3TP8A

Crystal structure of staphylococcal nuclease variant delta+phs l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E at cryogenic temperature
rcsb
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tp8A00
3QB3A 5F2DA 3P1HA 2F0EA 1EY0A 4PMBA 4E6IA 4NDXA 1STHA 4WRDA 5C3WA 2RDFA 1STAA 1STGA 5IIFA 3NHHA 4NKLA 4KV6A 4RKLA 5CGKA 5IGGA 2EYJA 5J39A 1EY5A 3P75A 3OSOA 3ITPA 3OMGA 4WORA 3D4DA 3RUZA 2EY6A 5CV5A 3D6CA 5J22A 1NSNS 2F0DA 3H6MA 1A3TA 1A2UA 2PQEA 4IUNA 4KTAA 4K2LA 3OWFA 3OMCA 1EZ8A 1A3VA 4F8MA 1SYFA 1EY8A 5C4HA 5KRUA 1JORA 2PZUA 3SK5A 4K6DA 2PW7A 3U9OA 4K5XA 2F0HA 1STYA 3MHBA 3SK6A 1TT2A 2EYHA 2F3WA 4KHVA 1SNCA 4K8IA 1SNPA 3NK9A 5I6WA 2F0WA 3LX0A 3TP8A 1SNMA 5C3XA 4HTHA 3MZ5A 2F0MA 4KD3A 5IOCA 4R8NA 1EYDA 2F0SA 2SNSA 1ENCA 2PYKA 3BDLA 5HGTA 3T16A 2EXZA 2EY1A 2F0LA 3D4WA 4KJNA 1AEXA 5K5PA 1F2MA 4H7BA 1SYGA 1EY4A 3BDCA 3DMUA 4F7XA 2F0KA 4IALA 4B9WA 2F3VA 5CC4A 4NP5A 4B9XA 2EYPA 1F2ZA 4PMCA 1KDCA 4ZUJA 2F0IA 3HEJA 5KEEA 4J1MA 4ID6A 4K5VA 5ISRA 4EQPA 3C1EA 4S3SA 2F0OA 4ZUIA 1RKNA 3QOJA 1SYDA 1U9RA 5IGDA 3SR1A 5I9PA 1SNOA 2F0NA 5M9OA 5DAUA 1TQOA 5IGCA 3TMEA 5KIXA 2PW5A 3MEHA 1IHZA 3SHLA 2KQ3A 4J6HA 3SK4A 4DF7A 5I6YA 1EZ6A 4DGZA 3C1FA 3T13A 1EY7A 4YIJA 2F0PA 2EYFA 1II3A 2QDBA 3EROA 2SNMA 4DFAA 2WACA 3NUCA 5E3FA 1KDAA 3D8GA 2NUCA 5CV6A 1SNDA 1EY9A 5EGTA 3VA5A 4EVOA 5IGFA 2PZTA 2F0QA 2M00A 3EJIA 4K2KA 5CV8A 3NXWA 3SXHA 2OEOA 3DHQA 2F0FA 3NQTA 4N9TA 2F0VA 4IZ8A 4NMZA 4PNYA 3TP7A 3V2TA 3QOLA 4LAAA 2PZWA 4K14A 1KDBA 1A3UA 3ERQA 2SOBA 5C5MA 5C5LA 4K8JA 4ZQ3A 5KGUA 3MXPA 4HMJA 5C4ZA 4QB4A 4RKBA 4ODGA 4HMIA 5C6AA 1SYEA 2F0GA 1NUCA 5IODA 4KD4A 1TR5A 1JOKA 5EKLA 5NUCA 5HURA 5CR3A 4I65A 3TP5A 1SYCA 2O4XA 3E5SA 5E1FA 3EVQA 5IGEA 4MIUA 1SYBA 2ENBA 4G57A 5CV4A 2F0TA 2KHSA 5KYLA 2F0JA 3R3OA 4KJOA 5KYIA 1JOQA 2EYLA 4OL7A 2EY2A 3NP8A 4DU9A 4EQOA 1EY6A 1EYAA 1KAAA 2RBMA 1JOOA 2LKVA 1SNQA 4QMGA 1KABA 5DEHA 5EKKA 5CV9A 1STBA 1STNA 3SK8A 4K5WA 1A2TA 3TP6A 2OF1A 5JAVA 3PMFA 5CV7A 2OXPA 5I9OA 5IGBA 4QF4A 5JOBA 4KY7A 2EYOA 3HZXA 1ENAA 1F2YA 2EY5A 2RKSA 4KY5A 5J1ZA 4KY6A 2EYMA 4TRDA 4EQNA 2F0UA 4ME5A 3S9WA 3MVVA 2HQEA 4N9PA 1EYCA 1EQVA
chains in the Genus database with same CATH superfamily
4NDXA 1STHA 4P75A 2ZT9C 3EFXD 3DWAA 3ND8A 4CHTB 4Y7NH 3F8TA 1WTHA 2UUCQ 4DR1L 3S17H 4L5RC 2CW0D 5EAYA 3HOYG 1NSNS 4L63B 1SMYC 2Q2HA 3I8ZA 5C0XG 2H1EA 3OMCA 2XNAC 2C5CA 2AUKA 3A8IE 1CQVA 4JI7Q 2RSOA 2F0HA 1XWEA 2E2HH 1HCZA 2R93H 2NVYB 1RD9D 2H4OA 1SNPA 5CBEE 5AJ3L 1T5EA 3G7LA 4IUPA 2K5NA 1GVPA 3T16A 3NQIA 3BYYB 4KJNA 1AEXA 2DY8A 2VQFL 3J7AV 2F3VA 4OXPA 3CC4A 4KKUA 1B3AA 1S4ZA 4S3SA 1G8ZD 4I7AA 1VQ5A 1RKNA 2BDNA 3K7AB 3HOWH 3X3MA 4M1UB 1PH3A 1IXRA 5I9PA 4OGQC 3KUPA 4XT1B 3SHLA 1E0BA 3HOUG 3SK4A 1M90C 1HNWQ 1HQRD 1XPRA 2K5HA 3FHWA 1G6ZA 1I4QA 1RTOA 2OQKA 2SNMA 2K32A 3PCOB 2UU9Q 4FF3A 1TWCB 1SRUA 3EJIA 1S5ED 5JVH3 3NQTA 4IZ8A 3V2TA 5IWAL 4LF5Q 3OIQA 2DJFC 1PH6A 2WV6D 5C4JH 2XN9C 2WAQB 3K8AA 4IPHA 4DN4M 1JICA 4QB4A 1FL0A 3S15B 4JI8L 4X65Q 2E2IB 3SVMA 1EU3A 3I4NB 3RZDH 2BH2A 1Y14B 2DNEA 2KHSA 4DV7Q 4DV4Q 3AFQA 5KYIA 3LWUA 3UE1A 2EY2A 4LF9Q 2LKVA 4DXGA 4JI4L 3KFUA 2EJFC 3L7ZC 4DR3L 3PMFA 4JCVE 1K9MC 1YI2A 2NZOA 1FJGL 3BG3A 5H1SE 3KF6B 4MHEA 4KHPQ 1A8VA 1WCMG 2L15A 4XTCS 1EY0A 1SROA 3CPFA 1IL2A 4NKLA 4B08A 1IZ6A 2BE5C 1N36L 3U50C 2PNRC 5LL6S 4A75A 2XTIA 4IFDJ 3A74A 1C48A 1HFNA 1A3TA 1A2UA 1L1OA 1HJPA 1L0YB 4IQZA 1YHBA 4QL5A 3PGZA 4H13C 2NVQB 1LTLA 2UUBQ 3J81L 1Y1VG 1EWCA 2NVTB 5ELNA 4DV1Q 3PUXA 4NXML 3M4OH 4JC0A 3KOJA 4JV5Q 1TWFB 4FP5D 4A3IH 1EYDA 3GTMH 1SE3A 3VYUA 1SSOA 4DV6L 2BA0A 1F2MA 2DY7A 4IALA 1FGUA 5M3FH 1JQYD 4DUYL 3SE0A 1LT4D 1FR3A 1IBML 4K5VA 3HOWB 2GVBA 4J15A 3S1NH 2LXKA 3OW2A 2PO4A 1TVXA 5AFWA 4YWLA 1OO9B 2WKCA 4C3HB 3A56A 1WFQA 2G5DA 3I4MB 1EZ6A 2A6HD 4DAVA 2UU9L 2Z6KC 3TS2A 1EY7A 1NMFA 1QZGA 2EYFA 1KRTA 4ALPA 1VQEA 1EY9A 1E1TA 1SJHD 2L12A 2R7ZB 3HOYH 1K83B 3R2IA 1WTPA 3SXHA 5GAGC 1EL0A 1LACA 2CW0C 1TY2A 4N9TA 4OWTB 4DV3Q 4LAAA 2K1BA 1IYJB 3CU7A 2Q8RE 3H0GB 1Q7YC 1CTMA 1KTKA 2ICIA 5IP9G 1IW7D 1Y1WH 4A3IG 4G57A 3E9IA 5AJ3Q 3I73A 1E24A 2V4DA 1ZKOA 1YITA 1LM0A 1BBWA 1EFWA 4HCEA 2R7ZH 4O0AA 1AN8A 4FF2A 1Y8PB 5JPMC 2LS01 3J7A5 1U4MA 2ZXOA 3HOZH 5IGBA 2B39A 5HGQA 1X54A 1AE2A 4JBWA 4FXGC 1DJRD 3RMHA 5BR8L 1TS2A 3KF6A 4CKBA 1VF5C 4KV6A 4RKLA 1XNQQ 4A3DH 2KOLA 3N6RA 4OIJA 1PH4A 3D4DA 1HZCA 1ICWA 5J22A 3PUWA 3HOVB 4RWSC 4BY1G 4KKSA 2R7ZG 3S17B 3NTIA 4EQ5A 3AB9A 2IJ0A 2Q2TA 2JE6I 3E9HA 5K36H 1SXTA 2NVXH 4UHVA 3U58A 3S14B 1O7ZA 4KHVA 3PO2B 3TDQA 4GNXA 3NK9A 5GAHC 3G71A 1N32L 4KMUC 3TP8A 1J5EL 1XMOQ 1QUQA 1VQPA 2RHQB 4DUZQ 4JI2Q 4ZAIA 5HGTA 3Q6SA 1ESFA 4C3IH 4XIGS 1L0XB 3UDIA 2R7FA 3FKIB 3J80i 2L5TA 2A68C 4KKTA 2HDLA 2MHVA 4HIKA 1QE6A 4B9WA 5CC4A 1UE6A 1F2ZA 3M7GA 4OO1I 3MXGA 3NBIA 1W6KA 3GTQH 3QOJA 2V1CC 2VNUD 5FO7B 3SR1A 3BYTB 1MKHA 1S5DD 3LNNA 1FNVA 5CORA 5M9OA 3CPWA 5C4XG 2PW5A 4TQUS 4NB3A 2A69C 1E7ZA 3WOFA 1B1ZA 1S3OA 1F9SA 1CSQA 1II3A 3AYHB 1PH9A 1DYQA 4IUTA 1ZEQX 1N34L 1N36Q 1DOKA 1V1OA 4PZ7A 4X3UA 4DR6Q 3J80c 3NXWA 3AEVA 5M5WH 2BCOA 5C0XH 5LMUQ 4GN4B 3VDYA 1HNXQ 3C3LA 3HOVG 1PTOC 4BY1B 1VQGA 1KNAA 3PUYA 4JBJA 5LHY1 4JBKA 4IN3A 5EKLA 4A3FH 2AMCB 3BS1A 3X3NA 3I70A 1SYBA 4C3IG 1PRTB 4MN3A 3MAQA 1GOZA 1X3PA 2KHIA 2A5HA 1E1OA 1PZID 4BY1H 3FKIG 1B44D 4A3EH 2XWJB 3I56A 4QJFA 4RFBA 1I94Q 3VR5A 3AQQA 2TSSA 3DM3A 1PV4A 2R92H 3H3VI 4HEDA 1PHJA 1PLFA 2LMCB 3HKZB 3MVVA 1GHKA 1HR0L 2Y0SE 4TSSA 1ESRA 1KLUD 5GAEC 1V1PB 4OWWB 3GD7A 3LGJA 4BA2I 2ZXPA 3OMGA 4IJLA 2I5MX 1Q8KA 1MGSA 4A3BH 1V9PA 4DV0Q 2E5LL 5C4HA 1YHAA 1E2WA 3TZUA 2NTSA 2Z6KA 2UXBL 3H91A 1H9JA 2F3WA 2R7DA 4V190 4LF4Q 1SNMA 1G291 4DK6C 1JE5A 3BDLA 3CRLC 2PQAB 1ILQA 2Z8LA 4DV7L 2VB2X 3EBEA 4Y7NB 1RL2A 5LL6X 2VUMG 5FLXL 4L5QA 1LO5D 1J5EQ 4R4IA 1LLRD 1W2BA 1GUOA 4JI2L 2WB1B 4J1MA 3FRPB 4FDBA 1UE7A 3JAML 2MGSA 1LV9A 1HQMC 3CCMA 4DK0A 4WJ3M 4PQXA 1LTSD 5DAUA 2KQ3A 1EYGA 1SLJA 5I6YA 4CBVA 3K5NA 2PMZB 2B2VA 3GTOB 4G4KA 1BBUA 1XX8A 4CJ2C 1PMRA 3AU7A 3QR8A 4LFCQ 1GUTA 3QJYA 4NMZA 4CKEA 1MJEA 3N52A 4LUOA 4IUQA 4JYAQ 2R92G 4K8JA 3K81C 4RKBA 3TZDA 5IODA 4YCVA 1B7YB 1B2TA 1PA6A 2HD3A 2WKDA 4A3JB 2N88A 4C3JB 1M1KC 4OO1H 4JI0Q 1UEAB 2EVBA 3VR3A 1S5FD 5KYLA 5C3EB 3CAMA 1FD7D 4FO2A 1R4PB 4DV6Q 4RHRA 1A2TA 3S1MH 2OF1A 2VUMB 1CSPA 1E22A 4FNFA 5FJ8H 5M3MB 1PZJD 1H9SB 2MFIA 3A54A 2NZ1D 4B3SQ 5LMNQ 2N49A 5IIFA 2B63B 2K7VA 1CHQD 4R9WA 5IGGA 2DUDA 2R6GA 4O2DA 3K59A 4HIOA 2G9HD 2JA5B 2XVSA 1BR9A 1NBWA 5IYBH 3H6MA 2N55A 3CMAA 3JAME 4IFDI 2SEBD 1S5CD 5D65A 1DONA 3IFDA 4NXNQ 5M3MH 3GTKH 3HOXH 4DK1A 5IP7G 3DLLA 4GOPA 1XPOA 3LX0A 4XQJA 3G6EA 4DKAC 2HT1A 1CKNB 1D2BA 2F0SA 3I4OA 3K6OA 2JA8G 3PF4A 1SYGA 3BDCA 3OOCA 1C0AA 1VQ7A 4X66Q 4JI8Q 2MPMA 4X65L 2B2UC 4AIMA 2A19A 4DR5Q 1N33Q 4L8JA 1WTOA 2K5WA 3MEHA 5I2YA 1SAPA 1YNJC 4GKKL 4IUVA 1VQCA 1UUPA 3BZDB 2JK8A 3H09A 5M3FB 1AE3A 5E3FA 2X6LA 4XDXA 1SNDA 3S2DB 2F0QA 2LFNA 4H0LC 3KBXA 3TEHB 3TP7A 3JAMc 2JJQA 2F0VA 1PYWD 4IFDG 1F9PA 1CM9A 3MXPA 1CK1A 5FOBB 2WIIB 1H95A 5NUCA 1S40A 2Z4HA 1I4XA 3FEWX 3HG9A 2RCNA 2UXDL 1NNXA 4YHHQ 3S15H 1PTOH 3UE0A 1MBYA 1O7IA 3I4NH 2E2IH 4IURA 3BJUA 5EBCA 3DXJC 1KAWA 3I2ZA 5EPKA 1ASYA 5IE8A 1STBA 2I07B 4OX9L 2JA8B 5JAVA 2FXQA 4POGA 5JEAG 3NENA 2Q2UA 1TS4A 4P2CB 4A3GG 2NN6I 4RGOS 4IPCA 3PIOA 5J1ZA 3W5OA 4HJ7A 1L2FA 1LUZA 2B2YA 1EQVA 2YYZA 3QB3A 3A7AB 1BQQT 3EN2A 2R3ZA 5IY0A 4JPBW 1FVIA 4GZYC 1GO3E 3KJPA 5M3FG 1XNRL 1IKMA 3K7AH 1QG7A 1DCZA 1MSGA 2Y0SB 4A3MH 4L5TA 4LJZC 1WTRA 1JJCB 4A3LG 1PH1A 4YCWA 5T1IA 3M7NA 2ZXRA 3DWQA 5IOCA 1HUNA 4YHHL 1VMCA 5C44G 1CKOA 1H9KA 2NB0A 2A1AA 4HJ5A 2JA6G 3E0JA 3OHXC 4LF6Q 1HA6A 3D4RA 3RD4A 4HJ9A 4PMCA 5KEEA 4A4IA 1Y8NB 4KLKA 1QUQB 1OTCA 2F0NA 2VW9A 4ME3A 2ICEC 3I55A 3ULJA 5JJZA 1VQOA 1X65A 1XYIA 3I4MH 1GJXA 5A2QL 3KBGA 4E6IA 3HOYB 1SEBD 3NUCA 3KK7A 5IYDG 5IGFA 2UUAL 4GS3A 2M00A 1JJGA 2PI2A 2OEOA 1GM5A 2ZTDA 3CCVA 4G7ZC 3HOZG 1TWAH 1H9SA 2HIXA 4L6TB 1CZWA 2HHHQ 1CFMA 1J6QA 2EDGA 2JXMB 2O2LD 5C3EH 3CCJA 3GTJB 2ENBA 3P7JA 4KJOA 1KC8C 2ZM6L 4R4TA 3V96A 1VQKA 5JEAJ 1EYAA 2MO0A 1XPUA 3SK8A 1MD2D 4K5WA 2YTXA 3GTPB 5G3LD 1V1PA 3J7ZC 2BDOA 4U68A 2B2TA 2D62A 3MA2B 2DNCA 2HIVA 4R4CA 4A3DB 3CF5A 3R8BA 2Z1CA 4DR4Q 3OPOA 4YWMA 1KRSA 4ZLTF 4B3ML 2OTJA 1QNKA 5E4WC 3M3YB 5EPLA 4A3KB 1M8AA 4IOCA 2UUAQ 4F88A 2F0DA 4WFN3 2X69A 2A74C 1U4LA 3F2DA 4CJ0B 2E2DC 2F1MA 4HJAA 3GTPH 2IHFA 2F4VQ 1B4OA 5I4DA 5IP9H 3H0GG 5DNFA 3BZCA 3CCRA 4R4QA 4OO1G 1LT3D 2PQAA 1X3FA 2L9HA 3STBC 3RZOB 1EOVA 2ZM6Q 2EY1A 3G6JB 2EPBA 3ZYYX 4LK1C 1N32Q 4OX9Q 3DMUA 4F7XA 2IHEA 4HSPA 1WD1A 3K5OA 4KI0A 3HEJA 1BXTA 3BU2A 1SE2A 2QEXA 1U9RA 1T9HA 5IGDA 5K36G 3S1QH 2EOTA 2WINB 4P74A 5JVG3 2VZAA 5E4XA 2CWAA 4DF7A 2NVTH 4LNQA 3NSWA 4LMQD 3EROA 4FVMA 1OXVA 2NZHA 1RIPA 2JSOA 2AUJD 1EFID 1PFBA 3DHQA 1OXUA 2F0FA 3KJOA 3ULPA 2E2JB 2B2TC 2CHBD 3NTHA 2K01A 5M5WB 1HNWL 2D9UA 4MZ9A 1EQQA 3E6ZX 1YNND 3H3VH 1LABA 1E2ZA 3UDGA 2M9VA 1B53A 1Y8OB 1TS5A 4OEMB 1F9QA 1FNUA 2ZJQA 2KCMA 2F0TA 1CT1D 4OL7A 1H9RA 1RODA 2JA8H 1DM0B 4DFAA 1V1QA 2JA7B 4H44C 4O42A 4KY7A 2EY5A 1VQJA 2K5QA 1BUVT 1KL9A 2B8FA 2E75C 1XMQL 4GKJL 1RTNA 5F2DA 2EJMA 4M8AA 4P73A 2VQEL 4LF8L 4A3FG 5M5YH 1EY5A 4UP7A 2ASBA 2D0PA 1KIXA 3HP3A 1AW7A 3D6CA 1I4RA 4BBRG 4KTAA 3W1BA 4K2LA 1ET6A 1XNQL 5DM63 3BZKA 3K5LA 1TS3A 3S1MB 2PZUA 2O5JC 3J81i 1ILPA 1Q3LA 1MJCA 4OELB 2QA4A 2EYHA 1WTVA 5BR8Q 1BKBA 4NPSA 4EX5A 2RF4A 4H02A 1QVGA 4K6LA 1YHQA 2QCPX 1EIFA 1Z6HA 4A93B 2HDMA 5GROA 3IKJA 1Y69U 2B2VC 1HXYD 2CH4W 4RGTA 5ELCA 2YU9H 2IL8A 1O7LA 2CQAA 4KN4C 1HR0W 3PO2H 3U9SA 5FO8B 1SNOA 4C1NK 4GOPB 1W3SA 1PFSA 1LTGD 4BY7G 1SBBB 2CQOA 1SR3A 4OONA 3U4ZA 2C35B 1TIID 1CZGA 5EGTA 4Y52H 1IKLA 3F2BA 4QIWE 3ICEA 2E2JH 4DPGA 1X9NA 2QILA 5C0XI 1TWAB 2KCNA 4DAMA 1BCPB 2OTLA 4BBRB 1ZXTA 3VYSA 3PO2G 5KGUA 4CDEC 1JOKA 1Q1EA 1J9OA 1A15A 4DAPA 1EU4A 2PMZE 3GTGH 1BO0A 4ZKBB 2VS1A 1EQRA 5E1FA 4MIUA 4LF7L 4KK7A 3R3OA 3CD6A 4FXKC 2QW7A 4ZKCB 3NEMA 2VUMH 1LTRD 2A6ED 1SDFA 1SNQA 5DEHA 4JI0L 1K3BC 5CV7A 2A6HC 2OXPA 3NELA 2MNAA 2E2HB 4JI7L 3AMUA 5C4XB 4JOIC 3RLOA 4KY5A 4KY6A 3NPPA 4KHZA 4QUFA 4HCSA 2B63H 1F77A 1Z47A 4WRDA 3KDFA 2RDFA 1VQBA 1QVFA 4C3HG 3S14H 2AQ1B 2EYJA 1IL8A 1UE1A 4B3MQ 5LMNL 1I6VC 2KVMA 3K7UC 2F4IA 4F8MA 4A3CG 1EY8A 1A0IA 5KRUA 3FPUB 1UAPA 2RVLA 3Q22A 1SFOB 3BVMA 3MFYA 4K5XA 4GKKQ 1WYDA 1HFGA 1DOMA 3H15A 2R92B 4G7OC 1Q90A 2K5VA 1NCVA 1HR0Q 4K8IA 3G48A 1B70B 5C3XA 1L0WA 3GO5A 1DXMA 1Z7TA 1PYSB 4A3IB 2F0LA 1HTPA 1Q82C 2A69D 2L55A 5L37A 1M4VA 1GUSA 4JV5L 2K05A 1VMPA 5ELBA 4ZUJA 1YJ9A 2GVAA 1C4QA 2F0OA 3OYYA 2IX1A 2ATWA 4DUZL 2NWGA 2NTTA 3A5UA 4JI5Q 5M3MG 4DR7L 3HOXG 1C9OA 3PO3B 4J8QA 1JT8A 4AQYL 2F0PA 3E3XA 4ZYSA 2QDBA 3CP0A 1K83H 3KLSX 3D8GA 1K73C 4QCLA 3FMCA 3VA5A 2FJ2A 2IX3A 1NE3A 3TS0A 1YJWA 1BOSA 2JA6H 1HTLD 5GQOA 5JEAH 3H3VC 1TU2B 5C5MA 1NY4A 3JAMi 2ID0A 3GDEA 1Q12A 4KD4A 4PZ8A 1NJIC 1ZYRD 3Q24A 1X56A 2VXWA 3CQZH 4RCNA 5FLMH 2K52A 3D6WA 2X6GA 4ILWA 4P72A 5CYUA 3F2CA 4A3EB 1L1OC 2WB1G 1JOOA 4CGYB 1VQ6A 1KABA 4UPAA 1STNA 2PPBC 5JPNC 4PZ6A 2Z6BA 3HRZC 1D8LA 3CKIB 2EJGC 2EYOA 1ENAA 2M2LA 3TSSA 5GADC 4HR7B 5C4JB 5BN5A 3QWNA 4A3LH 1HZBA 4XYOA 3D0FA 1GHJA 3ND9A 1CUKA 4NW2A 2OQ0A 1PTOF 2HQEA 2LSSA 1XJVA 1H9MA 4Z9CB 3NWTA 3HOXB 1HUMA 1KLGD 3NHHA 3M4OB 4TKOB 2Q8IB 4HAEA 2CKZB 5J39A 3PO3G 1MI2A 1GUGA 2A73B 3EA6A 3MC0B 3O13A 5IYCH 1Q8IA 3CHBD 5IT9E 1UEBA 1GUNA 3Q23A 4K6DA 1PTOD 3MHBA 1CA6A 2DN8A 4A3JG 3SK6A 1I3QB 4C3JG 2Q8TA 5G3LF 4GLVB 3SDZA 3T4AC 2ES2A 2SDFA 1OXSC 5EQ0A 2FMMA 2SNSA 2PYKA 3A5ZB 1UNSA 2NN6H 4H7BA 1BBXC 3RLNA 4C3IB 2F0KA 2K5DA 3CC7A 1D5XC 3M85A 4B9XA 3FKIH 2KA7A 4AYBB 1XMOL 4XQNA 3QIAA 4DV0L 5EKIA 4GLXA 1WCMH 4DV5L 3GTGB 3RZOH 1JB7A 2B63G 4DA2A 1IHZA 2KCCA 4NXMQ 4IO9A 4DGZA 1I4HA 1XTCD 1TWGH 5JJLA 4JI3L 5CV6A 2EQSA 2KENA 4O1NA 1SE4A 3VR6A 1U4RA 2F52A 1I5FA 1EOTA 1PFMA 4RA8A 2MQHA 5KNDA 4UY8C 4B3SL 1Q81C 3ERQA 2KECA 4DV2L 3KF8A 5C6AA 4HMIA 1C7YA 3URYA 1SMYD 1TWHB 4R4OA 2AHOB 5EBDA 3MXNB 1A63A 2K33A 1QNUA 1GXDC 1TY0A 4QIWB 3OTOL 1FJGQ 2PCFB 2DGYA 1RDPD 5C44H 2KUMA 2B29A 3TQYA 1TWGB 2KEDA 3RN2A 2J0TD 1Q1BA 3U4VA 2QDLA 2B8GA 1V43A 4LWCA 1GKHA 3K0XA 2JA9A 3KF8B 1Z9FA 2K28A 3G4SA 3HOVH 3ERSX 4V0BA 2GA4B 2E74C 4LFAL 1VQMA 4A3MG 4LF5L 1Y1WB 2EZVA 2OT2A 5ELOA 5EJWA 4EQNA 5CBAE 3H0GH 2XIWA 5C4XH 1K3RA 4RGMA 5A2QE 4UAIA 3GTKB 1E2VA 4DK3C 3IL8A 2K50A 2N78A 5KNBA 1FNWA 2E76C 4LUZA 4JI3Q 4WORA 3GQBA 4CDCC 2EY6A 4GNXB 4DR4L 4MTNA 4DR5L 2L1BA 4QQBX 1JORA 4GNXC 3L3OC 1I3QH 4APVA 2PW7A 3U9OA 1JC7A 5DM73 3HOZB 3Q8DA 3NE5B 5I6WA 1SJED 3OW7A 3PV0A 2IWHA 1A6XA 4IUUA 1JE4A 4OIKA 2MP1A 4K0KQ 2D0OA 2JQOA 1WJJA 2ZJRA 2MJ8A 2QKIC 1ZYRC 4NP5A 1PXUA 2EYPA 1K28A 2KCTA 1DOLA 4IPGA 3CCSA 2Q2IA 1JB3A 3KYHC 3K0YA 3VYTA 1Y1WG 3CW2C 4I7ZC 3M4PA 1BCPC 1STEA 4X64L 4A3DG 1D6EC 2KBNA 1KDAA 2RQXA 3OIPA 4DXFA 4PV1C 4U673 2PZTA 3GTOH 1PTOB 2K03A 2RA4A 1K8AC 5IYCG 1VQAA 1Y1VB 3QOLA 1BCPF 4CJ1B 5T1GA 4P71A 3NTKA 1PRTD 3EQLC 4ABNA 1TR5A 4CDDC 1JJ2A 2TMPA 1D7QA 2HQLA 3EVQA 5IGEA 1IBLL 1WI5A 3BDOA 4B3RL 4DR2Q 2JA6B 1XTDA 3TRZA 3GTLH 4G7HC 4DU9A 1HH2P 3AFPA 3RNUA 3I3CA 1YZ6A 5CV9A 1Q46A 3VA7A 1V8QA 1YNJD 2J7ZA 4BS9A 1SFOH 1D5ZC 5I9OA 2HHHL 1HZ9A 1LT6D 3PIP3 4DV1L 3LWEA 1KHIA 3IRBA 1YNXA 3W3AA 2R93B 1ASZA 4TRDA 1SE8A 2CVRA 3I90A 2F03A 4IOAA 1HA5A 3UI2A 4PMBA 1BNZA 5C3WA 3WOEA 1HRJA 3S24A 2K4KA 3A7LA 5CGKA 3DEOA 1F9RA 4RMFA 3FPPA 1O78A 5M5XH 1Q86C 1G51A 1AP0A 1EEFD 3J81E 3FVQA 2L0CA 3HFZB 4L5SA 1QOHA 1SYFA 3A0JA 1RHPA 1R9TH 2LXJA 4LUVA 4RCOA 1STYA 1L1OB 2BA1A 2WAQG 3S2HH 1SNCA 4DAYB 4AH6A 1NR4A 1X32A 2FHTA 4TVAB 3TBIB 4DR2L 4R8NA 2IPKD 1ENCA 3A8KE 3KLRA 1YNNC 2VY3A 4GN3B 3I4NG 4YY3L 1AH9A 3K5MA 2FFKB 1IW7C 1VQHA 4RG1A 1D5MC 5E7NA 1ML0D 2F0IA 4ID6A 2MO1A 3C1EA 4RH6A 2JA7G 3STBD 3CCEA 2JYOA 1VQFA 1YBYA 3GTQB 1PDQA 1YJNA 4LF4L 2R93G 1I4GA 1JCKB 3FDTA 2NYZD 1WCMB 3TN2A 2B2UA 4A3KG 3A55A 3T13A 1YIJA 1YVCA 1GUWA 3KDFB 4JI1Q 4EVOA 5CV8A 1RJTA 3J81c 4X64Q 1LYLA 1B9MA 2I46A 2PZWA 1R4QB 1D1IA 4C2MH 1F2LA 4XT3B 2QEJC 4ODGA 2K75A 1PVOA 3TP5A 1G91A 3HOUH 3VR2A 4DNTB 3GV3A 4K0KL 3ZJYC 3K80C 3S1RH 1I50B 2GN5A 1PH8A 2F0JA 1DGSA 4A93G 2QGQA 5C44B 1XXGA 4CKCA 3M4YA 4QF4A 5EPJA 2EYMA 3HOUB 3HOWG 1K8OA 2F0UA 1J8IA 5D3IB 1TWFH 1D1KA 3P1HA 3A8JE 1KNEA 5M5XB 1B9NA 1JWUD 2ZTEA 5FLMG 4BY7B 2G9DA 5COYA 4AQYQ 1CKNA 3I4MG 3GTJH 1VQ9A 4X62L 2IY5B 3D3RA 2RDHA 5CV5A 4MTKA 1CA5A 4DR7Q 1BCPD 3CMEA 3PUVA 4BWGB 3W2DA 3S16H 5FJ8G 2RDGA 1PRTF 3K57A 1YEZA 3ER0A 4GKJQ 1TT2A 3KLWA 4KHPL 2VQEQ 3R93A 1U0LA 2F0WA 1K8GA 1VQDA 1IBKQ 4KD3A 2J4XA 1KQSA 3M9BA 2EXZA 1KXLA 3CC2A 4A76A 2BOSA 5K5PA 1LTID 4DAYA 3TREA 1X3GA 1CHPD 2FINB 3CRKC 4UDUC 2HCCA 1KDCA 4EQPA 4NXNL 3PF5A 4ZUIA 3R2TA 5IGCA 3TMEA 2IW3A 5KIXA 3CCLA 3VYRA 4ZRZA 2CH4A 2FMCA 4DNRB 1QILA 5IWAQ 2UXCL 2NUCA 1HNXL 3I72A 3DM1A 2AQ2B 4K2KA 1VF7A 3RLFA 1KDBA 1VQ4A 4A3GH 2UXCQ 5C5LA 2PI2E 3Q0AA 5DLQE 5C4ZA 3WDNA 5JJIA 4BBSG 1NUCA 3WWVA 4GLAC 5CR3A 4I65A 5D14A 1K0SA 1OXTA 1JWMD 4N8X1 3NWSA 4C3HH 1NTGA 3PSIA 3GP7A 2HCIA 4DR3Q 2K6AA 3CQZB 1X3EA 4WJ4A 1RCVD 2AWOA 1EY6A 2K14A 2CCZA 1I4PA 1QZHA 4ZK9B 3CCQA 5BN4A 4A3CH 1O80A 1S5BD 3IAYA 2L4NA 4IPDA 4ME5A 4MNOA 1EIYB 2A6EC 1DD2A 1PZKD 2OCEA 1N8RC 3M3YH 2ZTCA 1EWHA 5TSSA 2L11A 3P75A 3OSOA 2NN6G 1VCIA 1W6JA 3JC66 5IYDH 1E3PA 3L0OA 2PQEA 1ICFB 1A3VA 2NBFA 3SK5A 4HIDA 1NMGA 2LY7A 2VB3X 1RF2D 1SN8A 5BN3A 2ZJPA 5HY6A 5FKAC 3I4LA 5IT9c 4BBSB 4C56C 3C46A 2AKWB 4X66L 4HTHA 3MZ5A 2VQFQ 1N9WA 5FLXE 2KEEA 5I2XA 4HIMA 3BVGA 3PUZA 1WTQA 2JP1A 1KD1C 3MXUA 1G6PA 1HHVA 1X3QA 2JN4A 4LFBQ 2KHJA 3MFGA 1QB5D 1JMCA 4WJWA 5LMNW 2E5LQ 1EUJA 1OXXK 1Y1VH 3OTOQ 3T53B 1PH5A 4EGVA 1U4PA 4C3JH 4JBMA 1ENFA 4XXEA 1B50A 3RZDB 4RGNA 1PH7A 3HKZG 1UE5A 4JYAL 3RR5A 2JA5G 3SGIA 3C1FA 5ELEA 1UWVA 1EIGA 4A3FB 3KLSA 5IYBG 3HS0C 4X62Q 1FGBD 3S2DH 4KN7C 3MWYW 4JI1L 2K04A 1TWHH 4ZQ3A 4JI5L 5A35A 3HKSA 4HMJA 4BXXG 5KNCA 1SYEA 4UP8A 2YTYA 4JI4Q 2XGTA 1EEID 5ELDA 1QWYA 4QUCA 1WTXA 4LF9L 4QGUA 1QVCA 3J7AF 3S1RB 2ALYB 2Z9HA 2Z0SA 3E5SA 4HN7A 3J80L 2JA5H 5FLXc 3NBHA 3EIVA 1GD7A 1BVSA 2IX0A 2PNHA 2XRSD 3NP8A 3MXNA 1WOCA 1KAAA 4YY3Q 4LFBL 4DUYQ 4QMGA 5EKKA 4C2MB 1X6OA 5IT9L 4CDFC 3T56B 4YCUA 1F2YA 5ELFA 1LT5D 1AZPA 4FF4A 1NR2A 4OWXB 4N9PA 1AFPA 2UUCL 3FP9A 3M4QA 1IYUA 1K0RA 2NVYH 3T1HL 2OWOA 3ITPA 4X3TA 5FO9B 4XQQA 4ZCKA 4B3TQ 1ONLA 4IFDH 1EZ8A 2I5LX 5CMDA 1EWIA 2NVXB 1K8MA 2B2YC 2O5IC 4BA1I 3CCUA 3P20A 2NVQH 3S1NB 1SMXA 3GV6A 1G2SA 4FF1A 1PYBA 1LTBD 4JG2A 2IT1A 3L9AX 1PH2A 1EY4A 4A93H 3GTMB 3I7FA 1B8AA 2B2WA 2I0QA 2KJXA 4A3GB 4PMWA 4POFA 5FK9C 1T5XD 3CXCA 3C2PA 3J7YW 2XSCA 3S2HB 2C9OA 1IBLQ 2R61A 2UXDQ 1TXYA 2UXBQ 1QCBD 1TQOA 2CWPA 3J80E 4DV3L 1X55A 4J6HA 2I5HA 2UUBL 2DJGC 1O7YA 4LFCL 4DNIA 4R1JA 4JW0A 3T1HQ 2B2WC 2EE1A 3L2PA 3NBHB 1BF4A 3HGBA 2AWNA 3UDXA 4RHSA 3F1ZA 3QO2A 1P16A 1CKMA 4PNYA 2Y0SG 4LFAQ 1LTAD 2A8VA 4GOPC 1XMQQ 4XYQA 2JA7H 4IJHA 2F0GA 2N8NA 1IBMQ 1FYCA 2O4XA 1JWSD 3HKZE 1WD0A 4C1NI 3GTLB 3DUZA 4JI6Q 2JEAI 3PIPA 1U5KA 4JVZA 4N8FA 3T1YQ 4AYBE 2EYLA 2YTVA 4EQOA 3J81j 4HJ8A 2B3GA 4AYBG 3T51B 2RBMA 1C8CA 2D2CC 5M5YB 1JOQA 4X3SA 1I6HB 1TWCH 5JJKA 1ET9A 2WAQE 4B3RQ 4JK1C 4DV2Q 1MHWC 3ONAB 5JOBA 1EIHA 3HZXA 4RAUC 1VQIA 4LF7Q 3MTSA 3S9WA 1JR0D 3S16B 3IFTA 1I50H 2F0EA 1VQLA 1HNZL 1STAA 1STGA 1A62A 1XNRQ 2RSNA 4R8IA 4X3KA 2AQ3B 4B3TL 4A3BB 3RUZA 1EQTA 3RN5A 3F2UA 3BVZA 4IUNA 3DWPA 1HNZQ 3OWFA 5J3BA 4DV5Q 4UP9A 1BDOA 1NAPA 4BXXH 2H5XA 3MEFA 1VQ8A 2P5ZX 3K58A 4LF6L 1N33L 4JOIA 4Q0FA 1MSHA 2N3SA 1P8LA 3I91A 5C3EG 4DV4L 2F0MA 2E8GA 3W1GA 1DZ1A 2QF7A 2JEBI 1S72A 4JI6L 1IYVA 3T1YL 1VS0A 3D4WA 2RHSB 1CI3M 1PFNA 2D5DA 4A3EG 1WVLA 4BBRH 1HZAA 5ISRA 4A3MB 3S1QB 3PQIA 1VDZA 2XWBB 1IBKL 2BE5D 3V05A 1SYDA 3ULLA 4GN5A 3B6YA 4BY7H 3UDFA 3H94A 2Z4IA 2YV5A 5IP7H 5LMUL 4DR6L 1N34Q 4FXDA 4YIJA 1B3QA 3OWEB 4ULLA 2RCFA 2WACA 4F87A 3PIO3 3PO3H 5C0XJ 2A68D 1HPCA 1G2TA 2WB1E 4DR1Q 4X6AH 3E0EA 4A3BG 4HSVA 1QJOA 4LW1A 3SEBA 4K14A 2WFWA 1A3UA 2EXDA 2SOBA 4OHJA 2YU9B 2HUGA 4A3JH 2WP8J 4LF8Q 5HURA 2XRQD 1SYCA 2EIFA 1TKWB 5D3DA 4A3KH 1MIUA 5CV4A 3VR4A 1WTWA 2F3IA 2BH8A 4FYDA 1VQNA 1I94L 1AZQA 3D31A 2MUYA 1CQFA 4PG3A 4Q5VA 3TP6A 1R9TB 2VL6A 3DEPA 4YWKA 1I6HH 2F4VL 4QY7A 2CFMA 2RKSA 1PRTC 4BBSH 3QG1A 1LTTD 1EYCA
chains in the Genus database with same CATH topology
4NDXA 1STHA 2ZT9C 3EFXD 3DWAA 3ND8A 4CHTB 2CW0D 1NSNS 4L63B 1SMYC 3I8ZA 5C0XG 2H1EA 3OMCA 2XNAC 2C5CA 2AUKA 3A8IE 1CQVA 2RSOA 2F0HA 1XWEA 1HCZA 2NVYB 1RD9D 2H4OA 1SNPA 5CBEE 1T5EA 3G7LA 4IUPA 3T16A 3NQIA 3BYYB 4KJNA 1AEXA 2DY8A 3J7AV 2F3VA 4KKUA 1B3AA 1S4ZA 4S3SA 1G8ZD 1RKNA 2BDNA 3K7AB 3X3MA 4M1UB 5I9PA 4OGQC 3KUPA 4XT1B 3SHLA 1E0BA 3SK4A 1HQRD 1G6ZA 1I4QA 1RTOA 2SNMA 2K32A 4FF3A 1TWCB 3EJIA 1S5ED 5JVH3 3NQTA 4IZ8A 3V2TA 3OIQA 2WV6D 2XN9C 2WAQB 4DN4M 1JICA 4QB4A 3S15B 2E2IB 3SVMA 1EU3A 3I4NB 2DNEA 2KHSA 5KYIA 3LWUA 2EY2A 2LKVA 4DXGA 2EJFC 3L7ZC 3PMFA 3BG3A 4MHEA 4XTCS 1EY0A 4NKLA 4B08A 2BE5C 2PNRC 5LL6S 4IFDJ 1C48A 1HFNA 1A3TA 1A2UA 1L0YB 4IQZA 4H13C 2NVQB 3J81L 1EWCA 2NVTB 3PUXA 1TWFB 4FP5D 1EYDA 1SE3A 3VYUA 1SSOA 2BA0A 1F2MA 2DY7A 4IALA 1JQYD 3SE0A 1LT4D 1FR3A 4K5VA 3HOWB 2PO4A 1TVXA 5AFWA 1OO9B 2WKCA 4C3HB 3A56A 3I4MB 1EZ6A 2A6HD 4DAVA 1EY7A 2EYFA 1EY9A 1SJHD 2L12A 2R7ZB 1K83B 3R2IA 1WTPA 3SXHA 1EL0A 1LACA 2CW0C 1TY2A 4N9TA 4LAAA 2K1BA 3CU7A 2Q8RE 3H0GB 1CTMA 1KTKA 2ICIA 1IW7D 4G57A 3I73A 2V4DA 1ZKOA 4HCEA 1AN8A 4FF2A 1Y8PB 5JPMC 2LS01 1U4MA 2ZXOA 5IGBA 2B39A 4JBWA 4FXGC 1DJRD 3RMHA 1TS2A 4CKBA 1VF5C 4KV6A 4RKLA 2KOLA 3N6RA 4OIJA 3D4DA 1ICWA 5J22A 3PUWA 3HOVB 4RWSC 4KKSA 3S17B 3NTIA 3AB9A 2IJ0A 2JE6I 5K36H 1SXTA 3S14B 1O7ZA 4KHVA 3PO2B 3TDQA 3NK9A 4KMUC 3TP8A 4ZAIA 5HGTA 3Q6SA 1ESFA 4XIGS 1L0XB 3FKIB 2L5TA 2A68C 4KKTA 2HDLA 2MHVA 1QE6A 4B9WA 5CC4A 1F2ZA 3M7GA 4OO1I 3MXGA 3NBIA 1W6KA 3QOJA 2VNUD 5FO7B 3SR1A 3BYTB 1S5DD 3LNNA 1FNVA 5CORA 5M9OA 2PW5A 4TQUS 2A69C 3WOFA 1B1ZA 1F9SA 1II3A 1DYQA 4IUTA 1ZEQX 1DOKA 1V1OA 4X3UA 3NXWA 2BCOA 5C0XH 3C3LA 1PTOC 4BY1B 1KNAA 3PUYA 5LHY1 4IN3A 5EKLA 3BS1A 3X3NA 3I70A 1SYBA 4C3IG 1PRTB 4MN3A 3MAQA 1GOZA 1X3PA 2A5HA 1PZID 1B44D 2XWJB 4RFBA 3VR5A 2TSSA 4HEDA 1PLFA 2LMCB 3HKZB 3MVVA 1GHKA 4TSSA 1ESRA 1KLUD 1V1PB 3GD7A 4BA2I 2ZXPA 3OMGA 1MGSA 5C4HA 1E2WA 3TZUA 2NTSA 3H91A 1H9JA 2F3WA 4V190 1SNMA 1G291 3BDLA 3CRLC 1ILQA 2Z8LA 2VB2X 4Y7NB 5LL6X 5FLXL 1LO5D 1LLRD 1GUOA 2WB1B 4J1MA 3FRPB 3JAML 2MGSA 1LV9A 1HQMC 4DK0A 4PQXA 1LTSD 5DAUA 2KQ3A 5I6YA 4CBVA 3K5NA 2PMZB 2B2VA 3GTOB 4G4KA 1XX8A 4CJ2C 1PMRA 3AU7A 1GUTA 3QJYA 4NMZA 4CKEA 3N52A 4IUQA 4K8JA 4RKBA 3TZDA 5IODA 1B2TA 4A3JB 2WKDA 4OO1H 2N88A 4C3JB 1UEAB 2EVBA 3VR3A 1S5FD 5KYLA 5C3EB 1FD7D 4FO2A 1R4PB 4RHRA 1A2TA 2OF1A 2VUMB 5M3MB 4FNFA 1PZJD 1H9SB 3A54A 2NZ1D 5IIFA 2B63B 2K7VA 1CHQD 4R9WA 5IGGA 2R6GA 3K59A 2JA5B 2G9HD 2XVSA 1BR9A 3H6MA 2N55A 3JAME 4IFDI 2SEBD 1S5CD 5D65A 1DONA 3IFDA 4DK1A 3LX0A 4XQJA 1D2BA 2F0SA 3K6OA 1SYGA 3BDCA 3OOCA 2MPMA 2B2UC 4L8JA 1WTOA 2K5WA 3MEHA 5I2YA 1SAPA 1YNJC 4IUVA 3BZDB 1UUPA 3H09A 5M3FB 5E3FA 2X6LA 4XDXA 1SNDA 3S2DB 2F0QA 2LFNA 4H0LC 3KBXA 3TP7A 2F0VA 1PYWD 4IFDG 1F9PA 1CM9A 3MXPA 1CK1A 5FOBB 2WIIB 5NUCA 2Z4HA 1I4XA 3FEWX 3HG9A 1PTOH 1MBYA 4IURA 5EBCA 3DXJC 5EPKA 1STBA 2I07B 2JA8B 5JAVA 5JEAG 1TS4A 4P2CB 2NN6I 4RGOS 5J1ZA 2B2YA 1EQVA 2YYZA 3QB3A 3A7AB 1BQQT 2R3ZA 4GZYC 1IKMA 1QG7A 1DCZA 1MSGA 2Y0SB 4LJZC 1WTRA 5T1IA 3M7NA 2ZXRA 3DWQA 5IOCA 1HUNA 1VMCA 1H9KA 2NB0A 3E0JA 3OHXC 1HA6A 3D4RA 3RD4A 4PMCA 5KEEA 1Y8NB 2F0NA 2ICEC 5JJZA 1XYIA 1GJXA 5A2QL 3KBGA 4E6IA 3HOYB 1SEBD 3NUCA 3KK7A 5IGFA 2M00A 2OEOA 4G7ZC 4L6TB 1H9SA 1CZWA 1CFMA 2EDGA 2JXMB 2O2LD 3GTJB 2ENBA 3P7JA 4KJOA 3V96A 5JEAJ 1EYAA 3SK8A 1MD2D 4K5WA 3GTPB 5G3LD 1V1PA 2BDOA 4U68A 2B2TA 2D62A 3MA2B 2DNCA 4A3DB 3R8BA 2Z1CA 3OPOA 4ZLTF 1QNKA 5E4WC 3M3YB 5EPLA 4A3KB 1M8AA 4F88A 2F0DA 4WFN3 2X69A 2A74C 1U4LA 4CJ0B 2E2DC 2F1MA 1B4OA 5I4DA 5DNFA 4OO1G 1LT3D 2L9HA 3RZOB 2EY1A 3G6JB 2EPBA 3ZYYX 4LK1C 3DMUA 4F7XA 4HSPA 1WD1A 3K5OA 4KI0A 3HEJA 1BXTA 1SE2A 1U9RA 5IGDA 5K36G 2EOTA 2WINB 5JVG3 5E4XA 4DF7A 3NSWA 4LMQD 3EROA 1OXVA 4FVMA 2JSOA 2AUJD 1EFID 1PFBA 3DHQA 1OXUA 2F0FA 2E2JB 2B2TC 2CHBD 3NTHA 2K01A 5M5WB 2D9UA 3E6ZX 1YNND 1LABA 1E2ZA 2M9VA 1B53A 1Y8OB 1TS5A 1F9QA 1FNUA 2F0TA 1CT1D 4OL7A 1H9RA 1RODA 1DM0B 4DFAA 2JA7B 4H44C 4O42A 4KY7A 2EY5A 2K5QA 1BUVT 2E75C 2B8FA 1RTNA 5F2DA 2EJMA 4M8AA 1EY5A 3HP3A 1AW7A 3D6CA 1I4RA 4KTAA 4K2LA 1ET6A 5DM63 3K5LA 1TS3A 3S1MB 2PZUA 2O5JC 1ILPA 1Q3LA 2EYHA 1WTVA 4K6LA 4A93B 2QCPX 1Z6HA 2HDMA 3IKJA 1Y69U 2B2VC 1HXYD 4RGTA 5ELCA 2IL8A 1O7LA 2CQAA 4KN4C 3U9SA 5FO8B 1SNOA 4C1NK 1LTGD 1SBBB 1TIID 1CZGA 5EGTA 1IKLA 2QILA 5C0XI 1TWAB 2KCNA 1BCPB 4BBRB 1ZXTA 3VYSA 5KGUA 1JOKA 1Q1EA 1J9OA 1A15A 4DAPA 1EU4A 1BO0A 4ZKBB 5E1FA 4MIUA 4KK7A 3R3OA 4FXKC 4ZKCB 1LTRD 2A6ED 1SDFA 1SNQA 5DEHA 5CV7A 2A6HC 2OXPA 2E2HB 3AMUA 5C4XB 4KY5A 4KY6A 3NPPA 4QUFA 4KHZA 4HCSA 1F77A 1Z47A 4WRDA 2RDFA 4C3HG 2AQ1B 2EYJA 1IL8A 1I6VC 2KVMA 2F4IA 4F8MA 1EY8A 5KRUA 3FPUB 1UAPA 2RVLA 3Q22A 1SFOB 3BVMA 3MFYA 4K5XA 1HFGA 1DOMA 2R92B 4G7OC 1Q90A 1NCVA 4K8IA 5C3XA 3GO5A 1DXMA 1Z7TA 4A3IB 2F0LA 1HTPA 2A69D 2L55A 1M4VA 1GUSA 2K05A 1VMPA 5ELBA 4ZUJA 1C4QA 2F0OA 2IX1A 2NWGA 2NTTA 3PO3B 4J8QA 2F0PA 4ZYSA 2QDBA 3KLSX 3D8GA 4QCLA 3FMCA 3VA5A 2FJ2A 2IX3A 1BOSA 1HTLD 5JEAH 3H3VC 1TU2B 5C5MA 2ID0A 1Q12A 4KD4A 1ZYRD 3Q24A 2VXWA 4RCNA 3D6WA 2X6GA 4ILWA 5CYUA 4A3EB 1JOOA 4CGYB 1KABA 1STNA 2PPBC 5JPNC 3HRZC 3CKIB 2EJGC 2EYOA 1ENAA 2M2LA 3TSSA 4HR7B 5C4JB 5BN5A 3QWNA 4XYOA 1GHJA 3ND9A 4NW2A 1PTOF 2HQEA 1H9MA 4Z9CB 3NWTA 3HOXB 1HUMA 1KLGD 3NHHA 3M4OB 4TKOB 2Q8IB 4HAEA 5J39A 1MI2A 1GUGA 2A73B 3EA6A 3MC0B 3O13A 1Q8IA 3CHBD 5IT9E 1GUNA 3Q23A 4K6DA 1PTOD 3MHBA 1CA6A 2DN8A 3SK6A 1I3QB 4C3JG 2Q8TA 5G3LF 3SDZA 3T4AC 2SDFA 1OXSC 5EQ0A 2FMMA 2SNSA 2PYKA 1UNSA 2NN6H 4H7BA 1BBXC 4C3IB 2F0KA 2K5DA 1D5XC 3M85A 4B9XA 2KA7A 4AYBB 4XQNA 3QIAA 5EKIA 3GTGB 4DA2A 1IHZA 2KCCA 4DGZA 1I4HA 1XTCD 5CV6A 4O1NA 1SE4A 3VR6A 1U4RA 1EOTA 1PFMA 4RA8A 5KNDA 3ERQA 2KECA 3KF8A 5C6AA 4HMIA 3URYA 1SMYD 1TWHB 5EBDA 2K33A 1QNUA 1GXDC 1TY0A 4QIWB 2PCFB 1RDPD 2KUMA 1TWGB 2KEDA 2J0TD 1Q1BA 2B8GA 1V43A 2K28A 4V0BA 2GA4B 2E74C 1Y1WB 2EZVA 2OT2A 4EQNA 5EJWA 5CBAE 2XIWA 4RGMA 5A2QE 4UAIA 3GTKB 1E2VA 3IL8A 5KNBA 1FNWA 2E76C 4WORA 3GQBA 2EY6A 2L1BA 1JORA 3L3OC 2PW7A 3U9OA 1JC7A 5DM73 3HOZB 3NE5B 5I6WA 1SJED 3OW7A 3PV0A 2IWHA 1A6XA 4IUUA 1JE4A 4OIKA 2MP1A 2MJ8A 2QKIC 1ZYRC 4NP5A 1PXUA 2EYPA 1DOLA 1JB3A 3K0YA 3VYTA 4I7ZC 1BCPC 1STEA 1D6EC 2RQXA 1KDAA 3OIPA 4DXFA 4PV1C 4U673 2PZTA 1PTOB 2K03A 2RA4A 1Y1VB 3QOLA 1BCPF 4CJ1B 5T1GA 3NTKA 1PRTD 3EQLC 4ABNA 1TR5A 2TMPA 3EVQA 5IGEA 3BDOA 2JA6B 4G7HC 4DU9A 3I3CA 5CV9A 3VA7A 1V8QA 1YNJD 2J7ZA 4BS9A 1D5ZC 5I9OA 1LT6D 3PIP3 3LWEA 3W3AA 2R93B 4TRDA 2CVRA 3I90A 2F03A 1HA5A 3UI2A 4PMBA 1BNZA 5C3WA 3WOEA 1HRJA 3A7LA 5CGKA 3DEOA 1F9RA 3FPPA 1O78A 1AP0A 1EEFD 3J81E 3FVQA 2L0CA 1QOHA 1SYFA 1RHPA 4RCOA 1STYA 2BA1A 1SNCA 1NR4A 1X32A 2FHTA 3TBIB 4R8NA 2IPKD 1ENCA 3A8KE 3KLRA 1YNNC 3K5MA 2FFKB 1IW7C 1D5MC 1ML0D 2F0IA 4ID6A 3C1EA 4RH6A 2JYOA 3GTQB 1PDQA 1I4GA 1JCKB 3FDTA 2NYZD 1WCMB 3TN2A 2B2UA 3A55A 3T13A 1GUWA 4EVOA 5CV8A 1RJTA 1B9MA 2I46A 2PZWA 1R4QB 1D1IA 1F2LA 4XT3B 2QEJC 4ODGA 3TP5A 1G91A 3VR2A 4DNTB 3GV3A 1I50B 2F0JA 5C44B 1XXGA 4CKCA 3M4YA 4QF4A 5EPJA 2EYMA 3HOUB 1K8OA 2F0UA 1J8IA 5D3IB 1D1KA 3P1HA 3A8JE 1KNEA 5M5XB 1B9NA 1JWUD 4BY7B 2G9DA 5COYA 3D3RA 2RDHA 5CV5A 1CA5A 1BCPD 3PUVA 4BWGB 3W2DA 2RDGA 1PRTF 3K57A 1TT2A 3R93A 2F0WA 4KD3A 2J4XA 2EXZA 2BOSA 5K5PA 1LTID 4DAYA 1CHPD 2FINB 3CRKC 4UDUC 2HCCA 1KDCA 4EQPA 4ZUIA 3R2TA 5IGCA 3TMEA 2IW3A 5KIXA 3VYRA 4ZRZA 2FMCA 4DNRB 1QILA 2NUCA 3I72A 3DM1A 2AQ2B 4K2KA 1VF7A 3RLFA 1KDBA 5C5LA 3Q0AA 5C4ZA 3WDNA 1NUCA 5CR3A 4I65A 5D14A 1OXTA 1JWMD 3NWSA 3GP7A 2HCIA 2K6AA 3CQZB 1RCVD 2AWOA 1EY6A 1I4PA 4ZK9B 5BN4A 1O80A 1S5BD 3IAYA 2L4NA 4ME5A 2A6EC 1DD2A 1PZKD 1EWHA 5TSSA 2L11A 3P75A 3OSOA 2NN6G 1VCIA 1W6JA 2PQEA 1A3VA 2NBFA 3SK5A 2LY7A 2VB3X 1RF2D 5BN3A 5FKAC 3I4LA 4BBSB 4C56C 3C46A 4HTHA 3MZ5A 5FLXE 2KEEA 5I2XA 3BVGA 3PUZA 1WTQA 2JP1A 3MXUA 1HHVA 1X3QA 3MFGA 1QB5D 4WJWA 1OXXK 3T53B 4EGVA 1U4PA 1ENFA 4XXEA 1B50A 3RZDB 4RGNA 3C1FA 5ELEA 1EIGA 4A3FB 3KLSA 3HS0C 1FGBD 4KN7C 3MWYW 2K04A 5A35A 4ZQ3A 4HMJA 5KNCA 1SYEA 5ELDA 1EEID 1QWYA 4QUCA 1WTXA 3J7AF 3S1RB 3E5SA 4HN7A 3J80L 3NBHA 2IX0A 2XRSD 3NP8A 3MXNA 1KAAA 4QMGA 5EKKA 4C2MB 5IT9L 3T56B 1F2YA 5ELFA 1LT5D 1AZPA 4FF4A 1NR2A 4N9PA 1AFPA 1IYUA 3ITPA 4X3TA 5FO9B 4XQQA 1ONLA 4IFDH 1EZ8A 5CMDA 2NVXB 1K8MA 2B2YC 2O5IC 4BA1I 3P20A 3S1NB 3GV6A 1G2SA 4FF1A 1LTBD 2IT1A 3L9AX 1EY4A 3GTMB 2B2WA 2KJXA 4A3GB 4PMWA 5FK9C 1T5XD 3C2PA 3J7YW 2XSCA 3S2HB 2C9OA 2R61A 1QCBD 1TQOA 3J80E 4J6HA 1O7YA 2B2WC 2EE1A 1BF4A 3HGBA 2AWNA 4RHSA 3QO2A 4PNYA 1LTAD 4XYQA 2F0GA 1FYCA 2O4XA 1JWSD 1WD0A 3GTLB 4C1NI 3DUZA 2JEAI 2EYLA 4EQOA 3T51B 2RBMA 1C8CA 2D2CC 5M5YB 1JOQA 4X3SA 1I6HB 1ET9A 4JK1C 3ONAB 5JOBA 1EIHA 3HZXA 4RAUC 3MTSA 3S9WA 1JR0D 3S16B 3IFTA 2F0EA 1STAA 1STGA 2RSNA 4R8IA 4X3KA 2AQ3B 4A3BB 3RUZA 1EQTA 3F2UA 3BVZA 4IUNA 3DWPA 3OWFA 1BDOA 1NAPA 3K58A 4Q0FA 1MSHA 3I91A 2F0MA 1DZ1A 2QF7A 2JEBI 1IYVA 3D4WA 1CI3M 1PFNA 2D5DA 1WVLA 5ISRA 4A3MB 3S1QB 1VDZA 2XWBB 2BE5D 3V05A 1SYDA 3H94A 2Z4IA 4FXDA 4YIJA 3OWEB 4ULLA 2WACA 4F87A 3PIO3 5C0XJ 2A68D 1HPCA 1G2TA 4HSVA 1QJOA 3SEBA 4K14A 1A3UA 2SOBA 4OHJA 2YU9B 2HUGA 2WP8J 5HURA 2XRQD 1SYCA 1TKWB 5D3DA 5CV4A 3VR4A 1WTWA 4FYDA 1AZQA 3D31A 2MUYA 1CQFA 4Q5VA 3TP6A 1R9TB 3DEPA 2RKSA 1PRTC 3QG1A 1LTTD 1EYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB3 A;  5F2D A;  3P1H A;  2F0E A;  1EY0 A;  4PMB A;  4E6I A;  4NDX A;  1STH A;  4WRD A;  5C3W A;  2RDF A;  1STA A;  1STG A;  5IIF A;  3NHH A;  4NKL A;  4KV6 A;  4RKL A;  5CGK A;  5IGG A;  2EYJ A;  5J39 A;  1EY5 A;  3P75 A;  3OSO A;  3ITP A;  3OMG A;  4WOR A;  3D4D A;  3RUZ A;  2EY6 A;  5CV5 A;  3D6C A;  5J22 A;  1NSN S;  2F0D A;  3H6M A;  1A3T A;  1A2U A;  2PQE A;  4IUN A;  4KTA A;  4K2L A;  3OWF A;  3OMC A;  1EZ8 A;  1A3V A;  4F8M A;  1SYF A;  1EY8 A;  5C4H A;  5KRU A;  1JOR A;  2PZU A;  3SK5 A;  4K6D A;  2PW7 A;  3U9O A;  4K5X A;  2F0H A;  1STY A;  3MHB A;  3SK6 A;  1TT2 A;  2EYH A;  2F3W A;  4KHV A;  1SNC A;  4K8I A;  1SNP A;  3NK9 A;  5I6W A;  2F0W A;  3LX0 A;  3TP8 A;  1SNM A;  5C3X A;  4HTH A;  3MZ5 A;  2F0M A;  4KD3 A;  5IOC A;  4R8N A;  1EYD A;  2F0S A;  2SNS A;  1ENC A;  2PYK A;  3BDL A;  5HGT A;  3T16 A;  2EXZ A;  2EY1 A;  2F0L A;  3D4W A;  4KJN A;  1AEX A;  5K5P A;  1F2M A;  4H7B A;  1SYG A;  1EY4 A;  3BDC A;  3DMU A;  4F7X A;  2F0K A;  4IAL A;  4B9W A;  2F3V A;  5CC4 A;  4NP5 A;  4B9X A;  2EYP A;  1F2Z A;  4PMC A;  1KDC A;  4ZUJ A;  2F0I A;  3HEJ A;  5KEE A;  4J1M A;  4ID6 A;  4K5V A;  5ISR A;  4EQP A;  3C1E A;  4S3S A;  2F0O A;  4ZUI A;  1RKN A;  3QOJ A;  1SYD A;  1U9R A;  5IGD A;  3SR1 A;  5I9P A;  1SNO A;  2F0N A;  5M9O A;  5DAU A;  1TQO A;  5IGC A;  3TME A;  5KIX A;  2PW5 A;  3MEH A;  1IHZ A;  3SHL A;  2KQ3 A;  4J6H A;  3SK4 A;  4DF7 A;  5I6Y A;  1EZ6 A;  4DGZ A;  3C1F A;  3T13 A;  1EY7 A;  4YIJ A;  2F0P A;  2EYF A;  1II3 A;  2QDB A;  3ERO A;  2SNM A;  4DFA A;  2WAC A;  3NUC A;  5E3F A;  1KDA A;  3D8G A;  2NUC A;  5CV6 A;  1SND A;  1EY9 A;  5EGT A;  3VA5 A;  4EVO A;  5IGF A;  2PZT A;  2F0Q A;  2M00 A;  3EJI A;  4K2K A;  5CV8 A;  3NXW A;  3SXH A;  2OEO A;  3DHQ A;  2F0F A;  3NQT A;  4N9T A;  2F0V A;  4IZ8 A;  4NMZ A;  4PNY A;  3TP7 A;  3V2T A;  3QOL A;  4LAA A;  2PZW A;  4K14 A;  1KDB A;  1A3U A;  3ERQ A;  2SOB A;  5C5M A;  5C5L A;  4K8J A;  4ZQ3 A;  5KGU A;  3MXP A;  4HMJ A;  5C4Z A;  4QB4 A;  4RKB A;  4ODG A;  4HMI A;  5C6A A;  1SYE A;  2F0G A;  1NUC A;  5IOD A;  4KD4 A;  1TR5 A;  1JOK A;  5EKL A;  5NUC A;  5HUR A;  5CR3 A;  4I65 A;  3TP5 A;  1SYC A;  2O4X A;  3E5S A;  5E1F A;  3EVQ A;  5IGE A;  4MIU A;  1SYB A;  2ENB A;  4G57 A;  5CV4 A;  2F0T A;  2KHS A;  5KYL A;  2F0J A;  3R3O A;  4KJO A;  5KYI A;  1JOQ A;  2EYL A;  4OL7 A;  2EY2 A;  3NP8 A;  4DU9 A;  4EQO A;  1EY6 A;  1EYA A;  1KAA A;  2RBM A;  1JOO A;  2LKV A;  1SNQ A;  4QMG A;  1KAB A;  5DEH A;  5EKK A;  5CV9 A;  1STB A;  1STN A;  3SK8 A;  4K5W A;  1A2T A;  3TP6 A;  2OF1 A;  5JAV A;  3PMF A;  5CV7 A;  2OXP A;  5I9O A;  5IGB A;  4QF4 A;  5JOB A;  4KY7 A;  2EYO A;  3HZX A;  1ENA A;  1F2Y A;  2EY5 A;  2RKS A;  4KY5 A;  5J1Z A;  4KY6 A;  2EYM A;  4TRD A;  4EQN A;  2F0U A;  4ME5 A;  3S9W A;  3MVV A;  2HQE A;  4N9P A;  1EYC A;  1EQV A; 
#chains in the Genus database with same CATH topology
 4NDX A;  1STH A;  4P75 A;  2ZT9 C;  3EFX D;  3DWA A;  3ND8 A;  4CHT B;  4Y7N H;  3F8T A;  1WTH A;  2UUC Q;  4DR1 L;  3S17 H;  4L5R C;  2CW0 D;  5EAY A;  3HOY G;  1NSN S;  4L63 B;  1SMY C;  2Q2H A;  3I8Z A;  5C0X G;  2H1E A;  3OMC A;  2XNA C;  2C5C A;  2AUK A;  3A8I E;  1CQV A;  4JI7 Q;  2RSO A;  2F0H A;  1XWE A;  2E2H H;  1HCZ A;  2R93 H;  2NVY B;  1RD9 D;  2H4O A;  1SNP A;  5CBE E;  5AJ3 L;  1T5E A;  3G7L A;  4IUP A;  2K5N A;  1GVP A;  3T16 A;  3NQI A;  3BYY B;  4KJN A;  1AEX A;  2DY8 A;  2VQF L;  3J7A V;  2F3V A;  4OXP A;  3CC4 A;  4KKU A;  1B3A A;  1S4Z A;  4S3S A;  1G8Z D;  4I7A A;  1VQ5 A;  1RKN A;  2BDN A;  3K7A B;  3HOW H;  3X3M A;  4M1U B;  1PH3 A;  1IXR A;  5I9P A;  4OGQ C;  3KUP A;  4XT1 B;  3SHL A;  1E0B A;  3HOU G;  3SK4 A;  1M90 C;  1HNW Q;  1HQR D;  1XPR A;  2K5H A;  3FHW A;  1G6Z A;  1I4Q A;  1RTO A;  2OQK A;  2SNM A;  2K32 A;  3PCO B;  2UU9 Q;  4FF3 A;  1TWC B;  1SRU A;  3EJI A;  1S5E D;  5JVH 3;  3NQT A;  4IZ8 A;  3V2T A;  5IWA L;  4LF5 Q;  3OIQ A;  2DJF C;  1PH6 A;  2WV6 D;  5C4J H;  2XN9 C;  2WAQ B;  3K8A A;  4IPH A;  4DN4 M;  1JIC A;  4QB4 A;  1FL0 A;  3S15 B;  4JI8 L;  4X65 Q;  2E2I B;  3SVM A;  1EU3 A;  3I4N B;  3RZD H;  2BH2 A;  1Y14 B;  2DNE A;  2KHS A;  4DV7 Q;  4DV4 Q;  3AFQ A;  5KYI A;  3LWU A;  3UE1 A;  2EY2 A;  4LF9 Q;  2LKV A;  4DXG A;  4JI4 L;  3KFU A;  2EJF C;  3L7Z C;  4DR3 L;  3PMF A;  4JCV E;  1K9M C;  1YI2 A;  2NZO A;  1FJG L;  3BG3 A;  5H1S E;  3KF6 B;  4MHE A;  4KHP Q;  1A8V A;  1WCM G;  2L15 A;  4XTC S;  1EY0 A;  1SRO A;  3CPF A;  1IL2 A;  4NKL A;  4B08 A;  1IZ6 A;  2BE5 C;  1N36 L;  3U50 C;  2PNR C;  5LL6 S;  4A75 A;  2XTI A;  4IFD J;  3A74 A;  1C48 A;  1HFN A;  1A3T A;  1A2U A;  1L1O A;  1HJP A;  1L0Y B;  4IQZ A;  1YHB A;  4QL5 A;  3PGZ A;  4H13 C;  2NVQ B;  1LTL A;  2UUB Q;  3J81 L;  1Y1V G;  1EWC A;  2NVT B;  5ELN A;  4DV1 Q;  3PUX A;  4NXM L;  3M4O H;  4JC0 A;  3KOJ A;  4JV5 Q;  1TWF B;  4FP5 D;  4A3I H;  1EYD A;  3GTM H;  1SE3 A;  3VYU A;  1SSO A;  4DV6 L;  2BA0 A;  1F2M A;  2DY7 A;  4IAL A;  1FGU A;  5M3F H;  1JQY D;  4DUY L;  3SE0 A;  1LT4 D;  1FR3 A;  1IBM L;  4K5V A;  3HOW B;  2GVB A;  4J15 A;  3S1N H;  2LXK A;  3OW2 A;  2PO4 A;  1TVX A;  5AFW A;  4YWL A;  1OO9 B;  2WKC A;  4C3H B;  3A56 A;  1WFQ A;  2G5D A;  3I4M B;  1EZ6 A;  2A6H D;  4DAV A;  2UU9 L;  2Z6K C;  3TS2 A;  1EY7 A;  1NMF A;  1QZG A;  2EYF A;  1KRT A;  4ALP A;  1VQE A;  1EY9 A;  1E1T A;  1SJH D;  2L12 A;  2R7Z B;  3HOY H;  1K83 B;  3R2I A;  1WTP A;  3SXH A;  5GAG C;  1EL0 A;  1LAC A;  2CW0 C;  1TY2 A;  4N9T A;  4OWT B;  4DV3 Q;  4LAA A;  2K1B A;  1IYJ B;  3CU7 A;  2Q8R E;  3H0G B;  1Q7Y C;  1CTM A;  1KTK A;  2ICI A;  5IP9 G;  1IW7 D;  1Y1W H;  4A3I G;  4G57 A;  3E9I A;  5AJ3 Q;  3I73 A;  1E24 A;  2V4D A;  1ZKO A;  1YIT A;  1LM0 A;  1BBW A;  1EFW A;  4HCE A;  2R7Z H;  4O0A A;  1AN8 A;  4FF2 A;  1Y8P B;  5JPM C;  2LS0 1;  3J7A 5;  1U4M A;  2ZXO A;  3HOZ H;  5IGB A;  2B39 A;  5HGQ A;  1X54 A;  1AE2 A;  4JBW A;  4FXG C;  1DJR D;  3RMH A;  5BR8 L;  1TS2 A;  3KF6 A;  4CKB A;  1VF5 C;  4KV6 A;  4RKL A;  1XNQ Q;  4A3D H;  2KOL A;  3N6R A;  4OIJ A;  1PH4 A;  3D4D A;  1HZC A;  1ICW A;  5J22 A;  3PUW A;  3HOV B;  4RWS C;  4BY1 G;  4KKS A;  2R7Z G;  3S17 B;  3NTI A;  4EQ5 A;  3AB9 A;  2IJ0 A;  2Q2T A;  2JE6 I;  3E9H A;  5K36 H;  1SXT A;  2NVX H;  4UHV A;  3U58 A;  3S14 B;  1O7Z A;  4KHV A;  3PO2 B;  3TDQ A;  4GNX A;  3NK9 A;  5GAH C;  3G71 A;  1N32 L;  4KMU C;  3TP8 A;  1J5E L;  1XMO Q;  1QUQ A;  1VQP A;  2RHQ B;  4DUZ Q;  4JI2 Q;  4ZAI A;  5HGT A;  3Q6S A;  1ESF A;  4C3I H;  4XIG S;  1L0X B;  3UDI A;  2R7F A;  3FKI B;  3J80 i;  2L5T A;  2A68 C;  4KKT A;  2HDL A;  2MHV A;  4HIK A;  1QE6 A;  4B9W A;  5CC4 A;  1UE6 A;  1F2Z A;  3M7G A;  4OO1 I;  3MXG A;  3NBI A;  1W6K A;  3GTQ H;  3QOJ A;  2V1C C;  2VNU D;  5FO7 B;  3SR1 A;  3BYT B;  1MKH A;  1S5D D;  3LNN A;  1FNV A;  5COR A;  5M9O A;  3CPW A;  5C4X G;  2PW5 A;  4TQU S;  4NB3 A;  2A69 C;  1E7Z A;  3WOF A;  1B1Z A;  1S3O A;  1F9S A;  1CSQ A;  1II3 A;  3AYH B;  1PH9 A;  1DYQ A;  4IUT A;  1ZEQ X;  1N34 L;  1N36 Q;  1DOK A;  1V1O A;  4PZ7 A;  4X3U A;  4DR6 Q;  3J80 c;  3NXW A;  3AEV A;  5M5W H;  2BCO A;  5C0X H;  5LMU Q;  4GN4 B;  3VDY A;  1HNX Q;  3C3L A;  3HOV G;  1PTO C;  4BY1 B;  1VQG A;  1KNA A;  3PUY A;  4JBJ A;  5LHY 1;  4JBK A;  4IN3 A;  5EKL A;  4A3F H;  2AMC B;  3BS1 A;  3X3N A;  3I70 A;  1SYB A;  4C3I G;  1PRT B;  4MN3 A;  3MAQ A;  1GOZ A;  1X3P A;  2KHI A;  2A5H A;  1E1O A;  1PZI D;  4BY1 H;  3FKI G;  1B44 D;  4A3E H;  2XWJ B;  3I56 A;  4QJF A;  4RFB A;  1I94 Q;  3VR5 A;  3AQQ A;  2TSS A;  3DM3 A;  1PV4 A;  2R92 H;  3H3V I;  4HED A;  1PHJ A;  1PLF A;  2LMC B;  3HKZ B;  3MVV A;  1GHK A;  1HR0 L;  2Y0S E;  4TSS A;  1ESR A;  1KLU D;  5GAE C;  1V1P B;  4OWW B;  3GD7 A;  3LGJ A;  4BA2 I;  2ZXP A;  3OMG A;  4IJL A;  2I5M X;  1Q8K A;  1MGS A;  4A3B H;  1V9P A;  4DV0 Q;  2E5L L;  5C4H A;  1YHA A;  1E2W A;  3TZU A;  2NTS A;  2Z6K A;  2UXB L;  3H91 A;  1H9J A;  2F3W A;  2R7D A;  4V19 0;  4LF4 Q;  1SNM A;  1G29 1;  4DK6 C;  1JE5 A;  3BDL A;  3CRL C;  2PQA B;  1ILQ A;  2Z8L A;  4DV7 L;  2VB2 X;  3EBE A;  4Y7N B;  1RL2 A;  5LL6 X;  2VUM G;  5FLX L;  4L5Q A;  1LO5 D;  1J5E Q;  4R4I A;  1LLR D;  1W2B A;  1GUO A;  4JI2 L;  2WB1 B;  4J1M A;  3FRP B;  4FDB A;  1UE7 A;  3JAM L;  2MGS A;  1LV9 A;  1HQM C;  3CCM A;  4DK0 A;  4WJ3 M;  4PQX A;  1LTS D;  5DAU A;  2KQ3 A;  1EYG A;  1SLJ A;  5I6Y A;  4CBV A;  3K5N A;  2PMZ B;  2B2V A;  3GTO B;  4G4K A;  1BBU A;  1XX8 A;  4CJ2 C;  1PMR A;  3AU7 A;  3QR8 A;  4LFC Q;  1GUT A;  3QJY A;  4NMZ A;  4CKE A;  1MJE A;  3N52 A;  4LUO A;  4IUQ A;  4JYA Q;  2R92 G;  4K8J A;  3K81 C;  4RKB A;  3TZD A;  5IOD A;  4YCV A;  1B7Y B;  1B2T A;  1PA6 A;  2HD3 A;  2WKD A;  4A3J B;  2N88 A;  4C3J B;  1M1K C;  4OO1 H;  4JI0 Q;  1UEA B;  2EVB A;  3VR3 A;  1S5F D;  5KYL A;  5C3E B;  3CAM A;  1FD7 D;  4FO2 A;  1R4P B;  4DV6 Q;  4RHR A;  1A2T A;  3S1M H;  2OF1 A;  2VUM B;  1CSP A;  1E22 A;  4FNF A;  5FJ8 H;  5M3M B;  1PZJ D;  1H9S B;  2MFI A;  3A54 A;  2NZ1 D;  4B3S Q;  5LMN Q;  2N49 A;  5IIF A;  2B63 B;  2K7V A;  1CHQ D;  4R9W A;  5IGG A;  2DUD A;  2R6G A;  4O2D A;  3K59 A;  4HIO A;  2G9H D;  2JA5 B;  2XVS A;  1BR9 A;  1NBW A;  5IYB H;  3H6M A;  2N55 A;  3CMA A;  3JAM E;  4IFD I;  2SEB D;  1S5C D;  5D65 A;  1DON A;  3IFD A;  4NXN Q;  5M3M H;  3GTK H;  3HOX H;  4DK1 A;  5IP7 G;  3DLL A;  4GOP A;  1XPO A;  3LX0 A;  4XQJ A;  3G6E A;  4DKA C;  2HT1 A;  1CKN B;  1D2B A;  2F0S A;  3I4O A;  3K6O A;  2JA8 G;  3PF4 A;  1SYG A;  3BDC A;  3OOC A;  1C0A A;  1VQ7 A;  4X66 Q;  4JI8 Q;  2MPM A;  4X65 L;  2B2U C;  4AIM A;  2A19 A;  4DR5 Q;  1N33 Q;  4L8J A;  1WTO A;  2K5W A;  3MEH A;  5I2Y A;  1SAP A;  1YNJ C;  4GKK L;  4IUV A;  1VQC A;  1UUP A;  3BZD B;  2JK8 A;  3H09 A;  5M3F B;  1AE3 A;  5E3F A;  2X6L A;  4XDX A;  1SND A;  3S2D B;  2F0Q A;  2LFN A;  4H0L C;  3KBX A;  3TEH B;  3TP7 A;  3JAM c;  2JJQ A;  2F0V A;  1PYW D;  4IFD G;  1F9P A;  1CM9 A;  3MXP A;  1CK1 A;  5FOB B;  2WII B;  1H95 A;  5NUC A;  1S40 A;  2Z4H A;  1I4X A;  3FEW X;  3HG9 A;  2RCN A;  2UXD L;  1NNX A;  4YHH Q;  3S15 H;  1PTO H;  3UE0 A;  1MBY A;  1O7I A;  3I4N H;  2E2I H;  4IUR A;  3BJU A;  5EBC A;  3DXJ C;  1KAW A;  3I2Z A;  5EPK A;  1ASY A;  5IE8 A;  1STB A;  2I07 B;  4OX9 L;  2JA8 B;  5JAV A;  2FXQ A;  4POG A;  5JEA G;  3NEN A;  2Q2U A;  1TS4 A;  4P2C B;  4A3G G;  2NN6 I;  4RGO S;  4IPC A;  3PIO A;  5J1Z A;  3W5O A;  4HJ7 A;  1L2F A;  1LUZ A;  2B2Y A;  1EQV A;  2YYZ A;  3QB3 A;  3A7A B;  1BQQ T;  3EN2 A;  2R3Z A;  5IY0 A;  4JPB W;  1FVI A;  4GZY C;  1GO3 E;  3KJP A;  5M3F G;  1XNR L;  1IKM A;  3K7A H;  1QG7 A;  1DCZ A;  1MSG A;  2Y0S B;  4A3M H;  4L5T A;  4LJZ C;  1WTR A;  1JJC B;  4A3L G;  1PH1 A;  4YCW A;  5T1I A;  3M7N A;  2ZXR A;  3DWQ A;  5IOC A;  1HUN A;  4YHH L;  1VMC A;  5C44 G;  1CKO A;  1H9K A;  2NB0 A;  2A1A A;  4HJ5 A;  2JA6 G;  3E0J A;  3OHX C;  4LF6 Q;  1HA6 A;  3D4R A;  3RD4 A;  4HJ9 A;  4PMC A;  5KEE A;  4A4I A;  1Y8N B;  4KLK A;  1QUQ B;  1OTC A;  2F0N A;  2VW9 A;  4ME3 A;  2ICE C;  3I55 A;  3ULJ A;  5JJZ A;  1VQO A;  1X65 A;  1XYI A;  3I4M H;  1GJX A;  5A2Q L;  3KBG A;  4E6I A;  3HOY B;  1SEB D;  3NUC A;  3KK7 A;  5IYD G;  5IGF A;  2UUA L;  4GS3 A;  2M00 A;  1JJG A;  2PI2 A;  2OEO A;  1GM5 A;  2ZTD A;  3CCV A;  4G7Z C;  3HOZ G;  1TWA H;  1H9S A;  2HIX A;  4L6T B;  1CZW A;  2HHH Q;  1CFM A;  1J6Q A;  2EDG A;  2JXM B;  2O2L D;  5C3E H;  3CCJ A;  3GTJ B;  2ENB A;  3P7J A;  4KJO A;  1KC8 C;  2ZM6 L;  4R4T A;  3V96 A;  1VQK A;  5JEA J;  1EYA A;  2MO0 A;  1XPU A;  3SK8 A;  1MD2 D;  4K5W A;  2YTX A;  3GTP B;  5G3L D;  1V1P A;  3J7Z C;  2BDO A;  4U68 A;  2B2T A;  2D62 A;  3MA2 B;  2DNC A;  2HIV A;  4R4C A;  4A3D B;  3CF5 A;  3R8B A;  2Z1C A;  4DR4 Q;  3OPO A;  4YWM A;  1KRS A;  4ZLT F;  4B3M L;  2OTJ A;  1QNK A;  5E4W C;  3M3Y B;  5EPL A;  4A3K B;  1M8A A;  4IOC A;  2UUA Q;  4F88 A;  2F0D A;  4WFN 3;  2X69 A;  2A74 C;  1U4L A;  3F2D A;  4CJ0 B;  2E2D C;  2F1M A;  4HJA A;  3GTP H;  2IHF A;  2F4V Q;  1B4O A;  5I4D A;  5IP9 H;  3H0G G;  5DNF A;  3BZC A;  3CCR A;  4R4Q A;  4OO1 G;  1LT3 D;  2PQA A;  1X3F A;  2L9H A;  3STB C;  3RZO B;  1EOV A;  2ZM6 Q;  2EY1 A;  3G6J B;  2EPB A;  3ZYY X;  4LK1 C;  1N32 Q;  4OX9 Q;  3DMU A;  4F7X A;  2IHE A;  4HSP A;  1WD1 A;  3K5O A;  4KI0 A;  3HEJ A;  1BXT A;  3BU2 A;  1SE2 A;  2QEX A;  1U9R A;  1T9H A;  5IGD A;  5K36 G;  3S1Q H;  2EOT A;  2WIN B;  4P74 A;  5JVG 3;  2VZA A;  5E4X A;  2CWA A;  4DF7 A;  2NVT H;  4LNQ A;  3NSW A;  4LMQ D;  3ERO A;  4FVM A;  1OXV A;  2NZH A;  1RIP A;  2JSO A;  2AUJ D;  1EFI D;  1PFB A;  3DHQ A;  1OXU A;  2F0F A;  3KJO A;  3ULP A;  2E2J B;  2B2T C;  2CHB D;  3NTH A;  2K01 A;  5M5W B;  1HNW L;  2D9U A;  4MZ9 A;  1EQQ A;  3E6Z X;  1YNN D;  3H3V H;  1LAB A;  1E2Z A;  3UDG A;  2M9V A;  1B53 A;  1Y8O B;  1TS5 A;  4OEM B;  1F9Q A;  1FNU A;  2ZJQ A;  2KCM A;  2F0T A;  1CT1 D;  4OL7 A;  1H9R A;  1ROD A;  2JA8 H;  1DM0 B;  4DFA A;  1V1Q A;  2JA7 B;  4H44 C;  4O42 A;  4KY7 A;  2EY5 A;  1VQJ A;  2K5Q A;  1BUV T;  1KL9 A;  2B8F A;  2E75 C;  1XMQ L;  4GKJ L;  1RTN A;  5F2D A;  2EJM A;  4M8A A;  4P73 A;  2VQE L;  4LF8 L;  4A3F G;  5M5Y H;  1EY5 A;  4UP7 A;  2ASB A;  2D0P A;  1KIX A;  3HP3 A;  1AW7 A;  3D6C A;  1I4R A;  4BBR G;  4KTA A;  3W1B A;  4K2L A;  1ET6 A;  1XNQ L;  5DM6 3;  3BZK A;  3K5L A;  1TS3 A;  3S1M B;  2PZU A;  2O5J C;  3J81 i;  1ILP A;  1Q3L A;  1MJC A;  4OEL B;  2QA4 A;  2EYH A;  1WTV A;  5BR8 Q;  1BKB A;  4NPS A;  4EX5 A;  2RF4 A;  4H02 A;  1QVG A;  4K6L A;  1YHQ A;  2QCP X;  1EIF A;  1Z6H A;  4A93 B;  2HDM A;  5GRO A;  3IKJ A;  1Y69 U;  2B2V C;  1HXY D;  2CH4 W;  4RGT A;  5ELC A;  2YU9 H;  2IL8 A;  1O7L A;  2CQA A;  4KN4 C;  1HR0 W;  3PO2 H;  3U9S A;  5FO8 B;  1SNO A;  4C1N K;  4GOP B;  1W3S A;  1PFS A;  1LTG D;  4BY7 G;  1SBB B;  2CQO A;  1SR3 A;  4OON A;  3U4Z A;  2C35 B;  1TII D;  1CZG A;  5EGT A;  4Y52 H;  1IKL A;  3F2B A;  4QIW E;  3ICE A;  2E2J H;  4DPG A;  1X9N A;  2QIL A;  5C0X I;  1TWA B;  2KCN A;  4DAM A;  1BCP B;  2OTL A;  4BBR B;  1ZXT A;  3VYS A;  3PO2 G;  5KGU A;  4CDE C;  1JOK A;  1Q1E A;  1J9O A;  1A15 A;  4DAP A;  1EU4 A;  2PMZ E;  3GTG H;  1BO0 A;  4ZKB B;  2VS1 A;  1EQR A;  5E1F A;  4MIU A;  4LF7 L;  4KK7 A;  3R3O A;  3CD6 A;  4FXK C;  2QW7 A;  4ZKC B;  3NEM A;  2VUM H;  1LTR D;  2A6E D;  1SDF A;  1SNQ A;  5DEH A;  4JI0 L;  1K3B C;  5CV7 A;  2A6H C;  2OXP A;  3NEL A;  2MNA A;  2E2H B;  4JI7 L;  3AMU A;  5C4X B;  4JOI C;  3RLO A;  4KY5 A;  4KY6 A;  3NPP A;  4KHZ A;  4QUF A;  4HCS A;  2B63 H;  1F77 A;  1Z47 A;  4WRD A;  3KDF A;  2RDF A;  1VQB A;  1QVF A;  4C3H G;  3S14 H;  2AQ1 B;  2EYJ A;  1IL8 A;  1UE1 A;  4B3M Q;  5LMN L;  1I6V C;  2KVM A;  3K7U C;  2F4I A;  4F8M A;  4A3C G;  1EY8 A;  1A0I A;  5KRU A;  3FPU B;  1UAP A;  2RVL A;  3Q22 A;  1SFO B;  3BVM A;  3MFY A;  4K5X A;  4GKK Q;  1WYD A;  1HFG A;  1DOM A;  3H15 A;  2R92 B;  4G7O C;  1Q90 A;  2K5V A;  1NCV A;  1HR0 Q;  4K8I A;  3G48 A;  1B70 B;  5C3X A;  1L0W A;  3GO5 A;  1DXM A;  1Z7T A;  1PYS B;  4A3I B;  2F0L A;  1HTP A;  1Q82 C;  2A69 D;  2L55 A;  5L37 A;  1M4V A;  1GUS A;  4JV5 L;  2K05 A;  1VMP A;  5ELB A;  4ZUJ A;  1YJ9 A;  2GVA A;  1C4Q A;  2F0O A;  3OYY A;  2IX1 A;  2ATW A;  4DUZ L;  2NWG A;  2NTT A;  3A5U A;  4JI5 Q;  5M3M G;  4DR7 L;  3HOX G;  1C9O A;  3PO3 B;  4J8Q A;  1JT8 A;  4AQY L;  2F0P A;  3E3X A;  4ZYS A;  2QDB A;  3CP0 A;  1K83 H;  3KLS X;  3D8G A;  1K73 C;  4QCL A;  3FMC A;  3VA5 A;  2FJ2 A;  2IX3 A;  1NE3 A;  3TS0 A;  1YJW A;  1BOS A;  2JA6 H;  1HTL D;  5GQO A;  5JEA H;  3H3V C;  1TU2 B;  5C5M A;  1NY4 A;  3JAM i;  2ID0 A;  3GDE A;  1Q12 A;  4KD4 A;  4PZ8 A;  1NJI C;  1ZYR D;  3Q24 A;  1X56 A;  2VXW A;  3CQZ H;  4RCN A;  5FLM H;  2K52 A;  3D6W A;  2X6G A;  4ILW A;  4P72 A;  5CYU A;  3F2C A;  4A3E B;  1L1O C;  2WB1 G;  1JOO A;  4CGY B;  1VQ6 A;  1KAB A;  4UPA A;  1STN A;  2PPB C;  5JPN C;  4PZ6 A;  2Z6B A;  3HRZ C;  1D8L A;  3CKI B;  2EJG C;  2EYO A;  1ENA A;  2M2L A;  3TSS A;  5GAD C;  4HR7 B;  5C4J B;  5BN5 A;  3QWN A;  4A3L H;  1HZB A;  4XYO A;  3D0F A;  1GHJ A;  3ND9 A;  1CUK A;  4NW2 A;  2OQ0 A;  1PTO F;  2HQE A;  2LSS A;  1XJV A;  1H9M A;  4Z9C B;  3NWT A;  3HOX B;  1HUM A;  1KLG D;  3NHH A;  3M4O B;  4TKO B;  2Q8I B;  4HAE A;  2CKZ B;  5J39 A;  3PO3 G;  1MI2 A;  1GUG A;  2A73 B;  3EA6 A;  3MC0 B;  3O13 A;  5IYC H;  1Q8I A;  3CHB D;  5IT9 E;  1UEB A;  1GUN A;  3Q23 A;  4K6D A;  1PTO D;  3MHB A;  1CA6 A;  2DN8 A;  4A3J G;  3SK6 A;  1I3Q B;  4C3J G;  2Q8T A;  5G3L F;  4GLV B;  3SDZ A;  3T4A C;  2ES2 A;  2SDF A;  1OXS C;  5EQ0 A;  2FMM A;  2SNS A;  2PYK A;  3A5Z B;  1UNS A;  2NN6 H;  4H7B A;  1BBX C;  3RLN A;  4C3I B;  2F0K A;  2K5D A;  3CC7 A;  1D5X C;  3M85 A;  4B9X A;  3FKI H;  2KA7 A;  4AYB B;  1XMO L;  4XQN A;  3QIA A;  4DV0 L;  5EKI A;  4GLX A;  1WCM H;  4DV5 L;  3GTG B;  3RZO H;  1JB7 A;  2B63 G;  4DA2 A;  1IHZ A;  2KCC A;  4NXM Q;  4IO9 A;  4DGZ A;  1I4H A;  1XTC D;  1TWG H;  5JJL A;  4JI3 L;  5CV6 A;  2EQS A;  2KEN A;  4O1N A;  1SE4 A;  3VR6 A;  1U4R A;  2F52 A;  1I5F A;  1EOT A;  1PFM A;  4RA8 A;  2MQH A;  5KND A;  4UY8 C;  4B3S L;  1Q81 C;  3ERQ A;  2KEC A;  4DV2 L;  3KF8 A;  5C6A A;  4HMI A;  1C7Y A;  3URY A;  1SMY D;  1TWH B;  4R4O A;  2AHO B;  5EBD A;  3MXN B;  1A63 A;  2K33 A;  1QNU A;  1GXD C;  1TY0 A;  4QIW B;  3OTO L;  1FJG Q;  2PCF B;  2DGY A;  1RDP D;  5C44 H;  2KUM A;  2B29 A;  3TQY A;  1TWG B;  2KED A;  3RN2 A;  2J0T D;  1Q1B A;  3U4V A;  2QDL A;  2B8G A;  1V43 A;  4LWC A;  1GKH A;  3K0X A;  2JA9 A;  3KF8 B;  1Z9F A;  2K28 A;  3G4S A;  3HOV H;  3ERS X;  4V0B A;  2GA4 B;  2E74 C;  4LFA L;  1VQM A;  4A3M G;  4LF5 L;  1Y1W B;  2EZV A;  2OT2 A;  5ELO A;  5EJW A;  4EQN A;  5CBA E;  3H0G H;  2XIW A;  5C4X H;  1K3R A;  4RGM A;  5A2Q E;  4UAI A;  3GTK B;  1E2V A;  4DK3 C;  3IL8 A;  2K50 A;  2N78 A;  5KNB A;  1FNW A;  2E76 C;  4LUZ A;  4JI3 Q;  4WOR A;  3GQB A;  4CDC C;  2EY6 A;  4GNX B;  4DR4 L;  4MTN A;  4DR5 L;  2L1B A;  4QQB X;  1JOR A;  4GNX C;  3L3O C;  1I3Q H;  4APV A;  2PW7 A;  3U9O A;  1JC7 A;  5DM7 3;  3HOZ B;  3Q8D A;  3NE5 B;  5I6W A;  1SJE D;  3OW7 A;  3PV0 A;  2IWH A;  1A6X A;  4IUU A;  1JE4 A;  4OIK A;  2MP1 A;  4K0K Q;  2D0O A;  2JQO A;  1WJJ A;  2ZJR A;  2MJ8 A;  2QKI C;  1ZYR C;  4NP5 A;  1PXU A;  2EYP A;  1K28 A;  2KCT A;  1DOL A;  4IPG A;  3CCS A;  2Q2I A;  1JB3 A;  3KYH C;  3K0Y A;  3VYT A;  1Y1W G;  3CW2 C;  4I7Z C;  3M4P A;  1BCP C;  1STE A;  4X64 L;  4A3D G;  1D6E C;  2KBN A;  1KDA A;  2RQX A;  3OIP A;  4DXF A;  4PV1 C;  4U67 3;  2PZT A;  3GTO H;  1PTO B;  2K03 A;  2RA4 A;  1K8A C;  5IYC G;  1VQA A;  1Y1V B;  3QOL A;  1BCP F;  4CJ1 B;  5T1G A;  4P71 A;  3NTK A;  1PRT D;  3EQL C;  4ABN A;  1TR5 A;  4CDD C;  1JJ2 A;  2TMP A;  1D7Q A;  2HQL A;  3EVQ A;  5IGE A;  1IBL L;  1WI5 A;  3BDO A;  4B3R L;  4DR2 Q;  2JA6 B;  1XTD A;  3TRZ A;  3GTL H;  4G7H C;  4DU9 A;  1HH2 P;  3AFP A;  3RNU A;  3I3C A;  1YZ6 A;  5CV9 A;  1Q46 A;  3VA7 A;  1V8Q A;  1YNJ D;  2J7Z A;  4BS9 A;  1SFO H;  1D5Z C;  5I9O A;  2HHH L;  1HZ9 A;  1LT6 D;  3PIP 3;  4DV1 L;  3LWE A;  1KHI A;  3IRB A;  1YNX A;  3W3A A;  2R93 B;  1ASZ A;  4TRD A;  1SE8 A;  2CVR A;  3I90 A;  2F03 A;  4IOA A;  1HA5 A;  3UI2 A;  4PMB A;  1BNZ A;  5C3W A;  3WOE A;  1HRJ A;  3S24 A;  2K4K A;  3A7L A;  5CGK A;  3DEO A;  1F9R A;  4RMF A;  3FPP A;  1O78 A;  5M5X H;  1Q86 C;  1G51 A;  1AP0 A;  1EEF D;  3J81 E;  3FVQ A;  2L0C A;  3HFZ B;  4L5S A;  1QOH A;  1SYF A;  3A0J A;  1RHP A;  1R9T H;  2LXJ A;  4LUV A;  4RCO A;  1STY A;  1L1O B;  2BA1 A;  2WAQ G;  3S2H H;  1SNC A;  4DAY B;  4AH6 A;  1NR4 A;  1X32 A;  2FHT A;  4TVA B;  3TBI B;  4DR2 L;  4R8N A;  2IPK D;  1ENC A;  3A8K E;  3KLR A;  1YNN C;  2VY3 A;  4GN3 B;  3I4N G;  4YY3 L;  1AH9 A;  3K5M A;  2FFK B;  1IW7 C;  1VQH A;  4RG1 A;  1D5M C;  5E7N A;  1ML0 D;  2F0I A;  4ID6 A;  2MO1 A;  3C1E A;  4RH6 A;  2JA7 G;  3STB D;  3CCE A;  2JYO A;  1VQF A;  1YBY A;  3GTQ B;  1PDQ A;  1YJN A;  4LF4 L;  2R93 G;  1I4G A;  1JCK B;  3FDT A;  2NYZ D;  1WCM B;  3TN2 A;  2B2U A;  4A3K G;  3A55 A;  3T13 A;  1YIJ A;  1YVC A;  1GUW A;  3KDF B;  4JI1 Q;  4EVO A;  5CV8 A;  1RJT A;  3J81 c;  4X64 Q;  1LYL A;  1B9M A;  2I46 A;  2PZW A;  1R4Q B;  1D1I A;  4C2M H;  1F2L A;  4XT3 B;  2QEJ C;  4ODG A;  2K75 A;  1PVO A;  3TP5 A;  1G91 A;  3HOU H;  3VR2 A;  4DNT B;  3GV3 A;  4K0K L;  3ZJY C;  3K80 C;  3S1R H;  1I50 B;  2GN5 A;  1PH8 A;  2F0J A;  1DGS A;  4A93 G;  2QGQ A;  5C44 B;  1XXG A;  4CKC A;  3M4Y A;  4QF4 A;  5EPJ A;  2EYM A;  3HOU B;  3HOW G;  1K8O A;  2F0U A;  1J8I A;  5D3I B;  1TWF H;  1D1K A;  3P1H A;  3A8J E;  1KNE A;  5M5X B;  1B9N A;  1JWU D;  2ZTE A;  5FLM G;  4BY7 B;  2G9D A;  5COY A;  4AQY Q;  1CKN A;  3I4M G;  3GTJ H;  1VQ9 A;  4X62 L;  2IY5 B;  3D3R A;  2RDH A;  5CV5 A;  4MTK A;  1CA5 A;  4DR7 Q;  1BCP D;  3CME A;  3PUV A;  4BWG B;  3W2D A;  3S16 H;  5FJ8 G;  2RDG A;  1PRT F;  3K57 A;  1YEZ A;  3ER0 A;  4GKJ Q;  1TT2 A;  3KLW A;  4KHP L;  2VQE Q;  3R93 A;  1U0L A;  2F0W A;  1K8G A;  1VQD A;  1IBK Q;  4KD3 A;  2J4X A;  1KQS A;  3M9B A;  2EXZ A;  1KXL A;  3CC2 A;  4A76 A;  2BOS A;  5K5P A;  1LTI D;  4DAY A;  3TRE A;  1X3G A;  1CHP D;  2FIN B;  3CRK C;  4UDU C;  2HCC A;  1KDC A;  4EQP A;  4NXN L;  3PF5 A;  4ZUI A;  3R2T A;  5IGC A;  3TME A;  2IW3 A;  5KIX A;  3CCL A;  3VYR A;  4ZRZ A;  2CH4 A;  2FMC A;  4DNR B;  1QIL A;  5IWA Q;  2UXC L;  2NUC A;  1HNX L;  3I72 A;  3DM1 A;  2AQ2 B;  4K2K A;  1VF7 A;  3RLF A;  1KDB A;  1VQ4 A;  4A3G H;  2UXC Q;  5C5L A;  2PI2 E;  3Q0A A;  5DLQ E;  5C4Z A;  3WDN A;  5JJI A;  4BBS G;  1NUC A;  3WWV A;  4GLA C;  5CR3 A;  4I65 A;  5D14 A;  1K0S A;  1OXT A;  1JWM D;  4N8X 1;  3NWS A;  4C3H H;  1NTG A;  3PSI A;  3GP7 A;  2HCI A;  4DR3 Q;  2K6A A;  3CQZ B;  1X3E A;  4WJ4 A;  1RCV D;  2AWO A;  1EY6 A;  2K14 A;  2CCZ A;  1I4P A;  1QZH A;  4ZK9 B;  3CCQ A;  5BN4 A;  4A3C H;  1O80 A;  1S5B D;  3IAY A;  2L4N A;  4IPD A;  4ME5 A;  4MNO A;  1EIY B;  2A6E C;  1DD2 A;  1PZK D;  2OCE A;  1N8R C;  3M3Y H;  2ZTC A;  1EWH A;  5TSS A;  2L11 A;  3P75 A;  3OSO A;  2NN6 G;  1VCI A;  1W6J A;  3JC6 6;  5IYD H;  1E3P A;  3L0O A;  2PQE A;  1ICF B;  1A3V A;  2NBF A;  3SK5 A;  4HID A;  1NMG A;  2LY7 A;  2VB3 X;  1RF2 D;  1SN8 A;  5BN3 A;  2ZJP A;  5HY6 A;  5FKA C;  3I4L A;  5IT9 c;  4BBS B;  4C56 C;  3C46 A;  2AKW B;  4X66 L;  4HTH A;  3MZ5 A;  2VQF Q;  1N9W A;  5FLX E;  2KEE A;  5I2X A;  4HIM A;  3BVG A;  3PUZ A;  1WTQ A;  2JP1 A;  1KD1 C;  3MXU A;  1G6P A;  1HHV A;  1X3Q A;  2JN4 A;  4LFB Q;  2KHJ A;  3MFG A;  1QB5 D;  1JMC A;  4WJW A;  5LMN W;  2E5L Q;  1EUJ A;  1OXX K;  1Y1V H;  3OTO Q;  3T53 B;  1PH5 A;  4EGV A;  1U4P A;  4C3J H;  4JBM A;  1ENF A;  4XXE A;  1B50 A;  3RZD B;  4RGN A;  1PH7 A;  3HKZ G;  1UE5 A;  4JYA L;  3RR5 A;  2JA5 G;  3SGI A;  3C1F A;  5ELE A;  1UWV A;  1EIG A;  4A3F B;  3KLS A;  5IYB G;  3HS0 C;  4X62 Q;  1FGB D;  3S2D H;  4KN7 C;  3MWY W;  4JI1 L;  2K04 A;  1TWH H;  4ZQ3 A;  4JI5 L;  5A35 A;  3HKS A;  4HMJ A;  4BXX G;  5KNC A;  1SYE A;  4UP8 A;  2YTY A;  4JI4 Q;  2XGT A;  1EEI D;  5ELD A;  1QWY A;  4QUC A;  1WTX A;  4LF9 L;  4QGU A;  1QVC A;  3J7A F;  3S1R B;  2ALY B;  2Z9H A;  2Z0S A;  3E5S A;  4HN7 A;  3J80 L;  2JA5 H;  5FLX c;  3NBH A;  3EIV A;  1GD7 A;  1BVS A;  2IX0 A;  2PNH A;  2XRS D;  3NP8 A;  3MXN A;  1WOC A;  1KAA A;  4YY3 Q;  4LFB L;  4DUY Q;  4QMG A;  5EKK A;  4C2M B;  1X6O A;  5IT9 L;  4CDF C;  3T56 B;  4YCU A;  1F2Y A;  5ELF A;  1LT5 D;  1AZP A;  4FF4 A;  1NR2 A;  4OWX B;  4N9P A;  1AFP A;  2UUC L;  3FP9 A;  3M4Q A;  1IYU A;  1K0R A;  2NVY H;  3T1H L;  2OWO A;  3ITP A;  4X3T A;  5FO9 B;  4XQQ A;  4ZCK A;  4B3T Q;  1ONL A;  4IFD H;  1EZ8 A;  2I5L X;  5CMD A;  1EWI A;  2NVX B;  1K8M A;  2B2Y C;  2O5I C;  4BA1 I;  3CCU A;  3P20 A;  2NVQ H;  3S1N B;  1SMX A;  3GV6 A;  1G2S A;  4FF1 A;  1PYB A;  1LTB D;  4JG2 A;  2IT1 A;  3L9A X;  1PH2 A;  1EY4 A;  4A93 H;  3GTM B;  3I7F A;  1B8A A;  2B2W A;  2I0Q A;  2KJX A;  4A3G B;  4PMW A;  4POF A;  5FK9 C;  1T5X D;  3CXC A;  3C2P A;  3J7Y W;  2XSC A;  3S2H B;  2C9O A;  1IBL Q;  2R61 A;  2UXD Q;  1TXY A;  2UXB Q;  1QCB D;  1TQO A;  2CWP A;  3J80 E;  4DV3 L;  1X55 A;  4J6H A;  2I5H A;  2UUB L;  2DJG C;  1O7Y A;  4LFC L;  4DNI A;  4R1J A;  4JW0 A;  3T1H Q;  2B2W C;  2EE1 A;  3L2P A;  3NBH B;  1BF4 A;  3HGB A;  2AWN A;  3UDX A;  4RHS A;  3F1Z A;  3QO2 A;  1P16 A;  1CKM A;  4PNY A;  2Y0S G;  4LFA Q;  1LTA D;  2A8V A;  4GOP C;  1XMQ Q;  4XYQ A;  2JA7 H;  4IJH A;  2F0G A;  2N8N A;  1IBM Q;  1FYC A;  2O4X A;  1JWS D;  3HKZ E;  1WD0 A;  4C1N I;  3GTL B;  3DUZ A;  4JI6 Q;  2JEA I;  3PIP A;  1U5K A;  4JVZ A;  4N8F A;  3T1Y Q;  4AYB E;  2EYL A;  2YTV A;  4EQO A;  3J81 j;  4HJ8 A;  2B3G A;  4AYB G;  3T51 B;  2RBM A;  1C8C A;  2D2C C;  5M5Y B;  1JOQ A;  4X3S A;  1I6H B;  1TWC H;  5JJK A;  1ET9 A;  2WAQ E;  4B3R Q;  4JK1 C;  4DV2 Q;  1MHW C;  3ONA B;  5JOB A;  1EIH A;  3HZX A;  4RAU C;  1VQI A;  4LF7 Q;  3MTS A;  3S9W A;  1JR0 D;  3S16 B;  3IFT A;  1I50 H;  2F0E A;  1VQL A;  1HNZ L;  1STA A;  1STG A;  1A62 A;  1XNR Q;  2RSN A;  4R8I A;  4X3K A;  2AQ3 B;  4B3T L;  4A3B B;  3RUZ A;  1EQT A;  3RN5 A;  3F2U A;  3BVZ A;  4IUN A;  3DWP A;  1HNZ Q;  3OWF A;  5J3B A;  4DV5 Q;  4UP9 A;  1BDO A;  1NAP A;  4BXX H;  2H5X A;  3MEF A;  1VQ8 A;  2P5Z X;  3K58 A;  4LF6 L;  1N33 L;  4JOI A;  4Q0F A;  1MSH A;  2N3S A;  1P8L A;  3I91 A;  5C3E G;  4DV4 L;  2F0M A;  2E8G A;  3W1G A;  1DZ1 A;  2QF7 A;  2JEB I;  1S72 A;  4JI6 L;  1IYV A;  3T1Y L;  1VS0 A;  3D4W A;  2RHS B;  1CI3 M;  1PFN A;  2D5D A;  4A3E G;  1WVL A;  4BBR H;  1HZA A;  5ISR A;  4A3M B;  3S1Q B;  3PQI A;  1VDZ A;  2XWB B;  1IBK L;  2BE5 D;  3V05 A;  1SYD A;  3ULL A;  4GN5 A;  3B6Y A;  4BY7 H;  3UDF A;  3H94 A;  2Z4I A;  2YV5 A;  5IP7 H;  5LMU L;  4DR6 L;  1N34 Q;  4FXD A;  4YIJ A;  1B3Q A;  3OWE B;  4ULL A;  2RCF A;  2WAC A;  4F87 A;  3PIO 3;  3PO3 H;  5C0X J;  2A68 D;  1HPC A;  1G2T A;  2WB1 E;  4DR1 Q;  4X6A H;  3E0E A;  4A3B G;  4HSV A;  1QJO A;  4LW1 A;  3SEB A;  4K14 A;  2WFW A;  1A3U A;  2EXD A;  2SOB A;  4OHJ A;  2YU9 B;  2HUG A;  4A3J H;  2WP8 J;  4LF8 Q;  5HUR A;  2XRQ D;  1SYC A;  2EIF A;  1TKW B;  5D3D A;  4A3K H;  1MIU A;  5CV4 A;  3VR4 A;  1WTW A;  2F3I A;  2BH8 A;  4FYD A;  1VQN A;  1I94 L;  1AZQ A;  3D31 A;  2MUY A;  1CQF A;  4PG3 A;  4Q5V A;  3TP6 A;  1R9T B;  2VL6 A;  3DEP A;  4YWK A;  1I6H H;  2F4V L;  4QY7 A;  2CFM A;  2RKS A;  1PRT C;  4BBS H;  3QG1 A;  1LTT D;  1EYC A; 
#chains in the Genus database with same CATH homology
 4NDX A;  1STH A;  2ZT9 C;  3EFX D;  3DWA A;  3ND8 A;  4CHT B;  2CW0 D;  1NSN S;  4L63 B;  1SMY C;  3I8Z A;  5C0X G;  2H1E A;  3OMC A;  2XNA C;  2C5C A;  2AUK A;  3A8I E;  1CQV A;  2RSO A;  2F0H A;  1XWE A;  1HCZ A;  2NVY B;  1RD9 D;  2H4O A;  1SNP A;  5CBE E;  1T5E A;  3G7L A;  4IUP A;  3T16 A;  3NQI A;  3BYY B;  4KJN A;  1AEX A;  2DY8 A;  3J7A V;  2F3V A;  4KKU A;  1B3A A;  1S4Z A;  4S3S A;  1G8Z D;  1RKN A;  2BDN A;  3K7A B;  3X3M A;  4M1U B;  5I9P A;  4OGQ C;  3KUP A;  4XT1 B;  3SHL A;  1E0B A;  3SK4 A;  1HQR D;  1G6Z A;  1I4Q A;  1RTO A;  2SNM A;  2K32 A;  4FF3 A;  1TWC B;  3EJI A;  1S5E D;  5JVH 3;  3NQT A;  4IZ8 A;  3V2T A;  3OIQ A;  2WV6 D;  2XN9 C;  2WAQ B;  4DN4 M;  1JIC A;  4QB4 A;  3S15 B;  2E2I B;  3SVM A;  1EU3 A;  3I4N B;  2DNE A;  2KHS A;  5KYI A;  3LWU A;  2EY2 A;  2LKV A;  4DXG A;  2EJF C;  3L7Z C;  3PMF A;  3BG3 A;  4MHE A;  4XTC S;  1EY0 A;  4NKL A;  4B08 A;  2BE5 C;  2PNR C;  5LL6 S;  4IFD J;  1C48 A;  1HFN A;  1A3T A;  1A2U A;  1L0Y B;  4IQZ A;  4H13 C;  2NVQ B;  3J81 L;  1EWC A;  2NVT B;  3PUX A;  1TWF B;  4FP5 D;  1EYD A;  1SE3 A;  3VYU A;  1SSO A;  2BA0 A;  1F2M A;  2DY7 A;  4IAL A;  1JQY D;  3SE0 A;  1LT4 D;  1FR3 A;  4K5V A;  3HOW B;  2PO4 A;  1TVX A;  5AFW A;  1OO9 B;  2WKC A;  4C3H B;  3A56 A;  3I4M B;  1EZ6 A;  2A6H D;  4DAV A;  1EY7 A;  2EYF A;  1EY9 A;  1SJH D;  2L12 A;  2R7Z B;  1K83 B;  3R2I A;  1WTP A;  3SXH A;  1EL0 A;  1LAC A;  2CW0 C;  1TY2 A;  4N9T A;  4LAA A;  2K1B A;  3CU7 A;  2Q8R E;  3H0G B;  1CTM A;  1KTK A;  2ICI A;  1IW7 D;  4G57 A;  3I73 A;  2V4D A;  1ZKO A;  4HCE A;  1AN8 A;  4FF2 A;  1Y8P B;  5JPM C;  2LS0 1;  1U4M A;  2ZXO A;  5IGB A;  2B39 A;  4JBW A;  4FXG C;  1DJR D;  3RMH A;  1TS2 A;  4CKB A;  1VF5 C;  4KV6 A;  4RKL A;  2KOL A;  3N6R A;  4OIJ A;  3D4D A;  1ICW A;  5J22 A;  3PUW A;  3HOV B;  4RWS C;  4KKS A;  3S17 B;  3NTI A;  3AB9 A;  2IJ0 A;  2JE6 I;  5K36 H;  1SXT A;  3S14 B;  1O7Z A;  4KHV A;  3PO2 B;  3TDQ A;  3NK9 A;  4KMU C;  3TP8 A;  4ZAI A;  5HGT A;  3Q6S A;  1ESF A;  4XIG S;  1L0X B;  3FKI B;  2L5T A;  2A68 C;  4KKT A;  2HDL A;  2MHV A;  1QE6 A;  4B9W A;  5CC4 A;  1F2Z A;  3M7G A;  4OO1 I;  3MXG A;  3NBI A;  1W6K A;  3QOJ A;  2VNU D;  5FO7 B;  3SR1 A;  3BYT B;  1S5D D;  3LNN A;  1FNV A;  5COR A;  5M9O A;  2PW5 A;  4TQU S;  2A69 C;  3WOF A;  1B1Z A;  1F9S A;  1II3 A;  1DYQ A;  4IUT A;  1ZEQ X;  1DOK A;  1V1O A;  4X3U A;  3NXW A;  2BCO A;  5C0X H;  3C3L A;  1PTO C;  4BY1 B;  1KNA A;  3PUY A;  5LHY 1;  4IN3 A;  5EKL A;  3BS1 A;  3X3N A;  3I70 A;  1SYB A;  4C3I G;  1PRT B;  4MN3 A;  3MAQ A;  1GOZ A;  1X3P A;  2A5H A;  1PZI D;  1B44 D;  2XWJ B;  4RFB A;  3VR5 A;  2TSS A;  4HED A;  1PLF A;  2LMC B;  3HKZ B;  3MVV A;  1GHK A;  4TSS A;  1ESR A;  1KLU D;  1V1P B;  3GD7 A;  4BA2 I;  2ZXP A;  3OMG A;  1MGS A;  5C4H A;  1E2W A;  3TZU A;  2NTS A;  3H91 A;  1H9J A;  2F3W A;  4V19 0;  1SNM A;  1G29 1;  3BDL A;  3CRL C;  1ILQ A;  2Z8L A;  2VB2 X;  4Y7N B;  5LL6 X;  5FLX L;  1LO5 D;  1LLR D;  1GUO A;  2WB1 B;  4J1M A;  3FRP B;  3JAM L;  2MGS A;  1LV9 A;  1HQM C;  4DK0 A;  4PQX A;  1LTS D;  5DAU A;  2KQ3 A;  5I6Y A;  4CBV A;  3K5N A;  2PMZ B;  2B2V A;  3GTO B;  4G4K A;  1XX8 A;  4CJ2 C;  1PMR A;  3AU7 A;  1GUT A;  3QJY A;  4NMZ A;  4CKE A;  3N52 A;  4IUQ A;  4K8J A;  4RKB A;  3TZD A;  5IOD A;  1B2T A;  4A3J B;  2WKD A;  4OO1 H;  2N88 A;  4C3J B;  1UEA B;  2EVB A;  3VR3 A;  1S5F D;  5KYL A;  5C3E B;  1FD7 D;  4FO2 A;  1R4P B;  4RHR A;  1A2T A;  2OF1 A;  2VUM B;  5M3M B;  4FNF A;  1PZJ D;  1H9S B;  3A54 A;  2NZ1 D;  5IIF A;  2B63 B;  2K7V A;  1CHQ D;  4R9W A;  5IGG A;  2R6G A;  3K59 A;  2JA5 B;  2G9H D;  2XVS A;  1BR9 A;  3H6M A;  2N55 A;  3JAM E;  4IFD I;  2SEB D;  1S5C D;  5D65 A;  1DON A;  3IFD A;  4DK1 A;  3LX0 A;  4XQJ A;  1D2B A;  2F0S A;  3K6O A;  1SYG A;  3BDC A;  3OOC A;  2MPM A;  2B2U C;  4L8J A;  1WTO A;  2K5W A;  3MEH A;  5I2Y A;  1SAP A;  1YNJ C;  4IUV A;  3BZD B;  1UUP A;  3H09 A;  5M3F B;  5E3F A;  2X6L A;  4XDX A;  1SND A;  3S2D B;  2F0Q A;  2LFN A;  4H0L C;  3KBX A;  3TP7 A;  2F0V A;  1PYW D;  4IFD G;  1F9P A;  1CM9 A;  3MXP A;  1CK1 A;  5FOB B;  2WII B;  5NUC A;  2Z4H A;  1I4X A;  3FEW X;  3HG9 A;  1PTO H;  1MBY A;  4IUR A;  5EBC A;  3DXJ C;  5EPK A;  1STB A;  2I07 B;  2JA8 B;  5JAV A;  5JEA G;  1TS4 A;  4P2C B;  2NN6 I;  4RGO S;  5J1Z A;  2B2Y A;  1EQV A;  2YYZ A;  3QB3 A;  3A7A B;  1BQQ T;  2R3Z A;  4GZY C;  1IKM A;  1QG7 A;  1DCZ A;  1MSG A;  2Y0S B;  4LJZ C;  1WTR A;  5T1I A;  3M7N A;  2ZXR A;  3DWQ A;  5IOC A;  1HUN A;  1VMC A;  1H9K A;  2NB0 A;  3E0J A;  3OHX C;  1HA6 A;  3D4R A;  3RD4 A;  4PMC A;  5KEE A;  1Y8N B;  2F0N A;  2ICE C;  5JJZ A;  1XYI A;  1GJX A;  5A2Q L;  3KBG A;  4E6I A;  3HOY B;  1SEB D;  3NUC A;  3KK7 A;  5IGF A;  2M00 A;  2OEO A;  4G7Z C;  4L6T B;  1H9S A;  1CZW A;  1CFM A;  2EDG A;  2JXM B;  2O2L D;  3GTJ B;  2ENB A;  3P7J A;  4KJO A;  3V96 A;  5JEA J;  1EYA A;  3SK8 A;  1MD2 D;  4K5W A;  3GTP B;  5G3L D;  1V1P A;  2BDO A;  4U68 A;  2B2T A;  2D62 A;  3MA2 B;  2DNC A;  4A3D B;  3R8B A;  2Z1C A;  3OPO A;  4ZLT F;  1QNK A;  5E4W C;  3M3Y B;  5EPL A;  4A3K B;  1M8A A;  4F88 A;  2F0D A;  4WFN 3;  2X69 A;  2A74 C;  1U4L A;  4CJ0 B;  2E2D C;  2F1M A;  1B4O A;  5I4D A;  5DNF A;  4OO1 G;  1LT3 D;  2L9H A;  3RZO B;  2EY1 A;  3G6J B;  2EPB A;  3ZYY X;  4LK1 C;  3DMU A;  4F7X A;  4HSP A;  1WD1 A;  3K5O A;  4KI0 A;  3HEJ A;  1BXT A;  1SE2 A;  1U9R A;  5IGD A;  5K36 G;  2EOT A;  2WIN B;  5JVG 3;  5E4X A;  4DF7 A;  3NSW A;  4LMQ D;  3ERO A;  1OXV A;  4FVM A;  2JSO A;  2AUJ D;  1EFI D;  1PFB A;  3DHQ A;  1OXU A;  2F0F A;  2E2J B;  2B2T C;  2CHB D;  3NTH A;  2K01 A;  5M5W B;  2D9U A;  3E6Z X;  1YNN D;  1LAB A;  1E2Z A;  2M9V A;  1B53 A;  1Y8O B;  1TS5 A;  1F9Q A;  1FNU A;  2F0T A;  1CT1 D;  4OL7 A;  1H9R A;  1ROD A;  1DM0 B;  4DFA A;  2JA7 B;  4H44 C;  4O42 A;  4KY7 A;  2EY5 A;  2K5Q A;  1BUV T;  2E75 C;  2B8F A;  1RTN A;  5F2D A;  2EJM A;  4M8A A;  1EY5 A;  3HP3 A;  1AW7 A;  3D6C A;  1I4R A;  4KTA A;  4K2L A;  1ET6 A;  5DM6 3;  3K5L A;  1TS3 A;  3S1M B;  2PZU A;  2O5J C;  1ILP A;  1Q3L A;  2EYH A;  1WTV A;  4K6L A;  4A93 B;  2QCP X;  1Z6H A;  2HDM A;  3IKJ A;  1Y69 U;  2B2V C;  1HXY D;  4RGT A;  5ELC A;  2IL8 A;  1O7L A;  2CQA A;  4KN4 C;  3U9S A;  5FO8 B;  1SNO A;  4C1N K;  1LTG D;  1SBB B;  1TII D;  1CZG A;  5EGT A;  1IKL A;  2QIL A;  5C0X I;  1TWA B;  2KCN A;  1BCP B;  4BBR B;  1ZXT A;  3VYS A;  5KGU A;  1JOK A;  1Q1E A;  1J9O A;  1A15 A;  4DAP A;  1EU4 A;  1BO0 A;  4ZKB B;  5E1F A;  4MIU A;  4KK7 A;  3R3O A;  4FXK C;  4ZKC B;  1LTR D;  2A6E D;  1SDF A;  1SNQ A;  5DEH A;  5CV7 A;  2A6H C;  2OXP A;  2E2H B;  3AMU A;  5C4X B;  4KY5 A;  4KY6 A;  3NPP A;  4QUF A;  4KHZ A;  4HCS A;  1F77 A;  1Z47 A;  4WRD A;  2RDF A;  4C3H G;  2AQ1 B;  2EYJ A;  1IL8 A;  1I6V C;  2KVM A;  2F4I A;  4F8M A;  1EY8 A;  5KRU A;  3FPU B;  1UAP A;  2RVL A;  3Q22 A;  1SFO B;  3BVM A;  3MFY A;  4K5X A;  1HFG A;  1DOM A;  2R92 B;  4G7O C;  1Q90 A;  1NCV A;  4K8I A;  5C3X A;  3GO5 A;  1DXM A;  1Z7T A;  4A3I B;  2F0L A;  1HTP A;  2A69 D;  2L55 A;  1M4V A;  1GUS A;  2K05 A;  1VMP A;  5ELB A;  4ZUJ A;  1C4Q A;  2F0O A;  2IX1 A;  2NWG A;  2NTT A;  3PO3 B;  4J8Q A;  2F0P A;  4ZYS A;  2QDB A;  3KLS X;  3D8G A;  4QCL A;  3FMC A;  3VA5 A;  2FJ2 A;  2IX3 A;  1BOS A;  1HTL D;  5JEA H;  3H3V C;  1TU2 B;  5C5M A;  2ID0 A;  1Q12 A;  4KD4 A;  1ZYR D;  3Q24 A;  2VXW A;  4RCN A;  3D6W A;  2X6G A;  4ILW A;  5CYU A;  4A3E B;  1JOO A;  4CGY B;  1KAB A;  1STN A;  2PPB C;  5JPN C;  3HRZ C;  3CKI B;  2EJG C;  2EYO A;  1ENA A;  2M2L A;  3TSS A;  4HR7 B;  5C4J B;  5BN5 A;  3QWN A;  4XYO A;  1GHJ A;  3ND9 A;  4NW2 A;  1PTO F;  2HQE A;  1H9M A;  4Z9C B;  3NWT A;  3HOX B;  1HUM A;  1KLG D;  3NHH A;  3M4O B;  4TKO B;  2Q8I B;  4HAE A;  5J39 A;  1MI2 A;  1GUG A;  2A73 B;  3EA6 A;  3MC0 B;  3O13 A;  1Q8I A;  3CHB D;  5IT9 E;  1GUN A;  3Q23 A;  4K6D A;  1PTO D;  3MHB A;  1CA6 A;  2DN8 A;  3SK6 A;  1I3Q B;  4C3J G;  2Q8T A;  5G3L F;  3SDZ A;  3T4A C;  2SDF A;  1OXS C;  5EQ0 A;  2FMM A;  2SNS A;  2PYK A;  1UNS A;  2NN6 H;  4H7B A;  1BBX C;  4C3I B;  2F0K A;  2K5D A;  1D5X C;  3M85 A;  4B9X A;  2KA7 A;  4AYB B;  4XQN A;  3QIA A;  5EKI A;  3GTG B;  4DA2 A;  1IHZ A;  2KCC A;  4DGZ A;  1I4H A;  1XTC D;  5CV6 A;  4O1N A;  1SE4 A;  3VR6 A;  1U4R A;  1EOT A;  1PFM A;  4RA8 A;  5KND A;  3ERQ A;  2KEC A;  3KF8 A;  5C6A A;  4HMI A;  3URY A;  1SMY D;  1TWH B;  5EBD A;  2K33 A;  1QNU A;  1GXD C;  1TY0 A;  4QIW B;  2PCF B;  1RDP D;  2KUM A;  1TWG B;  2KED A;  2J0T D;  1Q1B A;  2B8G A;  1V43 A;  2K28 A;  4V0B A;  2GA4 B;  2E74 C;  1Y1W B;  2EZV A;  2OT2 A;  4EQN A;  5EJW A;  5CBA E;  2XIW A;  4RGM A;  5A2Q E;  4UAI A;  3GTK B;  1E2V A;  3IL8 A;  5KNB A;  1FNW A;  2E76 C;  4WOR A;  3GQB A;  2EY6 A;  2L1B A;  1JOR A;  3L3O C;  2PW7 A;  3U9O A;  1JC7 A;  5DM7 3;  3HOZ B;  3NE5 B;  5I6W A;  1SJE D;  3OW7 A;  3PV0 A;  2IWH A;  1A6X A;  4IUU A;  1JE4 A;  4OIK A;  2MP1 A;  2MJ8 A;  2QKI C;  1ZYR C;  4NP5 A;  1PXU A;  2EYP A;  1DOL A;  1JB3 A;  3K0Y A;  3VYT A;  4I7Z C;  1BCP C;  1STE A;  1D6E C;  2RQX A;  1KDA A;  3OIP A;  4DXF A;  4PV1 C;  4U67 3;  2PZT A;  1PTO B;  2K03 A;  2RA4 A;  1Y1V B;  3QOL A;  1BCP F;  4CJ1 B;  5T1G A;  3NTK A;  1PRT D;  3EQL C;  4ABN A;  1TR5 A;  2TMP A;  3EVQ A;  5IGE A;  3BDO A;  2JA6 B;  4G7H C;  4DU9 A;  3I3C A;  5CV9 A;  3VA7 A;  1V8Q A;  1YNJ D;  2J7Z A;  4BS9 A;  1D5Z C;  5I9O A;  1LT6 D;  3PIP 3;  3LWE A;  3W3A A;  2R93 B;  4TRD A;  2CVR A;  3I90 A;  2F03 A;  1HA5 A;  3UI2 A;  4PMB A;  1BNZ A;  5C3W A;  3WOE A;  1HRJ A;  3A7L A;  5CGK A;  3DEO A;  1F9R A;  3FPP A;  1O78 A;  1AP0 A;  1EEF D;  3J81 E;  3FVQ A;  2L0C A;  1QOH A;  1SYF A;  1RHP A;  4RCO A;  1STY A;  2BA1 A;  1SNC A;  1NR4 A;  1X32 A;  2FHT A;  3TBI B;  4R8N A;  2IPK D;  1ENC A;  3A8K E;  3KLR A;  1YNN C;  3K5M A;  2FFK B;  1IW7 C;  1D5M C;  1ML0 D;  2F0I A;  4ID6 A;  3C1E A;  4RH6 A;  2JYO A;  3GTQ B;  1PDQ A;  1I4G A;  1JCK B;  3FDT A;  2NYZ D;  1WCM B;  3TN2 A;  2B2U A;  3A55 A;  3T13 A;  1GUW A;  4EVO A;  5CV8 A;  1RJT A;  1B9M A;  2I46 A;  2PZW A;  1R4Q B;  1D1I A;  1F2L A;  4XT3 B;  2QEJ C;  4ODG A;  3TP5 A;  1G91 A;  3VR2 A;  4DNT B;  3GV3 A;  1I50 B;  2F0J A;  5C44 B;  1XXG A;  4CKC A;  3M4Y A;  4QF4 A;  5EPJ A;  2EYM A;  3HOU B;  1K8O A;  2F0U A;  1J8I A;  5D3I B;  1D1K A;  3P1H A;  3A8J E;  1KNE A;  5M5X B;  1B9N A;  1JWU D;  4BY7 B;  2G9D A;  5COY A;  3D3R A;  2RDH A;  5CV5 A;  1CA5 A;  1BCP D;  3PUV A;  4BWG B;  3W2D A;  2RDG A;  1PRT F;  3K57 A;  1TT2 A;  3R93 A;  2F0W A;  4KD3 A;  2J4X A;  2EXZ A;  2BOS A;  5K5P A;  1LTI D;  4DAY A;  1CHP D;  2FIN B;  3CRK C;  4UDU C;  2HCC A;  1KDC A;  4EQP A;  4ZUI A;  3R2T A;  5IGC A;  3TME A;  2IW3 A;  5KIX A;  3VYR A;  4ZRZ A;  2FMC A;  4DNR B;  1QIL A;  2NUC A;  3I72 A;  3DM1 A;  2AQ2 B;  4K2K A;  1VF7 A;  3RLF A;  1KDB A;  5C5L A;  3Q0A A;  5C4Z A;  3WDN A;  1NUC A;  5CR3 A;  4I65 A;  5D14 A;  1OXT A;  1JWM D;  3NWS A;  3GP7 A;  2HCI A;  2K6A A;  3CQZ B;  1RCV D;  2AWO A;  1EY6 A;  1I4P A;  4ZK9 B;  5BN4 A;  1O80 A;  1S5B D;  3IAY A;  2L4N A;  4ME5 A;  2A6E C;  1DD2 A;  1PZK D;  1EWH A;  5TSS A;  2L11 A;  3P75 A;  3OSO A;  2NN6 G;  1VCI A;  1W6J A;  2PQE A;  1A3V A;  2NBF A;  3SK5 A;  2LY7 A;  2VB3 X;  1RF2 D;  5BN3 A;  5FKA C;  3I4L A;  4BBS B;  4C56 C;  3C46 A;  4HTH A;  3MZ5 A;  5FLX E;  2KEE A;  5I2X A;  3BVG A;  3PUZ A;  1WTQ A;  2JP1 A;  3MXU A;  1HHV A;  1X3Q A;  3MFG A;  1QB5 D;  4WJW A;  1OXX K;  3T53 B;  4EGV A;  1U4P A;  1ENF A;  4XXE A;  1B50 A;  3RZD B;  4RGN A;  3C1F A;  5ELE A;  1EIG A;  4A3F B;  3KLS A;  3HS0 C;  1FGB D;  4KN7 C;  3MWY W;  2K04 A;  5A35 A;  4ZQ3 A;  4HMJ A;  5KNC A;  1SYE A;  5ELD A;  1EEI D;  1QWY A;  4QUC A;  1WTX A;  3J7A F;  3S1R B;  3E5S A;  4HN7 A;  3J80 L;  3NBH A;  2IX0 A;  2XRS D;  3NP8 A;  3MXN A;  1KAA A;  4QMG A;  5EKK A;  4C2M B;  5IT9 L;  3T56 B;  1F2Y A;  5ELF A;  1LT5 D;  1AZP A;  4FF4 A;  1NR2 A;  4N9P A;  1AFP A;  1IYU A;  3ITP A;  4X3T A;  5FO9 B;  4XQQ A;  1ONL A;  4IFD H;  1EZ8 A;  5CMD A;  2NVX B;  1K8M A;  2B2Y C;  2O5I C;  4BA1 I;  3P20 A;  3S1N B;  3GV6 A;  1G2S A;  4FF1 A;  1LTB D;  2IT1 A;  3L9A X;  1EY4 A;  3GTM B;  2B2W A;  2KJX A;  4A3G B;  4PMW A;  5FK9 C;  1T5X D;  3C2P A;  3J7Y W;  2XSC A;  3S2H B;  2C9O A;  2R61 A;  1QCB D;  1TQO A;  3J80 E;  4J6H A;  1O7Y A;  2B2W C;  2EE1 A;  1BF4 A;  3HGB A;  2AWN A;  4RHS A;  3QO2 A;  4PNY A;  1LTA D;  4XYQ A;  2F0G A;  1FYC A;  2O4X A;  1JWS D;  1WD0 A;  3GTL B;  4C1N I;  3DUZ A;  2JEA I;  2EYL A;  4EQO A;  3T51 B;  2RBM A;  1C8C A;  2D2C C;  5M5Y B;  1JOQ A;  4X3S A;  1I6H B;  1ET9 A;  4JK1 C;  3ONA B;  5JOB A;  1EIH A;  3HZX A;  4RAU C;  3MTS A;  3S9W A;  1JR0 D;  3S16 B;  3IFT A;  2F0E A;  1STA A;  1STG A;  2RSN A;  4R8I A;  4X3K A;  2AQ3 B;  4A3B B;  3RUZ A;  1EQT A;  3F2U A;  3BVZ A;  4IUN A;  3DWP A;  3OWF A;  1BDO A;  1NAP A;  3K58 A;  4Q0F A;  1MSH A;  3I91 A;  2F0M A;  1DZ1 A;  2QF7 A;  2JEB I;  1IYV A;  3D4W A;  1CI3 M;  1PFN A;  2D5D A;  1WVL A;  5ISR A;  4A3M B;  3S1Q B;  1VDZ A;  2XWB B;  2BE5 D;  3V05 A;  1SYD A;  3H94 A;  2Z4I A;  4FXD A;  4YIJ A;  3OWE B;  4ULL A;  2WAC A;  4F87 A;  3PIO 3;  5C0X J;  2A68 D;  1HPC A;  1G2T A;  4HSV A;  1QJO A;  3SEB A;  4K14 A;  1A3U A;  2SOB A;  4OHJ A;  2YU9 B;  2HUG A;  2WP8 J;  5HUR A;  2XRQ D;  1SYC A;  1TKW B;  5D3D A;  5CV4 A;  3VR4 A;  1WTW A;  4FYD A;  1AZQ A;  3D31 A;  2MUY A;  1CQF A;  4Q5V A;  3TP6 A;  1R9T B;  3DEP A;  2RKS A;  1PRT C;  3QG1 A;  1LTT D;  1EYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...