3S9WA

Crystal structure of staphylococcal nuclease variant delta+phs m98g bound to ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS M98G bound to Ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3s9wA00
3VA5A 1EY0A 4IUNA 4K14A 2F0LA 1SNCA 4NKLA 5CV6A 5EKKA 4ZUJA 3V2TA 4MIUA 5E3FA 1STYA 3R3OA 3NUCA 3DMUA 2EYJA 4PMCA 2F0QA 4TRDA 5I9PA 2EYLA 4K2LA 2F0TA 1EY8A 4PMBA 5ISRA 3EJIA 4HMJA 4KY5A 3SHLA 1SNOA 5HURA 5CC4A 3OMCA 5CGKA 3P75A 4N9TA 5KIXA 1NUCA 5KYIA 5CV7A 5C5MA 1KDCA 2SOBA 2SNMA 1TR5A 4QF4A 4RKBA 5IGEA 5E1FA 4K6DA 3SR1A 1SNPA 4QMGA 4ZUIA 4ME5A 4HMIA 4K5XA 4NDXA 3TP8A 3SXHA 1JOKA 2F0MA 5C3WA 1STAA 4ID6A 5IGFA 1U9RA 5I9OA 4N9PA 1EYAA 1SYBA 4E6IA 2EYMA 2RDFA 1KAAA 2EY5A 3P1HA 5C6AA 4KV6A 3MXPA 1KDAA 2F0DA 5EKLA 4KHVA 5KEEA 2EY1A 4I65A 3NK9A 5HGTA 5KRUA 2OXPA 4F7XA 3MVVA 3QOJA 2F0VA 5J22A 4NP5A 2F0PA 2KQ3A 3D8GA 5NUCA 1EZ6A 1EQVA 5DEHA 1STNA 2NUCA 4EQPA 1STHA 4NMZA 2LKVA 1STGA 1EY9A 3T13A 3DHQA 2F0HA 2PW7A 1II3A 3SK4A 2EY2A 2F0GA 4R8NA 4F8MA 5CV5A 3T16A 5J1ZA 1JOOA 5M9OA 4B9XA 2M00A 1EZ8A 2SNSA 4KTAA 3TP7A 5C3XA 2F0SA 1F2YA 1EY6A 3OMGA 2F0JA 2F3WA 2QDBA 3NP8A 1A2UA 1SNDA 2HQEA 4J6HA 1SYGA 2EXZA 3EROA 3TP5A 1ENCA 2EYPA 4DFAA 3D6CA 2O4XA 1SNMA 1EYDA 1EY5A 3H6MA 4HTHA 1NSNS 4WORA 2F0UA 2PZUA 3E5SA 2EY6A 4KY7A 4ZQ3A 5F2DA 4IALA 4B9WA 1RKNA 1TT2A 3MEHA 3MHBA 4KD3A 3BDCA 4LAAA 4WRDA 5CV9A 5C4HA 5K5PA 5CR3A 5CV4A 3D4DA 5IOCA 1JORA 2F0KA 1A2TA 3QB3A 2F0FA 1SYEA 2F0IA 2EYFA 2OF1A 3ITPA 1EY7A 5C5LA 4IZ8A 4K2KA 5CV8A 5IGCA 1TQOA 5IIFA 1JOQA 2KHSA 2RKSA 3SK5A 2PZWA 5KGUA 2EYHA 4K8IA 3U9OA 1IHZA 4DU9A 3NQTA 1STBA 3PMFA 2PZTA 2F0OA 4KD4A 3NXWA 2F0NA 4K8JA 3HZXA 2PQEA 4J1MA 4RKLA 3TP6A 1SNQA 2PYKA 3HEJA 4K5VA 3NHHA 4ODGA 1A3VA 5DAUA 1AEXA 1KDBA 5I6YA 5J39A 5C4ZA 4EVOA 3S9WA 2PW5A 1F2MA 3OSOA 1KABA 4KY6A 5IGGA 3EVQA 4KJNA 4G57A 4EQOA 1F2ZA 3ERQA 3QOLA 4QB4A 5JOBA 2ENBA 3TMEA 2EYOA 2RBMA 1A3TA 4EQNA 4PNYA 5I6WA 5JAVA 3SK8A 4S3SA 5EGTA 5IGDA 2F0EA 2WACA 1A3UA 1SYDA 4DF7A 4K5WA 3SK6A 3OWFA 3MZ5A 3LX0A 4YIJA 4KJOA 5IODA 1ENAA 2F0WA 3BDLA 5IGBA 3C1FA 2F3VA 2OEOA 1EYCA 4DGZA 1SYCA 4OL7A 3D4WA 5KYLA 3RUZA 1SYFA 3C1EA 4H7BA 1EY4A
chains in the Genus database with same CATH superfamily
4L5QA 1HNXL 3BVGA 1NE3A 4LUZA 2OT2A 2E76C 2ZXPA 3OOCA 1DCZA 3WOFA 1IBKQ 1BCPD 1TKWB 3K5NA 4A3EH 1BNZA 5CC4A 3OMCA 3S2DB 4YY3Q 2E8GA 3FHWA 2AQ2B 1Y14B 4RFBA 3NTHA 1SNPA 1ILPA 4OEMB 4XTCS 1AH9A 1WTVA 4DV5Q 1VQIA 1Q8IA 1VQ9A 3EA6A 3MXPA 1PFMA 3QWNA 3H15A 4C1NK 2E2JH 1MGSA 2AMCB 3CCVA 3AQQA 1SSOA 2ICEC 1S5BD 1QOHA 2B2WC 1HPCA 1V8QA 2PPBC 2KHJA 1YZ6A 1GUTA 1AW7A 1XWEA 3GTOH 4QGUA 3A5ZB 4GZYC 5G3LD 3AEVA 2HCCA 4DA2A 1NR4A 1B9NA 2UXDL 2L1BA 2E75C 4R4TA 2B2VC 3H09A 4V190 5C4XB 1EYDA 2UUAL 1ML0D 1B7YB 3E5SA 4DR6Q 5IWAQ 5M3MG 1HQMC 2OQKA 2KCCA 4YCVA 1VQBA 3BJUA 2Q8TA 1U0LA 5I9PA 1QB5D 1AP0A 2KBNA 1FGUA 4A75A 2QDLA 3T1HL 1GO3E 2IPKD 4HCEA 2B2YA 3QIAA 4BWGB 1YITA 1UEBA 1HR0Q 3TSSA 3H91A 1TS3A 4X3SA 1SNQA 3K7AH 2LY7A 5DAUA 1K28A 2MNAA 3W2DA 2Z9HA 2VQFL 2G5DA 3S14H 5HGQA 2KCNA 4UP7A 4LF9L 1A8VA 1ESFA 1UNSA 1ENFA 2F4IA 3I90A 4R8IA 4QJFA 1LTLA 1JC7A 3BU2A 2UXCL 1ICFB 1HRJA 4DR5L 2F3VA 1LTBD 1EL0A 2Z6KC 4YWLA 1X55A 1VF5C 4JBMA 1BBUA 1HZAA 2NVXH 2BA0A 1WVLA 2JA6G 5CBEE 1Y8NB 1Q86C 1H9KA 2KEEA 4GOPB 1O78A 1EUJA 5C3EG 4KY5A 1T5EA 1O7IA 1HXYD 1FNUA 2N88A 4KKUA 1LTRD 5IGEA 3CRKC 2C9OA 3TQYA 4DUYQ 3AU7A 5LMNQ 1Z47A 2R7DA 3E9HA 3F1ZA 3G6JB 1C8CA 4N9PA 4E6IA 2Z8LA 1HHVA 1XXGA 3D6WA 1AFPA 1TWFB 5JPNC 3CCMA 3CU7A 3IFTA 3D8GA 3KF8A 4YY3L 1ET6A 2EPBA 2HQLA 2NN6G 3R2TA 4Z9CB 1O7ZA 2EY2A 1Q1BA 4FNFA 3S14B 5C3XA 1B44D 2QEJC 5K36G 1F2YA 2JA8B 1HA5A 4DR6L 1G2TA 4J6HA 2YTXA 2G9DA 4A3FG 4X62Q 2Z4HA 4IALA 3MEHA 1FJGQ 2M9VA 3PUYA 3RLFA 2AUJD 4JI7Q 1FNVA 2KCMA 5FOBB 3U4VA 4JOIA 1XMOL 1WTWA 4MTNA 3FEWX 3SK5A 5C0XI 4L63B 4DN4M 1LV9A 1V1PA 3T1HQ 4MNOA 1A63A 3C2PA 3JC66 4AYBB 1EWHA 1DM0B 3NENA 3S9WA 2Q8RE 2PW5A 3D0FA 2DY8A 1A6XA 2VZAA 5JEAG 1X65A 4OWXB 4YHHL 4DR3L 4Y52H 1S5FD 1KIXA 4KHPQ 2A6EC 5JAVA 1VQGA 2IHEA 1TWGB 3LGJA 2GN5A 3S17B 4X62L 4RA8A 1I94Q 3MZ5A 1VQEA 1Z9FA 2F0WA 1LT5D 2E2DC 1NNXA 4JI7L 2WAQG 4JVZA 3W1GA 5FO9B 1SE8A 4X64L 5LMUQ 1TWAB 2K5DA 4LF4Q 2UUBL 1SXTA 2KVMA 1ONLA 2PNHA 1WTXA 4NXNQ 2CWPA 2EOTA 3DMUA 4CKEA 1QZHA 3FKIH 5C3EH 3CMEA 1J6QA 2NVXB 3EJIA 5HURA 3CCQA 2EDGA 1SE4A 1LO5D 3CRLC 4X65Q 2UXBL 3PF4A 4AH6A 2CFMA 1MJEA 2ICIA 3BVZA 4KMUC 2F0MA 3AB9A 2G9HD 5JJKA 1U9RA 3K0YA 1Q81C 2B8FA 2EY5A 2MO1A 4KV6A 2R3ZA 1Z7TA 3KOJA 3X3NA 3K5LA 2F0DA 4B3ML 3I4NB 1IXRA 5HGTA 5KRUA 2OXPA 1GUWA 3F2UA 3I4OA 2CH4W 2FINB 2K4KA 5AJ3L 1Q7YC 1STHA 2NZ1D 2UU9L 4PV1C 2FMCA 3NBIA 5BN4A 3EQLC 2HT1A 2GVBA 4C1NI 5CV5A 3PQIA 3A8KE 5IYDG 1PH3A 5M9OA 1XTDA 2NYZD 4KTAA 5GAHC 3RMHA 4BBRH 5M3FH 4AQYQ 4DFAA 4M8AA 2QEXA 4U673 3HOXH 4HTHA 3PO2H 2JA5B 2PZUA 3I3CA 5IYCG 3HOVG 5JVG3 3BDCA 2QGQA 4UAIA 2NB0A 4DR4L 5CV4A 4DV0L 3R93A 1X3FA 1UE1A 4IZ8A 4ABNA 4A3MG 5EBCA 4JPBW 1B2TA 3A8IE 4LF9Q 5KNBA 4KD4A 1ET9A 3KBXA 4M1UB 1I3QH 2PQEA 1C7YA 2ZM6Q 4ODGA 3VR3A 2JJQA 2N3SA 3NHHA 3ONAB 4DV1L 3DWQA 2TSSA 4JI4Q 2R92B 4A3BB 2DJGC 4DAVA 5IP7H 2K05A 4KKSA 4HIMA 3STBD 2E2JB 4QB4A 1JJGA 4A3LG 3AFQA 1GVPA 3GDEA 2CHBD 1M1KC 4JBWA 5LL6S 3J81i 2NWGA 1FD7D 3ND9A 5IGBA 4LF4L 2WIIB 1K8GA 1H9SB 1V1OA 3TZDA 3K8AA 1IBMQ 4A3JH 1KL9A 4LNQA 1KHIA 3RN2A 3HOWH 3I4NH 3HOZH 3KLRA 5CV6A 4MIUA 2ZJRA 2K28A 1STYA 1BCPB 2FXQA 2K04A 4IUPA 5FLMH 4K2LA 2HIXA 3SHLA 4DR7L 4N9TA 4RHRA 2BH2A 1YNND 1MHWC 3KF6A 4JC0A 1TIID 1EOTA 2OTLA 1KLUD 1BCPC 1ZYRD 4GLAC 3N52A 3SXHA 1CM9A 3VR4A 1FVIA 4JI5L 3OTOL 2EY1A 2D0OA 4A3JB 4NP5A 1ZKOA 2RF4A 4MZ9A 5BN3A 1VQNA 2UUCQ 5GQOA 1RDPD 1TWGH 3T16A 5J1ZA 3ZJYC 1QWYA 1IBKL 3HOUG 4A3DG 2F0SA 1WI5A 1GM5A 4Q5VA 2VY3A 3GTPH 2QDBA 5LMUL 1KTKA 1AE2A 1GUNA 3CCUA 2HHHQ 4A3BH 2R92H 4OHJA 4B9WA 2A69C 2E2HB 2VB2X 3NEMA 1PVOA 1XMQL 3ULLA 2B2VA 3DWAA 4R9WA 1SLJA 3I7FA 4C3IH 4IUQA 2L15A 4F88A 3VDYA 3BZDB 4HEDA 1J5EL 2HDLA 3G4SA 1Y1VH 5KGUA 3DLLA 4CDEC 1QNUA 1R4QB 4FP5D 3CMAA 4K8JA 3HKZE 2VQFQ 3W5OA 3CHBD 3HOUB 2DN8A 4DXFA 1N33Q 2JA6B 2M2LA 5I6YA 1Q82C 1T9HA 1PV4A 2YU9H 3K81C 1F2MA 1YNJC 1KABA 2Y0SG 1HR0L 5IT9E 1JR0D 1F2ZA 1GUOA 4EQ5A 2RBMA 5C44H 1ILQA 1RCVD 2K52A 3SK6A 3H3VI 4JI2Q 1E1OA 4GLVB 2L55A 3MXNB 3VR6A 1L0WA 1IBML 1SROA 1SNCA 4G7OC 2F0QA 5GROA 3X3MA 3M9BA 2VQEL 1NUCA 2WFWA 5C5MA 1B70B 2R7FA 3SE0A 2D0PA 4OO1I 3Q23A 5JEAH 4K5XA 1VQPA 2N8NA 4TQUS 3OTOQ 5JPMC 4BY1G 4ID6A 2R7ZB 5G3LF 1XNQL 4EX5A 1F9RA 3URYA 1YVCA 4A3FH 4I65A 3SGIA 4JW0A 5EPKA 4POGA 2E5LL 2BDNA 1EZ6A 4G7HC 2PI2E 5K36H 5DM73 4HSVA 2DY7A 4FF4A 4P75A 2BE5C 3T1YQ 4NB3A 4X3TA 2JA8H 1IYJB 4OIJA 3GTLH 4GN5A 3F2DA 3HRZC 1EY6A 2B63B 5I2XA 1PYWD 4AQYL 3EROA 5L37A 2R7ZG 5EPLA 1EY5A 3J7YW 2K5VA 4QCLA 1EFID 2HCIA 5CV9A 3ULJA 3IL8A 1XPOA 4LFCQ 1VQAA 1IW7D 2F0KA 1PRTB 1VMCA 1Q90A 1I4RA 1RTNA 3J80E 3I91A 2Z1CA 1JOQA 2KHSA 5M5YB 1NR2A 1CUKA 4R4CA 4IJLA 4IN3A 4C2MH 2F0NA 1SBBB 3I2ZA 2E74C 4JI1Q 1Q46A 3BYYB 1PH6A 4A3DH 1TS5A 3S16H 3CCSA 2IX1A 1N33L 4DV3Q 2E2IH 5EJWA 4KJNA 3D3RA 4G57A 3GQBA 4QQBX 5IT9c 1EQQA 2K6AA 2D5DA 3CPWA 1VQ4A 1RL2A 4KHZA 5IODA 3J81c 2E2HH 2MGSA 5FLMG 4DV0Q 1RODA 4DR2L 3S1RB 2OEOA 1DJRD 1DONA 5DLQE 4OL7A 4IOCA 3RZOB 1SYFA 3ICEA 3AYHB 2UU9Q 1EY0A 4JI8Q 1BQQT 1YNNC 4ZUJA 2R7ZH 2CKZB 5EAYA 1F9SA 5TSSA 2UXCQ 1EY8A 1VDZA 4HMJA 5ELDA 2O2LD 3IRBA 2PO4A 3I73A 1JWSD 3S2DH 1D1KA 1JICA 3SR1A 1PH7A 3V96A 1X32A 1IKLA 4GOPC 4ME5A 4C2MB 2FHTA 4H02A 4DR1L 3NTKA 1EWIA 5IP7G 1JB3A 1PZID 5I9OA 2UXBQ 3VYSA 1SYBA 1I4QA 2EYMA 3P1HA 3QR8A 5IYBH 2R93G 4IFDJ 3RR5A 4DAYA 1K83H 1H9JA 4OWWB 4GKKL 1YHBA 4X6AH 3OIQA 4TVAB 2IX3A 4A3LH 4NMZA 2NVQB 4DK6C 1EY9A 1MSGA 4UPAA 1YBYA 2VUMG 4DV4L 4ZKCB 5GAEC 5C0XJ 2EZVA 4F8MA 1Q8KA 2UUBQ 1FJGL 1JOOA 4JI0L 4B3TQ 2XRSD 1UE7A 1KAWA 2Z6KA 1ICWA 2C35B 5CYUA 3S15H 2Q2HA 3VYTA 1X3GA 2B2YC 2R93B 1WTHA 1QZGA 4LAAA 3RLNA 2HD3A 5M5XH 1BOSA 3K80C 3I4MH 3MWYW 4JI5Q 1JORA 2KHIA 1WYDA 5BN5A 1PZJD 4UDUC 2F4VQ 4GKJL 4MHEA 2KA7A 1K73C 3H94A 2ID0A 3PMFA 4L8JA 1YNXA 2EE1A 3C46A 2PYKA 2ATWA 2VL6A 3J7AV 3L3OC 3J7A5 2B39A 1R9TH 5IYDH 5I2YA 2IX0A 4ZCKA 4XT1B 4A3EB 4RH6A 4H13C 2FJ2A 4EQNA 2Q8IB 4R4QA 4OX9L 2WACA 3J81L 1PFBA 1YHAA 4HJ8A 1XJVA 1E2VA 1XX8A 4UY8C 2VQEQ 1PH4A 2A73B 1RJTA 3T1YL 2WAQE 4FXDA 4HJ7A 1KC8C 2YTYA 4HIDA 1HJPA 3HOYG 3PUVA 4IUNA 2R92G 4A3BG 2LFNA 5EKKA 3W1BA 1KQSA 1YJWA 3R3OA 3E0JA 2EYJA 2B2UA 1PMRA 5D14A 1SE3A 3PIPA 3PIO3 4BBSH 5A35A 5IP9G 1PH2A 3H3VH 2JA7H 5JEAJ 2BCOA 2OTJA 3P75A 1Y8OB 2H4OA 1SN8A 3E9IA 3RZDB 4LJZC 1QUQB 4IOAA 3M3YB 1HCZA 3MA2B 3BZCA 1C4QA 4HJ9A 2SDFA 1QVCA 2K50A 5IGFA 2A68D 4LF7Q 1RHPA 3HOYB 3CCLA 2BA1A 2JEBI 2GA4B 1BXTA 5DEHA 4EQPA 3QO2A 4OO1H 3GTGB 3U4ZA 1CQFA 4A3CG 5A2QL 1QUQA 3I70A 1G6PA 3CW2C 1QILA 2RSNA 3C3LA 1IZ6A 1SNDA 1KRTA 3I4MB 3GTJH 3GTGH 3DM1A 4WORA 4DNIA 2EY6A 4J8QA 3RN5A 3NBHB 4A3JG 5K5PA 5E7NA 1CFMA 5H1SE 2CH4A 3GV3A 3T4AC 5BR8Q 2H1EA 1JE5A 2XN9C 4K2KA 1TQOA 2E5LQ 3F2BA 1I4HA 3NQTA 1QJOA 2ZTDA 4H0LC 4QUCA 1VQCA 3A55A 1K8AC 1MKHA 2NVQH 3HP3A 3UE0A 5ELNA 4A3DB 2K32A 2JEAI 1CSPA 3N6RA 1HUMA 3MXUA 1VQMA 1PHJA 2ENBA 1LM0A 3FKIB 5C3EB 5ELCA 1PA6A 4JI6Q 3A74A 3SK8A 1I4PA 3GO5A 3KYHC 3I55A 1K8MA 2PQAB 1S5CD 3OWFA 4YIJA 4CKBA 1PH9A 5IYBG 2R93H 1PZKD 1R4PB 4MN3A 1SYCA 4BA2I 2B63H 3S1MB 4OO1G 4FF3A 4QIWB 1G6ZA 1N36Q 4BY7H 1Y1WH 3PO3H 3CPFA 5D3IB 2Z4IA 4DPGA 2A6HD 1RD9D 2JE6I 3UDGA 4IJHA 5DM63 2WKDA 4KHPL 2XRQD 5EBDA 2NTTA 3J81j 4ILWA 3KJPA 1XPRA 3RZOH 1UE6A 1A0IA 1KNEA 1WTRA 2A74C 2JA9A 4JCVE 2B29A 1VQOA 3M4QA 1U5KA 1K83B 1D6EC 4DV5L 5LL6X 4DV7Q 3J7ZC 1HUNA 5IYCH 2JA8G 5FLXL 1H95A 4GLXA 1H9MA 2HIVA 4J15A 1Y8PB 3FPPA 2EQSA 2LSSA 4LFAQ 2IL8A 4KHVA 5KEEA 1A62A 4ZLTF 2I46A 5M5XB 4O2DA 4HIOA 2NN6I 1STNA 3OYYA 2LKVA 3BG3A 2ZJPA 2N78A 3S15B 4I7AA 4BY1H 2NBFA 4GS3A 1LYLA 2UXDQ 4R8NA 2Q2TA 5JVH3 1YHQA 2ES2A 4PQXA 2JQOA 2YYZA 2M00A 4DXGA 1AZPA 3UDFA 1CTMA 3TP7A 4AYBG 1VCIA 1N34L 4X66Q 1F2LA 1X56A 1SJED 1J9OA 1D5ZC 2J7ZA 2O4XA 1DD2A 3UDXA 1V1QA 1E1TA 2V1CC 4A3KH 2QA4A 4OIKA 1RIPA 2QCPX 1JE4A 2AQ3B 1SYEA 2MJ8A 5LMNL 1XNQQ 2RKSA 1WFQA 5GAGC 1OXSC 1VQKA 1STBA 3TDQA 4ME3A 2K33A 4B3RQ 1IKMA 3F2CA 3CXCA 1SAPA 1S3OA 1SJHD 1WOCA 4DUZL 1J5EQ 4LF7L 3EBEA 3Q6SA 4OXPA 1D7QA 2EYOA 5IGDA 1K0SA 4C3JB 2VB3X 3LX0A 2N55A 4MTKA 4A3KB 1JJCB 3E0EA 2FMMA 1C48A 2L9HA 4LF5L 1N36L 1WCMG 2WB1B 3S1RH 2CW0C 5KYLA 3D31A 4OONA 2I5HA 3EN2A 3S2HB 2KEDA 2QW7A 3V2TA 1F9PA 3KDFA 4LF8Q 3MEFA 2B2TC 2EJGC 1PTOD 2L12A 4CJ0B 2L11A 1X9NA 5KIXA 2AWOA 2SOBA 4OX9Q 4A3KG 3G71A 3SEBA 4CJ2C 3TP8A 4ALPA 3KK7A 2FFKB 1DZ1A 3GTKB 5D65A 2DNEA 3CD6A 3HOVB 1SR3A 3CQZH 2F3IA 4JV5L 2XIWA 2EVBA 4F7XA 2F0VA 5M5WH 1KNAA 2QILA 3LNNA 1STGA 5C4XH 3HS0C 4LFBQ 2PW7A 4WJ4A 3PO3B 1B9MA 1O7LA 2B3GA 1EEFD 1LUZA 3U50C 3A0JA 3L2PA 3CAMA 4GOPA 2HQEA 2V4DA 1VQ6A 1N32L 2HUGA 3H6MA 3KF6B 2NVYB 3MTSA 3PGZA 4HSPA 5JJZA 5C4JB 5C4HA 3TEHB 1E2WA 5EPJA 5C44B 2JYOA 2RHQB 4WJ3M 1Z6HA 3GV6A 4DAPA 4FO2A 4DU9A 1PFSA 2F0OA 2I5MX 3PO3G 3NXWA 1M8AA 3RD4A 3KDFB 5EKIA 3KLSX 2F4VL 1AEXA 4A3GG 5IT9L 1H9RA 1VQ7A 3NTIA 4RHSA 2BE5D 1HNWL 4A3IB 1QCBD 4HAEA 1YEZA 5I6WA 4GNXA 2CW0D 4IQZA 3UDIA 1UAPA 4N8FA 4O1NA 1CZGA 1GHJA 4OWTB 1BBXC 1CHPD 1TWHB 2KCTA 3K5OA 3NPPA 1W3SA 4RG1A 4RWSC 1MD2D 3W3AA 1BKBA 1YJ9A 4P73A 1CQVA 1PDQA 2R6GA 3GTPB 1L1OC 1NMGA 1VS0A 4B3SQ 2EJFC 1LACA 2KOLA 4FF1A 1E22A 1VQJA 1YI2A 4R1JA 4A3EG 3S1MH 1NBWA 1PFNA 1E24A 5FLXc 1O80A 2SNMA 4RKBA 4XQNA 3HOZG 1ASZA 2WINB 3JAMi 3D4RA 5C3WA 1SFOH 1EIHA 4RGTA 1PRTF 4LFAL 3U58A 3BYTB 1YIJA 2CQOA 1B50A 1GJXA 2F0PA 1XMOQ 3JAMc 4B3SL 2CCZA 1JB7A 1K3RA 4A3MH 2HHHL 2L5TA 1QVGA 4P74A 4G7ZC 1HTPA 1YNJD 2F0GA 5E4XA 1SMYC 4JI3Q 1M90C 1JWUD 2QF7A 2JA7G 3HOZB 2WV6D 5C0XH 3HOWB 1SYGA 2OQ0A 2Y0SB 3DXJC 1SNMA 2EIFA 4LUVA 4O42A 4KY7A 4ZQ3A 2CQAA 3FKIG 4JI2L 1PYBA 1KLGD 1I4XA 4JI0Q 1I5FA 4IFDG 2IY5B 2I07B 4BBRB 5M3FB 1MBYA 1A2TA 1A15A 2EYFA 3KLWA 1EY7A 2XVSA 2A69D 1G291 3A7LA 1G51A 1Y69U 1UEAB 4K8IA 3U9OA 4JOIC 3DM3A 2JSOA 1HZ9A 5C0XG 4BBSG 4PG3A 1G2SA 4GNXC 1OTCA 1CT1D 3I56A 5C4ZA 2PMZE 3PSIA 1GUSA 4LMQD 2BDOA 3EVQA 3BS1A 2XNAC 3QOLA 5DNFA 2NZHA 3E3XA 3TBIB 3I4LA 2LXJA 3I8ZA 3SVMA 1U4RA 2F0EA 3CCEA 1SFOB 4Q0FA 3IAYA 4K5WA 1SMXA 1FR3A 1KRSA 3K7UC 1JMCA 2JP1A 2JA5H 4ZAIA 2YTVA 2PCFB 4YWKA 2B8GA 3G6EA 1ZYRC 3CQZB 4IO9A 3K57A 2NZOA 3R2IA 4NXML 1VF7A 1OXVA 1DOLA 3NUCA 2XSCA 2A19A 1MI2A 4JK1C 4DV6L 1TWAH 3BVMA 1UE5A 4DNRB 5D3DA 3FDTA 3L0OA 1TR5A 4QF4A 1FYCA 5AJ3Q 2KECA 4K6DA 1TWFH 4A93G 1TWHH 4N8X1 3CCJA 3CC2A 4P72A 1GKHA 1I3QB 1LTTD 4NDXA 1FNWA 3UI2A 1WD1A 2X6LA 4GN3B 4BXXH 1PRTC 4RGMA 5C6AA 1IYVA 1JQYD 5EKLA 2K03A 3OW7A 4X65L 5NUCA 4XYQA 2AUKA 3BDOA 1HH2P 1SRUA 3K5MA 3Q22A 3EIVA 4RCNA 4X3KA 1NMFA 2DJFC 1X54A 3PV0A 1ZEQX 4B9XA 1IL2A 4A93B 1EZ8A 1S5ED 3GTMB 2IT1A 3OWEB 1V9PA 2L0CA 3TREA 4IPCA 3TP5A 3J80c 1JT8A 1F77A 1VQ8A 4G4KA 5ELFA 1JCKB 1TT2A 3UE1A 4WRDA 3T56B 1N8RC 2RQXA 3D4DA 1HNWQ 3QB3A 1V1PB 2ZTEA 2F0FA 2F0IA 2OF1A 5EQ0A 2NN6H 1S40A 1VQDA 2K5HA 1LTID 2E2IB 4P2CB 1WCMB 1D1IA 1X3PA 3CCRA 1XNRL 1M4VA 3S16B 4K5VA 1P16A 5J39A 3Q8DA 1W2BA 4EVOA 2ZJQA 3IFDA 4K0KL 3OSOA 1WJJA 4KY6A 3R8BA 4A3GH 5C4XG 1OO9B 4EQOA 3SDZA 5M5YH 1BCPF 5M3MB 1N32Q 3J81E 3NWTA 1I6HH 3QJYA 5EGTA 3V05A 3PIOA 4HCSA 1N34Q 2DUDA 2NVTH 3Q24A 4KK7A 4XIGS 1CI3M 3AMUA 4JBJA 2VW9A 4F87A 3D4WA 3C1EA 1ASYA 3TRZA 4LFBL 2K7VA 4L5TA 1EIYB 2NVTB 1QVFA 1CKOA 4DV2L 1AZQA 2A6HC 5E3FA 4LF6Q 1CKNB 2AHOB 3HKSA 5IY0A 2MPMA 3M7NA 1HFNA 5CGKA 1WTPA 4IPDA 4R4OA 1TY0A 3ULPA 4C3JG 1IBLQ 1KDCA 4IPGA 2DNCA 4ZK9B 4QL5A 1EQRA 3DEPA 4QMGA 1UUPA 3A5UA 4LWCA 4ZYSA 2VS1A 1GUGA 2K5QA 3P20A 4C3HH 2XWJB 2N49A 4V0BA 1KAAA 3K59A 2XTIA 2O5IC 3HKZG 1EU3A 3NE5B 3QOJA 4IPHA 3F8TA 4IURA 4UP9A 4DUYL 1K8OA 3HFZB 1HTLD 4GN4B 3PUXA 4IFDI 4Y7NH 1HZBA 3JAML 4POFA 1II3A 3OIPA 1ZXTA 4HJAA 5M3MH 1OXXK 3MFGA 1PRTD 1JJ2A 2R61A 1TXYA 1EEID 3H0GG 4CDCC 1XPUA 1D2BA 4TSSA 1H9SA 2KUMA 2X69A 4AYBE 4HJ5A 4ZRZA 2K75A 2CVRA 2F0UA 4BA1I 1RKNA 1PTOF 2GVAA 3G7LA 3HGBA 4IUUA 1WCMH 4JBKA 5IOCA 1D8LA 3OPOA 4PZ6A 4NW2A 5T1GA 4A4IA 5IIFA 3GTLB 3GTOB 4DR1Q 2EYHA 1W6KA 5FO7B 1IHZA 3LWUA 2MUYA 4DV3L 5FKAC 2ZXOA 4ZKBB 3CF5A 4PZ7A 4RCOA 1KDBA 3TZUA 3NSWA 4XQJA 1L0YB 4FVMA 3AFPA 2D9UA 1Y1VB 3TMEA 5JOBA 2L4NA 2MFIA 4DAMA 4A93H 3M4PA 1G8ZD 1WTQA 1J8IA 2A68C 1E3PA 4KLKA 1B8AA 1X3EA 3MXGA 4NPSA 1MJCA 4BS9A 1WTOA 2J4XA 3DUZA 1G91A 1EIGA 2ZT9C 4TKOB 3M85A 2VUMH 5KNCA 1VQFA 1PTOB 4IUVA 5CORA 3TS0A 3DEOA 1VQ5A 1JWMD 1AE3A 3K58A 3VA5A 4K14A 2F0LA 4HN7A 1HZCA 3E6ZX 1HQRD 3J80L 1EWCA 4BY7B 4RAUC 4A3IG 3CKIB 2Y0SE 3M4OH 1AN8A 3RZDH 3U9SA 4AIMA 1Y1WG 5GADC 5E1FA 4JV5Q 3S1NB 3ER0A 1S5DD 1Q3LA 1JOKA 4C3IG 4DR7Q 3I4MG 1LTAD 4YWMA 1CSQA 3I72A 1EIFA 1EYAA 1GHKA 1SMYD 1QE6A 4CJ1B 3FVQA 4K6LA 3NQIA 5J22A 4NXMQ 5LHY1 3PIP3 3HOUH 3NELA 1TS2A 1IBLL 5JJIA 2A5HA 2RHSB 3HG9A 1N9WA 3OW2A 4DNTB 3ERSX 4KN4C 1PTOC 2MHVA 3OMGA 1CKNA 1A2UA 4UP8A 1ENCA 1PH8A 2B2UC 3MXNA 3D6CA 1R9TB 3VA7A 1NSNS 4JI3L 2VUMB 1HNZQ 3S1QB 2F52A 3K0XA 4K0KQ 4JI4L 4CBVA 4DV4Q 3ITPA 5C5LA 4EGVA 2J0TD 2PZWA 1CHQD 3O13A 5JJLA 4L5SA 2VXWA 2PZTA 4RKLA 3HZXA 1RF2D 3RNUA 3HEJA 3S24A 2K5NA 3HOWG 1E2ZA 4DR4Q 2AKWB 1U4PA 2ZTCA 1EQTA 2EXDA 2LMCB 5IGGA 2RSOA 2PQAA 1GD7A 2H5XA 3VYUA 1U4MA 1A3TA 4WJWA 3G48A 4S3SA 2K1BA 3STBC 4X3UA 2F1MA 2MO0A 1EU4A 4A3MB 4DR2Q 1DOKA 3C1FA 1IYUA 4QUFA 1EYCA 3FP9A 4C3HG 4LW1A 2WKCA 4BBSB 1S4ZA 4JI8L 3HOVH 3IKJA 4CDDC 3PO2G 1LT6D 4DR5Q 5FO8B 4TRDA 4PMCA 1DGSA 4A3IH 4PMBA 5ISRA 3CC7A 5KYIA 1LT4D 1YJNA 4P71A 1Q1EA 1OXUA 4ZUIA 1PH5A 1STAA 4C3HB 3H3VC 5FJ8H 3ND8A 3S2HH 1EOVA 2RDFA 3KJOA 4FXGC 1NJIC 3HOXG 2B2WA 4HR7B 4HIKA 2KQ3A 5ELBA 4L5RC 1TWCB 3WOEA 2AWNA 4LFCL 4FF2A 1HFGA 1KD1C 5COYA 1O7YA 1NAPA 3SK4A 1BO0A 4PZ8A 1L1OA 4CGYB 1DXMA 2BOSA 3VYRA 2IJ0A 5IWAL 1I4GA 4DK1A 3NP8A 2EXZA 1L1OB 1TY2A 2EYPA 2DGYA 1SDFA 1TVXA 2Q2IA 4DK3C 3MHBA 4XQQA 2ALYB 5M5WB 3HOXB 4H44C 2ASBA 2VNUD 4IFDH 2HDMA 4GNXB 3S17H 1LLRD 3TS2A 2RA4A 1I6HB 2O5JC 3GTKH 5CMDA 2WB1G 4J1MA 5E4WC 1A3VA 2NVYH 2ZM6L 3RLOA 4DV1Q 5AFWA 2IHFA 1VQHA 3P7JA 1XNRQ 3EFXD 2A6ED 3ERQA 1TU2B 4DK0A 1LTSD 4KN7C 4RMFA 2XGTA 4ULLA 1EYGA 3FPUB 5BR8L 2TMPA 2JK8A 3H0GH 4Y7NB 2KENA 3DWPA 2SEBD 1XMQQ 4B3TL 3VR2A 3MC0B 1PTOH 1UWVA 3A54A 2KJXA 4B08A 3RUZA 4DKAC 3KFUA 1EY4A 1L2FA 1HNXQ 4NKLA 2RVLA 1CK1A 4XDXA 4C3JH 2A8VA 1KXLA 1K0RA 1PH1A 1K3BC 4LF5Q 2F0TA 2RCNA 4I7ZC 1CKMA 4L6TB 2K14A 2RDHA 3ZYYX 2P5ZX 2LXKA 2WB1E 5HY6A 4DUZQ 3H0GB 2PNRC 3BZKA 2QKIC 2A1AA 2K5WA 2I0QA 1KDAA 1WD0A 5IE8A 4OGQC 1PXUA 4JI1L 2EJMA 3NK9A 4RGOS 1XYIA 5C44G 3L9AX 4WFN3 2NUCA 2B2TA 4LUOA 2ZXRA 2C5CA 3T13A 1U4LA 2MQHA 1LTGD 3JAME 4DAYB 3B6YA 4LF6L 1SE2A 1I50B 2UUCL 4NXNL 3WDNA 1I50H 2MP1A 1BF4A 3Q0AA 1B4OA 4QY7A 4A3GB 5FJ8G 3PCOB 4BY1B 2YU9B 2JA6H 1Y1VG 5F2DA 3HKZB 2NTSA 2AQ1B 1HR0W 3LWEA 1OXTA 4CHTB 2Z0SA 4B3MQ 1BUVT 1D5XC 4A76A 5IGCA 1IL8A 5CV8A 4JG2A 1IW7C 3PF5A 1W6JA 3A8JE 1C0AA 3VR5A 1Q12A 2YV5A 4JYAQ 3TP6A 4YHHQ 4DR3Q 1TWCH 4PMWA 1TS4A 2Z6BA 2IW3A 2B63G 1HA6A 1NCVA 2PI2A 3PUZA 4BY7G 4A3FB 4PNYA 4C56C 4YCWA 4O0AA 5J3BA 2K01A 3GD7A 5I4DA 1A3UA 1GOZA 1SYDA 2LS01 3FRPB 1Y1WB 4X64Q 5ELOA 4DF7A 4IUTA 1CA6A 1VQLA 1DOMA 3M4YA 4BXXG 3FMCA 1QNKA 1NY4A 1P8LA 2IWHA 3KF8B 4LF8L 3A56A 4DGZA 1I94L 1SEBD 4CDFC 2UUAQ 3I4NG 2OCEA 1B3QA 3WWVA 1K9MC 4KI0A 4OELB 5CBAE 2EYLA 3GTQH 4RGNA 1RTOA 1SNOA 3NBHA 2RDGA 4JI6L 1CA5A 1BBWA 2XWBB 3MFYA 5CV7A 1BR9A 2WP8J 5T1IA 2F03A 4GKKQ 2JA7B 4DV7L 3OHXC 3A7AB 4XYOA 1S72A 4HMIA 4QIWE 2WAQB 4GKJQ 3PUWA 4KKTA 4B3RL 4XT3B 3S1NH 3K6OA 5A2QE 4FXKC 1EFWA 3QG1A 1B1ZA 1VMPA 3MVVA 1BVSA 4CKCA 1E0BA 4BBRG 5M3FG 1EQVA 1PYSB 3K7AB 3M4OB 4DV6Q 1GXDC 2Q2UA 3CC4A 3DHQA 2F0HA 2D62A 3GTJB 2X6GA 2PMZB 2OWOA 1FL0A 1F9QA 4A3CH 1LABA 1T5XD 3MAQA 3GTMH 3T53B 1LT3D 3T51B 2SNSA 5IP9H 2I5LX 1FGBD 2F0JA 2F3WA 4X66L 4C3IB 3L7ZC 2D2CC 1NTGA 3CP0A 4KD3A 1B3AA 1E7ZA 1MIUA 1BDOA 5CR3A 5FLXE 3KLSA 2JN4A 1PLFA 4UHVA 1I6VC 4FDBA 4APVA 1CZWA 5LMNW 2RCFA 4JYAL 3HOYH 1STEA 1X3QA 2JXMB 4XXEA 3GP7A 1V43A 3M3YH 3PO2B 3TN2A 1C9OA 4FYDA 1QG7A 4R4IA 2JA5G 1ESRA 1X6OA 3M7GA 5FK9C 2BH8A 3J7AF 4U68A 2CWAA 1MSHA 3KUPA 3J80i 4LK1C 3KBGA 4KJOA 1ENAA 4YCUA 3NWSA 3BDLA 5C4JH 3S1QH 1HNZL 1L0XB 1B53A 1DYQA 5KNDA 5ELEA 1XTCD 4DV2Q 1D5MC 4H7BA 3GTQB
chains in the Genus database with same CATH topology
3BVGA 2OT2A 2E76C 2ZXPA 3OOCA 1DCZA 3WOFA 1BCPD 1TKWB 3K5NA 1BNZA 5CC4A 3OMCA 3S2DB 2AQ2B 4RFBA 3NTHA 1SNPA 1ILPA 4XTCS 1WTVA 1Q8IA 3EA6A 3MXPA 1PFMA 3QWNA 4C1NK 1MGSA 1SSOA 2ICEC 1S5BD 1QOHA 2B2WC 1HPCA 1V8QA 2PPBC 1GUTA 1AW7A 1XWEA 4GZYC 5G3LD 2HCCA 4DA2A 1NR4A 1B9NA 2L1BA 2E75C 2B2VC 3H09A 4V190 5C4XB 1EYDA 1ML0D 3E5SA 1HQMC 2KCCA 2Q8TA 5I9PA 1QB5D 1AP0A 2IPKD 4HCEA 2B2YA 3QIAA 4BWGB 3TSSA 3H91A 1TS3A 4X3SA 1SNQA 2LY7A 5DAUA 3W2DA 2KCNA 1ESFA 1UNSA 1ENFA 2F4IA 3I90A 4R8IA 1JC7A 1HRJA 2F3VA 1LTBD 1EL0A 1VF5C 2BA0A 1WVLA 5CBEE 1Y8NB 1H9KA 2KEEA 1O78A 4KY5A 1T5EA 1HXYD 1FNUA 2N88A 4KKUA 1LTRD 5IGEA 3CRKC 2C9OA 3AU7A 1Z47A 3G6JB 1C8CA 4N9PA 4E6IA 2Z8LA 1HHVA 1XXGA 3D6WA 1AFPA 1TWFB 5JPNC 3CU7A 3IFTA 3D8GA 3KF8A 1ET6A 2EPBA 2NN6G 3R2TA 4Z9CB 1O7ZA 2EY2A 1Q1BA 4FNFA 3S14B 5C3XA 1B44D 2QEJC 5K36G 1F2YA 2JA8B 1HA5A 1G2TA 4J6HA 2G9DA 2Z4HA 4IALA 3MEHA 2M9VA 3PUYA 3RLFA 2AUJD 1FNVA 5FOBB 1WTWA 3SK5A 3FEWX 5C0XI 4L63B 4DN4M 1LV9A 1V1PA 3C2PA 4AYBB 1EWHA 1DM0B 3S9WA 2Q8RE 2PW5A 1A6XA 2DY8A 5JEAG 1S5FD 2A6EC 5JAVA 1TWGB 3S17B 4RA8A 3MZ5A 2F0WA 1LT5D 2E2DC 5FO9B 1TWAB 2K5DA 1SXTA 2KVMA 1ONLA 1WTXA 2EOTA 3DMUA 4CKEA 2NVXB 3EJIA 5HURA 2EDGA 1SE4A 1LO5D 3CRLC 2ICIA 3BVZA 4KMUC 2F0MA 3AB9A 2G9HD 1U9RA 3K0YA 2B8FA 3K5LA 2EY5A 2R3ZA 4KV6A 3I4NB 1Z7TA 3X3NA 2F0DA 5HGTA 5KRUA 2OXPA 1GUWA 3F2UA 2FINB 1STHA 2NZ1D 4PV1C 2FMCA 3NBIA 5BN4A 3EQLC 4C1NI 5CV5A 3A8KE 5M9OA 2NYZD 4KTAA 3RMHA 4DFAA 4M8AA 4U673 4HTHA 2JA5B 2PZUA 3I3CA 5JVG3 3BDCA 4UAIA 2NB0A 5CV4A 3R93A 4IZ8A 4ABNA 5EBCA 1B2TA 3A8IE 5KNBA 4KD4A 1ET9A 3KBXA 4M1UB 2PQEA 4ODGA 3VR3A 3NHHA 3ONAB 3DWQA 2TSSA 2R92B 4A3BB 4DAVA 2K05A 4KKSA 2E2JB 4QB4A 2CHBD 4JBWA 5LL6S 2NWGA 1FD7D 5IGBA 3ND9A 2WIIB 1H9SB 1V1OA 3TZDA 3KLRA 5CV6A 4MIUA 2K28A 1STYA 1BCPB 2K04A 4IUPA 4K2LA 3SHLA 4N9TA 4RHRA 1YNND 1TIID 1EOTA 1KLUD 1BCPC 1ZYRD 3N52A 3SXHA 1CM9A 3VR4A 2EY1A 4A3JB 4NP5A 1ZKOA 5BN3A 1RDPD 3T16A 5J1ZA 1QWYA 2F0SA 4Q5VA 2QDBA 1KTKA 1GUNA 4OHJA 4B9WA 2A69C 2E2HB 2VB2X 2B2VA 3DWAA 4R9WA 4IUQA 4F88A 3BZDB 4HEDA 2HDLA 5KGUA 1QNUA 1R4QB 4FP5D 4K8JA 3CHBD 3HOUB 2DN8A 4DXFA 2JA6B 2M2LA 5I6YA 1F2MA 1YNJC 1KABA 5IT9E 1JR0D 1F2ZA 1GUOA 2RBMA 1ILQA 1RCVD 3SK6A 2L55A 3VR6A 1SNCA 4G7OC 2F0QA 3X3MA 1NUCA 5C5MA 3SE0A 4OO1I 3Q23A 5JEAH 4K5XA 4TQUS 5JPMC 4ID6A 2R7ZB 5G3LF 1F9RA 3URYA 4I65A 5EPKA 2BDNA 1EZ6A 4G7HC 5K36H 5DM73 4HSVA 2DY7A 4FF4A 2BE5C 4X3TA 4OIJA 3HRZC 1EY6A 2B63B 5I2XA 1PYWD 3EROA 5EPLA 1EY5A 3J7YW 4QCLA 1EFID 2HCIA 5CV9A 3IL8A 1IW7D 2F0KA 1PRTB 1VMCA 1Q90A 1I4RA 1RTNA 3J80E 3I91A 2Z1CA 1JOQA 2KHSA 5M5YB 1NR2A 4IN3A 2F0NA 1SBBB 2E74C 3BYYB 1TS5A 2IX1A 5EJWA 4KJNA 3D3RA 4G57A 3GQBA 2K6AA 2D5DA 4KHZA 5IODA 2MGSA 1RODA 3S1RB 2OEOA 1DJRD 1DONA 4OL7A 3RZOB 1SYFA 1EY0A 1BQQT 1YNNC 4ZUJA 1F9SA 5TSSA 1EY8A 1VDZA 4HMJA 5ELDA 2O2LD 2PO4A 3I73A 1JWSD 1D1KA 1JICA 3SR1A 3V96A 1X32A 1IKLA 4ME5A 4C2MB 2FHTA 3NTKA 1JB3A 1PZID 5I9OA 3VYSA 1SYBA 1I4QA 2EYMA 3P1HA 4IFDJ 4DAYA 1H9JA 3OIQA 2IX3A 4NMZA 2NVQB 1EY9A 1MSGA 4ZKCB 5C0XJ 2EZVA 4F8MA 1JOOA 2XRSD 1ICWA 5CYUA 3VYTA 2B2YC 2R93B 4LAAA 1BOSA 3MWYW 1JORA 5BN5A 1PZJD 4UDUC 4MHEA 2KA7A 3H94A 2ID0A 3PMFA 4L8JA 2EE1A 3C46A 2PYKA 3J7AV 3L3OC 2B39A 5I2YA 2IX0A 4XT1B 4A3EB 4RH6A 4H13C 2FJ2A 4EQNA 2Q8IB 2WACA 3J81L 1PFBA 1E2VA 1XX8A 2A73B 1RJTA 4FXDA 3PUVA 4IUNA 2LFNA 5EKKA 3R3OA 3E0JA 2EYJA 2B2UA 1PMRA 5D14A 1SE3A 3PIO3 5A35A 5JEAJ 2BCOA 3P75A 1Y8OB 2H4OA 3RZDB 4LJZC 3M3YB 1HCZA 3MA2B 1C4QA 2SDFA 5IGFA 2A68D 1RHPA 3HOYB 2BA1A 2JEBI 2GA4B 1BXTA 5DEHA 4EQPA 3QO2A 4OO1H 3GTGB 1CQFA 5A2QL 3I70A 1QILA 2RSNA 3C3LA 1SNDA 3I4MB 3DM1A 4WORA 2EY6A 4J8QA 5K5PA 1CFMA 3GV3A 3T4AC 2H1EA 2XN9C 4K2KA 1TQOA 1I4HA 3NQTA 1QJOA 4H0LC 4QUCA 3A55A 3HP3A 4A3DB 2K32A 2JEAI 3N6RA 1HUMA 3MXUA 2ENBA 5C3EB 3FKIB 5ELCA 3SK8A 1I4PA 3GO5A 1K8MA 1S5CD 3OWFA 4YIJA 4CKBA 1PZKD 1R4PB 4MN3A 1SYCA 4BA2I 3S1MB 4OO1G 4FF3A 4QIWB 1G6ZA 5D3IB 2Z4IA 2A6HD 1RD9D 2JE6I 5DM63 2WKDA 2XRQD 5EBDA 2NTTA 4ILWA 1KNEA 1WTRA 2A74C 1K83B 1D6EC 5LL6X 1HUNA 5FLXL 1H9MA 1Y8PB 3FPPA 2IL8A 4KHVA 5KEEA 4ZLTF 2I46A 5M5XB 2NN6I 1STNA 2LKVA 3BG3A 3S15B 2NBFA 4R8NA 5JVH3 4PQXA 4DXGA 2YYZA 2M00A 1AZPA 1CTMA 3TP7A 1VCIA 1F2LA 1SJED 1J9OA 1D5ZC 2J7ZA 2O4XA 1DD2A 4OIKA 2QCPX 1JE4A 2AQ3B 1SYEA 2MJ8A 2RKSA 1OXSC 1STBA 3TDQA 2K33A 1IKMA 1SAPA 1SJHD 3Q6SA 2EYOA 5IGDA 4C3JB 2VB3X 3LX0A 2N55A 4A3KB 2FMMA 1C48A 2L9HA 2WB1B 2CW0C 5KYLA 3D31A 3S2HB 2KEDA 3V2TA 1F9PA 2B2TC 2EJGC 1PTOD 2L12A 4CJ0B 2L11A 5KIXA 2AWOA 2SOBA 3SEBA 4CJ2C 3TP8A 3KK7A 2FFKB 1DZ1A 3GTKB 5D65A 2DNEA 3HOVB 2XIWA 2EVBA 4F7XA 2F0VA 1KNAA 2QILA 3LNNA 1STGA 3HS0C 2PW7A 3PO3B 1B9MA 1O7LA 1EEFD 2HQEA 2V4DA 2HUGA 3H6MA 2NVYB 3MTSA 4HSPA 5JJZA 5C4JB 5C4HA 1E2WA 5EPJA 5C44B 2JYOA 1Z6HA 3GV6A 4DAPA 4FO2A 4DU9A 2F0OA 3NXWA 1M8AA 3RD4A 5EKIA 3KLSX 1AEXA 5IT9L 1H9RA 3NTIA 4RHSA 2BE5D 4A3IB 1QCBD 4HAEA 5I6WA 2CW0D 4IQZA 1UAPA 4O1NA 1CZGA 1GHJA 1BBXC 1CHPD 1TWHB 3K5OA 3NPPA 4RWSC 1MD2D 3W3AA 1CQVA 1PDQA 2R6GA 3GTPB 2EJFC 1LACA 2KOLA 4FF1A 1PFNA 1O80A 2SNMA 4RKBA 4XQNA 2WINB 3D4RA 5C3WA 1EIHA 4RGTA 1PRTF 3BYTB 1B50A 1GJXA 2F0PA 2L5TA 4G7ZC 1HTPA 1YNJD 2F0GA 5E4XA 1SMYC 1JWUD 2QF7A 3HOZB 2WV6D 5C0XH 3HOWB 1SYGA 2Y0SB 3DXJC 1SNMA 4O42A 4KY7A 4ZQ3A 2CQAA 1KLGD 1I4XA 4IFDG 2I07B 4BBRB 5M3FB 1MBYA 1A2TA 1A15A 2EYFA 1EY7A 2XVSA 2A69D 1G291 3A7LA 1Y69U 1UEAB 4K8IA 3U9OA 2JSOA 5C0XG 1G2SA 1CT1D 5C4ZA 1GUSA 4LMQD 2BDOA 3EVQA 3BS1A 2XNAC 3QOLA 5DNFA 3TBIB 3I4LA 3I8ZA 3SVMA 1U4RA 2F0EA 1SFOB 4Q0FA 3IAYA 4K5WA 1FR3A 2JP1A 4ZAIA 2PCFB 2B8GA 1ZYRC 3CQZB 3K57A 3R2IA 1VF7A 1OXVA 1DOLA 3NUCA 2XSCA 1MI2A 4JK1C 3BVMA 4DNRB 5D3DA 3FDTA 1TR5A 4QF4A 1FYCA 2KECA 4K6DA 1I3QB 1LTTD 4NDXA 1FNWA 3UI2A 1WD1A 2X6LA 1PRTC 4RGMA 5C6AA 1IYVA 1JQYD 5EKLA 2K03A 3OW7A 5NUCA 4XYQA 2AUKA 3BDOA 3K5MA 3Q22A 4RCNA 4X3KA 3PV0A 1ZEQX 4B9XA 4A93B 1EZ8A 1S5ED 3GTMB 2IT1A 3OWEB 2L0CA 3TP5A 1F77A 4G4KA 5ELFA 1JCKB 1TT2A 4WRDA 3T56B 2RQXA 3D4DA 3QB3A 1V1PB 5EQ0A 2F0FA 2F0IA 2OF1A 2NN6H 1LTID 2E2IB 4P2CB 1WCMB 1D1IA 1X3PA 1M4VA 3S16B 4K5VA 5J39A 4EVOA 3IFDA 3OSOA 4KY6A 3R8BA 1OO9B 4EQOA 3SDZA 1BCPF 5M3MB 3J81E 3NWTA 3QJYA 5EGTA 3V05A 4HCSA 3Q24A 4KK7A 4XIGS 1CI3M 3AMUA 4F87A 3D4WA 3C1EA 2K7VA 2NVTB 1AZQA 2A6HC 5E3FA 2MPMA 3M7NA 1HFNA 5CGKA 1WTPA 1TY0A 4C3JG 1KDCA 2DNCA 4ZK9B 3DEPA 4QMGA 1UUPA 4ZYSA 1GUGA 2K5QA 3P20A 2XWJB 4V0BA 1KAAA 3K59A 2O5IC 1EU3A 3NE5B 3QOJA 4IURA 1K8OA 1HTLD 3PUXA 4IFDI 3JAML 1II3A 3OIPA 1ZXTA 1OXXK 3MFGA 1PRTD 2R61A 1EEID 1D2BA 4TSSA 1H9SA 2KUMA 2X69A 4ZRZA 2CVRA 2F0UA 4BA1I 1RKNA 1PTOF 3G7LA 4IUUA 3HGBA 5IOCA 3OPOA 4NW2A 5T1GA 5IIFA 3GTLB 3GTOB 2EYHA 1W6KA 5FO7B 1IHZA 3LWUA 2MUYA 5FKAC 2ZXOA 4ZKBB 4RCOA 1KDBA 3TZUA 3NSWA 4XQJA 1L0YB 4FVMA 2D9UA 1Y1VB 3TMEA 5JOBA 2L4NA 1G8ZD 1WTQA 1J8IA 2A68C 3MXGA 4BS9A 1WTOA 2J4XA 3DUZA 1G91A 1EIGA 2ZT9C 4TKOB 3M85A 5KNCA 1PTOB 4IUVA 5CORA 3DEOA 1JWMD 3K58A 3VA5A 4K14A 2F0LA 4HN7A 3E6ZX 1HQRD 3J80L 1EWCA 4BY7B 4RAUC 3CKIB 1AN8A 3U9SA 5E1FA 3S1NB 1S5DD 1Q3LA 1JOKA 4C3IG 1LTAD 3I72A 1EYAA 1GHKA 1SMYD 1QE6A 4CJ1B 3FVQA 4K6LA 3NQIA 5J22A 5LHY1 3PIP3 1TS2A 2A5HA 3HG9A 4DNTB 4KN4C 1PTOC 2MHVA 3OMGA 1A2UA 1ENCA 2B2UC 3MXNA 3D6CA 1R9TB 3VA7A 1NSNS 2VUMB 3S1QB 4CBVA 3ITPA 5C5LA 4EGVA 2J0TD 2PZWA 1CHQD 3O13A 2VXWA 2PZTA 4RKLA 3HZXA 1RF2D 3HEJA 1E2ZA 1U4PA 1EQTA 2LMCB 5IGGA 2RSOA 3VYUA 1U4MA 1A3TA 4WJWA 4S3SA 2K1BA 4X3UA 2F1MA 1EU4A 4A3MB 1DOKA 3C1FA 1IYUA 4QUFA 1EYCA 4C3HG 2WKCA 4BBSB 1S4ZA 3IKJA 1LT6D 5FO8B 4TRDA 4PMCA 4PMBA 5ISRA 5KYIA 1LT4D 1Q1EA 1OXUA 4ZUIA 1STAA 4C3HB 3H3VC 3ND8A 2RDFA 4FXGC 2B2WA 4HR7B 2KQ3A 5ELBA 1TWCB 3WOEA 2AWNA 4FF2A 1HFGA 5COYA 1O7YA 1NAPA 3SK4A 1BO0A 4CGYB 1DXMA 2BOSA 3VYRA 2IJ0A 1I4GA 4DK1A 3NP8A 2EXZA 1TY2A 2EYPA 1SDFA 1TVXA 3MHBA 4XQQA 5M5WB 3HOXB 4H44C 2VNUD 4IFDH 2HDMA 1LLRD 2RA4A 1I6HB 2O5JC 5CMDA 4J1MA 5E4WC 1A3VA 5AFWA 3P7JA 3EFXD 2A6ED 3ERQA 4DK0A 1TU2B 1LTSD 4KN7C 4ULLA 3FPUB 2TMPA 4Y7NB 3DWPA 2SEBD 3VR2A 3MC0B 1PTOH 3A54A 2KJXA 4B08A 3RUZA 1EY4A 4NKLA 2RVLA 1CK1A 4XDXA 2F0TA 4I7ZC 4L6TB 2RDHA 3ZYYX 3H0GB 2PNRC 2QKIC 2K5WA 1KDAA 1WD0A 4OGQC 1PXUA 2EJMA 3NK9A 4RGOS 1XYIA 3L9AX 4WFN3 2NUCA 2B2TA 2ZXRA 2C5CA 3T13A 1U4LA 1LTGD 3JAME 1SE2A 1I50B 3WDNA 2MP1A 1BF4A 3Q0AA 1B4OA 4A3GB 4BY1B 2YU9B 5F2DA 3HKZB 2NTSA 2AQ1B 3LWEA 1OXTA 4CHTB 1BUVT 1D5XC 5IGCA 1IL8A 5CV8A 1IW7C 1W6JA 3A8JE 3VR5A 1Q12A 3TP6A 4PMWA 1TS4A 2IW3A 1HA6A 1NCVA 3PUZA 4A3FB 4PNYA 4C56C 2K01A 3GD7A 5I4DA 1A3UA 1SYDA 1GOZA 1Y1WB 2LS01 3FRPB 4DF7A 4IUTA 1CA6A 1DOMA 3M4YA 3FMCA 1QNKA 2IWHA 3A56A 4DGZA 1SEBD 4KI0A 5CBAE 2EYLA 4RGNA 1RTOA 1SNOA 3NBHA 2RDGA 1CA5A 3MFYA 2XWBB 5CV7A 1BR9A 2WP8J 5T1IA 2F03A 2JA7B 3OHXC 3A7AB 4XYOA 4HMIA 2WAQB 3PUWA 4KKTA 4XT3B 3K6OA 5A2QE 4FXKC 3QG1A 1B1ZA 1VMPA 3MVVA 4CKCA 1E0BA 1EQVA 3K7AB 3M4OB 1GXDC 3DHQA 2F0HA 2D62A 3GTJB 2X6GA 2PMZB 1F9QA 1LABA 1T5XD 3MAQA 3T53B 1LT3D 3T51B 2SNSA 1FGBD 2F0JA 2F3WA 4C3IB 3L7ZC 2D2CC 4KD3A 1B3AA 1BDOA 5CR3A 5FLXE 3KLSA 1PLFA 1I6VC 1CZWA 1STEA 1X3QA 2JXMB 4XXEA 3GP7A 1V43A 3PO2B 3TN2A 4FYDA 1QG7A 1ESRA 3M7GA 5FK9C 3J7AF 4U68A 1MSHA 3KUPA 3KBGA 4KJOA 4LK1C 1ENAA 3NWSA 3BDLA 1L0XB 1B53A 1DYQA 5KNDA 5ELEA 1XTCD 1D5MC 4H7BA 3GTQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA5 A;  1EY0 A;  4IUN A;  4K14 A;  2F0L A;  1SNC A;  4NKL A;  5CV6 A;  5EKK A;  4ZUJ A;  3V2T A;  4MIU A;  5E3F A;  1STY A;  3R3O A;  3NUC A;  3DMU A;  2EYJ A;  4PMC A;  2F0Q A;  4TRD A;  5I9P A;  2EYL A;  4K2L A;  2F0T A;  1EY8 A;  4PMB A;  5ISR A;  3EJI A;  4HMJ A;  4KY5 A;  3SHL A;  1SNO A;  5HUR A;  5CC4 A;  3OMC A;  5CGK A;  3P75 A;  4N9T A;  5KIX A;  1NUC A;  5KYI A;  5CV7 A;  5C5M A;  1KDC A;  2SOB A;  2SNM A;  1TR5 A;  4QF4 A;  4RKB A;  5IGE A;  5E1F A;  4K6D A;  3SR1 A;  1SNP A;  4QMG A;  4ZUI A;  4ME5 A;  4HMI A;  4K5X A;  4NDX A;  3TP8 A;  3SXH A;  1JOK A;  2F0M A;  5C3W A;  1STA A;  4ID6 A;  5IGF A;  1U9R A;  5I9O A;  4N9P A;  1EYA A;  1SYB A;  4E6I A;  2EYM A;  2RDF A;  1KAA A;  2EY5 A;  3P1H A;  5C6A A;  4KV6 A;  3MXP A;  1KDA A;  2F0D A;  5EKL A;  4KHV A;  5KEE A;  2EY1 A;  4I65 A;  3NK9 A;  5HGT A;  5KRU A;  2OXP A;  4F7X A;  3MVV A;  3QOJ A;  2F0V A;  5J22 A;  4NP5 A;  2F0P A;  2KQ3 A;  3D8G A;  5NUC A;  1EZ6 A;  1EQV A;  5DEH A;  1STN A;  2NUC A;  4EQP A;  1STH A;  4NMZ A;  2LKV A;  1STG A;  1EY9 A;  3T13 A;  3DHQ A;  2F0H A;  2PW7 A;  1II3 A;  3SK4 A;  2EY2 A;  2F0G A;  4R8N A;  4F8M A;  5CV5 A;  3T16 A;  5J1Z A;  1JOO A;  5M9O A;  4B9X A;  2M00 A;  1EZ8 A;  2SNS A;  4KTA A;  3TP7 A;  5C3X A;  2F0S A;  1F2Y A;  1EY6 A;  3OMG A;  2F0J A;  2F3W A;  2QDB A;  3NP8 A;  1A2U A;  1SND A;  2HQE A;  4J6H A;  1SYG A;  2EXZ A;  3ERO A;  3TP5 A;  1ENC A;  2EYP A;  4DFA A;  3D6C A;  2O4X A;  1SNM A;  1EYD A;  1EY5 A;  3H6M A;  4HTH A;  1NSN S;  4WOR A;  2F0U A;  2PZU A;  3E5S A;  2EY6 A;  4KY7 A;  4ZQ3 A;  5F2D A;  4IAL A;  4B9W A;  1RKN A;  1TT2 A;  3MEH A;  3MHB A;  4KD3 A;  3BDC A;  4LAA A;  4WRD A;  5CV9 A;  5C4H A;  5K5P A;  5CR3 A;  5CV4 A;  3D4D A;  5IOC A;  1JOR A;  2F0K A;  1A2T A;  3QB3 A;  2F0F A;  1SYE A;  2F0I A;  2EYF A;  2OF1 A;  3ITP A;  1EY7 A;  5C5L A;  4IZ8 A;  4K2K A;  5CV8 A;  5IGC A;  1TQO A;  5IIF A;  1JOQ A;  2KHS A;  2RKS A;  3SK5 A;  2PZW A;  5KGU A;  2EYH A;  4K8I A;  3U9O A;  1IHZ A;  4DU9 A;  3NQT A;  1STB A;  3PMF A;  2PZT A;  2F0O A;  4KD4 A;  3NXW A;  2F0N A;  4K8J A;  3HZX A;  2PQE A;  4J1M A;  4RKL A;  3TP6 A;  1SNQ A;  2PYK A;  3HEJ A;  4K5V A;  3NHH A;  4ODG A;  1A3V A;  5DAU A;  1AEX A;  1KDB A;  5I6Y A;  5J39 A;  5C4Z A;  4EVO A;  3S9W A;  2PW5 A;  1F2M A;  3OSO A;  1KAB A;  4KY6 A;  5IGG A;  3EVQ A;  4KJN A;  4G57 A;  4EQO A;  1F2Z A;  3ERQ A;  3QOL A;  4QB4 A;  5JOB A;  2ENB A;  3TME A;  2EYO A;  2RBM A;  1A3T A;  4EQN A;  4PNY A;  5I6W A;  5JAV A;  3SK8 A;  4S3S A;  5EGT A;  5IGD A;  2F0E A;  2WAC A;  1A3U A;  1SYD A;  4DF7 A;  4K5W A;  3SK6 A;  3OWF A;  3MZ5 A;  3LX0 A;  4YIJ A;  4KJO A;  5IOD A;  1ENA A;  2F0W A;  3BDL A;  5IGB A;  3C1F A;  2F3V A;  2OEO A;  1EYC A;  4DGZ A;  1SYC A;  4OL7 A;  3D4W A;  5KYL A;  3RUZ A;  1SYF A;  3C1E A;  4H7B A;  1EY4 A; 
#chains in the Genus database with same CATH topology
 4L5Q A;  1HNX L;  3BVG A;  1NE3 A;  4LUZ A;  2OT2 A;  2E76 C;  2ZXP A;  3OOC A;  1DCZ A;  3WOF A;  1IBK Q;  1BCP D;  1TKW B;  3K5N A;  4A3E H;  1BNZ A;  5CC4 A;  3OMC A;  3S2D B;  4YY3 Q;  2E8G A;  3FHW A;  2AQ2 B;  1Y14 B;  4RFB A;  3NTH A;  1SNP A;  1ILP A;  4OEM B;  4XTC S;  1AH9 A;  1WTV A;  4DV5 Q;  1VQI A;  1Q8I A;  1VQ9 A;  3EA6 A;  3MXP A;  1PFM A;  3QWN A;  3H15 A;  4C1N K;  2E2J H;  1MGS A;  2AMC B;  3CCV A;  3AQQ A;  1SSO A;  2ICE C;  1S5B D;  1QOH A;  2B2W C;  1HPC A;  1V8Q A;  2PPB C;  2KHJ A;  1YZ6 A;  1GUT A;  1AW7 A;  1XWE A;  3GTO H;  4QGU A;  3A5Z B;  4GZY C;  5G3L D;  3AEV A;  2HCC A;  4DA2 A;  1NR4 A;  1B9N A;  2UXD L;  2L1B A;  2E75 C;  4R4T A;  2B2V C;  3H09 A;  4V19 0;  5C4X B;  1EYD A;  2UUA L;  1ML0 D;  1B7Y B;  3E5S A;  4DR6 Q;  5IWA Q;  5M3M G;  1HQM C;  2OQK A;  2KCC A;  4YCV A;  1VQB A;  3BJU A;  2Q8T A;  1U0L A;  5I9P A;  1QB5 D;  1AP0 A;  2KBN A;  1FGU A;  4A75 A;  2QDL A;  3T1H L;  1GO3 E;  2IPK D;  4HCE A;  2B2Y A;  3QIA A;  4BWG B;  1YIT A;  1UEB A;  1HR0 Q;  3TSS A;  3H91 A;  1TS3 A;  4X3S A;  1SNQ A;  3K7A H;  2LY7 A;  5DAU A;  1K28 A;  2MNA A;  3W2D A;  2Z9H A;  2VQF L;  2G5D A;  3S14 H;  5HGQ A;  2KCN A;  4UP7 A;  4LF9 L;  1A8V A;  1ESF A;  1UNS A;  1ENF A;  2F4I A;  3I90 A;  4R8I A;  4QJF A;  1LTL A;  1JC7 A;  3BU2 A;  2UXC L;  1ICF B;  1HRJ A;  4DR5 L;  2F3V A;  1LTB D;  1EL0 A;  2Z6K C;  4YWL A;  1X55 A;  1VF5 C;  4JBM A;  1BBU A;  1HZA A;  2NVX H;  2BA0 A;  1WVL A;  2JA6 G;  5CBE E;  1Y8N B;  1Q86 C;  1H9K A;  2KEE A;  4GOP B;  1O78 A;  1EUJ A;  5C3E G;  4KY5 A;  1T5E A;  1O7I A;  1HXY D;  1FNU A;  2N88 A;  4KKU A;  1LTR D;  5IGE A;  3CRK C;  2C9O A;  3TQY A;  4DUY Q;  3AU7 A;  5LMN Q;  1Z47 A;  2R7D A;  3E9H A;  3F1Z A;  3G6J B;  1C8C A;  4N9P A;  4E6I A;  2Z8L A;  1HHV A;  1XXG A;  3D6W A;  1AFP A;  1TWF B;  5JPN C;  3CCM A;  3CU7 A;  3IFT A;  3D8G A;  3KF8 A;  4YY3 L;  1ET6 A;  2EPB A;  2HQL A;  2NN6 G;  3R2T A;  4Z9C B;  1O7Z A;  2EY2 A;  1Q1B A;  4FNF A;  3S14 B;  5C3X A;  1B44 D;  2QEJ C;  5K36 G;  1F2Y A;  2JA8 B;  1HA5 A;  4DR6 L;  1G2T A;  4J6H A;  2YTX A;  2G9D A;  4A3F G;  4X62 Q;  2Z4H A;  4IAL A;  3MEH A;  1FJG Q;  2M9V A;  3PUY A;  3RLF A;  2AUJ D;  4JI7 Q;  1FNV A;  2KCM A;  5FOB B;  3U4V A;  4JOI A;  1XMO L;  1WTW A;  4MTN A;  3FEW X;  3SK5 A;  5C0X I;  4L63 B;  4DN4 M;  1LV9 A;  1V1P A;  3T1H Q;  4MNO A;  1A63 A;  3C2P A;  3JC6 6;  4AYB B;  1EWH A;  1DM0 B;  3NEN A;  3S9W A;  2Q8R E;  2PW5 A;  3D0F A;  2DY8 A;  1A6X A;  2VZA A;  5JEA G;  1X65 A;  4OWX B;  4YHH L;  4DR3 L;  4Y52 H;  1S5F D;  1KIX A;  4KHP Q;  2A6E C;  5JAV A;  1VQG A;  2IHE A;  1TWG B;  3LGJ A;  2GN5 A;  3S17 B;  4X62 L;  4RA8 A;  1I94 Q;  3MZ5 A;  1VQE A;  1Z9F A;  2F0W A;  1LT5 D;  2E2D C;  1NNX A;  4JI7 L;  2WAQ G;  4JVZ A;  3W1G A;  5FO9 B;  1SE8 A;  4X64 L;  5LMU Q;  1TWA B;  2K5D A;  4LF4 Q;  2UUB L;  1SXT A;  2KVM A;  1ONL A;  2PNH A;  1WTX A;  4NXN Q;  2CWP A;  2EOT A;  3DMU A;  4CKE A;  1QZH A;  3FKI H;  5C3E H;  3CME A;  1J6Q A;  2NVX B;  3EJI A;  5HUR A;  3CCQ A;  2EDG A;  1SE4 A;  1LO5 D;  3CRL C;  4X65 Q;  2UXB L;  3PF4 A;  4AH6 A;  2CFM A;  1MJE A;  2ICI A;  3BVZ A;  4KMU C;  2F0M A;  3AB9 A;  2G9H D;  5JJK A;  1U9R A;  3K0Y A;  1Q81 C;  2B8F A;  2EY5 A;  2MO1 A;  4KV6 A;  2R3Z A;  1Z7T A;  3KOJ A;  3X3N A;  3K5L A;  2F0D A;  4B3M L;  3I4N B;  1IXR A;  5HGT A;  5KRU A;  2OXP A;  1GUW A;  3F2U A;  3I4O A;  2CH4 W;  2FIN B;  2K4K A;  5AJ3 L;  1Q7Y C;  1STH A;  2NZ1 D;  2UU9 L;  4PV1 C;  2FMC A;  3NBI A;  5BN4 A;  3EQL C;  2HT1 A;  2GVB A;  4C1N I;  5CV5 A;  3PQI A;  3A8K E;  5IYD G;  1PH3 A;  5M9O A;  1XTD A;  2NYZ D;  4KTA A;  5GAH C;  3RMH A;  4BBR H;  5M3F H;  4AQY Q;  4DFA A;  4M8A A;  2QEX A;  4U67 3;  3HOX H;  4HTH A;  3PO2 H;  2JA5 B;  2PZU A;  3I3C A;  5IYC G;  3HOV G;  5JVG 3;  3BDC A;  2QGQ A;  4UAI A;  2NB0 A;  4DR4 L;  5CV4 A;  4DV0 L;  3R93 A;  1X3F A;  1UE1 A;  4IZ8 A;  4ABN A;  4A3M G;  5EBC A;  4JPB W;  1B2T A;  3A8I E;  4LF9 Q;  5KNB A;  4KD4 A;  1ET9 A;  3KBX A;  4M1U B;  1I3Q H;  2PQE A;  1C7Y A;  2ZM6 Q;  4ODG A;  3VR3 A;  2JJQ A;  2N3S A;  3NHH A;  3ONA B;  4DV1 L;  3DWQ A;  2TSS A;  4JI4 Q;  2R92 B;  4A3B B;  2DJG C;  4DAV A;  5IP7 H;  2K05 A;  4KKS A;  4HIM A;  3STB D;  2E2J B;  4QB4 A;  1JJG A;  4A3L G;  3AFQ A;  1GVP A;  3GDE A;  2CHB D;  1M1K C;  4JBW A;  5LL6 S;  3J81 i;  2NWG A;  1FD7 D;  3ND9 A;  5IGB A;  4LF4 L;  2WII B;  1K8G A;  1H9S B;  1V1O A;  3TZD A;  3K8A A;  1IBM Q;  4A3J H;  1KL9 A;  4LNQ A;  1KHI A;  3RN2 A;  3HOW H;  3I4N H;  3HOZ H;  3KLR A;  5CV6 A;  4MIU A;  2ZJR A;  2K28 A;  1STY A;  1BCP B;  2FXQ A;  2K04 A;  4IUP A;  5FLM H;  4K2L A;  2HIX A;  3SHL A;  4DR7 L;  4N9T A;  4RHR A;  2BH2 A;  1YNN D;  1MHW C;  3KF6 A;  4JC0 A;  1TII D;  1EOT A;  2OTL A;  1KLU D;  1BCP C;  1ZYR D;  4GLA C;  3N52 A;  3SXH A;  1CM9 A;  3VR4 A;  1FVI A;  4JI5 L;  3OTO L;  2EY1 A;  2D0O A;  4A3J B;  4NP5 A;  1ZKO A;  2RF4 A;  4MZ9 A;  5BN3 A;  1VQN A;  2UUC Q;  5GQO A;  1RDP D;  1TWG H;  3T16 A;  5J1Z A;  3ZJY C;  1QWY A;  1IBK L;  3HOU G;  4A3D G;  2F0S A;  1WI5 A;  1GM5 A;  4Q5V A;  2VY3 A;  3GTP H;  2QDB A;  5LMU L;  1KTK A;  1AE2 A;  1GUN A;  3CCU A;  2HHH Q;  4A3B H;  2R92 H;  4OHJ A;  4B9W A;  2A69 C;  2E2H B;  2VB2 X;  3NEM A;  1PVO A;  1XMQ L;  3ULL A;  2B2V A;  3DWA A;  4R9W A;  1SLJ A;  3I7F A;  4C3I H;  4IUQ A;  2L15 A;  4F88 A;  3VDY A;  3BZD B;  4HED A;  1J5E L;  2HDL A;  3G4S A;  1Y1V H;  5KGU A;  3DLL A;  4CDE C;  1QNU A;  1R4Q B;  4FP5 D;  3CMA A;  4K8J A;  3HKZ E;  2VQF Q;  3W5O A;  3CHB D;  3HOU B;  2DN8 A;  4DXF A;  1N33 Q;  2JA6 B;  2M2L A;  5I6Y A;  1Q82 C;  1T9H A;  1PV4 A;  2YU9 H;  3K81 C;  1F2M A;  1YNJ C;  1KAB A;  2Y0S G;  1HR0 L;  5IT9 E;  1JR0 D;  1F2Z A;  1GUO A;  4EQ5 A;  2RBM A;  5C44 H;  1ILQ A;  1RCV D;  2K52 A;  3SK6 A;  3H3V I;  4JI2 Q;  1E1O A;  4GLV B;  2L55 A;  3MXN B;  3VR6 A;  1L0W A;  1IBM L;  1SRO A;  1SNC A;  4G7O C;  2F0Q A;  5GRO A;  3X3M A;  3M9B A;  2VQE L;  1NUC A;  2WFW A;  5C5M A;  1B70 B;  2R7F A;  3SE0 A;  2D0P A;  4OO1 I;  3Q23 A;  5JEA H;  4K5X A;  1VQP A;  2N8N A;  4TQU S;  3OTO Q;  5JPM C;  4BY1 G;  4ID6 A;  2R7Z B;  5G3L F;  1XNQ L;  4EX5 A;  1F9R A;  3URY A;  1YVC A;  4A3F H;  4I65 A;  3SGI A;  4JW0 A;  5EPK A;  4POG A;  2E5L L;  2BDN A;  1EZ6 A;  4G7H C;  2PI2 E;  5K36 H;  5DM7 3;  4HSV A;  2DY7 A;  4FF4 A;  4P75 A;  2BE5 C;  3T1Y Q;  4NB3 A;  4X3T A;  2JA8 H;  1IYJ B;  4OIJ A;  3GTL H;  4GN5 A;  3F2D A;  3HRZ C;  1EY6 A;  2B63 B;  5I2X A;  1PYW D;  4AQY L;  3ERO A;  5L37 A;  2R7Z G;  5EPL A;  1EY5 A;  3J7Y W;  2K5V A;  4QCL A;  1EFI D;  2HCI A;  5CV9 A;  3ULJ A;  3IL8 A;  1XPO A;  4LFC Q;  1VQA A;  1IW7 D;  2F0K A;  1PRT B;  1VMC A;  1Q90 A;  1I4R A;  1RTN A;  3J80 E;  3I91 A;  2Z1C A;  1JOQ A;  2KHS A;  5M5Y B;  1NR2 A;  1CUK A;  4R4C A;  4IJL A;  4IN3 A;  4C2M H;  2F0N A;  1SBB B;  3I2Z A;  2E74 C;  4JI1 Q;  1Q46 A;  3BYY B;  1PH6 A;  4A3D H;  1TS5 A;  3S16 H;  3CCS A;  2IX1 A;  1N33 L;  4DV3 Q;  2E2I H;  5EJW A;  4KJN A;  3D3R A;  4G57 A;  3GQB A;  4QQB X;  5IT9 c;  1EQQ A;  2K6A A;  2D5D A;  3CPW A;  1VQ4 A;  1RL2 A;  4KHZ A;  5IOD A;  3J81 c;  2E2H H;  2MGS A;  5FLM G;  4DV0 Q;  1ROD A;  4DR2 L;  3S1R B;  2OEO A;  1DJR D;  1DON A;  5DLQ E;  4OL7 A;  4IOC A;  3RZO B;  1SYF A;  3ICE A;  3AYH B;  2UU9 Q;  1EY0 A;  4JI8 Q;  1BQQ T;  1YNN C;  4ZUJ A;  2R7Z H;  2CKZ B;  5EAY A;  1F9S A;  5TSS A;  2UXC Q;  1EY8 A;  1VDZ A;  4HMJ A;  5ELD A;  2O2L D;  3IRB A;  2PO4 A;  3I73 A;  1JWS D;  3S2D H;  1D1K A;  1JIC A;  3SR1 A;  1PH7 A;  3V96 A;  1X32 A;  1IKL A;  4GOP C;  4ME5 A;  4C2M B;  2FHT A;  4H02 A;  4DR1 L;  3NTK A;  1EWI A;  5IP7 G;  1JB3 A;  1PZI D;  5I9O A;  2UXB Q;  3VYS A;  1SYB A;  1I4Q A;  2EYM A;  3P1H A;  3QR8 A;  5IYB H;  2R93 G;  4IFD J;  3RR5 A;  4DAY A;  1K83 H;  1H9J A;  4OWW B;  4GKK L;  1YHB A;  4X6A H;  3OIQ A;  4TVA B;  2IX3 A;  4A3L H;  4NMZ A;  2NVQ B;  4DK6 C;  1EY9 A;  1MSG A;  4UPA A;  1YBY A;  2VUM G;  4DV4 L;  4ZKC B;  5GAE C;  5C0X J;  2EZV A;  4F8M A;  1Q8K A;  2UUB Q;  1FJG L;  1JOO A;  4JI0 L;  4B3T Q;  2XRS D;  1UE7 A;  1KAW A;  2Z6K A;  1ICW A;  2C35 B;  5CYU A;  3S15 H;  2Q2H A;  3VYT A;  1X3G A;  2B2Y C;  2R93 B;  1WTH A;  1QZG A;  4LAA A;  3RLN A;  2HD3 A;  5M5X H;  1BOS A;  3K80 C;  3I4M H;  3MWY W;  4JI5 Q;  1JOR A;  2KHI A;  1WYD A;  5BN5 A;  1PZJ D;  4UDU C;  2F4V Q;  4GKJ L;  4MHE A;  2KA7 A;  1K73 C;  3H94 A;  2ID0 A;  3PMF A;  4L8J A;  1YNX A;  2EE1 A;  3C46 A;  2PYK A;  2ATW A;  2VL6 A;  3J7A V;  3L3O C;  3J7A 5;  2B39 A;  1R9T H;  5IYD H;  5I2Y A;  2IX0 A;  4ZCK A;  4XT1 B;  4A3E B;  4RH6 A;  4H13 C;  2FJ2 A;  4EQN A;  2Q8I B;  4R4Q A;  4OX9 L;  2WAC A;  3J81 L;  1PFB A;  1YHA A;  4HJ8 A;  1XJV A;  1E2V A;  1XX8 A;  4UY8 C;  2VQE Q;  1PH4 A;  2A73 B;  1RJT A;  3T1Y L;  2WAQ E;  4FXD A;  4HJ7 A;  1KC8 C;  2YTY A;  4HID A;  1HJP A;  3HOY G;  3PUV A;  4IUN A;  2R92 G;  4A3B G;  2LFN A;  5EKK A;  3W1B A;  1KQS A;  1YJW A;  3R3O A;  3E0J A;  2EYJ A;  2B2U A;  1PMR A;  5D14 A;  1SE3 A;  3PIP A;  3PIO 3;  4BBS H;  5A35 A;  5IP9 G;  1PH2 A;  3H3V H;  2JA7 H;  5JEA J;  2BCO A;  2OTJ A;  3P75 A;  1Y8O B;  2H4O A;  1SN8 A;  3E9I A;  3RZD B;  4LJZ C;  1QUQ B;  4IOA A;  3M3Y B;  1HCZ A;  3MA2 B;  3BZC A;  1C4Q A;  4HJ9 A;  2SDF A;  1QVC A;  2K50 A;  5IGF A;  2A68 D;  4LF7 Q;  1RHP A;  3HOY B;  3CCL A;  2BA1 A;  2JEB I;  2GA4 B;  1BXT A;  5DEH A;  4EQP A;  3QO2 A;  4OO1 H;  3GTG B;  3U4Z A;  1CQF A;  4A3C G;  5A2Q L;  1QUQ A;  3I70 A;  1G6P A;  3CW2 C;  1QIL A;  2RSN A;  3C3L A;  1IZ6 A;  1SND A;  1KRT A;  3I4M B;  3GTJ H;  3GTG H;  3DM1 A;  4WOR A;  4DNI A;  2EY6 A;  4J8Q A;  3RN5 A;  3NBH B;  4A3J G;  5K5P A;  5E7N A;  1CFM A;  5H1S E;  2CH4 A;  3GV3 A;  3T4A C;  5BR8 Q;  2H1E A;  1JE5 A;  2XN9 C;  4K2K A;  1TQO A;  2E5L Q;  3F2B A;  1I4H A;  3NQT A;  1QJO A;  2ZTD A;  4H0L C;  4QUC A;  1VQC A;  3A55 A;  1K8A C;  1MKH A;  2NVQ H;  3HP3 A;  3UE0 A;  5ELN A;  4A3D B;  2K32 A;  2JEA I;  1CSP A;  3N6R A;  1HUM A;  3MXU A;  1VQM A;  1PHJ A;  2ENB A;  1LM0 A;  3FKI B;  5C3E B;  5ELC A;  1PA6 A;  4JI6 Q;  3A74 A;  3SK8 A;  1I4P A;  3GO5 A;  3KYH C;  3I55 A;  1K8M A;  2PQA B;  1S5C D;  3OWF A;  4YIJ A;  4CKB A;  1PH9 A;  5IYB G;  2R93 H;  1PZK D;  1R4P B;  4MN3 A;  1SYC A;  4BA2 I;  2B63 H;  3S1M B;  4OO1 G;  4FF3 A;  4QIW B;  1G6Z A;  1N36 Q;  4BY7 H;  1Y1W H;  3PO3 H;  3CPF A;  5D3I B;  2Z4I A;  4DPG A;  2A6H D;  1RD9 D;  2JE6 I;  3UDG A;  4IJH A;  5DM6 3;  2WKD A;  4KHP L;  2XRQ D;  5EBD A;  2NTT A;  3J81 j;  4ILW A;  3KJP A;  1XPR A;  3RZO H;  1UE6 A;  1A0I A;  1KNE A;  1WTR A;  2A74 C;  2JA9 A;  4JCV E;  2B29 A;  1VQO A;  3M4Q A;  1U5K A;  1K83 B;  1D6E C;  4DV5 L;  5LL6 X;  4DV7 Q;  3J7Z C;  1HUN A;  5IYC H;  2JA8 G;  5FLX L;  1H95 A;  4GLX A;  1H9M A;  2HIV A;  4J15 A;  1Y8P B;  3FPP A;  2EQS A;  2LSS A;  4LFA Q;  2IL8 A;  4KHV A;  5KEE A;  1A62 A;  4ZLT F;  2I46 A;  5M5X B;  4O2D A;  4HIO A;  2NN6 I;  1STN A;  3OYY A;  2LKV A;  3BG3 A;  2ZJP A;  2N78 A;  3S15 B;  4I7A A;  4BY1 H;  2NBF A;  4GS3 A;  1LYL A;  2UXD Q;  4R8N A;  2Q2T A;  5JVH 3;  1YHQ A;  2ES2 A;  4PQX A;  2JQO A;  2YYZ A;  2M00 A;  4DXG A;  1AZP A;  3UDF A;  1CTM A;  3TP7 A;  4AYB G;  1VCI A;  1N34 L;  4X66 Q;  1F2L A;  1X56 A;  1SJE D;  1J9O A;  1D5Z C;  2J7Z A;  2O4X A;  1DD2 A;  3UDX A;  1V1Q A;  1E1T A;  2V1C C;  4A3K H;  2QA4 A;  4OIK A;  1RIP A;  2QCP X;  1JE4 A;  2AQ3 B;  1SYE A;  2MJ8 A;  5LMN L;  1XNQ Q;  2RKS A;  1WFQ A;  5GAG C;  1OXS C;  1VQK A;  1STB A;  3TDQ A;  4ME3 A;  2K33 A;  4B3R Q;  1IKM A;  3F2C A;  3CXC A;  1SAP A;  1S3O A;  1SJH D;  1WOC A;  4DUZ L;  1J5E Q;  4LF7 L;  3EBE A;  3Q6S A;  4OXP A;  1D7Q A;  2EYO A;  5IGD A;  1K0S A;  4C3J B;  2VB3 X;  3LX0 A;  2N55 A;  4MTK A;  4A3K B;  1JJC B;  3E0E A;  2FMM A;  1C48 A;  2L9H A;  4LF5 L;  1N36 L;  1WCM G;  2WB1 B;  3S1R H;  2CW0 C;  5KYL A;  3D31 A;  4OON A;  2I5H A;  3EN2 A;  3S2H B;  2KED A;  2QW7 A;  3V2T A;  1F9P A;  3KDF A;  4LF8 Q;  3MEF A;  2B2T C;  2EJG C;  1PTO D;  2L12 A;  4CJ0 B;  2L11 A;  1X9N A;  5KIX A;  2AWO A;  2SOB A;  4OX9 Q;  4A3K G;  3G71 A;  3SEB A;  4CJ2 C;  3TP8 A;  4ALP A;  3KK7 A;  2FFK B;  1DZ1 A;  3GTK B;  5D65 A;  2DNE A;  3CD6 A;  3HOV B;  1SR3 A;  3CQZ H;  2F3I A;  4JV5 L;  2XIW A;  2EVB A;  4F7X A;  2F0V A;  5M5W H;  1KNA A;  2QIL A;  3LNN A;  1STG A;  5C4X H;  3HS0 C;  4LFB Q;  2PW7 A;  4WJ4 A;  3PO3 B;  1B9M A;  1O7L A;  2B3G A;  1EEF D;  1LUZ A;  3U50 C;  3A0J A;  3L2P A;  3CAM A;  4GOP A;  2HQE A;  2V4D A;  1VQ6 A;  1N32 L;  2HUG A;  3H6M A;  3KF6 B;  2NVY B;  3MTS A;  3PGZ A;  4HSP A;  5JJZ A;  5C4J B;  5C4H A;  3TEH B;  1E2W A;  5EPJ A;  5C44 B;  2JYO A;  2RHQ B;  4WJ3 M;  1Z6H A;  3GV6 A;  4DAP A;  4FO2 A;  4DU9 A;  1PFS A;  2F0O A;  2I5M X;  3PO3 G;  3NXW A;  1M8A A;  3RD4 A;  3KDF B;  5EKI A;  3KLS X;  2F4V L;  1AEX A;  4A3G G;  5IT9 L;  1H9R A;  1VQ7 A;  3NTI A;  4RHS A;  2BE5 D;  1HNW L;  4A3I B;  1QCB D;  4HAE A;  1YEZ A;  5I6W A;  4GNX A;  2CW0 D;  4IQZ A;  3UDI A;  1UAP A;  4N8F A;  4O1N A;  1CZG A;  1GHJ A;  4OWT B;  1BBX C;  1CHP D;  1TWH B;  2KCT A;  3K5O A;  3NPP A;  1W3S A;  4RG1 A;  4RWS C;  1MD2 D;  3W3A A;  1BKB A;  1YJ9 A;  4P73 A;  1CQV A;  1PDQ A;  2R6G A;  3GTP B;  1L1O C;  1NMG A;  1VS0 A;  4B3S Q;  2EJF C;  1LAC A;  2KOL A;  4FF1 A;  1E22 A;  1VQJ A;  1YI2 A;  4R1J A;  4A3E G;  3S1M H;  1NBW A;  1PFN A;  1E24 A;  5FLX c;  1O80 A;  2SNM A;  4RKB A;  4XQN A;  3HOZ G;  1ASZ A;  2WIN B;  3JAM i;  3D4R A;  5C3W A;  1SFO H;  1EIH A;  4RGT A;  1PRT F;  4LFA L;  3U58 A;  3BYT B;  1YIJ A;  2CQO A;  1B50 A;  1GJX A;  2F0P A;  1XMO Q;  3JAM c;  4B3S L;  2CCZ A;  1JB7 A;  1K3R A;  4A3M H;  2HHH L;  2L5T A;  1QVG A;  4P74 A;  4G7Z C;  1HTP A;  1YNJ D;  2F0G A;  5E4X A;  1SMY C;  4JI3 Q;  1M90 C;  1JWU D;  2QF7 A;  2JA7 G;  3HOZ B;  2WV6 D;  5C0X H;  3HOW B;  1SYG A;  2OQ0 A;  2Y0S B;  3DXJ C;  1SNM A;  2EIF A;  4LUV A;  4O42 A;  4KY7 A;  4ZQ3 A;  2CQA A;  3FKI G;  4JI2 L;  1PYB A;  1KLG D;  1I4X A;  4JI0 Q;  1I5F A;  4IFD G;  2IY5 B;  2I07 B;  4BBR B;  5M3F B;  1MBY A;  1A2T A;  1A15 A;  2EYF A;  3KLW A;  1EY7 A;  2XVS A;  2A69 D;  1G29 1;  3A7L A;  1G51 A;  1Y69 U;  1UEA B;  4K8I A;  3U9O A;  4JOI C;  3DM3 A;  2JSO A;  1HZ9 A;  5C0X G;  4BBS G;  4PG3 A;  1G2S A;  4GNX C;  1OTC A;  1CT1 D;  3I56 A;  5C4Z A;  2PMZ E;  3PSI A;  1GUS A;  4LMQ D;  2BDO A;  3EVQ A;  3BS1 A;  2XNA C;  3QOL A;  5DNF A;  2NZH A;  3E3X A;  3TBI B;  3I4L A;  2LXJ A;  3I8Z A;  3SVM A;  1U4R A;  2F0E A;  3CCE A;  1SFO B;  4Q0F A;  3IAY A;  4K5W A;  1SMX A;  1FR3 A;  1KRS A;  3K7U C;  1JMC A;  2JP1 A;  2JA5 H;  4ZAI A;  2YTV A;  2PCF B;  4YWK A;  2B8G A;  3G6E A;  1ZYR C;  3CQZ B;  4IO9 A;  3K57 A;  2NZO A;  3R2I A;  4NXM L;  1VF7 A;  1OXV A;  1DOL A;  3NUC A;  2XSC A;  2A19 A;  1MI2 A;  4JK1 C;  4DV6 L;  1TWA H;  3BVM A;  1UE5 A;  4DNR B;  5D3D A;  3FDT A;  3L0O A;  1TR5 A;  4QF4 A;  1FYC A;  5AJ3 Q;  2KEC A;  4K6D A;  1TWF H;  4A93 G;  1TWH H;  4N8X 1;  3CCJ A;  3CC2 A;  4P72 A;  1GKH A;  1I3Q B;  1LTT D;  4NDX A;  1FNW A;  3UI2 A;  1WD1 A;  2X6L A;  4GN3 B;  4BXX H;  1PRT C;  4RGM A;  5C6A A;  1IYV A;  1JQY D;  5EKL A;  2K03 A;  3OW7 A;  4X65 L;  5NUC A;  4XYQ A;  2AUK A;  3BDO A;  1HH2 P;  1SRU A;  3K5M A;  3Q22 A;  3EIV A;  4RCN A;  4X3K A;  1NMF A;  2DJF C;  1X54 A;  3PV0 A;  1ZEQ X;  4B9X A;  1IL2 A;  4A93 B;  1EZ8 A;  1S5E D;  3GTM B;  2IT1 A;  3OWE B;  1V9P A;  2L0C A;  3TRE A;  4IPC A;  3TP5 A;  3J80 c;  1JT8 A;  1F77 A;  1VQ8 A;  4G4K A;  5ELF A;  1JCK B;  1TT2 A;  3UE1 A;  4WRD A;  3T56 B;  1N8R C;  2RQX A;  3D4D A;  1HNW Q;  3QB3 A;  1V1P B;  2ZTE A;  2F0F A;  2F0I A;  2OF1 A;  5EQ0 A;  2NN6 H;  1S40 A;  1VQD A;  2K5H A;  1LTI D;  2E2I B;  4P2C B;  1WCM B;  1D1I A;  1X3P A;  3CCR A;  1XNR L;  1M4V A;  3S16 B;  4K5V A;  1P16 A;  5J39 A;  3Q8D A;  1W2B A;  4EVO A;  2ZJQ A;  3IFD A;  4K0K L;  3OSO A;  1WJJ A;  4KY6 A;  3R8B A;  4A3G H;  5C4X G;  1OO9 B;  4EQO A;  3SDZ A;  5M5Y H;  1BCP F;  5M3M B;  1N32 Q;  3J81 E;  3NWT A;  1I6H H;  3QJY A;  5EGT A;  3V05 A;  3PIO A;  4HCS A;  1N34 Q;  2DUD A;  2NVT H;  3Q24 A;  4KK7 A;  4XIG S;  1CI3 M;  3AMU A;  4JBJ A;  2VW9 A;  4F87 A;  3D4W A;  3C1E A;  1ASY A;  3TRZ A;  4LFB L;  2K7V A;  4L5T A;  1EIY B;  2NVT B;  1QVF A;  1CKO A;  4DV2 L;  1AZQ A;  2A6H C;  5E3F A;  4LF6 Q;  1CKN B;  2AHO B;  3HKS A;  5IY0 A;  2MPM A;  3M7N A;  1HFN A;  5CGK A;  1WTP A;  4IPD A;  4R4O A;  1TY0 A;  3ULP A;  4C3J G;  1IBL Q;  1KDC A;  4IPG A;  2DNC A;  4ZK9 B;  4QL5 A;  1EQR A;  3DEP A;  4QMG A;  1UUP A;  3A5U A;  4LWC A;  4ZYS A;  2VS1 A;  1GUG A;  2K5Q A;  3P20 A;  4C3H H;  2XWJ B;  2N49 A;  4V0B A;  1KAA A;  3K59 A;  2XTI A;  2O5I C;  3HKZ G;  1EU3 A;  3NE5 B;  3QOJ A;  4IPH A;  3F8T A;  4IUR A;  4UP9 A;  4DUY L;  1K8O A;  3HFZ B;  1HTL D;  4GN4 B;  3PUX A;  4IFD I;  4Y7N H;  1HZB A;  3JAM L;  4POF A;  1II3 A;  3OIP A;  1ZXT A;  4HJA A;  5M3M H;  1OXX K;  3MFG A;  1PRT D;  1JJ2 A;  2R61 A;  1TXY A;  1EEI D;  3H0G G;  4CDC C;  1XPU A;  1D2B A;  4TSS A;  1H9S A;  2KUM A;  2X69 A;  4AYB E;  4HJ5 A;  4ZRZ A;  2K75 A;  2CVR A;  2F0U A;  4BA1 I;  1RKN A;  1PTO F;  2GVA A;  3G7L A;  3HGB A;  4IUU A;  1WCM H;  4JBK A;  5IOC A;  1D8L A;  3OPO A;  4PZ6 A;  4NW2 A;  5T1G A;  4A4I A;  5IIF A;  3GTL B;  3GTO B;  4DR1 Q;  2EYH A;  1W6K A;  5FO7 B;  1IHZ A;  3LWU A;  2MUY A;  4DV3 L;  5FKA C;  2ZXO A;  4ZKB B;  3CF5 A;  4PZ7 A;  4RCO A;  1KDB A;  3TZU A;  3NSW A;  4XQJ A;  1L0Y B;  4FVM A;  3AFP A;  2D9U A;  1Y1V B;  3TME A;  5JOB A;  2L4N A;  2MFI A;  4DAM A;  4A93 H;  3M4P A;  1G8Z D;  1WTQ A;  1J8I A;  2A68 C;  1E3P A;  4KLK A;  1B8A A;  1X3E A;  3MXG A;  4NPS A;  1MJC A;  4BS9 A;  1WTO A;  2J4X A;  3DUZ A;  1G91 A;  1EIG A;  2ZT9 C;  4TKO B;  3M85 A;  2VUM H;  5KNC A;  1VQF A;  1PTO B;  4IUV A;  5COR A;  3TS0 A;  3DEO A;  1VQ5 A;  1JWM D;  1AE3 A;  3K58 A;  3VA5 A;  4K14 A;  2F0L A;  4HN7 A;  1HZC A;  3E6Z X;  1HQR D;  3J80 L;  1EWC A;  4BY7 B;  4RAU C;  4A3I G;  3CKI B;  2Y0S E;  3M4O H;  1AN8 A;  3RZD H;  3U9S A;  4AIM A;  1Y1W G;  5GAD C;  5E1F A;  4JV5 Q;  3S1N B;  3ER0 A;  1S5D D;  1Q3L A;  1JOK A;  4C3I G;  4DR7 Q;  3I4M G;  1LTA D;  4YWM A;  1CSQ A;  3I72 A;  1EIF A;  1EYA A;  1GHK A;  1SMY D;  1QE6 A;  4CJ1 B;  3FVQ A;  4K6L A;  3NQI A;  5J22 A;  4NXM Q;  5LHY 1;  3PIP 3;  3HOU H;  3NEL A;  1TS2 A;  1IBL L;  5JJI A;  2A5H A;  2RHS B;  3HG9 A;  1N9W A;  3OW2 A;  4DNT B;  3ERS X;  4KN4 C;  1PTO C;  2MHV A;  3OMG A;  1CKN A;  1A2U A;  4UP8 A;  1ENC A;  1PH8 A;  2B2U C;  3MXN A;  3D6C A;  1R9T B;  3VA7 A;  1NSN S;  4JI3 L;  2VUM B;  1HNZ Q;  3S1Q B;  2F52 A;  3K0X A;  4K0K Q;  4JI4 L;  4CBV A;  4DV4 Q;  3ITP A;  5C5L A;  4EGV A;  2J0T D;  2PZW A;  1CHQ D;  3O13 A;  5JJL A;  4L5S A;  2VXW A;  2PZT A;  4RKL A;  3HZX A;  1RF2 D;  3RNU A;  3HEJ A;  3S24 A;  2K5N A;  3HOW G;  1E2Z A;  4DR4 Q;  2AKW B;  1U4P A;  2ZTC A;  1EQT A;  2EXD A;  2LMC B;  5IGG A;  2RSO A;  2PQA A;  1GD7 A;  2H5X A;  3VYU A;  1U4M A;  1A3T A;  4WJW A;  3G48 A;  4S3S A;  2K1B A;  3STB C;  4X3U A;  2F1M A;  2MO0 A;  1EU4 A;  4A3M B;  4DR2 Q;  1DOK A;  3C1F A;  1IYU A;  4QUF A;  1EYC A;  3FP9 A;  4C3H G;  4LW1 A;  2WKC A;  4BBS B;  1S4Z A;  4JI8 L;  3HOV H;  3IKJ A;  4CDD C;  3PO2 G;  1LT6 D;  4DR5 Q;  5FO8 B;  4TRD A;  4PMC A;  1DGS A;  4A3I H;  4PMB A;  5ISR A;  3CC7 A;  5KYI A;  1LT4 D;  1YJN A;  4P71 A;  1Q1E A;  1OXU A;  4ZUI A;  1PH5 A;  1STA A;  4C3H B;  3H3V C;  5FJ8 H;  3ND8 A;  3S2H H;  1EOV A;  2RDF A;  3KJO A;  4FXG C;  1NJI C;  3HOX G;  2B2W A;  4HR7 B;  4HIK A;  2KQ3 A;  5ELB A;  4L5R C;  1TWC B;  3WOE A;  2AWN A;  4LFC L;  4FF2 A;  1HFG A;  1KD1 C;  5COY A;  1O7Y A;  1NAP A;  3SK4 A;  1BO0 A;  4PZ8 A;  1L1O A;  4CGY B;  1DXM A;  2BOS A;  3VYR A;  2IJ0 A;  5IWA L;  1I4G A;  4DK1 A;  3NP8 A;  2EXZ A;  1L1O B;  1TY2 A;  2EYP A;  2DGY A;  1SDF A;  1TVX A;  2Q2I A;  4DK3 C;  3MHB A;  4XQQ A;  2ALY B;  5M5W B;  3HOX B;  4H44 C;  2ASB A;  2VNU D;  4IFD H;  2HDM A;  4GNX B;  3S17 H;  1LLR D;  3TS2 A;  2RA4 A;  1I6H B;  2O5J C;  3GTK H;  5CMD A;  2WB1 G;  4J1M A;  5E4W C;  1A3V A;  2NVY H;  2ZM6 L;  3RLO A;  4DV1 Q;  5AFW A;  2IHF A;  1VQH A;  3P7J A;  1XNR Q;  3EFX D;  2A6E D;  3ERQ A;  1TU2 B;  4DK0 A;  1LTS D;  4KN7 C;  4RMF A;  2XGT A;  4ULL A;  1EYG A;  3FPU B;  5BR8 L;  2TMP A;  2JK8 A;  3H0G H;  4Y7N B;  2KEN A;  3DWP A;  2SEB D;  1XMQ Q;  4B3T L;  3VR2 A;  3MC0 B;  1PTO H;  1UWV A;  3A54 A;  2KJX A;  4B08 A;  3RUZ A;  4DKA C;  3KFU A;  1EY4 A;  1L2F A;  1HNX Q;  4NKL A;  2RVL A;  1CK1 A;  4XDX A;  4C3J H;  2A8V A;  1KXL A;  1K0R A;  1PH1 A;  1K3B C;  4LF5 Q;  2F0T A;  2RCN A;  4I7Z C;  1CKM A;  4L6T B;  2K14 A;  2RDH A;  3ZYY X;  2P5Z X;  2LXK A;  2WB1 E;  5HY6 A;  4DUZ Q;  3H0G B;  2PNR C;  3BZK A;  2QKI C;  2A1A A;  2K5W A;  2I0Q A;  1KDA A;  1WD0 A;  5IE8 A;  4OGQ C;  1PXU A;  4JI1 L;  2EJM A;  3NK9 A;  4RGO S;  1XYI A;  5C44 G;  3L9A X;  4WFN 3;  2NUC A;  2B2T A;  4LUO A;  2ZXR A;  2C5C A;  3T13 A;  1U4L A;  2MQH A;  1LTG D;  3JAM E;  4DAY B;  3B6Y A;  4LF6 L;  1SE2 A;  1I50 B;  2UUC L;  4NXN L;  3WDN A;  1I50 H;  2MP1 A;  1BF4 A;  3Q0A A;  1B4O A;  4QY7 A;  4A3G B;  5FJ8 G;  3PCO B;  4BY1 B;  2YU9 B;  2JA6 H;  1Y1V G;  5F2D A;  3HKZ B;  2NTS A;  2AQ1 B;  1HR0 W;  3LWE A;  1OXT A;  4CHT B;  2Z0S A;  4B3M Q;  1BUV T;  1D5X C;  4A76 A;  5IGC A;  1IL8 A;  5CV8 A;  4JG2 A;  1IW7 C;  3PF5 A;  1W6J A;  3A8J E;  1C0A A;  3VR5 A;  1Q12 A;  2YV5 A;  4JYA Q;  3TP6 A;  4YHH Q;  4DR3 Q;  1TWC H;  4PMW A;  1TS4 A;  2Z6B A;  2IW3 A;  2B63 G;  1HA6 A;  1NCV A;  2PI2 A;  3PUZ A;  4BY7 G;  4A3F B;  4PNY A;  4C56 C;  4YCW A;  4O0A A;  5J3B A;  2K01 A;  3GD7 A;  5I4D A;  1A3U A;  1GOZ A;  1SYD A;  2LS0 1;  3FRP B;  1Y1W B;  4X64 Q;  5ELO A;  4DF7 A;  4IUT A;  1CA6 A;  1VQL A;  1DOM A;  3M4Y A;  4BXX G;  3FMC A;  1QNK A;  1NY4 A;  1P8L A;  2IWH A;  3KF8 B;  4LF8 L;  3A56 A;  4DGZ A;  1I94 L;  1SEB D;  4CDF C;  2UUA Q;  3I4N G;  2OCE A;  1B3Q A;  3WWV A;  1K9M C;  4KI0 A;  4OEL B;  5CBA E;  2EYL A;  3GTQ H;  4RGN A;  1RTO A;  1SNO A;  3NBH A;  2RDG A;  4JI6 L;  1CA5 A;  1BBW A;  2XWB B;  3MFY A;  5CV7 A;  1BR9 A;  2WP8 J;  5T1I A;  2F03 A;  4GKK Q;  2JA7 B;  4DV7 L;  3OHX C;  3A7A B;  4XYO A;  1S72 A;  4HMI A;  4QIW E;  2WAQ B;  4GKJ Q;  3PUW A;  4KKT A;  4B3R L;  4XT3 B;  3S1N H;  3K6O A;  5A2Q E;  4FXK C;  1EFW A;  3QG1 A;  1B1Z A;  1VMP A;  3MVV A;  1BVS A;  4CKC A;  1E0B A;  4BBR G;  5M3F G;  1EQV A;  1PYS B;  3K7A B;  3M4O B;  4DV6 Q;  1GXD C;  2Q2U A;  3CC4 A;  3DHQ A;  2F0H A;  2D62 A;  3GTJ B;  2X6G A;  2PMZ B;  2OWO A;  1FL0 A;  1F9Q A;  4A3C H;  1LAB A;  1T5X D;  3MAQ A;  3GTM H;  3T53 B;  1LT3 D;  3T51 B;  2SNS A;  5IP9 H;  2I5L X;  1FGB D;  2F0J A;  2F3W A;  4X66 L;  4C3I B;  3L7Z C;  2D2C C;  1NTG A;  3CP0 A;  4KD3 A;  1B3A A;  1E7Z A;  1MIU A;  1BDO A;  5CR3 A;  5FLX E;  3KLS A;  2JN4 A;  1PLF A;  4UHV A;  1I6V C;  4FDB A;  4APV A;  1CZW A;  5LMN W;  2RCF A;  4JYA L;  3HOY H;  1STE A;  1X3Q A;  2JXM B;  4XXE A;  3GP7 A;  1V43 A;  3M3Y H;  3PO2 B;  3TN2 A;  1C9O A;  4FYD A;  1QG7 A;  4R4I A;  2JA5 G;  1ESR A;  1X6O A;  3M7G A;  5FK9 C;  2BH8 A;  3J7A F;  4U68 A;  2CWA A;  1MSH A;  3KUP A;  3J80 i;  4LK1 C;  3KBG A;  4KJO A;  1ENA A;  4YCU A;  3NWS A;  3BDL A;  5C4J H;  3S1Q H;  1HNZ L;  1L0X B;  1B53 A;  1DYQ A;  5KND A;  5ELE A;  1XTC D;  4DV2 Q;  1D5M C;  4H7B A;  3GTQ B; 
#chains in the Genus database with same CATH homology
 3BVG A;  2OT2 A;  2E76 C;  2ZXP A;  3OOC A;  1DCZ A;  3WOF A;  1BCP D;  1TKW B;  3K5N A;  1BNZ A;  5CC4 A;  3OMC A;  3S2D B;  2AQ2 B;  4RFB A;  3NTH A;  1SNP A;  1ILP A;  4XTC S;  1WTV A;  1Q8I A;  3EA6 A;  3MXP A;  1PFM A;  3QWN A;  4C1N K;  1MGS A;  1SSO A;  2ICE C;  1S5B D;  1QOH A;  2B2W C;  1HPC A;  1V8Q A;  2PPB C;  1GUT A;  1AW7 A;  1XWE A;  4GZY C;  5G3L D;  2HCC A;  4DA2 A;  1NR4 A;  1B9N A;  2L1B A;  2E75 C;  2B2V C;  3H09 A;  4V19 0;  5C4X B;  1EYD A;  1ML0 D;  3E5S A;  1HQM C;  2KCC A;  2Q8T A;  5I9P A;  1QB5 D;  1AP0 A;  2IPK D;  4HCE A;  2B2Y A;  3QIA A;  4BWG B;  3TSS A;  3H91 A;  1TS3 A;  4X3S A;  1SNQ A;  2LY7 A;  5DAU A;  3W2D A;  2KCN A;  1ESF A;  1UNS A;  1ENF A;  2F4I A;  3I90 A;  4R8I A;  1JC7 A;  1HRJ A;  2F3V A;  1LTB D;  1EL0 A;  1VF5 C;  2BA0 A;  1WVL A;  5CBE E;  1Y8N B;  1H9K A;  2KEE A;  1O78 A;  4KY5 A;  1T5E A;  1HXY D;  1FNU A;  2N88 A;  4KKU A;  1LTR D;  5IGE A;  3CRK C;  2C9O A;  3AU7 A;  1Z47 A;  3G6J B;  1C8C A;  4N9P A;  4E6I A;  2Z8L A;  1HHV A;  1XXG A;  3D6W A;  1AFP A;  1TWF B;  5JPN C;  3CU7 A;  3IFT A;  3D8G A;  3KF8 A;  1ET6 A;  2EPB A;  2NN6 G;  3R2T A;  4Z9C B;  1O7Z A;  2EY2 A;  1Q1B A;  4FNF A;  3S14 B;  5C3X A;  1B44 D;  2QEJ C;  5K36 G;  1F2Y A;  2JA8 B;  1HA5 A;  1G2T A;  4J6H A;  2G9D A;  2Z4H A;  4IAL A;  3MEH A;  2M9V A;  3PUY A;  3RLF A;  2AUJ D;  1FNV A;  5FOB B;  1WTW A;  3SK5 A;  3FEW X;  5C0X I;  4L63 B;  4DN4 M;  1LV9 A;  1V1P A;  3C2P A;  4AYB B;  1EWH A;  1DM0 B;  3S9W A;  2Q8R E;  2PW5 A;  1A6X A;  2DY8 A;  5JEA G;  1S5F D;  2A6E C;  5JAV A;  1TWG B;  3S17 B;  4RA8 A;  3MZ5 A;  2F0W A;  1LT5 D;  2E2D C;  5FO9 B;  1TWA B;  2K5D A;  1SXT A;  2KVM A;  1ONL A;  1WTX A;  2EOT A;  3DMU A;  4CKE A;  2NVX B;  3EJI A;  5HUR A;  2EDG A;  1SE4 A;  1LO5 D;  3CRL C;  2ICI A;  3BVZ A;  4KMU C;  2F0M A;  3AB9 A;  2G9H D;  1U9R A;  3K0Y A;  2B8F A;  3K5L A;  2EY5 A;  2R3Z A;  4KV6 A;  3I4N B;  1Z7T A;  3X3N A;  2F0D A;  5HGT A;  5KRU A;  2OXP A;  1GUW A;  3F2U A;  2FIN B;  1STH A;  2NZ1 D;  4PV1 C;  2FMC A;  3NBI A;  5BN4 A;  3EQL C;  4C1N I;  5CV5 A;  3A8K E;  5M9O A;  2NYZ D;  4KTA A;  3RMH A;  4DFA A;  4M8A A;  4U67 3;  4HTH A;  2JA5 B;  2PZU A;  3I3C A;  5JVG 3;  3BDC A;  4UAI A;  2NB0 A;  5CV4 A;  3R93 A;  4IZ8 A;  4ABN A;  5EBC A;  1B2T A;  3A8I E;  5KNB A;  4KD4 A;  1ET9 A;  3KBX A;  4M1U B;  2PQE A;  4ODG A;  3VR3 A;  3NHH A;  3ONA B;  3DWQ A;  2TSS A;  2R92 B;  4A3B B;  4DAV A;  2K05 A;  4KKS A;  2E2J B;  4QB4 A;  2CHB D;  4JBW A;  5LL6 S;  2NWG A;  1FD7 D;  5IGB A;  3ND9 A;  2WII B;  1H9S B;  1V1O A;  3TZD A;  3KLR A;  5CV6 A;  4MIU A;  2K28 A;  1STY A;  1BCP B;  2K04 A;  4IUP A;  4K2L A;  3SHL A;  4N9T A;  4RHR A;  1YNN D;  1TII D;  1EOT A;  1KLU D;  1BCP C;  1ZYR D;  3N52 A;  3SXH A;  1CM9 A;  3VR4 A;  2EY1 A;  4A3J B;  4NP5 A;  1ZKO A;  5BN3 A;  1RDP D;  3T16 A;  5J1Z A;  1QWY A;  2F0S A;  4Q5V A;  2QDB A;  1KTK A;  1GUN A;  4OHJ A;  4B9W A;  2A69 C;  2E2H B;  2VB2 X;  2B2V A;  3DWA A;  4R9W A;  4IUQ A;  4F88 A;  3BZD B;  4HED A;  2HDL A;  5KGU A;  1QNU A;  1R4Q B;  4FP5 D;  4K8J A;  3CHB D;  3HOU B;  2DN8 A;  4DXF A;  2JA6 B;  2M2L A;  5I6Y A;  1F2M A;  1YNJ C;  1KAB A;  5IT9 E;  1JR0 D;  1F2Z A;  1GUO A;  2RBM A;  1ILQ A;  1RCV D;  3SK6 A;  2L55 A;  3VR6 A;  1SNC A;  4G7O C;  2F0Q A;  3X3M A;  1NUC A;  5C5M A;  3SE0 A;  4OO1 I;  3Q23 A;  5JEA H;  4K5X A;  4TQU S;  5JPM C;  4ID6 A;  2R7Z B;  5G3L F;  1F9R A;  3URY A;  4I65 A;  5EPK A;  2BDN A;  1EZ6 A;  4G7H C;  5K36 H;  5DM7 3;  4HSV A;  2DY7 A;  4FF4 A;  2BE5 C;  4X3T A;  4OIJ A;  3HRZ C;  1EY6 A;  2B63 B;  5I2X A;  1PYW D;  3ERO A;  5EPL A;  1EY5 A;  3J7Y W;  4QCL A;  1EFI D;  2HCI A;  5CV9 A;  3IL8 A;  1IW7 D;  2F0K A;  1PRT B;  1VMC A;  1Q90 A;  1I4R A;  1RTN A;  3J80 E;  3I91 A;  2Z1C A;  1JOQ A;  2KHS A;  5M5Y B;  1NR2 A;  4IN3 A;  2F0N A;  1SBB B;  2E74 C;  3BYY B;  1TS5 A;  2IX1 A;  5EJW A;  4KJN A;  3D3R A;  4G57 A;  3GQB A;  2K6A A;  2D5D A;  4KHZ A;  5IOD A;  2MGS A;  1ROD A;  3S1R B;  2OEO A;  1DJR D;  1DON A;  4OL7 A;  3RZO B;  1SYF A;  1EY0 A;  1BQQ T;  1YNN C;  4ZUJ A;  1F9S A;  5TSS A;  1EY8 A;  1VDZ A;  4HMJ A;  5ELD A;  2O2L D;  2PO4 A;  3I73 A;  1JWS D;  1D1K A;  1JIC A;  3SR1 A;  3V96 A;  1X32 A;  1IKL A;  4ME5 A;  4C2M B;  2FHT A;  3NTK A;  1JB3 A;  1PZI D;  5I9O A;  3VYS A;  1SYB A;  1I4Q A;  2EYM A;  3P1H A;  4IFD J;  4DAY A;  1H9J A;  3OIQ A;  2IX3 A;  4NMZ A;  2NVQ B;  1EY9 A;  1MSG A;  4ZKC B;  5C0X J;  2EZV A;  4F8M A;  1JOO A;  2XRS D;  1ICW A;  5CYU A;  3VYT A;  2B2Y C;  2R93 B;  4LAA A;  1BOS A;  3MWY W;  1JOR A;  5BN5 A;  1PZJ D;  4UDU C;  4MHE A;  2KA7 A;  3H94 A;  2ID0 A;  3PMF A;  4L8J A;  2EE1 A;  3C46 A;  2PYK A;  3J7A V;  3L3O C;  2B39 A;  5I2Y A;  2IX0 A;  4XT1 B;  4A3E B;  4RH6 A;  4H13 C;  2FJ2 A;  4EQN A;  2Q8I B;  2WAC A;  3J81 L;  1PFB A;  1E2V A;  1XX8 A;  2A73 B;  1RJT A;  4FXD A;  3PUV A;  4IUN A;  2LFN A;  5EKK A;  3R3O A;  3E0J A;  2EYJ A;  2B2U A;  1PMR A;  5D14 A;  1SE3 A;  3PIO 3;  5A35 A;  5JEA J;  2BCO A;  3P75 A;  1Y8O B;  2H4O A;  3RZD B;  4LJZ C;  3M3Y B;  1HCZ A;  3MA2 B;  1C4Q A;  2SDF A;  5IGF A;  2A68 D;  1RHP A;  3HOY B;  2BA1 A;  2JEB I;  2GA4 B;  1BXT A;  5DEH A;  4EQP A;  3QO2 A;  4OO1 H;  3GTG B;  1CQF A;  5A2Q L;  3I70 A;  1QIL A;  2RSN A;  3C3L A;  1SND A;  3I4M B;  3DM1 A;  4WOR A;  2EY6 A;  4J8Q A;  5K5P A;  1CFM A;  3GV3 A;  3T4A C;  2H1E A;  2XN9 C;  4K2K A;  1TQO A;  1I4H A;  3NQT A;  1QJO A;  4H0L C;  4QUC A;  3A55 A;  3HP3 A;  4A3D B;  2K32 A;  2JEA I;  3N6R A;  1HUM A;  3MXU A;  2ENB A;  5C3E B;  3FKI B;  5ELC A;  3SK8 A;  1I4P A;  3GO5 A;  1K8M A;  1S5C D;  3OWF A;  4YIJ A;  4CKB A;  1PZK D;  1R4P B;  4MN3 A;  1SYC A;  4BA2 I;  3S1M B;  4OO1 G;  4FF3 A;  4QIW B;  1G6Z A;  5D3I B;  2Z4I A;  2A6H D;  1RD9 D;  2JE6 I;  5DM6 3;  2WKD A;  2XRQ D;  5EBD A;  2NTT A;  4ILW A;  1KNE A;  1WTR A;  2A74 C;  1K83 B;  1D6E C;  5LL6 X;  1HUN A;  5FLX L;  1H9M A;  1Y8P B;  3FPP A;  2IL8 A;  4KHV A;  5KEE A;  4ZLT F;  2I46 A;  5M5X B;  2NN6 I;  1STN A;  2LKV A;  3BG3 A;  3S15 B;  2NBF A;  4R8N A;  5JVH 3;  4PQX A;  4DXG A;  2YYZ A;  2M00 A;  1AZP A;  1CTM A;  3TP7 A;  1VCI A;  1F2L A;  1SJE D;  1J9O A;  1D5Z C;  2J7Z A;  2O4X A;  1DD2 A;  4OIK A;  2QCP X;  1JE4 A;  2AQ3 B;  1SYE A;  2MJ8 A;  2RKS A;  1OXS C;  1STB A;  3TDQ A;  2K33 A;  1IKM A;  1SAP A;  1SJH D;  3Q6S A;  2EYO A;  5IGD A;  4C3J B;  2VB3 X;  3LX0 A;  2N55 A;  4A3K B;  2FMM A;  1C48 A;  2L9H A;  2WB1 B;  2CW0 C;  5KYL A;  3D31 A;  3S2H B;  2KED A;  3V2T A;  1F9P A;  2B2T C;  2EJG C;  1PTO D;  2L12 A;  4CJ0 B;  2L11 A;  5KIX A;  2AWO A;  2SOB A;  3SEB A;  4CJ2 C;  3TP8 A;  3KK7 A;  2FFK B;  1DZ1 A;  3GTK B;  5D65 A;  2DNE A;  3HOV B;  2XIW A;  2EVB A;  4F7X A;  2F0V A;  1KNA A;  2QIL A;  3LNN A;  1STG A;  3HS0 C;  2PW7 A;  3PO3 B;  1B9M A;  1O7L A;  1EEF D;  2HQE A;  2V4D A;  2HUG A;  3H6M A;  2NVY B;  3MTS A;  4HSP A;  5JJZ A;  5C4J B;  5C4H A;  1E2W A;  5EPJ A;  5C44 B;  2JYO A;  1Z6H A;  3GV6 A;  4DAP A;  4FO2 A;  4DU9 A;  2F0O A;  3NXW A;  1M8A A;  3RD4 A;  5EKI A;  3KLS X;  1AEX A;  5IT9 L;  1H9R A;  3NTI A;  4RHS A;  2BE5 D;  4A3I B;  1QCB D;  4HAE A;  5I6W A;  2CW0 D;  4IQZ A;  1UAP A;  4O1N A;  1CZG A;  1GHJ A;  1BBX C;  1CHP D;  1TWH B;  3K5O A;  3NPP A;  4RWS C;  1MD2 D;  3W3A A;  1CQV A;  1PDQ A;  2R6G A;  3GTP B;  2EJF C;  1LAC A;  2KOL A;  4FF1 A;  1PFN A;  1O80 A;  2SNM A;  4RKB A;  4XQN A;  2WIN B;  3D4R A;  5C3W A;  1EIH A;  4RGT A;  1PRT F;  3BYT B;  1B50 A;  1GJX A;  2F0P A;  2L5T A;  4G7Z C;  1HTP A;  1YNJ D;  2F0G A;  5E4X A;  1SMY C;  1JWU D;  2QF7 A;  3HOZ B;  2WV6 D;  5C0X H;  3HOW B;  1SYG A;  2Y0S B;  3DXJ C;  1SNM A;  4O42 A;  4KY7 A;  4ZQ3 A;  2CQA A;  1KLG D;  1I4X A;  4IFD G;  2I07 B;  4BBR B;  5M3F B;  1MBY A;  1A2T A;  1A15 A;  2EYF A;  1EY7 A;  2XVS A;  2A69 D;  1G29 1;  3A7L A;  1Y69 U;  1UEA B;  4K8I A;  3U9O A;  2JSO A;  5C0X G;  1G2S A;  1CT1 D;  5C4Z A;  1GUS A;  4LMQ D;  2BDO A;  3EVQ A;  3BS1 A;  2XNA C;  3QOL A;  5DNF A;  3TBI B;  3I4L A;  3I8Z A;  3SVM A;  1U4R A;  2F0E A;  1SFO B;  4Q0F A;  3IAY A;  4K5W A;  1FR3 A;  2JP1 A;  4ZAI A;  2PCF B;  2B8G A;  1ZYR C;  3CQZ B;  3K57 A;  3R2I A;  1VF7 A;  1OXV A;  1DOL A;  3NUC A;  2XSC A;  1MI2 A;  4JK1 C;  3BVM A;  4DNR B;  5D3D A;  3FDT A;  1TR5 A;  4QF4 A;  1FYC A;  2KEC A;  4K6D A;  1I3Q B;  1LTT D;  4NDX A;  1FNW A;  3UI2 A;  1WD1 A;  2X6L A;  1PRT C;  4RGM A;  5C6A A;  1IYV A;  1JQY D;  5EKL A;  2K03 A;  3OW7 A;  5NUC A;  4XYQ A;  2AUK A;  3BDO A;  3K5M A;  3Q22 A;  4RCN A;  4X3K A;  3PV0 A;  1ZEQ X;  4B9X A;  4A93 B;  1EZ8 A;  1S5E D;  3GTM B;  2IT1 A;  3OWE B;  2L0C A;  3TP5 A;  1F77 A;  4G4K A;  5ELF A;  1JCK B;  1TT2 A;  4WRD A;  3T56 B;  2RQX A;  3D4D A;  3QB3 A;  1V1P B;  5EQ0 A;  2F0F A;  2F0I A;  2OF1 A;  2NN6 H;  1LTI D;  2E2I B;  4P2C B;  1WCM B;  1D1I A;  1X3P A;  1M4V A;  3S16 B;  4K5V A;  5J39 A;  4EVO A;  3IFD A;  3OSO A;  4KY6 A;  3R8B A;  1OO9 B;  4EQO A;  3SDZ A;  1BCP F;  5M3M B;  3J81 E;  3NWT A;  3QJY A;  5EGT A;  3V05 A;  4HCS A;  3Q24 A;  4KK7 A;  4XIG S;  1CI3 M;  3AMU A;  4F87 A;  3D4W A;  3C1E A;  2K7V A;  2NVT B;  1AZQ A;  2A6H C;  5E3F A;  2MPM A;  3M7N A;  1HFN A;  5CGK A;  1WTP A;  1TY0 A;  4C3J G;  1KDC A;  2DNC A;  4ZK9 B;  3DEP A;  4QMG A;  1UUP A;  4ZYS A;  1GUG A;  2K5Q A;  3P20 A;  2XWJ B;  4V0B A;  1KAA A;  3K59 A;  2O5I C;  1EU3 A;  3NE5 B;  3QOJ A;  4IUR A;  1K8O A;  1HTL D;  3PUX A;  4IFD I;  3JAM L;  1II3 A;  3OIP A;  1ZXT A;  1OXX K;  3MFG A;  1PRT D;  2R61 A;  1EEI D;  1D2B A;  4TSS A;  1H9S A;  2KUM A;  2X69 A;  4ZRZ A;  2CVR A;  2F0U A;  4BA1 I;  1RKN A;  1PTO F;  3G7L A;  4IUU A;  3HGB A;  5IOC A;  3OPO A;  4NW2 A;  5T1G A;  5IIF A;  3GTL B;  3GTO B;  2EYH A;  1W6K A;  5FO7 B;  1IHZ A;  3LWU A;  2MUY A;  5FKA C;  2ZXO A;  4ZKB B;  4RCO A;  1KDB A;  3TZU A;  3NSW A;  4XQJ A;  1L0Y B;  4FVM A;  2D9U A;  1Y1V B;  3TME A;  5JOB A;  2L4N A;  1G8Z D;  1WTQ A;  1J8I A;  2A68 C;  3MXG A;  4BS9 A;  1WTO A;  2J4X A;  3DUZ A;  1G91 A;  1EIG A;  2ZT9 C;  4TKO B;  3M85 A;  5KNC A;  1PTO B;  4IUV A;  5COR A;  3DEO A;  1JWM D;  3K58 A;  3VA5 A;  4K14 A;  2F0L A;  4HN7 A;  3E6Z X;  1HQR D;  3J80 L;  1EWC A;  4BY7 B;  4RAU C;  3CKI B;  1AN8 A;  3U9S A;  5E1F A;  3S1N B;  1S5D D;  1Q3L A;  1JOK A;  4C3I G;  1LTA D;  3I72 A;  1EYA A;  1GHK A;  1SMY D;  1QE6 A;  4CJ1 B;  3FVQ A;  4K6L A;  3NQI A;  5J22 A;  5LHY 1;  3PIP 3;  1TS2 A;  2A5H A;  3HG9 A;  4DNT B;  4KN4 C;  1PTO C;  2MHV A;  3OMG A;  1A2U A;  1ENC A;  2B2U C;  3MXN A;  3D6C A;  1R9T B;  3VA7 A;  1NSN S;  2VUM B;  3S1Q B;  4CBV A;  3ITP A;  5C5L A;  4EGV A;  2J0T D;  2PZW A;  1CHQ D;  3O13 A;  2VXW A;  2PZT A;  4RKL A;  3HZX A;  1RF2 D;  3HEJ A;  1E2Z A;  1U4P A;  1EQT A;  2LMC B;  5IGG A;  2RSO A;  3VYU A;  1U4M A;  1A3T A;  4WJW A;  4S3S A;  2K1B A;  4X3U A;  2F1M A;  1EU4 A;  4A3M B;  1DOK A;  3C1F A;  1IYU A;  4QUF A;  1EYC A;  4C3H G;  2WKC A;  4BBS B;  1S4Z A;  3IKJ A;  1LT6 D;  5FO8 B;  4TRD A;  4PMC A;  4PMB A;  5ISR A;  5KYI A;  1LT4 D;  1Q1E A;  1OXU A;  4ZUI A;  1STA A;  4C3H B;  3H3V C;  3ND8 A;  2RDF A;  4FXG C;  2B2W A;  4HR7 B;  2KQ3 A;  5ELB A;  1TWC B;  3WOE A;  2AWN A;  4FF2 A;  1HFG A;  5COY A;  1O7Y A;  1NAP A;  3SK4 A;  1BO0 A;  4CGY B;  1DXM A;  2BOS A;  3VYR A;  2IJ0 A;  1I4G A;  4DK1 A;  3NP8 A;  2EXZ A;  1TY2 A;  2EYP A;  1SDF A;  1TVX A;  3MHB A;  4XQQ A;  5M5W B;  3HOX B;  4H44 C;  2VNU D;  4IFD H;  2HDM A;  1LLR D;  2RA4 A;  1I6H B;  2O5J C;  5CMD A;  4J1M A;  5E4W C;  1A3V A;  5AFW A;  3P7J A;  3EFX D;  2A6E D;  3ERQ A;  4DK0 A;  1TU2 B;  1LTS D;  4KN7 C;  4ULL A;  3FPU B;  2TMP A;  4Y7N B;  3DWP A;  2SEB D;  3VR2 A;  3MC0 B;  1PTO H;  3A54 A;  2KJX A;  4B08 A;  3RUZ A;  1EY4 A;  4NKL A;  2RVL A;  1CK1 A;  4XDX A;  2F0T A;  4I7Z C;  4L6T B;  2RDH A;  3ZYY X;  3H0G B;  2PNR C;  2QKI C;  2K5W A;  1KDA A;  1WD0 A;  4OGQ C;  1PXU A;  2EJM A;  3NK9 A;  4RGO S;  1XYI A;  3L9A X;  4WFN 3;  2NUC A;  2B2T A;  2ZXR A;  2C5C A;  3T13 A;  1U4L A;  1LTG D;  3JAM E;  1SE2 A;  1I50 B;  3WDN A;  2MP1 A;  1BF4 A;  3Q0A A;  1B4O A;  4A3G B;  4BY1 B;  2YU9 B;  5F2D A;  3HKZ B;  2NTS A;  2AQ1 B;  3LWE A;  1OXT A;  4CHT B;  1BUV T;  1D5X C;  5IGC A;  1IL8 A;  5CV8 A;  1IW7 C;  1W6J A;  3A8J E;  3VR5 A;  1Q12 A;  3TP6 A;  4PMW A;  1TS4 A;  2IW3 A;  1HA6 A;  1NCV A;  3PUZ A;  4A3F B;  4PNY A;  4C56 C;  2K01 A;  3GD7 A;  5I4D A;  1A3U A;  1SYD A;  1GOZ A;  1Y1W B;  2LS0 1;  3FRP B;  4DF7 A;  4IUT A;  1CA6 A;  1DOM A;  3M4Y A;  3FMC A;  1QNK A;  2IWH A;  3A56 A;  4DGZ A;  1SEB D;  4KI0 A;  5CBA E;  2EYL A;  4RGN A;  1RTO A;  1SNO A;  3NBH A;  2RDG A;  1CA5 A;  3MFY A;  2XWB B;  5CV7 A;  1BR9 A;  2WP8 J;  5T1I A;  2F03 A;  2JA7 B;  3OHX C;  3A7A B;  4XYO A;  4HMI A;  2WAQ B;  3PUW A;  4KKT A;  4XT3 B;  3K6O A;  5A2Q E;  4FXK C;  3QG1 A;  1B1Z A;  1VMP A;  3MVV A;  4CKC A;  1E0B A;  1EQV A;  3K7A B;  3M4O B;  1GXD C;  3DHQ A;  2F0H A;  2D62 A;  3GTJ B;  2X6G A;  2PMZ B;  1F9Q A;  1LAB A;  1T5X D;  3MAQ A;  3T53 B;  1LT3 D;  3T51 B;  2SNS A;  1FGB D;  2F0J A;  2F3W A;  4C3I B;  3L7Z C;  2D2C C;  4KD3 A;  1B3A A;  1BDO A;  5CR3 A;  5FLX E;  3KLS A;  1PLF A;  1I6V C;  1CZW A;  1STE A;  1X3Q A;  2JXM B;  4XXE A;  3GP7 A;  1V43 A;  3PO2 B;  3TN2 A;  4FYD A;  1QG7 A;  1ESR A;  3M7G A;  5FK9 C;  3J7A F;  4U68 A;  1MSH A;  3KUP A;  3KBG A;  4KJO A;  4LK1 C;  1ENA A;  3NWS A;  3BDL A;  1L0X B;  1B53 A;  1DYQ A;  5KND A;  5ELE A;  1XTC D;  1D5M C;  4H7B A;  3GTQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...