3TP8A

Crystal structure of staphylococcal nuclease variant delta+phs l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tp8A00
2F0EA 3D4WA 5IGDA 4K14A 4PMCA 2O4XA 2RDFA 2F0MA 5C3XA 2F0WA 2PW5A 3HEJA 3TMEA 1SNPA 3NK9A 4KY5A 4NKLA 1SYFA 1AEXA 2RKSA 3NXWA 4LAAA 5EKLA 1EY0A 5KRUA 4ODGA 4H7BA 2PZWA 2PZUA 4HMJA 3P1HA 4F8MA 2OXPA 4DU9A 1F2YA 4K8IA 4IZ8A 1EYDA 4IALA 3T13A 1NSNS 5K5PA 1STYA 4DGZA 2EYJA 3ITPA 4K5XA 5KEEA 3NUCA 1U9RA 1KABA 1SYCA 5CGKA 5E1FA 1A2TA 2M00A 4KHVA 4KD4A 1SNQA 2EYFA 4I65A 5KYLA 1EZ8A 1II3A 4EQOA 2F0PA 2F0NA 4ME5A 3SK6A 2EYLA 2SNSA 4MIUA 1EYCA 1TT2A 4IUNA 5ISRA 3C1FA 2WACA 4ZUJA 2F3VA 2PW7A 4KJNA 4PMBA 4RKBA 3LX0A 5CV7A 5CV5A 5CV6A 3U9OA 4DFAA 1NUCA 2PYKA 2EY6A 3EROA 4E6IA 5KIXA 5CC4A 1EYAA 5IGCA 1EY7A 2EYMA 3MHBA 5I9OA 5IGEA 1SNOA 2PZTA 4HTHA 2OEOA 3H6MA 1JOQA 2PQEA 1SYBA 2F0OA 3E5SA 3NQTA 4J6HA 4NP5A 5CV9A 3SK4A 5CV4A 2F0FA 5M9OA 1SNCA 4EQNA 4N9TA 1F2MA 5J1ZA 2QDBA 3C1EA 5IOCA 2F0DA 3EVQA 4KV6A 3SR1A 3OSOA 2F0UA 5HURA 4QMGA 3TP7A 1TR5A 4KTAA 3S9WA 1A3TA 3TP5A 1A3UA 2F0TA 4B9WA 5IIFA 1SNDA 2LKVA 4K2LA 2F0VA 2F0JA 2RBMA 4R8NA 4WRDA 3T16A 5KYIA 1EY9A 1JOOA 2F0QA 2F0KA 1SYDA 2F0SA 4N9PA 2F0GA 4HMIA 4F7XA 1A2UA 1STHA 1ENCA 1SNMA 4YIJA 5EGTA 3RUZA 5C4ZA 5F2DA 1EY5A 3HZXA 4QB4A 5CV8A 2EY2A 1TQOA 5IGGA 5E3FA 1JORA 2KQ3A 1SYGA 2NUCA 5C5MA 3SXHA 5J39A 2OF1A 5C5LA 5C3WA 4TRDA 5IGBA 2F0HA 3QOJA 3OMGA 3R3OA 4QF4A 2F3WA 3PMFA 4NDXA 4PNYA 3V2TA 4EQPA 4ZQ3A 2EYPA 4ZUIA 1SYEA 4DF7A 2EXZA 1EY4A 2SNMA 3NP8A 5DEHA 3SK5A 1STBA 3SK8A 3D4DA 1KDBA 3D6CA 5DAUA 5J22A 2F0IA 3P75A 1STNA 4K2KA 3MEHA 3MXPA 1STAA 4OL7A 5CR3A 5I6WA 1RKNA 4G57A 1ENAA 1EY6A 2KHSA 1STGA 5EKKA 4WORA 3D8GA 4K8JA 3DMUA 3ERQA 3NHHA 4B9XA 5I6YA 4KY6A 2SOBA 1EZ6A 3BDLA 3TP6A 1JOKA 5C4HA 2EYHA 4NMZA 2EY5A 1EQVA 3DHQA 3EJIA 1A3VA 3TP8A 4KD3A 4EVOA 2F0LA 4KJOA 3MZ5A 2HQEA 4S3SA 3VA5A 4K6DA 1F2ZA 5JAVA 4RKLA 1EY8A 1IHZA 1KAAA 5NUCA 5I9PA 3OWFA 3SHLA 5IGFA 3MVVA 4J1MA 5HGTA 5IODA 4KY7A 2ENBA 2EY1A 4K5VA 4K5WA 3QOLA 5KGUA 1KDCA 2EYOA 5C6AA 1KDAA 3OMCA 3BDCA 4ID6A 3QB3A 5JOBA
chains in the Genus database with same CATH superfamily
1GOZA 3CPWA 1M4VA 5C3EH 3HEJA 2VNUD 1WCMB 3C46A 2ALYB 1N32Q 3IFDA 1S3OA 3M3YB 5KRUA 1HQMC 2H1EA 2NN6G 2QA4A 4B3MQ 3I90A 3Q23A 2OXPA 1JQYD 3VR5A 2AQ1B 1Q90A 5FO8B 1TY0A 2EYJA 5C3EB 1IBLQ 1KQSA 1QUQB 2B2UC 3I70A 1SEBD 4BA2I 4RH6A 4FYDA 1VQIA 1YHQA 1WTOA 2VB3X 4X65L 5IYBH 4GKKQ 1B2TA 2IJ0A 3V05A 2Q2IA 5EBCA 1EYAA 3Q24A 3PQIA 2DY7A 5JPNC 4AQYQ 1JJGA 1UE7A 3K7AH 1UEBA 3BZKA 4UP8A 4KKUA 2IL8A 2BE5D 1LACA 4POGA 1TS2A 5EKIA 1JJCB 2ZT9C 4MZ9A 1SE3A 3DEOA 2QDBA 2K52A 3TBIB 3K7AB 4X62L 1JJ2A 1JWSD 4KTAA 1LTSD 3AB9A 1JB3A 4G4KA 5IYCH 1O7IA 4A3DG 2UXDL 3GTOH 1SYDA 1U4MA 2F0SA 4A3EG 3K6OA 4JI2Q 1BVSA 1CZGA 2UUBQ 1CTMA 1JORA 3MTSA 5D3DA 2XSCA 3MXGA 3TS0A 3OMGA 5BN3A 3EIVA 5T1IA 2IX0A 3S1QH 4A3JG 4HJ8A 2PPBC 2B3GA 2IY5B 3H3VI 3Q8DA 3MEFA 5CR3A 5I6WA 4RCNA 4X6AH 4JG2A 1Y1WH 3S1QB 1WTQA 4MTKA 1PTOB 4A3BG 2NZ1D 4NMZA 3PSIA 4L5SA 3EJIA 3TP8A 2NZOA 3H0GG 2Z4HA 2HQEA 1CQVA 1Y1WB 1BCPB 2DNEA 1PFMA 3A8IE 1I6HH 5HGTA 1KLGD 5IT9L 1SJED 2EY1A 1FR3A 4DAYA 1EIGA 4ID6A 1V1OA 2MUYA 4K14A 2KOLA 1Z47A 4POFA 2X6GA 2RCNA 1I6HB 1E7ZA 4NKLA 1XXGA 2JEBI 4DR1Q 5JJZA 1IBKL 4ODGA 3BYTB 1HTPA 2AQ2B 1EYDA 3K7UC 4DV0L 1W3SA 4LFBQ 1KABA 4LWCA 2CCZA 3PO2H 4LNQA 4BWGB 3KLRA 4CKEA 4RKBA 4JV5L 4PG3A 4H0LC 4CDDC 1DONA 3RLNA 2A6HD 4XQQA 1J9OA 2Q2TA 4DKAC 1UE1A 1NR4A 1Z7TA 4HCSA 4YWKA 1XPRA 5IP9H 2F03A 5C0XH 4ZLTF 3P7JA 4DAVA 5CBEE 1EIYB 2NZHA 3HKZB 1ESFA 1Y8PB 3NPPA 2SEBD 5KNCA 4JC0A 3A54A 1KXLA 1RODA 1E22A 2B63G 2MFIA 1MSHA 1GUOA 3G48A 1FGUA 5A2QL 3I4MH 4IOAA 2EY2A 1K8OA 1XMOL 2Q2HA 2VXWA 5M3FG 4HJAA 1XNQL 3S17H 3NTHA 5I2XA 1MBYA 3TDQA 2UXBQ 1IKMA 3I4MB 4FXGC 1Q82C 1PFBA 5J22A 2F0IA 2DN8A 1PZKD 1STNA 3AEVA 2YTVA 4GLVB 3S17B 1TS5A 2L9HA 1K83H 3W3AA 4TVAB 4JI0L 4WORA 3D8GA 1ET9A 1SE8A 2MJ8A 1X3QA 3M4QA 1Y14B 1G51A 1F9SA 2LS01 2K5VA 5L37A 3NE5B 4IFDI 2NVYH 2IT1A 2HCIA 3DXJC 3GTJB 1EY8A 2BCOA 4DAYB 4JI3L 4IUPA 2VW9A 3D4WA 1PDQA 3DEPA 1S40A 2RDFA 2NVQB 4BS9A 5I4DA 3D6WA 2CHBD 3NK9A 3CD6A 1G6PA 3J7YW 1YJNA 2NVTB 3I7FA 3M7GA 3HOWH 2VS1A 3Q22A 1STYA 1K3BC 3BYYB 2JQOA 5E1FA 1CUKA 2A69C 2CW0C 3HOWB 4NB3A 3PV0A 1PFNA 3SE0A 4ME5A 4EQOA 1I94Q 4QUFA 4RMFA 1V1PB 1E2VA 5ELFA 1CKNA 1E24A 1V1QA 1HZ9A 1TT2A 3I4OA 5ISRA 3ZJYC 1NJIC 2F3VA 2L55A 1T5XD 3GO5A 1F2LA 4XDXA 1VQNA 1KHIA 3M7NA 3FP9A 3ICEA 1ML0D 3T53B 1GJXA 4DV4Q 1HCZA 1Y1VH 4LUOA 3RZDH 3RN2A 2WKDA 1MSGA 1VQCA 1XTDA 1N32L 1DOKA 1TWFH 1YNNC 2L1BA 4MTNA 4A3MH 4B3ML 1EWCA 2F0VA 3PCOB 3J80c 3VYRA 4O1NA 3GV3A 4XXEA 4DR7Q 4LF8Q 1IBLL 3RZDB 3JC66 1JMCA 2TSSA 1F77A 3A55A 1WD1A 5IYDH 1QILA 1TQOA 1N33Q 2KCTA 3BVMA 2KQ3A 3F2CA 4CDEC 4R4TA 1S5DD 4LF4L 3WOFA 4IPCA 3J81c 3I73A 2A1AA 2FMMA 1YBYA 4GKKL 3DWQA 5IP7H 4JPBW 1GUWA 4AQYL 4JI8Q 1UE5A 4K2KA 2RSOA 4K0KL 3MEHA 2FJ2A 1UE6A 1R9TH 5JEAJ 3R93A 1ENAA 5FKAC 2KHSA 4GN5A 3B6YA 4TSSA 1JOKA 1G291 1R4QB 1R9TB 1FJGQ 3VA5A 3D3RA 1WCMG 3QWNA 2I46A 3L2PA 1HR0Q 1E2WA 1D2BA 4HEDA 4JI2L 3J81j 3AMUA 3F2UA 3FPPA 1YJ9A 4JI5L 2UUBL 5C3EG 2D5DA 1EYGA 4OX9Q 1M8AA 4PMCA 3TZDA 3TN2A 4C3HB 2K5DA 3KK7A 4IOCA 1BR9A 1SBBB 5BR8Q 2TMPA 1GUTA 1HNZQ 2K1BA 1ICWA 3KF8A 4P73A 4F8MA 1SAPA 1YJWA 1LO5D 3RD4A 1QNUA 1U9RA 3T1YQ 2ZJQA 4XT3B 4P2CB 4OIKA 1GKHA 1JWMD 1CKNB 5JEAG 2Z1CA 3TREA 1PH1A 4C2MH 1AH9A 5LL6X 4IFDJ 1DM0B 2FINB 1MD2D 4MIUA 5IYBG 4HSVA 1VQMA 2Y0SE 3F2DA 1GUNA 1LLRD 1NUCA 2A19A 2JE6I 1VQ6A 4QY7A 1K73C 1EY7A 4KKTA 2EYMA 1ZYRD 3K58A 4XQNA 1J6QA 4DV3Q 3UI2A 2EPBA 3H6MA 3DM1A 5LMNQ 3FRPB 1RTOA 1PMRA 2XRQD 4N9TA 4LFAQ 3RLOA 1QZGA 1PHJA 4DR1L 2PNHA 3KJOA 1XMQL 2C35B 4B9WA 3CCJA 4JBJA 2N55A 4LFBL 2XNAC 3ER0A 1ENCA 4ZRZA 1H9RA 4IUUA 4DAMA 2NUCA 5C5MA 3HS0C 3S9WA 4IFDG 2UUAQ 2A8VA 5FO9B 4DV1Q 4GZYC 4BBSH 1N34Q 4DK6C 4KHZA 1X3EA 5AJ3L 3CAMA 3L0OA 2HIVA 2NTTA 3OPOA 1QVFA 4YHHQ 2R3ZA 1PV4A 4KY6A 3A74A 2R93G 4ZKCB 1EZ6A 4C1NI 3TP6A 3GD7A 1N36Q 1Q86C 5C4HA 2DNCA 5BN5A 2L11A 1I4HA 2D2CC 1X3PA 1ONLA 2L15A 4DV7L 1WTVA 1ICFB 1C0AA 2ENBA 1J5EL 1KDCA 2EYOA 4KI0A 1SMYD 3K5NA 2QF7A 4L63B 1HNWL 4DNIA 3F8TA 5JJIA 1ENFA 4IUTA 3U4VA 1SJHD 3W5OA 2MGSA 2JP1A 1G2SA 1EIFA 3S1NB 2RVLA 3KF8B 3L7ZC 1IZ6A 4Z9CB 3AQQA 2JA5H 2E5LL 1RJTA 1EFWA 4K8IA 1PYBA 1Q8KA 2G5DA 2KHJA 4JOIA 2WP8J 1PH2A 1VQHA 3FDTA 4DR4Q 3NUCA 2A68D 5COYA 4XQJA 3PIO3 1VF7A 1WTRA 2JA5B 4RCOA 2UUCL 1TS3A 4OO1I 3N52A 3K0XA 4RGNA 1X9NA 1PH5A 1X6OA 5M3MH 3STBC 5HGQA 1PH4A 3HKZG 2EY6A 3S2DB 1FYCA 2KEDA 2XWBB 3HFZB 5IGEA 2PZTA 2OT2A 2EOTA 5DLQE 1PH3A 1A63A 2FFKB 3CKIB 1IXRA 1F2MA 4DNRB 1WTHA 2F3IA 1UUPA 1TR5A 1IL2A 2K33A 1MKHA 1VQLA 1WOCA 5IIFA 3OTOQ 1B3QA 5EQ0A 1CI3M 3TEHB 4G7ZC 1ESRA 2NBFA 2K50A 1SNMA 2XRSD 4A3KH 2BA1A 1EY5A 3HZXA 1S5BD 1GUGA 3J7A5 3SXHA 2OF1A 2ID0A 3T56B 3QOJA 4EQPA 1Q7YC 2OWOA 1VS0A 3PUYA 2B2TC 3HP3A 4RAUC 1WTXA 2DJGC 4A3FH 5D14A 2K01A 1TIID 2DJFC 3SEBA 2ICIA 3NTIA 4K8JA 3DMUA 4Q5VA 1E2ZA 1BBUA 2HUGA 4DAPA 2EYHA 4UY8C 4A3FB 3N6RA 1A3VA 4IN3A 2R7ZG 2WB1E 5EJWA 2JA7H 1MJCA 3HG9A 4LF8L 2ZXPA 5IODA 1PRTD 1YNJD 3FKIH 2PI2A 1STEA 1N33L 3LWUA 1O80A 1LABA 2CKZB 1I3QB 4X66L 1S5ED 3FKIB 3F1ZA 4TKOB 4FF2A 1HHVA 1W6JA 2PZWA 2Q8IB 1PYSB 4DR6Q 4JI8L 4IALA 4BBRG 4DV2L 1I6VC 2A6EC 4JI6Q 3HOYH 2RF4A 3K81C 1A2TA 4IQZA 3HOXH 3BZCA 4GOPC 2CFMA 1HNXQ 2SNSA 1L1OC 4RGTA 1LTRD 1V8QA 5EPKA 2K6AA 1B3AA 4E6IA 2F4IA 5C44B 3R8BA 2CQAA 1VQ7A 1DXMA 4BY1H 5E4WC 3OIQA 3IL8A 4HTHA 1NY4A 5LMUL 5FLXE 2N88A 5M9OA 2B29A 1KRTA 4EX5A 3GTLH 1DJRD 1VF5C 4J8QA 5M5WH 1Z9FA 1K28A 4AYBG 2WAQG 4A93H 2LXJA 3T16A 4GKJL 3EA6A 1X56A 3GTLB 2A73B 2F0KA 3AFQA 1TWHH 3T1YL 5FLXL 5M5WB 2N49A 4DUYQ 4A93B 4KLKA 3GTQH 2KUMA 3R3OA 1CA6A 1DGSA 4EQ5A 3PIPA 2GVBA 2K75A 3GTQB 5EPJA 5LMNL 5JJKA 2DY8A 1U4LA 1QCBD 4DXFA 1DCZA 2D9UA 4ZKBB 1CHPD 1FVIA 3CRLC 2MO0A 3E6ZX 4C3HG 4KD3A 4L6TB 5JAVA 4S3SA 5JVH3 5EPLA 1PH8A 2B2TA 4JI7Q 4HJ7A 5I9PA 4IPGA 3GTOB 3F2BA 2VUMH 5IE8A 3I4NG 1UEAB 2DUDA 4CJ2C 1W6KA 2R61A 4QB4A 4GS3A 1HTLD 5JOBA 1H9JA 4OWXB 1B7YB 1LUZA 1JT8A 1SXTA 2HHHL 4OO1G 1QWYA 5IT9E 2PW5A 4RGMA 4CBVA 1AFPA 4KY5A 2UUAL 1AEXA 3VR4A 4A3GG 4IPDA 4DV1L 3BVGA 3CMEA 1N34L 5FLMG 4PZ6A 5A35A 1QNKA 2EE1A 4JCVE 2D0PA 4A3IG 1OXVA 3V96A 4YHHL 1SNQA 2EYFA 4BY7G 4AIMA 2QKIC 3IAYA 1GHKA 3J81i 3SK6A 3HOUG 1N36L 5D3IB 2EXDA 2PI2E 4L5RC 5JVG3 2CQOA 4PV1C 5I2YA 3U9OA 4B3RL 4YWLA 1F9QA 3OW7A 4DV6Q 3RR5A 1E1OA 3AFPA 4R4QA 3MHBA 1C9OA 4LMQD 2C9OA 1IW7C 5FO7B 4ILWA 4ZK9B 1WI5A 4GNXA 2ATWA 3C1EA 3KLSA 4GN3B 4HAEA 3TP7A 1QG7A 1A3TA 3K5OA 4HCEA 2NTSA 1PRTB 3PGZA 3URYA 1VQBA 2JA8H 1VQ4A 4DR5L 2F0QA 4DR4L 2R92G 3NBIA 3PO2B 1VQ9A 1FD7D 5K36G 5C4XH 4ALPA 5FJ8H 5IGGA 3CCQA 4C3IH 1WTPA 4V0BA 1EU3A 2B2UA 2JA6G 5A2QE 3WOEA 5C4XB 1KNAA 3DWPA 3NP8A 1B4OA 3D4DA 4C3IB 2HD3A 3K80C 2VQFL 3CF5A 4U673 2JYOA 2N8NA 4LF5Q 1QOHA 3A0JA 4XIGS 4JI4L 5FOBB 5KNBA 1I4PA 1CQFA 1BXTA 1SN8A 3JAMc 3DHQA 2JXMB 1Q1EA 2L4NA 2LMCB 4PQXA 1OXTA 3E9HA 1DZ1A 1IHZA 3CC4A 1K0RA 5IGFA 3UE1A 2YU9H 1M90C 3M4PA 1G6ZA 1XPOA 1KDAA 2GN5A 2YV5A 2KA7A 3QB3A 2HIXA 3QIAA 4OEMB 2LFNA 3I72A 3LGJA 4FXKC 2DGYA 4C1NK 2JA5G 4PZ8A 2Z0SA 3PUXA 3VDYA 2ICEC 1PA6A 1G8ZD 3T13A 1K83B 3EBEA 5KEEA 2D0OA 4CDCC 4DNTB 1FNWA 4KD4A 3T1HQ 1II3A 4ZCKA 4P75A 4RWSC 3VYSA 4A3LH 1GUSA 1ZXTA 4IUNA 2NVYB 1XX8A 3CW2C 4F88A 3LX0A 1C48A 4C3JH 4A3CH 3EROA 1I4QA 4IJHA 4DK0A 2KCMA 3OW2A 3I91A 1OXXK 4YCVA 4GNXB 1JOQA 1AW7A 2K5HA 4GLAC 3E5SA 4NP5A 4CKCA 5G3LF 2FXQA 2FMCA 1EWHA 5IOCA 3K59A 2I5MX 1GXDC 3ULPA 3S1MH 2YTYA 3HOZH 3VYTA 5ELOA 4LUZA 4DR6L 1F9PA 3QO2A 3G71A 3H15A 2G9HD 1CT1D 1Y8NB 2F1MA 1V9PA 3FEWX 4B3SQ 3A56A 1P8LA 4F7XA 2E2DC 3CCUA 3IRBA 1LT3D 3S1MB 3HOZB 2EQSA 2QEXA 4WJ4A 2JK8A 1EQRA 4AH6A 3Q6SA 4A4IA 2MPMA 4RFBA 1K0SA 3QR8A 4BXXG 4UP9A 5GAGC 1O7LA 3SK5A 1STBA 5DAUA 4APVA 1EWIA 2J0TD 2PQAA 5GQOA 4EGVA 1SSOA 2P5ZX 3CCEA 1I50H 3SGIA 4KHPQ 1VQPA 3AU7A 1Y1VB 2Q8RE 2EZVA 2E2JH 5C0XI 3BDOA 1TWFB 5EAYA 2QCPX 1U5KA 3K57A 1UNSA 3GDEA 4A3MB 2NN6H 4IUVA 1LTAD 2EIFA 1A62A 3D4RA 3FKIG 1IYJB 3U58A 3HOVH 3SHLA 3A7AB 3NTKA 2E2JB 1EIHA 4DA2A 1CZWA 4H13C 2OQ0A 1KD1C 2RQXA 1SE4A 4JYAQ 3W1GA 4LFCQ 3P20A 4HJ9A 3HOVB 1B9NA 1PTOF 3TQYA 2NWGA 4MHEA 4X3UA 2A69D 3MFGA 2RKSA 3D0FA 1YI2A 2CW0D 2PZUA 1BCPF 4P71A 1NCVA 1NSNS 4FF4A 5K5PA 1QVCA 1FL0A 2YYZA 5C44G 3J81E 1FNVA 2JA9A 1D1KA 4I65A 2Y0SB 5JPMC 2SDFA 1TY2A 1X3FA 2KHIA 1NTGA 2EYLA 4CJ1B 3PF5A 3A5UA 4CJ0B 1UWVA 2QILA 5M5YH 3H3VC 3R2IA 3M85A 1G2TA 2XWJB 3G6EA 4JI7L 2I0QA 4KMUC 2I5HA 4ABNA 5T1GA 3S24A 3J81L 4A3EH 2K04A 4LJZC 2K28A 3K8AA 1YNND 1VQOA 1NBWA 1K8GA 2F0OA 3SK4A 2F0FA 4K6LA 1ILPA 4A3EB 3UDIA 1TVXA 1UAPA 1GO3E 4A3JH 3RNUA 1Q3LA 2VQEQ 1VDZA 2F52A 4R8NA 3GTGH 1D5MC 4RHSA 3BVZA 1SR3A 1QVGA 4C2MB 5TSSA 2Z6KC 4JI1Q 4XT1B 1KIXA 1JC7A 4A3BH 2OTLA 1TWGH 3GTGB 1DOMA 4QUCA 2F3WA 1EQQA 4ZQ3A 2M9VA 2VL6A 2PQAB 2NB0A 3PIP3 2B2YC 3BS1A 1RIPA 5IYCG 2IPKD 4R4CA 1TWGB 1NE3A 2ZTDA 4G57A 4DV5Q 2I5LX 3AYHB 1VQAA 1M1KC 4X62Q 4U68A 5C4JH 4FXDA 4N8X1 4Y7NH 1B1ZA 2F0LA 1XYIA 4DR2Q 2ZJPA 5JJLA 2OTJA 3OWFA 5GAHC 3T4AC 3VR2A 4Y52H 4K5WA 5C4JB 1TWAH 3GTKH 1RCVD 1GM5A 1XNRQ 4Y7NB 1K9MC 2ZM6Q 5IGDA 1Y1WG 2PMZB 1SRUA 4LF7Q 4DPGA 2K32A 4JVZA 3TMEA 1SNPA 4MNOA 2XN9C 1TWAB 1C7YA 4BBSB 4HMJA 3SVMA 2QGQA 1XJVA 2B8GA 1I4XA 4LF5L 2E2IH 1LYLA 2B2VC 1SYCA 5C0XJ 4KHVA 1WVLA 3OWEB 2ES2A 1NAPA 2F0NA 4FF3A 2XIWA 3E3XA 3C1FA 4XTCS 2E2IB 4DF7A 5CV7A 4PMBA 2B2WC 4NXNQ 3CCRA 1WYDA 3VR3A 1Q46A 1GD7A 4DXGA 2B63H 2UXBL 1SROA 2PMZE 4DK1A 3KUPA 3I8ZA 3G4SA 3PO2G 1TU2B 5G3LD 1PTOC 5M3FH 5CV4A 1IBKQ 5J1ZA 3ULLA 1QB5D 2EJMA 4KV6A 3SR1A 2F0UA 1BCPC 1D5XC 1XTCD 2LKVA 1Q1BA 2F0JA 2K05A 1Z6HA 1D7QA 1BO0A 4KK7A 4ME3A 4N9PA 4V190 1I4RA 4HMIA 2I07B 5DM73 4R9WA 5CV8A 4B3TQ 3T1HL 3WWVA 3FMCA 5IP9G 5C0XG 4LUVA 5C5LA 5IGBA 4TRDA 5M3MB 2O5JC 2N78A 5J3BA 4PNYA 2YTXA 4JW0A 5LMNW 1JB7A 1B53A 1QE6A 4RHRA 4YCWA 2ZJRA 4FP5D 2BDNA 1PH6A 2WINB 2IX1A 3X3NA 1EY4A 1S5CD 5DEHA 3D6CA 1ZKOA 4LF9Q 3NBHA 1QJOA 1HUNA 1E3PA 2HDMA 4R1JA 3NHHA 2QEJC 3I4MG 1CKMA 2WB1B 1P16A 1TWCH 1RTNA 1YNXA 2ZTEA 1EQVA 5E4XA 2NYZD 1FGBD 1I94L 2IW3A 4GLXA 5EBDA 1JE5A 2B2YA 4J1MA 4KY7A 1TWCB 4A3KB 1D5ZC 2L0CA 1TXYA 1XNQQ 1HXYD 4L8JA 1PTOD 1Q12A 4DV4L 1CSPA 4IO9A 1EY0A 3E0EA 1HZBA 3DLLA 1BCPD 2NVXH 4OWWB 1F2YA 4IZ8A 1VQ5A 2WKCA 4DGZA 3CXCA 3STBD 4KHPL 3G7LA 3UE0A 4OIJA 1QZHA 3C2PA 1LTGD 4DR7L 3A5ZB 3KDFA 1TKWB 2JJQA 2HCCA 4OXPA 1K8MA 2RDGA 3CP0A 3BG3A 2JA7B 1TS4A 3MXNA 3NSWA 2BA0A 3HOWG 3H3VH 5IGCA 3NELA 1G91A 3I2ZA 3KF6A 2OCEA 4KN7C 4NW2A 3ULJA 3KBXA 2LXKA 5LL6S 3SDZA 3JAMi 3S2HH 3EVQA 3OSOA 5ELCA 3TRZA 2BE5C 3DUZA 2B2WA 1BOSA 1YITA 1KNEA 3VR6A 1EY9A 1MGSA 1B9MA 1BKBA 2BDOA 1FJGL 3HOYB 1PVOA 1ET6A 3S2HB 1HR0L 3HOXB 3RLFA 4GN4B 2KECA 3CU7A 1SDFA 2CWAA 1L0WA 3QG1A 1Y1VG 4OX9L 4QF4A 3BZDB 1SFOH 1AN8A 1BQQT 3M3YH 4BY1B 1L2FA 4A3MG 5BR8L 5KGUA 5AFWA 4HIDA 3NBHB 1HNZL 4R8IA 4X64Q 1BNZA 3MXPA 3ERSX 3T51B 1KLUD 1SFOB 2R6GA 1Y8OB 2XVSA 4UHVA 5IYDG 4FDBA 1NR2A 4OWTB 4KN4C 1HFNA 3H94A 3KYHC 1B50A 3HOVG 4EVOA 3ONAB 1ZEQX 3CHBD 2L12A 1XWEA 2VQEL 5IP7G 1TWHB 1EFID 3GTMH 3S1RH 1LTLA 4WFN3 1VMCA 4LF4Q 2J7ZA 1HPCA 5JEAH 2IX3A 4JI1L 3IFTA 4DV3L 2Z6BA 2A6ED 2Y0SG 1KAWA 2V4DA 3GTMB 4FNFA 3S1RB 3KLSX 4LFAL 4H44C 4K0KQ 1IBMQ 2IHFA 4PMWA 4IJLA 2Q2UA 3RZOH 4A76A 3KDFB 3NQIA 4DV5L 3O13A 2RCFA 3ZYYX 2HQLA 4QCLA 2RHSB 4M1UB 5IT9c 3MXNB 1A0IA 3RZOB 2HDLA 3J7ZC 4KKSA 2MP1A 4DR2L 4DR3Q 5HY6A 2VUMB 2G9DA 5CBAE 4JI5Q 1KL9A 3MA2B 1D8LA 3KF6B 2KJXA 5I9OA 1XNRL 3J80i 1PYWD 1C4QA 2ZM6L 4OELB 1EOTA 3NQTA 4LF7L 1LT4D 3DM3A 2A6HC 4IFDH 2N3SA 1PTOH 1H9SA 2E8GA 2M2LA 1X55A 1S4ZA 1SNDA 4K2LA 1VQKA 2MQHA 2UXCQ 3A8KE 1BBXC 5EGTA 3RUZA 1SE2A 4I7ZC 5F2DA 3S14H 2E75C 2R93H 1SYGA 2JN4A 2FHTA 2VB2X 3I56A 3PMFA 1YEZA 4GOPA 1L0YB 3ND8A 4NXNL 1CFMA 3S14B 2EXZA 1L1OA 2KENA 3LNNA 2R93B 3I4LA 5LHY1 4QIWB 4OL7A 3NENA 3G6JB 3CCLA 4WJWA 1JCKB 4OONA 1WTWA 2F4VQ 4RGOS 4JBKA 2KCCA 4XYOA 1XMQQ 1T5EA 2WIIB 2EY5A 3U9SA 2JA8B 1A8VA 2MNAA 1F2ZA 1YZ6A 3L9AX 4BBSG 3MVVA 1LTID 3PIOA 2V1CC 4DUZQ 5BN4A 1W2BA 4MN3A 1CKOA 4B3TL 2QDLA 3Q0AA 2F0EA 1V1PA 3X3MA 5GADC 1E1TA 2Z9HA 3A8JE 4DN4M 5CMDA 1MJEA 4TQUS 3CMAA 2GA4B 1HH2P 4QIWE 5AJ3Q 1U4PA 3P1HA 2BH8A 4DU9A 5IWAQ 3CCVA 4O0AA 4LF9L 3CC7A 4K5XA 3OTOL 1FNUA 4FO2A 2J4XA 1ILQA 1HJPA 1VCIA 4LF6Q 2M00A 2AUJD 5KYLA 4FF1A 1WJJA 2F0PA 2ZXRA 1IW7D 2WACA 4ZUJA 4DFAA 4DV7Q 4ZYSA 1J5EQ 1X54A 2YU9B 4BA1I 2AWNA 1HNWQ 2KCNA 5GROA 4RG1A 4YWMA 2X69A 4UDUC 1SNOA 2Z4IA 1PLFA 1ASZA 3U50C 3JAME 2EVBA 2R7DA 1YVCA 1O78A 3CCSA 1H9SB 4N8FA 1AZQA 1MHWC 2E5LQ 2AWOA 4L5TA 4QMGA 2HT1A 4X3KA 5M3MG 3CQZH 4YY3Q 1AZPA 3GTJH 3HKZE 1WFQA 3CCMA 2F0GA 3JAML 1O7YA 4CGYB 4YIJA 2UUCQ 1EEID 2AKWB 4IPHA 2RHQB 1LV9A 3CQZB 5J39A 4GOPB 3MAQA 2NVQH 2CWPA 2R7ZH 2WB1G 4C3JB 1PFSA 4P74A 1L1OB 4HJ5A 2EYPA 2O5IC 1F9RA 4H02A 1T9HA 2NVTH 1N8RC 2K5QA 4NPSA 1HZCA 3M9BA 3W1BA 3RN5A 3P75A 1VQGA 1O7ZA 2ZTCA 1LTTD 1IYVA 4QJFA 2C5CA 3GP7A 2R7ZB 1EQTA 4A3KG 1PZJD 4JI6L 3OYYA 1SLJA 2CVRA 1I5FA 2A5HA 3H09A 1RF2D 4CHTB 1HNXL 4KJOA 2A74C 2RSNA 5ELEA 4HIOA 1IKLA 4P72A 3L3OC 5NUCA 2UU9Q 4BBRH 2K5WA 3OHXC 4LW1A 4A3FG 3HRZC 1H9KA 2IHEA 3MC0B 1CA5A 3PO3H 1KTKA 5C3XA 2GVAA 4NXMQ 4BBRB 2JEAI 2F0WA 1VQDA 3MWYW 5DM63 1SYFA 4B08A 5EKLA 5FK9C 3KBGA 2VZAA 3PUVA 4QL5A 1U4RA 3K0YA 4ZAIA 4JBMA 2JA7G 3S15H 3PO3B 2R7FA 4X64L 3ITPA 1I50B 1HFGA 1PZID 3KLWA 4UP7A 4C56C 4ULLA 1JE4A 2BH2A 2K4KA 3S15B 1VQFA 1X32A 4DUYL 5CV5A 5CV6A 4QGUA 3UDFA 5KIXA 5D65A 4YCUA 3J80E 3W2DA 3K5LA 3KOJA 2K5NA 1DOLA 4AYBB 4X66Q 2WAQB 2OEOA 1KRSA 5ELBA 3HOYG 5KNDA 3PUZA 2PQEA 4OGQC 5CV9A 4A75A 3HOXG 1BUVT 2KBNA 4IURA 4EQNA 2ASBA 3OIPA 3NWSA 5E7NA 4QQBX 2F0DA 1ZYRC 1LTBD 1S5FD 3J80L 1IBML 4DV2Q 1HQRD 2F0TA 2EDGA 1J8IA 5ELDA 3CC2A 4WRDA 2OQKA 4BY1G 1X65A 4A3DH 4X3SA 3BJUA 2CH4A 2RDHA 1S72A 4JBWA 4HSPA 3LWEA 1OO9B 1K3RA 3S16H 2H5XA 5M5YB 3D31A 4C3HH 4J15A 4JOIC 3C3LA 4DR3L 4ZUIA 2CH4W 1B8AA 1PRTF 1SYEA 4AYBE 4A3DB 1JWUD 2WAQE 3M4YA 4I7AA 2QW7A 2SNMA 4A93G 3SK8A 3I4NH 3UDGA 3S16B 5LMUQ 1NNXA 2WV6D 2K14A 1VQEA 4M8AA 3U4ZA 1RKNA 2WFWA 3QJYA 3PUWA 1N9WA 5EKKA 4B9XA 4HN7A 2AMCB 1SMXA 2AUKA 4PZ7A 4OO1H 1DYQA 2SOBA 3BDLA 5H1SE 3I4NB 2BOSA 1ASYA 4FVMA 5DNFA 3KFUA 4A3GH 4A3JB 4GKJQ 1H9MA 5FLMH 3FVQA 4X65Q 1CHQD 2K7VA 3H0GH 2UXCL 3J7AV 3I3CA 4A3IH 1LM0A 3QOLA 3E0JA 5C6AA 4DV6L 4A3GB 4OHJA 4BY7H 1EOVA 1JR0D 3HOUH 4A3BB 3NWTA 1NMGA 3H0GB 4O2DA 3MXUA 4A3IB 1SMYC 4BY7B 4H7BA 2Z8LA 3HOUB 2VUMG 2UXDQ 1D1IA 2KVMA 4HR7B 1BDOA 2F4VL 2EJGC 1HA6A 4G7HC 1VQJA 1A15A 1Q8IA 3OOCA 1U0LA 2AHOB 1EL0A 4KJNA 2A68C 4F87A 2KEEA 2NN6I 1GHJA 2B8FA 1B44D 1X3GA 5CC4A 4DUZL 2R92H 3GTKB 1Y69U 5K36H 5M5XH 2HHHQ 1XPUA 1EUJA 4CDFC 2E76C 1IYUA 2MHVA 1SNCA 2MO1A 3FPUB 2R92B 1A6XA 2JA6H 1HR0W 5M5XB 3TP5A 1A3UA 4G7OC 3CPFA 5IWAL 2RBMA 5KYIA 2X6LA 3CRKC 3EQLC 4LF6L 1VQ8A 1IL8A 2JA6B 2EJFC 1LT6D 4RA8A 1MI2A 3A7LA 3EN2A 1KC8C 1BF4A 1NMFA 1OTCA 4B3RQ 2RA4A 3E9IA 5C3WA 1PH9A 3HGBA 4NDXA 3S1NH 3UDXA 2PNRC 2B63B 1PXUA 2JA8G 4IUQA 3FHWA 4R4OA 3KJPA 4DV0Q 1C8CA 4HIKA 3M4OH 5M3FB 1STGA 5I6YA 5C4XG 3ERQA 5FJ8G 2ZXOA 1MIUA 4C3IG 1K8AC 4L5QA 1WD0A 3M4OB 3MZ5A 4DR5Q 3MFYA 1V43A 4K6DA 3TZUA 4YY3L 4JV5Q 2E74C 1KAAA 3S2DH 4K5VA 4Q0FA 1EEFD 2K03A 1HA5A 3IKJA 4HIMA 2O4XA 2F0MA 5CORA 1R4PB 3VYUA 1AP0A 1PRTC 1YNJC 3NXWA 4LAAA 2Z6KA 3TS2A 2VQFQ 3H91A 2Q8TA 2H4OA 2XGTA 3K5MA 4JI4Q 5CGKA 4DK3C 4B3SL 2D62A 1QUQA 1EZ8A 5GAEC 1XMOQ 2PCFB 1EYCA 1RDPD 2LSSA 2PW7A 1CM9A 3GTPH 2UU9L 4WJ3M 2PYKA 5CYUA 1B70B 1I4GA 4UAIA 4UPAA 1RHPA 2JSOA 5ELNA 1SYBA 3GTPB 4JI0Q 4J6HA 4JK1C 1JICA 4NXML 1YHBA 2PO4A 1D6EC 4CKBA 4A3LG 2B39A 3EFXD 1OXUA 1OXSC 5HURA 3WDNA 2NVXB 1L0XB 4LK1C 1AE2A 4BXXH 1HUMA 2AQ3B 4C3JG 3VA7A 2L5TA 1CK1A 3ND9A 4A3CG 1JOOA 1YIJA 4JI3Q 1A2UA 1STHA 5C4ZA 3HKSA 2O2LD 5E3FA 1RL2A 1EU4A 3GV6A 2LY7A 2XTIA 5IY0A 2B2VA 3I55A 1HRJA 1I3QH 2F0HA 4JYAL 4LFCL 1GVPA 4X3TA 3V2TA 1Q81C 3PF4A 1H95A 1BBWA 1LT5D 3HOZG 2VY3A 3RMHA 2E2HH 3NEMA 1PH7A 1KDBA 1AE3A 3TSSA 3J7AF 1HZAA 1STAA 1EY6A 3R2TA 2E2HB 3GQBA 1RD9D 1DD2A 1YHAA 2IWHA 5FLXc 4O42A 4RKLA 4XYQA 3DWAA 1VMPA 1WCMH 5C44H 4GNXC 1CSQA 3PO3G 3OMCA 3BDCA 4R4IA 1E0BA 3BU2A
chains in the Genus database with same CATH topology
1GOZA 1M4VA 3HEJA 2VNUD 1WCMB 3C46A 3IFDA 3M3YB 5KRUA 1HQMC 2H1EA 2NN6G 3I90A 3Q23A 2OXPA 1JQYD 3VR5A 2AQ1B 1Q90A 5FO8B 1TY0A 2EYJA 5C3EB 2B2UC 3I70A 1SEBD 4BA2I 4RH6A 4FYDA 1WTOA 2VB3X 1B2TA 2IJ0A 3V05A 5EBCA 1EYAA 3Q24A 2DY7A 5JPNC 4KKUA 2IL8A 2BE5D 1LACA 1TS2A 5EKIA 2ZT9C 1SE3A 3DEOA 2QDBA 3TBIB 3K7AB 1JWSD 4KTAA 1LTSD 3AB9A 1JB3A 4G4KA 1SYDA 1U4MA 2F0SA 3K6OA 1CZGA 1CTMA 1JORA 3MTSA 5D3DA 2XSCA 3MXGA 3OMGA 5BN3A 5T1IA 2IX0A 2PPBC 5CR3A 5I6WA 4RCNA 3S1QB 1WTQA 1PTOB 2NZ1D 4NMZA 3EJIA 3TP8A 2Z4HA 2HQEA 1CQVA 1Y1WB 1BCPB 2DNEA 1PFMA 3A8IE 5HGTA 1KLGD 5IT9L 1SJED 2EY1A 1FR3A 4DAYA 1EIGA 4ID6A 1V1OA 2MUYA 4K14A 2KOLA 1Z47A 2X6GA 1I6HB 4NKLA 1XXGA 2JEBI 5JJZA 4ODGA 3BYTB 1HTPA 2AQ2B 1EYDA 1KABA 4BWGB 3KLRA 4CKEA 4RKBA 4H0LC 1DONA 2A6HD 4XQQA 1J9OA 1NR4A 1Z7TA 4HCSA 2F03A 5C0XH 4ZLTF 3P7JA 4DAVA 5CBEE 3HKZB 1ESFA 1Y8PB 3NPPA 2SEBD 5KNCA 3A54A 1RODA 1MSHA 1GUOA 5A2QL 2EY2A 1K8OA 2VXWA 3NTHA 5I2XA 1MBYA 3TDQA 1IKMA 3I4MB 4FXGC 1PFBA 5J22A 2F0IA 2DN8A 1PZKD 1STNA 3S17B 1TS5A 2L9HA 3W3AA 4WORA 3D8GA 1ET9A 2MJ8A 1X3QA 1F9SA 2LS01 3NE5B 4IFDI 2IT1A 2HCIA 3DXJC 3GTJB 1EY8A 2BCOA 4IUPA 3D4WA 1PDQA 3DEPA 2NVQB 2RDFA 4BS9A 5I4DA 3D6WA 2CHBD 3NK9A 3J7YW 2NVTB 3M7GA 3Q22A 1STYA 3BYYB 5E1FA 2A69C 2CW0C 3HOWB 3PV0A 1PFNA 3SE0A 4ME5A 4EQOA 4QUFA 1V1PB 1E2VA 5ELFA 1TT2A 5ISRA 2F3VA 2L55A 1T5XD 3GO5A 1F2LA 4XDXA 3M7NA 1ML0D 3T53B 1GJXA 1HCZA 2WKDA 1MSGA 1DOKA 1YNNC 2L1BA 1EWCA 2F0VA 3VYRA 4O1NA 3GV3A 4XXEA 3RZDB 2TSSA 1F77A 3A55A 1WD1A 1QILA 1TQOA 3BVMA 2KQ3A 1S5DD 3WOFA 3I73A 2FMMA 3DWQA 1GUWA 4K2KA 2RSOA 3MEHA 2FJ2A 5JEAJ 3R93A 1ENAA 5FKAC 2KHSA 4TSSA 1JOKA 1G291 1R4QB 1R9TB 3VA5A 3D3RA 3QWNA 2I46A 1E2WA 1D2BA 4HEDA 3AMUA 3F2UA 3FPPA 2D5DA 1M8AA 4PMCA 3TZDA 3TN2A 4C3HB 2K5DA 3KK7A 1BR9A 1SBBB 2TMPA 1GUTA 2K1BA 1ICWA 3KF8A 4F8MA 1SAPA 1LO5D 3RD4A 1QNUA 1U9RA 4XT3B 4P2CB 4OIKA 1JWMD 5JEAG 2Z1CA 5LL6X 4IFDJ 4MIUA 1DM0B 2FINB 1MD2D 4HSVA 1GUNA 1LLRD 1NUCA 2JE6I 1EY7A 4KKTA 2EYMA 1ZYRD 3K58A 4XQNA 3UI2A 2EPBA 3H6MA 3DM1A 3FRPB 1RTOA 1PMRA 2XRQD 4N9TA 4B9WA 2N55A 2XNAC 1ENCA 4ZRZA 1H9RA 4IUUA 2NUCA 5C5MA 3HS0C 3S9WA 4IFDG 5FO9B 4GZYC 4KHZA 2NTTA 3OPOA 2R3ZA 4KY6A 4ZKCB 1EZ6A 4C1NI 3TP6A 3GD7A 5C4HA 2DNCA 5BN5A 2L11A 1I4HA 2D2CC 1X3PA 1ONLA 1WTVA 2ENBA 1KDCA 2EYOA 4KI0A 1SMYD 3K5NA 2QF7A 4L63B 1ENFA 4IUTA 1SJHD 2MGSA 2JP1A 1G2SA 3S1NB 2RVLA 3L7ZC 4Z9CB 1RJTA 4K8IA 2WP8J 3FDTA 3NUCA 2A68D 5COYA 4XQJA 3PIO3 1VF7A 1WTRA 2JA5B 4RCOA 1TS3A 4OO1I 3N52A 4RGNA 2EY6A 3S2DB 1FYCA 2KEDA 2XWBB 5IGEA 2PZTA 2OT2A 2EOTA 2FFKB 3CKIB 1F2MA 4DNRB 1UUPA 1TR5A 2K33A 5IIFA 5EQ0A 1CI3M 4G7ZC 1ESRA 2NBFA 1SNMA 2XRSD 2BA1A 1EY5A 3HZXA 1S5BD 1GUGA 3SXHA 2OF1A 2ID0A 3T56B 3QOJA 4EQPA 3PUYA 2B2TC 3HP3A 4RAUC 1WTXA 5D14A 2K01A 1TIID 3SEBA 2ICIA 3NTIA 4K8JA 3DMUA 4Q5VA 1E2ZA 2HUGA 4DAPA 2EYHA 4A3FB 3N6RA 1A3VA 4IN3A 5EJWA 3HG9A 2ZXPA 5IODA 1PRTD 1YNJD 1STEA 3LWUA 1O80A 1LABA 1I3QB 1S5ED 3FKIB 4TKOB 4FF2A 1HHVA 1W6JA 2PZWA 2Q8IB 4IALA 1I6VC 2A6EC 1A2TA 4IQZA 2SNSA 4RGTA 1LTRD 1V8QA 5EPKA 2K6AA 1B3AA 4E6IA 2F4IA 5C44B 3R8BA 2CQAA 1DXMA 5E4WC 3OIQA 3IL8A 4HTHA 5FLXE 2N88A 5M9OA 1DJRD 1VF5C 4J8QA 3T16A 3EA6A 3GTLB 2A73B 2F0KA 5FLXL 5M5WB 4A93B 2KUMA 3R3OA 1CA6A 3GTQB 5EPJA 2DY8A 1U4LA 1QCBD 4DXFA 1DCZA 2D9UA 4ZKBB 1CHPD 3CRLC 3E6ZX 4C3HG 4KD3A 4L6TB 5JAVA 4S3SA 5JVH3 5EPLA 2B2TA 5I9PA 3GTOB 1UEAB 4CJ2C 1W6KA 2R61A 4QB4A 1HTLD 5JOBA 1H9JA 1SXTA 4OO1G 1QWYA 5IT9E 2PW5A 4RGMA 4CBVA 1AFPA 4KY5A 1AEXA 3VR4A 3BVGA 5A35A 1QNKA 2EE1A 1OXVA 3V96A 1SNQA 2EYFA 2QKIC 3IAYA 1GHKA 3SK6A 5D3IB 5JVG3 5I2YA 4PV1C 3U9OA 1F9QA 3OW7A 3MHBA 4LMQD 2C9OA 1IW7C 5FO7B 4ILWA 4ZK9B 3C1EA 3KLSA 4HAEA 3TP7A 1QG7A 1A3TA 3K5OA 4HCEA 2NTSA 1PRTB 3URYA 2F0QA 3NBIA 3PO2B 1FD7D 5K36G 5IGGA 1WTPA 4V0BA 1EU3A 2B2UA 5A2QE 3WOEA 5C4XB 1KNAA 3DWPA 3NP8A 1B4OA 3D4DA 4C3IB 4U673 2JYOA 1QOHA 4XIGS 5FOBB 5KNBA 1I4PA 1CQFA 1BXTA 3DHQA 2JXMB 1Q1EA 2L4NA 2LMCB 4PQXA 1OXTA 1DZ1A 1IHZA 5IGFA 1G6ZA 1KDAA 2KA7A 3QB3A 3QIAA 2LFNA 3I72A 4FXKC 4C1NK 3PUXA 2ICEC 1G8ZD 3T13A 1K83B 5KEEA 4DNTB 1FNWA 4KD4A 1II3A 3VYSA 4RWSC 1GUSA 1ZXTA 4IUNA 2NVYB 1XX8A 4F88A 3LX0A 1C48A 3EROA 1I4QA 4DK0A 3I91A 1OXXK 1JOQA 1AW7A 3E5SA 4NP5A 4CKCA 5G3LF 2FMCA 1EWHA 5IOCA 3K59A 1GXDC 3VYTA 1F9PA 3QO2A 2G9HD 1CT1D 1Y8NB 2F1MA 3FEWX 3A56A 4F7XA 2E2DC 1LT3D 3S1MB 3HOZB 3Q6SA 2MPMA 4RFBA 1O7LA 3SK5A 1STBA 5DAUA 2J0TD 4EGVA 1SSOA 3AU7A 1Y1VB 2Q8RE 2EZVA 5C0XI 3BDOA 1TWFB 2QCPX 3K57A 1UNSA 4A3MB 2NN6H 4IUVA 1LTAD 3D4RA 3SHLA 3A7AB 3NTKA 2E2JB 1EIHA 4DA2A 1CZWA 4H13C 2RQXA 1SE4A 3P20A 3HOVB 1B9NA 1PTOF 2NWGA 4MHEA 4X3UA 2A69D 3MFGA 2RKSA 2CW0D 2PZUA 1BCPF 1NCVA 1NSNS 4FF4A 5K5PA 2YYZA 3J81E 1FNVA 1D1KA 4I65A 2Y0SB 5JPMC 2SDFA 1TY2A 2EYLA 4CJ1B 4CJ0B 2QILA 3H3VC 3R2IA 3M85A 1G2TA 2XWJB 4KMUC 4ABNA 5T1GA 3J81L 2K04A 4LJZC 2K28A 1YNND 2F0OA 3SK4A 2F0FA 4K6LA 1ILPA 4A3EB 1TVXA 1UAPA 1Q3LA 1VDZA 4R8NA 1D5MC 4RHSA 3BVZA 4C2MB 5TSSA 4XT1B 1JC7A 3GTGB 1DOMA 4QUCA 2F3WA 4ZQ3A 2M9VA 2NB0A 3PIP3 2B2YC 3BS1A 2IPKD 1TWGB 4G57A 4U68A 4FXDA 1B1ZA 2F0LA 1XYIA 3OWFA 3T4AC 3VR2A 4K5WA 5C4JB 1RCVD 4Y7NB 5IGDA 2PMZB 2K32A 3TMEA 1SNPA 2XN9C 1TWAB 4BBSB 4HMJA 3SVMA 2B8GA 1I4XA 2B2VC 1SYCA 5C0XJ 4KHVA 1WVLA 3OWEB 1NAPA 2F0NA 4FF3A 2XIWA 3C1FA 4XTCS 2E2IB 4DF7A 5CV7A 4PMBA 2B2WC 3VR3A 4DXGA 4DK1A 3KUPA 3I8ZA 1TU2B 5G3LD 1PTOC 5CV4A 5J1ZA 1QB5D 2EJMA 4KV6A 3SR1A 2F0UA 1BCPC 1D5XC 1XTCD 2LKVA 1Q1BA 2F0JA 2K05A 1Z6HA 1BO0A 4KK7A 4N9PA 4V190 1I4RA 4HMIA 2I07B 5DM73 4R9WA 5CV8A 3FMCA 5C0XG 5M3MB 5C5LA 5IGBA 4TRDA 2O5JC 4PNYA 1B53A 1QE6A 4RHRA 4FP5D 2BDNA 2IX1A 2WINB 3X3NA 1EY4A 1S5CD 5DEHA 3D6CA 1ZKOA 3NBHA 1QJOA 1HUNA 2HDMA 3NHHA 2QEJC 2WB1B 1RTNA 1EQVA 5E4XA 2NYZD 1FGBD 2IW3A 5EBDA 2B2YA 4J1MA 4KY7A 1TWCB 4A3KB 1D5ZC 2L0CA 1HXYD 4L8JA 1PTOD 1Q12A 1EY0A 1BCPD 1F2YA 4IZ8A 2WKCA 4DGZA 3G7LA 4OIJA 3C2PA 1LTGD 1TKWB 2HCCA 1K8MA 2RDGA 3BG3A 2JA7B 1TS4A 3MXNA 3NSWA 2BA0A 5IGCA 1G91A 4KN7C 4NW2A 3KBXA 5LL6S 3SDZA 3EVQA 3OSOA 5ELCA 2BE5C 3DUZA 2B2WA 1BOSA 1KNEA 3VR6A 1EY9A 1MGSA 1B9MA 2BDOA 3HOYB 1ET6A 3S2HB 3HOXB 3RLFA 2KECA 3CU7A 1SDFA 3QG1A 4QF4A 3BZDB 1AN8A 1BQQT 4BY1B 5KGUA 5AFWA 4R8IA 1BNZA 3MXPA 3T51B 1KLUD 1SFOB 2R6GA 1Y8OB 2XVSA 1NR2A 4KN4C 1HFNA 3H94A 1B50A 4EVOA 3ONAB 1ZEQX 3CHBD 2L12A 1XWEA 1TWHB 1EFID 4WFN3 1VMCA 2J7ZA 1HPCA 5JEAH 2IX3A 3IFTA 2A6ED 2V4DA 3GTMB 4FNFA 3S1RB 3KLSX 4H44C 4PMWA 3NQIA 3O13A 3ZYYX 4QCLA 4M1UB 3RZOB 2HDLA 4KKSA 2MP1A 2VUMB 2G9DA 5CBAE 3MA2B 2KJXA 5I9OA 1PYWD 1C4QA 1EOTA 3NQTA 1LT4D 2A6HC 4IFDH 1PTOH 1H9SA 2M2LA 1S4ZA 1SNDA 4K2LA 3A8KE 1BBXC 5EGTA 3RUZA 1SE2A 4I7ZC 5F2DA 2E75C 1SYGA 2FHTA 2VB2X 3PMFA 1L0YB 3ND8A 1CFMA 3S14B 2EXZA 3LNNA 2R93B 3I4LA 5LHY1 4QIWB 4OL7A 3G6JB 4WJWA 1JCKB 1WTWA 4RGOS 2KCCA 4XYOA 1T5EA 2WIIB 2EY5A 3U9SA 2JA8B 1F2ZA 3L9AX 3MVVA 1LTID 5BN4A 4MN3A 3Q0AA 2F0EA 1V1PA 3X3MA 3A8JE 4DN4M 5CMDA 4TQUS 2GA4B 1U4PA 3P1HA 4DU9A 4K5XA 1FNUA 4FO2A 2J4XA 1ILQA 1VCIA 2M00A 2AUJD 5KYLA 4FF1A 2F0PA 2ZXRA 1IW7D 2WACA 4ZUJA 4DFAA 4ZYSA 2YU9B 4BA1I 2AWNA 2KCNA 2X69A 4UDUC 1SNOA 2Z4IA 1PLFA 3JAME 2EVBA 1O78A 1H9SB 1AZQA 2AWOA 4QMGA 4X3KA 1AZPA 2F0GA 3JAML 1O7YA 4CGYB 4YIJA 1EEID 3CQZB 1LV9A 5J39A 3MAQA 4C3JB 2EYPA 2O5IC 1F9RA 2K5QA 3P75A 1O7ZA 1LTTD 1IYVA 2C5CA 3GP7A 2R7ZB 1EQTA 1PZJD 2CVRA 2A5HA 3H09A 1RF2D 4CHTB 4KJOA 2A74C 2RSNA 5ELEA 1IKLA 3L3OC 5NUCA 2K5WA 3OHXC 3HRZC 1H9KA 3MC0B 1CA5A 1KTKA 5C3XA 4BBRB 2JEAI 2F0WA 3MWYW 5DM63 1SYFA 4B08A 5EKLA 5FK9C 3KBGA 3PUVA 1U4RA 3K0YA 4ZAIA 3PO3B 3ITPA 1I50B 1HFGA 1PZID 4C56C 4ULLA 1JE4A 3S15B 1X32A 5CV5A 5CV6A 5KIXA 5D65A 3J80E 3K5LA 3W2DA 1DOLA 4AYBB 2WAQB 2OEOA 5ELBA 5KNDA 3PUZA 2PQEA 4OGQC 5CV9A 1BUVT 4IURA 4EQNA 3OIPA 3NWSA 2F0DA 1ZYRC 1LTBD 1S5FD 3J80L 1HQRD 2F0TA 2EDGA 1J8IA 5ELDA 4WRDA 4X3SA 2RDHA 4JBWA 4HSPA 3LWEA 1OO9B 5M5YB 3D31A 3C3LA 4ZUIA 1SYEA 1PRTF 4A3DB 1JWUD 3M4YA 2SNMA 3SK8A 3S16B 2WV6D 4M8AA 1RKNA 3QJYA 3PUWA 5EKKA 4B9XA 4HN7A 2AUKA 4OO1H 1DYQA 2SOBA 3BDLA 3I4NB 2BOSA 4FVMA 5DNFA 4A3JB 1H9MA 3FVQA 1CHQD 2K7VA 3J7AV 3I3CA 3QOLA 3E0JA 5C6AA 4A3GB 4OHJA 1JR0D 4A3BB 3NWTA 3H0GB 3MXUA 4A3IB 1SMYC 4BY7B 4H7BA 2Z8LA 3HOUB 1D1IA 2KVMA 4HR7B 1BDOA 2EJGC 1HA6A 4G7HC 1A15A 1Q8IA 3OOCA 1EL0A 4KJNA 2A68C 4F87A 2KEEA 2NN6I 1GHJA 2B8FA 1B44D 5CC4A 3GTKB 1Y69U 5K36H 2E76C 1IYUA 2MHVA 1SNCA 3FPUB 2R92B 1A6XA 5M5XB 3TP5A 1A3UA 4G7OC 2RBMA 5KYIA 2X6LA 3CRKC 3EQLC 1IL8A 2JA6B 2EJFC 1LT6D 4RA8A 1MI2A 3A7LA 1BF4A 2RA4A 5C3WA 3HGBA 4NDXA 2PNRC 2B63B 1PXUA 4IUQA 1C8CA 5M3FB 1STGA 5I6YA 3ERQA 2ZXOA 4C3IG 1WD0A 3M4OB 3MZ5A 3TZUA 3MFYA 4K6DA 1V43A 2E74C 1KAAA 4K5VA 4Q0FA 1EEFD 2K03A 1HA5A 3IKJA 2O4XA 2F0MA 5CORA 1R4PB 3VYUA 1AP0A 1PRTC 1YNJC 3NXWA 4LAAA 3H91A 2Q8TA 2H4OA 3K5MA 5CGKA 2D62A 1EZ8A 2PCFB 1EYCA 1RDPD 2PW7A 1CM9A 2PYKA 5CYUA 1I4GA 4UAIA 1RHPA 2JSOA 3GTPB 1SYBA 4J6HA 4JK1C 1JICA 2PO4A 1D6EC 4CKBA 2B39A 3EFXD 1OXUA 1OXSC 5HURA 3WDNA 2NVXB 1L0XB 4LK1C 1HUMA 2AQ3B 4C3JG 3VA7A 2L5TA 1CK1A 3ND9A 1JOOA 1A2UA 1STHA 5C4ZA 2O2LD 5E3FA 1EU4A 3GV6A 2LY7A 2B2VA 1HRJA 2F0HA 4X3TA 3V2TA 1LT5D 3RMHA 1KDBA 3TSSA 3J7AF 1STAA 1EY6A 3R2TA 2E2HB 3GQBA 1RD9D 1DD2A 2IWHA 4O42A 4RKLA 4XYQA 3DWAA 1VMPA 3OMCA 3BDCA 1E0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0E A;  3D4W A;  5IGD A;  4K14 A;  4PMC A;  2O4X A;  2RDF A;  2F0M A;  5C3X A;  2F0W A;  2PW5 A;  3HEJ A;  3TME A;  1SNP A;  3NK9 A;  4KY5 A;  4NKL A;  1SYF A;  1AEX A;  2RKS A;  3NXW A;  4LAA A;  5EKL A;  1EY0 A;  5KRU A;  4ODG A;  4H7B A;  2PZW A;  2PZU A;  4HMJ A;  3P1H A;  4F8M A;  2OXP A;  4DU9 A;  1F2Y A;  4K8I A;  4IZ8 A;  1EYD A;  4IAL A;  3T13 A;  1NSN S;  5K5P A;  1STY A;  4DGZ A;  2EYJ A;  3ITP A;  4K5X A;  5KEE A;  3NUC A;  1U9R A;  1KAB A;  1SYC A;  5CGK A;  5E1F A;  1A2T A;  2M00 A;  4KHV A;  4KD4 A;  1SNQ A;  2EYF A;  4I65 A;  5KYL A;  1EZ8 A;  1II3 A;  4EQO A;  2F0P A;  2F0N A;  4ME5 A;  3SK6 A;  2EYL A;  2SNS A;  4MIU A;  1EYC A;  1TT2 A;  4IUN A;  5ISR A;  3C1F A;  2WAC A;  4ZUJ A;  2F3V A;  2PW7 A;  4KJN A;  4PMB A;  4RKB A;  3LX0 A;  5CV7 A;  5CV5 A;  5CV6 A;  3U9O A;  4DFA A;  1NUC A;  2PYK A;  2EY6 A;  3ERO A;  4E6I A;  5KIX A;  5CC4 A;  1EYA A;  5IGC A;  1EY7 A;  2EYM A;  3MHB A;  5I9O A;  5IGE A;  1SNO A;  2PZT A;  4HTH A;  2OEO A;  3H6M A;  1JOQ A;  2PQE A;  1SYB A;  2F0O A;  3E5S A;  3NQT A;  4J6H A;  4NP5 A;  5CV9 A;  3SK4 A;  5CV4 A;  2F0F A;  5M9O A;  1SNC A;  4EQN A;  4N9T A;  1F2M A;  5J1Z A;  2QDB A;  3C1E A;  5IOC A;  2F0D A;  3EVQ A;  4KV6 A;  3SR1 A;  3OSO A;  2F0U A;  5HUR A;  4QMG A;  3TP7 A;  1TR5 A;  4KTA A;  3S9W A;  1A3T A;  3TP5 A;  1A3U A;  2F0T A;  4B9W A;  5IIF A;  1SND A;  2LKV A;  4K2L A;  2F0V A;  2F0J A;  2RBM A;  4R8N A;  4WRD A;  3T16 A;  5KYI A;  1EY9 A;  1JOO A;  2F0Q A;  2F0K A;  1SYD A;  2F0S A;  4N9P A;  2F0G A;  4HMI A;  4F7X A;  1A2U A;  1STH A;  1ENC A;  1SNM A;  4YIJ A;  5EGT A;  3RUZ A;  5C4Z A;  5F2D A;  1EY5 A;  3HZX A;  4QB4 A;  5CV8 A;  2EY2 A;  1TQO A;  5IGG A;  5E3F A;  1JOR A;  2KQ3 A;  1SYG A;  2NUC A;  5C5M A;  3SXH A;  5J39 A;  2OF1 A;  5C5L A;  5C3W A;  4TRD A;  5IGB A;  2F0H A;  3QOJ A;  3OMG A;  3R3O A;  4QF4 A;  2F3W A;  3PMF A;  4NDX A;  4PNY A;  3V2T A;  4EQP A;  4ZQ3 A;  2EYP A;  4ZUI A;  1SYE A;  4DF7 A;  2EXZ A;  1EY4 A;  2SNM A;  3NP8 A;  5DEH A;  3SK5 A;  1STB A;  3SK8 A;  3D4D A;  1KDB A;  3D6C A;  5DAU A;  5J22 A;  2F0I A;  3P75 A;  1STN A;  4K2K A;  3MEH A;  3MXP A;  1STA A;  4OL7 A;  5CR3 A;  5I6W A;  1RKN A;  4G57 A;  1ENA A;  1EY6 A;  2KHS A;  1STG A;  5EKK A;  4WOR A;  3D8G A;  4K8J A;  3DMU A;  3ERQ A;  3NHH A;  4B9X A;  5I6Y A;  4KY6 A;  2SOB A;  1EZ6 A;  3BDL A;  3TP6 A;  1JOK A;  5C4H A;  2EYH A;  4NMZ A;  2EY5 A;  1EQV A;  3DHQ A;  3EJI A;  1A3V A;  3TP8 A;  4KD3 A;  4EVO A;  2F0L A;  4KJO A;  3MZ5 A;  2HQE A;  4S3S A;  3VA5 A;  4K6D A;  1F2Z A;  5JAV A;  4RKL A;  1EY8 A;  1IHZ A;  1KAA A;  5NUC A;  5I9P A;  3OWF A;  3SHL A;  5IGF A;  3MVV A;  4J1M A;  5HGT A;  5IOD A;  4KY7 A;  2ENB A;  2EY1 A;  4K5V A;  4K5W A;  3QOL A;  5KGU A;  1KDC A;  2EYO A;  5C6A A;  1KDA A;  3OMC A;  3BDC A;  4ID6 A;  3QB3 A;  5JOB A; 
#chains in the Genus database with same CATH topology
 1GOZ A;  3CPW A;  1M4V A;  5C3E H;  3HEJ A;  2VNU D;  1WCM B;  3C46 A;  2ALY B;  1N32 Q;  3IFD A;  1S3O A;  3M3Y B;  5KRU A;  1HQM C;  2H1E A;  2NN6 G;  2QA4 A;  4B3M Q;  3I90 A;  3Q23 A;  2OXP A;  1JQY D;  3VR5 A;  2AQ1 B;  1Q90 A;  5FO8 B;  1TY0 A;  2EYJ A;  5C3E B;  1IBL Q;  1KQS A;  1QUQ B;  2B2U C;  3I70 A;  1SEB D;  4BA2 I;  4RH6 A;  4FYD A;  1VQI A;  1YHQ A;  1WTO A;  2VB3 X;  4X65 L;  5IYB H;  4GKK Q;  1B2T A;  2IJ0 A;  3V05 A;  2Q2I A;  5EBC A;  1EYA A;  3Q24 A;  3PQI A;  2DY7 A;  5JPN C;  4AQY Q;  1JJG A;  1UE7 A;  3K7A H;  1UEB A;  3BZK A;  4UP8 A;  4KKU A;  2IL8 A;  2BE5 D;  1LAC A;  4POG A;  1TS2 A;  5EKI A;  1JJC B;  2ZT9 C;  4MZ9 A;  1SE3 A;  3DEO A;  2QDB A;  2K52 A;  3TBI B;  3K7A B;  4X62 L;  1JJ2 A;  1JWS D;  4KTA A;  1LTS D;  3AB9 A;  1JB3 A;  4G4K A;  5IYC H;  1O7I A;  4A3D G;  2UXD L;  3GTO H;  1SYD A;  1U4M A;  2F0S A;  4A3E G;  3K6O A;  4JI2 Q;  1BVS A;  1CZG A;  2UUB Q;  1CTM A;  1JOR A;  3MTS A;  5D3D A;  2XSC A;  3MXG A;  3TS0 A;  3OMG A;  5BN3 A;  3EIV A;  5T1I A;  2IX0 A;  3S1Q H;  4A3J G;  4HJ8 A;  2PPB C;  2B3G A;  2IY5 B;  3H3V I;  3Q8D A;  3MEF A;  5CR3 A;  5I6W A;  4RCN A;  4X6A H;  4JG2 A;  1Y1W H;  3S1Q B;  1WTQ A;  4MTK A;  1PTO B;  4A3B G;  2NZ1 D;  4NMZ A;  3PSI A;  4L5S A;  3EJI A;  3TP8 A;  2NZO A;  3H0G G;  2Z4H A;  2HQE A;  1CQV A;  1Y1W B;  1BCP B;  2DNE A;  1PFM A;  3A8I E;  1I6H H;  5HGT A;  1KLG D;  5IT9 L;  1SJE D;  2EY1 A;  1FR3 A;  4DAY A;  1EIG A;  4ID6 A;  1V1O A;  2MUY A;  4K14 A;  2KOL A;  1Z47 A;  4POF A;  2X6G A;  2RCN A;  1I6H B;  1E7Z A;  4NKL A;  1XXG A;  2JEB I;  4DR1 Q;  5JJZ A;  1IBK L;  4ODG A;  3BYT B;  1HTP A;  2AQ2 B;  1EYD A;  3K7U C;  4DV0 L;  1W3S A;  4LFB Q;  1KAB A;  4LWC A;  2CCZ A;  3PO2 H;  4LNQ A;  4BWG B;  3KLR A;  4CKE A;  4RKB A;  4JV5 L;  4PG3 A;  4H0L C;  4CDD C;  1DON A;  3RLN A;  2A6H D;  4XQQ A;  1J9O A;  2Q2T A;  4DKA C;  1UE1 A;  1NR4 A;  1Z7T A;  4HCS A;  4YWK A;  1XPR A;  5IP9 H;  2F03 A;  5C0X H;  4ZLT F;  3P7J A;  4DAV A;  5CBE E;  1EIY B;  2NZH A;  3HKZ B;  1ESF A;  1Y8P B;  3NPP A;  2SEB D;  5KNC A;  4JC0 A;  3A54 A;  1KXL A;  1ROD A;  1E22 A;  2B63 G;  2MFI A;  1MSH A;  1GUO A;  3G48 A;  1FGU A;  5A2Q L;  3I4M H;  4IOA A;  2EY2 A;  1K8O A;  1XMO L;  2Q2H A;  2VXW A;  5M3F G;  4HJA A;  1XNQ L;  3S17 H;  3NTH A;  5I2X A;  1MBY A;  3TDQ A;  2UXB Q;  1IKM A;  3I4M B;  4FXG C;  1Q82 C;  1PFB A;  5J22 A;  2F0I A;  2DN8 A;  1PZK D;  1STN A;  3AEV A;  2YTV A;  4GLV B;  3S17 B;  1TS5 A;  2L9H A;  1K83 H;  3W3A A;  4TVA B;  4JI0 L;  4WOR A;  3D8G A;  1ET9 A;  1SE8 A;  2MJ8 A;  1X3Q A;  3M4Q A;  1Y14 B;  1G51 A;  1F9S A;  2LS0 1;  2K5V A;  5L37 A;  3NE5 B;  4IFD I;  2NVY H;  2IT1 A;  2HCI A;  3DXJ C;  3GTJ B;  1EY8 A;  2BCO A;  4DAY B;  4JI3 L;  4IUP A;  2VW9 A;  3D4W A;  1PDQ A;  3DEP A;  1S40 A;  2RDF A;  2NVQ B;  4BS9 A;  5I4D A;  3D6W A;  2CHB D;  3NK9 A;  3CD6 A;  1G6P A;  3J7Y W;  1YJN A;  2NVT B;  3I7F A;  3M7G A;  3HOW H;  2VS1 A;  3Q22 A;  1STY A;  1K3B C;  3BYY B;  2JQO A;  5E1F A;  1CUK A;  2A69 C;  2CW0 C;  3HOW B;  4NB3 A;  3PV0 A;  1PFN A;  3SE0 A;  4ME5 A;  4EQO A;  1I94 Q;  4QUF A;  4RMF A;  1V1P B;  1E2V A;  5ELF A;  1CKN A;  1E24 A;  1V1Q A;  1HZ9 A;  1TT2 A;  3I4O A;  5ISR A;  3ZJY C;  1NJI C;  2F3V A;  2L55 A;  1T5X D;  3GO5 A;  1F2L A;  4XDX A;  1VQN A;  1KHI A;  3M7N A;  3FP9 A;  3ICE A;  1ML0 D;  3T53 B;  1GJX A;  4DV4 Q;  1HCZ A;  1Y1V H;  4LUO A;  3RZD H;  3RN2 A;  2WKD A;  1MSG A;  1VQC A;  1XTD A;  1N32 L;  1DOK A;  1TWF H;  1YNN C;  2L1B A;  4MTN A;  4A3M H;  4B3M L;  1EWC A;  2F0V A;  3PCO B;  3J80 c;  3VYR A;  4O1N A;  3GV3 A;  4XXE A;  4DR7 Q;  4LF8 Q;  1IBL L;  3RZD B;  3JC6 6;  1JMC A;  2TSS A;  1F77 A;  3A55 A;  1WD1 A;  5IYD H;  1QIL A;  1TQO A;  1N33 Q;  2KCT A;  3BVM A;  2KQ3 A;  3F2C A;  4CDE C;  4R4T A;  1S5D D;  4LF4 L;  3WOF A;  4IPC A;  3J81 c;  3I73 A;  2A1A A;  2FMM A;  1YBY A;  4GKK L;  3DWQ A;  5IP7 H;  4JPB W;  1GUW A;  4AQY L;  4JI8 Q;  1UE5 A;  4K2K A;  2RSO A;  4K0K L;  3MEH A;  2FJ2 A;  1UE6 A;  1R9T H;  5JEA J;  3R93 A;  1ENA A;  5FKA C;  2KHS A;  4GN5 A;  3B6Y A;  4TSS A;  1JOK A;  1G29 1;  1R4Q B;  1R9T B;  1FJG Q;  3VA5 A;  3D3R A;  1WCM G;  3QWN A;  2I46 A;  3L2P A;  1HR0 Q;  1E2W A;  1D2B A;  4HED A;  4JI2 L;  3J81 j;  3AMU A;  3F2U A;  3FPP A;  1YJ9 A;  4JI5 L;  2UUB L;  5C3E G;  2D5D A;  1EYG A;  4OX9 Q;  1M8A A;  4PMC A;  3TZD A;  3TN2 A;  4C3H B;  2K5D A;  3KK7 A;  4IOC A;  1BR9 A;  1SBB B;  5BR8 Q;  2TMP A;  1GUT A;  1HNZ Q;  2K1B A;  1ICW A;  3KF8 A;  4P73 A;  4F8M A;  1SAP A;  1YJW A;  1LO5 D;  3RD4 A;  1QNU A;  1U9R A;  3T1Y Q;  2ZJQ A;  4XT3 B;  4P2C B;  4OIK A;  1GKH A;  1JWM D;  1CKN B;  5JEA G;  2Z1C A;  3TRE A;  1PH1 A;  4C2M H;  1AH9 A;  5LL6 X;  4IFD J;  1DM0 B;  2FIN B;  1MD2 D;  4MIU A;  5IYB G;  4HSV A;  1VQM A;  2Y0S E;  3F2D A;  1GUN A;  1LLR D;  1NUC A;  2A19 A;  2JE6 I;  1VQ6 A;  4QY7 A;  1K73 C;  1EY7 A;  4KKT A;  2EYM A;  1ZYR D;  3K58 A;  4XQN A;  1J6Q A;  4DV3 Q;  3UI2 A;  2EPB A;  3H6M A;  3DM1 A;  5LMN Q;  3FRP B;  1RTO A;  1PMR A;  2XRQ D;  4N9T A;  4LFA Q;  3RLO A;  1QZG A;  1PHJ A;  4DR1 L;  2PNH A;  3KJO A;  1XMQ L;  2C35 B;  4B9W A;  3CCJ A;  4JBJ A;  2N55 A;  4LFB L;  2XNA C;  3ER0 A;  1ENC A;  4ZRZ A;  1H9R A;  4IUU A;  4DAM A;  2NUC A;  5C5M A;  3HS0 C;  3S9W A;  4IFD G;  2UUA Q;  2A8V A;  5FO9 B;  4DV1 Q;  4GZY C;  4BBS H;  1N34 Q;  4DK6 C;  4KHZ A;  1X3E A;  5AJ3 L;  3CAM A;  3L0O A;  2HIV A;  2NTT A;  3OPO A;  1QVF A;  4YHH Q;  2R3Z A;  1PV4 A;  4KY6 A;  3A74 A;  2R93 G;  4ZKC B;  1EZ6 A;  4C1N I;  3TP6 A;  3GD7 A;  1N36 Q;  1Q86 C;  5C4H A;  2DNC A;  5BN5 A;  2L11 A;  1I4H A;  2D2C C;  1X3P A;  1ONL A;  2L15 A;  4DV7 L;  1WTV A;  1ICF B;  1C0A A;  2ENB A;  1J5E L;  1KDC A;  2EYO A;  4KI0 A;  1SMY D;  3K5N A;  2QF7 A;  4L63 B;  1HNW L;  4DNI A;  3F8T A;  5JJI A;  1ENF A;  4IUT A;  3U4V A;  1SJH D;  3W5O A;  2MGS A;  2JP1 A;  1G2S A;  1EIF A;  3S1N B;  2RVL A;  3KF8 B;  3L7Z C;  1IZ6 A;  4Z9C B;  3AQQ A;  2JA5 H;  2E5L L;  1RJT A;  1EFW A;  4K8I A;  1PYB A;  1Q8K A;  2G5D A;  2KHJ A;  4JOI A;  2WP8 J;  1PH2 A;  1VQH A;  3FDT A;  4DR4 Q;  3NUC A;  2A68 D;  5COY A;  4XQJ A;  3PIO 3;  1VF7 A;  1WTR A;  2JA5 B;  4RCO A;  2UUC L;  1TS3 A;  4OO1 I;  3N52 A;  3K0X A;  4RGN A;  1X9N A;  1PH5 A;  1X6O A;  5M3M H;  3STB C;  5HGQ A;  1PH4 A;  3HKZ G;  2EY6 A;  3S2D B;  1FYC A;  2KED A;  2XWB B;  3HFZ B;  5IGE A;  2PZT A;  2OT2 A;  2EOT A;  5DLQ E;  1PH3 A;  1A63 A;  2FFK B;  3CKI B;  1IXR A;  1F2M A;  4DNR B;  1WTH A;  2F3I A;  1UUP A;  1TR5 A;  1IL2 A;  2K33 A;  1MKH A;  1VQL A;  1WOC A;  5IIF A;  3OTO Q;  1B3Q A;  5EQ0 A;  1CI3 M;  3TEH B;  4G7Z C;  1ESR A;  2NBF A;  2K50 A;  1SNM A;  2XRS D;  4A3K H;  2BA1 A;  1EY5 A;  3HZX A;  1S5B D;  1GUG A;  3J7A 5;  3SXH A;  2OF1 A;  2ID0 A;  3T56 B;  3QOJ A;  4EQP A;  1Q7Y C;  2OWO A;  1VS0 A;  3PUY A;  2B2T C;  3HP3 A;  4RAU C;  1WTX A;  2DJG C;  4A3F H;  5D14 A;  2K01 A;  1TII D;  2DJF C;  3SEB A;  2ICI A;  3NTI A;  4K8J A;  3DMU A;  4Q5V A;  1E2Z A;  1BBU A;  2HUG A;  4DAP A;  2EYH A;  4UY8 C;  4A3F B;  3N6R A;  1A3V A;  4IN3 A;  2R7Z G;  2WB1 E;  5EJW A;  2JA7 H;  1MJC A;  3HG9 A;  4LF8 L;  2ZXP A;  5IOD A;  1PRT D;  1YNJ D;  3FKI H;  2PI2 A;  1STE A;  1N33 L;  3LWU A;  1O80 A;  1LAB A;  2CKZ B;  1I3Q B;  4X66 L;  1S5E D;  3FKI B;  3F1Z A;  4TKO B;  4FF2 A;  1HHV A;  1W6J A;  2PZW A;  2Q8I B;  1PYS B;  4DR6 Q;  4JI8 L;  4IAL A;  4BBR G;  4DV2 L;  1I6V C;  2A6E C;  4JI6 Q;  3HOY H;  2RF4 A;  3K81 C;  1A2T A;  4IQZ A;  3HOX H;  3BZC A;  4GOP C;  2CFM A;  1HNX Q;  2SNS A;  1L1O C;  4RGT A;  1LTR D;  1V8Q A;  5EPK A;  2K6A A;  1B3A A;  4E6I A;  2F4I A;  5C44 B;  3R8B A;  2CQA A;  1VQ7 A;  1DXM A;  4BY1 H;  5E4W C;  3OIQ A;  3IL8 A;  4HTH A;  1NY4 A;  5LMU L;  5FLX E;  2N88 A;  5M9O A;  2B29 A;  1KRT A;  4EX5 A;  3GTL H;  1DJR D;  1VF5 C;  4J8Q A;  5M5W H;  1Z9F A;  1K28 A;  4AYB G;  2WAQ G;  4A93 H;  2LXJ A;  3T16 A;  4GKJ L;  3EA6 A;  1X56 A;  3GTL B;  2A73 B;  2F0K A;  3AFQ A;  1TWH H;  3T1Y L;  5FLX L;  5M5W B;  2N49 A;  4DUY Q;  4A93 B;  4KLK A;  3GTQ H;  2KUM A;  3R3O A;  1CA6 A;  1DGS A;  4EQ5 A;  3PIP A;  2GVB A;  2K75 A;  3GTQ B;  5EPJ A;  5LMN L;  5JJK A;  2DY8 A;  1U4L A;  1QCB D;  4DXF A;  1DCZ A;  2D9U A;  4ZKB B;  1CHP D;  1FVI A;  3CRL C;  2MO0 A;  3E6Z X;  4C3H G;  4KD3 A;  4L6T B;  5JAV A;  4S3S A;  5JVH 3;  5EPL A;  1PH8 A;  2B2T A;  4JI7 Q;  4HJ7 A;  5I9P A;  4IPG A;  3GTO B;  3F2B A;  2VUM H;  5IE8 A;  3I4N G;  1UEA B;  2DUD A;  4CJ2 C;  1W6K A;  2R61 A;  4QB4 A;  4GS3 A;  1HTL D;  5JOB A;  1H9J A;  4OWX B;  1B7Y B;  1LUZ A;  1JT8 A;  1SXT A;  2HHH L;  4OO1 G;  1QWY A;  5IT9 E;  2PW5 A;  4RGM A;  4CBV A;  1AFP A;  4KY5 A;  2UUA L;  1AEX A;  3VR4 A;  4A3G G;  4IPD A;  4DV1 L;  3BVG A;  3CME A;  1N34 L;  5FLM G;  4PZ6 A;  5A35 A;  1QNK A;  2EE1 A;  4JCV E;  2D0P A;  4A3I G;  1OXV A;  3V96 A;  4YHH L;  1SNQ A;  2EYF A;  4BY7 G;  4AIM A;  2QKI C;  3IAY A;  1GHK A;  3J81 i;  3SK6 A;  3HOU G;  1N36 L;  5D3I B;  2EXD A;  2PI2 E;  4L5R C;  5JVG 3;  2CQO A;  4PV1 C;  5I2Y A;  3U9O A;  4B3R L;  4YWL A;  1F9Q A;  3OW7 A;  4DV6 Q;  3RR5 A;  1E1O A;  3AFP A;  4R4Q A;  3MHB A;  1C9O A;  4LMQ D;  2C9O A;  1IW7 C;  5FO7 B;  4ILW A;  4ZK9 B;  1WI5 A;  4GNX A;  2ATW A;  3C1E A;  3KLS A;  4GN3 B;  4HAE A;  3TP7 A;  1QG7 A;  1A3T A;  3K5O A;  4HCE A;  2NTS A;  1PRT B;  3PGZ A;  3URY A;  1VQB A;  2JA8 H;  1VQ4 A;  4DR5 L;  2F0Q A;  4DR4 L;  2R92 G;  3NBI A;  3PO2 B;  1VQ9 A;  1FD7 D;  5K36 G;  5C4X H;  4ALP A;  5FJ8 H;  5IGG A;  3CCQ A;  4C3I H;  1WTP A;  4V0B A;  1EU3 A;  2B2U A;  2JA6 G;  5A2Q E;  3WOE A;  5C4X B;  1KNA A;  3DWP A;  3NP8 A;  1B4O A;  3D4D A;  4C3I B;  2HD3 A;  3K80 C;  2VQF L;  3CF5 A;  4U67 3;  2JYO A;  2N8N A;  4LF5 Q;  1QOH A;  3A0J A;  4XIG S;  4JI4 L;  5FOB B;  5KNB A;  1I4P A;  1CQF A;  1BXT A;  1SN8 A;  3JAM c;  3DHQ A;  2JXM B;  1Q1E A;  2L4N A;  2LMC B;  4PQX A;  1OXT A;  3E9H A;  1DZ1 A;  1IHZ A;  3CC4 A;  1K0R A;  5IGF A;  3UE1 A;  2YU9 H;  1M90 C;  3M4P A;  1G6Z A;  1XPO A;  1KDA A;  2GN5 A;  2YV5 A;  2KA7 A;  3QB3 A;  2HIX A;  3QIA A;  4OEM B;  2LFN A;  3I72 A;  3LGJ A;  4FXK C;  2DGY A;  4C1N K;  2JA5 G;  4PZ8 A;  2Z0S A;  3PUX A;  3VDY A;  2ICE C;  1PA6 A;  1G8Z D;  3T13 A;  1K83 B;  3EBE A;  5KEE A;  2D0O A;  4CDC C;  4DNT B;  1FNW A;  4KD4 A;  3T1H Q;  1II3 A;  4ZCK A;  4P75 A;  4RWS C;  3VYS A;  4A3L H;  1GUS A;  1ZXT A;  4IUN A;  2NVY B;  1XX8 A;  3CW2 C;  4F88 A;  3LX0 A;  1C48 A;  4C3J H;  4A3C H;  3ERO A;  1I4Q A;  4IJH A;  4DK0 A;  2KCM A;  3OW2 A;  3I91 A;  1OXX K;  4YCV A;  4GNX B;  1JOQ A;  1AW7 A;  2K5H A;  4GLA C;  3E5S A;  4NP5 A;  4CKC A;  5G3L F;  2FXQ A;  2FMC A;  1EWH A;  5IOC A;  3K59 A;  2I5M X;  1GXD C;  3ULP A;  3S1M H;  2YTY A;  3HOZ H;  3VYT A;  5ELO A;  4LUZ A;  4DR6 L;  1F9P A;  3QO2 A;  3G71 A;  3H15 A;  2G9H D;  1CT1 D;  1Y8N B;  2F1M A;  1V9P A;  3FEW X;  4B3S Q;  3A56 A;  1P8L A;  4F7X A;  2E2D C;  3CCU A;  3IRB A;  1LT3 D;  3S1M B;  3HOZ B;  2EQS A;  2QEX A;  4WJ4 A;  2JK8 A;  1EQR A;  4AH6 A;  3Q6S A;  4A4I A;  2MPM A;  4RFB A;  1K0S A;  3QR8 A;  4BXX G;  4UP9 A;  5GAG C;  1O7L A;  3SK5 A;  1STB A;  5DAU A;  4APV A;  1EWI A;  2J0T D;  2PQA A;  5GQO A;  4EGV A;  1SSO A;  2P5Z X;  3CCE A;  1I50 H;  3SGI A;  4KHP Q;  1VQP A;  3AU7 A;  1Y1V B;  2Q8R E;  2EZV A;  2E2J H;  5C0X I;  3BDO A;  1TWF B;  5EAY A;  2QCP X;  1U5K A;  3K57 A;  1UNS A;  3GDE A;  4A3M B;  2NN6 H;  4IUV A;  1LTA D;  2EIF A;  1A62 A;  3D4R A;  3FKI G;  1IYJ B;  3U58 A;  3HOV H;  3SHL A;  3A7A B;  3NTK A;  2E2J B;  1EIH A;  4DA2 A;  1CZW A;  4H13 C;  2OQ0 A;  1KD1 C;  2RQX A;  1SE4 A;  4JYA Q;  3W1G A;  4LFC Q;  3P20 A;  4HJ9 A;  3HOV B;  1B9N A;  1PTO F;  3TQY A;  2NWG A;  4MHE A;  4X3U A;  2A69 D;  3MFG A;  2RKS A;  3D0F A;  1YI2 A;  2CW0 D;  2PZU A;  1BCP F;  4P71 A;  1NCV A;  1NSN S;  4FF4 A;  5K5P A;  1QVC A;  1FL0 A;  2YYZ A;  5C44 G;  3J81 E;  1FNV A;  2JA9 A;  1D1K A;  4I65 A;  2Y0S B;  5JPM C;  2SDF A;  1TY2 A;  1X3F A;  2KHI A;  1NTG A;  2EYL A;  4CJ1 B;  3PF5 A;  3A5U A;  4CJ0 B;  1UWV A;  2QIL A;  5M5Y H;  3H3V C;  3R2I A;  3M85 A;  1G2T A;  2XWJ B;  3G6E A;  4JI7 L;  2I0Q A;  4KMU C;  2I5H A;  4ABN A;  5T1G A;  3S24 A;  3J81 L;  4A3E H;  2K04 A;  4LJZ C;  2K28 A;  3K8A A;  1YNN D;  1VQO A;  1NBW A;  1K8G A;  2F0O A;  3SK4 A;  2F0F A;  4K6L A;  1ILP A;  4A3E B;  3UDI A;  1TVX A;  1UAP A;  1GO3 E;  4A3J H;  3RNU A;  1Q3L A;  2VQE Q;  1VDZ A;  2F52 A;  4R8N A;  3GTG H;  1D5M C;  4RHS A;  3BVZ A;  1SR3 A;  1QVG A;  4C2M B;  5TSS A;  2Z6K C;  4JI1 Q;  4XT1 B;  1KIX A;  1JC7 A;  4A3B H;  2OTL A;  1TWG H;  3GTG B;  1DOM A;  4QUC A;  2F3W A;  1EQQ A;  4ZQ3 A;  2M9V A;  2VL6 A;  2PQA B;  2NB0 A;  3PIP 3;  2B2Y C;  3BS1 A;  1RIP A;  5IYC G;  2IPK D;  4R4C A;  1TWG B;  1NE3 A;  2ZTD A;  4G57 A;  4DV5 Q;  2I5L X;  3AYH B;  1VQA A;  1M1K C;  4X62 Q;  4U68 A;  5C4J H;  4FXD A;  4N8X 1;  4Y7N H;  1B1Z A;  2F0L A;  1XYI A;  4DR2 Q;  2ZJP A;  5JJL A;  2OTJ A;  3OWF A;  5GAH C;  3T4A C;  3VR2 A;  4Y52 H;  4K5W A;  5C4J B;  1TWA H;  3GTK H;  1RCV D;  1GM5 A;  1XNR Q;  4Y7N B;  1K9M C;  2ZM6 Q;  5IGD A;  1Y1W G;  2PMZ B;  1SRU A;  4LF7 Q;  4DPG A;  2K32 A;  4JVZ A;  3TME A;  1SNP A;  4MNO A;  2XN9 C;  1TWA B;  1C7Y A;  4BBS B;  4HMJ A;  3SVM A;  2QGQ A;  1XJV A;  2B8G A;  1I4X A;  4LF5 L;  2E2I H;  1LYL A;  2B2V C;  1SYC A;  5C0X J;  4KHV A;  1WVL A;  3OWE B;  2ES2 A;  1NAP A;  2F0N A;  4FF3 A;  2XIW A;  3E3X A;  3C1F A;  4XTC S;  2E2I B;  4DF7 A;  5CV7 A;  4PMB A;  2B2W C;  4NXN Q;  3CCR A;  1WYD A;  3VR3 A;  1Q46 A;  1GD7 A;  4DXG A;  2B63 H;  2UXB L;  1SRO A;  2PMZ E;  4DK1 A;  3KUP A;  3I8Z A;  3G4S A;  3PO2 G;  1TU2 B;  5G3L D;  1PTO C;  5M3F H;  5CV4 A;  1IBK Q;  5J1Z A;  3ULL A;  1QB5 D;  2EJM A;  4KV6 A;  3SR1 A;  2F0U A;  1BCP C;  1D5X C;  1XTC D;  2LKV A;  1Q1B A;  2F0J A;  2K05 A;  1Z6H A;  1D7Q A;  1BO0 A;  4KK7 A;  4ME3 A;  4N9P A;  4V19 0;  1I4R A;  4HMI A;  2I07 B;  5DM7 3;  4R9W A;  5CV8 A;  4B3T Q;  3T1H L;  3WWV A;  3FMC A;  5IP9 G;  5C0X G;  4LUV A;  5C5L A;  5IGB A;  4TRD A;  5M3M B;  2O5J C;  2N78 A;  5J3B A;  4PNY A;  2YTX A;  4JW0 A;  5LMN W;  1JB7 A;  1B53 A;  1QE6 A;  4RHR A;  4YCW A;  2ZJR A;  4FP5 D;  2BDN A;  1PH6 A;  2WIN B;  2IX1 A;  3X3N A;  1EY4 A;  1S5C D;  5DEH A;  3D6C A;  1ZKO A;  4LF9 Q;  3NBH A;  1QJO A;  1HUN A;  1E3P A;  2HDM A;  4R1J A;  3NHH A;  2QEJ C;  3I4M G;  1CKM A;  2WB1 B;  1P16 A;  1TWC H;  1RTN A;  1YNX A;  2ZTE A;  1EQV A;  5E4X A;  2NYZ D;  1FGB D;  1I94 L;  2IW3 A;  4GLX A;  5EBD A;  1JE5 A;  2B2Y A;  4J1M A;  4KY7 A;  1TWC B;  4A3K B;  1D5Z C;  2L0C A;  1TXY A;  1XNQ Q;  1HXY D;  4L8J A;  1PTO D;  1Q12 A;  4DV4 L;  1CSP A;  4IO9 A;  1EY0 A;  3E0E A;  1HZB A;  3DLL A;  1BCP D;  2NVX H;  4OWW B;  1F2Y A;  4IZ8 A;  1VQ5 A;  2WKC A;  4DGZ A;  3CXC A;  3STB D;  4KHP L;  3G7L A;  3UE0 A;  4OIJ A;  1QZH A;  3C2P A;  1LTG D;  4DR7 L;  3A5Z B;  3KDF A;  1TKW B;  2JJQ A;  2HCC A;  4OXP A;  1K8M A;  2RDG A;  3CP0 A;  3BG3 A;  2JA7 B;  1TS4 A;  3MXN A;  3NSW A;  2BA0 A;  3HOW G;  3H3V H;  5IGC A;  3NEL A;  1G91 A;  3I2Z A;  3KF6 A;  2OCE A;  4KN7 C;  4NW2 A;  3ULJ A;  3KBX A;  2LXK A;  5LL6 S;  3SDZ A;  3JAM i;  3S2H H;  3EVQ A;  3OSO A;  5ELC A;  3TRZ A;  2BE5 C;  3DUZ A;  2B2W A;  1BOS A;  1YIT A;  1KNE A;  3VR6 A;  1EY9 A;  1MGS A;  1B9M A;  1BKB A;  2BDO A;  1FJG L;  3HOY B;  1PVO A;  1ET6 A;  3S2H B;  1HR0 L;  3HOX B;  3RLF A;  4GN4 B;  2KEC A;  3CU7 A;  1SDF A;  2CWA A;  1L0W A;  3QG1 A;  1Y1V G;  4OX9 L;  4QF4 A;  3BZD B;  1SFO H;  1AN8 A;  1BQQ T;  3M3Y H;  4BY1 B;  1L2F A;  4A3M G;  5BR8 L;  5KGU A;  5AFW A;  4HID A;  3NBH B;  1HNZ L;  4R8I A;  4X64 Q;  1BNZ A;  3MXP A;  3ERS X;  3T51 B;  1KLU D;  1SFO B;  2R6G A;  1Y8O B;  2XVS A;  4UHV A;  5IYD G;  4FDB A;  1NR2 A;  4OWT B;  4KN4 C;  1HFN A;  3H94 A;  3KYH C;  1B50 A;  3HOV G;  4EVO A;  3ONA B;  1ZEQ X;  3CHB D;  2L12 A;  1XWE A;  2VQE L;  5IP7 G;  1TWH B;  1EFI D;  3GTM H;  3S1R H;  1LTL A;  4WFN 3;  1VMC A;  4LF4 Q;  2J7Z A;  1HPC A;  5JEA H;  2IX3 A;  4JI1 L;  3IFT A;  4DV3 L;  2Z6B A;  2A6E D;  2Y0S G;  1KAW A;  2V4D A;  3GTM B;  4FNF A;  3S1R B;  3KLS X;  4LFA L;  4H44 C;  4K0K Q;  1IBM Q;  2IHF A;  4PMW A;  4IJL A;  2Q2U A;  3RZO H;  4A76 A;  3KDF B;  3NQI A;  4DV5 L;  3O13 A;  2RCF A;  3ZYY X;  2HQL A;  4QCL A;  2RHS B;  4M1U B;  5IT9 c;  3MXN B;  1A0I A;  3RZO B;  2HDL A;  3J7Z C;  4KKS A;  2MP1 A;  4DR2 L;  4DR3 Q;  5HY6 A;  2VUM B;  2G9D A;  5CBA E;  4JI5 Q;  1KL9 A;  3MA2 B;  1D8L A;  3KF6 B;  2KJX A;  5I9O A;  1XNR L;  3J80 i;  1PYW D;  1C4Q A;  2ZM6 L;  4OEL B;  1EOT A;  3NQT A;  4LF7 L;  1LT4 D;  3DM3 A;  2A6H C;  4IFD H;  2N3S A;  1PTO H;  1H9S A;  2E8G A;  2M2L A;  1X55 A;  1S4Z A;  1SND A;  4K2L A;  1VQK A;  2MQH A;  2UXC Q;  3A8K E;  1BBX C;  5EGT A;  3RUZ A;  1SE2 A;  4I7Z C;  5F2D A;  3S14 H;  2E75 C;  2R93 H;  1SYG A;  2JN4 A;  2FHT A;  2VB2 X;  3I56 A;  3PMF A;  1YEZ A;  4GOP A;  1L0Y B;  3ND8 A;  4NXN L;  1CFM A;  3S14 B;  2EXZ A;  1L1O A;  2KEN A;  3LNN A;  2R93 B;  3I4L A;  5LHY 1;  4QIW B;  4OL7 A;  3NEN A;  3G6J B;  3CCL A;  4WJW A;  1JCK B;  4OON A;  1WTW A;  2F4V Q;  4RGO S;  4JBK A;  2KCC A;  4XYO A;  1XMQ Q;  1T5E A;  2WII B;  2EY5 A;  3U9S A;  2JA8 B;  1A8V A;  2MNA A;  1F2Z A;  1YZ6 A;  3L9A X;  4BBS G;  3MVV A;  1LTI D;  3PIO A;  2V1C C;  4DUZ Q;  5BN4 A;  1W2B A;  4MN3 A;  1CKO A;  4B3T L;  2QDL A;  3Q0A A;  2F0E A;  1V1P A;  3X3M A;  5GAD C;  1E1T A;  2Z9H A;  3A8J E;  4DN4 M;  5CMD A;  1MJE A;  4TQU S;  3CMA A;  2GA4 B;  1HH2 P;  4QIW E;  5AJ3 Q;  1U4P A;  3P1H A;  2BH8 A;  4DU9 A;  5IWA Q;  3CCV A;  4O0A A;  4LF9 L;  3CC7 A;  4K5X A;  3OTO L;  1FNU A;  4FO2 A;  2J4X A;  1ILQ A;  1HJP A;  1VCI A;  4LF6 Q;  2M00 A;  2AUJ D;  5KYL A;  4FF1 A;  1WJJ A;  2F0P A;  2ZXR A;  1IW7 D;  2WAC A;  4ZUJ A;  4DFA A;  4DV7 Q;  4ZYS A;  1J5E Q;  1X54 A;  2YU9 B;  4BA1 I;  2AWN A;  1HNW Q;  2KCN A;  5GRO A;  4RG1 A;  4YWM A;  2X69 A;  4UDU C;  1SNO A;  2Z4I A;  1PLF A;  1ASZ A;  3U50 C;  3JAM E;  2EVB A;  2R7D A;  1YVC A;  1O78 A;  3CCS A;  1H9S B;  4N8F A;  1AZQ A;  1MHW C;  2E5L Q;  2AWO A;  4L5T A;  4QMG A;  2HT1 A;  4X3K A;  5M3M G;  3CQZ H;  4YY3 Q;  1AZP A;  3GTJ H;  3HKZ E;  1WFQ A;  3CCM A;  2F0G A;  3JAM L;  1O7Y A;  4CGY B;  4YIJ A;  2UUC Q;  1EEI D;  2AKW B;  4IPH A;  2RHQ B;  1LV9 A;  3CQZ B;  5J39 A;  4GOP B;  3MAQ A;  2NVQ H;  2CWP A;  2R7Z H;  2WB1 G;  4C3J B;  1PFS A;  4P74 A;  1L1O B;  4HJ5 A;  2EYP A;  2O5I C;  1F9R A;  4H02 A;  1T9H A;  2NVT H;  1N8R C;  2K5Q A;  4NPS A;  1HZC A;  3M9B A;  3W1B A;  3RN5 A;  3P75 A;  1VQG A;  1O7Z A;  2ZTC A;  1LTT D;  1IYV A;  4QJF A;  2C5C A;  3GP7 A;  2R7Z B;  1EQT A;  4A3K G;  1PZJ D;  4JI6 L;  3OYY A;  1SLJ A;  2CVR A;  1I5F A;  2A5H A;  3H09 A;  1RF2 D;  4CHT B;  1HNX L;  4KJO A;  2A74 C;  2RSN A;  5ELE A;  4HIO A;  1IKL A;  4P72 A;  3L3O C;  5NUC A;  2UU9 Q;  4BBR H;  2K5W A;  3OHX C;  4LW1 A;  4A3F G;  3HRZ C;  1H9K A;  2IHE A;  3MC0 B;  1CA5 A;  3PO3 H;  1KTK A;  5C3X A;  2GVA A;  4NXM Q;  4BBR B;  2JEA I;  2F0W A;  1VQD A;  3MWY W;  5DM6 3;  1SYF A;  4B08 A;  5EKL A;  5FK9 C;  3KBG A;  2VZA A;  3PUV A;  4QL5 A;  1U4R A;  3K0Y A;  4ZAI A;  4JBM A;  2JA7 G;  3S15 H;  3PO3 B;  2R7F A;  4X64 L;  3ITP A;  1I50 B;  1HFG A;  1PZI D;  3KLW A;  4UP7 A;  4C56 C;  4ULL A;  1JE4 A;  2BH2 A;  2K4K A;  3S15 B;  1VQF A;  1X32 A;  4DUY L;  5CV5 A;  5CV6 A;  4QGU A;  3UDF A;  5KIX A;  5D65 A;  4YCU A;  3J80 E;  3W2D A;  3K5L A;  3KOJ A;  2K5N A;  1DOL A;  4AYB B;  4X66 Q;  2WAQ B;  2OEO A;  1KRS A;  5ELB A;  3HOY G;  5KND A;  3PUZ A;  2PQE A;  4OGQ C;  5CV9 A;  4A75 A;  3HOX G;  1BUV T;  2KBN A;  4IUR A;  4EQN A;  2ASB A;  3OIP A;  3NWS A;  5E7N A;  4QQB X;  2F0D A;  1ZYR C;  1LTB D;  1S5F D;  3J80 L;  1IBM L;  4DV2 Q;  1HQR D;  2F0T A;  2EDG A;  1J8I A;  5ELD A;  3CC2 A;  4WRD A;  2OQK A;  4BY1 G;  1X65 A;  4A3D H;  4X3S A;  3BJU A;  2CH4 A;  2RDH A;  1S72 A;  4JBW A;  4HSP A;  3LWE A;  1OO9 B;  1K3R A;  3S16 H;  2H5X A;  5M5Y B;  3D31 A;  4C3H H;  4J15 A;  4JOI C;  3C3L A;  4DR3 L;  4ZUI A;  2CH4 W;  1B8A A;  1PRT F;  1SYE A;  4AYB E;  4A3D B;  1JWU D;  2WAQ E;  3M4Y A;  4I7A A;  2QW7 A;  2SNM A;  4A93 G;  3SK8 A;  3I4N H;  3UDG A;  3S16 B;  5LMU Q;  1NNX A;  2WV6 D;  2K14 A;  1VQE A;  4M8A A;  3U4Z A;  1RKN A;  2WFW A;  3QJY A;  3PUW A;  1N9W A;  5EKK A;  4B9X A;  4HN7 A;  2AMC B;  1SMX A;  2AUK A;  4PZ7 A;  4OO1 H;  1DYQ A;  2SOB A;  3BDL A;  5H1S E;  3I4N B;  2BOS A;  1ASY A;  4FVM A;  5DNF A;  3KFU A;  4A3G H;  4A3J B;  4GKJ Q;  1H9M A;  5FLM H;  3FVQ A;  4X65 Q;  1CHQ D;  2K7V A;  3H0G H;  2UXC L;  3J7A V;  3I3C A;  4A3I H;  1LM0 A;  3QOL A;  3E0J A;  5C6A A;  4DV6 L;  4A3G B;  4OHJ A;  4BY7 H;  1EOV A;  1JR0 D;  3HOU H;  4A3B B;  3NWT A;  1NMG A;  3H0G B;  4O2D A;  3MXU A;  4A3I B;  1SMY C;  4BY7 B;  4H7B A;  2Z8L A;  3HOU B;  2VUM G;  2UXD Q;  1D1I A;  2KVM A;  4HR7 B;  1BDO A;  2F4V L;  2EJG C;  1HA6 A;  4G7H C;  1VQJ A;  1A15 A;  1Q8I A;  3OOC A;  1U0L A;  2AHO B;  1EL0 A;  4KJN A;  2A68 C;  4F87 A;  2KEE A;  2NN6 I;  1GHJ A;  2B8F A;  1B44 D;  1X3G A;  5CC4 A;  4DUZ L;  2R92 H;  3GTK B;  1Y69 U;  5K36 H;  5M5X H;  2HHH Q;  1XPU A;  1EUJ A;  4CDF C;  2E76 C;  1IYU A;  2MHV A;  1SNC A;  2MO1 A;  3FPU B;  2R92 B;  1A6X A;  2JA6 H;  1HR0 W;  5M5X B;  3TP5 A;  1A3U A;  4G7O C;  3CPF A;  5IWA L;  2RBM A;  5KYI A;  2X6L A;  3CRK C;  3EQL C;  4LF6 L;  1VQ8 A;  1IL8 A;  2JA6 B;  2EJF C;  1LT6 D;  4RA8 A;  1MI2 A;  3A7L A;  3EN2 A;  1KC8 C;  1BF4 A;  1NMF A;  1OTC A;  4B3R Q;  2RA4 A;  3E9I A;  5C3W A;  1PH9 A;  3HGB A;  4NDX A;  3S1N H;  3UDX A;  2PNR C;  2B63 B;  1PXU A;  2JA8 G;  4IUQ A;  3FHW A;  4R4O A;  3KJP A;  4DV0 Q;  1C8C A;  4HIK A;  3M4O H;  5M3F B;  1STG A;  5I6Y A;  5C4X G;  3ERQ A;  5FJ8 G;  2ZXO A;  1MIU A;  4C3I G;  1K8A C;  4L5Q A;  1WD0 A;  3M4O B;  3MZ5 A;  4DR5 Q;  3MFY A;  1V43 A;  4K6D A;  3TZU A;  4YY3 L;  4JV5 Q;  2E74 C;  1KAA A;  3S2D H;  4K5V A;  4Q0F A;  1EEF D;  2K03 A;  1HA5 A;  3IKJ A;  4HIM A;  2O4X A;  2F0M A;  5COR A;  1R4P B;  3VYU A;  1AP0 A;  1PRT C;  1YNJ C;  3NXW A;  4LAA A;  2Z6K A;  3TS2 A;  2VQF Q;  3H91 A;  2Q8T A;  2H4O A;  2XGT A;  3K5M A;  4JI4 Q;  5CGK A;  4DK3 C;  4B3S L;  2D62 A;  1QUQ A;  1EZ8 A;  5GAE C;  1XMO Q;  2PCF B;  1EYC A;  1RDP D;  2LSS A;  2PW7 A;  1CM9 A;  3GTP H;  2UU9 L;  4WJ3 M;  2PYK A;  5CYU A;  1B70 B;  1I4G A;  4UAI A;  4UPA A;  1RHP A;  2JSO A;  5ELN A;  1SYB A;  3GTP B;  4JI0 Q;  4J6H A;  4JK1 C;  1JIC A;  4NXM L;  1YHB A;  2PO4 A;  1D6E C;  4CKB A;  4A3L G;  2B39 A;  3EFX D;  1OXU A;  1OXS C;  5HUR A;  3WDN A;  2NVX B;  1L0X B;  4LK1 C;  1AE2 A;  4BXX H;  1HUM A;  2AQ3 B;  4C3J G;  3VA7 A;  2L5T A;  1CK1 A;  3ND9 A;  4A3C G;  1JOO A;  1YIJ A;  4JI3 Q;  1A2U A;  1STH A;  5C4Z A;  3HKS A;  2O2L D;  5E3F A;  1RL2 A;  1EU4 A;  3GV6 A;  2LY7 A;  2XTI A;  5IY0 A;  2B2V A;  3I55 A;  1HRJ A;  1I3Q H;  2F0H A;  4JYA L;  4LFC L;  1GVP A;  4X3T A;  3V2T A;  1Q81 C;  3PF4 A;  1H95 A;  1BBW A;  1LT5 D;  3HOZ G;  2VY3 A;  3RMH A;  2E2H H;  3NEM A;  1PH7 A;  1KDB A;  1AE3 A;  3TSS A;  3J7A F;  1HZA A;  1STA A;  1EY6 A;  3R2T A;  2E2H B;  3GQB A;  1RD9 D;  1DD2 A;  1YHA A;  2IWH A;  5FLX c;  4O42 A;  4RKL A;  4XYQ A;  3DWA A;  1VMP A;  1WCM H;  5C44 H;  4GNX C;  1CSQ A;  3PO3 G;  3OMC A;  3BDC A;  4R4I A;  1E0B A;  3BU2 A; 
#chains in the Genus database with same CATH homology
 1GOZ A;  1M4V A;  3HEJ A;  2VNU D;  1WCM B;  3C46 A;  3IFD A;  3M3Y B;  5KRU A;  1HQM C;  2H1E A;  2NN6 G;  3I90 A;  3Q23 A;  2OXP A;  1JQY D;  3VR5 A;  2AQ1 B;  1Q90 A;  5FO8 B;  1TY0 A;  2EYJ A;  5C3E B;  2B2U C;  3I70 A;  1SEB D;  4BA2 I;  4RH6 A;  4FYD A;  1WTO A;  2VB3 X;  1B2T A;  2IJ0 A;  3V05 A;  5EBC A;  1EYA A;  3Q24 A;  2DY7 A;  5JPN C;  4KKU A;  2IL8 A;  2BE5 D;  1LAC A;  1TS2 A;  5EKI A;  2ZT9 C;  1SE3 A;  3DEO A;  2QDB A;  3TBI B;  3K7A B;  1JWS D;  4KTA A;  1LTS D;  3AB9 A;  1JB3 A;  4G4K A;  1SYD A;  1U4M A;  2F0S A;  3K6O A;  1CZG A;  1CTM A;  1JOR A;  3MTS A;  5D3D A;  2XSC A;  3MXG A;  3OMG A;  5BN3 A;  5T1I A;  2IX0 A;  2PPB C;  5CR3 A;  5I6W A;  4RCN A;  3S1Q B;  1WTQ A;  1PTO B;  2NZ1 D;  4NMZ A;  3EJI A;  3TP8 A;  2Z4H A;  2HQE A;  1CQV A;  1Y1W B;  1BCP B;  2DNE A;  1PFM A;  3A8I E;  5HGT A;  1KLG D;  5IT9 L;  1SJE D;  2EY1 A;  1FR3 A;  4DAY A;  1EIG A;  4ID6 A;  1V1O A;  2MUY A;  4K14 A;  2KOL A;  1Z47 A;  2X6G A;  1I6H B;  4NKL A;  1XXG A;  2JEB I;  5JJZ A;  4ODG A;  3BYT B;  1HTP A;  2AQ2 B;  1EYD A;  1KAB A;  4BWG B;  3KLR A;  4CKE A;  4RKB A;  4H0L C;  1DON A;  2A6H D;  4XQQ A;  1J9O A;  1NR4 A;  1Z7T A;  4HCS A;  2F03 A;  5C0X H;  4ZLT F;  3P7J A;  4DAV A;  5CBE E;  3HKZ B;  1ESF A;  1Y8P B;  3NPP A;  2SEB D;  5KNC A;  3A54 A;  1ROD A;  1MSH A;  1GUO A;  5A2Q L;  2EY2 A;  1K8O A;  2VXW A;  3NTH A;  5I2X A;  1MBY A;  3TDQ A;  1IKM A;  3I4M B;  4FXG C;  1PFB A;  5J22 A;  2F0I A;  2DN8 A;  1PZK D;  1STN A;  3S17 B;  1TS5 A;  2L9H A;  3W3A A;  4WOR A;  3D8G A;  1ET9 A;  2MJ8 A;  1X3Q A;  1F9S A;  2LS0 1;  3NE5 B;  4IFD I;  2IT1 A;  2HCI A;  3DXJ C;  3GTJ B;  1EY8 A;  2BCO A;  4IUP A;  3D4W A;  1PDQ A;  3DEP A;  2NVQ B;  2RDF A;  4BS9 A;  5I4D A;  3D6W A;  2CHB D;  3NK9 A;  3J7Y W;  2NVT B;  3M7G A;  3Q22 A;  1STY A;  3BYY B;  5E1F A;  2A69 C;  2CW0 C;  3HOW B;  3PV0 A;  1PFN A;  3SE0 A;  4ME5 A;  4EQO A;  4QUF A;  1V1P B;  1E2V A;  5ELF A;  1TT2 A;  5ISR A;  2F3V A;  2L55 A;  1T5X D;  3GO5 A;  1F2L A;  4XDX A;  3M7N A;  1ML0 D;  3T53 B;  1GJX A;  1HCZ A;  2WKD A;  1MSG A;  1DOK A;  1YNN C;  2L1B A;  1EWC A;  2F0V A;  3VYR A;  4O1N A;  3GV3 A;  4XXE A;  3RZD B;  2TSS A;  1F77 A;  3A55 A;  1WD1 A;  1QIL A;  1TQO A;  3BVM A;  2KQ3 A;  1S5D D;  3WOF A;  3I73 A;  2FMM A;  3DWQ A;  1GUW A;  4K2K A;  2RSO A;  3MEH A;  2FJ2 A;  5JEA J;  3R93 A;  1ENA A;  5FKA C;  2KHS A;  4TSS A;  1JOK A;  1G29 1;  1R4Q B;  1R9T B;  3VA5 A;  3D3R A;  3QWN A;  2I46 A;  1E2W A;  1D2B A;  4HED A;  3AMU A;  3F2U A;  3FPP A;  2D5D A;  1M8A A;  4PMC A;  3TZD A;  3TN2 A;  4C3H B;  2K5D A;  3KK7 A;  1BR9 A;  1SBB B;  2TMP A;  1GUT A;  2K1B A;  1ICW A;  3KF8 A;  4F8M A;  1SAP A;  1LO5 D;  3RD4 A;  1QNU A;  1U9R A;  4XT3 B;  4P2C B;  4OIK A;  1JWM D;  5JEA G;  2Z1C A;  5LL6 X;  4IFD J;  4MIU A;  1DM0 B;  2FIN B;  1MD2 D;  4HSV A;  1GUN A;  1LLR D;  1NUC A;  2JE6 I;  1EY7 A;  4KKT A;  2EYM A;  1ZYR D;  3K58 A;  4XQN A;  3UI2 A;  2EPB A;  3H6M A;  3DM1 A;  3FRP B;  1RTO A;  1PMR A;  2XRQ D;  4N9T A;  4B9W A;  2N55 A;  2XNA C;  1ENC A;  4ZRZ A;  1H9R A;  4IUU A;  2NUC A;  5C5M A;  3HS0 C;  3S9W A;  4IFD G;  5FO9 B;  4GZY C;  4KHZ A;  2NTT A;  3OPO A;  2R3Z A;  4KY6 A;  4ZKC B;  1EZ6 A;  4C1N I;  3TP6 A;  3GD7 A;  5C4H A;  2DNC A;  5BN5 A;  2L11 A;  1I4H A;  2D2C C;  1X3P A;  1ONL A;  1WTV A;  2ENB A;  1KDC A;  2EYO A;  4KI0 A;  1SMY D;  3K5N A;  2QF7 A;  4L63 B;  1ENF A;  4IUT A;  1SJH D;  2MGS A;  2JP1 A;  1G2S A;  3S1N B;  2RVL A;  3L7Z C;  4Z9C B;  1RJT A;  4K8I A;  2WP8 J;  3FDT A;  3NUC A;  2A68 D;  5COY A;  4XQJ A;  3PIO 3;  1VF7 A;  1WTR A;  2JA5 B;  4RCO A;  1TS3 A;  4OO1 I;  3N52 A;  4RGN A;  2EY6 A;  3S2D B;  1FYC A;  2KED A;  2XWB B;  5IGE A;  2PZT A;  2OT2 A;  2EOT A;  2FFK B;  3CKI B;  1F2M A;  4DNR B;  1UUP A;  1TR5 A;  2K33 A;  5IIF A;  5EQ0 A;  1CI3 M;  4G7Z C;  1ESR A;  2NBF A;  1SNM A;  2XRS D;  2BA1 A;  1EY5 A;  3HZX A;  1S5B D;  1GUG A;  3SXH A;  2OF1 A;  2ID0 A;  3T56 B;  3QOJ A;  4EQP A;  3PUY A;  2B2T C;  3HP3 A;  4RAU C;  1WTX A;  5D14 A;  2K01 A;  1TII D;  3SEB A;  2ICI A;  3NTI A;  4K8J A;  3DMU A;  4Q5V A;  1E2Z A;  2HUG A;  4DAP A;  2EYH A;  4A3F B;  3N6R A;  1A3V A;  4IN3 A;  5EJW A;  3HG9 A;  2ZXP A;  5IOD A;  1PRT D;  1YNJ D;  1STE A;  3LWU A;  1O80 A;  1LAB A;  1I3Q B;  1S5E D;  3FKI B;  4TKO B;  4FF2 A;  1HHV A;  1W6J A;  2PZW A;  2Q8I B;  4IAL A;  1I6V C;  2A6E C;  1A2T A;  4IQZ A;  2SNS A;  4RGT A;  1LTR D;  1V8Q A;  5EPK A;  2K6A A;  1B3A A;  4E6I A;  2F4I A;  5C44 B;  3R8B A;  2CQA A;  1DXM A;  5E4W C;  3OIQ A;  3IL8 A;  4HTH A;  5FLX E;  2N88 A;  5M9O A;  1DJR D;  1VF5 C;  4J8Q A;  3T16 A;  3EA6 A;  3GTL B;  2A73 B;  2F0K A;  5FLX L;  5M5W B;  4A93 B;  2KUM A;  3R3O A;  1CA6 A;  3GTQ B;  5EPJ A;  2DY8 A;  1U4L A;  1QCB D;  4DXF A;  1DCZ A;  2D9U A;  4ZKB B;  1CHP D;  3CRL C;  3E6Z X;  4C3H G;  4KD3 A;  4L6T B;  5JAV A;  4S3S A;  5JVH 3;  5EPL A;  2B2T A;  5I9P A;  3GTO B;  1UEA B;  4CJ2 C;  1W6K A;  2R61 A;  4QB4 A;  1HTL D;  5JOB A;  1H9J A;  1SXT A;  4OO1 G;  1QWY A;  5IT9 E;  2PW5 A;  4RGM A;  4CBV A;  1AFP A;  4KY5 A;  1AEX A;  3VR4 A;  3BVG A;  5A35 A;  1QNK A;  2EE1 A;  1OXV A;  3V96 A;  1SNQ A;  2EYF A;  2QKI C;  3IAY A;  1GHK A;  3SK6 A;  5D3I B;  5JVG 3;  5I2Y A;  4PV1 C;  3U9O A;  1F9Q A;  3OW7 A;  3MHB A;  4LMQ D;  2C9O A;  1IW7 C;  5FO7 B;  4ILW A;  4ZK9 B;  3C1E A;  3KLS A;  4HAE A;  3TP7 A;  1QG7 A;  1A3T A;  3K5O A;  4HCE A;  2NTS A;  1PRT B;  3URY A;  2F0Q A;  3NBI A;  3PO2 B;  1FD7 D;  5K36 G;  5IGG A;  1WTP A;  4V0B A;  1EU3 A;  2B2U A;  5A2Q E;  3WOE A;  5C4X B;  1KNA A;  3DWP A;  3NP8 A;  1B4O A;  3D4D A;  4C3I B;  4U67 3;  2JYO A;  1QOH A;  4XIG S;  5FOB B;  5KNB A;  1I4P A;  1CQF A;  1BXT A;  3DHQ A;  2JXM B;  1Q1E A;  2L4N A;  2LMC B;  4PQX A;  1OXT A;  1DZ1 A;  1IHZ A;  5IGF A;  1G6Z A;  1KDA A;  2KA7 A;  3QB3 A;  3QIA A;  2LFN A;  3I72 A;  4FXK C;  4C1N K;  3PUX A;  2ICE C;  1G8Z D;  3T13 A;  1K83 B;  5KEE A;  4DNT B;  1FNW A;  4KD4 A;  1II3 A;  3VYS A;  4RWS C;  1GUS A;  1ZXT A;  4IUN A;  2NVY B;  1XX8 A;  4F88 A;  3LX0 A;  1C48 A;  3ERO A;  1I4Q A;  4DK0 A;  3I91 A;  1OXX K;  1JOQ A;  1AW7 A;  3E5S A;  4NP5 A;  4CKC A;  5G3L F;  2FMC A;  1EWH A;  5IOC A;  3K59 A;  1GXD C;  3VYT A;  1F9P A;  3QO2 A;  2G9H D;  1CT1 D;  1Y8N B;  2F1M A;  3FEW X;  3A56 A;  4F7X A;  2E2D C;  1LT3 D;  3S1M B;  3HOZ B;  3Q6S A;  2MPM A;  4RFB A;  1O7L A;  3SK5 A;  1STB A;  5DAU A;  2J0T D;  4EGV A;  1SSO A;  3AU7 A;  1Y1V B;  2Q8R E;  2EZV A;  5C0X I;  3BDO A;  1TWF B;  2QCP X;  3K57 A;  1UNS A;  4A3M B;  2NN6 H;  4IUV A;  1LTA D;  3D4R A;  3SHL A;  3A7A B;  3NTK A;  2E2J B;  1EIH A;  4DA2 A;  1CZW A;  4H13 C;  2RQX A;  1SE4 A;  3P20 A;  3HOV B;  1B9N A;  1PTO F;  2NWG A;  4MHE A;  4X3U A;  2A69 D;  3MFG A;  2RKS A;  2CW0 D;  2PZU A;  1BCP F;  1NCV A;  1NSN S;  4FF4 A;  5K5P A;  2YYZ A;  3J81 E;  1FNV A;  1D1K A;  4I65 A;  2Y0S B;  5JPM C;  2SDF A;  1TY2 A;  2EYL A;  4CJ1 B;  4CJ0 B;  2QIL A;  3H3V C;  3R2I A;  3M85 A;  1G2T A;  2XWJ B;  4KMU C;  4ABN A;  5T1G A;  3J81 L;  2K04 A;  4LJZ C;  2K28 A;  1YNN D;  2F0O A;  3SK4 A;  2F0F A;  4K6L A;  1ILP A;  4A3E B;  1TVX A;  1UAP A;  1Q3L A;  1VDZ A;  4R8N A;  1D5M C;  4RHS A;  3BVZ A;  4C2M B;  5TSS A;  4XT1 B;  1JC7 A;  3GTG B;  1DOM A;  4QUC A;  2F3W A;  4ZQ3 A;  2M9V A;  2NB0 A;  3PIP 3;  2B2Y C;  3BS1 A;  2IPK D;  1TWG B;  4G57 A;  4U68 A;  4FXD A;  1B1Z A;  2F0L A;  1XYI A;  3OWF A;  3T4A C;  3VR2 A;  4K5W A;  5C4J B;  1RCV D;  4Y7N B;  5IGD A;  2PMZ B;  2K32 A;  3TME A;  1SNP A;  2XN9 C;  1TWA B;  4BBS B;  4HMJ A;  3SVM A;  2B8G A;  1I4X A;  2B2V C;  1SYC A;  5C0X J;  4KHV A;  1WVL A;  3OWE B;  1NAP A;  2F0N A;  4FF3 A;  2XIW A;  3C1F A;  4XTC S;  2E2I B;  4DF7 A;  5CV7 A;  4PMB A;  2B2W C;  3VR3 A;  4DXG A;  4DK1 A;  3KUP A;  3I8Z A;  1TU2 B;  5G3L D;  1PTO C;  5CV4 A;  5J1Z A;  1QB5 D;  2EJM A;  4KV6 A;  3SR1 A;  2F0U A;  1BCP C;  1D5X C;  1XTC D;  2LKV A;  1Q1B A;  2F0J A;  2K05 A;  1Z6H A;  1BO0 A;  4KK7 A;  4N9P A;  4V19 0;  1I4R A;  4HMI A;  2I07 B;  5DM7 3;  4R9W A;  5CV8 A;  3FMC A;  5C0X G;  5M3M B;  5C5L A;  5IGB A;  4TRD A;  2O5J C;  4PNY A;  1B53 A;  1QE6 A;  4RHR A;  4FP5 D;  2BDN A;  2IX1 A;  2WIN B;  3X3N A;  1EY4 A;  1S5C D;  5DEH A;  3D6C A;  1ZKO A;  3NBH A;  1QJO A;  1HUN A;  2HDM A;  3NHH A;  2QEJ C;  2WB1 B;  1RTN A;  1EQV A;  5E4X A;  2NYZ D;  1FGB D;  2IW3 A;  5EBD A;  2B2Y A;  4J1M A;  4KY7 A;  1TWC B;  4A3K B;  1D5Z C;  2L0C A;  1HXY D;  4L8J A;  1PTO D;  1Q12 A;  1EY0 A;  1BCP D;  1F2Y A;  4IZ8 A;  2WKC A;  4DGZ A;  3G7L A;  4OIJ A;  3C2P A;  1LTG D;  1TKW B;  2HCC A;  1K8M A;  2RDG A;  3BG3 A;  2JA7 B;  1TS4 A;  3MXN A;  3NSW A;  2BA0 A;  5IGC A;  1G91 A;  4KN7 C;  4NW2 A;  3KBX A;  5LL6 S;  3SDZ A;  3EVQ A;  3OSO A;  5ELC A;  2BE5 C;  3DUZ A;  2B2W A;  1BOS A;  1KNE A;  3VR6 A;  1EY9 A;  1MGS A;  1B9M A;  2BDO A;  3HOY B;  1ET6 A;  3S2H B;  3HOX B;  3RLF A;  2KEC A;  3CU7 A;  1SDF A;  3QG1 A;  4QF4 A;  3BZD B;  1AN8 A;  1BQQ T;  4BY1 B;  5KGU A;  5AFW A;  4R8I A;  1BNZ A;  3MXP A;  3T51 B;  1KLU D;  1SFO B;  2R6G A;  1Y8O B;  2XVS A;  1NR2 A;  4KN4 C;  1HFN A;  3H94 A;  1B50 A;  4EVO A;  3ONA B;  1ZEQ X;  3CHB D;  2L12 A;  1XWE A;  1TWH B;  1EFI D;  4WFN 3;  1VMC A;  2J7Z A;  1HPC A;  5JEA H;  2IX3 A;  3IFT A;  2A6E D;  2V4D A;  3GTM B;  4FNF A;  3S1R B;  3KLS X;  4H44 C;  4PMW A;  3NQI A;  3O13 A;  3ZYY X;  4QCL A;  4M1U B;  3RZO B;  2HDL A;  4KKS A;  2MP1 A;  2VUM B;  2G9D A;  5CBA E;  3MA2 B;  2KJX A;  5I9O A;  1PYW D;  1C4Q A;  1EOT A;  3NQT A;  1LT4 D;  2A6H C;  4IFD H;  1PTO H;  1H9S A;  2M2L A;  1S4Z A;  1SND A;  4K2L A;  3A8K E;  1BBX C;  5EGT A;  3RUZ A;  1SE2 A;  4I7Z C;  5F2D A;  2E75 C;  1SYG A;  2FHT A;  2VB2 X;  3PMF A;  1L0Y B;  3ND8 A;  1CFM A;  3S14 B;  2EXZ A;  3LNN A;  2R93 B;  3I4L A;  5LHY 1;  4QIW B;  4OL7 A;  3G6J B;  4WJW A;  1JCK B;  1WTW A;  4RGO S;  2KCC A;  4XYO A;  1T5E A;  2WII B;  2EY5 A;  3U9S A;  2JA8 B;  1F2Z A;  3L9A X;  3MVV A;  1LTI D;  5BN4 A;  4MN3 A;  3Q0A A;  2F0E A;  1V1P A;  3X3M A;  3A8J E;  4DN4 M;  5CMD A;  4TQU S;  2GA4 B;  1U4P A;  3P1H A;  4DU9 A;  4K5X A;  1FNU A;  4FO2 A;  2J4X A;  1ILQ A;  1VCI A;  2M00 A;  2AUJ D;  5KYL A;  4FF1 A;  2F0P A;  2ZXR A;  1IW7 D;  2WAC A;  4ZUJ A;  4DFA A;  4ZYS A;  2YU9 B;  4BA1 I;  2AWN A;  2KCN A;  2X69 A;  4UDU C;  1SNO A;  2Z4I A;  1PLF A;  3JAM E;  2EVB A;  1O78 A;  1H9S B;  1AZQ A;  2AWO A;  4QMG A;  4X3K A;  1AZP A;  2F0G A;  3JAM L;  1O7Y A;  4CGY B;  4YIJ A;  1EEI D;  3CQZ B;  1LV9 A;  5J39 A;  3MAQ A;  4C3J B;  2EYP A;  2O5I C;  1F9R A;  2K5Q A;  3P75 A;  1O7Z A;  1LTT D;  1IYV A;  2C5C A;  3GP7 A;  2R7Z B;  1EQT A;  1PZJ D;  2CVR A;  2A5H A;  3H09 A;  1RF2 D;  4CHT B;  4KJO A;  2A74 C;  2RSN A;  5ELE A;  1IKL A;  3L3O C;  5NUC A;  2K5W A;  3OHX C;  3HRZ C;  1H9K A;  3MC0 B;  1CA5 A;  1KTK A;  5C3X A;  4BBR B;  2JEA I;  2F0W A;  3MWY W;  5DM6 3;  1SYF A;  4B08 A;  5EKL A;  5FK9 C;  3KBG A;  3PUV A;  1U4R A;  3K0Y A;  4ZAI A;  3PO3 B;  3ITP A;  1I50 B;  1HFG A;  1PZI D;  4C56 C;  4ULL A;  1JE4 A;  3S15 B;  1X32 A;  5CV5 A;  5CV6 A;  5KIX A;  5D65 A;  3J80 E;  3K5L A;  3W2D A;  1DOL A;  4AYB B;  2WAQ B;  2OEO A;  5ELB A;  5KND A;  3PUZ A;  2PQE A;  4OGQ C;  5CV9 A;  1BUV T;  4IUR A;  4EQN A;  3OIP A;  3NWS A;  2F0D A;  1ZYR C;  1LTB D;  1S5F D;  3J80 L;  1HQR D;  2F0T A;  2EDG A;  1J8I A;  5ELD A;  4WRD A;  4X3S A;  2RDH A;  4JBW A;  4HSP A;  3LWE A;  1OO9 B;  5M5Y B;  3D31 A;  3C3L A;  4ZUI A;  1SYE A;  1PRT F;  4A3D B;  1JWU D;  3M4Y A;  2SNM A;  3SK8 A;  3S16 B;  2WV6 D;  4M8A A;  1RKN A;  3QJY A;  3PUW A;  5EKK A;  4B9X A;  4HN7 A;  2AUK A;  4OO1 H;  1DYQ A;  2SOB A;  3BDL A;  3I4N B;  2BOS A;  4FVM A;  5DNF A;  4A3J B;  1H9M A;  3FVQ A;  1CHQ D;  2K7V A;  3J7A V;  3I3C A;  3QOL A;  3E0J A;  5C6A A;  4A3G B;  4OHJ A;  1JR0 D;  4A3B B;  3NWT A;  3H0G B;  3MXU A;  4A3I B;  1SMY C;  4BY7 B;  4H7B A;  2Z8L A;  3HOU B;  1D1I A;  2KVM A;  4HR7 B;  1BDO A;  2EJG C;  1HA6 A;  4G7H C;  1A15 A;  1Q8I A;  3OOC A;  1EL0 A;  4KJN A;  2A68 C;  4F87 A;  2KEE A;  2NN6 I;  1GHJ A;  2B8F A;  1B44 D;  5CC4 A;  3GTK B;  1Y69 U;  5K36 H;  2E76 C;  1IYU A;  2MHV A;  1SNC A;  3FPU B;  2R92 B;  1A6X A;  5M5X B;  3TP5 A;  1A3U A;  4G7O C;  2RBM A;  5KYI A;  2X6L A;  3CRK C;  3EQL C;  1IL8 A;  2JA6 B;  2EJF C;  1LT6 D;  4RA8 A;  1MI2 A;  3A7L A;  1BF4 A;  2RA4 A;  5C3W A;  3HGB A;  4NDX A;  2PNR C;  2B63 B;  1PXU A;  4IUQ A;  1C8C A;  5M3F B;  1STG A;  5I6Y A;  3ERQ A;  2ZXO A;  4C3I G;  1WD0 A;  3M4O B;  3MZ5 A;  3TZU A;  3MFY A;  4K6D A;  1V43 A;  2E74 C;  1KAA A;  4K5V A;  4Q0F A;  1EEF D;  2K03 A;  1HA5 A;  3IKJ A;  2O4X A;  2F0M A;  5COR A;  1R4P B;  3VYU A;  1AP0 A;  1PRT C;  1YNJ C;  3NXW A;  4LAA A;  3H91 A;  2Q8T A;  2H4O A;  3K5M A;  5CGK A;  2D62 A;  1EZ8 A;  2PCF B;  1EYC A;  1RDP D;  2PW7 A;  1CM9 A;  2PYK A;  5CYU A;  1I4G A;  4UAI A;  1RHP A;  2JSO A;  3GTP B;  1SYB A;  4J6H A;  4JK1 C;  1JIC A;  2PO4 A;  1D6E C;  4CKB A;  2B39 A;  3EFX D;  1OXU A;  1OXS C;  5HUR A;  3WDN A;  2NVX B;  1L0X B;  4LK1 C;  1HUM A;  2AQ3 B;  4C3J G;  3VA7 A;  2L5T A;  1CK1 A;  3ND9 A;  1JOO A;  1A2U A;  1STH A;  5C4Z A;  2O2L D;  5E3F A;  1EU4 A;  3GV6 A;  2LY7 A;  2B2V A;  1HRJ A;  2F0H A;  4X3T A;  3V2T A;  1LT5 D;  3RMH A;  1KDB A;  3TSS A;  3J7A F;  1STA A;  1EY6 A;  3R2T A;  2E2H B;  3GQB A;  1RD9 D;  1DD2 A;  2IWH A;  4O42 A;  4RKL A;  4XYQ A;  3DWA A;  1VMP A;  3OMC A;  3BDC A;  1E0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...