3F2UA

Crystal structure of human chromobox homolog 1 (cbx1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
GEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Chromobox protein homolog 1
publication title Crystal structure of the complex of human chromobox homolog 1 (CBX1)
rcsb
source organism Homo sapiens
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3f2uA00
4CJ2C 1JE4A 1F9PA 2HDMA 4XDXA 1GUWA 5D65A 1BNZA 2RA4A 2RSOA 1WD0A 5COYA 2KEEA 4R9WA 3FPUB 1F9QA 3G7LA 2B2VA 1RODA 4OIJA 1XYIA 1PFBA 4IUTA 1G2SA 1BBXC 2DY7A 1WD1A 1EIHA 5CBEE 1HUNA 1MSHA 2R3ZA 2L11A 1NR4A 1O80A 1U4PA 2FFKB 2IL8A 3DM1A 3KBXA 4ZKBB 1DOMA 4X3TA 2CVRA 1J9OA 3DEOA 1WVLA 4U68A 1EQTA 2B2TC 1QE6A 5EPJA 1ILPA 1WTWA 1AZQA 1QNKA 2KECA 2X6GA 3FDTA 3LWEA 4IUPA 1M8AA 4CJ0B 1U4LA 1RTNA 2K01A 5EJWA 2MGSA 4ZAIA 4RAUC 3D6WA 1BF4A 2NZ1D 4HCSA 1NCVA 2FJ2A 1A15A 1HFGA 2Q8RE 3KUPA 4UAIA 2EPBA 2KEDA 2KVMA 4NW2A 5AFWA 2BDNA 2L12A 5JJZA 3I91A 4IUVA 2HDLA 4X3KA 5CORA 1KNAA 1SAPA 5D14A 1WTQA 3GV3A 2X6LA 1HUMA 1ZXTA 4MHEA 4X3SA 4ZLTF 1DZ1A 4IURA 4XT1B 1QG7A 1B3AA 2JP1A 1B2TA 1JICA 2HCCA 1ESRA 1HHVA 1SSOA 2L4NA 1O7ZA 1RTOA 3TN2A 1LV9A 1J8IA 3UI2A 1HA6A 3GV6A 2B2YC 2XIWA 1WTRA 1IKLA 1X3PA 2H1EA 1B4OA 2MP1A 1B53A 4HAEA 4XT3B 1BO0A 4RWSC 1G91A 1HRJA 2B2UC 2DY8A 4HEDA 4ZK9B 1VMPA 2EOTA 1EOTA 1ML0D 1PFNA 1F9RA 1U4RA 1VMCA 1DONA 5EQ0A 3R93A 4HSVA 4ZKCB 3DEPA 2FMMA 5DNFA 2K28A 2RVLA 3P7JA 3H91A 1U4MA 2EE1A 2HCIA 3F2UA 4QUFA 1EL0A 1C8CA 2NYZD 1B50A 1NR2A 1O7YA 2B2WC 1WTPA 2K1BA 5EPKA 1WTVA 1XX8A 2B2TA 1RJTA 1X32A 1IL8A 4O42A 5EKIA 1WTOA 1AP0A 1F2LA 2SDFA 3N52A 2M2LA 2B2UA 4OIKA 1AZPA 3MTSA 1G6ZA 2RSNA 1ILQA 2FINB 4IUQA 4MN3A 4DN4M 1Q3LA 1RHPA 2N88A 3IL8A 1MSGA 4CJ1B 4QUCA 5T1IA 3I8ZA 4X3UA 5T1GA 2B2WA 2FHTA 2K05A 4IUUA 2MPMA 5EPLA 1PLFA 1EIGA 3HP3A 2NWGA 5CBAE 1TVXA 2N55A 5CMDA 3MWYW 2KOLA 2J7ZA 1DOLA 1F9SA 2VXWA 3IFDA 3I90A 5E4XA 1G2TA 1HFNA 3SVMA 1DOKA 2MJ8A 3Q6SA 1MGSA 1CA5A 1E0BA 2L1BA 3TZDA 2Q8TA 5E4WC 2B2YA 1NAPA 1S4ZA 1KNEA 3I3CA 3ONAB 1CA6A 2B2VC 2K04A 1IKMA 1SDFA 4LMQD 1WTXA 1X3QA 1PDQA 1CM9A 2KUMA 2X69A 4RA8A 2L9HA 4R8IA 2K03A 2HUGA 1ICWA 1MI2A 1PFMA 2JYOA 2D9UA 3QO2A
chains in the Genus database with same CATH superfamily
3HOXB 4A3IH 3EIVA 1SYCA 3EBEA 2MO0A 1BCPD 3NK9A 1C48A 4LF4Q 1VQ7A 4KHZA 3OWFA 4ZRZA 1PH2A 1G2SA 4X66L 2L11A 4B3TQ 1GO3E 5JJLA 1F77A 3W5OA 3DXJC 3F1ZA 4DK6C 1O78A 1ILPA 3CC4A 1PH3A 3EVQA 3OYYA 4IUPA 2JSOA 1U4LA 1MHWC 3TZUA 4OWWB 4FF4A 2RDFA 4U673 3BYYB 1YHQA 1BF4A 2NTSA 4LFBL 1GHKA 3GO5A 3H3VI 1KNAA 1KDAA 4JI4L 5KIXA 5KRUA 4BY1H 4C1NI 4PQXA 2QF7A 2JP1A 2LXJA 3PO3H 4NXNQ 4JBMA 2OTLA 2E2HB 2XIWA 1EFID 3HKSA 4HAEA 3TP6A 2UUBQ 1WCMB 2K75A 1LTAD 2CW0C 2IX1A 1F9RA 1BBWA 3AYHB 1EY9A 1CQFA 3L3OC 5EBCA 4X62L 4BXXH 2R7ZB 3D8GA 4A3MG 4ULLA 3F2UA 5IGFA 4OO1I 1Y1WB 4CDCC 1LACA 2F4VQ 2B2TA 5LMNW 1NE3A 4X65Q 1HH2P 5DAUA 4YIJA 3W1BA 4MN3A 1LYLA 2K32A 3W1GA 3HKZE 1YNJD 4IPDA 4BY7B 5AJ3Q 4GKJQ 3H3VC 4IJLA 1EQQA 4EQOA 2KHSA 3M4QA 3DWAA 1H9JA 3CXCA 2K5WA 3HG9A 3NUCA 1VQ5A 1HQMC 2IY5B 3L7ZC 4P71A 4IFDG 1DM0B 2K50A 2IX0A 5ISRA 4UP7A 2L1BA 4RMFA 2LSSA 2MQHA 5M5YB 1X56A 2D5DA 4LF4L 4MTKA 4OXPA 4OGQC 2K33A 2SNSA 1JWSD 4JI3Q 1F9PA 2ICIA 3MXGA 2HDMA 4A3FH 3KF6B 5HGTA 5C44H 2K5DA 4C3IH 3K8AA 2PNRC 1HXYD 2E2DC 3H94A 2WAQB 2HD3A 5C4XH 4IUTA 3BVGA 1NJIC 3CCEA 3GTLB 3RMHA 5IT9c 5IGBA 4JI7Q 1V1QA 3MZ5A 5EPJA 1KD1C 4N8X1 4O2DA 4POFA 1LTSD 1SNQA 2PPBC 1HCZA 4J1MA 4ZAIA 5ELDA 4F87A 2NZ1D 1LABA 4DNRB 1S5CD 3NTHA 3S2DH 1TY0A 3WWVA 3OW7A 4NW2A 2F0VA 3EN2A 3PSIA 2UUBL 1WTQA 2EXZA 1AH9A 2UU9Q 3D4RA 4J6HA 1HUMA 1E2VA 3HS0C 5C0XG 2QEXA 2AQ1B 1VQBA 4NPSA 4JI2Q 1CQVA 2F3WA 4DR7Q 3CRKC 2B3GA 2P5ZX 2AUKA 4H13C 3HOXG 1XJVA 4J15A 1BDOA 1TWHH 4FXKC 3URYA 1BO0A 4LF9Q 1ENAA 3OMGA 2F4VL 3M85A 4DUYQ 4C3JH 1PFNA 1TWGH 1MBYA 3M4OH 4HSVA 1RKNA 5IY0A 4LUOA 4I7ZC 1XMOQ 1N36Q 2MUYA 3H91A 1U4MA 2EE1A 3OOCA 1B9NA 1LTID 2B2WC 1VF5C 2B63B 4IOAA 5AJ3L 4GKJL 5EPKA 1OXVA 1S5ED 3RLNA 3OTOQ 1PTOD 2NUCA 5M3MG 4OWTB 3ULJA 4PMWA 1N8RC 4N8FA 3PUZA 3G48A 3QOJA 5F2DA 4EVOA 3KK7A 3BZCA 1QUQA 2NZHA 2LMCB 3GTOB 1Y8NB 3OMCA 2F3IA 1E3PA 1KAWA 2WB1B 2NBFA 4JOIC 1H9MA 1PH9A 1GUSA 1YITA 2KHJA 3I90A 1G6PA 1Z6HA 1YJ9A 4JI3L 3F2DA 1WCMG 2XTIA 1SYBA 3BVMA 1PDQA 1ET6A 2X69A 1K8OA 1VQAA 4ODGA 3KF8B 5TSSA 4AYBB 3I72A 2O2LD 4UP8A 5JAVA 1HR0Q 1RL2A 3V2TA 1Y1WG 5FJ8G 4A3KH 1UAPA 1VQKA 1KIXA 2VY3A 1SEBD 4RG1A 3S24A 2K52A 2JA6B 2Z0SA 4L8JA 4K8JA 2UXCQ 4DK0A 2JA9A 3KLWA 3LWUA 1JT8A 5JEAH 2FFKB 2JA8B 1XMQQ 4BY7G 1LLRD 4KKSA 2KBNA 3RR5A 4KD3A 4PMBA 3E9IA 4LFCQ 4OX9Q 3KLSX 1EOVA 2RBMA 1K73C 3E9HA 2UU9L 4DV2L 4DR7L 4UDUC 5C3EH 3HRZC 4JI2L 4YCVA 2FXQA 1SNMA 3PO2B 3KUPA 2Q8RE 1GJXA 2RF4A 3U9SA 1JOQA 4C2MB 4C3HH 5I2XA 1SFOB 3TP8A 5K5PA 4QY7A 3MEHA 2IPKD 2NB0A 1X65A 2WV6D 1VQJA 1IBML 3GTJB 2YU9B 1HHVA 2EXDA 4A3LG 2EYPA 3DHQA 1HTLD 2DJFC 4V190 3MVVA 4HN7A 4LAAA 2B8FA 2JA7H 1D5ZC 4GLXA 3OTOL 4GS3A 4EX5A 3GTPB 3P7JA 3S17B 2HCIA 2A73B 2IJ0A 3N6RA 1WFQA 1L0XB 2PYKA 2LY7A 1VQ9A 1RCVD 2CH4A 3DWQA 1KXLA 1I6HB 2IHEA 1HNZQ 1K8GA 1FYCA 1S5BD 2EDGA 3MFYA 4P73A 1ILQA 4HR7B 4A3GG 2SNMA 3K59A 4JYAQ 3NTIA 2F0UA 3HOVB 5C3XA 2K5QA 3G6EA 1BXTA 1PYBA 1W6JA 2MPMA 4IUUA 1AEXA 3QR8A 5IE8A 4IJHA 1Y1VH 2KQ3A 4CDDC 2KOLA 2VZAA 3VA7A 5JEAJ 3OPOA 3SVMA 4BWGB 1E0BA 4YCUA 1HR0L 2BE5C 2IW3A 3S2HB 4B3MQ 2KJXA 2F0TA 4KV6A 1UNSA 2R93G 5CV6A 3AEVA 3CF5A 2NVXH 2UXCL 2HUGA 3C1FA 3VR4A 1B1ZA 4NDXA 2OCEA 1XMQL 2XNAC 4LW1A 2F0OA 4LFCL 4OX9L 4JBWA 4K8IA 4M8AA 1JJGA 1RODA 1MSHA 4O0AA 1EY6A 1X3FA 2DN8A 5KYLA 1VQDA 2O4XA 3V96A 5GROA 5JJIA 3CHBD 3RLFA 2Z6KC 3AQQA 3RN5A 1PFSA 3W3AA 5C4HA 3ER0A 2JXMB 1L0WA 4RKLA 1HFGA 4FF1A 2EJGC 2H4OA 1N34Q 1SNOA 4R1JA 4DV4Q 4Y7NH 3HOUG 4TVAB 1BOSA 1DZ1A 1NMFA 1IL2A 4AYBG 4KY7A 2EY2A 4GNXB 2PMZB 4DAYA 1YNXA 1UUPA 3T1HQ 1BCPC 1P16A 3T4AC 4YY3Q 4FNFA 4DV1Q 1STNA 4JI5Q 1H9RA 5KNCA 3J80i 3RLOA 1IYVA 4TKOB 3NWTA 2LFNA 1A2TA 3CCJA 1DCZA 4GLAC 1CUKA 2RHQB 1KABA 3HKZG 3K7AB 2H5XA 1J6QA 4JYAL 1C8CA 3A8KE 2D62A 4EGVA 4A3BB 1PVOA 2K1BA 1XX8A 1AP0A 4JG2A 1G6ZA 2HT1A 3TDQA 4CKBA 1A8VA 1A0IA 4IUQA 1K83B 1KHIA 3KOJA 3VYSA 4HMIA 4DN4M 2NVYH 1RF2D 2NVTB 1TXYA 3TMEA 1STAA 3T13A 3I8ZA 1D8LA 5T1GA 4DUZL 2JA5G 2BH8A 2F0DA 3L0OA 1ET9A 3S1RB 3SR1A 4A93H 4QIWE 2HIVA 3TZDA 1S40A 4PZ8A 1ASZA 4IO9A 1X54A 4OWXB 5FLXE 4S3SA 3RZDH 5IOCA 2R92H 1EL0A 2JYOA 1I3QB 2PCFB 4GLVB 3GTGH 1TWFH 3S1QB 4NMZA 1SMYD 1EZ8A 1RDPD 3BU2A 1TQOA 3GTQB 5C0XH 3FMCA 3FPUB 1FNVA 4RHSA 4A3EG 1K3RA 1EIHA 3OWEB 1BBXC 1Y8PB 1YNJC 5A2QL 4ILWA 2IL8A 4UP9A 4X3TA 3Q22A 3RD4A 1N34L 5G3LF 1KDBA 1PZJD 3BDLA 4DV4L 1HA5A 1VCIA 1CHQD 4A3CG 1AN8A 5K36H 2XRSD 2FJ2A 4MTNA 3C46A 2F0HA 3T1HL 4YY3L 3T56B 4DV1L 2HDLA 4KJOA 4JI5L 4CDEC 1YI2A 2EY6A 4LJZC 3TRZA 5JVH3 4DK3C 3QWNA 3PIP3 3Q24A 4N9TA 1VQMA 4L6TB 4KMUC 4PG3A 1J5EQ 1IYJB 4HEDA 2E75C 1YBYA 2Y0SG 3J81L 3GTKB 1EYDA 2RVLA 2E2HH 4MZ9A 5C6AA 1B9MA 4FYDA 5GAGC 2G9HD 5E7NA 5M3FB 1N9WA 3CQZB 1U9RA 1WYDA 1WTOA 4GOPC 2R7DA 1AZPA 1L1OC 5IGCA 5LMUL 1M1KC 4HTHA 2R7ZH 2YYZA 3J7AF 1RHPA 1X9NA 2CFMA 5FJ8H 4YWKA 3T51B 3C2PA 4K6LA 4WFN3 1YIJA 2OF1A 1EIGA 3U4ZA 5C0XJ 1TT2A 3MWYW 4CBVA 1EYCA 4LF8Q 2EJFC 2ZXPA 4K14A 5EBDA 3S16B 3I3CA 2I07B 3VR3A 2VQEL 5A2QE 2GA4B 3ERQA 1IHZA 2QA4A 3S15H 1U0LA 1QWYA 3KBGA 1PFMA 3PGZA 3QO2A 4A3BG 1PTOC 2EYHA 2RA4A 2A69D 2BA1A 3MXNA 2G9DA 5M5YH 3IFTA 5KGUA 1A3VA 1I5FA 3S14B 3T16A 4POGA 5ELBA 2J0TD 1VQLA 3T1YQ 1WVLA 1UEAB 3C3LA 1A6XA 1BBUA 2AQ2B 4JOIA 3FHWA 2KECA 5BR8L 3ULPA 2K01A 2N78A 1EU4A 4FXDA 4AIMA 1PRTD 4Z9CB 3A8IE 5BN5A 2BDNA 5D14A 3J81E 4PNYA 3NHHA 1J5EL 5C3WA 2A68D 2BOSA 3J80L 1B2TA 1D1IA 1SSOA 4OO1G 1EY7A 1PA6A 3DM3A 5FO9B 3E0EA 4BBSG 5M3MB 5IGDA 3LGJA 1HTPA 3M9BA 4HJ7A 4XIGS 5JVG3 3KLSA 2K5HA 3J7YW 5IYDH 3H15A 1WTPA 1O7YA 1XNRL 4ID6A 3DMUA 2ALYB 5E3FA 5G3LD 3M7GA 1LT3D 2UXDQ 1F2LA 1A2UA 4YCWA 3MA2B 1YJWA 3F8TA 1IBKQ 4R4CA 4KJNA 4GN3B 1B7YB 5LL6X 1T5XD 5LMNQ 2I5LX 1HNXQ 2B63H 1JJ2A 3A7AB 4AQYQ 5T1IA 1Q82C 5IYBH 5BN3A 2F0GA 3TQYA 4IZ8A 1EZ6A 3I4NB 1N32Q 1LM0A 5CV9A 4DR1Q 2WB1E 4DV7Q 4JI6Q 2J7ZA 1V43A 2GVAA 3IFDA 1XPUA 3GTOH 2KENA 1I4GA 1IZ6A 2AHOB 4IN3A 1SDFA 3K5MA 1JORA 5HY6A 1EWCA 3X3MA 4R8IA 2XN9C 1TWAH 4G7ZC 2NVQH 3T1YL 3JAMi 5M3FG 4NB3A 2DUDA 3PIO3 1TU2B 1VDZA 3HEJA 5KNBA 1F9QA 4OIJA 5I6YA 3FEWX 2UUAQ 5CBEE 4LF6Q 3KYHC 5I6WA 1ASYA 4OONA 1I4XA 3A7LA 1W6KA 2JQOA 2QDLA 2JA6H 1I50B 3J80E 3H0GB 3E0JA 2X6GA 4DV0Q 4XXEA 1KTKA 4QF4A 4QQBX 2JA8H 3D6WA 4B3TL 1A15A 1IYUA 1G8ZD 1S5FD 1TS3A 2EPBA 5AFWA 3RZOH 5IP9H 1BR9A 2F0QA 4KHPQ 3K80C 1N33Q 2JJQA 1PYWD 1UE7A 5CR3A 1XNQQ 2IWHA 4IPGA 5EKKA 2Q8IB 2IX3A 2CWAA 3CP0A 1O7ZA 3SDZA 3PO2H 4C2MH 5EKLA 4APVA 1SFOH 3GV6A 1HA6A 1BCPB 1B53A 3U9OA 4QCLA 1NBWA 3SK6A 4LNQA 3O13A 1DD2A 2DY8A 4ZQ3A 1X55A 2F0FA 2UXDL 3ERSX 1M90C 4A3GB 2YU9H 4ZCKA 1QILA 3CCVA 4RCNA 1QUQB 3TP5A 4NXNL 3CC2A 3G6JB 1FGUA 2ZJQA 1NMGA 3A0JA 5LMNL 4LFAQ 2EIFA 3KDFB 5I9OA 4AQYL 2Z6KA 1EYGA 2SDFA 3KLRA 3GTPH 4DR1L 4JI0Q 3S17H 4JI6L 3PIPA 1LTGD 3S1NH 3PUYA 4PMCA 2R7FA 2R93B 2L5TA 2PQAA 2K05A 3A54A 4X65L 1I4QA 1D5XC 2OXPA 1O7LA 3PUVA 2WACA 3K5LA 2CKZB 2VXWA 3HOVH 2PI2A 2VB3X 5ELNA 2QDBA 2WKCA 1EFWA 3ONAB 2EYMA 1X3QA 3HOWB 1V1PA 5D3DA 1Y69U 5JJKA 1TS4A 1JWUD 3KBXA 4JK1C 5IP7H 4DR5Q 4K0KQ 1DYQA 2EYFA 3S2HH 4RCOA 3NWSA 3KDFA 2RSOA 3BG3A 1UEBA 2BA0A 4HIDA 4G4KA 1CHPD 2C35B 3HOYH 3PUWA 4R9WA 4F7XA 3S9WA 4DV0L 3FKIH 1HUNA 5I9PA 4JW0A 4A3JG 3SEBA 1J9OA 1EEFD 1L0YB 2NTTA 3I4NG 1QE6A 4KHPL 3HOUB 1N33L 4CJ0B 3J81j 1EU3A 1RTNA 1W2BA 2HQEA 2NN6H 2R6GA 1WI5A 2F0KA 3OHXC 5C0XI 2VB2X 1V9PA 1B44D 3MFGA 4EQ5A 4HJ5A 4JI7L 1STHA 2NZOA 4NKLA 4QJFA 2F52A 2X6LA 2F0PA 5IYCH 2XVSA 1ENFA 2C9OA 1H9SA 2EY5A 5FLMH 3HKZB 1SMYC 4IPHA 2QCPX 3M4PA 1J8IA 1JJCB 1EEID 1IKLA 4EQPA 4ALPA 1Z9FA 4RWSC 1E2ZA 1HRJA 3TSSA 1STGA 4FF2A 3PF5A 5EQ0A 2FMMA 3CAMA 1E22A 4JPBW 4BBRG 1B3QA 3OW2A 4YHHQ 3K0YA 4V0BA 1CT1D 2PW5A 2JA5B 4LF9L 4A4IA 4DUYL 3H0GG 4LUVA 4HIOA 1FGBD 5C44B 1SROA 2F0SA 3A74A 5CV8A 1XMOL 1N36L 1FJGQ 2VUMG 4FDBA 3RUZA 2AKWB 5IGGA 5C4XB 4A3BH 1XTDA 1M4VA 4OL7A 1CI3M 1K83H 1VQEA 3I4LA 1II3A 3U4VA 1FD7D 3M4YA 3CKIB 4DR5L 2Q8TA 1DJRD 3J81i 3PCOB 1TWCB 3S1MB 1KNEA 1VQIA 2GVBA 3JAML 2F0NA 2E76C 2ZTEA 3D3RA 5FO8B 1WTXA 3K58A 4A3EB 4QL5A 3J80c 1Z7TA 2KCNA 3UE0A 3S1RH 5CYUA 4WORA 3CCUA 1VQ4A 4DV3Q 1PTOB 2D0OA 4P72A 2F0IA 1K8MA 1TWHB 3AU7A 4GOPA 5M5XB 3J7A5 1L1OA 2ZTDA 1JWMD 2JEBI 2LS01 1I3QH 4BA2I 1QVFA 1TWGB 1CSPA 1NR4A 1U4PA 3S1QH 1DOMA 1GUTA 1G291 2C5CA 5E1FA 4U68A 1LTRD 3GTQH 2Q2IA 1QVCA 1LT4D 3NELA 2QKIC 4RH6A 3I4MB 4DAYB 1HPCA 1OXXK 1BQQT 4IUNA 3R2IA 1KL9A 5CORA 3UDGA 3PIOA 3HOWG 1GM5A 1KRSA 2EYOA 2Y0SB 4C56C 5FLXL 4BY1G 2E5LQ 3I70A 4JC0A 4LF7Q 3JC66 3BS1A 2XWBB 2XRQD 2ATWA 1RTOA 1LT5D 2A69C 3STBD 3PO3G 4YHHL 2R61A 3K7UC 4B08A 1BKBA 1U4RA 4GN5A 4A3MH 5DNFA 1Q1EA 2K28A 1QZGA 2OWOA 3HOZB 4BXXG 2PQEA 1X6OA 1CFMA 1L2FA 2TSSA 3CCLA 2KA7A 3PV0A 4X64Q 2CWPA 4A3KB 1Q12A 4RGOS 4HJAA 3GTKH 2ZJPA 1PRTC 3MXPA 1XWEA 4KHVA 1CTMA 1Q3LA 4KD4A 3JAME 1VQPA 3CQZH 2A68C 4O1NA 3MEFA 5GQOA 1Q46A 2A6ED 1HNZL 1STEA 2K14A 4DGZA 1EYAA 4DAVA 1PYSB 4OELB 4IFDH 4Y52H 1FNUA 4PZ6A 2TMPA 4DKAC 2I5HA 1TS5A 3QJYA 1GUGA 5C3EB 4DV3L 3TBIB 3TP7A 1K9MC 2E2IH 2EY1A 2F0WA 4TSSA 3KJPA 1YNND 4C3HB 2F03A 1IKMA 5J3BA 4QGUA 1GUNA 4JBJA 4KLKA 1IBLQ 5DEHA 1PH7A 4IPCA 4WJ3M 2D0PA 4B3ML 3S16H 1OO9B 1R9TB 4RKBA 4A3FG 5C44G 1XPRA 4C3IG 2YTXA 1KLUD 2XGTA 2DY7A 2V4DA 2YV5A 1WD1A 4GN4B 3J7ZC 1QNUA 3SK8A 5C4XG 1HNWQ 4ZKBB 1QVGA 1K28A 1ZYRD 1SN8A 2QEJC 4ZYSA 5ELOA 2HIXA 5DM63 1WTWA 1CKNB 3SXHA 1HQRD 3S14H 3FDTA 4IOCA 2E5LL 4LF7L 4HCSA 1NCVA 4KN4C 1QZHA 4YWMA 2KVMA 3K57A 1KQSA 4HJ8A 2L12A 1FNWA 1VF7A 5JJZA 1AW7A 4BBSB 3HZXA 1SAPA 5C4JB 1MJCA 4RFBA 1FR3A 1BCPF 1ZKOA 3UDIA 5J39A 1B3AA 3HOXH 1E1OA 1EY0A 5EAYA 3RN2A 3UI2A 1Q7YC 2JEAI 2MP1A 1BVSA 1K8AC 3K5NA 2ZM6Q 5HURA 1U5KA 1PH4A 4X64L 1KDCA 3R93A 4IFDJ 3LNNA 1ICFB 4C3JG 2YTYA 1DXMA 4EQNA 2NYZD 1D6EC 2EVBA 1B50A 4LF5Q 1MJEA 5M3MH 1CKNA 4HJ9A 3SGIA 2B2UA 5LL6S 3MTSA 3I4MG 4A76A 4P74A 1D1KA 1B8AA 4DV5Q 4DR6Q 2ENBA 5KNDA 1JCKB 3NEMA 2ICEC 4CKCA 1WTHA 2NWGA 1I4PA 1TVXA 3OIQA 4NXMQ 1NTGA 3R3OA 1Q90A 3EFXD 1DOLA 1F9SA 1CK1A 1KC8C 1C4QA 1WCMH 3BZDB 3MXNB 4H7BA 4ABNA 1TR5A 5IGEA 3CPWA 2A19A 3BDOA 2RQXA 2CQOA 3AB9A 1FL0A 3HOZG 1Q1BA 1MI2A 1YHBA 2CH4W 2RDGA 4JCVE 3U50C 3WDNA 1Y1WH 1JE4A 1QJOA 1HNWL 3G4SA 1O7IA 4DK1A 2ASBA 3BYTB 3NE5B 3I55A 2LKVA 4A3KG 1OTCA 3CPFA 1XYIA 3K81C 4BY7H 2Z6BA 3TS2A 2HHHQ 4XQNA 1SRUA 5JEAG 2BH2A 2CVRA 2HQLA 4FVMA 5LHY1 4JI4Q 4Q0FA 5C3EG 4K2KA 2Z4HA 5JOBA 5M5WB 4C3HG 4DXFA 2VL6A 5JPMC 5IWAQ 1CSQA 2WAQE 4X62Q 3C1EA 2HCCA 2WP8J 4A3LH 3CU7A 4L5TA 1X3GA 2NN6I 1HZCA 1P8LA 2B2YC 1GXDC 1ENCA 3JAMc 1IW7D 4LF5L 5J22A 3F2BA 2SOBA 4ZK9B 2RCNA 2E2JB 4DAMA 1VMCA 1EY4A 2JA7G 3GTLH 1PH1A 5H1SE 3A8JE 3SHLA 3R8BA 2N49A 1A3TA 5CV5A 1EWIA 3I2ZA 2OQKA 4DR6L 5NUCA 1YJNA 3IAYA 1KLGD 1TWFB 1HZBA 1X32A 5EKIA 5IODA 4F8MA 2EJMA 4HIKA 3J7AV 4A3GH 1GD7A 3P1HA 2LXKA 4RGNA 1PH6A 2KCMA 1Y14B 2A1AA 2E74C 3D4WA 3IL8A 5D3IB 4L5QA 4PV1C 4F88A 3MHBA 4X6AH 3GDEA 2EZVA 3DUZA 4KKUA 5CMDA 5C5MA 3CW2C 1Y1VG 5E4XA 1JE5A 1NNXA 3Q0AA 2R93H 2MFIA 3X3NA 3NBHA 5IIFA 1CKOA 1TKWB 3L2PA 2A74C 1VS0A 4B9XA 4FF3A 5FLXc 3GD7A 1GHJA 3NPPA 3I56A 3B6YA 1JR0D 1PTOF 1UWVA 1I6VC 4HMJA 4A3DB 2QGQA 2EQSA 3SK5A 4A3JB 3M3YB 4LF8L 2HHHL 3D31A 1GVPA 1PZKD 2OT2A 3ITPA 3HOWH 3NXWA 1JMCA 4LUZA 4DU9A 1C7YA 2GN5A 4HCEA 1SE2A 5GADC 4GNXC 3CCSA 3DM1A 4CKEA 3SK4A 4MNOA 2F0LA 1AZQA 2QILA 1EIYB 3LWEA 1D2BA 2IHFA 4WRDA 2PZUA 5IWAL 2MGSA 4RAUC 3NTKA 3GTMB 4GKKQ 4AYBE 1YEZA 1ZEQX 3VR6A 1Q86C 2Q2TA 4UHVA 1SR3A 3I91A 3HOUH 4FXGC 4DNIA 3UDXA 4XT1B 5KYIA 5CV4A 5BN4A 3TN2A 4BBRB 2L55A 2EYLA 2OQ0A 4UPAA 3H09A 4IQZA 1KAAA 2A8VA 5FK9C 1G91A 2B2UC 2I0QA 1EOTA 2RKSA 3K0XA 2VW9A 1GOZA 2VUMB 1VQCA 3EJIA 2PZWA 3FPPA 1HZ9A 3S15B 4CHTB 2CCZA 4FP5D 1H9KA 1NR2A 4DAPA 1SXTA 2PQAB 2B29A 3EQLC 1EY5A 4FO2A 2RDHA 4RGTA 3I4OA 4L5RC 3NBIA 1VQOA 1HJPA 1PRTB 3NQIA 1VQNA 2AMCB 2F0MA 1D7QA 1T5EA 4CJ1B 2JA5H 4BS9A 2WIIB 4B3RQ 2VNUD 4K2LA 1VQGA 3GTJH 2F3VA 1PXUA 2B8GA 5M9OA 1V1PB 1IBKL 3STBC 1HFNA 4KY5A 1G2TA 1SMXA 1GUOA 3Q6SA 4H02A 1HNXL 1TY2A 1NAPA 2EYJA 4A93G 4A3IB 1N32L 4XQQA 4KKTA 1XPOA 1B70B 2JE6I 1CM9A 2KUMA 3E6ZX 3ZYYX 4DV7L 1PHJA 2O5JC 2AQ3B 1H95A 3CCQA 2D9UA 4L5SA 4IFDI 2R92G 4CJ2C 3IRBA 5KEEA 3PF4A 1XXGA 1I6HH 1TWCH 2FMCA 3AFQA 3E5SA 3S1MH 4JBKA 1SNCA 4A3EH 3BDCA 1CZGA 2K7VA 3Q8DA 2L0CA 4ME5A 4DV2Q 2AWNA 3QB3A 1SJED 4WJWA 2QW7A 3PUXA 1C9OA 1O80A 4GKKL 1SE4A 3AFPA 1PTOH 2SEBD 2A6EC 1YZ6A 5GAEC 4DXGA 1EQTA 4NP5A 1ESFA 1PMRA 3KF6A 4XYOA 5M5XH 4A3CH 4BY1B 1H9SB 5C5LA 1M8AA 3R2TA 4QB4A 4I65A 2UUAL 2MHVA 1IBMQ 1QOHA 4LF6L 1SNDA 4R4TA 4L63B 1E24A 3PO3B 2D2CC 4UAIA 1WOCA 1LT6D 2ID0A 5K36G 1JB7A 2Z1CA 1YNNC 3J81c 2WFWA 2JN4A 2B39A 4R4IA 1MKHA 1PZID 4X3SA 4IURA 3I4MH 4A3DG 3GP7A 1SLJA 2ZXRA 2Y0SE 2L4NA 3D6CA 4AH6A 2ZJRA 2PZTA 1X3PA 2H1EA 4DR2Q 3QIAA 3T53B 2A6HD 4BA1I 3QG1A 1K0RA 3CCMA 4XTCS 2EOTA 3SE0A 1XNQL 1ZYRC 4GZYC 4TRDA 1PH8A 2KHIA 1WTVA 1TWAB 5CGKA 2NVQB 4B3RL 1Y8OB 2L15A 4ZUIA 1SYEA 1Z47A 4CDFC 1MIUA 1V1OA 2RHSB 4CGYB 1STYA 3HOZH 1E1TA 5DM73 1E2WA 2R7ZG 4Q5VA 2PMZE 4XQJA 4LFAL 1NY4A 4J8QA 1KRTA 3MAQA 3WOEA 3GQBA 2N55A 2K6AA 1QCBD 4JI0L 1A63A 3K6OA 3E3XA 1DOKA 5HGQA 3G71A 1S4ZA 1LTTD 4A3FB 2J4XA 3V05A 4GOPB 1GKHA 3A5UA 1HR0W 1L1OB 3RZOB 1I4HA 4C3IB 3K7AH 2F4IA 3ULLA 3U58A 1G51A 3BVZA 1LTBD 3TREA 1GUWA 2UUCQ 1BNZA 3CD6A 1TIID 3I73A 3D4DA 1EIFA 2KEEA 3UE1A 2NVTH 2CW0D 4K0KL 3KF8A 4DA2A 3H3VH 1Q81C 5CV7A 3FVQA 1R9TH 3I7FA 3DWPA 2K5VA 4DR3Q 3TS0A 2UXBQ 3S2DB 2B2TC 1VQFA 1F2MA 1R4QB 4ZUJA 1WD0A 2WAQG 2Z4IA 2AWOA 4B3SQ 3EROA 2Q2HA 4G7OC 1YVCA 4DFAA 5ELCA 1V8QA 2KEDA 4A3IG 1JQYD 2DNEA 1F2YA 4DR2L 3P20A 1VQ8A 2WKDA 3S1NB 2ZTCA 3GV3A 3VYTA 3VR2A 2K5NA 4C3JB 2F0JA 1AE3A 3M4OB 4OO1H 4HSPA 1LV9A 4KY6A 4K5VA 1WTRA 2G5DA 1T9HA 2DJGC 4BBSH 1UE5A 3L9AX 5C4JH 4HIMA 3UDFA 1ML0D 1DONA 5CC4A 1Q8KA 4ZKCB 2MNAA 4DR4Q 4RGMA 3MXUA 4TQUS 2ZT9C 3VDYA 5IYDG 2I46A 3ND8A 4DUZQ 1IL8A 4R4OA 3KFUA 4K5XA 3ND9A 1K0SA 3M7NA 4XYQA 5ELEA 3HOYB 4R4QA 4YWLA 1F2ZA 2XSCA 2N88A 3CRLC 1VQHA 4P75A 3FKIB 4QUCA 2YTVA 2B63G 1MD2D 2FHTA 3ZJYC 3HP3A 2ES2A 5IYBG 1JB3A 5I4DA 1EQRA 1OXUA 4LK1C 1FJGL 3CMAA 1AFPA 2F0EA 4IALA 1IW7C 1EWHA 2CQAA 3IKJA 2B2YA 5J1ZA 2UUCL 4UY8C 2PNHA 2V1CC 5FOBB 2WB1G 4QMGA 4KK7A 1YHAA 4N9PA 1SE3A 2L9HA 2K03A 5M3FH 1CA5A 1VQ6A 3OSOA 3PMFA 4XDXA 3CMEA 5D65A 4JI8Q 1SJHD 4DR3L 2UXBL 2I5MX 2PO4A 5COYA 3VYRA 2Z9HA 3G7LA 4K5WA 2B2VA 4B3SL 4OHJA 2R3ZA 1LUZA 3DLLA 2E8GA 3EA6A 4DF7A 3HGBA 1HZAA 1Q8IA 2KCTA 2JA6G 1D5MC 5EJWA 4JI1Q 3LX0A 1SYGA 4JV5Q 3VR5A 2JA8G 2Z8LA 2Q2UA 1S5DD 1JC7A 1EUJA 2DGYA 1I94Q 4R8NA 5IP9G 3AMUA 4JVZA 4MHEA 2JA7B 1WJJA 1PH5A 2XWJB 1CZWA 1PV4A 1W3SA 4DR4L 5M5WH 3PO2G 1SE8A 1B4OA 1UE6A 4XT3B 1AE2A 4G7HC 3CCRA 3NQTA 3TEHB 3W2DA 3NSWA 5LMUQ 5FKAC 2VQFQ 1UE1A 3D0FA 4GNXA 3OIPA 4QUFA 4ME3A 1EQVA 1PRTF 3H6MA 5IT9L 2MO1A 2E2JH 1LO5D 1CKMA 3N52A 2M2LA 2M00A 2RSNA 1Y1VB 1SYFA 4E6IA 1MSGA 1SNPA 1NUCA 2JK8A 4K6DA 1RIPA 5A35A 4RHRA 4X3UA 1LTLA 2VQEQ 2RCFA 1QB5D 3A55A 5CBAE 4H0LC 2NVXB 4DV6Q 1A62A 4H44C 2VS1A 3A5ZB 2ZXOA 4MIUA 3HOVG 1SYDA 5E4WC 4JI8L 1DGSA 5EGTA 3NENA 1R4PB 4RA8A 1E7ZA 3P75A 1ICWA 3WOFA 5I2YA 5IP7G 3MC0B 3FRPB 2PW7A 3VA5A 1JOOA 4A3DH 5C4ZA 5BR8Q 1I4RA 2KCCA 1PFBA 3HOYG 1NSNS 4A3JH 4JI1L 1IBLL 3M3YH 1RD9D 1JOKA 4A3MB 2BDOA 3FKIG 4JV5L 2BCOA 3BZKA 1XTCD 3DEOA 3I4NH 3BJUA 4G57A 1I94L 5GAHC 4Y7NB 1QNKA 1BUVT 1X3EA 4X66Q 4DNTB 3RNUA 3QOLA 2NN6G 2DNCA 2OTJA 4I7AA 1STBA 2K4KA 2N8NA 4IUVA 2M9VA 4X3KA 1S3OA 4C1NK 1ZXTA 4ZLTF 3ICEA 1QG7A 3GTMH 1JICA 4P2CB 5IYCG 1ESRA 2VQFL 5IT9E 3NP8A 4LFBQ 1SBBB 1EY8A 5FLMG 2O5IC 1ONLA 3HFZB 3K5OA 5FO7B 2AUJD 1XNRQ 2F1MA 2BE5D 5ELFA 3KJOA 1VMPA 4KN7C 2E2IB 3CC7A 3DEPA 1OXTA 2A5HA 4BBRH 4M1UB 3A56A 4DPGA 3F2CA 1K3BC 2NVYB 2IT1A 1I50H 5JPNC 3H0GH 5DLQE 2ZM6L 1RJTA 4O42A 4OIKA 1TS2A 2VUMH 4KTAA 2FINB 3VYUA 1OXSC 3Q23A 4DV6L 3NBHB 1IXRA 2PI2E 4A93B 4OEMB 2B2WA 5EPLA 1PLFA 2N3SA 1C0AA 4KI0A 4QIWB 3RZDB 4B9WA 5L37A 2WINB 3FP9A 2R92B 2MJ8A 2OEOA 1MGSA 2A6HC 4PZ7A 1A3UA 4DV5L 3GTGB 1FVIA 3PQIA 4A75A 1CA6A 2B2VC 2K04A 4LMQD 4NXML 2CHBD 4LWCA 1S72A 4WJ4A
chains in the Genus database with same CATH topology
3HOXB 1SYCA 1BCPD 3NK9A 1C48A 4KHZA 3OWFA 4ZRZA 1G2SA 2L11A 1F77A 3DXJC 1O78A 1ILPA 3EVQA 4IUPA 2JSOA 1U4LA 3TZUA 4FF4A 2RDFA 4U673 3BYYB 1BF4A 2NTSA 1GHKA 3GO5A 1KNAA 1KDAA 5KIXA 5KRUA 4C1NI 4PQXA 2QF7A 2JP1A 2E2HB 2XIWA 1EFID 4HAEA 3TP6A 1WCMB 1LTAD 2CW0C 2IX1A 1F9RA 3L3OC 1EY9A 1CQFA 5EBCA 2R7ZB 3D8GA 4ULLA 3F2UA 5IGFA 4OO1I 1Y1WB 1LACA 2B2TA 5DAUA 4YIJA 4MN3A 2K32A 1YNJD 4BY7B 3H3VC 4EQOA 2KHSA 3DWAA 1H9JA 2K5WA 3HG9A 3NUCA 1HQMC 3L7ZC 4IFDG 1DM0B 2IX0A 5ISRA 2L1BA 5M5YB 2D5DA 4OGQC 2K33A 2SNSA 1JWSD 1F9PA 2ICIA 3MXGA 2HDMA 5HGTA 2K5DA 2PNRC 1HXYD 2E2DC 3H94A 2WAQB 4IUTA 3BVGA 3GTLB 3RMHA 5IGBA 3MZ5A 5EPJA 1LTSD 1SNQA 2PPBC 1HCZA 4J1MA 4ZAIA 5ELDA 4F87A 2NZ1D 1LABA 4DNRB 1S5CD 3NTHA 1TY0A 3OW7A 4NW2A 2F0VA 1WTQA 2EXZA 3D4RA 4J6HA 1HUMA 1E2VA 3HS0C 5C0XG 2AQ1B 1CQVA 2F3WA 3CRKC 2AUKA 4H13C 1BDOA 3URYA 4FXKC 1BO0A 1ENAA 3OMGA 3M85A 1PFNA 1MBYA 4HSVA 1RKNA 4I7ZC 2MUYA 3H91A 1U4MA 2EE1A 3OOCA 1B9NA 1LTID 2B2WC 1VF5C 2B63B 5EPKA 1OXVA 1S5ED 1PTOD 2NUCA 4PMWA 3PUZA 3QOJA 5F2DA 4EVOA 3KK7A 2LMCB 3GTOB 1Y8NB 3OMCA 2NBFA 2WB1B 1H9MA 1GUSA 3I90A 1Z6HA 1SYBA 3BVMA 1PDQA 1ET6A 2X69A 1K8OA 5TSSA 4ODGA 4AYBB 3I72A 2O2LD 5JAVA 3V2TA 1UAPA 1SEBD 2JA6B 4L8JA 4K8JA 4DK0A 3LWUA 5JEAH 2FFKB 2JA8B 1LLRD 4KKSA 4KD3A 4PMBA 3KLSX 2RBMA 4UDUC 3HRZC 1SNMA 3PO2B 3KUPA 2Q8RE 1GJXA 3U9SA 1JOQA 4C2MB 5I2XA 1SFOB 3TP8A 5K5PA 3MEHA 2IPKD 2NB0A 2WV6D 3GTJB 2YU9B 1HHVA 2EYPA 3DHQA 1HTLD 4V190 3MVVA 4HN7A 4LAAA 2B8FA 1D5ZC 3GTPB 3P7JA 3S17B 2HCIA 2A73B 2IJ0A 3N6RA 1L0XB 2PYKA 2LY7A 1RCVD 3DWQA 1I6HB 1FYCA 1S5BD 2EDGA 3MFYA 1ILQA 4HR7B 2SNMA 3K59A 3NTIA 2F0UA 3HOVB 5C3XA 2K5QA 1BXTA 1W6JA 2MPMA 4IUUA 1AEXA 2KQ3A 2KOLA 3VA7A 5JEAJ 3OPOA 3SVMA 4BWGB 1E0BA 2BE5C 2IW3A 3S2HB 2KJXA 2F0TA 4KV6A 1UNSA 5CV6A 2HUGA 3C1FA 3VR4A 1B1ZA 4NDXA 2XNAC 2F0OA 4JBWA 4K8IA 4M8AA 1RODA 1MSHA 1EY6A 2DN8A 5KYLA 2O4XA 3V96A 3CHBD 3RLFA 3W3AA 5C4HA 2JXMB 4RKLA 1HFGA 4FF1A 2EJGC 2H4OA 1SNOA 1BOSA 1DZ1A 4KY7A 2EY2A 2PMZB 4DAYA 1UUPA 1BCPC 3T4AC 4FNFA 1STNA 1H9RA 5KNCA 1IYVA 4TKOB 3NWTA 2LFNA 1A2TA 1DCZA 1KABA 3K7AB 1C8CA 3A8KE 2D62A 4EGVA 4A3BB 2K1BA 1XX8A 1AP0A 1G6ZA 3TDQA 4CKBA 4IUQA 1K83B 3VYSA 4HMIA 4DN4M 1RF2D 2NVTB 3TMEA 1STAA 3T13A 3I8ZA 5T1GA 2F0DA 1ET9A 3S1RB 3SR1A 3TZDA 5FLXE 4S3SA 5IOCA 1EL0A 2JYOA 1I3QB 2PCFB 3S1QB 4NMZA 1SMYD 1EZ8A 1RDPD 1TQOA 3GTQB 5C0XH 3FMCA 3FPUB 1FNVA 4RHSA 1EIHA 3OWEB 1BBXC 1Y8PB 1YNJC 5A2QL 4ILWA 2IL8A 4X3TA 3Q22A 3RD4A 5G3LF 1KDBA 1PZJD 3BDLA 1HA5A 1VCIA 1CHQD 1AN8A 5K36H 2XRSD 2FJ2A 3C46A 2F0HA 3T56B 2HDLA 4KJOA 2EY6A 4LJZC 5JVH3 3QWNA 3PIP3 3Q24A 4N9TA 4L6TB 4KMUC 4HEDA 2E75C 3J81L 3GTKB 1EYDA 2RVLA 5C6AA 4FYDA 1B9MA 2G9HD 5M3FB 3CQZB 1U9RA 1WTOA 1AZPA 5IGCA 4HTHA 2YYZA 3J7AF 1RHPA 3T51B 3C2PA 4K6LA 4WFN3 2OF1A 1EIGA 5C0XJ 1TT2A 3MWYW 4CBVA 1EYCA 2EJFC 2ZXPA 4K14A 5EBDA 3S16B 3I3CA 2I07B 3VR3A 5A2QE 2GA4B 3ERQA 1IHZA 1QWYA 3KBGA 1PFMA 3QO2A 1PTOC 2EYHA 2RA4A 2A69D 2BA1A 3MXNA 2G9DA 3IFTA 5KGUA 1A3VA 3S14B 3T16A 5ELBA 2J0TD 1WVLA 1UEAB 3C3LA 1A6XA 2AQ2B 2KECA 2K01A 1EU4A 4FXDA 1PRTD 4Z9CB 3A8IE 5BN5A 2BDNA 5D14A 3J81E 4PNYA 3NHHA 5C3WA 2A68D 2BOSA 3J80L 1B2TA 1D1IA 1SSOA 4OO1G 1EY7A 5FO9B 5M3MB 5IGDA 1HTPA 4XIGS 5JVG3 3KLSA 3J7YW 1WTPA 1O7YA 4ID6A 3DMUA 5E3FA 5G3LD 3M7GA 1LT3D 1F2LA 1A2UA 3MA2B 4KJNA 5LL6X 1T5XD 3A7AB 5T1IA 5BN3A 2F0GA 4IZ8A 1EZ6A 3I4NB 5CV9A 2J7ZA 1V43A 3IFDA 1I4GA 4IN3A 1SDFA 3K5MA 1JORA 1EWCA 3X3MA 4R8IA 2XN9C 4G7ZC 3PIO3 1TU2B 1VDZA 3HEJA 5KNBA 1F9QA 4OIJA 5I6YA 3FEWX 5CBEE 5I6WA 1I4XA 3A7LA 1W6KA 1I50B 3J80E 3H0GB 3E0JA 2X6GA 4XXEA 1KTKA 4QF4A 3D6WA 1A15A 1IYUA 1G8ZD 1S5FD 1TS3A 2EPBA 5AFWA 1BR9A 2F0QA 1PYWD 5CR3A 2IWHA 5EKKA 2Q8IB 2IX3A 1O7ZA 3SDZA 5EKLA 1HA6A 3GV6A 1BCPB 1B53A 3U9OA 4QCLA 3SK6A 1DD2A 3O13A 2DY8A 4ZQ3A 2F0FA 4A3GB 1QILA 4RCNA 3TP5A 3G6JB 5I9OA 2SDFA 3KLRA 1LTGD 3PUYA 4PMCA 2R93B 2L5TA 2K05A 3A54A 1I4QA 1D5XC 2OXPA 1O7LA 3PUVA 2WACA 3K5LA 2VXWA 2VB3X 2QDBA 2WKCA 3ONAB 2EYMA 1X3QA 3HOWB 1V1PA 5D3DA 1Y69U 1TS4A 1JWUD 3KBXA 4JK1C 1DYQA 2EYFA 4RCOA 3NWSA 2RSOA 3BG3A 2BA0A 4G4KA 1CHPD 3PUWA 4R9WA 4F7XA 3S9WA 1HUNA 5I9PA 3SEBA 1J9OA 1EEFD 1L0YB 2NTTA 1QE6A 3HOUB 4CJ0B 1EU3A 1RTNA 2HQEA 2NN6H 2R6GA 2F0KA 3OHXC 5C0XI 2VB2X 1B44D 3MFGA 1STHA 4NKLA 2X6LA 2F0PA 2XVSA 1ENFA 2C9OA 1H9SA 2EY5A 3HKZB 1SMYC 2QCPX 1J8IA 1EEID 1IKLA 4EQPA 4RWSC 1E2ZA 1HRJA 3TSSA 1STGA 4FF2A 5EQ0A 2FMMA 3K0YA 4V0BA 1CT1D 2PW5A 2JA5B 1FGBD 5C44B 2F0SA 5CV8A 3RUZA 5IGGA 5C4XB 1M4VA 4OL7A 1CI3M 3I4LA 1II3A 1FD7D 3M4YA 3CKIB 2Q8TA 1DJRD 1TWCB 3S1MB 1KNEA 3JAML 2F0NA 2E76C 3D3RA 5FO8B 1WTXA 3K58A 4A3EB 1Z7TA 2KCNA 5CYUA 4WORA 1PTOB 2F0IA 1K8MA 1TWHB 3AU7A 5M5XB 1JWMD 2JEBI 2LS01 4BA2I 1TWGB 1NR4A 1U4PA 1DOMA 1GUTA 1G291 2C5CA 5E1FA 4U68A 1LTRD 1LT4D 2QKIC 4RH6A 3I4MB 1HPCA 1OXXK 1BQQT 4IUNA 3R2IA 5CORA 2EYOA 2Y0SB 4C56C 5FLXL 3I70A 3BS1A 2XWBB 2XRQD 1RTOA 1LT5D 2A69C 2R61A 4B08A 1U4RA 5DNFA 1Q1EA 2K28A 3HOZB 2PQEA 1CFMA 2TSSA 2KA7A 3PV0A 4A3KB 1Q12A 4RGOS 1PRTC 3MXPA 1XWEA 4KHVA 1CTMA 1Q3LA 4KD4A 3JAME 2A68C 4O1NA 2A6ED 1STEA 4DGZA 1EYAA 4DAVA 4IFDH 1FNUA 2TMPA 1TS5A 3QJYA 1GUGA 5C3EB 3TBIB 3TP7A 2EY1A 2F0WA 4TSSA 1YNND 4C3HB 2F03A 1IKMA 1GUNA 5DEHA 1OO9B 1R9TB 4RKBA 4C3IG 1KLUD 2DY7A 2V4DA 1WD1A 1QNUA 3SK8A 4ZKBB 1ZYRD 2QEJC 4ZYSA 5DM63 1WTWA 3SXHA 1HQRD 3FDTA 4HCSA 1NCVA 4KN4C 2KVMA 3K57A 2L12A 1FNWA 1VF7A 5JJZA 1AW7A 4BBSB 3HZXA 1SAPA 5C4JB 4RFBA 1FR3A 1BCPF 1ZKOA 5J39A 1B3AA 1EY0A 3UI2A 2JEAI 2MP1A 3K5NA 5HURA 1KDCA 3R93A 4IFDJ 3LNNA 4C3JG 1DXMA 4EQNA 2NYZD 1D6EC 2EVBA 1B50A 2B2UA 5LL6S 3MTSA 1D1KA 2ENBA 5KNDA 1JCKB 2ICEC 4CKCA 2NWGA 1I4PA 1TVXA 3OIQA 3R3OA 1Q90A 3EFXD 1DOLA 1F9SA 1CK1A 1C4QA 3BZDB 4H7BA 4ABNA 1TR5A 5IGEA 3BDOA 2RQXA 3AB9A 1Q1BA 1MI2A 2RDGA 3WDNA 1JE4A 1QJOA 4DK1A 3BYTB 3NE5B 2LKVA 1XYIA 4XQNA 5JEAG 2CVRA 4FVMA 5LHY1 4Q0FA 4K2KA 2Z4HA 5JOBA 5M5WB 4C3HG 4DXFA 5JPMC 3C1EA 2HCCA 2WP8J 3CU7A 2NN6I 2B2YC 1GXDC 1ENCA 1IW7D 5J22A 2SOBA 4ZK9B 2E2JB 1VMCA 1EY4A 3A8JE 3SHLA 3R8BA 1A3TA 5CV5A 5NUCA 3IAYA 1KLGD 1TWFB 5EKIA 1X32A 5IODA 4F8MA 2EJMA 3J7AV 3P1HA 4RGNA 2E74C 3IL8A 3D4WA 5D3IB 4PV1C 4F88A 3MHBA 2EZVA 3DUZA 4KKUA 5CMDA 5C5MA 5E4XA 3Q0AA 3X3NA 3NBHA 5IIFA 1TKWB 2A74C 4B9XA 4FF3A 3GD7A 1GHJA 3NPPA 1JR0D 1PTOF 1I6VC 4HMJA 4A3DB 3SK5A 4A3JB 3M3YB 3D31A 1PZKD 2OT2A 3ITPA 3NXWA 4DU9A 4HCEA 1SE2A 3DM1A 4CKEA 3SK4A 2F0LA 1AZQA 2QILA 3LWEA 1D2BA 4WRDA 2PZUA 2MGSA 4RAUC 3NTKA 3GTMB 1ZEQX 3VR6A 3I91A 4FXGC 4XT1B 5KYIA 5CV4A 5BN4A 3TN2A 4BBRB 2L55A 2EYLA 3H09A 4IQZA 1KAAA 5FK9C 1G91A 2B2UC 1EOTA 2RKSA 1GOZA 2VUMB 3FPPA 3EJIA 2PZWA 3S15B 4CHTB 4FP5D 1H9KA 1NR2A 4DAPA 1SXTA 3EQLC 1EY5A 4FO2A 2RDHA 4RGTA 3NBIA 1PRTB 3NQIA 2F0MA 1T5EA 4CJ1B 4BS9A 2WIIB 2VNUD 4K2LA 2F3VA 1PXUA 2B8GA 5M9OA 1V1PB 1HFNA 4KY5A 1G2TA 1GUOA 3Q6SA 1TY2A 1NAPA 2EYJA 4A3IB 4XQQA 4KKTA 2JE6I 1CM9A 2KUMA 3E6ZX 3ZYYX 2O5JC 2AQ3B 2D9UA 4IFDI 4CJ2C 5KEEA 1XXGA 2FMCA 3E5SA 1SNCA 3BDCA 1CZGA 2K7VA 2L0CA 4ME5A 2AWNA 3QB3A 1SJED 4WJWA 3PUXA 1O80A 1SE4A 1PTOH 2SEBD 2A6EC 4DXGA 1EQTA 4NP5A 1ESFA 1PMRA 4XYOA 4BY1B 1H9SB 5C5LA 1M8AA 3R2TA 4QB4A 4I65A 2MHVA 1QOHA 1SNDA 4L63B 3PO3B 2D2CC 4UAIA 5K36G 1LT6D 2ID0A 2Z1CA 1YNNC 2B39A 1PZID 4X3SA 4IURA 3GP7A 2ZXRA 2L4NA 3D6CA 2PZTA 1X3PA 2H1EA 3QIAA 3T53B 2A6HD 4BA1I 3QG1A 4XTCS 2EOTA 3SE0A 1ZYRC 4GZYC 4TRDA 1WTVA 1TWAB 5CGKA 2NVQB 1Y8OB 4ZUIA 1SYEA 1Z47A 1V1OA 4CGYB 1STYA 5DM73 1E2WA 4Q5VA 4XQJA 4J8QA 3MAQA 3WOEA 3GQBA 2N55A 2K6AA 1QCBD 3K6OA 1DOKA 1S4ZA 1LTTD 4A3FB 2J4XA 3V05A 3RZOB 1I4HA 4C3IB 2F4IA 3BVZA 1LTBD 1GUWA 1BNZA 1TIID 3I73A 3D4DA 2KEEA 2CW0D 3KF8A 4DA2A 5CV7A 3FVQA 3DWPA 3S2DB 2B2TC 1F2MA 1R4QB 4ZUJA 1WD0A 2Z4IA 2AWOA 3EROA 4G7OC 4DFAA 5ELCA 1V8QA 2KEDA 1JQYD 2DNEA 1F2YA 3P20A 2WKDA 3S1NB 3GV3A 3VYTA 3VR2A 4C3JB 2F0JA 3M4OB 4OO1H 4HSPA 1LV9A 4KY6A 4K5VA 1WTRA 3L9AX 1ML0D 1DONA 5CC4A 4ZKCB 4RGMA 3MXUA 4TQUS 2ZT9C 2I46A 3ND8A 1IL8A 4K5XA 3ND9A 3M7NA 4XYQA 5ELEA 3HOYB 1F2ZA 2XSCA 2N88A 3CRLC 3FKIB 4QUCA 1MD2D 2FHTA 3HP3A 1JB3A 5I4DA 1OXUA 4LK1C 1AFPA 2F0EA 4IALA 1IW7C 1EWHA 2CQAA 3IKJA 2B2YA 5J1ZA 5FOBB 4QMGA 4KK7A 4N9PA 1SE3A 2L9HA 2K03A 1CA5A 3OSOA 3PMFA 4XDXA 5D65A 1SJHD 2PO4A 5COYA 3VYRA 3G7LA 4K5WA 2B2VA 4OHJA 2R3ZA 3EA6A 4DF7A 3HGBA 1Q8IA 1D5MC 5EJWA 3LX0A 1SYGA 3VR5A 2Z8LA 1S5DD 1JC7A 4R8NA 3AMUA 4MHEA 2JA7B 2XWJB 1CZWA 1B4OA 4XT3B 4G7HC 3NQTA 3W2DA 3NSWA 5FKAC 3OIPA 4QUFA 1EQVA 1PRTF 3H6MA 5IT9L 1LO5D 3N52A 2M2LA 2M00A 2RSNA 1Y1VB 1SYFA 4E6IA 1MSGA 1SNPA 1NUCA 4K6DA 5A35A 4RHRA 4X3UA 1QB5D 3A55A 5CBAE 4H0LC 2NVXB 4H44C 2ZXOA 4MIUA 1SYDA 5E4WC 5EGTA 1R4PB 4RA8A 3P75A 1ICWA 3WOFA 5I2YA 3MC0B 3FRPB 2PW7A 3VA5A 1JOOA 5C4ZA 1I4RA 2KCCA 1PFBA 1NSNS 1RD9D 1JOKA 4A3MB 2BDOA 2BCOA 1XTCD 3DEOA 4G57A 4Y7NB 1QNKA 1BUVT 4DNTB 3QOLA 2NN6G 2DNCA 1STBA 4IUVA 2M9VA 4X3KA 4C1NK 1ZXTA 4ZLTF 1QG7A 1JICA 4P2CB 1ESRA 5IT9E 3NP8A 1SBBB 1EY8A 2O5IC 1ONLA 3K5OA 5FO7B 2AUJD 2F1MA 2BE5D 5ELFA 1VMPA 4KN7C 2E2IB 3DEPA 1OXTA 2A5HA 4M1UB 3A56A 2NVYB 2IT1A 5JPNC 1RJTA 4O42A 4OIKA 1TS2A 4KTAA 2FINB 3VYUA 1OXSC 3Q23A 4A93B 2B2WA 5EPLA 1PLFA 4KI0A 4QIWB 3RZDB 4B9WA 2WINB 2R92B 2MJ8A 2OEOA 1MGSA 2A6HC 1A3UA 3GTGB 1CA6A 2B2VC 2K04A 4LMQD 2CHBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ2 C;  1JE4 A;  1F9P A;  2HDM A;  4XDX A;  1GUW A;  5D65 A;  1BNZ A;  2RA4 A;  2RSO A;  1WD0 A;  5COY A;  2KEE A;  4R9W A;  3FPU B;  1F9Q A;  3G7L A;  2B2V A;  1ROD A;  4OIJ A;  1XYI A;  1PFB A;  4IUT A;  1G2S A;  1BBX C;  2DY7 A;  1WD1 A;  1EIH A;  5CBE E;  1HUN A;  1MSH A;  2R3Z A;  2L11 A;  1NR4 A;  1O80 A;  1U4P A;  2FFK B;  2IL8 A;  3DM1 A;  3KBX A;  4ZKB B;  1DOM A;  4X3T A;  2CVR A;  1J9O A;  3DEO A;  1WVL A;  4U68 A;  1EQT A;  2B2T C;  1QE6 A;  5EPJ A;  1ILP A;  1WTW A;  1AZQ A;  1QNK A;  2KEC A;  2X6G A;  3FDT A;  3LWE A;  4IUP A;  1M8A A;  4CJ0 B;  1U4L A;  1RTN A;  2K01 A;  5EJW A;  2MGS A;  4ZAI A;  4RAU C;  3D6W A;  1BF4 A;  2NZ1 D;  4HCS A;  1NCV A;  2FJ2 A;  1A15 A;  1HFG A;  2Q8R E;  3KUP A;  4UAI A;  2EPB A;  2KED A;  2KVM A;  4NW2 A;  5AFW A;  2BDN A;  2L12 A;  5JJZ A;  3I91 A;  4IUV A;  2HDL A;  4X3K A;  5COR A;  1KNA A;  1SAP A;  5D14 A;  1WTQ A;  3GV3 A;  2X6L A;  1HUM A;  1ZXT A;  4MHE A;  4X3S A;  4ZLT F;  1DZ1 A;  4IUR A;  4XT1 B;  1QG7 A;  1B3A A;  2JP1 A;  1B2T A;  1JIC A;  2HCC A;  1ESR A;  1HHV A;  1SSO A;  2L4N A;  1O7Z A;  1RTO A;  3TN2 A;  1LV9 A;  1J8I A;  3UI2 A;  1HA6 A;  3GV6 A;  2B2Y C;  2XIW A;  1WTR A;  1IKL A;  1X3P A;  2H1E A;  1B4O A;  2MP1 A;  1B53 A;  4HAE A;  4XT3 B;  1BO0 A;  4RWS C;  1G91 A;  1HRJ A;  2B2U C;  2DY8 A;  4HED A;  4ZK9 B;  1VMP A;  2EOT A;  1EOT A;  1ML0 D;  1PFN A;  1F9R A;  1U4R A;  1VMC A;  1DON A;  5EQ0 A;  3R93 A;  4HSV A;  4ZKC B;  3DEP A;  2FMM A;  5DNF A;  2K28 A;  2RVL A;  3P7J A;  3H91 A;  1U4M A;  2EE1 A;  2HCI A;  3F2U A;  4QUF A;  1EL0 A;  1C8C A;  2NYZ D;  1B50 A;  1NR2 A;  1O7Y A;  2B2W C;  1WTP A;  2K1B A;  5EPK A;  1WTV A;  1XX8 A;  2B2T A;  1RJT A;  1X32 A;  1IL8 A;  4O42 A;  5EKI A;  1WTO A;  1AP0 A;  1F2L A;  2SDF A;  3N52 A;  2M2L A;  2B2U A;  4OIK A;  1AZP A;  3MTS A;  1G6Z A;  2RSN A;  1ILQ A;  2FIN B;  4IUQ A;  4MN3 A;  4DN4 M;  1Q3L A;  1RHP A;  2N88 A;  3IL8 A;  1MSG A;  4CJ1 B;  4QUC A;  5T1I A;  3I8Z A;  4X3U A;  5T1G A;  2B2W A;  2FHT A;  2K05 A;  4IUU A;  2MPM A;  5EPL A;  1PLF A;  1EIG A;  3HP3 A;  2NWG A;  5CBA E;  1TVX A;  2N55 A;  5CMD A;  3MWY W;  2KOL A;  2J7Z A;  1DOL A;  1F9S A;  2VXW A;  3IFD A;  3I90 A;  5E4X A;  1G2T A;  1HFN A;  3SVM A;  1DOK A;  2MJ8 A;  3Q6S A;  1MGS A;  1CA5 A;  1E0B A;  2L1B A;  3TZD A;  2Q8T A;  5E4W C;  2B2Y A;  1NAP A;  1S4Z A;  1KNE A;  3I3C A;  3ONA B;  1CA6 A;  2B2V C;  2K04 A;  1IKM A;  1SDF A;  4LMQ D;  1WTX A;  1X3Q A;  1PDQ A;  1CM9 A;  2KUM A;  2X69 A;  4RA8 A;  2L9H A;  4R8I A;  2K03 A;  2HUG A;  1ICW A;  1MI2 A;  1PFM A;  2JYO A;  2D9U A;  3QO2 A; 
#chains in the Genus database with same CATH topology
 3HOX B;  4A3I H;  3EIV A;  1SYC A;  3EBE A;  2MO0 A;  1BCP D;  3NK9 A;  1C48 A;  4LF4 Q;  1VQ7 A;  4KHZ A;  3OWF A;  4ZRZ A;  1PH2 A;  1G2S A;  4X66 L;  2L11 A;  4B3T Q;  1GO3 E;  5JJL A;  1F77 A;  3W5O A;  3DXJ C;  3F1Z A;  4DK6 C;  1O78 A;  1ILP A;  3CC4 A;  1PH3 A;  3EVQ A;  3OYY A;  4IUP A;  2JSO A;  1U4L A;  1MHW C;  3TZU A;  4OWW B;  4FF4 A;  2RDF A;  4U67 3;  3BYY B;  1YHQ A;  1BF4 A;  2NTS A;  4LFB L;  1GHK A;  3GO5 A;  3H3V I;  1KNA A;  1KDA A;  4JI4 L;  5KIX A;  5KRU A;  4BY1 H;  4C1N I;  4PQX A;  2QF7 A;  2JP1 A;  2LXJ A;  3PO3 H;  4NXN Q;  4JBM A;  2OTL A;  2E2H B;  2XIW A;  1EFI D;  3HKS A;  4HAE A;  3TP6 A;  2UUB Q;  1WCM B;  2K75 A;  1LTA D;  2CW0 C;  2IX1 A;  1F9R A;  1BBW A;  3AYH B;  1EY9 A;  1CQF A;  3L3O C;  5EBC A;  4X62 L;  4BXX H;  2R7Z B;  3D8G A;  4A3M G;  4ULL A;  3F2U A;  5IGF A;  4OO1 I;  1Y1W B;  4CDC C;  1LAC A;  2F4V Q;  2B2T A;  5LMN W;  1NE3 A;  4X65 Q;  1HH2 P;  5DAU A;  4YIJ A;  3W1B A;  4MN3 A;  1LYL A;  2K32 A;  3W1G A;  3HKZ E;  1YNJ D;  4IPD A;  4BY7 B;  5AJ3 Q;  4GKJ Q;  3H3V C;  4IJL A;  1EQQ A;  4EQO A;  2KHS A;  3M4Q A;  3DWA A;  1H9J A;  3CXC A;  2K5W A;  3HG9 A;  3NUC A;  1VQ5 A;  1HQM C;  2IY5 B;  3L7Z C;  4P71 A;  4IFD G;  1DM0 B;  2K50 A;  2IX0 A;  5ISR A;  4UP7 A;  2L1B A;  4RMF A;  2LSS A;  2MQH A;  5M5Y B;  1X56 A;  2D5D A;  4LF4 L;  4MTK A;  4OXP A;  4OGQ C;  2K33 A;  2SNS A;  1JWS D;  4JI3 Q;  1F9P A;  2ICI A;  3MXG A;  2HDM A;  4A3F H;  3KF6 B;  5HGT A;  5C44 H;  2K5D A;  4C3I H;  3K8A A;  2PNR C;  1HXY D;  2E2D C;  3H94 A;  2WAQ B;  2HD3 A;  5C4X H;  4IUT A;  3BVG A;  1NJI C;  3CCE A;  3GTL B;  3RMH A;  5IT9 c;  5IGB A;  4JI7 Q;  1V1Q A;  3MZ5 A;  5EPJ A;  1KD1 C;  4N8X 1;  4O2D A;  4POF A;  1LTS D;  1SNQ A;  2PPB C;  1HCZ A;  4J1M A;  4ZAI A;  5ELD A;  4F87 A;  2NZ1 D;  1LAB A;  4DNR B;  1S5C D;  3NTH A;  3S2D H;  1TY0 A;  3WWV A;  3OW7 A;  4NW2 A;  2F0V A;  3EN2 A;  3PSI A;  2UUB L;  1WTQ A;  2EXZ A;  1AH9 A;  2UU9 Q;  3D4R A;  4J6H A;  1HUM A;  1E2V A;  3HS0 C;  5C0X G;  2QEX A;  2AQ1 B;  1VQB A;  4NPS A;  4JI2 Q;  1CQV A;  2F3W A;  4DR7 Q;  3CRK C;  2B3G A;  2P5Z X;  2AUK A;  4H13 C;  3HOX G;  1XJV A;  4J15 A;  1BDO A;  1TWH H;  4FXK C;  3URY A;  1BO0 A;  4LF9 Q;  1ENA A;  3OMG A;  2F4V L;  3M85 A;  4DUY Q;  4C3J H;  1PFN A;  1TWG H;  1MBY A;  3M4O H;  4HSV A;  1RKN A;  5IY0 A;  4LUO A;  4I7Z C;  1XMO Q;  1N36 Q;  2MUY A;  3H91 A;  1U4M A;  2EE1 A;  3OOC A;  1B9N A;  1LTI D;  2B2W C;  1VF5 C;  2B63 B;  4IOA A;  5AJ3 L;  4GKJ L;  5EPK A;  1OXV A;  1S5E D;  3RLN A;  3OTO Q;  1PTO D;  2NUC A;  5M3M G;  4OWT B;  3ULJ A;  4PMW A;  1N8R C;  4N8F A;  3PUZ A;  3G48 A;  3QOJ A;  5F2D A;  4EVO A;  3KK7 A;  3BZC A;  1QUQ A;  2NZH A;  2LMC B;  3GTO B;  1Y8N B;  3OMC A;  2F3I A;  1E3P A;  1KAW A;  2WB1 B;  2NBF A;  4JOI C;  1H9M A;  1PH9 A;  1GUS A;  1YIT A;  2KHJ A;  3I90 A;  1G6P A;  1Z6H A;  1YJ9 A;  4JI3 L;  3F2D A;  1WCM G;  2XTI A;  1SYB A;  3BVM A;  1PDQ A;  1ET6 A;  2X69 A;  1K8O A;  1VQA A;  4ODG A;  3KF8 B;  5TSS A;  4AYB B;  3I72 A;  2O2L D;  4UP8 A;  5JAV A;  1HR0 Q;  1RL2 A;  3V2T A;  1Y1W G;  5FJ8 G;  4A3K H;  1UAP A;  1VQK A;  1KIX A;  2VY3 A;  1SEB D;  4RG1 A;  3S24 A;  2K52 A;  2JA6 B;  2Z0S A;  4L8J A;  4K8J A;  2UXC Q;  4DK0 A;  2JA9 A;  3KLW A;  3LWU A;  1JT8 A;  5JEA H;  2FFK B;  2JA8 B;  1XMQ Q;  4BY7 G;  1LLR D;  4KKS A;  2KBN A;  3RR5 A;  4KD3 A;  4PMB A;  3E9I A;  4LFC Q;  4OX9 Q;  3KLS X;  1EOV A;  2RBM A;  1K73 C;  3E9H A;  2UU9 L;  4DV2 L;  4DR7 L;  4UDU C;  5C3E H;  3HRZ C;  4JI2 L;  4YCV A;  2FXQ A;  1SNM A;  3PO2 B;  3KUP A;  2Q8R E;  1GJX A;  2RF4 A;  3U9S A;  1JOQ A;  4C2M B;  4C3H H;  5I2X A;  1SFO B;  3TP8 A;  5K5P A;  4QY7 A;  3MEH A;  2IPK D;  2NB0 A;  1X65 A;  2WV6 D;  1VQJ A;  1IBM L;  3GTJ B;  2YU9 B;  1HHV A;  2EXD A;  4A3L G;  2EYP A;  3DHQ A;  1HTL D;  2DJF C;  4V19 0;  3MVV A;  4HN7 A;  4LAA A;  2B8F A;  2JA7 H;  1D5Z C;  4GLX A;  3OTO L;  4GS3 A;  4EX5 A;  3GTP B;  3P7J A;  3S17 B;  2HCI A;  2A73 B;  2IJ0 A;  3N6R A;  1WFQ A;  1L0X B;  2PYK A;  2LY7 A;  1VQ9 A;  1RCV D;  2CH4 A;  3DWQ A;  1KXL A;  1I6H B;  2IHE A;  1HNZ Q;  1K8G A;  1FYC A;  1S5B D;  2EDG A;  3MFY A;  4P73 A;  1ILQ A;  4HR7 B;  4A3G G;  2SNM A;  3K59 A;  4JYA Q;  3NTI A;  2F0U A;  3HOV B;  5C3X A;  2K5Q A;  3G6E A;  1BXT A;  1PYB A;  1W6J A;  2MPM A;  4IUU A;  1AEX A;  3QR8 A;  5IE8 A;  4IJH A;  1Y1V H;  2KQ3 A;  4CDD C;  2KOL A;  2VZA A;  3VA7 A;  5JEA J;  3OPO A;  3SVM A;  4BWG B;  1E0B A;  4YCU A;  1HR0 L;  2BE5 C;  2IW3 A;  3S2H B;  4B3M Q;  2KJX A;  2F0T A;  4KV6 A;  1UNS A;  2R93 G;  5CV6 A;  3AEV A;  3CF5 A;  2NVX H;  2UXC L;  2HUG A;  3C1F A;  3VR4 A;  1B1Z A;  4NDX A;  2OCE A;  1XMQ L;  2XNA C;  4LW1 A;  2F0O A;  4LFC L;  4OX9 L;  4JBW A;  4K8I A;  4M8A A;  1JJG A;  1ROD A;  1MSH A;  4O0A A;  1EY6 A;  1X3F A;  2DN8 A;  5KYL A;  1VQD A;  2O4X A;  3V96 A;  5GRO A;  5JJI A;  3CHB D;  3RLF A;  2Z6K C;  3AQQ A;  3RN5 A;  1PFS A;  3W3A A;  5C4H A;  3ER0 A;  2JXM B;  1L0W A;  4RKL A;  1HFG A;  4FF1 A;  2EJG C;  2H4O A;  1N34 Q;  1SNO A;  4R1J A;  4DV4 Q;  4Y7N H;  3HOU G;  4TVA B;  1BOS A;  1DZ1 A;  1NMF A;  1IL2 A;  4AYB G;  4KY7 A;  2EY2 A;  4GNX B;  2PMZ B;  4DAY A;  1YNX A;  1UUP A;  3T1H Q;  1BCP C;  1P16 A;  3T4A C;  4YY3 Q;  4FNF A;  4DV1 Q;  1STN A;  4JI5 Q;  1H9R A;  5KNC A;  3J80 i;  3RLO A;  1IYV A;  4TKO B;  3NWT A;  2LFN A;  1A2T A;  3CCJ A;  1DCZ A;  4GLA C;  1CUK A;  2RHQ B;  1KAB A;  3HKZ G;  3K7A B;  2H5X A;  1J6Q A;  4JYA L;  1C8C A;  3A8K E;  2D62 A;  4EGV A;  4A3B B;  1PVO A;  2K1B A;  1XX8 A;  1AP0 A;  4JG2 A;  1G6Z A;  2HT1 A;  3TDQ A;  4CKB A;  1A8V A;  1A0I A;  4IUQ A;  1K83 B;  1KHI A;  3KOJ A;  3VYS A;  4HMI A;  4DN4 M;  2NVY H;  1RF2 D;  2NVT B;  1TXY A;  3TME A;  1STA A;  3T13 A;  3I8Z A;  1D8L A;  5T1G A;  4DUZ L;  2JA5 G;  2BH8 A;  2F0D A;  3L0O A;  1ET9 A;  3S1R B;  3SR1 A;  4A93 H;  4QIW E;  2HIV A;  3TZD A;  1S40 A;  4PZ8 A;  1ASZ A;  4IO9 A;  1X54 A;  4OWX B;  5FLX E;  4S3S A;  3RZD H;  5IOC A;  2R92 H;  1EL0 A;  2JYO A;  1I3Q B;  2PCF B;  4GLV B;  3GTG H;  1TWF H;  3S1Q B;  4NMZ A;  1SMY D;  1EZ8 A;  1RDP D;  3BU2 A;  1TQO A;  3GTQ B;  5C0X H;  3FMC A;  3FPU B;  1FNV A;  4RHS A;  4A3E G;  1K3R A;  1EIH A;  3OWE B;  1BBX C;  1Y8P B;  1YNJ C;  5A2Q L;  4ILW A;  2IL8 A;  4UP9 A;  4X3T A;  3Q22 A;  3RD4 A;  1N34 L;  5G3L F;  1KDB A;  1PZJ D;  3BDL A;  4DV4 L;  1HA5 A;  1VCI A;  1CHQ D;  4A3C G;  1AN8 A;  5K36 H;  2XRS D;  2FJ2 A;  4MTN A;  3C46 A;  2F0H A;  3T1H L;  4YY3 L;  3T56 B;  4DV1 L;  2HDL A;  4KJO A;  4JI5 L;  4CDE C;  1YI2 A;  2EY6 A;  4LJZ C;  3TRZ A;  5JVH 3;  4DK3 C;  3QWN A;  3PIP 3;  3Q24 A;  4N9T A;  1VQM A;  4L6T B;  4KMU C;  4PG3 A;  1J5E Q;  1IYJ B;  4HED A;  2E75 C;  1YBY A;  2Y0S G;  3J81 L;  3GTK B;  1EYD A;  2RVL A;  2E2H H;  4MZ9 A;  5C6A A;  1B9M A;  4FYD A;  5GAG C;  2G9H D;  5E7N A;  5M3F B;  1N9W A;  3CQZ B;  1U9R A;  1WYD A;  1WTO A;  4GOP C;  2R7D A;  1AZP A;  1L1O C;  5IGC A;  5LMU L;  1M1K C;  4HTH A;  2R7Z H;  2YYZ A;  3J7A F;  1RHP A;  1X9N A;  2CFM A;  5FJ8 H;  4YWK A;  3T51 B;  3C2P A;  4K6L A;  4WFN 3;  1YIJ A;  2OF1 A;  1EIG A;  3U4Z A;  5C0X J;  1TT2 A;  3MWY W;  4CBV A;  1EYC A;  4LF8 Q;  2EJF C;  2ZXP A;  4K14 A;  5EBD A;  3S16 B;  3I3C A;  2I07 B;  3VR3 A;  2VQE L;  5A2Q E;  2GA4 B;  3ERQ A;  1IHZ A;  2QA4 A;  3S15 H;  1U0L A;  1QWY A;  3KBG A;  1PFM A;  3PGZ A;  3QO2 A;  4A3B G;  1PTO C;  2EYH A;  2RA4 A;  2A69 D;  2BA1 A;  3MXN A;  2G9D A;  5M5Y H;  3IFT A;  5KGU A;  1A3V A;  1I5F A;  3S14 B;  3T16 A;  4POG A;  5ELB A;  2J0T D;  1VQL A;  3T1Y Q;  1WVL A;  1UEA B;  3C3L A;  1A6X A;  1BBU A;  2AQ2 B;  4JOI A;  3FHW A;  2KEC A;  5BR8 L;  3ULP A;  2K01 A;  2N78 A;  1EU4 A;  4FXD A;  4AIM A;  1PRT D;  4Z9C B;  3A8I E;  5BN5 A;  2BDN A;  5D14 A;  3J81 E;  4PNY A;  3NHH A;  1J5E L;  5C3W A;  2A68 D;  2BOS A;  3J80 L;  1B2T A;  1D1I A;  1SSO A;  4OO1 G;  1EY7 A;  1PA6 A;  3DM3 A;  5FO9 B;  3E0E A;  4BBS G;  5M3M B;  5IGD A;  3LGJ A;  1HTP A;  3M9B A;  4HJ7 A;  4XIG S;  5JVG 3;  3KLS A;  2K5H A;  3J7Y W;  5IYD H;  3H15 A;  1WTP A;  1O7Y A;  1XNR L;  4ID6 A;  3DMU A;  2ALY B;  5E3F A;  5G3L D;  3M7G A;  1LT3 D;  2UXD Q;  1F2L A;  1A2U A;  4YCW A;  3MA2 B;  1YJW A;  3F8T A;  1IBK Q;  4R4C A;  4KJN A;  4GN3 B;  1B7Y B;  5LL6 X;  1T5X D;  5LMN Q;  2I5L X;  1HNX Q;  2B63 H;  1JJ2 A;  3A7A B;  4AQY Q;  5T1I A;  1Q82 C;  5IYB H;  5BN3 A;  2F0G A;  3TQY A;  4IZ8 A;  1EZ6 A;  3I4N B;  1N32 Q;  1LM0 A;  5CV9 A;  4DR1 Q;  2WB1 E;  4DV7 Q;  4JI6 Q;  2J7Z A;  1V43 A;  2GVA A;  3IFD A;  1XPU A;  3GTO H;  2KEN A;  1I4G A;  1IZ6 A;  2AHO B;  4IN3 A;  1SDF A;  3K5M A;  1JOR A;  5HY6 A;  1EWC A;  3X3M A;  4R8I A;  2XN9 C;  1TWA H;  4G7Z C;  2NVQ H;  3T1Y L;  3JAM i;  5M3F G;  4NB3 A;  2DUD A;  3PIO 3;  1TU2 B;  1VDZ A;  3HEJ A;  5KNB A;  1F9Q A;  4OIJ A;  5I6Y A;  3FEW X;  2UUA Q;  5CBE E;  4LF6 Q;  3KYH C;  5I6W A;  1ASY A;  4OON A;  1I4X A;  3A7L A;  1W6K A;  2JQO A;  2QDL A;  2JA6 H;  1I50 B;  3J80 E;  3H0G B;  3E0J A;  2X6G A;  4DV0 Q;  4XXE A;  1KTK A;  4QF4 A;  4QQB X;  2JA8 H;  3D6W A;  4B3T L;  1A15 A;  1IYU A;  1G8Z D;  1S5F D;  1TS3 A;  2EPB A;  5AFW A;  3RZO H;  5IP9 H;  1BR9 A;  2F0Q A;  4KHP Q;  3K80 C;  1N33 Q;  2JJQ A;  1PYW D;  1UE7 A;  5CR3 A;  1XNQ Q;  2IWH A;  4IPG A;  5EKK A;  2Q8I B;  2IX3 A;  2CWA A;  3CP0 A;  1O7Z A;  3SDZ A;  3PO2 H;  4C2M H;  5EKL A;  4APV A;  1SFO H;  3GV6 A;  1HA6 A;  1BCP B;  1B53 A;  3U9O A;  4QCL A;  1NBW A;  3SK6 A;  4LNQ A;  3O13 A;  1DD2 A;  2DY8 A;  4ZQ3 A;  1X55 A;  2F0F A;  2UXD L;  3ERS X;  1M90 C;  4A3G B;  2YU9 H;  4ZCK A;  1QIL A;  3CCV A;  4RCN A;  1QUQ B;  3TP5 A;  4NXN L;  3CC2 A;  3G6J B;  1FGU A;  2ZJQ A;  1NMG A;  3A0J A;  5LMN L;  4LFA Q;  2EIF A;  3KDF B;  5I9O A;  4AQY L;  2Z6K A;  1EYG A;  2SDF A;  3KLR A;  3GTP H;  4DR1 L;  4JI0 Q;  3S17 H;  4JI6 L;  3PIP A;  1LTG D;  3S1N H;  3PUY A;  4PMC A;  2R7F A;  2R93 B;  2L5T A;  2PQA A;  2K05 A;  3A54 A;  4X65 L;  1I4Q A;  1D5X C;  2OXP A;  1O7L A;  3PUV A;  2WAC A;  3K5L A;  2CKZ B;  2VXW A;  3HOV H;  2PI2 A;  2VB3 X;  5ELN A;  2QDB A;  2WKC A;  1EFW A;  3ONA B;  2EYM A;  1X3Q A;  3HOW B;  1V1P A;  5D3D A;  1Y69 U;  5JJK A;  1TS4 A;  1JWU D;  3KBX A;  4JK1 C;  5IP7 H;  4DR5 Q;  4K0K Q;  1DYQ A;  2EYF A;  3S2H H;  4RCO A;  3NWS A;  3KDF A;  2RSO A;  3BG3 A;  1UEB A;  2BA0 A;  4HID A;  4G4K A;  1CHP D;  2C35 B;  3HOY H;  3PUW A;  4R9W A;  4F7X A;  3S9W A;  4DV0 L;  3FKI H;  1HUN A;  5I9P A;  4JW0 A;  4A3J G;  3SEB A;  1J9O A;  1EEF D;  1L0Y B;  2NTT A;  3I4N G;  1QE6 A;  4KHP L;  3HOU B;  1N33 L;  4CJ0 B;  3J81 j;  1EU3 A;  1RTN A;  1W2B A;  2HQE A;  2NN6 H;  2R6G A;  1WI5 A;  2F0K A;  3OHX C;  5C0X I;  2VB2 X;  1V9P A;  1B44 D;  3MFG A;  4EQ5 A;  4HJ5 A;  4JI7 L;  1STH A;  2NZO A;  4NKL A;  4QJF A;  2F52 A;  2X6L A;  2F0P A;  5IYC H;  2XVS A;  1ENF A;  2C9O A;  1H9S A;  2EY5 A;  5FLM H;  3HKZ B;  1SMY C;  4IPH A;  2QCP X;  3M4P A;  1J8I A;  1JJC B;  1EEI D;  1IKL A;  4EQP A;  4ALP A;  1Z9F A;  4RWS C;  1E2Z A;  1HRJ A;  3TSS A;  1STG A;  4FF2 A;  3PF5 A;  5EQ0 A;  2FMM A;  3CAM A;  1E22 A;  4JPB W;  4BBR G;  1B3Q A;  3OW2 A;  4YHH Q;  3K0Y A;  4V0B A;  1CT1 D;  2PW5 A;  2JA5 B;  4LF9 L;  4A4I A;  4DUY L;  3H0G G;  4LUV A;  4HIO A;  1FGB D;  5C44 B;  1SRO A;  2F0S A;  3A74 A;  5CV8 A;  1XMO L;  1N36 L;  1FJG Q;  2VUM G;  4FDB A;  3RUZ A;  2AKW B;  5IGG A;  5C4X B;  4A3B H;  1XTD A;  1M4V A;  4OL7 A;  1CI3 M;  1K83 H;  1VQE A;  3I4L A;  1II3 A;  3U4V A;  1FD7 D;  3M4Y A;  3CKI B;  4DR5 L;  2Q8T A;  1DJR D;  3J81 i;  3PCO B;  1TWC B;  3S1M B;  1KNE A;  1VQI A;  2GVB A;  3JAM L;  2F0N A;  2E76 C;  2ZTE A;  3D3R A;  5FO8 B;  1WTX A;  3K58 A;  4A3E B;  4QL5 A;  3J80 c;  1Z7T A;  2KCN A;  3UE0 A;  3S1R H;  5CYU A;  4WOR A;  3CCU A;  1VQ4 A;  4DV3 Q;  1PTO B;  2D0O A;  4P72 A;  2F0I A;  1K8M A;  1TWH B;  3AU7 A;  4GOP A;  5M5X B;  3J7A 5;  1L1O A;  2ZTD A;  1JWM D;  2JEB I;  2LS0 1;  1I3Q H;  4BA2 I;  1QVF A;  1TWG B;  1CSP A;  1NR4 A;  1U4P A;  3S1Q H;  1DOM A;  1GUT A;  1G29 1;  2C5C A;  5E1F A;  4U68 A;  1LTR D;  3GTQ H;  2Q2I A;  1QVC A;  1LT4 D;  3NEL A;  2QKI C;  4RH6 A;  3I4M B;  4DAY B;  1HPC A;  1OXX K;  1BQQ T;  4IUN A;  3R2I A;  1KL9 A;  5COR A;  3UDG A;  3PIO A;  3HOW G;  1GM5 A;  1KRS A;  2EYO A;  2Y0S B;  4C56 C;  5FLX L;  4BY1 G;  2E5L Q;  3I70 A;  4JC0 A;  4LF7 Q;  3JC6 6;  3BS1 A;  2XWB B;  2XRQ D;  2ATW A;  1RTO A;  1LT5 D;  2A69 C;  3STB D;  3PO3 G;  4YHH L;  2R61 A;  3K7U C;  4B08 A;  1BKB A;  1U4R A;  4GN5 A;  4A3M H;  5DNF A;  1Q1E A;  2K28 A;  1QZG A;  2OWO A;  3HOZ B;  4BXX G;  2PQE A;  1X6O A;  1CFM A;  1L2F A;  2TSS A;  3CCL A;  2KA7 A;  3PV0 A;  4X64 Q;  2CWP A;  4A3K B;  1Q12 A;  4RGO S;  4HJA A;  3GTK H;  2ZJP A;  1PRT C;  3MXP A;  1XWE A;  4KHV A;  1CTM A;  1Q3L A;  4KD4 A;  3JAM E;  1VQP A;  3CQZ H;  2A68 C;  4O1N A;  3MEF A;  5GQO A;  1Q46 A;  2A6E D;  1HNZ L;  1STE A;  2K14 A;  4DGZ A;  1EYA A;  4DAV A;  1PYS B;  4OEL B;  4IFD H;  4Y52 H;  1FNU A;  4PZ6 A;  2TMP A;  4DKA C;  2I5H A;  1TS5 A;  3QJY A;  1GUG A;  5C3E B;  4DV3 L;  3TBI B;  3TP7 A;  1K9M C;  2E2I H;  2EY1 A;  2F0W A;  4TSS A;  3KJP A;  1YNN D;  4C3H B;  2F03 A;  1IKM A;  5J3B A;  4QGU A;  1GUN A;  4JBJ A;  4KLK A;  1IBL Q;  5DEH A;  1PH7 A;  4IPC A;  4WJ3 M;  2D0P A;  4B3M L;  3S16 H;  1OO9 B;  1R9T B;  4RKB A;  4A3F G;  5C44 G;  1XPR A;  4C3I G;  2YTX A;  1KLU D;  2XGT A;  2DY7 A;  2V4D A;  2YV5 A;  1WD1 A;  4GN4 B;  3J7Z C;  1QNU A;  3SK8 A;  5C4X G;  1HNW Q;  4ZKB B;  1QVG A;  1K28 A;  1ZYR D;  1SN8 A;  2QEJ C;  4ZYS A;  5ELO A;  2HIX A;  5DM6 3;  1WTW A;  1CKN B;  3SXH A;  1HQR D;  3S14 H;  3FDT A;  4IOC A;  2E5L L;  4LF7 L;  4HCS A;  1NCV A;  4KN4 C;  1QZH A;  4YWM A;  2KVM A;  3K57 A;  1KQS A;  4HJ8 A;  2L12 A;  1FNW A;  1VF7 A;  5JJZ A;  1AW7 A;  4BBS B;  3HZX A;  1SAP A;  5C4J B;  1MJC A;  4RFB A;  1FR3 A;  1BCP F;  1ZKO A;  3UDI A;  5J39 A;  1B3A A;  3HOX H;  1E1O A;  1EY0 A;  5EAY A;  3RN2 A;  3UI2 A;  1Q7Y C;  2JEA I;  2MP1 A;  1BVS A;  1K8A C;  3K5N A;  2ZM6 Q;  5HUR A;  1U5K A;  1PH4 A;  4X64 L;  1KDC A;  3R93 A;  4IFD J;  3LNN A;  1ICF B;  4C3J G;  2YTY A;  1DXM A;  4EQN A;  2NYZ D;  1D6E C;  2EVB A;  1B50 A;  4LF5 Q;  1MJE A;  5M3M H;  1CKN A;  4HJ9 A;  3SGI A;  2B2U A;  5LL6 S;  3MTS A;  3I4M G;  4A76 A;  4P74 A;  1D1K A;  1B8A A;  4DV5 Q;  4DR6 Q;  2ENB A;  5KND A;  1JCK B;  3NEM A;  2ICE C;  4CKC A;  1WTH A;  2NWG A;  1I4P A;  1TVX A;  3OIQ A;  4NXM Q;  1NTG A;  3R3O A;  1Q90 A;  3EFX D;  1DOL A;  1F9S A;  1CK1 A;  1KC8 C;  1C4Q A;  1WCM H;  3BZD B;  3MXN B;  4H7B A;  4ABN A;  1TR5 A;  5IGE A;  3CPW A;  2A19 A;  3BDO A;  2RQX A;  2CQO A;  3AB9 A;  1FL0 A;  3HOZ G;  1Q1B A;  1MI2 A;  1YHB A;  2CH4 W;  2RDG A;  4JCV E;  3U50 C;  3WDN A;  1Y1W H;  1JE4 A;  1QJO A;  1HNW L;  3G4S A;  1O7I A;  4DK1 A;  2ASB A;  3BYT B;  3NE5 B;  3I55 A;  2LKV A;  4A3K G;  1OTC A;  3CPF A;  1XYI A;  3K81 C;  4BY7 H;  2Z6B A;  3TS2 A;  2HHH Q;  4XQN A;  1SRU A;  5JEA G;  2BH2 A;  2CVR A;  2HQL A;  4FVM A;  5LHY 1;  4JI4 Q;  4Q0F A;  5C3E G;  4K2K A;  2Z4H A;  5JOB A;  5M5W B;  4C3H G;  4DXF A;  2VL6 A;  5JPM C;  5IWA Q;  1CSQ A;  2WAQ E;  4X62 Q;  3C1E A;  2HCC A;  2WP8 J;  4A3L H;  3CU7 A;  4L5T A;  1X3G A;  2NN6 I;  1HZC A;  1P8L A;  2B2Y C;  1GXD C;  1ENC A;  3JAM c;  1IW7 D;  4LF5 L;  5J22 A;  3F2B A;  2SOB A;  4ZK9 B;  2RCN A;  2E2J B;  4DAM A;  1VMC A;  1EY4 A;  2JA7 G;  3GTL H;  1PH1 A;  5H1S E;  3A8J E;  3SHL A;  3R8B A;  2N49 A;  1A3T A;  5CV5 A;  1EWI A;  3I2Z A;  2OQK A;  4DR6 L;  5NUC A;  1YJN A;  3IAY A;  1KLG D;  1TWF B;  1HZB A;  1X32 A;  5EKI A;  5IOD A;  4F8M A;  2EJM A;  4HIK A;  3J7A V;  4A3G H;  1GD7 A;  3P1H A;  2LXK A;  4RGN A;  1PH6 A;  2KCM A;  1Y14 B;  2A1A A;  2E74 C;  3D4W A;  3IL8 A;  5D3I B;  4L5Q A;  4PV1 C;  4F88 A;  3MHB A;  4X6A H;  3GDE A;  2EZV A;  3DUZ A;  4KKU A;  5CMD A;  5C5M A;  3CW2 C;  1Y1V G;  5E4X A;  1JE5 A;  1NNX A;  3Q0A A;  2R93 H;  2MFI A;  3X3N A;  3NBH A;  5IIF A;  1CKO A;  1TKW B;  3L2P A;  2A74 C;  1VS0 A;  4B9X A;  4FF3 A;  5FLX c;  3GD7 A;  1GHJ A;  3NPP A;  3I56 A;  3B6Y A;  1JR0 D;  1PTO F;  1UWV A;  1I6V C;  4HMJ A;  4A3D B;  2QGQ A;  2EQS A;  3SK5 A;  4A3J B;  3M3Y B;  4LF8 L;  2HHH L;  3D31 A;  1GVP A;  1PZK D;  2OT2 A;  3ITP A;  3HOW H;  3NXW A;  1JMC A;  4LUZ A;  4DU9 A;  1C7Y A;  2GN5 A;  4HCE A;  1SE2 A;  5GAD C;  4GNX C;  3CCS A;  3DM1 A;  4CKE A;  3SK4 A;  4MNO A;  2F0L A;  1AZQ A;  2QIL A;  1EIY B;  3LWE A;  1D2B A;  2IHF A;  4WRD A;  2PZU A;  5IWA L;  2MGS A;  4RAU C;  3NTK A;  3GTM B;  4GKK Q;  4AYB E;  1YEZ A;  1ZEQ X;  3VR6 A;  1Q86 C;  2Q2T A;  4UHV A;  1SR3 A;  3I91 A;  3HOU H;  4FXG C;  4DNI A;  3UDX A;  4XT1 B;  5KYI A;  5CV4 A;  5BN4 A;  3TN2 A;  4BBR B;  2L55 A;  2EYL A;  2OQ0 A;  4UPA A;  3H09 A;  4IQZ A;  1KAA A;  2A8V A;  5FK9 C;  1G91 A;  2B2U C;  2I0Q A;  1EOT A;  2RKS A;  3K0X A;  2VW9 A;  1GOZ A;  2VUM B;  1VQC A;  3EJI A;  2PZW A;  3FPP A;  1HZ9 A;  3S15 B;  4CHT B;  2CCZ A;  4FP5 D;  1H9K A;  1NR2 A;  4DAP A;  1SXT A;  2PQA B;  2B29 A;  3EQL C;  1EY5 A;  4FO2 A;  2RDH A;  4RGT A;  3I4O A;  4L5R C;  3NBI A;  1VQO A;  1HJP A;  1PRT B;  3NQI A;  1VQN A;  2AMC B;  2F0M A;  1D7Q A;  1T5E A;  4CJ1 B;  2JA5 H;  4BS9 A;  2WII B;  4B3R Q;  2VNU D;  4K2L A;  1VQG A;  3GTJ H;  2F3V A;  1PXU A;  2B8G A;  5M9O A;  1V1P B;  1IBK L;  3STB C;  1HFN A;  4KY5 A;  1G2T A;  1SMX A;  1GUO A;  3Q6S A;  4H02 A;  1HNX L;  1TY2 A;  1NAP A;  2EYJ A;  4A93 G;  4A3I B;  1N32 L;  4XQQ A;  4KKT A;  1XPO A;  1B70 B;  2JE6 I;  1CM9 A;  2KUM A;  3E6Z X;  3ZYY X;  4DV7 L;  1PHJ A;  2O5J C;  2AQ3 B;  1H95 A;  3CCQ A;  2D9U A;  4L5S A;  4IFD I;  2R92 G;  4CJ2 C;  3IRB A;  5KEE A;  3PF4 A;  1XXG A;  1I6H H;  1TWC H;  2FMC A;  3AFQ A;  3E5S A;  3S1M H;  4JBK A;  1SNC A;  4A3E H;  3BDC A;  1CZG A;  2K7V A;  3Q8D A;  2L0C A;  4ME5 A;  4DV2 Q;  2AWN A;  3QB3 A;  1SJE D;  4WJW A;  2QW7 A;  3PUX A;  1C9O A;  1O80 A;  4GKK L;  1SE4 A;  3AFP A;  1PTO H;  2SEB D;  2A6E C;  1YZ6 A;  5GAE C;  4DXG A;  1EQT A;  4NP5 A;  1ESF A;  1PMR A;  3KF6 A;  4XYO A;  5M5X H;  4A3C H;  4BY1 B;  1H9S B;  5C5L A;  1M8A A;  3R2T A;  4QB4 A;  4I65 A;  2UUA L;  2MHV A;  1IBM Q;  1QOH A;  4LF6 L;  1SND A;  4R4T A;  4L63 B;  1E24 A;  3PO3 B;  2D2C C;  4UAI A;  1WOC A;  1LT6 D;  2ID0 A;  5K36 G;  1JB7 A;  2Z1C A;  1YNN C;  3J81 c;  2WFW A;  2JN4 A;  2B39 A;  4R4I A;  1MKH A;  1PZI D;  4X3S A;  4IUR A;  3I4M H;  4A3D G;  3GP7 A;  1SLJ A;  2ZXR A;  2Y0S E;  2L4N A;  3D6C A;  4AH6 A;  2ZJR A;  2PZT A;  1X3P A;  2H1E A;  4DR2 Q;  3QIA A;  3T53 B;  2A6H D;  4BA1 I;  3QG1 A;  1K0R A;  3CCM A;  4XTC S;  2EOT A;  3SE0 A;  1XNQ L;  1ZYR C;  4GZY C;  4TRD A;  1PH8 A;  2KHI A;  1WTV A;  1TWA B;  5CGK A;  2NVQ B;  4B3R L;  1Y8O B;  2L15 A;  4ZUI A;  1SYE A;  1Z47 A;  4CDF C;  1MIU A;  1V1O A;  2RHS B;  4CGY B;  1STY A;  3HOZ H;  1E1T A;  5DM7 3;  1E2W A;  2R7Z G;  4Q5V A;  2PMZ E;  4XQJ A;  4LFA L;  1NY4 A;  4J8Q A;  1KRT A;  3MAQ A;  3WOE A;  3GQB A;  2N55 A;  2K6A A;  1QCB D;  4JI0 L;  1A63 A;  3K6O A;  3E3X A;  1DOK A;  5HGQ A;  3G71 A;  1S4Z A;  1LTT D;  4A3F B;  2J4X A;  3V05 A;  4GOP B;  1GKH A;  3A5U A;  1HR0 W;  1L1O B;  3RZO B;  1I4H A;  4C3I B;  3K7A H;  2F4I A;  3ULL A;  3U58 A;  1G51 A;  3BVZ A;  1LTB D;  3TRE A;  1GUW A;  2UUC Q;  1BNZ A;  3CD6 A;  1TII D;  3I73 A;  3D4D A;  1EIF A;  2KEE A;  3UE1 A;  2NVT H;  2CW0 D;  4K0K L;  3KF8 A;  4DA2 A;  3H3V H;  1Q81 C;  5CV7 A;  3FVQ A;  1R9T H;  3I7F A;  3DWP A;  2K5V A;  4DR3 Q;  3TS0 A;  2UXB Q;  3S2D B;  2B2T C;  1VQF A;  1F2M A;  1R4Q B;  4ZUJ A;  1WD0 A;  2WAQ G;  2Z4I A;  2AWO A;  4B3S Q;  3ERO A;  2Q2H A;  4G7O C;  1YVC A;  4DFA A;  5ELC A;  1V8Q A;  2KED A;  4A3I G;  1JQY D;  2DNE A;  1F2Y A;  4DR2 L;  3P20 A;  1VQ8 A;  2WKD A;  3S1N B;  2ZTC A;  3GV3 A;  3VYT A;  3VR2 A;  2K5N A;  4C3J B;  2F0J A;  1AE3 A;  3M4O B;  4OO1 H;  4HSP A;  1LV9 A;  4KY6 A;  4K5V A;  1WTR A;  2G5D A;  1T9H A;  2DJG C;  4BBS H;  1UE5 A;  3L9A X;  5C4J H;  4HIM A;  3UDF A;  1ML0 D;  1DON A;  5CC4 A;  1Q8K A;  4ZKC B;  2MNA A;  4DR4 Q;  4RGM A;  3MXU A;  4TQU S;  2ZT9 C;  3VDY A;  5IYD G;  2I46 A;  3ND8 A;  4DUZ Q;  1IL8 A;  4R4O A;  3KFU A;  4K5X A;  3ND9 A;  1K0S A;  3M7N A;  4XYQ A;  5ELE A;  3HOY B;  4R4Q A;  4YWL A;  1F2Z A;  2XSC A;  2N88 A;  3CRL C;  1VQH A;  4P75 A;  3FKI B;  4QUC A;  2YTV A;  2B63 G;  1MD2 D;  2FHT A;  3ZJY C;  3HP3 A;  2ES2 A;  5IYB G;  1JB3 A;  5I4D A;  1EQR A;  1OXU A;  4LK1 C;  1FJG L;  3CMA A;  1AFP A;  2F0E A;  4IAL A;  1IW7 C;  1EWH A;  2CQA A;  3IKJ A;  2B2Y A;  5J1Z A;  2UUC L;  4UY8 C;  2PNH A;  2V1C C;  5FOB B;  2WB1 G;  4QMG A;  4KK7 A;  1YHA A;  4N9P A;  1SE3 A;  2L9H A;  2K03 A;  5M3F H;  1CA5 A;  1VQ6 A;  3OSO A;  3PMF A;  4XDX A;  3CME A;  5D65 A;  4JI8 Q;  1SJH D;  4DR3 L;  2UXB L;  2I5M X;  2PO4 A;  5COY A;  3VYR A;  2Z9H A;  3G7L A;  4K5W A;  2B2V A;  4B3S L;  4OHJ A;  2R3Z A;  1LUZ A;  3DLL A;  2E8G A;  3EA6 A;  4DF7 A;  3HGB A;  1HZA A;  1Q8I A;  2KCT A;  2JA6 G;  1D5M C;  5EJW A;  4JI1 Q;  3LX0 A;  1SYG A;  4JV5 Q;  3VR5 A;  2JA8 G;  2Z8L A;  2Q2U A;  1S5D D;  1JC7 A;  1EUJ A;  2DGY A;  1I94 Q;  4R8N A;  5IP9 G;  3AMU A;  4JVZ A;  4MHE A;  2JA7 B;  1WJJ A;  1PH5 A;  2XWJ B;  1CZW A;  1PV4 A;  1W3S A;  4DR4 L;  5M5W H;  3PO2 G;  1SE8 A;  1B4O A;  1UE6 A;  4XT3 B;  1AE2 A;  4G7H C;  3CCR A;  3NQT A;  3TEH B;  3W2D A;  3NSW A;  5LMU Q;  5FKA C;  2VQF Q;  1UE1 A;  3D0F A;  4GNX A;  3OIP A;  4QUF A;  4ME3 A;  1EQV A;  1PRT F;  3H6M A;  5IT9 L;  2MO1 A;  2E2J H;  1LO5 D;  1CKM A;  3N52 A;  2M2L A;  2M00 A;  2RSN A;  1Y1V B;  1SYF A;  4E6I A;  1MSG A;  1SNP A;  1NUC A;  2JK8 A;  4K6D A;  1RIP A;  5A35 A;  4RHR A;  4X3U A;  1LTL A;  2VQE Q;  2RCF A;  1QB5 D;  3A55 A;  5CBA E;  4H0L C;  2NVX B;  4DV6 Q;  1A62 A;  4H44 C;  2VS1 A;  3A5Z B;  2ZXO A;  4MIU A;  3HOV G;  1SYD A;  5E4W C;  4JI8 L;  1DGS A;  5EGT A;  3NEN A;  1R4P B;  4RA8 A;  1E7Z A;  3P75 A;  1ICW A;  3WOF A;  5I2Y A;  5IP7 G;  3MC0 B;  3FRP B;  2PW7 A;  3VA5 A;  1JOO A;  4A3D H;  5C4Z A;  5BR8 Q;  1I4R A;  2KCC A;  1PFB A;  3HOY G;  1NSN S;  4A3J H;  4JI1 L;  1IBL L;  3M3Y H;  1RD9 D;  1JOK A;  4A3M B;  2BDO A;  3FKI G;  4JV5 L;  2BCO A;  3BZK A;  1XTC D;  3DEO A;  3I4N H;  3BJU A;  4G57 A;  1I94 L;  5GAH C;  4Y7N B;  1QNK A;  1BUV T;  1X3E A;  4X66 Q;  4DNT B;  3RNU A;  3QOL A;  2NN6 G;  2DNC A;  2OTJ A;  4I7A A;  1STB A;  2K4K A;  2N8N A;  4IUV A;  2M9V A;  4X3K A;  1S3O A;  4C1N K;  1ZXT A;  4ZLT F;  3ICE A;  1QG7 A;  3GTM H;  1JIC A;  4P2C B;  5IYC G;  1ESR A;  2VQF L;  5IT9 E;  3NP8 A;  4LFB Q;  1SBB B;  1EY8 A;  5FLM G;  2O5I C;  1ONL A;  3HFZ B;  3K5O A;  5FO7 B;  2AUJ D;  1XNR Q;  2F1M A;  2BE5 D;  5ELF A;  3KJO A;  1VMP A;  4KN7 C;  2E2I B;  3CC7 A;  3DEP A;  1OXT A;  2A5H A;  4BBR H;  4M1U B;  3A56 A;  4DPG A;  3F2C A;  1K3B C;  2NVY B;  2IT1 A;  1I50 H;  5JPN C;  3H0G H;  5DLQ E;  2ZM6 L;  1RJT A;  4O42 A;  4OIK A;  1TS2 A;  2VUM H;  4KTA A;  2FIN B;  3VYU A;  1OXS C;  3Q23 A;  4DV6 L;  3NBH B;  1IXR A;  2PI2 E;  4A93 B;  4OEM B;  2B2W A;  5EPL A;  1PLF A;  2N3S A;  1C0A A;  4KI0 A;  4QIW B;  3RZD B;  4B9W A;  5L37 A;  2WIN B;  3FP9 A;  2R92 B;  2MJ8 A;  2OEO A;  1MGS A;  2A6H C;  4PZ7 A;  1A3U A;  4DV5 L;  3GTG B;  1FVI A;  3PQI A;  4A75 A;  1CA6 A;  2B2V C;  2K04 A;  4LMQ D;  4NXM L;  2CHB D;  4LWC A;  1S72 A;  4WJ4 A; 
#chains in the Genus database with same CATH homology
 3HOX B;  1SYC A;  1BCP D;  3NK9 A;  1C48 A;  4KHZ A;  3OWF A;  4ZRZ A;  1G2S A;  2L11 A;  1F77 A;  3DXJ C;  1O78 A;  1ILP A;  3EVQ A;  4IUP A;  2JSO A;  1U4L A;  3TZU A;  4FF4 A;  2RDF A;  4U67 3;  3BYY B;  1BF4 A;  2NTS A;  1GHK A;  3GO5 A;  1KNA A;  1KDA A;  5KIX A;  5KRU A;  4C1N I;  4PQX A;  2QF7 A;  2JP1 A;  2E2H B;  2XIW A;  1EFI D;  4HAE A;  3TP6 A;  1WCM B;  1LTA D;  2CW0 C;  2IX1 A;  1F9R A;  3L3O C;  1EY9 A;  1CQF A;  5EBC A;  2R7Z B;  3D8G A;  4ULL A;  3F2U A;  5IGF A;  4OO1 I;  1Y1W B;  1LAC A;  2B2T A;  5DAU A;  4YIJ A;  4MN3 A;  2K32 A;  1YNJ D;  4BY7 B;  3H3V C;  4EQO A;  2KHS A;  3DWA A;  1H9J A;  2K5W A;  3HG9 A;  3NUC A;  1HQM C;  3L7Z C;  4IFD G;  1DM0 B;  2IX0 A;  5ISR A;  2L1B A;  5M5Y B;  2D5D A;  4OGQ C;  2K33 A;  2SNS A;  1JWS D;  1F9P A;  2ICI A;  3MXG A;  2HDM A;  5HGT A;  2K5D A;  2PNR C;  1HXY D;  2E2D C;  3H94 A;  2WAQ B;  4IUT A;  3BVG A;  3GTL B;  3RMH A;  5IGB A;  3MZ5 A;  5EPJ A;  1LTS D;  1SNQ A;  2PPB C;  1HCZ A;  4J1M A;  4ZAI A;  5ELD A;  4F87 A;  2NZ1 D;  1LAB A;  4DNR B;  1S5C D;  3NTH A;  1TY0 A;  3OW7 A;  4NW2 A;  2F0V A;  1WTQ A;  2EXZ A;  3D4R A;  4J6H A;  1HUM A;  1E2V A;  3HS0 C;  5C0X G;  2AQ1 B;  1CQV A;  2F3W A;  3CRK C;  2AUK A;  4H13 C;  1BDO A;  3URY A;  4FXK C;  1BO0 A;  1ENA A;  3OMG A;  3M85 A;  1PFN A;  1MBY A;  4HSV A;  1RKN A;  4I7Z C;  2MUY A;  3H91 A;  1U4M A;  2EE1 A;  3OOC A;  1B9N A;  1LTI D;  2B2W C;  1VF5 C;  2B63 B;  5EPK A;  1OXV A;  1S5E D;  1PTO D;  2NUC A;  4PMW A;  3PUZ A;  3QOJ A;  5F2D A;  4EVO A;  3KK7 A;  2LMC B;  3GTO B;  1Y8N B;  3OMC A;  2NBF A;  2WB1 B;  1H9M A;  1GUS A;  3I90 A;  1Z6H A;  1SYB A;  3BVM A;  1PDQ A;  1ET6 A;  2X69 A;  1K8O A;  5TSS A;  4ODG A;  4AYB B;  3I72 A;  2O2L D;  5JAV A;  3V2T A;  1UAP A;  1SEB D;  2JA6 B;  4L8J A;  4K8J A;  4DK0 A;  3LWU A;  5JEA H;  2FFK B;  2JA8 B;  1LLR D;  4KKS A;  4KD3 A;  4PMB A;  3KLS X;  2RBM A;  4UDU C;  3HRZ C;  1SNM A;  3PO2 B;  3KUP A;  2Q8R E;  1GJX A;  3U9S A;  1JOQ A;  4C2M B;  5I2X A;  1SFO B;  3TP8 A;  5K5P A;  3MEH A;  2IPK D;  2NB0 A;  2WV6 D;  3GTJ B;  2YU9 B;  1HHV A;  2EYP A;  3DHQ A;  1HTL D;  4V19 0;  3MVV A;  4HN7 A;  4LAA A;  2B8F A;  1D5Z C;  3GTP B;  3P7J A;  3S17 B;  2HCI A;  2A73 B;  2IJ0 A;  3N6R A;  1L0X B;  2PYK A;  2LY7 A;  1RCV D;  3DWQ A;  1I6H B;  1FYC A;  1S5B D;  2EDG A;  3MFY A;  1ILQ A;  4HR7 B;  2SNM A;  3K59 A;  3NTI A;  2F0U A;  3HOV B;  5C3X A;  2K5Q A;  1BXT A;  1W6J A;  2MPM A;  4IUU A;  1AEX A;  2KQ3 A;  2KOL A;  3VA7 A;  5JEA J;  3OPO A;  3SVM A;  4BWG B;  1E0B A;  2BE5 C;  2IW3 A;  3S2H B;  2KJX A;  2F0T A;  4KV6 A;  1UNS A;  5CV6 A;  2HUG A;  3C1F A;  3VR4 A;  1B1Z A;  4NDX A;  2XNA C;  2F0O A;  4JBW A;  4K8I A;  4M8A A;  1ROD A;  1MSH A;  1EY6 A;  2DN8 A;  5KYL A;  2O4X A;  3V96 A;  3CHB D;  3RLF A;  3W3A A;  5C4H A;  2JXM B;  4RKL A;  1HFG A;  4FF1 A;  2EJG C;  2H4O A;  1SNO A;  1BOS A;  1DZ1 A;  4KY7 A;  2EY2 A;  2PMZ B;  4DAY A;  1UUP A;  1BCP C;  3T4A C;  4FNF A;  1STN A;  1H9R A;  5KNC A;  1IYV A;  4TKO B;  3NWT A;  2LFN A;  1A2T A;  1DCZ A;  1KAB A;  3K7A B;  1C8C A;  3A8K E;  2D62 A;  4EGV A;  4A3B B;  2K1B A;  1XX8 A;  1AP0 A;  1G6Z A;  3TDQ A;  4CKB A;  4IUQ A;  1K83 B;  3VYS A;  4HMI A;  4DN4 M;  1RF2 D;  2NVT B;  3TME A;  1STA A;  3T13 A;  3I8Z A;  5T1G A;  2F0D A;  1ET9 A;  3S1R B;  3SR1 A;  3TZD A;  5FLX E;  4S3S A;  5IOC A;  1EL0 A;  2JYO A;  1I3Q B;  2PCF B;  3S1Q B;  4NMZ A;  1SMY D;  1EZ8 A;  1RDP D;  1TQO A;  3GTQ B;  5C0X H;  3FMC A;  3FPU B;  1FNV A;  4RHS A;  1EIH A;  3OWE B;  1BBX C;  1Y8P B;  1YNJ C;  5A2Q L;  4ILW A;  2IL8 A;  4X3T A;  3Q22 A;  3RD4 A;  5G3L F;  1KDB A;  1PZJ D;  3BDL A;  1HA5 A;  1VCI A;  1CHQ D;  1AN8 A;  5K36 H;  2XRS D;  2FJ2 A;  3C46 A;  2F0H A;  3T56 B;  2HDL A;  4KJO A;  2EY6 A;  4LJZ C;  5JVH 3;  3QWN A;  3PIP 3;  3Q24 A;  4N9T A;  4L6T B;  4KMU C;  4HED A;  2E75 C;  3J81 L;  3GTK B;  1EYD A;  2RVL A;  5C6A A;  4FYD A;  1B9M A;  2G9H D;  5M3F B;  3CQZ B;  1U9R A;  1WTO A;  1AZP A;  5IGC A;  4HTH A;  2YYZ A;  3J7A F;  1RHP A;  3T51 B;  3C2P A;  4K6L A;  4WFN 3;  2OF1 A;  1EIG A;  5C0X J;  1TT2 A;  3MWY W;  4CBV A;  1EYC A;  2EJF C;  2ZXP A;  4K14 A;  5EBD A;  3S16 B;  3I3C A;  2I07 B;  3VR3 A;  5A2Q E;  2GA4 B;  3ERQ A;  1IHZ A;  1QWY A;  3KBG A;  1PFM A;  3QO2 A;  1PTO C;  2EYH A;  2RA4 A;  2A69 D;  2BA1 A;  3MXN A;  2G9D A;  3IFT A;  5KGU A;  1A3V A;  3S14 B;  3T16 A;  5ELB A;  2J0T D;  1WVL A;  1UEA B;  3C3L A;  1A6X A;  2AQ2 B;  2KEC A;  2K01 A;  1EU4 A;  4FXD A;  1PRT D;  4Z9C B;  3A8I E;  5BN5 A;  2BDN A;  5D14 A;  3J81 E;  4PNY A;  3NHH A;  5C3W A;  2A68 D;  2BOS A;  3J80 L;  1B2T A;  1D1I A;  1SSO A;  4OO1 G;  1EY7 A;  5FO9 B;  5M3M B;  5IGD A;  1HTP A;  4XIG S;  5JVG 3;  3KLS A;  3J7Y W;  1WTP A;  1O7Y A;  4ID6 A;  3DMU A;  5E3F A;  5G3L D;  3M7G A;  1LT3 D;  1F2L A;  1A2U A;  3MA2 B;  4KJN A;  5LL6 X;  1T5X D;  3A7A B;  5T1I A;  5BN3 A;  2F0G A;  4IZ8 A;  1EZ6 A;  3I4N B;  5CV9 A;  2J7Z A;  1V43 A;  3IFD A;  1I4G A;  4IN3 A;  1SDF A;  3K5M A;  1JOR A;  1EWC A;  3X3M A;  4R8I A;  2XN9 C;  4G7Z C;  3PIO 3;  1TU2 B;  1VDZ A;  3HEJ A;  5KNB A;  1F9Q A;  4OIJ A;  5I6Y A;  3FEW X;  5CBE E;  5I6W A;  1I4X A;  3A7L A;  1W6K A;  1I50 B;  3J80 E;  3H0G B;  3E0J A;  2X6G A;  4XXE A;  1KTK A;  4QF4 A;  3D6W A;  1A15 A;  1IYU A;  1G8Z D;  1S5F D;  1TS3 A;  2EPB A;  5AFW A;  1BR9 A;  2F0Q A;  1PYW D;  5CR3 A;  2IWH A;  5EKK A;  2Q8I B;  2IX3 A;  1O7Z A;  3SDZ A;  5EKL A;  1HA6 A;  3GV6 A;  1BCP B;  1B53 A;  3U9O A;  4QCL A;  3SK6 A;  1DD2 A;  3O13 A;  2DY8 A;  4ZQ3 A;  2F0F A;  4A3G B;  1QIL A;  4RCN A;  3TP5 A;  3G6J B;  5I9O A;  2SDF A;  3KLR A;  1LTG D;  3PUY A;  4PMC A;  2R93 B;  2L5T A;  2K05 A;  3A54 A;  1I4Q A;  1D5X C;  2OXP A;  1O7L A;  3PUV A;  2WAC A;  3K5L A;  2VXW A;  2VB3 X;  2QDB A;  2WKC A;  3ONA B;  2EYM A;  1X3Q A;  3HOW B;  1V1P A;  5D3D A;  1Y69 U;  1TS4 A;  1JWU D;  3KBX A;  4JK1 C;  1DYQ A;  2EYF A;  4RCO A;  3NWS A;  2RSO A;  3BG3 A;  2BA0 A;  4G4K A;  1CHP D;  3PUW A;  4R9W A;  4F7X A;  3S9W A;  1HUN A;  5I9P A;  3SEB A;  1J9O A;  1EEF D;  1L0Y B;  2NTT A;  1QE6 A;  3HOU B;  4CJ0 B;  1EU3 A;  1RTN A;  2HQE A;  2NN6 H;  2R6G A;  2F0K A;  3OHX C;  5C0X I;  2VB2 X;  1B44 D;  3MFG A;  1STH A;  4NKL A;  2X6L A;  2F0P A;  2XVS A;  1ENF A;  2C9O A;  1H9S A;  2EY5 A;  3HKZ B;  1SMY C;  2QCP X;  1J8I A;  1EEI D;  1IKL A;  4EQP A;  4RWS C;  1E2Z A;  1HRJ A;  3TSS A;  1STG A;  4FF2 A;  5EQ0 A;  2FMM A;  3K0Y A;  4V0B A;  1CT1 D;  2PW5 A;  2JA5 B;  1FGB D;  5C44 B;  2F0S A;  5CV8 A;  3RUZ A;  5IGG A;  5C4X B;  1M4V A;  4OL7 A;  1CI3 M;  3I4L A;  1II3 A;  1FD7 D;  3M4Y A;  3CKI B;  2Q8T A;  1DJR D;  1TWC B;  3S1M B;  1KNE A;  3JAM L;  2F0N A;  2E76 C;  3D3R A;  5FO8 B;  1WTX A;  3K58 A;  4A3E B;  1Z7T A;  2KCN A;  5CYU A;  4WOR A;  1PTO B;  2F0I A;  1K8M A;  1TWH B;  3AU7 A;  5M5X B;  1JWM D;  2JEB I;  2LS0 1;  4BA2 I;  1TWG B;  1NR4 A;  1U4P A;  1DOM A;  1GUT A;  1G29 1;  2C5C A;  5E1F A;  4U68 A;  1LTR D;  1LT4 D;  2QKI C;  4RH6 A;  3I4M B;  1HPC A;  1OXX K;  1BQQ T;  4IUN A;  3R2I A;  5COR A;  2EYO A;  2Y0S B;  4C56 C;  5FLX L;  3I70 A;  3BS1 A;  2XWB B;  2XRQ D;  1RTO A;  1LT5 D;  2A69 C;  2R61 A;  4B08 A;  1U4R A;  5DNF A;  1Q1E A;  2K28 A;  3HOZ B;  2PQE A;  1CFM A;  2TSS A;  2KA7 A;  3PV0 A;  4A3K B;  1Q12 A;  4RGO S;  1PRT C;  3MXP A;  1XWE A;  4KHV A;  1CTM A;  1Q3L A;  4KD4 A;  3JAM E;  2A68 C;  4O1N A;  2A6E D;  1STE A;  4DGZ A;  1EYA A;  4DAV A;  4IFD H;  1FNU A;  2TMP A;  1TS5 A;  3QJY A;  1GUG A;  5C3E B;  3TBI B;  3TP7 A;  2EY1 A;  2F0W A;  4TSS A;  1YNN D;  4C3H B;  2F03 A;  1IKM A;  1GUN A;  5DEH A;  1OO9 B;  1R9T B;  4RKB A;  4C3I G;  1KLU D;  2DY7 A;  2V4D A;  1WD1 A;  1QNU A;  3SK8 A;  4ZKB B;  1ZYR D;  2QEJ C;  4ZYS A;  5DM6 3;  1WTW A;  3SXH A;  1HQR D;  3FDT A;  4HCS A;  1NCV A;  4KN4 C;  2KVM A;  3K57 A;  2L12 A;  1FNW A;  1VF7 A;  5JJZ A;  1AW7 A;  4BBS B;  3HZX A;  1SAP A;  5C4J B;  4RFB A;  1FR3 A;  1BCP F;  1ZKO A;  5J39 A;  1B3A A;  1EY0 A;  3UI2 A;  2JEA I;  2MP1 A;  3K5N A;  5HUR A;  1KDC A;  3R93 A;  4IFD J;  3LNN A;  4C3J G;  1DXM A;  4EQN A;  2NYZ D;  1D6E C;  2EVB A;  1B50 A;  2B2U A;  5LL6 S;  3MTS A;  1D1K A;  2ENB A;  5KND A;  1JCK B;  2ICE C;  4CKC A;  2NWG A;  1I4P A;  1TVX A;  3OIQ A;  3R3O A;  1Q90 A;  3EFX D;  1DOL A;  1F9S A;  1CK1 A;  1C4Q A;  3BZD B;  4H7B A;  4ABN A;  1TR5 A;  5IGE A;  3BDO A;  2RQX A;  3AB9 A;  1Q1B A;  1MI2 A;  2RDG A;  3WDN A;  1JE4 A;  1QJO A;  4DK1 A;  3BYT B;  3NE5 B;  2LKV A;  1XYI A;  4XQN A;  5JEA G;  2CVR A;  4FVM A;  5LHY 1;  4Q0F A;  4K2K A;  2Z4H A;  5JOB A;  5M5W B;  4C3H G;  4DXF A;  5JPM C;  3C1E A;  2HCC A;  2WP8 J;  3CU7 A;  2NN6 I;  2B2Y C;  1GXD C;  1ENC A;  1IW7 D;  5J22 A;  2SOB A;  4ZK9 B;  2E2J B;  1VMC A;  1EY4 A;  3A8J E;  3SHL A;  3R8B A;  1A3T A;  5CV5 A;  5NUC A;  3IAY A;  1KLG D;  1TWF B;  5EKI A;  1X32 A;  5IOD A;  4F8M A;  2EJM A;  3J7A V;  3P1H A;  4RGN A;  2E74 C;  3IL8 A;  3D4W A;  5D3I B;  4PV1 C;  4F88 A;  3MHB A;  2EZV A;  3DUZ A;  4KKU A;  5CMD A;  5C5M A;  5E4X A;  3Q0A A;  3X3N A;  3NBH A;  5IIF A;  1TKW B;  2A74 C;  4B9X A;  4FF3 A;  3GD7 A;  1GHJ A;  3NPP A;  1JR0 D;  1PTO F;  1I6V C;  4HMJ A;  4A3D B;  3SK5 A;  4A3J B;  3M3Y B;  3D31 A;  1PZK D;  2OT2 A;  3ITP A;  3NXW A;  4DU9 A;  4HCE A;  1SE2 A;  3DM1 A;  4CKE A;  3SK4 A;  2F0L A;  1AZQ A;  2QIL A;  3LWE A;  1D2B A;  4WRD A;  2PZU A;  2MGS A;  4RAU C;  3NTK A;  3GTM B;  1ZEQ X;  3VR6 A;  3I91 A;  4FXG C;  4XT1 B;  5KYI A;  5CV4 A;  5BN4 A;  3TN2 A;  4BBR B;  2L55 A;  2EYL A;  3H09 A;  4IQZ A;  1KAA A;  5FK9 C;  1G91 A;  2B2U C;  1EOT A;  2RKS A;  1GOZ A;  2VUM B;  3FPP A;  3EJI A;  2PZW A;  3S15 B;  4CHT B;  4FP5 D;  1H9K A;  1NR2 A;  4DAP A;  1SXT A;  3EQL C;  1EY5 A;  4FO2 A;  2RDH A;  4RGT A;  3NBI A;  1PRT B;  3NQI A;  2F0M A;  1T5E A;  4CJ1 B;  4BS9 A;  2WII B;  2VNU D;  4K2L A;  2F3V A;  1PXU A;  2B8G A;  5M9O A;  1V1P B;  1HFN A;  4KY5 A;  1G2T A;  1GUO A;  3Q6S A;  1TY2 A;  1NAP A;  2EYJ A;  4A3I B;  4XQQ A;  4KKT A;  2JE6 I;  1CM9 A;  2KUM A;  3E6Z X;  3ZYY X;  2O5J C;  2AQ3 B;  2D9U A;  4IFD I;  4CJ2 C;  5KEE A;  1XXG A;  2FMC A;  3E5S A;  1SNC A;  3BDC A;  1CZG A;  2K7V A;  2L0C A;  4ME5 A;  2AWN A;  3QB3 A;  1SJE D;  4WJW A;  3PUX A;  1O80 A;  1SE4 A;  1PTO H;  2SEB D;  2A6E C;  4DXG A;  1EQT A;  4NP5 A;  1ESF A;  1PMR A;  4XYO A;  4BY1 B;  1H9S B;  5C5L A;  1M8A A;  3R2T A;  4QB4 A;  4I65 A;  2MHV A;  1QOH A;  1SND A;  4L63 B;  3PO3 B;  2D2C C;  4UAI A;  5K36 G;  1LT6 D;  2ID0 A;  2Z1C A;  1YNN C;  2B39 A;  1PZI D;  4X3S A;  4IUR A;  3GP7 A;  2ZXR A;  2L4N A;  3D6C A;  2PZT A;  1X3P A;  2H1E A;  3QIA A;  3T53 B;  2A6H D;  4BA1 I;  3QG1 A;  4XTC S;  2EOT A;  3SE0 A;  1ZYR C;  4GZY C;  4TRD A;  1WTV A;  1TWA B;  5CGK A;  2NVQ B;  1Y8O B;  4ZUI A;  1SYE A;  1Z47 A;  1V1O A;  4CGY B;  1STY A;  5DM7 3;  1E2W A;  4Q5V A;  4XQJ A;  4J8Q A;  3MAQ A;  3WOE A;  3GQB A;  2N55 A;  2K6A A;  1QCB D;  3K6O A;  1DOK A;  1S4Z A;  1LTT D;  4A3F B;  2J4X A;  3V05 A;  3RZO B;  1I4H A;  4C3I B;  2F4I A;  3BVZ A;  1LTB D;  1GUW A;  1BNZ A;  1TII D;  3I73 A;  3D4D A;  2KEE A;  2CW0 D;  3KF8 A;  4DA2 A;  5CV7 A;  3FVQ A;  3DWP A;  3S2D B;  2B2T C;  1F2M A;  1R4Q B;  4ZUJ A;  1WD0 A;  2Z4I A;  2AWO A;  3ERO A;  4G7O C;  4DFA A;  5ELC A;  1V8Q A;  2KED A;  1JQY D;  2DNE A;  1F2Y A;  3P20 A;  2WKD A;  3S1N B;  3GV3 A;  3VYT A;  3VR2 A;  4C3J B;  2F0J A;  3M4O B;  4OO1 H;  4HSP A;  1LV9 A;  4KY6 A;  4K5V A;  1WTR A;  3L9A X;  1ML0 D;  1DON A;  5CC4 A;  4ZKC B;  4RGM A;  3MXU A;  4TQU S;  2ZT9 C;  2I46 A;  3ND8 A;  1IL8 A;  4K5X A;  3ND9 A;  3M7N A;  4XYQ A;  5ELE A;  3HOY B;  1F2Z A;  2XSC A;  2N88 A;  3CRL C;  3FKI B;  4QUC A;  1MD2 D;  2FHT A;  3HP3 A;  1JB3 A;  5I4D A;  1OXU A;  4LK1 C;  1AFP A;  2F0E A;  4IAL A;  1IW7 C;  1EWH A;  2CQA A;  3IKJ A;  2B2Y A;  5J1Z A;  5FOB B;  4QMG A;  4KK7 A;  4N9P A;  1SE3 A;  2L9H A;  2K03 A;  1CA5 A;  3OSO A;  3PMF A;  4XDX A;  5D65 A;  1SJH D;  2PO4 A;  5COY A;  3VYR A;  3G7L A;  4K5W A;  2B2V A;  4OHJ A;  2R3Z A;  3EA6 A;  4DF7 A;  3HGB A;  1Q8I A;  1D5M C;  5EJW A;  3LX0 A;  1SYG A;  3VR5 A;  2Z8L A;  1S5D D;  1JC7 A;  4R8N A;  3AMU A;  4MHE A;  2JA7 B;  2XWJ B;  1CZW A;  1B4O A;  4XT3 B;  4G7H C;  3NQT A;  3W2D A;  3NSW A;  5FKA C;  3OIP A;  4QUF A;  1EQV A;  1PRT F;  3H6M A;  5IT9 L;  1LO5 D;  3N52 A;  2M2L A;  2M00 A;  2RSN A;  1Y1V B;  1SYF A;  4E6I A;  1MSG A;  1SNP A;  1NUC A;  4K6D A;  5A35 A;  4RHR A;  4X3U A;  1QB5 D;  3A55 A;  5CBA E;  4H0L C;  2NVX B;  4H44 C;  2ZXO A;  4MIU A;  1SYD A;  5E4W C;  5EGT A;  1R4P B;  4RA8 A;  3P75 A;  1ICW A;  3WOF A;  5I2Y A;  3MC0 B;  3FRP B;  2PW7 A;  3VA5 A;  1JOO A;  5C4Z A;  1I4R A;  2KCC A;  1PFB A;  1NSN S;  1RD9 D;  1JOK A;  4A3M B;  2BDO A;  2BCO A;  1XTC D;  3DEO A;  4G57 A;  4Y7N B;  1QNK A;  1BUV T;  4DNT B;  3QOL A;  2NN6 G;  2DNC A;  1STB A;  4IUV A;  2M9V A;  4X3K A;  4C1N K;  1ZXT A;  4ZLT F;  1QG7 A;  1JIC A;  4P2C B;  1ESR A;  5IT9 E;  3NP8 A;  1SBB B;  1EY8 A;  2O5I C;  1ONL A;  3K5O A;  5FO7 B;  2AUJ D;  2F1M A;  2BE5 D;  5ELF A;  1VMP A;  4KN7 C;  2E2I B;  3DEP A;  1OXT A;  2A5H A;  4M1U B;  3A56 A;  2NVY B;  2IT1 A;  5JPN C;  1RJT A;  4O42 A;  4OIK A;  1TS2 A;  4KTA A;  2FIN B;  3VYU A;  1OXS C;  3Q23 A;  4A93 B;  2B2W A;  5EPL A;  1PLF A;  4KI0 A;  4QIW B;  3RZD B;  4B9W A;  2WIN B;  2R92 B;  2MJ8 A;  2OEO A;  1MGS A;  2A6H C;  1A3U A;  3GTG B;  1CA6 A;  2B2V C;  2K04 A;  4LMQ D;  2CHB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...