5JVH3

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 1
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jvh300
4WFN3 4U673 5DM63 3PIP3 5JVG3 3PIO3 5JVH3 5DM73
chains in the Genus database with same CATH superfamily
3BDOA 3L3OC 2K7VA 1ENAA 5FLMH 2H1EA 1YNXA 4LJZC 1G2TA 4HEDA 2GN5A 2C35B 1GKHA 2NN6G 4RG1A 4Q5VA 1MD2D 2EJMA 3EN2A 4RGMA 1CA6A 2O4XA 2IW3A 3CRKC 4IUPA 3I4NH 5C5LA 4A3MH 3ZJYC 1IL8A 1HTPA 1S5CD 4KY6A 2VUMG 1I4XA 1AW7A 3KDFA 4MHEA 3AMUA 4A93H 1PH8A 1EWHA 4TSSA 2E2JB 3J7A5 1B7YB 2F0NA 4LW1A 1PRTD 4YCWA 5EJWA 4CDFC 2AWNA 1SFOH 1EWCA 1E22A 4IFDI 1X3GA 1SR3A 4A3DB 1L0YB 4LF7L 1VQKA 2EYPA 3BDCA 3Q6SA 2JA8H 2QGQA 4JI8L 3GTJB 5CMDA 1EL0A 4DAVA 1LT6D 2WB1G 2IT1A 3MEFA 3QB3A 1BF4A 2NB0A 3KLRA 3KOJA 2UUAQ 2JA9A 3TMEA 3A54A 2F0QA 2A1AA 4LFCQ 1Q86C 3DM1A 4A3BB 2B2UC 3T4AC 2ATWA 1F2LA 1T5EA 3BDLA 1K83B 2Z6KC 2UUCL 2VB3X 5BR8L 4K8JA 2Y0SG 1CKMA 3NENA 1DCZA 1XMOL 1HR0W 4DV2Q 4OWXB 5EBCA 2B63G 2JE6I 5E3FA 5EQ0A 1K8AC 1TU2B 5M5WB 2R92B 5DNFA 1BDOA 4XQNA 2R93G 2O2LD 1TWHH 3GTQB 1W2BA 1PYWD 1K28A 3I56A 4C2MH 3QJYA 1SMXA 2CHBD 5AFWA 1ILQA 2IL8A 1QUQA 3RZOH 4LF9L 4RAUC 1CFMA 2B2TC 3IKJA 3KLSA 4RHRA 4YHHL 4WORA 2AQ3B 4E6IA 1HJPA 4QUCA 1DOMA 1SNQA 2K32A 4Y7NB 3T1HL 4AQYQ 3P7JA 4CKBA 1D5MC 3P1HA 3D4WA 3ER0A 2WAQB 3MXNB 3R2IA 2KCMA 3GDEA 4ULLA 1ZEQX 5FLXE 1JJ2A 2N8NA 1QWYA 4TKOB 3AQQA 2BH2A 4IPGA 1AE2A 1HA6A 4BWGB 1EYGA 1YNJC 4DR7Q 1G6ZA 2K05A 1DGSA 1OTCA 3T13A 1X56A 2R7FA 3BU2A 1HR0Q 2DY7A 1F9RA 2RDGA 1U4LA 1KL9A 4YCUA 4G57A 1BBXC 4JI4Q 4IURA 1HNWL 1RDPD 4BBSG 4JV5Q 1KD1C 2WKCA 3S2DB 4JI2L 4I7ZC 1TQOA 1B3AA 2B2UA 4OIKA 2BH8A 2LSSA 3BYTB 4OXPA 1RCVD 1JE5A 5C0XH 3PO2B 1BCPD 5TSSA 4WFN3 2R7ZH 2Z6KA 1LT3D 1ASYA 4FYDA 5FOBB 3CCLA 1NCVA 4DGZA 1LTTD 3F2UA 3BS1A 4R4OA 3NELA 2XWJB 1EIYB 1L0XB 3HOUG 4R4TA 2EJFC 3PUXA 5C4ZA 4QUFA 2ENBA 1TWGH 2PI2E 1N9WA 2NVYB 3CW2C 2E5LL 4A3KH 1SBBB 1R9TB 1ML0D 1UNSA 3HOYG 4MIUA 5G3LF 3HOVG 2RSNA 1YHQA 2PPBC 2ASBA 1HZAA 5IWAQ 1J6QA 3HZXA 1A6XA 1A63A 1WD1A 1K9MC 3CRLC 1QVGA 4KKUA 4B3SL 1KQSA 2PQEA 3J80L 1H9SB 3PSIA 4JC0A 1PZJD 4DV1Q 2NVXH 2KEEA 3DUZA 1WFQA 1EY4A 3BJUA 1CKOA 3JAME 1YNNC 4ID6A 5FJ8H 5CV9A 3STBD 2WINB 2CWAA 3CCRA 3I8ZA 1XMQQ 1YIJA 1Y1WG 2OTJA 1S72A 1SYFA 2P5ZX 1I3QH 2SNSA 4PZ6A 5D3IB 1CKNA 2RHQB 1GM5A 1MHWC 4Y52H 4OONA 4R4CA 4A3EG 2I07B 1ICFB 2CH4A 3NE5B 5FO7B 4HSVA 1VQOA 2MO0A 4N8X1 2UU9Q 2AUKA 2HUGA 3RLNA 2Q8TA 2RDHA 1VQBA 2K50A 4JV5L 2BDNA 3KYHC 4NPSA 1HRJA 1EEID 1KNAA 4RGNA 3K0XA 1LYLA 2RSOA 1PZKD 2OXPA 3GTMH 3DEPA 5J22A 3RN5A 3LX0A 2FMCA 1Q1BA 4A3FH 2F0VA 3X3MA 3F2DA 4KD4A 4X6AH 1HHVA 3T1YQ 1VDZA 1Y69U 3UDFA 3CPWA 5IT9L 4UPAA 3C2PA 4XQJA 3GO5A 4DFAA 5HGTA 4V0BA 1R4PB 3K5LA 4P72A 1PLFA 4JCVE 2JA5B 2B2YC 3U58A 3W5OA 4KKSA 3M3YB 2LXKA 5C44G 3NTKA 1EY0A 1O7IA 2NTSA 3RZDB 3K57A 4C3JG 1LACA 3X3NA 4X65L 1J5EL 1A2UA 2C9OA 1ENFA 4OWTB 1DONA 3RNUA 4R1JA 3R3OA 1EZ6A 1OXUA 3IFDA 1YNJD 1QOHA 1XTDA 1XPOA 5K36H 1UE5A 1HTLD 2PNHA 3FMCA 4H7BA 4HJ8A 2DY8A 1JQYD 1D1KA 1PV4A 1ASZA 3PMFA 1JICA 2LFNA 1JJCB 1RF2D 4H0LC 5J3BA 1W6JA 4B3ML 1DYQA 1X65A 1NE3A 1HFNA 1JT8A 1CSQA 2E2JH 2PZWA 1S5BD 4CGYB 4FF2A 4XTCS 1GOZA 4DR4Q 1E1TA 1MSHA 2MFIA 3NHHA 1STNA 2OQ0A 4HTHA 1QCBD 4A3DH 4L8JA 1HNZQ 3S1QB 2RCNA 3I70A 4YY3Q 4IPHA 4U68A 1Q7YC 4JYAQ 3GTJH 4DUYQ 2ALYB 4NMZA 4FVMA 1I6VC 3MA2B 3UDXA 2CW0D 4QIWE 2PMZB 2Q2UA 2Q2HA 5M3MG 4DR6Q 1K73C 1LLRD 1RTNA 3F1ZA 4LFBQ 1SJHD 3SXHA 4GOPA 3S17B 1ZKOA 1F2YA 1XJVA 3L2PA 4JK1C 1L1OA 3K80C 3CAMA 1BKBA 4MTKA 3DMUA 2B2YA 3MAQA 2ZJQA 2EIFA 4IO9A 2CQOA 2YTYA 2QW7A 3VYRA 5CV6A 1HUNA 2A8VA 3PF4A 3J81L 1XXGA 4Z9CB 3H0GG 4OX9L 2FMMA 2HIXA 1LV9A 4ZCKA 2JA7G 3MHBA 3MWYW 5M5WH 1CA5A 4C1NK 2UXDL 4F7XA 3S14B 5ELDA 2RF4A 1TWHB 2ZXOA 2JEBI 3M7GA 5D65A 3A5ZB 4L6TB 3GTQH 4X3KA 3K5MA 4GKJL 1FD7D 3CQZB 1VQFA 3DEOA 4TQUS 3EROA 3KDFB 5EKIA 3OSOA 2DN8A 3HKSA 1P16A 2ZTCA 2MGSA 4DK6C 1PH9A 1IBLQ 1QVFA 1Y1VB 2K5NA 3KJPA 2CCZA 5CR3A 2AHOB 3A7AB 1SEBD 3EIVA 4J6HA 5EPJA 4BY1B 3NEMA 3HOZB 4PMWA 1QVCA 3OYYA 1PZID 4GKKQ 3P20A 4A3JH 2VL6A 1B4OA 3BZKA 3F8TA 5ELCA 1RJTA 4ZAIA 4C56C 1UEBA 2KOLA 3AU7A 5JEAH 5I6WA 1TVXA 1Y8PB 4DUYL 2N49A 2F0WA 1WTPA 5A2QL 3Q0AA 2IPKD 4X66L 3TRZA 1P8LA 1HH2P 5CBAE 4A3CH 3CCUA 5C4JB 5A35A 4CJ0B 5E4WC 3D3RA 1PRTC 1D1IA 2G9DA 2UXCQ 3I55A 4K5WA 1N36Q 1Q82C 2NVQB 2MO1A 2F0KA 1SYBA 4K2LA 3IFTA 4QJFA 1WTRA 1PTOH 1NTGA 1LTID 5DAUA 3HKZB 1BQQT 2JSOA 4B3TL 1EY6A 5BN3A 1K8GA 2NVYH 4DNIA 4KV6A 1R9TH 1JWUD 4C3HH 1Q3LA 4BBRG 1QB5D 4UAIA 4ILWA 4ZKCB 5ELEA 1V1QA 1EEFD 3I72A 1F9PA 4RKBA 2LS01 1Z47A 3CC4A 4A3BG 2R7DA 1CT1D 1M90C 5IYBG 1GJXA 3H6MA 4KMUC 4PMCA 2HIVA 4IQZA 3BYYB 2EY1A 3H09A 1B70B 1VCIA 2F3WA 4IPDA 2JQOA 4HJAA 1GUOA 1SN8A 2F0DA 2LKVA 3TSSA 4CHTB 4HIOA 5I9PA 1LT4D 1RD9D 3NQIA 4YCVA 2R92G 1EUJA 3CMEA 3GTPB 4A4IA 3U4ZA 1FYCA 2NN6I 4NP5A 3FKIG 5C0XJ 4BA2I 1SAPA 3ERSX 1GO3E 2O5IC 4DPGA 2L12A 1BO0A 4WJWA 2WP8J 1QG7A 5IT9E 1NJIC 2IWHA 3HOWB 4K6DA 3E9IA 1KHIA 1PTOF 4C3IG 3M85A 3BVZA 2CVRA 4ME5A 4LF7Q 1TWCB 2K6AA 2BA1A 2OF1A 2VZAA 4A3FB 3OOCA 4HJ7A 4ODGA 3A74A 4WJ3M 4DK1A 5FLXc 2ZJRA 3IL8A 1VF7A 1STGA 4J1MA 4DXFA 1N8RC 1T5XD 5IGFA 3Q22A 2RVLA 2K04A 2IHEA 1II3A 4EQ5A 1VQPA 3S24A 1KC8C 3TP7A 4O42A 2TMPA 2JA5H 2UUCQ 5BR8Q 1GHJA 3W2DA 2R6GA 2JA6B 4IJLA 3M3YH 2L9HA 1XMOQ 2F0FA 1HUMA 1STAA 2BDOA 1VQAA 1W3SA 2JP1A 3RZDH 3PO2G 1PH7A 3A7LA 1EY9A 4R8IA 3RLOA 1AFPA 1KLUD 1CZWA 3FP9A 4GNXA 4JI6L 1Y14B 3PV0A 4OL7A 1NUCA 3JC66 4DNRB 4IFDH 4L63B 1CKNB 4P75A 2KCCA 1CHPD 5DEHA 4BS9A 4DV6L 2HHHQ 2CWPA 3EFXD 3UDIA 1XPRA 2Q2TA 4LF9Q 4YWLA 3DXJC 1KIXA 4YHHQ 3S16B 2B3GA 1RODA 1SROA 4JI3L 4P73A 4PZ8A 2Z9HA 5FO9B 1X55A 3T1HQ 3WOEA 3J7ZC 2I46A 3OMGA 2XWBB 2PNRC 3PO3B 4A3GG 2EXZA 1VQ6A 1KRSA 4DV4L 4A3IG 3OW7A 3J7AF 2RDFA 2Z4HA 2NZOA 3KF8A 5IGBA 2Z4IA 1YJNA 3STBC 2ZJPA 4LF4L 2F0EA 3S1QH 2X6GA 2K4KA 2N78A 4QCLA 1AH9A 2FINB 1D2BA 2J4XA 2EYHA 1HA5A 2D0PA 3U4VA 1B3QA 1XYIA 3I4MB 2RCFA 2F4VL 1HNWQ 2A19A 4LUOA 1VQLA 1N33L 2KBNA 5K5PA 4JI2Q 1C8CA 3S17H 3J81E 2K03A 1GUNA 4KHZA 4CDDC 1RIPA 1MI2A 1JMCA 4GLVB 3MVVA 1W6KA 3SK4A 2UUBL 5M3FG 2Z8LA 1X3QA 3CC2A 2EQSA 1LTRD 3EQLC 2B2WA 2L1BA 4QL5A 3VR3A 4PG3A 4XXEA 1JOKA 3FEWX 1WVLA 1VMPA 1XPUA 3OIPA 2E5LQ 4L5QA 1S5FD 4OO1G 3H3VI 1PVOA 4BY7H 3PGZA 3E3XA 3J81j 3S14H 1LTSD 1VQEA 2L15A 5GAEC 5KRUA 2HHHL 4MN3A 3U9OA 3CQZH 4X3SA 4ZKBB 4DNTB 2PCFB 1PFBA 1V8QA 4NXML 4B3SQ 1IYVA 4YWMA 5FK9C 1QILA 3PIOA 5IP7G 1Y1VH 2JN4A 2LXJA 3VR6A 1XNQL 1DM0B 5IYCH 3DWAA 1HZBA 4C1NI 3AEVA 2MQHA 4LF5L 1C4QA 1LTLA 3FHWA 4BY1H 3J7YW 2PW5A 5A2QE 3HOZH 4A3JB 2XRQD 4R9WA 4IZ8A 2HT1A 1E3PA 5EGTA 3EBEA 5CBEE 3HOXB 5C3EG 1VQDA 3D31A 1DOLA 5FLMG 2EXDA 3F2CA 1PDQA 2AQ1B 4GOPB 3SDZA 4L5RC 3A55A 1H95A 2HCCA 2ZXPA 3TP5A 4DK0A 1IZ6A 1A15A 3G6JB 3I4NG 2J7ZA 4A3MG 2L11A 4B08A 2R3ZA 3SE0A 1A2TA 3G71A 2Q8RE 4RMFA 5C4JH 1ET9A 1F77A 1JOOA 2PI2A 4A93G 2XRSD 2K5WA 4JBKA 2JXMB 1O7ZA 1SDFA 1MGSA 1QNUA 2NVQH 5D3DA 2UXBL 2GA4B 4BXXH 1PTOB 4RGTA 5COYA 2QDLA 2AKWB 3OW2A 1SMYC 2EYMA 3I73A 1G8ZD 3A8JE 2PYKA 3GQBA 2JA8G 2CW0C 4YWKA 1LUZA 4NB3A 1KAWA 2CKZB 4C3HB 2H5XA 4IN3A 3GTGB 4KHPL 3VDYA 2F4IA 1OXXK 2GVBA 1K8OA 3I90A 2B2TA 3NK9A 2E74C 3KLSX 1K0RA 4X65Q 1J5EQ 3MTSA 1VQHA 4K6LA 2KJXA 3M4QA 3H15A 2VUMB 4DAMA 3FVQA 5JEAJ 5L37A 2M9VA 3IRBA 2ICIA 1S40A 2IY5B 2Q8IB 1NY4A 3GV6A 3S1NB 4X62L 2AMCB 5KYIA 4K0KL 3GTPH 3KFUA 1PYBA 3R2TA 2KHSA 4ALPA 1LTAD 3S1MB 1NR4A 5CC4A 1BCPF 2VQEL 1V1PB 4B3MQ 4N8FA 4JBWA 3VR5A 1FR3A 3J7AV 3M4OH 2WB1B 4M1UB 4POFA 1EU3A 1FNUA 3MZ5A 2KEDA 2EYFA 2K52A 4FF1A 3HOWH 2EY5A 2Z1CA 1X32A 3FPPA 3C3LA 3CC7A 1RHPA 1TWCH 1O7YA 5HY6A 4KN4C 4HIMA 4DR2L 4ZQ3A 2E8GA 3OPOA 2BOSA 4RWSC 3TEHB 1WTHA 4KI0A 1VQCA 1N32L 2Y0SB 2BCOA 1EFID 2V4DA 2B63B 3VR2A 4HN7A 4NXNL 1O7LA 5IODA 1MBYA 1C9OA 3TP8A 4KJOA 1SE3A 1ICWA 1QNKA 1JWMD 2D2CC 1SYGA 3EJIA 1U0LA 2JA6H 2FXQA 4OX9Q 2K1BA 4GLXA 4UDUC 1X3PA 2B39A 5C0XG 1EQQA 1S5DD 3BZDB 1ESRA 3EVQA 2F3VA 3PCOB 4PV1C 5I9OA 1VQNA 4FXKC 2R7ZG 1B1ZA 3TQYA 1B50A 2ZTEA 3W1BA 1WTWA 2UXDQ 2ZM6L 1KNEA 3VYSA 3RLFA 1H9KA 2PZUA 3GV3A 5EPKA 1YI2A 4GKJQ 1KXLA 1GVPA 3PQIA 4R4QA 4AIMA 4HMIA 3CCJA 1R4QB 3I4OA 4A3KG 5ELFA 2B2VC 3S16H 4H02A 2MPMA 3I2ZA 4HSPA 2VB2X 2ZTDA 3PO3H 1EOTA 5C4XH 4LUVA 3PIP3 3TS2A 2OWOA 4BBSB 3WDNA 1IL2A 4JI5L 2LMCB 4RHSA 1VMCA 4M8AA 2WFWA 5C5MA 1SMYD 4DAYA 2JJQA 4HR7B 3EA6A 5FJ8G 2MJ8A 1JB3A 1EIFA 3I4MH 3AB9A 1D7QA 1WYDA 4FXDA 4X66Q 1SNDA 4KKTA 1QZHA 1WOCA 2Z6BA 3MXNA 3S1RB 2YV5A 2B8FA 2OCEA 4ABNA 1I50B 2MNAA 2PO4A 1NR2A 3ND8A 1CQFA 5C4HA 3HOYB 2VXWA 1HQRD 2ZXRA 3SEBA 3HOVB 2ES2A 2CFMA 1DXMA 5LMNL 1K3BC 1UE7A 2KUMA 2WAQE 1YJ9A 4IFDJ 3BVGA 4GNXB 3SHLA 3VA7A 4LF6L 5CV4A 2K5DA 4B3TQ 4A3LH 4A3FG 4V190 1PMRA 1YZ6A 5CV8A 4BY7B 3R8BA 3K7UC 1GD7A 1VS0A 3UE0A 4KLKA 2AQ2B 1HCZA 4GZYC 3CU7A 5IP9H 2R61A 4LFAL 2K28A 5BN5A 1Y1WB 1V1OA 2E2HB 4XYOA 4DV7L 4JI1L 1FL0A 3N52A 4FF3A 1KDAA 3CF5A 4FF4A 2QEJC 1B2TA 2I0QA 4O0AA 1LABA 4N9TA 2DJFC 1C0AA 4HJ9A 1WTOA 1DOKA 2PQAA 1U9RA 4QB4A 2KHJA 1B53A 2D62A 2YU9B 2IX1A 3HOXH 1D6EC 4AYBB 4X64L 1BBWA 3GTLH 1CQVA 1L0WA 1SE2A 3KJOA 5IYDH 4RKLA 5LMUQ 1WCMH 3E5SA 5K36G 2VS1A 2MP1A 2WACA 3I3CA 1PH3A 3C1FA 5CYUA 2E2DC 1BVSA 2F0OA 5JOBA 1E2WA 1BCPB 2E2IH 3D4DA 4HIKA 3URYA 1HPCA 3OIQA 5ELOA 5KNDA 1IW7C 4NW2A 1GUTA 5HGQA 4RH6A 4LAAA 1BNZA 4B3RQ 2WV6D 1X54A 2MHVA 1M1KC 4EX5A 4A3DG 1OXSC 5IOCA 1STYA 3DWPA 4PNYA 3CD6A 4O1NA 5C44B 1TS3A 2HDMA 2YTVA 2XNAC 1GUSA 4C3JB 1N34L 3J80E 2RA4A 4FNFA 5ISRA 1B9NA 4DR5L 3GTGH 1QUQB 5M5YB 1X9NA 3L0OA 3ERQA 1TR5A 2Q2IA 3ZYYX 2OEOA 1IBML 1UEAB 2I5LX 1PTOD 2NN6H 1TT2A 4CJ2C 3OMCA 3J81c 3SK6A 3NPPA 3CHBD 4X3UA 5M9OA 1M4VA 4DR1L 4JI6Q 1KRTA 4EVOA 5JAVA 1VQ5A 2VUMH 2DJGC 4G7ZC 1LT5D 1WTQA 1MJEA 4DV6Q 2JEAI 1DD2A 4DU9A 3S1NH 1QJOA 4LK1C 4TVAB 1AZQA 3S15H 1UE1A 1PFNA 4P71A 1G2SA 2EZVA 5KNCA 4JI3Q 1FGBD 4XT3B 1WTXA 3S1MH 3O13A 2E76C 4PZ7A 5LMUL 1PH4A 3M4OB 1E0BA 4DV4Q 1Q8KA 2C5CA 1YITA 3L9AX 4JI0L 5M3MB 3K8AA 2F52A 3R93A 4JW0A 3TDQA 1LO5D 3RD4A 3VYUA 5KNBA 2DGYA 2XIWA 3SVMA 4LF4Q 1SXTA 3E0EA 3PUWA 1Y8OB 3UDGA 2K5QA 2WAQG 1YJWA 5I4DA 4NKLA 1H9JA 4DK3C 3HP3A 1D8LA 2EVBA 2N3SA 2F4VQ 1TWAB 1IBKL 4B3RL 4A3JG 3DWQA 2N88A 1N33Q 3OTOL 1FNWA 1SE4A 1VQMA 1G51A 5GAHC 2BE5D 3H0GB 1E2ZA 4X3TA 1I6HH 4P74A 1BUVT 4ZLTF 5JEAG 2NTTA 5D14A 5T1IA 2B63H 3PIO3 4BA1I 3KBGA 1MJCA 2UUBQ 2WKDA 1YBYA 3CCMA 5JPNC 3C46A 4JVZA 2L0CA 4Q0FA 4DA2A 5FKAC 4OELB 3W1GA 4CDCC 3ULPA 2R93H 1EQRA 1U4PA 2F0SA 1EYCA 1UAPA 4MNOA 4EQPA 1OO9B 4IOAA 4A3CG 1E7ZA 1G6PA 2F03A 1AZPA 2F0TA 2JK8A 2B8GA 4KHVA 1X3EA 4KJNA 3QWNA 3I7FA 1HZ9A 1WTVA 1SSOA 5ELNA 2PMZE 1YHBA 2X6LA 3PUYA 3NUCA 1IXRA 4OO1I 3K6OA 4F88A 2A74C 3CCVA 3D6CA 4NXMQ 1O78A 1EIGA 4C3HG 1XNQQ 2EYLA 3VR4A 1K8MA 1XNRQ 4UP8A 4DV5L 2EE1A 2KA7A 1G291 1I4PA 2VQFL 1BOSA 3MFYA 4DR3L 4LF5Q 3JAMi 1XTCD 5C4XB 2Z0SA 1FNVA 3NXWA 5IGEA 1EY8A 4G7HC 4BBSH 3Q8DA 4RFBA 3SK8A 1EQVA 3FPUB 1IW7D 4DV3L 5CGKA 4HMJA 5IGGA 4DV0L 1TKWB 1WI5A 2A68C 1WD0A 1JB7A 2F0HA 3A0JA 1IKMA 1JWSD 3V05A 3JAMc 5KEEA 1I94Q 4MTNA 1AN8A 1KDCA 1KDBA 1EY5A 1UWVA 3ULLA 2IJ0A 3H3VH 4HIDA 5CORA 1HNXL 4JBJA 4CKCA 1JR0D 2QA4A 3HOUH 2D5DA 4GN3B 3S1RH 1QE6A 1PXUA 4KTAA 3TREA 1I50H 1YHAA 4JI7L 3GP7A 1LTGD 4K5VA 2HQLA 3HOYH 1J9OA 1F9SA 1SYDA 4BBRB 3HOVH 1G91A 2DNEA 2UXBQ 2A6ED 3BVMA 4U673 2EJGC 4G7OC 3HEJA 1A62A 2EY2A 5DM73 1B44D 2OT2A 3KF6A 5LHY1 4TRDA 3N6RA 4AYBE 4LF8L 2NUCA 5NUCA 2D9UA 1FJGL 5GROA 3H91A 4KHPQ 5C3XA 3NBHA 3QO2A 1RL2A 4XQQA 4GN4B 5KYLA 5I6YA 3I91A 2RKSA 3WWVA 3A8IE 1Y1WH 1B8AA 1PRTF 2F0JA 2E2HH 1SNOA 2HQEA 4QIWB 4A3EH 3KK7A 1XNRL 1B9MA 2JA5G 3FKIB 4LWCA 2BA0A 3M9BA 1EWIA 4GS3A 2HDLA 3LNNA 3W3AA 4IOCA 1PA6A 2G9HD 1ZXTA 4DAYB 3FDTA 4X62Q 4XYQA 2YU9H 1EQTA 4CKEA 3GTLB 3D8GA 3QG1A 4K0KQ 3M4PA 5G3LD 4FXGC 4C3IB 3HKZE 3UE1A 2A69C 3UI2A 3I4LA 4KD3A 4JOIC 4IFDG 5I2YA 2VQEQ 1WCMB 5GAGC 5DM63 3NP8A 2QF7A 3K7AB 1L1OB 3TS0A 2RQXA 1JJGA 1I94L 2K33A 1PH1A 2ID0A 1VQIA 2XGTA 1F2ZA 1AEXA 3K81C 2E2IB 3HRZC 4ZK9B 4APVA 1ESFA 1SNPA 3HFZB 5C3EH 1Q1EA 1NNXA 1MSGA 4EQOA 1I4GA 4CJ1B 1OXTA 4DR2Q 3E6ZX 2QCPX 4QF4A 3NWTA 1ZYRD 3CKIB 1Q81C 2XVSA 2AUJD 1N32Q 4IPCA 1F2MA 2M00A 1H9MA 3DHQA 2UUAL 5JJKA 4KK7A 1JE4A 5C44H 4LFCL 5JVG3 4C3JH 4NXNQ 2F0GA 1D5XC 2K5HA 4DUZQ 1LM0A 5M5YH 4B9XA 4DAPA 1GUGA 1S3OA 3ONAB 3AFQA 3QR8A 5LL6X 4XDXA 1U4RA 3NTIA 1IYJB 5IIFA 1VF5C 1Q46A 5DLQE 2NVTB 3F2BA 4DV2L 4J15A 2ZT9C 3MXGA 5ELBA 3U9SA 1FVIA 4HAEA 1TY2A 1EYDA 2XTIA 3MXPA 1TWFH 3MXUA 2PQAB 1T9HA 2N55A 4UP7A 4HCEA 2ZM6Q 3MEHA 2DNCA 1PH2A 2A68D 5J39A 1YEZA 5C0XI 3GTKB 1Q12A 1RTOA 4A3GB 4GN5A 2EYJA 2YTXA 3HS0C 4A3IB 2KVMA 4HJ5A 2IHFA 2TSSA 3S15B 2A5HA 1SYCA 4JOIA 5LMNW 4BY7G 3GD7A 3VA5A 2PW7A 3KLWA 4AQYL 1BR9A 1E24A 4IUUA 1EOVA 2L5TA 1PH6A 1SNMA 3CP0A 1JC7A 2F0MA 2HCIA 1A8VA 4H44C 2L55A 5M3MH 4WRDA 4JI5Q 1V9PA 1EU4A 3G48A 2FHTA 2NYZD 1UE6A 1Y1VG 3HGBA 4PMBA 4DR7L 1Z9FA 5IYCG 1HR0L 4MZ9A 4BY1G 5M3FB 4JI4L 3HOZG 1TWAH 4GLAC 5IY0A 1GUWA 4AYBG 1CSPA 1I6HB 3H0GH 5IGCA 2AWOA 2JA7H 1SYEA 3PUZA 1BXTA 3A56A 3BG3A 3S2HB 1SLJA 4DUZL 1NSNS 3D4RA 5EPLA 3ICEA 3B6YA 3CXCA 2X69A 4NDXA 1XX8A 5LMNQ 4A75A 4DKAC 2R93B 2K01A 5T1GA 3K0YA 2IX0A 4LF6Q 4GOPC 3M7NA 5LL6S 1TIID 2LY7A 2MUYA 1L1OC 2VY3A 1IHZA 3J80i 1C48A 1PFSA 1I5FA 1QZGA 4BXXG 3A8KE 5M5XB 1PHJA 2A69D 5IWAL 3K5NA 3GTOB 3TN2A 2PZTA 1KABA 5EKKA 4LFAQ 3HKZG 5BN4A 1Y8NB 1EY7A 2J0TD 1JORA 5C3EB 4DV7Q 3MFGA 4JI1Q 4KY5A 2I5HA 3J80c 1F9QA 1CHQD 3E0JA 1LTBD 4DV1L 1PTOC 1S5ED 1CTMA 3TP6A 1Q8IA 1A3TA 4I65A 1RKNA 2KCNA 4O2DA 1XMQL 1VQ7A 5AJ3Q 1PRTB 5H1SE 1GXDC 1TS2A 4PQXA 3OWEB 3I4NB 4LNQA 4A3MB 2GVAA 3TZDA 4X64Q 4B9WA 1V43A 1D5ZC 4K14A 4UY8C 2KECA 1ILPA 2UU9L 3U50C 3ULJA 1I4QA 4H13C 4A93B 1XWEA 2KQ3A 4JPBW 2WIIB 3TBIB 4F87A 1DJRD 1A0IA 3D0FA 2L4NA 4AH6A 4POGA 4DXGA 5E4XA 1SFOB 3HOUB 1A3UA 1Z6HA 1A3VA 2JA8B 2K75A 4P2CB 4K8IA 4LMQD 5C6AA 5C3WA 1HZCA 3T53B 1VQ9A 1MKHA 3RN2A 1NBWA 2HD3A 4BBRH 3T1YL 2VW9A 1CI3M 4HCSA 2EY6A 3HOWG 3S9WA 5IT9c 4ZUIA 4R8NA 5JJIA 2O5JC 1H9RA 4IUQA 1DZ1A 1ENCA 1STEA 1N34Q 4A3BH 4KY7A 4ZYSA 1TY0A 2H4OA 5IYBH 2G5DA 2BE5C 1MIUA 4DR5Q 1K83H 4CDEC 2VNUD 1O80A 1IBMQ 1KTKA 2EOTA 1SRUA 3LGJA 1WJJA 4IUNA 2K14A 1YNND 1IYUA 2B2VA 2DUDA 4F8MA 4IUTA 1EYAA 4A3EB 3QIAA 1PH5A 2R92H 4DR1Q 2QKIC 3KF8B 1X6OA 3FKIH 1IKLA 2FJ2A 4KN7C 3T51B 2A6HC 4L5SA 1HFGA 2JA6G 3H94A 5EBDA 3A5UA 4C2MB 5AJ3L 5FO8B 2NBFA 4OGQC 2EDGA 1BBUA 3RZOB 3L7ZC 1K3RA 2FFKB 4ZUJA 1JCKB 3T56B 2OTLA 4C3IH 2F1MA 3Q24A 2F0PA 2F0LA 2XN9C 4EQNA 4CBVA 4Y7NH 3AYHB 2CH4W 3TZUA 2EYOA 2NZHA 1H9SA 4RGOS 4RCNA 3K7AH 4JI0Q 4QY7A 1M8AA 4DR4L 4K2KA 1GHKA 3CCSA 3AFPA 2F0IA 4JG2A 3K58A 3HG9A 1HNZL 2I5MX 3G6EA 2SOBA 4OHJA 4YY3L 1AE3A 4JYAL 3IAYA 1L2FA 3PO3G 4FDBA 5FLXL 4A76A 5C4XG 5CV5A 2F3IA 3KF6B 1U4MA 4ME3A 1IBKQ 4WJ4A 4DR6L 4DF7A 4LFBL 1VQJA 2D0OA 3OTOQ 4YIJA 1I4RA 3LWUA 1V1PA 2E75C 4XIGS 3S2DH 3J81i 1HQMC 2SEBD 3NBHB 3PO2H 2A73B 2F0UA 3P75A 2KCTA 3SGIA 2R7ZB 5E7NA 3VYTA 1C7YA 3K59A 2XSCA 3I4MG 4L5TA 3NBIA 3SR1A 3PIPA 3OWFA 1PYSB 2QDBA 3KUPA 1HXYD 4UHVA 2WB1E 2NVTH 2V1CC 1OXVA 1J8IA 4ZRZA 5IE8A 1TWGB 2JYOA 4A3KB 1JOQA 3ITPA 3G4SA 1TWFB 5JJLA 2QEXA 2A6EC 3G7LA 3H3VC 1FGUA 2NZ1D 2RBMA 2KHIA 4RCOA 3V2TA 3BZCA 3GTKH 4A3GH 3D6WA 5HURA 2NWGA 3ND9A 4A3IH 2M2LA 2YYZA 4OWWB 1NAPA 4A3LG 4OIJA 1ONLA 3Q23A 4I7AA 3RMHA 1VQ4A 3DM3A 2Y0SE 5KIXA 1IBLL 1UUPA 1E1OA 5GQOA 4OEMB 2NVXB 1TXYA 4IJHA 1I4HA 5EAYA 4DV5Q 5CV7A 2RHSB 2VQFQ 1VQGA 5IGDA 4GNXC 4DR3Q 5IP9G 1EIHA 1SJED 5EKLA 5E1FA 4GKKL 4DN4M 3KBXA 1EZ8A 1I3QB 4EGVA 1STHA 5F2DA 4DV3Q 3K5OA 4FO2A 3CCEA 3NWSA 4DV0Q 1PFMA 3LWEA 4IUVA 4XT1B 1Q90A 2OQKA 2CQAA 3JAML 3M4YA 2ICEC 3E9HA 5I2XA 4N9PA 5M3FH 3NTHA 3RR5A 1S4ZA 4RA8A 1AP0A 2EPBA 3PUVA 3HOXG 1HNXQ 4J8QA 4QQBX 1STBA 2JA7B 1CK1A 3GTMB 5IYDG 3RUZA 3QOJA 4FP5D 1SNCA 4JI8Q 3T16A 2QILA 2SNMA 4JI7Q 2K5VA 3NQTA 1EFWA 1WCMG 3S2HH 4OO1H 1CZGA 2UXCL 1KLGD 1VQ8A 4LUZA 1N36L 4G4KA 5JPMC 5KGUA 3QOLA 1E2VA 3SK5A 1TS4A 2IX3A 2A6HD 1YVCA 4QMGA 1NMFA 1ET6A 3CMAA 1K0SA 5GADC 4QGUA 1NMGA 3CPFA 4IALA 2B29A 3CCQA 1ZYRC 1KAAA 4LF8Q 4S3SA 2SDFA 5IP7H 1CM9A 1CUKA 2KENA 3NSWA 5J1ZA 3V96A 1FJGQ 4K5XA 3MC0B 4UP9A 5M5XH 3DLLA 4R4IA 1U5KA 3FRPB 1BCPC 1Z7TA 5JJZA 3PF5A 3GTOH 5JVH3 1TS5A 4JBMA 1X3FA 3C1EA 3OHXC 1SE8A 3WOFA 2B2WC
chains in the Genus database with same CATH topology
3BDOA 3L3OC 2K7VA 1ENAA 2H1EA 4LJZC 1G2TA 4HEDA 2NN6G 1CA6A 4Q5VA 1MD2D 2EJMA 4RGMA 2O4XA 2IW3A 3CRKC 4IUPA 5C5LA 1IL8A 1HTPA 1S5CD 4KY6A 1I4XA 1AW7A 4MHEA 3AMUA 1EWHA 4TSSA 2E2JB 2F0NA 1PRTD 5EJWA 2AWNA 1EWCA 4IFDI 4A3DB 1L0YB 2EYPA 3BDCA 3Q6SA 3GTJB 5CMDA 1EL0A 4DAVA 1LT6D 2IT1A 3QB3A 1BF4A 2NB0A 3KLRA 3TMEA 3A54A 2F0QA 3DM1A 4A3BB 2B2UC 3T4AC 1F2LA 1T5EA 3BDLA 1K83B 2VB3X 4K8JA 1DCZA 5EBCA 2JE6I 5E3FA 5EQ0A 1TU2B 5M5WB 2R92B 5DNFA 1BDOA 4XQNA 2O2LD 3GTQB 1PYWD 3QJYA 2CHBD 5AFWA 1ILQA 2IL8A 4RAUC 1CFMA 2B2TC 3IKJA 3KLSA 4RHRA 4WORA 2AQ3B 4E6IA 4QUCA 1DOMA 1SNQA 2K32A 4Y7NB 3P7JA 4CKBA 1D5MC 3P1HA 3D4WA 2WAQB 3R2IA 4ULLA 1ZEQX 5FLXE 1QWYA 4TKOB 1HA6A 4BWGB 1YNJC 1G6ZA 2K05A 3T13A 2DY7A 1F9RA 2RDGA 1U4LA 4G57A 1BBXC 4IURA 1RDPD 2WKCA 3S2DB 4I7ZC 1TQOA 1B3AA 2B2UA 4OIKA 3BYTB 3PO2B 1RCVD 5C0XH 1BCPD 5TSSA 4WFN3 1LT3D 4FYDA 1NCVA 4DGZA 1LTTD 3F2UA 3BS1A 2XWJB 1L0XB 2EJFC 3PUXA 5C4ZA 4QUFA 2ENBA 2NVYB 1SBBB 1R9TB 1ML0D 1UNSA 4MIUA 5G3LF 2RSNA 2PPBC 3HZXA 1A6XA 1WD1A 3CRLC 4KKUA 2PQEA 3J80L 1H9SB 1PZJD 2KEEA 3DUZA 1EY4A 3JAME 1YNNC 4ID6A 5CV9A 2WINB 3I8ZA 1SYFA 2SNSA 5D3IB 2I07B 3NE5B 5FO7B 4HSVA 2AUKA 2HUGA 2Q8TA 2RDHA 2BDNA 1HRJA 1EEID 1KNAA 4RGNA 2RSOA 1PZKD 2OXPA 3DEPA 5J22A 3LX0A 2FMCA 1Q1BA 2F0VA 3X3MA 4KD4A 1HHVA 1VDZA 1Y69U 5IT9L 3C2PA 4XQJA 3GO5A 4DFAA 5HGTA 4V0BA 1R4PB 3K5LA 1PLFA 2JA5B 2B2YC 4KKSA 3M3YB 3NTKA 1EY0A 3RZDB 2NTSA 3K57A 4C3JG 1LACA 3X3NA 1A2UA 2C9OA 1ENFA 1DONA 3R3OA 1EZ6A 1OXUA 3IFDA 1YNJD 1QOHA 5K36H 1HTLD 3FMCA 4H7BA 2DY8A 1JQYD 1D1KA 3PMFA 1JICA 2LFNA 1RF2D 4H0LC 1W6JA 1DYQA 1HFNA 2PZWA 1S5BD 4CGYB 4FF2A 4XTCS 1GOZA 1MSHA 3NHHA 1STNA 4HTHA 1QCBD 4L8JA 3S1QB 3I70A 4U68A 4NMZA 4FVMA 1I6VC 3MA2B 2CW0D 2PMZB 1LLRD 1RTNA 1SJHD 3SXHA 3S17B 1ZKOA 1F2YA 4JK1C 3DMUA 2B2YA 3MAQA 3VYRA 5CV6A 1HUNA 3J81L 1XXGA 4Z9CB 2FMMA 1LV9A 3MHBA 3MWYW 1CA5A 4C1NK 4F7XA 3S14B 5ELDA 1TWHB 2ZXOA 2JEBI 3M7GA 5D65A 4L6TB 4X3KA 3K5MA 1FD7D 3CQZB 3DEOA 4TQUS 3EROA 5EKIA 2DN8A 3OSOA 2MGSA 1Y1VB 5CR3A 3A7AB 1SEBD 4J6HA 5EPJA 4BY1B 3HOZB 4PMWA 1PZID 3P20A 1B4OA 5ELCA 1RJTA 4ZAIA 4C56C 3AU7A 2KOLA 5JEAH 5I6WA 1TVXA 1Y8PB 2F0WA 1WTPA 5A2QL 3Q0AA 2IPKD 5CBAE 5C4JB 5A35A 4CJ0B 5E4WC 3D3RA 1PRTC 1D1IA 2G9DA 4K5WA 2NVQB 2F0KA 1SYBA 4K2LA 3IFTA 1WTRA 1PTOH 1LTID 5DAUA 3HKZB 1BQQT 2JSOA 1EY6A 5BN3A 4KV6A 1JWUD 1Q3LA 1QB5D 4UAIA 4ILWA 4ZKCB 5ELEA 1EEFD 3I72A 1F9PA 4RKBA 2LS01 1Z47A 1CT1D 1GJXA 3H6MA 4KMUC 4PMCA 4IQZA 3BYYB 2EY1A 3H09A 1VCIA 2F3WA 1GUOA 2F0DA 2LKVA 3TSSA 4CHTB 5I9PA 1LT4D 1RD9D 3NQIA 3GTPB 1FYCA 2NN6I 4NP5A 5C0XJ 4BA2I 1SAPA 2O5IC 2L12A 1BO0A 4WJWA 2WP8J 1QG7A 5IT9E 3HOWB 2IWHA 4K6DA 1PTOF 4C3IG 3M85A 3BVZA 2CVRA 4ME5A 1TWCB 2K6AA 2BA1A 2OF1A 4A3FB 3OOCA 4ODGA 4DK1A 3IL8A 1VF7A 1STGA 4J1MA 4DXFA 1T5XD 5IGFA 3Q22A 2RVLA 2K04A 1II3A 3TP7A 4O42A 2TMPA 1GHJA 3W2DA 2R6GA 2JA6B 2L9HA 2F0FA 1HUMA 1STAA 2BDOA 2JP1A 3A7LA 1EY9A 4R8IA 1AFPA 1KLUD 1CZWA 3PV0A 4OL7A 1NUCA 4DNRB 4IFDH 4L63B 2KCCA 1CHPD 5DEHA 4BS9A 3EFXD 3DXJC 3S16B 1RODA 5FO9B 3WOEA 2I46A 3OMGA 2XWBB 2PNRC 3PO3B 2EXZA 3OW7A 3J7AF 2RDFA 2Z4HA 3KF8A 5IGBA 2Z4IA 2F0EA 2X6GA 4QCLA 2FINB 1D2BA 2J4XA 2EYHA 1HA5A 3I4MB 1XYIA 5K5PA 1C8CA 3J81E 2K03A 1GUNA 4KHZA 1MI2A 3MVVA 1W6KA 3SK4A 2Z8LA 1X3QA 1LTRD 3EQLC 2B2WA 2L1BA 3VR3A 4XXEA 1JOKA 3FEWX 1WVLA 1VMPA 3OIPA 1S5FD 4OO1G 1LTSD 5KRUA 4MN3A 3U9OA 4X3SA 4ZKBB 4DNTB 2PCFB 1PFBA 1V8QA 1IYVA 5FK9C 1QILA 3VR6A 1DM0B 3DWAA 4C1NI 1C4QA 3J7YW 2PW5A 5A2QE 4A3JB 2XRQD 4R9WA 4IZ8A 5EGTA 5CBEE 3HOXB 3D31A 1DOLA 1PDQA 2AQ1B 3SDZA 3A55A 2HCCA 2ZXPA 3TP5A 4DK0A 1A15A 3G6JB 2J7ZA 2L11A 4B08A 2R3ZA 3SE0A 1A2TA 2Q8RE 1ET9A 1F77A 1JOOA 2XRSD 2K5WA 2JXMB 1O7ZA 1SDFA 1MGSA 1QNUA 5D3DA 2GA4B 1PTOB 4RGTA 5COYA 1SMYC 2EYMA 3I73A 1G8ZD 3A8JE 2PYKA 3GQBA 2CW0C 4C3HB 4IN3A 3GTGB 2F4IA 1OXXK 1K8OA 3I90A 2B2TA 3NK9A 2E74C 3KLSX 3MTSA 4K6LA 2KJXA 2VUMB 3FVQA 5JEAJ 2M9VA 2ICIA 2Q8IB 3GV6A 3S1NB 5KYIA 3R2TA 2KHSA 1LTAD 3S1MB 1NR4A 5CC4A 1BCPF 1V1PB 4JBWA 3VR5A 1FR3A 3J7AV 2WB1B 4M1UB 1EU3A 1FNUA 3MZ5A 2KEDA 2EYFA 4FF1A 2EY5A 2Z1CA 1X32A 3FPPA 3C3LA 1RHPA 1O7YA 4KN4C 4ZQ3A 3OPOA 2BOSA 4RWSC 4KI0A 2Y0SB 2BCOA 1EFID 2V4DA 2B63B 3VR2A 4HN7A 1O7LA 5IODA 1MBYA 3TP8A 4KJOA 1SE3A 1ICWA 1QNKA 1JWMD 2D2CC 1SYGA 3EJIA 2K1BA 4UDUC 1X3PA 2B39A 5C0XG 1S5DD 3BZDB 1ESRA 3EVQA 2F3VA 4PV1C 5I9OA 4FXKC 1B1ZA 1B50A 1WTWA 1KNEA 3VYSA 3RLFA 1H9KA 2PZUA 3GV3A 5EPKA 4HMIA 1R4QB 5ELFA 2B2VC 2MPMA 4HSPA 2VB2X 1EOTA 3PIP3 4BBSB 3WDNA 2LMCB 4RHSA 1VMCA 4M8AA 5C5MA 1SMYD 4DAYA 4HR7B 3EA6A 2MJ8A 1JB3A 3AB9A 4FXDA 1SNDA 4KKTA 3MXNA 3S1RB 2B8FA 4ABNA 1I50B 2PO4A 1NR2A 3ND8A 1CQFA 5C4HA 3HOYB 2VXWA 1HQRD 2ZXRA 3SEBA 3HOVB 1DXMA 2KUMA 4IFDJ 3BVGA 3SHLA 3VA7A 5CV4A 2K5DA 4BY7B 4V190 1PMRA 5CV8A 3R8BA 2AQ2B 1HCZA 4GZYC 3CU7A 2R61A 2K28A 5BN5A 1Y1WB 1V1OA 2E2HB 4XYOA 3N52A 4FF3A 1KDAA 4FF4A 2QEJC 1B2TA 1LABA 4N9TA 1WTOA 1DOKA 1U9RA 4QB4A 1B53A 2D62A 2YU9B 2IX1A 1D6EC 4AYBB 1CQVA 1SE2A 4RKLA 3E5SA 5K36G 2MP1A 2WACA 3I3CA 3C1FA 5CYUA 2E2DC 2F0OA 5JOBA 1E2WA 1BCPB 3D4DA 3URYA 1HPCA 3OIQA 5KNDA 1IW7C 4NW2A 1GUTA 4RH6A 4LAAA 1BNZA 2WV6D 2MHVA 1OXSC 5IOCA 1STYA 3DWPA 4PNYA 4O1NA 5C44B 1TS3A 2HDMA 2XNAC 1GUSA 4C3JB 3J80E 2RA4A 4FNFA 5ISRA 1B9NA 5M5YB 3ERQA 1TR5A 3ZYYX 2OEOA 1UEAB 1PTOD 2NN6H 1TT2A 4CJ2C 3OMCA 3SK6A 3NPPA 3CHBD 4X3UA 5M9OA 1M4VA 4EVOA 5JAVA 4G7ZC 1LT5D 1WTQA 2JEAI 1DD2A 4DU9A 1QJOA 4LK1C 1AZQA 1PFNA 1G2SA 2EZVA 5KNCA 1FGBD 4XT3B 1WTXA 3O13A 2E76C 3M4OB 1E0BA 2C5CA 3L9AX 5M3MB 3R93A 3TDQA 1LO5D 3RD4A 3VYUA 5KNBA 2XIWA 3SVMA 1SXTA 3PUWA 1Y8OB 2K5QA 5I4DA 4NKLA 1H9JA 3HP3A 2EVBA 1TWAB 3DWQA 2N88A 1FNWA 1SE4A 2BE5D 3H0GB 1E2ZA 4X3TA 4ZLTF 1BUVT 5JEAG 2NTTA 5D14A 5T1IA 3PIO3 4BA1I 3KBGA 2WKDA 5JPNC 3C46A 2L0CA 4Q0FA 4DA2A 5FKAC 1U4PA 2F0SA 1EYCA 1UAPA 4EQPA 1OO9B 2F03A 1AZPA 2F0TA 2B8GA 4KHVA 4KJNA 3QWNA 1WTVA 1SSOA 3PUYA 2X6LA 3NUCA 4OO1I 3K6OA 4F88A 2A74C 3D6CA 1O78A 1EIGA 4C3HG 2EYLA 3VR4A 1K8MA 2EE1A 2KA7A 1G291 1I4PA 1BOSA 3MFYA 1XTCD 5C4XB 1FNVA 3NXWA 5IGEA 1EY8A 4G7HC 4RFBA 3SK8A 1EQVA 3FPUB 1IW7D 5CGKA 4HMJA 5IGGA 1TKWB 2A68C 1WD0A 2F0HA 1IKMA 1JWSD 3V05A 5KEEA 1AN8A 1KDCA 1KDBA 1EY5A 2IJ0A 5CORA 4CKCA 1JR0D 2D5DA 1QE6A 1PXUA 4KTAA 3GP7A 1LTGD 4K5VA 1J9OA 1F9SA 1SYDA 4BBRB 1G91A 2DNEA 2A6ED 3BVMA 4U673 2EJGC 4G7OC 3HEJA 2EY2A 5DM73 1B44D 2OT2A 5LHY1 4TRDA 3N6RA 2NUCA 5NUCA 2D9UA 3H91A 5C3XA 3NBHA 3QO2A 4XQQA 5KYLA 5I6YA 3I91A 2RKSA 3A8IE 1PRTF 2F0JA 1SNOA 2HQEA 4QIWB 3KK7A 1B9MA 3FKIB 2BA0A 2HDLA 3LNNA 3W3AA 2G9HD 1ZXTA 3FDTA 4XYQA 1EQTA 4CKEA 3GTLB 3D8GA 3QG1A 5G3LD 4FXGC 4C3IB 2A69C 3UI2A 3I4LA 4KD3A 4IFDG 5I2YA 1WCMB 5DM63 3NP8A 2QF7A 3K7AB 2RQXA 2K33A 2ID0A 1F2ZA 1AEXA 2E2IB 3HRZC 4ZK9B 1ESFA 1SNPA 1Q1EA 1MSGA 4EQOA 1I4GA 4CJ1B 1OXTA 3E6ZX 2QCPX 4QF4A 3NWTA 1ZYRD 3CKIB 2XVSA 2AUJD 1F2MA 2M00A 1H9MA 3DHQA 4KK7A 1JE4A 5JVG3 2F0GA 1D5XC 4B9XA 4DAPA 1GUGA 3ONAB 5LL6X 4XDXA 1U4RA 3NTIA 5IIFA 1VF5C 2NVTB 2ZT9C 3MXGA 5ELBA 3U9SA 4HAEA 1TY2A 1EYDA 3MXUA 3MXPA 2N55A 4HCEA 3MEHA 2DNCA 2A68D 5J39A 5C0XI 3GTKB 1Q12A 1RTOA 4A3GB 2EYJA 3HS0C 4A3IB 2KVMA 3S15B 2TSSA 2A5HA 1SYCA 3GD7A 3VA5A 2PW7A 1BR9A 4IUUA 2L5TA 1SNMA 1JC7A 2F0MA 2HCIA 4H44C 2L55A 4WRDA 1EU4A 2FHTA 2NYZD 3HGBA 4PMBA 5M3FB 1GUWA 1I6HB 5IGCA 2AWOA 3WOFA 1SYEA 3PUZA 1BXTA 3A56A 3BG3A 3S2HB 1NSNS 3D4RA 5EPLA 2X69A 4NDXA 1XX8A 2R93B 2K01A 5T1GA 3K0YA 2IX0A 3M7NA 5LL6S 1TIID 2LY7A 2MUYA 1IHZA 1C48A 3A8KE 5M5XB 2A69D 3K5NA 3GTOB 3TN2A 2PZTA 1KABA 5EKKA 5BN4A 1Y8NB 1EY7A 2J0TD 1JORA 5C3EB 3MFGA 4KY5A 1F9QA 1CHQD 3E0JA 1LTBD 1PTOC 1S5ED 1CTMA 3TP6A 1Q8IA 1A3TA 4I65A 1RKNA 2KCNA 1PRTB 1GXDC 1TS2A 4PQXA 3OWEB 3I4NB 4A3MB 3TZDA 4B9WA 1V43A 1D5ZC 4K14A 2KECA 1ILPA 1I4QA 4H13C 4A93B 1XWEA 2KQ3A 2WIIB 3TBIB 4F87A 1DJRD 2L4NA 4DXGA 5E4XA 1SFOB 3HOUB 1A3UA 1Z6HA 1A3VA 2JA8B 4P2CB 4K8IA 4LMQD 5C6AA 5C3WA 3T53B 1CI3M 4HCSA 2EY6A 3S9WA 4ZUIA 4R8NA 2O5JC 1H9RA 4IUQA 1DZ1A 1ENCA 1STEA 4KY7A 4ZYSA 1TY0A 2H4OA 2BE5C 2VNUD 1O80A 1KTKA 2EOTA 4IUNA 1YNND 1IYUA 2B2VA 4F8MA 4IUTA 1EYAA 4A3EB 3QIAA 2QKIC 1IKLA 2FJ2A 4KN7C 3T51B 2A6HC 1HFGA 3H94A 5EBDA 4C2MB 5FO8B 2NBFA 4OGQC 2EDGA 3RZOB 3L7ZC 2FFKB 4ZUJA 1JCKB 3T56B 2F1MA 3Q24A 2F0PA 2F0LA 2XN9C 4EQNA 4CBVA 3TZUA 2EYOA 1H9SA 4RGOS 4RCNA 1M8AA 4K2KA 1GHKA 2F0IA 3K58A 3HG9A 2SOBA 4OHJA 3IAYA 5FLXL 5CV5A 1U4MA 4DF7A 4YIJA 1I4RA 3LWUA 1V1PA 2E75C 4XIGS 1HQMC 2SEBD 2A73B 2F0UA 3P75A 2R7ZB 3VYTA 3K59A 2XSCA 3NBIA 3SR1A 3OWFA 2QDBA 3KUPA 1HXYD 1OXVA 1J8IA 4ZRZA 1TWGB 2JYOA 4A3KB 1JOQA 3ITPA 1TWFB 2A6EC 3G7LA 3H3VC 2NZ1D 2RBMA 4RCOA 3V2TA 3D6WA 5HURA 2NWGA 3ND9A 2M2LA 2YYZA 1NAPA 4OIJA 1ONLA 3Q23A 3RMHA 5KIXA 1UUPA 2NVXB 1I4HA 5CV7A 5IGDA 1EIHA 1SJED 5EKLA 5E1FA 4DN4M 3KBXA 1EZ8A 1I3QB 4EGVA 1STHA 5F2DA 3K5OA 4FO2A 3NWSA 1PFMA 3LWEA 4IUVA 4XT1B 1Q90A 2CQAA 3JAML 3M4YA 2ICEC 5I2XA 4N9PA 3NTHA 1AP0A 1S4ZA 4RA8A 2EPBA 3PUVA 4J8QA 1STBA 2JA7B 1CK1A 3GTMB 3RUZA 3QOJA 1SNCA 4FP5D 3T16A 2QILA 2SNMA 3NQTA 4OO1H 1CZGA 1KLGD 4G4KA 5JPMC 5KGUA 3QOLA 1E2VA 3SK5A 1TS4A 2IX3A 2A6HD 4QMGA 1ET6A 4IALA 1ZYRC 1KAAA 4S3SA 2SDFA 1CM9A 3NSWA 5J1ZA 3V96A 4K5XA 3MC0B 3FRPB 1BCPC 1Z7TA 5JJZA 5JVH3 1TS5A 3C1EA 3OHXC 5FOBB 2B2WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFN 3;  4U67 3;  5DM6 3;  3PIP 3;  5JVG 3;  3PIO 3;  5JVH 3;  5DM7 3; 
#chains in the Genus database with same CATH topology
 3BDO A;  3L3O C;  2K7V A;  1ENA A;  5FLM H;  2H1E A;  1YNX A;  4LJZ C;  1G2T A;  4HED A;  2GN5 A;  2C35 B;  1GKH A;  2NN6 G;  4RG1 A;  4Q5V A;  1MD2 D;  2EJM A;  3EN2 A;  4RGM A;  1CA6 A;  2O4X A;  2IW3 A;  3CRK C;  4IUP A;  3I4N H;  5C5L A;  4A3M H;  3ZJY C;  1IL8 A;  1HTP A;  1S5C D;  4KY6 A;  2VUM G;  1I4X A;  1AW7 A;  3KDF A;  4MHE A;  3AMU A;  4A93 H;  1PH8 A;  1EWH A;  4TSS A;  2E2J B;  3J7A 5;  1B7Y B;  2F0N A;  4LW1 A;  1PRT D;  4YCW A;  5EJW A;  4CDF C;  2AWN A;  1SFO H;  1EWC A;  1E22 A;  4IFD I;  1X3G A;  1SR3 A;  4A3D B;  1L0Y B;  4LF7 L;  1VQK A;  2EYP A;  3BDC A;  3Q6S A;  2JA8 H;  2QGQ A;  4JI8 L;  3GTJ B;  5CMD A;  1EL0 A;  4DAV A;  1LT6 D;  2WB1 G;  2IT1 A;  3MEF A;  3QB3 A;  1BF4 A;  2NB0 A;  3KLR A;  3KOJ A;  2UUA Q;  2JA9 A;  3TME A;  3A54 A;  2F0Q A;  2A1A A;  4LFC Q;  1Q86 C;  3DM1 A;  4A3B B;  2B2U C;  3T4A C;  2ATW A;  1F2L A;  1T5E A;  3BDL A;  1K83 B;  2Z6K C;  2UUC L;  2VB3 X;  5BR8 L;  4K8J A;  2Y0S G;  1CKM A;  3NEN A;  1DCZ A;  1XMO L;  1HR0 W;  4DV2 Q;  4OWX B;  5EBC A;  2B63 G;  2JE6 I;  5E3F A;  5EQ0 A;  1K8A C;  1TU2 B;  5M5W B;  2R92 B;  5DNF A;  1BDO A;  4XQN A;  2R93 G;  2O2L D;  1TWH H;  3GTQ B;  1W2B A;  1PYW D;  1K28 A;  3I56 A;  4C2M H;  3QJY A;  1SMX A;  2CHB D;  5AFW A;  1ILQ A;  2IL8 A;  1QUQ A;  3RZO H;  4LF9 L;  4RAU C;  1CFM A;  2B2T C;  3IKJ A;  3KLS A;  4RHR A;  4YHH L;  4WOR A;  2AQ3 B;  4E6I A;  1HJP A;  4QUC A;  1DOM A;  1SNQ A;  2K32 A;  4Y7N B;  3T1H L;  4AQY Q;  3P7J A;  4CKB A;  1D5M C;  3P1H A;  3D4W A;  3ER0 A;  2WAQ B;  3MXN B;  3R2I A;  2KCM A;  3GDE A;  4ULL A;  1ZEQ X;  5FLX E;  1JJ2 A;  2N8N A;  1QWY A;  4TKO B;  3AQQ A;  2BH2 A;  4IPG A;  1AE2 A;  1HA6 A;  4BWG B;  1EYG A;  1YNJ C;  4DR7 Q;  1G6Z A;  2K05 A;  1DGS A;  1OTC A;  3T13 A;  1X56 A;  2R7F A;  3BU2 A;  1HR0 Q;  2DY7 A;  1F9R A;  2RDG A;  1U4L A;  1KL9 A;  4YCU A;  4G57 A;  1BBX C;  4JI4 Q;  4IUR A;  1HNW L;  1RDP D;  4BBS G;  4JV5 Q;  1KD1 C;  2WKC A;  3S2D B;  4JI2 L;  4I7Z C;  1TQO A;  1B3A A;  2B2U A;  4OIK A;  2BH8 A;  2LSS A;  3BYT B;  4OXP A;  1RCV D;  1JE5 A;  5C0X H;  3PO2 B;  1BCP D;  5TSS A;  4WFN 3;  2R7Z H;  2Z6K A;  1LT3 D;  1ASY A;  4FYD A;  5FOB B;  3CCL A;  1NCV A;  4DGZ A;  1LTT D;  3F2U A;  3BS1 A;  4R4O A;  3NEL A;  2XWJ B;  1EIY B;  1L0X B;  3HOU G;  4R4T A;  2EJF C;  3PUX A;  5C4Z A;  4QUF A;  2ENB A;  1TWG H;  2PI2 E;  1N9W A;  2NVY B;  3CW2 C;  2E5L L;  4A3K H;  1SBB B;  1R9T B;  1ML0 D;  1UNS A;  3HOY G;  4MIU A;  5G3L F;  3HOV G;  2RSN A;  1YHQ A;  2PPB C;  2ASB A;  1HZA A;  5IWA Q;  1J6Q A;  3HZX A;  1A6X A;  1A63 A;  1WD1 A;  1K9M C;  3CRL C;  1QVG A;  4KKU A;  4B3S L;  1KQS A;  2PQE A;  3J80 L;  1H9S B;  3PSI A;  4JC0 A;  1PZJ D;  4DV1 Q;  2NVX H;  2KEE A;  3DUZ A;  1WFQ A;  1EY4 A;  3BJU A;  1CKO A;  3JAM E;  1YNN C;  4ID6 A;  5FJ8 H;  5CV9 A;  3STB D;  2WIN B;  2CWA A;  3CCR A;  3I8Z A;  1XMQ Q;  1YIJ A;  1Y1W G;  2OTJ A;  1S72 A;  1SYF A;  2P5Z X;  1I3Q H;  2SNS A;  4PZ6 A;  5D3I B;  1CKN A;  2RHQ B;  1GM5 A;  1MHW C;  4Y52 H;  4OON A;  4R4C A;  4A3E G;  2I07 B;  1ICF B;  2CH4 A;  3NE5 B;  5FO7 B;  4HSV A;  1VQO A;  2MO0 A;  4N8X 1;  2UU9 Q;  2AUK A;  2HUG A;  3RLN A;  2Q8T A;  2RDH A;  1VQB A;  2K50 A;  4JV5 L;  2BDN A;  3KYH C;  4NPS A;  1HRJ A;  1EEI D;  1KNA A;  4RGN A;  3K0X A;  1LYL A;  2RSO A;  1PZK D;  2OXP A;  3GTM H;  3DEP A;  5J22 A;  3RN5 A;  3LX0 A;  2FMC A;  1Q1B A;  4A3F H;  2F0V A;  3X3M A;  3F2D A;  4KD4 A;  4X6A H;  1HHV A;  3T1Y Q;  1VDZ A;  1Y69 U;  3UDF A;  3CPW A;  5IT9 L;  4UPA A;  3C2P A;  4XQJ A;  3GO5 A;  4DFA A;  5HGT A;  4V0B A;  1R4P B;  3K5L A;  4P72 A;  1PLF A;  4JCV E;  2JA5 B;  2B2Y C;  3U58 A;  3W5O A;  4KKS A;  3M3Y B;  2LXK A;  5C44 G;  3NTK A;  1EY0 A;  1O7I A;  2NTS A;  3RZD B;  3K57 A;  4C3J G;  1LAC A;  3X3N A;  4X65 L;  1J5E L;  1A2U A;  2C9O A;  1ENF A;  4OWT B;  1DON A;  3RNU A;  4R1J A;  3R3O A;  1EZ6 A;  1OXU A;  3IFD A;  1YNJ D;  1QOH A;  1XTD A;  1XPO A;  5K36 H;  1UE5 A;  1HTL D;  2PNH A;  3FMC A;  4H7B A;  4HJ8 A;  2DY8 A;  1JQY D;  1D1K A;  1PV4 A;  1ASZ A;  3PMF A;  1JIC A;  2LFN A;  1JJC B;  1RF2 D;  4H0L C;  5J3B A;  1W6J A;  4B3M L;  1DYQ A;  1X65 A;  1NE3 A;  1HFN A;  1JT8 A;  1CSQ A;  2E2J H;  2PZW A;  1S5B D;  4CGY B;  4FF2 A;  4XTC S;  1GOZ A;  4DR4 Q;  1E1T A;  1MSH A;  2MFI A;  3NHH A;  1STN A;  2OQ0 A;  4HTH A;  1QCB D;  4A3D H;  4L8J A;  1HNZ Q;  3S1Q B;  2RCN A;  3I70 A;  4YY3 Q;  4IPH A;  4U68 A;  1Q7Y C;  4JYA Q;  3GTJ H;  4DUY Q;  2ALY B;  4NMZ A;  4FVM A;  1I6V C;  3MA2 B;  3UDX A;  2CW0 D;  4QIW E;  2PMZ B;  2Q2U A;  2Q2H A;  5M3M G;  4DR6 Q;  1K73 C;  1LLR D;  1RTN A;  3F1Z A;  4LFB Q;  1SJH D;  3SXH A;  4GOP A;  3S17 B;  1ZKO A;  1F2Y A;  1XJV A;  3L2P A;  4JK1 C;  1L1O A;  3K80 C;  3CAM A;  1BKB A;  4MTK A;  3DMU A;  2B2Y A;  3MAQ A;  2ZJQ A;  2EIF A;  4IO9 A;  2CQO A;  2YTY A;  2QW7 A;  3VYR A;  5CV6 A;  1HUN A;  2A8V A;  3PF4 A;  3J81 L;  1XXG A;  4Z9C B;  3H0G G;  4OX9 L;  2FMM A;  2HIX A;  1LV9 A;  4ZCK A;  2JA7 G;  3MHB A;  3MWY W;  5M5W H;  1CA5 A;  4C1N K;  2UXD L;  4F7X A;  3S14 B;  5ELD A;  2RF4 A;  1TWH B;  2ZXO A;  2JEB I;  3M7G A;  5D65 A;  3A5Z B;  4L6T B;  3GTQ H;  4X3K A;  3K5M A;  4GKJ L;  1FD7 D;  3CQZ B;  1VQF A;  3DEO A;  4TQU S;  3ERO A;  3KDF B;  5EKI A;  3OSO A;  2DN8 A;  3HKS A;  1P16 A;  2ZTC A;  2MGS A;  4DK6 C;  1PH9 A;  1IBL Q;  1QVF A;  1Y1V B;  2K5N A;  3KJP A;  2CCZ A;  5CR3 A;  2AHO B;  3A7A B;  1SEB D;  3EIV A;  4J6H A;  5EPJ A;  4BY1 B;  3NEM A;  3HOZ B;  4PMW A;  1QVC A;  3OYY A;  1PZI D;  4GKK Q;  3P20 A;  4A3J H;  2VL6 A;  1B4O A;  3BZK A;  3F8T A;  5ELC A;  1RJT A;  4ZAI A;  4C56 C;  1UEB A;  2KOL A;  3AU7 A;  5JEA H;  5I6W A;  1TVX A;  1Y8P B;  4DUY L;  2N49 A;  2F0W A;  1WTP A;  5A2Q L;  3Q0A A;  2IPK D;  4X66 L;  3TRZ A;  1P8L A;  1HH2 P;  5CBA E;  4A3C H;  3CCU A;  5C4J B;  5A35 A;  4CJ0 B;  5E4W C;  3D3R A;  1PRT C;  1D1I A;  2G9D A;  2UXC Q;  3I55 A;  4K5W A;  1N36 Q;  1Q82 C;  2NVQ B;  2MO1 A;  2F0K A;  1SYB A;  4K2L A;  3IFT A;  4QJF A;  1WTR A;  1PTO H;  1NTG A;  1LTI D;  5DAU A;  3HKZ B;  1BQQ T;  2JSO A;  4B3T L;  1EY6 A;  5BN3 A;  1K8G A;  2NVY H;  4DNI A;  4KV6 A;  1R9T H;  1JWU D;  4C3H H;  1Q3L A;  4BBR G;  1QB5 D;  4UAI A;  4ILW A;  4ZKC B;  5ELE A;  1V1Q A;  1EEF D;  3I72 A;  1F9P A;  4RKB A;  2LS0 1;  1Z47 A;  3CC4 A;  4A3B G;  2R7D A;  1CT1 D;  1M90 C;  5IYB G;  1GJX A;  3H6M A;  4KMU C;  4PMC A;  2HIV A;  4IQZ A;  3BYY B;  2EY1 A;  3H09 A;  1B70 B;  1VCI A;  2F3W A;  4IPD A;  2JQO A;  4HJA A;  1GUO A;  1SN8 A;  2F0D A;  2LKV A;  3TSS A;  4CHT B;  4HIO A;  5I9P A;  1LT4 D;  1RD9 D;  3NQI A;  4YCV A;  2R92 G;  1EUJ A;  3CME A;  3GTP B;  4A4I A;  3U4Z A;  1FYC A;  2NN6 I;  4NP5 A;  3FKI G;  5C0X J;  4BA2 I;  1SAP A;  3ERS X;  1GO3 E;  2O5I C;  4DPG A;  2L12 A;  1BO0 A;  4WJW A;  2WP8 J;  1QG7 A;  5IT9 E;  1NJI C;  2IWH A;  3HOW B;  4K6D A;  3E9I A;  1KHI A;  1PTO F;  4C3I G;  3M85 A;  3BVZ A;  2CVR A;  4ME5 A;  4LF7 Q;  1TWC B;  2K6A A;  2BA1 A;  2OF1 A;  2VZA A;  4A3F B;  3OOC A;  4HJ7 A;  4ODG A;  3A74 A;  4WJ3 M;  4DK1 A;  5FLX c;  2ZJR A;  3IL8 A;  1VF7 A;  1STG A;  4J1M A;  4DXF A;  1N8R C;  1T5X D;  5IGF A;  3Q22 A;  2RVL A;  2K04 A;  2IHE A;  1II3 A;  4EQ5 A;  1VQP A;  3S24 A;  1KC8 C;  3TP7 A;  4O42 A;  2TMP A;  2JA5 H;  2UUC Q;  5BR8 Q;  1GHJ A;  3W2D A;  2R6G A;  2JA6 B;  4IJL A;  3M3Y H;  2L9H A;  1XMO Q;  2F0F A;  1HUM A;  1STA A;  2BDO A;  1VQA A;  1W3S A;  2JP1 A;  3RZD H;  3PO2 G;  1PH7 A;  3A7L A;  1EY9 A;  4R8I A;  3RLO A;  1AFP A;  1KLU D;  1CZW A;  3FP9 A;  4GNX A;  4JI6 L;  1Y14 B;  3PV0 A;  4OL7 A;  1NUC A;  3JC6 6;  4DNR B;  4IFD H;  4L63 B;  1CKN B;  4P75 A;  2KCC A;  1CHP D;  5DEH A;  4BS9 A;  4DV6 L;  2HHH Q;  2CWP A;  3EFX D;  3UDI A;  1XPR A;  2Q2T A;  4LF9 Q;  4YWL A;  3DXJ C;  1KIX A;  4YHH Q;  3S16 B;  2B3G A;  1ROD A;  1SRO A;  4JI3 L;  4P73 A;  4PZ8 A;  2Z9H A;  5FO9 B;  1X55 A;  3T1H Q;  3WOE A;  3J7Z C;  2I46 A;  3OMG A;  2XWB B;  2PNR C;  3PO3 B;  4A3G G;  2EXZ A;  1VQ6 A;  1KRS A;  4DV4 L;  4A3I G;  3OW7 A;  3J7A F;  2RDF A;  2Z4H A;  2NZO A;  3KF8 A;  5IGB A;  2Z4I A;  1YJN A;  3STB C;  2ZJP A;  4LF4 L;  2F0E A;  3S1Q H;  2X6G A;  2K4K A;  2N78 A;  4QCL A;  1AH9 A;  2FIN B;  1D2B A;  2J4X A;  2EYH A;  1HA5 A;  2D0P A;  3U4V A;  1B3Q A;  1XYI A;  3I4M B;  2RCF A;  2F4V L;  1HNW Q;  2A19 A;  4LUO A;  1VQL A;  1N33 L;  2KBN A;  5K5P A;  4JI2 Q;  1C8C A;  3S17 H;  3J81 E;  2K03 A;  1GUN A;  4KHZ A;  4CDD C;  1RIP A;  1MI2 A;  1JMC A;  4GLV B;  3MVV A;  1W6K A;  3SK4 A;  2UUB L;  5M3F G;  2Z8L A;  1X3Q A;  3CC2 A;  2EQS A;  1LTR D;  3EQL C;  2B2W A;  2L1B A;  4QL5 A;  3VR3 A;  4PG3 A;  4XXE A;  1JOK A;  3FEW X;  1WVL A;  1VMP A;  1XPU A;  3OIP A;  2E5L Q;  4L5Q A;  1S5F D;  4OO1 G;  3H3V I;  1PVO A;  4BY7 H;  3PGZ A;  3E3X A;  3J81 j;  3S14 H;  1LTS D;  1VQE A;  2L15 A;  5GAE C;  5KRU A;  2HHH L;  4MN3 A;  3U9O A;  3CQZ H;  4X3S A;  4ZKB B;  4DNT B;  2PCF B;  1PFB A;  1V8Q A;  4NXM L;  4B3S Q;  1IYV A;  4YWM A;  5FK9 C;  1QIL A;  3PIO A;  5IP7 G;  1Y1V H;  2JN4 A;  2LXJ A;  3VR6 A;  1XNQ L;  1DM0 B;  5IYC H;  3DWA A;  1HZB A;  4C1N I;  3AEV A;  2MQH A;  4LF5 L;  1C4Q A;  1LTL A;  3FHW A;  4BY1 H;  3J7Y W;  2PW5 A;  5A2Q E;  3HOZ H;  4A3J B;  2XRQ D;  4R9W A;  4IZ8 A;  2HT1 A;  1E3P A;  5EGT A;  3EBE A;  5CBE E;  3HOX B;  5C3E G;  1VQD A;  3D31 A;  1DOL A;  5FLM G;  2EXD A;  3F2C A;  1PDQ A;  2AQ1 B;  4GOP B;  3SDZ A;  4L5R C;  3A55 A;  1H95 A;  2HCC A;  2ZXP A;  3TP5 A;  4DK0 A;  1IZ6 A;  1A15 A;  3G6J B;  3I4N G;  2J7Z A;  4A3M G;  2L11 A;  4B08 A;  2R3Z A;  3SE0 A;  1A2T A;  3G71 A;  2Q8R E;  4RMF A;  5C4J H;  1ET9 A;  1F77 A;  1JOO A;  2PI2 A;  4A93 G;  2XRS D;  2K5W A;  4JBK A;  2JXM B;  1O7Z A;  1SDF A;  1MGS A;  1QNU A;  2NVQ H;  5D3D A;  2UXB L;  2GA4 B;  4BXX H;  1PTO B;  4RGT A;  5COY A;  2QDL A;  2AKW B;  3OW2 A;  1SMY C;  2EYM A;  3I73 A;  1G8Z D;  3A8J E;  2PYK A;  3GQB A;  2JA8 G;  2CW0 C;  4YWK A;  1LUZ A;  4NB3 A;  1KAW A;  2CKZ B;  4C3H B;  2H5X A;  4IN3 A;  3GTG B;  4KHP L;  3VDY A;  2F4I A;  1OXX K;  2GVB A;  1K8O A;  3I90 A;  2B2T A;  3NK9 A;  2E74 C;  3KLS X;  1K0R A;  4X65 Q;  1J5E Q;  3MTS A;  1VQH A;  4K6L A;  2KJX A;  3M4Q A;  3H15 A;  2VUM B;  4DAM A;  3FVQ A;  5JEA J;  5L37 A;  2M9V A;  3IRB A;  2ICI A;  1S40 A;  2IY5 B;  2Q8I B;  1NY4 A;  3GV6 A;  3S1N B;  4X62 L;  2AMC B;  5KYI A;  4K0K L;  3GTP H;  3KFU A;  1PYB A;  3R2T A;  2KHS A;  4ALP A;  1LTA D;  3S1M B;  1NR4 A;  5CC4 A;  1BCP F;  2VQE L;  1V1P B;  4B3M Q;  4N8F A;  4JBW A;  3VR5 A;  1FR3 A;  3J7A V;  3M4O H;  2WB1 B;  4M1U B;  4POF A;  1EU3 A;  1FNU A;  3MZ5 A;  2KED A;  2EYF A;  2K52 A;  4FF1 A;  3HOW H;  2EY5 A;  2Z1C A;  1X32 A;  3FPP A;  3C3L A;  3CC7 A;  1RHP A;  1TWC H;  1O7Y A;  5HY6 A;  4KN4 C;  4HIM A;  4DR2 L;  4ZQ3 A;  2E8G A;  3OPO A;  2BOS A;  4RWS C;  3TEH B;  1WTH A;  4KI0 A;  1VQC A;  1N32 L;  2Y0S B;  2BCO A;  1EFI D;  2V4D A;  2B63 B;  3VR2 A;  4HN7 A;  4NXN L;  1O7L A;  5IOD A;  1MBY A;  1C9O A;  3TP8 A;  4KJO A;  1SE3 A;  1ICW A;  1QNK A;  1JWM D;  2D2C C;  1SYG A;  3EJI A;  1U0L A;  2JA6 H;  2FXQ A;  4OX9 Q;  2K1B A;  4GLX A;  4UDU C;  1X3P A;  2B39 A;  5C0X G;  1EQQ A;  1S5D D;  3BZD B;  1ESR A;  3EVQ A;  2F3V A;  3PCO B;  4PV1 C;  5I9O A;  1VQN A;  4FXK C;  2R7Z G;  1B1Z A;  3TQY A;  1B50 A;  2ZTE A;  3W1B A;  1WTW A;  2UXD Q;  2ZM6 L;  1KNE A;  3VYS A;  3RLF A;  1H9K A;  2PZU A;  3GV3 A;  5EPK A;  1YI2 A;  4GKJ Q;  1KXL A;  1GVP A;  3PQI A;  4R4Q A;  4AIM A;  4HMI A;  3CCJ A;  1R4Q B;  3I4O A;  4A3K G;  5ELF A;  2B2V C;  3S16 H;  4H02 A;  2MPM A;  3I2Z A;  4HSP A;  2VB2 X;  2ZTD A;  3PO3 H;  1EOT A;  5C4X H;  4LUV A;  3PIP 3;  3TS2 A;  2OWO A;  4BBS B;  3WDN A;  1IL2 A;  4JI5 L;  2LMC B;  4RHS A;  1VMC A;  4M8A A;  2WFW A;  5C5M A;  1SMY D;  4DAY A;  2JJQ A;  4HR7 B;  3EA6 A;  5FJ8 G;  2MJ8 A;  1JB3 A;  1EIF A;  3I4M H;  3AB9 A;  1D7Q A;  1WYD A;  4FXD A;  4X66 Q;  1SND A;  4KKT A;  1QZH A;  1WOC A;  2Z6B A;  3MXN A;  3S1R B;  2YV5 A;  2B8F A;  2OCE A;  4ABN A;  1I50 B;  2MNA A;  2PO4 A;  1NR2 A;  3ND8 A;  1CQF A;  5C4H A;  3HOY B;  2VXW A;  1HQR D;  2ZXR A;  3SEB A;  3HOV B;  2ES2 A;  2CFM A;  1DXM A;  5LMN L;  1K3B C;  1UE7 A;  2KUM A;  2WAQ E;  1YJ9 A;  4IFD J;  3BVG A;  4GNX B;  3SHL A;  3VA7 A;  4LF6 L;  5CV4 A;  2K5D A;  4B3T Q;  4A3L H;  4A3F G;  4V19 0;  1PMR A;  1YZ6 A;  5CV8 A;  4BY7 B;  3R8B A;  3K7U C;  1GD7 A;  1VS0 A;  3UE0 A;  4KLK A;  2AQ2 B;  1HCZ A;  4GZY C;  3CU7 A;  5IP9 H;  2R61 A;  4LFA L;  2K28 A;  5BN5 A;  1Y1W B;  1V1O A;  2E2H B;  4XYO A;  4DV7 L;  4JI1 L;  1FL0 A;  3N52 A;  4FF3 A;  1KDA A;  3CF5 A;  4FF4 A;  2QEJ C;  1B2T A;  2I0Q A;  4O0A A;  1LAB A;  4N9T A;  2DJF C;  1C0A A;  4HJ9 A;  1WTO A;  1DOK A;  2PQA A;  1U9R A;  4QB4 A;  2KHJ A;  1B53 A;  2D62 A;  2YU9 B;  2IX1 A;  3HOX H;  1D6E C;  4AYB B;  4X64 L;  1BBW A;  3GTL H;  1CQV A;  1L0W A;  1SE2 A;  3KJO A;  5IYD H;  4RKL A;  5LMU Q;  1WCM H;  3E5S A;  5K36 G;  2VS1 A;  2MP1 A;  2WAC A;  3I3C A;  1PH3 A;  3C1F A;  5CYU A;  2E2D C;  1BVS A;  2F0O A;  5JOB A;  1E2W A;  1BCP B;  2E2I H;  3D4D A;  4HIK A;  3URY A;  1HPC A;  3OIQ A;  5ELO A;  5KND A;  1IW7 C;  4NW2 A;  1GUT A;  5HGQ A;  4RH6 A;  4LAA A;  1BNZ A;  4B3R Q;  2WV6 D;  1X54 A;  2MHV A;  1M1K C;  4EX5 A;  4A3D G;  1OXS C;  5IOC A;  1STY A;  3DWP A;  4PNY A;  3CD6 A;  4O1N A;  5C44 B;  1TS3 A;  2HDM A;  2YTV A;  2XNA C;  1GUS A;  4C3J B;  1N34 L;  3J80 E;  2RA4 A;  4FNF A;  5ISR A;  1B9N A;  4DR5 L;  3GTG H;  1QUQ B;  5M5Y B;  1X9N A;  3L0O A;  3ERQ A;  1TR5 A;  2Q2I A;  3ZYY X;  2OEO A;  1IBM L;  1UEA B;  2I5L X;  1PTO D;  2NN6 H;  1TT2 A;  4CJ2 C;  3OMC A;  3J81 c;  3SK6 A;  3NPP A;  3CHB D;  4X3U A;  5M9O A;  1M4V A;  4DR1 L;  4JI6 Q;  1KRT A;  4EVO A;  5JAV A;  1VQ5 A;  2VUM H;  2DJG C;  4G7Z C;  1LT5 D;  1WTQ A;  1MJE A;  4DV6 Q;  2JEA I;  1DD2 A;  4DU9 A;  3S1N H;  1QJO A;  4LK1 C;  4TVA B;  1AZQ A;  3S15 H;  1UE1 A;  1PFN A;  4P71 A;  1G2S A;  2EZV A;  5KNC A;  4JI3 Q;  1FGB D;  4XT3 B;  1WTX A;  3S1M H;  3O13 A;  2E76 C;  4PZ7 A;  5LMU L;  1PH4 A;  3M4O B;  1E0B A;  4DV4 Q;  1Q8K A;  2C5C A;  1YIT A;  3L9A X;  4JI0 L;  5M3M B;  3K8A A;  2F52 A;  3R93 A;  4JW0 A;  3TDQ A;  1LO5 D;  3RD4 A;  3VYU A;  5KNB A;  2DGY A;  2XIW A;  3SVM A;  4LF4 Q;  1SXT A;  3E0E A;  3PUW A;  1Y8O B;  3UDG A;  2K5Q A;  2WAQ G;  1YJW A;  5I4D A;  4NKL A;  1H9J A;  4DK3 C;  3HP3 A;  1D8L A;  2EVB A;  2N3S A;  2F4V Q;  1TWA B;  1IBK L;  4B3R L;  4A3J G;  3DWQ A;  2N88 A;  1N33 Q;  3OTO L;  1FNW A;  1SE4 A;  1VQM A;  1G51 A;  5GAH C;  2BE5 D;  3H0G B;  1E2Z A;  4X3T A;  1I6H H;  4P74 A;  1BUV T;  4ZLT F;  5JEA G;  2NTT A;  5D14 A;  5T1I A;  2B63 H;  3PIO 3;  4BA1 I;  3KBG A;  1MJC A;  2UUB Q;  2WKD A;  1YBY A;  3CCM A;  5JPN C;  3C46 A;  4JVZ A;  2L0C A;  4Q0F A;  4DA2 A;  5FKA C;  4OEL B;  3W1G A;  4CDC C;  3ULP A;  2R93 H;  1EQR A;  1U4P A;  2F0S A;  1EYC A;  1UAP A;  4MNO A;  4EQP A;  1OO9 B;  4IOA A;  4A3C G;  1E7Z A;  1G6P A;  2F03 A;  1AZP A;  2F0T A;  2JK8 A;  2B8G A;  4KHV A;  1X3E A;  4KJN A;  3QWN A;  3I7F A;  1HZ9 A;  1WTV A;  1SSO A;  5ELN A;  2PMZ E;  1YHB A;  2X6L A;  3PUY A;  3NUC A;  1IXR A;  4OO1 I;  3K6O A;  4F88 A;  2A74 C;  3CCV A;  3D6C A;  4NXM Q;  1O78 A;  1EIG A;  4C3H G;  1XNQ Q;  2EYL A;  3VR4 A;  1K8M A;  1XNR Q;  4UP8 A;  4DV5 L;  2EE1 A;  2KA7 A;  1G29 1;  1I4P A;  2VQF L;  1BOS A;  3MFY A;  4DR3 L;  4LF5 Q;  3JAM i;  1XTC D;  5C4X B;  2Z0S A;  1FNV A;  3NXW A;  5IGE A;  1EY8 A;  4G7H C;  4BBS H;  3Q8D A;  4RFB A;  3SK8 A;  1EQV A;  3FPU B;  1IW7 D;  4DV3 L;  5CGK A;  4HMJ A;  5IGG A;  4DV0 L;  1TKW B;  1WI5 A;  2A68 C;  1WD0 A;  1JB7 A;  2F0H A;  3A0J A;  1IKM A;  1JWS D;  3V05 A;  3JAM c;  5KEE A;  1I94 Q;  4MTN A;  1AN8 A;  1KDC A;  1KDB A;  1EY5 A;  1UWV A;  3ULL A;  2IJ0 A;  3H3V H;  4HID A;  5COR A;  1HNX L;  4JBJ A;  4CKC A;  1JR0 D;  2QA4 A;  3HOU H;  2D5D A;  4GN3 B;  3S1R H;  1QE6 A;  1PXU A;  4KTA A;  3TRE A;  1I50 H;  1YHA A;  4JI7 L;  3GP7 A;  1LTG D;  4K5V A;  2HQL A;  3HOY H;  1J9O A;  1F9S A;  1SYD A;  4BBR B;  3HOV H;  1G91 A;  2DNE A;  2UXB Q;  2A6E D;  3BVM A;  4U67 3;  2EJG C;  4G7O C;  3HEJ A;  1A62 A;  2EY2 A;  5DM7 3;  1B44 D;  2OT2 A;  3KF6 A;  5LHY 1;  4TRD A;  3N6R A;  4AYB E;  4LF8 L;  2NUC A;  5NUC A;  2D9U A;  1FJG L;  5GRO A;  3H91 A;  4KHP Q;  5C3X A;  3NBH A;  3QO2 A;  1RL2 A;  4XQQ A;  4GN4 B;  5KYL A;  5I6Y A;  3I91 A;  2RKS A;  3WWV A;  3A8I E;  1Y1W H;  1B8A A;  1PRT F;  2F0J A;  2E2H H;  1SNO A;  2HQE A;  4QIW B;  4A3E H;  3KK7 A;  1XNR L;  1B9M A;  2JA5 G;  3FKI B;  4LWC A;  2BA0 A;  3M9B A;  1EWI A;  4GS3 A;  2HDL A;  3LNN A;  3W3A A;  4IOC A;  1PA6 A;  2G9H D;  1ZXT A;  4DAY B;  3FDT A;  4X62 Q;  4XYQ A;  2YU9 H;  1EQT A;  4CKE A;  3GTL B;  3D8G A;  3QG1 A;  4K0K Q;  3M4P A;  5G3L D;  4FXG C;  4C3I B;  3HKZ E;  3UE1 A;  2A69 C;  3UI2 A;  3I4L A;  4KD3 A;  4JOI C;  4IFD G;  5I2Y A;  2VQE Q;  1WCM B;  5GAG C;  5DM6 3;  3NP8 A;  2QF7 A;  3K7A B;  1L1O B;  3TS0 A;  2RQX A;  1JJG A;  1I94 L;  2K33 A;  1PH1 A;  2ID0 A;  1VQI A;  2XGT A;  1F2Z A;  1AEX A;  3K81 C;  2E2I B;  3HRZ C;  4ZK9 B;  4APV A;  1ESF A;  1SNP A;  3HFZ B;  5C3E H;  1Q1E A;  1NNX A;  1MSG A;  4EQO A;  1I4G A;  4CJ1 B;  1OXT A;  4DR2 Q;  3E6Z X;  2QCP X;  4QF4 A;  3NWT A;  1ZYR D;  3CKI B;  1Q81 C;  2XVS A;  2AUJ D;  1N32 Q;  4IPC A;  1F2M A;  2M00 A;  1H9M A;  3DHQ A;  2UUA L;  5JJK A;  4KK7 A;  1JE4 A;  5C44 H;  4LFC L;  5JVG 3;  4C3J H;  4NXN Q;  2F0G A;  1D5X C;  2K5H A;  4DUZ Q;  1LM0 A;  5M5Y H;  4B9X A;  4DAP A;  1GUG A;  1S3O A;  3ONA B;  3AFQ A;  3QR8 A;  5LL6 X;  4XDX A;  1U4R A;  3NTI A;  1IYJ B;  5IIF A;  1VF5 C;  1Q46 A;  5DLQ E;  2NVT B;  3F2B A;  4DV2 L;  4J15 A;  2ZT9 C;  3MXG A;  5ELB A;  3U9S A;  1FVI A;  4HAE A;  1TY2 A;  1EYD A;  2XTI A;  3MXP A;  1TWF H;  3MXU A;  2PQA B;  1T9H A;  2N55 A;  4UP7 A;  4HCE A;  2ZM6 Q;  3MEH A;  2DNC A;  1PH2 A;  2A68 D;  5J39 A;  1YEZ A;  5C0X I;  3GTK B;  1Q12 A;  1RTO A;  4A3G B;  4GN5 A;  2EYJ A;  2YTX A;  3HS0 C;  4A3I B;  2KVM A;  4HJ5 A;  2IHF A;  2TSS A;  3S15 B;  2A5H A;  1SYC A;  4JOI A;  5LMN W;  4BY7 G;  3GD7 A;  3VA5 A;  2PW7 A;  3KLW A;  4AQY L;  1BR9 A;  1E24 A;  4IUU A;  1EOV A;  2L5T A;  1PH6 A;  1SNM A;  3CP0 A;  1JC7 A;  2F0M A;  2HCI A;  1A8V A;  4H44 C;  2L55 A;  5M3M H;  4WRD A;  4JI5 Q;  1V9P A;  1EU4 A;  3G48 A;  2FHT A;  2NYZ D;  1UE6 A;  1Y1V G;  3HGB A;  4PMB A;  4DR7 L;  1Z9F A;  5IYC G;  1HR0 L;  4MZ9 A;  4BY1 G;  5M3F B;  4JI4 L;  3HOZ G;  1TWA H;  4GLA C;  5IY0 A;  1GUW A;  4AYB G;  1CSP A;  1I6H B;  3H0G H;  5IGC A;  2AWO A;  2JA7 H;  1SYE A;  3PUZ A;  1BXT A;  3A56 A;  3BG3 A;  3S2H B;  1SLJ A;  4DUZ L;  1NSN S;  3D4R A;  5EPL A;  3ICE A;  3B6Y A;  3CXC A;  2X69 A;  4NDX A;  1XX8 A;  5LMN Q;  4A75 A;  4DKA C;  2R93 B;  2K01 A;  5T1G A;  3K0Y A;  2IX0 A;  4LF6 Q;  4GOP C;  3M7N A;  5LL6 S;  1TII D;  2LY7 A;  2MUY A;  1L1O C;  2VY3 A;  1IHZ A;  3J80 i;  1C48 A;  1PFS A;  1I5F A;  1QZG A;  4BXX G;  3A8K E;  5M5X B;  1PHJ A;  2A69 D;  5IWA L;  3K5N A;  3GTO B;  3TN2 A;  2PZT A;  1KAB A;  5EKK A;  4LFA Q;  3HKZ G;  5BN4 A;  1Y8N B;  1EY7 A;  2J0T D;  1JOR A;  5C3E B;  4DV7 Q;  3MFG A;  4JI1 Q;  4KY5 A;  2I5H A;  3J80 c;  1F9Q A;  1CHQ D;  3E0J A;  1LTB D;  4DV1 L;  1PTO C;  1S5E D;  1CTM A;  3TP6 A;  1Q8I A;  1A3T A;  4I65 A;  1RKN A;  2KCN A;  4O2D A;  1XMQ L;  1VQ7 A;  5AJ3 Q;  1PRT B;  5H1S E;  1GXD C;  1TS2 A;  4PQX A;  3OWE B;  3I4N B;  4LNQ A;  4A3M B;  2GVA A;  3TZD A;  4X64 Q;  4B9W A;  1V43 A;  1D5Z C;  4K14 A;  4UY8 C;  2KEC A;  1ILP A;  2UU9 L;  3U50 C;  3ULJ A;  1I4Q A;  4H13 C;  4A93 B;  1XWE A;  2KQ3 A;  4JPB W;  2WII B;  3TBI B;  4F87 A;  1DJR D;  1A0I A;  3D0F A;  2L4N A;  4AH6 A;  4POG A;  4DXG A;  5E4X A;  1SFO B;  3HOU B;  1A3U A;  1Z6H A;  1A3V A;  2JA8 B;  2K75 A;  4P2C B;  4K8I A;  4LMQ D;  5C6A A;  5C3W A;  1HZC A;  3T53 B;  1VQ9 A;  1MKH A;  3RN2 A;  1NBW A;  2HD3 A;  4BBR H;  3T1Y L;  2VW9 A;  1CI3 M;  4HCS A;  2EY6 A;  3HOW G;  3S9W A;  5IT9 c;  4ZUI A;  4R8N A;  5JJI A;  2O5J C;  1H9R A;  4IUQ A;  1DZ1 A;  1ENC A;  1STE A;  1N34 Q;  4A3B H;  4KY7 A;  4ZYS A;  1TY0 A;  2H4O A;  5IYB H;  2G5D A;  2BE5 C;  1MIU A;  4DR5 Q;  1K83 H;  4CDE C;  2VNU D;  1O80 A;  1IBM Q;  1KTK A;  2EOT A;  1SRU A;  3LGJ A;  1WJJ A;  4IUN A;  2K14 A;  1YNN D;  1IYU A;  2B2V A;  2DUD A;  4F8M A;  4IUT A;  1EYA A;  4A3E B;  3QIA A;  1PH5 A;  2R92 H;  4DR1 Q;  2QKI C;  3KF8 B;  1X6O A;  3FKI H;  1IKL A;  2FJ2 A;  4KN7 C;  3T51 B;  2A6H C;  4L5S A;  1HFG A;  2JA6 G;  3H94 A;  5EBD A;  3A5U A;  4C2M B;  5AJ3 L;  5FO8 B;  2NBF A;  4OGQ C;  2EDG A;  1BBU A;  3RZO B;  3L7Z C;  1K3R A;  2FFK B;  4ZUJ A;  1JCK B;  3T56 B;  2OTL A;  4C3I H;  2F1M A;  3Q24 A;  2F0P A;  2F0L A;  2XN9 C;  4EQN A;  4CBV A;  4Y7N H;  3AYH B;  2CH4 W;  3TZU A;  2EYO A;  2NZH A;  1H9S A;  4RGO S;  4RCN A;  3K7A H;  4JI0 Q;  4QY7 A;  1M8A A;  4DR4 L;  4K2K A;  1GHK A;  3CCS A;  3AFP A;  2F0I A;  4JG2 A;  3K58 A;  3HG9 A;  1HNZ L;  2I5M X;  3G6E A;  2SOB A;  4OHJ A;  4YY3 L;  1AE3 A;  4JYA L;  3IAY A;  1L2F A;  3PO3 G;  4FDB A;  5FLX L;  4A76 A;  5C4X G;  5CV5 A;  2F3I A;  3KF6 B;  1U4M A;  4ME3 A;  1IBK Q;  4WJ4 A;  4DR6 L;  4DF7 A;  4LFB L;  1VQJ A;  2D0O A;  3OTO Q;  4YIJ A;  1I4R A;  3LWU A;  1V1P A;  2E75 C;  4XIG S;  3S2D H;  3J81 i;  1HQM C;  2SEB D;  3NBH B;  3PO2 H;  2A73 B;  2F0U A;  3P75 A;  2KCT A;  3SGI A;  2R7Z B;  5E7N A;  3VYT A;  1C7Y A;  3K59 A;  2XSC A;  3I4M G;  4L5T A;  3NBI A;  3SR1 A;  3PIP A;  3OWF A;  1PYS B;  2QDB A;  3KUP A;  1HXY D;  4UHV A;  2WB1 E;  2NVT H;  2V1C C;  1OXV A;  1J8I A;  4ZRZ A;  5IE8 A;  1TWG B;  2JYO A;  4A3K B;  1JOQ A;  3ITP A;  3G4S A;  1TWF B;  5JJL A;  2QEX A;  2A6E C;  3G7L A;  3H3V C;  1FGU A;  2NZ1 D;  2RBM A;  2KHI A;  4RCO A;  3V2T A;  3BZC A;  3GTK H;  4A3G H;  3D6W A;  5HUR A;  2NWG A;  3ND9 A;  4A3I H;  2M2L A;  2YYZ A;  4OWW B;  1NAP A;  4A3L G;  4OIJ A;  1ONL A;  3Q23 A;  4I7A A;  3RMH A;  1VQ4 A;  3DM3 A;  2Y0S E;  5KIX A;  1IBL L;  1UUP A;  1E1O A;  5GQO A;  4OEM B;  2NVX B;  1TXY A;  4IJH A;  1I4H A;  5EAY A;  4DV5 Q;  5CV7 A;  2RHS B;  2VQF Q;  1VQG A;  5IGD A;  4GNX C;  4DR3 Q;  5IP9 G;  1EIH A;  1SJE D;  5EKL A;  5E1F A;  4GKK L;  4DN4 M;  3KBX A;  1EZ8 A;  1I3Q B;  4EGV A;  1STH A;  5F2D A;  4DV3 Q;  3K5O A;  4FO2 A;  3CCE A;  3NWS A;  4DV0 Q;  1PFM A;  3LWE A;  4IUV A;  4XT1 B;  1Q90 A;  2OQK A;  2CQA A;  3JAM L;  3M4Y A;  2ICE C;  3E9H A;  5I2X A;  4N9P A;  5M3F H;  3NTH A;  3RR5 A;  1S4Z A;  4RA8 A;  1AP0 A;  2EPB A;  3PUV A;  3HOX G;  1HNX Q;  4J8Q A;  4QQB X;  1STB A;  2JA7 B;  1CK1 A;  3GTM B;  5IYD G;  3RUZ A;  3QOJ A;  4FP5 D;  1SNC A;  4JI8 Q;  3T16 A;  2QIL A;  2SNM A;  4JI7 Q;  2K5V A;  3NQT A;  1EFW A;  1WCM G;  3S2H H;  4OO1 H;  1CZG A;  2UXC L;  1KLG D;  1VQ8 A;  4LUZ A;  1N36 L;  4G4K A;  5JPM C;  5KGU A;  3QOL A;  1E2V A;  3SK5 A;  1TS4 A;  2IX3 A;  2A6H D;  1YVC A;  4QMG A;  1NMF A;  1ET6 A;  3CMA A;  1K0S A;  5GAD C;  4QGU A;  1NMG A;  3CPF A;  4IAL A;  2B29 A;  3CCQ A;  1ZYR C;  1KAA A;  4LF8 Q;  4S3S A;  2SDF A;  5IP7 H;  1CM9 A;  1CUK A;  2KEN A;  3NSW A;  5J1Z A;  3V96 A;  1FJG Q;  4K5X A;  3MC0 B;  4UP9 A;  5M5X H;  3DLL A;  4R4I A;  1U5K A;  3FRP B;  1BCP C;  1Z7T A;  5JJZ A;  3PF5 A;  3GTO H;  5JVH 3;  1TS5 A;  4JBM A;  1X3F A;  3C1E A;  3OHX C;  1SE8 A;  3WOF A;  2B2W C; 
#chains in the Genus database with same CATH homology
 3BDO A;  3L3O C;  2K7V A;  1ENA A;  2H1E A;  4LJZ C;  1G2T A;  4HED A;  2NN6 G;  1CA6 A;  4Q5V A;  1MD2 D;  2EJM A;  4RGM A;  2O4X A;  2IW3 A;  3CRK C;  4IUP A;  5C5L A;  1IL8 A;  1HTP A;  1S5C D;  4KY6 A;  1I4X A;  1AW7 A;  4MHE A;  3AMU A;  1EWH A;  4TSS A;  2E2J B;  2F0N A;  1PRT D;  5EJW A;  2AWN A;  1EWC A;  4IFD I;  4A3D B;  1L0Y B;  2EYP A;  3BDC A;  3Q6S A;  3GTJ B;  5CMD A;  1EL0 A;  4DAV A;  1LT6 D;  2IT1 A;  3QB3 A;  1BF4 A;  2NB0 A;  3KLR A;  3TME A;  3A54 A;  2F0Q A;  3DM1 A;  4A3B B;  2B2U C;  3T4A C;  1F2L A;  1T5E A;  3BDL A;  1K83 B;  2VB3 X;  4K8J A;  1DCZ A;  5EBC A;  2JE6 I;  5E3F A;  5EQ0 A;  1TU2 B;  5M5W B;  2R92 B;  5DNF A;  1BDO A;  4XQN A;  2O2L D;  3GTQ B;  1PYW D;  3QJY A;  2CHB D;  5AFW A;  1ILQ A;  2IL8 A;  4RAU C;  1CFM A;  2B2T C;  3IKJ A;  3KLS A;  4RHR A;  4WOR A;  2AQ3 B;  4E6I A;  4QUC A;  1DOM A;  1SNQ A;  2K32 A;  4Y7N B;  3P7J A;  4CKB A;  1D5M C;  3P1H A;  3D4W A;  2WAQ B;  3R2I A;  4ULL A;  1ZEQ X;  5FLX E;  1QWY A;  4TKO B;  1HA6 A;  4BWG B;  1YNJ C;  1G6Z A;  2K05 A;  3T13 A;  2DY7 A;  1F9R A;  2RDG A;  1U4L A;  4G57 A;  1BBX C;  4IUR A;  1RDP D;  2WKC A;  3S2D B;  4I7Z C;  1TQO A;  1B3A A;  2B2U A;  4OIK A;  3BYT B;  3PO2 B;  1RCV D;  5C0X H;  1BCP D;  5TSS A;  4WFN 3;  1LT3 D;  4FYD A;  1NCV A;  4DGZ A;  1LTT D;  3F2U A;  3BS1 A;  2XWJ B;  1L0X B;  2EJF C;  3PUX A;  5C4Z A;  4QUF A;  2ENB A;  2NVY B;  1SBB B;  1R9T B;  1ML0 D;  1UNS A;  4MIU A;  5G3L F;  2RSN A;  2PPB C;  3HZX A;  1A6X A;  1WD1 A;  3CRL C;  4KKU A;  2PQE A;  3J80 L;  1H9S B;  1PZJ D;  2KEE A;  3DUZ A;  1EY4 A;  3JAM E;  1YNN C;  4ID6 A;  5CV9 A;  2WIN B;  3I8Z A;  1SYF A;  2SNS A;  5D3I B;  2I07 B;  3NE5 B;  5FO7 B;  4HSV A;  2AUK A;  2HUG A;  2Q8T A;  2RDH A;  2BDN A;  1HRJ A;  1EEI D;  1KNA A;  4RGN A;  2RSO A;  1PZK D;  2OXP A;  3DEP A;  5J22 A;  3LX0 A;  2FMC A;  1Q1B A;  2F0V A;  3X3M A;  4KD4 A;  1HHV A;  1VDZ A;  1Y69 U;  5IT9 L;  3C2P A;  4XQJ A;  3GO5 A;  4DFA A;  5HGT A;  4V0B A;  1R4P B;  3K5L A;  1PLF A;  2JA5 B;  2B2Y C;  4KKS A;  3M3Y B;  3NTK A;  1EY0 A;  3RZD B;  2NTS A;  3K57 A;  4C3J G;  1LAC A;  3X3N A;  1A2U A;  2C9O A;  1ENF A;  1DON A;  3R3O A;  1EZ6 A;  1OXU A;  3IFD A;  1YNJ D;  1QOH A;  5K36 H;  1HTL D;  3FMC A;  4H7B A;  2DY8 A;  1JQY D;  1D1K A;  3PMF A;  1JIC A;  2LFN A;  1RF2 D;  4H0L C;  1W6J A;  1DYQ A;  1HFN A;  2PZW A;  1S5B D;  4CGY B;  4FF2 A;  4XTC S;  1GOZ A;  1MSH A;  3NHH A;  1STN A;  4HTH A;  1QCB D;  4L8J A;  3S1Q B;  3I70 A;  4U68 A;  4NMZ A;  4FVM A;  1I6V C;  3MA2 B;  2CW0 D;  2PMZ B;  1LLR D;  1RTN A;  1SJH D;  3SXH A;  3S17 B;  1ZKO A;  1F2Y A;  4JK1 C;  3DMU A;  2B2Y A;  3MAQ A;  3VYR A;  5CV6 A;  1HUN A;  3J81 L;  1XXG A;  4Z9C B;  2FMM A;  1LV9 A;  3MHB A;  3MWY W;  1CA5 A;  4C1N K;  4F7X A;  3S14 B;  5ELD A;  1TWH B;  2ZXO A;  2JEB I;  3M7G A;  5D65 A;  4L6T B;  4X3K A;  3K5M A;  1FD7 D;  3CQZ B;  3DEO A;  4TQU S;  3ERO A;  5EKI A;  2DN8 A;  3OSO A;  2MGS A;  1Y1V B;  5CR3 A;  3A7A B;  1SEB D;  4J6H A;  5EPJ A;  4BY1 B;  3HOZ B;  4PMW A;  1PZI D;  3P20 A;  1B4O A;  5ELC A;  1RJT A;  4ZAI A;  4C56 C;  3AU7 A;  2KOL A;  5JEA H;  5I6W A;  1TVX A;  1Y8P B;  2F0W A;  1WTP A;  5A2Q L;  3Q0A A;  2IPK D;  5CBA E;  5C4J B;  5A35 A;  4CJ0 B;  5E4W C;  3D3R A;  1PRT C;  1D1I A;  2G9D A;  4K5W A;  2NVQ B;  2F0K A;  1SYB A;  4K2L A;  3IFT A;  1WTR A;  1PTO H;  1LTI D;  5DAU A;  3HKZ B;  1BQQ T;  2JSO A;  1EY6 A;  5BN3 A;  4KV6 A;  1JWU D;  1Q3L A;  1QB5 D;  4UAI A;  4ILW A;  4ZKC B;  5ELE A;  1EEF D;  3I72 A;  1F9P A;  4RKB A;  2LS0 1;  1Z47 A;  1CT1 D;  1GJX A;  3H6M A;  4KMU C;  4PMC A;  4IQZ A;  3BYY B;  2EY1 A;  3H09 A;  1VCI A;  2F3W A;  1GUO A;  2F0D A;  2LKV A;  3TSS A;  4CHT B;  5I9P A;  1LT4 D;  1RD9 D;  3NQI A;  3GTP B;  1FYC A;  2NN6 I;  4NP5 A;  5C0X J;  4BA2 I;  1SAP A;  2O5I C;  2L12 A;  1BO0 A;  4WJW A;  2WP8 J;  1QG7 A;  5IT9 E;  3HOW B;  2IWH A;  4K6D A;  1PTO F;  4C3I G;  3M85 A;  3BVZ A;  2CVR A;  4ME5 A;  1TWC B;  2K6A A;  2BA1 A;  2OF1 A;  4A3F B;  3OOC A;  4ODG A;  4DK1 A;  3IL8 A;  1VF7 A;  1STG A;  4J1M A;  4DXF A;  1T5X D;  5IGF A;  3Q22 A;  2RVL A;  2K04 A;  1II3 A;  3TP7 A;  4O42 A;  2TMP A;  1GHJ A;  3W2D A;  2R6G A;  2JA6 B;  2L9H A;  2F0F A;  1HUM A;  1STA A;  2BDO A;  2JP1 A;  3A7L A;  1EY9 A;  4R8I A;  1AFP A;  1KLU D;  1CZW A;  3PV0 A;  4OL7 A;  1NUC A;  4DNR B;  4IFD H;  4L63 B;  2KCC A;  1CHP D;  5DEH A;  4BS9 A;  3EFX D;  3DXJ C;  3S16 B;  1ROD A;  5FO9 B;  3WOE A;  2I46 A;  3OMG A;  2XWB B;  2PNR C;  3PO3 B;  2EXZ A;  3OW7 A;  3J7A F;  2RDF A;  2Z4H A;  3KF8 A;  5IGB A;  2Z4I A;  2F0E A;  2X6G A;  4QCL A;  2FIN B;  1D2B A;  2J4X A;  2EYH A;  1HA5 A;  3I4M B;  1XYI A;  5K5P A;  1C8C A;  3J81 E;  2K03 A;  1GUN A;  4KHZ A;  1MI2 A;  3MVV A;  1W6K A;  3SK4 A;  2Z8L A;  1X3Q A;  1LTR D;  3EQL C;  2B2W A;  2L1B A;  3VR3 A;  4XXE A;  1JOK A;  3FEW X;  1WVL A;  1VMP A;  3OIP A;  1S5F D;  4OO1 G;  1LTS D;  5KRU A;  4MN3 A;  3U9O A;  4X3S A;  4ZKB B;  4DNT B;  2PCF B;  1PFB A;  1V8Q A;  1IYV A;  5FK9 C;  1QIL A;  3VR6 A;  1DM0 B;  3DWA A;  4C1N I;  1C4Q A;  3J7Y W;  2PW5 A;  5A2Q E;  4A3J B;  2XRQ D;  4R9W A;  4IZ8 A;  5EGT A;  5CBE E;  3HOX B;  3D31 A;  1DOL A;  1PDQ A;  2AQ1 B;  3SDZ A;  3A55 A;  2HCC A;  2ZXP A;  3TP5 A;  4DK0 A;  1A15 A;  3G6J B;  2J7Z A;  2L11 A;  4B08 A;  2R3Z A;  3SE0 A;  1A2T A;  2Q8R E;  1ET9 A;  1F77 A;  1JOO A;  2XRS D;  2K5W A;  2JXM B;  1O7Z A;  1SDF A;  1MGS A;  1QNU A;  5D3D A;  2GA4 B;  1PTO B;  4RGT A;  5COY A;  1SMY C;  2EYM A;  3I73 A;  1G8Z D;  3A8J E;  2PYK A;  3GQB A;  2CW0 C;  4C3H B;  4IN3 A;  3GTG B;  2F4I A;  1OXX K;  1K8O A;  3I90 A;  2B2T A;  3NK9 A;  2E74 C;  3KLS X;  3MTS A;  4K6L A;  2KJX A;  2VUM B;  3FVQ A;  5JEA J;  2M9V A;  2ICI A;  2Q8I B;  3GV6 A;  3S1N B;  5KYI A;  3R2T A;  2KHS A;  1LTA D;  3S1M B;  1NR4 A;  5CC4 A;  1BCP F;  1V1P B;  4JBW A;  3VR5 A;  1FR3 A;  3J7A V;  2WB1 B;  4M1U B;  1EU3 A;  1FNU A;  3MZ5 A;  2KED A;  2EYF A;  4FF1 A;  2EY5 A;  2Z1C A;  1X32 A;  3FPP A;  3C3L A;  1RHP A;  1O7Y A;  4KN4 C;  4ZQ3 A;  3OPO A;  2BOS A;  4RWS C;  4KI0 A;  2Y0S B;  2BCO A;  1EFI D;  2V4D A;  2B63 B;  3VR2 A;  4HN7 A;  1O7L A;  5IOD A;  1MBY A;  3TP8 A;  4KJO A;  1SE3 A;  1ICW A;  1QNK A;  1JWM D;  2D2C C;  1SYG A;  3EJI A;  2K1B A;  4UDU C;  1X3P A;  2B39 A;  5C0X G;  1S5D D;  3BZD B;  1ESR A;  3EVQ A;  2F3V A;  4PV1 C;  5I9O A;  4FXK C;  1B1Z A;  1B50 A;  1WTW A;  1KNE A;  3VYS A;  3RLF A;  1H9K A;  2PZU A;  3GV3 A;  5EPK A;  4HMI A;  1R4Q B;  5ELF A;  2B2V C;  2MPM A;  4HSP A;  2VB2 X;  1EOT A;  3PIP 3;  4BBS B;  3WDN A;  2LMC B;  4RHS A;  1VMC A;  4M8A A;  5C5M A;  1SMY D;  4DAY A;  4HR7 B;  3EA6 A;  2MJ8 A;  1JB3 A;  3AB9 A;  4FXD A;  1SND A;  4KKT A;  3MXN A;  3S1R B;  2B8F A;  4ABN A;  1I50 B;  2PO4 A;  1NR2 A;  3ND8 A;  1CQF A;  5C4H A;  3HOY B;  2VXW A;  1HQR D;  2ZXR A;  3SEB A;  3HOV B;  1DXM A;  2KUM A;  4IFD J;  3BVG A;  3SHL A;  3VA7 A;  5CV4 A;  2K5D A;  4BY7 B;  4V19 0;  1PMR A;  5CV8 A;  3R8B A;  2AQ2 B;  1HCZ A;  4GZY C;  3CU7 A;  2R61 A;  2K28 A;  5BN5 A;  1Y1W B;  1V1O A;  2E2H B;  4XYO A;  3N52 A;  4FF3 A;  1KDA A;  4FF4 A;  2QEJ C;  1B2T A;  1LAB A;  4N9T A;  1WTO A;  1DOK A;  1U9R A;  4QB4 A;  1B53 A;  2D62 A;  2YU9 B;  2IX1 A;  1D6E C;  4AYB B;  1CQV A;  1SE2 A;  4RKL A;  3E5S A;  5K36 G;  2MP1 A;  2WAC A;  3I3C A;  3C1F A;  5CYU A;  2E2D C;  2F0O A;  5JOB A;  1E2W A;  1BCP B;  3D4D A;  3URY A;  1HPC A;  3OIQ A;  5KND A;  1IW7 C;  4NW2 A;  1GUT A;  4RH6 A;  4LAA A;  1BNZ A;  2WV6 D;  2MHV A;  1OXS C;  5IOC A;  1STY A;  3DWP A;  4PNY A;  4O1N A;  5C44 B;  1TS3 A;  2HDM A;  2XNA C;  1GUS A;  4C3J B;  3J80 E;  2RA4 A;  4FNF A;  5ISR A;  1B9N A;  5M5Y B;  3ERQ A;  1TR5 A;  3ZYY X;  2OEO A;  1UEA B;  1PTO D;  2NN6 H;  1TT2 A;  4CJ2 C;  3OMC A;  3SK6 A;  3NPP A;  3CHB D;  4X3U A;  5M9O A;  1M4V A;  4EVO A;  5JAV A;  4G7Z C;  1LT5 D;  1WTQ A;  2JEA I;  1DD2 A;  4DU9 A;  1QJO A;  4LK1 C;  1AZQ A;  1PFN A;  1G2S A;  2EZV A;  5KNC A;  1FGB D;  4XT3 B;  1WTX A;  3O13 A;  2E76 C;  3M4O B;  1E0B A;  2C5C A;  3L9A X;  5M3M B;  3R93 A;  3TDQ A;  1LO5 D;  3RD4 A;  3VYU A;  5KNB A;  2XIW A;  3SVM A;  1SXT A;  3PUW A;  1Y8O B;  2K5Q A;  5I4D A;  4NKL A;  1H9J A;  3HP3 A;  2EVB A;  1TWA B;  3DWQ A;  2N88 A;  1FNW A;  1SE4 A;  2BE5 D;  3H0G B;  1E2Z A;  4X3T A;  4ZLT F;  1BUV T;  5JEA G;  2NTT A;  5D14 A;  5T1I A;  3PIO 3;  4BA1 I;  3KBG A;  2WKD A;  5JPN C;  3C46 A;  2L0C A;  4Q0F A;  4DA2 A;  5FKA C;  1U4P A;  2F0S A;  1EYC A;  1UAP A;  4EQP A;  1OO9 B;  2F03 A;  1AZP A;  2F0T A;  2B8G A;  4KHV A;  4KJN A;  3QWN A;  1WTV A;  1SSO A;  3PUY A;  2X6L A;  3NUC A;  4OO1 I;  3K6O A;  4F88 A;  2A74 C;  3D6C A;  1O78 A;  1EIG A;  4C3H G;  2EYL A;  3VR4 A;  1K8M A;  2EE1 A;  2KA7 A;  1G29 1;  1I4P A;  1BOS A;  3MFY A;  1XTC D;  5C4X B;  1FNV A;  3NXW A;  5IGE A;  1EY8 A;  4G7H C;  4RFB A;  3SK8 A;  1EQV A;  3FPU B;  1IW7 D;  5CGK A;  4HMJ A;  5IGG A;  1TKW B;  2A68 C;  1WD0 A;  2F0H A;  1IKM A;  1JWS D;  3V05 A;  5KEE A;  1AN8 A;  1KDC A;  1KDB A;  1EY5 A;  2IJ0 A;  5COR A;  4CKC A;  1JR0 D;  2D5D A;  1QE6 A;  1PXU A;  4KTA A;  3GP7 A;  1LTG D;  4K5V A;  1J9O A;  1F9S A;  1SYD A;  4BBR B;  1G91 A;  2DNE A;  2A6E D;  3BVM A;  4U67 3;  2EJG C;  4G7O C;  3HEJ A;  2EY2 A;  5DM7 3;  1B44 D;  2OT2 A;  5LHY 1;  4TRD A;  3N6R A;  2NUC A;  5NUC A;  2D9U A;  3H91 A;  5C3X A;  3NBH A;  3QO2 A;  4XQQ A;  5KYL A;  5I6Y A;  3I91 A;  2RKS A;  3A8I E;  1PRT F;  2F0J A;  1SNO A;  2HQE A;  4QIW B;  3KK7 A;  1B9M A;  3FKI B;  2BA0 A;  2HDL A;  3LNN A;  3W3A A;  2G9H D;  1ZXT A;  3FDT A;  4XYQ A;  1EQT A;  4CKE A;  3GTL B;  3D8G A;  3QG1 A;  5G3L D;  4FXG C;  4C3I B;  2A69 C;  3UI2 A;  3I4L A;  4KD3 A;  4IFD G;  5I2Y A;  1WCM B;  5DM6 3;  3NP8 A;  2QF7 A;  3K7A B;  2RQX A;  2K33 A;  2ID0 A;  1F2Z A;  1AEX A;  2E2I B;  3HRZ C;  4ZK9 B;  1ESF A;  1SNP A;  1Q1E A;  1MSG A;  4EQO A;  1I4G A;  4CJ1 B;  1OXT A;  3E6Z X;  2QCP X;  4QF4 A;  3NWT A;  1ZYR D;  3CKI B;  2XVS A;  2AUJ D;  1F2M A;  2M00 A;  1H9M A;  3DHQ A;  4KK7 A;  1JE4 A;  5JVG 3;  2F0G A;  1D5X C;  4B9X A;  4DAP A;  1GUG A;  3ONA B;  5LL6 X;  4XDX A;  1U4R A;  3NTI A;  5IIF A;  1VF5 C;  2NVT B;  2ZT9 C;  3MXG A;  5ELB A;  3U9S A;  4HAE A;  1TY2 A;  1EYD A;  3MXU A;  3MXP A;  2N55 A;  4HCE A;  3MEH A;  2DNC A;  2A68 D;  5J39 A;  5C0X I;  3GTK B;  1Q12 A;  1RTO A;  4A3G B;  2EYJ A;  3HS0 C;  4A3I B;  2KVM A;  3S15 B;  2TSS A;  2A5H A;  1SYC A;  3GD7 A;  3VA5 A;  2PW7 A;  1BR9 A;  4IUU A;  2L5T A;  1SNM A;  1JC7 A;  2F0M A;  2HCI A;  4H44 C;  2L55 A;  4WRD A;  1EU4 A;  2FHT A;  2NYZ D;  3HGB A;  4PMB A;  5M3F B;  1GUW A;  1I6H B;  5IGC A;  2AWO A;  3WOF A;  1SYE A;  3PUZ A;  1BXT A;  3A56 A;  3BG3 A;  3S2H B;  1NSN S;  3D4R A;  5EPL A;  2X69 A;  4NDX A;  1XX8 A;  2R93 B;  2K01 A;  5T1G A;  3K0Y A;  2IX0 A;  3M7N A;  5LL6 S;  1TII D;  2LY7 A;  2MUY A;  1IHZ A;  1C48 A;  3A8K E;  5M5X B;  2A69 D;  3K5N A;  3GTO B;  3TN2 A;  2PZT A;  1KAB A;  5EKK A;  5BN4 A;  1Y8N B;  1EY7 A;  2J0T D;  1JOR A;  5C3E B;  3MFG A;  4KY5 A;  1F9Q A;  1CHQ D;  3E0J A;  1LTB D;  1PTO C;  1S5E D;  1CTM A;  3TP6 A;  1Q8I A;  1A3T A;  4I65 A;  1RKN A;  2KCN A;  1PRT B;  1GXD C;  1TS2 A;  4PQX A;  3OWE B;  3I4N B;  4A3M B;  3TZD A;  4B9W A;  1V43 A;  1D5Z C;  4K14 A;  2KEC A;  1ILP A;  1I4Q A;  4H13 C;  4A93 B;  1XWE A;  2KQ3 A;  2WII B;  3TBI B;  4F87 A;  1DJR D;  2L4N A;  4DXG A;  5E4X A;  1SFO B;  3HOU B;  1A3U A;  1Z6H A;  1A3V A;  2JA8 B;  4P2C B;  4K8I A;  4LMQ D;  5C6A A;  5C3W A;  3T53 B;  1CI3 M;  4HCS A;  2EY6 A;  3S9W A;  4ZUI A;  4R8N A;  2O5J C;  1H9R A;  4IUQ A;  1DZ1 A;  1ENC A;  1STE A;  4KY7 A;  4ZYS A;  1TY0 A;  2H4O A;  2BE5 C;  2VNU D;  1O80 A;  1KTK A;  2EOT A;  4IUN A;  1YNN D;  1IYU A;  2B2V A;  4F8M A;  4IUT A;  1EYA A;  4A3E B;  3QIA A;  2QKI C;  1IKL A;  2FJ2 A;  4KN7 C;  3T51 B;  2A6H C;  1HFG A;  3H94 A;  5EBD A;  4C2M B;  5FO8 B;  2NBF A;  4OGQ C;  2EDG A;  3RZO B;  3L7Z C;  2FFK B;  4ZUJ A;  1JCK B;  3T56 B;  2F1M A;  3Q24 A;  2F0P A;  2F0L A;  2XN9 C;  4EQN A;  4CBV A;  3TZU A;  2EYO A;  1H9S A;  4RGO S;  4RCN A;  1M8A A;  4K2K A;  1GHK A;  2F0I A;  3K58 A;  3HG9 A;  2SOB A;  4OHJ A;  3IAY A;  5FLX L;  5CV5 A;  1U4M A;  4DF7 A;  4YIJ A;  1I4R A;  3LWU A;  1V1P A;  2E75 C;  4XIG S;  1HQM C;  2SEB D;  2A73 B;  2F0U A;  3P75 A;  2R7Z B;  3VYT A;  3K59 A;  2XSC A;  3NBI A;  3SR1 A;  3OWF A;  2QDB A;  3KUP A;  1HXY D;  1OXV A;  1J8I A;  4ZRZ A;  1TWG B;  2JYO A;  4A3K B;  1JOQ A;  3ITP A;  1TWF B;  2A6E C;  3G7L A;  3H3V C;  2NZ1 D;  2RBM A;  4RCO A;  3V2T A;  3D6W A;  5HUR A;  2NWG A;  3ND9 A;  2M2L A;  2YYZ A;  1NAP A;  4OIJ A;  1ONL A;  3Q23 A;  3RMH A;  5KIX A;  1UUP A;  2NVX B;  1I4H A;  5CV7 A;  5IGD A;  1EIH A;  1SJE D;  5EKL A;  5E1F A;  4DN4 M;  3KBX A;  1EZ8 A;  1I3Q B;  4EGV A;  1STH A;  5F2D A;  3K5O A;  4FO2 A;  3NWS A;  1PFM A;  3LWE A;  4IUV A;  4XT1 B;  1Q90 A;  2CQA A;  3JAM L;  3M4Y A;  2ICE C;  5I2X A;  4N9P A;  3NTH A;  1AP0 A;  1S4Z A;  4RA8 A;  2EPB A;  3PUV A;  4J8Q A;  1STB A;  2JA7 B;  1CK1 A;  3GTM B;  3RUZ A;  3QOJ A;  1SNC A;  4FP5 D;  3T16 A;  2QIL A;  2SNM A;  3NQT A;  4OO1 H;  1CZG A;  1KLG D;  4G4K A;  5JPM C;  5KGU A;  3QOL A;  1E2V A;  3SK5 A;  1TS4 A;  2IX3 A;  2A6H D;  4QMG A;  1ET6 A;  4IAL A;  1ZYR C;  1KAA A;  4S3S A;  2SDF A;  1CM9 A;  3NSW A;  5J1Z A;  3V96 A;  4K5X A;  3MC0 B;  3FRP B;  1BCP C;  1Z7T A;  5JJZ A;  5JVH 3;  1TS5 A;  3C1E A;  3OHX C;  5FOB B;  2B2W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...