4X62L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x62L00
2E5LQ 1ASYA 1L0WA 3GTJH 4GNXB 2N3SA 1K83H 1TWGH 1YVCA 1WI5A 3FP9A 4IPGA 3TQYA 3J81i 3UDGA 1N8RC 1CKNB 2MFIA 1X9NA 1VQ9A 1W2BA 1LUZA 2NVQH 4BY7H 4IFDG 2UXCL 4R1JA 4UP7A 3DM3A 1HZCA 2YYZA 4X64L 3S1RH 3PUVA 4IJHA 1Y1WG 5C4XG 2FXQA 1YEZA 2R6GA 1VQ6A 3ZJYC 1UE1A 2ZJPA 4LF6L 2VUMG 2R7ZG 1Z47A 4A3EH 3S24A 4LUVA 2K5VA 4YWKA 4AIMA 2B3GA 2Q2IA 4LF4Q 1IBLQ 4LF8L 2NZOA 5C44H 1LM0A 1CKNA 1X3FA 5FLMG 3GTLH 2I5MX 3K80C 3K7AH 1VQNA 5C3EG 3CC4A 5M3FG 1SE8A 3KFUA 4A3GG 1BVSA 1NJIC 4YCVA 3CCLA 5ELOA 2Q2UA 2CQOA 5JJLA 2HHHQ 1PA6A 4B3SL 1BBWA 4GN4B 4WJ3M 1KL9A 4Y7NH 2PQAA 1I94L 4DV1L 2NVXH 1X3GA 4QL5A 1PH5A 3EBEA 4HJ9A 2JA8G 4K0KL 1WCMG 4BA1I 3KLWA 4DNIA 1YHBA 3RR5A 3I4NG 1YJWA 5C0XJ 3UDXA 3AFQA 3HOYH 4IFDJ 1NMGA 3GTOH 1OXSC 2I5LX 3TS0A 4A93H 3HOVG 4IOAA 3HOWG 1YI2A 3A0JA 4B3RQ 4R4TA 4ME3A 4DV4L 1PV4A 4A3DH 4WJ4A 4YY3L 2CKZB 3RLOA 2MNAA 4A3BH 2D62A 1HJPA 2HIVA 1E3PA 1Q1BA 2WB1G 3AQQA 3AYHB 3BZCA 4OWXB 3CMEA 1X65A 3CCMA 1HNXQ 3HOUG 3RZOH 1PVOA 2OQ0A 1W3SA 4DR1Q 4DV5Q 3CF5A 1KQSA 3PGZA 2K52A 1K0RA 4KI0A 3I7FA 3PIPA 1S40A 3BZKA 4C3JH 2Q2TA 4BA2I 1GVPA 4P72A 1G6PA 3M4QA 3PUWA 4DR7L 2KENA 4UP8A 4NB3A 1LYLA 2C35B 1JMCA 4A3LH 4OX9Q 2LXKA 3HOXH 4R4IA 1V9PA 3I2ZA 1FL0A 3FKIH 1CKMA 2ID0A 3W5OA 4DUZL 5IYDH 4DR2L 2K5NA 4JBWA 4P74A 3H0GH 4JI2Q 1GM5A 1XMOQ 2B63G 2OCEA 2K14A 1OXVA 4DV3L 1EQRA 4R4CA 3L7ZC 2H5XA 5BR8Q 4JI5L 4A3CH 1PH4A 5FLXc 4OO1I 4TVAB 1TWFH 5EAYA 1K8AC 4DR6Q 3K81C 1OXXK 4JYAL 4A76A 3HKSA 2PI2E 1K73C 4JI3L 1C9OA 3MXNB 5LMUQ 1YIJA 1HNWL 4POGA 4A3KH 5IYBG 2AWOA 2QEXA 3U58A 3G4SA 1VS0A 1XNQL 3NELA 3D0FA 3UE0A 1QVGA 1XTDA 1JJCB 1J5EL 2EQSA 1PH6A 1ASZA 2LSSA 4HIDA 4LNQA 4GOPA 1DGSA 4GS3A 1Q82C 2UUBL 4BXXG 1A62A 2EIFA 4XTCS 4YWLA 5E7NA 5FJ8H 4A3FH 2JK8A 4YCUA 2ZTEA 3M4PA 4QGUA 1KD1C 4JI7Q 4IPHA 4DAYB 4DR4L 1E24A 1YBYA 1PH7A 1VQ7A 4A3MG 3CP0A 1PH9A 4RMFA 1IL2A 5J3BA 3PV0A 5C0XI 1EWIA 3F1ZA 3IRBA 4OONA 4IFDI 4OO1G 2HQLA 1A0IA 4LUOA 4DR5L 3T1YQ 1CSPA 4DV0L 4ALPA 2UU9Q 3U50C 1VCIA 3BU2A 2JA5H 2A1AA 2YTYA 4B3TQ 2ZJRA 1Y14B 2KCTA 4LF9L 2GVAA 4B3MQ 4LFCQ 1VQLA 4GOPC 4JBKA 3FHWA 3S2DH 4R4QA 2MO0A 1MIUA 2BH2A 3HKZE 2JEAI 1UE7A 4IJLA 1N32L 1A8VA 1UEBA 2YU9H 3I55A 1XNRL 1L1OA 3F2DA 1HNZQ 3L0OA 4DV7Q 4GKKQ 1VQHA 2WB1E 1JE5A 3PUYA 1K8GA 4PMWA 1HR0Q 2E5LL 4LF7Q 4A3IG 1SR3A 4LWCA 1Y1VH 3NBHB 5C0XG 2ZJQA 3H3VI 4LW1A 4QIWE 4LFAQ 4DV2Q 1AE2A 4X62Q 2VZAA 4OWWB 5IP7H 2UXDQ 3W1GA 1PH1A 1TWHH 2AKWB 4RG1A 3RNUA 3F8TA 1X6OA 2R7FA 4J15A 3CCJA 3CCQA 1VQMA 1YJNA 1K3RA 5JJKA 1JJ2A 3ER0A 2UXBQ 2PQAB 3I4MH 1IBLL 2KHIA 1EFWA 1GKHA 1X54A 2R7DA 2JQOA 3J80c 4JBJA 3KF6A 2L15A 2DUDA 2R93H 3RN5A 1PH3A 2ATWA 2E8GA 4BXXH 1FVIA 1E1OA 3SGIA 3GO5A 4LF5Q 3J80i 2K75A 2JA7G 2HHHL 4JI8Q 1UWVA 1Q86C 4BY1G 2GN5A 5LMNQ 4EX5A 2MQHA 4R4OA 5GROA 2A19A 1Y1WH 3LGJA 1UE6A 4A3JG 4HJ8A 3CD6A 4MZ9A 1P8LA 4A93G 2VUMH 2R7ZH 4QJFA 3CXCA 1PYSB 1I6HH 1Q46A 1WFQA 4C2MH 1GD7A 3S1MH 2MO1A 3S14H 1O7IA 5IP9G 1EOVA 2AHOB 3A74A 5FLMH 3HKZG 1YHQA 2E2IH 4A3BG 3PO2G 3K0XA 3UDFA 1Z9FA 1FJGL 1V43A 1OTCA 5C3EH 5AJ3Q 5M3FH 3H15A 4A3GH 1MJCA 4DV1Q 1IBKQ 1OXUA 5HGQA 4JI4L 1HR0W 5GAGC 2KBNA 3PSIA 1HNXL 1X3EA 4GLXA 4JC0A 3DLLA 3ULJA 3OW2A 4O2DA 2UUAL 4DR1L 2ASBA 1NE3A 4DV5L 2JE6I 3UDIA 5GAHC 2R92G 5GAEC 5IYCG 3TEHB 2I5HA 2JA6G 1PYBA 1WCMH 3G6EA 3I4NH 1OXTA 3JC66 2VQEL 2OTLA 4P73A 2B29A 5IWAQ 3KF8B 4NPSA 3OTOQ 3J81j 4JV5Q 1QZHA 1V1QA 3STBD 1N9WA 3GDEA 3EIVA 5M5WH 4JI2L 2PMZE 2WAQG 1XMOL 1VQ8A 4L5SA 3HOWH 4DUYL 4GOPB 1GO3E 5BR8L 4GN5A 1CSQA 2OWOA 1HZ9A 1IBMQ 1EIFA 3KDFA 4AQYQ 3CC2A 1X55A 4DR6L 3HOUH 3CPWA 4NXNQ 2N49A 3A5UA 3F2CA 1VQEA 3J7A5 5LMUL 4KHPL 2Y0SE 3RLNA 2RF4A 2NVTH 4HJ7A 2RCNA 3CQZH 4IPCA 3I4OA 2YV5A 5GADC 1S72A 5LMNW 4X66Q 4JI6L 1LTLA 2VY3A 1KAWA 4HJAA 1XMQQ 1U0LA 4C3IH 4DPGA 4L5TA 3PUXA 2LXJA 3RLFA 1VQIA 5JEAJ 1N33Q 1QVCA 3S16H 4JI7L 2NN6G 4DKAC 1XPOA 4KLKA 5M3MH 2ZM6Q 3Q8DA 3A5ZB 1NY4A 3CCUA 1C7YA 2VL6A 3PO3G 4NXMQ 1R9TH 1H95A 2I0QA 2UUCQ 2F3IA 2NVYH 2PI2A 1VQGA 1E7ZA 4PZ6A 2VQFQ 5H1SE 3HOZG 2D0OA 1L1OB 2IT1A 1D8LA 4MTNA 5K36G 2ALYB 3T1YL 1IYJB 3PF5A 5M5YH 2WP8J 2CCZA 2UU9L 5IYBH 3KJPA 1TWCH 4JI0L 1N34Q 2E2JH 4B3TL 3S2HH 3KOJA 4BBSG 4PZ8A 3W1BA 4TQUS 3M85A 4B3ML 4LFCL 1YJ9A 3GTGH 3PCOB 1NTGA 4DV6Q 2F4VL 5HY6A 3NEMA 4PZ7A 2VW9A 1N36Q 1PH8A 4L5QA 4YCWA 3J7ZC 2Z6KA 1E1TA 4LFBQ 1G51A 1HNZL 4BY7G 4DV0Q 1KXLA 4DV7L 1VQPA 4A3MH 3D31A 1VQJA 1K9MC 4YHHQ 3CW2C 1HR0L 4JI1Q 4BBRH 4FDBA 1A63A 4GLAC 4HIMA 1IZ6A 4DV2L 2YTXA 3KF6B 4LFAL 2F52A 1KRSA 4X62L 4X65Q 4A3EG 1M1KC 2UXDL 2ZTDA 3K8AA 2OTJA 1D7QA 5C44G 1B7YB 2OQKA 3J81c 2Y0SG 1SN8A 5DLQE 1KRTA 3ULLA 4GKJQ 3PUZA 3T1HQ 2CWAA 4DR3Q 3GTKH 3M9BA 4PG3A 2Q2HA 4LF4L 2IX1A 2CWPA 1L1OC 2WAQE 4A4IA 3RZDH 2UXBL 2Z6KC 1QZGA 3CCEA 5IY0A 1NMFA 1HZAA 5C4JH 3GTQH 3AEVA 1SLJA 1T9HA 2N8NA 4HIKA 2UXCQ 4DK3C 1EYGA 1XJVA 4C3HH 1SFOH 2HT1A 4H02A 1WYDA 4UPAA 4X64Q 4P75A 1SRUA 4A3IH 1FGUA 4JBMA 4AH6A 1VQDA 4LF6Q 3GTMH 2RHQB 4LF5L 1AE3A 1CKOA 4JI8L 1KIXA 5C4XH 1E22A 5LMNL 3HOYG 4GNXA 3KJOA 1JB7A 4LF8Q 1PH2A 1AH9A 3KYHC 1X56A 3WWVA 4HIOA 3I56A 3PF4A 1NBWA 1TXYA 1YNXA 1BBUA 4DK6C 4A3DG 1QUQB 2IHEA 4HJ5A 3E0EA 5GQOA 1G291 1I50H 3CMAA 4B3RL 4B3SQ 4JCVE 4UP9A 1MKHA 1WOCA 1I94Q 5AJ3L 4O0AA 2BA0A 1MJEA 1XPUA 1YITA 1Q1EA 1Q8KA 3RN2A 1IBKL 3M4OH 3H3VH 3S1NH 4K0KQ 1SMXA 4P71A 5JEAG 2JA7H 4QY7A 4BY1H 1QUQA 3G48A 3CCVA 3PIOA 4GNXC 4LUZA 5ELNA 4A3LG 3HOXG 2ZTCA 3FKIG 3L2PA 4A3JH 3ULPA 4OWTB 5IYDG 1KC8C 2JA8H 3KDFB 3H0GG 1VQCA 3E9IA 2KHJA 1FJGQ 1YHAA 3ICEA 1EUJA 1Q12A 2KCMA 1B70B 4JOIA 4DV4Q 4A75A 4OXPA 3VDYA 4OX9L 4YY3Q 3CCRA 2NN6I 5IP9H 1RL2A 5IWAL 3OTOL 4POFA 3F2BA 1U5KA 3HOVH 4A3CG 3CPFA 1VQKA 2K50A 2N78A 4JV5L 3M3YH 4JI4Q 3PO2H 2VS1A 4XIGS 1UE5A 3U4ZA 1VQBA 4DAMA 1KHIA 4JI0Q 2UUAQ 3OYYA 4A3KG 1VQFA 4Y52H 2BA1A 3CAMA 4DR7Q 2K4KA 1IBML 1EQQA 1XPRA 1C0AA 4AQYL 4NXNL 1IXRA 4JG2A 2VQEQ 2A8VA 1M90C 5FJ8G 1YZ6A 4GN3B 4A3FG 2E2HH 2JEBI 4AYBE 2R92H 4DUZQ 4DR2Q 5IYCH 3CCSA 3S1QH 4X66L 2JA6H 3ERSX 4DV3Q 1TWAH 1EIYB 1S3OA 4JOIC 3B6YA 5M3MG 4GLVB 3U4VA 1HH2P 4KHZA 4DUYQ 4IPDA 3G71A 3NENA 1XMQL 4JI5Q 3GTPH 3TRZA 2CFMA 2IHFA 1L2FA 1N33L 2AWNA 2B63H 3TS2A 1JJGA 1PFSA 3S17H 4JYAQ 1VQAA 2K5HA 5JJIA 4JI3Q 3TREA 3K7UC 1HNWQ 2ZM6L 2XGTA 2V1CC 2BH8A 4KHPQ 2JA5G 4NXML 2JJQA 1XNQQ 2UUCL 1JT8A 3JAMc 2VQFL 4IO9A 4X6AH 1HZBA 1J5EQ 2D0PA 2ES2A 2WFWA 4JI6Q 4MNOA 2IX0A 3CC7A 2DGYA 1P16A 2UUBQ 1VQ4A 5IE8A 2PNHA 4QQBX 3E9HA 4IOCA 1J6QA 3EN2A 1Q7YC 1N34L 3JAMi 2AMCB 4EQ5A 4DR4Q 3GD7A 3S15H 3STBC 1B8AA 4DV6L 2EXDA 1N36L 2GVBA 5M5XH 1Y1VG 4BBRG 2XTIA 1I5FA 2NZHA 4DR5Q 4GKKL 4LFBL 3HFZB 3M7NA 5IP7G 3UE1A 3PO3H 5IT9c 2RHSB 4LF7L 4YHHL 4JI1L 4LF9Q 1BKBA 3HOZH 2Z0SA 4YWMA 2YTVA 1QVFA 3BJUA 2IY5B 4APVA 2JA9A 1VQ5A 1SROA 4X65L 2F4VQ 2VNUD 1N32Q 1RIPA 3AFPA 3I4MG 2QGQA 1XNRQ 2HIXA 1Q81C 1I3QH 4BBSH 4UY8C 4AYBG 3MEFA 1PHJA 4GKJL 1CUKA 2R93G 3T1HL 2QA4A 4DR3L 1VQOA 4L5RC 1WJJA
chains in the Genus database with same CATH superfamily
1F2MA 2E5LQ 1ASYA 1JWUD 2N3SA 2QILA 2K32A 3FP9A 3TQYA 1W2BA 2AQ3B 1HZCA 4HSVA 1Y1WG 3RD4A 1YEZA 2R6GA 4S3SA 2MHVA 4LF6L 1SBBB 2CQAA 1Z47A 1PZKD 1EFID 4K2LA 4AIMA 4LF4Q 3J7AV 5C44H 1CKNA 3GTLH 2K5WA 2RQXA 3K7AH 1WTRA 5M3FG 1SE8A 4YCVA 5ELOA 2Q8IB 2OT2A 2Q2UA 4H13C 5IIFA 1CFMA 1WTHA 2O5JC 4B3SL 4WJ3M 4Y7NH 3D4DA 2NVXH 1X3GA 4K0KL 1WCMG 2X6GA 1PFBA 2N55A 5D65A 3RR5A 3VR2A 3F2UA 1YJWA 5C0XJ 4GZYC 3NTIA 1GUTA 3TS0A 3R2IA 1SE2A 4BBSB 3KK7A 4WJ4A 2CKZB 5ELCA 3RLOA 2MNAA 2D62A 3E5SA 1HNXQ 3DXJC 3HOUG 1DOMA 3URYA 1W3SA 4DV5Q 2O4XA 4BY7B 1H9JA 1CQVA 3I7FA 3NSWA 1S40A 2TMPA 4CJ0B 2KOLA 2Z6BA 1RD9D 5EKIA 1A6XA 1JMCA 2KUMA 3EFXD 3HOXH 2KEEA 3I2ZA 1FL0A 1CI3M 4JBWA 2B63G 5EBCA 2OCEA 1OXVA 1QWYA 4R4CA 1EY9A 4JI5L 3BZDB 4NP5A 4A3CH 1KDCA 4OO1I 4TVAB 1K8AC 2L1BA 3K81C 4JYAL 1C9OA 4A3KH 1EZ8A 5IYBG 4QF4A 3MXUA 3D0FA 1J5EL 1ASZA 1PH6A 4LNQA 1C4QA 4GS3A 1E2WA 2UUBL 1A62A 1KLGD 4YWLA 5KNCA 3HOYB 1KD1C 4JI7Q 3GTOB 3FPUB 4PV1C 4DAYB 4DR4L 1PH7A 4K5VA 4FF1A 2NYZD 4J8QA 1IL2A 3PV0A 5C3EB 1EWIA 3L3OC 3F1ZA 4OO1G 2XRQD 3Q24A 4DR5L 4FXDA 1CSPA 4DV0L 1STBA 3MFYA 2JA5H 4QB4A 1X3PA 1PTOD 2ZJRA 4QUCA 4B3MQ 3FEWX 5IGFA 1AFPA 1U4RA 2XNAC 4R4QA 2MO0A 5K5PA 3HKZE 1UE7A 1N32L 1A8VA 3JAML 1L1OA 2MP1A 3WOFA 1HNZQ 1NAPA 4ZLTF 4C56C 4DV7Q 4GKKQ 3U9SA 2Z8LA 5L37A 1JE5A 3SK8A 1K8GA 2E5LL 3E3XA 1UNSA 1LABA 4X62Q 1KNAA 2TSSA 3RMHA 1PH1A 2AKWB 4RG1A 3KLSX 3TZDA 1TKWB 4FF3A 3F8TA 1X6OA 3EVQA 3PIO3 1VQMA 3VR4A 1YJNA 2PQAB 3E6ZX 3FRPB 4R8NA 1CTMA 4P2CB 2DUDA 2ATWA 3TP7A 2RSNA 2A74C 5M3MB 4NDXA 1RTNA 2K75A 1Q86C 4BY1G 1YNJC 2QCPX 5JPMC 3HG9A 1PDQA 4A3JG 3BVMA 3CD6A 1P8LA 4A93G 4X3TA 4QJFA 1DXMA 2KQ3A 4UHVA 4RGTA 3CXCA 1Q46A 2B2UA 3S1MH 3OW7A 3L9AX 3A74A 5FLMH 3V96A 2YU9B 2BCOA 1IYVA 5C3XA 4OGQC 4A3GH 2PCFB 4K8JA 5GAGC 1Y1VB 3PSIA 5J39A 1HNXL 5LHY1 3OW2A 3SK5A 4DV5L 3UDIA 4V190 5GAHC 5GAEC 1LACA 5IYCG 3TEHB 2I5HA 1PYBA 3OWEB 3I4NH 1OXTA 4ABNA 1I4PA 1EIHA 1QNKA 3WOEA 1A2UA 3OTOQ 4NPSA 4JV5Q 5A2QE 3I4MB 1GHKA 4I65A 1N9WA 3GDEA 5M5WH 3HOWH 4KN4C 2PMZE 4AYBB 4DUYL 2FHTA 2R93B 3ZYYX 5D3IB 5K36H 1O7YA 3DEPA 3BYTB 3A5UA 2C5CA 4KHPL 2NVTH 4IUPA 3C1EA 4X66Q 1S5ED 1KLUD 1CHPD 1NSNS 2VUMB 2R7ZB 4L5TA 2LXJA 3I4LA 3S14B 4KKSA 3ND9A 4JI7L 1EU4A 2B2YA 2ZM6Q 4FYDA 3Q0AA 3MXPA 2VL6A 3RUZA 1H95A 3SK4A 2PI2A 5J22A 3HOZG 4PZ6A 4ZKBB 3P20A 4KV6A 2NZ1D 1GUNA 2EXZA 3KJPA 4QMGA 1N34Q 5FLXL 3MZ5A 2DNEA 1STNA 4B9XA 4B3ML 3M85A 1NTGA 1HFGA 4RHRA 1N36Q 4IURA 4YCWA 1O7ZA 2Z6KA 4NW2A 2JXMB 3D8GA 4R8IA 1HNZL 1ET6A 4WJWA 4DV7L 1B50A 1K9MC 1KTKA 1U4PA 1L0YB 4FDBA 1DYQA 4GLAC 2WB1B 2RDGA 3KF6B 3MXGA 1GJXA 2F52A 2OEOA 4X62L 1EY8A 3HRZC 1M1KC 5E4XA 5C44G 1B7YB 3J81c 2Y0SG 2KJXA 5M9OA 3PUZA 2F0KA 1D5MC 3S1QB 3T56B 1B3QA 3RZDH 3CCEA 5IY0A 2B2VC 1SAPA 3OPOA 3S17B 1HQMC 1GUSA 1SRUA 4A3IH 1QNUA 5C0XH 2A73B 2LMCB 4H7BA 2RVLA 1JB7A 4LF8Q 4MIUA 3KYHC 1IL8A 2RSOA 4L63B 3S2HB 2EYLA 1YNXA 2K01A 3K5LA 1QG7A 4DK6C 3GTGB 2PPBC 2QKIC 3R3OA 5GQOA 5JVH3 2SOBA 4DXFA 1WOCA 4A3MB 2QDLA 3MEHA 2NUCA 1MJEA 3J80L 1Q1EA 1Q8KA 1ZXTA 4U673 3H3VH 1VF7A 1I4GA 3CCVA 4LUZA 1XWEA 3HOXG 4OWTB 1O80A 4Z9CB 2K28A 3VYUA 1VQCA 3ICEA 1T5XD 1EUJA 5I4DA 3JAME 3CCRA 3OTOL 4A3CG 4POFA 4JV5L 2BE5C 2K50A 5FO8B 3PO2H 5CV8A 2NB0A 4XIGS 1UE5A 3I91A 3U4ZA 5C4JB 1VQBA 2N88A 2UUAQ 1FNWA 3OYYA 4A3KG 4C3HB 1SFOB 1ML0D 3Q22A 1WTWA 3CAMA 1II3A 5J1ZA 3P75A 4IQZA 1SEBD 1LLRD 2CH4W 2E2HH 2R92H 1GOZA 5DNFA 3VYSA 4X66L 1DM0B 3MHBA 1B9NA 3U4VA 3D4WA 4C1NI 3I72A 2CFMA 1L2FA 2F0PA 2B63H 3TS2A 1PFSA 3NWSA 1SDFA 5JJIA 3K7UC 1I50B 2ZM6L 2V1CC 5T1GA 2JA5G 3LWEA 2JJQA 5CC4A 1XNQQ 4IUUA 4CDCC 1BOSA 1HZBA 4MNOA 2IX0A 4X3KA 2JA7B 5IE8A 1JR0D 4QQBX 5BN5A 1J6QA 1Q7YC 1N34L 1EY4A 3M4YA 1NR2A 5JJZA 1MSGA 3GD7A 5EBDA 1PTOB 4G7OC 1WD1A 2KCCA 1N36L 3EJIA 4BBRG 2XTIA 1I5FA 3HKZB 1TQOA 3X3NA 3UE1A 5IT9c 1DOLA 4LF9Q 1BKBA 2OF1A 2R3ZA 5CBAE 2YTVA 1YNJD 3BJUA 1VQ5A 1SROA 1HA5A 1U9RA 4M8AA 2VNUD 4ZRZA 3R2TA 3AFPA 1SYFA 1XNRQ 4BBSH 1I3QH 5EGTA 3MEFA 1PHJA 2JA6B 4CKBA 4K6LA 1SYBA 3TP8A 3N6RA 4GNXB 1TS4A 3J81i 4O1NA 3A54A 3QIAA 2MFIA 4DAVA 1VQ9A 4BY7H 5C4XG 2FXQA 1HUNA 1LT4D 1UE1A 5KEEA 3PIP3 3TP6A 2AQ2B 1D1KA 4LUVA 2K5VA 1JOQA 2Q2IA 1NNXA 3I73A 4LF8L 2NZOA 1LM0A 3SK6A 5FLMG 1ONLA 1S5BD 4KTAA 2XIWA 3VR6A 3KFUA 4A3GG 5KYLA 3KLRA 5JJLA 2HHHQ 1PA6A 1BNZA 1F9QA 3QO2A 3QOLA 3SE0A 2PQAA 4QL5A 1PH5A 3EBEA 5AFWA 4BA1I 3KLWA 1V1PB 1YHBA 3I4NG 1BR9A 1HXYD 4X3UA 3HOYH 1NMGA 4PQXA 3GTOH 2I5LX 2AUKA 1A3VA 4A93H 3HOVG 1V8QA 3D6WA 2J4XA 1YI2A 3HOWG 2DY7A 4R4TA 1STHA 1QCBD 4ME3A 5JVG3 5K36G 2A5HA 2HIVA 3AQQA 1E3PA 1Q1BA 1TWGB 5DM63 3CMEA 2ZT9C 1DCZA 2ICEC 2A8VA 3G7LA 4DR1Q 4KI0A 2NVQB 1K0RA 1BDOA 4XDXA 3BZKA 4BA2I 2PMZB 1GVPA 3SR1A 1G6PA 2SNMA 3M4QA 3VR3A 1LYLA 4MN3A 4A3LH 3OMGA 4OX9Q 1MBYA 1SNQA 4R4IA 5KRUA 3I8ZA 3W5OA 1CKMA 3A56A 5IYDH 4IZ8A 3H0GH 4ODGA 1XMOQ 2K14A 2H5XA 3V05A 3OOCA 1S5CD 2EPBA 4DK1A 5EAYA 1STYA 2P5ZX 3HKSA 4MHEA 4POGA 1JE4A 2AWOA 4FF2A 2QEXA 3QR8A 1XNQL 3BG3A 3NELA 3TN2A 3UE0A 1QVGA 2CH4A 4HIDA 1EU3A 1Q82C 3IAYA 2EIFA 5FJ8H 4JK1C 4QGUA 2ZTEA 1CHQD 1YBYA 1ZYRD 3CP0A 2F4IA 5E1FA 4HTHA 2HDMA 1LTSD 5C0XI 1E2ZA 4A3DB 1EY7A 3IRBA 2B8FA 2HQLA 3C1FA 4KMUC 4ALPA 3QWNA 3U50C 4TRDA 3J80E 3LX0A 2A1AA 2PZWA 1JQYD 5HGTA 2KCTA 2JSOA 4C3JB 4LF9L 4LFCQ 3NWTA 1CA6A 4GOPC 1EQVA 1MIUA 3K58A 3K5OA 1AZQA 4M1UB 1UEBA 2YU9H 4DA2A 3I55A 1XNRL 3L0OA 2B2VA 2WB1E 3ITPA 3PUYA 4PMWA 4A3IG 1VF5C 1SR3A 3KUPA 4ZQ3A 1Y1VH 5C0XG 2HUGA 3H3VI 4LFAQ 4DV2Q 2C9OA 4EQNA 2WACA 3MA2B 2R7FA 3KLSA 4J15A 3CCJA 3CCQA 1UAPA 1ESRA 1PYWD 1K3RA 3QB3A 5JJKA 2K33A 3NBHA 2UXBQ 1KDBA 1WVLA 3I4MH 1B4OA 1GKHA 1X54A 1Q90A 1XX8A 2JQOA 2R7DA 1EFWA 3KF6A 1C8CA 2R93H 2E8GA 1FVIA 2BE5D 3QJYA 1H9KA 1E1OA 1EWCA 1EL0A 2JN4A 4B9WA 2E2DC 2HHHL 5EKLA 2G9HD 1CZGA 1PRTF 4R4OA 4HCEA 2A19A 4KD3A 2VUMH 2R7ZH 1PYSB 1GD7A 2MO1A 3S14H 3S2DB 1EOVA 4A3BG 3PO2G 3NK9A 3H91A 1V43A 3AMUA 3X3MA 4UAIA 4DV1Q 5HGQA 1K8MA 4JI4L 1HR0W 1DD2A 2KBNA 4JC0A 3DLLA 3ULJA 4O2DA 5FOBB 4DR1L 1NE3A 1B2TA 1K8OA 2R92G 1TWHB 4ID6A 4N9TA 4DK0A 1T5EA 1YNNC 4PMCA 4F7XA 3K5MA 2B29A 2Q8TA 1HCZA 3DWQA 3A8JE 1QZHA 1V1QA 1XMOL 1VQ8A 2A69C 5EPLA 1HZ9A 2N49A 3J7A5 2KA7A 2Z9HA 4HJ7A 4IPCA 3HEJA 3AU7A 3IKJA 4LJZC 2VXWA 1LTLA 1KAWA 4HJAA 1LTID 3PUXA 3RLFA 1VQIA 5JEAJ 1PFNA 1QVCA 5CV9A 4CJ2C 4EGVA 1PXUA 1SMYD 2F0VA 2KHSA 3OIPA 2I0QA 2F3IA 1D8LA 2ALYB 4XQNA 4RGMA 3PF5A 3OSOA 2WP8J 4DN4M 1B3AA 1SYDA 3S2HH 3KOJA 1HA6A 4BBSG 4PZ8A 3W1BA 4TQUS 4LFCL 4A3JB 1YJ9A 2JA8B 3GTGH 3PCOB 3DEOA 1JB3A 4H0LC 3NEMA 4L5QA 3J7ZC 5KIXA 4BY7G 1F2LA 4A3MH 3D31A 1NR4A 1VQJA 4YHHQ 5DEHA 4BBRH 3MTSA 2EOTA 3BDCA 1IZ6A 4L6TB 4DV2L 4ZUIA 4K14A 4HR7B 4LFAL 5I2YA 2V4DA 1KRSA 1GHJA 3U9OA 2JP1A 2OTJA 5CV5A 2OQKA 1HUMA 1RODA 1KRTA 3T1HQ 2F0TA 3GTKH 5DM73 1EWHA 4LF4L 3HP3A 4DU9A 4C3IB 2UXBL 1QZGA 5C4JH 1LTRD 2G5DA 2N8NA 4DK3C 4C3HH 1SFOH 4X64Q 5HURA 1HTPA 4AH6A 1VQDA 3GTMH 2RHQB 4CDFC 1CKOA 3VA7A 1RHPA 5C4XH 1E22A 3HOYG 5M5YB 4GNXA 2EYFA 1ET9A 1PH2A 1TWCB 4KN7C 4HSPA 4HIOA 4G7ZC 3A8IE 3PF4A 1MD2D 4K6DA 1BBUA 2IHEA 1PFMA 4HJ5A 3HS0C 1Q3LA 1XTCD 1I50H 3CMAA 1A3TA 4DNTB 2PW5A 2F0HA 5KYIA 5EPKA 3BS1A 1XPUA 1EYDA 1SMXA 2JA7H 1QUQA 1GUWA 4A3LG 3TMEA 3H94A 3L2PA 5IYDG 3KDFB 3H0GG 1PTOH 4OEMB 3E9IA 1FJGQ 1YHAA 1BO0A 1Q12A 2KCMA 4JOIA 1B70B 4A75A 4YY3Q 2IJ0A 1G6ZA 3HOVH 1U5KA 3Q6SA 3CPFA 3PQIA 1V1PA 3GTQB 4NMZA 4Y52H 1VQFA 4DR7Q 2K4KA 1XPRA 1C0AA 4RFBA 3FVQA 1IXRA 2VQEQ 1FD7D 5FJ8G 1YZ6A 4GN3B 1M90C 1SYGA 5F2DA 4DUZQ 4PMBA 2JA6H 3ERSX 1S3OA 2I07B 5M3MG 5COYA 4KJOA 1QB5D 3G71A 1M8AA 1JJGA 1V1OA 2AWNA 2LY7A 4KKUA 2DNCA 1VQAA 2K5HA 4F87A 1TS2A 1AZPA 1HNWQ 2PYKA 2BH8A 2WINB 2B2TC 2ES2A 2WFWA 4JI6Q 3MFGA 3M4OB 2L12A 3CC7A 3S1NB 3NE5B 4K8IA 2PNHA 3GP7A 1A15A 1JOKA 4IOCA 5FO9B 4RHSA 2AMCB 3CHBD 3JAMi 4K5XA 1UUPA 4KY5A 1X32A 4ZUJA 3STBC 1B8AA 1K3BC 3NBIA 2L0CA 2GVBA 1Y1VG 1IYUA 2NN6H 4RAUC 2NZHA 4GKKL 1IHZA 3HFZB 2RA4A 3A7AB 3C46A 2RHSB 4YHHL 1B1ZA 2EY1A 1SNCA 2F4VQ 3I4MG 2QGQA 2KECA 1Q81C 3BVGA 3HOXB 4UY8C 4AYBG 1STEA 4BS9A 2R93G 3T1HL 1TWAB 1SJHD 3TSSA 1ZYRC 2A6HD 3GTJH 1TWGH 1TY2A 3GTPB 1YVCA 2F3VA 1BXTA 1CKNB 2HCCA 3T16A 4IUNA 2NVQH 1LUZA 4IFDG 5EJWA 2WAQB 4R1JA 4XXEA 1RDPD 2D2CC 2YYZA 4X64L 3PUVA 4IJHA 2ICIA 4ZKCB 2O2LD 1J8IA 2VUMG 2R7ZG 4A3EH 3S24A 1YNND 1IBLQ 1X3FA 3IFTA 4XYOA 3TP5A 1VQNA 3CC4A 1XYIA 4HAEA 1NJIC 3J81L 3CCLA 2X69A 2A69D 5FKAC 1I4HA 2HCIA 4RKLA 1BBWA 2FINB 4GN4B 2WKCA 3PO3B 1EZ6A 4HJ9A 3C3LA 4RA8A 3AFQA 1HRJA 4IFDJ 1EEID 1QOHA 4B3RQ 2IPKD 1TS5A 1G2TA 4FO2A 2IX3A 2F0QA 4A3DH 4YY3L 4A3BH 2WB1G 1PV4A 1K83B 3BZCA 4OWXB 1X65A 1PVOA 2OQ0A 3ONAB 1MSHA 4WORA 1KQSA 3PGZA 3MWYW 4C3JH 1ILPA 2WKDA 3S1RB 3PUWA 4DR7L 1PTOF 2KEDA 1AN8A 3EQLC 3SVMA 5JEAH 4O42A 4ME5A 1F2YA 4XT1B 2LXKA 1V9PA 2ID0A 4DUZL 2K5NA 4P74A 1SNOA 4CKEA 1HFNA 3HGBA 3L7ZC 5BR8Q 2A6ED 2EJGC 4V0BA 2XSCA 4DR6Q 3MXNB 1PRTD 2EYJA 1YIJA 1HNWL 3I90A 1R4QB 3KBGA 2A68D 2FMCA 5JAVA 3U58A 3G4SA 2PO4A 1DZ1A 2EQSA 2LSSA 1DGSA 1Q8IA 3R8BA 1CM9A 5I9OA 2JK8A 4YCUA 4IPHA 1K0SA 4A3MG 1PH9A 5CMDA 1HQRD 4RMFA 3K6OA 4OONA 3NQTA 3NQIA 1A0IA 3T1YQ 2L11A 3PMFA 2ZXOA 3RZOB 1S5DD 4B08A 4CDDC 2YTYA 2R61A 4DAYA 2IWHA 2PQEA 1TU2B 3K57A 3S2DH 2IW3A 1EY6A 1L0XB 2WIIB 3SXHA 1VDZA 1TS3A 2EYOA 3FKIB 3F2DA 1NUCA 4CHTB 1VQHA 2F3WA 4J1MA 4C3HG 5M5WB 1HR0Q 4LF7Q 1SMYC 1G2SA 3W3AA 1D2BA 5D14A 3GQBA 4LW1A 2FFKB 1AE2A 1TWFB 4KK7A 2VZAA 4OWWB 5CV6A 1TWHH 1BQQT 1HTLD 2QEJC 3GV6A 3N52A 4LK1C 4E6IA 4JPBW 5IT9L 1JJ2A 3ER0A 2RDHA 1IBLL 2KHIA 3J7AF 4A3FB 1QJOA 4G7HC 4IUVA 2L15A 3RN5A 1PH3A 3M7GA 2F1MA 3TZUA 3SGIA 4K2KA 3GO5A 3OMCA 3J80i 2JA7G 4JI8Q 1UWVA 2GN5A 4N8X1 2MQHA 4EX5A 2K1BA 2CVRA 1LTBD 4MZ9A 3NXWA 4WRDA 2CW0D 5FLXE 4RKBA 2QDBA 4IUTA 2AHOB 1A2TA 3HKZG 2E76C 1BCPF 3BDOA 3UDFA 5C3EH 3R93A 3H15A 1MJCA 2XWBB 2F0JA 5G3LF 3DM1A 1JICA 2KVMA 2UUAL 4XQJA 5CYUA 2JE6I 3ERQA 2JA6G 4JVZA 3JC66 1WTPA 2OTLA 2DY8A 5IWAQ 3KF8B 3J81j 4XT3B 3T13A 1EOTA 3STBD 2L9HA 3EIVA 4GOPB 1GO3E 5BR8L 4GN5A 1CSQA 1JORA 1IBMQ 1EIFA 2M2LA 3KDFA 1X55A 2PNRC 4DR6L 1Z7TA 3CPWA 4NXNQ 1VQEA 5EPJA 2Y0SE 3RLNA 2RF4A 1S72A 2EYPA 2YV5A 5GADC 1Y1WB 5LMNW 2VY3A 4TSSA 4C3IH 3MC0B 1I6HB 1OO9B 2BOSA 4C2MB 2AUJD 1ENAA 2NN6G 5KNDA 3KBXA 4KLKA 1K28A 5M3MH 2E2IB 3A5ZB 1NY4A 3DWPA 3CCUA 5M3FB 1VQGA 1E7ZA 4DGZA 2VQFQ 1WTQA 2D0OA 2QF7A 2H1EA 3T1YL 1IYJB 2MGSA 5M5YH 2CCZA 2BDOA 1IW7D 1TWCH 5EKKA 1UEAB 2DJFC 5ELDA 4FXGC 1FGBD 3OHXC 2F0GA 5FK9C 1EY5A 3A7LA 1WCMB 4PNYA 2X6LA 1PZJD 4PZ7A 1LT3D 1I4XA 4ZYSA 3VR5A 1E1TA 2B2YC 3CRLC 4LFBQ 2WV6D 1G51A 2O5IC 4DV0Q 4OHJA 1F77A 3CU7A 4FNFA 1HR0L 4LMQD 1SNMA 5CV7A 1FNVA 2YTXA 4A3EG 3HOUB 2FMMA 2LKVA 1JCKB 4OELB 3K8AA 1D7QA 4QIWB 4N9PA 3SDZA 1SN8A 3CQZB 3ULLA 3BYYB 4DR3Q 1EIGA 5E3FA 5A2QL 4PG3A 2Q2HA 3ND8A 2IX1A 2CWPA 4A4IA 2WAQE 2Z4HA 2Z6KC 1NMFA 1HZAA 3GTQH 3AEVA 1SLJA 1T9HA 3H3VC 3S16B 4HIKA 2UXCQ 2DN8A 1C48A 2B63B 1Z6HA 4ULLA 2MPMA 1R9TB 3C2PA 2NVYB 4IFDH 3OWFA 4JI8L 1KIXA 2F0NA 1B9MA 2ZXRA 3P7JA 1EY0A 4Q0FA 4EQPA 5I6WA 3W2DA 1AH9A 3WWVA 1U4MA 2E2JB 3VA5A 1NBWA 1TXYA 1SYCA 4A3DG 4WFN3 4IUQA 2A6HC 3E0EA 3K0YA 1MKHA 2K04A 4DAPA 5I9PA 1I94Q 3FDTA 1E0BA 2BA0A 4C3JG 2H4OA 1D5ZC 3M4OH 3S1NH 1ICFB 2EYHA 5JEAG 5C5LA 5I2XA 4QY7A 1D5XC 5ELNA 1B44D 2EYMA 3ULPA 1IKLA 2MUYA 2SDFA 2KHJA 1EYCA 5C4ZA 1I3QB 1ESFA 4DV4Q 4OX9L 4OL7A 5IP9H 2Z4IA 1RL2A 5IWAL 4KY6A 1VQKA 3K59A 2VS1A 1KHIA 1FNUA 4JI0Q 4IN3A 5ISRA 2BA1A 2SEBD 5IODA 1IBML 4CDEC 4NXNL 1PLFA 1H9SB 2DJGC 4DR2Q 4YIJA 3CCSA 3S1QH 1PRTB 5IT9E 4DV3Q 1TWAH 3IFDA 4LAAA 1F9RA 2EY5A 1HH2P 4DUYQ 3GTPH 4IPDA 2F0SA 3TRZA 1GXDC 1FR3A 2EY2A 3P1HA 3S17H 4HMIA 4JI3Q 2XRSD 1AEXA 2XGTA 4KHPQ 1W6KA 1EEFD 2LS01 1JT8A 3VYRA 3JAMc 2VQFL 4IO9A 4X6AH 5C4HA 2D0PA 1HHVA 2PZUA 4QUFA 2F0UA 1VQ4A 1RF2D 4BY1B 3EN2A 1M4VA 3MXNA 4A93B 3BVZA 4DXGA 1EQTA 2A6EC 5A35A 1LTAD 5DAUA 4LFBL 3M3YB 1STGA 3PO3H 5IGEA 1PRTC 2B2WC 5JOBA 4CBVA 3DMUA 1AW7A 2A68C 2EY6A 2F0MA 3D4RA 1QVFA 2IY5B 1QE6A 2EJFC 2JA9A 4APVA 3A8KE 3T51B 3TDQA 3E0JA 3A55A 1U4LA 1J9OA 3SHLA 4DR3L 1VQOA 4L5RC 3H0GB 1L0WA 3TBIB 4KKTA 1K83H 1Y8PB 1WI5A 2RKSA 4IPGA 2K6AA 3UDGA 3QG1A 4KHVA 1N8RC 1X9NA 1G8ZD 2HQEA 2UXCL 3UI2A 4UP7A 3DM3A 3S1RH 4RWSC 1VQ6A 3ZJYC 2ZJPA 3NTKA 4YWKA 2B3GA 3OIQA 4FXKC 2I5MX 3K80C 5IGDA 5C3EG 1FYCA 3S15B 2AQ1B 3CRKC 5BN3A 1BVSA 2CHBD 2CQOA 5M5XB 1HPCA 5ELBA 1ENFA 1KL9A 1I94L 4DV1L 1PMRA 2JA8G 3HOZB 2QW7A 4N8FA 4DNIA 1SSOA 2G9DA 3UDXA 3EA6A 4HCSA 1OXSC 2RBMA 4KD4A 2B39A 3A0JA 1PZID 4DV4L 1GUOA 1HJPA 4KJNA 3AYHB 3CCMA 3RZOH 4RCNA 3DUZA 3CF5A 5IGCA 3PIPA 2K52A 4JI0L 1QILA 1VMCA 2Q2TA 1CK1A 1GUGA 1Y8OB 2KCNA 3DHQA 5C5MA 4P72A 2KENA 4UP8A 4NB3A 4XQQA 3H09A 2C35B 4C3IG 2CW0C 5JPNC 3FKIH 1H9RA 3BDLA 1MGSA 1JOOA 2F0IA 2EJMA 5CBEE 4DR2L 4JI2Q 5C44B 1GM5A 2Y0SB 3GTLB 4DV3L 1EQRA 2K7VA 3K7AB 1I4QA 5FO7B 1PH4A 5FLXc 1TWFH 2Z1CA 1OXXK 4A76A 2PI2E 1K73C 4JI3L 5IGBA 5LMUQ 4G4KA 3KF8A 4C1NK 1VS0A 5E4WC 4Y7NB 1MHWC 2NVXB 1KABA 1XTDA 1JJCB 2I46A 4GOPA 4XTCS 4A3FH 3EROA 5E7NA 3M4PA 2EE1A 2F0WA 2NTSA 1BCPD 1E24A 1VQ7A 1BBXC 5J3BA 5G3LD 4QCLA 2LFNA 4IFDI 1TR5A 4UDUC 3VYTA 4LUOA 3GV3A 1WTOA 2UU9Q 1VCIA 1H9MA 4HN7A 3BU2A 2L5TA 4B3TQ 1DONA 1Y14B 2GVAA 1RTOA 2MJ8A 1VQLA 4JBKA 3FHWA 2BH2A 2JEAI 4IJLA 4RGNA 2F0EA 4I7ZC 3MAQA 3D6CA 4X3SA 4LWCA 3NBHB 2ZJQA 4QIWE 1KDAA 4J6HA 5IOCA 2RCFA 1D1IA 3T4AC 2UXDQ 5IP7H 3W1GA 2D5DA 4CGYB 4ZCKA 1IW7C 5IGGA 4A3KB 4FP5D 3RNUA 3K5NA 1KAAA 4IALA 4DNRB 4CKCA 3Q23A 3J80c 3IL8A 1CA5A 4JBJA 1E2VA 2J7ZA 4BXXH 1O78A 4HMJA 2PW7A 1ZKOA 1LO5D 1BUVT 4LF5Q 2F03A 3MVVA 5LMNQ 5GROA 1Y1WH 3LGJA 4FVMA 1UE6A 1LV9A 1BF4A 2JA5B 4HJ8A 2ZXPA 4ZK9B 1TT2A 1I6HH 4C2MH 1WFQA 1B53A 5I6YA 1O7IA 5IP9G 5C6AA 2EZVA 4NKLA 2E2IH 1YHQA 4G57A 2NTTA 3K0XA 1Z9FA 4F88A 1FJGL 1OTCA 3CKIB 5D3DA 4DFAA 5AJ3Q 5M3FH 1TVXA 1TY0A 1IBKQ 1OXUA 1SYEA 2HDLA 1D6EC 4BBRB 1X3EA 4GLXA 2ASBA 1SE4A 3G6JB 1WCMH 2B8GA 3G6EA 2NBFA 2VQEL 1F9PA 4K5WA 4P73A 2K5QA 3J7YW 4RGOS 3NP8A 5LL6S 3GTKB 3I70A 2Q8RE 1Y69U 1S5FD 1JWMD 4JI2L 3H6MA 2WAQG 4L5SA 2OWOA 2K05A 4XYQA 4AQYQ 1I4RA 3CC2A 4CJ1B 1JC7A 3HOUH 3F2CA 3GTMB 5LMUL 3LWUA 3V2TA 2RCNA 3CQZH 3I4OA 5C4XB 4BWGB 4JI6L 1XXGA 1XMQQ 1U0LA 2F0OA 4DPGA 3S1MB 1N33Q 3S16H 3I3CA 3NTHA 4DKAC 1XPOA 1CQFA 4EQOA 4ZAIA 1SXTA 3Q8DA 1H9SA 1C7YA 3PO3G 4NXMQ 1R9TH 2UUCQ 2JYOA 2NVYH 2B2WA 5H1SE 4A3GB 4I7AA 1L1OB 2IT1A 4MTNA 1O7LA 3T53B 2UU9L 5IYBH 1STAA 2XN9C 4B3TL 2E2JH 1TIID 2E74C 2FJ2A 4DV6Q 2F4VL 2E75C 5HY6A 3I4NB 5T1IA 2VW9A 1F9SA 1PH8A 1VMPA 3SEBA 1LT5D 4FF4A 3AB9A 3HOVB 1KXLA 1VQPA 3HOWB 4R9WA 1WTVA 2M00A 3CW2C 1SNDA 1KNEA 4JI1Q 1A63A 4OO1H 4RCOA 4HIMA 2F0FA 5CV4A 1LTTD 3QOJA 2BDNA 4X65Q 1ICWA 2UXDL 4OIJA 2ZTDA 2D9UA 2GA4B 2NVTB 5DLQE 4GKJQ 4TKOB 2CWAA 3M9BA 1W6JA 5CORA 4EVOA 1L1OC 2OXPA 2M9VA 4DF7A 3FMCA 1EYGA 1XJVA 2HT1A 4H02A 1WYDA 4UPAA 2EDGA 4P75A 2F0DA 1FGUA 4JBMA 4LF6Q 3HZXA 1PTOC 1RKNA 4LF5L 2F0LA 2EVBA 1AE3A 3WDNA 2NWGA 5LMNL 3KJOA 1X56A 3O13A 3I56A 5LL6X 1RJTA 4RH6A 1A3UA 2L4NA 1QUQB 2VB2X 4F8MA 2K5DA 3NHHA 5NUCA 2XWJB 1G291 4B3RL 4B3SQ 4JCVE 4UP9A 5C3WA 5AJ3L 4O0AA 1DOKA 5EQ0A 1YITA 3RN2A 1IBKL 4K0KQ 4P71A 4BY1H 1LT6D 3G48A 3PIOA 4GNXC 1ENCA 2ZTCA 3FKIG 4A3JH 2JA8H 1KC8C 2ENBA 4OIKA 5KNBA 2B2UC 1Y8NB 3VDYA 4OXPA 2IL8A 4U68A 2NN6I 3F2BA 2N78A 2XVSA 3RZDB 1WTXA 3GTJB 4JI4Q 3M3YH 2RDFA 4DAMA 3NUCA 5CGKA 1SE3A 2PZTA 4L8JA 1ILQA 4A3IB 3D3RA 1EQQA 4AQYL 2B2TA 5ELFA 4JG2A 4HEDA 4A3FG 2JEBI 4AYBE 4A3EB 5IYCH 1EIYB 4JOIC 3B6YA 1S4ZA 4GLVB 1NCVA 2VB3X 1CT1D 4KHZA 1XMQL 3NENA 4JI5Q 2IHFA 1N33L 4JYAQ 1SNPA 3TREA 3J81E 1IKMA 3LNNA 1LTGD 1G91A 1BCPB 5ELEA 4NXML 2K03A 2UUCL 1CZWA 2HD3A 1J5EQ 3NPPA 2DGYA 1P16A 2UUBQ 5KGUA 3E9HA 5CR3A 1F2ZA 4H44C 4EQ5A 4DR4Q 1EYAA 3S15H 4DV6L 2EXDA 2J0TD 1DJRD 4ILWA 1SJED 1RCVD 4Q5VA 1WD0A 5M5XH 3DWAA 4DR5Q 2L55A 1JWSD 1MI2A 4A3BB 3PO2B 3M7NA 5IP7G 1AP0A 4LF7L 5BN4A 4JI1L 3HOZH 1R4PB 2Z0SA 1ZEQX 4YWMA 1X3QA 5TSSA 4X65L 1N32Q 2SNSA 1RIPA 4JW0A 1I6VC 2E2HB 2R92B 2HIXA 4MTKA 4KY7A 3FPPA 4GKJL 1CUKA 1BCPC 3S9WA 4BXXG 2QA4A 4IOAA 1WJJA
chains in the Genus database with same CATH topology
2E5LQ 1ASYA 1L0WA 3GTJH 4GNXB 2N3SA 1K83H 1TWGH 1YVCA 1WI5A 3FP9A 4IPGA 3TQYA 3J81i 3UDGA 1N8RC 1CKNB 2MFIA 1X9NA 1VQ9A 1W2BA 1LUZA 2NVQH 4BY7H 4IFDG 2UXCL 4R1JA 4UP7A 3DM3A 1HZCA 2YYZA 4X64L 3S1RH 3PUVA 4IJHA 1Y1WG 5C4XG 2FXQA 1YEZA 2R6GA 1VQ6A 3ZJYC 1UE1A 2ZJPA 4LF6L 2VUMG 2R7ZG 1Z47A 4A3EH 3S24A 4LUVA 2K5VA 4YWKA 4AIMA 2B3GA 2Q2IA 4LF4Q 1IBLQ 4LF8L 2NZOA 5C44H 1LM0A 1CKNA 1X3FA 5FLMG 3GTLH 2I5MX 3K80C 3K7AH 1VQNA 5C3EG 3CC4A 5M3FG 1SE8A 3KFUA 4A3GG 1BVSA 1NJIC 4YCVA 3CCLA 5ELOA 2Q2UA 2CQOA 5JJLA 2HHHQ 1PA6A 4B3SL 1BBWA 4GN4B 4WJ3M 1KL9A 4Y7NH 2PQAA 1I94L 4DV1L 2NVXH 1X3GA 4QL5A 1PH5A 3EBEA 4HJ9A 2JA8G 4K0KL 1WCMG 4BA1I 3KLWA 4DNIA 1YHBA 3RR5A 3I4NG 1YJWA 5C0XJ 3UDXA 3AFQA 3HOYH 4IFDJ 1NMGA 3GTOH 1OXSC 2I5LX 3TS0A 4A93H 3HOVG 4IOAA 3HOWG 1YI2A 3A0JA 4B3RQ 4R4TA 4ME3A 4DV4L 1PV4A 4A3DH 4WJ4A 4YY3L 2CKZB 3RLOA 2MNAA 4A3BH 2D62A 1HJPA 2HIVA 1E3PA 1Q1BA 2WB1G 3AQQA 3AYHB 3BZCA 4OWXB 3CMEA 1X65A 3CCMA 1HNXQ 3HOUG 3RZOH 1PVOA 2OQ0A 1W3SA 4DR1Q 4DV5Q 3CF5A 1KQSA 3PGZA 2K52A 1K0RA 4KI0A 3I7FA 3PIPA 1S40A 3BZKA 4C3JH 2Q2TA 4BA2I 1GVPA 4P72A 1G6PA 3M4QA 3PUWA 4DR7L 2KENA 4UP8A 4NB3A 1LYLA 2C35B 1JMCA 4A3LH 4OX9Q 2LXKA 3HOXH 4R4IA 1V9PA 3I2ZA 1FL0A 3FKIH 1CKMA 2ID0A 3W5OA 4DUZL 5IYDH 4DR2L 2K5NA 4JBWA 4P74A 3H0GH 4JI2Q 1GM5A 1XMOQ 2B63G 2OCEA 2K14A 1OXVA 4DV3L 1EQRA 4R4CA 3L7ZC 2H5XA 5BR8Q 4JI5L 4A3CH 1PH4A 5FLXc 4OO1I 4TVAB 1TWFH 5EAYA 1K8AC 4DR6Q 3K81C 1OXXK 4JYAL 4A76A 3HKSA 2PI2E 1K73C 4JI3L 1C9OA 3MXNB 5LMUQ 1YIJA 1HNWL 4POGA 4A3KH 5IYBG 2AWOA 2QEXA 3U58A 3G4SA 1VS0A 1XNQL 3NELA 3D0FA 3UE0A 1QVGA 1XTDA 1JJCB 1J5EL 2EQSA 1PH6A 1ASZA 2LSSA 4HIDA 4LNQA 4GOPA 1DGSA 4GS3A 1Q82C 2UUBL 4BXXG 1A62A 2EIFA 4XTCS 4YWLA 5E7NA 5FJ8H 4A3FH 2JK8A 4YCUA 2ZTEA 3M4PA 4QGUA 1KD1C 4JI7Q 4IPHA 4DAYB 4DR4L 1E24A 1YBYA 1PH7A 1VQ7A 4A3MG 3CP0A 1PH9A 4RMFA 1IL2A 5J3BA 3PV0A 5C0XI 1EWIA 3F1ZA 3IRBA 4OONA 4IFDI 4OO1G 2HQLA 1A0IA 4LUOA 4DR5L 3T1YQ 1CSPA 4DV0L 4ALPA 2UU9Q 3U50C 1VCIA 3BU2A 2JA5H 2A1AA 2YTYA 4B3TQ 2ZJRA 1Y14B 2KCTA 4LF9L 2GVAA 4B3MQ 4LFCQ 1VQLA 4GOPC 4JBKA 3FHWA 3S2DH 4R4QA 2MO0A 1MIUA 2BH2A 3HKZE 2JEAI 1UE7A 4IJLA 1N32L 1A8VA 1UEBA 2YU9H 3I55A 1XNRL 1L1OA 3F2DA 1HNZQ 3L0OA 4DV7Q 4GKKQ 1VQHA 2WB1E 1JE5A 3PUYA 1K8GA 4PMWA 1HR0Q 2E5LL 4LF7Q 4A3IG 1SR3A 4LWCA 1Y1VH 3NBHB 5C0XG 2ZJQA 3H3VI 4LW1A 4QIWE 4LFAQ 4DV2Q 1AE2A 4X62Q 2VZAA 4OWWB 5IP7H 2UXDQ 3W1GA 1PH1A 1TWHH 2AKWB 4RG1A 3RNUA 3F8TA 1X6OA 2R7FA 4J15A 3CCJA 3CCQA 1VQMA 1YJNA 1K3RA 5JJKA 1JJ2A 3ER0A 2UXBQ 2PQAB 3I4MH 1IBLL 2KHIA 1EFWA 1GKHA 1X54A 2R7DA 2JQOA 3J80c 4JBJA 3KF6A 2L15A 2DUDA 2R93H 3RN5A 1PH3A 2ATWA 2E8GA 4BXXH 1FVIA 1E1OA 3SGIA 3GO5A 4LF5Q 3J80i 2K75A 2JA7G 2HHHL 4JI8Q 1UWVA 1Q86C 4BY1G 2GN5A 5LMNQ 4EX5A 2MQHA 4R4OA 5GROA 2A19A 1Y1WH 3LGJA 1UE6A 4A3JG 4HJ8A 3CD6A 4MZ9A 1P8LA 4A93G 2VUMH 2R7ZH 4QJFA 3CXCA 1PYSB 1I6HH 1Q46A 1WFQA 4C2MH 1GD7A 3S1MH 2MO1A 3S14H 1O7IA 5IP9G 1EOVA 2AHOB 3A74A 5FLMH 3HKZG 1YHQA 2E2IH 4A3BG 3PO2G 3K0XA 3UDFA 1Z9FA 1FJGL 1V43A 1OTCA 5C3EH 5AJ3Q 5M3FH 3H15A 4A3GH 1MJCA 4DV1Q 1IBKQ 1OXUA 5HGQA 4JI4L 1HR0W 5GAGC 2KBNA 3PSIA 1HNXL 1X3EA 4GLXA 4JC0A 3DLLA 3ULJA 3OW2A 4O2DA 2UUAL 4DR1L 2ASBA 1NE3A 4DV5L 2JE6I 3UDIA 5GAHC 2R92G 5GAEC 5IYCG 3TEHB 2I5HA 2JA6G 1PYBA 1WCMH 3G6EA 3I4NH 1OXTA 3JC66 2VQEL 2OTLA 4P73A 2B29A 5IWAQ 3KF8B 4NPSA 3OTOQ 3J81j 4JV5Q 1QZHA 1V1QA 3STBD 1N9WA 3GDEA 3EIVA 5M5WH 4JI2L 2PMZE 2WAQG 1XMOL 1VQ8A 4L5SA 3HOWH 4DUYL 4GOPB 1GO3E 5BR8L 4GN5A 1CSQA 2OWOA 1HZ9A 1IBMQ 1EIFA 3KDFA 4AQYQ 3CC2A 1X55A 4DR6L 3HOUH 3CPWA 4NXNQ 2N49A 3A5UA 3F2CA 1VQEA 3J7A5 5LMUL 4KHPL 2Y0SE 3RLNA 2RF4A 2NVTH 4HJ7A 2RCNA 3CQZH 4IPCA 3I4OA 2YV5A 5GADC 1S72A 5LMNW 4X66Q 4JI6L 1LTLA 2VY3A 1KAWA 4HJAA 1XMQQ 1U0LA 4C3IH 4DPGA 4L5TA 3PUXA 2LXJA 3RLFA 1VQIA 5JEAJ 1N33Q 1QVCA 3S16H 4JI7L 2NN6G 4DKAC 1XPOA 4KLKA 5M3MH 2ZM6Q 3Q8DA 3A5ZB 1NY4A 3CCUA 1C7YA 2VL6A 3PO3G 4NXMQ 1R9TH 1H95A 2I0QA 2UUCQ 2F3IA 2NVYH 2PI2A 1VQGA 1E7ZA 4PZ6A 2VQFQ 5H1SE 3HOZG 2D0OA 1L1OB 2IT1A 1D8LA 4MTNA 5K36G 2ALYB 3T1YL 1IYJB 3PF5A 5M5YH 2WP8J 2CCZA 2UU9L 5IYBH 3KJPA 1TWCH 4JI0L 1N34Q 2E2JH 4B3TL 3S2HH 3KOJA 4BBSG 4PZ8A 3W1BA 4TQUS 3M85A 4B3ML 4LFCL 1YJ9A 3GTGH 3PCOB 1NTGA 4DV6Q 2F4VL 5HY6A 3NEMA 4PZ7A 2VW9A 1N36Q 1PH8A 4L5QA 4YCWA 3J7ZC 2Z6KA 1E1TA 4LFBQ 1G51A 1HNZL 4BY7G 4DV0Q 1KXLA 4DV7L 1VQPA 4A3MH 3D31A 1VQJA 1K9MC 4YHHQ 3CW2C 1HR0L 4JI1Q 4BBRH 4FDBA 1A63A 4GLAC 4HIMA 1IZ6A 4DV2L 2YTXA 3KF6B 4LFAL 2F52A 1KRSA 4X62L 4X65Q 4A3EG 1M1KC 2UXDL 2ZTDA 3K8AA 2OTJA 1D7QA 5C44G 1B7YB 2OQKA 3J81c 2Y0SG 1SN8A 5DLQE 1KRTA 3ULLA 4GKJQ 3PUZA 3T1HQ 2CWAA 4DR3Q 3GTKH 3M9BA 4PG3A 2Q2HA 4LF4L 2IX1A 2CWPA 1L1OC 2WAQE 4A4IA 3RZDH 2UXBL 2Z6KC 1QZGA 3CCEA 5IY0A 1NMFA 1HZAA 5C4JH 3GTQH 3AEVA 1SLJA 1T9HA 2N8NA 4HIKA 2UXCQ 4DK3C 1EYGA 1XJVA 4C3HH 1SFOH 2HT1A 4H02A 1WYDA 4UPAA 4X64Q 4P75A 1SRUA 4A3IH 1FGUA 4JBMA 4AH6A 1VQDA 4LF6Q 3GTMH 2RHQB 4LF5L 1AE3A 1CKOA 4JI8L 1KIXA 5C4XH 1E22A 5LMNL 3HOYG 4GNXA 3KJOA 1JB7A 4LF8Q 1PH2A 1AH9A 3KYHC 1X56A 3WWVA 4HIOA 3I56A 3PF4A 1NBWA 1TXYA 1YNXA 1BBUA 4DK6C 4A3DG 1QUQB 2IHEA 4HJ5A 3E0EA 5GQOA 1G291 1I50H 3CMAA 4B3RL 4B3SQ 4JCVE 4UP9A 1MKHA 1WOCA 1I94Q 5AJ3L 4O0AA 2BA0A 1MJEA 1XPUA 1YITA 1Q1EA 1Q8KA 3RN2A 1IBKL 3M4OH 3H3VH 3S1NH 4K0KQ 1SMXA 4P71A 5JEAG 2JA7H 4QY7A 4BY1H 1QUQA 3G48A 3CCVA 3PIOA 4GNXC 4LUZA 5ELNA 4A3LG 3HOXG 2ZTCA 3FKIG 3L2PA 4A3JH 3ULPA 4OWTB 5IYDG 1KC8C 2JA8H 3KDFB 3H0GG 1VQCA 3E9IA 2KHJA 1FJGQ 1YHAA 3ICEA 1EUJA 1Q12A 2KCMA 1B70B 4JOIA 4DV4Q 4A75A 4OXPA 3VDYA 4OX9L 4YY3Q 3CCRA 2NN6I 5IP9H 1RL2A 5IWAL 3OTOL 4POFA 3F2BA 1U5KA 3HOVH 4A3CG 3CPFA 1VQKA 2K50A 2N78A 4JV5L 3M3YH 4JI4Q 3PO2H 2VS1A 4XIGS 1UE5A 3U4ZA 1VQBA 4DAMA 1KHIA 4JI0Q 2UUAQ 3OYYA 4A3KG 1VQFA 4Y52H 2BA1A 3CAMA 4DR7Q 2K4KA 1IBML 1EQQA 1XPRA 1C0AA 4AQYL 4NXNL 1IXRA 4JG2A 2VQEQ 2A8VA 1M90C 5FJ8G 1YZ6A 4GN3B 4A3FG 2E2HH 2JEBI 4AYBE 2R92H 4DUZQ 4DR2Q 5IYCH 3CCSA 3S1QH 4X66L 2JA6H 3ERSX 4DV3Q 1TWAH 1EIYB 1S3OA 4JOIC 3B6YA 5M3MG 4GLVB 3U4VA 1HH2P 4KHZA 4DUYQ 4IPDA 3G71A 3NENA 1XMQL 4JI5Q 3GTPH 3TRZA 2CFMA 2IHFA 1L2FA 1N33L 2AWNA 2B63H 3TS2A 1JJGA 1PFSA 3S17H 4JYAQ 1VQAA 2K5HA 5JJIA 4JI3Q 3TREA 3K7UC 1HNWQ 2ZM6L 2XGTA 2V1CC 2BH8A 4KHPQ 2JA5G 4NXML 2JJQA 1XNQQ 2UUCL 1JT8A 3JAMc 2VQFL 4IO9A 4X6AH 1HZBA 1J5EQ 2D0PA 2ES2A 2WFWA 4JI6Q 4MNOA 2IX0A 3CC7A 2DGYA 1P16A 2UUBQ 1VQ4A 5IE8A 2PNHA 4QQBX 3E9HA 4IOCA 1J6QA 3EN2A 1Q7YC 1N34L 3JAMi 2AMCB 4EQ5A 4DR4Q 3GD7A 3S15H 3STBC 1B8AA 4DV6L 2EXDA 1N36L 2GVBA 5M5XH 1Y1VG 4BBRG 2XTIA 1I5FA 2NZHA 4DR5Q 4GKKL 4LFBL 3HFZB 3M7NA 5IP7G 3UE1A 3PO3H 5IT9c 2RHSB 4LF7L 4YHHL 4JI1L 4LF9Q 1BKBA 3HOZH 2Z0SA 4YWMA 2YTVA 1QVFA 3BJUA 2IY5B 4APVA 2JA9A 1VQ5A 1SROA 4X65L 2F4VQ 2VNUD 1N32Q 1RIPA 3AFPA 3I4MG 2QGQA 1XNRQ 2HIXA 1Q81C 1I3QH 4BBSH 4UY8C 4AYBG 3MEFA 1PHJA 4GKJL 1CUKA 2R93G 3T1HL 2QA4A 4DR3L 1VQOA 4L5RC 1WJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L Q;  1ASY A;  1L0W A;  3GTJ H;  4GNX B;  2N3S A;  1K83 H;  1TWG H;  1YVC A;  1WI5 A;  3FP9 A;  4IPG A;  3TQY A;  3J81 i;  3UDG A;  1N8R C;  1CKN B;  2MFI A;  1X9N A;  1VQ9 A;  1W2B A;  1LUZ A;  2NVQ H;  4BY7 H;  4IFD G;  2UXC L;  4R1J A;  4UP7 A;  3DM3 A;  1HZC A;  2YYZ A;  4X64 L;  3S1R H;  3PUV A;  4IJH A;  1Y1W G;  5C4X G;  2FXQ A;  1YEZ A;  2R6G A;  1VQ6 A;  3ZJY C;  1UE1 A;  2ZJP A;  4LF6 L;  2VUM G;  2R7Z G;  1Z47 A;  4A3E H;  3S24 A;  4LUV A;  2K5V A;  4YWK A;  4AIM A;  2B3G A;  2Q2I A;  4LF4 Q;  1IBL Q;  4LF8 L;  2NZO A;  5C44 H;  1LM0 A;  1CKN A;  1X3F A;  5FLM G;  3GTL H;  2I5M X;  3K80 C;  3K7A H;  1VQN A;  5C3E G;  3CC4 A;  5M3F G;  1SE8 A;  3KFU A;  4A3G G;  1BVS A;  1NJI C;  4YCV A;  3CCL A;  5ELO A;  2Q2U A;  2CQO A;  5JJL A;  2HHH Q;  1PA6 A;  4B3S L;  1BBW A;  4GN4 B;  4WJ3 M;  1KL9 A;  4Y7N H;  2PQA A;  1I94 L;  4DV1 L;  2NVX H;  1X3G A;  4QL5 A;  1PH5 A;  3EBE A;  4HJ9 A;  2JA8 G;  4K0K L;  1WCM G;  4BA1 I;  3KLW A;  4DNI A;  1YHB A;  3RR5 A;  3I4N G;  1YJW A;  5C0X J;  3UDX A;  3AFQ A;  3HOY H;  4IFD J;  1NMG A;  3GTO H;  1OXS C;  2I5L X;  3TS0 A;  4A93 H;  3HOV G;  4IOA A;  3HOW G;  1YI2 A;  3A0J A;  4B3R Q;  4R4T A;  4ME3 A;  4DV4 L;  1PV4 A;  4A3D H;  4WJ4 A;  4YY3 L;  2CKZ B;  3RLO A;  2MNA A;  4A3B H;  2D62 A;  1HJP A;  2HIV A;  1E3P A;  1Q1B A;  2WB1 G;  3AQQ A;  3AYH B;  3BZC A;  4OWX B;  3CME A;  1X65 A;  3CCM A;  1HNX Q;  3HOU G;  3RZO H;  1PVO A;  2OQ0 A;  1W3S A;  4DR1 Q;  4DV5 Q;  3CF5 A;  1KQS A;  3PGZ A;  2K52 A;  1K0R A;  4KI0 A;  3I7F A;  3PIP A;  1S40 A;  3BZK A;  4C3J H;  2Q2T A;  4BA2 I;  1GVP A;  4P72 A;  1G6P A;  3M4Q A;  3PUW A;  4DR7 L;  2KEN A;  4UP8 A;  4NB3 A;  1LYL A;  2C35 B;  1JMC A;  4A3L H;  4OX9 Q;  2LXK A;  3HOX H;  4R4I A;  1V9P A;  3I2Z A;  1FL0 A;  3FKI H;  1CKM A;  2ID0 A;  3W5O A;  4DUZ L;  5IYD H;  4DR2 L;  2K5N A;  4JBW A;  4P74 A;  3H0G H;  4JI2 Q;  1GM5 A;  1XMO Q;  2B63 G;  2OCE A;  2K14 A;  1OXV A;  4DV3 L;  1EQR A;  4R4C A;  3L7Z C;  2H5X A;  5BR8 Q;  4JI5 L;  4A3C H;  1PH4 A;  5FLX c;  4OO1 I;  4TVA B;  1TWF H;  5EAY A;  1K8A C;  4DR6 Q;  3K81 C;  1OXX K;  4JYA L;  4A76 A;  3HKS A;  2PI2 E;  1K73 C;  4JI3 L;  1C9O A;  3MXN B;  5LMU Q;  1YIJ A;  1HNW L;  4POG A;  4A3K H;  5IYB G;  2AWO A;  2QEX A;  3U58 A;  3G4S A;  1VS0 A;  1XNQ L;  3NEL A;  3D0F A;  3UE0 A;  1QVG A;  1XTD A;  1JJC B;  1J5E L;  2EQS A;  1PH6 A;  1ASZ A;  2LSS A;  4HID A;  4LNQ A;  4GOP A;  1DGS A;  4GS3 A;  1Q82 C;  2UUB L;  4BXX G;  1A62 A;  2EIF A;  4XTC S;  4YWL A;  5E7N A;  5FJ8 H;  4A3F H;  2JK8 A;  4YCU A;  2ZTE A;  3M4P A;  4QGU A;  1KD1 C;  4JI7 Q;  4IPH A;  4DAY B;  4DR4 L;  1E24 A;  1YBY A;  1PH7 A;  1VQ7 A;  4A3M G;  3CP0 A;  1PH9 A;  4RMF A;  1IL2 A;  5J3B A;  3PV0 A;  5C0X I;  1EWI A;  3F1Z A;  3IRB A;  4OON A;  4IFD I;  4OO1 G;  2HQL A;  1A0I A;  4LUO A;  4DR5 L;  3T1Y Q;  1CSP A;  4DV0 L;  4ALP A;  2UU9 Q;  3U50 C;  1VCI A;  3BU2 A;  2JA5 H;  2A1A A;  2YTY A;  4B3T Q;  2ZJR A;  1Y14 B;  2KCT A;  4LF9 L;  2GVA A;  4B3M Q;  4LFC Q;  1VQL A;  4GOP C;  4JBK A;  3FHW A;  3S2D H;  4R4Q A;  2MO0 A;  1MIU A;  2BH2 A;  3HKZ E;  2JEA I;  1UE7 A;  4IJL A;  1N32 L;  1A8V A;  1UEB A;  2YU9 H;  3I55 A;  1XNR L;  1L1O A;  3F2D A;  1HNZ Q;  3L0O A;  4DV7 Q;  4GKK Q;  1VQH A;  2WB1 E;  1JE5 A;  3PUY A;  1K8G A;  4PMW A;  1HR0 Q;  2E5L L;  4LF7 Q;  4A3I G;  1SR3 A;  4LWC A;  1Y1V H;  3NBH B;  5C0X G;  2ZJQ A;  3H3V I;  4LW1 A;  4QIW E;  4LFA Q;  4DV2 Q;  1AE2 A;  4X62 Q;  2VZA A;  4OWW B;  5IP7 H;  2UXD Q;  3W1G A;  1PH1 A;  1TWH H;  2AKW B;  4RG1 A;  3RNU A;  3F8T A;  1X6O A;  2R7F A;  4J15 A;  3CCJ A;  3CCQ A;  1VQM A;  1YJN A;  1K3R A;  5JJK A;  1JJ2 A;  3ER0 A;  2UXB Q;  2PQA B;  3I4M H;  1IBL L;  2KHI A;  1EFW A;  1GKH A;  1X54 A;  2R7D A;  2JQO A;  3J80 c;  4JBJ A;  3KF6 A;  2L15 A;  2DUD A;  2R93 H;  3RN5 A;  1PH3 A;  2ATW A;  2E8G A;  4BXX H;  1FVI A;  1E1O A;  3SGI A;  3GO5 A;  4LF5 Q;  3J80 i;  2K75 A;  2JA7 G;  2HHH L;  4JI8 Q;  1UWV A;  1Q86 C;  4BY1 G;  2GN5 A;  5LMN Q;  4EX5 A;  2MQH A;  4R4O A;  5GRO A;  2A19 A;  1Y1W H;  3LGJ A;  1UE6 A;  4A3J G;  4HJ8 A;  3CD6 A;  4MZ9 A;  1P8L A;  4A93 G;  2VUM H;  2R7Z H;  4QJF A;  3CXC A;  1PYS B;  1I6H H;  1Q46 A;  1WFQ A;  4C2M H;  1GD7 A;  3S1M H;  2MO1 A;  3S14 H;  1O7I A;  5IP9 G;  1EOV A;  2AHO B;  3A74 A;  5FLM H;  3HKZ G;  1YHQ A;  2E2I H;  4A3B G;  3PO2 G;  3K0X A;  3UDF A;  1Z9F A;  1FJG L;  1V43 A;  1OTC A;  5C3E H;  5AJ3 Q;  5M3F H;  3H15 A;  4A3G H;  1MJC A;  4DV1 Q;  1IBK Q;  1OXU A;  5HGQ A;  4JI4 L;  1HR0 W;  5GAG C;  2KBN A;  3PSI A;  1HNX L;  1X3E A;  4GLX A;  4JC0 A;  3DLL A;  3ULJ A;  3OW2 A;  4O2D A;  2UUA L;  4DR1 L;  2ASB A;  1NE3 A;  4DV5 L;  2JE6 I;  3UDI A;  5GAH C;  2R92 G;  5GAE C;  5IYC G;  3TEH B;  2I5H A;  2JA6 G;  1PYB A;  1WCM H;  3G6E A;  3I4N H;  1OXT A;  3JC6 6;  2VQE L;  2OTL A;  4P73 A;  2B29 A;  5IWA Q;  3KF8 B;  4NPS A;  3OTO Q;  3J81 j;  4JV5 Q;  1QZH A;  1V1Q A;  3STB D;  1N9W A;  3GDE A;  3EIV A;  5M5W H;  4JI2 L;  2PMZ E;  2WAQ G;  1XMO L;  1VQ8 A;  4L5S A;  3HOW H;  4DUY L;  4GOP B;  1GO3 E;  5BR8 L;  4GN5 A;  1CSQ A;  2OWO A;  1HZ9 A;  1IBM Q;  1EIF A;  3KDF A;  4AQY Q;  3CC2 A;  1X55 A;  4DR6 L;  3HOU H;  3CPW A;  4NXN Q;  2N49 A;  3A5U A;  3F2C A;  1VQE A;  3J7A 5;  5LMU L;  4KHP L;  2Y0S E;  3RLN A;  2RF4 A;  2NVT H;  4HJ7 A;  2RCN A;  3CQZ H;  4IPC A;  3I4O A;  2YV5 A;  5GAD C;  1S72 A;  5LMN W;  4X66 Q;  4JI6 L;  1LTL A;  2VY3 A;  1KAW A;  4HJA A;  1XMQ Q;  1U0L A;  4C3I H;  4DPG A;  4L5T A;  3PUX A;  2LXJ A;  3RLF A;  1VQI A;  5JEA J;  1N33 Q;  1QVC A;  3S16 H;  4JI7 L;  2NN6 G;  4DKA C;  1XPO A;  4KLK A;  5M3M H;  2ZM6 Q;  3Q8D A;  3A5Z B;  1NY4 A;  3CCU A;  1C7Y A;  2VL6 A;  3PO3 G;  4NXM Q;  1R9T H;  1H95 A;  2I0Q A;  2UUC Q;  2F3I A;  2NVY H;  2PI2 A;  1VQG A;  1E7Z A;  4PZ6 A;  2VQF Q;  5H1S E;  3HOZ G;  2D0O A;  1L1O B;  2IT1 A;  1D8L A;  4MTN A;  5K36 G;  2ALY B;  3T1Y L;  1IYJ B;  3PF5 A;  5M5Y H;  2WP8 J;  2CCZ A;  2UU9 L;  5IYB H;  3KJP A;  1TWC H;  4JI0 L;  1N34 Q;  2E2J H;  4B3T L;  3S2H H;  3KOJ A;  4BBS G;  4PZ8 A;  3W1B A;  4TQU S;  3M85 A;  4B3M L;  4LFC L;  1YJ9 A;  3GTG H;  3PCO B;  1NTG A;  4DV6 Q;  2F4V L;  5HY6 A;  3NEM A;  4PZ7 A;  2VW9 A;  1N36 Q;  1PH8 A;  4L5Q A;  4YCW A;  3J7Z C;  2Z6K A;  1E1T A;  4LFB Q;  1G51 A;  1HNZ L;  4BY7 G;  4DV0 Q;  1KXL A;  4DV7 L;  1VQP A;  4A3M H;  3D31 A;  1VQJ A;  1K9M C;  4YHH Q;  3CW2 C;  1HR0 L;  4JI1 Q;  4BBR H;  4FDB A;  1A63 A;  4GLA C;  4HIM A;  1IZ6 A;  4DV2 L;  2YTX A;  3KF6 B;  4LFA L;  2F52 A;  1KRS A;  4X62 L;  4X65 Q;  4A3E G;  1M1K C;  2UXD L;  2ZTD A;  3K8A A;  2OTJ A;  1D7Q A;  5C44 G;  1B7Y B;  2OQK A;  3J81 c;  2Y0S G;  1SN8 A;  5DLQ E;  1KRT A;  3ULL A;  4GKJ Q;  3PUZ A;  3T1H Q;  2CWA A;  4DR3 Q;  3GTK H;  3M9B A;  4PG3 A;  2Q2H A;  4LF4 L;  2IX1 A;  2CWP A;  1L1O C;  2WAQ E;  4A4I A;  3RZD H;  2UXB L;  2Z6K C;  1QZG A;  3CCE A;  5IY0 A;  1NMF A;  1HZA A;  5C4J H;  3GTQ H;  3AEV A;  1SLJ A;  1T9H A;  2N8N A;  4HIK A;  2UXC Q;  4DK3 C;  1EYG A;  1XJV A;  4C3H H;  1SFO H;  2HT1 A;  4H02 A;  1WYD A;  4UPA A;  4X64 Q;  4P75 A;  1SRU A;  4A3I H;  1FGU A;  4JBM A;  4AH6 A;  1VQD A;  4LF6 Q;  3GTM H;  2RHQ B;  4LF5 L;  1AE3 A;  1CKO A;  4JI8 L;  1KIX A;  5C4X H;  1E22 A;  5LMN L;  3HOY G;  4GNX A;  3KJO A;  1JB7 A;  4LF8 Q;  1PH2 A;  1AH9 A;  3KYH C;  1X56 A;  3WWV A;  4HIO A;  3I56 A;  3PF4 A;  1NBW A;  1TXY A;  1YNX A;  1BBU A;  4DK6 C;  4A3D G;  1QUQ B;  2IHE A;  4HJ5 A;  3E0E A;  5GQO A;  1G29 1;  1I50 H;  3CMA A;  4B3R L;  4B3S Q;  4JCV E;  4UP9 A;  1MKH A;  1WOC A;  1I94 Q;  5AJ3 L;  4O0A A;  2BA0 A;  1MJE A;  1XPU A;  1YIT A;  1Q1E A;  1Q8K A;  3RN2 A;  1IBK L;  3M4O H;  3H3V H;  3S1N H;  4K0K Q;  1SMX A;  4P71 A;  5JEA G;  2JA7 H;  4QY7 A;  4BY1 H;  1QUQ A;  3G48 A;  3CCV A;  3PIO A;  4GNX C;  4LUZ A;  5ELN A;  4A3L G;  3HOX G;  2ZTC A;  3FKI G;  3L2P A;  4A3J H;  3ULP A;  4OWT B;  5IYD G;  1KC8 C;  2JA8 H;  3KDF B;  3H0G G;  1VQC A;  3E9I A;  2KHJ A;  1FJG Q;  1YHA A;  3ICE A;  1EUJ A;  1Q12 A;  2KCM A;  1B70 B;  4JOI A;  4DV4 Q;  4A75 A;  4OXP A;  3VDY A;  4OX9 L;  4YY3 Q;  3CCR A;  2NN6 I;  5IP9 H;  1RL2 A;  5IWA L;  3OTO L;  4POF A;  3F2B A;  1U5K A;  3HOV H;  4A3C G;  3CPF A;  1VQK A;  2K50 A;  2N78 A;  4JV5 L;  3M3Y H;  4JI4 Q;  3PO2 H;  2VS1 A;  4XIG S;  1UE5 A;  3U4Z A;  1VQB A;  4DAM A;  1KHI A;  4JI0 Q;  2UUA Q;  3OYY A;  4A3K G;  1VQF A;  4Y52 H;  2BA1 A;  3CAM A;  4DR7 Q;  2K4K A;  1IBM L;  1EQQ A;  1XPR A;  1C0A A;  4AQY L;  4NXN L;  1IXR A;  4JG2 A;  2VQE Q;  2A8V A;  1M90 C;  5FJ8 G;  1YZ6 A;  4GN3 B;  4A3F G;  2E2H H;  2JEB I;  4AYB E;  2R92 H;  4DUZ Q;  4DR2 Q;  5IYC H;  3CCS A;  3S1Q H;  4X66 L;  2JA6 H;  3ERS X;  4DV3 Q;  1TWA H;  1EIY B;  1S3O A;  4JOI C;  3B6Y A;  5M3M G;  4GLV B;  3U4V A;  1HH2 P;  4KHZ A;  4DUY Q;  4IPD A;  3G71 A;  3NEN A;  1XMQ L;  4JI5 Q;  3GTP H;  3TRZ A;  2CFM A;  2IHF A;  1L2F A;  1N33 L;  2AWN A;  2B63 H;  3TS2 A;  1JJG A;  1PFS A;  3S17 H;  4JYA Q;  1VQA A;  2K5H A;  5JJI A;  4JI3 Q;  3TRE A;  3K7U C;  1HNW Q;  2ZM6 L;  2XGT A;  2V1C C;  2BH8 A;  4KHP Q;  2JA5 G;  4NXM L;  2JJQ A;  1XNQ Q;  2UUC L;  1JT8 A;  3JAM c;  2VQF L;  4IO9 A;  4X6A H;  1HZB A;  1J5E Q;  2D0P A;  2ES2 A;  2WFW A;  4JI6 Q;  4MNO A;  2IX0 A;  3CC7 A;  2DGY A;  1P16 A;  2UUB Q;  1VQ4 A;  5IE8 A;  2PNH A;  4QQB X;  3E9H A;  4IOC A;  1J6Q A;  3EN2 A;  1Q7Y C;  1N34 L;  3JAM i;  2AMC B;  4EQ5 A;  4DR4 Q;  3GD7 A;  3S15 H;  3STB C;  1B8A A;  4DV6 L;  2EXD A;  1N36 L;  2GVB A;  5M5X H;  1Y1V G;  4BBR G;  2XTI A;  1I5F A;  2NZH A;  4DR5 Q;  4GKK L;  4LFB L;  3HFZ B;  3M7N A;  5IP7 G;  3UE1 A;  3PO3 H;  5IT9 c;  2RHS B;  4LF7 L;  4YHH L;  4JI1 L;  4LF9 Q;  1BKB A;  3HOZ H;  2Z0S A;  4YWM A;  2YTV A;  1QVF A;  3BJU A;  2IY5 B;  4APV A;  2JA9 A;  1VQ5 A;  1SRO A;  4X65 L;  2F4V Q;  2VNU D;  1N32 Q;  1RIP A;  3AFP A;  3I4M G;  2QGQ A;  1XNR Q;  2HIX A;  1Q81 C;  1I3Q H;  4BBS H;  4UY8 C;  4AYB G;  3MEF A;  1PHJ A;  4GKJ L;  1CUK A;  2R93 G;  3T1H L;  2QA4 A;  4DR3 L;  1VQO A;  4L5R C;  1WJJ A; 
#chains in the Genus database with same CATH topology
 1F2M A;  2E5L Q;  1ASY A;  1JWU D;  2N3S A;  2QIL A;  2K32 A;  3FP9 A;  3TQY A;  1W2B A;  2AQ3 B;  1HZC A;  4HSV A;  1Y1W G;  3RD4 A;  1YEZ A;  2R6G A;  4S3S A;  2MHV A;  4LF6 L;  1SBB B;  2CQA A;  1Z47 A;  1PZK D;  1EFI D;  4K2L A;  4AIM A;  4LF4 Q;  3J7A V;  5C44 H;  1CKN A;  3GTL H;  2K5W A;  2RQX A;  3K7A H;  1WTR A;  5M3F G;  1SE8 A;  4YCV A;  5ELO A;  2Q8I B;  2OT2 A;  2Q2U A;  4H13 C;  5IIF A;  1CFM A;  1WTH A;  2O5J C;  4B3S L;  4WJ3 M;  4Y7N H;  3D4D A;  2NVX H;  1X3G A;  4K0K L;  1WCM G;  2X6G A;  1PFB A;  2N55 A;  5D65 A;  3RR5 A;  3VR2 A;  3F2U A;  1YJW A;  5C0X J;  4GZY C;  3NTI A;  1GUT A;  3TS0 A;  3R2I A;  1SE2 A;  4BBS B;  3KK7 A;  4WJ4 A;  2CKZ B;  5ELC A;  3RLO A;  2MNA A;  2D62 A;  3E5S A;  1HNX Q;  3DXJ C;  3HOU G;  1DOM A;  3URY A;  1W3S A;  4DV5 Q;  2O4X A;  4BY7 B;  1H9J A;  1CQV A;  3I7F A;  3NSW A;  1S40 A;  2TMP A;  4CJ0 B;  2KOL A;  2Z6B A;  1RD9 D;  5EKI A;  1A6X A;  1JMC A;  2KUM A;  3EFX D;  3HOX H;  2KEE A;  3I2Z A;  1FL0 A;  1CI3 M;  4JBW A;  2B63 G;  5EBC A;  2OCE A;  1OXV A;  1QWY A;  4R4C A;  1EY9 A;  4JI5 L;  3BZD B;  4NP5 A;  4A3C H;  1KDC A;  4OO1 I;  4TVA B;  1K8A C;  2L1B A;  3K81 C;  4JYA L;  1C9O A;  4A3K H;  1EZ8 A;  5IYB G;  4QF4 A;  3MXU A;  3D0F A;  1J5E L;  1ASZ A;  1PH6 A;  4LNQ A;  1C4Q A;  4GS3 A;  1E2W A;  2UUB L;  1A62 A;  1KLG D;  4YWL A;  5KNC A;  3HOY B;  1KD1 C;  4JI7 Q;  3GTO B;  3FPU B;  4PV1 C;  4DAY B;  4DR4 L;  1PH7 A;  4K5V A;  4FF1 A;  2NYZ D;  4J8Q A;  1IL2 A;  3PV0 A;  5C3E B;  1EWI A;  3L3O C;  3F1Z A;  4OO1 G;  2XRQ D;  3Q24 A;  4DR5 L;  4FXD A;  1CSP A;  4DV0 L;  1STB A;  3MFY A;  2JA5 H;  4QB4 A;  1X3P A;  1PTO D;  2ZJR A;  4QUC A;  4B3M Q;  3FEW X;  5IGF A;  1AFP A;  1U4R A;  2XNA C;  4R4Q A;  2MO0 A;  5K5P A;  3HKZ E;  1UE7 A;  1N32 L;  1A8V A;  3JAM L;  1L1O A;  2MP1 A;  3WOF A;  1HNZ Q;  1NAP A;  4ZLT F;  4C56 C;  4DV7 Q;  4GKK Q;  3U9S A;  2Z8L A;  5L37 A;  1JE5 A;  3SK8 A;  1K8G A;  2E5L L;  3E3X A;  1UNS A;  1LAB A;  4X62 Q;  1KNA A;  2TSS A;  3RMH A;  1PH1 A;  2AKW B;  4RG1 A;  3KLS X;  3TZD A;  1TKW B;  4FF3 A;  3F8T A;  1X6O A;  3EVQ A;  3PIO 3;  1VQM A;  3VR4 A;  1YJN A;  2PQA B;  3E6Z X;  3FRP B;  4R8N A;  1CTM A;  4P2C B;  2DUD A;  2ATW A;  3TP7 A;  2RSN A;  2A74 C;  5M3M B;  4NDX A;  1RTN A;  2K75 A;  1Q86 C;  4BY1 G;  1YNJ C;  2QCP X;  5JPM C;  3HG9 A;  1PDQ A;  4A3J G;  3BVM A;  3CD6 A;  1P8L A;  4A93 G;  4X3T A;  4QJF A;  1DXM A;  2KQ3 A;  4UHV A;  4RGT A;  3CXC A;  1Q46 A;  2B2U A;  3S1M H;  3OW7 A;  3L9A X;  3A74 A;  5FLM H;  3V96 A;  2YU9 B;  2BCO A;  1IYV A;  5C3X A;  4OGQ C;  4A3G H;  2PCF B;  4K8J A;  5GAG C;  1Y1V B;  3PSI A;  5J39 A;  1HNX L;  5LHY 1;  3OW2 A;  3SK5 A;  4DV5 L;  3UDI A;  4V19 0;  5GAH C;  5GAE C;  1LAC A;  5IYC G;  3TEH B;  2I5H A;  1PYB A;  3OWE B;  3I4N H;  1OXT A;  4ABN A;  1I4P A;  1EIH A;  1QNK A;  3WOE A;  1A2U A;  3OTO Q;  4NPS A;  4JV5 Q;  5A2Q E;  3I4M B;  1GHK A;  4I65 A;  1N9W A;  3GDE A;  5M5W H;  3HOW H;  4KN4 C;  2PMZ E;  4AYB B;  4DUY L;  2FHT A;  2R93 B;  3ZYY X;  5D3I B;  5K36 H;  1O7Y A;  3DEP A;  3BYT B;  3A5U A;  2C5C A;  4KHP L;  2NVT H;  4IUP A;  3C1E A;  4X66 Q;  1S5E D;  1KLU D;  1CHP D;  1NSN S;  2VUM B;  2R7Z B;  4L5T A;  2LXJ A;  3I4L A;  3S14 B;  4KKS A;  3ND9 A;  4JI7 L;  1EU4 A;  2B2Y A;  2ZM6 Q;  4FYD A;  3Q0A A;  3MXP A;  2VL6 A;  3RUZ A;  1H95 A;  3SK4 A;  2PI2 A;  5J22 A;  3HOZ G;  4PZ6 A;  4ZKB B;  3P20 A;  4KV6 A;  2NZ1 D;  1GUN A;  2EXZ A;  3KJP A;  4QMG A;  1N34 Q;  5FLX L;  3MZ5 A;  2DNE A;  1STN A;  4B9X A;  4B3M L;  3M85 A;  1NTG A;  1HFG A;  4RHR A;  1N36 Q;  4IUR A;  4YCW A;  1O7Z A;  2Z6K A;  4NW2 A;  2JXM B;  3D8G A;  4R8I A;  1HNZ L;  1ET6 A;  4WJW A;  4DV7 L;  1B50 A;  1K9M C;  1KTK A;  1U4P A;  1L0Y B;  4FDB A;  1DYQ A;  4GLA C;  2WB1 B;  2RDG A;  3KF6 B;  3MXG A;  1GJX A;  2F52 A;  2OEO A;  4X62 L;  1EY8 A;  3HRZ C;  1M1K C;  5E4X A;  5C44 G;  1B7Y B;  3J81 c;  2Y0S G;  2KJX A;  5M9O A;  3PUZ A;  2F0K A;  1D5M C;  3S1Q B;  3T56 B;  1B3Q A;  3RZD H;  3CCE A;  5IY0 A;  2B2V C;  1SAP A;  3OPO A;  3S17 B;  1HQM C;  1GUS A;  1SRU A;  4A3I H;  1QNU A;  5C0X H;  2A73 B;  2LMC B;  4H7B A;  2RVL A;  1JB7 A;  4LF8 Q;  4MIU A;  3KYH C;  1IL8 A;  2RSO A;  4L63 B;  3S2H B;  2EYL A;  1YNX A;  2K01 A;  3K5L A;  1QG7 A;  4DK6 C;  3GTG B;  2PPB C;  2QKI C;  3R3O A;  5GQO A;  5JVH 3;  2SOB A;  4DXF A;  1WOC A;  4A3M B;  2QDL A;  3MEH A;  2NUC A;  1MJE A;  3J80 L;  1Q1E A;  1Q8K A;  1ZXT A;  4U67 3;  3H3V H;  1VF7 A;  1I4G A;  3CCV A;  4LUZ A;  1XWE A;  3HOX G;  4OWT B;  1O80 A;  4Z9C B;  2K28 A;  3VYU A;  1VQC A;  3ICE A;  1T5X D;  1EUJ A;  5I4D A;  3JAM E;  3CCR A;  3OTO L;  4A3C G;  4POF A;  4JV5 L;  2BE5 C;  2K50 A;  5FO8 B;  3PO2 H;  5CV8 A;  2NB0 A;  4XIG S;  1UE5 A;  3I91 A;  3U4Z A;  5C4J B;  1VQB A;  2N88 A;  2UUA Q;  1FNW A;  3OYY A;  4A3K G;  4C3H B;  1SFO B;  1ML0 D;  3Q22 A;  1WTW A;  3CAM A;  1II3 A;  5J1Z A;  3P75 A;  4IQZ A;  1SEB D;  1LLR D;  2CH4 W;  2E2H H;  2R92 H;  1GOZ A;  5DNF A;  3VYS A;  4X66 L;  1DM0 B;  3MHB A;  1B9N A;  3U4V A;  3D4W A;  4C1N I;  3I72 A;  2CFM A;  1L2F A;  2F0P A;  2B63 H;  3TS2 A;  1PFS A;  3NWS A;  1SDF A;  5JJI A;  3K7U C;  1I50 B;  2ZM6 L;  2V1C C;  5T1G A;  2JA5 G;  3LWE A;  2JJQ A;  5CC4 A;  1XNQ Q;  4IUU A;  4CDC C;  1BOS A;  1HZB A;  4MNO A;  2IX0 A;  4X3K A;  2JA7 B;  5IE8 A;  1JR0 D;  4QQB X;  5BN5 A;  1J6Q A;  1Q7Y C;  1N34 L;  1EY4 A;  3M4Y A;  1NR2 A;  5JJZ A;  1MSG A;  3GD7 A;  5EBD A;  1PTO B;  4G7O C;  1WD1 A;  2KCC A;  1N36 L;  3EJI A;  4BBR G;  2XTI A;  1I5F A;  3HKZ B;  1TQO A;  3X3N A;  3UE1 A;  5IT9 c;  1DOL A;  4LF9 Q;  1BKB A;  2OF1 A;  2R3Z A;  5CBA E;  2YTV A;  1YNJ D;  3BJU A;  1VQ5 A;  1SRO A;  1HA5 A;  1U9R A;  4M8A A;  2VNU D;  4ZRZ A;  3R2T A;  3AFP A;  1SYF A;  1XNR Q;  4BBS H;  1I3Q H;  5EGT A;  3MEF A;  1PHJ A;  2JA6 B;  4CKB A;  4K6L A;  1SYB A;  3TP8 A;  3N6R A;  4GNX B;  1TS4 A;  3J81 i;  4O1N A;  3A54 A;  3QIA A;  2MFI A;  4DAV A;  1VQ9 A;  4BY7 H;  5C4X G;  2FXQ A;  1HUN A;  1LT4 D;  1UE1 A;  5KEE A;  3PIP 3;  3TP6 A;  2AQ2 B;  1D1K A;  4LUV A;  2K5V A;  1JOQ A;  2Q2I A;  1NNX A;  3I73 A;  4LF8 L;  2NZO A;  1LM0 A;  3SK6 A;  5FLM G;  1ONL A;  1S5B D;  4KTA A;  2XIW A;  3VR6 A;  3KFU A;  4A3G G;  5KYL A;  3KLR A;  5JJL A;  2HHH Q;  1PA6 A;  1BNZ A;  1F9Q A;  3QO2 A;  3QOL A;  3SE0 A;  2PQA A;  4QL5 A;  1PH5 A;  3EBE A;  5AFW A;  4BA1 I;  3KLW A;  1V1P B;  1YHB A;  3I4N G;  1BR9 A;  1HXY D;  4X3U A;  3HOY H;  1NMG A;  4PQX A;  3GTO H;  2I5L X;  2AUK A;  1A3V A;  4A93 H;  3HOV G;  1V8Q A;  3D6W A;  2J4X A;  1YI2 A;  3HOW G;  2DY7 A;  4R4T A;  1STH A;  1QCB D;  4ME3 A;  5JVG 3;  5K36 G;  2A5H A;  2HIV A;  3AQQ A;  1E3P A;  1Q1B A;  1TWG B;  5DM6 3;  3CME A;  2ZT9 C;  1DCZ A;  2ICE C;  2A8V A;  3G7L A;  4DR1 Q;  4KI0 A;  2NVQ B;  1K0R A;  1BDO A;  4XDX A;  3BZK A;  4BA2 I;  2PMZ B;  1GVP A;  3SR1 A;  1G6P A;  2SNM A;  3M4Q A;  3VR3 A;  1LYL A;  4MN3 A;  4A3L H;  3OMG A;  4OX9 Q;  1MBY A;  1SNQ A;  4R4I A;  5KRU A;  3I8Z A;  3W5O A;  1CKM A;  3A56 A;  5IYD H;  4IZ8 A;  3H0G H;  4ODG A;  1XMO Q;  2K14 A;  2H5X A;  3V05 A;  3OOC A;  1S5C D;  2EPB A;  4DK1 A;  5EAY A;  1STY A;  2P5Z X;  3HKS A;  4MHE A;  4POG A;  1JE4 A;  2AWO A;  4FF2 A;  2QEX A;  3QR8 A;  1XNQ L;  3BG3 A;  3NEL A;  3TN2 A;  3UE0 A;  1QVG A;  2CH4 A;  4HID A;  1EU3 A;  1Q82 C;  3IAY A;  2EIF A;  5FJ8 H;  4JK1 C;  4QGU A;  2ZTE A;  1CHQ D;  1YBY A;  1ZYR D;  3CP0 A;  2F4I A;  5E1F A;  4HTH A;  2HDM A;  1LTS D;  5C0X I;  1E2Z A;  4A3D B;  1EY7 A;  3IRB A;  2B8F A;  2HQL A;  3C1F A;  4KMU C;  4ALP A;  3QWN A;  3U50 C;  4TRD A;  3J80 E;  3LX0 A;  2A1A A;  2PZW A;  1JQY D;  5HGT A;  2KCT A;  2JSO A;  4C3J B;  4LF9 L;  4LFC Q;  3NWT A;  1CA6 A;  4GOP C;  1EQV A;  1MIU A;  3K58 A;  3K5O A;  1AZQ A;  4M1U B;  1UEB A;  2YU9 H;  4DA2 A;  3I55 A;  1XNR L;  3L0O A;  2B2V A;  2WB1 E;  3ITP A;  3PUY A;  4PMW A;  4A3I G;  1VF5 C;  1SR3 A;  3KUP A;  4ZQ3 A;  1Y1V H;  5C0X G;  2HUG A;  3H3V I;  4LFA Q;  4DV2 Q;  2C9O A;  4EQN A;  2WAC A;  3MA2 B;  2R7F A;  3KLS A;  4J15 A;  3CCJ A;  3CCQ A;  1UAP A;  1ESR A;  1PYW D;  1K3R A;  3QB3 A;  5JJK A;  2K33 A;  3NBH A;  2UXB Q;  1KDB A;  1WVL A;  3I4M H;  1B4O A;  1GKH A;  1X54 A;  1Q90 A;  1XX8 A;  2JQO A;  2R7D A;  1EFW A;  3KF6 A;  1C8C A;  2R93 H;  2E8G A;  1FVI A;  2BE5 D;  3QJY A;  1H9K A;  1E1O A;  1EWC A;  1EL0 A;  2JN4 A;  4B9W A;  2E2D C;  2HHH L;  5EKL A;  2G9H D;  1CZG A;  1PRT F;  4R4O A;  4HCE A;  2A19 A;  4KD3 A;  2VUM H;  2R7Z H;  1PYS B;  1GD7 A;  2MO1 A;  3S14 H;  3S2D B;  1EOV A;  4A3B G;  3PO2 G;  3NK9 A;  3H91 A;  1V43 A;  3AMU A;  3X3M A;  4UAI A;  4DV1 Q;  5HGQ A;  1K8M A;  4JI4 L;  1HR0 W;  1DD2 A;  2KBN A;  4JC0 A;  3DLL A;  3ULJ A;  4O2D A;  5FOB B;  4DR1 L;  1NE3 A;  1B2T A;  1K8O A;  2R92 G;  1TWH B;  4ID6 A;  4N9T A;  4DK0 A;  1T5E A;  1YNN C;  4PMC A;  4F7X A;  3K5M A;  2B29 A;  2Q8T A;  1HCZ A;  3DWQ A;  3A8J E;  1QZH A;  1V1Q A;  1XMO L;  1VQ8 A;  2A69 C;  5EPL A;  1HZ9 A;  2N49 A;  3J7A 5;  2KA7 A;  2Z9H A;  4HJ7 A;  4IPC A;  3HEJ A;  3AU7 A;  3IKJ A;  4LJZ C;  2VXW A;  1LTL A;  1KAW A;  4HJA A;  1LTI D;  3PUX A;  3RLF A;  1VQI A;  5JEA J;  1PFN A;  1QVC A;  5CV9 A;  4CJ2 C;  4EGV A;  1PXU A;  1SMY D;  2F0V A;  2KHS A;  3OIP A;  2I0Q A;  2F3I A;  1D8L A;  2ALY B;  4XQN A;  4RGM A;  3PF5 A;  3OSO A;  2WP8 J;  4DN4 M;  1B3A A;  1SYD A;  3S2H H;  3KOJ A;  1HA6 A;  4BBS G;  4PZ8 A;  3W1B A;  4TQU S;  4LFC L;  4A3J B;  1YJ9 A;  2JA8 B;  3GTG H;  3PCO B;  3DEO A;  1JB3 A;  4H0L C;  3NEM A;  4L5Q A;  3J7Z C;  5KIX A;  4BY7 G;  1F2L A;  4A3M H;  3D31 A;  1NR4 A;  1VQJ A;  4YHH Q;  5DEH A;  4BBR H;  3MTS A;  2EOT A;  3BDC A;  1IZ6 A;  4L6T B;  4DV2 L;  4ZUI A;  4K14 A;  4HR7 B;  4LFA L;  5I2Y A;  2V4D A;  1KRS A;  1GHJ A;  3U9O A;  2JP1 A;  2OTJ A;  5CV5 A;  2OQK A;  1HUM A;  1ROD A;  1KRT A;  3T1H Q;  2F0T A;  3GTK H;  5DM7 3;  1EWH A;  4LF4 L;  3HP3 A;  4DU9 A;  4C3I B;  2UXB L;  1QZG A;  5C4J H;  1LTR D;  2G5D A;  2N8N A;  4DK3 C;  4C3H H;  1SFO H;  4X64 Q;  5HUR A;  1HTP A;  4AH6 A;  1VQD A;  3GTM H;  2RHQ B;  4CDF C;  1CKO A;  3VA7 A;  1RHP A;  5C4X H;  1E22 A;  3HOY G;  5M5Y B;  4GNX A;  2EYF A;  1ET9 A;  1PH2 A;  1TWC B;  4KN7 C;  4HSP A;  4HIO A;  4G7Z C;  3A8I E;  3PF4 A;  1MD2 D;  4K6D A;  1BBU A;  2IHE A;  1PFM A;  4HJ5 A;  3HS0 C;  1Q3L A;  1XTC D;  1I50 H;  3CMA A;  1A3T A;  4DNT B;  2PW5 A;  2F0H A;  5KYI A;  5EPK A;  3BS1 A;  1XPU A;  1EYD A;  1SMX A;  2JA7 H;  1QUQ A;  1GUW A;  4A3L G;  3TME A;  3H94 A;  3L2P A;  5IYD G;  3KDF B;  3H0G G;  1PTO H;  4OEM B;  3E9I A;  1FJG Q;  1YHA A;  1BO0 A;  1Q12 A;  2KCM A;  4JOI A;  1B70 B;  4A75 A;  4YY3 Q;  2IJ0 A;  1G6Z A;  3HOV H;  1U5K A;  3Q6S A;  3CPF A;  3PQI A;  1V1P A;  3GTQ B;  4NMZ A;  4Y52 H;  1VQF A;  4DR7 Q;  2K4K A;  1XPR A;  1C0A A;  4RFB A;  3FVQ A;  1IXR A;  2VQE Q;  1FD7 D;  5FJ8 G;  1YZ6 A;  4GN3 B;  1M90 C;  1SYG A;  5F2D A;  4DUZ Q;  4PMB A;  2JA6 H;  3ERS X;  1S3O A;  2I07 B;  5M3M G;  5COY A;  4KJO A;  1QB5 D;  3G71 A;  1M8A A;  1JJG A;  1V1O A;  2AWN A;  2LY7 A;  4KKU A;  2DNC A;  1VQA A;  2K5H A;  4F87 A;  1TS2 A;  1AZP A;  1HNW Q;  2PYK A;  2BH8 A;  2WIN B;  2B2T C;  2ES2 A;  2WFW A;  4JI6 Q;  3MFG A;  3M4O B;  2L12 A;  3CC7 A;  3S1N B;  3NE5 B;  4K8I A;  2PNH A;  3GP7 A;  1A15 A;  1JOK A;  4IOC A;  5FO9 B;  4RHS A;  2AMC B;  3CHB D;  3JAM i;  4K5X A;  1UUP A;  4KY5 A;  1X32 A;  4ZUJ A;  3STB C;  1B8A A;  1K3B C;  3NBI A;  2L0C A;  2GVB A;  1Y1V G;  1IYU A;  2NN6 H;  4RAU C;  2NZH A;  4GKK L;  1IHZ A;  3HFZ B;  2RA4 A;  3A7A B;  3C46 A;  2RHS B;  4YHH L;  1B1Z A;  2EY1 A;  1SNC A;  2F4V Q;  3I4M G;  2QGQ A;  2KEC A;  1Q81 C;  3BVG A;  3HOX B;  4UY8 C;  4AYB G;  1STE A;  4BS9 A;  2R93 G;  3T1H L;  1TWA B;  1SJH D;  3TSS A;  1ZYR C;  2A6H D;  3GTJ H;  1TWG H;  1TY2 A;  3GTP B;  1YVC A;  2F3V A;  1BXT A;  1CKN B;  2HCC A;  3T16 A;  4IUN A;  2NVQ H;  1LUZ A;  4IFD G;  5EJW A;  2WAQ B;  4R1J A;  4XXE A;  1RDP D;  2D2C C;  2YYZ A;  4X64 L;  3PUV A;  4IJH A;  2ICI A;  4ZKC B;  2O2L D;  1J8I A;  2VUM G;  2R7Z G;  4A3E H;  3S24 A;  1YNN D;  1IBL Q;  1X3F A;  3IFT A;  4XYO A;  3TP5 A;  1VQN A;  3CC4 A;  1XYI A;  4HAE A;  1NJI C;  3J81 L;  3CCL A;  2X69 A;  2A69 D;  5FKA C;  1I4H A;  2HCI A;  4RKL A;  1BBW A;  2FIN B;  4GN4 B;  2WKC A;  3PO3 B;  1EZ6 A;  4HJ9 A;  3C3L A;  4RA8 A;  3AFQ A;  1HRJ A;  4IFD J;  1EEI D;  1QOH A;  4B3R Q;  2IPK D;  1TS5 A;  1G2T A;  4FO2 A;  2IX3 A;  2F0Q A;  4A3D H;  4YY3 L;  4A3B H;  2WB1 G;  1PV4 A;  1K83 B;  3BZC A;  4OWX B;  1X65 A;  1PVO A;  2OQ0 A;  3ONA B;  1MSH A;  4WOR A;  1KQS A;  3PGZ A;  3MWY W;  4C3J H;  1ILP A;  2WKD A;  3S1R B;  3PUW A;  4DR7 L;  1PTO F;  2KED A;  1AN8 A;  3EQL C;  3SVM A;  5JEA H;  4O42 A;  4ME5 A;  1F2Y A;  4XT1 B;  2LXK A;  1V9P A;  2ID0 A;  4DUZ L;  2K5N A;  4P74 A;  1SNO A;  4CKE A;  1HFN A;  3HGB A;  3L7Z C;  5BR8 Q;  2A6E D;  2EJG C;  4V0B A;  2XSC A;  4DR6 Q;  3MXN B;  1PRT D;  2EYJ A;  1YIJ A;  1HNW L;  3I90 A;  1R4Q B;  3KBG A;  2A68 D;  2FMC A;  5JAV A;  3U58 A;  3G4S A;  2PO4 A;  1DZ1 A;  2EQS A;  2LSS A;  1DGS A;  1Q8I A;  3R8B A;  1CM9 A;  5I9O A;  2JK8 A;  4YCU A;  4IPH A;  1K0S A;  4A3M G;  1PH9 A;  5CMD A;  1HQR D;  4RMF A;  3K6O A;  4OON A;  3NQT A;  3NQI A;  1A0I A;  3T1Y Q;  2L11 A;  3PMF A;  2ZXO A;  3RZO B;  1S5D D;  4B08 A;  4CDD C;  2YTY A;  2R61 A;  4DAY A;  2IWH A;  2PQE A;  1TU2 B;  3K57 A;  3S2D H;  2IW3 A;  1EY6 A;  1L0X B;  2WII B;  3SXH A;  1VDZ A;  1TS3 A;  2EYO A;  3FKI B;  3F2D A;  1NUC A;  4CHT B;  1VQH A;  2F3W A;  4J1M A;  4C3H G;  5M5W B;  1HR0 Q;  4LF7 Q;  1SMY C;  1G2S A;  3W3A A;  1D2B A;  5D14 A;  3GQB A;  4LW1 A;  2FFK B;  1AE2 A;  1TWF B;  4KK7 A;  2VZA A;  4OWW B;  5CV6 A;  1TWH H;  1BQQ T;  1HTL D;  2QEJ C;  3GV6 A;  3N52 A;  4LK1 C;  4E6I A;  4JPB W;  5IT9 L;  1JJ2 A;  3ER0 A;  2RDH A;  1IBL L;  2KHI A;  3J7A F;  4A3F B;  1QJO A;  4G7H C;  4IUV A;  2L15 A;  3RN5 A;  1PH3 A;  3M7G A;  2F1M A;  3TZU A;  3SGI A;  4K2K A;  3GO5 A;  3OMC A;  3J80 i;  2JA7 G;  4JI8 Q;  1UWV A;  2GN5 A;  4N8X 1;  2MQH A;  4EX5 A;  2K1B A;  2CVR A;  1LTB D;  4MZ9 A;  3NXW A;  4WRD A;  2CW0 D;  5FLX E;  4RKB A;  2QDB A;  4IUT A;  2AHO B;  1A2T A;  3HKZ G;  2E76 C;  1BCP F;  3BDO A;  3UDF A;  5C3E H;  3R93 A;  3H15 A;  1MJC A;  2XWB B;  2F0J A;  5G3L F;  3DM1 A;  1JIC A;  2KVM A;  2UUA L;  4XQJ A;  5CYU A;  2JE6 I;  3ERQ A;  2JA6 G;  4JVZ A;  3JC6 6;  1WTP A;  2OTL A;  2DY8 A;  5IWA Q;  3KF8 B;  3J81 j;  4XT3 B;  3T13 A;  1EOT A;  3STB D;  2L9H A;  3EIV A;  4GOP B;  1GO3 E;  5BR8 L;  4GN5 A;  1CSQ A;  1JOR A;  1IBM Q;  1EIF A;  2M2L A;  3KDF A;  1X55 A;  2PNR C;  4DR6 L;  1Z7T A;  3CPW A;  4NXN Q;  1VQE A;  5EPJ A;  2Y0S E;  3RLN A;  2RF4 A;  1S72 A;  2EYP A;  2YV5 A;  5GAD C;  1Y1W B;  5LMN W;  2VY3 A;  4TSS A;  4C3I H;  3MC0 B;  1I6H B;  1OO9 B;  2BOS A;  4C2M B;  2AUJ D;  1ENA A;  2NN6 G;  5KND A;  3KBX A;  4KLK A;  1K28 A;  5M3M H;  2E2I B;  3A5Z B;  1NY4 A;  3DWP A;  3CCU A;  5M3F B;  1VQG A;  1E7Z A;  4DGZ A;  2VQF Q;  1WTQ A;  2D0O A;  2QF7 A;  2H1E A;  3T1Y L;  1IYJ B;  2MGS A;  5M5Y H;  2CCZ A;  2BDO A;  1IW7 D;  1TWC H;  5EKK A;  1UEA B;  2DJF C;  5ELD A;  4FXG C;  1FGB D;  3OHX C;  2F0G A;  5FK9 C;  1EY5 A;  3A7L A;  1WCM B;  4PNY A;  2X6L A;  1PZJ D;  4PZ7 A;  1LT3 D;  1I4X A;  4ZYS A;  3VR5 A;  1E1T A;  2B2Y C;  3CRL C;  4LFB Q;  2WV6 D;  1G51 A;  2O5I C;  4DV0 Q;  4OHJ A;  1F77 A;  3CU7 A;  4FNF A;  1HR0 L;  4LMQ D;  1SNM A;  5CV7 A;  1FNV A;  2YTX A;  4A3E G;  3HOU B;  2FMM A;  2LKV A;  1JCK B;  4OEL B;  3K8A A;  1D7Q A;  4QIW B;  4N9P A;  3SDZ A;  1SN8 A;  3CQZ B;  3ULL A;  3BYY B;  4DR3 Q;  1EIG A;  5E3F A;  5A2Q L;  4PG3 A;  2Q2H A;  3ND8 A;  2IX1 A;  2CWP A;  4A4I A;  2WAQ E;  2Z4H A;  2Z6K C;  1NMF A;  1HZA A;  3GTQ H;  3AEV A;  1SLJ A;  1T9H A;  3H3V C;  3S16 B;  4HIK A;  2UXC Q;  2DN8 A;  1C48 A;  2B63 B;  1Z6H A;  4ULL A;  2MPM A;  1R9T B;  3C2P A;  2NVY B;  4IFD H;  3OWF A;  4JI8 L;  1KIX A;  2F0N A;  1B9M A;  2ZXR A;  3P7J A;  1EY0 A;  4Q0F A;  4EQP A;  5I6W A;  3W2D A;  1AH9 A;  3WWV A;  1U4M A;  2E2J B;  3VA5 A;  1NBW A;  1TXY A;  1SYC A;  4A3D G;  4WFN 3;  4IUQ A;  2A6H C;  3E0E A;  3K0Y A;  1MKH A;  2K04 A;  4DAP A;  5I9P A;  1I94 Q;  3FDT A;  1E0B A;  2BA0 A;  4C3J G;  2H4O A;  1D5Z C;  3M4O H;  3S1N H;  1ICF B;  2EYH A;  5JEA G;  5C5L A;  5I2X A;  4QY7 A;  1D5X C;  5ELN A;  1B44 D;  2EYM A;  3ULP A;  1IKL A;  2MUY A;  2SDF A;  2KHJ A;  1EYC A;  5C4Z A;  1I3Q B;  1ESF A;  4DV4 Q;  4OX9 L;  4OL7 A;  5IP9 H;  2Z4I A;  1RL2 A;  5IWA L;  4KY6 A;  1VQK A;  3K59 A;  2VS1 A;  1KHI A;  1FNU A;  4JI0 Q;  4IN3 A;  5ISR A;  2BA1 A;  2SEB D;  5IOD A;  1IBM L;  4CDE C;  4NXN L;  1PLF A;  1H9S B;  2DJG C;  4DR2 Q;  4YIJ A;  3CCS A;  3S1Q H;  1PRT B;  5IT9 E;  4DV3 Q;  1TWA H;  3IFD A;  4LAA A;  1F9R A;  2EY5 A;  1HH2 P;  4DUY Q;  3GTP H;  4IPD A;  2F0S A;  3TRZ A;  1GXD C;  1FR3 A;  2EY2 A;  3P1H A;  3S17 H;  4HMI A;  4JI3 Q;  2XRS D;  1AEX A;  2XGT A;  4KHP Q;  1W6K A;  1EEF D;  2LS0 1;  1JT8 A;  3VYR A;  3JAM c;  2VQF L;  4IO9 A;  4X6A H;  5C4H A;  2D0P A;  1HHV A;  2PZU A;  4QUF A;  2F0U A;  1VQ4 A;  1RF2 D;  4BY1 B;  3EN2 A;  1M4V A;  3MXN A;  4A93 B;  3BVZ A;  4DXG A;  1EQT A;  2A6E C;  5A35 A;  1LTA D;  5DAU A;  4LFB L;  3M3Y B;  1STG A;  3PO3 H;  5IGE A;  1PRT C;  2B2W C;  5JOB A;  4CBV A;  3DMU A;  1AW7 A;  2A68 C;  2EY6 A;  2F0M A;  3D4R A;  1QVF A;  2IY5 B;  1QE6 A;  2EJF C;  2JA9 A;  4APV A;  3A8K E;  3T51 B;  3TDQ A;  3E0J A;  3A55 A;  1U4L A;  1J9O A;  3SHL A;  4DR3 L;  1VQO A;  4L5R C;  3H0G B;  1L0W A;  3TBI B;  4KKT A;  1K83 H;  1Y8P B;  1WI5 A;  2RKS A;  4IPG A;  2K6A A;  3UDG A;  3QG1 A;  4KHV A;  1N8R C;  1X9N A;  1G8Z D;  2HQE A;  2UXC L;  3UI2 A;  4UP7 A;  3DM3 A;  3S1R H;  4RWS C;  1VQ6 A;  3ZJY C;  2ZJP A;  3NTK A;  4YWK A;  2B3G A;  3OIQ A;  4FXK C;  2I5M X;  3K80 C;  5IGD A;  5C3E G;  1FYC A;  3S15 B;  2AQ1 B;  3CRK C;  5BN3 A;  1BVS A;  2CHB D;  2CQO A;  5M5X B;  1HPC A;  5ELB A;  1ENF A;  1KL9 A;  1I94 L;  4DV1 L;  1PMR A;  2JA8 G;  3HOZ B;  2QW7 A;  4N8F A;  4DNI A;  1SSO A;  2G9D A;  3UDX A;  3EA6 A;  4HCS A;  1OXS C;  2RBM A;  4KD4 A;  2B39 A;  3A0J A;  1PZI D;  4DV4 L;  1GUO A;  1HJP A;  4KJN A;  3AYH B;  3CCM A;  3RZO H;  4RCN A;  3DUZ A;  3CF5 A;  5IGC A;  3PIP A;  2K52 A;  4JI0 L;  1QIL A;  1VMC A;  2Q2T A;  1CK1 A;  1GUG A;  1Y8O B;  2KCN A;  3DHQ A;  5C5M A;  4P72 A;  2KEN A;  4UP8 A;  4NB3 A;  4XQQ A;  3H09 A;  2C35 B;  4C3I G;  2CW0 C;  5JPN C;  3FKI H;  1H9R A;  3BDL A;  1MGS A;  1JOO A;  2F0I A;  2EJM A;  5CBE E;  4DR2 L;  4JI2 Q;  5C44 B;  1GM5 A;  2Y0S B;  3GTL B;  4DV3 L;  1EQR A;  2K7V A;  3K7A B;  1I4Q A;  5FO7 B;  1PH4 A;  5FLX c;  1TWF H;  2Z1C A;  1OXX K;  4A76 A;  2PI2 E;  1K73 C;  4JI3 L;  5IGB A;  5LMU Q;  4G4K A;  3KF8 A;  4C1N K;  1VS0 A;  5E4W C;  4Y7N B;  1MHW C;  2NVX B;  1KAB A;  1XTD A;  1JJC B;  2I46 A;  4GOP A;  4XTC S;  4A3F H;  3ERO A;  5E7N A;  3M4P A;  2EE1 A;  2F0W A;  2NTS A;  1BCP D;  1E24 A;  1VQ7 A;  1BBX C;  5J3B A;  5G3L D;  4QCL A;  2LFN A;  4IFD I;  1TR5 A;  4UDU C;  3VYT A;  4LUO A;  3GV3 A;  1WTO A;  2UU9 Q;  1VCI A;  1H9M A;  4HN7 A;  3BU2 A;  2L5T A;  4B3T Q;  1DON A;  1Y14 B;  2GVA A;  1RTO A;  2MJ8 A;  1VQL A;  4JBK A;  3FHW A;  2BH2 A;  2JEA I;  4IJL A;  4RGN A;  2F0E A;  4I7Z C;  3MAQ A;  3D6C A;  4X3S A;  4LWC A;  3NBH B;  2ZJQ A;  4QIW E;  1KDA A;  4J6H A;  5IOC A;  2RCF A;  1D1I A;  3T4A C;  2UXD Q;  5IP7 H;  3W1G A;  2D5D A;  4CGY B;  4ZCK A;  1IW7 C;  5IGG A;  4A3K B;  4FP5 D;  3RNU A;  3K5N A;  1KAA A;  4IAL A;  4DNR B;  4CKC A;  3Q23 A;  3J80 c;  3IL8 A;  1CA5 A;  4JBJ A;  1E2V A;  2J7Z A;  4BXX H;  1O78 A;  4HMJ A;  2PW7 A;  1ZKO A;  1LO5 D;  1BUV T;  4LF5 Q;  2F03 A;  3MVV A;  5LMN Q;  5GRO A;  1Y1W H;  3LGJ A;  4FVM A;  1UE6 A;  1LV9 A;  1BF4 A;  2JA5 B;  4HJ8 A;  2ZXP A;  4ZK9 B;  1TT2 A;  1I6H H;  4C2M H;  1WFQ A;  1B53 A;  5I6Y A;  1O7I A;  5IP9 G;  5C6A A;  2EZV A;  4NKL A;  2E2I H;  1YHQ A;  4G57 A;  2NTT A;  3K0X A;  1Z9F A;  4F88 A;  1FJG L;  1OTC A;  3CKI B;  5D3D A;  4DFA A;  5AJ3 Q;  5M3F H;  1TVX A;  1TY0 A;  1IBK Q;  1OXU A;  1SYE A;  2HDL A;  1D6E C;  4BBR B;  1X3E A;  4GLX A;  2ASB A;  1SE4 A;  3G6J B;  1WCM H;  2B8G A;  3G6E A;  2NBF A;  2VQE L;  1F9P A;  4K5W A;  4P73 A;  2K5Q A;  3J7Y W;  4RGO S;  3NP8 A;  5LL6 S;  3GTK B;  3I70 A;  2Q8R E;  1Y69 U;  1S5F D;  1JWM D;  4JI2 L;  3H6M A;  2WAQ G;  4L5S A;  2OWO A;  2K05 A;  4XYQ A;  4AQY Q;  1I4R A;  3CC2 A;  4CJ1 B;  1JC7 A;  3HOU H;  3F2C A;  3GTM B;  5LMU L;  3LWU A;  3V2T A;  2RCN A;  3CQZ H;  3I4O A;  5C4X B;  4BWG B;  4JI6 L;  1XXG A;  1XMQ Q;  1U0L A;  2F0O A;  4DPG A;  3S1M B;  1N33 Q;  3S16 H;  3I3C A;  3NTH A;  4DKA C;  1XPO A;  1CQF A;  4EQO A;  4ZAI A;  1SXT A;  3Q8D A;  1H9S A;  1C7Y A;  3PO3 G;  4NXM Q;  1R9T H;  2UUC Q;  2JYO A;  2NVY H;  2B2W A;  5H1S E;  4A3G B;  4I7A A;  1L1O B;  2IT1 A;  4MTN A;  1O7L A;  3T53 B;  2UU9 L;  5IYB H;  1STA A;  2XN9 C;  4B3T L;  2E2J H;  1TII D;  2E74 C;  2FJ2 A;  4DV6 Q;  2F4V L;  2E75 C;  5HY6 A;  3I4N B;  5T1I A;  2VW9 A;  1F9S A;  1PH8 A;  1VMP A;  3SEB A;  1LT5 D;  4FF4 A;  3AB9 A;  3HOV B;  1KXL A;  1VQP A;  3HOW B;  4R9W A;  1WTV A;  2M00 A;  3CW2 C;  1SND A;  1KNE A;  4JI1 Q;  1A63 A;  4OO1 H;  4RCO A;  4HIM A;  2F0F A;  5CV4 A;  1LTT D;  3QOJ A;  2BDN A;  4X65 Q;  1ICW A;  2UXD L;  4OIJ A;  2ZTD A;  2D9U A;  2GA4 B;  2NVT B;  5DLQ E;  4GKJ Q;  4TKO B;  2CWA A;  3M9B A;  1W6J A;  5COR A;  4EVO A;  1L1O C;  2OXP A;  2M9V A;  4DF7 A;  3FMC A;  1EYG A;  1XJV A;  2HT1 A;  4H02 A;  1WYD A;  4UPA A;  2EDG A;  4P75 A;  2F0D A;  1FGU A;  4JBM A;  4LF6 Q;  3HZX A;  1PTO C;  1RKN A;  4LF5 L;  2F0L A;  2EVB A;  1AE3 A;  3WDN A;  2NWG A;  5LMN L;  3KJO A;  1X56 A;  3O13 A;  3I56 A;  5LL6 X;  1RJT A;  4RH6 A;  1A3U A;  2L4N A;  1QUQ B;  2VB2 X;  4F8M A;  2K5D A;  3NHH A;  5NUC A;  2XWJ B;  1G29 1;  4B3R L;  4B3S Q;  4JCV E;  4UP9 A;  5C3W A;  5AJ3 L;  4O0A A;  1DOK A;  5EQ0 A;  1YIT A;  3RN2 A;  1IBK L;  4K0K Q;  4P71 A;  4BY1 H;  1LT6 D;  3G48 A;  3PIO A;  4GNX C;  1ENC A;  2ZTC A;  3FKI G;  4A3J H;  2JA8 H;  1KC8 C;  2ENB A;  4OIK A;  5KNB A;  2B2U C;  1Y8N B;  3VDY A;  4OXP A;  2IL8 A;  4U68 A;  2NN6 I;  3F2B A;  2N78 A;  2XVS A;  3RZD B;  1WTX A;  3GTJ B;  4JI4 Q;  3M3Y H;  2RDF A;  4DAM A;  3NUC A;  5CGK A;  1SE3 A;  2PZT A;  4L8J A;  1ILQ A;  4A3I B;  3D3R A;  1EQQ A;  4AQY L;  2B2T A;  5ELF A;  4JG2 A;  4HED A;  4A3F G;  2JEB I;  4AYB E;  4A3E B;  5IYC H;  1EIY B;  4JOI C;  3B6Y A;  1S4Z A;  4GLV B;  1NCV A;  2VB3 X;  1CT1 D;  4KHZ A;  1XMQ L;  3NEN A;  4JI5 Q;  2IHF A;  1N33 L;  4JYA Q;  1SNP A;  3TRE A;  3J81 E;  1IKM A;  3LNN A;  1LTG D;  1G91 A;  1BCP B;  5ELE A;  4NXM L;  2K03 A;  2UUC L;  1CZW A;  2HD3 A;  1J5E Q;  3NPP A;  2DGY A;  1P16 A;  2UUB Q;  5KGU A;  3E9H A;  5CR3 A;  1F2Z A;  4H44 C;  4EQ5 A;  4DR4 Q;  1EYA A;  3S15 H;  4DV6 L;  2EXD A;  2J0T D;  1DJR D;  4ILW A;  1SJE D;  1RCV D;  4Q5V A;  1WD0 A;  5M5X H;  3DWA A;  4DR5 Q;  2L55 A;  1JWS D;  1MI2 A;  4A3B B;  3PO2 B;  3M7N A;  5IP7 G;  1AP0 A;  4LF7 L;  5BN4 A;  4JI1 L;  3HOZ H;  1R4P B;  2Z0S A;  1ZEQ X;  4YWM A;  1X3Q A;  5TSS A;  4X65 L;  1N32 Q;  2SNS A;  1RIP A;  4JW0 A;  1I6V C;  2E2H B;  2R92 B;  2HIX A;  4MTK A;  4KY7 A;  3FPP A;  4GKJ L;  1CUK A;  1BCP C;  3S9W A;  4BXX G;  2QA4 A;  4IOA A;  1WJJ A; 
#chains in the Genus database with same CATH homology
 2E5L Q;  1ASY A;  1L0W A;  3GTJ H;  4GNX B;  2N3S A;  1K83 H;  1TWG H;  1YVC A;  1WI5 A;  3FP9 A;  4IPG A;  3TQY A;  3J81 i;  3UDG A;  1N8R C;  1CKN B;  2MFI A;  1X9N A;  1VQ9 A;  1W2B A;  1LUZ A;  2NVQ H;  4BY7 H;  4IFD G;  2UXC L;  4R1J A;  4UP7 A;  3DM3 A;  1HZC A;  2YYZ A;  4X64 L;  3S1R H;  3PUV A;  4IJH A;  1Y1W G;  5C4X G;  2FXQ A;  1YEZ A;  2R6G A;  1VQ6 A;  3ZJY C;  1UE1 A;  2ZJP A;  4LF6 L;  2VUM G;  2R7Z G;  1Z47 A;  4A3E H;  3S24 A;  4LUV A;  2K5V A;  4YWK A;  4AIM A;  2B3G A;  2Q2I A;  4LF4 Q;  1IBL Q;  4LF8 L;  2NZO A;  5C44 H;  1LM0 A;  1CKN A;  1X3F A;  5FLM G;  3GTL H;  2I5M X;  3K80 C;  3K7A H;  1VQN A;  5C3E G;  3CC4 A;  5M3F G;  1SE8 A;  3KFU A;  4A3G G;  1BVS A;  1NJI C;  4YCV A;  3CCL A;  5ELO A;  2Q2U A;  2CQO A;  5JJL A;  2HHH Q;  1PA6 A;  4B3S L;  1BBW A;  4GN4 B;  4WJ3 M;  1KL9 A;  4Y7N H;  2PQA A;  1I94 L;  4DV1 L;  2NVX H;  1X3G A;  4QL5 A;  1PH5 A;  3EBE A;  4HJ9 A;  2JA8 G;  4K0K L;  1WCM G;  4BA1 I;  3KLW A;  4DNI A;  1YHB A;  3RR5 A;  3I4N G;  1YJW A;  5C0X J;  3UDX A;  3AFQ A;  3HOY H;  4IFD J;  1NMG A;  3GTO H;  1OXS C;  2I5L X;  3TS0 A;  4A93 H;  3HOV G;  4IOA A;  3HOW G;  1YI2 A;  3A0J A;  4B3R Q;  4R4T A;  4ME3 A;  4DV4 L;  1PV4 A;  4A3D H;  4WJ4 A;  4YY3 L;  2CKZ B;  3RLO A;  2MNA A;  4A3B H;  2D62 A;  1HJP A;  2HIV A;  1E3P A;  1Q1B A;  2WB1 G;  3AQQ A;  3AYH B;  3BZC A;  4OWX B;  3CME A;  1X65 A;  3CCM A;  1HNX Q;  3HOU G;  3RZO H;  1PVO A;  2OQ0 A;  1W3S A;  4DR1 Q;  4DV5 Q;  3CF5 A;  1KQS A;  3PGZ A;  2K52 A;  1K0R A;  4KI0 A;  3I7F A;  3PIP A;  1S40 A;  3BZK A;  4C3J H;  2Q2T A;  4BA2 I;  1GVP A;  4P72 A;  1G6P A;  3M4Q A;  3PUW A;  4DR7 L;  2KEN A;  4UP8 A;  4NB3 A;  1LYL A;  2C35 B;  1JMC A;  4A3L H;  4OX9 Q;  2LXK A;  3HOX H;  4R4I A;  1V9P A;  3I2Z A;  1FL0 A;  3FKI H;  1CKM A;  2ID0 A;  3W5O A;  4DUZ L;  5IYD H;  4DR2 L;  2K5N A;  4JBW A;  4P74 A;  3H0G H;  4JI2 Q;  1GM5 A;  1XMO Q;  2B63 G;  2OCE A;  2K14 A;  1OXV A;  4DV3 L;  1EQR A;  4R4C A;  3L7Z C;  2H5X A;  5BR8 Q;  4JI5 L;  4A3C H;  1PH4 A;  5FLX c;  4OO1 I;  4TVA B;  1TWF H;  5EAY A;  1K8A C;  4DR6 Q;  3K81 C;  1OXX K;  4JYA L;  4A76 A;  3HKS A;  2PI2 E;  1K73 C;  4JI3 L;  1C9O A;  3MXN B;  5LMU Q;  1YIJ A;  1HNW L;  4POG A;  4A3K H;  5IYB G;  2AWO A;  2QEX A;  3U58 A;  3G4S A;  1VS0 A;  1XNQ L;  3NEL A;  3D0F A;  3UE0 A;  1QVG A;  1XTD A;  1JJC B;  1J5E L;  2EQS A;  1PH6 A;  1ASZ A;  2LSS A;  4HID A;  4LNQ A;  4GOP A;  1DGS A;  4GS3 A;  1Q82 C;  2UUB L;  4BXX G;  1A62 A;  2EIF A;  4XTC S;  4YWL A;  5E7N A;  5FJ8 H;  4A3F H;  2JK8 A;  4YCU A;  2ZTE A;  3M4P A;  4QGU A;  1KD1 C;  4JI7 Q;  4IPH A;  4DAY B;  4DR4 L;  1E24 A;  1YBY A;  1PH7 A;  1VQ7 A;  4A3M G;  3CP0 A;  1PH9 A;  4RMF A;  1IL2 A;  5J3B A;  3PV0 A;  5C0X I;  1EWI A;  3F1Z A;  3IRB A;  4OON A;  4IFD I;  4OO1 G;  2HQL A;  1A0I A;  4LUO A;  4DR5 L;  3T1Y Q;  1CSP A;  4DV0 L;  4ALP A;  2UU9 Q;  3U50 C;  1VCI A;  3BU2 A;  2JA5 H;  2A1A A;  2YTY A;  4B3T Q;  2ZJR A;  1Y14 B;  2KCT A;  4LF9 L;  2GVA A;  4B3M Q;  4LFC Q;  1VQL A;  4GOP C;  4JBK A;  3FHW A;  3S2D H;  4R4Q A;  2MO0 A;  1MIU A;  2BH2 A;  3HKZ E;  2JEA I;  1UE7 A;  4IJL A;  1N32 L;  1A8V A;  1UEB A;  2YU9 H;  3I55 A;  1XNR L;  1L1O A;  3F2D A;  1HNZ Q;  3L0O A;  4DV7 Q;  4GKK Q;  1VQH A;  2WB1 E;  1JE5 A;  3PUY A;  1K8G A;  4PMW A;  1HR0 Q;  2E5L L;  4LF7 Q;  4A3I G;  1SR3 A;  4LWC A;  1Y1V H;  3NBH B;  5C0X G;  2ZJQ A;  3H3V I;  4LW1 A;  4QIW E;  4LFA Q;  4DV2 Q;  1AE2 A;  4X62 Q;  2VZA A;  4OWW B;  5IP7 H;  2UXD Q;  3W1G A;  1PH1 A;  1TWH H;  2AKW B;  4RG1 A;  3RNU A;  3F8T A;  1X6O A;  2R7F A;  4J15 A;  3CCJ A;  3CCQ A;  1VQM A;  1YJN A;  1K3R A;  5JJK A;  1JJ2 A;  3ER0 A;  2UXB Q;  2PQA B;  3I4M H;  1IBL L;  2KHI A;  1EFW A;  1GKH A;  1X54 A;  2R7D A;  2JQO A;  3J80 c;  4JBJ A;  3KF6 A;  2L15 A;  2DUD A;  2R93 H;  3RN5 A;  1PH3 A;  2ATW A;  2E8G A;  4BXX H;  1FVI A;  1E1O A;  3SGI A;  3GO5 A;  4LF5 Q;  3J80 i;  2K75 A;  2JA7 G;  2HHH L;  4JI8 Q;  1UWV A;  1Q86 C;  4BY1 G;  2GN5 A;  5LMN Q;  4EX5 A;  2MQH A;  4R4O A;  5GRO A;  2A19 A;  1Y1W H;  3LGJ A;  1UE6 A;  4A3J G;  4HJ8 A;  3CD6 A;  4MZ9 A;  1P8L A;  4A93 G;  2VUM H;  2R7Z H;  4QJF A;  3CXC A;  1PYS B;  1I6H H;  1Q46 A;  1WFQ A;  4C2M H;  1GD7 A;  3S1M H;  2MO1 A;  3S14 H;  1O7I A;  5IP9 G;  1EOV A;  2AHO B;  3A74 A;  5FLM H;  3HKZ G;  1YHQ A;  2E2I H;  4A3B G;  3PO2 G;  3K0X A;  3UDF A;  1Z9F A;  1FJG L;  1V43 A;  1OTC A;  5C3E H;  5AJ3 Q;  5M3F H;  3H15 A;  4A3G H;  1MJC A;  4DV1 Q;  1IBK Q;  1OXU A;  5HGQ A;  4JI4 L;  1HR0 W;  5GAG C;  2KBN A;  3PSI A;  1HNX L;  1X3E A;  4GLX A;  4JC0 A;  3DLL A;  3ULJ A;  3OW2 A;  4O2D A;  2UUA L;  4DR1 L;  2ASB A;  1NE3 A;  4DV5 L;  2JE6 I;  3UDI A;  5GAH C;  2R92 G;  5GAE C;  5IYC G;  3TEH B;  2I5H A;  2JA6 G;  1PYB A;  1WCM H;  3G6E A;  3I4N H;  1OXT A;  3JC6 6;  2VQE L;  2OTL A;  4P73 A;  2B29 A;  5IWA Q;  3KF8 B;  4NPS A;  3OTO Q;  3J81 j;  4JV5 Q;  1QZH A;  1V1Q A;  3STB D;  1N9W A;  3GDE A;  3EIV A;  5M5W H;  4JI2 L;  2PMZ E;  2WAQ G;  1XMO L;  1VQ8 A;  4L5S A;  3HOW H;  4DUY L;  4GOP B;  1GO3 E;  5BR8 L;  4GN5 A;  1CSQ A;  2OWO A;  1HZ9 A;  1IBM Q;  1EIF A;  3KDF A;  4AQY Q;  3CC2 A;  1X55 A;  4DR6 L;  3HOU H;  3CPW A;  4NXN Q;  2N49 A;  3A5U A;  3F2C A;  1VQE A;  3J7A 5;  5LMU L;  4KHP L;  2Y0S E;  3RLN A;  2RF4 A;  2NVT H;  4HJ7 A;  2RCN A;  3CQZ H;  4IPC A;  3I4O A;  2YV5 A;  5GAD C;  1S72 A;  5LMN W;  4X66 Q;  4JI6 L;  1LTL A;  2VY3 A;  1KAW A;  4HJA A;  1XMQ Q;  1U0L A;  4C3I H;  4DPG A;  4L5T A;  3PUX A;  2LXJ A;  3RLF A;  1VQI A;  5JEA J;  1N33 Q;  1QVC A;  3S16 H;  4JI7 L;  2NN6 G;  4DKA C;  1XPO A;  4KLK A;  5M3M H;  2ZM6 Q;  3Q8D A;  3A5Z B;  1NY4 A;  3CCU A;  1C7Y A;  2VL6 A;  3PO3 G;  4NXM Q;  1R9T H;  1H95 A;  2I0Q A;  2UUC Q;  2F3I A;  2NVY H;  2PI2 A;  1VQG A;  1E7Z A;  4PZ6 A;  2VQF Q;  5H1S E;  3HOZ G;  2D0O A;  1L1O B;  2IT1 A;  1D8L A;  4MTN A;  5K36 G;  2ALY B;  3T1Y L;  1IYJ B;  3PF5 A;  5M5Y H;  2WP8 J;  2CCZ A;  2UU9 L;  5IYB H;  3KJP A;  1TWC H;  4JI0 L;  1N34 Q;  2E2J H;  4B3T L;  3S2H H;  3KOJ A;  4BBS G;  4PZ8 A;  3W1B A;  4TQU S;  3M85 A;  4B3M L;  4LFC L;  1YJ9 A;  3GTG H;  3PCO B;  1NTG A;  4DV6 Q;  2F4V L;  5HY6 A;  3NEM A;  4PZ7 A;  2VW9 A;  1N36 Q;  1PH8 A;  4L5Q A;  4YCW A;  3J7Z C;  2Z6K A;  1E1T A;  4LFB Q;  1G51 A;  1HNZ L;  4BY7 G;  4DV0 Q;  1KXL A;  4DV7 L;  1VQP A;  4A3M H;  3D31 A;  1VQJ A;  1K9M C;  4YHH Q;  3CW2 C;  1HR0 L;  4JI1 Q;  4BBR H;  4FDB A;  1A63 A;  4GLA C;  4HIM A;  1IZ6 A;  4DV2 L;  2YTX A;  3KF6 B;  4LFA L;  2F52 A;  1KRS A;  4X62 L;  4X65 Q;  4A3E G;  1M1K C;  2UXD L;  2ZTD A;  3K8A A;  2OTJ A;  1D7Q A;  5C44 G;  1B7Y B;  2OQK A;  3J81 c;  2Y0S G;  1SN8 A;  5DLQ E;  1KRT A;  3ULL A;  4GKJ Q;  3PUZ A;  3T1H Q;  2CWA A;  4DR3 Q;  3GTK H;  3M9B A;  4PG3 A;  2Q2H A;  4LF4 L;  2IX1 A;  2CWP A;  1L1O C;  2WAQ E;  4A4I A;  3RZD H;  2UXB L;  2Z6K C;  1QZG A;  3CCE A;  5IY0 A;  1NMF A;  1HZA A;  5C4J H;  3GTQ H;  3AEV A;  1SLJ A;  1T9H A;  2N8N A;  4HIK A;  2UXC Q;  4DK3 C;  1EYG A;  1XJV A;  4C3H H;  1SFO H;  2HT1 A;  4H02 A;  1WYD A;  4UPA A;  4X64 Q;  4P75 A;  1SRU A;  4A3I H;  1FGU A;  4JBM A;  4AH6 A;  1VQD A;  4LF6 Q;  3GTM H;  2RHQ B;  4LF5 L;  1AE3 A;  1CKO A;  4JI8 L;  1KIX A;  5C4X H;  1E22 A;  5LMN L;  3HOY G;  4GNX A;  3KJO A;  1JB7 A;  4LF8 Q;  1PH2 A;  1AH9 A;  3KYH C;  1X56 A;  3WWV A;  4HIO A;  3I56 A;  3PF4 A;  1NBW A;  1TXY A;  1YNX A;  1BBU A;  4DK6 C;  4A3D G;  1QUQ B;  2IHE A;  4HJ5 A;  3E0E A;  5GQO A;  1G29 1;  1I50 H;  3CMA A;  4B3R L;  4B3S Q;  4JCV E;  4UP9 A;  1MKH A;  1WOC A;  1I94 Q;  5AJ3 L;  4O0A A;  2BA0 A;  1MJE A;  1XPU A;  1YIT A;  1Q1E A;  1Q8K A;  3RN2 A;  1IBK L;  3M4O H;  3H3V H;  3S1N H;  4K0K Q;  1SMX A;  4P71 A;  5JEA G;  2JA7 H;  4QY7 A;  4BY1 H;  1QUQ A;  3G48 A;  3CCV A;  3PIO A;  4GNX C;  4LUZ A;  5ELN A;  4A3L G;  3HOX G;  2ZTC A;  3FKI G;  3L2P A;  4A3J H;  3ULP A;  4OWT B;  5IYD G;  1KC8 C;  2JA8 H;  3KDF B;  3H0G G;  1VQC A;  3E9I A;  2KHJ A;  1FJG Q;  1YHA A;  3ICE A;  1EUJ A;  1Q12 A;  2KCM A;  1B70 B;  4JOI A;  4DV4 Q;  4A75 A;  4OXP A;  3VDY A;  4OX9 L;  4YY3 Q;  3CCR A;  2NN6 I;  5IP9 H;  1RL2 A;  5IWA L;  3OTO L;  4POF A;  3F2B A;  1U5K A;  3HOV H;  4A3C G;  3CPF A;  1VQK A;  2K50 A;  2N78 A;  4JV5 L;  3M3Y H;  4JI4 Q;  3PO2 H;  2VS1 A;  4XIG S;  1UE5 A;  3U4Z A;  1VQB A;  4DAM A;  1KHI A;  4JI0 Q;  2UUA Q;  3OYY A;  4A3K G;  1VQF A;  4Y52 H;  2BA1 A;  3CAM A;  4DR7 Q;  2K4K A;  1IBM L;  1EQQ A;  1XPR A;  1C0A A;  4AQY L;  4NXN L;  1IXR A;  4JG2 A;  2VQE Q;  2A8V A;  1M90 C;  5FJ8 G;  1YZ6 A;  4GN3 B;  4A3F G;  2E2H H;  2JEB I;  4AYB E;  2R92 H;  4DUZ Q;  4DR2 Q;  5IYC H;  3CCS A;  3S1Q H;  4X66 L;  2JA6 H;  3ERS X;  4DV3 Q;  1TWA H;  1EIY B;  1S3O A;  4JOI C;  3B6Y A;  5M3M G;  4GLV B;  3U4V A;  1HH2 P;  4KHZ A;  4DUY Q;  4IPD A;  3G71 A;  3NEN A;  1XMQ L;  4JI5 Q;  3GTP H;  3TRZ A;  2CFM A;  2IHF A;  1L2F A;  1N33 L;  2AWN A;  2B63 H;  3TS2 A;  1JJG A;  1PFS A;  3S17 H;  4JYA Q;  1VQA A;  2K5H A;  5JJI A;  4JI3 Q;  3TRE A;  3K7U C;  1HNW Q;  2ZM6 L;  2XGT A;  2V1C C;  2BH8 A;  4KHP Q;  2JA5 G;  4NXM L;  2JJQ A;  1XNQ Q;  2UUC L;  1JT8 A;  3JAM c;  2VQF L;  4IO9 A;  4X6A H;  1HZB A;  1J5E Q;  2D0P A;  2ES2 A;  2WFW A;  4JI6 Q;  4MNO A;  2IX0 A;  3CC7 A;  2DGY A;  1P16 A;  2UUB Q;  1VQ4 A;  5IE8 A;  2PNH A;  4QQB X;  3E9H A;  4IOC A;  1J6Q A;  3EN2 A;  1Q7Y C;  1N34 L;  3JAM i;  2AMC B;  4EQ5 A;  4DR4 Q;  3GD7 A;  3S15 H;  3STB C;  1B8A A;  4DV6 L;  2EXD A;  1N36 L;  2GVB A;  5M5X H;  1Y1V G;  4BBR G;  2XTI A;  1I5F A;  2NZH A;  4DR5 Q;  4GKK L;  4LFB L;  3HFZ B;  3M7N A;  5IP7 G;  3UE1 A;  3PO3 H;  5IT9 c;  2RHS B;  4LF7 L;  4YHH L;  4JI1 L;  4LF9 Q;  1BKB A;  3HOZ H;  2Z0S A;  4YWM A;  2YTV A;  1QVF A;  3BJU A;  2IY5 B;  4APV A;  2JA9 A;  1VQ5 A;  1SRO A;  4X65 L;  2F4V Q;  2VNU D;  1N32 Q;  1RIP A;  3AFP A;  3I4M G;  2QGQ A;  1XNR Q;  2HIX A;  1Q81 C;  1I3Q H;  4BBS H;  4UY8 C;  4AYB G;  3MEF A;  1PHJ A;  4GKJ L;  1CUK A;  2R93 G;  3T1H L;  2QA4 A;  4DR3 L;  1VQO A;  4L5R C;  1WJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...