2GVBA

Refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna-binding (viral)
molecule keywords GENE V PROTEIN
total genus 5
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gvbA00
5ELNA 3AEVA 2IY5B 2VZAA 1JMCA 3UDGA 5E7NA 3SGIA 3GDEA 3T1HL 1IBMQ 1A0IA 4QY7A 4HIDA 3RLFA 4APVA 1N8RC 4L5QA 2JA7H 1EQQA 3RNUA 1KIXA 1Q1BA 2D0PA 2UU9L 4DR5L 1TWAH 3U4ZA 4X6AH 5IP9G 2N78A 4QL5A 1U0LA 1VQLA 4B3RL 4LFBL 4DV5L 4A76A 1V1QA 4EX5A 1HNZL 2VS1A 4JI7Q 4LF5Q 2HHHL 4NXNQ 1AH9A 4IPHA 3HOYG 1I3QH 1N9WA 4GOPA 4AQYL 1M90C 1KL9A 1GKHA 2NN6G 4IPCA 1KD1C 1JB7A 3KF8B 2QGQA 4A3EH 1VQAA 3CCEA 3J80c 2MQHA 2B63G 4DK6C 2E5LQ 3H3VI 3I4MH 4R4QA 4A3MH 1NJIC 3GTQH 2R93G 1PA6A 1TWHH 1G51A 1J5EQ 4H02A 5HGQA 1MJEA 1EFWA 3E9IA 1X56A 4MNOA 2Q2UA 1EQRA 1HR0W 3KDFB 4B3SQ 1HZBA 1XMOL 2UXCL 1TWCH 3PIPA 4JBKA 4BBSG 4IJHA 4PZ7A 4POFA 4NB3A 3G6EA 1I94L 1JE5A 3LGJA 3ULLA 1QZHA 4A3DH 4DR1Q 2IHEA 3PIOA 3KOJA 2E5LL 1QVCA 4Y7NH 4LFCL 2OCEA 1Q82C 1HR0Q 1WFQA 2ZTDA 1L0WA 2AWOA 2WFWA 4P74A 1LUZA 1WJJA 4DV5Q 3M4QA 1FJGL 1PVOA 2WB1G 4OWXB 3ERSX 3HOUH 4GOPC 2I0QA 2Z6KA 3KJPA 1SROA 4B3TQ 3TEHB 2RF4A 2N49A 3E9HA 4GNXA 1TXYA 1OXTA 1ASZA 2YYZA 4A3FG 3AFQA 3KYHC 3CXCA 4HJ7A 2R92G 3B6YA 3STBC 3CQZH 3OYYA 4DR5Q 1UWVA 2PQAB 1X54A 4FDBA 1FGUA 5JEAJ 3GTMH 3MXNB 2E2JH 4AIMA 4JI5Q 3RLNA 3T1YQ 4KHZA 3I4MG 4GKJQ 2KBNA 5C44G 4DUZQ 1IBLL 1XPUA 5C4XG 4HJ8A 5FJ8G 4A93H 5HY6A 4PG3A 5IYDH 3PUWA 4DUYQ 4GN5A 3KF6B 4EQ5A 2UUAL 2K75A 3OTOL 2OWOA 1YJNA 2JA9A 3BZKA 2RHSB 5LMNL 3U4VA 2VY3A 5C0XJ 4OO1I 4WJ3M 3PUXA 1HNXQ 2CKZB 2PQAA 1PH7A 4P72A 4GLXA 1A63A 4R4IA 1VQPA 1YI2A 1PH1A 2JA7G 2NZHA 4AYBG 5IYDG 1CSPA 4A3LG 2AKWB 3TS2A 4R4OA 4JV5L 3RZDH 1D8LA 3A74A 3JC66 3CCMA 1I94Q 4X66L 4JI4Q 1Z47A 2JJQA 1E1TA 2RHQB 3I56A 1VQNA 4DR3L 2VQFQ 1OTCA 1KAWA 3I55A 2MO0A 4LUOA 4JBMA 5M3FG 1EYGA 1YHBA 4KHPQ 1IXRA 3UDFA 5M5YH 3TQYA 1TWGH 4DUZL 5C3EG 3L7ZC 4RMFA 1IBLQ 4LW1A 4LF7Q 4DNIA 1MIUA 3FKIH 3UDXA 3CF5A 4IOCA 5C4XH 3K81C 4MTNA 4C2MH 4A3IG 4X66Q 4JI4L 2A1AA 4L5RC 3HOUG 5LMUQ 4DR7Q 5IP7H 1EUJA 3F8TA 2ID0A 5GAHC 4JI5L 3AQQA 3CCUA 4A3FH 1UE6A 4NXNL 2VW9A 2HHHQ 4A3JG 1XNRQ 4JV5Q 1LM0A 2FXQA 1PHJA 4LWCA 1RL2A 4TQUS 1EWIA 4LUZA 5JJKA 1B8AA 3CCQA 5GAGC 5M3MH 3JAMi 5M5WH 3D31A 4JI2L 4YY3L 1C9OA 5LMUL 2QEXA 1PH2A 4NXMQ 1CKOA 3PUYA 4JG2A 4L5TA 1GO3E 2JA6H 4LF9Q 3CAMA 1EIFA 4IPDA 4OWWB 3HOXG 4JBJA 4A3MG 4YCVA 1KRTA 4DR6L 4IFDJ 2JEBI 1OXXK 4TVAB 2VUMH 1XPOA 4LF8Q 4A3DG 4LF7L 4X65L 4JI3Q 5FLMG 1B7YB 3FP9A 1YITA 4BBSH 1VQKA 1E3PA 2JQOA 1SMXA 2ES2A 4LF4Q 1PFSA 1LTLA 3CC4A 5IE8A 3PGZA 3OW2A 3S1MH 4GKKL 4YY3Q 1UE5A 4JBWA 4BY7H 4NPSA 2JA5H 4X62Q 2IT1A 2L15A 2Z0SA 3ER0A 1VQ6A 3WWVA 1XMQQ 1VQ5A 4DV6Q 2B63H 4A3EG 4LF6L 1XNRL 5ELOA 4AYBE 1Z9FA 4YCWA 1JT8A 2WAQG 3U58A 3HOYH 5C0XG 2PMZE 2F3IA 4XIGS 1Q8KA 1SE8A 3CP0A 3ICEA 1S40A 4PZ8A 3PSIA 4DR7L 2CFMA 2AMCB 2Q2HA 4GLVB 3CCVA 3PV0A 1HJPA 3GTOH 5K36G 1SN8A 4QJFA 2UXDQ 1XJVA 4JI3L 4X65Q 1NE3A 4MZ9A 3CCRA 1E7ZA 4OWTB 4A3GG 3PO2G 4IOAA 2K5NA 4GS3A 2UXBL 1N33L 3KJOA 2QA4A 4B3TL 3M4PA 2K50A 1L1OA 1X6OA 3GTLH 3HOZG 2VNUD 3M85A 4WJ4A 4DPGA 3S14H 4O0AA 1NMFA 2KCTA 1PH4A 1I5FA 2CWAA 2UU9Q 1PH3A 1I50H 4LF5L 4GNXB 1IYJB 1L1OB 1W2BA 2LXJA 1RIPA 2K5VA 2NVYH 4DV0L 2A8VA 3S2DH 1NTGA 2AWNA 4GKKQ 1K8GA 5IYCH 4YWMA 4BBRH 1L1OC 5FLXc 3EN2A 1H95A 1AE3A 2R92H 2K5HA 3I4OA 1ASYA 1E22A 2I5HA 1N34Q 2GVBA 2GN5A 3G71A 1KHIA 4LFBQ 4JI1Q 4DV3L 3PO3G 1BKBA 3HOVG 1SRUA 2UXCQ 4JYAQ 2NZOA 2JEAI 2JA5G 4R4TA 2UXBQ 5IWAQ 3W5OA 3A5UA 4JI0L 3BZCA 4DR2L 1A8VA 1VQEA 3NELA 1WCMG 2PI2E 2OQ0A 2CCZA 1O7IA 5FLMH 1KC8C 1SFOH 1NBWA 2YTYA 1QUQB 4LFAQ 3K7AH 4L5SA 1VQIA 1NMGA 1VQHA 1IBKL 4HIKA 4X64L 3CD6A 2R7DA 4BY1G 2KENA 3S16H 3TRZA 2KHIA 2LXKA 1VQCA 3CCSA 5J3BA 1UE1A 4AQYQ 4RG1A 2CQOA 2F52A 2V1CC 3UE0A 2N3SA 5M3MG 1Y14B 3RN5A 4BY1H 1IL2A 2RCNA 1MJCA 1W3SA 4UP8A 1VQJA 3PF5A 4JC0A 1J5EL 2EIFA 4LF8L 1J6QA 2N8NA 5LMNW 2EXDA 1XMOQ 2HT1A 4YWKA 2JA8H 3DLLA 1Q86C 3BJUA 4IO9A 1UEBA 1WYDA 2Z6KC 1HZCA 2VQEQ 3FKIG 4NXML 2ZM6Q 2NVQH 4DAMA 4DV1Q 2UUBQ 4DR6Q 4P73A 3ZJYC 4LUVA 1IBKQ 2AHOB 1WOCA 2WB1E 1U5KA 3J7ZC 1Q1EA 4JCVE 4JOIC 1HNZQ 1YVCA 2VL6A 3J80i 3GTPH 3GTJH 1Q12A 4DV2L 3L0OA 1KQSA 3RZOH 4K0KQ 4JI6L 2YTVA 1X3GA 2PI2A 3UDIA 3S17H 1VQ7A 1Q81C 1VQGA 1K83H 2B29A 4HJ9A 2ALYB 2CWPA 4UY8C 2UUAQ 3GTKH 3HOWH 3J81c 1X55A 2MO1A 5IY0A 4A3LH 4UPAA 4B3RQ 4DV7L 4BA1I 4GN3B 4JI8L 2MFIA 4ALPA 3T1YL 1S72A 1QVFA 3HOWG 1SLJA 1VQFA 3K7UC 3UE1A 4B3SL 2R7ZH 4AH6A 4A3BG 4GKJL 1YHQA 3F1ZA 1YBYA 2I5LX 2XGTA 1GD7A 2DUDA 3EIVA 4DAYB 2Y0SG 3PF4A 2D0OA 1M1KC 1OXUA 5FJ8H 4A93G 4DR3Q 4YHHL 5C44H 2PNHA 1CKNA 3BU2A 4ME3A 4QGUA 3H15A 1HNXL 4J15A 3M3YH 2ZTCA 3L2PA 1N36L 2HIXA 3JAMc 2B3GA 2BH8A 4DV4Q 4IPGA 3H0GH 4HJ5A 4BY7G 1XNQL 2D62A 4K0KL 2IHFA 3HKZE 3Q8DA 2XTIA 3TREA 1HH2P 4DR1L 3CCLA 3STBD 4A3KH 4R1JA 1YJ9A 1N33Q 1YHAA 1HZ9A 3W1BA 1P16A 2ASBA 2ZM6L 2MNAA 1QVGA 3S2HH 4YHHQ 5GROA 5M5XH 4JI8Q 4BXXG 1CKNB 4JI1L 4DV3Q 2K52A 3G48A 1CSQA 5DLQE 1I6HH 3D0FA 1WCMH 3DM3A 3J81i 3S1RH 3CMAA 1KRSA 3HFZB 5IWAL 1XPRA 4OXPA 3MEFA 3KFUA 4R4CA 3CW2C 3F2BA 1Q46A 1S3OA 5AJ3Q 1VQOA 4HIMA 4Y52H 3FHWA 4BXXH 4IFDI 1TWFH 4B3ML 5H1SE 3NBHB 3HKZG 1N36Q 3CMEA 2JE6I 1T9HA 4X64Q 4DV6L 1BBUA 1B70B 1JJCB 1Y1VH 4A3CH 4C3HH 4DV4L 2YTXA 2OQKA 4A3KG 2E8GA 1HNWL 1V43A 1D7QA 1FL0A 2R93H 3NEMA 4JOIA 1CUKA 3NENA 1PH9A 3T1HQ 5BR8Q 2R7ZG 3OTOQ 3A0JA 5IYBH 4LF4L 4DR2Q 2R7FA 2IX1A 3GO5A 3CC7A 3KDFA 5LMNQ 1R9TH 4A3JH 2R6GA 2NVXH 3M7NA 1C0AA 1KXLA 4GLAC 3RLOA 3I4NH 1VQ9A 3K80C 3G4SA 3GD7A 3S15H 4BA2I 4POGA 1BBWA 1IZ6A 1FVIA 3CPWA 3PUZA 3J7A5 1DGSA 2ZJPA 1E1OA 3ULJA 1K8AC 3S1NH 4YCUA 1JJGA 2Y0SE 1OXSC 3PUVA 4PZ6A 1Y1WG 4HIOA 1C7YA 2VQFL 4A3BH 1VQBA 4GNXC 3E0EA 5C3EH 2YV5A 1YNXA 3PCOB 3F2CA 4P71A 4C3JH 1Y1WH 1XTDA 3F2DA 4A75A 1NY4A 3I2ZA 1YZ6A 4DV2Q 2GVAA 2WAQE 2UUCQ 4JI7L 1EIYB 1K73C 2YU9H 5JJIA 3IRBA 4KI0A 2KCMA 1K3RA 1P8LA 3K0XA 1BVSA 1VQ4A 3H3VH 1MKHA 3PO2H 5AJ3L 1A62A 3I4NG 1VQDA 3S1QH 1L2FA 3AYHB 1HR0L 2I5MX 1E24A 1X3EA 2WP8J 5C0XI 4DV7Q 1QUQA 2A19A 2ZJQA 2NVTH 5IYBG 1YJWA 3M9BA 1N34L 2K14A 4XTCS 1EOVA 3I7FA 3TS0A 4JYAL 1N32Q 4OO1G 1YIJA 4JI6Q 4A3CG 1Y1VG 4JI2Q 4DV0Q 1SR3A 4HJAA 4LNQA 2JA8G 5C4JH 2VUMG 4OX9Q 1K0RA 1PH6A 3CC2A 2H5XA 2C35B 3EBEA 5GAEC 1JJ2A 2BA1A 1XMQL 4LFAL 2Q2TA 1Q7YC 1FJGQ 4LF6Q 2UUCL 2HIVA 2JA6G 4O2DA 1GVPA 3KF6A 1XNQQ 1UE7A 1PYBA 3HKSA 2BH2A 1N32L 5JJLA 3U50C 4DUYL 3HOVH 4JI0Q 4DR4L 1QZGA 1IBML 2OTJA 2F4VL 2K4KA 4X62L 4A4IA 4LF9L 4IJLA 1V9PA 4QQBX 3HOXH 3J81j 2E2IH 4BBRG 2ZTEA 5IYCG 3RN2A 5IP7G 1PH8A 1G6PA 1PYSB 2KHJA 4KLKA 3RR5A 2HQLA 1X65A 3H0GG 4A3IH 1VQMA 1PV4A 4UP7A 1PH5A 2JK8A 4DKAC 4YWLA 4P75A 3K8AA 1K9MC 2EQSA 4DR4Q 2ZJRA 3PO3H 3ULPA 1YEZA 2DGYA 2F4VQ 3CPFA 4B3MQ 5EAYA 1X9NA 2UUBL 2ATWA 5IP9H 1GM5A 5IT9c 2IX0A 1HNWQ 3HOZH 3A5ZB 1LYLA 1CKMA 1OXVA 2E2HH 1AE2A 5JEAG 4A3GH 3KLWA 2Q2IA 5BR8L 4QIWE 4IFDG 2BA0A 3VDYA 4OX9L 2NN6I 2LSSA 1HZAA 4PMWA 1VCIA 5GADC 2VQEL 4LFCQ 2OTLA 3W1GA 4DK3C 3CCJA 3GTGH 5M3FH 4OONA 4DV1L 2UXDL 4GN4B 3S24A 4C3IH 1G291 1VS0A 4KHPL 3M4OH 1WI5A 4UP9A 4GOPB 1X3FA 3AFPA 1VQ8A 5GQOA
chains in the Genus database with same CATH superfamily
4K2KA 3UDGA 1DJRD 1MBYA 3WDNA 4WRDA 1IBMQ 4G7HC 3MC0B 1EQQA 5ELFA 1HTPA 1V1OA 2D0PA 2UU9L 1U0LA 4LFBL 4RGTA 4DV5L 2A73B 3AU7A 4DXGA 4GOPA 4AQYL 1KL9A 1V1PB 4KY5A 2BCOA 4HR7B 3I4MH 2GA4B 4A3MH 2BE5C 4E6IA 1G51A 3UI2A 1EFWA 3E9IA 1ML0D 1EQRA 1HR0W 3KDFB 4CJ0B 5IGDA 4L63B 3OWFA 1DOKA 4A3DH 4DR1Q 1PRTB 1Y8PB 1VF7A 4LFCL 1HR0Q 1H9SB 1L0WA 1LUZA 4XT3B 2LY7A 5ELBA 3ONAB 4CJ1B 4GOPC 1DD2A 2F0MA 3M4OB 4B3TQ 1E2WA 1WTXA 2A69D 4A3FG 3CXCA 1TWFB 2R92G 4RKLA 3B6YA 3CQZH 1MSGA 3OYYA 5JEAJ 1X54A 3GTMH 3T1YQ 2O5JC 4DUZQ 2K01A 2E2HB 4J8QA 5C4XG 3HOWB 1NNXA 5IYDH 5KNCA 3OTOL 2JA9A 2E2DC 3NP8A 3PUXA 3FVQA 4P72A 1LTSD 1YI2A 1PH1A 2NZHA 5IYDG 4DAPA 1CK1A 2QF7A 4JV5L 1VMCA 3JC66 2RHQB 1E1TA 1VQNA 4LUOA 1YHBA 4KHPQ 1IXRA 5M5YH 4N9TA 3PO3B 3D4WA 5C3EG 4QMGA 3I3CA 2D2CC 3FKIH 4IFDH 4MTNA 2HCIA 3HOUB 4C2MH 4X66Q 2F0UA 5JVH3 3I70A 1B50A 3W2DA 2ID0A 3SEBA 4CDFC 3V2TA 1EOTA 1HQMC 4JI5L 2E76C 1E0BA 3URYA 2VW9A 1BQQT 3SK4A 1AEXA 1PTOC 1RL2A 3J80E 5GAGC 2WKCA 1CKOA 3PUYA 4LF9Q 1AZQA 4JBJA 4A3MG 2JEBI 4ODGA 5FLXE 1DOLA 3MEHA 1BBXC 2D5DA 2DY8A 4LJZC 1XPOA 2VUMH 4LF8Q 1LT6D 2A6HC 1EEFD 2FINB 5FLMG 1RKNA 3FP9A 2L9HA 1ENCA 3E6ZX 3J7YW 1SMXA 1ET6A 4LF4Q 3S1MH 1SNDA 3PGZA 2KEDA 1Q3LA 4OIJA 5CORA 5EPJA 2L15A 2F0KA 1VQ6A 3WWVA 2XVSA 1XMQQ 1GUSA 4LF6L 1PMRA 1QWYA 1S5CD 5ELOA 3OMCA 4DK1A 1AZPA 3HOYH 2PMZE 3Q0AA 1SYCA 1KABA 1Q8KA 1SE8A 4XYQA 3ICEA 1S40A 1Y8NB 2PZWA 2Q2HA 3PV0A 5DEHA 2J4XA 1HFGA 5KNBA 1EYCA 1QG7A 2B2YA 1SN8A 2UXDQ 1JWUD 2KHSA 4MZ9A 4A3GB 3K5LA 3KJOA 1X6OA 4RCNA 4DPGA 4O0AA 1PDQA 1BCPC 4H13C 1LABA 4Z9CB 5FKAC 2F4IA 3DM1A 1IYJB 3I91A 5C44B 3S2DH 1G2SA 1NTGA 2AWNA 4MN3A 2EZVA 4GKKQ 1LTID 5FLXc 2QKIC 4L6TB 1A3TA 3I4OA 1LT5D 1BKBA 3GQBA 4R4TA 3R3OA 3A5UA 4JI0L 2TSSA 3NSWA 3N52A 4DR2L 2JXMB 3GTMB 3PMFA 3DEOA 4M1UB 3JAME 2NTSA 2YTYA 4F88A 2EYFA 3K7AH 4L5SA 2EJFC 3CD6A 1BOSA 2DJGC 3S16H 3TRZA 1ENAA 2KHIA 5J3BA 2CQOA 1I4RA 2N3SA 2EYMA 1B3AA 1TU2B 3RN5A 1CA5A 5HGTA 3HGBA 1NR4A 1VQJA 2A6EC 2G5DA 4JC0A 1YNJD 3MTSA 1XMOQ 4YWKA 2YU9B 4FF3A 3EVQA 4X3TA 4MTKA 2AQ1B 1RODA 2Z9HA 2NVQH 4DR6Q 1HFNA 4HSPA 4G7ZC 1HNZQ 1YVCA 2VL6A 1G6ZA 1TWGB 4DV2L 2WAQB 3L0OA 4RAUC 3RZOH 4JI6L 1STAA 1LTRD 3QB3A 3UDIA 1VQGA 3PIO3 1K83H 3U9OA 4UY8C 2UUAQ 3GTKH 3HOWH 5CYUA 1X55A 1I50B 4BA1I 4JI8L 3R2IA 3HOWG 4A3BG 4Q0FA 2C5CA 4X3UA 1SXTA 3KK7A 1K83B 2DUDA 3A7AB 2JYOA 1Y1VB 5DM63 3PF4A 1Y8OB 4BWGB 1EY9A 1AP0A 5FJ8H 1F9SA 3NQTA 4A93G 5C44H 1CKNA 2KEEA 3BVZA 3ERQA 2F0EA 4BY1B 3M3YH 3L3OC 1N36L 4ZKBB 1HUMA 1ZYRC 2KOLA 2B3GA 4UDUC 4RFBA 4DV4Q 4U68A 2D62A 2IHFA 3HRZC 3TREA 1HH2P 5C0XH 1YJ9A 2HUGA 1P16A 3KBXA 3C3LA 2A69C 2HD3A 5GROA 2A74C 2KCCA 3MXNA 5M5XH 4JI1L 4DV3Q 3G48A 5DLQE 5EKIA 1I6HH 4O42A 3KFUA 1B44D 1ZKOA 5CV5A 4QUFA 3CW2C 1Q46A 3D4DA 2Q8TA 2ZXRA 1SE2A 2EYJA 2F0LA 2QDLA 4B3ML 4K6LA 2VUMB 1EQTA 1HNWL 5C5LA 4JOIA 2R7ZB 3NENA 4A3BB 1YNND 3A8JE 3OTOQ 4DR2Q 4CDCC 3GO5A 5LMNQ 3M7NA 2R6GA 1RDPD 1KXLA 4GLAC 3RLOA 3I4NH 1D5XC 1SAPA 1PRTF 3G4SA 3HZXA 3BZDB 3CPWA 3PUZA 1DGSA 1E1OA 3ULJA 3S1NH 1FD7D 4IALA 2L55A 4N9PA 5CBAE 2Y0SE 3DWPA 4PZ6A 1Y1WG 4A3BH 3BG3A 1TWHB 1UAPA 5NUCA 4QUCA 5C3EH 3F2CA 4C3JH 1M8AA 3NXWA 4UAIA 4DV2Q 4FF1A 1EIYB 2C9OA 4BS9A 3PO2H 3HKZB 3H3VH 1MKHA 2EJGC 3S9WA 1TY0A 1L2FA 1O80A 5C0XI 2EYPA 2WP8J 2BDOA 2A19A 3D4RA 4XTCS 5CV8A 1EOVA 3TS0A 4RKBA 5L37A 4MHEA 4JYAL 1N32Q 3MAQA 4JI6Q 1EY6A 1JOKA 4HJAA 3D6CA 3K57A 5FK9C 5IGGA 1YNJC 1K0RA 2H5XA 4HEDA 3EJIA 1F2YA 2JA6G 3KF6A 1UE7A 4KV6A 1B9NA 3J81L 1PYBA 4BY7B 5E4WC 5IODA 1Y69U 1LT3D 3HOVH 2K04A 2IPKD 4JPBW 4DR4L 1QZGA 3HP3A 1IBML 2F4VL 3QO2A 2K1BA 4IJLA 5F2DA 1V9PA 1DZ1A 1U4RA 1D6EC 4IUPA 1Y1WB 1HUNA 1QNUA 2G9HD 1I4GA 2KHJA 4KLKA 3OMGA 4A3IH 1LLRD 3GTKB 1HHVA 3CQZB 2JK8A 3FRPB 4P75A 2ZJRA 3QWNA 2ICEC 3NQIA 2EDGA 2ENBA 3EA6A 2UUBL 5CV4A 1GM5A 5A35A 3J7AV 1HNWQ 3K5OA 1B2TA 3HOZH 2O2LD 1OXVA 2NWGA 2BOSA 4PMCA 3KLWA 2Q2IA 3QR8A 4IFDG 1MGSA 1HZAA 5GADC 1D2BA 2OTLA 3TN2A 1G291 3IKJA 4MIUA 2ICIA 2H1EA 1IKLA 1GUOA 1CZGA 1F9PA 3D8GA 4K6DA 4EGVA 5E7NA 4PQXA 3GDEA 4QY7A 4HIDA 3RLFA 1Q1BA 5IGEA 1A3VA 5IP9G 2F0NA 3FDTA 3SDZA 4EX5A 2JA8B 4LF5Q 5EJWA 1JQYD 3T56B 1JB7A 1KD1C 4H0LC 2QGQA 4A3EH 2MQHA 4DK6C 4R4QA 2J7ZA 1EIHA 1TWHH 1J5EQ 4H02A 1MJEA 3I8ZA 1X56A 2B8FA 1S5FD 4JBKA 1U9RA 5EBCA 3E3XA 2OT2A 2F0HA 2AUJD 1JE5A 5AFWA 3ULLA 1SJED 3R2TA 3PIOA 1R9TB 1Q82C 1CI3M 1QE6A 3MXGA 2AWOA 1FJGL 1WJJA 3M4QA 3MZ5A 1ESRA 4FXGC 2WB1G 2A68C 2K5WA 4HN7A 4RA8A 3CHBD 2I0QA 1CTMA 4B08A 4GNXA 1OXTA 3VYRA 3AFQA 3KYHC 1O78A 4FDBA 1UWVA 2L11A 2PQAB 3MXNB 2E2JH 3EROA 4IUNA 5E3FA 3RLNA 4KHZA 2KBNA 5C44G 4HJ8A 5FJ8G 4HAEA 4A93H 4PG3A 2RBMA 3PUWA 5IOCA 4OO1H 3KF6B 4EQ5A 1I3QB 2OWOA 1BCPB 3ITPA 3BZKA 5C0XJ 3FPPA 1HNXQ 4QCLA 1A63A 3OHXC 4R4IA 2EYOA 4V190 3SXHA 4R4OA 4XT1B 3RZDH 4KJNA 3A74A 3I90A 1FGBD 3CCMA 1I94Q 1VF5C 2FJ2A 1Z47A 3I56A 2VQFQ 4R8IA 1OTCA 3I55A 3K58A 5I9OA 4JBMA 2EVBA 5M3FG 3H3VC 4DUZL 3GTJB 3K0YA 2I46A 5M9OA 2KJXA 1IYUA 1PFNA 4A3IG 5M3MB 5CGKA 4L5RC 4DR7Q 1OO9B 4A3FH 1XNRQ 2FXQA 1GXDC 1A3UA 4ZUIA 4TQUS 1EWIA 2M2LA 1B8AA 2CW0D 4H7BA 3JAMi 4LMQD 3GP7A 4JI2L 3BDOA 5LMUL 4L5TA 4JG2A 2JA6H 4UHVA 4C3HG 1EIFA 4IPDA 1BNZA 3L9AX 1KRTA 3NTKA 2Q8RE 1HRJA 2IW3A 1W6KA 1FYCA 1L0YB 3MWYW 1B7YB 3HOYB 4BBSH 2RDFA 1E3PA 2QEJC 2A68D 4A3JB 1PFSA 3CC4A 4GKKL 4R8NA 1UE5A 4H44C 4JBWA 2NUCA 2PQEA 4NPSA 2JA5H 4X62Q 1STGA 3ER0A 4F87A 4B9WA 4DV6Q 2B63H 3MFYA 2K32A 2NB0A 3A55A 1SNMA 2WAQG 1GUNA 4K5WA 1QNKA 2F3IA 5IGBA 1DOMA 2FMCA 4PZ8A 3PSIA 3GTLB 3OW7A 1F9RA 5C3EB 5K36G 2LKVA 4CDEC 1NE3A 4OWTB 2PMZB 2B2VC 2K5NA 4GS3A 5FO7B 3HOZB 1JWSD 3LX0A 4WJ4A 2B2WA 5KGUA 1NMFA 1I5FA 5ELEA 4A93B 3IFTA 4ZAIA 2RCFA 1XXGA 4LF5L 2E74C 2JSOA 2K5VA 1EY5A 3RD4A 5IYCH 1BCPD 2O4XA 3EN2A 2R92H 2K5HA 1ASYA 1QJOA 4NW2A 4LFBQ 1F2LA 3P20A 1G8ZD 3HOVG 3VA7A 4XQNA 2NZOA 2JEAI 4XDXA 3QIAA 3W5OA 3BZCA 1SYEA 1STNA 3NELA 3S1QB 2EPBA 1O7IA 2KCNA 5FLMH 2CCZA 3MXUA 2DY7A 1QUQB 4PV1C 3OSOA 4LFAQ 4X64L 1LT4D 1HQRD 2R7DA 1B53A 2KENA 2FFKB 2LXKA 3CCSA 2RVLA 4NP5A 5BN4A 1JB3A 1C48A 4RG1A 2F52A 2V1CC 3E0JA 5T1GA 1D1IA 3H09A 4ZLTF 1IL2A 4UP8A 4XYOA 4OHJA 1ZXTA 1DM0B 3IFDA 2EIFA 2L12A 2A6HD 3SK6A 4RHRA 2Z6KC 5EPLA 3FKIG 3Q6SA 2KQ3A 1WOCA 2WB1E 1EU4A 1C8CA 3AMUA 2VB3X 1X3GA 4KTAA 1GUWA 5LL6S 2B29A 2CWPA 1Z7TA 4A3LH 4UPAA 4DV7L 2MFIA 1S5BD 2F0FA 5CC4A 2R7ZH 4AH6A 1YHQA 2CHBD 4O1NA 2I5LX 2AUKA 1GD7A 3DXJC 2EY1A 2K03A 1BUVT 1M1KC 4DR3Q 3SK5A 4ULLA 2NYZD 2WACA 4RHSA 5KNDA 1HNXL 2D9UA 1GHKA 3L2PA 2L5TA 4IPGA 3H0GH 4BY7G 2F0QA 4KN7C 1QCBD 5CR3A 3CCLA 1KDAA 4R1JA 1UUPA 4FXKC 1N33Q 3W1BA 1KLUD 4JI8Q 2F3VA 1CKNB 5G3LF 3GTPB 1CSQA 1SNOA 2F0JA 1GUTA 1WCMH 3HG9A 1EWCA 4G57A 3HFZB 5IWAL 1XPRA 4OXPA 4WFN3 4G4KA 1SE4A 4RCOA 1E2ZA 5AJ3Q 5C4HA 2LFNA 3NBHB 5IT9L 1E2VA 1B70B 5FO8B 1JJCB 1TR5A 1V1PA 4C3HH 2YTXA 2OQKA 4DV4L 2E8GA 4A3KG 3TP8A 1IW7C 3G6JB 3PIP3 3NEMA 2MUYA 2Z4IA 3N6RA 3BDLA 5BR8Q 4HMJA 3A0JA 5IYBH 2IX1A 3QOJA 3CC7A 3KDFA 4A3JH 5DNFA 1PYWD 5JJZA 4A3FB 3K80C 3D6WA 3T13A 1BO0A 3S15H 3J7A5 1SSOA 4CGYB 4M8AA 1ILQA 1OXSC 1ZYRD 3PUVA 2EJMA 2VQFL 4FO2A 1YNXA 1STHA 3I4MB 3A7LA 5COYA 1KDCA 1XTDA 1SYDA 4A75A 2GVAA 2WAQE 2QCPX 4JI7L 4C3IB 2YU9H 1D1KA 3KLSX 4KI0A 1K3RA 1P8LA 1GHJA 3K0XA 1VQ4A 4TKOB 3C2PA 1KNAA 3T51B 2I5MX 1E24A 1X3EA 5C4XB 4AYBB 2ZJQA 1QUQA 5EQ0A 1BR9A 3FPUB 2B2VA 2B39A 2WV6D 2G9DA 4TRDA 1JICA 3SR1A 5DM73 1PRTC 4A3CG 3G7LA 4JI2Q 4A3KB 2JA8G 5C4JH 4ZCKA 2VUMG 1NAPA 1PH6A 3CC2A 1JJ2A 2C35B 3S2DB 2BA1A 4LFAL 3NBHA 1X3PA 2XWBB 2UUCL 2HIVA 4O2DA 2RDHA 4I65A 5FLXL 5A2QE 3HKSA 3U50C 1LTTD 5I6YA 3LWEA 2XNAC 4X62L 4LF9L 2E2IH 3NPPA 2J0TD 4K8JA 1PH8A 3H0GG 1VQMA 1JE4A 4UP7A 1PH5A 4DKAC 4YWLA 1K9MC 1EWHA 1HPCA 3HOXB 3ULPA 3PO2B 2DGYA 3KUPA 3S15B 4EQNA 2XIWA 2RDGA 2CH4W 1X9NA 2ATWA 5I9PA 5IT9c 1CQVA 1M4VA 1DXMA 4XQJA 1LYLA 1CKMA 2E2HH 1AE2A 1EZ8A 2B2UA 1V8QA 1WCMB 3NTIA 1WVLA 2NBFA 4OX9L 5EBDA 1TQOA 2LSSA 2SNSA 3J81E 4OONA 5M3FH 4GN4B 5EKKA 1VDZA 1X3FA 3AFPA 2PCFB 4DFAA 1VQ8A 5GQOA 5ELNA 3AEVA 1NCVA 3SGIA 3RZDB 4FVMA 2B2UC 1RJTA 2LMCB 1FNWA 3A54A 2EYHA 1RCVD 3W3AA 4APVA 4C1NI 3RNUA 2JA7H 3MFGA 4DR5L 1TWAH 4X6AH 1CFMA 1MSHA 2FHTA 2N78A 4LAAA 4QL5A 4B3RL 1C4QA 4A76A 1V1QA 3D3RA 1TT2A 4JI7Q 1AH9A 2HHHL 1STYA 4NXNQ 4N8FA 1I3QH 1N9WA 3I4NB 1M90C 4IPCA 3M4YA 3TZUA 4IUVA 2B63G 2R93G 2E5LQ 2NVQB 3MVVA 5CMDA 1NJIC 3QOLA 1PA6A 5HGQA 5IGCA 3OIPA 4B3SQ 1HZBA 1XMOL 5JVG3 2UXCL 3K7AB 1RD9D 3PQIA 3VR2A 3PIPA 4BBSG 4IJHA 1EEID 4PZ7A 4POFA 3G6EA 1I94L 3LGJA 2AQ2B 5LL6X 2RKSA 2E5LL 4Y7NH 3OPOA 2NVXB 3VR4A 1WFQA 2WFWA 4P74A 5CV6A 1QILA 2OF1A 4KKTA 3TBIB 3HOUH 4OWXB 3ERSX 1IW7D 2Z6KA 1LTGD 3KJPA 2RF4A 3E9HA 5EKLA 1TXYA 1EQVA 1S5DD 3E5SA 3U9SA 3STBC 3C46A 1TS2A 4RGOS 3WOEA 1IBLL 5JPMC 1TS4A 2HCCA 1I6VC 2B2TC 4DUYQ 2K75A 5LMNL 3U4VA 2R61A 4WJ3M 2CKZB 2PQAA 2QDBA 1VQPA 2Z6BA 3SE0A 1CSPA 1PZKD 2PPBC 4A3LG 3TS2A 1G91A 4DAYA 4RH6A 1EZ6A 2NZ1D 2EY2A 2IJ0A 4X66L 3BYYB 4DR3L 1KAWA 4BBSB 4C3IG 1ET9A 2MO0A 5C6AA 5G3LD 1EYGA 4PNYA 3QJYA 4C3JG 3IAYA 3Q24A 3UDFA 4EVOA 1TWGH 4DNIA 1MIUA 5JPNC 3C1EA 3CF5A 1X3QA 3K81C 4DU9A 1HA5A 3HOUG 4A3MB 2F0OA 5IP7H 4DN4M 5GAHC 4IURA 1QB5D 3SK8A 1BDOA 1UE6A 4NXNL 2HHHQ 1WD0A 4LWCA 1TWAB 2K6AA 5M3MH 5M5WH 3D31A 1EL0A 1C9OA 4IZ8A 2QEXA 4NXMQ 2SEBD 1GO3E 1X32A 3CAMA 4DR6L 1JC7A 4IFDJ 4YCVA 3BVMA 1MI2A 4TVAB 1EYAA 4LF7L 4N8X1 1YITA 4HSVA 1VQKA 2JQOA 2XRQD 2F0IA 2ES2A 3P7JA 1LTLA 3A8IE 5IE8A 3OW2A 2EY6A 3VA5A 4BY7H 3KLRA 1WTWA 4EQPA 3FKIB 4A3EG 3OIQA 1XNRL 2F1MA 5T1IA 1JT8A 3I72A 3U58A 3MXPA 5C0XG 4XIGS 1H9KA 4ILWA 4DR7L 1U4MA 2CFMA 1KTKA 3TDQA 3GTOH 4YIJA 1UNSA 1XJVA 4JI3L 4C1NK 5IGFA 4X65Q 4A3GG 3PO2G 4C3HB 4B3TL 2K05A 2K50A 1L1OA 2F0SA 2VNUD 3M85A 3S14H 2R92B 2CWAA 2UU9Q 1B9MA 1I50H 1CZWA 3NTHA 1L1OB 4GNXB 1W2BA 2LXJA 5ELCA 1RIPA 2NVYH 4DV0L 4IUQA 1W6JA 4YWMA 1L1OC 1H95A 1AE3A 2HQEA 1L0XB 2KUMA 2HDLA 2A5HA 2I5HA 1N34Q 3T53B 4JI1Q 4DV3L 5C3WA 1K8MA 1SRUA 4DF7A 2K5QA 4JYAQ 1GUGA 3TZDA 2JA5G 4GZYC 2UXCQ 2UXBQ 4WORA 1PFMA 1TIID 4G7OC 1WCMG 2PI2E 2OQ0A 1KC8C 1SFOH 1EFID 1NBWA 4DA2A 5EGTA 3S2HB 1H9JA 4P2CB 2RSOA 4S3SA 3NWSA 1VQCA 3O13A 1UE1A 4AQYQ 1IL8A 3UE0A 3VR3A 4X3KA 3MA2B 1MJCA 3S16B 3PF5A 3BYTB 3RMHA 4K2LA 4LF8L 3ND9A 2EXDA 5ELDA 3DLLA 1Q86C 3BJUA 4IO9A 4K8IA 1ICFB 1WYDA 1SNPA 4KD4A 4CDDC 2H4OA 4NXML 2ZM6Q 4DAMA 4DV1Q 2UUBQ 1XTCD 4P73A 1IBKQ 5BN3A 1TVXA 1U5KA 3J7ZC 1Q1EA 4JOIC 4JVZA 3J80i 4OGQC 4DXFA 3Q23A 1KQSA 4HTHA 4K0KQ 2YTVA 2PI2A 3GV3A 3S17H 1KLGD 1ONLA 1XYIA 2ALYB 5I4DA 5I6WA 3J81c 1PZJD 1SMYC 4B3RQ 4LK1C 5LHY1 4GN3B 1S72A 1EIGA 3T1YL 1VQFA 3K7UC 3NK9A 2XGTA 1II3A 3EIVA 3LWUA 4RGMA 2Y0SG 2D0OA 1OXUA 1K0SA 1SYFA 1JOQA 1FNUA 2PNHA 4ME3A 2HIXA 3JAMc 2BH8A 5JOBA 4HJ5A 1XNQL 1UEAB 3HKZE 4DR1L 3STBD 1YHAA 2HDMA 4HCSA 2MNAA 3P75A 1BF4A 2K52A 2X6GA 1SYBA 1LTAD 3S1RH 1KRSA 4NDXA 3MEFA 1F2MA 1EY8A 1XWEA 3R93A 3F2BA 1S3OA 2RSNA 4HIMA 3A56A 1CHPD 4FXDA 4DAVA 2IX3A 3FEWX 4KD3A 1V43A 5J1ZA 1D7QA 3HS0C 4FYDA 2JA7B 1CUKA 1PH9A 3CRKC 3T1HQ 2R7ZG 3BS1A 5D3IB 2WINB 1R9TH 3NE5B 2Y0SB 5C3XA 2B2WC 4F8MA 3KLSA 1AN8A 3H6MA 3NUCA 3GD7A 4BA2I 4POGA 1BBWA 1IZ6A 1FVIA 2P5ZX 3TP5A 1SFOB 3EFXD 4IUTA 3CRLC 4YCUA 2B63B 1RHPA 1C7YA 1SEBD 1VQBA 3F2UA 2MPMA 1I4XA 5K36H 3ND8A 4P71A 1Y1WH 3BVGA 1HCZA 3F2DA 1NY4A 3I2ZA 4JW0A 2UUCQ 2CVRA 2XSCA 1K73C 3IRBA 2KCMA 4DGZA 5AJ3L 1B4OA 4ZK9B 3I4NG 4KKSA 3S1QH 1U4LA 3AYHB 4C2MB 5J22A 4B9XA 2NVTH 2R93B 3J80L 4J1MA 1N34L 2K14A 3H91A 2KECA 1GOZA 3I7FA 4PMBA 4ZRZA 1YIJA 3K5NA 4ZQ3A 3GTGB 4OX9Q 4K5XA 5GAEC 2EY5A 2JA6B 3H94A 1SMYD 1FJGQ 1FNVA 2WKDA 1GVPA 1XNQQ 3S1NB 1N32L 3TSSA 2OTJA 4IUUA 4I7AA 3VYUA 4A4IA 3GV6A 3TMEA 1I4QA 4CBVA 4BBRG 5IYCG 1A6XA 1NUCA 2MP1A 1PYSB 3RR5A 1PV4A 2HQLA 1RTNA 1X65A 4V0BA 2AQ3B 3K8AA 4DR4Q 2B2YC 1YEZA 2F4VQ 4L8JA 4B3MQ 1O7LA 4ZYSA 5IP9H 2IX0A 1F77A 2K28A 3VR6A 3A5ZB 4HCEA 3X3NA 1LO5D 5JEAG 4RWSC 2QW7A 4QIWE 4Y7NB 4RGNA 4FF2A 3BDCA 4PMWA 2VQEL 5E1FA 4LFCQ 2JP1A 3W1GA 3CCJA 3GTGH 1MD2D 4ID6A 5DAUA 3S24A 4C3IH 1WI5A 4UP9A 4GOPB 3Q22A 3VYTA 2QILA 2IY5B 2F0TA 2VZAA 1JMCA 3T1HL 1WTPA 1A0IA 2EXZA 1N8RC 4L5QA 2IL8A 1KIXA 3U4ZA 2XN9C 1VQLA 1EYDA 5HURA 1HNZL 4KKUA 2VS1A 1TWCB 5KYIA 5IT9E 2KVMA 4IPHA 3HOYG 3SHLA 2Q8IB 1H9RA 1GKHA 2NN6G 3KF8B 4CHTB 1VQAA 3CCEA 1T5EA 3J80c 3H3VI 1JORA 3GTQH 2L0CA 4U673 1JWMD 2F0DA 2Q2UA 1SNQA 4MNOA 1TWCH 3DWAA 2NTTA 1EY4A 4NB3A 2Z4HA 1QZHA 1KNEA 2F0PA 2IHEA 3VR5A 3KOJA 1QVCA 2OCEA 2ZTDA 4DV5Q 5D3DA 4I7ZC 4A3EB 1PVOA 4NKLA 2E2IB 1J9OA 1PFBA 3K6OA 3S14B 1SROA 3TEHB 1KDBA 2N49A 1WTHA 2K7VA 2Z8LA 1ASZA 3C1FA 2YYZA 4KK7A 3SVMA 4HJ7A 1T5XD 4DR5Q 1FGUA 1CM9A 2N55A 2VB2X 4AIMA 4JI5Q 4FP5D 3I4MG 4GKJQ 2PYKA 1XPUA 4KY6A 3OWEB 5HY6A 4R9WA 4FF4A 1EY7A 3CU7A 2VXWA 4GN5A 4OL7A 2UUAL 2K5DA 1YJNA 2OXPA 1H9SA 1PTOF 2RHSB 4OO1I 2VY3A 2M9VA 1RF2D 1GJXA 1PH7A 4GLXA 2JA7G 4AYBG 4A3IB 2AKWB 3MHBA 1D8LA 2L4NA 4CKEA 4JI4Q 2JJQA 1PRTD 1I4HA 4CKBA 3TQYA 1IBLQ 3L7ZC 4RMFA 4LW1A 4LF7Q 2I07B 3UDXA 5TSSA 4IOCA 5C4XH 5M5WB 2PNRC 5BN5A 5D65A 4JI4L 2A1AA 4OELB 5LMUQ 1EUJA 3F8TA 5C5MA 1PTOH 2ZXPA 3AQQA 3CCUA 4A3JG 4JV5Q 1LM0A 5D14A 1PHJA 1K28A 4LUZA 1RTOA 1TY2A 5JJKA 3CCQA 2OEOA 2RQXA 4YY3L 3DMUA 1PH2A 4K5VA 2JA5B 4OWWB 3HOXG 1WTVA 2MJ8A 4NMZA 1OXXK 1SYGA 4A3DG 4X65L 4JI3Q 4ZUJA 1S5ED 4BBRB 2PW7A 4HMIA 4YY3Q 1D5ZC 1SBBB 2IT1A 2Z0SA 3RUZA 3DHQA 3A8KE 1VQ5A 5K5PA 3GTOB 4AYBE 3S1MB 1BCPF 1O7ZA 1Z9FA 4YCWA 5C4JB 5KIXA 1R4QB 2L1BA 3CP0A 3FMCA 1JOOA 1HTLD 2AMCB 3DWQA 4GLVB 5KYLA 3CCVA 1HJPA 4C3JB 3T16A 1K8OA 1CA6A 4DNRB 4QJFA 3EQLC 2BE5D 1ZEQX 3CCRA 1E7ZA 1ILPA 5JEAH 4IOAA 2UXBL 1N33L 1TKWB 2QA4A 3M4PA 3HOZG 3GTLH 2EE1A 1WTOA 1I4PA 3OOCA 4C56C 1JR0D 2KCTA 1PH4A 4IQZA 3HOVB 1IYVA 5A2QL 1PH3A 1SNCA 3TP7A 1IHZA 1SE3A 2DNEA 1LACA 1VMPA 2A8VA 4A3DB 5CV9A 3DUZA 1K8GA 5KRUA 4BBRH 5E4XA 1E22A 4JK1C 2GVBA 2GN5A 4CJ2C 1A2UA 1KHIA 3G71A 3T4AC 1O7YA 2KA7A 3PO3G 2CH4A 2F3WA 1AFPA 4F7XA 5IWAQ 1PXUA 3DEPA 1PLFA 1A8VA 1VQEA 4ZKCB 4CKCA 5KEEA 4FNFA 5M5XB 1WTRA 1VQIA 2BDNA 1NMGA 1VQHA 3P1HA 4KJOA 4HIKA 1IBKL 4BY1G 2K33A 3J7AF 1PTOB 4XXEA 5M3MG 2DNCA 1Y14B 2TMPA 1IKMA 4BY1H 3M3YB 2RCNA 1SJHD 1W3SA 2B2TA 1J5EL 1R4PB 3S17B 1B1ZA 5JAVA 1J6QA 2N8NA 5LMNW 2HT1A 2JA8H 1KAAA 4OIKA 1UEBA 3LNNA 2XWJB 2EOTA 4K14A 1HZCA 1J8IA 3H0GB 2VQEQ 3GTQB 3CKIB 3ZJYC 4LUVA 1NR2A 2AHOB 4IN3A 5EPKA 4JCVE 3GTPH 4KY7A 1Q12A 3GTJH 4WJWA 1ICWA 1NSNS 1VQ7A 1Q81C 3M7GA 1ESFA 3JAML 1S4ZA 4HJ9A 2N88A 2FMMA 2E75C 1DCZA 5IY0A 2MO1A 1STEA 3K5MA 2ZXOA 3I73A 3QG1A 4QB4A 1QVFA 1EU3A 4ALPA 1YNNC 1SLJA 3UE1A 4B3SL 4GKJL 1EY0A 2DN8A 3F1ZA 1YBYA 5J39A 4DNTB 4QF4A 4DAYB 4YHHL 3H15A 2X69A 3BU2A 4QGUA 4J15A 3V96A 3X3MA 2ZTCA 4Q5VA 2DJFC 2MHVA 1HXYD 4K0KL 2LS01 2O5IC 2E2JB 3Q8DA 2XTIA 4A3KH 5IIFA 2B8GA 1CT1D 1HZ9A 5C4ZA 2ASBA 2ZM6L 1QVGA 3S2HH 4YHHQ 1ENFA 4X3SA 4BXXG 1F9QA 1LTBD 3D0FA 4KN4C 3K59A 3DM3A 3J81i 3CMAA 3KBGA 4R4CA 1PTOD 1VQOA 4Y52H 3FHWA 4BXXH 4IFDI 1TWFH 5H1SE 3HKZG 1N36Q 3CMEA 2JE6I 1T9HA 4X64Q 4DV6L 1BBUA 1Y1VH 4A3CH 1K3BC 1FL0A 1TS3A 2R93H 2NVTB 2SNMA 4LF4L 1CQFA 2R7FA 2NVXH 1XX8A 1C0AA 2PZUA 2CQAA 4DK0A 1VQ9A 1DONA 2JN4A 4J6HA 3RZOB 1D5MC 2ZJPA 1K8AC 1JJGA 4TSSA 3ZYYX 4HIOA 4ME5A 4GNXC 3E0EA 1H9MA 2CW0C 2YV5A 3PCOB 2IWHA 3NHHA 2V4DA 1YZ6A 1SDFA 5JJIA 1F2ZA 5CBEE 5CV7A 1BVSA 1AW7A 2MGSA 2PO4A 2F03A 1A62A 1VQDA 3I4LA 2A6ED 1HR0L 4XQQA 4DV7Q 1Q90A 5IYBG 1YJWA 3M9BA 2F0VA 3NWTA 2F0GA 4OEMB 2SDFA 1A15A 4OO1G 1U4PA 1Y1VG 2M00A 1SR3A 3AB9A 4DV0Q 4LNQA 1HA6A 3HEJA 5M3FB 2PW5A 4QIWB 2WIIB 3EBEA 2NVYB 1XMQL 5FOBB 3S1RB 2Q2TA 1PZID 1JCKB 1TS5A 3V05A 1Q7YC 4LF6Q 1I6HB 2Z1CA 1CHQD 2BH2A 4ABNA 5JJLA 5M5YB 4DUYL 4JI0Q 2XRSD 5ISRA 2EYLA 2K4KA 1WTQA 1QOHA 4QQBX 3R8BA 3HOXH 3J81j 2ZTEA 3RN2A 5IP7G 1G6PA 5I2XA 4EQOA 3VYSA 1Q8IA 1STBA 1BXTA 2EQSA 5I2YA 3PO3H 3WOFA 3CPFA 1DYQA 5EAYA 1LV9A 1MHWC 2F0WA 3TP6A 2ZT9C 5FO9B 1A2TA 2PZTA 2X6LA 4A3GH 2WB1B 1Z6HA 4KMUC 2R3ZA 2NN6H 5BR8L 3NBIA 2RA4A 2BA0A 3VDYA 4KHVA 2NN6I 1VCIA 4DK3C 1FR3A 4DV1L 2UXDL 1VS0A 4KHPL 1G2TA 3M4OH 3KF8A 1B3QA 3IL8A 1WD1A 2SOBA
chains in the Genus database with same CATH topology
5ELNA 3AEVA 2IY5B 2VZAA 1JMCA 3UDGA 5E7NA 3SGIA 3GDEA 3T1HL 1IBMQ 1A0IA 4QY7A 4HIDA 3RLFA 4APVA 1N8RC 4L5QA 2JA7H 1EQQA 3RNUA 1KIXA 1Q1BA 2D0PA 2UU9L 4DR5L 1TWAH 3U4ZA 4X6AH 5IP9G 2N78A 4QL5A 1U0LA 1VQLA 4B3RL 4LFBL 4DV5L 4A76A 1V1QA 4EX5A 1HNZL 2VS1A 4JI7Q 4LF5Q 2HHHL 4NXNQ 1AH9A 4IPHA 3HOYG 1I3QH 1N9WA 4GOPA 4AQYL 1M90C 1KL9A 1GKHA 2NN6G 4IPCA 1KD1C 1JB7A 3KF8B 2QGQA 4A3EH 1VQAA 3CCEA 3J80c 2MQHA 2B63G 4DK6C 2E5LQ 3H3VI 3I4MH 4R4QA 4A3MH 1NJIC 3GTQH 2R93G 1PA6A 1TWHH 1G51A 1J5EQ 4H02A 5HGQA 1MJEA 1EFWA 3E9IA 1X56A 4MNOA 2Q2UA 1EQRA 1HR0W 3KDFB 4B3SQ 1HZBA 1XMOL 2UXCL 1TWCH 3PIPA 4JBKA 4BBSG 4IJHA 4PZ7A 4POFA 4NB3A 3G6EA 1I94L 1JE5A 3LGJA 3ULLA 1QZHA 4A3DH 4DR1Q 2IHEA 3PIOA 3KOJA 2E5LL 1QVCA 4Y7NH 4LFCL 2OCEA 1Q82C 1HR0Q 1WFQA 2ZTDA 1L0WA 2AWOA 2WFWA 4P74A 1LUZA 1WJJA 4DV5Q 3M4QA 1FJGL 1PVOA 2WB1G 4OWXB 3ERSX 3HOUH 4GOPC 2I0QA 2Z6KA 3KJPA 1SROA 4B3TQ 3TEHB 2RF4A 2N49A 3E9HA 4GNXA 1TXYA 1OXTA 1ASZA 2YYZA 4A3FG 3AFQA 3KYHC 3CXCA 4HJ7A 2R92G 3B6YA 3STBC 3CQZH 3OYYA 4DR5Q 1UWVA 2PQAB 1X54A 4FDBA 1FGUA 5JEAJ 3GTMH 3MXNB 2E2JH 4AIMA 4JI5Q 3RLNA 3T1YQ 4KHZA 3I4MG 4GKJQ 2KBNA 5C44G 4DUZQ 1IBLL 1XPUA 5C4XG 4HJ8A 5FJ8G 4A93H 5HY6A 4PG3A 5IYDH 3PUWA 4DUYQ 4GN5A 3KF6B 4EQ5A 2UUAL 2K75A 3OTOL 2OWOA 1YJNA 2JA9A 3BZKA 2RHSB 5LMNL 3U4VA 2VY3A 5C0XJ 4OO1I 4WJ3M 3PUXA 1HNXQ 2CKZB 2PQAA 1PH7A 4P72A 4GLXA 1A63A 4R4IA 1VQPA 1YI2A 1PH1A 2JA7G 2NZHA 4AYBG 5IYDG 1CSPA 4A3LG 2AKWB 3TS2A 4R4OA 4JV5L 3RZDH 1D8LA 3A74A 3JC66 3CCMA 1I94Q 4X66L 4JI4Q 1Z47A 2JJQA 1E1TA 2RHQB 3I56A 1VQNA 4DR3L 2VQFQ 1OTCA 1KAWA 3I55A 2MO0A 4LUOA 4JBMA 5M3FG 1EYGA 1YHBA 4KHPQ 1IXRA 3UDFA 5M5YH 3TQYA 1TWGH 4DUZL 5C3EG 3L7ZC 4RMFA 1IBLQ 4LW1A 4LF7Q 4DNIA 1MIUA 3FKIH 3UDXA 3CF5A 4IOCA 5C4XH 3K81C 4MTNA 4C2MH 4A3IG 4X66Q 4JI4L 2A1AA 4L5RC 3HOUG 5LMUQ 4DR7Q 5IP7H 1EUJA 3F8TA 2ID0A 5GAHC 4JI5L 3AQQA 3CCUA 4A3FH 1UE6A 4NXNL 2VW9A 2HHHQ 4A3JG 1XNRQ 4JV5Q 1LM0A 2FXQA 1PHJA 4LWCA 1RL2A 4TQUS 1EWIA 4LUZA 5JJKA 1B8AA 3CCQA 5GAGC 5M3MH 3JAMi 5M5WH 3D31A 4JI2L 4YY3L 1C9OA 5LMUL 2QEXA 1PH2A 4NXMQ 1CKOA 3PUYA 4JG2A 4L5TA 1GO3E 2JA6H 4LF9Q 3CAMA 1EIFA 4IPDA 4OWWB 3HOXG 4JBJA 4A3MG 4YCVA 1KRTA 4DR6L 4IFDJ 2JEBI 1OXXK 4TVAB 2VUMH 1XPOA 4LF8Q 4A3DG 4LF7L 4X65L 4JI3Q 5FLMG 1B7YB 3FP9A 1YITA 4BBSH 1VQKA 1E3PA 2JQOA 1SMXA 2ES2A 4LF4Q 1PFSA 1LTLA 3CC4A 5IE8A 3PGZA 3OW2A 3S1MH 4GKKL 4YY3Q 1UE5A 4JBWA 4BY7H 4NPSA 2JA5H 4X62Q 2IT1A 2L15A 2Z0SA 3ER0A 1VQ6A 3WWVA 1XMQQ 1VQ5A 4DV6Q 2B63H 4A3EG 4LF6L 1XNRL 5ELOA 4AYBE 1Z9FA 4YCWA 1JT8A 2WAQG 3U58A 3HOYH 5C0XG 2PMZE 2F3IA 4XIGS 1Q8KA 1SE8A 3CP0A 3ICEA 1S40A 4PZ8A 3PSIA 4DR7L 2CFMA 2AMCB 2Q2HA 4GLVB 3CCVA 3PV0A 1HJPA 3GTOH 5K36G 1SN8A 4QJFA 2UXDQ 1XJVA 4JI3L 4X65Q 1NE3A 4MZ9A 3CCRA 1E7ZA 4OWTB 4A3GG 3PO2G 4IOAA 2K5NA 4GS3A 2UXBL 1N33L 3KJOA 2QA4A 4B3TL 3M4PA 2K50A 1L1OA 1X6OA 3GTLH 3HOZG 2VNUD 3M85A 4WJ4A 4DPGA 3S14H 4O0AA 1NMFA 2KCTA 1PH4A 1I5FA 2CWAA 2UU9Q 1PH3A 1I50H 4LF5L 4GNXB 1IYJB 1L1OB 1W2BA 2LXJA 1RIPA 2K5VA 2NVYH 4DV0L 2A8VA 3S2DH 1NTGA 2AWNA 4GKKQ 1K8GA 5IYCH 4YWMA 4BBRH 1L1OC 5FLXc 3EN2A 1H95A 1AE3A 2R92H 2K5HA 3I4OA 1ASYA 1E22A 2I5HA 1N34Q 2GVBA 2GN5A 3G71A 1KHIA 4LFBQ 4JI1Q 4DV3L 3PO3G 1BKBA 3HOVG 1SRUA 2UXCQ 4JYAQ 2NZOA 2JEAI 2JA5G 4R4TA 2UXBQ 5IWAQ 3W5OA 3A5UA 4JI0L 3BZCA 4DR2L 1A8VA 1VQEA 3NELA 1WCMG 2PI2E 2OQ0A 2CCZA 1O7IA 5FLMH 1KC8C 1SFOH 1NBWA 2YTYA 1QUQB 4LFAQ 3K7AH 4L5SA 1VQIA 1NMGA 1VQHA 1IBKL 4HIKA 4X64L 3CD6A 2R7DA 4BY1G 2KENA 3S16H 3TRZA 2KHIA 2LXKA 1VQCA 3CCSA 5J3BA 1UE1A 4AQYQ 4RG1A 2CQOA 2F52A 2V1CC 3UE0A 2N3SA 5M3MG 1Y14B 3RN5A 4BY1H 1IL2A 2RCNA 1MJCA 1W3SA 4UP8A 1VQJA 3PF5A 4JC0A 1J5EL 2EIFA 4LF8L 1J6QA 2N8NA 5LMNW 2EXDA 1XMOQ 2HT1A 4YWKA 2JA8H 3DLLA 1Q86C 3BJUA 4IO9A 1UEBA 1WYDA 2Z6KC 1HZCA 2VQEQ 3FKIG 4NXML 2ZM6Q 2NVQH 4DAMA 4DV1Q 2UUBQ 4DR6Q 4P73A 3ZJYC 4LUVA 1IBKQ 2AHOB 1WOCA 2WB1E 1U5KA 3J7ZC 1Q1EA 4JCVE 4JOIC 1HNZQ 1YVCA 2VL6A 3J80i 3GTPH 3GTJH 1Q12A 4DV2L 3L0OA 1KQSA 3RZOH 4K0KQ 4JI6L 2YTVA 1X3GA 2PI2A 3UDIA 3S17H 1VQ7A 1Q81C 1VQGA 1K83H 2B29A 4HJ9A 2ALYB 2CWPA 4UY8C 2UUAQ 3GTKH 3HOWH 3J81c 1X55A 2MO1A 5IY0A 4A3LH 4UPAA 4B3RQ 4DV7L 4BA1I 4GN3B 4JI8L 2MFIA 4ALPA 3T1YL 1S72A 1QVFA 3HOWG 1SLJA 1VQFA 3K7UC 3UE1A 4B3SL 2R7ZH 4AH6A 4A3BG 4GKJL 1YHQA 3F1ZA 1YBYA 2I5LX 2XGTA 1GD7A 2DUDA 3EIVA 4DAYB 2Y0SG 3PF4A 2D0OA 1M1KC 1OXUA 5FJ8H 4A93G 4DR3Q 4YHHL 5C44H 2PNHA 1CKNA 3BU2A 4ME3A 4QGUA 3H15A 1HNXL 4J15A 3M3YH 2ZTCA 3L2PA 1N36L 2HIXA 3JAMc 2B3GA 2BH8A 4DV4Q 4IPGA 3H0GH 4HJ5A 4BY7G 1XNQL 2D62A 4K0KL 2IHFA 3HKZE 3Q8DA 2XTIA 3TREA 1HH2P 4DR1L 3CCLA 3STBD 4A3KH 4R1JA 1YJ9A 1N33Q 1YHAA 1HZ9A 3W1BA 1P16A 2ASBA 2ZM6L 2MNAA 1QVGA 3S2HH 4YHHQ 5GROA 5M5XH 4JI8Q 4BXXG 1CKNB 4JI1L 4DV3Q 2K52A 3G48A 1CSQA 5DLQE 1I6HH 3D0FA 1WCMH 3DM3A 3J81i 3S1RH 3CMAA 1KRSA 3HFZB 5IWAL 1XPRA 4OXPA 3MEFA 3KFUA 4R4CA 3CW2C 3F2BA 1Q46A 1S3OA 5AJ3Q 1VQOA 4HIMA 4Y52H 3FHWA 4BXXH 4IFDI 1TWFH 4B3ML 5H1SE 3NBHB 3HKZG 1N36Q 3CMEA 2JE6I 1T9HA 4X64Q 4DV6L 1BBUA 1B70B 1JJCB 1Y1VH 4A3CH 4C3HH 4DV4L 2YTXA 2OQKA 4A3KG 2E8GA 1HNWL 1V43A 1D7QA 1FL0A 2R93H 3NEMA 4JOIA 1CUKA 3NENA 1PH9A 3T1HQ 5BR8Q 2R7ZG 3OTOQ 3A0JA 5IYBH 4LF4L 4DR2Q 2R7FA 2IX1A 3GO5A 3CC7A 3KDFA 5LMNQ 1R9TH 4A3JH 2R6GA 2NVXH 3M7NA 1C0AA 1KXLA 4GLAC 3RLOA 3I4NH 1VQ9A 3K80C 3G4SA 3GD7A 3S15H 4BA2I 4POGA 1BBWA 1IZ6A 1FVIA 3CPWA 3PUZA 3J7A5 1DGSA 2ZJPA 1E1OA 3ULJA 1K8AC 3S1NH 4YCUA 1JJGA 2Y0SE 1OXSC 3PUVA 4PZ6A 1Y1WG 4HIOA 1C7YA 2VQFL 4A3BH 1VQBA 4GNXC 3E0EA 5C3EH 2YV5A 1YNXA 3PCOB 3F2CA 4P71A 4C3JH 1Y1WH 1XTDA 3F2DA 4A75A 1NY4A 3I2ZA 1YZ6A 4DV2Q 2GVAA 2WAQE 2UUCQ 4JI7L 1EIYB 1K73C 2YU9H 5JJIA 3IRBA 4KI0A 2KCMA 1K3RA 1P8LA 3K0XA 1BVSA 1VQ4A 3H3VH 1MKHA 3PO2H 5AJ3L 1A62A 3I4NG 1VQDA 3S1QH 1L2FA 3AYHB 1HR0L 2I5MX 1E24A 1X3EA 2WP8J 5C0XI 4DV7Q 1QUQA 2A19A 2ZJQA 2NVTH 5IYBG 1YJWA 3M9BA 1N34L 2K14A 4XTCS 1EOVA 3I7FA 3TS0A 4JYAL 1N32Q 4OO1G 1YIJA 4JI6Q 4A3CG 1Y1VG 4JI2Q 4DV0Q 1SR3A 4HJAA 4LNQA 2JA8G 5C4JH 2VUMG 4OX9Q 1K0RA 1PH6A 3CC2A 2H5XA 2C35B 3EBEA 5GAEC 1JJ2A 2BA1A 1XMQL 4LFAL 2Q2TA 1Q7YC 1FJGQ 4LF6Q 2UUCL 2HIVA 2JA6G 4O2DA 1GVPA 3KF6A 1XNQQ 1UE7A 1PYBA 3HKSA 2BH2A 1N32L 5JJLA 3U50C 4DUYL 3HOVH 4JI0Q 4DR4L 1QZGA 1IBML 2OTJA 2F4VL 2K4KA 4X62L 4A4IA 4LF9L 4IJLA 1V9PA 4QQBX 3HOXH 3J81j 2E2IH 4BBRG 2ZTEA 5IYCG 3RN2A 5IP7G 1PH8A 1G6PA 1PYSB 2KHJA 4KLKA 3RR5A 2HQLA 1X65A 3H0GG 4A3IH 1VQMA 1PV4A 4UP7A 1PH5A 2JK8A 4DKAC 4YWLA 4P75A 3K8AA 1K9MC 2EQSA 4DR4Q 2ZJRA 3PO3H 3ULPA 1YEZA 2DGYA 2F4VQ 3CPFA 4B3MQ 5EAYA 1X9NA 2UUBL 2ATWA 5IP9H 1GM5A 5IT9c 2IX0A 1HNWQ 3HOZH 3A5ZB 1LYLA 1CKMA 1OXVA 2E2HH 1AE2A 5JEAG 4A3GH 3KLWA 2Q2IA 5BR8L 4QIWE 4IFDG 2BA0A 3VDYA 4OX9L 2NN6I 2LSSA 1HZAA 4PMWA 1VCIA 5GADC 2VQEL 4LFCQ 2OTLA 3W1GA 4DK3C 3CCJA 3GTGH 5M3FH 4OONA 4DV1L 2UXDL 4GN4B 3S24A 4C3IH 1G291 1VS0A 4KHPL 3M4OH 1WI5A 4UP9A 4GOPB 1X3FA 3AFPA 1VQ8A 5GQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  3AEV A;  2IY5 B;  2VZA A;  1JMC A;  3UDG A;  5E7N A;  3SGI A;  3GDE A;  3T1H L;  1IBM Q;  1A0I A;  4QY7 A;  4HID A;  3RLF A;  4APV A;  1N8R C;  4L5Q A;  2JA7 H;  1EQQ A;  3RNU A;  1KIX A;  1Q1B A;  2D0P A;  2UU9 L;  4DR5 L;  1TWA H;  3U4Z A;  4X6A H;  5IP9 G;  2N78 A;  4QL5 A;  1U0L A;  1VQL A;  4B3R L;  4LFB L;  4DV5 L;  4A76 A;  1V1Q A;  4EX5 A;  1HNZ L;  2VS1 A;  4JI7 Q;  4LF5 Q;  2HHH L;  4NXN Q;  1AH9 A;  4IPH A;  3HOY G;  1I3Q H;  1N9W A;  4GOP A;  4AQY L;  1M90 C;  1KL9 A;  1GKH A;  2NN6 G;  4IPC A;  1KD1 C;  1JB7 A;  3KF8 B;  2QGQ A;  4A3E H;  1VQA A;  3CCE A;  3J80 c;  2MQH A;  2B63 G;  4DK6 C;  2E5L Q;  3H3V I;  3I4M H;  4R4Q A;  4A3M H;  1NJI C;  3GTQ H;  2R93 G;  1PA6 A;  1TWH H;  1G51 A;  1J5E Q;  4H02 A;  5HGQ A;  1MJE A;  1EFW A;  3E9I A;  1X56 A;  4MNO A;  2Q2U A;  1EQR A;  1HR0 W;  3KDF B;  4B3S Q;  1HZB A;  1XMO L;  2UXC L;  1TWC H;  3PIP A;  4JBK A;  4BBS G;  4IJH A;  4PZ7 A;  4POF A;  4NB3 A;  3G6E A;  1I94 L;  1JE5 A;  3LGJ A;  3ULL A;  1QZH A;  4A3D H;  4DR1 Q;  2IHE A;  3PIO A;  3KOJ A;  2E5L L;  1QVC A;  4Y7N H;  4LFC L;  2OCE A;  1Q82 C;  1HR0 Q;  1WFQ A;  2ZTD A;  1L0W A;  2AWO A;  2WFW A;  4P74 A;  1LUZ A;  1WJJ A;  4DV5 Q;  3M4Q A;  1FJG L;  1PVO A;  2WB1 G;  4OWX B;  3ERS X;  3HOU H;  4GOP C;  2I0Q A;  2Z6K A;  3KJP A;  1SRO A;  4B3T Q;  3TEH B;  2RF4 A;  2N49 A;  3E9H A;  4GNX A;  1TXY A;  1OXT A;  1ASZ A;  2YYZ A;  4A3F G;  3AFQ A;  3KYH C;  3CXC A;  4HJ7 A;  2R92 G;  3B6Y A;  3STB C;  3CQZ H;  3OYY A;  4DR5 Q;  1UWV A;  2PQA B;  1X54 A;  4FDB A;  1FGU A;  5JEA J;  3GTM H;  3MXN B;  2E2J H;  4AIM A;  4JI5 Q;  3RLN A;  3T1Y Q;  4KHZ A;  3I4M G;  4GKJ Q;  2KBN A;  5C44 G;  4DUZ Q;  1IBL L;  1XPU A;  5C4X G;  4HJ8 A;  5FJ8 G;  4A93 H;  5HY6 A;  4PG3 A;  5IYD H;  3PUW A;  4DUY Q;  4GN5 A;  3KF6 B;  4EQ5 A;  2UUA L;  2K75 A;  3OTO L;  2OWO A;  1YJN A;  2JA9 A;  3BZK A;  2RHS B;  5LMN L;  3U4V A;  2VY3 A;  5C0X J;  4OO1 I;  4WJ3 M;  3PUX A;  1HNX Q;  2CKZ B;  2PQA A;  1PH7 A;  4P72 A;  4GLX A;  1A63 A;  4R4I A;  1VQP A;  1YI2 A;  1PH1 A;  2JA7 G;  2NZH A;  4AYB G;  5IYD G;  1CSP A;  4A3L G;  2AKW B;  3TS2 A;  4R4O A;  4JV5 L;  3RZD H;  1D8L A;  3A74 A;  3JC6 6;  3CCM A;  1I94 Q;  4X66 L;  4JI4 Q;  1Z47 A;  2JJQ A;  1E1T A;  2RHQ B;  3I56 A;  1VQN A;  4DR3 L;  2VQF Q;  1OTC A;  1KAW A;  3I55 A;  2MO0 A;  4LUO A;  4JBM A;  5M3F G;  1EYG A;  1YHB A;  4KHP Q;  1IXR A;  3UDF A;  5M5Y H;  3TQY A;  1TWG H;  4DUZ L;  5C3E G;  3L7Z C;  4RMF A;  1IBL Q;  4LW1 A;  4LF7 Q;  4DNI A;  1MIU A;  3FKI H;  3UDX A;  3CF5 A;  4IOC A;  5C4X H;  3K81 C;  4MTN A;  4C2M H;  4A3I G;  4X66 Q;  4JI4 L;  2A1A A;  4L5R C;  3HOU G;  5LMU Q;  4DR7 Q;  5IP7 H;  1EUJ A;  3F8T A;  2ID0 A;  5GAH C;  4JI5 L;  3AQQ A;  3CCU A;  4A3F H;  1UE6 A;  4NXN L;  2VW9 A;  2HHH Q;  4A3J G;  1XNR Q;  4JV5 Q;  1LM0 A;  2FXQ A;  1PHJ A;  4LWC A;  1RL2 A;  4TQU S;  1EWI A;  4LUZ A;  5JJK A;  1B8A A;  3CCQ A;  5GAG C;  5M3M H;  3JAM i;  5M5W H;  3D31 A;  4JI2 L;  4YY3 L;  1C9O A;  5LMU L;  2QEX A;  1PH2 A;  4NXM Q;  1CKO A;  3PUY A;  4JG2 A;  4L5T A;  1GO3 E;  2JA6 H;  4LF9 Q;  3CAM A;  1EIF A;  4IPD A;  4OWW B;  3HOX G;  4JBJ A;  4A3M G;  4YCV A;  1KRT A;  4DR6 L;  4IFD J;  2JEB I;  1OXX K;  4TVA B;  2VUM H;  1XPO A;  4LF8 Q;  4A3D G;  4LF7 L;  4X65 L;  4JI3 Q;  5FLM G;  1B7Y B;  3FP9 A;  1YIT A;  4BBS H;  1VQK A;  1E3P A;  2JQO A;  1SMX A;  2ES2 A;  4LF4 Q;  1PFS A;  1LTL A;  3CC4 A;  5IE8 A;  3PGZ A;  3OW2 A;  3S1M H;  4GKK L;  4YY3 Q;  1UE5 A;  4JBW A;  4BY7 H;  4NPS A;  2JA5 H;  4X62 Q;  2IT1 A;  2L15 A;  2Z0S A;  3ER0 A;  1VQ6 A;  3WWV A;  1XMQ Q;  1VQ5 A;  4DV6 Q;  2B63 H;  4A3E G;  4LF6 L;  1XNR L;  5ELO A;  4AYB E;  1Z9F A;  4YCW A;  1JT8 A;  2WAQ G;  3U58 A;  3HOY H;  5C0X G;  2PMZ E;  2F3I A;  4XIG S;  1Q8K A;  1SE8 A;  3CP0 A;  3ICE A;  1S40 A;  4PZ8 A;  3PSI A;  4DR7 L;  2CFM A;  2AMC B;  2Q2H A;  4GLV B;  3CCV A;  3PV0 A;  1HJP A;  3GTO H;  5K36 G;  1SN8 A;  4QJF A;  2UXD Q;  1XJV A;  4JI3 L;  4X65 Q;  1NE3 A;  4MZ9 A;  3CCR A;  1E7Z A;  4OWT B;  4A3G G;  3PO2 G;  4IOA A;  2K5N A;  4GS3 A;  2UXB L;  1N33 L;  3KJO A;  2QA4 A;  4B3T L;  3M4P A;  2K50 A;  1L1O A;  1X6O A;  3GTL H;  3HOZ G;  2VNU D;  3M85 A;  4WJ4 A;  4DPG A;  3S14 H;  4O0A A;  1NMF A;  2KCT A;  1PH4 A;  1I5F A;  2CWA A;  2UU9 Q;  1PH3 A;  1I50 H;  4LF5 L;  4GNX B;  1IYJ B;  1L1O B;  1W2B A;  2LXJ A;  1RIP A;  2K5V A;  2NVY H;  4DV0 L;  2A8V A;  3S2D H;  1NTG A;  2AWN A;  4GKK Q;  1K8G A;  5IYC H;  4YWM A;  4BBR H;  1L1O C;  5FLX c;  3EN2 A;  1H95 A;  1AE3 A;  2R92 H;  2K5H A;  3I4O A;  1ASY A;  1E22 A;  2I5H A;  1N34 Q;  2GVB A;  2GN5 A;  3G71 A;  1KHI A;  4LFB Q;  4JI1 Q;  4DV3 L;  3PO3 G;  1BKB A;  3HOV G;  1SRU A;  2UXC Q;  4JYA Q;  2NZO A;  2JEA I;  2JA5 G;  4R4T A;  2UXB Q;  5IWA Q;  3W5O A;  3A5U A;  4JI0 L;  3BZC A;  4DR2 L;  1A8V A;  1VQE A;  3NEL A;  1WCM G;  2PI2 E;  2OQ0 A;  2CCZ A;  1O7I A;  5FLM H;  1KC8 C;  1SFO H;  1NBW A;  2YTY A;  1QUQ B;  4LFA Q;  3K7A H;  4L5S A;  1VQI A;  1NMG A;  1VQH A;  1IBK L;  4HIK A;  4X64 L;  3CD6 A;  2R7D A;  4BY1 G;  2KEN A;  3S16 H;  3TRZ A;  2KHI A;  2LXK A;  1VQC A;  3CCS A;  5J3B A;  1UE1 A;  4AQY Q;  4RG1 A;  2CQO A;  2F52 A;  2V1C C;  3UE0 A;  2N3S A;  5M3M G;  1Y14 B;  3RN5 A;  4BY1 H;  1IL2 A;  2RCN A;  1MJC A;  1W3S A;  4UP8 A;  1VQJ A;  3PF5 A;  4JC0 A;  1J5E L;  2EIF A;  4LF8 L;  1J6Q A;  2N8N A;  5LMN W;  2EXD A;  1XMO Q;  2HT1 A;  4YWK A;  2JA8 H;  3DLL A;  1Q86 C;  3BJU A;  4IO9 A;  1UEB A;  1WYD A;  2Z6K C;  1HZC A;  2VQE Q;  3FKI G;  4NXM L;  2ZM6 Q;  2NVQ H;  4DAM A;  4DV1 Q;  2UUB Q;  4DR6 Q;  4P73 A;  3ZJY C;  4LUV A;  1IBK Q;  2AHO B;  1WOC A;  2WB1 E;  1U5K A;  3J7Z C;  1Q1E A;  4JCV E;  4JOI C;  1HNZ Q;  1YVC A;  2VL6 A;  3J80 i;  3GTP H;  3GTJ H;  1Q12 A;  4DV2 L;  3L0O A;  1KQS A;  3RZO H;  4K0K Q;  4JI6 L;  2YTV A;  1X3G A;  2PI2 A;  3UDI A;  3S17 H;  1VQ7 A;  1Q81 C;  1VQG A;  1K83 H;  2B29 A;  4HJ9 A;  2ALY B;  2CWP A;  4UY8 C;  2UUA Q;  3GTK H;  3HOW H;  3J81 c;  1X55 A;  2MO1 A;  5IY0 A;  4A3L H;  4UPA A;  4B3R Q;  4DV7 L;  4BA1 I;  4GN3 B;  4JI8 L;  2MFI A;  4ALP A;  3T1Y L;  1S72 A;  1QVF A;  3HOW G;  1SLJ A;  1VQF A;  3K7U C;  3UE1 A;  4B3S L;  2R7Z H;  4AH6 A;  4A3B G;  4GKJ L;  1YHQ A;  3F1Z A;  1YBY A;  2I5L X;  2XGT A;  1GD7 A;  2DUD A;  3EIV A;  4DAY B;  2Y0S G;  3PF4 A;  2D0O A;  1M1K C;  1OXU A;  5FJ8 H;  4A93 G;  4DR3 Q;  4YHH L;  5C44 H;  2PNH A;  1CKN A;  3BU2 A;  4ME3 A;  4QGU A;  3H15 A;  1HNX L;  4J15 A;  3M3Y H;  2ZTC A;  3L2P A;  1N36 L;  2HIX A;  3JAM c;  2B3G A;  2BH8 A;  4DV4 Q;  4IPG A;  3H0G H;  4HJ5 A;  4BY7 G;  1XNQ L;  2D62 A;  4K0K L;  2IHF A;  3HKZ E;  3Q8D A;  2XTI A;  3TRE A;  1HH2 P;  4DR1 L;  3CCL A;  3STB D;  4A3K H;  4R1J A;  1YJ9 A;  1N33 Q;  1YHA A;  1HZ9 A;  3W1B A;  1P16 A;  2ASB A;  2ZM6 L;  2MNA A;  1QVG A;  3S2H H;  4YHH Q;  5GRO A;  5M5X H;  4JI8 Q;  4BXX G;  1CKN B;  4JI1 L;  4DV3 Q;  2K52 A;  3G48 A;  1CSQ A;  5DLQ E;  1I6H H;  3D0F A;  1WCM H;  3DM3 A;  3J81 i;  3S1R H;  3CMA A;  1KRS A;  3HFZ B;  5IWA L;  1XPR A;  4OXP A;  3MEF A;  3KFU A;  4R4C A;  3CW2 C;  3F2B A;  1Q46 A;  1S3O A;  5AJ3 Q;  1VQO A;  4HIM A;  4Y52 H;  3FHW A;  4BXX H;  4IFD I;  1TWF H;  4B3M L;  5H1S E;  3NBH B;  3HKZ G;  1N36 Q;  3CME A;  2JE6 I;  1T9H A;  4X64 Q;  4DV6 L;  1BBU A;  1B70 B;  1JJC B;  1Y1V H;  4A3C H;  4C3H H;  4DV4 L;  2YTX A;  2OQK A;  4A3K G;  2E8G A;  1HNW L;  1V43 A;  1D7Q A;  1FL0 A;  2R93 H;  3NEM A;  4JOI A;  1CUK A;  3NEN A;  1PH9 A;  3T1H Q;  5BR8 Q;  2R7Z G;  3OTO Q;  3A0J A;  5IYB H;  4LF4 L;  4DR2 Q;  2R7F A;  2IX1 A;  3GO5 A;  3CC7 A;  3KDF A;  5LMN Q;  1R9T H;  4A3J H;  2R6G A;  2NVX H;  3M7N A;  1C0A A;  1KXL A;  4GLA C;  3RLO A;  3I4N H;  1VQ9 A;  3K80 C;  3G4S A;  3GD7 A;  3S15 H;  4BA2 I;  4POG A;  1BBW A;  1IZ6 A;  1FVI A;  3CPW A;  3PUZ A;  3J7A 5;  1DGS A;  2ZJP A;  1E1O A;  3ULJ A;  1K8A C;  3S1N H;  4YCU A;  1JJG A;  2Y0S E;  1OXS C;  3PUV A;  4PZ6 A;  1Y1W G;  4HIO A;  1C7Y A;  2VQF L;  4A3B H;  1VQB A;  4GNX C;  3E0E A;  5C3E H;  2YV5 A;  1YNX A;  3PCO B;  3F2C A;  4P71 A;  4C3J H;  1Y1W H;  1XTD A;  3F2D A;  4A75 A;  1NY4 A;  3I2Z A;  1YZ6 A;  4DV2 Q;  2GVA A;  2WAQ E;  2UUC Q;  4JI7 L;  1EIY B;  1K73 C;  2YU9 H;  5JJI A;  3IRB A;  4KI0 A;  2KCM A;  1K3R A;  1P8L A;  3K0X A;  1BVS A;  1VQ4 A;  3H3V H;  1MKH A;  3PO2 H;  5AJ3 L;  1A62 A;  3I4N G;  1VQD A;  3S1Q H;  1L2F A;  3AYH B;  1HR0 L;  2I5M X;  1E24 A;  1X3E A;  2WP8 J;  5C0X I;  4DV7 Q;  1QUQ A;  2A19 A;  2ZJQ A;  2NVT H;  5IYB G;  1YJW A;  3M9B A;  1N34 L;  2K14 A;  4XTC S;  1EOV A;  3I7F A;  3TS0 A;  4JYA L;  1N32 Q;  4OO1 G;  1YIJ A;  4JI6 Q;  4A3C G;  1Y1V G;  4JI2 Q;  4DV0 Q;  1SR3 A;  4HJA A;  4LNQ A;  2JA8 G;  5C4J H;  2VUM G;  4OX9 Q;  1K0R A;  1PH6 A;  3CC2 A;  2H5X A;  2C35 B;  3EBE A;  5GAE C;  1JJ2 A;  2BA1 A;  1XMQ L;  4LFA L;  2Q2T A;  1Q7Y C;  1FJG Q;  4LF6 Q;  2UUC L;  2HIV A;  2JA6 G;  4O2D A;  1GVP A;  3KF6 A;  1XNQ Q;  1UE7 A;  1PYB A;  3HKS A;  2BH2 A;  1N32 L;  5JJL A;  3U50 C;  4DUY L;  3HOV H;  4JI0 Q;  4DR4 L;  1QZG A;  1IBM L;  2OTJ A;  2F4V L;  2K4K A;  4X62 L;  4A4I A;  4LF9 L;  4IJL A;  1V9P A;  4QQB X;  3HOX H;  3J81 j;  2E2I H;  4BBR G;  2ZTE A;  5IYC G;  3RN2 A;  5IP7 G;  1PH8 A;  1G6P A;  1PYS B;  2KHJ A;  4KLK A;  3RR5 A;  2HQL A;  1X65 A;  3H0G G;  4A3I H;  1VQM A;  1PV4 A;  4UP7 A;  1PH5 A;  2JK8 A;  4DKA C;  4YWL A;  4P75 A;  3K8A A;  1K9M C;  2EQS A;  4DR4 Q;  2ZJR A;  3PO3 H;  3ULP A;  1YEZ A;  2DGY A;  2F4V Q;  3CPF A;  4B3M Q;  5EAY A;  1X9N A;  2UUB L;  2ATW A;  5IP9 H;  1GM5 A;  5IT9 c;  2IX0 A;  1HNW Q;  3HOZ H;  3A5Z B;  1LYL A;  1CKM A;  1OXV A;  2E2H H;  1AE2 A;  5JEA G;  4A3G H;  3KLW A;  2Q2I A;  5BR8 L;  4QIW E;  4IFD G;  2BA0 A;  3VDY A;  4OX9 L;  2NN6 I;  2LSS A;  1HZA A;  4PMW A;  1VCI A;  5GAD C;  2VQE L;  4LFC Q;  2OTL A;  3W1G A;  4DK3 C;  3CCJ A;  3GTG H;  5M3F H;  4OON A;  4DV1 L;  2UXD L;  4GN4 B;  3S24 A;  4C3I H;  1G29 1;  1VS0 A;  4KHP L;  3M4O H;  1WI5 A;  4UP9 A;  4GOP B;  1X3F A;  3AFP A;  1VQ8 A;  5GQO A; 
#chains in the Genus database with same CATH topology
 4K2K A;  3UDG A;  1DJR D;  1MBY A;  3WDN A;  4WRD A;  1IBM Q;  4G7H C;  3MC0 B;  1EQQ A;  5ELF A;  1HTP A;  1V1O A;  2D0P A;  2UU9 L;  1U0L A;  4LFB L;  4RGT A;  4DV5 L;  2A73 B;  3AU7 A;  4DXG A;  4GOP A;  4AQY L;  1KL9 A;  1V1P B;  4KY5 A;  2BCO A;  4HR7 B;  3I4M H;  2GA4 B;  4A3M H;  2BE5 C;  4E6I A;  1G51 A;  3UI2 A;  1EFW A;  3E9I A;  1ML0 D;  1EQR A;  1HR0 W;  3KDF B;  4CJ0 B;  5IGD A;  4L63 B;  3OWF A;  1DOK A;  4A3D H;  4DR1 Q;  1PRT B;  1Y8P B;  1VF7 A;  4LFC L;  1HR0 Q;  1H9S B;  1L0W A;  1LUZ A;  4XT3 B;  2LY7 A;  5ELB A;  3ONA B;  4CJ1 B;  4GOP C;  1DD2 A;  2F0M A;  3M4O B;  4B3T Q;  1E2W A;  1WTX A;  2A69 D;  4A3F G;  3CXC A;  1TWF B;  2R92 G;  4RKL A;  3B6Y A;  3CQZ H;  1MSG A;  3OYY A;  5JEA J;  1X54 A;  3GTM H;  3T1Y Q;  2O5J C;  4DUZ Q;  2K01 A;  2E2H B;  4J8Q A;  5C4X G;  3HOW B;  1NNX A;  5IYD H;  5KNC A;  3OTO L;  2JA9 A;  2E2D C;  3NP8 A;  3PUX A;  3FVQ A;  4P72 A;  1LTS D;  1YI2 A;  1PH1 A;  2NZH A;  5IYD G;  4DAP A;  1CK1 A;  2QF7 A;  4JV5 L;  1VMC A;  3JC6 6;  2RHQ B;  1E1T A;  1VQN A;  4LUO A;  1YHB A;  4KHP Q;  1IXR A;  5M5Y H;  4N9T A;  3PO3 B;  3D4W A;  5C3E G;  4QMG A;  3I3C A;  2D2C C;  3FKI H;  4IFD H;  4MTN A;  2HCI A;  3HOU B;  4C2M H;  4X66 Q;  2F0U A;  5JVH 3;  3I70 A;  1B50 A;  3W2D A;  2ID0 A;  3SEB A;  4CDF C;  3V2T A;  1EOT A;  1HQM C;  4JI5 L;  2E76 C;  1E0B A;  3URY A;  2VW9 A;  1BQQ T;  3SK4 A;  1AEX A;  1PTO C;  1RL2 A;  3J80 E;  5GAG C;  2WKC A;  1CKO A;  3PUY A;  4LF9 Q;  1AZQ A;  4JBJ A;  4A3M G;  2JEB I;  4ODG A;  5FLX E;  1DOL A;  3MEH A;  1BBX C;  2D5D A;  2DY8 A;  4LJZ C;  1XPO A;  2VUM H;  4LF8 Q;  1LT6 D;  2A6H C;  1EEF D;  2FIN B;  5FLM G;  1RKN A;  3FP9 A;  2L9H A;  1ENC A;  3E6Z X;  3J7Y W;  1SMX A;  1ET6 A;  4LF4 Q;  3S1M H;  1SND A;  3PGZ A;  2KED A;  1Q3L A;  4OIJ A;  5COR A;  5EPJ A;  2L15 A;  2F0K A;  1VQ6 A;  3WWV A;  2XVS A;  1XMQ Q;  1GUS A;  4LF6 L;  1PMR A;  1QWY A;  1S5C D;  5ELO A;  3OMC A;  4DK1 A;  1AZP A;  3HOY H;  2PMZ E;  3Q0A A;  1SYC A;  1KAB A;  1Q8K A;  1SE8 A;  4XYQ A;  3ICE A;  1S40 A;  1Y8N B;  2PZW A;  2Q2H A;  3PV0 A;  5DEH A;  2J4X A;  1HFG A;  5KNB A;  1EYC A;  1QG7 A;  2B2Y A;  1SN8 A;  2UXD Q;  1JWU D;  2KHS A;  4MZ9 A;  4A3G B;  3K5L A;  3KJO A;  1X6O A;  4RCN A;  4DPG A;  4O0A A;  1PDQ A;  1BCP C;  4H13 C;  1LAB A;  4Z9C B;  5FKA C;  2F4I A;  3DM1 A;  1IYJ B;  3I91 A;  5C44 B;  3S2D H;  1G2S A;  1NTG A;  2AWN A;  4MN3 A;  2EZV A;  4GKK Q;  1LTI D;  5FLX c;  2QKI C;  4L6T B;  1A3T A;  3I4O A;  1LT5 D;  1BKB A;  3GQB A;  4R4T A;  3R3O A;  3A5U A;  4JI0 L;  2TSS A;  3NSW A;  3N52 A;  4DR2 L;  2JXM B;  3GTM B;  3PMF A;  3DEO A;  4M1U B;  3JAM E;  2NTS A;  2YTY A;  4F88 A;  2EYF A;  3K7A H;  4L5S A;  2EJF C;  3CD6 A;  1BOS A;  2DJG C;  3S16 H;  3TRZ A;  1ENA A;  2KHI A;  5J3B A;  2CQO A;  1I4R A;  2N3S A;  2EYM A;  1B3A A;  1TU2 B;  3RN5 A;  1CA5 A;  5HGT A;  3HGB A;  1NR4 A;  1VQJ A;  2A6E C;  2G5D A;  4JC0 A;  1YNJ D;  3MTS A;  1XMO Q;  4YWK A;  2YU9 B;  4FF3 A;  3EVQ A;  4X3T A;  4MTK A;  2AQ1 B;  1ROD A;  2Z9H A;  2NVQ H;  4DR6 Q;  1HFN A;  4HSP A;  4G7Z C;  1HNZ Q;  1YVC A;  2VL6 A;  1G6Z A;  1TWG B;  4DV2 L;  2WAQ B;  3L0O A;  4RAU C;  3RZO H;  4JI6 L;  1STA A;  1LTR D;  3QB3 A;  3UDI A;  1VQG A;  3PIO 3;  1K83 H;  3U9O A;  4UY8 C;  2UUA Q;  3GTK H;  3HOW H;  5CYU A;  1X55 A;  1I50 B;  4BA1 I;  4JI8 L;  3R2I A;  3HOW G;  4A3B G;  4Q0F A;  2C5C A;  4X3U A;  1SXT A;  3KK7 A;  1K83 B;  2DUD A;  3A7A B;  2JYO A;  1Y1V B;  5DM6 3;  3PF4 A;  1Y8O B;  4BWG B;  1EY9 A;  1AP0 A;  5FJ8 H;  1F9S A;  3NQT A;  4A93 G;  5C44 H;  1CKN A;  2KEE A;  3BVZ A;  3ERQ A;  2F0E A;  4BY1 B;  3M3Y H;  3L3O C;  1N36 L;  4ZKB B;  1HUM A;  1ZYR C;  2KOL A;  2B3G A;  4UDU C;  4RFB A;  4DV4 Q;  4U68 A;  2D62 A;  2IHF A;  3HRZ C;  3TRE A;  1HH2 P;  5C0X H;  1YJ9 A;  2HUG A;  1P16 A;  3KBX A;  3C3L A;  2A69 C;  2HD3 A;  5GRO A;  2A74 C;  2KCC A;  3MXN A;  5M5X H;  4JI1 L;  4DV3 Q;  3G48 A;  5DLQ E;  5EKI A;  1I6H H;  4O42 A;  3KFU A;  1B44 D;  1ZKO A;  5CV5 A;  4QUF A;  3CW2 C;  1Q46 A;  3D4D A;  2Q8T A;  2ZXR A;  1SE2 A;  2EYJ A;  2F0L A;  2QDL A;  4B3M L;  4K6L A;  2VUM B;  1EQT A;  1HNW L;  5C5L A;  4JOI A;  2R7Z B;  3NEN A;  4A3B B;  1YNN D;  3A8J E;  3OTO Q;  4DR2 Q;  4CDC C;  3GO5 A;  5LMN Q;  3M7N A;  2R6G A;  1RDP D;  1KXL A;  4GLA C;  3RLO A;  3I4N H;  1D5X C;  1SAP A;  1PRT F;  3G4S A;  3HZX A;  3BZD B;  3CPW A;  3PUZ A;  1DGS A;  1E1O A;  3ULJ A;  3S1N H;  1FD7 D;  4IAL A;  2L55 A;  4N9P A;  5CBA E;  2Y0S E;  3DWP A;  4PZ6 A;  1Y1W G;  4A3B H;  3BG3 A;  1TWH B;  1UAP A;  5NUC A;  4QUC A;  5C3E H;  3F2C A;  4C3J H;  1M8A A;  3NXW A;  4UAI A;  4DV2 Q;  4FF1 A;  1EIY B;  2C9O A;  4BS9 A;  3PO2 H;  3HKZ B;  3H3V H;  1MKH A;  2EJG C;  3S9W A;  1TY0 A;  1L2F A;  1O80 A;  5C0X I;  2EYP A;  2WP8 J;  2BDO A;  2A19 A;  3D4R A;  4XTC S;  5CV8 A;  1EOV A;  3TS0 A;  4RKB A;  5L37 A;  4MHE A;  4JYA L;  1N32 Q;  3MAQ A;  4JI6 Q;  1EY6 A;  1JOK A;  4HJA A;  3D6C A;  3K57 A;  5FK9 C;  5IGG A;  1YNJ C;  1K0R A;  2H5X A;  4HED A;  3EJI A;  1F2Y A;  2JA6 G;  3KF6 A;  1UE7 A;  4KV6 A;  1B9N A;  3J81 L;  1PYB A;  4BY7 B;  5E4W C;  5IOD A;  1Y69 U;  1LT3 D;  3HOV H;  2K04 A;  2IPK D;  4JPB W;  4DR4 L;  1QZG A;  3HP3 A;  1IBM L;  2F4V L;  3QO2 A;  2K1B A;  4IJL A;  5F2D A;  1V9P A;  1DZ1 A;  1U4R A;  1D6E C;  4IUP A;  1Y1W B;  1HUN A;  1QNU A;  2G9H D;  1I4G A;  2KHJ A;  4KLK A;  3OMG A;  4A3I H;  1LLR D;  3GTK B;  1HHV A;  3CQZ B;  2JK8 A;  3FRP B;  4P75 A;  2ZJR A;  3QWN A;  2ICE C;  3NQI A;  2EDG A;  2ENB A;  3EA6 A;  2UUB L;  5CV4 A;  1GM5 A;  5A35 A;  3J7A V;  1HNW Q;  3K5O A;  1B2T A;  3HOZ H;  2O2L D;  1OXV A;  2NWG A;  2BOS A;  4PMC A;  3KLW A;  2Q2I A;  3QR8 A;  4IFD G;  1MGS A;  1HZA A;  5GAD C;  1D2B A;  2OTL A;  3TN2 A;  1G29 1;  3IKJ A;  4MIU A;  2ICI A;  2H1E A;  1IKL A;  1GUO A;  1CZG A;  1F9P A;  3D8G A;  4K6D A;  4EGV A;  5E7N A;  4PQX A;  3GDE A;  4QY7 A;  4HID A;  3RLF A;  1Q1B A;  5IGE A;  1A3V A;  5IP9 G;  2F0N A;  3FDT A;  3SDZ A;  4EX5 A;  2JA8 B;  4LF5 Q;  5EJW A;  1JQY D;  3T56 B;  1JB7 A;  1KD1 C;  4H0L C;  2QGQ A;  4A3E H;  2MQH A;  4DK6 C;  4R4Q A;  2J7Z A;  1EIH A;  1TWH H;  1J5E Q;  4H02 A;  1MJE A;  3I8Z A;  1X56 A;  2B8F A;  1S5F D;  4JBK A;  1U9R A;  5EBC A;  3E3X A;  2OT2 A;  2F0H A;  2AUJ D;  1JE5 A;  5AFW A;  3ULL A;  1SJE D;  3R2T A;  3PIO A;  1R9T B;  1Q82 C;  1CI3 M;  1QE6 A;  3MXG A;  2AWO A;  1FJG L;  1WJJ A;  3M4Q A;  3MZ5 A;  1ESR A;  4FXG C;  2WB1 G;  2A68 C;  2K5W A;  4HN7 A;  4RA8 A;  3CHB D;  2I0Q A;  1CTM A;  4B08 A;  4GNX A;  1OXT A;  3VYR A;  3AFQ A;  3KYH C;  1O78 A;  4FDB A;  1UWV A;  2L11 A;  2PQA B;  3MXN B;  2E2J H;  3ERO A;  4IUN A;  5E3F A;  3RLN A;  4KHZ A;  2KBN A;  5C44 G;  4HJ8 A;  5FJ8 G;  4HAE A;  4A93 H;  4PG3 A;  2RBM A;  3PUW A;  5IOC A;  4OO1 H;  3KF6 B;  4EQ5 A;  1I3Q B;  2OWO A;  1BCP B;  3ITP A;  3BZK A;  5C0X J;  3FPP A;  1HNX Q;  4QCL A;  1A63 A;  3OHX C;  4R4I A;  2EYO A;  4V19 0;  3SXH A;  4R4O A;  4XT1 B;  3RZD H;  4KJN A;  3A74 A;  3I90 A;  1FGB D;  3CCM A;  1I94 Q;  1VF5 C;  2FJ2 A;  1Z47 A;  3I56 A;  2VQF Q;  4R8I A;  1OTC A;  3I55 A;  3K58 A;  5I9O A;  4JBM A;  2EVB A;  5M3F G;  3H3V C;  4DUZ L;  3GTJ B;  3K0Y A;  2I46 A;  5M9O A;  2KJX A;  1IYU A;  1PFN A;  4A3I G;  5M3M B;  5CGK A;  4L5R C;  4DR7 Q;  1OO9 B;  4A3F H;  1XNR Q;  2FXQ A;  1GXD C;  1A3U A;  4ZUI A;  4TQU S;  1EWI A;  2M2L A;  1B8A A;  2CW0 D;  4H7B A;  3JAM i;  4LMQ D;  3GP7 A;  4JI2 L;  3BDO A;  5LMU L;  4L5T A;  4JG2 A;  2JA6 H;  4UHV A;  4C3H G;  1EIF A;  4IPD A;  1BNZ A;  3L9A X;  1KRT A;  3NTK A;  2Q8R E;  1HRJ A;  2IW3 A;  1W6K A;  1FYC A;  1L0Y B;  3MWY W;  1B7Y B;  3HOY B;  4BBS H;  2RDF A;  1E3P A;  2QEJ C;  2A68 D;  4A3J B;  1PFS A;  3CC4 A;  4GKK L;  4R8N A;  1UE5 A;  4H44 C;  4JBW A;  2NUC A;  2PQE A;  4NPS A;  2JA5 H;  4X62 Q;  1STG A;  3ER0 A;  4F87 A;  4B9W A;  4DV6 Q;  2B63 H;  3MFY A;  2K32 A;  2NB0 A;  3A55 A;  1SNM A;  2WAQ G;  1GUN A;  4K5W A;  1QNK A;  2F3I A;  5IGB A;  1DOM A;  2FMC A;  4PZ8 A;  3PSI A;  3GTL B;  3OW7 A;  1F9R A;  5C3E B;  5K36 G;  2LKV A;  4CDE C;  1NE3 A;  4OWT B;  2PMZ B;  2B2V C;  2K5N A;  4GS3 A;  5FO7 B;  3HOZ B;  1JWS D;  3LX0 A;  4WJ4 A;  2B2W A;  5KGU A;  1NMF A;  1I5F A;  5ELE A;  4A93 B;  3IFT A;  4ZAI A;  2RCF A;  1XXG A;  4LF5 L;  2E74 C;  2JSO A;  2K5V A;  1EY5 A;  3RD4 A;  5IYC H;  1BCP D;  2O4X A;  3EN2 A;  2R92 H;  2K5H A;  1ASY A;  1QJO A;  4NW2 A;  4LFB Q;  1F2L A;  3P20 A;  1G8Z D;  3HOV G;  3VA7 A;  4XQN A;  2NZO A;  2JEA I;  4XDX A;  3QIA A;  3W5O A;  3BZC A;  1SYE A;  1STN A;  3NEL A;  3S1Q B;  2EPB A;  1O7I A;  2KCN A;  5FLM H;  2CCZ A;  3MXU A;  2DY7 A;  1QUQ B;  4PV1 C;  3OSO A;  4LFA Q;  4X64 L;  1LT4 D;  1HQR D;  2R7D A;  1B53 A;  2KEN A;  2FFK B;  2LXK A;  3CCS A;  2RVL A;  4NP5 A;  5BN4 A;  1JB3 A;  1C48 A;  4RG1 A;  2F52 A;  2V1C C;  3E0J A;  5T1G A;  1D1I A;  3H09 A;  4ZLT F;  1IL2 A;  4UP8 A;  4XYO A;  4OHJ A;  1ZXT A;  1DM0 B;  3IFD A;  2EIF A;  2L12 A;  2A6H D;  3SK6 A;  4RHR A;  2Z6K C;  5EPL A;  3FKI G;  3Q6S A;  2KQ3 A;  1WOC A;  2WB1 E;  1EU4 A;  1C8C A;  3AMU A;  2VB3 X;  1X3G A;  4KTA A;  1GUW A;  5LL6 S;  2B29 A;  2CWP A;  1Z7T A;  4A3L H;  4UPA A;  4DV7 L;  2MFI A;  1S5B D;  2F0F A;  5CC4 A;  2R7Z H;  4AH6 A;  1YHQ A;  2CHB D;  4O1N A;  2I5L X;  2AUK A;  1GD7 A;  3DXJ C;  2EY1 A;  2K03 A;  1BUV T;  1M1K C;  4DR3 Q;  3SK5 A;  4ULL A;  2NYZ D;  2WAC A;  4RHS A;  5KND A;  1HNX L;  2D9U A;  1GHK A;  3L2P A;  2L5T A;  4IPG A;  3H0G H;  4BY7 G;  2F0Q A;  4KN7 C;  1QCB D;  5CR3 A;  3CCL A;  1KDA A;  4R1J A;  1UUP A;  4FXK C;  1N33 Q;  3W1B A;  1KLU D;  4JI8 Q;  2F3V A;  1CKN B;  5G3L F;  3GTP B;  1CSQ A;  1SNO A;  2F0J A;  1GUT A;  1WCM H;  3HG9 A;  1EWC A;  4G57 A;  3HFZ B;  5IWA L;  1XPR A;  4OXP A;  4WFN 3;  4G4K A;  1SE4 A;  4RCO A;  1E2Z A;  5AJ3 Q;  5C4H A;  2LFN A;  3NBH B;  5IT9 L;  1E2V A;  1B70 B;  5FO8 B;  1JJC B;  1TR5 A;  1V1P A;  4C3H H;  2YTX A;  2OQK A;  4DV4 L;  2E8G A;  4A3K G;  3TP8 A;  1IW7 C;  3G6J B;  3PIP 3;  3NEM A;  2MUY A;  2Z4I A;  3N6R A;  3BDL A;  5BR8 Q;  4HMJ A;  3A0J A;  5IYB H;  2IX1 A;  3QOJ A;  3CC7 A;  3KDF A;  4A3J H;  5DNF A;  1PYW D;  5JJZ A;  4A3F B;  3K80 C;  3D6W A;  3T13 A;  1BO0 A;  3S15 H;  3J7A 5;  1SSO A;  4CGY B;  4M8A A;  1ILQ A;  1OXS C;  1ZYR D;  3PUV A;  2EJM A;  2VQF L;  4FO2 A;  1YNX A;  1STH A;  3I4M B;  3A7L A;  5COY A;  1KDC A;  1XTD A;  1SYD A;  4A75 A;  2GVA A;  2WAQ E;  2QCP X;  4JI7 L;  4C3I B;  2YU9 H;  1D1K A;  3KLS X;  4KI0 A;  1K3R A;  1P8L A;  1GHJ A;  3K0X A;  1VQ4 A;  4TKO B;  3C2P A;  1KNA A;  3T51 B;  2I5M X;  1E24 A;  1X3E A;  5C4X B;  4AYB B;  2ZJQ A;  1QUQ A;  5EQ0 A;  1BR9 A;  3FPU B;  2B2V A;  2B39 A;  2WV6 D;  2G9D A;  4TRD A;  1JIC A;  3SR1 A;  5DM7 3;  1PRT C;  4A3C G;  3G7L A;  4JI2 Q;  4A3K B;  2JA8 G;  5C4J H;  4ZCK A;  2VUM G;  1NAP A;  1PH6 A;  3CC2 A;  1JJ2 A;  2C35 B;  3S2D B;  2BA1 A;  4LFA L;  3NBH A;  1X3P A;  2XWB B;  2UUC L;  2HIV A;  4O2D A;  2RDH A;  4I65 A;  5FLX L;  5A2Q E;  3HKS A;  3U50 C;  1LTT D;  5I6Y A;  3LWE A;  2XNA C;  4X62 L;  4LF9 L;  2E2I H;  3NPP A;  2J0T D;  4K8J A;  1PH8 A;  3H0G G;  1VQM A;  1JE4 A;  4UP7 A;  1PH5 A;  4DKA C;  4YWL A;  1K9M C;  1EWH A;  1HPC A;  3HOX B;  3ULP A;  3PO2 B;  2DGY A;  3KUP A;  3S15 B;  4EQN A;  2XIW A;  2RDG A;  2CH4 W;  1X9N A;  2ATW A;  5I9P A;  5IT9 c;  1CQV A;  1M4V A;  1DXM A;  4XQJ A;  1LYL A;  1CKM A;  2E2H H;  1AE2 A;  1EZ8 A;  2B2U A;  1V8Q A;  1WCM B;  3NTI A;  1WVL A;  2NBF A;  4OX9 L;  5EBD A;  1TQO A;  2LSS A;  2SNS A;  3J81 E;  4OON A;  5M3F H;  4GN4 B;  5EKK A;  1VDZ A;  1X3F A;  3AFP A;  2PCF B;  4DFA A;  1VQ8 A;  5GQO A;  5ELN A;  3AEV A;  1NCV A;  3SGI A;  3RZD B;  4FVM A;  2B2U C;  1RJT A;  2LMC B;  1FNW A;  3A54 A;  2EYH A;  1RCV D;  3W3A A;  4APV A;  4C1N I;  3RNU A;  2JA7 H;  3MFG A;  4DR5 L;  1TWA H;  4X6A H;  1CFM A;  1MSH A;  2FHT A;  2N78 A;  4LAA A;  4QL5 A;  4B3R L;  1C4Q A;  4A76 A;  1V1Q A;  3D3R A;  1TT2 A;  4JI7 Q;  1AH9 A;  2HHH L;  1STY A;  4NXN Q;  4N8F A;  1I3Q H;  1N9W A;  3I4N B;  1M90 C;  4IPC A;  3M4Y A;  3TZU A;  4IUV A;  2B63 G;  2R93 G;  2E5L Q;  2NVQ B;  3MVV A;  5CMD A;  1NJI C;  3QOL A;  1PA6 A;  5HGQ A;  5IGC A;  3OIP A;  4B3S Q;  1HZB A;  1XMO L;  5JVG 3;  2UXC L;  3K7A B;  1RD9 D;  3PQI A;  3VR2 A;  3PIP A;  4BBS G;  4IJH A;  1EEI D;  4PZ7 A;  4POF A;  3G6E A;  1I94 L;  3LGJ A;  2AQ2 B;  5LL6 X;  2RKS A;  2E5L L;  4Y7N H;  3OPO A;  2NVX B;  3VR4 A;  1WFQ A;  2WFW A;  4P74 A;  5CV6 A;  1QIL A;  2OF1 A;  4KKT A;  3TBI B;  3HOU H;  4OWX B;  3ERS X;  1IW7 D;  2Z6K A;  1LTG D;  3KJP A;  2RF4 A;  3E9H A;  5EKL A;  1TXY A;  1EQV A;  1S5D D;  3E5S A;  3U9S A;  3STB C;  3C46 A;  1TS2 A;  4RGO S;  3WOE A;  1IBL L;  5JPM C;  1TS4 A;  2HCC A;  1I6V C;  2B2T C;  4DUY Q;  2K75 A;  5LMN L;  3U4V A;  2R61 A;  4WJ3 M;  2CKZ B;  2PQA A;  2QDB A;  1VQP A;  2Z6B A;  3SE0 A;  1CSP A;  1PZK D;  2PPB C;  4A3L G;  3TS2 A;  1G91 A;  4DAY A;  4RH6 A;  1EZ6 A;  2NZ1 D;  2EY2 A;  2IJ0 A;  4X66 L;  3BYY B;  4DR3 L;  1KAW A;  4BBS B;  4C3I G;  1ET9 A;  2MO0 A;  5C6A A;  5G3L D;  1EYG A;  4PNY A;  3QJY A;  4C3J G;  3IAY A;  3Q24 A;  3UDF A;  4EVO A;  1TWG H;  4DNI A;  1MIU A;  5JPN C;  3C1E A;  3CF5 A;  1X3Q A;  3K81 C;  4DU9 A;  1HA5 A;  3HOU G;  4A3M B;  2F0O A;  5IP7 H;  4DN4 M;  5GAH C;  4IUR A;  1QB5 D;  3SK8 A;  1BDO A;  1UE6 A;  4NXN L;  2HHH Q;  1WD0 A;  4LWC A;  1TWA B;  2K6A A;  5M3M H;  5M5W H;  3D31 A;  1EL0 A;  1C9O A;  4IZ8 A;  2QEX A;  4NXM Q;  2SEB D;  1GO3 E;  1X32 A;  3CAM A;  4DR6 L;  1JC7 A;  4IFD J;  4YCV A;  3BVM A;  1MI2 A;  4TVA B;  1EYA A;  4LF7 L;  4N8X 1;  1YIT A;  4HSV A;  1VQK A;  2JQO A;  2XRQ D;  2F0I A;  2ES2 A;  3P7J A;  1LTL A;  3A8I E;  5IE8 A;  3OW2 A;  2EY6 A;  3VA5 A;  4BY7 H;  3KLR A;  1WTW A;  4EQP A;  3FKI B;  4A3E G;  3OIQ A;  1XNR L;  2F1M A;  5T1I A;  1JT8 A;  3I72 A;  3U58 A;  3MXP A;  5C0X G;  4XIG S;  1H9K A;  4ILW A;  4DR7 L;  1U4M A;  2CFM A;  1KTK A;  3TDQ A;  3GTO H;  4YIJ A;  1UNS A;  1XJV A;  4JI3 L;  4C1N K;  5IGF A;  4X65 Q;  4A3G G;  3PO2 G;  4C3H B;  4B3T L;  2K05 A;  2K50 A;  1L1O A;  2F0S A;  2VNU D;  3M85 A;  3S14 H;  2R92 B;  2CWA A;  2UU9 Q;  1B9M A;  1I50 H;  1CZW A;  3NTH A;  1L1O B;  4GNX B;  1W2B A;  2LXJ A;  5ELC A;  1RIP A;  2NVY H;  4DV0 L;  4IUQ A;  1W6J A;  4YWM A;  1L1O C;  1H95 A;  1AE3 A;  2HQE A;  1L0X B;  2KUM A;  2HDL A;  2A5H A;  2I5H A;  1N34 Q;  3T53 B;  4JI1 Q;  4DV3 L;  5C3W A;  1K8M A;  1SRU A;  4DF7 A;  2K5Q A;  4JYA Q;  1GUG A;  3TZD A;  2JA5 G;  4GZY C;  2UXC Q;  2UXB Q;  4WOR A;  1PFM A;  1TII D;  4G7O C;  1WCM G;  2PI2 E;  2OQ0 A;  1KC8 C;  1SFO H;  1EFI D;  1NBW A;  4DA2 A;  5EGT A;  3S2H B;  1H9J A;  4P2C B;  2RSO A;  4S3S A;  3NWS A;  1VQC A;  3O13 A;  1UE1 A;  4AQY Q;  1IL8 A;  3UE0 A;  3VR3 A;  4X3K A;  3MA2 B;  1MJC A;  3S16 B;  3PF5 A;  3BYT B;  3RMH A;  4K2L A;  4LF8 L;  3ND9 A;  2EXD A;  5ELD A;  3DLL A;  1Q86 C;  3BJU A;  4IO9 A;  4K8I A;  1ICF B;  1WYD A;  1SNP A;  4KD4 A;  4CDD C;  2H4O A;  4NXM L;  2ZM6 Q;  4DAM A;  4DV1 Q;  2UUB Q;  1XTC D;  4P73 A;  1IBK Q;  5BN3 A;  1TVX A;  1U5K A;  3J7Z C;  1Q1E A;  4JOI C;  4JVZ A;  3J80 i;  4OGQ C;  4DXF A;  3Q23 A;  1KQS A;  4HTH A;  4K0K Q;  2YTV A;  2PI2 A;  3GV3 A;  3S17 H;  1KLG D;  1ONL A;  1XYI A;  2ALY B;  5I4D A;  5I6W A;  3J81 c;  1PZJ D;  1SMY C;  4B3R Q;  4LK1 C;  5LHY 1;  4GN3 B;  1S72 A;  1EIG A;  3T1Y L;  1VQF A;  3K7U C;  3NK9 A;  2XGT A;  1II3 A;  3EIV A;  3LWU A;  4RGM A;  2Y0S G;  2D0O A;  1OXU A;  1K0S A;  1SYF A;  1JOQ A;  1FNU A;  2PNH A;  4ME3 A;  2HIX A;  3JAM c;  2BH8 A;  5JOB A;  4HJ5 A;  1XNQ L;  1UEA B;  3HKZ E;  4DR1 L;  3STB D;  1YHA A;  2HDM A;  4HCS A;  2MNA A;  3P75 A;  1BF4 A;  2K52 A;  2X6G A;  1SYB A;  1LTA D;  3S1R H;  1KRS A;  4NDX A;  3MEF A;  1F2M A;  1EY8 A;  1XWE A;  3R93 A;  3F2B A;  1S3O A;  2RSN A;  4HIM A;  3A56 A;  1CHP D;  4FXD A;  4DAV A;  2IX3 A;  3FEW X;  4KD3 A;  1V43 A;  5J1Z A;  1D7Q A;  3HS0 C;  4FYD A;  2JA7 B;  1CUK A;  1PH9 A;  3CRK C;  3T1H Q;  2R7Z G;  3BS1 A;  5D3I B;  2WIN B;  1R9T H;  3NE5 B;  2Y0S B;  5C3X A;  2B2W C;  4F8M A;  3KLS A;  1AN8 A;  3H6M A;  3NUC A;  3GD7 A;  4BA2 I;  4POG A;  1BBW A;  1IZ6 A;  1FVI A;  2P5Z X;  3TP5 A;  1SFO B;  3EFX D;  4IUT A;  3CRL C;  4YCU A;  2B63 B;  1RHP A;  1C7Y A;  1SEB D;  1VQB A;  3F2U A;  2MPM A;  1I4X A;  5K36 H;  3ND8 A;  4P71 A;  1Y1W H;  3BVG A;  1HCZ A;  3F2D A;  1NY4 A;  3I2Z A;  4JW0 A;  2UUC Q;  2CVR A;  2XSC A;  1K73 C;  3IRB A;  2KCM A;  4DGZ A;  5AJ3 L;  1B4O A;  4ZK9 B;  3I4N G;  4KKS A;  3S1Q H;  1U4L A;  3AYH B;  4C2M B;  5J22 A;  4B9X A;  2NVT H;  2R93 B;  3J80 L;  4J1M A;  1N34 L;  2K14 A;  3H91 A;  2KEC A;  1GOZ A;  3I7F A;  4PMB A;  4ZRZ A;  1YIJ A;  3K5N A;  4ZQ3 A;  3GTG B;  4OX9 Q;  4K5X A;  5GAE C;  2EY5 A;  2JA6 B;  3H94 A;  1SMY D;  1FJG Q;  1FNV A;  2WKD A;  1GVP A;  1XNQ Q;  3S1N B;  1N32 L;  3TSS A;  2OTJ A;  4IUU A;  4I7A A;  3VYU A;  4A4I A;  3GV6 A;  3TME A;  1I4Q A;  4CBV A;  4BBR G;  5IYC G;  1A6X A;  1NUC A;  2MP1 A;  1PYS B;  3RR5 A;  1PV4 A;  2HQL A;  1RTN A;  1X65 A;  4V0B A;  2AQ3 B;  3K8A A;  4DR4 Q;  2B2Y C;  1YEZ A;  2F4V Q;  4L8J A;  4B3M Q;  1O7L A;  4ZYS A;  5IP9 H;  2IX0 A;  1F77 A;  2K28 A;  3VR6 A;  3A5Z B;  4HCE A;  3X3N A;  1LO5 D;  5JEA G;  4RWS C;  2QW7 A;  4QIW E;  4Y7N B;  4RGN A;  4FF2 A;  3BDC A;  4PMW A;  2VQE L;  5E1F A;  4LFC Q;  2JP1 A;  3W1G A;  3CCJ A;  3GTG H;  1MD2 D;  4ID6 A;  5DAU A;  3S24 A;  4C3I H;  1WI5 A;  4UP9 A;  4GOP B;  3Q22 A;  3VYT A;  2QIL A;  2IY5 B;  2F0T A;  2VZA A;  1JMC A;  3T1H L;  1WTP A;  1A0I A;  2EXZ A;  1N8R C;  4L5Q A;  2IL8 A;  1KIX A;  3U4Z A;  2XN9 C;  1VQL A;  1EYD A;  5HUR A;  1HNZ L;  4KKU A;  2VS1 A;  1TWC B;  5KYI A;  5IT9 E;  2KVM A;  4IPH A;  3HOY G;  3SHL A;  2Q8I B;  1H9R A;  1GKH A;  2NN6 G;  3KF8 B;  4CHT B;  1VQA A;  3CCE A;  1T5E A;  3J80 c;  3H3V I;  1JOR A;  3GTQ H;  2L0C A;  4U67 3;  1JWM D;  2F0D A;  2Q2U A;  1SNQ A;  4MNO A;  1TWC H;  3DWA A;  2NTT A;  1EY4 A;  4NB3 A;  2Z4H A;  1QZH A;  1KNE A;  2F0P A;  2IHE A;  3VR5 A;  3KOJ A;  1QVC A;  2OCE A;  2ZTD A;  4DV5 Q;  5D3D A;  4I7Z C;  4A3E B;  1PVO A;  4NKL A;  2E2I B;  1J9O A;  1PFB A;  3K6O A;  3S14 B;  1SRO A;  3TEH B;  1KDB A;  2N49 A;  1WTH A;  2K7V A;  2Z8L A;  1ASZ A;  3C1F A;  2YYZ A;  4KK7 A;  3SVM A;  4HJ7 A;  1T5X D;  4DR5 Q;  1FGU A;  1CM9 A;  2N55 A;  2VB2 X;  4AIM A;  4JI5 Q;  4FP5 D;  3I4M G;  4GKJ Q;  2PYK A;  1XPU A;  4KY6 A;  3OWE B;  5HY6 A;  4R9W A;  4FF4 A;  1EY7 A;  3CU7 A;  2VXW A;  4GN5 A;  4OL7 A;  2UUA L;  2K5D A;  1YJN A;  2OXP A;  1H9S A;  1PTO F;  2RHS B;  4OO1 I;  2VY3 A;  2M9V A;  1RF2 D;  1GJX A;  1PH7 A;  4GLX A;  2JA7 G;  4AYB G;  4A3I B;  2AKW B;  3MHB A;  1D8L A;  2L4N A;  4CKE A;  4JI4 Q;  2JJQ A;  1PRT D;  1I4H A;  4CKB A;  3TQY A;  1IBL Q;  3L7Z C;  4RMF A;  4LW1 A;  4LF7 Q;  2I07 B;  3UDX A;  5TSS A;  4IOC A;  5C4X H;  5M5W B;  2PNR C;  5BN5 A;  5D65 A;  4JI4 L;  2A1A A;  4OEL B;  5LMU Q;  1EUJ A;  3F8T A;  5C5M A;  1PTO H;  2ZXP A;  3AQQ A;  3CCU A;  4A3J G;  4JV5 Q;  1LM0 A;  5D14 A;  1PHJ A;  1K28 A;  4LUZ A;  1RTO A;  1TY2 A;  5JJK A;  3CCQ A;  2OEO A;  2RQX A;  4YY3 L;  3DMU A;  1PH2 A;  4K5V A;  2JA5 B;  4OWW B;  3HOX G;  1WTV A;  2MJ8 A;  4NMZ A;  1OXX K;  1SYG A;  4A3D G;  4X65 L;  4JI3 Q;  4ZUJ A;  1S5E D;  4BBR B;  2PW7 A;  4HMI A;  4YY3 Q;  1D5Z C;  1SBB B;  2IT1 A;  2Z0S A;  3RUZ A;  3DHQ A;  3A8K E;  1VQ5 A;  5K5P A;  3GTO B;  4AYB E;  3S1M B;  1BCP F;  1O7Z A;  1Z9F A;  4YCW A;  5C4J B;  5KIX A;  1R4Q B;  2L1B A;  3CP0 A;  3FMC A;  1JOO A;  1HTL D;  2AMC B;  3DWQ A;  4GLV B;  5KYL A;  3CCV A;  1HJP A;  4C3J B;  3T16 A;  1K8O A;  1CA6 A;  4DNR B;  4QJF A;  3EQL C;  2BE5 D;  1ZEQ X;  3CCR A;  1E7Z A;  1ILP A;  5JEA H;  4IOA A;  2UXB L;  1N33 L;  1TKW B;  2QA4 A;  3M4P A;  3HOZ G;  3GTL H;  2EE1 A;  1WTO A;  1I4P A;  3OOC A;  4C56 C;  1JR0 D;  2KCT A;  1PH4 A;  4IQZ A;  3HOV B;  1IYV A;  5A2Q L;  1PH3 A;  1SNC A;  3TP7 A;  1IHZ A;  1SE3 A;  2DNE A;  1LAC A;  1VMP A;  2A8V A;  4A3D B;  5CV9 A;  3DUZ A;  1K8G A;  5KRU A;  4BBR H;  5E4X A;  1E22 A;  4JK1 C;  2GVB A;  2GN5 A;  4CJ2 C;  1A2U A;  1KHI A;  3G71 A;  3T4A C;  1O7Y A;  2KA7 A;  3PO3 G;  2CH4 A;  2F3W A;  1AFP A;  4F7X A;  5IWA Q;  1PXU A;  3DEP A;  1PLF A;  1A8V A;  1VQE A;  4ZKC B;  4CKC A;  5KEE A;  4FNF A;  5M5X B;  1WTR A;  1VQI A;  2BDN A;  1NMG A;  1VQH A;  3P1H A;  4KJO A;  4HIK A;  1IBK L;  4BY1 G;  2K33 A;  3J7A F;  1PTO B;  4XXE A;  5M3M G;  2DNC A;  1Y14 B;  2TMP A;  1IKM A;  4BY1 H;  3M3Y B;  2RCN A;  1SJH D;  1W3S A;  2B2T A;  1J5E L;  1R4P B;  3S17 B;  1B1Z A;  5JAV A;  1J6Q A;  2N8N A;  5LMN W;  2HT1 A;  2JA8 H;  1KAA A;  4OIK A;  1UEB A;  3LNN A;  2XWJ B;  2EOT A;  4K14 A;  1HZC A;  1J8I A;  3H0G B;  2VQE Q;  3GTQ B;  3CKI B;  3ZJY C;  4LUV A;  1NR2 A;  2AHO B;  4IN3 A;  5EPK A;  4JCV E;  3GTP H;  4KY7 A;  1Q12 A;  3GTJ H;  4WJW A;  1ICW A;  1NSN S;  1VQ7 A;  1Q81 C;  3M7G A;  1ESF A;  3JAM L;  1S4Z A;  4HJ9 A;  2N88 A;  2FMM A;  2E75 C;  1DCZ A;  5IY0 A;  2MO1 A;  1STE A;  3K5M A;  2ZXO A;  3I73 A;  3QG1 A;  4QB4 A;  1QVF A;  1EU3 A;  4ALP A;  1YNN C;  1SLJ A;  3UE1 A;  4B3S L;  4GKJ L;  1EY0 A;  2DN8 A;  3F1Z A;  1YBY A;  5J39 A;  4DNT B;  4QF4 A;  4DAY B;  4YHH L;  3H15 A;  2X69 A;  3BU2 A;  4QGU A;  4J15 A;  3V96 A;  3X3M A;  2ZTC A;  4Q5V A;  2DJF C;  2MHV A;  1HXY D;  4K0K L;  2LS0 1;  2O5I C;  2E2J B;  3Q8D A;  2XTI A;  4A3K H;  5IIF A;  2B8G A;  1CT1 D;  1HZ9 A;  5C4Z A;  2ASB A;  2ZM6 L;  1QVG A;  3S2H H;  4YHH Q;  1ENF A;  4X3S A;  4BXX G;  1F9Q A;  1LTB D;  3D0F A;  4KN4 C;  3K59 A;  3DM3 A;  3J81 i;  3CMA A;  3KBG A;  4R4C A;  1PTO D;  1VQO A;  4Y52 H;  3FHW A;  4BXX H;  4IFD I;  1TWF H;  5H1S E;  3HKZ G;  1N36 Q;  3CME A;  2JE6 I;  1T9H A;  4X64 Q;  4DV6 L;  1BBU A;  1Y1V H;  4A3C H;  1K3B C;  1FL0 A;  1TS3 A;  2R93 H;  2NVT B;  2SNM A;  4LF4 L;  1CQF A;  2R7F A;  2NVX H;  1XX8 A;  1C0A A;  2PZU A;  2CQA A;  4DK0 A;  1VQ9 A;  1DON A;  2JN4 A;  4J6H A;  3RZO B;  1D5M C;  2ZJP A;  1K8A C;  1JJG A;  4TSS A;  3ZYY X;  4HIO A;  4ME5 A;  4GNX C;  3E0E A;  1H9M A;  2CW0 C;  2YV5 A;  3PCO B;  2IWH A;  3NHH A;  2V4D A;  1YZ6 A;  1SDF A;  5JJI A;  1F2Z A;  5CBE E;  5CV7 A;  1BVS A;  1AW7 A;  2MGS A;  2PO4 A;  2F03 A;  1A62 A;  1VQD A;  3I4L A;  2A6E D;  1HR0 L;  4XQQ A;  4DV7 Q;  1Q90 A;  5IYB G;  1YJW A;  3M9B A;  2F0V A;  3NWT A;  2F0G A;  4OEM B;  2SDF A;  1A15 A;  4OO1 G;  1U4P A;  1Y1V G;  2M00 A;  1SR3 A;  3AB9 A;  4DV0 Q;  4LNQ A;  1HA6 A;  3HEJ A;  5M3F B;  2PW5 A;  4QIW B;  2WII B;  3EBE A;  2NVY B;  1XMQ L;  5FOB B;  3S1R B;  2Q2T A;  1PZI D;  1JCK B;  1TS5 A;  3V05 A;  1Q7Y C;  4LF6 Q;  1I6H B;  2Z1C A;  1CHQ D;  2BH2 A;  4ABN A;  5JJL A;  5M5Y B;  4DUY L;  4JI0 Q;  2XRS D;  5ISR A;  2EYL A;  2K4K A;  1WTQ A;  1QOH A;  4QQB X;  3R8B A;  3HOX H;  3J81 j;  2ZTE A;  3RN2 A;  5IP7 G;  1G6P A;  5I2X A;  4EQO A;  3VYS A;  1Q8I A;  1STB A;  1BXT A;  2EQS A;  5I2Y A;  3PO3 H;  3WOF A;  3CPF A;  1DYQ A;  5EAY A;  1LV9 A;  1MHW C;  2F0W A;  3TP6 A;  2ZT9 C;  5FO9 B;  1A2T A;  2PZT A;  2X6L A;  4A3G H;  2WB1 B;  1Z6H A;  4KMU C;  2R3Z A;  2NN6 H;  5BR8 L;  3NBI A;  2RA4 A;  2BA0 A;  3VDY A;  4KHV A;  2NN6 I;  1VCI A;  4DK3 C;  1FR3 A;  4DV1 L;  2UXD L;  1VS0 A;  4KHP L;  1G2T A;  3M4O H;  3KF8 A;  1B3Q A;  3IL8 A;  1WD1 A;  2SOB A; 
#chains in the Genus database with same CATH homology
 5ELN A;  3AEV A;  2IY5 B;  2VZA A;  1JMC A;  3UDG A;  5E7N A;  3SGI A;  3GDE A;  3T1H L;  1IBM Q;  1A0I A;  4QY7 A;  4HID A;  3RLF A;  4APV A;  1N8R C;  4L5Q A;  2JA7 H;  1EQQ A;  3RNU A;  1KIX A;  1Q1B A;  2D0P A;  2UU9 L;  4DR5 L;  1TWA H;  3U4Z A;  4X6A H;  5IP9 G;  2N78 A;  4QL5 A;  1U0L A;  1VQL A;  4B3R L;  4LFB L;  4DV5 L;  4A76 A;  1V1Q A;  4EX5 A;  1HNZ L;  2VS1 A;  4JI7 Q;  4LF5 Q;  2HHH L;  4NXN Q;  1AH9 A;  4IPH A;  3HOY G;  1I3Q H;  1N9W A;  4GOP A;  4AQY L;  1M90 C;  1KL9 A;  1GKH A;  2NN6 G;  4IPC A;  1KD1 C;  1JB7 A;  3KF8 B;  2QGQ A;  4A3E H;  1VQA A;  3CCE A;  3J80 c;  2MQH A;  2B63 G;  4DK6 C;  2E5L Q;  3H3V I;  3I4M H;  4R4Q A;  4A3M H;  1NJI C;  3GTQ H;  2R93 G;  1PA6 A;  1TWH H;  1G51 A;  1J5E Q;  4H02 A;  5HGQ A;  1MJE A;  1EFW A;  3E9I A;  1X56 A;  4MNO A;  2Q2U A;  1EQR A;  1HR0 W;  3KDF B;  4B3S Q;  1HZB A;  1XMO L;  2UXC L;  1TWC H;  3PIP A;  4JBK A;  4BBS G;  4IJH A;  4PZ7 A;  4POF A;  4NB3 A;  3G6E A;  1I94 L;  1JE5 A;  3LGJ A;  3ULL A;  1QZH A;  4A3D H;  4DR1 Q;  2IHE A;  3PIO A;  3KOJ A;  2E5L L;  1QVC A;  4Y7N H;  4LFC L;  2OCE A;  1Q82 C;  1HR0 Q;  1WFQ A;  2ZTD A;  1L0W A;  2AWO A;  2WFW A;  4P74 A;  1LUZ A;  1WJJ A;  4DV5 Q;  3M4Q A;  1FJG L;  1PVO A;  2WB1 G;  4OWX B;  3ERS X;  3HOU H;  4GOP C;  2I0Q A;  2Z6K A;  3KJP A;  1SRO A;  4B3T Q;  3TEH B;  2RF4 A;  2N49 A;  3E9H A;  4GNX A;  1TXY A;  1OXT A;  1ASZ A;  2YYZ A;  4A3F G;  3AFQ A;  3KYH C;  3CXC A;  4HJ7 A;  2R92 G;  3B6Y A;  3STB C;  3CQZ H;  3OYY A;  4DR5 Q;  1UWV A;  2PQA B;  1X54 A;  4FDB A;  1FGU A;  5JEA J;  3GTM H;  3MXN B;  2E2J H;  4AIM A;  4JI5 Q;  3RLN A;  3T1Y Q;  4KHZ A;  3I4M G;  4GKJ Q;  2KBN A;  5C44 G;  4DUZ Q;  1IBL L;  1XPU A;  5C4X G;  4HJ8 A;  5FJ8 G;  4A93 H;  5HY6 A;  4PG3 A;  5IYD H;  3PUW A;  4DUY Q;  4GN5 A;  3KF6 B;  4EQ5 A;  2UUA L;  2K75 A;  3OTO L;  2OWO A;  1YJN A;  2JA9 A;  3BZK A;  2RHS B;  5LMN L;  3U4V A;  2VY3 A;  5C0X J;  4OO1 I;  4WJ3 M;  3PUX A;  1HNX Q;  2CKZ B;  2PQA A;  1PH7 A;  4P72 A;  4GLX A;  1A63 A;  4R4I A;  1VQP A;  1YI2 A;  1PH1 A;  2JA7 G;  2NZH A;  4AYB G;  5IYD G;  1CSP A;  4A3L G;  2AKW B;  3TS2 A;  4R4O A;  4JV5 L;  3RZD H;  1D8L A;  3A74 A;  3JC6 6;  3CCM A;  1I94 Q;  4X66 L;  4JI4 Q;  1Z47 A;  2JJQ A;  1E1T A;  2RHQ B;  3I56 A;  1VQN A;  4DR3 L;  2VQF Q;  1OTC A;  1KAW A;  3I55 A;  2MO0 A;  4LUO A;  4JBM A;  5M3F G;  1EYG A;  1YHB A;  4KHP Q;  1IXR A;  3UDF A;  5M5Y H;  3TQY A;  1TWG H;  4DUZ L;  5C3E G;  3L7Z C;  4RMF A;  1IBL Q;  4LW1 A;  4LF7 Q;  4DNI A;  1MIU A;  3FKI H;  3UDX A;  3CF5 A;  4IOC A;  5C4X H;  3K81 C;  4MTN A;  4C2M H;  4A3I G;  4X66 Q;  4JI4 L;  2A1A A;  4L5R C;  3HOU G;  5LMU Q;  4DR7 Q;  5IP7 H;  1EUJ A;  3F8T A;  2ID0 A;  5GAH C;  4JI5 L;  3AQQ A;  3CCU A;  4A3F H;  1UE6 A;  4NXN L;  2VW9 A;  2HHH Q;  4A3J G;  1XNR Q;  4JV5 Q;  1LM0 A;  2FXQ A;  1PHJ A;  4LWC A;  1RL2 A;  4TQU S;  1EWI A;  4LUZ A;  5JJK A;  1B8A A;  3CCQ A;  5GAG C;  5M3M H;  3JAM i;  5M5W H;  3D31 A;  4JI2 L;  4YY3 L;  1C9O A;  5LMU L;  2QEX A;  1PH2 A;  4NXM Q;  1CKO A;  3PUY A;  4JG2 A;  4L5T A;  1GO3 E;  2JA6 H;  4LF9 Q;  3CAM A;  1EIF A;  4IPD A;  4OWW B;  3HOX G;  4JBJ A;  4A3M G;  4YCV A;  1KRT A;  4DR6 L;  4IFD J;  2JEB I;  1OXX K;  4TVA B;  2VUM H;  1XPO A;  4LF8 Q;  4A3D G;  4LF7 L;  4X65 L;  4JI3 Q;  5FLM G;  1B7Y B;  3FP9 A;  1YIT A;  4BBS H;  1VQK A;  1E3P A;  2JQO A;  1SMX A;  2ES2 A;  4LF4 Q;  1PFS A;  1LTL A;  3CC4 A;  5IE8 A;  3PGZ A;  3OW2 A;  3S1M H;  4GKK L;  4YY3 Q;  1UE5 A;  4JBW A;  4BY7 H;  4NPS A;  2JA5 H;  4X62 Q;  2IT1 A;  2L15 A;  2Z0S A;  3ER0 A;  1VQ6 A;  3WWV A;  1XMQ Q;  1VQ5 A;  4DV6 Q;  2B63 H;  4A3E G;  4LF6 L;  1XNR L;  5ELO A;  4AYB E;  1Z9F A;  4YCW A;  1JT8 A;  2WAQ G;  3U58 A;  3HOY H;  5C0X G;  2PMZ E;  2F3I A;  4XIG S;  1Q8K A;  1SE8 A;  3CP0 A;  3ICE A;  1S40 A;  4PZ8 A;  3PSI A;  4DR7 L;  2CFM A;  2AMC B;  2Q2H A;  4GLV B;  3CCV A;  3PV0 A;  1HJP A;  3GTO H;  5K36 G;  1SN8 A;  4QJF A;  2UXD Q;  1XJV A;  4JI3 L;  4X65 Q;  1NE3 A;  4MZ9 A;  3CCR A;  1E7Z A;  4OWT B;  4A3G G;  3PO2 G;  4IOA A;  2K5N A;  4GS3 A;  2UXB L;  1N33 L;  3KJO A;  2QA4 A;  4B3T L;  3M4P A;  2K50 A;  1L1O A;  1X6O A;  3GTL H;  3HOZ G;  2VNU D;  3M85 A;  4WJ4 A;  4DPG A;  3S14 H;  4O0A A;  1NMF A;  2KCT A;  1PH4 A;  1I5F A;  2CWA A;  2UU9 Q;  1PH3 A;  1I50 H;  4LF5 L;  4GNX B;  1IYJ B;  1L1O B;  1W2B A;  2LXJ A;  1RIP A;  2K5V A;  2NVY H;  4DV0 L;  2A8V A;  3S2D H;  1NTG A;  2AWN A;  4GKK Q;  1K8G A;  5IYC H;  4YWM A;  4BBR H;  1L1O C;  5FLX c;  3EN2 A;  1H95 A;  1AE3 A;  2R92 H;  2K5H A;  3I4O A;  1ASY A;  1E22 A;  2I5H A;  1N34 Q;  2GVB A;  2GN5 A;  3G71 A;  1KHI A;  4LFB Q;  4JI1 Q;  4DV3 L;  3PO3 G;  1BKB A;  3HOV G;  1SRU A;  2UXC Q;  4JYA Q;  2NZO A;  2JEA I;  2JA5 G;  4R4T A;  2UXB Q;  5IWA Q;  3W5O A;  3A5U A;  4JI0 L;  3BZC A;  4DR2 L;  1A8V A;  1VQE A;  3NEL A;  1WCM G;  2PI2 E;  2OQ0 A;  2CCZ A;  1O7I A;  5FLM H;  1KC8 C;  1SFO H;  1NBW A;  2YTY A;  1QUQ B;  4LFA Q;  3K7A H;  4L5S A;  1VQI A;  1NMG A;  1VQH A;  1IBK L;  4HIK A;  4X64 L;  3CD6 A;  2R7D A;  4BY1 G;  2KEN A;  3S16 H;  3TRZ A;  2KHI A;  2LXK A;  1VQC A;  3CCS A;  5J3B A;  1UE1 A;  4AQY Q;  4RG1 A;  2CQO A;  2F52 A;  2V1C C;  3UE0 A;  2N3S A;  5M3M G;  1Y14 B;  3RN5 A;  4BY1 H;  1IL2 A;  2RCN A;  1MJC A;  1W3S A;  4UP8 A;  1VQJ A;  3PF5 A;  4JC0 A;  1J5E L;  2EIF A;  4LF8 L;  1J6Q A;  2N8N A;  5LMN W;  2EXD A;  1XMO Q;  2HT1 A;  4YWK A;  2JA8 H;  3DLL A;  1Q86 C;  3BJU A;  4IO9 A;  1UEB A;  1WYD A;  2Z6K C;  1HZC A;  2VQE Q;  3FKI G;  4NXM L;  2ZM6 Q;  2NVQ H;  4DAM A;  4DV1 Q;  2UUB Q;  4DR6 Q;  4P73 A;  3ZJY C;  4LUV A;  1IBK Q;  2AHO B;  1WOC A;  2WB1 E;  1U5K A;  3J7Z C;  1Q1E A;  4JCV E;  4JOI C;  1HNZ Q;  1YVC A;  2VL6 A;  3J80 i;  3GTP H;  3GTJ H;  1Q12 A;  4DV2 L;  3L0O A;  1KQS A;  3RZO H;  4K0K Q;  4JI6 L;  2YTV A;  1X3G A;  2PI2 A;  3UDI A;  3S17 H;  1VQ7 A;  1Q81 C;  1VQG A;  1K83 H;  2B29 A;  4HJ9 A;  2ALY B;  2CWP A;  4UY8 C;  2UUA Q;  3GTK H;  3HOW H;  3J81 c;  1X55 A;  2MO1 A;  5IY0 A;  4A3L H;  4UPA A;  4B3R Q;  4DV7 L;  4BA1 I;  4GN3 B;  4JI8 L;  2MFI A;  4ALP A;  3T1Y L;  1S72 A;  1QVF A;  3HOW G;  1SLJ A;  1VQF A;  3K7U C;  3UE1 A;  4B3S L;  2R7Z H;  4AH6 A;  4A3B G;  4GKJ L;  1YHQ A;  3F1Z A;  1YBY A;  2I5L X;  2XGT A;  1GD7 A;  2DUD A;  3EIV A;  4DAY B;  2Y0S G;  3PF4 A;  2D0O A;  1M1K C;  1OXU A;  5FJ8 H;  4A93 G;  4DR3 Q;  4YHH L;  5C44 H;  2PNH A;  1CKN A;  3BU2 A;  4ME3 A;  4QGU A;  3H15 A;  1HNX L;  4J15 A;  3M3Y H;  2ZTC A;  3L2P A;  1N36 L;  2HIX A;  3JAM c;  2B3G A;  2BH8 A;  4DV4 Q;  4IPG A;  3H0G H;  4HJ5 A;  4BY7 G;  1XNQ L;  2D62 A;  4K0K L;  2IHF A;  3HKZ E;  3Q8D A;  2XTI A;  3TRE A;  1HH2 P;  4DR1 L;  3CCL A;  3STB D;  4A3K H;  4R1J A;  1YJ9 A;  1N33 Q;  1YHA A;  1HZ9 A;  3W1B A;  1P16 A;  2ASB A;  2ZM6 L;  2MNA A;  1QVG A;  3S2H H;  4YHH Q;  5GRO A;  5M5X H;  4JI8 Q;  4BXX G;  1CKN B;  4JI1 L;  4DV3 Q;  2K52 A;  3G48 A;  1CSQ A;  5DLQ E;  1I6H H;  3D0F A;  1WCM H;  3DM3 A;  3J81 i;  3S1R H;  3CMA A;  1KRS A;  3HFZ B;  5IWA L;  1XPR A;  4OXP A;  3MEF A;  3KFU A;  4R4C A;  3CW2 C;  3F2B A;  1Q46 A;  1S3O A;  5AJ3 Q;  1VQO A;  4HIM A;  4Y52 H;  3FHW A;  4BXX H;  4IFD I;  1TWF H;  4B3M L;  5H1S E;  3NBH B;  3HKZ G;  1N36 Q;  3CME A;  2JE6 I;  1T9H A;  4X64 Q;  4DV6 L;  1BBU A;  1B70 B;  1JJC B;  1Y1V H;  4A3C H;  4C3H H;  4DV4 L;  2YTX A;  2OQK A;  4A3K G;  2E8G A;  1HNW L;  1V43 A;  1D7Q A;  1FL0 A;  2R93 H;  3NEM A;  4JOI A;  1CUK A;  3NEN A;  1PH9 A;  3T1H Q;  5BR8 Q;  2R7Z G;  3OTO Q;  3A0J A;  5IYB H;  4LF4 L;  4DR2 Q;  2R7F A;  2IX1 A;  3GO5 A;  3CC7 A;  3KDF A;  5LMN Q;  1R9T H;  4A3J H;  2R6G A;  2NVX H;  3M7N A;  1C0A A;  1KXL A;  4GLA C;  3RLO A;  3I4N H;  1VQ9 A;  3K80 C;  3G4S A;  3GD7 A;  3S15 H;  4BA2 I;  4POG A;  1BBW A;  1IZ6 A;  1FVI A;  3CPW A;  3PUZ A;  3J7A 5;  1DGS A;  2ZJP A;  1E1O A;  3ULJ A;  1K8A C;  3S1N H;  4YCU A;  1JJG A;  2Y0S E;  1OXS C;  3PUV A;  4PZ6 A;  1Y1W G;  4HIO A;  1C7Y A;  2VQF L;  4A3B H;  1VQB A;  4GNX C;  3E0E A;  5C3E H;  2YV5 A;  1YNX A;  3PCO B;  3F2C A;  4P71 A;  4C3J H;  1Y1W H;  1XTD A;  3F2D A;  4A75 A;  1NY4 A;  3I2Z A;  1YZ6 A;  4DV2 Q;  2GVA A;  2WAQ E;  2UUC Q;  4JI7 L;  1EIY B;  1K73 C;  2YU9 H;  5JJI A;  3IRB A;  4KI0 A;  2KCM A;  1K3R A;  1P8L A;  3K0X A;  1BVS A;  1VQ4 A;  3H3V H;  1MKH A;  3PO2 H;  5AJ3 L;  1A62 A;  3I4N G;  1VQD A;  3S1Q H;  1L2F A;  3AYH B;  1HR0 L;  2I5M X;  1E24 A;  1X3E A;  2WP8 J;  5C0X I;  4DV7 Q;  1QUQ A;  2A19 A;  2ZJQ A;  2NVT H;  5IYB G;  1YJW A;  3M9B A;  1N34 L;  2K14 A;  4XTC S;  1EOV A;  3I7F A;  3TS0 A;  4JYA L;  1N32 Q;  4OO1 G;  1YIJ A;  4JI6 Q;  4A3C G;  1Y1V G;  4JI2 Q;  4DV0 Q;  1SR3 A;  4HJA A;  4LNQ A;  2JA8 G;  5C4J H;  2VUM G;  4OX9 Q;  1K0R A;  1PH6 A;  3CC2 A;  2H5X A;  2C35 B;  3EBE A;  5GAE C;  1JJ2 A;  2BA1 A;  1XMQ L;  4LFA L;  2Q2T A;  1Q7Y C;  1FJG Q;  4LF6 Q;  2UUC L;  2HIV A;  2JA6 G;  4O2D A;  1GVP A;  3KF6 A;  1XNQ Q;  1UE7 A;  1PYB A;  3HKS A;  2BH2 A;  1N32 L;  5JJL A;  3U50 C;  4DUY L;  3HOV H;  4JI0 Q;  4DR4 L;  1QZG A;  1IBM L;  2OTJ A;  2F4V L;  2K4K A;  4X62 L;  4A4I A;  4LF9 L;  4IJL A;  1V9P A;  4QQB X;  3HOX H;  3J81 j;  2E2I H;  4BBR G;  2ZTE A;  5IYC G;  3RN2 A;  5IP7 G;  1PH8 A;  1G6P A;  1PYS B;  2KHJ A;  4KLK A;  3RR5 A;  2HQL A;  1X65 A;  3H0G G;  4A3I H;  1VQM A;  1PV4 A;  4UP7 A;  1PH5 A;  2JK8 A;  4DKA C;  4YWL A;  4P75 A;  3K8A A;  1K9M C;  2EQS A;  4DR4 Q;  2ZJR A;  3PO3 H;  3ULP A;  1YEZ A;  2DGY A;  2F4V Q;  3CPF A;  4B3M Q;  5EAY A;  1X9N A;  2UUB L;  2ATW A;  5IP9 H;  1GM5 A;  5IT9 c;  2IX0 A;  1HNW Q;  3HOZ H;  3A5Z B;  1LYL A;  1CKM A;  1OXV A;  2E2H H;  1AE2 A;  5JEA G;  4A3G H;  3KLW A;  2Q2I A;  5BR8 L;  4QIW E;  4IFD G;  2BA0 A;  3VDY A;  4OX9 L;  2NN6 I;  2LSS A;  1HZA A;  4PMW A;  1VCI A;  5GAD C;  2VQE L;  4LFC Q;  2OTL A;  3W1G A;  4DK3 C;  3CCJ A;  3GTG H;  5M3F H;  4OON A;  4DV1 L;  2UXD L;  4GN4 B;  3S24 A;  4C3I H;  1G29 1;  1VS0 A;  4KHP L;  3M4O H;  1WI5 A;  4UP9 A;  4GOP B;  1X3F A;  3AFP A;  1VQ8 A;  5GQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...