3S9WA

Crystal structure of staphylococcal nuclease variant delta+phs m98g bound to ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS M98G bound to Ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3s9wA00
3MHBA 3SK8A 3C1EA 1SNDA 1IHZA 2F0FA 3TP5A 5I9PA 4RKBA 1RKNA 4QMGA 1F2MA 1A3TA 1JOOA 2EY1A 2HQEA 5HGTA 2PW7A 1KDCA 3QOJA 2F0SA 3R3OA 1STYA 5JOBA 1EYDA 2LKVA 2F0LA 3D6CA 1SYGA 3NXWA 3OSOA 5J1ZA 4YIJA 1STNA 1TT2A 2KQ3A 1A3UA 4G57A 4KD3A 3SK6A 3T13A 4NP5A 5ISRA 2PW5A 3QOLA 3TP6A 3D4WA 3EVQA 2QDBA 5IOCA 5CC4A 4NMZA 2SOBA 4B9WA 5E3FA 2EYOA 2F0IA 3OMGA 4EQNA 2PZWA 4KV6A 4ZUIA 3SHLA 1STBA 2F0PA 2PYKA 2RDFA 2RKSA 1KABA 3NQTA 4IZ8A 3SR1A 2O4XA 1JORA 4F8MA 4HMIA 1ENAA 2ENBA 5IIFA 4PMBA 5C4ZA 3T16A 1NUCA 3HZXA 4K6DA 4WRDA 2EY5A 5CV8A 5CR3A 5DAUA 1EY7A 4S3SA 3TP7A 1STAA 1EYCA 2EYPA 4WORA 5E1FA 4NDXA 4HMJA 2SNSA 2RBMA 3EROA 1KAAA 1TR5A 4KJOA 5F2DA 4ZQ3A 4DGZA 5IGDA 4J6HA 4R8NA 2F0WA 4KTAA 4DF7A 5IODA 1EY4A 5KIXA 3D8GA 1A2TA 3TMEA 2EYMA 1EZ6A 2F0TA 3DHQA 1U9RA 3BDCA 3P75A 4H7BA 5EGTA 4K8JA 3SK5A 4ZUJA 3SXHA 4B9XA 4HTHA 1SYFA 2EY2A 5CV9A 5EKLA 2EYJA 4EQPA 3NUCA 3BDLA 4KY7A 4MIUA 3P1HA 5CV5A 5KRUA 1EY8A 4K14A 5I6YA 5KEEA 1EZ8A 2OXPA 1SNOA 4RKLA 2F0DA 3C1FA 3TP8A 5CV4A 1EY9A 4K2KA 5IGEA 3SK4A 1EY6A 5IGGA 1A2UA 1EY0A 5NUCA 3V2TA 2EYFA 3VA5A 3NHHA 5C3XA 4EQOA 4F7XA 4ME5A 1EYAA 4QB4A 5I9OA 1EY5A 2EYLA 4DU9A 4K5XA 5KGUA 5KYLA 1SYCA 4PMCA 3S9WA 1ENCA 2F0EA 1F2ZA 2EY6A 2PQEA 3QB3A 4QF4A 4TRDA 2F0KA 4DFAA 3PMFA 5C5MA 1SNPA 2F0VA 5M9OA 4J1MA 2F0OA 4K2LA 1KDBA 2F3VA 5CV6A 4I65A 1II3A 5K5PA 1STHA 2EYHA 3OMCA 4NKLA 2WACA 1JOQA 2KHSA 2F0MA 4ODGA 4K5VA 3MEHA 3RUZA 4KHVA 1STGA 3MXPA 4IALA 5DEHA 4OL7A 5IGFA 5KYIA 2PZUA 2PZTA 4KJNA 1F2YA 3E5SA 1TQOA 3ITPA 4KY6A 5I6WA 1KDAA 5C6AA 3MZ5A 2F0HA 4N9TA 2OEOA 3EJIA 1SYDA 3H6MA 3ERQA 3U9OA 1SYEA 1AEXA 5IGBA 1SNCA 2SNMA 3NK9A 3D4DA 3NP8A 4KY5A 3DMUA 1SYBA 3MVVA 3HEJA 2OF1A 4E6IA 2EXZA 1SNMA 2F3WA 1NSNS 5IGCA 4PNYA 1SNQA 2F0UA 4K5WA 4K8IA 4LAAA 1EQVA 1A3VA 3OWFA 2F0JA 2M00A 5J39A 2F0QA 4N9PA 2F0GA 5J22A 5JAVA 5C4HA 1JOKA 3LX0A 4ID6A 4IUNA 5CGKA 5C5LA 2NUCA 5EKKA 5CV7A 5C3WA 5HURA 4KD4A 4EVOA 2F0NA
chains in the Genus database with same CATH superfamily
2CW0C 1KHIA 5IWAQ 4HJ8A 2JA8G 3TP5A 1Y1VH 5I9PA 1ASZA 1VQJA 4MZ9A 4HIKA 2NZOA 1BQQT 1C7YA 1F9PA 4DAYA 1STYA 1BO0A 3MXGA 2R92B 2E76C 1H9MA 4AQYQ 2VQFQ 4FXGC 1WTRA 1EIHA 2HD3A 3S1NB 2F0IA 5IYDG 2NTSA 1SEBD 1V1PB 3GTPH 2PPBC 2L0CA 1CHQD 1X3PA 2O4XA 1LT4D 2GN5A 2XIWA 5M3FB 2H1EA 3HZXA 1Y69U 1ML0D 4A3FG 4JBMA 4GOPC 1CA6A 1E1OA 1RIPA 1K73C 4L5RC 3GTKB 3J80E 2SNSA 1TWAH 3ND8A 4IPDA 3M4PA 1G2TA 1KD1C 4A3IB 3ND9A 4R8NA 5E7NA 1GOZA 2F1MA 2EYMA 4A3GG 2XRQD 4H44C 2EY2A 2EYJA 4WFN3 2L4NA 3D31A 5IP7H 2ZXRA 5C0XH 3GTQB 4LFBQ 1EY8A 3K5MA 4A4IA 2V1CC 4JI3Q 1PV4A 4DXFA 1W3SA 5IE8A 5FOBB 4JI5L 1XNQL 1CQFA 1EY6A 2RDHA 1A2UA 3UE1A 1XNRL 3VA5A 2AHOB 2SEBD 4DV3Q 2IT1A 2EYLA 3I70A 3BYTB 1GJXA 4QUFA 4LF6L 4C3JH 2JEBI 3T1YQ 2B2YC 5M5YH 1YNNC 4GS3A 2FXQA 1ZXTA 1KDBA 1FGUA 2VB2X 4BY7G 2FINB 1I6HB 2IX3A 2UUAL 3ER0A 4XIGS 3CC2A 3R2IA 3DXJC 3BDOA 5KYIA 1N36Q 3KLSX 4RH6A 4JBJA 3PIP3 2JYOA 3ULLA 4DV1L 2OTLA 1C0AA 4F88A 2M9VA 1IKLA 2L9HA 2EXZA 1PDQA 2JA6B 3I4NB 5IGCA 4IFDH 1Q8IA 1S5BD 3OOCA 1H9JA 5CGKA 1H9RA 2A69C 2EJFC 4FXDA 2I0QA 1IHZA 4K6LA 3CCMA 1S40A 1SN8A 4JG2A 4A3KH 5IYBG 2Z4IA 3H91A 4R1JA 4FYDA 4HEDA 2D62A 1I94Q 2UXCQ 3VYUA 1MSGA 4IN3A 3C3LA 3EVQA 4J8QA 1X65A 1U4PA 1JJCB 1I4RA 1Q7YC 1HRJA 1AFPA 3Q8DA 1YITA 4OIJA 3S17B 2Q8RE 3F2BA 4XT3B 4DAPA 1B2TA 4RGOS 4A93H 1RCVD 3S16B 2WKCA 2L1BA 4DR1L 1SE4A 2AWNA 4XYQA 2H4OA 2YYZA 1WTXA 4JBWA 2E2JB 3WOEA 4NB3A 2B3GA 4OWTB 4H7BA 2L15A 2RF4A 2CWAA 4HTHA 1WCMH 4G7OC 1MD2D 1VQKA 3I7FA 5ELBA 3OYYA 5JVH3 3BVZA 4DR3Q 1Z47A 5A2QE 5EJWA 1MSHA 4C3IH 1U4MA 2Z0SA 2Z1CA 4QB4A 3LGJA 5JEAG 4DUYQ 3HKZB 1IBKQ 2CHBD 4I65A 4A3MB 2JA7B 1I50B 4OX9L 4LF5L 3S14H 1X3GA 1STGA 4IALA 5C0XI 2D0PA 3S1QB 1KLGD 1W6KA 3TS2A 3Q24A 1VF5C 4ZRZA 4DNRB 2FMCA 1PH5A 3GTGB 1C48A 3DMUA 1F2LA 2BOSA 3U4ZA 3PO3B 2B8GA 3O13A 1AW7A 4PNYA 4LF8L 1PFSA 2C9OA 1TY0A 1Y1VG 4CKEA 3WWVA 1YJWA 3M3YB 2JA8H 4QQBX 4QIWE 1OXTA 2GVBA 4JV5L 4KHPQ 1RKNA 2Y0SB 1WTPA 1S5CD 1KNEA 2E74C 3L2PA 3K81C 1MGSA 2K32A 2K5VA 3HGBA 3RLOA 4WJWA 3HOXH 2EE1A 4AYBB 3QOLA 1PH4A 3CPWA 2KCCA 3IAYA 4X64Q 3MXUA 2EYOA 1O78A 4JVZA 2CQOA 2ZTDA 3BZCA 1UEAB 3FVQA 2RDFA 1C8CA 4A3BB 3I2ZA 3SR1A 5M5XB 5KNDA 3HOZH 4LF4Q 1CI3M 2HHHL 3HOUH 3GTGH 1B9MA 2YTYA 5DAUA 1JWMD 1ZYRC 3J7ZC 3P20A 3FKIB 3U58A 4DV4Q 1STAA 3CKIB 1FGBD 5BN3A 4NDXA 1ET9A 1GD7A 3S15H 2B63G 2GVAA 2VXWA 2OWOA 3DHQA 1U9RA 3HS0C 3I8ZA 2NVYB 3A5UA 1I50H 2OT2A 3CC7A 1EIYB 4JYAL 1HZBA 2JA9A 3FP9A 3NUCA 5GAHC 1D5XC 4JI5Q 1XNQQ 1B53A 1RTOA 3S1RB 3ONAB 1XNRQ 3KUPA 2R7FA 4UP9A 3DWPA 1DOLA 4JI7Q 5IGGA 4B08A 4A3DB 4IFDJ 1EY5A 4A75A 3B6YA 1BCPD 1IBKL 4TRDA 2F0KA 4LF5Q 1WCMB 3CRLC 2NB0A 3NTHA 4G4KA 2NBFA 2BE5C 4GLXA 4KHPL 4EGVA 1B1ZA 2BDOA 2MFIA 1U4RA 4K5VA 1IW7D 3T1HQ 1DM0B 4U68A 3J80i 1WD0A 2KEEA 4KJNA 1VQFA 3HKSA 3ITPA 3MA2B 5C6AA 5I6WA 4YY3L 3S16H 1BR9A 1K8OA 4IFDI 2Z6BA 4X62L 1SNCA 2VUMG 1Q1EA 4X64L 1YNJC 5AJ3L 3GP7A 3FPUB 5J3BA 2JA6G 4RGMA 2F0UA 4J15A 4QY7A 5C0XG 2DY7A 1PH7A 4IOAA 3SEBA 2A5HA 2E2HB 1X9NA 2F0GA 3G6JB 1PH2A 4CDDC 1VQAA 2R7ZB 4IUNA 2SDFA 4BWGB 1PRTF 4YHHL 5CMDA 1E24A 3I4MB 1VQ6A 1UEBA 1HQMC 4A3LG 4A3KB 1KDCA 3T4AC 2L12A 2LFNA 5JOBA 4DR5Q 4OONA 2A1AA 3OSOA 3GQBA 4YWMA 2WAQG 3WDNA 5JPMC 2WB1E 3J80c 5IYDH 4CDCC 3IKJA 1VQIA 2BA0A 4XQQA 1STBA 1SE8A 2PYKA 2XRSD 4G7HC 4OELB 1SROA 1GXDC 2IW3A 2CKZB 1ZKOA 4GZYC 1OTCA 1MJCA 5C44G 2M2LA 3KK7A 2EQSA 4ZKBB 1XTCD 1NMFA 2NN6G 5E4XA 1WOCA 2LSSA 4KJOA 1STEA 2HUGA 2QF7A 1NJIC 1YNND 4L8JA 4C3HG 2K01A 2UXBL 2BH2A 1FNVA 2D2CC 3QIAA 4ZUJA 2N49A 2VQFL 4KY7A 1PH9A 3KJOA 2K5QA 4LFAL 4FF2A 3J7AF 4OEMB 4A3JG 2A6HC 4A3MG 1HTPA 4FO2A 4K2KA 3UDXA 1XYIA 3JAMi 1DOMA 3NBHA 4B3SL 4H0LC 5K36G 4F7XA 3UI2A 2QA4A 3JAME 5COYA 1LM0A 2Z8LA 4FF1A 1VQ9A 3J7AV 3NTKA 3S1RH 2QEXA 5EQ0A 4DAVA 4LUOA 1L0WA 1II3A 1GUGA 1STHA 3G6EA 2QGQA 1ZEQX 4BXXH 3OW2A 4DR2Q 3RUZA 4A3IH 1AH9A 3E6ZX 1D1IA 1DOKA 4C2MB 3FKIH 4BBRG 3H6MA 2IX0A 3U9OA 2E2JH 4LMQD 2PI2E 2XWJB 2ZJRA 4UY8C 4JI3L 1IZ6A 5E4WC 3S2DH 3K6OA 4DV6Q 4DV4L 5IT9c 1VQMA 2E5LL 2PQAA 5IT9L 5KNBA 2MJ8A 1E22A 1IBLL 1M90C 4KLKA 3BVGA 1OXVA 5EKIA 5LL6S 1N33Q 4HCEA 3SK8A 1B3QA 1EU3A 4RKBA 2WKDA 1CKNB 4L5QA 3MC0B 3QO2A 1F2MA 1JOOA 2J4XA 2ZJQA 5HGTA 5C44B 1D2BA 1XMQL 1EIGA 3MEFA 1TWGH 2KQ3A 1J5EL 4KD3A 4JI6Q 1VQNA 5JPNC 3R8BA 1JCKB 4Q0FA 4IUTA 4FXKC 4U673 3CP0A 2SOBA 4RFBA 3D4RA 1PA6A 1H9KA 2R92G 1XMOL 4K6DA 4OXPA 3CF5A 4S3SA 2PMZB 3PUYA 3I4NH 1GHKA 4GKJL 1EYCA 1WJJA 2KCTA 2FFKB 4OX9Q 3NWTA 5KIXA 1U0LA 2JSOA 3MFGA 4BY1B 2IWHA 5M3FG 4B3MQ 4EQPA 3M7GA 4YCWA 1WCMG 3J81c 3SVMA 5FJ8H 1HA6A 1GHJA 2OXPA 5LMUQ 2BCOA 4N8FA 3CHBD 3K8AA 5NUCA 4PZ6A 4C3IB 1EOTA 2JJQA 1DCZA 1NAPA 3GV6A 2NZHA 3BJUA 4NPSA 4R4IA 4DU9A 4K5XA 4A3DG 2K04A 1LTLA 4DFAA 5DLQE 1PTOF 3I4LA 1XX8A 5LL6X 3EIVA 4DAMA 4A3CH 1CSQA 2ZT9C 1Y8NB 2MQHA 1LT3D 1XXGA 4TQUS 4DV1Q 2NVXH 1HFNA 4I7ZC 1PH8A 4JBKA 1LO5D 4HJ9A 2G9HD 5C4XG 4A93B 3TZUA 1A8VA 1DXMA 3KF6A 1ASYA 3IL8A 2VUMB 1TS4A 1S72A 3BS1A 4IUUA 4CBVA 1WTWA 1VQGA 3MAQA 3DEPA 2MUYA 2A68C 1T5EA 3PO3G 1TS2A 3KLWA 2RCFA 1R9TH 1SSOA 5C3WA 1Y1WG 4LF9L 4JC0A 4DR6Q 1FJGL 4DR7Q 1PZKD 1KNAA 3F2UA 4KMUC 3H3VI 4AYBE 4ABNA 3RZOH 1HCZA 1SYGA 2A19A 1STNA 2HDLA 3P7JA 1EQTA 2ICEC 1R9TB 2A6ED 2PW5A 3IFTA 1K0SA 1YI2A 2FJ2A 2LXKA 4NMZA 1KC8C 2DN8A 3TBIB 3KF8A 1TY2A 1I3QH 2EJGC 3H3VC 4C3HB 3C2PA 1PH3A 4YCUA 5T1IA 3GTQH 4CJ0B 4IJHA 2EIFA 4AYBG 4BBSG 2RKSA 4BA2I 2B2VC 3QWNA 1Z9FA 2FMMA 1N9WA 2K5HA 1NUCA 5FKAC 5ELNA 1PYSB 1NCVA 3IRBA 4ZKCB 2EYPA 2NVXB 1BBXC 1TR5A 4DV5Q 1IL8A 1LLRD 3DM3A 1S3OA 1VQPA 1QVGA 1IYVA 2UXDQ 1V8QA 1CZGA 2AUKA 4JCVE 4JPBW 3S2HH 1KRTA 2MO0A 1I6HH 1HR0W 4RHSA 2O2LD 2K14A 3GD7A 2XGTA 4LWCA 2N88A 4B3RL 4DV6L 4HIMA 1Q1BA 3FRPB 5LMUL 5CV5A 4C3JB 4X62Q 2MNAA 3L0OA 4B3SQ 4RKLA 2YTVA 1VQBA 3CU7A 4OO1H 1N33L 3HOWH 1DJRD 1HNZL 3G48A 2A73B 4RMFA 1O80A 4R8IA 3VYTA 4HCSA 2X69A 4BY1H 5JEAJ 5FO9B 2WACA 2HQLA 4JI4Q 2JXMB 4ODGA 5C4JB 5FLMH 4KHVA 2LY7A 4OL7A 1XPUA 2PZTA 1TQOA 3HKZG 1UAPA 1B70B 2OEOA 3T56B 3KYHC 1CTMA 1SYEA 1JE5A 2SNMA 3NP8A 3PO2G 1KXLA 1WTQA 3HOUG 4CDEC 1QZGA 2F3WA 2B2UC 5A35A 2DUDA 1SR3A 1OXSC 4LK1C 3GTPB 1L1OA 1EQVA 1A3VA 1S5FD 1HR0Q 3CQZH 2L55A 5EBDA 3ULPA 3VYSA 5J22A 1CFMA 3E0JA 3NBIA 1H9SB 1WI5A 5EKKA 4OGQC 5ELOA 5GQOA 1XTDA 4LF7L 2WIIB 3K5OA 1PZJD 4MNOA 4HIOA 1NMGA 3UDFA 5JJLA 3J81j 1Y1VB 2L5TA 2ZTEA 4JK1C 2NZ1D 1JMCA 1IYJB 1YVCA 1KIXA 3KJPA 3M4OB 1CK1A 5ELEA 1L1OC 2B2WA 2IL8A 1G6PA 4KV6A 4TKOB 1BOSA 1T9HA 4HMIA 1P8LA 2E2DC 5TSSA 3CCVA 5EBCA 3T16A 1J6QA 1TWFH 4UAIA 4ZK9B 1B3AA 3DLLA 2WB1G 1EU4A 1GM5A 3PO2H 1EWCA 2CH4A 1FD7D 1BF4A 3NENA 4B3TQ 2ES2A 4MTNA 2UXDL 3HOYB 4JI4L 3AQQA 1EEID 3A55A 5IODA 2CCZA 2EOTA 2UXBQ 1PHJA 3SK5A 1B44D 3J7A5 1WVLA 1SYFA 3A8IE 4JOIC 3U9SA 4PZ8A 2ZM6L 4PMWA 1QUQA 2IPKD 1VQCA 1JB3A 1YEZA 2N3SA 5LMNQ 5IGEA 2VZAA 4YWLA 3HOVB 4C3IG 1EYAA 2CFMA 5KGUA 1WFQA 5EAYA 1PRTC 4ZCKA 2YV5A 5C4XB 3S24A 4X66Q 1SMYD 1WTOA 4J1MA 1PTOH 2F3VA 1X6OA 2HDMA 2EYHA 4FF3A 4LF4L 2ASBA 5IY0A 1LYLA 3D3RA 5M5WB 2Y0SE 2CQAA 3T51B 2PZUA 4KY6A 1X3FA 1A15A 5HGQA 1VQDA 1Y1WB 4XDXA 4A3EG 3J80L 4ZYSA 4Y7NH 2ID0A 3PGZA 1ILPA 1LTTD 1SYBA 3MVVA 4JI2L 2OF1A 3RN2A 2EVBA 3SE0A 1J9OA 3I73A 4DR4L 4Y52H 2FHTA 4LAAA 2Z6KC 3BG3A 3OWFA 3J81i 1RHPA 3HOZG 2B2YA 5C3EH 1LTRD 1CKNA 3K0XA 4HJAA 2AUJD 1TS5A 4POFA 5G3LF 1FJGQ 4CKBA 4C56C 4JI7L 2DY8A 4EVOA 1OO9B 2KUMA 3H0GH 1DYQA 1SNDA 3K7UC 2DJGC 4DXGA 2NN6I 1SDFA 1YHAA 2RDGA 3NPPA 4DK1A 3W3AA 3RZDB 3ULJA 4IPGA 1ICWA 4G57A 1I5FA 4GOPB 1HTLD 5JVG3 3GTJH 3I72A 1AZQA 1N34Q 5IOCA 2Z4HA 3BZDB 3HRZC 4YY3Q 1RTNA 1QCBD 1O7YA 2NVTH 4ULLA 1PRTB 2XVSA 2RHSB 3BZKA 1UWVA 1M8AA 1XWEA 3W1BA 3U4VA 1Q90A 2Q2UA 3NEMA 5F2DA 1IXRA 1L1OB 4CJ1B 2UUBL 3OHXC 3CW2C 3I56A 3A0JA 1QJOA 2HCCA 3TS0A 1GO3E 2QDLA 2B8FA 1LABA 1QVFA 3GTOB 3J81L 4PQXA 3BDLA 4GN3B 4GN5A 1JE4A 4KN4C 4DNIA 2B2VA 4A3DH 4IUQA 4DV0Q 1V43A 2NYZD 4EQOA 1EWIA 4BY7B 2OTJA 1ENCA 3A56A 4OO1G 1AP0A 5HY6A 4HR7B 4A3JB 3RMHA 2NVQB 3OMCA 1DZ1A 1A6XA 1B7YB 1IYUA 1EQRA 2EXDA 1GUNA 2WFWA 1VQ8A 4APVA 2JA5G 3GTOH 5I9OA 4RAUC 4V0BA 5I4DA 1X32A 1JICA 1QNUA 3MZ5A 1PFMA 3I4NG 4HJ7A 3GTMH 5EPKA 2KJXA 1YJNA 2D0OA 3D4DA 3GO5A 2K5WA 2PQAB 2K05A 1HR0L 3E3XA 4QJFA 1QE6A 3FMCA 3F2CA 1K0RA 2KENA 3UDGA 4HN7A 1WD1A 2KECA 4XXEA 2BE5D 5CYUA 1LTBD 2NVTB 2K52A 4DK6C 2XN9C 1JWSD 4G7ZC 3C1EA 1TWHB 4L5SA 1RD9D 1E2ZA 1HQRD 2DNCA 1MBYA 5IYCG 5A2QL 2GA4B 3AB9A 1R4QB 2ZM6Q 1O7ZA 2F0SA 1GUWA 2F0LA 4DA2A 1ET6A 1TWHH 1CKMA 5EPLA 4Z9CB 1V1PA 3MXNA 4X65Q 4M8AA 1LT5D 1EFID 2WV6D 3M3YH 1SAPA 1E0BA 3NTIA 3HOYG 3FHWA 3IFDA 1SMXA 1JORA 5ELCA 3PO3H 2ENBA 1G91A 2UUAQ 5C4ZA 1K8AC 1Q3LA 1HNWQ 1X56A 4A3FB 3CXCA 3TP7A 3ERSX 5ELDA 1D6EC 3EROA 1F9RA 1IKMA 1BVSA 4DF7A 3TMEA 1QG7A 1NR2A 1LTAD 4JI2Q 2R93H 2JA7H 1Q82C 1ICFB 5EKLA 3GTLB 2B2WC 3J7YW 4YCVA 1VF7A 1X54A 2N8NA 1VQ4A 1XMQQ 1PXUA 4A3CG 3SDZA 3TP8A 3H3VH 1EY9A 3PUWA 3F1ZA 4NXML 2K28A 5GAEC 1XPOA 4EQ5A 5BR8Q 1PTOC 3AEVA 2PQEA 4FNFA 1HNZQ 4A3EB 3HOVH 4GN4B 4FF4A 1CSPA 3UE0A 3AFQA 2Q2IA 4DR5L 3A7AB 4WJ4A 3V05A 1HUNA 4JI0L 1LTID 5FJ8G 3CMEA 5M3MG 3ZYYX 1KRSA 4O0AA 1SFOH 4JOIA 3MXPA 2J7ZA 1HHVA 2ALYB 3WOFA 4C1NI 1UE1A 4TSSA 2NVYH 4RA8A 2A6HD 2F0HA 1VQ7A 1T5XD 3EJIA 4OWXB 2K6AA 2PI2A 1N8RC 4DV7L 5GAGC 1ESRA 5IGBA 1TIID 3PV0A 3S15B 4A3FH 1SNQA 3PIO3 4K8IA 3S17H 1G8ZD 1TWFB 3PO2B 2KOLA 2TMPA 2HHHQ 5M5XH 3AU7A 3EN2A 3GTJB 4KD4A 4IURA 2A74C 1K8MA 4R9WA 3CMAA 3FEWX 1VCIA 4QMGA 3M4OH 3TEHB 3K5NA 2NTTA 4ME3A 4R4OA 3T1YL 1EYGA 2RHQB 4V190 2B63B 1MIUA 4TVAB 4YIJA 3TN2A 1K83H 4IPCA 1Q8KA 2JE6I 3JC66 2EPBA 4K0KL 2VB3X 2O5JC 3KOJA 4A3BG 3R93A 3EA6A 5LMNL 1TS3A 1UUPA 2F0PA 5M3MH 2JA6H 3NQTA 4IZ8A 4F8MA 1HNWL 2MPMA 4PMBA 3STBC 3VDYA 4EX5A 4IPHA 1WTVA 2AMCB 3KF6B 5GADC 1TXYA 4IO9A 3TSSA 3AMUA 1V1QA 1YHBA 2F3IA 1PRTD 1UNSA 5IGDA 1KAAA 4QCLA 4POGA 4ZQ3A 1SMYC 3RD4A 1YIJA 3H94A 3TREA 3N52A 1ZYRD 1RL2A 3DM1A 5EGTA 1SLJA 4PZ7A 5FLXc 2VY3A 3S1QH 1O7LA 5M5YB 3JAML 5C4JH 2X6LA 2K7VA 4A3GB 1PYBA 3CD6A 2VQEL 2XSCA 4N8X1 1VQEA 1EY0A 1QWYA 3OWEB 3OIPA 1RODA 4JV5Q 4KI0A 4PV1C 3PF4A 1BBWA 2DGYA 3NELA 3HOWB 1SNPA 5FLMG 4XT1B 5M9OA 2OQ0A 2KBNA 1EL0A 4O42A 4B3TL 1PZID 3I3CA 4Q5VA 1L0YB 4PG3A 3H15A 2QEJC 1MKHA 1CQVA 1V1OA 5DEHA 3HOYH 1TWAB 3E5SA 3F2DA 4RGNA 3S2HB 1SBBB 1YHQA 1R4PB 1A63A 1SYDA 3RR5A 3PIPA 4LFBL 4ALPA 2KA7A 1I6VC 2RQXA 2WAQB 1IL2A 4K5WA 1G291 4GNXC 1B8AA 5FO8B 3I4MG 1D5MC 1YNJD 5JAVA 3LX0A 4ID6A 3TQYA 5HURA 2F0NA 4ZAIA 3RLFA 1QILA 4OWWB 3MHBA 1I3QB 2WINB 2Y0SG 1FVIA 4GOPA 1HH2P 1VMPA 2I46A 2HT1A 1TWCB 4DNTB 4JI1L 2F4VL 1QZHA 1Z7TA 1AZPA 2LKVA 1N36L 3NXWA 1FR3A 3T13A 4A3LH 1RJTA 3D4WA 2QDBA 5CC4A 5BR8L 3H09A 4UPAA 4MN3A 2P5ZX 2I07B 1SE2A 2Q8IB 2LMCB 3KBXA 1S5DD 2JP1A 2PMZE 4LUVA 4X3TA 1JT8A 5CV8A 3J81E 1EY7A 1HXYD 2UUBQ 2VUMH 4P72A 1FL0A 1PLFA 4J6HA 5EPJA 3NSWA 2R3ZA 1A2TA 1LUZA 1AE3A 1NR4A 1F9SA 3BDCA 5AJ3Q 2Z6KA 5CV9A 1UE5A 1EIFA 3K5LA 5I6YA 1YBYA 4C1NK 4KN7C 1PTOB 3EFXD 5C0XJ 1D1KA 2J0TD 4DR3L 3NHHA 5C4XH 5C3XA 1TU2B 4X66L 2MHVA 3S9WA 3VA7A 2F0EA 1F2ZA 3PMFA 3W1GA 2MP1A 4DV2Q 3KF8B 4DK0A 2R6GA 2ICIA 4RCNA 1JQYD 5L37A 3PCOB 2TSSA 1W2BA 2XNAC 4HIDA 3DEOA 3CCJA 1W6JA 4KHZA 3HOVG 2Q8TA 3BVMA 3URYA 1I4PA 1G2SA 4IJLA 1AEXA 4DR4Q 4E6IA 2R7DA 3E9IA 3HKZE 2BA1A 4LF8Q 5I2YA 2R7ZG 4DK3C 2JA7G 1JOKA 1DD2A 1LTSD 5CBAE 1P16A 3RZOB 4B3RQ 2VNUD 4YHHQ 3A8KE 1PFNA 2PW7A 5IYBH 3HOXG 2UU9Q 2ZJPA 3PSIA 3K58A 3E9HA 2R92H 4K0KQ 1RDPD 1PVOA 1N34L 5DM73 1EEFD 1EFWA 1X3QA 1XPRA 2BH8A 3X3NA 1E2VA 3CC4A 1SXTA 1UE6A 3K0YA 1TVXA 5BN5A 2ZXPA 3MWYW 4BS9A 1HA5A 3VR2A 1VQ5A 4IFDG 4NXMQ 1XMOQ 1DGSA 2EY5A 4OIKA 2KHJA 1EWHA 4DGZA 3S2DB 5IYCH 1B9NA 1F77A 2KCMA 3M7NA 2F0TA 2PO4A 1I4XA 3AYHB 4C2MH 3P75A 3RLNA 2NWGA 4AH6A 1HPCA 1WYDA 2E2IB 3M85A 4DV7Q 4MIUA 5KRUA 2ZXOA 1K3RA 1CHPD 4OHJA 1C9OA 2CH4W 4LW1A 2OQKA 3VYRA 2QILA 2E75C 4ME5A 3FKIG 4BBRH 2JEAI 2HIXA 4JW0A 5JJIA 1FNWA 3CAMA 4PMCA 1LV9A 3LNNA 4DAYB 2EY6A 2JA5H 1GUTA 3VR3A 1F9QA 1KTKA 3A74A 1VQHA 5IP7G 4KKSA 2F0OA 4BXXG 4RCOA 2A69D 3CPFA 3VR6A 3M4QA 2F0MA 2IHEA 4A3GH 1AE2A 1U4LA 1DONA 2IY5B 4DUZQ 1PMRA 4X6AH 1KL9A 4JI8L 2CVRA 3A5ZB 2BDNA 4X3KA 1SE3A 1IBML 5K36H 3NK9A 5G3LD 4KY5A 2AWOA 3JAMc 5DM63 1VQOA 2I5MX 1GVPA 3K59A 3LWUA 3NE5B 2AQ1B 4IOCA 3AFPA 3I4OA 2Z9HA 1BCPB 1I4HA 5C4HA 2EJMA 4BBSB 1HFGA 5CV7A 4DV0L 3KFUA 1M4VA 5JJKA 1HNXQ 4C3HH 3STBD 3I55A 1X55A 2NN6H 1TKWB 1TWCH 1JB7A 3I90A 5C44H 1NE3A 1Q86C 2B39A 1EYDA 1GKHA 3D6CA 3U50C 1CT1D 2UUCQ 3T53B 2K5DA 3Q23A 1A3UA 1SJED 3SK6A 4KK7A 4A3KG 4NP5A 4P73A 3TZDA 3M9BA 4CKCA 4DV3L 5BN4A 1J5EQ 4JI6L 3L7ZC 2RA4A 4GNXA 1HUMA 5CBEE 3MTSA 1I4GA 4WJ3M 4H13C 2A6EC 3W5OA 2B2TC 1AN8A 1JJ2A 1ENAA 3F8TA 1KAWA 5D3IB 1K3BC 3K57A 2PCFB 2Q2TA 1QVCA 1FNUA 3HFZB 1JC7A 5E1FA 2O5IC 2RBMA 1U5KA 1S5ED 4KTAA 3D8GA 4GKKQ 2YU9H 4LUZA 3LWEA 4K8JA 4L5TA 4QUCA 1PFBA 2KEDA 1SRUA 5C3EG 4IUVA 5CORA 1C4QA 4DN4M 1SFOB 4K14A 5D3DA 2VQEQ 2IX1A 4B3ML 4BY7H 3EBEA 2AQ3B 5AFWA 4DR6L 4A3EH 4X65L 5LHY1 1UE7A 5KYLA 1SYCA 2VL6A 1G51A 1Q12A 3QB3A 1K8GA 1Y14B 1BDOA 4NXNL 1PH1A 4K2LA 2WAQE 1FYCA 1LTGD 1V9PA 2KHSA 1K28A 1B4OA 3G7LA 1Z6HA 5IGFA 1F2YA 2R93B 1HZAA 4N9TA 3PIOA 1D7QA 1H95A 4QIWB 2JN4A 1Q46A 3GDEA 2K75A 4RG1A 1ONLA 2VW9A 1GUSA 5M3MB 1NSNS 1H9SA 1E2WA 4RWSC 1CKOA 3NQIA 1BXTA 2I5LX 3RN5A 2DNEA 4N9PA 1RF2D 1X3EA 1OXXK 2B29A 4UP8A 3C46A 1K83B 1JJGA 1PYWD 3OTOQ 1Q81C 2B63H 4X3UA 4JI1Q 2F4VQ 1A3TA 1GUOA 4CGYB 1VQLA 3N6RA 3HOXB 4HSPA 2IJ0A 1TWGB 5J1ZA 1TT2A 3H0GB 1LT6D 2N78A 1A0IA 1JWUD 1HJPA 4AQYL 2EZVA 4QL5A 5C3EB 4XQNA 3OMGA 2PZWA 4ZUIA 3SHLA 4XQJA 5DNFA 3CCRA 4BA1I 2CW0D 3DWQA 1CA5A 2XTIA 4WRDA 5CR3A 4HAEA 2K5NA 4AIMA 1BCPC 3L3OC 4DUZL 4WORA 4B9WA 4HMJA 2X6GA 1B50A 2CWPA 2RSNA 5H1SE 4GLVB 2F03A 3Q6SA 4F87A 1QUQB 1CZWA 2EDGA 3EQLC 1KLUD 1IW7C 3SXHA 2IHFA 2PNRC 4DR7L 2K03A 3ZJYC 1BCPF 5KEEA 2R93G 3PUXA 4XYOA 2F0DA 5CV4A 4CHTB 3SK4A 3V2TA 3S1MH 1EUJA 3OW7A 3M4YA 3MXNB 2RCNA 3S1MB 3GTLH 1CUKA 5D14A 5K5PA 1N32Q 5IP9G 2G5DA 2UUCL 2A8VA 3UDIA 4DPGA 3V96A 1O7IA 4YWKA 2ZTCA 1CM9A 4BY1G 3G71A 4M1UB 4NW2A 3HG9A 2YU9B 3D0FA 4RHRA 1IBMQ 2WP8J 4P74A 3QJYA 2G9DA 3KDFB 5JEAH 1YJ9A 5FK9C 3HOWG 3FDTA 1I4QA 4MTKA 4H02A 3HOUB 1YNXA 2A68D 4R4TA 3HEJA 1BKBA 1A62A 1SNMA 1PTOD 2Q2HA 3HP3A 2F0JA 2M00A 2F0QA 1Y8PB 3A7LA 3TDQA 2XWBB 1NY4A 2F4IA 1MJEA 2UU9L 4LF9Q 4JYAQ 3BU2A 3R2TA 1E3PA 1D8LA 2HQEA 3QOJA 5IWAL 3CCLA 3R3OA 4A93G 3RZDH 3Q22A 1MHWC 4ILWA 4ZLTF 4DKAC 5ISRA 4BBSH 1I94L 2UXCL 4OO1I 2JA8B 1VMCA 3CQZB 3PUZA 3I4MH 4XTCS 4EQNA 3OIQA 3W2DA 3TRZA 2R7ZH 4DUYL 2MO1A 2I5HA 5D65A 2OCEA 1K9MC 4L63B 3KLRA 2E2HH 3GTMB 2K33A 1EQQA 2B2UA 2E5LQ 4FDBA 3X3MA 1YZ6A 3SGIA 2F0WA 3CCSA 5FLXL 2ATWA 4QGUA 1Y1WH 4DV5L 4A3MH 3PQIA 4A3JH 2NVQH 1D5ZC 4GKKL 1NBWA 2JA5B 3ICEA 1EOVA 3PF5A 1EZ8A 1SNOA 2DJFC 2R61A 3C1FA 2RVLA 2H5XA 2VS1A 4FVMA 1KQSA 4P71A 4O1NA 1E1TA 4FP5D 1ILQA 1JR0D 5IT9E 4QF4A 4L6TB 5GROA 4LNQA 2F0VA 2MGSA 5CV6A 4LF6Q 1Y8OB 4KKUA 1NNXA 4NKLA 1JOQA 1PH6A 4P2CB 1NTGA 1QOHA 4GNXB 4C3JG 4I7AA 4LFCL 3T1HL 4JI8Q 5LMNW 3QR8A 3RNUA 1WTHA 1S4ZA 1VS0A 1ESFA 3KDFA 2AQ2B 2QKIC 3Q0AA 3OPOA 5M3FH 4CDFC 5J39A 1BNZA 3HOZB 4A76A 3H0GG 4UDUC 4A3BH 5C5LA 2NUCA 2KCNA 1ENFA 2KHIA 2D9UA 3S1NH 2F0FA 5FO7B 4LF7Q 4R4QA 2EY1A 3G4SA 4LFAQ 3OTOL 2C35B 1L2FA 4DV2L 4UP7A 1HZ9A 3NBHB 3NWSA 5I2XA 2K50A 2QW7A 2F52A 3TP6A 3L9AX 2L11A 5E3FA 2KVMA 1KABA 3BYYB 3KBGA 5FLXE 5IIFA 4IUPA 4Y7NB 4DR2L 3K7AB 5KNCA 2C5CA 1VDZA 4RGTA 1HNXL 2K1BA 1QB5D 3GV3A 5M5WH 1EY4A 1EZ6A 3CRKC 3CCUA 1M1KC 4R4CA 2HCIA 4B9XA 2JK8A 1BBUA 2QCPX 3A8JE 3VR5A 3VR4A 4HSVA 3D6WA 3S14B 5IP9H 2YTXA 4HJ5A 1IBLQ 3A54A 3QG1A 4X3SA 2LS01 3I91A 2EYFA 2WB1B 1G6ZA 5T1GA 1XJVA 2JQOA 1N32L 4BBRB 4KKTA 3CCQA 4A3IG 5C5MA 4JI0Q 4UHVA 1BUVT 3K80C 4O2DA 1SJHD 3PUVA 5JJZA 2K4KA 2RSOA 4NXNQ 3MEHA 4GLAC 3FPPA 4LFCQ 4IQZA 2E2IH 3KLSA 4DR1Q 2V4DA 5ELFA 4CJ2C 1HZCA 1KDAA 3GTKH 2D5DA 3ERQA 1LACA 1E7ZA 4P75A 1QNKA 4LJZC 2N55A 2HIVA 2LXJA 2PNHA 3MFYA 3DWAA 3E0EA 1MI2A 3DUZA 3CCEA 1OXUA 4GKJQ 3K7AH 1L0XB 4MHEA 1J8IA 2B2TA 2E8GA 2AKWB 3P1HA
chains in the Genus database with same CATH topology
2CW0C 3TP5A 5I9PA 1BQQT 1F9PA 4DAYA 1STYA 1BO0A 3MXGA 2R92B 2E76C 1H9MA 4FXGC 1WTRA 1EIHA 3S1NB 2F0IA 2NTSA 1SEBD 1V1PB 2PPBC 2L0CA 1CHQD 1X3PA 2O4XA 1LT4D 2XIWA 5M3FB 2H1EA 3HZXA 1Y69U 1ML0D 1CA6A 3GTKB 3J80E 2SNSA 3ND8A 1G2TA 4A3IB 3ND9A 4R8NA 1GOZA 2F1MA 2EYMA 2XRQD 4H44C 2EY2A 2EYJA 4WFN3 2L4NA 3D31A 2ZXRA 5C0XH 1EY8A 3K5MA 4DXFA 5FOBB 1CQFA 1EY6A 2RDHA 1A2UA 3VA5A 2SEBD 2IT1A 2EYLA 3I70A 3BYTB 1GJXA 4QUFA 2JEBI 2B2YC 1YNNC 1ZXTA 1KDBA 2VB2X 2FINB 1I6HB 2IX3A 4XIGS 3R2IA 3DXJC 3BDOA 5KYIA 3KLSX 4RH6A 3PIP3 2JYOA 4F88A 2M9VA 1IKLA 2L9HA 2EXZA 1PDQA 2JA6B 3I4NB 5IGCA 4IFDH 1Q8IA 1S5BD 3OOCA 1H9JA 5CGKA 1H9RA 2A69C 2EJFC 4FXDA 1IHZA 4K6LA 2Z4IA 3H91A 4FYDA 4HEDA 2D62A 3VYUA 1MSGA 4IN3A 3C3LA 3EVQA 4J8QA 1U4PA 1I4RA 1HRJA 1AFPA 4OIJA 3S17B 2Q8RE 4XT3B 4DAPA 1B2TA 4RGOS 1RCVD 3S16B 2WKCA 2L1BA 1SE4A 2AWNA 4XYQA 2H4OA 2YYZA 1WTXA 4JBWA 2E2JB 3WOEA 4H7BA 4HTHA 4G7OC 1MD2D 5ELBA 5JVH3 3BVZA 1Z47A 5A2QE 5EJWA 1MSHA 1U4MA 2Z1CA 4QB4A 5JEAG 3HKZB 2CHBD 4I65A 4A3MB 2JA7B 1I50B 1STGA 4IALA 5C0XI 3S1QB 1KLGD 1W6KA 3Q24A 1VF5C 4ZRZA 4DNRB 2FMCA 3GTGB 1C48A 3DMUA 1F2LA 2BOSA 3PO3B 2B8GA 3O13A 1AW7A 4PNYA 2C9OA 1TY0A 4CKEA 3M3YB 1OXTA 1RKNA 2Y0SB 1WTPA 1S5CD 1KNEA 2E74C 1MGSA 2K32A 3HGBA 4WJWA 2EE1A 4AYBB 3QOLA 2KCCA 3IAYA 3MXUA 2EYOA 1O78A 1UEAB 3FVQA 2RDFA 1C8CA 4A3BB 3SR1A 5M5XB 5KNDA 1CI3M 1B9MA 5DAUA 1JWMD 1ZYRC 3P20A 3FKIB 1STAA 3CKIB 1FGBD 5BN3A 4NDXA 1ET9A 2VXWA 3DHQA 1U9RA 3HS0C 3I8ZA 2NVYB 2OT2A 3NUCA 1D5XC 1B53A 1RTOA 3S1RB 3ONAB 3KUPA 3DWPA 1DOLA 5IGGA 4B08A 4A3DB 4IFDJ 1EY5A 1BCPD 4TRDA 2F0KA 1WCMB 3CRLC 2NB0A 3NTHA 4G4KA 2NBFA 2BE5C 4EGVA 1B1ZA 2BDOA 1U4RA 4K5VA 1IW7D 1DM0B 4U68A 1WD0A 2KEEA 4KJNA 3ITPA 3MA2B 5I6WA 5C6AA 1BR9A 1K8OA 4IFDI 1SNCA 1Q1EA 1YNJC 3GP7A 3FPUB 4RGMA 2F0UA 5C0XG 2DY7A 3SEBA 2A5HA 2E2HB 2F0GA 3G6JB 2R7ZB 4IUNA 2SDFA 4BWGB 1PRTF 5CMDA 3I4MB 1HQMC 4A3KB 1KDCA 3T4AC 2L12A 2LFNA 5JOBA 3OSOA 3GQBA 3WDNA 5JPMC 3IKJA 2BA0A 4XQQA 1STBA 2PYKA 2XRSD 4G7HC 1GXDC 2IW3A 1ZKOA 4GZYC 2M2LA 3KK7A 4ZKBB 1XTCD 2NN6G 5E4XA 4KJOA 1STEA 2HUGA 2QF7A 1YNND 4L8JA 4C3HG 2K01A 1FNVA 2D2CC 3QIAA 4ZUJA 4KY7A 2K5QA 4FF2A 3J7AF 2A6HC 1HTPA 4FO2A 4K2KA 1XYIA 1DOMA 3NBHA 4H0LC 5K36G 4F7XA 3UI2A 3JAME 5COYA 4FF1A 2Z8LA 3J7AV 3NTKA 5EQ0A 4DAVA 1II3A 1GUGA 1STHA 1ZEQX 3RUZA 3E6ZX 1D1IA 1DOKA 4C2MB 3H6MA 2IX0A 3U9OA 2XWJB 4LMQD 5E4WC 3K6OA 5IT9L 5KNBA 2MJ8A 5LL6S 3BVGA 5EKIA 1OXVA 4HCEA 3SK8A 1EU3A 4RKBA 2WKDA 3QO2A 3MC0B 1F2MA 1JOOA 2J4XA 5HGTA 5C44B 1D2BA 1EIGA 2KQ3A 4KD3A 5JPNC 3R8BA 1JCKB 4Q0FA 4IUTA 4FXKC 4U673 2SOBA 4RFBA 3D4RA 1H9KA 4K6DA 4S3SA 2PMZB 3PUYA 1GHKA 1EYCA 2FFKB 3NWTA 5KIXA 2JSOA 3MFGA 4BY1B 2IWHA 4EQPA 3M7GA 3SVMA 1HA6A 1GHJA 2OXPA 2BCOA 3CHBD 5NUCA 4C3IB 1EOTA 3GV6A 1DCZA 1NAPA 4DU9A 4K5XA 2K04A 4DFAA 1PTOF 3I4LA 1XX8A 5LL6X 2ZT9C 1Y8NB 1LT3D 1XXGA 4TQUS 1HFNA 4I7ZC 1LO5D 2G9HD 4A93B 3TZUA 1DXMA 2VUMB 3IL8A 1TS4A 3BS1A 4IUUA 4CBVA 1WTWA 3MAQA 3DEPA 2MUYA 2A68C 1T5EA 1TS2A 1SSOA 5C3WA 1PZKD 1KNAA 3F2UA 4KMUC 4ABNA 1HCZA 1SYGA 1STNA 2HDLA 3P7JA 1EQTA 2ICEC 1R9TB 2A6ED 2PW5A 3IFTA 2FJ2A 4NMZA 2DN8A 3TBIB 3KF8A 1TY2A 2EJGC 3H3VC 4C3HB 3C2PA 5T1IA 4CJ0B 2RKSA 4BA2I 2B2VC 3QWNA 2FMMA 1NUCA 5FKAC 1NCVA 4ZKCB 2EYPA 2NVXB 1BBXC 1TR5A 1IL8A 1LLRD 1IYVA 1V8QA 1CZGA 2AUKA 4RHSA 2O2LD 3GD7A 2N88A 1Q1BA 3FRPB 5CV5A 4C3JB 4RKLA 3CU7A 4OO1H 1DJRD 2A73B 1O80A 4R8IA 3VYTA 4HCSA 2X69A 5JEAJ 5FO9B 2WACA 2JXMB 4ODGA 5C4JB 4KHVA 2LY7A 4OL7A 2PZTA 1TQOA 1UAPA 2OEOA 3T56B 1CTMA 1SYEA 2SNMA 3NP8A 1WTQA 2F3WA 2B2UC 5A35A 1OXSC 4LK1C 3GTPB 1EQVA 1A3VA 1S5FD 2L55A 5EBDA 3VYSA 5J22A 1CFMA 3E0JA 3NBIA 1H9SB 5EKKA 4OGQC 2WIIB 3K5OA 1PZJD 1Y1VB 2L5TA 4JK1C 2NZ1D 3M4OB 1CK1A 5ELEA 2B2WA 2IL8A 4KV6A 4TKOB 1BOSA 4HMIA 2E2DC 5TSSA 5EBCA 3T16A 4UAIA 4ZK9B 1B3AA 1EU4A 1EWCA 1FD7D 1BF4A 3HOYB 1EEID 3A55A 5IODA 2EOTA 3SK5A 1B44D 1WVLA 1SYFA 3A8IE 3U9SA 3P1HA 4PMWA 2IPKD 1JB3A 5IGEA 3HOVB 4C3IG 1EYAA 5KGUA 1PRTC 5C4XB 1SMYD 1WTOA 4J1MA 1PTOH 2F3VA 2HDMA 2EYHA 4FF3A 3D3RA 5M5WB 3T51B 2CQAA 2PZUA 4KY6A 1A15A 1Y1WB 4XDXA 3J80L 4ZYSA 2ID0A 1ILPA 1LTTD 1SYBA 3MVVA 2OF1A 2EVBA 3SE0A 1J9OA 3I73A 2FHTA 4LAAA 3BG3A 3OWFA 1RHPA 2B2YA 1LTRD 2AUJD 1TS5A 5G3LF 4CKBA 4C56C 2DY8A 4EVOA 1OO9B 2KUMA 1DYQA 1SNDA 4DXGA 2NN6I 1SDFA 2RDGA 3NPPA 4DK1A 3W3AA 3RZDB 1ICWA 4G57A 1HTLD 5JVG3 3I72A 1AZQA 5IOCA 2Z4HA 3BZDB 3HRZC 1RTNA 1QCBD 1O7YA 4ULLA 1PRTB 2XVSA 1M8AA 1XWEA 1Q90A 5F2DA 4CJ1B 3OHXC 1QJOA 2HCCA 2B8FA 1LABA 3GTOB 3J81L 4PQXA 3BDLA 4KN4C 1JE4A 2B2VA 4IUQA 1V43A 2NYZD 4EQOA 4BY7B 1ENCA 3A56A 4OO1G 1AP0A 4HR7B 4A3JB 3RMHA 2NVQB 3OMCA 1DZ1A 1A6XA 1IYUA 1GUNA 5I9OA 4RAUC 4V0BA 5I4DA 1X32A 1JICA 1QNUA 3MZ5A 1PFMA 5EPKA 2KJXA 3D4DA 3GO5A 2K5WA 2K05A 1QE6A 3FMCA 4HN7A 1WD1A 2KECA 4XXEA 2BE5D 5CYUA 1LTBD 2NVTB 2XN9C 1JWSD 4G7ZC 3C1EA 1TWHB 1RD9D 1E2ZA 1HQRD 2DNCA 1MBYA 5A2QL 2GA4B 3AB9A 1R4QB 1O7ZA 2F0SA 1GUWA 2F0LA 4DA2A 1ET6A 5EPLA 4Z9CB 1V1PA 3MXNA 4M8AA 1LT5D 1EFID 2WV6D 1SAPA 1E0BA 3NTIA 3IFDA 1JORA 5ELCA 2ENBA 1G91A 5C4ZA 1Q3LA 4A3FB 3TP7A 5ELDA 1D6EC 3EROA 1F9RA 1IKMA 4DF7A 3TMEA 1QG7A 1NR2A 1LTAD 5EKLA 3GTLB 2B2WC 3J7YW 1VF7A 1PXUA 3SDZA 3TP8A 1EY9A 3PUWA 2K28A 1PTOC 2PQEA 4FNFA 4A3EB 4FF4A 3A7AB 3V05A 1HUNA 1LTID 3ZYYX 3MXPA 2J7ZA 1HHVA 3WOFA 4C1NI 4TSSA 4RA8A 2A6HD 2F0HA 1T5XD 3EJIA 2K6AA 1ESRA 5IGBA 1TIID 3PV0A 3S15B 1SNQA 3PIO3 4K8IA 1G8ZD 1TWFB 3PO2B 2KOLA 2TMPA 3AU7A 3GTJB 4KD4A 4IURA 2A74C 1K8MA 4R9WA 3FEWX 1VCIA 4QMGA 3K5NA 2NTTA 4V190 2B63B 4YIJA 3TN2A 2JE6I 2EPBA 2VB3X 2O5JC 3R93A 3EA6A 1TS3A 1UUPA 2F0PA 3NQTA 4IZ8A 4F8MA 2MPMA 4PMBA 1WTVA 3TSSA 3AMUA 1PRTD 1UNSA 5IGDA 1KAAA 4QCLA 4ZQ3A 1SMYC 3RD4A 3H94A 3N52A 1ZYRD 3DM1A 5EGTA 1O7LA 5M5YB 3JAML 2X6LA 2K7VA 4A3GB 2XSCA 1EY0A 1QWYA 3OWEB 3OIPA 1RODA 4KI0A 4PV1C 3HOWB 1SNPA 4XT1B 5M9OA 1EL0A 4O42A 1PZID 3I3CA 4Q5VA 1L0YB 2QEJC 1CQVA 1V1OA 5DEHA 1TWAB 3E5SA 4RGNA 3S2HB 1SBBB 1R4PB 1SYDA 2KA7A 1I6VC 2RQXA 2WAQB 4K5WA 1G291 5FO8B 1D5MC 1YNJD 5JAVA 3LX0A 4ID6A 5HURA 2F0NA 4ZAIA 3RLFA 1QILA 3MHBA 1I3QB 2WINB 1VMPA 2I46A 1TWCB 4DNTB 1Z7TA 1AZPA 2LKVA 3NXWA 1FR3A 3T13A 1RJTA 3D4WA 2QDBA 5CC4A 3H09A 4MN3A 2I07B 1SE2A 2Q8IB 2LMCB 3KBXA 1S5DD 2JP1A 4X3TA 5CV8A 3J81E 1EY7A 1HXYD 1PLFA 4J6HA 5EPJA 3NSWA 2R3ZA 1A2TA 1NR4A 1F9SA 3BDCA 5CV9A 3K5LA 5I6YA 4C1NK 4KN7C 1PTOB 3EFXD 5C0XJ 1D1KA 2J0TD 3NHHA 5C3XA 1TU2B 2MHVA 3S9WA 3VA7A 2F0EA 1F2ZA 3PMFA 2MP1A 4DK0A 2R6GA 2ICIA 4RCNA 1JQYD 2TSSA 2XNAC 3DEOA 1W6JA 4KHZA 2Q8TA 3BVMA 3URYA 1I4PA 1G2SA 1AEXA 4E6IA 2BA1A 5I2YA 1JOKA 1DD2A 1LTSD 5CBAE 3RZOB 2VNUD 3A8KE 1PFNA 2PW7A 3K58A 1RDPD 5DM73 1EEFD 1X3QA 3X3NA 1E2VA 1SXTA 3K0YA 1TVXA 5BN5A 2ZXPA 3MWYW 4BS9A 1HA5A 3VR2A 4IFDG 2EY5A 4OIKA 1EWHA 4DGZA 3S2DB 1B9NA 1F77A 3M7NA 2F0TA 2PO4A 1I4XA 3P75A 2NWGA 1HPCA 2E2IB 3M85A 4MIUA 5KRUA 2ZXOA 1CHPD 4OHJA 3VYRA 2QILA 2E75C 4ME5A 2JEAI 1FNWA 4PMCA 1LV9A 3LNNA 2EY6A 1GUTA 3VR3A 1F9QA 1KTKA 4KKSA 2F0OA 4RCOA 2A69D 3VR6A 2F0MA 1U4LA 1DONA 1PMRA 2CVRA 2BDNA 4X3KA 1SE3A 5K36H 3NK9A 5G3LD 4KY5A 2AWOA 5DM63 3K59A 3LWUA 3NE5B 2AQ1B 1BCPB 1I4HA 5C4HA 2EJMA 4BBSB 1HFGA 5CV7A 1M4VA 2NN6H 1TKWB 3I90A 2B39A 1EYDA 3D6CA 1CT1D 3T53B 2K5DA 3Q23A 1A3UA 1SJED 3SK6A 4KK7A 4NP5A 3TZDA 4CKCA 5BN4A 3L7ZC 2RA4A 1HUMA 5CBEE 3MTSA 1I4GA 4H13C 2A6EC 2B2TC 1AN8A 1ENAA 5D3IB 3K57A 2PCFB 1FNUA 1JC7A 5E1FA 2O5IC 2RBMA 1S5ED 4KTAA 3D8GA 3LWEA 4K8JA 4QUCA 1PFBA 2KEDA 4IUVA 5CORA 1C4QA 4DN4M 1SFOB 4K14A 5D3DA 2IX1A 2AQ3B 5AFWA 5LHY1 5KYLA 1SYCA 1Q12A 3QB3A 1BDOA 4K2LA 1FYCA 1LTGD 2KHSA 1B4OA 3G7LA 1Z6HA 5IGFA 1F2YA 2R93B 4N9TA 4QIWB 1ONLA 1GUSA 5M3MB 1NSNS 1H9SA 1E2WA 4RWSC 3NQIA 1BXTA 2DNEA 4N9PA 1RF2D 1OXXK 3C46A 1K83B 1PYWD 4X3UA 1A3TA 1GUOA 4CGYB 3N6RA 3HOXB 4HSPA 2IJ0A 1TWGB 5J1ZA 1TT2A 3H0GB 1LT6D 1JWUD 2EZVA 5C3EB 4XQNA 3OMGA 2PZWA 4ZUIA 3SHLA 4XQJA 5DNFA 4BA1I 2CW0D 3DWQA 1CA5A 4WRDA 5CR3A 4HAEA 1BCPC 3L3OC 4WORA 4B9WA 4HMJA 2X6GA 1B50A 2RSNA 2F03A 3Q6SA 4F87A 1CZWA 2EDGA 3EQLC 1KLUD 1IW7C 3SXHA 2PNRC 2K03A 1BCPF 5KEEA 3PUXA 4XYOA 2F0DA 5CV4A 4CHTB 3SK4A 3V2TA 3OW7A 3M4YA 3S1MB 5D14A 5K5PA 3V96A 1CM9A 4M1UB 4NW2A 3HG9A 2YU9B 4RHRA 2WP8J 3QJYA 2G9DA 5JEAH 5FK9C 3FDTA 1I4QA 3HOUB 2A68D 3HEJA 1SNMA 1PTOD 3HP3A 2F0JA 2M00A 2F0QA 1Y8PB 3A7LA 3TDQA 2XWBB 2F4IA 3R2TA 2HQEA 3QOJA 3R3OA 3Q22A 4ILWA 4ZLTF 5ISRA 4OO1I 2JA8B 1VMCA 3CQZB 3PUZA 4XTCS 4EQNA 3OIQA 3W2DA 5D65A 4L63B 3KLRA 3GTMB 2K33A 2B2UA 3X3MA 2F0WA 5FLXL 1D5ZC 2JA5B 1EZ8A 1SNOA 2R61A 3C1FA 2RVLA 4FVMA 4O1NA 4FP5D 1ILQA 1JR0D 5IT9E 4QF4A 4L6TB 2F0VA 2MGSA 5CV6A 1Y8OB 4KKUA 4NKLA 1JOQA 4P2CB 1QOHA 4C3JG 1S4ZA 1ESFA 2AQ2B 2QKIC 3Q0AA 3OPOA 5J39A 1BNZA 3HOZB 4UDUC 5C5LA 2NUCA 2KCNA 1ENFA 2D9UA 2F0FA 5FO7B 2EY1A 3NWSA 5I2XA 3TP6A 3L9AX 2L11A 5E3FA 2KVMA 1KABA 3BYYB 3KBGA 5FLXE 5IIFA 4IUPA 4Y7NB 3K7AB 5KNCA 2C5CA 1VDZA 4RGTA 2K1BA 1QB5D 3GV3A 1EY4A 1EZ6A 3CRKC 2HCIA 4B9XA 2QCPX 3A8JE 3VR5A 3VR4A 4HSVA 3D6WA 3S14B 3A54A 3QG1A 4X3SA 2LS01 3I91A 2EYFA 2WB1B 1G6ZA 5T1GA 4BBRB 4KKTA 5C5MA 1BUVT 1SJHD 3PUVA 5JJZA 2RSOA 3MEHA 3FPPA 4IQZA 3KLSA 2V4DA 5ELFA 4CJ2C 1KDAA 2D5DA 3ERQA 1LACA 1QNKA 4LJZC 2N55A 3MFYA 3DWAA 1MI2A 3DUZA 1OXUA 1L0XB 4MHEA 1J8IA 2B2TA 3GTQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHB A;  3SK8 A;  3C1E A;  1SND A;  1IHZ A;  2F0F A;  3TP5 A;  5I9P A;  4RKB A;  1RKN A;  4QMG A;  1F2M A;  1A3T A;  1JOO A;  2EY1 A;  2HQE A;  5HGT A;  2PW7 A;  1KDC A;  3QOJ A;  2F0S A;  3R3O A;  1STY A;  5JOB A;  1EYD A;  2LKV A;  2F0L A;  3D6C A;  1SYG A;  3NXW A;  3OSO A;  5J1Z A;  4YIJ A;  1STN A;  1TT2 A;  2KQ3 A;  1A3U A;  4G57 A;  4KD3 A;  3SK6 A;  3T13 A;  4NP5 A;  5ISR A;  2PW5 A;  3QOL A;  3TP6 A;  3D4W A;  3EVQ A;  2QDB A;  5IOC A;  5CC4 A;  4NMZ A;  2SOB A;  4B9W A;  5E3F A;  2EYO A;  2F0I A;  3OMG A;  4EQN A;  2PZW A;  4KV6 A;  4ZUI A;  3SHL A;  1STB A;  2F0P A;  2PYK A;  2RDF A;  2RKS A;  1KAB A;  3NQT A;  4IZ8 A;  3SR1 A;  2O4X A;  1JOR A;  4F8M A;  4HMI A;  1ENA A;  2ENB A;  5IIF A;  4PMB A;  5C4Z A;  3T16 A;  1NUC A;  3HZX A;  4K6D A;  4WRD A;  2EY5 A;  5CV8 A;  5CR3 A;  5DAU A;  1EY7 A;  4S3S A;  3TP7 A;  1STA A;  1EYC A;  2EYP A;  4WOR A;  5E1F A;  4NDX A;  4HMJ A;  2SNS A;  2RBM A;  3ERO A;  1KAA A;  1TR5 A;  4KJO A;  5F2D A;  4ZQ3 A;  4DGZ A;  5IGD A;  4J6H A;  4R8N A;  2F0W A;  4KTA A;  4DF7 A;  5IOD A;  1EY4 A;  5KIX A;  3D8G A;  1A2T A;  3TME A;  2EYM A;  1EZ6 A;  2F0T A;  3DHQ A;  1U9R A;  3BDC A;  3P75 A;  4H7B A;  5EGT A;  4K8J A;  3SK5 A;  4ZUJ A;  3SXH A;  4B9X A;  4HTH A;  1SYF A;  2EY2 A;  5CV9 A;  5EKL A;  2EYJ A;  4EQP A;  3NUC A;  3BDL A;  4KY7 A;  4MIU A;  3P1H A;  5CV5 A;  5KRU A;  1EY8 A;  4K14 A;  5I6Y A;  5KEE A;  1EZ8 A;  2OXP A;  1SNO A;  4RKL A;  2F0D A;  3C1F A;  3TP8 A;  5CV4 A;  1EY9 A;  4K2K A;  5IGE A;  3SK4 A;  1EY6 A;  5IGG A;  1A2U A;  1EY0 A;  5NUC A;  3V2T A;  2EYF A;  3VA5 A;  3NHH A;  5C3X A;  4EQO A;  4F7X A;  4ME5 A;  1EYA A;  4QB4 A;  5I9O A;  1EY5 A;  2EYL A;  4DU9 A;  4K5X A;  5KGU A;  5KYL A;  1SYC A;  4PMC A;  3S9W A;  1ENC A;  2F0E A;  1F2Z A;  2EY6 A;  2PQE A;  3QB3 A;  4QF4 A;  4TRD A;  2F0K A;  4DFA A;  3PMF A;  5C5M A;  1SNP A;  2F0V A;  5M9O A;  4J1M A;  2F0O A;  4K2L A;  1KDB A;  2F3V A;  5CV6 A;  4I65 A;  1II3 A;  5K5P A;  1STH A;  2EYH A;  3OMC A;  4NKL A;  2WAC A;  1JOQ A;  2KHS A;  2F0M A;  4ODG A;  4K5V A;  3MEH A;  3RUZ A;  4KHV A;  1STG A;  3MXP A;  4IAL A;  5DEH A;  4OL7 A;  5IGF A;  5KYI A;  2PZU A;  2PZT A;  4KJN A;  1F2Y A;  3E5S A;  1TQO A;  3ITP A;  4KY6 A;  5I6W A;  1KDA A;  5C6A A;  3MZ5 A;  2F0H A;  4N9T A;  2OEO A;  3EJI A;  1SYD A;  3H6M A;  3ERQ A;  3U9O A;  1SYE A;  1AEX A;  5IGB A;  1SNC A;  2SNM A;  3NK9 A;  3D4D A;  3NP8 A;  4KY5 A;  3DMU A;  1SYB A;  3MVV A;  3HEJ A;  2OF1 A;  4E6I A;  2EXZ A;  1SNM A;  2F3W A;  1NSN S;  5IGC A;  4PNY A;  1SNQ A;  2F0U A;  4K5W A;  4K8I A;  4LAA A;  1EQV A;  1A3V A;  3OWF A;  2F0J A;  2M00 A;  5J39 A;  2F0Q A;  4N9P A;  2F0G A;  5J22 A;  5JAV A;  5C4H A;  1JOK A;  3LX0 A;  4ID6 A;  4IUN A;  5CGK A;  5C5L A;  2NUC A;  5EKK A;  5CV7 A;  5C3W A;  5HUR A;  4KD4 A;  4EVO A;  2F0N A; 
#chains in the Genus database with same CATH topology
 2CW0 C;  1KHI A;  5IWA Q;  4HJ8 A;  2JA8 G;  3TP5 A;  1Y1V H;  5I9P A;  1ASZ A;  1VQJ A;  4MZ9 A;  4HIK A;  2NZO A;  1BQQ T;  1C7Y A;  1F9P A;  4DAY A;  1STY A;  1BO0 A;  3MXG A;  2R92 B;  2E76 C;  1H9M A;  4AQY Q;  2VQF Q;  4FXG C;  1WTR A;  1EIH A;  2HD3 A;  3S1N B;  2F0I A;  5IYD G;  2NTS A;  1SEB D;  1V1P B;  3GTP H;  2PPB C;  2L0C A;  1CHQ D;  1X3P A;  2O4X A;  1LT4 D;  2GN5 A;  2XIW A;  5M3F B;  2H1E A;  3HZX A;  1Y69 U;  1ML0 D;  4A3F G;  4JBM A;  4GOP C;  1CA6 A;  1E1O A;  1RIP A;  1K73 C;  4L5R C;  3GTK B;  3J80 E;  2SNS A;  1TWA H;  3ND8 A;  4IPD A;  3M4P A;  1G2T A;  1KD1 C;  4A3I B;  3ND9 A;  4R8N A;  5E7N A;  1GOZ A;  2F1M A;  2EYM A;  4A3G G;  2XRQ D;  4H44 C;  2EY2 A;  2EYJ A;  4WFN 3;  2L4N A;  3D31 A;  5IP7 H;  2ZXR A;  5C0X H;  3GTQ B;  4LFB Q;  1EY8 A;  3K5M A;  4A4I A;  2V1C C;  4JI3 Q;  1PV4 A;  4DXF A;  1W3S A;  5IE8 A;  5FOB B;  4JI5 L;  1XNQ L;  1CQF A;  1EY6 A;  2RDH A;  1A2U A;  3UE1 A;  1XNR L;  3VA5 A;  2AHO B;  2SEB D;  4DV3 Q;  2IT1 A;  2EYL A;  3I70 A;  3BYT B;  1GJX A;  4QUF A;  4LF6 L;  4C3J H;  2JEB I;  3T1Y Q;  2B2Y C;  5M5Y H;  1YNN C;  4GS3 A;  2FXQ A;  1ZXT A;  1KDB A;  1FGU A;  2VB2 X;  4BY7 G;  2FIN B;  1I6H B;  2IX3 A;  2UUA L;  3ER0 A;  4XIG S;  3CC2 A;  3R2I A;  3DXJ C;  3BDO A;  5KYI A;  1N36 Q;  3KLS X;  4RH6 A;  4JBJ A;  3PIP 3;  2JYO A;  3ULL A;  4DV1 L;  2OTL A;  1C0A A;  4F88 A;  2M9V A;  1IKL A;  2L9H A;  2EXZ A;  1PDQ A;  2JA6 B;  3I4N B;  5IGC A;  4IFD H;  1Q8I A;  1S5B D;  3OOC A;  1H9J A;  5CGK A;  1H9R A;  2A69 C;  2EJF C;  4FXD A;  2I0Q A;  1IHZ A;  4K6L A;  3CCM A;  1S40 A;  1SN8 A;  4JG2 A;  4A3K H;  5IYB G;  2Z4I A;  3H91 A;  4R1J A;  4FYD A;  4HED A;  2D62 A;  1I94 Q;  2UXC Q;  3VYU A;  1MSG A;  4IN3 A;  3C3L A;  3EVQ A;  4J8Q A;  1X65 A;  1U4P A;  1JJC B;  1I4R A;  1Q7Y C;  1HRJ A;  1AFP A;  3Q8D A;  1YIT A;  4OIJ A;  3S17 B;  2Q8R E;  3F2B A;  4XT3 B;  4DAP A;  1B2T A;  4RGO S;  4A93 H;  1RCV D;  3S16 B;  2WKC A;  2L1B A;  4DR1 L;  1SE4 A;  2AWN A;  4XYQ A;  2H4O A;  2YYZ A;  1WTX A;  4JBW A;  2E2J B;  3WOE A;  4NB3 A;  2B3G A;  4OWT B;  4H7B A;  2L15 A;  2RF4 A;  2CWA A;  4HTH A;  1WCM H;  4G7O C;  1MD2 D;  1VQK A;  3I7F A;  5ELB A;  3OYY A;  5JVH 3;  3BVZ A;  4DR3 Q;  1Z47 A;  5A2Q E;  5EJW A;  1MSH A;  4C3I H;  1U4M A;  2Z0S A;  2Z1C A;  4QB4 A;  3LGJ A;  5JEA G;  4DUY Q;  3HKZ B;  1IBK Q;  2CHB D;  4I65 A;  4A3M B;  2JA7 B;  1I50 B;  4OX9 L;  4LF5 L;  3S14 H;  1X3G A;  1STG A;  4IAL A;  5C0X I;  2D0P A;  3S1Q B;  1KLG D;  1W6K A;  3TS2 A;  3Q24 A;  1VF5 C;  4ZRZ A;  4DNR B;  2FMC A;  1PH5 A;  3GTG B;  1C48 A;  3DMU A;  1F2L A;  2BOS A;  3U4Z A;  3PO3 B;  2B8G A;  3O13 A;  1AW7 A;  4PNY A;  4LF8 L;  1PFS A;  2C9O A;  1TY0 A;  1Y1V G;  4CKE A;  3WWV A;  1YJW A;  3M3Y B;  2JA8 H;  4QQB X;  4QIW E;  1OXT A;  2GVB A;  4JV5 L;  4KHP Q;  1RKN A;  2Y0S B;  1WTP A;  1S5C D;  1KNE A;  2E74 C;  3L2P A;  3K81 C;  1MGS A;  2K32 A;  2K5V A;  3HGB A;  3RLO A;  4WJW A;  3HOX H;  2EE1 A;  4AYB B;  3QOL A;  1PH4 A;  3CPW A;  2KCC A;  3IAY A;  4X64 Q;  3MXU A;  2EYO A;  1O78 A;  4JVZ A;  2CQO A;  2ZTD A;  3BZC A;  1UEA B;  3FVQ A;  2RDF A;  1C8C A;  4A3B B;  3I2Z A;  3SR1 A;  5M5X B;  5KND A;  3HOZ H;  4LF4 Q;  1CI3 M;  2HHH L;  3HOU H;  3GTG H;  1B9M A;  2YTY A;  5DAU A;  1JWM D;  1ZYR C;  3J7Z C;  3P20 A;  3FKI B;  3U58 A;  4DV4 Q;  1STA A;  3CKI B;  1FGB D;  5BN3 A;  4NDX A;  1ET9 A;  1GD7 A;  3S15 H;  2B63 G;  2GVA A;  2VXW A;  2OWO A;  3DHQ A;  1U9R A;  3HS0 C;  3I8Z A;  2NVY B;  3A5U A;  1I50 H;  2OT2 A;  3CC7 A;  1EIY B;  4JYA L;  1HZB A;  2JA9 A;  3FP9 A;  3NUC A;  5GAH C;  1D5X C;  4JI5 Q;  1XNQ Q;  1B53 A;  1RTO A;  3S1R B;  3ONA B;  1XNR Q;  3KUP A;  2R7F A;  4UP9 A;  3DWP A;  1DOL A;  4JI7 Q;  5IGG A;  4B08 A;  4A3D B;  4IFD J;  1EY5 A;  4A75 A;  3B6Y A;  1BCP D;  1IBK L;  4TRD A;  2F0K A;  4LF5 Q;  1WCM B;  3CRL C;  2NB0 A;  3NTH A;  4G4K A;  2NBF A;  2BE5 C;  4GLX A;  4KHP L;  4EGV A;  1B1Z A;  2BDO A;  2MFI A;  1U4R A;  4K5V A;  1IW7 D;  3T1H Q;  1DM0 B;  4U68 A;  3J80 i;  1WD0 A;  2KEE A;  4KJN A;  1VQF A;  3HKS A;  3ITP A;  3MA2 B;  5C6A A;  5I6W A;  4YY3 L;  3S16 H;  1BR9 A;  1K8O A;  4IFD I;  2Z6B A;  4X62 L;  1SNC A;  2VUM G;  1Q1E A;  4X64 L;  1YNJ C;  5AJ3 L;  3GP7 A;  3FPU B;  5J3B A;  2JA6 G;  4RGM A;  2F0U A;  4J15 A;  4QY7 A;  5C0X G;  2DY7 A;  1PH7 A;  4IOA A;  3SEB A;  2A5H A;  2E2H B;  1X9N A;  2F0G A;  3G6J B;  1PH2 A;  4CDD C;  1VQA A;  2R7Z B;  4IUN A;  2SDF A;  4BWG B;  1PRT F;  4YHH L;  5CMD A;  1E24 A;  3I4M B;  1VQ6 A;  1UEB A;  1HQM C;  4A3L G;  4A3K B;  1KDC A;  3T4A C;  2L12 A;  2LFN A;  5JOB A;  4DR5 Q;  4OON A;  2A1A A;  3OSO A;  3GQB A;  4YWM A;  2WAQ G;  3WDN A;  5JPM C;  2WB1 E;  3J80 c;  5IYD H;  4CDC C;  3IKJ A;  1VQI A;  2BA0 A;  4XQQ A;  1STB A;  1SE8 A;  2PYK A;  2XRS D;  4G7H C;  4OEL B;  1SRO A;  1GXD C;  2IW3 A;  2CKZ B;  1ZKO A;  4GZY C;  1OTC A;  1MJC A;  5C44 G;  2M2L A;  3KK7 A;  2EQS A;  4ZKB B;  1XTC D;  1NMF A;  2NN6 G;  5E4X A;  1WOC A;  2LSS A;  4KJO A;  1STE A;  2HUG A;  2QF7 A;  1NJI C;  1YNN D;  4L8J A;  4C3H G;  2K01 A;  2UXB L;  2BH2 A;  1FNV A;  2D2C C;  3QIA A;  4ZUJ A;  2N49 A;  2VQF L;  4KY7 A;  1PH9 A;  3KJO A;  2K5Q A;  4LFA L;  4FF2 A;  3J7A F;  4OEM B;  4A3J G;  2A6H C;  4A3M G;  1HTP A;  4FO2 A;  4K2K A;  3UDX A;  1XYI A;  3JAM i;  1DOM A;  3NBH A;  4B3S L;  4H0L C;  5K36 G;  4F7X A;  3UI2 A;  2QA4 A;  3JAM E;  5COY A;  1LM0 A;  2Z8L A;  4FF1 A;  1VQ9 A;  3J7A V;  3NTK A;  3S1R H;  2QEX A;  5EQ0 A;  4DAV A;  4LUO A;  1L0W A;  1II3 A;  1GUG A;  1STH A;  3G6E A;  2QGQ A;  1ZEQ X;  4BXX H;  3OW2 A;  4DR2 Q;  3RUZ A;  4A3I H;  1AH9 A;  3E6Z X;  1D1I A;  1DOK A;  4C2M B;  3FKI H;  4BBR G;  3H6M A;  2IX0 A;  3U9O A;  2E2J H;  4LMQ D;  2PI2 E;  2XWJ B;  2ZJR A;  4UY8 C;  4JI3 L;  1IZ6 A;  5E4W C;  3S2D H;  3K6O A;  4DV6 Q;  4DV4 L;  5IT9 c;  1VQM A;  2E5L L;  2PQA A;  5IT9 L;  5KNB A;  2MJ8 A;  1E22 A;  1IBL L;  1M90 C;  4KLK A;  3BVG A;  1OXV A;  5EKI A;  5LL6 S;  1N33 Q;  4HCE A;  3SK8 A;  1B3Q A;  1EU3 A;  4RKB A;  2WKD A;  1CKN B;  4L5Q A;  3MC0 B;  3QO2 A;  1F2M A;  1JOO A;  2J4X A;  2ZJQ A;  5HGT A;  5C44 B;  1D2B A;  1XMQ L;  1EIG A;  3MEF A;  1TWG H;  2KQ3 A;  1J5E L;  4KD3 A;  4JI6 Q;  1VQN A;  5JPN C;  3R8B A;  1JCK B;  4Q0F A;  4IUT A;  4FXK C;  4U67 3;  3CP0 A;  2SOB A;  4RFB A;  3D4R A;  1PA6 A;  1H9K A;  2R92 G;  1XMO L;  4K6D A;  4OXP A;  3CF5 A;  4S3S A;  2PMZ B;  3PUY A;  3I4N H;  1GHK A;  4GKJ L;  1EYC A;  1WJJ A;  2KCT A;  2FFK B;  4OX9 Q;  3NWT A;  5KIX A;  1U0L A;  2JSO A;  3MFG A;  4BY1 B;  2IWH A;  5M3F G;  4B3M Q;  4EQP A;  3M7G A;  4YCW A;  1WCM G;  3J81 c;  3SVM A;  5FJ8 H;  1HA6 A;  1GHJ A;  2OXP A;  5LMU Q;  2BCO A;  4N8F A;  3CHB D;  3K8A A;  5NUC A;  4PZ6 A;  4C3I B;  1EOT A;  2JJQ A;  1DCZ A;  1NAP A;  3GV6 A;  2NZH A;  3BJU A;  4NPS A;  4R4I A;  4DU9 A;  4K5X A;  4A3D G;  2K04 A;  1LTL A;  4DFA A;  5DLQ E;  1PTO F;  3I4L A;  1XX8 A;  5LL6 X;  3EIV A;  4DAM A;  4A3C H;  1CSQ A;  2ZT9 C;  1Y8N B;  2MQH A;  1LT3 D;  1XXG A;  4TQU S;  4DV1 Q;  2NVX H;  1HFN A;  4I7Z C;  1PH8 A;  4JBK A;  1LO5 D;  4HJ9 A;  2G9H D;  5C4X G;  4A93 B;  3TZU A;  1A8V A;  1DXM A;  3KF6 A;  1ASY A;  3IL8 A;  2VUM B;  1TS4 A;  1S72 A;  3BS1 A;  4IUU A;  4CBV A;  1WTW A;  1VQG A;  3MAQ A;  3DEP A;  2MUY A;  2A68 C;  1T5E A;  3PO3 G;  1TS2 A;  3KLW A;  2RCF A;  1R9T H;  1SSO A;  5C3W A;  1Y1W G;  4LF9 L;  4JC0 A;  4DR6 Q;  1FJG L;  4DR7 Q;  1PZK D;  1KNA A;  3F2U A;  4KMU C;  3H3V I;  4AYB E;  4ABN A;  3RZO H;  1HCZ A;  1SYG A;  2A19 A;  1STN A;  2HDL A;  3P7J A;  1EQT A;  2ICE C;  1R9T B;  2A6E D;  2PW5 A;  3IFT A;  1K0S A;  1YI2 A;  2FJ2 A;  2LXK A;  4NMZ A;  1KC8 C;  2DN8 A;  3TBI B;  3KF8 A;  1TY2 A;  1I3Q H;  2EJG C;  3H3V C;  4C3H B;  3C2P A;  1PH3 A;  4YCU A;  5T1I A;  3GTQ H;  4CJ0 B;  4IJH A;  2EIF A;  4AYB G;  4BBS G;  2RKS A;  4BA2 I;  2B2V C;  3QWN A;  1Z9F A;  2FMM A;  1N9W A;  2K5H A;  1NUC A;  5FKA C;  5ELN A;  1PYS B;  1NCV A;  3IRB A;  4ZKC B;  2EYP A;  2NVX B;  1BBX C;  1TR5 A;  4DV5 Q;  1IL8 A;  1LLR D;  3DM3 A;  1S3O A;  1VQP A;  1QVG A;  1IYV A;  2UXD Q;  1V8Q A;  1CZG A;  2AUK A;  4JCV E;  4JPB W;  3S2H H;  1KRT A;  2MO0 A;  1I6H H;  1HR0 W;  4RHS A;  2O2L D;  2K14 A;  3GD7 A;  2XGT A;  4LWC A;  2N88 A;  4B3R L;  4DV6 L;  4HIM A;  1Q1B A;  3FRP B;  5LMU L;  5CV5 A;  4C3J B;  4X62 Q;  2MNA A;  3L0O A;  4B3S Q;  4RKL A;  2YTV A;  1VQB A;  3CU7 A;  4OO1 H;  1N33 L;  3HOW H;  1DJR D;  1HNZ L;  3G48 A;  2A73 B;  4RMF A;  1O80 A;  4R8I A;  3VYT A;  4HCS A;  2X69 A;  4BY1 H;  5JEA J;  5FO9 B;  2WAC A;  2HQL A;  4JI4 Q;  2JXM B;  4ODG A;  5C4J B;  5FLM H;  4KHV A;  2LY7 A;  4OL7 A;  1XPU A;  2PZT A;  1TQO A;  3HKZ G;  1UAP A;  1B70 B;  2OEO A;  3T56 B;  3KYH C;  1CTM A;  1SYE A;  1JE5 A;  2SNM A;  3NP8 A;  3PO2 G;  1KXL A;  1WTQ A;  3HOU G;  4CDE C;  1QZG A;  2F3W A;  2B2U C;  5A35 A;  2DUD A;  1SR3 A;  1OXS C;  4LK1 C;  3GTP B;  1L1O A;  1EQV A;  1A3V A;  1S5F D;  1HR0 Q;  3CQZ H;  2L55 A;  5EBD A;  3ULP A;  3VYS A;  5J22 A;  1CFM A;  3E0J A;  3NBI A;  1H9S B;  1WI5 A;  5EKK A;  4OGQ C;  5ELO A;  5GQO A;  1XTD A;  4LF7 L;  2WII B;  3K5O A;  1PZJ D;  4MNO A;  4HIO A;  1NMG A;  3UDF A;  5JJL A;  3J81 j;  1Y1V B;  2L5T A;  2ZTE A;  4JK1 C;  2NZ1 D;  1JMC A;  1IYJ B;  1YVC A;  1KIX A;  3KJP A;  3M4O B;  1CK1 A;  5ELE A;  1L1O C;  2B2W A;  2IL8 A;  1G6P A;  4KV6 A;  4TKO B;  1BOS A;  1T9H A;  4HMI A;  1P8L A;  2E2D C;  5TSS A;  3CCV A;  5EBC A;  3T16 A;  1J6Q A;  1TWF H;  4UAI A;  4ZK9 B;  1B3A A;  3DLL A;  2WB1 G;  1EU4 A;  1GM5 A;  3PO2 H;  1EWC A;  2CH4 A;  1FD7 D;  1BF4 A;  3NEN A;  4B3T Q;  2ES2 A;  4MTN A;  2UXD L;  3HOY B;  4JI4 L;  3AQQ A;  1EEI D;  3A55 A;  5IOD A;  2CCZ A;  2EOT A;  2UXB Q;  1PHJ A;  3SK5 A;  1B44 D;  3J7A 5;  1WVL A;  1SYF A;  3A8I E;  4JOI C;  3U9S A;  4PZ8 A;  2ZM6 L;  4PMW A;  1QUQ A;  2IPK D;  1VQC A;  1JB3 A;  1YEZ A;  2N3S A;  5LMN Q;  5IGE A;  2VZA A;  4YWL A;  3HOV B;  4C3I G;  1EYA A;  2CFM A;  5KGU A;  1WFQ A;  5EAY A;  1PRT C;  4ZCK A;  2YV5 A;  5C4X B;  3S24 A;  4X66 Q;  1SMY D;  1WTO A;  4J1M A;  1PTO H;  2F3V A;  1X6O A;  2HDM A;  2EYH A;  4FF3 A;  4LF4 L;  2ASB A;  5IY0 A;  1LYL A;  3D3R A;  5M5W B;  2Y0S E;  2CQA A;  3T51 B;  2PZU A;  4KY6 A;  1X3F A;  1A15 A;  5HGQ A;  1VQD A;  1Y1W B;  4XDX A;  4A3E G;  3J80 L;  4ZYS A;  4Y7N H;  2ID0 A;  3PGZ A;  1ILP A;  1LTT D;  1SYB A;  3MVV A;  4JI2 L;  2OF1 A;  3RN2 A;  2EVB A;  3SE0 A;  1J9O A;  3I73 A;  4DR4 L;  4Y52 H;  2FHT A;  4LAA A;  2Z6K C;  3BG3 A;  3OWF A;  3J81 i;  1RHP A;  3HOZ G;  2B2Y A;  5C3E H;  1LTR D;  1CKN A;  3K0X A;  4HJA A;  2AUJ D;  1TS5 A;  4POF A;  5G3L F;  1FJG Q;  4CKB A;  4C56 C;  4JI7 L;  2DY8 A;  4EVO A;  1OO9 B;  2KUM A;  3H0G H;  1DYQ A;  1SND A;  3K7U C;  2DJG C;  4DXG A;  2NN6 I;  1SDF A;  1YHA A;  2RDG A;  3NPP A;  4DK1 A;  3W3A A;  3RZD B;  3ULJ A;  4IPG A;  1ICW A;  4G57 A;  1I5F A;  4GOP B;  1HTL D;  5JVG 3;  3GTJ H;  3I72 A;  1AZQ A;  1N34 Q;  5IOC A;  2Z4H A;  3BZD B;  3HRZ C;  4YY3 Q;  1RTN A;  1QCB D;  1O7Y A;  2NVT H;  4ULL A;  1PRT B;  2XVS A;  2RHS B;  3BZK A;  1UWV A;  1M8A A;  1XWE A;  3W1B A;  3U4V A;  1Q90 A;  2Q2U A;  3NEM A;  5F2D A;  1IXR A;  1L1O B;  4CJ1 B;  2UUB L;  3OHX C;  3CW2 C;  3I56 A;  3A0J A;  1QJO A;  2HCC A;  3TS0 A;  1GO3 E;  2QDL A;  2B8F A;  1LAB A;  1QVF A;  3GTO B;  3J81 L;  4PQX A;  3BDL A;  4GN3 B;  4GN5 A;  1JE4 A;  4KN4 C;  4DNI A;  2B2V A;  4A3D H;  4IUQ A;  4DV0 Q;  1V43 A;  2NYZ D;  4EQO A;  1EWI A;  4BY7 B;  2OTJ A;  1ENC A;  3A56 A;  4OO1 G;  1AP0 A;  5HY6 A;  4HR7 B;  4A3J B;  3RMH A;  2NVQ B;  3OMC A;  1DZ1 A;  1A6X A;  1B7Y B;  1IYU A;  1EQR A;  2EXD A;  1GUN A;  2WFW A;  1VQ8 A;  4APV A;  2JA5 G;  3GTO H;  5I9O A;  4RAU C;  4V0B A;  5I4D A;  1X32 A;  1JIC A;  1QNU A;  3MZ5 A;  1PFM A;  3I4N G;  4HJ7 A;  3GTM H;  5EPK A;  2KJX A;  1YJN A;  2D0O A;  3D4D A;  3GO5 A;  2K5W A;  2PQA B;  2K05 A;  1HR0 L;  3E3X A;  4QJF A;  1QE6 A;  3FMC A;  3F2C A;  1K0R A;  2KEN A;  3UDG A;  4HN7 A;  1WD1 A;  2KEC A;  4XXE A;  2BE5 D;  5CYU A;  1LTB D;  2NVT B;  2K52 A;  4DK6 C;  2XN9 C;  1JWS D;  4G7Z C;  3C1E A;  1TWH B;  4L5S A;  1RD9 D;  1E2Z A;  1HQR D;  2DNC A;  1MBY A;  5IYC G;  5A2Q L;  2GA4 B;  3AB9 A;  1R4Q B;  2ZM6 Q;  1O7Z A;  2F0S A;  1GUW A;  2F0L A;  4DA2 A;  1ET6 A;  1TWH H;  1CKM A;  5EPL A;  4Z9C B;  1V1P A;  3MXN A;  4X65 Q;  4M8A A;  1LT5 D;  1EFI D;  2WV6 D;  3M3Y H;  1SAP A;  1E0B A;  3NTI A;  3HOY G;  3FHW A;  3IFD A;  1SMX A;  1JOR A;  5ELC A;  3PO3 H;  2ENB A;  1G91 A;  2UUA Q;  5C4Z A;  1K8A C;  1Q3L A;  1HNW Q;  1X56 A;  4A3F B;  3CXC A;  3TP7 A;  3ERS X;  5ELD A;  1D6E C;  3ERO A;  1F9R A;  1IKM A;  1BVS A;  4DF7 A;  3TME A;  1QG7 A;  1NR2 A;  1LTA D;  4JI2 Q;  2R93 H;  2JA7 H;  1Q82 C;  1ICF B;  5EKL A;  3GTL B;  2B2W C;  3J7Y W;  4YCV A;  1VF7 A;  1X54 A;  2N8N A;  1VQ4 A;  1XMQ Q;  1PXU A;  4A3C G;  3SDZ A;  3TP8 A;  3H3V H;  1EY9 A;  3PUW A;  3F1Z A;  4NXM L;  2K28 A;  5GAE C;  1XPO A;  4EQ5 A;  5BR8 Q;  1PTO C;  3AEV A;  2PQE A;  4FNF A;  1HNZ Q;  4A3E B;  3HOV H;  4GN4 B;  4FF4 A;  1CSP A;  3UE0 A;  3AFQ A;  2Q2I A;  4DR5 L;  3A7A B;  4WJ4 A;  3V05 A;  1HUN A;  4JI0 L;  1LTI D;  5FJ8 G;  3CME A;  5M3M G;  3ZYY X;  1KRS A;  4O0A A;  1SFO H;  4JOI A;  3MXP A;  2J7Z A;  1HHV A;  2ALY B;  3WOF A;  4C1N I;  1UE1 A;  4TSS A;  2NVY H;  4RA8 A;  2A6H D;  2F0H A;  1VQ7 A;  1T5X D;  3EJI A;  4OWX B;  2K6A A;  2PI2 A;  1N8R C;  4DV7 L;  5GAG C;  1ESR A;  5IGB A;  1TII D;  3PV0 A;  3S15 B;  4A3F H;  1SNQ A;  3PIO 3;  4K8I A;  3S17 H;  1G8Z D;  1TWF B;  3PO2 B;  2KOL A;  2TMP A;  2HHH Q;  5M5X H;  3AU7 A;  3EN2 A;  3GTJ B;  4KD4 A;  4IUR A;  2A74 C;  1K8M A;  4R9W A;  3CMA A;  3FEW X;  1VCI A;  4QMG A;  3M4O H;  3TEH B;  3K5N A;  2NTT A;  4ME3 A;  4R4O A;  3T1Y L;  1EYG A;  2RHQ B;  4V19 0;  2B63 B;  1MIU A;  4TVA B;  4YIJ A;  3TN2 A;  1K83 H;  4IPC A;  1Q8K A;  2JE6 I;  3JC6 6;  2EPB A;  4K0K L;  2VB3 X;  2O5J C;  3KOJ A;  4A3B G;  3R93 A;  3EA6 A;  5LMN L;  1TS3 A;  1UUP A;  2F0P A;  5M3M H;  2JA6 H;  3NQT A;  4IZ8 A;  4F8M A;  1HNW L;  2MPM A;  4PMB A;  3STB C;  3VDY A;  4EX5 A;  4IPH A;  1WTV A;  2AMC B;  3KF6 B;  5GAD C;  1TXY A;  4IO9 A;  3TSS A;  3AMU A;  1V1Q A;  1YHB A;  2F3I A;  1PRT D;  1UNS A;  5IGD A;  1KAA A;  4QCL A;  4POG A;  4ZQ3 A;  1SMY C;  3RD4 A;  1YIJ A;  3H94 A;  3TRE A;  3N52 A;  1ZYR D;  1RL2 A;  3DM1 A;  5EGT A;  1SLJ A;  4PZ7 A;  5FLX c;  2VY3 A;  3S1Q H;  1O7L A;  5M5Y B;  3JAM L;  5C4J H;  2X6L A;  2K7V A;  4A3G B;  1PYB A;  3CD6 A;  2VQE L;  2XSC A;  4N8X 1;  1VQE A;  1EY0 A;  1QWY A;  3OWE B;  3OIP A;  1ROD A;  4JV5 Q;  4KI0 A;  4PV1 C;  3PF4 A;  1BBW A;  2DGY A;  3NEL A;  3HOW B;  1SNP A;  5FLM G;  4XT1 B;  5M9O A;  2OQ0 A;  2KBN A;  1EL0 A;  4O42 A;  4B3T L;  1PZI D;  3I3C A;  4Q5V A;  1L0Y B;  4PG3 A;  3H15 A;  2QEJ C;  1MKH A;  1CQV A;  1V1O A;  5DEH A;  3HOY H;  1TWA B;  3E5S A;  3F2D A;  4RGN A;  3S2H B;  1SBB B;  1YHQ A;  1R4P B;  1A63 A;  1SYD A;  3RR5 A;  3PIP A;  4LFB L;  4ALP A;  2KA7 A;  1I6V C;  2RQX A;  2WAQ B;  1IL2 A;  4K5W A;  1G29 1;  4GNX C;  1B8A A;  5FO8 B;  3I4M G;  1D5M C;  1YNJ D;  5JAV A;  3LX0 A;  4ID6 A;  3TQY A;  5HUR A;  2F0N A;  4ZAI A;  3RLF A;  1QIL A;  4OWW B;  3MHB A;  1I3Q B;  2WIN B;  2Y0S G;  1FVI A;  4GOP A;  1HH2 P;  1VMP A;  2I46 A;  2HT1 A;  1TWC B;  4DNT B;  4JI1 L;  2F4V L;  1QZH A;  1Z7T A;  1AZP A;  2LKV A;  1N36 L;  3NXW A;  1FR3 A;  3T13 A;  4A3L H;  1RJT A;  3D4W A;  2QDB A;  5CC4 A;  5BR8 L;  3H09 A;  4UPA A;  4MN3 A;  2P5Z X;  2I07 B;  1SE2 A;  2Q8I B;  2LMC B;  3KBX A;  1S5D D;  2JP1 A;  2PMZ E;  4LUV A;  4X3T A;  1JT8 A;  5CV8 A;  3J81 E;  1EY7 A;  1HXY D;  2UUB Q;  2VUM H;  4P72 A;  1FL0 A;  1PLF A;  4J6H A;  5EPJ A;  3NSW A;  2R3Z A;  1A2T A;  1LUZ A;  1AE3 A;  1NR4 A;  1F9S A;  3BDC A;  5AJ3 Q;  2Z6K A;  5CV9 A;  1UE5 A;  1EIF A;  3K5L A;  5I6Y A;  1YBY A;  4C1N K;  4KN7 C;  1PTO B;  3EFX D;  5C0X J;  1D1K A;  2J0T D;  4DR3 L;  3NHH A;  5C4X H;  5C3X A;  1TU2 B;  4X66 L;  2MHV A;  3S9W A;  3VA7 A;  2F0E A;  1F2Z A;  3PMF A;  3W1G A;  2MP1 A;  4DV2 Q;  3KF8 B;  4DK0 A;  2R6G A;  2ICI A;  4RCN A;  1JQY D;  5L37 A;  3PCO B;  2TSS A;  1W2B A;  2XNA C;  4HID A;  3DEO A;  3CCJ A;  1W6J A;  4KHZ A;  3HOV G;  2Q8T A;  3BVM A;  3URY A;  1I4P A;  1G2S A;  4IJL A;  1AEX A;  4DR4 Q;  4E6I A;  2R7D A;  3E9I A;  3HKZ E;  2BA1 A;  4LF8 Q;  5I2Y A;  2R7Z G;  4DK3 C;  2JA7 G;  1JOK A;  1DD2 A;  1LTS D;  5CBA E;  1P16 A;  3RZO B;  4B3R Q;  2VNU D;  4YHH Q;  3A8K E;  1PFN A;  2PW7 A;  5IYB H;  3HOX G;  2UU9 Q;  2ZJP A;  3PSI A;  3K58 A;  3E9H A;  2R92 H;  4K0K Q;  1RDP D;  1PVO A;  1N34 L;  5DM7 3;  1EEF D;  1EFW A;  1X3Q A;  1XPR A;  2BH8 A;  3X3N A;  1E2V A;  3CC4 A;  1SXT A;  1UE6 A;  3K0Y A;  1TVX A;  5BN5 A;  2ZXP A;  3MWY W;  4BS9 A;  1HA5 A;  3VR2 A;  1VQ5 A;  4IFD G;  4NXM Q;  1XMO Q;  1DGS A;  2EY5 A;  4OIK A;  2KHJ A;  1EWH A;  4DGZ A;  3S2D B;  5IYC H;  1B9N A;  1F77 A;  2KCM A;  3M7N A;  2F0T A;  2PO4 A;  1I4X A;  3AYH B;  4C2M H;  3P75 A;  3RLN A;  2NWG A;  4AH6 A;  1HPC A;  1WYD A;  2E2I B;  3M85 A;  4DV7 Q;  4MIU A;  5KRU A;  2ZXO A;  1K3R A;  1CHP D;  4OHJ A;  1C9O A;  2CH4 W;  4LW1 A;  2OQK A;  3VYR A;  2QIL A;  2E75 C;  4ME5 A;  3FKI G;  4BBR H;  2JEA I;  2HIX A;  4JW0 A;  5JJI A;  1FNW A;  3CAM A;  4PMC A;  1LV9 A;  3LNN A;  4DAY B;  2EY6 A;  2JA5 H;  1GUT A;  3VR3 A;  1F9Q A;  1KTK A;  3A74 A;  1VQH A;  5IP7 G;  4KKS A;  2F0O A;  4BXX G;  4RCO A;  2A69 D;  3CPF A;  3VR6 A;  3M4Q A;  2F0M A;  2IHE A;  4A3G H;  1AE2 A;  1U4L A;  1DON A;  2IY5 B;  4DUZ Q;  1PMR A;  4X6A H;  1KL9 A;  4JI8 L;  2CVR A;  3A5Z B;  2BDN A;  4X3K A;  1SE3 A;  1IBM L;  5K36 H;  3NK9 A;  5G3L D;  4KY5 A;  2AWO A;  3JAM c;  5DM6 3;  1VQO A;  2I5M X;  1GVP A;  3K59 A;  3LWU A;  3NE5 B;  2AQ1 B;  4IOC A;  3AFP A;  3I4O A;  2Z9H A;  1BCP B;  1I4H A;  5C4H A;  2EJM A;  4BBS B;  1HFG A;  5CV7 A;  4DV0 L;  3KFU A;  1M4V A;  5JJK A;  1HNX Q;  4C3H H;  3STB D;  3I55 A;  1X55 A;  2NN6 H;  1TKW B;  1TWC H;  1JB7 A;  3I90 A;  5C44 H;  1NE3 A;  1Q86 C;  2B39 A;  1EYD A;  1GKH A;  3D6C A;  3U50 C;  1CT1 D;  2UUC Q;  3T53 B;  2K5D A;  3Q23 A;  1A3U A;  1SJE D;  3SK6 A;  4KK7 A;  4A3K G;  4NP5 A;  4P73 A;  3TZD A;  3M9B A;  4CKC A;  4DV3 L;  5BN4 A;  1J5E Q;  4JI6 L;  3L7Z C;  2RA4 A;  4GNX A;  1HUM A;  5CBE E;  3MTS A;  1I4G A;  4WJ3 M;  4H13 C;  2A6E C;  3W5O A;  2B2T C;  1AN8 A;  1JJ2 A;  1ENA A;  3F8T A;  1KAW A;  5D3I B;  1K3B C;  3K57 A;  2PCF B;  2Q2T A;  1QVC A;  1FNU A;  3HFZ B;  1JC7 A;  5E1F A;  2O5I C;  2RBM A;  1U5K A;  1S5E D;  4KTA A;  3D8G A;  4GKK Q;  2YU9 H;  4LUZ A;  3LWE A;  4K8J A;  4L5T A;  4QUC A;  1PFB A;  2KED A;  1SRU A;  5C3E G;  4IUV A;  5COR A;  1C4Q A;  4DN4 M;  1SFO B;  4K14 A;  5D3D A;  2VQE Q;  2IX1 A;  4B3M L;  4BY7 H;  3EBE A;  2AQ3 B;  5AFW A;  4DR6 L;  4A3E H;  4X65 L;  5LHY 1;  1UE7 A;  5KYL A;  1SYC A;  2VL6 A;  1G51 A;  1Q12 A;  3QB3 A;  1K8G A;  1Y14 B;  1BDO A;  4NXN L;  1PH1 A;  4K2L A;  2WAQ E;  1FYC A;  1LTG D;  1V9P A;  2KHS A;  1K28 A;  1B4O A;  3G7L A;  1Z6H A;  5IGF A;  1F2Y A;  2R93 B;  1HZA A;  4N9T A;  3PIO A;  1D7Q A;  1H95 A;  4QIW B;  2JN4 A;  1Q46 A;  3GDE A;  2K75 A;  4RG1 A;  1ONL A;  2VW9 A;  1GUS A;  5M3M B;  1NSN S;  1H9S A;  1E2W A;  4RWS C;  1CKO A;  3NQI A;  1BXT A;  2I5L X;  3RN5 A;  2DNE A;  4N9P A;  1RF2 D;  1X3E A;  1OXX K;  2B29 A;  4UP8 A;  3C46 A;  1K83 B;  1JJG A;  1PYW D;  3OTO Q;  1Q81 C;  2B63 H;  4X3U A;  4JI1 Q;  2F4V Q;  1A3T A;  1GUO A;  4CGY B;  1VQL A;  3N6R A;  3HOX B;  4HSP A;  2IJ0 A;  1TWG B;  5J1Z A;  1TT2 A;  3H0G B;  1LT6 D;  2N78 A;  1A0I A;  1JWU D;  1HJP A;  4AQY L;  2EZV A;  4QL5 A;  5C3E B;  4XQN A;  3OMG A;  2PZW A;  4ZUI A;  3SHL A;  4XQJ A;  5DNF A;  3CCR A;  4BA1 I;  2CW0 D;  3DWQ A;  1CA5 A;  2XTI A;  4WRD A;  5CR3 A;  4HAE A;  2K5N A;  4AIM A;  1BCP C;  3L3O C;  4DUZ L;  4WOR A;  4B9W A;  4HMJ A;  2X6G A;  1B50 A;  2CWP A;  2RSN A;  5H1S E;  4GLV B;  2F03 A;  3Q6S A;  4F87 A;  1QUQ B;  1CZW A;  2EDG A;  3EQL C;  1KLU D;  1IW7 C;  3SXH A;  2IHF A;  2PNR C;  4DR7 L;  2K03 A;  3ZJY C;  1BCP F;  5KEE A;  2R93 G;  3PUX A;  4XYO A;  2F0D A;  5CV4 A;  4CHT B;  3SK4 A;  3V2T A;  3S1M H;  1EUJ A;  3OW7 A;  3M4Y A;  3MXN B;  2RCN A;  3S1M B;  3GTL H;  1CUK A;  5D14 A;  5K5P A;  1N32 Q;  5IP9 G;  2G5D A;  2UUC L;  2A8V A;  3UDI A;  4DPG A;  3V96 A;  1O7I A;  4YWK A;  2ZTC A;  1CM9 A;  4BY1 G;  3G71 A;  4M1U B;  4NW2 A;  3HG9 A;  2YU9 B;  3D0F A;  4RHR A;  1IBM Q;  2WP8 J;  4P74 A;  3QJY A;  2G9D A;  3KDF B;  5JEA H;  1YJ9 A;  5FK9 C;  3HOW G;  3FDT A;  1I4Q A;  4MTK A;  4H02 A;  3HOU B;  1YNX A;  2A68 D;  4R4T A;  3HEJ A;  1BKB A;  1A62 A;  1SNM A;  1PTO D;  2Q2H A;  3HP3 A;  2F0J A;  2M00 A;  2F0Q A;  1Y8P B;  3A7L A;  3TDQ A;  2XWB B;  1NY4 A;  2F4I A;  1MJE A;  2UU9 L;  4LF9 Q;  4JYA Q;  3BU2 A;  3R2T A;  1E3P A;  1D8L A;  2HQE A;  3QOJ A;  5IWA L;  3CCL A;  3R3O A;  4A93 G;  3RZD H;  3Q22 A;  1MHW C;  4ILW A;  4ZLT F;  4DKA C;  5ISR A;  4BBS H;  1I94 L;  2UXC L;  4OO1 I;  2JA8 B;  1VMC A;  3CQZ B;  3PUZ A;  3I4M H;  4XTC S;  4EQN A;  3OIQ A;  3W2D A;  3TRZ A;  2R7Z H;  4DUY L;  2MO1 A;  2I5H A;  5D65 A;  2OCE A;  1K9M C;  4L63 B;  3KLR A;  2E2H H;  3GTM B;  2K33 A;  1EQQ A;  2B2U A;  2E5L Q;  4FDB A;  3X3M A;  1YZ6 A;  3SGI A;  2F0W A;  3CCS A;  5FLX L;  2ATW A;  4QGU A;  1Y1W H;  4DV5 L;  4A3M H;  3PQI A;  4A3J H;  2NVQ H;  1D5Z C;  4GKK L;  1NBW A;  2JA5 B;  3ICE A;  1EOV A;  3PF5 A;  1EZ8 A;  1SNO A;  2DJF C;  2R61 A;  3C1F A;  2RVL A;  2H5X A;  2VS1 A;  4FVM A;  1KQS A;  4P71 A;  4O1N A;  1E1T A;  4FP5 D;  1ILQ A;  1JR0 D;  5IT9 E;  4QF4 A;  4L6T B;  5GRO A;  4LNQ A;  2F0V A;  2MGS A;  5CV6 A;  4LF6 Q;  1Y8O B;  4KKU A;  1NNX A;  4NKL A;  1JOQ A;  1PH6 A;  4P2C B;  1NTG A;  1QOH A;  4GNX B;  4C3J G;  4I7A A;  4LFC L;  3T1H L;  4JI8 Q;  5LMN W;  3QR8 A;  3RNU A;  1WTH A;  1S4Z A;  1VS0 A;  1ESF A;  3KDF A;  2AQ2 B;  2QKI C;  3Q0A A;  3OPO A;  5M3F H;  4CDF C;  5J39 A;  1BNZ A;  3HOZ B;  4A76 A;  3H0G G;  4UDU C;  4A3B H;  5C5L A;  2NUC A;  2KCN A;  1ENF A;  2KHI A;  2D9U A;  3S1N H;  2F0F A;  5FO7 B;  4LF7 Q;  4R4Q A;  2EY1 A;  3G4S A;  4LFA Q;  3OTO L;  2C35 B;  1L2F A;  4DV2 L;  4UP7 A;  1HZ9 A;  3NBH B;  3NWS A;  5I2X A;  2K50 A;  2QW7 A;  2F52 A;  3TP6 A;  3L9A X;  2L11 A;  5E3F A;  2KVM A;  1KAB A;  3BYY B;  3KBG A;  5FLX E;  5IIF A;  4IUP A;  4Y7N B;  4DR2 L;  3K7A B;  5KNC A;  2C5C A;  1VDZ A;  4RGT A;  1HNX L;  2K1B A;  1QB5 D;  3GV3 A;  5M5W H;  1EY4 A;  1EZ6 A;  3CRK C;  3CCU A;  1M1K C;  4R4C A;  2HCI A;  4B9X A;  2JK8 A;  1BBU A;  2QCP X;  3A8J E;  3VR5 A;  3VR4 A;  4HSV A;  3D6W A;  3S14 B;  5IP9 H;  2YTX A;  4HJ5 A;  1IBL Q;  3A54 A;  3QG1 A;  4X3S A;  2LS0 1;  3I91 A;  2EYF A;  2WB1 B;  1G6Z A;  5T1G A;  1XJV A;  2JQO A;  1N32 L;  4BBR B;  4KKT A;  3CCQ A;  4A3I G;  5C5M A;  4JI0 Q;  4UHV A;  1BUV T;  3K80 C;  4O2D A;  1SJH D;  3PUV A;  5JJZ A;  2K4K A;  2RSO A;  4NXN Q;  3MEH A;  4GLA C;  3FPP A;  4LFC Q;  4IQZ A;  2E2I H;  3KLS A;  4DR1 Q;  2V4D A;  5ELF A;  4CJ2 C;  1HZC A;  1KDA A;  3GTK H;  2D5D A;  3ERQ A;  1LAC A;  1E7Z A;  4P75 A;  1QNK A;  4LJZ C;  2N55 A;  2HIV A;  2LXJ A;  2PNH A;  3MFY A;  3DWA A;  3E0E A;  1MI2 A;  3DUZ A;  3CCE A;  1OXU A;  4GKJ Q;  3K7A H;  1L0X B;  4MHE A;  1J8I A;  2B2T A;  2E8G A;  2AKW B;  3P1H A; 
#chains in the Genus database with same CATH homology
 2CW0 C;  3TP5 A;  5I9P A;  1BQQ T;  1F9P A;  4DAY A;  1STY A;  1BO0 A;  3MXG A;  2R92 B;  2E76 C;  1H9M A;  4FXG C;  1WTR A;  1EIH A;  3S1N B;  2F0I A;  2NTS A;  1SEB D;  1V1P B;  2PPB C;  2L0C A;  1CHQ D;  1X3P A;  2O4X A;  1LT4 D;  2XIW A;  5M3F B;  2H1E A;  3HZX A;  1Y69 U;  1ML0 D;  1CA6 A;  3GTK B;  3J80 E;  2SNS A;  3ND8 A;  1G2T A;  4A3I B;  3ND9 A;  4R8N A;  1GOZ A;  2F1M A;  2EYM A;  2XRQ D;  4H44 C;  2EY2 A;  2EYJ A;  4WFN 3;  2L4N A;  3D31 A;  2ZXR A;  5C0X H;  1EY8 A;  3K5M A;  4DXF A;  5FOB B;  1CQF A;  1EY6 A;  2RDH A;  1A2U A;  3VA5 A;  2SEB D;  2IT1 A;  2EYL A;  3I70 A;  3BYT B;  1GJX A;  4QUF A;  2JEB I;  2B2Y C;  1YNN C;  1ZXT A;  1KDB A;  2VB2 X;  2FIN B;  1I6H B;  2IX3 A;  4XIG S;  3R2I A;  3DXJ C;  3BDO A;  5KYI A;  3KLS X;  4RH6 A;  3PIP 3;  2JYO A;  4F88 A;  2M9V A;  1IKL A;  2L9H A;  2EXZ A;  1PDQ A;  2JA6 B;  3I4N B;  5IGC A;  4IFD H;  1Q8I A;  1S5B D;  3OOC A;  1H9J A;  5CGK A;  1H9R A;  2A69 C;  2EJF C;  4FXD A;  1IHZ A;  4K6L A;  2Z4I A;  3H91 A;  4FYD A;  4HED A;  2D62 A;  3VYU A;  1MSG A;  4IN3 A;  3C3L A;  3EVQ A;  4J8Q A;  1U4P A;  1I4R A;  1HRJ A;  1AFP A;  4OIJ A;  3S17 B;  2Q8R E;  4XT3 B;  4DAP A;  1B2T A;  4RGO S;  1RCV D;  3S16 B;  2WKC A;  2L1B A;  1SE4 A;  2AWN A;  4XYQ A;  2H4O A;  2YYZ A;  1WTX A;  4JBW A;  2E2J B;  3WOE A;  4H7B A;  4HTH A;  4G7O C;  1MD2 D;  5ELB A;  5JVH 3;  3BVZ A;  1Z47 A;  5A2Q E;  5EJW A;  1MSH A;  1U4M A;  2Z1C A;  4QB4 A;  5JEA G;  3HKZ B;  2CHB D;  4I65 A;  4A3M B;  2JA7 B;  1I50 B;  1STG A;  4IAL A;  5C0X I;  3S1Q B;  1KLG D;  1W6K A;  3Q24 A;  1VF5 C;  4ZRZ A;  4DNR B;  2FMC A;  3GTG B;  1C48 A;  3DMU A;  1F2L A;  2BOS A;  3PO3 B;  2B8G A;  3O13 A;  1AW7 A;  4PNY A;  2C9O A;  1TY0 A;  4CKE A;  3M3Y B;  1OXT A;  1RKN A;  2Y0S B;  1WTP A;  1S5C D;  1KNE A;  2E74 C;  1MGS A;  2K32 A;  3HGB A;  4WJW A;  2EE1 A;  4AYB B;  3QOL A;  2KCC A;  3IAY A;  3MXU A;  2EYO A;  1O78 A;  1UEA B;  3FVQ A;  2RDF A;  1C8C A;  4A3B B;  3SR1 A;  5M5X B;  5KND A;  1CI3 M;  1B9M A;  5DAU A;  1JWM D;  1ZYR C;  3P20 A;  3FKI B;  1STA A;  3CKI B;  1FGB D;  5BN3 A;  4NDX A;  1ET9 A;  2VXW A;  3DHQ A;  1U9R A;  3HS0 C;  3I8Z A;  2NVY B;  2OT2 A;  3NUC A;  1D5X C;  1B53 A;  1RTO A;  3S1R B;  3ONA B;  3KUP A;  3DWP A;  1DOL A;  5IGG A;  4B08 A;  4A3D B;  4IFD J;  1EY5 A;  1BCP D;  4TRD A;  2F0K A;  1WCM B;  3CRL C;  2NB0 A;  3NTH A;  4G4K A;  2NBF A;  2BE5 C;  4EGV A;  1B1Z A;  2BDO A;  1U4R A;  4K5V A;  1IW7 D;  1DM0 B;  4U68 A;  1WD0 A;  2KEE A;  4KJN A;  3ITP A;  3MA2 B;  5I6W A;  5C6A A;  1BR9 A;  1K8O A;  4IFD I;  1SNC A;  1Q1E A;  1YNJ C;  3GP7 A;  3FPU B;  4RGM A;  2F0U A;  5C0X G;  2DY7 A;  3SEB A;  2A5H A;  2E2H B;  2F0G A;  3G6J B;  2R7Z B;  4IUN A;  2SDF A;  4BWG B;  1PRT F;  5CMD A;  3I4M B;  1HQM C;  4A3K B;  1KDC A;  3T4A C;  2L12 A;  2LFN A;  5JOB A;  3OSO A;  3GQB A;  3WDN A;  5JPM C;  3IKJ A;  2BA0 A;  4XQQ A;  1STB A;  2PYK A;  2XRS D;  4G7H C;  1GXD C;  2IW3 A;  1ZKO A;  4GZY C;  2M2L A;  3KK7 A;  4ZKB B;  1XTC D;  2NN6 G;  5E4X A;  4KJO A;  1STE A;  2HUG A;  2QF7 A;  1YNN D;  4L8J A;  4C3H G;  2K01 A;  1FNV A;  2D2C C;  3QIA A;  4ZUJ A;  4KY7 A;  2K5Q A;  4FF2 A;  3J7A F;  2A6H C;  1HTP A;  4FO2 A;  4K2K A;  1XYI A;  1DOM A;  3NBH A;  4H0L C;  5K36 G;  4F7X A;  3UI2 A;  3JAM E;  5COY A;  4FF1 A;  2Z8L A;  3J7A V;  3NTK A;  5EQ0 A;  4DAV A;  1II3 A;  1GUG A;  1STH A;  1ZEQ X;  3RUZ A;  3E6Z X;  1D1I A;  1DOK A;  4C2M B;  3H6M A;  2IX0 A;  3U9O A;  2XWJ B;  4LMQ D;  5E4W C;  3K6O A;  5IT9 L;  5KNB A;  2MJ8 A;  5LL6 S;  3BVG A;  5EKI A;  1OXV A;  4HCE A;  3SK8 A;  1EU3 A;  4RKB A;  2WKD A;  3QO2 A;  3MC0 B;  1F2M A;  1JOO A;  2J4X A;  5HGT A;  5C44 B;  1D2B A;  1EIG A;  2KQ3 A;  4KD3 A;  5JPN C;  3R8B A;  1JCK B;  4Q0F A;  4IUT A;  4FXK C;  4U67 3;  2SOB A;  4RFB A;  3D4R A;  1H9K A;  4K6D A;  4S3S A;  2PMZ B;  3PUY A;  1GHK A;  1EYC A;  2FFK B;  3NWT A;  5KIX A;  2JSO A;  3MFG A;  4BY1 B;  2IWH A;  4EQP A;  3M7G A;  3SVM A;  1HA6 A;  1GHJ A;  2OXP A;  2BCO A;  3CHB D;  5NUC A;  4C3I B;  1EOT A;  3GV6 A;  1DCZ A;  1NAP A;  4DU9 A;  4K5X A;  2K04 A;  4DFA A;  1PTO F;  3I4L A;  1XX8 A;  5LL6 X;  2ZT9 C;  1Y8N B;  1LT3 D;  1XXG A;  4TQU S;  1HFN A;  4I7Z C;  1LO5 D;  2G9H D;  4A93 B;  3TZU A;  1DXM A;  2VUM B;  3IL8 A;  1TS4 A;  3BS1 A;  4IUU A;  4CBV A;  1WTW A;  3MAQ A;  3DEP A;  2MUY A;  2A68 C;  1T5E A;  1TS2 A;  1SSO A;  5C3W A;  1PZK D;  1KNA A;  3F2U A;  4KMU C;  4ABN A;  1HCZ A;  1SYG A;  1STN A;  2HDL A;  3P7J A;  1EQT A;  2ICE C;  1R9T B;  2A6E D;  2PW5 A;  3IFT A;  2FJ2 A;  4NMZ A;  2DN8 A;  3TBI B;  3KF8 A;  1TY2 A;  2EJG C;  3H3V C;  4C3H B;  3C2P A;  5T1I A;  4CJ0 B;  2RKS A;  4BA2 I;  2B2V C;  3QWN A;  2FMM A;  1NUC A;  5FKA C;  1NCV A;  4ZKC B;  2EYP A;  2NVX B;  1BBX C;  1TR5 A;  1IL8 A;  1LLR D;  1IYV A;  1V8Q A;  1CZG A;  2AUK A;  4RHS A;  2O2L D;  3GD7 A;  2N88 A;  1Q1B A;  3FRP B;  5CV5 A;  4C3J B;  4RKL A;  3CU7 A;  4OO1 H;  1DJR D;  2A73 B;  1O80 A;  4R8I A;  3VYT A;  4HCS A;  2X69 A;  5JEA J;  5FO9 B;  2WAC A;  2JXM B;  4ODG A;  5C4J B;  4KHV A;  2LY7 A;  4OL7 A;  2PZT A;  1TQO A;  1UAP A;  2OEO A;  3T56 B;  1CTM A;  1SYE A;  2SNM A;  3NP8 A;  1WTQ A;  2F3W A;  2B2U C;  5A35 A;  1OXS C;  4LK1 C;  3GTP B;  1EQV A;  1A3V A;  1S5F D;  2L55 A;  5EBD A;  3VYS A;  5J22 A;  1CFM A;  3E0J A;  3NBI A;  1H9S B;  5EKK A;  4OGQ C;  2WII B;  3K5O A;  1PZJ D;  1Y1V B;  2L5T A;  4JK1 C;  2NZ1 D;  3M4O B;  1CK1 A;  5ELE A;  2B2W A;  2IL8 A;  4KV6 A;  4TKO B;  1BOS A;  4HMI A;  2E2D C;  5TSS A;  5EBC A;  3T16 A;  4UAI A;  4ZK9 B;  1B3A A;  1EU4 A;  1EWC A;  1FD7 D;  1BF4 A;  3HOY B;  1EEI D;  3A55 A;  5IOD A;  2EOT A;  3SK5 A;  1B44 D;  1WVL A;  1SYF A;  3A8I E;  3U9S A;  3P1H A;  4PMW A;  2IPK D;  1JB3 A;  5IGE A;  3HOV B;  4C3I G;  1EYA A;  5KGU A;  1PRT C;  5C4X B;  1SMY D;  1WTO A;  4J1M A;  1PTO H;  2F3V A;  2HDM A;  2EYH A;  4FF3 A;  3D3R A;  5M5W B;  3T51 B;  2CQA A;  2PZU A;  4KY6 A;  1A15 A;  1Y1W B;  4XDX A;  3J80 L;  4ZYS A;  2ID0 A;  1ILP A;  1LTT D;  1SYB A;  3MVV A;  2OF1 A;  2EVB A;  3SE0 A;  1J9O A;  3I73 A;  2FHT A;  4LAA A;  3BG3 A;  3OWF A;  1RHP A;  2B2Y A;  1LTR D;  2AUJ D;  1TS5 A;  5G3L F;  4CKB A;  4C56 C;  2DY8 A;  4EVO A;  1OO9 B;  2KUM A;  1DYQ A;  1SND A;  4DXG A;  2NN6 I;  1SDF A;  2RDG A;  3NPP A;  4DK1 A;  3W3A A;  3RZD B;  1ICW A;  4G57 A;  1HTL D;  5JVG 3;  3I72 A;  1AZQ A;  5IOC A;  2Z4H A;  3BZD B;  3HRZ C;  1RTN A;  1QCB D;  1O7Y A;  4ULL A;  1PRT B;  2XVS A;  1M8A A;  1XWE A;  1Q90 A;  5F2D A;  4CJ1 B;  3OHX C;  1QJO A;  2HCC A;  2B8F A;  1LAB A;  3GTO B;  3J81 L;  4PQX A;  3BDL A;  4KN4 C;  1JE4 A;  2B2V A;  4IUQ A;  1V43 A;  2NYZ D;  4EQO A;  4BY7 B;  1ENC A;  3A56 A;  4OO1 G;  1AP0 A;  4HR7 B;  4A3J B;  3RMH A;  2NVQ B;  3OMC A;  1DZ1 A;  1A6X A;  1IYU A;  1GUN A;  5I9O A;  4RAU C;  4V0B A;  5I4D A;  1X32 A;  1JIC A;  1QNU A;  3MZ5 A;  1PFM A;  5EPK A;  2KJX A;  3D4D A;  3GO5 A;  2K5W A;  2K05 A;  1QE6 A;  3FMC A;  4HN7 A;  1WD1 A;  2KEC A;  4XXE A;  2BE5 D;  5CYU A;  1LTB D;  2NVT B;  2XN9 C;  1JWS D;  4G7Z C;  3C1E A;  1TWH B;  1RD9 D;  1E2Z A;  1HQR D;  2DNC A;  1MBY A;  5A2Q L;  2GA4 B;  3AB9 A;  1R4Q B;  1O7Z A;  2F0S A;  1GUW A;  2F0L A;  4DA2 A;  1ET6 A;  5EPL A;  4Z9C B;  1V1P A;  3MXN A;  4M8A A;  1LT5 D;  1EFI D;  2WV6 D;  1SAP A;  1E0B A;  3NTI A;  3IFD A;  1JOR A;  5ELC A;  2ENB A;  1G91 A;  5C4Z A;  1Q3L A;  4A3F B;  3TP7 A;  5ELD A;  1D6E C;  3ERO A;  1F9R A;  1IKM A;  4DF7 A;  3TME A;  1QG7 A;  1NR2 A;  1LTA D;  5EKL A;  3GTL B;  2B2W C;  3J7Y W;  1VF7 A;  1PXU A;  3SDZ A;  3TP8 A;  1EY9 A;  3PUW A;  2K28 A;  1PTO C;  2PQE A;  4FNF A;  4A3E B;  4FF4 A;  3A7A B;  3V05 A;  1HUN A;  1LTI D;  3ZYY X;  3MXP A;  2J7Z A;  1HHV A;  3WOF A;  4C1N I;  4TSS A;  4RA8 A;  2A6H D;  2F0H A;  1T5X D;  3EJI A;  2K6A A;  1ESR A;  5IGB A;  1TII D;  3PV0 A;  3S15 B;  1SNQ A;  3PIO 3;  4K8I A;  1G8Z D;  1TWF B;  3PO2 B;  2KOL A;  2TMP A;  3AU7 A;  3GTJ B;  4KD4 A;  4IUR A;  2A74 C;  1K8M A;  4R9W A;  3FEW X;  1VCI A;  4QMG A;  3K5N A;  2NTT A;  4V19 0;  2B63 B;  4YIJ A;  3TN2 A;  2JE6 I;  2EPB A;  2VB3 X;  2O5J C;  3R93 A;  3EA6 A;  1TS3 A;  1UUP A;  2F0P A;  3NQT A;  4IZ8 A;  4F8M A;  2MPM A;  4PMB A;  1WTV A;  3TSS A;  3AMU A;  1PRT D;  1UNS A;  5IGD A;  1KAA A;  4QCL A;  4ZQ3 A;  1SMY C;  3RD4 A;  3H94 A;  3N52 A;  1ZYR D;  3DM1 A;  5EGT A;  1O7L A;  5M5Y B;  3JAM L;  2X6L A;  2K7V A;  4A3G B;  2XSC A;  1EY0 A;  1QWY A;  3OWE B;  3OIP A;  1ROD A;  4KI0 A;  4PV1 C;  3HOW B;  1SNP A;  4XT1 B;  5M9O A;  1EL0 A;  4O42 A;  1PZI D;  3I3C A;  4Q5V A;  1L0Y B;  2QEJ C;  1CQV A;  1V1O A;  5DEH A;  1TWA B;  3E5S A;  4RGN A;  3S2H B;  1SBB B;  1R4P B;  1SYD A;  2KA7 A;  1I6V C;  2RQX A;  2WAQ B;  4K5W A;  1G29 1;  5FO8 B;  1D5M C;  1YNJ D;  5JAV A;  3LX0 A;  4ID6 A;  5HUR A;  2F0N A;  4ZAI A;  3RLF A;  1QIL A;  3MHB A;  1I3Q B;  2WIN B;  1VMP A;  2I46 A;  1TWC B;  4DNT B;  1Z7T A;  1AZP A;  2LKV A;  3NXW A;  1FR3 A;  3T13 A;  1RJT A;  3D4W A;  2QDB A;  5CC4 A;  3H09 A;  4MN3 A;  2I07 B;  1SE2 A;  2Q8I B;  2LMC B;  3KBX A;  1S5D D;  2JP1 A;  4X3T A;  5CV8 A;  3J81 E;  1EY7 A;  1HXY D;  1PLF A;  4J6H A;  5EPJ A;  3NSW A;  2R3Z A;  1A2T A;  1NR4 A;  1F9S A;  3BDC A;  5CV9 A;  3K5L A;  5I6Y A;  4C1N K;  4KN7 C;  1PTO B;  3EFX D;  5C0X J;  1D1K A;  2J0T D;  3NHH A;  5C3X A;  1TU2 B;  2MHV A;  3S9W A;  3VA7 A;  2F0E A;  1F2Z A;  3PMF A;  2MP1 A;  4DK0 A;  2R6G A;  2ICI A;  4RCN A;  1JQY D;  2TSS A;  2XNA C;  3DEO A;  1W6J A;  4KHZ A;  2Q8T A;  3BVM A;  3URY A;  1I4P A;  1G2S A;  1AEX A;  4E6I A;  2BA1 A;  5I2Y A;  1JOK A;  1DD2 A;  1LTS D;  5CBA E;  3RZO B;  2VNU D;  3A8K E;  1PFN A;  2PW7 A;  3K58 A;  1RDP D;  5DM7 3;  1EEF D;  1X3Q A;  3X3N A;  1E2V A;  1SXT A;  3K0Y A;  1TVX A;  5BN5 A;  2ZXP A;  3MWY W;  4BS9 A;  1HA5 A;  3VR2 A;  4IFD G;  2EY5 A;  4OIK A;  1EWH A;  4DGZ A;  3S2D B;  1B9N A;  1F77 A;  3M7N A;  2F0T A;  2PO4 A;  1I4X A;  3P75 A;  2NWG A;  1HPC A;  2E2I B;  3M85 A;  4MIU A;  5KRU A;  2ZXO A;  1CHP D;  4OHJ A;  3VYR A;  2QIL A;  2E75 C;  4ME5 A;  2JEA I;  1FNW A;  4PMC A;  1LV9 A;  3LNN A;  2EY6 A;  1GUT A;  3VR3 A;  1F9Q A;  1KTK A;  4KKS A;  2F0O A;  4RCO A;  2A69 D;  3VR6 A;  2F0M A;  1U4L A;  1DON A;  1PMR A;  2CVR A;  2BDN A;  4X3K A;  1SE3 A;  5K36 H;  3NK9 A;  5G3L D;  4KY5 A;  2AWO A;  5DM6 3;  3K59 A;  3LWU A;  3NE5 B;  2AQ1 B;  1BCP B;  1I4H A;  5C4H A;  2EJM A;  4BBS B;  1HFG A;  5CV7 A;  1M4V A;  2NN6 H;  1TKW B;  3I90 A;  2B39 A;  1EYD A;  3D6C A;  1CT1 D;  3T53 B;  2K5D A;  3Q23 A;  1A3U A;  1SJE D;  3SK6 A;  4KK7 A;  4NP5 A;  3TZD A;  4CKC A;  5BN4 A;  3L7Z C;  2RA4 A;  1HUM A;  5CBE E;  3MTS A;  1I4G A;  4H13 C;  2A6E C;  2B2T C;  1AN8 A;  1ENA A;  5D3I B;  3K57 A;  2PCF B;  1FNU A;  1JC7 A;  5E1F A;  2O5I C;  2RBM A;  1S5E D;  4KTA A;  3D8G A;  3LWE A;  4K8J A;  4QUC A;  1PFB A;  2KED A;  4IUV A;  5COR A;  1C4Q A;  4DN4 M;  1SFO B;  4K14 A;  5D3D A;  2IX1 A;  2AQ3 B;  5AFW A;  5LHY 1;  5KYL A;  1SYC A;  1Q12 A;  3QB3 A;  1BDO A;  4K2L A;  1FYC A;  1LTG D;  2KHS A;  1B4O A;  3G7L A;  1Z6H A;  5IGF A;  1F2Y A;  2R93 B;  4N9T A;  4QIW B;  1ONL A;  1GUS A;  5M3M B;  1NSN S;  1H9S A;  1E2W A;  4RWS C;  3NQI A;  1BXT A;  2DNE A;  4N9P A;  1RF2 D;  1OXX K;  3C46 A;  1K83 B;  1PYW D;  4X3U A;  1A3T A;  1GUO A;  4CGY B;  3N6R A;  3HOX B;  4HSP A;  2IJ0 A;  1TWG B;  5J1Z A;  1TT2 A;  3H0G B;  1LT6 D;  1JWU D;  2EZV A;  5C3E B;  4XQN A;  3OMG A;  2PZW A;  4ZUI A;  3SHL A;  4XQJ A;  5DNF A;  4BA1 I;  2CW0 D;  3DWQ A;  1CA5 A;  4WRD A;  5CR3 A;  4HAE A;  1BCP C;  3L3O C;  4WOR A;  4B9W A;  4HMJ A;  2X6G A;  1B50 A;  2RSN A;  2F03 A;  3Q6S A;  4F87 A;  1CZW A;  2EDG A;  3EQL C;  1KLU D;  1IW7 C;  3SXH A;  2PNR C;  2K03 A;  1BCP F;  5KEE A;  3PUX A;  4XYO A;  2F0D A;  5CV4 A;  4CHT B;  3SK4 A;  3V2T A;  3OW7 A;  3M4Y A;  3S1M B;  5D14 A;  5K5P A;  3V96 A;  1CM9 A;  4M1U B;  4NW2 A;  3HG9 A;  2YU9 B;  4RHR A;  2WP8 J;  3QJY A;  2G9D A;  5JEA H;  5FK9 C;  3FDT A;  1I4Q A;  3HOU B;  2A68 D;  3HEJ A;  1SNM A;  1PTO D;  3HP3 A;  2F0J A;  2M00 A;  2F0Q A;  1Y8P B;  3A7L A;  3TDQ A;  2XWB B;  2F4I A;  3R2T A;  2HQE A;  3QOJ A;  3R3O A;  3Q22 A;  4ILW A;  4ZLT F;  5ISR A;  4OO1 I;  2JA8 B;  1VMC A;  3CQZ B;  3PUZ A;  4XTC S;  4EQN A;  3OIQ A;  3W2D A;  5D65 A;  4L63 B;  3KLR A;  3GTM B;  2K33 A;  2B2U A;  3X3M A;  2F0W A;  5FLX L;  1D5Z C;  2JA5 B;  1EZ8 A;  1SNO A;  2R61 A;  3C1F A;  2RVL A;  4FVM A;  4O1N A;  4FP5 D;  1ILQ A;  1JR0 D;  5IT9 E;  4QF4 A;  4L6T B;  2F0V A;  2MGS A;  5CV6 A;  1Y8O B;  4KKU A;  4NKL A;  1JOQ A;  4P2C B;  1QOH A;  4C3J G;  1S4Z A;  1ESF A;  2AQ2 B;  2QKI C;  3Q0A A;  3OPO A;  5J39 A;  1BNZ A;  3HOZ B;  4UDU C;  5C5L A;  2NUC A;  2KCN A;  1ENF A;  2D9U A;  2F0F A;  5FO7 B;  2EY1 A;  3NWS A;  5I2X A;  3TP6 A;  3L9A X;  2L11 A;  5E3F A;  2KVM A;  1KAB A;  3BYY B;  3KBG A;  5FLX E;  5IIF A;  4IUP A;  4Y7N B;  3K7A B;  5KNC A;  2C5C A;  1VDZ A;  4RGT A;  2K1B A;  1QB5 D;  3GV3 A;  1EY4 A;  1EZ6 A;  3CRK C;  2HCI A;  4B9X A;  2QCP X;  3A8J E;  3VR5 A;  3VR4 A;  4HSV A;  3D6W A;  3S14 B;  3A54 A;  3QG1 A;  4X3S A;  2LS0 1;  3I91 A;  2EYF A;  2WB1 B;  1G6Z A;  5T1G A;  4BBR B;  4KKT A;  5C5M A;  1BUV T;  1SJH D;  3PUV A;  5JJZ A;  2RSO A;  3MEH A;  3FPP A;  4IQZ A;  3KLS A;  2V4D A;  5ELF A;  4CJ2 C;  1KDA A;  2D5D A;  3ERQ A;  1LAC A;  1QNK A;  4LJZ C;  2N55 A;  3MFY A;  3DWA A;  1MI2 A;  3DUZ A;  1OXU A;  1L0X B;  4MHE A;  1J8I A;  2B2T A;  3GTQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...