3DMUA

Crystal structure of staphylococcal nuclease variant phs t62k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
126
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEKYGPEASAFKKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcal nuclease variant PHS T62K at cryogenic temperature
rcsb
total genus 36
structure length 126
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dmuA00
3T13A 2SNMA 4F8MA 3ITPA 1STYA 1SNDA 4EVOA 4RKBA 1U9RA 2F0IA 2EY6A 5M9OA 3OSOA 5HGTA 2PW7A 3R3OA 5CV9A 3MEHA 5EKLA 1KABA 1EY7A 1SNQA 1EQVA 1SYBA 4KD4A 4RKLA 2SOBA 5CV6A 5DEHA 4NP5A 3EJIA 2EY5A 1JORA 2F0UA 5KGUA 4DGZA 2EYLA 1TR5A 1F2MA 2QDBA 3HEJA 4IALA 4KY5A 3MVVA 4YIJA 3SK6A 3VA5A 3TP8A 4KY7A 1RKNA 3PMFA 4EQOA 4K2LA 2F0DA 3MXPA 3MZ5A 4J1MA 2SNSA 2EYMA 2EYPA 4NDXA 5IGDA 1EYAA 5IOCA 3EVQA 4DF7A 5C4ZA 5C3WA 2F0OA 4QB4A 4EQPA 3D6CA 3OMCA 5JOBA 1EY8A 4MIUA 1F2ZA 5KYLA 1SNMA 1TQOA 4ZUIA 1SYCA 2PZUA 5KYIA 1STAA 1SYEA 2F0PA 3ERQA 4K2KA 3RUZA 1F2YA 3T16A 5C4HA 4K5VA 1A3UA 3QOLA 2EYOA 4WRDA 1NSNS 5CV5A 4K5XA 1AEXA 1ENAA 2RBMA 3H6MA 2F0TA 3NUCA 3NXWA 5CV7A 5IGBA 1A3TA 5E1FA 5JAVA 1EYCA 1II3A 5IGGA 4KD3A 2EYHA 4K8IA 4NMZA 3TP5A 2F0WA 1SYDA 4J6HA 4WORA 4EQNA 2EY1A 5IGEA 5IIFA 1JOKA 4HMIA 2EXZA 2F3VA 1STNA 3C1FA 4KV6A 3QOJA 2O4XA 4R8NA 1KDCA 4S3SA 5KEEA 5KIXA 4I65A 3SK5A 2F0LA 1EY5A 2KQ3A 3SR1A 1SNPA 2RKSA 1SNCA 2OXPA 3DMUA 5I6WA 1STGA 3S9WA 2F0KA 4KY6A 2F0VA 4KJOA 3SHLA 1EZ6A 4HMJA 4E6IA 1KDAA 1STHA 2WACA 1ENCA 3MHBA 3D4DA 3P75A 2HQEA 3TP7A 5J39A 1EZ8A 3NQTA 5C5MA 2PYKA 5NUCA 4B9XA 3DHQA 1EY9A 3E5SA 4F7XA 5I9PA 5CV4A 5E3FA 5IODA 4LAAA 4DFAA 4KTAA 1STBA 1A2UA 2F3WA 1KAAA 2F0MA 3NK9A 5C3XA 4HTHA 1SYGA 2F0HA 4IZ8A 4OL7A 3V2TA 5K5PA 4K14A 3TP6A 5KRUA 1SNOA 2PQEA 5DAUA 5I6YA 3SK8A 5F2DA 2F0EA 2OF1A 5IGCA 5CC4A 2PW5A 1NUCA 2KHSA 3EROA 3P1HA 4N9PA 4PMBA 2PZWA 4G57A 2F0NA 4IUNA 5CR3A 3SXHA 4QF4A 4TRDA 5CV8A 2RDFA 3OMGA 3OWFA 5C5LA 1A3VA 2F0JA 3SK4A 1EY6A 1IHZA 3C1EA 4KHVA 5C6AA 2F0SA 4DU9A 4NKLA 2F0FA 5EGTA 4K8JA 2LKVA 2OEOA 5IGFA 5J22A 4H7BA 1TT2A 5J1ZA 5HURA 5EKKA 5ISRA 2ENBA 4K6DA 3BDLA 1JOOA 2EYJA 4B9WA 3LX0A 4ODGA 2NUCA 2PZTA 1EYDA 4ID6A 3D8GA 3TMEA 1SYFA 1A2TA 3D4WA 3NHHA 4KJNA 2F0GA 1EY4A 3BDCA 2EYFA 1JOQA 1KDBA 2EY2A 3NP8A 2F0QA 3HZXA 4K5WA 2M00A 4ME5A 3QB3A 4PMCA 5I9OA 5CGKA 4N9TA 4QMGA 1EY0A 4ZUJA 4PNYA 3U9OA 4ZQ3A
chains in the Genus database with same CATH superfamily
1V1QA 5EBDA 3S1NH 4C3HH 2L55A 2JA6B 3HKZB 3CCVA 1F9SA 1TWHH 3HOVG 3RLOA 1VQAA 1QZGA 2X6LA 2NVYB 2NTTA 4KN4C 1QB5D 4DR3L 4KMUC 2NTSA 2RCNA 4DR4L 1V1OA 2IY5B 3BZKA 2K14A 3FDTA 4CJ2C 2F0DA 1UAPA 3F2UA 4DV1Q 1U4RA 1YJWA 5C3WA 1E24A 3P7JA 1PZKD 1EY8A 4HSPA 4ZYSA 1SN8A 4ZUIA 1SYCA 4A3GB 1SYEA 2JA9A 3ERQA 4UP8A 3A8JE 3VYRA 5CV7A 4FXDA 3M4PA 4B3TQ 1SSOA 2ALYB 4OONA 2X6GA 2E2HH 2EY1A 1BCPD 3OTOL 2PMZE 1MGSA 1PYBA 2DY7A 2NBFA 4X64L 2KQ3A 3R2IA 1B3AA 3HOXH 2OXPA 4I7ZC 1SR3A 4RGTA 1XMQQ 2K50A 3HOVH 3TQYA 4V190 3MHBA 4YWLA 1HCZA 4DV6Q 2PYKA 3DHQA 1KLGD 2RHSB 1VQEA 1STBA 4HTHA 2F0HA 1YHAA 2CFMA 2OQ0A 4CJ1B 5I6YA 1P16A 4BY7B 2C9OA 2B2UC 3BYTB 1BCPF 4RA8A 1EY6A 3HOVB 2K5VA 2E2DC 4DR5Q 4NKLA 1PTOC 1VDZA 5EGTA 3SE0A 1H9JA 3SGIA 4LFBL 1SFOB 2JA6G 3A55A 4A3MH 5IYDH 1FNWA 3S17B 5CYUA 3TEHB 5T1GA 5KNBA 3CCQA 2D2CC 1JOQA 1PFSA 2K1BA 3K5LA 3G6EA 1L1OC 4RFBA 1GUGA 2QCPX 2Y0SB 1IYJB 4V0BA 2A73B 4CJ0B 4N8X1 3W5OA 3X3MA 4DK6C 2I5MX 4C3JH 3ITPA 2F3IA 3RMHA 3K0XA 4R9WA 2YTYA 1HNXQ 3DEPA 3HKZE 1LTLA 1SNQA 2RDGA 1O7YA 4JOIA 4AYBE 3J81c 3X3NA 1HNZQ 4DPGA 2WP8J 3PIPA 3DWAA 1YZ6A 2RDHA 4KI0A 1B53A 1BR9A 2I0QA 3D4RA 1MSGA 5M5XB 2EYPA 3JC66 4UAIA 1J5EL 4GKKQ 4L5SA 2JA7B 2K05A 1F2ZA 2E5LQ 2E74C 2XN9C 3T16A 5CORA 3RD4A 1LUZA 1ONLA 2N88A 3H6MA 3RR5A 1HR0W 2WV6D 5C0XG 1B70B 1WFQA 2QA4A 2R3ZA 1M1KC 5M5XH 5BN4A 1JB3A 1EFID 2F3VA 1LTAD 3QOJA 4QY7A 2F03A 2VQFQ 1XJVA 2RCFA 1N32Q 2O2LD 1AP0A 4L5TA 2K33A 1NE3A 1V1PB 2F4IA 1NMFA 3HOXB 5K36H 2ZXRA 4IPHA 3CCUA 4E6IA 1UE5A 1PRTF 2WB1E 2RSOA 3P75A 4YHHQ 3FPUB 1LACA 3M3YB 1E22A 3CCSA 2B2VA 1DZ1A 2VL6A 5M3FH 3EQLC 3ICEA 1FYCA 4KKTA 1QWYA 4BY1G 2KEEA 1U0LA 4A3FH 4BBSG 2F0EA 2JP1A 2QKIC 1VQDA 3RZDB 2HT1A 3E0EA 1XMQL 3FKIB 4H13C 4PMBA 2ZTCA 5AJ3L 1WCMB 4RGMA 3KDFA 4WFN3 3FKIH 1SFOH 4C2MB 4JI2Q 1Q8KA 5T1IA 3MFYA 3CQZH 5HURA 5EKKA 5JEAG 2R7DA 2CWPA 2KCMA 3VR6A 4B3ML 3D8GA 3MA2B 2VB2X 2E2JH 3TZUA 2UUCL 2M00A 5JEAH 5KNDA 3H0GG 4A3JG 2UXBL 4JI4L 1M90C 4A3EH 5C3EH 2EY6A 1QE6A 2MHVA 1EQQA 3M4OH 2CQAA 4A4IA 2I46A 4ZK9B 1ZYRD 2G5DA 4BA2I 1EL0A 3S1MH 2EJFC 1GUNA 4LF6L 1VQ9A 3KLSA 3W1BA 2EPBA 2Z6KA 2A6HD 4JPBW 3T1HL 1RIPA 4DNTB 2Z6KC 1C0AA 5FLXE 2A5HA 4P75A 3T56B 2Q2UA 1H9KA 4KHZA 3PO2G 5KYLA 4DV4Q 4IO9A 2VUMG 4DKAC 2Z0SA 1YHBA 1TS2A 4DV6L 3RLNA 3PO2H 1OXSC 1PRTC 1TWAB 3ONAB 1EU4A 4Z9CB 4BXXH 4OEMB 4J15A 2DN8A 2A8VA 1SYDA 5EKIA 1VQ8A 1HTPA 5FLXc 2QDLA 1I4XA 2L12A 2M2LA 3ZJYC 2ZM6Q 2XSCA 5DM63 2F0VA 4C1NK 4X65Q 1ENCA 1MIUA 3BZCA 1H9SA 2K5HA 1ZKOA 3FKIG 2JQOA 3STBC 1EY9A 1KD1C 5LMUL 3L7ZC 4DFAA 3S17H 3N6RA 4KTAA 4BY1B 1WTHA 1VS0A 4IZ8A 3J7AV 4IJLA 2YU9B 4ME3A 2NYZD 4IOAA 2NZ1D 1DGSA 1FGBD 2KECA 4G57A 1E2WA 4EQ5A 3PCOB 4X62Q 1IBLQ 4OWTB 3G4SA 5C0XI 1Q81C 5IGFA 2NVQH 3VYSA 1X3QA 5K36G 4DUZQ 2R6GA 4GN5A 1PHJA 3E3XA 1SYFA 4ABNA 3K8AA 4LF4Q 1S5CD 5FLMG 5IP9G 2HD3A 1EY0A 2NN6G 4ZQ3A 2SNMA 1PRTB 2B2TC 4RKBA 3S1QH 2QW7A 2CW0C 2WAQB 3GDEA 5CV9A 3EA6A 2M9VA 4A3KG 3CCJA 1AFPA 2QGQA 3CCMA 4NXNL 3HOWH 1G291 3S24A 5C4XB 1XMOL 3HOYH 1SXTA 2AQ1B 1VMPA 1I3QB 4QJFA 2LFNA 1E2ZA 5I2XA 5A2QE 4LFCL 1ET6A 3HKSA 5EAYA 3BVMA 2BE5D 3CHBD 1HZBA 3MZ5A 5C0XH 3F8TA 4A75A 5BR8L 4RAUC 3GTJH 1BBXC 5DLQE 4FF1A 1IZ6A 3F2DA 1G2TA 4ALPA 3I4OA 2XVSA 1JWMD 2YTVA 1O80A 2AQ2B 4KKSA 2IT1A 4K8IA 3PIOA 3L3OC 3EFXD 2E76C 4R8NA 1Q12A 1Y1WH 4P2CB 4DR2L 1QVCA 3DMUA 1STGA 4NW2A 5M5YH 1WCMH 4HEDA 1S4ZA 1GM5A 4A3DH 1ICFB 1EZ6A 1D5XC 1F77A 1IYUA 2IX0A 4HN7A 1BO0A 4U673 4LFAQ 3J80E 2HQEA 4A3BH 1YITA 1D6EC 3J81i 4YY3Q 1TWFH 4IN3A 1L0YB 2KCNA 5ELCA 1KXLA 1G6ZA 5KRUA 5DM73 2EDGA 3KOJA 3IFTA 1XNQQ 2OF1A 1CI3M 4IOCA 4IUTA 4LFCQ 2KHSA 2VZAA 4GZYC 2R7ZB 2PZWA 3HOZG 4K0KL 2F0SA 4NXMQ 1D1IA 1HA6A 1O7ZA 1XNQL 2JEAI 1TWHB 2L11A 2WB1G 2Z1CA 3STBD 5IYBH 2FXQA 2UUBQ 2KHJA 4H7BA 4LF8L 4JV5L 1LTGD 1G91A 4R4TA 5FLXL 3HOYB 1FGUA 4QUCA 2PZTA 2Q8RE 2IHEA 1XTDA 4IURA 3QB3A 1A62A 1TS5A 2KBNA 4UP7A 4DV5L 1YEZA 4HJ7A 4XT1B 5IYCH 1LT4D 2GN5A 3MEHA 2L4NA 1G51A 3I7FA 3D31A 5KGUA 4DGZA 1YI2A 4BY7G 1TR5A 4KY5A 5FO8B 2WINB 3NTIA 2B2YA 4KY7A 4P73A 5E4XA 1R4QB 3F1ZA 4RGOS 1TXYA 3J80i 2K5QA 1TU2B 4FO2A 3Q23A 3TS0A 4DAMA 1Y1WB 5M5WB 1L0XB 3V96A 3I2ZA 3B6YA 5BR8Q 4JI8L 3J81L 1WTXA 3HP3A 4CGYB 1RL2A 2PI2E 3NPPA 1S40A 1VQ7A 1AEXA 3HKZG 1VQIA 2ZTEA 4JBJA 2NN6I 4X6AH 1MKHA 2F0WA 1HQRD 5IGEA 2KCTA 3NBHB 4BXXG 2UU9L 3C1FA 5KEEA 4BA1I 2YYZA 2YU9H 4LNQA 4B08A 1IBKQ 1FJGQ 3HOYG 4I7AA 3SK5A 1PTOB 5C44B 5I6WA 2JA8G 2CQOA 3L0OA 2WB1B 4A3GG 4A3BB 1STHA 5BN3A 4LF5L 4A3DB 3J81j 1PXUA 4A3KH 2WAQG 4KKUA 2VY3A 3DM3A 1KHIA 1KAAA 1SYGA 1EQTA 3RZOB 2MGSA 2PQEA 2R61A 5JEAJ 2EJGC 5GQOA 2ZT9C 2B2VC 3H3VH 4JI0Q 2DJFC 1VQOA 4DV7Q 1PH6A 1I94L 2AWNA 1I4HA 1GD7A 2RVLA 1EYDA 5HY6A 4LW1A 2F0GA 1Q86C 1JJGA 1CSQA 2A69D 2VNUD 2CHBD 4JYAQ 1U9RA 1D5ZC 1SMXA 2UUCQ 5M3MG 4X66L 1B2TA 5C4XH 1IW7D 3NWSA 4R4IA 5C44G 1HR0Q 2PPBC 4YWMA 2BA1A 4RGNA 2K52A 5EBCA 4C1NI 4L5RC 4LF5Q 3C46A 1TWAH 4XQNA 4CHTB 5IY0A 2ZJPA 5AJ3Q 1AE3A 3OIPA 2Q2HA 2KCCA 4DXGA 1EIHA 1PMRA 2NZHA 3GO5A 3MXPA 4NDXA 4XYQA 2KVMA 4DUYQ 3EVQA 2YTXA 3OMCA 4FXKC 4GLVB 5JOBA 4MIUA 1SAPA 1E0BA 1Y1VB 3K5MA 4YHHL 3AU7A 2WKDA 3C2PA 3M4YA 3NUCA 1H95A 1PDQA 5JPMC 3S2DB 2J0TD 2FMCA 3MTSA 2KJXA 3I55A 2MUYA 1CKNB 1ESRA 3KBGA 3KF6A 3K7AB 5FJ8H 4JI3Q 3FEWX 1K83H 2Q2IA 3H94A 2VS1A 3M3YH 3PO3H 1QG7A 5ELBA 5J39A 3NQTA 1CK1A 4HJAA 2E5LL 2HDLA 1A2UA 1WJJA 1X3FA 3EIVA 3NK9A 1J5EQ 4A3LH 5FOBB 4K6LA 1Q1BA 5COYA 4POGA 4M8AA 3CCRA 1XNRL 3Q6SA 4A3IG 5C6AA 1SDFA 2JXMB 4DK1A 1UNSA 4DXFA 4LMQD 1W6KA 4XQQA 1VQ4A 3PF4A 1RTNA 2UUBL 1J9OA 2R7ZG 2ENBA 4K6DA 1Q46A 1CSPA 1E3PA 4BWGB 4MNOA 1JC7A 2O5IC 2EY2A 4OX9Q 1I4GA 2MJ8A 1EFWA 3AYHB 5M3FG 4QMGA 1B8AA 1V43A 3R2TA 4PZ8A 1FNUA 1W3SA 2F0IA 1TKWB 2RHQB 2X69A 4JBKA 4KN7C 2HHHL 3HOWB 2VQFL 2NWGA 4L5QA 4YY3L 1EQVA 3LNNA 4HCSA 2JA8H 1EWIA 3PO2B 1EQRA 1PH4A 4CKEA 1JQYD 3VA5A 2EZVA 1U4LA 5LMNL 4TQUS 1OXUA 2B29A 2VXWA 2EYMA 1HTLD 3HOUB 1D2BA 2JA7H 3S16H 5TSSA 3NQIA 1RCVD 4HJ8A 2HDMA 3UE1A 1PH7A 3HFZB 3RUZA 2EE1A 4A76A 1HZCA 3URYA 1UE6A 3VYTA 1VQPA 1TWGH 5DEHA 4B9XA 2ATWA 2F0TA 4CDDC 3U9SA 2OT2A 3BVGA 4HIOA 5IT9L 1LTRD 3AFQA 2PQAB 4C3JG 4HJ5A 1VQMA 2NVXB 4X3KA 1JOKA 4FF4A 4S3SA 3VR2A 4P72A 1O7IA 3DXJC 3NWTA 1WTRA 3AQQA 1X3GA 1PH9A 4KJOA 2AWOA 1PZJD 4BBRH 1STEA 5G3LD 3OIQA 1V9PA 3QWNA 3BJUA 4Q5VA 4NXNQ 5JVH3 1BOSA 3ND9A 5CV4A 4RCNA 3L2PA 4OIJA 4U68A 2A68D 3GTGB 1LT3D 2JA5H 1NCVA 3T1YQ 1EEID 3HG9A 5IGCA 3J7ZC 1NUCA 5IT9E 5EJWA 1WD0A 1PH1A 5IYBG 1K73C 4DR3Q 4JI0L 1A3VA 4A3MG 3GTQH 3OOCA 1HPCA 2IJ0A 2QEJC 1KRTA 3I73A 4ZRZA 1PYSB 3D4WA 3NHHA 3A54A 1LT5D 4ME5A 2B2TA 3GTMB 2JA5G 2QILA 3S14H 1M4VA 3T13A 3CKIB 2N78A 5IT9c 2PNHA 1BVSA 1AE2A 3IRBA 2Q8IB 1LTSD 2PW7A 2XRQD 1J6QA 3D6WA 1FJGL 5LMUQ 2OWOA 4A3DG 1K8MA 5C0XJ 4DV2Q 1YNNC 2NVYH 1WCMG 4KD4A 3J7YW 2CVRA 2QDBA 3K80C 1X3PA 3MVVA 4RCOA 1R9TH 1K8AC 3TS2A 2AUKA 1N9WA 3R93A 5ELNA 4Y52H 5EQ0A 1DXMA 3IKJA 2EIFA 2ASBA 4A3CG 2IX3A 3CPWA 1CKNA 1PTOH 4AYBB 3OWEB 2D5DA 1Z7TA 3PUZA 4PG3A 2A69C 2F4VL 2BH2A 1II3A 4IUPA 4JI1L 3TP5A 3TDQA 1H9SB 1AN8A 4B3SQ 1SJED 3PUVA 1BUVT 1KC8C 1A8VA 1X32A 2K5WA 4BS9A 4AIMA 3Q0AA 3KLRA 1JMCA 1RD9D 1X54A 1VMCA 1I4RA 1UEAB 1K83B 3WDNA 5DNFA 3HOWG 1KTKA 4HMJA 4LF6Q 1KDAA 2IHFA 1K0SA 1N36L 3GTKB 1G2SA 2LSSA 3QG1A 5IP9H 1ZYRC 4LAAA 2F0MA 4JG2A 5D14A 1ILQA 3BVZA 4IQZA 1SMYD 1VF5C 4B3RQ 4CDFC 5FKAC 3SK8A 3WOEA 2UXBQ 3H09A 4QQBX 3GTLB 2A6HC 4TRDA 4C3HB 3T4AC 4KHVA 3NELA 1U4MA 1GOZA 4A3IB 1B4OA 1EU3A 1MHWC 2B8FA 1X55A 4BBRG 5IP7H 1JT8A 4A93B 2K4KA 1RJTA 3S1RB 1C8CA 4ODGA 2NUCA 1M8AA 3MXGA 1ICWA 4A3FB 1PYWD 3SVMA 1JJ2A 4KHPQ 1D5MC 1HFNA 4ZUJA 2IWHA 3KF8B 3F2BA 2XNAC 2VQEL 3S14B 4HR7B 1YJ9A 4IPDA 3CC2A 1GUOA 1EWCA 1B50A 2BOSA 4A93H 1SYBA 3S2HH 2SOBA 1J8IA 1S5DD 3FHWA 1D1KA 2B2YC 4IUQA 1QNUA 1T9HA 2B39A 2XGTA 1YJNA 1F2MA 1DOMA 2KEDA 2K01A 1S5BD 2HIVA 1P8LA 2E8GA 3E9HA 1KNEA 1T5XD 4O1NA 4GKJL 3S15H 1HUNA 3S1NB 3KUPA 1GHJA 5A35A 2GVBA 2SNSA 1ZEQX 5IGDA 3S15B 1DYQA 3TSSA 5C4ZA 1CTMA 3I4LA 4HIKA 3D6CA 3LWEA 4FXGC 3KF8A 2K04A 3VYUA 2G9HD 3GTPH 3ER0A 1MJEA 3E0JA 4K5VA 1A3UA 3DEOA 4DK0A 4LF9Q 1UWVA 4OO1G 1R9TB 2JE6I 2RF4A 4OX9L 1A3TA 1C9OA 1IKMA 1HRJA 2UXCQ 1PFNA 3WOFA 2C35B 1CZGA 4L6TB 5KIXA 3KDFB 1PFMA 3N52A 3VR5A 4C56C 1FR3A 3GP7A 2KENA 2RKSA 4YCUA 2K75A 3T53B 5BN5A 5C4XG 1E7ZA 1JE5A 1XNRQ 2UUAL 5C44H 1TWGB 5M3MH 3GTKH 1I4PA 1WVLA 4LF4L 3AFPA 1HR0L 1GJXA 5D3IB 1SRUA 4LF7L 3KFUA 1MD2D 2EXDA 3CP0A 1VQFA 1L1OA 2KHIA 1KRSA 4LK1C 5HGQA 1HNXL 3CRKC 1B7YB 2Q2TA 5IWAQ 3CAMA 5F2DA 4UP9A 3GTQB 2AUJD 4QF4A 3SK4A 2OTJA 4NPSA 3C1EA 5GROA 1SE2A 4XT3B 2Z4HA 1E1OA 3GV3A 2XTIA 3RLFA 3FPPA 2EYJA 5FJ8G 3GTGH 1QNKA 3TMEA 4X3TA 1EY4A 3HZXA 1QZHA 3CCLA 1O7LA 3UE0A 3BZDB 1STYA 1WTOA 1SNDA 1LTTD 3HOUH 4Q0FA 3MEFA 5JVG3 2D9UA 4UY8C 3KBXA 5EKLA 3KJOA 1IL8A 1KABA 1VQCA 1GKHA 1DOKA 1EY7A 4JVZA 1PH8A 4DUYL 4AQYL 1GXDC 2K03A 3I4MH 3WWVA 2EY5A 2EQSA 1QUQB 2LXKA 1GUSA 2AMCB 3ULJA 4QUFA 1PRTD 2EVBA 5L37A 1XXGA 2HIXA 4K2LA 5IE8A 3O13A 5A2QL 3NENA 1TWCB 4AQYQ 2Y0SE 4HIDA 2XWBB 3CW2C 2F0OA 1X3EA 1EIGA 4XTCS 1PFBA 2B63G 1L0WA 2R92G 2OCEA 4H02A 2L1BA 4JI6L 3S2HB 1EIFA 3Q24A 4GOPA 2LMCB 3V2TA 2NVTB 3DLLA 3H3VC 4APVA 5IGBA 4M1UB 5JAVA 4HJ9A 2ICIA 1XPUA 3E9IA 1S5FD 3JAMi 4KV6A 2O4XA 2NVXH 1CUKA 2JYOA 2TMPA 4DV1L 4DAYA 1Q1EA 3U50C 1TIID 2F0LA 4DV7L 1R4PB 3A8KE 4KK7A 1G8ZD 4JI4Q 3SHLA 1NTGA 5C4JH 4R4CA 3TREA 2JJQA 5IYCG 4ZCKA 1BCPC 3M85A 4JI6Q 4GOPB 1B44D 5E3FA 1QCBD 1C4QA 3NTKA 4C3IB 1CQVA 1XWEA 3DWQA 4DV5Q 1KIXA 2PW5A 1NMGA 3OHXC 4YIJA 2UUAQ 4IUNA 1TY0A 4FF3A 1NR2A 3I3CA 3A5UA 3HOZH 2UXDQ 3BG3A 1IBKL 4G4KA 4UPAA 2YV5A 2A1AA 1U5KA 1N8RC 1PH2A 1VQ5A 2G9DA 3GQBA 2WIIB 2KUMA 2ES2A 2VB3X 1LTBD 4IFDH 4C3JB 1MI2A 1NBWA 4LF9L 1EYAA 2MO0A 4P74A 1UUPA 3U9OA 5I2YA 3HRZC 4XQJA 2BH8A 2LY7A 3NSWA 5GADC 1N34L 2SDFA 5HGTA 4DV3Q 3HOXG 4IJHA 3Q8DA 2EJMA 2F0UA 1WTVA 4DR7L 1SMYC 1A63A 3JAML 3PGZA 3OW7A 3BU2A 2WKCA 1IL2A 4QIWB 3PIO3 3TP8A 1IYVA 1OTCA 2AKWB 1CFMA 1RKNA 3NEMA 3PMFA 5LL6X 1HHVA 4J1MA 1N33Q 5EPKA 3CRLC 4LUVA 3CC7A 3PSIA 4RHRA 4FYDA 2V4DA 4JI5L 3GTPB 1I50B 3UDIA 4K2KA 1D8LA 1Y69U 1Y1VG 2VQEQ 4JW0A 2ZJRA 1X9NA 1RDPD 4PQXA 2EYOA 2DUDA 2Z9HA 3SEBA 1AZPA 2RBMA 1K8OA 3A74A 3T51B 4RH6A 2I5LX 3QO2A 3ERSX 2K28A 2L9HA 5M3FB 1Q90A 1Q7YC 4FNFA 4LF8Q 4JV5Q 4XIGS 1DONA 4JC0A 1KQSA 3U4ZA 2Z4IA 3A5ZB 4NXML 4K0KQ 1SNPA 1VCIA 2A6EC 3G6JB 4KY6A 1H9MA 1Q8IA 1QOHA 1HNWQ 1K28A 2JSOA 1YNXA 1HA5A 3TP7A 4MN3A 1EZ8A 3A56A 4X3UA 3PO3B 1LTID 1JCKB 5I9PA 1VQGA 1NAPA 4DK3C 4F7XA 1JR0D 1YHQA 1ML0D 1HJPA 3ZYYX 4DAPA 3U4VA 4OL7A 5K5PA 5DAUA 3KF6B 2BDOA 4LFAL 1KAWA 4GKJQ 1RODA 3IFDA 4O42A 3EROA 1BF4A 1LO5D 3OWFA 4DR2Q 1ILPA 4IFDJ 1GUTA 2AHOB 4K8JA 2LKVA 4JK1C 3I70A 1TT2A 2NN6H 1MJCA 4B9WA 2XRSD 3GTOB 1WI5A 2E2JB 4JCVE 4X62L 1IBLL 1YVCA 4WJWA 4JI1Q 1IBMQ 1QUQA 1D7QA 4K5WA 3MFGA 4UHVA 5I4DA 1ESFA 4X3SA 2A74C 4PNYA 4MTNA 1B1ZA 4OXPA 1DD2A 1B3QA 2HCIA 1TS4A 1LYLA 2PI2A 4A3IH 1BBWA 2CCZA 2E75C 1OO9B 3J80c 3LGJA 3Q22A 3I8ZA 2QF7A 4ZKCB 1VQBA 5CBAE 3PF5A 4DR1L 4X65L 4WJ3M 3NBHA 5G3LF 2ZM6L 2B3GA 4G7ZC 4H44C 4C3IG 1QILA 2XWJB 4IUUA 1XMOQ 4ZLTF 1ASZA 5IOCA 3W1GA 2CH4W 1PTOD 4EQPA 4GNXC 2PZUA 1KNAA 1Q3LA 4DN4M 4NB3A 1UE7A 2H4OA 4G7HC 4OO1I 2GA4B 2VUMH 3UDXA 1JE4A 3QR8A 1NSNS 5CV8A 1QVFA 3NXWA 5FO9B 4DR4Q 1PA6A 1Z6HA 1EYCA 4DV4L 5LMNW 1TVXA 3GV6A 3PQIA 1SBBB 1KDCA 3M4QA 3GD7A 2P5ZX 3I4MG 2WFWA 2Z6BA 1EEFD 1EY5A 2PNRC 3D0FA 3BS1A 3SR1A 4TVAB 1IXRA 1NJIC 2F4VQ 1CHPD 2R92B 1SE3A 3T1YL 1CQFA 1KL9A 2BDNA 5EPJA 2EOTA 1CA6A 3K59A 3E5SA 1S5ED 1MSHA 2HQLA 2I5HA 4C3IH 3S1RH 1O78A 1RHPA 3VR4A 1XYIA 3TP6A 3DM1A 1BCPB 1WOCA 3RZOH 1LT6D 2PO4A 5KYIA 1OXXK 3FMCA 2F0JA 1TY2A 2B8GA 4BBRB 4B3MQ 4QIWE 1B9MA 1GO3E 4DNRB 4DV2L 1IW7C 2CWAA 4JI2L 4CDEC 1LM0A 2DNEA 3PIP3 4BY1H 2Y0SG 2A19A 4BBSH 3QJYA 3NP8A 3M9BA 1IKLA 3S1QB 3ULPA 1DJRD 3JAME 4JBWA 5D3DA 4F87A 4EVOA 2ZTDA 4OWXB 2DY8A 3M4OB 1S72A 1PVOA 2I07B 3MXUA 4G7OC 3G48A 3AEVA 3UI2A 2KOLA 2QEXA 1SROA 4PZ7A 2MQHA 1BDOA 4AH6A 5CV6A 5H1SE 1F9RA 4QCLA 3GTOH 1A6XA 4IFDI 3T1HQ 5LMNQ 3SK6A 2V1CC 1CT1D 1HH2P 1VQ6A 4GN3B 3CMAA 2CW0D 1DOLA 1SJHD 2K5DA 1HFGA 2SEBD 1I6VC 1VQHA 3PV0A 4OO1H 2CKZB 4QB4A 3KJPA 2HHHQ 3AB9A 4GLAC 1WTWA 1SNMA 2LXJA 4CKBA 2L15A 5AFWA 1STAA 3GTJB 4F88A 2E2IH 1F2YA 5C4HA 4IUVA 2F1MA 1V1PA 3IL8A 4FVMA 1ASYA 1HNWL 4XDXA 3CXCA 4DA2A 4EGVA 5IGGA 2ID0A 2IL8A 2EYHA 4KD3A 1HZ9A 2BE5C 4DR1Q 4L8JA 3TZDA 4GOPC 2EXZA 4FDBA 1STNA 3IAYA 4GKKL 2ICEC 3W2DA 1CKOA 1X65A 3EBEA 2JEBI 4JI7Q 4RWSC 4RG1A 1VF7A 4A93G 1GHKA 4A3CH 3CD6A 3BYYB 3PUYA 3VDYA 2FJ2A 1SE8A 2OQKA 1HNZL 3TRZA 1XPRA 2VW9A 2MNAA 1IBML 4GNXB 1S3OA 2K32A 3RNUA 4RMFA 2E2HB 4LUOA 1JICA 1PTOF 3NBIA 3QIAA 1JB7A 4N9PA 1E2VA 2F0NA 3SXHA 4JI3L 3VA7A 2JA6H 1K3RA 1N32L 2DNCA 2F0FA 3K57A 3A0JA 5J1ZA 1LV9A 1ET9A 1EUJA 3DUZA 2DGYA 1WTPA 4LFBQ 1LLRD 1HUMA 4O2DA 4DR5L 3I4MB 4ID6A 3VR3A 1K9MC 4KJNA 3A8IE 2F0QA 1FL0A 5LL6S 3HS0C 4R8IA 2FFKB 2A6ED 2F52A 5C3EB 1JJCB 5FO7B 2K5NA 3I72A 4DV0L 1MBYA 3M7NA 5JJLA 2J7ZA 3HGBA 3P20A 2L5TA 3ND8A 2HUGA 2HCCA 3OSOA 3RN2A 1W2BA 3R3OA 3MXNA 1PH3A 4A3BG 2RSNA 2BA0A 4IPCA 1WTQA 2JA8B 4UDUC 1JORA 2UXDL 4GLXA 5E7NA 4LJZC 2EYLA 2NZOA 1EYGA 2IPKD 1YIJA 1TS3A 1NY4A 3S2DH 5J3BA 4X64Q 1F9PA 4TKOB 3OPOA 2MFIA 2Z8LA 2Q8TA 1FD7D 5CBEE 4JI5Q 1TQOA 1Y1VH 1I6HH 4RHSA 4CKCA 1EWHA 2JK8A 1I6HB 1Y1WG 2NVTH 1L2FA 3CU7A 4MTKA 4POFA 2E2IB 4PMWA 4FP5D 2DJGC 3OW2A 5CV5A 1ENAA 1BKBA 4XXEA 4ZKBB 1XTCD 3DWPA 4ILWA 4J6HA 4WORA 3J80L 3RN5A 1WYDA 4PV1C 4WJ4A 2A68C 2NB0A 1I4QA 1V8QA 1RTOA 4YWKA 2PMZB 3TN2A 3R8BA 1CKMA 1I50H 1BNZA 3KLWA 3RZDH 3L9AX 1N34Q 3UDGA 3C3LA 2R92H 4AYBG 4EX5A 4DR6Q 2D62A 5NUCA 4HSVA 4OHJA 1DM0B 3CCEA 4IFDG 1JWSD 1HQMC 3MWYW 1EOVA 2F3WA 2O5JC 5ELEA 1A15A 1Z47A 3S9WA 4K14A 3JAMc 3CF5A 3K7UC 3P1HA 3H15A 4CDCC 1K0RA 5CR3A 3OMGA 5CGKA 2XIWA 1IHZA 2L0CA 1KLUD 1C7YA 4C3HG 4LWCA 1C48A 2OEOA 3SDZA 1Y8OB 3OTOQ 1YNND 5FK9C 2R93B 4X66Q 1A0IA 3K6OA 3BDCA 2R93H 2EYFA 5KNCA 4OELB 1HZAA 5I9OA 4B3TL 4DR6L 4JYAL 3LWUA 1Y14B 1UE1A 3PUWA 2R7ZH 2R7FA 3H91A 4F8MA 3BDOA 3MC0B 1Y8PB 4IPGA 3PUXA 3CPFA 3I4NB 1ZXTA 4A3MB 5CMDA 4NP5A 1PV4A 2VUMB 1I94Q 1PZID 3ULLA 3F2CA 4IALA 2BCOA 4ULLA 4YCWA 4A3EB 1XX8A 1H9RA 5IWAL 4DF7A 4KLKA 3PO3G 1DCZA 3K0YA 1F9QA 3EN2A 4QL5A 3S16B 1QJOA 4LF7Q 1EOTA 2J4XA 3S1MB 2OTLA 2AQ3B 2B63H 4WRDA 5J22A 4K5XA 2JA7G 1ENFA 5JJKA 2FHTA 1BBUA 1K3BC 5E1FA 1XPOA 3U58A 1Y8NB 4EQNA 1TWFB 2K6AA 2H5XA 5IIFA 4HMIA 2N3SA 2N49A 5FLMH 2FMMA 2UU9Q 4MHEA 4I65A 3M7GA 5M5YB 3OYYA 3J7A5 3GTLH 2MPMA 4Y7NH 2B2WA 2F0KA 4DV0Q 4A3KB 2WACA 2B2WC 2GVAA 1QVGA 3D4DA 3KK7A 3FP9A 3NTHA 3KLSX 2D0OA 5M3MB 4JI8Q 4O0AA 2B2UA 2PQAA 3HOUG 1CHQD 1GVPA 1FNVA 4A3EG 2JA5B 5IODA 4OWWB 1Q82C 2CH4A 3A7LA 1YBYA 3CC4A 1E1TA 4DAYB 1YNJC 5ELOA 5CC4A 3GTMH 1PH5A 2C5CA 2N55A 2PCFB 5C5LA 2RDFA 4R1JA 4CBVA 5GAGC 3I4NG 1X6OA 3I56A 2NVQB 3MXNB 3G71A 3H0GH 1Z9FA 4A3JH 1K8GA 3CQZB 3BDLA 1JOOA 2LS01 3MAQA 3J7AF 3H0GB 4A3JB 4A3LG 3I91A 4HIMA 1VQKA 1AW7A 4R4OA 1I3QH 4PMCA 5JJZA 1HXYD 3K5NA 3NE5B 4N9TA 1L1OB 1W6JA 4PZ6A 2ZXOA 1AH9A 4GN4B 1SEBD 4HCEA 4TSSA 5M9OA 3I4NH 5LHY1 4YCVA 2RA4A 4JI7L 5JJIA 2FINB 1WD1A 5E4WC 4H0LC 3A7AB 4RKLA 4OIKA 4P71A 3EJIA 4XYOA 3CMEA 2B63B 3K5OA 3H3VI 2UXCL 2ZXPA 3K81C 5GAEC 1FVIA 2N8NA 3HEJA 5EPLA 1VQLA 1X56A 1OXTA 1BQQT 1GUWA 4EQOA 4FF2A 3KYHC 1JWUD 1RF2D 5M5WH 1TWCH 4A3GH 2JN4A 3K58A 3K7AH 2F0PA 1N36Q 1BXTA 5GAHC 3QOLA 3J81E 2H1EA 3FVQA 3TBIB 3UDFA 2K7VA 1I5FA 1F2LA 1G6PA 1NR4A 3E6ZX 2IW3A 4LUZA 1SE4A 4NMZA 5C3EG 4ZAIA 4DUZL 2ZJQA 1CA5A 2MO1A 1N33L 4N8FA 2RQXA 4DNIA 4L63B 4Y7NB 4B3SL 3AMUA 1SNCA 2KA7A 5C4JB 1T5EA 4JOIC 4DR7Q 2MP1A 1LABA 2TSSA 4C2MH 4KHPL 5C5MA 2D0PA 3I90A 1PLFA 1UEBA 4HAEA 1VQJA 4R4QA 1NNXA 3V05A 4DV3L 5C3XA 4MZ9A 4BY7H 4GS3A 4A3FG 4JBMA 4QGUA 1B9NA 1SNOA 2R93G 1OXVA 1EIYB 3W3AA 5IP7G 1CZWA 4J8QA 5IYDG 4DU9A 4OGQC 1AZQA 5ELFA 4B3RL 3FRPB 2IX1A 3G7LA 3HOZB 2WAQE 5ISRA 1SLJA 5JPNC 1VQNA 3LX0A 4DAVA 4BBSB 1A2TA 1YNJD 1KDBA 5ELDA 4GNXA 3D3RA 5D65A 1U4PA 1CM9A
chains in the Genus database with same CATH topology
5EBDA 2L55A 2JA6B 3HKZB 1F9SA 2X6LA 2NVYB 2NTTA 4KN4C 1QB5D 4KMUC 2NTSA 1V1OA 3FDTA 4CJ2C 2F0DA 1UAPA 3F2UA 1U4RA 5C3WA 3P7JA 1PZKD 1EY8A 4HSPA 4ZYSA 4ZUIA 1SYCA 4A3GB 1SYEA 3ERQA 3A8JE 3VYRA 5CV7A 4FXDA 1SSOA 2X6GA 2EY1A 1BCPD 1MGSA 2DY7A 2NBFA 2KQ3A 3R2IA 1B3AA 2OXPA 4I7ZC 4RGTA 4V190 3MHBA 1HCZA 2PYKA 3DHQA 1KLGD 1STBA 4HTHA 2F0HA 5I6YA 4CJ1B 4BY7B 2C9OA 2B2UC 3BYTB 1BCPF 4RA8A 1EY6A 3HOVB 2E2DC 4NKLA 1PTOC 1VDZA 5EGTA 3SE0A 1H9JA 1SFOB 3A55A 1FNWA 3S17B 5CYUA 5T1GA 5KNBA 2D2CC 1JOQA 2K1BA 3K5LA 4RFBA 1GUGA 2QCPX 2Y0SB 4V0BA 2A73B 4CJ0B 3X3MA 3ITPA 3RMHA 4R9WA 3DEPA 1SNQA 2RDGA 1O7YA 3X3NA 2WP8J 3DWAA 2RDHA 4KI0A 1B53A 1BR9A 3D4RA 1MSGA 5M5XB 2EYPA 4UAIA 2JA7B 2K05A 1F2ZA 2E74C 2XN9C 3T16A 5CORA 3RD4A 1ONLA 2N88A 3H6MA 2WV6D 5C0XG 2R3ZA 5BN4A 1JB3A 1EFID 2F3VA 1LTAD 3QOJA 2F03A 2O2LD 1AP0A 2K33A 1V1PB 2F4IA 5K36H 3HOXB 2ZXRA 4E6IA 1PRTF 2RSOA 3P75A 3FPUB 1LACA 3M3YB 2B2VA 1DZ1A 3EQLC 1FYCA 4KKTA 1QWYA 2KEEA 2F0EA 2JP1A 2QKIC 3RZDB 3FKIB 4H13C 4PMBA 1WCMB 4RGMA 4WFN3 4C2MB 5T1IA 3MFYA 5HURA 5EKKA 5JEAG 3VR6A 3D8GA 3MA2B 2VB2X 3TZUA 2M00A 5JEAH 5KNDA 2EY6A 1QE6A 2MHVA 2CQAA 2I46A 4ZK9B 1ZYRD 4BA2I 1EL0A 2EJFC 1GUNA 3KLSA 2EPBA 2A6HD 4DNTB 5FLXE 2A5HA 3T56B 1H9KA 4KHZA 5KYLA 1TS2A 1OXSC 1PRTC 1TWAB 3ONAB 1EU4A 4Z9CB 2DN8A 1SYDA 5EKIA 1HTPA 1I4XA 2L12A 2M2LA 2XSCA 5DM63 2F0VA 4C1NK 1ENCA 1H9SA 1ZKOA 1EY9A 3L7ZC 4DFAA 3N6RA 4KTAA 4BY1B 4IZ8A 3J7AV 2YU9B 2NYZD 2NZ1D 1FGBD 2KECA 4G57A 1E2WA 5C0XI 5IGFA 3VYSA 1X3QA 5K36G 2R6GA 1SYFA 4ABNA 1S5CD 1EY0A 2NN6G 4ZQ3A 2SNMA 1PRTB 2B2TC 4RKBA 2CW0C 2WAQB 5CV9A 3EA6A 2M9VA 1AFPA 1G291 5C4XB 1SXTA 2AQ1B 1VMPA 1I3QB 2LFNA 1E2ZA 5I2XA 5A2QE 1ET6A 3BVMA 2BE5D 3CHBD 3MZ5A 5C0XH 4RAUC 1BBXC 4FF1A 1G2TA 2XVSA 1JWMD 1O80A 2AQ2B 4KKSA 2IT1A 4K8IA 3L3OC 3EFXD 2E76C 4R8NA 1Q12A 4P2CB 3DMUA 1STGA 4NW2A 4HEDA 1S4ZA 1EZ6A 1D5XC 1F77A 1IYUA 3J80E 2IX0A 1BO0A 4HN7A 4U673 2HQEA 1D6EC 4IN3A 1L0YB 2KCNA 5ELCA 1G6ZA 5KRUA 5DM73 2EDGA 3IFTA 2OF1A 1CI3M 4GZYC 4IUTA 2R7ZB 2KHSA 2PZWA 2F0SA 1D1IA 1HA6A 1O7ZA 2JEAI 1TWHB 2L11A 2Z1CA 4H7BA 1LTGD 1G91A 5FLXL 3HOYB 4QUCA 2PZTA 2Q8RE 4IURA 3QB3A 1TS5A 4XT1B 1LT4D 3MEHA 2L4NA 3D31A 5KGUA 4DGZA 1TR5A 4KY5A 5FO8B 2WINB 3NTIA 2B2YA 4KY7A 5E4XA 1R4QB 4RGOS 2K5QA 1TU2B 4FO2A 3Q23A 1Y1WB 5M5WB 1L0XB 3V96A 3J81L 1WTXA 3HP3A 4CGYB 3NPPA 1AEXA 2NN6I 2F0WA 1HQRD 5IGEA 3C1FA 5KEEA 4BA1I 2YYZA 4B08A 3SK5A 1PTOB 5C44B 5I6WA 2WB1B 4A3BB 1STHA 5BN3A 4A3DB 1PXUA 4KKUA 1KAAA 1SYGA 1EQTA 3RZOB 2MGSA 2PQEA 2R61A 5JEAJ 2EJGC 2ZT9C 2B2VC 2AWNA 1I4HA 2RVLA 1EYDA 2F0GA 2A69D 2VNUD 2CHBD 1U9RA 1D5ZC 1B2TA 1IW7D 3NWSA 2PPBC 2BA1A 4RGNA 5EBCA 4C1NI 3C46A 4XQNA 4CHTB 3OIPA 2KCCA 4DXGA 1EIHA 1PMRA 3GO5A 3MXPA 4NDXA 4XYQA 2KVMA 3EVQA 3OMCA 4FXKC 5JOBA 4MIUA 1SAPA 1E0BA 1Y1VB 3K5MA 3AU7A 2WKDA 3C2PA 3M4YA 3NUCA 1PDQA 5JPMC 3S2DB 2J0TD 2FMCA 3MTSA 2KJXA 2MUYA 1ESRA 3KBGA 3K7AB 3FEWX 3H94A 1QG7A 5ELBA 5J39A 3NQTA 1CK1A 2HDLA 1A2UA 3NK9A 5FOBB 4K6LA 1Q1BA 5COYA 4M8AA 3Q6SA 5C6AA 1SDFA 2JXMB 4DK1A 1UNSA 4DXFA 4LMQD 1W6KA 4XQQA 1RTNA 1J9OA 2ENBA 4K6DA 4BWGB 2O5IC 1JC7A 2EY2A 1I4GA 2MJ8A 4QMGA 1V43A 3R2TA 1FNUA 2F0IA 1TKWB 2X69A 4KN7C 3HOWB 2NWGA 1EQVA 3LNNA 4HCSA 3PO2B 4CKEA 1JQYD 3VA5A 2EZVA 1U4LA 4TQUS 1OXUA 3HOUB 2EYMA 1HTLD 2VXWA 1D2BA 5TSSA 3NQIA 1RCVD 2HDMA 3RUZA 2EE1A 3URYA 3VYTA 5DEHA 4B9XA 2F0TA 3U9SA 2OT2A 3BVGA 5IT9L 1LTRD 4C3JG 2NVXB 4X3KA 1JOKA 4FF4A 4S3SA 3VR2A 3DXJC 3NWTA 1WTRA 4KJOA 2AWOA 1PZJD 1STEA 5G3LD 3OIQA 3QWNA 4Q5VA 5JVH3 1BOSA 3ND9A 5CV4A 4RCNA 4OIJA 4U68A 2A68D 3GTGB 1LT3D 1NCVA 1EEID 3HG9A 5IGCA 1NUCA 5IT9E 5EJWA 1WD0A 1A3VA 3OOCA 1HPCA 2IJ0A 2QEJC 3I73A 4ZRZA 3D4WA 3NHHA 3A54A 1LT5D 4ME5A 2B2TA 3GTMB 2QILA 1M4VA 3T13A 3CKIB 2Q8IB 1LTSD 2PW7A 2XRQD 3D6WA 1K8MA 5C0XJ 1YNNC 4KD4A 3J7YW 2CVRA 2QDBA 1X3PA 3MVVA 4RCOA 2AUKA 3R93A 5EQ0A 1DXMA 3IKJA 2IX3A 1PTOH 4AYBB 3OWEB 2D5DA 1Z7TA 3PUZA 2A69C 1II3A 4IUPA 3TP5A 3TDQA 1H9SB 1AN8A 1SJED 3PUVA 1BUVT 1X32A 2K5WA 4BS9A 3Q0AA 3KLRA 1RD9D 1VMCA 1I4RA 1UEAB 1K83B 3WDNA 5DNFA 1KTKA 4HMJA 1KDAA 3GTKB 1G2SA 3QG1A 1ZYRC 4LAAA 2F0MA 5D14A 1ILQA 3BVZA 4IQZA 1SMYD 1VF5C 5FKAC 3SK8A 3WOEA 3H09A 3GTLB 2A6HC 4TRDA 4C3HB 3T4AC 4KHVA 1U4MA 1GOZA 4A3IB 1EU3A 1B4OA 2B8FA 4A93B 1RJTA 3S1RB 1C8CA 4ODGA 2NUCA 1M8AA 3MXGA 1ICWA 4A3FB 1PYWD 3SVMA 1D5MC 1HFNA 4ZUJA 2IWHA 2XNAC 3S14B 4HR7B 1GUOA 1EWCA 1B50A 2BOSA 1SYBA 2SOBA 1J8IA 1S5DD 1D1KA 2B2YC 4IUQA 1QNUA 2B39A 1F2MA 1DOMA 2KEDA 2K01A 1S5BD 4O1NA 1KNEA 1T5XD 1HUNA 3S1NB 3KUPA 1GHJA 5A35A 2SNSA 1ZEQX 5IGDA 3S15B 1DYQA 3TSSA 5C4ZA 1CTMA 3I4LA 3D6CA 3LWEA 4FXGC 3KF8A 2K04A 3VYUA 2G9HD 3E0JA 4K5VA 1A3UA 3DEOA 4DK0A 4OO1G 1R9TB 2JE6I 1A3TA 1IKMA 1HRJA 1PFNA 3WOFA 4L6TB 1CZGA 5KIXA 1PFMA 3N52A 3VR5A 4C56C 1FR3A 3GP7A 2RKSA 3T53B 5BN5A 1TWGB 1I4PA 1WVLA 1GJXA 5D3IB 1MD2D 4LK1C 3CRKC 5F2DA 3GTQB 2AUJD 4QF4A 3SK4A 3C1EA 1SE2A 4XT3B 2Z4HA 3GV3A 3RLFA 3FPPA 2EYJA 1QNKA 3TMEA 4X3TA 1EY4A 3HZXA 1O7LA 3BZDB 1STYA 1WTOA 1SNDA 1LTTD 4Q0FA 5JVG3 2D9UA 3KBXA 5EKLA 1IL8A 1KABA 1DOKA 1EY7A 1GXDC 2K03A 2EY5A 1GUSA 4QUFA 1PRTD 2EVBA 1XXGA 4K2LA 3O13A 5A2QL 1TWCB 2XWBB 2F0OA 1EIGA 4XTCS 1PFBA 2L1BA 3S2HB 3Q24A 2LMCB 3V2TA 2NVTB 3H3VC 5IGBA 4M1UB 5JAVA 2ICIA 1S5FD 4KV6A 2O4XA 2JYOA 2TMPA 4DAYA 1Q1EA 1TIID 2F0LA 1R4PB 3A8KE 4KK7A 1G8ZD 3SHLA 3M85A 1BCPC 1B44D 5E3FA 1QCBD 1C4QA 3NTKA 4C3IB 1CQVA 1XWEA 3DWQA 2PW5A 4YIJA 3OHXC 4IUNA 1TY0A 4FF3A 1NR2A 3I3CA 3BG3A 4G4KA 2G9DA 3GQBA 2WIIB 2KUMA 2VB3X 1LTBD 4IFDH 4C3JB 1MI2A 1EYAA 5I2YA 1UUPA 3U9OA 3HRZC 4XQJA 2LY7A 3NSWA 2SDFA 5HGTA 2EJMA 2F0UA 1WTVA 1SMYC 3JAML 3OW7A 2WKCA 4QIWB 3PIO3 3TP8A 1IYVA 1CFMA 1RKNA 3PMFA 5LL6X 1HHVA 4J1MA 5EPKA 3CRLC 4RHRA 4FYDA 2V4DA 3GTPB 1I50B 4K2KA 1Y69U 1RDPD 4PQXA 2EYOA 3SEBA 1AZPA 2RBMA 1K8OA 3T51B 4RH6A 3QO2A 2K28A 2L9HA 5M3FB 1Q90A 4FNFA 4XIGS 1DONA 2Z4IA 1SNPA 1VCIA 2A6EC 3G6JB 4KY6A 1H9MA 1Q8IA 1QOHA 2JSOA 1HA5A 3TP7A 4MN3A 1EZ8A 3A56A 4X3UA 3PO3B 1LTID 1JCKB 5I9PA 4F7XA 1NAPA 1JR0D 1ML0D 3ZYYX 4DAPA 4OL7A 5K5PA 5DAUA 2BDOA 1RODA 3IFDA 4O42A 3EROA 1BF4A 1LO5D 3OWFA 1ILPA 4IFDJ 1GUTA 4K8JA 2LKVA 4JK1C 3I70A 1TT2A 2NN6H 4B9WA 3GTOB 2XRSD 2E2JB 4WJWA 4K5WA 3MFGA 5I4DA 1ESFA 4X3SA 2A74C 4PNYA 1B1ZA 1DD2A 2HCIA 1TS4A 2E75C 3Q22A 1OO9B 3I8ZA 2QF7A 4ZKCB 5CBAE 3NBHA 5G3LF 4G7ZC 4H44C 4C3IG 1QILA 2XWJB 4IUUA 4ZLTF 5IOCA 1PTOD 4EQPA 2PZUA 1KNAA 1Q3LA 4DN4M 2H4OA 4G7HC 4OO1I 2GA4B 1JE4A 1NSNS 5CV8A 3NXWA 5FO9B 1Z6HA 1EYCA 1TVXA 3GV6A 1SBBB 1KDCA 3GD7A 1EEFD 1EY5A 2PNRC 3BS1A 3SR1A 1CHPD 2R92B 1SE3A 1CQFA 2BDNA 5EPJA 2EOTA 1CA6A 3K59A 3E5SA 1S5ED 1MSHA 1O78A 1RHPA 3VR4A 1XYIA 3TP6A 3DM1A 1BCPB 1LT6D 2PO4A 5KYIA 1OXXK 3FMCA 2F0JA 1TY2A 2B8GA 4BBRB 1B9MA 4DNRB 1IW7C 2DNEA 3PIP3 3QJYA 3NP8A 1IKLA 3S1QB 3JAME 1DJRD 4JBWA 5D3DA 4F87A 4EVOA 2DY8A 3M4OB 2I07B 3MXUA 4G7OC 3UI2A 2KOLA 1BDOA 4QCLA 5CV6A 1F9RA 1A6XA 4IFDI 3SK6A 1CT1D 2CW0D 1DOLA 1SJHD 2K5DA 1HFGA 2SEBD 1I6VC 3PV0A 4OO1H 4QB4A 3AB9A 1WTWA 1SNMA 4CKBA 5AFWA 3GTJB 1STAA 4F88A 1F2YA 5C4HA 4IUVA 2F1MA 1V1PA 3IL8A 4FVMA 4XDXA 4DA2A 4EGVA 5IGGA 2ID0A 2IL8A 2EYHA 4KD3A 2BE5C 4L8JA 3TZDA 2EXZA 1STNA 3IAYA 2ICEC 3W2DA 2JEBI 4RWSC 1VF7A 1GHKA 3BYYB 3PUYA 2FJ2A 2K32A 2E2HB 1JICA 1PTOF 3NBIA 3QIAA 4N9PA 1E2VA 2F0NA 3SXHA 3VA7A 2DNCA 2F0FA 3K57A 5J1ZA 1LV9A 1ET9A 3DUZA 1WTPA 1LLRD 1HUMA 3I4MB 4ID6A 3VR3A 4KJNA 3A8IE 2F0QA 5LL6S 3HS0C 4R8IA 2FFKB 2A6ED 5C3EB 5FO7B 3I72A 1MBYA 3M7NA 2J7ZA 3HGBA 3P20A 2L5TA 3ND8A 2HUGA 2HCCA 3OSOA 3R3OA 3MXNA 2RSNA 2BA0A 1WTQA 2JA8B 4UDUC 1JORA 4LJZC 2EYLA 2IPKD 1TS3A 1F9PA 4TKOB 3OPOA 2Z8LA 2Q8TA 1FD7D 5CBEE 1TQOA 4RHSA 4CKCA 1EWHA 1I6HB 3CU7A 2E2IB 4PMWA 4FP5D 5CV5A 1ENAA 4XXEA 4ZKBB 1XTCD 3DWPA 4ILWA 4J6HA 4WORA 3J80L 4PV1C 2A68C 2NB0A 1I4QA 1V8QA 1RTOA 2PMZB 3TN2A 3R8BA 1BNZA 3L9AX 3C3LA 2D62A 5NUCA 4HSVA 4OHJA 1DM0B 4IFDG 1JWSD 1HQMC 3MWYW 2F3WA 2O5JC 5ELEA 1A15A 1Z47A 3S9WA 4K14A 3P1HA 5CR3A 3OMGA 5CGKA 2XIWA 1IHZA 2L0CA 1KLUD 4C3HG 1C48A 2OEOA 3SDZA 1Y8OB 1YNND 5FK9C 2R93B 3K6OA 3BDCA 2EYFA 5KNCA 5I9OA 3LWUA 3PUWA 3H91A 4F8MA 3BDOA 3MC0B 1Y8PB 3PUXA 3I4NB 1ZXTA 4A3MB 5CMDA 4NP5A 2VUMB 1PZID 4IALA 2BCOA 4ULLA 4A3EB 1XX8A 1H9RA 4DF7A 1DCZA 3K0YA 1F9QA 3S16B 1QJOA 1EOTA 2J4XA 3S1MB 2AQ3B 5J22A 4WRDA 4K5XA 1ENFA 2FHTA 5E1FA 1Y8NB 4EQNA 1TWFB 2K6AA 5IIFA 4HMIA 2FMMA 4MHEA 4I65A 3M7GA 5M5YB 2MPMA 2B2WA 2F0KA 4A3KB 2WACA 2B2WC 3D4DA 3KK7A 3NTHA 3KLSX 5M3MB 2B2UA 1CHQD 1FNVA 2JA5B 5IODA 3A7LA 1YNJC 5CC4A 2C5CA 2N55A 2PCFB 5C5LA 2RDFA 4CBVA 2NVQB 3CQZB 3BDLA 1JOOA 2LS01 3MAQA 3J7AF 3H0GB 4A3JB 3I91A 1AW7A 4PMCA 5JJZA 1HXYD 3K5NA 3NE5B 4N9TA 1W6JA 2ZXOA 1SEBD 4HCEA 4TSSA 5M9OA 5LHY1 2RA4A 2FINB 1WD1A 5E4WC 4H0LC 3A7AB 4RKLA 4OIKA 3EJIA 4XYOA 2B63B 3K5OA 2ZXPA 5EPLA 3HEJA 1OXTA 1BQQT 1GUWA 4EQOA 4FF2A 1JWUD 1RF2D 3K58A 2F0PA 1BXTA 3QOLA 3J81E 2H1EA 3FVQA 3TBIB 2K7VA 1F2LA 1NR4A 3E6ZX 2IW3A 1SE4A 4NMZA 4ZAIA 1CA5A 2RQXA 4L63B 4Y7NB 3AMUA 1SNCA 2KA7A 5C4JB 1T5EA 2MP1A 1LABA 2TSSA 5C5MA 3I90A 1PLFA 4HAEA 3V05A 5C3XA 1B9NA 1SNOA 1OXVA 3W3AA 1CZWA 4J8QA 4DU9A 4OGQC 1AZQA 5ELFA 3FRPB 2IX1A 3G7LA 3HOZB 5ISRA 5JPNC 3LX0A 4DAVA 4BBSB 1A2TA 1YNJD 1KDBA 5ELDA 3D3RA 5D65A 1U4PA 1CM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T13 A;  2SNM A;  4F8M A;  3ITP A;  1STY A;  1SND A;  4EVO A;  4RKB A;  1U9R A;  2F0I A;  2EY6 A;  5M9O A;  3OSO A;  5HGT A;  2PW7 A;  3R3O A;  5CV9 A;  3MEH A;  5EKL A;  1KAB A;  1EY7 A;  1SNQ A;  1EQV A;  1SYB A;  4KD4 A;  4RKL A;  2SOB A;  5CV6 A;  5DEH A;  4NP5 A;  3EJI A;  2EY5 A;  1JOR A;  2F0U A;  5KGU A;  4DGZ A;  2EYL A;  1TR5 A;  1F2M A;  2QDB A;  3HEJ A;  4IAL A;  4KY5 A;  3MVV A;  4YIJ A;  3SK6 A;  3VA5 A;  3TP8 A;  4KY7 A;  1RKN A;  3PMF A;  4EQO A;  4K2L A;  2F0D A;  3MXP A;  3MZ5 A;  4J1M A;  2SNS A;  2EYM A;  2EYP A;  4NDX A;  5IGD A;  1EYA A;  5IOC A;  3EVQ A;  4DF7 A;  5C4Z A;  5C3W A;  2F0O A;  4QB4 A;  4EQP A;  3D6C A;  3OMC A;  5JOB A;  1EY8 A;  4MIU A;  1F2Z A;  5KYL A;  1SNM A;  1TQO A;  4ZUI A;  1SYC A;  2PZU A;  5KYI A;  1STA A;  1SYE A;  2F0P A;  3ERQ A;  4K2K A;  3RUZ A;  1F2Y A;  3T16 A;  5C4H A;  4K5V A;  1A3U A;  3QOL A;  2EYO A;  4WRD A;  1NSN S;  5CV5 A;  4K5X A;  1AEX A;  1ENA A;  2RBM A;  3H6M A;  2F0T A;  3NUC A;  3NXW A;  5CV7 A;  5IGB A;  1A3T A;  5E1F A;  5JAV A;  1EYC A;  1II3 A;  5IGG A;  4KD3 A;  2EYH A;  4K8I A;  4NMZ A;  3TP5 A;  2F0W A;  1SYD A;  4J6H A;  4WOR A;  4EQN A;  2EY1 A;  5IGE A;  5IIF A;  1JOK A;  4HMI A;  2EXZ A;  2F3V A;  1STN A;  3C1F A;  4KV6 A;  3QOJ A;  2O4X A;  4R8N A;  1KDC A;  4S3S A;  5KEE A;  5KIX A;  4I65 A;  3SK5 A;  2F0L A;  1EY5 A;  2KQ3 A;  3SR1 A;  1SNP A;  2RKS A;  1SNC A;  2OXP A;  3DMU A;  5I6W A;  1STG A;  3S9W A;  2F0K A;  4KY6 A;  2F0V A;  4KJO A;  3SHL A;  1EZ6 A;  4HMJ A;  4E6I A;  1KDA A;  1STH A;  2WAC A;  1ENC A;  3MHB A;  3D4D A;  3P75 A;  2HQE A;  3TP7 A;  5J39 A;  1EZ8 A;  3NQT A;  5C5M A;  2PYK A;  5NUC A;  4B9X A;  3DHQ A;  1EY9 A;  3E5S A;  4F7X A;  5I9P A;  5CV4 A;  5E3F A;  5IOD A;  4LAA A;  4DFA A;  4KTA A;  1STB A;  1A2U A;  2F3W A;  1KAA A;  2F0M A;  3NK9 A;  5C3X A;  4HTH A;  1SYG A;  2F0H A;  4IZ8 A;  4OL7 A;  3V2T A;  5K5P A;  4K14 A;  3TP6 A;  5KRU A;  1SNO A;  2PQE A;  5DAU A;  5I6Y A;  3SK8 A;  5F2D A;  2F0E A;  2OF1 A;  5IGC A;  5CC4 A;  2PW5 A;  1NUC A;  2KHS A;  3ERO A;  3P1H A;  4N9P A;  4PMB A;  2PZW A;  4G57 A;  2F0N A;  4IUN A;  5CR3 A;  3SXH A;  4QF4 A;  4TRD A;  5CV8 A;  2RDF A;  3OMG A;  3OWF A;  5C5L A;  1A3V A;  2F0J A;  3SK4 A;  1EY6 A;  1IHZ A;  3C1E A;  4KHV A;  5C6A A;  2F0S A;  4DU9 A;  4NKL A;  2F0F A;  5EGT A;  4K8J A;  2LKV A;  2OEO A;  5IGF A;  5J22 A;  4H7B A;  1TT2 A;  5J1Z A;  5HUR A;  5EKK A;  5ISR A;  2ENB A;  4K6D A;  3BDL A;  1JOO A;  2EYJ A;  4B9W A;  3LX0 A;  4ODG A;  2NUC A;  2PZT A;  1EYD A;  4ID6 A;  3D8G A;  3TME A;  1SYF A;  1A2T A;  3D4W A;  3NHH A;  4KJN A;  2F0G A;  1EY4 A;  3BDC A;  2EYF A;  1JOQ A;  1KDB A;  2EY2 A;  3NP8 A;  2F0Q A;  3HZX A;  4K5W A;  2M00 A;  4ME5 A;  3QB3 A;  4PMC A;  5I9O A;  5CGK A;  4N9T A;  4QMG A;  1EY0 A;  4ZUJ A;  4PNY A;  3U9O A;  4ZQ3 A; 
#chains in the Genus database with same CATH topology
 1V1Q A;  5EBD A;  3S1N H;  4C3H H;  2L55 A;  2JA6 B;  3HKZ B;  3CCV A;  1F9S A;  1TWH H;  3HOV G;  3RLO A;  1VQA A;  1QZG A;  2X6L A;  2NVY B;  2NTT A;  4KN4 C;  1QB5 D;  4DR3 L;  4KMU C;  2NTS A;  2RCN A;  4DR4 L;  1V1O A;  2IY5 B;  3BZK A;  2K14 A;  3FDT A;  4CJ2 C;  2F0D A;  1UAP A;  3F2U A;  4DV1 Q;  1U4R A;  1YJW A;  5C3W A;  1E24 A;  3P7J A;  1PZK D;  1EY8 A;  4HSP A;  4ZYS A;  1SN8 A;  4ZUI A;  1SYC A;  4A3G B;  1SYE A;  2JA9 A;  3ERQ A;  4UP8 A;  3A8J E;  3VYR A;  5CV7 A;  4FXD A;  3M4P A;  4B3T Q;  1SSO A;  2ALY B;  4OON A;  2X6G A;  2E2H H;  2EY1 A;  1BCP D;  3OTO L;  2PMZ E;  1MGS A;  1PYB A;  2DY7 A;  2NBF A;  4X64 L;  2KQ3 A;  3R2I A;  1B3A A;  3HOX H;  2OXP A;  4I7Z C;  1SR3 A;  4RGT A;  1XMQ Q;  2K50 A;  3HOV H;  3TQY A;  4V19 0;  3MHB A;  4YWL A;  1HCZ A;  4DV6 Q;  2PYK A;  3DHQ A;  1KLG D;  2RHS B;  1VQE A;  1STB A;  4HTH A;  2F0H A;  1YHA A;  2CFM A;  2OQ0 A;  4CJ1 B;  5I6Y A;  1P16 A;  4BY7 B;  2C9O A;  2B2U C;  3BYT B;  1BCP F;  4RA8 A;  1EY6 A;  3HOV B;  2K5V A;  2E2D C;  4DR5 Q;  4NKL A;  1PTO C;  1VDZ A;  5EGT A;  3SE0 A;  1H9J A;  3SGI A;  4LFB L;  1SFO B;  2JA6 G;  3A55 A;  4A3M H;  5IYD H;  1FNW A;  3S17 B;  5CYU A;  3TEH B;  5T1G A;  5KNB A;  3CCQ A;  2D2C C;  1JOQ A;  1PFS A;  2K1B A;  3K5L A;  3G6E A;  1L1O C;  4RFB A;  1GUG A;  2QCP X;  2Y0S B;  1IYJ B;  4V0B A;  2A73 B;  4CJ0 B;  4N8X 1;  3W5O A;  3X3M A;  4DK6 C;  2I5M X;  4C3J H;  3ITP A;  2F3I A;  3RMH A;  3K0X A;  4R9W A;  2YTY A;  1HNX Q;  3DEP A;  3HKZ E;  1LTL A;  1SNQ A;  2RDG A;  1O7Y A;  4JOI A;  4AYB E;  3J81 c;  3X3N A;  1HNZ Q;  4DPG A;  2WP8 J;  3PIP A;  3DWA A;  1YZ6 A;  2RDH A;  4KI0 A;  1B53 A;  1BR9 A;  2I0Q A;  3D4R A;  1MSG A;  5M5X B;  2EYP A;  3JC6 6;  4UAI A;  1J5E L;  4GKK Q;  4L5S A;  2JA7 B;  2K05 A;  1F2Z A;  2E5L Q;  2E74 C;  2XN9 C;  3T16 A;  5COR A;  3RD4 A;  1LUZ A;  1ONL A;  2N88 A;  3H6M A;  3RR5 A;  1HR0 W;  2WV6 D;  5C0X G;  1B70 B;  1WFQ A;  2QA4 A;  2R3Z A;  1M1K C;  5M5X H;  5BN4 A;  1JB3 A;  1EFI D;  2F3V A;  1LTA D;  3QOJ A;  4QY7 A;  2F03 A;  2VQF Q;  1XJV A;  2RCF A;  1N32 Q;  2O2L D;  1AP0 A;  4L5T A;  2K33 A;  1NE3 A;  1V1P B;  2F4I A;  1NMF A;  3HOX B;  5K36 H;  2ZXR A;  4IPH A;  3CCU A;  4E6I A;  1UE5 A;  1PRT F;  2WB1 E;  2RSO A;  3P75 A;  4YHH Q;  3FPU B;  1LAC A;  3M3Y B;  1E22 A;  3CCS A;  2B2V A;  1DZ1 A;  2VL6 A;  5M3F H;  3EQL C;  3ICE A;  1FYC A;  4KKT A;  1QWY A;  4BY1 G;  2KEE A;  1U0L A;  4A3F H;  4BBS G;  2F0E A;  2JP1 A;  2QKI C;  1VQD A;  3RZD B;  2HT1 A;  3E0E A;  1XMQ L;  3FKI B;  4H13 C;  4PMB A;  2ZTC A;  5AJ3 L;  1WCM B;  4RGM A;  3KDF A;  4WFN 3;  3FKI H;  1SFO H;  4C2M B;  4JI2 Q;  1Q8K A;  5T1I A;  3MFY A;  3CQZ H;  5HUR A;  5EKK A;  5JEA G;  2R7D A;  2CWP A;  2KCM A;  3VR6 A;  4B3M L;  3D8G A;  3MA2 B;  2VB2 X;  2E2J H;  3TZU A;  2UUC L;  2M00 A;  5JEA H;  5KND A;  3H0G G;  4A3J G;  2UXB L;  4JI4 L;  1M90 C;  4A3E H;  5C3E H;  2EY6 A;  1QE6 A;  2MHV A;  1EQQ A;  3M4O H;  2CQA A;  4A4I A;  2I46 A;  4ZK9 B;  1ZYR D;  2G5D A;  4BA2 I;  1EL0 A;  3S1M H;  2EJF C;  1GUN A;  4LF6 L;  1VQ9 A;  3KLS A;  3W1B A;  2EPB A;  2Z6K A;  2A6H D;  4JPB W;  3T1H L;  1RIP A;  4DNT B;  2Z6K C;  1C0A A;  5FLX E;  2A5H A;  4P75 A;  3T56 B;  2Q2U A;  1H9K A;  4KHZ A;  3PO2 G;  5KYL A;  4DV4 Q;  4IO9 A;  2VUM G;  4DKA C;  2Z0S A;  1YHB A;  1TS2 A;  4DV6 L;  3RLN A;  3PO2 H;  1OXS C;  1PRT C;  1TWA B;  3ONA B;  1EU4 A;  4Z9C B;  4BXX H;  4OEM B;  4J15 A;  2DN8 A;  2A8V A;  1SYD A;  5EKI A;  1VQ8 A;  1HTP A;  5FLX c;  2QDL A;  1I4X A;  2L12 A;  2M2L A;  3ZJY C;  2ZM6 Q;  2XSC A;  5DM6 3;  2F0V A;  4C1N K;  4X65 Q;  1ENC A;  1MIU A;  3BZC A;  1H9S A;  2K5H A;  1ZKO A;  3FKI G;  2JQO A;  3STB C;  1EY9 A;  1KD1 C;  5LMU L;  3L7Z C;  4DFA A;  3S17 H;  3N6R A;  4KTA A;  4BY1 B;  1WTH A;  1VS0 A;  4IZ8 A;  3J7A V;  4IJL A;  2YU9 B;  4ME3 A;  2NYZ D;  4IOA A;  2NZ1 D;  1DGS A;  1FGB D;  2KEC A;  4G57 A;  1E2W A;  4EQ5 A;  3PCO B;  4X62 Q;  1IBL Q;  4OWT B;  3G4S A;  5C0X I;  1Q81 C;  5IGF A;  2NVQ H;  3VYS A;  1X3Q A;  5K36 G;  4DUZ Q;  2R6G A;  4GN5 A;  1PHJ A;  3E3X A;  1SYF A;  4ABN A;  3K8A A;  4LF4 Q;  1S5C D;  5FLM G;  5IP9 G;  2HD3 A;  1EY0 A;  2NN6 G;  4ZQ3 A;  2SNM A;  1PRT B;  2B2T C;  4RKB A;  3S1Q H;  2QW7 A;  2CW0 C;  2WAQ B;  3GDE A;  5CV9 A;  3EA6 A;  2M9V A;  4A3K G;  3CCJ A;  1AFP A;  2QGQ A;  3CCM A;  4NXN L;  3HOW H;  1G29 1;  3S24 A;  5C4X B;  1XMO L;  3HOY H;  1SXT A;  2AQ1 B;  1VMP A;  1I3Q B;  4QJF A;  2LFN A;  1E2Z A;  5I2X A;  5A2Q E;  4LFC L;  1ET6 A;  3HKS A;  5EAY A;  3BVM A;  2BE5 D;  3CHB D;  1HZB A;  3MZ5 A;  5C0X H;  3F8T A;  4A75 A;  5BR8 L;  4RAU C;  3GTJ H;  1BBX C;  5DLQ E;  4FF1 A;  1IZ6 A;  3F2D A;  1G2T A;  4ALP A;  3I4O A;  2XVS A;  1JWM D;  2YTV A;  1O80 A;  2AQ2 B;  4KKS A;  2IT1 A;  4K8I A;  3PIO A;  3L3O C;  3EFX D;  2E76 C;  4R8N A;  1Q12 A;  1Y1W H;  4P2C B;  4DR2 L;  1QVC A;  3DMU A;  1STG A;  4NW2 A;  5M5Y H;  1WCM H;  4HED A;  1S4Z A;  1GM5 A;  4A3D H;  1ICF B;  1EZ6 A;  1D5X C;  1F77 A;  1IYU A;  2IX0 A;  4HN7 A;  1BO0 A;  4U67 3;  4LFA Q;  3J80 E;  2HQE A;  4A3B H;  1YIT A;  1D6E C;  3J81 i;  4YY3 Q;  1TWF H;  4IN3 A;  1L0Y B;  2KCN A;  5ELC A;  1KXL A;  1G6Z A;  5KRU A;  5DM7 3;  2EDG A;  3KOJ A;  3IFT A;  1XNQ Q;  2OF1 A;  1CI3 M;  4IOC A;  4IUT A;  4LFC Q;  2KHS A;  2VZA A;  4GZY C;  2R7Z B;  2PZW A;  3HOZ G;  4K0K L;  2F0S A;  4NXM Q;  1D1I A;  1HA6 A;  1O7Z A;  1XNQ L;  2JEA I;  1TWH B;  2L11 A;  2WB1 G;  2Z1C A;  3STB D;  5IYB H;  2FXQ A;  2UUB Q;  2KHJ A;  4H7B A;  4LF8 L;  4JV5 L;  1LTG D;  1G91 A;  4R4T A;  5FLX L;  3HOY B;  1FGU A;  4QUC A;  2PZT A;  2Q8R E;  2IHE A;  1XTD A;  4IUR A;  3QB3 A;  1A62 A;  1TS5 A;  2KBN A;  4UP7 A;  4DV5 L;  1YEZ A;  4HJ7 A;  4XT1 B;  5IYC H;  1LT4 D;  2GN5 A;  3MEH A;  2L4N A;  1G51 A;  3I7F A;  3D31 A;  5KGU A;  4DGZ A;  1YI2 A;  4BY7 G;  1TR5 A;  4KY5 A;  5FO8 B;  2WIN B;  3NTI A;  2B2Y A;  4KY7 A;  4P73 A;  5E4X A;  1R4Q B;  3F1Z A;  4RGO S;  1TXY A;  3J80 i;  2K5Q A;  1TU2 B;  4FO2 A;  3Q23 A;  3TS0 A;  4DAM A;  1Y1W B;  5M5W B;  1L0X B;  3V96 A;  3I2Z A;  3B6Y A;  5BR8 Q;  4JI8 L;  3J81 L;  1WTX A;  3HP3 A;  4CGY B;  1RL2 A;  2PI2 E;  3NPP A;  1S40 A;  1VQ7 A;  1AEX A;  3HKZ G;  1VQI A;  2ZTE A;  4JBJ A;  2NN6 I;  4X6A H;  1MKH A;  2F0W A;  1HQR D;  5IGE A;  2KCT A;  3NBH B;  4BXX G;  2UU9 L;  3C1F A;  5KEE A;  4BA1 I;  2YYZ A;  2YU9 H;  4LNQ A;  4B08 A;  1IBK Q;  1FJG Q;  3HOY G;  4I7A A;  3SK5 A;  1PTO B;  5C44 B;  5I6W A;  2JA8 G;  2CQO A;  3L0O A;  2WB1 B;  4A3G G;  4A3B B;  1STH A;  5BN3 A;  4LF5 L;  4A3D B;  3J81 j;  1PXU A;  4A3K H;  2WAQ G;  4KKU A;  2VY3 A;  3DM3 A;  1KHI A;  1KAA A;  1SYG A;  1EQT A;  3RZO B;  2MGS A;  2PQE A;  2R61 A;  5JEA J;  2EJG C;  5GQO A;  2ZT9 C;  2B2V C;  3H3V H;  4JI0 Q;  2DJF C;  1VQO A;  4DV7 Q;  1PH6 A;  1I94 L;  2AWN A;  1I4H A;  1GD7 A;  2RVL A;  1EYD A;  5HY6 A;  4LW1 A;  2F0G A;  1Q86 C;  1JJG A;  1CSQ A;  2A69 D;  2VNU D;  2CHB D;  4JYA Q;  1U9R A;  1D5Z C;  1SMX A;  2UUC Q;  5M3M G;  4X66 L;  1B2T A;  5C4X H;  1IW7 D;  3NWS A;  4R4I A;  5C44 G;  1HR0 Q;  2PPB C;  4YWM A;  2BA1 A;  4RGN A;  2K52 A;  5EBC A;  4C1N I;  4L5R C;  4LF5 Q;  3C46 A;  1TWA H;  4XQN A;  4CHT B;  5IY0 A;  2ZJP A;  5AJ3 Q;  1AE3 A;  3OIP A;  2Q2H A;  2KCC A;  4DXG A;  1EIH A;  1PMR A;  2NZH A;  3GO5 A;  3MXP A;  4NDX A;  4XYQ A;  2KVM A;  4DUY Q;  3EVQ A;  2YTX A;  3OMC A;  4FXK C;  4GLV B;  5JOB A;  4MIU A;  1SAP A;  1E0B A;  1Y1V B;  3K5M A;  4YHH L;  3AU7 A;  2WKD A;  3C2P A;  3M4Y A;  3NUC A;  1H95 A;  1PDQ A;  5JPM C;  3S2D B;  2J0T D;  2FMC A;  3MTS A;  2KJX A;  3I55 A;  2MUY A;  1CKN B;  1ESR A;  3KBG A;  3KF6 A;  3K7A B;  5FJ8 H;  4JI3 Q;  3FEW X;  1K83 H;  2Q2I A;  3H94 A;  2VS1 A;  3M3Y H;  3PO3 H;  1QG7 A;  5ELB A;  5J39 A;  3NQT A;  1CK1 A;  4HJA A;  2E5L L;  2HDL A;  1A2U A;  1WJJ A;  1X3F A;  3EIV A;  3NK9 A;  1J5E Q;  4A3L H;  5FOB B;  4K6L A;  1Q1B A;  5COY A;  4POG A;  4M8A A;  3CCR A;  1XNR L;  3Q6S A;  4A3I G;  5C6A A;  1SDF A;  2JXM B;  4DK1 A;  1UNS A;  4DXF A;  4LMQ D;  1W6K A;  4XQQ A;  1VQ4 A;  3PF4 A;  1RTN A;  2UUB L;  1J9O A;  2R7Z G;  2ENB A;  4K6D A;  1Q46 A;  1CSP A;  1E3P A;  4BWG B;  4MNO A;  1JC7 A;  2O5I C;  2EY2 A;  4OX9 Q;  1I4G A;  2MJ8 A;  1EFW A;  3AYH B;  5M3F G;  4QMG A;  1B8A A;  1V43 A;  3R2T A;  4PZ8 A;  1FNU A;  1W3S A;  2F0I A;  1TKW B;  2RHQ B;  2X69 A;  4JBK A;  4KN7 C;  2HHH L;  3HOW B;  2VQF L;  2NWG A;  4L5Q A;  4YY3 L;  1EQV A;  3LNN A;  4HCS A;  2JA8 H;  1EWI A;  3PO2 B;  1EQR A;  1PH4 A;  4CKE A;  1JQY D;  3VA5 A;  2EZV A;  1U4L A;  5LMN L;  4TQU S;  1OXU A;  2B29 A;  2VXW A;  2EYM A;  1HTL D;  3HOU B;  1D2B A;  2JA7 H;  3S16 H;  5TSS A;  3NQI A;  1RCV D;  4HJ8 A;  2HDM A;  3UE1 A;  1PH7 A;  3HFZ B;  3RUZ A;  2EE1 A;  4A76 A;  1HZC A;  3URY A;  1UE6 A;  3VYT A;  1VQP A;  1TWG H;  5DEH A;  4B9X A;  2ATW A;  2F0T A;  4CDD C;  3U9S A;  2OT2 A;  3BVG A;  4HIO A;  5IT9 L;  1LTR D;  3AFQ A;  2PQA B;  4C3J G;  4HJ5 A;  1VQM A;  2NVX B;  4X3K A;  1JOK A;  4FF4 A;  4S3S A;  3VR2 A;  4P72 A;  1O7I A;  3DXJ C;  3NWT A;  1WTR A;  3AQQ A;  1X3G A;  1PH9 A;  4KJO A;  2AWO A;  1PZJ D;  4BBR H;  1STE A;  5G3L D;  3OIQ A;  1V9P A;  3QWN A;  3BJU A;  4Q5V A;  4NXN Q;  5JVH 3;  1BOS A;  3ND9 A;  5CV4 A;  4RCN A;  3L2P A;  4OIJ A;  4U68 A;  2A68 D;  3GTG B;  1LT3 D;  2JA5 H;  1NCV A;  3T1Y Q;  1EEI D;  3HG9 A;  5IGC A;  3J7Z C;  1NUC A;  5IT9 E;  5EJW A;  1WD0 A;  1PH1 A;  5IYB G;  1K73 C;  4DR3 Q;  4JI0 L;  1A3V A;  4A3M G;  3GTQ H;  3OOC A;  1HPC A;  2IJ0 A;  2QEJ C;  1KRT A;  3I73 A;  4ZRZ A;  1PYS B;  3D4W A;  3NHH A;  3A54 A;  1LT5 D;  4ME5 A;  2B2T A;  3GTM B;  2JA5 G;  2QIL A;  3S14 H;  1M4V A;  3T13 A;  3CKI B;  2N78 A;  5IT9 c;  2PNH A;  1BVS A;  1AE2 A;  3IRB A;  2Q8I B;  1LTS D;  2PW7 A;  2XRQ D;  1J6Q A;  3D6W A;  1FJG L;  5LMU Q;  2OWO A;  4A3D G;  1K8M A;  5C0X J;  4DV2 Q;  1YNN C;  2NVY H;  1WCM G;  4KD4 A;  3J7Y W;  2CVR A;  2QDB A;  3K80 C;  1X3P A;  3MVV A;  4RCO A;  1R9T H;  1K8A C;  3TS2 A;  2AUK A;  1N9W A;  3R93 A;  5ELN A;  4Y52 H;  5EQ0 A;  1DXM A;  3IKJ A;  2EIF A;  2ASB A;  4A3C G;  2IX3 A;  3CPW A;  1CKN A;  1PTO H;  4AYB B;  3OWE B;  2D5D A;  1Z7T A;  3PUZ A;  4PG3 A;  2A69 C;  2F4V L;  2BH2 A;  1II3 A;  4IUP A;  4JI1 L;  3TP5 A;  3TDQ A;  1H9S B;  1AN8 A;  4B3S Q;  1SJE D;  3PUV A;  1BUV T;  1KC8 C;  1A8V A;  1X32 A;  2K5W A;  4BS9 A;  4AIM A;  3Q0A A;  3KLR A;  1JMC A;  1RD9 D;  1X54 A;  1VMC A;  1I4R A;  1UEA B;  1K83 B;  3WDN A;  5DNF A;  3HOW G;  1KTK A;  4HMJ A;  4LF6 Q;  1KDA A;  2IHF A;  1K0S A;  1N36 L;  3GTK B;  1G2S A;  2LSS A;  3QG1 A;  5IP9 H;  1ZYR C;  4LAA A;  2F0M A;  4JG2 A;  5D14 A;  1ILQ A;  3BVZ A;  4IQZ A;  1SMY D;  1VF5 C;  4B3R Q;  4CDF C;  5FKA C;  3SK8 A;  3WOE A;  2UXB Q;  3H09 A;  4QQB X;  3GTL B;  2A6H C;  4TRD A;  4C3H B;  3T4A C;  4KHV A;  3NEL A;  1U4M A;  1GOZ A;  4A3I B;  1B4O A;  1EU3 A;  1MHW C;  2B8F A;  1X55 A;  4BBR G;  5IP7 H;  1JT8 A;  4A93 B;  2K4K A;  1RJT A;  3S1R B;  1C8C A;  4ODG A;  2NUC A;  1M8A A;  3MXG A;  1ICW A;  4A3F B;  1PYW D;  3SVM A;  1JJ2 A;  4KHP Q;  1D5M C;  1HFN A;  4ZUJ A;  2IWH A;  3KF8 B;  3F2B A;  2XNA C;  2VQE L;  3S14 B;  4HR7 B;  1YJ9 A;  4IPD A;  3CC2 A;  1GUO A;  1EWC A;  1B50 A;  2BOS A;  4A93 H;  1SYB A;  3S2H H;  2SOB A;  1J8I A;  1S5D D;  3FHW A;  1D1K A;  2B2Y C;  4IUQ A;  1QNU A;  1T9H A;  2B39 A;  2XGT A;  1YJN A;  1F2M A;  1DOM A;  2KED A;  2K01 A;  1S5B D;  2HIV A;  1P8L A;  2E8G A;  3E9H A;  1KNE A;  1T5X D;  4O1N A;  4GKJ L;  3S15 H;  1HUN A;  3S1N B;  3KUP A;  1GHJ A;  5A35 A;  2GVB A;  2SNS A;  1ZEQ X;  5IGD A;  3S15 B;  1DYQ A;  3TSS A;  5C4Z A;  1CTM A;  3I4L A;  4HIK A;  3D6C A;  3LWE A;  4FXG C;  3KF8 A;  2K04 A;  3VYU A;  2G9H D;  3GTP H;  3ER0 A;  1MJE A;  3E0J A;  4K5V A;  1A3U A;  3DEO A;  4DK0 A;  4LF9 Q;  1UWV A;  4OO1 G;  1R9T B;  2JE6 I;  2RF4 A;  4OX9 L;  1A3T A;  1C9O A;  1IKM A;  1HRJ A;  2UXC Q;  1PFN A;  3WOF A;  2C35 B;  1CZG A;  4L6T B;  5KIX A;  3KDF B;  1PFM A;  3N52 A;  3VR5 A;  4C56 C;  1FR3 A;  3GP7 A;  2KEN A;  2RKS A;  4YCU A;  2K75 A;  3T53 B;  5BN5 A;  5C4X G;  1E7Z A;  1JE5 A;  1XNR Q;  2UUA L;  5C44 H;  1TWG B;  5M3M H;  3GTK H;  1I4P A;  1WVL A;  4LF4 L;  3AFP A;  1HR0 L;  1GJX A;  5D3I B;  1SRU A;  4LF7 L;  3KFU A;  1MD2 D;  2EXD A;  3CP0 A;  1VQF A;  1L1O A;  2KHI A;  1KRS A;  4LK1 C;  5HGQ A;  1HNX L;  3CRK C;  1B7Y B;  2Q2T A;  5IWA Q;  3CAM A;  5F2D A;  4UP9 A;  3GTQ B;  2AUJ D;  4QF4 A;  3SK4 A;  2OTJ A;  4NPS A;  3C1E A;  5GRO A;  1SE2 A;  4XT3 B;  2Z4H A;  1E1O A;  3GV3 A;  2XTI A;  3RLF A;  3FPP A;  2EYJ A;  5FJ8 G;  3GTG H;  1QNK A;  3TME A;  4X3T A;  1EY4 A;  3HZX A;  1QZH A;  3CCL A;  1O7L A;  3UE0 A;  3BZD B;  1STY A;  1WTO A;  1SND A;  1LTT D;  3HOU H;  4Q0F A;  3MEF A;  5JVG 3;  2D9U A;  4UY8 C;  3KBX A;  5EKL A;  3KJO A;  1IL8 A;  1KAB A;  1VQC A;  1GKH A;  1DOK A;  1EY7 A;  4JVZ A;  1PH8 A;  4DUY L;  4AQY L;  1GXD C;  2K03 A;  3I4M H;  3WWV A;  2EY5 A;  2EQS A;  1QUQ B;  2LXK A;  1GUS A;  2AMC B;  3ULJ A;  4QUF A;  1PRT D;  2EVB A;  5L37 A;  1XXG A;  2HIX A;  4K2L A;  5IE8 A;  3O13 A;  5A2Q L;  3NEN A;  1TWC B;  4AQY Q;  2Y0S E;  4HID A;  2XWB B;  3CW2 C;  2F0O A;  1X3E A;  1EIG A;  4XTC S;  1PFB A;  2B63 G;  1L0W A;  2R92 G;  2OCE A;  4H02 A;  2L1B A;  4JI6 L;  3S2H B;  1EIF A;  3Q24 A;  4GOP A;  2LMC B;  3V2T A;  2NVT B;  3DLL A;  3H3V C;  4APV A;  5IGB A;  4M1U B;  5JAV A;  4HJ9 A;  2ICI A;  1XPU A;  3E9I A;  1S5F D;  3JAM i;  4KV6 A;  2O4X A;  2NVX H;  1CUK A;  2JYO A;  2TMP A;  4DV1 L;  4DAY A;  1Q1E A;  3U50 C;  1TII D;  2F0L A;  4DV7 L;  1R4P B;  3A8K E;  4KK7 A;  1G8Z D;  4JI4 Q;  3SHL A;  1NTG A;  5C4J H;  4R4C A;  3TRE A;  2JJQ A;  5IYC G;  4ZCK A;  1BCP C;  3M85 A;  4JI6 Q;  4GOP B;  1B44 D;  5E3F A;  1QCB D;  1C4Q A;  3NTK A;  4C3I B;  1CQV A;  1XWE A;  3DWQ A;  4DV5 Q;  1KIX A;  2PW5 A;  1NMG A;  3OHX C;  4YIJ A;  2UUA Q;  4IUN A;  1TY0 A;  4FF3 A;  1NR2 A;  3I3C A;  3A5U A;  3HOZ H;  2UXD Q;  3BG3 A;  1IBK L;  4G4K A;  4UPA A;  2YV5 A;  2A1A A;  1U5K A;  1N8R C;  1PH2 A;  1VQ5 A;  2G9D A;  3GQB A;  2WII B;  2KUM A;  2ES2 A;  2VB3 X;  1LTB D;  4IFD H;  4C3J B;  1MI2 A;  1NBW A;  4LF9 L;  1EYA A;  2MO0 A;  4P74 A;  1UUP A;  3U9O A;  5I2Y A;  3HRZ C;  4XQJ A;  2BH8 A;  2LY7 A;  3NSW A;  5GAD C;  1N34 L;  2SDF A;  5HGT A;  4DV3 Q;  3HOX G;  4IJH A;  3Q8D A;  2EJM A;  2F0U A;  1WTV A;  4DR7 L;  1SMY C;  1A63 A;  3JAM L;  3PGZ A;  3OW7 A;  3BU2 A;  2WKC A;  1IL2 A;  4QIW B;  3PIO 3;  3TP8 A;  1IYV A;  1OTC A;  2AKW B;  1CFM A;  1RKN A;  3NEM A;  3PMF A;  5LL6 X;  1HHV A;  4J1M A;  1N33 Q;  5EPK A;  3CRL C;  4LUV A;  3CC7 A;  3PSI A;  4RHR A;  4FYD A;  2V4D A;  4JI5 L;  3GTP B;  1I50 B;  3UDI A;  4K2K A;  1D8L A;  1Y69 U;  1Y1V G;  2VQE Q;  4JW0 A;  2ZJR A;  1X9N A;  1RDP D;  4PQX A;  2EYO A;  2DUD A;  2Z9H A;  3SEB A;  1AZP A;  2RBM A;  1K8O A;  3A74 A;  3T51 B;  4RH6 A;  2I5L X;  3QO2 A;  3ERS X;  2K28 A;  2L9H A;  5M3F B;  1Q90 A;  1Q7Y C;  4FNF A;  4LF8 Q;  4JV5 Q;  4XIG S;  1DON A;  4JC0 A;  1KQS A;  3U4Z A;  2Z4I A;  3A5Z B;  4NXM L;  4K0K Q;  1SNP A;  1VCI A;  2A6E C;  3G6J B;  4KY6 A;  1H9M A;  1Q8I A;  1QOH A;  1HNW Q;  1K28 A;  2JSO A;  1YNX A;  1HA5 A;  3TP7 A;  4MN3 A;  1EZ8 A;  3A56 A;  4X3U A;  3PO3 B;  1LTI D;  1JCK B;  5I9P A;  1VQG A;  1NAP A;  4DK3 C;  4F7X A;  1JR0 D;  1YHQ A;  1ML0 D;  1HJP A;  3ZYY X;  4DAP A;  3U4V A;  4OL7 A;  5K5P A;  5DAU A;  3KF6 B;  2BDO A;  4LFA L;  1KAW A;  4GKJ Q;  1ROD A;  3IFD A;  4O42 A;  3ERO A;  1BF4 A;  1LO5 D;  3OWF A;  4DR2 Q;  1ILP A;  4IFD J;  1GUT A;  2AHO B;  4K8J A;  2LKV A;  4JK1 C;  3I70 A;  1TT2 A;  2NN6 H;  1MJC A;  4B9W A;  2XRS D;  3GTO B;  1WI5 A;  2E2J B;  4JCV E;  4X62 L;  1IBL L;  1YVC A;  4WJW A;  4JI1 Q;  1IBM Q;  1QUQ A;  1D7Q A;  4K5W A;  3MFG A;  4UHV A;  5I4D A;  1ESF A;  4X3S A;  2A74 C;  4PNY A;  4MTN A;  1B1Z A;  4OXP A;  1DD2 A;  1B3Q A;  2HCI A;  1TS4 A;  1LYL A;  2PI2 A;  4A3I H;  1BBW A;  2CCZ A;  2E75 C;  1OO9 B;  3J80 c;  3LGJ A;  3Q22 A;  3I8Z A;  2QF7 A;  4ZKC B;  1VQB A;  5CBA E;  3PF5 A;  4DR1 L;  4X65 L;  4WJ3 M;  3NBH A;  5G3L F;  2ZM6 L;  2B3G A;  4G7Z C;  4H44 C;  4C3I G;  1QIL A;  2XWJ B;  4IUU A;  1XMO Q;  4ZLT F;  1ASZ A;  5IOC A;  3W1G A;  2CH4 W;  1PTO D;  4EQP A;  4GNX C;  2PZU A;  1KNA A;  1Q3L A;  4DN4 M;  4NB3 A;  1UE7 A;  2H4O A;  4G7H C;  4OO1 I;  2GA4 B;  2VUM H;  3UDX A;  1JE4 A;  3QR8 A;  1NSN S;  5CV8 A;  1QVF A;  3NXW A;  5FO9 B;  4DR4 Q;  1PA6 A;  1Z6H A;  1EYC A;  4DV4 L;  5LMN W;  1TVX A;  3GV6 A;  3PQI A;  1SBB B;  1KDC A;  3M4Q A;  3GD7 A;  2P5Z X;  3I4M G;  2WFW A;  2Z6B A;  1EEF D;  1EY5 A;  2PNR C;  3D0F A;  3BS1 A;  3SR1 A;  4TVA B;  1IXR A;  1NJI C;  2F4V Q;  1CHP D;  2R92 B;  1SE3 A;  3T1Y L;  1CQF A;  1KL9 A;  2BDN A;  5EPJ A;  2EOT A;  1CA6 A;  3K59 A;  3E5S A;  1S5E D;  1MSH A;  2HQL A;  2I5H A;  4C3I H;  3S1R H;  1O78 A;  1RHP A;  3VR4 A;  1XYI A;  3TP6 A;  3DM1 A;  1BCP B;  1WOC A;  3RZO H;  1LT6 D;  2PO4 A;  5KYI A;  1OXX K;  3FMC A;  2F0J A;  1TY2 A;  2B8G A;  4BBR B;  4B3M Q;  4QIW E;  1B9M A;  1GO3 E;  4DNR B;  4DV2 L;  1IW7 C;  2CWA A;  4JI2 L;  4CDE C;  1LM0 A;  2DNE A;  3PIP 3;  4BY1 H;  2Y0S G;  2A19 A;  4BBS H;  3QJY A;  3NP8 A;  3M9B A;  1IKL A;  3S1Q B;  3ULP A;  1DJR D;  3JAM E;  4JBW A;  5D3D A;  4F87 A;  4EVO A;  2ZTD A;  4OWX B;  2DY8 A;  3M4O B;  1S72 A;  1PVO A;  2I07 B;  3MXU A;  4G7O C;  3G48 A;  3AEV A;  3UI2 A;  2KOL A;  2QEX A;  1SRO A;  4PZ7 A;  2MQH A;  1BDO A;  4AH6 A;  5CV6 A;  5H1S E;  1F9R A;  4QCL A;  3GTO H;  1A6X A;  4IFD I;  3T1H Q;  5LMN Q;  3SK6 A;  2V1C C;  1CT1 D;  1HH2 P;  1VQ6 A;  4GN3 B;  3CMA A;  2CW0 D;  1DOL A;  1SJH D;  2K5D A;  1HFG A;  2SEB D;  1I6V C;  1VQH A;  3PV0 A;  4OO1 H;  2CKZ B;  4QB4 A;  3KJP A;  2HHH Q;  3AB9 A;  4GLA C;  1WTW A;  1SNM A;  2LXJ A;  4CKB A;  2L15 A;  5AFW A;  1STA A;  3GTJ B;  4F88 A;  2E2I H;  1F2Y A;  5C4H A;  4IUV A;  2F1M A;  1V1P A;  3IL8 A;  4FVM A;  1ASY A;  1HNW L;  4XDX A;  3CXC A;  4DA2 A;  4EGV A;  5IGG A;  2ID0 A;  2IL8 A;  2EYH A;  4KD3 A;  1HZ9 A;  2BE5 C;  4DR1 Q;  4L8J A;  3TZD A;  4GOP C;  2EXZ A;  4FDB A;  1STN A;  3IAY A;  4GKK L;  2ICE C;  3W2D A;  1CKO A;  1X65 A;  3EBE A;  2JEB I;  4JI7 Q;  4RWS C;  4RG1 A;  1VF7 A;  4A93 G;  1GHK A;  4A3C H;  3CD6 A;  3BYY B;  3PUY A;  3VDY A;  2FJ2 A;  1SE8 A;  2OQK A;  1HNZ L;  3TRZ A;  1XPR A;  2VW9 A;  2MNA A;  1IBM L;  4GNX B;  1S3O A;  2K32 A;  3RNU A;  4RMF A;  2E2H B;  4LUO A;  1JIC A;  1PTO F;  3NBI A;  3QIA A;  1JB7 A;  4N9P A;  1E2V A;  2F0N A;  3SXH A;  4JI3 L;  3VA7 A;  2JA6 H;  1K3R A;  1N32 L;  2DNC A;  2F0F A;  3K57 A;  3A0J A;  5J1Z A;  1LV9 A;  1ET9 A;  1EUJ A;  3DUZ A;  2DGY A;  1WTP A;  4LFB Q;  1LLR D;  1HUM A;  4O2D A;  4DR5 L;  3I4M B;  4ID6 A;  3VR3 A;  1K9M C;  4KJN A;  3A8I E;  2F0Q A;  1FL0 A;  5LL6 S;  3HS0 C;  4R8I A;  2FFK B;  2A6E D;  2F52 A;  5C3E B;  1JJC B;  5FO7 B;  2K5N A;  3I72 A;  4DV0 L;  1MBY A;  3M7N A;  5JJL A;  2J7Z A;  3HGB A;  3P20 A;  2L5T A;  3ND8 A;  2HUG A;  2HCC A;  3OSO A;  3RN2 A;  1W2B A;  3R3O A;  3MXN A;  1PH3 A;  4A3B G;  2RSN A;  2BA0 A;  4IPC A;  1WTQ A;  2JA8 B;  4UDU C;  1JOR A;  2UXD L;  4GLX A;  5E7N A;  4LJZ C;  2EYL A;  2NZO A;  1EYG A;  2IPK D;  1YIJ A;  1TS3 A;  1NY4 A;  3S2D H;  5J3B A;  4X64 Q;  1F9P A;  4TKO B;  3OPO A;  2MFI A;  2Z8L A;  2Q8T A;  1FD7 D;  5CBE E;  4JI5 Q;  1TQO A;  1Y1V H;  1I6H H;  4RHS A;  4CKC A;  1EWH A;  2JK8 A;  1I6H B;  1Y1W G;  2NVT H;  1L2F A;  3CU7 A;  4MTK A;  4POF A;  2E2I B;  4PMW A;  4FP5 D;  2DJG C;  3OW2 A;  5CV5 A;  1ENA A;  1BKB A;  4XXE A;  4ZKB B;  1XTC D;  3DWP A;  4ILW A;  4J6H A;  4WOR A;  3J80 L;  3RN5 A;  1WYD A;  4PV1 C;  4WJ4 A;  2A68 C;  2NB0 A;  1I4Q A;  1V8Q A;  1RTO A;  4YWK A;  2PMZ B;  3TN2 A;  3R8B A;  1CKM A;  1I50 H;  1BNZ A;  3KLW A;  3RZD H;  3L9A X;  1N34 Q;  3UDG A;  3C3L A;  2R92 H;  4AYB G;  4EX5 A;  4DR6 Q;  2D62 A;  5NUC A;  4HSV A;  4OHJ A;  1DM0 B;  3CCE A;  4IFD G;  1JWS D;  1HQM C;  3MWY W;  1EOV A;  2F3W A;  2O5J C;  5ELE A;  1A15 A;  1Z47 A;  3S9W A;  4K14 A;  3JAM c;  3CF5 A;  3K7U C;  3P1H A;  3H15 A;  4CDC C;  1K0R A;  5CR3 A;  3OMG A;  5CGK A;  2XIW A;  1IHZ A;  2L0C A;  1KLU D;  1C7Y A;  4C3H G;  4LWC A;  1C48 A;  2OEO A;  3SDZ A;  1Y8O B;  3OTO Q;  1YNN D;  5FK9 C;  2R93 B;  4X66 Q;  1A0I A;  3K6O A;  3BDC A;  2R93 H;  2EYF A;  5KNC A;  4OEL B;  1HZA A;  5I9O A;  4B3T L;  4DR6 L;  4JYA L;  3LWU A;  1Y14 B;  1UE1 A;  3PUW A;  2R7Z H;  2R7F A;  3H91 A;  4F8M A;  3BDO A;  3MC0 B;  1Y8P B;  4IPG A;  3PUX A;  3CPF A;  3I4N B;  1ZXT A;  4A3M B;  5CMD A;  4NP5 A;  1PV4 A;  2VUM B;  1I94 Q;  1PZI D;  3ULL A;  3F2C A;  4IAL A;  2BCO A;  4ULL A;  4YCW A;  4A3E B;  1XX8 A;  1H9R A;  5IWA L;  4DF7 A;  4KLK A;  3PO3 G;  1DCZ A;  3K0Y A;  1F9Q A;  3EN2 A;  4QL5 A;  3S16 B;  1QJO A;  4LF7 Q;  1EOT A;  2J4X A;  3S1M B;  2OTL A;  2AQ3 B;  2B63 H;  4WRD A;  5J22 A;  4K5X A;  2JA7 G;  1ENF A;  5JJK A;  2FHT A;  1BBU A;  1K3B C;  5E1F A;  1XPO A;  3U58 A;  1Y8N B;  4EQN A;  1TWF B;  2K6A A;  2H5X A;  5IIF A;  4HMI A;  2N3S A;  2N49 A;  5FLM H;  2FMM A;  2UU9 Q;  4MHE A;  4I65 A;  3M7G A;  5M5Y B;  3OYY A;  3J7A 5;  3GTL H;  2MPM A;  4Y7N H;  2B2W A;  2F0K A;  4DV0 Q;  4A3K B;  2WAC A;  2B2W C;  2GVA A;  1QVG A;  3D4D A;  3KK7 A;  3FP9 A;  3NTH A;  3KLS X;  2D0O A;  5M3M B;  4JI8 Q;  4O0A A;  2B2U A;  2PQA A;  3HOU G;  1CHQ D;  1GVP A;  1FNV A;  4A3E G;  2JA5 B;  5IOD A;  4OWW B;  1Q82 C;  2CH4 A;  3A7L A;  1YBY A;  3CC4 A;  1E1T A;  4DAY B;  1YNJ C;  5ELO A;  5CC4 A;  3GTM H;  1PH5 A;  2C5C A;  2N55 A;  2PCF B;  5C5L A;  2RDF A;  4R1J A;  4CBV A;  5GAG C;  3I4N G;  1X6O A;  3I56 A;  2NVQ B;  3MXN B;  3G71 A;  3H0G H;  1Z9F A;  4A3J H;  1K8G A;  3CQZ B;  3BDL A;  1JOO A;  2LS0 1;  3MAQ A;  3J7A F;  3H0G B;  4A3J B;  4A3L G;  3I91 A;  4HIM A;  1VQK A;  1AW7 A;  4R4O A;  1I3Q H;  4PMC A;  5JJZ A;  1HXY D;  3K5N A;  3NE5 B;  4N9T A;  1L1O B;  1W6J A;  4PZ6 A;  2ZXO A;  1AH9 A;  4GN4 B;  1SEB D;  4HCE A;  4TSS A;  5M9O A;  3I4N H;  5LHY 1;  4YCV A;  2RA4 A;  4JI7 L;  5JJI A;  2FIN B;  1WD1 A;  5E4W C;  4H0L C;  3A7A B;  4RKL A;  4OIK A;  4P71 A;  3EJI A;  4XYO A;  3CME A;  2B63 B;  3K5O A;  3H3V I;  2UXC L;  2ZXP A;  3K81 C;  5GAE C;  1FVI A;  2N8N A;  3HEJ A;  5EPL A;  1VQL A;  1X56 A;  1OXT A;  1BQQ T;  1GUW A;  4EQO A;  4FF2 A;  3KYH C;  1JWU D;  1RF2 D;  5M5W H;  1TWC H;  4A3G H;  2JN4 A;  3K58 A;  3K7A H;  2F0P A;  1N36 Q;  1BXT A;  5GAH C;  3QOL A;  3J81 E;  2H1E A;  3FVQ A;  3TBI B;  3UDF A;  2K7V A;  1I5F A;  1F2L A;  1G6P A;  1NR4 A;  3E6Z X;  2IW3 A;  4LUZ A;  1SE4 A;  4NMZ A;  5C3E G;  4ZAI A;  4DUZ L;  2ZJQ A;  1CA5 A;  2MO1 A;  1N33 L;  4N8F A;  2RQX A;  4DNI A;  4L63 B;  4Y7N B;  4B3S L;  3AMU A;  1SNC A;  2KA7 A;  5C4J B;  1T5E A;  4JOI C;  4DR7 Q;  2MP1 A;  1LAB A;  2TSS A;  4C2M H;  4KHP L;  5C5M A;  2D0P A;  3I90 A;  1PLF A;  1UEB A;  4HAE A;  1VQJ A;  4R4Q A;  1NNX A;  3V05 A;  4DV3 L;  5C3X A;  4MZ9 A;  4BY7 H;  4GS3 A;  4A3F G;  4JBM A;  4QGU A;  1B9N A;  1SNO A;  2R93 G;  1OXV A;  1EIY B;  3W3A A;  5IP7 G;  1CZW A;  4J8Q A;  5IYD G;  4DU9 A;  4OGQ C;  1AZQ A;  5ELF A;  4B3R L;  3FRP B;  2IX1 A;  3G7L A;  3HOZ B;  2WAQ E;  5ISR A;  1SLJ A;  5JPN C;  1VQN A;  3LX0 A;  4DAV A;  4BBS B;  1A2T A;  1YNJ D;  1KDB A;  5ELD A;  4GNX A;  3D3R A;  5D65 A;  1U4P A;  1CM9 A; 
#chains in the Genus database with same CATH homology
 5EBD A;  2L55 A;  2JA6 B;  3HKZ B;  1F9S A;  2X6L A;  2NVY B;  2NTT A;  4KN4 C;  1QB5 D;  4KMU C;  2NTS A;  1V1O A;  3FDT A;  4CJ2 C;  2F0D A;  1UAP A;  3F2U A;  1U4R A;  5C3W A;  3P7J A;  1PZK D;  1EY8 A;  4HSP A;  4ZYS A;  4ZUI A;  1SYC A;  4A3G B;  1SYE A;  3ERQ A;  3A8J E;  3VYR A;  5CV7 A;  4FXD A;  1SSO A;  2X6G A;  2EY1 A;  1BCP D;  1MGS A;  2DY7 A;  2NBF A;  2KQ3 A;  3R2I A;  1B3A A;  2OXP A;  4I7Z C;  4RGT A;  4V19 0;  3MHB A;  1HCZ A;  2PYK A;  3DHQ A;  1KLG D;  1STB A;  4HTH A;  2F0H A;  5I6Y A;  4CJ1 B;  4BY7 B;  2C9O A;  2B2U C;  3BYT B;  1BCP F;  4RA8 A;  1EY6 A;  3HOV B;  2E2D C;  4NKL A;  1PTO C;  1VDZ A;  5EGT A;  3SE0 A;  1H9J A;  1SFO B;  3A55 A;  1FNW A;  3S17 B;  5CYU A;  5T1G A;  5KNB A;  2D2C C;  1JOQ A;  2K1B A;  3K5L A;  4RFB A;  1GUG A;  2QCP X;  2Y0S B;  4V0B A;  2A73 B;  4CJ0 B;  3X3M A;  3ITP A;  3RMH A;  4R9W A;  3DEP A;  1SNQ A;  2RDG A;  1O7Y A;  3X3N A;  2WP8 J;  3DWA A;  2RDH A;  4KI0 A;  1B53 A;  1BR9 A;  3D4R A;  1MSG A;  5M5X B;  2EYP A;  4UAI A;  2JA7 B;  2K05 A;  1F2Z A;  2E74 C;  2XN9 C;  3T16 A;  5COR A;  3RD4 A;  1ONL A;  2N88 A;  3H6M A;  2WV6 D;  5C0X G;  2R3Z A;  5BN4 A;  1JB3 A;  1EFI D;  2F3V A;  1LTA D;  3QOJ A;  2F03 A;  2O2L D;  1AP0 A;  2K33 A;  1V1P B;  2F4I A;  5K36 H;  3HOX B;  2ZXR A;  4E6I A;  1PRT F;  2RSO A;  3P75 A;  3FPU B;  1LAC A;  3M3Y B;  2B2V A;  1DZ1 A;  3EQL C;  1FYC A;  4KKT A;  1QWY A;  2KEE A;  2F0E A;  2JP1 A;  2QKI C;  3RZD B;  3FKI B;  4H13 C;  4PMB A;  1WCM B;  4RGM A;  4WFN 3;  4C2M B;  5T1I A;  3MFY A;  5HUR A;  5EKK A;  5JEA G;  3VR6 A;  3D8G A;  3MA2 B;  2VB2 X;  3TZU A;  2M00 A;  5JEA H;  5KND A;  2EY6 A;  1QE6 A;  2MHV A;  2CQA A;  2I46 A;  4ZK9 B;  1ZYR D;  4BA2 I;  1EL0 A;  2EJF C;  1GUN A;  3KLS A;  2EPB A;  2A6H D;  4DNT B;  5FLX E;  2A5H A;  3T56 B;  1H9K A;  4KHZ A;  5KYL A;  1TS2 A;  1OXS C;  1PRT C;  1TWA B;  3ONA B;  1EU4 A;  4Z9C B;  2DN8 A;  1SYD A;  5EKI A;  1HTP A;  1I4X A;  2L12 A;  2M2L A;  2XSC A;  5DM6 3;  2F0V A;  4C1N K;  1ENC A;  1H9S A;  1ZKO A;  1EY9 A;  3L7Z C;  4DFA A;  3N6R A;  4KTA A;  4BY1 B;  4IZ8 A;  3J7A V;  2YU9 B;  2NYZ D;  2NZ1 D;  1FGB D;  2KEC A;  4G57 A;  1E2W A;  5C0X I;  5IGF A;  3VYS A;  1X3Q A;  5K36 G;  2R6G A;  1SYF A;  4ABN A;  1S5C D;  1EY0 A;  2NN6 G;  4ZQ3 A;  2SNM A;  1PRT B;  2B2T C;  4RKB A;  2CW0 C;  2WAQ B;  5CV9 A;  3EA6 A;  2M9V A;  1AFP A;  1G29 1;  5C4X B;  1SXT A;  2AQ1 B;  1VMP A;  1I3Q B;  2LFN A;  1E2Z A;  5I2X A;  5A2Q E;  1ET6 A;  3BVM A;  2BE5 D;  3CHB D;  3MZ5 A;  5C0X H;  4RAU C;  1BBX C;  4FF1 A;  1G2T A;  2XVS A;  1JWM D;  1O80 A;  2AQ2 B;  4KKS A;  2IT1 A;  4K8I A;  3L3O C;  3EFX D;  2E76 C;  4R8N A;  1Q12 A;  4P2C B;  3DMU A;  1STG A;  4NW2 A;  4HED A;  1S4Z A;  1EZ6 A;  1D5X C;  1F77 A;  1IYU A;  3J80 E;  2IX0 A;  1BO0 A;  4HN7 A;  4U67 3;  2HQE A;  1D6E C;  4IN3 A;  1L0Y B;  2KCN A;  5ELC A;  1G6Z A;  5KRU A;  5DM7 3;  2EDG A;  3IFT A;  2OF1 A;  1CI3 M;  4GZY C;  4IUT A;  2R7Z B;  2KHS A;  2PZW A;  2F0S A;  1D1I A;  1HA6 A;  1O7Z A;  2JEA I;  1TWH B;  2L11 A;  2Z1C A;  4H7B A;  1LTG D;  1G91 A;  5FLX L;  3HOY B;  4QUC A;  2PZT A;  2Q8R E;  4IUR A;  3QB3 A;  1TS5 A;  4XT1 B;  1LT4 D;  3MEH A;  2L4N A;  3D31 A;  5KGU A;  4DGZ A;  1TR5 A;  4KY5 A;  5FO8 B;  2WIN B;  3NTI A;  2B2Y A;  4KY7 A;  5E4X A;  1R4Q B;  4RGO S;  2K5Q A;  1TU2 B;  4FO2 A;  3Q23 A;  1Y1W B;  5M5W B;  1L0X B;  3V96 A;  3J81 L;  1WTX A;  3HP3 A;  4CGY B;  3NPP A;  1AEX A;  2NN6 I;  2F0W A;  1HQR D;  5IGE A;  3C1F A;  5KEE A;  4BA1 I;  2YYZ A;  4B08 A;  3SK5 A;  1PTO B;  5C44 B;  5I6W A;  2WB1 B;  4A3B B;  1STH A;  5BN3 A;  4A3D B;  1PXU A;  4KKU A;  1KAA A;  1SYG A;  1EQT A;  3RZO B;  2MGS A;  2PQE A;  2R61 A;  5JEA J;  2EJG C;  2ZT9 C;  2B2V C;  2AWN A;  1I4H A;  2RVL A;  1EYD A;  2F0G A;  2A69 D;  2VNU D;  2CHB D;  1U9R A;  1D5Z C;  1B2T A;  1IW7 D;  3NWS A;  2PPB C;  2BA1 A;  4RGN A;  5EBC A;  4C1N I;  3C46 A;  4XQN A;  4CHT B;  3OIP A;  2KCC A;  4DXG A;  1EIH A;  1PMR A;  3GO5 A;  3MXP A;  4NDX A;  4XYQ A;  2KVM A;  3EVQ A;  3OMC A;  4FXK C;  5JOB A;  4MIU A;  1SAP A;  1E0B A;  1Y1V B;  3K5M A;  3AU7 A;  2WKD A;  3C2P A;  3M4Y A;  3NUC A;  1PDQ A;  5JPM C;  3S2D B;  2J0T D;  2FMC A;  3MTS A;  2KJX A;  2MUY A;  1ESR A;  3KBG A;  3K7A B;  3FEW X;  3H94 A;  1QG7 A;  5ELB A;  5J39 A;  3NQT A;  1CK1 A;  2HDL A;  1A2U A;  3NK9 A;  5FOB B;  4K6L A;  1Q1B A;  5COY A;  4M8A A;  3Q6S A;  5C6A A;  1SDF A;  2JXM B;  4DK1 A;  1UNS A;  4DXF A;  4LMQ D;  1W6K A;  4XQQ A;  1RTN A;  1J9O A;  2ENB A;  4K6D A;  4BWG B;  2O5I C;  1JC7 A;  2EY2 A;  1I4G A;  2MJ8 A;  4QMG A;  1V43 A;  3R2T A;  1FNU A;  2F0I A;  1TKW B;  2X69 A;  4KN7 C;  3HOW B;  2NWG A;  1EQV A;  3LNN A;  4HCS A;  3PO2 B;  4CKE A;  1JQY D;  3VA5 A;  2EZV A;  1U4L A;  4TQU S;  1OXU A;  3HOU B;  2EYM A;  1HTL D;  2VXW A;  1D2B A;  5TSS A;  3NQI A;  1RCV D;  2HDM A;  3RUZ A;  2EE1 A;  3URY A;  3VYT A;  5DEH A;  4B9X A;  2F0T A;  3U9S A;  2OT2 A;  3BVG A;  5IT9 L;  1LTR D;  4C3J G;  2NVX B;  4X3K A;  1JOK A;  4FF4 A;  4S3S A;  3VR2 A;  3DXJ C;  3NWT A;  1WTR A;  4KJO A;  2AWO A;  1PZJ D;  1STE A;  5G3L D;  3OIQ A;  3QWN A;  4Q5V A;  5JVH 3;  1BOS A;  3ND9 A;  5CV4 A;  4RCN A;  4OIJ A;  4U68 A;  2A68 D;  3GTG B;  1LT3 D;  1NCV A;  1EEI D;  3HG9 A;  5IGC A;  1NUC A;  5IT9 E;  5EJW A;  1WD0 A;  1A3V A;  3OOC A;  1HPC A;  2IJ0 A;  2QEJ C;  3I73 A;  4ZRZ A;  3D4W A;  3NHH A;  3A54 A;  1LT5 D;  4ME5 A;  2B2T A;  3GTM B;  2QIL A;  1M4V A;  3T13 A;  3CKI B;  2Q8I B;  1LTS D;  2PW7 A;  2XRQ D;  3D6W A;  1K8M A;  5C0X J;  1YNN C;  4KD4 A;  3J7Y W;  2CVR A;  2QDB A;  1X3P A;  3MVV A;  4RCO A;  2AUK A;  3R93 A;  5EQ0 A;  1DXM A;  3IKJ A;  2IX3 A;  1PTO H;  4AYB B;  3OWE B;  2D5D A;  1Z7T A;  3PUZ A;  2A69 C;  1II3 A;  4IUP A;  3TP5 A;  3TDQ A;  1H9S B;  1AN8 A;  1SJE D;  3PUV A;  1BUV T;  1X32 A;  2K5W A;  4BS9 A;  3Q0A A;  3KLR A;  1RD9 D;  1VMC A;  1I4R A;  1UEA B;  1K83 B;  3WDN A;  5DNF A;  1KTK A;  4HMJ A;  1KDA A;  3GTK B;  1G2S A;  3QG1 A;  1ZYR C;  4LAA A;  2F0M A;  5D14 A;  1ILQ A;  3BVZ A;  4IQZ A;  1SMY D;  1VF5 C;  5FKA C;  3SK8 A;  3WOE A;  3H09 A;  3GTL B;  2A6H C;  4TRD A;  4C3H B;  3T4A C;  4KHV A;  1U4M A;  1GOZ A;  4A3I B;  1EU3 A;  1B4O A;  2B8F A;  4A93 B;  1RJT A;  3S1R B;  1C8C A;  4ODG A;  2NUC A;  1M8A A;  3MXG A;  1ICW A;  4A3F B;  1PYW D;  3SVM A;  1D5M C;  1HFN A;  4ZUJ A;  2IWH A;  2XNA C;  3S14 B;  4HR7 B;  1GUO A;  1EWC A;  1B50 A;  2BOS A;  1SYB A;  2SOB A;  1J8I A;  1S5D D;  1D1K A;  2B2Y C;  4IUQ A;  1QNU A;  2B39 A;  1F2M A;  1DOM A;  2KED A;  2K01 A;  1S5B D;  4O1N A;  1KNE A;  1T5X D;  1HUN A;  3S1N B;  3KUP A;  1GHJ A;  5A35 A;  2SNS A;  1ZEQ X;  5IGD A;  3S15 B;  1DYQ A;  3TSS A;  5C4Z A;  1CTM A;  3I4L A;  3D6C A;  3LWE A;  4FXG C;  3KF8 A;  2K04 A;  3VYU A;  2G9H D;  3E0J A;  4K5V A;  1A3U A;  3DEO A;  4DK0 A;  4OO1 G;  1R9T B;  2JE6 I;  1A3T A;  1IKM A;  1HRJ A;  1PFN A;  3WOF A;  4L6T B;  1CZG A;  5KIX A;  1PFM A;  3N52 A;  3VR5 A;  4C56 C;  1FR3 A;  3GP7 A;  2RKS A;  3T53 B;  5BN5 A;  1TWG B;  1I4P A;  1WVL A;  1GJX A;  5D3I B;  1MD2 D;  4LK1 C;  3CRK C;  5F2D A;  3GTQ B;  2AUJ D;  4QF4 A;  3SK4 A;  3C1E A;  1SE2 A;  4XT3 B;  2Z4H A;  3GV3 A;  3RLF A;  3FPP A;  2EYJ A;  1QNK A;  3TME A;  4X3T A;  1EY4 A;  3HZX A;  1O7L A;  3BZD B;  1STY A;  1WTO A;  1SND A;  1LTT D;  4Q0F A;  5JVG 3;  2D9U A;  3KBX A;  5EKL A;  1IL8 A;  1KAB A;  1DOK A;  1EY7 A;  1GXD C;  2K03 A;  2EY5 A;  1GUS A;  4QUF A;  1PRT D;  2EVB A;  1XXG A;  4K2L A;  3O13 A;  5A2Q L;  1TWC B;  2XWB B;  2F0O A;  1EIG A;  4XTC S;  1PFB A;  2L1B A;  3S2H B;  3Q24 A;  2LMC B;  3V2T A;  2NVT B;  3H3V C;  5IGB A;  4M1U B;  5JAV A;  2ICI A;  1S5F D;  4KV6 A;  2O4X A;  2JYO A;  2TMP A;  4DAY A;  1Q1E A;  1TII D;  2F0L A;  1R4P B;  3A8K E;  4KK7 A;  1G8Z D;  3SHL A;  3M85 A;  1BCP C;  1B44 D;  5E3F A;  1QCB D;  1C4Q A;  3NTK A;  4C3I B;  1CQV A;  1XWE A;  3DWQ A;  2PW5 A;  4YIJ A;  3OHX C;  4IUN A;  1TY0 A;  4FF3 A;  1NR2 A;  3I3C A;  3BG3 A;  4G4K A;  2G9D A;  3GQB A;  2WII B;  2KUM A;  2VB3 X;  1LTB D;  4IFD H;  4C3J B;  1MI2 A;  1EYA A;  5I2Y A;  1UUP A;  3U9O A;  3HRZ C;  4XQJ A;  2LY7 A;  3NSW A;  2SDF A;  5HGT A;  2EJM A;  2F0U A;  1WTV A;  1SMY C;  3JAM L;  3OW7 A;  2WKC A;  4QIW B;  3PIO 3;  3TP8 A;  1IYV A;  1CFM A;  1RKN A;  3PMF A;  5LL6 X;  1HHV A;  4J1M A;  5EPK A;  3CRL C;  4RHR A;  4FYD A;  2V4D A;  3GTP B;  1I50 B;  4K2K A;  1Y69 U;  1RDP D;  4PQX A;  2EYO A;  3SEB A;  1AZP A;  2RBM A;  1K8O A;  3T51 B;  4RH6 A;  3QO2 A;  2K28 A;  2L9H A;  5M3F B;  1Q90 A;  4FNF A;  4XIG S;  1DON A;  2Z4I A;  1SNP A;  1VCI A;  2A6E C;  3G6J B;  4KY6 A;  1H9M A;  1Q8I A;  1QOH A;  2JSO A;  1HA5 A;  3TP7 A;  4MN3 A;  1EZ8 A;  3A56 A;  4X3U A;  3PO3 B;  1LTI D;  1JCK B;  5I9P A;  4F7X A;  1NAP A;  1JR0 D;  1ML0 D;  3ZYY X;  4DAP A;  4OL7 A;  5K5P A;  5DAU A;  2BDO A;  1ROD A;  3IFD A;  4O42 A;  3ERO A;  1BF4 A;  1LO5 D;  3OWF A;  1ILP A;  4IFD J;  1GUT A;  4K8J A;  2LKV A;  4JK1 C;  3I70 A;  1TT2 A;  2NN6 H;  4B9W A;  3GTO B;  2XRS D;  2E2J B;  4WJW A;  4K5W A;  3MFG A;  5I4D A;  1ESF A;  4X3S A;  2A74 C;  4PNY A;  1B1Z A;  1DD2 A;  2HCI A;  1TS4 A;  2E75 C;  3Q22 A;  1OO9 B;  3I8Z A;  2QF7 A;  4ZKC B;  5CBA E;  3NBH A;  5G3L F;  4G7Z C;  4H44 C;  4C3I G;  1QIL A;  2XWJ B;  4IUU A;  4ZLT F;  5IOC A;  1PTO D;  4EQP A;  2PZU A;  1KNA A;  1Q3L A;  4DN4 M;  2H4O A;  4G7H C;  4OO1 I;  2GA4 B;  1JE4 A;  1NSN S;  5CV8 A;  3NXW A;  5FO9 B;  1Z6H A;  1EYC A;  1TVX A;  3GV6 A;  1SBB B;  1KDC A;  3GD7 A;  1EEF D;  1EY5 A;  2PNR C;  3BS1 A;  3SR1 A;  1CHP D;  2R92 B;  1SE3 A;  1CQF A;  2BDN A;  5EPJ A;  2EOT A;  1CA6 A;  3K59 A;  3E5S A;  1S5E D;  1MSH A;  1O78 A;  1RHP A;  3VR4 A;  1XYI A;  3TP6 A;  3DM1 A;  1BCP B;  1LT6 D;  2PO4 A;  5KYI A;  1OXX K;  3FMC A;  2F0J A;  1TY2 A;  2B8G A;  4BBR B;  1B9M A;  4DNR B;  1IW7 C;  2DNE A;  3PIP 3;  3QJY A;  3NP8 A;  1IKL A;  3S1Q B;  3JAM E;  1DJR D;  4JBW A;  5D3D A;  4F87 A;  4EVO A;  2DY8 A;  3M4O B;  2I07 B;  3MXU A;  4G7O C;  3UI2 A;  2KOL A;  1BDO A;  4QCL A;  5CV6 A;  1F9R A;  1A6X A;  4IFD I;  3SK6 A;  1CT1 D;  2CW0 D;  1DOL A;  1SJH D;  2K5D A;  1HFG A;  2SEB D;  1I6V C;  3PV0 A;  4OO1 H;  4QB4 A;  3AB9 A;  1WTW A;  1SNM A;  4CKB A;  5AFW A;  3GTJ B;  1STA A;  4F88 A;  1F2Y A;  5C4H A;  4IUV A;  2F1M A;  1V1P A;  3IL8 A;  4FVM A;  4XDX A;  4DA2 A;  4EGV A;  5IGG A;  2ID0 A;  2IL8 A;  2EYH A;  4KD3 A;  2BE5 C;  4L8J A;  3TZD A;  2EXZ A;  1STN A;  3IAY A;  2ICE C;  3W2D A;  2JEB I;  4RWS C;  1VF7 A;  1GHK A;  3BYY B;  3PUY A;  2FJ2 A;  2K32 A;  2E2H B;  1JIC A;  1PTO F;  3NBI A;  3QIA A;  4N9P A;  1E2V A;  2F0N A;  3SXH A;  3VA7 A;  2DNC A;  2F0F A;  3K57 A;  5J1Z A;  1LV9 A;  1ET9 A;  3DUZ A;  1WTP A;  1LLR D;  1HUM A;  3I4M B;  4ID6 A;  3VR3 A;  4KJN A;  3A8I E;  2F0Q A;  5LL6 S;  3HS0 C;  4R8I A;  2FFK B;  2A6E D;  5C3E B;  5FO7 B;  3I72 A;  1MBY A;  3M7N A;  2J7Z A;  3HGB A;  3P20 A;  2L5T A;  3ND8 A;  2HUG A;  2HCC A;  3OSO A;  3R3O A;  3MXN A;  2RSN A;  2BA0 A;  1WTQ A;  2JA8 B;  4UDU C;  1JOR A;  4LJZ C;  2EYL A;  2IPK D;  1TS3 A;  1F9P A;  4TKO B;  3OPO A;  2Z8L A;  2Q8T A;  1FD7 D;  5CBE E;  1TQO A;  4RHS A;  4CKC A;  1EWH A;  1I6H B;  3CU7 A;  2E2I B;  4PMW A;  4FP5 D;  5CV5 A;  1ENA A;  4XXE A;  4ZKB B;  1XTC D;  3DWP A;  4ILW A;  4J6H A;  4WOR A;  3J80 L;  4PV1 C;  2A68 C;  2NB0 A;  1I4Q A;  1V8Q A;  1RTO A;  2PMZ B;  3TN2 A;  3R8B A;  1BNZ A;  3L9A X;  3C3L A;  2D62 A;  5NUC A;  4HSV A;  4OHJ A;  1DM0 B;  4IFD G;  1JWS D;  1HQM C;  3MWY W;  2F3W A;  2O5J C;  5ELE A;  1A15 A;  1Z47 A;  3S9W A;  4K14 A;  3P1H A;  5CR3 A;  3OMG A;  5CGK A;  2XIW A;  1IHZ A;  2L0C A;  1KLU D;  4C3H G;  1C48 A;  2OEO A;  3SDZ A;  1Y8O B;  1YNN D;  5FK9 C;  2R93 B;  3K6O A;  3BDC A;  2EYF A;  5KNC A;  5I9O A;  3LWU A;  3PUW A;  3H91 A;  4F8M A;  3BDO A;  3MC0 B;  1Y8P B;  3PUX A;  3I4N B;  1ZXT A;  4A3M B;  5CMD A;  4NP5 A;  2VUM B;  1PZI D;  4IAL A;  2BCO A;  4ULL A;  4A3E B;  1XX8 A;  1H9R A;  4DF7 A;  1DCZ A;  3K0Y A;  1F9Q A;  3S16 B;  1QJO A;  1EOT A;  2J4X A;  3S1M B;  2AQ3 B;  5J22 A;  4WRD A;  4K5X A;  1ENF A;  2FHT A;  5E1F A;  1Y8N B;  4EQN A;  1TWF B;  2K6A A;  5IIF A;  4HMI A;  2FMM A;  4MHE A;  4I65 A;  3M7G A;  5M5Y B;  2MPM A;  2B2W A;  2F0K A;  4A3K B;  2WAC A;  2B2W C;  3D4D A;  3KK7 A;  3NTH A;  3KLS X;  5M3M B;  2B2U A;  1CHQ D;  1FNV A;  2JA5 B;  5IOD A;  3A7L A;  1YNJ C;  5CC4 A;  2C5C A;  2N55 A;  2PCF B;  5C5L A;  2RDF A;  4CBV A;  2NVQ B;  3CQZ B;  3BDL A;  1JOO A;  2LS0 1;  3MAQ A;  3J7A F;  3H0G B;  4A3J B;  3I91 A;  1AW7 A;  4PMC A;  5JJZ A;  1HXY D;  3K5N A;  3NE5 B;  4N9T A;  1W6J A;  2ZXO A;  1SEB D;  4HCE A;  4TSS A;  5M9O A;  5LHY 1;  2RA4 A;  2FIN B;  1WD1 A;  5E4W C;  4H0L C;  3A7A B;  4RKL A;  4OIK A;  3EJI A;  4XYO A;  2B63 B;  3K5O A;  2ZXP A;  5EPL A;  3HEJ A;  1OXT A;  1BQQ T;  1GUW A;  4EQO A;  4FF2 A;  1JWU D;  1RF2 D;  3K58 A;  2F0P A;  1BXT A;  3QOL A;  3J81 E;  2H1E A;  3FVQ A;  3TBI B;  2K7V A;  1F2L A;  1NR4 A;  3E6Z X;  2IW3 A;  1SE4 A;  4NMZ A;  4ZAI A;  1CA5 A;  2RQX A;  4L63 B;  4Y7N B;  3AMU A;  1SNC A;  2KA7 A;  5C4J B;  1T5E A;  2MP1 A;  1LAB A;  2TSS A;  5C5M A;  3I90 A;  1PLF A;  4HAE A;  3V05 A;  5C3X A;  1B9N A;  1SNO A;  1OXV A;  3W3A A;  1CZW A;  4J8Q A;  4DU9 A;  4OGQ C;  1AZQ A;  5ELF A;  3FRP B;  2IX1 A;  3G7L A;  3HOZ B;  5ISR A;  5JPN C;  3LX0 A;  4DAV A;  4BBS B;  1A2T A;  1YNJ D;  1KDB A;  5ELD A;  3D3R A;  5D65 A;  1U4P A;  1CM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...