2GVBA

Refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna-binding (viral)
total genus 5
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gvbA00
4KHZA 1HR0W 4GOPB 1N36Q 4B3RQ 4GS3A 1CKNA 2VNUD 2C35B 1NMGA 4GKJL 1PYSB 1HR0L 2AHOB 2JK8A 4AIMA 3CCVA 1W3SA 4X66L 2JA5G 1VQPA 4DR4Q 4YHHQ 4BBRH 1NY4A 2EQSA 4P75A 1TWHH 1WOCA 3DLLA 2K5VA 3MXNB 2HQLA 3PGZA 4RG1A 3UE0A 4DV7L 1IBKQ 3HOZH 4BBSG 3GTKH 5GAGC 1J6QA 3PV0A 1XMQQ 2RCNA 5C4JH 4X6AH 3NEMA 4LNQA 3HOWH 2QEXA 3OW2A 3CCUA 1ASZA 2ZTCA 4JYAQ 5IYBG 3FKIH 3BU2A 4DR7L 3S1MH 1VQGA 1Q1EA 2B63G 4YY3Q 1BKBA 1L1OA 3B6YA 3OTOQ 1XTDA 3PUYA 3K0XA 1JB7A 3HOVH 4O0AA 3UDGA 4BBSH 5C4XG 1IBLQ 1VQ8A 4IPHA 4LFBQ 1IBML 4X65Q 3S1NH 1G6PA 3J81j 3G4SA 1EIFA 3TS0A 1YITA 3RLFA 3KYHC 1K83H 3E9IA 1YBYA 1K9MC 2K14A 3T1YQ 2UUAL 4JI4Q 1YVCA 1PH3A 5GQOA 4MTNA 2KCTA 3RZDH 3S1QH 2Z6KA 1KQSA 1FGUA 3M4OH 3TRZA 3J81i 5C4XH 3F2DA 4BXXG 3WWVA 3UDFA 4GKKL 4DV5Q 4GOPA 5JEAG 1UEBA 1B8AA 3J7A5 5IYCG 4DV2L 3M4PA 2EIFA 2D0PA 4JI8L 2I5LX 1K73C 5AJ3L 1YJNA 4FDBA 3HOYG 3CMAA 4JV5L 4L5SA 4PZ8A 4OO1I 2CFMA 5C0XJ 4DNIA 3K7AH 3M4QA 1YHAA 1Y14B 4JI2Q 2VQFQ 2MO1A 3GTQH 4IOAA 3CC7A 4A3JH 4A3MH 2V1CC 1HNZL 1XNRQ 3CD6A 4DV0L 2Q2TA 1Q8KA 2ASBA 3A5ZB 2BA0A 1SE8A 1R9TH 3KF6B 1N36L 4B3RL 4B3MQ 2I5HA 4X62L 3S1RH 2CKZB 1VQIA 3KJOA 2R92H 1HJPA 3TREA 1EIYB 4HIMA 1TWCH 1I5FA 4DR4L 2YTVA 4YHHL 1UE5A 4A93H 2AWOA 3HKSA 3RN5A 1OXUA 1D7QA 1UE1A 5IYDH 1IBKL 4LFAQ 3AFQA 3CF5A 1VQ7A 3A74A 1VQKA 3T1HQ 4PZ6A 1VS0A 2IX1A 4A3CH 1VQJA 4B3TL 3PO3G 3F1ZA 4LF4Q 2UXCL 3Q8DA 4AQYQ 2UU9L 1UE6A 5GAHC 3I55A 1V43A 2UUCQ 1X54A 2PMZE 4OO1G 4A3KG 4JYAL 2FXQA 2VQEQ 4LF8Q 2IHEA 2CCZA 3A0JA 1Y1VH 4EX5A 1YJWA 2JA7H 2IY5B 4MZ9A 4YY3L 1PYBA 3PF4A 3OTOL 4DV1Q 2OQKA 2N78A 4OX9Q 4GN5A 4YCVA 4GLAC 5C3EG 4DR6Q 2K4KA 1IBLL 1H95A 2ZTDA 4NB3A 1Y1WG 4X65L 2WAQE 5E7NA 5IP7G 1E3PA 2VW9A 4JI0Q 2ZM6Q 3F2BA 2HHHQ 1JT8A 3T1YL 1O7IA 1BVSA 4JI4L 1P8LA 3PUXA 1PH5A 4IPCA 1FVIA 4DV3Q 4EQ5A 5JJIA 2N3SA 2OWOA 1X56A 1JE5A 2RF4A 2ES2A 2YTXA 4LW1A 1YIJA 2RHSB 4DV5L 5LMNW 5M5XH 4BBRG 4DV4Q 2JEBI 3BZCA 4DKAC 4XIGS 4DAYB 4JCVE 2DUDA 1TWFH 5IP7H 3CXCA 2RHQB 1PH6A 2HT1A 3HOZG 4DV0Q 2Q2UA 4LF5Q 1FJGQ 2IHFA 3M9BA 1IL2A 3JC66 4DR3Q 1N9WA 4DV6Q 1HNWQ 4JI2L 2VQFL 1GO3E 4R4CA 1N8RC 4X62Q 3KF8B 3HOWG 4IJLA 4DR5Q 1VQFA 3EBEA 1MJEA 1XNRL 4YWMA 3IRBA 1Z47A 4NXML 2AKWB 4JI1Q 4IOCA 2VS1A 2E2HH 1XNQQ 3FKIG 2ZTEA 3CCLA 3F8TA 4B3ML 1SRUA 3RN2A 2YTYA 4HIOA 1DGSA 1VQMA 3HFZB 2R7ZH 3HOVG 1GD7A 1X3GA 1SLJA 3CAMA 4JC0A 4QIWE 3RLNA 5C44H 3S2HH 1UE7A 1VQOA 5LMUL 2BA1A 2GVBA 3RNUA 1K8AC 1OXVA 4UP8A 1MJCA 4OONA 3U50C 2E5LQ 2UU9Q 4B3TQ 2UXCQ 1OXTA 1JJGA 1XPOA 1PH9A 1L1OC 3NBHB 1N34Q 1RIPA 2WB1G 4LFAL 5DLQE 2R93H 4NPSA 3L2PA 3T1HL 1QVGA 2YYZA 1SR3A 1XPRA 4LF4L 3CMEA 4AQYL 1NMFA 3CCMA 2UUCL 4A75A 3PIOA 4YWKA 2VQEL 4LF8L 4DAMA 1BBUA 1I3QH 4UY8C 1CKOA 1EFWA 4DV1L 4OX9L 2WP8J 4DR6L 2ID0A 4QL5A 2Z6KC 2F3IA 2MFIA 4BY1G 3ULPA 3K81C 4IO9A 1S72A 1SROA 2ZJQA 3GTPH 3KFUA 4GNXB 2B29A 4GOPC 1P16A 3HOXH 2PI2E 4A3JG 4DR1Q 4A3MG 4JI0L 4R4IA 1QUQB 2ZM6L 1A62A 2HHHL 4NXNQ 1HZBA 2CWPA 2F4VL 3GTOH 4UP9A 4DV3L 4OWTB 2JE6I 4DUZQ 4KHPQ 1X3FA 1QZHA 4YWLA 2BH8A 1VQNA 1QVFA 2R92G 3A5UA 5HGQA 1EQQA 3H3VH 1VQCA 1S3OA 2Y0SG 4YCWA 5IT9c 4R1JA 3STBC 4BY1H 1VQ5A 1VQ6A 1N32Q 2BH2A 3F2CA 1HNXQ 4R4OA 3RZOH 4A93G 4DV4L 4R4TA 1KL9A 2Z0SA 3S16H 5IYDG 4DPGA 4A3DH 2QGQA 4LF5L 4NXMQ 4P71A 4IJHA 2KCMA 1RL2A 1FJGL 4A3CG 4DR3L 1EOVA 4LUVA 2NZOA 4DV6L 4OWWB 1HNWL 1K0RA 2N49A 5IY0A 4X64Q 2HIVA 4DR5L 2IT1A 4HIKA 3EN2A 3PCOB 4BA1I 4IFDI 4JI1L 2KENA 4GLXA 1XNQL 4L5QA 2KHJA 5JEAJ 5M3FH 3D0FA 3AYHB 4LUZA 1X3EA 5LMUQ 1IXRA 4QGUA 1Y1VG 5HY6A 1ASYA 2JA7G 2DGYA 2K75A 2GVAA 1I50H 3KDFB 3HOUH 4POFA 1PFSA 3ULJA 2E2IH 3G71A 3PIPA 4BY7H 2E5LL 3GDEA 1Q7YC 2K5HA 4KLKA 3KJPA 2UXDQ 3MEFA 1YJ9A 1N34L 3ULLA 4A3EG 3BJUA 3UDXA 1HH2P 1CKMA 3K80C 1CUKA 2R7DA 4GNXA 3CPWA 2K5NA 4B3SQ 2ZJRA 2JA6G 4R4QA 4JG2A 1AE2A 1QUQA 3GO5A 4OWXB 4AH6A 2AWNA 4JI5Q 1NTGA 4JI6Q 1CKNB 2ATWA 1PH7A 4A3GG 3HKZE 1CSQA 2CWAA 4DK6C 1QVCA 2XTIA 2PNHA 3W5OA 4IFDG 1HZCA 4A3EH 1VQDA 3VDYA 1PA6A 4DR2Q 1LYLA 4IPGA 3U4ZA 2E2JH 1S40A 3NELA 4OXPA 1VQAA 2B3GA 1TXYA 1Q81C 4QY7A 2F4VQ 4A3BH 2D62A 3CCSA 4AYBE 2JA6H 2NVTH 4LF9Q 3I4MH 2MQHA 4DR1L 4NXNL 1LTLA 5M5WH 1PHJA 4A3GH 3L7ZC 1C0AA 3DM3A 3KF6A 4GN4B 4H02A 1OXSC 4HJ8A 1VQHA 4DUZL 1SMXA 4KHPL 4HJAA 2OTLA 2R7ZG 5BR8Q 5GAEC 1VQ9A 1N32L 5C44G 3GD7A 3GTJH 4JI7Q 1HNXL 1VQLA 1Q1BA 1I94L 3PO3H 3I56A 4GLVB 5GROA 4HIDA 2LXJA 3KDFA 1WI5A 4QJFA 2K52A 5FLMH 1V9PA 3UE1A 1LM0A 2R93G 3H3VI 1YZ6A 3RR5A 2CQOA 2OCEA 4X64L 2YU9H 4LF7Q 5M3MG 1K8GA 1E24A 2UXBL 2E8GA 2HIXA 4C3JH 4JBMA 2PQAB 3CCJA 4P72A 1LUZA 4DUYQ 2Q2HA 2QA4A 2YV5A 4P74A 1FL0A 1PH2A 3S24A 1Q46A 1L2FA 1PV4A 3PO2H 1KRSA 3AQQA 4LWCA 5C0XI 2NVQH 3AEVA 3S14H 3ZJYC 3OYYA 4Y52H 4BA2I 2UXDL 1A63A 5M3MH 4RMFA 1GM5A 2N8NA 1YHBA 3LGJA 1YI2A 3HOXG 5FJ8H 1EYGA 1OTCA 3NENA 2NZHA 2H5XA 3M3YH 5ELNA 4MNOA 4A3LH 1XMOQ 1M1KC 1B7YB 4B3SL 1NJIC 3STBD 1Z9FA 4C3IH 1D8LA 4JI5L 2GN5A 4JI6L 1HZAA 5J3BA 3L0OA 2JQOA 1C7YA 1W2BA 2UUBQ 2JEAI 1K3RA 1KRTA 1JJ2A 1WFQA 4TQUS 1PVOA 4LF6Q 2JA5H 2VZAA 1YNXA 1KIXA 3CC2A 3D31A 3J80c 4DR2L 3PUZA 4TVAB 4A3DG 1NBWA 1KAWA 3KLWA 2EXDA 1BBWA 1KXLA 1VQBA 3I2ZA 4LFCL 3CCEA 5IWAQ 3JAMc 1YEZA 4LF9L 2K50A 4UP7A 5C0XG 4K0KQ 1X6OA 4ALPA 3PF5A 4GN3B 4YCUA 5M3FG 2PI2A 3TEHB 1J5EQ 4BY7G 1N33Q 1I94Q 5IYBH 3W1BA 4JBWA 4JI3L 3PUVA 4L5RC 2LSSA 5JJKA 2NN6I 1A8VA 5BR8L 3HOUG 3FHWA 2B63H 1EUJA 2PQAA 2VY3A 4JI7L 3RLOA 1V1QA 3HKZG 1JJCB 5IP9G 2VL6A 1CSPA 3AFPA 4A3IG 1X9NA 3TS2A 2D0OA 4HJ9A 1X65A 1I6HH 2WAQG 1IYJB 1EQRA 4HJ7A 4PMWA 2UXBQ 1GKHA 1TWGH 1Q12A 4JBJA 1E22A 2ZJPA 1SFOH 2MNAA 2WB1E 2WFWA 5LMNQ 4LF7L 1KHIA 4AYBG 1Q86C 1MKHA 2I5MX 1KD1C 3I4OA 1AE3A 4WJ4A 2NVYH 2R7FA 2IX0A 2F52A 3BZKA 5EAYA 4POGA 1T9HA 2A19A 4L5TA 1NE3A 4A3IH 5IP9H 1HR0Q 4DUYL 4GNXC 4XTCS 3E9HA 3H15A 3U4VA 1G291 4BXXH 4WJ3M 4X66Q 2I0QA 1VQEA 3ER0A 2LXKA 4JBKA 4QQBX 5IYCH 5K36G 4P73A 5FLXc 1XJVA 3M7NA 4A4IA 3HOYH 3CW2C 4C2MH 1WCMG 2KHIA 2XGTA 3S2DH 2JA9A 4DK3C 4A3BG 4JOIC 3KOJA 4DV7Q 2OQ0A 1WYDA 2NN6G 2A8VA 1U0LA 1VCIA 1Q82C 3GTGH 3I4MG 2KBNA 2Q2IA 3TQYA 1EWIA 2NVXH 4KI0A 1PH1A 1UWVA 3CQZH 2A1AA 3EIVA 3J80i 1XMOL 4JOIA 1E1TA 3PUWA 2L15A 1PH8A 3ICEA 1L0WA 3GTMH 5ELOA 1XMQL 1VQ4A 3I4NG 4DR7Q 3CC4A 2JJQA 3S15H 3JAMi 1OXXK 3PSIA 3CCRA 2UUBL 1AH9A 1WCMH 3ERSX 3H0GG 4J15A 4C3HH 1JMCA 1WJJA 2Y0SE 3CPFA 3E0EA 3I7FA 5M5YH 1M90C 4LF6L 4LFCQ 1A0IA 1SN8A 4PZ7A 3UDIA 5H1SE 1PH4A 5JJLA 1YHQA 3CP0A 2ALYB 3GTLH 5FLMG 1IBMQ 3W1GA 3U58A 1GVPA 1C9OA 4O2DA 4GKJQ 5IWAL 2AMCB 4Y7NH 1IZ6A 3G48A 4ME3A 3M85A 4JI3Q 3I4NH 2JA8G 4LFBL 4K0KL 2UUAQ 2OTJA 1X55A 2VUMG 5GADC 1L1OB 3H0GH 3S17H 1J5EL 2R6GA 1N33L 1G51A 4A3KH 1TWAH 4IFDJ 3SGIA 4A3FG 4APVA 4PG3A 4LUOA 4GKKQ 4UPAA 3FP9A 1E7ZA 3PO2G 1QZGA 4DV2Q 1B70B 4JI8Q 1MIUA 3CCQA 5AJ3Q 3K8AA 3K7UC 4IPDA 5C3EH 3J7ZC 4JV5Q 3G6EA 1HZ9A 5IE8A 1Y1WH 2JA8H 5FJ8G 1KC8C 3J81c 4HJ5A 2VUMH 1XPUA 5LMNL 1HNZQ 4A3LG 2MO0A 4A76A 1U5KA 1E1OA 4A3FH
chains in the Genus database with same CATH superfamily
1T5XD 1N36Q 3P20A 5IGEA 4HSVA 2VNUD 1TKWB 1BCPB 4GKJL 1WTRA 2O4XA 4X66L 4DR4Q 3OHXC 1WTQA 3MXNB 4IUUA 3HOZH 5GAGC 3PV0A 1SYEA 2ZXOA 2JSOA 3BVMA 5C4JH 3NEMA 4N8FA 1AEXA 3OWEB 1MBYA 1ZYRD 2LKVA 3HP3A 4QUFA 2B63G 3VA5A 4YY3Q 1BKBA 3HOVH 4O0AA 1XTCD 5ELCA 3NQTA 3S1NH 1G6PA 3IFTA 4OGQC 3TS0A 3DHQA 2EDGA 4UAIA 3KYHC 3E0JA 1H9SB 5J22A 1D6EC 1STGA 4O1NA 4LJZC 4HSPA 1RTNA 1PH3A 4MTNA 2KCTA 2Z6KA 4ZKCB 1EYAA 1ZYRC 2EJMA 3TRZA 2G9DA 3HOYB 5D3IB 1M4VA 4GOPA 1HUMA 2F0VA 2A74C 3M4PA 1SYBA 4FDBA 1PTOC 4L5SA 5D65A 4OO1I 3J80E 3SXHA 4DNIA 2VQFQ 3CC7A 2E75C 1SE2A 4A3JH 2V1CC 1HNZL 1XNRQ 3X3NA 3CD6A 2KUMA 3A5ZB 4B3RL 3S1RH 3MXUA 5IIFA 1I4HA 3KLSA 1QNUA 3DM1A 3X3MA 4KKSA 3NTHA 3VR3A 4YHHL 3NHHA 1D5XC 3RN5A 4H0LC 4RGOS 1IBKL 3AFQA 1LACA 1EFID 3NWTA 2IX1A 4PZ6A 1VS0A 4A3CH 3F1ZA 5GAHC 4I7AA 3I55A 2EYPA 1HCZA 1HTLD 2FXQA 3EJIA 5C5LA 1S5FD 5IGCA 3A0JA 1J8IA 3OTOL 4DV1Q 4ZKBB 4OX9Q 2G9HD 5C3EG 4DR6Q 2IX3A 1A3VA 2K4KA 2L4NA 1TWFB 4DK0A 4FF3A 5FLXE 1Y1WG 4OEMB 1PZKD 1E2ZA 4X65L 2RBMA 3R3OA 2EJGC 2TSSA 1UAPA 4CKCA 2XRQD 4C1NI 2HHHQ 1JT8A 2RA4A 3PUXA 1PH5A 1A3UA 2OWOA 1X56A 1U4RA 1ICWA 1PZJD 4LW1A 1YIJA 2RHSB 1HXYD 4MTKA 1WVLA 5M5XH 1D5ZC 3TMEA 4BBRG 3BZCA 4JCVE 2HT1A 5C4JB 2AQ1B 2Q2UA 1I4RA 2WV6D 3M9BA 2DNEA 5EPKA 1IL2A 2XWBB 1X3PA 2BCOA 2PCFB 3KF8B 4IJLA 3EBEA 2M2LA 4NXML 2VS1A 3AU7A 4KMUC 4KJOA 2E2HH 1GXDC 4HIOA 1I3QB 2PYKA 2CW0C 3RLNA 5FO8B 2WB1B 2BA1A 3RNUA 3FMCA 1MJCA 4EVOA 1UNSA 1JJGA 1VMCA 1ILPA 1PH9A 2WIIB 2R93H 4K8JA 2KEEA 5EJWA 1NMFA 3J7YW 2A73B 1ENFA 4E6IA 5HURA 3PIOA 4DAMA 1IYUA 4J6HA 1SEBD 4UY8C 1EFWA 2WP8J 2ID0A 2L12A 3KFUA 4IO9A 2ZJQA 3OOCA 2B29A 2IJ0A 4NW2A 1KDBA 5CMDA 5IGGA 5COYA 4A3MG 4PV1C 2ZM6L 1QUQB 2F4IA 4UDUC 5A35A 1U4LA 1WTVA 4UP9A 1O7YA 1JOOA 4DV3L 3ND8A 4K5WA 4KHPQ 4ZLTF 3BYTB 2R92G 5HGQA 1S3OA 2Y0SG 1YNNC 3WOEA 4R1JA 1VQ5A 1LV9A 1DCZA 3MTSA 2E2IB 1SAPA 2RQXA 3E3XA 4HR7B 3S16H 5IYDG 3BS1A 1EWHA 4NXMQ 4P71A 4G7ZC 2KCMA 2F0JA 4LUVA 2NZOA 2IT1A 3NBHA 3PCOB 5C0XH 4IFDI 1WD1A 1Q3LA 4LUZA 3GQBA 2PW5A 1HUNA 1JWMD 1PFSA 3PIPA 1K3BC 4BY7H 4F88A 2E5LL 1Q7YC 3NE5B 2NWGA 1B1ZA 4CBVA 5JJZA 1N34L 4A3EG 2JA6B 1CKMA 2K5QA 1CUKA 2SDFA 2R7DA 4GNXA 2ZJRA 4A3GB 4IUQA 1AE2A 2KEDA 5M5XB 4AH6A 3HKZE 1SMYD 3Q23A 2HCCA 2XTIA 3W5OA 1HZCA 4A3EH 3VDYA 1PA6A 1BDOA 2E2JH 1E0BA 3NELA 1VQAA 2B3GA 2SNMA 4K6DA 3BG3A 2A6HC 1EIGA 2QCPX 2NN6H 3I4MH 5CV4A 4DR1L 3LNNA 5CBAE 1PZID 5M5WH 5ELBA 1PRTD 4U68A 5KIXA 2F0SA 1C0AA 4KD4A 5KYLA 1SNOA 5LL6S 4HJ8A 1OXSC 4HJAA 5EKKA 2OTLA 2R7ZG 3OMCA 1SMYC 2EYHA 4MN3A 3I56A 4DNTB 1AZPA 3S14B 1EY7A 1EY6A 2LXJA 3KDFA 5FLMH 5FKAC 2XRSD 1CZWA 1S5DD 1K8GA 5I4DA 3T56B 5EBCA 2B2VC 3FPUB 1ET9A 2WINB 3CCJA 2B2YC 4P72A 4V190 1FL0A 3HZXA 5DM63 1FD7D 3S24A 3D6WA 5IGBA 3D4RA 1PH2A 1L2FA 1NR4A 5EKLA 3OYYA 4Y52H 2UXDL 1YHBA 3I73A 5T1IA 3M3YH 5ELNA 2K05A 4A3LH 2K28A 3MWYW 3I70A 3DWPA 1NJIC 2PNRC 5DNFA 3J80L 1EY8A 1QJOA 4JI5L 2F0QA 5T1GA 2B2TC 3V96A 3K57A 1WFQA 1PVOA 2JA5H 1KIXA 3CC2A 3AB9A 1BCPF 1I6HB 3N6RA 2J7ZA 3KF8A 1SFOB 1X32A 4K0KQ 4ALPA 1AZQA 4RCOA 1YNJD 4BY7G 4QB4A 5C4HA 3PMFA 3PUVA 1CM9A 3HKZB 5JJKA 1DONA 1A8VA 3HOUG 5KGUA 1CFMA 4G4KA 2PQAA 2VY3A 2RKSA 4FVMA 3TS2A 4A3IG 5IP9G 4IALA 5ISRA 1F9SA 1CA5A 3S2DB 3C1EA 4OL7A 2DN8A 1TWGH 1GUGA 1Q12A 1E22A 4JBJA 2ZJPA 3J7AF 2WFWA 3H3VC 1E2VA 2EXZA 5F2DA 1MKHA 1CK1A 2I5MX 3MAQA 1MHWC 2LY7A 5FLXL 1EYCA 2R7FA 2F52A 4A3IH 5IP9H 2E2JB 4BXXH 1G291 1TS4A 5JEAH 5K36G 5IYCH 2KQ3A 4P73A 1XJVA 4K2KA 3CW2C 4C2MH 4YIJA 2E74C 2XGTA 2JA9A 4DK3C 5E4WC 4PNYA 2KBNA 2Q2IA 1EWIA 4R8IA 2NVXH 3FRPB 4KI0A 1UWVA 1O7ZA 3CRLC 3EIVA 3J80i 1DM0B 1PH8A 3H0GB 1VQ4A 4DR7Q 3CC4A 3S15H 3MC0B 1JMCA 3EA6A 3E5SA 5M5YH 3PO3G 1M90C 1PH4A 2GA4B 1NCVA 4KN4C 1IBMQ 3I4LA 1PRTB 3HS0C 1EY4A 5IWAL 1IYVA 1QG7A 2O5JC 1PFBA 2OTJA 1D1IA 3OPOA 2JA8G 2VUMG 4BS9A 1AFPA 2EZVA 1J5EL 4OO1H 1TWAH 3KLRA 1KTKA 3K59A 2F0NA 3SK4A 1E7ZA 3PO2G 3U9OA 2PZUA 4JI8Q 5NUCA 3M3YB 4OELB 2F0EA 2JA8H 3MFYA 1CQFA 1PLFA 3J81c 2BDOA 2VUMH 3GTKB 1S5CD 2EOTA 1ILQA 2MO0A 1E3PA 1U5KA 4A75A 2KJXA 2XIWA 4C3IG 4GOPB 1HR0W 2PO4A 2JA5B 3ZYYX 2C35B 1PYSB 3V05A 1SYDA 2A69C 4AIMA 3CCVA 4BBSB 5C5MA 2KCCA 2K5VA 4RG1A 1DOLA 2K5DA 1J6QA 3D6CA 4KY6A 3NTKA 4WORA 2V4DA 3HOWH 5IYBG 3FKIH 3RZDB 3M4OB 1HHVA 1VQGA 1GHJA 1Q1EA 4TKOB 3WDNA 1XTDA 3K0XA 4TRDA 3UDGA 1KABA 3F2UA 4IUNA 4RCNA 1VQ8A 3K5NA 1F2LA 3K7AB 1QB5D 1G2SA 3E9IA 1YBYA 5LL6X 4N9TA 4RHSA 2P5ZX 1YVCA 4ULLA 1U9RA 5GQOA 2NBFA 3F2DA 3QR8A 5CORA 3WWVA 3BDOA 4GKKL 3J7A5 2CH4W 4XYQA 2EIFA 1FNVA 2I5LX 5AJ3L 1K73C 3HOYG 1PXUA 3H6MA 1NR2A 1F77A 2AQ3B 3EQLC 4DV0L 1Q8KA 3O13A 1N36L 3KF6B 1EU3A 3FPPA 5M5YB 4B3MQ 4X62L 4N8X1 1VQIA 5I6WA 1Y1VB 2JA7B 3TREA 1G2TA 2D9UA 1TWCH 1I5FA 4DR4L 5KNDA 4G57A 3TSSA 4A93H 4RHRA 5BN3A 1UE1A 1HA5A 4LFAQ 3CF5A 2LFNA 1STAA 1STEA 4ABNA 5JAVA 1TWAB 1UE6A 1QOHA 5CGKA 2UUCQ 4OHJA 4LK1C 1TQOA 2IHEA 2CCZA 1EEID 4EX5A 1YJWA 2IY5B 3A7LA 4YY3L 1PYBA 3PF4A 1SNPA 4GLAC 3SE0A 3W2DA 4RA8A 1HQMC 2WAQE 1BO0A 4XT1B 3F2BA 3H94A 4FO2A 2WKDA 1O7IA 1BVSA 2C9OA 4HCSA 1I4XA 3Q22A 3SR1A 2XNAC 1JE5A 2RF4A 3TBIB 4PMCA 1TT2A 1CTMA 5C44B 1B3AA 1RDPD 4NP5A 4IFDH 1TWFH 1WTXA 3HOZG 2HUGA 2AUKA 4DV0Q 1FJGQ 2IHFA 4IUTA 1TS2A 3OW7A 3JC66 4DR3Q 1N9WA 4DV6Q 1HNWQ 2VQFL 4R4CA 4X62Q 3FKIB 4DR5Q 1MJEA 1VQFA 1XNRL 3IRBA 1Z47A 4JI1Q 3NWSA 2PZWA 3CCLA 1BOSA 4HTHA 3MXPA 3HOVG 1K8MA 3CAMA 1UE7A 1K8AC 4OONA 3U50C 3GTPB 1JOKA 1L1OC 3NBHB 2WB1G 3P1HA 2K1BA 1CHQD 1XPRA 3HOXB 3C2PA 3A55A 3LWUA 2ICEC 3AMUA 4X3UA 1BBUA 1I3QH 1PTOD 4NKLA 4BY1B 1CKOA 1HTPA 1GOZA 4DV1L 4OX9L 3HEJA 4DR6L 2F3IA 4EQOA 1SROA 2FFKB 4GNXB 1RD9D 2VXWA 4DAYA 4A3JG 4R4IA 1A62A 2HHHL 4NXNQ 3TZUA 1HZBA 4X3SA 2CWPA 2N55A 1TWCB 4EQPA 4DUZQ 4YWLA 1B9NA 4A93B 1EQQA 2AQ2B 1VQCA 2ICIA 2SOBA 4YCWA 3A56A 3F2CA 1HNXQ 1KL9A 2MHVA 4C1NK 2Z0SA 4A3DH 4DPGA 1M8AA 2WAQB 1RL2A 4A3CG 4RKBA 2E76C 2F0PA 3I72A 2NTSA 2QKIC 2KOLA 3EN2A 1NNXA 1ZKOA 2F0LA 2HD3A 1Q8IA 4GLXA 5M3FH 3RMHA 2X6LA 3R93A 1II3A 4QGUA 1RTOA 2DGYA 2K75A 3KDFB 2E2IH 3G71A 2A68C 1A6XA 1GUTA 1YJ9A 1CQVA 2NVTB 1S5BD 1SNCA 3I91A 1I4QA 2JA6G 4B3SQ 2CHBD 4R4QA 4RH6A 5IGFA 4OWXB 4QMGA 1CKNB 4CJ0B 1PH7A 4A3GG 3I8ZA 4DK6C 1QVCA 1STBA 5I9PA 1VQDA 1LYLA 3NP8A 4IPGA 1S40A 4A3BH 2D62A 3CCSA 1LTBD 2JA6H 4LF9Q 1HQRD 2R3ZA 2EJFC 3C46A 1QE6A 1V1PB 1NSNS 2YU9B 4A3GH 2CW0D 3DM3A 3KF6A 4DAVA 5I2YA 4GN4B 4C3JB 1IKMA 4KHPL 2HQEA 4S3SA 1GUWA 1VQ9A 2K6AA 3GD7A 3TP8A 4JI7Q 1Q1BA 3T53B 5GROA 4HIDA 2HDMA 1WI5A 1V9PA 2R93G 3IAYA 1IW7C 3MFGA 2NUCA 4KY7A 1QNKA 1STYA 3VYRA 2HDLA 1WTWA 4RWSC 1JORA 2EPBA 1SE4A 2RDFA 3QJYA 1SYFA 1EEFD 1PRTF 4LAAA 1AP0A 2PQAB 3T51B 1Z7TA 1LUZA 2QA4A 4FF1A 2YV5A 4P74A 3IFDA 1EY9A 2D5DA 1Q46A 1SBBB 3EVQA 3QIAA 3ND9A 4OIKA 3S14H 5CV8A 4X3TA 4BA2I 2H4OA 5FJ8H 1EYGA 1NAPA 4LMQD 1G8ZD 4Z9CB 3K58A 2E2DC 1PTOB 4P2CB 3I3CA 5LHY1 1M1KC 3Q0AA 1B7YB 1EZ8A 1YNND 1K0SA 1Z9FA 4CHTB 3VR2A 2NB0A 2GN5A 2UUBQ 1KRTA 4A3DB 4LF6Q 2B63B 2VZAA 3D31A 1T5EA 3PUZA 1LO5D 1B4OA 1VMPA 4CKEA 1MSHA 2EXDA 2RCFA 1DJRD 4XYOA 3JAMc 2RSOA 1YEZA 2K50A 5M3FB 4UP7A 5C0XG 4GN3B 4YCUA 4DA2A 2PI2A 5IGDA 2Z9HA 4JBWA 4JI3L 3W1BA 4L5RC 1D1KA 2LSSA 1Z6HA 3FHWA 3RLOA 1F2YA 3HKZG 1X9NA 1CSPA 3AFPA 2D0OA 1PFNA 1WTOA 1I6HH 1GKHA 2F0TA 3W3AA 3GTGB 1SFOH 5EPJA 1SJHD 5LMNQ 3A7AB 4MIUA 3CQZB 1KD1C 3I4OA 1AE3A 2EVBA 2NVYH 3BZKA 5M9OA 5EAYA 4POGA 2A19A 1NE3A 1JQYD 1HR0Q 1DOKA 2Z4IA 3U4VA 2I0QA 1WCMB 2F0OA 4QQBX 2A6HD 2LXKA 4JBKA 3IL8A 4A3BB 2WACA 2Z1CA 4H7BA 3S2DH 3VR5A 2KHIA 4IN3A 2EY5A 1UUPA 4JOIC 3J7AV 4DV7Q 1WYDA 2NN6G 3L9AX 1VCIA 3GP7A 3I4MG 4IQZA 3TQYA 4Y7NB 1X3QA 2A1AA 2IW3A 4KTAA 1L0WA 3GTMH 5ELOA 3S17B 3NQIA 2BE5D 2JJQA 2WKCA 5G3LD 3PSIA 3ERSX 3H0GG 4C3HH 2CH4A 3E6ZX 3NBIA 1WJJA 2Y0SE 3P75A 3I7FA 2IL8A 1V1OA 1ONLA 1SN8A 1SNDA 4PZ7A 5H1SE 3KK7A 5I6YA 5FLMG 3U58A 4M1UB 1GVPA 3MHBA 4O2DA 1B2TA 2F0UA 4WFN3 2AMCB 4JI3Q 4K0KL 3D4WA 2UUAQ 1X55A 4F8MA 4A3FB 3H0GH 2R6GA 1G51A 4A3KH 4K8IA 2BE5C 3SGIA 4PG3A 4LUOA 4DV2Q 1B70B 2MPMA 4HMJA 3CCQA 3K7UC 1XWEA 4BBRB 3J7ZC 4JV5Q 3D8GA 1TWHB 4HJ5A 5A2QL 2PPBC 1XPUA 4A3LG 1L0XB 1SE3A 4GS3A 1CKNA 1NMGA 2XWJB 3S1MB 1QILA 3P7JA 2F0MA 2JA5G 1VQPA 3DUZA 5C4ZA 1EL0A 1NY4A 2JP1A 4P75A 5CV6A 1KNAA 1WOCA 2OXPA 1SXTA 2HQLA 4BBSG 3GTKH 1F9QA 2B8FA 5JVG3 1V1PA 4X6AH 2AUJD 4C56C 5FO9B 2QEXA 1ML0D 1KDAA 3HRZC 4JYAQ 3BU2A 4DR7L 3S1QB 5C4XB 1RKNA 4FXGC 1L1OA 1C48A 4BBSH 3DMUA 5CV7A 1EQTA 1IBLQ 1RHPA 1IBML 3J81j 4ILWA 3G4SA 1EIFA 1HFGA 1JC7A 2NVYB 3RLFA 3GTQB 1K28A 2PZTA 4A3MB 3T1YQ 1V8QA 4JI4Q 3RZDH 1KQSA 3M4OH 1FGUA 2F1MA 4BXXG 2NTTA 2R92B 3BZDB 4DV5Q 5JEAG 1UEBA 1B8AA 5E1FA 5IYCG 1F9PA 4GZYC 1Q90A 4FXKC 4JI8L 4H44C 5J1ZA 2CFMA 3TDQA 3T4AC 5C0XJ 2L0CA 5KEEA 3K7AH 3M4QA 1YHAA 1Y14B 4JI2Q 3GTMB 4IOAA 2B2WC 2Q2TA 2B8GA 1LTTD 4KKTA 1SYGA 2ASBA 4C3HB 1RCVD 1SE8A 2CKZB 1GJXA 3KJOA 3VYSA 1W6JA 3ONAB 1EIYB 4HIMA 3CKIB 1UE5A 4BWGB 2EYOA 2QILA 1D7QA 2LS01 1VQ7A 1VQKA 1G91A 3T1HQ 1R4QB 4B3TL 4A3KB 4LF4Q 2UXCL 3SK5A 4AQYQ 1MI2A 4NMZA 1X54A 5JOBA 1O80A 4DFAA 1IHZA 2Q8RE 2A5HA 4OO1G 2VQEQ 4LF8Q 2JXMB 1BF4A 1Y1VH 3URYA 2IWHA 2JA7H 5DM73 2L9HA 1RF2D 4GN5A 2F03A 5HGTA 1VDZA 2ZTDA 4NB3A 3QOLA 1CI3M 5CC4A 2VW9A 2EY1A 4IZ8A 4JI0Q 2A69D 1JWUD 2FMMA 3KBXA 1CT1D 1FVIA 4EQ5A 2N3SA 4K2LA 4B08A 1B9MA 1TS3A 4RGMA 5CV5A 1LTSD 2ES2A 4J1MA 1KNEA 4ZAIA 4ZK9B 5LMNW 1AW7A 3S2HB 1EIHA 4DV4Q 2BH2A 4XIGS 4DAYB 2RHQB 4LF5Q 4XT3B 3CRKC 1DD2A 1LT3D 1SNMA 1GO3E 1N8RC 3HOWG 3OIPA 4ZUJA 4YWMA 1NUCA 2AKWB 4I7ZC 1XNQQ 1G6ZA 3FKIG 2Q8TA 1LABA 3F8TA 4B3ML 1DGSA 3M7GA 4FNFA 1GD7A 1X3GA 4JC0A 4QIWE 4DU9A 5C44H 3K5LA 3GV6A 1SDFA 1OXVA 4UP8A 2NYZD 4B3TQ 2UXCQ 2K33A 1OXTA 4LFAL 1RIPA 3SK8A 5DLQE 3L2PA 1QVGA 4CDDC 1SSOA 3J81E 1WD0A 1IKLA 1EOTA 1B44D 2UUCL 3GTOB 5I9OA 4N9PA 3VA7A 2XSCA 1VF7A 2MUYA 3RZOB 3BDLA 3ULPA 2MFIA 4BY1G 3GTPH 3K81C 1S72A 3Q6SA 1CA6A 1P16A 1BCPC 1KLGD 3HOXH 2PI2E 2M00A 2K01A 2B2UC 2F4VL 2QW7A 4NDXA 4XDXA 3H91A 4OWTB 1QZHA 1VQNA 2BH8A 4BY7B 3BVZA 3A5UA 3D4DA 4CDEC 4BY1H 5IT9c 1N32Q 1O78A 4HEDA 3STBC 4K6LA 1I50B 1PTOF 4ID6A 1VQ6A 4A93G 2L1BA 2C5CA 4R4TA 4KN7C 1FR3A 1FJGL 2A6EC 4IJHA 1F2MA 3Q24A 4DR3L 1EOVA 4DV6L 1HNWL 1BNZA 4OWWB 1Y69U 4M8AA 4X64Q 1XX8A 4DR5L 2ZXRA 1AN8A 3SDZA 1Y8PB 4HIKA 4BA1I 1DZ1A 4JI1L 2KENA 4WRDA 4DGZA 4L5QA 5JEAJ 2J0TD 1X3EA 5DAUA 1IXRA 1HPCA 5HY6A 1ASYA 3OWFA 2GVAA 3NSWA 3SHLA 1LTID 1TIID 4ZRZA 3GDEA 1I6VC 3MEFA 4PMBA 3ULLA 1EY5A 4CDCC 1ZEQX 2RDHA 3CPWA 3L3OC 4JG2A 2AWNA 4JI6Q 4HAEA 1WTHA 3T13A 1CSQA 2CWAA 2KVMA 4QIWB 2KCNA 2QF7A 4IFDG 4DR2Q 3PO3B 3LX0A 1Q81C 2F4VQ 4RAUC 4AYBE 5CV9A 2NVTH 5CYUA 4NXNL 5CR3A 3L7ZC 1BR9A 4UHVA 4H02A 3D3RA 1VQHA 4DUZL 1SMXA 3FDTA 5BR8Q 5JVH3 4C3JG 1HNXL 3PO2B 2VB3X 4GLVB 3SEBA 3UE1A 5M3MB 3H3VI 1QCBD 3RR5A 2CQOA 2OCEA 1ESRA 2YU9H 4LF7Q 5KYIA 1E24A 2UXBL 2HIXA 4QF4A 4C3JH 2OEOA 4DUYQ 5IOCA 2F0GA 1PV4A 2B2VA 3AQQA 4LWCA 3AEVA 4KD3A 2Z8LA 3TP6A 2F3WA 2IPKD 3U9SA 2B2YA 4DXFA 4RMFA 3LGJA 4ZUIA 3NENA 2JYOA 2ZXPA 1XMOQ 1CHPD 3QWNA 4B3SL 5A2QE 2G5DA 4HMIA 2L5TA 1HZAA 3L0OA 2JQOA 3MXGA 1W2BA 1C7YA 1JCKB 4TQUS 4L63B 2BOSA 3J80c 4TVAB 5E4XA 4A3DG 2B2TA 1KAWA 1OO9B 1VQBA 3I2ZA 1ENCA 3TP5A 4LFCL 3CCEA 4LF9L 4ODGA 1HA6A 1PTOH 3PF5A 3T16A 1TR5A 5M3FG 2OF1A 1N33Q 3QO2A 2A68D 3NTIA 1DYQA 2B63H 1EUJA 4JI7L 1V1QA 1JJCB 2VL6A 1H9MA 4HJ9A 4R8NA 5C6AA 2UXBQ 4AYBB 3DEOA 2MNAA 2WB1E 1ICFB 2EYFA 1Q86C 2KHSA 5AFWA 4WJ4A 3TN2A 2IX0A 4GKJQ 4L5TA 2DJFC 3E9HA 4WJ3M 4X66Q 1GHKA 4XXEA 1BBXC 2F0HA 1HRJA 5FLXc 2XN9C 3NK9A 2B2WA 1RODA 1WCMG 3GTLB 4A3BG 5FOBB 3KOJA 2OQ0A 1U0LA 3GTGH 2F3VA 3CQZH 3I4NB 2NZ1D 3ICEA 4QCLA 1XMQL 1LT5D 2F0WA 2EYLA 1OXXK 3CCRA 2UUBL 2R61A 1B53A 1WCMH 2OT2A 2K32A 4LF6L 1LT4D 2F0DA 4K5XA 4LFCQ 5JJLA 1IW7D 1S5ED 1B3QA 3UDIA 2ALYB 5KRUA 3W1GA 3BYYB 3K6OA 4TSSA 4Y7NH 3G48A 4ME3A 3M85A 4LFBL 3A8KE 2H1EA 3OMGA 1L1OB 3S17H 4IFDJ 1KDCA 4A3FG 1D2BA 3J81L 4UPAA 5G3LF 3K8AA 5C3EH 4IPDA 3K5MA 3EFXD 5EGTA 3CHBD 5IE8A 1Y1WH 3OSOA 3HOZB 5FJ8G 1KC8C 1U4MA 5LMNL 5DEHA 1HNZQ 1LLRD 1PFMA 4KY5A 4A76A 4A3FH 4KHZA 2HCIA 4B3RQ 1JR0D 4PQXA 1HR0L 2AHOB 2JK8A 3RUZA 1XYIA 1R4PB 1W3SA 2QDBA 1SYCA 4YHHQ 3HOVB 1STHA 4BBRH 2EE1A 2EQSA 3S9WA 1B50A 1D5MC 1TWHH 3DLLA 3PGZA 3UE0A 1IBKQ 3S1NB 4DV7L 1A2TA 1XMQQ 2RCNA 5ELFA 3UI2A 3A54A 2I07B 4LNQA 3A8IE 3OW2A 3CCUA 2PW7A 1ASZA 2ZTCA 3KUPA 1TY0A 1L0YB 3S1MH 3B6YA 3OTOQ 3PUYA 5I2XA 1JB7A 5JPMC 3DEPA 5C4XG 2Z4HA 4IPHA 1FNUA 1LTAD 4LFBQ 4X65Q 1JWSD 4CKBA 3FVQA 1YITA 3CU7A 4CGYB 1K83H 2MGSA 5CBEE 4A3JB 1K9MC 2K14A 2UUAL 1VF5C 4EQNA 3S1QH 5IT9L 3NPPA 3S1RB 2VB2X 3J81i 5C4XH 3UDFA 1GUSA 1H9RA 4DV2L 1F2ZA 2D0PA 4JK1C 4CDFC 1LT6D 1EZ6A 1PMRA 1YJNA 3CMAA 4JV5L 5BN5A 4PZ8A 2B2UA 2X6GA 1JOQA 5IODA 2MO1A 4G7HC 3DWAA 3GTQH 3I90A 4A3MH 1QWYA 3MXNA 3JAME 3NUCA 3VYUA 3SVMA 2BA0A 1O7LA 1R9TH 2I5HA 4V0BA 3HG9A 2R92H 4C3HG 2O5IC 1HJPA 2YTVA 3MVVA 3ITPA 4HN7A 1IL8A 2AWOA 3HKSA 1OXUA 5IYDH 3A74A 1VQJA 1BUVT 2D2CC 3BVGA 1CZGA 3Q8DA 2UU9L 3M4YA 3MZ5A 1V43A 2PMZE 1C8CA 2K7VA 4A3KG 3KLSX 4JYAL 1H9SA 3HGBA 5C3EB 5E3FA 4MZ9A 3BDCA 2EYMA 2OQKA 2N78A 1Y1WB 3TZDA 2TMPA 4YCVA 4FYDA 1IBLL 3TP7A 1H95A 2F0IA 5ELEA 5E7NA 5IP7G 5EKIA 1DOMA 4F7XA 1SNQA 5KNCA 2ZM6Q 1PYWD 2PQEA 3T1YL 4JI4L 1P8LA 2Z6BA 4IPCA 4DV3Q 3QG1A 2E2HB 5JJIA 2LMCB 1DXMA 2JN4A 2YTXA 3G7LA 4DV5L 4L6TB 3DXJC 2JEBI 5IP7H 4DKAC 3CXCA 2DUDA 1PH6A 2SNSA 1TU2B 4JI2L 2R93B 1C4QA 4IOCA 1WTPA 2ZTEA 1SRUA 4XQQA 3RN2A 4U673 2YTYA 2RSNA 3IKJA 1PRTC 1XXGA 3HFZB 2N88A 1VQMA 2R7ZH 1SLJA 4O42A 2EY2A 2F0KA 3S2HH 2MJ8A 1ZXTA 1VQOA 5LMUL 2GVBA 2E5LQ 5C3WA 1K83B 2UU9Q 4FP5D 1XPOA 1N34Q 3MA2B 4NPSA 3T1HL 2YYZA 1SR3A 1A15A 4DK1A 4LF4L 3CMEA 2B39A 4AQYL 3CCMA 1FNWA 4KK7A 1BXTA 1EU4A 1HFNA 4YWKA 2VQEL 4LF8L 1TVXA 4X3KA 4DAPA 4QL5A 2Z6KC 4FXDA 2Q8IB 3S16B 4GOPC 5FO7B 4FF4A 1ENAA 3LWEA 1R9TB 4EGVA 4DR1Q 4JI0L 1ET6A 1W6KA 2CQAA 1U4PA 3GTOH 2PMZB 5ELDA 2Y0SB 2JE6I 3H09A 1X3FA 1Y8NB 1QVFA 3H3VH 5K5PA 4ME5A 1EY0A 4K5VA 4R4OA 3KBGA 4HCEA 4DV4L 3RZOH 2CVRA 3R8BA 1A3TA 4OIJA 3VR4A 2QGQA 2RDGA 4LF5L 3VYTA 2DY8A 1K0RA 2KECA 2N49A 5IY0A 3R2IA 2HIVA 4DNRB 2ZT9C 1BQQT 1XNQL 2KHJA 3D0FA 3QOJA 3AYHB 3N52A 4Q0FA 5BN4A 2ENBA 1Y1VG 2DNCA 5LMUQ 2JA7G 4G7OC 3SK6A 1I50H 3HOUH 4POFA 1YNJC 3ULJA 4DXGA 4A3EB 3QB3A 1LTRD 2K5HA 4KLKA 3KJPA 2UXDQ 3BJUA 3UDXA 1HH2P 4R9WA 5J39A 3I4MB 1GUNA 3K80C 3PIO3 5M5WB 2K5NA 3DWQA 5L37A 2EYJA 1QUQA 3GO5A 4JI5Q 2L11A 2ATWA 3MEHA 1NTGA 5D3DA 1KAAA 1F9RA 5TSSA 1A2UA 1I4GA 3K0YA 4CJ2C 2PNHA 5K36H 3U4ZA 1TS5A 2L55A 4OXPA 1TXYA 4Q5VA 4QY7A 4XQJA 4CJ1B 4JPBW 2I46A 4H13C 2MQHA 4IUPA 1H9KA 4KV6A 1K8OA 1LTLA 1PHJA 2K03A 1FGBD 2R7ZB 1JE4A 2FINB 5GAEC 1N32L 5C44G 3C1FA 1ESFA 3GTJH 1VQLA 2BDNA 1I94L 3PO3H 4K14A 1E2WA 4F87A 4QJFA 1LTGD 2K52A 2SEBD 1LM0A 1YZ6A 3K5OA 3ERQA 4X64L 5M3MG 1EQVA 4DN4M 2E8GA 4JBMA 1H9JA 3PIP3 2Q2HA 1EYDA 3PO2H 1KRSA 5JPNC 1PDQA 5C0XI 1BCPD 2NVQH 1FYCA 3ZJYC 4QUCA 3FEWX 1JICA 1A63A 5M3MH 3WOFA 1EWCA 1GM5A 2N8NA 1YI2A 3HOXG 4RFBA 1OTCA 2NZHA 2H5XA 4MNOA 5C3XA 2FMCA 5KNBA 3STBD 1I4PA 1UEAB 4C3IH 1D8LA 4JI6L 2RVLA 5J3BA 2JEAI 1K3RA 3JAML 1JJ2A 2A6ED 4B9XA 1YNXA 2DY7A 1S4ZA 4I65A 4DR2L 5EPLA 2X69A 5EBDA 1NBWA 4L8JA 3KLWA 1BBWA 4FF2A 4RKLA 1KXLA 3GV3A 1TWGB 5IWAQ 2FJ2A 3R2TA 1MD2D 1X6OA 1MGSA 3PQIA 3HOUB 3TEHB 1J5EQ 1I94Q 5IYBH 4A3IB 2NN6I 1GUOA 5EQ0A 5BR8L 2F0FA 1Y8OB 1SJED 1STNA 2EY6A 1X65A 2WAQG 3VR6A 1IYJB 1EQRA 4C2MB 4HJ7A 4PMWA 3OIQA 1RJTA 3G6JB 1TY2A 2O2LD 2NVXB 4LF7L 1KHIA 4AYBG 2J4XA 4KJNA 5FK9C 3C3LA 2XVSA 4IUVA 3RD4A 2MP1A 1T9HA 2FHTA 2QDLA 4DUYL 4XTCS 4GNXC 3H15A 3S15B 1VQEA 3ER0A 5IT9E 4KKUA 3M7NA 4A4IA 3HOYH 4KHVA 3A8JE 2A8VA 1Q82C 4RGNA 1PH1A 4JW0A 4ZCKA 4ZQ3A 4JVZA 1XMOL 2DJGC 4JOIA 1E1TA 3PUWA 2L15A 3NXWA 2K04A 4MHEA 3GTJB 1JB3A 2M9VA 3I4NG 5D14A 4RGTA 3JAMi 1AH9A 4J15A 3V2TA 3CPFA 3E0EA 1MSGA 1A0IA 1YHQA 3CP0A 3GTLH 1C9OA 2JA8B 3EROA 2VUMB 4ZYSA 1IZ6A 3I4NH 1J9OA 5GADC 2QEJC 1N33L 1KLUD 2NVQB 4APVA 4XQNA 4GKKQ 3FP9A 1QZGA 4WJWA 1MIUA 5AJ3Q 3G6EA 1HZ9A 2K5WA 4B9WA 4DF7A 4J8QA 2KA7A 4C3IB 4IURA 3HOWB 1E1OA
chains in the Genus database with same CATH topology
4KHZA 1HR0W 4GOPB 1N36Q 4B3RQ 4GS3A 1CKNA 2VNUD 2C35B 1NMGA 4GKJL 1PYSB 1HR0L 2AHOB 2JK8A 4AIMA 3CCVA 1W3SA 4X66L 2JA5G 1VQPA 4DR4Q 4YHHQ 4BBRH 1NY4A 2EQSA 4P75A 1TWHH 1WOCA 3DLLA 2K5VA 3MXNB 2HQLA 3PGZA 4RG1A 3UE0A 4DV7L 1IBKQ 3HOZH 4BBSG 3GTKH 5GAGC 1J6QA 3PV0A 1XMQQ 2RCNA 5C4JH 4X6AH 3NEMA 4LNQA 3HOWH 2QEXA 3OW2A 3CCUA 1ASZA 2ZTCA 4JYAQ 5IYBG 3FKIH 3BU2A 4DR7L 3S1MH 1VQGA 1Q1EA 2B63G 4YY3Q 1BKBA 1L1OA 3B6YA 3OTOQ 1XTDA 3PUYA 3K0XA 1JB7A 3HOVH 4O0AA 3UDGA 4BBSH 5C4XG 1IBLQ 1VQ8A 4IPHA 4LFBQ 1IBML 4X65Q 3S1NH 1G6PA 3J81j 3G4SA 1EIFA 3TS0A 1YITA 3RLFA 3KYHC 1K83H 3E9IA 1YBYA 1K9MC 2K14A 3T1YQ 2UUAL 4JI4Q 1YVCA 1PH3A 5GQOA 4MTNA 2KCTA 3RZDH 3S1QH 2Z6KA 1KQSA 1FGUA 3M4OH 3TRZA 3J81i 5C4XH 3F2DA 4BXXG 3WWVA 3UDFA 4GKKL 4DV5Q 4GOPA 5JEAG 1UEBA 1B8AA 3J7A5 5IYCG 4DV2L 3M4PA 2EIFA 2D0PA 4JI8L 2I5LX 1K73C 5AJ3L 1YJNA 4FDBA 3HOYG 3CMAA 4JV5L 4L5SA 4PZ8A 4OO1I 2CFMA 5C0XJ 4DNIA 3K7AH 3M4QA 1YHAA 1Y14B 4JI2Q 2VQFQ 2MO1A 3GTQH 4IOAA 3CC7A 4A3JH 4A3MH 2V1CC 1HNZL 1XNRQ 3CD6A 4DV0L 2Q2TA 1Q8KA 2ASBA 3A5ZB 2BA0A 1SE8A 1R9TH 3KF6B 1N36L 4B3RL 4B3MQ 2I5HA 4X62L 3S1RH 2CKZB 1VQIA 3KJOA 2R92H 1HJPA 3TREA 1EIYB 4HIMA 1TWCH 1I5FA 4DR4L 2YTVA 4YHHL 1UE5A 4A93H 2AWOA 3HKSA 3RN5A 1OXUA 1D7QA 1UE1A 5IYDH 1IBKL 4LFAQ 3AFQA 3CF5A 1VQ7A 3A74A 1VQKA 3T1HQ 4PZ6A 1VS0A 2IX1A 4A3CH 1VQJA 4B3TL 3PO3G 3F1ZA 4LF4Q 2UXCL 3Q8DA 4AQYQ 2UU9L 1UE6A 5GAHC 3I55A 1V43A 2UUCQ 1X54A 2PMZE 4OO1G 4A3KG 4JYAL 2FXQA 2VQEQ 4LF8Q 2IHEA 2CCZA 3A0JA 1Y1VH 4EX5A 1YJWA 2JA7H 2IY5B 4MZ9A 4YY3L 1PYBA 3PF4A 3OTOL 4DV1Q 2OQKA 2N78A 4OX9Q 4GN5A 4YCVA 4GLAC 5C3EG 4DR6Q 2K4KA 1IBLL 1H95A 2ZTDA 4NB3A 1Y1WG 4X65L 2WAQE 5E7NA 5IP7G 1E3PA 2VW9A 4JI0Q 2ZM6Q 3F2BA 2HHHQ 1JT8A 3T1YL 1O7IA 1BVSA 4JI4L 1P8LA 3PUXA 1PH5A 4IPCA 1FVIA 4DV3Q 4EQ5A 5JJIA 2N3SA 2OWOA 1X56A 1JE5A 2RF4A 2ES2A 2YTXA 4LW1A 1YIJA 2RHSB 4DV5L 5LMNW 5M5XH 4BBRG 4DV4Q 2JEBI 3BZCA 4DKAC 4XIGS 4DAYB 4JCVE 2DUDA 1TWFH 5IP7H 3CXCA 2RHQB 1PH6A 2HT1A 3HOZG 4DV0Q 2Q2UA 4LF5Q 1FJGQ 2IHFA 3M9BA 1IL2A 3JC66 4DR3Q 1N9WA 4DV6Q 1HNWQ 4JI2L 2VQFL 1GO3E 4R4CA 1N8RC 4X62Q 3KF8B 3HOWG 4IJLA 4DR5Q 1VQFA 3EBEA 1MJEA 1XNRL 4YWMA 3IRBA 1Z47A 4NXML 2AKWB 4JI1Q 4IOCA 2VS1A 2E2HH 1XNQQ 3FKIG 2ZTEA 3CCLA 3F8TA 4B3ML 1SRUA 3RN2A 2YTYA 4HIOA 1DGSA 1VQMA 3HFZB 2R7ZH 3HOVG 1GD7A 1X3GA 1SLJA 3CAMA 4JC0A 4QIWE 3RLNA 5C44H 3S2HH 1UE7A 1VQOA 5LMUL 2BA1A 2GVBA 3RNUA 1K8AC 1OXVA 4UP8A 1MJCA 4OONA 3U50C 2E5LQ 2UU9Q 4B3TQ 2UXCQ 1OXTA 1JJGA 1XPOA 1PH9A 1L1OC 3NBHB 1N34Q 1RIPA 2WB1G 4LFAL 5DLQE 2R93H 4NPSA 3L2PA 3T1HL 1QVGA 2YYZA 1SR3A 1XPRA 4LF4L 3CMEA 4AQYL 1NMFA 3CCMA 2UUCL 4A75A 3PIOA 4YWKA 2VQEL 4LF8L 4DAMA 1BBUA 1I3QH 4UY8C 1CKOA 1EFWA 4DV1L 4OX9L 2WP8J 4DR6L 2ID0A 4QL5A 2Z6KC 2F3IA 2MFIA 4BY1G 3ULPA 3K81C 4IO9A 1S72A 1SROA 2ZJQA 3GTPH 3KFUA 4GNXB 2B29A 4GOPC 1P16A 3HOXH 2PI2E 4A3JG 4DR1Q 4A3MG 4JI0L 4R4IA 1QUQB 2ZM6L 1A62A 2HHHL 4NXNQ 1HZBA 2CWPA 2F4VL 3GTOH 4UP9A 4DV3L 4OWTB 2JE6I 4DUZQ 4KHPQ 1X3FA 1QZHA 4YWLA 2BH8A 1VQNA 1QVFA 2R92G 3A5UA 5HGQA 1EQQA 3H3VH 1VQCA 1S3OA 2Y0SG 4YCWA 5IT9c 4R1JA 3STBC 4BY1H 1VQ5A 1VQ6A 1N32Q 2BH2A 3F2CA 1HNXQ 4R4OA 3RZOH 4A93G 4DV4L 4R4TA 1KL9A 2Z0SA 3S16H 5IYDG 4DPGA 4A3DH 2QGQA 4LF5L 4NXMQ 4P71A 4IJHA 2KCMA 1RL2A 1FJGL 4A3CG 4DR3L 1EOVA 4LUVA 2NZOA 4DV6L 4OWWB 1HNWL 1K0RA 2N49A 5IY0A 4X64Q 2HIVA 4DR5L 2IT1A 4HIKA 3EN2A 3PCOB 4BA1I 4IFDI 4JI1L 2KENA 4GLXA 1XNQL 4L5QA 2KHJA 5JEAJ 5M3FH 3D0FA 3AYHB 4LUZA 1X3EA 5LMUQ 1IXRA 4QGUA 1Y1VG 5HY6A 1ASYA 2JA7G 2DGYA 2K75A 2GVAA 1I50H 3KDFB 3HOUH 4POFA 1PFSA 3ULJA 2E2IH 3G71A 3PIPA 4BY7H 2E5LL 3GDEA 1Q7YC 2K5HA 4KLKA 3KJPA 2UXDQ 3MEFA 1YJ9A 1N34L 3ULLA 4A3EG 3BJUA 3UDXA 1HH2P 1CKMA 3K80C 1CUKA 2R7DA 4GNXA 3CPWA 2K5NA 4B3SQ 2ZJRA 2JA6G 4R4QA 4JG2A 1AE2A 1QUQA 3GO5A 4OWXB 4AH6A 2AWNA 4JI5Q 1NTGA 4JI6Q 1CKNB 2ATWA 1PH7A 4A3GG 3HKZE 1CSQA 2CWAA 4DK6C 1QVCA 2XTIA 2PNHA 3W5OA 4IFDG 1HZCA 4A3EH 1VQDA 3VDYA 1PA6A 4DR2Q 1LYLA 4IPGA 3U4ZA 2E2JH 1S40A 3NELA 4OXPA 1VQAA 2B3GA 1TXYA 1Q81C 4QY7A 2F4VQ 4A3BH 2D62A 3CCSA 4AYBE 2JA6H 2NVTH 4LF9Q 3I4MH 2MQHA 4DR1L 4NXNL 1LTLA 5M5WH 1PHJA 4A3GH 3L7ZC 1C0AA 3DM3A 3KF6A 4GN4B 4H02A 1OXSC 4HJ8A 1VQHA 4DUZL 1SMXA 4KHPL 4HJAA 2OTLA 2R7ZG 5BR8Q 5GAEC 1VQ9A 1N32L 5C44G 3GD7A 3GTJH 4JI7Q 1HNXL 1VQLA 1Q1BA 1I94L 3PO3H 3I56A 4GLVB 5GROA 4HIDA 2LXJA 3KDFA 1WI5A 4QJFA 2K52A 5FLMH 1V9PA 3UE1A 1LM0A 2R93G 3H3VI 1YZ6A 3RR5A 2CQOA 2OCEA 4X64L 2YU9H 4LF7Q 5M3MG 1K8GA 1E24A 2UXBL 2E8GA 2HIXA 4C3JH 4JBMA 2PQAB 3CCJA 4P72A 1LUZA 4DUYQ 2Q2HA 2QA4A 2YV5A 4P74A 1FL0A 1PH2A 3S24A 1Q46A 1L2FA 1PV4A 3PO2H 1KRSA 3AQQA 4LWCA 5C0XI 2NVQH 3AEVA 3S14H 3ZJYC 3OYYA 4Y52H 4BA2I 2UXDL 1A63A 5M3MH 4RMFA 1GM5A 2N8NA 1YHBA 3LGJA 1YI2A 3HOXG 5FJ8H 1EYGA 1OTCA 3NENA 2NZHA 2H5XA 3M3YH 5ELNA 4MNOA 4A3LH 1XMOQ 1M1KC 1B7YB 4B3SL 1NJIC 3STBD 1Z9FA 4C3IH 1D8LA 4JI5L 2GN5A 4JI6L 1HZAA 5J3BA 3L0OA 2JQOA 1C7YA 1W2BA 2UUBQ 2JEAI 1K3RA 1KRTA 1JJ2A 1WFQA 4TQUS 1PVOA 4LF6Q 2JA5H 2VZAA 1YNXA 1KIXA 3CC2A 3D31A 3J80c 4DR2L 3PUZA 4TVAB 4A3DG 1NBWA 1KAWA 3KLWA 2EXDA 1BBWA 1KXLA 1VQBA 3I2ZA 4LFCL 3CCEA 5IWAQ 3JAMc 1YEZA 4LF9L 2K50A 4UP7A 5C0XG 4K0KQ 1X6OA 4ALPA 3PF5A 4GN3B 4YCUA 5M3FG 2PI2A 3TEHB 1J5EQ 4BY7G 1N33Q 1I94Q 5IYBH 3W1BA 4JBWA 4JI3L 3PUVA 4L5RC 2LSSA 5JJKA 2NN6I 1A8VA 5BR8L 3HOUG 3FHWA 2B63H 1EUJA 2PQAA 2VY3A 4JI7L 3RLOA 1V1QA 3HKZG 1JJCB 5IP9G 2VL6A 1CSPA 3AFPA 4A3IG 1X9NA 3TS2A 2D0OA 4HJ9A 1X65A 1I6HH 2WAQG 1IYJB 1EQRA 4HJ7A 4PMWA 2UXBQ 1GKHA 1TWGH 1Q12A 4JBJA 1E22A 2ZJPA 1SFOH 2MNAA 2WB1E 2WFWA 5LMNQ 4LF7L 1KHIA 4AYBG 1Q86C 1MKHA 2I5MX 1KD1C 3I4OA 1AE3A 4WJ4A 2NVYH 2R7FA 2IX0A 2F52A 3BZKA 5EAYA 4POGA 1T9HA 2A19A 4L5TA 1NE3A 4A3IH 5IP9H 1HR0Q 4DUYL 4GNXC 4XTCS 3E9HA 3H15A 3U4VA 1G291 4BXXH 4WJ3M 4X66Q 2I0QA 1VQEA 3ER0A 2LXKA 4JBKA 4QQBX 5IYCH 5K36G 4P73A 5FLXc 1XJVA 3M7NA 4A4IA 3HOYH 3CW2C 4C2MH 1WCMG 2KHIA 2XGTA 3S2DH 2JA9A 4DK3C 4A3BG 4JOIC 3KOJA 4DV7Q 2OQ0A 1WYDA 2NN6G 2A8VA 1U0LA 1VCIA 1Q82C 3GTGH 3I4MG 2KBNA 2Q2IA 3TQYA 1EWIA 2NVXH 4KI0A 1PH1A 1UWVA 3CQZH 2A1AA 3EIVA 3J80i 1XMOL 4JOIA 1E1TA 3PUWA 2L15A 1PH8A 3ICEA 1L0WA 3GTMH 5ELOA 1XMQL 1VQ4A 3I4NG 4DR7Q 3CC4A 2JJQA 3S15H 3JAMi 1OXXK 3PSIA 3CCRA 2UUBL 1AH9A 1WCMH 3ERSX 3H0GG 4J15A 4C3HH 1JMCA 1WJJA 2Y0SE 3CPFA 3E0EA 3I7FA 5M5YH 1M90C 4LF6L 4LFCQ 1A0IA 1SN8A 4PZ7A 3UDIA 5H1SE 1PH4A 5JJLA 1YHQA 3CP0A 2ALYB 3GTLH 5FLMG 1IBMQ 3W1GA 3U58A 1GVPA 1C9OA 4O2DA 4GKJQ 5IWAL 2AMCB 4Y7NH 1IZ6A 3G48A 4ME3A 3M85A 4JI3Q 3I4NH 2JA8G 4LFBL 4K0KL 2UUAQ 2OTJA 1X55A 2VUMG 5GADC 1L1OB 3H0GH 3S17H 1J5EL 2R6GA 1N33L 1G51A 4A3KH 1TWAH 4IFDJ 3SGIA 4A3FG 4APVA 4PG3A 4LUOA 4GKKQ 4UPAA 3FP9A 1E7ZA 3PO2G 1QZGA 4DV2Q 1B70B 4JI8Q 1MIUA 3CCQA 5AJ3Q 3K8AA 3K7UC 4IPDA 5C3EH 3J7ZC 4JV5Q 3G6EA 1HZ9A 5IE8A 1Y1WH 2JA8H 5FJ8G 1KC8C 3J81c 4HJ5A 2VUMH 1XPUA 5LMNL 1HNZQ 4A3LG 2MO0A 4A76A 1U5KA 1E1OA 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHZ A;  1HR0 W;  4GOP B;  1N36 Q;  4B3R Q;  4GS3 A;  1CKN A;  2VNU D;  2C35 B;  1NMG A;  4GKJ L;  1PYS B;  1HR0 L;  2AHO B;  2JK8 A;  4AIM A;  3CCV A;  1W3S A;  4X66 L;  2JA5 G;  1VQP A;  4DR4 Q;  4YHH Q;  4BBR H;  1NY4 A;  2EQS A;  4P75 A;  1TWH H;  1WOC A;  3DLL A;  2K5V A;  3MXN B;  2HQL A;  3PGZ A;  4RG1 A;  3UE0 A;  4DV7 L;  1IBK Q;  3HOZ H;  4BBS G;  3GTK H;  5GAG C;  1J6Q A;  3PV0 A;  1XMQ Q;  2RCN A;  5C4J H;  4X6A H;  3NEM A;  4LNQ A;  3HOW H;  2QEX A;  3OW2 A;  3CCU A;  1ASZ A;  2ZTC A;  4JYA Q;  5IYB G;  3FKI H;  3BU2 A;  4DR7 L;  3S1M H;  1VQG A;  1Q1E A;  2B63 G;  4YY3 Q;  1BKB A;  1L1O A;  3B6Y A;  3OTO Q;  1XTD A;  3PUY A;  3K0X A;  1JB7 A;  3HOV H;  4O0A A;  3UDG A;  4BBS H;  5C4X G;  1IBL Q;  1VQ8 A;  4IPH A;  4LFB Q;  1IBM L;  4X65 Q;  3S1N H;  1G6P A;  3J81 j;  3G4S A;  1EIF A;  3TS0 A;  1YIT A;  3RLF A;  3KYH C;  1K83 H;  3E9I A;  1YBY A;  1K9M C;  2K14 A;  3T1Y Q;  2UUA L;  4JI4 Q;  1YVC A;  1PH3 A;  5GQO A;  4MTN A;  2KCT A;  3RZD H;  3S1Q H;  2Z6K A;  1KQS A;  1FGU A;  3M4O H;  3TRZ A;  3J81 i;  5C4X H;  3F2D A;  4BXX G;  3WWV A;  3UDF A;  4GKK L;  4DV5 Q;  4GOP A;  5JEA G;  1UEB A;  1B8A A;  3J7A 5;  5IYC G;  4DV2 L;  3M4P A;  2EIF A;  2D0P A;  4JI8 L;  2I5L X;  1K73 C;  5AJ3 L;  1YJN A;  4FDB A;  3HOY G;  3CMA A;  4JV5 L;  4L5S A;  4PZ8 A;  4OO1 I;  2CFM A;  5C0X J;  4DNI A;  3K7A H;  3M4Q A;  1YHA A;  1Y14 B;  4JI2 Q;  2VQF Q;  2MO1 A;  3GTQ H;  4IOA A;  3CC7 A;  4A3J H;  4A3M H;  2V1C C;  1HNZ L;  1XNR Q;  3CD6 A;  4DV0 L;  2Q2T A;  1Q8K A;  2ASB A;  3A5Z B;  2BA0 A;  1SE8 A;  1R9T H;  3KF6 B;  1N36 L;  4B3R L;  4B3M Q;  2I5H A;  4X62 L;  3S1R H;  2CKZ B;  1VQI A;  3KJO A;  2R92 H;  1HJP A;  3TRE A;  1EIY B;  4HIM A;  1TWC H;  1I5F A;  4DR4 L;  2YTV A;  4YHH L;  1UE5 A;  4A93 H;  2AWO A;  3HKS A;  3RN5 A;  1OXU A;  1D7Q A;  1UE1 A;  5IYD H;  1IBK L;  4LFA Q;  3AFQ A;  3CF5 A;  1VQ7 A;  3A74 A;  1VQK A;  3T1H Q;  4PZ6 A;  1VS0 A;  2IX1 A;  4A3C H;  1VQJ A;  4B3T L;  3PO3 G;  3F1Z A;  4LF4 Q;  2UXC L;  3Q8D A;  4AQY Q;  2UU9 L;  1UE6 A;  5GAH C;  3I55 A;  1V43 A;  2UUC Q;  1X54 A;  2PMZ E;  4OO1 G;  4A3K G;  4JYA L;  2FXQ A;  2VQE Q;  4LF8 Q;  2IHE A;  2CCZ A;  3A0J A;  1Y1V H;  4EX5 A;  1YJW A;  2JA7 H;  2IY5 B;  4MZ9 A;  4YY3 L;  1PYB A;  3PF4 A;  3OTO L;  4DV1 Q;  2OQK A;  2N78 A;  4OX9 Q;  4GN5 A;  4YCV A;  4GLA C;  5C3E G;  4DR6 Q;  2K4K A;  1IBL L;  1H95 A;  2ZTD A;  4NB3 A;  1Y1W G;  4X65 L;  2WAQ E;  5E7N A;  5IP7 G;  1E3P A;  2VW9 A;  4JI0 Q;  2ZM6 Q;  3F2B A;  2HHH Q;  1JT8 A;  3T1Y L;  1O7I A;  1BVS A;  4JI4 L;  1P8L A;  3PUX A;  1PH5 A;  4IPC A;  1FVI A;  4DV3 Q;  4EQ5 A;  5JJI A;  2N3S A;  2OWO A;  1X56 A;  1JE5 A;  2RF4 A;  2ES2 A;  2YTX A;  4LW1 A;  1YIJ A;  2RHS B;  4DV5 L;  5LMN W;  5M5X H;  4BBR G;  4DV4 Q;  2JEB I;  3BZC A;  4DKA C;  4XIG S;  4DAY B;  4JCV E;  2DUD A;  1TWF H;  5IP7 H;  3CXC A;  2RHQ B;  1PH6 A;  2HT1 A;  3HOZ G;  4DV0 Q;  2Q2U A;  4LF5 Q;  1FJG Q;  2IHF A;  3M9B A;  1IL2 A;  3JC6 6;  4DR3 Q;  1N9W A;  4DV6 Q;  1HNW Q;  4JI2 L;  2VQF L;  1GO3 E;  4R4C A;  1N8R C;  4X62 Q;  3KF8 B;  3HOW G;  4IJL A;  4DR5 Q;  1VQF A;  3EBE A;  1MJE A;  1XNR L;  4YWM A;  3IRB A;  1Z47 A;  4NXM L;  2AKW B;  4JI1 Q;  4IOC A;  2VS1 A;  2E2H H;  1XNQ Q;  3FKI G;  2ZTE A;  3CCL A;  3F8T A;  4B3M L;  1SRU A;  3RN2 A;  2YTY A;  4HIO A;  1DGS A;  1VQM A;  3HFZ B;  2R7Z H;  3HOV G;  1GD7 A;  1X3G A;  1SLJ A;  3CAM A;  4JC0 A;  4QIW E;  3RLN A;  5C44 H;  3S2H H;  1UE7 A;  1VQO A;  5LMU L;  2BA1 A;  2GVB A;  3RNU A;  1K8A C;  1OXV A;  4UP8 A;  1MJC A;  4OON A;  3U50 C;  2E5L Q;  2UU9 Q;  4B3T Q;  2UXC Q;  1OXT A;  1JJG A;  1XPO A;  1PH9 A;  1L1O C;  3NBH B;  1N34 Q;  1RIP A;  2WB1 G;  4LFA L;  5DLQ E;  2R93 H;  4NPS A;  3L2P A;  3T1H L;  1QVG A;  2YYZ A;  1SR3 A;  1XPR A;  4LF4 L;  3CME A;  4AQY L;  1NMF A;  3CCM A;  2UUC L;  4A75 A;  3PIO A;  4YWK A;  2VQE L;  4LF8 L;  4DAM A;  1BBU A;  1I3Q H;  4UY8 C;  1CKO A;  1EFW A;  4DV1 L;  4OX9 L;  2WP8 J;  4DR6 L;  2ID0 A;  4QL5 A;  2Z6K C;  2F3I A;  2MFI A;  4BY1 G;  3ULP A;  3K81 C;  4IO9 A;  1S72 A;  1SRO A;  2ZJQ A;  3GTP H;  3KFU A;  4GNX B;  2B29 A;  4GOP C;  1P16 A;  3HOX H;  2PI2 E;  4A3J G;  4DR1 Q;  4A3M G;  4JI0 L;  4R4I A;  1QUQ B;  2ZM6 L;  1A62 A;  2HHH L;  4NXN Q;  1HZB A;  2CWP A;  2F4V L;  3GTO H;  4UP9 A;  4DV3 L;  4OWT B;  2JE6 I;  4DUZ Q;  4KHP Q;  1X3F A;  1QZH A;  4YWL A;  2BH8 A;  1VQN A;  1QVF A;  2R92 G;  3A5U A;  5HGQ A;  1EQQ A;  3H3V H;  1VQC A;  1S3O A;  2Y0S G;  4YCW A;  5IT9 c;  4R1J A;  3STB C;  4BY1 H;  1VQ5 A;  1VQ6 A;  1N32 Q;  2BH2 A;  3F2C A;  1HNX Q;  4R4O A;  3RZO H;  4A93 G;  4DV4 L;  4R4T A;  1KL9 A;  2Z0S A;  3S16 H;  5IYD G;  4DPG A;  4A3D H;  2QGQ A;  4LF5 L;  4NXM Q;  4P71 A;  4IJH A;  2KCM A;  1RL2 A;  1FJG L;  4A3C G;  4DR3 L;  1EOV A;  4LUV A;  2NZO A;  4DV6 L;  4OWW B;  1HNW L;  1K0R A;  2N49 A;  5IY0 A;  4X64 Q;  2HIV A;  4DR5 L;  2IT1 A;  4HIK A;  3EN2 A;  3PCO B;  4BA1 I;  4IFD I;  4JI1 L;  2KEN A;  4GLX A;  1XNQ L;  4L5Q A;  2KHJ A;  5JEA J;  5M3F H;  3D0F A;  3AYH B;  4LUZ A;  1X3E A;  5LMU Q;  1IXR A;  4QGU A;  1Y1V G;  5HY6 A;  1ASY A;  2JA7 G;  2DGY A;  2K75 A;  2GVA A;  1I50 H;  3KDF B;  3HOU H;  4POF A;  1PFS A;  3ULJ A;  2E2I H;  3G71 A;  3PIP A;  4BY7 H;  2E5L L;  3GDE A;  1Q7Y C;  2K5H A;  4KLK A;  3KJP A;  2UXD Q;  3MEF A;  1YJ9 A;  1N34 L;  3ULL A;  4A3E G;  3BJU A;  3UDX A;  1HH2 P;  1CKM A;  3K80 C;  1CUK A;  2R7D A;  4GNX A;  3CPW A;  2K5N A;  4B3S Q;  2ZJR A;  2JA6 G;  4R4Q A;  4JG2 A;  1AE2 A;  1QUQ A;  3GO5 A;  4OWX B;  4AH6 A;  2AWN A;  4JI5 Q;  1NTG A;  4JI6 Q;  1CKN B;  2ATW A;  1PH7 A;  4A3G G;  3HKZ E;  1CSQ A;  2CWA A;  4DK6 C;  1QVC A;  2XTI A;  2PNH A;  3W5O A;  4IFD G;  1HZC A;  4A3E H;  1VQD A;  3VDY A;  1PA6 A;  4DR2 Q;  1LYL A;  4IPG A;  3U4Z A;  2E2J H;  1S40 A;  3NEL A;  4OXP A;  1VQA A;  2B3G A;  1TXY A;  1Q81 C;  4QY7 A;  2F4V Q;  4A3B H;  2D62 A;  3CCS A;  4AYB E;  2JA6 H;  2NVT H;  4LF9 Q;  3I4M H;  2MQH A;  4DR1 L;  4NXN L;  1LTL A;  5M5W H;  1PHJ A;  4A3G H;  3L7Z C;  1C0A A;  3DM3 A;  3KF6 A;  4GN4 B;  4H02 A;  1OXS C;  4HJ8 A;  1VQH A;  4DUZ L;  1SMX A;  4KHP L;  4HJA A;  2OTL A;  2R7Z G;  5BR8 Q;  5GAE C;  1VQ9 A;  1N32 L;  5C44 G;  3GD7 A;  3GTJ H;  4JI7 Q;  1HNX L;  1VQL A;  1Q1B A;  1I94 L;  3PO3 H;  3I56 A;  4GLV B;  5GRO A;  4HID A;  2LXJ A;  3KDF A;  1WI5 A;  4QJF A;  2K52 A;  5FLM H;  1V9P A;  3UE1 A;  1LM0 A;  2R93 G;  3H3V I;  1YZ6 A;  3RR5 A;  2CQO A;  2OCE A;  4X64 L;  2YU9 H;  4LF7 Q;  5M3M G;  1K8G A;  1E24 A;  2UXB L;  2E8G A;  2HIX A;  4C3J H;  4JBM A;  2PQA B;  3CCJ A;  4P72 A;  1LUZ A;  4DUY Q;  2Q2H A;  2QA4 A;  2YV5 A;  4P74 A;  1FL0 A;  1PH2 A;  3S24 A;  1Q46 A;  1L2F A;  1PV4 A;  3PO2 H;  1KRS A;  3AQQ A;  4LWC A;  5C0X I;  2NVQ H;  3AEV A;  3S14 H;  3ZJY C;  3OYY A;  4Y52 H;  4BA2 I;  2UXD L;  1A63 A;  5M3M H;  4RMF A;  1GM5 A;  2N8N A;  1YHB A;  3LGJ A;  1YI2 A;  3HOX G;  5FJ8 H;  1EYG A;  1OTC A;  3NEN A;  2NZH A;  2H5X A;  3M3Y H;  5ELN A;  4MNO A;  4A3L H;  1XMO Q;  1M1K C;  1B7Y B;  4B3S L;  1NJI C;  3STB D;  1Z9F A;  4C3I H;  1D8L A;  4JI5 L;  2GN5 A;  4JI6 L;  1HZA A;  5J3B A;  3L0O A;  2JQO A;  1C7Y A;  1W2B A;  2UUB Q;  2JEA I;  1K3R A;  1KRT A;  1JJ2 A;  1WFQ A;  4TQU S;  1PVO A;  4LF6 Q;  2JA5 H;  2VZA A;  1YNX A;  1KIX A;  3CC2 A;  3D31 A;  3J80 c;  4DR2 L;  3PUZ A;  4TVA B;  4A3D G;  1NBW A;  1KAW A;  3KLW A;  2EXD A;  1BBW A;  1KXL A;  1VQB A;  3I2Z A;  4LFC L;  3CCE A;  5IWA Q;  3JAM c;  1YEZ A;  4LF9 L;  2K50 A;  4UP7 A;  5C0X G;  4K0K Q;  1X6O A;  4ALP A;  3PF5 A;  4GN3 B;  4YCU A;  5M3F G;  2PI2 A;  3TEH B;  1J5E Q;  4BY7 G;  1N33 Q;  1I94 Q;  5IYB H;  3W1B A;  4JBW A;  4JI3 L;  3PUV A;  4L5R C;  2LSS A;  5JJK A;  2NN6 I;  1A8V A;  5BR8 L;  3HOU G;  3FHW A;  2B63 H;  1EUJ A;  2PQA A;  2VY3 A;  4JI7 L;  3RLO A;  1V1Q A;  3HKZ G;  1JJC B;  5IP9 G;  2VL6 A;  1CSP A;  3AFP A;  4A3I G;  1X9N A;  3TS2 A;  2D0O A;  4HJ9 A;  1X65 A;  1I6H H;  2WAQ G;  1IYJ B;  1EQR A;  4HJ7 A;  4PMW A;  2UXB Q;  1GKH A;  1TWG H;  1Q12 A;  4JBJ A;  1E22 A;  2ZJP A;  1SFO H;  2MNA A;  2WB1 E;  2WFW A;  5LMN Q;  4LF7 L;  1KHI A;  4AYB G;  1Q86 C;  1MKH A;  2I5M X;  1KD1 C;  3I4O A;  1AE3 A;  4WJ4 A;  2NVY H;  2R7F A;  2IX0 A;  2F52 A;  3BZK A;  5EAY A;  4POG A;  1T9H A;  2A19 A;  4L5T A;  1NE3 A;  4A3I H;  5IP9 H;  1HR0 Q;  4DUY L;  4GNX C;  4XTC S;  3E9H A;  3H15 A;  3U4V A;  1G29 1;  4BXX H;  4WJ3 M;  4X66 Q;  2I0Q A;  1VQE A;  3ER0 A;  2LXK A;  4JBK A;  4QQB X;  5IYC H;  5K36 G;  4P73 A;  5FLX c;  1XJV A;  3M7N A;  4A4I A;  3HOY H;  3CW2 C;  4C2M H;  1WCM G;  2KHI A;  2XGT A;  3S2D H;  2JA9 A;  4DK3 C;  4A3B G;  4JOI C;  3KOJ A;  4DV7 Q;  2OQ0 A;  1WYD A;  2NN6 G;  2A8V A;  1U0L A;  1VCI A;  1Q82 C;  3GTG H;  3I4M G;  2KBN A;  2Q2I A;  3TQY A;  1EWI A;  2NVX H;  4KI0 A;  1PH1 A;  1UWV A;  3CQZ H;  2A1A A;  3EIV A;  3J80 i;  1XMO L;  4JOI A;  1E1T A;  3PUW A;  2L15 A;  1PH8 A;  3ICE A;  1L0W A;  3GTM H;  5ELO A;  1XMQ L;  1VQ4 A;  3I4N G;  4DR7 Q;  3CC4 A;  2JJQ A;  3S15 H;  3JAM i;  1OXX K;  3PSI A;  3CCR A;  2UUB L;  1AH9 A;  1WCM H;  3ERS X;  3H0G G;  4J15 A;  4C3H H;  1JMC A;  1WJJ A;  2Y0S E;  3CPF A;  3E0E A;  3I7F A;  5M5Y H;  1M90 C;  4LF6 L;  4LFC Q;  1A0I A;  1SN8 A;  4PZ7 A;  3UDI A;  5H1S E;  1PH4 A;  5JJL A;  1YHQ A;  3CP0 A;  2ALY B;  3GTL H;  5FLM G;  1IBM Q;  3W1G A;  3U58 A;  1GVP A;  1C9O A;  4O2D A;  4GKJ Q;  5IWA L;  2AMC B;  4Y7N H;  1IZ6 A;  3G48 A;  4ME3 A;  3M85 A;  4JI3 Q;  3I4N H;  2JA8 G;  4LFB L;  4K0K L;  2UUA Q;  2OTJ A;  1X55 A;  2VUM G;  5GAD C;  1L1O B;  3H0G H;  3S17 H;  1J5E L;  2R6G A;  1N33 L;  1G51 A;  4A3K H;  1TWA H;  4IFD J;  3SGI A;  4A3F G;  4APV A;  4PG3 A;  4LUO A;  4GKK Q;  4UPA A;  3FP9 A;  1E7Z A;  3PO2 G;  1QZG A;  4DV2 Q;  1B70 B;  4JI8 Q;  1MIU A;  3CCQ A;  5AJ3 Q;  3K8A A;  3K7U C;  4IPD A;  5C3E H;  3J7Z C;  4JV5 Q;  3G6E A;  1HZ9 A;  5IE8 A;  1Y1W H;  2JA8 H;  5FJ8 G;  1KC8 C;  3J81 c;  4HJ5 A;  2VUM H;  1XPU A;  5LMN L;  1HNZ Q;  4A3L G;  2MO0 A;  4A76 A;  1U5K A;  1E1O A;  4A3F H; 
#chains in the Genus database with same CATH topology
 1T5X D;  1N36 Q;  3P20 A;  5IGE A;  4HSV A;  2VNU D;  1TKW B;  1BCP B;  4GKJ L;  1WTR A;  2O4X A;  4X66 L;  4DR4 Q;  3OHX C;  1WTQ A;  3MXN B;  4IUU A;  3HOZ H;  5GAG C;  3PV0 A;  1SYE A;  2ZXO A;  2JSO A;  3BVM A;  5C4J H;  3NEM A;  4N8F A;  1AEX A;  3OWE B;  1MBY A;  1ZYR D;  2LKV A;  3HP3 A;  4QUF A;  2B63 G;  3VA5 A;  4YY3 Q;  1BKB A;  3HOV H;  4O0A A;  1XTC D;  5ELC A;  3NQT A;  3S1N H;  1G6P A;  3IFT A;  4OGQ C;  3TS0 A;  3DHQ A;  2EDG A;  4UAI A;  3KYH C;  3E0J A;  1H9S B;  5J22 A;  1D6E C;  1STG A;  4O1N A;  4LJZ C;  4HSP A;  1RTN A;  1PH3 A;  4MTN A;  2KCT A;  2Z6K A;  4ZKC B;  1EYA A;  1ZYR C;  2EJM A;  3TRZ A;  2G9D A;  3HOY B;  5D3I B;  1M4V A;  4GOP A;  1HUM A;  2F0V A;  2A74 C;  3M4P A;  1SYB A;  4FDB A;  1PTO C;  4L5S A;  5D65 A;  4OO1 I;  3J80 E;  3SXH A;  4DNI A;  2VQF Q;  3CC7 A;  2E75 C;  1SE2 A;  4A3J H;  2V1C C;  1HNZ L;  1XNR Q;  3X3N A;  3CD6 A;  2KUM A;  3A5Z B;  4B3R L;  3S1R H;  3MXU A;  5IIF A;  1I4H A;  3KLS A;  1QNU A;  3DM1 A;  3X3M A;  4KKS A;  3NTH A;  3VR3 A;  4YHH L;  3NHH A;  1D5X C;  3RN5 A;  4H0L C;  4RGO S;  1IBK L;  3AFQ A;  1LAC A;  1EFI D;  3NWT A;  2IX1 A;  4PZ6 A;  1VS0 A;  4A3C H;  3F1Z A;  5GAH C;  4I7A A;  3I55 A;  2EYP A;  1HCZ A;  1HTL D;  2FXQ A;  3EJI A;  5C5L A;  1S5F D;  5IGC A;  3A0J A;  1J8I A;  3OTO L;  4DV1 Q;  4ZKB B;  4OX9 Q;  2G9H D;  5C3E G;  4DR6 Q;  2IX3 A;  1A3V A;  2K4K A;  2L4N A;  1TWF B;  4DK0 A;  4FF3 A;  5FLX E;  1Y1W G;  4OEM B;  1PZK D;  1E2Z A;  4X65 L;  2RBM A;  3R3O A;  2EJG C;  2TSS A;  1UAP A;  4CKC A;  2XRQ D;  4C1N I;  2HHH Q;  1JT8 A;  2RA4 A;  3PUX A;  1PH5 A;  1A3U A;  2OWO A;  1X56 A;  1U4R A;  1ICW A;  1PZJ D;  4LW1 A;  1YIJ A;  2RHS B;  1HXY D;  4MTK A;  1WVL A;  5M5X H;  1D5Z C;  3TME A;  4BBR G;  3BZC A;  4JCV E;  2HT1 A;  5C4J B;  2AQ1 B;  2Q2U A;  1I4R A;  2WV6 D;  3M9B A;  2DNE A;  5EPK A;  1IL2 A;  2XWB B;  1X3P A;  2BCO A;  2PCF B;  3KF8 B;  4IJL A;  3EBE A;  2M2L A;  4NXM L;  2VS1 A;  3AU7 A;  4KMU C;  4KJO A;  2E2H H;  1GXD C;  4HIO A;  1I3Q B;  2PYK A;  2CW0 C;  3RLN A;  5FO8 B;  2WB1 B;  2BA1 A;  3RNU A;  3FMC A;  1MJC A;  4EVO A;  1UNS A;  1JJG A;  1VMC A;  1ILP A;  1PH9 A;  2WII B;  2R93 H;  4K8J A;  2KEE A;  5EJW A;  1NMF A;  3J7Y W;  2A73 B;  1ENF A;  4E6I A;  5HUR A;  3PIO A;  4DAM A;  1IYU A;  4J6H A;  1SEB D;  4UY8 C;  1EFW A;  2WP8 J;  2ID0 A;  2L12 A;  3KFU A;  4IO9 A;  2ZJQ A;  3OOC A;  2B29 A;  2IJ0 A;  4NW2 A;  1KDB A;  5CMD A;  5IGG A;  5COY A;  4A3M G;  4PV1 C;  2ZM6 L;  1QUQ B;  2F4I A;  4UDU C;  5A35 A;  1U4L A;  1WTV A;  4UP9 A;  1O7Y A;  1JOO A;  4DV3 L;  3ND8 A;  4K5W A;  4KHP Q;  4ZLT F;  3BYT B;  2R92 G;  5HGQ A;  1S3O A;  2Y0S G;  1YNN C;  3WOE A;  4R1J A;  1VQ5 A;  1LV9 A;  1DCZ A;  3MTS A;  2E2I B;  1SAP A;  2RQX A;  3E3X A;  4HR7 B;  3S16 H;  5IYD G;  3BS1 A;  1EWH A;  4NXM Q;  4P71 A;  4G7Z C;  2KCM A;  2F0J A;  4LUV A;  2NZO A;  2IT1 A;  3NBH A;  3PCO B;  5C0X H;  4IFD I;  1WD1 A;  1Q3L A;  4LUZ A;  3GQB A;  2PW5 A;  1HUN A;  1JWM D;  1PFS A;  3PIP A;  1K3B C;  4BY7 H;  4F88 A;  2E5L L;  1Q7Y C;  3NE5 B;  2NWG A;  1B1Z A;  4CBV A;  5JJZ A;  1N34 L;  4A3E G;  2JA6 B;  1CKM A;  2K5Q A;  1CUK A;  2SDF A;  2R7D A;  4GNX A;  2ZJR A;  4A3G B;  4IUQ A;  1AE2 A;  2KED A;  5M5X B;  4AH6 A;  3HKZ E;  1SMY D;  3Q23 A;  2HCC A;  2XTI A;  3W5O A;  1HZC A;  4A3E H;  3VDY A;  1PA6 A;  1BDO A;  2E2J H;  1E0B A;  3NEL A;  1VQA A;  2B3G A;  2SNM A;  4K6D A;  3BG3 A;  2A6H C;  1EIG A;  2QCP X;  2NN6 H;  3I4M H;  5CV4 A;  4DR1 L;  3LNN A;  5CBA E;  1PZI D;  5M5W H;  5ELB A;  1PRT D;  4U68 A;  5KIX A;  2F0S A;  1C0A A;  4KD4 A;  5KYL A;  1SNO A;  5LL6 S;  4HJ8 A;  1OXS C;  4HJA A;  5EKK A;  2OTL A;  2R7Z G;  3OMC A;  1SMY C;  2EYH A;  4MN3 A;  3I56 A;  4DNT B;  1AZP A;  3S14 B;  1EY7 A;  1EY6 A;  2LXJ A;  3KDF A;  5FLM H;  5FKA C;  2XRS D;  1CZW A;  1S5D D;  1K8G A;  5I4D A;  3T56 B;  5EBC A;  2B2V C;  3FPU B;  1ET9 A;  2WIN B;  3CCJ A;  2B2Y C;  4P72 A;  4V19 0;  1FL0 A;  3HZX A;  5DM6 3;  1FD7 D;  3S24 A;  3D6W A;  5IGB A;  3D4R A;  1PH2 A;  1L2F A;  1NR4 A;  5EKL A;  3OYY A;  4Y52 H;  2UXD L;  1YHB A;  3I73 A;  5T1I A;  3M3Y H;  5ELN A;  2K05 A;  4A3L H;  2K28 A;  3MWY W;  3I70 A;  3DWP A;  1NJI C;  2PNR C;  5DNF A;  3J80 L;  1EY8 A;  1QJO A;  4JI5 L;  2F0Q A;  5T1G A;  2B2T C;  3V96 A;  3K57 A;  1WFQ A;  1PVO A;  2JA5 H;  1KIX A;  3CC2 A;  3AB9 A;  1BCP F;  1I6H B;  3N6R A;  2J7Z A;  3KF8 A;  1SFO B;  1X32 A;  4K0K Q;  4ALP A;  1AZQ A;  4RCO A;  1YNJ D;  4BY7 G;  4QB4 A;  5C4H A;  3PMF A;  3PUV A;  1CM9 A;  3HKZ B;  5JJK A;  1DON A;  1A8V A;  3HOU G;  5KGU A;  1CFM A;  4G4K A;  2PQA A;  2VY3 A;  2RKS A;  4FVM A;  3TS2 A;  4A3I G;  5IP9 G;  4IAL A;  5ISR A;  1F9S A;  1CA5 A;  3S2D B;  3C1E A;  4OL7 A;  2DN8 A;  1TWG H;  1GUG A;  1Q12 A;  1E22 A;  4JBJ A;  2ZJP A;  3J7A F;  2WFW A;  3H3V C;  1E2V A;  2EXZ A;  5F2D A;  1MKH A;  1CK1 A;  2I5M X;  3MAQ A;  1MHW C;  2LY7 A;  5FLX L;  1EYC A;  2R7F A;  2F52 A;  4A3I H;  5IP9 H;  2E2J B;  4BXX H;  1G29 1;  1TS4 A;  5JEA H;  5K36 G;  5IYC H;  2KQ3 A;  4P73 A;  1XJV A;  4K2K A;  3CW2 C;  4C2M H;  4YIJ A;  2E74 C;  2XGT A;  2JA9 A;  4DK3 C;  5E4W C;  4PNY A;  2KBN A;  2Q2I A;  1EWI A;  4R8I A;  2NVX H;  3FRP B;  4KI0 A;  1UWV A;  1O7Z A;  3CRL C;  3EIV A;  3J80 i;  1DM0 B;  1PH8 A;  3H0G B;  1VQ4 A;  4DR7 Q;  3CC4 A;  3S15 H;  3MC0 B;  1JMC A;  3EA6 A;  3E5S A;  5M5Y H;  3PO3 G;  1M90 C;  1PH4 A;  2GA4 B;  1NCV A;  4KN4 C;  1IBM Q;  3I4L A;  1PRT B;  3HS0 C;  1EY4 A;  5IWA L;  1IYV A;  1QG7 A;  2O5J C;  1PFB A;  2OTJ A;  1D1I A;  3OPO A;  2JA8 G;  2VUM G;  4BS9 A;  1AFP A;  2EZV A;  1J5E L;  4OO1 H;  1TWA H;  3KLR A;  1KTK A;  3K59 A;  2F0N A;  3SK4 A;  1E7Z A;  3PO2 G;  3U9O A;  2PZU A;  4JI8 Q;  5NUC A;  3M3Y B;  4OEL B;  2F0E A;  2JA8 H;  3MFY A;  1CQF A;  1PLF A;  3J81 c;  2BDO A;  2VUM H;  3GTK B;  1S5C D;  2EOT A;  1ILQ A;  2MO0 A;  1E3P A;  1U5K A;  4A75 A;  2KJX A;  2XIW A;  4C3I G;  4GOP B;  1HR0 W;  2PO4 A;  2JA5 B;  3ZYY X;  2C35 B;  1PYS B;  3V05 A;  1SYD A;  2A69 C;  4AIM A;  3CCV A;  4BBS B;  5C5M A;  2KCC A;  2K5V A;  4RG1 A;  1DOL A;  2K5D A;  1J6Q A;  3D6C A;  4KY6 A;  3NTK A;  4WOR A;  2V4D A;  3HOW H;  5IYB G;  3FKI H;  3RZD B;  3M4O B;  1HHV A;  1VQG A;  1GHJ A;  1Q1E A;  4TKO B;  3WDN A;  1XTD A;  3K0X A;  4TRD A;  3UDG A;  1KAB A;  3F2U A;  4IUN A;  4RCN A;  1VQ8 A;  3K5N A;  1F2L A;  3K7A B;  1QB5 D;  1G2S A;  3E9I A;  1YBY A;  5LL6 X;  4N9T A;  4RHS A;  2P5Z X;  1YVC A;  4ULL A;  1U9R A;  5GQO A;  2NBF A;  3F2D A;  3QR8 A;  5COR A;  3WWV A;  3BDO A;  4GKK L;  3J7A 5;  2CH4 W;  4XYQ A;  2EIF A;  1FNV A;  2I5L X;  5AJ3 L;  1K73 C;  3HOY G;  1PXU A;  3H6M A;  1NR2 A;  1F77 A;  2AQ3 B;  3EQL C;  4DV0 L;  1Q8K A;  3O13 A;  1N36 L;  3KF6 B;  1EU3 A;  3FPP A;  5M5Y B;  4B3M Q;  4X62 L;  4N8X 1;  1VQI A;  5I6W A;  1Y1V B;  2JA7 B;  3TRE A;  1G2T A;  2D9U A;  1TWC H;  1I5F A;  4DR4 L;  5KND A;  4G57 A;  3TSS A;  4A93 H;  4RHR A;  5BN3 A;  1UE1 A;  1HA5 A;  4LFA Q;  3CF5 A;  2LFN A;  1STA A;  1STE A;  4ABN A;  5JAV A;  1TWA B;  1UE6 A;  1QOH A;  5CGK A;  2UUC Q;  4OHJ A;  4LK1 C;  1TQO A;  2IHE A;  2CCZ A;  1EEI D;  4EX5 A;  1YJW A;  2IY5 B;  3A7L A;  4YY3 L;  1PYB A;  3PF4 A;  1SNP A;  4GLA C;  3SE0 A;  3W2D A;  4RA8 A;  1HQM C;  2WAQ E;  1BO0 A;  4XT1 B;  3F2B A;  3H94 A;  4FO2 A;  2WKD A;  1O7I A;  1BVS A;  2C9O A;  4HCS A;  1I4X A;  3Q22 A;  3SR1 A;  2XNA C;  1JE5 A;  2RF4 A;  3TBI B;  4PMC A;  1TT2 A;  1CTM A;  5C44 B;  1B3A A;  1RDP D;  4NP5 A;  4IFD H;  1TWF H;  1WTX A;  3HOZ G;  2HUG A;  2AUK A;  4DV0 Q;  1FJG Q;  2IHF A;  4IUT A;  1TS2 A;  3OW7 A;  3JC6 6;  4DR3 Q;  1N9W A;  4DV6 Q;  1HNW Q;  2VQF L;  4R4C A;  4X62 Q;  3FKI B;  4DR5 Q;  1MJE A;  1VQF A;  1XNR L;  3IRB A;  1Z47 A;  4JI1 Q;  3NWS A;  2PZW A;  3CCL A;  1BOS A;  4HTH A;  3MXP A;  3HOV G;  1K8M A;  3CAM A;  1UE7 A;  1K8A C;  4OON A;  3U50 C;  3GTP B;  1JOK A;  1L1O C;  3NBH B;  2WB1 G;  3P1H A;  2K1B A;  1CHQ D;  1XPR A;  3HOX B;  3C2P A;  3A55 A;  3LWU A;  2ICE C;  3AMU A;  4X3U A;  1BBU A;  1I3Q H;  1PTO D;  4NKL A;  4BY1 B;  1CKO A;  1HTP A;  1GOZ A;  4DV1 L;  4OX9 L;  3HEJ A;  4DR6 L;  2F3I A;  4EQO A;  1SRO A;  2FFK B;  4GNX B;  1RD9 D;  2VXW A;  4DAY A;  4A3J G;  4R4I A;  1A62 A;  2HHH L;  4NXN Q;  3TZU A;  1HZB A;  4X3S A;  2CWP A;  2N55 A;  1TWC B;  4EQP A;  4DUZ Q;  4YWL A;  1B9N A;  4A93 B;  1EQQ A;  2AQ2 B;  1VQC A;  2ICI A;  2SOB A;  4YCW A;  3A56 A;  3F2C A;  1HNX Q;  1KL9 A;  2MHV A;  4C1N K;  2Z0S A;  4A3D H;  4DPG A;  1M8A A;  2WAQ B;  1RL2 A;  4A3C G;  4RKB A;  2E76 C;  2F0P A;  3I72 A;  2NTS A;  2QKI C;  2KOL A;  3EN2 A;  1NNX A;  1ZKO A;  2F0L A;  2HD3 A;  1Q8I A;  4GLX A;  5M3F H;  3RMH A;  2X6L A;  3R93 A;  1II3 A;  4QGU A;  1RTO A;  2DGY A;  2K75 A;  3KDF B;  2E2I H;  3G71 A;  2A68 C;  1A6X A;  1GUT A;  1YJ9 A;  1CQV A;  2NVT B;  1S5B D;  1SNC A;  3I91 A;  1I4Q A;  2JA6 G;  4B3S Q;  2CHB D;  4R4Q A;  4RH6 A;  5IGF A;  4OWX B;  4QMG A;  1CKN B;  4CJ0 B;  1PH7 A;  4A3G G;  3I8Z A;  4DK6 C;  1QVC A;  1STB A;  5I9P A;  1VQD A;  1LYL A;  3NP8 A;  4IPG A;  1S40 A;  4A3B H;  2D62 A;  3CCS A;  1LTB D;  2JA6 H;  4LF9 Q;  1HQR D;  2R3Z A;  2EJF C;  3C46 A;  1QE6 A;  1V1P B;  1NSN S;  2YU9 B;  4A3G H;  2CW0 D;  3DM3 A;  3KF6 A;  4DAV A;  5I2Y A;  4GN4 B;  4C3J B;  1IKM A;  4KHP L;  2HQE A;  4S3S A;  1GUW A;  1VQ9 A;  2K6A A;  3GD7 A;  3TP8 A;  4JI7 Q;  1Q1B A;  3T53 B;  5GRO A;  4HID A;  2HDM A;  1WI5 A;  1V9P A;  2R93 G;  3IAY A;  1IW7 C;  3MFG A;  2NUC A;  4KY7 A;  1QNK A;  1STY A;  3VYR A;  2HDL A;  1WTW A;  4RWS C;  1JOR A;  2EPB A;  1SE4 A;  2RDF A;  3QJY A;  1SYF A;  1EEF D;  1PRT F;  4LAA A;  1AP0 A;  2PQA B;  3T51 B;  1Z7T A;  1LUZ A;  2QA4 A;  4FF1 A;  2YV5 A;  4P74 A;  3IFD A;  1EY9 A;  2D5D A;  1Q46 A;  1SBB B;  3EVQ A;  3QIA A;  3ND9 A;  4OIK A;  3S14 H;  5CV8 A;  4X3T A;  4BA2 I;  2H4O A;  5FJ8 H;  1EYG A;  1NAP A;  4LMQ D;  1G8Z D;  4Z9C B;  3K58 A;  2E2D C;  1PTO B;  4P2C B;  3I3C A;  5LHY 1;  1M1K C;  3Q0A A;  1B7Y B;  1EZ8 A;  1YNN D;  1K0S A;  1Z9F A;  4CHT B;  3VR2 A;  2NB0 A;  2GN5 A;  2UUB Q;  1KRT A;  4A3D B;  4LF6 Q;  2B63 B;  2VZA A;  3D31 A;  1T5E A;  3PUZ A;  1LO5 D;  1B4O A;  1VMP A;  4CKE A;  1MSH A;  2EXD A;  2RCF A;  1DJR D;  4XYO A;  3JAM c;  2RSO A;  1YEZ A;  2K50 A;  5M3F B;  4UP7 A;  5C0X G;  4GN3 B;  4YCU A;  4DA2 A;  2PI2 A;  5IGD A;  2Z9H A;  4JBW A;  4JI3 L;  3W1B A;  4L5R C;  1D1K A;  2LSS A;  1Z6H A;  3FHW A;  3RLO A;  1F2Y A;  3HKZ G;  1X9N A;  1CSP A;  3AFP A;  2D0O A;  1PFN A;  1WTO A;  1I6H H;  1GKH A;  2F0T A;  3W3A A;  3GTG B;  1SFO H;  5EPJ A;  1SJH D;  5LMN Q;  3A7A B;  4MIU A;  3CQZ B;  1KD1 C;  3I4O A;  1AE3 A;  2EVB A;  2NVY H;  3BZK A;  5M9O A;  5EAY A;  4POG A;  2A19 A;  1NE3 A;  1JQY D;  1HR0 Q;  1DOK A;  2Z4I A;  3U4V A;  2I0Q A;  1WCM B;  2F0O A;  4QQB X;  2A6H D;  2LXK A;  4JBK A;  3IL8 A;  4A3B B;  2WAC A;  2Z1C A;  4H7B A;  3S2D H;  3VR5 A;  2KHI A;  4IN3 A;  2EY5 A;  1UUP A;  4JOI C;  3J7A V;  4DV7 Q;  1WYD A;  2NN6 G;  3L9A X;  1VCI A;  3GP7 A;  3I4M G;  4IQZ A;  3TQY A;  4Y7N B;  1X3Q A;  2A1A A;  2IW3 A;  4KTA A;  1L0W A;  3GTM H;  5ELO A;  3S17 B;  3NQI A;  2BE5 D;  2JJQ A;  2WKC A;  5G3L D;  3PSI A;  3ERS X;  3H0G G;  4C3H H;  2CH4 A;  3E6Z X;  3NBI A;  1WJJ A;  2Y0S E;  3P75 A;  3I7F A;  2IL8 A;  1V1O A;  1ONL A;  1SN8 A;  1SND A;  4PZ7 A;  5H1S E;  3KK7 A;  5I6Y A;  5FLM G;  3U58 A;  4M1U B;  1GVP A;  3MHB A;  4O2D A;  1B2T A;  2F0U A;  4WFN 3;  2AMC B;  4JI3 Q;  4K0K L;  3D4W A;  2UUA Q;  1X55 A;  4F8M A;  4A3F B;  3H0G H;  2R6G A;  1G51 A;  4A3K H;  4K8I A;  2BE5 C;  3SGI A;  4PG3 A;  4LUO A;  4DV2 Q;  1B70 B;  2MPM A;  4HMJ A;  3CCQ A;  3K7U C;  1XWE A;  4BBR B;  3J7Z C;  4JV5 Q;  3D8G A;  1TWH B;  4HJ5 A;  5A2Q L;  2PPB C;  1XPU A;  4A3L G;  1L0X B;  1SE3 A;  4GS3 A;  1CKN A;  1NMG A;  2XWJ B;  3S1M B;  1QIL A;  3P7J A;  2F0M A;  2JA5 G;  1VQP A;  3DUZ A;  5C4Z A;  1EL0 A;  1NY4 A;  2JP1 A;  4P75 A;  5CV6 A;  1KNA A;  1WOC A;  2OXP A;  1SXT A;  2HQL A;  4BBS G;  3GTK H;  1F9Q A;  2B8F A;  5JVG 3;  1V1P A;  4X6A H;  2AUJ D;  4C56 C;  5FO9 B;  2QEX A;  1ML0 D;  1KDA A;  3HRZ C;  4JYA Q;  3BU2 A;  4DR7 L;  3S1Q B;  5C4X B;  1RKN A;  4FXG C;  1L1O A;  1C48 A;  4BBS H;  3DMU A;  5CV7 A;  1EQT A;  1IBL Q;  1RHP A;  1IBM L;  3J81 j;  4ILW A;  3G4S A;  1EIF A;  1HFG A;  1JC7 A;  2NVY B;  3RLF A;  3GTQ B;  1K28 A;  2PZT A;  4A3M B;  3T1Y Q;  1V8Q A;  4JI4 Q;  3RZD H;  1KQS A;  3M4O H;  1FGU A;  2F1M A;  4BXX G;  2NTT A;  2R92 B;  3BZD B;  4DV5 Q;  5JEA G;  1UEB A;  1B8A A;  5E1F A;  5IYC G;  1F9P A;  4GZY C;  1Q90 A;  4FXK C;  4JI8 L;  4H44 C;  5J1Z A;  2CFM A;  3TDQ A;  3T4A C;  5C0X J;  2L0C A;  5KEE A;  3K7A H;  3M4Q A;  1YHA A;  1Y14 B;  4JI2 Q;  3GTM B;  4IOA A;  2B2W C;  2Q2T A;  2B8G A;  1LTT D;  4KKT A;  1SYG A;  2ASB A;  4C3H B;  1RCV D;  1SE8 A;  2CKZ B;  1GJX A;  3KJO A;  3VYS A;  1W6J A;  3ONA B;  1EIY B;  4HIM A;  3CKI B;  1UE5 A;  4BWG B;  2EYO A;  2QIL A;  1D7Q A;  2LS0 1;  1VQ7 A;  1VQK A;  1G91 A;  3T1H Q;  1R4Q B;  4B3T L;  4A3K B;  4LF4 Q;  2UXC L;  3SK5 A;  4AQY Q;  1MI2 A;  4NMZ A;  1X54 A;  5JOB A;  1O80 A;  4DFA A;  1IHZ A;  2Q8R E;  2A5H A;  4OO1 G;  2VQE Q;  4LF8 Q;  2JXM B;  1BF4 A;  1Y1V H;  3URY A;  2IWH A;  2JA7 H;  5DM7 3;  2L9H A;  1RF2 D;  4GN5 A;  2F03 A;  5HGT A;  1VDZ A;  2ZTD A;  4NB3 A;  3QOL A;  1CI3 M;  5CC4 A;  2VW9 A;  2EY1 A;  4IZ8 A;  4JI0 Q;  2A69 D;  1JWU D;  2FMM A;  3KBX A;  1CT1 D;  1FVI A;  4EQ5 A;  2N3S A;  4K2L A;  4B08 A;  1B9M A;  1TS3 A;  4RGM A;  5CV5 A;  1LTS D;  2ES2 A;  4J1M A;  1KNE A;  4ZAI A;  4ZK9 B;  5LMN W;  1AW7 A;  3S2H B;  1EIH A;  4DV4 Q;  2BH2 A;  4XIG S;  4DAY B;  2RHQ B;  4LF5 Q;  4XT3 B;  3CRK C;  1DD2 A;  1LT3 D;  1SNM A;  1GO3 E;  1N8R C;  3HOW G;  3OIP A;  4ZUJ A;  4YWM A;  1NUC A;  2AKW B;  4I7Z C;  1XNQ Q;  1G6Z A;  3FKI G;  2Q8T A;  1LAB A;  3F8T A;  4B3M L;  1DGS A;  3M7G A;  4FNF A;  1GD7 A;  1X3G A;  4JC0 A;  4QIW E;  4DU9 A;  5C44 H;  3K5L A;  3GV6 A;  1SDF A;  1OXV A;  4UP8 A;  2NYZ D;  4B3T Q;  2UXC Q;  2K33 A;  1OXT A;  4LFA L;  1RIP A;  3SK8 A;  5DLQ E;  3L2P A;  1QVG A;  4CDD C;  1SSO A;  3J81 E;  1WD0 A;  1IKL A;  1EOT A;  1B44 D;  2UUC L;  3GTO B;  5I9O A;  4N9P A;  3VA7 A;  2XSC A;  1VF7 A;  2MUY A;  3RZO B;  3BDL A;  3ULP A;  2MFI A;  4BY1 G;  3GTP H;  3K81 C;  1S72 A;  3Q6S A;  1CA6 A;  1P16 A;  1BCP C;  1KLG D;  3HOX H;  2PI2 E;  2M00 A;  2K01 A;  2B2U C;  2F4V L;  2QW7 A;  4NDX A;  4XDX A;  3H91 A;  4OWT B;  1QZH A;  1VQN A;  2BH8 A;  4BY7 B;  3BVZ A;  3A5U A;  3D4D A;  4CDE C;  4BY1 H;  5IT9 c;  1N32 Q;  1O78 A;  4HED A;  3STB C;  4K6L A;  1I50 B;  1PTO F;  4ID6 A;  1VQ6 A;  4A93 G;  2L1B A;  2C5C A;  4R4T A;  4KN7 C;  1FR3 A;  1FJG L;  2A6E C;  4IJH A;  1F2M A;  3Q24 A;  4DR3 L;  1EOV A;  4DV6 L;  1HNW L;  1BNZ A;  4OWW B;  1Y69 U;  4M8A A;  4X64 Q;  1XX8 A;  4DR5 L;  2ZXR A;  1AN8 A;  3SDZ A;  1Y8P B;  4HIK A;  4BA1 I;  1DZ1 A;  4JI1 L;  2KEN A;  4WRD A;  4DGZ A;  4L5Q A;  5JEA J;  2J0T D;  1X3E A;  5DAU A;  1IXR A;  1HPC A;  5HY6 A;  1ASY A;  3OWF A;  2GVA A;  3NSW A;  3SHL A;  1LTI D;  1TII D;  4ZRZ A;  3GDE A;  1I6V C;  3MEF A;  4PMB A;  3ULL A;  1EY5 A;  4CDC C;  1ZEQ X;  2RDH A;  3CPW A;  3L3O C;  4JG2 A;  2AWN A;  4JI6 Q;  4HAE A;  1WTH A;  3T13 A;  1CSQ A;  2CWA A;  2KVM A;  4QIW B;  2KCN A;  2QF7 A;  4IFD G;  4DR2 Q;  3PO3 B;  3LX0 A;  1Q81 C;  2F4V Q;  4RAU C;  4AYB E;  5CV9 A;  2NVT H;  5CYU A;  4NXN L;  5CR3 A;  3L7Z C;  1BR9 A;  4UHV A;  4H02 A;  3D3R A;  1VQH A;  4DUZ L;  1SMX A;  3FDT A;  5BR8 Q;  5JVH 3;  4C3J G;  1HNX L;  3PO2 B;  2VB3 X;  4GLV B;  3SEB A;  3UE1 A;  5M3M B;  3H3V I;  1QCB D;  3RR5 A;  2CQO A;  2OCE A;  1ESR A;  2YU9 H;  4LF7 Q;  5KYI A;  1E24 A;  2UXB L;  2HIX A;  4QF4 A;  4C3J H;  2OEO A;  4DUY Q;  5IOC A;  2F0G A;  1PV4 A;  2B2V A;  3AQQ A;  4LWC A;  3AEV A;  4KD3 A;  2Z8L A;  3TP6 A;  2F3W A;  2IPK D;  3U9S A;  2B2Y A;  4DXF A;  4RMF A;  3LGJ A;  4ZUI A;  3NEN A;  2JYO A;  2ZXP A;  1XMO Q;  1CHP D;  3QWN A;  4B3S L;  5A2Q E;  2G5D A;  4HMI A;  2L5T A;  1HZA A;  3L0O A;  2JQO A;  3MXG A;  1W2B A;  1C7Y A;  1JCK B;  4TQU S;  4L63 B;  2BOS A;  3J80 c;  4TVA B;  5E4X A;  4A3D G;  2B2T A;  1KAW A;  1OO9 B;  1VQB A;  3I2Z A;  1ENC A;  3TP5 A;  4LFC L;  3CCE A;  4LF9 L;  4ODG A;  1HA6 A;  1PTO H;  3PF5 A;  3T16 A;  1TR5 A;  5M3F G;  2OF1 A;  1N33 Q;  3QO2 A;  2A68 D;  3NTI A;  1DYQ A;  2B63 H;  1EUJ A;  4JI7 L;  1V1Q A;  1JJC B;  2VL6 A;  1H9M A;  4HJ9 A;  4R8N A;  5C6A A;  2UXB Q;  4AYB B;  3DEO A;  2MNA A;  2WB1 E;  1ICF B;  2EYF A;  1Q86 C;  2KHS A;  5AFW A;  4WJ4 A;  3TN2 A;  2IX0 A;  4GKJ Q;  4L5T A;  2DJF C;  3E9H A;  4WJ3 M;  4X66 Q;  1GHK A;  4XXE A;  1BBX C;  2F0H A;  1HRJ A;  5FLX c;  2XN9 C;  3NK9 A;  2B2W A;  1ROD A;  1WCM G;  3GTL B;  4A3B G;  5FOB B;  3KOJ A;  2OQ0 A;  1U0L A;  3GTG H;  2F3V A;  3CQZ H;  3I4N B;  2NZ1 D;  3ICE A;  4QCL A;  1XMQ L;  1LT5 D;  2F0W A;  2EYL A;  1OXX K;  3CCR A;  2UUB L;  2R61 A;  1B53 A;  1WCM H;  2OT2 A;  2K32 A;  4LF6 L;  1LT4 D;  2F0D A;  4K5X A;  4LFC Q;  5JJL A;  1IW7 D;  1S5E D;  1B3Q A;  3UDI A;  2ALY B;  5KRU A;  3W1G A;  3BYY B;  3K6O A;  4TSS A;  4Y7N H;  3G48 A;  4ME3 A;  3M85 A;  4LFB L;  3A8K E;  2H1E A;  3OMG A;  1L1O B;  3S17 H;  4IFD J;  1KDC A;  4A3F G;  1D2B A;  3J81 L;  4UPA A;  5G3L F;  3K8A A;  5C3E H;  4IPD A;  3K5M A;  3EFX D;  5EGT A;  3CHB D;  5IE8 A;  1Y1W H;  3OSO A;  3HOZ B;  5FJ8 G;  1KC8 C;  1U4M A;  5LMN L;  5DEH A;  1HNZ Q;  1LLR D;  1PFM A;  4KY5 A;  4A76 A;  4A3F H;  4KHZ A;  2HCI A;  4B3R Q;  1JR0 D;  4PQX A;  1HR0 L;  2AHO B;  2JK8 A;  3RUZ A;  1XYI A;  1R4P B;  1W3S A;  2QDB A;  1SYC A;  4YHH Q;  3HOV B;  1STH A;  4BBR H;  2EE1 A;  2EQS A;  3S9W A;  1B50 A;  1D5M C;  1TWH H;  3DLL A;  3PGZ A;  3UE0 A;  1IBK Q;  3S1N B;  4DV7 L;  1A2T A;  1XMQ Q;  2RCN A;  5ELF A;  3UI2 A;  3A54 A;  2I07 B;  4LNQ A;  3A8I E;  3OW2 A;  3CCU A;  2PW7 A;  1ASZ A;  2ZTC A;  3KUP A;  1TY0 A;  1L0Y B;  3S1M H;  3B6Y A;  3OTO Q;  3PUY A;  5I2X A;  1JB7 A;  5JPM C;  3DEP A;  5C4X G;  2Z4H A;  4IPH A;  1FNU A;  1LTA D;  4LFB Q;  4X65 Q;  1JWS D;  4CKB A;  3FVQ A;  1YIT A;  3CU7 A;  4CGY B;  1K83 H;  2MGS A;  5CBE E;  4A3J B;  1K9M C;  2K14 A;  2UUA L;  1VF5 C;  4EQN A;  3S1Q H;  5IT9 L;  3NPP A;  3S1R B;  2VB2 X;  3J81 i;  5C4X H;  3UDF A;  1GUS A;  1H9R A;  4DV2 L;  1F2Z A;  2D0P A;  4JK1 C;  4CDF C;  1LT6 D;  1EZ6 A;  1PMR A;  1YJN A;  3CMA A;  4JV5 L;  5BN5 A;  4PZ8 A;  2B2U A;  2X6G A;  1JOQ A;  5IOD A;  2MO1 A;  4G7H C;  3DWA A;  3GTQ H;  3I90 A;  4A3M H;  1QWY A;  3MXN A;  3JAM E;  3NUC A;  3VYU A;  3SVM A;  2BA0 A;  1O7L A;  1R9T H;  2I5H A;  4V0B A;  3HG9 A;  2R92 H;  4C3H G;  2O5I C;  1HJP A;  2YTV A;  3MVV A;  3ITP A;  4HN7 A;  1IL8 A;  2AWO A;  3HKS A;  1OXU A;  5IYD H;  3A74 A;  1VQJ A;  1BUV T;  2D2C C;  3BVG A;  1CZG A;  3Q8D A;  2UU9 L;  3M4Y A;  3MZ5 A;  1V43 A;  2PMZ E;  1C8C A;  2K7V A;  4A3K G;  3KLS X;  4JYA L;  1H9S A;  3HGB A;  5C3E B;  5E3F A;  4MZ9 A;  3BDC A;  2EYM A;  2OQK A;  2N78 A;  1Y1W B;  3TZD A;  2TMP A;  4YCV A;  4FYD A;  1IBL L;  3TP7 A;  1H95 A;  2F0I A;  5ELE A;  5E7N A;  5IP7 G;  5EKI A;  1DOM A;  4F7X A;  1SNQ A;  5KNC A;  2ZM6 Q;  1PYW D;  2PQE A;  3T1Y L;  4JI4 L;  1P8L A;  2Z6B A;  4IPC A;  4DV3 Q;  3QG1 A;  2E2H B;  5JJI A;  2LMC B;  1DXM A;  2JN4 A;  2YTX A;  3G7L A;  4DV5 L;  4L6T B;  3DXJ C;  2JEB I;  5IP7 H;  4DKA C;  3CXC A;  2DUD A;  1PH6 A;  2SNS A;  1TU2 B;  4JI2 L;  2R93 B;  1C4Q A;  4IOC A;  1WTP A;  2ZTE A;  1SRU A;  4XQQ A;  3RN2 A;  4U67 3;  2YTY A;  2RSN A;  3IKJ A;  1PRT C;  1XXG A;  3HFZ B;  2N88 A;  1VQM A;  2R7Z H;  1SLJ A;  4O42 A;  2EY2 A;  2F0K A;  3S2H H;  2MJ8 A;  1ZXT A;  1VQO A;  5LMU L;  2GVB A;  2E5L Q;  5C3W A;  1K83 B;  2UU9 Q;  4FP5 D;  1XPO A;  1N34 Q;  3MA2 B;  4NPS A;  3T1H L;  2YYZ A;  1SR3 A;  1A15 A;  4DK1 A;  4LF4 L;  3CME A;  2B39 A;  4AQY L;  3CCM A;  1FNW A;  4KK7 A;  1BXT A;  1EU4 A;  1HFN A;  4YWK A;  2VQE L;  4LF8 L;  1TVX A;  4X3K A;  4DAP A;  4QL5 A;  2Z6K C;  4FXD A;  2Q8I B;  3S16 B;  4GOP C;  5FO7 B;  4FF4 A;  1ENA A;  3LWE A;  1R9T B;  4EGV A;  4DR1 Q;  4JI0 L;  1ET6 A;  1W6K A;  2CQA A;  1U4P A;  3GTO H;  2PMZ B;  5ELD A;  2Y0S B;  2JE6 I;  3H09 A;  1X3F A;  1Y8N B;  1QVF A;  3H3V H;  5K5P A;  4ME5 A;  1EY0 A;  4K5V A;  4R4O A;  3KBG A;  4HCE A;  4DV4 L;  3RZO H;  2CVR A;  3R8B A;  1A3T A;  4OIJ A;  3VR4 A;  2QGQ A;  2RDG A;  4LF5 L;  3VYT A;  2DY8 A;  1K0R A;  2KEC A;  2N49 A;  5IY0 A;  3R2I A;  2HIV A;  4DNR B;  2ZT9 C;  1BQQ T;  1XNQ L;  2KHJ A;  3D0F A;  3QOJ A;  3AYH B;  3N52 A;  4Q0F A;  5BN4 A;  2ENB A;  1Y1V G;  2DNC A;  5LMU Q;  2JA7 G;  4G7O C;  3SK6 A;  1I50 H;  3HOU H;  4POF A;  1YNJ C;  3ULJ A;  4DXG A;  4A3E B;  3QB3 A;  1LTR D;  2K5H A;  4KLK A;  3KJP A;  2UXD Q;  3BJU A;  3UDX A;  1HH2 P;  4R9W A;  5J39 A;  3I4M B;  1GUN A;  3K80 C;  3PIO 3;  5M5W B;  2K5N A;  3DWQ A;  5L37 A;  2EYJ A;  1QUQ A;  3GO5 A;  4JI5 Q;  2L11 A;  2ATW A;  3MEH A;  1NTG A;  5D3D A;  1KAA A;  1F9R A;  5TSS A;  1A2U A;  1I4G A;  3K0Y A;  4CJ2 C;  2PNH A;  5K36 H;  3U4Z A;  1TS5 A;  2L55 A;  4OXP A;  1TXY A;  4Q5V A;  4QY7 A;  4XQJ A;  4CJ1 B;  4JPB W;  2I46 A;  4H13 C;  2MQH A;  4IUP A;  1H9K A;  4KV6 A;  1K8O A;  1LTL A;  1PHJ A;  2K03 A;  1FGB D;  2R7Z B;  1JE4 A;  2FIN B;  5GAE C;  1N32 L;  5C44 G;  3C1F A;  1ESF A;  3GTJ H;  1VQL A;  2BDN A;  1I94 L;  3PO3 H;  4K14 A;  1E2W A;  4F87 A;  4QJF A;  1LTG D;  2K52 A;  2SEB D;  1LM0 A;  1YZ6 A;  3K5O A;  3ERQ A;  4X64 L;  5M3M G;  1EQV A;  4DN4 M;  2E8G A;  4JBM A;  1H9J A;  3PIP 3;  2Q2H A;  1EYD A;  3PO2 H;  1KRS A;  5JPN C;  1PDQ A;  5C0X I;  1BCP D;  2NVQ H;  1FYC A;  3ZJY C;  4QUC A;  3FEW X;  1JIC A;  1A63 A;  5M3M H;  3WOF A;  1EWC A;  1GM5 A;  2N8N A;  1YI2 A;  3HOX G;  4RFB A;  1OTC A;  2NZH A;  2H5X A;  4MNO A;  5C3X A;  2FMC A;  5KNB A;  3STB D;  1I4P A;  1UEA B;  4C3I H;  1D8L A;  4JI6 L;  2RVL A;  5J3B A;  2JEA I;  1K3R A;  3JAM L;  1JJ2 A;  2A6E D;  4B9X A;  1YNX A;  2DY7 A;  1S4Z A;  4I65 A;  4DR2 L;  5EPL A;  2X69 A;  5EBD A;  1NBW A;  4L8J A;  3KLW A;  1BBW A;  4FF2 A;  4RKL A;  1KXL A;  3GV3 A;  1TWG B;  5IWA Q;  2FJ2 A;  3R2T A;  1MD2 D;  1X6O A;  1MGS A;  3PQI A;  3HOU B;  3TEH B;  1J5E Q;  1I94 Q;  5IYB H;  4A3I B;  2NN6 I;  1GUO A;  5EQ0 A;  5BR8 L;  2F0F A;  1Y8O B;  1SJE D;  1STN A;  2EY6 A;  1X65 A;  2WAQ G;  3VR6 A;  1IYJ B;  1EQR A;  4C2M B;  4HJ7 A;  4PMW A;  3OIQ A;  1RJT A;  3G6J B;  1TY2 A;  2O2L D;  2NVX B;  4LF7 L;  1KHI A;  4AYB G;  2J4X A;  4KJN A;  5FK9 C;  3C3L A;  2XVS A;  4IUV A;  3RD4 A;  2MP1 A;  1T9H A;  2FHT A;  2QDL A;  4DUY L;  4XTC S;  4GNX C;  3H15 A;  3S15 B;  1VQE A;  3ER0 A;  5IT9 E;  4KKU A;  3M7N A;  4A4I A;  3HOY H;  4KHV A;  3A8J E;  2A8V A;  1Q82 C;  4RGN A;  1PH1 A;  4JW0 A;  4ZCK A;  4ZQ3 A;  4JVZ A;  1XMO L;  2DJG C;  4JOI A;  1E1T A;  3PUW A;  2L15 A;  3NXW A;  2K04 A;  4MHE A;  3GTJ B;  1JB3 A;  2M9V A;  3I4N G;  5D14 A;  4RGT A;  3JAM i;  1AH9 A;  4J15 A;  3V2T A;  3CPF A;  3E0E A;  1MSG A;  1A0I A;  1YHQ A;  3CP0 A;  3GTL H;  1C9O A;  2JA8 B;  3ERO A;  2VUM B;  4ZYS A;  1IZ6 A;  3I4N H;  1J9O A;  5GAD C;  2QEJ C;  1N33 L;  1KLU D;  2NVQ B;  4APV A;  4XQN A;  4GKK Q;  3FP9 A;  1QZG A;  4WJW A;  1MIU A;  5AJ3 Q;  3G6E A;  1HZ9 A;  2K5W A;  4B9W A;  4DF7 A;  4J8Q A;  2KA7 A;  4C3I B;  4IUR A;  3HOW B;  1E1O A; 
#chains in the Genus database with same CATH homology
 4KHZ A;  1HR0 W;  4GOP B;  1N36 Q;  4B3R Q;  4GS3 A;  1CKN A;  2VNU D;  2C35 B;  1NMG A;  4GKJ L;  1PYS B;  1HR0 L;  2AHO B;  2JK8 A;  4AIM A;  3CCV A;  1W3S A;  4X66 L;  2JA5 G;  1VQP A;  4DR4 Q;  4YHH Q;  4BBR H;  1NY4 A;  2EQS A;  4P75 A;  1TWH H;  1WOC A;  3DLL A;  2K5V A;  3MXN B;  2HQL A;  3PGZ A;  4RG1 A;  3UE0 A;  4DV7 L;  1IBK Q;  3HOZ H;  4BBS G;  3GTK H;  5GAG C;  1J6Q A;  3PV0 A;  1XMQ Q;  2RCN A;  5C4J H;  4X6A H;  3NEM A;  4LNQ A;  3HOW H;  2QEX A;  3OW2 A;  3CCU A;  1ASZ A;  2ZTC A;  4JYA Q;  5IYB G;  3FKI H;  3BU2 A;  4DR7 L;  3S1M H;  1VQG A;  1Q1E A;  2B63 G;  4YY3 Q;  1BKB A;  1L1O A;  3B6Y A;  3OTO Q;  1XTD A;  3PUY A;  3K0X A;  1JB7 A;  3HOV H;  4O0A A;  3UDG A;  4BBS H;  5C4X G;  1IBL Q;  1VQ8 A;  4IPH A;  4LFB Q;  1IBM L;  4X65 Q;  3S1N H;  1G6P A;  3J81 j;  3G4S A;  1EIF A;  3TS0 A;  1YIT A;  3RLF A;  3KYH C;  1K83 H;  3E9I A;  1YBY A;  1K9M C;  2K14 A;  3T1Y Q;  2UUA L;  4JI4 Q;  1YVC A;  1PH3 A;  5GQO A;  4MTN A;  2KCT A;  3RZD H;  3S1Q H;  2Z6K A;  1KQS A;  1FGU A;  3M4O H;  3TRZ A;  3J81 i;  5C4X H;  3F2D A;  4BXX G;  3WWV A;  3UDF A;  4GKK L;  4DV5 Q;  4GOP A;  5JEA G;  1UEB A;  1B8A A;  3J7A 5;  5IYC G;  4DV2 L;  3M4P A;  2EIF A;  2D0P A;  4JI8 L;  2I5L X;  1K73 C;  5AJ3 L;  1YJN A;  4FDB A;  3HOY G;  3CMA A;  4JV5 L;  4L5S A;  4PZ8 A;  4OO1 I;  2CFM A;  5C0X J;  4DNI A;  3K7A H;  3M4Q A;  1YHA A;  1Y14 B;  4JI2 Q;  2VQF Q;  2MO1 A;  3GTQ H;  4IOA A;  3CC7 A;  4A3J H;  4A3M H;  2V1C C;  1HNZ L;  1XNR Q;  3CD6 A;  4DV0 L;  2Q2T A;  1Q8K A;  2ASB A;  3A5Z B;  2BA0 A;  1SE8 A;  1R9T H;  3KF6 B;  1N36 L;  4B3R L;  4B3M Q;  2I5H A;  4X62 L;  3S1R H;  2CKZ B;  1VQI A;  3KJO A;  2R92 H;  1HJP A;  3TRE A;  1EIY B;  4HIM A;  1TWC H;  1I5F A;  4DR4 L;  2YTV A;  4YHH L;  1UE5 A;  4A93 H;  2AWO A;  3HKS A;  3RN5 A;  1OXU A;  1D7Q A;  1UE1 A;  5IYD H;  1IBK L;  4LFA Q;  3AFQ A;  3CF5 A;  1VQ7 A;  3A74 A;  1VQK A;  3T1H Q;  4PZ6 A;  1VS0 A;  2IX1 A;  4A3C H;  1VQJ A;  4B3T L;  3PO3 G;  3F1Z A;  4LF4 Q;  2UXC L;  3Q8D A;  4AQY Q;  2UU9 L;  1UE6 A;  5GAH C;  3I55 A;  1V43 A;  2UUC Q;  1X54 A;  2PMZ E;  4OO1 G;  4A3K G;  4JYA L;  2FXQ A;  2VQE Q;  4LF8 Q;  2IHE A;  2CCZ A;  3A0J A;  1Y1V H;  4EX5 A;  1YJW A;  2JA7 H;  2IY5 B;  4MZ9 A;  4YY3 L;  1PYB A;  3PF4 A;  3OTO L;  4DV1 Q;  2OQK A;  2N78 A;  4OX9 Q;  4GN5 A;  4YCV A;  4GLA C;  5C3E G;  4DR6 Q;  2K4K A;  1IBL L;  1H95 A;  2ZTD A;  4NB3 A;  1Y1W G;  4X65 L;  2WAQ E;  5E7N A;  5IP7 G;  1E3P A;  2VW9 A;  4JI0 Q;  2ZM6 Q;  3F2B A;  2HHH Q;  1JT8 A;  3T1Y L;  1O7I A;  1BVS A;  4JI4 L;  1P8L A;  3PUX A;  1PH5 A;  4IPC A;  1FVI A;  4DV3 Q;  4EQ5 A;  5JJI A;  2N3S A;  2OWO A;  1X56 A;  1JE5 A;  2RF4 A;  2ES2 A;  2YTX A;  4LW1 A;  1YIJ A;  2RHS B;  4DV5 L;  5LMN W;  5M5X H;  4BBR G;  4DV4 Q;  2JEB I;  3BZC A;  4DKA C;  4XIG S;  4DAY B;  4JCV E;  2DUD A;  1TWF H;  5IP7 H;  3CXC A;  2RHQ B;  1PH6 A;  2HT1 A;  3HOZ G;  4DV0 Q;  2Q2U A;  4LF5 Q;  1FJG Q;  2IHF A;  3M9B A;  1IL2 A;  3JC6 6;  4DR3 Q;  1N9W A;  4DV6 Q;  1HNW Q;  4JI2 L;  2VQF L;  1GO3 E;  4R4C A;  1N8R C;  4X62 Q;  3KF8 B;  3HOW G;  4IJL A;  4DR5 Q;  1VQF A;  3EBE A;  1MJE A;  1XNR L;  4YWM A;  3IRB A;  1Z47 A;  4NXM L;  2AKW B;  4JI1 Q;  4IOC A;  2VS1 A;  2E2H H;  1XNQ Q;  3FKI G;  2ZTE A;  3CCL A;  3F8T A;  4B3M L;  1SRU A;  3RN2 A;  2YTY A;  4HIO A;  1DGS A;  1VQM A;  3HFZ B;  2R7Z H;  3HOV G;  1GD7 A;  1X3G A;  1SLJ A;  3CAM A;  4JC0 A;  4QIW E;  3RLN A;  5C44 H;  3S2H H;  1UE7 A;  1VQO A;  5LMU L;  2BA1 A;  2GVB A;  3RNU A;  1K8A C;  1OXV A;  4UP8 A;  1MJC A;  4OON A;  3U50 C;  2E5L Q;  2UU9 Q;  4B3T Q;  2UXC Q;  1OXT A;  1JJG A;  1XPO A;  1PH9 A;  1L1O C;  3NBH B;  1N34 Q;  1RIP A;  2WB1 G;  4LFA L;  5DLQ E;  2R93 H;  4NPS A;  3L2P A;  3T1H L;  1QVG A;  2YYZ A;  1SR3 A;  1XPR A;  4LF4 L;  3CME A;  4AQY L;  1NMF A;  3CCM A;  2UUC L;  4A75 A;  3PIO A;  4YWK A;  2VQE L;  4LF8 L;  4DAM A;  1BBU A;  1I3Q H;  4UY8 C;  1CKO A;  1EFW A;  4DV1 L;  4OX9 L;  2WP8 J;  4DR6 L;  2ID0 A;  4QL5 A;  2Z6K C;  2F3I A;  2MFI A;  4BY1 G;  3ULP A;  3K81 C;  4IO9 A;  1S72 A;  1SRO A;  2ZJQ A;  3GTP H;  3KFU A;  4GNX B;  2B29 A;  4GOP C;  1P16 A;  3HOX H;  2PI2 E;  4A3J G;  4DR1 Q;  4A3M G;  4JI0 L;  4R4I A;  1QUQ B;  2ZM6 L;  1A62 A;  2HHH L;  4NXN Q;  1HZB A;  2CWP A;  2F4V L;  3GTO H;  4UP9 A;  4DV3 L;  4OWT B;  2JE6 I;  4DUZ Q;  4KHP Q;  1X3F A;  1QZH A;  4YWL A;  2BH8 A;  1VQN A;  1QVF A;  2R92 G;  3A5U A;  5HGQ A;  1EQQ A;  3H3V H;  1VQC A;  1S3O A;  2Y0S G;  4YCW A;  5IT9 c;  4R1J A;  3STB C;  4BY1 H;  1VQ5 A;  1VQ6 A;  1N32 Q;  2BH2 A;  3F2C A;  1HNX Q;  4R4O A;  3RZO H;  4A93 G;  4DV4 L;  4R4T A;  1KL9 A;  2Z0S A;  3S16 H;  5IYD G;  4DPG A;  4A3D H;  2QGQ A;  4LF5 L;  4NXM Q;  4P71 A;  4IJH A;  2KCM A;  1RL2 A;  1FJG L;  4A3C G;  4DR3 L;  1EOV A;  4LUV A;  2NZO A;  4DV6 L;  4OWW B;  1HNW L;  1K0R A;  2N49 A;  5IY0 A;  4X64 Q;  2HIV A;  4DR5 L;  2IT1 A;  4HIK A;  3EN2 A;  3PCO B;  4BA1 I;  4IFD I;  4JI1 L;  2KEN A;  4GLX A;  1XNQ L;  4L5Q A;  2KHJ A;  5JEA J;  5M3F H;  3D0F A;  3AYH B;  4LUZ A;  1X3E A;  5LMU Q;  1IXR A;  4QGU A;  1Y1V G;  5HY6 A;  1ASY A;  2JA7 G;  2DGY A;  2K75 A;  2GVA A;  1I50 H;  3KDF B;  3HOU H;  4POF A;  1PFS A;  3ULJ A;  2E2I H;  3G71 A;  3PIP A;  4BY7 H;  2E5L L;  3GDE A;  1Q7Y C;  2K5H A;  4KLK A;  3KJP A;  2UXD Q;  3MEF A;  1YJ9 A;  1N34 L;  3ULL A;  4A3E G;  3BJU A;  3UDX A;  1HH2 P;  1CKM A;  3K80 C;  1CUK A;  2R7D A;  4GNX A;  3CPW A;  2K5N A;  4B3S Q;  2ZJR A;  2JA6 G;  4R4Q A;  4JG2 A;  1AE2 A;  1QUQ A;  3GO5 A;  4OWX B;  4AH6 A;  2AWN A;  4JI5 Q;  1NTG A;  4JI6 Q;  1CKN B;  2ATW A;  1PH7 A;  4A3G G;  3HKZ E;  1CSQ A;  2CWA A;  4DK6 C;  1QVC A;  2XTI A;  2PNH A;  3W5O A;  4IFD G;  1HZC A;  4A3E H;  1VQD A;  3VDY A;  1PA6 A;  4DR2 Q;  1LYL A;  4IPG A;  3U4Z A;  2E2J H;  1S40 A;  3NEL A;  4OXP A;  1VQA A;  2B3G A;  1TXY A;  1Q81 C;  4QY7 A;  2F4V Q;  4A3B H;  2D62 A;  3CCS A;  4AYB E;  2JA6 H;  2NVT H;  4LF9 Q;  3I4M H;  2MQH A;  4DR1 L;  4NXN L;  1LTL A;  5M5W H;  1PHJ A;  4A3G H;  3L7Z C;  1C0A A;  3DM3 A;  3KF6 A;  4GN4 B;  4H02 A;  1OXS C;  4HJ8 A;  1VQH A;  4DUZ L;  1SMX A;  4KHP L;  4HJA A;  2OTL A;  2R7Z G;  5BR8 Q;  5GAE C;  1VQ9 A;  1N32 L;  5C44 G;  3GD7 A;  3GTJ H;  4JI7 Q;  1HNX L;  1VQL A;  1Q1B A;  1I94 L;  3PO3 H;  3I56 A;  4GLV B;  5GRO A;  4HID A;  2LXJ A;  3KDF A;  1WI5 A;  4QJF A;  2K52 A;  5FLM H;  1V9P A;  3UE1 A;  1LM0 A;  2R93 G;  3H3V I;  1YZ6 A;  3RR5 A;  2CQO A;  2OCE A;  4X64 L;  2YU9 H;  4LF7 Q;  5M3M G;  1K8G A;  1E24 A;  2UXB L;  2E8G A;  2HIX A;  4C3J H;  4JBM A;  2PQA B;  3CCJ A;  4P72 A;  1LUZ A;  4DUY Q;  2Q2H A;  2QA4 A;  2YV5 A;  4P74 A;  1FL0 A;  1PH2 A;  3S24 A;  1Q46 A;  1L2F A;  1PV4 A;  3PO2 H;  1KRS A;  3AQQ A;  4LWC A;  5C0X I;  2NVQ H;  3AEV A;  3S14 H;  3ZJY C;  3OYY A;  4Y52 H;  4BA2 I;  2UXD L;  1A63 A;  5M3M H;  4RMF A;  1GM5 A;  2N8N A;  1YHB A;  3LGJ A;  1YI2 A;  3HOX G;  5FJ8 H;  1EYG A;  1OTC A;  3NEN A;  2NZH A;  2H5X A;  3M3Y H;  5ELN A;  4MNO A;  4A3L H;  1XMO Q;  1M1K C;  1B7Y B;  4B3S L;  1NJI C;  3STB D;  1Z9F A;  4C3I H;  1D8L A;  4JI5 L;  2GN5 A;  4JI6 L;  1HZA A;  5J3B A;  3L0O A;  2JQO A;  1C7Y A;  1W2B A;  2UUB Q;  2JEA I;  1K3R A;  1KRT A;  1JJ2 A;  1WFQ A;  4TQU S;  1PVO A;  4LF6 Q;  2JA5 H;  2VZA A;  1YNX A;  1KIX A;  3CC2 A;  3D31 A;  3J80 c;  4DR2 L;  3PUZ A;  4TVA B;  4A3D G;  1NBW A;  1KAW A;  3KLW A;  2EXD A;  1BBW A;  1KXL A;  1VQB A;  3I2Z A;  4LFC L;  3CCE A;  5IWA Q;  3JAM c;  1YEZ A;  4LF9 L;  2K50 A;  4UP7 A;  5C0X G;  4K0K Q;  1X6O A;  4ALP A;  3PF5 A;  4GN3 B;  4YCU A;  5M3F G;  2PI2 A;  3TEH B;  1J5E Q;  4BY7 G;  1N33 Q;  1I94 Q;  5IYB H;  3W1B A;  4JBW A;  4JI3 L;  3PUV A;  4L5R C;  2LSS A;  5JJK A;  2NN6 I;  1A8V A;  5BR8 L;  3HOU G;  3FHW A;  2B63 H;  1EUJ A;  2PQA A;  2VY3 A;  4JI7 L;  3RLO A;  1V1Q A;  3HKZ G;  1JJC B;  5IP9 G;  2VL6 A;  1CSP A;  3AFP A;  4A3I G;  1X9N A;  3TS2 A;  2D0O A;  4HJ9 A;  1X65 A;  1I6H H;  2WAQ G;  1IYJ B;  1EQR A;  4HJ7 A;  4PMW A;  2UXB Q;  1GKH A;  1TWG H;  1Q12 A;  4JBJ A;  1E22 A;  2ZJP A;  1SFO H;  2MNA A;  2WB1 E;  2WFW A;  5LMN Q;  4LF7 L;  1KHI A;  4AYB G;  1Q86 C;  1MKH A;  2I5M X;  1KD1 C;  3I4O A;  1AE3 A;  4WJ4 A;  2NVY H;  2R7F A;  2IX0 A;  2F52 A;  3BZK A;  5EAY A;  4POG A;  1T9H A;  2A19 A;  4L5T A;  1NE3 A;  4A3I H;  5IP9 H;  1HR0 Q;  4DUY L;  4GNX C;  4XTC S;  3E9H A;  3H15 A;  3U4V A;  1G29 1;  4BXX H;  4WJ3 M;  4X66 Q;  2I0Q A;  1VQE A;  3ER0 A;  2LXK A;  4JBK A;  4QQB X;  5IYC H;  5K36 G;  4P73 A;  5FLX c;  1XJV A;  3M7N A;  4A4I A;  3HOY H;  3CW2 C;  4C2M H;  1WCM G;  2KHI A;  2XGT A;  3S2D H;  2JA9 A;  4DK3 C;  4A3B G;  4JOI C;  3KOJ A;  4DV7 Q;  2OQ0 A;  1WYD A;  2NN6 G;  2A8V A;  1U0L A;  1VCI A;  1Q82 C;  3GTG H;  3I4M G;  2KBN A;  2Q2I A;  3TQY A;  1EWI A;  2NVX H;  4KI0 A;  1PH1 A;  1UWV A;  3CQZ H;  2A1A A;  3EIV A;  3J80 i;  1XMO L;  4JOI A;  1E1T A;  3PUW A;  2L15 A;  1PH8 A;  3ICE A;  1L0W A;  3GTM H;  5ELO A;  1XMQ L;  1VQ4 A;  3I4N G;  4DR7 Q;  3CC4 A;  2JJQ A;  3S15 H;  3JAM i;  1OXX K;  3PSI A;  3CCR A;  2UUB L;  1AH9 A;  1WCM H;  3ERS X;  3H0G G;  4J15 A;  4C3H H;  1JMC A;  1WJJ A;  2Y0S E;  3CPF A;  3E0E A;  3I7F A;  5M5Y H;  1M90 C;  4LF6 L;  4LFC Q;  1A0I A;  1SN8 A;  4PZ7 A;  3UDI A;  5H1S E;  1PH4 A;  5JJL A;  1YHQ A;  3CP0 A;  2ALY B;  3GTL H;  5FLM G;  1IBM Q;  3W1G A;  3U58 A;  1GVP A;  1C9O A;  4O2D A;  4GKJ Q;  5IWA L;  2AMC B;  4Y7N H;  1IZ6 A;  3G48 A;  4ME3 A;  3M85 A;  4JI3 Q;  3I4N H;  2JA8 G;  4LFB L;  4K0K L;  2UUA Q;  2OTJ A;  1X55 A;  2VUM G;  5GAD C;  1L1O B;  3H0G H;  3S17 H;  1J5E L;  2R6G A;  1N33 L;  1G51 A;  4A3K H;  1TWA H;  4IFD J;  3SGI A;  4A3F G;  4APV A;  4PG3 A;  4LUO A;  4GKK Q;  4UPA A;  3FP9 A;  1E7Z A;  3PO2 G;  1QZG A;  4DV2 Q;  1B70 B;  4JI8 Q;  1MIU A;  3CCQ A;  5AJ3 Q;  3K8A A;  3K7U C;  4IPD A;  5C3E H;  3J7Z C;  4JV5 Q;  3G6E A;  1HZ9 A;  5IE8 A;  1Y1W H;  2JA8 H;  5FJ8 G;  1KC8 C;  3J81 c;  4HJ5 A;  2VUM H;  1XPU A;  5LMN L;  1HNZ Q;  4A3L G;  2MO0 A;  4A76 A;  1U5K A;  1E1O A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...