3S9WA

Crystal structure of staphylococcal nuclease variant delta+phs m98g bound to ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS M98G bound to Ca2+ and thymidine-5',3'-diphosphate at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3s9wA00
1STBA 3NHHA 1KAAA 5J39A 3NUCA 1EY8A 5DEHA 5JOBA 5C4HA 2EY2A 1EY6A 4ME5A 3SXHA 2F0OA 1SNCA 2F0KA 2PW7A 5CV4A 3TP6A 1KABA 4ZQ3A 2EYMA 2F0SA 2F0VA 2OEOA 3D6CA 3DMUA 2EYFA 3MXPA 3MZ5A 1F2YA 4J1MA 4N9PA 5EKKA 5EKLA 3EROA 4ZUJA 1NUCA 3OMGA 5K5PA 1TT2A 2F3WA 1RKNA 5F2DA 5NUCA 3RUZA 3TP5A 5C3XA 5IIFA 3TP8A 4KJNA 3EJIA 3NXWA 4EQOA 1KDBA 4QMGA 2EY5A 1SYFA 2HQEA 3NK9A 2WACA 3NP8A 3OWFA 2EY1A 2F0QA 4HMJA 4PMCA 2F0LA 2EYJA 1EYCA 2F0NA 2LKVA 4RKBA 4K2LA 4NP5A 1EYDA 1A2UA 1II3A 2RKSA 4IUNA 4G57A 4NKLA 4WRDA 1SNOA 3PMFA 1SYCA 4DF7A 1SNQA 5C3WA 2PW5A 4K8IA 3H6MA 3QOLA 4PMBA 4K2KA 4R8NA 3C1EA 4LAAA 4B9WA 4K14A 2F0EA 3MHBA 4TRDA 4B9XA 2ENBA 5KEEA 3MEHA 4ID6A 5CC4A 4H7BA 1SYDA 2F0HA 1EYAA 3BDCA 1U9RA 3V2TA 3ITPA 5IOCA 3P75A 4KY7A 5KGUA 4DU9A 5KIXA 1KDCA 4KY5A 4K5VA 2EY6A 4KD3A 4NMZA 5C4ZA 2EYLA 2F3VA 4KHVA 3OMCA 4WORA 3U9OA 5HURA 4EQNA 3TMEA 5KYLA 4K8JA 5EGTA 4ZUIA 1EY5A 4F8MA 1SYEA 1EZ8A 3HEJA 2EXZA 3SK8A 4N9TA 4KY6A 4HTHA 5I6WA 5IGEA 4I65A 1A2TA 1SYGA 4IZ8A 5CV8A 3SHLA 3OSOA 4F7XA 2M00A 2PYKA 2QDBA 3EVQA 5IGGA 1TR5A 5KYIA 2PZWA 2RBMA 3VA5A 5IGBA 3T13A 2RDFA 4IALA 3SK4A 4DFAA 3QOJA 2SOBA 4DGZA 1STNA 3T16A 1EQVA 4OL7A 1STAA 4K6DA 2F0IA 4QB4A 2F0FA 3SK5A 1EZ6A 4KV6A 3S9WA 3R3OA 4EVOA 5HGTA 2O4XA 2F0GA 5DAUA 2KQ3A 3C1FA 1TQOA 1A3TA 2EYHA 4PNYA 2PZTA 3TP7A 3E5SA 3D4DA 5C6AA 2KHSA 4YIJA 4KD4A 1EY9A 3SK6A 5IGDA 5IGFA 3DHQA 3D8GA 4KTAA 5CGKA 3QB3A 1SNDA 1STYA 5J22A 3BDLA 1ENAA 1STHA 2PZUA 1NSNS 2OXPA 2F0JA 3HZXA 5CR3A 2OF1A 1ENCA 5M9OA 5I6YA 2NUCA 1A3VA 1EY0A 1SNMA 4J6HA 4K5XA 5E3FA 1JOKA 1STGA 4K5WA 2SNSA 2F0PA 2F0WA 4QF4A 4EQPA 1A3UA 5ISRA 4KJOA 2SNMA 4RKLA 5IGCA 1AEXA 1EY4A 2F0MA 4ODGA 2F0DA 1SYBA 5C5MA 1KDAA 3MVVA 4HMIA 2EYPA 1F2MA 2F0UA 4S3SA 5E1FA 2EYOA 2F0TA 1IHZA 5C5LA 2PQEA 3NQTA 5IODA 5J1ZA 4MIUA 4E6IA 5I9PA 5CV5A 1JOOA 3D4WA 5CV7A 3P1HA 1JOQA 4NDXA 5I9OA 5CV6A 3SR1A 5JAVA 1JORA 5CV9A 1EY7A 3LX0A 1SNPA 5KRUA 1F2ZA 3ERQA
chains in the Genus database with same CATH superfamily
1WVLA 5JOBA 5ELDA 2VW9A 3GTGB 1EOVA 1LT5D 5EKLA 1F2YA 2E5LL 1W6JA 1YNJC 3S2HB 3ICEA 1DOLA 5IIFA 4IJLA 5C0XG 4DUYQ 5M3FH 1D1IA 1YJWA 3OHXC 1BF4A 4JV5Q 4Y52H 4L63B 3GP7A 4C3JH 2F1MA 4NKLA 4DV7L 1VQ8A 2NVYH 5BN5A 1TKWB 4A3MG 3MFGA 1SLJA 3J7A5 1NR2A 1I3QB 1HH2P 3IKJA 2H5XA 4PG3A 2NZOA 4OONA 4KY7A 5C44H 3JC66 1Q81C 3F1ZA 4AYBG 3BVZA 1X3GA 2F3VA 4ZUIA 1EY5A 2NVTB 3GTGH 1EZ8A 3T1HL 2ZJQA 5I6WA 1EIFA 1UWVA 3M7GA 2HIXA 2QDBA 5IGGA 1GHKA 4RG1A 1TR5A 2PZWA 1HNWQ 1AN8A 4I7ZC 2LFNA 5GAEC 3KFUA 3KUPA 1CHQD 3J80i 1AZPA 4IURA 4UAIA 1O7YA 2IWHA 2DJGC 1S72A 1RJTA 4HN7A 5LMUQ 4QJFA 3X3NA 1GVPA 3ND8A 1FNWA 4AYBE 1PYWD 2JA6G 2R93G 2VS1A 2MP1A 2J0TD 1DM0B 2F0JA 2PQAA 3WWVA 1Y1WB 1JOKA 3KYHC 2JEBI 2NVTH 2VUMB 4BA2I 2WAQB 1IHZA 3NQTA 3NBHB 2NTSA 4TKOB 3FKIG 3I72A 4ZYSA 1LT6D 3G6JB 2BA1A 4A3LH 5KRUA 2UXCQ 1L0WA 1EY8A 4A3FG 2K33A 3QO2A 3SXHA 3HOUB 3GTPB 2EYFA 3LWUA 4BS9A 4ZUJA 1PRTD 1E0BA 1XX8A 2K5VA 1OO9B 1FD7D 1HR0L 3H91A 2F3WA 5FLXL 3EFXD 2MO0A 2R6GA 1XJVA 3EJIA 3L3OC 4UHVA 3CCLA 2EJGC 4DN4M 4C1NI 3HG9A 5C4HA 5KYIA 1A2UA 2Q2HA 1SFOH 2Q8RE 1B1ZA 1PRTB 3HOWB 1WCMH 4KN7C 1HJPA 1QG7A 2VUMH 1IL8A 5CC4A 3I2ZA 3I4OA 5C0XI 4OGQC 1FGUA 3DM1A 3ITPA 1X9NA 3CPWA 4QIWE 4NXNQ 3TRZA 1TS4A 3R93A 4JI6Q 3KJOA 4ZKBB 4LF4Q 3J81E 2HHHL 5M3FG 1IZ6A 1K83H 2FINB 3DUZA 3GTPH 5GROA 3A7LA 3BYYB 4JBJA 1X54A 5DM73 4C3JG 2I46A 3NBIA 5TSSA 3RZDB 3OSOA 3IFTA 5ELCA 3EA6A 1WTXA 4X66Q 4Q5VA 1NY4A 4B3ML 2F0FA 5ELFA 4DAMA 1M1KC 5C44G 3I4NB 2Q8TA 1JJ2A 5DLQE 4PNYA 2PZTA 3QIAA 1N36Q 3GTOB 1EEID 4DUZQ 2VNUD 4GNXB 1RTNA 2M2LA 1QVFA 3CC7A 3I8ZA 1QUQA 1VQGA 4PZ8A 4KKTA 1HR0W 3S16H 1MBYA 5GAGC 4KJOA 2SNMA 3A54A 5LMNQ 4A75A 1UE7A 4CKBA 3HOYB 3CCQA 2D5DA 1AE2A 2F0TA 5C5LA 3RZDH 1PFSA 4HSPA 2TMPA 3CD6A 1PH5A 3ERQA 5CORA 5IT9E 4BA1I 5DEHA 2MGSA 1MSGA 3CCJA 1EYGA 1LO5D 2FMCA 1K28A 3BU2A 5CBAE 1CZWA 3OW2A 2UUCQ 1BDOA 3J7AF 1PH8A 3GO5A 4DNRB 3HOVH 2KEEA 5NUCA 4X62L 2JA8H 4QMGA 2EY5A 2NZ1D 1KNAA 1MKHA 3CRKC 3GQBA 3KDFA 5ELEA 5A2QE 1PZKD 2Y0SB 4JVZA 5ELOA 2QCPX 3T1YL 2PMZB 2L9HA 3FVQA 4B08A 2ZXPA 4FP5D 3GTLB 2RVLA 2OTJA 2L12A 4A3LG 1P16A 1K0RA 1UE6A 4GN5A 3VYUA 4JI3Q 1J5EL 1Y69U 1DYQA 1CTMA 3ERSX 2QDLA 2CH4W 1YI2A 2ZM6L 4XXEA 5C4ZA 2TSSA 3PF4A 2K5HA 1JE5A 2B2VA 5KYLA 1K8OA 3R2TA 4O1NA 2R7DA 1ICWA 4DV5Q 5C3EH 2EXZA 1PYBA 3QJYA 4N9TA 3PGZA 2RHQB 5EBDA 3K5OA 5FK9C 4GZYC 2M00A 1N32L 1H9RA 1WCMG 3NELA 3VYTA 3VR4A 4OWWB 2VUMG 2I07B 2WAQG 3G48A 4K6DA 4DK0A 3HS0C 2DY8A 5BN4A 3M7NA 4DR7L 5K36H 2O4XA 3OYYA 1L1OC 4DR4Q 3GTLH 1IBMQ 1K73C 1S5ED 4Z9CB 1Y1VB 4B3TQ 1KLGD 2K75A 4KKSA 3VR6A 4KTAA 2E76C 4JI2Q 2G9DA 5J22A 1HFGA 1ZYRC 3W3AA 3A56A 1PFMA 3CQZB 3GTKH 3NSWA 2UU9Q 4DV1L 2EZVA 3OTOQ 4ODGA 1IBKL 1EUJA 1DOKA 2EYPA 1YJ9A 1B44D 2JN4A 2NVXB 1JR0D 3KBXA 1CA5A 2KBNA 2WAQE 4NDXA 3U9SA 1K8GA 4HIOA 5E4WC 1A0IA 2MHVA 3CCMA 4M1UB 3SDZA 4HIMA 1PH7A 1TWGH 2B2UA 2EY2A 4ME5A 2IPKD 4RGTA 1QB5D 3D6CA 2WKDA 3S1NB 3EBEA 3OMGA 4LFBQ 3QG1A 2EDGA 1Q12A 3TP8A 3AQQA 3U4ZA 3GTMB 4DV3Q 1VQLA 4DPGA 1VMCA 2I0QA 2FHTA 1SNOA 3CW2C 3I7FA 3PMFA 5C3WA 2ES2A 4LFCQ 1N8RC 4K2KA 4LAAA 4TVAB 4OX9L 4BBSB 3NWSA 5IOCA 3CCRA 3D0FA 1J9OA 4A3KG 4RH6A 4LF9Q 4HJ5A 1DCZA 3HOVG 4IUVA 2RA4A 4RFBA 4JI1L 3BS1A 3TMEA 1KIXA 4HIDA 1ZXTA 2JA8G 3Q23A 5C4XG 2QKIC 5I2XA 5IYCG 1GUNA 3A5UA 3E0JA 3S1NH 2CQAA 4I65A 1G291 1ESFA 1YNJD 1HNXQ 1QWYA 5IP7H 5IWAL 1BBXC 4LF7Q 4QY7A 1IYVA 4C3HH 1HZBA 2B63G 2DNEA 5J3BA 5JVG3 1A3TA 3M85A 3GTJH 1EL0A 1D8LA 2BE5C 4XQQA 2YTVA 4R4TA 4GKKQ 2VY3A 1R9TH 2BOSA 1I4QA 1WTRA 1BBWA 3TBIB 4DR2L 1JWMD 4P71A 2K05A 3QB3A 5C3EG 5GQOA 2A74C 1X3QA 2PZUA 1ET6A 3MTSA 3J81L 3RR5A 2ZT9C 3W2DA 4L5QA 1WI5A 4EQPA 1TS3A 4QF4A 3BZCA 4LF5Q 5AJ3Q 1B9MA 2GVAA 2VQFL 3H3VC 5C5MA 3HP3A 1EFID 4BY7B 4LFAL 4FXGC 2RF4A 3K0YA 4LF6Q 4P74A 3ULJA 5K36G 1IL2A 2WINB 3BVMA 2Z6BA 4H02A 1IYUA 2HIVA 1JORA 2RDGA 2IHEA 4MZ9A 1XWEA 3K5MA 1Z47A 5K5PA 1KQSA 5FLXc 3KLWA 2K28A 3GTQB 3JAME 2F0SA 1WTQA 3GDEA 3EROA 1VQEA 4A3IB 3F2UA 1GUOA 5IY0A 4IJHA 4DK1A 5F2DA 5C3XA 1YHBA 4Y7NH 1WD0A 1X3FA 2C9OA 1Z6HA 3OIPA 5JJLA 1U4PA 1C48A 3K7AH 1PLFA 3MXUA 1UEBA 3VA7A 1AP0A 1JCKB 2EYJA 1KRTA 3ZYYX 1EYDA 1II3A 3IFDA 3CCEA 3A8JE 1BNZA 2YU9B 2N78A 3C46A 4JI5L 1LYLA 4L5SA 3Q8DA 1H9MA 2XWBB 4CDFC 2XRQD 4DV4L 2QF7A 1VS0A 4BY7H 2LS01 1TXYA 3T4AC 2X6GA 1BXTA 5IT9L 1KDCA 4KY5A 4CDDC 1FJGL 3F8TA 2JQOA 4LJZC 4U673 3GTQH 2CCZA 4CBVA 1CUKA 3SHLA 2KECA 2VXWA 5A2QL 4A3IH 4RHSA 5IYBG 1E2WA 1EFWA 3T53B 1G51A 4K6LA 4LWCA 3HOXG 2R3ZA 3EQLC 1XNQL 4ULLA 2BH8A 4YWMA 1YNXA 4XYOA 2KHJA 2YU9H 3OW7A 2AMCB 3I90A 1QZHA 1LT4D 1Q1BA 4AQYL 3D8GA 5JEAJ 3J81j 1EU3A 1STYA 4EQ5A 1SE3A 4MTKA 1O7ZA 1K0SA 4CGYB 3RLFA 1SE8A 2ICIA 1WTPA 2HCCA 1BCPC 2SEBD 2AQ3B 1EU4A 1FNUA 4X3SA 4OELB 3E0EA 1BCPF 3CCSA 1CT1D 5IP7G 1HA5A 2R7ZH 1KDAA 4OEMB 2MO1A 4C3HG 4S3SA 1LUZA 2JP1A 2IX3A 1Q90A 2L5TA 1PMRA 1DGSA 4FVMA 1CKMA 4XT3B 1DXMA 3P20A 5I2YA 1DOMA 1RIPA 1N33Q 5CV8A 2XN9C 4J1MA 4DR5Q 3PUZA 2EVBA 1RKNA 4DR3L 2HQEA 4UY8C 4HJ7A 1TWAB 1EYCA 4R9WA 1L0XB 4FXDA 2N49A 1KD1C 1H9JA 1SR3A 4ABNA 4DXFA 2C35B 2XWJB 4R8IA 3K6OA 4IUPA 1VMPA 2NN6H 2ALYB 1TWCH 3BZKA 1QCBD 5KNCA 4N8FA 4P75A 5BN3A 4DNIA 1TS5A 5LHY1 3U9OA 4WORA 3H15A 1RTOA 2OQ0A 3E9IA 3SGIA 3KF6A 3MAQA 2R92B 3MEFA 2ZXOA 2PNHA 3E6ZX 2G9HD 1FGBD 2K1BA 3VA5A 3CXCA 1PH1A 1ZEQX 5DM63 1YITA 4IOAA 2L55A 3N6RA 1CSPA 1TWAH 4BY7G 3WOFA 4AIMA 2KCTA 3M3YB 3N52A 5ELNA 1TQOA 1PDQA 3HFZB 3LNNA 1KNEA 1WYDA 5C6AA 2E5LQ 1C4QA 4QQBX 1V1OA 4FF3A 5CBEE 2E2HB 3I73A 3X3MA 2F4VL 2BH2A 1MSHA 3VYSA 4XIGS 4DV6L 5T1GA 1WFQA 3S2HH 1HNZL 3Q6SA 4RGOS 1X56A 2E2DC 5ISRA 4DV7Q 1OXVA 1QVCA 4BXXH 3I70A 1TWHB 1E2ZA 1HRJA 5IGCA 2B2WC 1UE5A 5DNFA 1VQBA 3GV6A 1ESRA 3OWEB 4ZAIA 5FOBB 4FXKC 2CW0C 1QILA 5I9PA 4GOPA 3D4WA 4YCVA 1I3QH 5IP9H 2AWOA 4PMCA 3NUCA 3I56A 1RD9D 2CQOA 3M3YH 1NNXA 4Q0FA 3BJUA 3T1HQ 1SMYC 3TZDA 3K57A 5EKKA 3S1RB 3OIQA 5FJ8H 3CP0A 2XNAC 1BBUA 3RUZA 1X6OA 3K5NA 2E2HH 2B2VC 2XIWA 1KDBA 5T1IA 4NW2A 2R7ZG 3CC2A 1ZYRD 2UUAL 1A8VA 1SYCA 1L1OB 1VQJA 3QOLA 4R8NA 1VQKA 4IFDH 4MNOA 1UNSA 3RD4A 4DAPA 4TSSA 5EKIA 3ZJYC 3TSSA 4C2MB 3P75A 1BOSA 5CMDA 1YVCA 2B8FA 5A35A 2YYZA 3IAYA 1CKNB 1EWHA 4MTNA 5HURA 4P73A 4RCOA 3NTKA 2QGQA 2E8GA 5FLMH 2IY5B 3E9HA 4A3JB 3S1RH 4A4IA 1SYGA 2R61A 1Y1WH 1PFBA 1UE1A 2PYKA 2RBMA 2WIIB 1TY2A 3T13A 1JJGA 3SK4A 1N34L 1JB7A 4JI4Q 2NN6G 3ER0A 4JYAL 1YBYA 2F3IA 1EZ6A 2A73B 3RLOA 4G7ZC 4FF2A 2OCEA 1U0LA 3J81c 4A3GB 1HR0Q 2MFIA 1Q8KA 4DV0L 1E7ZA 2RCNA 3HOUH 4HJ8A 2UXBL 4EX5A 1Q82C 4APVA 4C2MH 1YJNA 1EIHA 4LNQA 4V0BA 2O5JC 4PV1C 2F0WA 2IT1A 2ASBA 1SMXA 4DUZL 4O42A 4CJ1B 3ULPA 4JBKA 3Q22A 3MFYA 3V05A 3MXGA 2F0DA 1SYBA 4A3CH 1NBWA 2PQEA 4RAUC 5J1ZA 3HOWH 5C0XJ 1QJOA 2VQEL 4YY3L 1XPRA 2KCMA 2IHFA 4DAVA 3A55A 3DEOA 4UDUC 2HHHQ 2Z6KC 1EQRA 2EYMA 4A3EB 4X65L 3MZ5A 1LM0A 1H9SA 4QCLA 4A3GH 3CAMA 3S1QB 1NUCA 4JK1C 2BE5D 1ILQA 1HCZA 3TP5A 4BXXG 4LK1C 4KHPL 1E22A 3NP8A 4YHHL 3RLNA 4B3MQ 1XMOL 3NENA 4CKCA 3K58A 4JCVE 1QNUA 4OWXB 2RSNA 5IT9c 3BVGA 5IP9G 1NJIC 1PZID 3J7YW 1YNNC 3HKZB 3I4NH 5I4DA 1U9RA 3V2TA 1HTLD 1X3EA 1S5BD 2IW3A 3GTOH 5JEAH 3U50C 2RSOA 2CWAA 5BR8L 1WTHA 4F87A 3G7LA 1TS2A 5FJ8G 5M3MB 1TU2B 2ZXRA 2AKWB 3W1BA 1P8LA 4DK3C 3PO2B 1CKOA 1IBLL 1VQ9A 1YHQA 4LF8L 1PA6A 4CHTB 4A3EH 1A2TA 3I3CA 2KOLA 3S1QH 1V1QA 4F7XA 4IFDG 1WTVA 1CFMA 1B9NA 1NTGA 3HOYH 1L2FA 2IX0A 3ULLA 4QB4A 3SK5A 2LY7A 2L4NA 1MD2D 4J15A 1XTDA 2HQLA 3E5SA 1GJXA 3D4DA 5COYA 1JE4A 1RF2D 4YIJA 1RDPD 2D62A 3SK6A 4X62Q 2KVMA 3S1MB 4CJ2C 3GV3A 5M5YB 1GO3E 1VQCA 1ONLA 3C2PA 1NSNS 3HZXA 1HFNA 3D4RA 4ZCKA 3T1YQ 5M9OA 1E3PA 4XQJA 2NUCA 1Y1WG 4JI7Q 1D5XC 2EJMA 1I4RA 3PO2H 1X55A 2AQ1B 4YWKA 1HTPA 1A15A 3FPPA 3CCVA 3H3VH 4DXGA 1F2LA 1K8MA 1B7YB 3PO3B 4K0KL 2EJFC 1J5EQ 3S14B 4JBMA 1VQ5A 4XTCS 1H9KA 1B3AA 5CV7A 4IOCA 3P1HA 1M4VA 5KNDA 2ZM6Q 4BY1B 2K04A 5JAVA 4NXMQ 1EY7A 1F2ZA 1DJRD 1XYIA 4X64L 1VQOA 4FF1A 1HQMC 3HOUG 3VR3A 1I5FA 4R1JA 1BQQT 1V9PA 1G6ZA 4XYQA 3TP6A 4RCNA 5J39A 4R4QA 2PQAB 4EGVA 1N32Q 1VQIA 2V1CC 3S1MH 4GKJL 1E24A 3VDYA 2EY1A 2F0QA 1I94L 4DR7Q 3FP9A 4G7OC 3Q24A 4A3BB 3HOWG 2PW5A 5H1SE 4K8IA 3AFQA 2E75C 2HCIA 2CFMA 1BCPD 4OHJA 4WFN3 2RHSB 3PV0A 3PO3H 3BDCA 4IUQA 3A0JA 4DV3L 3FEWX 1PH2A 3BG3A 4RWSC 4DU9A 1CA6A 3WDNA 5KIXA 1VQ6A 3K59A 1Y1VH 3UDXA 5EBCA 2JSOA 2CKZB 1VQAA 2EY6A 4NMZA 3DEPA 4TQUS 5D3DA 1ASZA 1ET9A 1BCPB 1DZ1A 3H0GB 5GADC 5EGTA 4DV1Q 2DGYA 2RCFA 1IBKQ 1LTAD 3CQZH 4KY6A 1D5MC 3G6EA 1BO0A 3A8KE 2E2JB 1T5EA 3PF5A 3AYHB 2NVXH 2WB1B 1VQ7A 3I4NG 1HZAA 3L0OA 2PI2E 4KV6A 4EVOA 4JPBW 1M8AA 2B2TC 4A3BH 3PQIA 4KI0A 1TWFB 1LABA 5IGDA 1EY9A 4RMFA 2A1AA 2YTXA 3M4PA 5CGKA 4IFDI 3PIP3 4A3DB 1SNDA 1KLUD 2KCCA 1F77A 4A3EG 4OXPA 3UDGA 1NMGA 1ML0D 1W3SA 2FJ2A 3DXJC 3KOJA 2CVRA 4KHZA 4DV2L 1LTBD 1QVGA 3GTMH 2ATWA 1AEXA 1XPUA 4PMWA 3HOYG 1EY4A 3LGJA 4OX9Q 3P7JA 3RNUA 4HMIA 4JI0L 3VR2A 2MNAA 2LSSA 2E2JH 2QILA 4GS3A 1O7LA 1JWSD 4BBSH 4LF5L 1HZ9A 4JI1Q 4HR7B 4K14A 1PHJA 3HKZG 2UUBL 2A6ED 1Z7TA 1VQHA 1NAPA 1N9WA 2Q2UA 1KC8C 3F2CA 1TWFH 2K5DA 1PTOD 1Q1EA 1SRUA 1JC7A 1TT2A 4UP7A 1XPOA 3PO2G 5FKAC 1C7YA 1GUWA 1MGSA 2CHBD 3NXWA 2Y0SG 4JOIA 3K5LA 4A3DH 3OWFA 2GN5A 5IWAQ 4RKBA 4PZ6A 1Q46A 1D7QA 4NP5A 4B3SL 2RKSA 4OIJA 2NB0A 2NVQB 1I6VC 1SNQA 1PTOB 4PMBA 2OWOA 1JJCB 2F0EA 4FDBA 4TRDA 3UE1A 3JAMc 1T9HA 4G4KA 1SYDA 1EYAA 1Y14B 4QUCA 3QWNA 1I6HB 2MUYA 3HKZE 2CW0D 2Z4HA 4ZK9B 1SAPA 2K5WA 5G3LF 2P5ZX 2JA5B 1HUNA 4AYBB 1EIGA 1VQ4A 1VQMA 2ID0A 4F8MA 2VQFQ 3KDFB 3G71A 3HEJA 4X6AH 2A6HC 1LTLA 3FMCA 4LFAQ 2K6AA 2O2LD 2Y0SE 4LW1A 1SMYD 4GLVB 2PMZE 1AH9A 4IPGA 4JI8L 2K14A 2RDFA 4DFAA 1V43A 1GM5A 3S2DB 1STAA 3PO3G 3W5OA 2I5LX 2MJ8A 3NBHA 4DR1L 1XNRL 1HHVA 2KCNA 3RZOB 1Y1VG 2LXKA 5E7NA 2RDHA 1R4QB 1L1OA 1NMFA 3F2BA 1U4MA 1OXUA 1PFNA 2K52A 4L6TB 1VQFA 4A93B 4IQZA 4DA2A 1SN8A 2M9VA 4LMQD 3ONAB 5CR3A 2R93B 3L9AX 2JA5H 4K5WA 3S15B 1I4XA 5JVH3 4JI5Q 3KBGA 4RKLA 3BZDB 1YIJA 1KXLA 3PUXA 5IYDH 4DV4Q 1D5ZC 1LLRD 4CDEC 2VZAA 4CDCC 4HEDA 4POFA 4A3BG 3CHBD 3KF8B 3U58A 3FKIB 4GLXA 5CV9A 2X6LA 3LX0A 2L11A 3KLSX 4BBRB 2PI2A 1FJGQ 1SJHD 1HZCA 1EY6A 5L37A 4QIWB 3TEHB 2F0OA 2F0KA 2OEOA 5D65A 5GAHC 3HRZC 3RZOH 1F9RA 4N9PA 3PIPA 3AFPA 4JC0A 1K9MC 1ZKOA 4UP8A 2MQHA 1CSQA 3OPOA 5IE8A 5CYUA 4KJNA 4A93H 3HOZB 1XMQL 1SYFA 2ZTDA 3M4OB 2AQ2B 2F0LA 1XNQQ 3J7AV 4DR6L 1N33L 1QNKA 3PUYA 2HDLA 1Q86C 3S15H 4B9WA 4BBSG 1CM9A 2K4KA 3A8IE 1Q7YC 2BCOA 1GUSA 1K8AC 4AQYQ 4B3RL 2WB1G 4O0AA 1PH6A 1BKBA 1SE2A 3MC0B 4ZRZA 2UXDL 1I50B 4P72A 4DAYB 4NPSA 4BBRH 4GNXA 2JXMB 2E2IB 5M3FB 3SK8A 4OO1H 4KK7A 4C3JB 3J80c 3B6YA 4XQNA 3J80E 4DUYL 4IALA 2NVYB 2A68C 4R4CA 3QOJA 3HOZH 1S3OA 2I5HA 1WOCA 1U5KA 1STNA 4QGUA 1BVSA 4JV5L 3TN2A 2QA4A 4IN3A 1G91A 3UDIA 2HD3A 3CF5A 4HCSA 1ICFB 2EYHA 2WB1E 5C44B 1RODA 4FO2A 5EJWA 1KL9A 2ZJPA 1O78A 1UAPA 4DR3Q 2EOTA 5HGQA 1YNND 2PNRC 3H94A 3S17B 1I50H 2EIFA 5LL6X 2OXPA 2B2YA 3PUVA 1UEAB 3DWQA 2NBFA 1LT3D 4OIKA 1A63A 2A6EC 1PV4A 4U68A 3AMUA 2E2IH 5EQ0A 4X3UA 2NZHA 1IKLA 1RL2A 2EYOA 5M5WB 1F9PA 4C1NK 2OT2A 1PTOC 5EPLA 4ALPA 1AW7A 1PTOF 4R4IA 1HNWL 4AH6A 2X69A 4FYDA 2AHOB 1STBA 1VDZA 5JJIA 3A7AB 1AE3A 3AB9A 3D6WA 3NTHA 1YEZA 4A3IG 5LMUL 2JA5G 1JICA 3URYA 3I91A 5JJKA 2H1EA 5IYDG 2R92H 3S17H 3L7ZC 3OOCA 4LUZA 2Q2TA 4DK6C 2Z0SA 3MA2B 3MHBA 5KNBA 1KTKA 2DY7A 2VB3X 4ID6A 2GA4B 2K32A 2F4VQ 5M5WH 2L0CA 1YZ6A 4DV6Q 1X3PA 5AFWA 1HNZQ 3M4YA 3AEVA 3TS2A 2UXCL 3CMEA 2XTIA 1BR9A 2WP8J 1MJEA 4A93G 2WFWA 3NQIA 2CH4A 1HPCA 2JYOA 2A8VA 1KAWA 4WJ3M 1ASYA 3J7ZC 2N88A 4IZ8A 5FO8B 2PO4A 5JPNC 3TDQA 1TWHH 1AFPA 1MJCA 1SFOB 3L2PA 3FRPB 4PZ7A 1FL0A 1WCMB 4OL7A 2F0GA 3JAML 1KRSA 4CKEA 1G8ZD 4BBRG 2JA7B 1E1OA 1GHJA 4JI4L 4KKUA 4IPHA 2A69C 4V190 2DNCA 2NTTA 1QOHA 1SEBD 3FDTA 2G5DA 1BUVT 3BDLA 4WJWA 4OWTB 1EWCA 2QW7A 1K83B 1MHWC 2OF1A 3CKIB 3MWYW 4NXNL 3UI2A 5I6YA 2UUAQ 4OO1G 4JI6L 3SEBA 2SNSA 1V1PB 4LF4L 3HOZG 4RHRA 1K3RA 2F0MA 3W1GA 2N3SA 3MVVA 2OTLA 1MIUA 4HCEA 1JMCA 2K5QA 5CV5A 1KHIA 2BDOA 1EEFD 4X66L 4HIKA 3I55A 2B2UC 3IRBA 3K7UC 2K03A 2EXDA 2YV5A 3G4SA 2DJFC 1N36L 1S5CD 5JJZA 1FVIA 2LMCB 3S16B 2O5IC 2JA7H 1B2TA 3IL8A 1N34Q 3NK9A 2WACA 4ME3A 4MN3A 4A3JH 5JPMC 3I4MB 4JYAQ 2PCFB 2KUMA 4IPCA 1PH4A 1NR4A 1QZGA 3F2DA 3STBD 1GUGA 4POGA 1IW7C 4H13C 4B9XA 5LMNL 2ENBA 2IX1A 4DV0Q 1Y8OB 2UXBQ 2EPBA 3NEMA 4RA8A 2FXQA 2B8GA 3K80C 4K5VA 3K8AA 4A3KB 1PVOA 4KHVA 4L5TA 3Q0AA 3KLRA 3HOVB 4KMUC 2HT1A 3UE0A 2R92G 1JB3A 1X32A 2JA8B 3RN2A 4H0LC 3HKSA 3NTIA 5C4XB 5IGEA 1Q3LA 2UUCL 1EWIA 3MXNB 5IGBA 2VQEQ 3U4VA 4YY3Q 2SOBA 4X3TA 3T16A 1EQVA 3I4MH 3S9WA 1C0AA 5HGTA 2B63B 2KQ3A 1FYCA 3GD7A 4O2DA 1B3QA 4F88A 2XRSD 4X65Q 3KJPA 1K3BC 4KD4A 1VQDA 2ZTCA 4JI3L 2A19A 4L5RC 1XTCD 2KA7A 1CI3M 4KHPQ 3J81i 4YHHQ 1ENAA 4WJ4A 1B8AA 3KF6B 5C3EB 1ENCA 1XMOQ 1X65A 5G3LD 1EY0A 4A3KH 1GKHA 3D31A 1AZQA 4J8QA 4JOIC 5EPKA 4DV5L 2B3GA 5KGUA 4LUOA 3J80L 2B2WA 4HAEA 1HXYD 3VR5A 5C4XH 1S5DD 5IYCH 5M5XB 5E4XA 2A6HD 3T56B 4JI7L 2K01A 2AUJD 4RGMA 1LV9A 1LTTD 3M9BA 4GLAC 5BR8Q 5LMNW 3BDOA 4OO1I 4FF4A 1S5FD 5FLMG 3NHHA 1OXSC 2C5CA 2NN6I 3V96A 1IBLQ 4HJ9A 2AWNA 2L15A 4UPAA 5CV4A 1SNCA 3DWPA 4LF8Q 3CCUA 2B63H 4DR4L 3CU7A 4ZQ3A 3DMUA 5M3MH 1LTRD 1A6XA 1IBML 4B3TL 1IXRA 2Q8IB 4NXML 3GTKB 1VQPA 4EQOA 3DM3A 2KJXA 4JI2L 5FO9B 4HMJA 3NPPA 2F0NA 4K2LA 4WRDA 4G57A 3CRLC 1I4PA 4GOPB 1HUMA 3H6MA 1Q8IA 2SDFA 3R8BA 2UU9L 2WV6D 3QR8A 3OTOL 1JQYD 3PIO3 2QEXA 5M5XH 1D2BA 2JA9A 1TWGB 3PCOB 3CMAA 3KF8A 3ND9A 4KD3A 1IKMA 2EYLA 2JA7G 5M5YH 1SE4A 4K8JA 1QE6A 1E1TA 4NB3A 4A3CG 2Z8LA 4DNTB 4A3JG 1ILPA 2RQXA 4K0KQ 4GN4B 3EVQA 3SVMA 4LFBL 2J4XA 1L0YB 3A5ZB 3D3RA 4DGZA 2FMMA 4X64Q 1HQRD 3S14H 2OQKA 2F0IA 3HOXB 1OXTA 2AUKA 3FHWA 3RN5A 2DN8A 2L1BA 1I4HA 3R3OA 1DD2A 5DAUA 3NE5B 4LFCL 4BY1H 3C1FA 4A3GG 1PRTC 1HA6A 2XVSA 4A76A 1PRTF 5IGFA 1IYJB 4C3IB 2XGTA 1SBBB 4GKJQ 2BA0A 2N55A 1C9OA 3WOEA 1I94Q 4JW0A 3TZUA 4LF9L 3CPFA 1A3VA 4DAYA 1SNMA 4J6HA 4XDXA 1STGA 1O7IA 1I4GA 1C8CA 2JEAI 4YCUA 1PZJD 2V4DA 1YHAA 3K0XA 4JBWA 3I4MG 1PYSB 2D9UA 4M8AA 5JEAG 5LL6S 3C3LA 1EIYB 4C3HB 1E2VA 1EQTA 1VF7A 5CV6A 1HNXL 3GTJB 1S4ZA 5IYBH 1S40A 4MIUA 4LF7L 2A68D 1R9TB 3PSIA 3HOXH 2K7VA 4RGNA 4X3KA 3STBC 2Z6KA 3EIVA 4UP9A 1F9SA 4GKKL 1JWUD 2D2CC 3H0GH 4HSVA 4C3IH 4GNXC 1RCVD 3TS0A 2VB2X 1SSOA 2EE1A 2LKVA 1D6EC 1EOTA 2NWGA 4ZKCB 1M90C 2HUGA 4IUNA 2PPBC 2Q2IA 1UUPA 1LTID 3C1EA 2B29A 5AJ3L 1PH3A 4C56C 3EN2A 5KEEA 3MEHA 4HJAA 2JE6I 4H7BA 2F0HA 1V8QA 4LF6L 1QUQB 2CWPA 1H95A 5M3MG 4IFDJ 1OXXK 1H9SB 4DV2Q 4IO9A 1GXDC 4EQNA 3DWAA 2IJ0A 3HGBA 4Y7NB 2Z9HA 4KLKA 4JG2A 1SYEA 1GUTA 1F9QA 2E74C 2HDMA 3K7AB 4JI0Q 1U4LA 1XXGA 1Y8NB 2F52A 5HY6A 2B2YC 1FR3A 3E3XA 1ENFA 4A3MB 1CQFA 2IL8A 4YWLA 2VL6A 2XSCA 1TIID 4DR2Q 1B70B 1D1KA 3DLLA 1VCIA 1FNVA 2KEDA 2UUBQ 4DKAC 1TY0A 3PIOA 5FO7B 3TP7A 4QUFA 1PH9A 1SJED 4H44C 3TQYA 3TREA 5D3IB 2NYZD 4GN3B 1STHA 4IPDA 5FLXE 4CJ0B 5ELBA 4IUUA 4B3SQ 5C4JB 1SXTA 1STEA 2F0PA 3H09A 1Z9FA 4KN4C 5C0XH 2R7FA 1U4RA 2B39A 5I9OA 2K5NA 2NVQH 4GOPC 3VYRA 1GOZA 3KK7A 1LTSD 1PTOH 4BY1G 2Z4IA 1JOOA 1LTGD 2K50A 3SR1A 4A3MH 2DUDA 1SNPA 3CC4A 1KAAA 2QEJC 3I4LA 4I7AA 1WTWA 1J8IA 1JT8A 1GD7A 3PUWA 2JA6B 1I6HH 4ZLTF 2PW7A 1B50A 2FFKB 1KABA 1MI2A 3MXPA 2F0VA 1SDFA 1W2BA 3UDFA 1CKNA 4XT1B 4JI8Q 2YTYA 4QL5A 1G2TA 2A69D 2MPMA 2GVBA 2R7ZB 2KHIA 5C4JH 4DR1Q 4DF7A 1XNRQ 2A5HA 2N8NA 2ZJRA 2JJQA 1SROA 3S2DH 1V1PA 4N8X1 1EQQA 1CQVA 4A3FB 2ICEC 1WTOA 4L8JA 3RMHA 1WJJA 2JK8A 1VF5C 2KENA 2WKCA 3JAMi 3NWTA 3H0GG 3OMCA 4C3IG 4G7HC 2EQSA 2JA6H 1G2SA 2R93H 3AU7A 3K81C 4MHEA 4HTHA 2D0PA 4IUTA 2J7ZA 3O13A 4ILWA 4DR5L 4BWGB 3S24A 5EAYA 5D14A 1J6QA 3FPUB 2Z1CA 1DONA 2D0OA 4FNFA 1A62A 1G6PA 5EPJA 1B53A 3H3VI 4P2CB 4R4OA 1TWCB 3M4QA 3FKIH 1NE3A 2B2TA 1T5XD 2KHSA 1PXUA 1NCVA 3DHQA 1IW7D 4A3DG 1CHPD 4A3FH 1XMQQ 1WD1A 1OTCA 2F03A 1RHPA 1B4OA 4DR6Q 4PQXA 3BYTB 3KLSA 3A74A 1LACA 4K5XA 5E3FA 1Y8PB 1VQNA 1CK1A 1W6KA 1A3UA 3M4OH 2F4IA 1R4PB 1O80A 3R2IA 4B3RQ 1F2MA 2F0UA 4YCWA 5E1FA 2LXJA 5IODA 2BDNA 3T51B 4LUVA 2UXDQ 4E6IA 2ZTEA 1JOQA 3SE0A 2I5MX 1CZGA 2H4OA 3MXNA 3LWEA 1TVXA
chains in the Genus database with same CATH topology
1WVLA 5JOBA 5ELDA 3GTGB 1LT5D 5EKLA 1F2YA 1W6JA 1YNJC 3S2HB 1DOLA 5IIFA 5C0XG 1D1IA 3OHXC 1BF4A 4L63B 3GP7A 2F1MA 4NKLA 5BN5A 1TKWB 3MFGA 1NR2A 1I3QB 3IKJA 4KY7A 3BVZA 2F3VA 4ZUIA 1EY5A 2NVTB 1EZ8A 5I6WA 3M7GA 2QDBA 5IGGA 1GHKA 1TR5A 2PZWA 1AN8A 4I7ZC 2LFNA 3KUPA 1CHQD 1AZPA 4IURA 4UAIA 1O7YA 2IWHA 1RJTA 4HN7A 3X3NA 3ND8A 1FNWA 1PYWD 2MP1A 2J0TD 1DM0B 2F0JA 1Y1WB 1JOKA 2JEBI 2VUMB 4BA2I 2WAQB 1IHZA 3NQTA 2NTSA 4TKOB 4ZYSA 3I72A 1LT6D 3G6JB 2BA1A 5KRUA 1EY8A 2K33A 3QO2A 3SXHA 3HOUB 3GTPB 2EYFA 3LWUA 4BS9A 4ZUJA 1PRTD 1E0BA 1XX8A 1OO9B 1FD7D 3H91A 2F3WA 5FLXL 3EFXD 2R6GA 3EJIA 3L3OC 2EJGC 4DN4M 4C1NI 3HG9A 5C4HA 5KYIA 1A2UA 2Q8RE 1B1ZA 1PRTB 3HOWB 4KN7C 1QG7A 1IL8A 5CC4A 5C0XI 4OGQC 3DM1A 3ITPA 1TS4A 3R93A 4ZKBB 3J81E 3DUZA 2FINB 3A7LA 3BYYB 5DM73 4C3JG 2I46A 3NBIA 5TSSA 3RZDB 3OSOA 3IFTA 5ELCA 3EA6A 1WTXA 4Q5VA 2F0FA 5ELFA 3I4NB 2Q8TA 4PNYA 2PZTA 3QIAA 3GTOB 1EEID 2VNUD 1RTNA 2M2LA 3I8ZA 4KKTA 1MBYA 4KJOA 2SNMA 3A54A 4CKBA 3HOYB 2D5DA 2F0TA 5C5LA 4HSPA 2TMPA 3ERQA 5CORA 5IT9E 4BA1I 5DEHA 2MGSA 1MSGA 1LO5D 2FMCA 5CBAE 1CZWA 1BDOA 3J7AF 3GO5A 4DNRB 2KEEA 5NUCA 4QMGA 2EY5A 2NZ1D 1KNAA 3CRKC 3GQBA 5ELEA 5A2QE 1PZKD 2Y0SB 2QCPX 2PMZB 2L9HA 3FVQA 4B08A 2ZXPA 4FP5D 3GTLB 2RVLA 2L12A 3VYUA 1Y69U 1DYQA 1CTMA 4XXEA 5C4ZA 2TSSA 5KYLA 2B2VA 1K8OA 3R2TA 4O1NA 1ICWA 2EXZA 3QJYA 4N9TA 5EBDA 3K5OA 5FK9C 4GZYC 2M00A 1H9RA 3VYTA 3VR4A 2I07B 4K6DA 4DK0A 3M7NA 3HS0C 2DY8A 5BN4A 5K36H 2O4XA 1S5ED 4Z9CB 1Y1VB 1KLGD 4KKSA 3VR6A 4KTAA 2E76C 2G9DA 5J22A 1HFGA 1ZYRC 3W3AA 3A56A 1PFMA 3CQZB 3NSWA 2EZVA 4ODGA 1DOKA 2EYPA 1B44D 2NVXB 1JR0D 3KBXA 1CA5A 4NDXA 3U9SA 5E4WC 2MHVA 4M1UB 3SDZA 2B2UA 2EY2A 4ME5A 2IPKD 4RGTA 1QB5D 3D6CA 2WKDA 3S1NB 3OMGA 3QG1A 2EDGA 1Q12A 3TP8A 3GTMB 1VMCA 2FHTA 1SNOA 3PMFA 5C3WA 4K2KA 4LAAA 4BBSB 3NWSA 5IOCA 1J9OA 4RH6A 1DCZA 4IUVA 2RA4A 4RFBA 3BS1A 3TMEA 1ZXTA 3Q23A 2QKIC 5I2XA 1GUNA 3E0JA 2CQAA 4I65A 1G291 1ESFA 1YNJD 1QWYA 1BBXC 1IYVA 2DNEA 5JVG3 1A3TA 3M85A 1EL0A 4XQQA 2BE5C 2BOSA 1I4QA 1WTRA 3TBIB 1JWMD 2K05A 3QB3A 2A74C 1X3QA 2PZUA 1ET6A 3MTSA 3J81L 2ZT9C 3W2DA 4EQPA 1TS3A 4QF4A 1B9MA 3H3VC 5C5MA 3HP3A 1EFID 4BY7B 4FXGC 3K0YA 5K36G 2WINB 3BVMA 1IYUA 1JORA 2RDGA 1XWEA 3K5MA 1Z47A 5K5PA 2K28A 3GTQB 3JAME 2F0SA 1WTQA 3EROA 4A3IB 3F2UA 1GUOA 4DK1A 5F2DA 5C3XA 1WD0A 2C9OA 1Z6HA 3OIPA 1U4PA 1C48A 1PLFA 3MXUA 3VA7A 1AP0A 1JCKB 2EYJA 3ZYYX 1EYDA 1II3A 3IFDA 3A8JE 1BNZA 2YU9B 3C46A 1H9MA 2XWBB 2XRQD 2QF7A 2LS01 3T4AC 2X6GA 1BXTA 5IT9L 1KDCA 4KY5A 4LJZC 4U673 4CBVA 3SHLA 2KECA 2VXWA 5A2QL 4RHSA 1E2WA 3T53B 4K6LA 2R3ZA 3EQLC 4ULLA 4XYOA 3OW7A 3I90A 1LT4D 1Q1BA 3D8GA 5JEAJ 1EU3A 1STYA 1SE3A 1O7ZA 4CGYB 3RLFA 2ICIA 1WTPA 2HCCA 1BCPC 2SEBD 2AQ3B 1EU4A 1FNUA 4X3SA 1BCPF 1CT1D 1HA5A 1KDAA 4C3HG 4S3SA 2JP1A 2IX3A 1Q90A 2L5TA 1PMRA 4FVMA 4XT3B 1DXMA 3P20A 5I2YA 1DOMA 5CV8A 2XN9C 4J1MA 3PUZA 2EVBA 1RKNA 2HQEA 1TWAB 1EYCA 4R9WA 1L0XB 4FXDA 1H9JA 4ABNA 4DXFA 2XWJB 4R8IA 3K6OA 4IUPA 1VMPA 2NN6H 1QCBD 5KNCA 5BN3A 1TS5A 5LHY1 3U9OA 4WORA 1RTOA 3MAQA 2R92B 2ZXOA 3E6ZX 2G9HD 1FGBD 2K1BA 3VA5A 1ZEQX 5DM63 2L55A 3N6RA 3WOFA 3M3YB 3N52A 1TQOA 1PDQA 3LNNA 1KNEA 5C6AA 1C4QA 1V1OA 4FF3A 5CBEE 2E2HB 3I73A 3X3MA 1MSHA 3VYSA 4XIGS 5T1GA 3Q6SA 4RGOS 2E2DC 5ISRA 1OXVA 3I70A 1TWHB 1E2ZA 1HRJA 5IGCA 2B2WC 5DNFA 3GV6A 1ESRA 3OWEB 4ZAIA 5FOBB 4FXKC 2CW0C 1QILA 5I9PA 3D4WA 2AWOA 4PMCA 3NUCA 1RD9D 4Q0FA 1SMYC 3TZDA 3K57A 5EKKA 3S1RB 3OIQA 2XNAC 3RUZA 3K5NA 2B2VC 2XIWA 1KDBA 5T1IA 4NW2A 1ZYRD 1SYCA 3QOLA 4R8NA 4IFDH 3RD4A 1UNSA 4DAPA 4TSSA 5EKIA 3TSSA 4C2MB 3P75A 1BOSA 5CMDA 2B8FA 5A35A 2YYZA 3IAYA 1EWHA 5HURA 4RCOA 3NTKA 4A3JB 1SYGA 2R61A 1PFBA 2PYKA 2RBMA 2WIIB 1TY2A 3T13A 3SK4A 2NN6G 1EZ6A 2A73B 4G7ZC 4FF2A 4A3GB 1EIHA 4V0BA 2O5JC 4PV1C 2F0WA 2IT1A 4O42A 4CJ1B 3Q22A 3MFYA 3V05A 3MXGA 2F0DA 1SYBA 2PQEA 4RAUC 5J1ZA 5C0XJ 1QJOA 4DAVA 3A55A 3DEOA 4UDUC 2EYMA 4A3EB 3MZ5A 1H9SA 4QCLA 3S1QB 1NUCA 4JK1C 2BE5D 1ILQA 1HCZA 3TP5A 4LK1C 3NP8A 4CKCA 3K58A 1QNUA 2RSNA 3BVGA 1PZID 3J7YW 1YNNC 3HKZB 5I4DA 1U9RA 3V2TA 1HTLD 1S5BD 2IW3A 5JEAH 2RSOA 4F87A 3G7LA 1TS2A 5M3MB 1TU2B 2ZXRA 3PO2B 4CHTB 1A2TA 3I3CA 2KOLA 4F7XA 4IFDG 1WTVA 1CFMA 1B9NA 2IX0A 4QB4A 3SK5A 2LY7A 2L4NA 1MD2D 1GJXA 3E5SA 3D4DA 5COYA 1JE4A 1RF2D 4YIJA 1RDPD 3SK6A 2D62A 2KVMA 3S1MB 4CJ2C 3GV3A 5M5YB 1ONLA 3C2PA 1NSNS 3HZXA 1HFNA 3D4RA 5M9OA 4XQJA 2NUCA 1D5XC 2EJMA 1I4RA 2AQ1B 1HTPA 1A15A 3FPPA 4DXGA 1F2LA 1K8MA 3PO3B 2EJFC 3S14B 4XTCS 1H9KA 1B3AA 5CV7A 3P1HA 1M4VA 5KNDA 4BY1B 2K04A 5JAVA 1EY7A 1F2ZA 1DJRD 1XYIA 4FF1A 1HQMC 3VR3A 1BQQT 1G6ZA 4XYQA 3TP6A 4RCNA 5J39A 4EGVA 2EY1A 2F0QA 4G7OC 3Q24A 4A3BB 2PW5A 4K8IA 2E75C 2HCIA 1BCPD 4OHJA 4WFN3 3PV0A 3BDCA 4IUQA 3FEWX 3BG3A 4RWSC 4DU9A 1CA6A 3WDNA 5KIXA 3K59A 5EBCA 2JSOA 2EY6A 4NMZA 3DEPA 4TQUS 5D3DA 1ET9A 1BCPB 1DZ1A 3H0GB 5EGTA 1LTAD 4KY6A 1D5MC 1BO0A 3A8KE 2E2JB 1T5EA 2WB1B 4KV6A 4EVOA 1M8AA 2B2TC 4KI0A 1TWFB 1LABA 5IGDA 1EY9A 5CGKA 4IFDI 3PIP3 4A3DB 1SNDA 1KLUD 2KCCA 1F77A 1ML0D 2FJ2A 3DXJC 4KHZA 2CVRA 1LTBD 1AEXA 4PMWA 1EY4A 3P7JA 4HMIA 3VR2A 2QILA 1O7LA 1JWSD 4HR7B 4K14A 2A6ED 1Z7TA 1NAPA 2K5DA 1PTOD 1Q1EA 1JC7A 1TT2A 5FKAC 1GUWA 1MGSA 2CHBD 3NXWA 3K5LA 3OWFA 4RKBA 4NP5A 2RKSA 4OIJA 2NB0A 2NVQB 1I6VC 1SNQA 1PTOB 4PMBA 2F0EA 4TRDA 4G4KA 1SYDA 1EYAA 4QUCA 3QWNA 1I6HB 2MUYA 2CW0D 2Z4HA 4ZK9B 1SAPA 2K5WA 5G3LF 1HUNA 2JA5B 4AYBB 1EIGA 2ID0A 4F8MA 3HEJA 2A6HC 3FMCA 2K6AA 2O2LD 1SMYD 2RDFA 4DFAA 1V43A 3S2DB 1STAA 2MJ8A 3NBHA 1HHVA 2KCNA 3RZOB 2RDHA 1R4QB 1U4MA 1OXUA 1PFNA 4L6TB 4A93B 4IQZA 4DA2A 2M9VA 4LMQD 3ONAB 5CR3A 2R93B 3L9AX 4K5WA 3S15B 1I4XA 5JVH3 3KBGA 4RKLA 3BZDB 3PUXA 1D5ZC 1LLRD 4HEDA 3CHBD 3FKIB 5CV9A 2X6LA 3LX0A 2L11A 3KLSX 4BBRB 1SJHD 1EY6A 4QIWB 2F0OA 2F0KA 2OEOA 5D65A 3HRZC 1F9RA 4N9PA 1ZKOA 3OPOA 5CYUA 4KJNA 3HOZB 1SYFA 3M4OB 2AQ2B 2F0LA 3J7AV 1QNKA 3PUYA 2HDLA 4B9WA 1CM9A 3A8IE 2BCOA 1GUSA 1SE2A 3MC0B 4ZRZA 1I50B 2JXMB 2E2IB 5M3FB 3SK8A 4OO1H 4KK7A 4C3JB 4XQNA 3J80E 4IALA 2NVYB 2A68C 3QOJA 1STNA 3TN2A 4IN3A 1G91A 4HCSA 2EYHA 5C44B 1RODA 4FO2A 5EJWA 1O78A 1UAPA 2EOTA 1YNND 2PNRC 3H94A 3S17B 5LL6X 2OXPA 2B2YA 3PUVA 1UEAB 3DWQA 2NBFA 1LT3D 4OIKA 2A6EC 4U68A 3AMUA 5EQ0A 4X3UA 1IKLA 2EYOA 5M5WB 1F9PA 4C1NK 2OT2A 1PTOC 5EPLA 1AW7A 1PTOF 2X69A 4FYDA 1STBA 1VDZA 3A7AB 3AB9A 3D6WA 3NTHA 1JICA 3URYA 3I91A 2H1EA 3L7ZC 3OOCA 3MA2B 3MHBA 5KNBA 1KTKA 2DY7A 2VB3X 4ID6A 2GA4B 2K32A 2L0CA 1X3PA 5AFWA 3M4YA 1BR9A 2WP8J 3NQIA 1HPCA 2JYOA 2N88A 4IZ8A 5FO8B 2PO4A 5JPNC 3TDQA 1AFPA 1SFOB 3FRPB 1WCMB 4OL7A 2F0GA 3JAML 4CKEA 1G8ZD 2JA7B 1GHJA 4KKUA 2A69C 4V190 2DNCA 2NTTA 1QOHA 1SEBD 3FDTA 4WJWA 3BDLA 1BUVT 1EWCA 1K83B 3CKIB 2OF1A 3UI2A 3MWYW 5I6YA 4OO1G 3SEBA 2SNSA 1V1PB 4RHRA 2F0MA 3MVVA 4HCEA 2K5QA 5CV5A 2BDOA 1EEFD 2B2UC 2K03A 1S5CD 5JJZA 2LMCB 3S16B 2O5IC 1B2TA 3IL8A 3NK9A 2WACA 4MN3A 5JPMC 3I4MB 2PCFB 2KUMA 1NR4A 1GUGA 1IW7C 4H13C 4B9XA 2ENBA 2IX1A 1Y8OB 2EPBA 4RA8A 2B8GA 4K5VA 4A3KB 4KHVA 3Q0AA 3KLRA 3HOVB 4KMUC 1JB3A 1X32A 2JA8B 4H0LC 3NTIA 5C4XB 5IGEA 1Q3LA 5IGBA 2SOBA 4X3TA 3T16A 1EQVA 3S9WA 5HGTA 2B63B 2KQ3A 1FYCA 3GD7A 4F88A 2XRSD 4KD4A 1XTCD 2KA7A 1CI3M 1ENAA 5C3EB 1ENCA 5G3LD 1EY0A 3D31A 1AZQA 4J8QA 5EPKA 5KGUA 3J80L 2B2WA 4HAEA 1HXYD 3VR5A 1S5DD 5M5XB 5E4XA 2A6HD 3T56B 2K01A 2AUJD 4RGMA 1LV9A 1LTTD 3BDOA 4OO1I 4FF4A 1S5FD 3NHHA 1OXSC 2C5CA 2NN6I 3V96A 2AWNA 5CV4A 1SNCA 3DWPA 3CU7A 4ZQ3A 3DMUA 1LTRD 1A6XA 2Q8IB 3GTKB 4EQOA 2KJXA 5FO9B 4HMJA 3NPPA 2F0NA 4K2LA 4WRDA 4G57A 3CRLC 1I4PA 1HUMA 3H6MA 1Q8IA 2SDFA 3R8BA 2WV6D 1JQYD 3PIO3 1D2BA 1TWGB 3KF8A 3ND9A 4KD3A 1IKMA 2EYLA 1SE4A 4K8JA 1QE6A 2Z8LA 4DNTB 1ILPA 2RQXA 3EVQA 3SVMA 2J4XA 1L0YB 3D3RA 4DGZA 2FMMA 1HQRD 2F0IA 3HOXB 1OXTA 2AUKA 2DN8A 2L1BA 1I4HA 3R3OA 1DD2A 5DAUA 3NE5B 3C1FA 1PRTC 1HA6A 2XVSA 1PRTF 5IGFA 4C3IB 1SBBB 2BA0A 2N55A 3WOEA 3TZUA 1A3VA 4DAYA 1SNMA 4J6HA 4XDXA 1STGA 1I4GA 1C8CA 2JEAI 1PZJD 2V4DA 4JBWA 2D9UA 4M8AA 5JEAG 5LL6S 3C3LA 4C3HB 1E2VA 1EQTA 1VF7A 5CV6A 3GTJB 1S4ZA 4MIUA 2A68D 1R9TB 2K7VA 4RGNA 4X3KA 1F9SA 1JWUD 2D2CC 4HSVA 1RCVD 2VB2X 1SSOA 2EE1A 2LKVA 1D6EC 1EOTA 2NWGA 4ZKCB 2HUGA 4IUNA 2PPBC 1UUPA 1LTID 3C1EA 4C56C 5KEEA 3MEHA 2JE6I 4H7BA 2F0HA 1V8QA 4IFDJ 1OXXK 1H9SB 1GXDC 4EQNA 3DWAA 2IJ0A 3HGBA 4Y7NB 1SYEA 1GUTA 1F9QA 2E74C 2HDMA 3K7AB 1U4LA 1XXGA 1Y8NB 2B2YC 1FR3A 1ENFA 4A3MB 1CQFA 2IL8A 2XSCA 1TIID 1D1KA 1VCIA 1FNVA 2KEDA 1TY0A 5FO7B 3TP7A 4QUFA 1SJED 4H44C 5D3IB 2NYZD 1STHA 5FLXE 4CJ0B 5ELBA 4IUUA 5C4JB 1SXTA 1STEA 2F0PA 3H09A 4KN4C 5C0XH 1U4RA 2B39A 5I9OA 3VYRA 1GOZA 3KK7A 1LTSD 1PTOH 2Z4IA 1JOOA 1LTGD 3SR1A 1SNPA 1KAAA 2QEJC 3I4LA 1WTWA 1J8IA 3PUWA 2JA6B 4ZLTF 2PW7A 1B50A 2FFKB 1KABA 1MI2A 3MXPA 2F0VA 1SDFA 4XT1B 1G2TA 2A69D 2MPMA 2R7ZB 4DF7A 2A5HA 1V1PA 1CQVA 4A3FB 2ICEC 1WTOA 4L8JA 3RMHA 1VF5C 2WKCA 3NWTA 3OMCA 4C3IG 4G7HC 1G2SA 3AU7A 4MHEA 4HTHA 4IUTA 2J7ZA 3O13A 4ILWA 4BWGB 5D14A 3FPUB 2Z1CA 1DONA 4FNFA 5EPJA 1B53A 4P2CB 1TWCB 2B2TA 1T5XD 1PXUA 2KHSA 1NCVA 3DHQA 1IW7D 1CHPD 1WD1A 2F03A 1RHPA 1B4OA 4PQXA 3BYTB 3KLSA 1LACA 4K5XA 5E3FA 1Y8PB 1CK1A 1W6KA 1A3UA 2F4IA 1R4PB 1O80A 3R2IA 1F2MA 2F0UA 5E1FA 5IODA 2BDNA 3T51B 4E6IA 1JOQA 3SE0A 1CZGA 2H4OA 3MXNA 3LWEA 1TVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STB A;  3NHH A;  1KAA A;  5J39 A;  3NUC A;  1EY8 A;  5DEH A;  5JOB A;  5C4H A;  2EY2 A;  1EY6 A;  4ME5 A;  3SXH A;  2F0O A;  1SNC A;  2F0K A;  2PW7 A;  5CV4 A;  3TP6 A;  1KAB A;  4ZQ3 A;  2EYM A;  2F0S A;  2F0V A;  2OEO A;  3D6C A;  3DMU A;  2EYF A;  3MXP A;  3MZ5 A;  1F2Y A;  4J1M A;  4N9P A;  5EKK A;  5EKL A;  3ERO A;  4ZUJ A;  1NUC A;  3OMG A;  5K5P A;  1TT2 A;  2F3W A;  1RKN A;  5F2D A;  5NUC A;  3RUZ A;  3TP5 A;  5C3X A;  5IIF A;  3TP8 A;  4KJN A;  3EJI A;  3NXW A;  4EQO A;  1KDB A;  4QMG A;  2EY5 A;  1SYF A;  2HQE A;  3NK9 A;  2WAC A;  3NP8 A;  3OWF A;  2EY1 A;  2F0Q A;  4HMJ A;  4PMC A;  2F0L A;  2EYJ A;  1EYC A;  2F0N A;  2LKV A;  4RKB A;  4K2L A;  4NP5 A;  1EYD A;  1A2U A;  1II3 A;  2RKS A;  4IUN A;  4G57 A;  4NKL A;  4WRD A;  1SNO A;  3PMF A;  1SYC A;  4DF7 A;  1SNQ A;  5C3W A;  2PW5 A;  4K8I A;  3H6M A;  3QOL A;  4PMB A;  4K2K A;  4R8N A;  3C1E A;  4LAA A;  4B9W A;  4K14 A;  2F0E A;  3MHB A;  4TRD A;  4B9X A;  2ENB A;  5KEE A;  3MEH A;  4ID6 A;  5CC4 A;  4H7B A;  1SYD A;  2F0H A;  1EYA A;  3BDC A;  1U9R A;  3V2T A;  3ITP A;  5IOC A;  3P75 A;  4KY7 A;  5KGU A;  4DU9 A;  5KIX A;  1KDC A;  4KY5 A;  4K5V A;  2EY6 A;  4KD3 A;  4NMZ A;  5C4Z A;  2EYL A;  2F3V A;  4KHV A;  3OMC A;  4WOR A;  3U9O A;  5HUR A;  4EQN A;  3TME A;  5KYL A;  4K8J A;  5EGT A;  4ZUI A;  1EY5 A;  4F8M A;  1SYE A;  1EZ8 A;  3HEJ A;  2EXZ A;  3SK8 A;  4N9T A;  4KY6 A;  4HTH A;  5I6W A;  5IGE A;  4I65 A;  1A2T A;  1SYG A;  4IZ8 A;  5CV8 A;  3SHL A;  3OSO A;  4F7X A;  2M00 A;  2PYK A;  2QDB A;  3EVQ A;  5IGG A;  1TR5 A;  5KYI A;  2PZW A;  2RBM A;  3VA5 A;  5IGB A;  3T13 A;  2RDF A;  4IAL A;  3SK4 A;  4DFA A;  3QOJ A;  2SOB A;  4DGZ A;  1STN A;  3T16 A;  1EQV A;  4OL7 A;  1STA A;  4K6D A;  2F0I A;  4QB4 A;  2F0F A;  3SK5 A;  1EZ6 A;  4KV6 A;  3S9W A;  3R3O A;  4EVO A;  5HGT A;  2O4X A;  2F0G A;  5DAU A;  2KQ3 A;  3C1F A;  1TQO A;  1A3T A;  2EYH A;  4PNY A;  2PZT A;  3TP7 A;  3E5S A;  3D4D A;  5C6A A;  2KHS A;  4YIJ A;  4KD4 A;  1EY9 A;  3SK6 A;  5IGD A;  5IGF A;  3DHQ A;  3D8G A;  4KTA A;  5CGK A;  3QB3 A;  1SND A;  1STY A;  5J22 A;  3BDL A;  1ENA A;  1STH A;  2PZU A;  1NSN S;  2OXP A;  2F0J A;  3HZX A;  5CR3 A;  2OF1 A;  1ENC A;  5M9O A;  5I6Y A;  2NUC A;  1A3V A;  1EY0 A;  1SNM A;  4J6H A;  4K5X A;  5E3F A;  1JOK A;  1STG A;  4K5W A;  2SNS A;  2F0P A;  2F0W A;  4QF4 A;  4EQP A;  1A3U A;  5ISR A;  4KJO A;  2SNM A;  4RKL A;  5IGC A;  1AEX A;  1EY4 A;  2F0M A;  4ODG A;  2F0D A;  1SYB A;  5C5M A;  1KDA A;  3MVV A;  4HMI A;  2EYP A;  1F2M A;  2F0U A;  4S3S A;  5E1F A;  2EYO A;  2F0T A;  1IHZ A;  5C5L A;  2PQE A;  3NQT A;  5IOD A;  5J1Z A;  4MIU A;  4E6I A;  5I9P A;  5CV5 A;  1JOO A;  3D4W A;  5CV7 A;  3P1H A;  1JOQ A;  4NDX A;  5I9O A;  5CV6 A;  3SR1 A;  5JAV A;  1JOR A;  5CV9 A;  1EY7 A;  3LX0 A;  1SNP A;  5KRU A;  1F2Z A;  3ERQ A; 
#chains in the Genus database with same CATH topology
 1WVL A;  5JOB A;  5ELD A;  2VW9 A;  3GTG B;  1EOV A;  1LT5 D;  5EKL A;  1F2Y A;  2E5L L;  1W6J A;  1YNJ C;  3S2H B;  3ICE A;  1DOL A;  5IIF A;  4IJL A;  5C0X G;  4DUY Q;  5M3F H;  1D1I A;  1YJW A;  3OHX C;  1BF4 A;  4JV5 Q;  4Y52 H;  4L63 B;  3GP7 A;  4C3J H;  2F1M A;  4NKL A;  4DV7 L;  1VQ8 A;  2NVY H;  5BN5 A;  1TKW B;  4A3M G;  3MFG A;  1SLJ A;  3J7A 5;  1NR2 A;  1I3Q B;  1HH2 P;  3IKJ A;  2H5X A;  4PG3 A;  2NZO A;  4OON A;  4KY7 A;  5C44 H;  3JC6 6;  1Q81 C;  3F1Z A;  4AYB G;  3BVZ A;  1X3G A;  2F3V A;  4ZUI A;  1EY5 A;  2NVT B;  3GTG H;  1EZ8 A;  3T1H L;  2ZJQ A;  5I6W A;  1EIF A;  1UWV A;  3M7G A;  2HIX A;  2QDB A;  5IGG A;  1GHK A;  4RG1 A;  1TR5 A;  2PZW A;  1HNW Q;  1AN8 A;  4I7Z C;  2LFN A;  5GAE C;  3KFU A;  3KUP A;  1CHQ D;  3J80 i;  1AZP A;  4IUR A;  4UAI A;  1O7Y A;  2IWH A;  2DJG C;  1S72 A;  1RJT A;  4HN7 A;  5LMU Q;  4QJF A;  3X3N A;  1GVP A;  3ND8 A;  1FNW A;  4AYB E;  1PYW D;  2JA6 G;  2R93 G;  2VS1 A;  2MP1 A;  2J0T D;  1DM0 B;  2F0J A;  2PQA A;  3WWV A;  1Y1W B;  1JOK A;  3KYH C;  2JEB I;  2NVT H;  2VUM B;  4BA2 I;  2WAQ B;  1IHZ A;  3NQT A;  3NBH B;  2NTS A;  4TKO B;  3FKI G;  3I72 A;  4ZYS A;  1LT6 D;  3G6J B;  2BA1 A;  4A3L H;  5KRU A;  2UXC Q;  1L0W A;  1EY8 A;  4A3F G;  2K33 A;  3QO2 A;  3SXH A;  3HOU B;  3GTP B;  2EYF A;  3LWU A;  4BS9 A;  4ZUJ A;  1PRT D;  1E0B A;  1XX8 A;  2K5V A;  1OO9 B;  1FD7 D;  1HR0 L;  3H91 A;  2F3W A;  5FLX L;  3EFX D;  2MO0 A;  2R6G A;  1XJV A;  3EJI A;  3L3O C;  4UHV A;  3CCL A;  2EJG C;  4DN4 M;  4C1N I;  3HG9 A;  5C4H A;  5KYI A;  1A2U A;  2Q2H A;  1SFO H;  2Q8R E;  1B1Z A;  1PRT B;  3HOW B;  1WCM H;  4KN7 C;  1HJP A;  1QG7 A;  2VUM H;  1IL8 A;  5CC4 A;  3I2Z A;  3I4O A;  5C0X I;  4OGQ C;  1FGU A;  3DM1 A;  3ITP A;  1X9N A;  3CPW A;  4QIW E;  4NXN Q;  3TRZ A;  1TS4 A;  3R93 A;  4JI6 Q;  3KJO A;  4ZKB B;  4LF4 Q;  3J81 E;  2HHH L;  5M3F G;  1IZ6 A;  1K83 H;  2FIN B;  3DUZ A;  3GTP H;  5GRO A;  3A7L A;  3BYY B;  4JBJ A;  1X54 A;  5DM7 3;  4C3J G;  2I46 A;  3NBI A;  5TSS A;  3RZD B;  3OSO A;  3IFT A;  5ELC A;  3EA6 A;  1WTX A;  4X66 Q;  4Q5V A;  1NY4 A;  4B3M L;  2F0F A;  5ELF A;  4DAM A;  1M1K C;  5C44 G;  3I4N B;  2Q8T A;  1JJ2 A;  5DLQ E;  4PNY A;  2PZT A;  3QIA A;  1N36 Q;  3GTO B;  1EEI D;  4DUZ Q;  2VNU D;  4GNX B;  1RTN A;  2M2L A;  1QVF A;  3CC7 A;  3I8Z A;  1QUQ A;  1VQG A;  4PZ8 A;  4KKT A;  1HR0 W;  3S16 H;  1MBY A;  5GAG C;  4KJO A;  2SNM A;  3A54 A;  5LMN Q;  4A75 A;  1UE7 A;  4CKB A;  3HOY B;  3CCQ A;  2D5D A;  1AE2 A;  2F0T A;  5C5L A;  3RZD H;  1PFS A;  4HSP A;  2TMP A;  3CD6 A;  1PH5 A;  3ERQ A;  5COR A;  5IT9 E;  4BA1 I;  5DEH A;  2MGS A;  1MSG A;  3CCJ A;  1EYG A;  1LO5 D;  2FMC A;  1K28 A;  3BU2 A;  5CBA E;  1CZW A;  3OW2 A;  2UUC Q;  1BDO A;  3J7A F;  1PH8 A;  3GO5 A;  4DNR B;  3HOV H;  2KEE A;  5NUC A;  4X62 L;  2JA8 H;  4QMG A;  2EY5 A;  2NZ1 D;  1KNA A;  1MKH A;  3CRK C;  3GQB A;  3KDF A;  5ELE A;  5A2Q E;  1PZK D;  2Y0S B;  4JVZ A;  5ELO A;  2QCP X;  3T1Y L;  2PMZ B;  2L9H A;  3FVQ A;  4B08 A;  2ZXP A;  4FP5 D;  3GTL B;  2RVL A;  2OTJ A;  2L12 A;  4A3L G;  1P16 A;  1K0R A;  1UE6 A;  4GN5 A;  3VYU A;  4JI3 Q;  1J5E L;  1Y69 U;  1DYQ A;  1CTM A;  3ERS X;  2QDL A;  2CH4 W;  1YI2 A;  2ZM6 L;  4XXE A;  5C4Z A;  2TSS A;  3PF4 A;  2K5H A;  1JE5 A;  2B2V A;  5KYL A;  1K8O A;  3R2T A;  4O1N A;  2R7D A;  1ICW A;  4DV5 Q;  5C3E H;  2EXZ A;  1PYB A;  3QJY A;  4N9T A;  3PGZ A;  2RHQ B;  5EBD A;  3K5O A;  5FK9 C;  4GZY C;  2M00 A;  1N32 L;  1H9R A;  1WCM G;  3NEL A;  3VYT A;  3VR4 A;  4OWW B;  2VUM G;  2I07 B;  2WAQ G;  3G48 A;  4K6D A;  4DK0 A;  3HS0 C;  2DY8 A;  5BN4 A;  3M7N A;  4DR7 L;  5K36 H;  2O4X A;  3OYY A;  1L1O C;  4DR4 Q;  3GTL H;  1IBM Q;  1K73 C;  1S5E D;  4Z9C B;  1Y1V B;  4B3T Q;  1KLG D;  2K75 A;  4KKS A;  3VR6 A;  4KTA A;  2E76 C;  4JI2 Q;  2G9D A;  5J22 A;  1HFG A;  1ZYR C;  3W3A A;  3A56 A;  1PFM A;  3CQZ B;  3GTK H;  3NSW A;  2UU9 Q;  4DV1 L;  2EZV A;  3OTO Q;  4ODG A;  1IBK L;  1EUJ A;  1DOK A;  2EYP A;  1YJ9 A;  1B44 D;  2JN4 A;  2NVX B;  1JR0 D;  3KBX A;  1CA5 A;  2KBN A;  2WAQ E;  4NDX A;  3U9S A;  1K8G A;  4HIO A;  5E4W C;  1A0I A;  2MHV A;  3CCM A;  4M1U B;  3SDZ A;  4HIM A;  1PH7 A;  1TWG H;  2B2U A;  2EY2 A;  4ME5 A;  2IPK D;  4RGT A;  1QB5 D;  3D6C A;  2WKD A;  3S1N B;  3EBE A;  3OMG A;  4LFB Q;  3QG1 A;  2EDG A;  1Q12 A;  3TP8 A;  3AQQ A;  3U4Z A;  3GTM B;  4DV3 Q;  1VQL A;  4DPG A;  1VMC A;  2I0Q A;  2FHT A;  1SNO A;  3CW2 C;  3I7F A;  3PMF A;  5C3W A;  2ES2 A;  4LFC Q;  1N8R C;  4K2K A;  4LAA A;  4TVA B;  4OX9 L;  4BBS B;  3NWS A;  5IOC A;  3CCR A;  3D0F A;  1J9O A;  4A3K G;  4RH6 A;  4LF9 Q;  4HJ5 A;  1DCZ A;  3HOV G;  4IUV A;  2RA4 A;  4RFB A;  4JI1 L;  3BS1 A;  3TME A;  1KIX A;  4HID A;  1ZXT A;  2JA8 G;  3Q23 A;  5C4X G;  2QKI C;  5I2X A;  5IYC G;  1GUN A;  3A5U A;  3E0J A;  3S1N H;  2CQA A;  4I65 A;  1G29 1;  1ESF A;  1YNJ D;  1HNX Q;  1QWY A;  5IP7 H;  5IWA L;  1BBX C;  4LF7 Q;  4QY7 A;  1IYV A;  4C3H H;  1HZB A;  2B63 G;  2DNE A;  5J3B A;  5JVG 3;  1A3T A;  3M85 A;  3GTJ H;  1EL0 A;  1D8L A;  2BE5 C;  4XQQ A;  2YTV A;  4R4T A;  4GKK Q;  2VY3 A;  1R9T H;  2BOS A;  1I4Q A;  1WTR A;  1BBW A;  3TBI B;  4DR2 L;  1JWM D;  4P71 A;  2K05 A;  3QB3 A;  5C3E G;  5GQO A;  2A74 C;  1X3Q A;  2PZU A;  1ET6 A;  3MTS A;  3J81 L;  3RR5 A;  2ZT9 C;  3W2D A;  4L5Q A;  1WI5 A;  4EQP A;  1TS3 A;  4QF4 A;  3BZC A;  4LF5 Q;  5AJ3 Q;  1B9M A;  2GVA A;  2VQF L;  3H3V C;  5C5M A;  3HP3 A;  1EFI D;  4BY7 B;  4LFA L;  4FXG C;  2RF4 A;  3K0Y A;  4LF6 Q;  4P74 A;  3ULJ A;  5K36 G;  1IL2 A;  2WIN B;  3BVM A;  2Z6B A;  4H02 A;  1IYU A;  2HIV A;  1JOR A;  2RDG A;  2IHE A;  4MZ9 A;  1XWE A;  3K5M A;  1Z47 A;  5K5P A;  1KQS A;  5FLX c;  3KLW A;  2K28 A;  3GTQ B;  3JAM E;  2F0S A;  1WTQ A;  3GDE A;  3ERO A;  1VQE A;  4A3I B;  3F2U A;  1GUO A;  5IY0 A;  4IJH A;  4DK1 A;  5F2D A;  5C3X A;  1YHB A;  4Y7N H;  1WD0 A;  1X3F A;  2C9O A;  1Z6H A;  3OIP A;  5JJL A;  1U4P A;  1C48 A;  3K7A H;  1PLF A;  3MXU A;  1UEB A;  3VA7 A;  1AP0 A;  1JCK B;  2EYJ A;  1KRT A;  3ZYY X;  1EYD A;  1II3 A;  3IFD A;  3CCE A;  3A8J E;  1BNZ A;  2YU9 B;  2N78 A;  3C46 A;  4JI5 L;  1LYL A;  4L5S A;  3Q8D A;  1H9M A;  2XWB B;  4CDF C;  2XRQ D;  4DV4 L;  2QF7 A;  1VS0 A;  4BY7 H;  2LS0 1;  1TXY A;  3T4A C;  2X6G A;  1BXT A;  5IT9 L;  1KDC A;  4KY5 A;  4CDD C;  1FJG L;  3F8T A;  2JQO A;  4LJZ C;  4U67 3;  3GTQ H;  2CCZ A;  4CBV A;  1CUK A;  3SHL A;  2KEC A;  2VXW A;  5A2Q L;  4A3I H;  4RHS A;  5IYB G;  1E2W A;  1EFW A;  3T53 B;  1G51 A;  4K6L A;  4LWC A;  3HOX G;  2R3Z A;  3EQL C;  1XNQ L;  4ULL A;  2BH8 A;  4YWM A;  1YNX A;  4XYO A;  2KHJ A;  2YU9 H;  3OW7 A;  2AMC B;  3I90 A;  1QZH A;  1LT4 D;  1Q1B A;  4AQY L;  3D8G A;  5JEA J;  3J81 j;  1EU3 A;  1STY A;  4EQ5 A;  1SE3 A;  4MTK A;  1O7Z A;  1K0S A;  4CGY B;  3RLF A;  1SE8 A;  2ICI A;  1WTP A;  2HCC A;  1BCP C;  2SEB D;  2AQ3 B;  1EU4 A;  1FNU A;  4X3S A;  4OEL B;  3E0E A;  1BCP F;  3CCS A;  1CT1 D;  5IP7 G;  1HA5 A;  2R7Z H;  1KDA A;  4OEM B;  2MO1 A;  4C3H G;  4S3S A;  1LUZ A;  2JP1 A;  2IX3 A;  1Q90 A;  2L5T A;  1PMR A;  1DGS A;  4FVM A;  1CKM A;  4XT3 B;  1DXM A;  3P20 A;  5I2Y A;  1DOM A;  1RIP A;  1N33 Q;  5CV8 A;  2XN9 C;  4J1M A;  4DR5 Q;  3PUZ A;  2EVB A;  1RKN A;  4DR3 L;  2HQE A;  4UY8 C;  4HJ7 A;  1TWA B;  1EYC A;  4R9W A;  1L0X B;  4FXD A;  2N49 A;  1KD1 C;  1H9J A;  1SR3 A;  4ABN A;  4DXF A;  2C35 B;  2XWJ B;  4R8I A;  3K6O A;  4IUP A;  1VMP A;  2NN6 H;  2ALY B;  1TWC H;  3BZK A;  1QCB D;  5KNC A;  4N8F A;  4P75 A;  5BN3 A;  4DNI A;  1TS5 A;  5LHY 1;  3U9O A;  4WOR A;  3H15 A;  1RTO A;  2OQ0 A;  3E9I A;  3SGI A;  3KF6 A;  3MAQ A;  2R92 B;  3MEF A;  2ZXO A;  2PNH A;  3E6Z X;  2G9H D;  1FGB D;  2K1B A;  3VA5 A;  3CXC A;  1PH1 A;  1ZEQ X;  5DM6 3;  1YIT A;  4IOA A;  2L55 A;  3N6R A;  1CSP A;  1TWA H;  4BY7 G;  3WOF A;  4AIM A;  2KCT A;  3M3Y B;  3N52 A;  5ELN A;  1TQO A;  1PDQ A;  3HFZ B;  3LNN A;  1KNE A;  1WYD A;  5C6A A;  2E5L Q;  1C4Q A;  4QQB X;  1V1O A;  4FF3 A;  5CBE E;  2E2H B;  3I73 A;  3X3M A;  2F4V L;  2BH2 A;  1MSH A;  3VYS A;  4XIG S;  4DV6 L;  5T1G A;  1WFQ A;  3S2H H;  1HNZ L;  3Q6S A;  4RGO S;  1X56 A;  2E2D C;  5ISR A;  4DV7 Q;  1OXV A;  1QVC A;  4BXX H;  3I70 A;  1TWH B;  1E2Z A;  1HRJ A;  5IGC A;  2B2W C;  1UE5 A;  5DNF A;  1VQB A;  3GV6 A;  1ESR A;  3OWE B;  4ZAI A;  5FOB B;  4FXK C;  2CW0 C;  1QIL A;  5I9P A;  4GOP A;  3D4W A;  4YCV A;  1I3Q H;  5IP9 H;  2AWO A;  4PMC A;  3NUC A;  3I56 A;  1RD9 D;  2CQO A;  3M3Y H;  1NNX A;  4Q0F A;  3BJU A;  3T1H Q;  1SMY C;  3TZD A;  3K57 A;  5EKK A;  3S1R B;  3OIQ A;  5FJ8 H;  3CP0 A;  2XNA C;  1BBU A;  3RUZ A;  1X6O A;  3K5N A;  2E2H H;  2B2V C;  2XIW A;  1KDB A;  5T1I A;  4NW2 A;  2R7Z G;  3CC2 A;  1ZYR D;  2UUA L;  1A8V A;  1SYC A;  1L1O B;  1VQJ A;  3QOL A;  4R8N A;  1VQK A;  4IFD H;  4MNO A;  1UNS A;  3RD4 A;  4DAP A;  4TSS A;  5EKI A;  3ZJY C;  3TSS A;  4C2M B;  3P75 A;  1BOS A;  5CMD A;  1YVC A;  2B8F A;  5A35 A;  2YYZ A;  3IAY A;  1CKN B;  1EWH A;  4MTN A;  5HUR A;  4P73 A;  4RCO A;  3NTK A;  2QGQ A;  2E8G A;  5FLM H;  2IY5 B;  3E9H A;  4A3J B;  3S1R H;  4A4I A;  1SYG A;  2R61 A;  1Y1W H;  1PFB A;  1UE1 A;  2PYK A;  2RBM A;  2WII B;  1TY2 A;  3T13 A;  1JJG A;  3SK4 A;  1N34 L;  1JB7 A;  4JI4 Q;  2NN6 G;  3ER0 A;  4JYA L;  1YBY A;  2F3I A;  1EZ6 A;  2A73 B;  3RLO A;  4G7Z C;  4FF2 A;  2OCE A;  1U0L A;  3J81 c;  4A3G B;  1HR0 Q;  2MFI A;  1Q8K A;  4DV0 L;  1E7Z A;  2RCN A;  3HOU H;  4HJ8 A;  2UXB L;  4EX5 A;  1Q82 C;  4APV A;  4C2M H;  1YJN A;  1EIH A;  4LNQ A;  4V0B A;  2O5J C;  4PV1 C;  2F0W A;  2IT1 A;  2ASB A;  1SMX A;  4DUZ L;  4O42 A;  4CJ1 B;  3ULP A;  4JBK A;  3Q22 A;  3MFY A;  3V05 A;  3MXG A;  2F0D A;  1SYB A;  4A3C H;  1NBW A;  2PQE A;  4RAU C;  5J1Z A;  3HOW H;  5C0X J;  1QJO A;  2VQE L;  4YY3 L;  1XPR A;  2KCM A;  2IHF A;  4DAV A;  3A55 A;  3DEO A;  4UDU C;  2HHH Q;  2Z6K C;  1EQR A;  2EYM A;  4A3E B;  4X65 L;  3MZ5 A;  1LM0 A;  1H9S A;  4QCL A;  4A3G H;  3CAM A;  3S1Q B;  1NUC A;  4JK1 C;  2BE5 D;  1ILQ A;  1HCZ A;  3TP5 A;  4BXX G;  4LK1 C;  4KHP L;  1E22 A;  3NP8 A;  4YHH L;  3RLN A;  4B3M Q;  1XMO L;  3NEN A;  4CKC A;  3K58 A;  4JCV E;  1QNU A;  4OWX B;  2RSN A;  5IT9 c;  3BVG A;  5IP9 G;  1NJI C;  1PZI D;  3J7Y W;  1YNN C;  3HKZ B;  3I4N H;  5I4D A;  1U9R A;  3V2T A;  1HTL D;  1X3E A;  1S5B D;  2IW3 A;  3GTO H;  5JEA H;  3U50 C;  2RSO A;  2CWA A;  5BR8 L;  1WTH A;  4F87 A;  3G7L A;  1TS2 A;  5FJ8 G;  5M3M B;  1TU2 B;  2ZXR A;  2AKW B;  3W1B A;  1P8L A;  4DK3 C;  3PO2 B;  1CKO A;  1IBL L;  1VQ9 A;  1YHQ A;  4LF8 L;  1PA6 A;  4CHT B;  4A3E H;  1A2T A;  3I3C A;  2KOL A;  3S1Q H;  1V1Q A;  4F7X A;  4IFD G;  1WTV A;  1CFM A;  1B9N A;  1NTG A;  3HOY H;  1L2F A;  2IX0 A;  3ULL A;  4QB4 A;  3SK5 A;  2LY7 A;  2L4N A;  1MD2 D;  4J15 A;  1XTD A;  2HQL A;  3E5S A;  1GJX A;  3D4D A;  5COY A;  1JE4 A;  1RF2 D;  4YIJ A;  1RDP D;  2D62 A;  3SK6 A;  4X62 Q;  2KVM A;  3S1M B;  4CJ2 C;  3GV3 A;  5M5Y B;  1GO3 E;  1VQC A;  1ONL A;  3C2P A;  1NSN S;  3HZX A;  1HFN A;  3D4R A;  4ZCK A;  3T1Y Q;  5M9O A;  1E3P A;  4XQJ A;  2NUC A;  1Y1W G;  4JI7 Q;  1D5X C;  2EJM A;  1I4R A;  3PO2 H;  1X55 A;  2AQ1 B;  4YWK A;  1HTP A;  1A15 A;  3FPP A;  3CCV A;  3H3V H;  4DXG A;  1F2L A;  1K8M A;  1B7Y B;  3PO3 B;  4K0K L;  2EJF C;  1J5E Q;  3S14 B;  4JBM A;  1VQ5 A;  4XTC S;  1H9K A;  1B3A A;  5CV7 A;  4IOC A;  3P1H A;  1M4V A;  5KND A;  2ZM6 Q;  4BY1 B;  2K04 A;  5JAV A;  4NXM Q;  1EY7 A;  1F2Z A;  1DJR D;  1XYI A;  4X64 L;  1VQO A;  4FF1 A;  1HQM C;  3HOU G;  3VR3 A;  1I5F A;  4R1J A;  1BQQ T;  1V9P A;  1G6Z A;  4XYQ A;  3TP6 A;  4RCN A;  5J39 A;  4R4Q A;  2PQA B;  4EGV A;  1N32 Q;  1VQI A;  2V1C C;  3S1M H;  4GKJ L;  1E24 A;  3VDY A;  2EY1 A;  2F0Q A;  1I94 L;  4DR7 Q;  3FP9 A;  4G7O C;  3Q24 A;  4A3B B;  3HOW G;  2PW5 A;  5H1S E;  4K8I A;  3AFQ A;  2E75 C;  2HCI A;  2CFM A;  1BCP D;  4OHJ A;  4WFN 3;  2RHS B;  3PV0 A;  3PO3 H;  3BDC A;  4IUQ A;  3A0J A;  4DV3 L;  3FEW X;  1PH2 A;  3BG3 A;  4RWS C;  4DU9 A;  1CA6 A;  3WDN A;  5KIX A;  1VQ6 A;  3K59 A;  1Y1V H;  3UDX A;  5EBC A;  2JSO A;  2CKZ B;  1VQA A;  2EY6 A;  4NMZ A;  3DEP A;  4TQU S;  5D3D A;  1ASZ A;  1ET9 A;  1BCP B;  1DZ1 A;  3H0G B;  5GAD C;  5EGT A;  4DV1 Q;  2DGY A;  2RCF A;  1IBK Q;  1LTA D;  3CQZ H;  4KY6 A;  1D5M C;  3G6E A;  1BO0 A;  3A8K E;  2E2J B;  1T5E A;  3PF5 A;  3AYH B;  2NVX H;  2WB1 B;  1VQ7 A;  3I4N G;  1HZA A;  3L0O A;  2PI2 E;  4KV6 A;  4EVO A;  4JPB W;  1M8A A;  2B2T C;  4A3B H;  3PQI A;  4KI0 A;  1TWF B;  1LAB A;  5IGD A;  1EY9 A;  4RMF A;  2A1A A;  2YTX A;  3M4P A;  5CGK A;  4IFD I;  3PIP 3;  4A3D B;  1SND A;  1KLU D;  2KCC A;  1F77 A;  4A3E G;  4OXP A;  3UDG A;  1NMG A;  1ML0 D;  1W3S A;  2FJ2 A;  3DXJ C;  3KOJ A;  2CVR A;  4KHZ A;  4DV2 L;  1LTB D;  1QVG A;  3GTM H;  2ATW A;  1AEX A;  1XPU A;  4PMW A;  3HOY G;  1EY4 A;  3LGJ A;  4OX9 Q;  3P7J A;  3RNU A;  4HMI A;  4JI0 L;  3VR2 A;  2MNA A;  2LSS A;  2E2J H;  2QIL A;  4GS3 A;  1O7L A;  1JWS D;  4BBS H;  4LF5 L;  1HZ9 A;  4JI1 Q;  4HR7 B;  4K14 A;  1PHJ A;  3HKZ G;  2UUB L;  2A6E D;  1Z7T A;  1VQH A;  1NAP A;  1N9W A;  2Q2U A;  1KC8 C;  3F2C A;  1TWF H;  2K5D A;  1PTO D;  1Q1E A;  1SRU A;  1JC7 A;  1TT2 A;  4UP7 A;  1XPO A;  3PO2 G;  5FKA C;  1C7Y A;  1GUW A;  1MGS A;  2CHB D;  3NXW A;  2Y0S G;  4JOI A;  3K5L A;  4A3D H;  3OWF A;  2GN5 A;  5IWA Q;  4RKB A;  4PZ6 A;  1Q46 A;  1D7Q A;  4NP5 A;  4B3S L;  2RKS A;  4OIJ A;  2NB0 A;  2NVQ B;  1I6V C;  1SNQ A;  1PTO B;  4PMB A;  2OWO A;  1JJC B;  2F0E A;  4FDB A;  4TRD A;  3UE1 A;  3JAM c;  1T9H A;  4G4K A;  1SYD A;  1EYA A;  1Y14 B;  4QUC A;  3QWN A;  1I6H B;  2MUY A;  3HKZ E;  2CW0 D;  2Z4H A;  4ZK9 B;  1SAP A;  2K5W A;  5G3L F;  2P5Z X;  2JA5 B;  1HUN A;  4AYB B;  1EIG A;  1VQ4 A;  1VQM A;  2ID0 A;  4F8M A;  2VQF Q;  3KDF B;  3G71 A;  3HEJ A;  4X6A H;  2A6H C;  1LTL A;  3FMC A;  4LFA Q;  2K6A A;  2O2L D;  2Y0S E;  4LW1 A;  1SMY D;  4GLV B;  2PMZ E;  1AH9 A;  4IPG A;  4JI8 L;  2K14 A;  2RDF A;  4DFA A;  1V43 A;  1GM5 A;  3S2D B;  1STA A;  3PO3 G;  3W5O A;  2I5L X;  2MJ8 A;  3NBH A;  4DR1 L;  1XNR L;  1HHV A;  2KCN A;  3RZO B;  1Y1V G;  2LXK A;  5E7N A;  2RDH A;  1R4Q B;  1L1O A;  1NMF A;  3F2B A;  1U4M A;  1OXU A;  1PFN A;  2K52 A;  4L6T B;  1VQF A;  4A93 B;  4IQZ A;  4DA2 A;  1SN8 A;  2M9V A;  4LMQ D;  3ONA B;  5CR3 A;  2R93 B;  3L9A X;  2JA5 H;  4K5W A;  3S15 B;  1I4X A;  5JVH 3;  4JI5 Q;  3KBG A;  4RKL A;  3BZD B;  1YIJ A;  1KXL A;  3PUX A;  5IYD H;  4DV4 Q;  1D5Z C;  1LLR D;  4CDE C;  2VZA A;  4CDC C;  4HED A;  4POF A;  4A3B G;  3CHB D;  3KF8 B;  3U58 A;  3FKI B;  4GLX A;  5CV9 A;  2X6L A;  3LX0 A;  2L11 A;  3KLS X;  4BBR B;  2PI2 A;  1FJG Q;  1SJH D;  1HZC A;  1EY6 A;  5L37 A;  4QIW B;  3TEH B;  2F0O A;  2F0K A;  2OEO A;  5D65 A;  5GAH C;  3HRZ C;  3RZO H;  1F9R A;  4N9P A;  3PIP A;  3AFP A;  4JC0 A;  1K9M C;  1ZKO A;  4UP8 A;  2MQH A;  1CSQ A;  3OPO A;  5IE8 A;  5CYU A;  4KJN A;  4A93 H;  3HOZ B;  1XMQ L;  1SYF A;  2ZTD A;  3M4O B;  2AQ2 B;  2F0L A;  1XNQ Q;  3J7A V;  4DR6 L;  1N33 L;  1QNK A;  3PUY A;  2HDL A;  1Q86 C;  3S15 H;  4B9W A;  4BBS G;  1CM9 A;  2K4K A;  3A8I E;  1Q7Y C;  2BCO A;  1GUS A;  1K8A C;  4AQY Q;  4B3R L;  2WB1 G;  4O0A A;  1PH6 A;  1BKB A;  1SE2 A;  3MC0 B;  4ZRZ A;  2UXD L;  1I50 B;  4P72 A;  4DAY B;  4NPS A;  4BBR H;  4GNX A;  2JXM B;  2E2I B;  5M3F B;  3SK8 A;  4OO1 H;  4KK7 A;  4C3J B;  3J80 c;  3B6Y A;  4XQN A;  3J80 E;  4DUY L;  4IAL A;  2NVY B;  2A68 C;  4R4C A;  3QOJ A;  3HOZ H;  1S3O A;  2I5H A;  1WOC A;  1U5K A;  1STN A;  4QGU A;  1BVS A;  4JV5 L;  3TN2 A;  2QA4 A;  4IN3 A;  1G91 A;  3UDI A;  2HD3 A;  3CF5 A;  4HCS A;  1ICF B;  2EYH A;  2WB1 E;  5C44 B;  1ROD A;  4FO2 A;  5EJW A;  1KL9 A;  2ZJP A;  1O78 A;  1UAP A;  4DR3 Q;  2EOT A;  5HGQ A;  1YNN D;  2PNR C;  3H94 A;  3S17 B;  1I50 H;  2EIF A;  5LL6 X;  2OXP A;  2B2Y A;  3PUV A;  1UEA B;  3DWQ A;  2NBF A;  1LT3 D;  4OIK A;  1A63 A;  2A6E C;  1PV4 A;  4U68 A;  3AMU A;  2E2I H;  5EQ0 A;  4X3U A;  2NZH A;  1IKL A;  1RL2 A;  2EYO A;  5M5W B;  1F9P A;  4C1N K;  2OT2 A;  1PTO C;  5EPL A;  4ALP A;  1AW7 A;  1PTO F;  4R4I A;  1HNW L;  4AH6 A;  2X69 A;  4FYD A;  2AHO B;  1STB A;  1VDZ A;  5JJI A;  3A7A B;  1AE3 A;  3AB9 A;  3D6W A;  3NTH A;  1YEZ A;  4A3I G;  5LMU L;  2JA5 G;  1JIC A;  3URY A;  3I91 A;  5JJK A;  2H1E A;  5IYD G;  2R92 H;  3S17 H;  3L7Z C;  3OOC A;  4LUZ A;  2Q2T A;  4DK6 C;  2Z0S A;  3MA2 B;  3MHB A;  5KNB A;  1KTK A;  2DY7 A;  2VB3 X;  4ID6 A;  2GA4 B;  2K32 A;  2F4V Q;  5M5W H;  2L0C A;  1YZ6 A;  4DV6 Q;  1X3P A;  5AFW A;  1HNZ Q;  3M4Y A;  3AEV A;  3TS2 A;  2UXC L;  3CME A;  2XTI A;  1BR9 A;  2WP8 J;  1MJE A;  4A93 G;  2WFW A;  3NQI A;  2CH4 A;  1HPC A;  2JYO A;  2A8V A;  1KAW A;  4WJ3 M;  1ASY A;  3J7Z C;  2N88 A;  4IZ8 A;  5FO8 B;  2PO4 A;  5JPN C;  3TDQ A;  1TWH H;  1AFP A;  1MJC A;  1SFO B;  3L2P A;  3FRP B;  4PZ7 A;  1FL0 A;  1WCM B;  4OL7 A;  2F0G A;  3JAM L;  1KRS A;  4CKE A;  1G8Z D;  4BBR G;  2JA7 B;  1E1O A;  1GHJ A;  4JI4 L;  4KKU A;  4IPH A;  2A69 C;  4V19 0;  2DNC A;  2NTT A;  1QOH A;  1SEB D;  3FDT A;  2G5D A;  1BUV T;  3BDL A;  4WJW A;  4OWT B;  1EWC A;  2QW7 A;  1K83 B;  1MHW C;  2OF1 A;  3CKI B;  3MWY W;  4NXN L;  3UI2 A;  5I6Y A;  2UUA Q;  4OO1 G;  4JI6 L;  3SEB A;  2SNS A;  1V1P B;  4LF4 L;  3HOZ G;  4RHR A;  1K3R A;  2F0M A;  3W1G A;  2N3S A;  3MVV A;  2OTL A;  1MIU A;  4HCE A;  1JMC A;  2K5Q A;  5CV5 A;  1KHI A;  2BDO A;  1EEF D;  4X66 L;  4HIK A;  3I55 A;  2B2U C;  3IRB A;  3K7U C;  2K03 A;  2EXD A;  2YV5 A;  3G4S A;  2DJF C;  1N36 L;  1S5C D;  5JJZ A;  1FVI A;  2LMC B;  3S16 B;  2O5I C;  2JA7 H;  1B2T A;  3IL8 A;  1N34 Q;  3NK9 A;  2WAC A;  4ME3 A;  4MN3 A;  4A3J H;  5JPM C;  3I4M B;  4JYA Q;  2PCF B;  2KUM A;  4IPC A;  1PH4 A;  1NR4 A;  1QZG A;  3F2D A;  3STB D;  1GUG A;  4POG A;  1IW7 C;  4H13 C;  4B9X A;  5LMN L;  2ENB A;  2IX1 A;  4DV0 Q;  1Y8O B;  2UXB Q;  2EPB A;  3NEM A;  4RA8 A;  2FXQ A;  2B8G A;  3K80 C;  4K5V A;  3K8A A;  4A3K B;  1PVO A;  4KHV A;  4L5T A;  3Q0A A;  3KLR A;  3HOV B;  4KMU C;  2HT1 A;  3UE0 A;  2R92 G;  1JB3 A;  1X32 A;  2JA8 B;  3RN2 A;  4H0L C;  3HKS A;  3NTI A;  5C4X B;  5IGE A;  1Q3L A;  2UUC L;  1EWI A;  3MXN B;  5IGB A;  2VQE Q;  3U4V A;  4YY3 Q;  2SOB A;  4X3T A;  3T16 A;  1EQV A;  3I4M H;  3S9W A;  1C0A A;  5HGT A;  2B63 B;  2KQ3 A;  1FYC A;  3GD7 A;  4O2D A;  1B3Q A;  4F88 A;  2XRS D;  4X65 Q;  3KJP A;  1K3B C;  4KD4 A;  1VQD A;  2ZTC A;  4JI3 L;  2A19 A;  4L5R C;  1XTC D;  2KA7 A;  1CI3 M;  4KHP Q;  3J81 i;  4YHH Q;  1ENA A;  4WJ4 A;  1B8A A;  3KF6 B;  5C3E B;  1ENC A;  1XMO Q;  1X65 A;  5G3L D;  1EY0 A;  4A3K H;  1GKH A;  3D31 A;  1AZQ A;  4J8Q A;  4JOI C;  5EPK A;  4DV5 L;  2B3G A;  5KGU A;  4LUO A;  3J80 L;  2B2W A;  4HAE A;  1HXY D;  3VR5 A;  5C4X H;  1S5D D;  5IYC H;  5M5X B;  5E4X A;  2A6H D;  3T56 B;  4JI7 L;  2K01 A;  2AUJ D;  4RGM A;  1LV9 A;  1LTT D;  3M9B A;  4GLA C;  5BR8 Q;  5LMN W;  3BDO A;  4OO1 I;  4FF4 A;  1S5F D;  5FLM G;  3NHH A;  1OXS C;  2C5C A;  2NN6 I;  3V96 A;  1IBL Q;  4HJ9 A;  2AWN A;  2L15 A;  4UPA A;  5CV4 A;  1SNC A;  3DWP A;  4LF8 Q;  3CCU A;  2B63 H;  4DR4 L;  3CU7 A;  4ZQ3 A;  3DMU A;  5M3M H;  1LTR D;  1A6X A;  1IBM L;  4B3T L;  1IXR A;  2Q8I B;  4NXM L;  3GTK B;  1VQP A;  4EQO A;  3DM3 A;  2KJX A;  4JI2 L;  5FO9 B;  4HMJ A;  3NPP A;  2F0N A;  4K2L A;  4WRD A;  4G57 A;  3CRL C;  1I4P A;  4GOP B;  1HUM A;  3H6M A;  1Q8I A;  2SDF A;  3R8B A;  2UU9 L;  2WV6 D;  3QR8 A;  3OTO L;  1JQY D;  3PIO 3;  2QEX A;  5M5X H;  1D2B A;  2JA9 A;  1TWG B;  3PCO B;  3CMA A;  3KF8 A;  3ND9 A;  4KD3 A;  1IKM A;  2EYL A;  2JA7 G;  5M5Y H;  1SE4 A;  4K8J A;  1QE6 A;  1E1T A;  4NB3 A;  4A3C G;  2Z8L A;  4DNT B;  4A3J G;  1ILP A;  2RQX A;  4K0K Q;  4GN4 B;  3EVQ A;  3SVM A;  4LFB L;  2J4X A;  1L0Y B;  3A5Z B;  3D3R A;  4DGZ A;  2FMM A;  4X64 Q;  1HQR D;  3S14 H;  2OQK A;  2F0I A;  3HOX B;  1OXT A;  2AUK A;  3FHW A;  3RN5 A;  2DN8 A;  2L1B A;  1I4H A;  3R3O A;  1DD2 A;  5DAU A;  3NE5 B;  4LFC L;  4BY1 H;  3C1F A;  4A3G G;  1PRT C;  1HA6 A;  2XVS A;  4A76 A;  1PRT F;  5IGF A;  1IYJ B;  4C3I B;  2XGT A;  1SBB B;  4GKJ Q;  2BA0 A;  2N55 A;  1C9O A;  3WOE A;  1I94 Q;  4JW0 A;  3TZU A;  4LF9 L;  3CPF A;  1A3V A;  4DAY A;  1SNM A;  4J6H A;  4XDX A;  1STG A;  1O7I A;  1I4G A;  1C8C A;  2JEA I;  4YCU A;  1PZJ D;  2V4D A;  1YHA A;  3K0X A;  4JBW A;  3I4M G;  1PYS B;  2D9U A;  4M8A A;  5JEA G;  5LL6 S;  3C3L A;  1EIY B;  4C3H B;  1E2V A;  1EQT A;  1VF7 A;  5CV6 A;  1HNX L;  3GTJ B;  1S4Z A;  5IYB H;  1S40 A;  4MIU A;  4LF7 L;  2A68 D;  1R9T B;  3PSI A;  3HOX H;  2K7V A;  4RGN A;  4X3K A;  3STB C;  2Z6K A;  3EIV A;  4UP9 A;  1F9S A;  4GKK L;  1JWU D;  2D2C C;  3H0G H;  4HSV A;  4C3I H;  4GNX C;  1RCV D;  3TS0 A;  2VB2 X;  1SSO A;  2EE1 A;  2LKV A;  1D6E C;  1EOT A;  2NWG A;  4ZKC B;  1M90 C;  2HUG A;  4IUN A;  2PPB C;  2Q2I A;  1UUP A;  1LTI D;  3C1E A;  2B29 A;  5AJ3 L;  1PH3 A;  4C56 C;  3EN2 A;  5KEE A;  3MEH A;  4HJA A;  2JE6 I;  4H7B A;  2F0H A;  1V8Q A;  4LF6 L;  1QUQ B;  2CWP A;  1H95 A;  5M3M G;  4IFD J;  1OXX K;  1H9S B;  4DV2 Q;  4IO9 A;  1GXD C;  4EQN A;  3DWA A;  2IJ0 A;  3HGB A;  4Y7N B;  2Z9H A;  4KLK A;  4JG2 A;  1SYE A;  1GUT A;  1F9Q A;  2E74 C;  2HDM A;  3K7A B;  4JI0 Q;  1U4L A;  1XXG A;  1Y8N B;  2F52 A;  5HY6 A;  2B2Y C;  1FR3 A;  3E3X A;  1ENF A;  4A3M B;  1CQF A;  2IL8 A;  4YWL A;  2VL6 A;  2XSC A;  1TII D;  4DR2 Q;  1B70 B;  1D1K A;  3DLL A;  1VCI A;  1FNV A;  2KED A;  2UUB Q;  4DKA C;  1TY0 A;  3PIO A;  5FO7 B;  3TP7 A;  4QUF A;  1PH9 A;  1SJE D;  4H44 C;  3TQY A;  3TRE A;  5D3I B;  2NYZ D;  4GN3 B;  1STH A;  4IPD A;  5FLX E;  4CJ0 B;  5ELB A;  4IUU A;  4B3S Q;  5C4J B;  1SXT A;  1STE A;  2F0P A;  3H09 A;  1Z9F A;  4KN4 C;  5C0X H;  2R7F A;  1U4R A;  2B39 A;  5I9O A;  2K5N A;  2NVQ H;  4GOP C;  3VYR A;  1GOZ A;  3KK7 A;  1LTS D;  1PTO H;  4BY1 G;  2Z4I A;  1JOO A;  1LTG D;  2K50 A;  3SR1 A;  4A3M H;  2DUD A;  1SNP A;  3CC4 A;  1KAA A;  2QEJ C;  3I4L A;  4I7A A;  1WTW A;  1J8I A;  1JT8 A;  1GD7 A;  3PUW A;  2JA6 B;  1I6H H;  4ZLT F;  2PW7 A;  1B50 A;  2FFK B;  1KAB A;  1MI2 A;  3MXP A;  2F0V A;  1SDF A;  1W2B A;  3UDF A;  1CKN A;  4XT1 B;  4JI8 Q;  2YTY A;  4QL5 A;  1G2T A;  2A69 D;  2MPM A;  2GVB A;  2R7Z B;  2KHI A;  5C4J H;  4DR1 Q;  4DF7 A;  1XNR Q;  2A5H A;  2N8N A;  2ZJR A;  2JJQ A;  1SRO A;  3S2D H;  1V1P A;  4N8X 1;  1EQQ A;  1CQV A;  4A3F B;  2ICE C;  1WTO A;  4L8J A;  3RMH A;  1WJJ A;  2JK8 A;  1VF5 C;  2KEN A;  2WKC A;  3JAM i;  3NWT A;  3H0G G;  3OMC A;  4C3I G;  4G7H C;  2EQS A;  2JA6 H;  1G2S A;  2R93 H;  3AU7 A;  3K81 C;  4MHE A;  4HTH A;  2D0P A;  4IUT A;  2J7Z A;  3O13 A;  4ILW A;  4DR5 L;  4BWG B;  3S24 A;  5EAY A;  5D14 A;  1J6Q A;  3FPU B;  2Z1C A;  1DON A;  2D0O A;  4FNF A;  1A62 A;  1G6P A;  5EPJ A;  1B53 A;  3H3V I;  4P2C B;  4R4O A;  1TWC B;  3M4Q A;  3FKI H;  1NE3 A;  2B2T A;  1T5X D;  2KHS A;  1PXU A;  1NCV A;  3DHQ A;  1IW7 D;  4A3D G;  1CHP D;  4A3F H;  1XMQ Q;  1WD1 A;  1OTC A;  2F03 A;  1RHP A;  1B4O A;  4DR6 Q;  4PQX A;  3BYT B;  3KLS A;  3A74 A;  1LAC A;  4K5X A;  5E3F A;  1Y8P B;  1VQN A;  1CK1 A;  1W6K A;  1A3U A;  3M4O H;  2F4I A;  1R4P B;  1O80 A;  3R2I A;  4B3R Q;  1F2M A;  2F0U A;  4YCW A;  5E1F A;  2LXJ A;  5IOD A;  2BDN A;  3T51 B;  4LUV A;  2UXD Q;  4E6I A;  2ZTE A;  1JOQ A;  3SE0 A;  2I5M X;  1CZG A;  2H4O A;  3MXN A;  3LWE A;  1TVX A; 
#chains in the Genus database with same CATH homology
 1WVL A;  5JOB A;  5ELD A;  3GTG B;  1LT5 D;  5EKL A;  1F2Y A;  1W6J A;  1YNJ C;  3S2H B;  1DOL A;  5IIF A;  5C0X G;  1D1I A;  3OHX C;  1BF4 A;  4L63 B;  3GP7 A;  2F1M A;  4NKL A;  5BN5 A;  1TKW B;  3MFG A;  1NR2 A;  1I3Q B;  3IKJ A;  4KY7 A;  3BVZ A;  2F3V A;  4ZUI A;  1EY5 A;  2NVT B;  1EZ8 A;  5I6W A;  3M7G A;  2QDB A;  5IGG A;  1GHK A;  1TR5 A;  2PZW A;  1AN8 A;  4I7Z C;  2LFN A;  3KUP A;  1CHQ D;  1AZP A;  4IUR A;  4UAI A;  1O7Y A;  2IWH A;  1RJT A;  4HN7 A;  3X3N A;  3ND8 A;  1FNW A;  1PYW D;  2MP1 A;  2J0T D;  1DM0 B;  2F0J A;  1Y1W B;  1JOK A;  2JEB I;  2VUM B;  4BA2 I;  2WAQ B;  1IHZ A;  3NQT A;  2NTS A;  4TKO B;  4ZYS A;  3I72 A;  1LT6 D;  3G6J B;  2BA1 A;  5KRU A;  1EY8 A;  2K33 A;  3QO2 A;  3SXH A;  3HOU B;  3GTP B;  2EYF A;  3LWU A;  4BS9 A;  4ZUJ A;  1PRT D;  1E0B A;  1XX8 A;  1OO9 B;  1FD7 D;  3H91 A;  2F3W A;  5FLX L;  3EFX D;  2R6G A;  3EJI A;  3L3O C;  2EJG C;  4DN4 M;  4C1N I;  3HG9 A;  5C4H A;  5KYI A;  1A2U A;  2Q8R E;  1B1Z A;  1PRT B;  3HOW B;  4KN7 C;  1QG7 A;  1IL8 A;  5CC4 A;  5C0X I;  4OGQ C;  3DM1 A;  3ITP A;  1TS4 A;  3R93 A;  4ZKB B;  3J81 E;  3DUZ A;  2FIN B;  3A7L A;  3BYY B;  5DM7 3;  4C3J G;  2I46 A;  3NBI A;  5TSS A;  3RZD B;  3OSO A;  3IFT A;  5ELC A;  3EA6 A;  1WTX A;  4Q5V A;  2F0F A;  5ELF A;  3I4N B;  2Q8T A;  4PNY A;  2PZT A;  3QIA A;  3GTO B;  1EEI D;  2VNU D;  1RTN A;  2M2L A;  3I8Z A;  4KKT A;  1MBY A;  4KJO A;  2SNM A;  3A54 A;  4CKB A;  3HOY B;  2D5D A;  2F0T A;  5C5L A;  4HSP A;  2TMP A;  3ERQ A;  5COR A;  5IT9 E;  4BA1 I;  5DEH A;  2MGS A;  1MSG A;  1LO5 D;  2FMC A;  5CBA E;  1CZW A;  1BDO A;  3J7A F;  3GO5 A;  4DNR B;  2KEE A;  5NUC A;  4QMG A;  2EY5 A;  2NZ1 D;  1KNA A;  3CRK C;  3GQB A;  5ELE A;  5A2Q E;  1PZK D;  2Y0S B;  2QCP X;  2PMZ B;  2L9H A;  3FVQ A;  4B08 A;  2ZXP A;  4FP5 D;  3GTL B;  2RVL A;  2L12 A;  3VYU A;  1Y69 U;  1DYQ A;  1CTM A;  4XXE A;  5C4Z A;  2TSS A;  5KYL A;  2B2V A;  1K8O A;  3R2T A;  4O1N A;  1ICW A;  2EXZ A;  3QJY A;  4N9T A;  5EBD A;  3K5O A;  5FK9 C;  4GZY C;  2M00 A;  1H9R A;  3VYT A;  3VR4 A;  2I07 B;  4K6D A;  4DK0 A;  3M7N A;  3HS0 C;  2DY8 A;  5BN4 A;  5K36 H;  2O4X A;  1S5E D;  4Z9C B;  1Y1V B;  1KLG D;  4KKS A;  3VR6 A;  4KTA A;  2E76 C;  2G9D A;  5J22 A;  1HFG A;  1ZYR C;  3W3A A;  3A56 A;  1PFM A;  3CQZ B;  3NSW A;  2EZV A;  4ODG A;  1DOK A;  2EYP A;  1B44 D;  2NVX B;  1JR0 D;  3KBX A;  1CA5 A;  4NDX A;  3U9S A;  5E4W C;  2MHV A;  4M1U B;  3SDZ A;  2B2U A;  2EY2 A;  4ME5 A;  2IPK D;  4RGT A;  1QB5 D;  3D6C A;  2WKD A;  3S1N B;  3OMG A;  3QG1 A;  2EDG A;  1Q12 A;  3TP8 A;  3GTM B;  1VMC A;  2FHT A;  1SNO A;  3PMF A;  5C3W A;  4K2K A;  4LAA A;  4BBS B;  3NWS A;  5IOC A;  1J9O A;  4RH6 A;  1DCZ A;  4IUV A;  2RA4 A;  4RFB A;  3BS1 A;  3TME A;  1ZXT A;  3Q23 A;  2QKI C;  5I2X A;  1GUN A;  3E0J A;  2CQA A;  4I65 A;  1G29 1;  1ESF A;  1YNJ D;  1QWY A;  1BBX C;  1IYV A;  2DNE A;  5JVG 3;  1A3T A;  3M85 A;  1EL0 A;  4XQQ A;  2BE5 C;  2BOS A;  1I4Q A;  1WTR A;  3TBI B;  1JWM D;  2K05 A;  3QB3 A;  2A74 C;  1X3Q A;  2PZU A;  1ET6 A;  3MTS A;  3J81 L;  2ZT9 C;  3W2D A;  4EQP A;  1TS3 A;  4QF4 A;  1B9M A;  3H3V C;  5C5M A;  3HP3 A;  1EFI D;  4BY7 B;  4FXG C;  3K0Y A;  5K36 G;  2WIN B;  3BVM A;  1IYU A;  1JOR A;  2RDG A;  1XWE A;  3K5M A;  1Z47 A;  5K5P A;  2K28 A;  3GTQ B;  3JAM E;  2F0S A;  1WTQ A;  3ERO A;  4A3I B;  3F2U A;  1GUO A;  4DK1 A;  5F2D A;  5C3X A;  1WD0 A;  2C9O A;  1Z6H A;  3OIP A;  1U4P A;  1C48 A;  1PLF A;  3MXU A;  3VA7 A;  1AP0 A;  1JCK B;  2EYJ A;  3ZYY X;  1EYD A;  1II3 A;  3IFD A;  3A8J E;  1BNZ A;  2YU9 B;  3C46 A;  1H9M A;  2XWB B;  2XRQ D;  2QF7 A;  2LS0 1;  3T4A C;  2X6G A;  1BXT A;  5IT9 L;  1KDC A;  4KY5 A;  4LJZ C;  4U67 3;  4CBV A;  3SHL A;  2KEC A;  2VXW A;  5A2Q L;  4RHS A;  1E2W A;  3T53 B;  4K6L A;  2R3Z A;  3EQL C;  4ULL A;  4XYO A;  3OW7 A;  3I90 A;  1LT4 D;  1Q1B A;  3D8G A;  5JEA J;  1EU3 A;  1STY A;  1SE3 A;  1O7Z A;  4CGY B;  3RLF A;  2ICI A;  1WTP A;  2HCC A;  1BCP C;  2SEB D;  2AQ3 B;  1EU4 A;  1FNU A;  4X3S A;  1BCP F;  1CT1 D;  1HA5 A;  1KDA A;  4C3H G;  4S3S A;  2JP1 A;  2IX3 A;  1Q90 A;  2L5T A;  1PMR A;  4FVM A;  4XT3 B;  1DXM A;  3P20 A;  5I2Y A;  1DOM A;  5CV8 A;  2XN9 C;  4J1M A;  3PUZ A;  2EVB A;  1RKN A;  2HQE A;  1TWA B;  1EYC A;  4R9W A;  1L0X B;  4FXD A;  1H9J A;  4ABN A;  4DXF A;  2XWJ B;  4R8I A;  3K6O A;  4IUP A;  1VMP A;  2NN6 H;  1QCB D;  5KNC A;  5BN3 A;  1TS5 A;  5LHY 1;  3U9O A;  4WOR A;  1RTO A;  3MAQ A;  2R92 B;  2ZXO A;  3E6Z X;  2G9H D;  1FGB D;  2K1B A;  3VA5 A;  1ZEQ X;  5DM6 3;  2L55 A;  3N6R A;  3WOF A;  3M3Y B;  3N52 A;  1TQO A;  1PDQ A;  3LNN A;  1KNE A;  5C6A A;  1C4Q A;  1V1O A;  4FF3 A;  5CBE E;  2E2H B;  3I73 A;  3X3M A;  1MSH A;  3VYS A;  4XIG S;  5T1G A;  3Q6S A;  4RGO S;  2E2D C;  5ISR A;  1OXV A;  3I70 A;  1TWH B;  1E2Z A;  1HRJ A;  5IGC A;  2B2W C;  5DNF A;  3GV6 A;  1ESR A;  3OWE B;  4ZAI A;  5FOB B;  4FXK C;  2CW0 C;  1QIL A;  5I9P A;  3D4W A;  2AWO A;  4PMC A;  3NUC A;  1RD9 D;  4Q0F A;  1SMY C;  3TZD A;  3K57 A;  5EKK A;  3S1R B;  3OIQ A;  2XNA C;  3RUZ A;  3K5N A;  2B2V C;  2XIW A;  1KDB A;  5T1I A;  4NW2 A;  1ZYR D;  1SYC A;  3QOL A;  4R8N A;  4IFD H;  3RD4 A;  1UNS A;  4DAP A;  4TSS A;  5EKI A;  3TSS A;  4C2M B;  3P75 A;  1BOS A;  5CMD A;  2B8F A;  5A35 A;  2YYZ A;  3IAY A;  1EWH A;  5HUR A;  4RCO A;  3NTK A;  4A3J B;  1SYG A;  2R61 A;  1PFB A;  2PYK A;  2RBM A;  2WII B;  1TY2 A;  3T13 A;  3SK4 A;  2NN6 G;  1EZ6 A;  2A73 B;  4G7Z C;  4FF2 A;  4A3G B;  1EIH A;  4V0B A;  2O5J C;  4PV1 C;  2F0W A;  2IT1 A;  4O42 A;  4CJ1 B;  3Q22 A;  3MFY A;  3V05 A;  3MXG A;  2F0D A;  1SYB A;  2PQE A;  4RAU C;  5J1Z A;  5C0X J;  1QJO A;  4DAV A;  3A55 A;  3DEO A;  4UDU C;  2EYM A;  4A3E B;  3MZ5 A;  1H9S A;  4QCL A;  3S1Q B;  1NUC A;  4JK1 C;  2BE5 D;  1ILQ A;  1HCZ A;  3TP5 A;  4LK1 C;  3NP8 A;  4CKC A;  3K58 A;  1QNU A;  2RSN A;  3BVG A;  1PZI D;  3J7Y W;  1YNN C;  3HKZ B;  5I4D A;  1U9R A;  3V2T A;  1HTL D;  1S5B D;  2IW3 A;  5JEA H;  2RSO A;  4F87 A;  3G7L A;  1TS2 A;  5M3M B;  1TU2 B;  2ZXR A;  3PO2 B;  4CHT B;  1A2T A;  3I3C A;  2KOL A;  4F7X A;  4IFD G;  1WTV A;  1CFM A;  1B9N A;  2IX0 A;  4QB4 A;  3SK5 A;  2LY7 A;  2L4N A;  1MD2 D;  1GJX A;  3E5S A;  3D4D A;  5COY A;  1JE4 A;  1RF2 D;  4YIJ A;  1RDP D;  3SK6 A;  2D62 A;  2KVM A;  3S1M B;  4CJ2 C;  3GV3 A;  5M5Y B;  1ONL A;  3C2P A;  1NSN S;  3HZX A;  1HFN A;  3D4R A;  5M9O A;  4XQJ A;  2NUC A;  1D5X C;  2EJM A;  1I4R A;  2AQ1 B;  1HTP A;  1A15 A;  3FPP A;  4DXG A;  1F2L A;  1K8M A;  3PO3 B;  2EJF C;  3S14 B;  4XTC S;  1H9K A;  1B3A A;  5CV7 A;  3P1H A;  1M4V A;  5KND A;  4BY1 B;  2K04 A;  5JAV A;  1EY7 A;  1F2Z A;  1DJR D;  1XYI A;  4FF1 A;  1HQM C;  3VR3 A;  1BQQ T;  1G6Z A;  4XYQ A;  3TP6 A;  4RCN A;  5J39 A;  4EGV A;  2EY1 A;  2F0Q A;  4G7O C;  3Q24 A;  4A3B B;  2PW5 A;  4K8I A;  2E75 C;  2HCI A;  1BCP D;  4OHJ A;  4WFN 3;  3PV0 A;  3BDC A;  4IUQ A;  3FEW X;  3BG3 A;  4RWS C;  4DU9 A;  1CA6 A;  3WDN A;  5KIX A;  3K59 A;  5EBC A;  2JSO A;  2EY6 A;  4NMZ A;  3DEP A;  4TQU S;  5D3D A;  1ET9 A;  1BCP B;  1DZ1 A;  3H0G B;  5EGT A;  1LTA D;  4KY6 A;  1D5M C;  1BO0 A;  3A8K E;  2E2J B;  1T5E A;  2WB1 B;  4KV6 A;  4EVO A;  1M8A A;  2B2T C;  4KI0 A;  1TWF B;  1LAB A;  5IGD A;  1EY9 A;  5CGK A;  4IFD I;  3PIP 3;  4A3D B;  1SND A;  1KLU D;  2KCC A;  1F77 A;  1ML0 D;  2FJ2 A;  3DXJ C;  4KHZ A;  2CVR A;  1LTB D;  1AEX A;  4PMW A;  1EY4 A;  3P7J A;  4HMI A;  3VR2 A;  2QIL A;  1O7L A;  1JWS D;  4HR7 B;  4K14 A;  2A6E D;  1Z7T A;  1NAP A;  2K5D A;  1PTO D;  1Q1E A;  1JC7 A;  1TT2 A;  5FKA C;  1GUW A;  1MGS A;  2CHB D;  3NXW A;  3K5L A;  3OWF A;  4RKB A;  4NP5 A;  2RKS A;  4OIJ A;  2NB0 A;  2NVQ B;  1I6V C;  1SNQ A;  1PTO B;  4PMB A;  2F0E A;  4TRD A;  4G4K A;  1SYD A;  1EYA A;  4QUC A;  3QWN A;  1I6H B;  2MUY A;  2CW0 D;  2Z4H A;  4ZK9 B;  1SAP A;  2K5W A;  5G3L F;  1HUN A;  2JA5 B;  4AYB B;  1EIG A;  2ID0 A;  4F8M A;  3HEJ A;  2A6H C;  3FMC A;  2K6A A;  2O2L D;  1SMY D;  2RDF A;  4DFA A;  1V43 A;  3S2D B;  1STA A;  2MJ8 A;  3NBH A;  1HHV A;  2KCN A;  3RZO B;  2RDH A;  1R4Q B;  1U4M A;  1OXU A;  1PFN A;  4L6T B;  4A93 B;  4IQZ A;  4DA2 A;  2M9V A;  4LMQ D;  3ONA B;  5CR3 A;  2R93 B;  3L9A X;  4K5W A;  3S15 B;  1I4X A;  5JVH 3;  3KBG A;  4RKL A;  3BZD B;  3PUX A;  1D5Z C;  1LLR D;  4HED A;  3CHB D;  3FKI B;  5CV9 A;  2X6L A;  3LX0 A;  2L11 A;  3KLS X;  4BBR B;  1SJH D;  1EY6 A;  4QIW B;  2F0O A;  2F0K A;  2OEO A;  5D65 A;  3HRZ C;  1F9R A;  4N9P A;  1ZKO A;  3OPO A;  5CYU A;  4KJN A;  3HOZ B;  1SYF A;  3M4O B;  2AQ2 B;  2F0L A;  3J7A V;  1QNK A;  3PUY A;  2HDL A;  4B9W A;  1CM9 A;  3A8I E;  2BCO A;  1GUS A;  1SE2 A;  3MC0 B;  4ZRZ A;  1I50 B;  2JXM B;  2E2I B;  5M3F B;  3SK8 A;  4OO1 H;  4KK7 A;  4C3J B;  4XQN A;  3J80 E;  4IAL A;  2NVY B;  2A68 C;  3QOJ A;  1STN A;  3TN2 A;  4IN3 A;  1G91 A;  4HCS A;  2EYH A;  5C44 B;  1ROD A;  4FO2 A;  5EJW A;  1O78 A;  1UAP A;  2EOT A;  1YNN D;  2PNR C;  3H94 A;  3S17 B;  5LL6 X;  2OXP A;  2B2Y A;  3PUV A;  1UEA B;  3DWQ A;  2NBF A;  1LT3 D;  4OIK A;  2A6E C;  4U68 A;  3AMU A;  5EQ0 A;  4X3U A;  1IKL A;  2EYO A;  5M5W B;  1F9P A;  4C1N K;  2OT2 A;  1PTO C;  5EPL A;  1AW7 A;  1PTO F;  2X69 A;  4FYD A;  1STB A;  1VDZ A;  3A7A B;  3AB9 A;  3D6W A;  3NTH A;  1JIC A;  3URY A;  3I91 A;  2H1E A;  3L7Z C;  3OOC A;  3MA2 B;  3MHB A;  5KNB A;  1KTK A;  2DY7 A;  2VB3 X;  4ID6 A;  2GA4 B;  2K32 A;  2L0C A;  1X3P A;  5AFW A;  3M4Y A;  1BR9 A;  2WP8 J;  3NQI A;  1HPC A;  2JYO A;  2N88 A;  4IZ8 A;  5FO8 B;  2PO4 A;  5JPN C;  3TDQ A;  1AFP A;  1SFO B;  3FRP B;  1WCM B;  4OL7 A;  2F0G A;  3JAM L;  4CKE A;  1G8Z D;  2JA7 B;  1GHJ A;  4KKU A;  2A69 C;  4V19 0;  2DNC A;  2NTT A;  1QOH A;  1SEB D;  3FDT A;  4WJW A;  3BDL A;  1BUV T;  1EWC A;  1K83 B;  3CKI B;  2OF1 A;  3UI2 A;  3MWY W;  5I6Y A;  4OO1 G;  3SEB A;  2SNS A;  1V1P B;  4RHR A;  2F0M A;  3MVV A;  4HCE A;  2K5Q A;  5CV5 A;  2BDO A;  1EEF D;  2B2U C;  2K03 A;  1S5C D;  5JJZ A;  2LMC B;  3S16 B;  2O5I C;  1B2T A;  3IL8 A;  3NK9 A;  2WAC A;  4MN3 A;  5JPM C;  3I4M B;  2PCF B;  2KUM A;  1NR4 A;  1GUG A;  1IW7 C;  4H13 C;  4B9X A;  2ENB A;  2IX1 A;  1Y8O B;  2EPB A;  4RA8 A;  2B8G A;  4K5V A;  4A3K B;  4KHV A;  3Q0A A;  3KLR A;  3HOV B;  4KMU C;  1JB3 A;  1X32 A;  2JA8 B;  4H0L C;  3NTI A;  5C4X B;  5IGE A;  1Q3L A;  5IGB A;  2SOB A;  4X3T A;  3T16 A;  1EQV A;  3S9W A;  5HGT A;  2B63 B;  2KQ3 A;  1FYC A;  3GD7 A;  4F88 A;  2XRS D;  4KD4 A;  1XTC D;  2KA7 A;  1CI3 M;  1ENA A;  5C3E B;  1ENC A;  5G3L D;  1EY0 A;  3D31 A;  1AZQ A;  4J8Q A;  5EPK A;  5KGU A;  3J80 L;  2B2W A;  4HAE A;  1HXY D;  3VR5 A;  1S5D D;  5M5X B;  5E4X A;  2A6H D;  3T56 B;  2K01 A;  2AUJ D;  4RGM A;  1LV9 A;  1LTT D;  3BDO A;  4OO1 I;  4FF4 A;  1S5F D;  3NHH A;  1OXS C;  2C5C A;  2NN6 I;  3V96 A;  2AWN A;  5CV4 A;  1SNC A;  3DWP A;  3CU7 A;  4ZQ3 A;  3DMU A;  1LTR D;  1A6X A;  2Q8I B;  3GTK B;  4EQO A;  2KJX A;  5FO9 B;  4HMJ A;  3NPP A;  2F0N A;  4K2L A;  4WRD A;  4G57 A;  3CRL C;  1I4P A;  1HUM A;  3H6M A;  1Q8I A;  2SDF A;  3R8B A;  2WV6 D;  1JQY D;  3PIO 3;  1D2B A;  1TWG B;  3KF8 A;  3ND9 A;  4KD3 A;  1IKM A;  2EYL A;  1SE4 A;  4K8J A;  1QE6 A;  2Z8L A;  4DNT B;  1ILP A;  2RQX A;  3EVQ A;  3SVM A;  2J4X A;  1L0Y B;  3D3R A;  4DGZ A;  2FMM A;  1HQR D;  2F0I A;  3HOX B;  1OXT A;  2AUK A;  2DN8 A;  2L1B A;  1I4H A;  3R3O A;  1DD2 A;  5DAU A;  3NE5 B;  3C1F A;  1PRT C;  1HA6 A;  2XVS A;  1PRT F;  5IGF A;  4C3I B;  1SBB B;  2BA0 A;  2N55 A;  3WOE A;  3TZU A;  1A3V A;  4DAY A;  1SNM A;  4J6H A;  4XDX A;  1STG A;  1I4G A;  1C8C A;  2JEA I;  1PZJ D;  2V4D A;  4JBW A;  2D9U A;  4M8A A;  5JEA G;  5LL6 S;  3C3L A;  4C3H B;  1E2V A;  1EQT A;  1VF7 A;  5CV6 A;  3GTJ B;  1S4Z A;  4MIU A;  2A68 D;  1R9T B;  2K7V A;  4RGN A;  4X3K A;  1F9S A;  1JWU D;  2D2C C;  4HSV A;  1RCV D;  2VB2 X;  1SSO A;  2EE1 A;  2LKV A;  1D6E C;  1EOT A;  2NWG A;  4ZKC B;  2HUG A;  4IUN A;  2PPB C;  1UUP A;  1LTI D;  3C1E A;  4C56 C;  5KEE A;  3MEH A;  2JE6 I;  4H7B A;  2F0H A;  1V8Q A;  4IFD J;  1OXX K;  1H9S B;  1GXD C;  4EQN A;  3DWA A;  2IJ0 A;  3HGB A;  4Y7N B;  1SYE A;  1GUT A;  1F9Q A;  2E74 C;  2HDM A;  3K7A B;  1U4L A;  1XXG A;  1Y8N B;  2B2Y C;  1FR3 A;  1ENF A;  4A3M B;  1CQF A;  2IL8 A;  2XSC A;  1TII D;  1D1K A;  1VCI A;  1FNV A;  2KED A;  1TY0 A;  5FO7 B;  3TP7 A;  4QUF A;  1SJE D;  4H44 C;  5D3I B;  2NYZ D;  1STH A;  5FLX E;  4CJ0 B;  5ELB A;  4IUU A;  5C4J B;  1SXT A;  1STE A;  2F0P A;  3H09 A;  4KN4 C;  5C0X H;  1U4R A;  2B39 A;  5I9O A;  3VYR A;  1GOZ A;  3KK7 A;  1LTS D;  1PTO H;  2Z4I A;  1JOO A;  1LTG D;  3SR1 A;  1SNP A;  1KAA A;  2QEJ C;  3I4L A;  1WTW A;  1J8I A;  3PUW A;  2JA6 B;  4ZLT F;  2PW7 A;  1B50 A;  2FFK B;  1KAB A;  1MI2 A;  3MXP A;  2F0V A;  1SDF A;  4XT1 B;  1G2T A;  2A69 D;  2MPM A;  2R7Z B;  4DF7 A;  2A5H A;  1V1P A;  1CQV A;  4A3F B;  2ICE C;  1WTO A;  4L8J A;  3RMH A;  1VF5 C;  2WKC A;  3NWT A;  3OMC A;  4C3I G;  4G7H C;  1G2S A;  3AU7 A;  4MHE A;  4HTH A;  4IUT A;  2J7Z A;  3O13 A;  4ILW A;  4BWG B;  5D14 A;  3FPU B;  2Z1C A;  1DON A;  4FNF A;  5EPJ A;  1B53 A;  4P2C B;  1TWC B;  2B2T A;  1T5X D;  1PXU A;  2KHS A;  1NCV A;  3DHQ A;  1IW7 D;  1CHP D;  1WD1 A;  2F03 A;  1RHP A;  1B4O A;  4PQX A;  3BYT B;  3KLS A;  1LAC A;  4K5X A;  5E3F A;  1Y8P B;  1CK1 A;  1W6K A;  1A3U A;  2F4I A;  1R4P B;  1O80 A;  3R2I A;  1F2M A;  2F0U A;  5E1F A;  5IOD A;  2BDN A;  3T51 B;  4E6I A;  1JOQ A;  3SE0 A;  1CZG A;  2H4O A;  3MXN A;  3LWE A;  1TVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...