4LUVA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luvA00
1R9TH 4JI2L 4YCVA 4A3IH 1UEBA 4JI0Q 1PA6A 4AH6A 3DM3A 1IBKL 1UWVA 3GTJH 1HZAA 3BZKA 2K75A 3PSIA 4R4IA 4BY1H 3K81C 2XGTA 1KQSA 2AKWB 4AIMA 2QEXA 1J5EQ 2OTLA 3M3YH 1E3PA 5C0XG 3G48A 1XPUA 3GTKH 2JQOA 2R93G 3UE0A 3S15H 4A3JG 1K8GA 1I50H 4LFAL 2JEBI 3WWVA 4UPAA 1PH9A 1Y1VG 1IBKQ 1VQKA 3H3VI 4JI5L 1QZGA 3PF5A 3I55A 4X64L 2D0OA 4L5QA 4C3HH 4WJ4A 1H95A 1KHIA 2JA9A 3CCRA 1J5EL 1JT8A 4X65L 3S1RH 4JBWA 3CCEA 1PFSA 3TRZA 3HKSA 1IYJB 2NVYH 1SROA 1VQHA 2LSSA 1OXUA 3FP9A 2K14A 4A3MG 1C0AA 4DV1Q 3KDFB 2WFWA 3CPFA 4HJ9A 4TVAB 2C35B 4A3LG 4YY3L 2VQEL 4OWTB 1EYGA 4LF5L 4IFDJ 1N32Q 4IPHA 2K50A 4HJ5A 2ALYB 3PUWA 1SRUA 1HNZL 1IXRA 1VQ4A 3S14H 4GKJL 4JI6Q 2KBNA 4X66Q 1OXSC 1Q1BA 1X3GA 2K5VA 4IPGA 1TWCH 3U58A 2NZOA 1LUZA 1MJCA 1WFQA 4LF6Q 3K8AA 3J80i 4LF8Q 1VQ5A 3PIOA 4DV6L 4IO9A 1VQPA 3VDYA 4JCVE 3KDFA 4JI8L 3UDIA 1N32L 3D0FA 4L5RC 1JJ2A 4IPDA 2F4VL 2WB1G 5IYBG 1SR3A 1IBML 4BY1G 1Q86C 2R92G 2VUMG 2EIFA 2R93H 2OQKA 1EIFA 2Q2UA 1RIPA 2EQSA 3RLFA 2OTJA 3H15A 4OWXB 5IT9c 3MEFA 1AE2A 3U4VA 1L1OA 3HOVH 4R4QA 1YHBA 4UP9A 4R1JA 1HZ9A 2JA8H 4LFAQ 3M9BA 1VQAA 2VQFL 3NEMA 3GD7A 5LMNL 1PHJA 1KD1C 2F4VQ 2VW9A 3PO3H 1FVIA 2Q2HA 1MIUA 1NMFA 1VQBA 3ULLA 2JE6I 3J81i 1HJPA 2VS1A 3S16H 2MO1A 2D0PA 4JYAQ 3B6YA 1YHQA 2WAQE 5EAYA 5M3FG 5DLQE 3UDFA 4KLKA 2UU9L 3HKZG 4NPSA 3BJUA 2JEAI 3T1HQ 4C3IH 5M3FH 2UUCQ 5M5XH 4LFBL 4TQUS 2CWPA 5IYCH 1XMOL 2UUBL 3M7NA 1VQGA 3CCVA 3CPWA 3GTPH 4GN3B 1KIXA 4DV4Q 3CCJA 1Y1WG 1HNXL 3I4NG 1UE1A 3K80C 4LUZA 2K4KA 5IWAL 1L0WA 4DR5L 2AHOB 3ULJA 1N34L 2ASBA 1XNQL 1CKNB 1RL2A 4JI8Q 2KCMA 1X65A 2FXQA 4X6AH 3KYHC 3CCUA 1VCIA 3OTOL 3L0OA 3KLWA 2WP8J 2UXBQ 4DV4L 1YIJA 4R4CA 4IPCA 1K3RA 1XMQL 2AMCB 1Q12A 2N8NA 2DGYA 1NE3A 2NZHA 4QGUA 4DR5Q 4A3EG 3GTQH 4A75A 3A5UA 4IJHA 3TQYA 1HH2P 1X3EA 1EFWA 4JI2Q 4R4TA 4DR2L 1SN8A 1NMGA 3G4SA 1T9HA 2QGQA 3NENA 3F2CA 1TWAH 2GN5A 3CP0A 1M1KC 1X56A 3UDGA 4X62L 3K7AH 2ZJPA 4HJ7A 4DNIA 4JYAL 2JA8G 5M3MG 4IFDG 1I94L 3PO3G 4DR1L 3S1MH 4OWWB 2E5LL 1NBWA 4YWMA 3E9HA 2KCTA 1YZ6A 4AQYL 1VS0A 2UU9Q 4POGA 4A76A 1FL0A 1EQRA 3GDEA 4A3CH 1TXYA 3CW2C 5IYDH 2R7ZH 1XJVA 2IHEA 1XPOA 1W2BA 2JA6G 5IYCG 1XMOQ 4DR4Q 1PH8A 4NXMQ 1VQFA 5FLXc 5H1SE 4DPGA 4A4IA 4X65Q 2VY3A 4JI7L 1A63A 2I0QA 1HNXQ 1I3QH 4YHHL 4WJ3M 1GM5A 2JJQA 3J81j 1HR0W 1FGUA 2JA5G 2MO0A 5C4XH 4BBRH 3S17H 1AE3A 4DV1L 4DR7Q 4IFDI 2UXCQ 2AWOA 2WAQG 5C44H 1Z47A 4B3ML 2MFIA 1HZCA 4POFA 4R4OA 4YY3Q 3HOVG 3KJOA 1EWIA 2VL6A 5HY6A 4GOPA 4NXML 1QZHA 4GKKL 5C44G 2HHHQ 4IJLA 1N36L 1IL2A 1Q8KA 1QUQB 4LF6L 4DR6Q 1JJCB 3KJPA 5GROA 2VNUD 4GN4B 4GN5A 3CC4A 3ZJYC 4UP8A 3JC66 1WCMH 4K0KQ 4APVA 1YI2A 2I5LX 4DAYB 1M90C 1I6HH 3ER0A 2IY5B 1PH3A 3M4QA 2EXDA 2H5XA 4GNXC 3OW2A 3H3VH 4LUOA 1Y1VH 4DUYL 4LNQA 3FHWA 2RCNA 3AQQA 4BBSH 2KENA 3ERSX 5M5YH 1I94Q 1IBLQ 1PH7A 4A3JH 4LF9L 4A3FH 3E9IA 3DLLA 1SFOH 1KL9A 4HIOA 3HOUH 1A0IA 3ICEA 3CMAA 2B3GA 5LMNQ 5IP9H 1FJGL 3I4NH 4BXXH 5JJLA 1U0LA 1X3FA 2F3IA 3H0GG 1J6QA 5FJ8H 2DUDA 2YU9H 2JA7H 4UP7A 3KF8B 4A3LH 2R7FA 3PV0A 4FDBA 2ES2A 4JI7Q 3EN2A 2E2JH 3CCLA 3MXNB 1TWHH 4DV5Q 5C3EH 4BA1I 3F8TA 4C2MH 3UE1A 1G6PA 1KXLA 1VQ6A 1CSPA 2Y0SG 4B3TQ 4JBMA 2RHQB 3HFZB 3BU2A 3ULPA 4JI5Q 4GS3A 2UUCL 3HOYG 2A1AA 1C9OA 4PZ7A 3PUVA 5GAGC 4HJ8A 1NY4A 1B70B 2CQOA 2A19A 4DV2L 2E8GA 2YTYA 4QY7A 2UXDL 2NVTH 2HHHL 4P73A 4DUZQ 1PH2A 2D62A 3Q8DA 3BZCA 1X6OA 5HGQA 2VUMH 1S3OA 1XNRL 2LXKA 1CUKA 1UE6A 1BBWA 3AEVA 1PVOA 2BH2A 1YNXA 2ID0A 4LF5Q 4PZ6A 3HOWH 1B7YB 5IYBH 1NTGA 1OXTA 3STBC 3OTOQ 2PNHA 4EQ5A 2QA4A 1JMCA 2UXDQ 4MTNA 4O0AA 3AFQA 2ZTDA 3UDXA 5IYDG 3GTOH 4DUYQ 4A3CG 2UXBL 3RR5A 4GLXA 4MNOA 1L1OC 1XMQQ 2JK8A 4J15A 1IBLL 3J7A5 1OTCA 1YJWA 1VQ9A 5GQOA 1Q7YC 1YJ9A 2K52A 4JBJA 3RLNA 5BR8L 3I56A 1KC8C 3CD6A 3CAMA 1FJGQ 1KRTA 5K36G 4BA2I 2R6GA 2ZM6Q 2N78A 3LGJA 2ZTCA 5FJ8G 1SMXA 4LUVA 4DK6C 1GO3E 3TS0A 2WB1E 4AYBE 4BY7G 4XTCS 1VQJA 4BXXG 1YEZA 2Z0SA 2YV5A 5C3EG 3NELA 4DV5L 4DR1Q 4LF4L 2IT1A 3F2BA 1VQLA 2PMZE 4O2DA 1WOCA 1O7IA 2IHFA 3HOXG 2CFMA 3CCQA 3PGZA 4JI1L 3W5OA 4AQYQ 4B3SL 1CKNA 1BBUA 2NN6I 4B3TL 2JA7G 2CKZB 3RZOH 1OXVA 1HR0Q 1PH5A 1ASYA 5ELOA 3S2DH 4DK3C 2R92H 1CSQA 3W1BA 1Q1EA 4A3DG 1YBYA 1VQDA 3K0XA 2NVQH 1BVSA 2I5HA 4OO1G 2Y0SE 3RNUA 4LFCL 1HZBA 1E1OA 2MNAA 2KHJA 4YCUA 1XNRQ 5GAHC 4A3BH 2NN6G 4B3SQ 2PI2A 1VQNA 5AJ3Q 3HOXH 4A3IG 4JI4L 3AYHB 4JC0A 4OONA 3W1GA 2GVAA 3T1HL 1K0RA 2AWNA 1YITA 4X64Q 3KF6A 3CXCA 2OCEA 4QL5A 1K73C 4L5SA 4A3GH 4LFCQ 3U4ZA 4QQBX 4LF7Q 4NXNQ 1BKBA 1D8LA 1WYDA 2ZTEA 2RHSB 5FLMH 2KHIA 3IRBA 3G6EA 4OXPA 2B63H 1GVPA 2Q2IA 2YTXA 4YWKA 4DV0Q 4A3FG 4A3BG 1MJEA 5BR8Q 2NVXH 5M3MH 2CCZA 4Y52H 1PH4A 4GOPC 1LYLA 3CF5A 3GO5A 2B63G 1HNZQ 1VQ7A 3KF6B 5LMNW 1K8AC 1JB7A 3OYYA 4X66L 5C0XI 4GNXB 3D31A 1KRSA 1EQQA 2RF4A 4A3KH 3TREA 4LF7L 2R7ZG 2LXJA 1LTLA 4B3RQ 4Y7NH 1HNWQ 2IX1A 4JI3L 2JA6H 4HIMA 4DV6Q 4LF9Q 1PYSB 2HIXA 4GLAC 4MZ9A 3GTMH 4JI1Q 3M85A 4DR2Q 3PIPA 4BY7H 3CMEA 1YJNA 1IBMQ 3KFUA 2UUAL 5C0XJ 4GOPB 3FKIG 3RN2A 1LM0A 4JV5Q 2E2HH 4ALPA 1U5KA 2ZJQA 2A8VA 1E1TA 1B8AA 4L5TA 3L7ZC 4X62Q 2YTVA 4GNXA 2B29A 3I4MH 4B3RL 3S1NH 1QUQA 3F2DA 3S2HH 2OWOA 1Q46A 3JAMi 4A3DH 3PF4A 5C4XG 4BBRG 2BH8A 4YCWA 2JA5H 4JI0L 1EOVA 4QIWE 4QJFA 5AJ3L 3E0EA 2BA1A 3U50C 4DR3L 2Q2TA 4JI4Q 1Y14B 5IP7H 1DGSA 1N33Q 1CKMA 1E7ZA 3EBEA 2ATWA 4AYBG 1JJGA 2OQ0A 1I5FA 2F52A 1KAWA 4P75A 4DV2Q 1TWGH 4JOIC 1WCMG 1N9WA 5ELNA 4EX5A 4A93G 1QVCA 4DUZL 1MKHA 1VQEA 3TS2A 4RG1A 4DV7L 1GKHA 4HJAA 4YHHQ 3TEHB 3CC7A 1XPRA 4GLVB 4PG3A 4C3JH 5GADC 1C7YA 4DR7L 2YYZA 4DV0L 2E2IH 2UXCL 3PCOB 4DR3Q 3S1QH 4A93H 1QVGA 4B3MQ 4XIGS 3G71A 3I7FA 3J81c 2ZJRA 1N33L 4LFBQ 1V43A 3AFPA 1PH6A 1JE5A 2UUBQ 1S40A 1X55A 3A5ZB 1XTDA 5JJIA 2I5MX 1N36Q 4P71A 4DV3L 3RN5A 4DV7Q 1HNWL 4DR6L 1L1OB 3J7ZC 3GTLH 1N34Q 3CC2A 2VZAA 1K83H 5M5WH 1XNQQ 3L2PA 1VQIA 1OXXK 2HQLA 1S72A 2HT1A 1Q81C 4ME3A 3SGIA 2VQEQ 3HOZG 4K0KL 3K7UC 4JOIA 4UY8C 2MQHA 2UUAQ 3FKIH 4OX9L 2ZM6L 4GKJQ 4JV5L 4KHPQ 1A62A 1YVCA 4DV3Q 3PUYA 2N3SA 1K9MC 3HOZH 1A8VA 2Z6KC 4YWLA 4JG2A 1E22A 3M4PA 2PI2E 4NB3A 2PQAB 1TWFH 3F1ZA 3S24A 3KOJA 3CCMA 3GTGH 3RZDH 4OO1I 1ASZA 3I4MG 1HR0L 3NBHB 5FLMG 5C4JH 1SLJA 1Y1WH 3HOYH 4OX9Q 1YHAA 1V1QA 3JAMc 5LMUQ 5JJKA 4A3GG 1IZ6A 1NJIC 3I4OA 4DKAC 1EUJA 3J80c 1VQOA 1VQMA 1VQ8A 4IOAA 1SE8A 5IY0A 3PUXA 2E5LQ 1GD7A 5IP7G 1X54A 3PO2H 1Q82C 3M4OH 1PH1A 2PQAA 4P74A 2Z6KA 1X9NA 2VQFQ 2GVBA 1N8RC 1AH9A 3A0JA 3H0GH 4JBKA 1G51A 1E24A 2K5HA 3I2ZA 3PUZA 5LMUL 1WI5A 4IOCA 4DR4L 1Z9FA 4LWCA 2K5NA 3HOUG 1UE5A 1D7QA 3STBD 5IP9G 3CQZH 4NXNL 1P16A 3EIVA 1G291 1UE7A 2L15A 5E7NA 4HIDA 1QVFA 2N49A 4DAMA 1CKOA 1W3SA 4PMWA 3RLOA 4BBSG 4A3MH 2R7DA 5IE8A 3T1YQ 1P8LA 4LW1A 4GKKQ 4KHPL 5JEAJ 3A74A 2XTIA 1V9PA 5IWAQ 4JI3Q 2HIVA 4P72A 5JEAG 1L2FA 4HIKA 4H02A 2IX0A 4A3KG 5J3BA 1VQCA 4RMFA 2CWAA 3T1YL 4JI6L 5GAEC 1PV4A 1WJJA 2BA0A 1PYBA 4PZ8A 4LF8L 4KI0A 3HKZE 3CCSA 3HOWG 4LF4Q 2V1CC 3PO2G 4KHZA 4A3EH 1EIYB
chains in the Genus database with same CATH superfamily
4JI2L 4JI0Q 3DM3A 1UWVA 2JA6B 4ZK9B 2XN9C 3PSIA 2Y0SB 3HP3A 2EZVA 4AIMA 4QCLA 2R93G 5C0XG 3G48A 4FF1A 3UE0A 1A3VA 3HOYB 3WWVA 1VQKA 2L1BA 2HCCA 3EJIA 2EYJA 3PMFA 1LT3D 2PYKA 1E2WA 1J5EL 1PRTF 3CCRA 4JBWA 5C5LA 1Y1WB 1IYJB 1VQHA 3EVQA 1EWHA 2WFWA 4B08A 4HJ9A 1Y69U 4YY3L 4OWTB 4PNYA 1QILA 4HJ5A 4XXEA 1JB3A 1X3GA 5C3WA 2L4NA 1MJCA 2LS01 2Z4IA 1EFID 3KDFA 3OMGA 1SYFA 1TWHB 3D0FA 1RTOA 5ELCA 1JJ2A 5IYBG 4BY1G 1Q86C 1XYIA 4KKUA 1K0SA 2CQAA 1STGA 1RIPA 3RLFA 3IL8A 1BCPC 3H15A 4OWXB 5IT9c 1F2YA 4UP9A 1GUTA 5HURA 1KTKA 1B3AA 3M9BA 5LMNL 3NEMA 2F4VQ 5C0XH 3I4MB 4HSVA 1NMFA 3DWAA 3RUZA 5C4HA 1HJPA 3B6YA 1R4QB 3NPPA 2JA5B 1SE2A 5DLQE 1W6JA 3UDFA 4NPSA 2JEAI 4FP5D 4C3IH 5M3FH 4A3EB 2CWPA 1TS3A 3CCVA 4GN3B 3PO2B 3CCJA 1UE1A 1CQFA 1L0WA 4J6HA 1MSHA 3CRKC 3J80L 1XNQL 4BBSB 3D6WA 1DYQA 3K0YA 3KYHC 3D4DA 3OTOL 3H91A 3L0OA 3T13A 2WP8J 2EXZA 4DV4L 3Q22A 1AEXA 4IPCA 1K3RA 2KCNA 1Q12A 3W3AA 4A75A 3A5UA 4KJOA 4IJHA 1G8ZD 1C4QA 1X3EA 1TR5A 1SN8A 3V96A 1EY9A 1O80A 1ESFA 3NENA 2E2DC 3L3OC 4RA8A 3UDGA 2ZJPA 4KN4C 4K5WA 4OWWB 4YWMA 1TWCB 3E9HA 1PRTD 1YZ6A 5C4ZA 3GDEA 5IYDH 3CW2C 3Q0AA 1RJTA 2R7ZH 2NBFA 1TVXA 3I91A 1K8OA 4DR4Q 4NXMQ 1UUPA 4DPGA 4X65Q 4JI7L 2NTTA 2I0QA 4CJ2C 1I3QH 3SE0A 3M3YB 4DR7Q 1AE3A 1AW7A 1BDOA 3I8ZA 4ZLTF 1Z47A 3BYYB 3Q24A 1JICA 3HOVG 3KJOA 1EY5A 2K5DA 1PRTC 4GKKL 3J80E 3D4RA 4JW0A 5C44G 4IJLA 2HHHQ 3TP8A 1Q8KA 1HRJA 1JJCB 2VNUD 4GN5A 1VMPA 1AFPA 4B9WA 5TSSA 2IY5B 4WRDA 4F8MA 4GNXC 2B8GA 1LV9A 4LUOA 3ND8A 4BBSH 3ERSX 4YIJA 5M5YH 1I94Q 5I6WA 3TN2A 1H9SA 4LF9L 4XDXA 4A3FH 1CQVA 1KL9A 5ELFA 3ICEA 3CMAA 4BXXH 4DFAA 3H0GG 1SMYC 5FOBB 3MWYW 3AB9A 3KF8B 5IGEA 2R7FA 3W2DA 4TKOB 4C2MH 1G6PA 1YNND 1KXLA 4JBMA 3JAML 3R2TA 3ULPA 3HOYG 5J22A 4HJ8A 2SNMA 2CQOA 2Z4HA 3SK4A 2UXDL 2HHHL 4K5VA 4DUZQ 3BZCA 1X6OA 5HGQA 4QIWB 5F2DA 2VUMH 5D65A 1CUKA 2EYMA 5DAUA 1DXMA 5BN4A 3C46A 2SOBA 3HRZC 4ZQ3A 3HOZB 1KLGD 1LTTD 2ID0A 4IQZA 3S17B 1ET9A 1OXTA 4CDCC 1S5BD 3K5OA 4NW2A 1PTOH 4MTNA 1D6EC 2ZTDA 3NE5B 1CK1A 1SYCA 1SDFA 2F0KA 1XMQQ 4J15A 1IBLL 3J7A5 4KN7C 1VQ9A 2TSSA 1Q7YC 2R61A 4JBJA 1TS4A 3I56A 1YJ9A 1KC8C 4K6LA 1FJGQ 1KRTA 2A6EC 1G2TA 5C4XB 2Q8IB 5FJ8G 4C3JB 4DK6C 3TS0A 4AYBE 2E2IB 4XTCS 4ZKBB 1VQJA 1A3TA 4K8IA 2F0QA 2Z0SA 4IURA 5C3EG 4DR1Q 2NN6H 3F2BA 1K28A 4CKEA 1WOCA 2IHFA 1EY8A 4NP5A 3W5OA 2JA7G 1EY4A 2NN6I 3K7AB 1QNUA 2CKZB 1HR0Q 5ELOA 4DK3C 3C1EA 1BNZA 1Q1EA 4A3DG 3K0XA 1SE4A 1EOTA 2RSNA 4OO1G 3UI2A 5IOCA 2Y0SE 1GUGA 1I4GA 3HOXH 4JC0A 3W1GA 1YITA 4X64Q 3WDNA 4QF4A 2OCEA 1K73C 4Q0FA 4H0LC 4LFCQ 3FDTA 5G3LD 1B9MA 3K5MA 3U4ZA 1D8LA 5FLMH 3IRBA 2B63H 1TT2A 3H94A 1MJEA 2CCZA 1DJRD 2VB3X 3GO5A 5JVG3 1HPCA 1HNZQ 3KF6B 4ODGA 1K8AC 5C0XI 3D31A 1EU4A 1STEA 2E76C 4Y7NH 2IX1A 4JI3L 4DXFA 1NUCA 4HIMA 4DNTB 3M85A 2UUAL 1X32A 1O7LA 4UAIA 5T1IA 2ZJQA 1SYGA 4XYOA 1E1TA 3I4MH 2E74C 4B3RL 1CI3M 2OWOA 4RFBA 4ME5A 1PYWD 4BBRG 2BH8A 2JA5H 1ZEQX 5AJ3L 2Q2TA 3E0EA 4DR3L 2AUJD 3I3CA 1Y14B 2C9OA 2F0DA 1JJGA 2NWGA 1NSNS 1PZID 1LLRD 4A93G 1MKHA 1VQEA 4RG1A 1GKHA 1QOHA 3TEHB 3QOLA 1XPRA 3TP7A 1H9SB 4DR7L 4DV0L 3JAME 3PCOB 4A93H 4KK7A 2ZJRA 1IW7C 1V43A 3AFPA 2NUCA 5K36H 1HCZA 1WTXA 2I5MX 4P71A 4M1UB 3C2PA 3GTLH 4FNFA 4KD4A 1N34Q 2B2TC 1K83H 1LO5D 1OXXK 1A2TA 1RKNA 4JOIA 3OWFA 1ET6A 1WVLA 2JP1A 1TKWB 2G9DA 2K32A 4DV3Q 2K01A 1K9MC 3NUCA 4DNRB 4LAAA 4JG2A 1E22A 1JE4A 1GUOA 1MHWC 2PQAB 1JWSD 1CT1D 4OO1I 1ASZA 5FLMG 5C4JH 1Y1WH 5EKKA 4OX9Q 1T5XD 1V1QA 4RHRA 3RMHA 4DKAC 4IOAA 2B2WC 2KEEA 3SK8A 1X54A 3M4OH 4L6TB 4P74A 3E3XA 2VQFQ 3T51B 1MD2D 2A6HD 3G7LA 2E2JB 4JBKA 3I2ZA 2K5HA 2K1BA 5A35A 2A69D 4ULLA 3CQZH 5IP9G 4RHSA 3EIVA 5E7NA 4N8X1 1JCKB 4X3KA 1LTGD 3NTIA 1GHJA 3RLOA 1U9RA 3PQIA 3IAYA 4DU9A 2R7DA 5EBDA 5IE8A 4LW1A 2L11A 3QB3A 5JEAJ 4KY5A 4I65A 2V4DA 1ICWA 1KDBA 3BZDB 1Q8IA 2FJ2A 1HUMA 3NQTA 4P72A 2JN4A 4GZYC 2IX0A 5EPKA 3BS1A 2H1EA 5J3BA 4FF3A 3T1YL 2F0MA 4JI6L 4CKBA 2MP1A 4K8JA 1WJJA 4HCEA 3PO3B 2BA0A 1IYVA 2EYFA 2F0EA 2K7VA 4LF4Q 2V1CC 2F0WA 4A3EH 3KK7A 2OTJA 1EIYB 1R9TH 1UAPA 1GOZA 4UHVA 1PA6A 1EU3A 3GTJH 4IUVA 2K75A 4LK1C 2N55A 1J5EQ 2OTLA 1E3PA 1XPUA 2JQOA 4KY7A 3S15H 5IODA 1QB5D 1HQMC 4HN7A 1QNKA 2EY1A 2F1MA 2JEBI 4UPAA 1IBKQ 4G7OC 3NWSA 2VUMB 3PF5A 1SAPA 4FXKC 4XQNA 4L5QA 4A3BB 1H95A 5J39A 4X65L 3S1RH 2RDHA 3CCEA 1PFSA 1WTOA 5I9OA 2XIWA 2LSSA 4DV1Q 3KDFB 5EPJA 4TVAB 2C35B 1N32Q 4LF5L 1SYEA 4IPHA 3S14H 5DNFA 1HNZL 1EZ6A 1VQ4A 4JI6Q 1Q1BA 2K5VA 3P20A 1TWCH 4IPGA 1Q90A 2NZOA 1I6HB 3K8AA 4DV6L 5CV7A 5D3IB 3UDIA 4L5RC 3HKZB 3SEBA 2F4VL 2DJFC 2KUMA 1IBML 1I3QB 2VUMG 3MAQA 2R93H 2IL8A 4H7BA 3BG3A 3X3MA 1O7ZA 5CYUA 3FPPA 3HOVH 4R4QA 3DEOA 4R1JA 2F0PA 1KD1C 1EY7A 5C6AA 1FVIA 3PO3H 2LY7A 2L9HA 3J81i 2MO1A 2D0PA 4JYAQ 1DOKA 2WAQE 5CC4A 3I73A 4C3IG 5M3FG 1ML0D 2UU9L 4X3SA 5M5XH 2UUBL 4RGNA 3M7NA 3MEHA 2BE5C 4FXGC 1KIXA 5KNCA 2K4KA 4RGOS 3H0GB 1N34L 5KEEA 1FNVA 2ASBA 2OEOA 2NZ1D 2FXQA 2F4IA 3TP6A 5DM63 3KLWA 4A3JB 2K5WA 4UDUC 4ZAIA 2Z8LA 2N8NA 4OIJA 2DGYA 2NZHA 3GV3A 4A3EG 4PMBA 3EROA 4FXDA 1HH2P 1EFWA 4JI2Q 4DR2L 4AYBB 1C48A 2ICEC 2QGQA 3CP0A 1M1KC 1X56A 4X62L 1WTWA 5C44B 5M3MG 4IFDG 4DR1L 3S1MH 4I7AA 1FR3A 2UU9Q 4POGA 4IUPA 4A3CH 1TXYA 2EJGC 4OEMB 1DONA 2IHEA 5D3DA 1XPOA 1XMOQ 1PH8A 1VQFA 5FLXc 4KMUC 4C1NK 4WFN3 4ILWA 4YHHL 4WJ3M 2KHSA 5C4XH 2Z6BA 4CHTB 1SBBB 4BWGB 4YY3Q 3OIQA 5HY6A 1EL0A 1PMRA 4LF6L 5GROA 2RQXA 5DEHA 3ZJYC 2E2HB 1TY0A 2FFKB 1YI2A 3U9SA 1M90C 3ER0A 1IHZA 1TY2A 2H5XA 3OW2A 2N88A 1Y1VH 3FHWA 2MJ8A 3DEPA 1SNQA 3DLLA 3HOUH 1K3BC 4BS9A 1A0IA 5JJLA 1HXYD 1LACA 3M4OB 5FJ8H 2DUDA 2JA7H 1T5EA 3DWQA 3PV0A 2ES2A 2E2JH 3CCLA 3MXNB 1TWHH 4DV5Q 5C3EH 1A15A 1CSPA 1S5ED 4B3TQ 2RHQB 2RKSA 1BCPD 4F87A 2UUCL 1BR9A 5CV8A 1B70B 4DV2L 1M4VA 3S1MB 2PQEA 3VR3A 2NVXB 5JAVA 4CGYB 2D62A 3Q8DA 1S3OA 1XNRL 2MHVA 4C3JG 3EA6A 5A2QL 1GUWA 1SYBA 2DNCA 3HOWH 2OF1A 5JPNC 3STBC 1JMCA 3OTOQ 4MHEA 4L8JA 3GTOH 3UDXA 1KNEA 1L1OC 4CDEC 2JK8A 1F9QA 4N9TA 5BR8L 5EKIA 1VF5C 2F0VA 1CZWA 3CAMA 3DXJC 2AUKA 2EY6A 3DM1A 2WACA 3LGJA 1GO3E 2WB1E 2EJMA 2PZUA 3VR4A 1KDCA 5CR3A 4BXXG 4K14A 3NELA 2IT1A 4ID6A 2ENBA 5E4XA 2K5QA 3CCQA 4AQYQ 4B3TL 4JI1L 1BBUA 5EKLA 1OXVA 1ASYA 3NHHA 2R92H 5J1ZA 1LT6D 2I5HA 4DAVA 4LFCL 1D5XC 1E1OA 4L63B 3HOUB 2RBMA 1PTOD 4U673 1PTOF 1D1IA 4YCUA 1XNRQ 1AZQA 4A3BH 5ISRA 2PI2A 3KUPA 2PO4A 3V05A 1EYDA 2GVAA 1FNUA 2XNAC 5FKAC 5K5PA 4L5SA 4A3GH 3OIPA 4LF7Q 3SVMA 5IT9E 4X3TA 3G6EA 4OXPA 2YTXA 4YWKA 2L12A 4Q5VA 4RAUC 5BR8Q 2NVXH 2F0SA 1PH4A 4ZCKA 5JJZA 3CF5A 5LMNW 2AQ1B 2R7ZG 1HNWQ 4B3RQ 3NBIA 2JA6H 3PIP3 2GA4B 4MZ9A 1V1OA 2K28A 3GTMH 3PIPA 3KFUA 1EIHA 1LT4D 5C0XJ 4C1NI 5KRUA 4LMQD 2IJ0A 5AFWA 4X62Q 3QWNA 2YTVA 3J7AV 2PPBC 2KJXA 4YCWA 1EOVA 2YU9B 5JVH3 1II3A 1N33Q 1CKMA 3C3LA 3I4NB 5ELNA 4XYQA 4DUZL 4A3MB 2RSOA 1CA5A 1ICFB 4H44C 1TQOA 4YHHQ 1SNDA 4GLVB 4PG3A 3TP5A 2UXCL 2BE5D 4DR3Q 3MTSA 3MXUA 1QVGA 3G71A 3I7FA 4IFDH 2A68D 5M9OA 2XSCA 2IX3A 1JE5A 3HOXB 2G5DA 1X55A 4BBRB 1JQYD 1N36Q 4DV3L 1J8IA 1HNWL 4DR6L 2BDNA 5CBEE 2EYPA 2KCCA 2C5CA 5IIFA 5M5WH 2Q8RE 1XNQQ 5IGFA 2HT1A 1S72A 5CORA 3SGIA 3A7AB 1KAAA 2MQHA 3FKIH 4OX9L 2ZM6L 1L0YB 4RKBA 1YVCA 2B39A 3PUYA 3SXHA 1TIID 3HOZH 1VF7A 5LL6X 1O78A 3KBGA 1TWFH 3F1ZA 3KOJA 3CCMA 3H6MA 3GTGH 3NBHB 4V0BA 1D5ZC 2QF7A 3NQIA 3JAMc 1IZ6A 1NJIC 1VQMA 2B2TA 3J80c 2K6AA 2R3ZA 3NTKA 1NNXA 5ELDA 5IP7G 5I6YA 1Q82C 1PH1A 2PQAA 5CV5A 2GVBA 5KNBA 1Z7TA 1WI5A 1HFNA 1S5FD 3TBIB 1UE5A 1D7QA 4K5XA 3STBD 1UE7A 2L15A 1QVFA 1X3QA 2N49A 4DAMA 1STYA 3S1NB 1H9JA 4CBVA 3NSWA 4A3MH 1P8LA 1BF4A 4GKKQ 4KHPL 1LTBD 4V190 2XTIA 3VYSA 3H3VC 1VMCA 3K6OA 3NK9A 4FVMA 5JEAG 1AZPA 4X3UA 4A3KG 2Z1CA 3QO2A 2EJFC 3IKJA 2CWAA 3X3NA 2IW3A 3I72A 1SXTA 4PZ8A 3CCSA 4J8QA 1KDAA 2R7ZB 1PH9A 2QW7A 2NB0A 3J81L 1UEBA 3S16B 1IBKL 2J4XA 2EPBA 1HZAA 3BZKA 1Y8PB 2FMCA 4R4IA 4BY1H 3K81C 2XGTA 2QEXA 3M3YH 3OWEB 3V2TA 3FRPB 3GTGB 4A3JG 1I50H 1RODA 3FEWX 1SJHD 1FNWA 3I90A 3S2HB 2PCFB 1G6ZA 5FO8B 1WTQA 1QZGA 3I55A 4RH6A 2D0OA 4C3HH 4WJ4A 3RZDB 1YNNC 1EYAA 4KTAA 3HOWB 3TRZA 3HKSA 2NVYH 3FP9A 2P5ZX 2K14A 3MHBA 1C0AA 3QIAA 1LABA 1PZKD 2DY8A 4TRDA 3CPFA 2VQEL 4IFDJ 2K50A 2ALYB 1DOLA 1SRUA 1U4RA 4GKJL 4C56C 4ZYSA 2KBNA 4X66Q 1OXSC 3CRLC 2DN8A 3VA7A 3GTQB 3U58A 2ZXRA 4FF2A 1LUZA 4LF6Q 5DM73 3VR5A 4IO9A 1IW7D 4KHVA 2MPMA 1VQPA 1ZYRD 2ZXOA 5C5MA 1N32L 4IPDA 1SR3A 2R92G 2EIFA 3BYTB 1TS5A 2OQKA 1EIFA 4C2MB 4RGMA 2Q2UA 2EQSA 3SHLA 3MEFA 3H09A 5CV6A 5D14A 1V8QA 1NAPA 1HZ9A 4KJNA 5IGGA 2JA8H 1VQAA 1PFNA 2VQFL 1PHJA 2VW9A 2WKCA 2O5IC 1VQBA 3K57A 2PZWA 4ABNA 1JC7A 1ZYRC 5CV4A 5I9PA 2MGSA 5EAYA 2A73B 4KLKA 4FF4A 4R9WA 1H9MA 2UUCQ 2FMMA 2M2LA 2EOTA 1RD9D 5IYCH 4KKSA 1GXDC 3Q6SA 3I4NG 1WCMB 1XTCD 4LUZA 5IWAL 1HTLD 2CH4A 1PTOB 1EY6A 4IUNA 1RL2A 4F7XA 1X65A 2HDLA 1VCIA 1SFOB 1S4ZA 3S2DB 1NE3A 2VB2X 4DR5Q 4DK1A 1ENCA 2DJGC 2EDGA 3HS0C 3R2IA 3G4SA 1H9RA 1WTVA 3K7AH 2JA8G 1F9SA 3IFTA 1I94L 3PO3G 5KNDA 4HMIA 4IUQA 2E5LL 1NBWA 2NVTB 3F2UA 2KCTA 4AQYL 1CM9A 4A76A 1FL0A 1XJVA 1W2BA 2Q8TA 1L0XB 1Y8OB 1WD0A 4U68A 5ELBA 3E6ZX 2HD3A 1A63A 4IUUA 3HEJA 4EQPA 3GTJB 1A2UA 2JJQA 2JA5G 2MO0A 4BBRH 1EY0A 1QCBD 2L0CA 4DV1L 2WAQG 4B3ML 2MFIA 4POFA 4R4OA 3SK5A 2A69C 2B63B 2VL6A 4GOPA 3AMUA 1QJOA 1BO0A 2FHTA 5IGBA 5M5XB 1IL2A 1QUQB 4OIKA 1KNAA 3KJPA 2LKVA 1SMYD 3WOEA 1E2VA 4UP8A 2QILA 3JC66 4APVA 5I4DA 4CDDC 4Z9CB 5T1GA 3T53B 1PH3A 2EXDA 1D2BA 3WOFA 1MI2A 3HZXA 4LNQA 2RCNA 2D2CC 1CHPD 2KENA 1IBLQ 1PH7A 5KYLA 4A3JH 3GTPB 2NVQB 1SFOH 1F9RA 3OPOA 1PZJD 2HQEA 2B3GA 5IP9H 1FJGL 1U0LA 1J6QA 1W6KA 1WTPA 5I2YA 4UP7A 4LJZC 4OL7A 1CFMA 4A3LH 3LNNA 1K8MA 4FDBA 4PV1C 4JI7Q 3EN2A 3NP8A 3I4LA 4BA1I 3F8TA 4RCOA 4ZUIA 3N52A 4TSSA 1NR2A 5EJWA 4CJ1B 3HFZB 1BCPF 2ICIA 1EIGA 2KA7A 2A1AA 5GAGC 1KABA 4A3FB 1NY4A 2E8GA 2YTYA 4QY7A 2NVTH 3MA2B 4P73A 1JOOA 1U4MA 4C3IB 5M3FB 1IL8A 2A6HC 3K58A 1UE6A 3VYTA 3VYUA 2BH2A 3T4AC 1YNXA 3MXGA 3GTLB 5IYBH 1NTGA 4HTHA 2PNHA 3AFQA 4A3CG 2UXBL 1GUSA 3OW7A 2FINB 4GLXA 3ERQA 4MNOA 5EQ0A 1YJWA 1HA5A 5GQOA 3CD6A 4IUTA 1DOMA 2JSOA 2R6GA 2ZM6Q 3T16A 3ONAB 5C4JB 1YEZA 2YV5A 4LF4L 4N9PA 1VQLA 1LTRD 1TS2A 2PMZE 3R3OA 1O7IA 4B3SL 3HOXG 2CFMA 2OT2A 3MFYA 5E1FA 1AP0A 3G6JB 1PH5A 1YNJC 5L37A 1YBYA 1CZGA 1VQDA 5BN3A 1I4PA 1STBA 1HZBA 4JVZA 4CKCA 2QDLA 2KHJA 4HR7B 5GAHC 1HQRD 3OHXC 2DNEA 2RA4A 5AJ3Q 1E2ZA 4A3IG 2EY2A 4EVOA 1ONLA 2XRQD 1K0RA 2AWNA 2B2VC 4Y7NB 3CXCA 4F88A 3D3RA 1ZKOA 4QQBX 4NXNQ 1XX8A 3M4YA 3BVGA 1BKBA 2RHSB 2O2LD 2BDOA 1GVPA 2CH4W 2K05A 4DV0Q 3M7GA 5M3MH 4Y52H 3SK6A 1LYLA 5CGKA 1F2MA 2B63G 2B8FA 4XT3B 4DAPA 4IALA 5HGTA 1VQ7A 1JB7A 1KRSA 3NXWA 4LF7L 3TREA 2LXJA 4DV6Q 1EWCA 1I4RA 2HIXA 4GLAC 4BY7H 3P7JA 1YJNA 1IBMQ 4H13C 2I07B 5M5YB 3S9WA 2EE1A 4QMGA 2A8VA 2PW5A 5LHY1 4GNXA 3O13A 3S1NH 5LL6S 2XWBB 1Q46A 4A3DH 4QB4A 1SE3A 3PF4A 1EEFD 5C4XG 4JI0L 4QIWE 4QJFA 2X6LA 2BA1A 2A5HA 1SNPA 1Y1VB 3S1RB 2KOLA 2QKIC 3DHQA 2CHBD 3OSOA 2OQ0A 3J7YW 4DV2Q 1TWGH 1CA6A 4JOIC 1WCMG 1N9WA 1K83B 1I4QA 3HGBA 2HUGA 3A56A 3CC7A 2PMZB 5GADC 1H9KA 2YYZA 3S1QH 5FLXL 4B3MQ 4XIGS 1N33L 4LFBQ 2UUBQ 2MUYA 1XTDA 5JJIA 3KF8A 4JK1C 4DV7Q 3RN5A 1L1OB 3MXNA 4NKLA 3J7ZC 1SSOA 3KBXA 3CC2A 1BXTA 2VZAA 4WORA 1V1PB 4OHJA 3L2PA 1VQIA 1HFGA 1X3PA 1Q81C 3A8KE 2VQEQ 1B53A 2UUAQ 4GKJQ 4KV6A 1I50B 1A62A 1A8VA 1B3QA 2CVRA 1TU2B 3I70A 1IYUA 2D9UA 3S24A 5CBAE 3RZDH 3I4MG 2NYZD 2SDFA 2X6GA 2H4OA 5E4WC 1FD7D 1STAA 5LMUQ 5JJKA 2PW7A 1VDZA 1VQOA 1EUJA 3P1HA 1VQ8A 3R8BA 2IWHA 2XWJB 1SE8A 3PUXA 1GD7A 3PO2H 4CDFC 2Z6KA 1AH9A 1Q3LA 3A0JA 1A3UA 1E24A 3PUZA 3GV6A 1G2SA 3NWTA 3GQBA 4IOCA 1Z9FA 2K5NA 3HOUG 1MBYA 2AQ2B 2M00A 3E5SA 1PXUA 1P16A 3QOJA 1G291 1D5MC 1LTID 4HIDA 5JEAH 1CKOA 1DM0B 3KLSX 4DK0A 1F77A 4PMWA 4BBSG 1JOKA 1PTOC 2EVBA 2I46A 3VA5A 1HUNA 2F3WA 3A74A 3S1QB 5IWAQ 3TMEA 1ESRA 1L2FA 4H02A 4RKLA 3NTHA 5EGTA 1U4PA 1VQCA 4RMFA 2WV6D 5GAEC 1RHPA 1PV4A 1CTMA 4LF8L 4KI0A 3HKZE 1KLUD 2JYOA 4R8NA 5EPLA 4DA2A 3PO2G 4FYDA 2LMCB 3LWEA 4YCVA 4A3IH 4AH6A 1SJED 4MN3A 3OOCA 1KQSA 3MC0B 2AKWB 4HCSA 4E6IA 3GTKH 3RZOB 1K8GA 4JPBW 1BCPB 1JR0D 1RDPD 3FVQA 5JOBA 4LFAL 3H3VI 1Y1VG 1EYCA 3J81E 2RVLA 4JI5L 1B2TA 2WB1B 4X64L 1JOQA 1KHIA 2G9HD 2JA9A 1JT8A 1LTAD 1A6XA 3A55A 4A93B 1SROA 1OO9B 1OXUA 4A3MG 2OXPA 1SYDA 3OMCA 1RF2D 4A3LG 1EYGA 2KEDA 3RD4A 3PUWA 1IXRA 3ITPA 2EYLA 1NCVA 2PNRC 1B1ZA 1WFQA 2K04A 3J80i 3MXPA 4LF8Q 1VQ5A 3PIOA 3BVZA 4XQJA 3VDYA 4JCVE 4JI8L 1XWEA 2PZTA 2WB1G 2D5DA 4O1NA 2B2UA 1WTRA 2SEBD 1G91A 3LX0A 4OELB 1ZXTA 1HHVA 2Z9HA 2B2UC 1SNCA 3P75A 1AE2A 3U4VA 1L1OA 1YHBA 2J0TD 3A8IE 3TZDA 4LFAQ 3GD7A 3CU7A 3KLSA 2Q2HA 4S3SA 1MIUA 3ULLA 2JE6I 2VS1A 3S16H 1YHQA 1TWFB 3QR8A 1B4OA 1MGSA 1PLFA 2HCIA 3BDOA 3HKZG 3BJUA 3T1HQ 3HOVB 3NBHA 4HEDA 4LFBL 2AQ3B 2BOSA 4TQUS 1XMOL 1VQGA 3D4WA 3CPWA 3GTPH 5M3MB 4ZKCB 4DV4Q 1Y1WG 1HNXL 3K80C 2F0GA 4DR5L 2AHOB 3ULJA 1D1KA 3GP7A 3CQZB 1CKNB 4JI8Q 3DMUA 1XXGA 4B9XA 2KCMA 5CMDA 4X6AH 3CCUA 4J1MA 5FO7B 1PFBA 2K03A 2UXBQ 2F0NA 4BY7B 1FGBD 2QCPX 4R4CA 1YIJA 2CW0C 4R8IA 1XMQL 2AMCB 4QGUA 3LWUA 3GTQH 2QDBA 3TQYA 4R4TA 1NMGA 2F0TA 4A3DB 5IT9L 1T9HA 4I7ZC 1Z6HA 1ENAA 3F2CA 1TWAH 2GN5A 1BBXC 1I4XA 4HJ7A 4DNIA 4JYAL 3A54A 4FO2A 3MFGA 2SNSA 4DGZA 3HG9A 1VS0A 1EQRA 2RDFA 3A7LA 1WD1A 4ZUJA 4RWSC 3S15B 2JA6G 5IYCG 1QWYA 5H1SE 3Q23A 4A4IA 2VY3A 4HMJA 1HNXQ 4DN4M 4QUCA 3PIO3 4MIUA 1GM5A 1B9NA 3J81j 1HR0W 1FGUA 3S17H 2WIIB 4IFDI 2UXCQ 4BY1B 4RCNA 2AWOA 5C44H 1I6VC 1HZCA 2JXMB 3ZYYX 1EWIA 1RCVD 1LTSD 4OO1H 4NXML 1QZHA 2EYOA 1ENFA 1N36L 1S5DD 4DR6Q 3VYRA 4GN4B 3CC4A 2A68C 3VR2A 4C3HB 1WCMH 4K0KQ 2L5TA 2I5LX 4DAYB 2B2WA 1I6HH 2RCFA 3M4QA 1EQTA 3H3VH 4DUYL 3S14B 3R93A 5KGUA 2EYHA 3AQQA 3TSSA 1B44D 5I2XA 3E9IA 3CHBD 5FK9C 1UEAB 4HIOA 5LMNQ 3I4NH 2WAQB 1X3FA 5EBCA 2F3IA 1BQQT 1RTNA 1J9OA 2YU9H 1NR4A 1STHA 1PRTB 2WKDA 3DWPA 1GUNA 3AU7A 1GHKA 2F3VA 4K6DA 2J7ZA 3UE1A 1VQ6A 1UNSA 2Y0SG 1TWAB 4KY6A 3MZ5A 4HSPA 3BU2A 4XQQA 4JI5Q 4GS3A 3J7AF 2CW0D 1C9OA 4PZ7A 3PUVA 4RGTA 4G4KA 2A19A 1FYCA 1PH2A 1SNOA 2KVMA 2LXKA 4A3KB 1BBWA 3AEVA 1PVOA 2WINB 3CKIB 1E0BA 4QUFA 4LF5Q 4PZ6A 1B7YB 2QA4A 2O4XA 3FMCA 4EQ5A 2UXDQ 4O0AA 5IYDG 4DUYQ 2X69A 3RR5A 1F2LA 4PQXA 5C3XA 1OTCA 2R92B 3QG1A 2K52A 3RLNA 1PFMA 3U9OA 5K36G 1SEBD 2F0LA 4BA2I 2N78A 2ZTCA 1SMXA 4LUVA 4A3IB 4EQOA 5BN5A 4BY7G 4DV5L 3KLRA 4O2DA 4O42A 2F0JA 3GTOB 1BUVT 3PGZA 4K2LA 1CKNA 4XT1B 3RZOH 1JORA 3S2DH 2F0FA 1CSQA 4P2CB 3W1BA 2NVQH 1BVSA 1M8AA 3RNUA 2VXWA 3T56B 2QEJC 2MNAA 1CHQD 2NN6G 2K33A 4B3SQ 1VQNA 4JI4L 2F0OA 3VR6A 3AYHB 4OONA 4N8FA 3T1HL 2F03A 3EFXD 5COYA 3KF6A 4QL5A 2TMPA 1WYDA 2ZTEA 2L55A 2KHIA 4KKTA 2Q2IA 4A3BG 4A3FG 5KIXA 4NDXA 4GOPC 3DUZA 1AN8A 1R9TB 3OYYA 4X66L 1F2ZA 4GNXB 3D6CA 1EQQA 1C8CA 1I4HA 1S5CD 4WJWA 5CV9A 2RF4A 4A3KH 5NUCA 1LTLA 1ILQA 1HTPA 2M9VA 5FLXE 3TZUA 4A3GB 4LF9Q 1PYSB 4JI1Q 4DR2Q 3CMEA 4GOPB 3FKIG 4NMZA 1LM0A 2A74C 3RN2A 4ALPA 1U5KA 2E2HH 4JV5Q 3EQLC 1B8AA 4L5TA 3L7ZC 2KECA 2NTSA 5A2QE 2B29A 3FPUB 2DY7A 2LFNA 4DXGA 1QUQA 3F2DA 1ILPA 3S2HH 2B2YC 3JAMi 4EGVA 5ELEA 3URYA 1DZ1A 4K2KA 3BDCA 4JI4Q 2JA7B 2HDMA 3U50C 2ZXPA 4DAYA 5IP7H 1IKMA 1DGSA 1E7ZA 3EBEA 2ATWA 4AYBG 5C3EB 1I5FA 1STNA 1KAWA 2F52A 4P75A 3QJYA 3GTMB 4ZRZA 1JWMD 4EX5A 4MTKA 1QVCA 3TS2A 2ZT9C 4DV7L 4HJAA 2XRSD 2XVSA 1DCZA 1C7YA 4C3JH 3FKIB 1V1PA 1PDQA 2E2IH 1IKLA 3TDQA 2NVYB 5IGCA 3J81c 2RDGA 1PH6A 2KQ3A 1S40A 1BOSA 3A5ZB 1HA6A 2B2YA 2R93B 2EY5A 1QG7A 3MVVA 3ND9A 4EQNA 2HQLA 4ME3A 4K0KL 4HAEA 3HOZG 3GTKB 3K7UC 3SDZA 4M8AA 3K5LA 4UY8C 4JV5L 4KHPQ 5E3FA 2N3SA 2Z6KC 2JA8B 1R4PB 3BVMA 1EEID 4YWLA 3M4PA 2PI2E 4NB3A 1U4LA 3IFDA 3C1FA 1HR0L 2F0IA 1SLJA 1MSGA 4G7ZC 3HOYH 1YHAA 5M5WB 3K59A 4A3GG 4G7HC 2F0HA 1YNJD 3I4OA 5IY0A 2E5LQ 1EQVA 3A8JE 4KD3A 5G3LF 1X9NA 4G57A 1O7YA 4DF7A 1N8RC 1LT5D 3H0GH 3E0JA 1G51A 3K5NA 5LMUL 4DR4L 4LWCA 5IGDA 1EZ8A 2O5JC 1QE6A 4NXNL 1TWGB 4IZ8A 1F9PA 3N6RA 1W3SA 4PMCA 3SR1A 4CJ0B 5JPMC 1JWUD 3T1YQ 4C3HG 5KYIA 2BCOA 2IPKD 1V9PA 1GJXA 4JI3Q 2HIVA 1B50A 4HIKA 4OGQC 5FO9B 3L9AX 2F0UA 1Y8NB 1PYBA 2E75C 2B2VA 1DD2A 3D8GA 2A6ED 3HOWG 1SNMA 1WTHA 3BDLA 4KHZA 4IN3A
chains in the Genus database with same CATH topology
1R9TH 4JI2L 4YCVA 4A3IH 1UEBA 4JI0Q 1PA6A 4AH6A 3DM3A 1IBKL 1UWVA 3GTJH 1HZAA 3BZKA 2K75A 3PSIA 4R4IA 4BY1H 3K81C 2XGTA 1KQSA 2AKWB 4AIMA 2QEXA 1J5EQ 2OTLA 3M3YH 1E3PA 5C0XG 3G48A 1XPUA 3GTKH 2JQOA 2R93G 3UE0A 3S15H 4A3JG 1K8GA 1I50H 4LFAL 2JEBI 3WWVA 4UPAA 1PH9A 1Y1VG 1IBKQ 1VQKA 3H3VI 4JI5L 1QZGA 3PF5A 3I55A 4X64L 2D0OA 4L5QA 4C3HH 4WJ4A 1H95A 1KHIA 2JA9A 3CCRA 1J5EL 1JT8A 4X65L 3S1RH 4JBWA 3CCEA 1PFSA 3TRZA 3HKSA 1IYJB 2NVYH 1SROA 1VQHA 2LSSA 1OXUA 3FP9A 2K14A 4A3MG 1C0AA 4DV1Q 3KDFB 2WFWA 3CPFA 4HJ9A 4TVAB 2C35B 4A3LG 4YY3L 2VQEL 4OWTB 1EYGA 4LF5L 4IFDJ 1N32Q 4IPHA 2K50A 4HJ5A 2ALYB 3PUWA 1SRUA 1HNZL 1IXRA 1VQ4A 3S14H 4GKJL 4JI6Q 2KBNA 4X66Q 1OXSC 1Q1BA 1X3GA 2K5VA 4IPGA 1TWCH 3U58A 2NZOA 1LUZA 1MJCA 1WFQA 4LF6Q 3K8AA 3J80i 4LF8Q 1VQ5A 3PIOA 4DV6L 4IO9A 1VQPA 3VDYA 4JCVE 3KDFA 4JI8L 3UDIA 1N32L 3D0FA 4L5RC 1JJ2A 4IPDA 2F4VL 2WB1G 5IYBG 1SR3A 1IBML 4BY1G 1Q86C 2R92G 2VUMG 2EIFA 2R93H 2OQKA 1EIFA 2Q2UA 1RIPA 2EQSA 3RLFA 2OTJA 3H15A 4OWXB 5IT9c 3MEFA 1AE2A 3U4VA 1L1OA 3HOVH 4R4QA 1YHBA 4UP9A 4R1JA 1HZ9A 2JA8H 4LFAQ 3M9BA 1VQAA 2VQFL 3NEMA 3GD7A 5LMNL 1PHJA 1KD1C 2F4VQ 2VW9A 3PO3H 1FVIA 2Q2HA 1MIUA 1NMFA 1VQBA 3ULLA 2JE6I 3J81i 1HJPA 2VS1A 3S16H 2MO1A 2D0PA 4JYAQ 3B6YA 1YHQA 2WAQE 5EAYA 5M3FG 5DLQE 3UDFA 4KLKA 2UU9L 3HKZG 4NPSA 3BJUA 2JEAI 3T1HQ 4C3IH 5M3FH 2UUCQ 5M5XH 4LFBL 4TQUS 2CWPA 5IYCH 1XMOL 2UUBL 3M7NA 1VQGA 3CCVA 3CPWA 3GTPH 4GN3B 1KIXA 4DV4Q 3CCJA 1Y1WG 1HNXL 3I4NG 1UE1A 3K80C 4LUZA 2K4KA 5IWAL 1L0WA 4DR5L 2AHOB 3ULJA 1N34L 2ASBA 1XNQL 1CKNB 1RL2A 4JI8Q 2KCMA 1X65A 2FXQA 4X6AH 3KYHC 3CCUA 1VCIA 3OTOL 3L0OA 3KLWA 2WP8J 2UXBQ 4DV4L 1YIJA 4R4CA 4IPCA 1K3RA 1XMQL 2AMCB 1Q12A 2N8NA 2DGYA 1NE3A 2NZHA 4QGUA 4DR5Q 4A3EG 3GTQH 4A75A 3A5UA 4IJHA 3TQYA 1HH2P 1X3EA 1EFWA 4JI2Q 4R4TA 4DR2L 1SN8A 1NMGA 3G4SA 1T9HA 2QGQA 3NENA 3F2CA 1TWAH 2GN5A 3CP0A 1M1KC 1X56A 3UDGA 4X62L 3K7AH 2ZJPA 4HJ7A 4DNIA 4JYAL 2JA8G 5M3MG 4IFDG 1I94L 3PO3G 4DR1L 3S1MH 4OWWB 2E5LL 1NBWA 4YWMA 3E9HA 2KCTA 1YZ6A 4AQYL 1VS0A 2UU9Q 4POGA 4A76A 1FL0A 1EQRA 3GDEA 4A3CH 1TXYA 3CW2C 5IYDH 2R7ZH 1XJVA 2IHEA 1XPOA 1W2BA 2JA6G 5IYCG 1XMOQ 4DR4Q 1PH8A 4NXMQ 1VQFA 5FLXc 5H1SE 4DPGA 4A4IA 4X65Q 2VY3A 4JI7L 1A63A 2I0QA 1HNXQ 1I3QH 4YHHL 4WJ3M 1GM5A 2JJQA 3J81j 1HR0W 1FGUA 2JA5G 2MO0A 5C4XH 4BBRH 3S17H 1AE3A 4DV1L 4DR7Q 4IFDI 2UXCQ 2AWOA 2WAQG 5C44H 1Z47A 4B3ML 2MFIA 1HZCA 4POFA 4R4OA 4YY3Q 3HOVG 3KJOA 1EWIA 2VL6A 5HY6A 4GOPA 4NXML 1QZHA 4GKKL 5C44G 2HHHQ 4IJLA 1N36L 1IL2A 1Q8KA 1QUQB 4LF6L 4DR6Q 1JJCB 3KJPA 5GROA 2VNUD 4GN4B 4GN5A 3CC4A 3ZJYC 4UP8A 3JC66 1WCMH 4K0KQ 4APVA 1YI2A 2I5LX 4DAYB 1M90C 1I6HH 3ER0A 2IY5B 1PH3A 3M4QA 2EXDA 2H5XA 4GNXC 3OW2A 3H3VH 4LUOA 1Y1VH 4DUYL 4LNQA 3FHWA 2RCNA 3AQQA 4BBSH 2KENA 3ERSX 5M5YH 1I94Q 1IBLQ 1PH7A 4A3JH 4LF9L 4A3FH 3E9IA 3DLLA 1SFOH 1KL9A 4HIOA 3HOUH 1A0IA 3ICEA 3CMAA 2B3GA 5LMNQ 5IP9H 1FJGL 3I4NH 4BXXH 5JJLA 1U0LA 1X3FA 2F3IA 3H0GG 1J6QA 5FJ8H 2DUDA 2YU9H 2JA7H 4UP7A 3KF8B 4A3LH 2R7FA 3PV0A 4FDBA 2ES2A 4JI7Q 3EN2A 2E2JH 3CCLA 3MXNB 1TWHH 4DV5Q 5C3EH 4BA1I 3F8TA 4C2MH 3UE1A 1G6PA 1KXLA 1VQ6A 1CSPA 2Y0SG 4B3TQ 4JBMA 2RHQB 3HFZB 3BU2A 3ULPA 4JI5Q 4GS3A 2UUCL 3HOYG 2A1AA 1C9OA 4PZ7A 3PUVA 5GAGC 4HJ8A 1NY4A 1B70B 2CQOA 2A19A 4DV2L 2E8GA 2YTYA 4QY7A 2UXDL 2NVTH 2HHHL 4P73A 4DUZQ 1PH2A 2D62A 3Q8DA 3BZCA 1X6OA 5HGQA 2VUMH 1S3OA 1XNRL 2LXKA 1CUKA 1UE6A 1BBWA 3AEVA 1PVOA 2BH2A 1YNXA 2ID0A 4LF5Q 4PZ6A 3HOWH 1B7YB 5IYBH 1NTGA 1OXTA 3STBC 3OTOQ 2PNHA 4EQ5A 2QA4A 1JMCA 2UXDQ 4MTNA 4O0AA 3AFQA 2ZTDA 3UDXA 5IYDG 3GTOH 4DUYQ 4A3CG 2UXBL 3RR5A 4GLXA 4MNOA 1L1OC 1XMQQ 2JK8A 4J15A 1IBLL 3J7A5 1OTCA 1YJWA 1VQ9A 5GQOA 1Q7YC 1YJ9A 2K52A 4JBJA 3RLNA 5BR8L 3I56A 1KC8C 3CD6A 3CAMA 1FJGQ 1KRTA 5K36G 4BA2I 2R6GA 2ZM6Q 2N78A 3LGJA 2ZTCA 5FJ8G 1SMXA 4LUVA 4DK6C 1GO3E 3TS0A 2WB1E 4AYBE 4BY7G 4XTCS 1VQJA 4BXXG 1YEZA 2Z0SA 2YV5A 5C3EG 3NELA 4DV5L 4DR1Q 4LF4L 2IT1A 3F2BA 1VQLA 2PMZE 4O2DA 1WOCA 1O7IA 2IHFA 3HOXG 2CFMA 3CCQA 3PGZA 4JI1L 3W5OA 4AQYQ 4B3SL 1CKNA 1BBUA 2NN6I 4B3TL 2JA7G 2CKZB 3RZOH 1OXVA 1HR0Q 1PH5A 1ASYA 5ELOA 3S2DH 4DK3C 2R92H 1CSQA 3W1BA 1Q1EA 4A3DG 1YBYA 1VQDA 3K0XA 2NVQH 1BVSA 2I5HA 4OO1G 2Y0SE 3RNUA 4LFCL 1HZBA 1E1OA 2MNAA 2KHJA 4YCUA 1XNRQ 5GAHC 4A3BH 2NN6G 4B3SQ 2PI2A 1VQNA 5AJ3Q 3HOXH 4A3IG 4JI4L 3AYHB 4JC0A 4OONA 3W1GA 2GVAA 3T1HL 1K0RA 2AWNA 1YITA 4X64Q 3KF6A 3CXCA 2OCEA 4QL5A 1K73C 4L5SA 4A3GH 4LFCQ 3U4ZA 4QQBX 4LF7Q 4NXNQ 1BKBA 1D8LA 1WYDA 2ZTEA 2RHSB 5FLMH 2KHIA 3IRBA 3G6EA 4OXPA 2B63H 1GVPA 2Q2IA 2YTXA 4YWKA 4DV0Q 4A3FG 4A3BG 1MJEA 5BR8Q 2NVXH 5M3MH 2CCZA 4Y52H 1PH4A 4GOPC 1LYLA 3CF5A 3GO5A 2B63G 1HNZQ 1VQ7A 3KF6B 5LMNW 1K8AC 1JB7A 3OYYA 4X66L 5C0XI 4GNXB 3D31A 1KRSA 1EQQA 2RF4A 4A3KH 3TREA 4LF7L 2R7ZG 2LXJA 1LTLA 4B3RQ 4Y7NH 1HNWQ 2IX1A 4JI3L 2JA6H 4HIMA 4DV6Q 4LF9Q 1PYSB 2HIXA 4GLAC 4MZ9A 3GTMH 4JI1Q 3M85A 4DR2Q 3PIPA 4BY7H 3CMEA 1YJNA 1IBMQ 3KFUA 2UUAL 5C0XJ 4GOPB 3FKIG 3RN2A 1LM0A 4JV5Q 2E2HH 4ALPA 1U5KA 2ZJQA 2A8VA 1E1TA 1B8AA 4L5TA 3L7ZC 4X62Q 2YTVA 4GNXA 2B29A 3I4MH 4B3RL 3S1NH 1QUQA 3F2DA 3S2HH 2OWOA 1Q46A 3JAMi 4A3DH 3PF4A 5C4XG 4BBRG 2BH8A 4YCWA 2JA5H 4JI0L 1EOVA 4QIWE 4QJFA 5AJ3L 3E0EA 2BA1A 3U50C 4DR3L 2Q2TA 4JI4Q 1Y14B 5IP7H 1DGSA 1N33Q 1CKMA 1E7ZA 3EBEA 2ATWA 4AYBG 1JJGA 2OQ0A 1I5FA 2F52A 1KAWA 4P75A 4DV2Q 1TWGH 4JOIC 1WCMG 1N9WA 5ELNA 4EX5A 4A93G 1QVCA 4DUZL 1MKHA 1VQEA 3TS2A 4RG1A 4DV7L 1GKHA 4HJAA 4YHHQ 3TEHB 3CC7A 1XPRA 4GLVB 4PG3A 4C3JH 5GADC 1C7YA 4DR7L 2YYZA 4DV0L 2E2IH 2UXCL 3PCOB 4DR3Q 3S1QH 4A93H 1QVGA 4B3MQ 4XIGS 3G71A 3I7FA 3J81c 2ZJRA 1N33L 4LFBQ 1V43A 3AFPA 1PH6A 1JE5A 2UUBQ 1S40A 1X55A 3A5ZB 1XTDA 5JJIA 2I5MX 1N36Q 4P71A 4DV3L 3RN5A 4DV7Q 1HNWL 4DR6L 1L1OB 3J7ZC 3GTLH 1N34Q 3CC2A 2VZAA 1K83H 5M5WH 1XNQQ 3L2PA 1VQIA 1OXXK 2HQLA 1S72A 2HT1A 1Q81C 4ME3A 3SGIA 2VQEQ 3HOZG 4K0KL 3K7UC 4JOIA 4UY8C 2MQHA 2UUAQ 3FKIH 4OX9L 2ZM6L 4GKJQ 4JV5L 4KHPQ 1A62A 1YVCA 4DV3Q 3PUYA 2N3SA 1K9MC 3HOZH 1A8VA 2Z6KC 4YWLA 4JG2A 1E22A 3M4PA 2PI2E 4NB3A 2PQAB 1TWFH 3F1ZA 3S24A 3KOJA 3CCMA 3GTGH 3RZDH 4OO1I 1ASZA 3I4MG 1HR0L 3NBHB 5FLMG 5C4JH 1SLJA 1Y1WH 3HOYH 4OX9Q 1YHAA 1V1QA 3JAMc 5LMUQ 5JJKA 4A3GG 1IZ6A 1NJIC 3I4OA 4DKAC 1EUJA 3J80c 1VQOA 1VQMA 1VQ8A 4IOAA 1SE8A 5IY0A 3PUXA 2E5LQ 1GD7A 5IP7G 1X54A 3PO2H 1Q82C 3M4OH 1PH1A 2PQAA 4P74A 2Z6KA 1X9NA 2VQFQ 2GVBA 1N8RC 1AH9A 3A0JA 3H0GH 4JBKA 1G51A 1E24A 2K5HA 3I2ZA 3PUZA 5LMUL 1WI5A 4IOCA 4DR4L 1Z9FA 4LWCA 2K5NA 3HOUG 1UE5A 1D7QA 3STBD 5IP9G 3CQZH 4NXNL 1P16A 3EIVA 1G291 1UE7A 2L15A 5E7NA 4HIDA 1QVFA 2N49A 4DAMA 1CKOA 1W3SA 4PMWA 3RLOA 4BBSG 4A3MH 2R7DA 5IE8A 3T1YQ 1P8LA 4LW1A 4GKKQ 4KHPL 5JEAJ 3A74A 2XTIA 1V9PA 5IWAQ 4JI3Q 2HIVA 4P72A 5JEAG 1L2FA 4HIKA 4H02A 2IX0A 4A3KG 5J3BA 1VQCA 4RMFA 2CWAA 3T1YL 4JI6L 5GAEC 1PV4A 1WJJA 2BA0A 1PYBA 4PZ8A 4LF8L 4KI0A 3HKZE 3CCSA 3HOWG 4LF4Q 2V1CC 3PO2G 4KHZA 4A3EH 1EIYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T H;  4JI2 L;  4YCV A;  4A3I H;  1UEB A;  4JI0 Q;  1PA6 A;  4AH6 A;  3DM3 A;  1IBK L;  1UWV A;  3GTJ H;  1HZA A;  3BZK A;  2K75 A;  3PSI A;  4R4I A;  4BY1 H;  3K81 C;  2XGT A;  1KQS A;  2AKW B;  4AIM A;  2QEX A;  1J5E Q;  2OTL A;  3M3Y H;  1E3P A;  5C0X G;  3G48 A;  1XPU A;  3GTK H;  2JQO A;  2R93 G;  3UE0 A;  3S15 H;  4A3J G;  1K8G A;  1I50 H;  4LFA L;  2JEB I;  3WWV A;  4UPA A;  1PH9 A;  1Y1V G;  1IBK Q;  1VQK A;  3H3V I;  4JI5 L;  1QZG A;  3PF5 A;  3I55 A;  4X64 L;  2D0O A;  4L5Q A;  4C3H H;  4WJ4 A;  1H95 A;  1KHI A;  2JA9 A;  3CCR A;  1J5E L;  1JT8 A;  4X65 L;  3S1R H;  4JBW A;  3CCE A;  1PFS A;  3TRZ A;  3HKS A;  1IYJ B;  2NVY H;  1SRO A;  1VQH A;  2LSS A;  1OXU A;  3FP9 A;  2K14 A;  4A3M G;  1C0A A;  4DV1 Q;  3KDF B;  2WFW A;  3CPF A;  4HJ9 A;  4TVA B;  2C35 B;  4A3L G;  4YY3 L;  2VQE L;  4OWT B;  1EYG A;  4LF5 L;  4IFD J;  1N32 Q;  4IPH A;  2K50 A;  4HJ5 A;  2ALY B;  3PUW A;  1SRU A;  1HNZ L;  1IXR A;  1VQ4 A;  3S14 H;  4GKJ L;  4JI6 Q;  2KBN A;  4X66 Q;  1OXS C;  1Q1B A;  1X3G A;  2K5V A;  4IPG A;  1TWC H;  3U58 A;  2NZO A;  1LUZ A;  1MJC A;  1WFQ A;  4LF6 Q;  3K8A A;  3J80 i;  4LF8 Q;  1VQ5 A;  3PIO A;  4DV6 L;  4IO9 A;  1VQP A;  3VDY A;  4JCV E;  3KDF A;  4JI8 L;  3UDI A;  1N32 L;  3D0F A;  4L5R C;  1JJ2 A;  4IPD A;  2F4V L;  2WB1 G;  5IYB G;  1SR3 A;  1IBM L;  4BY1 G;  1Q86 C;  2R92 G;  2VUM G;  2EIF A;  2R93 H;  2OQK A;  1EIF A;  2Q2U A;  1RIP A;  2EQS A;  3RLF A;  2OTJ A;  3H15 A;  4OWX B;  5IT9 c;  3MEF A;  1AE2 A;  3U4V A;  1L1O A;  3HOV H;  4R4Q A;  1YHB A;  4UP9 A;  4R1J A;  1HZ9 A;  2JA8 H;  4LFA Q;  3M9B A;  1VQA A;  2VQF L;  3NEM A;  3GD7 A;  5LMN L;  1PHJ A;  1KD1 C;  2F4V Q;  2VW9 A;  3PO3 H;  1FVI A;  2Q2H A;  1MIU A;  1NMF A;  1VQB A;  3ULL A;  2JE6 I;  3J81 i;  1HJP A;  2VS1 A;  3S16 H;  2MO1 A;  2D0P A;  4JYA Q;  3B6Y A;  1YHQ A;  2WAQ E;  5EAY A;  5M3F G;  5DLQ E;  3UDF A;  4KLK A;  2UU9 L;  3HKZ G;  4NPS A;  3BJU A;  2JEA I;  3T1H Q;  4C3I H;  5M3F H;  2UUC Q;  5M5X H;  4LFB L;  4TQU S;  2CWP A;  5IYC H;  1XMO L;  2UUB L;  3M7N A;  1VQG A;  3CCV A;  3CPW A;  3GTP H;  4GN3 B;  1KIX A;  4DV4 Q;  3CCJ A;  1Y1W G;  1HNX L;  3I4N G;  1UE1 A;  3K80 C;  4LUZ A;  2K4K A;  5IWA L;  1L0W A;  4DR5 L;  2AHO B;  3ULJ A;  1N34 L;  2ASB A;  1XNQ L;  1CKN B;  1RL2 A;  4JI8 Q;  2KCM A;  1X65 A;  2FXQ A;  4X6A H;  3KYH C;  3CCU A;  1VCI A;  3OTO L;  3L0O A;  3KLW A;  2WP8 J;  2UXB Q;  4DV4 L;  1YIJ A;  4R4C A;  4IPC A;  1K3R A;  1XMQ L;  2AMC B;  1Q12 A;  2N8N A;  2DGY A;  1NE3 A;  2NZH A;  4QGU A;  4DR5 Q;  4A3E G;  3GTQ H;  4A75 A;  3A5U A;  4IJH A;  3TQY A;  1HH2 P;  1X3E A;  1EFW A;  4JI2 Q;  4R4T A;  4DR2 L;  1SN8 A;  1NMG A;  3G4S A;  1T9H A;  2QGQ A;  3NEN A;  3F2C A;  1TWA H;  2GN5 A;  3CP0 A;  1M1K C;  1X56 A;  3UDG A;  4X62 L;  3K7A H;  2ZJP A;  4HJ7 A;  4DNI A;  4JYA L;  2JA8 G;  5M3M G;  4IFD G;  1I94 L;  3PO3 G;  4DR1 L;  3S1M H;  4OWW B;  2E5L L;  1NBW A;  4YWM A;  3E9H A;  2KCT A;  1YZ6 A;  4AQY L;  1VS0 A;  2UU9 Q;  4POG A;  4A76 A;  1FL0 A;  1EQR A;  3GDE A;  4A3C H;  1TXY A;  3CW2 C;  5IYD H;  2R7Z H;  1XJV A;  2IHE A;  1XPO A;  1W2B A;  2JA6 G;  5IYC G;  1XMO Q;  4DR4 Q;  1PH8 A;  4NXM Q;  1VQF A;  5FLX c;  5H1S E;  4DPG A;  4A4I A;  4X65 Q;  2VY3 A;  4JI7 L;  1A63 A;  2I0Q A;  1HNX Q;  1I3Q H;  4YHH L;  4WJ3 M;  1GM5 A;  2JJQ A;  3J81 j;  1HR0 W;  1FGU A;  2JA5 G;  2MO0 A;  5C4X H;  4BBR H;  3S17 H;  1AE3 A;  4DV1 L;  4DR7 Q;  4IFD I;  2UXC Q;  2AWO A;  2WAQ G;  5C44 H;  1Z47 A;  4B3M L;  2MFI A;  1HZC A;  4POF A;  4R4O A;  4YY3 Q;  3HOV G;  3KJO A;  1EWI A;  2VL6 A;  5HY6 A;  4GOP A;  4NXM L;  1QZH A;  4GKK L;  5C44 G;  2HHH Q;  4IJL A;  1N36 L;  1IL2 A;  1Q8K A;  1QUQ B;  4LF6 L;  4DR6 Q;  1JJC B;  3KJP A;  5GRO A;  2VNU D;  4GN4 B;  4GN5 A;  3CC4 A;  3ZJY C;  4UP8 A;  3JC6 6;  1WCM H;  4K0K Q;  4APV A;  1YI2 A;  2I5L X;  4DAY B;  1M90 C;  1I6H H;  3ER0 A;  2IY5 B;  1PH3 A;  3M4Q A;  2EXD A;  2H5X A;  4GNX C;  3OW2 A;  3H3V H;  4LUO A;  1Y1V H;  4DUY L;  4LNQ A;  3FHW A;  2RCN A;  3AQQ A;  4BBS H;  2KEN A;  3ERS X;  5M5Y H;  1I94 Q;  1IBL Q;  1PH7 A;  4A3J H;  4LF9 L;  4A3F H;  3E9I A;  3DLL A;  1SFO H;  1KL9 A;  4HIO A;  3HOU H;  1A0I A;  3ICE A;  3CMA A;  2B3G A;  5LMN Q;  5IP9 H;  1FJG L;  3I4N H;  4BXX H;  5JJL A;  1U0L A;  1X3F A;  2F3I A;  3H0G G;  1J6Q A;  5FJ8 H;  2DUD A;  2YU9 H;  2JA7 H;  4UP7 A;  3KF8 B;  4A3L H;  2R7F A;  3PV0 A;  4FDB A;  2ES2 A;  4JI7 Q;  3EN2 A;  2E2J H;  3CCL A;  3MXN B;  1TWH H;  4DV5 Q;  5C3E H;  4BA1 I;  3F8T A;  4C2M H;  3UE1 A;  1G6P A;  1KXL A;  1VQ6 A;  1CSP A;  2Y0S G;  4B3T Q;  4JBM A;  2RHQ B;  3HFZ B;  3BU2 A;  3ULP A;  4JI5 Q;  4GS3 A;  2UUC L;  3HOY G;  2A1A A;  1C9O A;  4PZ7 A;  3PUV A;  5GAG C;  4HJ8 A;  1NY4 A;  1B70 B;  2CQO A;  2A19 A;  4DV2 L;  2E8G A;  2YTY A;  4QY7 A;  2UXD L;  2NVT H;  2HHH L;  4P73 A;  4DUZ Q;  1PH2 A;  2D62 A;  3Q8D A;  3BZC A;  1X6O A;  5HGQ A;  2VUM H;  1S3O A;  1XNR L;  2LXK A;  1CUK A;  1UE6 A;  1BBW A;  3AEV A;  1PVO A;  2BH2 A;  1YNX A;  2ID0 A;  4LF5 Q;  4PZ6 A;  3HOW H;  1B7Y B;  5IYB H;  1NTG A;  1OXT A;  3STB C;  3OTO Q;  2PNH A;  4EQ5 A;  2QA4 A;  1JMC A;  2UXD Q;  4MTN A;  4O0A A;  3AFQ A;  2ZTD A;  3UDX A;  5IYD G;  3GTO H;  4DUY Q;  4A3C G;  2UXB L;  3RR5 A;  4GLX A;  4MNO A;  1L1O C;  1XMQ Q;  2JK8 A;  4J15 A;  1IBL L;  3J7A 5;  1OTC A;  1YJW A;  1VQ9 A;  5GQO A;  1Q7Y C;  1YJ9 A;  2K52 A;  4JBJ A;  3RLN A;  5BR8 L;  3I56 A;  1KC8 C;  3CD6 A;  3CAM A;  1FJG Q;  1KRT A;  5K36 G;  4BA2 I;  2R6G A;  2ZM6 Q;  2N78 A;  3LGJ A;  2ZTC A;  5FJ8 G;  1SMX A;  4LUV A;  4DK6 C;  1GO3 E;  3TS0 A;  2WB1 E;  4AYB E;  4BY7 G;  4XTC S;  1VQJ A;  4BXX G;  1YEZ A;  2Z0S A;  2YV5 A;  5C3E G;  3NEL A;  4DV5 L;  4DR1 Q;  4LF4 L;  2IT1 A;  3F2B A;  1VQL A;  2PMZ E;  4O2D A;  1WOC A;  1O7I A;  2IHF A;  3HOX G;  2CFM A;  3CCQ A;  3PGZ A;  4JI1 L;  3W5O A;  4AQY Q;  4B3S L;  1CKN A;  1BBU A;  2NN6 I;  4B3T L;  2JA7 G;  2CKZ B;  3RZO H;  1OXV A;  1HR0 Q;  1PH5 A;  1ASY A;  5ELO A;  3S2D H;  4DK3 C;  2R92 H;  1CSQ A;  3W1B A;  1Q1E A;  4A3D G;  1YBY A;  1VQD A;  3K0X A;  2NVQ H;  1BVS A;  2I5H A;  4OO1 G;  2Y0S E;  3RNU A;  4LFC L;  1HZB A;  1E1O A;  2MNA A;  2KHJ A;  4YCU A;  1XNR Q;  5GAH C;  4A3B H;  2NN6 G;  4B3S Q;  2PI2 A;  1VQN A;  5AJ3 Q;  3HOX H;  4A3I G;  4JI4 L;  3AYH B;  4JC0 A;  4OON A;  3W1G A;  2GVA A;  3T1H L;  1K0R A;  2AWN A;  1YIT A;  4X64 Q;  3KF6 A;  3CXC A;  2OCE A;  4QL5 A;  1K73 C;  4L5S A;  4A3G H;  4LFC Q;  3U4Z A;  4QQB X;  4LF7 Q;  4NXN Q;  1BKB A;  1D8L A;  1WYD A;  2ZTE A;  2RHS B;  5FLM H;  2KHI A;  3IRB A;  3G6E A;  4OXP A;  2B63 H;  1GVP A;  2Q2I A;  2YTX A;  4YWK A;  4DV0 Q;  4A3F G;  4A3B G;  1MJE A;  5BR8 Q;  2NVX H;  5M3M H;  2CCZ A;  4Y52 H;  1PH4 A;  4GOP C;  1LYL A;  3CF5 A;  3GO5 A;  2B63 G;  1HNZ Q;  1VQ7 A;  3KF6 B;  5LMN W;  1K8A C;  1JB7 A;  3OYY A;  4X66 L;  5C0X I;  4GNX B;  3D31 A;  1KRS A;  1EQQ A;  2RF4 A;  4A3K H;  3TRE A;  4LF7 L;  2R7Z G;  2LXJ A;  1LTL A;  4B3R Q;  4Y7N H;  1HNW Q;  2IX1 A;  4JI3 L;  2JA6 H;  4HIM A;  4DV6 Q;  4LF9 Q;  1PYS B;  2HIX A;  4GLA C;  4MZ9 A;  3GTM H;  4JI1 Q;  3M85 A;  4DR2 Q;  3PIP A;  4BY7 H;  3CME A;  1YJN A;  1IBM Q;  3KFU A;  2UUA L;  5C0X J;  4GOP B;  3FKI G;  3RN2 A;  1LM0 A;  4JV5 Q;  2E2H H;  4ALP A;  1U5K A;  2ZJQ A;  2A8V A;  1E1T A;  1B8A A;  4L5T A;  3L7Z C;  4X62 Q;  2YTV A;  4GNX A;  2B29 A;  3I4M H;  4B3R L;  3S1N H;  1QUQ A;  3F2D A;  3S2H H;  2OWO A;  1Q46 A;  3JAM i;  4A3D H;  3PF4 A;  5C4X G;  4BBR G;  2BH8 A;  4YCW A;  2JA5 H;  4JI0 L;  1EOV A;  4QIW E;  4QJF A;  5AJ3 L;  3E0E A;  2BA1 A;  3U50 C;  4DR3 L;  2Q2T A;  4JI4 Q;  1Y14 B;  5IP7 H;  1DGS A;  1N33 Q;  1CKM A;  1E7Z A;  3EBE A;  2ATW A;  4AYB G;  1JJG A;  2OQ0 A;  1I5F A;  2F52 A;  1KAW A;  4P75 A;  4DV2 Q;  1TWG H;  4JOI C;  1WCM G;  1N9W A;  5ELN A;  4EX5 A;  4A93 G;  1QVC A;  4DUZ L;  1MKH A;  1VQE A;  3TS2 A;  4RG1 A;  4DV7 L;  1GKH A;  4HJA A;  4YHH Q;  3TEH B;  3CC7 A;  1XPR A;  4GLV B;  4PG3 A;  4C3J H;  5GAD C;  1C7Y A;  4DR7 L;  2YYZ A;  4DV0 L;  2E2I H;  2UXC L;  3PCO B;  4DR3 Q;  3S1Q H;  4A93 H;  1QVG A;  4B3M Q;  4XIG S;  3G71 A;  3I7F A;  3J81 c;  2ZJR A;  1N33 L;  4LFB Q;  1V43 A;  3AFP A;  1PH6 A;  1JE5 A;  2UUB Q;  1S40 A;  1X55 A;  3A5Z B;  1XTD A;  5JJI A;  2I5M X;  1N36 Q;  4P71 A;  4DV3 L;  3RN5 A;  4DV7 Q;  1HNW L;  4DR6 L;  1L1O B;  3J7Z C;  3GTL H;  1N34 Q;  3CC2 A;  2VZA A;  1K83 H;  5M5W H;  1XNQ Q;  3L2P A;  1VQI A;  1OXX K;  2HQL A;  1S72 A;  2HT1 A;  1Q81 C;  4ME3 A;  3SGI A;  2VQE Q;  3HOZ G;  4K0K L;  3K7U C;  4JOI A;  4UY8 C;  2MQH A;  2UUA Q;  3FKI H;  4OX9 L;  2ZM6 L;  4GKJ Q;  4JV5 L;  4KHP Q;  1A62 A;  1YVC A;  4DV3 Q;  3PUY A;  2N3S A;  1K9M C;  3HOZ H;  1A8V A;  2Z6K C;  4YWL A;  4JG2 A;  1E22 A;  3M4P A;  2PI2 E;  4NB3 A;  2PQA B;  1TWF H;  3F1Z A;  3S24 A;  3KOJ A;  3CCM A;  3GTG H;  3RZD H;  4OO1 I;  1ASZ A;  3I4M G;  1HR0 L;  3NBH B;  5FLM G;  5C4J H;  1SLJ A;  1Y1W H;  3HOY H;  4OX9 Q;  1YHA A;  1V1Q A;  3JAM c;  5LMU Q;  5JJK A;  4A3G G;  1IZ6 A;  1NJI C;  3I4O A;  4DKA C;  1EUJ A;  3J80 c;  1VQO A;  1VQM A;  1VQ8 A;  4IOA A;  1SE8 A;  5IY0 A;  3PUX A;  2E5L Q;  1GD7 A;  5IP7 G;  1X54 A;  3PO2 H;  1Q82 C;  3M4O H;  1PH1 A;  2PQA A;  4P74 A;  2Z6K A;  1X9N A;  2VQF Q;  2GVB A;  1N8R C;  1AH9 A;  3A0J A;  3H0G H;  4JBK A;  1G51 A;  1E24 A;  2K5H A;  3I2Z A;  3PUZ A;  5LMU L;  1WI5 A;  4IOC A;  4DR4 L;  1Z9F A;  4LWC A;  2K5N A;  3HOU G;  1UE5 A;  1D7Q A;  3STB D;  5IP9 G;  3CQZ H;  4NXN L;  1P16 A;  3EIV A;  1G29 1;  1UE7 A;  2L15 A;  5E7N A;  4HID A;  1QVF A;  2N49 A;  4DAM A;  1CKO A;  1W3S A;  4PMW A;  3RLO A;  4BBS G;  4A3M H;  2R7D A;  5IE8 A;  3T1Y Q;  1P8L A;  4LW1 A;  4GKK Q;  4KHP L;  5JEA J;  3A74 A;  2XTI A;  1V9P A;  5IWA Q;  4JI3 Q;  2HIV A;  4P72 A;  5JEA G;  1L2F A;  4HIK A;  4H02 A;  2IX0 A;  4A3K G;  5J3B A;  1VQC A;  4RMF A;  2CWA A;  3T1Y L;  4JI6 L;  5GAE C;  1PV4 A;  1WJJ A;  2BA0 A;  1PYB A;  4PZ8 A;  4LF8 L;  4KI0 A;  3HKZ E;  3CCS A;  3HOW G;  4LF4 Q;  2V1C C;  3PO2 G;  4KHZ A;  4A3E H;  1EIY B; 
#chains in the Genus database with same CATH topology
 4JI2 L;  4JI0 Q;  3DM3 A;  1UWV A;  2JA6 B;  4ZK9 B;  2XN9 C;  3PSI A;  2Y0S B;  3HP3 A;  2EZV A;  4AIM A;  4QCL A;  2R93 G;  5C0X G;  3G48 A;  4FF1 A;  3UE0 A;  1A3V A;  3HOY B;  3WWV A;  1VQK A;  2L1B A;  2HCC A;  3EJI A;  2EYJ A;  3PMF A;  1LT3 D;  2PYK A;  1E2W A;  1J5E L;  1PRT F;  3CCR A;  4JBW A;  5C5L A;  1Y1W B;  1IYJ B;  1VQH A;  3EVQ A;  1EWH A;  2WFW A;  4B08 A;  4HJ9 A;  1Y69 U;  4YY3 L;  4OWT B;  4PNY A;  1QIL A;  4HJ5 A;  4XXE A;  1JB3 A;  1X3G A;  5C3W A;  2L4N A;  1MJC A;  2LS0 1;  2Z4I A;  1EFI D;  3KDF A;  3OMG A;  1SYF A;  1TWH B;  3D0F A;  1RTO A;  5ELC A;  1JJ2 A;  5IYB G;  4BY1 G;  1Q86 C;  1XYI A;  4KKU A;  1K0S A;  2CQA A;  1STG A;  1RIP A;  3RLF A;  3IL8 A;  1BCP C;  3H15 A;  4OWX B;  5IT9 c;  1F2Y A;  4UP9 A;  1GUT A;  5HUR A;  1KTK A;  1B3A A;  3M9B A;  5LMN L;  3NEM A;  2F4V Q;  5C0X H;  3I4M B;  4HSV A;  1NMF A;  3DWA A;  3RUZ A;  5C4H A;  1HJP A;  3B6Y A;  1R4Q B;  3NPP A;  2JA5 B;  1SE2 A;  5DLQ E;  1W6J A;  3UDF A;  4NPS A;  2JEA I;  4FP5 D;  4C3I H;  5M3F H;  4A3E B;  2CWP A;  1TS3 A;  3CCV A;  4GN3 B;  3PO2 B;  3CCJ A;  1UE1 A;  1CQF A;  1L0W A;  4J6H A;  1MSH A;  3CRK C;  3J80 L;  1XNQ L;  4BBS B;  3D6W A;  1DYQ A;  3K0Y A;  3KYH C;  3D4D A;  3OTO L;  3H91 A;  3L0O A;  3T13 A;  2WP8 J;  2EXZ A;  4DV4 L;  3Q22 A;  1AEX A;  4IPC A;  1K3R A;  2KCN A;  1Q12 A;  3W3A A;  4A75 A;  3A5U A;  4KJO A;  4IJH A;  1G8Z D;  1C4Q A;  1X3E A;  1TR5 A;  1SN8 A;  3V96 A;  1EY9 A;  1O80 A;  1ESF A;  3NEN A;  2E2D C;  3L3O C;  4RA8 A;  3UDG A;  2ZJP A;  4KN4 C;  4K5W A;  4OWW B;  4YWM A;  1TWC B;  3E9H A;  1PRT D;  1YZ6 A;  5C4Z A;  3GDE A;  5IYD H;  3CW2 C;  3Q0A A;  1RJT A;  2R7Z H;  2NBF A;  1TVX A;  3I91 A;  1K8O A;  4DR4 Q;  4NXM Q;  1UUP A;  4DPG A;  4X65 Q;  4JI7 L;  2NTT A;  2I0Q A;  4CJ2 C;  1I3Q H;  3SE0 A;  3M3Y B;  4DR7 Q;  1AE3 A;  1AW7 A;  1BDO A;  3I8Z A;  4ZLT F;  1Z47 A;  3BYY B;  3Q24 A;  1JIC A;  3HOV G;  3KJO A;  1EY5 A;  2K5D A;  1PRT C;  4GKK L;  3J80 E;  3D4R A;  4JW0 A;  5C44 G;  4IJL A;  2HHH Q;  3TP8 A;  1Q8K A;  1HRJ A;  1JJC B;  2VNU D;  4GN5 A;  1VMP A;  1AFP A;  4B9W A;  5TSS A;  2IY5 B;  4WRD A;  4F8M A;  4GNX C;  2B8G A;  1LV9 A;  4LUO A;  3ND8 A;  4BBS H;  3ERS X;  4YIJ A;  5M5Y H;  1I94 Q;  5I6W A;  3TN2 A;  1H9S A;  4LF9 L;  4XDX A;  4A3F H;  1CQV A;  1KL9 A;  5ELF A;  3ICE A;  3CMA A;  4BXX H;  4DFA A;  3H0G G;  1SMY C;  5FOB B;  3MWY W;  3AB9 A;  3KF8 B;  5IGE A;  2R7F A;  3W2D A;  4TKO B;  4C2M H;  1G6P A;  1YNN D;  1KXL A;  4JBM A;  3JAM L;  3R2T A;  3ULP A;  3HOY G;  5J22 A;  4HJ8 A;  2SNM A;  2CQO A;  2Z4H A;  3SK4 A;  2UXD L;  2HHH L;  4K5V A;  4DUZ Q;  3BZC A;  1X6O A;  5HGQ A;  4QIW B;  5F2D A;  2VUM H;  5D65 A;  1CUK A;  2EYM A;  5DAU A;  1DXM A;  5BN4 A;  3C46 A;  2SOB A;  3HRZ C;  4ZQ3 A;  3HOZ B;  1KLG D;  1LTT D;  2ID0 A;  4IQZ A;  3S17 B;  1ET9 A;  1OXT A;  4CDC C;  1S5B D;  3K5O A;  4NW2 A;  1PTO H;  4MTN A;  1D6E C;  2ZTD A;  3NE5 B;  1CK1 A;  1SYC A;  1SDF A;  2F0K A;  1XMQ Q;  4J15 A;  1IBL L;  3J7A 5;  4KN7 C;  1VQ9 A;  2TSS A;  1Q7Y C;  2R61 A;  4JBJ A;  1TS4 A;  3I56 A;  1YJ9 A;  1KC8 C;  4K6L A;  1FJG Q;  1KRT A;  2A6E C;  1G2T A;  5C4X B;  2Q8I B;  5FJ8 G;  4C3J B;  4DK6 C;  3TS0 A;  4AYB E;  2E2I B;  4XTC S;  4ZKB B;  1VQJ A;  1A3T A;  4K8I A;  2F0Q A;  2Z0S A;  4IUR A;  5C3E G;  4DR1 Q;  2NN6 H;  3F2B A;  1K28 A;  4CKE A;  1WOC A;  2IHF A;  1EY8 A;  4NP5 A;  3W5O A;  2JA7 G;  1EY4 A;  2NN6 I;  3K7A B;  1QNU A;  2CKZ B;  1HR0 Q;  5ELO A;  4DK3 C;  3C1E A;  1BNZ A;  1Q1E A;  4A3D G;  3K0X A;  1SE4 A;  1EOT A;  2RSN A;  4OO1 G;  3UI2 A;  5IOC A;  2Y0S E;  1GUG A;  1I4G A;  3HOX H;  4JC0 A;  3W1G A;  1YIT A;  4X64 Q;  3WDN A;  4QF4 A;  2OCE A;  1K73 C;  4Q0F A;  4H0L C;  4LFC Q;  3FDT A;  5G3L D;  1B9M A;  3K5M A;  3U4Z A;  1D8L A;  5FLM H;  3IRB A;  2B63 H;  1TT2 A;  3H94 A;  1MJE A;  2CCZ A;  1DJR D;  2VB3 X;  3GO5 A;  5JVG 3;  1HPC A;  1HNZ Q;  3KF6 B;  4ODG A;  1K8A C;  5C0X I;  3D31 A;  1EU4 A;  1STE A;  2E76 C;  4Y7N H;  2IX1 A;  4JI3 L;  4DXF A;  1NUC A;  4HIM A;  4DNT B;  3M85 A;  2UUA L;  1X32 A;  1O7L A;  4UAI A;  5T1I A;  2ZJQ A;  1SYG A;  4XYO A;  1E1T A;  3I4M H;  2E74 C;  4B3R L;  1CI3 M;  2OWO A;  4RFB A;  4ME5 A;  1PYW D;  4BBR G;  2BH8 A;  2JA5 H;  1ZEQ X;  5AJ3 L;  2Q2T A;  3E0E A;  4DR3 L;  2AUJ D;  3I3C A;  1Y14 B;  2C9O A;  2F0D A;  1JJG A;  2NWG A;  1NSN S;  1PZI D;  1LLR D;  4A93 G;  1MKH A;  1VQE A;  4RG1 A;  1GKH A;  1QOH A;  3TEH B;  3QOL A;  1XPR A;  3TP7 A;  1H9S B;  4DR7 L;  4DV0 L;  3JAM E;  3PCO B;  4A93 H;  4KK7 A;  2ZJR A;  1IW7 C;  1V43 A;  3AFP A;  2NUC A;  5K36 H;  1HCZ A;  1WTX A;  2I5M X;  4P71 A;  4M1U B;  3C2P A;  3GTL H;  4FNF A;  4KD4 A;  1N34 Q;  2B2T C;  1K83 H;  1LO5 D;  1OXX K;  1A2T A;  1RKN A;  4JOI A;  3OWF A;  1ET6 A;  1WVL A;  2JP1 A;  1TKW B;  2G9D A;  2K32 A;  4DV3 Q;  2K01 A;  1K9M C;  3NUC A;  4DNR B;  4LAA A;  4JG2 A;  1E22 A;  1JE4 A;  1GUO A;  1MHW C;  2PQA B;  1JWS D;  1CT1 D;  4OO1 I;  1ASZ A;  5FLM G;  5C4J H;  1Y1W H;  5EKK A;  4OX9 Q;  1T5X D;  1V1Q A;  4RHR A;  3RMH A;  4DKA C;  4IOA A;  2B2W C;  2KEE A;  3SK8 A;  1X54 A;  3M4O H;  4L6T B;  4P74 A;  3E3X A;  2VQF Q;  3T51 B;  1MD2 D;  2A6H D;  3G7L A;  2E2J B;  4JBK A;  3I2Z A;  2K5H A;  2K1B A;  5A35 A;  2A69 D;  4ULL A;  3CQZ H;  5IP9 G;  4RHS A;  3EIV A;  5E7N A;  4N8X 1;  1JCK B;  4X3K A;  1LTG D;  3NTI A;  1GHJ A;  3RLO A;  1U9R A;  3PQI A;  3IAY A;  4DU9 A;  2R7D A;  5EBD A;  5IE8 A;  4LW1 A;  2L11 A;  3QB3 A;  5JEA J;  4KY5 A;  4I65 A;  2V4D A;  1ICW A;  1KDB A;  3BZD B;  1Q8I A;  2FJ2 A;  1HUM A;  3NQT A;  4P72 A;  2JN4 A;  4GZY C;  2IX0 A;  5EPK A;  3BS1 A;  2H1E A;  5J3B A;  4FF3 A;  3T1Y L;  2F0M A;  4JI6 L;  4CKB A;  2MP1 A;  4K8J A;  1WJJ A;  4HCE A;  3PO3 B;  2BA0 A;  1IYV A;  2EYF A;  2F0E A;  2K7V A;  4LF4 Q;  2V1C C;  2F0W A;  4A3E H;  3KK7 A;  2OTJ A;  1EIY B;  1R9T H;  1UAP A;  1GOZ A;  4UHV A;  1PA6 A;  1EU3 A;  3GTJ H;  4IUV A;  2K75 A;  4LK1 C;  2N55 A;  1J5E Q;  2OTL A;  1E3P A;  1XPU A;  2JQO A;  4KY7 A;  3S15 H;  5IOD A;  1QB5 D;  1HQM C;  4HN7 A;  1QNK A;  2EY1 A;  2F1M A;  2JEB I;  4UPA A;  1IBK Q;  4G7O C;  3NWS A;  2VUM B;  3PF5 A;  1SAP A;  4FXK C;  4XQN A;  4L5Q A;  4A3B B;  1H95 A;  5J39 A;  4X65 L;  3S1R H;  2RDH A;  3CCE A;  1PFS A;  1WTO A;  5I9O A;  2XIW A;  2LSS A;  4DV1 Q;  3KDF B;  5EPJ A;  4TVA B;  2C35 B;  1N32 Q;  4LF5 L;  1SYE A;  4IPH A;  3S14 H;  5DNF A;  1HNZ L;  1EZ6 A;  1VQ4 A;  4JI6 Q;  1Q1B A;  2K5V A;  3P20 A;  1TWC H;  4IPG A;  1Q90 A;  2NZO A;  1I6H B;  3K8A A;  4DV6 L;  5CV7 A;  5D3I B;  3UDI A;  4L5R C;  3HKZ B;  3SEB A;  2F4V L;  2DJF C;  2KUM A;  1IBM L;  1I3Q B;  2VUM G;  3MAQ A;  2R93 H;  2IL8 A;  4H7B A;  3BG3 A;  3X3M A;  1O7Z A;  5CYU A;  3FPP A;  3HOV H;  4R4Q A;  3DEO A;  4R1J A;  2F0P A;  1KD1 C;  1EY7 A;  5C6A A;  1FVI A;  3PO3 H;  2LY7 A;  2L9H A;  3J81 i;  2MO1 A;  2D0P A;  4JYA Q;  1DOK A;  2WAQ E;  5CC4 A;  3I73 A;  4C3I G;  5M3F G;  1ML0 D;  2UU9 L;  4X3S A;  5M5X H;  2UUB L;  4RGN A;  3M7N A;  3MEH A;  2BE5 C;  4FXG C;  1KIX A;  5KNC A;  2K4K A;  4RGO S;  3H0G B;  1N34 L;  5KEE A;  1FNV A;  2ASB A;  2OEO A;  2NZ1 D;  2FXQ A;  2F4I A;  3TP6 A;  5DM6 3;  3KLW A;  4A3J B;  2K5W A;  4UDU C;  4ZAI A;  2Z8L A;  2N8N A;  4OIJ A;  2DGY A;  2NZH A;  3GV3 A;  4A3E G;  4PMB A;  3ERO A;  4FXD A;  1HH2 P;  1EFW A;  4JI2 Q;  4DR2 L;  4AYB B;  1C48 A;  2ICE C;  2QGQ A;  3CP0 A;  1M1K C;  1X56 A;  4X62 L;  1WTW A;  5C44 B;  5M3M G;  4IFD G;  4DR1 L;  3S1M H;  4I7A A;  1FR3 A;  2UU9 Q;  4POG A;  4IUP A;  4A3C H;  1TXY A;  2EJG C;  4OEM B;  1DON A;  2IHE A;  5D3D A;  1XPO A;  1XMO Q;  1PH8 A;  1VQF A;  5FLX c;  4KMU C;  4C1N K;  4WFN 3;  4ILW A;  4YHH L;  4WJ3 M;  2KHS A;  5C4X H;  2Z6B A;  4CHT B;  1SBB B;  4BWG B;  4YY3 Q;  3OIQ A;  5HY6 A;  1EL0 A;  1PMR A;  4LF6 L;  5GRO A;  2RQX A;  5DEH A;  3ZJY C;  2E2H B;  1TY0 A;  2FFK B;  1YI2 A;  3U9S A;  1M90 C;  3ER0 A;  1IHZ A;  1TY2 A;  2H5X A;  3OW2 A;  2N88 A;  1Y1V H;  3FHW A;  2MJ8 A;  3DEP A;  1SNQ A;  3DLL A;  3HOU H;  1K3B C;  4BS9 A;  1A0I A;  5JJL A;  1HXY D;  1LAC A;  3M4O B;  5FJ8 H;  2DUD A;  2JA7 H;  1T5E A;  3DWQ A;  3PV0 A;  2ES2 A;  2E2J H;  3CCL A;  3MXN B;  1TWH H;  4DV5 Q;  5C3E H;  1A15 A;  1CSP A;  1S5E D;  4B3T Q;  2RHQ B;  2RKS A;  1BCP D;  4F87 A;  2UUC L;  1BR9 A;  5CV8 A;  1B70 B;  4DV2 L;  1M4V A;  3S1M B;  2PQE A;  3VR3 A;  2NVX B;  5JAV A;  4CGY B;  2D62 A;  3Q8D A;  1S3O A;  1XNR L;  2MHV A;  4C3J G;  3EA6 A;  5A2Q L;  1GUW A;  1SYB A;  2DNC A;  3HOW H;  2OF1 A;  5JPN C;  3STB C;  1JMC A;  3OTO Q;  4MHE A;  4L8J A;  3GTO H;  3UDX A;  1KNE A;  1L1O C;  4CDE C;  2JK8 A;  1F9Q A;  4N9T A;  5BR8 L;  5EKI A;  1VF5 C;  2F0V A;  1CZW A;  3CAM A;  3DXJ C;  2AUK A;  2EY6 A;  3DM1 A;  2WAC A;  3LGJ A;  1GO3 E;  2WB1 E;  2EJM A;  2PZU A;  3VR4 A;  1KDC A;  5CR3 A;  4BXX G;  4K14 A;  3NEL A;  2IT1 A;  4ID6 A;  2ENB A;  5E4X A;  2K5Q A;  3CCQ A;  4AQY Q;  4B3T L;  4JI1 L;  1BBU A;  5EKL A;  1OXV A;  1ASY A;  3NHH A;  2R92 H;  5J1Z A;  1LT6 D;  2I5H A;  4DAV A;  4LFC L;  1D5X C;  1E1O A;  4L63 B;  3HOU B;  2RBM A;  1PTO D;  4U67 3;  1PTO F;  1D1I A;  4YCU A;  1XNR Q;  1AZQ A;  4A3B H;  5ISR A;  2PI2 A;  3KUP A;  2PO4 A;  3V05 A;  1EYD A;  2GVA A;  1FNU A;  2XNA C;  5FKA C;  5K5P A;  4L5S A;  4A3G H;  3OIP A;  4LF7 Q;  3SVM A;  5IT9 E;  4X3T A;  3G6E A;  4OXP A;  2YTX A;  4YWK A;  2L12 A;  4Q5V A;  4RAU C;  5BR8 Q;  2NVX H;  2F0S A;  1PH4 A;  4ZCK A;  5JJZ A;  3CF5 A;  5LMN W;  2AQ1 B;  2R7Z G;  1HNW Q;  4B3R Q;  3NBI A;  2JA6 H;  3PIP 3;  2GA4 B;  4MZ9 A;  1V1O A;  2K28 A;  3GTM H;  3PIP A;  3KFU A;  1EIH A;  1LT4 D;  5C0X J;  4C1N I;  5KRU A;  4LMQ D;  2IJ0 A;  5AFW A;  4X62 Q;  3QWN A;  2YTV A;  3J7A V;  2PPB C;  2KJX A;  4YCW A;  1EOV A;  2YU9 B;  5JVH 3;  1II3 A;  1N33 Q;  1CKM A;  3C3L A;  3I4N B;  5ELN A;  4XYQ A;  4DUZ L;  4A3M B;  2RSO A;  1CA5 A;  1ICF B;  4H44 C;  1TQO A;  4YHH Q;  1SND A;  4GLV B;  4PG3 A;  3TP5 A;  2UXC L;  2BE5 D;  4DR3 Q;  3MTS A;  3MXU A;  1QVG A;  3G71 A;  3I7F A;  4IFD H;  2A68 D;  5M9O A;  2XSC A;  2IX3 A;  1JE5 A;  3HOX B;  2G5D A;  1X55 A;  4BBR B;  1JQY D;  1N36 Q;  4DV3 L;  1J8I A;  1HNW L;  4DR6 L;  2BDN A;  5CBE E;  2EYP A;  2KCC A;  2C5C A;  5IIF A;  5M5W H;  2Q8R E;  1XNQ Q;  5IGF A;  2HT1 A;  1S72 A;  5COR A;  3SGI A;  3A7A B;  1KAA A;  2MQH A;  3FKI H;  4OX9 L;  2ZM6 L;  1L0Y B;  4RKB A;  1YVC A;  2B39 A;  3PUY A;  3SXH A;  1TII D;  3HOZ H;  1VF7 A;  5LL6 X;  1O78 A;  3KBG A;  1TWF H;  3F1Z A;  3KOJ A;  3CCM A;  3H6M A;  3GTG H;  3NBH B;  4V0B A;  1D5Z C;  2QF7 A;  3NQI A;  3JAM c;  1IZ6 A;  1NJI C;  1VQM A;  2B2T A;  3J80 c;  2K6A A;  2R3Z A;  3NTK A;  1NNX A;  5ELD A;  5IP7 G;  5I6Y A;  1Q82 C;  1PH1 A;  2PQA A;  5CV5 A;  2GVB A;  5KNB A;  1Z7T A;  1WI5 A;  1HFN A;  1S5F D;  3TBI B;  1UE5 A;  1D7Q A;  4K5X A;  3STB D;  1UE7 A;  2L15 A;  1QVF A;  1X3Q A;  2N49 A;  4DAM A;  1STY A;  3S1N B;  1H9J A;  4CBV A;  3NSW A;  4A3M H;  1P8L A;  1BF4 A;  4GKK Q;  4KHP L;  1LTB D;  4V19 0;  2XTI A;  3VYS A;  3H3V C;  1VMC A;  3K6O A;  3NK9 A;  4FVM A;  5JEA G;  1AZP A;  4X3U A;  4A3K G;  2Z1C A;  3QO2 A;  2EJF C;  3IKJ A;  2CWA A;  3X3N A;  2IW3 A;  3I72 A;  1SXT A;  4PZ8 A;  3CCS A;  4J8Q A;  1KDA A;  2R7Z B;  1PH9 A;  2QW7 A;  2NB0 A;  3J81 L;  1UEB A;  3S16 B;  1IBK L;  2J4X A;  2EPB A;  1HZA A;  3BZK A;  1Y8P B;  2FMC A;  4R4I A;  4BY1 H;  3K81 C;  2XGT A;  2QEX A;  3M3Y H;  3OWE B;  3V2T A;  3FRP B;  3GTG B;  4A3J G;  1I50 H;  1ROD A;  3FEW X;  1SJH D;  1FNW A;  3I90 A;  3S2H B;  2PCF B;  1G6Z A;  5FO8 B;  1WTQ A;  1QZG A;  3I55 A;  4RH6 A;  2D0O A;  4C3H H;  4WJ4 A;  3RZD B;  1YNN C;  1EYA A;  4KTA A;  3HOW B;  3TRZ A;  3HKS A;  2NVY H;  3FP9 A;  2P5Z X;  2K14 A;  3MHB A;  1C0A A;  3QIA A;  1LAB A;  1PZK D;  2DY8 A;  4TRD A;  3CPF A;  2VQE L;  4IFD J;  2K50 A;  2ALY B;  1DOL A;  1SRU A;  1U4R A;  4GKJ L;  4C56 C;  4ZYS A;  2KBN A;  4X66 Q;  1OXS C;  3CRL C;  2DN8 A;  3VA7 A;  3GTQ B;  3U58 A;  2ZXR A;  4FF2 A;  1LUZ A;  4LF6 Q;  5DM7 3;  3VR5 A;  4IO9 A;  1IW7 D;  4KHV A;  2MPM A;  1VQP A;  1ZYR D;  2ZXO A;  5C5M A;  1N32 L;  4IPD A;  1SR3 A;  2R92 G;  2EIF A;  3BYT B;  1TS5 A;  2OQK A;  1EIF A;  4C2M B;  4RGM A;  2Q2U A;  2EQS A;  3SHL A;  3MEF A;  3H09 A;  5CV6 A;  5D14 A;  1V8Q A;  1NAP A;  1HZ9 A;  4KJN A;  5IGG A;  2JA8 H;  1VQA A;  1PFN A;  2VQF L;  1PHJ A;  2VW9 A;  2WKC A;  2O5I C;  1VQB A;  3K57 A;  2PZW A;  4ABN A;  1JC7 A;  1ZYR C;  5CV4 A;  5I9P A;  2MGS A;  5EAY A;  2A73 B;  4KLK A;  4FF4 A;  4R9W A;  1H9M A;  2UUC Q;  2FMM A;  2M2L A;  2EOT A;  1RD9 D;  5IYC H;  4KKS A;  1GXD C;  3Q6S A;  3I4N G;  1WCM B;  1XTC D;  4LUZ A;  5IWA L;  1HTL D;  2CH4 A;  1PTO B;  1EY6 A;  4IUN A;  1RL2 A;  4F7X A;  1X65 A;  2HDL A;  1VCI A;  1SFO B;  1S4Z A;  3S2D B;  1NE3 A;  2VB2 X;  4DR5 Q;  4DK1 A;  1ENC A;  2DJG C;  2EDG A;  3HS0 C;  3R2I A;  3G4S A;  1H9R A;  1WTV A;  3K7A H;  2JA8 G;  1F9S A;  3IFT A;  1I94 L;  3PO3 G;  5KND A;  4HMI A;  4IUQ A;  2E5L L;  1NBW A;  2NVT B;  3F2U A;  2KCT A;  4AQY L;  1CM9 A;  4A76 A;  1FL0 A;  1XJV A;  1W2B A;  2Q8T A;  1L0X B;  1Y8O B;  1WD0 A;  4U68 A;  5ELB A;  3E6Z X;  2HD3 A;  1A63 A;  4IUU A;  3HEJ A;  4EQP A;  3GTJ B;  1A2U A;  2JJQ A;  2JA5 G;  2MO0 A;  4BBR H;  1EY0 A;  1QCB D;  2L0C A;  4DV1 L;  2WAQ G;  4B3M L;  2MFI A;  4POF A;  4R4O A;  3SK5 A;  2A69 C;  2B63 B;  2VL6 A;  4GOP A;  3AMU A;  1QJO A;  1BO0 A;  2FHT A;  5IGB A;  5M5X B;  1IL2 A;  1QUQ B;  4OIK A;  1KNA A;  3KJP A;  2LKV A;  1SMY D;  3WOE A;  1E2V A;  4UP8 A;  2QIL A;  3JC6 6;  4APV A;  5I4D A;  4CDD C;  4Z9C B;  5T1G A;  3T53 B;  1PH3 A;  2EXD A;  1D2B A;  3WOF A;  1MI2 A;  3HZX A;  4LNQ A;  2RCN A;  2D2C C;  1CHP D;  2KEN A;  1IBL Q;  1PH7 A;  5KYL A;  4A3J H;  3GTP B;  2NVQ B;  1SFO H;  1F9R A;  3OPO A;  1PZJ D;  2HQE A;  2B3G A;  5IP9 H;  1FJG L;  1U0L A;  1J6Q A;  1W6K A;  1WTP A;  5I2Y A;  4UP7 A;  4LJZ C;  4OL7 A;  1CFM A;  4A3L H;  3LNN A;  1K8M A;  4FDB A;  4PV1 C;  4JI7 Q;  3EN2 A;  3NP8 A;  3I4L A;  4BA1 I;  3F8T A;  4RCO A;  4ZUI A;  3N52 A;  4TSS A;  1NR2 A;  5EJW A;  4CJ1 B;  3HFZ B;  1BCP F;  2ICI A;  1EIG A;  2KA7 A;  2A1A A;  5GAG C;  1KAB A;  4A3F B;  1NY4 A;  2E8G A;  2YTY A;  4QY7 A;  2NVT H;  3MA2 B;  4P73 A;  1JOO A;  1U4M A;  4C3I B;  5M3F B;  1IL8 A;  2A6H C;  3K58 A;  1UE6 A;  3VYT A;  3VYU A;  2BH2 A;  3T4A C;  1YNX A;  3MXG A;  3GTL B;  5IYB H;  1NTG A;  4HTH A;  2PNH A;  3AFQ A;  4A3C G;  2UXB L;  1GUS A;  3OW7 A;  2FIN B;  4GLX A;  3ERQ A;  4MNO A;  5EQ0 A;  1YJW A;  1HA5 A;  5GQO A;  3CD6 A;  4IUT A;  1DOM A;  2JSO A;  2R6G A;  2ZM6 Q;  3T16 A;  3ONA B;  5C4J B;  1YEZ A;  2YV5 A;  4LF4 L;  4N9P A;  1VQL A;  1LTR D;  1TS2 A;  2PMZ E;  3R3O A;  1O7I A;  4B3S L;  3HOX G;  2CFM A;  2OT2 A;  3MFY A;  5E1F A;  1AP0 A;  3G6J B;  1PH5 A;  1YNJ C;  5L37 A;  1YBY A;  1CZG A;  1VQD A;  5BN3 A;  1I4P A;  1STB A;  1HZB A;  4JVZ A;  4CKC A;  2QDL A;  2KHJ A;  4HR7 B;  5GAH C;  1HQR D;  3OHX C;  2DNE A;  2RA4 A;  5AJ3 Q;  1E2Z A;  4A3I G;  2EY2 A;  4EVO A;  1ONL A;  2XRQ D;  1K0R A;  2AWN A;  2B2V C;  4Y7N B;  3CXC A;  4F88 A;  3D3R A;  1ZKO A;  4QQB X;  4NXN Q;  1XX8 A;  3M4Y A;  3BVG A;  1BKB A;  2RHS B;  2O2L D;  2BDO A;  1GVP A;  2CH4 W;  2K05 A;  4DV0 Q;  3M7G A;  5M3M H;  4Y52 H;  3SK6 A;  1LYL A;  5CGK A;  1F2M A;  2B63 G;  2B8F A;  4XT3 B;  4DAP A;  4IAL A;  5HGT A;  1VQ7 A;  1JB7 A;  1KRS A;  3NXW A;  4LF7 L;  3TRE A;  2LXJ A;  4DV6 Q;  1EWC A;  1I4R A;  2HIX A;  4GLA C;  4BY7 H;  3P7J A;  1YJN A;  1IBM Q;  4H13 C;  2I07 B;  5M5Y B;  3S9W A;  2EE1 A;  4QMG A;  2A8V A;  2PW5 A;  5LHY 1;  4GNX A;  3O13 A;  3S1N H;  5LL6 S;  2XWB B;  1Q46 A;  4A3D H;  4QB4 A;  1SE3 A;  3PF4 A;  1EEF D;  5C4X G;  4JI0 L;  4QIW E;  4QJF A;  2X6L A;  2BA1 A;  2A5H A;  1SNP A;  1Y1V B;  3S1R B;  2KOL A;  2QKI C;  3DHQ A;  2CHB D;  3OSO A;  2OQ0 A;  3J7Y W;  4DV2 Q;  1TWG H;  1CA6 A;  4JOI C;  1WCM G;  1N9W A;  1K83 B;  1I4Q A;  3HGB A;  2HUG A;  3A56 A;  3CC7 A;  2PMZ B;  5GAD C;  1H9K A;  2YYZ A;  3S1Q H;  5FLX L;  4B3M Q;  4XIG S;  1N33 L;  4LFB Q;  2UUB Q;  2MUY A;  1XTD A;  5JJI A;  3KF8 A;  4JK1 C;  4DV7 Q;  3RN5 A;  1L1O B;  3MXN A;  4NKL A;  3J7Z C;  1SSO A;  3KBX A;  3CC2 A;  1BXT A;  2VZA A;  4WOR A;  1V1P B;  4OHJ A;  3L2P A;  1VQI A;  1HFG A;  1X3P A;  1Q81 C;  3A8K E;  2VQE Q;  1B53 A;  2UUA Q;  4GKJ Q;  4KV6 A;  1I50 B;  1A62 A;  1A8V A;  1B3Q A;  2CVR A;  1TU2 B;  3I70 A;  1IYU A;  2D9U A;  3S24 A;  5CBA E;  3RZD H;  3I4M G;  2NYZ D;  2SDF A;  2X6G A;  2H4O A;  5E4W C;  1FD7 D;  1STA A;  5LMU Q;  5JJK A;  2PW7 A;  1VDZ A;  1VQO A;  1EUJ A;  3P1H A;  1VQ8 A;  3R8B A;  2IWH A;  2XWJ B;  1SE8 A;  3PUX A;  1GD7 A;  3PO2 H;  4CDF C;  2Z6K A;  1AH9 A;  1Q3L A;  3A0J A;  1A3U A;  1E24 A;  3PUZ A;  3GV6 A;  1G2S A;  3NWT A;  3GQB A;  4IOC A;  1Z9F A;  2K5N A;  3HOU G;  1MBY A;  2AQ2 B;  2M00 A;  3E5S A;  1PXU A;  1P16 A;  3QOJ A;  1G29 1;  1D5M C;  1LTI D;  4HID A;  5JEA H;  1CKO A;  1DM0 B;  3KLS X;  4DK0 A;  1F77 A;  4PMW A;  4BBS G;  1JOK A;  1PTO C;  2EVB A;  2I46 A;  3VA5 A;  1HUN A;  2F3W A;  3A74 A;  3S1Q B;  5IWA Q;  3TME A;  1ESR A;  1L2F A;  4H02 A;  4RKL A;  3NTH A;  5EGT A;  1U4P A;  1VQC A;  4RMF A;  2WV6 D;  5GAE C;  1RHP A;  1PV4 A;  1CTM A;  4LF8 L;  4KI0 A;  3HKZ E;  1KLU D;  2JYO A;  4R8N A;  5EPL A;  4DA2 A;  3PO2 G;  4FYD A;  2LMC B;  3LWE A;  4YCV A;  4A3I H;  4AH6 A;  1SJE D;  4MN3 A;  3OOC A;  1KQS A;  3MC0 B;  2AKW B;  4HCS A;  4E6I A;  3GTK H;  3RZO B;  1K8G A;  4JPB W;  1BCP B;  1JR0 D;  1RDP D;  3FVQ A;  5JOB A;  4LFA L;  3H3V I;  1Y1V G;  1EYC A;  3J81 E;  2RVL A;  4JI5 L;  1B2T A;  2WB1 B;  4X64 L;  1JOQ A;  1KHI A;  2G9H D;  2JA9 A;  1JT8 A;  1LTA D;  1A6X A;  3A55 A;  4A93 B;  1SRO A;  1OO9 B;  1OXU A;  4A3M G;  2OXP A;  1SYD A;  3OMC A;  1RF2 D;  4A3L G;  1EYG A;  2KED A;  3RD4 A;  3PUW A;  1IXR A;  3ITP A;  2EYL A;  1NCV A;  2PNR C;  1B1Z A;  1WFQ A;  2K04 A;  3J80 i;  3MXP A;  4LF8 Q;  1VQ5 A;  3PIO A;  3BVZ A;  4XQJ A;  3VDY A;  4JCV E;  4JI8 L;  1XWE A;  2PZT A;  2WB1 G;  2D5D A;  4O1N A;  2B2U A;  1WTR A;  2SEB D;  1G91 A;  3LX0 A;  4OEL B;  1ZXT A;  1HHV A;  2Z9H A;  2B2U C;  1SNC A;  3P75 A;  1AE2 A;  3U4V A;  1L1O A;  1YHB A;  2J0T D;  3A8I E;  3TZD A;  4LFA Q;  3GD7 A;  3CU7 A;  3KLS A;  2Q2H A;  4S3S A;  1MIU A;  3ULL A;  2JE6 I;  2VS1 A;  3S16 H;  1YHQ A;  1TWF B;  3QR8 A;  1B4O A;  1MGS A;  1PLF A;  2HCI A;  3BDO A;  3HKZ G;  3BJU A;  3T1H Q;  3HOV B;  3NBH A;  4HED A;  4LFB L;  2AQ3 B;  2BOS A;  4TQU S;  1XMO L;  1VQG A;  3D4W A;  3CPW A;  3GTP H;  5M3M B;  4ZKC B;  4DV4 Q;  1Y1W G;  1HNX L;  3K80 C;  2F0G A;  4DR5 L;  2AHO B;  3ULJ A;  1D1K A;  3GP7 A;  3CQZ B;  1CKN B;  4JI8 Q;  3DMU A;  1XXG A;  4B9X A;  2KCM A;  5CMD A;  4X6A H;  3CCU A;  4J1M A;  5FO7 B;  1PFB A;  2K03 A;  2UXB Q;  2F0N A;  4BY7 B;  1FGB D;  2QCP X;  4R4C A;  1YIJ A;  2CW0 C;  4R8I A;  1XMQ L;  2AMC B;  4QGU A;  3LWU A;  3GTQ H;  2QDB A;  3TQY A;  4R4T A;  1NMG A;  2F0T A;  4A3D B;  5IT9 L;  1T9H A;  4I7Z C;  1Z6H A;  1ENA A;  3F2C A;  1TWA H;  2GN5 A;  1BBX C;  1I4X A;  4HJ7 A;  4DNI A;  4JYA L;  3A54 A;  4FO2 A;  3MFG A;  2SNS A;  4DGZ A;  3HG9 A;  1VS0 A;  1EQR A;  2RDF A;  3A7L A;  1WD1 A;  4ZUJ A;  4RWS C;  3S15 B;  2JA6 G;  5IYC G;  1QWY A;  5H1S E;  3Q23 A;  4A4I A;  2VY3 A;  4HMJ A;  1HNX Q;  4DN4 M;  4QUC A;  3PIO 3;  4MIU A;  1GM5 A;  1B9N A;  3J81 j;  1HR0 W;  1FGU A;  3S17 H;  2WII B;  4IFD I;  2UXC Q;  4BY1 B;  4RCN A;  2AWO A;  5C44 H;  1I6V C;  1HZC A;  2JXM B;  3ZYY X;  1EWI A;  1RCV D;  1LTS D;  4OO1 H;  4NXM L;  1QZH A;  2EYO A;  1ENF A;  1N36 L;  1S5D D;  4DR6 Q;  3VYR A;  4GN4 B;  3CC4 A;  2A68 C;  3VR2 A;  4C3H B;  1WCM H;  4K0K Q;  2L5T A;  2I5L X;  4DAY B;  2B2W A;  1I6H H;  2RCF A;  3M4Q A;  1EQT A;  3H3V H;  4DUY L;  3S14 B;  3R93 A;  5KGU A;  2EYH A;  3AQQ A;  3TSS A;  1B44 D;  5I2X A;  3E9I A;  3CHB D;  5FK9 C;  1UEA B;  4HIO A;  5LMN Q;  3I4N H;  2WAQ B;  1X3F A;  5EBC A;  2F3I A;  1BQQ T;  1RTN A;  1J9O A;  2YU9 H;  1NR4 A;  1STH A;  1PRT B;  2WKD A;  3DWP A;  1GUN A;  3AU7 A;  1GHK A;  2F3V A;  4K6D A;  2J7Z A;  3UE1 A;  1VQ6 A;  1UNS A;  2Y0S G;  1TWA B;  4KY6 A;  3MZ5 A;  4HSP A;  3BU2 A;  4XQQ A;  4JI5 Q;  4GS3 A;  3J7A F;  2CW0 D;  1C9O A;  4PZ7 A;  3PUV A;  4RGT A;  4G4K A;  2A19 A;  1FYC A;  1PH2 A;  1SNO A;  2KVM A;  2LXK A;  4A3K B;  1BBW A;  3AEV A;  1PVO A;  2WIN B;  3CKI B;  1E0B A;  4QUF A;  4LF5 Q;  4PZ6 A;  1B7Y B;  2QA4 A;  2O4X A;  3FMC A;  4EQ5 A;  2UXD Q;  4O0A A;  5IYD G;  4DUY Q;  2X69 A;  3RR5 A;  1F2L A;  4PQX A;  5C3X A;  1OTC A;  2R92 B;  3QG1 A;  2K52 A;  3RLN A;  1PFM A;  3U9O A;  5K36 G;  1SEB D;  2F0L A;  4BA2 I;  2N78 A;  2ZTC A;  1SMX A;  4LUV A;  4A3I B;  4EQO A;  5BN5 A;  4BY7 G;  4DV5 L;  3KLR A;  4O2D A;  4O42 A;  2F0J A;  3GTO B;  1BUV T;  3PGZ A;  4K2L A;  1CKN A;  4XT1 B;  3RZO H;  1JOR A;  3S2D H;  2F0F A;  1CSQ A;  4P2C B;  3W1B A;  2NVQ H;  1BVS A;  1M8A A;  3RNU A;  2VXW A;  3T56 B;  2QEJ C;  2MNA A;  1CHQ D;  2NN6 G;  2K33 A;  4B3S Q;  1VQN A;  4JI4 L;  2F0O A;  3VR6 A;  3AYH B;  4OON A;  4N8F A;  3T1H L;  2F03 A;  3EFX D;  5COY A;  3KF6 A;  4QL5 A;  2TMP A;  1WYD A;  2ZTE A;  2L55 A;  2KHI A;  4KKT A;  2Q2I A;  4A3B G;  4A3F G;  5KIX A;  4NDX A;  4GOP C;  3DUZ A;  1AN8 A;  1R9T B;  3OYY A;  4X66 L;  1F2Z A;  4GNX B;  3D6C A;  1EQQ A;  1C8C A;  1I4H A;  1S5C D;  4WJW A;  5CV9 A;  2RF4 A;  4A3K H;  5NUC A;  1LTL A;  1ILQ A;  1HTP A;  2M9V A;  5FLX E;  3TZU A;  4A3G B;  4LF9 Q;  1PYS B;  4JI1 Q;  4DR2 Q;  3CME A;  4GOP B;  3FKI G;  4NMZ A;  1LM0 A;  2A74 C;  3RN2 A;  4ALP A;  1U5K A;  2E2H H;  4JV5 Q;  3EQL C;  1B8A A;  4L5T A;  3L7Z C;  2KEC A;  2NTS A;  5A2Q E;  2B29 A;  3FPU B;  2DY7 A;  2LFN A;  4DXG A;  1QUQ A;  3F2D A;  1ILP A;  3S2H H;  2B2Y C;  3JAM i;  4EGV A;  5ELE A;  3URY A;  1DZ1 A;  4K2K A;  3BDC A;  4JI4 Q;  2JA7 B;  2HDM A;  3U50 C;  2ZXP A;  4DAY A;  5IP7 H;  1IKM A;  1DGS A;  1E7Z A;  3EBE A;  2ATW A;  4AYB G;  5C3E B;  1I5F A;  1STN A;  1KAW A;  2F52 A;  4P75 A;  3QJY A;  3GTM B;  4ZRZ A;  1JWM D;  4EX5 A;  4MTK A;  1QVC A;  3TS2 A;  2ZT9 C;  4DV7 L;  4HJA A;  2XRS D;  2XVS A;  1DCZ A;  1C7Y A;  4C3J H;  3FKI B;  1V1P A;  1PDQ A;  2E2I H;  1IKL A;  3TDQ A;  2NVY B;  5IGC A;  3J81 c;  2RDG A;  1PH6 A;  2KQ3 A;  1S40 A;  1BOS A;  3A5Z B;  1HA6 A;  2B2Y A;  2R93 B;  2EY5 A;  1QG7 A;  3MVV A;  3ND9 A;  4EQN A;  2HQL A;  4ME3 A;  4K0K L;  4HAE A;  3HOZ G;  3GTK B;  3K7U C;  3SDZ A;  4M8A A;  3K5L A;  4UY8 C;  4JV5 L;  4KHP Q;  5E3F A;  2N3S A;  2Z6K C;  2JA8 B;  1R4P B;  3BVM A;  1EEI D;  4YWL A;  3M4P A;  2PI2 E;  4NB3 A;  1U4L A;  3IFD A;  3C1F A;  1HR0 L;  2F0I A;  1SLJ A;  1MSG A;  4G7Z C;  3HOY H;  1YHA A;  5M5W B;  3K59 A;  4A3G G;  4G7H C;  2F0H A;  1YNJ D;  3I4O A;  5IY0 A;  2E5L Q;  1EQV A;  3A8J E;  4KD3 A;  5G3L F;  1X9N A;  4G57 A;  1O7Y A;  4DF7 A;  1N8R C;  1LT5 D;  3H0G H;  3E0J A;  1G51 A;  3K5N A;  5LMU L;  4DR4 L;  4LWC A;  5IGD A;  1EZ8 A;  2O5J C;  1QE6 A;  4NXN L;  1TWG B;  4IZ8 A;  1F9P A;  3N6R A;  1W3S A;  4PMC A;  3SR1 A;  4CJ0 B;  5JPM C;  1JWU D;  3T1Y Q;  4C3H G;  5KYI A;  2BCO A;  2IPK D;  1V9P A;  1GJX A;  4JI3 Q;  2HIV A;  1B50 A;  4HIK A;  4OGQ C;  5FO9 B;  3L9A X;  2F0U A;  1Y8N B;  1PYB A;  2E75 C;  2B2V A;  1DD2 A;  3D8G A;  2A6E D;  3HOW G;  1SNM A;  1WTH A;  3BDL A;  4KHZ A;  4IN3 A; 
#chains in the Genus database with same CATH homology
 1R9T H;  4JI2 L;  4YCV A;  4A3I H;  1UEB A;  4JI0 Q;  1PA6 A;  4AH6 A;  3DM3 A;  1IBK L;  1UWV A;  3GTJ H;  1HZA A;  3BZK A;  2K75 A;  3PSI A;  4R4I A;  4BY1 H;  3K81 C;  2XGT A;  1KQS A;  2AKW B;  4AIM A;  2QEX A;  1J5E Q;  2OTL A;  3M3Y H;  1E3P A;  5C0X G;  3G48 A;  1XPU A;  3GTK H;  2JQO A;  2R93 G;  3UE0 A;  3S15 H;  4A3J G;  1K8G A;  1I50 H;  4LFA L;  2JEB I;  3WWV A;  4UPA A;  1PH9 A;  1Y1V G;  1IBK Q;  1VQK A;  3H3V I;  4JI5 L;  1QZG A;  3PF5 A;  3I55 A;  4X64 L;  2D0O A;  4L5Q A;  4C3H H;  4WJ4 A;  1H95 A;  1KHI A;  2JA9 A;  3CCR A;  1J5E L;  1JT8 A;  4X65 L;  3S1R H;  4JBW A;  3CCE A;  1PFS A;  3TRZ A;  3HKS A;  1IYJ B;  2NVY H;  1SRO A;  1VQH A;  2LSS A;  1OXU A;  3FP9 A;  2K14 A;  4A3M G;  1C0A A;  4DV1 Q;  3KDF B;  2WFW A;  3CPF A;  4HJ9 A;  4TVA B;  2C35 B;  4A3L G;  4YY3 L;  2VQE L;  4OWT B;  1EYG A;  4LF5 L;  4IFD J;  1N32 Q;  4IPH A;  2K50 A;  4HJ5 A;  2ALY B;  3PUW A;  1SRU A;  1HNZ L;  1IXR A;  1VQ4 A;  3S14 H;  4GKJ L;  4JI6 Q;  2KBN A;  4X66 Q;  1OXS C;  1Q1B A;  1X3G A;  2K5V A;  4IPG A;  1TWC H;  3U58 A;  2NZO A;  1LUZ A;  1MJC A;  1WFQ A;  4LF6 Q;  3K8A A;  3J80 i;  4LF8 Q;  1VQ5 A;  3PIO A;  4DV6 L;  4IO9 A;  1VQP A;  3VDY A;  4JCV E;  3KDF A;  4JI8 L;  3UDI A;  1N32 L;  3D0F A;  4L5R C;  1JJ2 A;  4IPD A;  2F4V L;  2WB1 G;  5IYB G;  1SR3 A;  1IBM L;  4BY1 G;  1Q86 C;  2R92 G;  2VUM G;  2EIF A;  2R93 H;  2OQK A;  1EIF A;  2Q2U A;  1RIP A;  2EQS A;  3RLF A;  2OTJ A;  3H15 A;  4OWX B;  5IT9 c;  3MEF A;  1AE2 A;  3U4V A;  1L1O A;  3HOV H;  4R4Q A;  1YHB A;  4UP9 A;  4R1J A;  1HZ9 A;  2JA8 H;  4LFA Q;  3M9B A;  1VQA A;  2VQF L;  3NEM A;  3GD7 A;  5LMN L;  1PHJ A;  1KD1 C;  2F4V Q;  2VW9 A;  3PO3 H;  1FVI A;  2Q2H A;  1MIU A;  1NMF A;  1VQB A;  3ULL A;  2JE6 I;  3J81 i;  1HJP A;  2VS1 A;  3S16 H;  2MO1 A;  2D0P A;  4JYA Q;  3B6Y A;  1YHQ A;  2WAQ E;  5EAY A;  5M3F G;  5DLQ E;  3UDF A;  4KLK A;  2UU9 L;  3HKZ G;  4NPS A;  3BJU A;  2JEA I;  3T1H Q;  4C3I H;  5M3F H;  2UUC Q;  5M5X H;  4LFB L;  4TQU S;  2CWP A;  5IYC H;  1XMO L;  2UUB L;  3M7N A;  1VQG A;  3CCV A;  3CPW A;  3GTP H;  4GN3 B;  1KIX A;  4DV4 Q;  3CCJ A;  1Y1W G;  1HNX L;  3I4N G;  1UE1 A;  3K80 C;  4LUZ A;  2K4K A;  5IWA L;  1L0W A;  4DR5 L;  2AHO B;  3ULJ A;  1N34 L;  2ASB A;  1XNQ L;  1CKN B;  1RL2 A;  4JI8 Q;  2KCM A;  1X65 A;  2FXQ A;  4X6A H;  3KYH C;  3CCU A;  1VCI A;  3OTO L;  3L0O A;  3KLW A;  2WP8 J;  2UXB Q;  4DV4 L;  1YIJ A;  4R4C A;  4IPC A;  1K3R A;  1XMQ L;  2AMC B;  1Q12 A;  2N8N A;  2DGY A;  1NE3 A;  2NZH A;  4QGU A;  4DR5 Q;  4A3E G;  3GTQ H;  4A75 A;  3A5U A;  4IJH A;  3TQY A;  1HH2 P;  1X3E A;  1EFW A;  4JI2 Q;  4R4T A;  4DR2 L;  1SN8 A;  1NMG A;  3G4S A;  1T9H A;  2QGQ A;  3NEN A;  3F2C A;  1TWA H;  2GN5 A;  3CP0 A;  1M1K C;  1X56 A;  3UDG A;  4X62 L;  3K7A H;  2ZJP A;  4HJ7 A;  4DNI A;  4JYA L;  2JA8 G;  5M3M G;  4IFD G;  1I94 L;  3PO3 G;  4DR1 L;  3S1M H;  4OWW B;  2E5L L;  1NBW A;  4YWM A;  3E9H A;  2KCT A;  1YZ6 A;  4AQY L;  1VS0 A;  2UU9 Q;  4POG A;  4A76 A;  1FL0 A;  1EQR A;  3GDE A;  4A3C H;  1TXY A;  3CW2 C;  5IYD H;  2R7Z H;  1XJV A;  2IHE A;  1XPO A;  1W2B A;  2JA6 G;  5IYC G;  1XMO Q;  4DR4 Q;  1PH8 A;  4NXM Q;  1VQF A;  5FLX c;  5H1S E;  4DPG A;  4A4I A;  4X65 Q;  2VY3 A;  4JI7 L;  1A63 A;  2I0Q A;  1HNX Q;  1I3Q H;  4YHH L;  4WJ3 M;  1GM5 A;  2JJQ A;  3J81 j;  1HR0 W;  1FGU A;  2JA5 G;  2MO0 A;  5C4X H;  4BBR H;  3S17 H;  1AE3 A;  4DV1 L;  4DR7 Q;  4IFD I;  2UXC Q;  2AWO A;  2WAQ G;  5C44 H;  1Z47 A;  4B3M L;  2MFI A;  1HZC A;  4POF A;  4R4O A;  4YY3 Q;  3HOV G;  3KJO A;  1EWI A;  2VL6 A;  5HY6 A;  4GOP A;  4NXM L;  1QZH A;  4GKK L;  5C44 G;  2HHH Q;  4IJL A;  1N36 L;  1IL2 A;  1Q8K A;  1QUQ B;  4LF6 L;  4DR6 Q;  1JJC B;  3KJP A;  5GRO A;  2VNU D;  4GN4 B;  4GN5 A;  3CC4 A;  3ZJY C;  4UP8 A;  3JC6 6;  1WCM H;  4K0K Q;  4APV A;  1YI2 A;  2I5L X;  4DAY B;  1M90 C;  1I6H H;  3ER0 A;  2IY5 B;  1PH3 A;  3M4Q A;  2EXD A;  2H5X A;  4GNX C;  3OW2 A;  3H3V H;  4LUO A;  1Y1V H;  4DUY L;  4LNQ A;  3FHW A;  2RCN A;  3AQQ A;  4BBS H;  2KEN A;  3ERS X;  5M5Y H;  1I94 Q;  1IBL Q;  1PH7 A;  4A3J H;  4LF9 L;  4A3F H;  3E9I A;  3DLL A;  1SFO H;  1KL9 A;  4HIO A;  3HOU H;  1A0I A;  3ICE A;  3CMA A;  2B3G A;  5LMN Q;  5IP9 H;  1FJG L;  3I4N H;  4BXX H;  5JJL A;  1U0L A;  1X3F A;  2F3I A;  3H0G G;  1J6Q A;  5FJ8 H;  2DUD A;  2YU9 H;  2JA7 H;  4UP7 A;  3KF8 B;  4A3L H;  2R7F A;  3PV0 A;  4FDB A;  2ES2 A;  4JI7 Q;  3EN2 A;  2E2J H;  3CCL A;  3MXN B;  1TWH H;  4DV5 Q;  5C3E H;  4BA1 I;  3F8T A;  4C2M H;  3UE1 A;  1G6P A;  1KXL A;  1VQ6 A;  1CSP A;  2Y0S G;  4B3T Q;  4JBM A;  2RHQ B;  3HFZ B;  3BU2 A;  3ULP A;  4JI5 Q;  4GS3 A;  2UUC L;  3HOY G;  2A1A A;  1C9O A;  4PZ7 A;  3PUV A;  5GAG C;  4HJ8 A;  1NY4 A;  1B70 B;  2CQO A;  2A19 A;  4DV2 L;  2E8G A;  2YTY A;  4QY7 A;  2UXD L;  2NVT H;  2HHH L;  4P73 A;  4DUZ Q;  1PH2 A;  2D62 A;  3Q8D A;  3BZC A;  1X6O A;  5HGQ A;  2VUM H;  1S3O A;  1XNR L;  2LXK A;  1CUK A;  1UE6 A;  1BBW A;  3AEV A;  1PVO A;  2BH2 A;  1YNX A;  2ID0 A;  4LF5 Q;  4PZ6 A;  3HOW H;  1B7Y B;  5IYB H;  1NTG A;  1OXT A;  3STB C;  3OTO Q;  2PNH A;  4EQ5 A;  2QA4 A;  1JMC A;  2UXD Q;  4MTN A;  4O0A A;  3AFQ A;  2ZTD A;  3UDX A;  5IYD G;  3GTO H;  4DUY Q;  4A3C G;  2UXB L;  3RR5 A;  4GLX A;  4MNO A;  1L1O C;  1XMQ Q;  2JK8 A;  4J15 A;  1IBL L;  3J7A 5;  1OTC A;  1YJW A;  1VQ9 A;  5GQO A;  1Q7Y C;  1YJ9 A;  2K52 A;  4JBJ A;  3RLN A;  5BR8 L;  3I56 A;  1KC8 C;  3CD6 A;  3CAM A;  1FJG Q;  1KRT A;  5K36 G;  4BA2 I;  2R6G A;  2ZM6 Q;  2N78 A;  3LGJ A;  2ZTC A;  5FJ8 G;  1SMX A;  4LUV A;  4DK6 C;  1GO3 E;  3TS0 A;  2WB1 E;  4AYB E;  4BY7 G;  4XTC S;  1VQJ A;  4BXX G;  1YEZ A;  2Z0S A;  2YV5 A;  5C3E G;  3NEL A;  4DV5 L;  4DR1 Q;  4LF4 L;  2IT1 A;  3F2B A;  1VQL A;  2PMZ E;  4O2D A;  1WOC A;  1O7I A;  2IHF A;  3HOX G;  2CFM A;  3CCQ A;  3PGZ A;  4JI1 L;  3W5O A;  4AQY Q;  4B3S L;  1CKN A;  1BBU A;  2NN6 I;  4B3T L;  2JA7 G;  2CKZ B;  3RZO H;  1OXV A;  1HR0 Q;  1PH5 A;  1ASY A;  5ELO A;  3S2D H;  4DK3 C;  2R92 H;  1CSQ A;  3W1B A;  1Q1E A;  4A3D G;  1YBY A;  1VQD A;  3K0X A;  2NVQ H;  1BVS A;  2I5H A;  4OO1 G;  2Y0S E;  3RNU A;  4LFC L;  1HZB A;  1E1O A;  2MNA A;  2KHJ A;  4YCU A;  1XNR Q;  5GAH C;  4A3B H;  2NN6 G;  4B3S Q;  2PI2 A;  1VQN A;  5AJ3 Q;  3HOX H;  4A3I G;  4JI4 L;  3AYH B;  4JC0 A;  4OON A;  3W1G A;  2GVA A;  3T1H L;  1K0R A;  2AWN A;  1YIT A;  4X64 Q;  3KF6 A;  3CXC A;  2OCE A;  4QL5 A;  1K73 C;  4L5S A;  4A3G H;  4LFC Q;  3U4Z A;  4QQB X;  4LF7 Q;  4NXN Q;  1BKB A;  1D8L A;  1WYD A;  2ZTE A;  2RHS B;  5FLM H;  2KHI A;  3IRB A;  3G6E A;  4OXP A;  2B63 H;  1GVP A;  2Q2I A;  2YTX A;  4YWK A;  4DV0 Q;  4A3F G;  4A3B G;  1MJE A;  5BR8 Q;  2NVX H;  5M3M H;  2CCZ A;  4Y52 H;  1PH4 A;  4GOP C;  1LYL A;  3CF5 A;  3GO5 A;  2B63 G;  1HNZ Q;  1VQ7 A;  3KF6 B;  5LMN W;  1K8A C;  1JB7 A;  3OYY A;  4X66 L;  5C0X I;  4GNX B;  3D31 A;  1KRS A;  1EQQ A;  2RF4 A;  4A3K H;  3TRE A;  4LF7 L;  2R7Z G;  2LXJ A;  1LTL A;  4B3R Q;  4Y7N H;  1HNW Q;  2IX1 A;  4JI3 L;  2JA6 H;  4HIM A;  4DV6 Q;  4LF9 Q;  1PYS B;  2HIX A;  4GLA C;  4MZ9 A;  3GTM H;  4JI1 Q;  3M85 A;  4DR2 Q;  3PIP A;  4BY7 H;  3CME A;  1YJN A;  1IBM Q;  3KFU A;  2UUA L;  5C0X J;  4GOP B;  3FKI G;  3RN2 A;  1LM0 A;  4JV5 Q;  2E2H H;  4ALP A;  1U5K A;  2ZJQ A;  2A8V A;  1E1T A;  1B8A A;  4L5T A;  3L7Z C;  4X62 Q;  2YTV A;  4GNX A;  2B29 A;  3I4M H;  4B3R L;  3S1N H;  1QUQ A;  3F2D A;  3S2H H;  2OWO A;  1Q46 A;  3JAM i;  4A3D H;  3PF4 A;  5C4X G;  4BBR G;  2BH8 A;  4YCW A;  2JA5 H;  4JI0 L;  1EOV A;  4QIW E;  4QJF A;  5AJ3 L;  3E0E A;  2BA1 A;  3U50 C;  4DR3 L;  2Q2T A;  4JI4 Q;  1Y14 B;  5IP7 H;  1DGS A;  1N33 Q;  1CKM A;  1E7Z A;  3EBE A;  2ATW A;  4AYB G;  1JJG A;  2OQ0 A;  1I5F A;  2F52 A;  1KAW A;  4P75 A;  4DV2 Q;  1TWG H;  4JOI C;  1WCM G;  1N9W A;  5ELN A;  4EX5 A;  4A93 G;  1QVC A;  4DUZ L;  1MKH A;  1VQE A;  3TS2 A;  4RG1 A;  4DV7 L;  1GKH A;  4HJA A;  4YHH Q;  3TEH B;  3CC7 A;  1XPR A;  4GLV B;  4PG3 A;  4C3J H;  5GAD C;  1C7Y A;  4DR7 L;  2YYZ A;  4DV0 L;  2E2I H;  2UXC L;  3PCO B;  4DR3 Q;  3S1Q H;  4A93 H;  1QVG A;  4B3M Q;  4XIG S;  3G71 A;  3I7F A;  3J81 c;  2ZJR A;  1N33 L;  4LFB Q;  1V43 A;  3AFP A;  1PH6 A;  1JE5 A;  2UUB Q;  1S40 A;  1X55 A;  3A5Z B;  1XTD A;  5JJI A;  2I5M X;  1N36 Q;  4P71 A;  4DV3 L;  3RN5 A;  4DV7 Q;  1HNW L;  4DR6 L;  1L1O B;  3J7Z C;  3GTL H;  1N34 Q;  3CC2 A;  2VZA A;  1K83 H;  5M5W H;  1XNQ Q;  3L2P A;  1VQI A;  1OXX K;  2HQL A;  1S72 A;  2HT1 A;  1Q81 C;  4ME3 A;  3SGI A;  2VQE Q;  3HOZ G;  4K0K L;  3K7U C;  4JOI A;  4UY8 C;  2MQH A;  2UUA Q;  3FKI H;  4OX9 L;  2ZM6 L;  4GKJ Q;  4JV5 L;  4KHP Q;  1A62 A;  1YVC A;  4DV3 Q;  3PUY A;  2N3S A;  1K9M C;  3HOZ H;  1A8V A;  2Z6K C;  4YWL A;  4JG2 A;  1E22 A;  3M4P A;  2PI2 E;  4NB3 A;  2PQA B;  1TWF H;  3F1Z A;  3S24 A;  3KOJ A;  3CCM A;  3GTG H;  3RZD H;  4OO1 I;  1ASZ A;  3I4M G;  1HR0 L;  3NBH B;  5FLM G;  5C4J H;  1SLJ A;  1Y1W H;  3HOY H;  4OX9 Q;  1YHA A;  1V1Q A;  3JAM c;  5LMU Q;  5JJK A;  4A3G G;  1IZ6 A;  1NJI C;  3I4O A;  4DKA C;  1EUJ A;  3J80 c;  1VQO A;  1VQM A;  1VQ8 A;  4IOA A;  1SE8 A;  5IY0 A;  3PUX A;  2E5L Q;  1GD7 A;  5IP7 G;  1X54 A;  3PO2 H;  1Q82 C;  3M4O H;  1PH1 A;  2PQA A;  4P74 A;  2Z6K A;  1X9N A;  2VQF Q;  2GVB A;  1N8R C;  1AH9 A;  3A0J A;  3H0G H;  4JBK A;  1G51 A;  1E24 A;  2K5H A;  3I2Z A;  3PUZ A;  5LMU L;  1WI5 A;  4IOC A;  4DR4 L;  1Z9F A;  4LWC A;  2K5N A;  3HOU G;  1UE5 A;  1D7Q A;  3STB D;  5IP9 G;  3CQZ H;  4NXN L;  1P16 A;  3EIV A;  1G29 1;  1UE7 A;  2L15 A;  5E7N A;  4HID A;  1QVF A;  2N49 A;  4DAM A;  1CKO A;  1W3S A;  4PMW A;  3RLO A;  4BBS G;  4A3M H;  2R7D A;  5IE8 A;  3T1Y Q;  1P8L A;  4LW1 A;  4GKK Q;  4KHP L;  5JEA J;  3A74 A;  2XTI A;  1V9P A;  5IWA Q;  4JI3 Q;  2HIV A;  4P72 A;  5JEA G;  1L2F A;  4HIK A;  4H02 A;  2IX0 A;  4A3K G;  5J3B A;  1VQC A;  4RMF A;  2CWA A;  3T1Y L;  4JI6 L;  5GAE C;  1PV4 A;  1WJJ A;  2BA0 A;  1PYB A;  4PZ8 A;  4LF8 L;  4KI0 A;  3HKZ E;  3CCS A;  3HOW G;  4LF4 Q;  2V1C C;  3PO2 G;  4KHZ A;  4A3E H;  1EIY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...