3TP8A

Crystal structure of staphylococcal nuclease variant delta+phs l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tp8A00
3HEJA 3NXWA 1EQVA 1EY4A 3SHLA 5IGDA 4PMBA 5KYLA 3NUCA 5EGTA 5I9PA 3TP7A 3QOJA 2EY1A 3D8GA 2EYFA 3SK6A 3T13A 3VA5A 5I6WA 5I6YA 1SNOA 5C5MA 4IALA 1A3VA 2QDBA 3MXPA 3OSOA 2F0NA 1JOOA 3QB3A 1EYDA 1STYA 3QOLA 4B9XA 5J39A 1EZ8A 4KY7A 2F0TA 1EY8A 2PW7A 2SNSA 3EROA 3NQTA 2RDFA 5IGEA 1EYCA 4N9PA 5C3WA 2EY6A 5ISRA 5DEHA 4ZQ3A 2F0VA 3TP5A 2OXPA 2RKSA 4QB4A 5CR3A 5M9OA 5EKKA 5J22A 5CV7A 3SXHA 2M00A 5C3XA 3OMCA 4KHVA 3SK5A 1NSNS 4IUNA 3P75A 1EY6A 1EY5A 2F0FA 4OL7A 4HMIA 4ME5A 1KABA 2F0WA 1SYBA 1SYGA 3MHBA 4EQNA 5C4ZA 5IGCA 5KGUA 4K8JA 5KEEA 3NP8A 2EYOA 4H7BA 3E5SA 4HTHA 4J1MA 4TRDA 1A2UA 4S3SA 4EVOA 1STGA 2EYLA 2RBMA 5K5PA 1TQOA 4KJOA 3TMEA 5DAUA 1F2MA 1A3TA 2EYJA 4HMJA 5F2DA 3SK4A 4ZUJA 1F2ZA 4IZ8A 4EQOA 2ENBA 1AEXA 2EY5A 2F3VA 1SYEA 3R3OA 4J6HA 4QMGA 2F0LA 3C1FA 3S9WA 3H6MA 4F7XA 3D4WA 2F0KA 4WORA 2KHSA 1JORA 1STNA 5E3FA 2PZTA 1A3UA 5C4HA 1EY9A 5C5LA 1SNCA 2PW5A 2EXZA 3EJIA 4WRDA 1U9RA 1EZ6A 5HGTA 3OWFA 4K14A 4K2KA 1SNDA 2F0HA 3P1HA 4N9TA 5J1ZA 5HURA 5I9OA 3MVVA 1TT2A 5CV8A 1RKNA 3C1EA 3OMGA 4KD4A 5KRUA 3RUZA 4B9WA 1SYDA 2EYMA 2PYKA 4KTAA 5KIXA 4NMZA 5EKLA 1SNQA 4K5XA 3ERQA 4NKLA 4NP5A 5JOBA 5CGKA 5E1FA 1SYFA 2F0IA 4KV6A 2WACA 4QF4A 3T16A 2O4XA 4KY6A 1A2TA 4G57A 3LX0A 5IGBA 4MIUA 4R8NA 4DU9A 1EY7A 1JOQA 5IGFA 1KDCA 3ITPA 1SNPA 1ENCA 4KJNA 2KQ3A 4LAAA 4I65A 4K8IA 5IIFA 1IHZA 5NUCA 4EQPA 2F0UA 3BDLA 1EYAA 4ZUIA 5CC4A 5IGGA 4PMCA 4RKLA 2EYPA 5IODA 5KYIA 2OF1A 4E6IA 2F0DA 5JAVA 4DFAA 4KD3A 4NDXA 3V2TA 3TP6A 5CV5A 5CV9A 2F0QA 2HQEA 2F0JA 2LKVA 5C6AA 4ODGA 2F0SA 4DF7A 1SNMA 3BDCA 4K5WA 5CV6A 1STHA 1SYCA 3SK8A 4ID6A 2PQEA 4KY5A 4DGZA 2F3WA 3MEHA 1KDAA 2SOBA 4K2LA 5IOCA 1KDBA 1NUCA 2F0GA 1JOKA 1KAAA 1STBA 1II3A 2F0EA 2F0OA 3DMUA 3PMFA 2F0MA 2SNMA 2F0PA 3SR1A 3DHQA 4RKBA 1ENAA 1EY0A 3D6CA 3NK9A 3EVQA 2NUCA 5CV4A 4YIJA 3NHHA 4K6DA 3U9OA 1TR5A 2OEOA 4K5VA 3MZ5A 2PZUA 3TP8A 3HZXA 4F8MA 3D4DA 2PZWA 1STAA 4PNYA 2EY2A 2EYHA 1F2YA
chains in the Genus database with same CATH superfamily
5K36G 1Q82C 2IX3A 1WJJA 3NUCA 2VZAA 5IGGA 3T13A 1MJCA 1HZAA 3TN2A 3OSOA 4LUVA 4KHPQ 2JK8A 4B9XA 3WWVA 4DKAC 1G91A 1IBKL 2ID0A 1CQFA 4IURA 2MUYA 1NNXA 1KRTA 4L63B 5D65A 2OXPA 2KCNA 2RKSA 3F2UA 1ONLA 1PDQA 5C3XA 2UUCQ 1SXTA 3T53B 2VQFL 1SYBA 2GVBA 1PMRA 2E5LL 1EL0A 3I56A 3PO3G 1RDPD 4KI0A 3KF6A 4JI2L 1BDOA 4A93B 5TSSA 5DAUA 3VR3A 1AE2A 4G7HC 4OX9Q 1VQ8A 3GTMB 1IKLA 4Y52H 2VUMB 2R93G 1PTOD 1LTID 3TEHB 4EQ5A 4MN3A 2C9OA 3J81L 4B3TL 4P73A 3ULJA 3T4AC 2ZXOA 2A73B 1IBLQ 1C9OA 1D5XC 2F0HA 5J1ZA 3VYUA 2D5DA 1BBUA 1F9SA 1Y8NB 5M3MB 1NAPA 4G7OC 2QDLA 1SMYD 3L0OA 4JI3L 3HOZG 3GV6A 4BBSB 1UE5A 1LT5D 4BY7H 4X3KA 4C1NI 1I4QA 3T16A 1C7YA 2O4XA 4LW1A 1J5EQ 2FMCA 5JJLA 3VR4A 2BA1A 4PG3A 2Y0SE 1PH1A 1SNPA 2WB1E 4LF9L 2CVRA 4A3KB 1BNZA 1IHZA 4BA2I 1VQDA 4ZUIA 3I91A 5D14A 4JI0Q 2ZXPA 4OXPA 3KDFB 3S17B 2HD3A 1QVFA 4JBMA 3HOUG 4HJ5A 3P7JA 4CGYB 2PPBC 3EBEA 2I5HA 4KK7A 2ZTEA 3SK8A 1AN8A 1ZXTA 4X66Q 2DGYA 1YNJC 4N8FA 4YCVA 1H9KA 2R6GA 1UNSA 2JXMB 3NHHA 2UUBL 4JPBW 1B4OA 3S2DH 1H9SB 4MNOA 1Q46A 2EY2A 2KCMA 3FRPB 3RN5A 2H4OA 3DEPA 2IJ0A 3GTKB 2BOSA 4A3BG 5C5MA 4DR7Q 2B2UA 1LTRD 1NMFA 2NTTA 3BG3A 2M9VA 5IGEA 1B2TA 1X9NA 1WCMH 1YI2A 4DV2Q 3ULPA 5HGQA 1DOMA 3HKZG 2DY8A 3CC4A 2ZT9C 1K8AC 4KHVA 1D7QA 3H0GG 1SLJA 2Z4IA 4HMIA 3URYA 2XNAC 3S14B 1DOLA 1MBYA 1SE4A 1PTOF 3I4LA 4CKEA 4MZ9A 5KNDA 4ZUJA 4DAVA 3WOFA 2ZM6Q 2ENBA 4DK3C 2LS01 1Y8OB 3E9HA 3I8ZA 4RHRA 3I4MB 1D8LA 1I6VC 3E0EA 3PF5A 1AZPA 4QIWB 2D9UA 5I2XA 4P75A 5E3FA 5FLXc 1V43A 1PZID 1PXUA 5I9OA 4K0KL 1HTPA 1CK1A 3EFXD 3J7AF 1RKNA 1HHVA 4JV5Q 5C44H 4A3MH 3S1NH 1G2SA 5JOBA 4NPSA 2F4VL 5JPMC 2R92G 3UDGA 3PUXA 3L7ZC 3CP0A 4LFCL 1JOQA 3PUWA 1M90C 3FPPA 2JA8G 2NVQH 5FLXL 3J80c 4KJNA 1U0LA 2BE5D 2KQ3A 2XGTA 2Z9HA 3PV0A 2Q2TA 3TBIB 1K83B 4A3JB 1NR2A 3PIP3 2RSOA 4LUOA 3KJOA 1JB7A 4BY1B 2F0QA 4DR4Q 3W1BA 2HHHL 4LF8L 3K7UC 5CBAE 2PQEA 1KQSA 1ZYRD 4YWLA 3GTQH 2UUAQ 1YNJD 1FGUA 4IFDG 1HUMA 2AWOA 4BBRG 4C2MB 4QUFA 3RNUA 5IP9H 4AYBE 1F2YA 4IUQA 4IOAA 3NXWA 5EJWA 3W2DA 4JBJA 5IGDA 2D62A 2RDGA 5KYLA 3QOJA 3GTKH 2EYFA 2VL6A 1IW7C 3I90A 2JA6G 1JOOA 2PI2E 3DXJC 4LWCA 1L1OA 1HUNA 3PO2G 3DWQA 5C3WA 3K7AH 1PH8A 3HOXB 2JYOA 3W3AA 3NTHA 1LACA 2R92B 2QEJC 1L0WA 1MKHA 4FXGC 5DLQE 1FGBD 1Y1WG 5LMNL 5E4WC 4AH6A 2XWJB 5KEEA 3IFTA 1EFID 4HIOA 1JCKB 3UDIA 1AW7A 5BN4A 2BDOA 1L0YB 4EQOA 1BCPD 4QMGA 2CWPA 5IYDG 2F0LA 3NSWA 3HKZE 2OT2A 1X65A 3D0FA 2GVAA 2RCFA 1A6XA 1X32A 3S1RB 4JOIC 3KJPA 2YTXA 1O7ZA 2XN9C 1VQNA 1PRTF 3RUZA 4B9WA 2OTJA 1RTNA 5C3EG 1HPCA 2IHEA 1XNRL 4NMZA 2NBFA 1Z6HA 3EIVA 3D4RA 1CUKA 2R7ZG 3R8BA 4C3IH 5M5WB 4JI6Q 4G4KA 3S2HB 4DU9A 1X3EA 3BYYB 5I4DA 2UU9Q 4QCLA 1NR4A 1XMQQ 1LO5D 4A3BB 5C3EB 4A3JH 4ABNA 2JA6H 2HUGA 4A75A 2HQEA 4APVA 3UDXA 5EQ0A 3KF8B 3RLOA 1PYWD 2F0GA 1W3SA 2Z0SA 5E4XA 4DR4L 4DV4L 2K5HA 3D6CA 3GP7A 3TDQA 4O2DA 2VY3A 3UI2A 1D2BA 4OHJA 2B8GA 3CRKC 3TP8A 2JQOA 1O7LA 1F2LA 3M9BA 2UXBQ 1Y1VH 1D6EC 1A62A 2YU9B 1JQYD 2LFNA 3M7GA 5T1GA 3S14H 1NMGA 3MFGA 1JB3A 3TRZA 4DK6C 3CMAA 1VS0A 2K50A 3VYSA 5IP7H 1SEBD 1LT6D 5CMDA 1R9TB 4QB4A 4WJWA 4DNTB 1YJWA 1VQIA 4GKKL 3MA2B 1SYGA 3HOZB 3K8AA 1X6OA 4EVOA 4H7BA 4J1MA 2R3ZA 1ICFB 4X64L 4F88A 2EJFC 4FO2A 1V9PA 4JYAL 2VNUD 3R3OA 2LY7A 1TKWB 4B3SL 4DR7L 4M1UB 2NZOA 2UU9L 4OO1H 1EOTA 4DN4M 2IT1A 2C5CA 3CW2C 3OIQA 5HGTA 1NJIC 2BH8A 3WOEA 1YJ9A 1SFOB 2ICIA 2N3SA 3G6EA 2RQXA 3I70A 5ELNA 4OGQC 1VCIA 3M3YB 4JW0A 3H0GB 1JWUD 3J7YW 1M4VA 4IOCA 3G71A 2MQHA 5COYA 1VQ5A 4UAIA 2EQSA 1WVLA 1LTAD 2VW9A 3C2PA 1SROA 2JA8B 1BQQT 4HIMA 5C4XB 2N8NA 1EEFD 2XIWA 1KDCA 1WCMB 2ZTCA 1GHKA 4DR1L 1PH9A 2E2JH 4KKSA 4LAAA 1XMOQ 1FVIA 3HKSA 4UHVA 5L37A 1W6JA 1XPOA 2B39A 4P72A 4A3EH 4RKLA 1SMYC 3K59A 4A3CH 4KHZA 4NDXA 3V2TA 4K0KQ 1JICA 4NW2A 4OO1I 2IHFA 1IL2A 2F3WA 3MEHA 4K2LA 2KCTA 1II3A 3H91A 3MC0B 3TSSA 1ENAA 2EXDA 4IUTA 2B2UC 4K5VA 3MZ5A 1G6ZA 2JSOA 2RA4A 2CQOA 2A68D 4PNYA 3D31A 3NQIA 4LF6L 2IWHA 3QIAA 1Y1WB 4HIKA 3K81C 4LUZA 5C4JB 3RD4A 2QW7A 2JA5B 4IALA 1PH7A 1HA5A 1V1OA 5AJ3L 3T1YQ 1LTSD 1IXRA 4JYAQ 2K52A 2WAQE 3NTKA 1QCBD 2JA9A 1I5FA 5CV7A 1XMOL 1NSNS 5A2QE 1U4LA 3NTIA 4YCWA 3E5SA 4DR3L 1B1ZA 2Y0SG 3GTLH 3KLSX 1F2MA 1TIID 3CCJA 5LMUQ 2F3VA 1SYEA 4X65L 3I4MH 5IT9L 1X56A 4P2CB 4WORA 3NBHB 1D1IA 3H3VH 1A3UA 2NVXH 1AP0A 1G6PA 1H95A 5ELBA 2R92H 1V8QA 3QG1A 2F52A 3ULLA 1B50A 1GUWA 2F4VQ 4A3GG 2Z6KA 2X6GA 1HTLD 2K5NA 4XIGS 2PCFB 1S40A 1AFPA 1B53A 1CSPA 1CKNB 1A2TA 2N78A 5JJIA 1YJNA 2CQAA 2K7VA 3K6OA 3U50C 4ILWA 3H3VC 1SRUA 4AQYL 3OTOQ 3OW2A 5EPLA 3A0JA 3HGBA 1QVGA 1EOVA 3I7FA 4IFDH 1L0XB 2PI2A 3HOZH 5M3MH 2AHOB 4U68A 3TQYA 2OF1A 1D5MC 5CV5A 1Q86C 2B29A 5CV6A 1ET9A 1ML0D 2SOBA 3TP7A 1STBA 3PMFA 2SNMA 4UPAA 4H0LC 3M85A 1V1PB 3DHQA 1BO0A 5IWAL 3FEWX 3BU2A 2Q2UA 1HR0W 4WFN3 4JI0L 2A5HA 5M3FG 4A3BH 5H1SE 3HEJA 2K04A 3S16B 5BN3A 1VQJA 3SHLA 3S1QB 3T1HL 1Y1WH 3KFUA 1CT1D 5JJZA 2EPBA 1X54A 1Y1VG 1CKOA 3OYYA 1EZ8A 1PH5A 2YTYA 1F9QA 1YNNC 1JE4A 3NQTA 1EYCA 2N88A 5DEHA 2F0VA 2KCCA 1IYUA 3K57A 4ZAIA 1I3QB 5FK9C 5KYIA 4NB3A 1HNWL 3NBHA 1GKHA 4R4OA 4DPGA 4FF2A 4DV1Q 5FLMH 2K33A 1R4QB 3D4WA 1GUOA 4DNRB 3IFDA 1G291 2WAQG 1I3QH 1HQMC 5JJKA 2FFKB 3K5OA 3CHBD 3MAQA 1JJCB 2CW0D 5M5XB 4CKCA 4A3EG 2I5MX 1MJEA 3HP3A 4FYDA 5I9PA 5KIXA 4YHHQ 2B3GA 4ZK9B 1GUNA 3OHXC 1Q8KA 1SJHD 2F0IA 4KV6A 4QF4A 3HOXG 1VQ7A 5C4XG 3AYHB 3CU7A 4O42A 4UY8C 1AE3A 3Q0AA 1LT3D 2NN6I 4JBWA 4POFA 4ALPA 1C48A 3DLLA 1J9OA 2K5QA 1KTKA 1DM0B 4DUZL 4JI4L 2H1EA 5CC4A 4BY7G 2JA7G 3M3YH 2L55A 3CQZH 4E6IA 5JEAJ 4DFAA 1EU3A 2BH2A 4FF3A 5CV9A 3GO5A 1JWMD 4GNXB 3K5LA 3GD7A 2VQFQ 4KY5A 1QZGA 4A3IB 1MGSA 2ZXRA 2L4NA 2UUCL 4QUCA 3M4OB 1YZ6A 3GTJH 1N34L 2A6ED 2EJMA 2NUCA 3V05A 1MD2D 4K6DA 2EZVA 1F9RA 3HG9A 3PO3H 2YU9H 1VQCA 1Q1BA 3I2ZA 5FLMG 2QEXA 1NY4A 1IYVA 3KLRA 1SNOA 4JCVE 3CKIB 1CA5A 1JE5A 2F0TA 3J81j 1MHWC 3BZDB 1QILA 1BUVT 1K0RA 1TWHH 4LNQA 5EKKA 2EOTA 4DR1Q 3SK5A 2CH4W 2UXCQ 1EY6A 4OL7A 3AFPA 1LTLA 1F77A 1N9WA 2F0WA 3KDFA 1QG7A 4TRDA 2MO0A 4FVMA 5K5PA 2Q2IA 2LXJA 1TQOA 3QJYA 1YHQA 2KECA 4LJZC 4IUUA 1S5BD 4JVZA 5BR8Q 2IL8A 1TWCB 2KHSA 1JORA 3K7AB 4TSSA 1JJ2A 2VUMG 4X3SA 2MGSA 3ER0A 4B3TQ 1CHQD 1HNZL 4JI6L 2WKCA 4A3FG 5IT9E 4LF5Q 3CCEA 4LFBL 2R7ZH 2L12A 1Y14B 2B63G 2JP1A 3LWUA 3HOYB 1PFSA 4DAYB 4IN3A 3VYRA 5DM73 4DV2L 2ASBA 3A5ZB 3FDTA 1SNQA 2JA5H 2JA7H 3VR5A 3JAMc 5CGKA 3NWSA 3DEOA 2RCNA 1XMQL 3J80i 4KY6A 5M5YH 4JI7L 4G57A 1L1OB 2JJQA 4A3DB 4X3UA 4ZLTF 5IGBA 1EY7A 2QCPX 1VQMA 1VMCA 3I55A 4DK1A 2K01A 2NN6H 4OWWB 2WIIB 4EQPA 1S5CD 2NWGA 5JVG3 4B3RQ 4CKBA 4A3MG 5M3FH 4HSVA 2A1AA 3I4OA 3VR2A 2LKVA 4Q5VA 1TS4A 1SYCA 2JN4A 4YCUA 3F8TA 2ATWA 1OXUA 2HDMA 3DMUA 4KKTA 1GUTA 4RKBA 2L1BA 2QF7A 1Z47A 3EA6A 2R7FA 4PZ6A 3CD6A 2UUBQ 3U9OA 1QNKA 3K80C 1TR5A 4C2MH 1BKBA 4LFBQ 1STAA 1N36Q 1BOSA 1OO9B 4AYBB 3CCVA 5LMNW 4HSPA 1EY4A 3M7NA 4IFDI 5A35A 5J3BA 1EIHA 5FJ8H 2N49A 2QDBA 2E75C 2MFIA 5ELDA 3QB3A 2FINB 3J80L 5BR8L 1Y69U 3U4ZA 4X62Q 1GM5A 2K14A 1IKMA 5ISRA 1DXMA 2K05A 3KF6B 4YY3Q 4V0BA 1KD1C 4A3KH 5DNFA 4BBSG 2K03A 2F0FA 2F03A 2E74C 3ZYYX 1WTXA 4DXFA 3PIOA 3LGJA 2PNRC 1J6QA 1IBML 2IY5B 2GN5A 4ZKBB 3TZUA 4BA1I 5C44B 1LM0A 4K6LA 2E8GA 1CQVA 2DY7A 4QY7A 1F2ZA 1I4RA 1ENFA 1X3QA 3KF8A 4J6HA 4HJ8A 3GTMH 1T9HA 2JA8H 2CFMA 3S1MH 1GJXA 4XDXA 2UXDL 2PZTA 2OTLA 1HA6A 3EJIA 4CDFC 3PUVA 3FVQA 3PIO3 2IX0A 3RN2A 3TS2A 4GN4B 1HRJA 3PO3B 1BCPC 1T5XD 1TT2A 3HOUH 4IFDJ 1H9JA 1PH6A 2A68C 3A54A 1GO3E 3CCRA 1EIYB 1E24A 1O7YA 4A3LG 4GLVB 3DUZA 4ZCKA 2XWBB 1VQFA 1VQAA 2ALYB 4UP7A 4HJ7A 2IPKD 3CAMA 3PQIA 2K6AA 4FF1A 4Z9CB 1IL8A 2F1MA 5EBCA 2Z6BA 1L1OC 4A3CG 4K8IA 2I46A 2E2IB 5IYCG 3JAME 4DUZQ 3S17H 5JAVA 1S3OA 4HJAA 4A3MB 5GAEC 1VQEA 1AZQA 1YNND 3K58A 5IYBH 1E3PA 5EPKA 1I4PA 1STEA 2F0MA 2F0PA 1PZJD 1VQLA 1ESRA 4A3DG 3EVQA 5LMUL 3KK7A 5JEAH 3K0XA 4F8MA 3D4DA 5CR3A 1E1OA 4EQNA 4IO9A 3JAML 1PTOC 1D1KA 1UEBA 2ES2A 1A63A 3GTOB 4PMBA 2L15A 3W1GA 3GTLB 1TS3A 4N8X1 2V4DA 1A3VA 1VMPA 1U4MA 3MWYW 4C3IB 1SR3A 3UE0A 3HOVG 3LWEA 1VQ9A 1GOZA 1U4PA 4RGMA 5CYUA 2I5LX 2HIXA 3F2CA 2KUMA 4YWKA 4C3JB 1KNAA 4LMQD 3RZOB 2IX1A 5IE8A 1FNVA 1XJVA 3GTPB 1G51A 1IBLL 1VQKA 1XPRA 1PV4A 4GZYC 2EYLA 4R4IA 3W5OA 5C4JH 1CSQA 3E6ZX 5IYCH 3J80E 4LF4Q 1IBMQ 4IZ8A 4L8JA 3R2IA 4GN3B 4OEMB 1TVXA 3S9WA 1Z9FA 5JPNC 1I94L 4RH6A 2JEBI 4X64Q 4BXXG 1WD1A 5IYBG 1HZ9A 3SDZA 1WFQA 1N32L 3HOVB 4XYOA 3OMGA 3AMUA 3A74A 5JEAG 1DOKA 1BF4A 2EYMA 1WTOA 4A93H 1LTGD 2RF4A 2AMCB 3SGIA 1PRTD 4R8IA 1VQHA 2K75A 4IPCA 5IT9c 3MFYA 1NTGA 5KNCA 3Q6SA 1R9TH 4U673 1X55A 1S5ED 1ENCA 1KLUD 1HZBA 1UWVA 2NVXB 2NZ1D 4I65A 3U58A 4RFBA 2E2IH 1K83H 3HOVH 5C44G 3K5MA 1NBWA 2EYPA 2ZTDA 4L5SA 4LF5L 2Q2HA 4AQYQ 2JA7B 2UXCL 1TWFH 5ELFA 4BY7B 2F0JA 4ODGA 1CZGA 1YNXA 4JK1C 3H09A 2I07B 2H5XA 3S2HH 2F0OA 4JI8L 3M4OH 1NCVA 1YVCA 4JI1Q 1Q8IA 3AU7A 4CDDC 3C3LA 1I4GA 2PZWA 3NE5B 1H9MA 1TS5A 3NP8A 4RG1A 1FJGQ 3N52A 5EGTA 4H13C 3VA5A 4L6TB 3A7AB 4C3HB 4FNFA 4OO1G 1PH4A 2F0NA 3CF5A 4A3GB 1EYDA 1STYA 3STBC 3FKIB 1Q81C 4DR6L 2WAQB 4UDUC 2B2YC 2HCIA 2LSSA 3N6RA 3TP5A 1BCPF 2SDFA 4KHPL 2XSCA 1A8VA 5BN5A 2M00A 5GADC 1PVOA 3HOWG 4B08A 5IGCA 4FDBA 5C3EH 2XTIA 1T5EA 4MHEA 5C0XI 2L9HA 4RGTA 4CBVA 2EYOA 4DA2A 4A3FH 3MTSA 1STGA 4DV3Q 4DV6L 2EYJA 3KOJA 4HMJA 3PUZA 3FKIH 3ND8A 4EGVA 1MIUA 2RSNA 3I73A 5KNBA 2B2TA 4R4CA 5C5LA 2PW5A 3T1HQ 1EZ6A 2Z8LA 3OWFA 4XQQA 1XNRQ 4L5TA 2WFWA 4N9TA 1EYGA 4GOPC 3GTGH 2WKDA 4QIWE 4LK1C 2EVBA 2X69A 4LFAQ 3SE0A 4DV7L 3CC2A 3DWPA 3VA7A 2NVTH 3PUYA 5E1FA 4GS3A 4AYBG 4A3IH 3Q24A 2QA4A 4HAEA 1QUQB 1UUPA 2HHHQ 2OWOA 5E7NA 3J81i 3ITPA 1S5FD 5G3LF 2LXKA 2WV6D 4JI1L 5ELCA 1J5EL 1B9MA 5NUCA 3X3MA 3I4NB 4DV7Q 4LFAL 1GHJA 1X3PA 3GTPH 4CDEC 2MPMA 4BS9A 3GTGB 5AJ3Q 3T1YL 1FL0A 1EWCA 4JI3Q 3HOWH 2VXWA 2BE5C 3BDCA 1STHA 3K5NA 4RGOS 3OW7A 3D6WA 2NTSA 3IL8A 4B3MQ 3L3OC 3AEVA 3S1MB 5HY6A 4PQXA 5LL6S 1DYQA 4RCNA 4YIJA 1TWGH 4O0AA 2ZJRA 1O7IA 1DD2A 2OEOA 5T1IA 1VQPA 1GVPA 2AQ3B 1C8CA 1SSOA 2D2CC 2CH4A 3EN2A 2E2HH 1TXYA 1JJGA 4WJ4A 3SK6A 5LHY1 5I6YA 1Q3LA 5I6WA 3BYTB 1B7YB 4B3SQ 4NXNL 1H9SA 4DAPA 2B2TC 1YHAA 3H3VI 3STBD 3ICEA 1RCVD 2KENA 1BBXC 4GKKQ 2ZM6L 1SJED 4IQZA 4N9PA 2EY6A 1EWHA 3A7LA 1DZ1A 4X66L 3GTJB 5J22A 4BBRB 3RZDB 3A56A 4RA8A 4QJFA 2F4IA 4ME5A 1XYIA 4DV0L 1XTCD 2Y0SB 2PQAB 3G4SA 4HJ9A 1LUZA 2JEAI 3HOYH 3KLWA 4S3SA 1ASYA 2K5VA 4QQBX 3BVMA 1B70B 5IWAQ 1E0BA 1WI5A 2EY5A 1KLGD 1G8ZD 2KVMA 4F7XA 2F0KA 5FO7B 1X3FA 1QOHA 2B2YA 2Q8TA 3RLFA 1WTQA 1OTCA 1U5KA 1A0IA 1CM9A 1FNUA 1HQRD 1SN8A 4DV4Q 3O13A 4WRDA 1U9RA 2IW3A 4JBKA 2JA5G 3T51B 1EU4A 5KRUA 1XX8A 2Z4HA 3IAYA 4XTCS 2PYKA 1TWAB 2NVYH 2A6HD 1YHBA 2PMZE 1W2BA 1PFBA 4R4TA 1HNXL 2WACA 3R2TA 1AH9A 4CDCC 2I0QA 2VUMH 2DNCA 4MIUA 3QO2A 2AUKA 4OX9L 5FO8B 2K5DA 2R93H 2YYZA 2OQKA 2F0UA 4C3HG 1E1TA 3Q8DA 4PMCA 1SE3A 4CJ2C 1XWEA 4OWXB 1N8RC 3S16H 1WD0A 3S1QH 3GV3A 4KD3A 4DV5Q 4RHSA 4FXKC 4DF7A 4DAMA 2J4XA 3TREA 2AWNA 1KDBA 3OOCA 4GLXA 1PYBA 4X62L 4HIDA 1EQRA 5AFWA 4R4QA 1PTOB 1V1QA 1ASZA 1VQGA 1K8GA 4DR3Q 1IW7D 1YEZA 1ILQA 4FP5D 4DV0Q 3QR8A 4YY3L 3SXHA 4CHTB 4L5RC 2VQEL 2BDNA 1ET6A 1LTTD 1K8MA 1HJPA 2DNEA 4KY7A 3SEBA 4TKOB 2WP8J 1XXGA 3NEMA 4ZYSA 2PQAA 4ZQ3A 4CJ0B 2A6EC 2R61A 2CHBD 3T56B 5A2QL 3U4VA 3I4NH 4IUNA 4PMWA 3CCSA 3H94A 2KJXA 2RVLA 2VS1A 3NPPA 4X65Q 4NXMQ 1DONA 4DXGA 5IP9G 2L0CA 2G5DA 3TS0A 4C3HH 3ND9A 4JOIA 3TMEA 1RF2D 5F2DA 4MTNA 1BCPB 2NVTB 3A8KE 5GAHC 1AEXA 1QNUA 1K3BC 1BBWA 3H6MA 3X3NA 1Q7YC 1STNA 3PCOB 4A3KG 1MI2A 1TY2A 5GROA 2A69D 1SNCA 2EXZA 4F87A 3V96A 3Q22A 1S4ZA 5HURA 2GA4B 2Z1CA 4MTKA 5D3IB 4BBSH 1WYDA 4HCSA 4H02A 4OIJA 1GD7A 3IKJA 4BY1H 1WOCA 4NP5A 3ERQA 3A5UA 1HXYD 3MXNB 2C35B 3AB9A 3PSIA 5M5YB 3LX0A 1TWHB 3OPOA 2KEEA 1CA6A 2J7ZA 4FF4A 2R93B 1I50H 1FYCA 1EYAA 4JI4Q 1FD7D 1RHPA 1M1KC 3UE1A 5IODA 2TMPA 1QWYA 3FPUB 3RLNA 2VQEQ 3KBXA 2F0SA 1FR3A 4DV5L 1S72A 4ID6A 1KDAA 3L2PA 1KAAA 1LYLA 3TZDA 2A19A 2NN6G 3M4QA 4JV5L 4GKJQ 5IY0A 2O5IC 3S1RH 4PZ8A 1LT4D 1N33L 4ZRZA 2E2JB 4DUYQ 2PZUA 5IP7G 2B63H 4LF7L 1PFNA 1E2WA 2EE1A 1E22A 4LFCQ 1EQVA 4IJHA 4KMUC 1P8LA 4OWTB 2NVYB 1PH3A 2O2LD 1DJRD 1PYSB 1K73C 4XT1B 5D3DA 4JI7Q 3J7ZC 3KBGA 2QKIC 1OXSC 3EROA 4LF4L 2EIFA 1GUGA 3GQBA 5EKIA 2A8VA 3VDYA 4PV1C 3F2DA 2G9HD 1IBKQ 1KABA 4OONA 2E2HB 1VF5C 3B6YA 4GN5A 3J81E 1A2UA 3PF4A 4KJOA 3J7A5 3HRZC 4J15A 4IPGA 2PMZB 3NWTA 2MHVA 1KAWA 2DUDA 3R93A 2E5LQ 1M8AA 2QGQA 1VQOA 1LTBD 1HR0Q 3HS0C 4A3IG 1PTOH 3J81c 4GOPB 1H9RA 4POGA 1TY0A 4RCOA 1K3RA 4K2KA 1ICWA 2AQ2B 3D3RA 1O78A 4XYQA 1K28A 1TS2A 3MXNA 5M5XH 1I94Q 1FNWA 1RIPA 3KUPA 2CCZA 1ZEQX 2B2WC 1SE2A 4H44C 1G2TA 1QB5D 4YWMA 4HN7A 4JI5Q 1EIGA 1SYFA 2MNAA 3S15B 1N36L 1KHIA 5DM63 2CW0C 2EJGC 1EIFA 3CCQA 1EWIA 3S24A 4BBRH 3PO2H 1ZYRC 1YIJA 2ZJPA 2B2WA 2WINB 2KHJA 4PZ7A 5G3LD 5JVH3 1VDZA 5GAGC 4XQNA 3TP6A 5FO9B 1HFGA 3G6JB 2Q8IB 4K5WA 4KN4C 2YV5A 4QL5A 3PGZA 5M5WH 2XVSA 3GTQB 3S15H 4HTHA 1NUCA 5ELEA 4A4IA 4RGNA 5LL6X 1RL2A 1O80A 4DR5Q 2A69C 1HR0L 3CC7A 3NELA 4R9WA 1WCMG 4HR7B 1CFMA 1IZ6A 2KHIA 3MXUA 3HFZB 3ERSX 2K4KA 1LABA 2KBNA 1YITA 3BJUA 2CKZB 1NE3A 2JA6B 2PO4A 1HCZA 2ZJQA 4IJLA 1PFMA 3D8GA 4RAUC 2UXDQ 1WTHA 2KOLA 2D0OA 2B2VA 2D0PA 2HIVA 2LMCB 1ZKOA 2P5ZX 2SNSA 3FP9A 2PW7A 3E9IA 2RDFA 1CTMA 1HNXQ 4ULLA 1I4HA 2AUJD 3ONAB 5M9OA 3I4MG 3AFQA 1PZKD 4UP9A 4C3IG 4EX5A 1Q12A 1EY5A 1I4XA 2L5TA 4C3JH 3S2DB 1RD9D 3MHBA 4UP8A 5C4ZA 1SDFA 4G7ZC 3E3XA 2DJGC 3H0GH 2RBMA 4GOPA 2HT1A 3ZJYC 2OQ0A 3IRBA 4A3GH 2UXBL 4Y7NH 3AQQA 1U4RA 3C1FA 4Q0FA 1N34Q 3JAMi 2J0TD 2Q8RE 4DAYA 2BCOA 4K14A 2CWAA 1YBYA 2R7ZB 3JC66 3CQZB 4DR6Q 3GTOH 1HFNA 4XT3B 1K0SA 4HEDA 1C4QA 3HOWB 4K5XA 1ILPA 1B8AA 3M4PA 4A3DH 1SE8A 5FOBB 3WDNA 4J8QA 3K0YA 1F9PA 4L5QA 5IGFA 1D5ZC 2XRSD 3CPFA 3FKIG 1JC7A 2F3IA 3CCMA 4ME3A 2VB2X 4JI2Q 4DNIA 1SFOH 2NYZD 2A74C 1CKNA 1XPUA 2K1BA 5C0XH 3HOUB 5FJ8G 2UUAL 1VQ6A 3NENA 4X6AH 2XRQD 4LF9Q 2O5JC 3G48A 4DV1L 1SAPA 4GLAC 4NXML 3BDOA 1MSGA 1MSHA 4DGZA 5IOCA 3OWEB 1N32Q 3SK4A 4JI5L 3P20A 1B44D 1CKMA 4DR2Q 1N33Q 4P71A 3NBIA 3HZXA 2BA0A 1DGSA 1LV9A 4B3ML 2AKWB 2K5WA 4C3JG 5LMNQ 2Z6KC 1W6KA 5FLXE 2MO1A 3MXPA 5J39A 4BXXH 1KXLA 2JE6I 1QUQA 1TWCH 1QVCA 3LNNA 2HCCA 1VF7A 4TQUS 2B63B 2RHQB 3CRLC 2R7DA 3HOYG 1UEAB 2NB0A 3SVMA 3P75A 1CI3M 4LF8Q 2MJ8A 1DCZA 4A3EB 1WTPA 3EQLC 1VQ4A 3GDEA 1E2ZA 2FXQA 5I2YA 1KRSA 1OXTA 1RTOA 1JR0D 1B3AA 4XXEA 1E2VA 1HNWQ 2PNHA 4KKUA 5EBDA 2L11A 4DV3L 4DV6Q 1S5DD 5C4HA 3H15A 2HQLA 1EY9A 1FJGL 1I6HH 5IYDH 4C56C 1WTVA 2KA7A 1BVSA 3PO2B 4OELB 4WJ3M 3MVVA 4FXDA 5C0XJ 3E0JA 4LF7Q 4KD4A 1X3GA 1UE7A 1E7ZA 5ELOA 3A55A 1SYDA 5C0XG 3DWAA 1P16A 3CMEA 1Q90A 1RODA 3L9AX 1TWFB 3A8JE 4NKLA 4JI8Q 3BZCA 1EUJA 4QGUA 1J8IA 3VR6A 1PRTB 5FKAC 1EFWA 4R1JA 1HNZQ 4R8NA 2FJ2A 2OCEA 1BR9A 1QZHA 2HDLA 2RDHA 5IIFA 1Y1VB 2DN8A 3BDLA 3U9SA 4A3LH 3KYHC 3KLSA 3BS1A 1R4PB 3FHWA 1VQBA 1TWAH 1QE6A 1LLRD 4M8AA 4A3JG 4O1NA 2MP1A 4BWGB 2K28A 4RWSC 3HKZB 2DJFC 2QILA 2F0EA 4YHHL 4XQJA 3SR1A 2X6LA 1KL9A 1EY0A 3NK9A 2B8FA 1EEID 4RMFA 4GNXA 2B2VC 4IPDA 1KIXA 1OXVA 1Q1EA 3I3CA 2N55A 1GUSA 2TSSA 3FMCA 3M4YA 2AQ1B 1CZWA 3CCUA 2EY1A 1PH2A 1ESFA 4P74A 2SEBD 3I72A 3QWNA 3QOLA 4IPHA 1EY8A 3A8IE 4JC0A 4Y7NB 1EQTA 4DK0A 1JMCA 1JT8A 5EPJA 2M2LA 1PA6A 4NXNQ 3MXGA 1UE1A 2KEDA 2G9DA 3OMCA 3G7LA 3OTOL 3RZOH 4V190 5KGUA 3MEFA 3CXCA 4K8JA 2A6HC 1GXDC 2V1CC 2YTVA 1PHJA 2E76C 1XNQL 3F1ZA 1A3TA 3S1NB 1WTRA 1Y8PB 1L2FA 5CBEE 1B9NA 4ZKCB 1V1PA 2NVQB 1EQQA 1A15A 4DR5L 3J7AV 1BXTA 1SMXA 4CJ1B 1PLFA 1C0AA 1I6HB 4X3TA 3C46A 1I50B 1SNDA 3P1HA 4OIKA 3PIPA 1RJTA 1SBBB 5CV8A 3C1EA 4TVAB 1OXXK 4AIMA 4B3RL 2WB1G 3I4NG 3BZKA 4KTAA 3BVZA 1KC8C 1CHPD 5M3MG 5EKLA 4A76A 1XTDA 2WB1B 3DM3A 3DM1A 2RHSB 1TU2B 5GQOA 1UAPA 1IYJB 3VYTA 1KNEA 3RR5A 3CCLA 4JG2A 1PRTC 1TWGB 2VB3X 4HCEA 1HH2P 4KLKA 1K8OA 1HZCA 2ICEC 5K36H 1JWSD 1K9MC 3UDFA 1B3QA 3OIPA 4A93G 4BY1G 1Z7TA 4DUYL 4IUPA 5M3FB 3CPWA 2F0DA 1QJOA 4A3FB 1XNQQ 4GKJL 2NZHA 5CORA 4I7ZC 3BVGA 2E2DC 5C6AA 2FMMA 1SNMA 4KN7C 4GNXC 5EAYA 4C1NK 4LF6Q 3F2BA 1JOKA 1WTWA 2FHTA 2EDGA 5C4XH 3HOXH 5CV4A 4IUVA 2K32A 4I7AA 4DR2L 3RZDH 1UE6A 3Q23A 3RMHA 2EYHA
chains in the Genus database with same CATH topology
5K36G 2IX3A 3NUCA 5IGGA 3T13A 3TN2A 3OSOA 4B9XA 1G91A 2ID0A 1CQFA 4IURA 2MUYA 4L63B 5D65A 2OXPA 2KCNA 2RKSA 3F2UA 1ONLA 1PDQA 5C3XA 1SXTA 3T53B 1SYBA 1PMRA 1EL0A 1RDPD 4KI0A 1BDOA 4A93B 5TSSA 5DAUA 3VR3A 4G7HC 3GTMB 1IKLA 2VUMB 1PTOD 1LTID 4MN3A 2C9OA 3J81L 3T4AC 2ZXOA 2A73B 1D5XC 2F0HA 5J1ZA 3VYUA 2D5DA 1F9SA 1Y8NB 5M3MB 1NAPA 4G7OC 1SMYD 3GV6A 4BBSB 1LT5D 4X3KA 4C1NI 1I4QA 3T16A 2O4XA 2FMCA 3VR4A 2BA1A 1SNPA 2CVRA 4A3KB 1BNZA 1IHZA 4BA2I 4ZUIA 3I91A 5D14A 2ZXPA 3S17B 2PPBC 3P7JA 4CGYB 4KK7A 3SK8A 1AN8A 1ZXTA 1YNJC 1H9KA 2R6GA 1UNSA 2JXMB 3NHHA 1B4OA 1H9SB 2EY2A 3FRPB 2H4OA 3DEPA 2IJ0A 3GTKB 2BOSA 5C5MA 2B2UA 1LTRD 2NTTA 3BG3A 2M9VA 5IGEA 1B2TA 1DOMA 2DY8A 2ZT9C 4KHVA 2Z4IA 4HMIA 3URYA 2XNAC 3S14B 1DOLA 1MBYA 1SE4A 1PTOF 3I4LA 4CKEA 5KNDA 4ZUJA 4DAVA 3WOFA 2ENBA 2LS01 1Y8OB 3I8ZA 4RHRA 3I4MB 1I6VC 1AZPA 4QIWB 2D9UA 5I2XA 5E3FA 1V43A 1PZID 1PXUA 5I9OA 1HTPA 1CK1A 3EFXD 3J7AF 1RKNA 1HHVA 1G2SA 5JOBA 5JPMC 3PUXA 3L7ZC 1JOQA 3PUWA 3FPPA 5FLXL 4KJNA 2BE5D 2KQ3A 3PV0A 3TBIB 1K83B 4A3JB 1NR2A 3PIP3 2RSOA 4BY1B 2F0QA 5CBAE 2PQEA 1ZYRD 1YNJD 4IFDG 1HUMA 2AWOA 4C2MB 4QUFA 1F2YA 4IUQA 3NXWA 5EJWA 3W2DA 5IGDA 2D62A 2RDGA 5KYLA 3QOJA 2EYFA 1IW7C 3I90A 1JOOA 3DXJC 1HUNA 3DWQA 5C3WA 3HOXB 2JYOA 3W3AA 3NTHA 1LACA 2R92B 2QEJC 4FXGC 1FGBD 5E4WC 2XWJB 5KEEA 3IFTA 1EFID 1JCKB 1AW7A 5BN4A 2BDOA 1L0YB 4EQOA 1BCPD 4QMGA 2F0LA 3NSWA 2OT2A 1A6XA 1X32A 3S1RB 1O7ZA 2XN9C 1PRTF 3RUZA 4B9WA 1RTNA 1HPCA 4NMZA 2NBFA 1Z6HA 3D4RA 3R8BA 5M5WB 4G4KA 3S2HB 4DU9A 3BYYB 5I4DA 4QCLA 1NR4A 1LO5D 4A3BB 5C3EB 4ABNA 2HUGA 2HQEA 5EQ0A 1PYWD 2F0GA 5E4XA 3D6CA 3GP7A 3TDQA 3UI2A 1D2BA 4OHJA 2B8GA 3CRKC 3TP8A 1O7LA 1F2LA 1D6EC 2YU9B 1JQYD 2LFNA 3M7GA 5T1GA 3MFGA 1JB3A 3VYSA 1SEBD 1LT6D 5CMDA 1R9TB 4QB4A 4WJWA 4DNTB 3MA2B 1SYGA 3HOZB 4EVOA 4H7BA 4J1MA 2R3ZA 4F88A 2EJFC 4FO2A 2VNUD 3R3OA 2LY7A 1TKWB 4M1UB 4OO1H 1EOTA 4DN4M 2IT1A 2C5CA 3OIQA 5HGTA 3WOEA 1SFOB 2ICIA 2RQXA 3I70A 4OGQC 1VCIA 3M3YB 3H0GB 1JWUD 3J7YW 1M4VA 5COYA 4UAIA 1WVLA 1LTAD 3C2PA 2JA8B 1BQQT 5C4XB 1EEFD 2XIWA 1KDCA 1WCMB 1GHKA 4KKSA 4LAAA 1W6JA 2B39A 4RKLA 1SMYC 3K59A 4KHZA 4NDXA 3V2TA 1JICA 4NW2A 4OO1I 2F3WA 3MEHA 4K2LA 1II3A 3H91A 3MC0B 3TSSA 1ENAA 4IUTA 2B2UC 4K5VA 3MZ5A 1G6ZA 2JSOA 2RA4A 4PNYA 2A68D 3D31A 3NQIA 2IWHA 3QIAA 1Y1WB 5C4JB 3RD4A 2JA5B 4IALA 1HA5A 1V1OA 1LTSD 3NTKA 1QCBD 5CV7A 1NSNS 5A2QE 1U4LA 3NTIA 3E5SA 1B1ZA 3KLSX 1F2MA 1TIID 2F3VA 1SYEA 5IT9L 4P2CB 4WORA 1D1IA 1A3UA 1AP0A 5ELBA 1V8QA 3QG1A 1B50A 1GUWA 2X6GA 1HTLD 4XIGS 2PCFB 1AFPA 1B53A 1A2TA 2CQAA 2K7VA 3K6OA 4ILWA 3H3VC 5EPLA 3HGBA 4IFDH 1L0XB 4U68A 2OF1A 1D5MC 5CV5A 5CV6A 1ET9A 1ML0D 2SOBA 3TP7A 1STBA 3PMFA 2SNMA 4H0LC 3M85A 1V1PB 3DHQA 1BO0A 3FEWX 4WFN3 2A5HA 3HEJA 2K04A 3S16B 5BN3A 3SHLA 3S1QB 1CT1D 5JJZA 2EPBA 1EZ8A 1F9QA 1YNNC 1JE4A 3NQTA 1EYCA 2N88A 5DEHA 2F0VA 2KCCA 1IYUA 3K57A 4ZAIA 1I3QB 5FK9C 5KYIA 3NBHA 4FF2A 2K33A 1R4QB 3D4WA 1GUOA 4DNRB 3IFDA 1G291 1HQMC 2FFKB 3K5OA 3CHBD 3MAQA 2CW0D 5M5XB 4CKCA 3HP3A 4FYDA 5I9PA 5KIXA 4ZK9B 1GUNA 3OHXC 1SJHD 2F0IA 4KV6A 4QF4A 3CU7A 4O42A 3Q0AA 1LT3D 2NN6I 4JBWA 1C48A 1J9OA 2K5QA 1KTKA 1DM0B 2H1EA 5CC4A 2L55A 4E6IA 5JEAJ 4DFAA 1EU3A 4FF3A 5CV9A 3GO5A 1JWMD 3K5LA 3GD7A 4KY5A 4A3IB 1MGSA 2ZXRA 2L4NA 4QUCA 3M4OB 2A6ED 2EJMA 2NUCA 3V05A 1MD2D 4K6DA 2EZVA 1F9RA 3HG9A 1Q1BA 1IYVA 3KLRA 1SNOA 3CKIB 1CA5A 2F0TA 3BZDB 1QILA 1BUVT 5EKKA 2EOTA 3SK5A 1EY6A 4OL7A 1F77A 2F0WA 1QG7A 4TRDA 4FVMA 5K5PA 1TQOA 3QJYA 2KECA 4LJZC 4IUUA 1S5BD 2IL8A 1TWCB 2KHSA 1JORA 3K7AB 4TSSA 4X3SA 2MGSA 1CHQD 2WKCA 5IT9E 2L12A 3HOYB 2JP1A 3LWUA 4IN3A 3VYRA 5DM73 1SNQA 3FDTA 3VR5A 5CGKA 3NWSA 3DEOA 4KY6A 4G57A 4A3DB 4X3UA 4ZLTF 5IGBA 1EY7A 2QCPX 1VMCA 4DK1A 2K01A 2NN6H 2WIIB 4EQPA 1S5CD 2NWGA 5JVG3 4CKBA 4HSVA 3VR2A 2LKVA 4Q5VA 1TS4A 1SYCA 1OXUA 2HDMA 3DMUA 4KKTA 1GUTA 4RKBA 2L1BA 2QF7A 1Z47A 3EA6A 3U9OA 1QNKA 1TR5A 1STAA 1BOSA 1OO9B 4AYBB 4HSPA 1EY4A 3M7NA 4IFDI 5A35A 1EIHA 2QDBA 2E75C 5ELDA 3QB3A 2FINB 3J80L 1Y69U 1IKMA 5ISRA 1DXMA 2K05A 4V0BA 5DNFA 2K03A 2F0FA 2F03A 2E74C 3ZYYX 1WTXA 4DXFA 2PNRC 4ZKBB 3TZUA 4BA1I 5C44B 4K6LA 1CQVA 2DY7A 1F2ZA 1I4RA 1ENFA 1X3QA 3KF8A 4J6HA 1GJXA 4XDXA 2PZTA 1HA6A 3EJIA 3PIO3 3PUVA 3FVQA 2IX0A 1HRJA 3PO3B 1BCPC 1T5XD 1TT2A 4IFDJ 1H9JA 2A68C 3A54A 1O7YA 3DUZA 2XWBB 2IPKD 2K6AA 4FF1A 4Z9CB 1IL8A 2F1MA 5EBCA 4K8IA 2I46A 2E2IB 3JAME 5JAVA 4A3MB 1AZQA 1YNND 3K58A 5EPKA 1I4PA 1STEA 2F0MA 2F0PA 1PZJD 1ESRA 3EVQA 3KK7A 5JEAH 4F8MA 3D4DA 5CR3A 4EQNA 3JAML 1PTOC 1D1KA 3GTOB 4PMBA 3GTLB 1TS3A 2V4DA 1A3VA 1VMPA 1U4MA 3MWYW 4C3IB 3LWEA 1GOZA 1U4PA 4RGMA 5CYUA 2KUMA 4C3JB 1KNAA 4LMQD 3RZOB 2IX1A 1FNVA 3GTPB 4GZYC 2EYLA 3E6ZX 3J80E 4IZ8A 4L8JA 3R2IA 1TVXA 3S9WA 5JPNC 4RH6A 2JEBI 1WD1A 3SDZA 3HOVB 4XYOA 3OMGA 3AMUA 5JEAG 1BF4A 1DOKA 2EYMA 1WTOA 1LTGD 1PRTD 4R8IA 3MFYA 5KNCA 3Q6SA 4U673 1S5ED 1ENCA 1KLUD 2NVXB 2NZ1D 4I65A 4RFBA 3K5MA 2EYPA 2JA7B 5ELFA 4BY7B 2F0JA 4ODGA 1CZGA 4JK1C 3H09A 2I07B 2F0OA 1NCVA 1Q8IA 3AU7A 3C3LA 1I4GA 2PZWA 3NE5B 1H9MA 1TS5A 3NP8A 3N52A 5EGTA 4H13C 3VA5A 4L6TB 3A7AB 4C3HB 4FNFA 4OO1G 4A3GB 2F0NA 1EYDA 1STYA 3FKIB 2WAQB 4UDUC 2B2YC 2HCIA 3N6RA 3TP5A 1BCPF 2SDFA 2XSCA 5BN5A 2M00A 4B08A 5IGCA 4MHEA 1T5EA 5C0XI 2L9HA 4RGTA 4CBVA 2EYOA 4DA2A 3MTSA 1STGA 2EYJA 4HMJA 3PUZA 3ND8A 4EGVA 2RSNA 3I73A 5KNBA 2B2TA 5C5LA 2PW5A 1EZ6A 2Z8LA 3OWFA 4XQQA 4N9TA 2WKDA 4LK1C 2EVBA 2X69A 3SE0A 3DWPA 3VA7A 3PUYA 5E1FA 3Q24A 4HAEA 1UUPA 3ITPA 1S5FD 5G3LF 2WV6D 5ELCA 1B9MA 5NUCA 3X3MA 3I4NB 1GHJA 1X3PA 2MPMA 4BS9A 3GTGB 1EWCA 2VXWA 2BE5C 3BDCA 1STHA 3K5NA 4RGOS 3OW7A 3D6WA 2NTSA 3IL8A 3L3OC 3S1MB 4PQXA 5LL6S 1DYQA 4RCNA 4YIJA 1DD2A 2OEOA 5T1IA 2AQ3B 1C8CA 1SSOA 2D2CC 3SK6A 5LHY1 5I6YA 1Q3LA 5I6WA 3BYTB 1H9SA 4DAPA 2B2TC 1RCVD 1BBXC 1SJED 4IQZA 4N9PA 2EY6A 1EWHA 3A7LA 1DZ1A 3GTJB 5J22A 4BBRB 3RZDB 3A56A 4RA8A 2F4IA 4ME5A 1XYIA 1XTCD 2Y0SB 2JEAI 4S3SA 3BVMA 1E0BA 2EY5A 1KLGD 1G8ZD 2KVMA 4F7XA 5FO7B 2F0KA 2Q8TA 2B2YA 1QOHA 1WTQA 3RLFA 1CM9A 1FNUA 1HQRD 3O13A 4WRDA 1U9RA 2IW3A 3T51B 1EU4A 5KRUA 1XX8A 2Z4HA 3IAYA 4XTCS 2PYKA 1TWAB 2A6HD 1PFBA 2WACA 3R2TA 2DNCA 4MIUA 3QO2A 2AUKA 5FO8B 2K5DA 2YYZA 2F0UA 4C3HG 4PMCA 1SE3A 4CJ2C 1XWEA 1WD0A 3GV3A 4KD3A 4RHSA 4FXKC 4DF7A 2J4XA 2AWNA 1KDBA 3OOCA 5AFWA 1PTOB 1IW7D 1ILQA 4FP5D 3SXHA 4CHTB 2BDNA 1ET6A 1LTTD 1K8MA 2DNEA 4KY7A 3SEBA 4TKOB 2WP8J 1XXGA 4ZYSA 4ZQ3A 4CJ0B 2A6EC 2R61A 2CHBD 3T56B 5A2QL 4IUNA 4PMWA 3H94A 2KJXA 2RVLA 3NPPA 1DONA 4DXGA 2L0CA 3ND9A 3TMEA 1RF2D 5F2DA 1BCPB 2NVTB 3A8KE 1AEXA 1QNUA 3H6MA 3X3NA 1STNA 1MI2A 1TY2A 2A69D 1SNCA 2EXZA 4F87A 3V96A 3Q22A 1S4ZA 5HURA 2GA4B 2Z1CA 5D3IB 4HCSA 3IKJA 4OIJA 4NP5A 3ERQA 1HXYD 3AB9A 5M5YB 3LX0A 1TWHB 3OPOA 2KEEA 1CA6A 2J7ZA 4FF4A 2R93B 1FYCA 1EYAA 1FD7D 1RHPA 5IODA 2TMPA 1QWYA 3FPUB 3KBXA 2F0SA 1FR3A 4ID6A 1KDAA 1KAAA 3TZDA 2NN6G 2O5IC 1LT4D 2E2JB 4ZRZA 2PZUA 1PFNA 1E2WA 2EE1A 1EQVA 4KMUC 2NVYB 2O2LD 1DJRD 4XT1B 5D3DA 3KBGA 2QKIC 1OXSC 3EROA 1GUGA 3GQBA 5EKIA 4PV1C 2G9HD 1KABA 2E2HB 1VF5C 3J81E 1A2UA 4KJOA 3HRZC 2PMZB 3NWTA 2MHVA 3R93A 1M8AA 1LTBD 3HS0C 1PTOH 1H9RA 1TY0A 4RCOA 4K2KA 1ICWA 2AQ2B 3D3RA 1O78A 4XYQA 1TS2A 3MXNA 1FNWA 3KUPA 1ZEQX 2B2WC 1SE2A 4H44C 1G2TA 1QB5D 4HN7A 1EIGA 1SYFA 3S15B 5DM63 2CW0C 2EJGC 1ZYRC 2B2WA 2WINB 5G3LD 5JVH3 1VDZA 4XQNA 3TP6A 5FO9B 1HFGA 3G6JB 2Q8IB 4K5WA 4KN4C 2XVSA 3GTQB 4HTHA 1NUCA 5ELEA 4RGNA 5LL6X 1O80A 2A69C 4R9WA 4HR7B 1CFMA 3MXUA 1LABA 2JA6B 2PO4A 1HCZA 1PFMA 3D8GA 4RAUC 2KOLA 2B2VA 2LMCB 1ZKOA 2PW7A 2SNSA 2RDFA 1CTMA 4ULLA 1I4HA 2AUJD 3ONAB 5M9OA 4C3IG 1PZKD 1Q12A 1EY5A 1I4XA 2L5TA 3S2DB 1RD9D 3MHBA 5C4ZA 1SDFA 4G7ZC 2RBMA 3C1FA 1U4RA 4Q0FA 2J0TD 2Q8RE 4DAYA 2BCOA 4K14A 2R7ZB 3CQZB 1HFNA 4XT3B 4HEDA 1C4QA 3HOWB 4K5XA 1ILPA 5FOBB 3WDNA 4J8QA 3K0YA 1F9PA 5IGFA 1D5ZC 2XRSD 1JC7A 2VB2X 2NYZD 2A74C 2K1BA 5C0XH 3HOUB 2XRQD 2O5JC 1SAPA 3BDOA 1MSGA 1MSHA 4DGZA 5IOCA 3OWEB 3SK4A 3P20A 1B44D 3NBIA 3HZXA 2BA0A 1LV9A 2K5WA 4C3JG 1W6KA 5FLXE 3MXPA 5J39A 2JE6I 3LNNA 2HCCA 1VF7A 4TQUS 2B63B 3CRLC 1UEAB 2NB0A 3SVMA 3P75A 1CI3M 2MJ8A 1DCZA 4A3EB 1WTPA 3EQLC 1E2ZA 5I2YA 1OXTA 1RTOA 1JR0D 1B3AA 4XXEA 1E2VA 4KKUA 5EBDA 2L11A 1S5DD 5C4HA 1EY9A 4C56C 1WTVA 2KA7A 3PO2B 3MVVA 4FXDA 5C0XJ 3E0JA 4KD4A 3A55A 1SYDA 5C0XG 3DWAA 1Q90A 1RODA 3L9AX 1TWFB 3A8JE 4NKLA 1J8IA 3VR6A 1PRTB 5FKAC 4R8NA 2FJ2A 1BR9A 2HDLA 2RDHA 5IIFA 1Y1VB 2DN8A 3BDLA 3U9SA 3KLSA 3BS1A 1R4PB 1QE6A 1LLRD 4M8AA 2MP1A 4O1NA 4BWGB 4RWSC 2K28A 3HKZB 2QILA 2F0EA 4XQJA 3SR1A 2X6LA 1EY0A 3NK9A 2B8FA 1EEID 2B2VC 1OXVA 1Q1EA 3I3CA 2N55A 1GUSA 2TSSA 3FMCA 3M4YA 2AQ1B 1CZWA 2EY1A 1ESFA 2SEBD 3I72A 3QWNA 3QOLA 1EY8A 3A8IE 4Y7NB 1EQTA 4DK0A 5EPJA 2M2LA 3MXGA 2KEDA 2G9DA 3OMCA 3G7LA 4V190 5KGUA 4K8JA 2A6HC 1GXDC 2E76C 1A3TA 3S1NB 1WTRA 1Y8PB 5CBEE 1B9NA 4ZKCB 1V1PA 2NVQB 1A15A 3J7AV 1BXTA 4CJ1B 1PLFA 1I6HB 3C46A 4X3TA 1I50B 1SNDA 3P1HA 4OIKA 1RJTA 1SBBB 5CV8A 3C1EA 1OXXK 4KTAA 3BVZA 1CHPD 5EKLA 2WB1B 3DM1A 1TU2B 1UAPA 3VYTA 1KNEA 1PRTC 1TWGB 2VB3X 4HCEA 1K8OA 2ICEC 5K36H 1JWSD 3OIPA 1Z7TA 4IUPA 5M3FB 2F0DA 1QJOA 4A3FB 5CORA 4I7ZC 3BVGA 2E2DC 5C6AA 2FMMA 1SNMA 4KN7C 4C1NK 1JOKA 1WTWA 2FHTA 2EDGA 5CV4A 4IUVA 2K32A 3Q23A 3RMHA 2EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEJ A;  3NXW A;  1EQV A;  1EY4 A;  3SHL A;  5IGD A;  4PMB A;  5KYL A;  3NUC A;  5EGT A;  5I9P A;  3TP7 A;  3QOJ A;  2EY1 A;  3D8G A;  2EYF A;  3SK6 A;  3T13 A;  3VA5 A;  5I6W A;  5I6Y A;  1SNO A;  5C5M A;  4IAL A;  1A3V A;  2QDB A;  3MXP A;  3OSO A;  2F0N A;  1JOO A;  3QB3 A;  1EYD A;  1STY A;  3QOL A;  4B9X A;  5J39 A;  1EZ8 A;  4KY7 A;  2F0T A;  1EY8 A;  2PW7 A;  2SNS A;  3ERO A;  3NQT A;  2RDF A;  5IGE A;  1EYC A;  4N9P A;  5C3W A;  2EY6 A;  5ISR A;  5DEH A;  4ZQ3 A;  2F0V A;  3TP5 A;  2OXP A;  2RKS A;  4QB4 A;  5CR3 A;  5M9O A;  5EKK A;  5J22 A;  5CV7 A;  3SXH A;  2M00 A;  5C3X A;  3OMC A;  4KHV A;  3SK5 A;  1NSN S;  4IUN A;  3P75 A;  1EY6 A;  1EY5 A;  2F0F A;  4OL7 A;  4HMI A;  4ME5 A;  1KAB A;  2F0W A;  1SYB A;  1SYG A;  3MHB A;  4EQN A;  5C4Z A;  5IGC A;  5KGU A;  4K8J A;  5KEE A;  3NP8 A;  2EYO A;  4H7B A;  3E5S A;  4HTH A;  4J1M A;  4TRD A;  1A2U A;  4S3S A;  4EVO A;  1STG A;  2EYL A;  2RBM A;  5K5P A;  1TQO A;  4KJO A;  3TME A;  5DAU A;  1F2M A;  1A3T A;  2EYJ A;  4HMJ A;  5F2D A;  3SK4 A;  4ZUJ A;  1F2Z A;  4IZ8 A;  4EQO A;  2ENB A;  1AEX A;  2EY5 A;  2F3V A;  1SYE A;  3R3O A;  4J6H A;  4QMG A;  2F0L A;  3C1F A;  3S9W A;  3H6M A;  4F7X A;  3D4W A;  2F0K A;  4WOR A;  2KHS A;  1JOR A;  1STN A;  5E3F A;  2PZT A;  1A3U A;  5C4H A;  1EY9 A;  5C5L A;  1SNC A;  2PW5 A;  2EXZ A;  3EJI A;  4WRD A;  1U9R A;  1EZ6 A;  5HGT A;  3OWF A;  4K14 A;  4K2K A;  1SND A;  2F0H A;  3P1H A;  4N9T A;  5J1Z A;  5HUR A;  5I9O A;  3MVV A;  1TT2 A;  5CV8 A;  1RKN A;  3C1E A;  3OMG A;  4KD4 A;  5KRU A;  3RUZ A;  4B9W A;  1SYD A;  2EYM A;  2PYK A;  4KTA A;  5KIX A;  4NMZ A;  5EKL A;  1SNQ A;  4K5X A;  3ERQ A;  4NKL A;  4NP5 A;  5JOB A;  5CGK A;  5E1F A;  1SYF A;  2F0I A;  4KV6 A;  2WAC A;  4QF4 A;  3T16 A;  2O4X A;  4KY6 A;  1A2T A;  4G57 A;  3LX0 A;  5IGB A;  4MIU A;  4R8N A;  4DU9 A;  1EY7 A;  1JOQ A;  5IGF A;  1KDC A;  3ITP A;  1SNP A;  1ENC A;  4KJN A;  2KQ3 A;  4LAA A;  4I65 A;  4K8I A;  5IIF A;  1IHZ A;  5NUC A;  4EQP A;  2F0U A;  3BDL A;  1EYA A;  4ZUI A;  5CC4 A;  5IGG A;  4PMC A;  4RKL A;  2EYP A;  5IOD A;  5KYI A;  2OF1 A;  4E6I A;  2F0D A;  5JAV A;  4DFA A;  4KD3 A;  4NDX A;  3V2T A;  3TP6 A;  5CV5 A;  5CV9 A;  2F0Q A;  2HQE A;  2F0J A;  2LKV A;  5C6A A;  4ODG A;  2F0S A;  4DF7 A;  1SNM A;  3BDC A;  4K5W A;  5CV6 A;  1STH A;  1SYC A;  3SK8 A;  4ID6 A;  2PQE A;  4KY5 A;  4DGZ A;  2F3W A;  3MEH A;  1KDA A;  2SOB A;  4K2L A;  5IOC A;  1KDB A;  1NUC A;  2F0G A;  1JOK A;  1KAA A;  1STB A;  1II3 A;  2F0E A;  2F0O A;  3DMU A;  3PMF A;  2F0M A;  2SNM A;  2F0P A;  3SR1 A;  3DHQ A;  4RKB A;  1ENA A;  1EY0 A;  3D6C A;  3NK9 A;  3EVQ A;  2NUC A;  5CV4 A;  4YIJ A;  3NHH A;  4K6D A;  3U9O A;  1TR5 A;  2OEO A;  4K5V A;  3MZ5 A;  2PZU A;  3TP8 A;  3HZX A;  4F8M A;  3D4D A;  2PZW A;  1STA A;  4PNY A;  2EY2 A;  2EYH A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 5K36 G;  1Q82 C;  2IX3 A;  1WJJ A;  3NUC A;  2VZA A;  5IGG A;  3T13 A;  1MJC A;  1HZA A;  3TN2 A;  3OSO A;  4LUV A;  4KHP Q;  2JK8 A;  4B9X A;  3WWV A;  4DKA C;  1G91 A;  1IBK L;  2ID0 A;  1CQF A;  4IUR A;  2MUY A;  1NNX A;  1KRT A;  4L63 B;  5D65 A;  2OXP A;  2KCN A;  2RKS A;  3F2U A;  1ONL A;  1PDQ A;  5C3X A;  2UUC Q;  1SXT A;  3T53 B;  2VQF L;  1SYB A;  2GVB A;  1PMR A;  2E5L L;  1EL0 A;  3I56 A;  3PO3 G;  1RDP D;  4KI0 A;  3KF6 A;  4JI2 L;  1BDO A;  4A93 B;  5TSS A;  5DAU A;  3VR3 A;  1AE2 A;  4G7H C;  4OX9 Q;  1VQ8 A;  3GTM B;  1IKL A;  4Y52 H;  2VUM B;  2R93 G;  1PTO D;  1LTI D;  3TEH B;  4EQ5 A;  4MN3 A;  2C9O A;  3J81 L;  4B3T L;  4P73 A;  3ULJ A;  3T4A C;  2ZXO A;  2A73 B;  1IBL Q;  1C9O A;  1D5X C;  2F0H A;  5J1Z A;  3VYU A;  2D5D A;  1BBU A;  1F9S A;  1Y8N B;  5M3M B;  1NAP A;  4G7O C;  2QDL A;  1SMY D;  3L0O A;  4JI3 L;  3HOZ G;  3GV6 A;  4BBS B;  1UE5 A;  1LT5 D;  4BY7 H;  4X3K A;  4C1N I;  1I4Q A;  3T16 A;  1C7Y A;  2O4X A;  4LW1 A;  1J5E Q;  2FMC A;  5JJL A;  3VR4 A;  2BA1 A;  4PG3 A;  2Y0S E;  1PH1 A;  1SNP A;  2WB1 E;  4LF9 L;  2CVR A;  4A3K B;  1BNZ A;  1IHZ A;  4BA2 I;  1VQD A;  4ZUI A;  3I91 A;  5D14 A;  4JI0 Q;  2ZXP A;  4OXP A;  3KDF B;  3S17 B;  2HD3 A;  1QVF A;  4JBM A;  3HOU G;  4HJ5 A;  3P7J A;  4CGY B;  2PPB C;  3EBE A;  2I5H A;  4KK7 A;  2ZTE A;  3SK8 A;  1AN8 A;  1ZXT A;  4X66 Q;  2DGY A;  1YNJ C;  4N8F A;  4YCV A;  1H9K A;  2R6G A;  1UNS A;  2JXM B;  3NHH A;  2UUB L;  4JPB W;  1B4O A;  3S2D H;  1H9S B;  4MNO A;  1Q46 A;  2EY2 A;  2KCM A;  3FRP B;  3RN5 A;  2H4O A;  3DEP A;  2IJ0 A;  3GTK B;  2BOS A;  4A3B G;  5C5M A;  4DR7 Q;  2B2U A;  1LTR D;  1NMF A;  2NTT A;  3BG3 A;  2M9V A;  5IGE A;  1B2T A;  1X9N A;  1WCM H;  1YI2 A;  4DV2 Q;  3ULP A;  5HGQ A;  1DOM A;  3HKZ G;  2DY8 A;  3CC4 A;  2ZT9 C;  1K8A C;  4KHV A;  1D7Q A;  3H0G G;  1SLJ A;  2Z4I A;  4HMI A;  3URY A;  2XNA C;  3S14 B;  1DOL A;  1MBY A;  1SE4 A;  1PTO F;  3I4L A;  4CKE A;  4MZ9 A;  5KND A;  4ZUJ A;  4DAV A;  3WOF A;  2ZM6 Q;  2ENB A;  4DK3 C;  2LS0 1;  1Y8O B;  3E9H A;  3I8Z A;  4RHR A;  3I4M B;  1D8L A;  1I6V C;  3E0E A;  3PF5 A;  1AZP A;  4QIW B;  2D9U A;  5I2X A;  4P75 A;  5E3F A;  5FLX c;  1V43 A;  1PZI D;  1PXU A;  5I9O A;  4K0K L;  1HTP A;  1CK1 A;  3EFX D;  3J7A F;  1RKN A;  1HHV A;  4JV5 Q;  5C44 H;  4A3M H;  3S1N H;  1G2S A;  5JOB A;  4NPS A;  2F4V L;  5JPM C;  2R92 G;  3UDG A;  3PUX A;  3L7Z C;  3CP0 A;  4LFC L;  1JOQ A;  3PUW A;  1M90 C;  3FPP A;  2JA8 G;  2NVQ H;  5FLX L;  3J80 c;  4KJN A;  1U0L A;  2BE5 D;  2KQ3 A;  2XGT A;  2Z9H A;  3PV0 A;  2Q2T A;  3TBI B;  1K83 B;  4A3J B;  1NR2 A;  3PIP 3;  2RSO A;  4LUO A;  3KJO A;  1JB7 A;  4BY1 B;  2F0Q A;  4DR4 Q;  3W1B A;  2HHH L;  4LF8 L;  3K7U C;  5CBA E;  2PQE A;  1KQS A;  1ZYR D;  4YWL A;  3GTQ H;  2UUA Q;  1YNJ D;  1FGU A;  4IFD G;  1HUM A;  2AWO A;  4BBR G;  4C2M B;  4QUF A;  3RNU A;  5IP9 H;  4AYB E;  1F2Y A;  4IUQ A;  4IOA A;  3NXW A;  5EJW A;  3W2D A;  4JBJ A;  5IGD A;  2D62 A;  2RDG A;  5KYL A;  3QOJ A;  3GTK H;  2EYF A;  2VL6 A;  1IW7 C;  3I90 A;  2JA6 G;  1JOO A;  2PI2 E;  3DXJ C;  4LWC A;  1L1O A;  1HUN A;  3PO2 G;  3DWQ A;  5C3W A;  3K7A H;  1PH8 A;  3HOX B;  2JYO A;  3W3A A;  3NTH A;  1LAC A;  2R92 B;  2QEJ C;  1L0W A;  1MKH A;  4FXG C;  5DLQ E;  1FGB D;  1Y1W G;  5LMN L;  5E4W C;  4AH6 A;  2XWJ B;  5KEE A;  3IFT A;  1EFI D;  4HIO A;  1JCK B;  3UDI A;  1AW7 A;  5BN4 A;  2BDO A;  1L0Y B;  4EQO A;  1BCP D;  4QMG A;  2CWP A;  5IYD G;  2F0L A;  3NSW A;  3HKZ E;  2OT2 A;  1X65 A;  3D0F A;  2GVA A;  2RCF A;  1A6X A;  1X32 A;  3S1R B;  4JOI C;  3KJP A;  2YTX A;  1O7Z A;  2XN9 C;  1VQN A;  1PRT F;  3RUZ A;  4B9W A;  2OTJ A;  1RTN A;  5C3E G;  1HPC A;  2IHE A;  1XNR L;  4NMZ A;  2NBF A;  1Z6H A;  3EIV A;  3D4R A;  1CUK A;  2R7Z G;  3R8B A;  4C3I H;  5M5W B;  4JI6 Q;  4G4K A;  3S2H B;  4DU9 A;  1X3E A;  3BYY B;  5I4D A;  2UU9 Q;  4QCL A;  1NR4 A;  1XMQ Q;  1LO5 D;  4A3B B;  5C3E B;  4A3J H;  4ABN A;  2JA6 H;  2HUG A;  4A75 A;  2HQE A;  4APV A;  3UDX A;  5EQ0 A;  3KF8 B;  3RLO A;  1PYW D;  2F0G A;  1W3S A;  2Z0S A;  5E4X A;  4DR4 L;  4DV4 L;  2K5H A;  3D6C A;  3GP7 A;  3TDQ A;  4O2D A;  2VY3 A;  3UI2 A;  1D2B A;  4OHJ A;  2B8G A;  3CRK C;  3TP8 A;  2JQO A;  1O7L A;  1F2L A;  3M9B A;  2UXB Q;  1Y1V H;  1D6E C;  1A62 A;  2YU9 B;  1JQY D;  2LFN A;  3M7G A;  5T1G A;  3S14 H;  1NMG A;  3MFG A;  1JB3 A;  3TRZ A;  4DK6 C;  3CMA A;  1VS0 A;  2K50 A;  3VYS A;  5IP7 H;  1SEB D;  1LT6 D;  5CMD A;  1R9T B;  4QB4 A;  4WJW A;  4DNT B;  1YJW A;  1VQI A;  4GKK L;  3MA2 B;  1SYG A;  3HOZ B;  3K8A A;  1X6O A;  4EVO A;  4H7B A;  4J1M A;  2R3Z A;  1ICF B;  4X64 L;  4F88 A;  2EJF C;  4FO2 A;  1V9P A;  4JYA L;  2VNU D;  3R3O A;  2LY7 A;  1TKW B;  4B3S L;  4DR7 L;  4M1U B;  2NZO A;  2UU9 L;  4OO1 H;  1EOT A;  4DN4 M;  2IT1 A;  2C5C A;  3CW2 C;  3OIQ A;  5HGT A;  1NJI C;  2BH8 A;  3WOE A;  1YJ9 A;  1SFO B;  2ICI A;  2N3S A;  3G6E A;  2RQX A;  3I70 A;  5ELN A;  4OGQ C;  1VCI A;  3M3Y B;  4JW0 A;  3H0G B;  1JWU D;  3J7Y W;  1M4V A;  4IOC A;  3G71 A;  2MQH A;  5COY A;  1VQ5 A;  4UAI A;  2EQS A;  1WVL A;  1LTA D;  2VW9 A;  3C2P A;  1SRO A;  2JA8 B;  1BQQ T;  4HIM A;  5C4X B;  2N8N A;  1EEF D;  2XIW A;  1KDC A;  1WCM B;  2ZTC A;  1GHK A;  4DR1 L;  1PH9 A;  2E2J H;  4KKS A;  4LAA A;  1XMO Q;  1FVI A;  3HKS A;  4UHV A;  5L37 A;  1W6J A;  1XPO A;  2B39 A;  4P72 A;  4A3E H;  4RKL A;  1SMY C;  3K59 A;  4A3C H;  4KHZ A;  4NDX A;  3V2T A;  4K0K Q;  1JIC A;  4NW2 A;  4OO1 I;  2IHF A;  1IL2 A;  2F3W A;  3MEH A;  4K2L A;  2KCT A;  1II3 A;  3H91 A;  3MC0 B;  3TSS A;  1ENA A;  2EXD A;  4IUT A;  2B2U C;  4K5V A;  3MZ5 A;  1G6Z A;  2JSO A;  2RA4 A;  2CQO A;  2A68 D;  4PNY A;  3D31 A;  3NQI A;  4LF6 L;  2IWH A;  3QIA A;  1Y1W B;  4HIK A;  3K81 C;  4LUZ A;  5C4J B;  3RD4 A;  2QW7 A;  2JA5 B;  4IAL A;  1PH7 A;  1HA5 A;  1V1O A;  5AJ3 L;  3T1Y Q;  1LTS D;  1IXR A;  4JYA Q;  2K52 A;  2WAQ E;  3NTK A;  1QCB D;  2JA9 A;  1I5F A;  5CV7 A;  1XMO L;  1NSN S;  5A2Q E;  1U4L A;  3NTI A;  4YCW A;  3E5S A;  4DR3 L;  1B1Z A;  2Y0S G;  3GTL H;  3KLS X;  1F2M A;  1TII D;  3CCJ A;  5LMU Q;  2F3V A;  1SYE A;  4X65 L;  3I4M H;  5IT9 L;  1X56 A;  4P2C B;  4WOR A;  3NBH B;  1D1I A;  3H3V H;  1A3U A;  2NVX H;  1AP0 A;  1G6P A;  1H95 A;  5ELB A;  2R92 H;  1V8Q A;  3QG1 A;  2F52 A;  3ULL A;  1B50 A;  1GUW A;  2F4V Q;  4A3G G;  2Z6K A;  2X6G A;  1HTL D;  2K5N A;  4XIG S;  2PCF B;  1S40 A;  1AFP A;  1B53 A;  1CSP A;  1CKN B;  1A2T A;  2N78 A;  5JJI A;  1YJN A;  2CQA A;  2K7V A;  3K6O A;  3U50 C;  4ILW A;  3H3V C;  1SRU A;  4AQY L;  3OTO Q;  3OW2 A;  5EPL A;  3A0J A;  3HGB A;  1QVG A;  1EOV A;  3I7F A;  4IFD H;  1L0X B;  2PI2 A;  3HOZ H;  5M3M H;  2AHO B;  4U68 A;  3TQY A;  2OF1 A;  1D5M C;  5CV5 A;  1Q86 C;  2B29 A;  5CV6 A;  1ET9 A;  1ML0 D;  2SOB A;  3TP7 A;  1STB A;  3PMF A;  2SNM A;  4UPA A;  4H0L C;  3M85 A;  1V1P B;  3DHQ A;  1BO0 A;  5IWA L;  3FEW X;  3BU2 A;  2Q2U A;  1HR0 W;  4WFN 3;  4JI0 L;  2A5H A;  5M3F G;  4A3B H;  5H1S E;  3HEJ A;  2K04 A;  3S16 B;  5BN3 A;  1VQJ A;  3SHL A;  3S1Q B;  3T1H L;  1Y1W H;  3KFU A;  1CT1 D;  5JJZ A;  2EPB A;  1X54 A;  1Y1V G;  1CKO A;  3OYY A;  1EZ8 A;  1PH5 A;  2YTY A;  1F9Q A;  1YNN C;  1JE4 A;  3NQT A;  1EYC A;  2N88 A;  5DEH A;  2F0V A;  2KCC A;  1IYU A;  3K57 A;  4ZAI A;  1I3Q B;  5FK9 C;  5KYI A;  4NB3 A;  1HNW L;  3NBH A;  1GKH A;  4R4O A;  4DPG A;  4FF2 A;  4DV1 Q;  5FLM H;  2K33 A;  1R4Q B;  3D4W A;  1GUO A;  4DNR B;  3IFD A;  1G29 1;  2WAQ G;  1I3Q H;  1HQM C;  5JJK A;  2FFK B;  3K5O A;  3CHB D;  3MAQ A;  1JJC B;  2CW0 D;  5M5X B;  4CKC A;  4A3E G;  2I5M X;  1MJE A;  3HP3 A;  4FYD A;  5I9P A;  5KIX A;  4YHH Q;  2B3G A;  4ZK9 B;  1GUN A;  3OHX C;  1Q8K A;  1SJH D;  2F0I A;  4KV6 A;  4QF4 A;  3HOX G;  1VQ7 A;  5C4X G;  3AYH B;  3CU7 A;  4O42 A;  4UY8 C;  1AE3 A;  3Q0A A;  1LT3 D;  2NN6 I;  4JBW A;  4POF A;  4ALP A;  1C48 A;  3DLL A;  1J9O A;  2K5Q A;  1KTK A;  1DM0 B;  4DUZ L;  4JI4 L;  2H1E A;  5CC4 A;  4BY7 G;  2JA7 G;  3M3Y H;  2L55 A;  3CQZ H;  4E6I A;  5JEA J;  4DFA A;  1EU3 A;  2BH2 A;  4FF3 A;  5CV9 A;  3GO5 A;  1JWM D;  4GNX B;  3K5L A;  3GD7 A;  2VQF Q;  4KY5 A;  1QZG A;  4A3I B;  1MGS A;  2ZXR A;  2L4N A;  2UUC L;  4QUC A;  3M4O B;  1YZ6 A;  3GTJ H;  1N34 L;  2A6E D;  2EJM A;  2NUC A;  3V05 A;  1MD2 D;  4K6D A;  2EZV A;  1F9R A;  3HG9 A;  3PO3 H;  2YU9 H;  1VQC A;  1Q1B A;  3I2Z A;  5FLM G;  2QEX A;  1NY4 A;  1IYV A;  3KLR A;  1SNO A;  4JCV E;  3CKI B;  1CA5 A;  1JE5 A;  2F0T A;  3J81 j;  1MHW C;  3BZD B;  1QIL A;  1BUV T;  1K0R A;  1TWH H;  4LNQ A;  5EKK A;  2EOT A;  4DR1 Q;  3SK5 A;  2CH4 W;  2UXC Q;  1EY6 A;  4OL7 A;  3AFP A;  1LTL A;  1F77 A;  1N9W A;  2F0W A;  3KDF A;  1QG7 A;  4TRD A;  2MO0 A;  4FVM A;  5K5P A;  2Q2I A;  2LXJ A;  1TQO A;  3QJY A;  1YHQ A;  2KEC A;  4LJZ C;  4IUU A;  1S5B D;  4JVZ A;  5BR8 Q;  2IL8 A;  1TWC B;  2KHS A;  1JOR A;  3K7A B;  4TSS A;  1JJ2 A;  2VUM G;  4X3S A;  2MGS A;  3ER0 A;  4B3T Q;  1CHQ D;  1HNZ L;  4JI6 L;  2WKC A;  4A3F G;  5IT9 E;  4LF5 Q;  3CCE A;  4LFB L;  2R7Z H;  2L12 A;  1Y14 B;  2B63 G;  2JP1 A;  3LWU A;  3HOY B;  1PFS A;  4DAY B;  4IN3 A;  3VYR A;  5DM7 3;  4DV2 L;  2ASB A;  3A5Z B;  3FDT A;  1SNQ A;  2JA5 H;  2JA7 H;  3VR5 A;  3JAM c;  5CGK A;  3NWS A;  3DEO A;  2RCN A;  1XMQ L;  3J80 i;  4KY6 A;  5M5Y H;  4JI7 L;  4G57 A;  1L1O B;  2JJQ A;  4A3D B;  4X3U A;  4ZLT F;  5IGB A;  1EY7 A;  2QCP X;  1VQM A;  1VMC A;  3I55 A;  4DK1 A;  2K01 A;  2NN6 H;  4OWW B;  2WII B;  4EQP A;  1S5C D;  2NWG A;  5JVG 3;  4B3R Q;  4CKB A;  4A3M G;  5M3F H;  4HSV A;  2A1A A;  3I4O A;  3VR2 A;  2LKV A;  4Q5V A;  1TS4 A;  1SYC A;  2JN4 A;  4YCU A;  3F8T A;  2ATW A;  1OXU A;  2HDM A;  3DMU A;  4KKT A;  1GUT A;  4RKB A;  2L1B A;  2QF7 A;  1Z47 A;  3EA6 A;  2R7F A;  4PZ6 A;  3CD6 A;  2UUB Q;  3U9O A;  1QNK A;  3K80 C;  1TR5 A;  4C2M H;  1BKB A;  4LFB Q;  1STA A;  1N36 Q;  1BOS A;  1OO9 B;  4AYB B;  3CCV A;  5LMN W;  4HSP A;  1EY4 A;  3M7N A;  4IFD I;  5A35 A;  5J3B A;  1EIH A;  5FJ8 H;  2N49 A;  2QDB A;  2E75 C;  2MFI A;  5ELD A;  3QB3 A;  2FIN B;  3J80 L;  5BR8 L;  1Y69 U;  3U4Z A;  4X62 Q;  1GM5 A;  2K14 A;  1IKM A;  5ISR A;  1DXM A;  2K05 A;  3KF6 B;  4YY3 Q;  4V0B A;  1KD1 C;  4A3K H;  5DNF A;  4BBS G;  2K03 A;  2F0F A;  2F03 A;  2E74 C;  3ZYY X;  1WTX A;  4DXF A;  3PIO A;  3LGJ A;  2PNR C;  1J6Q A;  1IBM L;  2IY5 B;  2GN5 A;  4ZKB B;  3TZU A;  4BA1 I;  5C44 B;  1LM0 A;  4K6L A;  2E8G A;  1CQV A;  2DY7 A;  4QY7 A;  1F2Z A;  1I4R A;  1ENF A;  1X3Q A;  3KF8 A;  4J6H A;  4HJ8 A;  3GTM H;  1T9H A;  2JA8 H;  2CFM A;  3S1M H;  1GJX A;  4XDX A;  2UXD L;  2PZT A;  2OTL A;  1HA6 A;  3EJI A;  4CDF C;  3PUV A;  3FVQ A;  3PIO 3;  2IX0 A;  3RN2 A;  3TS2 A;  4GN4 B;  1HRJ A;  3PO3 B;  1BCP C;  1T5X D;  1TT2 A;  3HOU H;  4IFD J;  1H9J A;  1PH6 A;  2A68 C;  3A54 A;  1GO3 E;  3CCR A;  1EIY B;  1E24 A;  1O7Y A;  4A3L G;  4GLV B;  3DUZ A;  4ZCK A;  2XWB B;  1VQF A;  1VQA A;  2ALY B;  4UP7 A;  4HJ7 A;  2IPK D;  3CAM A;  3PQI A;  2K6A A;  4FF1 A;  4Z9C B;  1IL8 A;  2F1M A;  5EBC A;  2Z6B A;  1L1O C;  4A3C G;  4K8I A;  2I46 A;  2E2I B;  5IYC G;  3JAM E;  4DUZ Q;  3S17 H;  5JAV A;  1S3O A;  4HJA A;  4A3M B;  5GAE C;  1VQE A;  1AZQ A;  1YNN D;  3K58 A;  5IYB H;  1E3P A;  5EPK A;  1I4P A;  1STE A;  2F0M A;  2F0P A;  1PZJ D;  1VQL A;  1ESR A;  4A3D G;  3EVQ A;  5LMU L;  3KK7 A;  5JEA H;  3K0X A;  4F8M A;  3D4D A;  5CR3 A;  1E1O A;  4EQN A;  4IO9 A;  3JAM L;  1PTO C;  1D1K A;  1UEB A;  2ES2 A;  1A63 A;  3GTO B;  4PMB A;  2L15 A;  3W1G A;  3GTL B;  1TS3 A;  4N8X 1;  2V4D A;  1A3V A;  1VMP A;  1U4M A;  3MWY W;  4C3I B;  1SR3 A;  3UE0 A;  3HOV G;  3LWE A;  1VQ9 A;  1GOZ A;  1U4P A;  4RGM A;  5CYU A;  2I5L X;  2HIX A;  3F2C A;  2KUM A;  4YWK A;  4C3J B;  1KNA A;  4LMQ D;  3RZO B;  2IX1 A;  5IE8 A;  1FNV A;  1XJV A;  3GTP B;  1G51 A;  1IBL L;  1VQK A;  1XPR A;  1PV4 A;  4GZY C;  2EYL A;  4R4I A;  3W5O A;  5C4J H;  1CSQ A;  3E6Z X;  5IYC H;  3J80 E;  4LF4 Q;  1IBM Q;  4IZ8 A;  4L8J A;  3R2I A;  4GN3 B;  4OEM B;  1TVX A;  3S9W A;  1Z9F A;  5JPN C;  1I94 L;  4RH6 A;  2JEB I;  4X64 Q;  4BXX G;  1WD1 A;  5IYB G;  1HZ9 A;  3SDZ A;  1WFQ A;  1N32 L;  3HOV B;  4XYO A;  3OMG A;  3AMU A;  3A74 A;  5JEA G;  1DOK A;  1BF4 A;  2EYM A;  1WTO A;  4A93 H;  1LTG D;  2RF4 A;  2AMC B;  3SGI A;  1PRT D;  4R8I A;  1VQH A;  2K75 A;  4IPC A;  5IT9 c;  3MFY A;  1NTG A;  5KNC A;  3Q6S A;  1R9T H;  4U67 3;  1X55 A;  1S5E D;  1ENC A;  1KLU D;  1HZB A;  1UWV A;  2NVX B;  2NZ1 D;  4I65 A;  3U58 A;  4RFB A;  2E2I H;  1K83 H;  3HOV H;  5C44 G;  3K5M A;  1NBW A;  2EYP A;  2ZTD A;  4L5S A;  4LF5 L;  2Q2H A;  4AQY Q;  2JA7 B;  2UXC L;  1TWF H;  5ELF A;  4BY7 B;  2F0J A;  4ODG A;  1CZG A;  1YNX A;  4JK1 C;  3H09 A;  2I07 B;  2H5X A;  3S2H H;  2F0O A;  4JI8 L;  3M4O H;  1NCV A;  1YVC A;  4JI1 Q;  1Q8I A;  3AU7 A;  4CDD C;  3C3L A;  1I4G A;  2PZW A;  3NE5 B;  1H9M A;  1TS5 A;  3NP8 A;  4RG1 A;  1FJG Q;  3N52 A;  5EGT A;  4H13 C;  3VA5 A;  4L6T B;  3A7A B;  4C3H B;  4FNF A;  4OO1 G;  1PH4 A;  2F0N A;  3CF5 A;  4A3G B;  1EYD A;  1STY A;  3STB C;  3FKI B;  1Q81 C;  4DR6 L;  2WAQ B;  4UDU C;  2B2Y C;  2HCI A;  2LSS A;  3N6R A;  3TP5 A;  1BCP F;  2SDF A;  4KHP L;  2XSC A;  1A8V A;  5BN5 A;  2M00 A;  5GAD C;  1PVO A;  3HOW G;  4B08 A;  5IGC A;  4FDB A;  5C3E H;  2XTI A;  1T5E A;  4MHE A;  5C0X I;  2L9H A;  4RGT A;  4CBV A;  2EYO A;  4DA2 A;  4A3F H;  3MTS A;  1STG A;  4DV3 Q;  4DV6 L;  2EYJ A;  3KOJ A;  4HMJ A;  3PUZ A;  3FKI H;  3ND8 A;  4EGV A;  1MIU A;  2RSN A;  3I73 A;  5KNB A;  2B2T A;  4R4C A;  5C5L A;  2PW5 A;  3T1H Q;  1EZ6 A;  2Z8L A;  3OWF A;  4XQQ A;  1XNR Q;  4L5T A;  2WFW A;  4N9T A;  1EYG A;  4GOP C;  3GTG H;  2WKD A;  4QIW E;  4LK1 C;  2EVB A;  2X69 A;  4LFA Q;  3SE0 A;  4DV7 L;  3CC2 A;  3DWP A;  3VA7 A;  2NVT H;  3PUY A;  5E1F A;  4GS3 A;  4AYB G;  4A3I H;  3Q24 A;  2QA4 A;  4HAE A;  1QUQ B;  1UUP A;  2HHH Q;  2OWO A;  5E7N A;  3J81 i;  3ITP A;  1S5F D;  5G3L F;  2LXK A;  2WV6 D;  4JI1 L;  5ELC A;  1J5E L;  1B9M A;  5NUC A;  3X3M A;  3I4N B;  4DV7 Q;  4LFA L;  1GHJ A;  1X3P A;  3GTP H;  4CDE C;  2MPM A;  4BS9 A;  3GTG B;  5AJ3 Q;  3T1Y L;  1FL0 A;  1EWC A;  4JI3 Q;  3HOW H;  2VXW A;  2BE5 C;  3BDC A;  1STH A;  3K5N A;  4RGO S;  3OW7 A;  3D6W A;  2NTS A;  3IL8 A;  4B3M Q;  3L3O C;  3AEV A;  3S1M B;  5HY6 A;  4PQX A;  5LL6 S;  1DYQ A;  4RCN A;  4YIJ A;  1TWG H;  4O0A A;  2ZJR A;  1O7I A;  1DD2 A;  2OEO A;  5T1I A;  1VQP A;  1GVP A;  2AQ3 B;  1C8C A;  1SSO A;  2D2C C;  2CH4 A;  3EN2 A;  2E2H H;  1TXY A;  1JJG A;  4WJ4 A;  3SK6 A;  5LHY 1;  5I6Y A;  1Q3L A;  5I6W A;  3BYT B;  1B7Y B;  4B3S Q;  4NXN L;  1H9S A;  4DAP A;  2B2T C;  1YHA A;  3H3V I;  3STB D;  3ICE A;  1RCV D;  2KEN A;  1BBX C;  4GKK Q;  2ZM6 L;  1SJE D;  4IQZ A;  4N9P A;  2EY6 A;  1EWH A;  3A7L A;  1DZ1 A;  4X66 L;  3GTJ B;  5J22 A;  4BBR B;  3RZD B;  3A56 A;  4RA8 A;  4QJF A;  2F4I A;  4ME5 A;  1XYI A;  4DV0 L;  1XTC D;  2Y0S B;  2PQA B;  3G4S A;  4HJ9 A;  1LUZ A;  2JEA I;  3HOY H;  3KLW A;  4S3S A;  1ASY A;  2K5V A;  4QQB X;  3BVM A;  1B70 B;  5IWA Q;  1E0B A;  1WI5 A;  2EY5 A;  1KLG D;  1G8Z D;  2KVM A;  4F7X A;  2F0K A;  5FO7 B;  1X3F A;  1QOH A;  2B2Y A;  2Q8T A;  3RLF A;  1WTQ A;  1OTC A;  1U5K A;  1A0I A;  1CM9 A;  1FNU A;  1HQR D;  1SN8 A;  4DV4 Q;  3O13 A;  4WRD A;  1U9R A;  2IW3 A;  4JBK A;  2JA5 G;  3T51 B;  1EU4 A;  5KRU A;  1XX8 A;  2Z4H A;  3IAY A;  4XTC S;  2PYK A;  1TWA B;  2NVY H;  2A6H D;  1YHB A;  2PMZ E;  1W2B A;  1PFB A;  4R4T A;  1HNX L;  2WAC A;  3R2T A;  1AH9 A;  4CDC C;  2I0Q A;  2VUM H;  2DNC A;  4MIU A;  3QO2 A;  2AUK A;  4OX9 L;  5FO8 B;  2K5D A;  2R93 H;  2YYZ A;  2OQK A;  2F0U A;  4C3H G;  1E1T A;  3Q8D A;  4PMC A;  1SE3 A;  4CJ2 C;  1XWE A;  4OWX B;  1N8R C;  3S16 H;  1WD0 A;  3S1Q H;  3GV3 A;  4KD3 A;  4DV5 Q;  4RHS A;  4FXK C;  4DF7 A;  4DAM A;  2J4X A;  3TRE A;  2AWN A;  1KDB A;  3OOC A;  4GLX A;  1PYB A;  4X62 L;  4HID A;  1EQR A;  5AFW A;  4R4Q A;  1PTO B;  1V1Q A;  1ASZ A;  1VQG A;  1K8G A;  4DR3 Q;  1IW7 D;  1YEZ A;  1ILQ A;  4FP5 D;  4DV0 Q;  3QR8 A;  4YY3 L;  3SXH A;  4CHT B;  4L5R C;  2VQE L;  2BDN A;  1ET6 A;  1LTT D;  1K8M A;  1HJP A;  2DNE A;  4KY7 A;  3SEB A;  4TKO B;  2WP8 J;  1XXG A;  3NEM A;  4ZYS A;  2PQA A;  4ZQ3 A;  4CJ0 B;  2A6E C;  2R61 A;  2CHB D;  3T56 B;  5A2Q L;  3U4V A;  3I4N H;  4IUN A;  4PMW A;  3CCS A;  3H94 A;  2KJX A;  2RVL A;  2VS1 A;  3NPP A;  4X65 Q;  4NXM Q;  1DON A;  4DXG A;  5IP9 G;  2L0C A;  2G5D A;  3TS0 A;  4C3H H;  3ND9 A;  4JOI A;  3TME A;  1RF2 D;  5F2D A;  4MTN A;  1BCP B;  2NVT B;  3A8K E;  5GAH C;  1AEX A;  1QNU A;  1K3B C;  1BBW A;  3H6M A;  3X3N A;  1Q7Y C;  1STN A;  3PCO B;  4A3K G;  1MI2 A;  1TY2 A;  5GRO A;  2A69 D;  1SNC A;  2EXZ A;  4F87 A;  3V96 A;  3Q22 A;  1S4Z A;  5HUR A;  2GA4 B;  2Z1C A;  4MTK A;  5D3I B;  4BBS H;  1WYD A;  4HCS A;  4H02 A;  4OIJ A;  1GD7 A;  3IKJ A;  4BY1 H;  1WOC A;  4NP5 A;  3ERQ A;  3A5U A;  1HXY D;  3MXN B;  2C35 B;  3AB9 A;  3PSI A;  5M5Y B;  3LX0 A;  1TWH B;  3OPO A;  2KEE A;  1CA6 A;  2J7Z A;  4FF4 A;  2R93 B;  1I50 H;  1FYC A;  1EYA A;  4JI4 Q;  1FD7 D;  1RHP A;  1M1K C;  3UE1 A;  5IOD A;  2TMP A;  1QWY A;  3FPU B;  3RLN A;  2VQE Q;  3KBX A;  2F0S A;  1FR3 A;  4DV5 L;  1S72 A;  4ID6 A;  1KDA A;  3L2P A;  1KAA A;  1LYL A;  3TZD A;  2A19 A;  2NN6 G;  3M4Q A;  4JV5 L;  4GKJ Q;  5IY0 A;  2O5I C;  3S1R H;  4PZ8 A;  1LT4 D;  1N33 L;  4ZRZ A;  2E2J B;  4DUY Q;  2PZU A;  5IP7 G;  2B63 H;  4LF7 L;  1PFN A;  1E2W A;  2EE1 A;  1E22 A;  4LFC Q;  1EQV A;  4IJH A;  4KMU C;  1P8L A;  4OWT B;  2NVY B;  1PH3 A;  2O2L D;  1DJR D;  1PYS B;  1K73 C;  4XT1 B;  5D3D A;  4JI7 Q;  3J7Z C;  3KBG A;  2QKI C;  1OXS C;  3ERO A;  4LF4 L;  2EIF A;  1GUG A;  3GQB A;  5EKI A;  2A8V A;  3VDY A;  4PV1 C;  3F2D A;  2G9H D;  1IBK Q;  1KAB A;  4OON A;  2E2H B;  1VF5 C;  3B6Y A;  4GN5 A;  3J81 E;  1A2U A;  3PF4 A;  4KJO A;  3J7A 5;  3HRZ C;  4J15 A;  4IPG A;  2PMZ B;  3NWT A;  2MHV A;  1KAW A;  2DUD A;  3R93 A;  2E5L Q;  1M8A A;  2QGQ A;  1VQO A;  1LTB D;  1HR0 Q;  3HS0 C;  4A3I G;  1PTO H;  3J81 c;  4GOP B;  1H9R A;  4POG A;  1TY0 A;  4RCO A;  1K3R A;  4K2K A;  1ICW A;  2AQ2 B;  3D3R A;  1O78 A;  4XYQ A;  1K28 A;  1TS2 A;  3MXN A;  5M5X H;  1I94 Q;  1FNW A;  1RIP A;  3KUP A;  2CCZ A;  1ZEQ X;  2B2W C;  1SE2 A;  4H44 C;  1G2T A;  1QB5 D;  4YWM A;  4HN7 A;  4JI5 Q;  1EIG A;  1SYF A;  2MNA A;  3S15 B;  1N36 L;  1KHI A;  5DM6 3;  2CW0 C;  2EJG C;  1EIF A;  3CCQ A;  1EWI A;  3S24 A;  4BBR H;  3PO2 H;  1ZYR C;  1YIJ A;  2ZJP A;  2B2W A;  2WIN B;  2KHJ A;  4PZ7 A;  5G3L D;  5JVH 3;  1VDZ A;  5GAG C;  4XQN A;  3TP6 A;  5FO9 B;  1HFG A;  3G6J B;  2Q8I B;  4K5W A;  4KN4 C;  2YV5 A;  4QL5 A;  3PGZ A;  5M5W H;  2XVS A;  3GTQ B;  3S15 H;  4HTH A;  1NUC A;  5ELE A;  4A4I A;  4RGN A;  5LL6 X;  1RL2 A;  1O80 A;  4DR5 Q;  2A69 C;  1HR0 L;  3CC7 A;  3NEL A;  4R9W A;  1WCM G;  4HR7 B;  1CFM A;  1IZ6 A;  2KHI A;  3MXU A;  3HFZ B;  3ERS X;  2K4K A;  1LAB A;  2KBN A;  1YIT A;  3BJU A;  2CKZ B;  1NE3 A;  2JA6 B;  2PO4 A;  1HCZ A;  2ZJQ A;  4IJL A;  1PFM A;  3D8G A;  4RAU C;  2UXD Q;  1WTH A;  2KOL A;  2D0O A;  2B2V A;  2D0P A;  2HIV A;  2LMC B;  1ZKO A;  2P5Z X;  2SNS A;  3FP9 A;  2PW7 A;  3E9I A;  2RDF A;  1CTM A;  1HNX Q;  4ULL A;  1I4H A;  2AUJ D;  3ONA B;  5M9O A;  3I4M G;  3AFQ A;  1PZK D;  4UP9 A;  4C3I G;  4EX5 A;  1Q12 A;  1EY5 A;  1I4X A;  2L5T A;  4C3J H;  3S2D B;  1RD9 D;  3MHB A;  4UP8 A;  5C4Z A;  1SDF A;  4G7Z C;  3E3X A;  2DJG C;  3H0G H;  2RBM A;  4GOP A;  2HT1 A;  3ZJY C;  2OQ0 A;  3IRB A;  4A3G H;  2UXB L;  4Y7N H;  3AQQ A;  1U4R A;  3C1F A;  4Q0F A;  1N34 Q;  3JAM i;  2J0T D;  2Q8R E;  4DAY A;  2BCO A;  4K14 A;  2CWA A;  1YBY A;  2R7Z B;  3JC6 6;  3CQZ B;  4DR6 Q;  3GTO H;  1HFN A;  4XT3 B;  1K0S A;  4HED A;  1C4Q A;  3HOW B;  4K5X A;  1ILP A;  1B8A A;  3M4P A;  4A3D H;  1SE8 A;  5FOB B;  3WDN A;  4J8Q A;  3K0Y A;  1F9P A;  4L5Q A;  5IGF A;  1D5Z C;  2XRS D;  3CPF A;  3FKI G;  1JC7 A;  2F3I A;  3CCM A;  4ME3 A;  2VB2 X;  4JI2 Q;  4DNI A;  1SFO H;  2NYZ D;  2A74 C;  1CKN A;  1XPU A;  2K1B A;  5C0X H;  3HOU B;  5FJ8 G;  2UUA L;  1VQ6 A;  3NEN A;  4X6A H;  2XRQ D;  4LF9 Q;  2O5J C;  3G48 A;  4DV1 L;  1SAP A;  4GLA C;  4NXM L;  3BDO A;  1MSG A;  1MSH A;  4DGZ A;  5IOC A;  3OWE B;  1N32 Q;  3SK4 A;  4JI5 L;  3P20 A;  1B44 D;  1CKM A;  4DR2 Q;  1N33 Q;  4P71 A;  3NBI A;  3HZX A;  2BA0 A;  1DGS A;  1LV9 A;  4B3M L;  2AKW B;  2K5W A;  4C3J G;  5LMN Q;  2Z6K C;  1W6K A;  5FLX E;  2MO1 A;  3MXP A;  5J39 A;  4BXX H;  1KXL A;  2JE6 I;  1QUQ A;  1TWC H;  1QVC A;  3LNN A;  2HCC A;  1VF7 A;  4TQU S;  2B63 B;  2RHQ B;  3CRL C;  2R7D A;  3HOY G;  1UEA B;  2NB0 A;  3SVM A;  3P75 A;  1CI3 M;  4LF8 Q;  2MJ8 A;  1DCZ A;  4A3E B;  1WTP A;  3EQL C;  1VQ4 A;  3GDE A;  1E2Z A;  2FXQ A;  5I2Y A;  1KRS A;  1OXT A;  1RTO A;  1JR0 D;  1B3A A;  4XXE A;  1E2V A;  1HNW Q;  2PNH A;  4KKU A;  5EBD A;  2L11 A;  4DV3 L;  4DV6 Q;  1S5D D;  5C4H A;  3H15 A;  2HQL A;  1EY9 A;  1FJG L;  1I6H H;  5IYD H;  4C56 C;  1WTV A;  2KA7 A;  1BVS A;  3PO2 B;  4OEL B;  4WJ3 M;  3MVV A;  4FXD A;  5C0X J;  3E0J A;  4LF7 Q;  4KD4 A;  1X3G A;  1UE7 A;  1E7Z A;  5ELO A;  3A55 A;  1SYD A;  5C0X G;  3DWA A;  1P16 A;  3CME A;  1Q90 A;  1ROD A;  3L9A X;  1TWF B;  3A8J E;  4NKL A;  4JI8 Q;  3BZC A;  1EUJ A;  4QGU A;  1J8I A;  3VR6 A;  1PRT B;  5FKA C;  1EFW A;  4R1J A;  1HNZ Q;  4R8N A;  2FJ2 A;  2OCE A;  1BR9 A;  1QZH A;  2HDL A;  2RDH A;  5IIF A;  1Y1V B;  2DN8 A;  3BDL A;  3U9S A;  4A3L H;  3KYH C;  3KLS A;  3BS1 A;  1R4P B;  3FHW A;  1VQB A;  1TWA H;  1QE6 A;  1LLR D;  4M8A A;  4A3J G;  4O1N A;  2MP1 A;  4BWG B;  2K28 A;  4RWS C;  3HKZ B;  2DJF C;  2QIL A;  2F0E A;  4YHH L;  4XQJ A;  3SR1 A;  2X6L A;  1KL9 A;  1EY0 A;  3NK9 A;  2B8F A;  1EEI D;  4RMF A;  4GNX A;  2B2V C;  4IPD A;  1KIX A;  1OXV A;  1Q1E A;  3I3C A;  2N55 A;  1GUS A;  2TSS A;  3FMC A;  3M4Y A;  2AQ1 B;  1CZW A;  3CCU A;  2EY1 A;  1PH2 A;  1ESF A;  4P74 A;  2SEB D;  3I72 A;  3QWN A;  3QOL A;  4IPH A;  1EY8 A;  3A8I E;  4JC0 A;  4Y7N B;  1EQT A;  4DK0 A;  1JMC A;  1JT8 A;  5EPJ A;  2M2L A;  1PA6 A;  4NXN Q;  3MXG A;  1UE1 A;  2KED A;  2G9D A;  3OMC A;  3G7L A;  3OTO L;  3RZO H;  4V19 0;  5KGU A;  3MEF A;  3CXC A;  4K8J A;  2A6H C;  1GXD C;  2V1C C;  2YTV A;  1PHJ A;  2E76 C;  1XNQ L;  3F1Z A;  1A3T A;  3S1N B;  1WTR A;  1Y8P B;  1L2F A;  5CBE E;  1B9N A;  4ZKC B;  1V1P A;  2NVQ B;  1EQQ A;  1A15 A;  4DR5 L;  3J7A V;  1BXT A;  1SMX A;  4CJ1 B;  1PLF A;  1C0A A;  1I6H B;  4X3T A;  3C46 A;  1I50 B;  1SND A;  3P1H A;  4OIK A;  3PIP A;  1RJT A;  1SBB B;  5CV8 A;  3C1E A;  4TVA B;  1OXX K;  4AIM A;  4B3R L;  2WB1 G;  3I4N G;  3BZK A;  4KTA A;  3BVZ A;  1KC8 C;  1CHP D;  5M3M G;  5EKL A;  4A76 A;  1XTD A;  2WB1 B;  3DM3 A;  3DM1 A;  2RHS B;  1TU2 B;  5GQO A;  1UAP A;  1IYJ B;  3VYT A;  1KNE A;  3RR5 A;  3CCL A;  4JG2 A;  1PRT C;  1TWG B;  2VB3 X;  4HCE A;  1HH2 P;  4KLK A;  1K8O A;  1HZC A;  2ICE C;  5K36 H;  1JWS D;  1K9M C;  3UDF A;  1B3Q A;  3OIP A;  4A93 G;  4BY1 G;  1Z7T A;  4DUY L;  4IUP A;  5M3F B;  3CPW A;  2F0D A;  1QJO A;  4A3F B;  1XNQ Q;  4GKJ L;  2NZH A;  5COR A;  4I7Z C;  3BVG A;  2E2D C;  5C6A A;  2FMM A;  1SNM A;  4KN7 C;  4GNX C;  5EAY A;  4C1N K;  4LF6 Q;  3F2B A;  1JOK A;  1WTW A;  2FHT A;  2EDG A;  5C4X H;  3HOX H;  5CV4 A;  4IUV A;  2K32 A;  4I7A A;  4DR2 L;  3RZD H;  1UE6 A;  3Q23 A;  3RMH A;  2EYH A; 
#chains in the Genus database with same CATH homology
 5K36 G;  2IX3 A;  3NUC A;  5IGG A;  3T13 A;  3TN2 A;  3OSO A;  4B9X A;  1G91 A;  2ID0 A;  1CQF A;  4IUR A;  2MUY A;  4L63 B;  5D65 A;  2OXP A;  2KCN A;  2RKS A;  3F2U A;  1ONL A;  1PDQ A;  5C3X A;  1SXT A;  3T53 B;  1SYB A;  1PMR A;  1EL0 A;  1RDP D;  4KI0 A;  1BDO A;  4A93 B;  5TSS A;  5DAU A;  3VR3 A;  4G7H C;  3GTM B;  1IKL A;  2VUM B;  1PTO D;  1LTI D;  4MN3 A;  2C9O A;  3J81 L;  3T4A C;  2ZXO A;  2A73 B;  1D5X C;  2F0H A;  5J1Z A;  3VYU A;  2D5D A;  1F9S A;  1Y8N B;  5M3M B;  1NAP A;  4G7O C;  1SMY D;  3GV6 A;  4BBS B;  1LT5 D;  4X3K A;  4C1N I;  1I4Q A;  3T16 A;  2O4X A;  2FMC A;  3VR4 A;  2BA1 A;  1SNP A;  2CVR A;  4A3K B;  1BNZ A;  1IHZ A;  4BA2 I;  4ZUI A;  3I91 A;  5D14 A;  2ZXP A;  3S17 B;  2PPB C;  3P7J A;  4CGY B;  4KK7 A;  3SK8 A;  1AN8 A;  1ZXT A;  1YNJ C;  1H9K A;  2R6G A;  1UNS A;  2JXM B;  3NHH A;  1B4O A;  1H9S B;  2EY2 A;  3FRP B;  2H4O A;  3DEP A;  2IJ0 A;  3GTK B;  2BOS A;  5C5M A;  2B2U A;  1LTR D;  2NTT A;  3BG3 A;  2M9V A;  5IGE A;  1B2T A;  1DOM A;  2DY8 A;  2ZT9 C;  4KHV A;  2Z4I A;  4HMI A;  3URY A;  2XNA C;  3S14 B;  1DOL A;  1MBY A;  1SE4 A;  1PTO F;  3I4L A;  4CKE A;  5KND A;  4ZUJ A;  4DAV A;  3WOF A;  2ENB A;  2LS0 1;  1Y8O B;  3I8Z A;  4RHR A;  3I4M B;  1I6V C;  1AZP A;  4QIW B;  2D9U A;  5I2X A;  5E3F A;  1V43 A;  1PZI D;  1PXU A;  5I9O A;  1HTP A;  1CK1 A;  3EFX D;  3J7A F;  1RKN A;  1HHV A;  1G2S A;  5JOB A;  5JPM C;  3PUX A;  3L7Z C;  1JOQ A;  3PUW A;  3FPP A;  5FLX L;  4KJN A;  2BE5 D;  2KQ3 A;  3PV0 A;  3TBI B;  1K83 B;  4A3J B;  1NR2 A;  3PIP 3;  2RSO A;  4BY1 B;  2F0Q A;  5CBA E;  2PQE A;  1ZYR D;  1YNJ D;  4IFD G;  1HUM A;  2AWO A;  4C2M B;  4QUF A;  1F2Y A;  4IUQ A;  3NXW A;  5EJW A;  3W2D A;  5IGD A;  2D62 A;  2RDG A;  5KYL A;  3QOJ A;  2EYF A;  1IW7 C;  3I90 A;  1JOO A;  3DXJ C;  1HUN A;  3DWQ A;  5C3W A;  3HOX B;  2JYO A;  3W3A A;  3NTH A;  1LAC A;  2R92 B;  2QEJ C;  4FXG C;  1FGB D;  5E4W C;  2XWJ B;  5KEE A;  3IFT A;  1EFI D;  1JCK B;  1AW7 A;  5BN4 A;  2BDO A;  1L0Y B;  4EQO A;  1BCP D;  4QMG A;  2F0L A;  3NSW A;  2OT2 A;  1A6X A;  1X32 A;  3S1R B;  1O7Z A;  2XN9 C;  1PRT F;  3RUZ A;  4B9W A;  1RTN A;  1HPC A;  4NMZ A;  2NBF A;  1Z6H A;  3D4R A;  3R8B A;  5M5W B;  4G4K A;  3S2H B;  4DU9 A;  3BYY B;  5I4D A;  4QCL A;  1NR4 A;  1LO5 D;  4A3B B;  5C3E B;  4ABN A;  2HUG A;  2HQE A;  5EQ0 A;  1PYW D;  2F0G A;  5E4X A;  3D6C A;  3GP7 A;  3TDQ A;  3UI2 A;  1D2B A;  4OHJ A;  2B8G A;  3CRK C;  3TP8 A;  1O7L A;  1F2L A;  1D6E C;  2YU9 B;  1JQY D;  2LFN A;  3M7G A;  5T1G A;  3MFG A;  1JB3 A;  3VYS A;  1SEB D;  1LT6 D;  5CMD A;  1R9T B;  4QB4 A;  4WJW A;  4DNT B;  3MA2 B;  1SYG A;  3HOZ B;  4EVO A;  4H7B A;  4J1M A;  2R3Z A;  4F88 A;  2EJF C;  4FO2 A;  2VNU D;  3R3O A;  2LY7 A;  1TKW B;  4M1U B;  4OO1 H;  1EOT A;  4DN4 M;  2IT1 A;  2C5C A;  3OIQ A;  5HGT A;  3WOE A;  1SFO B;  2ICI A;  2RQX A;  3I70 A;  4OGQ C;  1VCI A;  3M3Y B;  3H0G B;  1JWU D;  3J7Y W;  1M4V A;  5COY A;  4UAI A;  1WVL A;  1LTA D;  3C2P A;  2JA8 B;  1BQQ T;  5C4X B;  1EEF D;  2XIW A;  1KDC A;  1WCM B;  1GHK A;  4KKS A;  4LAA A;  1W6J A;  2B39 A;  4RKL A;  1SMY C;  3K59 A;  4KHZ A;  4NDX A;  3V2T A;  1JIC A;  4NW2 A;  4OO1 I;  2F3W A;  3MEH A;  4K2L A;  1II3 A;  3H91 A;  3MC0 B;  3TSS A;  1ENA A;  4IUT A;  2B2U C;  4K5V A;  3MZ5 A;  1G6Z A;  2JSO A;  2RA4 A;  4PNY A;  2A68 D;  3D31 A;  3NQI A;  2IWH A;  3QIA A;  1Y1W B;  5C4J B;  3RD4 A;  2JA5 B;  4IAL A;  1HA5 A;  1V1O A;  1LTS D;  3NTK A;  1QCB D;  5CV7 A;  1NSN S;  5A2Q E;  1U4L A;  3NTI A;  3E5S A;  1B1Z A;  3KLS X;  1F2M A;  1TII D;  2F3V A;  1SYE A;  5IT9 L;  4P2C B;  4WOR A;  1D1I A;  1A3U A;  1AP0 A;  5ELB A;  1V8Q A;  3QG1 A;  1B50 A;  1GUW A;  2X6G A;  1HTL D;  4XIG S;  2PCF B;  1AFP A;  1B53 A;  1A2T A;  2CQA A;  2K7V A;  3K6O A;  4ILW A;  3H3V C;  5EPL A;  3HGB A;  4IFD H;  1L0X B;  4U68 A;  2OF1 A;  1D5M C;  5CV5 A;  5CV6 A;  1ET9 A;  1ML0 D;  2SOB A;  3TP7 A;  1STB A;  3PMF A;  2SNM A;  4H0L C;  3M85 A;  1V1P B;  3DHQ A;  1BO0 A;  3FEW X;  4WFN 3;  2A5H A;  3HEJ A;  2K04 A;  3S16 B;  5BN3 A;  3SHL A;  3S1Q B;  1CT1 D;  5JJZ A;  2EPB A;  1EZ8 A;  1F9Q A;  1YNN C;  1JE4 A;  3NQT A;  1EYC A;  2N88 A;  5DEH A;  2F0V A;  2KCC A;  1IYU A;  3K57 A;  4ZAI A;  1I3Q B;  5FK9 C;  5KYI A;  3NBH A;  4FF2 A;  2K33 A;  1R4Q B;  3D4W A;  1GUO A;  4DNR B;  3IFD A;  1G29 1;  1HQM C;  2FFK B;  3K5O A;  3CHB D;  3MAQ A;  2CW0 D;  5M5X B;  4CKC A;  3HP3 A;  4FYD A;  5I9P A;  5KIX A;  4ZK9 B;  1GUN A;  3OHX C;  1SJH D;  2F0I A;  4KV6 A;  4QF4 A;  3CU7 A;  4O42 A;  3Q0A A;  1LT3 D;  2NN6 I;  4JBW A;  1C48 A;  1J9O A;  2K5Q A;  1KTK A;  1DM0 B;  2H1E A;  5CC4 A;  2L55 A;  4E6I A;  5JEA J;  4DFA A;  1EU3 A;  4FF3 A;  5CV9 A;  3GO5 A;  1JWM D;  3K5L A;  3GD7 A;  4KY5 A;  4A3I B;  1MGS A;  2ZXR A;  2L4N A;  4QUC A;  3M4O B;  2A6E D;  2EJM A;  2NUC A;  3V05 A;  1MD2 D;  4K6D A;  2EZV A;  1F9R A;  3HG9 A;  1Q1B A;  1IYV A;  3KLR A;  1SNO A;  3CKI B;  1CA5 A;  2F0T A;  3BZD B;  1QIL A;  1BUV T;  5EKK A;  2EOT A;  3SK5 A;  1EY6 A;  4OL7 A;  1F77 A;  2F0W A;  1QG7 A;  4TRD A;  4FVM A;  5K5P A;  1TQO A;  3QJY A;  2KEC A;  4LJZ C;  4IUU A;  1S5B D;  2IL8 A;  1TWC B;  2KHS A;  1JOR A;  3K7A B;  4TSS A;  4X3S A;  2MGS A;  1CHQ D;  2WKC A;  5IT9 E;  2L12 A;  3HOY B;  2JP1 A;  3LWU A;  4IN3 A;  3VYR A;  5DM7 3;  1SNQ A;  3FDT A;  3VR5 A;  5CGK A;  3NWS A;  3DEO A;  4KY6 A;  4G57 A;  4A3D B;  4X3U A;  4ZLT F;  5IGB A;  1EY7 A;  2QCP X;  1VMC A;  4DK1 A;  2K01 A;  2NN6 H;  2WII B;  4EQP A;  1S5C D;  2NWG A;  5JVG 3;  4CKB A;  4HSV A;  3VR2 A;  2LKV A;  4Q5V A;  1TS4 A;  1SYC A;  1OXU A;  2HDM A;  3DMU A;  4KKT A;  1GUT A;  4RKB A;  2L1B A;  2QF7 A;  1Z47 A;  3EA6 A;  3U9O A;  1QNK A;  1TR5 A;  1STA A;  1BOS A;  1OO9 B;  4AYB B;  4HSP A;  1EY4 A;  3M7N A;  4IFD I;  5A35 A;  1EIH A;  2QDB A;  2E75 C;  5ELD A;  3QB3 A;  2FIN B;  3J80 L;  1Y69 U;  1IKM A;  5ISR A;  1DXM A;  2K05 A;  4V0B A;  5DNF A;  2K03 A;  2F0F A;  2F03 A;  2E74 C;  3ZYY X;  1WTX A;  4DXF A;  2PNR C;  4ZKB B;  3TZU A;  4BA1 I;  5C44 B;  4K6L A;  1CQV A;  2DY7 A;  1F2Z A;  1I4R A;  1ENF A;  1X3Q A;  3KF8 A;  4J6H A;  1GJX A;  4XDX A;  2PZT A;  1HA6 A;  3EJI A;  3PIO 3;  3PUV A;  3FVQ A;  2IX0 A;  1HRJ A;  3PO3 B;  1BCP C;  1T5X D;  1TT2 A;  4IFD J;  1H9J A;  2A68 C;  3A54 A;  1O7Y A;  3DUZ A;  2XWB B;  2IPK D;  2K6A A;  4FF1 A;  4Z9C B;  1IL8 A;  2F1M A;  5EBC A;  4K8I A;  2I46 A;  2E2I B;  3JAM E;  5JAV A;  4A3M B;  1AZQ A;  1YNN D;  3K58 A;  5EPK A;  1I4P A;  1STE A;  2F0M A;  2F0P A;  1PZJ D;  1ESR A;  3EVQ A;  3KK7 A;  5JEA H;  4F8M A;  3D4D A;  5CR3 A;  4EQN A;  3JAM L;  1PTO C;  1D1K A;  3GTO B;  4PMB A;  3GTL B;  1TS3 A;  2V4D A;  1A3V A;  1VMP A;  1U4M A;  3MWY W;  4C3I B;  3LWE A;  1GOZ A;  1U4P A;  4RGM A;  5CYU A;  2KUM A;  4C3J B;  1KNA A;  4LMQ D;  3RZO B;  2IX1 A;  1FNV A;  3GTP B;  4GZY C;  2EYL A;  3E6Z X;  3J80 E;  4IZ8 A;  4L8J A;  3R2I A;  1TVX A;  3S9W A;  5JPN C;  4RH6 A;  2JEB I;  1WD1 A;  3SDZ A;  3HOV B;  4XYO A;  3OMG A;  3AMU A;  5JEA G;  1BF4 A;  1DOK A;  2EYM A;  1WTO A;  1LTG D;  1PRT D;  4R8I A;  3MFY A;  5KNC A;  3Q6S A;  4U67 3;  1S5E D;  1ENC A;  1KLU D;  2NVX B;  2NZ1 D;  4I65 A;  4RFB A;  3K5M A;  2EYP A;  2JA7 B;  5ELF A;  4BY7 B;  2F0J A;  4ODG A;  1CZG A;  4JK1 C;  3H09 A;  2I07 B;  2F0O A;  1NCV A;  1Q8I A;  3AU7 A;  3C3L A;  1I4G A;  2PZW A;  3NE5 B;  1H9M A;  1TS5 A;  3NP8 A;  3N52 A;  5EGT A;  4H13 C;  3VA5 A;  4L6T B;  3A7A B;  4C3H B;  4FNF A;  4OO1 G;  4A3G B;  2F0N A;  1EYD A;  1STY A;  3FKI B;  2WAQ B;  4UDU C;  2B2Y C;  2HCI A;  3N6R A;  3TP5 A;  1BCP F;  2SDF A;  2XSC A;  5BN5 A;  2M00 A;  4B08 A;  5IGC A;  4MHE A;  1T5E A;  5C0X I;  2L9H A;  4RGT A;  4CBV A;  2EYO A;  4DA2 A;  3MTS A;  1STG A;  2EYJ A;  4HMJ A;  3PUZ A;  3ND8 A;  4EGV A;  2RSN A;  3I73 A;  5KNB A;  2B2T A;  5C5L A;  2PW5 A;  1EZ6 A;  2Z8L A;  3OWF A;  4XQQ A;  4N9T A;  2WKD A;  4LK1 C;  2EVB A;  2X69 A;  3SE0 A;  3DWP A;  3VA7 A;  3PUY A;  5E1F A;  3Q24 A;  4HAE A;  1UUP A;  3ITP A;  1S5F D;  5G3L F;  2WV6 D;  5ELC A;  1B9M A;  5NUC A;  3X3M A;  3I4N B;  1GHJ A;  1X3P A;  2MPM A;  4BS9 A;  3GTG B;  1EWC A;  2VXW A;  2BE5 C;  3BDC A;  1STH A;  3K5N A;  4RGO S;  3OW7 A;  3D6W A;  2NTS A;  3IL8 A;  3L3O C;  3S1M B;  4PQX A;  5LL6 S;  1DYQ A;  4RCN A;  4YIJ A;  1DD2 A;  2OEO A;  5T1I A;  2AQ3 B;  1C8C A;  1SSO A;  2D2C C;  3SK6 A;  5LHY 1;  5I6Y A;  1Q3L A;  5I6W A;  3BYT B;  1H9S A;  4DAP A;  2B2T C;  1RCV D;  1BBX C;  1SJE D;  4IQZ A;  4N9P A;  2EY6 A;  1EWH A;  3A7L A;  1DZ1 A;  3GTJ B;  5J22 A;  4BBR B;  3RZD B;  3A56 A;  4RA8 A;  2F4I A;  4ME5 A;  1XYI A;  1XTC D;  2Y0S B;  2JEA I;  4S3S A;  3BVM A;  1E0B A;  2EY5 A;  1KLG D;  1G8Z D;  2KVM A;  4F7X A;  5FO7 B;  2F0K A;  2Q8T A;  2B2Y A;  1QOH A;  1WTQ A;  3RLF A;  1CM9 A;  1FNU A;  1HQR D;  3O13 A;  4WRD A;  1U9R A;  2IW3 A;  3T51 B;  1EU4 A;  5KRU A;  1XX8 A;  2Z4H A;  3IAY A;  4XTC S;  2PYK A;  1TWA B;  2A6H D;  1PFB A;  2WAC A;  3R2T A;  2DNC A;  4MIU A;  3QO2 A;  2AUK A;  5FO8 B;  2K5D A;  2YYZ A;  2F0U A;  4C3H G;  4PMC A;  1SE3 A;  4CJ2 C;  1XWE A;  1WD0 A;  3GV3 A;  4KD3 A;  4RHS A;  4FXK C;  4DF7 A;  2J4X A;  2AWN A;  1KDB A;  3OOC A;  5AFW A;  1PTO B;  1IW7 D;  1ILQ A;  4FP5 D;  3SXH A;  4CHT B;  2BDN A;  1ET6 A;  1LTT D;  1K8M A;  2DNE A;  4KY7 A;  3SEB A;  4TKO B;  2WP8 J;  1XXG A;  4ZYS A;  4ZQ3 A;  4CJ0 B;  2A6E C;  2R61 A;  2CHB D;  3T56 B;  5A2Q L;  4IUN A;  4PMW A;  3H94 A;  2KJX A;  2RVL A;  3NPP A;  1DON A;  4DXG A;  2L0C A;  3ND9 A;  3TME A;  1RF2 D;  5F2D A;  1BCP B;  2NVT B;  3A8K E;  1AEX A;  1QNU A;  3H6M A;  3X3N A;  1STN A;  1MI2 A;  1TY2 A;  2A69 D;  1SNC A;  2EXZ A;  4F87 A;  3V96 A;  3Q22 A;  1S4Z A;  5HUR A;  2GA4 B;  2Z1C A;  5D3I B;  4HCS A;  3IKJ A;  4OIJ A;  4NP5 A;  3ERQ A;  1HXY D;  3AB9 A;  5M5Y B;  3LX0 A;  1TWH B;  3OPO A;  2KEE A;  1CA6 A;  2J7Z A;  4FF4 A;  2R93 B;  1FYC A;  1EYA A;  1FD7 D;  1RHP A;  5IOD A;  2TMP A;  1QWY A;  3FPU B;  3KBX A;  2F0S A;  1FR3 A;  4ID6 A;  1KDA A;  1KAA A;  3TZD A;  2NN6 G;  2O5I C;  1LT4 D;  2E2J B;  4ZRZ A;  2PZU A;  1PFN A;  1E2W A;  2EE1 A;  1EQV A;  4KMU C;  2NVY B;  2O2L D;  1DJR D;  4XT1 B;  5D3D A;  3KBG A;  2QKI C;  1OXS C;  3ERO A;  1GUG A;  3GQB A;  5EKI A;  4PV1 C;  2G9H D;  1KAB A;  2E2H B;  1VF5 C;  3J81 E;  1A2U A;  4KJO A;  3HRZ C;  2PMZ B;  3NWT A;  2MHV A;  3R93 A;  1M8A A;  1LTB D;  3HS0 C;  1PTO H;  1H9R A;  1TY0 A;  4RCO A;  4K2K A;  1ICW A;  2AQ2 B;  3D3R A;  1O78 A;  4XYQ A;  1TS2 A;  3MXN A;  1FNW A;  3KUP A;  1ZEQ X;  2B2W C;  1SE2 A;  4H44 C;  1G2T A;  1QB5 D;  4HN7 A;  1EIG A;  1SYF A;  3S15 B;  5DM6 3;  2CW0 C;  2EJG C;  1ZYR C;  2B2W A;  2WIN B;  5G3L D;  5JVH 3;  1VDZ A;  4XQN A;  3TP6 A;  5FO9 B;  1HFG A;  3G6J B;  2Q8I B;  4K5W A;  4KN4 C;  2XVS A;  3GTQ B;  4HTH A;  1NUC A;  5ELE A;  4RGN A;  5LL6 X;  1O80 A;  2A69 C;  4R9W A;  4HR7 B;  1CFM A;  3MXU A;  1LAB A;  2JA6 B;  2PO4 A;  1HCZ A;  1PFM A;  3D8G A;  4RAU C;  2KOL A;  2B2V A;  2LMC B;  1ZKO A;  2PW7 A;  2SNS A;  2RDF A;  1CTM A;  4ULL A;  1I4H A;  2AUJ D;  3ONA B;  5M9O A;  4C3I G;  1PZK D;  1Q12 A;  1EY5 A;  1I4X A;  2L5T A;  3S2D B;  1RD9 D;  3MHB A;  5C4Z A;  1SDF A;  4G7Z C;  2RBM A;  3C1F A;  1U4R A;  4Q0F A;  2J0T D;  2Q8R E;  4DAY A;  2BCO A;  4K14 A;  2R7Z B;  3CQZ B;  1HFN A;  4XT3 B;  4HED A;  1C4Q A;  3HOW B;  4K5X A;  1ILP A;  5FOB B;  3WDN A;  4J8Q A;  3K0Y A;  1F9P A;  5IGF A;  1D5Z C;  2XRS D;  1JC7 A;  2VB2 X;  2NYZ D;  2A74 C;  2K1B A;  5C0X H;  3HOU B;  2XRQ D;  2O5J C;  1SAP A;  3BDO A;  1MSG A;  1MSH A;  4DGZ A;  5IOC A;  3OWE B;  3SK4 A;  3P20 A;  1B44 D;  3NBI A;  3HZX A;  2BA0 A;  1LV9 A;  2K5W A;  4C3J G;  1W6K A;  5FLX E;  3MXP A;  5J39 A;  2JE6 I;  3LNN A;  2HCC A;  1VF7 A;  4TQU S;  2B63 B;  3CRL C;  1UEA B;  2NB0 A;  3SVM A;  3P75 A;  1CI3 M;  2MJ8 A;  1DCZ A;  4A3E B;  1WTP A;  3EQL C;  1E2Z A;  5I2Y A;  1OXT A;  1RTO A;  1JR0 D;  1B3A A;  4XXE A;  1E2V A;  4KKU A;  5EBD A;  2L11 A;  1S5D D;  5C4H A;  1EY9 A;  4C56 C;  1WTV A;  2KA7 A;  3PO2 B;  3MVV A;  4FXD A;  5C0X J;  3E0J A;  4KD4 A;  3A55 A;  1SYD A;  5C0X G;  3DWA A;  1Q90 A;  1ROD A;  3L9A X;  1TWF B;  3A8J E;  4NKL A;  1J8I A;  3VR6 A;  1PRT B;  5FKA C;  4R8N A;  2FJ2 A;  1BR9 A;  2HDL A;  2RDH A;  5IIF A;  1Y1V B;  2DN8 A;  3BDL A;  3U9S A;  3KLS A;  3BS1 A;  1R4P B;  1QE6 A;  1LLR D;  4M8A A;  2MP1 A;  4O1N A;  4BWG B;  4RWS C;  2K28 A;  3HKZ B;  2QIL A;  2F0E A;  4XQJ A;  3SR1 A;  2X6L A;  1EY0 A;  3NK9 A;  2B8F A;  1EEI D;  2B2V C;  1OXV A;  1Q1E A;  3I3C A;  2N55 A;  1GUS A;  2TSS A;  3FMC A;  3M4Y A;  2AQ1 B;  1CZW A;  2EY1 A;  1ESF A;  2SEB D;  3I72 A;  3QWN A;  3QOL A;  1EY8 A;  3A8I E;  4Y7N B;  1EQT A;  4DK0 A;  5EPJ A;  2M2L A;  3MXG A;  2KED A;  2G9D A;  3OMC A;  3G7L A;  4V19 0;  5KGU A;  4K8J A;  2A6H C;  1GXD C;  2E76 C;  1A3T A;  3S1N B;  1WTR A;  1Y8P B;  5CBE E;  1B9N A;  4ZKC B;  1V1P A;  2NVQ B;  1A15 A;  3J7A V;  1BXT A;  4CJ1 B;  1PLF A;  1I6H B;  3C46 A;  4X3T A;  1I50 B;  1SND A;  3P1H A;  4OIK A;  1RJT A;  1SBB B;  5CV8 A;  3C1E A;  1OXX K;  4KTA A;  3BVZ A;  1CHP D;  5EKL A;  2WB1 B;  3DM1 A;  1TU2 B;  1UAP A;  3VYT A;  1KNE A;  1PRT C;  1TWG B;  2VB3 X;  4HCE A;  1K8O A;  2ICE C;  5K36 H;  1JWS D;  3OIP A;  1Z7T A;  4IUP A;  5M3F B;  2F0D A;  1QJO A;  4A3F B;  5COR A;  4I7Z C;  3BVG A;  2E2D C;  5C6A A;  2FMM A;  1SNM A;  4KN7 C;  4C1N K;  1JOK A;  1WTW A;  2FHT A;  2EDG A;  5CV4 A;  4IUV A;  2K32 A;  3Q23 A;  3RMH A;  2EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...