5JVH3

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
total genus 1
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jvh300
5DM63 5JVH3 4WFN3 5JVG3 3PIP3 5DM73 3PIO3 4U673
chains in the Genus database with same CATH superfamily
2IW3A 1E1TA 5COYA 2K32A 1II3A 2ZM6L 4X65Q 1TY0A 2WB1E 1VQDA 4O1NA 3UI2A 1G2TA 5C5LA 1Y1VG 2NVYH 4NKLA 4EQPA 5ELBA 4R9WA 3MWYW 1ZYRD 2RA4A 1XTCD 2JA8B 2I46A 2Z1CA 3K8AA 1LTSD 3C2PA 3TP7A 2R93G 1NY4A 4A3DB 1JORA 1QUQA 3G71A 4P73A 2IJ0A 1IYVA 4CJ2C 1Q8IA 4NB3A 1VQIA 1K83H 3H0GG 1R4PB 1I50H 2R6GA 4PG3A 3A5UA 3CCLA 1IYJB 1VQHA 3NE5B 1EY9A 1MJCA 2OTJA 1YHAA 1S72A 4RWSC 1BNZA 1EEID 1Y1VB 3U4ZA 4UDUC 5A2QL 5FJ8G 1Y8PB 4K5VA 2K5HA 5KGUA 2EOTA 2QGQA 4HMJA 4LJZC 2R93B 1H9SB 1SYBA 4K6LA 5DNFA 1HUNA 1PFSA 5I9OA 5HURA 5C4HA 1Y1WG 1VMCA 1X54A 3H0GB 1QWYA 4AYBG 4YHHL 3A56A 5AJ3Q 1KC8C 4LNQA 4LFBQ 4DAYB 2NZ1D 5CR3A 1KDBA 2WP8J 2BA1A 1HZAA 2LXKA 4JW0A 3OW2A 4YCUA 1EWHA 3GP7A 1LABA 1PHJA 3KLSA 4OWXB 4LF4L 2JA8H 4X3TA 1H9SA 5IT9L 3S16B 1VQBA 3GTGB 1OXUA 4A3DH 3G4SA 2B2UA 5EQ0A 5G3LD 2OWOA 3DEPA 4G57A 4IPCA 4MNOA 4JI4L 4JI3Q 2VNUD 3OPOA 2PI2E 2L5TA 2F0GA 1EFWA 1JE4A 2XIWA 1ML0D 2F0UA 5LL6S 4DV2Q 3FMCA 1EU3A 5DAUA 3V2TA 5A2QE 3J81L 3JAMi 3NTHA 2YTYA 1ENFA 4DV5L 3B6YA 5C0XG 5CV4A 1PZJD 5IT9c 4B08A 3I4OA 1OXXK 4X65L 2AUKA 2HQLA 1KD1C 4GN3B 2L15A 2A69D 3QB3A 4XQNA 2IY5B 1CZGA 1GHJA 1A62A 1J6QA 1KLUD 1E7ZA 1OXSC 3S1RB 3AU7A 1IHZA 4GN5A 3RD4A 1S3OA 1GUTA 1Q1BA 1S40A 1CSPA 3MXPA 2QCPX 4G4KA 3MAQA 1Q46A 4ZAIA 3N52A 3J81c 4HJ5A 2I5LX 1DM0B 2EJGC 1R9TB 3AQQA 3H09A 4FP5D 4QY7A 2JXMB 4JI0Q 3KFUA 3BVZA 3S16H 2OQKA 4A75A 3NP8A 2OTLA 1K0SA 5ELCA 1EYAA 1HNZL 1NJIC 2EYOA 1I4PA 2X69A 4U673 5JJZA 2Z9HA 3GQBA 3QWNA 1EQRA 4K2KA 4LWCA 5IGFA 1EIGA 3UDFA 1SSOA 3CXCA 1QVGA 3U9SA 3CCSA 4FVMA 2Q8IB 1DGSA 3C1EA 4KN7C 2UUAQ 5J22A 3L2PA 3OYYA 4LFBL 5C3EH 4GS3A 5CV6A 1LT5D 3J7A5 1XNQQ 1UE7A 3S1RH 1TWHH 4DK6C 2A8VA 3D8GA 1B3AA 4R1JA 5JJLA 2HHHL 1WTRA 1LUZA 2KENA 1ZXTA 2DY8A 1K3BC 4G7ZC 5HGTA 1UWVA 4R4CA 3DWPA 4AIMA 1RDPD 2IHEA 3MFYA 3D3RA 1R9TH 3KUPA 3ERSX 3OTOQ 4F7XA 3AYHB 4HAEA 3BDLA 2N8NA 1O78A 2A5HA 4DV1L 4UP9A 3A0JA 1VQAA 3I4MB 4I65A 2RCNA 1WFQA 3CCQA 1MD2D 3L3OC 1AFPA 4DV4L 1VQJA 1I6VC 4RGTA 1NNXA 4CJ1B 5BR8Q 1VQFA 4GOPC 4OELB 2O5JC 3QR8A 1EU4A 2YU9B 1NMGA 1VQEA 3QOLA 3SK6A 1QJOA 4X3SA 1WTVA 1BUVT 1L0XB 2EY1A 4H02A 1NR2A 2EPBA 1ASZA 4UY8C 2BE5D 3CKIB 4BA2I 2OCEA 3BDOA 4ZUJA 1HTPA 4J6HA 3I70A 4LFAQ 3X3NA 1PH2A 4XDXA 3SK8A 5FKAC 1TQOA 3V05A 5FO8B 1A2TA 2CH4A 5M5YB 5FLMH 1EY0A 2NBFA 4JI0L 2EDGA 4FF2A 1M4VA 4P74A 4A3JH 3T1HQ 1EY6A 2BDOA 1VQOA 3R2TA 3GTJB 2R7ZB 1P8LA 3QJYA 4HIDA 3RZOB 3DLLA 2XWBB 5EKIA 2CW0C 2MNAA 3BZCA 5FLXL 1BF4A 1HRJA 1B7YB 1VQNA 2E76C 3W1GA 3NTKA 3WDNA 5CGKA 4LF8Q 5EBDA 3I4MH 3SR1A 4ZLTF 2GN5A 3DM1A 1R4QB 2BOSA 2OXPA 3IFDA 4BY1H 4JI1L 1K9MC 2A74C 3HOZG 4DR2L 1ICWA 3J80E 2UUAL 2KECA 3TDQA 2VQFQ 1Q81C 1TS5A 2YU9H 1TS2A 2A6HC 1WTOA 3OIPA 4P72A 4TRDA 1KQSA 1MJEA 2EYJA 4IJHA 5K5PA 4L5TA 5EBCA 1EYDA 3I4NB 3S1QB 3CPFA 1C7YA 4YCVA 4EVOA 2IX1A 3D4WA 1I4GA 3P7JA 4L5SA 2F0OA 1KTKA 2NTTA 3RN5A 3H3VC 5CBEE 4GOPB 1Q7YC 5C0XJ 1JT8A 2R92H 2K6AA 3HOZB 4P75A 3I3CA 4KK7A 4UHVA 2QDBA 3OTOL 2A6EC 4B9WA 2MUYA 2RHQB 4IPDA 1A2UA 1SAPA 5EPJA 4GLXA 3FPUB 3I73A 3GTJH 2R7ZH 2QDLA 3IL8A 3J7AF 1B53A 3RZOH 5FLXE 3MEFA 2B2VC 4ZQ3A 2JA7H 4P71A 4DV7Q 5BR8L 1Z47A 2QF7A 1BKBA 1TWGH 5E1FA 2JA5G 4GOPA 1OXTA 5IODA 5JEAH 4WFN3 3HKSA 3SK4A 1SJED 1KLGD 1PTOH 2H5XA 1BVSA 4LF6Q 4ID6A 1HHVA 2B8FA 1BO0A 2NN6H 4IPGA 1OO9B 3OSOA 1UEAB 2WAQE 5D3IB 3I7FA 2NTSA 1HR0Q 3KLRA 5C4XG 1HXYD 4LFAL 3UDXA 4NXMQ 2F3IA 4PMBA 2PNHA 2NB0A 4XYQA 3S15B 1LO5D 3I4NH 2G9HD 4JI7Q 2RHSB 3S1QH 3K58A 1HQRD 4IUNA 3FKIG 2O4XA 1FNWA 1YNNC 5E4XA 3QOJA 1BCPF 4C1NI 1C9OA 2A73B 3T1HL 3MXNB 2JA5B 2B29A 4JOIC 4EX5A 5T1IA 4NXNQ 1F9RA 3VA7A 4QGUA 2K5VA 3EQLC 1I3QB 2L0CA 4PNYA 2WACA 1H9JA 2EY5A 1WCMG 2LS01 3I56A 2B63H 1LT3D 4HSVA 5ELEA 2AKWB 3MXGA 4KD4A 4EQNA 3Q22A 4MN3A 5IP9G 2JA6G 1I4RA 4H44C 4YY3Q 1JICA 5AFWA 3FKIB 3KLWA 1PH8A 2VQFL 3G6EA 2KHSA 1X3QA 4QMGA 5C4JH 1RTNA 2NVXB 1J5EL 3GTLB 1GVPA 3L9AX 1W2BA 4C3HG 2M00A 4DNRB 4K6DA 1TY2A 3H94A 3MTSA 1SNMA 3Q6SA 1KAWA 4UPAA 4GLVB 3PUWA 3CCUA 2HCIA 2R7FA 1N36Q 4OIKA 3VA5A 2NYZD 3FPPA 1WCMB 1NTGA 3FRPB 3HOXH 1TS4A 1V1PA 4XT1B 4LFCL 1FNUA 1JWSD 4PMWA 1U4PA 1EZ6A 1EOVA 2JP1A 4OIJA 2CKZB 1TWAH 4LF5Q 4B3TL 1AZQA 4MHEA 2L12A 1ZKOA 3D6CA 1UUPA 4DV6Q 1PRTF 4FXKC 3R3OA 1NSNS 2WINB 4C3JB 1I3QH 1PH5A 2WB1G 1Q12A 2RKSA 2YYZA 4DV7L 3JAML 3HOYB 1SYFA 5IYCH 2BH2A 4GKJQ 1NBWA 2F3WA 4N8FA 4DR3Q 4J1MA 2IWHA 1T5EA 3NEMA 4LF6L 5GQOA 5LHY1 1SJHD 1E0BA 1F2YA 1PVOA 2EQSA 3K5NA 1LTAD 5KIXA 4ODGA 3E3XA 2LMCB 3H3VH 1HR0L 4E6IA 5H1SE 1RTOA 2NVXH 1HCZA 1W3SA 2K52A 2EYLA 2EY6A 4JI7L 4X64Q 2K33A 2SNMA 1WYDA 3RLFA 3JAMc 1PDQA 1VDZA 1HFNA 3M4OH 5A35A 4H7BA 1F77A 5LMUQ 2E2JB 4XQQA 4O0AA 1G2SA 2AMCB 3C46A 2LY7A 1Q86C 4A93G 4JOIA 3DWQA 3TBIB 4KHZA 4K8JA 2ZJQA 1X3FA 4MZ9A 3PSIA 2WKDA 2D5DA 1PH4A 3EJIA 2B2TC 1B70B 1X55A 5IWAQ 4B3MQ 3CD6A 1STHA 4BY7G 1G6ZA 4GLAC 1LV9A 4QF4A 4YY3L 3HOYH 1WTXA 1QE6A 3T1YL 4A3GH 4OX9Q 1V1QA 1OXVA 2PW5A 3BVMA 3SGIA 2F3VA 2WKCA 2XTIA 3CP0A 3VR2A 1WVLA 3QO2A 3A54A 4BS9A 5JAVA 4DAVA 1WD0A 1QVFA 1N36L 3A74A 3CC7A 3PV0A 3I90A 1CI3M 2XNAC 2Q2IA 1IYUA 4DK3C 2VUMG 2J4XA 4LF5L 1O7ZA 4C3IB 1MIUA 4KY5A 3KLSX 2E2JH 1SYGA 3HOUB 1XWEA 2VS1A 2A68C 4DV6L 1MGSA 5IGGA 1A63A 2OEOA 1AE2A 1Y69U 2UUBQ 4KMUC 3T51B 1CHQD 4A3EB 1JB3A 3E6ZX 1CSQA 5EAYA 1N33Q 1WTPA 2HDLA 4K2LA 2G5DA 3A5ZB 2A6HD 4A3BG 4BBSG 4LK1C 2NN6I 4TSSA 5K36H 4DXFA 1FJGL 1PFNA 3K0XA 1YJNA 1STNA 1QG7A 2K5WA 1M90C 1O7IA 1W6JA 2B2WC 3S1NH 4DV3Q 1D5ZC 3STBC 1ENAA 3PGZA 1L1OC 1J8IA 2Z6KA 3FDTA 4OGQC 5M5XB 1O7YA 4AQYQ 4UAIA 5IGBA 4K0KL 2A6ED 4PQXA 3CRLC 1G51A 2F0IA 3CCJA 1KRSA 1DONA 4BBSB 4XQJA 3GTMB 5J39A 4C3IH 1VQ8A 4JVZA 1IL8A 2NZOA 3HOUH 3CPWA 1GD7A 1C8CA 1I4QA 2VZAA 5IWAL 4B3ML 1SE4A 1TKWB 2B2YC 4IUVA 1YNJC 4LAAA 3HS0C 4A3EH 4POFA 2N3SA 1ET9A 1LTLA 3HP3A 1LTTD 4JG2A 5ISRA 2XSCA 2DJGC 3M4OB 1B50A 4GNXC 3DWAA 2D62A 2KCNA 5KEEA 5KNBA 4JI6Q 1DOLA 4ME5A 3E9IA 4FF3A 2F0SA 1YNND 1CKOA 3HEJA 1DYQA 4J15A 1JOOA 2K5DA 4DNTB 4APVA 1N34Q 1V43A 4N8X1 4ZYSA 3K5LA 1DOKA 2GVBA 1VMPA 3SHLA 1U9RA 1PH3A 2FHTA 2PNRC 4Y52H 1ONLA 1U4MA 3SK5A 5FK9C 3PO2G 5I9PA 1X6OA 3L0OA 2CH4W 2F4VQ 4OO1G 4KLKA 5JVH3 1BQQT 4JBWA 1ESFA 4HR7B 1UE1A 2F0DA 3GTMH 4QUFA 1GUNA 4HJ7A 4DAYA 2RF4A 4PZ7A 4JPBW 1L1OB 1MSHA 1N33L 1Y1WB 4A3LG 2F0NA 4AYBB 2H4OA 4IO9A 3H3VI 1Y1VH 3D4RA 1YEZA 1PZKD 2ICIA 4RH6A 2UU9Q 4B3RL 1QVCA 1S5BD 3TZUA 3F2UA 5I2YA 1N32Q 1CKNB 1NAPA 2KEEA 5EJWA 3R93A 2L1BA 3VR3A 4DV3L 4LW1A 4ALPA 3C1FA 4POGA 2R93H 2Y0SG 4J8QA 4ZUIA 3J7YW 2ZJPA 1VQ6A 1TR5A 1H95A 2J7ZA 2RCFA 1PA6A 1Y8OB 4AQYL 1H9RA 3H0GH 1FL0A 2F0WA 1XTDA 1BBUA 3G48A 1MHWC 4CBVA 2SDFA 2F0MA 4OXPA 1PFMA 1CKMA 2LFNA 3RMHA 2ZTEA 1SMYC 5EKLA 4XT3B 1CKNA 2V1CC 4ZKCB 5IT9E 4KY6A 1EL0A 4GNXB 5JOBA 5FOBB 2B3GA 5FJ8H 1D8LA 3GTGH 2WFWA 2DNEA 1D1IA 3RLOA 4F8MA 1D5MC 3D4DA 2F0VA 4QIWB 5LMNQ 5IOCA 3GTPB 1YHQA 3HKZG 2Y0SB 2EJFC 3CC2A 2L11A 1X9NA 5IYDG 1SNOA 4IUUA 1P16A 2SEBD 3GTQB 3D31A 1Y1WH 4HN7A 1WJJA 1UNSA 3KBXA 4NPSA 3J81E 3OOCA 4HIKA 1XPRA 4JI6L 4GNXA 4A3KG 1F9QA 2ZTCA 1TU2B 3KF8B 4BXXG 1X65A 3RLNA 3S9WA 1EY8A 4ULLA 2PZUA 1XMOQ 5AJ3L 3TS2A 3UE0A 4RAUC 4RHRA 5KNDA 1KNAA 3K7AB 4R8NA 4B9XA 1STBA 2MO0A 1QNKA 3HZXA 1CT1D 3PIPA 4OWWB 1SE2A 2F4VL 1EUJA 1PMRA 2HT1A 3LGJA 3KF8A 2XWJB 2HD3A 2FXQA 4JI3L 3CMEA 4JC0A 1EWIA 2K5QA 5JPMC 3PF5A 1CK1A 1O7LA 2HUGA 1BCPC 3KF6B 3GTPH 1WTQA 1JB7A 2WAQG 3S24A 4DV2L 3TMEA 4HTHA 2K1BA 3HFZB 4YWKA 3GTOB 4A3FG 3DEOA 3DUZA 4ZCKA 3EIVA 2UU9L 2K4KA 3GTQH 2FMCA 2SNSA 3T13A 1B9MA 3TP8A 4EGVA 2OF1A 1XPUA 4DNIA 1I4XA 3M7NA 4PZ8A 3PUYA 3FHWA 2ES2A 3NPPA 3SE0A 1IBKQ 2RDGA 3KF6A 2X6GA 4A3CG 2UXCQ 2XRSD 1SN8A 2I0QA 1VQGA 2AQ3B 2K7VA 1VQLA 2B39A 2ICEC 3K7AH 1QZGA 2V4DA 4IPHA 3W2DA 3CF5A 1AE3A 2A68D 5M3MG 5C4ZA 4JBMA 2K50A 3ND8A 2FMMA 1WTHA 2F03A 1GHKA 4DR1Q 4A3FB 1STAA 1YI2A 1HR0W 1RJTA 1UEBA 3LWUA 4M8AA 4X3KA 4HMIA 3BG3A 1TXYA 5IP7G 3PIOA 2EZVA 5LMNL 4IURA 1RODA 4IFDG 2DUDA 4GN4B 3V96A 2FINB 4QJFA 2EYPA 3H91A 5JEAG 1K8GA 1SDFA 1K0RA 4DKAC 2OT2A 4PMCA 4MTKA 4XIGS 4CKCA 4JI5Q 1PRTC 2EIFA 3M7GA 3STBD 1JC7A 3KJPA 4G7HC 1QCBD 2FFKB 1C48A 1GUSA 2J0TD 3WOFA 3M4YA 1D5XC 4Q5VA 1S5ED 1AW7A 3LNNA 2JEAI 4OHJA 4KI0A 5C5MA 5CV8A 3G6JB 1HJPA 3L7ZC 2M2LA 1LT4D 1BCPB 1EFID 4JI8Q 5I6YA 1XNQL 2HCCA 5IY0A 3PMFA 4C56C 4DU9A 3BJUA 2ZJRA 2XVSA 5IIFA 3EROA 2AWOA 2F0FA 3MEHA 3UDGA 5EPLA 4IUQA 1V9PA 1GUOA 3P1HA 3I91A 3VYRA 5M5YH 4RFBA 1VQPA 5M3FG 5ELDA 4KN4C 5BN5A 1LACA 3AB9A 2N88A 2X6LA 3X3MA 1F9SA 2BDNA 3NHHA 1E3PA 4LUOA 3FVQA 3LX0A 4IZ8A 5C6AA 3M3YB 3F8TA 3NXWA 3DHQA 1ZYRC 5IGEA 2NVTB 1STEA 2KQ3A 3PUVA 3PO3G 3K59A 1AP0A 3A7LA 1LTID 2VL6A 3AFPA 3HG9A 1A3TA 1X3PA 2E8GA 3TQYA 1MSGA 1VS0A 1JE5A 5M3FB 1MBYA 1SRUA 2NVQB 3N6RA 4RG1A 3ND9A 1HZCA 4DR1L 1F2MA 1PRTB 3OMGA 4DGZA 2EJMA 1V1OA 4MTNA 4UP8A 4YWMA 4OONA 3PIP3 5C3WA 1GUGA 4CKBA 3CAMA 2D0PA 3GV3A 3HOZH 1HNWQ 5IYBG 4BBRG 1SYCA 1GXDC 5GADC 4JI5L 4LF8L 2F4IA 1IL2A 5C4XB 4K8IA 3BYYB 4FNFA 1G91A 4X66Q 5CORA 1KXLA 5I2XA 3FP9A 4Q0FA 1E2WA 3TRZA 3I72A 4FDBA 1KDCA 3MXNA 4HIMA 1XJVA 1LTGD 2PMZB 1RIPA 3M3YH 4DUZQ 2NVTH 2NUCA 5J3BA 1FGUA 3F2DA 1SMYD 3M4PA 3NENA 1ZEQX 1SEBD 2PZWA 1U5KA 4TKOB 1S5DD 2IHFA 4KHVA 2E2HB 5C44G 3D0FA 3S15H 1A6XA 2NVQH 4R4TA 5C0XI 3HGBA 1TWFB 1YHBA 2KCTA 3AFQA 2KCMA 4WJ4A 2JA6B 4KY7A 2PQAB 2D2CC 5EGTA 5ELOA 1IBLQ 3MC0B 2KUMA 3D6WA 3BS1A 1L0WA 1RD9D 2F0JA 3TP5A 2JA5H 3TSSA 4FF4A 1VQ4A 5HY6A 1I94Q 2KHJA 3U50C 4C1NK 4DK0A 4C3HB 2K04A 3VR5A 5IGDA 3PIO3 1NCVA 2B2VA 1WI5A 1GJXA 5C4XH 3SDZA 3CC4A 3HOVG 1PYWD 1U4RA 1J9OA 4K5XA 4O2DA 3GO5A 2Q2HA 4A3MG 5E3FA 4ABNA 3URYA 1HZ9A 2YV5A 1E2ZA 1WOCA 3OIQA 1ILPA 1JWMD 3FKIH 4NDXA 1VQ5A 3PCOB 2ATWA 4NXML 4IFDJ 4K5WA 5E4WC 3GTLH 1FVIA 4Y7NB 5JEAJ 4A3IG 2MQHA 1EWCA 1RCVD 2WB1B 1BCPD 2VW9A 3J7AV 2E2HH 5F2DA 2KBNA 4WRDA 4DN4M 4X3UA 1WCMH 3J80i 2B8GA 1B8AA 1TWFH 2Q2UA 1IKLA 3OW7A 4NXNL 5IP9H 2JA6H 3AMUA 4A3MB 1HNWL 4ZRZA 1VQMA 1T9HA 1W6KA 2VY3A 4WJWA 1PV4A 1ESRA 4DR6Q 3HOWG 4N9PA 3E9HA 3VDYA 2AQ1B 2G9DA 4C3JH 4X66L 4HJ9A 3OHXC 4C3HH 2L4NA 3T16A 3JAME 1I4HA 4QL5A 1LYLA 3MFGA 1Y8NB 5BN4A 5JVG3 2AHOB 4ME3A 2MHVA 1JCKB 2Q2TA 1FYCA 2KJXA 1PXUA 3KYHC 1B9NA 2I5HA 3ZYYX 1DCZA 1YIJA 4FF1A 4L63B 2JQOA 2RSNA 4A93B 3EA6A 3Q0AA 1N8RC 1DZ1A 5CYUA 3RZDB 4QUCA 4X62Q 3GV6A 3SEBA 1K8OA 2QEJC 4QQBX 3KDFB 4LUVA 2IX3A 4Y7NH 4KKTA 3NWSA 3O13A 4FXGC 4BY7B 5M9OA 2TSSA 5FO9B 4HJAA 2CW0D 1IBLL 1CTMA 4IJLA 3BZDB 5I6WA 1PRTD 2SOBA 1M8AA 1I94L 4NMZA 4YHHQ 1A15A 2UUCQ 3KDFA 3KBGA 4JYAQ 2N49A 3NK9A 1XNRQ 2F0PA 4GKJL 1PH1A 4DR3L 1F9PA 1NE3A 3K81C 5TSSA 1KDAA 3E0EA 1S5CD 2RBMA 2R7DA 4RCOA 1YJWA 1DOMA 3NQIA 2B2UC 1EOTA 1IBMQ 1LLRD 2ZTDA 1A8VA 2WIIB 3EVQA 1A0IA 2VUMB 2KVMA 1SYEA 3Q24A 3K0YA 2HIVA 2JK8A 2KCCA 4QCLA 1C4QA 1H9MA 2JA8G 4DR5Q 1SE8A 1TIID 1EIFA 4X64L 4A93H 2VB3X 4KTAA 4A3DG 3RZDH 1JWUD 5EKKA 1E1OA 3GD7A 4A76A 4BA1I 1SLJA 5GAHC 3CCVA 2XN9C 5LMUL 3TZDA 4DV5Q 1QUQB 2M9VA 3NQTA 4DAMA 1PH9A 2PQEA 3CQZB 4A3BB 1JR0D 4BY7H 2TMPA 1BBWA 3TEHB 1YNXA 2E75C 2I07B 2PZTA 3IRBA 2KOLA 4DUYQ 4DR6L 1B4OA 4OEMB 2F0LA 1GO3E 2B2TA 1LT6D 5M5WB 2HIXA 1SFOB 2QEXA 1SROA 2XGTA 1B2TA 2RDHA 4OX9L 1SXTA 5LMNW 3ULPA 1Q3LA 1G8ZD 2K28A 1I5FA 4F87A 1B44D 3K5MA 5I4DA 2E74C 1D2BA 1U0LA 3BVGA 4DXGA 4FYDA 2VUMH 2F0TA 4YWLA 4X62L 4DR7Q 4NW2A 1N9WA 1UE6A 1HNZQ 4L5RC 1AN8A 1PYBA 3U4VA 3T53B 1Q82C 2CFMA 4CDFC 1EQTA 1AZPA 3A8JE 3OWEB 4B3SQ 1TWCB 5M5XH 5BN3A 1NR4A 5KYIA 5C3XA 2IX0A 4DK1A 3P20A 3MVVA 4LF7Q 2CCZA 3ZJYC 4EQ5A 1VCIA 2MP1A 2QA4A 4A3BH 4BBSH 3OMCA 3CQZH 4CDEC 5CV9A 2O5IC 3K6OA 5DLQE 2UUCL 4HSPA 2UUBL 4JYAL 1L2FA 4RGMA 1XNRL 2R3ZA 1VQKA 5CBAE 5GROA 3GDEA 2ZXRA 2I5MX 3ONAB 3C3LA 4Z9CB 2JN4A 2MJ8A 5M5WH 1SFOH 3UE1A 2HHHQ 5L37A 2DJFC 1IBML 5C3EG 3PUZA 4PV1C 2H1EA 1SNDA 2C9OA 2MGSA 4LMQD 3PO2B 3CCRA 5D65A 2B2WA 3H15A 3DMUA 4DR5L 2JA9A 5GAGC 5JJKA 4DV1Q 1L1OA 4RA8A 3T56B 2R61A 2UXBQ 2EYHA 1CA5A 4DA2A 2RSOA 1GKHA 4DV4Q 1HUMA 1VF7A 3RN2A 1TWCH 3UDIA 3S1MB 2UXDQ 4RKLA 1V8QA 1Q1EA 5C3EB 1GOZA 1B3QA 3QG1A 1E24A 4DUYL 1HQMC 4TVAB 4BWGB 1ASYA 1VQ9A 1GM5A 1TWHB 1HNXQ 4JBJA 3MXUA 4ZKBB 2HDMA 2B2YA 1HH2P 5HGQA 3K57A 2DY7A 4DFAA 1LTBD 2RVLA 3RR5A 4M1UB 2DN8A 1CA6A 5EPKA 1I6HB 2F0HA 1S4ZA 1Y14B 2K01A 1D7QA 4YCWA 3NSWA 5FO7B 2PW7A 3W5OA 1EZ8A 3MHBA 1K28A 3PO2H 4DR7L 2L55A 4RCNA 3K80C 3R8BA 4OO1H 1N34L 1SMXA 2KEDA 5CV7A 4A4IA 5FLMG 4HEDA 3NBHB 4YIJA 4B3SL 1ET6A 3HKZB 4A3JG 1EYGA 2OQ0A 4RHSA 4DV0Q 1S5FD 2PO4A 1PZID 4JI1Q 4LF7L 3A8IE 1TVXA 4IOCA 1PFBA 4DR2Q 4A3LH 1JQYD 3JC66 2C35B 5GAEC 1SE3A 3S1MH 2C5CA 1PH6A 2N78A 1E2VA 1KHIA 4L5QA 4A3KB 3I4MG 1Z6HA 3F1ZA 2MFIA 5C0XH 4BY1G 4JCVE 3NBHA 3F2BA 5J1ZA 3WWVA 3NUCA 1PTOC 3S14B 1YVCA 1FR3A 2K03A 3ER0A 4A3JB 3J7ZC 3A8KE 2FJ2A 1JMCA 2A19A 1SNPA 1SR3A 1N32L 2VQEQ 4CDDC 4AYBE 2QW7A 1I6HH 4C2MB 1SYDA 1KIXA 3K7UC 1UAPA 4IOAA 3EN2A 2LXJA 2PPBC 1MKHA 3A55A 2UXBL 1FD7D 2JE6I 4BY1B 2ZXOA 2R92G 1HA5A 5ELNA 1QOHA 2K14A 1DJRD 1XMQQ 2WAQB 2Z4IA 1HA6A 2EYFA 3J80L 5IYDH 2UXDL 2E2IB 2NWGA 4CKEA 2CQAA 2R7ZG 1PH7A 3NWTA 2CVRA 3TN2A 3ERQA 2Z0SA 2RQXA 2JA7G 5NUCA 1HNXL 1QNUA 2L9HA 4RGNA 1Z9FA 4A3KH 1STYA 3IFTA 2VXWA 1YJ9A 4BXXH 5KRUA 3SVMA 4G7OC 3CU7A 4R8IA 1MI2A 2EYMA 4QIWE 2AQ2B 4I7ZC 2NN6G 2Q8TA 4U68A 2R92B 2PYKA 2K05A 1BDOA 3S14H 1JJGA 2Y0SE 3GTOH 3J80c 3RNUA 2GA4B 1YZ6A 4CDCC 5M3MB 4KV6A 3I4NG 4IQZA 4IUTA 1XMOL 1M1KC 4C2MH 4NP5A 1L0YB 1HPCA 3I55A 2D0OA 2JA7B 1EY4A 3PUXA 2O2LD 2RDFA 1KABA 1TWGB 1A3VA 1YITA 1LTRD 3TREA 4DV0L 1ENCA 2YTXA 2LKVA 4IN3A 4DPGA 3VYSA 4H13C 1D1KA 1PTOB 1X32A 4QB4A 1XXGA 3DXJC 4DAPA 2N55A 4MIUA 1RF2D 3HKZE 3QIAA 1F2LA 1YNJD 4A3FH 2E2IH 3WOEA 2B63G 4L8JA 1IW7C 1J5EQ 4XTCS 2VB2X 2MO1A 3BU2A 1ICFB 3PF4A 2LSSA 2WV6D 5FLXc 3S17B 1JJ2A 2YTVA 4A3CH 4JV5Q 5JJIA 3KK7A 4IALA 2VQEL 4LFCQ 4IUPA 1TS3A 4HIOA 3J81j 2PCFB 4OL7A 1EYCA 3CCEA 1KNEA 3E0JA 4B3TQ 2ALYB 1IBKL 5M3MH 3GTKB 1D6EC 2XRQD 3BDCA 2UXCL 2B63B 3HOXG 4WORA 4RGOS 5KYLA 3OWFA 3BYTB 2K5NA 5IP7H 1CZWA 1XMQL 2F1MA 3SXHA 2CWPA 4IFDH 1KL9A 5DM63 3E5SA 3J81i 5C4JB 3EFXD 1GUWA 5LL6X 1VQCA 4FXDA 4KD3A 2IT1A 2F0QA 1U4LA 5IYCG 4KKSA 1A3UA 2QKIC 1PTOF 3PO3B 1RHPA 4XYOA 2EE1A 2KA7A 3TP6A 1FNVA 3HOXB 4V190 1JOKA 3T4AC 4FO2A 4ZK9B 3S17H 3I8ZA 2BA0A 2JYOA 1NMFA 4HJ8A 3ITPA 2GVAA 4AH6A 5D14A 1TWAB 1STGA 5E7NA 4OO1I 1CUKA 2EXDA 3M85A 4RMFA 1F2ZA 5ELFA 3NELA 2Z8LA 1BBXC 4GKKQ 3CRKC 1X3EA 4EQOA 3GTKH 1EQQA 4JI8L 3RUZA 1X56A 1JOQA 5T1GA 3F2CA 1Z7TA 1LM0A 4KJNA 4CHTB 4BBRB 1DXMA 4XXEA 1K8AC 3A7AB 3U9OA 4DF7A 5M3FH 1H9KA 1V1PB 3T1YQ 2JSOA 3G7LA 1HFGA 5IE8A 1SBBB 4F88A 1SNCA 2E5LQ 1VQ7A 2BCOA 2CQOA 1IKMA 4K14A 1Q90A 1FGBD 4R4IA 5DM73 4C3JG 3P75A 3Q8DA 1WD1A 1PLFA 1CM9A 2CHBD 1G6PA 2F52A 3EBEA 4P2CB 3HOYG 4KHPQ 4V0BA 2JEBI 5KNCA 4A3GG 1C0AA 4S3SA 4N9TA 5CC4A 3IKJA 3PO3H 2Z4HA 2A69C 3TS0A 3U58A 4JV5L 1QILA 1ILQA 1QZHA 1IZ6A 5JPNC 4ILWA 1EY7A 2EXZA 4R4OA 4OWTB 1OTCA 4LF9Q 1EIHA 5C44B 1CFMA 3AEVA 1KAAA 2PQAA 1XYIA 1X3GA 3ULLA 1K73C 1HZBA 2Q8RE 2IPKD 3PQIA 4JI2Q 3I2ZA 1K3RA 1XPOA 2CWAA 4HCSA 3VR4A 2Z6BA 1YBYA 4DR4Q 3M4QA 1T5XD 1PYSB 4A3GB 1QB5D 4O42A 3VYTA 2NZHA 3BZKA 3W1BA 3KJOA 2ZT9C 5CMDA 5IYBH 4BBRH 3VYUA 1EEFD 1RL2A 1FJGQ 4KKUA 2HQEA 2MPMA 1RKNA 3S2DB 1SNQA 3HOVB 1PTOD 3IAYA 2ZM6Q 1DD2A 2D9UA 4PZ6A 1EQVA 2Z6KC 5K36G 2A1AA 1K8MA 1NUCA 1CQVA 3ICEA 3Q23A 4H0LC 2DGYA 2ZXPA 4HCEA 3CHBD 3FEWX 4K0KQ 3ULJA 1KRTA 4A3IB 1HTLD 4TQUS 1XX8A 3DM3A 3NBIA 3R2IA 2ID0A 3MZ5A 4CJ0B 5C44H 1IXRA 4GKKL 4UP7A 2AUJD 4DUZL 1E22A 3K5OA 3M9BA 5CV5A 3S2HB 4RKBA 4LUZA 3KOJA 2PMZE 1CHPD 4WJ3M 3H6MA 3CMAA 1WTWA 3HOWB 5DEHA 3CCMA 1BOSA 4C3IG 4X6AH 2EY2A 3HOUG 2E5LL 3W3AA 2KHIA 2QILA 3S1NB 1AH9A 1EY5A 2IL8A 3HRZC 4R4QA 5D3DA 3VR6A 3LWEA 4A3EG 2NVYB 3S2DH 4KJOA 1B1ZA 3HOVH 4KHPL 1TT2A 1BR9A 1G291 1AEXA 2E2DC 2F0EA 4A3MH 2AWNA 2P5ZX 3CW2C 4JK1C 4I7AA 4CGYB 1BXTA 1JJCB 2F0KA 2ENBA 4LF9L 4GZYC 2BE5C 4LF4Q 1K83B 1CQFA 3MA2B 4A3IH 4JBKA 2K75A 2EVBA 1I50B 1UE5A 4JI2L 4JI4Q 1Q8KA 5IGCA 4IFDI 5G3LF 3NTIA 4DR4L 2DNCA 2JJQA 2BH8A 3S2HH 1EIYB 1O80A 3I4LA 4L6TB 2ASBA 2PI2A 1IW7D 1VF5C 3HOWH 4B3RQ
chains in the Genus database with same CATH topology
2IW3A 5COYA 2K32A 1II3A 1TY0A 4O1NA 3UI2A 1G2TA 5C5LA 4NKLA 4EQPA 5ELBA 4R9WA 3MWYW 1ZYRD 2RA4A 1XTCD 2JA8B 2I46A 2Z1CA 1LTSD 3C2PA 3TP7A 4A3DB 1JORA 2IJ0A 1IYVA 4CJ2C 1Q8IA 1R4PB 2R6GA 3NE5B 1EY9A 4RWSC 1BNZA 1EEID 1Y1VB 4UDUC 5A2QL 1Y8PB 4K5VA 5KGUA 2EOTA 4HMJA 4LJZC 2R93B 1H9SB 1SYBA 4K6LA 5DNFA 1HUNA 5I9OA 5HURA 5C4HA 1VMCA 3H0GB 1QWYA 3A56A 2NZ1D 5CR3A 1KDBA 2WP8J 2BA1A 1EWHA 3GP7A 1LABA 3KLSA 4X3TA 1H9SA 5IT9L 3S16B 3GTGB 1OXUA 2B2UA 5EQ0A 5G3LD 3DEPA 4G57A 2VNUD 3OPOA 2L5TA 2F0GA 1JE4A 2XIWA 1ML0D 2F0UA 5LL6S 3FMCA 1EU3A 5DAUA 3V2TA 5A2QE 3J81L 3NTHA 1ENFA 5C0XG 5CV4A 1PZJD 4B08A 1OXXK 2AUKA 2A69D 3QB3A 4XQNA 1CZGA 1GHJA 1KLUD 1OXSC 3S1RB 3AU7A 1IHZA 3RD4A 1GUTA 1Q1BA 3MXPA 2QCPX 4G4KA 3MAQA 4ZAIA 3N52A 1DM0B 2EJGC 1R9TB 3H09A 4FP5D 2JXMB 3BVZA 3NP8A 5ELCA 1EYAA 2EYOA 1I4PA 2X69A 4U673 5JJZA 3GQBA 3QWNA 4K2KA 5IGFA 1EIGA 1SSOA 3U9SA 4FVMA 2Q8IB 3C1EA 4KN7C 5J22A 5CV6A 1LT5D 3D8GA 1B3AA 1WTRA 1ZXTA 2DY8A 4G7ZC 5HGTA 3DWPA 1RDPD 3MFYA 3D3RA 3KUPA 4F7XA 4HAEA 3BDLA 1O78A 2A5HA 3I4MB 4I65A 1MD2D 3L3OC 1AFPA 1I6VC 4RGTA 4CJ1B 2O5JC 1EU4A 2YU9B 3QOLA 3SK6A 1QJOA 4X3SA 1WTVA 1BUVT 1L0XB 2EY1A 1NR2A 2EPBA 2BE5D 3CKIB 4BA2I 3BDOA 4ZUJA 1HTPA 4J6HA 3I70A 3X3NA 4XDXA 3SK8A 5FKAC 1TQOA 3V05A 5FO8B 1A2TA 5M5YB 1EY0A 2NBFA 2EDGA 4FF2A 1M4VA 1EY6A 2BDOA 3R2TA 3GTJB 2R7ZB 3QJYA 3RZOB 2XWBB 5EKIA 2CW0C 5FLXL 1BF4A 1HRJA 2E76C 3NTKA 3WDNA 5CGKA 5EBDA 3SR1A 4ZLTF 3DM1A 1R4QB 2BOSA 2OXPA 3IFDA 2A74C 1ICWA 3J80E 2KECA 3TDQA 1TS5A 1TS2A 2A6HC 1WTOA 3OIPA 4TRDA 2EYJA 5K5PA 5EBCA 1EYDA 3I4NB 3S1QB 2IX1A 4EVOA 3D4WA 1I4GA 3P7JA 2F0OA 1KTKA 2NTTA 3H3VC 5CBEE 5C0XJ 2K6AA 3HOZB 3I3CA 4KK7A 2QDBA 2A6EC 4B9WA 2MUYA 1A2UA 1SAPA 5EPJA 3FPUB 3I73A 3IL8A 3J7AF 1B53A 5FLXE 2B2VC 4ZQ3A 1Z47A 2QF7A 5E1FA 1OXTA 5IODA 5JEAH 4WFN3 3SK4A 1SJED 1KLGD 1PTOH 4ID6A 1HHVA 2B8FA 1BO0A 2NN6H 1OO9B 3OSOA 1UEAB 5D3IB 2NTSA 3KLRA 1HXYD 4PMBA 2NB0A 4XYQA 3S15B 1LO5D 2G9HD 3K58A 1HQRD 4IUNA 2O4XA 1FNWA 1YNNC 5E4XA 3QOJA 1BCPF 4C1NI 2A73B 2JA5B 5T1IA 1F9RA 3VA7A 3EQLC 4PNYA 1I3QB 2L0CA 2WACA 1H9JA 2EY5A 2LS01 1LT3D 4HSVA 5ELEA 3MXGA 4KD4A 4EQNA 3Q22A 4MN3A 1I4RA 4H44C 1JICA 5AFWA 3FKIB 2KHSA 1X3QA 4QMGA 1RTNA 2NVXB 3GTLB 3L9AX 4C3HG 2M00A 4DNRB 4K6DA 1TY2A 3H94A 3MTSA 1SNMA 3Q6SA 3PUWA 2HCIA 4OIKA 3VA5A 2NYZD 3FPPA 1WCMB 3FRPB 1TS4A 1V1PA 4XT1B 1FNUA 1JWSD 4PMWA 1U4PA 1EZ6A 2JP1A 4OIJA 1AZQA 4MHEA 2L12A 1ZKOA 3D6CA 1UUPA 1PRTF 4FXKC 3R3OA 1NSNS 2WINB 4C3JB 1Q12A 2RKSA 2YYZA 3JAML 3HOYB 1SYFA 2F3WA 4J1MA 2IWHA 1T5EA 5LHY1 1SJHD 1E0BA 1F2YA 3K5NA 1LTAD 5KIXA 4ODGA 2LMCB 4E6IA 1RTOA 1HCZA 2EYLA 2EY6A 2K33A 2SNMA 3RLFA 1PDQA 1VDZA 1HFNA 5A35A 4H7BA 1F77A 2E2JB 4XQQA 1G2SA 3C46A 2LY7A 3DWQA 3TBIB 4KHZA 4K8JA 2WKDA 2D5DA 3EJIA 2B2TC 1STHA 1G6ZA 1LV9A 4QF4A 1WTXA 1QE6A 1OXVA 2PW5A 3BVMA 2F3VA 2WKCA 3VR2A 1WVLA 3QO2A 3A54A 4BS9A 5JAVA 4DAVA 1WD0A 3PV0A 3I90A 1CI3M 2XNAC 1IYUA 2J4XA 1O7ZA 4C3IB 4KY5A 3KLSX 1SYGA 3HOUB 1XWEA 2A68C 1MGSA 5IGGA 2OEOA 1Y69U 4KMUC 3T51B 1CHQD 4A3EB 1JB3A 3E6ZX 1WTPA 2HDLA 4K2LA 2A6HD 4LK1C 2NN6I 4TSSA 5K36H 4DXFA 1PFNA 1STNA 1QG7A 2K5WA 1W6JA 2B2WC 1D5ZC 1ENAA 1J8IA 3FDTA 4OGQC 5M5XB 1O7YA 4UAIA 5IGBA 2A6ED 4PQXA 3CRLC 2F0IA 1DONA 4BBSB 4XQJA 3GTMB 5J39A 1IL8A 1C8CA 1I4QA 1SE4A 1TKWB 2B2YC 4IUVA 1YNJC 4LAAA 3HS0C 1ET9A 3HP3A 1LTTD 5ISRA 2XSCA 3M4OB 1B50A 3DWAA 2D62A 2KCNA 5KEEA 5KNBA 1DOLA 4ME5A 4FF3A 2F0SA 1YNND 3HEJA 1DYQA 1JOOA 2K5DA 4DNTB 1V43A 4ZYSA 3K5LA 1DOKA 1VMPA 3SHLA 1U9RA 2FHTA 2PNRC 1ONLA 1U4MA 3SK5A 5FK9C 5I9PA 4OO1G 5JVH3 1BQQT 4JBWA 1ESFA 4HR7B 2F0DA 4QUFA 1GUNA 4DAYA 1MSHA 1Y1WB 2F0NA 4AYBB 2H4OA 3D4RA 1PZKD 2ICIA 4RH6A 1S5BD 3TZUA 3F2UA 5I2YA 1NAPA 2KEEA 5EJWA 3R93A 2L1BA 3VR3A 3C1FA 4J8QA 4ZUIA 3J7YW 1TR5A 2J7ZA 1Y8OB 1H9RA 2F0WA 4CBVA 2SDFA 2F0MA 1PFMA 2LFNA 3RMHA 1SMYC 5EKLA 4XT3B 4ZKCB 5IT9E 4KY6A 1EL0A 5JOBA 5FOBB 2DNEA 1D1IA 4F8MA 1D5MC 3D4DA 2F0VA 4QIWB 5IOCA 3GTPB 2Y0SB 2EJFC 2L11A 1SNOA 4IUUA 2SEBD 3GTQB 3D31A 4HN7A 1UNSA 3KBXA 3J81E 3OOCA 1F9QA 1TU2B 3S9WA 1EY8A 4ULLA 2PZUA 4RAUC 4RHRA 5KNDA 1KNAA 3K7AB 4R8NA 4B9XA 1STBA 1QNKA 3HZXA 1CT1D 1SE2A 1PMRA 3KF8A 2XWJB 2K5QA 5JPMC 1CK1A 1O7LA 2HUGA 1BCPC 1WTQA 3TMEA 4HTHA 2K1BA 3GTOB 3DEOA 3DUZA 2FMCA 2SNSA 3T13A 1B9MA 3TP8A 4EGVA 2OF1A 1I4XA 3M7NA 3PUYA 3NPPA 3SE0A 2RDGA 2X6GA 2XRSD 2AQ3B 2K7VA 2B39A 2ICEC 2V4DA 3W2DA 2A68D 5C4ZA 3ND8A 2FMMA 2F03A 1GHKA 4A3FB 1STAA 1RJTA 3LWUA 4M8AA 4X3KA 4HMIA 3BG3A 2EZVA 4IURA 1RODA 4IFDG 3V96A 2FINB 2EYPA 3H91A 5JEAG 1SDFA 2OT2A 4PMCA 4XIGS 4CKCA 1PRTC 3M7GA 1JC7A 4G7HC 1QCBD 2FFKB 1C48A 1GUSA 2J0TD 3WOFA 3M4YA 1D5XC 4Q5VA 1S5ED 1AW7A 3LNNA 2JEAI 4OHJA 4KI0A 5C5MA 5CV8A 3G6JB 3L7ZC 2M2LA 1LT4D 1BCPB 1EFID 5I6YA 2HCCA 3PMFA 4C56C 4DU9A 2XVSA 5IIFA 3EROA 2AWOA 2F0FA 3MEHA 5EPLA 4IUQA 1GUOA 3P1HA 3I91A 3VYRA 4RFBA 5ELDA 4KN4C 5BN5A 1LACA 3AB9A 2N88A 2X6LA 3X3MA 1F9SA 2BDNA 3NHHA 3FVQA 3LX0A 4IZ8A 5C6AA 3M3YB 3NXWA 3DHQA 1ZYRC 5IGEA 2NVTB 1STEA 2KQ3A 3PUVA 3K59A 1AP0A 3A7LA 1LTID 3HG9A 1A3TA 1X3PA 1MSGA 5M3FB 1MBYA 2NVQB 3N6RA 3ND9A 1F2MA 1PRTB 3OMGA 4DGZA 2EJMA 1V1OA 3PIP3 5C3WA 1GUGA 4CKBA 3GV3A 1SYCA 1GXDC 2F4IA 5C4XB 4K8IA 3BYYB 4FNFA 1G91A 5CORA 5I2XA 4Q0FA 1E2WA 3I72A 1KDCA 3MXNA 1LTGD 2PMZB 2NUCA 1SMYD 1ZEQX 1SEBD 2PZWA 4TKOB 1S5DD 4KHVA 2E2HB 1A6XA 5C0XI 3HGBA 1TWFB 2JA6B 4KY7A 2D2CC 5EGTA 3MC0B 2KUMA 3D6WA 3BS1A 1RD9D 2F0JA 3TP5A 3TSSA 4FF4A 4C1NK 4DK0A 4C3HB 2K04A 3VR5A 5IGDA 3PIO3 1NCVA 2B2VA 1GJXA 3SDZA 1PYWD 1U4RA 1J9OA 4K5XA 3GO5A 5E3FA 4ABNA 3URYA 3OIQA 1E2ZA 1ILPA 1JWMD 4NDXA 4IFDJ 4K5WA 5E4WC 4Y7NB 5JEAJ 1EWCA 1RCVD 2WB1B 1BCPD 3J7AV 5F2DA 4WRDA 4DN4M 4X3UA 2B8GA 1IKLA 3OW7A 3AMUA 4A3MB 4ZRZA 1W6KA 4WJWA 1ESRA 4N9PA 2AQ1B 2G9DA 3OHXC 2L4NA 3T16A 3JAME 1I4HA 3MFGA 1Y8NB 5BN4A 5JVG3 2MHVA 1JCKB 1FYCA 2KJXA 1PXUA 1B9NA 3ZYYX 1DCZA 4FF1A 4L63B 2RSNA 4A93B 3EA6A 3Q0AA 1DZ1A 5CYUA 3RZDB 4QUCA 3GV6A 3SEBA 1K8OA 2QEJC 2IX3A 4KKTA 3NWSA 3O13A 4FXGC 4BY7B 5M9OA 2TSSA 5FO9B 2CW0D 1CTMA 3BZDB 5I6WA 1PRTD 2SOBA 1M8AA 4NMZA 1A15A 3KBGA 3NK9A 2F0PA 1F9PA 5TSSA 1KDAA 1S5CD 2RBMA 4RCOA 1DOMA 3NQIA 2B2UC 1EOTA 1LLRD 2WIIB 3EVQA 2VUMB 2KVMA 1SYEA 3Q24A 3K0YA 2KCCA 4QCLA 1C4QA 1H9MA 1TIID 2VB3X 4KTAA 1JWUD 5EKKA 3GD7A 4BA1I 2XN9C 3TZDA 2M9VA 3NQTA 4A3BB 2PQEA 3CQZB 1JR0D 2TMPA 2E75C 2I07B 2PZTA 2KOLA 1B4OA 2F0LA 2B2TA 1LT6D 5M5WB 1SFOB 1B2TA 2RDHA 1SXTA 1Q3LA 1G8ZD 2K28A 4F87A 1B44D 3K5MA 5I4DA 2E74C 1D2BA 4DXGA 3BVGA 4FYDA 2F0TA 4NW2A 1AN8A 3T53B 1EQTA 1AZPA 3A8JE 3OWEB 1TWCB 5BN3A 1NR4A 5KYIA 5C3XA 2IX0A 4DK1A 3P20A 3MVVA 1VCIA 2MP1A 3OMCA 5CV9A 2O5IC 3K6OA 4HSPA 4RGMA 2R3ZA 5CBAE 2ZXRA 3ONAB 3C3LA 4Z9CB 2MJ8A 3PUZA 4PV1C 2H1EA 4LMQD 1SNDA 2C9OA 2MGSA 3PO2B 5D65A 2B2WA 3DMUA 4RA8A 3T56B 2R61A 2EYHA 1CA5A 4DA2A 2RSOA 1HUMA 1VF7A 3S1MB 4RKLA 1V8QA 1Q1EA 5C3EB 1GOZA 3QG1A 1HQMC 4BWGB 1TWHB 3MXUA 4ZKBB 2HDMA 2B2YA 3K57A 2DY7A 4DFAA 1LTBD 2RVLA 4M1UB 2DN8A 1CA6A 5EPKA 1I6HB 2F0HA 1S4ZA 2K01A 3NSWA 5FO7B 2PW7A 1EZ8A 3MHBA 2L55A 4RCNA 3R8BA 4OO1H 2KEDA 5CV7A 4HEDA 4YIJA 1ET6A 3HKZB 4RHSA 1S5FD 2PO4A 1PZID 3A8IE 1TVXA 1PFBA 1JQYD 1SE3A 2C5CA 1E2VA 4A3KB 1Z6HA 5C0XH 3NBHA 5J1ZA 3NUCA 1PTOC 3S14B 1FR3A 2K03A 4A3JB 3A8KE 2FJ2A 1SNPA 4C2MB 1SYDA 1UAPA 2PPBC 3A55A 1FD7D 2JE6I 4BY1B 2ZXOA 1HA5A 1QOHA 1DJRD 2WAQB 2Z4IA 1HA6A 2EYFA 3J80L 2E2IB 2NWGA 4CKEA 2CQAA 3NWTA 2CVRA 3TN2A 3ERQA 2RQXA 5NUCA 1QNUA 2L9HA 4RGNA 1STYA 3IFTA 2VXWA 5KRUA 3SVMA 4G7OC 3CU7A 4R8IA 1MI2A 2EYMA 2AQ2B 4I7ZC 2NN6G 2Q8TA 4U68A 2R92B 2PYKA 2K05A 1BDOA 2GA4B 5M3MB 4KV6A 4IQZA 4IUTA 4NP5A 1L0YB 1HPCA 2JA7B 1EY4A 2O2LD 3PUXA 2RDFA 1KABA 1TWGB 1A3VA 1LTRD 1ENCA 2LKVA 4IN3A 3VYSA 4H13C 1D1KA 1PTOB 1X32A 4QB4A 1XXGA 3DXJC 4DAPA 2N55A 4MIUA 1RF2D 3QIAA 1F2LA 1YNJD 3WOEA 4L8JA 1IW7C 4XTCS 2VB2X 2WV6D 3S17B 3KK7A 4IALA 4IUPA 1TS3A 2PCFB 4OL7A 1EYCA 1KNEA 3E0JA 3GTKB 1D6EC 2XRQD 3BDCA 2B63B 4WORA 4RGOS 5KYLA 3OWFA 3BYTB 1CZWA 2F1MA 3SXHA 4IFDH 5DM63 3E5SA 5C4JB 3EFXD 1GUWA 5LL6X 4FXDA 4KD3A 2IT1A 2F0QA 1U4LA 4KKSA 1A3UA 2QKIC 1PTOF 3PO3B 1RHPA 4XYOA 2EE1A 2KA7A 3TP6A 1FNVA 3HOXB 4V190 1JOKA 3T4AC 4FO2A 4ZK9B 3I8ZA 2BA0A 2JYOA 3ITPA 5D14A 1TWAB 1STGA 4OO1I 3M85A 1F2ZA 5ELFA 2Z8LA 1BBXC 3CRKC 4EQOA 3RUZA 1JOQA 5T1GA 1Z7TA 4KJNA 4CHTB 4BBRB 1DXMA 4XXEA 3A7AB 3U9OA 4DF7A 1H9KA 1V1PB 2JSOA 3G7LA 1HFGA 1SBBB 4F88A 1SNCA 2BCOA 1IKMA 4K14A 1Q90A 1FGBD 5DM73 4C3JG 3P75A 1WD1A 1PLFA 1CM9A 2CHBD 4P2CB 4V0BA 2JEBI 5KNCA 4S3SA 4N9TA 5CC4A 3IKJA 2Z4HA 2A69C 1QILA 1ILQA 5JPNC 4ILWA 1EY7A 2EXZA 1EIHA 5C44B 1CFMA 1KAAA 1XYIA 2Q8RE 2IPKD 4HCSA 3VR4A 1T5XD 4A3GB 1QB5D 4O42A 3VYTA 2ZT9C 5CMDA 3VYUA 1EEFD 4KKUA 2HQEA 2MPMA 1RKNA 3S2DB 1SNQA 3HOVB 1PTOD 3IAYA 1DD2A 2D9UA 1EQVA 5K36G 1K8MA 1NUCA 1CQVA 3Q23A 4H0LC 2ZXPA 4HCEA 3CHBD 3FEWX 4A3IB 1HTLD 4TQUS 1XX8A 3NBIA 3R2IA 2ID0A 3MZ5A 4CJ0B 2AUJD 3K5OA 5CV5A 3S2HB 4RKBA 1CHPD 3H6MA 1WTWA 3HOWB 5DEHA 1BOSA 4C3IG 2EY2A 3W3AA 2QILA 3S1NB 1EY5A 2IL8A 3HRZC 5D3DA 3VR6A 3LWEA 2NVYB 4KJOA 1B1ZA 1TT2A 1BR9A 1G291 1AEXA 2E2DC 2F0EA 2AWNA 4JK1C 4CGYB 1BXTA 2F0KA 2ENBA 4GZYC 2BE5C 1K83B 1CQFA 3MA2B 2EVBA 1I50B 4IFDI 5IGCA 5G3LF 3NTIA 2DNCA 1O80A 3I4LA 4L6TB 1IW7D 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 3;  5JVH 3;  4WFN 3;  5JVG 3;  3PIP 3;  5DM7 3;  3PIO 3;  4U67 3; 
#chains in the Genus database with same CATH topology
 2IW3 A;  1E1T A;  5COY A;  2K32 A;  1II3 A;  2ZM6 L;  4X65 Q;  1TY0 A;  2WB1 E;  1VQD A;  4O1N A;  3UI2 A;  1G2T A;  5C5L A;  1Y1V G;  2NVY H;  4NKL A;  4EQP A;  5ELB A;  4R9W A;  3MWY W;  1ZYR D;  2RA4 A;  1XTC D;  2JA8 B;  2I46 A;  2Z1C A;  3K8A A;  1LTS D;  3C2P A;  3TP7 A;  2R93 G;  1NY4 A;  4A3D B;  1JOR A;  1QUQ A;  3G71 A;  4P73 A;  2IJ0 A;  1IYV A;  4CJ2 C;  1Q8I A;  4NB3 A;  1VQI A;  1K83 H;  3H0G G;  1R4P B;  1I50 H;  2R6G A;  4PG3 A;  3A5U A;  3CCL A;  1IYJ B;  1VQH A;  3NE5 B;  1EY9 A;  1MJC A;  2OTJ A;  1YHA A;  1S72 A;  4RWS C;  1BNZ A;  1EEI D;  1Y1V B;  3U4Z A;  4UDU C;  5A2Q L;  5FJ8 G;  1Y8P B;  4K5V A;  2K5H A;  5KGU A;  2EOT A;  2QGQ A;  4HMJ A;  4LJZ C;  2R93 B;  1H9S B;  1SYB A;  4K6L A;  5DNF A;  1HUN A;  1PFS A;  5I9O A;  5HUR A;  5C4H A;  1Y1W G;  1VMC A;  1X54 A;  3H0G B;  1QWY A;  4AYB G;  4YHH L;  3A56 A;  5AJ3 Q;  1KC8 C;  4LNQ A;  4LFB Q;  4DAY B;  2NZ1 D;  5CR3 A;  1KDB A;  2WP8 J;  2BA1 A;  1HZA A;  2LXK A;  4JW0 A;  3OW2 A;  4YCU A;  1EWH A;  3GP7 A;  1LAB A;  1PHJ A;  3KLS A;  4OWX B;  4LF4 L;  2JA8 H;  4X3T A;  1H9S A;  5IT9 L;  3S16 B;  1VQB A;  3GTG B;  1OXU A;  4A3D H;  3G4S A;  2B2U A;  5EQ0 A;  5G3L D;  2OWO A;  3DEP A;  4G57 A;  4IPC A;  4MNO A;  4JI4 L;  4JI3 Q;  2VNU D;  3OPO A;  2PI2 E;  2L5T A;  2F0G A;  1EFW A;  1JE4 A;  2XIW A;  1ML0 D;  2F0U A;  5LL6 S;  4DV2 Q;  3FMC A;  1EU3 A;  5DAU A;  3V2T A;  5A2Q E;  3J81 L;  3JAM i;  3NTH A;  2YTY A;  1ENF A;  4DV5 L;  3B6Y A;  5C0X G;  5CV4 A;  1PZJ D;  5IT9 c;  4B08 A;  3I4O A;  1OXX K;  4X65 L;  2AUK A;  2HQL A;  1KD1 C;  4GN3 B;  2L15 A;  2A69 D;  3QB3 A;  4XQN A;  2IY5 B;  1CZG A;  1GHJ A;  1A62 A;  1J6Q A;  1KLU D;  1E7Z A;  1OXS C;  3S1R B;  3AU7 A;  1IHZ A;  4GN5 A;  3RD4 A;  1S3O A;  1GUT A;  1Q1B A;  1S40 A;  1CSP A;  3MXP A;  2QCP X;  4G4K A;  3MAQ A;  1Q46 A;  4ZAI A;  3N52 A;  3J81 c;  4HJ5 A;  2I5L X;  1DM0 B;  2EJG C;  1R9T B;  3AQQ A;  3H09 A;  4FP5 D;  4QY7 A;  2JXM B;  4JI0 Q;  3KFU A;  3BVZ A;  3S16 H;  2OQK A;  4A75 A;  3NP8 A;  2OTL A;  1K0S A;  5ELC A;  1EYA A;  1HNZ L;  1NJI C;  2EYO A;  1I4P A;  2X69 A;  4U67 3;  5JJZ A;  2Z9H A;  3GQB A;  3QWN A;  1EQR A;  4K2K A;  4LWC A;  5IGF A;  1EIG A;  3UDF A;  1SSO A;  3CXC A;  1QVG A;  3U9S A;  3CCS A;  4FVM A;  2Q8I B;  1DGS A;  3C1E A;  4KN7 C;  2UUA Q;  5J22 A;  3L2P A;  3OYY A;  4LFB L;  5C3E H;  4GS3 A;  5CV6 A;  1LT5 D;  3J7A 5;  1XNQ Q;  1UE7 A;  3S1R H;  1TWH H;  4DK6 C;  2A8V A;  3D8G A;  1B3A A;  4R1J A;  5JJL A;  2HHH L;  1WTR A;  1LUZ A;  2KEN A;  1ZXT A;  2DY8 A;  1K3B C;  4G7Z C;  5HGT A;  1UWV A;  4R4C A;  3DWP A;  4AIM A;  1RDP D;  2IHE A;  3MFY A;  3D3R A;  1R9T H;  3KUP A;  3ERS X;  3OTO Q;  4F7X A;  3AYH B;  4HAE A;  3BDL A;  2N8N A;  1O78 A;  2A5H A;  4DV1 L;  4UP9 A;  3A0J A;  1VQA A;  3I4M B;  4I65 A;  2RCN A;  1WFQ A;  3CCQ A;  1MD2 D;  3L3O C;  1AFP A;  4DV4 L;  1VQJ A;  1I6V C;  4RGT A;  1NNX A;  4CJ1 B;  5BR8 Q;  1VQF A;  4GOP C;  4OEL B;  2O5J C;  3QR8 A;  1EU4 A;  2YU9 B;  1NMG A;  1VQE A;  3QOL A;  3SK6 A;  1QJO A;  4X3S A;  1WTV A;  1BUV T;  1L0X B;  2EY1 A;  4H02 A;  1NR2 A;  2EPB A;  1ASZ A;  4UY8 C;  2BE5 D;  3CKI B;  4BA2 I;  2OCE A;  3BDO A;  4ZUJ A;  1HTP A;  4J6H A;  3I70 A;  4LFA Q;  3X3N A;  1PH2 A;  4XDX A;  3SK8 A;  5FKA C;  1TQO A;  3V05 A;  5FO8 B;  1A2T A;  2CH4 A;  5M5Y B;  5FLM H;  1EY0 A;  2NBF A;  4JI0 L;  2EDG A;  4FF2 A;  1M4V A;  4P74 A;  4A3J H;  3T1H Q;  1EY6 A;  2BDO A;  1VQO A;  3R2T A;  3GTJ B;  2R7Z B;  1P8L A;  3QJY A;  4HID A;  3RZO B;  3DLL A;  2XWB B;  5EKI A;  2CW0 C;  2MNA A;  3BZC A;  5FLX L;  1BF4 A;  1HRJ A;  1B7Y B;  1VQN A;  2E76 C;  3W1G A;  3NTK A;  3WDN A;  5CGK A;  4LF8 Q;  5EBD A;  3I4M H;  3SR1 A;  4ZLT F;  2GN5 A;  3DM1 A;  1R4Q B;  2BOS A;  2OXP A;  3IFD A;  4BY1 H;  4JI1 L;  1K9M C;  2A74 C;  3HOZ G;  4DR2 L;  1ICW A;  3J80 E;  2UUA L;  2KEC A;  3TDQ A;  2VQF Q;  1Q81 C;  1TS5 A;  2YU9 H;  1TS2 A;  2A6H C;  1WTO A;  3OIP A;  4P72 A;  4TRD A;  1KQS A;  1MJE A;  2EYJ A;  4IJH A;  5K5P A;  4L5T A;  5EBC A;  1EYD A;  3I4N B;  3S1Q B;  3CPF A;  1C7Y A;  4YCV A;  4EVO A;  2IX1 A;  3D4W A;  1I4G A;  3P7J A;  4L5S A;  2F0O A;  1KTK A;  2NTT A;  3RN5 A;  3H3V C;  5CBE E;  4GOP B;  1Q7Y C;  5C0X J;  1JT8 A;  2R92 H;  2K6A A;  3HOZ B;  4P75 A;  3I3C A;  4KK7 A;  4UHV A;  2QDB A;  3OTO L;  2A6E C;  4B9W A;  2MUY A;  2RHQ B;  4IPD A;  1A2U A;  1SAP A;  5EPJ A;  4GLX A;  3FPU B;  3I73 A;  3GTJ H;  2R7Z H;  2QDL A;  3IL8 A;  3J7A F;  1B53 A;  3RZO H;  5FLX E;  3MEF A;  2B2V C;  4ZQ3 A;  2JA7 H;  4P71 A;  4DV7 Q;  5BR8 L;  1Z47 A;  2QF7 A;  1BKB A;  1TWG H;  5E1F A;  2JA5 G;  4GOP A;  1OXT A;  5IOD A;  5JEA H;  4WFN 3;  3HKS A;  3SK4 A;  1SJE D;  1KLG D;  1PTO H;  2H5X A;  1BVS A;  4LF6 Q;  4ID6 A;  1HHV A;  2B8F A;  1BO0 A;  2NN6 H;  4IPG A;  1OO9 B;  3OSO A;  1UEA B;  2WAQ E;  5D3I B;  3I7F A;  2NTS A;  1HR0 Q;  3KLR A;  5C4X G;  1HXY D;  4LFA L;  3UDX A;  4NXM Q;  2F3I A;  4PMB A;  2PNH A;  2NB0 A;  4XYQ A;  3S15 B;  1LO5 D;  3I4N H;  2G9H D;  4JI7 Q;  2RHS B;  3S1Q H;  3K58 A;  1HQR D;  4IUN A;  3FKI G;  2O4X A;  1FNW A;  1YNN C;  5E4X A;  3QOJ A;  1BCP F;  4C1N I;  1C9O A;  2A73 B;  3T1H L;  3MXN B;  2JA5 B;  2B29 A;  4JOI C;  4EX5 A;  5T1I A;  4NXN Q;  1F9R A;  3VA7 A;  4QGU A;  2K5V A;  3EQL C;  1I3Q B;  2L0C A;  4PNY A;  2WAC A;  1H9J A;  2EY5 A;  1WCM G;  2LS0 1;  3I56 A;  2B63 H;  1LT3 D;  4HSV A;  5ELE A;  2AKW B;  3MXG A;  4KD4 A;  4EQN A;  3Q22 A;  4MN3 A;  5IP9 G;  2JA6 G;  1I4R A;  4H44 C;  4YY3 Q;  1JIC A;  5AFW A;  3FKI B;  3KLW A;  1PH8 A;  2VQF L;  3G6E A;  2KHS A;  1X3Q A;  4QMG A;  5C4J H;  1RTN A;  2NVX B;  1J5E L;  3GTL B;  1GVP A;  3L9A X;  1W2B A;  4C3H G;  2M00 A;  4DNR B;  4K6D A;  1TY2 A;  3H94 A;  3MTS A;  1SNM A;  3Q6S A;  1KAW A;  4UPA A;  4GLV B;  3PUW A;  3CCU A;  2HCI A;  2R7F A;  1N36 Q;  4OIK A;  3VA5 A;  2NYZ D;  3FPP A;  1WCM B;  1NTG A;  3FRP B;  3HOX H;  1TS4 A;  1V1P A;  4XT1 B;  4LFC L;  1FNU A;  1JWS D;  4PMW A;  1U4P A;  1EZ6 A;  1EOV A;  2JP1 A;  4OIJ A;  2CKZ B;  1TWA H;  4LF5 Q;  4B3T L;  1AZQ A;  4MHE A;  2L12 A;  1ZKO A;  3D6C A;  1UUP A;  4DV6 Q;  1PRT F;  4FXK C;  3R3O A;  1NSN S;  2WIN B;  4C3J B;  1I3Q H;  1PH5 A;  2WB1 G;  1Q12 A;  2RKS A;  2YYZ A;  4DV7 L;  3JAM L;  3HOY B;  1SYF A;  5IYC H;  2BH2 A;  4GKJ Q;  1NBW A;  2F3W A;  4N8F A;  4DR3 Q;  4J1M A;  2IWH A;  1T5E A;  3NEM A;  4LF6 L;  5GQO A;  5LHY 1;  1SJH D;  1E0B A;  1F2Y A;  1PVO A;  2EQS A;  3K5N A;  1LTA D;  5KIX A;  4ODG A;  3E3X A;  2LMC B;  3H3V H;  1HR0 L;  4E6I A;  5H1S E;  1RTO A;  2NVX H;  1HCZ A;  1W3S A;  2K52 A;  2EYL A;  2EY6 A;  4JI7 L;  4X64 Q;  2K33 A;  2SNM A;  1WYD A;  3RLF A;  3JAM c;  1PDQ A;  1VDZ A;  1HFN A;  3M4O H;  5A35 A;  4H7B A;  1F77 A;  5LMU Q;  2E2J B;  4XQQ A;  4O0A A;  1G2S A;  2AMC B;  3C46 A;  2LY7 A;  1Q86 C;  4A93 G;  4JOI A;  3DWQ A;  3TBI B;  4KHZ A;  4K8J A;  2ZJQ A;  1X3F A;  4MZ9 A;  3PSI A;  2WKD A;  2D5D A;  1PH4 A;  3EJI A;  2B2T C;  1B70 B;  1X55 A;  5IWA Q;  4B3M Q;  3CD6 A;  1STH A;  4BY7 G;  1G6Z A;  4GLA C;  1LV9 A;  4QF4 A;  4YY3 L;  3HOY H;  1WTX A;  1QE6 A;  3T1Y L;  4A3G H;  4OX9 Q;  1V1Q A;  1OXV A;  2PW5 A;  3BVM A;  3SGI A;  2F3V A;  2WKC A;  2XTI A;  3CP0 A;  3VR2 A;  1WVL A;  3QO2 A;  3A54 A;  4BS9 A;  5JAV A;  4DAV A;  1WD0 A;  1QVF A;  1N36 L;  3A74 A;  3CC7 A;  3PV0 A;  3I90 A;  1CI3 M;  2XNA C;  2Q2I A;  1IYU A;  4DK3 C;  2VUM G;  2J4X A;  4LF5 L;  1O7Z A;  4C3I B;  1MIU A;  4KY5 A;  3KLS X;  2E2J H;  1SYG A;  3HOU B;  1XWE A;  2VS1 A;  2A68 C;  4DV6 L;  1MGS A;  5IGG A;  1A63 A;  2OEO A;  1AE2 A;  1Y69 U;  2UUB Q;  4KMU C;  3T51 B;  1CHQ D;  4A3E B;  1JB3 A;  3E6Z X;  1CSQ A;  5EAY A;  1N33 Q;  1WTP A;  2HDL A;  4K2L A;  2G5D A;  3A5Z B;  2A6H D;  4A3B G;  4BBS G;  4LK1 C;  2NN6 I;  4TSS A;  5K36 H;  4DXF A;  1FJG L;  1PFN A;  3K0X A;  1YJN A;  1STN A;  1QG7 A;  2K5W A;  1M90 C;  1O7I A;  1W6J A;  2B2W C;  3S1N H;  4DV3 Q;  1D5Z C;  3STB C;  1ENA A;  3PGZ A;  1L1O C;  1J8I A;  2Z6K A;  3FDT A;  4OGQ C;  5M5X B;  1O7Y A;  4AQY Q;  4UAI A;  5IGB A;  4K0K L;  2A6E D;  4PQX A;  3CRL C;  1G51 A;  2F0I A;  3CCJ A;  1KRS A;  1DON A;  4BBS B;  4XQJ A;  3GTM B;  5J39 A;  4C3I H;  1VQ8 A;  4JVZ A;  1IL8 A;  2NZO A;  3HOU H;  3CPW A;  1GD7 A;  1C8C A;  1I4Q A;  2VZA A;  5IWA L;  4B3M L;  1SE4 A;  1TKW B;  2B2Y C;  4IUV A;  1YNJ C;  4LAA A;  3HS0 C;  4A3E H;  4POF A;  2N3S A;  1ET9 A;  1LTL A;  3HP3 A;  1LTT D;  4JG2 A;  5ISR A;  2XSC A;  2DJG C;  3M4O B;  1B50 A;  4GNX C;  3DWA A;  2D62 A;  2KCN A;  5KEE A;  5KNB A;  4JI6 Q;  1DOL A;  4ME5 A;  3E9I A;  4FF3 A;  2F0S A;  1YNN D;  1CKO A;  3HEJ A;  1DYQ A;  4J15 A;  1JOO A;  2K5D A;  4DNT B;  4APV A;  1N34 Q;  1V43 A;  4N8X 1;  4ZYS A;  3K5L A;  1DOK A;  2GVB A;  1VMP A;  3SHL A;  1U9R A;  1PH3 A;  2FHT A;  2PNR C;  4Y52 H;  1ONL A;  1U4M A;  3SK5 A;  5FK9 C;  3PO2 G;  5I9P A;  1X6O A;  3L0O A;  2CH4 W;  2F4V Q;  4OO1 G;  4KLK A;  5JVH 3;  1BQQ T;  4JBW A;  1ESF A;  4HR7 B;  1UE1 A;  2F0D A;  3GTM H;  4QUF A;  1GUN A;  4HJ7 A;  4DAY A;  2RF4 A;  4PZ7 A;  4JPB W;  1L1O B;  1MSH A;  1N33 L;  1Y1W B;  4A3L G;  2F0N A;  4AYB B;  2H4O A;  4IO9 A;  3H3V I;  1Y1V H;  3D4R A;  1YEZ A;  1PZK D;  2ICI A;  4RH6 A;  2UU9 Q;  4B3R L;  1QVC A;  1S5B D;  3TZU A;  3F2U A;  5I2Y A;  1N32 Q;  1CKN B;  1NAP A;  2KEE A;  5EJW A;  3R93 A;  2L1B A;  3VR3 A;  4DV3 L;  4LW1 A;  4ALP A;  3C1F A;  4POG A;  2R93 H;  2Y0S G;  4J8Q A;  4ZUI A;  3J7Y W;  2ZJP A;  1VQ6 A;  1TR5 A;  1H95 A;  2J7Z A;  2RCF A;  1PA6 A;  1Y8O B;  4AQY L;  1H9R A;  3H0G H;  1FL0 A;  2F0W A;  1XTD A;  1BBU A;  3G48 A;  1MHW C;  4CBV A;  2SDF A;  2F0M A;  4OXP A;  1PFM A;  1CKM A;  2LFN A;  3RMH A;  2ZTE A;  1SMY C;  5EKL A;  4XT3 B;  1CKN A;  2V1C C;  4ZKC B;  5IT9 E;  4KY6 A;  1EL0 A;  4GNX B;  5JOB A;  5FOB B;  2B3G A;  5FJ8 H;  1D8L A;  3GTG H;  2WFW A;  2DNE A;  1D1I A;  3RLO A;  4F8M A;  1D5M C;  3D4D A;  2F0V A;  4QIW B;  5LMN Q;  5IOC A;  3GTP B;  1YHQ A;  3HKZ G;  2Y0S B;  2EJF C;  3CC2 A;  2L11 A;  1X9N A;  5IYD G;  1SNO A;  4IUU A;  1P16 A;  2SEB D;  3GTQ B;  3D31 A;  1Y1W H;  4HN7 A;  1WJJ A;  1UNS A;  3KBX A;  4NPS A;  3J81 E;  3OOC A;  4HIK A;  1XPR A;  4JI6 L;  4GNX A;  4A3K G;  1F9Q A;  2ZTC A;  1TU2 B;  3KF8 B;  4BXX G;  1X65 A;  3RLN A;  3S9W A;  1EY8 A;  4ULL A;  2PZU A;  1XMO Q;  5AJ3 L;  3TS2 A;  3UE0 A;  4RAU C;  4RHR A;  5KND A;  1KNA A;  3K7A B;  4R8N A;  4B9X A;  1STB A;  2MO0 A;  1QNK A;  3HZX A;  1CT1 D;  3PIP A;  4OWW B;  1SE2 A;  2F4V L;  1EUJ A;  1PMR A;  2HT1 A;  3LGJ A;  3KF8 A;  2XWJ B;  2HD3 A;  2FXQ A;  4JI3 L;  3CME A;  4JC0 A;  1EWI A;  2K5Q A;  5JPM C;  3PF5 A;  1CK1 A;  1O7L A;  2HUG A;  1BCP C;  3KF6 B;  3GTP H;  1WTQ A;  1JB7 A;  2WAQ G;  3S24 A;  4DV2 L;  3TME A;  4HTH A;  2K1B A;  3HFZ B;  4YWK A;  3GTO B;  4A3F G;  3DEO A;  3DUZ A;  4ZCK A;  3EIV A;  2UU9 L;  2K4K A;  3GTQ H;  2FMC A;  2SNS A;  3T13 A;  1B9M A;  3TP8 A;  4EGV A;  2OF1 A;  1XPU A;  4DNI A;  1I4X A;  3M7N A;  4PZ8 A;  3PUY A;  3FHW A;  2ES2 A;  3NPP A;  3SE0 A;  1IBK Q;  2RDG A;  3KF6 A;  2X6G A;  4A3C G;  2UXC Q;  2XRS D;  1SN8 A;  2I0Q A;  1VQG A;  2AQ3 B;  2K7V A;  1VQL A;  2B39 A;  2ICE C;  3K7A H;  1QZG A;  2V4D A;  4IPH A;  3W2D A;  3CF5 A;  1AE3 A;  2A68 D;  5M3M G;  5C4Z A;  4JBM A;  2K50 A;  3ND8 A;  2FMM A;  1WTH A;  2F03 A;  1GHK A;  4DR1 Q;  4A3F B;  1STA A;  1YI2 A;  1HR0 W;  1RJT A;  1UEB A;  3LWU A;  4M8A A;  4X3K A;  4HMI A;  3BG3 A;  1TXY A;  5IP7 G;  3PIO A;  2EZV A;  5LMN L;  4IUR A;  1ROD A;  4IFD G;  2DUD A;  4GN4 B;  3V96 A;  2FIN B;  4QJF A;  2EYP A;  3H91 A;  5JEA G;  1K8G A;  1SDF A;  1K0R A;  4DKA C;  2OT2 A;  4PMC A;  4MTK A;  4XIG S;  4CKC A;  4JI5 Q;  1PRT C;  2EIF A;  3M7G A;  3STB D;  1JC7 A;  3KJP A;  4G7H C;  1QCB D;  2FFK B;  1C48 A;  1GUS A;  2J0T D;  3WOF A;  3M4Y A;  1D5X C;  4Q5V A;  1S5E D;  1AW7 A;  3LNN A;  2JEA I;  4OHJ A;  4KI0 A;  5C5M A;  5CV8 A;  3G6J B;  1HJP A;  3L7Z C;  2M2L A;  1LT4 D;  1BCP B;  1EFI D;  4JI8 Q;  5I6Y A;  1XNQ L;  2HCC A;  5IY0 A;  3PMF A;  4C56 C;  4DU9 A;  3BJU A;  2ZJR A;  2XVS A;  5IIF A;  3ERO A;  2AWO A;  2F0F A;  3MEH A;  3UDG A;  5EPL A;  4IUQ A;  1V9P A;  1GUO A;  3P1H A;  3I91 A;  3VYR A;  5M5Y H;  4RFB A;  1VQP A;  5M3F G;  5ELD A;  4KN4 C;  5BN5 A;  1LAC A;  3AB9 A;  2N88 A;  2X6L A;  3X3M A;  1F9S A;  2BDN A;  3NHH A;  1E3P A;  4LUO A;  3FVQ A;  3LX0 A;  4IZ8 A;  5C6A A;  3M3Y B;  3F8T A;  3NXW A;  3DHQ A;  1ZYR C;  5IGE A;  2NVT B;  1STE A;  2KQ3 A;  3PUV A;  3PO3 G;  3K59 A;  1AP0 A;  3A7L A;  1LTI D;  2VL6 A;  3AFP A;  3HG9 A;  1A3T A;  1X3P A;  2E8G A;  3TQY A;  1MSG A;  1VS0 A;  1JE5 A;  5M3F B;  1MBY A;  1SRU A;  2NVQ B;  3N6R A;  4RG1 A;  3ND9 A;  1HZC A;  4DR1 L;  1F2M A;  1PRT B;  3OMG A;  4DGZ A;  2EJM A;  1V1O A;  4MTN A;  4UP8 A;  4YWM A;  4OON A;  3PIP 3;  5C3W A;  1GUG A;  4CKB A;  3CAM A;  2D0P A;  3GV3 A;  3HOZ H;  1HNW Q;  5IYB G;  4BBR G;  1SYC A;  1GXD C;  5GAD C;  4JI5 L;  4LF8 L;  2F4I A;  1IL2 A;  5C4X B;  4K8I A;  3BYY B;  4FNF A;  1G91 A;  4X66 Q;  5COR A;  1KXL A;  5I2X A;  3FP9 A;  4Q0F A;  1E2W A;  3TRZ A;  3I72 A;  4FDB A;  1KDC A;  3MXN A;  4HIM A;  1XJV A;  1LTG D;  2PMZ B;  1RIP A;  3M3Y H;  4DUZ Q;  2NVT H;  2NUC A;  5J3B A;  1FGU A;  3F2D A;  1SMY D;  3M4P A;  3NEN A;  1ZEQ X;  1SEB D;  2PZW A;  1U5K A;  4TKO B;  1S5D D;  2IHF A;  4KHV A;  2E2H B;  5C44 G;  3D0F A;  3S15 H;  1A6X A;  2NVQ H;  4R4T A;  5C0X I;  3HGB A;  1TWF B;  1YHB A;  2KCT A;  3AFQ A;  2KCM A;  4WJ4 A;  2JA6 B;  4KY7 A;  2PQA B;  2D2C C;  5EGT A;  5ELO A;  1IBL Q;  3MC0 B;  2KUM A;  3D6W A;  3BS1 A;  1L0W A;  1RD9 D;  2F0J A;  3TP5 A;  2JA5 H;  3TSS A;  4FF4 A;  1VQ4 A;  5HY6 A;  1I94 Q;  2KHJ A;  3U50 C;  4C1N K;  4DK0 A;  4C3H B;  2K04 A;  3VR5 A;  5IGD A;  3PIO 3;  1NCV A;  2B2V A;  1WI5 A;  1GJX A;  5C4X H;  3SDZ A;  3CC4 A;  3HOV G;  1PYW D;  1U4R A;  1J9O A;  4K5X A;  4O2D A;  3GO5 A;  2Q2H A;  4A3M G;  5E3F A;  4ABN A;  3URY A;  1HZ9 A;  2YV5 A;  1E2Z A;  1WOC A;  3OIQ A;  1ILP A;  1JWM D;  3FKI H;  4NDX A;  1VQ5 A;  3PCO B;  2ATW A;  4NXM L;  4IFD J;  4K5W A;  5E4W C;  3GTL H;  1FVI A;  4Y7N B;  5JEA J;  4A3I G;  2MQH A;  1EWC A;  1RCV D;  2WB1 B;  1BCP D;  2VW9 A;  3J7A V;  2E2H H;  5F2D A;  2KBN A;  4WRD A;  4DN4 M;  4X3U A;  1WCM H;  3J80 i;  2B8G A;  1B8A A;  1TWF H;  2Q2U A;  1IKL A;  3OW7 A;  4NXN L;  5IP9 H;  2JA6 H;  3AMU A;  4A3M B;  1HNW L;  4ZRZ A;  1VQM A;  1T9H A;  1W6K A;  2VY3 A;  4WJW A;  1PV4 A;  1ESR A;  4DR6 Q;  3HOW G;  4N9P A;  3E9H A;  3VDY A;  2AQ1 B;  2G9D A;  4C3J H;  4X66 L;  4HJ9 A;  3OHX C;  4C3H H;  2L4N A;  3T16 A;  3JAM E;  1I4H A;  4QL5 A;  1LYL A;  3MFG A;  1Y8N B;  5BN4 A;  5JVG 3;  2AHO B;  4ME3 A;  2MHV A;  1JCK B;  2Q2T A;  1FYC A;  2KJX A;  1PXU A;  3KYH C;  1B9N A;  2I5H A;  3ZYY X;  1DCZ A;  1YIJ A;  4FF1 A;  4L63 B;  2JQO A;  2RSN A;  4A93 B;  3EA6 A;  3Q0A A;  1N8R C;  1DZ1 A;  5CYU A;  3RZD B;  4QUC A;  4X62 Q;  3GV6 A;  3SEB A;  1K8O A;  2QEJ C;  4QQB X;  3KDF B;  4LUV A;  2IX3 A;  4Y7N H;  4KKT A;  3NWS A;  3O13 A;  4FXG C;  4BY7 B;  5M9O A;  2TSS A;  5FO9 B;  4HJA A;  2CW0 D;  1IBL L;  1CTM A;  4IJL A;  3BZD B;  5I6W A;  1PRT D;  2SOB A;  1M8A A;  1I94 L;  4NMZ A;  4YHH Q;  1A15 A;  2UUC Q;  3KDF A;  3KBG A;  4JYA Q;  2N49 A;  3NK9 A;  1XNR Q;  2F0P A;  4GKJ L;  1PH1 A;  4DR3 L;  1F9P A;  1NE3 A;  3K81 C;  5TSS A;  1KDA A;  3E0E A;  1S5C D;  2RBM A;  2R7D A;  4RCO A;  1YJW A;  1DOM A;  3NQI A;  2B2U C;  1EOT A;  1IBM Q;  1LLR D;  2ZTD A;  1A8V A;  2WII B;  3EVQ A;  1A0I A;  2VUM B;  2KVM A;  1SYE A;  3Q24 A;  3K0Y A;  2HIV A;  2JK8 A;  2KCC A;  4QCL A;  1C4Q A;  1H9M A;  2JA8 G;  4DR5 Q;  1SE8 A;  1TII D;  1EIF A;  4X64 L;  4A93 H;  2VB3 X;  4KTA A;  4A3D G;  3RZD H;  1JWU D;  5EKK A;  1E1O A;  3GD7 A;  4A76 A;  4BA1 I;  1SLJ A;  5GAH C;  3CCV A;  2XN9 C;  5LMU L;  3TZD A;  4DV5 Q;  1QUQ B;  2M9V A;  3NQT A;  4DAM A;  1PH9 A;  2PQE A;  3CQZ B;  4A3B B;  1JR0 D;  4BY7 H;  2TMP A;  1BBW A;  3TEH B;  1YNX A;  2E75 C;  2I07 B;  2PZT A;  3IRB A;  2KOL A;  4DUY Q;  4DR6 L;  1B4O A;  4OEM B;  2F0L A;  1GO3 E;  2B2T A;  1LT6 D;  5M5W B;  2HIX A;  1SFO B;  2QEX A;  1SRO A;  2XGT A;  1B2T A;  2RDH A;  4OX9 L;  1SXT A;  5LMN W;  3ULP A;  1Q3L A;  1G8Z D;  2K28 A;  1I5F A;  4F87 A;  1B44 D;  3K5M A;  5I4D A;  2E74 C;  1D2B A;  1U0L A;  3BVG A;  4DXG A;  4FYD A;  2VUM H;  2F0T A;  4YWL A;  4X62 L;  4DR7 Q;  4NW2 A;  1N9W A;  1UE6 A;  1HNZ Q;  4L5R C;  1AN8 A;  1PYB A;  3U4V A;  3T53 B;  1Q82 C;  2CFM A;  4CDF C;  1EQT A;  1AZP A;  3A8J E;  3OWE B;  4B3S Q;  1TWC B;  5M5X H;  5BN3 A;  1NR4 A;  5KYI A;  5C3X A;  2IX0 A;  4DK1 A;  3P20 A;  3MVV A;  4LF7 Q;  2CCZ A;  3ZJY C;  4EQ5 A;  1VCI A;  2MP1 A;  2QA4 A;  4A3B H;  4BBS H;  3OMC A;  3CQZ H;  4CDE C;  5CV9 A;  2O5I C;  3K6O A;  5DLQ E;  2UUC L;  4HSP A;  2UUB L;  4JYA L;  1L2F A;  4RGM A;  1XNR L;  2R3Z A;  1VQK A;  5CBA E;  5GRO A;  3GDE A;  2ZXR A;  2I5M X;  3ONA B;  3C3L A;  4Z9C B;  2JN4 A;  2MJ8 A;  5M5W H;  1SFO H;  3UE1 A;  2HHH Q;  5L37 A;  2DJF C;  1IBM L;  5C3E G;  3PUZ A;  4PV1 C;  2H1E A;  1SND A;  2C9O A;  2MGS A;  4LMQ D;  3PO2 B;  3CCR A;  5D65 A;  2B2W A;  3H15 A;  3DMU A;  4DR5 L;  2JA9 A;  5GAG C;  5JJK A;  4DV1 Q;  1L1O A;  4RA8 A;  3T56 B;  2R61 A;  2UXB Q;  2EYH A;  1CA5 A;  4DA2 A;  2RSO A;  1GKH A;  4DV4 Q;  1HUM A;  1VF7 A;  3RN2 A;  1TWC H;  3UDI A;  3S1M B;  2UXD Q;  4RKL A;  1V8Q A;  1Q1E A;  5C3E B;  1GOZ A;  1B3Q A;  3QG1 A;  1E24 A;  4DUY L;  1HQM C;  4TVA B;  4BWG B;  1ASY A;  1VQ9 A;  1GM5 A;  1TWH B;  1HNX Q;  4JBJ A;  3MXU A;  4ZKB B;  2HDM A;  2B2Y A;  1HH2 P;  5HGQ A;  3K57 A;  2DY7 A;  4DFA A;  1LTB D;  2RVL A;  3RR5 A;  4M1U B;  2DN8 A;  1CA6 A;  5EPK A;  1I6H B;  2F0H A;  1S4Z A;  1Y14 B;  2K01 A;  1D7Q A;  4YCW A;  3NSW A;  5FO7 B;  2PW7 A;  3W5O A;  1EZ8 A;  3MHB A;  1K28 A;  3PO2 H;  4DR7 L;  2L55 A;  4RCN A;  3K80 C;  3R8B A;  4OO1 H;  1N34 L;  1SMX A;  2KED A;  5CV7 A;  4A4I A;  5FLM G;  4HED A;  3NBH B;  4YIJ A;  4B3S L;  1ET6 A;  3HKZ B;  4A3J G;  1EYG A;  2OQ0 A;  4RHS A;  4DV0 Q;  1S5F D;  2PO4 A;  1PZI D;  4JI1 Q;  4LF7 L;  3A8I E;  1TVX A;  4IOC A;  1PFB A;  4DR2 Q;  4A3L H;  1JQY D;  3JC6 6;  2C35 B;  5GAE C;  1SE3 A;  3S1M H;  2C5C A;  1PH6 A;  2N78 A;  1E2V A;  1KHI A;  4L5Q A;  4A3K B;  3I4M G;  1Z6H A;  3F1Z A;  2MFI A;  5C0X H;  4BY1 G;  4JCV E;  3NBH A;  3F2B A;  5J1Z A;  3WWV A;  3NUC A;  1PTO C;  3S14 B;  1YVC A;  1FR3 A;  2K03 A;  3ER0 A;  4A3J B;  3J7Z C;  3A8K E;  2FJ2 A;  1JMC A;  2A19 A;  1SNP A;  1SR3 A;  1N32 L;  2VQE Q;  4CDD C;  4AYB E;  2QW7 A;  1I6H H;  4C2M B;  1SYD A;  1KIX A;  3K7U C;  1UAP A;  4IOA A;  3EN2 A;  2LXJ A;  2PPB C;  1MKH A;  3A55 A;  2UXB L;  1FD7 D;  2JE6 I;  4BY1 B;  2ZXO A;  2R92 G;  1HA5 A;  5ELN A;  1QOH A;  2K14 A;  1DJR D;  1XMQ Q;  2WAQ B;  2Z4I A;  1HA6 A;  2EYF A;  3J80 L;  5IYD H;  2UXD L;  2E2I B;  2NWG A;  4CKE A;  2CQA A;  2R7Z G;  1PH7 A;  3NWT A;  2CVR A;  3TN2 A;  3ERQ A;  2Z0S A;  2RQX A;  2JA7 G;  5NUC A;  1HNX L;  1QNU A;  2L9H A;  4RGN A;  1Z9F A;  4A3K H;  1STY A;  3IFT A;  2VXW A;  1YJ9 A;  4BXX H;  5KRU A;  3SVM A;  4G7O C;  3CU7 A;  4R8I A;  1MI2 A;  2EYM A;  4QIW E;  2AQ2 B;  4I7Z C;  2NN6 G;  2Q8T A;  4U68 A;  2R92 B;  2PYK A;  2K05 A;  1BDO A;  3S14 H;  1JJG A;  2Y0S E;  3GTO H;  3J80 c;  3RNU A;  2GA4 B;  1YZ6 A;  4CDC C;  5M3M B;  4KV6 A;  3I4N G;  4IQZ A;  4IUT A;  1XMO L;  1M1K C;  4C2M H;  4NP5 A;  1L0Y B;  1HPC A;  3I55 A;  2D0O A;  2JA7 B;  1EY4 A;  3PUX A;  2O2L D;  2RDF A;  1KAB A;  1TWG B;  1A3V A;  1YIT A;  1LTR D;  3TRE A;  4DV0 L;  1ENC A;  2YTX A;  2LKV A;  4IN3 A;  4DPG A;  3VYS A;  4H13 C;  1D1K A;  1PTO B;  1X32 A;  4QB4 A;  1XXG A;  3DXJ C;  4DAP A;  2N55 A;  4MIU A;  1RF2 D;  3HKZ E;  3QIA A;  1F2L A;  1YNJ D;  4A3F H;  2E2I H;  3WOE A;  2B63 G;  4L8J A;  1IW7 C;  1J5E Q;  4XTC S;  2VB2 X;  2MO1 A;  3BU2 A;  1ICF B;  3PF4 A;  2LSS A;  2WV6 D;  5FLX c;  3S17 B;  1JJ2 A;  2YTV A;  4A3C H;  4JV5 Q;  5JJI A;  3KK7 A;  4IAL A;  2VQE L;  4LFC Q;  4IUP A;  1TS3 A;  4HIO A;  3J81 j;  2PCF B;  4OL7 A;  1EYC A;  3CCE A;  1KNE A;  3E0J A;  4B3T Q;  2ALY B;  1IBK L;  5M3M H;  3GTK B;  1D6E C;  2XRQ D;  3BDC A;  2UXC L;  2B63 B;  3HOX G;  4WOR A;  4RGO S;  5KYL A;  3OWF A;  3BYT B;  2K5N A;  5IP7 H;  1CZW A;  1XMQ L;  2F1M A;  3SXH A;  2CWP A;  4IFD H;  1KL9 A;  5DM6 3;  3E5S A;  3J81 i;  5C4J B;  3EFX D;  1GUW A;  5LL6 X;  1VQC A;  4FXD A;  4KD3 A;  2IT1 A;  2F0Q A;  1U4L A;  5IYC G;  4KKS A;  1A3U A;  2QKI C;  1PTO F;  3PO3 B;  1RHP A;  4XYO A;  2EE1 A;  2KA7 A;  3TP6 A;  1FNV A;  3HOX B;  4V19 0;  1JOK A;  3T4A C;  4FO2 A;  4ZK9 B;  3S17 H;  3I8Z A;  2BA0 A;  2JYO A;  1NMF A;  4HJ8 A;  3ITP A;  2GVA A;  4AH6 A;  5D14 A;  1TWA B;  1STG A;  5E7N A;  4OO1 I;  1CUK A;  2EXD A;  3M85 A;  4RMF A;  1F2Z A;  5ELF A;  3NEL A;  2Z8L A;  1BBX C;  4GKK Q;  3CRK C;  1X3E A;  4EQO A;  3GTK H;  1EQQ A;  4JI8 L;  3RUZ A;  1X56 A;  1JOQ A;  5T1G A;  3F2C A;  1Z7T A;  1LM0 A;  4KJN A;  4CHT B;  4BBR B;  1DXM A;  4XXE A;  1K8A C;  3A7A B;  3U9O A;  4DF7 A;  5M3F H;  1H9K A;  1V1P B;  3T1Y Q;  2JSO A;  3G7L A;  1HFG A;  5IE8 A;  1SBB B;  4F88 A;  1SNC A;  2E5L Q;  1VQ7 A;  2BCO A;  2CQO A;  1IKM A;  4K14 A;  1Q90 A;  1FGB D;  4R4I A;  5DM7 3;  4C3J G;  3P75 A;  3Q8D A;  1WD1 A;  1PLF A;  1CM9 A;  2CHB D;  1G6P A;  2F52 A;  3EBE A;  4P2C B;  3HOY G;  4KHP Q;  4V0B A;  2JEB I;  5KNC A;  4A3G G;  1C0A A;  4S3S A;  4N9T A;  5CC4 A;  3IKJ A;  3PO3 H;  2Z4H A;  2A69 C;  3TS0 A;  3U58 A;  4JV5 L;  1QIL A;  1ILQ A;  1QZH A;  1IZ6 A;  5JPN C;  4ILW A;  1EY7 A;  2EXZ A;  4R4O A;  4OWT B;  1OTC A;  4LF9 Q;  1EIH A;  5C44 B;  1CFM A;  3AEV A;  1KAA A;  2PQA A;  1XYI A;  1X3G A;  3ULL A;  1K73 C;  1HZB A;  2Q8R E;  2IPK D;  3PQI A;  4JI2 Q;  3I2Z A;  1K3R A;  1XPO A;  2CWA A;  4HCS A;  3VR4 A;  2Z6B A;  1YBY A;  4DR4 Q;  3M4Q A;  1T5X D;  1PYS B;  4A3G B;  1QB5 D;  4O42 A;  3VYT A;  2NZH A;  3BZK A;  3W1B A;  3KJO A;  2ZT9 C;  5CMD A;  5IYB H;  4BBR H;  3VYU A;  1EEF D;  1RL2 A;  1FJG Q;  4KKU A;  2HQE A;  2MPM A;  1RKN A;  3S2D B;  1SNQ A;  3HOV B;  1PTO D;  3IAY A;  2ZM6 Q;  1DD2 A;  2D9U A;  4PZ6 A;  1EQV A;  2Z6K C;  5K36 G;  2A1A A;  1K8M A;  1NUC A;  1CQV A;  3ICE A;  3Q23 A;  4H0L C;  2DGY A;  2ZXP A;  4HCE A;  3CHB D;  3FEW X;  4K0K Q;  3ULJ A;  1KRT A;  4A3I B;  1HTL D;  4TQU S;  1XX8 A;  3DM3 A;  3NBI A;  3R2I A;  2ID0 A;  3MZ5 A;  4CJ0 B;  5C44 H;  1IXR A;  4GKK L;  4UP7 A;  2AUJ D;  4DUZ L;  1E22 A;  3K5O A;  3M9B A;  5CV5 A;  3S2H B;  4RKB A;  4LUZ A;  3KOJ A;  2PMZ E;  1CHP D;  4WJ3 M;  3H6M A;  3CMA A;  1WTW A;  3HOW B;  5DEH A;  3CCM A;  1BOS A;  4C3I G;  4X6A H;  2EY2 A;  3HOU G;  2E5L L;  3W3A A;  2KHI A;  2QIL A;  3S1N B;  1AH9 A;  1EY5 A;  2IL8 A;  3HRZ C;  4R4Q A;  5D3D A;  3VR6 A;  3LWE A;  4A3E G;  2NVY B;  3S2D H;  4KJO A;  1B1Z A;  3HOV H;  4KHP L;  1TT2 A;  1BR9 A;  1G29 1;  1AEX A;  2E2D C;  2F0E A;  4A3M H;  2AWN A;  2P5Z X;  3CW2 C;  4JK1 C;  4I7A A;  4CGY B;  1BXT A;  1JJC B;  2F0K A;  2ENB A;  4LF9 L;  4GZY C;  2BE5 C;  4LF4 Q;  1K83 B;  1CQF A;  3MA2 B;  4A3I H;  4JBK A;  2K75 A;  2EVB A;  1I50 B;  1UE5 A;  4JI2 L;  4JI4 Q;  1Q8K A;  5IGC A;  4IFD I;  5G3L F;  3NTI A;  4DR4 L;  2DNC A;  2JJQ A;  2BH8 A;  3S2H H;  1EIY B;  1O80 A;  3I4L A;  4L6T B;  2ASB A;  2PI2 A;  1IW7 D;  1VF5 C;  3HOW H;  4B3R Q; 
#chains in the Genus database with same CATH homology
 2IW3 A;  5COY A;  2K32 A;  1II3 A;  1TY0 A;  4O1N A;  3UI2 A;  1G2T A;  5C5L A;  4NKL A;  4EQP A;  5ELB A;  4R9W A;  3MWY W;  1ZYR D;  2RA4 A;  1XTC D;  2JA8 B;  2I46 A;  2Z1C A;  1LTS D;  3C2P A;  3TP7 A;  4A3D B;  1JOR A;  2IJ0 A;  1IYV A;  4CJ2 C;  1Q8I A;  1R4P B;  2R6G A;  3NE5 B;  1EY9 A;  4RWS C;  1BNZ A;  1EEI D;  1Y1V B;  4UDU C;  5A2Q L;  1Y8P B;  4K5V A;  5KGU A;  2EOT A;  4HMJ A;  4LJZ C;  2R93 B;  1H9S B;  1SYB A;  4K6L A;  5DNF A;  1HUN A;  5I9O A;  5HUR A;  5C4H A;  1VMC A;  3H0G B;  1QWY A;  3A56 A;  2NZ1 D;  5CR3 A;  1KDB A;  2WP8 J;  2BA1 A;  1EWH A;  3GP7 A;  1LAB A;  3KLS A;  4X3T A;  1H9S A;  5IT9 L;  3S16 B;  3GTG B;  1OXU A;  2B2U A;  5EQ0 A;  5G3L D;  3DEP A;  4G57 A;  2VNU D;  3OPO A;  2L5T A;  2F0G A;  1JE4 A;  2XIW A;  1ML0 D;  2F0U A;  5LL6 S;  3FMC A;  1EU3 A;  5DAU A;  3V2T A;  5A2Q E;  3J81 L;  3NTH A;  1ENF A;  5C0X G;  5CV4 A;  1PZJ D;  4B08 A;  1OXX K;  2AUK A;  2A69 D;  3QB3 A;  4XQN A;  1CZG A;  1GHJ A;  1KLU D;  1OXS C;  3S1R B;  3AU7 A;  1IHZ A;  3RD4 A;  1GUT A;  1Q1B A;  3MXP A;  2QCP X;  4G4K A;  3MAQ A;  4ZAI A;  3N52 A;  1DM0 B;  2EJG C;  1R9T B;  3H09 A;  4FP5 D;  2JXM B;  3BVZ A;  3NP8 A;  5ELC A;  1EYA A;  2EYO A;  1I4P A;  2X69 A;  4U67 3;  5JJZ A;  3GQB A;  3QWN A;  4K2K A;  5IGF A;  1EIG A;  1SSO A;  3U9S A;  4FVM A;  2Q8I B;  3C1E A;  4KN7 C;  5J22 A;  5CV6 A;  1LT5 D;  3D8G A;  1B3A A;  1WTR A;  1ZXT A;  2DY8 A;  4G7Z C;  5HGT A;  3DWP A;  1RDP D;  3MFY A;  3D3R A;  3KUP A;  4F7X A;  4HAE A;  3BDL A;  1O78 A;  2A5H A;  3I4M B;  4I65 A;  1MD2 D;  3L3O C;  1AFP A;  1I6V C;  4RGT A;  4CJ1 B;  2O5J C;  1EU4 A;  2YU9 B;  3QOL A;  3SK6 A;  1QJO A;  4X3S A;  1WTV A;  1BUV T;  1L0X B;  2EY1 A;  1NR2 A;  2EPB A;  2BE5 D;  3CKI B;  4BA2 I;  3BDO A;  4ZUJ A;  1HTP A;  4J6H A;  3I70 A;  3X3N A;  4XDX A;  3SK8 A;  5FKA C;  1TQO A;  3V05 A;  5FO8 B;  1A2T A;  5M5Y B;  1EY0 A;  2NBF A;  2EDG A;  4FF2 A;  1M4V A;  1EY6 A;  2BDO A;  3R2T A;  3GTJ B;  2R7Z B;  3QJY A;  3RZO B;  2XWB B;  5EKI A;  2CW0 C;  5FLX L;  1BF4 A;  1HRJ A;  2E76 C;  3NTK A;  3WDN A;  5CGK A;  5EBD A;  3SR1 A;  4ZLT F;  3DM1 A;  1R4Q B;  2BOS A;  2OXP A;  3IFD A;  2A74 C;  1ICW A;  3J80 E;  2KEC A;  3TDQ A;  1TS5 A;  1TS2 A;  2A6H C;  1WTO A;  3OIP A;  4TRD A;  2EYJ A;  5K5P A;  5EBC A;  1EYD A;  3I4N B;  3S1Q B;  2IX1 A;  4EVO A;  3D4W A;  1I4G A;  3P7J A;  2F0O A;  1KTK A;  2NTT A;  3H3V C;  5CBE E;  5C0X J;  2K6A A;  3HOZ B;  3I3C A;  4KK7 A;  2QDB A;  2A6E C;  4B9W A;  2MUY A;  1A2U A;  1SAP A;  5EPJ A;  3FPU B;  3I73 A;  3IL8 A;  3J7A F;  1B53 A;  5FLX E;  2B2V C;  4ZQ3 A;  1Z47 A;  2QF7 A;  5E1F A;  1OXT A;  5IOD A;  5JEA H;  4WFN 3;  3SK4 A;  1SJE D;  1KLG D;  1PTO H;  4ID6 A;  1HHV A;  2B8F A;  1BO0 A;  2NN6 H;  1OO9 B;  3OSO A;  1UEA B;  5D3I B;  2NTS A;  3KLR A;  1HXY D;  4PMB A;  2NB0 A;  4XYQ A;  3S15 B;  1LO5 D;  2G9H D;  3K58 A;  1HQR D;  4IUN A;  2O4X A;  1FNW A;  1YNN C;  5E4X A;  3QOJ A;  1BCP F;  4C1N I;  2A73 B;  2JA5 B;  5T1I A;  1F9R A;  3VA7 A;  3EQL C;  4PNY A;  1I3Q B;  2L0C A;  2WAC A;  1H9J A;  2EY5 A;  2LS0 1;  1LT3 D;  4HSV A;  5ELE A;  3MXG A;  4KD4 A;  4EQN A;  3Q22 A;  4MN3 A;  1I4R A;  4H44 C;  1JIC A;  5AFW A;  3FKI B;  2KHS A;  1X3Q A;  4QMG A;  1RTN A;  2NVX B;  3GTL B;  3L9A X;  4C3H G;  2M00 A;  4DNR B;  4K6D A;  1TY2 A;  3H94 A;  3MTS A;  1SNM A;  3Q6S A;  3PUW A;  2HCI A;  4OIK A;  3VA5 A;  2NYZ D;  3FPP A;  1WCM B;  3FRP B;  1TS4 A;  1V1P A;  4XT1 B;  1FNU A;  1JWS D;  4PMW A;  1U4P A;  1EZ6 A;  2JP1 A;  4OIJ A;  1AZQ A;  4MHE A;  2L12 A;  1ZKO A;  3D6C A;  1UUP A;  1PRT F;  4FXK C;  3R3O A;  1NSN S;  2WIN B;  4C3J B;  1Q12 A;  2RKS A;  2YYZ A;  3JAM L;  3HOY B;  1SYF A;  2F3W A;  4J1M A;  2IWH A;  1T5E A;  5LHY 1;  1SJH D;  1E0B A;  1F2Y A;  3K5N A;  1LTA D;  5KIX A;  4ODG A;  2LMC B;  4E6I A;  1RTO A;  1HCZ A;  2EYL A;  2EY6 A;  2K33 A;  2SNM A;  3RLF A;  1PDQ A;  1VDZ A;  1HFN A;  5A35 A;  4H7B A;  1F77 A;  2E2J B;  4XQQ A;  1G2S A;  3C46 A;  2LY7 A;  3DWQ A;  3TBI B;  4KHZ A;  4K8J A;  2WKD A;  2D5D A;  3EJI A;  2B2T C;  1STH A;  1G6Z A;  1LV9 A;  4QF4 A;  1WTX A;  1QE6 A;  1OXV A;  2PW5 A;  3BVM A;  2F3V A;  2WKC A;  3VR2 A;  1WVL A;  3QO2 A;  3A54 A;  4BS9 A;  5JAV A;  4DAV A;  1WD0 A;  3PV0 A;  3I90 A;  1CI3 M;  2XNA C;  1IYU A;  2J4X A;  1O7Z A;  4C3I B;  4KY5 A;  3KLS X;  1SYG A;  3HOU B;  1XWE A;  2A68 C;  1MGS A;  5IGG A;  2OEO A;  1Y69 U;  4KMU C;  3T51 B;  1CHQ D;  4A3E B;  1JB3 A;  3E6Z X;  1WTP A;  2HDL A;  4K2L A;  2A6H D;  4LK1 C;  2NN6 I;  4TSS A;  5K36 H;  4DXF A;  1PFN A;  1STN A;  1QG7 A;  2K5W A;  1W6J A;  2B2W C;  1D5Z C;  1ENA A;  1J8I A;  3FDT A;  4OGQ C;  5M5X B;  1O7Y A;  4UAI A;  5IGB A;  2A6E D;  4PQX A;  3CRL C;  2F0I A;  1DON A;  4BBS B;  4XQJ A;  3GTM B;  5J39 A;  1IL8 A;  1C8C A;  1I4Q A;  1SE4 A;  1TKW B;  2B2Y C;  4IUV A;  1YNJ C;  4LAA A;  3HS0 C;  1ET9 A;  3HP3 A;  1LTT D;  5ISR A;  2XSC A;  3M4O B;  1B50 A;  3DWA A;  2D62 A;  2KCN A;  5KEE A;  5KNB A;  1DOL A;  4ME5 A;  4FF3 A;  2F0S A;  1YNN D;  3HEJ A;  1DYQ A;  1JOO A;  2K5D A;  4DNT B;  1V43 A;  4ZYS A;  3K5L A;  1DOK A;  1VMP A;  3SHL A;  1U9R A;  2FHT A;  2PNR C;  1ONL A;  1U4M A;  3SK5 A;  5FK9 C;  5I9P A;  4OO1 G;  5JVH 3;  1BQQ T;  4JBW A;  1ESF A;  4HR7 B;  2F0D A;  4QUF A;  1GUN A;  4DAY A;  1MSH A;  1Y1W B;  2F0N A;  4AYB B;  2H4O A;  3D4R A;  1PZK D;  2ICI A;  4RH6 A;  1S5B D;  3TZU A;  3F2U A;  5I2Y A;  1NAP A;  2KEE A;  5EJW A;  3R93 A;  2L1B A;  3VR3 A;  3C1F A;  4J8Q A;  4ZUI A;  3J7Y W;  1TR5 A;  2J7Z A;  1Y8O B;  1H9R A;  2F0W A;  4CBV A;  2SDF A;  2F0M A;  1PFM A;  2LFN A;  3RMH A;  1SMY C;  5EKL A;  4XT3 B;  4ZKC B;  5IT9 E;  4KY6 A;  1EL0 A;  5JOB A;  5FOB B;  2DNE A;  1D1I A;  4F8M A;  1D5M C;  3D4D A;  2F0V A;  4QIW B;  5IOC A;  3GTP B;  2Y0S B;  2EJF C;  2L11 A;  1SNO A;  4IUU A;  2SEB D;  3GTQ B;  3D31 A;  4HN7 A;  1UNS A;  3KBX A;  3J81 E;  3OOC A;  1F9Q A;  1TU2 B;  3S9W A;  1EY8 A;  4ULL A;  2PZU A;  4RAU C;  4RHR A;  5KND A;  1KNA A;  3K7A B;  4R8N A;  4B9X A;  1STB A;  1QNK A;  3HZX A;  1CT1 D;  1SE2 A;  1PMR A;  3KF8 A;  2XWJ B;  2K5Q A;  5JPM C;  1CK1 A;  1O7L A;  2HUG A;  1BCP C;  1WTQ A;  3TME A;  4HTH A;  2K1B A;  3GTO B;  3DEO A;  3DUZ A;  2FMC A;  2SNS A;  3T13 A;  1B9M A;  3TP8 A;  4EGV A;  2OF1 A;  1I4X A;  3M7N A;  3PUY A;  3NPP A;  3SE0 A;  2RDG A;  2X6G A;  2XRS D;  2AQ3 B;  2K7V A;  2B39 A;  2ICE C;  2V4D A;  3W2D A;  2A68 D;  5C4Z A;  3ND8 A;  2FMM A;  2F03 A;  1GHK A;  4A3F B;  1STA A;  1RJT A;  3LWU A;  4M8A A;  4X3K A;  4HMI A;  3BG3 A;  2EZV A;  4IUR A;  1ROD A;  4IFD G;  3V96 A;  2FIN B;  2EYP A;  3H91 A;  5JEA G;  1SDF A;  2OT2 A;  4PMC A;  4XIG S;  4CKC A;  1PRT C;  3M7G A;  1JC7 A;  4G7H C;  1QCB D;  2FFK B;  1C48 A;  1GUS A;  2J0T D;  3WOF A;  3M4Y A;  1D5X C;  4Q5V A;  1S5E D;  1AW7 A;  3LNN A;  2JEA I;  4OHJ A;  4KI0 A;  5C5M A;  5CV8 A;  3G6J B;  3L7Z C;  2M2L A;  1LT4 D;  1BCP B;  1EFI D;  5I6Y A;  2HCC A;  3PMF A;  4C56 C;  4DU9 A;  2XVS A;  5IIF A;  3ERO A;  2AWO A;  2F0F A;  3MEH A;  5EPL A;  4IUQ A;  1GUO A;  3P1H A;  3I91 A;  3VYR A;  4RFB A;  5ELD A;  4KN4 C;  5BN5 A;  1LAC A;  3AB9 A;  2N88 A;  2X6L A;  3X3M A;  1F9S A;  2BDN A;  3NHH A;  3FVQ A;  3LX0 A;  4IZ8 A;  5C6A A;  3M3Y B;  3NXW A;  3DHQ A;  1ZYR C;  5IGE A;  2NVT B;  1STE A;  2KQ3 A;  3PUV A;  3K59 A;  1AP0 A;  3A7L A;  1LTI D;  3HG9 A;  1A3T A;  1X3P A;  1MSG A;  5M3F B;  1MBY A;  2NVQ B;  3N6R A;  3ND9 A;  1F2M A;  1PRT B;  3OMG A;  4DGZ A;  2EJM A;  1V1O A;  3PIP 3;  5C3W A;  1GUG A;  4CKB A;  3GV3 A;  1SYC A;  1GXD C;  2F4I A;  5C4X B;  4K8I A;  3BYY B;  4FNF A;  1G91 A;  5COR A;  5I2X A;  4Q0F A;  1E2W A;  3I72 A;  1KDC A;  3MXN A;  1LTG D;  2PMZ B;  2NUC A;  1SMY D;  1ZEQ X;  1SEB D;  2PZW A;  4TKO B;  1S5D D;  4KHV A;  2E2H B;  1A6X A;  5C0X I;  3HGB A;  1TWF B;  2JA6 B;  4KY7 A;  2D2C C;  5EGT A;  3MC0 B;  2KUM A;  3D6W A;  3BS1 A;  1RD9 D;  2F0J A;  3TP5 A;  3TSS A;  4FF4 A;  4C1N K;  4DK0 A;  4C3H B;  2K04 A;  3VR5 A;  5IGD A;  3PIO 3;  1NCV A;  2B2V A;  1GJX A;  3SDZ A;  1PYW D;  1U4R A;  1J9O A;  4K5X A;  3GO5 A;  5E3F A;  4ABN A;  3URY A;  3OIQ A;  1E2Z A;  1ILP A;  1JWM D;  4NDX A;  4IFD J;  4K5W A;  5E4W C;  4Y7N B;  5JEA J;  1EWC A;  1RCV D;  2WB1 B;  1BCP D;  3J7A V;  5F2D A;  4WRD A;  4DN4 M;  4X3U A;  2B8G A;  1IKL A;  3OW7 A;  3AMU A;  4A3M B;  4ZRZ A;  1W6K A;  4WJW A;  1ESR A;  4N9P A;  2AQ1 B;  2G9D A;  3OHX C;  2L4N A;  3T16 A;  3JAM E;  1I4H A;  3MFG A;  1Y8N B;  5BN4 A;  5JVG 3;  2MHV A;  1JCK B;  1FYC A;  2KJX A;  1PXU A;  1B9N A;  3ZYY X;  1DCZ A;  4FF1 A;  4L63 B;  2RSN A;  4A93 B;  3EA6 A;  3Q0A A;  1DZ1 A;  5CYU A;  3RZD B;  4QUC A;  3GV6 A;  3SEB A;  1K8O A;  2QEJ C;  2IX3 A;  4KKT A;  3NWS A;  3O13 A;  4FXG C;  4BY7 B;  5M9O A;  2TSS A;  5FO9 B;  2CW0 D;  1CTM A;  3BZD B;  5I6W A;  1PRT D;  2SOB A;  1M8A A;  4NMZ A;  1A15 A;  3KBG A;  3NK9 A;  2F0P A;  1F9P A;  5TSS A;  1KDA A;  1S5C D;  2RBM A;  4RCO A;  1DOM A;  3NQI A;  2B2U C;  1EOT A;  1LLR D;  2WII B;  3EVQ A;  2VUM B;  2KVM A;  1SYE A;  3Q24 A;  3K0Y A;  2KCC A;  4QCL A;  1C4Q A;  1H9M A;  1TII D;  2VB3 X;  4KTA A;  1JWU D;  5EKK A;  3GD7 A;  4BA1 I;  2XN9 C;  3TZD A;  2M9V A;  3NQT A;  4A3B B;  2PQE A;  3CQZ B;  1JR0 D;  2TMP A;  2E75 C;  2I07 B;  2PZT A;  2KOL A;  1B4O A;  2F0L A;  2B2T A;  1LT6 D;  5M5W B;  1SFO B;  1B2T A;  2RDH A;  1SXT A;  1Q3L A;  1G8Z D;  2K28 A;  4F87 A;  1B44 D;  3K5M A;  5I4D A;  2E74 C;  1D2B A;  4DXG A;  3BVG A;  4FYD A;  2F0T A;  4NW2 A;  1AN8 A;  3T53 B;  1EQT A;  1AZP A;  3A8J E;  3OWE B;  1TWC B;  5BN3 A;  1NR4 A;  5KYI A;  5C3X A;  2IX0 A;  4DK1 A;  3P20 A;  3MVV A;  1VCI A;  2MP1 A;  3OMC A;  5CV9 A;  2O5I C;  3K6O A;  4HSP A;  4RGM A;  2R3Z A;  5CBA E;  2ZXR A;  3ONA B;  3C3L A;  4Z9C B;  2MJ8 A;  3PUZ A;  4PV1 C;  2H1E A;  4LMQ D;  1SND A;  2C9O A;  2MGS A;  3PO2 B;  5D65 A;  2B2W A;  3DMU A;  4RA8 A;  3T56 B;  2R61 A;  2EYH A;  1CA5 A;  4DA2 A;  2RSO A;  1HUM A;  1VF7 A;  3S1M B;  4RKL A;  1V8Q A;  1Q1E A;  5C3E B;  1GOZ A;  3QG1 A;  1HQM C;  4BWG B;  1TWH B;  3MXU A;  4ZKB B;  2HDM A;  2B2Y A;  3K57 A;  2DY7 A;  4DFA A;  1LTB D;  2RVL A;  4M1U B;  2DN8 A;  1CA6 A;  5EPK A;  1I6H B;  2F0H A;  1S4Z A;  2K01 A;  3NSW A;  5FO7 B;  2PW7 A;  1EZ8 A;  3MHB A;  2L55 A;  4RCN A;  3R8B A;  4OO1 H;  2KED A;  5CV7 A;  4HED A;  4YIJ A;  1ET6 A;  3HKZ B;  4RHS A;  1S5F D;  2PO4 A;  1PZI D;  3A8I E;  1TVX A;  1PFB A;  1JQY D;  1SE3 A;  2C5C A;  1E2V A;  4A3K B;  1Z6H A;  5C0X H;  3NBH A;  5J1Z A;  3NUC A;  1PTO C;  3S14 B;  1FR3 A;  2K03 A;  4A3J B;  3A8K E;  2FJ2 A;  1SNP A;  4C2M B;  1SYD A;  1UAP A;  2PPB C;  3A55 A;  1FD7 D;  2JE6 I;  4BY1 B;  2ZXO A;  1HA5 A;  1QOH A;  1DJR D;  2WAQ B;  2Z4I A;  1HA6 A;  2EYF A;  3J80 L;  2E2I B;  2NWG A;  4CKE A;  2CQA A;  3NWT A;  2CVR A;  3TN2 A;  3ERQ A;  2RQX A;  5NUC A;  1QNU A;  2L9H A;  4RGN A;  1STY A;  3IFT A;  2VXW A;  5KRU A;  3SVM A;  4G7O C;  3CU7 A;  4R8I A;  1MI2 A;  2EYM A;  2AQ2 B;  4I7Z C;  2NN6 G;  2Q8T A;  4U68 A;  2R92 B;  2PYK A;  2K05 A;  1BDO A;  2GA4 B;  5M3M B;  4KV6 A;  4IQZ A;  4IUT A;  4NP5 A;  1L0Y B;  1HPC A;  2JA7 B;  1EY4 A;  2O2L D;  3PUX A;  2RDF A;  1KAB A;  1TWG B;  1A3V A;  1LTR D;  1ENC A;  2LKV A;  4IN3 A;  3VYS A;  4H13 C;  1D1K A;  1PTO B;  1X32 A;  4QB4 A;  1XXG A;  3DXJ C;  4DAP A;  2N55 A;  4MIU A;  1RF2 D;  3QIA A;  1F2L A;  1YNJ D;  3WOE A;  4L8J A;  1IW7 C;  4XTC S;  2VB2 X;  2WV6 D;  3S17 B;  3KK7 A;  4IAL A;  4IUP A;  1TS3 A;  2PCF B;  4OL7 A;  1EYC A;  1KNE A;  3E0J A;  3GTK B;  1D6E C;  2XRQ D;  3BDC A;  2B63 B;  4WOR A;  4RGO S;  5KYL A;  3OWF A;  3BYT B;  1CZW A;  2F1M A;  3SXH A;  4IFD H;  5DM6 3;  3E5S A;  5C4J B;  3EFX D;  1GUW A;  5LL6 X;  4FXD A;  4KD3 A;  2IT1 A;  2F0Q A;  1U4L A;  4KKS A;  1A3U A;  2QKI C;  1PTO F;  3PO3 B;  1RHP A;  4XYO A;  2EE1 A;  2KA7 A;  3TP6 A;  1FNV A;  3HOX B;  4V19 0;  1JOK A;  3T4A C;  4FO2 A;  4ZK9 B;  3I8Z A;  2BA0 A;  2JYO A;  3ITP A;  5D14 A;  1TWA B;  1STG A;  4OO1 I;  3M85 A;  1F2Z A;  5ELF A;  2Z8L A;  1BBX C;  3CRK C;  4EQO A;  3RUZ A;  1JOQ A;  5T1G A;  1Z7T A;  4KJN A;  4CHT B;  4BBR B;  1DXM A;  4XXE A;  3A7A B;  3U9O A;  4DF7 A;  1H9K A;  1V1P B;  2JSO A;  3G7L A;  1HFG A;  1SBB B;  4F88 A;  1SNC A;  2BCO A;  1IKM A;  4K14 A;  1Q90 A;  1FGB D;  5DM7 3;  4C3J G;  3P75 A;  1WD1 A;  1PLF A;  1CM9 A;  2CHB D;  4P2C B;  4V0B A;  2JEB I;  5KNC A;  4S3S A;  4N9T A;  5CC4 A;  3IKJ A;  2Z4H A;  2A69 C;  1QIL A;  1ILQ A;  5JPN C;  4ILW A;  1EY7 A;  2EXZ A;  1EIH A;  5C44 B;  1CFM A;  1KAA A;  1XYI A;  2Q8R E;  2IPK D;  4HCS A;  3VR4 A;  1T5X D;  4A3G B;  1QB5 D;  4O42 A;  3VYT A;  2ZT9 C;  5CMD A;  3VYU A;  1EEF D;  4KKU A;  2HQE A;  2MPM A;  1RKN A;  3S2D B;  1SNQ A;  3HOV B;  1PTO D;  3IAY A;  1DD2 A;  2D9U A;  1EQV A;  5K36 G;  1K8M A;  1NUC A;  1CQV A;  3Q23 A;  4H0L C;  2ZXP A;  4HCE A;  3CHB D;  3FEW X;  4A3I B;  1HTL D;  4TQU S;  1XX8 A;  3NBI A;  3R2I A;  2ID0 A;  3MZ5 A;  4CJ0 B;  2AUJ D;  3K5O A;  5CV5 A;  3S2H B;  4RKB A;  1CHP D;  3H6M A;  1WTW A;  3HOW B;  5DEH A;  1BOS A;  4C3I G;  2EY2 A;  3W3A A;  2QIL A;  3S1N B;  1EY5 A;  2IL8 A;  3HRZ C;  5D3D A;  3VR6 A;  3LWE A;  2NVY B;  4KJO A;  1B1Z A;  1TT2 A;  1BR9 A;  1G29 1;  1AEX A;  2E2D C;  2F0E A;  2AWN A;  4JK1 C;  4CGY B;  1BXT A;  2F0K A;  2ENB A;  4GZY C;  2BE5 C;  1K83 B;  1CQF A;  3MA2 B;  2EVB A;  1I50 B;  4IFD I;  5IGC A;  5G3L F;  3NTI A;  2DNC A;  1O80 A;  3I4L A;  4L6T B;  1IW7 D;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...