4LUVA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luvA00
4BXXG 4K0KL 2D0OA 3PF5A 1A8VA 4JI6L 3T1HQ 5GADC 2ASBA 2OWOA 4JOIC 1VQ4A 2MNAA 3TRZA 4QGUA 4O2DA 3U4ZA 4JYAQ 4GKJQ 2PI2A 4JI2Q 4JV5Q 4UPAA 2R92G 3JAMi 2K14A 2FXQA 4GOPB 4HJ7A 1XMQQ 2WP8J 4EX5A 3DM3A 1XMOL 2JK8A 1IBKL 2XGTA 1YJWA 4LFBL 4HJ5A 4PG3A 1JJGA 4DV4L 5GROA 1HH2P 2VQEQ 2UUBL 4DAMA 2N3SA 3E9IA 1FJGQ 2E2JH 4DR5L 2JE6I 3M3YH 4A93G 2L15A 4IO9A 4JI7L 4LF5L 3AEVA 4P75A 1OXTA 4NPSA 1G291 2ATWA 1I50H 4C3JH 3F2CA 3ULPA 2ZJQA 3RLFA 1VQBA 3D0FA 1Q7YC 1PH8A 4BA1I 2RHSB 1N33Q 5IYBH 3KLWA 1KL9A 3W1BA 4AYBG 3HFZB 4QIWE 2R93G 2N78A 2DUDA 4BXXH 4B3TQ 1GD7A 2IHFA 3ULLA 4AYBE 4OWXB 4OX9Q 1NJIC 3T1YL 3S1NH 1K8AC 1OXXK 4LUZA 2NN6I 1WYDA 4DR7L 5M3MG 4QQBX 4JI0Q 4DV2Q 2E2HH 2PI2E 2YTXA 3L2PA 3EIVA 4LF9Q 1KHIA 3F1ZA 4IPGA 1K3RA 1TWCH 4B3ML 4DV5L 3S2HH 2K5VA 1GO3E 2NZHA 4DUYQ 1D7QA 2GVBA 4JI1Q 1VQJA 4DUZQ 4DR6Q 2NN6G 4MTNA 5ELNA 2MO1A 4DNIA 5LMUQ 2E2IH 2JA7H 1N32L 4A93H 2DGYA 1IBLQ 1N8RC 1PYBA 2JQOA 3S2DH 3U50C 3H0GG 2VQFL 1VQKA 3G6EA 1HNWQ 4KHPQ 3ULJA 2ES2A 2E5LQ 2IY5B 1PH2A 1P16A 5JEAJ 5AJ3Q 3PF4A 3M4OH 1Q8KA 4FDBA 2UUCQ 1H95A 3CC7A 2Z0SA 5M5XH 4MZ9A 1Q81C 1WOCA 3CCMA 2D62A 4TQUS 2OTJA 3PUZA 3KF8B 2OQ0A 1L1OC 1N34L 4UP9A 4JI4Q 5M3MH 3PCOB 2ZJPA 4AH6A 1J5EL 4JI5L 1CKNB 4B3RQ 4IPCA 2B29A 1NMGA 4LFCL 3G71A 4JI3Q 4X6AH 4IFDJ 2LSSA 4JG2A 1LYLA 1PH4A 1HJPA 1YHBA 5IWAQ 2Y0SG 3PGZA 4A3CG 1B8AA 5GAEC 1X65A 3CMAA 2ZTCA 3IRBA 4X65L 1HR0Q 2Y0SE 2Q2TA 2C35B 2GN5A 5JJLA 2VY3A 3H0GH 4WJ3M 3J81j 5IE8A 1YHAA 4L5TA 5IP9G 4XIGS 1UE6A 1Q46A 1KRTA 3H15A 1EYGA 3AFPA 3J7A5 4YWMA 2JEAI 1SRUA 3BU2A 3RLNA 5BR8Q 4NXML 2ZTEA 3PUVA 4X66L 1EOVA 1FGUA 4YCUA 1YI2A 2B63G 2IT1A 3FHWA 1AH9A 1HNZL 1V43A 4HIDA 3S1RH 1BBUA 1I94Q 2UXCQ 4JOIA 1Y14B 2KCTA 4DR1Q 4DR3L 1LM0A 3NELA 4YHHL 1XJVA 3E9HA 3PO2G 1J6QA 1T9HA 3JC66 3K7UC 1Y1WG 4YY3Q 1S40A 3GTOH 4B3SL 1AE3A 4A3BG 4DK6C 3J81c 2JA8G 1A62A 2LXKA 4LFAQ 1JMCA 4NXNQ 4LF6Q 4ALPA 2EXDA 3BZCA 1PYSB 2ZTDA 5IYDH 4GNXC 3U4VA 3S1QH 1Q86C 1VQ5A 1X3GA 4GS3A 5J3BA 2UXDQ 3ERSX 1SMXA 1HNXL 1PH7A 1S3OA 4GKKQ 2R7DA 1E1OA 2YTVA 4JBKA 4AQYQ 4A3CH 2A8VA 3HOUG 1NBWA 2HHHL 1YHQA 4A3KH 2A1AA 2ZM6Q 1N36L 5FLMG 1QZGA 3RLOA 2OTLA 4DV7L 1S72A 1O7IA 1OXSC 5IP9H 4A3LH 4Y52H 2A19A 2B3GA 1B70B 4Y7NH 2XTIA 4J15A 1QVGA 3A0JA 1IBMQ 2B63H 1VQMA 1XNQL 2VUMH 4WJ4A 5C0XI 4DK3C 4X62L 3GTQH 1VQGA 1G51A 3EBEA 4DV0L 3SGIA 4RMFA 1XMOQ 2YU9H 3CMEA 1YVCA 4A3EH 2AWNA 4IJHA 4DV4Q 3PO2H 4KI0A 2K4KA 4GLAC 1Y1WH 3J81i 2UUBQ 2QA4A 3K80C 1TWGH 4A3BH 2QEXA 1YJNA 3F2BA 1K9MC 5HY6A 4L5QA 3B6YA 1AE2A 1IZ6A 1PH6A 3T1HL 3CAMA 1EQRA 4YWKA 4C2MH 3HOWG 1VQAA 5C0XG 3GTGH 5DLQE 2HT1A 3CQZH 2F3IA 2LXJA 4POGA 4LUVA 3GTLH 4JYAL 4GKJL 3ZJYC 4JV5L 4GN4B 1RL2A 4LUOA 2KBNA 4BY1G 5FLXc 4NB3A 1XPRA 3H3VI 4A3GG 1VQPA 3HOUH 4R4TA 4OO1I 3L7ZC 5FJ8G 1GVPA 1NE3A 4QJFA 3STBC 1U5KA 3T1YQ 1V9PA 2CQOA 1BKBA 4JCVE 5FLMH 2VW9A 4DR2Q 4DR7Q 3ER0A 3W1GA 3DLLA 2VQEL 2WFWA 2Q2UA 2AKWB 5IYCG 4A76A 1FJGL 2H5XA 3S24A 2HIVA 4LWCA 3KJPA 3RNUA 1Y1VG 2R92H 4JBJA 4C3HH 1G6PA 1YJ9A 1L1OA 4B3MQ 3KF6A 4KLKA 4OO1G 3OTOL 4IOAA 4X64L 2UU9L 4BBRG 4HJ9A 1N33L 2IX1A 4A4IA 1YZ6A 4PZ6A 4DV6L 1PH1A 3BZKA 3I4MG 3Q8DA 2F4VQ 1N32Q 3F2DA 2NVQH 2VNUD 3K8AA 5C44G 3J80c 4DV3Q 2VQFQ 4LF4Q 2YYZA 4A3FG 5JJIA 4IPHA 2PMZE 4JI0L 3CC2A 4BY1H 2JJQA 2QGQA 3I55A 5HGQA 3RZOH 1HZ9A 3K81C 5C4JH 1KIXA 1QZHA 3K0XA 4A3GH 2R93H 1VQHA 1NY4A 2CWAA 4P73A 4DPGA 3STBD 1GM5A 4OWWB 1N34Q 1Z9FA 4DKAC 2CWPA 1IL2A 1C0AA 4JI1L 4LF7Q 2RCNA 4DR6L 4BBSG 5K36G 3PV0A 5IYCH 5LMUL 1NMFA 1EWIA 2JEBI 3AFQA 2Q2HA 3PUXA 3PSIA 4YWLA 1IBLL 1XNRQ 2D0PA 3M7NA 1W2BA 1SROA 1SFOH 3HOVG 3GO5A 2HIXA 2RHQB 5M5WH 1HNWL 4GOPC 3S1MH 4KHPL 1HZCA 4HIOA 3TS0A 1FL0A 4BBRH 1VQ7A 3MXNB 4XTCS 2F52A 2YV5A 5AJ3L 2WAQG 3FKIG 2NVTH 3M85A 1CKMA 2UUCL 4GNXA 1BBWA 2EQSA 1ASZA 3PO3G 2R6GA 2WAQE 3J80i 1PH5A 4UP8A 5C3EG 1VQCA 5JEAG 4A3FH 1WFQA 4A3DG 4HIMA 1QVCA 4IFDI 2Q2IA 4UP7A 4NXMQ 4R4OA 4X66Q 1IXRA 1YBYA 1WI5A 2WB1G 1OXUA 4R4QA 1HNZQ 3TEHB 2ZJRA 4JI3L 3OW2A 5M3FG 4DR3Q 1TWFH 2R7ZG 4YHHQ 2UUAQ 5IY0A 5IWAL 4DV1Q 1CSQA 2VZAA 5LMNL 1E1TA 2AMCB 1PA6A 1WCMG 4B3SQ 1X56A 4BBSH 3PUWA 2UXBL 1HR0L 1QVFA 2GVAA 4C3IH 1TWHH 1CSPA 1Q12A 1UE5A 1C7YA 2CFMA 2JA6G 3HOZG 3HOVH 3CCJA 3GTJH 1X3FA 1KD1C 3M4PA 3NENA 3PIOA 3CCRA 1PH3A 1LTLA 2Z6KC 4JI8L 2K50A 2K5HA 5LMNW 4PZ7A 4IOCA 3ICEA 1E7ZA 4K0KQ 1Q1EA 1I94L 3UDGA 2JA9A 1HR0W 2VL6A 4JI6Q 4DR4L 3FP9A 2IHEA 3I56A 2PQAA 2K75A 5C3EH 3CW2C 3F8TA 4DV7Q 3CPWA 4YY3L 1Q82C 4A3DH 1VQDA 4JBMA 1K83H 4LF8L 5GQOA 2BH8A 4NXNL 4PMWA 4LF6L 1XNQQ 3RZDH 3I4NG 4R1JA 4X62Q 1A0IA 5E7NA 4DV0Q 1PH9A 5EAYA 3CP0A 1V1QA 3KDFA 1CUKA 3G48A 1IBKQ 2UXDL 3I2ZA 4LFBQ 4GKKL 2PNHA 1PFSA 4HJAA 3CD6A 2RF4A 3MEFA 1M1KC 4DR5Q 3GTKH 5IT9c 2JA8H 1L1OB 3KF6B 5ELOA 3PUYA 4JI7Q 1BVSA 2N49A 2OCEA 2ZM6L 4GN5A 1VCIA 1U0LA 4P74A 3CF5A 1EFWA 4L5RC 4LF5Q 2JA6H 3HOZH 3E0EA 3I7FA 1I5FA 3L0OA 1I6HH 2BA1A 1EIFA 1A63A 3A74A 4JI2L 1KAWA 3NBHB 1IBML 1UE1A 1VQNA 1HZAA 1YEZA 3S16H 1VQEA 4GLVB 3GD7A 1XMQL 1ASYA 4HJ8A 4BY7G 4A75A 2JA5G 2CKZB 3S17H 4JC0A 2JA7G 1C9OA 3CCUA 2KHIA 3CCSA 3I4NH 2I5LX 5C4XG 1KQSA 1WJJA 3OYYA 3G4SA 2N8NA 3OTOQ 4DV5Q 1L0WA 4X64Q 1JB7A 2UU9Q 3HOYG 1X55A 1M90C 3GTMH 1TWAH 4YCWA 3WWVA 3U58A 4DV6Q 2I5HA 1Q1BA 1FVIA 1W3SA 5H1SE 3M9BA 2MFIA 3KJOA 1K0RA 4GOPA 4B3TL 1SN8A 3UDXA 4A3MG 1JJ2A 4OX9L 4DR2L 3GTPH 4APVA 4P72A 3HOWH 4P71A 4HIKA 2K52A 4H02A 4UY8C 4DV2L 1E22A 1OTCA 3CPFA 4GNXB 1NTGA 1XPUA 4LF9L 2ALYB 4QL5A 4A3JG 1QUQB 2NZOA 5FJ8H 3S15H 3NEMA 4AIMA 4JBWA 3LGJA 4BY7H 4DAYB 4RG1A 4DUYL 1UEBA 1XPOA 3BJUA 2KCMA 3UE0A 3AQQA 4DUZL 2JA5H 2F4VL 1VQOA 1J5EQ 3EN2A 4IJLA 1DGSA 1R9TH 1Y1VH 4JI5Q 1TXYA 3I4OA 1X54A 4LFCQ 5C4XH 4DV3L 1D8LA 1SLJA 4LF4L 2KENA 3H3VH 2E8GA 3TQYA 3HOYH 1N9WA 2E5LL 3D31A 1PHJA 1VQ6A 1K8GA 1X9NA 3I4MH 3W5OA 1MJCA 4X65Q 3UDIA 3TREA 4A3MH 1HZBA 1E3PA 2AWOA 3M4QA 5C44H 3CCVA 1QUQA 4POFA 4LNQA 1YIJA 4A3IG 2OQKA 2Z6KA 1E24A 4JI4L 3KOJA 2V1CC 4L5SA 4LF7L 2ID0A 1I3QH 4PZ8A 1GKHA 5JJKA 1B7YB 1EUJA 2I5MX 3CC4A 1VQ8A 5GAGC 3S14H 1XNRL 4B3RL 5IYDG 2NVYH 4A3JH 2PQAB 1SE8A 4EQ5A 2WB1E 3KYHC 1P8LA 2MQHA 4O0AA 3HOXG 3KFUA 5LMNQ 1L2FA 1LUZA 5M5YH 1EQQA 1EIYB 5GAHC 1X3EA 3CCQA 4BA2I 2YTYA 5IP7G 1Z47A 1XTDA 2UXBQ 4A3KG 1PV4A 4IFDG 4LW1A 4QY7A 4OXPA 2CCZA 3KDFB 1MKHA 4OWTB 3CXCA 1K73C 2BH2A 4A3LG 3UDFA 4OONA 3RN5A 2KHJA 1HNXQ 1UE7A 3J7ZC 3VDYA 2HQLA 1UWVA 3A5UA 1KRSA 1VS0A 4JI8Q 5BR8L 2NVXH 2VUMG 2MO0A 1PVOA 3FKIH 4YCVA 3JAMc 1KXLA 2HHHQ 3RN2A 2VS1A 1VQLA 1CKNA 1JJCB 2BA0A 3PO3H 4DR4Q 2UXCL 3UE1A 1JT8A 4A3EG 4DR1L 1N36Q 2I0QA 2UUAL 3HKZG 1X6OA 4MNOA 1IYJB 3K7AH 4TVAB 4DV1L 3RR5A 1VQIA 4A3IH 1MJEA 4LF8Q 4KHZA 3HKZE 3A5ZB 1VQ9A 4ME3A 1YITA 4LFAL 3PIPA 2K5NA 3TS2A 4GN3B 3CCEA 2R7FA 4GLXA 3CCLA 1SR3A 1RIPA 3HOXH 5M3FH 2R7ZH 2EIFA 1MIUA 4R4CA 3GDEA 5IYBG 1VQFA 1JE5A 1OXVA 1YNXA 3AYHB 1CKOA 5C0XJ 4AQYL 1KC8C 4IPDA 2IX0A 2AHOB 5IP7H 1WCMH 3HKSA 4R4IA
chains in the Genus database with same CATH superfamily
4BXXG 1TS2A 5GADC 1WTVA 2D5DA 4KKUA 2OWOA 1BO0A 1QOHA 3R8BA 4GKJQ 4JI2Q 4UPAA 4EQPA 2R92G 2K7VA 1F9QA 2K14A 2FXQA 4Q0FA 2C9OA 4EX5A 2G9DA 5CC4A 3W3AA 1AW7A 1EQTA 1XMOL 4RGTA 2XGTA 1IBKL 1TS5A 4A3IB 2N3SA 1ENFA 3M3YH 3J80E 1ICFB 4IO9A 4JI7L 1OO9B 4P75A 3F2CA 2ZJQA 3VR3A 3RLFA 1QNUA 5IYBH 3HZXA 2A68C 3D6WA 2N78A 4C1NI 2IHFA 4KD4A 3ULLA 2A6EC 4RAUC 1OXXK 2EYPA 4JI0Q 2RSOA 4DV2Q 2E2HH 2PI2E 2YTXA 1G91A 5EBDA 1NCVA 5G3LF 1RTOA 3BVGA 3ERQA 3A7LA 4DUYQ 4DUZQ 2NN6G 5ELNA 4XT3B 2JA7H 2DGYA 2JQOA 3U50C 2VQFL 2HQEA 3LWEA 3G6EA 1PFNA 1I50B 4IUVA 4C3JB 4FF4A 2CW0C 1P16A 2V4DA 4ZK9B 1E2ZA 1WOCA 1SNMA 4K2KA 1L1OC 3ITPA 4DN4M 5M3MH 1D5ZC 2QF7A 3F2UA 1J5EL 3HRZC 3MEHA 4JI5L 4CDEC 4LFCL 1AP0A 4JI3Q 1DOLA 5A2QE 1TWCB 1GUNA 1PH4A 5IWAQ 2Y0SG 1A6XA 1JQYD 1B8AA 5GAEC 5DM73 1X65A 3EJIA 1HR0Q 3IRBA 3I91A 4X65L 2Y0SE 1W6JA 2C35B 2GN5A 2Q2TA 2VY3A 4WJ3M 3D8GA 1V1PB 1EY7A 5IP9G 1UE6A 1EYGA 3U9OA 3H15A 4YWMA 2JEAI 1SRUA 3BU2A 1YI2A 4X66L 2B63G 1FGUA 2NB0A 3M4OB 3FHWA 1EY8A 3T51B 3GV6A 5M5XB 1Y14B 2KCTA 1I4QA 3MVVA 4U673 4DR3L 1JWSD 4YHHL 1XJVA 3E9HA 1M8AA 2G5DA 2FMCA 3JC66 4YY3Q 1S4ZA 3J81c 4LFAQ 4LAAA 3FVQA 1F9PA 4GNXC 3S1QH 1VQ5A 4DK0A 1XYIA 4B08A 1HNXL 1S3OA 2YTVA 4JBKA 3Q22A 1W6KA 2A8VA 1B4OA 3Q0AA 2HHHL 2A1AA 3TBIB 2IL8A 5FLMG 1QZGA 3H0GB 4DV7L 1OXSC 2EJMA 2RBMA 3DWAA 5LL6S 4CJ0B 1B3QA 1IBMQ 4J15A 5C0XI 3NTIA 3GTQH 1ZYRC 4DV0L 2E2DC 1YVCA 3A55A 3NHHA 4IJHA 4DV4Q 1J8IA 1Y1WH 4CKEA 1LABA 1YJNA 1CQVA 1Z7TA 3T13A 1K9MC 1AE2A 1IZ6A 4ZUIA 3T1HL 2F0HA 3QOLA 3GTGH 1PFBA 1S5FD 5T1GA 3GTLH 2LXJA 4LUVA 3ZJYC 4BY1G 2KBNA 2J4XA 2KVMA 4NB3A 1XPRA 3H3VI 3HOUH 5CV9A 4ILWA 4WJWA 4ZQ3A 4DA2A 2CQOA 4KJNA 3ER0A 3K0YA 3W1GA 5CR3A 2F3VA 1EIHA 2WFWA 1FJGL 4LWCA 4Y7NB 4XQQA 5ELFA 1YJ9A 3KF6A 3OTOL 2YU9B 4BBRG 4HJ9A 4A3EB 3PO2B 2F4VQ 4A3BB 3TZUA 1TY2A 3D6CA 3K8AA 5I9OA 1L0YB 4FXDA 1JE4A 3TP5A 3RUZA 1STEA 2K33A 5BN3A 2MUYA 2JJQA 2R93H 3K0XA 1YNND 1C0AA 1HA6A 4JI1L 5K36G 2KOLA 1D1IA 5LMUL 1NMFA 3AFQA 1IBLL 4C3HB 1SNOA 1HNWL 4R8NA 4GOPC 5DAUA 4HIOA 1B44D 3MXNB 3JAME 2WAQG 3FKIG 1UAPA 2IWHA 2FJ2A 2R6GA 1SJED 1F77A 1JOKA 2PZTA 2WAQE 3J80i 1PH5A 4L6TB 4HTHA 2LY7A 1VQCA 1IHZA 4DAYA 1TS3A 1QVCA 4EQOA 2O4XA 2WB1G 1WI5A 4A3GB 5C4JB 4IZ8A 4RGMA 4UHVA 3OW2A 5M3FG 1CK1A 3DXJC 2R7ZG 1U4PA 2UUAQ 3P1HA 5IY0A 4DV1Q 1CSQA 1GHKA 1WCMG 1TY0A 1QVFA 4IUTA 4C3IH 1TWHH 1Q12A 2CFMA 2JA6G 3HOZG 1IYUA 3DEOA 1KD1C 2Q8IB 3S1MB 3PIOA 4KJOA 2Z6KC 2K04A 4JI8L 2LFNA 5LMNW 3ICEA 1E7ZA 1RD9D 4WFN3 1Q1EA 3A8KE 1I94L 1NNXA 3FP9A 2HCCA 2M2LA 3I56A 1SJHD 2PQAA 2PMZB 2F0OA 3VR5A 3CW2C 4ZUJA 1B2TA 4A3FB 3OWFA 4P2CB 1K83H 1FNWA 4LF6L 1F2LA 4C1NK 4N8FA 4R1JA 5E7NA 1HUNA 2P5ZX 2SEBD 2NTSA 1V1QA 3KDFA 1CUKA 4I65A 1IBKQ 2UXDL 5IODA 4GKKL 2PNHA 3E6ZX 1PFSA 1SE4A 1PZJD 3J81L 2RF4A 2XWJB 5FO8B 2IX3A 4BBSB 2HD3A 1L1OB 2OT2A 4JI7Q 1BVSA 2OCEA 2Z4IA 4PNYA 2ZM6L 1EFWA 1ENAA 2EVBA 2PW7A 3I7FA 2L5TA 3L0OA 4ODGA 2BA1A 1EIFA 4JI2L 3NBHB 3VYTA 2WIIB 3OIQA 2K03A 3K5MA 1VQNA 5EKIA 4GLVB 4F8MA 4HJ8A 4BY7G 2CVRA 3OWEB 2A5HA 4A3DB 2RCFA 4JC0A 2JA7G 1C9OA 1AN8A 2KHIA 3E5SA 1JB7A 2UU9Q 3GTMH 1PTOF 1I4RA 5IT9L 2FHTA 5H1SE 2MFIA 3E3XA 3KJOA 1CT1D 1SN8A 4F7XA 5IGFA 3GTPH 5EPKA 1KDCA 4APVA 1DONA 3SHLA 4DV2L 3C46A 1E2VA 1E22A 2B2UA 2OEOA 5BN4A 4GNXB 3QJYA 4QL5A 4CDDC 1G8ZD 4AIMA 4DUYL 3LWUA 2KCMA 3NBIA 4DUZL 1J5EQ 2F0JA 4RA8A 1R9TH 4JI5Q 3I4OA 5BN5A 4LFCQ 2RSNA 1H9KA 3I4NB 4DV3L 3DM1A 1HA5A 1SLJA 4G7OC 4G7ZC 2FFKB 1T5EA 3EA6A 3GP7A 3HOYH 3D31A 1PHJA 1BCPC 1VQ6A 2NUCA 4KTAA 5CBEE 2F0TA 1I4GA 4K2LA 4HSPA 4X65Q 1VDZA 3TREA 4POFA 3X3NA 2ICIA 2OQKA 4DAVA 4A3IG 1FNUA 2V1CC 1SMYC 1EUJA 1DYQA 2ZXRA 4A3JH 4EQ5A 3OW7A 3S15B 3KFUA 4J8QA 1K28A 5I2XA 5LMNQ 1LUZA 5EPLA 4ZKCB 1XTDA 1PV4A 1F2ZA 4OXPA 1DCZA 1MKHA 1JC7A 3UDFA 4OONA 1HNXQ 1UE7A 4MN3A 3VR2A 4N8X1 2K1BA 1K8OA 3A5UA 1PVOA 1RDPD 1CFMA 2XWBB 2HHHQ 1VQLA 3K5NA 1JJCB 3PO3H 3VR6A 3OOCA 4HMIA 4MNOA 4TVAB 1SNPA 2Z9HA 1VQIA 3RR5A 4RKBA 2L9HA 4LF8Q 1VQ9A 2O2LD 1I3QB 4LFAL 2K5NA 1HQRD 2Z6BA 4C56C 2XSCA 4C3JG 3CCLA 1SR3A 1RIPA 3KLSX 3C2PA 1VQFA 3AYHB 1YNXA 2SOBA 5JVG3 1CZWA 2AHOB 5IP7H 3HKSA 2ZXOA 4EVOA 2BE5D 3OSOA 4JI6L 4IFDH 3T1HQ 2DY7A 1VQ4A 4ZAIA 5A35A 2I07B 4QGUA 4O2DA 2Z8LA 3JAMi 2F0LA 5CV6A 4GOPB 3FKIB 5CV8A 1KLGD 3M4YA 5C4HA 4HJ5A 4PG3A 1JJGA 4DV4L 5GROA 1FJGQ 2EY2A 2OXPA 3SEBA 2WB1B 2E75C 4NPSA 2ATWA 1G291 1ICWA 5M3FB 3TP8A 4BA1I 2R7ZB 1EY0A 1KL9A 1CTMA 3HFZB 5EBCA 2R93G 2DUDA 1WCMB 1EYDA 4B3TQ 1B9NA 4OWXB 2A6HD 1NJIC 4OX9Q 1K8AC 2NN6I 4QQBX 1FYCA 4CJ1B 2D2CC 3L2PA 4IALA 1A2UA 3F1ZA 3GQBA 4IPGA 2K5VA 1PMRA 2K01A 2NZHA 4KY6A 4JI1Q 3GV3A 4DNIA 2MO1A 5LMUQ 3FPUB 4A93H 3M3YB 1IBLQ 3H0GG 2H1EA 1HNWQ 1WTPA 1KDBA 3K5LA 3ULJA 1HTLD 4XYQA 1PH2A 1GXDC 4WRDA 1Q8KA 4FDBA 1H95A 3CCMA 4TQUS 2OTJA 2PYKA 3PMFA 3KBXA 4UP9A 3P7JA 1LTBD 2E2HB 5T1IA 4AH6A 1EL0A 3IL8A 1CKNB 4B3RQ 1D5XC 1H9MA 2EXZA 1KNAA 1RJTA 1JWUD 2LSSA 4JG2A 1HJPA 1STHA 3PGZA 5C6AA 4A3CG 3EQLC 4PV1C 4KMUC 3MA2B 4DXGA 4IN3A 3J81j 4L5TA 4XIGS 4B9WA 4NKLA 1BUVT 5BR8Q 1AFPA 4YCUA 1SE2A 2IT1A 4HIDA 1I94Q 1JICA 4ME5A 4DU9A 3HGBA 4ABNA 1J6QA 3PO2G 3K7UC 4CDFC 1HHVA 3QG1A 5M3MB 4A3BG 1AE3A 4DK6C 4TKOB 2CHBD 4LF6Q 3NTHA 1SAPA 3BZCA 2B2TA 3A7AB 5DM63 1U9RA 1Q86C 5J3BA 2UXDQ 3C1FA 4GKKQ 2R7DA 1E1OA 2SDFA 2JXMB 4GZYC 2QW7A 1NBWA 3IFDA 1HXYD 2ZM6Q 5ISRA 5J22A 2L1BA 2OTLA 1S72A 4Y52H 4RCOA 3A0JA 4WJ4A 4C3HG 4RWSC 2AQ1B 1H9SB 3EBEA 1S5DD 4NW2A 1LTGD 1A3TA 1BCPB 1QILA 2NTTA 3RMHA 2AWNA 4KI0A 2K4KA 4X3KA 3ND8A 2B2VC 1WCMH 1PH6A 1XTCD 4YWKA 1EZ8A 2WINB 5JAVA 1I4XA 3S1QB 1CHPD 5DLQE 2HT1A 2F3IA 4POGA 4JYAL 3Q24A 4JV5L 2QDLA 4A3GG 2ICEC 4R4TA 4V190 3I8ZA 1YNNC 1WTRA 1GVPA 1ZKOA 3KK7A 1U5KA 1H9SA 1V9PA 2VW9A 2EJFC 2VQEL 4M8AA 3S2DH 3MZ5A 1KDAA 5IYCG 3KUPA 4JBJA 1F2MA 2JP1A 4B3MQ 3GTQB 4KLKA 3DWQA 4OO1G 3NE5B 2UU9L 5K5PA 2VXWA 3NPPA 1N33L 4KD3A 4A4IA 3MFYA 4PZ6A 1PH1A 1Y1WB 1MI2A 1CA5A 1N32Q 2VB2X 2VNUD 1HTPA 3CRLC 5CGKA 1SYBA 4CKBA 4DV3Q 4A3FG 5C0XH 5JJIA 4IPHA 3GTGB 2PMZE 5TSSA 1PRTF 3CC2A 3GTLB 3H94A 5AFWA 5CV5A 4XQJA 5HGQA 3RZOH 1HZ9A 3K81C 2KCNA 3HOUB 3NK9A 1NY4A 4P73A 1ILQA 3STBD 4OWWB 1N34Q 2CWPA 3E0JA 2RCNA 4FNFA 1A3VA 3PV0A 4BBSG 1EWIA 4E6IA 1SNCA 2Q2HA 2TMPA 2D0PA 1W2BA 1SFOH 3GO5A 1MHWC 2RHQB 5M5WH 3MTSA 4KHPL 4O42A 4NMZA 2RKSA 1VQ7A 5AJ3L 3M85A 1BBWA 2B2UC 3I70A 2XRQD 1ASZA 3PO3G 1A2TA 1RCVD 1WTQA 4A3DG 1WTOA 4UP7A 4R4OA 1YBYA 1H9JA 4R4QA 1HNZQ 1M4VA 4KN7C 2R93B 1B9MA 1TWFH 1BNZA 3OMCA 2VZAA 5LMNL 1EWHA 1V8QA 1E1TA 2AMCB 4B3SQ 1X56A 2F0KA 3MXUA 2L4NA 2GVAA 4FXKC 1ZXTA 3HOVH 1HCZA 5ELBA 3GTJH 3P20A 2EZVA 1PXUA 4JI6Q 2EPBA 2IW3A 2K75A 5C3EH 3X3MA 3F8TA 3CPWA 1SYFA 4JBMA 4LF8L 2NWGA 5GQOA 4NXNL 1XNQQ 3I4NG 1A0IA 1VMCA 2F1MA 1EY6A 5CORA 3G48A 5ELCA 4HJAA 4KKSA 4MHEA 2JN4A 3GTKH 5IT9c 1HPCA 3KF6B 5ELOA 3J7YW 1HUMA 4C3IB 3CF5A 1TWHB 5NUCA 4L5RC 1CI3M 1I5FA 1I6HH 3A74A 4KY7A 1KAWA 1KNEA 1BBXC 4R8IA 1UE1A 4MTKA 1XWEA 1HZAA 3QWNA 3D3RA 3S16H 3TSSA 3GD7A 3MXGA 1JORA 3K7AB 5L37A 3CHBD 2M9VA 1K83B 3CCUA 1WJJA 2L55A 1DOKA 4X64Q 1X55A 1M90C 5G3LD 4K8IA 3D4DA 2FMMA 3J7AF 3QOJA 4DV6Q 4FYDA 2MHVA 1FVIA 3M9BA 1X3QA 1K0RA 4B3TL 3UDXA 3A56A 4OX9L 1FD7D 4HIKA 4H02A 1NTGA 1MSHA 1XPUA 3ZYYX 2AUKA 1QUQB 2SNSA 5J1ZA 5FJ8H 3NEMA 4JBWA 1XXGA 1LT4D 3LGJA 4DAYB 1KABA 1WTWA 1TS4A 1WD0A 3UE0A 2JA5H 1VQOA 3EN2A 2F3WA 4IJLA 5C5LA 1Y1VH 1L0XB 1TXYA 4HN7A 5C4XH 1EZ6A 3TQYA 2R61A 3SE0A 3IAYA 3GTMB 1ENCA 5KNBA 1HQMC 3K59A 1MJCA 5IIFA 1CHQD 5I2YA 3UDIA 4A3MH 1LV9A 3CCVA 1QUQA 2MPMA 3J81E 3GTPB 1BDOA 4L5SA 5E1FA 4TSSA 1Z6HA 4LF7L 1GKHA 1E0BA 5JJKA 2I5MX 3PIP3 3CC4A 5GAGC 1XNRL 2E74C 4B3RL 2PQAB 3V96A 3C3LA 2A74C 3PQIA 2WB1E 4O0AA 3U9SA 1LLRD 1JR0D 1EEID 2EOTA 3I72A 1L2FA 3SK8A 3WOEA 5M5YH 1EQQA 1X3EA 2YTYA 1Z47A 2HDLA 2BE5C 1GHJA 4LW1A 2CCZA 1R9TB 3KDFB 1ONLA 1D5MC 4M1UB 1PDQA 3QO2A 1TT2A 2KHJA 1RTNA 1AZPA 1X32A 3HOYB 1S5ED 3FRPB 1VS0A 5BR8L 2NVXH 2MO0A 2EYFA 3H91A 2VS1A 2BA0A 4DR4Q 2I0QA 1IYJB 3K7AH 5IT9E 5JEAH 1B3AA 3L3OC 4KHZA 4XQNA 4N9PA 2DNCA 4ME3A 3SDZA 4GN3B 3CCEA 4A3JB 3HOXH 2EY6A 5IYBG 1A3UA 1RODA 1CKOA 3TP6A 4HCEA 4IPDA 1OTCA 3KJPA 4R4IA 3PF5A 2DNEA 2A6HC 2ASBA 5E4XA 4JW0A 3IFTA 4JYAQ 3EFXD 2PCFB 2PI2A 4JV5Q 2MJ8A 1T5XD 1F2YA 4HJ7A 2WP8J 3DM3A 2B2TC 3PO3B 1EIGA 1YJWA 4LFBL 3TP7A 2VQEQ 1G2TA 4PQXA 2E2JH 4DR5L 1LTRD 5KYLA 1BQQT 5JOBA 4XXEA 4LF5L 3AEVA 1OXTA 2K6AA 4G57A 1KAAA 3ULPA 1PH8A 1VQBA 3D0FA 1Q7YC 1N33Q 2RHSB 3KLWA 3W1BA 1ET9A 4HSVA 1C8CA 4LMQD 2RQXA 5KEEA 4BXXH 2G9HD 4A3KB 1GD7A 3S1NH 3RD4A 3DUZA 4LUZA 1WYDA 5M3MG 3MHBA 2B2YA 2KHSA 1TQOA 1SEBD 4B3ML 4DV5L 2F0IA 3S2HH 2SNMA 1GO3E 1TVXA 5JPMC 2HDMA 1VQJA 5IGEA 2E2IH 1N32L 3S9WA 1FNVA 3MWYW 3I4LA 4KHPQ 2ES2A 5AJ3Q 4FVMA 5KRUA 2Z0SA 1IYVA 3T56B 1Q81C 4UDUC 2D62A 2EYLA 3DWPA 1N34L 4YIJA 3NQIA 4I7ZC 3NWSA 4IPCA 2K5QA 1CQFA 4IFDJ 3KLRA 3P75A 1YHBA 2HCIA 3AB9A 3CMAA 2ZTCA 5F2DA 4EGVA 5JJLA 4A93B 3K6OA 1EY4A 4G7HC 1KRTA 4DXFA 3AFPA 2BDOA 4QIWB 4RGOS 2ZTEA 3PUVA 1EOVA 1PZKD 1IKLA 1STNA 1HNZL 1V43A 4AYBB 3S1RH 2KEEA 2OF1A 2UXCQ 4JOIA 1SDFA 2RDHA 1QE6A 1EYCA 1Y1WG 1LT6D 2IJ0A 1S40A 2B2WA 3GTOH 3DEPA 4B3SL 2LXKA 4NXNQ 4ALPA 3BG3A 1PYSB 2ZTDA 5IYDH 4OHJA 1BCPF 1Q3LA 1QG7A 3ERSX 1SMXA 4F87A 1VF5C 3DMUA 4AQYQ 4ZYSA 3HOUG 5EKKA 4LJZC 3BS1A 4A3KH 3BDCA 4Z9CB 4DFAA 5IP9H 4A3LH 3DHQA 1V1OA 2B3GA 2XTIA 2B63H 1VQMA 1XNQL 1VQGA 4ZRZA 1O78A 4RMFA 4IUQA 1EY9A 3CMEA 2BOSA 4DAPA 1AZQA 1TIID 2O5IC 2UUBQ 3J81i 2J0TD 1TWGH 3I90A 1LTSD 5HY6A 3B6YA 1S5CD 3CAMA 1GUTA 2C5CA 1VQAA 4ID6A 5HGTA 3CQZH 1EEFD 4GN4B 1BR9A 4LUOA 4OIKA 1VQPA 2BDNA 4OO1I 3L7ZC 4IURA 4OGQC 1PTOD 5FJ8G 1NE3A 3STBC 3T1YQ 4JCVE 5FLMH 5JVH3 4DR7Q 3UI2A 4QCLA 2Q2UA 5LHY1 2WACA 3S24A 2HIVA 4NDXA 1Y1VG 3VYRA 4IOAA 4X64L 5E3FA 2WKDA 1YZ6A 4G4KA 4IUPA 4DNRB 1U4RA 2K5DA 4DV6L 4OELB 5FO9B 3Q8DA 4H7BA 2NVQH 1STBA 2F0VA 3J80c 3V05A 5FLXL 4BY1H 1EOTA 3VYSA 2X6GA 4K5XA 1ML0D 3I55A 4IUNA 1QZHA 1DJRD 1VQHA 4IQZA 5J39A 4DPGA 1GM5A 5D65A 2FINB 2KQ3A 4DKAC 1IL2A 2D9UA 4LF7Q 4DR6L 3S2DB 4IUUA 4KY5A 2JEBI 3SK4A 4C3IG 3PSIA 4YWLA 3SR1A 1XNRQ 3I73A 3NXWA 1B1ZA 5EPJA 5FK9C 3OHXC 1FL0A 4BBRH 4XTCS 1O7ZA 2F52A 2YV5A 2NVTH 4HCSA 1CKMA 2UUCL 4OIJA 5JEAG 4LK1C 1WFQA 1RHPA 2E76C 4IFDI 2Q2IA 4NXMQ 1NSNS 2F0EA 1IXRA 1OXUA 2MGSA 3SK5A 3RZOB 5KIXA 3HG9A 3R2TA 2PQEA 5K36H 4HEDA 5I6WA 1CSPA 1UE5A 1C7YA 3CCJA 1SFOB 5M5WB 1GUWA 2F0WA 2RVLA 1LTLA 2K5HA 4IOCA 1SSOA 4KK7A 1A15A 4N9TA 3UDGA 1XX8A 2JA9A 1HR0W 4DR4L 2IHEA 4RHRA 3CU7A 1VQDA 2F0QA 2BH8A 5I6YA 3RZDH 4K14A 4X62Q 3BYTB 2Z1CA 3CP0A 3BVMA 3I2ZA 4LFBQ 1TWFB 1DZ1A 5C5MA 2ZT9C 4CJ2C 1IW7D 3CD6A 3MEFA 3G6JB 4DR5Q 3K57A 2JA8H 4X3TA 3PUYA 4GN5A 4P74A 1U0LA 3L9AX 4V0BA 4LF5Q 2JA6H 3HOZH 3HOVB 3E0EA 3NQTA 3GTJB 1A63A 1SYEA 4K6DA 1E2WA 3R2IA 1PRTC 1YEZA 2DN8A 2LS01 2XIWA 1PTOH 5C3EB 2RDFA 5JJZA 2LMCB 4RFBA 2CKZB 3OMGA 3S17H 3CCSA 5KNCA 1KQSA 5IGBA 3FEWX 4DV5Q 2N8NA 1L0WA 3HOYG 1QJOA 4ZLTF 1F9SA 2F0DA 1TWAH 3D4RA 4YCWA 3U58A 1Q1BA 2EYOA 3HP3A 5D3DA 1VF7A 3GTKB 4DR2L 2QKIC 4P72A 4XDXA 3HOWH 2K52A 4UY8C 2NBFA 2GA4B 1I6HB 2KEDA 5ELDA 2EYJA 2Q8TA 2ALYB 4A3JG 2NZOA 1DXMA 3S16B 4BY7H 5LL6X 2RA4A 1EYAA 2KECA 1XPOA 3VA7A 3BJUA 3AQQA 5EKLA 4FP5D 5IOCA 4QUCA 1D8LA 4LF4L 3H3VH 1D2BA 2E8GA 3CKIB 1N9WA 2RDGA 1GJXA 1UNSA 4CDCC 1X9NA 3I4MH 2B2YC 5CV7A 3ND9A 3HS0C 2EE1A 3H6MA 3J80L 1HZBA 3M4QA 2AWOA 5C44H 3EROA 5JPNC 1YIJA 1E24A 3KOJA 2ID0A 4PZ8A 4RHSA 2PNRC 3S14H 5IYDG 3A54A 2NVYH 4WORA 5IGGA 3KYHC 1P8LA 1YNJD 2F0NA 2F0PA 1IKMA 5GAHC 5FKAC 5IP7G 2JA5B 2UXBQ 4A3KG 4IFDG 2XNAC 4QY7A 4KKTA 1Y1VB 1K73C 5C4XB 2PZWA 2BH2A 4A3LG 1JOQA 3J7ZC 1UWVA 1CA6A 2XRSD 2A69D 3JAMc 5IGCA 2UXCL 3UE1A 4HR7B 4A3MB 4PMCA 3TZDA 1EU3A 4A3IH 1MJEA 4Q5VA 3PIPA 1NR4A 3MC0B 4GLXA 1STGA 1O7YA 3BVZA 1V1PA 4QMGA 3WOFA 1MIUA 2PZUA 1CM9A 4AQYL 5M5YB 2B39A 2EDGA 4K0KL 2D0OA 1A8VA 4JOIC 3MAQA 5A2QL 2MNAA 3TRZA 3U4ZA 1H9RA 1AEXA 2B2WC 2NVXB 1XMQQ 1STAA 4UAIA 2JK8A 3NTKA 1LT3D 1HH2P 2UUBL 4DAMA 3E9IA 2ZXPA 2JE6I 1EQVA 4A93G 1II3A 2L15A 3T53B 1I6VC 2KCCA 2KJXA 1I50H 2IPKD 4C3JH 3W2DA 2X6LA 4U68A 3HOXB 1GUSA 1DD2A 3OPOA 5CBAE 4AYBG 4QIWE 1R4QB 3A8IE 2A73B 4AYBE 3N52A 3T1YL 4RH6A 4DR7L 2N88A 1DM0B 4F88A 2I46A 2VUMB 4LF9Q 1KHIA 1GUGA 1K3RA 1PRTD 1TWCH 5M9OA 1D7QA 3HKZB 2GVBA 4DR6Q 2NYZD 4MTNA 3G7LA 2E2JB 1TKWB 1JWMD 2K32A 1N8RC 1PYBA 4TRDA 4C2MB 3K5OA 5DEHA 1VQKA 4FF2A 4PMBA 4J6HA 1LO5D 2E5LQ 2IY5B 2WV6D 1EFID 2ENBA 5JEAJ 3PF4A 3M4OH 1HRJA 1F9RA 1LTTD 4R9WA 2UUCQ 3CC7A 2A68D 5M5XH 4MZ9A 2K28A 1UEAB 3PUZA 1J9OA 3KF8B 2OQ0A 2A6ED 3S1NB 2BCOA 4JI4Q 3PCOB 2MP1A 1BOSA 2ZJPA 5I4DA 5C3XA 1SYGA 2B29A 1NMGA 3TMEA 3G71A 2R92B 4X6AH 3OIPA 3S2HB 2F03A 1LYLA 1PRTB 4L63B 3EVQA 4L8JA 1C4QA 2E2IB 3H0GH 5CYUA 5IE8A 1YHAA 3KF8A 4CGYB 1Q46A 3J7A5 2B2VA 4NP5A 3RLNA 2CW0D 4NXML 1AH9A 1BBUA 4FF3A 2DJFC 4DR1Q 1U4MA 1LM0A 3NELA 1T9HA 5D14A 3MXNA 5KNDA 1KTKA 2KA7A 1A62A 3HEJA 1JMCA 2JA8G 4HAEA 4JVZA 2EXDA 1VMPA 3U4VA 5FOBB 1X3GA 4GS3A 1EWCA 1EY5A 1PH7A 4FXGC 4A3CH 1MD2D 1STYA 1PTOC 1YHQA 1NAPA 4H0LC 3IKJA 1N36L 3LX0A 3RLOA 1MBYA 1O7IA 2A19A 1B70B 1X3PA 4Y7NH 5C3WA 1QVGA 3JAML 2VUMH 4DK3C 2AQ2B 4X62L 1G51A 4K6LA 1SNDA 3SGIA 3S1RB 1XMOQ 2PPBC 2YU9H 4A3EH 2F4IA 3PO2H 4H44C 4GLAC 1EU4A 2TSSA 3K80C 5COYA 2QA4A 4A3BH 2LKVA 3VA5A 2QEXA 3F2BA 1WVLA 3GTOB 4L5QA 4C2MH 1EQRA 3HOWG 1K3BC 1Y8NB 5C0XG 3BYYB 2XVSA 2JYOA 4GKJL 4B9XA 1RL2A 5FLXc 2Y0SB 4QJFA 1MSGA 4DR2Q 1BKBA 3KLSA 3M7GA 3BDLA 3DLLA 3BZDB 2AKWB 4A76A 2NZ1D 2H5XA 2VB3X 3H3VC 3RNUA 2F0MA 1HFGA 1GOZA 2R92H 4C3HH 1SYDA 2B63B 1G6PA 4X3UA 1L1OA 1ZYRD 1PYWD 3I3CA 1TU2B 2IX1A 2EY5A 1ZEQX 3I4MG 3BZKA 3NWTA 3NBHA 3QB3A 1TWGB 2L11A 4J1MA 3Q23A 3F2DA 5C44G 2VQFQ 4LF4Q 4QB4A 2YYZA 3T4AC 4JI0L 1SE3A 2DJGC 3CQZB 1PFMA 4FO2A 2QGQA 2X69A 4A3GH 1B50A 1KIXA 5C4JH 4CHTB 1GUOA 2EYMA 1K8MA 2CWAA 1I4HA 3H09A 1Z9FA 4BS9A 1BXTA 1I4PA 1QWYA 1LACA 5FO7B 1QNKA 4I7AA 5I9PA 5IYCH 3FMCA 2QDBA 3PUXA 4OEMB 3M7NA 1SROA 3HOVG 2CQAA 2HIXA 1D6EC 3QIAA 3S1MH 1HZCA 4KN4C 4RCNA 4OO1H 4CKCA 2N55A 3PIO3 3TS0A 3LNNA 5CV4A 2NN6H 4GNXA 2EQSA 2H4OA 2NVQB 4UP8A 5C3EG 4A3FH 4QF4A 2QCPX 4HIMA 3URYA 1K0SA 3O13A 1NUCA 3R93A 4X66Q 1RKNA 4BY1B 4DGZA 1JB3A 3TEHB 2ZJRA 4JI3L 4ULLA 2CH4W 4DR3Q 1Y8OB 1UUPA 3QR8A 4YHHQ 5IWAL 2EYHA 1IW7C 1O80A 1PA6A 2QILA 4BBSH 3PUWA 2UXBL 1HR0L 1B53A 2F0UA 1D1KA 4HMJA 3C1EA 3WDNA 1X3FA 4FF1A 3M4PA 3NENA 3CCRA 2Q8RE 4BBRB 1PH3A 5EGTA 2K50A 2NVTB 4PZ7A 3SK6A 4OL7A 5HURA 4K0KQ 3NUCA 2VL6A 3Q6SA 4MIUA 4DV7Q 2EJGC 4YY3L 1Q82C 4A3DH 4RGNA 5IGDA 1FR3A 2CH4A 1LTAD 4PMWA 3TN2A 2L0CA 2M00A 4DV0Q 5EAYA 1PH9A 3BDOA 5FLXE 1Q8IA 5EQ0A 1QB5D 1Y69U 1M1KC 2B8FA 2F0SA 2N49A 3FPPA 1KLUD 1DOMA 1VCIA 4KHVA 1IBML 2WAQB 1BF4A 1MGSA 3VYUA 1FGBD 2JSOA 1VQEA 1XMQL 1ASYA 4S3SA 2R3ZA 3J7AV 4A75A 2XN9C 2JA5G 4XT1B 4QUFA 3I4NH 1WTHA 3RZDB 2I5LX 3AMUA 5C4XG 3OYYA 3G4SA 3OTOQ 4JK1C 4K8JA 1C48A 1ET6A 3V2TA 3WWVA 2I5HA 1R4PB 4X3SA 1W3SA 1SYCA 5E4WC 1PLFA 1PZID 1Q90A 2QEJC 2WKCA 2Z4HA 3MXPA 4GOPA 4A3MG 1JJ2A 2JA8B 3FDTA 2K05A 4DK1A 4P71A 2AUJD 3NP8A 2JA6B 3HOZB 2DY8A 3CPFA 4EQNA 1IL8A 1RF2D 4LF9L 1QCBD 5DNFA 3S15H 1YNJC 3T16A 1WTXA 2F0FA 4JPBW 4RG1A 1UEBA 1ESRA 1PTOB 1U4LA 2F4VL 3D4WA 3S17B 2J7ZA 1LT5D 1DGSA 1X54A 5KGUA 1WD1A 2KENA 1SXTA 5KYIA 3KBGA 2E5LL 4ZCKA 2A69C 2EY1A 1TWAB 1K8GA 3W5OA 2B8GA 2O5JC 1LTID 3TDQA 5C4ZA 3NSWA 1E3PA 3K58A 3MFGA 3SVMA 4LNQA 3HOWB 2Z6KA 4H13C 4JI4L 1I3QH 4CBVA 1JCKB 2L12A 4XYOA 1HFNA 1B7YB 1SBBB 1ILPA 2KUMA 1VQ8A 4BWGB 1SNQA 3A8JE 1SE8A 4DF7A 4RKLA 4ZKBB 3HOXG 2MQHA 3R3OA 1G2SA 4BY7B 3VR4A 1EIYB 3CCQA 1TR5A 4BA2I 4DNTB 2JA7B 1S5BD 4K5WA 5ELEA 4OWTB 2PW5A 3CXCA 2F0GA 3RN5A 3VDYA 3CRKC 2HQLA 1ESFA 1KRSA 4JI8Q 1BCPD 2VUMG 3FKIH 4YCVA 1NR2A 3SXHA 1KXLA 3I4MB 3RN2A 1JT8A 1CKNA 4A3EG 4DR1L 1N36Q 2UUAL 3HKZG 1X6OA 4DV1L 5C44B 1Y8PB 3ONAB 5D3IB 4K5VA 2PO4A 3HKZE 3A5ZB 1CZGA 1SMYD 2AQ3B 3AU7A 1YITA 1G6ZA 4KV6A 5CMDA 3TS2A 3S14B 1O7LA 2R7FA 2K5WA 2NVYB 3N6RA 4O1NA 5M3FH 1JOOA 2R7ZH 2EIFA 5EJWA 4R4CA 3GDEA 1JE5A 1OXVA 5C0XJ 1KC8C 2HUGA 2IX0A 3EIVA
chains in the Genus database with same CATH topology
4BXXG 4K0KL 2D0OA 3PF5A 1A8VA 4JI6L 3T1HQ 5GADC 2ASBA 2OWOA 4JOIC 1VQ4A 2MNAA 3TRZA 4QGUA 4O2DA 3U4ZA 4JYAQ 4GKJQ 2PI2A 4JI2Q 4JV5Q 4UPAA 2R92G 3JAMi 2K14A 2FXQA 4GOPB 4HJ7A 1XMQQ 2WP8J 4EX5A 3DM3A 1XMOL 2JK8A 1IBKL 2XGTA 1YJWA 4LFBL 4HJ5A 4PG3A 1JJGA 4DV4L 5GROA 1HH2P 2VQEQ 2UUBL 4DAMA 2N3SA 3E9IA 1FJGQ 2E2JH 4DR5L 2JE6I 3M3YH 4A93G 2L15A 4IO9A 4JI7L 4LF5L 3AEVA 4P75A 1OXTA 4NPSA 1G291 2ATWA 1I50H 4C3JH 3F2CA 3ULPA 2ZJQA 3RLFA 1VQBA 3D0FA 1Q7YC 1PH8A 4BA1I 2RHSB 1N33Q 5IYBH 3KLWA 1KL9A 3W1BA 4AYBG 3HFZB 4QIWE 2R93G 2N78A 2DUDA 4BXXH 4B3TQ 1GD7A 2IHFA 3ULLA 4AYBE 4OWXB 4OX9Q 1NJIC 3T1YL 3S1NH 1K8AC 1OXXK 4LUZA 2NN6I 1WYDA 4DR7L 5M3MG 4QQBX 4JI0Q 4DV2Q 2E2HH 2PI2E 2YTXA 3L2PA 3EIVA 4LF9Q 1KHIA 3F1ZA 4IPGA 1K3RA 1TWCH 4B3ML 4DV5L 3S2HH 2K5VA 1GO3E 2NZHA 4DUYQ 1D7QA 2GVBA 4JI1Q 1VQJA 4DUZQ 4DR6Q 2NN6G 4MTNA 5ELNA 2MO1A 4DNIA 5LMUQ 2E2IH 2JA7H 1N32L 4A93H 2DGYA 1IBLQ 1N8RC 1PYBA 2JQOA 3S2DH 3U50C 3H0GG 2VQFL 1VQKA 3G6EA 1HNWQ 4KHPQ 3ULJA 2ES2A 2E5LQ 2IY5B 1PH2A 1P16A 5JEAJ 5AJ3Q 3PF4A 3M4OH 1Q8KA 4FDBA 2UUCQ 1H95A 3CC7A 2Z0SA 5M5XH 4MZ9A 1Q81C 1WOCA 3CCMA 2D62A 4TQUS 2OTJA 3PUZA 3KF8B 2OQ0A 1L1OC 1N34L 4UP9A 4JI4Q 5M3MH 3PCOB 2ZJPA 4AH6A 1J5EL 4JI5L 1CKNB 4B3RQ 4IPCA 2B29A 1NMGA 4LFCL 3G71A 4JI3Q 4X6AH 4IFDJ 2LSSA 4JG2A 1LYLA 1PH4A 1HJPA 1YHBA 5IWAQ 2Y0SG 3PGZA 4A3CG 1B8AA 5GAEC 1X65A 3CMAA 2ZTCA 3IRBA 4X65L 1HR0Q 2Y0SE 2Q2TA 2C35B 2GN5A 5JJLA 2VY3A 3H0GH 4WJ3M 3J81j 5IE8A 1YHAA 4L5TA 5IP9G 4XIGS 1UE6A 1Q46A 1KRTA 3H15A 1EYGA 3AFPA 3J7A5 4YWMA 2JEAI 1SRUA 3BU2A 3RLNA 5BR8Q 4NXML 2ZTEA 3PUVA 4X66L 1EOVA 1FGUA 4YCUA 1YI2A 2B63G 2IT1A 3FHWA 1AH9A 1HNZL 1V43A 4HIDA 3S1RH 1BBUA 1I94Q 2UXCQ 4JOIA 1Y14B 2KCTA 4DR1Q 4DR3L 1LM0A 3NELA 4YHHL 1XJVA 3E9HA 3PO2G 1J6QA 1T9HA 3JC66 3K7UC 1Y1WG 4YY3Q 1S40A 3GTOH 4B3SL 1AE3A 4A3BG 4DK6C 3J81c 2JA8G 1A62A 2LXKA 4LFAQ 1JMCA 4NXNQ 4LF6Q 4ALPA 2EXDA 3BZCA 1PYSB 2ZTDA 5IYDH 4GNXC 3U4VA 3S1QH 1Q86C 1VQ5A 1X3GA 4GS3A 5J3BA 2UXDQ 3ERSX 1SMXA 1HNXL 1PH7A 1S3OA 4GKKQ 2R7DA 1E1OA 2YTVA 4JBKA 4AQYQ 4A3CH 2A8VA 3HOUG 1NBWA 2HHHL 1YHQA 4A3KH 2A1AA 2ZM6Q 1N36L 5FLMG 1QZGA 3RLOA 2OTLA 4DV7L 1S72A 1O7IA 1OXSC 5IP9H 4A3LH 4Y52H 2A19A 2B3GA 1B70B 4Y7NH 2XTIA 4J15A 1QVGA 3A0JA 1IBMQ 2B63H 1VQMA 1XNQL 2VUMH 4WJ4A 5C0XI 4DK3C 4X62L 3GTQH 1VQGA 1G51A 3EBEA 4DV0L 3SGIA 4RMFA 1XMOQ 2YU9H 3CMEA 1YVCA 4A3EH 2AWNA 4IJHA 4DV4Q 3PO2H 4KI0A 2K4KA 4GLAC 1Y1WH 3J81i 2UUBQ 2QA4A 3K80C 1TWGH 4A3BH 2QEXA 1YJNA 3F2BA 1K9MC 5HY6A 4L5QA 3B6YA 1AE2A 1IZ6A 1PH6A 3T1HL 3CAMA 1EQRA 4YWKA 4C2MH 3HOWG 1VQAA 5C0XG 3GTGH 5DLQE 2HT1A 3CQZH 2F3IA 2LXJA 4POGA 4LUVA 3GTLH 4JYAL 4GKJL 3ZJYC 4JV5L 4GN4B 1RL2A 4LUOA 2KBNA 4BY1G 5FLXc 4NB3A 1XPRA 3H3VI 4A3GG 1VQPA 3HOUH 4R4TA 4OO1I 3L7ZC 5FJ8G 1GVPA 1NE3A 4QJFA 3STBC 1U5KA 3T1YQ 1V9PA 2CQOA 1BKBA 4JCVE 5FLMH 2VW9A 4DR2Q 4DR7Q 3ER0A 3W1GA 3DLLA 2VQEL 2WFWA 2Q2UA 2AKWB 5IYCG 4A76A 1FJGL 2H5XA 3S24A 2HIVA 4LWCA 3KJPA 3RNUA 1Y1VG 2R92H 4JBJA 4C3HH 1G6PA 1YJ9A 1L1OA 4B3MQ 3KF6A 4KLKA 4OO1G 3OTOL 4IOAA 4X64L 2UU9L 4BBRG 4HJ9A 1N33L 2IX1A 4A4IA 1YZ6A 4PZ6A 4DV6L 1PH1A 3BZKA 3I4MG 3Q8DA 2F4VQ 1N32Q 3F2DA 2NVQH 2VNUD 3K8AA 5C44G 3J80c 4DV3Q 2VQFQ 4LF4Q 2YYZA 4A3FG 5JJIA 4IPHA 2PMZE 4JI0L 3CC2A 4BY1H 2JJQA 2QGQA 3I55A 5HGQA 3RZOH 1HZ9A 3K81C 5C4JH 1KIXA 1QZHA 3K0XA 4A3GH 2R93H 1VQHA 1NY4A 2CWAA 4P73A 4DPGA 3STBD 1GM5A 4OWWB 1N34Q 1Z9FA 4DKAC 2CWPA 1IL2A 1C0AA 4JI1L 4LF7Q 2RCNA 4DR6L 4BBSG 5K36G 3PV0A 5IYCH 5LMUL 1NMFA 1EWIA 2JEBI 3AFQA 2Q2HA 3PUXA 3PSIA 4YWLA 1IBLL 1XNRQ 2D0PA 3M7NA 1W2BA 1SROA 1SFOH 3HOVG 3GO5A 2HIXA 2RHQB 5M5WH 1HNWL 4GOPC 3S1MH 4KHPL 1HZCA 4HIOA 3TS0A 1FL0A 4BBRH 1VQ7A 3MXNB 4XTCS 2F52A 2YV5A 5AJ3L 2WAQG 3FKIG 2NVTH 3M85A 1CKMA 2UUCL 4GNXA 1BBWA 2EQSA 1ASZA 3PO3G 2R6GA 2WAQE 3J80i 1PH5A 4UP8A 5C3EG 1VQCA 5JEAG 4A3FH 1WFQA 4A3DG 4HIMA 1QVCA 4IFDI 2Q2IA 4UP7A 4NXMQ 4R4OA 4X66Q 1IXRA 1YBYA 1WI5A 2WB1G 1OXUA 4R4QA 1HNZQ 3TEHB 2ZJRA 4JI3L 3OW2A 5M3FG 4DR3Q 1TWFH 2R7ZG 4YHHQ 2UUAQ 5IY0A 5IWAL 4DV1Q 1CSQA 2VZAA 5LMNL 1E1TA 2AMCB 1PA6A 1WCMG 4B3SQ 1X56A 4BBSH 3PUWA 2UXBL 1HR0L 1QVFA 2GVAA 4C3IH 1TWHH 1CSPA 1Q12A 1UE5A 1C7YA 2CFMA 2JA6G 3HOZG 3HOVH 3CCJA 3GTJH 1X3FA 1KD1C 3M4PA 3NENA 3PIOA 3CCRA 1PH3A 1LTLA 2Z6KC 4JI8L 2K50A 2K5HA 5LMNW 4PZ7A 4IOCA 3ICEA 1E7ZA 4K0KQ 1Q1EA 1I94L 3UDGA 2JA9A 1HR0W 2VL6A 4JI6Q 4DR4L 3FP9A 2IHEA 3I56A 2PQAA 2K75A 5C3EH 3CW2C 3F8TA 4DV7Q 3CPWA 4YY3L 1Q82C 4A3DH 1VQDA 4JBMA 1K83H 4LF8L 5GQOA 2BH8A 4NXNL 4PMWA 4LF6L 1XNQQ 3RZDH 3I4NG 4R1JA 4X62Q 1A0IA 5E7NA 4DV0Q 1PH9A 5EAYA 3CP0A 1V1QA 3KDFA 1CUKA 3G48A 1IBKQ 2UXDL 3I2ZA 4LFBQ 4GKKL 2PNHA 1PFSA 4HJAA 3CD6A 2RF4A 3MEFA 1M1KC 4DR5Q 3GTKH 5IT9c 2JA8H 1L1OB 3KF6B 5ELOA 3PUYA 4JI7Q 1BVSA 2N49A 2OCEA 2ZM6L 4GN5A 1VCIA 1U0LA 4P74A 3CF5A 1EFWA 4L5RC 4LF5Q 2JA6H 3HOZH 3E0EA 3I7FA 1I5FA 3L0OA 1I6HH 2BA1A 1EIFA 1A63A 3A74A 4JI2L 1KAWA 3NBHB 1IBML 1UE1A 1VQNA 1HZAA 1YEZA 3S16H 1VQEA 4GLVB 3GD7A 1XMQL 1ASYA 4HJ8A 4BY7G 4A75A 2JA5G 2CKZB 3S17H 4JC0A 2JA7G 1C9OA 3CCUA 2KHIA 3CCSA 3I4NH 2I5LX 5C4XG 1KQSA 1WJJA 3OYYA 3G4SA 2N8NA 3OTOQ 4DV5Q 1L0WA 4X64Q 1JB7A 2UU9Q 3HOYG 1X55A 1M90C 3GTMH 1TWAH 4YCWA 3WWVA 3U58A 4DV6Q 2I5HA 1Q1BA 1FVIA 1W3SA 5H1SE 3M9BA 2MFIA 3KJOA 1K0RA 4GOPA 4B3TL 1SN8A 3UDXA 4A3MG 1JJ2A 4OX9L 4DR2L 3GTPH 4APVA 4P72A 3HOWH 4P71A 4HIKA 2K52A 4H02A 4UY8C 4DV2L 1E22A 1OTCA 3CPFA 4GNXB 1NTGA 1XPUA 4LF9L 2ALYB 4QL5A 4A3JG 1QUQB 2NZOA 5FJ8H 3S15H 3NEMA 4AIMA 4JBWA 3LGJA 4BY7H 4DAYB 4RG1A 4DUYL 1UEBA 1XPOA 3BJUA 2KCMA 3UE0A 3AQQA 4DUZL 2JA5H 2F4VL 1VQOA 1J5EQ 3EN2A 4IJLA 1DGSA 1R9TH 1Y1VH 4JI5Q 1TXYA 3I4OA 1X54A 4LFCQ 5C4XH 4DV3L 1D8LA 1SLJA 4LF4L 2KENA 3H3VH 2E8GA 3TQYA 3HOYH 1N9WA 2E5LL 3D31A 1PHJA 1VQ6A 1K8GA 1X9NA 3I4MH 3W5OA 1MJCA 4X65Q 3UDIA 3TREA 4A3MH 1HZBA 1E3PA 2AWOA 3M4QA 5C44H 3CCVA 1QUQA 4POFA 4LNQA 1YIJA 4A3IG 2OQKA 2Z6KA 1E24A 4JI4L 3KOJA 2V1CC 4L5SA 4LF7L 2ID0A 1I3QH 4PZ8A 1GKHA 5JJKA 1B7YB 1EUJA 2I5MX 3CC4A 1VQ8A 5GAGC 3S14H 1XNRL 4B3RL 5IYDG 2NVYH 4A3JH 2PQAB 1SE8A 4EQ5A 2WB1E 3KYHC 1P8LA 2MQHA 4O0AA 3HOXG 3KFUA 5LMNQ 1L2FA 1LUZA 5M5YH 1EQQA 1EIYB 5GAHC 1X3EA 3CCQA 4BA2I 2YTYA 5IP7G 1Z47A 1XTDA 2UXBQ 4A3KG 1PV4A 4IFDG 4LW1A 4QY7A 4OXPA 2CCZA 3KDFB 1MKHA 4OWTB 3CXCA 1K73C 2BH2A 4A3LG 3UDFA 4OONA 3RN5A 2KHJA 1HNXQ 1UE7A 3J7ZC 3VDYA 2HQLA 1UWVA 3A5UA 1KRSA 1VS0A 4JI8Q 5BR8L 2NVXH 2VUMG 2MO0A 1PVOA 3FKIH 4YCVA 3JAMc 1KXLA 2HHHQ 3RN2A 2VS1A 1VQLA 1CKNA 1JJCB 2BA0A 3PO3H 4DR4Q 2UXCL 3UE1A 1JT8A 4A3EG 4DR1L 1N36Q 2I0QA 2UUAL 3HKZG 1X6OA 4MNOA 1IYJB 3K7AH 4TVAB 4DV1L 3RR5A 1VQIA 4A3IH 1MJEA 4LF8Q 4KHZA 3HKZE 3A5ZB 1VQ9A 4ME3A 1YITA 4LFAL 3PIPA 2K5NA 3TS2A 4GN3B 3CCEA 2R7FA 4GLXA 3CCLA 1SR3A 1RIPA 3HOXH 5M3FH 2R7ZH 2EIFA 1MIUA 4R4CA 3GDEA 5IYBG 1VQFA 1JE5A 1OXVA 1YNXA 3AYHB 1CKOA 5C0XJ 4AQYL 1KC8C 4IPDA 2IX0A 2AHOB 5IP7H 1WCMH 3HKSA 4R4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX G;  4K0K L;  2D0O A;  3PF5 A;  1A8V A;  4JI6 L;  3T1H Q;  5GAD C;  2ASB A;  2OWO A;  4JOI C;  1VQ4 A;  2MNA A;  3TRZ A;  4QGU A;  4O2D A;  3U4Z A;  4JYA Q;  4GKJ Q;  2PI2 A;  4JI2 Q;  4JV5 Q;  4UPA A;  2R92 G;  3JAM i;  2K14 A;  2FXQ A;  4GOP B;  4HJ7 A;  1XMQ Q;  2WP8 J;  4EX5 A;  3DM3 A;  1XMO L;  2JK8 A;  1IBK L;  2XGT A;  1YJW A;  4LFB L;  4HJ5 A;  4PG3 A;  1JJG A;  4DV4 L;  5GRO A;  1HH2 P;  2VQE Q;  2UUB L;  4DAM A;  2N3S A;  3E9I A;  1FJG Q;  2E2J H;  4DR5 L;  2JE6 I;  3M3Y H;  4A93 G;  2L15 A;  4IO9 A;  4JI7 L;  4LF5 L;  3AEV A;  4P75 A;  1OXT A;  4NPS A;  1G29 1;  2ATW A;  1I50 H;  4C3J H;  3F2C A;  3ULP A;  2ZJQ A;  3RLF A;  1VQB A;  3D0F A;  1Q7Y C;  1PH8 A;  4BA1 I;  2RHS B;  1N33 Q;  5IYB H;  3KLW A;  1KL9 A;  3W1B A;  4AYB G;  3HFZ B;  4QIW E;  2R93 G;  2N78 A;  2DUD A;  4BXX H;  4B3T Q;  1GD7 A;  2IHF A;  3ULL A;  4AYB E;  4OWX B;  4OX9 Q;  1NJI C;  3T1Y L;  3S1N H;  1K8A C;  1OXX K;  4LUZ A;  2NN6 I;  1WYD A;  4DR7 L;  5M3M G;  4QQB X;  4JI0 Q;  4DV2 Q;  2E2H H;  2PI2 E;  2YTX A;  3L2P A;  3EIV A;  4LF9 Q;  1KHI A;  3F1Z A;  4IPG A;  1K3R A;  1TWC H;  4B3M L;  4DV5 L;  3S2H H;  2K5V A;  1GO3 E;  2NZH A;  4DUY Q;  1D7Q A;  2GVB A;  4JI1 Q;  1VQJ A;  4DUZ Q;  4DR6 Q;  2NN6 G;  4MTN A;  5ELN A;  2MO1 A;  4DNI A;  5LMU Q;  2E2I H;  2JA7 H;  1N32 L;  4A93 H;  2DGY A;  1IBL Q;  1N8R C;  1PYB A;  2JQO A;  3S2D H;  3U50 C;  3H0G G;  2VQF L;  1VQK A;  3G6E A;  1HNW Q;  4KHP Q;  3ULJ A;  2ES2 A;  2E5L Q;  2IY5 B;  1PH2 A;  1P16 A;  5JEA J;  5AJ3 Q;  3PF4 A;  3M4O H;  1Q8K A;  4FDB A;  2UUC Q;  1H95 A;  3CC7 A;  2Z0S A;  5M5X H;  4MZ9 A;  1Q81 C;  1WOC A;  3CCM A;  2D62 A;  4TQU S;  2OTJ A;  3PUZ A;  3KF8 B;  2OQ0 A;  1L1O C;  1N34 L;  4UP9 A;  4JI4 Q;  5M3M H;  3PCO B;  2ZJP A;  4AH6 A;  1J5E L;  4JI5 L;  1CKN B;  4B3R Q;  4IPC A;  2B29 A;  1NMG A;  4LFC L;  3G71 A;  4JI3 Q;  4X6A H;  4IFD J;  2LSS A;  4JG2 A;  1LYL A;  1PH4 A;  1HJP A;  1YHB A;  5IWA Q;  2Y0S G;  3PGZ A;  4A3C G;  1B8A A;  5GAE C;  1X65 A;  3CMA A;  2ZTC A;  3IRB A;  4X65 L;  1HR0 Q;  2Y0S E;  2Q2T A;  2C35 B;  2GN5 A;  5JJL A;  2VY3 A;  3H0G H;  4WJ3 M;  3J81 j;  5IE8 A;  1YHA A;  4L5T A;  5IP9 G;  4XIG S;  1UE6 A;  1Q46 A;  1KRT A;  3H15 A;  1EYG A;  3AFP A;  3J7A 5;  4YWM A;  2JEA I;  1SRU A;  3BU2 A;  3RLN A;  5BR8 Q;  4NXM L;  2ZTE A;  3PUV A;  4X66 L;  1EOV A;  1FGU A;  4YCU A;  1YI2 A;  2B63 G;  2IT1 A;  3FHW A;  1AH9 A;  1HNZ L;  1V43 A;  4HID A;  3S1R H;  1BBU A;  1I94 Q;  2UXC Q;  4JOI A;  1Y14 B;  2KCT A;  4DR1 Q;  4DR3 L;  1LM0 A;  3NEL A;  4YHH L;  1XJV A;  3E9H A;  3PO2 G;  1J6Q A;  1T9H A;  3JC6 6;  3K7U C;  1Y1W G;  4YY3 Q;  1S40 A;  3GTO H;  4B3S L;  1AE3 A;  4A3B G;  4DK6 C;  3J81 c;  2JA8 G;  1A62 A;  2LXK A;  4LFA Q;  1JMC A;  4NXN Q;  4LF6 Q;  4ALP A;  2EXD A;  3BZC A;  1PYS B;  2ZTD A;  5IYD H;  4GNX C;  3U4V A;  3S1Q H;  1Q86 C;  1VQ5 A;  1X3G A;  4GS3 A;  5J3B A;  2UXD Q;  3ERS X;  1SMX A;  1HNX L;  1PH7 A;  1S3O A;  4GKK Q;  2R7D A;  1E1O A;  2YTV A;  4JBK A;  4AQY Q;  4A3C H;  2A8V A;  3HOU G;  1NBW A;  2HHH L;  1YHQ A;  4A3K H;  2A1A A;  2ZM6 Q;  1N36 L;  5FLM G;  1QZG A;  3RLO A;  2OTL A;  4DV7 L;  1S72 A;  1O7I A;  1OXS C;  5IP9 H;  4A3L H;  4Y52 H;  2A19 A;  2B3G A;  1B70 B;  4Y7N H;  2XTI A;  4J15 A;  1QVG A;  3A0J A;  1IBM Q;  2B63 H;  1VQM A;  1XNQ L;  2VUM H;  4WJ4 A;  5C0X I;  4DK3 C;  4X62 L;  3GTQ H;  1VQG A;  1G51 A;  3EBE A;  4DV0 L;  3SGI A;  4RMF A;  1XMO Q;  2YU9 H;  3CME A;  1YVC A;  4A3E H;  2AWN A;  4IJH A;  4DV4 Q;  3PO2 H;  4KI0 A;  2K4K A;  4GLA C;  1Y1W H;  3J81 i;  2UUB Q;  2QA4 A;  3K80 C;  1TWG H;  4A3B H;  2QEX A;  1YJN A;  3F2B A;  1K9M C;  5HY6 A;  4L5Q A;  3B6Y A;  1AE2 A;  1IZ6 A;  1PH6 A;  3T1H L;  3CAM A;  1EQR A;  4YWK A;  4C2M H;  3HOW G;  1VQA A;  5C0X G;  3GTG H;  5DLQ E;  2HT1 A;  3CQZ H;  2F3I A;  2LXJ A;  4POG A;  4LUV A;  3GTL H;  4JYA L;  4GKJ L;  3ZJY C;  4JV5 L;  4GN4 B;  1RL2 A;  4LUO A;  2KBN A;  4BY1 G;  5FLX c;  4NB3 A;  1XPR A;  3H3V I;  4A3G G;  1VQP A;  3HOU H;  4R4T A;  4OO1 I;  3L7Z C;  5FJ8 G;  1GVP A;  1NE3 A;  4QJF A;  3STB C;  1U5K A;  3T1Y Q;  1V9P A;  2CQO A;  1BKB A;  4JCV E;  5FLM H;  2VW9 A;  4DR2 Q;  4DR7 Q;  3ER0 A;  3W1G A;  3DLL A;  2VQE L;  2WFW A;  2Q2U A;  2AKW B;  5IYC G;  4A76 A;  1FJG L;  2H5X A;  3S24 A;  2HIV A;  4LWC A;  3KJP A;  3RNU A;  1Y1V G;  2R92 H;  4JBJ A;  4C3H H;  1G6P A;  1YJ9 A;  1L1O A;  4B3M Q;  3KF6 A;  4KLK A;  4OO1 G;  3OTO L;  4IOA A;  4X64 L;  2UU9 L;  4BBR G;  4HJ9 A;  1N33 L;  2IX1 A;  4A4I A;  1YZ6 A;  4PZ6 A;  4DV6 L;  1PH1 A;  3BZK A;  3I4M G;  3Q8D A;  2F4V Q;  1N32 Q;  3F2D A;  2NVQ H;  2VNU D;  3K8A A;  5C44 G;  3J80 c;  4DV3 Q;  2VQF Q;  4LF4 Q;  2YYZ A;  4A3F G;  5JJI A;  4IPH A;  2PMZ E;  4JI0 L;  3CC2 A;  4BY1 H;  2JJQ A;  2QGQ A;  3I55 A;  5HGQ A;  3RZO H;  1HZ9 A;  3K81 C;  5C4J H;  1KIX A;  1QZH A;  3K0X A;  4A3G H;  2R93 H;  1VQH A;  1NY4 A;  2CWA A;  4P73 A;  4DPG A;  3STB D;  1GM5 A;  4OWW B;  1N34 Q;  1Z9F A;  4DKA C;  2CWP A;  1IL2 A;  1C0A A;  4JI1 L;  4LF7 Q;  2RCN A;  4DR6 L;  4BBS G;  5K36 G;  3PV0 A;  5IYC H;  5LMU L;  1NMF A;  1EWI A;  2JEB I;  3AFQ A;  2Q2H A;  3PUX A;  3PSI A;  4YWL A;  1IBL L;  1XNR Q;  2D0P A;  3M7N A;  1W2B A;  1SRO A;  1SFO H;  3HOV G;  3GO5 A;  2HIX A;  2RHQ B;  5M5W H;  1HNW L;  4GOP C;  3S1M H;  4KHP L;  1HZC A;  4HIO A;  3TS0 A;  1FL0 A;  4BBR H;  1VQ7 A;  3MXN B;  4XTC S;  2F52 A;  2YV5 A;  5AJ3 L;  2WAQ G;  3FKI G;  2NVT H;  3M85 A;  1CKM A;  2UUC L;  4GNX A;  1BBW A;  2EQS A;  1ASZ A;  3PO3 G;  2R6G A;  2WAQ E;  3J80 i;  1PH5 A;  4UP8 A;  5C3E G;  1VQC A;  5JEA G;  4A3F H;  1WFQ A;  4A3D G;  4HIM A;  1QVC A;  4IFD I;  2Q2I A;  4UP7 A;  4NXM Q;  4R4O A;  4X66 Q;  1IXR A;  1YBY A;  1WI5 A;  2WB1 G;  1OXU A;  4R4Q A;  1HNZ Q;  3TEH B;  2ZJR A;  4JI3 L;  3OW2 A;  5M3F G;  4DR3 Q;  1TWF H;  2R7Z G;  4YHH Q;  2UUA Q;  5IY0 A;  5IWA L;  4DV1 Q;  1CSQ A;  2VZA A;  5LMN L;  1E1T A;  2AMC B;  1PA6 A;  1WCM G;  4B3S Q;  1X56 A;  4BBS H;  3PUW A;  2UXB L;  1HR0 L;  1QVF A;  2GVA A;  4C3I H;  1TWH H;  1CSP A;  1Q12 A;  1UE5 A;  1C7Y A;  2CFM A;  2JA6 G;  3HOZ G;  3HOV H;  3CCJ A;  3GTJ H;  1X3F A;  1KD1 C;  3M4P A;  3NEN A;  3PIO A;  3CCR A;  1PH3 A;  1LTL A;  2Z6K C;  4JI8 L;  2K50 A;  2K5H A;  5LMN W;  4PZ7 A;  4IOC A;  3ICE A;  1E7Z A;  4K0K Q;  1Q1E A;  1I94 L;  3UDG A;  2JA9 A;  1HR0 W;  2VL6 A;  4JI6 Q;  4DR4 L;  3FP9 A;  2IHE A;  3I56 A;  2PQA A;  2K75 A;  5C3E H;  3CW2 C;  3F8T A;  4DV7 Q;  3CPW A;  4YY3 L;  1Q82 C;  4A3D H;  1VQD A;  4JBM A;  1K83 H;  4LF8 L;  5GQO A;  2BH8 A;  4NXN L;  4PMW A;  4LF6 L;  1XNQ Q;  3RZD H;  3I4N G;  4R1J A;  4X62 Q;  1A0I A;  5E7N A;  4DV0 Q;  1PH9 A;  5EAY A;  3CP0 A;  1V1Q A;  3KDF A;  1CUK A;  3G48 A;  1IBK Q;  2UXD L;  3I2Z A;  4LFB Q;  4GKK L;  2PNH A;  1PFS A;  4HJA A;  3CD6 A;  2RF4 A;  3MEF A;  1M1K C;  4DR5 Q;  3GTK H;  5IT9 c;  2JA8 H;  1L1O B;  3KF6 B;  5ELO A;  3PUY A;  4JI7 Q;  1BVS A;  2N49 A;  2OCE A;  2ZM6 L;  4GN5 A;  1VCI A;  1U0L A;  4P74 A;  3CF5 A;  1EFW A;  4L5R C;  4LF5 Q;  2JA6 H;  3HOZ H;  3E0E A;  3I7F A;  1I5F A;  3L0O A;  1I6H H;  2BA1 A;  1EIF A;  1A63 A;  3A74 A;  4JI2 L;  1KAW A;  3NBH B;  1IBM L;  1UE1 A;  1VQN A;  1HZA A;  1YEZ A;  3S16 H;  1VQE A;  4GLV B;  3GD7 A;  1XMQ L;  1ASY A;  4HJ8 A;  4BY7 G;  4A75 A;  2JA5 G;  2CKZ B;  3S17 H;  4JC0 A;  2JA7 G;  1C9O A;  3CCU A;  2KHI A;  3CCS A;  3I4N H;  2I5L X;  5C4X G;  1KQS A;  1WJJ A;  3OYY A;  3G4S A;  2N8N A;  3OTO Q;  4DV5 Q;  1L0W A;  4X64 Q;  1JB7 A;  2UU9 Q;  3HOY G;  1X55 A;  1M90 C;  3GTM H;  1TWA H;  4YCW A;  3WWV A;  3U58 A;  4DV6 Q;  2I5H A;  1Q1B A;  1FVI A;  1W3S A;  5H1S E;  3M9B A;  2MFI A;  3KJO A;  1K0R A;  4GOP A;  4B3T L;  1SN8 A;  3UDX A;  4A3M G;  1JJ2 A;  4OX9 L;  4DR2 L;  3GTP H;  4APV A;  4P72 A;  3HOW H;  4P71 A;  4HIK A;  2K52 A;  4H02 A;  4UY8 C;  4DV2 L;  1E22 A;  1OTC A;  3CPF A;  4GNX B;  1NTG A;  1XPU A;  4LF9 L;  2ALY B;  4QL5 A;  4A3J G;  1QUQ B;  2NZO A;  5FJ8 H;  3S15 H;  3NEM A;  4AIM A;  4JBW A;  3LGJ A;  4BY7 H;  4DAY B;  4RG1 A;  4DUY L;  1UEB A;  1XPO A;  3BJU A;  2KCM A;  3UE0 A;  3AQQ A;  4DUZ L;  2JA5 H;  2F4V L;  1VQO A;  1J5E Q;  3EN2 A;  4IJL A;  1DGS A;  1R9T H;  1Y1V H;  4JI5 Q;  1TXY A;  3I4O A;  1X54 A;  4LFC Q;  5C4X H;  4DV3 L;  1D8L A;  1SLJ A;  4LF4 L;  2KEN A;  3H3V H;  2E8G A;  3TQY A;  3HOY H;  1N9W A;  2E5L L;  3D31 A;  1PHJ A;  1VQ6 A;  1K8G A;  1X9N A;  3I4M H;  3W5O A;  1MJC A;  4X65 Q;  3UDI A;  3TRE A;  4A3M H;  1HZB A;  1E3P A;  2AWO A;  3M4Q A;  5C44 H;  3CCV A;  1QUQ A;  4POF A;  4LNQ A;  1YIJ A;  4A3I G;  2OQK A;  2Z6K A;  1E24 A;  4JI4 L;  3KOJ A;  2V1C C;  4L5S A;  4LF7 L;  2ID0 A;  1I3Q H;  4PZ8 A;  1GKH A;  5JJK A;  1B7Y B;  1EUJ A;  2I5M X;  3CC4 A;  1VQ8 A;  5GAG C;  3S14 H;  1XNR L;  4B3R L;  5IYD G;  2NVY H;  4A3J H;  2PQA B;  1SE8 A;  4EQ5 A;  2WB1 E;  3KYH C;  1P8L A;  2MQH A;  4O0A A;  3HOX G;  3KFU A;  5LMN Q;  1L2F A;  1LUZ A;  5M5Y H;  1EQQ A;  1EIY B;  5GAH C;  1X3E A;  3CCQ A;  4BA2 I;  2YTY A;  5IP7 G;  1Z47 A;  1XTD A;  2UXB Q;  4A3K G;  1PV4 A;  4IFD G;  4LW1 A;  4QY7 A;  4OXP A;  2CCZ A;  3KDF B;  1MKH A;  4OWT B;  3CXC A;  1K73 C;  2BH2 A;  4A3L G;  3UDF A;  4OON A;  3RN5 A;  2KHJ A;  1HNX Q;  1UE7 A;  3J7Z C;  3VDY A;  2HQL A;  1UWV A;  3A5U A;  1KRS A;  1VS0 A;  4JI8 Q;  5BR8 L;  2NVX H;  2VUM G;  2MO0 A;  1PVO A;  3FKI H;  4YCV A;  3JAM c;  1KXL A;  2HHH Q;  3RN2 A;  2VS1 A;  1VQL A;  1CKN A;  1JJC B;  2BA0 A;  3PO3 H;  4DR4 Q;  2UXC L;  3UE1 A;  1JT8 A;  4A3E G;  4DR1 L;  1N36 Q;  2I0Q A;  2UUA L;  3HKZ G;  1X6O A;  4MNO A;  1IYJ B;  3K7A H;  4TVA B;  4DV1 L;  3RR5 A;  1VQI A;  4A3I H;  1MJE A;  4LF8 Q;  4KHZ A;  3HKZ E;  3A5Z B;  1VQ9 A;  4ME3 A;  1YIT A;  4LFA L;  3PIP A;  2K5N A;  3TS2 A;  4GN3 B;  3CCE A;  2R7F A;  4GLX A;  3CCL A;  1SR3 A;  1RIP A;  3HOX H;  5M3F H;  2R7Z H;  2EIF A;  1MIU A;  4R4C A;  3GDE A;  5IYB G;  1VQF A;  1JE5 A;  1OXV A;  1YNX A;  3AYH B;  1CKO A;  5C0X J;  4AQY L;  1KC8 C;  4IPD A;  2IX0 A;  2AHO B;  5IP7 H;  1WCM H;  3HKS A;  4R4I A; 
#chains in the Genus database with same CATH topology
 4BXX G;  1TS2 A;  5GAD C;  1WTV A;  2D5D A;  4KKU A;  2OWO A;  1BO0 A;  1QOH A;  3R8B A;  4GKJ Q;  4JI2 Q;  4UPA A;  4EQP A;  2R92 G;  2K7V A;  1F9Q A;  2K14 A;  2FXQ A;  4Q0F A;  2C9O A;  4EX5 A;  2G9D A;  5CC4 A;  3W3A A;  1AW7 A;  1EQT A;  1XMO L;  4RGT A;  2XGT A;  1IBK L;  1TS5 A;  4A3I B;  2N3S A;  1ENF A;  3M3Y H;  3J80 E;  1ICF B;  4IO9 A;  4JI7 L;  1OO9 B;  4P75 A;  3F2C A;  2ZJQ A;  3VR3 A;  3RLF A;  1QNU A;  5IYB H;  3HZX A;  2A68 C;  3D6W A;  2N78 A;  4C1N I;  2IHF A;  4KD4 A;  3ULL A;  2A6E C;  4RAU C;  1OXX K;  2EYP A;  4JI0 Q;  2RSO A;  4DV2 Q;  2E2H H;  2PI2 E;  2YTX A;  1G91 A;  5EBD A;  1NCV A;  5G3L F;  1RTO A;  3BVG A;  3ERQ A;  3A7L A;  4DUY Q;  4DUZ Q;  2NN6 G;  5ELN A;  4XT3 B;  2JA7 H;  2DGY A;  2JQO A;  3U50 C;  2VQF L;  2HQE A;  3LWE A;  3G6E A;  1PFN A;  1I50 B;  4IUV A;  4C3J B;  4FF4 A;  2CW0 C;  1P16 A;  2V4D A;  4ZK9 B;  1E2Z A;  1WOC A;  1SNM A;  4K2K A;  1L1O C;  3ITP A;  4DN4 M;  5M3M H;  1D5Z C;  2QF7 A;  3F2U A;  1J5E L;  3HRZ C;  3MEH A;  4JI5 L;  4CDE C;  4LFC L;  1AP0 A;  4JI3 Q;  1DOL A;  5A2Q E;  1TWC B;  1GUN A;  1PH4 A;  5IWA Q;  2Y0S G;  1A6X A;  1JQY D;  1B8A A;  5GAE C;  5DM7 3;  1X65 A;  3EJI A;  1HR0 Q;  3IRB A;  3I91 A;  4X65 L;  2Y0S E;  1W6J A;  2C35 B;  2GN5 A;  2Q2T A;  2VY3 A;  4WJ3 M;  3D8G A;  1V1P B;  1EY7 A;  5IP9 G;  1UE6 A;  1EYG A;  3U9O A;  3H15 A;  4YWM A;  2JEA I;  1SRU A;  3BU2 A;  1YI2 A;  4X66 L;  2B63 G;  1FGU A;  2NB0 A;  3M4O B;  3FHW A;  1EY8 A;  3T51 B;  3GV6 A;  5M5X B;  1Y14 B;  2KCT A;  1I4Q A;  3MVV A;  4U67 3;  4DR3 L;  1JWS D;  4YHH L;  1XJV A;  3E9H A;  1M8A A;  2G5D A;  2FMC A;  3JC6 6;  4YY3 Q;  1S4Z A;  3J81 c;  4LFA Q;  4LAA A;  3FVQ A;  1F9P A;  4GNX C;  3S1Q H;  1VQ5 A;  4DK0 A;  1XYI A;  4B08 A;  1HNX L;  1S3O A;  2YTV A;  4JBK A;  3Q22 A;  1W6K A;  2A8V A;  1B4O A;  3Q0A A;  2HHH L;  2A1A A;  3TBI B;  2IL8 A;  5FLM G;  1QZG A;  3H0G B;  4DV7 L;  1OXS C;  2EJM A;  2RBM A;  3DWA A;  5LL6 S;  4CJ0 B;  1B3Q A;  1IBM Q;  4J15 A;  5C0X I;  3NTI A;  3GTQ H;  1ZYR C;  4DV0 L;  2E2D C;  1YVC A;  3A55 A;  3NHH A;  4IJH A;  4DV4 Q;  1J8I A;  1Y1W H;  4CKE A;  1LAB A;  1YJN A;  1CQV A;  1Z7T A;  3T13 A;  1K9M C;  1AE2 A;  1IZ6 A;  4ZUI A;  3T1H L;  2F0H A;  3QOL A;  3GTG H;  1PFB A;  1S5F D;  5T1G A;  3GTL H;  2LXJ A;  4LUV A;  3ZJY C;  4BY1 G;  2KBN A;  2J4X A;  2KVM A;  4NB3 A;  1XPR A;  3H3V I;  3HOU H;  5CV9 A;  4ILW A;  4WJW A;  4ZQ3 A;  4DA2 A;  2CQO A;  4KJN A;  3ER0 A;  3K0Y A;  3W1G A;  5CR3 A;  2F3V A;  1EIH A;  2WFW A;  1FJG L;  4LWC A;  4Y7N B;  4XQQ A;  5ELF A;  1YJ9 A;  3KF6 A;  3OTO L;  2YU9 B;  4BBR G;  4HJ9 A;  4A3E B;  3PO2 B;  2F4V Q;  4A3B B;  3TZU A;  1TY2 A;  3D6C A;  3K8A A;  5I9O A;  1L0Y B;  4FXD A;  1JE4 A;  3TP5 A;  3RUZ A;  1STE A;  2K33 A;  5BN3 A;  2MUY A;  2JJQ A;  2R93 H;  3K0X A;  1YNN D;  1C0A A;  1HA6 A;  4JI1 L;  5K36 G;  2KOL A;  1D1I A;  5LMU L;  1NMF A;  3AFQ A;  1IBL L;  4C3H B;  1SNO A;  1HNW L;  4R8N A;  4GOP C;  5DAU A;  4HIO A;  1B44 D;  3MXN B;  3JAM E;  2WAQ G;  3FKI G;  1UAP A;  2IWH A;  2FJ2 A;  2R6G A;  1SJE D;  1F77 A;  1JOK A;  2PZT A;  2WAQ E;  3J80 i;  1PH5 A;  4L6T B;  4HTH A;  2LY7 A;  1VQC A;  1IHZ A;  4DAY A;  1TS3 A;  1QVC A;  4EQO A;  2O4X A;  2WB1 G;  1WI5 A;  4A3G B;  5C4J B;  4IZ8 A;  4RGM A;  4UHV A;  3OW2 A;  5M3F G;  1CK1 A;  3DXJ C;  2R7Z G;  1U4P A;  2UUA Q;  3P1H A;  5IY0 A;  4DV1 Q;  1CSQ A;  1GHK A;  1WCM G;  1TY0 A;  1QVF A;  4IUT A;  4C3I H;  1TWH H;  1Q12 A;  2CFM A;  2JA6 G;  3HOZ G;  1IYU A;  3DEO A;  1KD1 C;  2Q8I B;  3S1M B;  3PIO A;  4KJO A;  2Z6K C;  2K04 A;  4JI8 L;  2LFN A;  5LMN W;  3ICE A;  1E7Z A;  1RD9 D;  4WFN 3;  1Q1E A;  3A8K E;  1I94 L;  1NNX A;  3FP9 A;  2HCC A;  2M2L A;  3I56 A;  1SJH D;  2PQA A;  2PMZ B;  2F0O A;  3VR5 A;  3CW2 C;  4ZUJ A;  1B2T A;  4A3F B;  3OWF A;  4P2C B;  1K83 H;  1FNW A;  4LF6 L;  1F2L A;  4C1N K;  4N8F A;  4R1J A;  5E7N A;  1HUN A;  2P5Z X;  2SEB D;  2NTS A;  1V1Q A;  3KDF A;  1CUK A;  4I65 A;  1IBK Q;  2UXD L;  5IOD A;  4GKK L;  2PNH A;  3E6Z X;  1PFS A;  1SE4 A;  1PZJ D;  3J81 L;  2RF4 A;  2XWJ B;  5FO8 B;  2IX3 A;  4BBS B;  2HD3 A;  1L1O B;  2OT2 A;  4JI7 Q;  1BVS A;  2OCE A;  2Z4I A;  4PNY A;  2ZM6 L;  1EFW A;  1ENA A;  2EVB A;  2PW7 A;  3I7F A;  2L5T A;  3L0O A;  4ODG A;  2BA1 A;  1EIF A;  4JI2 L;  3NBH B;  3VYT A;  2WII B;  3OIQ A;  2K03 A;  3K5M A;  1VQN A;  5EKI A;  4GLV B;  4F8M A;  4HJ8 A;  4BY7 G;  2CVR A;  3OWE B;  2A5H A;  4A3D B;  2RCF A;  4JC0 A;  2JA7 G;  1C9O A;  1AN8 A;  2KHI A;  3E5S A;  1JB7 A;  2UU9 Q;  3GTM H;  1PTO F;  1I4R A;  5IT9 L;  2FHT A;  5H1S E;  2MFI A;  3E3X A;  3KJO A;  1CT1 D;  1SN8 A;  4F7X A;  5IGF A;  3GTP H;  5EPK A;  1KDC A;  4APV A;  1DON A;  3SHL A;  4DV2 L;  3C46 A;  1E2V A;  1E22 A;  2B2U A;  2OEO A;  5BN4 A;  4GNX B;  3QJY A;  4QL5 A;  4CDD C;  1G8Z D;  4AIM A;  4DUY L;  3LWU A;  2KCM A;  3NBI A;  4DUZ L;  1J5E Q;  2F0J A;  4RA8 A;  1R9T H;  4JI5 Q;  3I4O A;  5BN5 A;  4LFC Q;  2RSN A;  1H9K A;  3I4N B;  4DV3 L;  3DM1 A;  1HA5 A;  1SLJ A;  4G7O C;  4G7Z C;  2FFK B;  1T5E A;  3EA6 A;  3GP7 A;  3HOY H;  3D31 A;  1PHJ A;  1BCP C;  1VQ6 A;  2NUC A;  4KTA A;  5CBE E;  2F0T A;  1I4G A;  4K2L A;  4HSP A;  4X65 Q;  1VDZ A;  3TRE A;  4POF A;  3X3N A;  2ICI A;  2OQK A;  4DAV A;  4A3I G;  1FNU A;  2V1C C;  1SMY C;  1EUJ A;  1DYQ A;  2ZXR A;  4A3J H;  4EQ5 A;  3OW7 A;  3S15 B;  3KFU A;  4J8Q A;  1K28 A;  5I2X A;  5LMN Q;  1LUZ A;  5EPL A;  4ZKC B;  1XTD A;  1PV4 A;  1F2Z A;  4OXP A;  1DCZ A;  1MKH A;  1JC7 A;  3UDF A;  4OON A;  1HNX Q;  1UE7 A;  4MN3 A;  3VR2 A;  4N8X 1;  2K1B A;  1K8O A;  3A5U A;  1PVO A;  1RDP D;  1CFM A;  2XWB B;  2HHH Q;  1VQL A;  3K5N A;  1JJC B;  3PO3 H;  3VR6 A;  3OOC A;  4HMI A;  4MNO A;  4TVA B;  1SNP A;  2Z9H A;  1VQI A;  3RR5 A;  4RKB A;  2L9H A;  4LF8 Q;  1VQ9 A;  2O2L D;  1I3Q B;  4LFA L;  2K5N A;  1HQR D;  2Z6B A;  4C56 C;  2XSC A;  4C3J G;  3CCL A;  1SR3 A;  1RIP A;  3KLS X;  3C2P A;  1VQF A;  3AYH B;  1YNX A;  2SOB A;  5JVG 3;  1CZW A;  2AHO B;  5IP7 H;  3HKS A;  2ZXO A;  4EVO A;  2BE5 D;  3OSO A;  4JI6 L;  4IFD H;  3T1H Q;  2DY7 A;  1VQ4 A;  4ZAI A;  5A35 A;  2I07 B;  4QGU A;  4O2D A;  2Z8L A;  3JAM i;  2F0L A;  5CV6 A;  4GOP B;  3FKI B;  5CV8 A;  1KLG D;  3M4Y A;  5C4H A;  4HJ5 A;  4PG3 A;  1JJG A;  4DV4 L;  5GRO A;  1FJG Q;  2EY2 A;  2OXP A;  3SEB A;  2WB1 B;  2E75 C;  4NPS A;  2ATW A;  1G29 1;  1ICW A;  5M3F B;  3TP8 A;  4BA1 I;  2R7Z B;  1EY0 A;  1KL9 A;  1CTM A;  3HFZ B;  5EBC A;  2R93 G;  2DUD A;  1WCM B;  1EYD A;  4B3T Q;  1B9N A;  4OWX B;  2A6H D;  1NJI C;  4OX9 Q;  1K8A C;  2NN6 I;  4QQB X;  1FYC A;  4CJ1 B;  2D2C C;  3L2P A;  4IAL A;  1A2U A;  3F1Z A;  3GQB A;  4IPG A;  2K5V A;  1PMR A;  2K01 A;  2NZH A;  4KY6 A;  4JI1 Q;  3GV3 A;  4DNI A;  2MO1 A;  5LMU Q;  3FPU B;  4A93 H;  3M3Y B;  1IBL Q;  3H0G G;  2H1E A;  1HNW Q;  1WTP A;  1KDB A;  3K5L A;  3ULJ A;  1HTL D;  4XYQ A;  1PH2 A;  1GXD C;  4WRD A;  1Q8K A;  4FDB A;  1H95 A;  3CCM A;  4TQU S;  2OTJ A;  2PYK A;  3PMF A;  3KBX A;  4UP9 A;  3P7J A;  1LTB D;  2E2H B;  5T1I A;  4AH6 A;  1EL0 A;  3IL8 A;  1CKN B;  4B3R Q;  1D5X C;  1H9M A;  2EXZ A;  1KNA A;  1RJT A;  1JWU D;  2LSS A;  4JG2 A;  1HJP A;  1STH A;  3PGZ A;  5C6A A;  4A3C G;  3EQL C;  4PV1 C;  4KMU C;  3MA2 B;  4DXG A;  4IN3 A;  3J81 j;  4L5T A;  4XIG S;  4B9W A;  4NKL A;  1BUV T;  5BR8 Q;  1AFP A;  4YCU A;  1SE2 A;  2IT1 A;  4HID A;  1I94 Q;  1JIC A;  4ME5 A;  4DU9 A;  3HGB A;  4ABN A;  1J6Q A;  3PO2 G;  3K7U C;  4CDF C;  1HHV A;  3QG1 A;  5M3M B;  4A3B G;  1AE3 A;  4DK6 C;  4TKO B;  2CHB D;  4LF6 Q;  3NTH A;  1SAP A;  3BZC A;  2B2T A;  3A7A B;  5DM6 3;  1U9R A;  1Q86 C;  5J3B A;  2UXD Q;  3C1F A;  4GKK Q;  2R7D A;  1E1O A;  2SDF A;  2JXM B;  4GZY C;  2QW7 A;  1NBW A;  3IFD A;  1HXY D;  2ZM6 Q;  5ISR A;  5J22 A;  2L1B A;  2OTL A;  1S72 A;  4Y52 H;  4RCO A;  3A0J A;  4WJ4 A;  4C3H G;  4RWS C;  2AQ1 B;  1H9S B;  3EBE A;  1S5D D;  4NW2 A;  1LTG D;  1A3T A;  1BCP B;  1QIL A;  2NTT A;  3RMH A;  2AWN A;  4KI0 A;  2K4K A;  4X3K A;  3ND8 A;  2B2V C;  1WCM H;  1PH6 A;  1XTC D;  4YWK A;  1EZ8 A;  2WIN B;  5JAV A;  1I4X A;  3S1Q B;  1CHP D;  5DLQ E;  2HT1 A;  2F3I A;  4POG A;  4JYA L;  3Q24 A;  4JV5 L;  2QDL A;  4A3G G;  2ICE C;  4R4T A;  4V19 0;  3I8Z A;  1YNN C;  1WTR A;  1GVP A;  1ZKO A;  3KK7 A;  1U5K A;  1H9S A;  1V9P A;  2VW9 A;  2EJF C;  2VQE L;  4M8A A;  3S2D H;  3MZ5 A;  1KDA A;  5IYC G;  3KUP A;  4JBJ A;  1F2M A;  2JP1 A;  4B3M Q;  3GTQ B;  4KLK A;  3DWQ A;  4OO1 G;  3NE5 B;  2UU9 L;  5K5P A;  2VXW A;  3NPP A;  1N33 L;  4KD3 A;  4A4I A;  3MFY A;  4PZ6 A;  1PH1 A;  1Y1W B;  1MI2 A;  1CA5 A;  1N32 Q;  2VB2 X;  2VNU D;  1HTP A;  3CRL C;  5CGK A;  1SYB A;  4CKB A;  4DV3 Q;  4A3F G;  5C0X H;  5JJI A;  4IPH A;  3GTG B;  2PMZ E;  5TSS A;  1PRT F;  3CC2 A;  3GTL B;  3H94 A;  5AFW A;  5CV5 A;  4XQJ A;  5HGQ A;  3RZO H;  1HZ9 A;  3K81 C;  2KCN A;  3HOU B;  3NK9 A;  1NY4 A;  4P73 A;  1ILQ A;  3STB D;  4OWW B;  1N34 Q;  2CWP A;  3E0J A;  2RCN A;  4FNF A;  1A3V A;  3PV0 A;  4BBS G;  1EWI A;  4E6I A;  1SNC A;  2Q2H A;  2TMP A;  2D0P A;  1W2B A;  1SFO H;  3GO5 A;  1MHW C;  2RHQ B;  5M5W H;  3MTS A;  4KHP L;  4O42 A;  4NMZ A;  2RKS A;  1VQ7 A;  5AJ3 L;  3M85 A;  1BBW A;  2B2U C;  3I70 A;  2XRQ D;  1ASZ A;  3PO3 G;  1A2T A;  1RCV D;  1WTQ A;  4A3D G;  1WTO A;  4UP7 A;  4R4O A;  1YBY A;  1H9J A;  4R4Q A;  1HNZ Q;  1M4V A;  4KN7 C;  2R93 B;  1B9M A;  1TWF H;  1BNZ A;  3OMC A;  2VZA A;  5LMN L;  1EWH A;  1V8Q A;  1E1T A;  2AMC B;  4B3S Q;  1X56 A;  2F0K A;  3MXU A;  2L4N A;  2GVA A;  4FXK C;  1ZXT A;  3HOV H;  1HCZ A;  5ELB A;  3GTJ H;  3P20 A;  2EZV A;  1PXU A;  4JI6 Q;  2EPB A;  2IW3 A;  2K75 A;  5C3E H;  3X3M A;  3F8T A;  3CPW A;  1SYF A;  4JBM A;  4LF8 L;  2NWG A;  5GQO A;  4NXN L;  1XNQ Q;  3I4N G;  1A0I A;  1VMC A;  2F1M A;  1EY6 A;  5COR A;  3G48 A;  5ELC A;  4HJA A;  4KKS A;  4MHE A;  2JN4 A;  3GTK H;  5IT9 c;  1HPC A;  3KF6 B;  5ELO A;  3J7Y W;  1HUM A;  4C3I B;  3CF5 A;  1TWH B;  5NUC A;  4L5R C;  1CI3 M;  1I5F A;  1I6H H;  3A74 A;  4KY7 A;  1KAW A;  1KNE A;  1BBX C;  4R8I A;  1UE1 A;  4MTK A;  1XWE A;  1HZA A;  3QWN A;  3D3R A;  3S16 H;  3TSS A;  3GD7 A;  3MXG A;  1JOR A;  3K7A B;  5L37 A;  3CHB D;  2M9V A;  1K83 B;  3CCU A;  1WJJ A;  2L55 A;  1DOK A;  4X64 Q;  1X55 A;  1M90 C;  5G3L D;  4K8I A;  3D4D A;  2FMM A;  3J7A F;  3QOJ A;  4DV6 Q;  4FYD A;  2MHV A;  1FVI A;  3M9B A;  1X3Q A;  1K0R A;  4B3T L;  3UDX A;  3A56 A;  4OX9 L;  1FD7 D;  4HIK A;  4H02 A;  1NTG A;  1MSH A;  1XPU A;  3ZYY X;  2AUK A;  1QUQ B;  2SNS A;  5J1Z A;  5FJ8 H;  3NEM A;  4JBW A;  1XXG A;  1LT4 D;  3LGJ A;  4DAY B;  1KAB A;  1WTW A;  1TS4 A;  1WD0 A;  3UE0 A;  2JA5 H;  1VQO A;  3EN2 A;  2F3W A;  4IJL A;  5C5L A;  1Y1V H;  1L0X B;  1TXY A;  4HN7 A;  5C4X H;  1EZ6 A;  3TQY A;  2R61 A;  3SE0 A;  3IAY A;  3GTM B;  1ENC A;  5KNB A;  1HQM C;  3K59 A;  1MJC A;  5IIF A;  1CHQ D;  5I2Y A;  3UDI A;  4A3M H;  1LV9 A;  3CCV A;  1QUQ A;  2MPM A;  3J81 E;  3GTP B;  1BDO A;  4L5S A;  5E1F A;  4TSS A;  1Z6H A;  4LF7 L;  1GKH A;  1E0B A;  5JJK A;  2I5M X;  3PIP 3;  3CC4 A;  5GAG C;  1XNR L;  2E74 C;  4B3R L;  2PQA B;  3V96 A;  3C3L A;  2A74 C;  3PQI A;  2WB1 E;  4O0A A;  3U9S A;  1LLR D;  1JR0 D;  1EEI D;  2EOT A;  3I72 A;  1L2F A;  3SK8 A;  3WOE A;  5M5Y H;  1EQQ A;  1X3E A;  2YTY A;  1Z47 A;  2HDL A;  2BE5 C;  1GHJ A;  4LW1 A;  2CCZ A;  1R9T B;  3KDF B;  1ONL A;  1D5M C;  4M1U B;  1PDQ A;  3QO2 A;  1TT2 A;  2KHJ A;  1RTN A;  1AZP A;  1X32 A;  3HOY B;  1S5E D;  3FRP B;  1VS0 A;  5BR8 L;  2NVX H;  2MO0 A;  2EYF A;  3H91 A;  2VS1 A;  2BA0 A;  4DR4 Q;  2I0Q A;  1IYJ B;  3K7A H;  5IT9 E;  5JEA H;  1B3A A;  3L3O C;  4KHZ A;  4XQN A;  4N9P A;  2DNC A;  4ME3 A;  3SDZ A;  4GN3 B;  3CCE A;  4A3J B;  3HOX H;  2EY6 A;  5IYB G;  1A3U A;  1ROD A;  1CKO A;  3TP6 A;  4HCE A;  4IPD A;  1OTC A;  3KJP A;  4R4I A;  3PF5 A;  2DNE A;  2A6H C;  2ASB A;  5E4X A;  4JW0 A;  3IFT A;  4JYA Q;  3EFX D;  2PCF B;  2PI2 A;  4JV5 Q;  2MJ8 A;  1T5X D;  1F2Y A;  4HJ7 A;  2WP8 J;  3DM3 A;  2B2T C;  3PO3 B;  1EIG A;  1YJW A;  4LFB L;  3TP7 A;  2VQE Q;  1G2T A;  4PQX A;  2E2J H;  4DR5 L;  1LTR D;  5KYL A;  1BQQ T;  5JOB A;  4XXE A;  4LF5 L;  3AEV A;  1OXT A;  2K6A A;  4G57 A;  1KAA A;  3ULP A;  1PH8 A;  1VQB A;  3D0F A;  1Q7Y C;  1N33 Q;  2RHS B;  3KLW A;  3W1B A;  1ET9 A;  4HSV A;  1C8C A;  4LMQ D;  2RQX A;  5KEE A;  4BXX H;  2G9H D;  4A3K B;  1GD7 A;  3S1N H;  3RD4 A;  3DUZ A;  4LUZ A;  1WYD A;  5M3M G;  3MHB A;  2B2Y A;  2KHS A;  1TQO A;  1SEB D;  4B3M L;  4DV5 L;  2F0I A;  3S2H H;  2SNM A;  1GO3 E;  1TVX A;  5JPM C;  2HDM A;  1VQJ A;  5IGE A;  2E2I H;  1N32 L;  3S9W A;  1FNV A;  3MWY W;  3I4L A;  4KHP Q;  2ES2 A;  5AJ3 Q;  4FVM A;  5KRU A;  2Z0S A;  1IYV A;  3T56 B;  1Q81 C;  4UDU C;  2D62 A;  2EYL A;  3DWP A;  1N34 L;  4YIJ A;  3NQI A;  4I7Z C;  3NWS A;  4IPC A;  2K5Q A;  1CQF A;  4IFD J;  3KLR A;  3P75 A;  1YHB A;  2HCI A;  3AB9 A;  3CMA A;  2ZTC A;  5F2D A;  4EGV A;  5JJL A;  4A93 B;  3K6O A;  1EY4 A;  4G7H C;  1KRT A;  4DXF A;  3AFP A;  2BDO A;  4QIW B;  4RGO S;  2ZTE A;  3PUV A;  1EOV A;  1PZK D;  1IKL A;  1STN A;  1HNZ L;  1V43 A;  4AYB B;  3S1R H;  2KEE A;  2OF1 A;  2UXC Q;  4JOI A;  1SDF A;  2RDH A;  1QE6 A;  1EYC A;  1Y1W G;  1LT6 D;  2IJ0 A;  1S40 A;  2B2W A;  3GTO H;  3DEP A;  4B3S L;  2LXK A;  4NXN Q;  4ALP A;  3BG3 A;  1PYS B;  2ZTD A;  5IYD H;  4OHJ A;  1BCP F;  1Q3L A;  1QG7 A;  3ERS X;  1SMX A;  4F87 A;  1VF5 C;  3DMU A;  4AQY Q;  4ZYS A;  3HOU G;  5EKK A;  4LJZ C;  3BS1 A;  4A3K H;  3BDC A;  4Z9C B;  4DFA A;  5IP9 H;  4A3L H;  3DHQ A;  1V1O A;  2B3G A;  2XTI A;  2B63 H;  1VQM A;  1XNQ L;  1VQG A;  4ZRZ A;  1O78 A;  4RMF A;  4IUQ A;  1EY9 A;  3CME A;  2BOS A;  4DAP A;  1AZQ A;  1TII D;  2O5I C;  2UUB Q;  3J81 i;  2J0T D;  1TWG H;  3I90 A;  1LTS D;  5HY6 A;  3B6Y A;  1S5C D;  3CAM A;  1GUT A;  2C5C A;  1VQA A;  4ID6 A;  5HGT A;  3CQZ H;  1EEF D;  4GN4 B;  1BR9 A;  4LUO A;  4OIK A;  1VQP A;  2BDN A;  4OO1 I;  3L7Z C;  4IUR A;  4OGQ C;  1PTO D;  5FJ8 G;  1NE3 A;  3STB C;  3T1Y Q;  4JCV E;  5FLM H;  5JVH 3;  4DR7 Q;  3UI2 A;  4QCL A;  2Q2U A;  5LHY 1;  2WAC A;  3S24 A;  2HIV A;  4NDX A;  1Y1V G;  3VYR A;  4IOA A;  4X64 L;  5E3F A;  2WKD A;  1YZ6 A;  4G4K A;  4IUP A;  4DNR B;  1U4R A;  2K5D A;  4DV6 L;  4OEL B;  5FO9 B;  3Q8D A;  4H7B A;  2NVQ H;  1STB A;  2F0V A;  3J80 c;  3V05 A;  5FLX L;  4BY1 H;  1EOT A;  3VYS A;  2X6G A;  4K5X A;  1ML0 D;  3I55 A;  4IUN A;  1QZH A;  1DJR D;  1VQH A;  4IQZ A;  5J39 A;  4DPG A;  1GM5 A;  5D65 A;  2FIN B;  2KQ3 A;  4DKA C;  1IL2 A;  2D9U A;  4LF7 Q;  4DR6 L;  3S2D B;  4IUU A;  4KY5 A;  2JEB I;  3SK4 A;  4C3I G;  3PSI A;  4YWL A;  3SR1 A;  1XNR Q;  3I73 A;  3NXW A;  1B1Z A;  5EPJ A;  5FK9 C;  3OHX C;  1FL0 A;  4BBR H;  4XTC S;  1O7Z A;  2F52 A;  2YV5 A;  2NVT H;  4HCS A;  1CKM A;  2UUC L;  4OIJ A;  5JEA G;  4LK1 C;  1WFQ A;  1RHP A;  2E76 C;  4IFD I;  2Q2I A;  4NXM Q;  1NSN S;  2F0E A;  1IXR A;  1OXU A;  2MGS A;  3SK5 A;  3RZO B;  5KIX A;  3HG9 A;  3R2T A;  2PQE A;  5K36 H;  4HED A;  5I6W A;  1CSP A;  1UE5 A;  1C7Y A;  3CCJ A;  1SFO B;  5M5W B;  1GUW A;  2F0W A;  2RVL A;  1LTL A;  2K5H A;  4IOC A;  1SSO A;  4KK7 A;  1A15 A;  4N9T A;  3UDG A;  1XX8 A;  2JA9 A;  1HR0 W;  4DR4 L;  2IHE A;  4RHR A;  3CU7 A;  1VQD A;  2F0Q A;  2BH8 A;  5I6Y A;  3RZD H;  4K14 A;  4X62 Q;  3BYT B;  2Z1C A;  3CP0 A;  3BVM A;  3I2Z A;  4LFB Q;  1TWF B;  1DZ1 A;  5C5M A;  2ZT9 C;  4CJ2 C;  1IW7 D;  3CD6 A;  3MEF A;  3G6J B;  4DR5 Q;  3K57 A;  2JA8 H;  4X3T A;  3PUY A;  4GN5 A;  4P74 A;  1U0L A;  3L9A X;  4V0B A;  4LF5 Q;  2JA6 H;  3HOZ H;  3HOV B;  3E0E A;  3NQT A;  3GTJ B;  1A63 A;  1SYE A;  4K6D A;  1E2W A;  3R2I A;  1PRT C;  1YEZ A;  2DN8 A;  2LS0 1;  2XIW A;  1PTO H;  5C3E B;  2RDF A;  5JJZ A;  2LMC B;  4RFB A;  2CKZ B;  3OMG A;  3S17 H;  3CCS A;  5KNC A;  1KQS A;  5IGB A;  3FEW X;  4DV5 Q;  2N8N A;  1L0W A;  3HOY G;  1QJO A;  4ZLT F;  1F9S A;  2F0D A;  1TWA H;  3D4R A;  4YCW A;  3U58 A;  1Q1B A;  2EYO A;  3HP3 A;  5D3D A;  1VF7 A;  3GTK B;  4DR2 L;  2QKI C;  4P72 A;  4XDX A;  3HOW H;  2K52 A;  4UY8 C;  2NBF A;  2GA4 B;  1I6H B;  2KED A;  5ELD A;  2EYJ A;  2Q8T A;  2ALY B;  4A3J G;  2NZO A;  1DXM A;  3S16 B;  4BY7 H;  5LL6 X;  2RA4 A;  1EYA A;  2KEC A;  1XPO A;  3VA7 A;  3BJU A;  3AQQ A;  5EKL A;  4FP5 D;  5IOC A;  4QUC A;  1D8L A;  4LF4 L;  3H3V H;  1D2B A;  2E8G A;  3CKI B;  1N9W A;  2RDG A;  1GJX A;  1UNS A;  4CDC C;  1X9N A;  3I4M H;  2B2Y C;  5CV7 A;  3ND9 A;  3HS0 C;  2EE1 A;  3H6M A;  3J80 L;  1HZB A;  3M4Q A;  2AWO A;  5C44 H;  3ERO A;  5JPN C;  1YIJ A;  1E24 A;  3KOJ A;  2ID0 A;  4PZ8 A;  4RHS A;  2PNR C;  3S14 H;  5IYD G;  3A54 A;  2NVY H;  4WOR A;  5IGG A;  3KYH C;  1P8L A;  1YNJ D;  2F0N A;  2F0P A;  1IKM A;  5GAH C;  5FKA C;  5IP7 G;  2JA5 B;  2UXB Q;  4A3K G;  4IFD G;  2XNA C;  4QY7 A;  4KKT A;  1Y1V B;  1K73 C;  5C4X B;  2PZW A;  2BH2 A;  4A3L G;  1JOQ A;  3J7Z C;  1UWV A;  1CA6 A;  2XRS D;  2A69 D;  3JAM c;  5IGC A;  2UXC L;  3UE1 A;  4HR7 B;  4A3M B;  4PMC A;  3TZD A;  1EU3 A;  4A3I H;  1MJE A;  4Q5V A;  3PIP A;  1NR4 A;  3MC0 B;  4GLX A;  1STG A;  1O7Y A;  3BVZ A;  1V1P A;  4QMG A;  3WOF A;  1MIU A;  2PZU A;  1CM9 A;  4AQY L;  5M5Y B;  2B39 A;  2EDG A;  4K0K L;  2D0O A;  1A8V A;  4JOI C;  3MAQ A;  5A2Q L;  2MNA A;  3TRZ A;  3U4Z A;  1H9R A;  1AEX A;  2B2W C;  2NVX B;  1XMQ Q;  1STA A;  4UAI A;  2JK8 A;  3NTK A;  1LT3 D;  1HH2 P;  2UUB L;  4DAM A;  3E9I A;  2ZXP A;  2JE6 I;  1EQV A;  4A93 G;  1II3 A;  2L15 A;  3T53 B;  1I6V C;  2KCC A;  2KJX A;  1I50 H;  2IPK D;  4C3J H;  3W2D A;  2X6L A;  4U68 A;  3HOX B;  1GUS A;  1DD2 A;  3OPO A;  5CBA E;  4AYB G;  4QIW E;  1R4Q B;  3A8I E;  2A73 B;  4AYB E;  3N52 A;  3T1Y L;  4RH6 A;  4DR7 L;  2N88 A;  1DM0 B;  4F88 A;  2I46 A;  2VUM B;  4LF9 Q;  1KHI A;  1GUG A;  1K3R A;  1PRT D;  1TWC H;  5M9O A;  1D7Q A;  3HKZ B;  2GVB A;  4DR6 Q;  2NYZ D;  4MTN A;  3G7L A;  2E2J B;  1TKW B;  1JWM D;  2K32 A;  1N8R C;  1PYB A;  4TRD A;  4C2M B;  3K5O A;  5DEH A;  1VQK A;  4FF2 A;  4PMB A;  4J6H A;  1LO5 D;  2E5L Q;  2IY5 B;  2WV6 D;  1EFI D;  2ENB A;  5JEA J;  3PF4 A;  3M4O H;  1HRJ A;  1F9R A;  1LTT D;  4R9W A;  2UUC Q;  3CC7 A;  2A68 D;  5M5X H;  4MZ9 A;  2K28 A;  1UEA B;  3PUZ A;  1J9O A;  3KF8 B;  2OQ0 A;  2A6E D;  3S1N B;  2BCO A;  4JI4 Q;  3PCO B;  2MP1 A;  1BOS A;  2ZJP A;  5I4D A;  5C3X A;  1SYG A;  2B29 A;  1NMG A;  3TME A;  3G71 A;  2R92 B;  4X6A H;  3OIP A;  3S2H B;  2F03 A;  1LYL A;  1PRT B;  4L63 B;  3EVQ A;  4L8J A;  1C4Q A;  2E2I B;  3H0G H;  5CYU A;  5IE8 A;  1YHA A;  3KF8 A;  4CGY B;  1Q46 A;  3J7A 5;  2B2V A;  4NP5 A;  3RLN A;  2CW0 D;  4NXM L;  1AH9 A;  1BBU A;  4FF3 A;  2DJF C;  4DR1 Q;  1U4M A;  1LM0 A;  3NEL A;  1T9H A;  5D14 A;  3MXN A;  5KND A;  1KTK A;  2KA7 A;  1A62 A;  3HEJ A;  1JMC A;  2JA8 G;  4HAE A;  4JVZ A;  2EXD A;  1VMP A;  3U4V A;  5FOB B;  1X3G A;  4GS3 A;  1EWC A;  1EY5 A;  1PH7 A;  4FXG C;  4A3C H;  1MD2 D;  1STY A;  1PTO C;  1YHQ A;  1NAP A;  4H0L C;  3IKJ A;  1N36 L;  3LX0 A;  3RLO A;  1MBY A;  1O7I A;  2A19 A;  1B70 B;  1X3P A;  4Y7N H;  5C3W A;  1QVG A;  3JAM L;  2VUM H;  4DK3 C;  2AQ2 B;  4X62 L;  1G51 A;  4K6L A;  1SND A;  3SGI A;  3S1R B;  1XMO Q;  2PPB C;  2YU9 H;  4A3E H;  2F4I A;  3PO2 H;  4H44 C;  4GLA C;  1EU4 A;  2TSS A;  3K80 C;  5COY A;  2QA4 A;  4A3B H;  2LKV A;  3VA5 A;  2QEX A;  3F2B A;  1WVL A;  3GTO B;  4L5Q A;  4C2M H;  1EQR A;  3HOW G;  1K3B C;  1Y8N B;  5C0X G;  3BYY B;  2XVS A;  2JYO A;  4GKJ L;  4B9X A;  1RL2 A;  5FLX c;  2Y0S B;  4QJF A;  1MSG A;  4DR2 Q;  1BKB A;  3KLS A;  3M7G A;  3BDL A;  3DLL A;  3BZD B;  2AKW B;  4A76 A;  2NZ1 D;  2H5X A;  2VB3 X;  3H3V C;  3RNU A;  2F0M A;  1HFG A;  1GOZ A;  2R92 H;  4C3H H;  1SYD A;  2B63 B;  1G6P A;  4X3U A;  1L1O A;  1ZYR D;  1PYW D;  3I3C A;  1TU2 B;  2IX1 A;  2EY5 A;  1ZEQ X;  3I4M G;  3BZK A;  3NWT A;  3NBH A;  3QB3 A;  1TWG B;  2L11 A;  4J1M A;  3Q23 A;  3F2D A;  5C44 G;  2VQF Q;  4LF4 Q;  4QB4 A;  2YYZ A;  3T4A C;  4JI0 L;  1SE3 A;  2DJG C;  3CQZ B;  1PFM A;  4FO2 A;  2QGQ A;  2X69 A;  4A3G H;  1B50 A;  1KIX A;  5C4J H;  4CHT B;  1GUO A;  2EYM A;  1K8M A;  2CWA A;  1I4H A;  3H09 A;  1Z9F A;  4BS9 A;  1BXT A;  1I4P A;  1QWY A;  1LAC A;  5FO7 B;  1QNK A;  4I7A A;  5I9P A;  5IYC H;  3FMC A;  2QDB A;  3PUX A;  4OEM B;  3M7N A;  1SRO A;  3HOV G;  2CQA A;  2HIX A;  1D6E C;  3QIA A;  3S1M H;  1HZC A;  4KN4 C;  4RCN A;  4OO1 H;  4CKC A;  2N55 A;  3PIO 3;  3TS0 A;  3LNN A;  5CV4 A;  2NN6 H;  4GNX A;  2EQS A;  2H4O A;  2NVQ B;  4UP8 A;  5C3E G;  4A3F H;  4QF4 A;  2QCP X;  4HIM A;  3URY A;  1K0S A;  3O13 A;  1NUC A;  3R93 A;  4X66 Q;  1RKN A;  4BY1 B;  4DGZ A;  1JB3 A;  3TEH B;  2ZJR A;  4JI3 L;  4ULL A;  2CH4 W;  4DR3 Q;  1Y8O B;  1UUP A;  3QR8 A;  4YHH Q;  5IWA L;  2EYH A;  1IW7 C;  1O80 A;  1PA6 A;  2QIL A;  4BBS H;  3PUW A;  2UXB L;  1HR0 L;  1B53 A;  2F0U A;  1D1K A;  4HMJ A;  3C1E A;  3WDN A;  1X3F A;  4FF1 A;  3M4P A;  3NEN A;  3CCR A;  2Q8R E;  4BBR B;  1PH3 A;  5EGT A;  2K50 A;  2NVT B;  4PZ7 A;  3SK6 A;  4OL7 A;  5HUR A;  4K0K Q;  3NUC A;  2VL6 A;  3Q6S A;  4MIU A;  4DV7 Q;  2EJG C;  4YY3 L;  1Q82 C;  4A3D H;  4RGN A;  5IGD A;  1FR3 A;  2CH4 A;  1LTA D;  4PMW A;  3TN2 A;  2L0C A;  2M00 A;  4DV0 Q;  5EAY A;  1PH9 A;  3BDO A;  5FLX E;  1Q8I A;  5EQ0 A;  1QB5 D;  1Y69 U;  1M1K C;  2B8F A;  2F0S A;  2N49 A;  3FPP A;  1KLU D;  1DOM A;  1VCI A;  4KHV A;  1IBM L;  2WAQ B;  1BF4 A;  1MGS A;  3VYU A;  1FGB D;  2JSO A;  1VQE A;  1XMQ L;  1ASY A;  4S3S A;  2R3Z A;  3J7A V;  4A75 A;  2XN9 C;  2JA5 G;  4XT1 B;  4QUF A;  3I4N H;  1WTH A;  3RZD B;  2I5L X;  3AMU A;  5C4X G;  3OYY A;  3G4S A;  3OTO Q;  4JK1 C;  4K8J A;  1C48 A;  1ET6 A;  3V2T A;  3WWV A;  2I5H A;  1R4P B;  4X3S A;  1W3S A;  1SYC A;  5E4W C;  1PLF A;  1PZI D;  1Q90 A;  2QEJ C;  2WKC A;  2Z4H A;  3MXP A;  4GOP A;  4A3M G;  1JJ2 A;  2JA8 B;  3FDT A;  2K05 A;  4DK1 A;  4P71 A;  2AUJ D;  3NP8 A;  2JA6 B;  3HOZ B;  2DY8 A;  3CPF A;  4EQN A;  1IL8 A;  1RF2 D;  4LF9 L;  1QCB D;  5DNF A;  3S15 H;  1YNJ C;  3T16 A;  1WTX A;  2F0F A;  4JPB W;  4RG1 A;  1UEB A;  1ESR A;  1PTO B;  1U4L A;  2F4V L;  3D4W A;  3S17 B;  2J7Z A;  1LT5 D;  1DGS A;  1X54 A;  5KGU A;  1WD1 A;  2KEN A;  1SXT A;  5KYI A;  3KBG A;  2E5L L;  4ZCK A;  2A69 C;  2EY1 A;  1TWA B;  1K8G A;  3W5O A;  2B8G A;  2O5J C;  1LTI D;  3TDQ A;  5C4Z A;  3NSW A;  1E3P A;  3K58 A;  3MFG A;  3SVM A;  4LNQ A;  3HOW B;  2Z6K A;  4H13 C;  4JI4 L;  1I3Q H;  4CBV A;  1JCK B;  2L12 A;  4XYO A;  1HFN A;  1B7Y B;  1SBB B;  1ILP A;  2KUM A;  1VQ8 A;  4BWG B;  1SNQ A;  3A8J E;  1SE8 A;  4DF7 A;  4RKL A;  4ZKB B;  3HOX G;  2MQH A;  3R3O A;  1G2S A;  4BY7 B;  3VR4 A;  1EIY B;  3CCQ A;  1TR5 A;  4BA2 I;  4DNT B;  2JA7 B;  1S5B D;  4K5W A;  5ELE A;  4OWT B;  2PW5 A;  3CXC A;  2F0G A;  3RN5 A;  3VDY A;  3CRK C;  2HQL A;  1ESF A;  1KRS A;  4JI8 Q;  1BCP D;  2VUM G;  3FKI H;  4YCV A;  1NR2 A;  3SXH A;  1KXL A;  3I4M B;  3RN2 A;  1JT8 A;  1CKN A;  4A3E G;  4DR1 L;  1N36 Q;  2UUA L;  3HKZ G;  1X6O A;  4DV1 L;  5C44 B;  1Y8P B;  3ONA B;  5D3I B;  4K5V A;  2PO4 A;  3HKZ E;  3A5Z B;  1CZG A;  1SMY D;  2AQ3 B;  3AU7 A;  1YIT A;  1G6Z A;  4KV6 A;  5CMD A;  3TS2 A;  3S14 B;  1O7L A;  2R7F A;  2K5W A;  2NVY B;  3N6R A;  4O1N A;  5M3F H;  1JOO A;  2R7Z H;  2EIF A;  5EJW A;  4R4C A;  3GDE A;  1JE5 A;  1OXV A;  5C0X J;  1KC8 C;  2HUG A;  2IX0 A;  3EIV A; 
#chains in the Genus database with same CATH homology
 4BXX G;  4K0K L;  2D0O A;  3PF5 A;  1A8V A;  4JI6 L;  3T1H Q;  5GAD C;  2ASB A;  2OWO A;  4JOI C;  1VQ4 A;  2MNA A;  3TRZ A;  4QGU A;  4O2D A;  3U4Z A;  4JYA Q;  4GKJ Q;  2PI2 A;  4JI2 Q;  4JV5 Q;  4UPA A;  2R92 G;  3JAM i;  2K14 A;  2FXQ A;  4GOP B;  4HJ7 A;  1XMQ Q;  2WP8 J;  4EX5 A;  3DM3 A;  1XMO L;  2JK8 A;  1IBK L;  2XGT A;  1YJW A;  4LFB L;  4HJ5 A;  4PG3 A;  1JJG A;  4DV4 L;  5GRO A;  1HH2 P;  2VQE Q;  2UUB L;  4DAM A;  2N3S A;  3E9I A;  1FJG Q;  2E2J H;  4DR5 L;  2JE6 I;  3M3Y H;  4A93 G;  2L15 A;  4IO9 A;  4JI7 L;  4LF5 L;  3AEV A;  4P75 A;  1OXT A;  4NPS A;  1G29 1;  2ATW A;  1I50 H;  4C3J H;  3F2C A;  3ULP A;  2ZJQ A;  3RLF A;  1VQB A;  3D0F A;  1Q7Y C;  1PH8 A;  4BA1 I;  2RHS B;  1N33 Q;  5IYB H;  3KLW A;  1KL9 A;  3W1B A;  4AYB G;  3HFZ B;  4QIW E;  2R93 G;  2N78 A;  2DUD A;  4BXX H;  4B3T Q;  1GD7 A;  2IHF A;  3ULL A;  4AYB E;  4OWX B;  4OX9 Q;  1NJI C;  3T1Y L;  3S1N H;  1K8A C;  1OXX K;  4LUZ A;  2NN6 I;  1WYD A;  4DR7 L;  5M3M G;  4QQB X;  4JI0 Q;  4DV2 Q;  2E2H H;  2PI2 E;  2YTX A;  3L2P A;  3EIV A;  4LF9 Q;  1KHI A;  3F1Z A;  4IPG A;  1K3R A;  1TWC H;  4B3M L;  4DV5 L;  3S2H H;  2K5V A;  1GO3 E;  2NZH A;  4DUY Q;  1D7Q A;  2GVB A;  4JI1 Q;  1VQJ A;  4DUZ Q;  4DR6 Q;  2NN6 G;  4MTN A;  5ELN A;  2MO1 A;  4DNI A;  5LMU Q;  2E2I H;  2JA7 H;  1N32 L;  4A93 H;  2DGY A;  1IBL Q;  1N8R C;  1PYB A;  2JQO A;  3S2D H;  3U50 C;  3H0G G;  2VQF L;  1VQK A;  3G6E A;  1HNW Q;  4KHP Q;  3ULJ A;  2ES2 A;  2E5L Q;  2IY5 B;  1PH2 A;  1P16 A;  5JEA J;  5AJ3 Q;  3PF4 A;  3M4O H;  1Q8K A;  4FDB A;  2UUC Q;  1H95 A;  3CC7 A;  2Z0S A;  5M5X H;  4MZ9 A;  1Q81 C;  1WOC A;  3CCM A;  2D62 A;  4TQU S;  2OTJ A;  3PUZ A;  3KF8 B;  2OQ0 A;  1L1O C;  1N34 L;  4UP9 A;  4JI4 Q;  5M3M H;  3PCO B;  2ZJP A;  4AH6 A;  1J5E L;  4JI5 L;  1CKN B;  4B3R Q;  4IPC A;  2B29 A;  1NMG A;  4LFC L;  3G71 A;  4JI3 Q;  4X6A H;  4IFD J;  2LSS A;  4JG2 A;  1LYL A;  1PH4 A;  1HJP A;  1YHB A;  5IWA Q;  2Y0S G;  3PGZ A;  4A3C G;  1B8A A;  5GAE C;  1X65 A;  3CMA A;  2ZTC A;  3IRB A;  4X65 L;  1HR0 Q;  2Y0S E;  2Q2T A;  2C35 B;  2GN5 A;  5JJL A;  2VY3 A;  3H0G H;  4WJ3 M;  3J81 j;  5IE8 A;  1YHA A;  4L5T A;  5IP9 G;  4XIG S;  1UE6 A;  1Q46 A;  1KRT A;  3H15 A;  1EYG A;  3AFP A;  3J7A 5;  4YWM A;  2JEA I;  1SRU A;  3BU2 A;  3RLN A;  5BR8 Q;  4NXM L;  2ZTE A;  3PUV A;  4X66 L;  1EOV A;  1FGU A;  4YCU A;  1YI2 A;  2B63 G;  2IT1 A;  3FHW A;  1AH9 A;  1HNZ L;  1V43 A;  4HID A;  3S1R H;  1BBU A;  1I94 Q;  2UXC Q;  4JOI A;  1Y14 B;  2KCT A;  4DR1 Q;  4DR3 L;  1LM0 A;  3NEL A;  4YHH L;  1XJV A;  3E9H A;  3PO2 G;  1J6Q A;  1T9H A;  3JC6 6;  3K7U C;  1Y1W G;  4YY3 Q;  1S40 A;  3GTO H;  4B3S L;  1AE3 A;  4A3B G;  4DK6 C;  3J81 c;  2JA8 G;  1A62 A;  2LXK A;  4LFA Q;  1JMC A;  4NXN Q;  4LF6 Q;  4ALP A;  2EXD A;  3BZC A;  1PYS B;  2ZTD A;  5IYD H;  4GNX C;  3U4V A;  3S1Q H;  1Q86 C;  1VQ5 A;  1X3G A;  4GS3 A;  5J3B A;  2UXD Q;  3ERS X;  1SMX A;  1HNX L;  1PH7 A;  1S3O A;  4GKK Q;  2R7D A;  1E1O A;  2YTV A;  4JBK A;  4AQY Q;  4A3C H;  2A8V A;  3HOU G;  1NBW A;  2HHH L;  1YHQ A;  4A3K H;  2A1A A;  2ZM6 Q;  1N36 L;  5FLM G;  1QZG A;  3RLO A;  2OTL A;  4DV7 L;  1S72 A;  1O7I A;  1OXS C;  5IP9 H;  4A3L H;  4Y52 H;  2A19 A;  2B3G A;  1B70 B;  4Y7N H;  2XTI A;  4J15 A;  1QVG A;  3A0J A;  1IBM Q;  2B63 H;  1VQM A;  1XNQ L;  2VUM H;  4WJ4 A;  5C0X I;  4DK3 C;  4X62 L;  3GTQ H;  1VQG A;  1G51 A;  3EBE A;  4DV0 L;  3SGI A;  4RMF A;  1XMO Q;  2YU9 H;  3CME A;  1YVC A;  4A3E H;  2AWN A;  4IJH A;  4DV4 Q;  3PO2 H;  4KI0 A;  2K4K A;  4GLA C;  1Y1W H;  3J81 i;  2UUB Q;  2QA4 A;  3K80 C;  1TWG H;  4A3B H;  2QEX A;  1YJN A;  3F2B A;  1K9M C;  5HY6 A;  4L5Q A;  3B6Y A;  1AE2 A;  1IZ6 A;  1PH6 A;  3T1H L;  3CAM A;  1EQR A;  4YWK A;  4C2M H;  3HOW G;  1VQA A;  5C0X G;  3GTG H;  5DLQ E;  2HT1 A;  3CQZ H;  2F3I A;  2LXJ A;  4POG A;  4LUV A;  3GTL H;  4JYA L;  4GKJ L;  3ZJY C;  4JV5 L;  4GN4 B;  1RL2 A;  4LUO A;  2KBN A;  4BY1 G;  5FLX c;  4NB3 A;  1XPR A;  3H3V I;  4A3G G;  1VQP A;  3HOU H;  4R4T A;  4OO1 I;  3L7Z C;  5FJ8 G;  1GVP A;  1NE3 A;  4QJF A;  3STB C;  1U5K A;  3T1Y Q;  1V9P A;  2CQO A;  1BKB A;  4JCV E;  5FLM H;  2VW9 A;  4DR2 Q;  4DR7 Q;  3ER0 A;  3W1G A;  3DLL A;  2VQE L;  2WFW A;  2Q2U A;  2AKW B;  5IYC G;  4A76 A;  1FJG L;  2H5X A;  3S24 A;  2HIV A;  4LWC A;  3KJP A;  3RNU A;  1Y1V G;  2R92 H;  4JBJ A;  4C3H H;  1G6P A;  1YJ9 A;  1L1O A;  4B3M Q;  3KF6 A;  4KLK A;  4OO1 G;  3OTO L;  4IOA A;  4X64 L;  2UU9 L;  4BBR G;  4HJ9 A;  1N33 L;  2IX1 A;  4A4I A;  1YZ6 A;  4PZ6 A;  4DV6 L;  1PH1 A;  3BZK A;  3I4M G;  3Q8D A;  2F4V Q;  1N32 Q;  3F2D A;  2NVQ H;  2VNU D;  3K8A A;  5C44 G;  3J80 c;  4DV3 Q;  2VQF Q;  4LF4 Q;  2YYZ A;  4A3F G;  5JJI A;  4IPH A;  2PMZ E;  4JI0 L;  3CC2 A;  4BY1 H;  2JJQ A;  2QGQ A;  3I55 A;  5HGQ A;  3RZO H;  1HZ9 A;  3K81 C;  5C4J H;  1KIX A;  1QZH A;  3K0X A;  4A3G H;  2R93 H;  1VQH A;  1NY4 A;  2CWA A;  4P73 A;  4DPG A;  3STB D;  1GM5 A;  4OWW B;  1N34 Q;  1Z9F A;  4DKA C;  2CWP A;  1IL2 A;  1C0A A;  4JI1 L;  4LF7 Q;  2RCN A;  4DR6 L;  4BBS G;  5K36 G;  3PV0 A;  5IYC H;  5LMU L;  1NMF A;  1EWI A;  2JEB I;  3AFQ A;  2Q2H A;  3PUX A;  3PSI A;  4YWL A;  1IBL L;  1XNR Q;  2D0P A;  3M7N A;  1W2B A;  1SRO A;  1SFO H;  3HOV G;  3GO5 A;  2HIX A;  2RHQ B;  5M5W H;  1HNW L;  4GOP C;  3S1M H;  4KHP L;  1HZC A;  4HIO A;  3TS0 A;  1FL0 A;  4BBR H;  1VQ7 A;  3MXN B;  4XTC S;  2F52 A;  2YV5 A;  5AJ3 L;  2WAQ G;  3FKI G;  2NVT H;  3M85 A;  1CKM A;  2UUC L;  4GNX A;  1BBW A;  2EQS A;  1ASZ A;  3PO3 G;  2R6G A;  2WAQ E;  3J80 i;  1PH5 A;  4UP8 A;  5C3E G;  1VQC A;  5JEA G;  4A3F H;  1WFQ A;  4A3D G;  4HIM A;  1QVC A;  4IFD I;  2Q2I A;  4UP7 A;  4NXM Q;  4R4O A;  4X66 Q;  1IXR A;  1YBY A;  1WI5 A;  2WB1 G;  1OXU A;  4R4Q A;  1HNZ Q;  3TEH B;  2ZJR A;  4JI3 L;  3OW2 A;  5M3F G;  4DR3 Q;  1TWF H;  2R7Z G;  4YHH Q;  2UUA Q;  5IY0 A;  5IWA L;  4DV1 Q;  1CSQ A;  2VZA A;  5LMN L;  1E1T A;  2AMC B;  1PA6 A;  1WCM G;  4B3S Q;  1X56 A;  4BBS H;  3PUW A;  2UXB L;  1HR0 L;  1QVF A;  2GVA A;  4C3I H;  1TWH H;  1CSP A;  1Q12 A;  1UE5 A;  1C7Y A;  2CFM A;  2JA6 G;  3HOZ G;  3HOV H;  3CCJ A;  3GTJ H;  1X3F A;  1KD1 C;  3M4P A;  3NEN A;  3PIO A;  3CCR A;  1PH3 A;  1LTL A;  2Z6K C;  4JI8 L;  2K50 A;  2K5H A;  5LMN W;  4PZ7 A;  4IOC A;  3ICE A;  1E7Z A;  4K0K Q;  1Q1E A;  1I94 L;  3UDG A;  2JA9 A;  1HR0 W;  2VL6 A;  4JI6 Q;  4DR4 L;  3FP9 A;  2IHE A;  3I56 A;  2PQA A;  2K75 A;  5C3E H;  3CW2 C;  3F8T A;  4DV7 Q;  3CPW A;  4YY3 L;  1Q82 C;  4A3D H;  1VQD A;  4JBM A;  1K83 H;  4LF8 L;  5GQO A;  2BH8 A;  4NXN L;  4PMW A;  4LF6 L;  1XNQ Q;  3RZD H;  3I4N G;  4R1J A;  4X62 Q;  1A0I A;  5E7N A;  4DV0 Q;  1PH9 A;  5EAY A;  3CP0 A;  1V1Q A;  3KDF A;  1CUK A;  3G48 A;  1IBK Q;  2UXD L;  3I2Z A;  4LFB Q;  4GKK L;  2PNH A;  1PFS A;  4HJA A;  3CD6 A;  2RF4 A;  3MEF A;  1M1K C;  4DR5 Q;  3GTK H;  5IT9 c;  2JA8 H;  1L1O B;  3KF6 B;  5ELO A;  3PUY A;  4JI7 Q;  1BVS A;  2N49 A;  2OCE A;  2ZM6 L;  4GN5 A;  1VCI A;  1U0L A;  4P74 A;  3CF5 A;  1EFW A;  4L5R C;  4LF5 Q;  2JA6 H;  3HOZ H;  3E0E A;  3I7F A;  1I5F A;  3L0O A;  1I6H H;  2BA1 A;  1EIF A;  1A63 A;  3A74 A;  4JI2 L;  1KAW A;  3NBH B;  1IBM L;  1UE1 A;  1VQN A;  1HZA A;  1YEZ A;  3S16 H;  1VQE A;  4GLV B;  3GD7 A;  1XMQ L;  1ASY A;  4HJ8 A;  4BY7 G;  4A75 A;  2JA5 G;  2CKZ B;  3S17 H;  4JC0 A;  2JA7 G;  1C9O A;  3CCU A;  2KHI A;  3CCS A;  3I4N H;  2I5L X;  5C4X G;  1KQS A;  1WJJ A;  3OYY A;  3G4S A;  2N8N A;  3OTO Q;  4DV5 Q;  1L0W A;  4X64 Q;  1JB7 A;  2UU9 Q;  3HOY G;  1X55 A;  1M90 C;  3GTM H;  1TWA H;  4YCW A;  3WWV A;  3U58 A;  4DV6 Q;  2I5H A;  1Q1B A;  1FVI A;  1W3S A;  5H1S E;  3M9B A;  2MFI A;  3KJO A;  1K0R A;  4GOP A;  4B3T L;  1SN8 A;  3UDX A;  4A3M G;  1JJ2 A;  4OX9 L;  4DR2 L;  3GTP H;  4APV A;  4P72 A;  3HOW H;  4P71 A;  4HIK A;  2K52 A;  4H02 A;  4UY8 C;  4DV2 L;  1E22 A;  1OTC A;  3CPF A;  4GNX B;  1NTG A;  1XPU A;  4LF9 L;  2ALY B;  4QL5 A;  4A3J G;  1QUQ B;  2NZO A;  5FJ8 H;  3S15 H;  3NEM A;  4AIM A;  4JBW A;  3LGJ A;  4BY7 H;  4DAY B;  4RG1 A;  4DUY L;  1UEB A;  1XPO A;  3BJU A;  2KCM A;  3UE0 A;  3AQQ A;  4DUZ L;  2JA5 H;  2F4V L;  1VQO A;  1J5E Q;  3EN2 A;  4IJL A;  1DGS A;  1R9T H;  1Y1V H;  4JI5 Q;  1TXY A;  3I4O A;  1X54 A;  4LFC Q;  5C4X H;  4DV3 L;  1D8L A;  1SLJ A;  4LF4 L;  2KEN A;  3H3V H;  2E8G A;  3TQY A;  3HOY H;  1N9W A;  2E5L L;  3D31 A;  1PHJ A;  1VQ6 A;  1K8G A;  1X9N A;  3I4M H;  3W5O A;  1MJC A;  4X65 Q;  3UDI A;  3TRE A;  4A3M H;  1HZB A;  1E3P A;  2AWO A;  3M4Q A;  5C44 H;  3CCV A;  1QUQ A;  4POF A;  4LNQ A;  1YIJ A;  4A3I G;  2OQK A;  2Z6K A;  1E24 A;  4JI4 L;  3KOJ A;  2V1C C;  4L5S A;  4LF7 L;  2ID0 A;  1I3Q H;  4PZ8 A;  1GKH A;  5JJK A;  1B7Y B;  1EUJ A;  2I5M X;  3CC4 A;  1VQ8 A;  5GAG C;  3S14 H;  1XNR L;  4B3R L;  5IYD G;  2NVY H;  4A3J H;  2PQA B;  1SE8 A;  4EQ5 A;  2WB1 E;  3KYH C;  1P8L A;  2MQH A;  4O0A A;  3HOX G;  3KFU A;  5LMN Q;  1L2F A;  1LUZ A;  5M5Y H;  1EQQ A;  1EIY B;  5GAH C;  1X3E A;  3CCQ A;  4BA2 I;  2YTY A;  5IP7 G;  1Z47 A;  1XTD A;  2UXB Q;  4A3K G;  1PV4 A;  4IFD G;  4LW1 A;  4QY7 A;  4OXP A;  2CCZ A;  3KDF B;  1MKH A;  4OWT B;  3CXC A;  1K73 C;  2BH2 A;  4A3L G;  3UDF A;  4OON A;  3RN5 A;  2KHJ A;  1HNX Q;  1UE7 A;  3J7Z C;  3VDY A;  2HQL A;  1UWV A;  3A5U A;  1KRS A;  1VS0 A;  4JI8 Q;  5BR8 L;  2NVX H;  2VUM G;  2MO0 A;  1PVO A;  3FKI H;  4YCV A;  3JAM c;  1KXL A;  2HHH Q;  3RN2 A;  2VS1 A;  1VQL A;  1CKN A;  1JJC B;  2BA0 A;  3PO3 H;  4DR4 Q;  2UXC L;  3UE1 A;  1JT8 A;  4A3E G;  4DR1 L;  1N36 Q;  2I0Q A;  2UUA L;  3HKZ G;  1X6O A;  4MNO A;  1IYJ B;  3K7A H;  4TVA B;  4DV1 L;  3RR5 A;  1VQI A;  4A3I H;  1MJE A;  4LF8 Q;  4KHZ A;  3HKZ E;  3A5Z B;  1VQ9 A;  4ME3 A;  1YIT A;  4LFA L;  3PIP A;  2K5N A;  3TS2 A;  4GN3 B;  3CCE A;  2R7F A;  4GLX A;  3CCL A;  1SR3 A;  1RIP A;  3HOX H;  5M3F H;  2R7Z H;  2EIF A;  1MIU A;  4R4C A;  3GDE A;  5IYB G;  1VQF A;  1JE5 A;  1OXV A;  1YNX A;  3AYH B;  1CKO A;  5C0X J;  4AQY L;  1KC8 C;  4IPD A;  2IX0 A;  2AHO B;  5IP7 H;  1WCM H;  3HKS A;  4R4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...