3S9WA

Crystal structure of staphylococcal nuclease variant delta+phs m98g bound to ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS M98G bound to Ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
rcsb
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3s9wA00
1F2MA 2PZTA 1F2ZA 3HEJA 3EROA 4PMCA 5JAVA 1STAA 1TT2A 2EYOA 5E1FA 4F7XA 1KDAA 1A2TA 2F0OA 5C5LA 4EQNA 1KABA 5HGTA 2F0IA 5IGGA 3VA5A 1F2YA 5IGCA 1SYBA 5NUCA 3R3OA 2RBMA 4RKBA 4G57A 5KYIA 4R8NA 5KRUA 3TP6A 1TQOA 4EVOA 1SYCA 2RKSA 4QMGA 3SXHA 2ENBA 3NQTA 1NUCA 2F0FA 3LX0A 2F0HA 1SNOA 4N9PA 4NMZA 4QB4A 5CV6A 4ZUJA 3TP8A 4WORA 2EY6A 1RKNA 2F0WA 4KJOA 2EYLA 4K2LA 2F0LA 1EY8A 3SK5A 4F8MA 4DGZA 3S9WA 4KHVA 5CV7A 4ID6A 5EKLA 3SR1A 3V2TA 5J22A 2LKVA 5C5MA 5K5PA 3ITPA 4K6DA 3SK8A 3D4DA 3OWFA 5EKKA 1SNPA 3RUZA 4J1MA 5C4ZA 1SYDA 2SOBA 5CC4A 1A2UA 1EY0A 3HZXA 4J6HA 5I9PA 3BDCA 1EY7A 3H6MA 4KY5A 2F0SA 2EY2A 2NUCA 4HMIA 2F0VA 1KAAA 1JOKA 2F0MA 4OL7A 3SK6A 3QOLA 2EY1A 4ZQ3A 1SNCA 4DU9A 5C4HA 5M9OA 5ISRA 5CV4A 4WRDA 4K5XA 2KHSA 4DF7A 1IHZA 2M00A 2O4XA 1EY9A 2HQEA 2PZWA 2SNMA 3NHHA 3NP8A 3NXWA 4HMJA 4K14A 3T13A 1JORA 1JOOA 4ODGA 1SYEA 5CV9A 5KGUA 4B9WA 5IIFA 5KEEA 4K2KA 4NDXA 4KY7A 1EZ6A 1ENCA 4IUNA 4K8JA 1SNMA 5J1ZA 5IGEA 2F0EA 2QDBA 5C3WA 5KYLA 1ENAA 3NK9A 3DMUA 4ME5A 4IALA 4NKLA 4ZUIA 5CGKA 2F0TA 5IGDA 1EZ8A 2PQEA 5DAUA 2WACA 5JOBA 4DFAA 1EY5A 1STHA 3T16A 1A3UA 2F0GA 1STYA 3D4WA 1EYDA 4H7BA 1KDCA 1EQVA 1JOQA 1EY4A 2EYHA 2PYKA 4PNYA 2EYMA 3SHLA 5C6AA 1A3TA 2F0DA 5IGFA 2F0UA 5F2DA 5I6WA 1U9RA 4K8IA 4PMBA 2F0KA 2F3WA 3QB3A 4TRDA 5CR3A 2KQ3A 3EVQA 2EYPA 3ERQA 4I65A 1NSNS 5KIXA 3DHQA 1EYAA 2EXZA 3P75A 5E3FA 4EQPA 2F3VA 2EYFA 2F0PA 4RKLA 1SYFA 4B9XA 5EGTA 4K5WA 3OMGA 3BDLA 2F0QA 3TP5A 5DEHA 1STGA 3C1FA 4E6IA 4K5VA 3U9OA 2PW5A 5IGBA 2RDFA 4KD4A 5I6YA 1KDBA 2F0NA 4N9TA 1STNA 5I9OA 1EYCA 5J39A 1II3A 4MIUA 3MVVA 4QF4A 3MZ5A 3QOJA 4NP5A 4KY6A 2EY5A 5IODA 3MXPA 3SK4A 5IOCA 4KD3A 3OMCA 3TMEA 1EY6A 3EJIA 4HTHA 1TR5A 3PMFA 3C1EA 4KV6A 4S3SA 1STBA 3NUCA 3MHBA 4KJNA 3TP7A 1A3VA 2F0JA 3D8GA 5CV5A 4LAAA 2OXPA 4IZ8A 2PZUA 3MEHA 3D6CA 4EQOA 1SYGA 1SNQA 2PW7A 2OF1A 4KTAA 3E5SA 5CV8A 1SNDA 3OSOA 4YIJA 2SNSA 2OEOA 5C3XA 5HURA 3P1HA 2EYJA 1AEXA
chains in the Genus database with same CATH superfamily
5LMUL 4GOPA 3HEJA 1V1OA 3EROA 4XXEA 1I6VC 2JJQA 2BA0A 5E1FA 3M85A 5JPNC 1JC7A 1PH1A 1VQMA 5HGTA 1E1OA 2E2IH 3PO2B 5IGCA 4DA2A 2M2LA 4ZAIA 1IYUA 3CCMA 1IYJB 5FOBB 2NZ1D 2WB1G 3NQTA 1ASYA 3HKZE 3ERSX 1VQFA 1LT6D 2EYLA 2A68D 2L5TA 4XT1B 3H0GB 3S9WA 1TU2B 5JEAH 2G9HD 2K5WA 1H9KA 4RH6A 3F2UA 3H3VC 1MIUA 1X3EA 2UXDQ 4LFBQ 3HZXA 1VQ7A 3BDCA 5IP9G 1EY7A 3I55A 1N33Q 3N6RA 4HMIA 5L37A 3SK6A 1DOKA 4NW2A 4ZQ3A 3AEVA 4PZ6A 4A3KG 2M00A 1L1OB 1JWSD 1HNXL 1S5FD 2XWBB 1J9OA 1RHPA 1SXTA 4L5RC 2NN6I 4OWXB 2A69C 3BVMA 3BVGA 1YNND 2R61A 3M4YA 4BY7G 2JXMB 5KYLA 4LF6L 5HY6A 2B8FA 3HOXG 1CUKA 3UE0A 1TIID 4JW0A 3Q22A 1STHA 1QUQA 4GS3A 1STYA 2Z4IA 5GADC 1EQVA 4A3IH 1S5CD 1FR3A 3GTMB 3GQBA 1CA6A 4R8IA 3X3NA 3DXJC 3PIPA 4J15A 3DHQA 5CYUA 1SE2A 3KF6B 2NVYH 2IJ0A 1GHKA 3FEWX 4A3GH 3S2DH 4ZLTF 2R7ZH 2K7VA 3SE0A 2JA9A 1IL8A 2XSCA 4QF4A 5IODA 4GLXA 2EY5A 5IOCA 3L0OA 4DAPA 1H9MA 1SRUA 3PO3G 4DXFA 4GOPB 3K6OA 2F0JA 2OQ0A 3KLSA 3D6CA 2MJ8A 2VUMB 3HGBA 2PW7A 5CV8A 3S1RB 4A3BB 1IL2A 3BYTB 4EX5A 1G2SA 2ATWA 1X56A 2NZHA 1EIFA 1PH4A 5M5XB 3K57A 2XRSD 1L0WA 4A93G 2JP1A 3SXHA 2QEXA 1F9QA 2WKCA 1SNOA 3TP8A 2ALYB 4JOIA 3HOZG 1LUZA 2YTVA 1EL0A 2JA6G 4G4KA 1JB3A 4A75A 4XQQA 3TEHB 1X9NA 3B6YA 4IFDI 1PTOF 2L4NA 5C5MA 5K5PA 3KJOA 3M4QA 3HOXH 2EDGA 3OWFA 4PZ8A 5EKKA 1KRTA 1SYDA 1RTOA 3BDOA 3G7LA 2Z0SA 1GUGA 4B3RL 2KEDA 4X65Q 2H1EA 2CHBD 5ELDA 4RG1A 1KNAA 4OL7A 1NJIC 3VR6A 2L11A 1HPCA 4DV4Q 4B3TQ 3PIP3 3J81i 1IBKL 2PZWA 1FYCA 2Y0SE 2PNRC 2HQEA 1GUTA 1EUJA 4KK7A 3R93A 4XT3B 1S72A 1JOOA 1CA5A 1W6JA 4KI0A 1BOSA 3PO2G 4LK1C 2VQEQ 3MTSA 3MXGA 1I4HA 4ALPA 3A7LA 1J6QA 4ME5A 1H9SB 1YNNC 2PQAB 5CGKA 4B3ML 2KBNA 4DAYB 3U4ZA 5ELBA 3I4NG 4TKOB 1UEBA 3ND9A 4O42A 2ZJPA 3EIVA 3NTKA 1LTBD 2EYHA 4DV7L 4K8IA 3GTOB 3TZDA 1KXLA 1Y1VG 4OO1H 2DUDA 3BU2A 5IE8A 4XDXA 5E3FA 2JA7G 3M4OH 5G3LF 3RZDB 4A3EG 5EGTA 1SE8A 2OWOA 1A0IA 5LMNL 1D5XC 5BN3A 4RGTA 1EYGA 1XNQL 4EGVA 1EQQA 2K28A 4BXXH 2EIFA 2K5VA 3S17B 1TWCH 4QY7A 4WFN3 3PIO3 1QZGA 3PMFA 4Q5VA 3H3VH 4XIGS 3MHBA 1PRTD 1BVSA 2Z1CA 1Y1WB 1Y1VH 3K80C 4BA1I 2R92G 2A6HD 2I5HA 1WOCA 4QQBX 3DWPA 3UI2A 4X3TA 1B3AA 4DK3C 4JI4L 2HDLA 1YJNA 4FVMA 1Y1VB 3T1YL 2QW7A 5LMNQ 1XMQL 1BKBA 3M7NA 5D3IB 1BXTA 3Q23A 1SN8A 2UU9L 1A6XA 4DUYQ 4KKUA 1R4QB 4N8FA 3PUXA 3HOXB 4QUCA 2BCOA 2AWOA 1HR0W 3MEFA 3L7ZC 3V96A 2N55A 4KJOA 5A2QE 4F8MA 4GLAC 1ICWA 4JI8L 4KHVA 4IFDH 1DONA 3I4MB 2MO1A 2A8VA 4LUZA 1EY0A 1HFNA 1TVXA 1VMPA 5JJIA 3KJPA 1SE4A 4LF6Q 1BCPB 1JOKA 3S2DB 1YITA 4R4TA 2F4VQ 2JA7H 3I3CA 1CT1D 1E7ZA 2ID0A 2A74C 2EJGC 1HQMC 3D6WA 4A3DB 1NR4A 2X6LA 4JI1L 5LHY1 2IX3A 1VMCA 2HQLA 3NBIA 1CZGA 4ZCKA 3EA6A 1YHQA 2LY7A 1ET9A 4JI3L 1JOQA 1J5EL 2HD3A 2F0UA 4AH6A 3CC4A 2N49A 2A6ED 1BR9A 3NQIA 5KIXA 3TSSA 1K9MC 2AQ2B 4IPDA 1CKNB 1FNVA 1ZYRC 4N9TA 2F0NA 2JA5H 2BOSA 2FXQA 3QOJA 4DK1A 3JAML 2IW3A 1EY6A 4HEDA 4HTHA 4KV6A 4LNQA 3NTIA 4IQZA 4UY8C 1STBA 3W3AA 2JQOA 2KUMA 1RJTA 1MHWC 1C7YA 4BA2I 2XNAC 5EKIA 4IJLA 3VA7A 2JYOA 5IT9c 3OSOA 1I3QB 1HFGA 3PUWA 2MQHA 2F1MA 3NBHB 1K8MA 3C3LA 4YHHQ 3HOUB 2EYOA 3OIPA 1TS2A 4C1NI 2A6EC 3KOJA 3I4MH 1UE5A 3CXCA 1ILQA 1SYCA 1PH2A 4OWWB 1PH3A 2EJFC 3M4PA 4DR6Q 2F0FA 2PMZE 4JI7Q 3Q24A 2DY8A 3I7FA 2QA4A 4DR4Q 1CQFA 4LJZC 1WJJA 1Y8PB 4ZYSA 1A15A 4L5TA 2E2JH 1OXXK 3I4NB 3PCOB 1TY2A 2R93G 4J1MA 1F9SA 1KAWA 2SOBA 4J6HA 2BDOA 3HS0C 4R4QA 1Y1WG 1E3PA 1QB5D 2AKWB 3LGJA 2FINB 1MD2D 1V9PA 3D0FA 2MFIA 4GN3B 5ISRA 2CVRA 2UUBL 3S15H 1PFNA 4I65A 3SK5A 1EY9A 3A55A 4QCLA 4K14A 5C0XG 4TSSA 4BBRH 2L0CA 2ZTDA 3QR8A 5IIFA 3HRZC 5C44G 1VCIA 2PO4A 2F0EA 3ICEA 2I5MX 2O5JC 2NN6H 3CCRA 3CMAA 1DYQA 1W6KA 1GUNA 2JSOA 1X3QA 1B53A 5F2DA 5I6WA 4G7ZC 1AE3A 2OCEA 1CSPA 1TS3A 3VDYA 2Y0SB 3CKIB 3ZJYC 2ZM6Q 2V4DA 3FKIB 1SYFA 1MSGA 2NVTH 1Q82C 1M8AA 4E6IA 3GTKH 3M3YB 1XMOL 1LABA 4YHHL 2J4XA 5BN5A 4ZK9B 1L2FA 3D4RA 2RSOA 1PRTC 4F88A 4RA8A 4S3SA 2WAQE 3C1EA 5IT9E 1PDQA 3TP7A 4HSPA 4Y7NB 1KC8C 1X3GA 1V1PB 4O2DA 1K83H 2B39A 3HOWH 3E9IA 1B7YB 2B63H 4KTAA 1JT8A 1Z9FA 1ZXTA 5C3XA 4PQXA 2Z4HA 5EBDA 2J7ZA 2GVBA 1HH2P 3NPPA 1STAA 2F4VL 2KCMA 1TWGH 5C44H 1D8LA 2MO0A 2WINB 1SYBA 5ELEA 5EJWA 3R3OA 3OTOQ 4RKBA 4JI6L 1XNQQ 3KLWA 2O5IC 4C3IH 3UE1A 2UXBQ 3S17H 4ZUJA 1TWCB 2K4KA 2UXBL 4ABNA 4LF4Q 3MXUA 1HNWQ 2B2VA 1KNEA 4L63B 4C3IB 2VUMH 1BDOA 2WAQB 1O7YA 5EBCA 3RUZA 3G4SA 1CKNA 1LTAD 2YTYA 4FP5D 3OWEB 1ESFA 4BY7H 3OW2A 4YCUA 3PO3B 5CMDA 3IL8A 5I9PA 4BS9A 1QVFA 3PSIA 3DWQA 3TQYA 2CW0D 1EIGA 1EQTA 1WTQA 1KLGD 4RCNA 3I4OA 1RL2A 4WRDA 4A3KH 4YCWA 3NHHA 4L8JA 5ELFA 4HMJA 3C2PA 3I72A 3CPWA 1NNXA 4Q0FA 1XTDA 2K75A 4QIWE 4DV4L 4B3TL 3CCUA 3S24A 1D1IA 2D62A 1I94Q 3I73A 4JYAQ 4KKTA 1XNRQ 1STEA 4WJWA 2DGYA 3RLFA 3IAYA 2HIXA 1EYDA 3T1HQ 4PNYA 2PI2E 5KNCA 3JC66 4JI2Q 1U9RA 2B2WC 1V8QA 1H9SA 4C3IG 2UXCQ 3NENA 1OXSC 4HJAA 2WB1B 2EXZA 1SLJA 1EOTA 5C4XB 1B9NA 3VR2A 3BDLA 2F0QA 2I5LX 4K5VA 2IX0A 4RGMA 5I6YA 1SFOH 4AYBE 2PPBC 1VQEA 4DR2Q 2ZTEA 3N52A 5C4XH 5M3MG 4FNFA 3RD4A 1HZ9A 4UDUC 3PGZA 4OEMB 4L6TB 4P74A 2A68C 4B3MQ 1HNXQ 2NBFA 1EWCA 4PZ7A 1PRTF 1WFQA 1SNQA 1WYDA 3CQZB 3J7AV 3H3VI 5LL6X 3J81E 1YJ9A 1QNKA 4DR1Q 1VQ5A 2CWAA 1B44D 2EXDA 1GJXA 1D5ZC 5FLMH 3CQZH 1VQHA 3WWVA 4MHEA 1IBKQ 4HCSA 4POGA 1WTRA 2QF7A 5FLXL 4A3IG 1HA5A 5M5XH 1SSOA 2I46A 4DU9A 2ICEC 2DNCA 2RVLA 1VQCA 1LM0A 1U5KA 4DV6Q 4DR1L 1XXGA 2KVMA 1FGUA 1GD7A 2N88A 2IHEA 3UDXA 1AW7A 1VS0A 1AZPA 3CCQA 1BUVT 1QVCA 4MZ9A 4FF4A 3W5OA 4A3MG 3LWUA 1YIJA 3GTMH 3R8BA 4OELB 1LACA 2EY1A 4U68A 1HQRD 2ICIA 3J80E 4DF7A 2ZJQA 3ZYYX 4HJ7A 5A35A 2QILA 1YHBA 1Y8NB 3AYHB 3R2TA 3PO2H 1EZ6A 2VW9A 1ENAA 1VQGA 3BZCA 1YEZA 2F0TA 2K5DA 5EPKA 3AFQA 4P71A 3PUZA 1ET6A 4NXMQ 2MUYA 2JK8A 4HIOA 5CR3A 2WAQG 2AUKA 3CHBD 4FDBA 1YI2A 4V190 1LLRD 3F2CA 1UUPA 1SMYD 3G6JB 3S15B 5LMNW 2LFNA 2HDMA 1EQRA 4BWGB 3BJUA 2I0QA 4R4CA 4HIKA 3X3MA 1PRTB 1SMYC 1EU3A 4MIUA 3DM1A 4LUVA 3MZ5A 4RCOA 1CM9A 1Y1WH 3ULJA 1LYLA 1X3FA 1VQ8A 5A2QL 4HIMA 2D2CC 4FF2A 4UP8A 2HHHQ 1GUWA 4C56C 1SYGA 4OHJA 4RGOS 4KMUC 4BBRG 5C3EH 2O2LD 4K0KL 2K6AA 1Z7TA 1S3OA 1F2ZA 3I90A 2ASBA 5C5LA 1Q1EA 1LTID 4AQYQ 5IGGA 3VA5A 1QWYA 4JI0Q 4TVAB 5GAEC 3SEBA 4R8NA 2Q2IA 4HAEA 4EVOA 1GOZA 1HTPA 4GNXB 5CV4A 2F0HA 4HSVA 1Q86C 1I3QH 1UE7A 3I4LA 4HR7B 1RKNA 4IOAA 1UE6A 3G71A 2R92H 5KNDA 4QUFA 1QJOA 3V2TA 3D4DA 1LTLA 2WFWA 4KHPQ 3MFGA 5CC4A 2HT1A 4FYDA 1IBML 1T5XD 2EE1A 3J80c 5C4JB 1CSQA 1HZCA 2K5NA 4LMQD 1Q8KA 1RF2D 3HOZH 2VZAA 3S1NH 1DM0B 1L1OC 4LFCL 3RN5A 1VQAA 1LTSD 3NXWA 3GP7A 1TWFH 1EU4A 1C48A 1VQ6A 1JJ2A 4B3RQ 1PYBA 3GTLH 1MKHA 1NMGA 4K2KA 2N3SA 2LMCB 4IUNA 1SNMA 1A8VA 5BR8Q 3CU7A 3I4NH 4TQUS 5CORA 5IGDA 1ASZA 4J8QA 4IO9A 2EPBA 4CKEA 2VQEL 1Y69U 3D4WA 2R7FA 1AN8A 1EFWA 4LFCQ 1G2TA 2F4IA 1CI3M 2LS01 3SHLA 1HUNA 4GNXA 4PMBA 2L12A 1E1TA 4RAUC 4IUPA 4FXDA 3P75A 1JWMD 1Q46A 4K5WA 3BZKA 3HOYH 3T53B 2JA8G 4K6LA 1UAPA 4M1UB 3S1QH 1QG7A 1SJED 2KEEA 2HCIA 4BY7B 2N78A 4A76A 1MSHA 2JN4A 3DUZA 4JI5L 3E0EA 1VF7A 3D8GA 2K05A 2UUAQ 3MC0B 2DJFC 1Q1BA 4LW1A 4P72A 4X64Q 1Q90A 1K73C 1SNDA 4A3KB 4IFDG 1TWHB 2SNSA 2Z8LA 1HHVA 3U58A 3PQIA 3W2DA 1DOMA 2Q8IB 4F7XA 1I4PA 1KABA 1QE6A 4ME3A 2Q8RE 4CJ0B 3HOVG 2R93H 5M5YB 1YZ6A 2KHIA 3J81c 1HNZL 1O78A 1W3SA 2QDLA 1WD1A 5IYDG 1TQOA 5ELOA 5EPLA 3T4AC 1RODA 1F9PA 3MXNB 4A3FB 1K8AC 3RLNA 3Q0AA 1TS4A 1LT5D 1BBWA 4XTCS 2HUGA 1B9MA 4DR7Q 5J22A 1D5MC 4DN4M 1N32Q 1IZ6A 3RZOB 2G9DA 5JVH3 1VQPA 4GKJL 1FJGL 4FXKC 1VQLA 3K5OA 3CCVA 1PLFA 1SFOB 2IHFA 1N34L 4O0AA 4IJHA 4K5XA 3URYA 3NP8A 2E5LQ 1AZQA 4UP9A 5D14A 1IKMA 1EFID 1H95A 2E5LL 2YV5A 3KF8B 4A3CG 1Y8OB 2QKIC 4B9WA 3HOVB 2XN9C 4CJ1B 5JVG3 2JA6B 3CCLA 4NKLA 2RCNA 2DN8A 3F1ZA 1VQBA 2PQEA 4K0KQ 1YNJD 2RHSB 2Z6BA 3I4MG 4H7BA 4DV7Q 1SJHD 4LF5L 4B3SQ 4CKBA 2HHHL 2UUAL 4JBWA 4YY3Q 1JJGA 3VR4A 3I2ZA 3STBC 4JI5Q 4A3LG 4DV2Q 4GN5A 1UEAB 3L3OC 1WVLA 4HJ5A 4A3IB 2B2YA 1VQNA 4X3UA 5LMUQ 2E74C 2RDFA 3ULLA 3VR5A 4KD3A 1I4QA 3E3XA 3TMEA 2UUCQ 3SDZA 4DXGA 3STBD 2WV6D 4CKCA 3TZUA 4IZ8A 4A3LH 4A3JH 1JCKB 1TY0A 3EBEA 2ES2A 2BH2A 5COYA 3KF8A 1AEXA 1HCZA 2PZTA 1N8RC 3NWTA 4A3FH 2XTIA 4A3JB 1KDAA 1A2TA 3CMEA 1CK1A 4IPGA 1FNWA 2DNEA 4A3DH 3CW2C 4H02A 2ZT9C 3AU7A 1X6OA 2RCFA 4GZYC 2EY6A 4OO1I 2BE5C 1XMQQ 4DGZA 1TWAH 2H5XA 2K50A 1PMRA 3SK8A 4DNRB 1PTOB 2KA7A 2K03A 3FVQA 5M3FH 3HP3A 3IFTA 3M7GA 1EEID 1W2BA 1BCPC 1WI5A 3NE5B 3FMCA 2B2VC 2Q8TA 3FDTA 4YY3L 1PYWD 4R4OA 5C4HA 4H44C 4IUTA 5HGQA 1IYVA 3ND8A 2O4XA 4CDFC 2PQAA 2XIWA 3TBIB 2YYZA 1FVIA 4ZRZA 1B2TA 1X65A 5C0XH 4LF7Q 1DD2A 5G3LD 3W1BA 3KUPA 1S5DD 3R2IA 2B2UC 3GTGB 1C0AA 3HKZB 1SAPA 4DV0Q 1IKLA 1GVPA 1GUOA 3A8KE 3A74A 3K58A 1M90C 1U4PA 4DK0A 2NTSA 1PH5A 1QZHA 1YNJC 1EIHA 4JCVE 3MXNA 5IYCH 1I4XA 2F3WA 2P5ZX 4JG2A 2UUBQ 2F0PA 3CPFA 4B08A 2EOTA 2R6GA 4C3HG 5FLMG 5DNFA 1CQVA 2F3IA 2RSNA 4YWLA 3K0YA 3HOYG 4CHTB 1NAPA 4JV5Q 3MVVA 1S4ZA 3PUYA 3A8IE 1DGSA 3UDGA 3S14H 4XQJA 5BR8L 4LAAA 5FK9C 2E2IB 2B8GA 4DUZQ 4FXGC 1LO5D 4YIJA 1S5BD 1Q81C 1GKHA 2V1CC 1I94L 5JAVA 2B2YC 4EQNA 3TS0A 4DV5L 2VY3A 3T1YQ 5JEAJ 3KFUA 3HOVH 2B2TC 4M8AA 1BBXC 2X69A 3K7AB 1SR3A 2H4OA 2WIIB 3TS2A 5J3BA 1L0XB 4N9PA 1MI2A 1N36L 2WP8J 5IP7H 4K2LA 3O13A 1YBYA 5JJZA 1HA6A 1M4VA 2L1BA 1D2BA 1I4RA 4G7HC 4P2CB 4A4IA 4A3EB 3J81j 3NELA 4XYOA 4CJ2C 5JJLA 1KD1C 3UDFA 4WJ4A 2ZXOA 3CC7A 2K01A 3HOUG 1PH7A 2F0MA 4GNXC 1PZKD 5IT9L 1V1PA 3M3YH 3GTKB 3KLRA 1U4LA 4F87A 2K52A 5IP7G 2GN5A 1AH9A 5IYCG 5TSSA 3FHWA 1TXYA 2Q2HA 4OONA 2B63G 1BF4A 1AP0A 4KY7A 3CP0A 3MWYW 2OTJA 5J1ZA 4CDCC 5IGEA 3IFDA 3J80i 1DXMA 4RMFA 1EZ8A 5JOBA 1D1KA 1EY5A 2FMMA 1KDCA 3JAME 4WJ3M 3M4OB 3H0GG 3GTLB 3GD7A 3QB3A 3EVQA 2UUCL 2XVSA 1WD0A 4RKLA 1VQIA 4DK6C 1KLUD 1HJPA 3S16B 5DEHA 1STGA 1NY4A 3J7ZC 5IGBA 1G91A 1JICA 1EYCA 1II3A 4N8X1 2J0TD 3RMHA 4JPBW 4BBSB 2NVQH 3VR3A 5E7NA 4JOIC 4LF8L 5I2XA 3MEHA 1PVOA 1Z6HA 3OYYA 5D65A 4LF5Q 3RR5A 1DJRD 1XNRL 1EWHA 4R9WA 3VYRA 1SBBB 1GO3E 4DR2L 4X64L 3PF5A 1IBLQ 2F0IA 5DM73 5IYDH 2RBMA 2K33A 3A5UA 3DWAA 4A93H 4KHZA 3MAQA 2KCNA 1E22A 3S1MH 1D6EC 1K3BC 4MTKA 2AWNA 3CD6A 3GTQB 2CH4W 4YWMA 1K0SA 1EY8A 3ONAB 4AIMA 5CV7A 3J7AF 3HFZB 3GTPB 2RDGA 1IBLL 1UWVA 1QVGA 1N36Q 3AMUA 1Q3LA 5C4ZA 1QOHA 2KCTA 4DV1L 4DR7L 4KY5A 4OIJA 1R9TB 3CC2A 3GTJB 3L9AX 2NUCA 2KJXA 1WCMH 4LF4L 5FLXE 1SNCA 2QEJC 3VYUA 1JB7A 4JI3Q 3HOWG 4A3BG 2Z9HA 4DR6L 5IYBH 4ILWA 4I7AA 1V1QA 1HZAA 5EPJA 3T13A 4ODGA 3IRBA 1N34Q 2MHVA 4C3HH 5KEEA 3GTOH 2CKZB 4K8JA 2XWJB 1E2WA 1O7ZA 4I7ZC 2VB3X 3DMUA 3RNUA 4LFAL 1JWUD 1K28A 1BNZA 1A3UA 1VQKA 4JV5L 5JJKA 2KOLA 3QO2A 5FO8B 1LTGD 2K04A 4A3JG 4OWTB 4RGNA 5EQ0A 1EYAA 3AB9A 3QWNA 3OMGA 3S1QB 2CH4A 2YU9B 3G48A 3P7JA 1LT4D 4JBKA 3OPOA 1WTHA 5J39A 1STNA 2RDHA 1ILPA 1K8GA 4RWSC 1WTOA 3GDEA 3UDIA 3EJIA 1XYIA 3RN2A 5AJ3Q 1V43A 2OTLA 3KLSX 1EEFD 5CV5A 1J5EQ 4C3JG 3A5ZB 5T1IA 1B1ZA 3E5SA 2OEOA 2EYJA 1G8ZD 3P20A 5JEAG 1SROA 2F0OA 2NN6G 1VQ9A 5NUCA 3ULPA 5KYIA 1B70B 5GAHC 5KRUA 2B2WA 3TRZA 1YHAA 3K0XA 2E2HH 5FJ8G 4APVA 4ZUIA 4GKJQ 2MGSA 2KHJA 1C8CA 1JJCB 1CKMA 1CFMA 2CW0C 4IPCA 1WCMB 1E2VA 2F0LA 3HKZG 1JE4A 3S2HH 2L15A 2QCPX 2NVXB 2E2HB 2LSSA 1ZYRD 4POFA 1BCPD 1RIPA 3BS1A 1I5FA 4YCVA 5IP9H 1YNXA 5M3MH 5C4XG 4X66Q 3KYHC 4X6AH 1XX8A 1T5EA 2R7ZB 2RHQB 1CKOA 4C3JB 1HUMA 3OTOL 1RCVD 3FKIG 2NB0A 3D31A 3HG9A 2BE5D 2JA8B 3D3RA 1ML0D 3HOYB 1JORA 3TN2A 4X3SA 1QUQB 4XYQA 5M3FB 4AQYL 4DAMA 5C3WA 1PTOC 2YTXA 1U0LA 2CQOA 1XWEA 4IALA 4IURA 3A54A 2WKDA 1OXTA 5DAUA 5C0XI 2FMCA 2FHTA 5AJ3L 2YU9H 4L5QA 1N32L 2EZVA 3FKIH 3KF6A 3FPPA 5IWAQ 1A3TA 2NVTB 2HIVA 1GXDC 5IYBG 3T51B 4MNOA 1CHQD 2LXJA 1P8LA 1X3PA 4GKKQ 2GA4B 5M5YH 1PTOD 2JEAI 2A6HC 3Q8DA 3A7AB 3K8AA 1O80A 4OIKA 2CFMA 4ZKBB 4R1JA 3HOZB 3HOWB 5M3FG 3CAMA 4ULLA 1BCPF 3Q6SA 3BVZA 2C9OA 4IUQA 2F52A 4IN3A 2AUJD 1GM5A 3FP9A 1C9OA 5GAGC 2BH8A 5FLXc 3SGIA 4DR5L 1PHJA 4X65L 2VL6A 4KN4C 1TWGB 4EQOA 5C44B 4JI7L 1PFMA 4IPHA 1H9RA 2OF1A 5DM63 4QGUA 1HR0L 2K14A 4A3GB 3P1HA 1Q12A 4PMCA 1EWIA 1CHPD 1MJEA 3LNNA 4H0LC 5KNBA 3E0JA 1JE5A 1HXYD 4NB3A 4V0BA 2SEBD 1VQJA 1SMXA 2A73B 1TWFB 4C3HB 4G57A 2E2JB 1QCBD 3TP6A 1R4PB 2ZXRA 2ENBA 1I6HH 1K8OA 3LX0A 2I07B 1GUSA 1L0YB 2B3GA 4QB4A 3H0GH 5GROA 4BY1H 1E0BA 1FGBD 4GLVB 4DR5Q 3GO5A 4P73A 1C4QA 1RDPD 3M9BA 3SVMA 2Q2UA 2JA6H 3T56B 1I6HB 3I70A 3DEOA 2K32A 1PXUA 1T9HA 1NE3A 2IY5B 1IXRA 4BBRB 1KHIA 2KECA 1K3RA 2FFKB 1KAAA 4FO2A 5C3EB 5M9OA 4X62Q 5FJ8H 2EJMA 3KBGA 2KHSA 3J7A5 3K7AH 3RLOA 3U50C 4C1NK 1VQDA 1Y14B 1FJGQ 4A93B 5CV9A 1MBYA 1Z47A 3J80L 1HZBA 4DR3Q 2EQSA 3I56A 4UP7A 4A3FG 1JR0D 3K5MA 2KENA 3EQLC 2BA1A 3WOEA 4PMWA 5H1SE 4JI4Q 4MTNA 3GV6A 3CCJA 3T16A 1A63A 2F0GA 3GTGH 2R92B 2R3ZA 1EY4A 3BYYB 4DNIA 1WTXA 2AHOB 2VQFQ 1WCMG 1I50H 4HJ8A 2F0KA 1OXUA 4IUUA 2C35B 4LFBL 2R93B 4B3SL 1RD9D 3RZOH 1NBWA 4B9XA 4PG3A 3I8ZA 3BZDB 3TP5A 3IKJA 2K5HA 1HTLD 3JAMi 3F8TA 4JI0L 3DLLA 2B63B 3PUVA 2IL8A 3MXPA 2CQAA 3SK4A 3WDNA 4LF7L 1TR5A 3NUCA 1XPUA 1F2LA 2JEBI 2RA4A 4UPAA 3H15A 1WTPA 2F03A 1TWAB 1O7LA 1CTMA 4H13C 5FO7B 1Q7YC 1ZKOA 5HURA 5D3DA 1B3QA 2R7ZG 4Y52H 2A1AA 2RF4A 4MN3A 4BY1B 3RZDH 4KN7C 2WB1E 2IT1A 4Z9CB 5E4XA 1MGSA 1FNUA 3CCEA 1E2ZA 1SEBD 2Z6KC 2LXKA 1B4OA 3KK7A 1G6ZA 1NUCA 2JA5B 3EN2A 4O1NA 3DEPA 1YVCA 2Q2TA 1QILA 2E2DC 1N9WA 2NYZD 3DM3A 5AFWA 1RTNA 4LFAQ 1N33L 5EKLA 2LKVA 1HNZQ 1WTVA 3PV0A 2A69D 3VYTA 3J81L 2C5CA 2PMZB 3A56A 4HN7A 3W1GA 1A2UA 3QG1A 1OO9B 3MA2B 1S5ED 1B50A 3OOCA 2NZOA 3HOUH 5C0XJ 1VQOA 1BO0A 1X54A 3H09A 3K81C 2E76C 1SDFA 1IHZA 4PV1C 2SNMA 4JC0A 1LT3D 2X6GA 3OHXC 1TS5A 2D0OA 4IUVA 2MPMA 1I50B 1O7IA 4NDXA 4LF9L 4OGQC 2VS1A 1PH9A 2QDBA 2N8NA 3OW7A 1H9JA 3ER0A 4A3GG 1XMOQ 5K36H 3I91A 3H94A 2CWPA 1ICFB 3OIQA 1KL9A 2CCZA 2PYKA 5C6AA 3TDQA 2F0DA 5IGFA 1NCVA 1CZWA 1G51A 4L5SA 4TRDA 2KQ3A 2EYPA 3ERQA 1NSNS 3K5LA 1U4MA 4A3CH 2ZXPA 4ZKCB 2IX1A 2A19A 2DJGC 1X55A 2JA8H 2NVXH 3GV3A 3S2HB 3NSWA 1F9RA 5FKAC 4KD4A 1KDBA 4UAIA 3PIOA 4OX9L 4KY6A 1WTWA 2ZJRA 5CBAE 4DKAC 1XTCD 2PI2A 5EAYA 1OXVA 3V05A 2VQFL 2SDFA 4FF3A 2PZUA 5C3EG 3CF5A 3CRLC 4DNTB 3E9HA 4X3KA 3OMCA 3LWEA 3VYSA 1E24A 2D9UA 2HCCA 4AYBB 1IBMQ 2TMPA 1TT2A 5IY0A 3A8JE 3QJYA 3L2PA 4DR3L 3NWSA 2RQXA 3WOFA 2RKSA 1AE2A 4RFBA 4RHSA 4CDDC 2QGQA 4NMZA 1BBUA 3AQQA 1FL0A 3JAMc 1P16A 4WORA 4X62L 1PH6A 3H91A 2R7DA 2E75C 2NVYB 3MFYA 2KCCA 4QL5A 4DV0L 2MNAA 1ZEQX 3SR1A 4JI2L 3K59A 3ITPA 1UE1A 4K6DA 4DV6L 3QIAA 4P75A 1K83B 2VXWA 3F2DA 1I4GA 2Y0SG 4RHRA 4QIWB 1NTGA 2F0SA 2EY2A 5K36G 4AYBG 2VNUD 2F0VA 4NXML 2JA7B 1EOVA 1PFSA 2PNHA 5T1GA 1TKWB 2JE6I 3S1RH 4A3BH 4IOCA 1QNUA 5C4JH 4JVZA 4OO1G 4BY1G 4DAYA 1SYEA 3HKSA 1LV9A 1KRSA 1PFBA 5M3MB 2GVAA 3E6ZX 5BN4A 4BBSG 2E8GA 2L9HA 4XQNA 3F2BA 3NK9A 2B29A 1VDZA 1KTKA 3PF4A 1ENFA 4LF9Q 2EYMA 5LL6S 1JQYD 1NMFA 3PO3H 1XJVA 1J8IA 1PTOH 4NPSA 1M1KC 2NVQB 4EQPA 2B2UA 2XRQD 3FPUB 1AFPA 4A3MB 4DV2L 3C1FA 3U9OA 2ZM6L 2PW5A 3C46A 3U9SA 1G6PA 2VB2X 1Q8IA 2NWGA 1PA6A 1HR0Q 4GKKL 1SE3A 3FRPB 4NP5A 5GQOA 1DZ1A 4JI1Q 4A3MH 3K7UC 1U4RA 1D7QA 3CRKC 4HJ9A 4DV1Q 1KIXA 4X66L 2G5DA 2OXPA 1L1OA 4DAVA 1G291 3NTHA 4QJFA 4KJNA 3S1MB 1PYSB 1PZID 1GHJA 3G6EA 3GTQH 1F2MA 5I4DA 4HCEA 4BXXG 4IFDJ 3GTJH 1R9TH 4KHPL 1F2YA 2A5HA 1ONLA 4Y7NH 1F77A 1B8AA 4CDEC 3KDFB 1BQQT 4QMGA 4A3DG 5CV6A 5M5WB 5IWAL 2FJ2A 4GN4B 1VF5C 2F0WA 2UXDL 2L55A 5ELNA 3S16H 4R4IA 4JK1C 4ID6A 2EVBA 4DUYL 5M5WH 1NR2A 2OQKA 1X32A 2NTTA 4DV5Q 1SNPA 2ZTCA 1A62A 1MJCA 2VUMG 1HRJA 4BBSH 3S14B 1KQSA 4LF8Q 4JI8Q 3H6MA 2UXCL 2XGTA 3CCSA 1UNSA 3QOLA 3EFXD 4HIDA 2MP1A 4OXPA 5I2YA 2BDNA 4DUZL 1DOLA 2AMCB 4C3JH 4OX9Q 3U4VA 4LWCA 4NXNQ 1DCZA 2Z6KA 4JYAL 2D0PA 2B2TA 3AFPA 4G7OC 5KGUA 2UU9Q 1PV4A 5CBEE 5ELCA 1LTTD 4DPGA 1ENCA 1OTCA 3J7YW 3K5NA 3KBXA 4LUOA 4C2MH 1IW7C 2K1BA 1ESRA 4KLKA 2WACA 2AQ1B 4DFAA 2IWHA 1EIYB 3KDFA 1XPOA 4DV3Q 4C2MB 4NXNL 2TSSA 4DR4L 4JI6Q 2PCFB 4JBJA 4A3EH 3GTPH 3T1HL 1JMCA 2F3VA 2EYFA 5FO9B 4CGYB 2DY7A 4U673 3NEMA 4CBVA 3BG3A 3TREA 1FD7D 5E4WC 5I9OA 1HNWL 4GOPC 2JA5G 1S40A 1XPRA 1TWHH 2M9VA 4DV3L 5JPMC 2IPKD 2AQ3B 1VQ4A 3NBHA 1PZJD 4EQ5A 4FF1A 1LTRD 2K5QA 1A3VA 5DLQE 4YWKA 1K0RA 1PH8A 4JBMA 3A0JA 2D5DA 2OT2A 1YJWA 4UHVA 4KKSA 3S1NB 1IW7D
chains in the Genus database with same CATH topology
3HEJA 1V1OA 3EROA 4XXEA 1I6VC 5E1FA 2BA0A 3M85A 5JPNC 1JC7A 5HGTA 3PO2B 5IGCA 4DA2A 2M2LA 4ZAIA 1IYUA 5FOBB 2NZ1D 3NQTA 1LT6D 2EYLA 2A68D 2L5TA 4XT1B 3H0GB 3S9WA 1TU2B 5JEAH 2G9HD 2K5WA 1H9KA 4RH6A 3F2UA 3H3VC 3HZXA 3BDCA 1EY7A 3N6RA 4HMIA 3SK6A 1DOKA 4NW2A 4ZQ3A 2M00A 1JWSD 1S5FD 2XWBB 1J9OA 1RHPA 1SXTA 2NN6I 2A69C 3BVMA 3BVGA 1YNND 2R61A 3M4YA 2JXMB 5KYLA 2B8FA 1TIID 3Q22A 1STHA 1STYA 2Z4IA 1EQVA 1S5CD 1FR3A 3GTMB 3GQBA 1CA6A 4R8IA 3X3NA 3DXJC 3DHQA 5CYUA 1SE2A 1GHKA 2IJ0A 3FEWX 4ZLTF 2K7VA 3SE0A 1IL8A 2XSCA 4QF4A 5IODA 2EY5A 5IOCA 4DAPA 1H9MA 4DXFA 3K6OA 2F0JA 3KLSA 3D6CA 2MJ8A 2VUMB 3HGBA 2PW7A 5CV8A 3S1RB 4A3BB 3BYTB 1G2SA 5M5XB 3K57A 2XRSD 2JP1A 3SXHA 1F9QA 2WKCA 1SNOA 3TP8A 1EL0A 4G4KA 1JB3A 4XQQA 4IFDI 5K5PA 1PTOF 2L4NA 5C5MA 2EDGA 3OWFA 5EKKA 1SYDA 1RTOA 3BDOA 3G7LA 1GUGA 2KEDA 2H1EA 2CHBD 5ELDA 1KNAA 4OL7A 3VR6A 2L11A 1HPCA 3PIP3 2PZWA 1FYCA 3R93A 2PNRC 2HQEA 1GUTA 4KK7A 4XT3B 1JOOA 1CA5A 1W6JA 4KI0A 1BOSA 4LK1C 3MTSA 3MXGA 1I4HA 3A7LA 4ME5A 1H9SB 1YNNC 5CGKA 5ELBA 4TKOB 3ND9A 4O42A 3NTKA 1LTBD 2EYHA 4K8IA 3GTOB 3TZDA 4OO1H 4XDXA 5E3FA 5G3LF 3RZDB 5EGTA 1D5XC 5BN3A 4RGTA 4EGVA 2K28A 3S17B 4WFN3 3PIO3 3PMFA 4Q5VA 4XIGS 3MHBA 1PRTD 2Z1CA 1Y1WB 4BA1I 2A6HD 3DWPA 3UI2A 4X3TA 1B3AA 2HDLA 4FVMA 1Y1VB 3M7NA 5D3IB 1BXTA 3Q23A 1A6XA 4KKUA 1R4QB 3PUXA 3HOXB 4QUCA 2BCOA 2AWOA 3L7ZC 3V96A 2N55A 4KJOA 5A2QE 4F8MA 1ICWA 4IFDH 4KHVA 1DONA 3I4MB 1EY0A 1HFNA 1TVXA 1VMPA 1SE4A 1BCPB 1JOKA 3S2DB 3I3CA 1CT1D 2ID0A 2A74C 2EJGC 1HQMC 3D6WA 4A3DB 1NR4A 2X6LA 5LHY1 2IX3A 1VMCA 3NBIA 1CZGA 3EA6A 2LY7A 1ET9A 1JOQA 2F0UA 2A6ED 1BR9A 3NQIA 5KIXA 3TSSA 2AQ2B 1FNVA 1ZYRC 4N9TA 2F0NA 2BOSA 3QOJA 4DK1A 3JAML 2IW3A 1EY6A 4HEDA 4HTHA 4KV6A 3NTIA 4IQZA 1STBA 3W3AA 2KUMA 1RJTA 4BA2I 2XNAC 5EKIA 3VA7A 2JYOA 3OSOA 1I3QB 1HFGA 3PUWA 2F1MA 1K8MA 3C3LA 3HOUB 2EYOA 3OIPA 1TS2A 4C1NI 2A6EC 1ILQA 1SYCA 2EJFC 2F0FA 3Q24A 2DY8A 1CQFA 4LJZC 1Y8PB 4ZYSA 1A15A 1OXXK 3I4NB 1TY2A 4J1MA 1F9SA 2SOBA 4J6HA 2BDOA 3HS0C 1QB5D 2FINB 1MD2D 5ISRA 2CVRA 1PFNA 4I65A 3SK5A 1EY9A 3A55A 4QCLA 4K14A 5C0XG 4TSSA 2L0CA 5IIFA 3HRZC 1VCIA 2PO4A 2F0EA 2O5JC 2NN6H 1DYQA 1W6KA 1GUNA 2JSOA 1X3QA 1B53A 5F2DA 5I6WA 4G7ZC 1TS3A 2Y0SB 3CKIB 2V4DA 3FKIB 1SYFA 1MSGA 1M8AA 4E6IA 3M3YB 1LABA 2J4XA 5BN5A 4ZK9B 3D4RA 2RSOA 1PRTC 4F88A 4RA8A 4S3SA 3C1EA 5IT9E 1PDQA 3TP7A 4HSPA 4Y7NB 1V1PB 2B39A 4KTAA 1ZXTA 5C3XA 4PQXA 2Z4HA 5EBDA 2J7ZA 3NPPA 1STAA 2WINB 1SYBA 5ELEA 5EJWA 3R3OA 4RKBA 2O5IC 4ZUJA 1TWCB 4ABNA 3MXUA 2B2VA 1KNEA 4L63B 4C3IB 1BDOA 2WAQB 1O7YA 5EBCA 3RUZA 1LTAD 4FP5D 3OWEB 1ESFA 3PO3B 5CMDA 3IL8A 5I9PA 4BS9A 3DWQA 2CW0D 1EIGA 1EQTA 1WTQA 1KLGD 4RCNA 4WRDA 3NHHA 4L8JA 5ELFA 4HMJA 3C2PA 3I72A 4Q0FA 1D1IA 2D62A 3I73A 4KKTA 1STEA 4WJWA 3RLFA 3IAYA 1EYDA 4PNYA 5KNCA 1U9RA 2B2WC 1V8QA 1H9SA 4C3IG 1OXSC 2WB1B 2EXZA 1EOTA 5C4XB 1B9NA 3VR2A 3BDLA 2F0QA 4K5VA 2IX0A 4RGMA 5I6YA 2PPBC 3N52A 4FNFA 3RD4A 4UDUC 4L6TB 2A68C 2NBFA 1EWCA 1PRTF 3CQZB 1SNQA 3J7AV 5LL6X 3J81E 1QNKA 1B44D 1GJXA 1D5ZC 4MHEA 4HCSA 1WTRA 2QF7A 5FLXL 1HA5A 1SSOA 2I46A 4DU9A 2ICEC 2DNCA 2RVLA 1XXGA 2KVMA 2N88A 1AW7A 1AZPA 1BUVT 4FF4A 3LWUA 3R8BA 1LACA 2EY1A 4U68A 1HQRD 2ICIA 3J80E 4DF7A 3ZYYX 5A35A 2QILA 3R2TA 1Y8NB 1EZ6A 1ENAA 2F0TA 2K5DA 5EPKA 3PUZA 1ET6A 2MUYA 5CR3A 2AUKA 3CHBD 4V190 1LLRD 1UUPA 1SMYD 3G6JB 3S15B 2LFNA 2HDMA 4BWGB 3X3MA 1PRTB 1SMYC 1EU3A 4MIUA 3DM1A 3MZ5A 4RCOA 1CM9A 5A2QL 2D2CC 4FF2A 1GUWA 4C56C 1SYGA 4OHJA 4RGOS 4KMUC 2O2LD 2K6AA 1Z7TA 1F2ZA 3I90A 5C5LA 1Q1EA 1LTID 5IGGA 3VA5A 1QWYA 3SEBA 4R8NA 4HAEA 4EVOA 1GOZA 1HTPA 5CV4A 2F0HA 4HSVA 3I4LA 4HR7B 1RKNA 5KNDA 4QUFA 1QJOA 3V2TA 3D4DA 3MFGA 5CC4A 4FYDA 1T5XD 2EE1A 5C4JB 4LMQD 1RF2D 1DM0B 1LTSD 3NXWA 3GP7A 1EU4A 1C48A 4K2KA 2LMCB 4IUNA 1SNMA 3CU7A 4TQUS 5CORA 5IGDA 4J8QA 2EPBA 4CKEA 1Y69U 1G2TA 3D4WA 1AN8A 2F4IA 1CI3M 2LS01 3SHLA 1HUNA 4PMBA 2L12A 4RAUC 4IUPA 4FXDA 3P75A 1JWMD 4K5WA 3T53B 4K6LA 1UAPA 4M1UB 1QG7A 1SJED 2KEEA 2HCIA 4BY7B 1MSHA 3DUZA 1VF7A 3D8GA 2K05A 3MC0B 1Q1BA 1Q90A 4IFDG 1SNDA 4A3KB 1TWHB 2SNSA 2Z8LA 1HHVA 3W2DA 1DOMA 2Q8IB 4F7XA 1I4PA 1KABA 1QE6A 5M5YB 2Q8RE 4CJ0B 1O78A 1WD1A 1TQOA 5EPLA 3T4AC 1RODA 1F9PA 4A3FB 3Q0AA 1TS4A 1LT5D 4XTCS 2HUGA 1B9MA 5J22A 1D5MC 4DN4M 3RZOB 2G9DA 5JVH3 4FXKC 3K5OA 1PLFA 1SFOB 4K5XA 3URYA 3NP8A 1AZQA 5D14A 1IKMA 1EFID 1Y8OB 2QKIC 4B9WA 3HOVB 2XN9C 4CJ1B 5JVG3 2JA6B 4NKLA 2DN8A 2PQEA 1YNJD 4H7BA 1SJHD 4CKBA 4JBWA 3VR4A 1UEAB 3L3OC 1WVLA 4A3IB 2B2YA 4X3UA 2E74C 2RDFA 3VR5A 4KD3A 1I4QA 3TMEA 3SDZA 4DXGA 2WV6D 4CKCA 3TZUA 4IZ8A 1JCKB 1TY0A 5COYA 3KF8A 1AEXA 1HCZA 2PZTA 3NWTA 4A3JB 1KDAA 1A2TA 1CK1A 1FNWA 2DNEA 2ZT9C 3AU7A 4GZYC 2EY6A 4OO1I 2BE5C 4DGZA 1PMRA 3SK8A 4DNRB 1PTOB 2KA7A 2K03A 3FVQA 3HP3A 3IFTA 3M7GA 1EEID 1BCPC 3NE5B 3FMCA 2B2VC 2Q8TA 3FDTA 1PYWD 5C4HA 4H44C 4IUTA 1IYVA 3ND8A 2O4XA 2XIWA 3TBIB 2YYZA 4ZRZA 1B2TA 5C0XH 1DD2A 5G3LD 3KUPA 1S5DD 3R2IA 2B2UC 3GTGB 3HKZB 1SAPA 1IKLA 1GUOA 3A8KE 3K58A 1U4PA 4DK0A 2NTSA 1YNJC 1EIHA 3MXNA 1I4XA 2F3WA 2F0PA 4B08A 2EOTA 2R6GA 4C3HG 5DNFA 1CQVA 2RSNA 3K0YA 4CHTB 1NAPA 3MVVA 1S4ZA 3PUYA 3A8IE 4XQJA 4LAAA 5FK9C 2E2IB 2B8GA 4FXGC 1LO5D 4YIJA 1S5BD 5JAVA 2B2YC 4EQNA 5JEAJ 2B2TC 4M8AA 1BBXC 2X69A 3K7AB 2H4OA 2WIIB 1L0XB 4N9PA 1MI2A 2WP8J 4K2LA 3O13A 5JJZA 1HA6A 1M4VA 2L1BA 1D2BA 1I4RA 4G7HC 4P2CB 4A3EB 4XYOA 4CJ2C 2ZXOA 2K01A 2F0MA 1PZKD 5IT9L 1V1PA 3GTKB 3KLRA 1U4LA 4F87A 5TSSA 1BF4A 1AP0A 4KY7A 3MWYW 5J1ZA 5IGEA 3IFDA 1DXMA 1EZ8A 5JOBA 1D1KA 1EY5A 2FMMA 1KDCA 3JAME 3M4OB 3GTLB 3GD7A 3QB3A 3EVQA 2XVSA 1WD0A 4RKLA 1KLUD 3S16B 5DEHA 1STGA 5IGBA 1G91A 1JICA 1EYCA 1II3A 2J0TD 3RMHA 4BBSB 3VR3A 5I2XA 3MEHA 1Z6HA 5D65A 1DJRD 1EWHA 4R9WA 3VYRA 1SBBB 2F0IA 5DM73 2RBMA 2K33A 3DWAA 4KHZA 3MAQA 2KCNA 1D6EC 2AWNA 3GTQB 1EY8A 3ONAB 5CV7A 3J7AF 3GTPB 2RDGA 3AMUA 1Q3LA 5C4ZA 1QOHA 4KY5A 1R9TB 3GTJB 4OIJA 3L9AX 2NUCA 2KJXA 5FLXE 1SNCA 2QEJC 3VYUA 4ILWA 5EPJA 3T13A 4ODGA 2MHVA 5KEEA 4K8JA 2XWJB 1E2WA 1O7ZA 4I7ZC 2VB3X 3DMUA 1JWUD 1BNZA 1A3UA 2KOLA 3QO2A 5FO8B 1LTGD 2K04A 4RGNA 5EQ0A 1EYAA 3AB9A 3QWNA 3OMGA 3S1QB 2YU9B 3P7JA 1LT4D 3OPOA 5J39A 1STNA 2RDHA 1ILPA 4RWSC 1WTOA 3EJIA 1XYIA 1V43A 3KLSX 1EEFD 5CV5A 4C3JG 5T1IA 1B1ZA 3E5SA 2OEOA 2EYJA 1G8ZD 3P20A 5JEAG 2F0OA 2NN6G 5NUCA 5KYIA 5KRUA 2B2WA 4ZUIA 2MGSA 1C8CA 1CFMA 2CW0C 1WCMB 1E2VA 2F0LA 2NVXB 1JE4A 2QCPX 2E2HB 1ZYRD 1BCPD 3BS1A 1XX8A 1T5EA 2R7ZB 4C3JB 1HUMA 1RCVD 2NB0A 3D31A 3HG9A 2BE5D 2JA8B 3D3RA 1ML0D 3HOYB 1JORA 3TN2A 4X3SA 5M3FB 4XYQA 5C3WA 1PTOC 1XWEA 4IALA 4IURA 3A54A 2WKDA 1OXTA 5DAUA 5C0XI 2FMCA 2FHTA 2EZVA 3FPPA 1A3TA 2NVTB 1GXDC 3T51B 1CHQD 1X3PA 2GA4B 1PTOD 2JEAI 2A6HC 3A7AB 1O80A 4OIKA 4ZKBB 3HOZB 3HOWB 4ULLA 1BCPF 3Q6SA 3BVZA 2C9OA 4IUQA 4IN3A 2AUJD 4KN4C 1TWGB 4EQOA 5C44B 1PFMA 1H9RA 2OF1A 5DM63 4A3GB 3P1HA 1Q12A 4PMCA 1CHPD 3LNNA 4H0LC 5KNBA 3E0JA 1HXYD 4V0BA 2SEBD 2A73B 1TWFB 4C3HB 4G57A 2E2JB 1QCBD 3TP6A 1R4PB 2ZXRA 2ENBA 1K8OA 2I07B 3LX0A 1GUSA 1L0YB 4QB4A 1E0BA 1FGBD 3GO5A 1C4QA 1RDPD 3SVMA 3T56B 1I6HB 3I70A 3DEOA 2K32A 1PXUA 4BBRB 2KECA 2FFKB 1KAAA 4FO2A 5C3EB 5M9OA 2EJMA 3KBGA 2KHSA 4C1NK 4A93B 5CV9A 1MBYA 1Z47A 3J80L 1JR0D 3K5MA 3EQLC 2BA1A 3WOEA 4PMWA 3GV6A 3T16A 2F0GA 2R92B 2R3ZA 1EY4A 3BYYB 1WTXA 2F0KA 1OXUA 4IUUA 2R93B 1RD9D 4B9XA 3I8ZA 3BZDB 3TP5A 3IKJA 1HTLD 2B63B 3PUVA 2IL8A 3MXPA 2CQAA 3SK4A 3WDNA 1TR5A 3NUCA 1F2LA 2JEBI 2RA4A 1WTPA 2F03A 1TWAB 1O7LA 1CTMA 4H13C 5FO7B 1ZKOA 5HURA 5D3DA 4MN3A 4BY1B 4KN7C 2IT1A 4Z9CB 5E4XA 1MGSA 1FNUA 1E2ZA 1SEBD 1B4OA 3KK7A 1G6ZA 1NUCA 2JA5B 4O1NA 3DEPA 1QILA 2E2DC 2NYZD 5AFWA 1RTNA 5EKLA 2LKVA 1WTVA 3PV0A 2A69D 3VYTA 3J81L 2C5CA 2PMZB 3A56A 4HN7A 1A2UA 3QG1A 1OO9B 3MA2B 1S5ED 1B50A 3OOCA 5C0XJ 1BO0A 3H09A 2E76C 1SDFA 1IHZA 4PV1C 2SNMA 1LT3D 2X6GA 3OHXC 1TS5A 4IUVA 2MPMA 1I50B 4NDXA 4OGQC 2QDBA 3OW7A 1H9JA 5K36H 3I91A 3H94A 3OIQA 2PYKA 5C6AA 3TDQA 2F0DA 5IGFA 1NCVA 1CZWA 4TRDA 2KQ3A 2EYPA 3ERQA 1NSNS 3K5LA 1U4MA 2ZXPA 4ZKCB 2IX1A 3S2HB 3GV3A 3NSWA 1F9RA 5FKAC 4KD4A 1KDBA 4UAIA 4KY6A 1WTWA 5CBAE 1XTCD 1OXVA 3V05A 2SDFA 4FF3A 2PZUA 3CRLC 4DNTB 4X3KA 3OMCA 3LWEA 3VYSA 2D9UA 2HCCA 4AYBB 2TMPA 1TT2A 3A8JE 3QJYA 3NWSA 2RQXA 3WOFA 2RKSA 4RFBA 4RHSA 4NMZA 4WORA 3H91A 2E75C 2NVYB 3MFYA 2KCCA 1ZEQX 3SR1A 3K59A 3ITPA 4K6DA 3QIAA 1K83B 2VXWA 1I4GA 4RHRA 4QIWB 2F0SA 2EY2A 5K36G 2VNUD 2F0VA 2JA7B 5T1GA 1TKWB 2JE6I 1QNUA 4OO1G 4DAYA 1SYEA 1LV9A 1PFBA 5M3MB 5BN4A 3E6ZX 2L9HA 4XQNA 3NK9A 1VDZA 1KTKA 1ENFA 2EYMA 5LL6S 1JQYD 1J8IA 1PTOH 2NVQB 4EQPA 2B2UA 2XRQD 3FPUB 1AFPA 4A3MB 3C1FA 3U9OA 2PW5A 3C46A 3U9SA 2VB2X 1Q8IA 2NWGA 1SE3A 3FRPB 4NP5A 1DZ1A 1U4RA 3CRKC 2OXPA 4DAVA 1G291 3NTHA 4KJNA 3S1MB 1PZID 1GHJA 1F2MA 5I4DA 4HCEA 4IFDJ 1F2YA 2A5HA 1ONLA 1F77A 1BQQT 4QMGA 5CV6A 5M5WB 2FJ2A 1VF5C 2F0WA 2L55A 4JK1C 4ID6A 2EVBA 1NR2A 1X32A 2NTTA 1SNPA 1HRJA 3S14B 3H6MA 1UNSA 3QOLA 3EFXD 2MP1A 5I2YA 2BDNA 1DOLA 1DCZA 2B2TA 4G7OC 5KGUA 5CBEE 5ELCA 1LTTD 1ENCA 3J7YW 3K5NA 3KBXA 1IW7C 2K1BA 1ESRA 2WACA 2AQ1B 4DFAA 2IWHA 4C2MB 2TSSA 2PCFB 2F3VA 2EYFA 5FO9B 4CGYB 2DY7A 4U673 4CBVA 3BG3A 1FD7D 5E4WC 5I9OA 2M9VA 5JPMC 2IPKD 2AQ3B 3NBHA 1PZJD 4FF1A 1LTRD 2K5QA 1A3VA 2D5DA 2OT2A 4KKSA 3S1NB 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2M A;  2PZT A;  1F2Z A;  3HEJ A;  3ERO A;  4PMC A;  5JAV A;  1STA A;  1TT2 A;  2EYO A;  5E1F A;  4F7X A;  1KDA A;  1A2T A;  2F0O A;  5C5L A;  4EQN A;  1KAB A;  5HGT A;  2F0I A;  5IGG A;  3VA5 A;  1F2Y A;  5IGC A;  1SYB A;  5NUC A;  3R3O A;  2RBM A;  4RKB A;  4G57 A;  5KYI A;  4R8N A;  5KRU A;  3TP6 A;  1TQO A;  4EVO A;  1SYC A;  2RKS A;  4QMG A;  3SXH A;  2ENB A;  3NQT A;  1NUC A;  2F0F A;  3LX0 A;  2F0H A;  1SNO A;  4N9P A;  4NMZ A;  4QB4 A;  5CV6 A;  4ZUJ A;  3TP8 A;  4WOR A;  2EY6 A;  1RKN A;  2F0W A;  4KJO A;  2EYL A;  4K2L A;  2F0L A;  1EY8 A;  3SK5 A;  4F8M A;  4DGZ A;  3S9W A;  4KHV A;  5CV7 A;  4ID6 A;  5EKL A;  3SR1 A;  3V2T A;  5J22 A;  2LKV A;  5C5M A;  5K5P A;  3ITP A;  4K6D A;  3SK8 A;  3D4D A;  3OWF A;  5EKK A;  1SNP A;  3RUZ A;  4J1M A;  5C4Z A;  1SYD A;  2SOB A;  5CC4 A;  1A2U A;  1EY0 A;  3HZX A;  4J6H A;  5I9P A;  3BDC A;  1EY7 A;  3H6M A;  4KY5 A;  2F0S A;  2EY2 A;  2NUC A;  4HMI A;  2F0V A;  1KAA A;  1JOK A;  2F0M A;  4OL7 A;  3SK6 A;  3QOL A;  2EY1 A;  4ZQ3 A;  1SNC A;  4DU9 A;  5C4H A;  5M9O A;  5ISR A;  5CV4 A;  4WRD A;  4K5X A;  2KHS A;  4DF7 A;  1IHZ A;  2M00 A;  2O4X A;  1EY9 A;  2HQE A;  2PZW A;  2SNM A;  3NHH A;  3NP8 A;  3NXW A;  4HMJ A;  4K14 A;  3T13 A;  1JOR A;  1JOO A;  4ODG A;  1SYE A;  5CV9 A;  5KGU A;  4B9W A;  5IIF A;  5KEE A;  4K2K A;  4NDX A;  4KY7 A;  1EZ6 A;  1ENC A;  4IUN A;  4K8J A;  1SNM A;  5J1Z A;  5IGE A;  2F0E A;  2QDB A;  5C3W A;  5KYL A;  1ENA A;  3NK9 A;  3DMU A;  4ME5 A;  4IAL A;  4NKL A;  4ZUI A;  5CGK A;  2F0T A;  5IGD A;  1EZ8 A;  2PQE A;  5DAU A;  2WAC A;  5JOB A;  4DFA A;  1EY5 A;  1STH A;  3T16 A;  1A3U A;  2F0G A;  1STY A;  3D4W A;  1EYD A;  4H7B A;  1KDC A;  1EQV A;  1JOQ A;  1EY4 A;  2EYH A;  2PYK A;  4PNY A;  2EYM A;  3SHL A;  5C6A A;  1A3T A;  2F0D A;  5IGF A;  2F0U A;  5F2D A;  5I6W A;  1U9R A;  4K8I A;  4PMB A;  2F0K A;  2F3W A;  3QB3 A;  4TRD A;  5CR3 A;  2KQ3 A;  3EVQ A;  2EYP A;  3ERQ A;  4I65 A;  1NSN S;  5KIX A;  3DHQ A;  1EYA A;  2EXZ A;  3P75 A;  5E3F A;  4EQP A;  2F3V A;  2EYF A;  2F0P A;  4RKL A;  1SYF A;  4B9X A;  5EGT A;  4K5W A;  3OMG A;  3BDL A;  2F0Q A;  3TP5 A;  5DEH A;  1STG A;  3C1F A;  4E6I A;  4K5V A;  3U9O A;  2PW5 A;  5IGB A;  2RDF A;  4KD4 A;  5I6Y A;  1KDB A;  2F0N A;  4N9T A;  1STN A;  5I9O A;  1EYC A;  5J39 A;  1II3 A;  4MIU A;  3MVV A;  4QF4 A;  3MZ5 A;  3QOJ A;  4NP5 A;  4KY6 A;  2EY5 A;  5IOD A;  3MXP A;  3SK4 A;  5IOC A;  4KD3 A;  3OMC A;  3TME A;  1EY6 A;  3EJI A;  4HTH A;  1TR5 A;  3PMF A;  3C1E A;  4KV6 A;  4S3S A;  1STB A;  3NUC A;  3MHB A;  4KJN A;  3TP7 A;  1A3V A;  2F0J A;  3D8G A;  5CV5 A;  4LAA A;  2OXP A;  4IZ8 A;  2PZU A;  3MEH A;  3D6C A;  4EQO A;  1SYG A;  1SNQ A;  2PW7 A;  2OF1 A;  4KTA A;  3E5S A;  5CV8 A;  1SND A;  3OSO A;  4YIJ A;  2SNS A;  2OEO A;  5C3X A;  5HUR A;  3P1H A;  2EYJ A;  1AEX A; 
#chains in the Genus database with same CATH topology
 5LMU L;  4GOP A;  3HEJ A;  1V1O A;  3ERO A;  4XXE A;  1I6V C;  2JJQ A;  2BA0 A;  5E1F A;  3M85 A;  5JPN C;  1JC7 A;  1PH1 A;  1VQM A;  5HGT A;  1E1O A;  2E2I H;  3PO2 B;  5IGC A;  4DA2 A;  2M2L A;  4ZAI A;  1IYU A;  3CCM A;  1IYJ B;  5FOB B;  2NZ1 D;  2WB1 G;  3NQT A;  1ASY A;  3HKZ E;  3ERS X;  1VQF A;  1LT6 D;  2EYL A;  2A68 D;  2L5T A;  4XT1 B;  3H0G B;  3S9W A;  1TU2 B;  5JEA H;  2G9H D;  2K5W A;  1H9K A;  4RH6 A;  3F2U A;  3H3V C;  1MIU A;  1X3E A;  2UXD Q;  4LFB Q;  3HZX A;  1VQ7 A;  3BDC A;  5IP9 G;  1EY7 A;  3I55 A;  1N33 Q;  3N6R A;  4HMI A;  5L37 A;  3SK6 A;  1DOK A;  4NW2 A;  4ZQ3 A;  3AEV A;  4PZ6 A;  4A3K G;  2M00 A;  1L1O B;  1JWS D;  1HNX L;  1S5F D;  2XWB B;  1J9O A;  1RHP A;  1SXT A;  4L5R C;  2NN6 I;  4OWX B;  2A69 C;  3BVM A;  3BVG A;  1YNN D;  2R61 A;  3M4Y A;  4BY7 G;  2JXM B;  5KYL A;  4LF6 L;  5HY6 A;  2B8F A;  3HOX G;  1CUK A;  3UE0 A;  1TII D;  4JW0 A;  3Q22 A;  1STH A;  1QUQ A;  4GS3 A;  1STY A;  2Z4I A;  5GAD C;  1EQV A;  4A3I H;  1S5C D;  1FR3 A;  3GTM B;  3GQB A;  1CA6 A;  4R8I A;  3X3N A;  3DXJ C;  3PIP A;  4J15 A;  3DHQ A;  5CYU A;  1SE2 A;  3KF6 B;  2NVY H;  2IJ0 A;  1GHK A;  3FEW X;  4A3G H;  3S2D H;  4ZLT F;  2R7Z H;  2K7V A;  3SE0 A;  2JA9 A;  1IL8 A;  2XSC A;  4QF4 A;  5IOD A;  4GLX A;  2EY5 A;  5IOC A;  3L0O A;  4DAP A;  1H9M A;  1SRU A;  3PO3 G;  4DXF A;  4GOP B;  3K6O A;  2F0J A;  2OQ0 A;  3KLS A;  3D6C A;  2MJ8 A;  2VUM B;  3HGB A;  2PW7 A;  5CV8 A;  3S1R B;  4A3B B;  1IL2 A;  3BYT B;  4EX5 A;  1G2S A;  2ATW A;  1X56 A;  2NZH A;  1EIF A;  1PH4 A;  5M5X B;  3K57 A;  2XRS D;  1L0W A;  4A93 G;  2JP1 A;  3SXH A;  2QEX A;  1F9Q A;  2WKC A;  1SNO A;  3TP8 A;  2ALY B;  4JOI A;  3HOZ G;  1LUZ A;  2YTV A;  1EL0 A;  2JA6 G;  4G4K A;  1JB3 A;  4A75 A;  4XQQ A;  3TEH B;  1X9N A;  3B6Y A;  4IFD I;  1PTO F;  2L4N A;  5C5M A;  5K5P A;  3KJO A;  3M4Q A;  3HOX H;  2EDG A;  3OWF A;  4PZ8 A;  5EKK A;  1KRT A;  1SYD A;  1RTO A;  3BDO A;  3G7L A;  2Z0S A;  1GUG A;  4B3R L;  2KED A;  4X65 Q;  2H1E A;  2CHB D;  5ELD A;  4RG1 A;  1KNA A;  4OL7 A;  1NJI C;  3VR6 A;  2L11 A;  1HPC A;  4DV4 Q;  4B3T Q;  3PIP 3;  3J81 i;  1IBK L;  2PZW A;  1FYC A;  2Y0S E;  2PNR C;  2HQE A;  1GUT A;  1EUJ A;  4KK7 A;  3R93 A;  4XT3 B;  1S72 A;  1JOO A;  1CA5 A;  1W6J A;  4KI0 A;  1BOS A;  3PO2 G;  4LK1 C;  2VQE Q;  3MTS A;  3MXG A;  1I4H A;  4ALP A;  3A7L A;  1J6Q A;  4ME5 A;  1H9S B;  1YNN C;  2PQA B;  5CGK A;  4B3M L;  2KBN A;  4DAY B;  3U4Z A;  5ELB A;  3I4N G;  4TKO B;  1UEB A;  3ND9 A;  4O42 A;  2ZJP A;  3EIV A;  3NTK A;  1LTB D;  2EYH A;  4DV7 L;  4K8I A;  3GTO B;  3TZD A;  1KXL A;  1Y1V G;  4OO1 H;  2DUD A;  3BU2 A;  5IE8 A;  4XDX A;  5E3F A;  2JA7 G;  3M4O H;  5G3L F;  3RZD B;  4A3E G;  5EGT A;  1SE8 A;  2OWO A;  1A0I A;  5LMN L;  1D5X C;  5BN3 A;  4RGT A;  1EYG A;  1XNQ L;  4EGV A;  1EQQ A;  2K28 A;  4BXX H;  2EIF A;  2K5V A;  3S17 B;  1TWC H;  4QY7 A;  4WFN 3;  3PIO 3;  1QZG A;  3PMF A;  4Q5V A;  3H3V H;  4XIG S;  3MHB A;  1PRT D;  1BVS A;  2Z1C A;  1Y1W B;  1Y1V H;  3K80 C;  4BA1 I;  2R92 G;  2A6H D;  2I5H A;  1WOC A;  4QQB X;  3DWP A;  3UI2 A;  4X3T A;  1B3A A;  4DK3 C;  4JI4 L;  2HDL A;  1YJN A;  4FVM A;  1Y1V B;  3T1Y L;  2QW7 A;  5LMN Q;  1XMQ L;  1BKB A;  3M7N A;  5D3I B;  1BXT A;  3Q23 A;  1SN8 A;  2UU9 L;  1A6X A;  4DUY Q;  4KKU A;  1R4Q B;  4N8F A;  3PUX A;  3HOX B;  4QUC A;  2BCO A;  2AWO A;  1HR0 W;  3MEF A;  3L7Z C;  3V96 A;  2N55 A;  4KJO A;  5A2Q E;  4F8M A;  4GLA C;  1ICW A;  4JI8 L;  4KHV A;  4IFD H;  1DON A;  3I4M B;  2MO1 A;  2A8V A;  4LUZ A;  1EY0 A;  1HFN A;  1TVX A;  1VMP A;  5JJI A;  3KJP A;  1SE4 A;  4LF6 Q;  1BCP B;  1JOK A;  3S2D B;  1YIT A;  4R4T A;  2F4V Q;  2JA7 H;  3I3C A;  1CT1 D;  1E7Z A;  2ID0 A;  2A74 C;  2EJG C;  1HQM C;  3D6W A;  4A3D B;  1NR4 A;  2X6L A;  4JI1 L;  5LHY 1;  2IX3 A;  1VMC A;  2HQL A;  3NBI A;  1CZG A;  4ZCK A;  3EA6 A;  1YHQ A;  2LY7 A;  1ET9 A;  4JI3 L;  1JOQ A;  1J5E L;  2HD3 A;  2F0U A;  4AH6 A;  3CC4 A;  2N49 A;  2A6E D;  1BR9 A;  3NQI A;  5KIX A;  3TSS A;  1K9M C;  2AQ2 B;  4IPD A;  1CKN B;  1FNV A;  1ZYR C;  4N9T A;  2F0N A;  2JA5 H;  2BOS A;  2FXQ A;  3QOJ A;  4DK1 A;  3JAM L;  2IW3 A;  1EY6 A;  4HED A;  4HTH A;  4KV6 A;  4LNQ A;  3NTI A;  4IQZ A;  4UY8 C;  1STB A;  3W3A A;  2JQO A;  2KUM A;  1RJT A;  1MHW C;  1C7Y A;  4BA2 I;  2XNA C;  5EKI A;  4IJL A;  3VA7 A;  2JYO A;  5IT9 c;  3OSO A;  1I3Q B;  1HFG A;  3PUW A;  2MQH A;  2F1M A;  3NBH B;  1K8M A;  3C3L A;  4YHH Q;  3HOU B;  2EYO A;  3OIP A;  1TS2 A;  4C1N I;  2A6E C;  3KOJ A;  3I4M H;  1UE5 A;  3CXC A;  1ILQ A;  1SYC A;  1PH2 A;  4OWW B;  1PH3 A;  2EJF C;  3M4P A;  4DR6 Q;  2F0F A;  2PMZ E;  4JI7 Q;  3Q24 A;  2DY8 A;  3I7F A;  2QA4 A;  4DR4 Q;  1CQF A;  4LJZ C;  1WJJ A;  1Y8P B;  4ZYS A;  1A15 A;  4L5T A;  2E2J H;  1OXX K;  3I4N B;  3PCO B;  1TY2 A;  2R93 G;  4J1M A;  1F9S A;  1KAW A;  2SOB A;  4J6H A;  2BDO A;  3HS0 C;  4R4Q A;  1Y1W G;  1E3P A;  1QB5 D;  2AKW B;  3LGJ A;  2FIN B;  1MD2 D;  1V9P A;  3D0F A;  2MFI A;  4GN3 B;  5ISR A;  2CVR A;  2UUB L;  3S15 H;  1PFN A;  4I65 A;  3SK5 A;  1EY9 A;  3A55 A;  4QCL A;  4K14 A;  5C0X G;  4TSS A;  4BBR H;  2L0C A;  2ZTD A;  3QR8 A;  5IIF A;  3HRZ C;  5C44 G;  1VCI A;  2PO4 A;  2F0E A;  3ICE A;  2I5M X;  2O5J C;  2NN6 H;  3CCR A;  3CMA A;  1DYQ A;  1W6K A;  1GUN A;  2JSO A;  1X3Q A;  1B53 A;  5F2D A;  5I6W A;  4G7Z C;  1AE3 A;  2OCE A;  1CSP A;  1TS3 A;  3VDY A;  2Y0S B;  3CKI B;  3ZJY C;  2ZM6 Q;  2V4D A;  3FKI B;  1SYF A;  1MSG A;  2NVT H;  1Q82 C;  1M8A A;  4E6I A;  3GTK H;  3M3Y B;  1XMO L;  1LAB A;  4YHH L;  2J4X A;  5BN5 A;  4ZK9 B;  1L2F A;  3D4R A;  2RSO A;  1PRT C;  4F88 A;  4RA8 A;  4S3S A;  2WAQ E;  3C1E A;  5IT9 E;  1PDQ A;  3TP7 A;  4HSP A;  4Y7N B;  1KC8 C;  1X3G A;  1V1P B;  4O2D A;  1K83 H;  2B39 A;  3HOW H;  3E9I A;  1B7Y B;  2B63 H;  4KTA A;  1JT8 A;  1Z9F A;  1ZXT A;  5C3X A;  4PQX A;  2Z4H A;  5EBD A;  2J7Z A;  2GVB A;  1HH2 P;  3NPP A;  1STA A;  2F4V L;  2KCM A;  1TWG H;  5C44 H;  1D8L A;  2MO0 A;  2WIN B;  1SYB A;  5ELE A;  5EJW A;  3R3O A;  3OTO Q;  4RKB A;  4JI6 L;  1XNQ Q;  3KLW A;  2O5I C;  4C3I H;  3UE1 A;  2UXB Q;  3S17 H;  4ZUJ A;  1TWC B;  2K4K A;  2UXB L;  4ABN A;  4LF4 Q;  3MXU A;  1HNW Q;  2B2V A;  1KNE A;  4L63 B;  4C3I B;  2VUM H;  1BDO A;  2WAQ B;  1O7Y A;  5EBC A;  3RUZ A;  3G4S A;  1CKN A;  1LTA D;  2YTY A;  4FP5 D;  3OWE B;  1ESF A;  4BY7 H;  3OW2 A;  4YCU A;  3PO3 B;  5CMD A;  3IL8 A;  5I9P A;  4BS9 A;  1QVF A;  3PSI A;  3DWQ A;  3TQY A;  2CW0 D;  1EIG A;  1EQT A;  1WTQ A;  1KLG D;  4RCN A;  3I4O A;  1RL2 A;  4WRD A;  4A3K H;  4YCW A;  3NHH A;  4L8J A;  5ELF A;  4HMJ A;  3C2P A;  3I72 A;  3CPW A;  1NNX A;  4Q0F A;  1XTD A;  2K75 A;  4QIW E;  4DV4 L;  4B3T L;  3CCU A;  3S24 A;  1D1I A;  2D62 A;  1I94 Q;  3I73 A;  4JYA Q;  4KKT A;  1XNR Q;  1STE A;  4WJW A;  2DGY A;  3RLF A;  3IAY A;  2HIX A;  1EYD A;  3T1H Q;  4PNY A;  2PI2 E;  5KNC A;  3JC6 6;  4JI2 Q;  1U9R A;  2B2W C;  1V8Q A;  1H9S A;  4C3I G;  2UXC Q;  3NEN A;  1OXS C;  4HJA A;  2WB1 B;  2EXZ A;  1SLJ A;  1EOT A;  5C4X B;  1B9N A;  3VR2 A;  3BDL A;  2F0Q A;  2I5L X;  4K5V A;  2IX0 A;  4RGM A;  5I6Y A;  1SFO H;  4AYB E;  2PPB C;  1VQE A;  4DR2 Q;  2ZTE A;  3N52 A;  5C4X H;  5M3M G;  4FNF A;  3RD4 A;  1HZ9 A;  4UDU C;  3PGZ A;  4OEM B;  4L6T B;  4P74 A;  2A68 C;  4B3M Q;  1HNX Q;  2NBF A;  1EWC A;  4PZ7 A;  1PRT F;  1WFQ A;  1SNQ A;  1WYD A;  3CQZ B;  3J7A V;  3H3V I;  5LL6 X;  3J81 E;  1YJ9 A;  1QNK A;  4DR1 Q;  1VQ5 A;  2CWA A;  1B44 D;  2EXD A;  1GJX A;  1D5Z C;  5FLM H;  3CQZ H;  1VQH A;  3WWV A;  4MHE A;  1IBK Q;  4HCS A;  4POG A;  1WTR A;  2QF7 A;  5FLX L;  4A3I G;  1HA5 A;  5M5X H;  1SSO A;  2I46 A;  4DU9 A;  2ICE C;  2DNC A;  2RVL A;  1VQC A;  1LM0 A;  1U5K A;  4DV6 Q;  4DR1 L;  1XXG A;  2KVM A;  1FGU A;  1GD7 A;  2N88 A;  2IHE A;  3UDX A;  1AW7 A;  1VS0 A;  1AZP A;  3CCQ A;  1BUV T;  1QVC A;  4MZ9 A;  4FF4 A;  3W5O A;  4A3M G;  3LWU A;  1YIJ A;  3GTM H;  3R8B A;  4OEL B;  1LAC A;  2EY1 A;  4U68 A;  1HQR D;  2ICI A;  3J80 E;  4DF7 A;  2ZJQ A;  3ZYY X;  4HJ7 A;  5A35 A;  2QIL A;  1YHB A;  1Y8N B;  3AYH B;  3R2T A;  3PO2 H;  1EZ6 A;  2VW9 A;  1ENA A;  1VQG A;  3BZC A;  1YEZ A;  2F0T A;  2K5D A;  5EPK A;  3AFQ A;  4P71 A;  3PUZ A;  1ET6 A;  4NXM Q;  2MUY A;  2JK8 A;  4HIO A;  5CR3 A;  2WAQ G;  2AUK A;  3CHB D;  4FDB A;  1YI2 A;  4V19 0;  1LLR D;  3F2C A;  1UUP A;  1SMY D;  3G6J B;  3S15 B;  5LMN W;  2LFN A;  2HDM A;  1EQR A;  4BWG B;  3BJU A;  2I0Q A;  4R4C A;  4HIK A;  3X3M A;  1PRT B;  1SMY C;  1EU3 A;  4MIU A;  3DM1 A;  4LUV A;  3MZ5 A;  4RCO A;  1CM9 A;  1Y1W H;  3ULJ A;  1LYL A;  1X3F A;  1VQ8 A;  5A2Q L;  4HIM A;  2D2C C;  4FF2 A;  4UP8 A;  2HHH Q;  1GUW A;  4C56 C;  1SYG A;  4OHJ A;  4RGO S;  4KMU C;  4BBR G;  5C3E H;  2O2L D;  4K0K L;  2K6A A;  1Z7T A;  1S3O A;  1F2Z A;  3I90 A;  2ASB A;  5C5L A;  1Q1E A;  1LTI D;  4AQY Q;  5IGG A;  3VA5 A;  1QWY A;  4JI0 Q;  4TVA B;  5GAE C;  3SEB A;  4R8N A;  2Q2I A;  4HAE A;  4EVO A;  1GOZ A;  1HTP A;  4GNX B;  5CV4 A;  2F0H A;  4HSV A;  1Q86 C;  1I3Q H;  1UE7 A;  3I4L A;  4HR7 B;  1RKN A;  4IOA A;  1UE6 A;  3G71 A;  2R92 H;  5KND A;  4QUF A;  1QJO A;  3V2T A;  3D4D A;  1LTL A;  2WFW A;  4KHP Q;  3MFG A;  5CC4 A;  2HT1 A;  4FYD A;  1IBM L;  1T5X D;  2EE1 A;  3J80 c;  5C4J B;  1CSQ A;  1HZC A;  2K5N A;  4LMQ D;  1Q8K A;  1RF2 D;  3HOZ H;  2VZA A;  3S1N H;  1DM0 B;  1L1O C;  4LFC L;  3RN5 A;  1VQA A;  1LTS D;  3NXW A;  3GP7 A;  1TWF H;  1EU4 A;  1C48 A;  1VQ6 A;  1JJ2 A;  4B3R Q;  1PYB A;  3GTL H;  1MKH A;  1NMG A;  4K2K A;  2N3S A;  2LMC B;  4IUN A;  1SNM A;  1A8V A;  5BR8 Q;  3CU7 A;  3I4N H;  4TQU S;  5COR A;  5IGD A;  1ASZ A;  4J8Q A;  4IO9 A;  2EPB A;  4CKE A;  2VQE L;  1Y69 U;  3D4W A;  2R7F A;  1AN8 A;  1EFW A;  4LFC Q;  1G2T A;  2F4I A;  1CI3 M;  2LS0 1;  3SHL A;  1HUN A;  4GNX A;  4PMB A;  2L12 A;  1E1T A;  4RAU C;  4IUP A;  4FXD A;  3P75 A;  1JWM D;  1Q46 A;  4K5W A;  3BZK A;  3HOY H;  3T53 B;  2JA8 G;  4K6L A;  1UAP A;  4M1U B;  3S1Q H;  1QG7 A;  1SJE D;  2KEE A;  2HCI A;  4BY7 B;  2N78 A;  4A76 A;  1MSH A;  2JN4 A;  3DUZ A;  4JI5 L;  3E0E A;  1VF7 A;  3D8G A;  2K05 A;  2UUA Q;  3MC0 B;  2DJF C;  1Q1B A;  4LW1 A;  4P72 A;  4X64 Q;  1Q90 A;  1K73 C;  1SND A;  4A3K B;  4IFD G;  1TWH B;  2SNS A;  2Z8L A;  1HHV A;  3U58 A;  3PQI A;  3W2D A;  1DOM A;  2Q8I B;  4F7X A;  1I4P A;  1KAB A;  1QE6 A;  4ME3 A;  2Q8R E;  4CJ0 B;  3HOV G;  2R93 H;  5M5Y B;  1YZ6 A;  2KHI A;  3J81 c;  1HNZ L;  1O78 A;  1W3S A;  2QDL A;  1WD1 A;  5IYD G;  1TQO A;  5ELO A;  5EPL A;  3T4A C;  1ROD A;  1F9P A;  3MXN B;  4A3F B;  1K8A C;  3RLN A;  3Q0A A;  1TS4 A;  1LT5 D;  1BBW A;  4XTC S;  2HUG A;  1B9M A;  4DR7 Q;  5J22 A;  1D5M C;  4DN4 M;  1N32 Q;  1IZ6 A;  3RZO B;  2G9D A;  5JVH 3;  1VQP A;  4GKJ L;  1FJG L;  4FXK C;  1VQL A;  3K5O A;  3CCV A;  1PLF A;  1SFO B;  2IHF A;  1N34 L;  4O0A A;  4IJH A;  4K5X A;  3URY A;  3NP8 A;  2E5L Q;  1AZQ A;  4UP9 A;  5D14 A;  1IKM A;  1EFI D;  1H95 A;  2E5L L;  2YV5 A;  3KF8 B;  4A3C G;  1Y8O B;  2QKI C;  4B9W A;  3HOV B;  2XN9 C;  4CJ1 B;  5JVG 3;  2JA6 B;  3CCL A;  4NKL A;  2RCN A;  2DN8 A;  3F1Z A;  1VQB A;  2PQE A;  4K0K Q;  1YNJ D;  2RHS B;  2Z6B A;  3I4M G;  4H7B A;  4DV7 Q;  1SJH D;  4LF5 L;  4B3S Q;  4CKB A;  2HHH L;  2UUA L;  4JBW A;  4YY3 Q;  1JJG A;  3VR4 A;  3I2Z A;  3STB C;  4JI5 Q;  4A3L G;  4DV2 Q;  4GN5 A;  1UEA B;  3L3O C;  1WVL A;  4HJ5 A;  4A3I B;  2B2Y A;  1VQN A;  4X3U A;  5LMU Q;  2E74 C;  2RDF A;  3ULL A;  3VR5 A;  4KD3 A;  1I4Q A;  3E3X A;  3TME A;  2UUC Q;  3SDZ A;  4DXG A;  3STB D;  2WV6 D;  4CKC A;  3TZU A;  4IZ8 A;  4A3L H;  4A3J H;  1JCK B;  1TY0 A;  3EBE A;  2ES2 A;  2BH2 A;  5COY A;  3KF8 A;  1AEX A;  1HCZ A;  2PZT A;  1N8R C;  3NWT A;  4A3F H;  2XTI A;  4A3J B;  1KDA A;  1A2T A;  3CME A;  1CK1 A;  4IPG A;  1FNW A;  2DNE A;  4A3D H;  3CW2 C;  4H02 A;  2ZT9 C;  3AU7 A;  1X6O A;  2RCF A;  4GZY C;  2EY6 A;  4OO1 I;  2BE5 C;  1XMQ Q;  4DGZ A;  1TWA H;  2H5X A;  2K50 A;  1PMR A;  3SK8 A;  4DNR B;  1PTO B;  2KA7 A;  2K03 A;  3FVQ A;  5M3F H;  3HP3 A;  3IFT A;  3M7G A;  1EEI D;  1W2B A;  1BCP C;  1WI5 A;  3NE5 B;  3FMC A;  2B2V C;  2Q8T A;  3FDT A;  4YY3 L;  1PYW D;  4R4O A;  5C4H A;  4H44 C;  4IUT A;  5HGQ A;  1IYV A;  3ND8 A;  2O4X A;  4CDF C;  2PQA A;  2XIW A;  3TBI B;  2YYZ A;  1FVI A;  4ZRZ A;  1B2T A;  1X65 A;  5C0X H;  4LF7 Q;  1DD2 A;  5G3L D;  3W1B A;  3KUP A;  1S5D D;  3R2I A;  2B2U C;  3GTG B;  1C0A A;  3HKZ B;  1SAP A;  4DV0 Q;  1IKL A;  1GVP A;  1GUO A;  3A8K E;  3A74 A;  3K58 A;  1M90 C;  1U4P A;  4DK0 A;  2NTS A;  1PH5 A;  1QZH A;  1YNJ C;  1EIH A;  4JCV E;  3MXN A;  5IYC H;  1I4X A;  2F3W A;  2P5Z X;  4JG2 A;  2UUB Q;  2F0P A;  3CPF A;  4B08 A;  2EOT A;  2R6G A;  4C3H G;  5FLM G;  5DNF A;  1CQV A;  2F3I A;  2RSN A;  4YWL A;  3K0Y A;  3HOY G;  4CHT B;  1NAP A;  4JV5 Q;  3MVV A;  1S4Z A;  3PUY A;  3A8I E;  1DGS A;  3UDG A;  3S14 H;  4XQJ A;  5BR8 L;  4LAA A;  5FK9 C;  2E2I B;  2B8G A;  4DUZ Q;  4FXG C;  1LO5 D;  4YIJ A;  1S5B D;  1Q81 C;  1GKH A;  2V1C C;  1I94 L;  5JAV A;  2B2Y C;  4EQN A;  3TS0 A;  4DV5 L;  2VY3 A;  3T1Y Q;  5JEA J;  3KFU A;  3HOV H;  2B2T C;  4M8A A;  1BBX C;  2X69 A;  3K7A B;  1SR3 A;  2H4O A;  2WII B;  3TS2 A;  5J3B A;  1L0X B;  4N9P A;  1MI2 A;  1N36 L;  2WP8 J;  5IP7 H;  4K2L A;  3O13 A;  1YBY A;  5JJZ A;  1HA6 A;  1M4V A;  2L1B A;  1D2B A;  1I4R A;  4G7H C;  4P2C B;  4A4I A;  4A3E B;  3J81 j;  3NEL A;  4XYO A;  4CJ2 C;  5JJL A;  1KD1 C;  3UDF A;  4WJ4 A;  2ZXO A;  3CC7 A;  2K01 A;  3HOU G;  1PH7 A;  2F0M A;  4GNX C;  1PZK D;  5IT9 L;  1V1P A;  3M3Y H;  3GTK B;  3KLR A;  1U4L A;  4F87 A;  2K52 A;  5IP7 G;  2GN5 A;  1AH9 A;  5IYC G;  5TSS A;  3FHW A;  1TXY A;  2Q2H A;  4OON A;  2B63 G;  1BF4 A;  1AP0 A;  4KY7 A;  3CP0 A;  3MWY W;  2OTJ A;  5J1Z A;  4CDC C;  5IGE A;  3IFD A;  3J80 i;  1DXM A;  4RMF A;  1EZ8 A;  5JOB A;  1D1K A;  1EY5 A;  2FMM A;  1KDC A;  3JAM E;  4WJ3 M;  3M4O B;  3H0G G;  3GTL B;  3GD7 A;  3QB3 A;  3EVQ A;  2UUC L;  2XVS A;  1WD0 A;  4RKL A;  1VQI A;  4DK6 C;  1KLU D;  1HJP A;  3S16 B;  5DEH A;  1STG A;  1NY4 A;  3J7Z C;  5IGB A;  1G91 A;  1JIC A;  1EYC A;  1II3 A;  4N8X 1;  2J0T D;  3RMH A;  4JPB W;  4BBS B;  2NVQ H;  3VR3 A;  5E7N A;  4JOI C;  4LF8 L;  5I2X A;  3MEH A;  1PVO A;  1Z6H A;  3OYY A;  5D65 A;  4LF5 Q;  3RR5 A;  1DJR D;  1XNR L;  1EWH A;  4R9W A;  3VYR A;  1SBB B;  1GO3 E;  4DR2 L;  4X64 L;  3PF5 A;  1IBL Q;  2F0I A;  5DM7 3;  5IYD H;  2RBM A;  2K33 A;  3A5U A;  3DWA A;  4A93 H;  4KHZ A;  3MAQ A;  2KCN A;  1E22 A;  3S1M H;  1D6E C;  1K3B C;  4MTK A;  2AWN A;  3CD6 A;  3GTQ B;  2CH4 W;  4YWM A;  1K0S A;  1EY8 A;  3ONA B;  4AIM A;  5CV7 A;  3J7A F;  3HFZ B;  3GTP B;  2RDG A;  1IBL L;  1UWV A;  1QVG A;  1N36 Q;  3AMU A;  1Q3L A;  5C4Z A;  1QOH A;  2KCT A;  4DV1 L;  4DR7 L;  4KY5 A;  4OIJ A;  1R9T B;  3CC2 A;  3GTJ B;  3L9A X;  2NUC A;  2KJX A;  1WCM H;  4LF4 L;  5FLX E;  1SNC A;  2QEJ C;  3VYU A;  1JB7 A;  4JI3 Q;  3HOW G;  4A3B G;  2Z9H A;  4DR6 L;  5IYB H;  4ILW A;  4I7A A;  1V1Q A;  1HZA A;  5EPJ A;  3T13 A;  4ODG A;  3IRB A;  1N34 Q;  2MHV A;  4C3H H;  5KEE A;  3GTO H;  2CKZ B;  4K8J A;  2XWJ B;  1E2W A;  1O7Z A;  4I7Z C;  2VB3 X;  3DMU A;  3RNU A;  4LFA L;  1JWU D;  1K28 A;  1BNZ A;  1A3U A;  1VQK A;  4JV5 L;  5JJK A;  2KOL A;  3QO2 A;  5FO8 B;  1LTG D;  2K04 A;  4A3J G;  4OWT B;  4RGN A;  5EQ0 A;  1EYA A;  3AB9 A;  3QWN A;  3OMG A;  3S1Q B;  2CH4 A;  2YU9 B;  3G48 A;  3P7J A;  1LT4 D;  4JBK A;  3OPO A;  1WTH A;  5J39 A;  1STN A;  2RDH A;  1ILP A;  1K8G A;  4RWS C;  1WTO A;  3GDE A;  3UDI A;  3EJI A;  1XYI A;  3RN2 A;  5AJ3 Q;  1V43 A;  2OTL A;  3KLS X;  1EEF D;  5CV5 A;  1J5E Q;  4C3J G;  3A5Z B;  5T1I A;  1B1Z A;  3E5S A;  2OEO A;  2EYJ A;  1G8Z D;  3P20 A;  5JEA G;  1SRO A;  2F0O A;  2NN6 G;  1VQ9 A;  5NUC A;  3ULP A;  5KYI A;  1B70 B;  5GAH C;  5KRU A;  2B2W A;  3TRZ A;  1YHA A;  3K0X A;  2E2H H;  5FJ8 G;  4APV A;  4ZUI A;  4GKJ Q;  2MGS A;  2KHJ A;  1C8C A;  1JJC B;  1CKM A;  1CFM A;  2CW0 C;  4IPC A;  1WCM B;  1E2V A;  2F0L A;  3HKZ G;  1JE4 A;  3S2H H;  2L15 A;  2QCP X;  2NVX B;  2E2H B;  2LSS A;  1ZYR D;  4POF A;  1BCP D;  1RIP A;  3BS1 A;  1I5F A;  4YCV A;  5IP9 H;  1YNX A;  5M3M H;  5C4X G;  4X66 Q;  3KYH C;  4X6A H;  1XX8 A;  1T5E A;  2R7Z B;  2RHQ B;  1CKO A;  4C3J B;  1HUM A;  3OTO L;  1RCV D;  3FKI G;  2NB0 A;  3D31 A;  3HG9 A;  2BE5 D;  2JA8 B;  3D3R A;  1ML0 D;  3HOY B;  1JOR A;  3TN2 A;  4X3S A;  1QUQ B;  4XYQ A;  5M3F B;  4AQY L;  4DAM A;  5C3W A;  1PTO C;  2YTX A;  1U0L A;  2CQO A;  1XWE A;  4IAL A;  4IUR A;  3A54 A;  2WKD A;  1OXT A;  5DAU A;  5C0X I;  2FMC A;  2FHT A;  5AJ3 L;  2YU9 H;  4L5Q A;  1N32 L;  2EZV A;  3FKI H;  3KF6 A;  3FPP A;  5IWA Q;  1A3T A;  2NVT B;  2HIV A;  1GXD C;  5IYB G;  3T51 B;  4MNO A;  1CHQ D;  2LXJ A;  1P8L A;  1X3P A;  4GKK Q;  2GA4 B;  5M5Y H;  1PTO D;  2JEA I;  2A6H C;  3Q8D A;  3A7A B;  3K8A A;  1O80 A;  4OIK A;  2CFM A;  4ZKB B;  4R1J A;  3HOZ B;  3HOW B;  5M3F G;  3CAM A;  4ULL A;  1BCP F;  3Q6S A;  3BVZ A;  2C9O A;  4IUQ A;  2F52 A;  4IN3 A;  2AUJ D;  1GM5 A;  3FP9 A;  1C9O A;  5GAG C;  2BH8 A;  5FLX c;  3SGI A;  4DR5 L;  1PHJ A;  4X65 L;  2VL6 A;  4KN4 C;  1TWG B;  4EQO A;  5C44 B;  4JI7 L;  1PFM A;  4IPH A;  1H9R A;  2OF1 A;  5DM6 3;  4QGU A;  1HR0 L;  2K14 A;  4A3G B;  3P1H A;  1Q12 A;  4PMC A;  1EWI A;  1CHP D;  1MJE A;  3LNN A;  4H0L C;  5KNB A;  3E0J A;  1JE5 A;  1HXY D;  4NB3 A;  4V0B A;  2SEB D;  1VQJ A;  1SMX A;  2A73 B;  1TWF B;  4C3H B;  4G57 A;  2E2J B;  1QCB D;  3TP6 A;  1R4P B;  2ZXR A;  2ENB A;  1I6H H;  1K8O A;  3LX0 A;  2I07 B;  1GUS A;  1L0Y B;  2B3G A;  4QB4 A;  3H0G H;  5GRO A;  4BY1 H;  1E0B A;  1FGB D;  4GLV B;  4DR5 Q;  3GO5 A;  4P73 A;  1C4Q A;  1RDP D;  3M9B A;  3SVM A;  2Q2U A;  2JA6 H;  3T56 B;  1I6H B;  3I70 A;  3DEO A;  2K32 A;  1PXU A;  1T9H A;  1NE3 A;  2IY5 B;  1IXR A;  4BBR B;  1KHI A;  2KEC A;  1K3R A;  2FFK B;  1KAA A;  4FO2 A;  5C3E B;  5M9O A;  4X62 Q;  5FJ8 H;  2EJM A;  3KBG A;  2KHS A;  3J7A 5;  3K7A H;  3RLO A;  3U50 C;  4C1N K;  1VQD A;  1Y14 B;  1FJG Q;  4A93 B;  5CV9 A;  1MBY A;  1Z47 A;  3J80 L;  1HZB A;  4DR3 Q;  2EQS A;  3I56 A;  4UP7 A;  4A3F G;  1JR0 D;  3K5M A;  2KEN A;  3EQL C;  2BA1 A;  3WOE A;  4PMW A;  5H1S E;  4JI4 Q;  4MTN A;  3GV6 A;  3CCJ A;  3T16 A;  1A63 A;  2F0G A;  3GTG H;  2R92 B;  2R3Z A;  1EY4 A;  3BYY B;  4DNI A;  1WTX A;  2AHO B;  2VQF Q;  1WCM G;  1I50 H;  4HJ8 A;  2F0K A;  1OXU A;  4IUU A;  2C35 B;  4LFB L;  2R93 B;  4B3S L;  1RD9 D;  3RZO H;  1NBW A;  4B9X A;  4PG3 A;  3I8Z A;  3BZD B;  3TP5 A;  3IKJ A;  2K5H A;  1HTL D;  3JAM i;  3F8T A;  4JI0 L;  3DLL A;  2B63 B;  3PUV A;  2IL8 A;  3MXP A;  2CQA A;  3SK4 A;  3WDN A;  4LF7 L;  1TR5 A;  3NUC A;  1XPU A;  1F2L A;  2JEB I;  2RA4 A;  4UPA A;  3H15 A;  1WTP A;  2F03 A;  1TWA B;  1O7L A;  1CTM A;  4H13 C;  5FO7 B;  1Q7Y C;  1ZKO A;  5HUR A;  5D3D A;  1B3Q A;  2R7Z G;  4Y52 H;  2A1A A;  2RF4 A;  4MN3 A;  4BY1 B;  3RZD H;  4KN7 C;  2WB1 E;  2IT1 A;  4Z9C B;  5E4X A;  1MGS A;  1FNU A;  3CCE A;  1E2Z A;  1SEB D;  2Z6K C;  2LXK A;  1B4O A;  3KK7 A;  1G6Z A;  1NUC A;  2JA5 B;  3EN2 A;  4O1N A;  3DEP A;  1YVC A;  2Q2T A;  1QIL A;  2E2D C;  1N9W A;  2NYZ D;  3DM3 A;  5AFW A;  1RTN A;  4LFA Q;  1N33 L;  5EKL A;  2LKV A;  1HNZ Q;  1WTV A;  3PV0 A;  2A69 D;  3VYT A;  3J81 L;  2C5C A;  2PMZ B;  3A56 A;  4HN7 A;  3W1G A;  1A2U A;  3QG1 A;  1OO9 B;  3MA2 B;  1S5E D;  1B50 A;  3OOC A;  2NZO A;  3HOU H;  5C0X J;  1VQO A;  1BO0 A;  1X54 A;  3H09 A;  3K81 C;  2E76 C;  1SDF A;  1IHZ A;  4PV1 C;  2SNM A;  4JC0 A;  1LT3 D;  2X6G A;  3OHX C;  1TS5 A;  2D0O A;  4IUV A;  2MPM A;  1I50 B;  1O7I A;  4NDX A;  4LF9 L;  4OGQ C;  2VS1 A;  1PH9 A;  2QDB A;  2N8N A;  3OW7 A;  1H9J A;  3ER0 A;  4A3G G;  1XMO Q;  5K36 H;  3I91 A;  3H94 A;  2CWP A;  1ICF B;  3OIQ A;  1KL9 A;  2CCZ A;  2PYK A;  5C6A A;  3TDQ A;  2F0D A;  5IGF A;  1NCV A;  1CZW A;  1G51 A;  4L5S A;  4TRD A;  2KQ3 A;  2EYP A;  3ERQ A;  1NSN S;  3K5L A;  1U4M A;  4A3C H;  2ZXP A;  4ZKC B;  2IX1 A;  2A19 A;  2DJG C;  1X55 A;  2JA8 H;  2NVX H;  3GV3 A;  3S2H B;  3NSW A;  1F9R A;  5FKA C;  4KD4 A;  1KDB A;  4UAI A;  3PIO A;  4OX9 L;  4KY6 A;  1WTW A;  2ZJR A;  5CBA E;  4DKA C;  1XTC D;  2PI2 A;  5EAY A;  1OXV A;  3V05 A;  2VQF L;  2SDF A;  4FF3 A;  2PZU A;  5C3E G;  3CF5 A;  3CRL C;  4DNT B;  3E9H A;  4X3K A;  3OMC A;  3LWE A;  3VYS A;  1E24 A;  2D9U A;  2HCC A;  4AYB B;  1IBM Q;  2TMP A;  1TT2 A;  5IY0 A;  3A8J E;  3QJY A;  3L2P A;  4DR3 L;  3NWS A;  2RQX A;  3WOF A;  2RKS A;  1AE2 A;  4RFB A;  4RHS A;  4CDD C;  2QGQ A;  4NMZ A;  1BBU A;  3AQQ A;  1FL0 A;  3JAM c;  1P16 A;  4WOR A;  4X62 L;  1PH6 A;  3H91 A;  2R7D A;  2E75 C;  2NVY B;  3MFY A;  2KCC A;  4QL5 A;  4DV0 L;  2MNA A;  1ZEQ X;  3SR1 A;  4JI2 L;  3K59 A;  3ITP A;  1UE1 A;  4K6D A;  4DV6 L;  3QIA A;  4P75 A;  1K83 B;  2VXW A;  3F2D A;  1I4G A;  2Y0S G;  4RHR A;  4QIW B;  1NTG A;  2F0S A;  2EY2 A;  5K36 G;  4AYB G;  2VNU D;  2F0V A;  4NXM L;  2JA7 B;  1EOV A;  1PFS A;  2PNH A;  5T1G A;  1TKW B;  2JE6 I;  3S1R H;  4A3B H;  4IOC A;  1QNU A;  5C4J H;  4JVZ A;  4OO1 G;  4BY1 G;  4DAY A;  1SYE A;  3HKS A;  1LV9 A;  1KRS A;  1PFB A;  5M3M B;  2GVA A;  3E6Z X;  5BN4 A;  4BBS G;  2E8G A;  2L9H A;  4XQN A;  3F2B A;  3NK9 A;  2B29 A;  1VDZ A;  1KTK A;  3PF4 A;  1ENF A;  4LF9 Q;  2EYM A;  5LL6 S;  1JQY D;  1NMF A;  3PO3 H;  1XJV A;  1J8I A;  1PTO H;  4NPS A;  1M1K C;  2NVQ B;  4EQP A;  2B2U A;  2XRQ D;  3FPU B;  1AFP A;  4A3M B;  4DV2 L;  3C1F A;  3U9O A;  2ZM6 L;  2PW5 A;  3C46 A;  3U9S A;  1G6P A;  2VB2 X;  1Q8I A;  2NWG A;  1PA6 A;  1HR0 Q;  4GKK L;  1SE3 A;  3FRP B;  4NP5 A;  5GQO A;  1DZ1 A;  4JI1 Q;  4A3M H;  3K7U C;  1U4R A;  1D7Q A;  3CRK C;  4HJ9 A;  4DV1 Q;  1KIX A;  4X66 L;  2G5D A;  2OXP A;  1L1O A;  4DAV A;  1G29 1;  3NTH A;  4QJF A;  4KJN A;  3S1M B;  1PYS B;  1PZI D;  1GHJ A;  3G6E A;  3GTQ H;  1F2M A;  5I4D A;  4HCE A;  4BXX G;  4IFD J;  3GTJ H;  1R9T H;  4KHP L;  1F2Y A;  2A5H A;  1ONL A;  4Y7N H;  1F77 A;  1B8A A;  4CDE C;  3KDF B;  1BQQ T;  4QMG A;  4A3D G;  5CV6 A;  5M5W B;  5IWA L;  2FJ2 A;  4GN4 B;  1VF5 C;  2F0W A;  2UXD L;  2L55 A;  5ELN A;  3S16 H;  4R4I A;  4JK1 C;  4ID6 A;  2EVB A;  4DUY L;  5M5W H;  1NR2 A;  2OQK A;  1X32 A;  2NTT A;  4DV5 Q;  1SNP A;  2ZTC A;  1A62 A;  1MJC A;  2VUM G;  1HRJ A;  4BBS H;  3S14 B;  1KQS A;  4LF8 Q;  4JI8 Q;  3H6M A;  2UXC L;  2XGT A;  3CCS A;  1UNS A;  3QOL A;  3EFX D;  4HID A;  2MP1 A;  4OXP A;  5I2Y A;  2BDN A;  4DUZ L;  1DOL A;  2AMC B;  4C3J H;  4OX9 Q;  3U4V A;  4LWC A;  4NXN Q;  1DCZ A;  2Z6K A;  4JYA L;  2D0P A;  2B2T A;  3AFP A;  4G7O C;  5KGU A;  2UU9 Q;  1PV4 A;  5CBE E;  5ELC A;  1LTT D;  4DPG A;  1ENC A;  1OTC A;  3J7Y W;  3K5N A;  3KBX A;  4LUO A;  4C2M H;  1IW7 C;  2K1B A;  1ESR A;  4KLK A;  2WAC A;  2AQ1 B;  4DFA A;  2IWH A;  1EIY B;  3KDF A;  1XPO A;  4DV3 Q;  4C2M B;  4NXN L;  2TSS A;  4DR4 L;  4JI6 Q;  2PCF B;  4JBJ A;  4A3E H;  3GTP H;  3T1H L;  1JMC A;  2F3V A;  2EYF A;  5FO9 B;  4CGY B;  2DY7 A;  4U67 3;  3NEM A;  4CBV A;  3BG3 A;  3TRE A;  1FD7 D;  5E4W C;  5I9O A;  1HNW L;  4GOP C;  2JA5 G;  1S40 A;  1XPR A;  1TWH H;  2M9V A;  4DV3 L;  5JPM C;  2IPK D;  2AQ3 B;  1VQ4 A;  3NBH A;  1PZJ D;  4EQ5 A;  4FF1 A;  1LTR D;  2K5Q A;  1A3V A;  5DLQ E;  4YWK A;  1K0R A;  1PH8 A;  4JBM A;  3A0J A;  2D5D A;  2OT2 A;  1YJW A;  4UHV A;  4KKS A;  3S1N B;  1IW7 D; 
#chains in the Genus database with same CATH homology
 3HEJ A;  1V1O A;  3ERO A;  4XXE A;  1I6V C;  5E1F A;  2BA0 A;  3M85 A;  5JPN C;  1JC7 A;  5HGT A;  3PO2 B;  5IGC A;  4DA2 A;  2M2L A;  4ZAI A;  1IYU A;  5FOB B;  2NZ1 D;  3NQT A;  1LT6 D;  2EYL A;  2A68 D;  2L5T A;  4XT1 B;  3H0G B;  3S9W A;  1TU2 B;  5JEA H;  2G9H D;  2K5W A;  1H9K A;  4RH6 A;  3F2U A;  3H3V C;  3HZX A;  3BDC A;  1EY7 A;  3N6R A;  4HMI A;  3SK6 A;  1DOK A;  4NW2 A;  4ZQ3 A;  2M00 A;  1JWS D;  1S5F D;  2XWB B;  1J9O A;  1RHP A;  1SXT A;  2NN6 I;  2A69 C;  3BVM A;  3BVG A;  1YNN D;  2R61 A;  3M4Y A;  2JXM B;  5KYL A;  2B8F A;  1TII D;  3Q22 A;  1STH A;  1STY A;  2Z4I A;  1EQV A;  1S5C D;  1FR3 A;  3GTM B;  3GQB A;  1CA6 A;  4R8I A;  3X3N A;  3DXJ C;  3DHQ A;  5CYU A;  1SE2 A;  1GHK A;  2IJ0 A;  3FEW X;  4ZLT F;  2K7V A;  3SE0 A;  1IL8 A;  2XSC A;  4QF4 A;  5IOD A;  2EY5 A;  5IOC A;  4DAP A;  1H9M A;  4DXF A;  3K6O A;  2F0J A;  3KLS A;  3D6C A;  2MJ8 A;  2VUM B;  3HGB A;  2PW7 A;  5CV8 A;  3S1R B;  4A3B B;  3BYT B;  1G2S A;  5M5X B;  3K57 A;  2XRS D;  2JP1 A;  3SXH A;  1F9Q A;  2WKC A;  1SNO A;  3TP8 A;  1EL0 A;  4G4K A;  1JB3 A;  4XQQ A;  4IFD I;  5K5P A;  1PTO F;  2L4N A;  5C5M A;  2EDG A;  3OWF A;  5EKK A;  1SYD A;  1RTO A;  3BDO A;  3G7L A;  1GUG A;  2KED A;  2H1E A;  2CHB D;  5ELD A;  1KNA A;  4OL7 A;  3VR6 A;  2L11 A;  1HPC A;  3PIP 3;  2PZW A;  1FYC A;  3R93 A;  2PNR C;  2HQE A;  1GUT A;  4KK7 A;  4XT3 B;  1JOO A;  1CA5 A;  1W6J A;  4KI0 A;  1BOS A;  4LK1 C;  3MTS A;  3MXG A;  1I4H A;  3A7L A;  4ME5 A;  1H9S B;  1YNN C;  5CGK A;  5ELB A;  4TKO B;  3ND9 A;  4O42 A;  3NTK A;  1LTB D;  2EYH A;  4K8I A;  3GTO B;  3TZD A;  4OO1 H;  4XDX A;  5E3F A;  5G3L F;  3RZD B;  5EGT A;  1D5X C;  5BN3 A;  4RGT A;  4EGV A;  2K28 A;  3S17 B;  4WFN 3;  3PIO 3;  3PMF A;  4Q5V A;  4XIG S;  3MHB A;  1PRT D;  2Z1C A;  1Y1W B;  4BA1 I;  2A6H D;  3DWP A;  3UI2 A;  4X3T A;  1B3A A;  2HDL A;  4FVM A;  1Y1V B;  3M7N A;  5D3I B;  1BXT A;  3Q23 A;  1A6X A;  4KKU A;  1R4Q B;  3PUX A;  3HOX B;  4QUC A;  2BCO A;  2AWO A;  3L7Z C;  3V96 A;  2N55 A;  4KJO A;  5A2Q E;  4F8M A;  1ICW A;  4IFD H;  4KHV A;  1DON A;  3I4M B;  1EY0 A;  1HFN A;  1TVX A;  1VMP A;  1SE4 A;  1BCP B;  1JOK A;  3S2D B;  3I3C A;  1CT1 D;  2ID0 A;  2A74 C;  2EJG C;  1HQM C;  3D6W A;  4A3D B;  1NR4 A;  2X6L A;  5LHY 1;  2IX3 A;  1VMC A;  3NBI A;  1CZG A;  3EA6 A;  2LY7 A;  1ET9 A;  1JOQ A;  2F0U A;  2A6E D;  1BR9 A;  3NQI A;  5KIX A;  3TSS A;  2AQ2 B;  1FNV A;  1ZYR C;  4N9T A;  2F0N A;  2BOS A;  3QOJ A;  4DK1 A;  3JAM L;  2IW3 A;  1EY6 A;  4HED A;  4HTH A;  4KV6 A;  3NTI A;  4IQZ A;  1STB A;  3W3A A;  2KUM A;  1RJT A;  4BA2 I;  2XNA C;  5EKI A;  3VA7 A;  2JYO A;  3OSO A;  1I3Q B;  1HFG A;  3PUW A;  2F1M A;  1K8M A;  3C3L A;  3HOU B;  2EYO A;  3OIP A;  1TS2 A;  4C1N I;  2A6E C;  1ILQ A;  1SYC A;  2EJF C;  2F0F A;  3Q24 A;  2DY8 A;  1CQF A;  4LJZ C;  1Y8P B;  4ZYS A;  1A15 A;  1OXX K;  3I4N B;  1TY2 A;  4J1M A;  1F9S A;  2SOB A;  4J6H A;  2BDO A;  3HS0 C;  1QB5 D;  2FIN B;  1MD2 D;  5ISR A;  2CVR A;  1PFN A;  4I65 A;  3SK5 A;  1EY9 A;  3A55 A;  4QCL A;  4K14 A;  5C0X G;  4TSS A;  2L0C A;  5IIF A;  3HRZ C;  1VCI A;  2PO4 A;  2F0E A;  2O5J C;  2NN6 H;  1DYQ A;  1W6K A;  1GUN A;  2JSO A;  1X3Q A;  1B53 A;  5F2D A;  5I6W A;  4G7Z C;  1TS3 A;  2Y0S B;  3CKI B;  2V4D A;  3FKI B;  1SYF A;  1MSG A;  1M8A A;  4E6I A;  3M3Y B;  1LAB A;  2J4X A;  5BN5 A;  4ZK9 B;  3D4R A;  2RSO A;  1PRT C;  4F88 A;  4RA8 A;  4S3S A;  3C1E A;  5IT9 E;  1PDQ A;  3TP7 A;  4HSP A;  4Y7N B;  1V1P B;  2B39 A;  4KTA A;  1ZXT A;  5C3X A;  4PQX A;  2Z4H A;  5EBD A;  2J7Z A;  3NPP A;  1STA A;  2WIN B;  1SYB A;  5ELE A;  5EJW A;  3R3O A;  4RKB A;  2O5I C;  4ZUJ A;  1TWC B;  4ABN A;  3MXU A;  2B2V A;  1KNE A;  4L63 B;  4C3I B;  1BDO A;  2WAQ B;  1O7Y A;  5EBC A;  3RUZ A;  1LTA D;  4FP5 D;  3OWE B;  1ESF A;  3PO3 B;  5CMD A;  3IL8 A;  5I9P A;  4BS9 A;  3DWQ A;  2CW0 D;  1EIG A;  1EQT A;  1WTQ A;  1KLG D;  4RCN A;  4WRD A;  3NHH A;  4L8J A;  5ELF A;  4HMJ A;  3C2P A;  3I72 A;  4Q0F A;  1D1I A;  2D62 A;  3I73 A;  4KKT A;  1STE A;  4WJW A;  3RLF A;  3IAY A;  1EYD A;  4PNY A;  5KNC A;  1U9R A;  2B2W C;  1V8Q A;  1H9S A;  4C3I G;  1OXS C;  2WB1 B;  2EXZ A;  1EOT A;  5C4X B;  1B9N A;  3VR2 A;  3BDL A;  2F0Q A;  4K5V A;  2IX0 A;  4RGM A;  5I6Y A;  2PPB C;  3N52 A;  4FNF A;  3RD4 A;  4UDU C;  4L6T B;  2A68 C;  2NBF A;  1EWC A;  1PRT F;  3CQZ B;  1SNQ A;  3J7A V;  5LL6 X;  3J81 E;  1QNK A;  1B44 D;  1GJX A;  1D5Z C;  4MHE A;  4HCS A;  1WTR A;  2QF7 A;  5FLX L;  1HA5 A;  1SSO A;  2I46 A;  4DU9 A;  2ICE C;  2DNC A;  2RVL A;  1XXG A;  2KVM A;  2N88 A;  1AW7 A;  1AZP A;  1BUV T;  4FF4 A;  3LWU A;  3R8B A;  1LAC A;  2EY1 A;  4U68 A;  1HQR D;  2ICI A;  3J80 E;  4DF7 A;  3ZYY X;  5A35 A;  2QIL A;  3R2T A;  1Y8N B;  1EZ6 A;  1ENA A;  2F0T A;  2K5D A;  5EPK A;  3PUZ A;  1ET6 A;  2MUY A;  5CR3 A;  2AUK A;  3CHB D;  4V19 0;  1LLR D;  1UUP A;  1SMY D;  3G6J B;  3S15 B;  2LFN A;  2HDM A;  4BWG B;  3X3M A;  1PRT B;  1SMY C;  1EU3 A;  4MIU A;  3DM1 A;  3MZ5 A;  4RCO A;  1CM9 A;  5A2Q L;  2D2C C;  4FF2 A;  1GUW A;  4C56 C;  1SYG A;  4OHJ A;  4RGO S;  4KMU C;  2O2L D;  2K6A A;  1Z7T A;  1F2Z A;  3I90 A;  5C5L A;  1Q1E A;  1LTI D;  5IGG A;  3VA5 A;  1QWY A;  3SEB A;  4R8N A;  4HAE A;  4EVO A;  1GOZ A;  1HTP A;  5CV4 A;  2F0H A;  4HSV A;  3I4L A;  4HR7 B;  1RKN A;  5KND A;  4QUF A;  1QJO A;  3V2T A;  3D4D A;  3MFG A;  5CC4 A;  4FYD A;  1T5X D;  2EE1 A;  5C4J B;  4LMQ D;  1RF2 D;  1DM0 B;  1LTS D;  3NXW A;  3GP7 A;  1EU4 A;  1C48 A;  4K2K A;  2LMC B;  4IUN A;  1SNM A;  3CU7 A;  4TQU S;  5COR A;  5IGD A;  4J8Q A;  2EPB A;  4CKE A;  1Y69 U;  1G2T A;  3D4W A;  1AN8 A;  2F4I A;  1CI3 M;  2LS0 1;  3SHL A;  1HUN A;  4PMB A;  2L12 A;  4RAU C;  4IUP A;  4FXD A;  3P75 A;  1JWM D;  4K5W A;  3T53 B;  4K6L A;  1UAP A;  4M1U B;  1QG7 A;  1SJE D;  2KEE A;  2HCI A;  4BY7 B;  1MSH A;  3DUZ A;  1VF7 A;  3D8G A;  2K05 A;  3MC0 B;  1Q1B A;  1Q90 A;  4IFD G;  1SND A;  4A3K B;  1TWH B;  2SNS A;  2Z8L A;  1HHV A;  3W2D A;  1DOM A;  2Q8I B;  4F7X A;  1I4P A;  1KAB A;  1QE6 A;  5M5Y B;  2Q8R E;  4CJ0 B;  1O78 A;  1WD1 A;  1TQO A;  5EPL A;  3T4A C;  1ROD A;  1F9P A;  4A3F B;  3Q0A A;  1TS4 A;  1LT5 D;  4XTC S;  2HUG A;  1B9M A;  5J22 A;  1D5M C;  4DN4 M;  3RZO B;  2G9D A;  5JVH 3;  4FXK C;  3K5O A;  1PLF A;  1SFO B;  4K5X A;  3URY A;  3NP8 A;  1AZQ A;  5D14 A;  1IKM A;  1EFI D;  1Y8O B;  2QKI C;  4B9W A;  3HOV B;  2XN9 C;  4CJ1 B;  5JVG 3;  2JA6 B;  4NKL A;  2DN8 A;  2PQE A;  1YNJ D;  4H7B A;  1SJH D;  4CKB A;  4JBW A;  3VR4 A;  1UEA B;  3L3O C;  1WVL A;  4A3I B;  2B2Y A;  4X3U A;  2E74 C;  2RDF A;  3VR5 A;  4KD3 A;  1I4Q A;  3TME A;  3SDZ A;  4DXG A;  2WV6 D;  4CKC A;  3TZU A;  4IZ8 A;  1JCK B;  1TY0 A;  5COY A;  3KF8 A;  1AEX A;  1HCZ A;  2PZT A;  3NWT A;  4A3J B;  1KDA A;  1A2T A;  1CK1 A;  1FNW A;  2DNE A;  2ZT9 C;  3AU7 A;  4GZY C;  2EY6 A;  4OO1 I;  2BE5 C;  4DGZ A;  1PMR A;  3SK8 A;  4DNR B;  1PTO B;  2KA7 A;  2K03 A;  3FVQ A;  3HP3 A;  3IFT A;  3M7G A;  1EEI D;  1BCP C;  3NE5 B;  3FMC A;  2B2V C;  2Q8T A;  3FDT A;  1PYW D;  5C4H A;  4H44 C;  4IUT A;  1IYV A;  3ND8 A;  2O4X A;  2XIW A;  3TBI B;  2YYZ A;  4ZRZ A;  1B2T A;  5C0X H;  1DD2 A;  5G3L D;  3KUP A;  1S5D D;  3R2I A;  2B2U C;  3GTG B;  3HKZ B;  1SAP A;  1IKL A;  1GUO A;  3A8K E;  3K58 A;  1U4P A;  4DK0 A;  2NTS A;  1YNJ C;  1EIH A;  3MXN A;  1I4X A;  2F3W A;  2F0P A;  4B08 A;  2EOT A;  2R6G A;  4C3H G;  5DNF A;  1CQV A;  2RSN A;  3K0Y A;  4CHT B;  1NAP A;  3MVV A;  1S4Z A;  3PUY A;  3A8I E;  4XQJ A;  4LAA A;  5FK9 C;  2E2I B;  2B8G A;  4FXG C;  1LO5 D;  4YIJ A;  1S5B D;  5JAV A;  2B2Y C;  4EQN A;  5JEA J;  2B2T C;  4M8A A;  1BBX C;  2X69 A;  3K7A B;  2H4O A;  2WII B;  1L0X B;  4N9P A;  1MI2 A;  2WP8 J;  4K2L A;  3O13 A;  5JJZ A;  1HA6 A;  1M4V A;  2L1B A;  1D2B A;  1I4R A;  4G7H C;  4P2C B;  4A3E B;  4XYO A;  4CJ2 C;  2ZXO A;  2K01 A;  2F0M A;  1PZK D;  5IT9 L;  1V1P A;  3GTK B;  3KLR A;  1U4L A;  4F87 A;  5TSS A;  1BF4 A;  1AP0 A;  4KY7 A;  3MWY W;  5J1Z A;  5IGE A;  3IFD A;  1DXM A;  1EZ8 A;  5JOB A;  1D1K A;  1EY5 A;  2FMM A;  1KDC A;  3JAM E;  3M4O B;  3GTL B;  3GD7 A;  3QB3 A;  3EVQ A;  2XVS A;  1WD0 A;  4RKL A;  1KLU D;  3S16 B;  5DEH A;  1STG A;  5IGB A;  1G91 A;  1JIC A;  1EYC A;  1II3 A;  2J0T D;  3RMH A;  4BBS B;  3VR3 A;  5I2X A;  3MEH A;  1Z6H A;  5D65 A;  1DJR D;  1EWH A;  4R9W A;  3VYR A;  1SBB B;  2F0I A;  5DM7 3;  2RBM A;  2K33 A;  3DWA A;  4KHZ A;  3MAQ A;  2KCN A;  1D6E C;  2AWN A;  3GTQ B;  1EY8 A;  3ONA B;  5CV7 A;  3J7A F;  3GTP B;  2RDG A;  3AMU A;  1Q3L A;  5C4Z A;  1QOH A;  4KY5 A;  1R9T B;  3GTJ B;  4OIJ A;  3L9A X;  2NUC A;  2KJX A;  5FLX E;  1SNC A;  2QEJ C;  3VYU A;  4ILW A;  5EPJ A;  3T13 A;  4ODG A;  2MHV A;  5KEE A;  4K8J A;  2XWJ B;  1E2W A;  1O7Z A;  4I7Z C;  2VB3 X;  3DMU A;  1JWU D;  1BNZ A;  1A3U A;  2KOL A;  3QO2 A;  5FO8 B;  1LTG D;  2K04 A;  4RGN A;  5EQ0 A;  1EYA A;  3AB9 A;  3QWN A;  3OMG A;  3S1Q B;  2YU9 B;  3P7J A;  1LT4 D;  3OPO A;  5J39 A;  1STN A;  2RDH A;  1ILP A;  4RWS C;  1WTO A;  3EJI A;  1XYI A;  1V43 A;  3KLS X;  1EEF D;  5CV5 A;  4C3J G;  5T1I A;  1B1Z A;  3E5S A;  2OEO A;  2EYJ A;  1G8Z D;  3P20 A;  5JEA G;  2F0O A;  2NN6 G;  5NUC A;  5KYI A;  5KRU A;  2B2W A;  4ZUI A;  2MGS A;  1C8C A;  1CFM A;  2CW0 C;  1WCM B;  1E2V A;  2F0L A;  2NVX B;  1JE4 A;  2QCP X;  2E2H B;  1ZYR D;  1BCP D;  3BS1 A;  1XX8 A;  1T5E A;  2R7Z B;  4C3J B;  1HUM A;  1RCV D;  2NB0 A;  3D31 A;  3HG9 A;  2BE5 D;  2JA8 B;  3D3R A;  1ML0 D;  3HOY B;  1JOR A;  3TN2 A;  4X3S A;  5M3F B;  4XYQ A;  5C3W A;  1PTO C;  1XWE A;  4IAL A;  4IUR A;  3A54 A;  2WKD A;  1OXT A;  5DAU A;  5C0X I;  2FMC A;  2FHT A;  2EZV A;  3FPP A;  1A3T A;  2NVT B;  1GXD C;  3T51 B;  1CHQ D;  1X3P A;  2GA4 B;  1PTO D;  2JEA I;  2A6H C;  3A7A B;  1O80 A;  4OIK A;  4ZKB B;  3HOZ B;  3HOW B;  4ULL A;  1BCP F;  3Q6S A;  3BVZ A;  2C9O A;  4IUQ A;  4IN3 A;  2AUJ D;  4KN4 C;  1TWG B;  4EQO A;  5C44 B;  1PFM A;  1H9R A;  2OF1 A;  5DM6 3;  4A3G B;  3P1H A;  1Q12 A;  4PMC A;  1CHP D;  3LNN A;  4H0L C;  5KNB A;  3E0J A;  1HXY D;  4V0B A;  2SEB D;  2A73 B;  1TWF B;  4C3H B;  4G57 A;  2E2J B;  1QCB D;  3TP6 A;  1R4P B;  2ZXR A;  2ENB A;  1K8O A;  2I07 B;  3LX0 A;  1GUS A;  1L0Y B;  4QB4 A;  1E0B A;  1FGB D;  3GO5 A;  1C4Q A;  1RDP D;  3SVM A;  3T56 B;  1I6H B;  3I70 A;  3DEO A;  2K32 A;  1PXU A;  4BBR B;  2KEC A;  2FFK B;  1KAA A;  4FO2 A;  5C3E B;  5M9O A;  2EJM A;  3KBG A;  2KHS A;  4C1N K;  4A93 B;  5CV9 A;  1MBY A;  1Z47 A;  3J80 L;  1JR0 D;  3K5M A;  3EQL C;  2BA1 A;  3WOE A;  4PMW A;  3GV6 A;  3T16 A;  2F0G A;  2R92 B;  2R3Z A;  1EY4 A;  3BYY B;  1WTX A;  2F0K A;  1OXU A;  4IUU A;  2R93 B;  1RD9 D;  4B9X A;  3I8Z A;  3BZD B;  3TP5 A;  3IKJ A;  1HTL D;  2B63 B;  3PUV A;  2IL8 A;  3MXP A;  2CQA A;  3SK4 A;  3WDN A;  1TR5 A;  3NUC A;  1F2L A;  2JEB I;  2RA4 A;  1WTP A;  2F03 A;  1TWA B;  1O7L A;  1CTM A;  4H13 C;  5FO7 B;  1ZKO A;  5HUR A;  5D3D A;  4MN3 A;  4BY1 B;  4KN7 C;  2IT1 A;  4Z9C B;  5E4X A;  1MGS A;  1FNU A;  1E2Z A;  1SEB D;  1B4O A;  3KK7 A;  1G6Z A;  1NUC A;  2JA5 B;  4O1N A;  3DEP A;  1QIL A;  2E2D C;  2NYZ D;  5AFW A;  1RTN A;  5EKL A;  2LKV A;  1WTV A;  3PV0 A;  2A69 D;  3VYT A;  3J81 L;  2C5C A;  2PMZ B;  3A56 A;  4HN7 A;  1A2U A;  3QG1 A;  1OO9 B;  3MA2 B;  1S5E D;  1B50 A;  3OOC A;  5C0X J;  1BO0 A;  3H09 A;  2E76 C;  1SDF A;  1IHZ A;  4PV1 C;  2SNM A;  1LT3 D;  2X6G A;  3OHX C;  1TS5 A;  4IUV A;  2MPM A;  1I50 B;  4NDX A;  4OGQ C;  2QDB A;  3OW7 A;  1H9J A;  5K36 H;  3I91 A;  3H94 A;  3OIQ A;  2PYK A;  5C6A A;  3TDQ A;  2F0D A;  5IGF A;  1NCV A;  1CZW A;  4TRD A;  2KQ3 A;  2EYP A;  3ERQ A;  1NSN S;  3K5L A;  1U4M A;  2ZXP A;  4ZKC B;  2IX1 A;  3S2H B;  3GV3 A;  3NSW A;  1F9R A;  5FKA C;  4KD4 A;  1KDB A;  4UAI A;  4KY6 A;  1WTW A;  5CBA E;  1XTC D;  1OXV A;  3V05 A;  2SDF A;  4FF3 A;  2PZU A;  3CRL C;  4DNT B;  4X3K A;  3OMC A;  3LWE A;  3VYS A;  2D9U A;  2HCC A;  4AYB B;  2TMP A;  1TT2 A;  3A8J E;  3QJY A;  3NWS A;  2RQX A;  3WOF A;  2RKS A;  4RFB A;  4RHS A;  4NMZ A;  4WOR A;  3H91 A;  2E75 C;  2NVY B;  3MFY A;  2KCC A;  1ZEQ X;  3SR1 A;  3K59 A;  3ITP A;  4K6D A;  3QIA A;  1K83 B;  2VXW A;  1I4G A;  4RHR A;  4QIW B;  2F0S A;  2EY2 A;  5K36 G;  2VNU D;  2F0V A;  2JA7 B;  5T1G A;  1TKW B;  2JE6 I;  1QNU A;  4OO1 G;  4DAY A;  1SYE A;  1LV9 A;  1PFB A;  5M3M B;  5BN4 A;  3E6Z X;  2L9H A;  4XQN A;  3NK9 A;  1VDZ A;  1KTK A;  1ENF A;  2EYM A;  5LL6 S;  1JQY D;  1J8I A;  1PTO H;  2NVQ B;  4EQP A;  2B2U A;  2XRQ D;  3FPU B;  1AFP A;  4A3M B;  3C1F A;  3U9O A;  2PW5 A;  3C46 A;  3U9S A;  2VB2 X;  1Q8I A;  2NWG A;  1SE3 A;  3FRP B;  4NP5 A;  1DZ1 A;  1U4R A;  3CRK C;  2OXP A;  4DAV A;  1G29 1;  3NTH A;  4KJN A;  3S1M B;  1PZI D;  1GHJ A;  1F2M A;  5I4D A;  4HCE A;  4IFD J;  1F2Y A;  2A5H A;  1ONL A;  1F77 A;  1BQQ T;  4QMG A;  5CV6 A;  5M5W B;  2FJ2 A;  1VF5 C;  2F0W A;  2L55 A;  4JK1 C;  4ID6 A;  2EVB A;  1NR2 A;  1X32 A;  2NTT A;  1SNP A;  1HRJ A;  3S14 B;  3H6M A;  1UNS A;  3QOL A;  3EFX D;  2MP1 A;  5I2Y A;  2BDN A;  1DOL A;  1DCZ A;  2B2T A;  4G7O C;  5KGU A;  5CBE E;  5ELC A;  1LTT D;  1ENC A;  3J7Y W;  3K5N A;  3KBX A;  1IW7 C;  2K1B A;  1ESR A;  2WAC A;  2AQ1 B;  4DFA A;  2IWH A;  4C2M B;  2TSS A;  2PCF B;  2F3V A;  2EYF A;  5FO9 B;  4CGY B;  2DY7 A;  4U67 3;  4CBV A;  3BG3 A;  1FD7 D;  5E4W C;  5I9O A;  2M9V A;  5JPM C;  2IPK D;  2AQ3 B;  3NBH A;  1PZJ D;  4FF1 A;  1LTR D;  2K5Q A;  1A3V A;  2D5D A;  2OT2 A;  4KKS A;  3S1N B;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...