4R8NA

Crystal structure of staphylococcal nuclease variant v23i/v66i/i72v/i92v at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4r8nA00
4PMCA 1EY5A 1A2TA 1EY0A 1STAA 5IGCA 5CV7A 4PNYA 4IZ8A 3E5SA 4I65A 4J1MA 3SK4A 5EKLA 4KY5A 3RUZA 2F0OA 4N9TA 5E1FA 3HZXA 1EZ6A 2EY5A 5I9PA 5C3WA 4K5WA 5CV8A 4DF7A 4LAAA 2F0PA 5K5PA 2F3VA 1STBA 3OMGA 2F0FA 2PQEA 5CV9A 3NQTA 4NDXA 2SOBA 4KTAA 2O4XA 2NUCA 2EY1A 1A2UA 3NP8A 5I6YA 5KRUA 2F0VA 3LX0A 4ZUIA 3SXHA 3TP7A 4EQNA 5KEEA 5J39A 4ID6A 4RKLA 3HEJA 2PZUA 1SYDA 5CV6A 3QOLA 3TMEA 5IGBA 1EYCA 4NP5A 5KYIA 3NXWA 5IODA 2OXPA 2QDBA 4IALA 5EKKA 2F0DA 1II3A 1SNQA 2RKSA 4KD4A 5I9OA 4H7BA 3D4DA 4N9PA 2EYHA 5JOBA 1EY8A 5CR3A 4K8JA 1KDBA 1A3TA 5J1ZA 3T13A 2F0TA 2EYOA 4KJOA 3P75A 1EQVA 1KAAA 2F0JA 2F0EA 3EVQA 2OF1A 2OEOA 3NUCA 4QF4A 5C6AA 1STGA 4RKBA 3C1EA 2PZWA 5C3XA 2F0QA 5CV4A 2KHSA 2RBMA 3C1FA 4G57A 4ODGA 1EYDA 1EY7A 3H6MA 5C5LA 3EJIA 4WORA 5IIFA 1AEXA 3R3OA 1TT2A 5C5MA 5IGDA 4KHVA 2EYPA 5HURA 3MEHA 1SNOA 1JOKA 1U9RA 3QOJA 4J6HA 4NKLA 4K8IA 3U9OA 4DGZA 2EYFA 3DHQA 4EQPA 4ME5A 2RDFA 1SNMA 2HQEA 3BDCA 4DU9A 5M9OA 4K2KA 1SYFA 4ZUJA 1STYA 3OWFA 4NMZA 3SK8A 1EZ8A 1F2YA 4B9XA 1TQOA 2KQ3A 4K2LA 1STHA 2SNMA 3D6CA 3DMUA 4KY6A 5C4ZA 5C4HA 1ENCA 3V2TA 3T16A 4F7XA 1NSNS 1JOQA 1EY4A 2WACA 4R8NA 5IOCA 4K5VA 1SYCA 3SHLA 4S3SA 1RKNA 4QB4A 5I6WA 1EY6A 2F0SA 4KY7A 4DFAA 2PYKA 2F0GA 1SYBA 3TP6A 2PZTA 2F0IA 5DAUA 4OL7A 1STNA 3ERQA 2EYMA 5DEHA 2ENBA 3TP8A 1A3VA 1JOOA 3P1HA 3SK5A 2EXZA 3MXPA 5E3FA 3MHBA 3SK6A 4WRDA 2EYJA 5NUCA 4QMGA 4HTHA 4KJNA 3QB3A 4E6IA 1EYAA 2F0NA 4ZQ3A 4K6DA 1A3UA 1KDAA 1F2ZA 2F0UA 1JORA 4HMIA 5JAVA 5J22A 1SNDA 3BDLA 5ISRA 1SYEA 3ITPA 2PW5A 1SNPA 3OSOA 1IHZA 5F2DA 4TRDA 1NUCA 2EYLA 3SR1A 2M00A 4B9WA 3PMFA 5CC4A 5HGTA 3NHHA 4K14A 4EQOA 5KGUA 1SNCA 1KDCA 1TR5A 2EY2A 2EY6A 2F0LA 2LKVA 2F3WA 3EROA 4HMJA 5CGKA 3D8GA 5KIXA 3D4WA 4PMBA 4MIUA 4EVOA 5EGTA 5IGFA 2F0MA 5IGEA 3MZ5A 5IGGA 1F2MA 4IUNA 4K5XA 2F0KA 2PW7A 4KV6A 5CV5A 2F0HA 1ENAA 2SNSA 3MVVA 3NK9A 4YIJA 3TP5A 3S9WA 1EY9A 2F0WA 3OMCA 1KABA 4KD3A 5KYLA 1SYGA 3VA5A 4F8MA
chains in the Genus database with same CATH superfamily
4NXNL 5IGCA 3NQIA 4JI4L 4O2DA 1TY0A 1HXYD 4DV0Q 1EQQA 4O1NA 2MPMA 2KJXA 4WFN3 3F2BA 5M5XB 3TSSA 1DGSA 2IT1A 1MHWC 1PFBA 5CV8A 1I50B 1BCPD 4LFBQ 2LXKA 3NWTA 3W2DA 1ENFA 5I2XA 1QZHA 3N52A 3LX0A 2C35B 4BXXH 4ZYSA 1VQ4A 4OO1I 1CKNA 5CV6A 1EYGA 2IPKD 4JW0A 1L0YB 2VB2X 4F87A 4YY3Q 3KFUA 1Q1BA 1KDBA 2CCZA 1HPCA 3BYTB 4NB3A 3BZDB 5GROA 3EN2A 3EVQA 4JVZA 4POFA 4P72A 4QF4A 1A63A 1YEZA 5C6AA 1EWIA 1ZYRC 2B2VA 2LXJA 2RBMA 4GOPC 3EJIA 1E22A 3A0JA 5IIFA 1GHJA 4N8X1 2WKDA 4J6HA 2L0CA 5L37A 2B2UA 1YHQA 2B29A 4K2KA 1SYFA 1IBKQ 2KQ3A 1JT8A 3DMUA 1TWCH 3HOUB 4KKSA 1ENCA 1BNZA 3E9HA 3PF4A 2I5MX 1JE4A 5FJ8G 4HIMA 3CP0A 4YWMA 4DAMA 2KENA 1NR4A 5BR8Q 2ENBA 4DR6Q 3GTMH 3SVMA 1WCMG 2LFNA 2F0NA 1AE3A 1KDAA 2R7ZH 1E1OA 1F2ZA 1E3PA 1ICFB 2VXWA 2Q2UA 3NTIA 1A15A 1FJGQ 4RGNA 2ZTCA 3R2TA 2CH4W 2K5DA 5DM73 4QCLA 2D0OA 5FJ8H 3IFTA 3AB9A 2OQ0A 3CCVA 3PUWA 3VR4A 3FMCA 4A3EH 3OTOL 1LV9A 1XMOL 3HOZG 1KDCA 2WAQB 4X65Q 1V9PA 5IP7H 4AYBB 1VDZA 1EQRA 1BBXC 3D4WA 4FNFA 3I4NB 1WTPA 4A93B 1HHVA 2D9UA 3Q0AA 3NK9A 2F0WA 5KYLA 2WB1G 3ULJA 1T9HA 2JXMB 2FXQA 4IFDG 2ZM6L 3E5SA 4CKBA 1S5FD 2RHSB 4DR5Q 2F0OA 4B3MQ 3HOZH 3HZXA 4LWCA 1SMYD 2M9VA 2A69C 3DM3A 3OMGA 1STBA 2UU9L 4B3RQ 1D1KA 3K7AB 1CHPD 1WJJA 1A2UA 3M4YA 3GTOB 4M8AA 2K33A 3MXUA 4U68A 1KNEA 1CZGA 1JCKB 1SYDA 3CW2C 4ALPA 3O13A 1GM5A 1OTCA 3GD7A 3HFZB 3K59A 4IUVA 2ZXOA 4Q0FA 4OELB 4CKCA 1SE4A 1VQOA 3D4DA 1WFQA 5ELDA 1K8OA 5CR3A 4LFAQ 2CKZB 2MHVA 4DAVA 4RA8A 3GTLB 1HZAA 2DJFC 1XMQL 2PQAB 1QG7A 2YTYA 2AMCB 4CJ2C 1PH1A 4A3JG 4IUQA 3GTJH 2IW3A 2YU9B 4DK1A 3D3RA 4DV2Q 3HOXG 2ZTDA 4EQPA 3GP7A 1RD9D 1K0SA 3STBC 4LF5Q 2ZT9C 1VQCA 5FLMG 4GNXB 1IBMQ 2CQAA 3CHBD 4K0KQ 1XNRQ 2DUDA 3F1ZA 2UUAL 4LW1A 1SFOB 4UY8C 5COYA 4A3JH 4XYOA 4DV3Q 4RH6A 1EY6A 2F0SA 4DFAA 2F4VL 3J81j 3HOXH 4GN4B 1KL9A 1W3SA 2DY7A 3S1MH 2K4KA 1JQYD 2A8VA 4HTHA 3BDOA 4X66Q 1EYAA 2VQEL 3RN2A 3CCMA 2F0UA 1UEAB 1FYCA 5JAVA 3A56A 3TS0A 1SNDA 3BDLA 1YVCA 3K5NA 4YHHQ 3ITPA 4JI2L 4A3IB 2L55A 1CKMA 3W1GA 1GJXA 4BY7B 2Y0SB 3S1QH 3KBXA 2ZJPA 1N8RC 1A6XA 5EGTA 1SMYC 3G48A 4KV6A 3HOWG 2SNSA 3TP5A 3L2PA 3HOVB 3UDGA 1KABA 4GN5A 1PH5A 2Q2TA 4H44C 1TWHH 2VZAA 2I5HA 1VQGA 4BWGB 4DR4L 4IPHA 3GO5A 5E1FA 3C46A 4DUZL 2EY5A 1EWCA 5M3MG 4C3IH 3FKIG 1F9SA 4C1NI 3A54A 4LF8Q 1S40A 2EY1A 1WTXA 2QW7A 3N6RA 2XTIA 1DONA 2NN6I 5J39A 5C0XG 4R8IA 3NXWA 2KECA 4LF9Q 5C44G 1OXUA 2JA9A 2KUMA 3P75A 3SGIA 5M3MH 1PTOH 3NUCA 2GVBA 3FKIH 3KF6A 2VUMG 2H1EA 1RJTA 3PGZA 4KKTA 1PYSB 1EY7A 2AQ1B 3CMAA 5CBAE 5C0XH 3Q22A 1Y14B 2HQLA 3TZDA 5FO9B 1TT2A 2QDLA 3FP9A 1AZPA 4RWSC 4GOPB 4BBSB 5C44H 2R6GA 2F03A 1X54A 4JI1L 2G9HD 1N34Q 1P16A 1F2YA 1RDPD 4YCVA 4TVAB 2EDGA 1S3OA 3S16H 3F2DA 4LFCQ 3D6WA 4R8NA 1X9NA 3PQIA 1N33Q 1M90C 3QO2A 1PLFA 4IN3A 1WCMB 2QILA 1LTLA 4LUZA 1STNA 5C4JB 2KHJA 2I07B 5E3FA 1V1QA 2Z4IA 3OW2A 2OT2A 3NELA 1GXDC 1RTNA 5LL6S 4BBRH 3G7LA 2K5QA 2KBNA 4PZ6A 2JJQA 4GKJL 2FJ2A 2JA7G 2B3GA 2R3ZA 3BU2A 3NSWA 1IKMA 4HSPA 1JB7A 4HN7A 1YHBA 4CDEC 4YCWA 3CCEA 2L4NA 5LMNQ 1FVIA 5HY6A 1HNXL 5ELFA 4X3KA 4AQYQ 1XWEA 1V8QA 4PMBA 1T5XD 2JSOA 4DAYA 1PXUA 4B3SL 3L7ZC 4L5QA 1MSHA 1B4OA 2JA7H 5AFWA 2JK8A 3IKJA 1ILPA 4TSSA 1HNZL 4PNYA 4OHJA 3J7A5 4N9TA 1LTAD 1B2TA 2VB3X 5I9PA 5CYUA 5FLXE 5M5YB 1G6ZA 2CFMA 4NDXA 4KTAA 1BXTA 1Q7YC 2NVYH 5KNCA 3PUYA 4ZCKA 5KEEA 4GKKQ 1KNAA 5JPMC 3S2DH 1SJED 1KLUD 2A73B 4DV4Q 2RQXA 1NY4A 5IE8A 5JEAG 1BF4A 4QIWB 1K0RA 5EPJA 1EY8A 3R8BA 2J0TD 4A75A 4KJOA 1CA5A 1UE5A 3EQLC 3S2HH 3EA6A 2QEXA 4BY1H 1I4QA 1EYDA 2JA6G 4R4IA 4DR3Q 1EEID 3R3OA 5G3LD 4X62Q 5IGDA 4JK1C 1PZJD 1SNOA 4DGZA 1GUTA 2K5NA 1VQJA 5JEAH 1ESFA 3WDNA 4JBJA 4KHPQ 2EE1A 1WD1A 4X64L 4J8QA 1DOKA 5ELBA 1DJRD 3H09A 1WI5A 1JOQA 3PO2B 5IOCA 2HUGA 1LUZA 1RCVD 5M5XH 3I73A 3LNNA 3RZOB 1X32A 1LTTD 3BJUA 1DZ1A 2UXDQ 1I50H 1XNQL 2K75A 5AJ3L 1G291 4DR7L 4E6IA 2EIFA 1HJPA 5LMUL 1MKHA 4OEMB 1IYUA 5HGTA 4OX9L 2TSSA 3HOWB 1KRSA 1K83B 1XYIA 1H9SA 5FOBB 3X3MA 3BG3A 3FPPA 1K3RA 2UXCQ 3H94A 3AFPA 1LT4D 3OMCA 3I2ZA 2YV5A 1SEBD 1HR0L 3ND8A 4JV5L 3K0YA 4B3TL 4POGA 3OHXC 2VQFL 1TWGB 4UPAA 4JI0Q 1PZID 2BCOA 3KLRA 3RD4A 4C3JB 4A3CG 3HOUH 2XVSA 2B2WC 1D1IA 4JI8Q 1LO5D 3TMEA 2MUYA 3KLSX 5ELNA 4C1NK 4XT3B 1Q90A 1CFMA 4BS9A 5EKKA 4EX5A 4AYBG 1OXSC 2R92B 2VUMB 1EEFD 4HAEA 1CSPA 1HA6A 1X56A 2EOTA 4DUYQ 5J1ZA 3MXNB 2F0JA 3NBHB 1YITA 3VR6A 4IURA 3HG9A 3TZUA 4XYQA 2KOLA 3BVMA 4APVA 1SE3A 1AEXA 2M2LA 4DNRB 1QVCA 1TY2A 2D2CC 5HURA 3G71A 1KC8C 1G8ZD 3QOJA 4IOCA 3M4OB 1C4QA 1V1PB 1WTVA 3TBIB 3I4NH 2HQEA 4A93H 4NMZA 5FO7B 1D6EC 1KLGD 1STHA 1SDFA 4F7XA 1AP0A 4QGUA 2I5LX 3SHLA 3TP6A 1SE8A 4A3KB 1TKWB 1JOOA 2JP1A 2MQHA 3PCOB 5CORA 3K7AH 3L9AX 3GTOH 1SYEA 1X3QA 3I91A 4JYAQ 3KUPA 2WINB 1G91A 4DN4M 1V43A 5EPKA 2EYLA 3DUZA 2YTXA 3NHHA 3GTLH 4EQOA 1TR5A 2EY2A 2DNCA 3H3VC 3D4RA 3D8GA 2WFWA 4L8JA 5BN4A 1L1OA 2XWJB 2ES2A 1B8AA 2Q8IB 4YIJA 3M4PA 1C7YA 2YU9H 4UP8A 2MGSA 3S15B 4HJ8A 3S1RB 3H0GG 5IT9c 3L0OA 2ZJQA 3C3LA 5C3WA 5D65A 3JAME 2DY8A 1DCZA 1SFOH 2SOBA 4A3IG 3QIAA 4DPGA 2FMMA 1LABA 4BY7G 2Y0SG 3U4ZA 3QOLA 1EYCA 1II3A 2RKSA 2K28A 1PHJA 2K5HA 5C3EB 2NBFA 3CD6A 3OTOQ 1G2SA 4X3UA 4IOAA 2JA6B 1EQVA 5A2QE 3BS1A 3GTQB 5CMDA 2F0EA 3HOVG 2OEOA 4A3IH 4DV5Q 3K8AA 5CV4A 2KHSA 1IBLL 2GVAA 3H6MA 2BDNA 4BY7H 1UE7A 4DNIA 4FVMA 2ZXRA 2FHTA 5E7NA 1I94L 3VR3A 3T4AC 2Z6KC 1LTRD 3SK8A 1STYA 3OWFA 4X3TA 3HOVH 5FK9C 3RLFA 5A35A 5ELEA 2AWOA 5EQ0A 2K14A 4S3SA 4FXKC 2F0GA 3PIO3 2F0IA 5DAUA 2E2JB 3KOJA 3PUXA 1VMPA 5ELOA 5BN3A 3CCJA 1AFPA 4LF7Q 2JN4A 1TXYA 4H02A 2HIVA 4OIKA 1WTWA 1MBYA 4AIMA 4CGYB 2R93B 1E2ZA 5JVG3 1XMQQ 2E5LL 1NUCA 4KN4C 3LGJA 4BBSG 1VQMA 5CC4A 2BA0A 2A68C 3Q6SA 5KGUA 3EROA 2F0LA 1X55A 2MO0A 1CM9A 1VQ5A 3UDXA 4DV6Q 1KTKA 3NTHA 4IUNA 4PZ8A 3J80i 3WOEA 1XXGA 4X6AH 2F0HA 2CWAA 1ILQA 3VA7A 3J7ZC 4WJ3M 1PVOA 5D3DA 1YNND 3VA5A 2UUAQ 1JC7A 4V190 1EY5A 2A6HD 4BBSH 4KN7C 4QUFA 1M4VA 1B3AA 4KY5A 1E24A 4KI0A 5JVH3 2F4VQ 1W6JA 2RVLA 5IWAL 3NQTA 1O7YA 1JWUD 4I7AA 1D7QA 1U4LA 2VQEQ 3NP8A 4ZUIA 1WCMH 4EQNA 4NXMQ 4RKLA 1JMCA 2PZUA 3KLWA 3NPPA 1BCPC 5FLXL 4CDCC 2QDBA 4IALA 5C4JH 4CKEA 1HA5A 2PO4A 1O7ZA 3J81E 2EYHA 5JOBA 2NYZD 4I7ZC 3T13A 2F0TA 2Q2IA 1XPRA 1O7LA 2PCFB 3PUZA 3NBHA 4G4KA 4DV0L 1YJ9A 1K73C 4G57A 5C5LA 1Q46A 4WORA 4HJAA 4OO1G 4C2MB 5ELCA 4DK6C 2KA7A 4NKLA 1JB3A 4ME5A 5IYDG 4OXPA 1EU4A 4DR4Q 2BDOA 4CDDC 4IFDH 2HDMA 4DUZQ 4LNQA 3G6JB 4K2LA 4LF6Q 3D6CA 4WJWA 1FD7D 2E2HB 1PTOD 5GADC 2ATWA 4OO1H 4QB4A 1B70B 3I4OA 2G5DA 3U9SA 1HZCA 1WYDA 1FGUA 3PO3G 2EPBA 5M5YH 2NVQB 2K1BA 4PZ7A 2AKWB 3VYTA 3T56B 3SK6A 4WRDA 1EFWA 5JJIA 4KJNA 5E4XA 4XQJA 4HMIA 3Q23A 3AQQA 4R1JA 2CHBD 1SXTA 1NBWA 4H13C 3T1YL 2HHHQ 1LTID 1XJVA 1YNNC 1U0LA 3E6ZX 2JA5G 4CHTB 1EU3A 2MFIA 3PIP3 3HOYB 4XQNA 4MIUA 2L1BA 4FXGC 3PIOA 3PO2G 1NTGA 2Z6BA 5BR8L 3H0GB 3S1NB 4KD3A 5FLMH 1SYGA 1M1KC 1OXXK 2R61A 3V05A 3FDTA 2IX3A 1SRUA 1ZEQX 2B2VC 5FLXc 3OOCA 4JG2A 1I4PA 3SK4A 1FJGL 1QNUA 2Z4HA 4O0AA 4IPGA 1DYQA 1NMGA 4FF1A 3KF8A 2WB1E 4CJ0B 1BCPF 4MTNA 1VQNA 3PO2H 1B1ZA 4EGVA 2A6ED 4A3FB 2B2UC 1PRTD 3OWEB 2A19A 3SXHA 4X65L 5DNFA 3RZOH 3OW7A 1WTHA 1VQ7A 2PI2A 3BVGA 1B3QA 1UE6A 1I6VC 2B63B 1LTSD 4C3HB 1IYJB 1U4PA 3EBEA 1W2BA 1SSOA 1NAPA 4BA1I 3KDFB 4JI7L 1YIJA 1HNXQ 5BN5A 1K28A 1VQBA 2NB0A 1K8GA 2K32A 2EJGC 2BOSA 1SMXA 4ILWA 5LL6X 3B6YA 1YNXA 4B3SQ 5I2YA 3DXJC 4B3RL 4KHVA 4DR2L 3HOWH 1ASYA 1U9RA 1JOKA 4C3JG 1K83H 2NZOA 4K8IA 4LF4L 2EYFA 1HNZQ 4A3GB 3NEMA 1DOLA 2IX0A 3UDIA 1BQQT 2EJFC 1TS4A 4O42A 1EZ8A 2QKIC 3M4QA 1Q82C 1LT5D 2K03A 3R2IA 3CXCA 2SNMA 2X6LA 4A3BB 3I90A 3V2TA 3VYRA 1L0XB 4NW2A 2R92G 1TWGH 2OCEA 3SE0A 4HIOA 1BR9A 4DV1L 1QWYA 4C3JH 2DJGC 4OWXB 3MXPA 5EPLA 1HTPA 2K01A 5HGQA 3CCUA 4CBVA 1CI3M 1BO0A 2K6AA 3H15A 1LLRD 4IUTA 3J80E 4LF5L 3A74A 1SNPA 2R92H 2VUMH 5GAGC 4JI5L 2V1CC 1C9OA 1ICWA 3DM1A 4R9WA 2UUCL 2B2TA 2M00A 4K0KL 1XNRL 1QILA 1X6OA 3A8JE 2MJ8A 4K14A 4LK1C 4PMWA 1SNCA 4X3SA 3RMHA 1PH7A 2EY6A 2O2LD 5CGKA 3CRKC 3IRBA 5CBEE 3URYA 1H95A 4NPSA 2B39A 1NJIC 4Y7NB 1UAPA 4HJ5A 4A3KG 4X66L 3RZDB 3M4OH 4MN3A 1PH3A 3TRZA 5M3FB 3CCQA 4ULLA 5EKLA 4YCUA 4YHHL 2RCNA 2UXBQ 1HTLD 5C4XG 4GN3B 4K5WA 5K5PA 2F0PA 5CV9A 3T1HL 3A7LA 4QY7A 2J4XA 2O4XA 1D5MC 3PIPA 4A3KH 2I46A 2H5XA 5LHY1 4G7OC 1K3BC 2F0DA 5E4WC 3JAML 2NTSA 4CJ1B 1SR3A 2A74C 2B8GA 1F9QA 1BCPB 2JA8G 3MA2B 2O5JC 1NE3A 2LS01 3J7YW 3Q24A 2MO1A 3CCLA 4IPCA 1N9WA 1PFNA 2KVMA 1IYVA 3S14B 2NVTB 3ONAB 1QNKA 2NN6G 4LF8L 2GA4B 3PUVA 5A2QL 3DEOA 2ICIA 1CZWA 3TS2A 4Q5VA 3U9OA 1HNWQ 5JJKA 3KLSA 4QL5A 1Q8IA 1HUMA 4FXDA 4RAUC 2K7VA 3CC7A 4FF2A 4RMFA 1KRTA 3J7AF 1OO9B 3JAMi 5GAEC 1QVGA 2ICEC 5DM63 3S15H 3PO3B 3S1RH 4K5VA 2VNUD 2PQAA 4CDFC 2NN6H 5C3EG 3A8IE 2AHOB 4UAIA 1CUKA 4JI3Q 4FDBA 1PYBA 3SK5A 2EXZA 1PZKD 1O78A 3DEPA 3D0FA 2X6GA 3WOFA 5H1SE 1WD0A 1TWAB 3FHWA 3QJYA 2JA5B 4GNXA 4TRDA 5EJWA 4MZ9A 3D31A 1N34L 1VQLA 1S5CD 5C3EH 1Z9FA 2QGQA 2BE5D 1EUJA 2JA6H 3GTQH 4KY7A 3F2CA 3OPOA 4GS3A 1ZKOA 1N33L 2N49A 2PMZE 2N78A 4EVOA 4UDUC 3IL8A 3MZ5A 1CKNB 2PW7A 2E75C 3CC2A 2CVRA 4PMCA 1PA6A 3CPFA 2JQOA 1QUQB 3I4MG 4J1MA 3JAMc 1PYWD 2K50A 3FEWX 4KHZA 4ZLTF 2R93G 2E2DC 2RCFA 4UHVA 2AUKA 2K5WA 1N32Q 4A3DG 3RNUA 4XDXA 5I6YA 5GQOA 2F0VA 2VY3A 5DLQE 1D5XC 4XQQA 1WOCA 4AQYL 5IGBA 1B44D 4QUCA 4NP5A 2E2JH 1HQRD 4RCOA 1SNQA 1CA6A 1GUSA 1N36Q 3NBIA 4YWLA 1R4PB 4JOIA 3UE1A 2R93H 3KDFA 4JC0A 5JPNC 1J5EQ 1HFNA 1NMFA 1Z47A 3HKZE 5C3XA 1WTQA 4OONA 3M7GA 1Y8PB 1I4GA 3T51B 3I8ZA 5C5MA 5J3BA 1SNMA 3UI2A 2A5HA 1PV4A 1SN8A 1T5EA 3J7AV 2NTTA 4DV4L 1H9KA 1PH2A 2CW0D 2Z6KA 5KNBA 1NSNS 4A3CH 1EY4A 4DR1L 1WTRA 1PH8A 1AW7A 5FO8B 1ESRA 1GUNA 2PYKA 1TVXA 5IYCG 3TQYA 4L5RC 1JICA 1Y69U 1B9MA 3AYHB 3J81i 4GOPA 3QB3A 4DR3L 2NZHA 4NXNQ 1ONLA 2EZVA 4JI4Q 4DV7L 3I4LA 1H9RA 1CTMA 1M8AA 2IWHA 3OSOA 5F2DA 1JJGA 2KEEA 3VYSA 2DNEA 4A3LG 1PMRA 1O80A 5IYCH 2A1AA 2AUJD 3JC66 1I94Q 1KXLA 3DLLA 3GTGB 1F77A 1EIHA 5CV5A 1H9MA 3MVVA 4TQUS 4JI6L 3K7UC 1L2FA 2TMPA 3S9WA 1EY9A 4DXFA 4C2MH 5C4XB 4H0LC 3NWSA 4IZ8A 3NENA 1HZBA 1J9OA 1GUOA 4A3LH 3R93A 1R9TB 1EZ6A 2C9OA 1IW7D 2B2YC 2F3VA 2E2HH 2KCMA 3GDEA 1FNWA 1VQ8A 3ULPA 2NZ1D 3UE0A 1YZ6A 3W3AA 3T53B 1I5FA 4FYDA 4ID6A 3HEJA 4XIGS 2JA8B 3QG1A 1SLJA 4ZAIA 4RGOS 5IODA 2NVQH 3HOYG 1CK1A 2UXCL 1BKBA 1ZYRD 1YJWA 3U58A 1TS2A 3ICEA 5K36G 4ZK9B 1A3TA 1IXRA 1ZXTA 2CH4A 1BBWA 3W1BA 1KAAA 1Y1VG 5LMNW 1LT3D 3CPWA 4XTCS 5IP9G 3C1EA 1D5ZC 2WAQE 3CCSA 4JI0L 2K04A 1AZQA 1MJCA 4AYBE 2E76C 2K52A 3U50C 2QF7A 1A62A 3HOYH 5G3LF 4JI8L 3GTKB 3BYYB 3DHQA 5EAYA 2FFKB 1Z7TA 4A3FG 1KQSA 5M9OA 4LMQD 1H9JA 3H3VH 1GOZA 1MSGA 3H0GH 4MTKA 1S72A 3S1NH 1V1OA 4KY6A 5IP9H 3G4SA 1XMOQ 3VDYA 3TREA 2WACA 1X65A 2F3IA 2B63G 2J7ZA 4MHEA 4C3HG 3VR2A 4RHRA 3HKZB 2K5VA 1EL0A 2UUBL 1ET9A 1Y8NB 2N55A 4XT1B 1VQPA 3BVZA 4BXXG 4A3FH 1I4HA 3Q8DA 4K6DA 1A8VA 2WP8J 2ZM6Q 3E0JA 4L5TA 1JJCB 1W6KA 1TWFH 4JPBW 3S17B 2ID0A 5EKIA 1UUPA 2B63H 1QE6A 4C3HH 1MIUA 5M5WB 1PH4A 4A3GG 4IFDI 4HEDA 2UU9Q 3G6EA 1BBUA 3GTPB 3K81C 3J80L 4A3BG 2E2IB 1UEBA 1RL2A 2SDFA 5IGFA 2F0MA 1LTGD 1IL8A 5IGEA 3M3YB 1IW7C 4DK3C 1X3EA 1HZ9A 3KYHC 3I4MB 2EVBA 2D5DA 2A69D 1YHAA 4L6TB 2OWOA 4HJ9A 1QUQA 4A3GH 1D2BA 2ZXPA 3EIVA 1VQAA 4A3DB 2JE6I 4JYAL 3KF6B 3F8TA 4PG3A 4A3BH 2PNRC 2ZJRA 2F0FA 2PQEA 1TS3A 1IL2A 2JEAI 3C2PA 2JEBI 3P7JA 3CF5A 2OXPA 5C0XJ 3T1YQ 4P75A 1DD2A 1J6QA 3OIPA 4GLXA 3K80C 2R7ZG 1JR0D 2LSSA 1R4QB 4OIJA 2EJMA 1BUVT 2EYOA 4QQBX 2Y0SE 4DNTB 1EOTA 4OWTB 1I3QB 1G6PA 4R4TA 1STGA 5I4DA 2PZWA 4A3EG 2KCNA 4OGQC 3STBD 2RF4A 5M3FG 1VQKA 5IYBG 1PDQA 5IP7G 1BVSA 2EYPA 1E1TA 1K8MA 4JI2Q 1PH6A 2EQSA 4KMUC 3RLOA 4R4OA 4Y7NH 2IX1A 2HCIA 5C4ZA 3MXNA 3RZDH 3T16A 4A3MB 3QWNA 1SYCA 5M3FH 1GO3E 5I6WA 1L1OC 1RKNA 2K05A 3CQZB 5IYBH 4LJZC 4L63B 4DV5L 1AH9A 1GVPA 3TP8A 3P1HA 4DAYB 4LFBL 2DN8A 4FF4A 2EYJA 4QMGA 3J80c 1GHKA 1FR3A 1V1PA 2IY5B 1A3UA 2OQKA 4P73A 2NVXB 4JI7Q 1RHPA 5D3IB 1IHZA 1TU2B 4PV1C 5JJLA 2GN5A 3L3OC 1VCIA 4B9WA 3KBGA 4YY3L 1K8AC 3BZKA 4R4CA 1CT1D 5IT9E 1YI2A 2H4OA 4DR2Q 2XN9C 4LF4Q 1CQFA 1KD1C 4J15A 1D8LA 4IJLA 1GKHA 2D0PA 1EOVA 4JBWA 2F0KA 4K5XA 4LUOA 3K58A 4ZKCB 2NVTH 4YWKA 4Y52H 5IYDH 4F8MA 5C0XI 1Y1WB 1ML0D 4JBMA 1A2TA 3ER0A 4LF7L 1STAA 4RGMA 1YBYA 1CHQD 1U4RA 2O5IC 3M85A 2FINB 1S5BD 3RUZA 3CKIB 4DV1Q 1WTOA 1IBKL 1B53A 1I6HB 2A6HC 3PO3H 2L15A 2NUCA 4IQZA 2XNAC 5KNDA 4JI1Q 4U673 5KYIA 4RHSA 4DV6L 1Q81C 1Y1VB 4DR6L 2Q8RE 1DM0B 1E0BA 4HIDA 4JI5Q 2UUCQ 1HH2P 1EIYB 5JEAJ 4EQ5A 4K8JA 4QJFA 1TWAH 2D62A 1O7IA 2JA5H 1VQ9A 1RIPA 3A7AB 3TEHB 4RKBA 1HRJA 3K5LA 2LMCB 1Q1EA 1A0IA 3LWUA 4XXEA 2QEJC 1C8CA 3MXGA 1E2VA 3OIQA 1SE2A 4N8FA 1VQIA 1TWFB 2L12A 1XX8A 4NXML 3CRLC 4GKJQ 2XSCA 4A76A 1STEA 4P74A 4HR7B 2RSOA 4B9XA 2WKCA 3HP3A 5C4HA 3T1HQ 2KCCA 2QA4A 1RTOA 3RR5A 1C0AA 4M1UB 2JYOA 2P5ZX 3DWPA 1VQDA 4DR5L 4B3ML 4LUVA 4OL7A 4C3IG 1H9SB 2EYMA 1Q3LA 1G2TA 1VMCA 2QCPX 3FRPB 1PTOC 1VQHA 1PH9A 4TKOB 2XRQD 2CQOA 1E7ZA 1SJHD 4QIWE 1JWMD 4FP5D 1MI2A 2AQ2B 1QJOA 3CU7A 3MEFA 5J22A 5ISRA 3AEVA 1KHIA 3M9BA 4KKUA 1XTDA 1QCBD 4PQXA 2G9DA 2KHIA 4LF6L 4LFAL 3IFDA 1VQ6A 2YYZA 2AQ3B 2AWNA 5KIXA 1KIXA 1HCZA 1LACA 1UWVA 1TWCB 3K5OA 4DV2L 1UNSA 5CV7A 4AH6A 3AMUA 2FMCA 3NTKA 2OTLA 4I65A 3RLNA 1AN8A 4KLKA 1IBML 2I0QA 4DF7A 2XIWA 2YTVA 4LAAA 2HHHL 3GTMB 3AU7A 2VL6A 2VW9A 3MFGA 2E74C 4DV3L 2R7ZB 3TP7A 1X3FA 3ULLA 4P71A 4X64Q 4K6LA 2ZTEA 3ERSX 4KD4A 2A6EC 4H7BA 2HD3A 3BZCA 4BBRG 1PRTC 4N9PA 4A3EB 1DOMA 3I72A 2PPBC 1RF2D 3QR8A 3A8KE 2E8GA 1VQEA 3HGBA 3PF5A 1S5ED 3EFXD 3NE5B 3DWAA 3CMEA 3K57A 2ALYB 2HIXA 1XNQQ 5AJ3Q 3P20A 3IAYA 1LT6D 5IY0A 3I3CA 4DR7Q 1VS0A 1NNXA 2RDHA 1OXTA 2Z1CA 3K0XA 2B2WA 1PFSA 1WVLA 3V96A 4ME3A 1MD2D 5GAHC 5LMUQ 1LTBD 3BDCA 1KAWA 2IJ0A 3GTGH 3KK7A 3HOZB 3A5ZB 4GZYC 1P8LA 1U4MA 1MJEA 5C4XH 4OX9Q 1PTOF 4ZKBB 4HCEA 4HCSA 3I56A 1SYBA 1R9TH 2WB1B 5D14A 1F2LA 3ERQA 5DEHA 1K9MC 1L1OB 1U5KA 1UE1A 3K5MA 1HR0Q 4JV5Q 1X3PA 4ZQ3A 4B3TQ 2L9HA 2VQFQ 4L5SA 3LWEA 2JA8H 4UP9A 1S5DD 1FNVA 4RCNA 4LF9L 3GTJB 4G7ZC 2Z9HA 1VQFA 1Q8KA 2Q2HA 2BH2A 2XRSD 4DAPA 1OXVA 4P2CB 5EBCA 4BY1G 1Q12A 1IZ6A 1EIFA 1CSQA 3HKZG 1ENAA 1B7YB 3MTSA 4R4QA 4FF3A 3GTKH 4C56C 1JWSD 2IHFA 4DR1Q 4A3JB 3MFYA 2LY7A 3A55A 5TSSA 1F9RA 3KJPA 3HOXB 1QB5D 4UP7A 2C5CA 2SEBD 2N3SA 4LFCL 1SBBB 3FVQA 3S1MB 1Z6HA 2B8FA 5KRUA 2B2YA 1PRTF 3CC4A 2EXDA 3ZYYX 4DV7Q 1JJ2A 1EFID 2RDGA 3GV3A 3E9IA 1EQTA 4ZRZA 5I9OA 3H91A 1J8IA 1BDOA 3S1QB 2N8NA 4JBKA 2OF1A 3SEBA 3S17H 3CAMA 5M5WH 2UXBL 3VYUA 2CWPA 1HUNA 4IO9A 1QZGA 1JE5A 1I4RA 3X3NA 4JI6Q 3GTPH 4DKAC 1Y8OB 5LMNL 3I70A 2Q8TA 3M7NA 1VF7A 2E2IH 1TWHB 3E0EA 1SAPA 3I55A 3M3YH 1QVFA 4DU9A 2MP1A 1HFGA 2PNHA 2Z0SA 2B2TC 4ZUJA 3WWVA 3I4MH 3CCRA 1VF5C 1TQOA 1XPOA 3S14H 1X3GA 4C3IB 1SROA 1NR2A 1IKLA 1PFMA 2KEDA 4A3DH 4DA2A 3RN5A 3HOUG 1LM0A 3J81L 1GUGA 2VS1A 3TN2A 3PSIA 2L11A 3KJOA 3MHBA 5NUCA 4WJ4A 1E2WA 1GD7A 2PI2E 1YNJD 1S4ZA 4FO2A 1JORA 1Q86C 3MC0B 3K6OA 3HRZC 5M3MB 3FPUB 1PTOB 5JJZA 4GKKL 4F88A 1HNWL 3HS0C 2PW5A 1QOHA 3FKIB 3UDFA 2F4IA 4JCVE 1FNUA 4HSVA 3SR1A 3H3VI 1ET6A 4KK7A 1I4XA 2L5TA 2IL8A 1I3QH 2LKVA 2F3WA 1FGBD 4V0BA 3W5OA 1LYLA 4A3MG 4ABNA 3PV0A 5C44B 3ND9A 1F2MA 4JI3L 3S24A 3ZJYC 2BE5C 2X69A 2WAQG 3MAQA 5IT9L 4IUPA 4X62L 3S16B 3I4NG 3E3XA 1EY0A 3VR5A 4GLVB 1C48A 4A93G 2Z8LA 4DXGA 3OYYA 1RODA 4KHPL 2R7DA 1GUWA 2UUBQ 1IBLQ 2F52A 4OWWB 2HDLA 1DXMA 2HCCA 4A3MH 3GV6A 4RGTA 3DWQA 3CQZH 4BBRB 2DGYA 1TIID 4IUUA 1YJNA 2MNAA 2UXDL 1FL0A 1NCVA 4BA2I 2ASBA 1B50A 2RHQB 1TS5A 2NVXH 2OTJA 3AFQA 1ASZA 4IFDJ 1PRTB 1Y1WG 1F9PA 3SDZA 1EWHA 2F0QA 3MWYW 1B9NA 1AE2A 1CKOA 3C1FA 4ODGA 2R7FA 1BOSA 1L0WA 1N32L 2PMZB 3MEHA 2JA7B 4GNXC 2BH8A 5FKAC 2BA1A 3J81c 2RDFA 4IPDA 5T1GA 2E5LQ 2WV6D 2KCTA 2NWGA 1N36L 4A4IA 1Y1WH 1YNJC 2N88A 2RSNA 4IJHA 4HJ7A 2NVYB 1J5EL 1EIGA 4DK0A 2PZTA 2HT1A 1XTCD 1MGSA 2CW0C 3U4VA 3S2DB 1A3VA 1I6HH 3TDQA 2V4DA 4Z9CB 2XGTA 5T1IA 2IHEA 4RG1A 1CQVA 4MNOA 4B08A 2A68D 5K36H 1HQMC 5EBDA 3HKSA 3S2HB 1Y1VH 3I7FA 4G7HC 4BY1B 5IWAQ 3PMFA 4GLAC 4DUYL 1XPUA 3KF8B 2F1MA 2XWBB 4HMJA 4HIKA 1HR0W 3GQBA 4RFBA 5IGGA 1G51A 2RA4A 3A5UA 3F2UA 4JOIC 2WIIB
chains in the Genus database with same CATH topology
5IGCA 3NQIA 1TY0A 1HXYD 4O1NA 2MPMA 2KJXA 4WFN3 5M5XB 3TSSA 2IT1A 5CV8A 1PFBA 1I50B 1BCPD 3NWTA 3W2DA 1ENFA 5I2XA 3N52A 3LX0A 4ZYSA 4OO1I 5CV6A 2IPKD 1L0YB 2VB2X 4F87A 1Q1BA 1KDBA 1HPCA 3BYTB 3BZDB 3EVQA 4QF4A 5C6AA 1ZYRC 2B2VA 2RBMA 3EJIA 5IIFA 1GHJA 2WKDA 4J6HA 2L0CA 2B2UA 4K2KA 1SYFA 2KQ3A 3DMUA 3HOUB 4KKSA 1ENCA 1BNZA 1JE4A 1NR4A 2ENBA 3SVMA 2LFNA 2F0NA 1KDAA 1F2ZA 2VXWA 3NTIA 1A15A 4RGNA 3R2TA 5DM73 2K5DA 4QCLA 3IFTA 3AB9A 3PUWA 3VR4A 3FMCA 1LV9A 1KDCA 2WAQB 4AYBB 1VDZA 1BBXC 3D4WA 4FNFA 3I4NB 1WTPA 4A93B 1HHVA 2D9UA 3Q0AA 3NK9A 2F0WA 5KYLA 2JXMB 4IFDG 3E5SA 4CKBA 1S5FD 2F0OA 3HZXA 1SMYD 2M9VA 2A69C 3OMGA 1STBA 1D1KA 3K7AB 1CHPD 1A2UA 3M4YA 3GTOB 4M8AA 2K33A 3MXUA 4U68A 1KNEA 1CZGA 1JCKB 1SYDA 3O13A 3GD7A 3K59A 4IUVA 2ZXOA 4Q0FA 4CKCA 1SE4A 3D4DA 5ELDA 1K8OA 5CR3A 2MHVA 4DAVA 4RA8A 3GTLB 1QG7A 4CJ2C 4IUQA 2IW3A 2YU9B 4DK1A 3D3RA 4EQPA 3GP7A 1RD9D 2ZT9C 2CQAA 3CHBD 1SFOB 5COYA 4XYOA 4RH6A 1EY6A 2F0SA 4DFAA 2DY7A 1JQYD 4HTHA 3BDOA 1EYAA 2F0UA 1UEAB 1FYCA 5JAVA 3A56A 1SNDA 3BDLA 3K5NA 3ITPA 4A3IB 2L55A 1GJXA 4BY7B 2Y0SB 3KBXA 1A6XA 5EGTA 1SMYC 4KV6A 2SNSA 3TP5A 3HOVB 1KABA 4H44C 4BWGB 3GO5A 5E1FA 3C46A 2EY5A 1EWCA 4C1NI 1F9SA 3A54A 2EY1A 1WTXA 3N6RA 1DONA 2NN6I 5J39A 5C0XG 4R8IA 3NXWA 2KECA 1OXUA 2KUMA 3P75A 1PTOH 3NUCA 2H1EA 1RJTA 4KKTA 1EY7A 2AQ1B 5CBAE 5C0XH 3Q22A 3TZDA 5FO9B 1TT2A 1AZPA 4RWSC 4BBSB 2R6GA 2F03A 2G9HD 1F2YA 1RDPD 2EDGA 3D6WA 4R8NA 3QO2A 1PLFA 4IN3A 1WCMB 2QILA 1STNA 5C4JB 2I07B 5E3FA 2Z4IA 2OT2A 1GXDC 1RTNA 5LL6S 3G7LA 2K5QA 2FJ2A 2R3ZA 3NSWA 1IKMA 4HSPA 4HN7A 2L4NA 5ELFA 4X3KA 1XWEA 1V8QA 4PMBA 1T5XD 2JSOA 4DAYA 1PXUA 3L7ZC 1MSHA 1B4OA 5AFWA 3IKJA 1ILPA 4TSSA 4PNYA 4OHJA 4N9TA 1LTAD 1B2TA 2VB3X 5I9PA 5CYUA 5FLXE 5M5YB 1G6ZA 4NDXA 4KTAA 1BXTA 5KNCA 3PUYA 5KEEA 1KNAA 5JPMC 1SJED 1KLUD 2A73B 2RQXA 5JEAG 1BF4A 4QIWB 5EPJA 1EY8A 3R8BA 2J0TD 4KJOA 1CA5A 3EQLC 3EA6A 1I4QA 1EYDA 1EEID 3R3OA 5G3LD 5IGDA 4JK1C 1PZJD 1SNOA 4DGZA 1GUTA 5JEAH 1ESFA 3WDNA 2EE1A 1WD1A 4J8QA 1DOKA 5ELBA 1DJRD 3H09A 1JOQA 3PO2B 5IOCA 2HUGA 1RCVD 3I73A 3LNNA 3RZOB 1X32A 1LTTD 1DZ1A 1G291 4E6IA 1IYUA 5HGTA 2TSSA 3HOWB 1K83B 1XYIA 1H9SA 5FOBB 3X3MA 3BG3A 3FPPA 3H94A 1LT4D 3OMCA 1SEBD 3ND8A 3K0YA 3OHXC 1TWGB 1PZID 2BCOA 3KLRA 3RD4A 4C3JB 2XVSA 2B2WC 1D1IA 1LO5D 3TMEA 2MUYA 3KLSX 4C1NK 4XT3B 1Q90A 1CFMA 4BS9A 5EKKA 1OXSC 2R92B 2VUMB 1EEFD 4HAEA 1HA6A 2EOTA 5J1ZA 2F0JA 3VR6A 4IURA 3HG9A 3TZUA 4XYQA 2KOLA 3BVMA 1SE3A 1AEXA 2M2LA 4DNRB 1TY2A 2D2CC 5HURA 1G8ZD 3QOJA 3M4OB 1C4QA 1V1PB 1WTVA 3TBIB 2HQEA 4NMZA 5FO7B 1D6EC 1KLGD 1STHA 1SDFA 4F7XA 1AP0A 3SHLA 3TP6A 4A3KB 1TKWB 1JOOA 2JP1A 5CORA 3L9AX 1SYEA 1X3QA 3I91A 3KUPA 2WINB 1G91A 4DN4M 1V43A 5EPKA 2EYLA 3DUZA 3NHHA 4EQOA 1TR5A 2EY2A 2DNCA 3H3VC 3D4RA 3D8GA 4L8JA 5BN4A 2XWJB 2Q8IB 4YIJA 2MGSA 3S15B 3S1RB 3C3LA 5C3WA 5D65A 3JAME 2DY8A 1DCZA 2SOBA 3QIAA 2FMMA 1LABA 3QOLA 1EYCA 1II3A 2RKSA 2K28A 5C3EB 2NBFA 1G2SA 4X3UA 2JA6B 1EQVA 5A2QE 3BS1A 3GTQB 5CMDA 2F0EA 2OEOA 5CV4A 2KHSA 3H6MA 2BDNA 4FVMA 2ZXRA 2FHTA 3VR3A 3T4AC 1LTRD 3SK8A 1STYA 3OWFA 4X3TA 5FK9C 3RLFA 5A35A 5ELEA 2AWOA 5EQ0A 4S3SA 4FXKC 2F0GA 3PIO3 2F0IA 5DAUA 2E2JB 3PUXA 1VMPA 5BN3A 1AFPA 4OIKA 1WTWA 1MBYA 4CGYB 2R93B 1E2ZA 5JVG3 1NUCA 4KN4C 5CC4A 2BA0A 2A68C 3Q6SA 5KGUA 3EROA 2F0LA 1CM9A 1KTKA 3NTHA 4IUNA 3WOEA 1XXGA 2F0HA 1ILQA 3VA7A 5D3DA 1YNND 3VA5A 1JC7A 4V190 1EY5A 2A6HD 4KN7C 4QUFA 1M4VA 1B3AA 4KY5A 4KI0A 5JVH3 1W6JA 2RVLA 3NQTA 1O7YA 1JWUD 1U4LA 3NP8A 4ZUIA 4EQNA 4RKLA 2PZUA 3NPPA 1BCPC 5FLXL 2QDBA 4IALA 4CKEA 1HA5A 2PO4A 1O7ZA 3J81E 2EYHA 5JOBA 2NYZD 4I7ZC 3T13A 2F0TA 1O7LA 2PCFB 3PUZA 3NBHA 4G4KA 4G57A 5C5LA 4WORA 4OO1G 4C2MB 5ELCA 2KA7A 4NKLA 1JB3A 4ME5A 1EU4A 2BDOA 4IFDH 2HDMA 3G6JB 4K2LA 3D6CA 4WJWA 1FD7D 2E2HB 1PTOD 4OO1H 4QB4A 3U9SA 2EPBA 2NVQB 2K1BA 3VYTA 3T56B 3SK6A 4WRDA 4KJNA 5E4XA 4XQJA 4HMIA 3Q23A 2CHBD 1SXTA 4H13C 1LTID 1YNNC 3E6ZX 4CHTB 1EU3A 3PIP3 3HOYB 4XQNA 4MIUA 2L1BA 4FXGC 3H0GB 3S1NB 4KD3A 1SYGA 1OXXK 2R61A 3V05A 3FDTA 2IX3A 1ZEQX 2B2VC 3OOCA 1I4PA 3SK4A 1QNUA 2Z4HA 1DYQA 4FF1A 3KF8A 4CJ0B 1BCPF 1B1ZA 4EGVA 2A6ED 4A3FB 2B2UC 1PRTD 3OWEB 3SXHA 5DNFA 3OW7A 3BVGA 1I6VC 2B63B 1LTSD 4C3HB 1U4PA 1SSOA 1NAPA 4BA1I 5BN5A 2NB0A 2K32A 2EJGC 2BOSA 4ILWA 5LL6X 5I2YA 3DXJC 4KHVA 1U9RA 1JOKA 4C3JG 4K8IA 2EYFA 4A3GB 1DOLA 2IX0A 1BQQT 2EJFC 1TS4A 4O42A 1EZ8A 2QKIC 1LT5D 2K03A 3R2IA 2SNMA 2X6LA 4A3BB 3I90A 3V2TA 3VYRA 1L0XB 4NW2A 3SE0A 1BR9A 1QWYA 3MXPA 5EPLA 1HTPA 2K01A 4CBVA 1CI3M 1BO0A 2K6AA 1LLRD 4IUTA 3J80E 1SNPA 4R9WA 1ICWA 3DM1A 2B2TA 2M00A 1QILA 3A8JE 2MJ8A 4K14A 4PMWA 4LK1C 1SNCA 4X3SA 3RMHA 2EY6A 2O2LD 5CGKA 3CRKC 5CBEE 3URYA 2B39A 4Y7NB 1UAPA 3RZDB 4MN3A 5M3FB 4ULLA 5EKLA 1HTLD 4K5WA 5K5PA 2F0PA 5CV9A 3A7LA 2J4XA 2O4XA 1D5MC 2I46A 5LHY1 4G7OC 2F0DA 5E4WC 3JAML 2NTSA 4CJ1B 2A74C 2B8GA 1F9QA 1BCPB 3MA2B 2O5JC 2LS01 3J7YW 3Q24A 1PFNA 2KVMA 1IYVA 3S14B 2NVTB 3ONAB 1QNKA 2NN6G 2GA4B 3PUVA 5A2QL 3DEOA 2ICIA 1CZWA 4Q5VA 3U9OA 3KLSA 1Q8IA 1HUMA 4FXDA 4RAUC 2K7VA 4FF2A 3J7AF 1OO9B 2ICEC 5DM63 3PO3B 4K5VA 2VNUD 2NN6H 3A8IE 4UAIA 3SK5A 2EXZA 1PZKD 1O78A 3DEPA 2X6GA 3WOFA 1WD0A 1TWAB 3QJYA 2JA5B 4TRDA 5EJWA 3D31A 1S5CD 2BE5D 4KY7A 3OPOA 1ZKOA 4EVOA 4UDUC 3IL8A 3MZ5A 2PW7A 2E75C 2CVRA 4PMCA 4J1MA 1PYWD 4ZLTF 3FEWX 4KHZA 2E2DC 2AUKA 2K5WA 4XDXA 5I6YA 2F0VA 1D5XC 4XQQA 5IGBA 1B44D 4QUCA 4NP5A 1HQRD 4RCOA 1SNQA 1CA6A 1GUSA 3NBIA 1R4PB 5JPNC 1HFNA 1Z47A 5C3XA 1WTQA 3M7GA 1Y8PB 1I4GA 3T51B 3I8ZA 5C5MA 1SNMA 3UI2A 2A5HA 1T5EA 3J7AV 2NTTA 1H9KA 2CW0D 5KNBA 1NSNS 1EY4A 1WTRA 1AW7A 5FO8B 1ESRA 1GUNA 2PYKA 1TVXA 1JICA 1Y69U 1B9MA 3QB3A 1ONLA 2EZVA 3I4LA 1H9RA 1CTMA 1M8AA 2IWHA 3OSOA 5F2DA 2KEEA 3VYSA 2DNEA 1PMRA 1O80A 2AUJD 3GTGB 1F77A 1EIHA 5CV5A 1H9MA 3MVVA 4TQUS 2TMPA 3S9WA 1EY9A 4DXFA 5C4XB 4H0LC 3NWSA 4IZ8A 1J9OA 1GUOA 3R93A 1R9TB 1EZ6A 2C9OA 1IW7D 2B2YC 2F3VA 1FNWA 2NZ1D 3W3AA 3T53B 4FYDA 4ID6A 3HEJA 4XIGS 2JA8B 3QG1A 4ZAIA 5IODA 4RGOS 1CK1A 1ZYRD 1TS2A 5K36G 4ZK9B 1A3TA 1ZXTA 1KAAA 1LT3D 4XTCS 3C1EA 1D5ZC 2K04A 1AZQA 2E76C 2QF7A 5G3LF 3GTKB 3BYYB 3DHQA 2FFKB 1Z7TA 5M9OA 4LMQD 1H9JA 1GOZA 1MSGA 1V1OA 4KY6A 2WACA 2J7ZA 4MHEA 4C3HG 3VR2A 4RHRA 3HKZB 1EL0A 1ET9A 1Y8NB 2N55A 4XT1B 3BVZA 1I4HA 4K6DA 2WP8J 3E0JA 1W6KA 3S17B 2ID0A 5EKIA 1UUPA 1QE6A 5M5WB 4IFDI 4HEDA 3GTPB 3J80L 2E2IB 2SDFA 5IGFA 2F0MA 1LTGD 1IL8A 5IGEA 3M3YB 1IW7C 3I4MB 2EVBA 2D5DA 2A69D 4L6TB 1D2BA 2ZXPA 4A3DB 2JE6I 2PNRC 2F0FA 2PQEA 1TS3A 2JEAI 3C2PA 2JEBI 3P7JA 2OXPA 5C0XJ 1DD2A 3OIPA 1JR0D 1R4QB 4OIJA 2EJMA 1BUVT 2EYOA 4DNTB 1EOTA 1I3QB 1STGA 5I4DA 2PZWA 2KCNA 4OGQC 1PDQA 2EYPA 1K8MA 4KMUC 2IX1A 2HCIA 5C4ZA 3MXNA 3T16A 4A3MB 3QWNA 1SYCA 5I6WA 1RKNA 2K05A 3CQZB 4LJZC 4L63B 3TP8A 3P1HA 2DN8A 4FF4A 2EYJA 4QMGA 1GHKA 1FR3A 1V1PA 1A3UA 2NVXB 1RHPA 5D3IB 1IHZA 1TU2B 4PV1C 3L3OC 1VCIA 4B9WA 3KBGA 1CT1D 5IT9E 2H4OA 2XN9C 1CQFA 4K5XA 4JBWA 2F0KA 3K58A 4ZKCB 4F8MA 5C0XI 1Y1WB 1ML0D 1A2TA 1STAA 4RGMA 1CHQD 1U4RA 2O5IC 3M85A 2FINB 1S5BD 3RUZA 3CKIB 1WTOA 1B53A 1I6HB 2A6HC 2NUCA 4IQZA 2XNAC 5KNDA 4U673 5KYIA 4RHSA 1Y1VB 2Q8RE 1DM0B 1E0BA 5JEAJ 4K8JA 2D62A 3A7AB 4RKBA 1HRJA 3K5LA 2LMCB 1Q1EA 3LWUA 4XXEA 2QEJC 1C8CA 3MXGA 1E2VA 3OIQA 1SE2A 1TWFB 2L12A 1XX8A 3CRLC 2XSCA 1STEA 4HR7B 2RSOA 4B9XA 2WKCA 3HP3A 5C4HA 2KCCA 1RTOA 4M1UB 2JYOA 3DWPA 4OL7A 4C3IG 1H9SB 2EYMA 1Q3LA 1G2TA 1VMCA 2QCPX 3FRPB 1PTOC 4TKOB 2XRQD 1SJHD 1JWMD 4FP5D 1MI2A 2AQ2B 1QJOA 3CU7A 5J22A 5ISRA 4KKUA 4PQXA 1QCBD 2G9DA 3IFDA 2YYZA 2AQ3B 2AWNA 5KIXA 1HCZA 1LACA 1TWCB 3K5OA 1UNSA 5CV7A 3AMUA 2FMCA 3NTKA 4I65A 1AN8A 4DF7A 2XIWA 4LAAA 3GTMB 3AU7A 3MFGA 2E74C 2R7ZB 3TP7A 4K6LA 4KD4A 2A6EC 4H7BA 1PRTC 4N9PA 4A3EB 1DOMA 3I72A 2PPBC 1RF2D 3A8KE 3HGBA 1S5ED 3EFXD 3NE5B 3DWAA 3K57A 3P20A 3IAYA 1LT6D 3I3CA 2RDHA 1OXTA 2Z1CA 2B2WA 1WVLA 3V96A 1MD2D 1LTBD 3BDCA 2IJ0A 3KK7A 3HOZB 4GZYC 1U4MA 1PTOF 4ZKBB 4HCEA 4HCSA 1SYBA 2WB1B 5D14A 1F2LA 3ERQA 5DEHA 3K5MA 1X3PA 4ZQ3A 2L9HA 3LWEA 1S5DD 1FNVA 4RCNA 3GTJB 4G7ZC 2XRSD 4DAPA 1OXVA 4P2CB 5EBCA 1Q12A 1ENAA 3MTSA 4FF3A 4C56C 1JWSD 4A3JB 3MFYA 2LY7A 3A55A 5TSSA 1F9RA 3HOXB 1QB5D 2C5CA 2SEBD 1SBBB 3FVQA 3S1MB 1Z6HA 2B8FA 5KRUA 2B2YA 1PRTF 3ZYYX 1EFID 2RDGA 3GV3A 1EQTA 4ZRZA 5I9OA 3H91A 1J8IA 1BDOA 3S1QB 2OF1A 3SEBA 3VYUA 1HUNA 1I4RA 3X3NA 1Y8OB 3I70A 2Q8TA 3M7NA 1VF7A 1TWHB 1SAPA 4DU9A 2MP1A 1HFGA 2B2TC 4ZUJA 1VF5C 1TQOA 4C3IB 1NR2A 1IKLA 1PFMA 2KEDA 4DA2A 3J81L 1GUGA 3TN2A 2L11A 3MHBA 5NUCA 1E2WA 1YNJD 1S4ZA 4FO2A 1JORA 3MC0B 3K6OA 3HRZC 5M3MB 3FPUB 1PTOB 5JJZA 4F88A 3HS0C 2PW5A 1QOHA 3FKIB 2F4IA 1FNUA 4HSVA 3SR1A 1ET6A 4KK7A 1I4XA 2L5TA 2IL8A 2LKVA 2F3WA 1FGBD 4V0BA 4ABNA 3PV0A 5C44B 3ND9A 1F2MA 2BE5C 2X69A 3MAQA 5IT9L 4IUPA 3S16B 3VR5A 1EY0A 1C48A 2Z8LA 4DXGA 1RODA 1GUWA 2HDLA 1DXMA 2HCCA 3GV6A 4RGTA 3DWQA 4BBRB 1TIID 4IUUA 1NCVA 4BA2I 1B50A 1TS5A 4IFDJ 1PRTB 1F9PA 3SDZA 1EWHA 2F0QA 3MWYW 1B9NA 3C1FA 4ODGA 1BOSA 2PMZB 3MEHA 2JA7B 5FKAC 2BA1A 2RDFA 5T1GA 2WV6D 2NWGA 1YNJC 2N88A 2RSNA 2NVYB 1EIGA 4DK0A 2PZTA 1XTCD 1MGSA 2CW0C 3S2DB 1A3VA 3TDQA 2V4DA 4Z9CB 5T1IA 1CQVA 4B08A 2A68D 5K36H 1HQMC 5EBDA 3S2HB 4G7HC 4BY1B 3PMFA 2F1MA 2XWBB 4HMJA 3GQBA 4RFBA 5IGGA 2RA4A 3F2UA 2WIIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMC A;  1EY5 A;  1A2T A;  1EY0 A;  1STA A;  5IGC A;  5CV7 A;  4PNY A;  4IZ8 A;  3E5S A;  4I65 A;  4J1M A;  3SK4 A;  5EKL A;  4KY5 A;  3RUZ A;  2F0O A;  4N9T A;  5E1F A;  3HZX A;  1EZ6 A;  2EY5 A;  5I9P A;  5C3W A;  4K5W A;  5CV8 A;  4DF7 A;  4LAA A;  2F0P A;  5K5P A;  2F3V A;  1STB A;  3OMG A;  2F0F A;  2PQE A;  5CV9 A;  3NQT A;  4NDX A;  2SOB A;  4KTA A;  2O4X A;  2NUC A;  2EY1 A;  1A2U A;  3NP8 A;  5I6Y A;  5KRU A;  2F0V A;  3LX0 A;  4ZUI A;  3SXH A;  3TP7 A;  4EQN A;  5KEE A;  5J39 A;  4ID6 A;  4RKL A;  3HEJ A;  2PZU A;  1SYD A;  5CV6 A;  3QOL A;  3TME A;  5IGB A;  1EYC A;  4NP5 A;  5KYI A;  3NXW A;  5IOD A;  2OXP A;  2QDB A;  4IAL A;  5EKK A;  2F0D A;  1II3 A;  1SNQ A;  2RKS A;  4KD4 A;  5I9O A;  4H7B A;  3D4D A;  4N9P A;  2EYH A;  5JOB A;  1EY8 A;  5CR3 A;  4K8J A;  1KDB A;  1A3T A;  5J1Z A;  3T13 A;  2F0T A;  2EYO A;  4KJO A;  3P75 A;  1EQV A;  1KAA A;  2F0J A;  2F0E A;  3EVQ A;  2OF1 A;  2OEO A;  3NUC A;  4QF4 A;  5C6A A;  1STG A;  4RKB A;  3C1E A;  2PZW A;  5C3X A;  2F0Q A;  5CV4 A;  2KHS A;  2RBM A;  3C1F A;  4G57 A;  4ODG A;  1EYD A;  1EY7 A;  3H6M A;  5C5L A;  3EJI A;  4WOR A;  5IIF A;  1AEX A;  3R3O A;  1TT2 A;  5C5M A;  5IGD A;  4KHV A;  2EYP A;  5HUR A;  3MEH A;  1SNO A;  1JOK A;  1U9R A;  3QOJ A;  4J6H A;  4NKL A;  4K8I A;  3U9O A;  4DGZ A;  2EYF A;  3DHQ A;  4EQP A;  4ME5 A;  2RDF A;  1SNM A;  2HQE A;  3BDC A;  4DU9 A;  5M9O A;  4K2K A;  1SYF A;  4ZUJ A;  1STY A;  3OWF A;  4NMZ A;  3SK8 A;  1EZ8 A;  1F2Y A;  4B9X A;  1TQO A;  2KQ3 A;  4K2L A;  1STH A;  2SNM A;  3D6C A;  3DMU A;  4KY6 A;  5C4Z A;  5C4H A;  1ENC A;  3V2T A;  3T16 A;  4F7X A;  1NSN S;  1JOQ A;  1EY4 A;  2WAC A;  4R8N A;  5IOC A;  4K5V A;  1SYC A;  3SHL A;  4S3S A;  1RKN A;  4QB4 A;  5I6W A;  1EY6 A;  2F0S A;  4KY7 A;  4DFA A;  2PYK A;  2F0G A;  1SYB A;  3TP6 A;  2PZT A;  2F0I A;  5DAU A;  4OL7 A;  1STN A;  3ERQ A;  2EYM A;  5DEH A;  2ENB A;  3TP8 A;  1A3V A;  1JOO A;  3P1H A;  3SK5 A;  2EXZ A;  3MXP A;  5E3F A;  3MHB A;  3SK6 A;  4WRD A;  2EYJ A;  5NUC A;  4QMG A;  4HTH A;  4KJN A;  3QB3 A;  4E6I A;  1EYA A;  2F0N A;  4ZQ3 A;  4K6D A;  1A3U A;  1KDA A;  1F2Z A;  2F0U A;  1JOR A;  4HMI A;  5JAV A;  5J22 A;  1SND A;  3BDL A;  5ISR A;  1SYE A;  3ITP A;  2PW5 A;  1SNP A;  3OSO A;  1IHZ A;  5F2D A;  4TRD A;  1NUC A;  2EYL A;  3SR1 A;  2M00 A;  4B9W A;  3PMF A;  5CC4 A;  5HGT A;  3NHH A;  4K14 A;  4EQO A;  5KGU A;  1SNC A;  1KDC A;  1TR5 A;  2EY2 A;  2EY6 A;  2F0L A;  2LKV A;  2F3W A;  3ERO A;  4HMJ A;  5CGK A;  3D8G A;  5KIX A;  3D4W A;  4PMB A;  4MIU A;  4EVO A;  5EGT A;  5IGF A;  2F0M A;  5IGE A;  3MZ5 A;  5IGG A;  1F2M A;  4IUN A;  4K5X A;  2F0K A;  2PW7 A;  4KV6 A;  5CV5 A;  2F0H A;  1ENA A;  2SNS A;  3MVV A;  3NK9 A;  4YIJ A;  3TP5 A;  3S9W A;  1EY9 A;  2F0W A;  3OMC A;  1KAB A;  4KD3 A;  5KYL A;  1SYG A;  3VA5 A;  4F8M A; 
#chains in the Genus database with same CATH topology
 4NXN L;  5IGC A;  3NQI A;  4JI4 L;  4O2D A;  1TY0 A;  1HXY D;  4DV0 Q;  1EQQ A;  4O1N A;  2MPM A;  2KJX A;  4WFN 3;  3F2B A;  5M5X B;  3TSS A;  1DGS A;  2IT1 A;  1MHW C;  1PFB A;  5CV8 A;  1I50 B;  1BCP D;  4LFB Q;  2LXK A;  3NWT A;  3W2D A;  1ENF A;  5I2X A;  1QZH A;  3N52 A;  3LX0 A;  2C35 B;  4BXX H;  4ZYS A;  1VQ4 A;  4OO1 I;  1CKN A;  5CV6 A;  1EYG A;  2IPK D;  4JW0 A;  1L0Y B;  2VB2 X;  4F87 A;  4YY3 Q;  3KFU A;  1Q1B A;  1KDB A;  2CCZ A;  1HPC A;  3BYT B;  4NB3 A;  3BZD B;  5GRO A;  3EN2 A;  3EVQ A;  4JVZ A;  4POF A;  4P72 A;  4QF4 A;  1A63 A;  1YEZ A;  5C6A A;  1EWI A;  1ZYR C;  2B2V A;  2LXJ A;  2RBM A;  4GOP C;  3EJI A;  1E22 A;  3A0J A;  5IIF A;  1GHJ A;  4N8X 1;  2WKD A;  4J6H A;  2L0C A;  5L37 A;  2B2U A;  1YHQ A;  2B29 A;  4K2K A;  1SYF A;  1IBK Q;  2KQ3 A;  1JT8 A;  3DMU A;  1TWC H;  3HOU B;  4KKS A;  1ENC A;  1BNZ A;  3E9H A;  3PF4 A;  2I5M X;  1JE4 A;  5FJ8 G;  4HIM A;  3CP0 A;  4YWM A;  4DAM A;  2KEN A;  1NR4 A;  5BR8 Q;  2ENB A;  4DR6 Q;  3GTM H;  3SVM A;  1WCM G;  2LFN A;  2F0N A;  1AE3 A;  1KDA A;  2R7Z H;  1E1O A;  1F2Z A;  1E3P A;  1ICF B;  2VXW A;  2Q2U A;  3NTI A;  1A15 A;  1FJG Q;  4RGN A;  2ZTC A;  3R2T A;  2CH4 W;  2K5D A;  5DM7 3;  4QCL A;  2D0O A;  5FJ8 H;  3IFT A;  3AB9 A;  2OQ0 A;  3CCV A;  3PUW A;  3VR4 A;  3FMC A;  4A3E H;  3OTO L;  1LV9 A;  1XMO L;  3HOZ G;  1KDC A;  2WAQ B;  4X65 Q;  1V9P A;  5IP7 H;  4AYB B;  1VDZ A;  1EQR A;  1BBX C;  3D4W A;  4FNF A;  3I4N B;  1WTP A;  4A93 B;  1HHV A;  2D9U A;  3Q0A A;  3NK9 A;  2F0W A;  5KYL A;  2WB1 G;  3ULJ A;  1T9H A;  2JXM B;  2FXQ A;  4IFD G;  2ZM6 L;  3E5S A;  4CKB A;  1S5F D;  2RHS B;  4DR5 Q;  2F0O A;  4B3M Q;  3HOZ H;  3HZX A;  4LWC A;  1SMY D;  2M9V A;  2A69 C;  3DM3 A;  3OMG A;  1STB A;  2UU9 L;  4B3R Q;  1D1K A;  3K7A B;  1CHP D;  1WJJ A;  1A2U A;  3M4Y A;  3GTO B;  4M8A A;  2K33 A;  3MXU A;  4U68 A;  1KNE A;  1CZG A;  1JCK B;  1SYD A;  3CW2 C;  4ALP A;  3O13 A;  1GM5 A;  1OTC A;  3GD7 A;  3HFZ B;  3K59 A;  4IUV A;  2ZXO A;  4Q0F A;  4OEL B;  4CKC A;  1SE4 A;  1VQO A;  3D4D A;  1WFQ A;  5ELD A;  1K8O A;  5CR3 A;  4LFA Q;  2CKZ B;  2MHV A;  4DAV A;  4RA8 A;  3GTL B;  1HZA A;  2DJF C;  1XMQ L;  2PQA B;  1QG7 A;  2YTY A;  2AMC B;  4CJ2 C;  1PH1 A;  4A3J G;  4IUQ A;  3GTJ H;  2IW3 A;  2YU9 B;  4DK1 A;  3D3R A;  4DV2 Q;  3HOX G;  2ZTD A;  4EQP A;  3GP7 A;  1RD9 D;  1K0S A;  3STB C;  4LF5 Q;  2ZT9 C;  1VQC A;  5FLM G;  4GNX B;  1IBM Q;  2CQA A;  3CHB D;  4K0K Q;  1XNR Q;  2DUD A;  3F1Z A;  2UUA L;  4LW1 A;  1SFO B;  4UY8 C;  5COY A;  4A3J H;  4XYO A;  4DV3 Q;  4RH6 A;  1EY6 A;  2F0S A;  4DFA A;  2F4V L;  3J81 j;  3HOX H;  4GN4 B;  1KL9 A;  1W3S A;  2DY7 A;  3S1M H;  2K4K A;  1JQY D;  2A8V A;  4HTH A;  3BDO A;  4X66 Q;  1EYA A;  2VQE L;  3RN2 A;  3CCM A;  2F0U A;  1UEA B;  1FYC A;  5JAV A;  3A56 A;  3TS0 A;  1SND A;  3BDL A;  1YVC A;  3K5N A;  4YHH Q;  3ITP A;  4JI2 L;  4A3I B;  2L55 A;  1CKM A;  3W1G A;  1GJX A;  4BY7 B;  2Y0S B;  3S1Q H;  3KBX A;  2ZJP A;  1N8R C;  1A6X A;  5EGT A;  1SMY C;  3G48 A;  4KV6 A;  3HOW G;  2SNS A;  3TP5 A;  3L2P A;  3HOV B;  3UDG A;  1KAB A;  4GN5 A;  1PH5 A;  2Q2T A;  4H44 C;  1TWH H;  2VZA A;  2I5H A;  1VQG A;  4BWG B;  4DR4 L;  4IPH A;  3GO5 A;  5E1F A;  3C46 A;  4DUZ L;  2EY5 A;  1EWC A;  5M3M G;  4C3I H;  3FKI G;  1F9S A;  4C1N I;  3A54 A;  4LF8 Q;  1S40 A;  2EY1 A;  1WTX A;  2QW7 A;  3N6R A;  2XTI A;  1DON A;  2NN6 I;  5J39 A;  5C0X G;  4R8I A;  3NXW A;  2KEC A;  4LF9 Q;  5C44 G;  1OXU A;  2JA9 A;  2KUM A;  3P75 A;  3SGI A;  5M3M H;  1PTO H;  3NUC A;  2GVB A;  3FKI H;  3KF6 A;  2VUM G;  2H1E A;  1RJT A;  3PGZ A;  4KKT A;  1PYS B;  1EY7 A;  2AQ1 B;  3CMA A;  5CBA E;  5C0X H;  3Q22 A;  1Y14 B;  2HQL A;  3TZD A;  5FO9 B;  1TT2 A;  2QDL A;  3FP9 A;  1AZP A;  4RWS C;  4GOP B;  4BBS B;  5C44 H;  2R6G A;  2F03 A;  1X54 A;  4JI1 L;  2G9H D;  1N34 Q;  1P16 A;  1F2Y A;  1RDP D;  4YCV A;  4TVA B;  2EDG A;  1S3O A;  3S16 H;  3F2D A;  4LFC Q;  3D6W A;  4R8N A;  1X9N A;  3PQI A;  1N33 Q;  1M90 C;  3QO2 A;  1PLF A;  4IN3 A;  1WCM B;  2QIL A;  1LTL A;  4LUZ A;  1STN A;  5C4J B;  2KHJ A;  2I07 B;  5E3F A;  1V1Q A;  2Z4I A;  3OW2 A;  2OT2 A;  3NEL A;  1GXD C;  1RTN A;  5LL6 S;  4BBR H;  3G7L A;  2K5Q A;  2KBN A;  4PZ6 A;  2JJQ A;  4GKJ L;  2FJ2 A;  2JA7 G;  2B3G A;  2R3Z A;  3BU2 A;  3NSW A;  1IKM A;  4HSP A;  1JB7 A;  4HN7 A;  1YHB A;  4CDE C;  4YCW A;  3CCE A;  2L4N A;  5LMN Q;  1FVI A;  5HY6 A;  1HNX L;  5ELF A;  4X3K A;  4AQY Q;  1XWE A;  1V8Q A;  4PMB A;  1T5X D;  2JSO A;  4DAY A;  1PXU A;  4B3S L;  3L7Z C;  4L5Q A;  1MSH A;  1B4O A;  2JA7 H;  5AFW A;  2JK8 A;  3IKJ A;  1ILP A;  4TSS A;  1HNZ L;  4PNY A;  4OHJ A;  3J7A 5;  4N9T A;  1LTA D;  1B2T A;  2VB3 X;  5I9P A;  5CYU A;  5FLX E;  5M5Y B;  1G6Z A;  2CFM A;  4NDX A;  4KTA A;  1BXT A;  1Q7Y C;  2NVY H;  5KNC A;  3PUY A;  4ZCK A;  5KEE A;  4GKK Q;  1KNA A;  5JPM C;  3S2D H;  1SJE D;  1KLU D;  2A73 B;  4DV4 Q;  2RQX A;  1NY4 A;  5IE8 A;  5JEA G;  1BF4 A;  4QIW B;  1K0R A;  5EPJ A;  1EY8 A;  3R8B A;  2J0T D;  4A75 A;  4KJO A;  1CA5 A;  1UE5 A;  3EQL C;  3S2H H;  3EA6 A;  2QEX A;  4BY1 H;  1I4Q A;  1EYD A;  2JA6 G;  4R4I A;  4DR3 Q;  1EEI D;  3R3O A;  5G3L D;  4X62 Q;  5IGD A;  4JK1 C;  1PZJ D;  1SNO A;  4DGZ A;  1GUT A;  2K5N A;  1VQJ A;  5JEA H;  1ESF A;  3WDN A;  4JBJ A;  4KHP Q;  2EE1 A;  1WD1 A;  4X64 L;  4J8Q A;  1DOK A;  5ELB A;  1DJR D;  3H09 A;  1WI5 A;  1JOQ A;  3PO2 B;  5IOC A;  2HUG A;  1LUZ A;  1RCV D;  5M5X H;  3I73 A;  3LNN A;  3RZO B;  1X32 A;  1LTT D;  3BJU A;  1DZ1 A;  2UXD Q;  1I50 H;  1XNQ L;  2K75 A;  5AJ3 L;  1G29 1;  4DR7 L;  4E6I A;  2EIF A;  1HJP A;  5LMU L;  1MKH A;  4OEM B;  1IYU A;  5HGT A;  4OX9 L;  2TSS A;  3HOW B;  1KRS A;  1K83 B;  1XYI A;  1H9S A;  5FOB B;  3X3M A;  3BG3 A;  3FPP A;  1K3R A;  2UXC Q;  3H94 A;  3AFP A;  1LT4 D;  3OMC A;  3I2Z A;  2YV5 A;  1SEB D;  1HR0 L;  3ND8 A;  4JV5 L;  3K0Y A;  4B3T L;  4POG A;  3OHX C;  2VQF L;  1TWG B;  4UPA A;  4JI0 Q;  1PZI D;  2BCO A;  3KLR A;  3RD4 A;  4C3J B;  4A3C G;  3HOU H;  2XVS A;  2B2W C;  1D1I A;  4JI8 Q;  1LO5 D;  3TME A;  2MUY A;  3KLS X;  5ELN A;  4C1N K;  4XT3 B;  1Q90 A;  1CFM A;  4BS9 A;  5EKK A;  4EX5 A;  4AYB G;  1OXS C;  2R92 B;  2VUM B;  1EEF D;  4HAE A;  1CSP A;  1HA6 A;  1X56 A;  2EOT A;  4DUY Q;  5J1Z A;  3MXN B;  2F0J A;  3NBH B;  1YIT A;  3VR6 A;  4IUR A;  3HG9 A;  3TZU A;  4XYQ A;  2KOL A;  3BVM A;  4APV A;  1SE3 A;  1AEX A;  2M2L A;  4DNR B;  1QVC A;  1TY2 A;  2D2C C;  5HUR A;  3G71 A;  1KC8 C;  1G8Z D;  3QOJ A;  4IOC A;  3M4O B;  1C4Q A;  1V1P B;  1WTV A;  3TBI B;  3I4N H;  2HQE A;  4A93 H;  4NMZ A;  5FO7 B;  1D6E C;  1KLG D;  1STH A;  1SDF A;  4F7X A;  1AP0 A;  4QGU A;  2I5L X;  3SHL A;  3TP6 A;  1SE8 A;  4A3K B;  1TKW B;  1JOO A;  2JP1 A;  2MQH A;  3PCO B;  5COR A;  3K7A H;  3L9A X;  3GTO H;  1SYE A;  1X3Q A;  3I91 A;  4JYA Q;  3KUP A;  2WIN B;  1G91 A;  4DN4 M;  1V43 A;  5EPK A;  2EYL A;  3DUZ A;  2YTX A;  3NHH A;  3GTL H;  4EQO A;  1TR5 A;  2EY2 A;  2DNC A;  3H3V C;  3D4R A;  3D8G A;  2WFW A;  4L8J A;  5BN4 A;  1L1O A;  2XWJ B;  2ES2 A;  1B8A A;  2Q8I B;  4YIJ A;  3M4P A;  1C7Y A;  2YU9 H;  4UP8 A;  2MGS A;  3S15 B;  4HJ8 A;  3S1R B;  3H0G G;  5IT9 c;  3L0O A;  2ZJQ A;  3C3L A;  5C3W A;  5D65 A;  3JAM E;  2DY8 A;  1DCZ A;  1SFO H;  2SOB A;  4A3I G;  3QIA A;  4DPG A;  2FMM A;  1LAB A;  4BY7 G;  2Y0S G;  3U4Z A;  3QOL A;  1EYC A;  1II3 A;  2RKS A;  2K28 A;  1PHJ A;  2K5H A;  5C3E B;  2NBF A;  3CD6 A;  3OTO Q;  1G2S A;  4X3U A;  4IOA A;  2JA6 B;  1EQV A;  5A2Q E;  3BS1 A;  3GTQ B;  5CMD A;  2F0E A;  3HOV G;  2OEO A;  4A3I H;  4DV5 Q;  3K8A A;  5CV4 A;  2KHS A;  1IBL L;  2GVA A;  3H6M A;  2BDN A;  4BY7 H;  1UE7 A;  4DNI A;  4FVM A;  2ZXR A;  2FHT A;  5E7N A;  1I94 L;  3VR3 A;  3T4A C;  2Z6K C;  1LTR D;  3SK8 A;  1STY A;  3OWF A;  4X3T A;  3HOV H;  5FK9 C;  3RLF A;  5A35 A;  5ELE A;  2AWO A;  5EQ0 A;  2K14 A;  4S3S A;  4FXK C;  2F0G A;  3PIO 3;  2F0I A;  5DAU A;  2E2J B;  3KOJ A;  3PUX A;  1VMP A;  5ELO A;  5BN3 A;  3CCJ A;  1AFP A;  4LF7 Q;  2JN4 A;  1TXY A;  4H02 A;  2HIV A;  4OIK A;  1WTW A;  1MBY A;  4AIM A;  4CGY B;  2R93 B;  1E2Z A;  5JVG 3;  1XMQ Q;  2E5L L;  1NUC A;  4KN4 C;  3LGJ A;  4BBS G;  1VQM A;  5CC4 A;  2BA0 A;  2A68 C;  3Q6S A;  5KGU A;  3ERO A;  2F0L A;  1X55 A;  2MO0 A;  1CM9 A;  1VQ5 A;  3UDX A;  4DV6 Q;  1KTK A;  3NTH A;  4IUN A;  4PZ8 A;  3J80 i;  3WOE A;  1XXG A;  4X6A H;  2F0H A;  2CWA A;  1ILQ A;  3VA7 A;  3J7Z C;  4WJ3 M;  1PVO A;  5D3D A;  1YNN D;  3VA5 A;  2UUA Q;  1JC7 A;  4V19 0;  1EY5 A;  2A6H D;  4BBS H;  4KN7 C;  4QUF A;  1M4V A;  1B3A A;  4KY5 A;  1E24 A;  4KI0 A;  5JVH 3;  2F4V Q;  1W6J A;  2RVL A;  5IWA L;  3NQT A;  1O7Y A;  1JWU D;  4I7A A;  1D7Q A;  1U4L A;  2VQE Q;  3NP8 A;  4ZUI A;  1WCM H;  4EQN A;  4NXM Q;  4RKL A;  1JMC A;  2PZU A;  3KLW A;  3NPP A;  1BCP C;  5FLX L;  4CDC C;  2QDB A;  4IAL A;  5C4J H;  4CKE A;  1HA5 A;  2PO4 A;  1O7Z A;  3J81 E;  2EYH A;  5JOB A;  2NYZ D;  4I7Z C;  3T13 A;  2F0T A;  2Q2I A;  1XPR A;  1O7L A;  2PCF B;  3PUZ A;  3NBH A;  4G4K A;  4DV0 L;  1YJ9 A;  1K73 C;  4G57 A;  5C5L A;  1Q46 A;  4WOR A;  4HJA A;  4OO1 G;  4C2M B;  5ELC A;  4DK6 C;  2KA7 A;  4NKL A;  1JB3 A;  4ME5 A;  5IYD G;  4OXP A;  1EU4 A;  4DR4 Q;  2BDO A;  4CDD C;  4IFD H;  2HDM A;  4DUZ Q;  4LNQ A;  3G6J B;  4K2L A;  4LF6 Q;  3D6C A;  4WJW A;  1FD7 D;  2E2H B;  1PTO D;  5GAD C;  2ATW A;  4OO1 H;  4QB4 A;  1B70 B;  3I4O A;  2G5D A;  3U9S A;  1HZC A;  1WYD A;  1FGU A;  3PO3 G;  2EPB A;  5M5Y H;  2NVQ B;  2K1B A;  4PZ7 A;  2AKW B;  3VYT A;  3T56 B;  3SK6 A;  4WRD A;  1EFW A;  5JJI A;  4KJN A;  5E4X A;  4XQJ A;  4HMI A;  3Q23 A;  3AQQ A;  4R1J A;  2CHB D;  1SXT A;  1NBW A;  4H13 C;  3T1Y L;  2HHH Q;  1LTI D;  1XJV A;  1YNN C;  1U0L A;  3E6Z X;  2JA5 G;  4CHT B;  1EU3 A;  2MFI A;  3PIP 3;  3HOY B;  4XQN A;  4MIU A;  2L1B A;  4FXG C;  3PIO A;  3PO2 G;  1NTG A;  2Z6B A;  5BR8 L;  3H0G B;  3S1N B;  4KD3 A;  5FLM H;  1SYG A;  1M1K C;  1OXX K;  2R61 A;  3V05 A;  3FDT A;  2IX3 A;  1SRU A;  1ZEQ X;  2B2V C;  5FLX c;  3OOC A;  4JG2 A;  1I4P A;  3SK4 A;  1FJG L;  1QNU A;  2Z4H A;  4O0A A;  4IPG A;  1DYQ A;  1NMG A;  4FF1 A;  3KF8 A;  2WB1 E;  4CJ0 B;  1BCP F;  4MTN A;  1VQN A;  3PO2 H;  1B1Z A;  4EGV A;  2A6E D;  4A3F B;  2B2U C;  1PRT D;  3OWE B;  2A19 A;  3SXH A;  4X65 L;  5DNF A;  3RZO H;  3OW7 A;  1WTH A;  1VQ7 A;  2PI2 A;  3BVG A;  1B3Q A;  1UE6 A;  1I6V C;  2B63 B;  1LTS D;  4C3H B;  1IYJ B;  1U4P A;  3EBE A;  1W2B A;  1SSO A;  1NAP A;  4BA1 I;  3KDF B;  4JI7 L;  1YIJ A;  1HNX Q;  5BN5 A;  1K28 A;  1VQB A;  2NB0 A;  1K8G A;  2K32 A;  2EJG C;  2BOS A;  1SMX A;  4ILW A;  5LL6 X;  3B6Y A;  1YNX A;  4B3S Q;  5I2Y A;  3DXJ C;  4B3R L;  4KHV A;  4DR2 L;  3HOW H;  1ASY A;  1U9R A;  1JOK A;  4C3J G;  1K83 H;  2NZO A;  4K8I A;  4LF4 L;  2EYF A;  1HNZ Q;  4A3G B;  3NEM A;  1DOL A;  2IX0 A;  3UDI A;  1BQQ T;  2EJF C;  1TS4 A;  4O42 A;  1EZ8 A;  2QKI C;  3M4Q A;  1Q82 C;  1LT5 D;  2K03 A;  3R2I A;  3CXC A;  2SNM A;  2X6L A;  4A3B B;  3I90 A;  3V2T A;  3VYR A;  1L0X B;  4NW2 A;  2R92 G;  1TWG H;  2OCE A;  3SE0 A;  4HIO A;  1BR9 A;  4DV1 L;  1QWY A;  4C3J H;  2DJG C;  4OWX B;  3MXP A;  5EPL A;  1HTP A;  2K01 A;  5HGQ A;  3CCU A;  4CBV A;  1CI3 M;  1BO0 A;  2K6A A;  3H15 A;  1LLR D;  4IUT A;  3J80 E;  4LF5 L;  3A74 A;  1SNP A;  2R92 H;  2VUM H;  5GAG C;  4JI5 L;  2V1C C;  1C9O A;  1ICW A;  3DM1 A;  4R9W A;  2UUC L;  2B2T A;  2M00 A;  4K0K L;  1XNR L;  1QIL A;  1X6O A;  3A8J E;  2MJ8 A;  4K14 A;  4LK1 C;  4PMW A;  1SNC A;  4X3S A;  3RMH A;  1PH7 A;  2EY6 A;  2O2L D;  5CGK A;  3CRK C;  3IRB A;  5CBE E;  3URY A;  1H95 A;  4NPS A;  2B39 A;  1NJI C;  4Y7N B;  1UAP A;  4HJ5 A;  4A3K G;  4X66 L;  3RZD B;  3M4O H;  4MN3 A;  1PH3 A;  3TRZ A;  5M3F B;  3CCQ A;  4ULL A;  5EKL A;  4YCU A;  4YHH L;  2RCN A;  2UXB Q;  1HTL D;  5C4X G;  4GN3 B;  4K5W A;  5K5P A;  2F0P A;  5CV9 A;  3T1H L;  3A7L A;  4QY7 A;  2J4X A;  2O4X A;  1D5M C;  3PIP A;  4A3K H;  2I46 A;  2H5X A;  5LHY 1;  4G7O C;  1K3B C;  2F0D A;  5E4W C;  3JAM L;  2NTS A;  4CJ1 B;  1SR3 A;  2A74 C;  2B8G A;  1F9Q A;  1BCP B;  2JA8 G;  3MA2 B;  2O5J C;  1NE3 A;  2LS0 1;  3J7Y W;  3Q24 A;  2MO1 A;  3CCL A;  4IPC A;  1N9W A;  1PFN A;  2KVM A;  1IYV A;  3S14 B;  2NVT B;  3ONA B;  1QNK A;  2NN6 G;  4LF8 L;  2GA4 B;  3PUV A;  5A2Q L;  3DEO A;  2ICI A;  1CZW A;  3TS2 A;  4Q5V A;  3U9O A;  1HNW Q;  5JJK A;  3KLS A;  4QL5 A;  1Q8I A;  1HUM A;  4FXD A;  4RAU C;  2K7V A;  3CC7 A;  4FF2 A;  4RMF A;  1KRT A;  3J7A F;  1OO9 B;  3JAM i;  5GAE C;  1QVG A;  2ICE C;  5DM6 3;  3S15 H;  3PO3 B;  3S1R H;  4K5V A;  2VNU D;  2PQA A;  4CDF C;  2NN6 H;  5C3E G;  3A8I E;  2AHO B;  4UAI A;  1CUK A;  4JI3 Q;  4FDB A;  1PYB A;  3SK5 A;  2EXZ A;  1PZK D;  1O78 A;  3DEP A;  3D0F A;  2X6G A;  3WOF A;  5H1S E;  1WD0 A;  1TWA B;  3FHW A;  3QJY A;  2JA5 B;  4GNX A;  4TRD A;  5EJW A;  4MZ9 A;  3D31 A;  1N34 L;  1VQL A;  1S5C D;  5C3E H;  1Z9F A;  2QGQ A;  2BE5 D;  1EUJ A;  2JA6 H;  3GTQ H;  4KY7 A;  3F2C A;  3OPO A;  4GS3 A;  1ZKO A;  1N33 L;  2N49 A;  2PMZ E;  2N78 A;  4EVO A;  4UDU C;  3IL8 A;  3MZ5 A;  1CKN B;  2PW7 A;  2E75 C;  3CC2 A;  2CVR A;  4PMC A;  1PA6 A;  3CPF A;  2JQO A;  1QUQ B;  3I4M G;  4J1M A;  3JAM c;  1PYW D;  2K50 A;  3FEW X;  4KHZ A;  4ZLT F;  2R93 G;  2E2D C;  2RCF A;  4UHV A;  2AUK A;  2K5W A;  1N32 Q;  4A3D G;  3RNU A;  4XDX A;  5I6Y A;  5GQO A;  2F0V A;  2VY3 A;  5DLQ E;  1D5X C;  4XQQ A;  1WOC A;  4AQY L;  5IGB A;  1B44 D;  4QUC A;  4NP5 A;  2E2J H;  1HQR D;  4RCO A;  1SNQ A;  1CA6 A;  1GUS A;  1N36 Q;  3NBI A;  4YWL A;  1R4P B;  4JOI A;  3UE1 A;  2R93 H;  3KDF A;  4JC0 A;  5JPN C;  1J5E Q;  1HFN A;  1NMF A;  1Z47 A;  3HKZ E;  5C3X A;  1WTQ A;  4OON A;  3M7G A;  1Y8P B;  1I4G A;  3T51 B;  3I8Z A;  5C5M A;  5J3B A;  1SNM A;  3UI2 A;  2A5H A;  1PV4 A;  1SN8 A;  1T5E A;  3J7A V;  2NTT A;  4DV4 L;  1H9K A;  1PH2 A;  2CW0 D;  2Z6K A;  5KNB A;  1NSN S;  4A3C H;  1EY4 A;  4DR1 L;  1WTR A;  1PH8 A;  1AW7 A;  5FO8 B;  1ESR A;  1GUN A;  2PYK A;  1TVX A;  5IYC G;  3TQY A;  4L5R C;  1JIC A;  1Y69 U;  1B9M A;  3AYH B;  3J81 i;  4GOP A;  3QB3 A;  4DR3 L;  2NZH A;  4NXN Q;  1ONL A;  2EZV A;  4JI4 Q;  4DV7 L;  3I4L A;  1H9R A;  1CTM A;  1M8A A;  2IWH A;  3OSO A;  5F2D A;  1JJG A;  2KEE A;  3VYS A;  2DNE A;  4A3L G;  1PMR A;  1O80 A;  5IYC H;  2A1A A;  2AUJ D;  3JC6 6;  1I94 Q;  1KXL A;  3DLL A;  3GTG B;  1F77 A;  1EIH A;  5CV5 A;  1H9M A;  3MVV A;  4TQU S;  4JI6 L;  3K7U C;  1L2F A;  2TMP A;  3S9W A;  1EY9 A;  4DXF A;  4C2M H;  5C4X B;  4H0L C;  3NWS A;  4IZ8 A;  3NEN A;  1HZB A;  1J9O A;  1GUO A;  4A3L H;  3R93 A;  1R9T B;  1EZ6 A;  2C9O A;  1IW7 D;  2B2Y C;  2F3V A;  2E2H H;  2KCM A;  3GDE A;  1FNW A;  1VQ8 A;  3ULP A;  2NZ1 D;  3UE0 A;  1YZ6 A;  3W3A A;  3T53 B;  1I5F A;  4FYD A;  4ID6 A;  3HEJ A;  4XIG S;  2JA8 B;  3QG1 A;  1SLJ A;  4ZAI A;  4RGO S;  5IOD A;  2NVQ H;  3HOY G;  1CK1 A;  2UXC L;  1BKB A;  1ZYR D;  1YJW A;  3U58 A;  1TS2 A;  3ICE A;  5K36 G;  4ZK9 B;  1A3T A;  1IXR A;  1ZXT A;  2CH4 A;  1BBW A;  3W1B A;  1KAA A;  1Y1V G;  5LMN W;  1LT3 D;  3CPW A;  4XTC S;  5IP9 G;  3C1E A;  1D5Z C;  2WAQ E;  3CCS A;  4JI0 L;  2K04 A;  1AZQ A;  1MJC A;  4AYB E;  2E76 C;  2K52 A;  3U50 C;  2QF7 A;  1A62 A;  3HOY H;  5G3L F;  4JI8 L;  3GTK B;  3BYY B;  3DHQ A;  5EAY A;  2FFK B;  1Z7T A;  4A3F G;  1KQS A;  5M9O A;  4LMQ D;  1H9J A;  3H3V H;  1GOZ A;  1MSG A;  3H0G H;  4MTK A;  1S72 A;  3S1N H;  1V1O A;  4KY6 A;  5IP9 H;  3G4S A;  1XMO Q;  3VDY A;  3TRE A;  2WAC A;  1X65 A;  2F3I A;  2B63 G;  2J7Z A;  4MHE A;  4C3H G;  3VR2 A;  4RHR A;  3HKZ B;  2K5V A;  1EL0 A;  2UUB L;  1ET9 A;  1Y8N B;  2N55 A;  4XT1 B;  1VQP A;  3BVZ A;  4BXX G;  4A3F H;  1I4H A;  3Q8D A;  4K6D A;  1A8V A;  2WP8 J;  2ZM6 Q;  3E0J A;  4L5T A;  1JJC B;  1W6K A;  1TWF H;  4JPB W;  3S17 B;  2ID0 A;  5EKI A;  1UUP A;  2B63 H;  1QE6 A;  4C3H H;  1MIU A;  5M5W B;  1PH4 A;  4A3G G;  4IFD I;  4HED A;  2UU9 Q;  3G6E A;  1BBU A;  3GTP B;  3K81 C;  3J80 L;  4A3B G;  2E2I B;  1UEB A;  1RL2 A;  2SDF A;  5IGF A;  2F0M A;  1LTG D;  1IL8 A;  5IGE A;  3M3Y B;  1IW7 C;  4DK3 C;  1X3E A;  1HZ9 A;  3KYH C;  3I4M B;  2EVB A;  2D5D A;  2A69 D;  1YHA A;  4L6T B;  2OWO A;  4HJ9 A;  1QUQ A;  4A3G H;  1D2B A;  2ZXP A;  3EIV A;  1VQA A;  4A3D B;  2JE6 I;  4JYA L;  3KF6 B;  3F8T A;  4PG3 A;  4A3B H;  2PNR C;  2ZJR A;  2F0F A;  2PQE A;  1TS3 A;  1IL2 A;  2JEA I;  3C2P A;  2JEB I;  3P7J A;  3CF5 A;  2OXP A;  5C0X J;  3T1Y Q;  4P75 A;  1DD2 A;  1J6Q A;  3OIP A;  4GLX A;  3K80 C;  2R7Z G;  1JR0 D;  2LSS A;  1R4Q B;  4OIJ A;  2EJM A;  1BUV T;  2EYO A;  4QQB X;  2Y0S E;  4DNT B;  1EOT A;  4OWT B;  1I3Q B;  1G6P A;  4R4T A;  1STG A;  5I4D A;  2PZW A;  4A3E G;  2KCN A;  4OGQ C;  3STB D;  2RF4 A;  5M3F G;  1VQK A;  5IYB G;  1PDQ A;  5IP7 G;  1BVS A;  2EYP A;  1E1T A;  1K8M A;  4JI2 Q;  1PH6 A;  2EQS A;  4KMU C;  3RLO A;  4R4O A;  4Y7N H;  2IX1 A;  2HCI A;  5C4Z A;  3MXN A;  3RZD H;  3T16 A;  4A3M B;  3QWN A;  1SYC A;  5M3F H;  1GO3 E;  5I6W A;  1L1O C;  1RKN A;  2K05 A;  3CQZ B;  5IYB H;  4LJZ C;  4L63 B;  4DV5 L;  1AH9 A;  1GVP A;  3TP8 A;  3P1H A;  4DAY B;  4LFB L;  2DN8 A;  4FF4 A;  2EYJ A;  4QMG A;  3J80 c;  1GHK A;  1FR3 A;  1V1P A;  2IY5 B;  1A3U A;  2OQK A;  4P73 A;  2NVX B;  4JI7 Q;  1RHP A;  5D3I B;  1IHZ A;  1TU2 B;  4PV1 C;  5JJL A;  2GN5 A;  3L3O C;  1VCI A;  4B9W A;  3KBG A;  4YY3 L;  1K8A C;  3BZK A;  4R4C A;  1CT1 D;  5IT9 E;  1YI2 A;  2H4O A;  4DR2 Q;  2XN9 C;  4LF4 Q;  1CQF A;  1KD1 C;  4J15 A;  1D8L A;  4IJL A;  1GKH A;  2D0P A;  1EOV A;  4JBW A;  2F0K A;  4K5X A;  4LUO A;  3K58 A;  4ZKC B;  2NVT H;  4YWK A;  4Y52 H;  5IYD H;  4F8M A;  5C0X I;  1Y1W B;  1ML0 D;  4JBM A;  1A2T A;  3ER0 A;  4LF7 L;  1STA A;  4RGM A;  1YBY A;  1CHQ D;  1U4R A;  2O5I C;  3M85 A;  2FIN B;  1S5B D;  3RUZ A;  3CKI B;  4DV1 Q;  1WTO A;  1IBK L;  1B53 A;  1I6H B;  2A6H C;  3PO3 H;  2L15 A;  2NUC A;  4IQZ A;  2XNA C;  5KND A;  4JI1 Q;  4U67 3;  5KYI A;  4RHS A;  4DV6 L;  1Q81 C;  1Y1V B;  4DR6 L;  2Q8R E;  1DM0 B;  1E0B A;  4HID A;  4JI5 Q;  2UUC Q;  1HH2 P;  1EIY B;  5JEA J;  4EQ5 A;  4K8J A;  4QJF A;  1TWA H;  2D62 A;  1O7I A;  2JA5 H;  1VQ9 A;  1RIP A;  3A7A B;  3TEH B;  4RKB A;  1HRJ A;  3K5L A;  2LMC B;  1Q1E A;  1A0I A;  3LWU A;  4XXE A;  2QEJ C;  1C8C A;  3MXG A;  1E2V A;  3OIQ A;  1SE2 A;  4N8F A;  1VQI A;  1TWF B;  2L12 A;  1XX8 A;  4NXM L;  3CRL C;  4GKJ Q;  2XSC A;  4A76 A;  1STE A;  4P74 A;  4HR7 B;  2RSO A;  4B9X A;  2WKC A;  3HP3 A;  5C4H A;  3T1H Q;  2KCC A;  2QA4 A;  1RTO A;  3RR5 A;  1C0A A;  4M1U B;  2JYO A;  2P5Z X;  3DWP A;  1VQD A;  4DR5 L;  4B3M L;  4LUV A;  4OL7 A;  4C3I G;  1H9S B;  2EYM A;  1Q3L A;  1G2T A;  1VMC A;  2QCP X;  3FRP B;  1PTO C;  1VQH A;  1PH9 A;  4TKO B;  2XRQ D;  2CQO A;  1E7Z A;  1SJH D;  4QIW E;  1JWM D;  4FP5 D;  1MI2 A;  2AQ2 B;  1QJO A;  3CU7 A;  3MEF A;  5J22 A;  5ISR A;  3AEV A;  1KHI A;  3M9B A;  4KKU A;  1XTD A;  1QCB D;  4PQX A;  2G9D A;  2KHI A;  4LF6 L;  4LFA L;  3IFD A;  1VQ6 A;  2YYZ A;  2AQ3 B;  2AWN A;  5KIX A;  1KIX A;  1HCZ A;  1LAC A;  1UWV A;  1TWC B;  3K5O A;  4DV2 L;  1UNS A;  5CV7 A;  4AH6 A;  3AMU A;  2FMC A;  3NTK A;  2OTL A;  4I65 A;  3RLN A;  1AN8 A;  4KLK A;  1IBM L;  2I0Q A;  4DF7 A;  2XIW A;  2YTV A;  4LAA A;  2HHH L;  3GTM B;  3AU7 A;  2VL6 A;  2VW9 A;  3MFG A;  2E74 C;  4DV3 L;  2R7Z B;  3TP7 A;  1X3F A;  3ULL A;  4P71 A;  4X64 Q;  4K6L A;  2ZTE A;  3ERS X;  4KD4 A;  2A6E C;  4H7B A;  2HD3 A;  3BZC A;  4BBR G;  1PRT C;  4N9P A;  4A3E B;  1DOM A;  3I72 A;  2PPB C;  1RF2 D;  3QR8 A;  3A8K E;  2E8G A;  1VQE A;  3HGB A;  3PF5 A;  1S5E D;  3EFX D;  3NE5 B;  3DWA A;  3CME A;  3K57 A;  2ALY B;  2HIX A;  1XNQ Q;  5AJ3 Q;  3P20 A;  3IAY A;  1LT6 D;  5IY0 A;  3I3C A;  4DR7 Q;  1VS0 A;  1NNX A;  2RDH A;  1OXT A;  2Z1C A;  3K0X A;  2B2W A;  1PFS A;  1WVL A;  3V96 A;  4ME3 A;  1MD2 D;  5GAH C;  5LMU Q;  1LTB D;  3BDC A;  1KAW A;  2IJ0 A;  3GTG H;  3KK7 A;  3HOZ B;  3A5Z B;  4GZY C;  1P8L A;  1U4M A;  1MJE A;  5C4X H;  4OX9 Q;  1PTO F;  4ZKB B;  4HCE A;  4HCS A;  3I56 A;  1SYB A;  1R9T H;  2WB1 B;  5D14 A;  1F2L A;  3ERQ A;  5DEH A;  1K9M C;  1L1O B;  1U5K A;  1UE1 A;  3K5M A;  1HR0 Q;  4JV5 Q;  1X3P A;  4ZQ3 A;  4B3T Q;  2L9H A;  2VQF Q;  4L5S A;  3LWE A;  2JA8 H;  4UP9 A;  1S5D D;  1FNV A;  4RCN A;  4LF9 L;  3GTJ B;  4G7Z C;  2Z9H A;  1VQF A;  1Q8K A;  2Q2H A;  2BH2 A;  2XRS D;  4DAP A;  1OXV A;  4P2C B;  5EBC A;  4BY1 G;  1Q12 A;  1IZ6 A;  1EIF A;  1CSQ A;  3HKZ G;  1ENA A;  1B7Y B;  3MTS A;  4R4Q A;  4FF3 A;  3GTK H;  4C56 C;  1JWS D;  2IHF A;  4DR1 Q;  4A3J B;  3MFY A;  2LY7 A;  3A55 A;  5TSS A;  1F9R A;  3KJP A;  3HOX B;  1QB5 D;  4UP7 A;  2C5C A;  2SEB D;  2N3S A;  4LFC L;  1SBB B;  3FVQ A;  3S1M B;  1Z6H A;  2B8F A;  5KRU A;  2B2Y A;  1PRT F;  3CC4 A;  2EXD A;  3ZYY X;  4DV7 Q;  1JJ2 A;  1EFI D;  2RDG A;  3GV3 A;  3E9I A;  1EQT A;  4ZRZ A;  5I9O A;  3H91 A;  1J8I A;  1BDO A;  3S1Q B;  2N8N A;  4JBK A;  2OF1 A;  3SEB A;  3S17 H;  3CAM A;  5M5W H;  2UXB L;  3VYU A;  2CWP A;  1HUN A;  4IO9 A;  1QZG A;  1JE5 A;  1I4R A;  3X3N A;  4JI6 Q;  3GTP H;  4DKA C;  1Y8O B;  5LMN L;  3I70 A;  2Q8T A;  3M7N A;  1VF7 A;  2E2I H;  1TWH B;  3E0E A;  1SAP A;  3I55 A;  3M3Y H;  1QVF A;  4DU9 A;  2MP1 A;  1HFG A;  2PNH A;  2Z0S A;  2B2T C;  4ZUJ A;  3WWV A;  3I4M H;  3CCR A;  1VF5 C;  1TQO A;  1XPO A;  3S14 H;  1X3G A;  4C3I B;  1SRO A;  1NR2 A;  1IKL A;  1PFM A;  2KED A;  4A3D H;  4DA2 A;  3RN5 A;  3HOU G;  1LM0 A;  3J81 L;  1GUG A;  2VS1 A;  3TN2 A;  3PSI A;  2L11 A;  3KJO A;  3MHB A;  5NUC A;  4WJ4 A;  1E2W A;  1GD7 A;  2PI2 E;  1YNJ D;  1S4Z A;  4FO2 A;  1JOR A;  1Q86 C;  3MC0 B;  3K6O A;  3HRZ C;  5M3M B;  3FPU B;  1PTO B;  5JJZ A;  4GKK L;  4F88 A;  1HNW L;  3HS0 C;  2PW5 A;  1QOH A;  3FKI B;  3UDF A;  2F4I A;  4JCV E;  1FNU A;  4HSV A;  3SR1 A;  3H3V I;  1ET6 A;  4KK7 A;  1I4X A;  2L5T A;  2IL8 A;  1I3Q H;  2LKV A;  2F3W A;  1FGB D;  4V0B A;  3W5O A;  1LYL A;  4A3M G;  4ABN A;  3PV0 A;  5C44 B;  3ND9 A;  1F2M A;  4JI3 L;  3S24 A;  3ZJY C;  2BE5 C;  2X69 A;  2WAQ G;  3MAQ A;  5IT9 L;  4IUP A;  4X62 L;  3S16 B;  3I4N G;  3E3X A;  1EY0 A;  3VR5 A;  4GLV B;  1C48 A;  4A93 G;  2Z8L A;  4DXG A;  3OYY A;  1ROD A;  4KHP L;  2R7D A;  1GUW A;  2UUB Q;  1IBL Q;  2F52 A;  4OWW B;  2HDL A;  1DXM A;  2HCC A;  4A3M H;  3GV6 A;  4RGT A;  3DWQ A;  3CQZ H;  4BBR B;  2DGY A;  1TII D;  4IUU A;  1YJN A;  2MNA A;  2UXD L;  1FL0 A;  1NCV A;  4BA2 I;  2ASB A;  1B50 A;  2RHQ B;  1TS5 A;  2NVX H;  2OTJ A;  3AFQ A;  1ASZ A;  4IFD J;  1PRT B;  1Y1W G;  1F9P A;  3SDZ A;  1EWH A;  2F0Q A;  3MWY W;  1B9N A;  1AE2 A;  1CKO A;  3C1F A;  4ODG A;  2R7F A;  1BOS A;  1L0W A;  1N32 L;  2PMZ B;  3MEH A;  2JA7 B;  4GNX C;  2BH8 A;  5FKA C;  2BA1 A;  3J81 c;  2RDF A;  4IPD A;  5T1G A;  2E5L Q;  2WV6 D;  2KCT A;  2NWG A;  1N36 L;  4A4I A;  1Y1W H;  1YNJ C;  2N88 A;  2RSN A;  4IJH A;  4HJ7 A;  2NVY B;  1J5E L;  1EIG A;  4DK0 A;  2PZT A;  2HT1 A;  1XTC D;  1MGS A;  2CW0 C;  3U4V A;  3S2D B;  1A3V A;  1I6H H;  3TDQ A;  2V4D A;  4Z9C B;  2XGT A;  5T1I A;  2IHE A;  4RG1 A;  1CQV A;  4MNO A;  4B08 A;  2A68 D;  5K36 H;  1HQM C;  5EBD A;  3HKS A;  3S2H B;  1Y1V H;  3I7F A;  4G7H C;  4BY1 B;  5IWA Q;  3PMF A;  4GLA C;  4DUY L;  1XPU A;  3KF8 B;  2F1M A;  2XWB B;  4HMJ A;  4HIK A;  1HR0 W;  3GQB A;  4RFB A;  5IGG A;  1G51 A;  2RA4 A;  3A5U A;  3F2U A;  4JOI C;  2WII B; 
#chains in the Genus database with same CATH homology
 5IGC A;  3NQI A;  1TY0 A;  1HXY D;  4O1N A;  2MPM A;  2KJX A;  4WFN 3;  5M5X B;  3TSS A;  2IT1 A;  5CV8 A;  1PFB A;  1I50 B;  1BCP D;  3NWT A;  3W2D A;  1ENF A;  5I2X A;  3N52 A;  3LX0 A;  4ZYS A;  4OO1 I;  5CV6 A;  2IPK D;  1L0Y B;  2VB2 X;  4F87 A;  1Q1B A;  1KDB A;  1HPC A;  3BYT B;  3BZD B;  3EVQ A;  4QF4 A;  5C6A A;  1ZYR C;  2B2V A;  2RBM A;  3EJI A;  5IIF A;  1GHJ A;  2WKD A;  4J6H A;  2L0C A;  2B2U A;  4K2K A;  1SYF A;  2KQ3 A;  3DMU A;  3HOU B;  4KKS A;  1ENC A;  1BNZ A;  1JE4 A;  1NR4 A;  2ENB A;  3SVM A;  2LFN A;  2F0N A;  1KDA A;  1F2Z A;  2VXW A;  3NTI A;  1A15 A;  4RGN A;  3R2T A;  5DM7 3;  2K5D A;  4QCL A;  3IFT A;  3AB9 A;  3PUW A;  3VR4 A;  3FMC A;  1LV9 A;  1KDC A;  2WAQ B;  4AYB B;  1VDZ A;  1BBX C;  3D4W A;  4FNF A;  3I4N B;  1WTP A;  4A93 B;  1HHV A;  2D9U A;  3Q0A A;  3NK9 A;  2F0W A;  5KYL A;  2JXM B;  4IFD G;  3E5S A;  4CKB A;  1S5F D;  2F0O A;  3HZX A;  1SMY D;  2M9V A;  2A69 C;  3OMG A;  1STB A;  1D1K A;  3K7A B;  1CHP D;  1A2U A;  3M4Y A;  3GTO B;  4M8A A;  2K33 A;  3MXU A;  4U68 A;  1KNE A;  1CZG A;  1JCK B;  1SYD A;  3O13 A;  3GD7 A;  3K59 A;  4IUV A;  2ZXO A;  4Q0F A;  4CKC A;  1SE4 A;  3D4D A;  5ELD A;  1K8O A;  5CR3 A;  2MHV A;  4DAV A;  4RA8 A;  3GTL B;  1QG7 A;  4CJ2 C;  4IUQ A;  2IW3 A;  2YU9 B;  4DK1 A;  3D3R A;  4EQP A;  3GP7 A;  1RD9 D;  2ZT9 C;  2CQA A;  3CHB D;  1SFO B;  5COY A;  4XYO A;  4RH6 A;  1EY6 A;  2F0S A;  4DFA A;  2DY7 A;  1JQY D;  4HTH A;  3BDO A;  1EYA A;  2F0U A;  1UEA B;  1FYC A;  5JAV A;  3A56 A;  1SND A;  3BDL A;  3K5N A;  3ITP A;  4A3I B;  2L55 A;  1GJX A;  4BY7 B;  2Y0S B;  3KBX A;  1A6X A;  5EGT A;  1SMY C;  4KV6 A;  2SNS A;  3TP5 A;  3HOV B;  1KAB A;  4H44 C;  4BWG B;  3GO5 A;  5E1F A;  3C46 A;  2EY5 A;  1EWC A;  4C1N I;  1F9S A;  3A54 A;  2EY1 A;  1WTX A;  3N6R A;  1DON A;  2NN6 I;  5J39 A;  5C0X G;  4R8I A;  3NXW A;  2KEC A;  1OXU A;  2KUM A;  3P75 A;  1PTO H;  3NUC A;  2H1E A;  1RJT A;  4KKT A;  1EY7 A;  2AQ1 B;  5CBA E;  5C0X H;  3Q22 A;  3TZD A;  5FO9 B;  1TT2 A;  1AZP A;  4RWS C;  4BBS B;  2R6G A;  2F03 A;  2G9H D;  1F2Y A;  1RDP D;  2EDG A;  3D6W A;  4R8N A;  3QO2 A;  1PLF A;  4IN3 A;  1WCM B;  2QIL A;  1STN A;  5C4J B;  2I07 B;  5E3F A;  2Z4I A;  2OT2 A;  1GXD C;  1RTN A;  5LL6 S;  3G7L A;  2K5Q A;  2FJ2 A;  2R3Z A;  3NSW A;  1IKM A;  4HSP A;  4HN7 A;  2L4N A;  5ELF A;  4X3K A;  1XWE A;  1V8Q A;  4PMB A;  1T5X D;  2JSO A;  4DAY A;  1PXU A;  3L7Z C;  1MSH A;  1B4O A;  5AFW A;  3IKJ A;  1ILP A;  4TSS A;  4PNY A;  4OHJ A;  4N9T A;  1LTA D;  1B2T A;  2VB3 X;  5I9P A;  5CYU A;  5FLX E;  5M5Y B;  1G6Z A;  4NDX A;  4KTA A;  1BXT A;  5KNC A;  3PUY A;  5KEE A;  1KNA A;  5JPM C;  1SJE D;  1KLU D;  2A73 B;  2RQX A;  5JEA G;  1BF4 A;  4QIW B;  5EPJ A;  1EY8 A;  3R8B A;  2J0T D;  4KJO A;  1CA5 A;  3EQL C;  3EA6 A;  1I4Q A;  1EYD A;  1EEI D;  3R3O A;  5G3L D;  5IGD A;  4JK1 C;  1PZJ D;  1SNO A;  4DGZ A;  1GUT A;  5JEA H;  1ESF A;  3WDN A;  2EE1 A;  1WD1 A;  4J8Q A;  1DOK A;  5ELB A;  1DJR D;  3H09 A;  1JOQ A;  3PO2 B;  5IOC A;  2HUG A;  1RCV D;  3I73 A;  3LNN A;  3RZO B;  1X32 A;  1LTT D;  1DZ1 A;  1G29 1;  4E6I A;  1IYU A;  5HGT A;  2TSS A;  3HOW B;  1K83 B;  1XYI A;  1H9S A;  5FOB B;  3X3M A;  3BG3 A;  3FPP A;  3H94 A;  1LT4 D;  3OMC A;  1SEB D;  3ND8 A;  3K0Y A;  3OHX C;  1TWG B;  1PZI D;  2BCO A;  3KLR A;  3RD4 A;  4C3J B;  2XVS A;  2B2W C;  1D1I A;  1LO5 D;  3TME A;  2MUY A;  3KLS X;  4C1N K;  4XT3 B;  1Q90 A;  1CFM A;  4BS9 A;  5EKK A;  1OXS C;  2R92 B;  2VUM B;  1EEF D;  4HAE A;  1HA6 A;  2EOT A;  5J1Z A;  2F0J A;  3VR6 A;  4IUR A;  3HG9 A;  3TZU A;  4XYQ A;  2KOL A;  3BVM A;  1SE3 A;  1AEX A;  2M2L A;  4DNR B;  1TY2 A;  2D2C C;  5HUR A;  1G8Z D;  3QOJ A;  3M4O B;  1C4Q A;  1V1P B;  1WTV A;  3TBI B;  2HQE A;  4NMZ A;  5FO7 B;  1D6E C;  1KLG D;  1STH A;  1SDF A;  4F7X A;  1AP0 A;  3SHL A;  3TP6 A;  4A3K B;  1TKW B;  1JOO A;  2JP1 A;  5COR A;  3L9A X;  1SYE A;  1X3Q A;  3I91 A;  3KUP A;  2WIN B;  1G91 A;  4DN4 M;  1V43 A;  5EPK A;  2EYL A;  3DUZ A;  3NHH A;  4EQO A;  1TR5 A;  2EY2 A;  2DNC A;  3H3V C;  3D4R A;  3D8G A;  4L8J A;  5BN4 A;  2XWJ B;  2Q8I B;  4YIJ A;  2MGS A;  3S15 B;  3S1R B;  3C3L A;  5C3W A;  5D65 A;  3JAM E;  2DY8 A;  1DCZ A;  2SOB A;  3QIA A;  2FMM A;  1LAB A;  3QOL A;  1EYC A;  1II3 A;  2RKS A;  2K28 A;  5C3E B;  2NBF A;  1G2S A;  4X3U A;  2JA6 B;  1EQV A;  5A2Q E;  3BS1 A;  3GTQ B;  5CMD A;  2F0E A;  2OEO A;  5CV4 A;  2KHS A;  3H6M A;  2BDN A;  4FVM A;  2ZXR A;  2FHT A;  3VR3 A;  3T4A C;  1LTR D;  3SK8 A;  1STY A;  3OWF A;  4X3T A;  5FK9 C;  3RLF A;  5A35 A;  5ELE A;  2AWO A;  5EQ0 A;  4S3S A;  4FXK C;  2F0G A;  3PIO 3;  2F0I A;  5DAU A;  2E2J B;  3PUX A;  1VMP A;  5BN3 A;  1AFP A;  4OIK A;  1WTW A;  1MBY A;  4CGY B;  2R93 B;  1E2Z A;  5JVG 3;  1NUC A;  4KN4 C;  5CC4 A;  2BA0 A;  2A68 C;  3Q6S A;  5KGU A;  3ERO A;  2F0L A;  1CM9 A;  1KTK A;  3NTH A;  4IUN A;  3WOE A;  1XXG A;  2F0H A;  1ILQ A;  3VA7 A;  5D3D A;  1YNN D;  3VA5 A;  1JC7 A;  4V19 0;  1EY5 A;  2A6H D;  4KN7 C;  4QUF A;  1M4V A;  1B3A A;  4KY5 A;  4KI0 A;  5JVH 3;  1W6J A;  2RVL A;  3NQT A;  1O7Y A;  1JWU D;  1U4L A;  3NP8 A;  4ZUI A;  4EQN A;  4RKL A;  2PZU A;  3NPP A;  1BCP C;  5FLX L;  2QDB A;  4IAL A;  4CKE A;  1HA5 A;  2PO4 A;  1O7Z A;  3J81 E;  2EYH A;  5JOB A;  2NYZ D;  4I7Z C;  3T13 A;  2F0T A;  1O7L A;  2PCF B;  3PUZ A;  3NBH A;  4G4K A;  4G57 A;  5C5L A;  4WOR A;  4OO1 G;  4C2M B;  5ELC A;  2KA7 A;  4NKL A;  1JB3 A;  4ME5 A;  1EU4 A;  2BDO A;  4IFD H;  2HDM A;  3G6J B;  4K2L A;  3D6C A;  4WJW A;  1FD7 D;  2E2H B;  1PTO D;  4OO1 H;  4QB4 A;  3U9S A;  2EPB A;  2NVQ B;  2K1B A;  3VYT A;  3T56 B;  3SK6 A;  4WRD A;  4KJN A;  5E4X A;  4XQJ A;  4HMI A;  3Q23 A;  2CHB D;  1SXT A;  4H13 C;  1LTI D;  1YNN C;  3E6Z X;  4CHT B;  1EU3 A;  3PIP 3;  3HOY B;  4XQN A;  4MIU A;  2L1B A;  4FXG C;  3H0G B;  3S1N B;  4KD3 A;  1SYG A;  1OXX K;  2R61 A;  3V05 A;  3FDT A;  2IX3 A;  1ZEQ X;  2B2V C;  3OOC A;  1I4P A;  3SK4 A;  1QNU A;  2Z4H A;  1DYQ A;  4FF1 A;  3KF8 A;  4CJ0 B;  1BCP F;  1B1Z A;  4EGV A;  2A6E D;  4A3F B;  2B2U C;  1PRT D;  3OWE B;  3SXH A;  5DNF A;  3OW7 A;  3BVG A;  1I6V C;  2B63 B;  1LTS D;  4C3H B;  1U4P A;  1SSO A;  1NAP A;  4BA1 I;  5BN5 A;  2NB0 A;  2K32 A;  2EJG C;  2BOS A;  4ILW A;  5LL6 X;  5I2Y A;  3DXJ C;  4KHV A;  1U9R A;  1JOK A;  4C3J G;  4K8I A;  2EYF A;  4A3G B;  1DOL A;  2IX0 A;  1BQQ T;  2EJF C;  1TS4 A;  4O42 A;  1EZ8 A;  2QKI C;  1LT5 D;  2K03 A;  3R2I A;  2SNM A;  2X6L A;  4A3B B;  3I90 A;  3V2T A;  3VYR A;  1L0X B;  4NW2 A;  3SE0 A;  1BR9 A;  1QWY A;  3MXP A;  5EPL A;  1HTP A;  2K01 A;  4CBV A;  1CI3 M;  1BO0 A;  2K6A A;  1LLR D;  4IUT A;  3J80 E;  1SNP A;  4R9W A;  1ICW A;  3DM1 A;  2B2T A;  2M00 A;  1QIL A;  3A8J E;  2MJ8 A;  4K14 A;  4PMW A;  4LK1 C;  1SNC A;  4X3S A;  3RMH A;  2EY6 A;  2O2L D;  5CGK A;  3CRK C;  5CBE E;  3URY A;  2B39 A;  4Y7N B;  1UAP A;  3RZD B;  4MN3 A;  5M3F B;  4ULL A;  5EKL A;  1HTL D;  4K5W A;  5K5P A;  2F0P A;  5CV9 A;  3A7L A;  2J4X A;  2O4X A;  1D5M C;  2I46 A;  5LHY 1;  4G7O C;  2F0D A;  5E4W C;  3JAM L;  2NTS A;  4CJ1 B;  2A74 C;  2B8G A;  1F9Q A;  1BCP B;  3MA2 B;  2O5J C;  2LS0 1;  3J7Y W;  3Q24 A;  1PFN A;  2KVM A;  1IYV A;  3S14 B;  2NVT B;  3ONA B;  1QNK A;  2NN6 G;  2GA4 B;  3PUV A;  5A2Q L;  3DEO A;  2ICI A;  1CZW A;  4Q5V A;  3U9O A;  3KLS A;  1Q8I A;  1HUM A;  4FXD A;  4RAU C;  2K7V A;  4FF2 A;  3J7A F;  1OO9 B;  2ICE C;  5DM6 3;  3PO3 B;  4K5V A;  2VNU D;  2NN6 H;  3A8I E;  4UAI A;  3SK5 A;  2EXZ A;  1PZK D;  1O78 A;  3DEP A;  2X6G A;  3WOF A;  1WD0 A;  1TWA B;  3QJY A;  2JA5 B;  4TRD A;  5EJW A;  3D31 A;  1S5C D;  2BE5 D;  4KY7 A;  3OPO A;  1ZKO A;  4EVO A;  4UDU C;  3IL8 A;  3MZ5 A;  2PW7 A;  2E75 C;  2CVR A;  4PMC A;  4J1M A;  1PYW D;  4ZLT F;  3FEW X;  4KHZ A;  2E2D C;  2AUK A;  2K5W A;  4XDX A;  5I6Y A;  2F0V A;  1D5X C;  4XQQ A;  5IGB A;  1B44 D;  4QUC A;  4NP5 A;  1HQR D;  4RCO A;  1SNQ A;  1CA6 A;  1GUS A;  3NBI A;  1R4P B;  5JPN C;  1HFN A;  1Z47 A;  5C3X A;  1WTQ A;  3M7G A;  1Y8P B;  1I4G A;  3T51 B;  3I8Z A;  5C5M A;  1SNM A;  3UI2 A;  2A5H A;  1T5E A;  3J7A V;  2NTT A;  1H9K A;  2CW0 D;  5KNB A;  1NSN S;  1EY4 A;  1WTR A;  1AW7 A;  5FO8 B;  1ESR A;  1GUN A;  2PYK A;  1TVX A;  1JIC A;  1Y69 U;  1B9M A;  3QB3 A;  1ONL A;  2EZV A;  3I4L A;  1H9R A;  1CTM A;  1M8A A;  2IWH A;  3OSO A;  5F2D A;  2KEE A;  3VYS A;  2DNE A;  1PMR A;  1O80 A;  2AUJ D;  3GTG B;  1F77 A;  1EIH A;  5CV5 A;  1H9M A;  3MVV A;  4TQU S;  2TMP A;  3S9W A;  1EY9 A;  4DXF A;  5C4X B;  4H0L C;  3NWS A;  4IZ8 A;  1J9O A;  1GUO A;  3R93 A;  1R9T B;  1EZ6 A;  2C9O A;  1IW7 D;  2B2Y C;  2F3V A;  1FNW A;  2NZ1 D;  3W3A A;  3T53 B;  4FYD A;  4ID6 A;  3HEJ A;  4XIG S;  2JA8 B;  3QG1 A;  4ZAI A;  5IOD A;  4RGO S;  1CK1 A;  1ZYR D;  1TS2 A;  5K36 G;  4ZK9 B;  1A3T A;  1ZXT A;  1KAA A;  1LT3 D;  4XTC S;  3C1E A;  1D5Z C;  2K04 A;  1AZQ A;  2E76 C;  2QF7 A;  5G3L F;  3GTK B;  3BYY B;  3DHQ A;  2FFK B;  1Z7T A;  5M9O A;  4LMQ D;  1H9J A;  1GOZ A;  1MSG A;  1V1O A;  4KY6 A;  2WAC A;  2J7Z A;  4MHE A;  4C3H G;  3VR2 A;  4RHR A;  3HKZ B;  1EL0 A;  1ET9 A;  1Y8N B;  2N55 A;  4XT1 B;  3BVZ A;  1I4H A;  4K6D A;  2WP8 J;  3E0J A;  1W6K A;  3S17 B;  2ID0 A;  5EKI A;  1UUP A;  1QE6 A;  5M5W B;  4IFD I;  4HED A;  3GTP B;  3J80 L;  2E2I B;  2SDF A;  5IGF A;  2F0M A;  1LTG D;  1IL8 A;  5IGE A;  3M3Y B;  1IW7 C;  3I4M B;  2EVB A;  2D5D A;  2A69 D;  4L6T B;  1D2B A;  2ZXP A;  4A3D B;  2JE6 I;  2PNR C;  2F0F A;  2PQE A;  1TS3 A;  2JEA I;  3C2P A;  2JEB I;  3P7J A;  2OXP A;  5C0X J;  1DD2 A;  3OIP A;  1JR0 D;  1R4Q B;  4OIJ A;  2EJM A;  1BUV T;  2EYO A;  4DNT B;  1EOT A;  1I3Q B;  1STG A;  5I4D A;  2PZW A;  2KCN A;  4OGQ C;  1PDQ A;  2EYP A;  1K8M A;  4KMU C;  2IX1 A;  2HCI A;  5C4Z A;  3MXN A;  3T16 A;  4A3M B;  3QWN A;  1SYC A;  5I6W A;  1RKN A;  2K05 A;  3CQZ B;  4LJZ C;  4L63 B;  3TP8 A;  3P1H A;  2DN8 A;  4FF4 A;  2EYJ A;  4QMG A;  1GHK A;  1FR3 A;  1V1P A;  1A3U A;  2NVX B;  1RHP A;  5D3I B;  1IHZ A;  1TU2 B;  4PV1 C;  3L3O C;  1VCI A;  4B9W A;  3KBG A;  1CT1 D;  5IT9 E;  2H4O A;  2XN9 C;  1CQF A;  4K5X A;  4JBW A;  2F0K A;  3K58 A;  4ZKC B;  4F8M A;  5C0X I;  1Y1W B;  1ML0 D;  1A2T A;  1STA A;  4RGM A;  1CHQ D;  1U4R A;  2O5I C;  3M85 A;  2FIN B;  1S5B D;  3RUZ A;  3CKI B;  1WTO A;  1B53 A;  1I6H B;  2A6H C;  2NUC A;  4IQZ A;  2XNA C;  5KND A;  4U67 3;  5KYI A;  4RHS A;  1Y1V B;  2Q8R E;  1DM0 B;  1E0B A;  5JEA J;  4K8J A;  2D62 A;  3A7A B;  4RKB A;  1HRJ A;  3K5L A;  2LMC B;  1Q1E A;  3LWU A;  4XXE A;  2QEJ C;  1C8C A;  3MXG A;  1E2V A;  3OIQ A;  1SE2 A;  1TWF B;  2L12 A;  1XX8 A;  3CRL C;  2XSC A;  1STE A;  4HR7 B;  2RSO A;  4B9X A;  2WKC A;  3HP3 A;  5C4H A;  2KCC A;  1RTO A;  4M1U B;  2JYO A;  3DWP A;  4OL7 A;  4C3I G;  1H9S B;  2EYM A;  1Q3L A;  1G2T A;  1VMC A;  2QCP X;  3FRP B;  1PTO C;  4TKO B;  2XRQ D;  1SJH D;  1JWM D;  4FP5 D;  1MI2 A;  2AQ2 B;  1QJO A;  3CU7 A;  5J22 A;  5ISR A;  4KKU A;  4PQX A;  1QCB D;  2G9D A;  3IFD A;  2YYZ A;  2AQ3 B;  2AWN A;  5KIX A;  1HCZ A;  1LAC A;  1TWC B;  3K5O A;  1UNS A;  5CV7 A;  3AMU A;  2FMC A;  3NTK A;  4I65 A;  1AN8 A;  4DF7 A;  2XIW A;  4LAA A;  3GTM B;  3AU7 A;  3MFG A;  2E74 C;  2R7Z B;  3TP7 A;  4K6L A;  4KD4 A;  2A6E C;  4H7B A;  1PRT C;  4N9P A;  4A3E B;  1DOM A;  3I72 A;  2PPB C;  1RF2 D;  3A8K E;  3HGB A;  1S5E D;  3EFX D;  3NE5 B;  3DWA A;  3K57 A;  3P20 A;  3IAY A;  1LT6 D;  3I3C A;  2RDH A;  1OXT A;  2Z1C A;  2B2W A;  1WVL A;  3V96 A;  1MD2 D;  1LTB D;  3BDC A;  2IJ0 A;  3KK7 A;  3HOZ B;  4GZY C;  1U4M A;  1PTO F;  4ZKB B;  4HCE A;  4HCS A;  1SYB A;  2WB1 B;  5D14 A;  1F2L A;  3ERQ A;  5DEH A;  3K5M A;  1X3P A;  4ZQ3 A;  2L9H A;  3LWE A;  1S5D D;  1FNV A;  4RCN A;  3GTJ B;  4G7Z C;  2XRS D;  4DAP A;  1OXV A;  4P2C B;  5EBC A;  1Q12 A;  1ENA A;  3MTS A;  4FF3 A;  4C56 C;  1JWS D;  4A3J B;  3MFY A;  2LY7 A;  3A55 A;  5TSS A;  1F9R A;  3HOX B;  1QB5 D;  2C5C A;  2SEB D;  1SBB B;  3FVQ A;  3S1M B;  1Z6H A;  2B8F A;  5KRU A;  2B2Y A;  1PRT F;  3ZYY X;  1EFI D;  2RDG A;  3GV3 A;  1EQT A;  4ZRZ A;  5I9O A;  3H91 A;  1J8I A;  1BDO A;  3S1Q B;  2OF1 A;  3SEB A;  3VYU A;  1HUN A;  1I4R A;  3X3N A;  1Y8O B;  3I70 A;  2Q8T A;  3M7N A;  1VF7 A;  1TWH B;  1SAP A;  4DU9 A;  2MP1 A;  1HFG A;  2B2T C;  4ZUJ A;  1VF5 C;  1TQO A;  4C3I B;  1NR2 A;  1IKL A;  1PFM A;  2KED A;  4DA2 A;  3J81 L;  1GUG A;  3TN2 A;  2L11 A;  3MHB A;  5NUC A;  1E2W A;  1YNJ D;  1S4Z A;  4FO2 A;  1JOR A;  3MC0 B;  3K6O A;  3HRZ C;  5M3M B;  3FPU B;  1PTO B;  5JJZ A;  4F88 A;  3HS0 C;  2PW5 A;  1QOH A;  3FKI B;  2F4I A;  1FNU A;  4HSV A;  3SR1 A;  1ET6 A;  4KK7 A;  1I4X A;  2L5T A;  2IL8 A;  2LKV A;  2F3W A;  1FGB D;  4V0B A;  4ABN A;  3PV0 A;  5C44 B;  3ND9 A;  1F2M A;  2BE5 C;  2X69 A;  3MAQ A;  5IT9 L;  4IUP A;  3S16 B;  3VR5 A;  1EY0 A;  1C48 A;  2Z8L A;  4DXG A;  1ROD A;  1GUW A;  2HDL A;  1DXM A;  2HCC A;  3GV6 A;  4RGT A;  3DWQ A;  4BBR B;  1TII D;  4IUU A;  1NCV A;  4BA2 I;  1B50 A;  1TS5 A;  4IFD J;  1PRT B;  1F9P A;  3SDZ A;  1EWH A;  2F0Q A;  3MWY W;  1B9N A;  3C1F A;  4ODG A;  1BOS A;  2PMZ B;  3MEH A;  2JA7 B;  5FKA C;  2BA1 A;  2RDF A;  5T1G A;  2WV6 D;  2NWG A;  1YNJ C;  2N88 A;  2RSN A;  2NVY B;  1EIG A;  4DK0 A;  2PZT A;  1XTC D;  1MGS A;  2CW0 C;  3S2D B;  1A3V A;  3TDQ A;  2V4D A;  4Z9C B;  5T1I A;  1CQV A;  4B08 A;  2A68 D;  5K36 H;  1HQM C;  5EBD A;  3S2H B;  4G7H C;  4BY1 B;  3PMF A;  2F1M A;  2XWB B;  4HMJ A;  3GQB A;  4RFB A;  5IGG A;  2RA4 A;  3F2U A;  2WII B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...