4LUVA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luvA00
1B7YB 2YTYA 4GLAC 2R6GA 3ULPA 1IBKQ 3PF4A 1Z9FA 3CD6A 2WFWA 5IP7H 1B70B 4HIDA 1IBLQ 5BR8L 4B3SQ 2UXDL 1Q12A 5FLXc 3ERSX 2KHIA 1GKHA 4LFBQ 1WI5A 2VW9A 2UUAQ 3GTMH 4A3LH 3HKZG 1R9TH 3NELA 4JV5Q 1VQBA 4YHHL 3NBHB 1XPUA 4UP7A 4JBKA 3S1NH 1VQPA 4AIMA 2R92H 3RNUA 3CCMA 4DR5L 1YHBA 3F2DA 3J81j 2A8VA 1XNRQ 2BH2A 1VQDA 3F2BA 4JI5Q 2UXBL 4DV1Q 3UDXA 4X6AH 4UP8A 1JJ2A 1Y1VG 2DUDA 1LYLA 2RCNA 3JAMc 1VQFA 1E24A 3CC4A 4LF5Q 1X3EA 3AFPA 2B3GA 4DK6C 1A8VA 4J15A 1K73C 2E8GA 2Y0SE 4B3ML 3J7A5 5JJKA 4BBRH 1UE5A 1X3GA 5M5YH 1KQSA 1BKBA 4DV5L 1GVPA 1WFQA 2PQAB 2K14A 2AKWB 4LF9L 2QA4A 3S14H 3I56A 1TWGH 2UXCL 4JI2L 1NE3A 4IO9A 2KCMA 4X64Q 1QZGA 3CCQA 4DR1L 4BXXH 2JA9A 1FL0A 5LMNQ 1K0RA 1X3FA 5FLMG 2FXQA 2I5LX 3MXNB 3G71A 4ALPA 1GM5A 4A3DH 1Y1WH 3AFQA 2JE6I 4JI4L 5IWAQ 5LMNW 1SMXA 4DUZL 1PH4A 5DLQE 3UDGA 3PO2G 5JJIA 1PYSB 3L2PA 3I4MG 3EN2A 4XIGS 3STBD 3GDEA 2MNAA 3HKSA 4LNQA 4IPCA 1E1TA 3GD7A 4X62Q 3E9HA 4HJ5A 3RZDH 1YJWA 1AH9A 1YHQA 2NVQH 3KJPA 3OW2A 3S1MH 4MNOA 4PZ7A 3FKIG 3DLLA 4A3CH 3FP9A 3RLNA 2N49A 2D0OA 1IL2A 3I4NH 4DV4L 4A4IA 2R7ZG 1C0AA 2VZAA 5ELOA 3CC7A 5LMUL 1VQ4A 3CC2A 4LUZA 4IPDA 4OONA 5M5WH 4JG2A 3PSIA 5IYCH 2D0PA 4DPGA 4LF4Q 1XPOA 2VQFL 1PYBA 2N3SA 4C2MH 1OXTA 4JI6Q 4A3GH 1IBKL 3KF6A 1J6QA 1J5EQ 4DR6Q 1IBLL 4B3SL 3H3VI 2IHEA 2B63H 2YV5A 4PG3A 2JK8A 5C44H 4A3JG 4LFBL 1TXYA 1YNXA 3G48A 2KENA 4DR5Q 1EWIA 1XPRA 2HIVA 4K0KQ 2R7DA 2UUAL 4JOIC 3D0FA 1TWFH 4R4CA 1NBWA 1N33Q 2ZTDA 3CCJA 3K7AH 4JV5L 5GAHC 2JA7G 4A3KH 3OYYA 3AQQA 3UDFA 4DAYB 3UE1A 4AYBE 3GTGH 4A3MG 1XNRL 1MJEA 2ASBA 4OO1G 4JI8Q 2JA6G 1VCIA 1I94Q 4JI5L 4DV5Q 1QUQA 3UDIA 4DV1L 1EFWA 1L1OA 3K7UC 4IPHA 4HJ9A 1PFSA 1RL2A 5IYBH 4GOPB 4B3TQ 5GAEC 2I5HA 4IOCA 2VY3A 4L5SA 4GKJQ 5C4XH 4NB3A 4QIWE 2BH8A 2PMZE 4LF5L 1VQEA 3EIVA 1SLJA 2ALYB 1EQRA 4OXPA 3KF8B 3Q8DA 4A3FH 1Q82C 1Q1BA 1JJCB 3HOXG 4A93G 4X64L 3HOZH 2V1CC 3STBC 2NN6G 1M1KC 4YWKA 5LMNL 1VQKA 4JBWA 3CQZH 4GNXB 1SE8A 1PV4A 4PMWA 3CCSA 2LXKA 2HQLA 2Y0SG 1K8AC 1PH6A 5IWAL 1KAWA 4NXNQ 1G291 4YCWA 1KRTA 1L0WA 3SGIA 2A19A 3HOUH 1BBWA 1U5KA 4YCUA 1XTDA 1SFOH 4Y52H 4R1JA 3PO3H 4KHZA 2I5MX 4KHPQ 4OX9Q 4X62L 5H1SE 2AMCB 3KJOA 4IFDJ 1KC8C 2LSSA 1XNQQ 1G6PA 1N34Q 3HOVH 2VUMG 1IXRA 4RG1A 2WB1E 2GN5A 4EQ5A 3CCVA 3W1BA 2MQHA 5C3EH 4HJ7A 4A76A 4GN4B 4KI0A 3T1HQ 3S2HH 1I5FA 3M4QA 1PH3A 2ZJRA 1UE1A 1IYJB 1K8GA 4QJFA 4A3IH 4LF4L 3CP0A 3S17H 1PH8A 4GOPC 1OTCA 2CKZB 1FVIA 1QVGA 4A3EH 5FJ8H 1VQCA 4JI6L 1NMGA 2LXJA 4R4QA 1J5EL 1YJ9A 1CKOA 4DR6L 2CWPA 1AE3A 3AEVA 1WYDA 2IY5B 3G6EA 3PUVA 2R7FA 4K0KL 1TWCH 3DM3A 3F8TA 2JEAI 5HGQA 1MJCA 2VQEL 1N33L 3J80c 4GNXC 1CKMA 1K83H 2AHOB 3HOWG 2F3IA 4HJAA 2IX1A 2VNUD 3F2CA 4TQUS 4JI8L 1HZBA 1XJVA 2JA5H 4HJ8A 1I94L 2E5LL 3S16H 4GKKQ 2UU9L 1P16A 4POGA 1VQ8A 3PF5A 4B3TL 4BBRG 4R4IA 2N78A 3CCLA 4LF8Q 4GKJL 3PGZA 2ZJQA 1Y1VH 2PI2E 4UY8C 4MZ9A 1M90C 4OWWB 2WAQG 1UWVA 4HIKA 1OXSC 2AWOA 1BVSA 2Q2TA 4BY7H 4GN5A 1I3QH 1YITA 1JJGA 3BZKA 4A3BH 4APVA 4DR3Q 4IFDI 3RLOA 5IYDH 4X66Q 1IBMQ 4DR7Q 1E3PA 3ER0A 3LGJA 4H02A 4NXNL 1YHAA 2CWAA 3K8AA 5EAYA 1NTGA 4QQBX 4LF7Q 5IE8A 1EYGA 4JBMA 1A62A 1VS0A 4A3CG 1HJPA 2KBNA 2RF4A 3I4NG 4KHPL 4OX9L 3I4MH 1IZ6A 4DV2L 4NXML 2YTXA 3RLFA 3I2ZA 1XNQL 1N34L 2PNHA 4NPSA 4A75A 1W2BA 3M7NA 5IYCG 3S15H 2BA0A 4JI0Q 3GTKH 5GROA 3H0GH 3T1HL 1MIUA 3FKIH 4XTCS 2ATWA 4A3GG 1PH9A 4BY1H 1X54A 3PV0A 2K75A 4LFCQ 1FJGL 5GQOA 1VQNA 3PIOA 1W3SA 1X65A 1HR0Q 2RHSB 2MFIA 2EQSA 4R4OA 1B8AA 3B6YA 3BZCA 2WB1G 2VQEQ 1I6HH 3A74A 3TS0A 1HR0W 5M3FH 3CAMA 2A1AA 2JA8G 4OWTB 2UUBQ 1WJJA 1NY4A 1X55A 3HFZB 1FGUA 4O2DA 4RMFA 1DGSA 3W5OA 4EX5A 4DR4Q 2HIXA 4LW1A 3G4SA 1KL9A 1OXUA 2E5LQ 2ES2A 2UU9Q 1CUKA 3ICEA 4A3JH 3KDFA 2E2JH 1A0IA 5GADC 2HT1A 5IP9H 5C4JH 1EIFA 2H5XA 5IYBG 4IJLA 1JB7A 3RN5A 1X6OA 3K80C 4BBSH 1Q7YC 1HZAA 1HNXQ 2JA7H 3CMEA 4IOAA 2R93G 4GKKL 2QEXA 3GTQH 5C4XG 4JI3Q 1D7QA 4IFDG 3M85A 4JI7Q 3GTOH 2RHQB 3BU2A 4P72A 4A3MH 1SR3A 4LF8L 2JA6H 2D62A 1VQ9A 3M3YH 5HY6A 1VQ5A 4HIMA 3CW2C 3CCRA 3ZJYC 3FHWA 3HOYG 4GLVB 1Q1EA 1X9NA 4JCVE 3KF6B 1V43A 3CPFA 4R4TA 1XMQQ 2NVTH 2IT1A 3EBEA 4LUVA 4Y7NH 4AH6A 1QVFA 1EIYB 4JBJA 2MO1A 4BA1I 1PA6A 1WCMG 4DR3L 3GTPH 4B3RQ 2K52A 3HOUG 2OTJA 4X66L 5M3MG 1IBML 1KRSA 1P8LA 4DR7L 4DV2Q 3S1RH 1OXVA 4UP9A 1YIJA 4NXMQ 2JEBI 1CSPA 3K81C 3RN2A 4L5QA 3GTLH 3RZOH 4LF7L 1VQHA 4JYAQ 4A93H 1N36Q 1TWAH 1UE7A 1L2FA 1V9PA 2CFMA 2XGTA 3KYHC 3S24A 2JQOA 5C3EG 1QUQB 4PZ6A 3E9IA 1L1OB 1HZ9A 5IP7G 1FJGQ 1UE6A 1CKNA 1O7IA 1PH1A 2Q2IA 1Q8KA 5C0XJ 4DK3C 4A3IG 4JI0L 2KHJA 2Q2UA 5ELNA 2VUMH 1YZ6A 4X65Q 3WWVA 3PUXA 3JAMi 3U4VA 3CMAA 2K5HA 4JOIA 4LFCL 4LF6Q 3H3VH 4ME3A 3UE0A 1T9HA 4A3LG 5K36G 3ULLA 2K4KA 1HR0L 3OTOQ 2R92G 4DV3Q 2CCZA 4L5RC 3D31A 2NZOA 1HZCA 4P75A 3JC66 3KLWA 3TEHB 1K3RA 2F52A 1XMOQ 1HNZQ 1KXLA 1YEZA 4PZ8A 1C9OA 3CPWA 2UUBL 4GN3B 3GO5A 2VL6A 2K50A 4DR4L 4C3JH 1QZHA 4DNIA 1OXXK 2WP8J 1QVCA 3T1YQ 1WOCA 1H95A 3TQYA 2EIFA 4LFAQ 2F4VQ 2JA5G 1C7YA 2L15A 5J3BA 2MO0A 4BA2I 4DUYL 1N32Q 2I0QA 5AJ3L 3U4ZA 1E7ZA 2Z6KA 1N9WA 1HNWQ 4AYBG 4GLXA 1S3OA 1HNXL 4BXXG 2Z0SA 1AE2A 1RIPA 2E2IH 1U0LA 2K5VA 4JI3L 3ULJA 3HOWH 4OO1I 5E7NA 4A3DG 4JI7L 3CF5A 3PUWA 1Y1WG 1VQIA 2UUCQ 3L7ZC 1L1OC 1GO3E 1VQAA 3NENA 3M9BA 1PH5A 4OWXB 3IRBA 4BY7G 1VQMA 1CKNB 4DR2Q 1I50H 4UPAA 4A3BG 4POFA 1A63A 5IYDG 2BA1A 4FDBA 1XMQL 1TWHH 4YY3Q 5JEAG 4DV6L 5FLMH 4JI1Q 2PI2A 2OWOA 4P74A 4B3RL 2KCTA 1VQGA 3J81i 1D8LA 2GVAA 3PO2H 3I4OA 2ZM6Q 4P71A 1E22A 1G51A 3VDYA 3TRZA 3A5ZB 3KFUA 4YWLA 5C0XI 3H15A 1LTLA 3S1QH 4AQYQ 2NZHA 2ID0A 4JYAL 4GS3A 1BBUA 1N36L 4GOPA 1PH2A 2HHHQ 1JE5A 1CSQA 2NN6I 5JEAJ 3H0GG 3J7ZC 1KIXA 4DAMA 1K9MC 2R7ZH 4DV0Q 2YU9H 3MEFA 2B63G 4BY1G 5C44G 3HKZE 3PIPA 4DKAC 2IHFA 3CCEA 3M4OH 2UXDQ 3RR5A 1EOVA 5BR8Q 5GAGC 1YVCA 3U50C 4X65L 1YBYA 4DV7L 4LF6L 5M3FG 1NJIC 4KLKA 2N8NA 2YYZA 4GNXA 1LM0A 2DGYA 3OTOL 4A3KG 4DV3L 1EUJA 2B29A 5IY0A 3J81c 1XMOL 1HNZL 4IJHA 4YHHQ 3S2DH 2YTVA 3A5UA 2OQKA 3NEMA 1Y14B 2IX0A 3PUZA 4IPGA 4LWCA 1VQJA 4DUYQ 1VQOA 3F1ZA 1YJNA 5AJ3Q 1Q86C 4YWMA 1VQ6A 4YCVA 3M4PA 3T1YL 2JA8H 5IP9G 2XTIA 2UXBQ 3BJUA 4O0AA 1PH7A 1JMCA 1ASZA 3KOJA 4TVAB 4LFAL 4BBSG 2F4VL 4WJ4A 4L5TA 2CQOA 3W1GA 1YI2A 4A3FG 1Q81C 1N32L 5JJLA 5IT9c 4B3MQ 1HNWL 3I55A 3HOZG 2QGQA 2WAQE 1GD7A 3PCOB 4LF9Q 4C3HH 2UXCQ 1HH2P 4DV6Q 1S72A 4JI2Q 2ZTEA 2E2HH 4DR1Q 3CXCA 1PHJA 1SRUA 1ASYA 2UUCL 4P73A 4C3IH 2ZJPA 1N8RC 3TS2A 2R93H 5C0XG 4QY7A 3AYHB 4DR2L 1VQLA 2OCEA 3HOXH 1Q46A 1KHIA 4JI4Q 1JT8A 4DUZQ 1PVOA 2GVBA 2Z6KC 3PO3G 4YY3L 3A0JA 4QL5A 4JI1L 2VS1A 3HOYH 4WJ3M 3HOVG 3CCUA 1NMFA 2AWNA 1SROA 5M5XH 4HIOA 2OTLA 2JJQA 2ZM6L 2NVXH 1EQQA 1E1OA 4JC0A 1X56A 2OQ0A 1S40A 4LUOA 2C35B 1V1QA 1WCMH 3K0XA 3KDFB 1UEBA 4AQYL 1KD1C 1SN8A 5M3MH 4DV4Q 1MKHA 1Z47A 2EXDA 5LMUQ 2PQAA 3I7FA 3E0EA 3L0OA 3J80i 2NVYH 4A3EG 2HHHL 5FJ8G 3PUYA 3TREA 2Q2HA 1LUZA 4DV7Q 4MTNA 3GTJH 2K5NA 4QGUA 3U58A 2VQFQ 2ZTCA 4DV0L 1VQ7A
chains in the Genus database with same CATH superfamily
4QMGA 1EEID 2YTYA 4GLAC 1K8MA 3ULPA 1EU3A 1Y1WB 5KNBA 5FOBB 2PZTA 1Q12A 1S5CD 1GKHA 1C8CA 1WI5A 2MJ8A 2BDNA 2KCCA 1R9TH 4JV5Q 2LFNA 1VQBA 3SR1A 4YHHL 1RCVD 2EYJA 3CCMA 3T53B 4WRDA 2BH2A 2KEEA 1O7YA 1QCBD 1TQOA 4X6AH 1SYBA 4UP8A 1Y1VG 2JYOA 4B3ML 4J15A 3J7A5 4N8X1 2Y0SE 3QR8A 1WTXA 3VYTA 4IUTA 4LF9L 2PQAB 4G57A 2UXCL 1TWGH 4JI2L 4IO9A 2KCMA 1RKNA 4DR1L 5T1GA 5LMNQ 1K0RA 1X3FA 2I5LX 3R3OA 4MTKA 4ALPA 1Y1WH 4KKTA 4JI4L 5IOCA 1PH4A 1SMXA 4DUZL 1PYSB 3FPUB 2M9VA 2B8GA 1H9MA 3EN2A 4XIGS 3STBD 2EE1A 1D2BA 1DXMA 3R8BA 1E2WA 1E1TA 3GD7A 4IPCA 4UDUC 1YJWA 1F2LA 1YHQA 2LKVA 2E2DC 4MNOA 3DLLA 2N49A 1IL2A 4HSPA 4DV4L 4RGTA 3CC2A 2F0KA 2LMCB 4IUQA 3SEBA 2ZXRA 5JPNC 3PSIA 4LF4Q 2D0PA 4DPGA 3P7JA 4KD4A 4IUNA 2D5DA 1SNDA 3CQZB 5J1ZA 4JI6Q 3NE5B 4DR6Q 4JW0A 3G48A 3HRZC 3TP7A 1E2ZA 2UUAL 4JOIC 1BR9A 1DJRD 2SOBA 2Z1CA 5GAHC 3NWSA 3UDFA 1AP0A 1XNRL 2K05A 2NWGA 3UDIA 4DGZA 3K7UC 1F9PA 1PFSA 1EQVA 1T5EA 2NB0A 1CZGA 4QIWE 2IPKD 2BH8A 2PMZE 4LF5L 1VQEA 4HCSA 1GUOA 1BCPF 1NR4A 3H91A 3DWPA 1I4PA 4IFDH 2ALYB 1EQRA 1ILPA 3Q8DA 1Q82C 3NQTA 3OW7A 3CQZH 1Y8OB 5IT9E 1LO5D 1BCPD 2LXKA 1PH6A 4M8AA 4YCWA 2OF1A 1U4PA 1BBWA 2A68C 4QF4A 3ONAB 2B2YA 3SE0A 2A5HA 5H1SE 2VB3X 4X62L 3KJOA 4XXEA 1XNQQ 1EZ8A 1G6PA 1S4ZA 3PQIA 5ELEA 4EQNA 1IXRA 2Z4IA 1V1OA 1HFNA 3T1HQ 2PW5A 1PH3A 1JWMD 3URYA 1UE1A 1IYJB 3SVMA 4QJFA 1K8GA 3CP0A 4A3BB 1FVIA 1QJOA 1EIGA 4JVZA 3VR5A 1NMGA 4C3JG 5K36H 2RDHA 2JSOA 3P75A 3EVQA 1WYDA 2Z8LA 3D8GA 3DM3A 4N8FA 5HGQA 3QG1A 3KBGA 1G2SA 2MHVA 3WOFA 2F3IA 3HOWG 1NUCA 1CQVA 3H0GB 1FNVA 4FVMA 4JI8L 3FKIB 4RFBA 1I94L 1JC7A 4X3KA 3HS0C 2FHTA 5FO9B 4BBRG 4R4IA 4FO2A 3PGZA 2ZJQA 5DM63 2PI2E 2ICEC 3CRKC 1M90C 1UWVA 4H13C 2AWOA 1YITA 2EZVA 4H7BA 4A3BH 2H4OA 1WTHA 3RLOA 4IUPA 4A3JB 1IBMQ 3IL8A 3OHXC 3K59A 4DR7Q 1GJXA 3ER0A 1HRJA 3NTKA 3K8AA 2CWAA 4IQZA 5C4JB 2RSOA 2BDOA 2J0TD 3I4NG 3G7LA 4KHPL 4A3MB 2IL8A 4CJ1B 3GQBA 3RLFA 3I2ZA 4ID6A 5CGKA 2JA6B 5IYCG 3M4YA 3CKIB 3J81L 2EVBA 3H0GH 5I6WA 3FKIH 4FNFA 4RKLA 4JPBW 1X54A 3PV0A 4GZYC 1CT1D 5DEHA 1W3SA 3GTPB 2EQSA 5FK9C 2QILA 3B6YA 3BZCA 2Z6BA 2WB1G 2KECA 2G5DA 4HN7A 1HR0W 2A1AA 1OO9B 2SNMA 4OWTB 2UUBQ 3HZXA 1NY4A 2F0DA 1QNKA 1RHPA 4EX5A 3C3LA 4A93B 2Q8RE 2E5LQ 2ES2A 4ILWA 1NSNS 4A3JH 3KUPA 2HT1A 5C4JH 5IYBG 4CDEC 1X6OA 1II3A 4IOAA 4YIJA 2QEXA 4JI3Q 4A3MH 2CVRA 1D1IA 2JA6H 2D62A 5EKLA 1SE2A 5HY6A 4HIMA 1MD2D 3CCRA 3ZJYC 3FHWA 1EYAA 1Q1EA 4JCVE 4LUVA 3EBEA 2RA4A 4AH6A 2D9UA 1PA6A 2MO1A 4BA1I 3GTPH 4N9TA 4X66L 5M3MG 1KRSA 4B08A 3NBHA 2B2VC 4DV2Q 4NXMQ 2XIWA 2JEBI 2F0JA 4QUCA 1VQHA 4UHVA 4A93H 1A3VA 2E2IB 4RGNA 1L2FA 3C1FA 4CKBA 3S24A 1H9RA 1L1OB 4K6DA 3NSWA 1FJGQ 1O7IA 1Q8KA 1GUWA 4JI0L 1SEBD 1ZEQX 4LJZC 1ICWA 5CC4A 1B3AA 3PUXA 4DF7A 3FEWX 4LFCL 4EQPA 1JQYD 1HR0L 2EDGA 3MXNA 2WAQB 3NQIA 1GOZA 4IUUA 4L5RC 3D31A 4P75A 5DAUA 1D6EC 3T51B 5CYUA 4J6HA 4DR4L 4OHJA 4OIKA 3I8ZA 3BZDB 4DNIA 1OXXK 2WP8J 3T1YQ 2CW0C 1EYDA 3QOJA 1FYCA 3TQYA 1HQMC 2EIFA 4LFAQ 2R7ZB 1C7YA 2YU9B 1EIHA 2B8FA 3VA7A 4BA2I 1N32Q 1H9SA 5JVH3 1E7ZA 2Z6KA 3M4OB 4GLXA 1S3OA 4BXXG 3M7GA 2E2IH 1U0LA 2K5VA 1B50A 4A3DG 4JI7L 1SNQA 1TS5A 1L1OC 1GO3E 3M9BA 4OWXB 4BY7G 4CGYB 4FDBA 4YY3Q 4DV6L 4V0BA 4JI1Q 1PYWD 1DOMA 2OWOA 1VQGA 5K5PA 4CKCA 3A5ZB 4YWLA 5C0XI 3VR2A 1TS4A 1B9NA 2F1MA 1LT5D 5D65A 2NZHA 2Q8IB 1BBUA 1I4HA 4C3HB 2HUGA 1CSQA 1V1PB 2NN6I 1PTOF 2E2HB 3TDQA 1K9MC 2R7ZH 3X3MA 1WTOA 2YU9H 1IYVA 1NR2A 4BY1G 1A2UA 2IHFA 3M4OH 1J9OA 1YVCA 3U50C 4X65L 1YBYA 1STNA 1BDOA 3SXHA 1PTOD 5M5XB 1SJED 1LM0A 3TBIB 3OTOL 3E0JA 2B29A 2Z4HA 2DY8A 1XMOL 4IJHA 4YHHQ 3PUZA 1VQJA 5KNDA 3F1ZA 1IHZA 5AJ3Q 1U4LA 4P2CB 4YWMA 3UI2A 4ZRZA 5IP9G 3MWYW 1LTGD 3KOJA 4BBSG 2F4VL 2CQOA 3W1GA 1YI2A 1VMCA 4B3MQ 3IKJA 3I55A 2QGQA 4G7OC 3PCOB 4LF9Q 3FRPB 4C3HH 3MEHA 2UXCQ 1S72A 4HEDA 4JI2Q 2E2HH 1CZWA 4DR1Q 2UUCL 3TS2A 4P73A 2QF7A 2DNEA 3DHQA 4QY7A 2OCEA 1JR0D 3TP6A 1KHIA 4JI4Q 3FPPA 4DUZQ 2R92B 2VB2X 1NMFA 5KRUA 1SROA 5M5XH 1EQQA 5HGTA 4LUOA 2C35B 1V1QA 1UEBA 4DV4Q 1Z47A 2F0SA 4A3EG 2HHHL 1W6KA 2R61A 4OEMB 5C6AA 5I6YA 2ZTCA 5IGDA 1LT3D 4DXFA 3CD6A 5IP7H 1B70B 5FLXc 1KDAA 2EYPA 3ERSX 4QIWB 2PMZB 1K8OA 5COYA 3I91A 3BDCA 4OIJA 2VW9A 2UUAQ 3RZDB 4A3LH 4F8MA 3HKZG 3S1MB 1XPUA 4UP7A 2R92H 5KIXA 1YHBA 1XNRQ 2TMPA 1VF7A 2UXBL 3D4RA 4DU9A 2DUDA 5M9OA 1VQFA 4FXDA 1E24A 2XWBB 5NUCA 4LF5Q 4DK6C 2B3GA 1A8VA 1U4MA 1X3GA 1U9RA 2B63B 1GVPA 1VF5C 1WFQA 5C44B 3I56A 1NE3A 3E6ZX 1FL0A 1QB5D 5EGTA 1TWFB 2HDLA 2O5JC 3G71A 1ONLA 2NTTA 2JE6I 4XYOA 4HMIA 4ZUJA 5JJIA 3L2PA 3I4MG 3K5MA 5C5LA 3F2UA 1TY2A 3HKSA 3RZDH 4X62Q 3KJPA 3S1MH 4N9PA 5C4XB 5EBCA 3RLNA 5BN4A 5I4DA 1C0AA 3FDTA 5ELOA 3KF8A 5JVG3 4LUZA 4IPDA 3HOZB 3RD4A 2VQFL 1PYBA 2XN9C 3LX0A 2N3SA 3LWEA 1OXTA 1E2VA 3KF6A 1IBLL 4B3SL 3W2DA 3H3VI 4TKOB 2B63H 5C44H 4LFBL 4DR5Q 1SFOB 1QG7A 4NDXA 1HA6A 3PO3B 3R2IA 1T5XD 2KHSA 1TWFH 1TIID 5C5MA 3HOVB 2JA7G 4ZCKA 4DAYB 3MTSA 4KK7A 4OO1G 3S2HB 4JI8Q 1VCIA 1I94Q 4DV5Q 1QUQA 2L9HA 4DV1L 1EFWA 4A3IB 1GXDC 5IGBA 4HJ9A 2F3VA 3S17B 5CORA 5BN3A 4PV1C 1GUTA 5C4XH 4C3IG 5CV4A 1Q1BA 1JJCB 4XYQA 4X64L 3HOZH 3STBC 2NN6G 2F0TA 4GNXB 1XYIA 1PV4A 1BXTA 4E6IA 3T4AC 1E0BA 1K83B 1KAWA 1KRTA 2E74C 5C0XH 3HOUH 4QB4A 1LLRD 1HQRD 2F0QA 1U5KA 4YCUA 1SFOH 3E5SA 3PO3H 2M00A 4KHZA 4KHPQ 1KNEA 3C1EA 2LSSA 3HOVH 4FYDA 1CTMA 1Y1VB 2ENBA 3CCVA 4A76A 3H94A 4GN4B 3S2HH 3SDZA 1I5FA 1SYDA 3M4QA 1A2TA 4A3IH 3S17H 3QB3A 1ZKOA 3I4LA 1HFGA 5FJ8H 3L9AX 5FKAC 2LXJA 1EEFD 2QCPX 2IY5B 3KK7A 2C5CA 2A6EC 1N33L 3J80c 4GNXC 1JE4A 1CKMA 5KYIA 1F9RA 1K83H 2B2WA 5JOBA 4FXGC 4HTHA 3F2CA 5A2QL 3GTKB 4MN3A 2GA4B 2IW3A 1D5XC 2UU9L 1P16A 2CHBD 5KNCA 5EPLA 1CA5A 4GKJL 2M2LA 2SNSA 4IN3A 1KABA 3QIAA 4KHVA 1GHJA 1Y1VH 1ZYRC 2FMCA 3CU7A 2Q2TA 4F88A 1QWYA 1JORA 5IYDH 3JAME 2K1BA 4X66Q 5JEAH 1MSGA 1KLGD 2N55A 3HEJA 3LGJA 2E2JB 4NXNL 3OPOA 3K57A 1NTGA 2NBFA 2BE5C 5IE8A 1SNCA 3NTIA 1EYGA 1JICA 1PDQA 3DUZA 2A74C 3GP7A 4OX9L 1IZ6A 2PNHA 3M3YB 3N52A 2XRSD 2BA0A 4JI0Q 4K6LA 4EGVA 3GTKH 5E3FA 2SDFA 4LFCQ 2K75A 1F2YA 5GQOA 3CHBD 1HR0Q 2BOSA 2MFIA 3IFDA 1NCVA 4R4OA 5CV5A 5ELDA 4U673 2DJFC 4ZAIA 2VQEQ 3A74A 3TS0A 3GTLB 2JA8G 3RZOB 1WJJA 3HFZB 4ZYSA 4RMFA 4DR4Q 1DGSA 2MGSA 2HIXA 4I65A 1KL9A 4RH6A 1CUKA 3V96A 4LAAA 3QO2A 4XT1B 2E2JH 2JXMB 5EPKA 5LL6X 3NWTA 1YNJC 2EY5A 2WV6D 1O80A 4IFDG 1WVLA 4JI7Q 2RHQB 1EU4A 4LF8L 1BBXC 3M3YH 1VQ5A 4XQQA 3HOYG 1ICFB 2DY7A 4R4TA 2IT1A 2PO4A 1D5MC 3KLSX 4ME5A 4C3JB 1QVFA 2F0IA 1WCMG 4PQXA 2K52A 1EY6A 3SHLA 1P8LA 2X6LA 2HDMA 3GTLH 3RZOH 1LT6D 3Q0AA 2PYKA 4IZ8A 4CJ0B 4C56C 3HOWB 5FLXL 2CFMA 1JWUD 2JQOA 1CKNA 2Q2IA 5C0XJ 4DK3C 1I50B 2KHJA 2Q2UA 5ELNA 1TWHB 4J8QA 2EPBA 4X65Q 4Y52H 2F0PA 2K01A 3U4VA 4JOIA 5K36G 3H3VH 2O4XA 3UE0A 1RF2D 3H3VC 3ULLA 1JOOA 1X3PA 3OTOQ 2F0UA 3PO2B 2CCZA 5IGGA 3JC66 1XMOQ 1K3RA 1TS2A 1S5BD 3CPWA 2VXWA 4C3JH 2R3ZA 1QVCA 3T56B 2WINB 2RCFA 3NHHA 3MVVA 5EKKA 2F4VQ 2RSNA 5J3BA 2MO0A 1PFNA 4AYBG 3A7LA 1B9MA 4S3SA 1RIPA 3HOWH 1STBA 1EFID 1I4XA 3PUWA 3U9SA 2A6HC 3WDNA 1VQIA 2UUCQ 2FINB 3NENA 3IRBA 1SNMA 1VQMA 1I50H 4Q5VA 4A3BG 2F0EA 4DNTB 1JWSD 1TWHH 5ISRA 5FLMH 1ENCA 3R93A 1U4RA 4P74A 4B3RL 2KCTA 3J81i 1D8LA 1SMYC 2GVAA 2K5QA 3PO2H 1X3QA 1E22A 3TRZA 1QE6A 2ZXOA 4O1NA 2PCFB 1N36L 1EZ6A 1MBYA 3TN2A 2HHHQ 1JE5A 3X3NA 1KTKA 3A55A 5JEAJ 3H0GG 3J7ZC 1KIXA 4ZQ3A 1EWHA 1S5FD 4RHSA 4KKSA 3HOXB 1Q3LA 1FGBD 1LTAD 2A68D 3RR5A 3WOEA 4DA2A 5GAGC 4DV7L 1AZPA 2A69C 4KLKA 2YYZA 4KY6A 2DGYA 4A3KG 3MXGA 2YTVA 3A5UA 2OQKA 2KOLA 5M3MB 4IPGA 2XRQD 4DUYQ 1Q86C 1SXTA 1VQ6A 1CI3M 2UXBQ 1SYFA 1PH7A 1ASZA 1HUNA 1XXGA 4L5TA 2O2LD 2ZT9C 1RDPD 2I07B 4A3FG 1Q81C 1ESRA 5IT9c 2EY6A 1HNWL 1KLUD 3E3XA 2EXZA 1K0SA 1C4QA 1IL8A 3D6WA 1A6XA 1PRTB 1C48A 1B3QA 2PW7A 4DR2L 1VQLA 3HOXH 1PZKD 2KJXA 3S1NB 4NKLA 2Z6KC 4R8IA 4F87A 3I3CA 1EOTA 4WJ3M 1Y69U 2AWNA 5FO7B 2OTLA 2ZM6L 1E1OA 4A93G 3KDFB 3VA5A 3BS1A 4AQYL 2EYFA 5M3MH 5M5YB 2EXDA 3ERQA 3J80i 3KLRA 4MTNA 4QGUA 3MHBA 2VQFQ 3U58A 3NPPA 1B7YB 2RKSA 4A3DB 2R6GA 2F0FA 1Z9FA 3PF4A 2FJ2A 3J80L 2WFWA 2UXDL 1IBLQ 4B3SQ 5BR8L 3IFTA 4LFBQ 1LTBD 3Q24A 1PRTC 2NVQB 3NELA 5I2YA 1IW7C 4RKBA 3TZUA 1AFPA 4JBKA 3S1NH 4AIMA 4K2KA 5ELFA 2A8VA 5M5WB 4DV1Q 3UDXA 2I46A 1LYLA 5G3LF 4C2MB 5IGFA 5KYLA 3QOLA 3CC4A 4A3GB 5FLXE 2EY2A 4K5XA 1Z6HA 1UE5A 5M5YH 1BKBA 3U9OA 5DNFA 1WTQA 4OO1I 4BY1B 1HPCA 1QZGA 4X64Q 5JPMC 4BXXH 2B2VA 2F0WA 5G3LD 2FXQA 4A3DH 3K7AB 2EYMA 3AFQA 1G8ZD 1SYEA 1KDBA 4DAPA 2LY7A 3DM1A 2RBMA 4LMQD 1S5ED 3GTGB 4K5WA 1EQTA 3VR6A 1CM9A 1PFBA 4DNRB 1AH9A 3E9HA 2PZUA 1GHKA 2NVQH 3EROA 3OW2A 4A3CH 5AFWA 3FMCA 2D0OA 3ITPA 4ZK9B 4J1MA 4A4IA 2J7ZA 2R7ZG 2VZAA 3CC7A 5LMUL 4OONA 3TP8A 5M5WH 2F0LA 2ICIA 4JG2A 2OXPA 1LT4D 1KDCA 4KD3A 2N88A 4C2MH 3MFYA 3K5OA 4A3GH 1IBKL 3OIQA 1STAA 2IHEA 1DM0B 2K7VA 5EJWA 1TXYA 2A73B 1EWIA 2QW7A 4FP5D 2R7DA 2F0MA 1LABA 4R4CA 1QOHA 5D3IB 3AU7A 1NBWA 1N33Q 3CCJA 3RUZA 1QILA 3K7AH 2B2TC 4R8NA 4FXKC 1PFMA 3OYYA 1WTRA 4AYBE 5C3EB 5JAVA 3GTGH 2ASBA 5L37A 4JI5L 4EVOA 2E75C 1L1OA 1Q90A 4GOPB 1RL2A 3QWNA 2EYOA 2JP1A 3BVGA 4IOCA 2VY3A 3J81E 4A3EB 4GKJQ 1EY5A 1SLJA 3OMCA 2CW0D 1LACA 4OXPA 3KF8B 2L4NA 1VQKA 1BOSA 4PMWA 2HQLA 2Y0SG 4NXNQ 5IWAL 1Y8NB 1G291 2IWHA 4CDDC 3SGIA 1A3UA 2F4IA 2JA5B 4R1JA 3H6MA 3QJYA 3K5NA 2B2UC 1RODA 4OX9Q 4C1NI 4ABNA 4UAIA 1KC8C 1O78A 4PMCA 2VUMG 4RG1A 2WB1E 2GN5A 4EQ5A 3AB9A 2MQHA 5C3EH 1HTPA 4KI0A 3VYRA 2ZJRA 2RDFA 4MHEA 3KBXA 4GOPC 1OTCA 1F77A 2CKZB 4L6TB 4A3EH 1PZID 1J5EL 1YJ9A 1CKOA 2K5WA 3BYTB 3AEVA 2J4XA 2L55A 2R7FA 4K0KL 1XX8A 3BDLA 4TRDA 2NTSA 3F8TA 1MJCA 1RTOA 3I4MB 4K2LA 1MGSA 1BNZA 3D4DA 2IX1A 4ODGA 3A7AB 2JA5H 4HJ8A 1V1PA 2E5LL 4OELB 4POGA 1VQ8A 4B3TL 4KKUA 2N78A 3CCLA 5ELBA 5CV6A 4LF8Q 4DXGA 1DCZA 5M3FB 4MZ9A 4OWWB 2EYLA 4RGOS 1F9QA 1JJGA 5EKIA 2HCCA 3BZKA 3DMUA 3J80E 4IFDI 1RJTA 2QDLA 4RA8A 3VR3A 3EFXD 4H02A 3LNNA 2G9HD 4QQBX 5A35A 1VS0A 2JA7B 5CR3A 3GTQB 3K6OA 2TSSA 1HJPA 3GTOB 4G4KA 3I4MH 4DV2L 4NXML 1ML0D 2X69A 3OOCA 1N34L 4NPSA 3M7NA 4A75A 1JOQA 1AEXA 4DFAA 2F3WA 1F2MA 4Q0FA 5GROA 1NAPA 1MIUA 1GUNA 4XTCS 2ATWA 2NVTB 1FR3A 1STYA 1VQNA 1FJGL 2F0NA 1F9SA 2RHSB 1UEAB 5C4HA 5EPJA 1UAPA 1G6ZA 2RQXA 2JN4A 5M3FH 3CAMA 3MXUA 4RCOA 3OSOA 3OWEB 1STHA 5IT9L 4O2DA 1LTID 1ILQA 4M1UB 2SEBD 3ICEA 3MFGA 4G7ZC 1SJHD 1CHPD 4B9WA 4ZLTF 1EIFA 2KCNA 4IJLA 5C4XG 2K03A 2JA7H 3EA6A 2R93G 4GKKL 3GTQH 1D7QA 4EQOA 4FF3A 3GTOH 4OO1H 2NYZD 1SR3A 2KEDA 2WKCA 3CW2C 1HCZA 4GLVB 1X9NA 2HQEA 3CPFA 4CKEA 2NVTH 4LK1C 1TVXA 1B53A 1EIYB 3SK4A 1G2TA 4DR3L 1BUVT 4B3RQ 3HOUG 3PMFA 5T1IA 4IURA 1PXUA 2NZ1D 1OXVA 3NTHA 1YIJA 2AQ1B 4KY5A 3RN2A 2NN6H 4LF7L 3TZDA 1BCPB 3BG3A 1N36Q 3DWAA 1V9PA 2XGTA 3KYHC 1G91A 2H1EA 5D14A 1UE6A 1PH1A 4A3IG 3PIP3 3SK6A 3WWVA 1S5DD 2K4KA 5E1FA 1CK1A 5C3XA 2NZOA 2PZWA 2QKIC 3TEHB 1KXLA 1YEZA 3BVZA 1HXYD 1MI2A 4PZ8A 4GN3B 2EY1A 2VL6A 2EJMA 1QZHA 3SK5A 2I0QA 5AJ3L 1HNWQ 4WJWA 2DJGC 4HMJA 1HNXL 1SAPA 2Z0SA 3ZYYX 1BCPC 1VMPA 1EL0A 5E7NA 4U68A 3CF5A 1Y1WG 2KVMA 3L7ZC 1PH5A 3A8KE 1B4OA 1STEA 1CKNB 4DR2Q 2WKDA 4POFA 3S2DB 1A63A 4MIUA 5IYDG 2HCIA 4KTAA 4K5VA 4CDCC 1FNWA 5JEAG 1XMQL 2PI2A 4K8IA 2JA8B 3P20A 2ZM6Q 1O7LA 4P71A 3KFUA 3LWUA 1LTLA 3TSSA 4DAYA 4IALA 4AQYQ 2WACA 3NXWA 4JYAL 2AUJD 4GS3A 1Z7TA 2PNRC 2CH4W 4NP5A 1PH2A 4NMZA 1Y8PB 3I70A 3OIPA 5LL6S 1EY0A 1YNND 1IKMA 1SYCA 2B2YC 3HKZE 4TSSA 3PIPA 2UXDQ 1EOVA 3BVMA 5BR8Q 4K14A 1CFMA 2P5ZX 5IGEA 3GV3A 5IODA 4LF6L 3HOYB 5ELCA 3MC0B 4GNXA 2Z9HA 4WFN3 1KAAA 4DV3L 3ND8A 1O7ZA 2NVXB 2XSCA 1SE4A 1HNZL 1WCMB 3S2DH 3NEMA 4LWCA 1EY8A 1YJNA 1VQOA 3M4PA 2JA8H 2NVYB 5C4ZA 1DOLA 2XTIA 4O0AA 3A8JE 2F0GA 5JJLA 5J22A 3EQLC 1GD7A 2EJFC 1XWEA 2A6ED 4KJNA 4DV6Q 1F2ZA 2ZTEA 5I2XA 3CXCA 5KEEA 1SRUA 1PHJA 2ZJPA 3GTMB 3AYHB 1Q46A 2EOTA 1LV9A 1FNUA 1PVOA 3A0JA 1DONA 3P1HA 3HOYH 4CDFC 1WTPA 3CCUA 1QNUA 4NW2A 1R4QB 4HIOA 1SNOA 5LHY1 1ZYRD 2NVXH 4JC0A 2OQ0A 1WCMH 1CQFA 1KD1C 4BBRB 5LMUQ 4V190 2PQAA 2RVLA 3IAYA 1ENFA 3I7FA 3L0OA 3S14B 2NVYH 3VR4A 3PUYA 3TREA 1LUZA 2K5NA 4AYBB 2MPMA 3GO5A 1I4RA 4I7AA 2BE5D 4DV0L 3BDOA 4JK1C 1IBKQ 3FVQA 5J39A 4HIDA 5IGCA 2KHIA 1TT2A 3A8IE 1RD9D 3MZ5A 3VYSA 3GTMH 3NBHB 1VQPA 3RNUA 1PLFA 3I4NB 4KMUC 4DR5L 3F2DA 3J81j 1VQDA 3TMEA 3F2BA 4JI5Q 3J7AV 1LTSD 4X3TA 4KV6A 1JJ2A 4OL7A 2RCNA 4HAEA 3JAMc 4X3UA 5CBAE 2CH4A 4KY7A 1X3EA 5E4WC 3AFPA 1K73C 4DK0A 5JJKA 2E8GA 4BBRH 1L0XB 3MA2B 3SK8A 4DV5L 1KQSA 3S14H 2K14A 2AKWB 2QA4A 2WB1B 4XDXA 1BO0A 3CCQA 1DD2A 2JA9A 5FO8B 5FLMG 3MXNB 1GM5A 1YNJD 4KN7C 4ZKCB 2IX3A 2OT2A 5IWAQ 5LMNW 4A3KB 5DLQE 3UDGA 3PO2G 2XVSA 5I9PA 5C3WA 3GDEA 2MNAA 4LNQA 2KUMA 3I72A 4IUVA 4HJ5A 2PQEA 5A2QE 1EY4A 4PZ7A 3FKIG 2K32A 3FP9A 4QCLA 3I4NH 5HURA 4HCEA 1AW7A 1H9SB 1VQ4A 4A3FB 1WD0A 5IYCH 1XPOA 4ZUIA 2BCOA 2L0CA 1J6QA 1J5EQ 2YV5A 4PG3A 2JK8A 3O13A 4A3JG 3CRLC 1YNXA 2KENA 1XPRA 2HIVA 4K0KQ 1GUSA 4L8JA 1TKWB 3D0FA 4ULLA 2ZTDA 1SBBB 4BS9A 1PTOB 4JV5L 3BYYB 4A3KH 2OEOA 3AQQA 5DM73 3K5LA 3UE1A 2K28A 4A3MG 1MJEA 1SSOA 2JA6G 4XT3B 4IPHA 4FF2A 5IYBH 4B3TQ 5GAEC 2I5HA 2F0OA 4L5SA 1TS3A 3D4WA 4NB3A 4PMBA 1SYGA 3EIVA 3W3AA 4A3FH 2O5IC 1BQQT 3HOXG 3S9WA 1TWCB 2V1CC 1M1KC 4YWKA 5LMNL 4JBWA 4L63B 1NNXA 1SE8A 1XTCD 2DN8A 3TP5A 2LS01 3CCSA 1K8AC 1L0WA 2A19A 1BF4A 2A6HD 2XWJB 3HP3A 2AQ2B 1XTDA 1Q8IA 3N6RA 3S16B 1SDFA 1UUPA 2I5MX 2F0VA 2AMCB 4IFDJ 2D2CC 1PTOH 1N34Q 3K0YA 1PTOC 3T16A 3W1BA 4HJ7A 1SMYD 4BY7B 1I3QB 4LF4L 4DN4M 1PH8A 1MHWC 3PIO3 1EWCA 1M4VA 1QVGA 1CA6A 3Q23A 1VQCA 4JI6L 4R4QA 1SE3A 3J7AF 4DR6L 2CWPA 1AE3A 1DYQA 1SNPA 3G6EA 3PUVA 2KQ3A 4CBVA 1TWCH 5EQ0A 2JEAI 4KJOA 4ZKBB 1A3TA 1RTNA 2VQEL 3RMHA 3I73A 2AHOB 2A69D 4OGQC 4HJAA 3S15B 2VNUD 2FFKB 1HA5A 4TQUS 1XJVA 1HZBA 1I4GA 3S16H 4GKKQ 3PF5A 1MSHA 1V8QA 4RGMA 1I6HB 4FF1A 3GV6A 4UY8C 1X32A 3KLSA 2WAQG 4HIKA 1OXSC 2X6GA 1BVSA 4BY7H 4GN5A 1I3QH 4WORA 2MUYA 4APVA 4DR3Q 4RHRA 3MAQA 2QDBA 1E3PA 3H09A 2E76C 3R2TA 1JB3A 1YHAA 2AUKA 5EAYA 4LF7Q 1I4QA 4RCNA 3T13A 3MXPA 4JBMA 4BBSB 1A62A 4QUFA 4BWGB 4A3CG 2L5TA 3VYUA 2KBNA 2RF4A 2YTXA 1EYCA 1XNQL 4H44C 3Q22A 1W2BA 1DZ1A 3EJIA 2QEJC 3S15H 1ESFA 3T1HL 4Y7NB 4A3GG 2V4DA 1PH9A 4BY1H 4B9XA 3NP8A 3PIOA 3D6CA 1VDZA 1X65A 3NBIA 2DNCA 1B8AA 2IJ0A 5CV8A 3S1RB 1I6HH 4HR7B 2HD3A 2K33A 2B39A 1X55A 2EJGC 1FGUA 3W5OA 2L1BA 2Y0SB 1PRTF 4LW1A 1TWAB 3G4SA 3NK9A 1OXUA 1B2TA 1H9KA 2UU9Q 3KDFA 5CMDA 1LTRD 1AN8A 3D3RA 1A0IA 5GADC 4C3HG 5IP9H 2H5XA 1JB7A 3RN5A 3K80C 4BBSH 1Q7YC 1HZAA 1HNXQ 3CMEA 2VUMB 1AZQA 1PRTD 4I7ZC 5EBDA 1ZXTA 3M85A 1HHVA 1IW7D 3BU2A 4P72A 3I90A 1FD7D 3L3OC 4C1NK 1VQ9A 5CV7A 3K58A 3G6JB 3KF6B 4K8JA 1V43A 1XMQQ 3DWQA 4Y7NH 4X3SA 3HKZB 1I6VC 4XQNA 2OTJA 1IBML 4DR7L 3S1RH 4UP9A 1CSPA 3K81C 4L5QA 1TY0A 2K6AA 3V05A 4R9WA 1K3BC 2L11A 5I9OA 4JYAQ 1ET9A 1D5ZC 1TWAH 1UE7A 5CV9A 5C3EG 3J7YW 1QUQB 4PZ6A 3E9IA 1HZ9A 4HSVA 5IP7G 2KA7A 4CHTB 1JOKA 4RAUC 1M8AA 2VUMH 1YZ6A 5CBEE 3JAMi 3CMAA 4A3LG 2K5HA 4LF6Q 1DOKA 4ME3A 1T9HA 1ENAA 2B2TA 2R92G 4DV3Q 1HUMA 3OWFA 1HZCA 3KLWA 4DAVA 2F52A 1HNZQ 3S1QB 4F7XA 1C9OA 3JAML 2UUBL 2K50A 1TR5A 1WOCA 2RDGA 1H95A 2JA5G 2AQ3B 1PZJD 1J8IA 1H9JA 2L15A 4DUYL 1WTVA 3U4ZA 1N9WA 3C2PA 2C9OA 1AE2A 4JI3L 3ULJA 5JJZA 1D1KA 1B1ZA 1VQAA 3ND9A 1TU2B 1PMRA 4UPAA 2BA1A 5D3DA 1WD1A 2B2UA 4O42A 3I4OA 4DK1A 1G51A 3VDYA 1GUGA 4CJ2C 3H15A 1HTLD 3S1QH 2G9DA 4PNYA 1WTWA 2ID0A 4Z9CB 4GOPA 2F03A 5E4XA 4DAMA 1B44D 4C3IB 2R93B 2L12A 4KN4C 4DV0Q 3MEFA 2B63G 5C44G 4DKAC 3CCEA 5KGUA 3NUCA 5M3FG 1NJIC 2N8NA 3AMUA 2PPBC 1EUJA 2F0HA 3J81c 5IY0A 4H0LC 1IYUA 1L0YB 3C46A 3HOUB 1EY9A 1Y14B 2IX0A 4RWSC 1STGA 4YCVA 3T1YL 3BJUA 3GTJB 1JMCA 4TVAB 4LFAL 4WJ4A 3Q6SA 3DEOA 1N32L 1A15A 3HOZG 2WAQE 1CHQD 5IIFA 2B2WC 3A56A 5TSSA 5BN5A 1K28A 1HH2P 2MP1A 4G7HC 1KNAA 1ASYA 1N8RC 4C3IH 2R93H 3HG9A 5C0XG 1R9TB 1JT8A 2Q8TA 3V2TA 2GVBA 3PO3G 4YY3L 4XQJA 4QL5A 4JI1L 2VS1A 3HOVG 3HGBA 2ZXPA 2XNAC 2JJQA 1EY7A 4FF4A 1X56A 1S40A 1UNSA 2WIIB 3K0XA 3DXJC 3OMGA 1YNNC 1W6JA 1SN8A 1MKHA 1IKLA 5F2DA 3DEPA 2K04A 2EYHA 1ET6A 3E0EA 1TWGB 2K5DA 2NUCA 5FJ8G 2Q2HA 1LTTD 1JCKB 3GTJH 4DV7Q 3A54A 2CQAA 2FMMA 4JBJA 1R4PB 1VQ7A
chains in the Genus database with same CATH topology
1B7YB 2YTYA 4GLAC 2R6GA 3ULPA 1IBKQ 3PF4A 1Z9FA 3CD6A 2WFWA 5IP7H 1B70B 4HIDA 1IBLQ 5BR8L 4B3SQ 2UXDL 1Q12A 5FLXc 3ERSX 2KHIA 1GKHA 4LFBQ 1WI5A 2VW9A 2UUAQ 3GTMH 4A3LH 3HKZG 1R9TH 3NELA 4JV5Q 1VQBA 4YHHL 3NBHB 1XPUA 4UP7A 4JBKA 3S1NH 1VQPA 4AIMA 2R92H 3RNUA 3CCMA 4DR5L 1YHBA 3F2DA 3J81j 2A8VA 1XNRQ 2BH2A 1VQDA 3F2BA 4JI5Q 2UXBL 4DV1Q 3UDXA 4X6AH 4UP8A 1JJ2A 1Y1VG 2DUDA 1LYLA 2RCNA 3JAMc 1VQFA 1E24A 3CC4A 4LF5Q 1X3EA 3AFPA 2B3GA 4DK6C 1A8VA 4J15A 1K73C 2E8GA 2Y0SE 4B3ML 3J7A5 5JJKA 4BBRH 1UE5A 1X3GA 5M5YH 1KQSA 1BKBA 4DV5L 1GVPA 1WFQA 2PQAB 2K14A 2AKWB 4LF9L 2QA4A 3S14H 3I56A 1TWGH 2UXCL 4JI2L 1NE3A 4IO9A 2KCMA 4X64Q 1QZGA 3CCQA 4DR1L 4BXXH 2JA9A 1FL0A 5LMNQ 1K0RA 1X3FA 5FLMG 2FXQA 2I5LX 3MXNB 3G71A 4ALPA 1GM5A 4A3DH 1Y1WH 3AFQA 2JE6I 4JI4L 5IWAQ 5LMNW 1SMXA 4DUZL 1PH4A 5DLQE 3UDGA 3PO2G 5JJIA 1PYSB 3L2PA 3I4MG 3EN2A 4XIGS 3STBD 3GDEA 2MNAA 3HKSA 4LNQA 4IPCA 1E1TA 3GD7A 4X62Q 3E9HA 4HJ5A 3RZDH 1YJWA 1AH9A 1YHQA 2NVQH 3KJPA 3OW2A 3S1MH 4MNOA 4PZ7A 3FKIG 3DLLA 4A3CH 3FP9A 3RLNA 2N49A 2D0OA 1IL2A 3I4NH 4DV4L 4A4IA 2R7ZG 1C0AA 2VZAA 5ELOA 3CC7A 5LMUL 1VQ4A 3CC2A 4LUZA 4IPDA 4OONA 5M5WH 4JG2A 3PSIA 5IYCH 2D0PA 4DPGA 4LF4Q 1XPOA 2VQFL 1PYBA 2N3SA 4C2MH 1OXTA 4JI6Q 4A3GH 1IBKL 3KF6A 1J6QA 1J5EQ 4DR6Q 1IBLL 4B3SL 3H3VI 2IHEA 2B63H 2YV5A 4PG3A 2JK8A 5C44H 4A3JG 4LFBL 1TXYA 1YNXA 3G48A 2KENA 4DR5Q 1EWIA 1XPRA 2HIVA 4K0KQ 2R7DA 2UUAL 4JOIC 3D0FA 1TWFH 4R4CA 1NBWA 1N33Q 2ZTDA 3CCJA 3K7AH 4JV5L 5GAHC 2JA7G 4A3KH 3OYYA 3AQQA 3UDFA 4DAYB 3UE1A 4AYBE 3GTGH 4A3MG 1XNRL 1MJEA 2ASBA 4OO1G 4JI8Q 2JA6G 1VCIA 1I94Q 4JI5L 4DV5Q 1QUQA 3UDIA 4DV1L 1EFWA 1L1OA 3K7UC 4IPHA 4HJ9A 1PFSA 1RL2A 5IYBH 4GOPB 4B3TQ 5GAEC 2I5HA 4IOCA 2VY3A 4L5SA 4GKJQ 5C4XH 4NB3A 4QIWE 2BH8A 2PMZE 4LF5L 1VQEA 3EIVA 1SLJA 2ALYB 1EQRA 4OXPA 3KF8B 3Q8DA 4A3FH 1Q82C 1Q1BA 1JJCB 3HOXG 4A93G 4X64L 3HOZH 2V1CC 3STBC 2NN6G 1M1KC 4YWKA 5LMNL 1VQKA 4JBWA 3CQZH 4GNXB 1SE8A 1PV4A 4PMWA 3CCSA 2LXKA 2HQLA 2Y0SG 1K8AC 1PH6A 5IWAL 1KAWA 4NXNQ 1G291 4YCWA 1KRTA 1L0WA 3SGIA 2A19A 3HOUH 1BBWA 1U5KA 4YCUA 1XTDA 1SFOH 4Y52H 4R1JA 3PO3H 4KHZA 2I5MX 4KHPQ 4OX9Q 4X62L 5H1SE 2AMCB 3KJOA 4IFDJ 1KC8C 2LSSA 1XNQQ 1G6PA 1N34Q 3HOVH 2VUMG 1IXRA 4RG1A 2WB1E 2GN5A 4EQ5A 3CCVA 3W1BA 2MQHA 5C3EH 4HJ7A 4A76A 4GN4B 4KI0A 3T1HQ 3S2HH 1I5FA 3M4QA 1PH3A 2ZJRA 1UE1A 1IYJB 1K8GA 4QJFA 4A3IH 4LF4L 3CP0A 3S17H 1PH8A 4GOPC 1OTCA 2CKZB 1FVIA 1QVGA 4A3EH 5FJ8H 1VQCA 4JI6L 1NMGA 2LXJA 4R4QA 1J5EL 1YJ9A 1CKOA 4DR6L 2CWPA 1AE3A 3AEVA 1WYDA 2IY5B 3G6EA 3PUVA 2R7FA 4K0KL 1TWCH 3DM3A 3F8TA 2JEAI 5HGQA 1MJCA 2VQEL 1N33L 3J80c 4GNXC 1CKMA 1K83H 2AHOB 3HOWG 2F3IA 4HJAA 2IX1A 2VNUD 3F2CA 4TQUS 4JI8L 1HZBA 1XJVA 2JA5H 4HJ8A 1I94L 2E5LL 3S16H 4GKKQ 2UU9L 1P16A 4POGA 1VQ8A 3PF5A 4B3TL 4BBRG 4R4IA 2N78A 3CCLA 4LF8Q 4GKJL 3PGZA 2ZJQA 1Y1VH 2PI2E 4UY8C 4MZ9A 1M90C 4OWWB 2WAQG 1UWVA 4HIKA 1OXSC 2AWOA 1BVSA 2Q2TA 4BY7H 4GN5A 1I3QH 1YITA 1JJGA 3BZKA 4A3BH 4APVA 4DR3Q 4IFDI 3RLOA 5IYDH 4X66Q 1IBMQ 4DR7Q 1E3PA 3ER0A 3LGJA 4H02A 4NXNL 1YHAA 2CWAA 3K8AA 5EAYA 1NTGA 4QQBX 4LF7Q 5IE8A 1EYGA 4JBMA 1A62A 1VS0A 4A3CG 1HJPA 2KBNA 2RF4A 3I4NG 4KHPL 4OX9L 3I4MH 1IZ6A 4DV2L 4NXML 2YTXA 3RLFA 3I2ZA 1XNQL 1N34L 2PNHA 4NPSA 4A75A 1W2BA 3M7NA 5IYCG 3S15H 2BA0A 4JI0Q 3GTKH 5GROA 3H0GH 3T1HL 1MIUA 3FKIH 4XTCS 2ATWA 4A3GG 1PH9A 4BY1H 1X54A 3PV0A 2K75A 4LFCQ 1FJGL 5GQOA 1VQNA 3PIOA 1W3SA 1X65A 1HR0Q 2RHSB 2MFIA 2EQSA 4R4OA 1B8AA 3B6YA 3BZCA 2WB1G 2VQEQ 1I6HH 3A74A 3TS0A 1HR0W 5M3FH 3CAMA 2A1AA 2JA8G 4OWTB 2UUBQ 1WJJA 1NY4A 1X55A 3HFZB 1FGUA 4O2DA 4RMFA 1DGSA 3W5OA 4EX5A 4DR4Q 2HIXA 4LW1A 3G4SA 1KL9A 1OXUA 2E5LQ 2ES2A 2UU9Q 1CUKA 3ICEA 4A3JH 3KDFA 2E2JH 1A0IA 5GADC 2HT1A 5IP9H 5C4JH 1EIFA 2H5XA 5IYBG 4IJLA 1JB7A 3RN5A 1X6OA 3K80C 4BBSH 1Q7YC 1HZAA 1HNXQ 2JA7H 3CMEA 4IOAA 2R93G 4GKKL 2QEXA 3GTQH 5C4XG 4JI3Q 1D7QA 4IFDG 3M85A 4JI7Q 3GTOH 2RHQB 3BU2A 4P72A 4A3MH 1SR3A 4LF8L 2JA6H 2D62A 1VQ9A 3M3YH 5HY6A 1VQ5A 4HIMA 3CW2C 3CCRA 3ZJYC 3FHWA 3HOYG 4GLVB 1Q1EA 1X9NA 4JCVE 3KF6B 1V43A 3CPFA 4R4TA 1XMQQ 2NVTH 2IT1A 3EBEA 4LUVA 4Y7NH 4AH6A 1QVFA 1EIYB 4JBJA 2MO1A 4BA1I 1PA6A 1WCMG 4DR3L 3GTPH 4B3RQ 2K52A 3HOUG 2OTJA 4X66L 5M3MG 1IBML 1KRSA 1P8LA 4DR7L 4DV2Q 3S1RH 1OXVA 4UP9A 1YIJA 4NXMQ 2JEBI 1CSPA 3K81C 3RN2A 4L5QA 3GTLH 3RZOH 4LF7L 1VQHA 4JYAQ 4A93H 1N36Q 1TWAH 1UE7A 1L2FA 1V9PA 2CFMA 2XGTA 3KYHC 3S24A 2JQOA 5C3EG 1QUQB 4PZ6A 3E9IA 1L1OB 1HZ9A 5IP7G 1FJGQ 1UE6A 1CKNA 1O7IA 1PH1A 2Q2IA 1Q8KA 5C0XJ 4DK3C 4A3IG 4JI0L 2KHJA 2Q2UA 5ELNA 2VUMH 1YZ6A 4X65Q 3WWVA 3PUXA 3JAMi 3U4VA 3CMAA 2K5HA 4JOIA 4LFCL 4LF6Q 3H3VH 4ME3A 3UE0A 1T9HA 4A3LG 5K36G 3ULLA 2K4KA 1HR0L 3OTOQ 2R92G 4DV3Q 2CCZA 4L5RC 3D31A 2NZOA 1HZCA 4P75A 3JC66 3KLWA 3TEHB 1K3RA 2F52A 1XMOQ 1HNZQ 1KXLA 1YEZA 4PZ8A 1C9OA 3CPWA 2UUBL 4GN3B 3GO5A 2VL6A 2K50A 4DR4L 4C3JH 1QZHA 4DNIA 1OXXK 2WP8J 1QVCA 3T1YQ 1WOCA 1H95A 3TQYA 2EIFA 4LFAQ 2F4VQ 2JA5G 1C7YA 2L15A 5J3BA 2MO0A 4BA2I 4DUYL 1N32Q 2I0QA 5AJ3L 3U4ZA 1E7ZA 2Z6KA 1N9WA 1HNWQ 4AYBG 4GLXA 1S3OA 1HNXL 4BXXG 2Z0SA 1AE2A 1RIPA 2E2IH 1U0LA 2K5VA 4JI3L 3ULJA 3HOWH 4OO1I 5E7NA 4A3DG 4JI7L 3CF5A 3PUWA 1Y1WG 1VQIA 2UUCQ 3L7ZC 1L1OC 1GO3E 1VQAA 3NENA 3M9BA 1PH5A 4OWXB 3IRBA 4BY7G 1VQMA 1CKNB 4DR2Q 1I50H 4UPAA 4A3BG 4POFA 1A63A 5IYDG 2BA1A 4FDBA 1XMQL 1TWHH 4YY3Q 5JEAG 4DV6L 5FLMH 4JI1Q 2PI2A 2OWOA 4P74A 4B3RL 2KCTA 1VQGA 3J81i 1D8LA 2GVAA 3PO2H 3I4OA 2ZM6Q 4P71A 1E22A 1G51A 3VDYA 3TRZA 3A5ZB 3KFUA 4YWLA 5C0XI 3H15A 1LTLA 3S1QH 4AQYQ 2NZHA 2ID0A 4JYAL 4GS3A 1BBUA 1N36L 4GOPA 1PH2A 2HHHQ 1JE5A 1CSQA 2NN6I 5JEAJ 3H0GG 3J7ZC 1KIXA 4DAMA 1K9MC 2R7ZH 4DV0Q 2YU9H 3MEFA 2B63G 4BY1G 5C44G 3HKZE 3PIPA 4DKAC 2IHFA 3CCEA 3M4OH 2UXDQ 3RR5A 1EOVA 5BR8Q 5GAGC 1YVCA 3U50C 4X65L 1YBYA 4DV7L 4LF6L 5M3FG 1NJIC 4KLKA 2N8NA 2YYZA 4GNXA 1LM0A 2DGYA 3OTOL 4A3KG 4DV3L 1EUJA 2B29A 5IY0A 3J81c 1XMOL 1HNZL 4IJHA 4YHHQ 3S2DH 2YTVA 3A5UA 2OQKA 3NEMA 1Y14B 2IX0A 3PUZA 4IPGA 4LWCA 1VQJA 4DUYQ 1VQOA 3F1ZA 1YJNA 5AJ3Q 1Q86C 4YWMA 1VQ6A 4YCVA 3M4PA 3T1YL 2JA8H 5IP9G 2XTIA 2UXBQ 3BJUA 4O0AA 1PH7A 1JMCA 1ASZA 3KOJA 4TVAB 4LFAL 4BBSG 2F4VL 4WJ4A 4L5TA 2CQOA 3W1GA 1YI2A 4A3FG 1Q81C 1N32L 5JJLA 5IT9c 4B3MQ 1HNWL 3I55A 3HOZG 2QGQA 2WAQE 1GD7A 3PCOB 4LF9Q 4C3HH 2UXCQ 1HH2P 4DV6Q 1S72A 4JI2Q 2ZTEA 2E2HH 4DR1Q 3CXCA 1PHJA 1SRUA 1ASYA 2UUCL 4P73A 4C3IH 2ZJPA 1N8RC 3TS2A 2R93H 5C0XG 4QY7A 3AYHB 4DR2L 1VQLA 2OCEA 3HOXH 1Q46A 1KHIA 4JI4Q 1JT8A 4DUZQ 1PVOA 2GVBA 2Z6KC 3PO3G 4YY3L 3A0JA 4QL5A 4JI1L 2VS1A 3HOYH 4WJ3M 3HOVG 3CCUA 1NMFA 2AWNA 1SROA 5M5XH 4HIOA 2OTLA 2JJQA 2ZM6L 2NVXH 1EQQA 1E1OA 4JC0A 1X56A 2OQ0A 1S40A 4LUOA 2C35B 1V1QA 1WCMH 3K0XA 3KDFB 1UEBA 4AQYL 1KD1C 1SN8A 5M3MH 4DV4Q 1MKHA 1Z47A 2EXDA 5LMUQ 2PQAA 3I7FA 3E0EA 3L0OA 3J80i 2NVYH 4A3EG 2HHHL 5FJ8G 3PUYA 3TREA 2Q2HA 1LUZA 4DV7Q 4MTNA 3GTJH 2K5NA 4QGUA 3U58A 2VQFQ 2ZTCA 4DV0L 1VQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7Y B;  2YTY A;  4GLA C;  2R6G A;  3ULP A;  1IBK Q;  3PF4 A;  1Z9F A;  3CD6 A;  2WFW A;  5IP7 H;  1B70 B;  4HID A;  1IBL Q;  5BR8 L;  4B3S Q;  2UXD L;  1Q12 A;  5FLX c;  3ERS X;  2KHI A;  1GKH A;  4LFB Q;  1WI5 A;  2VW9 A;  2UUA Q;  3GTM H;  4A3L H;  3HKZ G;  1R9T H;  3NEL A;  4JV5 Q;  1VQB A;  4YHH L;  3NBH B;  1XPU A;  4UP7 A;  4JBK A;  3S1N H;  1VQP A;  4AIM A;  2R92 H;  3RNU A;  3CCM A;  4DR5 L;  1YHB A;  3F2D A;  3J81 j;  2A8V A;  1XNR Q;  2BH2 A;  1VQD A;  3F2B A;  4JI5 Q;  2UXB L;  4DV1 Q;  3UDX A;  4X6A H;  4UP8 A;  1JJ2 A;  1Y1V G;  2DUD A;  1LYL A;  2RCN A;  3JAM c;  1VQF A;  1E24 A;  3CC4 A;  4LF5 Q;  1X3E A;  3AFP A;  2B3G A;  4DK6 C;  1A8V A;  4J15 A;  1K73 C;  2E8G A;  2Y0S E;  4B3M L;  3J7A 5;  5JJK A;  4BBR H;  1UE5 A;  1X3G A;  5M5Y H;  1KQS A;  1BKB A;  4DV5 L;  1GVP A;  1WFQ A;  2PQA B;  2K14 A;  2AKW B;  4LF9 L;  2QA4 A;  3S14 H;  3I56 A;  1TWG H;  2UXC L;  4JI2 L;  1NE3 A;  4IO9 A;  2KCM A;  4X64 Q;  1QZG A;  3CCQ A;  4DR1 L;  4BXX H;  2JA9 A;  1FL0 A;  5LMN Q;  1K0R A;  1X3F A;  5FLM G;  2FXQ A;  2I5L X;  3MXN B;  3G71 A;  4ALP A;  1GM5 A;  4A3D H;  1Y1W H;  3AFQ A;  2JE6 I;  4JI4 L;  5IWA Q;  5LMN W;  1SMX A;  4DUZ L;  1PH4 A;  5DLQ E;  3UDG A;  3PO2 G;  5JJI A;  1PYS B;  3L2P A;  3I4M G;  3EN2 A;  4XIG S;  3STB D;  3GDE A;  2MNA A;  3HKS A;  4LNQ A;  4IPC A;  1E1T A;  3GD7 A;  4X62 Q;  3E9H A;  4HJ5 A;  3RZD H;  1YJW A;  1AH9 A;  1YHQ A;  2NVQ H;  3KJP A;  3OW2 A;  3S1M H;  4MNO A;  4PZ7 A;  3FKI G;  3DLL A;  4A3C H;  3FP9 A;  3RLN A;  2N49 A;  2D0O A;  1IL2 A;  3I4N H;  4DV4 L;  4A4I A;  2R7Z G;  1C0A A;  2VZA A;  5ELO A;  3CC7 A;  5LMU L;  1VQ4 A;  3CC2 A;  4LUZ A;  4IPD A;  4OON A;  5M5W H;  4JG2 A;  3PSI A;  5IYC H;  2D0P A;  4DPG A;  4LF4 Q;  1XPO A;  2VQF L;  1PYB A;  2N3S A;  4C2M H;  1OXT A;  4JI6 Q;  4A3G H;  1IBK L;  3KF6 A;  1J6Q A;  1J5E Q;  4DR6 Q;  1IBL L;  4B3S L;  3H3V I;  2IHE A;  2B63 H;  2YV5 A;  4PG3 A;  2JK8 A;  5C44 H;  4A3J G;  4LFB L;  1TXY A;  1YNX A;  3G48 A;  2KEN A;  4DR5 Q;  1EWI A;  1XPR A;  2HIV A;  4K0K Q;  2R7D A;  2UUA L;  4JOI C;  3D0F A;  1TWF H;  4R4C A;  1NBW A;  1N33 Q;  2ZTD A;  3CCJ A;  3K7A H;  4JV5 L;  5GAH C;  2JA7 G;  4A3K H;  3OYY A;  3AQQ A;  3UDF A;  4DAY B;  3UE1 A;  4AYB E;  3GTG H;  4A3M G;  1XNR L;  1MJE A;  2ASB A;  4OO1 G;  4JI8 Q;  2JA6 G;  1VCI A;  1I94 Q;  4JI5 L;  4DV5 Q;  1QUQ A;  3UDI A;  4DV1 L;  1EFW A;  1L1O A;  3K7U C;  4IPH A;  4HJ9 A;  1PFS A;  1RL2 A;  5IYB H;  4GOP B;  4B3T Q;  5GAE C;  2I5H A;  4IOC A;  2VY3 A;  4L5S A;  4GKJ Q;  5C4X H;  4NB3 A;  4QIW E;  2BH8 A;  2PMZ E;  4LF5 L;  1VQE A;  3EIV A;  1SLJ A;  2ALY B;  1EQR A;  4OXP A;  3KF8 B;  3Q8D A;  4A3F H;  1Q82 C;  1Q1B A;  1JJC B;  3HOX G;  4A93 G;  4X64 L;  3HOZ H;  2V1C C;  3STB C;  2NN6 G;  1M1K C;  4YWK A;  5LMN L;  1VQK A;  4JBW A;  3CQZ H;  4GNX B;  1SE8 A;  1PV4 A;  4PMW A;  3CCS A;  2LXK A;  2HQL A;  2Y0S G;  1K8A C;  1PH6 A;  5IWA L;  1KAW A;  4NXN Q;  1G29 1;  4YCW A;  1KRT A;  1L0W A;  3SGI A;  2A19 A;  3HOU H;  1BBW A;  1U5K A;  4YCU A;  1XTD A;  1SFO H;  4Y52 H;  4R1J A;  3PO3 H;  4KHZ A;  2I5M X;  4KHP Q;  4OX9 Q;  4X62 L;  5H1S E;  2AMC B;  3KJO A;  4IFD J;  1KC8 C;  2LSS A;  1XNQ Q;  1G6P A;  1N34 Q;  3HOV H;  2VUM G;  1IXR A;  4RG1 A;  2WB1 E;  2GN5 A;  4EQ5 A;  3CCV A;  3W1B A;  2MQH A;  5C3E H;  4HJ7 A;  4A76 A;  4GN4 B;  4KI0 A;  3T1H Q;  3S2H H;  1I5F A;  3M4Q A;  1PH3 A;  2ZJR A;  1UE1 A;  1IYJ B;  1K8G A;  4QJF A;  4A3I H;  4LF4 L;  3CP0 A;  3S17 H;  1PH8 A;  4GOP C;  1OTC A;  2CKZ B;  1FVI A;  1QVG A;  4A3E H;  5FJ8 H;  1VQC A;  4JI6 L;  1NMG A;  2LXJ A;  4R4Q A;  1J5E L;  1YJ9 A;  1CKO A;  4DR6 L;  2CWP A;  1AE3 A;  3AEV A;  1WYD A;  2IY5 B;  3G6E A;  3PUV A;  2R7F A;  4K0K L;  1TWC H;  3DM3 A;  3F8T A;  2JEA I;  5HGQ A;  1MJC A;  2VQE L;  1N33 L;  3J80 c;  4GNX C;  1CKM A;  1K83 H;  2AHO B;  3HOW G;  2F3I A;  4HJA A;  2IX1 A;  2VNU D;  3F2C A;  4TQU S;  4JI8 L;  1HZB A;  1XJV A;  2JA5 H;  4HJ8 A;  1I94 L;  2E5L L;  3S16 H;  4GKK Q;  2UU9 L;  1P16 A;  4POG A;  1VQ8 A;  3PF5 A;  4B3T L;  4BBR G;  4R4I A;  2N78 A;  3CCL A;  4LF8 Q;  4GKJ L;  3PGZ A;  2ZJQ A;  1Y1V H;  2PI2 E;  4UY8 C;  4MZ9 A;  1M90 C;  4OWW B;  2WAQ G;  1UWV A;  4HIK A;  1OXS C;  2AWO A;  1BVS A;  2Q2T A;  4BY7 H;  4GN5 A;  1I3Q H;  1YIT A;  1JJG A;  3BZK A;  4A3B H;  4APV A;  4DR3 Q;  4IFD I;  3RLO A;  5IYD H;  4X66 Q;  1IBM Q;  4DR7 Q;  1E3P A;  3ER0 A;  3LGJ A;  4H02 A;  4NXN L;  1YHA A;  2CWA A;  3K8A A;  5EAY A;  1NTG A;  4QQB X;  4LF7 Q;  5IE8 A;  1EYG A;  4JBM A;  1A62 A;  1VS0 A;  4A3C G;  1HJP A;  2KBN A;  2RF4 A;  3I4N G;  4KHP L;  4OX9 L;  3I4M H;  1IZ6 A;  4DV2 L;  4NXM L;  2YTX A;  3RLF A;  3I2Z A;  1XNQ L;  1N34 L;  2PNH A;  4NPS A;  4A75 A;  1W2B A;  3M7N A;  5IYC G;  3S15 H;  2BA0 A;  4JI0 Q;  3GTK H;  5GRO A;  3H0G H;  3T1H L;  1MIU A;  3FKI H;  4XTC S;  2ATW A;  4A3G G;  1PH9 A;  4BY1 H;  1X54 A;  3PV0 A;  2K75 A;  4LFC Q;  1FJG L;  5GQO A;  1VQN A;  3PIO A;  1W3S A;  1X65 A;  1HR0 Q;  2RHS B;  2MFI A;  2EQS A;  4R4O A;  1B8A A;  3B6Y A;  3BZC A;  2WB1 G;  2VQE Q;  1I6H H;  3A74 A;  3TS0 A;  1HR0 W;  5M3F H;  3CAM A;  2A1A A;  2JA8 G;  4OWT B;  2UUB Q;  1WJJ A;  1NY4 A;  1X55 A;  3HFZ B;  1FGU A;  4O2D A;  4RMF A;  1DGS A;  3W5O A;  4EX5 A;  4DR4 Q;  2HIX A;  4LW1 A;  3G4S A;  1KL9 A;  1OXU A;  2E5L Q;  2ES2 A;  2UU9 Q;  1CUK A;  3ICE A;  4A3J H;  3KDF A;  2E2J H;  1A0I A;  5GAD C;  2HT1 A;  5IP9 H;  5C4J H;  1EIF A;  2H5X A;  5IYB G;  4IJL A;  1JB7 A;  3RN5 A;  1X6O A;  3K80 C;  4BBS H;  1Q7Y C;  1HZA A;  1HNX Q;  2JA7 H;  3CME A;  4IOA A;  2R93 G;  4GKK L;  2QEX A;  3GTQ H;  5C4X G;  4JI3 Q;  1D7Q A;  4IFD G;  3M85 A;  4JI7 Q;  3GTO H;  2RHQ B;  3BU2 A;  4P72 A;  4A3M H;  1SR3 A;  4LF8 L;  2JA6 H;  2D62 A;  1VQ9 A;  3M3Y H;  5HY6 A;  1VQ5 A;  4HIM A;  3CW2 C;  3CCR A;  3ZJY C;  3FHW A;  3HOY G;  4GLV B;  1Q1E A;  1X9N A;  4JCV E;  3KF6 B;  1V43 A;  3CPF A;  4R4T A;  1XMQ Q;  2NVT H;  2IT1 A;  3EBE A;  4LUV A;  4Y7N H;  4AH6 A;  1QVF A;  1EIY B;  4JBJ A;  2MO1 A;  4BA1 I;  1PA6 A;  1WCM G;  4DR3 L;  3GTP H;  4B3R Q;  2K52 A;  3HOU G;  2OTJ A;  4X66 L;  5M3M G;  1IBM L;  1KRS A;  1P8L A;  4DR7 L;  4DV2 Q;  3S1R H;  1OXV A;  4UP9 A;  1YIJ A;  4NXM Q;  2JEB I;  1CSP A;  3K81 C;  3RN2 A;  4L5Q A;  3GTL H;  3RZO H;  4LF7 L;  1VQH A;  4JYA Q;  4A93 H;  1N36 Q;  1TWA H;  1UE7 A;  1L2F A;  1V9P A;  2CFM A;  2XGT A;  3KYH C;  3S24 A;  2JQO A;  5C3E G;  1QUQ B;  4PZ6 A;  3E9I A;  1L1O B;  1HZ9 A;  5IP7 G;  1FJG Q;  1UE6 A;  1CKN A;  1O7I A;  1PH1 A;  2Q2I A;  1Q8K A;  5C0X J;  4DK3 C;  4A3I G;  4JI0 L;  2KHJ A;  2Q2U A;  5ELN A;  2VUM H;  1YZ6 A;  4X65 Q;  3WWV A;  3PUX A;  3JAM i;  3U4V A;  3CMA A;  2K5H A;  4JOI A;  4LFC L;  4LF6 Q;  3H3V H;  4ME3 A;  3UE0 A;  1T9H A;  4A3L G;  5K36 G;  3ULL A;  2K4K A;  1HR0 L;  3OTO Q;  2R92 G;  4DV3 Q;  2CCZ A;  4L5R C;  3D31 A;  2NZO A;  1HZC A;  4P75 A;  3JC6 6;  3KLW A;  3TEH B;  1K3R A;  2F52 A;  1XMO Q;  1HNZ Q;  1KXL A;  1YEZ A;  4PZ8 A;  1C9O A;  3CPW A;  2UUB L;  4GN3 B;  3GO5 A;  2VL6 A;  2K50 A;  4DR4 L;  4C3J H;  1QZH A;  4DNI A;  1OXX K;  2WP8 J;  1QVC A;  3T1Y Q;  1WOC A;  1H95 A;  3TQY A;  2EIF A;  4LFA Q;  2F4V Q;  2JA5 G;  1C7Y A;  2L15 A;  5J3B A;  2MO0 A;  4BA2 I;  4DUY L;  1N32 Q;  2I0Q A;  5AJ3 L;  3U4Z A;  1E7Z A;  2Z6K A;  1N9W A;  1HNW Q;  4AYB G;  4GLX A;  1S3O A;  1HNX L;  4BXX G;  2Z0S A;  1AE2 A;  1RIP A;  2E2I H;  1U0L A;  2K5V A;  4JI3 L;  3ULJ A;  3HOW H;  4OO1 I;  5E7N A;  4A3D G;  4JI7 L;  3CF5 A;  3PUW A;  1Y1W G;  1VQI A;  2UUC Q;  3L7Z C;  1L1O C;  1GO3 E;  1VQA A;  3NEN A;  3M9B A;  1PH5 A;  4OWX B;  3IRB A;  4BY7 G;  1VQM A;  1CKN B;  4DR2 Q;  1I50 H;  4UPA A;  4A3B G;  4POF A;  1A63 A;  5IYD G;  2BA1 A;  4FDB A;  1XMQ L;  1TWH H;  4YY3 Q;  5JEA G;  4DV6 L;  5FLM H;  4JI1 Q;  2PI2 A;  2OWO A;  4P74 A;  4B3R L;  2KCT A;  1VQG A;  3J81 i;  1D8L A;  2GVA A;  3PO2 H;  3I4O A;  2ZM6 Q;  4P71 A;  1E22 A;  1G51 A;  3VDY A;  3TRZ A;  3A5Z B;  3KFU A;  4YWL A;  5C0X I;  3H15 A;  1LTL A;  3S1Q H;  4AQY Q;  2NZH A;  2ID0 A;  4JYA L;  4GS3 A;  1BBU A;  1N36 L;  4GOP A;  1PH2 A;  2HHH Q;  1JE5 A;  1CSQ A;  2NN6 I;  5JEA J;  3H0G G;  3J7Z C;  1KIX A;  4DAM A;  1K9M C;  2R7Z H;  4DV0 Q;  2YU9 H;  3MEF A;  2B63 G;  4BY1 G;  5C44 G;  3HKZ E;  3PIP A;  4DKA C;  2IHF A;  3CCE A;  3M4O H;  2UXD Q;  3RR5 A;  1EOV A;  5BR8 Q;  5GAG C;  1YVC A;  3U50 C;  4X65 L;  1YBY A;  4DV7 L;  4LF6 L;  5M3F G;  1NJI C;  4KLK A;  2N8N A;  2YYZ A;  4GNX A;  1LM0 A;  2DGY A;  3OTO L;  4A3K G;  4DV3 L;  1EUJ A;  2B29 A;  5IY0 A;  3J81 c;  1XMO L;  1HNZ L;  4IJH A;  4YHH Q;  3S2D H;  2YTV A;  3A5U A;  2OQK A;  3NEM A;  1Y14 B;  2IX0 A;  3PUZ A;  4IPG A;  4LWC A;  1VQJ A;  4DUY Q;  1VQO A;  3F1Z A;  1YJN A;  5AJ3 Q;  1Q86 C;  4YWM A;  1VQ6 A;  4YCV A;  3M4P A;  3T1Y L;  2JA8 H;  5IP9 G;  2XTI A;  2UXB Q;  3BJU A;  4O0A A;  1PH7 A;  1JMC A;  1ASZ A;  3KOJ A;  4TVA B;  4LFA L;  4BBS G;  2F4V L;  4WJ4 A;  4L5T A;  2CQO A;  3W1G A;  1YI2 A;  4A3F G;  1Q81 C;  1N32 L;  5JJL A;  5IT9 c;  4B3M Q;  1HNW L;  3I55 A;  3HOZ G;  2QGQ A;  2WAQ E;  1GD7 A;  3PCO B;  4LF9 Q;  4C3H H;  2UXC Q;  1HH2 P;  4DV6 Q;  1S72 A;  4JI2 Q;  2ZTE A;  2E2H H;  4DR1 Q;  3CXC A;  1PHJ A;  1SRU A;  1ASY A;  2UUC L;  4P73 A;  4C3I H;  2ZJP A;  1N8R C;  3TS2 A;  2R93 H;  5C0X G;  4QY7 A;  3AYH B;  4DR2 L;  1VQL A;  2OCE A;  3HOX H;  1Q46 A;  1KHI A;  4JI4 Q;  1JT8 A;  4DUZ Q;  1PVO A;  2GVB A;  2Z6K C;  3PO3 G;  4YY3 L;  3A0J A;  4QL5 A;  4JI1 L;  2VS1 A;  3HOY H;  4WJ3 M;  3HOV G;  3CCU A;  1NMF A;  2AWN A;  1SRO A;  5M5X H;  4HIO A;  2OTL A;  2JJQ A;  2ZM6 L;  2NVX H;  1EQQ A;  1E1O A;  4JC0 A;  1X56 A;  2OQ0 A;  1S40 A;  4LUO A;  2C35 B;  1V1Q A;  1WCM H;  3K0X A;  3KDF B;  1UEB A;  4AQY L;  1KD1 C;  1SN8 A;  5M3M H;  4DV4 Q;  1MKH A;  1Z47 A;  2EXD A;  5LMU Q;  2PQA A;  3I7F A;  3E0E A;  3L0O A;  3J80 i;  2NVY H;  4A3E G;  2HHH L;  5FJ8 G;  3PUY A;  3TRE A;  2Q2H A;  1LUZ A;  4DV7 Q;  4MTN A;  3GTJ H;  2K5N A;  4QGU A;  3U58 A;  2VQF Q;  2ZTC A;  4DV0 L;  1VQ7 A; 
#chains in the Genus database with same CATH topology
 4QMG A;  1EEI D;  2YTY A;  4GLA C;  1K8M A;  3ULP A;  1EU3 A;  1Y1W B;  5KNB A;  5FOB B;  2PZT A;  1Q12 A;  1S5C D;  1GKH A;  1C8C A;  1WI5 A;  2MJ8 A;  2BDN A;  2KCC A;  1R9T H;  4JV5 Q;  2LFN A;  1VQB A;  3SR1 A;  4YHH L;  1RCV D;  2EYJ A;  3CCM A;  3T53 B;  4WRD A;  2BH2 A;  2KEE A;  1O7Y A;  1QCB D;  1TQO A;  4X6A H;  1SYB A;  4UP8 A;  1Y1V G;  2JYO A;  4B3M L;  4J15 A;  3J7A 5;  4N8X 1;  2Y0S E;  3QR8 A;  1WTX A;  3VYT A;  4IUT A;  4LF9 L;  2PQA B;  4G57 A;  2UXC L;  1TWG H;  4JI2 L;  4IO9 A;  2KCM A;  1RKN A;  4DR1 L;  5T1G A;  5LMN Q;  1K0R A;  1X3F A;  2I5L X;  3R3O A;  4MTK A;  4ALP A;  1Y1W H;  4KKT A;  4JI4 L;  5IOC A;  1PH4 A;  1SMX A;  4DUZ L;  1PYS B;  3FPU B;  2M9V A;  2B8G A;  1H9M A;  3EN2 A;  4XIG S;  3STB D;  2EE1 A;  1D2B A;  1DXM A;  3R8B A;  1E2W A;  1E1T A;  3GD7 A;  4IPC A;  4UDU C;  1YJW A;  1F2L A;  1YHQ A;  2LKV A;  2E2D C;  4MNO A;  3DLL A;  2N49 A;  1IL2 A;  4HSP A;  4DV4 L;  4RGT A;  3CC2 A;  2F0K A;  2LMC B;  4IUQ A;  3SEB A;  2ZXR A;  5JPN C;  3PSI A;  4LF4 Q;  2D0P A;  4DPG A;  3P7J A;  4KD4 A;  4IUN A;  2D5D A;  1SND A;  3CQZ B;  5J1Z A;  4JI6 Q;  3NE5 B;  4DR6 Q;  4JW0 A;  3G48 A;  3HRZ C;  3TP7 A;  1E2Z A;  2UUA L;  4JOI C;  1BR9 A;  1DJR D;  2SOB A;  2Z1C A;  5GAH C;  3NWS A;  3UDF A;  1AP0 A;  1XNR L;  2K05 A;  2NWG A;  3UDI A;  4DGZ A;  3K7U C;  1F9P A;  1PFS A;  1EQV A;  1T5E A;  2NB0 A;  1CZG A;  4QIW E;  2IPK D;  2BH8 A;  2PMZ E;  4LF5 L;  1VQE A;  4HCS A;  1GUO A;  1BCP F;  1NR4 A;  3H91 A;  3DWP A;  1I4P A;  4IFD H;  2ALY B;  1EQR A;  1ILP A;  3Q8D A;  1Q82 C;  3NQT A;  3OW7 A;  3CQZ H;  1Y8O B;  5IT9 E;  1LO5 D;  1BCP D;  2LXK A;  1PH6 A;  4M8A A;  4YCW A;  2OF1 A;  1U4P A;  1BBW A;  2A68 C;  4QF4 A;  3ONA B;  2B2Y A;  3SE0 A;  2A5H A;  5H1S E;  2VB3 X;  4X62 L;  3KJO A;  4XXE A;  1XNQ Q;  1EZ8 A;  1G6P A;  1S4Z A;  3PQI A;  5ELE A;  4EQN A;  1IXR A;  2Z4I A;  1V1O A;  1HFN A;  3T1H Q;  2PW5 A;  1PH3 A;  1JWM D;  3URY A;  1UE1 A;  1IYJ B;  3SVM A;  4QJF A;  1K8G A;  3CP0 A;  4A3B B;  1FVI A;  1QJO A;  1EIG A;  4JVZ A;  3VR5 A;  1NMG A;  4C3J G;  5K36 H;  2RDH A;  2JSO A;  3P75 A;  3EVQ A;  1WYD A;  2Z8L A;  3D8G A;  3DM3 A;  4N8F A;  5HGQ A;  3QG1 A;  3KBG A;  1G2S A;  2MHV A;  3WOF A;  2F3I A;  3HOW G;  1NUC A;  1CQV A;  3H0G B;  1FNV A;  4FVM A;  4JI8 L;  3FKI B;  4RFB A;  1I94 L;  1JC7 A;  4X3K A;  3HS0 C;  2FHT A;  5FO9 B;  4BBR G;  4R4I A;  4FO2 A;  3PGZ A;  2ZJQ A;  5DM6 3;  2PI2 E;  2ICE C;  3CRK C;  1M90 C;  1UWV A;  4H13 C;  2AWO A;  1YIT A;  2EZV A;  4H7B A;  4A3B H;  2H4O A;  1WTH A;  3RLO A;  4IUP A;  4A3J B;  1IBM Q;  3IL8 A;  3OHX C;  3K59 A;  4DR7 Q;  1GJX A;  3ER0 A;  1HRJ A;  3NTK A;  3K8A A;  2CWA A;  4IQZ A;  5C4J B;  2RSO A;  2BDO A;  2J0T D;  3I4N G;  3G7L A;  4KHP L;  4A3M B;  2IL8 A;  4CJ1 B;  3GQB A;  3RLF A;  3I2Z A;  4ID6 A;  5CGK A;  2JA6 B;  5IYC G;  3M4Y A;  3CKI B;  3J81 L;  2EVB A;  3H0G H;  5I6W A;  3FKI H;  4FNF A;  4RKL A;  4JPB W;  1X54 A;  3PV0 A;  4GZY C;  1CT1 D;  5DEH A;  1W3S A;  3GTP B;  2EQS A;  5FK9 C;  2QIL A;  3B6Y A;  3BZC A;  2Z6B A;  2WB1 G;  2KEC A;  2G5D A;  4HN7 A;  1HR0 W;  2A1A A;  1OO9 B;  2SNM A;  4OWT B;  2UUB Q;  3HZX A;  1NY4 A;  2F0D A;  1QNK A;  1RHP A;  4EX5 A;  3C3L A;  4A93 B;  2Q8R E;  2E5L Q;  2ES2 A;  4ILW A;  1NSN S;  4A3J H;  3KUP A;  2HT1 A;  5C4J H;  5IYB G;  4CDE C;  1X6O A;  1II3 A;  4IOA A;  4YIJ A;  2QEX A;  4JI3 Q;  4A3M H;  2CVR A;  1D1I A;  2JA6 H;  2D62 A;  5EKL A;  1SE2 A;  5HY6 A;  4HIM A;  1MD2 D;  3CCR A;  3ZJY C;  3FHW A;  1EYA A;  1Q1E A;  4JCV E;  4LUV A;  3EBE A;  2RA4 A;  4AH6 A;  2D9U A;  1PA6 A;  2MO1 A;  4BA1 I;  3GTP H;  4N9T A;  4X66 L;  5M3M G;  1KRS A;  4B08 A;  3NBH A;  2B2V C;  4DV2 Q;  4NXM Q;  2XIW A;  2JEB I;  2F0J A;  4QUC A;  1VQH A;  4UHV A;  4A93 H;  1A3V A;  2E2I B;  4RGN A;  1L2F A;  3C1F A;  4CKB A;  3S24 A;  1H9R A;  1L1O B;  4K6D A;  3NSW A;  1FJG Q;  1O7I A;  1Q8K A;  1GUW A;  4JI0 L;  1SEB D;  1ZEQ X;  4LJZ C;  1ICW A;  5CC4 A;  1B3A A;  3PUX A;  4DF7 A;  3FEW X;  4LFC L;  4EQP A;  1JQY D;  1HR0 L;  2EDG A;  3MXN A;  2WAQ B;  3NQI A;  1GOZ A;  4IUU A;  4L5R C;  3D31 A;  4P75 A;  5DAU A;  1D6E C;  3T51 B;  5CYU A;  4J6H A;  4DR4 L;  4OHJ A;  4OIK A;  3I8Z A;  3BZD B;  4DNI A;  1OXX K;  2WP8 J;  3T1Y Q;  2CW0 C;  1EYD A;  3QOJ A;  1FYC A;  3TQY A;  1HQM C;  2EIF A;  4LFA Q;  2R7Z B;  1C7Y A;  2YU9 B;  1EIH A;  2B8F A;  3VA7 A;  4BA2 I;  1N32 Q;  1H9S A;  5JVH 3;  1E7Z A;  2Z6K A;  3M4O B;  4GLX A;  1S3O A;  4BXX G;  3M7G A;  2E2I H;  1U0L A;  2K5V A;  1B50 A;  4A3D G;  4JI7 L;  1SNQ A;  1TS5 A;  1L1O C;  1GO3 E;  3M9B A;  4OWX B;  4BY7 G;  4CGY B;  4FDB A;  4YY3 Q;  4DV6 L;  4V0B A;  4JI1 Q;  1PYW D;  1DOM A;  2OWO A;  1VQG A;  5K5P A;  4CKC A;  3A5Z B;  4YWL A;  5C0X I;  3VR2 A;  1TS4 A;  1B9N A;  2F1M A;  1LT5 D;  5D65 A;  2NZH A;  2Q8I B;  1BBU A;  1I4H A;  4C3H B;  2HUG A;  1CSQ A;  1V1P B;  2NN6 I;  1PTO F;  2E2H B;  3TDQ A;  1K9M C;  2R7Z H;  3X3M A;  1WTO A;  2YU9 H;  1IYV A;  1NR2 A;  4BY1 G;  1A2U A;  2IHF A;  3M4O H;  1J9O A;  1YVC A;  3U50 C;  4X65 L;  1YBY A;  1STN A;  1BDO A;  3SXH A;  1PTO D;  5M5X B;  1SJE D;  1LM0 A;  3TBI B;  3OTO L;  3E0J A;  2B29 A;  2Z4H A;  2DY8 A;  1XMO L;  4IJH A;  4YHH Q;  3PUZ A;  1VQJ A;  5KND A;  3F1Z A;  1IHZ A;  5AJ3 Q;  1U4L A;  4P2C B;  4YWM A;  3UI2 A;  4ZRZ A;  5IP9 G;  3MWY W;  1LTG D;  3KOJ A;  4BBS G;  2F4V L;  2CQO A;  3W1G A;  1YI2 A;  1VMC A;  4B3M Q;  3IKJ A;  3I55 A;  2QGQ A;  4G7O C;  3PCO B;  4LF9 Q;  3FRP B;  4C3H H;  3MEH A;  2UXC Q;  1S72 A;  4HED A;  4JI2 Q;  2E2H H;  1CZW A;  4DR1 Q;  2UUC L;  3TS2 A;  4P73 A;  2QF7 A;  2DNE A;  3DHQ A;  4QY7 A;  2OCE A;  1JR0 D;  3TP6 A;  1KHI A;  4JI4 Q;  3FPP A;  4DUZ Q;  2R92 B;  2VB2 X;  1NMF A;  5KRU A;  1SRO A;  5M5X H;  1EQQ A;  5HGT A;  4LUO A;  2C35 B;  1V1Q A;  1UEB A;  4DV4 Q;  1Z47 A;  2F0S A;  4A3E G;  2HHH L;  1W6K A;  2R61 A;  4OEM B;  5C6A A;  5I6Y A;  2ZTC A;  5IGD A;  1LT3 D;  4DXF A;  3CD6 A;  5IP7 H;  1B70 B;  5FLX c;  1KDA A;  2EYP A;  3ERS X;  4QIW B;  2PMZ B;  1K8O A;  5COY A;  3I91 A;  3BDC A;  4OIJ A;  2VW9 A;  2UUA Q;  3RZD B;  4A3L H;  4F8M A;  3HKZ G;  3S1M B;  1XPU A;  4UP7 A;  2R92 H;  5KIX A;  1YHB A;  1XNR Q;  2TMP A;  1VF7 A;  2UXB L;  3D4R A;  4DU9 A;  2DUD A;  5M9O A;  1VQF A;  4FXD A;  1E24 A;  2XWB B;  5NUC A;  4LF5 Q;  4DK6 C;  2B3G A;  1A8V A;  1U4M A;  1X3G A;  1U9R A;  2B63 B;  1GVP A;  1VF5 C;  1WFQ A;  5C44 B;  3I56 A;  1NE3 A;  3E6Z X;  1FL0 A;  1QB5 D;  5EGT A;  1TWF B;  2HDL A;  2O5J C;  3G71 A;  1ONL A;  2NTT A;  2JE6 I;  4XYO A;  4HMI A;  4ZUJ A;  5JJI A;  3L2P A;  3I4M G;  3K5M A;  5C5L A;  3F2U A;  1TY2 A;  3HKS A;  3RZD H;  4X62 Q;  3KJP A;  3S1M H;  4N9P A;  5C4X B;  5EBC A;  3RLN A;  5BN4 A;  5I4D A;  1C0A A;  3FDT A;  5ELO A;  3KF8 A;  5JVG 3;  4LUZ A;  4IPD A;  3HOZ B;  3RD4 A;  2VQF L;  1PYB A;  2XN9 C;  3LX0 A;  2N3S A;  3LWE A;  1OXT A;  1E2V A;  3KF6 A;  1IBL L;  4B3S L;  3W2D A;  3H3V I;  4TKO B;  2B63 H;  5C44 H;  4LFB L;  4DR5 Q;  1SFO B;  1QG7 A;  4NDX A;  1HA6 A;  3PO3 B;  3R2I A;  1T5X D;  2KHS A;  1TWF H;  1TII D;  5C5M A;  3HOV B;  2JA7 G;  4ZCK A;  4DAY B;  3MTS A;  4KK7 A;  4OO1 G;  3S2H B;  4JI8 Q;  1VCI A;  1I94 Q;  4DV5 Q;  1QUQ A;  2L9H A;  4DV1 L;  1EFW A;  4A3I B;  1GXD C;  5IGB A;  4HJ9 A;  2F3V A;  3S17 B;  5COR A;  5BN3 A;  4PV1 C;  1GUT A;  5C4X H;  4C3I G;  5CV4 A;  1Q1B A;  1JJC B;  4XYQ A;  4X64 L;  3HOZ H;  3STB C;  2NN6 G;  2F0T A;  4GNX B;  1XYI A;  1PV4 A;  1BXT A;  4E6I A;  3T4A C;  1E0B A;  1K83 B;  1KAW A;  1KRT A;  2E74 C;  5C0X H;  3HOU H;  4QB4 A;  1LLR D;  1HQR D;  2F0Q A;  1U5K A;  4YCU A;  1SFO H;  3E5S A;  3PO3 H;  2M00 A;  4KHZ A;  4KHP Q;  1KNE A;  3C1E A;  2LSS A;  3HOV H;  4FYD A;  1CTM A;  1Y1V B;  2ENB A;  3CCV A;  4A76 A;  3H94 A;  4GN4 B;  3S2H H;  3SDZ A;  1I5F A;  1SYD A;  3M4Q A;  1A2T A;  4A3I H;  3S17 H;  3QB3 A;  1ZKO A;  3I4L A;  1HFG A;  5FJ8 H;  3L9A X;  5FKA C;  2LXJ A;  1EEF D;  2QCP X;  2IY5 B;  3KK7 A;  2C5C A;  2A6E C;  1N33 L;  3J80 c;  4GNX C;  1JE4 A;  1CKM A;  5KYI A;  1F9R A;  1K83 H;  2B2W A;  5JOB A;  4FXG C;  4HTH A;  3F2C A;  5A2Q L;  3GTK B;  4MN3 A;  2GA4 B;  2IW3 A;  1D5X C;  2UU9 L;  1P16 A;  2CHB D;  5KNC A;  5EPL A;  1CA5 A;  4GKJ L;  2M2L A;  2SNS A;  4IN3 A;  1KAB A;  3QIA A;  4KHV A;  1GHJ A;  1Y1V H;  1ZYR C;  2FMC A;  3CU7 A;  2Q2T A;  4F88 A;  1QWY A;  1JOR A;  5IYD H;  3JAM E;  2K1B A;  4X66 Q;  5JEA H;  1MSG A;  1KLG D;  2N55 A;  3HEJ A;  3LGJ A;  2E2J B;  4NXN L;  3OPO A;  3K57 A;  1NTG A;  2NBF A;  2BE5 C;  5IE8 A;  1SNC A;  3NTI A;  1EYG A;  1JIC A;  1PDQ A;  3DUZ A;  2A74 C;  3GP7 A;  4OX9 L;  1IZ6 A;  2PNH A;  3M3Y B;  3N52 A;  2XRS D;  2BA0 A;  4JI0 Q;  4K6L A;  4EGV A;  3GTK H;  5E3F A;  2SDF A;  4LFC Q;  2K75 A;  1F2Y A;  5GQO A;  3CHB D;  1HR0 Q;  2BOS A;  2MFI A;  3IFD A;  1NCV A;  4R4O A;  5CV5 A;  5ELD A;  4U67 3;  2DJF C;  4ZAI A;  2VQE Q;  3A74 A;  3TS0 A;  3GTL B;  2JA8 G;  3RZO B;  1WJJ A;  3HFZ B;  4ZYS A;  4RMF A;  4DR4 Q;  1DGS A;  2MGS A;  2HIX A;  4I65 A;  1KL9 A;  4RH6 A;  1CUK A;  3V96 A;  4LAA A;  3QO2 A;  4XT1 B;  2E2J H;  2JXM B;  5EPK A;  5LL6 X;  3NWT A;  1YNJ C;  2EY5 A;  2WV6 D;  1O80 A;  4IFD G;  1WVL A;  4JI7 Q;  2RHQ B;  1EU4 A;  4LF8 L;  1BBX C;  3M3Y H;  1VQ5 A;  4XQQ A;  3HOY G;  1ICF B;  2DY7 A;  4R4T A;  2IT1 A;  2PO4 A;  1D5M C;  3KLS X;  4ME5 A;  4C3J B;  1QVF A;  2F0I A;  1WCM G;  4PQX A;  2K52 A;  1EY6 A;  3SHL A;  1P8L A;  2X6L A;  2HDM A;  3GTL H;  3RZO H;  1LT6 D;  3Q0A A;  2PYK A;  4IZ8 A;  4CJ0 B;  4C56 C;  3HOW B;  5FLX L;  2CFM A;  1JWU D;  2JQO A;  1CKN A;  2Q2I A;  5C0X J;  4DK3 C;  1I50 B;  2KHJ A;  2Q2U A;  5ELN A;  1TWH B;  4J8Q A;  2EPB A;  4X65 Q;  4Y52 H;  2F0P A;  2K01 A;  3U4V A;  4JOI A;  5K36 G;  3H3V H;  2O4X A;  3UE0 A;  1RF2 D;  3H3V C;  3ULL A;  1JOO A;  1X3P A;  3OTO Q;  2F0U A;  3PO2 B;  2CCZ A;  5IGG A;  3JC6 6;  1XMO Q;  1K3R A;  1TS2 A;  1S5B D;  3CPW A;  2VXW A;  4C3J H;  2R3Z A;  1QVC A;  3T56 B;  2WIN B;  2RCF A;  3NHH A;  3MVV A;  5EKK A;  2F4V Q;  2RSN A;  5J3B A;  2MO0 A;  1PFN A;  4AYB G;  3A7L A;  1B9M A;  4S3S A;  1RIP A;  3HOW H;  1STB A;  1EFI D;  1I4X A;  3PUW A;  3U9S A;  2A6H C;  3WDN A;  1VQI A;  2UUC Q;  2FIN B;  3NEN A;  3IRB A;  1SNM A;  1VQM A;  1I50 H;  4Q5V A;  4A3B G;  2F0E A;  4DNT B;  1JWS D;  1TWH H;  5ISR A;  5FLM H;  1ENC A;  3R93 A;  1U4R A;  4P74 A;  4B3R L;  2KCT A;  3J81 i;  1D8L A;  1SMY C;  2GVA A;  2K5Q A;  3PO2 H;  1X3Q A;  1E22 A;  3TRZ A;  1QE6 A;  2ZXO A;  4O1N A;  2PCF B;  1N36 L;  1EZ6 A;  1MBY A;  3TN2 A;  2HHH Q;  1JE5 A;  3X3N A;  1KTK A;  3A55 A;  5JEA J;  3H0G G;  3J7Z C;  1KIX A;  4ZQ3 A;  1EWH A;  1S5F D;  4RHS A;  4KKS A;  3HOX B;  1Q3L A;  1FGB D;  1LTA D;  2A68 D;  3RR5 A;  3WOE A;  4DA2 A;  5GAG C;  4DV7 L;  1AZP A;  2A69 C;  4KLK A;  2YYZ A;  4KY6 A;  2DGY A;  4A3K G;  3MXG A;  2YTV A;  3A5U A;  2OQK A;  2KOL A;  5M3M B;  4IPG A;  2XRQ D;  4DUY Q;  1Q86 C;  1SXT A;  1VQ6 A;  1CI3 M;  2UXB Q;  1SYF A;  1PH7 A;  1ASZ A;  1HUN A;  1XXG A;  4L5T A;  2O2L D;  2ZT9 C;  1RDP D;  2I07 B;  4A3F G;  1Q81 C;  1ESR A;  5IT9 c;  2EY6 A;  1HNW L;  1KLU D;  3E3X A;  2EXZ A;  1K0S A;  1C4Q A;  1IL8 A;  3D6W A;  1A6X A;  1PRT B;  1C48 A;  1B3Q A;  2PW7 A;  4DR2 L;  1VQL A;  3HOX H;  1PZK D;  2KJX A;  3S1N B;  4NKL A;  2Z6K C;  4R8I A;  4F87 A;  3I3C A;  1EOT A;  4WJ3 M;  1Y69 U;  2AWN A;  5FO7 B;  2OTL A;  2ZM6 L;  1E1O A;  4A93 G;  3KDF B;  3VA5 A;  3BS1 A;  4AQY L;  2EYF A;  5M3M H;  5M5Y B;  2EXD A;  3ERQ A;  3J80 i;  3KLR A;  4MTN A;  4QGU A;  3MHB A;  2VQF Q;  3U58 A;  3NPP A;  1B7Y B;  2RKS A;  4A3D B;  2R6G A;  2F0F A;  1Z9F A;  3PF4 A;  2FJ2 A;  3J80 L;  2WFW A;  2UXD L;  1IBL Q;  4B3S Q;  5BR8 L;  3IFT A;  4LFB Q;  1LTB D;  3Q24 A;  1PRT C;  2NVQ B;  3NEL A;  5I2Y A;  1IW7 C;  4RKB A;  3TZU A;  1AFP A;  4JBK A;  3S1N H;  4AIM A;  4K2K A;  5ELF A;  2A8V A;  5M5W B;  4DV1 Q;  3UDX A;  2I46 A;  1LYL A;  5G3L F;  4C2M B;  5IGF A;  5KYL A;  3QOL A;  3CC4 A;  4A3G B;  5FLX E;  2EY2 A;  4K5X A;  1Z6H A;  1UE5 A;  5M5Y H;  1BKB A;  3U9O A;  5DNF A;  1WTQ A;  4OO1 I;  4BY1 B;  1HPC A;  1QZG A;  4X64 Q;  5JPM C;  4BXX H;  2B2V A;  2F0W A;  5G3L D;  2FXQ A;  4A3D H;  3K7A B;  2EYM A;  3AFQ A;  1G8Z D;  1SYE A;  1KDB A;  4DAP A;  2LY7 A;  3DM1 A;  2RBM A;  4LMQ D;  1S5E D;  3GTG B;  4K5W A;  1EQT A;  3VR6 A;  1CM9 A;  1PFB A;  4DNR B;  1AH9 A;  3E9H A;  2PZU A;  1GHK A;  2NVQ H;  3ERO A;  3OW2 A;  4A3C H;  5AFW A;  3FMC A;  2D0O A;  3ITP A;  4ZK9 B;  4J1M A;  4A4I A;  2J7Z A;  2R7Z G;  2VZA A;  3CC7 A;  5LMU L;  4OON A;  3TP8 A;  5M5W H;  2F0L A;  2ICI A;  4JG2 A;  2OXP A;  1LT4 D;  1KDC A;  4KD3 A;  2N88 A;  4C2M H;  3MFY A;  3K5O A;  4A3G H;  1IBK L;  3OIQ A;  1STA A;  2IHE A;  1DM0 B;  2K7V A;  5EJW A;  1TXY A;  2A73 B;  1EWI A;  2QW7 A;  4FP5 D;  2R7D A;  2F0M A;  1LAB A;  4R4C A;  1QOH A;  5D3I B;  3AU7 A;  1NBW A;  1N33 Q;  3CCJ A;  3RUZ A;  1QIL A;  3K7A H;  2B2T C;  4R8N A;  4FXK C;  1PFM A;  3OYY A;  1WTR A;  4AYB E;  5C3E B;  5JAV A;  3GTG H;  2ASB A;  5L37 A;  4JI5 L;  4EVO A;  2E75 C;  1L1O A;  1Q90 A;  4GOP B;  1RL2 A;  3QWN A;  2EYO A;  2JP1 A;  3BVG A;  4IOC A;  2VY3 A;  3J81 E;  4A3E B;  4GKJ Q;  1EY5 A;  1SLJ A;  3OMC A;  2CW0 D;  1LAC A;  4OXP A;  3KF8 B;  2L4N A;  1VQK A;  1BOS A;  4PMW A;  2HQL A;  2Y0S G;  4NXN Q;  5IWA L;  1Y8N B;  1G29 1;  2IWH A;  4CDD C;  3SGI A;  1A3U A;  2F4I A;  2JA5 B;  4R1J A;  3H6M A;  3QJY A;  3K5N A;  2B2U C;  1ROD A;  4OX9 Q;  4C1N I;  4ABN A;  4UAI A;  1KC8 C;  1O78 A;  4PMC A;  2VUM G;  4RG1 A;  2WB1 E;  2GN5 A;  4EQ5 A;  3AB9 A;  2MQH A;  5C3E H;  1HTP A;  4KI0 A;  3VYR A;  2ZJR A;  2RDF A;  4MHE A;  3KBX A;  4GOP C;  1OTC A;  1F77 A;  2CKZ B;  4L6T B;  4A3E H;  1PZI D;  1J5E L;  1YJ9 A;  1CKO A;  2K5W A;  3BYT B;  3AEV A;  2J4X A;  2L55 A;  2R7F A;  4K0K L;  1XX8 A;  3BDL A;  4TRD A;  2NTS A;  3F8T A;  1MJC A;  1RTO A;  3I4M B;  4K2L A;  1MGS A;  1BNZ A;  3D4D A;  2IX1 A;  4ODG A;  3A7A B;  2JA5 H;  4HJ8 A;  1V1P A;  2E5L L;  4OEL B;  4POG A;  1VQ8 A;  4B3T L;  4KKU A;  2N78 A;  3CCL A;  5ELB A;  5CV6 A;  4LF8 Q;  4DXG A;  1DCZ A;  5M3F B;  4MZ9 A;  4OWW B;  2EYL A;  4RGO S;  1F9Q A;  1JJG A;  5EKI A;  2HCC A;  3BZK A;  3DMU A;  3J80 E;  4IFD I;  1RJT A;  2QDL A;  4RA8 A;  3VR3 A;  3EFX D;  4H02 A;  3LNN A;  2G9H D;  4QQB X;  5A35 A;  1VS0 A;  2JA7 B;  5CR3 A;  3GTQ B;  3K6O A;  2TSS A;  1HJP A;  3GTO B;  4G4K A;  3I4M H;  4DV2 L;  4NXM L;  1ML0 D;  2X69 A;  3OOC A;  1N34 L;  4NPS A;  3M7N A;  4A75 A;  1JOQ A;  1AEX A;  4DFA A;  2F3W A;  1F2M A;  4Q0F A;  5GRO A;  1NAP A;  1MIU A;  1GUN A;  4XTC S;  2ATW A;  2NVT B;  1FR3 A;  1STY A;  1VQN A;  1FJG L;  2F0N A;  1F9S A;  2RHS B;  1UEA B;  5C4H A;  5EPJ A;  1UAP A;  1G6Z A;  2RQX A;  2JN4 A;  5M3F H;  3CAM A;  3MXU A;  4RCO A;  3OSO A;  3OWE B;  1STH A;  5IT9 L;  4O2D A;  1LTI D;  1ILQ A;  4M1U B;  2SEB D;  3ICE A;  3MFG A;  4G7Z C;  1SJH D;  1CHP D;  4B9W A;  4ZLT F;  1EIF A;  2KCN A;  4IJL A;  5C4X G;  2K03 A;  2JA7 H;  3EA6 A;  2R93 G;  4GKK L;  3GTQ H;  1D7Q A;  4EQO A;  4FF3 A;  3GTO H;  4OO1 H;  2NYZ D;  1SR3 A;  2KED A;  2WKC A;  3CW2 C;  1HCZ A;  4GLV B;  1X9N A;  2HQE A;  3CPF A;  4CKE A;  2NVT H;  4LK1 C;  1TVX A;  1B53 A;  1EIY B;  3SK4 A;  1G2T A;  4DR3 L;  1BUV T;  4B3R Q;  3HOU G;  3PMF A;  5T1I A;  4IUR A;  1PXU A;  2NZ1 D;  1OXV A;  3NTH A;  1YIJ A;  2AQ1 B;  4KY5 A;  3RN2 A;  2NN6 H;  4LF7 L;  3TZD A;  1BCP B;  3BG3 A;  1N36 Q;  3DWA A;  1V9P A;  2XGT A;  3KYH C;  1G91 A;  2H1E A;  5D14 A;  1UE6 A;  1PH1 A;  4A3I G;  3PIP 3;  3SK6 A;  3WWV A;  1S5D D;  2K4K A;  5E1F A;  1CK1 A;  5C3X A;  2NZO A;  2PZW A;  2QKI C;  3TEH B;  1KXL A;  1YEZ A;  3BVZ A;  1HXY D;  1MI2 A;  4PZ8 A;  4GN3 B;  2EY1 A;  2VL6 A;  2EJM A;  1QZH A;  3SK5 A;  2I0Q A;  5AJ3 L;  1HNW Q;  4WJW A;  2DJG C;  4HMJ A;  1HNX L;  1SAP A;  2Z0S A;  3ZYY X;  1BCP C;  1VMP A;  1EL0 A;  5E7N A;  4U68 A;  3CF5 A;  1Y1W G;  2KVM A;  3L7Z C;  1PH5 A;  3A8K E;  1B4O A;  1STE A;  1CKN B;  4DR2 Q;  2WKD A;  4POF A;  3S2D B;  1A63 A;  4MIU A;  5IYD G;  2HCI A;  4KTA A;  4K5V A;  4CDC C;  1FNW A;  5JEA G;  1XMQ L;  2PI2 A;  4K8I A;  2JA8 B;  3P20 A;  2ZM6 Q;  1O7L A;  4P71 A;  3KFU A;  3LWU A;  1LTL A;  3TSS A;  4DAY A;  4IAL A;  4AQY Q;  2WAC A;  3NXW A;  4JYA L;  2AUJ D;  4GS3 A;  1Z7T A;  2PNR C;  2CH4 W;  4NP5 A;  1PH2 A;  4NMZ A;  1Y8P B;  3I70 A;  3OIP A;  5LL6 S;  1EY0 A;  1YNN D;  1IKM A;  1SYC A;  2B2Y C;  3HKZ E;  4TSS A;  3PIP A;  2UXD Q;  1EOV A;  3BVM A;  5BR8 Q;  4K14 A;  1CFM A;  2P5Z X;  5IGE A;  3GV3 A;  5IOD A;  4LF6 L;  3HOY B;  5ELC A;  3MC0 B;  4GNX A;  2Z9H A;  4WFN 3;  1KAA A;  4DV3 L;  3ND8 A;  1O7Z A;  2NVX B;  2XSC A;  1SE4 A;  1HNZ L;  1WCM B;  3S2D H;  3NEM A;  4LWC A;  1EY8 A;  1YJN A;  1VQO A;  3M4P A;  2JA8 H;  2NVY B;  5C4Z A;  1DOL A;  2XTI A;  4O0A A;  3A8J E;  2F0G A;  5JJL A;  5J22 A;  3EQL C;  1GD7 A;  2EJF C;  1XWE A;  2A6E D;  4KJN A;  4DV6 Q;  1F2Z A;  2ZTE A;  5I2X A;  3CXC A;  5KEE A;  1SRU A;  1PHJ A;  2ZJP A;  3GTM B;  3AYH B;  1Q46 A;  2EOT A;  1LV9 A;  1FNU A;  1PVO A;  3A0J A;  1DON A;  3P1H A;  3HOY H;  4CDF C;  1WTP A;  3CCU A;  1QNU A;  4NW2 A;  1R4Q B;  4HIO A;  1SNO A;  5LHY 1;  1ZYR D;  2NVX H;  4JC0 A;  2OQ0 A;  1WCM H;  1CQF A;  1KD1 C;  4BBR B;  5LMU Q;  4V19 0;  2PQA A;  2RVL A;  3IAY A;  1ENF A;  3I7F A;  3L0O A;  3S14 B;  2NVY H;  3VR4 A;  3PUY A;  3TRE A;  1LUZ A;  2K5N A;  4AYB B;  2MPM A;  3GO5 A;  1I4R A;  4I7A A;  2BE5 D;  4DV0 L;  3BDO A;  4JK1 C;  1IBK Q;  3FVQ A;  5J39 A;  4HID A;  5IGC A;  2KHI A;  1TT2 A;  3A8I E;  1RD9 D;  3MZ5 A;  3VYS A;  3GTM H;  3NBH B;  1VQP A;  3RNU A;  1PLF A;  3I4N B;  4KMU C;  4DR5 L;  3F2D A;  3J81 j;  1VQD A;  3TME A;  3F2B A;  4JI5 Q;  3J7A V;  1LTS D;  4X3T A;  4KV6 A;  1JJ2 A;  4OL7 A;  2RCN A;  4HAE A;  3JAM c;  4X3U A;  5CBA E;  2CH4 A;  4KY7 A;  1X3E A;  5E4W C;  3AFP A;  1K73 C;  4DK0 A;  5JJK A;  2E8G A;  4BBR H;  1L0X B;  3MA2 B;  3SK8 A;  4DV5 L;  1KQS A;  3S14 H;  2K14 A;  2AKW B;  2QA4 A;  2WB1 B;  4XDX A;  1BO0 A;  3CCQ A;  1DD2 A;  2JA9 A;  5FO8 B;  5FLM G;  3MXN B;  1GM5 A;  1YNJ D;  4KN7 C;  4ZKC B;  2IX3 A;  2OT2 A;  5IWA Q;  5LMN W;  4A3K B;  5DLQ E;  3UDG A;  3PO2 G;  2XVS A;  5I9P A;  5C3W A;  3GDE A;  2MNA A;  4LNQ A;  2KUM A;  3I72 A;  4IUV A;  4HJ5 A;  2PQE A;  5A2Q E;  1EY4 A;  4PZ7 A;  3FKI G;  2K32 A;  3FP9 A;  4QCL A;  3I4N H;  5HUR A;  4HCE A;  1AW7 A;  1H9S B;  1VQ4 A;  4A3F B;  1WD0 A;  5IYC H;  1XPO A;  4ZUI A;  2BCO A;  2L0C A;  1J6Q A;  1J5E Q;  2YV5 A;  4PG3 A;  2JK8 A;  3O13 A;  4A3J G;  3CRL C;  1YNX A;  2KEN A;  1XPR A;  2HIV A;  4K0K Q;  1GUS A;  4L8J A;  1TKW B;  3D0F A;  4ULL A;  2ZTD A;  1SBB B;  4BS9 A;  1PTO B;  4JV5 L;  3BYY B;  4A3K H;  2OEO A;  3AQQ A;  5DM7 3;  3K5L A;  3UE1 A;  2K28 A;  4A3M G;  1MJE A;  1SSO A;  2JA6 G;  4XT3 B;  4IPH A;  4FF2 A;  5IYB H;  4B3T Q;  5GAE C;  2I5H A;  2F0O A;  4L5S A;  1TS3 A;  3D4W A;  4NB3 A;  4PMB A;  1SYG A;  3EIV A;  3W3A A;  4A3F H;  2O5I C;  1BQQ T;  3HOX G;  3S9W A;  1TWC B;  2V1C C;  1M1K C;  4YWK A;  5LMN L;  4JBW A;  4L63 B;  1NNX A;  1SE8 A;  1XTC D;  2DN8 A;  3TP5 A;  2LS0 1;  3CCS A;  1K8A C;  1L0W A;  2A19 A;  1BF4 A;  2A6H D;  2XWJ B;  3HP3 A;  2AQ2 B;  1XTD A;  1Q8I A;  3N6R A;  3S16 B;  1SDF A;  1UUP A;  2I5M X;  2F0V A;  2AMC B;  4IFD J;  2D2C C;  1PTO H;  1N34 Q;  3K0Y A;  1PTO C;  3T16 A;  3W1B A;  4HJ7 A;  1SMY D;  4BY7 B;  1I3Q B;  4LF4 L;  4DN4 M;  1PH8 A;  1MHW C;  3PIO 3;  1EWC A;  1M4V A;  1QVG A;  1CA6 A;  3Q23 A;  1VQC A;  4JI6 L;  4R4Q A;  1SE3 A;  3J7A F;  4DR6 L;  2CWP A;  1AE3 A;  1DYQ A;  1SNP A;  3G6E A;  3PUV A;  2KQ3 A;  4CBV A;  1TWC H;  5EQ0 A;  2JEA I;  4KJO A;  4ZKB B;  1A3T A;  1RTN A;  2VQE L;  3RMH A;  3I73 A;  2AHO B;  2A69 D;  4OGQ C;  4HJA A;  3S15 B;  2VNU D;  2FFK B;  1HA5 A;  4TQU S;  1XJV A;  1HZB A;  1I4G A;  3S16 H;  4GKK Q;  3PF5 A;  1MSH A;  1V8Q A;  4RGM A;  1I6H B;  4FF1 A;  3GV6 A;  4UY8 C;  1X32 A;  3KLS A;  2WAQ G;  4HIK A;  1OXS C;  2X6G A;  1BVS A;  4BY7 H;  4GN5 A;  1I3Q H;  4WOR A;  2MUY A;  4APV A;  4DR3 Q;  4RHR A;  3MAQ A;  2QDB A;  1E3P A;  3H09 A;  2E76 C;  3R2T A;  1JB3 A;  1YHA A;  2AUK A;  5EAY A;  4LF7 Q;  1I4Q A;  4RCN A;  3T13 A;  3MXP A;  4JBM A;  4BBS B;  1A62 A;  4QUF A;  4BWG B;  4A3C G;  2L5T A;  3VYU A;  2KBN A;  2RF4 A;  2YTX A;  1EYC A;  1XNQ L;  4H44 C;  3Q22 A;  1W2B A;  1DZ1 A;  3EJI A;  2QEJ C;  3S15 H;  1ESF A;  3T1H L;  4Y7N B;  4A3G G;  2V4D A;  1PH9 A;  4BY1 H;  4B9X A;  3NP8 A;  3PIO A;  3D6C A;  1VDZ A;  1X65 A;  3NBI A;  2DNC A;  1B8A A;  2IJ0 A;  5CV8 A;  3S1R B;  1I6H H;  4HR7 B;  2HD3 A;  2K33 A;  2B39 A;  1X55 A;  2EJG C;  1FGU A;  3W5O A;  2L1B A;  2Y0S B;  1PRT F;  4LW1 A;  1TWA B;  3G4S A;  3NK9 A;  1OXU A;  1B2T A;  1H9K A;  2UU9 Q;  3KDF A;  5CMD A;  1LTR D;  1AN8 A;  3D3R A;  1A0I A;  5GAD C;  4C3H G;  5IP9 H;  2H5X A;  1JB7 A;  3RN5 A;  3K80 C;  4BBS H;  1Q7Y C;  1HZA A;  1HNX Q;  3CME A;  2VUM B;  1AZQ A;  1PRT D;  4I7Z C;  5EBD A;  1ZXT A;  3M85 A;  1HHV A;  1IW7 D;  3BU2 A;  4P72 A;  3I90 A;  1FD7 D;  3L3O C;  4C1N K;  1VQ9 A;  5CV7 A;  3K58 A;  3G6J B;  3KF6 B;  4K8J A;  1V43 A;  1XMQ Q;  3DWQ A;  4Y7N H;  4X3S A;  3HKZ B;  1I6V C;  4XQN A;  2OTJ A;  1IBM L;  4DR7 L;  3S1R H;  4UP9 A;  1CSP A;  3K81 C;  4L5Q A;  1TY0 A;  2K6A A;  3V05 A;  4R9W A;  1K3B C;  2L11 A;  5I9O A;  4JYA Q;  1ET9 A;  1D5Z C;  1TWA H;  1UE7 A;  5CV9 A;  5C3E G;  3J7Y W;  1QUQ B;  4PZ6 A;  3E9I A;  1HZ9 A;  4HSV A;  5IP7 G;  2KA7 A;  4CHT B;  1JOK A;  4RAU C;  1M8A A;  2VUM H;  1YZ6 A;  5CBE E;  3JAM i;  3CMA A;  4A3L G;  2K5H A;  4LF6 Q;  1DOK A;  4ME3 A;  1T9H A;  1ENA A;  2B2T A;  2R92 G;  4DV3 Q;  1HUM A;  3OWF A;  1HZC A;  3KLW A;  4DAV A;  2F52 A;  1HNZ Q;  3S1Q B;  4F7X A;  1C9O A;  3JAM L;  2UUB L;  2K50 A;  1TR5 A;  1WOC A;  2RDG A;  1H95 A;  2JA5 G;  2AQ3 B;  1PZJ D;  1J8I A;  1H9J A;  2L15 A;  4DUY L;  1WTV A;  3U4Z A;  1N9W A;  3C2P A;  2C9O A;  1AE2 A;  4JI3 L;  3ULJ A;  5JJZ A;  1D1K A;  1B1Z A;  1VQA A;  3ND9 A;  1TU2 B;  1PMR A;  4UPA A;  2BA1 A;  5D3D A;  1WD1 A;  2B2U A;  4O42 A;  3I4O A;  4DK1 A;  1G51 A;  3VDY A;  1GUG A;  4CJ2 C;  3H15 A;  1HTL D;  3S1Q H;  2G9D A;  4PNY A;  1WTW A;  2ID0 A;  4Z9C B;  4GOP A;  2F03 A;  5E4X A;  4DAM A;  1B44 D;  4C3I B;  2R93 B;  2L12 A;  4KN4 C;  4DV0 Q;  3MEF A;  2B63 G;  5C44 G;  4DKA C;  3CCE A;  5KGU A;  3NUC A;  5M3F G;  1NJI C;  2N8N A;  3AMU A;  2PPB C;  1EUJ A;  2F0H A;  3J81 c;  5IY0 A;  4H0L C;  1IYU A;  1L0Y B;  3C46 A;  3HOU B;  1EY9 A;  1Y14 B;  2IX0 A;  4RWS C;  1STG A;  4YCV A;  3T1Y L;  3BJU A;  3GTJ B;  1JMC A;  4TVA B;  4LFA L;  4WJ4 A;  3Q6S A;  3DEO A;  1N32 L;  1A15 A;  3HOZ G;  2WAQ E;  1CHQ D;  5IIF A;  2B2W C;  3A56 A;  5TSS A;  5BN5 A;  1K28 A;  1HH2 P;  2MP1 A;  4G7H C;  1KNA A;  1ASY A;  1N8R C;  4C3I H;  2R93 H;  3HG9 A;  5C0X G;  1R9T B;  1JT8 A;  2Q8T A;  3V2T A;  2GVB A;  3PO3 G;  4YY3 L;  4XQJ A;  4QL5 A;  4JI1 L;  2VS1 A;  3HOV G;  3HGB A;  2ZXP A;  2XNA C;  2JJQ A;  1EY7 A;  4FF4 A;  1X56 A;  1S40 A;  1UNS A;  2WII B;  3K0X A;  3DXJ C;  3OMG A;  1YNN C;  1W6J A;  1SN8 A;  1MKH A;  1IKL A;  5F2D A;  3DEP A;  2K04 A;  2EYH A;  1ET6 A;  3E0E A;  1TWG B;  2K5D A;  2NUC A;  5FJ8 G;  2Q2H A;  1LTT D;  1JCK B;  3GTJ H;  4DV7 Q;  3A54 A;  2CQA A;  2FMM A;  4JBJ A;  1R4P B;  1VQ7 A; 
#chains in the Genus database with same CATH homology
 1B7Y B;  2YTY A;  4GLA C;  2R6G A;  3ULP A;  1IBK Q;  3PF4 A;  1Z9F A;  3CD6 A;  2WFW A;  5IP7 H;  1B70 B;  4HID A;  1IBL Q;  5BR8 L;  4B3S Q;  2UXD L;  1Q12 A;  5FLX c;  3ERS X;  2KHI A;  1GKH A;  4LFB Q;  1WI5 A;  2VW9 A;  2UUA Q;  3GTM H;  4A3L H;  3HKZ G;  1R9T H;  3NEL A;  4JV5 Q;  1VQB A;  4YHH L;  3NBH B;  1XPU A;  4UP7 A;  4JBK A;  3S1N H;  1VQP A;  4AIM A;  2R92 H;  3RNU A;  3CCM A;  4DR5 L;  1YHB A;  3F2D A;  3J81 j;  2A8V A;  1XNR Q;  2BH2 A;  1VQD A;  3F2B A;  4JI5 Q;  2UXB L;  4DV1 Q;  3UDX A;  4X6A H;  4UP8 A;  1JJ2 A;  1Y1V G;  2DUD A;  1LYL A;  2RCN A;  3JAM c;  1VQF A;  1E24 A;  3CC4 A;  4LF5 Q;  1X3E A;  3AFP A;  2B3G A;  4DK6 C;  1A8V A;  4J15 A;  1K73 C;  2E8G A;  2Y0S E;  4B3M L;  3J7A 5;  5JJK A;  4BBR H;  1UE5 A;  1X3G A;  5M5Y H;  1KQS A;  1BKB A;  4DV5 L;  1GVP A;  1WFQ A;  2PQA B;  2K14 A;  2AKW B;  4LF9 L;  2QA4 A;  3S14 H;  3I56 A;  1TWG H;  2UXC L;  4JI2 L;  1NE3 A;  4IO9 A;  2KCM A;  4X64 Q;  1QZG A;  3CCQ A;  4DR1 L;  4BXX H;  2JA9 A;  1FL0 A;  5LMN Q;  1K0R A;  1X3F A;  5FLM G;  2FXQ A;  2I5L X;  3MXN B;  3G71 A;  4ALP A;  1GM5 A;  4A3D H;  1Y1W H;  3AFQ A;  2JE6 I;  4JI4 L;  5IWA Q;  5LMN W;  1SMX A;  4DUZ L;  1PH4 A;  5DLQ E;  3UDG A;  3PO2 G;  5JJI A;  1PYS B;  3L2P A;  3I4M G;  3EN2 A;  4XIG S;  3STB D;  3GDE A;  2MNA A;  3HKS A;  4LNQ A;  4IPC A;  1E1T A;  3GD7 A;  4X62 Q;  3E9H A;  4HJ5 A;  3RZD H;  1YJW A;  1AH9 A;  1YHQ A;  2NVQ H;  3KJP A;  3OW2 A;  3S1M H;  4MNO A;  4PZ7 A;  3FKI G;  3DLL A;  4A3C H;  3FP9 A;  3RLN A;  2N49 A;  2D0O A;  1IL2 A;  3I4N H;  4DV4 L;  4A4I A;  2R7Z G;  1C0A A;  2VZA A;  5ELO A;  3CC7 A;  5LMU L;  1VQ4 A;  3CC2 A;  4LUZ A;  4IPD A;  4OON A;  5M5W H;  4JG2 A;  3PSI A;  5IYC H;  2D0P A;  4DPG A;  4LF4 Q;  1XPO A;  2VQF L;  1PYB A;  2N3S A;  4C2M H;  1OXT A;  4JI6 Q;  4A3G H;  1IBK L;  3KF6 A;  1J6Q A;  1J5E Q;  4DR6 Q;  1IBL L;  4B3S L;  3H3V I;  2IHE A;  2B63 H;  2YV5 A;  4PG3 A;  2JK8 A;  5C44 H;  4A3J G;  4LFB L;  1TXY A;  1YNX A;  3G48 A;  2KEN A;  4DR5 Q;  1EWI A;  1XPR A;  2HIV A;  4K0K Q;  2R7D A;  2UUA L;  4JOI C;  3D0F A;  1TWF H;  4R4C A;  1NBW A;  1N33 Q;  2ZTD A;  3CCJ A;  3K7A H;  4JV5 L;  5GAH C;  2JA7 G;  4A3K H;  3OYY A;  3AQQ A;  3UDF A;  4DAY B;  3UE1 A;  4AYB E;  3GTG H;  4A3M G;  1XNR L;  1MJE A;  2ASB A;  4OO1 G;  4JI8 Q;  2JA6 G;  1VCI A;  1I94 Q;  4JI5 L;  4DV5 Q;  1QUQ A;  3UDI A;  4DV1 L;  1EFW A;  1L1O A;  3K7U C;  4IPH A;  4HJ9 A;  1PFS A;  1RL2 A;  5IYB H;  4GOP B;  4B3T Q;  5GAE C;  2I5H A;  4IOC A;  2VY3 A;  4L5S A;  4GKJ Q;  5C4X H;  4NB3 A;  4QIW E;  2BH8 A;  2PMZ E;  4LF5 L;  1VQE A;  3EIV A;  1SLJ A;  2ALY B;  1EQR A;  4OXP A;  3KF8 B;  3Q8D A;  4A3F H;  1Q82 C;  1Q1B A;  1JJC B;  3HOX G;  4A93 G;  4X64 L;  3HOZ H;  2V1C C;  3STB C;  2NN6 G;  1M1K C;  4YWK A;  5LMN L;  1VQK A;  4JBW A;  3CQZ H;  4GNX B;  1SE8 A;  1PV4 A;  4PMW A;  3CCS A;  2LXK A;  2HQL A;  2Y0S G;  1K8A C;  1PH6 A;  5IWA L;  1KAW A;  4NXN Q;  1G29 1;  4YCW A;  1KRT A;  1L0W A;  3SGI A;  2A19 A;  3HOU H;  1BBW A;  1U5K A;  4YCU A;  1XTD A;  1SFO H;  4Y52 H;  4R1J A;  3PO3 H;  4KHZ A;  2I5M X;  4KHP Q;  4OX9 Q;  4X62 L;  5H1S E;  2AMC B;  3KJO A;  4IFD J;  1KC8 C;  2LSS A;  1XNQ Q;  1G6P A;  1N34 Q;  3HOV H;  2VUM G;  1IXR A;  4RG1 A;  2WB1 E;  2GN5 A;  4EQ5 A;  3CCV A;  3W1B A;  2MQH A;  5C3E H;  4HJ7 A;  4A76 A;  4GN4 B;  4KI0 A;  3T1H Q;  3S2H H;  1I5F A;  3M4Q A;  1PH3 A;  2ZJR A;  1UE1 A;  1IYJ B;  1K8G A;  4QJF A;  4A3I H;  4LF4 L;  3CP0 A;  3S17 H;  1PH8 A;  4GOP C;  1OTC A;  2CKZ B;  1FVI A;  1QVG A;  4A3E H;  5FJ8 H;  1VQC A;  4JI6 L;  1NMG A;  2LXJ A;  4R4Q A;  1J5E L;  1YJ9 A;  1CKO A;  4DR6 L;  2CWP A;  1AE3 A;  3AEV A;  1WYD A;  2IY5 B;  3G6E A;  3PUV A;  2R7F A;  4K0K L;  1TWC H;  3DM3 A;  3F8T A;  2JEA I;  5HGQ A;  1MJC A;  2VQE L;  1N33 L;  3J80 c;  4GNX C;  1CKM A;  1K83 H;  2AHO B;  3HOW G;  2F3I A;  4HJA A;  2IX1 A;  2VNU D;  3F2C A;  4TQU S;  4JI8 L;  1HZB A;  1XJV A;  2JA5 H;  4HJ8 A;  1I94 L;  2E5L L;  3S16 H;  4GKK Q;  2UU9 L;  1P16 A;  4POG A;  1VQ8 A;  3PF5 A;  4B3T L;  4BBR G;  4R4I A;  2N78 A;  3CCL A;  4LF8 Q;  4GKJ L;  3PGZ A;  2ZJQ A;  1Y1V H;  2PI2 E;  4UY8 C;  4MZ9 A;  1M90 C;  4OWW B;  2WAQ G;  1UWV A;  4HIK A;  1OXS C;  2AWO A;  1BVS A;  2Q2T A;  4BY7 H;  4GN5 A;  1I3Q H;  1YIT A;  1JJG A;  3BZK A;  4A3B H;  4APV A;  4DR3 Q;  4IFD I;  3RLO A;  5IYD H;  4X66 Q;  1IBM Q;  4DR7 Q;  1E3P A;  3ER0 A;  3LGJ A;  4H02 A;  4NXN L;  1YHA A;  2CWA A;  3K8A A;  5EAY A;  1NTG A;  4QQB X;  4LF7 Q;  5IE8 A;  1EYG A;  4JBM A;  1A62 A;  1VS0 A;  4A3C G;  1HJP A;  2KBN A;  2RF4 A;  3I4N G;  4KHP L;  4OX9 L;  3I4M H;  1IZ6 A;  4DV2 L;  4NXM L;  2YTX A;  3RLF A;  3I2Z A;  1XNQ L;  1N34 L;  2PNH A;  4NPS A;  4A75 A;  1W2B A;  3M7N A;  5IYC G;  3S15 H;  2BA0 A;  4JI0 Q;  3GTK H;  5GRO A;  3H0G H;  3T1H L;  1MIU A;  3FKI H;  4XTC S;  2ATW A;  4A3G G;  1PH9 A;  4BY1 H;  1X54 A;  3PV0 A;  2K75 A;  4LFC Q;  1FJG L;  5GQO A;  1VQN A;  3PIO A;  1W3S A;  1X65 A;  1HR0 Q;  2RHS B;  2MFI A;  2EQS A;  4R4O A;  1B8A A;  3B6Y A;  3BZC A;  2WB1 G;  2VQE Q;  1I6H H;  3A74 A;  3TS0 A;  1HR0 W;  5M3F H;  3CAM A;  2A1A A;  2JA8 G;  4OWT B;  2UUB Q;  1WJJ A;  1NY4 A;  1X55 A;  3HFZ B;  1FGU A;  4O2D A;  4RMF A;  1DGS A;  3W5O A;  4EX5 A;  4DR4 Q;  2HIX A;  4LW1 A;  3G4S A;  1KL9 A;  1OXU A;  2E5L Q;  2ES2 A;  2UU9 Q;  1CUK A;  3ICE A;  4A3J H;  3KDF A;  2E2J H;  1A0I A;  5GAD C;  2HT1 A;  5IP9 H;  5C4J H;  1EIF A;  2H5X A;  5IYB G;  4IJL A;  1JB7 A;  3RN5 A;  1X6O A;  3K80 C;  4BBS H;  1Q7Y C;  1HZA A;  1HNX Q;  2JA7 H;  3CME A;  4IOA A;  2R93 G;  4GKK L;  2QEX A;  3GTQ H;  5C4X G;  4JI3 Q;  1D7Q A;  4IFD G;  3M85 A;  4JI7 Q;  3GTO H;  2RHQ B;  3BU2 A;  4P72 A;  4A3M H;  1SR3 A;  4LF8 L;  2JA6 H;  2D62 A;  1VQ9 A;  3M3Y H;  5HY6 A;  1VQ5 A;  4HIM A;  3CW2 C;  3CCR A;  3ZJY C;  3FHW A;  3HOY G;  4GLV B;  1Q1E A;  1X9N A;  4JCV E;  3KF6 B;  1V43 A;  3CPF A;  4R4T A;  1XMQ Q;  2NVT H;  2IT1 A;  3EBE A;  4LUV A;  4Y7N H;  4AH6 A;  1QVF A;  1EIY B;  4JBJ A;  2MO1 A;  4BA1 I;  1PA6 A;  1WCM G;  4DR3 L;  3GTP H;  4B3R Q;  2K52 A;  3HOU G;  2OTJ A;  4X66 L;  5M3M G;  1IBM L;  1KRS A;  1P8L A;  4DR7 L;  4DV2 Q;  3S1R H;  1OXV A;  4UP9 A;  1YIJ A;  4NXM Q;  2JEB I;  1CSP A;  3K81 C;  3RN2 A;  4L5Q A;  3GTL H;  3RZO H;  4LF7 L;  1VQH A;  4JYA Q;  4A93 H;  1N36 Q;  1TWA H;  1UE7 A;  1L2F A;  1V9P A;  2CFM A;  2XGT A;  3KYH C;  3S24 A;  2JQO A;  5C3E G;  1QUQ B;  4PZ6 A;  3E9I A;  1L1O B;  1HZ9 A;  5IP7 G;  1FJG Q;  1UE6 A;  1CKN A;  1O7I A;  1PH1 A;  2Q2I A;  1Q8K A;  5C0X J;  4DK3 C;  4A3I G;  4JI0 L;  2KHJ A;  2Q2U A;  5ELN A;  2VUM H;  1YZ6 A;  4X65 Q;  3WWV A;  3PUX A;  3JAM i;  3U4V A;  3CMA A;  2K5H A;  4JOI A;  4LFC L;  4LF6 Q;  3H3V H;  4ME3 A;  3UE0 A;  1T9H A;  4A3L G;  5K36 G;  3ULL A;  2K4K A;  1HR0 L;  3OTO Q;  2R92 G;  4DV3 Q;  2CCZ A;  4L5R C;  3D31 A;  2NZO A;  1HZC A;  4P75 A;  3JC6 6;  3KLW A;  3TEH B;  1K3R A;  2F52 A;  1XMO Q;  1HNZ Q;  1KXL A;  1YEZ A;  4PZ8 A;  1C9O A;  3CPW A;  2UUB L;  4GN3 B;  3GO5 A;  2VL6 A;  2K50 A;  4DR4 L;  4C3J H;  1QZH A;  4DNI A;  1OXX K;  2WP8 J;  1QVC A;  3T1Y Q;  1WOC A;  1H95 A;  3TQY A;  2EIF A;  4LFA Q;  2F4V Q;  2JA5 G;  1C7Y A;  2L15 A;  5J3B A;  2MO0 A;  4BA2 I;  4DUY L;  1N32 Q;  2I0Q A;  5AJ3 L;  3U4Z A;  1E7Z A;  2Z6K A;  1N9W A;  1HNW Q;  4AYB G;  4GLX A;  1S3O A;  1HNX L;  4BXX G;  2Z0S A;  1AE2 A;  1RIP A;  2E2I H;  1U0L A;  2K5V A;  4JI3 L;  3ULJ A;  3HOW H;  4OO1 I;  5E7N A;  4A3D G;  4JI7 L;  3CF5 A;  3PUW A;  1Y1W G;  1VQI A;  2UUC Q;  3L7Z C;  1L1O C;  1GO3 E;  1VQA A;  3NEN A;  3M9B A;  1PH5 A;  4OWX B;  3IRB A;  4BY7 G;  1VQM A;  1CKN B;  4DR2 Q;  1I50 H;  4UPA A;  4A3B G;  4POF A;  1A63 A;  5IYD G;  2BA1 A;  4FDB A;  1XMQ L;  1TWH H;  4YY3 Q;  5JEA G;  4DV6 L;  5FLM H;  4JI1 Q;  2PI2 A;  2OWO A;  4P74 A;  4B3R L;  2KCT A;  1VQG A;  3J81 i;  1D8L A;  2GVA A;  3PO2 H;  3I4O A;  2ZM6 Q;  4P71 A;  1E22 A;  1G51 A;  3VDY A;  3TRZ A;  3A5Z B;  3KFU A;  4YWL A;  5C0X I;  3H15 A;  1LTL A;  3S1Q H;  4AQY Q;  2NZH A;  2ID0 A;  4JYA L;  4GS3 A;  1BBU A;  1N36 L;  4GOP A;  1PH2 A;  2HHH Q;  1JE5 A;  1CSQ A;  2NN6 I;  5JEA J;  3H0G G;  3J7Z C;  1KIX A;  4DAM A;  1K9M C;  2R7Z H;  4DV0 Q;  2YU9 H;  3MEF A;  2B63 G;  4BY1 G;  5C44 G;  3HKZ E;  3PIP A;  4DKA C;  2IHF A;  3CCE A;  3M4O H;  2UXD Q;  3RR5 A;  1EOV A;  5BR8 Q;  5GAG C;  1YVC A;  3U50 C;  4X65 L;  1YBY A;  4DV7 L;  4LF6 L;  5M3F G;  1NJI C;  4KLK A;  2N8N A;  2YYZ A;  4GNX A;  1LM0 A;  2DGY A;  3OTO L;  4A3K G;  4DV3 L;  1EUJ A;  2B29 A;  5IY0 A;  3J81 c;  1XMO L;  1HNZ L;  4IJH A;  4YHH Q;  3S2D H;  2YTV A;  3A5U A;  2OQK A;  3NEM A;  1Y14 B;  2IX0 A;  3PUZ A;  4IPG A;  4LWC A;  1VQJ A;  4DUY Q;  1VQO A;  3F1Z A;  1YJN A;  5AJ3 Q;  1Q86 C;  4YWM A;  1VQ6 A;  4YCV A;  3M4P A;  3T1Y L;  2JA8 H;  5IP9 G;  2XTI A;  2UXB Q;  3BJU A;  4O0A A;  1PH7 A;  1JMC A;  1ASZ A;  3KOJ A;  4TVA B;  4LFA L;  4BBS G;  2F4V L;  4WJ4 A;  4L5T A;  2CQO A;  3W1G A;  1YI2 A;  4A3F G;  1Q81 C;  1N32 L;  5JJL A;  5IT9 c;  4B3M Q;  1HNW L;  3I55 A;  3HOZ G;  2QGQ A;  2WAQ E;  1GD7 A;  3PCO B;  4LF9 Q;  4C3H H;  2UXC Q;  1HH2 P;  4DV6 Q;  1S72 A;  4JI2 Q;  2ZTE A;  2E2H H;  4DR1 Q;  3CXC A;  1PHJ A;  1SRU A;  1ASY A;  2UUC L;  4P73 A;  4C3I H;  2ZJP A;  1N8R C;  3TS2 A;  2R93 H;  5C0X G;  4QY7 A;  3AYH B;  4DR2 L;  1VQL A;  2OCE A;  3HOX H;  1Q46 A;  1KHI A;  4JI4 Q;  1JT8 A;  4DUZ Q;  1PVO A;  2GVB A;  2Z6K C;  3PO3 G;  4YY3 L;  3A0J A;  4QL5 A;  4JI1 L;  2VS1 A;  3HOY H;  4WJ3 M;  3HOV G;  3CCU A;  1NMF A;  2AWN A;  1SRO A;  5M5X H;  4HIO A;  2OTL A;  2JJQ A;  2ZM6 L;  2NVX H;  1EQQ A;  1E1O A;  4JC0 A;  1X56 A;  2OQ0 A;  1S40 A;  4LUO A;  2C35 B;  1V1Q A;  1WCM H;  3K0X A;  3KDF B;  1UEB A;  4AQY L;  1KD1 C;  1SN8 A;  5M3M H;  4DV4 Q;  1MKH A;  1Z47 A;  2EXD A;  5LMU Q;  2PQA A;  3I7F A;  3E0E A;  3L0O A;  3J80 i;  2NVY H;  4A3E G;  2HHH L;  5FJ8 G;  3PUY A;  3TRE A;  2Q2H A;  1LUZ A;  4DV7 Q;  4MTN A;  3GTJ H;  2K5N A;  4QGU A;  3U58 A;  2VQF Q;  2ZTC A;  4DV0 L;  1VQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...