4LUVA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luvA00
1JJCB 2QA4A 1Y14B 2ZTDA 3HOWH 5ELOA 3M3YH 5K36G 1JT8A 3TS2A 1XPOA 1XPRA 4OWTB 3HKZG 2JEAI 1E3PA 2KCMA 1EYGA 1G291 5M3MH 4JCVE 4BBSH 2XTIA 5GROA 1Y1VG 2JA6G 1JB7A 3E9HA 1IBMQ 3GTJH 3HKZE 3RN2A 3I4MG 4A3IH 1XMOQ 3MXNB 1X55A 4LFCQ 1E7ZA 4IPCA 4HJ7A 4R4QA 4EX5A 2V1CC 4A3KG 2UUBL 2R7ZH 3GTQH 4LUZA 1K8AC 4IFDJ 4X65L 2MFIA 4DR4Q 4B3SL 2GVBA 2Y0SE 1Y1VH 3FP9A 1ASZA 1IZ6A 3J7A5 2ZM6Q 1Y1WG 1HNXQ 3M85A 1B70B 3K80C 3ULLA 4AH6A 2OTJA 1MJEA 2N78A 1TXYA 1VQEA 2VL6A 4DAYB 3HOWG 3AFPA 5C0XJ 4JI7L 2HHHL 3F8TA 3TREA 3U4ZA 4BBRG 4BBRH 4A3JG 2HHHQ 4JI0L 1N33L 1AH9A 3A5ZB 3K7UC 5E7NA 1CSPA 4LFBL 2WAQE 3CD6A 1VQ8A 4FDBA 4JI8L 2I0QA 1SN8A 2HIVA 4YCUA 1M90C 4A3MH 4GNXA 1LYLA 2RCNA 3PGZA 3CCUA 4LF8L 2N8NA 3A5UA 4BA1I 5IYCH 3PO2G 3NBHB 1CKMA 5C4XH 1VQAA 2OQKA 3FHWA 4NB3A 1SROA 3DLLA 4GLXA 1DGSA 4DV4L 3TQYA 4OWWB 4UP8A 1KD1C 2KCTA 4LFCL 1HZBA 3T1HL 3HOVH 2K5HA 3CQZH 1VQ7A 3RR5A 1QUQB 1FGUA 3G71A 5M3FG 3K81C 1QZGA 1KRTA 1X54A 1Q81C 4P71A 4JYAL 1CKOA 1TWHH 1WCMH 4JI2Q 1XNQQ 2YTYA 3E9IA 1Q86C 3UDFA 3ZJYC 4HIDA 3KF6A 4DR7Q 3BZKA 4QQBX 4IFDG 1PFSA 3RZDH 5C0XI 3CCRA 3ULPA 2WAQG 1Q1BA 3I4NG 2CKZB 1B7YB 4PMWA 2B3GA 1N8RC 4JI4Q 3KLWA 2E8GA 2VUMG 1Z9FA 1IBLQ 1M1KC 3K7AH 4PG3A 5EAYA 3BJUA 5GAEC 1UEBA 4P75A 4HIKA 1JMCA 2D62A 2IX1A 3S1QH 4A93G 4JI1L 3HOUG 1PH1A 2GN5A 2K4KA 1KXLA 3J81c 1L2FA 4DV3Q 1YI2A 3J80c 4DR1Q 3A74A 3FKIG 4XIGS 4DV6L 1I50H 1XJVA 3GTMH 4DR6L 4GLAC 4LF7Q 1TWGH 3ERSX 2Z6KA 1N36Q 2E2IH 3NEMA 5M5WH 2NZOA 1PYSB 2ZM6L 4A3MG 1W3SA 4JI0Q 3BZCA 4JI3L 3CXCA 4DR5Q 3HOUH 1SE8A 1HNZL 2UUAQ 2IY5B 3LGJA 2R7DA 1A0IA 4X62L 2NVTH 3U4VA 2K5NA 4KHPQ 4PZ6A 1ASYA 5C3EH 4A3JH 4A3DG 4DUZQ 2HQLA 4AQYL 1CKNA 2JA8H 3S24A 2VY3A 3I4NH 5JEAG 1SMXA 1V9PA 1RIPA 3S15H 3CMAA 4WJ3M 4JOIC 4JI8Q 3I56A 2ZJQA 3STBD 3W5OA 3UE1A 4DV2L 4GLVB 4X66L 4BY1G 1VQFA 3KOJA 3KJOA 3GTKH 2AKWB 4O2DA 4LF4Q 2ZTEA 2CWPA 3M9BA 5IT9c 1K0RA 5IYDH 1T9HA 2YTXA 4DK6C 3S1MH 3J81j 4DAMA 1NMFA 5IP9G 1X3GA 1J6QA 1V1QA 3NELA 3HOZH 1VQCA 2A1AA 3PIPA 1LM0A 5JEAJ 2K5VA 4DV6Q 3KF6B 4IOAA 3PUWA 3PUVA 3T1YQ 1WCMG 3GD7A 3F2DA 4X65Q 1OTCA 2WB1E 4DV7L 1G6PA 5GAHC 2BA0A 3I4OA 2NVXH 4JI7Q 2JA5H 4JV5Q 2K14A 2R6GA 5IWAL 3G6EA 5IWAQ 1HNZQ 3J7ZC 2IHEA 3L2PA 1KAWA 1OXXK 4GN4B 1MJCA 4X64Q 4B3RL 4B3RQ 2ALYB 1NTGA 5C44H 2PI2E 2PQAA 4LUOA 4DR6Q 5IE8A 5FLMG 1YJ9A 3HOYH 1KIXA 3PO3G 1N32Q 4JBWA 3H15A 1K8GA 2Q2TA 3AYHB 1VQNA 1QVFA 1XTDA 3RNUA 1VQOA 4NXML 4LF8Q 1WOCA 4DR5L 2KBNA 4QY7A 1HH2P 2LXJA 2NZHA 4A3EH 2VZAA 1A62A 1UE1A 3U58A 2LSSA 1K9MC 4NPSA 1K83H 2OQ0A 1EFWA 2YV5A 4UY8C 1XNRL 4HJ8A 3PIOA 1QVCA 5C4JH 3J81i 4DR7L 3GDEA 1Q1EA 4GN3B 4QIWE 4X62Q 1UWVA 5DLQE 4QGUA 2KHIA 3H3VH 1BBWA 1VQDA 1H95A 4DV5L 4LF4L 4OWXB 5IY0A 1A63A 1N34Q 4GKKQ 2MNAA 1N34L 4OXPA 5M3FH 4L5RC 1RL2A 1OXSC 2NVQH 4GN5A 4B3TQ 3I4MH 2CQOA 1EUJA 2N49A 3RLNA 2UUCL 2UU9Q 2UXDQ 2UUCQ 2MQHA 5C4XG 1SR3A 3CCLA 5JJLA 2NVYH 4POGA 3PO2H 3PO3H 2R93G 4AYBE 3L0OA 1Q46A 4YHHQ 4LF6Q 1IXRA 2I5LX 1VQPA 4MTNA 4DR4L 1S40A 5GADC 4OX9L 3S1NH 1HNXL 1PH8A 1I3QH 3S14H 2VQEQ 3GTLH 4AYBG 4IO9A 1VCIA 3I55A 2E2HH 3STBC 5C44G 4LNQA 1G51A 1HZ9A 1S3OA 4XTCS 4NXNL 3I2ZA 3M4QA 1X3EA 2C35B 1YHQA 1YITA 1EQRA 2FXQA 2VNUD 4IPHA 4DUYL 4LWCA 4ME3A 4K0KQ 3WWVA 3GTGH 2A8VA 3U50C 3I7FA 1BKBA 4OO1G 4DV1L 3KFUA 1PH5A 4DV1Q 2AHOB 2ATWA 1YEZA 4UPAA 4X64L 2CWAA 1AE2A 4JOIA 4DUZL 4LF9L 2A19A 4KI0A 2IX0A 3D31A 1AE3A 2ZJPA 1GKHA 4YWLA 2B29A 3GTOH 3A0JA 5IYDG 1VQMA 1N32L 3W1BA 2JA6H 2UU9L 4EQ5A 4KLKA 4BBSG 3KYHC 4JG2A 1KHIA 2XGTA 3Q8DA 3CW2C 2RHSB 2F4VL 2VUMH 3H0GH 4A3FH 1PH6A 3OW2A 4IOCA 3T1YL 1IBKQ 2PI2A 1V43A 4YY3L 3S2DH 3AFQA 2MO1A 3UDIA 2ASBA 3F2BA 3OTOQ 2ZTCA 2JEBI 3JC66 4GOPA 1KL9A 2VQEL 4P73A 1JE5A 1LTLA 2E5LL 4LUVA 1UE6A 1WJJA 3KDFB 3H0GG 4UP7A 4A3FG 1I94L 1SLJA 1L0WA 1E24A 1YIJA 3ER0A 2VQFL 2K52A 2VQFQ 1Y1WH 3MEFA 5AJ3Q 4GNXC 1N33Q 4K0KL 4YHHL 2B63H 2K50A 2H5XA 1OXUA 3CCJA 1JJ2A 4B3SQ 4A3KH 3EIVA 3G48A 1YJWA 5FLXc 1PH2A 3D0FA 1YBYA 1L1OC 2JA7G 4A76A 4P74A 5JJKA 3KJPA 2N3SA 3PF5A 2CCZA 4BA2I 4A3LH 2JA9A 2PMZE 3PUYA 4MZ9A 1XMQQ 4GNXB 3HKSA 1XMQL 1SFOH 3ICEA 4YCWA 2BH8A 1VS0A 3K8AA 1CUKA 1VQHA 1X56A 4A3BG 4JBMA 3F2CA 4JYAQ 4BY7G 4C3JH 4PZ8A 5LMNQ 1GVPA 4Y7NH 2UUAL 2MO0A 4L5TA 3RZOH 1VQBA 4HJ9A 1X3FA 2Z0SA 4HJ5A 3PSIA 1QUQA 1EOVA 1TWCH 4LF9Q 4A3GH 3CP0A 2OWOA 3JAMi 3EN2A 4O0AA 2QGQA 4MNOA 5M5YH 2QEXA 1XNRQ 4GKKL 1HR0W 1YHBA 1EWIA 2I5MX 2PNHA 1VQ4A 1VQIA 4JI6Q 1U0LA 5GAGC 3G4SA 1K73C 1S72A 4C2MH 4QJFA 1VQGA 3RLFA 3KDFA 3EBEA 3K0XA 2F4VQ 4HIMA 4LW1A 3HOXG 1PHJA 3S2HH 2Z6KC 4DR3Q 4GOPB 3E0EA 5C3EG 4YY3Q 3PV0A 2LXKA 3HOXH 3CCSA 2NN6I 4DR3L 1YVCA 1SRUA 1JJGA 1EIYB 4IJLA 1WFQA 4JI2L 2DUDA 4LF5Q 1NY4A 1KC8C 5FJ8H 4R1JA 3M7NA 1P16A 4IPGA 3UDXA 4L5SA 4A93H 4X6AH 1QVGA 2E5LQ 2AWOA 5IP7H 1HNWL 1E22A 4YWMA 4DV7Q 3CCMA 4RMFA 1J5EL 3L7ZC 4GS3A 3GTPH 2VS1A 1GO3E 1C9OA 1MKHA 3FKIH 5LMNL 4A4IA 1QZHA 1CSQA 3TRZA 2HIXA 1L1OA 2Q2HA 4JI5L 5H1SE 3UDGA 4A3EG 4NXNQ 3AQQA 2NN6G 5C0XG 2YTVA 1HNWQ 4J15A 1FJGL 4AQYQ 1PH4A 4DUYQ 3KF8B 4R4TA 2IT1A 3OYYA 2BA1A 3CPFA 4P72A 4BY1H 2JJQA 2WB1G 4A3CH 1A8VA 1WYDA 2R93H 1HR0Q 2HT1A 4DV2Q 2JA7H 1HR0L 4YWKA 2RF4A 4X66Q 3IRBA 2R92G 3AEVA 2JE6I 1C0AA 1B8AA 4APVA 1VQ5A 4DPGA 4C3HH 1W2BA 1EQQA 1U5KA 1PA6A 1X6OA 2IHFA 2UXCQ 4TQUS 1IL2A 4DKAC 5HGQA 3HOVG 5IP7G 2ZJRA 4JBJA 5HY6A 1D8LA 2L15A 3S1RH 5JJIA 4DNIA 1KQSA 1PV4A 2UXBQ 1NMGA 4B3MQ 3CMEA 1FL0A 2WP8J 3PUXA 3TEHB 1IBKL 5LMUQ 2F3IA 5BR8L 3CPWA 3CC7A 1Q82C 1NBWA 2R92H 1PH9A 1VQ6A 3CCVA 4DV5Q 1GD7A 5IP9H 4QL5A 5AJ3L 4JI4L 3HOZG 1YNXA 4BXXG 3W1GA 1IBLL 3H3VI 1Z47A 1X9NA 1L1OB 4GKJL 4LFAL 1I94Q 5FLMH 1XMOL 4LF5L 1YHAA 3HOYG 3S17H 1BVSA 4KHPL 4ALPA 3DM3A 1FVIA 4DR2L 2UUBQ 4DR2Q 2YU9H 1BBUA 4A3GG 1KRSA 2AWNA 1UE7A 5M5XH 4POFA 1J5EQ 3VDYA 2Y0SG 4BXXH 5IYBG 4OX9Q 1LUZA 2EQSA 2K75A 1WI5A 4JV5L 3CF5A 4NXMQ 3S16H 1VQ9A 2KHJA 5GQOA 4H02A 2JA5G 3B6YA 1PH3A 3J80i 2ID0A 1HZCA 1GM5A 5ELNA 1TWAH 1TWFH 4R4CA 4YCVA 4UP9A 1NE3A 4JBKA 1HJPA 1XPUA 2R7ZG 2UXBL 2PQAB 4LFBQ 1X65A 5LMNW 4R4OA 4DV0Q 5FJ8G 2KENA 2D0PA 4DV0L 4JI6L 4DV4Q 5BR8Q 1Q7YC 1MIUA 3T1HQ 4HJAA 1D7QA 1E1TA 1E1OA 1OXVA 2YYZA 5IYCG 3CC4A 2DGYA 4PZ7A 4RG1A 4C3IH 1PH7A 4A3CG 2EIFA 5M3MG 2UXCL 4B3TL 4IPDA 4LFAQ 3RN5A 2AMCB 1XNQL 1N9WA 1YJNA 2UXDL 2R7FA 4KHZA 1P8LA 2JA8G 3M4OH 4Y52H 4OO1I 4GOPC 3HFZB 2E2JH 1HZAA 3NENA 2OTLA 5LMUL 1O7IA 4BY7H 3JAMc 4A3BH 4DK3C 1OXTA 3OTOL 1VQKA 3RLOA 4A3DH 1I5FA 4B3ML 2RHQB 1VQLA 3TS0A 1IBML 4GKJQ 1IYJB 2JQOA 4A3LG 2WFWA 4JI5Q 3GO5A 2I5HA 4JI1Q 3CCEA 1Q12A 1Q8KA 5IYBH 4AIMA 2F52A 1C7YA 2JK8A 4A75A 4WJ4A 1VQJA 2BH2A 4OONA 4LF6L 4TVAB 2B63G 3PF4A 3BU2A 4JC0A 4A3IG 3CCQA 3CC2A 4IFDI 1PVOA 2GVAA 1NJIC 1CKNB 1K3RA 4IJHA 4L5QA 1EIFA 4DV3L 2OCEA 3M4PA 2ES2A 3CAMA 2VW9A 2CFMA 4DR1L 3PUZA 2Q2UA 4JI3Q 1FJGQ 3F1ZA 1R9TH 1I6HH 2Q2IA 3PCOB 4LF7L 1N36L 1UE5A 1YZ6A 3SGIA 4HIOA 1PYBA 2D0OA 4R4IA 3UE0A 3ULJA 2EXDA 5J3BA
chains in the Genus database with same CATH superfamily
1JJCB 4IUUA 3M3YH 2A6HC 1XPOA 1XPRA 2N55A 4OWTB 5NUCA 1G291 4JCVE 3VYSA 4BBSH 1U4RA 1JB7A 1HCZA 2RVLA 3GV6A 2B8GA 5DNFA 5C4JB 4A3IH 2PZUA 3KBGA 4HJ7A 2E76C 4EX5A 3I72A 4A3KG 3D8GA 2J7ZA 2ZXRA 4B3SL 3FP9A 3J7A5 2ZM6Q 1EZ8A 3DEOA 4G7OC 2IL8A 4H44C 3DUZA 2N78A 1ESFA 4ID6A 2F0TA 3QOLA 1SNMA 3E6ZX 4MIUA 3F8TA 5EPJA 4BBRH 2HHHQ 4A3JG 4V0BA 1MD2D 2EY5A 3K7UC 1CI3M 1CSPA 4LFBL 3CD6A 5JVH3 4ZK9B 3QOJA 4EQPA 4V190 4YCUA 1LYLA 4HMIA 4LF8L 3AMUA 2N8NA 3H94A 4BA1I 1V1PA 5IGCA 5KNCA 5IYCH 3NBHB 1STHA 4AYBB 3I90A 5C4XH 1VQAA 1SROA 4GLXA 1DGSA 4DV4L 4OWWB 4LFCL 1HZBA 2MPMA 4P71A 1TWHH 2MP1A 3GTKB 4JI2Q 1XNQQ 2YTYA 3E9IA 3UDFA 3ZJYC 2Z8LA 3KF6A 2LMCB 3VYUA 4QQBX 4IFDG 1K0SA 2K1BA 4CDCC 1EL0A 5C0XI 1Q90A 2WAQG 4H0LC 1Q1BA 2KEEA 2CKZB 2B3GA 3KLWA 1B9NA 4DXFA 2VUMG 1Z9FA 2TSSA 4HSPA 4J6HA 1EY6A 1M1KC 5GAEC 4P75A 1Y8PB 1JMCA 1ILQA 2D62A 2IX1A 2O4XA 2GN5A 1PH1A 1QB5D 1L2FA 4DV3Q 3A74A 3T51B 1XJVA 3GTMH 4KKUA 1TWGH 4F7XA 3K59A 5M5WH 5IGGA 4JI0Q 2O5IC 3T53B 4DR5Q 1DCZA 2R7DA 3U4VA 4XYQA 1PFMA 5C3EH 5DM63 4A3DG 3NWSA 3S24A 5JEAG 3S15H 2K01A 3HG9A 1ML0D 4BY1G 1D5MC 2SDFA 1PZJD 5IYDH 4HTHA 5CV4A 2JXMB 2PMZB 1A3VA 2EYFA 4DAMA 1V1QA 2DN8A 1BUVT 1CZGA 3BG3A 2K5VA 4DV6Q 4IOAA 2F3VA 1TY0A 4A3MB 3TMEA 2NVXH 3S9WA 1DJRD 2RA4A 1HNZQ 5C4ZA 3IFTA 3MFYA 4XDXA 3W2DA 4PMBA 1KAWA 2I46A 4X64Q 1G2TA 1VF7A 1T5XD 2KOLA 4DFAA 3ND8A 1Y1WB 2F0EA 1CA6A 3H15A 2Q2TA 5EQ0A 1VQOA 4NXML 4LF8Q 2HDLA 2KBNA 3AB9A 2LXJA 4A3EH 1YNNC 1UE1A 1FNVA 1K3BC 4R8IA 1L0XB 3PIOA 5A2QE 1IL8A 4XQNA 3EVQA 2VUMB 4X62Q 4QIWE 1Q8IA 5DLQE 4QGUA 5M3MB 4FXGC 2Z4HA 4LJZC 4CHTB 1N34Q 4GKKQ 3H09A 4QCLA 2F0IA 2UU9Q 2UUCQ 2MQHA 5JJLA 2PW7A 2R93G 3L0OA 1Q46A 2EY6A 4K2LA 4ZQ3A 2HCIA 3OW7A 5GADC 3S1NH 1HNXL 3S14H 2VQEQ 4KMUC 3I55A 1G51A 4RWSC 4NXNL 3OIPA 1YHQA 2C35B 1AZQA 3P75A 1HQMC 3I8ZA 4ME3A 3GTGH 2A8VA 2K33A 1BKBA 2MJ8A 4DV1Q 1H9MA 5IODA 4F8MA 1YEZA 2AQ3B 3BYYB 2CWAA 4LF9L 1B1ZA 2IPKD 4KI0A 5KEEA 4XYOA 1AE3A 2J4XA 1CA5A 2R3ZA 1BCPF 3TZDA 3W1BA 2JA6H 5EBDA 4KLKA 1GUOA 1AN8A 1JWMD 3HKZB 3Q8DA 2RHSB 4A3FH 1TU2B 4C3IB 2BCOA 3JAML 2NN6H 4YY3L 3AFQA 3F2BA 2JEBI 1TQOA 1KL9A 2NBFA 1JE5A 2F0GA 2M2LA 1V8QA 4LUVA 1I94L 2SEBD 1S5CD 1UNSA 3ER0A 2K52A 2VQFQ 1SAPA 2B63H 2K50A 5C44B 4Q0FA 1LT3D 2KQ3A 5FLXc 1PH2A 1MSGA 1O80A 1YBYA 1XX8A 5JJKA 3ERQA 4BA2I 2PMZE 1SFOH 1XMQQ 2Q8TA 3S17B 5LHY1 3K8AA 1X56A 4JBMA 4UHVA 3F2CA 4C3JH 4PZ8A 1O7LA 2UUAL 2MO0A 3FPUB 1VQBA 2A6HD 4TKOB 3RD4A 2R92B 4A3GH 3V05A 4O0AA 2QGQA 2QEXA 1HR0W 1EWIA 1VQ4A 4JI6Q 3I4LA 1K73C 3RLFA 4IUTA 1RTNA 3K0XA 1GUWA 4LW1A 5T1GA 1PHJA 3S2HH 1PLFA 1ENFA 4JYAQ 2X6GA 2XVSA 3HOXH 1JJGA 1GUGA 2K05A 1STNA 1EIYB 1K8OA 1WFQA 4A3JB 4LF5Q 1KC8C 1TKWB 1D1IA 4IPGA 4X6AH 3SE0A 4U673 1UAPA 5BN3A 1ESRA 4GS3A 3GTPH 2EJFC 2VS1A 1GO3E 3FKIH 5LMNL 1WTQA 1WD0A 2HIXA 3Q22A 1L1OA 4NXNQ 3AQQA 3GTPB 2NN6G 2YTVA 1LTRD 2EE1A 1IKLA 4MHEA 4P72A 1CT1D 2WB1G 3SK8A 4MTKA 1WYDA 2B2UA 3IRBA 1C0AA 2JE6I 5F2DA 3S2HB 3Q24A 3BDOA 1WVLA 3I91A 1X6OA 1PA6A 5HGQA 2ZJRA 2RDHA 4DA2A 2NUCA 3M4YA 4B08A 1PV4A 2UXBQ 2PZTA 3TP5A 2F0FA 1PRTB 1NNXA 1MBYA 1Q82C 1JWSD 3CC7A 4A3GB 2R92H 1PH9A 3CCVA 4XXEA 4CKEA 2OEOA 4JI4L 5CBAE 4G7ZC 3W1GA 4C3JB 4GKJL 5A2QL 1I94Q 1YHAA 3S17H 1EY0A 1FVIA 2UUBQ 1SFOB 4TSSA 1UE7A 1CHQD 1TS2A 4S3SA 1LUZA 5IYBG 1F2LA 1WI5A 3EFXD 3HZXA 3K58A 1RHPA 3FEWX 1A3UA 2D9UA 2B63B 2M9VA 1ONLA 5GQOA 1GUTA 3EA6A 3CU7A 2JA5G 1PH3A 3IKJA 2ID0A 1HZCA 3J80i 1GM5A 1KDAA 5HURA 3BZDB 4YCVA 1XPUA 4UP9A 1HJPA 1Z7TA 2PQAB 2R7ZB 5LMNW 2KENA 3QR8A 1EY7A 4J8QA 1FD7D 3N6RA 2RDGA 1Q7YC 4HJAA 1E1TA 3CC4A 1JCKB 4C3IH 4RG1A 1PH7A 4A3FB 4IUVA 2UXCL 4NP5A 4HN7A 1YJNA 2UXDL 4KN7C 3EQLC 3J81E 2XWJB 4K5XA 3R93A 4GOPC 4OO1I 3HOWB 3MXGA 2OTLA 1E2ZA 1O7IA 4A3BH 4DK3C 4ZKBB 2K5QA 4B3ML 3GTGB 4JPBW 4A3LG 3V96A 1Q12A 4M8AA 5IYBH 3NHHA 4WJ4A 1VQJA 4LF6L 3U9SA 3S14B 3D4DA 3CC2A 4RCOA 1NJIC 3S1NB 1I4RA 4IJHA 1EIFA 1TR5A 1YNND 3EROA 2EYOA 3T13A 3PCOB 4LF7L 5KGUA 1N36L 1YZ6A 1UEAB 4R4IA 1AP0A 3ULJA 2EXDA 1LTBD 5I9PA 2ZTDA 5K36G 2F0MA 1JT8A 3TS2A 2F0VA 2KCMA 5M3MH 2XTIA 1B9MA 5GROA 1Y1VG 2KHSA 1SYBA 3K0YA 3NPPA 5ELEA 1XMOQ 2F4IA 1AFPA 1X55A 5IT9L 2WINB 2EY2A 1DOKA 1LACA 3NXWA 1STYA 1K8AC 4IFDJ 4FYDA 2M00A 5JJZA 2MFIA 2GVBA 4DNRB 3M85A 2G9HD 5E4WC 2OTJA 1XTCD 2VL6A 3HOWG 1MGSA 3TBIB 2DY8A 1LO5D 5M5XB 1EOTA 4JI0L 1N33L 1AH9A 3A5ZB 5E7NA 2WAQE 4FDBA 3MXPA 4JI8L 3A56A 2HIVA 2CH4A 4A3MH 2LY7A 3PGZA 2RCNA 4ZUIA 3KLSA 4GNXA 1NR4A 4I65A 3PO2G 1BQQT 2OQKA 2ZXOA 3FHWA 3DLLA 4UP8A 3U9OA 2KCTA 3HOVH 2K5HA 3RR5A 2A6ED 1QUQB 5M3FG 3OSOA 1QZGA 1KRTA 1X54A 2A69C 3CKIB 1Q86C 4DR7Q 3BZKA 1BNZA 4ILWA 3ULPA 1EY9A 3I4NG 2KECA 2R93B 2KUMA 2E8GA 5CGKA 3NBIA 1IBLQ 1PTOC 4EQOA 5EAYA 3BJUA 1UEBA 3MC0B 4MN3A 1IHZA 3HOUG 4QUCA 1F9SA 4DR1Q 1I50H 1II3A 3GTMB 3J80E 2WKDA 2E2IH 2Z6KA 4N9PA 3DXJC 5FLXE 2NZOA 2MGSA 1PYSB 3LWUA 4BWGB 2ZM6L 1PZID 2OF1A 3BZCA 3HOUH 1SE8A 4A93B 2TMPA 1CTMA 1LTTD 1I4PA 3LGJA 1KNAA 2NVTH 1JE4A 2HQLA 4AQYL 3I4NH 1SMXA 4K2KA 4QUFA 3VA7A 1PXUA 1VDZA 3UE1A 4DV2L 2K28A 4HMJA 4X66L 3KOJA 1TWHB 3GTKH 4PQXA 4O2DA 1FNWA 2A68C 3D6CA 3K57A 3DMUA 2DNCA 2JP1A 3QJYA 4R8NA 3S1MH 1TWCB 3IL8A 5IP9G 1J6QA 2A1AA 3PIPA 5C4XB 3D3RA 4OIKA 1RTOA 2Z1CA 2NB0A 2EYLA 4Y7NB 3PUVA 2EYMA 1RJTA 1WCMG 4IUPA 5FO9B 1OTCA 2EXZA 1G6PA 5D3IB 3I4OA 4JI7Q 2JA5H 2L9HA 1TVXA 4JV5Q 2K14A 2R6GA 5IWAL 3G6EA 3SDZA 2EYPA 4C56C 4BBRB 2ZXPA 1MJCA 2NTTA 3KLRA 4PNYA 4B3RL 3P1HA 2CHBD 2PI2E 5I2XA 1WD1A 5IE8A 3QO2A 1YJ9A 1F77A 4JBWA 3AYHB 1VQNA 1QVFA 1JORA 1HXYD 3RNUA 4K8JA 5JOBA 3HS0C 1A62A 1E2WA 1ENCA 3U58A 4XQJA 1K83H 2OQ0A 5COYA 5FO8B 2YV5A 3KBXA 4A3IB 2FFKB 3S2DB 1QVCA 3QWNA 5C4JH 2G5DA 1S5DD 3BVGA 4KN4C 1IYUA 4GN3B 5CBEE 2B39A 2B2TC 4OWXB 1DZ1A 1N34L 4OXPA 3GTOB 3M3YB 3I4MH 1SDFA 4HEDA 1I4XA 4AYBE 2QF7A 2QDLA 1WTHA 2I5LX 4LK1C 1VQPA 3CHBD 4DR4L 2R61A 1PH8A 4AYBG 4X3TA 4LNQA 1HZ9A 1S3OA 3I2ZA 4FP5D 1MSHA 1YITA 1EQRA 2FXQA 5KIXA 4DUYL 4ZLTF 4GZYC 2CW0C 1B44D 3NTHA 3I7FA 1W6JA 3KFUA 3PO3B 3PO2B 1Y8NB 3H91A 4X64L 4BY7B 2A19A 1STGA 2C9OA 4UAIA 4DAVA 3D31A 2ZJPA 1GKHA 3A0JA 5IYDG 1JR0D 3E3XA 2QW7A 4JG2A 2F0HA 2XGTA 4X3UA 3CW2C 3P7JA 3BVZA 1PRTC 2MUYA 4NW2A 4QB4A 3OW2A 4IOCA 3T1YL 5L37A 4DN4M 3DEPA 2MO1A 3UDIA 2ASBA 4GOPA 1LTAD 1LTLA 1Y69U 1A3TA 3H0GG 1L0WA 1E24A 1HPCA 1O7ZA 5AJ3Q 1PTOB 1SNCA 3HOYB 4K0KL 2XSCA 2H5XA 3CCJA 3C3LA 4A3KH 3EIVA 1YJWA 3C1FA 2JA7G 4A76A 2HD3A 2SOBA 1V1PB 2N3SA 2CCZA 4A3LH 2JA9A 1WTWA 3VA5A 3HKSA 5IGFA 4RH6A 2BOSA 1VS0A 4A3BG 4KTAA 2F1MA 1EU3A 2MHVA 2WKCA 3BS1A 1EY8A 4HJ9A 3P20A 3PSIA 1QUQA 1EOVA 2FJ2A 3HOZB 3WOFA 3MXUA 2OWOA 3TSSA 3JAMi 1M4VA 4KJOA 4CBVA 4DF7A 1VQIA 1U0LA 3G4SA 3D4WA 2G9DA 4KD4A 4QJFA 4F87A 3EBEA 3NQTA 4F88A 4HIMA 1EQTA 2Z6KC 1CQFA 4GOPB 3HOVG 2JA8B 3CCSA 2LXKA 3NUCA 2NN6I 1B3QA 2PYKA 2WIIB 5FJ8H 1BCPC 4R1JA 3M7NA 3HEJA 1QVGA 5C3WA 3GV3A 4CKCA 1Z6HA 5IP7H 1E22A 4DV7Q 3L7ZC 3AU7A 3SK5A 1EWHA 1QZHA 2AQ1B 2Q2HA 5H1SE 4FNFA 3OOCA 1FJGL 5DEHA 4DUYQ 3KF8B 3K7AB 1PFNA 2BA1A 4BY1H 2JJQA 4DAYA 1HR0Q 2JA7H 3J7AF 2Y0SB 5IGEA 2R92G 3RZDB 3V2TA 5I6YA 4ZRZA 4C3HH 1C48A 2UXCQ 4TQUS 1EY5A 3TN2A 4DKAC 4JBJA 1D8LA 5JJIA 5CV5A 1KQSA 4N8X1 3CMEA 1FL0A 5M5YB 3CQZB 3PUXA 3TEHB 1HNWQ 2F3IA 5C6AA 3CPWA 1NBWA 2C5CA 2K7VA 4DV5Q 1GD7A 4WRDA 3HOZG 4QL5A 1PTOD 3RUZA 1B4OA 1S5FD 5KNDA 1J9OA 2A73B 1V1OA 2WV6D 4H13C 4KY6A 1RDPD 1TY2A 2YU9H 4IQZA 1J5EQ 3VDYA 1HTLD 4BXXH 4OX9Q 1DM0B 1G91A 2EQSA 2K75A 4C1NK 4OELB 4NXMQ 3S16H 1G6ZA 1NCVA 1PMRA 2KHJA 2NZ1D 4RGMA 5I6WA 3B6YA 5FO7B 1HA6A 1TS5A 1TWFH 1ENAA 4KY5A 4JBKA 1GUNA 2JYOA 3OWFA 3WDNA 2A6EC 3R3OA 4LFBQ 5I2YA 4KHVA 5FJ8G 5BR8Q 3DWAA 4KD3A 2K5WA 2AUKA 5IYCG 4A3CG 5M3MG 4LFAQ 2EYJA 1FYCA 1N9WA 1P8LA 4QIWB 3M4OH 2BE5C 3UI2A 2ICEC 4C3JG 5CORA 3OTOL 1VQKA 5E3FA 4DU9A 5KYLA 1MI2A 2EPBA 2RHQB 1R9TB 2JQOA 2WFWA 4HR7B 4JI5Q 4JI1Q 2BDNA 4C3HG 1Q8KA 2F52A 4OONA 2B63G 4XQQA 1X32A 3BU2A 4JC0A 3GTLB 1I3QB 4A3IG 3CCQA 2GVAA 1F2ZA 1CKNB 4L5QA 4DV3L 2WACA 3VYTA 2ES2A 3K5MA 1FJGQ 1I6HH 1R9TH 3KK7A 2NVYB 1EEFD 3K5OA 1PYBA 2PW5A 4ZYSA 1Z47A 5J3BA 1KTKA 2QA4A 5A35A 1Y14B 3M4OB 4P2CB 2DNEA 3HKZG 1E3PA 2JEAI 3SR1A 2ICIA 2JA6G 2E74C 3E9HA 1EU4A 2B2WA 1DOLA 1IBMQ 3GTJH 3HKZE 3RN2A 3Q23A 1K28A 2D5DA 3MXNB 2L12A 4LFCQ 4JK1C 2RQXA 4IPCA 2B2VC 1S5BD 4XT1B 3GTQH 1KDCA 4X65L 2RCFA 1TWFB 5D3DA 1BCPB 1ASZA 1HHVA 1Y1WG 1HNXQ 3TP8A 1ZXTA 4K5WA 3K80C 3ULLA 2XN9C 4AH6A 5LL6S 4PV1C 1ZEQX 1VQEA 4DAYB 3S16B 5C0XJ 1ZKOA 2JN4A 3U4ZA 1B53A 4ZAIA 2L4NA 2YU9B 2HUGA 4YIJA 3IAYA 5J22A 1BCPD 1D5XC 1PZKD 3E5SA 1SMYD 3CCUA 5CC4A 3A5UA 4DXGA 3CRLC 1CKMA 1D6EC 3TQYA 3K5NA 4FF2A 3CQZH 1VQ7A 3G71A 1FGUA 3K81C 1Q81C 4JYAL 3D6WA 3VR2A 1G2SA 1WTXA 5KRUA 1BF4A 3RZDH 3CCRA 2QILA 1RODA 1B7YB 4PMWA 5IGBA 4IUQA 2XRQD 4BY1B 3K7AH 4PG3A 5K5PA 4HIKA 4A93G 3S1QH 4JI1L 1WTOA 4RA8A 1YI2A 3J80c 3FKIG 4DV6L 4XIGS 2F0QA 5ISRA 1ZYRD 2F0JA 2NWGA 3DWQA 2LS01 2E75C 2OXPA 4A3MG 1D2BA 3CXCA 2A69D 1TS4A 1HNZL 2UUAQ 2DY7A 4DUZQ 2EDGA 2JA8H 1V9PA 1VMCA 3CMAA 4JOIC 4JI8Q 5G3LF 5J39A 1F2YA 2ZJQA 4OHJA 3STBD 3W5OA 1WCMB 4N8FA 4GLVB 1SSOA 2AKWB 3M9BA 5IT9c 1T9HA 2YTXA 1KABA 2HCCA 5JVG3 2BDOA 3HOZH 2PO4A 1LM0A 5JEAJ 3KF6B 2FHTA 3PUWA 3QG1A 4X65Q 5EKLA 2BA0A 5CR3A 3T56B 1TS3A 3G7LA 3Q0AA 4IALA 3FVQA 1T5EA 5IWAQ 3J7ZC 1RKNA 2IHEA 5EKKA 3L2PA 1OXXK 1ZYRC 1E2VA 3K5LA 4KKTA 4B3RQ 1U4MA 1NTGA 2PQAA 4LUOA 4DR6Q 3C1EA 3HOYH 1N32Q 5AFWA 4RGNA 1Y1VB 1XTDA 4R9WA 5IGDA 1SYGA 3TP6A 4XT3B 2VZAA 1R4PB 2KCCA 2LSSA 2XNAC 4NPSA 1K9MC 1AZPA 1XNRL 2B2VA 3MZ5A 3J81i 3GDEA 1UWVA 3ND9A 1BBWA 1STBA 3E0JA 4LF4L 2KA7A 1A63A 2MNAA 2NVQH 5M3FH 1OXSC 1S5ED 5FKAC 4B3TQ 2CVRA 1G8ZD 3M7GA 4WJWA 1DONA 4PMCA 1BXTA 1SR3A 5FLXL 1LABA 3PO2H 3PO3H 2XIWA 2F0OA 4LF6Q 1FR3A 4MTNA 1I4QA 1S40A 4I7AA 3NTKA 3GQBA 3O13A 4B9XA 2E2HH 2Q8IB 4K8IA 3NP8A 4DK0A 2VNUD 1BDOA 3BDCA 3SXHA 2P5ZX 3U50C 1IW7D 3OWEB 4OO1G 4A3DB 2IJ0A 5CV8A 2AHOB 2ATWA 2EY1A 5JPNC 1AE2A 2BE5D 4DUZL 1EYDA 3KLSX 2IX0A 2E2JB 3GTOH 2B29A 1SNDA 1VQMA 3MA2B 2PZWA 2UU9L 4EQ5A 4BBSG 5JPMC 3H0GH 1PH6A 1B50A 2EYHA 1IBKQ 1V43A 2Z4IA 3S2DH 2EJGC 1SYCA 3MFGA 2ZTCA 1K83B 2VQEL 5TSSA 3L9AX 2PPBC 1BBXC 1UE6A 1WJJA 4UP7A 1TWAB 1YIJA 4GNXC 4EGVA 1N33Q 2DJGC 2KCNA 4NMZA 4YHHL 5EJWA 5KNBA 4ZUJA 4B3SQ 1HUNA 3G48A 2F0LA 5ELFA 5EPLA 3RMHA 1L1OC 4ABNA 3KJPA 1LTSD 3PUYA 4MZ9A 4GNXB 3ICEA 1H9JA 5HGTA 2BH8A 2JA5B 1CUKA 1VQHA 1D5ZC 5LMNQ 4BY7G 1GVPA 4Y7NH 1QNUA 4L5TA 3RZOH 1HTPA 5EPKA 1X3FA 4HJ5A 1TWCH 2RSOA 3CP0A 1XNRQ 1PRTD 3EN2A 3MVVA 4MNOA 4U68A 3T4AC 3S1MB 1VMPA 4GKKL 1D1KA 1QCBD 2PNHA 5GAGC 3VR4A 3S1RB 1E0BA 3OMCA 3BDLA 4C2MH 1VQGA 2F4VQ 3GP7A 1B2TA 1S4ZA 3HOXG 3I4NB 4DR3Q 3E0EA 5C3EG 1YVCA 1HFNA 4IJLA 4JI2L 1NY4A 2CW0D 3FPPA 2NVTB 4L6TB 4IZ8A 3CRKC 3UDXA 5C4HA 4A93H 1GXDC 1JC7A 2E5LQ 3HOUB 2AWOA 1SMYC 3W3AA 4YWMA 2F0NA 1J5EL 1K8MA 1PYWD 3C2PA 1VF5C 2E2IB 1MKHA 4A4IA 1CSQA 3FRPB 2F0DA 1I50B 3UDGA 2QCPX 1KDBA 3SK4A 4J15A 1EIGA 4AQYQ 2XRSD 3OYYA 1KAAA 5DAUA 2VB2X 2R93H 4DV2Q 1HR0L 4EQNA 2RF4A 4X66Q 2O5JC 3T16A 5CV7A 3AEVA 1B8AA 1EQQA 2IHFA 5C5MA 1IL2A 2VB3X 5IP7G 1SE2A 4C2MB 3S1RH 5BN4A 1EWCA 1SE4A 1QILA 1IBKL 3HOVB 3J7AV 5I9OA 2SNMA 3A55A 3VR3A 1VQ6A 2F0WA 5IP9H 3A8JE 1YNXA 2AQ2B 2F0UA 4K6DA 4UDUC 3RZOB 2F0KA 1IBLL 1J8IA 1L1OB 2B2WC 2PNRC 2N88A 5FLMH 3J80L 1XMOL 1BOSA 1BVSA 4KHPL 3DM3A 4C3IG 1RF2D 3MTSA 4DR2L 1BR9A 1BBUA 1GUSA 3I3CA 3SHLA 1GHKA 1KRSA 2Q8RE 3PIO3 5M5XH 4POFA 5IT9E 3R2TA 3CF5A 2L0CA 1JOOA 4H02A 2L1BA 2K5DA 1PRTF 4WFN3 3TZUA 1TWAH 4R4CA 4RKBA 2UXBL 1QG7A 4CDDC 4DV0Q 4R4OA 4JI6L 1JB3A 1EQVA 3T1HQ 5JAVA 1SNQA 1D7QA 1E1OA 2YYZA 1LT6D 2IWHA 2B2YC 2DGYA 2X6LA 4PZ7A 1KNEA 1R4QB 4DNTB 3H0GB 3TP7A 2L5TA 4IPDA 3RN5A 2AMCB 3D4RA 2R7FA 4IN3A 2FINB 5DM73 4EVOA 2E2JH 1HZAA 1U4LA 5LMUL 3JAMc 1WTRA 1OXTA 4B9WA 3K6OA 4A3DH 1I5FA 2QKIC 3KUPA 2XWBB 1VQLA 1XWEA 1IYJB 1JWUD 4KY7A 1SE3A 1SNPA 3PQIA 5D65A 4HAEA 2JK8A 1F2MA 5CV6A 1JOQA 1STEA 2BH2A 2E2HB 2QEJC 3J81L 4IFDI 1PVOA 3PMFA 2F0PA 2OCEA 3M4PA 5J1ZA 1H9SA 2VW9A 4DR1L 2Q2UA 4JI3Q 3F1ZA 4CJ2C 4J1MA 3OIQA 4QMGA 3URYA 4RHSA 1UE5A 2KVMA 1SJHD 5CMDA 2D0OA 4A3BB 3UE0A 4BS9A 2OT2A 3EJIA 2NTSA 1MHWC 1WTVA 3HOWH 5ELOA 1NUCA 5M3FB 2NVQB 5IOCA 4IFDH 2FMCA 1EYGA 1A2UA 5IIFA 1SYFA 4FF1A 2SNSA 1TIID 3I4MG 1E7ZA 4R4QA 1QE6A 4RHRA 2V1CC 5KYIA 1TT2A 2UUBL 2R7ZH 4LUZA 1YNJD 5E4XA 2A5HA 4DR4Q 2Y0SE 1Y1VH 1IZ6A 2HDMA 1B70B 3Q6SA 1HFGA 1MJEA 1NR2A 1TXYA 5T1IA 3PIP3 5K36H 3WOEA 1EY4A 1CHPD 5C3XA 3A8IE 3AFPA 4JI7L 2HHHL 4BBRG 3TREA 1SXTA 3A7AB 3L3OC 5ELBA 2B8FA 3MEHA 1VQ8A 2I0QA 3I70A 1SN8A 1M90C 4G4KA 1BO0A 1KLGD 2L11A 3VR5A 1GJXA 4IUNA 4NB3A 4OL7A 2IW3A 4K5VA 1C4QA 1KD1C 3T1HL 1Q3LA 1CKOA 5CYUA 1WCMH 4K6LA 2PQEA 4HIDA 2DJFC 1PFSA 1GHJA 5FOBB 1N8RC 4JI4Q 1EYAA 2VXWA 3ZYYX 1OO9B 4KK7A 1QWYA 5C0XH 1PDQA 1DD2A 1EIHA 1KXLA 1XXGA 3OHXC 2K4KA 3J81c 3H3VC 1NSNS 3MHBA 1SYDA 3QB3A 3F2UA 5EKIA 4DGZA 2RSNA 4GLAC 3J7YW 4DR6L 1DXMA 3FKIB 4LF7Q 3ERSX 3R8BA 1N36Q 3NEMA 4HSVA 3S1QB 1W3SA 4JI3L 4FO2A 2IY5B 1SJED 1A0IA 4X62L 2K5NA 2F03A 4PZ6A 1ASYA 4A3JH 2B2YA 4I7ZC 4JVZA 4L8JA 1CKNA 3HOXB 1EZ6A 1ICWA 2VY3A 1RIPA 1CM9A 3NBHA 4WJ3M 2HQEA 3I56A 2K03A 1VQFA 3KJOA 3OPOA 4LF4Q 2ZTEA 4Z9CB 2CWPA 4ZCKA 1K0RA 1LT4D 4DK6C 2CQAA 1Y8OB 3G6JB 3J81j 1NMFA 1ET9A 3HRZC 1X3GA 3NELA 1VQCA 1JQYD 4LAAA 1SBBB 1O7YA 4ME5A 3T1YQ 3GD7A 3F2DA 2Z9HA 1U9RA 2WB1E 4DV7L 5GAHC 1ET6A 1LTID 3DM1A 1CFMA 1STAA 3MXNA 4RKLA 5D14A 4GN4B 1HQRD 2ALYB 5C44H 4RGOS 4M1UB 5FLMG 4L63B 1KIXA 3PO3G 2F3WA 1K8GA 2RBMA 1PFBA 4ZKCB 1WOCA 4DR5L 4NDXA 4QY7A 1HH2P 3GTQB 2NZHA 3A7LA 4CDFC 1QOHA 2KJXA 3DWPA 2RDFA 1EFWA 5C5LA 4UY8C 4CGYB 4HJ8A 1QNKA 3GTJB 4DR7L 1LV9A 4CJ0B 1Q1EA 2GA4B 2H1EA 2KHIA 1VQDA 5BN5A 2JA6B 3H3VH 4DV5L 1H95A 5IY0A 2Z6BA 4L5RC 1RL2A 3BVMA 3H6MA 4GN5A 2QDBA 2CQOA 2K04A 1EUJA 2N49A 3RLNA 2UUCL 2UXDQ 4KKSA 1SEBD 5C4XG 3CCLA 2NVYH 4POGA 4YHHQ 1RD9D 1IXRA 1I6HB 4K14A 2D2CC 1B3AA 2JSOA 4OX9L 1I3QH 3GTLH 4IO9A 1VCIA 3STBC 5C44G 2PCFB 1FNUA 4XTCS 3M4QA 1X3EA 3FMCA 3A54A 4RCNA 4IPHA 4LWCA 4K0KQ 3DHQA 3WWVA 3BYTB 4O42A 4DV1L 5FK9C 3JAME 3TDQA 4UPAA 1DOMA 3NE5B 4JOIA 4X3KA 4HCSA 2F0SA 4X3SA 1H9RA 4YWLA 1N32L 3KYHC 4OO1H 1KHIA 2E2DC 5E1FA 2F4VL 2VUMH 4KV6A 5M9OA 1SNOA 3NK9A 2PI2A 1X3PA 3QIAA 1CK1A 4RGTA 3OTOQ 3JC66 2ENBA 4P73A 4A3EB 1XYIA 1HRJA 2E5LL 1RCVD 1YNJC 4HCEA 3KDFB 4A3FG 3IFDA 1SLJA 2VQFL 1Y1WH 1PTOF 3MEFA 1UUPA 5ELCA 2J0TD 3NQIA 1OXUA 1JJ2A 4WORA 1QJOA 2L55A 3LNNA 1LT5D 2WAQB 3D0FA 2EJMA 1I6VC 3HP3A 1U4PA 3KF8A 4P74A 3PF5A 1XMQL 4YCWA 5CV9A 2NVXB 1LLRD 1W6KA 4TRDA 3MAQA 4NKLA 2EVBA 4RAUC 1DYQA 2Z0SA 1ILPA 4LF9Q 4LMQD 5M5YH 4CDEC 1SYEA 1H9SB 1YHBA 2I5MX 3NTIA 4ODGA 1S72A 1EFID 3KDFA 4FF3A 1AEXA 4QF4A 4C3HB 3S15B 4DR3L 4YY3Q 3PV0A 1SRUA 2X69A 2JA7B 2DUDA 5C3EB 2B2UC 3VYRA 1P16A 2K32A 4L5SA 1EYCA 1WTPA 1HNWL 1JICA 3CCMA 4RMFA 4FXDA 3SVMA 5M5WB 1C9OA 1TWGB 3SK6A 3TRZA 4H7BA 4JW0A 4JI5L 5EGTA 4A3EG 3MWYW 1F9PA 5C0XG 1JOKA 1KLUD 1PH4A 4R4TA 2IT1A 3HGBA 4DK1A 3CPFA 4CJ1B 2NYZD 2EZVA 4A3CH 1A8VA 2AUJD 3NWTA 4FF4A 1M8AA 4YWKA 1IYVA 4APVA 1VQ5A 4DPGA 3ONAB 1W2BA 4DAPA 1U5KA 4C1NI 2O2LD 3FDTA 5HY6A 2I07B 2L15A 4DNIA 2ZT9C 1NMGA 4B3MQ 3VR6A 2WP8J 1CZWA 4G7HC 3N52A 5LMUQ 5BR8L 3LX0A 2V4DA 5AJ3L 4BXXG 3I73A 4O1NA 3A8KE 1X9NA 3H3VI 1CQVA 2A74C 2FMMA 2H4OA 4LFAL 1IKMA 3HOYG 4LF5L 2LFNA 4ULLA 2EOTA 4RFBA 4ALPA 4DR2Q 5LL6X 4A3GG 2AWNA 5JEAH 3OMGA 2Y0SG 4A3KB 4JV5L 5I4DA 1VQ9A 4KJNA 1LTGD 1PTOH 4FVMA 5G3LD 4OGQC 1HA5A 3LWEA 5ELNA 2R7ZG 1NE3A 5ELDA 3SEBA 1IW7C 1X65A 3ITPA 4DV0L 2D0PA 4DV4Q 1FGBD 2B2TA 1X3QA 1MIUA 2A68D 1OXVA 1I4HA 2EIFA 1L0YB 4B3TL 1AW7A 4Q5VA 4BBSB 1XNQL 1GOZA 1I4GA 4KHZA 4Y52H 2JA8G 3HFZB 1EEID 3NENA 4N9TA 1A15A 4BY7H 1NAPA 3C46A 3NSWA 3RLOA 1F9QA 3X3MA 2RKSA 3TS0A 1IBML 4GKJQ 4IURA 3GO5A 2I5HA 4G57A 1H9KA 3CCEA 1F9RA 1A6XA 1HUMA 1C8CA 4AIMA 1C7YA 2CH4W 2IX3A 4A75A 2LKVA 4TVAB 1A2TA 1ICFB 3PF4A 4OIJA 2KEDA 1K3RA 4KHPQ 4CKBA 2HT1A 2K6AA 3CAMA 2CFMA 3R2IA 3PUZA 1O78A 2Q2IA 4E6IA 3SGIA 4OEMB 4HIOA 3X3NA 2WB1B 5EBCA 1PH5A 4FXKC 3I4MB
chains in the Genus database with same CATH topology
1JJCB 2QA4A 1Y14B 2ZTDA 3HOWH 5ELOA 3M3YH 5K36G 1JT8A 3TS2A 1XPOA 1XPRA 4OWTB 3HKZG 2JEAI 1E3PA 2KCMA 1EYGA 1G291 5M3MH 4JCVE 4BBSH 2XTIA 5GROA 1Y1VG 2JA6G 1JB7A 3E9HA 1IBMQ 3GTJH 3HKZE 3RN2A 3I4MG 4A3IH 1XMOQ 3MXNB 1X55A 4LFCQ 1E7ZA 4IPCA 4HJ7A 4R4QA 4EX5A 2V1CC 4A3KG 2UUBL 2R7ZH 3GTQH 4LUZA 1K8AC 4IFDJ 4X65L 2MFIA 4DR4Q 4B3SL 2GVBA 2Y0SE 1Y1VH 3FP9A 1ASZA 1IZ6A 3J7A5 2ZM6Q 1Y1WG 1HNXQ 3M85A 1B70B 3K80C 3ULLA 4AH6A 2OTJA 1MJEA 2N78A 1TXYA 1VQEA 2VL6A 4DAYB 3HOWG 3AFPA 5C0XJ 4JI7L 2HHHL 3F8TA 3TREA 3U4ZA 4BBRG 4BBRH 4A3JG 2HHHQ 4JI0L 1N33L 1AH9A 3A5ZB 3K7UC 5E7NA 1CSPA 4LFBL 2WAQE 3CD6A 1VQ8A 4FDBA 4JI8L 2I0QA 1SN8A 2HIVA 4YCUA 1M90C 4A3MH 4GNXA 1LYLA 2RCNA 3PGZA 3CCUA 4LF8L 2N8NA 3A5UA 4BA1I 5IYCH 3PO2G 3NBHB 1CKMA 5C4XH 1VQAA 2OQKA 3FHWA 4NB3A 1SROA 3DLLA 4GLXA 1DGSA 4DV4L 3TQYA 4OWWB 4UP8A 1KD1C 2KCTA 4LFCL 1HZBA 3T1HL 3HOVH 2K5HA 3CQZH 1VQ7A 3RR5A 1QUQB 1FGUA 3G71A 5M3FG 3K81C 1QZGA 1KRTA 1X54A 1Q81C 4P71A 4JYAL 1CKOA 1TWHH 1WCMH 4JI2Q 1XNQQ 2YTYA 3E9IA 1Q86C 3UDFA 3ZJYC 4HIDA 3KF6A 4DR7Q 3BZKA 4QQBX 4IFDG 1PFSA 3RZDH 5C0XI 3CCRA 3ULPA 2WAQG 1Q1BA 3I4NG 2CKZB 1B7YB 4PMWA 2B3GA 1N8RC 4JI4Q 3KLWA 2E8GA 2VUMG 1Z9FA 1IBLQ 1M1KC 3K7AH 4PG3A 5EAYA 3BJUA 5GAEC 1UEBA 4P75A 4HIKA 1JMCA 2D62A 2IX1A 3S1QH 4A93G 4JI1L 3HOUG 1PH1A 2GN5A 2K4KA 1KXLA 3J81c 1L2FA 4DV3Q 1YI2A 3J80c 4DR1Q 3A74A 3FKIG 4XIGS 4DV6L 1I50H 1XJVA 3GTMH 4DR6L 4GLAC 4LF7Q 1TWGH 3ERSX 2Z6KA 1N36Q 2E2IH 3NEMA 5M5WH 2NZOA 1PYSB 2ZM6L 4A3MG 1W3SA 4JI0Q 3BZCA 4JI3L 3CXCA 4DR5Q 3HOUH 1SE8A 1HNZL 2UUAQ 2IY5B 3LGJA 2R7DA 1A0IA 4X62L 2NVTH 3U4VA 2K5NA 4KHPQ 4PZ6A 1ASYA 5C3EH 4A3JH 4A3DG 4DUZQ 2HQLA 4AQYL 1CKNA 2JA8H 3S24A 2VY3A 3I4NH 5JEAG 1SMXA 1V9PA 1RIPA 3S15H 3CMAA 4WJ3M 4JOIC 4JI8Q 3I56A 2ZJQA 3STBD 3W5OA 3UE1A 4DV2L 4GLVB 4X66L 4BY1G 1VQFA 3KOJA 3KJOA 3GTKH 2AKWB 4O2DA 4LF4Q 2ZTEA 2CWPA 3M9BA 5IT9c 1K0RA 5IYDH 1T9HA 2YTXA 4DK6C 3S1MH 3J81j 4DAMA 1NMFA 5IP9G 1X3GA 1J6QA 1V1QA 3NELA 3HOZH 1VQCA 2A1AA 3PIPA 1LM0A 5JEAJ 2K5VA 4DV6Q 3KF6B 4IOAA 3PUWA 3PUVA 3T1YQ 1WCMG 3GD7A 3F2DA 4X65Q 1OTCA 2WB1E 4DV7L 1G6PA 5GAHC 2BA0A 3I4OA 2NVXH 4JI7Q 2JA5H 4JV5Q 2K14A 2R6GA 5IWAL 3G6EA 5IWAQ 1HNZQ 3J7ZC 2IHEA 3L2PA 1KAWA 1OXXK 4GN4B 1MJCA 4X64Q 4B3RL 4B3RQ 2ALYB 1NTGA 5C44H 2PI2E 2PQAA 4LUOA 4DR6Q 5IE8A 5FLMG 1YJ9A 3HOYH 1KIXA 3PO3G 1N32Q 4JBWA 3H15A 1K8GA 2Q2TA 3AYHB 1VQNA 1QVFA 1XTDA 3RNUA 1VQOA 4NXML 4LF8Q 1WOCA 4DR5L 2KBNA 4QY7A 1HH2P 2LXJA 2NZHA 4A3EH 2VZAA 1A62A 1UE1A 3U58A 2LSSA 1K9MC 4NPSA 1K83H 2OQ0A 1EFWA 2YV5A 4UY8C 1XNRL 4HJ8A 3PIOA 1QVCA 5C4JH 3J81i 4DR7L 3GDEA 1Q1EA 4GN3B 4QIWE 4X62Q 1UWVA 5DLQE 4QGUA 2KHIA 3H3VH 1BBWA 1VQDA 1H95A 4DV5L 4LF4L 4OWXB 5IY0A 1A63A 1N34Q 4GKKQ 2MNAA 1N34L 4OXPA 5M3FH 4L5RC 1RL2A 1OXSC 2NVQH 4GN5A 4B3TQ 3I4MH 2CQOA 1EUJA 2N49A 3RLNA 2UUCL 2UU9Q 2UXDQ 2UUCQ 2MQHA 5C4XG 1SR3A 3CCLA 5JJLA 2NVYH 4POGA 3PO2H 3PO3H 2R93G 4AYBE 3L0OA 1Q46A 4YHHQ 4LF6Q 1IXRA 2I5LX 1VQPA 4MTNA 4DR4L 1S40A 5GADC 4OX9L 3S1NH 1HNXL 1PH8A 1I3QH 3S14H 2VQEQ 3GTLH 4AYBG 4IO9A 1VCIA 3I55A 2E2HH 3STBC 5C44G 4LNQA 1G51A 1HZ9A 1S3OA 4XTCS 4NXNL 3I2ZA 3M4QA 1X3EA 2C35B 1YHQA 1YITA 1EQRA 2FXQA 2VNUD 4IPHA 4DUYL 4LWCA 4ME3A 4K0KQ 3WWVA 3GTGH 2A8VA 3U50C 3I7FA 1BKBA 4OO1G 4DV1L 3KFUA 1PH5A 4DV1Q 2AHOB 2ATWA 1YEZA 4UPAA 4X64L 2CWAA 1AE2A 4JOIA 4DUZL 4LF9L 2A19A 4KI0A 2IX0A 3D31A 1AE3A 2ZJPA 1GKHA 4YWLA 2B29A 3GTOH 3A0JA 5IYDG 1VQMA 1N32L 3W1BA 2JA6H 2UU9L 4EQ5A 4KLKA 4BBSG 3KYHC 4JG2A 1KHIA 2XGTA 3Q8DA 3CW2C 2RHSB 2F4VL 2VUMH 3H0GH 4A3FH 1PH6A 3OW2A 4IOCA 3T1YL 1IBKQ 2PI2A 1V43A 4YY3L 3S2DH 3AFQA 2MO1A 3UDIA 2ASBA 3F2BA 3OTOQ 2ZTCA 2JEBI 3JC66 4GOPA 1KL9A 2VQEL 4P73A 1JE5A 1LTLA 2E5LL 4LUVA 1UE6A 1WJJA 3KDFB 3H0GG 4UP7A 4A3FG 1I94L 1SLJA 1L0WA 1E24A 1YIJA 3ER0A 2VQFL 2K52A 2VQFQ 1Y1WH 3MEFA 5AJ3Q 4GNXC 1N33Q 4K0KL 4YHHL 2B63H 2K50A 2H5XA 1OXUA 3CCJA 1JJ2A 4B3SQ 4A3KH 3EIVA 3G48A 1YJWA 5FLXc 1PH2A 3D0FA 1YBYA 1L1OC 2JA7G 4A76A 4P74A 5JJKA 3KJPA 2N3SA 3PF5A 2CCZA 4BA2I 4A3LH 2JA9A 2PMZE 3PUYA 4MZ9A 1XMQQ 4GNXB 3HKSA 1XMQL 1SFOH 3ICEA 4YCWA 2BH8A 1VS0A 3K8AA 1CUKA 1VQHA 1X56A 4A3BG 4JBMA 3F2CA 4JYAQ 4BY7G 4C3JH 4PZ8A 5LMNQ 1GVPA 4Y7NH 2UUAL 2MO0A 4L5TA 3RZOH 1VQBA 4HJ9A 1X3FA 2Z0SA 4HJ5A 3PSIA 1QUQA 1EOVA 1TWCH 4LF9Q 4A3GH 3CP0A 2OWOA 3JAMi 3EN2A 4O0AA 2QGQA 4MNOA 5M5YH 2QEXA 1XNRQ 4GKKL 1HR0W 1YHBA 1EWIA 2I5MX 2PNHA 1VQ4A 1VQIA 4JI6Q 1U0LA 5GAGC 3G4SA 1K73C 1S72A 4C2MH 4QJFA 1VQGA 3RLFA 3KDFA 3EBEA 3K0XA 2F4VQ 4HIMA 4LW1A 3HOXG 1PHJA 3S2HH 2Z6KC 4DR3Q 4GOPB 3E0EA 5C3EG 4YY3Q 3PV0A 2LXKA 3HOXH 3CCSA 2NN6I 4DR3L 1YVCA 1SRUA 1JJGA 1EIYB 4IJLA 1WFQA 4JI2L 2DUDA 4LF5Q 1NY4A 1KC8C 5FJ8H 4R1JA 3M7NA 1P16A 4IPGA 3UDXA 4L5SA 4A93H 4X6AH 1QVGA 2E5LQ 2AWOA 5IP7H 1HNWL 1E22A 4YWMA 4DV7Q 3CCMA 4RMFA 1J5EL 3L7ZC 4GS3A 3GTPH 2VS1A 1GO3E 1C9OA 1MKHA 3FKIH 5LMNL 4A4IA 1QZHA 1CSQA 3TRZA 2HIXA 1L1OA 2Q2HA 4JI5L 5H1SE 3UDGA 4A3EG 4NXNQ 3AQQA 2NN6G 5C0XG 2YTVA 1HNWQ 4J15A 1FJGL 4AQYQ 1PH4A 4DUYQ 3KF8B 4R4TA 2IT1A 3OYYA 2BA1A 3CPFA 4P72A 4BY1H 2JJQA 2WB1G 4A3CH 1A8VA 1WYDA 2R93H 1HR0Q 2HT1A 4DV2Q 2JA7H 1HR0L 4YWKA 2RF4A 4X66Q 3IRBA 2R92G 3AEVA 2JE6I 1C0AA 1B8AA 4APVA 1VQ5A 4DPGA 4C3HH 1W2BA 1EQQA 1U5KA 1PA6A 1X6OA 2IHFA 2UXCQ 4TQUS 1IL2A 4DKAC 5HGQA 3HOVG 5IP7G 2ZJRA 4JBJA 5HY6A 1D8LA 2L15A 3S1RH 5JJIA 4DNIA 1KQSA 1PV4A 2UXBQ 1NMGA 4B3MQ 3CMEA 1FL0A 2WP8J 3PUXA 3TEHB 1IBKL 5LMUQ 2F3IA 5BR8L 3CPWA 3CC7A 1Q82C 1NBWA 2R92H 1PH9A 1VQ6A 3CCVA 4DV5Q 1GD7A 5IP9H 4QL5A 5AJ3L 4JI4L 3HOZG 1YNXA 4BXXG 3W1GA 1IBLL 3H3VI 1Z47A 1X9NA 1L1OB 4GKJL 4LFAL 1I94Q 5FLMH 1XMOL 4LF5L 1YHAA 3HOYG 3S17H 1BVSA 4KHPL 4ALPA 3DM3A 1FVIA 4DR2L 2UUBQ 4DR2Q 2YU9H 1BBUA 4A3GG 1KRSA 2AWNA 1UE7A 5M5XH 4POFA 1J5EQ 3VDYA 2Y0SG 4BXXH 5IYBG 4OX9Q 1LUZA 2EQSA 2K75A 1WI5A 4JV5L 3CF5A 4NXMQ 3S16H 1VQ9A 2KHJA 5GQOA 4H02A 2JA5G 3B6YA 1PH3A 3J80i 2ID0A 1HZCA 1GM5A 5ELNA 1TWAH 1TWFH 4R4CA 4YCVA 4UP9A 1NE3A 4JBKA 1HJPA 1XPUA 2R7ZG 2UXBL 2PQAB 4LFBQ 1X65A 5LMNW 4R4OA 4DV0Q 5FJ8G 2KENA 2D0PA 4DV0L 4JI6L 4DV4Q 5BR8Q 1Q7YC 1MIUA 3T1HQ 4HJAA 1D7QA 1E1TA 1E1OA 1OXVA 2YYZA 5IYCG 3CC4A 2DGYA 4PZ7A 4RG1A 4C3IH 1PH7A 4A3CG 2EIFA 5M3MG 2UXCL 4B3TL 4IPDA 4LFAQ 3RN5A 2AMCB 1XNQL 1N9WA 1YJNA 2UXDL 2R7FA 4KHZA 1P8LA 2JA8G 3M4OH 4Y52H 4OO1I 4GOPC 3HFZB 2E2JH 1HZAA 3NENA 2OTLA 5LMUL 1O7IA 4BY7H 3JAMc 4A3BH 4DK3C 1OXTA 3OTOL 1VQKA 3RLOA 4A3DH 1I5FA 4B3ML 2RHQB 1VQLA 3TS0A 1IBML 4GKJQ 1IYJB 2JQOA 4A3LG 2WFWA 4JI5Q 3GO5A 2I5HA 4JI1Q 3CCEA 1Q12A 1Q8KA 5IYBH 4AIMA 2F52A 1C7YA 2JK8A 4A75A 4WJ4A 1VQJA 2BH2A 4OONA 4LF6L 4TVAB 2B63G 3PF4A 3BU2A 4JC0A 4A3IG 3CCQA 3CC2A 4IFDI 1PVOA 2GVAA 1NJIC 1CKNB 1K3RA 4IJHA 4L5QA 1EIFA 4DV3L 2OCEA 3M4PA 2ES2A 3CAMA 2VW9A 2CFMA 4DR1L 3PUZA 2Q2UA 4JI3Q 1FJGQ 3F1ZA 1R9TH 1I6HH 2Q2IA 3PCOB 4LF7L 1N36L 1UE5A 1YZ6A 3SGIA 4HIOA 1PYBA 2D0OA 4R4IA 3UE0A 3ULJA 2EXDA 5J3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJC B;  2QA4 A;  1Y14 B;  2ZTD A;  3HOW H;  5ELO A;  3M3Y H;  5K36 G;  1JT8 A;  3TS2 A;  1XPO A;  1XPR A;  4OWT B;  3HKZ G;  2JEA I;  1E3P A;  2KCM A;  1EYG A;  1G29 1;  5M3M H;  4JCV E;  4BBS H;  2XTI A;  5GRO A;  1Y1V G;  2JA6 G;  1JB7 A;  3E9H A;  1IBM Q;  3GTJ H;  3HKZ E;  3RN2 A;  3I4M G;  4A3I H;  1XMO Q;  3MXN B;  1X55 A;  4LFC Q;  1E7Z A;  4IPC A;  4HJ7 A;  4R4Q A;  4EX5 A;  2V1C C;  4A3K G;  2UUB L;  2R7Z H;  3GTQ H;  4LUZ A;  1K8A C;  4IFD J;  4X65 L;  2MFI A;  4DR4 Q;  4B3S L;  2GVB A;  2Y0S E;  1Y1V H;  3FP9 A;  1ASZ A;  1IZ6 A;  3J7A 5;  2ZM6 Q;  1Y1W G;  1HNX Q;  3M85 A;  1B70 B;  3K80 C;  3ULL A;  4AH6 A;  2OTJ A;  1MJE A;  2N78 A;  1TXY A;  1VQE A;  2VL6 A;  4DAY B;  3HOW G;  3AFP A;  5C0X J;  4JI7 L;  2HHH L;  3F8T A;  3TRE A;  3U4Z A;  4BBR G;  4BBR H;  4A3J G;  2HHH Q;  4JI0 L;  1N33 L;  1AH9 A;  3A5Z B;  3K7U C;  5E7N A;  1CSP A;  4LFB L;  2WAQ E;  3CD6 A;  1VQ8 A;  4FDB A;  4JI8 L;  2I0Q A;  1SN8 A;  2HIV A;  4YCU A;  1M90 C;  4A3M H;  4GNX A;  1LYL A;  2RCN A;  3PGZ A;  3CCU A;  4LF8 L;  2N8N A;  3A5U A;  4BA1 I;  5IYC H;  3PO2 G;  3NBH B;  1CKM A;  5C4X H;  1VQA A;  2OQK A;  3FHW A;  4NB3 A;  1SRO A;  3DLL A;  4GLX A;  1DGS A;  4DV4 L;  3TQY A;  4OWW B;  4UP8 A;  1KD1 C;  2KCT A;  4LFC L;  1HZB A;  3T1H L;  3HOV H;  2K5H A;  3CQZ H;  1VQ7 A;  3RR5 A;  1QUQ B;  1FGU A;  3G71 A;  5M3F G;  3K81 C;  1QZG A;  1KRT A;  1X54 A;  1Q81 C;  4P71 A;  4JYA L;  1CKO A;  1TWH H;  1WCM H;  4JI2 Q;  1XNQ Q;  2YTY A;  3E9I A;  1Q86 C;  3UDF A;  3ZJY C;  4HID A;  3KF6 A;  4DR7 Q;  3BZK A;  4QQB X;  4IFD G;  1PFS A;  3RZD H;  5C0X I;  3CCR A;  3ULP A;  2WAQ G;  1Q1B A;  3I4N G;  2CKZ B;  1B7Y B;  4PMW A;  2B3G A;  1N8R C;  4JI4 Q;  3KLW A;  2E8G A;  2VUM G;  1Z9F A;  1IBL Q;  1M1K C;  3K7A H;  4PG3 A;  5EAY A;  3BJU A;  5GAE C;  1UEB A;  4P75 A;  4HIK A;  1JMC A;  2D62 A;  2IX1 A;  3S1Q H;  4A93 G;  4JI1 L;  3HOU G;  1PH1 A;  2GN5 A;  2K4K A;  1KXL A;  3J81 c;  1L2F A;  4DV3 Q;  1YI2 A;  3J80 c;  4DR1 Q;  3A74 A;  3FKI G;  4XIG S;  4DV6 L;  1I50 H;  1XJV A;  3GTM H;  4DR6 L;  4GLA C;  4LF7 Q;  1TWG H;  3ERS X;  2Z6K A;  1N36 Q;  2E2I H;  3NEM A;  5M5W H;  2NZO A;  1PYS B;  2ZM6 L;  4A3M G;  1W3S A;  4JI0 Q;  3BZC A;  4JI3 L;  3CXC A;  4DR5 Q;  3HOU H;  1SE8 A;  1HNZ L;  2UUA Q;  2IY5 B;  3LGJ A;  2R7D A;  1A0I A;  4X62 L;  2NVT H;  3U4V A;  2K5N A;  4KHP Q;  4PZ6 A;  1ASY A;  5C3E H;  4A3J H;  4A3D G;  4DUZ Q;  2HQL A;  4AQY L;  1CKN A;  2JA8 H;  3S24 A;  2VY3 A;  3I4N H;  5JEA G;  1SMX A;  1V9P A;  1RIP A;  3S15 H;  3CMA A;  4WJ3 M;  4JOI C;  4JI8 Q;  3I56 A;  2ZJQ A;  3STB D;  3W5O A;  3UE1 A;  4DV2 L;  4GLV B;  4X66 L;  4BY1 G;  1VQF A;  3KOJ A;  3KJO A;  3GTK H;  2AKW B;  4O2D A;  4LF4 Q;  2ZTE A;  2CWP A;  3M9B A;  5IT9 c;  1K0R A;  5IYD H;  1T9H A;  2YTX A;  4DK6 C;  3S1M H;  3J81 j;  4DAM A;  1NMF A;  5IP9 G;  1X3G A;  1J6Q A;  1V1Q A;  3NEL A;  3HOZ H;  1VQC A;  2A1A A;  3PIP A;  1LM0 A;  5JEA J;  2K5V A;  4DV6 Q;  3KF6 B;  4IOA A;  3PUW A;  3PUV A;  3T1Y Q;  1WCM G;  3GD7 A;  3F2D A;  4X65 Q;  1OTC A;  2WB1 E;  4DV7 L;  1G6P A;  5GAH C;  2BA0 A;  3I4O A;  2NVX H;  4JI7 Q;  2JA5 H;  4JV5 Q;  2K14 A;  2R6G A;  5IWA L;  3G6E A;  5IWA Q;  1HNZ Q;  3J7Z C;  2IHE A;  3L2P A;  1KAW A;  1OXX K;  4GN4 B;  1MJC A;  4X64 Q;  4B3R L;  4B3R Q;  2ALY B;  1NTG A;  5C44 H;  2PI2 E;  2PQA A;  4LUO A;  4DR6 Q;  5IE8 A;  5FLM G;  1YJ9 A;  3HOY H;  1KIX A;  3PO3 G;  1N32 Q;  4JBW A;  3H15 A;  1K8G A;  2Q2T A;  3AYH B;  1VQN A;  1QVF A;  1XTD A;  3RNU A;  1VQO A;  4NXM L;  4LF8 Q;  1WOC A;  4DR5 L;  2KBN A;  4QY7 A;  1HH2 P;  2LXJ A;  2NZH A;  4A3E H;  2VZA A;  1A62 A;  1UE1 A;  3U58 A;  2LSS A;  1K9M C;  4NPS A;  1K83 H;  2OQ0 A;  1EFW A;  2YV5 A;  4UY8 C;  1XNR L;  4HJ8 A;  3PIO A;  1QVC A;  5C4J H;  3J81 i;  4DR7 L;  3GDE A;  1Q1E A;  4GN3 B;  4QIW E;  4X62 Q;  1UWV A;  5DLQ E;  4QGU A;  2KHI A;  3H3V H;  1BBW A;  1VQD A;  1H95 A;  4DV5 L;  4LF4 L;  4OWX B;  5IY0 A;  1A63 A;  1N34 Q;  4GKK Q;  2MNA A;  1N34 L;  4OXP A;  5M3F H;  4L5R C;  1RL2 A;  1OXS C;  2NVQ H;  4GN5 A;  4B3T Q;  3I4M H;  2CQO A;  1EUJ A;  2N49 A;  3RLN A;  2UUC L;  2UU9 Q;  2UXD Q;  2UUC Q;  2MQH A;  5C4X G;  1SR3 A;  3CCL A;  5JJL A;  2NVY H;  4POG A;  3PO2 H;  3PO3 H;  2R93 G;  4AYB E;  3L0O A;  1Q46 A;  4YHH Q;  4LF6 Q;  1IXR A;  2I5L X;  1VQP A;  4MTN A;  4DR4 L;  1S40 A;  5GAD C;  4OX9 L;  3S1N H;  1HNX L;  1PH8 A;  1I3Q H;  3S14 H;  2VQE Q;  3GTL H;  4AYB G;  4IO9 A;  1VCI A;  3I55 A;  2E2H H;  3STB C;  5C44 G;  4LNQ A;  1G51 A;  1HZ9 A;  1S3O A;  4XTC S;  4NXN L;  3I2Z A;  3M4Q A;  1X3E A;  2C35 B;  1YHQ A;  1YIT A;  1EQR A;  2FXQ A;  2VNU D;  4IPH A;  4DUY L;  4LWC A;  4ME3 A;  4K0K Q;  3WWV A;  3GTG H;  2A8V A;  3U50 C;  3I7F A;  1BKB A;  4OO1 G;  4DV1 L;  3KFU A;  1PH5 A;  4DV1 Q;  2AHO B;  2ATW A;  1YEZ A;  4UPA A;  4X64 L;  2CWA A;  1AE2 A;  4JOI A;  4DUZ L;  4LF9 L;  2A19 A;  4KI0 A;  2IX0 A;  3D31 A;  1AE3 A;  2ZJP A;  1GKH A;  4YWL A;  2B29 A;  3GTO H;  3A0J A;  5IYD G;  1VQM A;  1N32 L;  3W1B A;  2JA6 H;  2UU9 L;  4EQ5 A;  4KLK A;  4BBS G;  3KYH C;  4JG2 A;  1KHI A;  2XGT A;  3Q8D A;  3CW2 C;  2RHS B;  2F4V L;  2VUM H;  3H0G H;  4A3F H;  1PH6 A;  3OW2 A;  4IOC A;  3T1Y L;  1IBK Q;  2PI2 A;  1V43 A;  4YY3 L;  3S2D H;  3AFQ A;  2MO1 A;  3UDI A;  2ASB A;  3F2B A;  3OTO Q;  2ZTC A;  2JEB I;  3JC6 6;  4GOP A;  1KL9 A;  2VQE L;  4P73 A;  1JE5 A;  1LTL A;  2E5L L;  4LUV A;  1UE6 A;  1WJJ A;  3KDF B;  3H0G G;  4UP7 A;  4A3F G;  1I94 L;  1SLJ A;  1L0W A;  1E24 A;  1YIJ A;  3ER0 A;  2VQF L;  2K52 A;  2VQF Q;  1Y1W H;  3MEF A;  5AJ3 Q;  4GNX C;  1N33 Q;  4K0K L;  4YHH L;  2B63 H;  2K50 A;  2H5X A;  1OXU A;  3CCJ A;  1JJ2 A;  4B3S Q;  4A3K H;  3EIV A;  3G48 A;  1YJW A;  5FLX c;  1PH2 A;  3D0F A;  1YBY A;  1L1O C;  2JA7 G;  4A76 A;  4P74 A;  5JJK A;  3KJP A;  2N3S A;  3PF5 A;  2CCZ A;  4BA2 I;  4A3L H;  2JA9 A;  2PMZ E;  3PUY A;  4MZ9 A;  1XMQ Q;  4GNX B;  3HKS A;  1XMQ L;  1SFO H;  3ICE A;  4YCW A;  2BH8 A;  1VS0 A;  3K8A A;  1CUK A;  1VQH A;  1X56 A;  4A3B G;  4JBM A;  3F2C A;  4JYA Q;  4BY7 G;  4C3J H;  4PZ8 A;  5LMN Q;  1GVP A;  4Y7N H;  2UUA L;  2MO0 A;  4L5T A;  3RZO H;  1VQB A;  4HJ9 A;  1X3F A;  2Z0S A;  4HJ5 A;  3PSI A;  1QUQ A;  1EOV A;  1TWC H;  4LF9 Q;  4A3G H;  3CP0 A;  2OWO A;  3JAM i;  3EN2 A;  4O0A A;  2QGQ A;  4MNO A;  5M5Y H;  2QEX A;  1XNR Q;  4GKK L;  1HR0 W;  1YHB A;  1EWI A;  2I5M X;  2PNH A;  1VQ4 A;  1VQI A;  4JI6 Q;  1U0L A;  5GAG C;  3G4S A;  1K73 C;  1S72 A;  4C2M H;  4QJF A;  1VQG A;  3RLF A;  3KDF A;  3EBE A;  3K0X A;  2F4V Q;  4HIM A;  4LW1 A;  3HOX G;  1PHJ A;  3S2H H;  2Z6K C;  4DR3 Q;  4GOP B;  3E0E A;  5C3E G;  4YY3 Q;  3PV0 A;  2LXK A;  3HOX H;  3CCS A;  2NN6 I;  4DR3 L;  1YVC A;  1SRU A;  1JJG A;  1EIY B;  4IJL A;  1WFQ A;  4JI2 L;  2DUD A;  4LF5 Q;  1NY4 A;  1KC8 C;  5FJ8 H;  4R1J A;  3M7N A;  1P16 A;  4IPG A;  3UDX A;  4L5S A;  4A93 H;  4X6A H;  1QVG A;  2E5L Q;  2AWO A;  5IP7 H;  1HNW L;  1E22 A;  4YWM A;  4DV7 Q;  3CCM A;  4RMF A;  1J5E L;  3L7Z C;  4GS3 A;  3GTP H;  2VS1 A;  1GO3 E;  1C9O A;  1MKH A;  3FKI H;  5LMN L;  4A4I A;  1QZH A;  1CSQ A;  3TRZ A;  2HIX A;  1L1O A;  2Q2H A;  4JI5 L;  5H1S E;  3UDG A;  4A3E G;  4NXN Q;  3AQQ A;  2NN6 G;  5C0X G;  2YTV A;  1HNW Q;  4J15 A;  1FJG L;  4AQY Q;  1PH4 A;  4DUY Q;  3KF8 B;  4R4T A;  2IT1 A;  3OYY A;  2BA1 A;  3CPF A;  4P72 A;  4BY1 H;  2JJQ A;  2WB1 G;  4A3C H;  1A8V A;  1WYD A;  2R93 H;  1HR0 Q;  2HT1 A;  4DV2 Q;  2JA7 H;  1HR0 L;  4YWK A;  2RF4 A;  4X66 Q;  3IRB A;  2R92 G;  3AEV A;  2JE6 I;  1C0A A;  1B8A A;  4APV A;  1VQ5 A;  4DPG A;  4C3H H;  1W2B A;  1EQQ A;  1U5K A;  1PA6 A;  1X6O A;  2IHF A;  2UXC Q;  4TQU S;  1IL2 A;  4DKA C;  5HGQ A;  3HOV G;  5IP7 G;  2ZJR A;  4JBJ A;  5HY6 A;  1D8L A;  2L15 A;  3S1R H;  5JJI A;  4DNI A;  1KQS A;  1PV4 A;  2UXB Q;  1NMG A;  4B3M Q;  3CME A;  1FL0 A;  2WP8 J;  3PUX A;  3TEH B;  1IBK L;  5LMU Q;  2F3I A;  5BR8 L;  3CPW A;  3CC7 A;  1Q82 C;  1NBW A;  2R92 H;  1PH9 A;  1VQ6 A;  3CCV A;  4DV5 Q;  1GD7 A;  5IP9 H;  4QL5 A;  5AJ3 L;  4JI4 L;  3HOZ G;  1YNX A;  4BXX G;  3W1G A;  1IBL L;  3H3V I;  1Z47 A;  1X9N A;  1L1O B;  4GKJ L;  4LFA L;  1I94 Q;  5FLM H;  1XMO L;  4LF5 L;  1YHA A;  3HOY G;  3S17 H;  1BVS A;  4KHP L;  4ALP A;  3DM3 A;  1FVI A;  4DR2 L;  2UUB Q;  4DR2 Q;  2YU9 H;  1BBU A;  4A3G G;  1KRS A;  2AWN A;  1UE7 A;  5M5X H;  4POF A;  1J5E Q;  3VDY A;  2Y0S G;  4BXX H;  5IYB G;  4OX9 Q;  1LUZ A;  2EQS A;  2K75 A;  1WI5 A;  4JV5 L;  3CF5 A;  4NXM Q;  3S16 H;  1VQ9 A;  2KHJ A;  5GQO A;  4H02 A;  2JA5 G;  3B6Y A;  1PH3 A;  3J80 i;  2ID0 A;  1HZC A;  1GM5 A;  5ELN A;  1TWA H;  1TWF H;  4R4C A;  4YCV A;  4UP9 A;  1NE3 A;  4JBK A;  1HJP A;  1XPU A;  2R7Z G;  2UXB L;  2PQA B;  4LFB Q;  1X65 A;  5LMN W;  4R4O A;  4DV0 Q;  5FJ8 G;  2KEN A;  2D0P A;  4DV0 L;  4JI6 L;  4DV4 Q;  5BR8 Q;  1Q7Y C;  1MIU A;  3T1H Q;  4HJA A;  1D7Q A;  1E1T A;  1E1O A;  1OXV A;  2YYZ A;  5IYC G;  3CC4 A;  2DGY A;  4PZ7 A;  4RG1 A;  4C3I H;  1PH7 A;  4A3C G;  2EIF A;  5M3M G;  2UXC L;  4B3T L;  4IPD A;  4LFA Q;  3RN5 A;  2AMC B;  1XNQ L;  1N9W A;  1YJN A;  2UXD L;  2R7F A;  4KHZ A;  1P8L A;  2JA8 G;  3M4O H;  4Y52 H;  4OO1 I;  4GOP C;  3HFZ B;  2E2J H;  1HZA A;  3NEN A;  2OTL A;  5LMU L;  1O7I A;  4BY7 H;  3JAM c;  4A3B H;  4DK3 C;  1OXT A;  3OTO L;  1VQK A;  3RLO A;  4A3D H;  1I5F A;  4B3M L;  2RHQ B;  1VQL A;  3TS0 A;  1IBM L;  4GKJ Q;  1IYJ B;  2JQO A;  4A3L G;  2WFW A;  4JI5 Q;  3GO5 A;  2I5H A;  4JI1 Q;  3CCE A;  1Q12 A;  1Q8K A;  5IYB H;  4AIM A;  2F52 A;  1C7Y A;  2JK8 A;  4A75 A;  4WJ4 A;  1VQJ A;  2BH2 A;  4OON A;  4LF6 L;  4TVA B;  2B63 G;  3PF4 A;  3BU2 A;  4JC0 A;  4A3I G;  3CCQ A;  3CC2 A;  4IFD I;  1PVO A;  2GVA A;  1NJI C;  1CKN B;  1K3R A;  4IJH A;  4L5Q A;  1EIF A;  4DV3 L;  2OCE A;  3M4P A;  2ES2 A;  3CAM A;  2VW9 A;  2CFM A;  4DR1 L;  3PUZ A;  2Q2U A;  4JI3 Q;  1FJG Q;  3F1Z A;  1R9T H;  1I6H H;  2Q2I A;  3PCO B;  4LF7 L;  1N36 L;  1UE5 A;  1YZ6 A;  3SGI A;  4HIO A;  1PYB A;  2D0O A;  4R4I A;  3UE0 A;  3ULJ A;  2EXD A;  5J3B A; 
#chains in the Genus database with same CATH topology
 1JJC B;  4IUU A;  3M3Y H;  2A6H C;  1XPO A;  1XPR A;  2N55 A;  4OWT B;  5NUC A;  1G29 1;  4JCV E;  3VYS A;  4BBS H;  1U4R A;  1JB7 A;  1HCZ A;  2RVL A;  3GV6 A;  2B8G A;  5DNF A;  5C4J B;  4A3I H;  2PZU A;  3KBG A;  4HJ7 A;  2E76 C;  4EX5 A;  3I72 A;  4A3K G;  3D8G A;  2J7Z A;  2ZXR A;  4B3S L;  3FP9 A;  3J7A 5;  2ZM6 Q;  1EZ8 A;  3DEO A;  4G7O C;  2IL8 A;  4H44 C;  3DUZ A;  2N78 A;  1ESF A;  4ID6 A;  2F0T A;  3QOL A;  1SNM A;  3E6Z X;  4MIU A;  3F8T A;  5EPJ A;  4BBR H;  2HHH Q;  4A3J G;  4V0B A;  1MD2 D;  2EY5 A;  3K7U C;  1CI3 M;  1CSP A;  4LFB L;  3CD6 A;  5JVH 3;  4ZK9 B;  3QOJ A;  4EQP A;  4V19 0;  4YCU A;  1LYL A;  4HMI A;  4LF8 L;  3AMU A;  2N8N A;  3H94 A;  4BA1 I;  1V1P A;  5IGC A;  5KNC A;  5IYC H;  3NBH B;  1STH A;  4AYB B;  3I90 A;  5C4X H;  1VQA A;  1SRO A;  4GLX A;  1DGS A;  4DV4 L;  4OWW B;  4LFC L;  1HZB A;  2MPM A;  4P71 A;  1TWH H;  2MP1 A;  3GTK B;  4JI2 Q;  1XNQ Q;  2YTY A;  3E9I A;  3UDF A;  3ZJY C;  2Z8L A;  3KF6 A;  2LMC B;  3VYU A;  4QQB X;  4IFD G;  1K0S A;  2K1B A;  4CDC C;  1EL0 A;  5C0X I;  1Q90 A;  2WAQ G;  4H0L C;  1Q1B A;  2KEE A;  2CKZ B;  2B3G A;  3KLW A;  1B9N A;  4DXF A;  2VUM G;  1Z9F A;  2TSS A;  4HSP A;  4J6H A;  1EY6 A;  1M1K C;  5GAE C;  4P75 A;  1Y8P B;  1JMC A;  1ILQ A;  2D62 A;  2IX1 A;  2O4X A;  2GN5 A;  1PH1 A;  1QB5 D;  1L2F A;  4DV3 Q;  3A74 A;  3T51 B;  1XJV A;  3GTM H;  4KKU A;  1TWG H;  4F7X A;  3K59 A;  5M5W H;  5IGG A;  4JI0 Q;  2O5I C;  3T53 B;  4DR5 Q;  1DCZ A;  2R7D A;  3U4V A;  4XYQ A;  1PFM A;  5C3E H;  5DM6 3;  4A3D G;  3NWS A;  3S24 A;  5JEA G;  3S15 H;  2K01 A;  3HG9 A;  1ML0 D;  4BY1 G;  1D5M C;  2SDF A;  1PZJ D;  5IYD H;  4HTH A;  5CV4 A;  2JXM B;  2PMZ B;  1A3V A;  2EYF A;  4DAM A;  1V1Q A;  2DN8 A;  1BUV T;  1CZG A;  3BG3 A;  2K5V A;  4DV6 Q;  4IOA A;  2F3V A;  1TY0 A;  4A3M B;  3TME A;  2NVX H;  3S9W A;  1DJR D;  2RA4 A;  1HNZ Q;  5C4Z A;  3IFT A;  3MFY A;  4XDX A;  3W2D A;  4PMB A;  1KAW A;  2I46 A;  4X64 Q;  1G2T A;  1VF7 A;  1T5X D;  2KOL A;  4DFA A;  3ND8 A;  1Y1W B;  2F0E A;  1CA6 A;  3H15 A;  2Q2T A;  5EQ0 A;  1VQO A;  4NXM L;  4LF8 Q;  2HDL A;  2KBN A;  3AB9 A;  2LXJ A;  4A3E H;  1YNN C;  1UE1 A;  1FNV A;  1K3B C;  4R8I A;  1L0X B;  3PIO A;  5A2Q E;  1IL8 A;  4XQN A;  3EVQ A;  2VUM B;  4X62 Q;  4QIW E;  1Q8I A;  5DLQ E;  4QGU A;  5M3M B;  4FXG C;  2Z4H A;  4LJZ C;  4CHT B;  1N34 Q;  4GKK Q;  3H09 A;  4QCL A;  2F0I A;  2UU9 Q;  2UUC Q;  2MQH A;  5JJL A;  2PW7 A;  2R93 G;  3L0O A;  1Q46 A;  2EY6 A;  4K2L A;  4ZQ3 A;  2HCI A;  3OW7 A;  5GAD C;  3S1N H;  1HNX L;  3S14 H;  2VQE Q;  4KMU C;  3I55 A;  1G51 A;  4RWS C;  4NXN L;  3OIP A;  1YHQ A;  2C35 B;  1AZQ A;  3P75 A;  1HQM C;  3I8Z A;  4ME3 A;  3GTG H;  2A8V A;  2K33 A;  1BKB A;  2MJ8 A;  4DV1 Q;  1H9M A;  5IOD A;  4F8M A;  1YEZ A;  2AQ3 B;  3BYY B;  2CWA A;  4LF9 L;  1B1Z A;  2IPK D;  4KI0 A;  5KEE A;  4XYO A;  1AE3 A;  2J4X A;  1CA5 A;  2R3Z A;  1BCP F;  3TZD A;  3W1B A;  2JA6 H;  5EBD A;  4KLK A;  1GUO A;  1AN8 A;  1JWM D;  3HKZ B;  3Q8D A;  2RHS B;  4A3F H;  1TU2 B;  4C3I B;  2BCO A;  3JAM L;  2NN6 H;  4YY3 L;  3AFQ A;  3F2B A;  2JEB I;  1TQO A;  1KL9 A;  2NBF A;  1JE5 A;  2F0G A;  2M2L A;  1V8Q A;  4LUV A;  1I94 L;  2SEB D;  1S5C D;  1UNS A;  3ER0 A;  2K52 A;  2VQF Q;  1SAP A;  2B63 H;  2K50 A;  5C44 B;  4Q0F A;  1LT3 D;  2KQ3 A;  5FLX c;  1PH2 A;  1MSG A;  1O80 A;  1YBY A;  1XX8 A;  5JJK A;  3ERQ A;  4BA2 I;  2PMZ E;  1SFO H;  1XMQ Q;  2Q8T A;  3S17 B;  5LHY 1;  3K8A A;  1X56 A;  4JBM A;  4UHV A;  3F2C A;  4C3J H;  4PZ8 A;  1O7L A;  2UUA L;  2MO0 A;  3FPU B;  1VQB A;  2A6H D;  4TKO B;  3RD4 A;  2R92 B;  4A3G H;  3V05 A;  4O0A A;  2QGQ A;  2QEX A;  1HR0 W;  1EWI A;  1VQ4 A;  4JI6 Q;  3I4L A;  1K73 C;  3RLF A;  4IUT A;  1RTN A;  3K0X A;  1GUW A;  4LW1 A;  5T1G A;  1PHJ A;  3S2H H;  1PLF A;  1ENF A;  4JYA Q;  2X6G A;  2XVS A;  3HOX H;  1JJG A;  1GUG A;  2K05 A;  1STN A;  1EIY B;  1K8O A;  1WFQ A;  4A3J B;  4LF5 Q;  1KC8 C;  1TKW B;  1D1I A;  4IPG A;  4X6A H;  3SE0 A;  4U67 3;  1UAP A;  5BN3 A;  1ESR A;  4GS3 A;  3GTP H;  2EJF C;  2VS1 A;  1GO3 E;  3FKI H;  5LMN L;  1WTQ A;  1WD0 A;  2HIX A;  3Q22 A;  1L1O A;  4NXN Q;  3AQQ A;  3GTP B;  2NN6 G;  2YTV A;  1LTR D;  2EE1 A;  1IKL A;  4MHE A;  4P72 A;  1CT1 D;  2WB1 G;  3SK8 A;  4MTK A;  1WYD A;  2B2U A;  3IRB A;  1C0A A;  2JE6 I;  5F2D A;  3S2H B;  3Q24 A;  3BDO A;  1WVL A;  3I91 A;  1X6O A;  1PA6 A;  5HGQ A;  2ZJR A;  2RDH A;  4DA2 A;  2NUC A;  3M4Y A;  4B08 A;  1PV4 A;  2UXB Q;  2PZT A;  3TP5 A;  2F0F A;  1PRT B;  1NNX A;  1MBY A;  1Q82 C;  1JWS D;  3CC7 A;  4A3G B;  2R92 H;  1PH9 A;  3CCV A;  4XXE A;  4CKE A;  2OEO A;  4JI4 L;  5CBA E;  4G7Z C;  3W1G A;  4C3J B;  4GKJ L;  5A2Q L;  1I94 Q;  1YHA A;  3S17 H;  1EY0 A;  1FVI A;  2UUB Q;  1SFO B;  4TSS A;  1UE7 A;  1CHQ D;  1TS2 A;  4S3S A;  1LUZ A;  5IYB G;  1F2L A;  1WI5 A;  3EFX D;  3HZX A;  3K58 A;  1RHP A;  3FEW X;  1A3U A;  2D9U A;  2B63 B;  2M9V A;  1ONL A;  5GQO A;  1GUT A;  3EA6 A;  3CU7 A;  2JA5 G;  1PH3 A;  3IKJ A;  2ID0 A;  1HZC A;  3J80 i;  1GM5 A;  1KDA A;  5HUR A;  3BZD B;  4YCV A;  1XPU A;  4UP9 A;  1HJP A;  1Z7T A;  2PQA B;  2R7Z B;  5LMN W;  2KEN A;  3QR8 A;  1EY7 A;  4J8Q A;  1FD7 D;  3N6R A;  2RDG A;  1Q7Y C;  4HJA A;  1E1T A;  3CC4 A;  1JCK B;  4C3I H;  4RG1 A;  1PH7 A;  4A3F B;  4IUV A;  2UXC L;  4NP5 A;  4HN7 A;  1YJN A;  2UXD L;  4KN7 C;  3EQL C;  3J81 E;  2XWJ B;  4K5X A;  3R93 A;  4GOP C;  4OO1 I;  3HOW B;  3MXG A;  2OTL A;  1E2Z A;  1O7I A;  4A3B H;  4DK3 C;  4ZKB B;  2K5Q A;  4B3M L;  3GTG B;  4JPB W;  4A3L G;  3V96 A;  1Q12 A;  4M8A A;  5IYB H;  3NHH A;  4WJ4 A;  1VQJ A;  4LF6 L;  3U9S A;  3S14 B;  3D4D A;  3CC2 A;  4RCO A;  1NJI C;  3S1N B;  1I4R A;  4IJH A;  1EIF A;  1TR5 A;  1YNN D;  3ERO A;  2EYO A;  3T13 A;  3PCO B;  4LF7 L;  5KGU A;  1N36 L;  1YZ6 A;  1UEA B;  4R4I A;  1AP0 A;  3ULJ A;  2EXD A;  1LTB D;  5I9P A;  2ZTD A;  5K36 G;  2F0M A;  1JT8 A;  3TS2 A;  2F0V A;  2KCM A;  5M3M H;  2XTI A;  1B9M A;  5GRO A;  1Y1V G;  2KHS A;  1SYB A;  3K0Y A;  3NPP A;  5ELE A;  1XMO Q;  2F4I A;  1AFP A;  1X55 A;  5IT9 L;  2WIN B;  2EY2 A;  1DOK A;  1LAC A;  3NXW A;  1STY A;  1K8A C;  4IFD J;  4FYD A;  2M00 A;  5JJZ A;  2MFI A;  2GVB A;  4DNR B;  3M85 A;  2G9H D;  5E4W C;  2OTJ A;  1XTC D;  2VL6 A;  3HOW G;  1MGS A;  3TBI B;  2DY8 A;  1LO5 D;  5M5X B;  1EOT A;  4JI0 L;  1N33 L;  1AH9 A;  3A5Z B;  5E7N A;  2WAQ E;  4FDB A;  3MXP A;  4JI8 L;  3A56 A;  2HIV A;  2CH4 A;  4A3M H;  2LY7 A;  3PGZ A;  2RCN A;  4ZUI A;  3KLS A;  4GNX A;  1NR4 A;  4I65 A;  3PO2 G;  1BQQ T;  2OQK A;  2ZXO A;  3FHW A;  3DLL A;  4UP8 A;  3U9O A;  2KCT A;  3HOV H;  2K5H A;  3RR5 A;  2A6E D;  1QUQ B;  5M3F G;  3OSO A;  1QZG A;  1KRT A;  1X54 A;  2A69 C;  3CKI B;  1Q86 C;  4DR7 Q;  3BZK A;  1BNZ A;  4ILW A;  3ULP A;  1EY9 A;  3I4N G;  2KEC A;  2R93 B;  2KUM A;  2E8G A;  5CGK A;  3NBI A;  1IBL Q;  1PTO C;  4EQO A;  5EAY A;  3BJU A;  1UEB A;  3MC0 B;  4MN3 A;  1IHZ A;  3HOU G;  4QUC A;  1F9S A;  4DR1 Q;  1I50 H;  1II3 A;  3GTM B;  3J80 E;  2WKD A;  2E2I H;  2Z6K A;  4N9P A;  3DXJ C;  5FLX E;  2NZO A;  2MGS A;  1PYS B;  3LWU A;  4BWG B;  2ZM6 L;  1PZI D;  2OF1 A;  3BZC A;  3HOU H;  1SE8 A;  4A93 B;  2TMP A;  1CTM A;  1LTT D;  1I4P A;  3LGJ A;  1KNA A;  2NVT H;  1JE4 A;  2HQL A;  4AQY L;  3I4N H;  1SMX A;  4K2K A;  4QUF A;  3VA7 A;  1PXU A;  1VDZ A;  3UE1 A;  4DV2 L;  2K28 A;  4HMJ A;  4X66 L;  3KOJ A;  1TWH B;  3GTK H;  4PQX A;  4O2D A;  1FNW A;  2A68 C;  3D6C A;  3K57 A;  3DMU A;  2DNC A;  2JP1 A;  3QJY A;  4R8N A;  3S1M H;  1TWC B;  3IL8 A;  5IP9 G;  1J6Q A;  2A1A A;  3PIP A;  5C4X B;  3D3R A;  4OIK A;  1RTO A;  2Z1C A;  2NB0 A;  2EYL A;  4Y7N B;  3PUV A;  2EYM A;  1RJT A;  1WCM G;  4IUP A;  5FO9 B;  1OTC A;  2EXZ A;  1G6P A;  5D3I B;  3I4O A;  4JI7 Q;  2JA5 H;  2L9H A;  1TVX A;  4JV5 Q;  2K14 A;  2R6G A;  5IWA L;  3G6E A;  3SDZ A;  2EYP A;  4C56 C;  4BBR B;  2ZXP A;  1MJC A;  2NTT A;  3KLR A;  4PNY A;  4B3R L;  3P1H A;  2CHB D;  2PI2 E;  5I2X A;  1WD1 A;  5IE8 A;  3QO2 A;  1YJ9 A;  1F77 A;  4JBW A;  3AYH B;  1VQN A;  1QVF A;  1JOR A;  1HXY D;  3RNU A;  4K8J A;  5JOB A;  3HS0 C;  1A62 A;  1E2W A;  1ENC A;  3U58 A;  4XQJ A;  1K83 H;  2OQ0 A;  5COY A;  5FO8 B;  2YV5 A;  3KBX A;  4A3I B;  2FFK B;  3S2D B;  1QVC A;  3QWN A;  5C4J H;  2G5D A;  1S5D D;  3BVG A;  4KN4 C;  1IYU A;  4GN3 B;  5CBE E;  2B39 A;  2B2T C;  4OWX B;  1DZ1 A;  1N34 L;  4OXP A;  3GTO B;  3M3Y B;  3I4M H;  1SDF A;  4HED A;  1I4X A;  4AYB E;  2QF7 A;  2QDL A;  1WTH A;  2I5L X;  4LK1 C;  1VQP A;  3CHB D;  4DR4 L;  2R61 A;  1PH8 A;  4AYB G;  4X3T A;  4LNQ A;  1HZ9 A;  1S3O A;  3I2Z A;  4FP5 D;  1MSH A;  1YIT A;  1EQR A;  2FXQ A;  5KIX A;  4DUY L;  4ZLT F;  4GZY C;  2CW0 C;  1B44 D;  3NTH A;  3I7F A;  1W6J A;  3KFU A;  3PO3 B;  3PO2 B;  1Y8N B;  3H91 A;  4X64 L;  4BY7 B;  2A19 A;  1STG A;  2C9O A;  4UAI A;  4DAV A;  3D31 A;  2ZJP A;  1GKH A;  3A0J A;  5IYD G;  1JR0 D;  3E3X A;  2QW7 A;  4JG2 A;  2F0H A;  2XGT A;  4X3U A;  3CW2 C;  3P7J A;  3BVZ A;  1PRT C;  2MUY A;  4NW2 A;  4QB4 A;  3OW2 A;  4IOC A;  3T1Y L;  5L37 A;  4DN4 M;  3DEP A;  2MO1 A;  3UDI A;  2ASB A;  4GOP A;  1LTA D;  1LTL A;  1Y69 U;  1A3T A;  3H0G G;  1L0W A;  1E24 A;  1HPC A;  1O7Z A;  5AJ3 Q;  1PTO B;  1SNC A;  3HOY B;  4K0K L;  2XSC A;  2H5X A;  3CCJ A;  3C3L A;  4A3K H;  3EIV A;  1YJW A;  3C1F A;  2JA7 G;  4A76 A;  2HD3 A;  2SOB A;  1V1P B;  2N3S A;  2CCZ A;  4A3L H;  2JA9 A;  1WTW A;  3VA5 A;  3HKS A;  5IGF A;  4RH6 A;  2BOS A;  1VS0 A;  4A3B G;  4KTA A;  2F1M A;  1EU3 A;  2MHV A;  2WKC A;  3BS1 A;  1EY8 A;  4HJ9 A;  3P20 A;  3PSI A;  1QUQ A;  1EOV A;  2FJ2 A;  3HOZ B;  3WOF A;  3MXU A;  2OWO A;  3TSS A;  3JAM i;  1M4V A;  4KJO A;  4CBV A;  4DF7 A;  1VQI A;  1U0L A;  3G4S A;  3D4W A;  2G9D A;  4KD4 A;  4QJF A;  4F87 A;  3EBE A;  3NQT A;  4F88 A;  4HIM A;  1EQT A;  2Z6K C;  1CQF A;  4GOP B;  3HOV G;  2JA8 B;  3CCS A;  2LXK A;  3NUC A;  2NN6 I;  1B3Q A;  2PYK A;  2WII B;  5FJ8 H;  1BCP C;  4R1J A;  3M7N A;  3HEJ A;  1QVG A;  5C3W A;  3GV3 A;  4CKC A;  1Z6H A;  5IP7 H;  1E22 A;  4DV7 Q;  3L7Z C;  3AU7 A;  3SK5 A;  1EWH A;  1QZH A;  2AQ1 B;  2Q2H A;  5H1S E;  4FNF A;  3OOC A;  1FJG L;  5DEH A;  4DUY Q;  3KF8 B;  3K7A B;  1PFN A;  2BA1 A;  4BY1 H;  2JJQ A;  4DAY A;  1HR0 Q;  2JA7 H;  3J7A F;  2Y0S B;  5IGE A;  2R92 G;  3RZD B;  3V2T A;  5I6Y A;  4ZRZ A;  4C3H H;  1C48 A;  2UXC Q;  4TQU S;  1EY5 A;  3TN2 A;  4DKA C;  4JBJ A;  1D8L A;  5JJI A;  5CV5 A;  1KQS A;  4N8X 1;  3CME A;  1FL0 A;  5M5Y B;  3CQZ B;  3PUX A;  3TEH B;  1HNW Q;  2F3I A;  5C6A A;  3CPW A;  1NBW A;  2C5C A;  2K7V A;  4DV5 Q;  1GD7 A;  4WRD A;  3HOZ G;  4QL5 A;  1PTO D;  3RUZ A;  1B4O A;  1S5F D;  5KND A;  1J9O A;  2A73 B;  1V1O A;  2WV6 D;  4H13 C;  4KY6 A;  1RDP D;  1TY2 A;  2YU9 H;  4IQZ A;  1J5E Q;  3VDY A;  1HTL D;  4BXX H;  4OX9 Q;  1DM0 B;  1G91 A;  2EQS A;  2K75 A;  4C1N K;  4OEL B;  4NXM Q;  3S16 H;  1G6Z A;  1NCV A;  1PMR A;  2KHJ A;  2NZ1 D;  4RGM A;  5I6W A;  3B6Y A;  5FO7 B;  1HA6 A;  1TS5 A;  1TWF H;  1ENA A;  4KY5 A;  4JBK A;  1GUN A;  2JYO A;  3OWF A;  3WDN A;  2A6E C;  3R3O A;  4LFB Q;  5I2Y A;  4KHV A;  5FJ8 G;  5BR8 Q;  3DWA A;  4KD3 A;  2K5W A;  2AUK A;  5IYC G;  4A3C G;  5M3M G;  4LFA Q;  2EYJ A;  1FYC A;  1N9W A;  1P8L A;  4QIW B;  3M4O H;  2BE5 C;  3UI2 A;  2ICE C;  4C3J G;  5COR A;  3OTO L;  1VQK A;  5E3F A;  4DU9 A;  5KYL A;  1MI2 A;  2EPB A;  2RHQ B;  1R9T B;  2JQO A;  2WFW A;  4HR7 B;  4JI5 Q;  4JI1 Q;  2BDN A;  4C3H G;  1Q8K A;  2F52 A;  4OON A;  2B63 G;  4XQQ A;  1X32 A;  3BU2 A;  4JC0 A;  3GTL B;  1I3Q B;  4A3I G;  3CCQ A;  2GVA A;  1F2Z A;  1CKN B;  4L5Q A;  4DV3 L;  2WAC A;  3VYT A;  2ES2 A;  3K5M A;  1FJG Q;  1I6H H;  1R9T H;  3KK7 A;  2NVY B;  1EEF D;  3K5O A;  1PYB A;  2PW5 A;  4ZYS A;  1Z47 A;  5J3B A;  1KTK A;  2QA4 A;  5A35 A;  1Y14 B;  3M4O B;  4P2C B;  2DNE A;  3HKZ G;  1E3P A;  2JEA I;  3SR1 A;  2ICI A;  2JA6 G;  2E74 C;  3E9H A;  1EU4 A;  2B2W A;  1DOL A;  1IBM Q;  3GTJ H;  3HKZ E;  3RN2 A;  3Q23 A;  1K28 A;  2D5D A;  3MXN B;  2L12 A;  4LFC Q;  4JK1 C;  2RQX A;  4IPC A;  2B2V C;  1S5B D;  4XT1 B;  3GTQ H;  1KDC A;  4X65 L;  2RCF A;  1TWF B;  5D3D A;  1BCP B;  1ASZ A;  1HHV A;  1Y1W G;  1HNX Q;  3TP8 A;  1ZXT A;  4K5W A;  3K80 C;  3ULL A;  2XN9 C;  4AH6 A;  5LL6 S;  4PV1 C;  1ZEQ X;  1VQE A;  4DAY B;  3S16 B;  5C0X J;  1ZKO A;  2JN4 A;  3U4Z A;  1B53 A;  4ZAI A;  2L4N A;  2YU9 B;  2HUG A;  4YIJ A;  3IAY A;  5J22 A;  1BCP D;  1D5X C;  1PZK D;  3E5S A;  1SMY D;  3CCU A;  5CC4 A;  3A5U A;  4DXG A;  3CRL C;  1CKM A;  1D6E C;  3TQY A;  3K5N A;  4FF2 A;  3CQZ H;  1VQ7 A;  3G71 A;  1FGU A;  3K81 C;  1Q81 C;  4JYA L;  3D6W A;  3VR2 A;  1G2S A;  1WTX A;  5KRU A;  1BF4 A;  3RZD H;  3CCR A;  2QIL A;  1ROD A;  1B7Y B;  4PMW A;  5IGB A;  4IUQ A;  2XRQ D;  4BY1 B;  3K7A H;  4PG3 A;  5K5P A;  4HIK A;  4A93 G;  3S1Q H;  4JI1 L;  1WTO A;  4RA8 A;  1YI2 A;  3J80 c;  3FKI G;  4DV6 L;  4XIG S;  2F0Q A;  5ISR A;  1ZYR D;  2F0J A;  2NWG A;  3DWQ A;  2LS0 1;  2E75 C;  2OXP A;  4A3M G;  1D2B A;  3CXC A;  2A69 D;  1TS4 A;  1HNZ L;  2UUA Q;  2DY7 A;  4DUZ Q;  2EDG A;  2JA8 H;  1V9P A;  1VMC A;  3CMA A;  4JOI C;  4JI8 Q;  5G3L F;  5J39 A;  1F2Y A;  2ZJQ A;  4OHJ A;  3STB D;  3W5O A;  1WCM B;  4N8F A;  4GLV B;  1SSO A;  2AKW B;  3M9B A;  5IT9 c;  1T9H A;  2YTX A;  1KAB A;  2HCC A;  5JVG 3;  2BDO A;  3HOZ H;  2PO4 A;  1LM0 A;  5JEA J;  3KF6 B;  2FHT A;  3PUW A;  3QG1 A;  4X65 Q;  5EKL A;  2BA0 A;  5CR3 A;  3T56 B;  1TS3 A;  3G7L A;  3Q0A A;  4IAL A;  3FVQ A;  1T5E A;  5IWA Q;  3J7Z C;  1RKN A;  2IHE A;  5EKK A;  3L2P A;  1OXX K;  1ZYR C;  1E2V A;  3K5L A;  4KKT A;  4B3R Q;  1U4M A;  1NTG A;  2PQA A;  4LUO A;  4DR6 Q;  3C1E A;  3HOY H;  1N32 Q;  5AFW A;  4RGN A;  1Y1V B;  1XTD A;  4R9W A;  5IGD A;  1SYG A;  3TP6 A;  4XT3 B;  2VZA A;  1R4P B;  2KCC A;  2LSS A;  2XNA C;  4NPS A;  1K9M C;  1AZP A;  1XNR L;  2B2V A;  3MZ5 A;  3J81 i;  3GDE A;  1UWV A;  3ND9 A;  1BBW A;  1STB A;  3E0J A;  4LF4 L;  2KA7 A;  1A63 A;  2MNA A;  2NVQ H;  5M3F H;  1OXS C;  1S5E D;  5FKA C;  4B3T Q;  2CVR A;  1G8Z D;  3M7G A;  4WJW A;  1DON A;  4PMC A;  1BXT A;  1SR3 A;  5FLX L;  1LAB A;  3PO2 H;  3PO3 H;  2XIW A;  2F0O A;  4LF6 Q;  1FR3 A;  4MTN A;  1I4Q A;  1S40 A;  4I7A A;  3NTK A;  3GQB A;  3O13 A;  4B9X A;  2E2H H;  2Q8I B;  4K8I A;  3NP8 A;  4DK0 A;  2VNU D;  1BDO A;  3BDC A;  3SXH A;  2P5Z X;  3U50 C;  1IW7 D;  3OWE B;  4OO1 G;  4A3D B;  2IJ0 A;  5CV8 A;  2AHO B;  2ATW A;  2EY1 A;  5JPN C;  1AE2 A;  2BE5 D;  4DUZ L;  1EYD A;  3KLS X;  2IX0 A;  2E2J B;  3GTO H;  2B29 A;  1SND A;  1VQM A;  3MA2 B;  2PZW A;  2UU9 L;  4EQ5 A;  4BBS G;  5JPM C;  3H0G H;  1PH6 A;  1B50 A;  2EYH A;  1IBK Q;  1V43 A;  2Z4I A;  3S2D H;  2EJG C;  1SYC A;  3MFG A;  2ZTC A;  1K83 B;  2VQE L;  5TSS A;  3L9A X;  2PPB C;  1BBX C;  1UE6 A;  1WJJ A;  4UP7 A;  1TWA B;  1YIJ A;  4GNX C;  4EGV A;  1N33 Q;  2DJG C;  2KCN A;  4NMZ A;  4YHH L;  5EJW A;  5KNB A;  4ZUJ A;  4B3S Q;  1HUN A;  3G48 A;  2F0L A;  5ELF A;  5EPL A;  3RMH A;  1L1O C;  4ABN A;  3KJP A;  1LTS D;  3PUY A;  4MZ9 A;  4GNX B;  3ICE A;  1H9J A;  5HGT A;  2BH8 A;  2JA5 B;  1CUK A;  1VQH A;  1D5Z C;  5LMN Q;  4BY7 G;  1GVP A;  4Y7N H;  1QNU A;  4L5T A;  3RZO H;  1HTP A;  5EPK A;  1X3F A;  4HJ5 A;  1TWC H;  2RSO A;  3CP0 A;  1XNR Q;  1PRT D;  3EN2 A;  3MVV A;  4MNO A;  4U68 A;  3T4A C;  3S1M B;  1VMP A;  4GKK L;  1D1K A;  1QCB D;  2PNH A;  5GAG C;  3VR4 A;  3S1R B;  1E0B A;  3OMC A;  3BDL A;  4C2M H;  1VQG A;  2F4V Q;  3GP7 A;  1B2T A;  1S4Z A;  3HOX G;  3I4N B;  4DR3 Q;  3E0E A;  5C3E G;  1YVC A;  1HFN A;  4IJL A;  4JI2 L;  1NY4 A;  2CW0 D;  3FPP A;  2NVT B;  4L6T B;  4IZ8 A;  3CRK C;  3UDX A;  5C4H A;  4A93 H;  1GXD C;  1JC7 A;  2E5L Q;  3HOU B;  2AWO A;  1SMY C;  3W3A A;  4YWM A;  2F0N A;  1J5E L;  1K8M A;  1PYW D;  3C2P A;  1VF5 C;  2E2I B;  1MKH A;  4A4I A;  1CSQ A;  3FRP B;  2F0D A;  1I50 B;  3UDG A;  2QCP X;  1KDB A;  3SK4 A;  4J15 A;  1EIG A;  4AQY Q;  2XRS D;  3OYY A;  1KAA A;  5DAU A;  2VB2 X;  2R93 H;  4DV2 Q;  1HR0 L;  4EQN A;  2RF4 A;  4X66 Q;  2O5J C;  3T16 A;  5CV7 A;  3AEV A;  1B8A A;  1EQQ A;  2IHF A;  5C5M A;  1IL2 A;  2VB3 X;  5IP7 G;  1SE2 A;  4C2M B;  3S1R H;  5BN4 A;  1EWC A;  1SE4 A;  1QIL A;  1IBK L;  3HOV B;  3J7A V;  5I9O A;  2SNM A;  3A55 A;  3VR3 A;  1VQ6 A;  2F0W A;  5IP9 H;  3A8J E;  1YNX A;  2AQ2 B;  2F0U A;  4K6D A;  4UDU C;  3RZO B;  2F0K A;  1IBL L;  1J8I A;  1L1O B;  2B2W C;  2PNR C;  2N88 A;  5FLM H;  3J80 L;  1XMO L;  1BOS A;  1BVS A;  4KHP L;  3DM3 A;  4C3I G;  1RF2 D;  3MTS A;  4DR2 L;  1BR9 A;  1BBU A;  1GUS A;  3I3C A;  3SHL A;  1GHK A;  1KRS A;  2Q8R E;  3PIO 3;  5M5X H;  4POF A;  5IT9 E;  3R2T A;  3CF5 A;  2L0C A;  1JOO A;  4H02 A;  2L1B A;  2K5D A;  1PRT F;  4WFN 3;  3TZU A;  1TWA H;  4R4C A;  4RKB A;  2UXB L;  1QG7 A;  4CDD C;  4DV0 Q;  4R4O A;  4JI6 L;  1JB3 A;  1EQV A;  3T1H Q;  5JAV A;  1SNQ A;  1D7Q A;  1E1O A;  2YYZ A;  1LT6 D;  2IWH A;  2B2Y C;  2DGY A;  2X6L A;  4PZ7 A;  1KNE A;  1R4Q B;  4DNT B;  3H0G B;  3TP7 A;  2L5T A;  4IPD A;  3RN5 A;  2AMC B;  3D4R A;  2R7F A;  4IN3 A;  2FIN B;  5DM7 3;  4EVO A;  2E2J H;  1HZA A;  1U4L A;  5LMU L;  3JAM c;  1WTR A;  1OXT A;  4B9W A;  3K6O A;  4A3D H;  1I5F A;  2QKI C;  3KUP A;  2XWB B;  1VQL A;  1XWE A;  1IYJ B;  1JWU D;  4KY7 A;  1SE3 A;  1SNP A;  3PQI A;  5D65 A;  4HAE A;  2JK8 A;  1F2M A;  5CV6 A;  1JOQ A;  1STE A;  2BH2 A;  2E2H B;  2QEJ C;  3J81 L;  4IFD I;  1PVO A;  3PMF A;  2F0P A;  2OCE A;  3M4P A;  5J1Z A;  1H9S A;  2VW9 A;  4DR1 L;  2Q2U A;  4JI3 Q;  3F1Z A;  4CJ2 C;  4J1M A;  3OIQ A;  4QMG A;  3URY A;  4RHS A;  1UE5 A;  2KVM A;  1SJH D;  5CMD A;  2D0O A;  4A3B B;  3UE0 A;  4BS9 A;  2OT2 A;  3EJI A;  2NTS A;  1MHW C;  1WTV A;  3HOW H;  5ELO A;  1NUC A;  5M3F B;  2NVQ B;  5IOC A;  4IFD H;  2FMC A;  1EYG A;  1A2U A;  5IIF A;  1SYF A;  4FF1 A;  2SNS A;  1TII D;  3I4M G;  1E7Z A;  4R4Q A;  1QE6 A;  4RHR A;  2V1C C;  5KYI A;  1TT2 A;  2UUB L;  2R7Z H;  4LUZ A;  1YNJ D;  5E4X A;  2A5H A;  4DR4 Q;  2Y0S E;  1Y1V H;  1IZ6 A;  2HDM A;  1B70 B;  3Q6S A;  1HFG A;  1MJE A;  1NR2 A;  1TXY A;  5T1I A;  3PIP 3;  5K36 H;  3WOE A;  1EY4 A;  1CHP D;  5C3X A;  3A8I E;  3AFP A;  4JI7 L;  2HHH L;  4BBR G;  3TRE A;  1SXT A;  3A7A B;  3L3O C;  5ELB A;  2B8F A;  3MEH A;  1VQ8 A;  2I0Q A;  3I70 A;  1SN8 A;  1M90 C;  4G4K A;  1BO0 A;  1KLG D;  2L11 A;  3VR5 A;  1GJX A;  4IUN A;  4NB3 A;  4OL7 A;  2IW3 A;  4K5V A;  1C4Q A;  1KD1 C;  3T1H L;  1Q3L A;  1CKO A;  5CYU A;  1WCM H;  4K6L A;  2PQE A;  4HID A;  2DJF C;  1PFS A;  1GHJ A;  5FOB B;  1N8R C;  4JI4 Q;  1EYA A;  2VXW A;  3ZYY X;  1OO9 B;  4KK7 A;  1QWY A;  5C0X H;  1PDQ A;  1DD2 A;  1EIH A;  1KXL A;  1XXG A;  3OHX C;  2K4K A;  3J81 c;  3H3V C;  1NSN S;  3MHB A;  1SYD A;  3QB3 A;  3F2U A;  5EKI A;  4DGZ A;  2RSN A;  4GLA C;  3J7Y W;  4DR6 L;  1DXM A;  3FKI B;  4LF7 Q;  3ERS X;  3R8B A;  1N36 Q;  3NEM A;  4HSV A;  3S1Q B;  1W3S A;  4JI3 L;  4FO2 A;  2IY5 B;  1SJE D;  1A0I A;  4X62 L;  2K5N A;  2F03 A;  4PZ6 A;  1ASY A;  4A3J H;  2B2Y A;  4I7Z C;  4JVZ A;  4L8J A;  1CKN A;  3HOX B;  1EZ6 A;  1ICW A;  2VY3 A;  1RIP A;  1CM9 A;  3NBH A;  4WJ3 M;  2HQE A;  3I56 A;  2K03 A;  1VQF A;  3KJO A;  3OPO A;  4LF4 Q;  2ZTE A;  4Z9C B;  2CWP A;  4ZCK A;  1K0R A;  1LT4 D;  4DK6 C;  2CQA A;  1Y8O B;  3G6J B;  3J81 j;  1NMF A;  1ET9 A;  3HRZ C;  1X3G A;  3NEL A;  1VQC A;  1JQY D;  4LAA A;  1SBB B;  1O7Y A;  4ME5 A;  3T1Y Q;  3GD7 A;  3F2D A;  2Z9H A;  1U9R A;  2WB1 E;  4DV7 L;  5GAH C;  1ET6 A;  1LTI D;  3DM1 A;  1CFM A;  1STA A;  3MXN A;  4RKL A;  5D14 A;  4GN4 B;  1HQR D;  2ALY B;  5C44 H;  4RGO S;  4M1U B;  5FLM G;  4L63 B;  1KIX A;  3PO3 G;  2F3W A;  1K8G A;  2RBM A;  1PFB A;  4ZKC B;  1WOC A;  4DR5 L;  4NDX A;  4QY7 A;  1HH2 P;  3GTQ B;  2NZH A;  3A7L A;  4CDF C;  1QOH A;  2KJX A;  3DWP A;  2RDF A;  1EFW A;  5C5L A;  4UY8 C;  4CGY B;  4HJ8 A;  1QNK A;  3GTJ B;  4DR7 L;  1LV9 A;  4CJ0 B;  1Q1E A;  2GA4 B;  2H1E A;  2KHI A;  1VQD A;  5BN5 A;  2JA6 B;  3H3V H;  4DV5 L;  1H95 A;  5IY0 A;  2Z6B A;  4L5R C;  1RL2 A;  3BVM A;  3H6M A;  4GN5 A;  2QDB A;  2CQO A;  2K04 A;  1EUJ A;  2N49 A;  3RLN A;  2UUC L;  2UXD Q;  4KKS A;  1SEB D;  5C4X G;  3CCL A;  2NVY H;  4POG A;  4YHH Q;  1RD9 D;  1IXR A;  1I6H B;  4K14 A;  2D2C C;  1B3A A;  2JSO A;  4OX9 L;  1I3Q H;  3GTL H;  4IO9 A;  1VCI A;  3STB C;  5C44 G;  2PCF B;  1FNU A;  4XTC S;  3M4Q A;  1X3E A;  3FMC A;  3A54 A;  4RCN A;  4IPH A;  4LWC A;  4K0K Q;  3DHQ A;  3WWV A;  3BYT B;  4O42 A;  4DV1 L;  5FK9 C;  3JAM E;  3TDQ A;  4UPA A;  1DOM A;  3NE5 B;  4JOI A;  4X3K A;  4HCS A;  2F0S A;  4X3S A;  1H9R A;  4YWL A;  1N32 L;  3KYH C;  4OO1 H;  1KHI A;  2E2D C;  5E1F A;  2F4V L;  2VUM H;  4KV6 A;  5M9O A;  1SNO A;  3NK9 A;  2PI2 A;  1X3P A;  3QIA A;  1CK1 A;  4RGT A;  3OTO Q;  3JC6 6;  2ENB A;  4P73 A;  4A3E B;  1XYI A;  1HRJ A;  2E5L L;  1RCV D;  1YNJ C;  4HCE A;  3KDF B;  4A3F G;  3IFD A;  1SLJ A;  2VQF L;  1Y1W H;  1PTO F;  3MEF A;  1UUP A;  5ELC A;  2J0T D;  3NQI A;  1OXU A;  1JJ2 A;  4WOR A;  1QJO A;  2L55 A;  3LNN A;  1LT5 D;  2WAQ B;  3D0F A;  2EJM A;  1I6V C;  3HP3 A;  1U4P A;  3KF8 A;  4P74 A;  3PF5 A;  1XMQ L;  4YCW A;  5CV9 A;  2NVX B;  1LLR D;  1W6K A;  4TRD A;  3MAQ A;  4NKL A;  2EVB A;  4RAU C;  1DYQ A;  2Z0S A;  1ILP A;  4LF9 Q;  4LMQ D;  5M5Y H;  4CDE C;  1SYE A;  1H9S B;  1YHB A;  2I5M X;  3NTI A;  4ODG A;  1S72 A;  1EFI D;  3KDF A;  4FF3 A;  1AEX A;  4QF4 A;  4C3H B;  3S15 B;  4DR3 L;  4YY3 Q;  3PV0 A;  1SRU A;  2X69 A;  2JA7 B;  2DUD A;  5C3E B;  2B2U C;  3VYR A;  1P16 A;  2K32 A;  4L5S A;  1EYC A;  1WTP A;  1HNW L;  1JIC A;  3CCM A;  4RMF A;  4FXD A;  3SVM A;  5M5W B;  1C9O A;  1TWG B;  3SK6 A;  3TRZ A;  4H7B A;  4JW0 A;  4JI5 L;  5EGT A;  4A3E G;  3MWY W;  1F9P A;  5C0X G;  1JOK A;  1KLU D;  1PH4 A;  4R4T A;  2IT1 A;  3HGB A;  4DK1 A;  3CPF A;  4CJ1 B;  2NYZ D;  2EZV A;  4A3C H;  1A8V A;  2AUJ D;  3NWT A;  4FF4 A;  1M8A A;  4YWK A;  1IYV A;  4APV A;  1VQ5 A;  4DPG A;  3ONA B;  1W2B A;  4DAP A;  1U5K A;  4C1N I;  2O2L D;  3FDT A;  5HY6 A;  2I07 B;  2L15 A;  4DNI A;  2ZT9 C;  1NMG A;  4B3M Q;  3VR6 A;  2WP8 J;  1CZW A;  4G7H C;  3N52 A;  5LMU Q;  5BR8 L;  3LX0 A;  2V4D A;  5AJ3 L;  4BXX G;  3I73 A;  4O1N A;  3A8K E;  1X9N A;  3H3V I;  1CQV A;  2A74 C;  2FMM A;  2H4O A;  4LFA L;  1IKM A;  3HOY G;  4LF5 L;  2LFN A;  4ULL A;  2EOT A;  4RFB A;  4ALP A;  4DR2 Q;  5LL6 X;  4A3G G;  2AWN A;  5JEA H;  3OMG A;  2Y0S G;  4A3K B;  4JV5 L;  5I4D A;  1VQ9 A;  4KJN A;  1LTG D;  1PTO H;  4FVM A;  5G3L D;  4OGQ C;  1HA5 A;  3LWE A;  5ELN A;  2R7Z G;  1NE3 A;  5ELD A;  3SEB A;  1IW7 C;  1X65 A;  3ITP A;  4DV0 L;  2D0P A;  4DV4 Q;  1FGB D;  2B2T A;  1X3Q A;  1MIU A;  2A68 D;  1OXV A;  1I4H A;  2EIF A;  1L0Y B;  4B3T L;  1AW7 A;  4Q5V A;  4BBS B;  1XNQ L;  1GOZ A;  1I4G A;  4KHZ A;  4Y52 H;  2JA8 G;  3HFZ B;  1EEI D;  3NEN A;  4N9T A;  1A15 A;  4BY7 H;  1NAP A;  3C46 A;  3NSW A;  3RLO A;  1F9Q A;  3X3M A;  2RKS A;  3TS0 A;  1IBM L;  4GKJ Q;  4IUR A;  3GO5 A;  2I5H A;  4G57 A;  1H9K A;  3CCE A;  1F9R A;  1A6X A;  1HUM A;  1C8C A;  4AIM A;  1C7Y A;  2CH4 W;  2IX3 A;  4A75 A;  2LKV A;  4TVA B;  1A2T A;  1ICF B;  3PF4 A;  4OIJ A;  2KED A;  1K3R A;  4KHP Q;  4CKB A;  2HT1 A;  2K6A A;  3CAM A;  2CFM A;  3R2I A;  3PUZ A;  1O78 A;  2Q2I A;  4E6I A;  3SGI A;  4OEM B;  4HIO A;  3X3N A;  2WB1 B;  5EBC A;  1PH5 A;  4FXK C;  3I4M B; 
#chains in the Genus database with same CATH homology
 1JJC B;  2QA4 A;  1Y14 B;  2ZTD A;  3HOW H;  5ELO A;  3M3Y H;  5K36 G;  1JT8 A;  3TS2 A;  1XPO A;  1XPR A;  4OWT B;  3HKZ G;  2JEA I;  1E3P A;  2KCM A;  1EYG A;  1G29 1;  5M3M H;  4JCV E;  4BBS H;  2XTI A;  5GRO A;  1Y1V G;  2JA6 G;  1JB7 A;  3E9H A;  1IBM Q;  3GTJ H;  3HKZ E;  3RN2 A;  3I4M G;  4A3I H;  1XMO Q;  3MXN B;  1X55 A;  4LFC Q;  1E7Z A;  4IPC A;  4HJ7 A;  4R4Q A;  4EX5 A;  2V1C C;  4A3K G;  2UUB L;  2R7Z H;  3GTQ H;  4LUZ A;  1K8A C;  4IFD J;  4X65 L;  2MFI A;  4DR4 Q;  4B3S L;  2GVB A;  2Y0S E;  1Y1V H;  3FP9 A;  1ASZ A;  1IZ6 A;  3J7A 5;  2ZM6 Q;  1Y1W G;  1HNX Q;  3M85 A;  1B70 B;  3K80 C;  3ULL A;  4AH6 A;  2OTJ A;  1MJE A;  2N78 A;  1TXY A;  1VQE A;  2VL6 A;  4DAY B;  3HOW G;  3AFP A;  5C0X J;  4JI7 L;  2HHH L;  3F8T A;  3TRE A;  3U4Z A;  4BBR G;  4BBR H;  4A3J G;  2HHH Q;  4JI0 L;  1N33 L;  1AH9 A;  3A5Z B;  3K7U C;  5E7N A;  1CSP A;  4LFB L;  2WAQ E;  3CD6 A;  1VQ8 A;  4FDB A;  4JI8 L;  2I0Q A;  1SN8 A;  2HIV A;  4YCU A;  1M90 C;  4A3M H;  4GNX A;  1LYL A;  2RCN A;  3PGZ A;  3CCU A;  4LF8 L;  2N8N A;  3A5U A;  4BA1 I;  5IYC H;  3PO2 G;  3NBH B;  1CKM A;  5C4X H;  1VQA A;  2OQK A;  3FHW A;  4NB3 A;  1SRO A;  3DLL A;  4GLX A;  1DGS A;  4DV4 L;  3TQY A;  4OWW B;  4UP8 A;  1KD1 C;  2KCT A;  4LFC L;  1HZB A;  3T1H L;  3HOV H;  2K5H A;  3CQZ H;  1VQ7 A;  3RR5 A;  1QUQ B;  1FGU A;  3G71 A;  5M3F G;  3K81 C;  1QZG A;  1KRT A;  1X54 A;  1Q81 C;  4P71 A;  4JYA L;  1CKO A;  1TWH H;  1WCM H;  4JI2 Q;  1XNQ Q;  2YTY A;  3E9I A;  1Q86 C;  3UDF A;  3ZJY C;  4HID A;  3KF6 A;  4DR7 Q;  3BZK A;  4QQB X;  4IFD G;  1PFS A;  3RZD H;  5C0X I;  3CCR A;  3ULP A;  2WAQ G;  1Q1B A;  3I4N G;  2CKZ B;  1B7Y B;  4PMW A;  2B3G A;  1N8R C;  4JI4 Q;  3KLW A;  2E8G A;  2VUM G;  1Z9F A;  1IBL Q;  1M1K C;  3K7A H;  4PG3 A;  5EAY A;  3BJU A;  5GAE C;  1UEB A;  4P75 A;  4HIK A;  1JMC A;  2D62 A;  2IX1 A;  3S1Q H;  4A93 G;  4JI1 L;  3HOU G;  1PH1 A;  2GN5 A;  2K4K A;  1KXL A;  3J81 c;  1L2F A;  4DV3 Q;  1YI2 A;  3J80 c;  4DR1 Q;  3A74 A;  3FKI G;  4XIG S;  4DV6 L;  1I50 H;  1XJV A;  3GTM H;  4DR6 L;  4GLA C;  4LF7 Q;  1TWG H;  3ERS X;  2Z6K A;  1N36 Q;  2E2I H;  3NEM A;  5M5W H;  2NZO A;  1PYS B;  2ZM6 L;  4A3M G;  1W3S A;  4JI0 Q;  3BZC A;  4JI3 L;  3CXC A;  4DR5 Q;  3HOU H;  1SE8 A;  1HNZ L;  2UUA Q;  2IY5 B;  3LGJ A;  2R7D A;  1A0I A;  4X62 L;  2NVT H;  3U4V A;  2K5N A;  4KHP Q;  4PZ6 A;  1ASY A;  5C3E H;  4A3J H;  4A3D G;  4DUZ Q;  2HQL A;  4AQY L;  1CKN A;  2JA8 H;  3S24 A;  2VY3 A;  3I4N H;  5JEA G;  1SMX A;  1V9P A;  1RIP A;  3S15 H;  3CMA A;  4WJ3 M;  4JOI C;  4JI8 Q;  3I56 A;  2ZJQ A;  3STB D;  3W5O A;  3UE1 A;  4DV2 L;  4GLV B;  4X66 L;  4BY1 G;  1VQF A;  3KOJ A;  3KJO A;  3GTK H;  2AKW B;  4O2D A;  4LF4 Q;  2ZTE A;  2CWP A;  3M9B A;  5IT9 c;  1K0R A;  5IYD H;  1T9H A;  2YTX A;  4DK6 C;  3S1M H;  3J81 j;  4DAM A;  1NMF A;  5IP9 G;  1X3G A;  1J6Q A;  1V1Q A;  3NEL A;  3HOZ H;  1VQC A;  2A1A A;  3PIP A;  1LM0 A;  5JEA J;  2K5V A;  4DV6 Q;  3KF6 B;  4IOA A;  3PUW A;  3PUV A;  3T1Y Q;  1WCM G;  3GD7 A;  3F2D A;  4X65 Q;  1OTC A;  2WB1 E;  4DV7 L;  1G6P A;  5GAH C;  2BA0 A;  3I4O A;  2NVX H;  4JI7 Q;  2JA5 H;  4JV5 Q;  2K14 A;  2R6G A;  5IWA L;  3G6E A;  5IWA Q;  1HNZ Q;  3J7Z C;  2IHE A;  3L2P A;  1KAW A;  1OXX K;  4GN4 B;  1MJC A;  4X64 Q;  4B3R L;  4B3R Q;  2ALY B;  1NTG A;  5C44 H;  2PI2 E;  2PQA A;  4LUO A;  4DR6 Q;  5IE8 A;  5FLM G;  1YJ9 A;  3HOY H;  1KIX A;  3PO3 G;  1N32 Q;  4JBW A;  3H15 A;  1K8G A;  2Q2T A;  3AYH B;  1VQN A;  1QVF A;  1XTD A;  3RNU A;  1VQO A;  4NXM L;  4LF8 Q;  1WOC A;  4DR5 L;  2KBN A;  4QY7 A;  1HH2 P;  2LXJ A;  2NZH A;  4A3E H;  2VZA A;  1A62 A;  1UE1 A;  3U58 A;  2LSS A;  1K9M C;  4NPS A;  1K83 H;  2OQ0 A;  1EFW A;  2YV5 A;  4UY8 C;  1XNR L;  4HJ8 A;  3PIO A;  1QVC A;  5C4J H;  3J81 i;  4DR7 L;  3GDE A;  1Q1E A;  4GN3 B;  4QIW E;  4X62 Q;  1UWV A;  5DLQ E;  4QGU A;  2KHI A;  3H3V H;  1BBW A;  1VQD A;  1H95 A;  4DV5 L;  4LF4 L;  4OWX B;  5IY0 A;  1A63 A;  1N34 Q;  4GKK Q;  2MNA A;  1N34 L;  4OXP A;  5M3F H;  4L5R C;  1RL2 A;  1OXS C;  2NVQ H;  4GN5 A;  4B3T Q;  3I4M H;  2CQO A;  1EUJ A;  2N49 A;  3RLN A;  2UUC L;  2UU9 Q;  2UXD Q;  2UUC Q;  2MQH A;  5C4X G;  1SR3 A;  3CCL A;  5JJL A;  2NVY H;  4POG A;  3PO2 H;  3PO3 H;  2R93 G;  4AYB E;  3L0O A;  1Q46 A;  4YHH Q;  4LF6 Q;  1IXR A;  2I5L X;  1VQP A;  4MTN A;  4DR4 L;  1S40 A;  5GAD C;  4OX9 L;  3S1N H;  1HNX L;  1PH8 A;  1I3Q H;  3S14 H;  2VQE Q;  3GTL H;  4AYB G;  4IO9 A;  1VCI A;  3I55 A;  2E2H H;  3STB C;  5C44 G;  4LNQ A;  1G51 A;  1HZ9 A;  1S3O A;  4XTC S;  4NXN L;  3I2Z A;  3M4Q A;  1X3E A;  2C35 B;  1YHQ A;  1YIT A;  1EQR A;  2FXQ A;  2VNU D;  4IPH A;  4DUY L;  4LWC A;  4ME3 A;  4K0K Q;  3WWV A;  3GTG H;  2A8V A;  3U50 C;  3I7F A;  1BKB A;  4OO1 G;  4DV1 L;  3KFU A;  1PH5 A;  4DV1 Q;  2AHO B;  2ATW A;  1YEZ A;  4UPA A;  4X64 L;  2CWA A;  1AE2 A;  4JOI A;  4DUZ L;  4LF9 L;  2A19 A;  4KI0 A;  2IX0 A;  3D31 A;  1AE3 A;  2ZJP A;  1GKH A;  4YWL A;  2B29 A;  3GTO H;  3A0J A;  5IYD G;  1VQM A;  1N32 L;  3W1B A;  2JA6 H;  2UU9 L;  4EQ5 A;  4KLK A;  4BBS G;  3KYH C;  4JG2 A;  1KHI A;  2XGT A;  3Q8D A;  3CW2 C;  2RHS B;  2F4V L;  2VUM H;  3H0G H;  4A3F H;  1PH6 A;  3OW2 A;  4IOC A;  3T1Y L;  1IBK Q;  2PI2 A;  1V43 A;  4YY3 L;  3S2D H;  3AFQ A;  2MO1 A;  3UDI A;  2ASB A;  3F2B A;  3OTO Q;  2ZTC A;  2JEB I;  3JC6 6;  4GOP A;  1KL9 A;  2VQE L;  4P73 A;  1JE5 A;  1LTL A;  2E5L L;  4LUV A;  1UE6 A;  1WJJ A;  3KDF B;  3H0G G;  4UP7 A;  4A3F G;  1I94 L;  1SLJ A;  1L0W A;  1E24 A;  1YIJ A;  3ER0 A;  2VQF L;  2K52 A;  2VQF Q;  1Y1W H;  3MEF A;  5AJ3 Q;  4GNX C;  1N33 Q;  4K0K L;  4YHH L;  2B63 H;  2K50 A;  2H5X A;  1OXU A;  3CCJ A;  1JJ2 A;  4B3S Q;  4A3K H;  3EIV A;  3G48 A;  1YJW A;  5FLX c;  1PH2 A;  3D0F A;  1YBY A;  1L1O C;  2JA7 G;  4A76 A;  4P74 A;  5JJK A;  3KJP A;  2N3S A;  3PF5 A;  2CCZ A;  4BA2 I;  4A3L H;  2JA9 A;  2PMZ E;  3PUY A;  4MZ9 A;  1XMQ Q;  4GNX B;  3HKS A;  1XMQ L;  1SFO H;  3ICE A;  4YCW A;  2BH8 A;  1VS0 A;  3K8A A;  1CUK A;  1VQH A;  1X56 A;  4A3B G;  4JBM A;  3F2C A;  4JYA Q;  4BY7 G;  4C3J H;  4PZ8 A;  5LMN Q;  1GVP A;  4Y7N H;  2UUA L;  2MO0 A;  4L5T A;  3RZO H;  1VQB A;  4HJ9 A;  1X3F A;  2Z0S A;  4HJ5 A;  3PSI A;  1QUQ A;  1EOV A;  1TWC H;  4LF9 Q;  4A3G H;  3CP0 A;  2OWO A;  3JAM i;  3EN2 A;  4O0A A;  2QGQ A;  4MNO A;  5M5Y H;  2QEX A;  1XNR Q;  4GKK L;  1HR0 W;  1YHB A;  1EWI A;  2I5M X;  2PNH A;  1VQ4 A;  1VQI A;  4JI6 Q;  1U0L A;  5GAG C;  3G4S A;  1K73 C;  1S72 A;  4C2M H;  4QJF A;  1VQG A;  3RLF A;  3KDF A;  3EBE A;  3K0X A;  2F4V Q;  4HIM A;  4LW1 A;  3HOX G;  1PHJ A;  3S2H H;  2Z6K C;  4DR3 Q;  4GOP B;  3E0E A;  5C3E G;  4YY3 Q;  3PV0 A;  2LXK A;  3HOX H;  3CCS A;  2NN6 I;  4DR3 L;  1YVC A;  1SRU A;  1JJG A;  1EIY B;  4IJL A;  1WFQ A;  4JI2 L;  2DUD A;  4LF5 Q;  1NY4 A;  1KC8 C;  5FJ8 H;  4R1J A;  3M7N A;  1P16 A;  4IPG A;  3UDX A;  4L5S A;  4A93 H;  4X6A H;  1QVG A;  2E5L Q;  2AWO A;  5IP7 H;  1HNW L;  1E22 A;  4YWM A;  4DV7 Q;  3CCM A;  4RMF A;  1J5E L;  3L7Z C;  4GS3 A;  3GTP H;  2VS1 A;  1GO3 E;  1C9O A;  1MKH A;  3FKI H;  5LMN L;  4A4I A;  1QZH A;  1CSQ A;  3TRZ A;  2HIX A;  1L1O A;  2Q2H A;  4JI5 L;  5H1S E;  3UDG A;  4A3E G;  4NXN Q;  3AQQ A;  2NN6 G;  5C0X G;  2YTV A;  1HNW Q;  4J15 A;  1FJG L;  4AQY Q;  1PH4 A;  4DUY Q;  3KF8 B;  4R4T A;  2IT1 A;  3OYY A;  2BA1 A;  3CPF A;  4P72 A;  4BY1 H;  2JJQ A;  2WB1 G;  4A3C H;  1A8V A;  1WYD A;  2R93 H;  1HR0 Q;  2HT1 A;  4DV2 Q;  2JA7 H;  1HR0 L;  4YWK A;  2RF4 A;  4X66 Q;  3IRB A;  2R92 G;  3AEV A;  2JE6 I;  1C0A A;  1B8A A;  4APV A;  1VQ5 A;  4DPG A;  4C3H H;  1W2B A;  1EQQ A;  1U5K A;  1PA6 A;  1X6O A;  2IHF A;  2UXC Q;  4TQU S;  1IL2 A;  4DKA C;  5HGQ A;  3HOV G;  5IP7 G;  2ZJR A;  4JBJ A;  5HY6 A;  1D8L A;  2L15 A;  3S1R H;  5JJI A;  4DNI A;  1KQS A;  1PV4 A;  2UXB Q;  1NMG A;  4B3M Q;  3CME A;  1FL0 A;  2WP8 J;  3PUX A;  3TEH B;  1IBK L;  5LMU Q;  2F3I A;  5BR8 L;  3CPW A;  3CC7 A;  1Q82 C;  1NBW A;  2R92 H;  1PH9 A;  1VQ6 A;  3CCV A;  4DV5 Q;  1GD7 A;  5IP9 H;  4QL5 A;  5AJ3 L;  4JI4 L;  3HOZ G;  1YNX A;  4BXX G;  3W1G A;  1IBL L;  3H3V I;  1Z47 A;  1X9N A;  1L1O B;  4GKJ L;  4LFA L;  1I94 Q;  5FLM H;  1XMO L;  4LF5 L;  1YHA A;  3HOY G;  3S17 H;  1BVS A;  4KHP L;  4ALP A;  3DM3 A;  1FVI A;  4DR2 L;  2UUB Q;  4DR2 Q;  2YU9 H;  1BBU A;  4A3G G;  1KRS A;  2AWN A;  1UE7 A;  5M5X H;  4POF A;  1J5E Q;  3VDY A;  2Y0S G;  4BXX H;  5IYB G;  4OX9 Q;  1LUZ A;  2EQS A;  2K75 A;  1WI5 A;  4JV5 L;  3CF5 A;  4NXM Q;  3S16 H;  1VQ9 A;  2KHJ A;  5GQO A;  4H02 A;  2JA5 G;  3B6Y A;  1PH3 A;  3J80 i;  2ID0 A;  1HZC A;  1GM5 A;  5ELN A;  1TWA H;  1TWF H;  4R4C A;  4YCV A;  4UP9 A;  1NE3 A;  4JBK A;  1HJP A;  1XPU A;  2R7Z G;  2UXB L;  2PQA B;  4LFB Q;  1X65 A;  5LMN W;  4R4O A;  4DV0 Q;  5FJ8 G;  2KEN A;  2D0P A;  4DV0 L;  4JI6 L;  4DV4 Q;  5BR8 Q;  1Q7Y C;  1MIU A;  3T1H Q;  4HJA A;  1D7Q A;  1E1T A;  1E1O A;  1OXV A;  2YYZ A;  5IYC G;  3CC4 A;  2DGY A;  4PZ7 A;  4RG1 A;  4C3I H;  1PH7 A;  4A3C G;  2EIF A;  5M3M G;  2UXC L;  4B3T L;  4IPD A;  4LFA Q;  3RN5 A;  2AMC B;  1XNQ L;  1N9W A;  1YJN A;  2UXD L;  2R7F A;  4KHZ A;  1P8L A;  2JA8 G;  3M4O H;  4Y52 H;  4OO1 I;  4GOP C;  3HFZ B;  2E2J H;  1HZA A;  3NEN A;  2OTL A;  5LMU L;  1O7I A;  4BY7 H;  3JAM c;  4A3B H;  4DK3 C;  1OXT A;  3OTO L;  1VQK A;  3RLO A;  4A3D H;  1I5F A;  4B3M L;  2RHQ B;  1VQL A;  3TS0 A;  1IBM L;  4GKJ Q;  1IYJ B;  2JQO A;  4A3L G;  2WFW A;  4JI5 Q;  3GO5 A;  2I5H A;  4JI1 Q;  3CCE A;  1Q12 A;  1Q8K A;  5IYB H;  4AIM A;  2F52 A;  1C7Y A;  2JK8 A;  4A75 A;  4WJ4 A;  1VQJ A;  2BH2 A;  4OON A;  4LF6 L;  4TVA B;  2B63 G;  3PF4 A;  3BU2 A;  4JC0 A;  4A3I G;  3CCQ A;  3CC2 A;  4IFD I;  1PVO A;  2GVA A;  1NJI C;  1CKN B;  1K3R A;  4IJH A;  4L5Q A;  1EIF A;  4DV3 L;  2OCE A;  3M4P A;  2ES2 A;  3CAM A;  2VW9 A;  2CFM A;  4DR1 L;  3PUZ A;  2Q2U A;  4JI3 Q;  1FJG Q;  3F1Z A;  1R9T H;  1I6H H;  2Q2I A;  3PCO B;  4LF7 L;  1N36 L;  1UE5 A;  1YZ6 A;  3SGI A;  4HIO A;  1PYB A;  2D0O A;  4R4I A;  3UE0 A;  3ULJ A;  2EXD A;  5J3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...