4LUVA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luvA00
3U4ZA 4YY3Q 4MTNA 4A3IH 2Y0SG 5C0XJ 3PO3H 4DR3Q 1XMQQ 5GAHC 3HOZH 1HZ9A 2GVBA 2WB1G 2MNAA 4QGUA 4P75A 1I94L 5HGQA 3K0XA 3RN5A 3GDEA 1IZ6A 4R1JA 5LMUQ 2KHIA 2RHQB 3CD6A 4K0KL 1FVIA 2NZHA 3BU2A 4R4QA 1UE5A 2VQFL 4JI5Q 2D0OA 1VQHA 4JI2Q 1UWVA 3F1ZA 1EFWA 2E5LQ 1Y1WG 2YYZA 4DV6Q 2PQAB 4LF7L 4DV5Q 2B63H 1B7YB 3PIPA 4LFAQ 5C44G 4DV7L 4X62L 4PZ8A 2I5MX 2KCMA 4LF8Q 2K75A 5IYDG 3W1GA 1BKBA 2VY3A 1QVCA 4DR7Q 4DK6C 2LSSA 4BY1H 1XPOA 4JOIA 3KLWA 1OTCA 4BXXG 1SROA 5GAEC 4B3RL 4JYAQ 2AHOB 4LF9L 1QUQB 1PH7A 5GQOA 3GTQH 3A5ZB 2JA6H 4LFBL 1PH5A 3TREA 3F2CA 1E7ZA 4A3CH 1KHIA 4ME3A 4UP7A 4YY3L 3HOUG 2ASBA 1NMFA 3RLNA 3CCEA 1NMGA 2N78A 4JBWA 1C0AA 1VQ9A 1EIFA 5M5XH 3G6EA 4DR2Q 1XMQL 3CCVA 4A3EH 1VQMA 5HY6A 2JJQA 4AYBE 4Y52H 3PCOB 4B3MQ 1BBUA 2GVAA 3CAMA 5AJ3Q 3UDFA 4YWLA 5M3MG 4JCVE 5M5WH 4DNIA 4UP8A 4JI8Q 1N9WA 5GAGC 1VQEA 3E9HA 3SGIA 4B3TQ 1L1OA 4A76A 1XJVA 4JI5L 3KDFB 2F3IA 1ASZA 2E2JH 4JI2L 1LTLA 2QGQA 1W2BA 2H5XA 3I4MG 2E5LL 1NE3A 5C0XG 4JV5Q 4OO1I 4DV6L 1I5FA 1IXRA 3ERSX 4DV5L 5C4JH 4P71A 3NENA 4LFAL 4NXMQ 4TQUS 5C3EH 2OCEA 4DV2Q 2K5HA 1Y1VH 2K4KA 4GLAC 4GN5A 4A3FG 1MJEA 2VS1A 2BH2A 4LF8L 1Q7YC 4A3LH 1VQ5A 1K9MC 3KJPA 2A1AA 3AFPA 1XNQQ 4DR7L 1AH9A 1MJCA 1MIUA 3HOWG 1RIPA 1E3PA 1VQNA 3GD7A 5M3FH 1K3RA 3L2PA 1GVPA 4BBSG 3AYHB 4BA1I 3S24A 4JYAL 2VUMG 3PUWA 2N3SA 4YWMA 2VW9A 2N8NA 3CCSA 2UXBQ 4POFA 4JI3L 1KRSA 3L7ZC 2DUDA 1GD7A 1CSQA 2UXDQ 2I0QA 2RF4A 3AQQA 4GNXA 4KLKA 4YWKA 3I7FA 1PH4A 2YU9H 5IYBH 1CKNA 5IYCG 1B8AA 4DR2L 2I5LX 3KF6B 4A4IA 1UE1A 3ZJYC 4UY8C 1Q46A 1KQSA 4B3ML 5JJIA 1I3QH 5AJ3L 1C9OA 4GOPC 3G48A 3RLFA 2VNUD 4JI8L 2KCTA 4B3TL 5FLMH 5DLQE 1O7IA 3S14H 4BBRH 3E9IA 1HNWQ 4P72A 3UE1A 3CCMA 4NXNQ 1K0RA 3HOXH 2ALYB 3KYHC 3G4SA 4OONA 4JV5L 5IWAQ 1TWFH 4JBMA 2RHSB 1PH9A 2Q2IA 1KC8C 1SMXA 5IP7H 2NVTH 4IPGA 5H1SE 2JEBI 3TEHB 1VQ4A 4NXML 1XNRQ 3L0OA 2YV5A 3NBHB 4DV2L 4HIMA 4IOAA 2OTJA 4OWTB 3K7AH 3ULLA 2ATWA 2IX1A 1WCMH 1IYJB 4APVA 2EXDA 4KHPL 1XNQL 4NB3A 4A3KH 1X65A 3CCLA 3OW2A 3HOVG 5IY0A 4ALPA 1K83H 4DR4Q 3RN2A 3IRBA 4X66Q 2WAQG 1IBMQ 1FGUA 1J5EQ 2D0PA 1G6PA 3G71A 3MEFA 2UXBL 4GS3A 1UE6A 2V1CC 2A8VA 4EX5A 2NN6I 2DGYA 3S17H 2UXDL 1IBLQ 2L15A 1Q82C 2B63G 1YHBA 1OXTA 3CPWA 1KIXA 3CXCA 3TS2A 3J81j 4X6AH 2D62A 4LF5L 2MQHA 4JI4Q 4BY7H 3I4NG 4A3DH 1EIYB 1X55A 5IT9c 4L5SA 4LF4Q 3TRZA 3KOJA 4Y7NH 2JA7G 4QJFA 2R92H 3PIOA 3T1YQ 2KENA 2UUAQ 3ER0A 3W5OA 1PV4A 5E7NA 1JJGA 1VQIA 1KL9A 2Z6KA 4DV4Q 3KJOA 1T9HA 4R4IA 1HNWL 3STBC 4NXNL 1YBYA 1HZCA 2K52A 5IWAL 4DUYQ 3RLOA 2UUCQ 3CC2A 2R6GA 4MZ9A 3S2HH 1BVSA 2HHHQ 3I2ZA 4AQYL 2AWOA 3RZDH 1XNRL 4DR6Q 1GKHA 5FJ8G 4PZ7A 2R93G 1YITA 4A3MG 1VQ7A 3PSIA 4GLVB 1PH1A 2IX0A 4L5TA 2WFWA 1C7YA 1Q81C 2JA5G 4WJ3M 1X56A 1XMOQ 2NVXH 4QIWE 2CQOA 4LUVA 3BZCA 1U0LA 3HKZE 3WWVA 1WOCA 1XTDA 3NEMA 3J7ZC 3OYYA 4HJ9A 1N32Q 4DR4L 1SRUA 1PH3A 3RR5A 2Q2UA 3GTOH 3K80C 4X66L 4DV0L 3VDYA 1IBML 4RG1A 1AE3A 1J5EL 1PA6A 1JT8A 2AMCB 2LXJA 2JEAI 4L5RC 4JI6Q 4MNOA 4KI0A 4C3HH 4A3BG 2ZTEA 5ELOA 4XIGS 1HH2P 3K7UC 4DR3L 1VQLA 2R7ZG 3S16H 2HIXA 3I4OA 4HIOA 3FHWA 1SE8A 4IPHA 1YNXA 3F2BA 1L1OC 3FKIG 1Y1WH 3Q8DA 2XGTA 1E1OA 3EIVA 4JI1Q 4JI4L 5LMUL 4IFDI 2PQAA 4JI7Q 5C44H 3STBD 1XPRA 2CFMA 4JI0Q 1E24A 1PH6A 4OWWB 4OO1G 3T1HQ 4LF4L 5C4XG 1JJCB 1R9TH 4KHZA 5BR8Q 3H3VH 3T1YL 2UUAL 1VQJA 2JA9A 2YTVA 2UU9Q 4DV4L 2EQSA 1N8RC 4QQBX 5IYDH 1U5KA 4C3IH 1HJPA 3HKSA 4DUYL 1HNZQ 2UUCL 2F4VQ 2OQ0A 4BXXH 4B3SQ 1VQDA 1OXVA 2HHHL 2ES2A 1N36Q 3ULJA 4LF6Q 1I6HH 4DR6L 2NZOA 1P16A 2PI2A 1QUQA 4PMWA 3BJUA 3CF5A 4DV3Q 4GKKQ 1DGSA 1E1TA 1S40A 1XMOL 3HOYG 3HOUH 1H95A 1X3GA 2OWOA 4A93G 3GTPH 4R4OA 1N32L 1SR3A 4R4TA 1UEBA 2I5HA 3A0JA 2B3GA 3TQYA 4YHHQ 4GNXC 3AEVA 3JAMi 4GOPB 1PH2A 2CKZB 2Y0SE 4P73A 5GROA 4OWXB 4X65Q 1K8GA 4LF6L 2UUBQ 5M3MH 4IPCA 4JI6L 2JA8G 3J7A5 3CC4A 3GTGH 2K14A 2QA4A 2WB1E 5LMNQ 3GTMH 3I56A 3RNUA 1D8LA 1X3FA 3PO2G 3KDFA 1EUJA 2ID0A 3I4MH 1YJ9A 3S1RH 2JE6I 1YI2A 2B29A 1JE5A 4JI1L 3PO3G 4JI7L 3CCQA 4JI0L 2HT1A 4DUZQ 4HIDA 4GLXA 3T1HL 4LNQA 1UE7A 1Q1BA 2MO0A 3H0GG 5BR8L 4A3FH 1KD1C 4LWCA 3M9BA 1QVGA 1VQBA 4YCWA 3UDXA 1CKMA 4OXPA 5IP9G 5JEAJ 3S1QH 1E22A 3HOWH 4GN3B 4AYBG 1QZHA 4A3IG 4BBSH 2MO1A 1HNZL 1YEZA 3PUZA 4B3SL 2PNHA 3EBEA 4LW1A 4X64Q 1N36L 3CP0A 1JB7A 2BA0A 3EN2A 3PGZA 4JBJA 3UE0A 2VUMH 1HNXQ 3HOZG 2PI2E 1VQ8A 2VQFQ 4IFDJ 1VQPA 2HIVA 1V43A 2JQOA 4DV3L 2FXQA 1NJIC 4GKKL 3GTJH 1G51A 1CSPA 3OTOQ 1N34Q 2E2HH 3GTKH 1X9NA 4BY7G 1KXLA 1FL0A 1V9PA 2IT1A 3DLLA 4J15A 4WJ4A 1A62A 2NN6G 2PMZE 5JJLA 2R92G 4YCVA 4YHHL 2JK8A 2ZM6Q 2MFIA 5EAYA 3KF6A 1YIJA 2UXCQ 4A3GH 4JG2A 3PV0A 4DPGA 4JBKA 4HJAA 2UUBL 3F8TA 3K81C 4C2MH 2VZAA 5LMNL 1YHAA 2QEXA 3PF5A 1VQOA 1Z9FA 1M1KC 4R4CA 1HR0Q 3KFUA 2CCZA 3PUYA 1YHQA 2E8GA 1EOVA 4BY1G 2Z6KC 1QZGA 1PHJA 3CQZH 3HFZB 1I50H 1A8VA 2N49A 4DUZL 3ULPA 1LM0A 4A3JH 2C35B 4PZ6A 3A74A 3M7NA 1X3EA 2ZJPA 2R7DA 1WFQA 1FJGQ 3M4OH 4LFCQ 4TVAB 2EIFA 2JA6G 2IHFA 1SFOH 3HOVH 4JOIC 4A3CG 1N33Q 4GKJQ 1K8AC 4DV1Q 1QVFA 1Z47A 2NVYH 4X64L 1S72A 1JMCA 2VL6A 1CUKA 4IOCA 4IJHA 4A3EG 1HNXL 1CKOA 1YVCA 1L2FA 4IPDA 5K36G 4DR1Q 2CWAA 4HJ5A 3OTOL 3CC7A 1N34L 1L1OB 4AIMA 1GO3E 5JEAG 1RL2A 3F2DA 4IJLA 4HJ7A 1NY4A 1P8LA 1SN8A 2Q2HA 3K8AA 2RCNA 4XTCS 2ZJRA 2ZM6L 3I4NH 2UXCL 1EYGA 1Y14B 1IBLL 5GADC 1YJNA 3H3VI 1PYSB 2JA7H 4IFDG 3D31A 5LMNW 1VQKA 5C3EG 1PFSA 1VQGA 1Y1VG 4GN4B 2Q2TA 2F52A 3CPFA 1HR0L 4A3LG 2GN5A 4AH6A 1W3SA 2KHJA 1KAWA 3FP9A 4JI3Q 2HQLA 1OXSC 2YTYA 3M3YH 5M3FG 4RMFA 3AFQA 2VQEQ 3UDIA 5FJ8H 3PUXA 2R93H 1KRTA 4A3MH 2OTLA 2JA5H 3S2DH 1X54A 4O0AA 1BBWA 4QL5A 1FJGL 1VQ6A 4LUOA 4LFCL 2XTIA 2KBNA 2AWNA 3CCUA 1NBWA 4GNXB 4C3JH 1N33L 4GKJL 3E0EA 3S1NH 1A63A 1S3OA 4DV1L 1JJ2A 1CKNB 5IYBG 2K50A 2ZTCA 1Q12A 1WI5A 4FDBA 2IHEA 1D7QA 3A5UA 3U58A 4A3BH 4JC0A 4UPAA 4DR1L 4DK3C 2WAQE 2R7ZH 1PYBA 1SLJA 3B6YA 3PUVA 4P74A 3U4VA 3JAMc 3M85A 1IBKQ 1XPUA 5FLMG 1AE2A 1OXXK 5C0XI 4BBRG 3I55A 1EWIA 3FKIH 5M5YH 4OX9Q 3J80c 3J80i 3HOXG 1J6QA 4IO9A 3KF8B 1Q8KA 1V1QA 4BA2I 4YCUA 4O2DA 1A0IA 4KHPQ 5C4XH 1TWAH 3JC66 5IP7G 2Z0SA 3NELA 1LUZA 1LYLA 3HKZG 1WYDA 3MXNB 3D0FA 1PH8A 4DR5Q 1HR0W 2BA1A 3CMAA 1WCMG 3M4QA 2R7FA 1YJWA 4EQ5A 1YZ6A 2NVQH 4A3KG 5JJKA 3BZKA 1ASYA 3CCJA 1EQRA 4DAMA 2ZTDA 1EQQA 2CWPA 1L0WA 3U50C 5IE8A 1Q86C 4A75A 2UU9L 2VQEL 1HZAA 4QY7A 3UDGA 1VCIA 2OQKA 3J81c 3J81i 1Q1EA 3TS0A 1I94Q 3ICEA 3PF4A 3RZOH 4LF5Q 2F4VL 2YTXA 1G291 1VQAA 3M4PA 3HOYH 4NPSA 1MKHA 4L5QA 4K0KQ 5FLXc 4A93H 4LUZA 3W1BA 4A3GG 1GM5A 2A19A 3H15A 4POGA 4HIKA 4H02A 1TXYA 1X6OA 1TWCH 4LF7Q 4GOPA 2JA8H 1B70B 4A3DG 3GO5A 1TWGH 1K73C 4DV7Q 1NTGA 1VQCA 4X62Q 4DAYB 1TWHH 5IYCH 2AKWB 2BH8A 2WP8J 2E2IH 3CCRA 2LXKA 4AQYQ 1IBKL 3DM3A 3PO2H 4X65L 4A3JG 5ELNA 2K5VA 4OX9L 1PVOA 3S15H 5J3BA 2K5NA 1VQFA 1WJJA 2IY5B 3LGJA 4PG3A 4B3RQ 3CMEA 3H0GH 1VS0A 4LF9Q 1IL2A 3GTLH 1M90C 1OXUA 4DKAC 3S1MH 3CW2C 4UP9A 4HJ8A 2ZJQA 4DR5L 1HZBA 4DV0Q 5IP9H 4LFBQ
chains in the Genus database with same CATH superfamily
4HCEA 2Y0SG 5IGCA 3PO3H 5CV7A 3X3MA 3VA7A 5GAHC 1HZ9A 1SNQA 2GVBA 2WB1G 5C4HA 2MNAA 4WRDA 2MUYA 5HGQA 1MGSA 1A6XA 1IZ6A 4LK1C 2KHIA 2RHQB 1DZ1A 3MA2B 1UE5A 4JI2Q 1GXDC 2VB2X 2EDGA 3MHBA 2PQAB 4DV5Q 5C44G 4DV7L 4IUVA 4X62L 4CKBA 1HRJA 3P1HA 5IYDG 5C3WA 2F0SA 1QVCA 1R9TB 1XTCD 4BY1H 5G3LF 1OTCA 4BXXG 4B3RL 4LF9L 1FNWA 1QUQB 1VMCA 1TY2A 2EY2A 1PH7A 2JSOA 3NHHA 3A5ZB 4OELB 1RTNA 1KHIA 4ME3A 2O2LD 1NMFA 2PMZB 4JBWA 1C0AA 4DK1A 5M5XH 1XMQL 1TU2B 1VQMA 4AYBE 1TS5A 4B3MQ 1BBUA 2GVAA 1HHVA 1MSHA 1TKWB 2ZXRA 1NNXA 1N9WA 4JI8Q 5GAGC 1SJHD 1L1OA 1PXUA 1YNND 2XWJB 3QOLA 5M3MB 4JI5L 5CORA 2F3IA 1ASZA 1LTLA 3GTMB 2E5LL 4JV5Q 3L9AX 5C0XG 4OO1I 1IXRA 1CZGA 3T16A 1B1ZA 3QJYA 4LFAL 2L0CA 3I4MB 4X3TA 4NXMQ 5CR3A 2K05A 1KLUD 4GN5A 1MJEA 4E6IA 3P7JA 1Q7YC 1JICA 5BN3A 1XNQQ 1AH9A 1AZPA 1B44D 1E3PA 1VQNA 1K3RA 1HUMA 5IGEA 1T5XD 3S1QB 2LMCB 4BA1I 3HOWB 3U9OA 1HFNA 4JI3L 2DN8A 2VUMB 3GP7A 2I0QA 5IYBH 4B08A 1CKNA 1WTXA 1RTOA 3OW7A 2K32A 2BOSA 1KQSA 4NDXA 5AJ3L 4DXGA 4GOPC 3RLFA 3A8IE 1PRTF 2KCTA 4B3TL 2F0QA 3K5OA 1O7IA 3MXGA 4CGYB 4BBRH 1HNWQ 3CCMA 1K0RA 2B8GA 3MWYW 3KYHC 3G4SA 1Y69U 3JAML 1TWFH 4JBMA 2SNSA 2M2LA 1SMXA 4IPGA 1NAPA 4DV2L 2YV5A 3CQZB 2OTJA 4IOAA 4F87A 2ATWA 3MXNA 5KNBA 4APVA 3Q22A 2IL8A 1RD9D 5KEEA 3CCLA 1D2BA 3J80E 1EFID 5L37A 3IRBA 4X66Q 4X3UA 2WAQG 2F1MA 1FGUA 4CKEA 3G71A 4H7BA 3F2UA 3S17H 1EIGA 1PFMA 4QUCA 2KHSA 1KIXA 1C8CA 3J81j 5EGTA 4JI4Q 2B63B 1EIYB 3J81E 1X55A 4L5SA 2CHBD 1S5ED 2EYHA 3C1EA 3TP6A 4DAYA 2KENA 5E7NA 5FLXE 1JJGA 1VQIA 3G7LA 4NXNL 1CA6A 1QB5D 5IWAL 3S2HH 2R6GA 1V1OA 5CV9A 3TZUA 1BUVT 3RZDH 1XNRL 5FJ8G 1BBXC 4PZ7A 2R93G 3PSIA 4DFAA 2WFWA 1C7YA 4WJ3M 1HQMC 2NVXH 4QIWE 2E2DC 2WINB 3WWVA 1IYUA 3S2DB 4HJ9A 3K5MA 3EJIA 1I4PA 4DR4L 2B2VC 1PH3A 3C3LA 4ZQ3A 1FGBD 4DV0L 4C3JB 1AE3A 4MNOA 4C3HH 4A3BG 2N55A 2ZTEA 2Z1CA 4QB4A 3OSOA 2O4XA 3QG1A 1S4ZA 2F3WA 4FP5D 2PYKA 1Y1WH 2XGTA 4HN7A 4IFDI 5LMUL 2CFMA 4OO1G 3FKIB 1SBBB 3T1HQ 4LF4L 4KHZA 3T1YL 1JR0D 1VQJA 2JA9A 2YTVA 5C4XB 3HS0C 3LWEA 2B2TC 2JXMB 2XRQD 2VB3X 2F4VQ 5DM73 2UUCL 1EYCA 3NUCA 4CJ0B 4DGZA 4DR6L 2PI2A 5E4XA 3CF5A 4DV3Q 1LTGD 4GKKQ 1S40A 4DA2A 3HOUH 1PTOF 3NSWA 3GTPH 3MXUA 3RZOB 4L8JA 1UEBA 3A0JA 3TQYA 4YHHQ 1PH2A 2HUGA 2Y0SE 4P73A 5A2QE 3GTGH 3TP5A 2WB1E 3FVQA 2PW5A 3I56A 2JA8B 3KDFA 1YJ9A 2E2IB 4JI1L 3A8JE 2CVRA 4JI0L 3OWFA 3T4AC 4DUZQ 1BNZA 5BR8L 2FMMA 2KQ3A 1VQBA 1CKMA 1KDCA 4OXPA 5JEAJ 1G2SA 3J80L 3A54A 1QZHA 1YEZA 4LF6L 1JB7A 5LHY1 3EN2A 3HOZG 4RCNA 3BVMA 1RHPA 1V43A 2JQOA 3PO3B 2VXWA 4XQJA 4HEDA 1G51A 1CSPA 1X9NA 1FL0A 1V9PA 1A62A 2KJXA 2F0HA 4BY7B 1ICWA 2ZM6Q 1YIJA 4K2LA 1RF2D 4JG2A 3PV0A 4DPGA 3J81L 4Y7NB 3K0YA 3F8TA 1TS2A 2QEXA 5FLXL 1VQOA 3KFUA 1QE6A 3KLRA 1ESRA 4DN4M 2L12A 4R9WA 1EU4A 1YHQA 1QZGA 1G91A 1I50H 1SNCA 2Z8LA 1AN8A 4BY1B 1GOZA 1I4GA 3M7NA 1X3EA 2ZJPA 2RA4A 1FJGQ 4LFCQ 2RCFA 2IHFA 4A3CG 1K8AC 4G7ZC 2EJGC 4X64L 1JMCA 3ITPA 1SE4A 2BE5C 4IPDA 1A3UA 2P5ZX 2RVLA 5M5XB 5K36G 4DR1Q 5BN4A 2CWAA 1KNEA 4HJ5A 5D3IB 3OTOL 1N34L 1GO3E 5DEHA 3K8AA 5KRUA 3I4NH 2UXCL 3LNNA 1EYGA 2EYOA 1Y14B 5GADC 2XIWA 1GUWA 1YJNA 3QB3A 1FD7D 1PYSB 4IFDG 4KY7A 2GN5A 4AH6A 4EQNA 1X3PA 1H9RA 3OPOA 4JI3Q 3AFQA 2VQEQ 2NYZD 2DNEA 1SYDA 2JA5H 1K8MA 1X54A 1CQFA 4LUOA 4NMZA 2AWNA 3U9SA 2BE5D 1NBWA 1K8OA 4GKJL 1BCPD 3E0EA 1X32A 1JJ2A 5EKLA 2J4XA 1RKNA 1B3QA 1Q12A 4FDBA 2F0GA 2IHEA 1D7QA 4J6HA 4JC0A 4UPAA 4PQXA 2WAQE 2AQ2B 1K3BC 2RBMA 1PYBA 3X3NA 3M85A 3PUVA 3JAMc 2SDFA 5FLMG 1LABA 5CBAE 1LV9A 1QILA 4K5WA 2BCOA 2B2TA 1QNUA 4BBRB 4O2DA 2DJGC 1XWEA 2X69A 2KVMA 2Z0SA 1LUZA 1TWFB 3HKZG 1WYDA 1KDAA 3D0FA 4DR5Q 1PDQA 1WCMG 3M4QA 2R7FA 1HXYD 1MBYA 2ICIA 4A3KG 5JJKA 2NUCA 3BZKA 1EQRA 1EQQA 3QIAA 5IE8A 2A6EC 1BO0A 4CHTB 3BVZA 5DAUA 4QY7A 2OQKA 1Q1EA 3TS0A 2GA4B 3J7AV 2YTXA 1G291 3M4PA 3HOYH 4L5QA 2F03A 4K0KQ 2D2CC 3W1BA 1TVXA 3ND8A 2RDGA 2K5DA 3H15A 2QCPX 5ISRA 4LF7Q 3QO2A 2EE1A 3GO5A 1A15A 3I72A 2AKWB 2WP8J 1STEA 2LXKA 3CCRA 1SYFA 1IBKL 4ZUIA 3PO2H 4X65L 1QWYA 4KK7A 5ELNA 2K5VA 4CDCC 1KLGD 4A3JB 2IY5B 3AU7A 3LGJA 1TY0A 2EJMA 3H0GH 1U4RA 3A7AB 3S2HB 2A6ED 1AZQA 1EY6A 1AW7A 1MI2A 4HJ8A 4DV0Q 3RZDB 4LFBQ 5EQ0A 4ABNA 2CQAA 4A3IH 1I6VC 5C0XJ 4XXEA 1LTBD 2HCCA 3P20A 1ICFB 5IGGA 5LMUQ 4R4QA 4J1MA 2ZT9C 4C3HB 4R8IA 2D0OA 5I9OA 1J9OA 4DV6Q 2B63H 2JA7B 2LS01 1Y1WB 5C5MA 3M7GA 2I5MX 2KCMA 4LF8Q 2K75A 2VY3A 4DK6C 1HA6A 3M3YB 5IGBA 4V0BA 1LTAD 2PW7A 4X3KA 5GAEC 4JYAQ 2AHOB 3SK5A 2B2UC 3GTQH 3NQIA 3TREA 5I2YA 2A68D 2FMCA 4XQNA 4I7ZC 3F2CA 4YY3L 2ASBA 1PZJD 3CCEA 1UAPA 4RH6A 1EIFA 4DR2Q 3HOUB 4A3EH 4Y52H 3GTPB 5M3MG 1QCBD 4UP8A 3SGIA 4A76A 3A56A 3MC0B 5M5YB 1SXTA 2E2JH 3GTGB 4M1UB 3I4MG 1W6JA 4BWGB 4DXFA 1BOSA 5C4JH 2E76C 2OXPA 3NENA 3NWTA 2M00A 2K5HA 2K4KA 4GLAC 5I6YA 3GV3A 4KTAA 1B9MA 1SEBD 2BH2A 4A3LH 3I90A 1K9MC 2A1AA 4DR7L 3HOWG 1ONLA 1ZKOA 2EY1A 2VUMG 2NBFA 4YWMA 2N8NA 1D5MC 1SNDA 3L7ZC 3EROA 3S9WA 1GD7A 2UXDQ 2RF4A 2WV6D 4CKCA 4GNXA 4MTKA 2YU9H 2K5QA 3KF6B 4A4IA 4ZLTF 1WTVA 1Q46A 1H9MA 1TWHB 1VF7A 3G48A 5JJZA 4HSPA 2KEDA 5J1ZA 4DU9A 2XVSA 2ALYB 4OONA 2B2WC 3KF8A 2D5DA 1F9SA 1PH9A 1IYVA 1KC8C 5IP7H 2A69D 2NVTH 1EY7A 2JEBI 4HMJA 3BS1A 3L0OA 1EEFD 4FVMA 5CV6A 4OWTB 3K7AH 5EPJA 4GZYC 2IX1A 4DAVA 3SVMA 3E5SA 1X65A 5E4WC 1EWHA 5CV5A 2K03A 3KK7A 1HA5A 4LMQD 4U673 1J5EQ 2UXBL 3MEFA 3D6CA 1PTOH 1STHA 4EQOA 2A8VA 1G2TA 2B8FA 1QOHA 1ILPA 2B63G 1BCPB 1DONA 2IWHA 1QNKA 5C5LA 2D62A 2F0LA 5JPNC 2MQHA 4Z9CB 3KBXA 1B50A 4BY7H 2DY8A 4A3DH 4H44C 5IT9c 2IX3A 2ZXOA 1NR2A 4NW2A 4Y7NH 3I4NB 2UUAQ 1LTSD 1Y8PB 1WTRA 1H9SA 1KL9A 4TSSA 1WTOA 1T9HA 2L55A 1YBYA 1YNNC 2MPMA 3A8KE 1HZCA 3IAYA 4DUYQ 3VR6A 4MZ9A 3Q6SA 2OEOA 3I2ZA 2A73B 2HDLA 3D6WA 1GKHA 5JVG3 2SOBA 2L5TA 1X56A 2F0UA 3D4DA 3GV6A 1T5EA 1R4QB 3HKZE 2JA5B 1WOCA 1XTDA 3NEMA 2DJFC 4WORA 2F0WA 4C3JG 1N32Q 3NP8A 3TP7A 2Q2UA 1O80A 1IBML 4RG1A 2AMCB 4L5RC 4JI6Q 1HPCA 5ELFA 5ELOA 1HH2P 3K7UC 3K5LA 4F7XA 3FHWA 5JAVA 2EJFC 3F2BA 3FKIG 2HCIA 1Y1VB 4K2KA 5C4XG 1JJCB 2PZWA 3H3VH 5NUCA 3A7LA 2XNAC 2B2YA 4QQBX 4DV4L 1N8RC 1DCZA 1GHKA 4C3IH 1HJPA 3HKSA 4JW0A 3EFXD 2OQ0A 4B3SQ 2HHHL 2ES2A 1D1KA 1I6HH 1P16A 2EZVA 1CI3M 3K6OA 3VR2A 2XN9C 1DGSA 1E1TA 4FF2A 4CDEC 3LWUA 1XMOL 1H95A 1SR3A 2EYPA 4R4TA 3HOYB 2I5HA 3AEVA 2CKZB 3SEBA 2JA8G 4X65Q 4DNRB 1V1PB 4IPCA 1GUNA 3CC4A 2QA4A 5LMNQ 1TR5A 2ID0A 4I7AA 1G6ZA 4LJZC 5F2DA 1STBA 3PO2B 4JI7L 2HT1A 4HIDA 5FOBB 4LNQA 2F0EA 3DHQA 1KD1C 4A3FH 4ZUJA 4LWCA 3M9BA 1QVGA 2IPKD 3UDXA 3H0GB 3CU7A 5IP9G 2D9UA 1E22A 4GN3B 4QUFA 2MO1A 1HNZL 2O5IC 4BBSH 3PO3G 1VDZA 1N36L 3CP0A 2BA0A 1HNXQ 4A3IB 1VQ8A 4IFDJ 1CHPD 3N6RA 1NJIC 5IOCA 3EVQA 5JVH3 1LT5D 2E2HH 5KNDA 4BY7G 1SYCA 1KXLA 3T13A 5EKIA 2PMZE 4WJ4A 5JJLA 2JK8A 5EAYA 4IALA 2FINB 4ZYSA 3QWNA 4HJAA 1B3AA 2UUBL 4JK1C 3PF5A 2EY6A 3OIPA 4R4CA 1PRTB 3A55A 2CCZA 2E8GA 4EQPA 4BY1G 2Z6KC 4QCLA 1PLFA 1O7LA 3RD4A 1A8VA 2N49A 3ULPA 2F0TA 4A3JH 1L0YB 3A74A 3NBHA 3NTIA 4ID6A 1C48A 2R7DA 1WFQA 3M4OH 5CV4A 3HOVH 5T1GA 3BDLA 3GTQB 1QVFA 1Z47A 2NVYH 1CUKA 3C1FA 1U4MA 3FPPA 3S16B 1S5CD 4A3EB 5FO8B 1L1OB 4RGTA 4HJ7A 1SN8A 2Q2HA 1EY4A 2ZJRA 2F0KA 2E2JB 2JA7H 1QG7A 5LMNW 1PFSA 1VQGA 4GN4B 5C4JB 1WD0A 3E6ZX 2F0VA 1HR0L 1W3SA 1KAWA 3G6JB 4IN3A 1OXSC 1E2WA 3M3YH 4RMFA 5IT9E 1MSGA 3UDIA 2RQXA 1KRTA 4XT3B 4A3MH 2WACA 1Q90A 4O0AA 2RKSA 2XTIA 3MFYA 1N33L 1EY0A 3S1NH 1A63A 4DV1L 2F3VA 1CKNB 5IYBG 4G7HC 1WI5A 4F88A 5KNCA 3N52A 5EKKA 2LY7A 3R2TA 2YU9B 2R7ZH 4DK3C 5I4DA 1SLJA 3B6YA 3U4VA 1AE2A 1OXXK 4BBRG 3VYRA 4KHVA 2ENBA 5M5YH 4OX9Q 1TS3A 2K28A 1J6QA 1F2YA 1Q8KA 1V1QA 4IUNA 4ZCKA 1R4PB 1GUTA 2KCNA 4ULLA 3NELA 4ZK9B 1LYLA 2MHVA 1J8IA 3MEHA 3MXNB 1PH8A 2NVTB 4FF3A 4EQ5A 1ML0D 3K7AB 1ASYA 2ZXPA 2ZTDA 2NTTA 1L0WA 1Q86C 4A75A 2UU9L 3Q0AA 4UHVA 1VCIA 4FXDA 1BF4A 4OEMB 4OGQC 3T51B 1VQAA 3CKIB 1SYGA 2AUKA 4NPSA 5D3DA 3RUZA 5DNFA 4A93H 4LUZA 4ZAIA 5IGFA 1PTOB 4O1NA 1W6KA 4EGVA 5C6AA 2Z4IA 1CQVA 1TWCH 4GOPA 3H91A 4DV7Q 4C2MB 1S5BD 4X62Q 4DAYB 4CBVA 3PIP3 1UNSA 1TWHH 3QR8A 5IYCH 4A3DB 4B9WA 4A3JG 4IQZA 2G9HD 3S15H 1VQFA 1X3QA 2TSSA 4PG3A 4B3RQ 1JOOA 2F0JA 1VS0A 5ELBA 4LF9Q 3GTLH 1I4QA 2TMPA 4DKAC 4UP9A 3OOCA 2LFNA 3U4ZA 4MTNA 1XMQQ 5TSSA 5K5PA 3DMUA 4X3SA 1NUCA 4QGUA 3SE0A 1I94L 4C3HG 2KA7A 4R1JA 1HQRD 1CA5A 1DD2A 4RGOS 5ELEA 1FVIA 2NZHA 2NN6H 4JI5Q 2VQFL 1A2TA 2K33A 3I70A 1DOKA 4OIJA 2RDFA 2E5LQ 1BCPC 1O7ZA 1Y1WG 2L4NA 1WD1A 3PIPA 4LFAQ 4KY5A 3OMCA 3VR4A 2K5WA 1A3VA 2KEEA 4PZ8A 3DUZA 1BKBA 1YNJD 1IHZA 1M4VA 1WVLA 2LSSA 1Q3LA 1M8AA 1VF5C 1SSOA 4RAUC 2CW0D 1SROA 2R61A 5IT9L 4C3IB 3WOFA 1IW7C 5GQOA 1I6HB 2JA6H 1PH5A 2B2VA 4UP7A 3HOUG 1EZ8A 5BN5A 3RLNA 1E0BA 3ZYYX 1VQ9A 3W3AA 5HY6A 1D5ZC 3PCOB 3CAMA 5AJ3Q 1O7YA 4YWLA 4Q5VA 4N9TA 5M5WH 2KECA 1VQEA 3E9HA 4B3TQ 5JEAH 3KDFB 4XT1B 4JI2L 1W2BA 3I4LA 2H5XA 5A2QL 3FEWX 3ERSX 4DV5L 2J0TD 4P71A 3BYTB 1STYA 1WTPA 4TQUS 5C3EH 4DV2Q 1Y1VH 2EYJA 1H9JA 3ONAB 2DY7A 3KJPA 3AFPA 2NVQB 1IW7D 1MJCA 4A3FB 1D6EC 3GD7A 5M3FH 3L2PA 1GVPA 3AYHB 4KD3A 3S24A 4BBSB 2N3SA 2XWBB 2VW9A 3CCSA 2E74C 1KRSA 2DUDA 4XYOA 4KLKA 2NWGA 2L11A 1NR4A 5IYCG 2E2HB 1B8AA 4KJOA 4DK0A 1SNPA 1UE1A 2G5DA 3HZXA 1GUSA 5CC4A 3EQLC 4B3ML 5JJIA 1C9OA 2VNUD 1LO5D 4JI8L 1ILQA 3PIO3 5DLQE 1JOQA 1KDBA 3E9IA 3UE1A 1DXMA 4NXNQ 2K6AA 4IURA 3HOXH 4K8IA 4JV5L 5IWAQ 1DJRD 3NTHA 1I4XA 1SMYC 3NTKA 1GJXA 5H1SE 1VQ4A 1XNRQ 3S1MB 4NXML 4HIMA 4RA8A 1ZXTA 1IYJB 2EXDA 4KHPL 1XNQL 4NB3A 4PMCA 3OW2A 5G3LD 5IY0A 4ALPA 1K83H 4DR4Q 3M4OB 3RN2A 1RDPD 3MTSA 4K6DA 4ODGA 1EY9A 4UDUC 3HOVB 4RFBA 2D0PA 1G6PA 3WOEA 5IIFA 2NVYB 4GS3A 1UE6A 4RHRA 2L15A 3TS2A 2A68C 2A6HD 4LF5L 3I91A 2WKCA 1CFMA 1ET9A 4FO2A 3I4NG 1MD2D 4LF4Q 3KOJA 5ELCA 4QJFA 3PIOA 3T1YQ 2WKDA 1O78A 1PV4A 1SMYD 5ELDA 3ERQA 4ILWA 1HNWL 1BXTA 2Q8RE 2K52A 1KAAA 2QKIC 3VYTA 2UUCQ 1PRTC 4K8JA 1PMRA 3K5NA 4AQYL 1LACA 1Q8IA 2AWOA 4DR6Q 1EY5A 4IZ8A 1VQ7A 2JA5G 2IX0A 3MVVA 3TBIB 1MHWC 3IKJA 4A3MB 3BZCA 1U0LA 3IFDA 2HDMA 1SRUA 3RR5A 3GTOH 3K80C 4X66L 1JWMD 3SR1A 3S1NB 2LXJA 4DAPA 2JEAI 5KYLA 4XIGS 3S16H 4DR3L 1VQLA 2HIXA 3H94A 2RDHA 3TZDA 3VA5A 2R7ZB 1YNXA 1L1OC 4HAEA 2PNRC 3EIVA 4JI1Q 4F8MA 4JI4L 2PQAA 5C44H 4JI0Q 1E24A 1PH6A 4OWWB 3HG9A 1PRTD 5BR8Q 2F0MA 4H13C 5IYDH 1LT4D 2UU9Q 2EQSA 4I65A 2L9HA 1HTLD 4BXXH 1VQDA 1OXVA 4LF6Q 4IUUA 3ULJA 3BDCA 2N88A 1EU3A 2NZOA 5AFWA 3R8BA 4EVOA 5J22A 1QUQA 4PMWA 2A69C 3OMGA 4ME5A 4ZRZA 3HOYG 4CJ2C 4R4OA 3AMUA 1SYEA 2AQ3B 1BR9A 2B3GA 4A93B 3JAMi 3HEJA 1SDFA 1K8GA 4NP5A 1UUPA 1I4HA 1XXGA 1TWCB 3S14B 5HURA 3RNUA 3WDNA 4L6TB 3PO2G 5JOBA 5C0XH 4KN4C 4MHEA 1YI2A 3CCQA 1HCZA 3MFGA 3T1HL 3S15B 2EYMA 2MO0A 3H0GG 3EA6A 1LTID 4C1NK 3AB9A 2B39A 3GTLB 2SEBD 3DWPA 3CHBD 1TIID 4A3IG 2XSCA 3PUZA 4X64Q 3TSSA 3PGZA 4AYBB 3K58A 1FYCA 1S5DD 2VQFQ 2HIVA 4IUPA 4DV3L 2FXQA 4GKKL 2NZ1D 3GTJH 4KJNA 3OTOQ 1N34Q 3GTKH 3OHXC 2IT1A 4XQQA 3DLLA 4J15A 3NBIA 3P75A 1CM9A 4YCVA 5EBCA 4YHHL 4FF4A 2MFIA 2UXCQ 1PTOC 4JBKA 2R92B 1TQOA 4KKTA 4C2MH 3D8GA 1SE3A 1WTQA 1YHAA 1C4QA 4J8QA 1M1KC 2A5HA 5CMDA 3PUYA 1WTWA 1EOVA 2RSNA 5FKAC 4FXGC 4DUZL 1LM0A 2C35B 3KUPA 1G8ZD 4PZ6A 4TVAB 1SFOH 2F0NA 4JOIC 2PQEA 4GKJQ 1UEAB 2JA6B 1S72A 4RGMA 4IOCA 4A3EG 3BG3A 1E2ZA 2BDOA 1L2FA 3BDOA 2JN4A 2QW7A 1PTOD 4CJ1B 4AIMA 4G7OC 1RL2A 4IJLA 1NY4A 5M5WB 2NB0A 1JWUD 3FMCA 2RCNA 2ZM6L 1IBLL 3H3VI 1LT3D 4A3LG 3NWSA 5C3EB 3K59A 4WJWA 2HQLA 2YTYA 4JVZA 4HMIA 3H3VC 1JWSD 2B2UA 3DWAA 4DF7A 5FJ8H 2PO4A 2R93H 2CH4W 5M3FB 1BBWA 4G4KA 1FJGL 4TKOB 1EYAA 4LFCL 3CCUA 4GNXB 1DM0B 2EYFA 4RHSA 3TDQA 3BZDB 5LL6S 1FNVA 2K50A 2ZTCA 2F4IA 3A5UA 3SDZA 4A3BH 1EY8A 3R93A 1STNA 4DR1L 1EIHA 1STGA 3NE5B 1BQQT 4S3SA 1IBKQ 1SAPA 1EWIA 3S1RB 4KD4A 2L1BA 1SNOA 3J80i 4BA2I 3KF8B 1TS4A 5T1IA 2E75C 4KHPQ 4QMGA 4OO1H 1TWAH 3JC66 5IP7G 3HOXB 3NPPA 1K28A 1EOTA 1JOKA 4H0LC 4RKBA 2BA1A 4QIWB 1BDOA 1B4OA 4O42A 1YZ6A 2NVQH 3ND9A 3CCJA 2AQ1B 4DAMA 2NTSA 1V8QA 2CWPA 2Z6BA 3U50C 2VQEL 2K1BA 1K83B 1CTMA 3J81i 3ICEA 4RWSC 4ZKCB 1LT6D 4LF5Q 1F9PA 1MKHA 5I2XA 1GHJA 4Q0FA 5FK9C 2G9DA 1GM5A 5EPLA 2A19A 3GQBA 1XX8A 2QEJC 5CBEE 4A3GB 3SK6A 1B70B 4A3DG 1TWGH 2O5JC 1ENAA 1H9SB 2PPBC 4AQYQ 1A2UA 3DM3A 3T53B 2B2WA 4PV1C 3DEPA 1PVOA 5J3BA 1RJTA 4C56C 4DNTB 1CHQD 3TN2A 1ENCA 4P2CB 1IL2A 1EQVA 1M90C 3S1MH 1D5XC 1OO9B 4DR5L 4OHJA 4YY3Q 2DNCA 1NSNS 3FDTA 3KLSA 4DR3Q 4KY6A 3HOZH 4K14A 2Y0SB 1GUOA 4P75A 3K0XA 3RN5A 3GDEA 3GTOB 2WB1B 3OIQA 2HD3A 3CD6A 4K0KL 3IL8A 2FJ2A 4ZKBB 1ZYRC 3BU2A 2EOTA 1VQHA 1UWVA 3F1ZA 3VR5A 1EFWA 4OIKA 3D4WA 2YYZA 4LF7L 1B7YB 3HP3A 2MP1A 3T56B 1AEXA 5C44B 2QILA 4L63B 3W1GA 4DR7Q 5J39A 4C3IG 1XPOA 2R3ZA 4JOIA 3KLWA 4RCOA 4XYQA 5CV8A 2LKVA 1RODA 3CRLC 4LFBL 1PZKD 1JQYD 3IFTA 4A3CH 1E7ZA 3NQTA 1PFBA 1NMGA 2N78A 3G6EA 1ZYRD 3CCVA 2JJQA 4U68A 3W2DA 5K36H 3UDFA 4JCVE 4DNIA 4M8AA 1XJVA 1SNMA 2QGQA 1II3A 1NE3A 2JP1A 4DV6L 1I5FA 4FXKC 4N8FA 4IFDH 2F0FA 2OCEA 1PFNA 3PQIA 4A3FG 2VS1A 4LF8L 3NXWA 1VQ5A 3DXJC 1MIUA 1RIPA 2QDBA 4QF4A 1F2LA 4BBSG 1CT1D 5EPKA 4JYAL 3PUWA 2UXBQ 1B2TA 4POFA 1CSQA 3RMHA 3UI2A 3AQQA 4YWKA 3I7FA 3GTJB 1PH4A 2QDLA 2QF7A 4DR2L 3GTKB 2I5LX 2A74C 3ZJYC 4UY8C 3J7YW 1I3QH 2FHTA 5IODA 3Q23A 5M9OA 3URYA 5FLMH 3S14H 1B9NA 4G57A 4P72A 2FFKB 2RHSB 2Q2IA 1E2VA 1LLRD 3TEHB 3NBHB 1ENFA 3ULLA 1WCMH 3BVGA 4A3KH 3HOVG 1YNJC 1CZWA 2M9VA 2PCFB 2RSOA 1SFOB 1IBMQ 2F0PA 3OWEB 1SJED 2CW0C 1QJOA 3H6MA 3DEOA 2WAQB 2V1CC 4EX5A 2NN6I 2DGYA 2UXDL 1IBLQ 1Q82C 1YHBA 1OXTA 5KIXA 2EPBA 3CXCA 3CPWA 2F0IA 1Z7TA 4X6AH 3D4RA 1U4LA 2Q8TA 3TRZA 4C1NI 2JA7G 2R92H 4KV6A 3M4YA 3ER0A 3W5OA 5DM63 2Z6KA 2SNMA 4DV4Q 1FNUA 3KJOA 5C3XA 4R4IA 3V96A 3STBC 4KKUA 4HSVA 3RLOA 3CC2A 1BVSA 2HHHQ 1IL8A 1LTRD 5COYA 5CYUA 1YITA 4A3MG 4TRDA 4GLVB 1PH1A 4L5TA 1Q81C 4RKLA 1XMOQ 2CQOA 2JYOA 4LUVA 2R93B 3J7ZC 3OYYA 4IUQA 3DM1A 3VYUA 3VDYA 2X6LA 1J5EL 1PA6A 1JT8A 2F0DA 4KI0A 2X6GA 1WTHA 2I07B 2R7ZG 3CRKC 1PYWD 3I4OA 4HIOA 4A3BB 1SE8A 4IPHA 4CDFC 3Q8DA 1F2MA 1E1OA 3SHLA 4JI7Q 3STBD 2I46A 1XPRA 5IGDA 4R8NA 1R9TH 4OL7A 2UUAL 4IUTA 2EXZA 1DOLA 1TWAB 4PNYA 1U5KA 2J7ZA 3SK4A 1HUNA 2EY5A 4DUYL 1HNZQ 3SK8A 1N36Q 1GUGA 1U9RA 3BJUA 1X3GA 2OT2A 2OWOA 4A93G 3Q24A 1N32L 4MIUA 5LL6X 4GNXC 4B9XA 4GOPB 4FF1A 4RGNA 5GROA 4OWXB 1Y8NB 1U4PA 3J7A5 2UUBQ 5M3MH 4JI6L 2XRSD 2K14A 3GTMH 2MJ8A 1TWGB 1EL0A 1D8LA 1X3FA 3QOJA 1EUJA 3I4MH 3I8ZA 2JE6I 3S1RH 2A6HC 2B29A 1JE5A 1IKLA 2MGSA 3E3XA 4GLXA 1UE7A 1Q1BA 4KMUC 4FNFA 4YCWA 3PMFA 4V190 5JPMC 3S1QH 2K01A 3HOWH 1SYBA 2IJ0A 4AYBG 4XDXA 5FO9B 4B3SL 2PNHA 3EBEA 4LW1A 1H9KA 3KLSX 4JBJA 1JORA 3UE0A 1HFGA 3V05A 2VUMH 1D1IA 1EEID 2PI2E 1VQPA 2WIIB 2OF1A 3S17B 5EJWA 3HOZB 3J7AF 2NN6G 1EQTA 4YIJA 2C5CA 2Q8IB 4PMBA 2R92G 2BDNA 4JPBW 3KBGA 1PZID 3KF6A 1JCKB 1EWCA 4A3GH 1F77A 3TMEA 3K81C 2VZAA 5LMNL 2K7VA 3I3CA 1Z9FA 1HR0Q 1KABA 3HRZC 3D3RA 2IW3A 2C9OA 3E0JA 5I6WA 1PHJA 3CQZH 3HFZB 4HTHA 1LTTD 4N9PA 3R3OA 5I9PA 3DWQA 1Y8OB 5KYIA 1JE4A 5HGTA 2NVXB 2EIFA 2JA6G 3BYYB 1N33Q 4DV1Q 5FO7B 2VL6A 1DYQA 3K57A 4IJHA 1HNXL 1CKOA 5E3FA 1YVCA 1A3TA 3C2PA 2EYLA 1EZ6A 3MAQA 3HGBA 1I4RA 3CC7A 3TP8A 5JEAG 4KKSA 3F2DA 1P8LA 1EYDA 1S5FD 4XTCS 2KOLA 3VR3A 2H4OA 1KTKA 2AUJD 3D31A 1VQKA 5C3EG 1JC7A 2Q2TA 1Y1VG 1ZEQX 2F52A 3CPFA 1TT2A 1JB3A 3C46A 2KHJA 2B2YC 1B53A 3FP9A 5E1FA 3NK9A 4K5VA 5M3FG 4BS9A 1AFPA 2F0OA 3VYSA 2PZTA 3PUXA 4K5XA 4UAIA 4CDDC 2OTLA 3MXPA 3S2DH 4QL5A 1L0XB 1VQ6A 2KBNA 4NKLA 4C3JH 1STAA 1S3OA 5CGKA 3MZ5A 3U58A 4K6LA 5C4ZA 4KN7C 5A35A 4P74A 1XPUA 1NCVA 2PZUA 1I3QB 5C0XI 3I55A 1IKMA 3FKIH 3J80c 4MN3A 3HOXG 4IO9A 5D14A 4YCUA 1A0IA 5C4XH 3O13A 2K04A 1HR0W 3R2IA 3CMAA 1FR3A 1YJWA 3HKZB 4HR7B 1WCMB 1F2ZA 4N8X1 3V2TA 1SE2A 4A3KB 1HZAA 3UDGA 3L3OC 2HQEA 3J81c 1I94Q 1KNAA 3PF4A 3RZOH 5D65A 2F4VL 1BCPF 2ICEC 3I73A 1F9RA 4HCSA 1XYIA 2EVBA 1CK1A 1DOMA 5FLXc 4A3GG 1ESFA 1HTPA 4POGA 4HIKA 4H02A 3SXHA 1TXYA 1X6OA 2Z9HA 2JA8H 3LX0A 5KGUA 1Z6HA 1K73C 1NTGA 1VQCA 1V1PA 3FPUB 1RCVD 4FYDA 2BH8A 2E2IH 1VMPA 2KUMA 1F9QA 2H1EA 2V4DA 4OX9L 1I50B 2CH4A 2K5NA 3JAME 4LAAA 1ET6A 1WJJA 3FRPB 3CMEA 5EBDA 1K0SA 2Z4HA 1OXUA 3CW2C 3H09A 2ZJQA 2KCCA 1HZBA 5IP9H 4WFN3 1AP0A
chains in the Genus database with same CATH topology
3U4ZA 4YY3Q 4MTNA 4A3IH 2Y0SG 5C0XJ 3PO3H 4DR3Q 1XMQQ 5GAHC 3HOZH 1HZ9A 2GVBA 2WB1G 2MNAA 4QGUA 4P75A 1I94L 5HGQA 3K0XA 3RN5A 3GDEA 1IZ6A 4R1JA 5LMUQ 2KHIA 2RHQB 3CD6A 4K0KL 1FVIA 2NZHA 3BU2A 4R4QA 1UE5A 2VQFL 4JI5Q 2D0OA 1VQHA 4JI2Q 1UWVA 3F1ZA 1EFWA 2E5LQ 1Y1WG 2YYZA 4DV6Q 2PQAB 4LF7L 4DV5Q 2B63H 1B7YB 3PIPA 4LFAQ 5C44G 4DV7L 4X62L 4PZ8A 2I5MX 2KCMA 4LF8Q 2K75A 5IYDG 3W1GA 1BKBA 2VY3A 1QVCA 4DR7Q 4DK6C 2LSSA 4BY1H 1XPOA 4JOIA 3KLWA 1OTCA 4BXXG 1SROA 5GAEC 4B3RL 4JYAQ 2AHOB 4LF9L 1QUQB 1PH7A 5GQOA 3GTQH 3A5ZB 2JA6H 4LFBL 1PH5A 3TREA 3F2CA 1E7ZA 4A3CH 1KHIA 4ME3A 4UP7A 4YY3L 3HOUG 2ASBA 1NMFA 3RLNA 3CCEA 1NMGA 2N78A 4JBWA 1C0AA 1VQ9A 1EIFA 5M5XH 3G6EA 4DR2Q 1XMQL 3CCVA 4A3EH 1VQMA 5HY6A 2JJQA 4AYBE 4Y52H 3PCOB 4B3MQ 1BBUA 2GVAA 3CAMA 5AJ3Q 3UDFA 4YWLA 5M3MG 4JCVE 5M5WH 4DNIA 4UP8A 4JI8Q 1N9WA 5GAGC 1VQEA 3E9HA 3SGIA 4B3TQ 1L1OA 4A76A 1XJVA 4JI5L 3KDFB 2F3IA 1ASZA 2E2JH 4JI2L 1LTLA 2QGQA 1W2BA 2H5XA 3I4MG 2E5LL 1NE3A 5C0XG 4JV5Q 4OO1I 4DV6L 1I5FA 1IXRA 3ERSX 4DV5L 5C4JH 4P71A 3NENA 4LFAL 4NXMQ 4TQUS 5C3EH 2OCEA 4DV2Q 2K5HA 1Y1VH 2K4KA 4GLAC 4GN5A 4A3FG 1MJEA 2VS1A 2BH2A 4LF8L 1Q7YC 4A3LH 1VQ5A 1K9MC 3KJPA 2A1AA 3AFPA 1XNQQ 4DR7L 1AH9A 1MJCA 1MIUA 3HOWG 1RIPA 1E3PA 1VQNA 3GD7A 5M3FH 1K3RA 3L2PA 1GVPA 4BBSG 3AYHB 4BA1I 3S24A 4JYAL 2VUMG 3PUWA 2N3SA 4YWMA 2VW9A 2N8NA 3CCSA 2UXBQ 4POFA 4JI3L 1KRSA 3L7ZC 2DUDA 1GD7A 1CSQA 2UXDQ 2I0QA 2RF4A 3AQQA 4GNXA 4KLKA 4YWKA 3I7FA 1PH4A 2YU9H 5IYBH 1CKNA 5IYCG 1B8AA 4DR2L 2I5LX 3KF6B 4A4IA 1UE1A 3ZJYC 4UY8C 1Q46A 1KQSA 4B3ML 5JJIA 1I3QH 5AJ3L 1C9OA 4GOPC 3G48A 3RLFA 2VNUD 4JI8L 2KCTA 4B3TL 5FLMH 5DLQE 1O7IA 3S14H 4BBRH 3E9IA 1HNWQ 4P72A 3UE1A 3CCMA 4NXNQ 1K0RA 3HOXH 2ALYB 3KYHC 3G4SA 4OONA 4JV5L 5IWAQ 1TWFH 4JBMA 2RHSB 1PH9A 2Q2IA 1KC8C 1SMXA 5IP7H 2NVTH 4IPGA 5H1SE 2JEBI 3TEHB 1VQ4A 4NXML 1XNRQ 3L0OA 2YV5A 3NBHB 4DV2L 4HIMA 4IOAA 2OTJA 4OWTB 3K7AH 3ULLA 2ATWA 2IX1A 1WCMH 1IYJB 4APVA 2EXDA 4KHPL 1XNQL 4NB3A 4A3KH 1X65A 3CCLA 3OW2A 3HOVG 5IY0A 4ALPA 1K83H 4DR4Q 3RN2A 3IRBA 4X66Q 2WAQG 1IBMQ 1FGUA 1J5EQ 2D0PA 1G6PA 3G71A 3MEFA 2UXBL 4GS3A 1UE6A 2V1CC 2A8VA 4EX5A 2NN6I 2DGYA 3S17H 2UXDL 1IBLQ 2L15A 1Q82C 2B63G 1YHBA 1OXTA 3CPWA 1KIXA 3CXCA 3TS2A 3J81j 4X6AH 2D62A 4LF5L 2MQHA 4JI4Q 4BY7H 3I4NG 4A3DH 1EIYB 1X55A 5IT9c 4L5SA 4LF4Q 3TRZA 3KOJA 4Y7NH 2JA7G 4QJFA 2R92H 3PIOA 3T1YQ 2KENA 2UUAQ 3ER0A 3W5OA 1PV4A 5E7NA 1JJGA 1VQIA 1KL9A 2Z6KA 4DV4Q 3KJOA 1T9HA 4R4IA 1HNWL 3STBC 4NXNL 1YBYA 1HZCA 2K52A 5IWAL 4DUYQ 3RLOA 2UUCQ 3CC2A 2R6GA 4MZ9A 3S2HH 1BVSA 2HHHQ 3I2ZA 4AQYL 2AWOA 3RZDH 1XNRL 4DR6Q 1GKHA 5FJ8G 4PZ7A 2R93G 1YITA 4A3MG 1VQ7A 3PSIA 4GLVB 1PH1A 2IX0A 4L5TA 2WFWA 1C7YA 1Q81C 2JA5G 4WJ3M 1X56A 1XMOQ 2NVXH 4QIWE 2CQOA 4LUVA 3BZCA 1U0LA 3HKZE 3WWVA 1WOCA 1XTDA 3NEMA 3J7ZC 3OYYA 4HJ9A 1N32Q 4DR4L 1SRUA 1PH3A 3RR5A 2Q2UA 3GTOH 3K80C 4X66L 4DV0L 3VDYA 1IBML 4RG1A 1AE3A 1J5EL 1PA6A 1JT8A 2AMCB 2LXJA 2JEAI 4L5RC 4JI6Q 4MNOA 4KI0A 4C3HH 4A3BG 2ZTEA 5ELOA 4XIGS 1HH2P 3K7UC 4DR3L 1VQLA 2R7ZG 3S16H 2HIXA 3I4OA 4HIOA 3FHWA 1SE8A 4IPHA 1YNXA 3F2BA 1L1OC 3FKIG 1Y1WH 3Q8DA 2XGTA 1E1OA 3EIVA 4JI1Q 4JI4L 5LMUL 4IFDI 2PQAA 4JI7Q 5C44H 3STBD 1XPRA 2CFMA 4JI0Q 1E24A 1PH6A 4OWWB 4OO1G 3T1HQ 4LF4L 5C4XG 1JJCB 1R9TH 4KHZA 5BR8Q 3H3VH 3T1YL 2UUAL 1VQJA 2JA9A 2YTVA 2UU9Q 4DV4L 2EQSA 1N8RC 4QQBX 5IYDH 1U5KA 4C3IH 1HJPA 3HKSA 4DUYL 1HNZQ 2UUCL 2F4VQ 2OQ0A 4BXXH 4B3SQ 1VQDA 1OXVA 2HHHL 2ES2A 1N36Q 3ULJA 4LF6Q 1I6HH 4DR6L 2NZOA 1P16A 2PI2A 1QUQA 4PMWA 3BJUA 3CF5A 4DV3Q 4GKKQ 1DGSA 1E1TA 1S40A 1XMOL 3HOYG 3HOUH 1H95A 1X3GA 2OWOA 4A93G 3GTPH 4R4OA 1N32L 1SR3A 4R4TA 1UEBA 2I5HA 3A0JA 2B3GA 3TQYA 4YHHQ 4GNXC 3AEVA 3JAMi 4GOPB 1PH2A 2CKZB 2Y0SE 4P73A 5GROA 4OWXB 4X65Q 1K8GA 4LF6L 2UUBQ 5M3MH 4IPCA 4JI6L 2JA8G 3J7A5 3CC4A 3GTGH 2K14A 2QA4A 2WB1E 5LMNQ 3GTMH 3I56A 3RNUA 1D8LA 1X3FA 3PO2G 3KDFA 1EUJA 2ID0A 3I4MH 1YJ9A 3S1RH 2JE6I 1YI2A 2B29A 1JE5A 4JI1L 3PO3G 4JI7L 3CCQA 4JI0L 2HT1A 4DUZQ 4HIDA 4GLXA 3T1HL 4LNQA 1UE7A 1Q1BA 2MO0A 3H0GG 5BR8L 4A3FH 1KD1C 4LWCA 3M9BA 1QVGA 1VQBA 4YCWA 3UDXA 1CKMA 4OXPA 5IP9G 5JEAJ 3S1QH 1E22A 3HOWH 4GN3B 4AYBG 1QZHA 4A3IG 4BBSH 2MO1A 1HNZL 1YEZA 3PUZA 4B3SL 2PNHA 3EBEA 4LW1A 4X64Q 1N36L 3CP0A 1JB7A 2BA0A 3EN2A 3PGZA 4JBJA 3UE0A 2VUMH 1HNXQ 3HOZG 2PI2E 1VQ8A 2VQFQ 4IFDJ 1VQPA 2HIVA 1V43A 2JQOA 4DV3L 2FXQA 1NJIC 4GKKL 3GTJH 1G51A 1CSPA 3OTOQ 1N34Q 2E2HH 3GTKH 1X9NA 4BY7G 1KXLA 1FL0A 1V9PA 2IT1A 3DLLA 4J15A 4WJ4A 1A62A 2NN6G 2PMZE 5JJLA 2R92G 4YCVA 4YHHL 2JK8A 2ZM6Q 2MFIA 5EAYA 3KF6A 1YIJA 2UXCQ 4A3GH 4JG2A 3PV0A 4DPGA 4JBKA 4HJAA 2UUBL 3F8TA 3K81C 4C2MH 2VZAA 5LMNL 1YHAA 2QEXA 3PF5A 1VQOA 1Z9FA 1M1KC 4R4CA 1HR0Q 3KFUA 2CCZA 3PUYA 1YHQA 2E8GA 1EOVA 4BY1G 2Z6KC 1QZGA 1PHJA 3CQZH 3HFZB 1I50H 1A8VA 2N49A 4DUZL 3ULPA 1LM0A 4A3JH 2C35B 4PZ6A 3A74A 3M7NA 1X3EA 2ZJPA 2R7DA 1WFQA 1FJGQ 3M4OH 4LFCQ 4TVAB 2EIFA 2JA6G 2IHFA 1SFOH 3HOVH 4JOIC 4A3CG 1N33Q 4GKJQ 1K8AC 4DV1Q 1QVFA 1Z47A 2NVYH 4X64L 1S72A 1JMCA 2VL6A 1CUKA 4IOCA 4IJHA 4A3EG 1HNXL 1CKOA 1YVCA 1L2FA 4IPDA 5K36G 4DR1Q 2CWAA 4HJ5A 3OTOL 3CC7A 1N34L 1L1OB 4AIMA 1GO3E 5JEAG 1RL2A 3F2DA 4IJLA 4HJ7A 1NY4A 1P8LA 1SN8A 2Q2HA 3K8AA 2RCNA 4XTCS 2ZJRA 2ZM6L 3I4NH 2UXCL 1EYGA 1Y14B 1IBLL 5GADC 1YJNA 3H3VI 1PYSB 2JA7H 4IFDG 3D31A 5LMNW 1VQKA 5C3EG 1PFSA 1VQGA 1Y1VG 4GN4B 2Q2TA 2F52A 3CPFA 1HR0L 4A3LG 2GN5A 4AH6A 1W3SA 2KHJA 1KAWA 3FP9A 4JI3Q 2HQLA 1OXSC 2YTYA 3M3YH 5M3FG 4RMFA 3AFQA 2VQEQ 3UDIA 5FJ8H 3PUXA 2R93H 1KRTA 4A3MH 2OTLA 2JA5H 3S2DH 1X54A 4O0AA 1BBWA 4QL5A 1FJGL 1VQ6A 4LUOA 4LFCL 2XTIA 2KBNA 2AWNA 3CCUA 1NBWA 4GNXB 4C3JH 1N33L 4GKJL 3E0EA 3S1NH 1A63A 1S3OA 4DV1L 1JJ2A 1CKNB 5IYBG 2K50A 2ZTCA 1Q12A 1WI5A 4FDBA 2IHEA 1D7QA 3A5UA 3U58A 4A3BH 4JC0A 4UPAA 4DR1L 4DK3C 2WAQE 2R7ZH 1PYBA 1SLJA 3B6YA 3PUVA 4P74A 3U4VA 3JAMc 3M85A 1IBKQ 1XPUA 5FLMG 1AE2A 1OXXK 5C0XI 4BBRG 3I55A 1EWIA 3FKIH 5M5YH 4OX9Q 3J80c 3J80i 3HOXG 1J6QA 4IO9A 3KF8B 1Q8KA 1V1QA 4BA2I 4YCUA 4O2DA 1A0IA 4KHPQ 5C4XH 1TWAH 3JC66 5IP7G 2Z0SA 3NELA 1LUZA 1LYLA 3HKZG 1WYDA 3MXNB 3D0FA 1PH8A 4DR5Q 1HR0W 2BA1A 3CMAA 1WCMG 3M4QA 2R7FA 1YJWA 4EQ5A 1YZ6A 2NVQH 4A3KG 5JJKA 3BZKA 1ASYA 3CCJA 1EQRA 4DAMA 2ZTDA 1EQQA 2CWPA 1L0WA 3U50C 5IE8A 1Q86C 4A75A 2UU9L 2VQEL 1HZAA 4QY7A 3UDGA 1VCIA 2OQKA 3J81c 3J81i 1Q1EA 3TS0A 1I94Q 3ICEA 3PF4A 3RZOH 4LF5Q 2F4VL 2YTXA 1G291 1VQAA 3M4PA 3HOYH 4NPSA 1MKHA 4L5QA 4K0KQ 5FLXc 4A93H 4LUZA 3W1BA 4A3GG 1GM5A 2A19A 3H15A 4POGA 4HIKA 4H02A 1TXYA 1X6OA 1TWCH 4LF7Q 4GOPA 2JA8H 1B70B 4A3DG 3GO5A 1TWGH 1K73C 4DV7Q 1NTGA 1VQCA 4X62Q 4DAYB 1TWHH 5IYCH 2AKWB 2BH8A 2WP8J 2E2IH 3CCRA 2LXKA 4AQYQ 1IBKL 3DM3A 3PO2H 4X65L 4A3JG 5ELNA 2K5VA 4OX9L 1PVOA 3S15H 5J3BA 2K5NA 1VQFA 1WJJA 2IY5B 3LGJA 4PG3A 4B3RQ 3CMEA 3H0GH 1VS0A 4LF9Q 1IL2A 3GTLH 1M90C 1OXUA 4DKAC 3S1MH 3CW2C 4UP9A 4HJ8A 2ZJQA 4DR5L 1HZBA 4DV0Q 5IP9H 4LFBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4Z A;  4YY3 Q;  4MTN A;  4A3I H;  2Y0S G;  5C0X J;  3PO3 H;  4DR3 Q;  1XMQ Q;  5GAH C;  3HOZ H;  1HZ9 A;  2GVB A;  2WB1 G;  2MNA A;  4QGU A;  4P75 A;  1I94 L;  5HGQ A;  3K0X A;  3RN5 A;  3GDE A;  1IZ6 A;  4R1J A;  5LMU Q;  2KHI A;  2RHQ B;  3CD6 A;  4K0K L;  1FVI A;  2NZH A;  3BU2 A;  4R4Q A;  1UE5 A;  2VQF L;  4JI5 Q;  2D0O A;  1VQH A;  4JI2 Q;  1UWV A;  3F1Z A;  1EFW A;  2E5L Q;  1Y1W G;  2YYZ A;  4DV6 Q;  2PQA B;  4LF7 L;  4DV5 Q;  2B63 H;  1B7Y B;  3PIP A;  4LFA Q;  5C44 G;  4DV7 L;  4X62 L;  4PZ8 A;  2I5M X;  2KCM A;  4LF8 Q;  2K75 A;  5IYD G;  3W1G A;  1BKB A;  2VY3 A;  1QVC A;  4DR7 Q;  4DK6 C;  2LSS A;  4BY1 H;  1XPO A;  4JOI A;  3KLW A;  1OTC A;  4BXX G;  1SRO A;  5GAE C;  4B3R L;  4JYA Q;  2AHO B;  4LF9 L;  1QUQ B;  1PH7 A;  5GQO A;  3GTQ H;  3A5Z B;  2JA6 H;  4LFB L;  1PH5 A;  3TRE A;  3F2C A;  1E7Z A;  4A3C H;  1KHI A;  4ME3 A;  4UP7 A;  4YY3 L;  3HOU G;  2ASB A;  1NMF A;  3RLN A;  3CCE A;  1NMG A;  2N78 A;  4JBW A;  1C0A A;  1VQ9 A;  1EIF A;  5M5X H;  3G6E A;  4DR2 Q;  1XMQ L;  3CCV A;  4A3E H;  1VQM A;  5HY6 A;  2JJQ A;  4AYB E;  4Y52 H;  3PCO B;  4B3M Q;  1BBU A;  2GVA A;  3CAM A;  5AJ3 Q;  3UDF A;  4YWL A;  5M3M G;  4JCV E;  5M5W H;  4DNI A;  4UP8 A;  4JI8 Q;  1N9W A;  5GAG C;  1VQE A;  3E9H A;  3SGI A;  4B3T Q;  1L1O A;  4A76 A;  1XJV A;  4JI5 L;  3KDF B;  2F3I A;  1ASZ A;  2E2J H;  4JI2 L;  1LTL A;  2QGQ A;  1W2B A;  2H5X A;  3I4M G;  2E5L L;  1NE3 A;  5C0X G;  4JV5 Q;  4OO1 I;  4DV6 L;  1I5F A;  1IXR A;  3ERS X;  4DV5 L;  5C4J H;  4P71 A;  3NEN A;  4LFA L;  4NXM Q;  4TQU S;  5C3E H;  2OCE A;  4DV2 Q;  2K5H A;  1Y1V H;  2K4K A;  4GLA C;  4GN5 A;  4A3F G;  1MJE A;  2VS1 A;  2BH2 A;  4LF8 L;  1Q7Y C;  4A3L H;  1VQ5 A;  1K9M C;  3KJP A;  2A1A A;  3AFP A;  1XNQ Q;  4DR7 L;  1AH9 A;  1MJC A;  1MIU A;  3HOW G;  1RIP A;  1E3P A;  1VQN A;  3GD7 A;  5M3F H;  1K3R A;  3L2P A;  1GVP A;  4BBS G;  3AYH B;  4BA1 I;  3S24 A;  4JYA L;  2VUM G;  3PUW A;  2N3S A;  4YWM A;  2VW9 A;  2N8N A;  3CCS A;  2UXB Q;  4POF A;  4JI3 L;  1KRS A;  3L7Z C;  2DUD A;  1GD7 A;  1CSQ A;  2UXD Q;  2I0Q A;  2RF4 A;  3AQQ A;  4GNX A;  4KLK A;  4YWK A;  3I7F A;  1PH4 A;  2YU9 H;  5IYB H;  1CKN A;  5IYC G;  1B8A A;  4DR2 L;  2I5L X;  3KF6 B;  4A4I A;  1UE1 A;  3ZJY C;  4UY8 C;  1Q46 A;  1KQS A;  4B3M L;  5JJI A;  1I3Q H;  5AJ3 L;  1C9O A;  4GOP C;  3G48 A;  3RLF A;  2VNU D;  4JI8 L;  2KCT A;  4B3T L;  5FLM H;  5DLQ E;  1O7I A;  3S14 H;  4BBR H;  3E9I A;  1HNW Q;  4P72 A;  3UE1 A;  3CCM A;  4NXN Q;  1K0R A;  3HOX H;  2ALY B;  3KYH C;  3G4S A;  4OON A;  4JV5 L;  5IWA Q;  1TWF H;  4JBM A;  2RHS B;  1PH9 A;  2Q2I A;  1KC8 C;  1SMX A;  5IP7 H;  2NVT H;  4IPG A;  5H1S E;  2JEB I;  3TEH B;  1VQ4 A;  4NXM L;  1XNR Q;  3L0O A;  2YV5 A;  3NBH B;  4DV2 L;  4HIM A;  4IOA A;  2OTJ A;  4OWT B;  3K7A H;  3ULL A;  2ATW A;  2IX1 A;  1WCM H;  1IYJ B;  4APV A;  2EXD A;  4KHP L;  1XNQ L;  4NB3 A;  4A3K H;  1X65 A;  3CCL A;  3OW2 A;  3HOV G;  5IY0 A;  4ALP A;  1K83 H;  4DR4 Q;  3RN2 A;  3IRB A;  4X66 Q;  2WAQ G;  1IBM Q;  1FGU A;  1J5E Q;  2D0P A;  1G6P A;  3G71 A;  3MEF A;  2UXB L;  4GS3 A;  1UE6 A;  2V1C C;  2A8V A;  4EX5 A;  2NN6 I;  2DGY A;  3S17 H;  2UXD L;  1IBL Q;  2L15 A;  1Q82 C;  2B63 G;  1YHB A;  1OXT A;  3CPW A;  1KIX A;  3CXC A;  3TS2 A;  3J81 j;  4X6A H;  2D62 A;  4LF5 L;  2MQH A;  4JI4 Q;  4BY7 H;  3I4N G;  4A3D H;  1EIY B;  1X55 A;  5IT9 c;  4L5S A;  4LF4 Q;  3TRZ A;  3KOJ A;  4Y7N H;  2JA7 G;  4QJF A;  2R92 H;  3PIO A;  3T1Y Q;  2KEN A;  2UUA Q;  3ER0 A;  3W5O A;  1PV4 A;  5E7N A;  1JJG A;  1VQI A;  1KL9 A;  2Z6K A;  4DV4 Q;  3KJO A;  1T9H A;  4R4I A;  1HNW L;  3STB C;  4NXN L;  1YBY A;  1HZC A;  2K52 A;  5IWA L;  4DUY Q;  3RLO A;  2UUC Q;  3CC2 A;  2R6G A;  4MZ9 A;  3S2H H;  1BVS A;  2HHH Q;  3I2Z A;  4AQY L;  2AWO A;  3RZD H;  1XNR L;  4DR6 Q;  1GKH A;  5FJ8 G;  4PZ7 A;  2R93 G;  1YIT A;  4A3M G;  1VQ7 A;  3PSI A;  4GLV B;  1PH1 A;  2IX0 A;  4L5T A;  2WFW A;  1C7Y A;  1Q81 C;  2JA5 G;  4WJ3 M;  1X56 A;  1XMO Q;  2NVX H;  4QIW E;  2CQO A;  4LUV A;  3BZC A;  1U0L A;  3HKZ E;  3WWV A;  1WOC A;  1XTD A;  3NEM A;  3J7Z C;  3OYY A;  4HJ9 A;  1N32 Q;  4DR4 L;  1SRU A;  1PH3 A;  3RR5 A;  2Q2U A;  3GTO H;  3K80 C;  4X66 L;  4DV0 L;  3VDY A;  1IBM L;  4RG1 A;  1AE3 A;  1J5E L;  1PA6 A;  1JT8 A;  2AMC B;  2LXJ A;  2JEA I;  4L5R C;  4JI6 Q;  4MNO A;  4KI0 A;  4C3H H;  4A3B G;  2ZTE A;  5ELO A;  4XIG S;  1HH2 P;  3K7U C;  4DR3 L;  1VQL A;  2R7Z G;  3S16 H;  2HIX A;  3I4O A;  4HIO A;  3FHW A;  1SE8 A;  4IPH A;  1YNX A;  3F2B A;  1L1O C;  3FKI G;  1Y1W H;  3Q8D A;  2XGT A;  1E1O A;  3EIV A;  4JI1 Q;  4JI4 L;  5LMU L;  4IFD I;  2PQA A;  4JI7 Q;  5C44 H;  3STB D;  1XPR A;  2CFM A;  4JI0 Q;  1E24 A;  1PH6 A;  4OWW B;  4OO1 G;  3T1H Q;  4LF4 L;  5C4X G;  1JJC B;  1R9T H;  4KHZ A;  5BR8 Q;  3H3V H;  3T1Y L;  2UUA L;  1VQJ A;  2JA9 A;  2YTV A;  2UU9 Q;  4DV4 L;  2EQS A;  1N8R C;  4QQB X;  5IYD H;  1U5K A;  4C3I H;  1HJP A;  3HKS A;  4DUY L;  1HNZ Q;  2UUC L;  2F4V Q;  2OQ0 A;  4BXX H;  4B3S Q;  1VQD A;  1OXV A;  2HHH L;  2ES2 A;  1N36 Q;  3ULJ A;  4LF6 Q;  1I6H H;  4DR6 L;  2NZO A;  1P16 A;  2PI2 A;  1QUQ A;  4PMW A;  3BJU A;  3CF5 A;  4DV3 Q;  4GKK Q;  1DGS A;  1E1T A;  1S40 A;  1XMO L;  3HOY G;  3HOU H;  1H95 A;  1X3G A;  2OWO A;  4A93 G;  3GTP H;  4R4O A;  1N32 L;  1SR3 A;  4R4T A;  1UEB A;  2I5H A;  3A0J A;  2B3G A;  3TQY A;  4YHH Q;  4GNX C;  3AEV A;  3JAM i;  4GOP B;  1PH2 A;  2CKZ B;  2Y0S E;  4P73 A;  5GRO A;  4OWX B;  4X65 Q;  1K8G A;  4LF6 L;  2UUB Q;  5M3M H;  4IPC A;  4JI6 L;  2JA8 G;  3J7A 5;  3CC4 A;  3GTG H;  2K14 A;  2QA4 A;  2WB1 E;  5LMN Q;  3GTM H;  3I56 A;  3RNU A;  1D8L A;  1X3F A;  3PO2 G;  3KDF A;  1EUJ A;  2ID0 A;  3I4M H;  1YJ9 A;  3S1R H;  2JE6 I;  1YI2 A;  2B29 A;  1JE5 A;  4JI1 L;  3PO3 G;  4JI7 L;  3CCQ A;  4JI0 L;  2HT1 A;  4DUZ Q;  4HID A;  4GLX A;  3T1H L;  4LNQ A;  1UE7 A;  1Q1B A;  2MO0 A;  3H0G G;  5BR8 L;  4A3F H;  1KD1 C;  4LWC A;  3M9B A;  1QVG A;  1VQB A;  4YCW A;  3UDX A;  1CKM A;  4OXP A;  5IP9 G;  5JEA J;  3S1Q H;  1E22 A;  3HOW H;  4GN3 B;  4AYB G;  1QZH A;  4A3I G;  4BBS H;  2MO1 A;  1HNZ L;  1YEZ A;  3PUZ A;  4B3S L;  2PNH A;  3EBE A;  4LW1 A;  4X64 Q;  1N36 L;  3CP0 A;  1JB7 A;  2BA0 A;  3EN2 A;  3PGZ A;  4JBJ A;  3UE0 A;  2VUM H;  1HNX Q;  3HOZ G;  2PI2 E;  1VQ8 A;  2VQF Q;  4IFD J;  1VQP A;  2HIV A;  1V43 A;  2JQO A;  4DV3 L;  2FXQ A;  1NJI C;  4GKK L;  3GTJ H;  1G51 A;  1CSP A;  3OTO Q;  1N34 Q;  2E2H H;  3GTK H;  1X9N A;  4BY7 G;  1KXL A;  1FL0 A;  1V9P A;  2IT1 A;  3DLL A;  4J15 A;  4WJ4 A;  1A62 A;  2NN6 G;  2PMZ E;  5JJL A;  2R92 G;  4YCV A;  4YHH L;  2JK8 A;  2ZM6 Q;  2MFI A;  5EAY A;  3KF6 A;  1YIJ A;  2UXC Q;  4A3G H;  4JG2 A;  3PV0 A;  4DPG A;  4JBK A;  4HJA A;  2UUB L;  3F8T A;  3K81 C;  4C2M H;  2VZA A;  5LMN L;  1YHA A;  2QEX A;  3PF5 A;  1VQO A;  1Z9F A;  1M1K C;  4R4C A;  1HR0 Q;  3KFU A;  2CCZ A;  3PUY A;  1YHQ A;  2E8G A;  1EOV A;  4BY1 G;  2Z6K C;  1QZG A;  1PHJ A;  3CQZ H;  3HFZ B;  1I50 H;  1A8V A;  2N49 A;  4DUZ L;  3ULP A;  1LM0 A;  4A3J H;  2C35 B;  4PZ6 A;  3A74 A;  3M7N A;  1X3E A;  2ZJP A;  2R7D A;  1WFQ A;  1FJG Q;  3M4O H;  4LFC Q;  4TVA B;  2EIF A;  2JA6 G;  2IHF A;  1SFO H;  3HOV H;  4JOI C;  4A3C G;  1N33 Q;  4GKJ Q;  1K8A C;  4DV1 Q;  1QVF A;  1Z47 A;  2NVY H;  4X64 L;  1S72 A;  1JMC A;  2VL6 A;  1CUK A;  4IOC A;  4IJH A;  4A3E G;  1HNX L;  1CKO A;  1YVC A;  1L2F A;  4IPD A;  5K36 G;  4DR1 Q;  2CWA A;  4HJ5 A;  3OTO L;  3CC7 A;  1N34 L;  1L1O B;  4AIM A;  1GO3 E;  5JEA G;  1RL2 A;  3F2D A;  4IJL A;  4HJ7 A;  1NY4 A;  1P8L A;  1SN8 A;  2Q2H A;  3K8A A;  2RCN A;  4XTC S;  2ZJR A;  2ZM6 L;  3I4N H;  2UXC L;  1EYG A;  1Y14 B;  1IBL L;  5GAD C;  1YJN A;  3H3V I;  1PYS B;  2JA7 H;  4IFD G;  3D31 A;  5LMN W;  1VQK A;  5C3E G;  1PFS A;  1VQG A;  1Y1V G;  4GN4 B;  2Q2T A;  2F52 A;  3CPF A;  1HR0 L;  4A3L G;  2GN5 A;  4AH6 A;  1W3S A;  2KHJ A;  1KAW A;  3FP9 A;  4JI3 Q;  2HQL A;  1OXS C;  2YTY A;  3M3Y H;  5M3F G;  4RMF A;  3AFQ A;  2VQE Q;  3UDI A;  5FJ8 H;  3PUX A;  2R93 H;  1KRT A;  4A3M H;  2OTL A;  2JA5 H;  3S2D H;  1X54 A;  4O0A A;  1BBW A;  4QL5 A;  1FJG L;  1VQ6 A;  4LUO A;  4LFC L;  2XTI A;  2KBN A;  2AWN A;  3CCU A;  1NBW A;  4GNX B;  4C3J H;  1N33 L;  4GKJ L;  3E0E A;  3S1N H;  1A63 A;  1S3O A;  4DV1 L;  1JJ2 A;  1CKN B;  5IYB G;  2K50 A;  2ZTC A;  1Q12 A;  1WI5 A;  4FDB A;  2IHE A;  1D7Q A;  3A5U A;  3U58 A;  4A3B H;  4JC0 A;  4UPA A;  4DR1 L;  4DK3 C;  2WAQ E;  2R7Z H;  1PYB A;  1SLJ A;  3B6Y A;  3PUV A;  4P74 A;  3U4V A;  3JAM c;  3M85 A;  1IBK Q;  1XPU A;  5FLM G;  1AE2 A;  1OXX K;  5C0X I;  4BBR G;  3I55 A;  1EWI A;  3FKI H;  5M5Y H;  4OX9 Q;  3J80 c;  3J80 i;  3HOX G;  1J6Q A;  4IO9 A;  3KF8 B;  1Q8K A;  1V1Q A;  4BA2 I;  4YCU A;  4O2D A;  1A0I A;  4KHP Q;  5C4X H;  1TWA H;  3JC6 6;  5IP7 G;  2Z0S A;  3NEL A;  1LUZ A;  1LYL A;  3HKZ G;  1WYD A;  3MXN B;  3D0F A;  1PH8 A;  4DR5 Q;  1HR0 W;  2BA1 A;  3CMA A;  1WCM G;  3M4Q A;  2R7F A;  1YJW A;  4EQ5 A;  1YZ6 A;  2NVQ H;  4A3K G;  5JJK A;  3BZK A;  1ASY A;  3CCJ A;  1EQR A;  4DAM A;  2ZTD A;  1EQQ A;  2CWP A;  1L0W A;  3U50 C;  5IE8 A;  1Q86 C;  4A75 A;  2UU9 L;  2VQE L;  1HZA A;  4QY7 A;  3UDG A;  1VCI A;  2OQK A;  3J81 c;  3J81 i;  1Q1E A;  3TS0 A;  1I94 Q;  3ICE A;  3PF4 A;  3RZO H;  4LF5 Q;  2F4V L;  2YTX A;  1G29 1;  1VQA A;  3M4P A;  3HOY H;  4NPS A;  1MKH A;  4L5Q A;  4K0K Q;  5FLX c;  4A93 H;  4LUZ A;  3W1B A;  4A3G G;  1GM5 A;  2A19 A;  3H15 A;  4POG A;  4HIK A;  4H02 A;  1TXY A;  1X6O A;  1TWC H;  4LF7 Q;  4GOP A;  2JA8 H;  1B70 B;  4A3D G;  3GO5 A;  1TWG H;  1K73 C;  4DV7 Q;  1NTG A;  1VQC A;  4X62 Q;  4DAY B;  1TWH H;  5IYC H;  2AKW B;  2BH8 A;  2WP8 J;  2E2I H;  3CCR A;  2LXK A;  4AQY Q;  1IBK L;  3DM3 A;  3PO2 H;  4X65 L;  4A3J G;  5ELN A;  2K5V A;  4OX9 L;  1PVO A;  3S15 H;  5J3B A;  2K5N A;  1VQF A;  1WJJ A;  2IY5 B;  3LGJ A;  4PG3 A;  4B3R Q;  3CME A;  3H0G H;  1VS0 A;  4LF9 Q;  1IL2 A;  3GTL H;  1M90 C;  1OXU A;  4DKA C;  3S1M H;  3CW2 C;  4UP9 A;  4HJ8 A;  2ZJQ A;  4DR5 L;  1HZB A;  4DV0 Q;  5IP9 H;  4LFB Q; 
#chains in the Genus database with same CATH topology
 4HCE A;  2Y0S G;  5IGC A;  3PO3 H;  5CV7 A;  3X3M A;  3VA7 A;  5GAH C;  1HZ9 A;  1SNQ A;  2GVB A;  2WB1 G;  5C4H A;  2MNA A;  4WRD A;  2MUY A;  5HGQ A;  1MGS A;  1A6X A;  1IZ6 A;  4LK1 C;  2KHI A;  2RHQ B;  1DZ1 A;  3MA2 B;  1UE5 A;  4JI2 Q;  1GXD C;  2VB2 X;  2EDG A;  3MHB A;  2PQA B;  4DV5 Q;  5C44 G;  4DV7 L;  4IUV A;  4X62 L;  4CKB A;  1HRJ A;  3P1H A;  5IYD G;  5C3W A;  2F0S A;  1QVC A;  1R9T B;  1XTC D;  4BY1 H;  5G3L F;  1OTC A;  4BXX G;  4B3R L;  4LF9 L;  1FNW A;  1QUQ B;  1VMC A;  1TY2 A;  2EY2 A;  1PH7 A;  2JSO A;  3NHH A;  3A5Z B;  4OEL B;  1RTN A;  1KHI A;  4ME3 A;  2O2L D;  1NMF A;  2PMZ B;  4JBW A;  1C0A A;  4DK1 A;  5M5X H;  1XMQ L;  1TU2 B;  1VQM A;  4AYB E;  1TS5 A;  4B3M Q;  1BBU A;  2GVA A;  1HHV A;  1MSH A;  1TKW B;  2ZXR A;  1NNX A;  1N9W A;  4JI8 Q;  5GAG C;  1SJH D;  1L1O A;  1PXU A;  1YNN D;  2XWJ B;  3QOL A;  5M3M B;  4JI5 L;  5COR A;  2F3I A;  1ASZ A;  1LTL A;  3GTM B;  2E5L L;  4JV5 Q;  3L9A X;  5C0X G;  4OO1 I;  1IXR A;  1CZG A;  3T16 A;  1B1Z A;  3QJY A;  4LFA L;  2L0C A;  3I4M B;  4X3T A;  4NXM Q;  5CR3 A;  2K05 A;  1KLU D;  4GN5 A;  1MJE A;  4E6I A;  3P7J A;  1Q7Y C;  1JIC A;  5BN3 A;  1XNQ Q;  1AH9 A;  1AZP A;  1B44 D;  1E3P A;  1VQN A;  1K3R A;  1HUM A;  5IGE A;  1T5X D;  3S1Q B;  2LMC B;  4BA1 I;  3HOW B;  3U9O A;  1HFN A;  4JI3 L;  2DN8 A;  2VUM B;  3GP7 A;  2I0Q A;  5IYB H;  4B08 A;  1CKN A;  1WTX A;  1RTO A;  3OW7 A;  2K32 A;  2BOS A;  1KQS A;  4NDX A;  5AJ3 L;  4DXG A;  4GOP C;  3RLF A;  3A8I E;  1PRT F;  2KCT A;  4B3T L;  2F0Q A;  3K5O A;  1O7I A;  3MXG A;  4CGY B;  4BBR H;  1HNW Q;  3CCM A;  1K0R A;  2B8G A;  3MWY W;  3KYH C;  3G4S A;  1Y69 U;  3JAM L;  1TWF H;  4JBM A;  2SNS A;  2M2L A;  1SMX A;  4IPG A;  1NAP A;  4DV2 L;  2YV5 A;  3CQZ B;  2OTJ A;  4IOA A;  4F87 A;  2ATW A;  3MXN A;  5KNB A;  4APV A;  3Q22 A;  2IL8 A;  1RD9 D;  5KEE A;  3CCL A;  1D2B A;  3J80 E;  1EFI D;  5L37 A;  3IRB A;  4X66 Q;  4X3U A;  2WAQ G;  2F1M A;  1FGU A;  4CKE A;  3G71 A;  4H7B A;  3F2U A;  3S17 H;  1EIG A;  1PFM A;  4QUC A;  2KHS A;  1KIX A;  1C8C A;  3J81 j;  5EGT A;  4JI4 Q;  2B63 B;  1EIY B;  3J81 E;  1X55 A;  4L5S A;  2CHB D;  1S5E D;  2EYH A;  3C1E A;  3TP6 A;  4DAY A;  2KEN A;  5E7N A;  5FLX E;  1JJG A;  1VQI A;  3G7L A;  4NXN L;  1CA6 A;  1QB5 D;  5IWA L;  3S2H H;  2R6G A;  1V1O A;  5CV9 A;  3TZU A;  1BUV T;  3RZD H;  1XNR L;  5FJ8 G;  1BBX C;  4PZ7 A;  2R93 G;  3PSI A;  4DFA A;  2WFW A;  1C7Y A;  4WJ3 M;  1HQM C;  2NVX H;  4QIW E;  2E2D C;  2WIN B;  3WWV A;  1IYU A;  3S2D B;  4HJ9 A;  3K5M A;  3EJI A;  1I4P A;  4DR4 L;  2B2V C;  1PH3 A;  3C3L A;  4ZQ3 A;  1FGB D;  4DV0 L;  4C3J B;  1AE3 A;  4MNO A;  4C3H H;  4A3B G;  2N55 A;  2ZTE A;  2Z1C A;  4QB4 A;  3OSO A;  2O4X A;  3QG1 A;  1S4Z A;  2F3W A;  4FP5 D;  2PYK A;  1Y1W H;  2XGT A;  4HN7 A;  4IFD I;  5LMU L;  2CFM A;  4OO1 G;  3FKI B;  1SBB B;  3T1H Q;  4LF4 L;  4KHZ A;  3T1Y L;  1JR0 D;  1VQJ A;  2JA9 A;  2YTV A;  5C4X B;  3HS0 C;  3LWE A;  2B2T C;  2JXM B;  2XRQ D;  2VB3 X;  2F4V Q;  5DM7 3;  2UUC L;  1EYC A;  3NUC A;  4CJ0 B;  4DGZ A;  4DR6 L;  2PI2 A;  5E4X A;  3CF5 A;  4DV3 Q;  1LTG D;  4GKK Q;  1S40 A;  4DA2 A;  3HOU H;  1PTO F;  3NSW A;  3GTP H;  3MXU A;  3RZO B;  4L8J A;  1UEB A;  3A0J A;  3TQY A;  4YHH Q;  1PH2 A;  2HUG A;  2Y0S E;  4P73 A;  5A2Q E;  3GTG H;  3TP5 A;  2WB1 E;  3FVQ A;  2PW5 A;  3I56 A;  2JA8 B;  3KDF A;  1YJ9 A;  2E2I B;  4JI1 L;  3A8J E;  2CVR A;  4JI0 L;  3OWF A;  3T4A C;  4DUZ Q;  1BNZ A;  5BR8 L;  2FMM A;  2KQ3 A;  1VQB A;  1CKM A;  1KDC A;  4OXP A;  5JEA J;  1G2S A;  3J80 L;  3A54 A;  1QZH A;  1YEZ A;  4LF6 L;  1JB7 A;  5LHY 1;  3EN2 A;  3HOZ G;  4RCN A;  3BVM A;  1RHP A;  1V43 A;  2JQO A;  3PO3 B;  2VXW A;  4XQJ A;  4HED A;  1G51 A;  1CSP A;  1X9N A;  1FL0 A;  1V9P A;  1A62 A;  2KJX A;  2F0H A;  4BY7 B;  1ICW A;  2ZM6 Q;  1YIJ A;  4K2L A;  1RF2 D;  4JG2 A;  3PV0 A;  4DPG A;  3J81 L;  4Y7N B;  3K0Y A;  3F8T A;  1TS2 A;  2QEX A;  5FLX L;  1VQO A;  3KFU A;  1QE6 A;  3KLR A;  1ESR A;  4DN4 M;  2L12 A;  4R9W A;  1EU4 A;  1YHQ A;  1QZG A;  1G91 A;  1I50 H;  1SNC A;  2Z8L A;  1AN8 A;  4BY1 B;  1GOZ A;  1I4G A;  3M7N A;  1X3E A;  2ZJP A;  2RA4 A;  1FJG Q;  4LFC Q;  2RCF A;  2IHF A;  4A3C G;  1K8A C;  4G7Z C;  2EJG C;  4X64 L;  1JMC A;  3ITP A;  1SE4 A;  2BE5 C;  4IPD A;  1A3U A;  2P5Z X;  2RVL A;  5M5X B;  5K36 G;  4DR1 Q;  5BN4 A;  2CWA A;  1KNE A;  4HJ5 A;  5D3I B;  3OTO L;  1N34 L;  1GO3 E;  5DEH A;  3K8A A;  5KRU A;  3I4N H;  2UXC L;  3LNN A;  1EYG A;  2EYO A;  1Y14 B;  5GAD C;  2XIW A;  1GUW A;  1YJN A;  3QB3 A;  1FD7 D;  1PYS B;  4IFD G;  4KY7 A;  2GN5 A;  4AH6 A;  4EQN A;  1X3P A;  1H9R A;  3OPO A;  4JI3 Q;  3AFQ A;  2VQE Q;  2NYZ D;  2DNE A;  1SYD A;  2JA5 H;  1K8M A;  1X54 A;  1CQF A;  4LUO A;  4NMZ A;  2AWN A;  3U9S A;  2BE5 D;  1NBW A;  1K8O A;  4GKJ L;  1BCP D;  3E0E A;  1X32 A;  1JJ2 A;  5EKL A;  2J4X A;  1RKN A;  1B3Q A;  1Q12 A;  4FDB A;  2F0G A;  2IHE A;  1D7Q A;  4J6H A;  4JC0 A;  4UPA A;  4PQX A;  2WAQ E;  2AQ2 B;  1K3B C;  2RBM A;  1PYB A;  3X3N A;  3M85 A;  3PUV A;  3JAM c;  2SDF A;  5FLM G;  1LAB A;  5CBA E;  1LV9 A;  1QIL A;  4K5W A;  2BCO A;  2B2T A;  1QNU A;  4BBR B;  4O2D A;  2DJG C;  1XWE A;  2X69 A;  2KVM A;  2Z0S A;  1LUZ A;  1TWF B;  3HKZ G;  1WYD A;  1KDA A;  3D0F A;  4DR5 Q;  1PDQ A;  1WCM G;  3M4Q A;  2R7F A;  1HXY D;  1MBY A;  2ICI A;  4A3K G;  5JJK A;  2NUC A;  3BZK A;  1EQR A;  1EQQ A;  3QIA A;  5IE8 A;  2A6E C;  1BO0 A;  4CHT B;  3BVZ A;  5DAU A;  4QY7 A;  2OQK A;  1Q1E A;  3TS0 A;  2GA4 B;  3J7A V;  2YTX A;  1G29 1;  3M4P A;  3HOY H;  4L5Q A;  2F03 A;  4K0K Q;  2D2C C;  3W1B A;  1TVX A;  3ND8 A;  2RDG A;  2K5D A;  3H15 A;  2QCP X;  5ISR A;  4LF7 Q;  3QO2 A;  2EE1 A;  3GO5 A;  1A15 A;  3I72 A;  2AKW B;  2WP8 J;  1STE A;  2LXK A;  3CCR A;  1SYF A;  1IBK L;  4ZUI A;  3PO2 H;  4X65 L;  1QWY A;  4KK7 A;  5ELN A;  2K5V A;  4CDC C;  1KLG D;  4A3J B;  2IY5 B;  3AU7 A;  3LGJ A;  1TY0 A;  2EJM A;  3H0G H;  1U4R A;  3A7A B;  3S2H B;  2A6E D;  1AZQ A;  1EY6 A;  1AW7 A;  1MI2 A;  4HJ8 A;  4DV0 Q;  3RZD B;  4LFB Q;  5EQ0 A;  4ABN A;  2CQA A;  4A3I H;  1I6V C;  5C0X J;  4XXE A;  1LTB D;  2HCC A;  3P20 A;  1ICF B;  5IGG A;  5LMU Q;  4R4Q A;  4J1M A;  2ZT9 C;  4C3H B;  4R8I A;  2D0O A;  5I9O A;  1J9O A;  4DV6 Q;  2B63 H;  2JA7 B;  2LS0 1;  1Y1W B;  5C5M A;  3M7G A;  2I5M X;  2KCM A;  4LF8 Q;  2K75 A;  2VY3 A;  4DK6 C;  1HA6 A;  3M3Y B;  5IGB A;  4V0B A;  1LTA D;  2PW7 A;  4X3K A;  5GAE C;  4JYA Q;  2AHO B;  3SK5 A;  2B2U C;  3GTQ H;  3NQI A;  3TRE A;  5I2Y A;  2A68 D;  2FMC A;  4XQN A;  4I7Z C;  3F2C A;  4YY3 L;  2ASB A;  1PZJ D;  3CCE A;  1UAP A;  4RH6 A;  1EIF A;  4DR2 Q;  3HOU B;  4A3E H;  4Y52 H;  3GTP B;  5M3M G;  1QCB D;  4UP8 A;  3SGI A;  4A76 A;  3A56 A;  3MC0 B;  5M5Y B;  1SXT A;  2E2J H;  3GTG B;  4M1U B;  3I4M G;  1W6J A;  4BWG B;  4DXF A;  1BOS A;  5C4J H;  2E76 C;  2OXP A;  3NEN A;  3NWT A;  2M00 A;  2K5H A;  2K4K A;  4GLA C;  5I6Y A;  3GV3 A;  4KTA A;  1B9M A;  1SEB D;  2BH2 A;  4A3L H;  3I90 A;  1K9M C;  2A1A A;  4DR7 L;  3HOW G;  1ONL A;  1ZKO A;  2EY1 A;  2VUM G;  2NBF A;  4YWM A;  2N8N A;  1D5M C;  1SND A;  3L7Z C;  3ERO A;  3S9W A;  1GD7 A;  2UXD Q;  2RF4 A;  2WV6 D;  4CKC A;  4GNX A;  4MTK A;  2YU9 H;  2K5Q A;  3KF6 B;  4A4I A;  4ZLT F;  1WTV A;  1Q46 A;  1H9M A;  1TWH B;  1VF7 A;  3G48 A;  5JJZ A;  4HSP A;  2KED A;  5J1Z A;  4DU9 A;  2XVS A;  2ALY B;  4OON A;  2B2W C;  3KF8 A;  2D5D A;  1F9S A;  1PH9 A;  1IYV A;  1KC8 C;  5IP7 H;  2A69 D;  2NVT H;  1EY7 A;  2JEB I;  4HMJ A;  3BS1 A;  3L0O A;  1EEF D;  4FVM A;  5CV6 A;  4OWT B;  3K7A H;  5EPJ A;  4GZY C;  2IX1 A;  4DAV A;  3SVM A;  3E5S A;  1X65 A;  5E4W C;  1EWH A;  5CV5 A;  2K03 A;  3KK7 A;  1HA5 A;  4LMQ D;  4U67 3;  1J5E Q;  2UXB L;  3MEF A;  3D6C A;  1PTO H;  1STH A;  4EQO A;  2A8V A;  1G2T A;  2B8F A;  1QOH A;  1ILP A;  2B63 G;  1BCP B;  1DON A;  2IWH A;  1QNK A;  5C5L A;  2D62 A;  2F0L A;  5JPN C;  2MQH A;  4Z9C B;  3KBX A;  1B50 A;  4BY7 H;  2DY8 A;  4A3D H;  4H44 C;  5IT9 c;  2IX3 A;  2ZXO A;  1NR2 A;  4NW2 A;  4Y7N H;  3I4N B;  2UUA Q;  1LTS D;  1Y8P B;  1WTR A;  1H9S A;  1KL9 A;  4TSS A;  1WTO A;  1T9H A;  2L55 A;  1YBY A;  1YNN C;  2MPM A;  3A8K E;  1HZC A;  3IAY A;  4DUY Q;  3VR6 A;  4MZ9 A;  3Q6S A;  2OEO A;  3I2Z A;  2A73 B;  2HDL A;  3D6W A;  1GKH A;  5JVG 3;  2SOB A;  2L5T A;  1X56 A;  2F0U A;  3D4D A;  3GV6 A;  1T5E A;  1R4Q B;  3HKZ E;  2JA5 B;  1WOC A;  1XTD A;  3NEM A;  2DJF C;  4WOR A;  2F0W A;  4C3J G;  1N32 Q;  3NP8 A;  3TP7 A;  2Q2U A;  1O80 A;  1IBM L;  4RG1 A;  2AMC B;  4L5R C;  4JI6 Q;  1HPC A;  5ELF A;  5ELO A;  1HH2 P;  3K7U C;  3K5L A;  4F7X A;  3FHW A;  5JAV A;  2EJF C;  3F2B A;  3FKI G;  2HCI A;  1Y1V B;  4K2K A;  5C4X G;  1JJC B;  2PZW A;  3H3V H;  5NUC A;  3A7L A;  2XNA C;  2B2Y A;  4QQB X;  4DV4 L;  1N8R C;  1DCZ A;  1GHK A;  4C3I H;  1HJP A;  3HKS A;  4JW0 A;  3EFX D;  2OQ0 A;  4B3S Q;  2HHH L;  2ES2 A;  1D1K A;  1I6H H;  1P16 A;  2EZV A;  1CI3 M;  3K6O A;  3VR2 A;  2XN9 C;  1DGS A;  1E1T A;  4FF2 A;  4CDE C;  3LWU A;  1XMO L;  1H95 A;  1SR3 A;  2EYP A;  4R4T A;  3HOY B;  2I5H A;  3AEV A;  2CKZ B;  3SEB A;  2JA8 G;  4X65 Q;  4DNR B;  1V1P B;  4IPC A;  1GUN A;  3CC4 A;  2QA4 A;  5LMN Q;  1TR5 A;  2ID0 A;  4I7A A;  1G6Z A;  4LJZ C;  5F2D A;  1STB A;  3PO2 B;  4JI7 L;  2HT1 A;  4HID A;  5FOB B;  4LNQ A;  2F0E A;  3DHQ A;  1KD1 C;  4A3F H;  4ZUJ A;  4LWC A;  3M9B A;  1QVG A;  2IPK D;  3UDX A;  3H0G B;  3CU7 A;  5IP9 G;  2D9U A;  1E22 A;  4GN3 B;  4QUF A;  2MO1 A;  1HNZ L;  2O5I C;  4BBS H;  3PO3 G;  1VDZ A;  1N36 L;  3CP0 A;  2BA0 A;  1HNX Q;  4A3I B;  1VQ8 A;  4IFD J;  1CHP D;  3N6R A;  1NJI C;  5IOC A;  3EVQ A;  5JVH 3;  1LT5 D;  2E2H H;  5KND A;  4BY7 G;  1SYC A;  1KXL A;  3T13 A;  5EKI A;  2PMZ E;  4WJ4 A;  5JJL A;  2JK8 A;  5EAY A;  4IAL A;  2FIN B;  4ZYS A;  3QWN A;  4HJA A;  1B3A A;  2UUB L;  4JK1 C;  3PF5 A;  2EY6 A;  3OIP A;  4R4C A;  1PRT B;  3A55 A;  2CCZ A;  2E8G A;  4EQP A;  4BY1 G;  2Z6K C;  4QCL A;  1PLF A;  1O7L A;  3RD4 A;  1A8V A;  2N49 A;  3ULP A;  2F0T A;  4A3J H;  1L0Y B;  3A74 A;  3NBH A;  3NTI A;  4ID6 A;  1C48 A;  2R7D A;  1WFQ A;  3M4O H;  5CV4 A;  3HOV H;  5T1G A;  3BDL A;  3GTQ B;  1QVF A;  1Z47 A;  2NVY H;  1CUK A;  3C1F A;  1U4M A;  3FPP A;  3S16 B;  1S5C D;  4A3E B;  5FO8 B;  1L1O B;  4RGT A;  4HJ7 A;  1SN8 A;  2Q2H A;  1EY4 A;  2ZJR A;  2F0K A;  2E2J B;  2JA7 H;  1QG7 A;  5LMN W;  1PFS A;  1VQG A;  4GN4 B;  5C4J B;  1WD0 A;  3E6Z X;  2F0V A;  1HR0 L;  1W3S A;  1KAW A;  3G6J B;  4IN3 A;  1OXS C;  1E2W A;  3M3Y H;  4RMF A;  5IT9 E;  1MSG A;  3UDI A;  2RQX A;  1KRT A;  4XT3 B;  4A3M H;  2WAC A;  1Q90 A;  4O0A A;  2RKS A;  2XTI A;  3MFY A;  1N33 L;  1EY0 A;  3S1N H;  1A63 A;  4DV1 L;  2F3V A;  1CKN B;  5IYB G;  4G7H C;  1WI5 A;  4F88 A;  5KNC A;  3N52 A;  5EKK A;  2LY7 A;  3R2T A;  2YU9 B;  2R7Z H;  4DK3 C;  5I4D A;  1SLJ A;  3B6Y A;  3U4V A;  1AE2 A;  1OXX K;  4BBR G;  3VYR A;  4KHV A;  2ENB A;  5M5Y H;  4OX9 Q;  1TS3 A;  2K28 A;  1J6Q A;  1F2Y A;  1Q8K A;  1V1Q A;  4IUN A;  4ZCK A;  1R4P B;  1GUT A;  2KCN A;  4ULL A;  3NEL A;  4ZK9 B;  1LYL A;  2MHV A;  1J8I A;  3MEH A;  3MXN B;  1PH8 A;  2NVT B;  4FF3 A;  4EQ5 A;  1ML0 D;  3K7A B;  1ASY A;  2ZXP A;  2ZTD A;  2NTT A;  1L0W A;  1Q86 C;  4A75 A;  2UU9 L;  3Q0A A;  4UHV A;  1VCI A;  4FXD A;  1BF4 A;  4OEM B;  4OGQ C;  3T51 B;  1VQA A;  3CKI B;  1SYG A;  2AUK A;  4NPS A;  5D3D A;  3RUZ A;  5DNF A;  4A93 H;  4LUZ A;  4ZAI A;  5IGF A;  1PTO B;  4O1N A;  1W6K A;  4EGV A;  5C6A A;  2Z4I A;  1CQV A;  1TWC H;  4GOP A;  3H91 A;  4DV7 Q;  4C2M B;  1S5B D;  4X62 Q;  4DAY B;  4CBV A;  3PIP 3;  1UNS A;  1TWH H;  3QR8 A;  5IYC H;  4A3D B;  4B9W A;  4A3J G;  4IQZ A;  2G9H D;  3S15 H;  1VQF A;  1X3Q A;  2TSS A;  4PG3 A;  4B3R Q;  1JOO A;  2F0J A;  1VS0 A;  5ELB A;  4LF9 Q;  3GTL H;  1I4Q A;  2TMP A;  4DKA C;  4UP9 A;  3OOC A;  2LFN A;  3U4Z A;  4MTN A;  1XMQ Q;  5TSS A;  5K5P A;  3DMU A;  4X3S A;  1NUC A;  4QGU A;  3SE0 A;  1I94 L;  4C3H G;  2KA7 A;  4R1J A;  1HQR D;  1CA5 A;  1DD2 A;  4RGO S;  5ELE A;  1FVI A;  2NZH A;  2NN6 H;  4JI5 Q;  2VQF L;  1A2T A;  2K33 A;  3I70 A;  1DOK A;  4OIJ A;  2RDF A;  2E5L Q;  1BCP C;  1O7Z A;  1Y1W G;  2L4N A;  1WD1 A;  3PIP A;  4LFA Q;  4KY5 A;  3OMC A;  3VR4 A;  2K5W A;  1A3V A;  2KEE A;  4PZ8 A;  3DUZ A;  1BKB A;  1YNJ D;  1IHZ A;  1M4V A;  1WVL A;  2LSS A;  1Q3L A;  1M8A A;  1VF5 C;  1SSO A;  4RAU C;  2CW0 D;  1SRO A;  2R61 A;  5IT9 L;  4C3I B;  3WOF A;  1IW7 C;  5GQO A;  1I6H B;  2JA6 H;  1PH5 A;  2B2V A;  4UP7 A;  3HOU G;  1EZ8 A;  5BN5 A;  3RLN A;  1E0B A;  3ZYY X;  1VQ9 A;  3W3A A;  5HY6 A;  1D5Z C;  3PCO B;  3CAM A;  5AJ3 Q;  1O7Y A;  4YWL A;  4Q5V A;  4N9T A;  5M5W H;  2KEC A;  1VQE A;  3E9H A;  4B3T Q;  5JEA H;  3KDF B;  4XT1 B;  4JI2 L;  1W2B A;  3I4L A;  2H5X A;  5A2Q L;  3FEW X;  3ERS X;  4DV5 L;  2J0T D;  4P71 A;  3BYT B;  1STY A;  1WTP A;  4TQU S;  5C3E H;  4DV2 Q;  1Y1V H;  2EYJ A;  1H9J A;  3ONA B;  2DY7 A;  3KJP A;  3AFP A;  2NVQ B;  1IW7 D;  1MJC A;  4A3F B;  1D6E C;  3GD7 A;  5M3F H;  3L2P A;  1GVP A;  3AYH B;  4KD3 A;  3S24 A;  4BBS B;  2N3S A;  2XWB B;  2VW9 A;  3CCS A;  2E74 C;  1KRS A;  2DUD A;  4XYO A;  4KLK A;  2NWG A;  2L11 A;  1NR4 A;  5IYC G;  2E2H B;  1B8A A;  4KJO A;  4DK0 A;  1SNP A;  1UE1 A;  2G5D A;  3HZX A;  1GUS A;  5CC4 A;  3EQL C;  4B3M L;  5JJI A;  1C9O A;  2VNU D;  1LO5 D;  4JI8 L;  1ILQ A;  3PIO 3;  5DLQ E;  1JOQ A;  1KDB A;  3E9I A;  3UE1 A;  1DXM A;  4NXN Q;  2K6A A;  4IUR A;  3HOX H;  4K8I A;  4JV5 L;  5IWA Q;  1DJR D;  3NTH A;  1I4X A;  1SMY C;  3NTK A;  1GJX A;  5H1S E;  1VQ4 A;  1XNR Q;  3S1M B;  4NXM L;  4HIM A;  4RA8 A;  1ZXT A;  1IYJ B;  2EXD A;  4KHP L;  1XNQ L;  4NB3 A;  4PMC A;  3OW2 A;  5G3L D;  5IY0 A;  4ALP A;  1K83 H;  4DR4 Q;  3M4O B;  3RN2 A;  1RDP D;  3MTS A;  4K6D A;  4ODG A;  1EY9 A;  4UDU C;  3HOV B;  4RFB A;  2D0P A;  1G6P A;  3WOE A;  5IIF A;  2NVY B;  4GS3 A;  1UE6 A;  4RHR A;  2L15 A;  3TS2 A;  2A68 C;  2A6H D;  4LF5 L;  3I91 A;  2WKC A;  1CFM A;  1ET9 A;  4FO2 A;  3I4N G;  1MD2 D;  4LF4 Q;  3KOJ A;  5ELC A;  4QJF A;  3PIO A;  3T1Y Q;  2WKD A;  1O78 A;  1PV4 A;  1SMY D;  5ELD A;  3ERQ A;  4ILW A;  1HNW L;  1BXT A;  2Q8R E;  2K52 A;  1KAA A;  2QKI C;  3VYT A;  2UUC Q;  1PRT C;  4K8J A;  1PMR A;  3K5N A;  4AQY L;  1LAC A;  1Q8I A;  2AWO A;  4DR6 Q;  1EY5 A;  4IZ8 A;  1VQ7 A;  2JA5 G;  2IX0 A;  3MVV A;  3TBI B;  1MHW C;  3IKJ A;  4A3M B;  3BZC A;  1U0L A;  3IFD A;  2HDM A;  1SRU A;  3RR5 A;  3GTO H;  3K80 C;  4X66 L;  1JWM D;  3SR1 A;  3S1N B;  2LXJ A;  4DAP A;  2JEA I;  5KYL A;  4XIG S;  3S16 H;  4DR3 L;  1VQL A;  2HIX A;  3H94 A;  2RDH A;  3TZD A;  3VA5 A;  2R7Z B;  1YNX A;  1L1O C;  4HAE A;  2PNR C;  3EIV A;  4JI1 Q;  4F8M A;  4JI4 L;  2PQA A;  5C44 H;  4JI0 Q;  1E24 A;  1PH6 A;  4OWW B;  3HG9 A;  1PRT D;  5BR8 Q;  2F0M A;  4H13 C;  5IYD H;  1LT4 D;  2UU9 Q;  2EQS A;  4I65 A;  2L9H A;  1HTL D;  4BXX H;  1VQD A;  1OXV A;  4LF6 Q;  4IUU A;  3ULJ A;  3BDC A;  2N88 A;  1EU3 A;  2NZO A;  5AFW A;  3R8B A;  4EVO A;  5J22 A;  1QUQ A;  4PMW A;  2A69 C;  3OMG A;  4ME5 A;  4ZRZ A;  3HOY G;  4CJ2 C;  4R4O A;  3AMU A;  1SYE A;  2AQ3 B;  1BR9 A;  2B3G A;  4A93 B;  3JAM i;  3HEJ A;  1SDF A;  1K8G A;  4NP5 A;  1UUP A;  1I4H A;  1XXG A;  1TWC B;  3S14 B;  5HUR A;  3RNU A;  3WDN A;  4L6T B;  3PO2 G;  5JOB A;  5C0X H;  4KN4 C;  4MHE A;  1YI2 A;  3CCQ A;  1HCZ A;  3MFG A;  3T1H L;  3S15 B;  2EYM A;  2MO0 A;  3H0G G;  3EA6 A;  1LTI D;  4C1N K;  3AB9 A;  2B39 A;  3GTL B;  2SEB D;  3DWP A;  3CHB D;  1TII D;  4A3I G;  2XSC A;  3PUZ A;  4X64 Q;  3TSS A;  3PGZ A;  4AYB B;  3K58 A;  1FYC A;  1S5D D;  2VQF Q;  2HIV A;  4IUP A;  4DV3 L;  2FXQ A;  4GKK L;  2NZ1 D;  3GTJ H;  4KJN A;  3OTO Q;  1N34 Q;  3GTK H;  3OHX C;  2IT1 A;  4XQQ A;  3DLL A;  4J15 A;  3NBI A;  3P75 A;  1CM9 A;  4YCV A;  5EBC A;  4YHH L;  4FF4 A;  2MFI A;  2UXC Q;  1PTO C;  4JBK A;  2R92 B;  1TQO A;  4KKT A;  4C2M H;  3D8G A;  1SE3 A;  1WTQ A;  1YHA A;  1C4Q A;  4J8Q A;  1M1K C;  2A5H A;  5CMD A;  3PUY A;  1WTW A;  1EOV A;  2RSN A;  5FKA C;  4FXG C;  4DUZ L;  1LM0 A;  2C35 B;  3KUP A;  1G8Z D;  4PZ6 A;  4TVA B;  1SFO H;  2F0N A;  4JOI C;  2PQE A;  4GKJ Q;  1UEA B;  2JA6 B;  1S72 A;  4RGM A;  4IOC A;  4A3E G;  3BG3 A;  1E2Z A;  2BDO A;  1L2F A;  3BDO A;  2JN4 A;  2QW7 A;  1PTO D;  4CJ1 B;  4AIM A;  4G7O C;  1RL2 A;  4IJL A;  1NY4 A;  5M5W B;  2NB0 A;  1JWU D;  3FMC A;  2RCN A;  2ZM6 L;  1IBL L;  3H3V I;  1LT3 D;  4A3L G;  3NWS A;  5C3E B;  3K59 A;  4WJW A;  2HQL A;  2YTY A;  4JVZ A;  4HMI A;  3H3V C;  1JWS D;  2B2U A;  3DWA A;  4DF7 A;  5FJ8 H;  2PO4 A;  2R93 H;  2CH4 W;  5M3F B;  1BBW A;  4G4K A;  1FJG L;  4TKO B;  1EYA A;  4LFC L;  3CCU A;  4GNX B;  1DM0 B;  2EYF A;  4RHS A;  3TDQ A;  3BZD B;  5LL6 S;  1FNV A;  2K50 A;  2ZTC A;  2F4I A;  3A5U A;  3SDZ A;  4A3B H;  1EY8 A;  3R93 A;  1STN A;  4DR1 L;  1EIH A;  1STG A;  3NE5 B;  1BQQ T;  4S3S A;  1IBK Q;  1SAP A;  1EWI A;  3S1R B;  4KD4 A;  2L1B A;  1SNO A;  3J80 i;  4BA2 I;  3KF8 B;  1TS4 A;  5T1I A;  2E75 C;  4KHP Q;  4QMG A;  4OO1 H;  1TWA H;  3JC6 6;  5IP7 G;  3HOX B;  3NPP A;  1K28 A;  1EOT A;  1JOK A;  4H0L C;  4RKB A;  2BA1 A;  4QIW B;  1BDO A;  1B4O A;  4O42 A;  1YZ6 A;  2NVQ H;  3ND9 A;  3CCJ A;  2AQ1 B;  4DAM A;  2NTS A;  1V8Q A;  2CWP A;  2Z6B A;  3U50 C;  2VQE L;  2K1B A;  1K83 B;  1CTM A;  3J81 i;  3ICE A;  4RWS C;  4ZKC B;  1LT6 D;  4LF5 Q;  1F9P A;  1MKH A;  5I2X A;  1GHJ A;  4Q0F A;  5FK9 C;  2G9D A;  1GM5 A;  5EPL A;  2A19 A;  3GQB A;  1XX8 A;  2QEJ C;  5CBE E;  4A3G B;  3SK6 A;  1B70 B;  4A3D G;  1TWG H;  2O5J C;  1ENA A;  1H9S B;  2PPB C;  4AQY Q;  1A2U A;  3DM3 A;  3T53 B;  2B2W A;  4PV1 C;  3DEP A;  1PVO A;  5J3B A;  1RJT A;  4C56 C;  4DNT B;  1CHQ D;  3TN2 A;  1ENC A;  4P2C B;  1IL2 A;  1EQV A;  1M90 C;  3S1M H;  1D5X C;  1OO9 B;  4DR5 L;  4OHJ A;  4YY3 Q;  2DNC A;  1NSN S;  3FDT A;  3KLS A;  4DR3 Q;  4KY6 A;  3HOZ H;  4K14 A;  2Y0S B;  1GUO A;  4P75 A;  3K0X A;  3RN5 A;  3GDE A;  3GTO B;  2WB1 B;  3OIQ A;  2HD3 A;  3CD6 A;  4K0K L;  3IL8 A;  2FJ2 A;  4ZKB B;  1ZYR C;  3BU2 A;  2EOT A;  1VQH A;  1UWV A;  3F1Z A;  3VR5 A;  1EFW A;  4OIK A;  3D4W A;  2YYZ A;  4LF7 L;  1B7Y B;  3HP3 A;  2MP1 A;  3T56 B;  1AEX A;  5C44 B;  2QIL A;  4L63 B;  3W1G A;  4DR7 Q;  5J39 A;  4C3I G;  1XPO A;  2R3Z A;  4JOI A;  3KLW A;  4RCO A;  4XYQ A;  5CV8 A;  2LKV A;  1ROD A;  3CRL C;  4LFB L;  1PZK D;  1JQY D;  3IFT A;  4A3C H;  1E7Z A;  3NQT A;  1PFB A;  1NMG A;  2N78 A;  3G6E A;  1ZYR D;  3CCV A;  2JJQ A;  4U68 A;  3W2D A;  5K36 H;  3UDF A;  4JCV E;  4DNI A;  4M8A A;  1XJV A;  1SNM A;  2QGQ A;  1II3 A;  1NE3 A;  2JP1 A;  4DV6 L;  1I5F A;  4FXK C;  4N8F A;  4IFD H;  2F0F A;  2OCE A;  1PFN A;  3PQI A;  4A3F G;  2VS1 A;  4LF8 L;  3NXW A;  1VQ5 A;  3DXJ C;  1MIU A;  1RIP A;  2QDB A;  4QF4 A;  1F2L A;  4BBS G;  1CT1 D;  5EPK A;  4JYA L;  3PUW A;  2UXB Q;  1B2T A;  4POF A;  1CSQ A;  3RMH A;  3UI2 A;  3AQQ A;  4YWK A;  3I7F A;  3GTJ B;  1PH4 A;  2QDL A;  2QF7 A;  4DR2 L;  3GTK B;  2I5L X;  2A74 C;  3ZJY C;  4UY8 C;  3J7Y W;  1I3Q H;  2FHT A;  5IOD A;  3Q23 A;  5M9O A;  3URY A;  5FLM H;  3S14 H;  1B9N A;  4G57 A;  4P72 A;  2FFK B;  2RHS B;  2Q2I A;  1E2V A;  1LLR D;  3TEH B;  3NBH B;  1ENF A;  3ULL A;  1WCM H;  3BVG A;  4A3K H;  3HOV G;  1YNJ C;  1CZW A;  2M9V A;  2PCF B;  2RSO A;  1SFO B;  1IBM Q;  2F0P A;  3OWE B;  1SJE D;  2CW0 C;  1QJO A;  3H6M A;  3DEO A;  2WAQ B;  2V1C C;  4EX5 A;  2NN6 I;  2DGY A;  2UXD L;  1IBL Q;  1Q82 C;  1YHB A;  1OXT A;  5KIX A;  2EPB A;  3CXC A;  3CPW A;  2F0I A;  1Z7T A;  4X6A H;  3D4R A;  1U4L A;  2Q8T A;  3TRZ A;  4C1N I;  2JA7 G;  2R92 H;  4KV6 A;  3M4Y A;  3ER0 A;  3W5O A;  5DM6 3;  2Z6K A;  2SNM A;  4DV4 Q;  1FNU A;  3KJO A;  5C3X A;  4R4I A;  3V96 A;  3STB C;  4KKU A;  4HSV A;  3RLO A;  3CC2 A;  1BVS A;  2HHH Q;  1IL8 A;  1LTR D;  5COY A;  5CYU A;  1YIT A;  4A3M G;  4TRD A;  4GLV B;  1PH1 A;  4L5T A;  1Q81 C;  4RKL A;  1XMO Q;  2CQO A;  2JYO A;  4LUV A;  2R93 B;  3J7Z C;  3OYY A;  4IUQ A;  3DM1 A;  3VYU A;  3VDY A;  2X6L A;  1J5E L;  1PA6 A;  1JT8 A;  2F0D A;  4KI0 A;  2X6G A;  1WTH A;  2I07 B;  2R7Z G;  3CRK C;  1PYW D;  3I4O A;  4HIO A;  4A3B B;  1SE8 A;  4IPH A;  4CDF C;  3Q8D A;  1F2M A;  1E1O A;  3SHL A;  4JI7 Q;  3STB D;  2I46 A;  1XPR A;  5IGD A;  4R8N A;  1R9T H;  4OL7 A;  2UUA L;  4IUT A;  2EXZ A;  1DOL A;  1TWA B;  4PNY A;  1U5K A;  2J7Z A;  3SK4 A;  1HUN A;  2EY5 A;  4DUY L;  1HNZ Q;  3SK8 A;  1N36 Q;  1GUG A;  1U9R A;  3BJU A;  1X3G A;  2OT2 A;  2OWO A;  4A93 G;  3Q24 A;  1N32 L;  4MIU A;  5LL6 X;  4GNX C;  4B9X A;  4GOP B;  4FF1 A;  4RGN A;  5GRO A;  4OWX B;  1Y8N B;  1U4P A;  3J7A 5;  2UUB Q;  5M3M H;  4JI6 L;  2XRS D;  2K14 A;  3GTM H;  2MJ8 A;  1TWG B;  1EL0 A;  1D8L A;  1X3F A;  3QOJ A;  1EUJ A;  3I4M H;  3I8Z A;  2JE6 I;  3S1R H;  2A6H C;  2B29 A;  1JE5 A;  1IKL A;  2MGS A;  3E3X A;  4GLX A;  1UE7 A;  1Q1B A;  4KMU C;  4FNF A;  4YCW A;  3PMF A;  4V19 0;  5JPM C;  3S1Q H;  2K01 A;  3HOW H;  1SYB A;  2IJ0 A;  4AYB G;  4XDX A;  5FO9 B;  4B3S L;  2PNH A;  3EBE A;  4LW1 A;  1H9K A;  3KLS X;  4JBJ A;  1JOR A;  3UE0 A;  1HFG A;  3V05 A;  2VUM H;  1D1I A;  1EEI D;  2PI2 E;  1VQP A;  2WII B;  2OF1 A;  3S17 B;  5EJW A;  3HOZ B;  3J7A F;  2NN6 G;  1EQT A;  4YIJ A;  2C5C A;  2Q8I B;  4PMB A;  2R92 G;  2BDN A;  4JPB W;  3KBG A;  1PZI D;  3KF6 A;  1JCK B;  1EWC A;  4A3G H;  1F77 A;  3TME A;  3K81 C;  2VZA A;  5LMN L;  2K7V A;  3I3C A;  1Z9F A;  1HR0 Q;  1KAB A;  3HRZ C;  3D3R A;  2IW3 A;  2C9O A;  3E0J A;  5I6W A;  1PHJ A;  3CQZ H;  3HFZ B;  4HTH A;  1LTT D;  4N9P A;  3R3O A;  5I9P A;  3DWQ A;  1Y8O B;  5KYI A;  1JE4 A;  5HGT A;  2NVX B;  2EIF A;  2JA6 G;  3BYY B;  1N33 Q;  4DV1 Q;  5FO7 B;  2VL6 A;  1DYQ A;  3K57 A;  4IJH A;  1HNX L;  1CKO A;  5E3F A;  1YVC A;  1A3T A;  3C2P A;  2EYL A;  1EZ6 A;  3MAQ A;  3HGB A;  1I4R A;  3CC7 A;  3TP8 A;  5JEA G;  4KKS A;  3F2D A;  1P8L A;  1EYD A;  1S5F D;  4XTC S;  2KOL A;  3VR3 A;  2H4O A;  1KTK A;  2AUJ D;  3D31 A;  1VQK A;  5C3E G;  1JC7 A;  2Q2T A;  1Y1V G;  1ZEQ X;  2F52 A;  3CPF A;  1TT2 A;  1JB3 A;  3C46 A;  2KHJ A;  2B2Y C;  1B53 A;  3FP9 A;  5E1F A;  3NK9 A;  4K5V A;  5M3F G;  4BS9 A;  1AFP A;  2F0O A;  3VYS A;  2PZT A;  3PUX A;  4K5X A;  4UAI A;  4CDD C;  2OTL A;  3MXP A;  3S2D H;  4QL5 A;  1L0X B;  1VQ6 A;  2KBN A;  4NKL A;  4C3J H;  1STA A;  1S3O A;  5CGK A;  3MZ5 A;  3U58 A;  4K6L A;  5C4Z A;  4KN7 C;  5A35 A;  4P74 A;  1XPU A;  1NCV A;  2PZU A;  1I3Q B;  5C0X I;  3I55 A;  1IKM A;  3FKI H;  3J80 c;  4MN3 A;  3HOX G;  4IO9 A;  5D14 A;  4YCU A;  1A0I A;  5C4X H;  3O13 A;  2K04 A;  1HR0 W;  3R2I A;  3CMA A;  1FR3 A;  1YJW A;  3HKZ B;  4HR7 B;  1WCM B;  1F2Z A;  4N8X 1;  3V2T A;  1SE2 A;  4A3K B;  1HZA A;  3UDG A;  3L3O C;  2HQE A;  3J81 c;  1I94 Q;  1KNA A;  3PF4 A;  3RZO H;  5D65 A;  2F4V L;  1BCP F;  2ICE C;  3I73 A;  1F9R A;  4HCS A;  1XYI A;  2EVB A;  1CK1 A;  1DOM A;  5FLX c;  4A3G G;  1ESF A;  1HTP A;  4POG A;  4HIK A;  4H02 A;  3SXH A;  1TXY A;  1X6O A;  2Z9H A;  2JA8 H;  3LX0 A;  5KGU A;  1Z6H A;  1K73 C;  1NTG A;  1VQC A;  1V1P A;  3FPU B;  1RCV D;  4FYD A;  2BH8 A;  2E2I H;  1VMP A;  2KUM A;  1F9Q A;  2H1E A;  2V4D A;  4OX9 L;  1I50 B;  2CH4 A;  2K5N A;  3JAM E;  4LAA A;  1ET6 A;  1WJJ A;  3FRP B;  3CME A;  5EBD A;  1K0S A;  2Z4H A;  1OXU A;  3CW2 C;  3H09 A;  2ZJQ A;  2KCC A;  1HZB A;  5IP9 H;  4WFN 3;  1AP0 A; 
#chains in the Genus database with same CATH homology
 3U4Z A;  4YY3 Q;  4MTN A;  4A3I H;  2Y0S G;  5C0X J;  3PO3 H;  4DR3 Q;  1XMQ Q;  5GAH C;  3HOZ H;  1HZ9 A;  2GVB A;  2WB1 G;  2MNA A;  4QGU A;  4P75 A;  1I94 L;  5HGQ A;  3K0X A;  3RN5 A;  3GDE A;  1IZ6 A;  4R1J A;  5LMU Q;  2KHI A;  2RHQ B;  3CD6 A;  4K0K L;  1FVI A;  2NZH A;  3BU2 A;  4R4Q A;  1UE5 A;  2VQF L;  4JI5 Q;  2D0O A;  1VQH A;  4JI2 Q;  1UWV A;  3F1Z A;  1EFW A;  2E5L Q;  1Y1W G;  2YYZ A;  4DV6 Q;  2PQA B;  4LF7 L;  4DV5 Q;  2B63 H;  1B7Y B;  3PIP A;  4LFA Q;  5C44 G;  4DV7 L;  4X62 L;  4PZ8 A;  2I5M X;  2KCM A;  4LF8 Q;  2K75 A;  5IYD G;  3W1G A;  1BKB A;  2VY3 A;  1QVC A;  4DR7 Q;  4DK6 C;  2LSS A;  4BY1 H;  1XPO A;  4JOI A;  3KLW A;  1OTC A;  4BXX G;  1SRO A;  5GAE C;  4B3R L;  4JYA Q;  2AHO B;  4LF9 L;  1QUQ B;  1PH7 A;  5GQO A;  3GTQ H;  3A5Z B;  2JA6 H;  4LFB L;  1PH5 A;  3TRE A;  3F2C A;  1E7Z A;  4A3C H;  1KHI A;  4ME3 A;  4UP7 A;  4YY3 L;  3HOU G;  2ASB A;  1NMF A;  3RLN A;  3CCE A;  1NMG A;  2N78 A;  4JBW A;  1C0A A;  1VQ9 A;  1EIF A;  5M5X H;  3G6E A;  4DR2 Q;  1XMQ L;  3CCV A;  4A3E H;  1VQM A;  5HY6 A;  2JJQ A;  4AYB E;  4Y52 H;  3PCO B;  4B3M Q;  1BBU A;  2GVA A;  3CAM A;  5AJ3 Q;  3UDF A;  4YWL A;  5M3M G;  4JCV E;  5M5W H;  4DNI A;  4UP8 A;  4JI8 Q;  1N9W A;  5GAG C;  1VQE A;  3E9H A;  3SGI A;  4B3T Q;  1L1O A;  4A76 A;  1XJV A;  4JI5 L;  3KDF B;  2F3I A;  1ASZ A;  2E2J H;  4JI2 L;  1LTL A;  2QGQ A;  1W2B A;  2H5X A;  3I4M G;  2E5L L;  1NE3 A;  5C0X G;  4JV5 Q;  4OO1 I;  4DV6 L;  1I5F A;  1IXR A;  3ERS X;  4DV5 L;  5C4J H;  4P71 A;  3NEN A;  4LFA L;  4NXM Q;  4TQU S;  5C3E H;  2OCE A;  4DV2 Q;  2K5H A;  1Y1V H;  2K4K A;  4GLA C;  4GN5 A;  4A3F G;  1MJE A;  2VS1 A;  2BH2 A;  4LF8 L;  1Q7Y C;  4A3L H;  1VQ5 A;  1K9M C;  3KJP A;  2A1A A;  3AFP A;  1XNQ Q;  4DR7 L;  1AH9 A;  1MJC A;  1MIU A;  3HOW G;  1RIP A;  1E3P A;  1VQN A;  3GD7 A;  5M3F H;  1K3R A;  3L2P A;  1GVP A;  4BBS G;  3AYH B;  4BA1 I;  3S24 A;  4JYA L;  2VUM G;  3PUW A;  2N3S A;  4YWM A;  2VW9 A;  2N8N A;  3CCS A;  2UXB Q;  4POF A;  4JI3 L;  1KRS A;  3L7Z C;  2DUD A;  1GD7 A;  1CSQ A;  2UXD Q;  2I0Q A;  2RF4 A;  3AQQ A;  4GNX A;  4KLK A;  4YWK A;  3I7F A;  1PH4 A;  2YU9 H;  5IYB H;  1CKN A;  5IYC G;  1B8A A;  4DR2 L;  2I5L X;  3KF6 B;  4A4I A;  1UE1 A;  3ZJY C;  4UY8 C;  1Q46 A;  1KQS A;  4B3M L;  5JJI A;  1I3Q H;  5AJ3 L;  1C9O A;  4GOP C;  3G48 A;  3RLF A;  2VNU D;  4JI8 L;  2KCT A;  4B3T L;  5FLM H;  5DLQ E;  1O7I A;  3S14 H;  4BBR H;  3E9I A;  1HNW Q;  4P72 A;  3UE1 A;  3CCM A;  4NXN Q;  1K0R A;  3HOX H;  2ALY B;  3KYH C;  3G4S A;  4OON A;  4JV5 L;  5IWA Q;  1TWF H;  4JBM A;  2RHS B;  1PH9 A;  2Q2I A;  1KC8 C;  1SMX A;  5IP7 H;  2NVT H;  4IPG A;  5H1S E;  2JEB I;  3TEH B;  1VQ4 A;  4NXM L;  1XNR Q;  3L0O A;  2YV5 A;  3NBH B;  4DV2 L;  4HIM A;  4IOA A;  2OTJ A;  4OWT B;  3K7A H;  3ULL A;  2ATW A;  2IX1 A;  1WCM H;  1IYJ B;  4APV A;  2EXD A;  4KHP L;  1XNQ L;  4NB3 A;  4A3K H;  1X65 A;  3CCL A;  3OW2 A;  3HOV G;  5IY0 A;  4ALP A;  1K83 H;  4DR4 Q;  3RN2 A;  3IRB A;  4X66 Q;  2WAQ G;  1IBM Q;  1FGU A;  1J5E Q;  2D0P A;  1G6P A;  3G71 A;  3MEF A;  2UXB L;  4GS3 A;  1UE6 A;  2V1C C;  2A8V A;  4EX5 A;  2NN6 I;  2DGY A;  3S17 H;  2UXD L;  1IBL Q;  2L15 A;  1Q82 C;  2B63 G;  1YHB A;  1OXT A;  3CPW A;  1KIX A;  3CXC A;  3TS2 A;  3J81 j;  4X6A H;  2D62 A;  4LF5 L;  2MQH A;  4JI4 Q;  4BY7 H;  3I4N G;  4A3D H;  1EIY B;  1X55 A;  5IT9 c;  4L5S A;  4LF4 Q;  3TRZ A;  3KOJ A;  4Y7N H;  2JA7 G;  4QJF A;  2R92 H;  3PIO A;  3T1Y Q;  2KEN A;  2UUA Q;  3ER0 A;  3W5O A;  1PV4 A;  5E7N A;  1JJG A;  1VQI A;  1KL9 A;  2Z6K A;  4DV4 Q;  3KJO A;  1T9H A;  4R4I A;  1HNW L;  3STB C;  4NXN L;  1YBY A;  1HZC A;  2K52 A;  5IWA L;  4DUY Q;  3RLO A;  2UUC Q;  3CC2 A;  2R6G A;  4MZ9 A;  3S2H H;  1BVS A;  2HHH Q;  3I2Z A;  4AQY L;  2AWO A;  3RZD H;  1XNR L;  4DR6 Q;  1GKH A;  5FJ8 G;  4PZ7 A;  2R93 G;  1YIT A;  4A3M G;  1VQ7 A;  3PSI A;  4GLV B;  1PH1 A;  2IX0 A;  4L5T A;  2WFW A;  1C7Y A;  1Q81 C;  2JA5 G;  4WJ3 M;  1X56 A;  1XMO Q;  2NVX H;  4QIW E;  2CQO A;  4LUV A;  3BZC A;  1U0L A;  3HKZ E;  3WWV A;  1WOC A;  1XTD A;  3NEM A;  3J7Z C;  3OYY A;  4HJ9 A;  1N32 Q;  4DR4 L;  1SRU A;  1PH3 A;  3RR5 A;  2Q2U A;  3GTO H;  3K80 C;  4X66 L;  4DV0 L;  3VDY A;  1IBM L;  4RG1 A;  1AE3 A;  1J5E L;  1PA6 A;  1JT8 A;  2AMC B;  2LXJ A;  2JEA I;  4L5R C;  4JI6 Q;  4MNO A;  4KI0 A;  4C3H H;  4A3B G;  2ZTE A;  5ELO A;  4XIG S;  1HH2 P;  3K7U C;  4DR3 L;  1VQL A;  2R7Z G;  3S16 H;  2HIX A;  3I4O A;  4HIO A;  3FHW A;  1SE8 A;  4IPH A;  1YNX A;  3F2B A;  1L1O C;  3FKI G;  1Y1W H;  3Q8D A;  2XGT A;  1E1O A;  3EIV A;  4JI1 Q;  4JI4 L;  5LMU L;  4IFD I;  2PQA A;  4JI7 Q;  5C44 H;  3STB D;  1XPR A;  2CFM A;  4JI0 Q;  1E24 A;  1PH6 A;  4OWW B;  4OO1 G;  3T1H Q;  4LF4 L;  5C4X G;  1JJC B;  1R9T H;  4KHZ A;  5BR8 Q;  3H3V H;  3T1Y L;  2UUA L;  1VQJ A;  2JA9 A;  2YTV A;  2UU9 Q;  4DV4 L;  2EQS A;  1N8R C;  4QQB X;  5IYD H;  1U5K A;  4C3I H;  1HJP A;  3HKS A;  4DUY L;  1HNZ Q;  2UUC L;  2F4V Q;  2OQ0 A;  4BXX H;  4B3S Q;  1VQD A;  1OXV A;  2HHH L;  2ES2 A;  1N36 Q;  3ULJ A;  4LF6 Q;  1I6H H;  4DR6 L;  2NZO A;  1P16 A;  2PI2 A;  1QUQ A;  4PMW A;  3BJU A;  3CF5 A;  4DV3 Q;  4GKK Q;  1DGS A;  1E1T A;  1S40 A;  1XMO L;  3HOY G;  3HOU H;  1H95 A;  1X3G A;  2OWO A;  4A93 G;  3GTP H;  4R4O A;  1N32 L;  1SR3 A;  4R4T A;  1UEB A;  2I5H A;  3A0J A;  2B3G A;  3TQY A;  4YHH Q;  4GNX C;  3AEV A;  3JAM i;  4GOP B;  1PH2 A;  2CKZ B;  2Y0S E;  4P73 A;  5GRO A;  4OWX B;  4X65 Q;  1K8G A;  4LF6 L;  2UUB Q;  5M3M H;  4IPC A;  4JI6 L;  2JA8 G;  3J7A 5;  3CC4 A;  3GTG H;  2K14 A;  2QA4 A;  2WB1 E;  5LMN Q;  3GTM H;  3I56 A;  3RNU A;  1D8L A;  1X3F A;  3PO2 G;  3KDF A;  1EUJ A;  2ID0 A;  3I4M H;  1YJ9 A;  3S1R H;  2JE6 I;  1YI2 A;  2B29 A;  1JE5 A;  4JI1 L;  3PO3 G;  4JI7 L;  3CCQ A;  4JI0 L;  2HT1 A;  4DUZ Q;  4HID A;  4GLX A;  3T1H L;  4LNQ A;  1UE7 A;  1Q1B A;  2MO0 A;  3H0G G;  5BR8 L;  4A3F H;  1KD1 C;  4LWC A;  3M9B A;  1QVG A;  1VQB A;  4YCW A;  3UDX A;  1CKM A;  4OXP A;  5IP9 G;  5JEA J;  3S1Q H;  1E22 A;  3HOW H;  4GN3 B;  4AYB G;  1QZH A;  4A3I G;  4BBS H;  2MO1 A;  1HNZ L;  1YEZ A;  3PUZ A;  4B3S L;  2PNH A;  3EBE A;  4LW1 A;  4X64 Q;  1N36 L;  3CP0 A;  1JB7 A;  2BA0 A;  3EN2 A;  3PGZ A;  4JBJ A;  3UE0 A;  2VUM H;  1HNX Q;  3HOZ G;  2PI2 E;  1VQ8 A;  2VQF Q;  4IFD J;  1VQP A;  2HIV A;  1V43 A;  2JQO A;  4DV3 L;  2FXQ A;  1NJI C;  4GKK L;  3GTJ H;  1G51 A;  1CSP A;  3OTO Q;  1N34 Q;  2E2H H;  3GTK H;  1X9N A;  4BY7 G;  1KXL A;  1FL0 A;  1V9P A;  2IT1 A;  3DLL A;  4J15 A;  4WJ4 A;  1A62 A;  2NN6 G;  2PMZ E;  5JJL A;  2R92 G;  4YCV A;  4YHH L;  2JK8 A;  2ZM6 Q;  2MFI A;  5EAY A;  3KF6 A;  1YIJ A;  2UXC Q;  4A3G H;  4JG2 A;  3PV0 A;  4DPG A;  4JBK A;  4HJA A;  2UUB L;  3F8T A;  3K81 C;  4C2M H;  2VZA A;  5LMN L;  1YHA A;  2QEX A;  3PF5 A;  1VQO A;  1Z9F A;  1M1K C;  4R4C A;  1HR0 Q;  3KFU A;  2CCZ A;  3PUY A;  1YHQ A;  2E8G A;  1EOV A;  4BY1 G;  2Z6K C;  1QZG A;  1PHJ A;  3CQZ H;  3HFZ B;  1I50 H;  1A8V A;  2N49 A;  4DUZ L;  3ULP A;  1LM0 A;  4A3J H;  2C35 B;  4PZ6 A;  3A74 A;  3M7N A;  1X3E A;  2ZJP A;  2R7D A;  1WFQ A;  1FJG Q;  3M4O H;  4LFC Q;  4TVA B;  2EIF A;  2JA6 G;  2IHF A;  1SFO H;  3HOV H;  4JOI C;  4A3C G;  1N33 Q;  4GKJ Q;  1K8A C;  4DV1 Q;  1QVF A;  1Z47 A;  2NVY H;  4X64 L;  1S72 A;  1JMC A;  2VL6 A;  1CUK A;  4IOC A;  4IJH A;  4A3E G;  1HNX L;  1CKO A;  1YVC A;  1L2F A;  4IPD A;  5K36 G;  4DR1 Q;  2CWA A;  4HJ5 A;  3OTO L;  3CC7 A;  1N34 L;  1L1O B;  4AIM A;  1GO3 E;  5JEA G;  1RL2 A;  3F2D A;  4IJL A;  4HJ7 A;  1NY4 A;  1P8L A;  1SN8 A;  2Q2H A;  3K8A A;  2RCN A;  4XTC S;  2ZJR A;  2ZM6 L;  3I4N H;  2UXC L;  1EYG A;  1Y14 B;  1IBL L;  5GAD C;  1YJN A;  3H3V I;  1PYS B;  2JA7 H;  4IFD G;  3D31 A;  5LMN W;  1VQK A;  5C3E G;  1PFS A;  1VQG A;  1Y1V G;  4GN4 B;  2Q2T A;  2F52 A;  3CPF A;  1HR0 L;  4A3L G;  2GN5 A;  4AH6 A;  1W3S A;  2KHJ A;  1KAW A;  3FP9 A;  4JI3 Q;  2HQL A;  1OXS C;  2YTY A;  3M3Y H;  5M3F G;  4RMF A;  3AFQ A;  2VQE Q;  3UDI A;  5FJ8 H;  3PUX A;  2R93 H;  1KRT A;  4A3M H;  2OTL A;  2JA5 H;  3S2D H;  1X54 A;  4O0A A;  1BBW A;  4QL5 A;  1FJG L;  1VQ6 A;  4LUO A;  4LFC L;  2XTI A;  2KBN A;  2AWN A;  3CCU A;  1NBW A;  4GNX B;  4C3J H;  1N33 L;  4GKJ L;  3E0E A;  3S1N H;  1A63 A;  1S3O A;  4DV1 L;  1JJ2 A;  1CKN B;  5IYB G;  2K50 A;  2ZTC A;  1Q12 A;  1WI5 A;  4FDB A;  2IHE A;  1D7Q A;  3A5U A;  3U58 A;  4A3B H;  4JC0 A;  4UPA A;  4DR1 L;  4DK3 C;  2WAQ E;  2R7Z H;  1PYB A;  1SLJ A;  3B6Y A;  3PUV A;  4P74 A;  3U4V A;  3JAM c;  3M85 A;  1IBK Q;  1XPU A;  5FLM G;  1AE2 A;  1OXX K;  5C0X I;  4BBR G;  3I55 A;  1EWI A;  3FKI H;  5M5Y H;  4OX9 Q;  3J80 c;  3J80 i;  3HOX G;  1J6Q A;  4IO9 A;  3KF8 B;  1Q8K A;  1V1Q A;  4BA2 I;  4YCU A;  4O2D A;  1A0I A;  4KHP Q;  5C4X H;  1TWA H;  3JC6 6;  5IP7 G;  2Z0S A;  3NEL A;  1LUZ A;  1LYL A;  3HKZ G;  1WYD A;  3MXN B;  3D0F A;  1PH8 A;  4DR5 Q;  1HR0 W;  2BA1 A;  3CMA A;  1WCM G;  3M4Q A;  2R7F A;  1YJW A;  4EQ5 A;  1YZ6 A;  2NVQ H;  4A3K G;  5JJK A;  3BZK A;  1ASY A;  3CCJ A;  1EQR A;  4DAM A;  2ZTD A;  1EQQ A;  2CWP A;  1L0W A;  3U50 C;  5IE8 A;  1Q86 C;  4A75 A;  2UU9 L;  2VQE L;  1HZA A;  4QY7 A;  3UDG A;  1VCI A;  2OQK A;  3J81 c;  3J81 i;  1Q1E A;  3TS0 A;  1I94 Q;  3ICE A;  3PF4 A;  3RZO H;  4LF5 Q;  2F4V L;  2YTX A;  1G29 1;  1VQA A;  3M4P A;  3HOY H;  4NPS A;  1MKH A;  4L5Q A;  4K0K Q;  5FLX c;  4A93 H;  4LUZ A;  3W1B A;  4A3G G;  1GM5 A;  2A19 A;  3H15 A;  4POG A;  4HIK A;  4H02 A;  1TXY A;  1X6O A;  1TWC H;  4LF7 Q;  4GOP A;  2JA8 H;  1B70 B;  4A3D G;  3GO5 A;  1TWG H;  1K73 C;  4DV7 Q;  1NTG A;  1VQC A;  4X62 Q;  4DAY B;  1TWH H;  5IYC H;  2AKW B;  2BH8 A;  2WP8 J;  2E2I H;  3CCR A;  2LXK A;  4AQY Q;  1IBK L;  3DM3 A;  3PO2 H;  4X65 L;  4A3J G;  5ELN A;  2K5V A;  4OX9 L;  1PVO A;  3S15 H;  5J3B A;  2K5N A;  1VQF A;  1WJJ A;  2IY5 B;  3LGJ A;  4PG3 A;  4B3R Q;  3CME A;  3H0G H;  1VS0 A;  4LF9 Q;  1IL2 A;  3GTL H;  1M90 C;  1OXU A;  4DKA C;  3S1M H;  3CW2 C;  4UP9 A;  4HJ8 A;  2ZJQ A;  4DR5 L;  1HZB A;  4DV0 Q;  5IP9 H;  4LFB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...