3S9WA

Crystal structure of staphylococcal nuclease variant delta+phs m98g bound to ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS M98G bound to Ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3s9wA00
2PQEA 2EYHA 4K2LA 5J1ZA 1EY6A 2F0TA 5C4HA 5KGUA 5C5LA 5C4ZA 1NUCA 4EQPA 3U9OA 3R3OA 4EQOA 5C3XA 5IIFA 4N9PA 3QB3A 4ZUJA 2F0SA 1EYCA 2F0MA 2PZUA 1KAAA 5CR3A 4N9TA 2F0HA 2RKSA 2WACA 1EYAA 1STBA 1A3UA 2NUCA 4ID6A 2F0VA 5E3FA 4E6IA 5HGTA 2SNSA 5I9PA 1IHZA 3EROA 1II3A 2F0FA 4YIJA 4ME5A 4PNYA 4NP5A 5E1FA 4EVOA 3NQTA 3OMGA 1JOKA 4QB4A 4WORA 3SK5A 4QF4A 3NUCA 3T16A 1SNPA 2O4XA 1EQVA 2KQ3A 1F2MA 1SNCA 1U9RA 3TP5A 5J39A 4KD4A 2EY5A 1EY0A 2PZTA 4F7XA 4ZQ3A 2M00A 1SNDA 2EYFA 4NDXA 5F2DA 1JORA 1SNOA 4OL7A 2EYJA 1KABA 3D4WA 4PMCA 2F0WA 1SYEA 3D4DA 4K5VA 1EZ8A 5C6AA 1KDAA 3P1HA 4K14A 4ZUIA 2PW7A 2EYOA 3TP7A 1TR5A 5CV5A 3BDCA 3TP6A 2OEOA 2ENBA 4RKLA 2RBMA 3MHBA 4KJOA 5CV9A 3MEHA 1F2YA 3D8GA 2EYPA 1RKNA 3TMEA 4DU9A 3SK8A 2EY2A 3LX0A 5C3WA 2F0QA 2QDBA 4ODGA 1A3TA 4EQNA 5KRUA 5I9OA 1JOQA 2F0OA 3OWFA 5JOBA 4IUNA 4J1MA 5EKLA 5CGKA 3RUZA 4KHVA 2F0NA 1AEXA 1STYA 3MVVA 3MXPA 4I65A 4DGZA 4IALA 3HEJA 1EZ6A 1TT2A 4KJNA 5IGGA 3NXWA 5M9OA 1STNA 3PMFA 1SYFA 5DAUA 1A3VA 1STAA 4KD3A 4NMZA 5IGEA 2F3VA 4KY5A 2KHSA 1EY9A 2F0JA 4K5XA 4B9WA 2SOBA 1SYCA 2EY6A 3EVQA 2PZWA 1SYBA 4NKLA 1EY4A 4PMBA 4DF7A 2PYKA 4HMIA 4LAAA 4K8IA 5IGFA 5KYIA 5ISRA 5IGCA 5I6YA 3NP8A 3TP8A 5K5PA 5KEEA 2F0DA 1SYGA 3NK9A 5IODA 1JOOA 2RDFA 3H6MA 3HZXA 1F2ZA 1EY7A 2F0LA 3OSOA 3BDLA 4MIUA 4S3SA 5JAVA 2HQEA 4K8JA 4KV6A 4IZ8A 3V2TA 3ITPA 5EGTA 5EKKA 1STGA 3OMCA 2EXZA 4HTHA 1NSNS 1SNMA 5I6WA 2F0PA 4RKBA 3DHQA 4HMJA 4DFAA 3VA5A 5J22A 5C5MA 1TQOA 1EYDA 2SNMA 4QMGA 1KDCA 3SK4A 4K2KA 3NHHA 3T13A 4K5WA 1ENCA 4F8MA 3S9WA 1ENAA 4KY6A 4KTAA 3SXHA 2EYMA 3D6CA 5CV8A 1A2TA 5CV7A 2F3WA 1A2UA 3DMUA 3QOJA 2F0UA 4KY7A 2F0IA 2LKVA 1KDBA 1SNQA 2F0GA 3C1FA 4K6DA 4TRDA 5CV4A 3SK6A 4G57A 5IGBA 1EY8A 1SYDA 2F0EA 3EJIA 3P75A 3MZ5A 4R8NA 5IOCA 2EYLA 2OF1A 3ERQA 4WRDA 5NUCA 5CC4A 3E5SA 3SHLA 5DEHA 5HURA 4J6HA 1STHA 5KIXA 2PW5A 1EY5A 4H7BA 2OXPA 3C1EA 2F0KA 5IGDA 3SR1A 5CV6A 2EY1A 3QOLA 4B9XA 5KYLA
chains in the Genus database with same CATH superfamily
1I6HB 2N8NA 5C4HA 1FJGQ 5C4JB 3R2TA 5FJ8G 2RVLA 4N9PA 1H9SA 2LS01 1WTXA 3V96A 2RSNA 2K7VA 4HSPA 1GHJA 1II3A 2ES2A 1XTDA 1IBMQ 1Q3LA 4A3DG 1V1PB 4K0KQ 1YNND 3RZDB 1DYQA 4QF4A 1IYJB 4CBVA 4ALPA 4K6LA 4DV5Q 4KD4A 3S2DB 1AH9A 4ZQ3A 3GQBA 5F2DA 4ZK9B 1V1QA 2M9VA 3OWEB 2R3ZA 3CCJA 1XNRQ 4DAMA 3QJYA 1BVSA 5JJIA 4EQ5A 4H0LC 1HNXL 1N34L 1G6PA 2B2WA 2RBMA 4KJOA 2HIVA 4DK6C 4KKSA 4NW2A 3VR5A 4DN4M 3RZOH 3DEOA 4NXMQ 3H0GG 2IX3A 1WTVA 1L0WA 3J81E 3FKIH 1VQMA 1MD2D 3RUZA 3PO2H 4R9WA 1PRTD 1L1OC 2DY7A 2B63G 4DR3Q 4FXGC 1YITA 4LWCA 3NPPA 4RMFA 3NELA 3GTGH 2E2HH 2VZAA 3M85A 2I0QA 4R4QA 4K5XA 5G3LD 2PZWA 4NKLA 3E9HA 1JT8A 1LUZA 3E3XA 5FLMG 3VYRA 3OSOA 4C56C 2R92H 2IX1A 3ITPA 4DR4L 3KBXA 2H4OA 3BYTB 4QIWB 4IOAA 2KEDA 3VA7A 3SK4A 4JBJA 1GO3E 3K0YA 1MI2A 1SR3A 1DCZA 2D0OA 2HHHQ 2TSSA 1ASZA 4RA8A 2I07B 5CV4A 1SNQA 2F0GA 1GKHA 1UE1A 4TSSA 2CH4A 1U4MA 2ZTEA 1E0BA 4YHHQ 5EPJA 1ICFB 3PIOA 1U4RA 3L3OC 1KIXA 2PQAA 4A3IB 5K36H 1DD2A 2EY1A 4OL7A 4O0AA 2PQEA 4BBSH 5IYBH 1C0AA 2MFIA 3GTPH 2XGTA 2PPBC 2R93B 2Z4IA 3MWYW 2NVXB 4L63B 4A3MG 1NR4A 1PXUA 4JI5Q 5BN4A 4QQBX 4BY7G 2Q8RE 3L2PA 1WVLA 3S2HB 3I2ZA 3T1HQ 3NTIA 1U9RA 2HCIA 2IL8A 3VR6A 4U673 1SDFA 4GLAC 4JV5L 5C6AA 2NVQB 1ZXTA 4BXXG 3BVZA 3K80C 3JAMc 3TP7A 1M90C 4FVMA 2Q8IB 3OHXC 4YWLA 3PF5A 1JJCB 4DK1A 4KHPL 1L2FA 4DPGA 2CCZA 2A6ED 1GJXA 1STYA 3J81j 4A3BH 2H1EA 1K8GA 4GLVB 1SBBB 1Q8IA 4X65L 1S40A 1XXGA 4DR6Q 4KY5A 1BOSA 3OIPA 2F0JA 3QR8A 4HJ8A 2Q8TA 2AMCB 1VQKA 4G7HC 2XSCA 3NP8A 2A6HC 2A69C 3M7GA 1SE8A 1A15A 3J7AV 3NK9A 2YTVA 5IP7H 3H3VH 5CYUA 1UUPA 1VQ4A 2CWAA 1E2WA 1PZKD 1AZPA 1D8LA 1LTBD 1XPOA 2VUMB 1PFMA 1EOTA 4DV0L 3RZOB 4M1UB 4F87A 1HRJA 3SEBA 3HOUG 4LF9Q 3RNUA 5CBAE 3DM3A 3QOJA 2WKCA 3NBHB 1DOMA 5DM63 5NUCA 3ERQA 2L1BA 1BQQT 2QGQA 3HOWB 3H15A 2E2HB 4DV6L 3BDOA 3AU7A 1D1KA 3W3AA 4JW0A 2F4VQ 5CBEE 5I2XA 3EN2A 3G71A 3I55A 2FJ2A 2UXDQ 2CH4W 3RLFA 2VQFQ 1KAAA 1B50A 4HN7A 5E3FA 2RF4A 4DR1Q 4A93H 2HCCA 3CRLC 2IHEA 3A54A 3J81L 1LTID 3DXJC 1HNZL 3IKJA 3T53B 1LABA 1HTLD 1IBKQ 2KUMA 3I56A 4DV7Q 2EY5A 5JJKA 4YWKA 4POGA 3TZUA 1DZ1A 2L11A 4LUVA 4R4CA 4JI7L 5ELCA 1RF2D 2Q2TA 3OYYA 1PH9A 3CCLA 1SYEA 3P1HA 1Q1EA 2IX0A 1WTRA 1PTOF 3S1NH 4CKEA 3J81i 5FJ8H 2J7ZA 5KNCA 1YHBA 1BKBA 2N88A 3TQYA 2ICIA 3I4NG 3GTPB 2BDNA 1EIYB 3E9IA 4A3EH 4FDBA 2KECA 3B6YA 4J15A 4KHVA 2AQ3B 1AEXA 1VQAA 2BDOA 2Q2UA 4HJ7A 2CWPA 1O78A 1YNJC 3I70A 3ER0A 4A3JH 2Y0SG 2LMCB 2WB1G 4PZ8A 1HQRD 4RGMA 2UUBL 2DY8A 1I94L 1QUQA 5ELNA 1Q86C 4JI8Q 5KYIA 2E5LQ 1WJJA 3GTLH 4I7ZC 1DGSA 4ABNA 3TP8A 3S16H 5KEEA 2B2TC 3ZYYX 3HZXA 5JAVA 4AQYL 2ZTDA 4BY1G 3ULPA 1VQHA 3D4RA 2I5MX 2WKDA 5EKKA 2K04A 4HR7B 1LTSD 1PH7A 2C35B 3H0GH 3JAME 1UE6A 2L0CA 1VQIA 2G9DA 2IT1A 2MP1A 2QKIC 2A68D 2E2JB 1KDCA 4Z9CB 5JEAG 3G4SA 3F2CA 2FMMA 4P71A 1Y1VH 1F9SA 2XIWA 2Z0SA 1EIHA 5CV8A 2JSOA 3PO3G 4DNIA 2JA7H 1KTKA 4J8QA 1EEFD 2ID0A 4A3BB 3HOYH 2NTTA 2WAQE 4DV1L 1HNWL 3BZDB 1LT4D 3S1QB 2XWBB 4CDEC 4B3ML 2B8GA 5E7NA 5C0XH 3K81C 5JPMC 3TRZA 2ZT9C 5IYCH 2VNUD 1E24A 2JJQA 4RCOA 3TDQA 2ZM6Q 5LMNL 3BYYB 1KHIA 4GOPC 4K2LA 4LNQA 4RHSA 1VF7A 2FHTA 1FNWA 3KLSA 2E2IB 1F2LA 2L12A 4GN4B 4QIWE 3MXUA 3LGJA 2B29A 3W5OA 3LNNA 2KVMA 2EIFA 4CKBA 5FKAC 1KNEA 2WINB 3H3VI 4EVOA 4DR7Q 1I4RA 1BBUA 4L8JA 5ELOA 2M2LA 2VB2X 1CZWA 5JVG3 2LXKA 2QA4A 1O7LA 4JI1L 5L37A 4A3LG 1UEAB 2V4DA 4IJLA 5BR8Q 1EZ8A 2EDGA 3C2PA 2PW7A 2A1AA 1SLJA 1WD1A 3TP6A 4HCSA 1DONA 3BZKA 1MHWC 1GM5A 3GTQB 1F2YA 1PA6A 3R93A 2G5DA 1RKNA 3FKIG 3TMEA 3A7AB 3PO2G 3SK8A 3CQZH 1YHAA 2CW0C 1OO9B 3X3MA 2MO1A 3GTJB 1EWIA 3S1MH 2VL6A 1OXSC 4KJNA 3NXWA 2WIIB 5TSSA 4R4TA 4HJ5A 3NENA 3IFDA 4N8FA 2NN6I 1CKNB 4IO9A 4FF2A 1E7ZA 3KYHC 5LMUL 2NBFA 2UUAL 2R92G 4OHJA 1I50H 3ERSX 1UE5A 2IJ0A 1EIGA 2Z4HA 4K8JA 5EGTA 1CHPD 5EQ0A 4FO2A 4XIGS 4HTHA 3DLLA 3S1NB 1G2SA 2HD3A 1GUOA 3QWNA 1CUKA 1TQOA 1EYDA 2SNMA 4QMGA 5KNBA 5IWAL 1Y8OB 1L0XB 2JP1A 2ZTCA 1QOHA 3HKSA 4A3DB 1A2UA 2E74C 1N34Q 1RTNA 2YU9H 3UE1A 3KUPA 2UU9Q 4A3JB 4YCVA 4JI3Q 3T1YL 3Q8DA 3CMEA 4HSVA 5K36G 4UP7A 4BBSG 5IYBG 1BCPD 1E1TA 3M4PA 3S16B 4IUPA 1VQFA 2B2WC 5C3XA 2GN5A 1H9RA 1ML0D 2CKZB 2SDFA 3QB3A 1K83B 4ZUJA 5IT9L 2O5IC 3I4OA 2F0HA 4X6AH 1VDZA 3H0GB 4KKUA 3SGIA 5BN3A 1LACA 5JPNC 4HJAA 3RLNA 1K0RA 3M3YH 4RGOS 5EJWA 4JI4L 3HOZG 1OXTA 5IYDH 4DR4Q 2B2TA 1U4LA 3PSIA 1EL0A 4UP8A 3OW7A 1RL2A 2EYJA 1O7ZA 5J3BA 1ZYRC 4PMCA 4K5VA 4XDXA 4L5SA 2RCFA 2K32A 2OTLA 2ALYB 1Q46A 5ELFA 4OWWB 4IFDJ 4OXPA 4DV4L 1I3QH 1WOCA 1OXUA 2EY2A 4IQZA 1GOZA 3UDIA 2QDBA 4DUYL 3CPFA 4DKAC 2F0OA 4WJWA 3VR3A 3E0EA 1MIUA 4A3BG 4LFBL 1Z47A 4C1NK 3JAML 4DA2A 4LJZC 1S5BD 1LM0A 4C3JG 2C5CA 5EPLA 1V8QA 3WOFA 3KDFA 1HR0L 1SYFA 3PIPA 2N3SA 2OQKA 2XRSD 4IUUA 2OCEA 4R4IA 1CQFA 1DJRD 3EVQA 4NB3A 3I4LA 4GOPA 2JA6H 1LTGD 4B08A 1LTTD 5IP7G 2QW7A 3T51B 3JAMi 3J80L 4XTCS 3PIO3 1JOOA 3STBD 3GTKH 2F0LA 1E3PA 4CHTB 1FR3A 3OOCA 2BE5D 1U0LA 4A75A 3CCSA 4A3MB 4K5WA 1S5CD 1X65A 5EPKA 1C7YA 1X3GA 4P74A 4PQXA 3D6CA 4ILWA 3M4OB 3J80i 4BY7B 3PCOB 1B70B 2PMZE 3EJIA 3OW2A 3L7ZC 2OF1A 1IW7D 4WRDA 1Y8PB 2GVBA 1BBXC 1WCMH 4KHPQ 1N33L 4OIKA 3FPUB 3OPOA 4LF6L 3IRBA 5LMNW 2PNRC 1TWFB 3QOLA 1AE2A 1I50B 1V1PA 1VQLA 4AYBB 1LV9A 4A93G 2FMCA 4X65Q 3PUZA 3A8IE 3C3LA 5KNDA 1FGUA 1TKWB 5E1FA 1NNXA 1K73C 2KQ3A 2DUDA 5FO9B 2OWOA 1SNDA 2IW3A 1K0SA 2F0WA 4HAEA 2VW9A 5GAHC 4NPSA 4LF8L 2QDLA 2ENBA 1PFNA 2QEJC 4JC0A 1JC7A 4PZ7A 1EQRA 4GKKQ 4A3EG 3PUWA 3H94A 2ATWA 3R8BA 1H9JA 1TWHH 4IUNA 3M4YA 3PUXA 3FVQA 2PO4A 4DV6Q 3HOUB 1MSGA 4A3JG 1V1OA 4X66L 1EZ6A 3AMUA 2EJFC 3A5ZB 5DAUA 3A0JA 1PYBA 4HIMA 4IURA 4X3KA 3O13A 4A3LH 1GUGA 2DN8A 2K28A 2WFWA 4LFAQ 5I2YA 1VQ9A 4A3FH 4LMQD 3F2DA 1HHVA 3A8JE 2Z9HA 5K5PA 4B3SL 2F0DA 4ZYSA 2RCNA 1KD1C 4BBRH 4MIUA 1N36L 3BDLA 5E4WC 3J7ZC 1HNZQ 1P16A 2MPMA 3SE0A 1Y1VG 3HOXH 4IPCA 2JA7G 5M5YH 1IYVA 2EJMA 1BDOA 1YEZA 4KTAA 4IUVA 3M4QA 3ONAB 4DV2Q 3HOYG 3D31A 2F3WA 2H5XA 3N6RA 4Q0FA 3IL8A 3OIQA 1NE3A 4TKOB 1JCKB 4TRDA 5C0XG 1C9OA 3HFZB 1KAWA 5IYCG 1HPCA 1SN8A 3FHWA 4ULLA 2ZJRA 3U9SA 5EBDA 1JWSD 3KJOA 1N9WA 1EFID 4DV3L 4L6TB 4LF7L 4H7BA 4KN7C 3T56B 1LT5D 2KEEA 1K3RA 3SR1A 4FXDA 1NUCA 3BJUA 3VDYA 1PFBA 2XVSA 1VQ8A 1SMYC 3UE0A 1YJWA 3I4NB 2RDGA 1L0YB 3D6WA 5EBCA 1ESRA 1X6OA 2UUBQ 4YIJA 1I94Q 3UI2A 1EFWA 4PNYA 1B3AA 1JWMD 2EQSA 5EAYA 4YY3L 1DOKA 4QB4A 3VYTA 5IT9c 3NUCA 1EUJA 1SNPA 3NSWA 2WP8J 1CI3M 4AQYQ 1V9PA 2Y0SB 5J39A 2PZTA 5IE8A 3RLOA 2WB1B 5DM73 3NWTA 3D4DA 3HKZE 1PZID 1ET6A 1EU4A 4K14A 4C3IH 1EWCA 2JK8A 2K5QA 1DM0B 1OXVA 4POFA 1B8AA 1XMOL 1H9MA 3MHBA 1CK1A 4BY1B 1F9PA 2EYPA 1QE6A 2UUCL 4DU9A 1PTOC 4LF5L 2NYZD 4DUZL 1VQGA 2K03A 3LWEA 1PH5A 2QF7A 2F0NA 1BF4A 1HR0W 2K6AA 3DUZA 1HXYD 1D5ZC 3G48A 4CDDC 3BS1A 5LMNQ 1STNA 2JXMB 4P73A 3PO3B 2F3IA 4PV1C 3HOZH 4JBKA 2JYOA 1W6JA 3Q23A 1GUNA 5G3LF 5D65A 5IGFA 2N55A 4DR2L 2PNHA 4AYBG 4DXFA 1AE3A 1FYCA 1VCIA 1Z9FA 3H6MA 2NVTH 4OEMB 4KLKA 4A3GH 1SMYD 1WFQA 1FNVA 4XT3B 1KL9A 1NSNS 2KCCA 4JI2L 2F0PA 4JOIC 3DHQA 3J7A5 5T1IA 3NBHA 2HT1A 5C5MA 5BN5A 1QG7A 3N52A 3J80c 1A6XA 4JI1Q 4C3JH 1XTCD 2MO0A 3TS2A 2N78A 4G57A 5FO8B 3X3NA 1GUSA 1HZAA 2RDHA 2PW5A 2FXQA 3M9BA 4LFCL 4JI6Q 2J0TD 3CHBD 1LYLA 5C5LA 2E2DC 3L0OA 1QZHA 4B3RL 1PTOD 1K3BC 1W3SA 1PDQA 3FKIB 3PO2B 4LUOA 2F0VA 1LTLA 3RN5A 4IJHA 3HOXB 3KF6B 5LMUQ 2UUAQ 2OTJA 5M5YB 3GTGB 2DNCA 5IYDG 1QB5D 2JA5G 3EFXD 3L9AX 2KHIA 4OIJA 5JJLA 1D2BA 2FFKB 4L5TA 3ND9A 2RHQB 1PRTB 4UDUC 5IWAQ 3AFQA 5C3EH 2R92B 2KHJA 1IBML 5AFWA 2LY7A 5CV9A 3D8GA 4V0BA 1B53A 4OO1H 1IXRA 1KLUD 4ODGA 4DV5L 1T9HA 5CGKA 4IPGA 4XQQA 2D0PA 2ICEC 3MVVA 1RHPA 2O2LD 4DGZA 1XNRL 3HEJA 2CFMA 3AB9A 2N49A 2Q2IA 2A6HD 2A69D 5IGEA 4NMZA 2JA6G 1RIPA 5IT9E 3W1GA 1CKMA 3I4MH 2AUJD 3CF5A 4BBSB 2RHSB 2UXBL 3GV3A 1VQOA 2MHVA 4XXEA 3BU2A 3OMCA 5M3MH 1G51A 4FYDA 5H1SE 3NHHA 4KMUC 2I46A 3S9WA 4A3KG 2LFNA 1KQSA 5JVH3 3F2BA 1I4QA 3DMUA 2K5HA 2L9HA 1WCMG 3I7FA 1I6VC 1S4ZA 1TU2B 3MXNB 4I7AA 4UP9A 1X56A 3HOZB 1STHA 4DV4Q 1L1OB 1X32A 1TY0A 3P7JA 1JICA 3MFYA 4DUYQ 1EY5A 2HDLA 4R1JA 4LF4L 4LFBQ 3TSSA 1EU3A 1X3PA 1OXXK 3CCEA 3UDGA 1J5EL 5KGUA 4IFDH 3H09A 1KRSA 1CSQA 2NVTB 5D3DA 1HR0Q 1K9MC 4QUCA 4Q5VA 2NUCA 1TWGH 2YTXA 1VQJA 4QUFA 5I9PA 4JYAQ 4ME5A 1QNUA 1E22A 3NQTA 1DOLA 3AFPA 4C3JB 2BH2A 3J80E 1UEBA 1F2MA 4X62Q 4DAPA 1RDPD 5C44H 2GA4B 2J4XA 2SEBD 3PIP3 3M7NA 4OWTB 1ICWA 3U4VA 4DR5L 4JOIA 4RKLA 3IFTA 2EE1A 5DLQE 1ET9A 4HIKA 5FOBB 2KA7A 1XJVA 1SJHD 1XMQL 1YNJD 1WTOA 1JOQA 2IHFA 4FNFA 1A62A 1V43A 3G7LA 3HS0C 3CXCA 2YYZA 2BCOA 4P72A 1CKNA 3MXPA 4LF6Q 2YTYA 1HZBA 1J6QA 3PMFA 1MSHA 5ELBA 4A3FG 1HCZA 2MNAA 1FVIA 2Y0SE 4IUQA 5FO7B 4PMBA 3GTMH 4DF7A 2E75C 3RMHA 4K8IA 3QIAA 4BBRG 2WB1E 1Q1BA 2KCTA 3DWQA 1I4GA 3TEHB 1B9NA 2JEAI 2CVRA 3QO2A 3F1ZA 5C3EB 4IZ8A 2Z6KA 1STGA 3HOXG 2VY3A 1E2VA 4RKBA 3CD6A 3E0JA 4A93B 1UE7A 4DAVA 2VB3X 2Z1CA 1BNZA 5COYA 4OONA 2IY5B 2F0UA 4CJ1B 4K6DA 3ICEA 4R8NA 1B1ZA 4LF8Q 1IL8A 4HEDA 1YIJA 2DJFC 1S5DD 1VQ6A 5HURA 3EIVA 1VMCA 1WYDA 4J6HA 1JE5A 1FL0A 1GUWA 4YWMA 3CCMA 2LXJA 4UAIA 3BZCA 3PUVA 3I4MB 4WJ4A 2NWGA 1A0IA 4EQOA 3R3OA 4RH6A 2MJ8A 4A3EB 1AP0A 5ELDA 2NVYH 4JI0L 1QWYA 5M5WH 1HNXQ 2F4VL 5C4XH 1MJEA 2XWJB 3OMGA 3MFGA 4C3HG 1B7YB 4H13C 1AFPA 2O4XA 1R9TH 1UAPA 4F7XA 1QZGA 3GTLB 4C3IG 2D5DA 1LO5D 3PUYA 1WTPA 1PV4A 2CW0D 1D1IA 1M4VA 1YJ9A 4BA1I 2JEBI 1Y1WH 3A8KE 4DAYA 1EYGA 1D7QA 5C4JH 2NZ1D 3Q6SA 4GLXA 3LX0A 2F0QA 5CORA 1Y1VB 1QNKA 4KI0A 4UHVA 2B2YC 2JN4A 2ZXRA 2JA7B 4CDFC 4DV3Q 1BBWA 3HOYB 2JA5H 3JC66 4WJ3M 2DGYA 2B39A 4RG1A 3IAYA 2A74C 3CAMA 2R7ZH 3WOEA 4BS9A 2L5TA 2F3VA 3RN2A 1NBWA 4XQJA 2B2VC 1SYCA 3KLWA 1ASYA 2PYKA 4LAAA 1W6KA 4AH6A 3A55A 5JJZA 4G7ZC 4C1NI 1STEA 4A3GG 5IODA 5C0XI 2MGSA 4YY3Q 4IPHA 4DAYB 4C2MH 4HMJA 2AWOA 3CKIB 2F1MA 1ENCA 1WI5A 4A3CH 2F4IA 2F52A 2KJXA 3A56A 3CPWA 2E5LL 3KFUA 3EA6A 1XWEA 1A2TA 2XN9C 5CV7A 1E2ZA 4FF4A 3SK6A 1XMOQ 3MC0B 4ZCKA 1SYDA 4YCWA 4RAUC 1ZEQX 5LL6S 3P20A 1B44D 1EIFA 3KF8B 5D14A 3Q0AA 2UUCQ 1WTQA 4LF5Q 1HA6A 1F9QA 3GTMB 1BCPF 4OELB 4BA2I 1HA5A 1RD9D 3NE5B 2EYHA 1RTOA 1I4PA 5C4ZA 1AZQA 3U9OA 3CQZB 3BVMA 3CW2C 5AJ3L 1IZ6A 1IL2A 2E8GA 1ONLA 4JV5Q 3NTKA 4GZYC 4GKJL 4A3KH 5HGTA 1VQPA 2L55A 3S1MB 2R6GA 3CRKC 1R4QB 2I5LX 3CMAA 1QVGA 1FGBD 1AW7A 4DR2Q 2K75A 4GNXB 2ZM6L 4X64L 1ZYRD 3KLSX 1KNAA 2EPBA 1T5XD 1TY2A 3MTSA 3GP7A 2QILA 5DNFA 2K5DA 1JWUD 2M00A 3LWUA 2EYFA 2HUGA 1VQDA 5C3EG 3PGZA 1SNOA 1KABA 1J9OA 2VS1A 5T1GA 3FRPB 4A3IH 3HRZC 1F9RA 4ZKCB 4OO1G 1QCBD 2FINB 4MZ9A 1PH4A 5GROA 1KLGD 1X3QA 5KRUA 2NVXH 1BUVT 4LW1A 3OWFA 3FEWX 5HGQA 4PG3A 3MA2B 3K57A 1CM9A 4Y7NH 1SXTA 3TS0A 2JA8H 4H02A 4O2DA 1TT2A 5LHY1 2YU9B 2NN6G 5M9OA 3TZDA 1Q7YC 5A2QE 3KOJA 4DV0Q 1UWVA 2I5HA 2B2UA 1R9TB 3I4MG 2XNAC 4B3RQ 1FNUA 4A76A 1N8RC 3VYUA 4OX9L 2K05A 2DJGC 2K1BA 1Q8KA 1K28A 2RQXA 3SDZA 5M3MG 3KBGA 4F88A 2DNEA 1BO0A 3AQQA 3V2TA 1G291 1SNMA 4B3TL 1BCPB 1G8ZD 3DEPA 3I8ZA 2KCNA 4KY6A 1CZGA 3M3YB 1S3OA 1JJGA 3GD7A 2B3GA 1IBLL 2OT2A 2NB0A 3P75A 2F0EA 2JA5B 1EWHA 1SE2A 3GTOH 2R7ZB 1W2BA 4KN4C 3ULJA 5FK9C 3W1BA 2F0KA 4O1NA 3HKZG 4IFDG 1KDAA 4B9XA 1NMGA 1U5KA 1PH3A 1I3QB 2A8VA 3OTOL 3DWAA 4JI7Q 2B2YA 2PI2E 2UU9L 2RKSA 2VUMH 1PLFA 4C2MB 4JI3L 2TMPA 1PYWD 1HFGA 1X3EA 2B2VA 3QG1A 1SEBD 2R7FA 1C8CA 1H9SB 1A63A 3SK5A 2UXBQ 5C44G 1SNCA 3G6JB 3V05A 3BG3A 4TVAB 2JA6B 2WAQB 4L5QA 2XRQD 3HOWH 4CKCA 1O7IA 1ILPA 3K7AH 1HZCA 4IUTA 3GTKB 5IY0A 3BDCA 4QGUA 1MKHA 2B8FA 3S15H 3ZJYC 3A74A 1HFNA 1MJCA 4QJFA 1NY4A 4XT1B 1PVOA 3S14H 4A3KB 1JMCA 2EZVA 4V190 4IALA 4C3HH 5M3FG 1SROA 2Z8LA 2A6EC 4EX5A 4LF4Q 1N32L 4FF1A 1XPRA 1WCMB 3EBEA 1J5EQ 1SMXA 1EY9A 4CJ0B 1B2TA 2SOBA 3H3VC 2HQLA 1QVCA 5ISRA 1RJTA 5GAEC 4UPAA 4LUZA 5D3IB 2K01A 1I4XA 4S3SA 1VQ7A 4DV1Q 1HNWQ 2A5HA 4KV6A 2ZJPA 1TS3A 4JPBW 4B3MQ 1WTHA 4JCVE 5CMDA 1X55A 1M1KC 1PH1A 1PRTF 2K33A 4ZLTF 2JE6I 3KK7A 3TREA 4APVA 1PH8A 1YI2A 1TWCH 1CHQD 3K6OA 3BVGA 2UXCL 1CKOA 2K50A 2HDMA 3PF4A 4Y7NB 2MQHA 4HIDA 1YNXA 4DR5Q 1VQNA 5FLXL 2JA8B 5IOCA 3MZ5A 4U68A 4H44C 4XYQA 2NZOA 3E5SA 3URYA 1GVPA 1NJIC 1B9MA 1HJPA 1LTRD 4KKTA 3F2UA 4Y52H 4M8AA 1XMQQ 3A5UA 4P75A 3C1EA 3UDXA 3KJPA 4RFBA 2F0TA 1E1OA 5IIFA 1PFSA 4DNTB 3KF6A 3F8TA 1A8VA 2F0SA 2PQAB 5A35A 2F0MA 2PZUA 1TWHB 1EYAA 4ID6A 1A3UA 2KCMA 2SNSA 5C4XG 2E2JH 1DXMA 4FXKC 4NP5A 1XNQL 5JEAJ 1JQYD 1JOKA 1K8AC 1PZJD 4NXNL 3EQLC 2GVAA 4G4KA 3U58A 1SE4A 3DM1A 4A3FB 1R4PB 5A2QL 4NDXA 2VQEL 3S1QH 1JORA 3GTOB 1SE3A 3HOVH 4GN5A 4BBRB 1Y1WG 1TS5A 3NWSA 2EYOA 1TR5A 2K4KA 1PMRA 1XYIA 1QILA 3K5LA 2Z6KC 1K8MA 1LT6D 1I4HA 2AQ2B 3CCQA 1C4QA 4HIOA 1Q81C 2E2IH 4JBWA 5I9OA 4J1MA 3R2IA 2R7ZG 1FJGL 1PTOH 4I65A 3K59A 1CA6A 1Q82C 1YBYA 1EQQA 1A3VA 3K8AA 1EEID 2Z6BA 1B3QA 4DXGA 5IP9H 1TXYA 4GKKL 4P2CB 1NR2A 1D6EC 3CCRA 1HZ9A 4K0KL 5I4DA 1SFOH 3A7LA 4PMWA 3CC7A 4JI0Q 1EOVA 3HGBA 3K7AB 4AIMA 2RDFA 1TWAH 1F2ZA 1O80A 1ZKOA 4AYBE 3D3RA 3GTQH 3T1YQ 4GN3B 3S15B 4A3CG 3FP9A 3U50C 3MXNA 4LFAL 3FMCA 3S14B 1L1OA 2WAQG 2NN6H 3GTJH 2A68C 3C1FA 4BWGB 2D2CC 4CJ2C 4NXML 2D62A 4JVZA 4C3HB 1EY8A 1NCVA 2X69A 1SJED 3NBIA 4XYOA 1GXDC 1S72A 4C3IB 5M5XH 4DR3L 2EXDA 1HQMC 1CT1D 4DV2L 3S17H 3NEMA 4EQPA 4JI4Q 3D0FA 2BOSA 3MAQA 1KXLA 3TN2A 2K52A 3S1RH 4L5RC 1STBA 4CGYB 3MXGA 3C46A 4XQNA 3G6EA 2F0FA 2MUYA 1VQEA 3K58A 1SSOA 1TWCB 4WORA 1XPUA 4A3DH 1HUMA 2F03A 1EQVA 1WTWA 1OTCA 2PMZB 3RR5A 1IYUA 1EY0A 4PZ6A 2NTSA 2HHHL 3D4WA 4A3IG 1HUNA 1KRTA 2EOTA 2ZJQA 4OWXB 2NZHA 4MTKA 4MTNA 1QJOA 2C9OA 2OEOA 4A3GB 4YHHL 1U4PA 4KK7A 5E4XA 2R93G 3MEHA 3UDFA 3CCUA 4A4IA 2ZXOA 3Q24A 1K83H 4EQNA 1EQTA 2L4NA 3I72A 1MGSA 2RSOA 3J7YW 2QEXA 2JA8G 4G7OC 4GNXC 1YHQA 2PCFB 2OQ0A 3J7AF 1VQ5A 4ZAIA 4QCLA 1GUTA 4WFN3 2LSSA 2B63H 1MBYA 4JI5L 2QCPX 2PI2A 4HMIA 5AJ3Q 3PV0A 5I6YA 4GKJQ 1VF5C 1JB3A 1SYGA 1B4OA 3HOVB 3T1HL 2AQ1B 2AWNA 3T4AC 1TVXA 2EJGC 5FLMH 4O42A 4DK3C 3I73A 2WV6D 1QUQB 4X64Q 1N33Q 3VA5A 2BA1A 1VMPA 2V1CC 1YZ6A 3T13A 3CC4A 3WDNA 4IPDA 1HH2P 1GHKA 5M3FH 2EYMA 3VR2A 2K5VA 2O5JC 2F0IA 1KDBA 1PTOB 1IKLA 5IGBA 3AYHB 4IN3A 2A19A 1UNSA 4DNRB 4JBMA 1TIID 4OGQC 5CC4A 1RODA 1K8OA 3NQIA 1XX8A 3FDTA 1TS4A 4R8IA 1Q12A 2OXPA 5IGDA 5CV6A 2EVBA 5FLXc 1EY6A 1SFOB 4DR6L 5LL6X 1TWAB 2ASBA 1BCPC 2VUMG 5CR3A 4DK0A 2WACA 4E6IA 3CU7A 1IHZA 3K5OA 4ME3A 4A3MH 1D5XC 1ILQA 4OX9Q 3RD4A 2ZXPA 3S24A 1Z6HA 4RGNA 4JI6L 4OO1I 5EKIA 3M4OH 1G91A 4BY7H 1NTGA 3K7UC 3HOWG 1CTMA 1S5ED 2IPKD 4MN3A 2B2UC 1JE4A 2AKWB 5GAGC 4LF9L 1LLRD 1X9NA 3ND8A 1Q90A 4B3TQ 4X66Q 2JA9A 1BR9A 4ZUIA 1Z7TA 2BH8A 5M5XB 3DWPA 4QL5A 1FD7D 1TWFH 1LT3D 5M3MB 4BXXH 4RGTA 1JB7A 1IBLQ 3CC2A 3HG9A 3S17B 4RCNA 2AHOB 2AUKA 4YCUA 1A3TA 1JJ2A 5JOBA 4B3SQ 1YVCA 3S1RB 1N36Q 2HIXA 1WD0A 2UXDL 1GD7A 4X3SA 4MHEA 1HTPA 2VQFL 4KD3A 1S5FD 3HP3A 3OTOQ 4DR1L 1SYBA 1EY4A 1YJNA 1SRUA 2KOLA 3I91A 3WWVA 5IGCA 1G6ZA 1I6HH 2IWHA 3HKZB 1IBKL 1EY7A 4DV7L 3VR4A 3SVMA 5HY6A 5I6WA 5J22A 1X54A 1TWGB 1ESFA 2JQOA 3STBC 4LF7Q 4CDCC 4HCEA 4X3TA 1CA5A 3PQIA 4QY7A 1ENAA 4GS3A 4IFDI 1LTAD 2BE5C 3RZDH 3KF8A 3H91A 4TQUS 3HOUH 2KENA 3S2DH 1G2TA 2X6LA 1QVFA 5C44B 2EYLA 4UY8C 2CQOA 3GV6A 2B63B 2CQAA 5DEHA 2KBNA 5ELEA 1PH2A 3E6ZX 1BXTA 2E76C 1I5FA 3GDEA 3KLRA 4KHZA 1CFMA 1O7YA 1IW7C 5KYLA 5J1ZA 3CCVA 2R7DA 3I3CA 3J81c 1RCVD 4GNXA 1EYCA 3I90A 4JI8L 1N32Q 1VS0A 4N9TA 1C48A 3MEFA 3EROA 2YV5A 1Y69U 5M3FB 3T16A 1KC8C 4DUZQ 3TP5A 2K5NA 1IKMA 3HOVG 1M8AA 4MNOA 5C0XJ 4ZRZA 4RWSC 5GADC 1TS2A 2VXWA 4EGVA 2L15A 1SAPA 2CHBD 4JYAL 5CV5A 4FF3A 1T5EA 1Y8NB 3AEVA 2UXCQ 3NTHA 2XTIA 3K0XA 5C3WA 3FPPA 5FLXE 4X62L 3CP0A 3I4NH 4X3UA 5EKLA 4IOCA 2K14A 1PHJA 4LK1C 5IP9G 5IGGA 1YNNC 2D9UA 4JI2Q 1STAA 4ZKBB 1J8IA 2R61A 2BA0A 2KHSA 4B9WA 3Q22A 2EY6A 1PH6A 1H9KA 1F77A 1D5MC 3KDFB 4DR7L 1CQVA 1H95A 4R4OA 3K5NA 2R93H 1JR0D 2HQEA 1XNQQ 2K5WA 4GOPB 2EXZA 3TBIB 2NVYB 4BY1H 4NXNQ 4DFAA 5M5WB 1AN8A 2Q2HA 1CSPA 5BR8L 2X6GA 3K5MA 4K2KA 4LFCQ 4F8MA 3U4ZA 2VQEQ 5C4XB 4N8X1 3SXHA 1NMFA 5GQOA 4JK1C 5JEAH 2G9HD 3S2HH 1PRTC 1NAPA 4RHRA 3ULLA 4KY7A 2LKVA 2A73B 2RA4A 1ENFA 4JG2A 3PO3H 3VYSA 3SHLA 1Y14B 2P5ZX 2NVQH 3W2DA 1VQCA 5KIXA 1VQBA 4HJ9A 4FP5D 3GO5A 1PYSB 1P8LA 1X3FA 1Y1WB
chains in the Genus database with same CATH topology
1I6HB 5C4HA 5C4JB 3R2TA 2RVLA 4N9PA 1H9SA 2LS01 1WTXA 3V96A 2RSNA 2K7VA 4HSPA 1GHJA 1II3A 1Q3LA 1V1PB 1YNND 3RZDB 1DYQA 4QF4A 4CBVA 4K6LA 4KD4A 3S2DB 4ZQ3A 3GQBA 5F2DA 4ZK9B 2M9VA 3OWEB 2R3ZA 3QJYA 4H0LC 2B2WA 2RBMA 4KJOA 4DN4M 4KKSA 4NW2A 3VR5A 3DEOA 2IX3A 1WTVA 3J81E 1MD2D 3RUZA 4R9WA 1PRTD 2DY7A 4FXGC 3NPPA 3M85A 4K5XA 5G3LD 2PZWA 4NKLA 3VYRA 3OSOA 4C56C 2IX1A 3ITPA 3KBXA 2H4OA 3BYTB 4QIWB 2KEDA 3VA7A 3SK4A 3K0YA 1MI2A 1DCZA 2TSSA 4RA8A 2I07B 5CV4A 1SNQA 2F0GA 4TSSA 1U4MA 1E0BA 5EPJA 1U4RA 3L3OC 4A3IB 5K36H 1DD2A 2EY1A 4OL7A 2PQEA 2PPBC 2R93B 2Z4IA 3MWYW 2NVXB 4L63B 1NR4A 1PXUA 5BN4A 2Q8RE 1WVLA 3S2HB 3NTIA 1U9RA 2HCIA 2IL8A 3VR6A 4U673 1SDFA 5C6AA 2NVQB 1ZXTA 3BVZA 3TP7A 4FVMA 2Q8IB 3OHXC 4DK1A 2A6ED 1GJXA 1STYA 2H1EA 1SBBB 1Q8IA 1XXGA 4KY5A 1BOSA 3OIPA 2F0JA 2Q8TA 4G7HC 2XSCA 3NP8A 2A6HC 2A69C 3M7GA 1A15A 3J7AV 3NK9A 5CYUA 1UUPA 1E2WA 1PZKD 1AZPA 1LTBD 2VUMB 1PFMA 1EOTA 3RZOB 4M1UB 4F87A 1HRJA 3SEBA 5CBAE 3QOJA 2WKCA 1DOMA 5DM63 5NUCA 3ERQA 2L1BA 1BQQT 3HOWB 2E2HB 3BDOA 3AU7A 1D1KA 3W3AA 5CBEE 5I2XA 2FJ2A 3RLFA 1KAAA 1B50A 4HN7A 5E3FA 2HCCA 3CRLC 3A54A 3J81L 1LTID 3DXJC 3IKJA 3T53B 1LABA 1HTLD 2KUMA 2EY5A 3TZUA 1DZ1A 2L11A 5ELCA 1RF2D 1SYEA 3P1HA 1Q1EA 2IX0A 1WTRA 1PTOF 4CKEA 2J7ZA 5KNCA 2N88A 2ICIA 3GTPB 2BDNA 2KECA 4KHVA 2AQ3B 1AEXA 2BDOA 1O78A 1YNJC 3I70A 2LMCB 1HQRD 4RGMA 2DY8A 5KYIA 4I7ZC 4ABNA 3TP8A 5KEEA 2B2TC 3ZYYX 3HZXA 5JAVA 3D4RA 2WKDA 5EKKA 2K04A 4HR7B 1LTSD 3JAME 2L0CA 2IT1A 2G9DA 2MP1A 2QKIC 2A68D 2E2JB 1KDCA 4Z9CB 5JEAG 2FMMA 1F9SA 2XIWA 1EIHA 5CV8A 2JSOA 1KTKA 4J8QA 1EEFD 2ID0A 4A3BB 2NTTA 3BZDB 1LT4D 3S1QB 2XWBB 2B8GA 5C0XH 5JPMC 2ZT9C 2VNUD 4RCOA 3TDQA 3BYYB 4K2LA 4RHSA 1VF7A 2FHTA 1FNWA 3KLSA 2E2IB 1F2LA 2L12A 3MXUA 3LNNA 2KVMA 4CKBA 5FKAC 1KNEA 2WINB 4EVOA 1I4RA 4L8JA 2M2LA 2VB2X 1CZWA 5JVG3 1O7LA 1UEAB 2V4DA 1EZ8A 2EDGA 3C2PA 2PW7A 1WD1A 3TP6A 4HCSA 1DONA 3GTQB 1F2YA 3R93A 1RKNA 3TMEA 3A7AB 3SK8A 2CW0C 1OO9B 3X3MA 3GTJB 1OXSC 4KJNA 3NXWA 2WIIB 5TSSA 3IFDA 2NN6I 4FF2A 2NBFA 4OHJA 2IJ0A 1EIGA 2Z4HA 4K8JA 5EGTA 1CHPD 5EQ0A 4FO2A 4XIGS 4HTHA 3S1NB 1G2SA 1GUOA 3QWNA 1TQOA 5KNBA 1EYDA 2SNMA 4QMGA 1Y8OB 1L0XB 2JP1A 1QOHA 4A3DB 1A2UA 2E74C 1RTNA 3KUPA 4A3JB 4HSVA 5K36G 1BCPD 3S16B 4IUPA 2B2WC 5C3XA 1H9RA 1ML0D 2SDFA 3QB3A 4ZUJA 1K83B 5IT9L 2O5IC 2F0HA 1VDZA 3H0GB 4KKUA 5BN3A 1LACA 5JPNC 4RGOS 5EJWA 1OXTA 2B2TA 1U4LA 1EL0A 3OW7A 2EYJA 1O7ZA 1ZYRC 4PMCA 4K5VA 4XDXA 2K32A 4IFDJ 5ELFA 1OXUA 2EY2A 4IQZA 1GOZA 2QDBA 2F0OA 4WJWA 3VR3A 1Z47A 4C1NK 3JAML 4DA2A 4LJZC 1S5BD 4C3JG 2C5CA 5EPLA 1V8QA 3WOFA 1SYFA 2XRSD 4IUUA 1CQFA 1DJRD 3EVQA 3I4LA 1LTGD 4B08A 1LTTD 3T51B 3J80L 4XTCS 3PIO3 1JOOA 2F0LA 4CHTB 1FR3A 3OOCA 2BE5D 4A3MB 4K5WA 1S5CD 5EPKA 4PQXA 3D6CA 4ILWA 3M4OB 4BY7B 3EJIA 3L7ZC 2OF1A 1IW7D 4WRDA 1Y8PB 1BBXC 4OIKA 3FPUB 3OPOA 2PNRC 1TWFB 3QOLA 1I50B 1V1PA 4AYBB 1LV9A 2FMCA 3PUZA 3A8IE 3C3LA 5KNDA 1TKWB 5E1FA 2KQ3A 5FO9B 1SNDA 2IW3A 2F0WA 4HAEA 2ENBA 1PFNA 2QEJC 1JC7A 3PUWA 3H94A 3R8BA 1H9JA 4IUNA 3M4YA 3PUXA 3FVQA 2PO4A 3HOUB 1MSGA 1V1OA 1EZ6A 3AMUA 2EJFC 5DAUA 4IURA 4X3KA 3O13A 1GUGA 2DN8A 2K28A 5I2YA 4LMQD 1HHVA 3A8JE 5K5PA 2F0DA 4ZYSA 4MIUA 3BDLA 5E4WC 3SE0A 2MPMA 1IYVA 2EJMA 1BDOA 4KTAA 4IUVA 3ONAB 3D31A 2F3WA 3N6RA 4Q0FA 3IL8A 3OIQA 4TKOB 1JCKB 4TRDA 5C0XG 1HPCA 4ULLA 3U9SA 5EBDA 1JWSD 4L6TB 4H7BA 4KN7C 3T56B 1LT5D 2KEEA 3SR1A 4FXDA 1NUCA 1PFBA 2XVSA 1SMYC 3I4NB 2RDGA 1L0YB 3D6WA 5EBCA 1ESRA 4YIJA 3UI2A 4PNYA 1B3AA 1JWMD 1DOKA 4QB4A 3VYTA 3NUCA 1SNPA 3NSWA 2WP8J 1CI3M 2Y0SB 5J39A 2PZTA 2WB1B 5DM73 3NWTA 3D4DA 1PZID 1ET6A 1EU4A 4K14A 1EWCA 2K5QA 1DM0B 1OXVA 1H9MA 3MHBA 1CK1A 4BY1B 1F9PA 2EYPA 1QE6A 4DU9A 1PTOC 2NYZD 2K03A 3LWEA 2QF7A 2F0NA 1BF4A 2K6AA 3DUZA 1HXYD 1D5ZC 3BS1A 3PO3B 1STNA 2JXMB 4PV1C 2JYOA 1W6JA 3Q23A 1GUNA 5G3LF 5D65A 5IGFA 2N55A 4DXFA 1VCIA 1FYCA 3H6MA 1SMYD 1FNVA 4XT3B 1NSNS 2KCCA 2F0PA 3DHQA 5T1IA 3NBHA 5C5MA 5BN5A 1QG7A 3N52A 1A6XA 1XTCD 4G57A 5FO8B 3X3NA 1GUSA 2RDHA 2PW5A 2J0TD 3CHBD 5C5LA 2E2DC 1PTOD 1PDQA 3FKIB 3PO2B 2F0VA 3HOXB 5M5YB 3GTGB 2DNCA 1QB5D 3EFXD 3L9AX 4OIJA 1D2BA 2FFKB 3ND9A 1PRTB 4UDUC 2R92B 5AFWA 2LY7A 5CV9A 3D8GA 4V0BA 1B53A 4OO1H 1KLUD 4ODGA 5CGKA 4XQQA 2ICEC 3MVVA 1RHPA 2O2LD 4DGZA 3HEJA 3AB9A 2A6HD 2A69D 5IGEA 4NMZA 5IT9E 2AUJD 4BBSB 3GV3A 2MHVA 4XXEA 3OMCA 4FYDA 3NHHA 4KMUC 2I46A 3S9WA 2LFNA 5JVH3 1I4QA 3DMUA 2L9HA 1I6VC 1S4ZA 1TU2B 3HOZB 1STHA 1X32A 1TY0A 3P7JA 1JICA 3MFYA 1EY5A 2HDLA 3TSSA 1EU3A 1X3PA 1OXXK 5KGUA 4IFDH 3H09A 2NVTB 5D3DA 4QUCA 4Q5VA 2NUCA 4QUFA 5I9PA 4ME5A 1QNUA 3NQTA 1DOLA 4C3JB 3J80E 1F2MA 4DAPA 1RDPD 2GA4B 2J4XA 2SEBD 3PIP3 3M7NA 1ICWA 4RKLA 3IFTA 2EE1A 1ET9A 5FOBB 2KA7A 1SJHD 1YNJD 1WTOA 1JOQA 4FNFA 1V43A 3G7LA 3HS0C 2YYZA 2BCOA 3MXPA 3PMFA 1MSHA 5ELBA 1HCZA 4IUQA 5FO7B 4PMBA 4DF7A 2E75C 3RMHA 4K8IA 3QIAA 1Q1BA 3DWQA 1I4GA 1B9NA 2JEAI 2CVRA 3QO2A 5C3EB 4IZ8A 1STGA 1E2VA 4RKBA 3E0JA 4A93B 4DAVA 2VB3X 2Z1CA 1BNZA 5COYA 2F0UA 4CJ1B 4K6DA 4R8NA 1B1ZA 1IL8A 4HEDA 1S5DD 5HURA 1VMCA 4J6HA 1GUWA 4UAIA 3PUVA 3I4MB 2NWGA 4EQOA 3R3OA 4RH6A 2MJ8A 4A3EB 1AP0A 5ELDA 1QWYA 2XWJB 3OMGA 3MFGA 4C3HG 4H13C 1AFPA 2O4XA 1UAPA 4F7XA 3GTLB 4C3IG 2D5DA 1LO5D 3PUYA 1WTPA 2CW0D 1D1IA 1M4VA 4BA1I 2JEBI 3A8KE 4DAYA 2NZ1D 3Q6SA 3LX0A 2F0QA 5CORA 1Y1VB 1QNKA 4KI0A 2B2YC 2ZXRA 2JA7B 3HOYB 2B39A 3IAYA 2A74C 3WOEA 4BS9A 2L5TA 2F3VA 4XQJA 2B2VC 1SYCA 2PYKA 4LAAA 1W6KA 3A55A 5JJZA 4G7ZC 4C1NI 1STEA 5IODA 5C0XI 2MGSA 4HMJA 2AWOA 3CKIB 2F1MA 1ENCA 2F4IA 2KJXA 3A56A 3EA6A 1XWEA 1A2TA 2XN9C 5CV7A 1E2ZA 4FF4A 3SK6A 3MC0B 1SYDA 4RAUC 1ZEQX 5LL6S 3P20A 1B44D 5D14A 3Q0AA 1WTQA 1HA6A 1F9QA 3GTMB 1BCPF 4BA2I 1RD9D 1HA5A 3NE5B 2EYHA 1RTOA 1I4PA 5C4ZA 1AZQA 3U9OA 3CQZB 3BVMA 1ONLA 3NTKA 4GZYC 5HGTA 2L55A 3S1MB 2R6GA 3CRKC 1R4QB 1FGBD 1AW7A 1ZYRD 3KLSX 1KNAA 2EPBA 1T5XD 1TY2A 3MTSA 3GP7A 2QILA 5DNFA 2K5DA 1JWUD 2M00A 3LWUA 2EYFA 2HUGA 1SNOA 1KABA 1J9OA 5T1GA 3FRPB 3HRZC 1F9RA 4ZKCB 4OO1G 1QCBD 2FINB 1KLGD 1X3QA 5KRUA 1BUVT 3OWFA 3FEWX 3K57A 3MA2B 1CM9A 1SXTA 1TT2A 5LHY1 2YU9B 2NN6G 5M9OA 3TZDA 5A2QE 2B2UA 1R9TB 2XNAC 1FNUA 3VYUA 2K05A 2K1BA 2RQXA 3SDZA 3KBGA 4F88A 2DNEA 1BO0A 3V2TA 1G291 1SNMA 1BCPB 1G8ZD 3DEPA 3I8ZA 2KCNA 4KY6A 1CZGA 3M3YB 3GD7A 2OT2A 2NB0A 3P75A 2F0EA 2JA5B 1EWHA 1SE2A 2R7ZB 4KN4C 5FK9C 2F0KA 4O1NA 4IFDG 1KDAA 4B9XA 1I3QB 3DWAA 2B2YA 2RKSA 1PLFA 4C2MB 2TMPA 1PYWD 1HFGA 2B2VA 3QG1A 1SEBD 1C8CA 1H9SB 3SK5A 1SNCA 3G6JB 3V05A 3BG3A 2JA6B 2WAQB 2XRQD 4CKCA 1ILPA 4IUTA 3GTKB 3BDCA 2B8FA 1HFNA 4XT1B 4A3KB 2EZVA 4V190 4IALA 2Z8LA 2A6EC 4FF1A 1WCMB 1EY9A 4CJ0B 1B2TA 2SOBA 3H3VC 5ISRA 1RJTA 5D3IB 2K01A 1I4XA 4S3SA 2A5HA 4KV6A 1TS3A 5CMDA 1PRTF 2K33A 4ZLTF 2JE6I 3KK7A 1CHQD 3K6OA 3BVGA 2HDMA 4Y7NB 2JA8B 5FLXL 5IOCA 3MZ5A 4U68A 4H44C 4XYQA 3E5SA 3URYA 1B9MA 1LTRD 4KKTA 3F2UA 4M8AA 3C1EA 4RFBA 2F0TA 5IIFA 4DNTB 2F0SA 5A35A 2F0MA 2PZUA 1TWHB 1EYAA 4ID6A 1A3UA 2SNSA 1DXMA 4FXKC 4NP5A 5JEAJ 1JQYD 1JOKA 1PZJD 3EQLC 4G4KA 1SE4A 3DM1A 4A3FB 1R4PB 5A2QL 4NDXA 1JORA 3GTOB 1SE3A 4BBRB 1TS5A 3NWSA 2EYOA 1TR5A 1PMRA 1XYIA 1QILA 3K5LA 1K8MA 1LT6D 1I4HA 2AQ2B 1C4QA 4JBWA 5I9OA 4J1MA 3R2IA 1PTOH 4I65A 3K59A 1CA6A 1A3VA 1EEID 4DXGA 4P2CB 1NR2A 1D6EC 5I4DA 3A7LA 4PMWA 3K7AB 3HGBA 2RDFA 1F2ZA 1O80A 1ZKOA 3D3RA 3S15B 3MXNA 3FMCA 3S14B 2NN6H 2A68C 3C1FA 4BWGB 2D2CC 4CJ2C 2D62A 4C3HB 1EY8A 1NCVA 2X69A 1SJED 3NBIA 4XYOA 1GXDC 4C3IB 1HQMC 1CT1D 4EQPA 2BOSA 3MAQA 3TN2A 1STBA 4CGYB 3MXGA 3C46A 4XQNA 2F0FA 2MUYA 3K58A 1SSOA 1TWCB 4WORA 1HUMA 2F03A 1EQVA 1WTWA 2PMZB 1IYUA 1EY0A 2NTSA 3D4WA 1HUNA 2EOTA 1QJOA 2C9OA 2OEOA 4A3GB 1U4PA 4KK7A 5E4XA 3MEHA 2ZXOA 3Q24A 4EQNA 1EQTA 2L4NA 3I72A 1MGSA 2RSOA 3J7YW 4G7OC 2PCFB 3J7AF 4ZAIA 4QCLA 1GUTA 4WFN3 1MBYA 2QCPX 4HMIA 3PV0A 5I6YA 1VF5C 1JB3A 1SYGA 1B4OA 3HOVB 2AQ1B 2AWNA 3T4AC 1TVXA 2EJGC 4O42A 3I73A 2WV6D 3VA5A 2BA1A 1VMPA 3T13A 3WDNA 1GHKA 2EYMA 3VR2A 2O5JC 2F0IA 1KDBA 1PTOB 1IKLA 5IGBA 4IN3A 4DNRB 1UNSA 1TIID 4OGQC 5CC4A 1RODA 1K8OA 3NQIA 1XX8A 3FDTA 1TS4A 4R8IA 1Q12A 2OXPA 5IGDA 5CV6A 2EVBA 1SFOB 1EY6A 5LL6X 1TWAB 1BCPC 5CR3A 4DK0A 2WACA 4E6IA 3CU7A 1IHZA 3K5OA 1D5XC 1ILQA 3RD4A 2ZXPA 4OO1I 1Z6HA 4RGNA 5EKIA 1G91A 1CTMA 1S5ED 2IPKD 4MN3A 2B2UC 1JE4A 1LLRD 3ND8A 1Q90A 1BR9A 4ZUIA 1Z7TA 5M5XB 3DWPA 1FD7D 1LT3D 5M3MB 4RGTA 3HG9A 3S17B 4RCNA 2AUKA 1A3TA 5JOBA 3S1RB 1WD0A 4X3SA 4MHEA 1HTPA 4KD3A 1S5FD 3HP3A 1SYBA 1EY4A 2KOLA 3I91A 5IGCA 1G6ZA 2IWHA 3HKZB 1EY7A 3VR4A 3SVMA 5I6WA 5J22A 1TWGB 1ESFA 4HCEA 4X3TA 1CA5A 1ENAA 4IFDI 1LTAD 2BE5C 3KF8A 3H91A 4TQUS 1G2TA 2X6LA 5C44B 2EYLA 3GV6A 2B63B 2CQAA 5DEHA 5ELEA 3E6ZX 1BXTA 2E76C 3KLRA 4KHZA 1CFMA 1O7YA 1IW7C 5KYLA 5J1ZA 3I3CA 1RCVD 1EYCA 3I90A 4N9TA 1C48A 3EROA 1Y69U 5M3FB 3T16A 3TP5A 1IKMA 1M8AA 5C0XJ 4ZRZA 4RWSC 1TS2A 2VXWA 4EGVA 1SAPA 2CHBD 5CV5A 4FF3A 1T5EA 1Y8NB 3NTHA 5C3WA 3FPPA 5FLXE 4X3UA 5EKLA 4LK1C 5IGGA 1YNNC 2D9UA 1STAA 4ZKBB 1J8IA 2R61A 2BA0A 2KHSA 4B9WA 3Q22A 2EY6A 1H9KA 1F77A 1D5MC 1CQVA 3K5NA 1JR0D 2HQEA 2K5WA 2EXZA 3TBIB 2NVYB 4DFAA 5M5WB 1AN8A 2X6GA 3K5MA 4K2KA 4F8MA 5C4XB 3SXHA 4JK1C 5JEAH 2G9HD 1PRTC 1NAPA 4RHRA 4KY7A 2LKVA 2A73B 2RA4A 1ENFA 3VYSA 3SHLA 3W2DA 5KIXA 4FP5D 3GO5A 1EFID 1Y1WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  2EYH A;  4K2L A;  5J1Z A;  1EY6 A;  2F0T A;  5C4H A;  5KGU A;  5C5L A;  5C4Z A;  1NUC A;  4EQP A;  3U9O A;  3R3O A;  4EQO A;  5C3X A;  5IIF A;  4N9P A;  3QB3 A;  4ZUJ A;  2F0S A;  1EYC A;  2F0M A;  2PZU A;  1KAA A;  5CR3 A;  4N9T A;  2F0H A;  2RKS A;  2WAC A;  1EYA A;  1STB A;  1A3U A;  2NUC A;  4ID6 A;  2F0V A;  5E3F A;  4E6I A;  5HGT A;  2SNS A;  5I9P A;  1IHZ A;  3ERO A;  1II3 A;  2F0F A;  4YIJ A;  4ME5 A;  4PNY A;  4NP5 A;  5E1F A;  4EVO A;  3NQT A;  3OMG A;  1JOK A;  4QB4 A;  4WOR A;  3SK5 A;  4QF4 A;  3NUC A;  3T16 A;  1SNP A;  2O4X A;  1EQV A;  2KQ3 A;  1F2M A;  1SNC A;  1U9R A;  3TP5 A;  5J39 A;  4KD4 A;  2EY5 A;  1EY0 A;  2PZT A;  4F7X A;  4ZQ3 A;  2M00 A;  1SND A;  2EYF A;  4NDX A;  5F2D A;  1JOR A;  1SNO A;  4OL7 A;  2EYJ A;  1KAB A;  3D4W A;  4PMC A;  2F0W A;  1SYE A;  3D4D A;  4K5V A;  1EZ8 A;  5C6A A;  1KDA A;  3P1H A;  4K14 A;  4ZUI A;  2PW7 A;  2EYO A;  3TP7 A;  1TR5 A;  5CV5 A;  3BDC A;  3TP6 A;  2OEO A;  2ENB A;  4RKL A;  2RBM A;  3MHB A;  4KJO A;  5CV9 A;  3MEH A;  1F2Y A;  3D8G A;  2EYP A;  1RKN A;  3TME A;  4DU9 A;  3SK8 A;  2EY2 A;  3LX0 A;  5C3W A;  2F0Q A;  2QDB A;  4ODG A;  1A3T A;  4EQN A;  5KRU A;  5I9O A;  1JOQ A;  2F0O A;  3OWF A;  5JOB A;  4IUN A;  4J1M A;  5EKL A;  5CGK A;  3RUZ A;  4KHV A;  2F0N A;  1AEX A;  1STY A;  3MVV A;  3MXP A;  4I65 A;  4DGZ A;  4IAL A;  3HEJ A;  1EZ6 A;  1TT2 A;  4KJN A;  5IGG A;  3NXW A;  5M9O A;  1STN A;  3PMF A;  1SYF A;  5DAU A;  1A3V A;  1STA A;  4KD3 A;  4NMZ A;  5IGE A;  2F3V A;  4KY5 A;  2KHS A;  1EY9 A;  2F0J A;  4K5X A;  4B9W A;  2SOB A;  1SYC A;  2EY6 A;  3EVQ A;  2PZW A;  1SYB A;  4NKL A;  1EY4 A;  4PMB A;  4DF7 A;  2PYK A;  4HMI A;  4LAA A;  4K8I A;  5IGF A;  5KYI A;  5ISR A;  5IGC A;  5I6Y A;  3NP8 A;  3TP8 A;  5K5P A;  5KEE A;  2F0D A;  1SYG A;  3NK9 A;  5IOD A;  1JOO A;  2RDF A;  3H6M A;  3HZX A;  1F2Z A;  1EY7 A;  2F0L A;  3OSO A;  3BDL A;  4MIU A;  4S3S A;  5JAV A;  2HQE A;  4K8J A;  4KV6 A;  4IZ8 A;  3V2T A;  3ITP A;  5EGT A;  5EKK A;  1STG A;  3OMC A;  2EXZ A;  4HTH A;  1NSN S;  1SNM A;  5I6W A;  2F0P A;  4RKB A;  3DHQ A;  4HMJ A;  4DFA A;  3VA5 A;  5J22 A;  5C5M A;  1TQO A;  1EYD A;  2SNM A;  4QMG A;  1KDC A;  3SK4 A;  4K2K A;  3NHH A;  3T13 A;  4K5W A;  1ENC A;  4F8M A;  3S9W A;  1ENA A;  4KY6 A;  4KTA A;  3SXH A;  2EYM A;  3D6C A;  5CV8 A;  1A2T A;  5CV7 A;  2F3W A;  1A2U A;  3DMU A;  3QOJ A;  2F0U A;  4KY7 A;  2F0I A;  2LKV A;  1KDB A;  1SNQ A;  2F0G A;  3C1F A;  4K6D A;  4TRD A;  5CV4 A;  3SK6 A;  4G57 A;  5IGB A;  1EY8 A;  1SYD A;  2F0E A;  3EJI A;  3P75 A;  3MZ5 A;  4R8N A;  5IOC A;  2EYL A;  2OF1 A;  3ERQ A;  4WRD A;  5NUC A;  5CC4 A;  3E5S A;  3SHL A;  5DEH A;  5HUR A;  4J6H A;  1STH A;  5KIX A;  2PW5 A;  1EY5 A;  4H7B A;  2OXP A;  3C1E A;  2F0K A;  5IGD A;  3SR1 A;  5CV6 A;  2EY1 A;  3QOL A;  4B9X A;  5KYL A; 
#chains in the Genus database with same CATH topology
 1I6H B;  2N8N A;  5C4H A;  1FJG Q;  5C4J B;  3R2T A;  5FJ8 G;  2RVL A;  4N9P A;  1H9S A;  2LS0 1;  1WTX A;  3V96 A;  2RSN A;  2K7V A;  4HSP A;  1GHJ A;  1II3 A;  2ES2 A;  1XTD A;  1IBM Q;  1Q3L A;  4A3D G;  1V1P B;  4K0K Q;  1YNN D;  3RZD B;  1DYQ A;  4QF4 A;  1IYJ B;  4CBV A;  4ALP A;  4K6L A;  4DV5 Q;  4KD4 A;  3S2D B;  1AH9 A;  4ZQ3 A;  3GQB A;  5F2D A;  4ZK9 B;  1V1Q A;  2M9V A;  3OWE B;  2R3Z A;  3CCJ A;  1XNR Q;  4DAM A;  3QJY A;  1BVS A;  5JJI A;  4EQ5 A;  4H0L C;  1HNX L;  1N34 L;  1G6P A;  2B2W A;  2RBM A;  4KJO A;  2HIV A;  4DK6 C;  4KKS A;  4NW2 A;  3VR5 A;  4DN4 M;  3RZO H;  3DEO A;  4NXM Q;  3H0G G;  2IX3 A;  1WTV A;  1L0W A;  3J81 E;  3FKI H;  1VQM A;  1MD2 D;  3RUZ A;  3PO2 H;  4R9W A;  1PRT D;  1L1O C;  2DY7 A;  2B63 G;  4DR3 Q;  4FXG C;  1YIT A;  4LWC A;  3NPP A;  4RMF A;  3NEL A;  3GTG H;  2E2H H;  2VZA A;  3M85 A;  2I0Q A;  4R4Q A;  4K5X A;  5G3L D;  2PZW A;  4NKL A;  3E9H A;  1JT8 A;  1LUZ A;  3E3X A;  5FLM G;  3VYR A;  3OSO A;  4C56 C;  2R92 H;  2IX1 A;  3ITP A;  4DR4 L;  3KBX A;  2H4O A;  3BYT B;  4QIW B;  4IOA A;  2KED A;  3VA7 A;  3SK4 A;  4JBJ A;  1GO3 E;  3K0Y A;  1MI2 A;  1SR3 A;  1DCZ A;  2D0O A;  2HHH Q;  2TSS A;  1ASZ A;  4RA8 A;  2I07 B;  5CV4 A;  1SNQ A;  2F0G A;  1GKH A;  1UE1 A;  4TSS A;  2CH4 A;  1U4M A;  2ZTE A;  1E0B A;  4YHH Q;  5EPJ A;  1ICF B;  3PIO A;  1U4R A;  3L3O C;  1KIX A;  2PQA A;  4A3I B;  5K36 H;  1DD2 A;  2EY1 A;  4OL7 A;  4O0A A;  2PQE A;  4BBS H;  5IYB H;  1C0A A;  2MFI A;  3GTP H;  2XGT A;  2PPB C;  2R93 B;  2Z4I A;  3MWY W;  2NVX B;  4L63 B;  4A3M G;  1NR4 A;  1PXU A;  4JI5 Q;  5BN4 A;  4QQB X;  4BY7 G;  2Q8R E;  3L2P A;  1WVL A;  3S2H B;  3I2Z A;  3T1H Q;  3NTI A;  1U9R A;  2HCI A;  2IL8 A;  3VR6 A;  4U67 3;  1SDF A;  4GLA C;  4JV5 L;  5C6A A;  2NVQ B;  1ZXT A;  4BXX G;  3BVZ A;  3K80 C;  3JAM c;  3TP7 A;  1M90 C;  4FVM A;  2Q8I B;  3OHX C;  4YWL A;  3PF5 A;  1JJC B;  4DK1 A;  4KHP L;  1L2F A;  4DPG A;  2CCZ A;  2A6E D;  1GJX A;  1STY A;  3J81 j;  4A3B H;  2H1E A;  1K8G A;  4GLV B;  1SBB B;  1Q8I A;  4X65 L;  1S40 A;  1XXG A;  4DR6 Q;  4KY5 A;  1BOS A;  3OIP A;  2F0J A;  3QR8 A;  4HJ8 A;  2Q8T A;  2AMC B;  1VQK A;  4G7H C;  2XSC A;  3NP8 A;  2A6H C;  2A69 C;  3M7G A;  1SE8 A;  1A15 A;  3J7A V;  3NK9 A;  2YTV A;  5IP7 H;  3H3V H;  5CYU A;  1UUP A;  1VQ4 A;  2CWA A;  1E2W A;  1PZK D;  1AZP A;  1D8L A;  1LTB D;  1XPO A;  2VUM B;  1PFM A;  1EOT A;  4DV0 L;  3RZO B;  4M1U B;  4F87 A;  1HRJ A;  3SEB A;  3HOU G;  4LF9 Q;  3RNU A;  5CBA E;  3DM3 A;  3QOJ A;  2WKC A;  3NBH B;  1DOM A;  5DM6 3;  5NUC A;  3ERQ A;  2L1B A;  1BQQ T;  2QGQ A;  3HOW B;  3H15 A;  2E2H B;  4DV6 L;  3BDO A;  3AU7 A;  1D1K A;  3W3A A;  4JW0 A;  2F4V Q;  5CBE E;  5I2X A;  3EN2 A;  3G71 A;  3I55 A;  2FJ2 A;  2UXD Q;  2CH4 W;  3RLF A;  2VQF Q;  1KAA A;  1B50 A;  4HN7 A;  5E3F A;  2RF4 A;  4DR1 Q;  4A93 H;  2HCC A;  3CRL C;  2IHE A;  3A54 A;  3J81 L;  1LTI D;  3DXJ C;  1HNZ L;  3IKJ A;  3T53 B;  1LAB A;  1HTL D;  1IBK Q;  2KUM A;  3I56 A;  4DV7 Q;  2EY5 A;  5JJK A;  4YWK A;  4POG A;  3TZU A;  1DZ1 A;  2L11 A;  4LUV A;  4R4C A;  4JI7 L;  5ELC A;  1RF2 D;  2Q2T A;  3OYY A;  1PH9 A;  3CCL A;  1SYE A;  3P1H A;  1Q1E A;  2IX0 A;  1WTR A;  1PTO F;  3S1N H;  4CKE A;  3J81 i;  5FJ8 H;  2J7Z A;  5KNC A;  1YHB A;  1BKB A;  2N88 A;  3TQY A;  2ICI A;  3I4N G;  3GTP B;  2BDN A;  1EIY B;  3E9I A;  4A3E H;  4FDB A;  2KEC A;  3B6Y A;  4J15 A;  4KHV A;  2AQ3 B;  1AEX A;  1VQA A;  2BDO A;  2Q2U A;  4HJ7 A;  2CWP A;  1O78 A;  1YNJ C;  3I70 A;  3ER0 A;  4A3J H;  2Y0S G;  2LMC B;  2WB1 G;  4PZ8 A;  1HQR D;  4RGM A;  2UUB L;  2DY8 A;  1I94 L;  1QUQ A;  5ELN A;  1Q86 C;  4JI8 Q;  5KYI A;  2E5L Q;  1WJJ A;  3GTL H;  4I7Z C;  1DGS A;  4ABN A;  3TP8 A;  3S16 H;  5KEE A;  2B2T C;  3ZYY X;  3HZX A;  5JAV A;  4AQY L;  2ZTD A;  4BY1 G;  3ULP A;  1VQH A;  3D4R A;  2I5M X;  2WKD A;  5EKK A;  2K04 A;  4HR7 B;  1LTS D;  1PH7 A;  2C35 B;  3H0G H;  3JAM E;  1UE6 A;  2L0C A;  1VQI A;  2G9D A;  2IT1 A;  2MP1 A;  2QKI C;  2A68 D;  2E2J B;  1KDC A;  4Z9C B;  5JEA G;  3G4S A;  3F2C A;  2FMM A;  4P71 A;  1Y1V H;  1F9S A;  2XIW A;  2Z0S A;  1EIH A;  5CV8 A;  2JSO A;  3PO3 G;  4DNI A;  2JA7 H;  1KTK A;  4J8Q A;  1EEF D;  2ID0 A;  4A3B B;  3HOY H;  2NTT A;  2WAQ E;  4DV1 L;  1HNW L;  3BZD B;  1LT4 D;  3S1Q B;  2XWB B;  4CDE C;  4B3M L;  2B8G A;  5E7N A;  5C0X H;  3K81 C;  5JPM C;  3TRZ A;  2ZT9 C;  5IYC H;  2VNU D;  1E24 A;  2JJQ A;  4RCO A;  3TDQ A;  2ZM6 Q;  5LMN L;  3BYY B;  1KHI A;  4GOP C;  4K2L A;  4LNQ A;  4RHS A;  1VF7 A;  2FHT A;  1FNW A;  3KLS A;  2E2I B;  1F2L A;  2L12 A;  4GN4 B;  4QIW E;  3MXU A;  3LGJ A;  2B29 A;  3W5O A;  3LNN A;  2KVM A;  2EIF A;  4CKB A;  5FKA C;  1KNE A;  2WIN B;  3H3V I;  4EVO A;  4DR7 Q;  1I4R A;  1BBU A;  4L8J A;  5ELO A;  2M2L A;  2VB2 X;  1CZW A;  5JVG 3;  2LXK A;  2QA4 A;  1O7L A;  4JI1 L;  5L37 A;  4A3L G;  1UEA B;  2V4D A;  4IJL A;  5BR8 Q;  1EZ8 A;  2EDG A;  3C2P A;  2PW7 A;  2A1A A;  1SLJ A;  1WD1 A;  3TP6 A;  4HCS A;  1DON A;  3BZK A;  1MHW C;  1GM5 A;  3GTQ B;  1F2Y A;  1PA6 A;  3R93 A;  2G5D A;  1RKN A;  3FKI G;  3TME A;  3A7A B;  3PO2 G;  3SK8 A;  3CQZ H;  1YHA A;  2CW0 C;  1OO9 B;  3X3M A;  2MO1 A;  3GTJ B;  1EWI A;  3S1M H;  2VL6 A;  1OXS C;  4KJN A;  3NXW A;  2WII B;  5TSS A;  4R4T A;  4HJ5 A;  3NEN A;  3IFD A;  4N8F A;  2NN6 I;  1CKN B;  4IO9 A;  4FF2 A;  1E7Z A;  3KYH C;  5LMU L;  2NBF A;  2UUA L;  2R92 G;  4OHJ A;  1I50 H;  3ERS X;  1UE5 A;  2IJ0 A;  1EIG A;  2Z4H A;  4K8J A;  5EGT A;  1CHP D;  5EQ0 A;  4FO2 A;  4XIG S;  4HTH A;  3DLL A;  3S1N B;  1G2S A;  2HD3 A;  1GUO A;  3QWN A;  1CUK A;  1TQO A;  1EYD A;  2SNM A;  4QMG A;  5KNB A;  5IWA L;  1Y8O B;  1L0X B;  2JP1 A;  2ZTC A;  1QOH A;  3HKS A;  4A3D B;  1A2U A;  2E74 C;  1N34 Q;  1RTN A;  2YU9 H;  3UE1 A;  3KUP A;  2UU9 Q;  4A3J B;  4YCV A;  4JI3 Q;  3T1Y L;  3Q8D A;  3CME A;  4HSV A;  5K36 G;  4UP7 A;  4BBS G;  5IYB G;  1BCP D;  1E1T A;  3M4P A;  3S16 B;  4IUP A;  1VQF A;  2B2W C;  5C3X A;  2GN5 A;  1H9R A;  1ML0 D;  2CKZ B;  2SDF A;  3QB3 A;  1K83 B;  4ZUJ A;  5IT9 L;  2O5I C;  3I4O A;  2F0H A;  4X6A H;  1VDZ A;  3H0G B;  4KKU A;  3SGI A;  5BN3 A;  1LAC A;  5JPN C;  4HJA A;  3RLN A;  1K0R A;  3M3Y H;  4RGO S;  5EJW A;  4JI4 L;  3HOZ G;  1OXT A;  5IYD H;  4DR4 Q;  2B2T A;  1U4L A;  3PSI A;  1EL0 A;  4UP8 A;  3OW7 A;  1RL2 A;  2EYJ A;  1O7Z A;  5J3B A;  1ZYR C;  4PMC A;  4K5V A;  4XDX A;  4L5S A;  2RCF A;  2K32 A;  2OTL A;  2ALY B;  1Q46 A;  5ELF A;  4OWW B;  4IFD J;  4OXP A;  4DV4 L;  1I3Q H;  1WOC A;  1OXU A;  2EY2 A;  4IQZ A;  1GOZ A;  3UDI A;  2QDB A;  4DUY L;  3CPF A;  4DKA C;  2F0O A;  4WJW A;  3VR3 A;  3E0E A;  1MIU A;  4A3B G;  4LFB L;  1Z47 A;  4C1N K;  3JAM L;  4DA2 A;  4LJZ C;  1S5B D;  1LM0 A;  4C3J G;  2C5C A;  5EPL A;  1V8Q A;  3WOF A;  3KDF A;  1HR0 L;  1SYF A;  3PIP A;  2N3S A;  2OQK A;  2XRS D;  4IUU A;  2OCE A;  4R4I A;  1CQF A;  1DJR D;  3EVQ A;  4NB3 A;  3I4L A;  4GOP A;  2JA6 H;  1LTG D;  4B08 A;  1LTT D;  5IP7 G;  2QW7 A;  3T51 B;  3JAM i;  3J80 L;  4XTC S;  3PIO 3;  1JOO A;  3STB D;  3GTK H;  2F0L A;  1E3P A;  4CHT B;  1FR3 A;  3OOC A;  2BE5 D;  1U0L A;  4A75 A;  3CCS A;  4A3M B;  4K5W A;  1S5C D;  1X65 A;  5EPK A;  1C7Y A;  1X3G A;  4P74 A;  4PQX A;  3D6C A;  4ILW A;  3M4O B;  3J80 i;  4BY7 B;  3PCO B;  1B70 B;  2PMZ E;  3EJI A;  3OW2 A;  3L7Z C;  2OF1 A;  1IW7 D;  4WRD A;  1Y8P B;  2GVB A;  1BBX C;  1WCM H;  4KHP Q;  1N33 L;  4OIK A;  3FPU B;  3OPO A;  4LF6 L;  3IRB A;  5LMN W;  2PNR C;  1TWF B;  3QOL A;  1AE2 A;  1I50 B;  1V1P A;  1VQL A;  4AYB B;  1LV9 A;  4A93 G;  2FMC A;  4X65 Q;  3PUZ A;  3A8I E;  3C3L A;  5KND A;  1FGU A;  1TKW B;  5E1F A;  1NNX A;  1K73 C;  2KQ3 A;  2DUD A;  5FO9 B;  2OWO A;  1SND A;  2IW3 A;  1K0S A;  2F0W A;  4HAE A;  2VW9 A;  5GAH C;  4NPS A;  4LF8 L;  2QDL A;  2ENB A;  1PFN A;  2QEJ C;  4JC0 A;  1JC7 A;  4PZ7 A;  1EQR A;  4GKK Q;  4A3E G;  3PUW A;  3H94 A;  2ATW A;  3R8B A;  1H9J A;  1TWH H;  4IUN A;  3M4Y A;  3PUX A;  3FVQ A;  2PO4 A;  4DV6 Q;  3HOU B;  1MSG A;  4A3J G;  1V1O A;  4X66 L;  1EZ6 A;  3AMU A;  2EJF C;  3A5Z B;  5DAU A;  3A0J A;  1PYB A;  4HIM A;  4IUR A;  4X3K A;  3O13 A;  4A3L H;  1GUG A;  2DN8 A;  2K28 A;  2WFW A;  4LFA Q;  5I2Y A;  1VQ9 A;  4A3F H;  4LMQ D;  3F2D A;  1HHV A;  3A8J E;  2Z9H A;  5K5P A;  4B3S L;  2F0D A;  4ZYS A;  2RCN A;  1KD1 C;  4BBR H;  4MIU A;  1N36 L;  3BDL A;  5E4W C;  3J7Z C;  1HNZ Q;  1P16 A;  2MPM A;  3SE0 A;  1Y1V G;  3HOX H;  4IPC A;  2JA7 G;  5M5Y H;  1IYV A;  2EJM A;  1BDO A;  1YEZ A;  4KTA A;  4IUV A;  3M4Q A;  3ONA B;  4DV2 Q;  3HOY G;  3D31 A;  2F3W A;  2H5X A;  3N6R A;  4Q0F A;  3IL8 A;  3OIQ A;  1NE3 A;  4TKO B;  1JCK B;  4TRD A;  5C0X G;  1C9O A;  3HFZ B;  1KAW A;  5IYC G;  1HPC A;  1SN8 A;  3FHW A;  4ULL A;  2ZJR A;  3U9S A;  5EBD A;  1JWS D;  3KJO A;  1N9W A;  1EFI D;  4DV3 L;  4L6T B;  4LF7 L;  4H7B A;  4KN7 C;  3T56 B;  1LT5 D;  2KEE A;  1K3R A;  3SR1 A;  4FXD A;  1NUC A;  3BJU A;  3VDY A;  1PFB A;  2XVS A;  1VQ8 A;  1SMY C;  3UE0 A;  1YJW A;  3I4N B;  2RDG A;  1L0Y B;  3D6W A;  5EBC A;  1ESR A;  1X6O A;  2UUB Q;  4YIJ A;  1I94 Q;  3UI2 A;  1EFW A;  4PNY A;  1B3A A;  1JWM D;  2EQS A;  5EAY A;  4YY3 L;  1DOK A;  4QB4 A;  3VYT A;  5IT9 c;  3NUC A;  1EUJ A;  1SNP A;  3NSW A;  2WP8 J;  1CI3 M;  4AQY Q;  1V9P A;  2Y0S B;  5J39 A;  2PZT A;  5IE8 A;  3RLO A;  2WB1 B;  5DM7 3;  3NWT A;  3D4D A;  3HKZ E;  1PZI D;  1ET6 A;  1EU4 A;  4K14 A;  4C3I H;  1EWC A;  2JK8 A;  2K5Q A;  1DM0 B;  1OXV A;  4POF A;  1B8A A;  1XMO L;  1H9M A;  3MHB A;  1CK1 A;  4BY1 B;  1F9P A;  2EYP A;  1QE6 A;  2UUC L;  4DU9 A;  1PTO C;  4LF5 L;  2NYZ D;  4DUZ L;  1VQG A;  2K03 A;  3LWE A;  1PH5 A;  2QF7 A;  2F0N A;  1BF4 A;  1HR0 W;  2K6A A;  3DUZ A;  1HXY D;  1D5Z C;  3G48 A;  4CDD C;  3BS1 A;  5LMN Q;  1STN A;  2JXM B;  4P73 A;  3PO3 B;  2F3I A;  4PV1 C;  3HOZ H;  4JBK A;  2JYO A;  1W6J A;  3Q23 A;  1GUN A;  5G3L F;  5D65 A;  5IGF A;  2N55 A;  4DR2 L;  2PNH A;  4AYB G;  4DXF A;  1AE3 A;  1FYC A;  1VCI A;  1Z9F A;  3H6M A;  2NVT H;  4OEM B;  4KLK A;  4A3G H;  1SMY D;  1WFQ A;  1FNV A;  4XT3 B;  1KL9 A;  1NSN S;  2KCC A;  4JI2 L;  2F0P A;  4JOI C;  3DHQ A;  3J7A 5;  5T1I A;  3NBH A;  2HT1 A;  5C5M A;  5BN5 A;  1QG7 A;  3N52 A;  3J80 c;  1A6X A;  4JI1 Q;  4C3J H;  1XTC D;  2MO0 A;  3TS2 A;  2N78 A;  4G57 A;  5FO8 B;  3X3N A;  1GUS A;  1HZA A;  2RDH A;  2PW5 A;  2FXQ A;  3M9B A;  4LFC L;  4JI6 Q;  2J0T D;  3CHB D;  1LYL A;  5C5L A;  2E2D C;  3L0O A;  1QZH A;  4B3R L;  1PTO D;  1K3B C;  1W3S A;  1PDQ A;  3FKI B;  3PO2 B;  4LUO A;  2F0V A;  1LTL A;  3RN5 A;  4IJH A;  3HOX B;  3KF6 B;  5LMU Q;  2UUA Q;  2OTJ A;  5M5Y B;  3GTG B;  2DNC A;  5IYD G;  1QB5 D;  2JA5 G;  3EFX D;  3L9A X;  2KHI A;  4OIJ A;  5JJL A;  1D2B A;  2FFK B;  4L5T A;  3ND9 A;  2RHQ B;  1PRT B;  4UDU C;  5IWA Q;  3AFQ A;  5C3E H;  2R92 B;  2KHJ A;  1IBM L;  5AFW A;  2LY7 A;  5CV9 A;  3D8G A;  4V0B A;  1B53 A;  4OO1 H;  1IXR A;  1KLU D;  4ODG A;  4DV5 L;  1T9H A;  5CGK A;  4IPG A;  4XQQ A;  2D0P A;  2ICE C;  3MVV A;  1RHP A;  2O2L D;  4DGZ A;  1XNR L;  3HEJ A;  2CFM A;  3AB9 A;  2N49 A;  2Q2I A;  2A6H D;  2A69 D;  5IGE A;  4NMZ A;  2JA6 G;  1RIP A;  5IT9 E;  3W1G A;  1CKM A;  3I4M H;  2AUJ D;  3CF5 A;  4BBS B;  2RHS B;  2UXB L;  3GV3 A;  1VQO A;  2MHV A;  4XXE A;  3BU2 A;  3OMC A;  5M3M H;  1G51 A;  4FYD A;  5H1S E;  3NHH A;  4KMU C;  2I46 A;  3S9W A;  4A3K G;  2LFN A;  1KQS A;  5JVH 3;  3F2B A;  1I4Q A;  3DMU A;  2K5H A;  2L9H A;  1WCM G;  3I7F A;  1I6V C;  1S4Z A;  1TU2 B;  3MXN B;  4I7A A;  4UP9 A;  1X56 A;  3HOZ B;  1STH A;  4DV4 Q;  1L1O B;  1X32 A;  1TY0 A;  3P7J A;  1JIC A;  3MFY A;  4DUY Q;  1EY5 A;  2HDL A;  4R1J A;  4LF4 L;  4LFB Q;  3TSS A;  1EU3 A;  1X3P A;  1OXX K;  3CCE A;  3UDG A;  1J5E L;  5KGU A;  4IFD H;  3H09 A;  1KRS A;  1CSQ A;  2NVT B;  5D3D A;  1HR0 Q;  1K9M C;  4QUC A;  4Q5V A;  2NUC A;  1TWG H;  2YTX A;  1VQJ A;  4QUF A;  5I9P A;  4JYA Q;  4ME5 A;  1QNU A;  1E22 A;  3NQT A;  1DOL A;  3AFP A;  4C3J B;  2BH2 A;  3J80 E;  1UEB A;  1F2M A;  4X62 Q;  4DAP A;  1RDP D;  5C44 H;  2GA4 B;  2J4X A;  2SEB D;  3PIP 3;  3M7N A;  4OWT B;  1ICW A;  3U4V A;  4DR5 L;  4JOI A;  4RKL A;  3IFT A;  2EE1 A;  5DLQ E;  1ET9 A;  4HIK A;  5FOB B;  2KA7 A;  1XJV A;  1SJH D;  1XMQ L;  1YNJ D;  1WTO A;  1JOQ A;  2IHF A;  4FNF A;  1A62 A;  1V43 A;  3G7L A;  3HS0 C;  3CXC A;  2YYZ A;  2BCO A;  4P72 A;  1CKN A;  3MXP A;  4LF6 Q;  2YTY A;  1HZB A;  1J6Q A;  3PMF A;  1MSH A;  5ELB A;  4A3F G;  1HCZ A;  2MNA A;  1FVI A;  2Y0S E;  4IUQ A;  5FO7 B;  4PMB A;  3GTM H;  4DF7 A;  2E75 C;  3RMH A;  4K8I A;  3QIA A;  4BBR G;  2WB1 E;  1Q1B A;  2KCT A;  3DWQ A;  1I4G A;  3TEH B;  1B9N A;  2JEA I;  2CVR A;  3QO2 A;  3F1Z A;  5C3E B;  4IZ8 A;  2Z6K A;  1STG A;  3HOX G;  2VY3 A;  1E2V A;  4RKB A;  3CD6 A;  3E0J A;  4A93 B;  1UE7 A;  4DAV A;  2VB3 X;  2Z1C A;  1BNZ A;  5COY A;  4OON A;  2IY5 B;  2F0U A;  4CJ1 B;  4K6D A;  3ICE A;  4R8N A;  1B1Z A;  4LF8 Q;  1IL8 A;  4HED A;  1YIJ A;  2DJF C;  1S5D D;  1VQ6 A;  5HUR A;  3EIV A;  1VMC A;  1WYD A;  4J6H A;  1JE5 A;  1FL0 A;  1GUW A;  4YWM A;  3CCM A;  2LXJ A;  4UAI A;  3BZC A;  3PUV A;  3I4M B;  4WJ4 A;  2NWG A;  1A0I A;  4EQO A;  3R3O A;  4RH6 A;  2MJ8 A;  4A3E B;  1AP0 A;  5ELD A;  2NVY H;  4JI0 L;  1QWY A;  5M5W H;  1HNX Q;  2F4V L;  5C4X H;  1MJE A;  2XWJ B;  3OMG A;  3MFG A;  4C3H G;  1B7Y B;  4H13 C;  1AFP A;  2O4X A;  1R9T H;  1UAP A;  4F7X A;  1QZG A;  3GTL B;  4C3I G;  2D5D A;  1LO5 D;  3PUY A;  1WTP A;  1PV4 A;  2CW0 D;  1D1I A;  1M4V A;  1YJ9 A;  4BA1 I;  2JEB I;  1Y1W H;  3A8K E;  4DAY A;  1EYG A;  1D7Q A;  5C4J H;  2NZ1 D;  3Q6S A;  4GLX A;  3LX0 A;  2F0Q A;  5COR A;  1Y1V B;  1QNK A;  4KI0 A;  4UHV A;  2B2Y C;  2JN4 A;  2ZXR A;  2JA7 B;  4CDF C;  4DV3 Q;  1BBW A;  3HOY B;  2JA5 H;  3JC6 6;  4WJ3 M;  2DGY A;  2B39 A;  4RG1 A;  3IAY A;  2A74 C;  3CAM A;  2R7Z H;  3WOE A;  4BS9 A;  2L5T A;  2F3V A;  3RN2 A;  1NBW A;  4XQJ A;  2B2V C;  1SYC A;  3KLW A;  1ASY A;  2PYK A;  4LAA A;  1W6K A;  4AH6 A;  3A55 A;  5JJZ A;  4G7Z C;  4C1N I;  1STE A;  4A3G G;  5IOD A;  5C0X I;  2MGS A;  4YY3 Q;  4IPH A;  4DAY B;  4C2M H;  4HMJ A;  2AWO A;  3CKI B;  2F1M A;  1ENC A;  1WI5 A;  4A3C H;  2F4I A;  2F52 A;  2KJX A;  3A56 A;  3CPW A;  2E5L L;  3KFU A;  3EA6 A;  1XWE A;  1A2T A;  2XN9 C;  5CV7 A;  1E2Z A;  4FF4 A;  3SK6 A;  1XMO Q;  3MC0 B;  4ZCK A;  1SYD A;  4YCW A;  4RAU C;  1ZEQ X;  5LL6 S;  3P20 A;  1B44 D;  1EIF A;  3KF8 B;  5D14 A;  3Q0A A;  2UUC Q;  1WTQ A;  4LF5 Q;  1HA6 A;  1F9Q A;  3GTM B;  1BCP F;  4OEL B;  4BA2 I;  1HA5 A;  1RD9 D;  3NE5 B;  2EYH A;  1RTO A;  1I4P A;  5C4Z A;  1AZQ A;  3U9O A;  3CQZ B;  3BVM A;  3CW2 C;  5AJ3 L;  1IZ6 A;  1IL2 A;  2E8G A;  1ONL A;  4JV5 Q;  3NTK A;  4GZY C;  4GKJ L;  4A3K H;  5HGT A;  1VQP A;  2L55 A;  3S1M B;  2R6G A;  3CRK C;  1R4Q B;  2I5L X;  3CMA A;  1QVG A;  1FGB D;  1AW7 A;  4DR2 Q;  2K75 A;  4GNX B;  2ZM6 L;  4X64 L;  1ZYR D;  3KLS X;  1KNA A;  2EPB A;  1T5X D;  1TY2 A;  3MTS A;  3GP7 A;  2QIL A;  5DNF A;  2K5D A;  1JWU D;  2M00 A;  3LWU A;  2EYF A;  2HUG A;  1VQD A;  5C3E G;  3PGZ A;  1SNO A;  1KAB A;  1J9O A;  2VS1 A;  5T1G A;  3FRP B;  4A3I H;  3HRZ C;  1F9R A;  4ZKC B;  4OO1 G;  1QCB D;  2FIN B;  4MZ9 A;  1PH4 A;  5GRO A;  1KLG D;  1X3Q A;  5KRU A;  2NVX H;  1BUV T;  4LW1 A;  3OWF A;  3FEW X;  5HGQ A;  4PG3 A;  3MA2 B;  3K57 A;  1CM9 A;  4Y7N H;  1SXT A;  3TS0 A;  2JA8 H;  4H02 A;  4O2D A;  1TT2 A;  5LHY 1;  2YU9 B;  2NN6 G;  5M9O A;  3TZD A;  1Q7Y C;  5A2Q E;  3KOJ A;  4DV0 Q;  1UWV A;  2I5H A;  2B2U A;  1R9T B;  3I4M G;  2XNA C;  4B3R Q;  1FNU A;  4A76 A;  1N8R C;  3VYU A;  4OX9 L;  2K05 A;  2DJG C;  2K1B A;  1Q8K A;  1K28 A;  2RQX A;  3SDZ A;  5M3M G;  3KBG A;  4F88 A;  2DNE A;  1BO0 A;  3AQQ A;  3V2T A;  1G29 1;  1SNM A;  4B3T L;  1BCP B;  1G8Z D;  3DEP A;  3I8Z A;  2KCN A;  4KY6 A;  1CZG A;  3M3Y B;  1S3O A;  1JJG A;  3GD7 A;  2B3G A;  1IBL L;  2OT2 A;  2NB0 A;  3P75 A;  2F0E A;  2JA5 B;  1EWH A;  1SE2 A;  3GTO H;  2R7Z B;  1W2B A;  4KN4 C;  3ULJ A;  5FK9 C;  3W1B A;  2F0K A;  4O1N A;  3HKZ G;  4IFD G;  1KDA A;  4B9X A;  1NMG A;  1U5K A;  1PH3 A;  1I3Q B;  2A8V A;  3OTO L;  3DWA A;  4JI7 Q;  2B2Y A;  2PI2 E;  2UU9 L;  2RKS A;  2VUM H;  1PLF A;  4C2M B;  4JI3 L;  2TMP A;  1PYW D;  1HFG A;  1X3E A;  2B2V A;  3QG1 A;  1SEB D;  2R7F A;  1C8C A;  1H9S B;  1A63 A;  3SK5 A;  2UXB Q;  5C44 G;  1SNC A;  3G6J B;  3V05 A;  3BG3 A;  4TVA B;  2JA6 B;  2WAQ B;  4L5Q A;  2XRQ D;  3HOW H;  4CKC A;  1O7I A;  1ILP A;  3K7A H;  1HZC A;  4IUT A;  3GTK B;  5IY0 A;  3BDC A;  4QGU A;  1MKH A;  2B8F A;  3S15 H;  3ZJY C;  3A74 A;  1HFN A;  1MJC A;  4QJF A;  1NY4 A;  4XT1 B;  1PVO A;  3S14 H;  4A3K B;  1JMC A;  2EZV A;  4V19 0;  4IAL A;  4C3H H;  5M3F G;  1SRO A;  2Z8L A;  2A6E C;  4EX5 A;  4LF4 Q;  1N32 L;  4FF1 A;  1XPR A;  1WCM B;  3EBE A;  1J5E Q;  1SMX A;  1EY9 A;  4CJ0 B;  1B2T A;  2SOB A;  3H3V C;  2HQL A;  1QVC A;  5ISR A;  1RJT A;  5GAE C;  4UPA A;  4LUZ A;  5D3I B;  2K01 A;  1I4X A;  4S3S A;  1VQ7 A;  4DV1 Q;  1HNW Q;  2A5H A;  4KV6 A;  2ZJP A;  1TS3 A;  4JPB W;  4B3M Q;  1WTH A;  4JCV E;  5CMD A;  1X55 A;  1M1K C;  1PH1 A;  1PRT F;  2K33 A;  4ZLT F;  2JE6 I;  3KK7 A;  3TRE A;  4APV A;  1PH8 A;  1YI2 A;  1TWC H;  1CHQ D;  3K6O A;  3BVG A;  2UXC L;  1CKO A;  2K50 A;  2HDM A;  3PF4 A;  4Y7N B;  2MQH A;  4HID A;  1YNX A;  4DR5 Q;  1VQN A;  5FLX L;  2JA8 B;  5IOC A;  3MZ5 A;  4U68 A;  4H44 C;  4XYQ A;  2NZO A;  3E5S A;  3URY A;  1GVP A;  1NJI C;  1B9M A;  1HJP A;  1LTR D;  4KKT A;  3F2U A;  4Y52 H;  4M8A A;  1XMQ Q;  3A5U A;  4P75 A;  3C1E A;  3UDX A;  3KJP A;  4RFB A;  2F0T A;  1E1O A;  5IIF A;  1PFS A;  4DNT B;  3KF6 A;  3F8T A;  1A8V A;  2F0S A;  2PQA B;  5A35 A;  2F0M A;  2PZU A;  1TWH B;  1EYA A;  4ID6 A;  1A3U A;  2KCM A;  2SNS A;  5C4X G;  2E2J H;  1DXM A;  4FXK C;  4NP5 A;  1XNQ L;  5JEA J;  1JQY D;  1JOK A;  1K8A C;  1PZJ D;  4NXN L;  3EQL C;  2GVA A;  4G4K A;  3U58 A;  1SE4 A;  3DM1 A;  4A3F B;  1R4P B;  5A2Q L;  4NDX A;  2VQE L;  3S1Q H;  1JOR A;  3GTO B;  1SE3 A;  3HOV H;  4GN5 A;  4BBR B;  1Y1W G;  1TS5 A;  3NWS A;  2EYO A;  1TR5 A;  2K4K A;  1PMR A;  1XYI A;  1QIL A;  3K5L A;  2Z6K C;  1K8M A;  1LT6 D;  1I4H A;  2AQ2 B;  3CCQ A;  1C4Q A;  4HIO A;  1Q81 C;  2E2I H;  4JBW A;  5I9O A;  4J1M A;  3R2I A;  2R7Z G;  1FJG L;  1PTO H;  4I65 A;  3K59 A;  1CA6 A;  1Q82 C;  1YBY A;  1EQQ A;  1A3V A;  3K8A A;  1EEI D;  2Z6B A;  1B3Q A;  4DXG A;  5IP9 H;  1TXY A;  4GKK L;  4P2C B;  1NR2 A;  1D6E C;  3CCR A;  1HZ9 A;  4K0K L;  5I4D A;  1SFO H;  3A7L A;  4PMW A;  3CC7 A;  4JI0 Q;  1EOV A;  3HGB A;  3K7A B;  4AIM A;  2RDF A;  1TWA H;  1F2Z A;  1O80 A;  1ZKO A;  4AYB E;  3D3R A;  3GTQ H;  3T1Y Q;  4GN3 B;  3S15 B;  4A3C G;  3FP9 A;  3U50 C;  3MXN A;  4LFA L;  3FMC A;  3S14 B;  1L1O A;  2WAQ G;  2NN6 H;  3GTJ H;  2A68 C;  3C1F A;  4BWG B;  2D2C C;  4CJ2 C;  4NXM L;  2D62 A;  4JVZ A;  4C3H B;  1EY8 A;  1NCV A;  2X69 A;  1SJE D;  3NBI A;  4XYO A;  1GXD C;  1S72 A;  4C3I B;  5M5X H;  4DR3 L;  2EXD A;  1HQM C;  1CT1 D;  4DV2 L;  3S17 H;  3NEM A;  4EQP A;  4JI4 Q;  3D0F A;  2BOS A;  3MAQ A;  1KXL A;  3TN2 A;  2K52 A;  3S1R H;  4L5R C;  1STB A;  4CGY B;  3MXG A;  3C46 A;  4XQN A;  3G6E A;  2F0F A;  2MUY A;  1VQE A;  3K58 A;  1SSO A;  1TWC B;  4WOR A;  1XPU A;  4A3D H;  1HUM A;  2F03 A;  1EQV A;  1WTW A;  1OTC A;  2PMZ B;  3RR5 A;  1IYU A;  1EY0 A;  4PZ6 A;  2NTS A;  2HHH L;  3D4W A;  4A3I G;  1HUN A;  1KRT A;  2EOT A;  2ZJQ A;  4OWX B;  2NZH A;  4MTK A;  4MTN A;  1QJO A;  2C9O A;  2OEO A;  4A3G B;  4YHH L;  1U4P A;  4KK7 A;  5E4X A;  2R93 G;  3MEH A;  3UDF A;  3CCU A;  4A4I A;  2ZXO A;  3Q24 A;  1K83 H;  4EQN A;  1EQT A;  2L4N A;  3I72 A;  1MGS A;  2RSO A;  3J7Y W;  2QEX A;  2JA8 G;  4G7O C;  4GNX C;  1YHQ A;  2PCF B;  2OQ0 A;  3J7A F;  1VQ5 A;  4ZAI A;  4QCL A;  1GUT A;  4WFN 3;  2LSS A;  2B63 H;  1MBY A;  4JI5 L;  2QCP X;  2PI2 A;  4HMI A;  5AJ3 Q;  3PV0 A;  5I6Y A;  4GKJ Q;  1VF5 C;  1JB3 A;  1SYG A;  1B4O A;  3HOV B;  3T1H L;  2AQ1 B;  2AWN A;  3T4A C;  1TVX A;  2EJG C;  5FLM H;  4O42 A;  4DK3 C;  3I73 A;  2WV6 D;  1QUQ B;  4X64 Q;  1N33 Q;  3VA5 A;  2BA1 A;  1VMP A;  2V1C C;  1YZ6 A;  3T13 A;  3CC4 A;  3WDN A;  4IPD A;  1HH2 P;  1GHK A;  5M3F H;  2EYM A;  3VR2 A;  2K5V A;  2O5J C;  2F0I A;  1KDB A;  1PTO B;  1IKL A;  5IGB A;  3AYH B;  4IN3 A;  2A19 A;  1UNS A;  4DNR B;  4JBM A;  1TII D;  4OGQ C;  5CC4 A;  1ROD A;  1K8O A;  3NQI A;  1XX8 A;  3FDT A;  1TS4 A;  4R8I A;  1Q12 A;  2OXP A;  5IGD A;  5CV6 A;  2EVB A;  5FLX c;  1EY6 A;  1SFO B;  4DR6 L;  5LL6 X;  1TWA B;  2ASB A;  1BCP C;  2VUM G;  5CR3 A;  4DK0 A;  2WAC A;  4E6I A;  3CU7 A;  1IHZ A;  3K5O A;  4ME3 A;  4A3M H;  1D5X C;  1ILQ A;  4OX9 Q;  3RD4 A;  2ZXP A;  3S24 A;  1Z6H A;  4RGN A;  4JI6 L;  4OO1 I;  5EKI A;  3M4O H;  1G91 A;  4BY7 H;  1NTG A;  3K7U C;  3HOW G;  1CTM A;  1S5E D;  2IPK D;  4MN3 A;  2B2U C;  1JE4 A;  2AKW B;  5GAG C;  4LF9 L;  1LLR D;  1X9N A;  3ND8 A;  1Q90 A;  4B3T Q;  4X66 Q;  2JA9 A;  1BR9 A;  4ZUI A;  1Z7T A;  2BH8 A;  5M5X B;  3DWP A;  4QL5 A;  1FD7 D;  1TWF H;  1LT3 D;  5M3M B;  4BXX H;  4RGT A;  1JB7 A;  1IBL Q;  3CC2 A;  3HG9 A;  3S17 B;  4RCN A;  2AHO B;  2AUK A;  4YCU A;  1A3T A;  1JJ2 A;  5JOB A;  4B3S Q;  1YVC A;  3S1R B;  1N36 Q;  2HIX A;  1WD0 A;  2UXD L;  1GD7 A;  4X3S A;  4MHE A;  1HTP A;  2VQF L;  4KD3 A;  1S5F D;  3HP3 A;  3OTO Q;  4DR1 L;  1SYB A;  1EY4 A;  1YJN A;  1SRU A;  2KOL A;  3I91 A;  3WWV A;  5IGC A;  1G6Z A;  1I6H H;  2IWH A;  3HKZ B;  1IBK L;  1EY7 A;  4DV7 L;  3VR4 A;  3SVM A;  5HY6 A;  5I6W A;  5J22 A;  1X54 A;  1TWG B;  1ESF A;  2JQO A;  3STB C;  4LF7 Q;  4CDC C;  4HCE A;  4X3T A;  1CA5 A;  3PQI A;  4QY7 A;  1ENA A;  4GS3 A;  4IFD I;  1LTA D;  2BE5 C;  3RZD H;  3KF8 A;  3H91 A;  4TQU S;  3HOU H;  2KEN A;  3S2D H;  1G2T A;  2X6L A;  1QVF A;  5C44 B;  2EYL A;  4UY8 C;  2CQO A;  3GV6 A;  2B63 B;  2CQA A;  5DEH A;  2KBN A;  5ELE A;  1PH2 A;  3E6Z X;  1BXT A;  2E76 C;  1I5F A;  3GDE A;  3KLR A;  4KHZ A;  1CFM A;  1O7Y A;  1IW7 C;  5KYL A;  5J1Z A;  3CCV A;  2R7D A;  3I3C A;  3J81 c;  1RCV D;  4GNX A;  1EYC A;  3I90 A;  4JI8 L;  1N32 Q;  1VS0 A;  4N9T A;  1C48 A;  3MEF A;  3ERO A;  2YV5 A;  1Y69 U;  5M3F B;  3T16 A;  1KC8 C;  4DUZ Q;  3TP5 A;  2K5N A;  1IKM A;  3HOV G;  1M8A A;  4MNO A;  5C0X J;  4ZRZ A;  4RWS C;  5GAD C;  1TS2 A;  2VXW A;  4EGV A;  2L15 A;  1SAP A;  2CHB D;  4JYA L;  5CV5 A;  4FF3 A;  1T5E A;  1Y8N B;  3AEV A;  2UXC Q;  3NTH A;  2XTI A;  3K0X A;  5C3W A;  3FPP A;  5FLX E;  4X62 L;  3CP0 A;  3I4N H;  4X3U A;  5EKL A;  4IOC A;  2K14 A;  1PHJ A;  4LK1 C;  5IP9 G;  5IGG A;  1YNN C;  2D9U A;  4JI2 Q;  1STA A;  4ZKB B;  1J8I A;  2R61 A;  2BA0 A;  2KHS A;  4B9W A;  3Q22 A;  2EY6 A;  1PH6 A;  1H9K A;  1F77 A;  1D5M C;  3KDF B;  4DR7 L;  1CQV A;  1H95 A;  4R4O A;  3K5N A;  2R93 H;  1JR0 D;  2HQE A;  1XNQ Q;  2K5W A;  4GOP B;  2EXZ A;  3TBI B;  2NVY B;  4BY1 H;  4NXN Q;  4DFA A;  5M5W B;  1AN8 A;  2Q2H A;  1CSP A;  5BR8 L;  2X6G A;  3K5M A;  4K2K A;  4LFC Q;  4F8M A;  3U4Z A;  2VQE Q;  5C4X B;  4N8X 1;  3SXH A;  1NMF A;  5GQO A;  4JK1 C;  5JEA H;  2G9H D;  3S2H H;  1PRT C;  1NAP A;  4RHR A;  3ULL A;  4KY7 A;  2LKV A;  2A73 B;  2RA4 A;  1ENF A;  4JG2 A;  3PO3 H;  3VYS A;  3SHL A;  1Y14 B;  2P5Z X;  2NVQ H;  3W2D A;  1VQC A;  5KIX A;  1VQB A;  4HJ9 A;  4FP5 D;  3GO5 A;  1PYS B;  1P8L A;  1X3F A;  1Y1W B; 
#chains in the Genus database with same CATH homology
 1I6H B;  5C4H A;  5C4J B;  3R2T A;  2RVL A;  4N9P A;  1H9S A;  2LS0 1;  1WTX A;  3V96 A;  2RSN A;  2K7V A;  4HSP A;  1GHJ A;  1II3 A;  1Q3L A;  1V1P B;  1YNN D;  3RZD B;  1DYQ A;  4QF4 A;  4CBV A;  4K6L A;  4KD4 A;  3S2D B;  4ZQ3 A;  3GQB A;  5F2D A;  4ZK9 B;  2M9V A;  3OWE B;  2R3Z A;  3QJY A;  4H0L C;  2B2W A;  2RBM A;  4KJO A;  4DN4 M;  4KKS A;  4NW2 A;  3VR5 A;  3DEO A;  2IX3 A;  1WTV A;  3J81 E;  1MD2 D;  3RUZ A;  4R9W A;  1PRT D;  2DY7 A;  4FXG C;  3NPP A;  3M85 A;  4K5X A;  5G3L D;  2PZW A;  4NKL A;  3VYR A;  3OSO A;  4C56 C;  2IX1 A;  3ITP A;  3KBX A;  2H4O A;  3BYT B;  4QIW B;  2KED A;  3VA7 A;  3SK4 A;  3K0Y A;  1MI2 A;  1DCZ A;  2TSS A;  4RA8 A;  2I07 B;  5CV4 A;  1SNQ A;  2F0G A;  4TSS A;  1U4M A;  1E0B A;  5EPJ A;  1U4R A;  3L3O C;  4A3I B;  5K36 H;  1DD2 A;  2EY1 A;  4OL7 A;  2PQE A;  2PPB C;  2R93 B;  2Z4I A;  3MWY W;  2NVX B;  4L63 B;  1NR4 A;  1PXU A;  5BN4 A;  2Q8R E;  1WVL A;  3S2H B;  3NTI A;  1U9R A;  2HCI A;  2IL8 A;  3VR6 A;  4U67 3;  1SDF A;  5C6A A;  2NVQ B;  1ZXT A;  3BVZ A;  3TP7 A;  4FVM A;  2Q8I B;  3OHX C;  4DK1 A;  2A6E D;  1GJX A;  1STY A;  2H1E A;  1SBB B;  1Q8I A;  1XXG A;  4KY5 A;  1BOS A;  3OIP A;  2F0J A;  2Q8T A;  4G7H C;  2XSC A;  3NP8 A;  2A6H C;  2A69 C;  3M7G A;  1A15 A;  3J7A V;  3NK9 A;  5CYU A;  1UUP A;  1E2W A;  1PZK D;  1AZP A;  1LTB D;  2VUM B;  1PFM A;  1EOT A;  3RZO B;  4M1U B;  4F87 A;  1HRJ A;  3SEB A;  5CBA E;  3QOJ A;  2WKC A;  1DOM A;  5DM6 3;  5NUC A;  3ERQ A;  2L1B A;  1BQQ T;  3HOW B;  2E2H B;  3BDO A;  3AU7 A;  1D1K A;  3W3A A;  5CBE E;  5I2X A;  2FJ2 A;  3RLF A;  1KAA A;  1B50 A;  4HN7 A;  5E3F A;  2HCC A;  3CRL C;  3A54 A;  3J81 L;  1LTI D;  3DXJ C;  3IKJ A;  3T53 B;  1LAB A;  1HTL D;  2KUM A;  2EY5 A;  3TZU A;  1DZ1 A;  2L11 A;  5ELC A;  1RF2 D;  1SYE A;  3P1H A;  1Q1E A;  2IX0 A;  1WTR A;  1PTO F;  4CKE A;  2J7Z A;  5KNC A;  2N88 A;  2ICI A;  3GTP B;  2BDN A;  2KEC A;  4KHV A;  2AQ3 B;  1AEX A;  2BDO A;  1O78 A;  1YNJ C;  3I70 A;  2LMC B;  1HQR D;  4RGM A;  2DY8 A;  5KYI A;  4I7Z C;  4ABN A;  3TP8 A;  5KEE A;  2B2T C;  3ZYY X;  3HZX A;  5JAV A;  3D4R A;  2WKD A;  5EKK A;  2K04 A;  4HR7 B;  1LTS D;  3JAM E;  2L0C A;  2IT1 A;  2G9D A;  2MP1 A;  2QKI C;  2A68 D;  2E2J B;  1KDC A;  4Z9C B;  5JEA G;  2FMM A;  1F9S A;  2XIW A;  1EIH A;  5CV8 A;  2JSO A;  1KTK A;  4J8Q A;  1EEF D;  2ID0 A;  4A3B B;  2NTT A;  3BZD B;  1LT4 D;  3S1Q B;  2XWB B;  2B8G A;  5C0X H;  5JPM C;  2ZT9 C;  2VNU D;  4RCO A;  3TDQ A;  3BYY B;  4K2L A;  4RHS A;  1VF7 A;  2FHT A;  1FNW A;  3KLS A;  2E2I B;  1F2L A;  2L12 A;  3MXU A;  3LNN A;  2KVM A;  4CKB A;  5FKA C;  1KNE A;  2WIN B;  4EVO A;  1I4R A;  4L8J A;  2M2L A;  2VB2 X;  1CZW A;  5JVG 3;  1O7L A;  1UEA B;  2V4D A;  1EZ8 A;  2EDG A;  3C2P A;  2PW7 A;  1WD1 A;  3TP6 A;  4HCS A;  1DON A;  3GTQ B;  1F2Y A;  3R93 A;  1RKN A;  3TME A;  3A7A B;  3SK8 A;  2CW0 C;  1OO9 B;  3X3M A;  3GTJ B;  1OXS C;  4KJN A;  3NXW A;  2WII B;  5TSS A;  3IFD A;  2NN6 I;  4FF2 A;  2NBF A;  4OHJ A;  2IJ0 A;  1EIG A;  2Z4H A;  4K8J A;  5EGT A;  1CHP D;  5EQ0 A;  4FO2 A;  4XIG S;  4HTH A;  3S1N B;  1G2S A;  1GUO A;  3QWN A;  1TQO A;  5KNB A;  1EYD A;  2SNM A;  4QMG A;  1Y8O B;  1L0X B;  2JP1 A;  1QOH A;  4A3D B;  1A2U A;  2E74 C;  1RTN A;  3KUP A;  4A3J B;  4HSV A;  5K36 G;  1BCP D;  3S16 B;  4IUP A;  2B2W C;  5C3X A;  1H9R A;  1ML0 D;  2SDF A;  3QB3 A;  4ZUJ A;  1K83 B;  5IT9 L;  2O5I C;  2F0H A;  1VDZ A;  3H0G B;  4KKU A;  5BN3 A;  1LAC A;  5JPN C;  4RGO S;  5EJW A;  1OXT A;  2B2T A;  1U4L A;  1EL0 A;  3OW7 A;  2EYJ A;  1O7Z A;  1ZYR C;  4PMC A;  4K5V A;  4XDX A;  2K32 A;  4IFD J;  5ELF A;  1OXU A;  2EY2 A;  4IQZ A;  1GOZ A;  2QDB A;  2F0O A;  4WJW A;  3VR3 A;  1Z47 A;  4C1N K;  3JAM L;  4DA2 A;  4LJZ C;  1S5B D;  4C3J G;  2C5C A;  5EPL A;  1V8Q A;  3WOF A;  1SYF A;  2XRS D;  4IUU A;  1CQF A;  1DJR D;  3EVQ A;  3I4L A;  1LTG D;  4B08 A;  1LTT D;  3T51 B;  3J80 L;  4XTC S;  3PIO 3;  1JOO A;  2F0L A;  4CHT B;  1FR3 A;  3OOC A;  2BE5 D;  4A3M B;  4K5W A;  1S5C D;  5EPK A;  4PQX A;  3D6C A;  4ILW A;  3M4O B;  4BY7 B;  3EJI A;  3L7Z C;  2OF1 A;  1IW7 D;  4WRD A;  1Y8P B;  1BBX C;  4OIK A;  3FPU B;  3OPO A;  2PNR C;  1TWF B;  3QOL A;  1I50 B;  1V1P A;  4AYB B;  1LV9 A;  2FMC A;  3PUZ A;  3A8I E;  3C3L A;  5KND A;  1TKW B;  5E1F A;  2KQ3 A;  5FO9 B;  1SND A;  2IW3 A;  2F0W A;  4HAE A;  2ENB A;  1PFN A;  2QEJ C;  1JC7 A;  3PUW A;  3H94 A;  3R8B A;  1H9J A;  4IUN A;  3M4Y A;  3PUX A;  3FVQ A;  2PO4 A;  3HOU B;  1MSG A;  1V1O A;  1EZ6 A;  3AMU A;  2EJF C;  5DAU A;  4IUR A;  4X3K A;  3O13 A;  1GUG A;  2DN8 A;  2K28 A;  5I2Y A;  4LMQ D;  1HHV A;  3A8J E;  5K5P A;  2F0D A;  4ZYS A;  4MIU A;  3BDL A;  5E4W C;  3SE0 A;  2MPM A;  1IYV A;  2EJM A;  1BDO A;  4KTA A;  4IUV A;  3ONA B;  3D31 A;  2F3W A;  3N6R A;  4Q0F A;  3IL8 A;  3OIQ A;  4TKO B;  1JCK B;  4TRD A;  5C0X G;  1HPC A;  4ULL A;  3U9S A;  5EBD A;  1JWS D;  4L6T B;  4H7B A;  4KN7 C;  3T56 B;  1LT5 D;  2KEE A;  3SR1 A;  4FXD A;  1NUC A;  1PFB A;  2XVS A;  1SMY C;  3I4N B;  2RDG A;  1L0Y B;  3D6W A;  5EBC A;  1ESR A;  4YIJ A;  3UI2 A;  4PNY A;  1B3A A;  1JWM D;  1DOK A;  4QB4 A;  3VYT A;  3NUC A;  1SNP A;  3NSW A;  2WP8 J;  1CI3 M;  2Y0S B;  5J39 A;  2PZT A;  2WB1 B;  5DM7 3;  3NWT A;  3D4D A;  1PZI D;  1ET6 A;  1EU4 A;  4K14 A;  1EWC A;  2K5Q A;  1DM0 B;  1OXV A;  1H9M A;  3MHB A;  1CK1 A;  4BY1 B;  1F9P A;  2EYP A;  1QE6 A;  4DU9 A;  1PTO C;  2NYZ D;  2K03 A;  3LWE A;  2QF7 A;  2F0N A;  1BF4 A;  2K6A A;  3DUZ A;  1HXY D;  1D5Z C;  3BS1 A;  3PO3 B;  1STN A;  2JXM B;  4PV1 C;  2JYO A;  1W6J A;  3Q23 A;  1GUN A;  5G3L F;  5D65 A;  5IGF A;  2N55 A;  4DXF A;  1VCI A;  1FYC A;  3H6M A;  1SMY D;  1FNV A;  4XT3 B;  1NSN S;  2KCC A;  2F0P A;  3DHQ A;  5T1I A;  3NBH A;  5C5M A;  5BN5 A;  1QG7 A;  3N52 A;  1A6X A;  1XTC D;  4G57 A;  5FO8 B;  3X3N A;  1GUS A;  2RDH A;  2PW5 A;  2J0T D;  3CHB D;  5C5L A;  2E2D C;  1PTO D;  1PDQ A;  3FKI B;  3PO2 B;  2F0V A;  3HOX B;  5M5Y B;  3GTG B;  2DNC A;  1QB5 D;  3EFX D;  3L9A X;  4OIJ A;  1D2B A;  2FFK B;  3ND9 A;  1PRT B;  4UDU C;  2R92 B;  5AFW A;  2LY7 A;  5CV9 A;  3D8G A;  4V0B A;  1B53 A;  4OO1 H;  1KLU D;  4ODG A;  5CGK A;  4XQQ A;  2ICE C;  3MVV A;  1RHP A;  2O2L D;  4DGZ A;  3HEJ A;  3AB9 A;  2A6H D;  2A69 D;  5IGE A;  4NMZ A;  5IT9 E;  2AUJ D;  4BBS B;  3GV3 A;  2MHV A;  4XXE A;  3OMC A;  4FYD A;  3NHH A;  4KMU C;  2I46 A;  3S9W A;  2LFN A;  5JVH 3;  1I4Q A;  3DMU A;  2L9H A;  1I6V C;  1S4Z A;  1TU2 B;  3HOZ B;  1STH A;  1X32 A;  1TY0 A;  3P7J A;  1JIC A;  3MFY A;  1EY5 A;  2HDL A;  3TSS A;  1EU3 A;  1X3P A;  1OXX K;  5KGU A;  4IFD H;  3H09 A;  2NVT B;  5D3D A;  4QUC A;  4Q5V A;  2NUC A;  4QUF A;  5I9P A;  4ME5 A;  1QNU A;  3NQT A;  1DOL A;  4C3J B;  3J80 E;  1F2M A;  4DAP A;  1RDP D;  2GA4 B;  2J4X A;  2SEB D;  3PIP 3;  3M7N A;  1ICW A;  4RKL A;  3IFT A;  2EE1 A;  1ET9 A;  5FOB B;  2KA7 A;  1SJH D;  1YNJ D;  1WTO A;  1JOQ A;  4FNF A;  1V43 A;  3G7L A;  3HS0 C;  2YYZ A;  2BCO A;  3MXP A;  3PMF A;  1MSH A;  5ELB A;  1HCZ A;  4IUQ A;  5FO7 B;  4PMB A;  4DF7 A;  2E75 C;  3RMH A;  4K8I A;  3QIA A;  1Q1B A;  3DWQ A;  1I4G A;  1B9N A;  2JEA I;  2CVR A;  3QO2 A;  5C3E B;  4IZ8 A;  1STG A;  1E2V A;  4RKB A;  3E0J A;  4A93 B;  4DAV A;  2VB3 X;  2Z1C A;  1BNZ A;  5COY A;  2F0U A;  4CJ1 B;  4K6D A;  4R8N A;  1B1Z A;  1IL8 A;  4HED A;  1S5D D;  5HUR A;  1VMC A;  4J6H A;  1GUW A;  4UAI A;  3PUV A;  3I4M B;  2NWG A;  4EQO A;  3R3O A;  4RH6 A;  2MJ8 A;  4A3E B;  1AP0 A;  5ELD A;  1QWY A;  2XWJ B;  3OMG A;  3MFG A;  4C3H G;  4H13 C;  1AFP A;  2O4X A;  1UAP A;  4F7X A;  3GTL B;  4C3I G;  2D5D A;  1LO5 D;  3PUY A;  1WTP A;  2CW0 D;  1D1I A;  1M4V A;  4BA1 I;  2JEB I;  3A8K E;  4DAY A;  2NZ1 D;  3Q6S A;  3LX0 A;  2F0Q A;  5COR A;  1Y1V B;  1QNK A;  4KI0 A;  2B2Y C;  2ZXR A;  2JA7 B;  3HOY B;  2B39 A;  3IAY A;  2A74 C;  3WOE A;  4BS9 A;  2L5T A;  2F3V A;  4XQJ A;  2B2V C;  1SYC A;  2PYK A;  4LAA A;  1W6K A;  3A55 A;  5JJZ A;  4G7Z C;  4C1N I;  1STE A;  5IOD A;  5C0X I;  2MGS A;  4HMJ A;  2AWO A;  3CKI B;  2F1M A;  1ENC A;  2F4I A;  2KJX A;  3A56 A;  3EA6 A;  1XWE A;  1A2T A;  2XN9 C;  5CV7 A;  1E2Z A;  4FF4 A;  3SK6 A;  3MC0 B;  1SYD A;  4RAU C;  1ZEQ X;  5LL6 S;  3P20 A;  1B44 D;  5D14 A;  3Q0A A;  1WTQ A;  1HA6 A;  1F9Q A;  3GTM B;  1BCP F;  4BA2 I;  1RD9 D;  1HA5 A;  3NE5 B;  2EYH A;  1RTO A;  1I4P A;  5C4Z A;  1AZQ A;  3U9O A;  3CQZ B;  3BVM A;  1ONL A;  3NTK A;  4GZY C;  5HGT A;  2L55 A;  3S1M B;  2R6G A;  3CRK C;  1R4Q B;  1FGB D;  1AW7 A;  1ZYR D;  3KLS X;  1KNA A;  2EPB A;  1T5X D;  1TY2 A;  3MTS A;  3GP7 A;  2QIL A;  5DNF A;  2K5D A;  1JWU D;  2M00 A;  3LWU A;  2EYF A;  2HUG A;  1SNO A;  1KAB A;  1J9O A;  5T1G A;  3FRP B;  3HRZ C;  1F9R A;  4ZKC B;  4OO1 G;  1QCB D;  2FIN B;  1KLG D;  1X3Q A;  5KRU A;  1BUV T;  3OWF A;  3FEW X;  3K57 A;  3MA2 B;  1CM9 A;  1SXT A;  1TT2 A;  5LHY 1;  2YU9 B;  2NN6 G;  5M9O A;  3TZD A;  5A2Q E;  2B2U A;  1R9T B;  2XNA C;  1FNU A;  3VYU A;  2K05 A;  2K1B A;  2RQX A;  3SDZ A;  3KBG A;  4F88 A;  2DNE A;  1BO0 A;  3V2T A;  1G29 1;  1SNM A;  1BCP B;  1G8Z D;  3DEP A;  3I8Z A;  2KCN A;  4KY6 A;  1CZG A;  3M3Y B;  3GD7 A;  2OT2 A;  2NB0 A;  3P75 A;  2F0E A;  2JA5 B;  1EWH A;  1SE2 A;  2R7Z B;  4KN4 C;  5FK9 C;  2F0K A;  4O1N A;  4IFD G;  1KDA A;  4B9X A;  1I3Q B;  3DWA A;  2B2Y A;  2RKS A;  1PLF A;  4C2M B;  2TMP A;  1PYW D;  1HFG A;  2B2V A;  3QG1 A;  1SEB D;  1C8C A;  1H9S B;  3SK5 A;  1SNC A;  3G6J B;  3V05 A;  3BG3 A;  2JA6 B;  2WAQ B;  2XRQ D;  4CKC A;  1ILP A;  4IUT A;  3GTK B;  3BDC A;  2B8F A;  1HFN A;  4XT1 B;  4A3K B;  2EZV A;  4V19 0;  4IAL A;  2Z8L A;  2A6E C;  4FF1 A;  1WCM B;  1EY9 A;  4CJ0 B;  1B2T A;  2SOB A;  3H3V C;  5ISR A;  1RJT A;  5D3I B;  2K01 A;  1I4X A;  4S3S A;  2A5H A;  4KV6 A;  1TS3 A;  5CMD A;  1PRT F;  2K33 A;  4ZLT F;  2JE6 I;  3KK7 A;  1CHQ D;  3K6O A;  3BVG A;  2HDM A;  4Y7N B;  2JA8 B;  5FLX L;  5IOC A;  3MZ5 A;  4U68 A;  4H44 C;  4XYQ A;  3E5S A;  3URY A;  1B9M A;  1LTR D;  4KKT A;  3F2U A;  4M8A A;  3C1E A;  4RFB A;  2F0T A;  5IIF A;  4DNT B;  2F0S A;  5A35 A;  2F0M A;  2PZU A;  1TWH B;  1EYA A;  4ID6 A;  1A3U A;  2SNS A;  1DXM A;  4FXK C;  4NP5 A;  5JEA J;  1JQY D;  1JOK A;  1PZJ D;  3EQL C;  4G4K A;  1SE4 A;  3DM1 A;  4A3F B;  1R4P B;  5A2Q L;  4NDX A;  1JOR A;  3GTO B;  1SE3 A;  4BBR B;  1TS5 A;  3NWS A;  2EYO A;  1TR5 A;  1PMR A;  1XYI A;  1QIL A;  3K5L A;  1K8M A;  1LT6 D;  1I4H A;  2AQ2 B;  1C4Q A;  4JBW A;  5I9O A;  4J1M A;  3R2I A;  1PTO H;  4I65 A;  3K59 A;  1CA6 A;  1A3V A;  1EEI D;  4DXG A;  4P2C B;  1NR2 A;  1D6E C;  5I4D A;  3A7L A;  4PMW A;  3K7A B;  3HGB A;  2RDF A;  1F2Z A;  1O80 A;  1ZKO A;  3D3R A;  3S15 B;  3MXN A;  3FMC A;  3S14 B;  2NN6 H;  2A68 C;  3C1F A;  4BWG B;  2D2C C;  4CJ2 C;  2D62 A;  4C3H B;  1EY8 A;  1NCV A;  2X69 A;  1SJE D;  3NBI A;  4XYO A;  1GXD C;  4C3I B;  1HQM C;  1CT1 D;  4EQP A;  2BOS A;  3MAQ A;  3TN2 A;  1STB A;  4CGY B;  3MXG A;  3C46 A;  4XQN A;  2F0F A;  2MUY A;  3K58 A;  1SSO A;  1TWC B;  4WOR A;  1HUM A;  2F03 A;  1EQV A;  1WTW A;  2PMZ B;  1IYU A;  1EY0 A;  2NTS A;  3D4W A;  1HUN A;  2EOT A;  1QJO A;  2C9O A;  2OEO A;  4A3G B;  1U4P A;  4KK7 A;  5E4X A;  3MEH A;  2ZXO A;  3Q24 A;  4EQN A;  1EQT A;  2L4N A;  3I72 A;  1MGS A;  2RSO A;  3J7Y W;  4G7O C;  2PCF B;  3J7A F;  4ZAI A;  4QCL A;  1GUT A;  4WFN 3;  1MBY A;  2QCP X;  4HMI A;  3PV0 A;  5I6Y A;  1VF5 C;  1JB3 A;  1SYG A;  1B4O A;  3HOV B;  2AQ1 B;  2AWN A;  3T4A C;  1TVX A;  2EJG C;  4O42 A;  3I73 A;  2WV6 D;  3VA5 A;  2BA1 A;  1VMP A;  3T13 A;  3WDN A;  1GHK A;  2EYM A;  3VR2 A;  2O5J C;  2F0I A;  1KDB A;  1PTO B;  1IKL A;  5IGB A;  4IN3 A;  4DNR B;  1UNS A;  1TII D;  4OGQ C;  5CC4 A;  1ROD A;  1K8O A;  3NQI A;  1XX8 A;  3FDT A;  1TS4 A;  4R8I A;  1Q12 A;  2OXP A;  5IGD A;  5CV6 A;  2EVB A;  1SFO B;  1EY6 A;  5LL6 X;  1TWA B;  1BCP C;  5CR3 A;  4DK0 A;  2WAC A;  4E6I A;  3CU7 A;  1IHZ A;  3K5O A;  1D5X C;  1ILQ A;  3RD4 A;  2ZXP A;  4OO1 I;  1Z6H A;  4RGN A;  5EKI A;  1G91 A;  1CTM A;  1S5E D;  2IPK D;  4MN3 A;  2B2U C;  1JE4 A;  1LLR D;  3ND8 A;  1Q90 A;  1BR9 A;  4ZUI A;  1Z7T A;  5M5X B;  3DWP A;  1FD7 D;  1LT3 D;  5M3M B;  4RGT A;  3HG9 A;  3S17 B;  4RCN A;  2AUK A;  1A3T A;  5JOB A;  3S1R B;  1WD0 A;  4X3S A;  4MHE A;  1HTP A;  4KD3 A;  1S5F D;  3HP3 A;  1SYB A;  1EY4 A;  2KOL A;  3I91 A;  5IGC A;  1G6Z A;  2IWH A;  3HKZ B;  1EY7 A;  3VR4 A;  3SVM A;  5I6W A;  5J22 A;  1TWG B;  1ESF A;  4HCE A;  4X3T A;  1CA5 A;  1ENA A;  4IFD I;  1LTA D;  2BE5 C;  3KF8 A;  3H91 A;  4TQU S;  1G2T A;  2X6L A;  5C44 B;  2EYL A;  3GV6 A;  2B63 B;  2CQA A;  5DEH A;  5ELE A;  3E6Z X;  1BXT A;  2E76 C;  3KLR A;  4KHZ A;  1CFM A;  1O7Y A;  1IW7 C;  5KYL A;  5J1Z A;  3I3C A;  1RCV D;  1EYC A;  3I90 A;  4N9T A;  1C48 A;  3ERO A;  1Y69 U;  5M3F B;  3T16 A;  3TP5 A;  1IKM A;  1M8A A;  5C0X J;  4ZRZ A;  4RWS C;  1TS2 A;  2VXW A;  4EGV A;  1SAP A;  2CHB D;  5CV5 A;  4FF3 A;  1T5E A;  1Y8N B;  3NTH A;  5C3W A;  3FPP A;  5FLX E;  4X3U A;  5EKL A;  4LK1 C;  5IGG A;  1YNN C;  2D9U A;  1STA A;  4ZKB B;  1J8I A;  2R61 A;  2BA0 A;  2KHS A;  4B9W A;  3Q22 A;  2EY6 A;  1H9K A;  1F77 A;  1D5M C;  1CQV A;  3K5N A;  1JR0 D;  2HQE A;  2K5W A;  2EXZ A;  3TBI B;  2NVY B;  4DFA A;  5M5W B;  1AN8 A;  2X6G A;  3K5M A;  4K2K A;  4F8M A;  5C4X B;  3SXH A;  4JK1 C;  5JEA H;  2G9H D;  1PRT C;  1NAP A;  4RHR A;  4KY7 A;  2LKV A;  2A73 B;  2RA4 A;  1ENF A;  3VYS A;  3SHL A;  3W2D A;  5KIX A;  4FP5 D;  3GO5 A;  1EFI D;  1Y1W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...