5JVH3

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 1
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jvh300
3PIP3 5DM73 4U673 5JVG3 3PIO3 5JVH3 5DM63 4WFN3
chains in the Genus database with same CATH superfamily
2KQ3A 4DR4L 2K01A 1HZAA 1Y8OB 4R4QA 4IPDA 4DU9A 3J81c 3NSWA 3DM3A 4BBRB 2IX3A 3R2IA 1I4XA 4A93H 5C5LA 2H4OA 2Z6KA 4OONA 4A3CG 1X54A 4DUYQ 4YIJA 1VQ7A 1H9RA 1GOZA 2PQAA 2WB1B 4JG2A 3S2HH 4EQOA 1V1OA 1UUPA 1HH2P 1K8MA 3GTPH 2DUDA 2VUMH 4J15A 4FXDA 5DEHA 2D5DA 4X66Q 2EJGC 4CJ1B 1STYA 4MNOA 1PH9A 4TSSA 2CWPA 3T4AC 3W3AA 2E2HH 1STNA 2HCCA 4FXGC 2F0GA 3FEWX 2L0CA 5JEAG 5FLXc 2ASBA 4XDXA 1OXSC 3WOFA 3PUVA 3TSSA 1SRUA 5K36H 3M3YB 4JC0A 2F0HA 3J80E 2EY5A 1G51A 1EWIA 4OX9L 2JE6I 3NUCA 2QILA 3RLNA 3RZDB 1IZ6A 4NB3A 1N33L 2NWGA 1X3GA 4A3JB 4E6IA 4HR7B 2R7ZH 1PH2A 1HCZA 3X3NA 5CBAE 2Q2UA 4F87A 2XRSD 2CWAA 3H91A 4LF6L 4GOPA 2IHEA 4O2DA 4GS3A 2M2LA 3CCVA 3PIPA 2JA5B 4BY1G 3K7AH 3SK8A 2KEEA 3CD6A 5IGGA 2F0EA 4C3IH 1GHJA 2FJ2A 4CKEA 1KDCA 2F03A 1JT8A 1C4QA 1JCKB 1Q1EA 4KY5A 4RA8A 3IRBA 5EKLA 1FJGQ 3IAYA 4G7HC 2XSCA 1A6XA 1TT2A 5C4JB 1ENCA 4FYDA 4ZAIA 4JI3Q 3I73A 2B2VC 1YJ9A 3PMFA 3TBIB 1TQOA 2KENA 4ZUIA 4DAVA 1TWFH 2F52A 2K03A 3CPWA 1PRTB 1EY4A 4PMBA 2TSSA 2ZTEA 5A2QE 4OIJA 2OT2A 1LYLA 1XNQL 1IYJB 3GTMH 2LS01 2V4DA 4JI5L 4B3SL 1QILA 3NELA 2VQEL 4IFDJ 1VF7A 1RCVD 2F1MA 1CHQD 2ZT9C 3M4OB 1VQDA 2ZXPA 4XQQA 1KL9A 4EGVA 1JE4A 3K0YA 1Z47A 1HA6A 2NUCA 2K4KA 4JBMA 1BBXC 1EFWA 5IYBG 1R9TB 5C4HA 5KGUA 3G4SA 1QJOA 1B9NA 2PPBC 1V1PA 5FK9C 1PH5A 2PO4A 3DWPA 3P20A 1V8QA 4DR6L 4S3SA 4JI5Q 1G6ZA 1QCBD 4KKSA 1KHIA 3HG9A 1BCPF 2HHHL 3D0FA 2B2YC 3I70A 5I6WA 2DNCA 4OO1G 4H0LC 4L5TA 1GUTA 3QOJA 2JA6H 1JB7A 3DEPA 2VQEQ 2DY8A 3S2HB 1C48A 3L9AX 1I94Q 1V9PA 1KD1C 1KLGD 2JA8H 2B2UC 1QOHA 5IWAL 1BOSA 2KOLA 2XN9C 1A3UA 4RMFA 1VQFA 1TU2B 1TS2A 4YHHQ 1FNVA 1AN8A 1E0BA 4CJ2C 5IGBA 3M4YA 2E75C 4IFDI 2DJFC 3J7AV 1E2WA 2BH2A 2K75A 2K14A 1EOTA 5EPKA 5IODA 2VXWA 1BVSA 5I4DA 2D2CC 1AW7A 4G57A 4HIDA 3HOVB 1D5XC 5HGQA 4LW1A 4JV5Q 5C3EB 1S5FD 1GUSA 1SNMA 3LGJA 5LMNQ 4GKKQ 1M4VA 2L5TA 4KD3A 4K8JA 1XTCD 2EZVA 4A3IB 1BXTA 1XMQQ 1SYCA 1I94L 5I9PA 3OHXC 5CR3A 4RHSA 4KN7C 1YHAA 2B63H 2EYPA 3I8ZA 1T5EA 5JJZA 1N36Q 1DONA 1UE5A 5M5WB 2XWBB 4AYBG 4J8QA 4QGUA 3S1QH 4LF7Q 4OEMB 5IGCA 2ZJRA 4LF5L 1A3TA 4JI7L 1V43A 1B2TA 2UXBL 3GTMB 4DV3L 2EE1A 3BDLA 5C3EG 5LMNW 2Q2IA 1XMOQ 4FF1A 4R1JA 2PZTA 1HNWQ 3GO5A 2LXKA 1JOOA 4K5WA 3MAQA 1WD0A 5JJKA 3I91A 2RSOA 3DEOA 1SJHD 2ICIA 3TZUA 5BN5A 2O5IC 4Q5VA 1WTRA 4POGA 1IBLL 3A7AB 4P73A 5C44H 1KABA 2B63G 3B6YA 1H9SA 3GTOB 1XMQL 5BR8Q 4R8IA 4A3FG 4CDEC 1F2MA 2UXDQ 1O7IA 5CYUA 4LF5Q 3E5SA 4X65Q 1LTTD 3KLSX 2Q2HA 3MZ5A 1KXLA 2WB1E 4PZ6A 4XIGS 1Q1BA 3EQLC 1TXYA 3PSIA 2H5XA 1J8IA 3KLRA 1O7YA 3H3VC 3MEHA 5IIFA 3T56B 3VDYA 1D1IA 2R92G 2F0LA 5JAVA 3G6JB 3HOUB 1NJIC 1UAPA 2JK8A 2R61A 5EBCA 1GO3E 3U50C 4PZ8A 2CQAA 4NW2A 3HOWH 1PFBA 1F9RA 3ICEA 4AIMA 2M00A 2PW7A 1F2YA 4IJHA 3VYUA 5BR8L 4C3HH 3I56A 3NTKA 2MQHA 5CV7A 3GQBA 2P5ZX 1VQCA 3BVZA 3LWEA 4DUZQ 1J9OA 5ISRA 1PLFA 1GXDC 2CVRA 5EPLA 5C0XG 4HJ7A 2JA6G 1SE8A 5J3BA 3AB9A 1I6VC 3OWEB 4B3RL 3MWYW 3RUZA 1TWCH 1Z7TA 3U9SA 1SYGA 2NTTA 1Q86C 3NWTA 2ZTCA 3FMCA 1ZEQX 2R93B 4A3LG 2QDLA 3GTGH 3NQTA 1Y1WH 1U0LA 3GD7A 4GNXB 3I3CA 3PUYA 3C46A 3D4DA 2BA0A 5LMUQ 1G91A 2IW3A 4LFBQ 3KUPA 1SMYD 2JA5H 1EZ8A 3AFQA 1ILQA 1V1QA 3D3RA 1FVIA 4KHPQ 1L0XB 3CKIB 5T1IA 4L5SA 4DV4L 3S1QB 2QCPX 2FINB 3L0OA 2KVMA 1BQQT 5ELBA 3AFPA 2Y0SE 4DUZL 4KN4C 2A69C 2B63B 1SNCA 1QB5D 1LT6D 4ZCKA 1F9PA 2K5NA 2R92B 1L0WA 4GOPB 1H9JA 1I6HB 4PMCA 5JOBA 2F3VA 3NPPA 1SYBA 2OTJA 2I5LX 3GTQB 2HD3A 2F0TA 2QF7A 4K2LA 1L1OB 2G5DA 1O7LA 3CCMA 1RF2D 3F2UA 2E2DC 3FPPA 1ASZA 4FVMA 1PH6A 3K0XA 3BVGA 2PQAB 4LF4L 1HZ9A 3NBIA 3A55A 1LTBD 2I5MX 1CSPA 2BDOA 1EY6A 4RKLA 4C3HG 2WV6D 4C2MB 4PG3A 1XTDA 2NZOA 1WYDA 4NXMQ 3HOUH 3DM1A 4YCWA 3NP8A 3UE0A 4TKOB 2VB2X 1WTVA 2ZTDA 1STHA 1YHQA 1BO0A 2HIXA 1QZHA 3GV6A 4J1MA 3UDGA 2NBFA 3OIQA 3GV3A 2NVXB 1TVXA 4HCEA 2NB0A 1BBUA 3V2TA 2K1BA 1P16A 4ZK9B 4HIMA 4C3JB 1ASYA 5EKKA 1K83B 1G8ZD 2EYFA 3OYYA 1LV9A 4LF4Q 5J1ZA 3AYHB 2I0QA 1O7ZA 3GP7A 1M8AA 3HKZG 2NVTH 4K6LA 4A3KB 1KRSA 1EWHA 2D62A 4XQNA 5AFWA 3CCQA 2E2IH 2UXCL 3S24A 1YJWA 1J5EQ 2CKZB 3A8KE 2FHTA 3I90A 1CM9A 4HN7A 3UDFA 3E3XA 1CFMA 3LX0A 1HJPA 4A3MH 2RQXA 1L2FA 5JVG3 4B9WA 3MEFA 2K5QA 4QUFA 5FLMG 4DXFA 5E1FA 5HY6A 4DV3Q 1AH9A 1K8OA 4HJAA 3HEJA 4ZKCB 3ULLA 1YZ6A 3KOJA 1VS0A 5E4XA 1WD1A 2KCNA 1FGUA 1KRTA 2IX1A 3OTOQ 4A3DH 4HCSA 2B2YA 3A54A 1WCMH 4K14A 1XYIA 4LUZA 2TMPA 3CF5A 1WJJA 2K5DA 2E2JH 3G7LA 2JYOA 4MTKA 5CV4A 5FO9B 3N52A 1IBLQ 1RDPD 5M3FB 2AHOB 3NTHA 1PRTC 3HOXG 2VY3A 4ZKBB 3Q0AA 2L1BA 1EY0A 2OQKA 2F0NA 4IOAA 3BZDB 1D6EC 1U5KA 2IJ0A 4DV1Q 4DV2L 4LFBL 2A6HC 4KY6A 1Q12A 3PO2H 1QNKA 1VQGA 1EU4A 2Z8LA 5I6YA 1I4RA 3S1MB 3I4MB 2F0VA 3HOZH 2RKSA 3IL8A 2XVSA 3JC66 1HFGA 1R9TH 4FO2A 2QEJC 5IWAQ 2NN6I 1WFQA 4DV6L 1CI3M 2IL8A 3GTLH 1QZGA 4DV1L 1TWAH 1XNQQ 4JI2Q 4JPBW 1MSHA 1HXYD 5GAGC 3BYTB 4BS9A 3TQYA 1MKHA 1H9KA 1ONLA 4JI0Q 4B3RQ 2KECA 2N88A 4C1NI 4C2MH 2LKVA 1O80A 2PCFB 1IHZA 4LNQA 2LMCB 3GTPB 4FF4A 2EXZA 4RGOS 4QQBX 1KNAA 5C0XJ 1PA6A 1WTOA 3KDFB 4HIKA 1S4ZA 4LFAQ 2A1AA 3M4QA 1VQOA 2JA6B 1HR0W 4B3TL 3H09A 3FDTA 3J81j 1IBKQ 2YU9B 1B53A 3H3VH 1VQ4A 1STBA 1YHBA 2WKDA 4QF4A 4KLKA 4GOPC 5BN3A 1FYCA 1NY4A 1TS3A 3GTGB 1VQKA 4NKLA 4DV7L 2DNEA 3LNNA 2VQFL 3T1HL 2AUJD 4YWLA 2BDNA 3T1YQ 2WAQB 2ZM6Q 2NN6H 2GN5A 4P74A 1GM5A 1MHWC 2Z9HA 1SE4A 3U4ZA 5DAUA 1LTGD 4X3KA 5IOCA 2UUAQ 1STEA 1II3A 1WI5A 4KHVA 4YWKA 4DF7A 5KYLA 4KV6A 4B3MQ 2XIWA 5EAYA 1IBML 1KAAA 1JOKA 2E76C 1DGSA 1CKNB 3I4LA 4P72A 3TDQA 3WOEA 5E3FA 1Q82C 1Y8PB 3PO2G 1E2ZA 1LTSD 2K7VA 4A3DB 1ESRA 2NVYB 4OWWB 4V190 4DKAC 5IYBH 1CTMA 3L7ZC 3QR8A 2C5CA 1G291 4NXNQ 1CK1A 4M1UB 2L9HA 4TVAB 4ZUJA 2RDHA 4GLXA 2EOTA 3GTQH 4DR7L 1WCMG 1SBBB 4DV0Q 2YV5A 1VQ5A 1NR4A 3CQZH 3MXUA 4LF8Q 2AQ2B 4DXGA 1LTID 4WJWA 5EKIA 5DNFA 1SYDA 1MD2D 2LFNA 3RLFA 5JJIA 1IL8A 2JQOA 4O0AA 4B3ML 3F2CA 2EDGA 3HZXA 3I4MH 1YNJD 4X66L 2F0IA 5GAEC 3Q6SA 1SNQA 2NN6G 3EFXD 2WACA 3SXHA 1HUMA 1NR2A 3FHWA 1SDFA 1E24A 1K28A 2R7DA 3IFTA 1MIUA 5IP7H 5M5YH 1EQVA 1X65A 3NK9A 3K58A 4A3IG 4RGNA 2N8NA 5IGEA 2F0OA 1MJCA 3CHBD 5M3MG 1EIHA 3GTLB 1XWEA 4K0KQ 1ZKOA 1EUJA 1I4PA 1CZWA 1X32A 2AMCB 3L2PA 3VA7A 1A3VA 4R8NA 2ZJQA 1Y8NB 2BE5D 4IPCA 5GADC 4BA2I 4IUVA 1X6OA 4DPGA 4JYAL 4QCLA 4JI4Q 4R9WA 2OXPA 3R93A 3C2PA 2F0FA 3H0GG 4BWGB 4ZQ3A 4JI0L 4A3FB 2YYZA 3FKIH 3MTSA 3CC4A 3ND8A 2R93H 3QIAA 4HJ9A 4A3LH 2B8GA 2EY6A 1Q7YC 4OHJA 3HFZB 1Q81C 3AQQA 5FLXE 1B50A 1DOMA 4X6AH 2F0PA 3DUZA 4KY7A 1B9MA 3NENA 3S1RB 2GA4B 4CDDC 1LM0A 2X6GA 1IW7C 3W2DA 1W2BA 1NE3A 2I07B 1I5FA 3KF6A 4A3MG 5IGDA 3TP7A 1JORA 1O78A 1Y1WB 2ENBA 4L5QA 2E5LQ 2EYHA 1QUQB 1KDAA 1HHVA 2L4NA 1KC8C 1ENFA 1Q3LA 4BY7H 3MXPA 4CKCA 4BBSG 1OO9B 2NZ1D 2IT1A 2KA7A 3MFGA 1JC7A 3TS2A 2R92H 4JV5L 3F2DA 4CBVA 1ZYRC 4F88A 1WVLA 2ALYB 4JBWA 5FKAC 3ONAB 2MHVA 3HS0C 3P7JA 1NBWA 1PYSB 2LY7A 4WFN3 1OXTA 3KFUA 4JI2L 3S1NH 3STBC 4A3EG 2NVQH 3VR2A 1PRTD 1PRTF 4K5XA 2F0WA 3KYHC 3D4RA 1VQ9A 1F9SA 2JP1A 1S3OA 1KNEA 2BCOA 4MHEA 3ERSX 2WIIB 2JA7B 1ICWA 3HOYH 1RODA 1B7YB 2ATWA 2RVLA 1SFOB 4FNFA 1J6QA 1PHJA 1TWHB 1BBWA 4OL7A 4JI8Q 2BOSA 3BS1A 1CA6A 1RHPA 3K59A 1IYUA 4Y52H 1Q46A 3PUXA 4IJLA 3RN5A 4LFAL 4DK3C 4DR5Q 1N9WA 1TWAB 1NNXA 4DFAA 2Y0SB 3PQIA 3JAME 4A3GG 3G6EA 2VB3X 3HKZE 4JBJA 4A3GH 1GUOA 2F0SA 4DN4M 4IALA 4BY7G 2XTIA 2MFIA 3FRPB 1LLRD 4GN3B 4UP9A 3BZCA 3AEVA 2B29A 4IUPA 2CFMA 3PO3H 4LWCA 3SGIA 1QVGA 2VUMB 1F2LA 3R2TA 4X65L 3HOWB 1XPOA 3K5OA 2VQFQ 5IP7G 3KJPA 1K9MC 3DLLA 5CMDA 1UNSA 4ZYSA 4NPSA 4N9TA 1I3QH 2CHBD 5M5XH 3IFDA 1W3SA 2E2HB 2NVTB 1W6JA 4OGQC 1EY9A 3NQIA 5M9OA 2N55A 2XWJB 4GLVB 3VR6A 1PTOH 1H95A 1Q8KA 2A68D 4JI1L 3DHQA 4A3EB 2A69D 4C3JH 5FJ8G 3J80L 1YNNC 4QJFA 1YNXA 5ELFA 2Q8IB 3HOUG 1RD9D 2LSSA 4RFBA 3K8AA 3ZJYC 2HQLA 2HHHQ 2XGTA 4IUQA 2F4VQ 4B08A 1TKWB 5J22A 4BBSH 4FF3A 4DV2Q 1AE2A 4WJ4A 1VQPA 3M85A 3OW7A 3E0JA 1ET9A 3D4WA 4FXKC 4R4OA 3JAML 4XTCS 5NUCA 3KBXA 2L15A 4L5RC 3CRLC 1K3BC 4HSPA 4YY3L 3A8JE 1PZID 2AWOA 2FFKB 5CC4A 1HZBA 2KHIA 1PMRA 4POFA 4ZLTF 2VW9A 5JPNC 3I2ZA 4A3IH 1F9QA 2NVYH 4NMZA 5KNCA 1N33Q 5CBEE 1D5MC 5C4JH 2RA4A 3TP5A 1TR5A 4I7ZC 5I2YA 4ULLA 1MBYA 4Y7NH 4I65A 3C1FA 4UAIA 3CCUA 2F0KA 1HQRD 2EJFC 2ES2A 3C1EA 2XRQD 2Z6KC 4XT3B 1IKMA 4PQXA 3S1MH 1I4HA 1EQTA 2KUMA 4LFCL 4A4IA 1SYFA 3BG3A 3R3OA 3PIOA 3T53B 4IUNA 1LABA 5JPMC 1FJGL 3S1NB 3MVVA 4UP7A 3CCEA 2K50A 2B2TC 3L3OC 3S15H 4YY3Q 4EQNA 5CV5A 5IYCH 3FP9A 1AP0A 4KKTA 1H9SB 1HZCA 1N36L 4JI4L 4K2KA 2YTYA 3MA2B 1BDOA 3RNUA 3PIP3 2MO0A 3EA6A 3H3VI 1UE7A 2PI2E 2UU9Q 3MFYA 1Y69U 5I9OA 3A7LA 5JVH3 4WORA 1PXUA 1D2BA 1OXVA 1JOQA 5FO7B 2B2VA 1Y14B 2KHSA 2KCMA 4EX5A 4HEDA 3GDEA 1RL2A 5A35A 2MP1A 5LL6X 1IYVA 2G9DA 1K0RA 2E74C 4U673 1PH1A 2MGSA 3DXJC 2ZM6L 3DWAA 1X55A 2CW0D 1CHPD 1FL0A 1QWYA 4H7BA 3T16A 3D6CA 3CXCA 2QDBA 1PTOF 5E7NA 1V1PB 1X3QA 2N78A 1IKLA 4NXML 4UDUC 2N49A 4XQJA 4CJ0B 3G71A 2L11A 2SNSA 1CKOA 1UEBA 3PO3G 2F0MA 3ER0A 1PH8A 3K6OA 1K8AC 2E2IB 3SR1A 4RHRA 2SEBD 3PIO3 4UY8C 2EY1A 4G7OC 5K36G 5CV9A 5AJ3L 5IYCG 3NBHB 4IOCA 2YU9H 2L55A 3KLSA 5G3LF 4YCVA 4DK1A 4LK1C 3NBHA 4WRDA 1HNZQ 4F8MA 4DV5Q 1Q90A 3G48A 1PFMA 3CU7A 4BXXH 2AQ1B 1KIXA 3J81E 1EU3A 4QB4A 1EYDA 2PNRC 1N32L 3OIPA 4LF9L 4K8IA 4DK6C 3S14H 1D7QA 4DR1L 1QE6A 1J5EL 4AYBB 4BY7B 4QL5A 3A5UA 2EQSA 4BA1I 4G7ZC 2E2JB 2B39A 1MGSA 3VR3A 2B2UA 3PUZA 3J7YW 3TMEA 2B2WC 2OF1A 2EYJA 1RTOA 5CORA 1WTWA 4IUUA 3D31A 4DGZA 1EYGA 5D3DA 4DAMA 2JA8G 3N6RA 5FLMH 4DV5L 4FP5D 3CCJA 2OTLA 3RZOB 1E1TA 2F0JA 3PO2B 2NVQB 1OXUA 1UE6A 3NTIA 1Z6HA 2LXJA 3JAMc 3KF8A 1VQEA 3M9BA 2EVBA 1K73C 2ZXOA 1VF5C 1TWFB 1I6HH 5C44B 3PV0A 1BNZA 3HOZB 2CCZA 2AWNA 1X3PA 2WKCA 4QMGA 3VA5A 1EY5A 2UUCL 4KK7A 1PTOC 1TS5A 2K05A 1EQRA 1N32Q 1U4MA 1B3AA 2DJGC 4BY1B 1N34Q 1TY0A 3Q22A 3I72A 2HUGA 1F77A 1LTLA 1SNPA 5M5YB 1FD7D 4XYQA 4ALPA 1AZQA 3H6MA 1FGBD 1VQAA 2IHFA 4Q0FA 2UXBQ 3ITPA 2O5JC 4BBRH 2EJMA 2CQOA 4NXNL 2BE5C 1EYAA 2RF4A 2SDFA 4TRDA 5EPJA 2UXCQ 4BBRG 4OO1I 1EIFA 2PNHA 1S5CD 4TQUS 4WJ3M 2QA4A 1YEZA 2HDMA 5ELNA 2NTSA 4A3BH 2D0OA 1CQFA 2PYKA 2VUMG 1EL0A 3SK5A 5GQOA 1QNUA 3FKIB 4DV7Q 1L1OC 3EVQA 5JEAJ 1QUQA 2UU9L 1C0AA 1IXRA 2F4VL 1FR3A 2MJ8A 3CCRA 2R7ZG 1BCPC 2J0TD 4HIOA 1EEFD 2K32A 3EBEA 3IKJA 4Z9CB 4C3IG 2QEXA 4KJOA 2A8VA 1H9MA 2R93G 1K83H 4N8FA 1HRJA 1JJCB 1MJEA 5CGKA 4K5VA 1DJRD 4IPHA 3RZDH 1YITA 2EPBA 3OPOA 4HTHA 3S14B 3E0EA 2R7ZB 3D6WA 1XXGA 5KYIA 4EQPA 2I46A 4JI7Q 2YTVA 4R4CA 4JW0A 3KDFA 1S5ED 3H0GH 3W1BA 2B8FA 2VZAA 1SXTA 5J39A 5D65A 3T1HQ 1TIID 1D8LA 3UDIA 5IT9L 4X64L 1LACA 1VQMA 4LF8L 4L63B 4KKUA 4PV1C 4KI0A 1E2VA 4DV6Q 1FNWA 1W6KA 4PNYA 5IYDG 5M3FG 1HA5A 4APVA 1SMYC 1CA5A 5M5WH 4DAYB 4O1NA 2E5LL 4DR1Q 4P2CB 2A6EC 1LO5D 3I4OA 2WFWA 3SE0A 1CKMA 4DAYA 1VCIA 3J7AF 2O2LD 3ND9A 3ULJA 3DMUA 4MTNA 2CW0C 4BY1H 1PFSA 1PH4A 3M4OH 5C0XH 4AQYL 1R4QB 5FO8B 3MC0B 4KHPL 1A15A 3CCSA 2AKWB 5COYA 4A93G 1U4LA 3KF6B 1BKBA 2HDLA 1EIGA 3V05A 3M4PA 4LF6Q 3PF5A 1T9HA 2AQ3B 4ME3A 3TEHB 4X3TA 2BH8A 4MN3A 1TWGB 5EJWA 4B3TQ 1GJXA 1VQBA 4QIWE 4H02A 1SFOH 4X64Q 3I4NH 3CRKC 3TRZA 1EFID 3RMHA 1KTKA 4A3KG 2SNMA 1B44D 1CT1D 2FXQA 4KMUC 2KJXA 3EROA 3PO3B 4R4TA 3I7FA 1NMFA 2IY5B 4GKJL 2KCCA 2JN4A 2PZUA 1K0SA 1NTGA 1PVOA 1A2UA 1PYWD 4HSVA 1XPUA 1RIPA 1M1KC 3F1ZA 2NVXH 4MZ9A 4DR2Q 3HKZB 1BCPD 1I50B 4N9PA 1X3EA 1SNOA 4F7XA 4X62Q 4BXXG 2J4XA 4DR5L 2NYZD 3A5ZB 1PTOB 2CH4W 3J80c 1JJ2A 3ERQA 4G4KA 4KD4A 4A3BB 1PZKD 1D5ZC 3BYYB 4A3FH 1UEAB 4LF9Q 1HFNA 1OTCA 2PMZE 1S5BD 4A3KH 3HP3A 1LT3D 3HGBA 4RH6A 2F3IA 1PZJD 4C3HB 4EQ5A 1SSOA 2IX0A 1E7ZA 1WOCA 1P8LA 3E9HA 1LTRD 3HOVH 4CGYB 1SMXA 2O4XA 1JE5A 2F0DA 1N8RC 4GN4B 1YBYA 2PI2A 1VQJA 2C35B 5C3EH 2OCEA 1VQ6A 1HR0L 2MNAA 1TS4A 2AUKA 3HOWG 1XJVA 5C4XB 3NWSA 3H0GB 2B3GA 4QIWB 1C9OA 1E22A 4RGMA 5IP9H 1DXMA 3GTKB 1EYCA 1LT5D 4JK1C 2UUBL 1SN8A 4IFDH 2F0UA 4J6HA 2JSOA 2Z1CA 1Q8IA 2HCIA 3Q24A 4QY7A 2F0QA 2PZWA 4H44C 1B3QA 1A63A 4YHHL 1WTQA 3U4VA 1LTAD 3DWQA 1X9NA 4KTAA 4X3SA 3RZOH 3URYA 1S5DD 1GUGA 1L1OA 4EVOA 1HNXL 1JWUD 3HOXH 3BU2A 4CHTB 2QKIC 5ELDA 2K6AA 1YVCA 4K0KL 1WTXA 1GUWA 1VDZA 1HR0Q 2UUBQ 2RDFA 4DR4Q 5FOBB 1AEXA 1MI2A 4DNRB 1B4OA 5LHY1 5TSSA 3PCOB 1TWGH 3E9IA 3S16B 4JYAQ 3CW2C 2X6LA 4K6DA 4P75A 4RG1A 5IT9c 2R3ZA 1LT4D 1STGA 2K28A 4LUOA 3BJUA 2OQ0A 1XNRL 3A56A 2H1EA 5KRUA 3KF8B 2R6GA 4A3JG 4U68A 3CC2A 4LFCQ 1D1KA 4B9XA 1UE1A 1PV4A 5KNBA 1SNDA 4DNTB 1GKHA 3I4NB 2MUYA 1IL2A 1JJGA 4A3DG 3J80i 1HQMC 2RDGA 3CPFA 3KK7A 4FDBA 4UHVA 3SK6A 3S9WA 4GNXC 1E3PA 1HNWL 1CQVA 3A74A 4IO9A 2JXMB 3SK4A 4RKBA 5C0XI 3J81L 2V1CC 3STBD 2UXDL 1XNRQ 3K57A 2ZXRA 5K5PA 4ZRZA 4LAAA 2JA5G 3UDXA 3K7UC 4GNXA 1ML0D 4PZ7A 4A3EH 1EZ6A 2WAQG 3H15A 4DAPA 2M9VA 3PUWA 1FNUA 2MPMA 2B2WA 2K52A 2A6ED 3A0JA 4M8AA 4N8X1 2Y0SG 4C3JG 1BUVT 2D9UA 3MXNA 5C4XH 2A19A 4HMIA 5C4XG 2ZJPA 1VQ8A 3SHLA 3HOZG 1RJTA 1CUKA 2ID0A 1YIJA 1E1OA 1CKNA 2HQEA 3W5OA 2DY7A 1CZGA 3VYSA 3TS0A 3S1RH 1RTNA 2EYOA 1GD7A 3CAMA 3M3YH 3SVMA 3K5MA 2VNUD 3E6ZX 5C4ZA 1S72A 4LF7L 2Z4HA 3D8GA 2KHJA 3S2DH 3UE1A 1G2TA 3TP6A 1YNJC 5DM73 2J7ZA 4CDCC 1SE2A 5GAHC 1SJED 2JJQA 1YI2A 1GVPA 3F8TA 1SYEA 1JWMD 1CSQA 1ZXTA 1Y1VB 1PH3A 3HOXB 5IYDH 1RKNA 1DM0B 3ZYYX 1JR0D 1JICA 1EY8A 3EJIA 5LL6S 1KDBA 3T1YL 2A68C 2WAQE 3J7ZC 5LMNL 4GKKL 4H13C 2XNAC 3SDZA 1YNND 5F2DA 3OMCA 3CQZB 2RSNA 4OWXB 4IZ8A 4IQZA 3S16H 3U9OA 3K80C 5IE8A 1GHKA 1OXXK 5C5MA 2A74C 5JEAH 4DV4Q 4P71A 4C56C 2RCFA 3EN2A 1ESFA 3H94A 2JA7G 3TN2A 1L0YB 3GTJH 2HIVA 1M90C 2BA1A 4OO1H 4GZYC 1C7YA 1HNXQ 2JA7H 2DN8A 5M3MB 2YTXA 3T51B 3VYTA 3CP0A 1SAPA 4JOIC 4UP8A 1AZPA 2D0PA 3J81i 1TWHH 3C3LA 4JI6L 3M7NA 2IWHA 4JI1Q 2Q8TA 1A2TA 3S17H 1QG7A 4RWSC 4V0BA 5IY0A 5DLQE 2RBMA 4YCUA 4DR3L 4A3CH 2UUCQ 1IW7D 3I55A 1JQYD 3VR4A 1IBKL 5EGTA 4OX9Q 1QVCA 3MXGA 2EXDA 1I50H 2NZHA 2X69A 4A93B 1Z9FA 1I4QA 3FPUB 4MIUA 5L37A 4PMWA 1EIYB 2IPKD 4B3SQ 4AYBE 2F4IA 4XXEA 2A5HA 5C3XA 1BR9A 1EWCA 4DNIA 1YJNA 4HAEA 3QG1A 5D3IB 4ABNA 5IGFA 1Y1WG 2K33A 1PH7A 3KBGA 3QO2A 1EY7A 2EYLA 5DM63 4NDXA 5IP9G 1ZYRD 1I3QB 4JCVE 5M5XB 3P75A 4ID6A 3CC7A 4DUYL 3AMUA 4KHZA 4CKBA 4DR3Q 4LJZC 4YWMA 4AH6A 1C8CA 4RCNA 2WINB 3QJYA 1XPRA 1DZ1A 3QWNA 3TREA 5ELOA 1GUNA 1SROA 3RR5A 3OSOA 2A73B 1AFPA 2PQEA 3JAMi 3LWUA 1KQSA 3V96A 4RCOA 1DCZA 1VQHA 2N3SA 2EIFA 3NE5B 5GROA 3HKSA 3M7GA 4JBKA 2Z0SA 1VMCA 4HJ8A 1JB3A 3R8BA 2KCTA 5HGTA 4UPAA 1VQIA 5AJ3Q 2SOBA 1K8GA 1WCMB 1G6PA 3K5NA 1KAWA 1K3RA 4O42A 3NEMA 1JMCA 4XYOA 3O13A 5H1SE 5CV8A 5KNDA 4DR7Q 3S2DB 3CMAA 3RD4A 1UWVA 2F3WA 2HT1A 5T1GA 4OXPA 3W1GA 3OWFA 1DD2A 4C3IB 1TY2A 2L12A 2G9HD 5I2XA 1I4GA 3PGZA 4DK0A 1U9RA 1Y1VH 1XX8A 3BDOA 4XT1B 2WP8J 3FKIG 2OWOA 4A76A 2Z6BA 1LUZA 1B1ZA 2GVAA 3SEBA 1B8AA 3GTJB 3I4NG 3NXWA 4RAUC 3OTOL 2C9OA 4IPGA 2GVBA 3WDNA 3GTOH 1X56A 5M3MH 3BZKA 5IT9E 1STAA 5A2QL 2K5VA 1B70B 2KEDA 3K81C 4CDFC 3T13A 1WTPA 1A0IA 2Z4IA 2CH4A 1EEID 3HRZC 4A3GB 3PF4A 5E4WC 3QOLA 5CV6A 4IN3A 4GN5A 2MO1A 4IFDG 1G2SA 2QGQA 5C6AA 1WTHA 4AQYQ 1PDQA 1BCPB 2Q2TA 1N34L 2JA9A 3ULPA 4C1NK 4I7AA 1XMOL 2R7FA 4L6TB 1S40A 5EQ0A 2JEAI 2VS1A 1JWSD 2ICEC 5ELCA 2PW5A 3X3MA 2K5WA 3I4MG 3A8IE 3UI2A 1R4PB 2RHSB 4JI8L 1ILPA 4HMJA 3HOVG 4NP5A 3P1HA 2DGYA 2WB1G 1HNZL 1KLUD 1NAPA 4KJNA 2UUAL 1SR3A 1NMGA 1A8VA 1SE3A 4GLAC 5C3WA 2KBNA 1MSGA 1VMPA 2JA8B 1U4PA 1HUNA 1IBMQ 1ET6A 1AE3A 2B2TA 3OOCA 5LMUL 1BF4A 1DYQA 1PFNA 3BDCA 4DR2L 2EYMA 3KLWA 4DA2A 3U58A 5FJ8H 3QB3A 4DR6Q 4BBSB 4LUVA 2JEBI 4FF2A 4GKJQ 2PMZB 3RN2A 2QW7A 3HOYG 5C44G 3TP8A 2FMCA 3EIVA 4JOIA 1DOLA 2K04A 3Q23A 3MXNB 5HURA 4A3JH 3MHBA 1Y1VG 1VQLA 1TWCB 5KEEA 1ENAA 4QUCA 4JI3L 2FMMA 4DV0L 1X3FA 4A3MB 5EBDA 5D14A 3K7AB 3NHHA 1A62A 3GTKH 3OW2A 3BVMA 4JVZA 4ILWA 4ODGA 4A3BG 5JJLA 5ELEA 2VL6A 1SEBD 4OELB 4Y7NB 2K5HA 2RCNA 1EOVA 4OWTB 1PYBA 3WWVA 5KIXA 2EY2A 1HTLD 2A6HD 3K5LA 5FLXL 4LMQD 4R4IA 4JI6Q 3AU7A 3OMGA 3J7A5 2I5HA 5M3FH 1QVFA 3VR5A 2RHQB 4L8JA 3RLOA 4OIKA 4IUTA 3CMEA 1DOKA 2E8GA 1F2ZA 1PTOD 2Q8RE 1NUCA 3VYRA 3KJOA 3Q8DA 1NSNS 3F2BA 3S15B 3FVQA 3TZDA 1NCVA 4ME5A 4RGTA 1EQQA 1HPCA 1ICFB 4A75A 4HJ5A 5BN4A 4IURA 3HOYB 1VQNA 1HTPA 2OEOA 1T5XD 4X3UA 5G3LD 3CCLA 1U4RA 3S17B 1SLJA 4X62L
chains in the Genus database with same CATH topology
2KQ3A 2K01A 1Y8OB 4DU9A 3NSWA 4BBRB 2IX3A 3R2IA 1I4XA 5C5LA 2H4OA 4YIJA 1H9RA 1GOZA 2WB1B 4EQOA 1V1OA 1UUPA 1K8MA 4FXDA 5DEHA 2D5DA 2EJGC 4CJ1B 1STYA 4TSSA 3T4AC 3W3AA 1STNA 2HCCA 4FXGC 2F0GA 3FEWX 2L0CA 5JEAG 4XDXA 1OXSC 3WOFA 3PUVA 3TSSA 5K36H 3M3YB 2F0HA 3J80E 2EY5A 2JE6I 3NUCA 2QILA 3RZDB 2NWGA 4A3JB 4E6IA 4HR7B 1HCZA 3X3NA 5CBAE 4F87A 2XRSD 3H91A 2M2LA 2JA5B 3SK8A 2KEEA 5IGGA 2F0EA 1GHJA 2FJ2A 4CKEA 1KDCA 2F03A 1C4QA 1JCKB 1Q1EA 4KY5A 4RA8A 5EKLA 3IAYA 4G7HC 2XSCA 1A6XA 1TT2A 5C4JB 1ENCA 4FYDA 4ZAIA 3I73A 2B2VC 3PMFA 3TBIB 1TQOA 4ZUIA 4DAVA 2K03A 1PRTB 1EY4A 4PMBA 2TSSA 5A2QE 4OIJA 2OT2A 2LS01 2V4DA 1QILA 4IFDJ 1VF7A 1RCVD 2F1MA 1CHQD 2ZT9C 3M4OB 2ZXPA 4XQQA 4EGVA 1JE4A 3K0YA 1Z47A 1HA6A 2NUCA 1BBXC 1R9TB 5C4HA 5KGUA 1QJOA 1B9NA 2PPBC 1V1PA 5FK9C 2PO4A 3DWPA 3P20A 1V8QA 4S3SA 1G6ZA 1QCBD 4KKSA 3HG9A 1BCPF 2B2YC 3I70A 5I6WA 2DNCA 4OO1G 4H0LC 1GUTA 3QOJA 3DEPA 2DY8A 3S2HB 1C48A 3L9AX 1KLGD 2B2UC 1QOHA 1BOSA 2KOLA 2XN9C 1A3UA 1TU2B 1TS2A 1FNVA 1AN8A 1E0BA 4CJ2C 5IGBA 3M4YA 2E75C 4IFDI 3J7AV 1E2WA 1EOTA 5EPKA 5IODA 2VXWA 5I4DA 2D2CC 1AW7A 4G57A 3HOVB 1D5XC 5C3EB 1S5FD 1GUSA 1SNMA 1M4VA 2L5TA 4KD3A 4K8JA 1XTCD 2EZVA 4A3IB 1BXTA 1SYCA 5I9PA 3OHXC 5CR3A 4RHSA 4KN7C 2EYPA 3I8ZA 1T5EA 5JJZA 1DONA 5M5WB 2XWBB 4J8QA 5IGCA 1A3TA 1V43A 1B2TA 3GTMB 2EE1A 3BDLA 4FF1A 2PZTA 3GO5A 1JOOA 4K5WA 3MAQA 1WD0A 3I91A 2RSOA 3DEOA 1SJHD 2ICIA 3TZUA 5BN5A 2O5IC 4Q5VA 1WTRA 3A7AB 1KABA 1H9SA 3GTOB 4R8IA 1F2MA 5CYUA 3E5SA 1LTTD 3KLSX 3MZ5A 4XIGS 1Q1BA 3EQLC 1J8IA 3KLRA 1O7YA 3H3VC 3MEHA 5IIFA 3T56B 1D1IA 2F0LA 5JAVA 3G6JB 3HOUB 1UAPA 2R61A 5EBCA 2CQAA 4NW2A 1PFBA 1F9RA 2M00A 2PW7A 1F2YA 3VYUA 3NTKA 5CV7A 3GQBA 3BVZA 3LWEA 1J9OA 5ISRA 1PLFA 1GXDC 2CVRA 5EPLA 5C0XG 3AB9A 1I6VC 3OWEB 3MWYW 3RUZA 1Z7TA 3U9SA 1SYGA 2NTTA 3NWTA 3FMCA 1ZEQX 2R93B 3NQTA 3GD7A 3I3CA 3PUYA 3C46A 3D4DA 2BA0A 1G91A 2IW3A 3KUPA 1SMYD 1EZ8A 1ILQA 3D3RA 1L0XB 3CKIB 5T1IA 3S1QB 2QCPX 2FINB 2KVMA 1BQQT 5ELBA 4KN4C 2A69C 2B63B 1SNCA 1QB5D 1LT6D 1F9PA 2R92B 1H9JA 1I6HB 4PMCA 5JOBA 2F3VA 3NPPA 1SYBA 3GTQB 2QF7A 2F0TA 4K2LA 1O7LA 1RF2D 3F2UA 2E2DC 3FPPA 4FVMA 3BVGA 3A55A 3NBIA 1LTBD 2BDOA 1EY6A 4RKLA 4C3HG 2WV6D 4C2MB 3DM1A 3NP8A 4TKOB 2VB2X 1WTVA 1STHA 1BO0A 3GV6A 4J1MA 2NBFA 3OIQA 3GV3A 2NVXB 1TVXA 4HCEA 2NB0A 3V2TA 2K1BA 4ZK9B 4C3JB 5EKKA 1K83B 1G8ZD 2EYFA 1LV9A 5J1ZA 1O7ZA 3GP7A 1M8AA 4K6LA 4A3KB 1EWHA 2D62A 4XQNA 5AFWA 3A8KE 2FHTA 3I90A 1CM9A 4HN7A 1CFMA 3LX0A 2RQXA 5JVG3 4B9WA 2K5QA 4QUFA 4DXFA 5E1FA 1K8OA 3HEJA 4ZKCB 5E4XA 1WD1A 2KCNA 2IX1A 4HCSA 2B2YA 3A54A 1XYIA 4K14A 2TMPA 2K5DA 3G7LA 2JYOA 5CV4A 5FO9B 3N52A 1RDPD 5M3FB 3NTHA 1PRTC 4ZKBB 3Q0AA 2L1BA 1EY0A 2F0NA 3BZDB 1D6EC 2IJ0A 2A6HC 4KY6A 1Q12A 1QNKA 1EU4A 2Z8LA 5I6YA 1I4RA 3S1MB 3I4MB 2F0VA 2RKSA 3IL8A 2XVSA 1HFGA 4FO2A 2QEJC 2NN6I 1CI3M 2IL8A 1MSHA 1HXYD 3BYTB 4BS9A 1H9KA 1ONLA 2KECA 2N88A 4C1NI 2LKVA 1O80A 2PCFB 1IHZA 2LMCB 3GTPB 4FF4A 2EXZA 4RGOS 1KNAA 5C0XJ 1WTOA 1S4ZA 2JA6B 3H09A 3FDTA 2YU9B 1B53A 1STBA 2WKDA 4QF4A 5BN3A 1FYCA 1TS3A 3GTGB 4NKLA 2DNEA 3LNNA 2AUJD 2BDNA 2WAQB 2NN6H 1SE4A 5DAUA 1LTGD 4X3KA 5IOCA 1STEA 1II3A 4KHVA 4DF7A 5KYLA 4KV6A 2XIWA 1KAAA 1JOKA 2E76C 3I4LA 3TDQA 3WOEA 5E3FA 1Y8PB 1E2ZA 1LTSD 2K7VA 4A3DB 1ESRA 2NVYB 4V190 1CTMA 3L7ZC 2C5CA 1G291 1CK1A 4M1UB 2L9HA 4ZUJA 2RDHA 2EOTA 1SBBB 1NR4A 3MXUA 2AQ2B 4DXGA 1LTID 4WJWA 5EKIA 5DNFA 1SYDA 1MD2D 2LFNA 3RLFA 1IL8A 2EDGA 3HZXA 1YNJD 2F0IA 3Q6SA 1SNQA 2NN6G 3EFXD 2WACA 3SXHA 1HUMA 1NR2A 1SDFA 3IFTA 1EQVA 3K58A 3NK9A 4RGNA 5IGEA 2F0OA 3CHBD 1EIHA 3GTLB 1XWEA 1ZKOA 1I4PA 1CZWA 1X32A 3VA7A 1A3VA 4R8NA 1Y8NB 2BE5D 4BA2I 4IUVA 4QCLA 4R9WA 2OXPA 3R93A 3C2PA 2F0FA 4BWGB 4ZQ3A 4A3FB 2YYZA 3MTSA 3ND8A 3QIAA 2B8GA 2EY6A 4OHJA 5FLXE 1B50A 1DOMA 2F0PA 3DUZA 4KY7A 1B9MA 3S1RB 2GA4B 2X6GA 1IW7C 3W2DA 2I07B 5IGDA 3TP7A 1JORA 1O78A 1Y1WB 2ENBA 2EYHA 1KDAA 1HHVA 2L4NA 1ENFA 1Q3LA 3MXPA 4CKCA 1OO9B 2NZ1D 2IT1A 2KA7A 3MFGA 1JC7A 4CBVA 1WVLA 1ZYRC 4F88A 4JBWA 5FKAC 3ONAB 2MHVA 3HS0C 3P7JA 2LY7A 4WFN3 1OXTA 3VR2A 1PRTD 1PRTF 4K5XA 2F0WA 3D4RA 1F9SA 2JP1A 1KNEA 2BCOA 4MHEA 2WIIB 2JA7B 1ICWA 1RODA 2RVLA 1SFOB 4FNFA 1TWHB 4OL7A 2BOSA 3BS1A 1CA6A 1RHPA 3K59A 1IYUA 3PUXA 1TWAB 4DFAA 3JAME 2Y0SB 2VB3X 1GUOA 2F0SA 4DN4M 4IALA 3FRPB 1LLRD 4IUPA 2VUMB 1F2LA 3R2TA 3HOWB 3K5OA 5CMDA 1UNSA 4ZYSA 4N9TA 2CHBD 3IFDA 2E2HB 2NVTB 1W6JA 4OGQC 1EY9A 5M9OA 3NQIA 2N55A 2XWJB 3VR6A 1PTOH 2A68D 4A3EB 3DHQA 2A69D 3J80L 1YNNC 2Q8IB 5ELFA 1RD9D 4RFBA 4IUQA 4B08A 1TKWB 5J22A 4FF3A 3M85A 3OW7A 3E0JA 1ET9A 3D4WA 4FXKC 3JAML 4XTCS 5NUCA 3KBXA 3CRLC 4HSPA 3A8JE 1PZID 2AWOA 2FFKB 5CC4A 1PMRA 4ZLTF 5JPNC 1F9QA 4NMZA 5KNCA 5CBEE 1D5MC 2RA4A 3TP5A 1TR5A 4I7ZC 5I2YA 4ULLA 1MBYA 4I65A 3C1FA 4UAIA 2F0KA 1HQRD 2EJFC 3C1EA 2XRQD 1IKMA 4XT3B 4PQXA 1I4HA 1EQTA 2KUMA 1SYFA 3BG3A 3R3OA 3T53B 4IUNA 1LABA 5JPMC 3S1NB 3MVVA 2B2TC 3L3OC 4EQNA 5CV5A 1AP0A 4KKTA 1H9SB 4K2KA 3MA2B 1BDOA 3PIP3 3EA6A 3MFYA 1Y69U 5I9OA 3A7LA 5JVH3 4WORA 1PXUA 1D2BA 1OXVA 1JOQA 5FO7B 2B2VA 2KHSA 4HEDA 5A35A 2MP1A 5LL6X 1IYVA 2G9DA 4U673 2E74C 2MGSA 3DXJC 3DWAA 2CW0D 1CHPD 1QWYA 4H7BA 3T16A 3D6CA 2QDBA 1PTOF 1V1PB 1X3QA 1IKLA 4UDUC 4XQJA 4CJ0B 2L11A 2SNSA 2F0MA 3K6OA 2E2IB 3SR1A 4RHRA 2SEBD 3PIO3 2EY1A 4G7OC 5K36G 5CV9A 2L55A 3KLSA 5G3LF 4DK1A 4LK1C 3NBHA 4WRDA 4F8MA 1Q90A 1PFMA 3CU7A 2AQ1B 3J81E 1EU3A 4QB4A 1EYDA 2PNRC 3OIPA 4K8IA 1QE6A 4AYBB 4BY7B 4BA1I 4G7ZC 2E2JB 2B39A 1MGSA 3VR3A 2B2UA 3PUZA 3J7YW 3TMEA 2B2WC 2OF1A 2EYJA 1RTOA 5CORA 1WTWA 4IUUA 3D31A 4DGZA 5D3DA 3N6RA 4FP5D 3RZOB 2F0JA 3PO2B 2NVQB 1OXUA 3NTIA 1Z6HA 3KF8A 2EVBA 2ZXOA 1VF5C 1TWFB 5C44B 3PV0A 1BNZA 3HOZB 2AWNA 1X3PA 2WKCA 4QMGA 3VA5A 1EY5A 4KK7A 1PTOC 1TS5A 2K05A 1U4MA 1B3AA 4BY1B 1TY0A 3Q22A 3I72A 2HUGA 1F77A 1SNPA 5M5YB 1FD7D 4XYQA 1AZQA 3H6MA 1FGBD 4Q0FA 3ITPA 2O5JC 2EJMA 2BE5C 1EYAA 2SDFA 4TRDA 5EPJA 4OO1I 1S5CD 4TQUS 2HDMA 2NTSA 1CQFA 2PYKA 1EL0A 3SK5A 1QNUA 3FKIB 3EVQA 5JEAJ 1FR3A 2MJ8A 1BCPC 2J0TD 1EEFD 2K32A 4Z9CB 3IKJA 4C3IG 4KJOA 1H9MA 1HRJA 5CGKA 4K5VA 1DJRD 2EPBA 3OPOA 4HTHA 3S14B 2R7ZB 3D6WA 1XXGA 5KYIA 4EQPA 2I46A 1S5ED 2B8FA 1SXTA 5J39A 5D65A 1TIID 5IT9L 1LACA 4L63B 4KKUA 4PV1C 4KI0A 1E2VA 1FNWA 1W6KA 4PNYA 1HA5A 1SMYC 1CA5A 4O1NA 2A6EC 4P2CB 1LO5D 3SE0A 4DAYA 1VCIA 3J7AF 2O2LD 3ND9A 3DMUA 2CW0C 5C0XH 1R4QB 5FO8B 3MC0B 1A15A 5COYA 1U4LA 2HDLA 1EIGA 3V05A 2AQ3B 4X3TA 4MN3A 1TWGB 5EJWA 1GJXA 3CRKC 1EFID 3RMHA 1KTKA 2SNMA 1B44D 1CT1D 2KJXA 3EROA 4KMUC 3PO3B 2KCCA 2PZUA 1A2UA 1PYWD 4HSVA 3HKZB 1BCPD 1I50B 4N9PA 1SNOA 4F7XA 2J4XA 2NYZD 1PTOB 3ERQA 4G4KA 4KD4A 4A3BB 1PZKD 1D5ZC 3BYYB 1UEAB 1HFNA 1S5BD 3HP3A 1LT3D 3HGBA 4RH6A 1PZJD 4C3HB 1SSOA 2IX0A 1LTRD 4CGYB 2O4XA 2F0DA 1TS4A 2AUKA 5C4XB 3NWSA 3H0GB 4QIWB 4RGMA 3GTKB 1DXMA 1EYCA 1LT5D 4JK1C 4IFDH 2F0UA 4J6HA 2JSOA 2Z1CA 1Q8IA 2HCIA 3Q24A 2F0QA 2PZWA 4H44C 1WTQA 1LTAD 3DWQA 4KTAA 4X3SA 3URYA 1S5DD 1GUGA 4EVOA 1JWUD 4CHTB 2QKIC 5ELDA 2K6AA 1WTXA 1GUWA 1VDZA 2RDFA 5FOBB 1AEXA 1MI2A 4DNRB 1B4OA 5LHY1 5TSSA 3S16B 2X6LA 4K6DA 2R3ZA 1LT4D 1STGA 2K28A 3A56A 2H1EA 5KRUA 2R6GA 4U68A 1D1KA 4B9XA 5KNBA 1SNDA 4DNTB 3I4NB 2MUYA 1HQMC 2RDGA 3KK7A 3SK6A 3S9WA 1CQVA 2JXMB 3SK4A 4RKBA 5C0XI 3J81L 3K57A 2ZXRA 5K5PA 4ZRZA 4LAAA 1ML0D 1EZ6A 4DAPA 2M9VA 3PUWA 1FNUA 2MPMA 2B2WA 2A6ED 4M8AA 4C3JG 1BUVT 2D9UA 3MXNA 4HMIA 3SHLA 1RJTA 2ID0A 2HQEA 2DY7A 1CZGA 3VYSA 1RTNA 2EYOA 3SVMA 3K5MA 2VNUD 3E6ZX 5C4ZA 2Z4HA 3D8GA 1G2TA 3TP6A 1YNJC 5DM73 2J7ZA 1SE2A 1SJED 1SYEA 1JWMD 3HOXB 1ZXTA 1Y1VB 1RKNA 1DM0B 3ZYYX 1JR0D 1JICA 1EY8A 3EJIA 5LL6S 1KDBA 2A68C 4H13C 2XNAC 3SDZA 1YNND 5F2DA 3OMCA 3CQZB 2RSNA 4IZ8A 4IQZA 3U9OA 1GHKA 1OXXK 5C5MA 2A74C 5JEAH 4C56C 1ESFA 3H94A 3TN2A 1L0YB 2BA1A 4OO1H 4GZYC 2DN8A 5M3MB 3T51B 3VYTA 1SAPA 1AZPA 3C3LA 3M7NA 2IWHA 2Q8TA 1A2TA 1QG7A 4RWSC 4V0BA 2RBMA 1IW7D 1JQYD 3VR4A 5EGTA 3MXGA 2X69A 4A93B 1I4QA 3FPUB 4MIUA 4PMWA 2IPKD 2F4IA 4XXEA 2A5HA 5C3XA 1BR9A 1EWCA 4HAEA 3QG1A 5D3IB 4ABNA 5IGFA 2K33A 3KBGA 3QO2A 1EY7A 2EYLA 5DM63 4NDXA 1ZYRD 1I3QB 5M5XB 3P75A 4ID6A 3AMUA 4KHZA 4CKBA 4LJZC 1C8CA 4RCNA 2WINB 3QJYA 1DZ1A 3QWNA 1AFPA 1GUNA 3OSOA 2A73B 2PQEA 3LWUA 3V96A 4RCOA 1DCZA 3NE5B 3M7GA 1VMCA 1JB3A 3R8BA 5HGTA 2SOBA 1WCMB 3K5NA 4O42A 4XYOA 3O13A 5CV8A 5KNDA 3S2DB 3RD4A 2F3WA 5T1GA 3OWFA 1DD2A 4C3IB 1TY2A 2L12A 2G9HD 5I2XA 1I4GA 4DK0A 1U9RA 1XX8A 3BDOA 4XT1B 2WP8J 1B1ZA 3SEBA 3GTJB 3NXWA 4RAUC 2C9OA 3WDNA 5IT9E 1STAA 5A2QL 2KEDA 3T13A 1WTPA 2Z4IA 1EEID 3HRZC 4A3GB 5E4WC 3QOLA 5CV6A 4IN3A 4IFDG 1G2SA 5C6AA 1PDQA 1BCPB 4C1NK 4L6TB 5EQ0A 2JEAI 1JWSD 2ICEC 5ELCA 2PW5A 3X3MA 2K5WA 3A8IE 3UI2A 1R4PB 1ILPA 4HMJA 4NP5A 3P1HA 1KLUD 1NAPA 4KJNA 5C3WA 1SE3A 1MSGA 1VMPA 2JA8B 1U4PA 1HUNA 1ET6A 2B2TA 3OOCA 1BF4A 1DYQA 1PFNA 3BDCA 2EYMA 4DA2A 3QB3A 4BBSB 2JEBI 4FF2A 2PMZB 3TP8A 2FMCA 1DOLA 2K04A 3Q23A 5HURA 3MHBA 1TWCB 5KEEA 1ENAA 4QUCA 4A3MB 2FMMA 5EBDA 5D14A 3K7AB 3NHHA 3BVMA 4ILWA 4ODGA 5ELEA 1SEBD 4Y7NB 5KIXA 2EY2A 1HTLD 2A6HD 3K5LA 5FLXL 4LMQD 3AU7A 3OMGA 3VR5A 4L8JA 4OIKA 4IUTA 1DOKA 1F2ZA 1PTOD 2Q8RE 1NUCA 3VYRA 1NSNS 3S15B 3FVQA 3TZDA 1NCVA 4ME5A 4RGTA 1HPCA 5BN4A 4IURA 3HOYB 1HTPA 2OEOA 1T5XD 4X3UA 5G3LD 3S17B 1U4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP 3;  5DM7 3;  4U67 3;  5JVG 3;  3PIO 3;  5JVH 3;  5DM6 3;  4WFN 3; 
#chains in the Genus database with same CATH topology
 2KQ3 A;  4DR4 L;  2K01 A;  1HZA A;  1Y8O B;  4R4Q A;  4IPD A;  4DU9 A;  3J81 c;  3NSW A;  3DM3 A;  4BBR B;  2IX3 A;  3R2I A;  1I4X A;  4A93 H;  5C5L A;  2H4O A;  2Z6K A;  4OON A;  4A3C G;  1X54 A;  4DUY Q;  4YIJ A;  1VQ7 A;  1H9R A;  1GOZ A;  2PQA A;  2WB1 B;  4JG2 A;  3S2H H;  4EQO A;  1V1O A;  1UUP A;  1HH2 P;  1K8M A;  3GTP H;  2DUD A;  2VUM H;  4J15 A;  4FXD A;  5DEH A;  2D5D A;  4X66 Q;  2EJG C;  4CJ1 B;  1STY A;  4MNO A;  1PH9 A;  4TSS A;  2CWP A;  3T4A C;  3W3A A;  2E2H H;  1STN A;  2HCC A;  4FXG C;  2F0G A;  3FEW X;  2L0C A;  5JEA G;  5FLX c;  2ASB A;  4XDX A;  1OXS C;  3WOF A;  3PUV A;  3TSS A;  1SRU A;  5K36 H;  3M3Y B;  4JC0 A;  2F0H A;  3J80 E;  2EY5 A;  1G51 A;  1EWI A;  4OX9 L;  2JE6 I;  3NUC A;  2QIL A;  3RLN A;  3RZD B;  1IZ6 A;  4NB3 A;  1N33 L;  2NWG A;  1X3G A;  4A3J B;  4E6I A;  4HR7 B;  2R7Z H;  1PH2 A;  1HCZ A;  3X3N A;  5CBA E;  2Q2U A;  4F87 A;  2XRS D;  2CWA A;  3H91 A;  4LF6 L;  4GOP A;  2IHE A;  4O2D A;  4GS3 A;  2M2L A;  3CCV A;  3PIP A;  2JA5 B;  4BY1 G;  3K7A H;  3SK8 A;  2KEE A;  3CD6 A;  5IGG A;  2F0E A;  4C3I H;  1GHJ A;  2FJ2 A;  4CKE A;  1KDC A;  2F03 A;  1JT8 A;  1C4Q A;  1JCK B;  1Q1E A;  4KY5 A;  4RA8 A;  3IRB A;  5EKL A;  1FJG Q;  3IAY A;  4G7H C;  2XSC A;  1A6X A;  1TT2 A;  5C4J B;  1ENC A;  4FYD A;  4ZAI A;  4JI3 Q;  3I73 A;  2B2V C;  1YJ9 A;  3PMF A;  3TBI B;  1TQO A;  2KEN A;  4ZUI A;  4DAV A;  1TWF H;  2F52 A;  2K03 A;  3CPW A;  1PRT B;  1EY4 A;  4PMB A;  2TSS A;  2ZTE A;  5A2Q E;  4OIJ A;  2OT2 A;  1LYL A;  1XNQ L;  1IYJ B;  3GTM H;  2LS0 1;  2V4D A;  4JI5 L;  4B3S L;  1QIL A;  3NEL A;  2VQE L;  4IFD J;  1VF7 A;  1RCV D;  2F1M A;  1CHQ D;  2ZT9 C;  3M4O B;  1VQD A;  2ZXP A;  4XQQ A;  1KL9 A;  4EGV A;  1JE4 A;  3K0Y A;  1Z47 A;  1HA6 A;  2NUC A;  2K4K A;  4JBM A;  1BBX C;  1EFW A;  5IYB G;  1R9T B;  5C4H A;  5KGU A;  3G4S A;  1QJO A;  1B9N A;  2PPB C;  1V1P A;  5FK9 C;  1PH5 A;  2PO4 A;  3DWP A;  3P20 A;  1V8Q A;  4DR6 L;  4S3S A;  4JI5 Q;  1G6Z A;  1QCB D;  4KKS A;  1KHI A;  3HG9 A;  1BCP F;  2HHH L;  3D0F A;  2B2Y C;  3I70 A;  5I6W A;  2DNC A;  4OO1 G;  4H0L C;  4L5T A;  1GUT A;  3QOJ A;  2JA6 H;  1JB7 A;  3DEP A;  2VQE Q;  2DY8 A;  3S2H B;  1C48 A;  3L9A X;  1I94 Q;  1V9P A;  1KD1 C;  1KLG D;  2JA8 H;  2B2U C;  1QOH A;  5IWA L;  1BOS A;  2KOL A;  2XN9 C;  1A3U A;  4RMF A;  1VQF A;  1TU2 B;  1TS2 A;  4YHH Q;  1FNV A;  1AN8 A;  1E0B A;  4CJ2 C;  5IGB A;  3M4Y A;  2E75 C;  4IFD I;  2DJF C;  3J7A V;  1E2W A;  2BH2 A;  2K75 A;  2K14 A;  1EOT A;  5EPK A;  5IOD A;  2VXW A;  1BVS A;  5I4D A;  2D2C C;  1AW7 A;  4G57 A;  4HID A;  3HOV B;  1D5X C;  5HGQ A;  4LW1 A;  4JV5 Q;  5C3E B;  1S5F D;  1GUS A;  1SNM A;  3LGJ A;  5LMN Q;  4GKK Q;  1M4V A;  2L5T A;  4KD3 A;  4K8J A;  1XTC D;  2EZV A;  4A3I B;  1BXT A;  1XMQ Q;  1SYC A;  1I94 L;  5I9P A;  3OHX C;  5CR3 A;  4RHS A;  4KN7 C;  1YHA A;  2B63 H;  2EYP A;  3I8Z A;  1T5E A;  5JJZ A;  1N36 Q;  1DON A;  1UE5 A;  5M5W B;  2XWB B;  4AYB G;  4J8Q A;  4QGU A;  3S1Q H;  4LF7 Q;  4OEM B;  5IGC A;  2ZJR A;  4LF5 L;  1A3T A;  4JI7 L;  1V43 A;  1B2T A;  2UXB L;  3GTM B;  4DV3 L;  2EE1 A;  3BDL A;  5C3E G;  5LMN W;  2Q2I A;  1XMO Q;  4FF1 A;  4R1J A;  2PZT A;  1HNW Q;  3GO5 A;  2LXK A;  1JOO A;  4K5W A;  3MAQ A;  1WD0 A;  5JJK A;  3I91 A;  2RSO A;  3DEO A;  1SJH D;  2ICI A;  3TZU A;  5BN5 A;  2O5I C;  4Q5V A;  1WTR A;  4POG A;  1IBL L;  3A7A B;  4P73 A;  5C44 H;  1KAB A;  2B63 G;  3B6Y A;  1H9S A;  3GTO B;  1XMQ L;  5BR8 Q;  4R8I A;  4A3F G;  4CDE C;  1F2M A;  2UXD Q;  1O7I A;  5CYU A;  4LF5 Q;  3E5S A;  4X65 Q;  1LTT D;  3KLS X;  2Q2H A;  3MZ5 A;  1KXL A;  2WB1 E;  4PZ6 A;  4XIG S;  1Q1B A;  3EQL C;  1TXY A;  3PSI A;  2H5X A;  1J8I A;  3KLR A;  1O7Y A;  3H3V C;  3MEH A;  5IIF A;  3T56 B;  3VDY A;  1D1I A;  2R92 G;  2F0L A;  5JAV A;  3G6J B;  3HOU B;  1NJI C;  1UAP A;  2JK8 A;  2R61 A;  5EBC A;  1GO3 E;  3U50 C;  4PZ8 A;  2CQA A;  4NW2 A;  3HOW H;  1PFB A;  1F9R A;  3ICE A;  4AIM A;  2M00 A;  2PW7 A;  1F2Y A;  4IJH A;  3VYU A;  5BR8 L;  4C3H H;  3I56 A;  3NTK A;  2MQH A;  5CV7 A;  3GQB A;  2P5Z X;  1VQC A;  3BVZ A;  3LWE A;  4DUZ Q;  1J9O A;  5ISR A;  1PLF A;  1GXD C;  2CVR A;  5EPL A;  5C0X G;  4HJ7 A;  2JA6 G;  1SE8 A;  5J3B A;  3AB9 A;  1I6V C;  3OWE B;  4B3R L;  3MWY W;  3RUZ A;  1TWC H;  1Z7T A;  3U9S A;  1SYG A;  2NTT A;  1Q86 C;  3NWT A;  2ZTC A;  3FMC A;  1ZEQ X;  2R93 B;  4A3L G;  2QDL A;  3GTG H;  3NQT A;  1Y1W H;  1U0L A;  3GD7 A;  4GNX B;  3I3C A;  3PUY A;  3C46 A;  3D4D A;  2BA0 A;  5LMU Q;  1G91 A;  2IW3 A;  4LFB Q;  3KUP A;  1SMY D;  2JA5 H;  1EZ8 A;  3AFQ A;  1ILQ A;  1V1Q A;  3D3R A;  1FVI A;  4KHP Q;  1L0X B;  3CKI B;  5T1I A;  4L5S A;  4DV4 L;  3S1Q B;  2QCP X;  2FIN B;  3L0O A;  2KVM A;  1BQQ T;  5ELB A;  3AFP A;  2Y0S E;  4DUZ L;  4KN4 C;  2A69 C;  2B63 B;  1SNC A;  1QB5 D;  1LT6 D;  4ZCK A;  1F9P A;  2K5N A;  2R92 B;  1L0W A;  4GOP B;  1H9J A;  1I6H B;  4PMC A;  5JOB A;  2F3V A;  3NPP A;  1SYB A;  2OTJ A;  2I5L X;  3GTQ B;  2HD3 A;  2F0T A;  2QF7 A;  4K2L A;  1L1O B;  2G5D A;  1O7L A;  3CCM A;  1RF2 D;  3F2U A;  2E2D C;  3FPP A;  1ASZ A;  4FVM A;  1PH6 A;  3K0X A;  3BVG A;  2PQA B;  4LF4 L;  1HZ9 A;  3NBI A;  3A55 A;  1LTB D;  2I5M X;  1CSP A;  2BDO A;  1EY6 A;  4RKL A;  4C3H G;  2WV6 D;  4C2M B;  4PG3 A;  1XTD A;  2NZO A;  1WYD A;  4NXM Q;  3HOU H;  3DM1 A;  4YCW A;  3NP8 A;  3UE0 A;  4TKO B;  2VB2 X;  1WTV A;  2ZTD A;  1STH A;  1YHQ A;  1BO0 A;  2HIX A;  1QZH A;  3GV6 A;  4J1M A;  3UDG A;  2NBF A;  3OIQ A;  3GV3 A;  2NVX B;  1TVX A;  4HCE A;  2NB0 A;  1BBU A;  3V2T A;  2K1B A;  1P16 A;  4ZK9 B;  4HIM A;  4C3J B;  1ASY A;  5EKK A;  1K83 B;  1G8Z D;  2EYF A;  3OYY A;  1LV9 A;  4LF4 Q;  5J1Z A;  3AYH B;  2I0Q A;  1O7Z A;  3GP7 A;  1M8A A;  3HKZ G;  2NVT H;  4K6L A;  4A3K B;  1KRS A;  1EWH A;  2D62 A;  4XQN A;  5AFW A;  3CCQ A;  2E2I H;  2UXC L;  3S24 A;  1YJW A;  1J5E Q;  2CKZ B;  3A8K E;  2FHT A;  3I90 A;  1CM9 A;  4HN7 A;  3UDF A;  3E3X A;  1CFM A;  3LX0 A;  1HJP A;  4A3M H;  2RQX A;  1L2F A;  5JVG 3;  4B9W A;  3MEF A;  2K5Q A;  4QUF A;  5FLM G;  4DXF A;  5E1F A;  5HY6 A;  4DV3 Q;  1AH9 A;  1K8O A;  4HJA A;  3HEJ A;  4ZKC B;  3ULL A;  1YZ6 A;  3KOJ A;  1VS0 A;  5E4X A;  1WD1 A;  2KCN A;  1FGU A;  1KRT A;  2IX1 A;  3OTO Q;  4A3D H;  4HCS A;  2B2Y A;  3A54 A;  1WCM H;  4K14 A;  1XYI A;  4LUZ A;  2TMP A;  3CF5 A;  1WJJ A;  2K5D A;  2E2J H;  3G7L A;  2JYO A;  4MTK A;  5CV4 A;  5FO9 B;  3N52 A;  1IBL Q;  1RDP D;  5M3F B;  2AHO B;  3NTH A;  1PRT C;  3HOX G;  2VY3 A;  4ZKB B;  3Q0A A;  2L1B A;  1EY0 A;  2OQK A;  2F0N A;  4IOA A;  3BZD B;  1D6E C;  1U5K A;  2IJ0 A;  4DV1 Q;  4DV2 L;  4LFB L;  2A6H C;  4KY6 A;  1Q12 A;  3PO2 H;  1QNK A;  1VQG A;  1EU4 A;  2Z8L A;  5I6Y A;  1I4R A;  3S1M B;  3I4M B;  2F0V A;  3HOZ H;  2RKS A;  3IL8 A;  2XVS A;  3JC6 6;  1HFG A;  1R9T H;  4FO2 A;  2QEJ C;  5IWA Q;  2NN6 I;  1WFQ A;  4DV6 L;  1CI3 M;  2IL8 A;  3GTL H;  1QZG A;  4DV1 L;  1TWA H;  1XNQ Q;  4JI2 Q;  4JPB W;  1MSH A;  1HXY D;  5GAG C;  3BYT B;  4BS9 A;  3TQY A;  1MKH A;  1H9K A;  1ONL A;  4JI0 Q;  4B3R Q;  2KEC A;  2N88 A;  4C1N I;  4C2M H;  2LKV A;  1O80 A;  2PCF B;  1IHZ A;  4LNQ A;  2LMC B;  3GTP B;  4FF4 A;  2EXZ A;  4RGO S;  4QQB X;  1KNA A;  5C0X J;  1PA6 A;  1WTO A;  3KDF B;  4HIK A;  1S4Z A;  4LFA Q;  2A1A A;  3M4Q A;  1VQO A;  2JA6 B;  1HR0 W;  4B3T L;  3H09 A;  3FDT A;  3J81 j;  1IBK Q;  2YU9 B;  1B53 A;  3H3V H;  1VQ4 A;  1STB A;  1YHB A;  2WKD A;  4QF4 A;  4KLK A;  4GOP C;  5BN3 A;  1FYC A;  1NY4 A;  1TS3 A;  3GTG B;  1VQK A;  4NKL A;  4DV7 L;  2DNE A;  3LNN A;  2VQF L;  3T1H L;  2AUJ D;  4YWL A;  2BDN A;  3T1Y Q;  2WAQ B;  2ZM6 Q;  2NN6 H;  2GN5 A;  4P74 A;  1GM5 A;  1MHW C;  2Z9H A;  1SE4 A;  3U4Z A;  5DAU A;  1LTG D;  4X3K A;  5IOC A;  2UUA Q;  1STE A;  1II3 A;  1WI5 A;  4KHV A;  4YWK A;  4DF7 A;  5KYL A;  4KV6 A;  4B3M Q;  2XIW A;  5EAY A;  1IBM L;  1KAA A;  1JOK A;  2E76 C;  1DGS A;  1CKN B;  3I4L A;  4P72 A;  3TDQ A;  3WOE A;  5E3F A;  1Q82 C;  1Y8P B;  3PO2 G;  1E2Z A;  1LTS D;  2K7V A;  4A3D B;  1ESR A;  2NVY B;  4OWW B;  4V19 0;  4DKA C;  5IYB H;  1CTM A;  3L7Z C;  3QR8 A;  2C5C A;  1G29 1;  4NXN Q;  1CK1 A;  4M1U B;  2L9H A;  4TVA B;  4ZUJ A;  2RDH A;  4GLX A;  2EOT A;  3GTQ H;  4DR7 L;  1WCM G;  1SBB B;  4DV0 Q;  2YV5 A;  1VQ5 A;  1NR4 A;  3CQZ H;  3MXU A;  4LF8 Q;  2AQ2 B;  4DXG A;  1LTI D;  4WJW A;  5EKI A;  5DNF A;  1SYD A;  1MD2 D;  2LFN A;  3RLF A;  5JJI A;  1IL8 A;  2JQO A;  4O0A A;  4B3M L;  3F2C A;  2EDG A;  3HZX A;  3I4M H;  1YNJ D;  4X66 L;  2F0I A;  5GAE C;  3Q6S A;  1SNQ A;  2NN6 G;  3EFX D;  2WAC A;  3SXH A;  1HUM A;  1NR2 A;  3FHW A;  1SDF A;  1E24 A;  1K28 A;  2R7D A;  3IFT A;  1MIU A;  5IP7 H;  5M5Y H;  1EQV A;  1X65 A;  3NK9 A;  3K58 A;  4A3I G;  4RGN A;  2N8N A;  5IGE A;  2F0O A;  1MJC A;  3CHB D;  5M3M G;  1EIH A;  3GTL B;  1XWE A;  4K0K Q;  1ZKO A;  1EUJ A;  1I4P A;  1CZW A;  1X32 A;  2AMC B;  3L2P A;  3VA7 A;  1A3V A;  4R8N A;  2ZJQ A;  1Y8N B;  2BE5 D;  4IPC A;  5GAD C;  4BA2 I;  4IUV A;  1X6O A;  4DPG A;  4JYA L;  4QCL A;  4JI4 Q;  4R9W A;  2OXP A;  3R93 A;  3C2P A;  2F0F A;  3H0G G;  4BWG B;  4ZQ3 A;  4JI0 L;  4A3F B;  2YYZ A;  3FKI H;  3MTS A;  3CC4 A;  3ND8 A;  2R93 H;  3QIA A;  4HJ9 A;  4A3L H;  2B8G A;  2EY6 A;  1Q7Y C;  4OHJ A;  3HFZ B;  1Q81 C;  3AQQ A;  5FLX E;  1B50 A;  1DOM A;  4X6A H;  2F0P A;  3DUZ A;  4KY7 A;  1B9M A;  3NEN A;  3S1R B;  2GA4 B;  4CDD C;  1LM0 A;  2X6G A;  1IW7 C;  3W2D A;  1W2B A;  1NE3 A;  2I07 B;  1I5F A;  3KF6 A;  4A3M G;  5IGD A;  3TP7 A;  1JOR A;  1O78 A;  1Y1W B;  2ENB A;  4L5Q A;  2E5L Q;  2EYH A;  1QUQ B;  1KDA A;  1HHV A;  2L4N A;  1KC8 C;  1ENF A;  1Q3L A;  4BY7 H;  3MXP A;  4CKC A;  4BBS G;  1OO9 B;  2NZ1 D;  2IT1 A;  2KA7 A;  3MFG A;  1JC7 A;  3TS2 A;  2R92 H;  4JV5 L;  3F2D A;  4CBV A;  1ZYR C;  4F88 A;  1WVL A;  2ALY B;  4JBW A;  5FKA C;  3ONA B;  2MHV A;  3HS0 C;  3P7J A;  1NBW A;  1PYS B;  2LY7 A;  4WFN 3;  1OXT A;  3KFU A;  4JI2 L;  3S1N H;  3STB C;  4A3E G;  2NVQ H;  3VR2 A;  1PRT D;  1PRT F;  4K5X A;  2F0W A;  3KYH C;  3D4R A;  1VQ9 A;  1F9S A;  2JP1 A;  1S3O A;  1KNE A;  2BCO A;  4MHE A;  3ERS X;  2WII B;  2JA7 B;  1ICW A;  3HOY H;  1ROD A;  1B7Y B;  2ATW A;  2RVL A;  1SFO B;  4FNF A;  1J6Q A;  1PHJ A;  1TWH B;  1BBW A;  4OL7 A;  4JI8 Q;  2BOS A;  3BS1 A;  1CA6 A;  1RHP A;  3K59 A;  1IYU A;  4Y52 H;  1Q46 A;  3PUX A;  4IJL A;  3RN5 A;  4LFA L;  4DK3 C;  4DR5 Q;  1N9W A;  1TWA B;  1NNX A;  4DFA A;  2Y0S B;  3PQI A;  3JAM E;  4A3G G;  3G6E A;  2VB3 X;  3HKZ E;  4JBJ A;  4A3G H;  1GUO A;  2F0S A;  4DN4 M;  4IAL A;  4BY7 G;  2XTI A;  2MFI A;  3FRP B;  1LLR D;  4GN3 B;  4UP9 A;  3BZC A;  3AEV A;  2B29 A;  4IUP A;  2CFM A;  3PO3 H;  4LWC A;  3SGI A;  1QVG A;  2VUM B;  1F2L A;  3R2T A;  4X65 L;  3HOW B;  1XPO A;  3K5O A;  2VQF Q;  5IP7 G;  3KJP A;  1K9M C;  3DLL A;  5CMD A;  1UNS A;  4ZYS A;  4NPS A;  4N9T A;  1I3Q H;  2CHB D;  5M5X H;  3IFD A;  1W3S A;  2E2H B;  2NVT B;  1W6J A;  4OGQ C;  1EY9 A;  3NQI A;  5M9O A;  2N55 A;  2XWJ B;  4GLV B;  3VR6 A;  1PTO H;  1H95 A;  1Q8K A;  2A68 D;  4JI1 L;  3DHQ A;  4A3E B;  2A69 D;  4C3J H;  5FJ8 G;  3J80 L;  1YNN C;  4QJF A;  1YNX A;  5ELF A;  2Q8I B;  3HOU G;  1RD9 D;  2LSS A;  4RFB A;  3K8A A;  3ZJY C;  2HQL A;  2HHH Q;  2XGT A;  4IUQ A;  2F4V Q;  4B08 A;  1TKW B;  5J22 A;  4BBS H;  4FF3 A;  4DV2 Q;  1AE2 A;  4WJ4 A;  1VQP A;  3M85 A;  3OW7 A;  3E0J A;  1ET9 A;  3D4W A;  4FXK C;  4R4O A;  3JAM L;  4XTC S;  5NUC A;  3KBX A;  2L15 A;  4L5R C;  3CRL C;  1K3B C;  4HSP A;  4YY3 L;  3A8J E;  1PZI D;  2AWO A;  2FFK B;  5CC4 A;  1HZB A;  2KHI A;  1PMR A;  4POF A;  4ZLT F;  2VW9 A;  5JPN C;  3I2Z A;  4A3I H;  1F9Q A;  2NVY H;  4NMZ A;  5KNC A;  1N33 Q;  5CBE E;  1D5M C;  5C4J H;  2RA4 A;  3TP5 A;  1TR5 A;  4I7Z C;  5I2Y A;  4ULL A;  1MBY A;  4Y7N H;  4I65 A;  3C1F A;  4UAI A;  3CCU A;  2F0K A;  1HQR D;  2EJF C;  2ES2 A;  3C1E A;  2XRQ D;  2Z6K C;  4XT3 B;  1IKM A;  4PQX A;  3S1M H;  1I4H A;  1EQT A;  2KUM A;  4LFC L;  4A4I A;  1SYF A;  3BG3 A;  3R3O A;  3PIO A;  3T53 B;  4IUN A;  1LAB A;  5JPM C;  1FJG L;  3S1N B;  3MVV A;  4UP7 A;  3CCE A;  2K50 A;  2B2T C;  3L3O C;  3S15 H;  4YY3 Q;  4EQN A;  5CV5 A;  5IYC H;  3FP9 A;  1AP0 A;  4KKT A;  1H9S B;  1HZC A;  1N36 L;  4JI4 L;  4K2K A;  2YTY A;  3MA2 B;  1BDO A;  3RNU A;  3PIP 3;  2MO0 A;  3EA6 A;  3H3V I;  1UE7 A;  2PI2 E;  2UU9 Q;  3MFY A;  1Y69 U;  5I9O A;  3A7L A;  5JVH 3;  4WOR A;  1PXU A;  1D2B A;  1OXV A;  1JOQ A;  5FO7 B;  2B2V A;  1Y14 B;  2KHS A;  2KCM A;  4EX5 A;  4HED A;  3GDE A;  1RL2 A;  5A35 A;  2MP1 A;  5LL6 X;  1IYV A;  2G9D A;  1K0R A;  2E74 C;  4U67 3;  1PH1 A;  2MGS A;  3DXJ C;  2ZM6 L;  3DWA A;  1X55 A;  2CW0 D;  1CHP D;  1FL0 A;  1QWY A;  4H7B A;  3T16 A;  3D6C A;  3CXC A;  2QDB A;  1PTO F;  5E7N A;  1V1P B;  1X3Q A;  2N78 A;  1IKL A;  4NXM L;  4UDU C;  2N49 A;  4XQJ A;  4CJ0 B;  3G71 A;  2L11 A;  2SNS A;  1CKO A;  1UEB A;  3PO3 G;  2F0M A;  3ER0 A;  1PH8 A;  3K6O A;  1K8A C;  2E2I B;  3SR1 A;  4RHR A;  2SEB D;  3PIO 3;  4UY8 C;  2EY1 A;  4G7O C;  5K36 G;  5CV9 A;  5AJ3 L;  5IYC G;  3NBH B;  4IOC A;  2YU9 H;  2L55 A;  3KLS A;  5G3L F;  4YCV A;  4DK1 A;  4LK1 C;  3NBH A;  4WRD A;  1HNZ Q;  4F8M A;  4DV5 Q;  1Q90 A;  3G48 A;  1PFM A;  3CU7 A;  4BXX H;  2AQ1 B;  1KIX A;  3J81 E;  1EU3 A;  4QB4 A;  1EYD A;  2PNR C;  1N32 L;  3OIP A;  4LF9 L;  4K8I A;  4DK6 C;  3S14 H;  1D7Q A;  4DR1 L;  1QE6 A;  1J5E L;  4AYB B;  4BY7 B;  4QL5 A;  3A5U A;  2EQS A;  4BA1 I;  4G7Z C;  2E2J B;  2B39 A;  1MGS A;  3VR3 A;  2B2U A;  3PUZ A;  3J7Y W;  3TME A;  2B2W C;  2OF1 A;  2EYJ A;  1RTO A;  5COR A;  1WTW A;  4IUU A;  3D31 A;  4DGZ A;  1EYG A;  5D3D A;  4DAM A;  2JA8 G;  3N6R A;  5FLM H;  4DV5 L;  4FP5 D;  3CCJ A;  2OTL A;  3RZO B;  1E1T A;  2F0J A;  3PO2 B;  2NVQ B;  1OXU A;  1UE6 A;  3NTI A;  1Z6H A;  2LXJ A;  3JAM c;  3KF8 A;  1VQE A;  3M9B A;  2EVB A;  1K73 C;  2ZXO A;  1VF5 C;  1TWF B;  1I6H H;  5C44 B;  3PV0 A;  1BNZ A;  3HOZ B;  2CCZ A;  2AWN A;  1X3P A;  2WKC A;  4QMG A;  3VA5 A;  1EY5 A;  2UUC L;  4KK7 A;  1PTO C;  1TS5 A;  2K05 A;  1EQR A;  1N32 Q;  1U4M A;  1B3A A;  2DJG C;  4BY1 B;  1N34 Q;  1TY0 A;  3Q22 A;  3I72 A;  2HUG A;  1F77 A;  1LTL A;  1SNP A;  5M5Y B;  1FD7 D;  4XYQ A;  4ALP A;  1AZQ A;  3H6M A;  1FGB D;  1VQA A;  2IHF A;  4Q0F A;  2UXB Q;  3ITP A;  2O5J C;  4BBR H;  2EJM A;  2CQO A;  4NXN L;  2BE5 C;  1EYA A;  2RF4 A;  2SDF A;  4TRD A;  5EPJ A;  2UXC Q;  4BBR G;  4OO1 I;  1EIF A;  2PNH A;  1S5C D;  4TQU S;  4WJ3 M;  2QA4 A;  1YEZ A;  2HDM A;  5ELN A;  2NTS A;  4A3B H;  2D0O A;  1CQF A;  2PYK A;  2VUM G;  1EL0 A;  3SK5 A;  5GQO A;  1QNU A;  3FKI B;  4DV7 Q;  1L1O C;  3EVQ A;  5JEA J;  1QUQ A;  2UU9 L;  1C0A A;  1IXR A;  2F4V L;  1FR3 A;  2MJ8 A;  3CCR A;  2R7Z G;  1BCP C;  2J0T D;  4HIO A;  1EEF D;  2K32 A;  3EBE A;  3IKJ A;  4Z9C B;  4C3I G;  2QEX A;  4KJO A;  2A8V A;  1H9M A;  2R93 G;  1K83 H;  4N8F A;  1HRJ A;  1JJC B;  1MJE A;  5CGK A;  4K5V A;  1DJR D;  4IPH A;  3RZD H;  1YIT A;  2EPB A;  3OPO A;  4HTH A;  3S14 B;  3E0E A;  2R7Z B;  3D6W A;  1XXG A;  5KYI A;  4EQP A;  2I46 A;  4JI7 Q;  2YTV A;  4R4C A;  4JW0 A;  3KDF A;  1S5E D;  3H0G H;  3W1B A;  2B8F A;  2VZA A;  1SXT A;  5J39 A;  5D65 A;  3T1H Q;  1TII D;  1D8L A;  3UDI A;  5IT9 L;  4X64 L;  1LAC A;  1VQM A;  4LF8 L;  4L63 B;  4KKU A;  4PV1 C;  4KI0 A;  1E2V A;  4DV6 Q;  1FNW A;  1W6K A;  4PNY A;  5IYD G;  5M3F G;  1HA5 A;  4APV A;  1SMY C;  1CA5 A;  5M5W H;  4DAY B;  4O1N A;  2E5L L;  4DR1 Q;  4P2C B;  2A6E C;  1LO5 D;  3I4O A;  2WFW A;  3SE0 A;  1CKM A;  4DAY A;  1VCI A;  3J7A F;  2O2L D;  3ND9 A;  3ULJ A;  3DMU A;  4MTN A;  2CW0 C;  4BY1 H;  1PFS A;  1PH4 A;  3M4O H;  5C0X H;  4AQY L;  1R4Q B;  5FO8 B;  3MC0 B;  4KHP L;  1A15 A;  3CCS A;  2AKW B;  5COY A;  4A93 G;  1U4L A;  3KF6 B;  1BKB A;  2HDL A;  1EIG A;  3V05 A;  3M4P A;  4LF6 Q;  3PF5 A;  1T9H A;  2AQ3 B;  4ME3 A;  3TEH B;  4X3T A;  2BH8 A;  4MN3 A;  1TWG B;  5EJW A;  4B3T Q;  1GJX A;  1VQB A;  4QIW E;  4H02 A;  1SFO H;  4X64 Q;  3I4N H;  3CRK C;  3TRZ A;  1EFI D;  3RMH A;  1KTK A;  4A3K G;  2SNM A;  1B44 D;  1CT1 D;  2FXQ A;  4KMU C;  2KJX A;  3ERO A;  3PO3 B;  4R4T A;  3I7F A;  1NMF A;  2IY5 B;  4GKJ L;  2KCC A;  2JN4 A;  2PZU A;  1K0S A;  1NTG A;  1PVO A;  1A2U A;  1PYW D;  4HSV A;  1XPU A;  1RIP A;  1M1K C;  3F1Z A;  2NVX H;  4MZ9 A;  4DR2 Q;  3HKZ B;  1BCP D;  1I50 B;  4N9P A;  1X3E A;  1SNO A;  4F7X A;  4X62 Q;  4BXX G;  2J4X A;  4DR5 L;  2NYZ D;  3A5Z B;  1PTO B;  2CH4 W;  3J80 c;  1JJ2 A;  3ERQ A;  4G4K A;  4KD4 A;  4A3B B;  1PZK D;  1D5Z C;  3BYY B;  4A3F H;  1UEA B;  4LF9 Q;  1HFN A;  1OTC A;  2PMZ E;  1S5B D;  4A3K H;  3HP3 A;  1LT3 D;  3HGB A;  4RH6 A;  2F3I A;  1PZJ D;  4C3H B;  4EQ5 A;  1SSO A;  2IX0 A;  1E7Z A;  1WOC A;  1P8L A;  3E9H A;  1LTR D;  3HOV H;  4CGY B;  1SMX A;  2O4X A;  1JE5 A;  2F0D A;  1N8R C;  4GN4 B;  1YBY A;  2PI2 A;  1VQJ A;  2C35 B;  5C3E H;  2OCE A;  1VQ6 A;  1HR0 L;  2MNA A;  1TS4 A;  2AUK A;  3HOW G;  1XJV A;  5C4X B;  3NWS A;  3H0G B;  2B3G A;  4QIW B;  1C9O A;  1E22 A;  4RGM A;  5IP9 H;  1DXM A;  3GTK B;  1EYC A;  1LT5 D;  4JK1 C;  2UUB L;  1SN8 A;  4IFD H;  2F0U A;  4J6H A;  2JSO A;  2Z1C A;  1Q8I A;  2HCI A;  3Q24 A;  4QY7 A;  2F0Q A;  2PZW A;  4H44 C;  1B3Q A;  1A63 A;  4YHH L;  1WTQ A;  3U4V A;  1LTA D;  3DWQ A;  1X9N A;  4KTA A;  4X3S A;  3RZO H;  3URY A;  1S5D D;  1GUG A;  1L1O A;  4EVO A;  1HNX L;  1JWU D;  3HOX H;  3BU2 A;  4CHT B;  2QKI C;  5ELD A;  2K6A A;  1YVC A;  4K0K L;  1WTX A;  1GUW A;  1VDZ A;  1HR0 Q;  2UUB Q;  2RDF A;  4DR4 Q;  5FOB B;  1AEX A;  1MI2 A;  4DNR B;  1B4O A;  5LHY 1;  5TSS A;  3PCO B;  1TWG H;  3E9I A;  3S16 B;  4JYA Q;  3CW2 C;  2X6L A;  4K6D A;  4P75 A;  4RG1 A;  5IT9 c;  2R3Z A;  1LT4 D;  1STG A;  2K28 A;  4LUO A;  3BJU A;  2OQ0 A;  1XNR L;  3A56 A;  2H1E A;  5KRU A;  3KF8 B;  2R6G A;  4A3J G;  4U68 A;  3CC2 A;  4LFC Q;  1D1K A;  4B9X A;  1UE1 A;  1PV4 A;  5KNB A;  1SND A;  4DNT B;  1GKH A;  3I4N B;  2MUY A;  1IL2 A;  1JJG A;  4A3D G;  3J80 i;  1HQM C;  2RDG A;  3CPF A;  3KK7 A;  4FDB A;  4UHV A;  3SK6 A;  3S9W A;  4GNX C;  1E3P A;  1HNW L;  1CQV A;  3A74 A;  4IO9 A;  2JXM B;  3SK4 A;  4RKB A;  5C0X I;  3J81 L;  2V1C C;  3STB D;  2UXD L;  1XNR Q;  3K57 A;  2ZXR A;  5K5P A;  4ZRZ A;  4LAA A;  2JA5 G;  3UDX A;  3K7U C;  4GNX A;  1ML0 D;  4PZ7 A;  4A3E H;  1EZ6 A;  2WAQ G;  3H15 A;  4DAP A;  2M9V A;  3PUW A;  1FNU A;  2MPM A;  2B2W A;  2K52 A;  2A6E D;  3A0J A;  4M8A A;  4N8X 1;  2Y0S G;  4C3J G;  1BUV T;  2D9U A;  3MXN A;  5C4X H;  2A19 A;  4HMI A;  5C4X G;  2ZJP A;  1VQ8 A;  3SHL A;  3HOZ G;  1RJT A;  1CUK A;  2ID0 A;  1YIJ A;  1E1O A;  1CKN A;  2HQE A;  3W5O A;  2DY7 A;  1CZG A;  3VYS A;  3TS0 A;  3S1R H;  1RTN A;  2EYO A;  1GD7 A;  3CAM A;  3M3Y H;  3SVM A;  3K5M A;  2VNU D;  3E6Z X;  5C4Z A;  1S72 A;  4LF7 L;  2Z4H A;  3D8G A;  2KHJ A;  3S2D H;  3UE1 A;  1G2T A;  3TP6 A;  1YNJ C;  5DM7 3;  2J7Z A;  4CDC C;  1SE2 A;  5GAH C;  1SJE D;  2JJQ A;  1YI2 A;  1GVP A;  3F8T A;  1SYE A;  1JWM D;  1CSQ A;  1ZXT A;  1Y1V B;  1PH3 A;  3HOX B;  5IYD H;  1RKN A;  1DM0 B;  3ZYY X;  1JR0 D;  1JIC A;  1EY8 A;  3EJI A;  5LL6 S;  1KDB A;  3T1Y L;  2A68 C;  2WAQ E;  3J7Z C;  5LMN L;  4GKK L;  4H13 C;  2XNA C;  3SDZ A;  1YNN D;  5F2D A;  3OMC A;  3CQZ B;  2RSN A;  4OWX B;  4IZ8 A;  4IQZ A;  3S16 H;  3U9O A;  3K80 C;  5IE8 A;  1GHK A;  1OXX K;  5C5M A;  2A74 C;  5JEA H;  4DV4 Q;  4P71 A;  4C56 C;  2RCF A;  3EN2 A;  1ESF A;  3H94 A;  2JA7 G;  3TN2 A;  1L0Y B;  3GTJ H;  2HIV A;  1M90 C;  2BA1 A;  4OO1 H;  4GZY C;  1C7Y A;  1HNX Q;  2JA7 H;  2DN8 A;  5M3M B;  2YTX A;  3T51 B;  3VYT A;  3CP0 A;  1SAP A;  4JOI C;  4UP8 A;  1AZP A;  2D0P A;  3J81 i;  1TWH H;  3C3L A;  4JI6 L;  3M7N A;  2IWH A;  4JI1 Q;  2Q8T A;  1A2T A;  3S17 H;  1QG7 A;  4RWS C;  4V0B A;  5IY0 A;  5DLQ E;  2RBM A;  4YCU A;  4DR3 L;  4A3C H;  2UUC Q;  1IW7 D;  3I55 A;  1JQY D;  3VR4 A;  1IBK L;  5EGT A;  4OX9 Q;  1QVC A;  3MXG A;  2EXD A;  1I50 H;  2NZH A;  2X69 A;  4A93 B;  1Z9F A;  1I4Q A;  3FPU B;  4MIU A;  5L37 A;  4PMW A;  1EIY B;  2IPK D;  4B3S Q;  4AYB E;  2F4I A;  4XXE A;  2A5H A;  5C3X A;  1BR9 A;  1EWC A;  4DNI A;  1YJN A;  4HAE A;  3QG1 A;  5D3I B;  4ABN A;  5IGF A;  1Y1W G;  2K33 A;  1PH7 A;  3KBG A;  3QO2 A;  1EY7 A;  2EYL A;  5DM6 3;  4NDX A;  5IP9 G;  1ZYR D;  1I3Q B;  4JCV E;  5M5X B;  3P75 A;  4ID6 A;  3CC7 A;  4DUY L;  3AMU A;  4KHZ A;  4CKB A;  4DR3 Q;  4LJZ C;  4YWM A;  4AH6 A;  1C8C A;  4RCN A;  2WIN B;  3QJY A;  1XPR A;  1DZ1 A;  3QWN A;  3TRE A;  5ELO A;  1GUN A;  1SRO A;  3RR5 A;  3OSO A;  2A73 B;  1AFP A;  2PQE A;  3JAM i;  3LWU A;  1KQS A;  3V96 A;  4RCO A;  1DCZ A;  1VQH A;  2N3S A;  2EIF A;  3NE5 B;  5GRO A;  3HKS A;  3M7G A;  4JBK A;  2Z0S A;  1VMC A;  4HJ8 A;  1JB3 A;  3R8B A;  2KCT A;  5HGT A;  4UPA A;  1VQI A;  5AJ3 Q;  2SOB A;  1K8G A;  1WCM B;  1G6P A;  3K5N A;  1KAW A;  1K3R A;  4O42 A;  3NEM A;  1JMC A;  4XYO A;  3O13 A;  5H1S E;  5CV8 A;  5KND A;  4DR7 Q;  3S2D B;  3CMA A;  3RD4 A;  1UWV A;  2F3W A;  2HT1 A;  5T1G A;  4OXP A;  3W1G A;  3OWF A;  1DD2 A;  4C3I B;  1TY2 A;  2L12 A;  2G9H D;  5I2X A;  1I4G A;  3PGZ A;  4DK0 A;  1U9R A;  1Y1V H;  1XX8 A;  3BDO A;  4XT1 B;  2WP8 J;  3FKI G;  2OWO A;  4A76 A;  2Z6B A;  1LUZ A;  1B1Z A;  2GVA A;  3SEB A;  1B8A A;  3GTJ B;  3I4N G;  3NXW A;  4RAU C;  3OTO L;  2C9O A;  4IPG A;  2GVB A;  3WDN A;  3GTO H;  1X56 A;  5M3M H;  3BZK A;  5IT9 E;  1STA A;  5A2Q L;  2K5V A;  1B70 B;  2KED A;  3K81 C;  4CDF C;  3T13 A;  1WTP A;  1A0I A;  2Z4I A;  2CH4 A;  1EEI D;  3HRZ C;  4A3G B;  3PF4 A;  5E4W C;  3QOL A;  5CV6 A;  4IN3 A;  4GN5 A;  2MO1 A;  4IFD G;  1G2S A;  2QGQ A;  5C6A A;  1WTH A;  4AQY Q;  1PDQ A;  1BCP B;  2Q2T A;  1N34 L;  2JA9 A;  3ULP A;  4C1N K;  4I7A A;  1XMO L;  2R7F A;  4L6T B;  1S40 A;  5EQ0 A;  2JEA I;  2VS1 A;  1JWS D;  2ICE C;  5ELC A;  2PW5 A;  3X3M A;  2K5W A;  3I4M G;  3A8I E;  3UI2 A;  1R4P B;  2RHS B;  4JI8 L;  1ILP A;  4HMJ A;  3HOV G;  4NP5 A;  3P1H A;  2DGY A;  2WB1 G;  1HNZ L;  1KLU D;  1NAP A;  4KJN A;  2UUA L;  1SR3 A;  1NMG A;  1A8V A;  1SE3 A;  4GLA C;  5C3W A;  2KBN A;  1MSG A;  1VMP A;  2JA8 B;  1U4P A;  1HUN A;  1IBM Q;  1ET6 A;  1AE3 A;  2B2T A;  3OOC A;  5LMU L;  1BF4 A;  1DYQ A;  1PFN A;  3BDC A;  4DR2 L;  2EYM A;  3KLW A;  4DA2 A;  3U58 A;  5FJ8 H;  3QB3 A;  4DR6 Q;  4BBS B;  4LUV A;  2JEB I;  4FF2 A;  4GKJ Q;  2PMZ B;  3RN2 A;  2QW7 A;  3HOY G;  5C44 G;  3TP8 A;  2FMC A;  3EIV A;  4JOI A;  1DOL A;  2K04 A;  3Q23 A;  3MXN B;  5HUR A;  4A3J H;  3MHB A;  1Y1V G;  1VQL A;  1TWC B;  5KEE A;  1ENA A;  4QUC A;  4JI3 L;  2FMM A;  4DV0 L;  1X3F A;  4A3M B;  5EBD A;  5D14 A;  3K7A B;  3NHH A;  1A62 A;  3GTK H;  3OW2 A;  3BVM A;  4JVZ A;  4ILW A;  4ODG A;  4A3B G;  5JJL A;  5ELE A;  2VL6 A;  1SEB D;  4OEL B;  4Y7N B;  2K5H A;  2RCN A;  1EOV A;  4OWT B;  1PYB A;  3WWV A;  5KIX A;  2EY2 A;  1HTL D;  2A6H D;  3K5L A;  5FLX L;  4LMQ D;  4R4I A;  4JI6 Q;  3AU7 A;  3OMG A;  3J7A 5;  2I5H A;  5M3F H;  1QVF A;  3VR5 A;  2RHQ B;  4L8J A;  3RLO A;  4OIK A;  4IUT A;  3CME A;  1DOK A;  2E8G A;  1F2Z A;  1PTO D;  2Q8R E;  1NUC A;  3VYR A;  3KJO A;  3Q8D A;  1NSN S;  3F2B A;  3S15 B;  3FVQ A;  3TZD A;  1NCV A;  4ME5 A;  4RGT A;  1EQQ A;  1HPC A;  1ICF B;  4A75 A;  4HJ5 A;  5BN4 A;  4IUR A;  3HOY B;  1VQN A;  1HTP A;  2OEO A;  1T5X D;  4X3U A;  5G3L D;  3CCL A;  1U4R A;  3S17 B;  1SLJ A;  4X62 L; 
#chains in the Genus database with same CATH homology
 2KQ3 A;  2K01 A;  1Y8O B;  4DU9 A;  3NSW A;  4BBR B;  2IX3 A;  3R2I A;  1I4X A;  5C5L A;  2H4O A;  4YIJ A;  1H9R A;  1GOZ A;  2WB1 B;  4EQO A;  1V1O A;  1UUP A;  1K8M A;  4FXD A;  5DEH A;  2D5D A;  2EJG C;  4CJ1 B;  1STY A;  4TSS A;  3T4A C;  3W3A A;  1STN A;  2HCC A;  4FXG C;  2F0G A;  3FEW X;  2L0C A;  5JEA G;  4XDX A;  1OXS C;  3WOF A;  3PUV A;  3TSS A;  5K36 H;  3M3Y B;  2F0H A;  3J80 E;  2EY5 A;  2JE6 I;  3NUC A;  2QIL A;  3RZD B;  2NWG A;  4A3J B;  4E6I A;  4HR7 B;  1HCZ A;  3X3N A;  5CBA E;  4F87 A;  2XRS D;  3H91 A;  2M2L A;  2JA5 B;  3SK8 A;  2KEE A;  5IGG A;  2F0E A;  1GHJ A;  2FJ2 A;  4CKE A;  1KDC A;  2F03 A;  1C4Q A;  1JCK B;  1Q1E A;  4KY5 A;  4RA8 A;  5EKL A;  3IAY A;  4G7H C;  2XSC A;  1A6X A;  1TT2 A;  5C4J B;  1ENC A;  4FYD A;  4ZAI A;  3I73 A;  2B2V C;  3PMF A;  3TBI B;  1TQO A;  4ZUI A;  4DAV A;  2K03 A;  1PRT B;  1EY4 A;  4PMB A;  2TSS A;  5A2Q E;  4OIJ A;  2OT2 A;  2LS0 1;  2V4D A;  1QIL A;  4IFD J;  1VF7 A;  1RCV D;  2F1M A;  1CHQ D;  2ZT9 C;  3M4O B;  2ZXP A;  4XQQ A;  4EGV A;  1JE4 A;  3K0Y A;  1Z47 A;  1HA6 A;  2NUC A;  1BBX C;  1R9T B;  5C4H A;  5KGU A;  1QJO A;  1B9N A;  2PPB C;  1V1P A;  5FK9 C;  2PO4 A;  3DWP A;  3P20 A;  1V8Q A;  4S3S A;  1G6Z A;  1QCB D;  4KKS A;  3HG9 A;  1BCP F;  2B2Y C;  3I70 A;  5I6W A;  2DNC A;  4OO1 G;  4H0L C;  1GUT A;  3QOJ A;  3DEP A;  2DY8 A;  3S2H B;  1C48 A;  3L9A X;  1KLG D;  2B2U C;  1QOH A;  1BOS A;  2KOL A;  2XN9 C;  1A3U A;  1TU2 B;  1TS2 A;  1FNV A;  1AN8 A;  1E0B A;  4CJ2 C;  5IGB A;  3M4Y A;  2E75 C;  4IFD I;  3J7A V;  1E2W A;  1EOT A;  5EPK A;  5IOD A;  2VXW A;  5I4D A;  2D2C C;  1AW7 A;  4G57 A;  3HOV B;  1D5X C;  5C3E B;  1S5F D;  1GUS A;  1SNM A;  1M4V A;  2L5T A;  4KD3 A;  4K8J A;  1XTC D;  2EZV A;  4A3I B;  1BXT A;  1SYC A;  5I9P A;  3OHX C;  5CR3 A;  4RHS A;  4KN7 C;  2EYP A;  3I8Z A;  1T5E A;  5JJZ A;  1DON A;  5M5W B;  2XWB B;  4J8Q A;  5IGC A;  1A3T A;  1V43 A;  1B2T A;  3GTM B;  2EE1 A;  3BDL A;  4FF1 A;  2PZT A;  3GO5 A;  1JOO A;  4K5W A;  3MAQ A;  1WD0 A;  3I91 A;  2RSO A;  3DEO A;  1SJH D;  2ICI A;  3TZU A;  5BN5 A;  2O5I C;  4Q5V A;  1WTR A;  3A7A B;  1KAB A;  1H9S A;  3GTO B;  4R8I A;  1F2M A;  5CYU A;  3E5S A;  1LTT D;  3KLS X;  3MZ5 A;  4XIG S;  1Q1B A;  3EQL C;  1J8I A;  3KLR A;  1O7Y A;  3H3V C;  3MEH A;  5IIF A;  3T56 B;  1D1I A;  2F0L A;  5JAV A;  3G6J B;  3HOU B;  1UAP A;  2R61 A;  5EBC A;  2CQA A;  4NW2 A;  1PFB A;  1F9R A;  2M00 A;  2PW7 A;  1F2Y A;  3VYU A;  3NTK A;  5CV7 A;  3GQB A;  3BVZ A;  3LWE A;  1J9O A;  5ISR A;  1PLF A;  1GXD C;  2CVR A;  5EPL A;  5C0X G;  3AB9 A;  1I6V C;  3OWE B;  3MWY W;  3RUZ A;  1Z7T A;  3U9S A;  1SYG A;  2NTT A;  3NWT A;  3FMC A;  1ZEQ X;  2R93 B;  3NQT A;  3GD7 A;  3I3C A;  3PUY A;  3C46 A;  3D4D A;  2BA0 A;  1G91 A;  2IW3 A;  3KUP A;  1SMY D;  1EZ8 A;  1ILQ A;  3D3R A;  1L0X B;  3CKI B;  5T1I A;  3S1Q B;  2QCP X;  2FIN B;  2KVM A;  1BQQ T;  5ELB A;  4KN4 C;  2A69 C;  2B63 B;  1SNC A;  1QB5 D;  1LT6 D;  1F9P A;  2R92 B;  1H9J A;  1I6H B;  4PMC A;  5JOB A;  2F3V A;  3NPP A;  1SYB A;  3GTQ B;  2QF7 A;  2F0T A;  4K2L A;  1O7L A;  1RF2 D;  3F2U A;  2E2D C;  3FPP A;  4FVM A;  3BVG A;  3A55 A;  3NBI A;  1LTB D;  2BDO A;  1EY6 A;  4RKL A;  4C3H G;  2WV6 D;  4C2M B;  3DM1 A;  3NP8 A;  4TKO B;  2VB2 X;  1WTV A;  1STH A;  1BO0 A;  3GV6 A;  4J1M A;  2NBF A;  3OIQ A;  3GV3 A;  2NVX B;  1TVX A;  4HCE A;  2NB0 A;  3V2T A;  2K1B A;  4ZK9 B;  4C3J B;  5EKK A;  1K83 B;  1G8Z D;  2EYF A;  1LV9 A;  5J1Z A;  1O7Z A;  3GP7 A;  1M8A A;  4K6L A;  4A3K B;  1EWH A;  2D62 A;  4XQN A;  5AFW A;  3A8K E;  2FHT A;  3I90 A;  1CM9 A;  4HN7 A;  1CFM A;  3LX0 A;  2RQX A;  5JVG 3;  4B9W A;  2K5Q A;  4QUF A;  4DXF A;  5E1F A;  1K8O A;  3HEJ A;  4ZKC B;  5E4X A;  1WD1 A;  2KCN A;  2IX1 A;  4HCS A;  2B2Y A;  3A54 A;  1XYI A;  4K14 A;  2TMP A;  2K5D A;  3G7L A;  2JYO A;  5CV4 A;  5FO9 B;  3N52 A;  1RDP D;  5M3F B;  3NTH A;  1PRT C;  4ZKB B;  3Q0A A;  2L1B A;  1EY0 A;  2F0N A;  3BZD B;  1D6E C;  2IJ0 A;  2A6H C;  4KY6 A;  1Q12 A;  1QNK A;  1EU4 A;  2Z8L A;  5I6Y A;  1I4R A;  3S1M B;  3I4M B;  2F0V A;  2RKS A;  3IL8 A;  2XVS A;  1HFG A;  4FO2 A;  2QEJ C;  2NN6 I;  1CI3 M;  2IL8 A;  1MSH A;  1HXY D;  3BYT B;  4BS9 A;  1H9K A;  1ONL A;  2KEC A;  2N88 A;  4C1N I;  2LKV A;  1O80 A;  2PCF B;  1IHZ A;  2LMC B;  3GTP B;  4FF4 A;  2EXZ A;  4RGO S;  1KNA A;  5C0X J;  1WTO A;  1S4Z A;  2JA6 B;  3H09 A;  3FDT A;  2YU9 B;  1B53 A;  1STB A;  2WKD A;  4QF4 A;  5BN3 A;  1FYC A;  1TS3 A;  3GTG B;  4NKL A;  2DNE A;  3LNN A;  2AUJ D;  2BDN A;  2WAQ B;  2NN6 H;  1SE4 A;  5DAU A;  1LTG D;  4X3K A;  5IOC A;  1STE A;  1II3 A;  4KHV A;  4DF7 A;  5KYL A;  4KV6 A;  2XIW A;  1KAA A;  1JOK A;  2E76 C;  3I4L A;  3TDQ A;  3WOE A;  5E3F A;  1Y8P B;  1E2Z A;  1LTS D;  2K7V A;  4A3D B;  1ESR A;  2NVY B;  4V19 0;  1CTM A;  3L7Z C;  2C5C A;  1G29 1;  1CK1 A;  4M1U B;  2L9H A;  4ZUJ A;  2RDH A;  2EOT A;  1SBB B;  1NR4 A;  3MXU A;  2AQ2 B;  4DXG A;  1LTI D;  4WJW A;  5EKI A;  5DNF A;  1SYD A;  1MD2 D;  2LFN A;  3RLF A;  1IL8 A;  2EDG A;  3HZX A;  1YNJ D;  2F0I A;  3Q6S A;  1SNQ A;  2NN6 G;  3EFX D;  2WAC A;  3SXH A;  1HUM A;  1NR2 A;  1SDF A;  3IFT A;  1EQV A;  3K58 A;  3NK9 A;  4RGN A;  5IGE A;  2F0O A;  3CHB D;  1EIH A;  3GTL B;  1XWE A;  1ZKO A;  1I4P A;  1CZW A;  1X32 A;  3VA7 A;  1A3V A;  4R8N A;  1Y8N B;  2BE5 D;  4BA2 I;  4IUV A;  4QCL A;  4R9W A;  2OXP A;  3R93 A;  3C2P A;  2F0F A;  4BWG B;  4ZQ3 A;  4A3F B;  2YYZ A;  3MTS A;  3ND8 A;  3QIA A;  2B8G A;  2EY6 A;  4OHJ A;  5FLX E;  1B50 A;  1DOM A;  2F0P A;  3DUZ A;  4KY7 A;  1B9M A;  3S1R B;  2GA4 B;  2X6G A;  1IW7 C;  3W2D A;  2I07 B;  5IGD A;  3TP7 A;  1JOR A;  1O78 A;  1Y1W B;  2ENB A;  2EYH A;  1KDA A;  1HHV A;  2L4N A;  1ENF A;  1Q3L A;  3MXP A;  4CKC A;  1OO9 B;  2NZ1 D;  2IT1 A;  2KA7 A;  3MFG A;  1JC7 A;  4CBV A;  1WVL A;  1ZYR C;  4F88 A;  4JBW A;  5FKA C;  3ONA B;  2MHV A;  3HS0 C;  3P7J A;  2LY7 A;  4WFN 3;  1OXT A;  3VR2 A;  1PRT D;  1PRT F;  4K5X A;  2F0W A;  3D4R A;  1F9S A;  2JP1 A;  1KNE A;  2BCO A;  4MHE A;  2WII B;  2JA7 B;  1ICW A;  1ROD A;  2RVL A;  1SFO B;  4FNF A;  1TWH B;  4OL7 A;  2BOS A;  3BS1 A;  1CA6 A;  1RHP A;  3K59 A;  1IYU A;  3PUX A;  1TWA B;  4DFA A;  3JAM E;  2Y0S B;  2VB3 X;  1GUO A;  2F0S A;  4DN4 M;  4IAL A;  3FRP B;  1LLR D;  4IUP A;  2VUM B;  1F2L A;  3R2T A;  3HOW B;  3K5O A;  5CMD A;  1UNS A;  4ZYS A;  4N9T A;  2CHB D;  3IFD A;  2E2H B;  2NVT B;  1W6J A;  4OGQ C;  1EY9 A;  5M9O A;  3NQI A;  2N55 A;  2XWJ B;  3VR6 A;  1PTO H;  2A68 D;  4A3E B;  3DHQ A;  2A69 D;  3J80 L;  1YNN C;  2Q8I B;  5ELF A;  1RD9 D;  4RFB A;  4IUQ A;  4B08 A;  1TKW B;  5J22 A;  4FF3 A;  3M85 A;  3OW7 A;  3E0J A;  1ET9 A;  3D4W A;  4FXK C;  3JAM L;  4XTC S;  5NUC A;  3KBX A;  3CRL C;  4HSP A;  3A8J E;  1PZI D;  2AWO A;  2FFK B;  5CC4 A;  1PMR A;  4ZLT F;  5JPN C;  1F9Q A;  4NMZ A;  5KNC A;  5CBE E;  1D5M C;  2RA4 A;  3TP5 A;  1TR5 A;  4I7Z C;  5I2Y A;  4ULL A;  1MBY A;  4I65 A;  3C1F A;  4UAI A;  2F0K A;  1HQR D;  2EJF C;  3C1E A;  2XRQ D;  1IKM A;  4XT3 B;  4PQX A;  1I4H A;  1EQT A;  2KUM A;  1SYF A;  3BG3 A;  3R3O A;  3T53 B;  4IUN A;  1LAB A;  5JPM C;  3S1N B;  3MVV A;  2B2T C;  3L3O C;  4EQN A;  5CV5 A;  1AP0 A;  4KKT A;  1H9S B;  4K2K A;  3MA2 B;  1BDO A;  3PIP 3;  3EA6 A;  3MFY A;  1Y69 U;  5I9O A;  3A7L A;  5JVH 3;  4WOR A;  1PXU A;  1D2B A;  1OXV A;  1JOQ A;  5FO7 B;  2B2V A;  2KHS A;  4HED A;  5A35 A;  2MP1 A;  5LL6 X;  1IYV A;  2G9D A;  4U67 3;  2E74 C;  2MGS A;  3DXJ C;  3DWA A;  2CW0 D;  1CHP D;  1QWY A;  4H7B A;  3T16 A;  3D6C A;  2QDB A;  1PTO F;  1V1P B;  1X3Q A;  1IKL A;  4UDU C;  4XQJ A;  4CJ0 B;  2L11 A;  2SNS A;  2F0M A;  3K6O A;  2E2I B;  3SR1 A;  4RHR A;  2SEB D;  3PIO 3;  2EY1 A;  4G7O C;  5K36 G;  5CV9 A;  2L55 A;  3KLS A;  5G3L F;  4DK1 A;  4LK1 C;  3NBH A;  4WRD A;  4F8M A;  1Q90 A;  1PFM A;  3CU7 A;  2AQ1 B;  3J81 E;  1EU3 A;  4QB4 A;  1EYD A;  2PNR C;  3OIP A;  4K8I A;  1QE6 A;  4AYB B;  4BY7 B;  4BA1 I;  4G7Z C;  2E2J B;  2B39 A;  1MGS A;  3VR3 A;  2B2U A;  3PUZ A;  3J7Y W;  3TME A;  2B2W C;  2OF1 A;  2EYJ A;  1RTO A;  5COR A;  1WTW A;  4IUU A;  3D31 A;  4DGZ A;  5D3D A;  3N6R A;  4FP5 D;  3RZO B;  2F0J A;  3PO2 B;  2NVQ B;  1OXU A;  3NTI A;  1Z6H A;  3KF8 A;  2EVB A;  2ZXO A;  1VF5 C;  1TWF B;  5C44 B;  3PV0 A;  1BNZ A;  3HOZ B;  2AWN A;  1X3P A;  2WKC A;  4QMG A;  3VA5 A;  1EY5 A;  4KK7 A;  1PTO C;  1TS5 A;  2K05 A;  1U4M A;  1B3A A;  4BY1 B;  1TY0 A;  3Q22 A;  3I72 A;  2HUG A;  1F77 A;  1SNP A;  5M5Y B;  1FD7 D;  4XYQ A;  1AZQ A;  3H6M A;  1FGB D;  4Q0F A;  3ITP A;  2O5J C;  2EJM A;  2BE5 C;  1EYA A;  2SDF A;  4TRD A;  5EPJ A;  4OO1 I;  1S5C D;  4TQU S;  2HDM A;  2NTS A;  1CQF A;  2PYK A;  1EL0 A;  3SK5 A;  1QNU A;  3FKI B;  3EVQ A;  5JEA J;  1FR3 A;  2MJ8 A;  1BCP C;  2J0T D;  1EEF D;  2K32 A;  4Z9C B;  3IKJ A;  4C3I G;  4KJO A;  1H9M A;  1HRJ A;  5CGK A;  4K5V A;  1DJR D;  2EPB A;  3OPO A;  4HTH A;  3S14 B;  2R7Z B;  3D6W A;  1XXG A;  5KYI A;  4EQP A;  2I46 A;  1S5E D;  2B8F A;  1SXT A;  5J39 A;  5D65 A;  1TII D;  5IT9 L;  1LAC A;  4L63 B;  4KKU A;  4PV1 C;  4KI0 A;  1E2V A;  1FNW A;  1W6K A;  4PNY A;  1HA5 A;  1SMY C;  1CA5 A;  4O1N A;  2A6E C;  4P2C B;  1LO5 D;  3SE0 A;  4DAY A;  1VCI A;  3J7A F;  2O2L D;  3ND9 A;  3DMU A;  2CW0 C;  5C0X H;  1R4Q B;  5FO8 B;  3MC0 B;  1A15 A;  5COY A;  1U4L A;  2HDL A;  1EIG A;  3V05 A;  2AQ3 B;  4X3T A;  4MN3 A;  1TWG B;  5EJW A;  1GJX A;  3CRK C;  1EFI D;  3RMH A;  1KTK A;  2SNM A;  1B44 D;  1CT1 D;  2KJX A;  3ERO A;  4KMU C;  3PO3 B;  2KCC A;  2PZU A;  1A2U A;  1PYW D;  4HSV A;  3HKZ B;  1BCP D;  1I50 B;  4N9P A;  1SNO A;  4F7X A;  2J4X A;  2NYZ D;  1PTO B;  3ERQ A;  4G4K A;  4KD4 A;  4A3B B;  1PZK D;  1D5Z C;  3BYY B;  1UEA B;  1HFN A;  1S5B D;  3HP3 A;  1LT3 D;  3HGB A;  4RH6 A;  1PZJ D;  4C3H B;  1SSO A;  2IX0 A;  1LTR D;  4CGY B;  2O4X A;  2F0D A;  1TS4 A;  2AUK A;  5C4X B;  3NWS A;  3H0G B;  4QIW B;  4RGM A;  3GTK B;  1DXM A;  1EYC A;  1LT5 D;  4JK1 C;  4IFD H;  2F0U A;  4J6H A;  2JSO A;  2Z1C A;  1Q8I A;  2HCI A;  3Q24 A;  2F0Q A;  2PZW A;  4H44 C;  1WTQ A;  1LTA D;  3DWQ A;  4KTA A;  4X3S A;  3URY A;  1S5D D;  1GUG A;  4EVO A;  1JWU D;  4CHT B;  2QKI C;  5ELD A;  2K6A A;  1WTX A;  1GUW A;  1VDZ A;  2RDF A;  5FOB B;  1AEX A;  1MI2 A;  4DNR B;  1B4O A;  5LHY 1;  5TSS A;  3S16 B;  2X6L A;  4K6D A;  2R3Z A;  1LT4 D;  1STG A;  2K28 A;  3A56 A;  2H1E A;  5KRU A;  2R6G A;  4U68 A;  1D1K A;  4B9X A;  5KNB A;  1SND A;  4DNT B;  3I4N B;  2MUY A;  1HQM C;  2RDG A;  3KK7 A;  3SK6 A;  3S9W A;  1CQV A;  2JXM B;  3SK4 A;  4RKB A;  5C0X I;  3J81 L;  3K57 A;  2ZXR A;  5K5P A;  4ZRZ A;  4LAA A;  1ML0 D;  1EZ6 A;  4DAP A;  2M9V A;  3PUW A;  1FNU A;  2MPM A;  2B2W A;  2A6E D;  4M8A A;  4C3J G;  1BUV T;  2D9U A;  3MXN A;  4HMI A;  3SHL A;  1RJT A;  2ID0 A;  2HQE A;  2DY7 A;  1CZG A;  3VYS A;  1RTN A;  2EYO A;  3SVM A;  3K5M A;  2VNU D;  3E6Z X;  5C4Z A;  2Z4H A;  3D8G A;  1G2T A;  3TP6 A;  1YNJ C;  5DM7 3;  2J7Z A;  1SE2 A;  1SJE D;  1SYE A;  1JWM D;  3HOX B;  1ZXT A;  1Y1V B;  1RKN A;  1DM0 B;  3ZYY X;  1JR0 D;  1JIC A;  1EY8 A;  3EJI A;  5LL6 S;  1KDB A;  2A68 C;  4H13 C;  2XNA C;  3SDZ A;  1YNN D;  5F2D A;  3OMC A;  3CQZ B;  2RSN A;  4IZ8 A;  4IQZ A;  3U9O A;  1GHK A;  1OXX K;  5C5M A;  2A74 C;  5JEA H;  4C56 C;  1ESF A;  3H94 A;  3TN2 A;  1L0Y B;  2BA1 A;  4OO1 H;  4GZY C;  2DN8 A;  5M3M B;  3T51 B;  3VYT A;  1SAP A;  1AZP A;  3C3L A;  3M7N A;  2IWH A;  2Q8T A;  1A2T A;  1QG7 A;  4RWS C;  4V0B A;  2RBM A;  1IW7 D;  1JQY D;  3VR4 A;  5EGT A;  3MXG A;  2X69 A;  4A93 B;  1I4Q A;  3FPU B;  4MIU A;  4PMW A;  2IPK D;  2F4I A;  4XXE A;  2A5H A;  5C3X A;  1BR9 A;  1EWC A;  4HAE A;  3QG1 A;  5D3I B;  4ABN A;  5IGF A;  2K33 A;  3KBG A;  3QO2 A;  1EY7 A;  2EYL A;  5DM6 3;  4NDX A;  1ZYR D;  1I3Q B;  5M5X B;  3P75 A;  4ID6 A;  3AMU A;  4KHZ A;  4CKB A;  4LJZ C;  1C8C A;  4RCN A;  2WIN B;  3QJY A;  1DZ1 A;  3QWN A;  1AFP A;  1GUN A;  3OSO A;  2A73 B;  2PQE A;  3LWU A;  3V96 A;  4RCO A;  1DCZ A;  3NE5 B;  3M7G A;  1VMC A;  1JB3 A;  3R8B A;  5HGT A;  2SOB A;  1WCM B;  3K5N A;  4O42 A;  4XYO A;  3O13 A;  5CV8 A;  5KND A;  3S2D B;  3RD4 A;  2F3W A;  5T1G A;  3OWF A;  1DD2 A;  4C3I B;  1TY2 A;  2L12 A;  2G9H D;  5I2X A;  1I4G A;  4DK0 A;  1U9R A;  1XX8 A;  3BDO A;  4XT1 B;  2WP8 J;  1B1Z A;  3SEB A;  3GTJ B;  3NXW A;  4RAU C;  2C9O A;  3WDN A;  5IT9 E;  1STA A;  5A2Q L;  2KED A;  3T13 A;  1WTP A;  2Z4I A;  1EEI D;  3HRZ C;  4A3G B;  5E4W C;  3QOL A;  5CV6 A;  4IN3 A;  4IFD G;  1G2S A;  5C6A A;  1PDQ A;  1BCP B;  4C1N K;  4L6T B;  5EQ0 A;  2JEA I;  1JWS D;  2ICE C;  5ELC A;  2PW5 A;  3X3M A;  2K5W A;  3A8I E;  3UI2 A;  1R4P B;  1ILP A;  4HMJ A;  4NP5 A;  3P1H A;  1KLU D;  1NAP A;  4KJN A;  5C3W A;  1SE3 A;  1MSG A;  1VMP A;  2JA8 B;  1U4P A;  1HUN A;  1ET6 A;  2B2T A;  3OOC A;  1BF4 A;  1DYQ A;  1PFN A;  3BDC A;  2EYM A;  4DA2 A;  3QB3 A;  4BBS B;  2JEB I;  4FF2 A;  2PMZ B;  3TP8 A;  2FMC A;  1DOL A;  2K04 A;  3Q23 A;  5HUR A;  3MHB A;  1TWC B;  5KEE A;  1ENA A;  4QUC A;  4A3M B;  2FMM A;  5EBD A;  5D14 A;  3K7A B;  3NHH A;  3BVM A;  4ILW A;  4ODG A;  5ELE A;  1SEB D;  4Y7N B;  5KIX A;  2EY2 A;  1HTL D;  2A6H D;  3K5L A;  5FLX L;  4LMQ D;  3AU7 A;  3OMG A;  3VR5 A;  4L8J A;  4OIK A;  4IUT A;  1DOK A;  1F2Z A;  1PTO D;  2Q8R E;  1NUC A;  3VYR A;  1NSN S;  3S15 B;  3FVQ A;  3TZD A;  1NCV A;  4ME5 A;  4RGT A;  1HPC A;  5BN4 A;  4IUR A;  3HOY B;  1HTP A;  2OEO A;  1T5X D;  4X3U A;  5G3L D;  3S17 B;  1U4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...