7 A;  3J81 j;  2A73 B;  4QUC A;  3IFD A;  1KRT A;  3DEO A;  2UUB L;  1F2M A;  4CDF C;  2EQS A;  5ELD A;  5K5P A;  1SN8 A;  4KLK A;  2B63 B;  1LT4 D;  1F9Q A; 
#chains in the Genus database with same CATH homology
 1ESR A;  3TP7 A;  1EY4 A;  1XWE A;  3A8K E;  5E3F A;  2H1E A;  1LTA D;  5A35 A;  3SEB A;  3GTK B;  5KEE A;  2AUJ D;  1EOT A;  4XQQ A;  2XIW A;  5M5W B;  4HR7 B;  1EU4 A;  1NSN S;  4DAV A;  2OF1 A;  2QIL A;  3G7L A;  1SE4 A;  1S5B D;  3NWS A;  2HDM A;  3IL8 A;  3HOU B;  3VYS A;  1LAB A;  1DCZ A;  2EY6 A;  1IYU A;  1JC7 A;  2E2I B;  2E75 C;  2RBM A;  2G9H D;  3BYT B;  1CM9 A;  1ENC A;  4IFD G;  5T1G A;  2E2J B;  4XQJ A;  3J80 E;  1EEF D;  5JEA J;  4L63 B;  2I46 A;  5DAU A;  1VDZ A;  3GV6 A;  2EYM A;  2VXW A;  3KK7 A;  1YNN C;  2PZW A;  2EDG A;  3EA6 A;  3OHX C;  3MVV A;  3SK5 A;  1PFB A;  1A15 A;  2KEE A;  1SEB D;  1LT6 D;  4OO1 G;  3P7J A;  1UEA B;  2EOT A;  2MPM A;  3BVG A;  1LTI D;  1TS2 A;  3FRP B;  4K5V A;  2QKI C;  1QB5 D;  1PTO C;  3MXU A;  3VR6 A;  1SJH D;  1KLU D;  4M1U B;  1SSO A;  1V1P B;  2DN8 A;  1BUV T;  3U9O A;  3URY A;  3PIO 3;  1KTK A;  1CTM A;  1LTS D;  4HCE A;  1U4M A;  4X3K A;  2SOB A;  4OIJ A;  4DGZ A;  3NHH A;  2L55 A;  4KHZ A;  3DHQ A;  2YYZ A;  2WIN B;  3D8G A;  2R93 B;  2K5W A;  1Z7T A;  3NWT A;  2D2C C;  1A2U A;  4FF4 A;  1MGS A;  5A2Q L;  4RWS C;  1UNS A;  1I4G A;  1MBY A;  3HOY B;  3KUP A;  3PO2 B;  4QUF A;  1HCZ A;  1ZYR C;  4R8N A;  4G7H C;  1WVL A;  4KY7 A;  2F0N A;  4IUU A;  1AZQ A;  2X6L A;  5KGU A;  1TVX A;  1SYD A;  2JSO A;  1RD9 D;  1JE4 A;  3RD4 A;  1EQT A;  3ND8 A;  4XDX A;  1G2S A;  3TP6 A;  4K6D A;  4H7B A;  3A7L A;  1BCP B;  3N6R A;  1PDQ A;  4RFB A;  5C4J B;  2XSC A;  2HCI A;  1GUN A;  4PMC A;  4YIJ A;  4FYD A;  4Z9C B;  4KY6 A;  3S2D B;  2RQX A;  1IKM A;  4CKC A;  1MSH A;  3PUV A;  3X3N A;  4G7Z C;  1O80 A;  2F0G A;  1JOR A;  4C2M B;  3WDN A;  5JJZ A;  4XIG S;  2DY8 A;  2BE5 D;  1JWS D;  2EY5 A;  5CV7 A;  5K36 H;  2B2U A;  4HSP A;  4S3S A;  2E74 C;  3FPU B;  1SYE A;  1QCB D;  1GHK A;  5CBA E;  3I4N B;  1FYC A;  1B2T A;  2BOS A;  4RGN A;  4ZLT F;  2L11 A;  3QO2 A;  2B2U C;  2CQA A;  1AZP A;  4J1M A;  5DNF A;  4M8A A;  1I4Q A;  4KN7 C;  3L7Z C;  4DA2 A;  5E4X A;  2KUM A;  2V4D A;  2PNR C;  2L5T A;  1CHP D;  3E6Z X;  1HA6 A;  1HFG A;  3VR2 A;  1HA5 A;  4KKU A;  4DAP A;  2E76 C;  5JVG 3;  3NPP A;  1GXD C;  3O13 A;  3T53 B;  3A56 A;  4IUR A;  4ZYS A;  1A2T A;  5ELE A;  4H0L C;  1I4X A;  1GHJ A;  1BNZ A;  5IGC A;  1XX8 A;  1DXM A;  1G6Z A;  2E2D C;  3SXH A;  2PYK A;  4FO2 A;  2Q8R E;  3A7A B;  1CFM A;  1QIL A;  3MFG A;  1S5F D;  3G6J B;  3Q24 A;  3MC0 B;  2KCN A;  3T13 A;  5A2Q E;  4RA8 A;  1DJR D;  2B8G A;  1D5M C;  1Y69 U;  3M4O B;  3R3O A;  4C3I G;  4Y7N B;  1R9T B;  3TSS A;  3PIP 3;  1BCP F;  3GTO B;  2F4I A;  3BVM A;  1OXS C;  3S9W A;  1QNU A;  1GOZ A;  1D5Z C;  4X3T A;  3NTH A;  2BDN A;  4KJN A;  4FVM A;  5BN5 A;  4TQU S;  2SEB D;  4IUP A;  2R3Z A;  2D62 A;  4WFN 3;  1GUG A;  4IFD J;  2AQ2 B;  1TU2 B;  4E6I A;  3OIQ A;  1Y8P B;  1UAP A;  2JP1 A;  3MTS A;  2BCO A;  2GA4 B;  2AWO A;  4IAL A;  4IUT A;  1V1O A;  1BQQ T;  5EBC A;  1TWA B;  1Y1V B;  1O7L A;  4CGY B;  2IL8 A;  3TZU A;  4KHV A;  1DOK A;  2BE5 C;  2OT2 A;  2WB1 B;  3ERQ A;  1WD1 A;  2Y0S B;  1B1Z A;  4CKB A;  1CA5 A;  1CK1 A;  5FOB B;  3HRZ C;  3SVM A;  1NCV A;  2XRQ D;  1GJX A;  4DNT B;  1TY2 A;  3BDC A;  2B2V A;  2F0I A;  2DNE A;  1EIG A;  3U9S A;  3FDT A;  1FNW A;  3EJI A;  2R7Z B;  1LT5 D;  3P20 A;  4TKO B;  2NZ1 D;  2EXZ A;  3W3A A;  3SHL A;  2VB3 X;  1FNU A;  4J6H A;  2Q8I B;  2B2V C;  5C0X I;  2CHB D;  1L0X B;  3FPP A;  2F0F A;  1IYV A;  5ELC A;  1O7Z A;  1SJE D;  3LWU A;  3JAM L;  3DWA A;  3V05 A;  1V43 A;  1J8I A;  4KJO A;  5FLX L;  3T51 B;  1EY9 A;  2EJG C;  1G91 A;  4ZKB B;  3PMF A;  2Z1C A;  1TT2 A;  1DYQ A;  2KEC A;  2R61 A;  5LL6 S;  4DXF A;  4DXG A;  3K7A B;  5KRU A;  1B4O A;  4XTC S;  4A3J B;  1ZEQ X;  1OXU A;  5COY A;  5ELB A;  3KLS A;  1G29 1;  2BDO A;  1BBX C;  3NTI A;  1PRT B;  4C56 C;  2NWG A;  4RCO A;  2E2H B;  2B8F A;  2RKS A;  1H9S A;  5M3M B;  3GQB A;  3GV3 A;  4J8Q A;  3GTQ B;  2IW3 A;  2TMP A;  5G3L D;  1D5X C;  1PTO D;  1STH A;  3AU7 A;  1ZKO A;  3UI2 A;  3NQI A;  2SNM A;  2WAC A;  1F2Z A;  4EVO A;  3MWY W;  4CHT B;  5CV4 A;  3OOC A;  5F2D A;  1RHP A;  2ID0 A;  4F7X A;  4K14 A;  3M7N A;  2CVR A;  1STN A;  4N9P A;  1AEX A;  5M5Y B;  1VMC A;  3I3C A;  4KMU C;  3HOX B;  3RUZ A;  4QMG A;  3RLF A;  3D4R A;  3C46 A;  1EU3 A;  2FJ2 A;  4H13 C;  2DY7 A;  1G8Z D;  3K59 A;  2FMM A;  5TSS A;  3A54 A;  4L6T B;  5CV6 A;  3K0Y A;  2Z4H A;  1D6E C;  4A3E B;  3K57 A;  3SK6 A;  5IOD A;  2NVT B;  2IPK D;  2YU9 B;  3L9A X;  2NUC A;  4BBR B;  4XYO A;  1TII D;  2A6E D;  4RKB A;  5C4H A;  1HQR D;  1ET6 A;  3P75 A;  1KAA A;  5CV5 A;  1TS3 A;  3H3V C;  1HXY D;  3RZD B;  3RZO B;  5C3W A;  4K8I A;  3H94 A;  4EQN A;  3QOJ A;  2F0D A;  3K5M A;  1AN8 A;  3S14 B;  3CRL C;  2EY2 A;  4F87 A;  1PYW D;  3EQL C;  3JAM E;  2B2Y A;  3OIP A;  1PZJ D;  2MGS A;  2WP8 J;  1TR5 A;  4C1N I;  4ZUI A;  1DOM A;  2WKD A;  3CKI B;  2EYF A;  2JA5 B;  1PRT F;  1BCP D;  4BWG B;  4ZK9 B;  2PZU A;  2PW5 A;  2XVS A;  2B2Y C;  2O5J C;  2ZT9 C;  3MFY A;  5JPM C;  1STY A;  2L0C A;  3GTL B;  2D9U A;  2J7Z A;  3FEW X;  2F0M A;  5IGB A;  3CU7 A;  2XWB B;  1B9M A;  1DD2 A;  2X69 A;  3Q6S A;  1I4R A;  3PUW A;  2HDL A;  2EYH A;  4DK1 A;  5CGK A;  5IGD A;  2F0O A;  1EL0 A;  1X32 A;  3IKJ A;  5DM7 3;  1EEI D;  3SDZ A;  5KIX A;  3HKZ B;  3FKI B;  1GUW A;  2F0S A;  4KKT A;  4OIK A;  1JWU D;  1EYA A;  3DMU A;  1JB3 A;  1Q1B A;  2WAQ B;  2F0T A;  1AP0 A;  2K1B A;  1WTP A;  5C3E B;  1Y1W B;  1B50 A;  5D3I B;  1V1P A;  2F3V A;  1EZ6 A;  2KJX A;  4LMQ D;  5C0X G;  2VUM B;  4XYQ A;  4G4K A;  1D2B A;  5CV8 A;  4KV6 A;  5IT9 L;  4ABN A;  1EWC A;  3OWF A;  1B53 A;  1VF7 A;  4OGQ C;  2JA8 B;  1C4Q A;  4V0B A;  3ERO A;  1BO0 A;  2NB0 A;  1HTP A;  2F0E A;  2Q8T A;  2WKC A;  2SDF A;  3K58 A;  1LTR D;  3TBI B;  1EY6 A;  2IT1 A;  2Z4I A;  3AB9 A;  5LL6 X;  1Y8N B;  1LLR D;  4EGV A;  4C3I B;  3LNN A;  1T5E A;  2JEB I;  2F03 A;  2EYO A;  2L12 A;  1Z47 A;  4OL7 A;  1U4P A;  1QJO A;  2A6E C;  4LK1 C;  4XQN A;  5KNB A;  5JAV A;  2IWH A;  2F0V A;  2MUY A;  3M85 A;  1STG A;  2M9V A;  4A3I B;  4AYB B;  5BN3 A;  1EYC A;  2EY1 A;  2QF7 A;  3I4L A;  4CJ0 B;  4QCL A;  3WOF A;  4IQZ A;  2A74 C;  2M00 A;  3BG3 A;  3NBI A;  1D1I A;  3OPO A;  3Q23 A;  1CZW A;  4XT3 B;  3I8Z A;  1OXT A;  5KND A;  4ZRZ A;  1BCP C;  3S1R B;  2K28 A;  3OW7 A;  2PCF B;  5C6A A;  1TY0 A;  2KHS A;  3PUX A;  1VCI A;  4NDX A;  2ENB A;  5EKK A;  2JEA I;  4ILW A;  2F1M A;  4A3F B;  3NE5 B;  4FXK C;  2K01 A;  1GUO A;  1ILQ A;  5T1I A;  1EY8 A;  2FFK B;  3VR5 A;  4C3H B;  1WTR A;  1HQM C;  3Q22 A;  1STB A;  1EY5 A;  1PZI D;  2XN9 C;  2RDG A;  1JOO A;  1E2Z A;  3HOV B;  4K2L A;  3DUZ A;  2B2W A;  2NTT A;  4UDU C;  4BA1 I;  5HUR A;  3BDL A;  1WCM B;  4DAY A;  4PNY A;  3FVQ A;  3C3L A;  2J0T D;  4IFD H;  5CR3 A;  4RKL A;  4KTA A;  1JQY D;  4WJW A;  1B44 D;  5EGT A;  2B2W C;  5EKI A;  4U67 3;  3QJY A;  4LAA A;  1SYF A;  4KD3 A;  3ONA B;  4RCN A;  2JYO A;  1H9R A;  2JA6 B;  1IHZ A;  1SMY D;  4KD4 A;  2N55 A;  3QWN A;  4OO1 H;  1RJT A;  1MI2 A;  5KYI A;  1PFN A;  3GTP B;  4A3M B;  3X3M A;  1IW7 D;  2RVL A;  4H44 C;  1WTQ A;  3D3R A;  3OMG A;  1WTW A;  3A8I E;  4B9X A;  1EY7 A;  1C8C A;  5I6Y A;  4IUN A;  1RTN A;  4ZUJ A;  1EQV A;  2FHT A;  1BXT A;  1FR3 A;  2C5C A;  2K7V A;  2F0Q A;  1Q12 A;  4K6L A;  2OEO A;  3QB3 A;  3NK9 A;  3EFX D;  3QIA A;  4CJ1 B;  1JWM D;  4A3B B;  4JBW A;  1LTB D;  2EPB A;  1F9S A;  3VR3 A;  4WOR A;  2ZXR A;  2QCP X;  5NUC A;  1O78 A;  2MHV A;  2F0P A;  1M4V A;  1SYC A;  3V2T A;  4A3G B;  1A3U A;  2PZT A;  1SNC A;  2ICI A;  1ROD A;  3C1F A;  3TZD A;  3J81 L;  1EWH A;  3TDQ A;  1I6V C;  1YNJ D;  1JOK A;  3GTJ B;  1KNA A;  1RDP D;  2EJM A;  2MJ8 A;  1D1K A;  5M5X B;  3C1E A;  1JR0 D;  3S1N B;  4O42 A;  2PQE A;  5C0X J;  1SE3 A;  1KAB A;  4C3H G;  4A3K B;  2EYJ A;  3D31 A;  2NTS A;  5IGG A;  3HS0 C;  5I6W A;  3VYU A;  1WTO A;  2ICE C;  5HGT A;  2FMC A;  3OSO A;  3L3O C;  3PV0 A;  3IFT A;  4FXD A;  1BR9 A;  1ONL A;  3KLS X;  5ISR A;  1I50 B;  3OMC A;  5BN4 A;  1QWY A;  3LWE A;  3I90 A;  3FMC A;  1PTO H;  1Y8O B;  5CV9 A;  4WRD A;  1ILP A;  3VA5 A;  2A68 D;  1TS4 A;  5M3F B;  1S5C D;  2XNA C;  2QEJ C;  3MXP A;  2K6A A;  3HG9 A;  3NXW A;  1S4Z A;  2AQ3 B;  4X3S A;  3K5O A;  4NW2 A;  3PO3 B;  1E2W A;  1U4R A;  2AQ1 B;  4HN7 A;  4KKS A;  4QB4 A;  1SMY C;  3T56 B;  4ODG A;  1ENA A;  4IN3 A;  1FD7 D;  4TSS A;  2CW0 D;  3DM1 A;  1LO5 D;  1FNV A;  3I4M B;  1I4P A;  2WV6 D;  3V96 A;  1IW7 C;  3J80 L;  4RGO S;  2K5Q A;  2JXM B;  2NYZ D;  4KI0 A;  3I91 A;  3BYY B;  2PMZ B;  3DWP A;  1SE2 A;  2KVM A;  1F9R A;  1ML0 D;  1B3A A;  2EJF C;  4Q5V A;  4KK7 A;  3HOZ B;  4HMI A;  3S17 B;  1HRJ A;  1SYB A;  4FP5 D;  2PW7 A;  1LT3 D;  4I65 A;  2B2T A;  3S2H B;  4BBS B;  2PPB C;  4HCS A;  4PMB A;  4XT1 B;  1DOL A;  1TWH B;  3H6M A;  3J81 E;  1XTC D;  4MIU A;  3HOW B;  3D4D A;  1HFN A;  3DXJ C;  2B2T C;  2EYL A;  4F88 A;  4NP5 A;  2G9D A;  4N9T A;  4BY1 B;  1J9O A;  4HMJ A;  1YNJ C;  1M8A A;  5JEA H;  3M7G A;  1DZ1 A;  2K04 A;  5I4D A;  3AMU A;  3ZYY X;  5JOB A;  1E0B A;  1B9N A;  4RHR A;  1WTX A;  1TS5 A;  1NUC A;  1R4P B;  5K36 G;  5JVH 3;  1T5X D;  4C3J B;  4FF2 A;  1MD2 D;  5CYU A;  3SE0 A;  5FLX E;  4B08 A;  2EVB A;  1W6J A;  3PUY A;  3T4A C;  4G57 A;  4RHS A;  1K83 B;  2K32 A;  4XXE A;  2EYP A;  1SDF A;  2A5H A;  1CI3 M;  5I9P A;  4EQP A;  1IL8 A;  2C9O A;  5EKL A;  5AFW A;  5LHY 1;  2IJ0 A;  2A68 C;  1ZXT A;  5D65 A;  3WOE A;  2L9H A;  3BDO A;  2JE6 I;  5EPJ A;  4PMW A;  1UUP A;  2NBF A;  5C4Z A;  1ET9 A;  1EYD A;  3S1M B;  2AUK A;  4FNF A;  2A6H D;  1U4L A;  1VMP A;  3D4W A;  3A8J E;  1TWC B;  5I9O A;  3GTM B;  1WD0 A;  1W6K A;  2CW0 C;  3BS1 A;  3W2D A;  2F0J A;  1PTO B;  3VYR A;  4L8J A;  3F2U A;  4K2K A;  3SR1 A;  5J1Z A;  3SK8 A;  1I3Q B;  3IAY A;  3I70 A;  1PLF A;  3CRK C;  2X6G A;  1Q3L A;  2K5D A;  1HTL D;  4R8I A;  5IGF A;  5EBD A;  4RH6 A;  1JIC A;  5E1F A;  3MA2 B;  4C1N K;  4HSV A;  2RDF A;  1WTV A;  4RAU C;  1F2L A;  3J7A V;  2VNU D;  3ITP A;  4G7O C;  1X3Q A;  2M2L A;  3GO5 A;  4FF3 A;  1QNK A;  3NTK A;  5C4X B;  1SNQ A;  2SNS A;  2J4X A;  3S16 B;  3KBX A;  1BOS A;  1A6X A;  5IGE A;  3E0J A;  2NVX B;  2I07 B;  1RTO A;  4C3J G;  2K05 A;  3J7Y W;  2K03 A;  2MP1 A;  3TP5 A;  2NN6 H;  3S1Q B;  4PQX A;  3Q0A A;  1SXT A;  2F3W A;  3KF8 A;  5EPK A;  2F0U A;  1Q1E A;  3KLR A;  2KA7 A;  1Z6H A;  3P1H A;  4A3D B;  1Q90 A;  1GUT A;  3R2I A;  1A3V A;  1I4H A;  5I2Y A;  1R4Q B;  5EJW A;  3SK4 A;  3CHB D;  1AW7 A;  1Q8I A;  2LMC B;  4BS9 A;  4NMZ A;  5G3L F;  1PTO F;  4KY5 A;  1EY0 A;  2O4X A;  4DNR B;  1RF2 D;  1TWG B;  4ZAI A;  2RSN A;  3QG1 A;  2WII B;  2R92 B;  2R6G A;  4JK1 C;  1PXU A;  2IX3 A;  3MZ5 A;  2A6H C;  4CBV A;  1SBB B;  1LV9 A;  4ZKC B;  2RSO A;  1JOQ A;  1C48 A;  3TN2 A;  1KDC A;  2IX1 A;  4DK0 A;  3NBH A;  2BA1 A;  1SNP A;  3H09 A;  5E4W C;  1X3P A;  3C2P A;  2PO4 A;  5D14 A;  4I7Z C;  3E5S A;  4CJ2 C;  1RKN A;  1IKL A;  3S15 B;  4K5X A;  4ZQ3 A;  3K5L A;  4RGM A;  2A69 D;  5IT9 E;  1S5D D;  2O5I C;  3R93 A;  4FF1 A;  3DWQ A;  2NN6 I;  1ICW A;  5J39 A;  5CBE E;  1NAP A;  1ENF A;  2Z8L A;  3MEH A;  1TQO A;  1NR4 A;  1STA A;  4KN4 C;  5FO9 B;  2VB2 X;  2F0H A;  5KNC A;  5DEH A;  4R9W A;  5EPL A;  3K5N A;  4V19 0;  1PRT D;  1DM0 B;  3I72 A;  1F2Y A;  4U68 A;  1H9J A;  1CT1 D;  3VR4 A;  3RMH A;  5C0X H;  1EZ8 A;  2BA0 A;  1LTG D;  4ULL A;  1K8O A;  4PV1 C;  1VF5 C;  1L0Y B;  5CMD A;  3R2T A;  4GZY C;  2L4N A;  3M4Y A;  1FGB D;  5J22 A;  3A55 A;  3GP7 A;  2KCC A;  4MHE A;  2B39 A;  4Q0F A;  4ID6 A;  4OHJ A;  1SNM A;  2L1B A;  1AFP A;  1MSG A;  5COR A;  5JEA G;  4P2C B;  4K5W A;  5DM6 3;  2RDH A;  1XYI A;  1ESF A;  2QDB A;  4HAE A;  1HUM A;  5D3D A;  4IUV A;  1QOH A;  3N52 A;  3H0G B;  1A3T A;  1CHQ D;  2NVY B;  3GD7 A;  1K8M A;  2RA4 A;  3J7A F;  4IFD I;  1F77 A;  4LJZ C;  1SNO A;  3MHB A;  1KDA A;  3H91 A;  1STE A;  3CQZ B;  1TWF B;  4DU9 A;  5FO7 B;  5CC4 A;  4IUQ A;  2FIN B;  2LS0 1;  5C3X A;  2XWJ B;  4HED A;  1EFI D;  4NKL A;  4X3U A;  1CA6 A;  1CZG A;  3LX0 A;  1KDB A;  3OWE B;  1QE6 A;  3HZX A;  5FKA C;  1CQV A;  1S5E D;  4OO1 I;  2KED A;  1II3 A;  3NSW A;  2LFN A;  3MXG A;  3HGB A;  3HEJ A;  5I2X A;  4EQO A;  3VYT A;  2KOL A;  1OXV A;  3K6O A;  3TP8 A;  1PMR A;  4RGT A;  1LAC A;  4BY7 B;  1CQF A;  2LKV A;  1HPC A;  2K33 A;  1HUN A;  1SFO B;  1SND A;  1H9M A;  1KNE A;  2A69 C;  1G2T A;  5EQ0 A;  4UAI A;  1GUS A;  3M3Y B;  1O7Y A;  1XXG A;  3D6C A;  3KBG A;  1RCV D;  2AWN A;  2HUG A;  4IZ8 A;  1BDO A;  3TME A;  2HCC A;  5KYL A;  1TKW B;  4F8M A;  3T16 A;  3MAQ A;  4ME5 A;  1NR2 A;  1LTT D;  2NVQ B;  1BF4 A;  1OXX K;  3I73 A;  3NUC A;  5M9O A;  1SYG A;  2KQ3 A;  1U9R A;  1YNN D;  4DF7 A;  2N88 A;  3HP3 A;  3GTG B;  4A93 B;  4FXG C;  1PRT C;  2EZV A;  1KLG D;  5C5M A;  1H9S B;  3NQT A;  4CKE A;  3PUZ A;  2H4O A;  3DEP A;  1E2V A;  5FK9 C;  5C5L A;  3BVZ A;  5JPN C;  1F9P A;  4K8J A;  1I6H B;  3R8B A;  2JA7 B;  2F0W A;  4DN4 M;  2XRS D;  4BA2 I;  3NP8 A;  5C44 B;  4QF4 A;  2F0K A;  3MXN A;  1OO9 B;  2HQE A;  3D6W A;  2DNC A;  1DON A;  2ZXP A;  2ZXO A;  1JCK B;  1PZK D;  4DFA A;  1EIH A;  2F0L A;  2O2L D;  2NN6 G;  4O1N A;  4TRD A;  3VA7 A;  2TSS A;  2D5D A;  4QIW B;  5ELF A;  2OXP A;  5IOC A;  5IIF A;  2EE1 A;  5FO8 B;  1H9K A;  4MN3 A;  2IX0 A;  1ZYR D;  1V8Q A;  3ND9 A;  1HHV A;  1SAP A;  3BZD B;  3EVQ A;  2LY7 A;  3QOL A;  4B9W A;  4HTH A;  1PFM A;  1QG7 A;  2A73 B;  4QUC A;  3IFD A;  3DEO A;  1F2M A;  5ELD A;  5K5P A;  2B63 B;  1LT4 D;  1F9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...