4LUVA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luvA00
1B8AA 3HOYH 3U4VA 2QA4A 4C3IH 1Y1WG 1Z9FA 2C35B 4XTCS 1WJJA 1AE2A 2ZTEA 1VS0A 3CF5A 2R93H 3I55A 1VQNA 4A4IA 2KCTA 1GD7A 4UPAA 4GOPC 1M1KC 4PZ7A 2JA8H 4BBRG 4ME3A 1DGSA 2D0OA 1TWHH 1FGUA 4NXNL 1JT8A 4R4TA 3CCQA 4L5RC 4LUZA 2NVYH 4JBKA 2K50A 2EXDA 1FVIA 2VS1A 1CUKA 2HIVA 4JI2Q 1Q12A 5IWAQ 3E9IA 3S1QH 1VQCA 4A93G 1KQSA 3KOJA 3M9BA 3HOUH 2CKZB 3UDGA 5M3FH 2K5NA 2LSSA 3OTOL 1J5EQ 2I0QA 2EIFA 3G6EA 2UXDL 1OXSC 1K83H 3W5OA 1Q8KA 3M85A 2UUCL 3CP0A 4A3EH 1O7IA 5H1SE 1YNXA 3F2DA 4K0KL 1AE3A 1PH8A 4AYBG 4LFAL 4Y52H 1K8GA 5GAEC 1Q81C 4GLVB 3A5ZB 1UWVA 4OWWB 3T1HQ 1N36Q 1AH9A 4JI7Q 1VQ6A 1D7QA 4NPSA 4KI0A 4DK3C 5C4JH 4JI3L 4JV5Q 2KHIA 3ULLA 3HOXG 4DR6L 4IOAA 4J15A 3KJPA 3TRZA 3DM3A 5IYCH 3I4MG 3CAMA 3BZCA 1IZ6A 4DR3L 1RL2A 4DV6L 3HOVH 3S1NH 1SE8A 4A3IG 4JYAQ 4X65Q 4LF7Q 4DV6Q 2MO0A 1PH3A 1MKHA 1V1QA 3HOYG 1X3FA 4OO1I 1A8VA 5FJ8H 4GKJL 1EOVA 1XTDA 3JAMc 2H5XA 2CWPA 2KBNA 2WAQG 4AYBE 1PHJA 3UE0A 2GVBA 4KHZA 4A3MG 2JA8G 1RIPA 2BA1A 3CD6A 4DKAC 1QVGA 2ID0A 4LF9Q 3S2HH 4H02A 1K8AC 3CC2A 2VY3A 1N8RC 2WFWA 4DUYL 3F8TA 2JA6H 1NJIC 1VQ9A 4A3CG 3PUZA 4JI4L 2R7ZH 2VNUD 3PIPA 2B63G 1KAWA 2NN6I 1MJCA 3RNUA 1VQPA 3CCVA 1KRTA 3AFPA 3G4SA 2AWNA 1KHIA 4DR7Q 4DR2Q 4OXPA 1I50H 2MQHA 1LTLA 3WWVA 2IX0A 1W2BA 4QQBX 1VCIA 3RN2A 2Z0SA 3EN2A 2HQLA 2PI2E 4GOPB 3T1YL 1XNRL 4GN3B 2QEXA 4DR2L 4IFDJ 1OTCA 3EBEA 3W1GA 2CCZA 1EQQA 1E1TA 2BA0A 3PUXA 3S1MH 4LFBL 3I7FA 1MIUA 4UP9A 2OTJA 4DV5L 1VQDA 2WAQE 2N78A 5FLMG 1Y14B 1K73C 1X55A 2Q2HA 2YV5A 3GO5A 3S1RH 1XPUA 3S14H 4WJ3M 4DR6Q 4LF9L 2VQFL 1IBMQ 1PFSA 4AIMA 5AJ3Q 1N32Q 3CXCA 2D62A 3PO3G 3PO2H 1XPOA 3M4OH 2ZTDA 5M3MH 1E1OA 1SLJA 4LW1A 4LUOA 3S17H 5IYDG 1N32L 4EQ5A 2VQFQ 1I6HH 3I2ZA 3SGIA 2MO1A 4IO9A 1XPRA 3J7A5 1C7YA 1WCMG 2AMCB 4OWTB 4LF4Q 2NZOA 4DV5Q 4HJ5A 4A3LG 4HIDA 4K0KQ 4DV7Q 2UXCQ 2JEBI 5IYBH 4JI8Q 1YI2A 4R4CA 3CCEA 1J5EL 1Y1WH 1VQGA 3CCLA 2UUAL 4KHPQ 1OXUA 4QY7A 2L15A 4X64Q 4O2DA 1S72A 2ZM6L 3GTPH 3OYYA 3HOZH 5C4XG 2DUDA 4JI6Q 3KF8B 4JI3Q 2XTIA 1Q7YC 1PH5A 2JEAI 4OONA 3PV0A 2VQEL 5LMNL 4B3MQ 2MNAA 2A8VA 3S15H 4JI4Q 1KD1C 3HOVG 5C0XJ 3H0GG 1FL0A 4R1JA 1HR0Q 1OXTA 4QGUA 3FKIH 4A3JG 1YJNA 4ALPA 1L1OA 3GTGH 4A76A 1QZHA 4BBSG 4P74A 4B3TL 4LF5Q 2VL6A 3RZOH 3GTLH 2BH8A 4XIGS 1PA6A 4DR5L 1VQOA 4AQYQ 1JB7A 1EQRA 2RF4A 3RLNA 5C3EG 3U4ZA 3I4MH 1HNWL 4L5TA 3AFQA 4IOCA 1IBKL 1X6OA 1YVCA 2I5HA 1L2FA 3HOWH 3S24A 2UUBQ 2WB1G 4DAMA 4NB3A 4TQUS 2N49A 1CSQA 3NEMA 4DV2Q 3AEVA 2NVTH 1C9OA 2K14A 4X66L 4BBRH 1CKMA 1N34Q 3TEHB 3CCJA 1BBWA 5JJKA 2B29A 4GNXA 1U5KA 2Y0SE 3PGZA 4DV3L 4A3IH 2HHHL 2V1CC 3CCUA 3G48A 1BBUA 4A3BG 3PUVA 2BH2A 5JJLA 4PZ8A 5IE8A 4BY7G 1B70B 1X9NA 1IXRA 1KRSA 4JI0L 1N9WA 4DR4Q 3Q8DA 5E7NA 3GTQH 1X56A 3BU2A 4B3RQ 4HJ8A 4YWLA 2B3GA 1IL2A 1XNQQ 4NXMQ 1Q1BA 4L5SA 3F1ZA 2Z6KC 2F4VL 1SFOH 1Q86C 4POFA 4GKKQ 1SRUA 2D0PA 3HKZE 4YCVA 4OWXB 4DNIA 2HIXA 2CWAA 4YWMA 5C3EH 4LNQA 1GVPA 2RHSB 2NVXH 4IPHA 2K5HA 3MEFA 3PSIA 4MNOA 4IJHA 1VQIA 1VQJA 3HOZG 2JA6G 4C3JH 1PH9A 5GAHC 5K36G 1LM0A 3D0FA 1W3SA 4A3EG 2IT1A 2NZHA 3ZJYC 4C3HH 4POGA 4A3KG 1I3QH 1TWFH 3J80i 2JK8A 4JI2L 4OX9L 2R93G 3RN5A 1TWGH 1EIFA 4HIMA 3PCOB 1YHAA 4JI5Q 3KF6A 3RLOA 4BA1I 3KJOA 4NXNQ 3NELA 3RZDH 1P8LA 4O0AA 1JJ2A 2E5LL 2B63H 1NTGA 5LMNQ 4B3ML 3I4NH 4LWCA 1YITA 5M3MG 4B3SQ 2MFIA 3A74A 1BKBA 3HKZG 4C2MH 4DPGA 4DUZL 1HNXL 1FJGL 1QVFA 3CW2C 4QL5A 1K9MC 4EX5A 3W1BA 2ZM6Q 3RLFA 4A3JH 1VQ4A 1SROA 2Q2IA 3NENA 1PH7A 1QUQA 5JEAJ 5GAGC 2F52A 3TS2A 1XMQL 1NE3A 1R9TH 1XMOL 1UE5A 3VDYA 2UU9L 1JJGA 2UXCL 3TS0A 2JQOA 2IHFA 3K0XA 1K3RA 4PMWA 1HZCA 4JBWA 1NMGA 5M5WH 4AH6A 5C44G 3JC66 1G51A 1YBYA 2Y0SG 2VW9A 5IYDH 3EIVA 4GKKL 4UY8C 5BR8L 1BVSA 4BY1G 4IJLA 3H15A 4HJ9A 1EUJA 3ULPA 1IBLQ 3L2PA 4NXML 2UXBQ 2ZJPA 3RR5A 3J80c 2OQKA 5M5YH 4AQYL 4B3RL 4DV4Q 3E9HA 4Y7NH 4GOPA 3H3VH 2N8NA 2NVQH 3ICEA 2JA5H 2R92H 1YHQA 2IY5B 2E8GA 3BJUA 2ES2A 5AJ3L 1JE5A 4B3SL 3K81C 4FDBA 3PUYA 1E3PA 1UEBA 5C0XG 4A3DH 2E5LQ 1L1OC 5IP9H 1UE6A 2F3IA 3I4NG 1HR0L 4LF6L 1B7YB 4DV0Q 4JI1Q 4JOIA 1PYSB 5IYBG 4X66Q 5IP7G 3KDFA 1V43A 2KHJA 4A75A 4A3MH 4A3FH 1N33L 1C0AA 4X6AH 1HNZQ 2JA7H 4YY3L 2WP8J 3CCRA 2N3SA 2NN6G 3G71A 3I4OA 1IBKQ 5GROA 1E22A 1TWCH 1L0WA 4KHPL 1VQMA 3AYHB 4YHHQ 1SN8A 4L5QA 3UDFA 4DR5Q 1A0IA 4UP7A 5LMNW 3NBHB 3KDFB 1X3EA 1X54A 1X3GA 1HZAA 1P16A 2YTVA 1NY4A 3A0JA 3UDXA 4X62Q 5M3FG 2OTLA 2F4VQ 1VQKA 3CC4A 1E7ZA 1EIYB 4BBSH 3KF6B 4DR1L 5M5XH 4DAYB 3J81j 4PG3A 3I56A 4DR4L 4BY1H 3BZKA 1ASYA 1Y1VG 2CQOA 2K5VA 2ZTCA 3TREA 4JI0Q 1MJEA 3STBC 5IY0A 3MXNB 1GKHA 3M4PA 5GQOA 4X64L 1OXVA 5C0XI 4DV3Q 3CPFA 2E2JH 2HHHQ 4GKJQ 4GS3A 3J7ZC 3CMAA 3PF4A 1I94Q 4YY3Q 4R4QA 1VQ5A 2VUMH 2HT1A 4P73A 4JI8L 1X65A 5EAYA 1EFWA 4P75A 5JJIA 3HFZB 3CC7A 4X65L 1TWAH 5IP9G 3FP9A 3GTJH 4DV7L 1UE7A 2CFMA 1VQ8A 1L1OB 4DR3Q 4LF8Q 4LF6Q 3PUWA 1IYJB 4LUVA 3H0GH 2R7FA 3CCSA 4LFCQ 4P72A 1OXXK 3M4QA 3FKIG 4APVA 3T1YQ 1XNRQ 3S2DH 2ALYB 2K52A 3HOWG 3PO2G 1I5FA 2PQAA 4JCVE 1WI5A 1G6PA 4DR7L 1HJPA 2VZAA 2PMZE 1PH2A 4A3GH 3U58A 1PH1A 4IFDI 4B3TQ 2KENA 4JBMA 3CMEA 5FLMH 2UXBL 1CKNA 2YYZA 1VQLA 1HZBA 3M3YH 4DUYQ 3J81c 2RHQB 1PH4A 4HIOA 1ASZA 5DLQE 3A5UA 3KFUA 1HH2P 1UE1A 3HKSA 5HGQA 4LFBQ 2VQEQ 1JMCA 1YZ6A 3STBD 3GD7A 3CQZH 5HY6A 2YTYA 1CSPA 1I94L 2UXDQ 4JI6L 3OTOQ 4HJAA 1Q82C 3HOXH 2IHEA 1WCMH 1GM5A 1KXLA 3K7AH 3E0EA 2UUAQ 1HNWQ 4MZ9A 2ATWA 2AHOB 2K75A 4GN4B 1HNXQ 1HNZL 2OWOA 1WFQA 2A1AA 4DUZQ 1FJGQ 1N33Q 1QZGA 5C44H 3PO3H 4RG1A 1J6QA 5JEAG 2Q2UA 1GO3E 4JYAL 3S16H 1V9PA 2ASBA 1VQFA 4DV0L 4LF4L 4RMFA 1PH6A 1TXYA 3F2BA 4OO1G 3F2CA 3JAMi 2LXJA 4JV5L 3KYHC 4A3CH 4UP8A 1M90C 4QJFA 1SR3A 4JI7L 2QGQA 3J81i 4P71A 4DV4L 3T1HL 2IX1A 2Z6KA 2I5LX 2R6GA 4JOIC 4R4IA 1Q46A 3ERSX 4YHHL 1IBML 3LGJA 4A3GG 2DGYA 5LMUQ 4LFCL 1EWIA 1VQEA 1K0RA 5IP7H 1G291 4LF8L 2JJQA 2Q2TA 3TQYA 1VQ7A 3ULJA 3GDEA 4LF7L 3L0OA 5GADC 2GVAA 2I5MX 1PV4A 1CKOA 4JBJA 1PVOA 4A3DG 1YHBA 1D8LA 4GLXA 4BXXG 2AKWB 1XNQL 5ELNA 1JJCB 4IPGA 2RCNA 4A3BH 2R92G 4A3LH 1KIXA 3UE1A 5J3BA 4GNXC 1HR0W 3KLWA 4WJ4A 2PQAB 3K8AA 2JA7G 1E24A 5IWAL 2AWOA 4DV1Q 5ELOA 4GNXB 1YJWA 1N36L 1WOCA 4JC0A 3B6YA 2OCEA 3DLLA 4A93H 2E2IH 1Q1EA 4IPDA 4GN5A 4DR1Q 4DK6C 1IBLL 1CKNB 3CPWA 5FJ8G 3ER0A 2YTXA 1U0LA 4LFAQ 5C4XH 4X62L 1YIJA 2PNHA 4BA2I 4OX9Q 4BY7H 1Z47A 4IPCA 1YJ9A 4HJ7A 1A63A 1A62A 3GTOH 3GTMH 5FLXc 2XGTA 2UUCQ 2UU9Q 2ZJQA 5IT9c 1S3OA 1XMOQ 2E2HH 1XJVA 2YU9H 3PIOA 1NMFA 4KLKA 1KC8C 4YCWA 4YCUA 3AQQA 4GLAC 3K7UC 4LF5L 1Y1VH 2A19A 4TVAB 3U50C 3K80C 1LYLA 2JA5G 2JE6I 1H95A 3CCMA 4JI1L 2WB1E 4YWKA 3D31A 2K4KA 4MTNA 4JI5L 2GN5A 3IRBA 3PF5A 1S40A 2ZJRA 1HZ9A 2LXKA 5IYCG 4DV1L 2R7ZG 4BXXH 3FHWA 3GTKH 2JA9A 1NBWA 3L7ZC 4PZ6A 1VQAA 1LUZA 1EYGA 3OW2A 3M7NA 4IFDG 1T9HA 2R7DA 1QVCA 2VUMG 4HIKA 4QIWE 1PYBA 3HOUG 1N34L 5BR8Q 1WYDA 2KCMA 2PI2A 4A3FG 1SMXA 1VQHA 1QUQB 4JG2A 2OQ0A 4DV2L 2EQSA 4A3KH 1YEZA 4R4OA 2UUBL 2FXQA 3UDIA 1KL9A 5LMUL 3H3VI 1VQBA 1XMQQ
chains in the Genus database with same CATH superfamily
4I7AA 4K8JA 4FXDA 1B8AA 4CKCA 1EOTA 3U4VA 4LMQD 4C3IH 1Y1WG 1Z9FA 2Z4IA 2C35B 3I8ZA 4DF7A 1VS0A 1ENAA 4UPAA 3TZDA 5C44B 1M1KC 4PZ7A 2JA8H 1EY7A 4BBRG 4X3KA 5CGKA 1DGSA 4NXNL 3SR1A 3SVMA 1JT8A 3CCQA 4JBKA 2EXDA 5KNBA 1QNUA 3A54A 3AU7A 3J81E 2ICEC 3KOJA 3M9BA 3HOUH 5CV5A 1BOSA 1U4PA 3G6EA 4IFDH 2I46A 3W5OA 3M85A 1II3A 1O7ZA 1YNXA 2DN8A 1HPCA 1PH8A 4FF2A 4AYBG 4LFAL 5GAEC 1UNSA 2DY8A 3A5ZB 4EGVA 1H9SA 1F9RA 4JI7Q 4RHSA 1TWCB 2OF1A 4JV5Q 4KY5A 2KHIA 4Q0FA 1ENFA 5M3FB 3CAMA 3BZCA 1JORA 1RL2A 1ONLA 3NE5B 1QCBD 2KUMA 4BBSB 1LTRD 3ERQA 4IUQA 4GKJL 4OO1I 2JP1A 1B1ZA 4ID6A 5I9PA 4RKBA 1XTDA 2F0SA 3GV6A 2CWPA 3F2UA 1O78A 3I91A 3BVGA 2AQ2B 2KCCA 1QVGA 3OPOA 3F8TA 4JI4L 3PIPA 2RVLA 2B63G 1KAWA 1MJCA 1EQVA 2AWNA 1KHIA 3D4DA 1T5EA 1LTLA 5KNCA 3RN2A 3EN2A 2HQLA 4GOPB 2JA5B 5FLXE 4DR2L 4IFDJ 1EQQA 1ICFB 3S1MH 4ZKBB 4UP9A 3J80E 1MHWC 2J7ZA 5FLMG 1TS4A 1XPUA 2VQFL 2J0TD 1EEID 1EZ6A 3PO2H 1S5ED 1JOKA 2F0EA 5E1FA 3K7AB 1TS2A 2SNSA 3MZ5A 1E1OA 5EBDA 4LW1A 4LUOA 3KBXA 5IYDG 3SE0A 4IUUA 1LTBD 2HCCA 3SGIA 3T56B 1DZ1A 3P7JA 4LF4Q 4PMBA 4DV5Q 4HJ5A 2R7ZB 4HIDA 2UXCQ 2XRSD 2PZTA 5DAUA 3CCLA 1VQGA 4RCNA 4QY7A 4QB4A 2K28A 2ZM6L 1TIID 3OYYA 5C4XG 3KF8B 1CK1A 2JEAI 4ZYSA 3J80L 2NUCA 4B3MQ 2MNAA 4ZUJA 1RKNA 2G9HD 3DUZA 2XVSA 1SXTA 1YJNA 5EKLA 4A76A 4LF5Q 2VL6A 1A6XA 3RZOH 1VQOA 4AQYQ 1JB7A 4QUCA 1BUVT 4K5XA 3I4MH 2CH4A 1X6OA 1HHVA 1L2FA 1TWHB 4KKUA 4XQQA 1ENCA 1KNEA 1TWFB 4NB3A 4DV2Q 2NVTH 3TEHB 3JAML 2V1CC 3CCUA 3G48A 4DN4M 2BH2A 5JJLA 1CFMA 3NSWA 4PZ8A 4BY7G 4JI0L 1KRSA 1RHPA 3Q8DA 5E7NA 4YWLA 1XNQQ 4NXMQ 2HUGA 3IL8A 3TP8A 4X3TA 1Q86C 5NUCA 3NP8A 1STHA 5D14A 4LNQA 2KCNA 4ZKCB 4IPHA 2K5HA 1ILPA 4IJHA 1VQJA 3FVQA 3URYA 1DCZA 4A3EG 3D0FA 2EVBA 4RAUC 2K5WA 4C3HB 1I3QH 1PRTF 3J80i 2JK8A 4JI2L 2KOLA 5C5MA 5C3XA 4J8QA 4RGNA 2VXWA 2F1MA 1JJ2A 4V0BA 2E5LL 1JR0D 4B3ML 1YITA 5M3MG 2YU9B 4DUZL 1BKBA 4KTAA 4C2MH 1QVFA 4DAVA 2JA7B 2A74C 4KJNA 3T16A 5I6YA 1G2TA 3W1BA 2ZM6Q 3K5OA 3MFGA 4A3JH 1VQ4A 3GTLB 1QUQA 1A2UA 3NBIA 4FO2A 3TS2A 5C4HA 4I65A 1XMQL 3S2HB 1LTTD 3TS0A 3N52A 1HZCA 4JBWA 1QG7A 2WV6D 3MXUA 4HJ9A 3ULPA 1EUJA 3L2PA 4NXML 2OQKA 5LL6S 4B3RL 1A3UA 3H09A 1SE3A 3H3VH 2R92H 2RDHA 2E8GA 3BJUA 2ES2A 1LT5D 1HTLD 4B3SL 4FDBA 2L4NA 4OL7A 1PLFA 5C0XG 4WFN3 2E5LQ 1SNCA 3EROA 2F3IA 4NW2A 3I4NG 4DV0Q 4JI1Q 2B2VA 3BYTB 4DNRB 1XTCD 4TRDA 3A55A 1V8QA 1C0AA 4X6AH 2WP8J 1JWMD 2PZUA 3A8IE 2NN6G 5AFWA 3G71A 1IBKQ 3CHBD 1TWCH 1SSOA 5D3DA 3FDTA 2K05A 1CZWA 4DXFA 4R8IA 2Q8RE 2AUKA 1SYCA 1C4QA 3HOZB 2HDMA 1VMPA 1U4MA 2I07B 4KY7A 2RCFA 3S1MB 1NY4A 4X3SA 4XQNA 1NAPA 1WTPA 1VQKA 2CVRA 1B9MA 1EIYB 5M5XH 3J81j 4PG3A 4DR4L 3BZKA 3NBHA 2ZTCA 1BCPD 1BQQT 2B2TA 2EDGA 1PTOF 3CPFA 4A3JB 2F0DA 4UHVA 3I90A 1B53A 2DNCA 4P73A 5EAYA 1E0BA 4P75A 1EFWA 4CJ2C 4DV7L 3FP9A 3MEHA 2CFMA 3TN2A 3DHQA 4DR3Q 2E76C 2WKCA 4KV6A 3CCSA 4LUVA 2K1BA 3OMGA 4P72A 3MAQA 4HR7B 3PO2G 1ILQA 4JCVE 4DR7L 2PMZE 1GUGA 1PH2A 4JBMA 5FLMH 2YYZA 2LMCB 4KD3A 3J81c 2RHQB 3TP7A 4IQZA 4L8JA 4XYOA 3KFUA 2CHBD 4J6HA 2WINB 1UE1A 1SFOB 1RD9D 4LFBQ 5I2XA 2XIWA 2YTYA 2B8FA 3HOXH 3I72A 2NZ1D 1GM5A 1HNWQ 2AUJD 2E74C 1KNAA 3D4RA 2OWOA 2B63H 4JW0A 1FJGQ 3GV3A 1N33Q 2Q2UA 1D5ZC 4JYAL 3ND8A 3S16H 4DNTB 4DV0L 4LF4L 1QWYA 4OO1G 1EY5A 1TY2A 3JAMi 2LXJA 3E3XA 1D1KA 4G57A 1M90C 3VR4A 3HOUB 1SR3A 4J1MA 1K8MA 4P71A 2IX3A 4R4IA 1Q46A 1IBML 1LV9A 2CW0D 2WKDA 3A7AB 5D65A 3S15B 4LF8L 2AQ3B 5M5XB 2L11A 3CKIB 3TQYA 3ULJA 3GDEA 5FO8B 5GADC 1PV4A 1PVOA 1IHZA 1D8LA 3T51B 2B39A 4IPGA 3S2DB 1Y1VB 3NWTA 2PQAB 2K03A 5IWAL 2AWOA 1N36L 1YJWA 1WOCA 3ONAB 4JC0A 3B6YA 5KYIA 3Q23A 1IBLL 1GJXA 1CKNB 3CPWA 2BDOA 5FOBB 1GUTA 4IPCA 1WTRA 2ICIA 3IKJA 5FLXc 2ZJQA 5JVG3 2EJFC 5KNDA 1W6KA 4KK7A 2E2HH 2B2YA 2QKIC 4IUTA 3HG9A 5JEAH 1O80A 3K7UC 2EXZA 4L6TB 1HCZA 1ML0D 1STBA 2MUYA 4K14A 1QILA 1MI2A 1UEAB 3CRKC 1CHQD 4YWKA 3MC0B 3DWPA 1AP0A 1HZ9A 1A3VA 4NKLA 2R7ZG 4HSVA 4M8AA 3VR3A 5JPNC 2VUMG 4KMUC 2DJGC 3KF8A 4FYDA 4QIWE 1N34L 4KKTA 1WYDA 1C8CA 5C4XB 2PMZB 4A3DB 1TU2B 1VQHA 1QUQB 4DV2L 2F03A 1SJHD 3BVZA 1KL9A 5CBAE 4MZ9A 1VQBA 3HOYH 1EZ8A 4H7BA 4P2CB 3CF5A 2FMMA 2R93H 4A4IA 2J4XA 3P75A 4C3JG 3TZUA 5IT9E 2FFKB 2K50A 3HOVB 2F0GA 1FVIA 3DM1A 2VS1A 1Q12A 2E75C 1VQCA 1T5XD 1KQSA 3UDGA 4RH6A 5M3FH 1GHJA 2K5NA 2I0QA 1AW7A 3V2TA 3NWSA 1O7IA 2D5DA 4K0KL 2X6LA 1K8GA 4RKLA 1GOZA 2CH4W 1SYFA 5KGUA 4KI0A 5C4JH 4B08A 3I4MB 4HAEA 1R9TB 5G3LF 1TVXA 2BCOA 4J15A 1B9NA 1KTKA 3TRZA 5IYCH 5CMDA 2KVMA 4DR3L 3HOVH 2F0LA 4A3IG 1A2TA 4X65Q 2M2LA 3VYUA 3NK9A 2QCPX 5KRUA 3IFDA 1A8VA 1RJTA 1IKMA 1G6ZA 2EJGC 2H5XA 4ZQ3A 2K33A 4IURA 5BN4A 4Q5VA 3LX0A 4LJZC 3CD6A 2E2DC 2HDLA 4JVZA 2ID0A 3S2HH 4H02A 1K8AC 1SYBA 2VY3A 1N8RC 1I4XA 2MPMA 1VQ9A 5DM73 2QW7A 3PUZA 2R7ZH 4A3CG 2NN6I 1V1OA 2TSSA 1KRTA 3AFPA 3KLRA 4HTHA 3G4SA 2B2WC 4OXPA 2MQHA 1Y69U 1W2BA 1Q90A 1ET9A 4QQBX 1CHPD 4GN3B 2QEXA 4XT3B 2F4IA 3EBEA 3W1GA 1LTGD 4LFBL 4BBRB 4DV5L 3HEJA 5CV4A 2A6ED 3S14H 4ODGA 4AIMA 2O5JC 3CXCA 3PO3G 2F0IA 1WTHA 1ZYRC 2ZTDA 2E2JB 1STAA 3S17H 1ESRA 1N32L 1WD1A 3CRLC 4IUNA 5ELFA 2MO1A 4IO9A 3J7A5 1XX8A 2QDBA 4OWTB 1IYVA 5FO9B 4DV7Q 2JEBI 4MTKA 1PTOH 3CU7A 1QJOA 3CCEA 2L55A 4O1NA 1Y1WH 2A69C 1K8OA 1PRTC 4Y7NB 2DUDA 3HOYB 3I4LA 4A3EB 3HZXA 3DXJC 2A8VA 3HOVG 1LTID 2MJ8A 2XRQD 3H0GG 4R1JA 3J7YW 3K0YA 1PZKD 3FKIH 4A3JG 3SEBA 2K7VA 5FKAC 2RKSA 4ALPA 4BBSG 4P74A 3RZOB 4XIGS 2B2VC 1JOOA 3FMCA 1EQRA 1ZYRD 2PCFB 5C3EG 3U4ZA 1HFGA 3P1HA 1EYAA 1YVCA 3BYYB 3HOWH 3S24A 1DXMA 2E2IB 4DAMA 1I3QB 2N49A 2XN9C 1CSQA 2LFNA 4CJ1B 5JJZA 5EBCA 1JICA 4B9XA 2BDNA 2L0CA 1AZQA 4IUPA 1CKMA 1PZID 1EYCA 4N9PA 4GNXA 4A3IH 3VR5A 3DEOA 1WVLA 1FR3A 1CTMA 3A8KE 4B3RQ 3GTQH 3BU2A 3Q22A 2KQ3A 2K5DA 1Q1BA 4K5WA 3EJIA 1SFOH 3E6ZX 4RCOA 4YCVA 4OWXB 5IIFA 4DNIA 2HIXA 5C3EH 5ELBA 2RHSB 2NVXH 2M9VA 3MEFA 3HOZG 3K5LA 1RDPD 2PYKA 5K36G 1QE6A 1U4RA 2NZHA 4POGA 4C3HH 1TWFH 1K83B 5C5LA 3SDZA 1SJED 1EIFA 3PCOB 1YHAA 4JI5Q 3NQTA 4BA1I 3IFTA 4ZCKA 3E0JA 4LWCA 4B3SQ 2MFIA 2DY7A 2D2CC 1K9MC 1PH7A 3RLFA 3GTQB 5GAGC 1XMOL 1UE5A 3VDYA 1DOLA 2JQOA 3T4AC 4M1UB 1G51A 2PZWA 4BY1G 4IJLA 4F87A 2UXBQ 2ZJPA 3RR5A 3J80c 2RA4A 5E4XA 2NVQH 1D1IA 2Q8IB 3AB9A 1F9QA 5AJ3L 1E3PA 1UEBA 2EPBA 1WTVA 4A3DH 1L1OC 3TP5A 1UE6A 1KDAA 4IALA 4KHVA 2NN6H 5IP7G 2EY6A 4A75A 4NP5A 5I2YA 4A3MH 2JA6B 1HNZQ 4YY3L 1D2BA 3M4OB 3I4OA 2F0OA 1FD7D 4KHPL 2A6HC 1VQMA 1X32A 3MXPA 4CBVA 4YHHQ 4UP7A 1LT4D 4Y52H 1P16A 1QOHA 4FF3A 3K5MA 3KF6B 4ZUIA 3D8GA 3I56A 4BY1H 1S5DD 3TDQA 1MJEA 3PMFA 5GQOA 4X64L 2E2JH 2XSCA 5JPMC 3HKZB 1WD0A 4GS3A 2PQEA 3PF4A 1I94Q 2HT1A 3HFZB 2JXMB 1VQ8A 3GTJH 4LF8Q 2IPKD 4LFCQ 4C3IB 1XNRQ 1OXXK 3M4QA 3S2DH 2K52A 3FPUB 3HOWG 1A15A 3EFXD 4DU9A 2PQAA 3KBGA 4G7ZC 1DD2A 4IFDI 1NR4A 2KENA 3CMEA 2UXBL 1PXUA 1VQLA 3M3YH 2K5QA 2L9HA 1ASZA 3D3RA 5DLQE 1HH2P 1YZ6A 1H9MA 3CQZH 4C56C 5HY6A 1CSPA 1FGBD 3OTOQ 4HJAA 1Q82C 1BXTA 5CORA 1KXLA 3E0EA 2AHOB 1EU4A 2K75A 1HA5A 1HNZL 5C44H 4RG1A 2RBMA 5CV8A 1V9PA 2ASBA 2NVTB 4RMFA 3F2BA 4BWGB 1SYEA 1PYWD 4V190 1G91A 4JV5L 3KYHC 1I50B 1E2WA 2DJFC 4F88A 3GTMB 4JI7L 3J81i 1DONA 4YHHL 3R2IA 4JOIC 3RD4A 2F0MA 2DGYA 5LMUQ 4LFCL 3BG3A 5IP7H 1STYA 1I6HB 1VQ7A 3R3OA 4IZ8A 2GVAA 1CKOA 1CA6A 4A3DG 1YHBA 2Z9HA 1D5MC 2AKWB 1XNQL 1JJCB 2RCNA 4QF4A 3GP7A 3L3OC 2PO4A 1MGSA 4GNXB 1B50A 5ELOA 4E6IA 2EYMA 2OCEA 3BZDB 1HXYD 4FF4A 5FJ8G 3ER0A 3ZYYX 1E2VA 1CI3M 4OX9Q 4HJ7A 4N8FA 2BE5C 4PV1C 2XGTA 2UU9Q 5IT9c 1XMOQ 1SNOA 4C2MB 1XJVA 2YU9H 1PFMA 3PIOA 3PO2B 1KC8C 2IJ0A 1EY4A 1JB3A 1DM0B 1Y1VH 3U50C 1EY8A 1LYLA 4F7XA 1F2ZA 4JI1L 2WB1E 2WACA 5M5WB 4JI5L 2GN5A 3IRBA 4HCSA 3PF5A 2ZJRA 3A56A 5IYCG 1UAPA 1G2SA 3GTKH 3L7ZC 2L12A 4PZ6A 2EYJA 1LUZA 3BDOA 3M7NA 3WOFA 1T9HA 3J81L 2RSOA 1QVCA 5BR8Q 4DFAA 3DMUA 4A3FG 1SYGA 3Q0AA 5JVH3 1K0SA 3RZDB 2EQSA 3RUZA 3BDCA 5EPLA 3HP3A 1BCPC 4A3IB 5ISRA 5LMUL 1WTXA 1SNPA 3GTPH 1PFNA 4OIJA 1BNZA 1Y8OB 1AE2A 1SDFA 2ZTEA 2A73B 3MVVA 1VQNA 2KCTA 5I4DA 4GOPC 4ME3A 2D0OA 5CV9A 1TWHH 1FGUA 2X6GA 2NVXB 2HIVA 3S1QH 1IYUA 4BY7B 2IW3A 3GTKB 2NB0A 1EQTA 1DJRD 4G7OC 1LACA 4H44C 2LSSA 1EEFD 4RWSC 3EQLC 1I4QA 4ULLA 1J5EQ 2XNAC 2UXDL 1OXSC 1K83H 3VYSA 3CP0A 4A3EH 1AE3A 2DNEA 5CR3A 1Z7TA 2EJMA 3RMHA 2OXPA 3FRPB 3SK6A 1RTOA 5L37A 1UWVA 1PTOB 1N36Q 2B2UA 5CBEE 4DK3C 3S1QB 3WDNA 4JI3L 2KJXA 4S3SA 4K8IA 3HOXG 3KJPA 3D6CA 3X3NA 1U4LA 2MHVA 1SE8A 4JYAQ 4G7HC 1PDQA 2MO0A 1NUCA 1HRJA 4DAPA 3HOYG 1MKHA 4FXKC 5JAVA 4A3GB 3S14B 5IGDA 3GTPB 5T1IA 3VA7A 4AYBE 1PHJA 2GVBA 4KHZA 4A3MG 1CQFA 4DKAC 2VUMB 4LF9Q 1ESFA 3CC2A 4C3IG 3PIP3 1R4PB 2Q8TA 2WFWA 2JA6H 4RGMA 1NJIC 2VNUD 5C3EB 2B2TC 4DR7Q 4DR2Q 1I50H 3LNNA 3C46A 1JWSD 3WWVA 2IX0A 1HNWL 4BY1B 3T1YL 3EA6A 4A93B 2R92B 1OTCA 5IOCA 3PUXA 3I7FA 1MIUA 3Q24A 2RQXA 2NYZD 1SNQA 2OTJA 1VQDA 2WAQE 2N78A 4RFBA 4OHJA 1Y14B 3TMEA 1X55A 2YV5A 3KUPA 3S1RH 1U9RA 2Y0SB 4WJ3M 3C1EA 1PFSA 4O42A 3K58A 1RODA 2D62A 3M4OH 4KKSA 1SLJA 2ZXOA 1LT6D 4EQ5A 3WOEA 1I6HH 1PMRA 3I2ZA 1PFBA 1WCMG 2AMCB 3PIO3 2NZOA 2B8GA 4A3LG 5A35A 4K0KQ 2BE5D 3D4WA 2EYPA 1B2TA 2WAQB 4KHPQ 2L15A 4X64Q 1AFPA 3HOZH 4EQNA 4JI3Q 4CDDC 4BS9A 1PH5A 3J7AF 4OONA 1HUMA 3PV0A 1A3TA 4KJOA 4U68A 2SDFA 4EQOA 1F9PA 1FL0A 4FP5D 2EY1A 1L1OA 4B3TL 2BH8A 2PPBC 5DNFA 1HFNA 1NCVA 1HQMC 2KA7A 2B2WA 3AFQA 4IOCA 2I5HA 2GA4B 1HA6A 2WB1G 3NEMA 1TWGB 1C9OA 1JWUD 4X66L 1B44D 2QF7A 3OWFA 4FVMA 1EIHA 3OIPA 2B29A 5JJKA 3K6OA 3PGZA 4WRDA 4DV3L 2HHHL 4OO1H 4A3BG 3PUVA 3CQZB 5J1ZA 5IE8A 3HOXB 1X9NA 1IXRA 1SE2A 1XWEA 1N9WA 4HJ8A 2B3GA 4ILWA 1FNUA 1NR2A 2OEOA 3F1ZA 2Z6KC 2F4VL 1GUOA 2CWAA 1IW7C 2EZVA 5HURA 3BS1A 2PW7A 4MNOA 5EPJA 2VB3X 1VQIA 1BCPB 5BN5A 2JA6G 4C3JH 3NQIA 1RTNA 1LM0A 1W3SA 3PO3B 4HCEA 4C1NK 2IT1A 2R93G 3RN5A 1TWGH 3SK4A 3KF6A 4NXNQ 3RZDH 1P8LA 4RGOS 1AEXA 4OELB 2A68C 1NTGA 3I4NH 1TY0A 4FNFA 4DPGA 1FJGL 3HKZG 3M7GA 5I9OA 2LS01 3H91A 3CW2C 4QL5A 1WTQA 5FLXL 1EL0A 2Q2IA 3S17B 2F52A 1NE3A 5FO7B 1K28A 1R9TH 2UU9L 2K01A 1YNJC 5CYUA 2IHFA 2N55A 1NMGA 5IYDH 2HCIA 4AH6A 1YBYA 3HS0C 2Y0SG 2EY5A 5A2QE 3EIVA 3H0GB 4KY6A 1BVSA 1IBLQ 5M5YH 4AQYL 4DV4Q 4Y7NH 1LO5D 1YHQA 5K36H 1WCMB 4MN3A 3PUYA 3R93A 4CGYB 3S1NB 3W3AA 5C4ZA 1F2YA 5IP9H 1S5FD 4WJWA 4LF6L 1B7YB 4JOIA 4ZK9B 4X66Q 2X69A 2KHJA 3I4NB 1N33L 2N3SA 2BOSA 4K6LA 1F77A 1L0WA 1S5CD 5D3IB 4L5QA 3NTKA 4DR5Q 1A0IA 2HQEA 2F3VA 5LMNW 1YNJD 3U9OA 3KDFB 5A2QL 1X3EA 1FNVA 1HZAA 3HGBA 3UDXA 4X62Q 3K57A 3CC4A 2EYOA 1RF2D 5I6WA 2A69D 4DR1L 4DAYB 1J9OA 2FHTA 3H94A 1ASYA 5KIXA 2K5VA 4A3MB 1BO0A 1CZGA 5IY0A 4DK0A 1GUNA 2R61A 3MXNB 4DV3Q 5T1GA 2HHHQ 1OXVA 1JOQA 2EYLA 3A8JE 2ZXRA 1H9JA 1SBBB 3CMAA 3C3LA 4QIWB 1VQ5A 3QJYA 1X65A 3QG1A 3W2DA 5JJIA 3CC7A 3VYRA 1TWAH 4X65L 4YIJA 4LF6Q 1IYJB 3H0GH 4A3BB 3T1YQ 2ALYB 4HN7A 1G6PA 1WI5A 4A3GH 3GQBA 3U58A 3OMCA 4B3TQ 2PNRC 4RGTA 4HMIA 2LKVA 1HZBA 4LK1C 4DUYQ 1EFID 4LAAA 2ZT9C 3A5UA 4PNYA 3HKSA 2XWJB 1LTSD 2VQEQ 1TR5A 2L5TA 2IHEA 1WCMH 2ENBA 3K7AH 1PRTD 1V1PA 2ATWA 2R93B 3MFYA 1B4OA 5KEEA 4CDEC 1WFQA 2A1AA 4DUZQ 1JCKB 3PO3H 3R2TA 3VR2A 1VQFA 2M00A 4WORA 5F2DA 4IN3A 3V96A 1TXYA 1AZPA 3HRZC 3F2CA 2H1EA 1Y1WB 4KN4C 4QCLA 4QJFA 2QGQA 3NPPA 3T1HL 2IX1A 2Z6KA 2R6GA 2NTTA 1BBXC 3LGJA 4A3GG 3M4YA 3X3MA 4B9WA 1D6EC 1EWIA 1VQEA 2NTSA 1K0RA 4JK1C 1G291 3VYTA 2JJQA 2Q2TA 4C3HG 1TS5A 1SMYC 2I5MX 3OOCA 4JBJA 5BN3A 1SEBD 4XYQA 4GLXA 1M8AA 2A68D 2NBFA 4BXXG 2F3WA 1ZEQX 4CHTB 5ELNA 4X3UA 2SEBD 4C1NI 1SE4A 1KIXA 3UE1A 5J3BA 2WB1B 1K3BC 3KLWA 2Z8LA 4WJ4A 3K8AA 2JA7G 1E24A 1TWAB 3DLLA 4A93H 2E2IH 1Q1EA 4IPDA 4TSSA 3OSOA 4DK6C 2YTXA 1U0LA 5C4XH 1YIJA 3D6WA 2FMCA 2R3ZA 4OEMB 1Z47A 4R9WA 1A62A 3MWYW 1NNXA 2O4XA 2F0VA 3QOLA 1F2MA 2UUCQ 1Q8IA 1CT1D 1S3OA 2XWBB 3EVQA 1NMFA 3AQQA 3DEPA 4LF5L 2A19A 1F2LA 1H95A 2QDLA 3NHHA 2O5IC 1X3PA 3D31A 3KLSA 2EYHA 2A6HD 2LXKA 3DWAA 2G5DA 1SNMA 1I6VC 3FHWA 1NBWA 1B3AA 1EU3A 4HIKA 5EKIA 1PYBA 4HMJA 5C6AA 2KCMA 2OQ0A 3MA2B 4A3KH 2UUBL 3UDIA 1I4RA 2CQAA 3H3VI 1F9SA 1XMQQ 5EJWA 2F0PA 3QIAA 2QA4A 2F0UA 4XTCS 1WJJA 4FF1A 3I55A 4C3JB 2JN4A 1GD7A 5FK9C 3FPPA 4EQPA 4HEDA 4R4TA 4L5RC 4LUZA 2NVYH 5IGFA 5JOBA 1CUKA 4JI2Q 5IWAQ 3E9IA 5C4JB 4A93G 3VA5A 4CKBA 2CKZB 2NVQB 1GHKA 3OTOL 2EIFA 3TP6A 1VMCA 1Q8KA 1EY6A 2UUCL 4DA2A 4UAIA 5H1SE 3F2DA 2RDGA 2K04A 1BDOA 1LLRD 3S1RB 1SNDA 3KLSX 1EWCA 1Y8NB 1Q81C 3NTIA 3AMUA 4GLVB 1MSHA 4OWWB 4JPBW 3T1HQ 1AH9A 1VQ6A 2EY2A 4NPSA 4ZLTF 1D7QA 2Z4HA 5C0XH 3ULLA 1XXGA 4DR6L 4IOAA 3L9AX 3DM3A 3I4MG 1IZ6A 4DV6L 3S1NH 2NVYB 4LF7Q 5IT9L 4DV6Q 5EPKA 3I73A 1TKWB 4IUVA 1PH3A 1V1QA 3QO2A 1LT3D 5M5YB 1BR9A 1X3FA 2L1BA 1PTOD 5FJ8H 1EOVA 5J39A 3NTHA 3JAMc 2C5CA 2KBNA 1KLUD 2WAQG 4ZRZA 3UE0A 2JSOA 1O7YA 2JA8G 1RIPA 2BA1A 5ELEA 5M9OA 1X3QA 1JC7A 4A3KB 1IL8A 4EVOA 4DUYL 2RDFA 4A3FB 1I4GA 3RNUA 1VQPA 3CCVA 1KABA 3QB3A 1D5XC 3A7LA 4OGQC 1MD2D 2IL8A 1VCIA 3G6JB 2Z0SA 2PI2E 3SK8A 1XNRL 2V4DA 4H13C 5CV6A 4MHEA 2CCZA 4K2KA 1E1TA 2BA0A 1V1PB 1PZJD 3MHBA 2A5HA 1K73C 2Q2HA 3GO5A 3U9SA 4DR6Q 4LF9L 1IBMQ 1PTOC 1S5BD 5AJ3Q 1N32Q 2P5ZX 2F0KA 2E2HB 1XPOA 5M3MH 5EKKA 3H3VC 2AQ1B 2VQFQ 2B2UC 1GUWA 4PMCA 3N6RA 1C7YA 4CJ0B 5ELDA 4DGZA 5IYBH 2TMPA 4JI8Q 1YI2A 4R4CA 1LABA 1WTOA 1KDBA 1J5EL 1CM9A 2UUAL 1OXUA 1Z6HA 4O2DA 4DXGA 1S72A 1H9RA 4JI6Q 2XTIA 1Q7YC 2VQEL 5LMNL 5ELCA 3S15H 4FXGC 4JI4Q 1KD1C 5K5PA 5C0XJ 1HR0Q 1OXTA 4QGUA 2FJ2A 1L0XB 1BF4A 3GTGH 1ZKOA 1QZHA 1DYQA 2OT2A 1EWHA 3GTLH 1CA5A 1PA6A 4DR5L 2NWGA 4ME5A 2RF4A 3RLNA 2CW0C 2EOTA 4L5TA 1AN8A 1IBKL 2UUBQ 3C2PA 1J8IA 4TQUS 3AEVA 2Z6BA 2RSNA 2K14A 1UUPA 2H4OA 4BBRH 1N34Q 1QNKA 3CCJA 3BVMA 1BBWA 4PQXA 1O7LA 1U5KA 2Y0SE 1BBUA 1EY0A 2QILA 4L63B 3PQIA 1SYDA 1BCPF 1B70B 3DWQA 1YNNC 1GUSA 2FINB 4DR4Q 2MGSA 1X56A 2EE1A 1IL2A 3T13A 4XXEA 4L5SA 4POFA 4GKKQ 1JQYD 1SRUA 4H0LC 2D0PA 3HKZE 3GTGB 3K5NA 4YWMA 1GVPA 1VF5C 2EYFA 3PSIA 4MIUA 3O13A 1PH9A 5GAHC 1LTAD 1WTWA 1H9KA 1G8ZD 3ZJYC 2PW5A 4A3KG 4OX9L 4XQJA 5IGGA 4HIMA 3RLOA 3KJOA 3NELA 4DAYA 4O0AA 1SMYD 5LMNQ 3GTJB 1I4PA 1GXDC 3A74A 3LWEA 2D9UA 1FYCA 1HNXL 3LWUA 4EX5A 1YNND 1SROA 3NENA 4N8X1 3OIQA 5JEAJ 1DOMA 4GZYC 1JJGA 5DM63 1S4ZA 4K6DA 2UXCL 5EGTA 3K0XA 1K3RA 4PMWA 3OW7A 5M5WH 1XPRA 5C44G 3JC66 4QMGA 4ZAIA 2VW9A 4GKKL 4UY8C 5BR8L 2HD3A 3H15A 2F0NA 4CDFC 1ET6A 3E9HA 4GOPA 3SXHA 2JYOA 3ICEA 2N8NA 2F0JA 2JA5H 3BDLA 2IY5B 1JE5A 3K81C 3SHLA 3VR6A 4R8NA 2N88A 3J7AV 3FEWX 1HR0L 1PYSB 5IYBG 1Y8PB 3V05A 3KDFA 1V43A 1IW7D 4A3FH 1R4QB 2JA7H 3CCRA 4AYBB 2B2YC 5C3WA 3NUCA 5CV7A 5GROA 1E22A 2F0WA 3AYHB 1SN8A 3UDFA 1KAAA 4F8MA 3NBHB 5KYLA 5COYA 2IWHA 1X54A 1JE4A 1X3GA 3UI2A 1H9SB 3A0JA 2YTVA 5M3FG 4RA8A 2OTLA 2F4VQ 3P20A 1E7ZA 4N9TA 4BBSH 3GTOB 4K2LA 1Y1VG 2CQOA 4JI0Q 3TREA 3STBC 2SNMA 3E5SA 3Q6SA 4I7ZC 1GKHA 3M4PA 5C0XI 4GKJQ 5M3MB 3J7ZC 1KDCA 2VUMH 4YY3Q 4R4QA 2MP1A 3MXGA 4JI8L 3QOJA 4TKOB 2K6AA 5IP9G 3I3CA 1UE7A 1L1OB 3PUWA 2R7FA 3MXNA 4APVA 5J22A 5CC4A 3FKIG 3I70A 3S9WA 5EQ0A 1Q3LA 1I5FA 2B63B 1HJPA 1FNWA 2VZAA 1PH1A 3HOWB 1E2ZA 2K32A 5IGBA 1XYIA 1SAPA 1CKNA 1PH4A 4HIOA 2VB2X 5IGCA 4XT1B 3KK7A 1HQRD 4UDUC 5HGQA 1JMCA 3STBD 3T53B 3GD7A 3C1FA 3IAYA 1ICWA 3TSSA 1I94L 2UXDQ 1W6JA 4JI6L 1EIGA 4HSPA 2UUAQ 1EYDA 4GN4B 1STEA 1HNXQ 1QZGA 1J6QA 5JEAG 1GO3E 1VDZA 3H6MA 2F0FA 1PH6A 4OIKA 5IODA 3R8BA 1B3QA 2KEEA 2ZXPA 5HGTA 3G7LA 1OO9B 2SOBA 4A3CH 4UP8A 1VF7A 3OHXC 1KLGD 4DV4L 1HTPA 5E3FA 1PRTB 4DK1A 2I5LX 2C9OA 3ERSX 2G9DA 3QR8A 4NMZA 1DOKA 4Z9CB 4NDXA 1TS3A 2WIIB 4LF7L 3L0OA 5IGEA 1QB5D 2F0TA 1ZXTA 3JAME 2JA8B 2O2LD 3TBIB 1STNA 2F0QA 4A3BH 1MSGA 4XDXA 2R92G 4A3LH 4GNXC 1HR0W 4QUFA 4DV1Q 3ND9A 4RHRA 5G3LD 5TSSA 4GN5A 4DR1Q 1STGA 2QEJC 4LFAQ 1C48A 4X62L 2PNHA 4BA2I 1TQOA 2LY7A 4BY7H 1YJ9A 1A63A 1L0YB 4KN7C 2KECA 3GTOH 2Z1CA 3GTMH 2F0HA 4U673 4G4KA 5LHY1 1HUNA 2A6EC 1RCVD 4KLKA 4YCWA 4YCUA 4GLAC 1NSNS 4TVAB 3K80C 2KEDA 2JA5G 1TT2A 2JE6I 5E4WC 3CCMA 3S16B 2KHSA 1IKLA 4MTNA 2K4KA 1EY9A 3QWNA 1S40A 4DV1L 3MTSA 4BXXH 2JA9A 4IFDG 1VQAA 1EYGA 3OW2A 2R7DA 4CDCC 4KD4A 3ITPA 3NXWA 3HOUG 3OWEB 1CQVA 1M4VA 3M3YB 4K5VA 4CKEA 5LL6X 2PI2A 1SMXA 5DEHA 4JG2A 3SK5A 1I4HA 3K59A 1YEZA 3FKIB 4R4OA 4ABNA 2FXQA 1MBYA
chains in the Genus database with same CATH topology
1B8AA 3HOYH 3U4VA 2QA4A 4C3IH 1Y1WG 1Z9FA 2C35B 4XTCS 1WJJA 1AE2A 2ZTEA 1VS0A 3CF5A 2R93H 3I55A 1VQNA 4A4IA 2KCTA 1GD7A 4UPAA 4GOPC 1M1KC 4PZ7A 2JA8H 4BBRG 4ME3A 1DGSA 2D0OA 1TWHH 1FGUA 4NXNL 1JT8A 4R4TA 3CCQA 4L5RC 4LUZA 2NVYH 4JBKA 2K50A 2EXDA 1FVIA 2VS1A 1CUKA 2HIVA 4JI2Q 1Q12A 5IWAQ 3E9IA 3S1QH 1VQCA 4A93G 1KQSA 3KOJA 3M9BA 3HOUH 2CKZB 3UDGA 5M3FH 2K5NA 2LSSA 3OTOL 1J5EQ 2I0QA 2EIFA 3G6EA 2UXDL 1OXSC 1K83H 3W5OA 1Q8KA 3M85A 2UUCL 3CP0A 4A3EH 1O7IA 5H1SE 1YNXA 3F2DA 4K0KL 1AE3A 1PH8A 4AYBG 4LFAL 4Y52H 1K8GA 5GAEC 1Q81C 4GLVB 3A5ZB 1UWVA 4OWWB 3T1HQ 1N36Q 1AH9A 4JI7Q 1VQ6A 1D7QA 4NPSA 4KI0A 4DK3C 5C4JH 4JI3L 4JV5Q 2KHIA 3ULLA 3HOXG 4DR6L 4IOAA 4J15A 3KJPA 3TRZA 3DM3A 5IYCH 3I4MG 3CAMA 3BZCA 1IZ6A 4DR3L 1RL2A 4DV6L 3HOVH 3S1NH 1SE8A 4A3IG 4JYAQ 4X65Q 4LF7Q 4DV6Q 2MO0A 1PH3A 1MKHA 1V1QA 3HOYG 1X3FA 4OO1I 1A8VA 5FJ8H 4GKJL 1EOVA 1XTDA 3JAMc 2H5XA 2CWPA 2KBNA 2WAQG 4AYBE 1PHJA 3UE0A 2GVBA 4KHZA 4A3MG 2JA8G 1RIPA 2BA1A 3CD6A 4DKAC 1QVGA 2ID0A 4LF9Q 3S2HH 4H02A 1K8AC 3CC2A 2VY3A 1N8RC 2WFWA 4DUYL 3F8TA 2JA6H 1NJIC 1VQ9A 4A3CG 3PUZA 4JI4L 2R7ZH 2VNUD 3PIPA 2B63G 1KAWA 2NN6I 1MJCA 3RNUA 1VQPA 3CCVA 1KRTA 3AFPA 3G4SA 2AWNA 1KHIA 4DR7Q 4DR2Q 4OXPA 1I50H 2MQHA 1LTLA 3WWVA 2IX0A 1W2BA 4QQBX 1VCIA 3RN2A 2Z0SA 3EN2A 2HQLA 2PI2E 4GOPB 3T1YL 1XNRL 4GN3B 2QEXA 4DR2L 4IFDJ 1OTCA 3EBEA 3W1GA 2CCZA 1EQQA 1E1TA 2BA0A 3PUXA 3S1MH 4LFBL 3I7FA 1MIUA 4UP9A 2OTJA 4DV5L 1VQDA 2WAQE 2N78A 5FLMG 1Y14B 1K73C 1X55A 2Q2HA 2YV5A 3GO5A 3S1RH 1XPUA 3S14H 4WJ3M 4DR6Q 4LF9L 2VQFL 1IBMQ 1PFSA 4AIMA 5AJ3Q 1N32Q 3CXCA 2D62A 3PO3G 3PO2H 1XPOA 3M4OH 2ZTDA 5M3MH 1E1OA 1SLJA 4LW1A 4LUOA 3S17H 5IYDG 1N32L 4EQ5A 2VQFQ 1I6HH 3I2ZA 3SGIA 2MO1A 4IO9A 1XPRA 3J7A5 1C7YA 1WCMG 2AMCB 4OWTB 4LF4Q 2NZOA 4DV5Q 4HJ5A 4A3LG 4HIDA 4K0KQ 4DV7Q 2UXCQ 2JEBI 5IYBH 4JI8Q 1YI2A 4R4CA 3CCEA 1J5EL 1Y1WH 1VQGA 3CCLA 2UUAL 4KHPQ 1OXUA 4QY7A 2L15A 4X64Q 4O2DA 1S72A 2ZM6L 3GTPH 3OYYA 3HOZH 5C4XG 2DUDA 4JI6Q 3KF8B 4JI3Q 2XTIA 1Q7YC 1PH5A 2JEAI 4OONA 3PV0A 2VQEL 5LMNL 4B3MQ 2MNAA 2A8VA 3S15H 4JI4Q 1KD1C 3HOVG 5C0XJ 3H0GG 1FL0A 4R1JA 1HR0Q 1OXTA 4QGUA 3FKIH 4A3JG 1YJNA 4ALPA 1L1OA 3GTGH 4A76A 1QZHA 4BBSG 4P74A 4B3TL 4LF5Q 2VL6A 3RZOH 3GTLH 2BH8A 4XIGS 1PA6A 4DR5L 1VQOA 4AQYQ 1JB7A 1EQRA 2RF4A 3RLNA 5C3EG 3U4ZA 3I4MH 1HNWL 4L5TA 3AFQA 4IOCA 1IBKL 1X6OA 1YVCA 2I5HA 1L2FA 3HOWH 3S24A 2UUBQ 2WB1G 4DAMA 4NB3A 4TQUS 2N49A 1CSQA 3NEMA 4DV2Q 3AEVA 2NVTH 1C9OA 2K14A 4X66L 4BBRH 1CKMA 1N34Q 3TEHB 3CCJA 1BBWA 5JJKA 2B29A 4GNXA 1U5KA 2Y0SE 3PGZA 4DV3L 4A3IH 2HHHL 2V1CC 3CCUA 3G48A 1BBUA 4A3BG 3PUVA 2BH2A 5JJLA 4PZ8A 5IE8A 4BY7G 1B70B 1X9NA 1IXRA 1KRSA 4JI0L 1N9WA 4DR4Q 3Q8DA 5E7NA 3GTQH 1X56A 3BU2A 4B3RQ 4HJ8A 4YWLA 2B3GA 1IL2A 1XNQQ 4NXMQ 1Q1BA 4L5SA 3F1ZA 2Z6KC 2F4VL 1SFOH 1Q86C 4POFA 4GKKQ 1SRUA 2D0PA 3HKZE 4YCVA 4OWXB 4DNIA 2HIXA 2CWAA 4YWMA 5C3EH 4LNQA 1GVPA 2RHSB 2NVXH 4IPHA 2K5HA 3MEFA 3PSIA 4MNOA 4IJHA 1VQIA 1VQJA 3HOZG 2JA6G 4C3JH 1PH9A 5GAHC 5K36G 1LM0A 3D0FA 1W3SA 4A3EG 2IT1A 2NZHA 3ZJYC 4C3HH 4POGA 4A3KG 1I3QH 1TWFH 3J80i 2JK8A 4JI2L 4OX9L 2R93G 3RN5A 1TWGH 1EIFA 4HIMA 3PCOB 1YHAA 4JI5Q 3KF6A 3RLOA 4BA1I 3KJOA 4NXNQ 3NELA 3RZDH 1P8LA 4O0AA 1JJ2A 2E5LL 2B63H 1NTGA 5LMNQ 4B3ML 3I4NH 4LWCA 1YITA 5M3MG 4B3SQ 2MFIA 3A74A 1BKBA 3HKZG 4C2MH 4DPGA 4DUZL 1HNXL 1FJGL 1QVFA 3CW2C 4QL5A 1K9MC 4EX5A 3W1BA 2ZM6Q 3RLFA 4A3JH 1VQ4A 1SROA 2Q2IA 3NENA 1PH7A 1QUQA 5JEAJ 5GAGC 2F52A 3TS2A 1XMQL 1NE3A 1R9TH 1XMOL 1UE5A 3VDYA 2UU9L 1JJGA 2UXCL 3TS0A 2JQOA 2IHFA 3K0XA 1K3RA 4PMWA 1HZCA 4JBWA 1NMGA 5M5WH 4AH6A 5C44G 3JC66 1G51A 1YBYA 2Y0SG 2VW9A 5IYDH 3EIVA 4GKKL 4UY8C 5BR8L 1BVSA 4BY1G 4IJLA 3H15A 4HJ9A 1EUJA 3ULPA 1IBLQ 3L2PA 4NXML 2UXBQ 2ZJPA 3RR5A 3J80c 2OQKA 5M5YH 4AQYL 4B3RL 4DV4Q 3E9HA 4Y7NH 4GOPA 3H3VH 2N8NA 2NVQH 3ICEA 2JA5H 2R92H 1YHQA 2IY5B 2E8GA 3BJUA 2ES2A 5AJ3L 1JE5A 4B3SL 3K81C 4FDBA 3PUYA 1E3PA 1UEBA 5C0XG 4A3DH 2E5LQ 1L1OC 5IP9H 1UE6A 2F3IA 3I4NG 1HR0L 4LF6L 1B7YB 4DV0Q 4JI1Q 4JOIA 1PYSB 5IYBG 4X66Q 5IP7G 3KDFA 1V43A 2KHJA 4A75A 4A3MH 4A3FH 1N33L 1C0AA 4X6AH 1HNZQ 2JA7H 4YY3L 2WP8J 3CCRA 2N3SA 2NN6G 3G71A 3I4OA 1IBKQ 5GROA 1E22A 1TWCH 1L0WA 4KHPL 1VQMA 3AYHB 4YHHQ 1SN8A 4L5QA 3UDFA 4DR5Q 1A0IA 4UP7A 5LMNW 3NBHB 3KDFB 1X3EA 1X54A 1X3GA 1HZAA 1P16A 2YTVA 1NY4A 3A0JA 3UDXA 4X62Q 5M3FG 2OTLA 2F4VQ 1VQKA 3CC4A 1E7ZA 1EIYB 4BBSH 3KF6B 4DR1L 5M5XH 4DAYB 3J81j 4PG3A 3I56A 4DR4L 4BY1H 3BZKA 1ASYA 1Y1VG 2CQOA 2K5VA 2ZTCA 3TREA 4JI0Q 1MJEA 3STBC 5IY0A 3MXNB 1GKHA 3M4PA 5GQOA 4X64L 1OXVA 5C0XI 4DV3Q 3CPFA 2E2JH 2HHHQ 4GKJQ 4GS3A 3J7ZC 3CMAA 3PF4A 1I94Q 4YY3Q 4R4QA 1VQ5A 2VUMH 2HT1A 4P73A 4JI8L 1X65A 5EAYA 1EFWA 4P75A 5JJIA 3HFZB 3CC7A 4X65L 1TWAH 5IP9G 3FP9A 3GTJH 4DV7L 1UE7A 2CFMA 1VQ8A 1L1OB 4DR3Q 4LF8Q 4LF6Q 3PUWA 1IYJB 4LUVA 3H0GH 2R7FA 3CCSA 4LFCQ 4P72A 1OXXK 3M4QA 3FKIG 4APVA 3T1YQ 1XNRQ 3S2DH 2ALYB 2K52A 3HOWG 3PO2G 1I5FA 2PQAA 4JCVE 1WI5A 1G6PA 4DR7L 1HJPA 2VZAA 2PMZE 1PH2A 4A3GH 3U58A 1PH1A 4IFDI 4B3TQ 2KENA 4JBMA 3CMEA 5FLMH 2UXBL 1CKNA 2YYZA 1VQLA 1HZBA 3M3YH 4DUYQ 3J81c 2RHQB 1PH4A 4HIOA 1ASZA 5DLQE 3A5UA 3KFUA 1HH2P 1UE1A 3HKSA 5HGQA 4LFBQ 2VQEQ 1JMCA 1YZ6A 3STBD 3GD7A 3CQZH 5HY6A 2YTYA 1CSPA 1I94L 2UXDQ 4JI6L 3OTOQ 4HJAA 1Q82C 3HOXH 2IHEA 1WCMH 1GM5A 1KXLA 3K7AH 3E0EA 2UUAQ 1HNWQ 4MZ9A 2ATWA 2AHOB 2K75A 4GN4B 1HNXQ 1HNZL 2OWOA 1WFQA 2A1AA 4DUZQ 1FJGQ 1N33Q 1QZGA 5C44H 3PO3H 4RG1A 1J6QA 5JEAG 2Q2UA 1GO3E 4JYAL 3S16H 1V9PA 2ASBA 1VQFA 4DV0L 4LF4L 4RMFA 1PH6A 1TXYA 3F2BA 4OO1G 3F2CA 3JAMi 2LXJA 4JV5L 3KYHC 4A3CH 4UP8A 1M90C 4QJFA 1SR3A 4JI7L 2QGQA 3J81i 4P71A 4DV4L 3T1HL 2IX1A 2Z6KA 2I5LX 2R6GA 4JOIC 4R4IA 1Q46A 3ERSX 4YHHL 1IBML 3LGJA 4A3GG 2DGYA 5LMUQ 4LFCL 1EWIA 1VQEA 1K0RA 5IP7H 1G291 4LF8L 2JJQA 2Q2TA 3TQYA 1VQ7A 3ULJA 3GDEA 4LF7L 3L0OA 5GADC 2GVAA 2I5MX 1PV4A 1CKOA 4JBJA 1PVOA 4A3DG 1YHBA 1D8LA 4GLXA 4BXXG 2AKWB 1XNQL 5ELNA 1JJCB 4IPGA 2RCNA 4A3BH 2R92G 4A3LH 1KIXA 3UE1A 5J3BA 4GNXC 1HR0W 3KLWA 4WJ4A 2PQAB 3K8AA 2JA7G 1E24A 5IWAL 2AWOA 4DV1Q 5ELOA 4GNXB 1YJWA 1N36L 1WOCA 4JC0A 3B6YA 2OCEA 3DLLA 4A93H 2E2IH 1Q1EA 4IPDA 4GN5A 4DR1Q 4DK6C 1IBLL 1CKNB 3CPWA 5FJ8G 3ER0A 2YTXA 1U0LA 4LFAQ 5C4XH 4X62L 1YIJA 2PNHA 4BA2I 4OX9Q 4BY7H 1Z47A 4IPCA 1YJ9A 4HJ7A 1A63A 1A62A 3GTOH 3GTMH 5FLXc 2XGTA 2UUCQ 2UU9Q 2ZJQA 5IT9c 1S3OA 1XMOQ 2E2HH 1XJVA 2YU9H 3PIOA 1NMFA 4KLKA 1KC8C 4YCWA 4YCUA 3AQQA 4GLAC 3K7UC 4LF5L 1Y1VH 2A19A 4TVAB 3U50C 3K80C 1LYLA 2JA5G 2JE6I 1H95A 3CCMA 4JI1L 2WB1E 4YWKA 3D31A 2K4KA 4MTNA 4JI5L 2GN5A 3IRBA 3PF5A 1S40A 2ZJRA 1HZ9A 2LXKA 5IYCG 4DV1L 2R7ZG 4BXXH 3FHWA 3GTKH 2JA9A 1NBWA 3L7ZC 4PZ6A 1VQAA 1LUZA 1EYGA 3OW2A 3M7NA 4IFDG 1T9HA 2R7DA 1QVCA 2VUMG 4HIKA 4QIWE 1PYBA 3HOUG 1N34L 5BR8Q 1WYDA 2KCMA 2PI2A 4A3FG 1SMXA 1VQHA 1QUQB 4JG2A 2OQ0A 4DV2L 2EQSA 4A3KH 1YEZA 4R4OA 2UUBL 2FXQA 3UDIA 1KL9A 5LMUL 3H3VI 1VQBA 1XMQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8A A;  3HOY H;  3U4V A;  2QA4 A;  4C3I H;  1Y1W G;  1Z9F A;  2C35 B;  4XTC S;  1WJJ A;  1AE2 A;  2ZTE A;  1VS0 A;  3CF5 A;  2R93 H;  3I55 A;  1VQN A;  4A4I A;  2KCT A;  1GD7 A;  4UPA A;  4GOP C;  1M1K C;  4PZ7 A;  2JA8 H;  4BBR G;  4ME3 A;  1DGS A;  2D0O A;  1TWH H;  1FGU A;  4NXN L;  1JT8 A;  4R4T A;  3CCQ A;  4L5R C;  4LUZ A;  2NVY H;  4JBK A;  2K50 A;  2EXD A;  1FVI A;  2VS1 A;  1CUK A;  2HIV A;  4JI2 Q;  1Q12 A;  5IWA Q;  3E9I A;  3S1Q H;  1VQC A;  4A93 G;  1KQS A;  3KOJ A;  3M9B A;  3HOU H;  2CKZ B;  3UDG A;  5M3F H;  2K5N A;  2LSS A;  3OTO L;  1J5E Q;  2I0Q A;  2EIF A;  3G6E A;  2UXD L;  1OXS C;  1K83 H;  3W5O A;  1Q8K A;  3M85 A;  2UUC L;  3CP0 A;  4A3E H;  1O7I A;  5H1S E;  1YNX A;  3F2D A;  4K0K L;  1AE3 A;  1PH8 A;  4AYB G;  4LFA L;  4Y52 H;  1K8G A;  5GAE C;  1Q81 C;  4GLV B;  3A5Z B;  1UWV A;  4OWW B;  3T1H Q;  1N36 Q;  1AH9 A;  4JI7 Q;  1VQ6 A;  1D7Q A;  4NPS A;  4KI0 A;  4DK3 C;  5C4J H;  4JI3 L;  4JV5 Q;  2KHI A;  3ULL A;  3HOX G;  4DR6 L;  4IOA A;  4J15 A;  3KJP A;  3TRZ A;  3DM3 A;  5IYC H;  3I4M G;  3CAM A;  3BZC A;  1IZ6 A;  4DR3 L;  1RL2 A;  4DV6 L;  3HOV H;  3S1N H;  1SE8 A;  4A3I G;  4JYA Q;  4X65 Q;  4LF7 Q;  4DV6 Q;  2MO0 A;  1PH3 A;  1MKH A;  1V1Q A;  3HOY G;  1X3F A;  4OO1 I;  1A8V A;  5FJ8 H;  4GKJ L;  1EOV A;  1XTD A;  3JAM c;  2H5X A;  2CWP A;  2KBN A;  2WAQ G;  4AYB E;  1PHJ A;  3UE0 A;  2GVB A;  4KHZ A;  4A3M G;  2JA8 G;  1RIP A;  2BA1 A;  3CD6 A;  4DKA C;  1QVG A;  2ID0 A;  4LF9 Q;  3S2H H;  4H02 A;  1K8A C;  3CC2 A;  2VY3 A;  1N8R C;  2WFW A;  4DUY L;  3F8T A;  2JA6 H;  1NJI C;  1VQ9 A;  4A3C G;  3PUZ A;  4JI4 L;  2R7Z H;  2VNU D;  3PIP A;  2B63 G;  1KAW A;  2NN6 I;  1MJC A;  3RNU A;  1VQP A;  3CCV A;  1KRT A;  3AFP A;  3G4S A;  2AWN A;  1KHI A;  4DR7 Q;  4DR2 Q;  4OXP A;  1I50 H;  2MQH A;  1LTL A;  3WWV A;  2IX0 A;  1W2B A;  4QQB X;  1VCI A;  3RN2 A;  2Z0S A;  3EN2 A;  2HQL A;  2PI2 E;  4GOP B;  3T1Y L;  1XNR L;  4GN3 B;  2QEX A;  4DR2 L;  4IFD J;  1OTC A;  3EBE A;  3W1G A;  2CCZ A;  1EQQ A;  1E1T A;  2BA0 A;  3PUX A;  3S1M H;  4LFB L;  3I7F A;  1MIU A;  4UP9 A;  2OTJ A;  4DV5 L;  1VQD A;  2WAQ E;  2N78 A;  5FLM G;  1Y14 B;  1K73 C;  1X55 A;  2Q2H A;  2YV5 A;  3GO5 A;  3S1R H;  1XPU A;  3S14 H;  4WJ3 M;  4DR6 Q;  4LF9 L;  2VQF L;  1IBM Q;  1PFS A;  4AIM A;  5AJ3 Q;  1N32 Q;  3CXC A;  2D62 A;  3PO3 G;  3PO2 H;  1XPO A;  3M4O H;  2ZTD A;  5M3M H;  1E1O A;  1SLJ A;  4LW1 A;  4LUO A;  3S17 H;  5IYD G;  1N32 L;  4EQ5 A;  2VQF Q;  1I6H H;  3I2Z A;  3SGI A;  2MO1 A;  4IO9 A;  1XPR A;  3J7A 5;  1C7Y A;  1WCM G;  2AMC B;  4OWT B;  4LF4 Q;  2NZO A;  4DV5 Q;  4HJ5 A;  4A3L G;  4HID A;  4K0K Q;  4DV7 Q;  2UXC Q;  2JEB I;  5IYB H;  4JI8 Q;  1YI2 A;  4R4C A;  3CCE A;  1J5E L;  1Y1W H;  1VQG A;  3CCL A;  2UUA L;  4KHP Q;  1OXU A;  4QY7 A;  2L15 A;  4X64 Q;  4O2D A;  1S72 A;  2ZM6 L;  3GTP H;  3OYY A;  3HOZ H;  5C4X G;  2DUD A;  4JI6 Q;  3KF8 B;  4JI3 Q;  2XTI A;  1Q7Y C;  1PH5 A;  2JEA I;  4OON A;  3PV0 A;  2VQE L;  5LMN L;  4B3M Q;  2MNA A;  2A8V A;  3S15 H;  4JI4 Q;  1KD1 C;  3HOV G;  5C0X J;  3H0G G;  1FL0 A;  4R1J A;  1HR0 Q;  1OXT A;  4QGU A;  3FKI H;  4A3J G;  1YJN A;  4ALP A;  1L1O A;  3GTG H;  4A76 A;  1QZH A;  4BBS G;  4P74 A;  4B3T L;  4LF5 Q;  2VL6 A;  3RZO H;  3GTL H;  2BH8 A;  4XIG S;  1PA6 A;  4DR5 L;  1VQO A;  4AQY Q;  1JB7 A;  1EQR A;  2RF4 A;  3RLN A;  5C3E G;  3U4Z A;  3I4M H;  1HNW L;  4L5T A;  3AFQ A;  4IOC A;  1IBK L;  1X6O A;  1YVC A;  2I5H A;  1L2F A;  3HOW H;  3S24 A;  2UUB Q;  2WB1 G;  4DAM A;  4NB3 A;  4TQU S;  2N49 A;  1CSQ A;  3NEM A;  4DV2 Q;  3AEV A;  2NVT H;  1C9O A;  2K14 A;  4X66 L;  4BBR H;  1CKM A;  1N34 Q;  3TEH B;  3CCJ A;  1BBW A;  5JJK A;  2B29 A;  4GNX A;  1U5K A;  2Y0S E;  3PGZ A;  4DV3 L;  4A3I H;  2HHH L;  2V1C C;  3CCU A;  3G48 A;  1BBU A;  4A3B G;  3PUV A;  2BH2 A;  5JJL A;  4PZ8 A;  5IE8 A;  4BY7 G;  1B70 B;  1X9N A;  1IXR A;  1KRS A;  4JI0 L;  1N9W A;  4DR4 Q;  3Q8D A;  5E7N A;  3GTQ H;  1X56 A;  3BU2 A;  4B3R Q;  4HJ8 A;  4YWL A;  2B3G A;  1IL2 A;  1XNQ Q;  4NXM Q;  1Q1B A;  4L5S A;  3F1Z A;  2Z6K C;  2F4V L;  1SFO H;  1Q86 C;  4POF A;  4GKK Q;  1SRU A;  2D0P A;  3HKZ E;  4YCV A;  4OWX B;  4DNI A;  2HIX A;  2CWA A;  4YWM A;  5C3E H;  4LNQ A;  1GVP A;  2RHS B;  2NVX H;  4IPH A;  2K5H A;  3MEF A;  3PSI A;  4MNO A;  4IJH A;  1VQI A;  1VQJ A;  3HOZ G;  2JA6 G;  4C3J H;  1PH9 A;  5GAH C;  5K36 G;  1LM0 A;  3D0F A;  1W3S A;  4A3E G;  2IT1 A;  2NZH A;  3ZJY C;  4C3H H;  4POG A;  4A3K G;  1I3Q H;  1TWF H;  3J80 i;  2JK8 A;  4JI2 L;  4OX9 L;  2R93 G;  3RN5 A;  1TWG H;  1EIF A;  4HIM A;  3PCO B;  1YHA A;  4JI5 Q;  3KF6 A;  3RLO A;  4BA1 I;  3KJO A;  4NXN Q;  3NEL A;  3RZD H;  1P8L A;  4O0A A;  1JJ2 A;  2E5L L;  2B63 H;  1NTG A;  5LMN Q;  4B3M L;  3I4N H;  4LWC A;  1YIT A;  5M3M G;  4B3S Q;  2MFI A;  3A74 A;  1BKB A;  3HKZ G;  4C2M H;  4DPG A;  4DUZ L;  1HNX L;  1FJG L;  1QVF A;  3CW2 C;  4QL5 A;  1K9M C;  4EX5 A;  3W1B A;  2ZM6 Q;  3RLF A;  4A3J H;  1VQ4 A;  1SRO A;  2Q2I A;  3NEN A;  1PH7 A;  1QUQ A;  5JEA J;  5GAG C;  2F52 A;  3TS2 A;  1XMQ L;  1NE3 A;  1R9T H;  1XMO L;  1UE5 A;  3VDY A;  2UU9 L;  1JJG A;  2UXC L;  3TS0 A;  2JQO A;  2IHF A;  3K0X A;  1K3R A;  4PMW A;  1HZC A;  4JBW A;  1NMG A;  5M5W H;  4AH6 A;  5C44 G;  3JC6 6;  1G51 A;  1YBY A;  2Y0S G;  2VW9 A;  5IYD H;  3EIV A;  4GKK L;  4UY8 C;  5BR8 L;  1BVS A;  4BY1 G;  4IJL A;  3H15 A;  4HJ9 A;  1EUJ A;  3ULP A;  1IBL Q;  3L2P A;  4NXM L;  2UXB Q;  2ZJP A;  3RR5 A;  3J80 c;  2OQK A;  5M5Y H;  4AQY L;  4B3R L;  4DV4 Q;  3E9H A;  4Y7N H;  4GOP A;  3H3V H;  2N8N A;  2NVQ H;  3ICE A;  2JA5 H;  2R92 H;  1YHQ A;  2IY5 B;  2E8G A;  3BJU A;  2ES2 A;  5AJ3 L;  1JE5 A;  4B3S L;  3K81 C;  4FDB A;  3PUY A;  1E3P A;  1UEB A;  5C0X G;  4A3D H;  2E5L Q;  1L1O C;  5IP9 H;  1UE6 A;  2F3I A;  3I4N G;  1HR0 L;  4LF6 L;  1B7Y B;  4DV0 Q;  4JI1 Q;  4JOI A;  1PYS B;  5IYB G;  4X66 Q;  5IP7 G;  3KDF A;  1V43 A;  2KHJ A;  4A75 A;  4A3M H;  4A3F H;  1N33 L;  1C0A A;  4X6A H;  1HNZ Q;  2JA7 H;  4YY3 L;  2WP8 J;  3CCR A;  2N3S A;  2NN6 G;  3G71 A;  3I4O A;  1IBK Q;  5GRO A;  1E22 A;  1TWC H;  1L0W A;  4KHP L;  1VQM A;  3AYH B;  4YHH Q;  1SN8 A;  4L5Q A;  3UDF A;  4DR5 Q;  1A0I A;  4UP7 A;  5LMN W;  3NBH B;  3KDF B;  1X3E A;  1X54 A;  1X3G A;  1HZA A;  1P16 A;  2YTV A;  1NY4 A;  3A0J A;  3UDX A;  4X62 Q;  5M3F G;  2OTL A;  2F4V Q;  1VQK A;  3CC4 A;  1E7Z A;  1EIY B;  4BBS H;  3KF6 B;  4DR1 L;  5M5X H;  4DAY B;  3J81 j;  4PG3 A;  3I56 A;  4DR4 L;  4BY1 H;  3BZK A;  1ASY A;  1Y1V G;  2CQO A;  2K5V A;  2ZTC A;  3TRE A;  4JI0 Q;  1MJE A;  3STB C;  5IY0 A;  3MXN B;  1GKH A;  3M4P A;  5GQO A;  4X64 L;  1OXV A;  5C0X I;  4DV3 Q;  3CPF A;  2E2J H;  2HHH Q;  4GKJ Q;  4GS3 A;  3J7Z C;  3CMA A;  3PF4 A;  1I94 Q;  4YY3 Q;  4R4Q A;  1VQ5 A;  2VUM H;  2HT1 A;  4P73 A;  4JI8 L;  1X65 A;  5EAY A;  1EFW A;  4P75 A;  5JJI A;  3HFZ B;  3CC7 A;  4X65 L;  1TWA H;  5IP9 G;  3FP9 A;  3GTJ H;  4DV7 L;  1UE7 A;  2CFM A;  1VQ8 A;  1L1O B;  4DR3 Q;  4LF8 Q;  4LF6 Q;  3PUW A;  1IYJ B;  4LUV A;  3H0G H;  2R7F A;  3CCS A;  4LFC Q;  4P72 A;  1OXX K;  3M4Q A;  3FKI G;  4APV A;  3T1Y Q;  1XNR Q;  3S2D H;  2ALY B;  2K52 A;  3HOW G;  3PO2 G;  1I5F A;  2PQA A;  4JCV E;  1WI5 A;  1G6P A;  4DR7 L;  1HJP A;  2VZA A;  2PMZ E;  1PH2 A;  4A3G H;  3U58 A;  1PH1 A;  4IFD I;  4B3T Q;  2KEN A;  4JBM A;  3CME A;  5FLM H;  2UXB L;  1CKN A;  2YYZ A;  1VQL A;  1HZB A;  3M3Y H;  4DUY Q;  3J81 c;  2RHQ B;  1PH4 A;  4HIO A;  1ASZ A;  5DLQ E;  3A5U A;  3KFU A;  1HH2 P;  1UE1 A;  3HKS A;  5HGQ A;  4LFB Q;  2VQE Q;  1JMC A;  1YZ6 A;  3STB D;  3GD7 A;  3CQZ H;  5HY6 A;  2YTY A;  1CSP A;  1I94 L;  2UXD Q;  4JI6 L;  3OTO Q;  4HJA A;  1Q82 C;  3HOX H;  2IHE A;  1WCM H;  1GM5 A;  1KXL A;  3K7A H;  3E0E A;  2UUA Q;  1HNW Q;  4MZ9 A;  2ATW A;  2AHO B;  2K75 A;  4GN4 B;  1HNX Q;  1HNZ L;  2OWO A;  1WFQ A;  2A1A A;  4DUZ Q;  1FJG Q;  1N33 Q;  1QZG A;  5C44 H;  3PO3 H;  4RG1 A;  1J6Q A;  5JEA G;  2Q2U A;  1GO3 E;  4JYA L;  3S16 H;  1V9P A;  2ASB A;  1VQF A;  4DV0 L;  4LF4 L;  4RMF A;  1PH6 A;  1TXY A;  3F2B A;  4OO1 G;  3F2C A;  3JAM i;  2LXJ A;  4JV5 L;  3KYH C;  4A3C H;  4UP8 A;  1M90 C;  4QJF A;  1SR3 A;  4JI7 L;  2QGQ A;  3J81 i;  4P71 A;  4DV4 L;  3T1H L;  2IX1 A;  2Z6K A;  2I5L X;  2R6G A;  4JOI C;  4R4I A;  1Q46 A;  3ERS X;  4YHH L;  1IBM L;  3LGJ A;  4A3G G;  2DGY A;  5LMU Q;  4LFC L;  1EWI A;  1VQE A;  1K0R A;  5IP7 H;  1G29 1;  4LF8 L;  2JJQ A;  2Q2T A;  3TQY A;  1VQ7 A;  3ULJ A;  3GDE A;  4LF7 L;  3L0O A;  5GAD C;  2GVA A;  2I5M X;  1PV4 A;  1CKO A;  4JBJ A;  1PVO A;  4A3D G;  1YHB A;  1D8L A;  4GLX A;  4BXX G;  2AKW B;  1XNQ L;  5ELN A;  1JJC B;  4IPG A;  2RCN A;  4A3B H;  2R92 G;  4A3L H;  1KIX A;  3UE1 A;  5J3B A;  4GNX C;  1HR0 W;  3KLW A;  4WJ4 A;  2PQA B;  3K8A A;  2JA7 G;  1E24 A;  5IWA L;  2AWO A;  4DV1 Q;  5ELO A;  4GNX B;  1YJW A;  1N36 L;  1WOC A;  4JC0 A;  3B6Y A;  2OCE A;  3DLL A;  4A93 H;  2E2I H;  1Q1E A;  4IPD A;  4GN5 A;  4DR1 Q;  4DK6 C;  1IBL L;  1CKN B;  3CPW A;  5FJ8 G;  3ER0 A;  2YTX A;  1U0L A;  4LFA Q;  5C4X H;  4X62 L;  1YIJ A;  2PNH A;  4BA2 I;  4OX9 Q;  4BY7 H;  1Z47 A;  4IPC A;  1YJ9 A;  4HJ7 A;  1A63 A;  1A62 A;  3GTO H;  3GTM H;  5FLX c;  2XGT A;  2UUC Q;  2UU9 Q;  2ZJQ A;  5IT9 c;  1S3O A;  1XMO Q;  2E2H H;  1XJV A;  2YU9 H;  3PIO A;  1NMF A;  4KLK A;  1KC8 C;  4YCW A;  4YCU A;  3AQQ A;  4GLA C;  3K7U C;  4LF5 L;  1Y1V H;  2A19 A;  4TVA B;  3U50 C;  3K80 C;  1LYL A;  2JA5 G;  2JE6 I;  1H95 A;  3CCM A;  4JI1 L;  2WB1 E;  4YWK A;  3D31 A;  2K4K A;  4MTN A;  4JI5 L;  2GN5 A;  3IRB A;  3PF5 A;  1S40 A;  2ZJR A;  1HZ9 A;  2LXK A;  5IYC G;  4DV1 L;  2R7Z G;  4BXX H;  3FHW A;  3GTK H;  2JA9 A;  1NBW A;  3L7Z C;  4PZ6 A;  1VQA A;  1LUZ A;  1EYG A;  3OW2 A;  3M7N A;  4IFD G;  1T9H A;  2R7D A;  1QVC A;  2VUM G;  4HIK A;  4QIW E;  1PYB A;  3HOU G;  1N34 L;  5BR8 Q;  1WYD A;  2KCM A;  2PI2 A;  4A3F G;  1SMX A;  1VQH A;  1QUQ B;  4JG2 A;  2OQ0 A;  4DV2 L;  2EQS A;  4A3K H;  1YEZ A;  4R4O A;  2UUB L;  2FXQ A;  3UDI A;  1KL9 A;  5LMU L;  3H3V I;  1VQB A;  1XMQ Q; 
#chains in the Genus database with same CATH topology
 4I7A A;  4K8J A;  4FXD A;  1B8A A;  4CKC A;  1EOT A;  3U4V A;  4LMQ D;  4C3I H;  1Y1W G;  1Z9F A;  2Z4I A;  2C35 B;  3I8Z A;  4DF7 A;  1VS0 A;  1ENA A;  4UPA A;  3TZD A;  5C44 B;  1M1K C;  4PZ7 A;  2JA8 H;  1EY7 A;  4BBR G;  4X3K A;  5CGK A;  1DGS A;  4NXN L;  3SR1 A;  3SVM A;  1JT8 A;  3CCQ A;  4JBK A;  2EXD A;  5KNB A;  1QNU A;  3A54 A;  3AU7 A;  3J81 E;  2ICE C;  3KOJ A;  3M9B A;  3HOU H;  5CV5 A;  1BOS A;  1U4P A;  3G6E A;  4IFD H;  2I46 A;  3W5O A;  3M85 A;  1II3 A;  1O7Z A;  1YNX A;  2DN8 A;  1HPC A;  1PH8 A;  4FF2 A;  4AYB G;  4LFA L;  5GAE C;  1UNS A;  2DY8 A;  3A5Z B;  4EGV A;  1H9S A;  1F9R A;  4JI7 Q;  4RHS A;  1TWC B;  2OF1 A;  4JV5 Q;  4KY5 A;  2KHI A;  4Q0F A;  1ENF A;  5M3F B;  3CAM A;  3BZC A;  1JOR A;  1RL2 A;  1ONL A;  3NE5 B;  1QCB D;  2KUM A;  4BBS B;  1LTR D;  3ERQ A;  4IUQ A;  4GKJ L;  4OO1 I;  2JP1 A;  1B1Z A;  4ID6 A;  5I9P A;  4RKB A;  1XTD A;  2F0S A;  3GV6 A;  2CWP A;  3F2U A;  1O78 A;  3I91 A;  3BVG A;  2AQ2 B;  2KCC A;  1QVG A;  3OPO A;  3F8T A;  4JI4 L;  3PIP A;  2RVL A;  2B63 G;  1KAW A;  1MJC A;  1EQV A;  2AWN A;  1KHI A;  3D4D A;  1T5E A;  1LTL A;  5KNC A;  3RN2 A;  3EN2 A;  2HQL A;  4GOP B;  2JA5 B;  5FLX E;  4DR2 L;  4IFD J;  1EQQ A;  1ICF B;  3S1M H;  4ZKB B;  4UP9 A;  3J80 E;  1MHW C;  2J7Z A;  5FLM G;  1TS4 A;  1XPU A;  2VQF L;  2J0T D;  1EEI D;  1EZ6 A;  3PO2 H;  1S5E D;  1JOK A;  2F0E A;  5E1F A;  3K7A B;  1TS2 A;  2SNS A;  3MZ5 A;  1E1O A;  5EBD A;  4LW1 A;  4LUO A;  3KBX A;  5IYD G;  3SE0 A;  4IUU A;  1LTB D;  2HCC A;  3SGI A;  3T56 B;  1DZ1 A;  3P7J A;  4LF4 Q;  4PMB A;  4DV5 Q;  4HJ5 A;  2R7Z B;  4HID A;  2UXC Q;  2XRS D;  2PZT A;  5DAU A;  3CCL A;  1VQG A;  4RCN A;  4QY7 A;  4QB4 A;  2K28 A;  2ZM6 L;  1TII D;  3OYY A;  5C4X G;  3KF8 B;  1CK1 A;  2JEA I;  4ZYS A;  3J80 L;  2NUC A;  4B3M Q;  2MNA A;  4ZUJ A;  1RKN A;  2G9H D;  3DUZ A;  2XVS A;  1SXT A;  1YJN A;  5EKL A;  4A76 A;  4LF5 Q;  2VL6 A;  1A6X A;  3RZO H;  1VQO A;  4AQY Q;  1JB7 A;  4QUC A;  1BUV T;  4K5X A;  3I4M H;  2CH4 A;  1X6O A;  1HHV A;  1L2F A;  1TWH B;  4KKU A;  4XQQ A;  1ENC A;  1KNE A;  1TWF B;  4NB3 A;  4DV2 Q;  2NVT H;  3TEH B;  3JAM L;  2V1C C;  3CCU A;  3G48 A;  4DN4 M;  2BH2 A;  5JJL A;  1CFM A;  3NSW A;  4PZ8 A;  4BY7 G;  4JI0 L;  1KRS A;  1RHP A;  3Q8D A;  5E7N A;  4YWL A;  1XNQ Q;  4NXM Q;  2HUG A;  3IL8 A;  3TP8 A;  4X3T A;  1Q86 C;  5NUC A;  3NP8 A;  1STH A;  5D14 A;  4LNQ A;  2KCN A;  4ZKC B;  4IPH A;  2K5H A;  1ILP A;  4IJH A;  1VQJ A;  3FVQ A;  3URY A;  1DCZ A;  4A3E G;  3D0F A;  2EVB A;  4RAU C;  2K5W A;  4C3H B;  1I3Q H;  1PRT F;  3J80 i;  2JK8 A;  4JI2 L;  2KOL A;  5C5M A;  5C3X A;  4J8Q A;  4RGN A;  2VXW A;  2F1M A;  1JJ2 A;  4V0B A;  2E5L L;  1JR0 D;  4B3M L;  1YIT A;  5M3M G;  2YU9 B;  4DUZ L;  1BKB A;  4KTA A;  4C2M H;  1QVF A;  4DAV A;  2JA7 B;  2A74 C;  4KJN A;  3T16 A;  5I6Y A;  1G2T A;  3W1B A;  2ZM6 Q;  3K5O A;  3MFG A;  4A3J H;  1VQ4 A;  3GTL B;  1QUQ A;  1A2U A;  3NBI A;  4FO2 A;  3TS2 A;  5C4H A;  4I65 A;  1XMQ L;  3S2H B;  1LTT D;  3TS0 A;  3N52 A;  1HZC A;  4JBW A;  1QG7 A;  2WV6 D;  3MXU A;  4HJ9 A;  3ULP A;  1EUJ A;  3L2P A;  4NXM L;  2OQK A;  5LL6 S;  4B3R L;  1A3U A;  3H09 A;  1SE3 A;  3H3V H;  2R92 H;  2RDH A;  2E8G A;  3BJU A;  2ES2 A;  1LT5 D;  1HTL D;  4B3S L;  4FDB A;  2L4N A;  4OL7 A;  1PLF A;  5C0X G;  4WFN 3;  2E5L Q;  1SNC A;  3ERO A;  2F3I A;  4NW2 A;  3I4N G;  4DV0 Q;  4JI1 Q;  2B2V A;  3BYT B;  4DNR B;  1XTC D;  4TRD A;  3A55 A;  1V8Q A;  1C0A A;  4X6A H;  2WP8 J;  1JWM D;  2PZU A;  3A8I E;  2NN6 G;  5AFW A;  3G71 A;  1IBK Q;  3CHB D;  1TWC H;  1SSO A;  5D3D A;  3FDT A;  2K05 A;  1CZW A;  4DXF A;  4R8I A;  2Q8R E;  2AUK A;  1SYC A;  1C4Q A;  3HOZ B;  2HDM A;  1VMP A;  1U4M A;  2I07 B;  4KY7 A;  2RCF A;  3S1M B;  1NY4 A;  4X3S A;  4XQN A;  1NAP A;  1WTP A;  1VQK A;  2CVR A;  1B9M A;  1EIY B;  5M5X H;  3J81 j;  4PG3 A;  4DR4 L;  3BZK A;  3NBH A;  2ZTC A;  1BCP D;  1BQQ T;  2B2T A;  2EDG A;  1PTO F;  3CPF A;  4A3J B;  2F0D A;  4UHV A;  3I90 A;  1B53 A;  2DNC A;  4P73 A;  5EAY A;  1E0B A;  4P75 A;  1EFW A;  4CJ2 C;  4DV7 L;  3FP9 A;  3MEH A;  2CFM A;  3TN2 A;  3DHQ A;  4DR3 Q;  2E76 C;  2WKC A;  4KV6 A;  3CCS A;  4LUV A;  2K1B A;  3OMG A;  4P72 A;  3MAQ A;  4HR7 B;  3PO2 G;  1ILQ A;  4JCV E;  4DR7 L;  2PMZ E;  1GUG A;  1PH2 A;  4JBM A;  5FLM H;  2YYZ A;  2LMC B;  4KD3 A;  3J81 c;  2RHQ B;  3TP7 A;  4IQZ A;  4L8J A;  4XYO A;  3KFU A;  2CHB D;  4J6H A;  2WIN B;  1UE1 A;  1SFO B;  1RD9 D;  4LFB Q;  5I2X A;  2XIW A;  2YTY A;  2B8F A;  3HOX H;  3I72 A;  2NZ1 D;  1GM5 A;  1HNW Q;  2AUJ D;  2E74 C;  1KNA A;  3D4R A;  2OWO A;  2B63 H;  4JW0 A;  1FJG Q;  3GV3 A;  1N33 Q;  2Q2U A;  1D5Z C;  4JYA L;  3ND8 A;  3S16 H;  4DNT B;  4DV0 L;  4LF4 L;  1QWY A;  4OO1 G;  1EY5 A;  1TY2 A;  3JAM i;  2LXJ A;  3E3X A;  1D1K A;  4G57 A;  1M90 C;  3VR4 A;  3HOU B;  1SR3 A;  4J1M A;  1K8M A;  4P71 A;  2IX3 A;  4R4I A;  1Q46 A;  1IBM L;  1LV9 A;  2CW0 D;  2WKD A;  3A7A B;  5D65 A;  3S15 B;  4LF8 L;  2AQ3 B;  5M5X B;  2L11 A;  3CKI B;  3TQY A;  3ULJ A;  3GDE A;  5FO8 B;  5GAD C;  1PV4 A;  1PVO A;  1IHZ A;  1D8L A;  3T51 B;  2B39 A;  4IPG A;  3S2D B;  1Y1V B;  3NWT A;  2PQA B;  2K03 A;  5IWA L;  2AWO A;  1N36 L;  1YJW A;  1WOC A;  3ONA B;  4JC0 A;  3B6Y A;  5KYI A;  3Q23 A;  1IBL L;  1GJX A;  1CKN B;  3CPW A;  2BDO A;  5FOB B;  1GUT A;  4IPC A;  1WTR A;  2ICI A;  3IKJ A;  5FLX c;  2ZJQ A;  5JVG 3;  2EJF C;  5KND A;  1W6K A;  4KK7 A;  2E2H H;  2B2Y A;  2QKI C;  4IUT A;  3HG9 A;  5JEA H;  1O80 A;  3K7U C;  2EXZ A;  4L6T B;  1HCZ A;  1ML0 D;  1STB A;  2MUY A;  4K14 A;  1QIL A;  1MI2 A;  1UEA B;  3CRK C;  1CHQ D;  4YWK A;  3MC0 B;  3DWP A;  1AP0 A;  1HZ9 A;  1A3V A;  4NKL A;  2R7Z G;  4HSV A;  4M8A A;  3VR3 A;  5JPN C;  2VUM G;  4KMU C;  2DJG C;  3KF8 A;  4FYD A;  4QIW E;  1N34 L;  4KKT A;  1WYD A;  1C8C A;  5C4X B;  2PMZ B;  4A3D B;  1TU2 B;  1VQH A;  1QUQ B;  4DV2 L;  2F03 A;  1SJH D;  3BVZ A;  1KL9 A;  5CBA E;  4MZ9 A;  1VQB A;  3HOY H;  1EZ8 A;  4H7B A;  4P2C B;  3CF5 A;  2FMM A;  2R93 H;  4A4I A;  2J4X A;  3P75 A;  4C3J G;  3TZU A;  5IT9 E;  2FFK B;  2K50 A;  3HOV B;  2F0G A;  1FVI A;  3DM1 A;  2VS1 A;  1Q12 A;  2E75 C;  1VQC A;  1T5X D;  1KQS A;  3UDG A;  4RH6 A;  5M3F H;  1GHJ A;  2K5N A;  2I0Q A;  1AW7 A;  3V2T A;  3NWS A;  1O7I A;  2D5D A;  4K0K L;  2X6L A;  1K8G A;  4RKL A;  1GOZ A;  2CH4 W;  1SYF A;  5KGU A;  4KI0 A;  5C4J H;  4B08 A;  3I4M B;  4HAE A;  1R9T B;  5G3L F;  1TVX A;  2BCO A;  4J15 A;  1B9N A;  1KTK A;  3TRZ A;  5IYC H;  5CMD A;  2KVM A;  4DR3 L;  3HOV H;  2F0L A;  4A3I G;  1A2T A;  4X65 Q;  2M2L A;  3VYU A;  3NK9 A;  2QCP X;  5KRU A;  3IFD A;  1A8V A;  1RJT A;  1IKM A;  1G6Z A;  2EJG C;  2H5X A;  4ZQ3 A;  2K33 A;  4IUR A;  5BN4 A;  4Q5V A;  3LX0 A;  4LJZ C;  3CD6 A;  2E2D C;  2HDL A;  4JVZ A;  2ID0 A;  3S2H H;  4H02 A;  1K8A C;  1SYB A;  2VY3 A;  1N8R C;  1I4X A;  2MPM A;  1VQ9 A;  5DM7 3;  2QW7 A;  3PUZ A;  2R7Z H;  4A3C G;  2NN6 I;  1V1O A;  2TSS A;  1KRT A;  3AFP A;  3KLR A;  4HTH A;  3G4S A;  2B2W C;  4OXP A;  2MQH A;  1Y69 U;  1W2B A;  1Q90 A;  1ET9 A;  4QQB X;  1CHP D;  4GN3 B;  2QEX A;  4XT3 B;  2F4I A;  3EBE A;  3W1G A;  1LTG D;  4LFB L;  4BBR B;  4DV5 L;  3HEJ A;  5CV4 A;  2A6E D;  3S14 H;  4ODG A;  4AIM A;  2O5J C;  3CXC A;  3PO3 G;  2F0I A;  1WTH A;  1ZYR C;  2ZTD A;  2E2J B;  1STA A;  3S17 H;  1ESR A;  1N32 L;  1WD1 A;  3CRL C;  4IUN A;  5ELF A;  2MO1 A;  4IO9 A;  3J7A 5;  1XX8 A;  2QDB A;  4OWT B;  1IYV A;  5FO9 B;  4DV7 Q;  2JEB I;  4MTK A;  1PTO H;  3CU7 A;  1QJO A;  3CCE A;  2L55 A;  4O1N A;  1Y1W H;  2A69 C;  1K8O A;  1PRT C;  4Y7N B;  2DUD A;  3HOY B;  3I4L A;  4A3E B;  3HZX A;  3DXJ C;  2A8V A;  3HOV G;  1LTI D;  2MJ8 A;  2XRQ D;  3H0G G;  4R1J A;  3J7Y W;  3K0Y A;  1PZK D;  3FKI H;  4A3J G;  3SEB A;  2K7V A;  5FKA C;  2RKS A;  4ALP A;  4BBS G;  4P74 A;  3RZO B;  4XIG S;  2B2V C;  1JOO A;  3FMC A;  1EQR A;  1ZYR D;  2PCF B;  5C3E G;  3U4Z A;  1HFG A;  3P1H A;  1EYA A;  1YVC A;  3BYY B;  3HOW H;  3S24 A;  1DXM A;  2E2I B;  4DAM A;  1I3Q B;  2N49 A;  2XN9 C;  1CSQ A;  2LFN A;  4CJ1 B;  5JJZ A;  5EBC A;  1JIC A;  4B9X A;  2BDN A;  2L0C A;  1AZQ A;  4IUP A;  1CKM A;  1PZI D;  1EYC A;  4N9P A;  4GNX A;  4A3I H;  3VR5 A;  3DEO A;  1WVL A;  1FR3 A;  1CTM A;  3A8K E;  4B3R Q;  3GTQ H;  3BU2 A;  3Q22 A;  2KQ3 A;  2K5D A;  1Q1B A;  4K5W A;  3EJI A;  1SFO H;  3E6Z X;  4RCO A;  4YCV A;  4OWX B;  5IIF A;  4DNI A;  2HIX A;  5C3E H;  5ELB A;  2RHS B;  2NVX H;  2M9V A;  3MEF A;  3HOZ G;  3K5L A;  1RDP D;  2PYK A;  5K36 G;  1QE6 A;  1U4R A;  2NZH A;  4POG A;  4C3H H;  1TWF H;  1K83 B;  5C5L A;  3SDZ A;  1SJE D;  1EIF A;  3PCO B;  1YHA A;  4JI5 Q;  3NQT A;  4BA1 I;  3IFT A;  4ZCK A;  3E0J A;  4LWC A;  4B3S Q;  2MFI A;  2DY7 A;  2D2C C;  1K9M C;  1PH7 A;  3RLF A;  3GTQ B;  5GAG C;  1XMO L;  1UE5 A;  3VDY A;  1DOL A;  2JQO A;  3T4A C;  4M1U B;  1G51 A;  2PZW A;  4BY1 G;  4IJL A;  4F87 A;  2UXB Q;  2ZJP A;  3RR5 A;  3J80 c;  2RA4 A;  5E4X A;  2NVQ H;  1D1I A;  2Q8I B;  3AB9 A;  1F9Q A;  5AJ3 L;  1E3P A;  1UEB A;  2EPB A;  1WTV A;  4A3D H;  1L1O C;  3TP5 A;  1UE6 A;  1KDA A;  4IAL A;  4KHV A;  2NN6 H;  5IP7 G;  2EY6 A;  4A75 A;  4NP5 A;  5I2Y A;  4A3M H;  2JA6 B;  1HNZ Q;  4YY3 L;  1D2B A;  3M4O B;  3I4O A;  2F0O A;  1FD7 D;  4KHP L;  2A6H C;  1VQM A;  1X32 A;  3MXP A;  4CBV A;  4YHH Q;  4UP7 A;  1LT4 D;  4Y52 H;  1P16 A;  1QOH A;  4FF3 A;  3K5M A;  3KF6 B;  4ZUI A;  3D8G A;  3I56 A;  4BY1 H;  1S5D D;  3TDQ A;  1MJE A;  3PMF A;  5GQO A;  4X64 L;  2E2J H;  2XSC A;  5JPM C;  3HKZ B;  1WD0 A;  4GS3 A;  2PQE A;  3PF4 A;  1I94 Q;  2HT1 A;  3HFZ B;  2JXM B;  1VQ8 A;  3GTJ H;  4LF8 Q;  2IPK D;  4LFC Q;  4C3I B;  1XNR Q;  1OXX K;  3M4Q A;  3S2D H;  2K52 A;  3FPU B;  3HOW G;  1A15 A;  3EFX D;  4DU9 A;  2PQA A;  3KBG A;  4G7Z C;  1DD2 A;  4IFD I;  1NR4 A;  2KEN A;  3CME A;  2UXB L;  1PXU A;  1VQL A;  3M3Y H;  2K5Q A;  2L9H A;  1ASZ A;  3D3R A;  5DLQ E;  1HH2 P;  1YZ6 A;  1H9M A;  3CQZ H;  4C56 C;  5HY6 A;  1CSP A;  1FGB D;  3OTO Q;  4HJA A;  1Q82 C;  1BXT A;  5COR A;  1KXL A;  3E0E A;  2AHO B;  1EU4 A;  2K75 A;  1HA5 A;  1HNZ L;  5C44 H;  4RG1 A;  2RBM A;  5CV8 A;  1V9P A;  2ASB A;  2NVT B;  4RMF A;  3F2B A;  4BWG B;  1SYE A;  1PYW D;  4V19 0;  1G91 A;  4JV5 L;  3KYH C;  1I50 B;  1E2W A;  2DJF C;  4F88 A;  3GTM B;  4JI7 L;  3J81 i;  1DON A;  4YHH L;  3R2I A;  4JOI C;  3RD4 A;  2F0M A;  2DGY A;  5LMU Q;  4LFC L;  3BG3 A;  5IP7 H;  1STY A;  1I6H B;  1VQ7 A;  3R3O A;  4IZ8 A;  2GVA A;  1CKO A;  1CA6 A;  4A3D G;  1YHB A;  2Z9H A;  1D5M C;  2AKW B;  1XNQ L;  1JJC B;  2RCN A;  4QF4 A;  3GP7 A;  3L3O C;  2PO4 A;  1MGS A;  4GNX B;  1B50 A;  5ELO A;  4E6I A;  2EYM A;  2OCE A;  3BZD B;  1HXY D;  4FF4 A;  5FJ8 G;  3ER0 A;  3ZYY X;  1E2V A;  1CI3 M;  4OX9 Q;  4HJ7 A;  4N8F A;  2BE5 C;  4PV1 C;  2XGT A;  2UU9 Q;  5IT9 c;  1XMO Q;  1SNO A;  4C2M B;  1XJV A;  2YU9 H;  1PFM A;  3PIO A;  3PO2 B;  1KC8 C;  2IJ0 A;  1EY4 A;  1JB3 A;  1DM0 B;  1Y1V H;  3U50 C;  1EY8 A;  1LYL A;  4F7X A;  1F2Z A;  4JI1 L;  2WB1 E;  2WAC A;  5M5W B;  4JI5 L;  2GN5 A;  3IRB A;  4HCS A;  3PF5 A;  2ZJR A;  3A56 A;  5IYC G;  1UAP A;  1G2S A;  3GTK H;  3L7Z C;  2L12 A;  4PZ6 A;  2EYJ A;  1LUZ A;  3BDO A;  3M7N A;  3WOF A;  1T9H A;  3J81 L;  2RSO A;  1QVC A;  5BR8 Q;  4DFA A;  3DMU A;  4A3F G;  1SYG A;  3Q0A A;  5JVH 3;  1K0S A;  3RZD B;  2EQS A;  3RUZ A;  3BDC A;  5EPL A;  3HP3 A;  1BCP C;  4A3I B;  5ISR A;  5LMU L;  1WTX A;  1SNP A;  3GTP H;  1PFN A;  4OIJ A;  1BNZ A;  1Y8O B;  1AE2 A;  1SDF A;  2ZTE A;  2A73 B;  3MVV A;  1VQN A;  2KCT A;  5I4D A;  4GOP C;  4ME3 A;  2D0O A;  5CV9 A;  1TWH H;  1FGU A;  2X6G A;  2NVX B;  2HIV A;  3S1Q H;  1IYU A;  4BY7 B;  2IW3 A;  3GTK B;  2NB0 A;  1EQT A;  1DJR D;  4G7O C;  1LAC A;  4H44 C;  2LSS A;  1EEF D;  4RWS C;  3EQL C;  1I4Q A;  4ULL A;  1J5E Q;  2XNA C;  2UXD L;  1OXS C;  1K83 H;  3VYS A;  3CP0 A;  4A3E H;  1AE3 A;  2DNE A;  5CR3 A;  1Z7T A;  2EJM A;  3RMH A;  2OXP A;  3FRP B;  3SK6 A;  1RTO A;  5L37 A;  1UWV A;  1PTO B;  1N36 Q;  2B2U A;  5CBE E;  4DK3 C;  3S1Q B;  3WDN A;  4JI3 L;  2KJX A;  4S3S A;  4K8I A;  3HOX G;  3KJP A;  3D6C A;  3X3N A;  1U4L A;  2MHV A;  1SE8 A;  4JYA Q;  4G7H C;  1PDQ A;  2MO0 A;  1NUC A;  1HRJ A;  4DAP A;  3HOY G;  1MKH A;  4FXK C;  5JAV A;  4A3G B;  3S14 B;  5IGD A;  3GTP B;  5T1I A;  3VA7 A;  4AYB E;  1PHJ A;  2GVB A;  4KHZ A;  4A3M G;  1CQF A;  4DKA C;  2VUM B;  4LF9 Q;  1ESF A;  3CC2 A;  4C3I G;  3PIP 3;  1R4P B;  2Q8T A;  2WFW A;  2JA6 H;  4RGM A;  1NJI C;  2VNU D;  5C3E B;  2B2T C;  4DR7 Q;  4DR2 Q;  1I50 H;  3LNN A;  3C46 A;  1JWS D;  3WWV A;  2IX0 A;  1HNW L;  4BY1 B;  3T1Y L;  3EA6 A;  4A93 B;  2R92 B;  1OTC A;  5IOC A;  3PUX A;  3I7F A;  1MIU A;  3Q24 A;  2RQX A;  2NYZ D;  1SNQ A;  2OTJ A;  1VQD A;  2WAQ E;  2N78 A;  4RFB A;  4OHJ A;  1Y14 B;  3TME A;  1X55 A;  2YV5 A;  3KUP A;  3S1R H;  1U9R A;  2Y0S B;  4WJ3 M;  3C1E A;  1PFS A;  4O42 A;  3K58 A;  1ROD A;  2D62 A;  3M4O H;  4KKS A;  1SLJ A;  2ZXO A;  1LT6 D;  4EQ5 A;  3WOE A;  1I6H H;  1PMR A;  3I2Z A;  1PFB A;  1WCM G;  2AMC B;  3PIO 3;  2NZO A;  2B8G A;  4A3L G;  5A35 A;  4K0K Q;  2BE5 D;  3D4W A;  2EYP A;  1B2T A;  2WAQ B;  4KHP Q;  2L15 A;  4X64 Q;  1AFP A;  3HOZ H;  4EQN A;  4JI3 Q;  4CDD C;  4BS9 A;  1PH5 A;  3J7A F;  4OON A;  1HUM A;  3PV0 A;  1A3T A;  4KJO A;  4U68 A;  2SDF A;  4EQO A;  1F9P A;  1FL0 A;  4FP5 D;  2EY1 A;  1L1O A;  4B3T L;  2BH8 A;  2PPB C;  5DNF A;  1HFN A;  1NCV A;  1HQM C;  2KA7 A;  2B2W A;  3AFQ A;  4IOC A;  2I5H A;  2GA4 B;  1HA6 A;  2WB1 G;  3NEM A;  1TWG B;  1C9O A;  1JWU D;  4X66 L;  1B44 D;  2QF7 A;  3OWF A;  4FVM A;  1EIH A;  3OIP A;  2B29 A;  5JJK A;  3K6O A;  3PGZ A;  4WRD A;  4DV3 L;  2HHH L;  4OO1 H;  4A3B G;  3PUV A;  3CQZ B;  5J1Z A;  5IE8 A;  3HOX B;  1X9N A;  1IXR A;  1SE2 A;  1XWE A;  1N9W A;  4HJ8 A;  2B3G A;  4ILW A;  1FNU A;  1NR2 A;  2OEO A;  3F1Z A;  2Z6K C;  2F4V L;  1GUO A;  2CWA A;  1IW7 C;  2EZV A;  5HUR A;  3BS1 A;  2PW7 A;  4MNO A;  5EPJ A;  2VB3 X;  1VQI A;  1BCP B;  5BN5 A;  2JA6 G;  4C3J H;  3NQI A;  1RTN A;  1LM0 A;  1W3S A;  3PO3 B;  4HCE A;  4C1N K;  2IT1 A;  2R93 G;  3RN5 A;  1TWG H;  3SK4 A;  3KF6 A;  4NXN Q;  3RZD H;  1P8L A;  4RGO S;  1AEX A;  4OEL B;  2A68 C;  1NTG A;  3I4N H;  1TY0 A;  4FNF A;  4DPG A;  1FJG L;  3HKZ G;  3M7G A;  5I9O A;  2LS0 1;  3H91 A;  3CW2 C;  4QL5 A;  1WTQ A;  5FLX L;  1EL0 A;  2Q2I A;  3S17 B;  2F52 A;  1NE3 A;  5FO7 B;  1K28 A;  1R9T H;  2UU9 L;  2K01 A;  1YNJ C;  5CYU A;  2IHF A;  2N55 A;  1NMG A;  5IYD H;  2HCI A;  4AH6 A;  1YBY A;  3HS0 C;  2Y0S G;  2EY5 A;  5A2Q E;  3EIV A;  3H0G B;  4KY6 A;  1BVS A;  1IBL Q;  5M5Y H;  4AQY L;  4DV4 Q;  4Y7N H;  1LO5 D;  1YHQ A;  5K36 H;  1WCM B;  4MN3 A;  3PUY A;  3R93 A;  4CGY B;  3S1N B;  3W3A A;  5C4Z A;  1F2Y A;  5IP9 H;  1S5F D;  4WJW A;  4LF6 L;  1B7Y B;  4JOI A;  4ZK9 B;  4X66 Q;  2X69 A;  2KHJ A;  3I4N B;  1N33 L;  2N3S A;  2BOS A;  4K6L A;  1F77 A;  1L0W A;  1S5C D;  5D3I B;  4L5Q A;  3NTK A;  4DR5 Q;  1A0I A;  2HQE A;  2F3V A;  5LMN W;  1YNJ D;  3U9O A;  3KDF B;  5A2Q L;  1X3E A;  1FNV A;  1HZA A;  3HGB A;  3UDX A;  4X62 Q;  3K57 A;  3CC4 A;  2EYO A;  1RF2 D;  5I6W A;  2A69 D;  4DR1 L;  4DAY B;  1J9O A;  2FHT A;  3H94 A;  1ASY A;  5KIX A;  2K5V A;  4A3M B;  1BO0 A;  1CZG A;  5IY0 A;  4DK0 A;  1GUN A;  2R61 A;  3MXN B;  4DV3 Q;  5T1G A;  2HHH Q;  1OXV A;  1JOQ A;  2EYL A;  3A8J E;  2ZXR A;  1H9J A;  1SBB B;  3CMA A;  3C3L A;  4QIW B;  1VQ5 A;  3QJY A;  1X65 A;  3QG1 A;  3W2D A;  5JJI A;  3CC7 A;  3VYR A;  1TWA H;  4X65 L;  4YIJ A;  4LF6 Q;  1IYJ B;  3H0G H;  4A3B B;  3T1Y Q;  2ALY B;  4HN7 A;  1G6P A;  1WI5 A;  4A3G H;  3GQB A;  3U58 A;  3OMC A;  4B3T Q;  2PNR C;  4RGT A;  4HMI A;  2LKV A;  1HZB A;  4LK1 C;  4DUY Q;  1EFI D;  4LAA A;  2ZT9 C;  3A5U A;  4PNY A;  3HKS A;  2XWJ B;  1LTS D;  2VQE Q;  1TR5 A;  2L5T A;  2IHE A;  1WCM H;  2ENB A;  3K7A H;  1PRT D;  1V1P A;  2ATW A;  2R93 B;  3MFY A;  1B4O A;  5KEE A;  4CDE C;  1WFQ A;  2A1A A;  4DUZ Q;  1JCK B;  3PO3 H;  3R2T A;  3VR2 A;  1VQF A;  2M00 A;  4WOR A;  5F2D A;  4IN3 A;  3V96 A;  1TXY A;  1AZP A;  3HRZ C;  3F2C A;  2H1E A;  1Y1W B;  4KN4 C;  4QCL A;  4QJF A;  2QGQ A;  3NPP A;  3T1H L;  2IX1 A;  2Z6K A;  2R6G A;  2NTT A;  1BBX C;  3LGJ A;  4A3G G;  3M4Y A;  3X3M A;  4B9W A;  1D6E C;  1EWI A;  1VQE A;  2NTS A;  1K0R A;  4JK1 C;  1G29 1;  3VYT A;  2JJQ A;  2Q2T A;  4C3H G;  1TS5 A;  1SMY C;  2I5M X;  3OOC A;  4JBJ A;  5BN3 A;  1SEB D;  4XYQ A;  4GLX A;  1M8A A;  2A68 D;  2NBF A;  4BXX G;  2F3W A;  1ZEQ X;  4CHT B;  5ELN A;  4X3U A;  2SEB D;  4C1N I;  1SE4 A;  1KIX A;  3UE1 A;  5J3B A;  2WB1 B;  1K3B C;  3KLW A;  2Z8L A;  4WJ4 A;  3K8A A;  2JA7 G;  1E24 A;  1TWA B;  3DLL A;  4A93 H;  2E2I H;  1Q1E A;  4IPD A;  4TSS A;  3OSO A;  4DK6 C;  2YTX A;  1U0L A;  5C4X H;  1YIJ A;  3D6W A;  2FMC A;  2R3Z A;  4OEM B;  1Z47 A;  4R9W A;  1A62 A;  3MWY W;  1NNX A;  2O4X A;  2F0V A;  3QOL A;  1F2M A;  2UUC Q;  1Q8I A;  1CT1 D;  1S3O A;  2XWB B;  3EVQ A;  1NMF A;  3AQQ A;  3DEP A;  4LF5 L;  2A19 A;  1F2L A;  1H95 A;  2QDL A;  3NHH A;  2O5I C;  1X3P A;  3D31 A;  3KLS A;  2EYH A;  2A6H D;  2LXK A;  3DWA A;  2G5D A;  1SNM A;  1I6V C;  3FHW A;  1NBW A;  1B3A A;  1EU3 A;  4HIK A;  5EKI A;  1PYB A;  4HMJ A;  5C6A A;  2KCM A;  2OQ0 A;  3MA2 B;  4A3K H;  2UUB L;  3UDI A;  1I4R A;  2CQA A;  3H3V I;  1F9S A;  1XMQ Q;  5EJW A;  2F0P A;  3QIA A;  2QA4 A;  2F0U A;  4XTC S;  1WJJ A;  4FF1 A;  3I55 A;  4C3J B;  2JN4 A;  1GD7 A;  5FK9 C;  3FPP A;  4EQP A;  4HED A;  4R4T A;  4L5R C;  4LUZ A;  2NVY H;  5IGF A;  5JOB A;  1CUK A;  4JI2 Q;  5IWA Q;  3E9I A;  5C4J B;  4A93 G;  3VA5 A;  4CKB A;  2CKZ B;  2NVQ B;  1GHK A;  3OTO L;  2EIF A;  3TP6 A;  1VMC A;  1Q8K A;  1EY6 A;  2UUC L;  4DA2 A;  4UAI A;  5H1S E;  3F2D A;  2RDG A;  2K04 A;  1BDO A;  1LLR D;  3S1R B;  1SND A;  3KLS X;  1EWC A;  1Y8N B;  1Q81 C;  3NTI A;  3AMU A;  4GLV B;  1MSH A;  4OWW B;  4JPB W;  3T1H Q;  1AH9 A;  1VQ6 A;  2EY2 A;  4NPS A;  4ZLT F;  1D7Q A;  2Z4H A;  5C0X H;  3ULL A;  1XXG A;  4DR6 L;  4IOA A;  3L9A X;  3DM3 A;  3I4M G;  1IZ6 A;  4DV6 L;  3S1N H;  2NVY B;  4LF7 Q;  5IT9 L;  4DV6 Q;  5EPK A;  3I73 A;  1TKW B;  4IUV A;  1PH3 A;  1V1Q A;  3QO2 A;  1LT3 D;  5M5Y B;  1BR9 A;  1X3F A;  2L1B A;  1PTO D;  5FJ8 H;  1EOV A;  5J39 A;  3NTH A;  3JAM c;  2C5C A;  2KBN A;  1KLU D;  2WAQ G;  4ZRZ A;  3UE0 A;  2JSO A;  1O7Y A;  2JA8 G;  1RIP A;  2BA1 A;  5ELE A;  5M9O A;  1X3Q A;  1JC7 A;  4A3K B;  1IL8 A;  4EVO A;  4DUY L;  2RDF A;  4A3F B;  1I4G A;  3RNU A;  1VQP A;  3CCV A;  1KAB A;  3QB3 A;  1D5X C;  3A7L A;  4OGQ C;  1MD2 D;  2IL8 A;  1VCI A;  3G6J B;  2Z0S A;  2PI2 E;  3SK8 A;  1XNR L;  2V4D A;  4H13 C;  5CV6 A;  4MHE A;  2CCZ A;  4K2K A;  1E1T A;  2BA0 A;  1V1P B;  1PZJ D;  3MHB A;  2A5H A;  1K73 C;  2Q2H A;  3GO5 A;  3U9S A;  4DR6 Q;  4LF9 L;  1IBM Q;  1PTO C;  1S5B D;  5AJ3 Q;  1N32 Q;  2P5Z X;  2F0K A;  2E2H B;  1XPO A;  5M3M H;  5EKK A;  3H3V C;  2AQ1 B;  2VQF Q;  2B2U C;  1GUW A;  4PMC A;  3N6R A;  1C7Y A;  4CJ0 B;  5ELD A;  4DGZ A;  5IYB H;  2TMP A;  4JI8 Q;  1YI2 A;  4R4C A;  1LAB A;  1WTO A;  1KDB A;  1J5E L;  1CM9 A;  2UUA L;  1OXU A;  1Z6H A;  4O2D A;  4DXG A;  1S72 A;  1H9R A;  4JI6 Q;  2XTI A;  1Q7Y C;  2VQE L;  5LMN L;  5ELC A;  3S15 H;  4FXG C;  4JI4 Q;  1KD1 C;  5K5P A;  5C0X J;  1HR0 Q;  1OXT A;  4QGU A;  2FJ2 A;  1L0X B;  1BF4 A;  3GTG H;  1ZKO A;  1QZH A;  1DYQ A;  2OT2 A;  1EWH A;  3GTL H;  1CA5 A;  1PA6 A;  4DR5 L;  2NWG A;  4ME5 A;  2RF4 A;  3RLN A;  2CW0 C;  2EOT A;  4L5T A;  1AN8 A;  1IBK L;  2UUB Q;  3C2P A;  1J8I A;  4TQU S;  3AEV A;  2Z6B A;  2RSN A;  2K14 A;  1UUP A;  2H4O A;  4BBR H;  1N34 Q;  1QNK A;  3CCJ A;  3BVM A;  1BBW A;  4PQX A;  1O7L A;  1U5K A;  2Y0S E;  1BBU A;  1EY0 A;  2QIL A;  4L63 B;  3PQI A;  1SYD A;  1BCP F;  1B70 B;  3DWQ A;  1YNN C;  1GUS A;  2FIN B;  4DR4 Q;  2MGS A;  1X56 A;  2EE1 A;  1IL2 A;  3T13 A;  4XXE A;  4L5S A;  4POF A;  4GKK Q;  1JQY D;  1SRU A;  4H0L C;  2D0P A;  3HKZ E;  3GTG B;  3K5N A;  4YWM A;  1GVP A;  1VF5 C;  2EYF A;  3PSI A;  4MIU A;  3O13 A;  1PH9 A;  5GAH C;  1LTA D;  1WTW A;  1H9K A;  1G8Z D;  3ZJY C;  2PW5 A;  4A3K G;  4OX9 L;  4XQJ A;  5IGG A;  4HIM A;  3RLO A;  3KJO A;  3NEL A;  4DAY A;  4O0A A;  1SMY D;  5LMN Q;  3GTJ B;  1I4P A;  1GXD C;  3A74 A;  3LWE A;  2D9U A;  1FYC A;  1HNX L;  3LWU A;  4EX5 A;  1YNN D;  1SRO A;  3NEN A;  4N8X 1;  3OIQ A;  5JEA J;  1DOM A;  4GZY C;  1JJG A;  5DM6 3;  1S4Z A;  4K6D A;  2UXC L;  5EGT A;  3K0X A;  1K3R A;  4PMW A;  3OW7 A;  5M5W H;  1XPR A;  5C44 G;  3JC6 6;  4QMG A;  4ZAI A;  2VW9 A;  4GKK L;  4UY8 C;  5BR8 L;  2HD3 A;  3H15 A;  2F0N A;  4CDF C;  1ET6 A;  3E9H A;  4GOP A;  3SXH A;  2JYO A;  3ICE A;  2N8N A;  2F0J A;  2JA5 H;  3BDL A;  2IY5 B;  1JE5 A;  3K81 C;  3SHL A;  3VR6 A;  4R8N A;  2N88 A;  3J7A V;  3FEW X;  1HR0 L;  1PYS B;  5IYB G;  1Y8P B;  3V05 A;  3KDF A;  1V43 A;  1IW7 D;  4A3F H;  1R4Q B;  2JA7 H;  3CCR A;  4AYB B;  2B2Y C;  5C3W A;  3NUC A;  5CV7 A;  5GRO A;  1E22 A;  2F0W A;  3AYH B;  1SN8 A;  3UDF A;  1KAA A;  4F8M A;  3NBH B;  5KYL A;  5COY A;  2IWH A;  1X54 A;  1JE4 A;  1X3G A;  3UI2 A;  1H9S B;  3A0J A;  2YTV A;  5M3F G;  4RA8 A;  2OTL A;  2F4V Q;  3P20 A;  1E7Z A;  4N9T A;  4BBS H;  3GTO B;  4K2L A;  1Y1V G;  2CQO A;  4JI0 Q;  3TRE A;  3STB C;  2SNM A;  3E5S A;  3Q6S A;  4I7Z C;  1GKH A;  3M4P A;  5C0X I;  4GKJ Q;  5M3M B;  3J7Z C;  1KDC A;  2VUM H;  4YY3 Q;  4R4Q A;  2MP1 A;  3MXG A;  4JI8 L;  3QOJ A;  4TKO B;  2K6A A;  5IP9 G;  3I3C A;  1UE7 A;  1L1O B;  3PUW A;  2R7F A;  3MXN A;  4APV A;  5J22 A;  5CC4 A;  3FKI G;  3I70 A;  3S9W A;  5EQ0 A;  1Q3L A;  1I5F A;  2B63 B;  1HJP A;  1FNW A;  2VZA A;  1PH1 A;  3HOW B;  1E2Z A;  2K32 A;  5IGB A;  1XYI A;  1SAP A;  1CKN A;  1PH4 A;  4HIO A;  2VB2 X;  5IGC A;  4XT1 B;  3KK7 A;  1HQR D;  4UDU C;  5HGQ A;  1JMC A;  3STB D;  3T53 B;  3GD7 A;  3C1F A;  3IAY A;  1ICW A;  3TSS A;  1I94 L;  2UXD Q;  1W6J A;  4JI6 L;  1EIG A;  4HSP A;  2UUA Q;  1EYD A;  4GN4 B;  1STE A;  1HNX Q;  1QZG A;  1J6Q A;  5JEA G;  1GO3 E;  1VDZ A;  3H6M A;  2F0F A;  1PH6 A;  4OIK A;  5IOD A;  3R8B A;  1B3Q A;  2KEE A;  2ZXP A;  5HGT A;  3G7L A;  1OO9 B;  2SOB A;  4A3C H;  4UP8 A;  1VF7 A;  3OHX C;  1KLG D;  4DV4 L;  1HTP A;  5E3F A;  1PRT B;  4DK1 A;  2I5L X;  2C9O A;  3ERS X;  2G9D A;  3QR8 A;  4NMZ A;  1DOK A;  4Z9C B;  4NDX A;  1TS3 A;  2WII B;  4LF7 L;  3L0O A;  5IGE A;  1QB5 D;  2F0T A;  1ZXT A;  3JAM E;  2JA8 B;  2O2L D;  3TBI B;  1STN A;  2F0Q A;  4A3B H;  1MSG A;  4XDX A;  2R92 G;  4A3L H;  4GNX C;  1HR0 W;  4QUF A;  4DV1 Q;  3ND9 A;  4RHR A;  5G3L D;  5TSS A;  4GN5 A;  4DR1 Q;  1STG A;  2QEJ C;  4LFA Q;  1C48 A;  4X62 L;  2PNH A;  4BA2 I;  1TQO A;  2LY7 A;  4BY7 H;  1YJ9 A;  1A63 A;  1L0Y B;  4KN7 C;  2KEC A;  3GTO H;  2Z1C A;  3GTM H;  2F0H A;  4U67 3;  4G4K A;  5LHY 1;  1HUN A;  2A6E C;  1RCV D;  4KLK A;  4YCW A;  4YCU A;  4GLA C;  1NSN S;  4TVA B;  3K80 C;  2KED A;  2JA5 G;  1TT2 A;  2JE6 I;  5E4W C;  3CCM A;  3S16 B;  2KHS A;  1IKL A;  4MTN A;  2K4K A;  1EY9 A;  3QWN A;  1S40 A;  4DV1 L;  3MTS A;  4BXX H;  2JA9 A;  4IFD G;  1VQA A;  1EYG A;  3OW2 A;  2R7D A;  4CDC C;  4KD4 A;  3ITP A;  3NXW A;  3HOU G;  3OWE B;  1CQV A;  1M4V A;  3M3Y B;  4K5V A;  4CKE A;  5LL6 X;  2PI2 A;  1SMX A;  5DEH A;  4JG2 A;  3SK5 A;  1I4H A;  3K59 A;  1YEZ A;  3FKI B;  4R4O A;  4ABN A;  2FXQ A;  1MBY A; 
#chains in the Genus database with same CATH homology
 1B8A A;  3HOY H;  3U4V A;  2QA4 A;  4C3I H;  1Y1W G;  1Z9F A;  2C35 B;  4XTC S;  1WJJ A;  1AE2 A;  2ZTE A;  1VS0 A;  3CF5 A;  2R93 H;  3I55 A;  1VQN A;  4A4I A;  2KCT A;  1GD7 A;  4UPA A;  4GOP C;  1M1K C;  4PZ7 A;  2JA8 H;  4BBR G;  4ME3 A;  1DGS A;  2D0O A;  1TWH H;  1FGU A;  4NXN L;  1JT8 A;  4R4T A;  3CCQ A;  4L5R C;  4LUZ A;  2NVY H;  4JBK A;  2K50 A;  2EXD A;  1FVI A;  2VS1 A;  1CUK A;  2HIV A;  4JI2 Q;  1Q12 A;  5IWA Q;  3E9I A;  3S1Q H;  1VQC A;  4A93 G;  1KQS A;  3KOJ A;  3M9B A;  3HOU H;  2CKZ B;  3UDG A;  5M3F H;  2K5N A;  2LSS A;  3OTO L;  1J5E Q;  2I0Q A;  2EIF A;  3G6E A;  2UXD L;  1OXS C;  1K83 H;  3W5O A;  1Q8K A;  3M85 A;  2UUC L;  3CP0 A;  4A3E H;  1O7I A;  5H1S E;  1YNX A;  3F2D A;  4K0K L;  1AE3 A;  1PH8 A;  4AYB G;  4LFA L;  4Y52 H;  1K8G A;  5GAE C;  1Q81 C;  4GLV B;  3A5Z B;  1UWV A;  4OWW B;  3T1H Q;  1N36 Q;  1AH9 A;  4JI7 Q;  1VQ6 A;  1D7Q A;  4NPS A;  4KI0 A;  4DK3 C;  5C4J H;  4JI3 L;  4JV5 Q;  2KHI A;  3ULL A;  3HOX G;  4DR6 L;  4IOA A;  4J15 A;  3KJP A;  3TRZ A;  3DM3 A;  5IYC H;  3I4M G;  3CAM A;  3BZC A;  1IZ6 A;  4DR3 L;  1RL2 A;  4DV6 L;  3HOV H;  3S1N H;  1SE8 A;  4A3I G;  4JYA Q;  4X65 Q;  4LF7 Q;  4DV6 Q;  2MO0 A;  1PH3 A;  1MKH A;  1V1Q A;  3HOY G;  1X3F A;  4OO1 I;  1A8V A;  5FJ8 H;  4GKJ L;  1EOV A;  1XTD A;  3JAM c;  2H5X A;  2CWP A;  2KBN A;  2WAQ G;  4AYB E;  1PHJ A;  3UE0 A;  2GVB A;  4KHZ A;  4A3M G;  2JA8 G;  1RIP A;  2BA1 A;  3CD6 A;  4DKA C;  1QVG A;  2ID0 A;  4LF9 Q;  3S2H H;  4H02 A;  1K8A C;  3CC2 A;  2VY3 A;  1N8R C;  2WFW A;  4DUY L;  3F8T A;  2JA6 H;  1NJI C;  1VQ9 A;  4A3C G;  3PUZ A;  4JI4 L;  2R7Z H;  2VNU D;  3PIP A;  2B63 G;  1KAW A;  2NN6 I;  1MJC A;  3RNU A;  1VQP A;  3CCV A;  1KRT A;  3AFP A;  3G4S A;  2AWN A;  1KHI A;  4DR7 Q;  4DR2 Q;  4OXP A;  1I50 H;  2MQH A;  1LTL A;  3WWV A;  2IX0 A;  1W2B A;  4QQB X;  1VCI A;  3RN2 A;  2Z0S A;  3EN2 A;  2HQL A;  2PI2 E;  4GOP B;  3T1Y L;  1XNR L;  4GN3 B;  2QEX A;  4DR2 L;  4IFD J;  1OTC A;  3EBE A;  3W1G A;  2CCZ A;  1EQQ A;  1E1T A;  2BA0 A;  3PUX A;  3S1M H;  4LFB L;  3I7F A;  1MIU A;  4UP9 A;  2OTJ A;  4DV5 L;  1VQD A;  2WAQ E;  2N78 A;  5FLM G;  1Y14 B;  1K73 C;  1X55 A;  2Q2H A;  2YV5 A;  3GO5 A;  3S1R H;  1XPU A;  3S14 H;  4WJ3 M;  4DR6 Q;  4LF9 L;  2VQF L;  1IBM Q;  1PFS A;  4AIM A;  5AJ3 Q;  1N32 Q;  3CXC A;  2D62 A;  3PO3 G;  3PO2 H;  1XPO A;  3M4O H;  2ZTD A;  5M3M H;  1E1O A;  1SLJ A;  4LW1 A;  4LUO A;  3S17 H;  5IYD G;  1N32 L;  4EQ5 A;  2VQF Q;  1I6H H;  3I2Z A;  3SGI A;  2MO1 A;  4IO9 A;  1XPR A;  3J7A 5;  1C7Y A;  1WCM G;  2AMC B;  4OWT B;  4LF4 Q;  2NZO A;  4DV5 Q;  4HJ5 A;  4A3L G;  4HID A;  4K0K Q;  4DV7 Q;  2UXC Q;  2JEB I;  5IYB H;  4JI8 Q;  1YI2 A;  4R4C A;  3CCE A;  1J5E L;  1Y1W H;  1VQG A;  3CCL A;  2UUA L;  4KHP Q;  1OXU A;  4QY7 A;  2L15 A;  4X64 Q;  4O2D A;  1S72 A;  2ZM6 L;  3GTP H;  3OYY A;  3HOZ H;  5C4X G;  2DUD A;  4JI6 Q;  3KF8 B;  4JI3 Q;  2XTI A;  1Q7Y C;  1PH5 A;  2JEA I;  4OON A;  3PV0 A;  2VQE L;  5LMN L;  4B3M Q;  2MNA A;  2A8V A;  3S15 H;  4JI4 Q;  1KD1 C;  3HOV G;  5C0X J;  3H0G G;  1FL0 A;  4R1J A;  1HR0 Q;  1OXT A;  4QGU A;  3FKI H;  4A3J G;  1YJN A;  4ALP A;  1L1O A;  3GTG H;  4A76 A;  1QZH A;  4BBS G;  4P74 A;  4B3T L;  4LF5 Q;  2VL6 A;  3RZO H;  3GTL H;  2BH8 A;  4XIG S;  1PA6 A;  4DR5 L;  1VQO A;  4AQY Q;  1JB7 A;  1EQR A;  2RF4 A;  3RLN A;  5C3E G;  3U4Z A;  3I4M H;  1HNW L;  4L5T A;  3AFQ A;  4IOC A;  1IBK L;  1X6O A;  1YVC A;  2I5H A;  1L2F A;  3HOW H;  3S24 A;  2UUB Q;  2WB1 G;  4DAM A;  4NB3 A;  4TQU S;  2N49 A;  1CSQ A;  3NEM A;  4DV2 Q;  3AEV A;  2NVT H;  1C9O A;  2K14 A;  4X66 L;  4BBR H;  1CKM A;  1N34 Q;  3TEH B;  3CCJ A;  1BBW A;  5JJK A;  2B29 A;  4GNX A;  1U5K A;  2Y0S E;  3PGZ A;  4DV3 L;  4A3I H;  2HHH L;  2V1C C;  3CCU A;  3G48 A;  1BBU A;  4A3B G;  3PUV A;  2BH2 A;  5JJL A;  4PZ8 A;  5IE8 A;  4BY7 G;  1B70 B;  1X9N A;  1IXR A;  1KRS A;  4JI0 L;  1N9W A;  4DR4 Q;  3Q8D A;  5E7N A;  3GTQ H;  1X56 A;  3BU2 A;  4B3R Q;  4HJ8 A;  4YWL A;  2B3G A;  1IL2 A;  1XNQ Q;  4NXM Q;  1Q1B A;  4L5S A;  3F1Z A;  2Z6K C;  2F4V L;  1SFO H;  1Q86 C;  4POF A;  4GKK Q;  1SRU A;  2D0P A;  3HKZ E;  4YCV A;  4OWX B;  4DNI A;  2HIX A;  2CWA A;  4YWM A;  5C3E H;  4LNQ A;  1GVP A;  2RHS B;  2NVX H;  4IPH A;  2K5H A;  3MEF A;  3PSI A;  4MNO A;  4IJH A;  1VQI A;  1VQJ A;  3HOZ G;  2JA6 G;  4C3J H;  1PH9 A;  5GAH C;  5K36 G;  1LM0 A;  3D0F A;  1W3S A;  4A3E G;  2IT1 A;  2NZH A;  3ZJY C;  4C3H H;  4POG A;  4A3K G;  1I3Q H;  1TWF H;  3J80 i;  2JK8 A;  4JI2 L;  4OX9 L;  2R93 G;  3RN5 A;  1TWG H;  1EIF A;  4HIM A;  3PCO B;  1YHA A;  4JI5 Q;  3KF6 A;  3RLO A;  4BA1 I;  3KJO A;  4NXN Q;  3NEL A;  3RZD H;  1P8L A;  4O0A A;  1JJ2 A;  2E5L L;  2B63 H;  1NTG A;  5LMN Q;  4B3M L;  3I4N H;  4LWC A;  1YIT A;  5M3M G;  4B3S Q;  2MFI A;  3A74 A;  1BKB A;  3HKZ G;  4C2M H;  4DPG A;  4DUZ L;  1HNX L;  1FJG L;  1QVF A;  3CW2 C;  4QL5 A;  1K9M C;  4EX5 A;  3W1B A;  2ZM6 Q;  3RLF A;  4A3J H;  1VQ4 A;  1SRO A;  2Q2I A;  3NEN A;  1PH7 A;  1QUQ A;  5JEA J;  5GAG C;  2F52 A;  3TS2 A;  1XMQ L;  1NE3 A;  1R9T H;  1XMO L;  1UE5 A;  3VDY A;  2UU9 L;  1JJG A;  2UXC L;  3TS0 A;  2JQO A;  2IHF A;  3K0X A;  1K3R A;  4PMW A;  1HZC A;  4JBW A;  1NMG A;  5M5W H;  4AH6 A;  5C44 G;  3JC6 6;  1G51 A;  1YBY A;  2Y0S G;  2VW9 A;  5IYD H;  3EIV A;  4GKK L;  4UY8 C;  5BR8 L;  1BVS A;  4BY1 G;  4IJL A;  3H15 A;  4HJ9 A;  1EUJ A;  3ULP A;  1IBL Q;  3L2P A;  4NXM L;  2UXB Q;  2ZJP A;  3RR5 A;  3J80 c;  2OQK A;  5M5Y H;  4AQY L;  4B3R L;  4DV4 Q;  3E9H A;  4Y7N H;  4GOP A;  3H3V H;  2N8N A;  2NVQ H;  3ICE A;  2JA5 H;  2R92 H;  1YHQ A;  2IY5 B;  2E8G A;  3BJU A;  2ES2 A;  5AJ3 L;  1JE5 A;  4B3S L;  3K81 C;  4FDB A;  3PUY A;  1E3P A;  1UEB A;  5C0X G;  4A3D H;  2E5L Q;  1L1O C;  5IP9 H;  1UE6 A;  2F3I A;  3I4N G;  1HR0 L;  4LF6 L;  1B7Y B;  4DV0 Q;  4JI1 Q;  4JOI A;  1PYS B;  5IYB G;  4X66 Q;  5IP7 G;  3KDF A;  1V43 A;  2KHJ A;  4A75 A;  4A3M H;  4A3F H;  1N33 L;  1C0A A;  4X6A H;  1HNZ Q;  2JA7 H;  4YY3 L;  2WP8 J;  3CCR A;  2N3S A;  2NN6 G;  3G71 A;  3I4O A;  1IBK Q;  5GRO A;  1E22 A;  1TWC H;  1L0W A;  4KHP L;  1VQM A;  3AYH B;  4YHH Q;  1SN8 A;  4L5Q A;  3UDF A;  4DR5 Q;  1A0I A;  4UP7 A;  5LMN W;  3NBH B;  3KDF B;  1X3E A;  1X54 A;  1X3G A;  1HZA A;  1P16 A;  2YTV A;  1NY4 A;  3A0J A;  3UDX A;  4X62 Q;  5M3F G;  2OTL A;  2F4V Q;  1VQK A;  3CC4 A;  1E7Z A;  1EIY B;  4BBS H;  3KF6 B;  4DR1 L;  5M5X H;  4DAY B;  3J81 j;  4PG3 A;  3I56 A;  4DR4 L;  4BY1 H;  3BZK A;  1ASY A;  1Y1V G;  2CQO A;  2K5V A;  2ZTC A;  3TRE A;  4JI0 Q;  1MJE A;  3STB C;  5IY0 A;  3MXN B;  1GKH A;  3M4P A;  5GQO A;  4X64 L;  1OXV A;  5C0X I;  4DV3 Q;  3CPF A;  2E2J H;  2HHH Q;  4GKJ Q;  4GS3 A;  3J7Z C;  3CMA A;  3PF4 A;  1I94 Q;  4YY3 Q;  4R4Q A;  1VQ5 A;  2VUM H;  2HT1 A;  4P73 A;  4JI8 L;  1X65 A;  5EAY A;  1EFW A;  4P75 A;  5JJI A;  3HFZ B;  3CC7 A;  4X65 L;  1TWA H;  5IP9 G;  3FP9 A;  3GTJ H;  4DV7 L;  1UE7 A;  2CFM A;  1VQ8 A;  1L1O B;  4DR3 Q;  4LF8 Q;  4LF6 Q;  3PUW A;  1IYJ B;  4LUV A;  3H0G H;  2R7F A;  3CCS A;  4LFC Q;  4P72 A;  1OXX K;  3M4Q A;  3FKI G;  4APV A;  3T1Y Q;  1XNR Q;  3S2D H;  2ALY B;  2K52 A;  3HOW G;  3PO2 G;  1I5F A;  2PQA A;  4JCV E;  1WI5 A;  1G6P A;  4DR7 L;  1HJP A;  2VZA A;  2PMZ E;  1PH2 A;  4A3G H;  3U58 A;  1PH1 A;  4IFD I;  4B3T Q;  2KEN A;  4JBM A;  3CME A;  5FLM H;  2UXB L;  1CKN A;  2YYZ A;  1VQL A;  1HZB A;  3M3Y H;  4DUY Q;  3J81 c;  2RHQ B;  1PH4 A;  4HIO A;  1ASZ A;  5DLQ E;  3A5U A;  3KFU A;  1HH2 P;  1UE1 A;  3HKS A;  5HGQ A;  4LFB Q;  2VQE Q;  1JMC A;  1YZ6 A;  3STB D;  3GD7 A;  3CQZ H;  5HY6 A;  2YTY A;  1CSP A;  1I94 L;  2UXD Q;  4JI6 L;  3OTO Q;  4HJA A;  1Q82 C;  3HOX H;  2IHE A;  1WCM H;  1GM5 A;  1KXL A;  3K7A H;  3E0E A;  2UUA Q;  1HNW Q;  4MZ9 A;  2ATW A;  2AHO B;  2K75 A;  4GN4 B;  1HNX Q;  1HNZ L;  2OWO A;  1WFQ A;  2A1A A;  4DUZ Q;  1FJG Q;  1N33 Q;  1QZG A;  5C44 H;  3PO3 H;  4RG1 A;  1J6Q A;  5JEA G;  2Q2U A;  1GO3 E;  4JYA L;  3S16 H;  1V9P A;  2ASB A;  1VQF A;  4DV0 L;  4LF4 L;  4RMF A;  1PH6 A;  1TXY A;  3F2B A;  4OO1 G;  3F2C A;  3JAM i;  2LXJ A;  4JV5 L;  3KYH C;  4A3C H;  4UP8 A;  1M90 C;  4QJF A;  1SR3 A;  4JI7 L;  2QGQ A;  3J81 i;  4P71 A;  4DV4 L;  3T1H L;  2IX1 A;  2Z6K A;  2I5L X;  2R6G A;  4JOI C;  4R4I A;  1Q46 A;  3ERS X;  4YHH L;  1IBM L;  3LGJ A;  4A3G G;  2DGY A;  5LMU Q;  4LFC L;  1EWI A;  1VQE A;  1K0R A;  5IP7 H;  1G29 1;  4LF8 L;  2JJQ A;  2Q2T A;  3TQY A;  1VQ7 A;  3ULJ A;  3GDE A;  4LF7 L;  3L0O A;  5GAD C;  2GVA A;  2I5M X;  1PV4 A;  1CKO A;  4JBJ A;  1PVO A;  4A3D G;  1YHB A;  1D8L A;  4GLX A;  4BXX G;  2AKW B;  1XNQ L;  5ELN A;  1JJC B;  4IPG A;  2RCN A;  4A3B H;  2R92 G;  4A3L H;  1KIX A;  3UE1 A;  5J3B A;  4GNX C;  1HR0 W;  3KLW A;  4WJ4 A;  2PQA B;  3K8A A;  2JA7 G;  1E24 A;  5IWA L;  2AWO A;  4DV1 Q;  5ELO A;  4GNX B;  1YJW A;  1N36 L;  1WOC A;  4JC0 A;  3B6Y A;  2OCE A;  3DLL A;  4A93 H;  2E2I H;  1Q1E A;  4IPD A;  4GN5 A;  4DR1 Q;  4DK6 C;  1IBL L;  1CKN B;  3CPW A;  5FJ8 G;  3ER0 A;  2YTX A;  1U0L A;  4LFA Q;  5C4X H;  4X62 L;  1YIJ A;  2PNH A;  4BA2 I;  4OX9 Q;  4BY7 H;  1Z47 A;  4IPC A;  1YJ9 A;  4HJ7 A;  1A63 A;  1A62 A;  3GTO H;  3GTM H;  5FLX c;  2XGT A;  2UUC Q;  2UU9 Q;  2ZJQ A;  5IT9 c;  1S3O A;  1XMO Q;  2E2H H;  1XJV A;  2YU9 H;  3PIO A;  1NMF A;  4KLK A;  1KC8 C;  4YCW A;  4YCU A;  3AQQ A;  4GLA C;  3K7U C;  4LF5 L;  1Y1V H;  2A19 A;  4TVA B;  3U50 C;  3K80 C;  1LYL A;  2JA5 G;  2JE6 I;  1H95 A;  3CCM A;  4JI1 L;  2WB1 E;  4YWK A;  3D31 A;  2K4K A;  4MTN A;  4JI5 L;  2GN5 A;  3IRB A;  3PF5 A;  1S40 A;  2ZJR A;  1HZ9 A;  2LXK A;  5IYC G;  4DV1 L;  2R7Z G;  4BXX H;  3FHW A;  3GTK H;  2JA9 A;  1NBW A;  3L7Z C;  4PZ6 A;  1VQA A;  1LUZ A;  1EYG A;  3OW2 A;  3M7N A;  4IFD G;  1T9H A;  2R7D A;  1QVC A;  2VUM G;  4HIK A;  4QIW E;  1PYB A;  3HOU G;  1N34 L;  5BR8 Q;  1WYD A;  2KCM A;  2PI2 A;  4A3F G;  1SMX A;  1VQH A;  1QUQ B;  4JG2 A;  2OQ0 A;  4DV2 L;  2EQS A;  4A3K H;  1YEZ A;  4R4O A;  2UUB L;  2FXQ A;  3UDI A;  1KL9 A;  5LMU L;  3H3V I;  1VQB A;  1XMQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...