4YHHQ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhQ00
3LGJA 3CC4A 2JA6H 2JA7G 3K81C 5C4XH 4C3IH 4RG1A 3M9BA 2F4VQ 1L2FA 1X3EA 2DUDA 4GOPC 3M4OH 2UXCQ 2HQLA 1GM5A 4LFAL 3F1ZA 3BJUA 2IHFA 3NEMA 1VQ5A 1XPOA 3I2ZA 1N34L 4GLVB 4FDBA 4BBRG 2QA4A 2N8NA 4HIMA 4AQYL 3CCQA 1KAWA 2ZM6L 4HJ7A 4LFCQ 2JK8A 3CQZH 4O2DA 3L7ZC 1D7QA 3RZDH 3B6YA 4UP8A 3F2BA 3CP0A 3S24A 4R4TA 3K8AA 4HJ8A 1WJJA 1DGSA 1N36Q 3PF4A 4ME3A 4B3TL 4LUOA 2HIXA 2NN6G 3RN5A 4NXMQ 2ATWA 2UXBQ 2ES2A 2AWOA 4B3SL 1FJGL 2B63G 2PMZE 4R4IA 4L5RC 3GTGH 1VQHA 1S3OA 4JI4L 2Q2HA 1WYDA 2NVYH 4IO9A 2AKWB 1YBYA 4JI1L 3HOVG 1HR0W 4GNXB 2WB1G 3L2PA 1I94Q 4JI4Q 2PNHA 4MZ9A 5E7NA 4LF9Q 4DR4Q 1Z9FA 3W1GA 2D0PA 4XTCS 5JJKA 1CSPA 2ZJQA 3ULJA 3HOYG 2B63H 1GO3E 1K8GA 4RMFA 3PO3H 1Q81C 1TWCH 5IP7H 4JBWA 4DV0L 4DV7L 1PH2A 4MNOA 1ASZA 4AH6A 2UXDQ 1IBML 3H15A 2JA5H 4JC0A 2ZM6Q 2UUBQ 3G4SA 4YCVA 3ZJYC 4BA1I 1LM0A 2JA9A 2Y0SE 3F8TA 2VUMG 4A93G 3EBEA 3H3VH 4JI3Q 4JOIA 3TRZA 2OTJA 1S40A 4GKKL 1U5KA 2F4VL 3I7FA 2IHEA 3HKSA 2RHQB 2QEXA 2R7DA 1OXVA 4GOPB 3PO2H 4A3FG 1N32L 3IRBA 3CAMA 4O0AA 5GAGC 4LF7L 2IT1A 3TREA 1XNRL 4LF6Q 3TS0A 3M4QA 1B8AA 2C35B 2UU9Q 4A3EG 4LF8Q 3HOUG 1KXLA 2GVBA 4JI5L 5GAHC 4X66L 1YJNA 2CKZB 2YV5A 3FP9A 1JJCB 3AFPA 2E8GA 4DV5L 1SMXA 3W1BA 4GNXC 1VQKA 1N33Q 1Q1BA 1QVGA 1TWFH 5JJLA 3NBHB 1PH8A 1OTCA 2JA6G 1PH1A 4YCWA 3GTJH 3OTOL 3KF6A 4HJ5A 4IFDG 4LF6L 4X64L 4R4OA 1X3FA 2QGQA 4C3JH 2JE6I 1D8LA 1UE5A 2EXDA 4NXNQ 4KLKA 1PFSA 4A3CH 1X3GA 2IX0A 4L5TA 1MJEA 1Q12A 4DV3Q 4BXXG 3I4NG 2NZHA 1LUZA 1EYGA 1XMQL 2UU9L 4DV6L 1YEZA 1S72A 3U4ZA 3AFQA 1AE3A 4IFDJ 1TWGH 3M4PA 5GADC 4DV0Q 4ALPA 1XNRQ 3HKZG 1XMQQ 1QZHA 2VUMH 4TVAB 1UE7A 4J15A 3U4VA 1P8LA 4GLAC 4QIWE 1XPUA 5IY0A 3J81i 1UEBA 2VQFQ 1EQQA 1B7YB 4JI6Q 3KDFA 4PZ7A 1I94L 1NTGA 3KDFB 4QL5A 4P75A 5IYDG 1VQDA 3U58A 2EIFA 1TXYA 1WCMG 3PO3G 4A3LH 1L1OC 3HOYH 4WJ4A 1B70B 3HOUH 5GROA 2HT1A 4DR7L 4A3DH 1A62A 4B3ML 3KOJA 1Q1EA 1T9HA 4PG3A 4B3SQ 3HOZG 1P16A 3S1QH 3CCJA 1SROA 3CW2C 1PH7A 1C0AA 2R93H 3J80i 4A3KH 2E5LQ 1L1OA 4R4QA 1WFQA 1HNXQ 5AJ3L 4B3MQ 1Y1WH 3J81c 1QVFA 5C3EG 3CXCA 5IP9G 4QQBX 4YWMA 1YI2A 1NJIC 1IXRA 3GO5A 1SN8A 4DR1Q 1VQJA 4R1JA 4DR5Q 4AQYQ 2JEBI 1IYJB 1YJ9A 3HKZE 1W3SA 3PUVA 5IWAL 2GN5A 4OO1I 1YZ6A 5IYCH 4X62Q 2LXJA 2UXCL 4B3TQ 2N78A 4DK3C 4A3GH 1E1TA 1FVIA 1N36L 2LXKA 1K73C 1M90C 1G51A 2H5XA 3I4MG 4P71A 3FHWA 2CQOA 4HJ9A 1Y14B 5FLMH 3HOWH 4LUZA 1MJCA 4EQ5A 5M5WH 1QUQA 3RNUA 1MIUA 1QUQB 1X55A 3BZKA 4DV1Q 3PUZA 2NN6I 3S1RH 1KL9A 1O7IA 1RL2A 3ER0A 4PZ8A 5IYDH 4A3IH 3W5OA 4JBKA 2XGTA 4JYAL 4A3IG 1SFOH 2YYZA 1MKHA 1HJPA 4IOAA 3K0XA 3TEHB 1EOVA 2R7ZH 1XMOQ 4OWXB 4A3BH 4APVA 3ULPA 4GKJQ 5IYBG 5BR8Q 1KQSA 2AWNA 3J7A5 1KD1C 1HNZL 3U50C 3KFUA 3RZOH 1TWHH 1GKHA 2KBNA 4L5QA 4DKAC 3FKIG 4GKJL 1L0WA 1E22A 4NB3A 4OO1G 1N32Q 5GQOA 1PA6A 1K3RA 3CPWA 4QGUA 2RF4A 4POFA 4A3MH 2CWAA 3H0GG 4BY1H 4JV5L 1I6HH 2Q2TA 3L0OA 2K5VA 1JT8A 2ZTCA 2K14A 1E3PA 1PV4A 3T1HQ 5K36G 2JJQA 1KRTA 3TQYA 3I56A 2CFMA 2NVXH 4DNIA 5JEAJ 1Y1WG 1CKMA 3GTMH 1HR0L 4UP9A 3ULLA 5C44G 2VW9A 3CCUA 1LYLA 2KHJA 4A3JH 2UUBL 1BKBA 1YHQA 3PIOA 2JA8H 1IBMQ 1VQAA 5DLQE 3AEVA 4X62L 1N9WA 5H1SE 4KI0A 3T1YQ 4A3EH 2DGYA 4JI8Q 2K50A 2VQEQ 1VS0A 1LTLA 1PH3A 1K83H 4JI7L 3CCEA 1A8VA 4DV4L 2MQHA 1A0IA 2JA8G 5HY6A 3PO2G 1PYBA 4A3JG 1V1QA 1VQIA 4IPCA 5ELOA 4OWTB 4AIMA 3GD7A 5C4JH 3F2CA 1XPRA 4LF9L 1Z47A 1HNWQ 4DUYQ 1E7ZA 2HHHQ 4P74A 4A93H 3A5UA 2OQKA 1A63A 4IJHA 1EIYB 4DR6L 2CWPA 1GVPA 4HIKA 1NMGA 1EWIA 1PYSB 3M85A 3PUWA 3CMAA 3A0JA 1C7YA 1YHAA 4YY3Q 2JA5G 2ASBA 3H3VI 2UUCL 1E1OA 2VZAA 2NVQH 4A3MG 4DPGA 1FL0A 1VQOA 2Y0SG 4JG2A 1Q8KA 5M5XH 4DR6Q 1Q86C 3GDEA 2N49A 1GD7A 4XIGS 5M3MG 1PH5A 1VQEA 4GN3B 4JI6L 4DV2L 5FLXc 4JBMA 3PSIA 4LF4L 2A1AA 4DUZQ 4LFBQ 1HH2P 4K0KL 2OWOA 1CUKA 4DV4Q 2Q2IA 2EQSA 3ICEA 2ZTDA 4UPAA 4JI0Q 2ALYB 2K52A 2IY5B 4LWCA 4DV6Q 5IT9c 1PH9A 1PH4A 1SRUA 4YWLA 1J5EL 2ZJRA 1NBWA 2AMCB 1EQRA 3S1NH 5C0XG 1BVSA 2ZTEA 4JOIC 1UE6A 5M3FH 3UE0A 3PGZA 2VL6A 1IBKL 3S2HH 1WOCA 3GTKH 3CPFA 3UDIA 1HNZQ 4NXNL 3STBD 4X65Q 4HJAA 3STBC 3FKIH 3K7UC 3GTPH 2AHOB 4B3RQ 4A3GG 3G71A 2OTLA 4GNXA 5ELNA 1XMOL 1IBLQ 5LMNW 2R7FA 2CCZA 4POGA 1OXUA 4GS3A 1L1OB 4DR2Q 2A8VA 3KYHC 1VQ9A 3CF5A 4IFDI 2N3SA 3JAMi 2B3GA 4HIDA 4YHHL 4BY7G 3RLNA 2GVAA 5IP9H 2JA7H 5IP7G 3HFZB 3M3YH 3VDYA 2KCMA 4A3KG 3CD6A 4LF7Q 2BH2A 5JJIA 4GLXA 1VQGA 1YVCA 1XJVA 4AYBG 4JI2Q 1VQ7A 3I4MH 1KHIA 5IWAQ 2R92G 3S17H 4A3DG 1WCMH 4A3LG 1VQFA 2K4KA 1CSQA 5IYCG 3UDGA 1XNQL 1EUJA 3S16H 3JAMc 4LFBL 3E9HA 2E2JH 2UUAQ 4LF4Q 4Y7NH 3CCMA 1WI5A 4DUYL 2I0QA 1I5FA 5LMNL 2Z6KC 4C3HH 2XTIA 5C3EH 4A75A 1YJWA 2UUAL 2IX1A 1C9OA 3A74A 2A19A 4IPHA 3HOXG 2JQOA 1XNQQ 1UWVA 1BBWA 1FGUA 4OXPA 2UUCQ 4JI7Q 4OX9Q 1Q46A 3KLWA 1AE2A 2K75A 4KHPL 4QY7A 4DR5L 4LW1A 3D31A 3JC66 4TQUS 4JCVE 4JI1Q 1JJGA 4BXXH 4JI2L 2BH8A 4LUVA 1QZGA 1PHJA 1I50H 2FXQA 4A3CG 1Y1VG 1K8AC 1EFWA 1V43A 2VQFL 4DAMA 4NXML 1Y1VH 1YITA 5C4XG 5FJ8G 2WAQG 1BBUA 3I4OA 1SR3A 1ASYA 2E2HH 2PQAA 2MO0A 4YHHQ 3CCRA 2VQEL 1HZ9A 2PQAB 4P72A 3ERSX 4DR7Q 1Q7YC 1RIPA 3K7AH 3J80c 2K5NA 1QVCA 4P73A 2RHSB 3HOXH 1E24A 3RR5A 1NE3A 2WFWA 3TS2A 1N34Q 1X54A 2R6GA 2MFIA 2NZOA 3BU2A 3J7ZC 2D62A 2PI2E 3MEFA 1VQ6A 4DAYB 1OXSC 1VQLA 4A3FH 4OONA 4BY1G 1VQMA 3Q8DA 4UP7A 4GN5A 1U0LA 4X6AH 1YIJA 1IBKQ 3PIPA 4JV5Q 3PV0A 1J5EQ 2E2IH 4WJ3M 3OW2A 3S2DH 3CCSA 4DV3L 3D0FA 1N33L 3GTQH 5JEAG 1VQNA 4B3RL 2YU9H 2Z6KA 4DV5Q 4JBJA 1VQBA 4IOCA 2ID0A 4JI5Q 1CKNA 4A3BG 4C2MH 5LMUL 1HNWL 4K0KQ 4A4IA 1X9NA 3AYHB 4EX5A 3KF8B 4IPGA 3DLLA 1KIXA 4BY7H 1M1KC 4PZ6A 1EIFA 3NELA 3G6EA 4A76A 1VQPA 2OCEA 2BA0A 2YTXA 4NPSA 4JI0L 1IL2A 3AQQA 2WP8J 4DR3L 3HOWG 1KRSA 1V9PA 4BBSG 4H02A 5FLMG 4GOPA 2JEAI 4DV1L 4X66Q 2D0OA 3G48A 4MTNA 3CC7A 2V1CC 1KC8C 4DUZL 5M3MH 2VNUD 4LF5Q 2UXDL 3MXNB 5C0XJ 3RLFA 4DV2Q 2HHHL 2K5HA 3CCLA 5AJ3Q 1XTDA 1I3QH 1HNXL 4OWWB 3S1MH 1W2BA 2WB1E 2MNAA 5M3FG 4GKKQ 2BA1A 4BA2I 1SE8A 4JI3L 3UDXA 1UE1A 1VQ8A 3S15H 4R4CA 1K9MC 2LSSA 3E0EA 2I5MX 4KHPQ 3F2DA 4DR4L 3KF6B 1PVOA 1Q82C 4OX9L 3NENA 1SLJA 2R93G 4KHZA 4JI8L 3PCOB 4YY3L 1PH6A 3T1YL 2B29A 2F3IA 4DR1L 3M7NA 1NMFA 4BBRH 2YTYA 3SGIA 1YHBA 1IZ6A 5IE8A 5LMNQ 4BBSH 4DV7Q 5FJ8H 1N8RC 1X6OA 3HOVH 1TWAH 3S14H 3HOZH 2VY3A 2E5LL 1G291 3K80C 4DK6C 4LNQA 1HR0Q 3GTLH 2MO1A 1CKOA 1HZAA 3WWVA 1OXTA 2KHIA 3E9IA 1VCIA 3CMEA 2YTVA 2RCNA 2Z0SA 4LF5L 5EAYA 1HZBA 5C44H 1JE5A 5HGQA 2L15A 1VQCA 4LFCL 1HZCA 2PI2A 4YCUA 4YWKA 1FJGQ 3CC2A 4DR3Q 2UXBL 2VS1A 4LFAQ 1X56A 4GN4B 5GAEC 3I4NH 3A5ZB 3GTOH 2ZJPA 4QJFA 3EIVA 1JB7A 5BR8L 1J6QA 2I5LX 3H0GH 3T1HL 3DM3A 1YNXA 2KCTA 2F52A 3EN2A 3OYYA 3PUYA 4IJLA 4PMWA 4X64Q 3RN2A 4L5SA 4DR2L 4Y52H 1X65A 1AH9A 1H95A 1NY4A 5M5YH 3OTOQ 1OXXK 3I55A 1G6PA 4AYBE 1VQ4A 3PUXA 1JJ2A 5J3BA 5LMUQ 1IBLL 3KJOA 1K0RA 4UY8C 2R92H 4JYAQ 3KJPA 3RLOA 2WAQE 2KENA 4HIOA 3UDFA 2I5HA 5C0XI 3J81j 2NVTH 5IYBH 4IPDA 3CCVA 2HIVA 4X65L 3PF5A 4LF8L 2Q2UA 1CKNB 2R7ZG 1R9TH 3BZCA 3UE1A 1JMCA 2OQ0A
chains in the Genus database with same CATH superfamily
3LGJA 3CC4A 2JA6H 2JA7G 3C1EA 1Z6HA 3K81C 3QOJA 2F0TA 1SJED 2XWBB 3M9BA 2F4VQ 1RJTA 2DUDA 1H9SA 2NWGA 3I2ZA 1N34L 5JJIA 4BBRG 4LFCQ 4HIMA 1KAWA 3VA7A 3CQZH 2ZXOA 3CP0A 5C5LA 4K5XA 5J39A 1DGSA 4ME3A 4B3TL 4LUOA 5CV6A 3E0JA 3RN5A 1SE4A 2Z4IA 1TY2A 3K5LA 2AWOA 2M2LA 1C4QA 4B3SL 1K28A 3BDCA 3FRPB 1F9SA 2F1MA 2Q2HA 4DAVA 3NUCA 1YBYA 1H9KA 2O2LD 2ZT9C 4GNXB 2WB1G 4JI4Q 5E7NA 1FNVA 4RGTA 3I4LA 4HAEA 5JJKA 2ZXPA 3RZOB 3QO2A 4RMFA 2R61A 3OWFA 1NR4A 4DV7L 3I72A 4JBWA 5DM73 2UXDQ 2B2YA 2KCNA 1EQVA 5F2DA 5FOBB 2ZM6Q 2JA9A 1TT2A 1RTNA 2Y0SE 3F8TA 2Q8TA 4A93G 4JI3Q 5KEEA 3R8BA 3D6WA 3PO2H 3IRBA 4O0AA 5GAGC 3TS0A 2B2WC 4MIUA 4ULLA 2C35B 4IQZA 4JI5L 5GAHC 1IKMA 4DV5L 3FP9A 2K1BA 3SK5A 2E8GA 5KNBA 4GNXC 5JPNC 1VQKA 1N33Q 1TWFH 1PH8A 2JA6G 1Q90A 4YCWA 5KIXA 1YNJD 4DK0A 4IFDG 2BE5D 2JYOA 1PTOH 4R4OA 4ZLTF 3KBXA 1UE5A 2EXDA 4WRDA 1PDQA 4NXNQ 2IX0A 1HA5A 1MJEA 1Q12A 4DV3Q 1ET6A 1S72A 4DV0Q 4WFN3 3OW7A 1ZYRC 1QZHA 4C3HG 1XPUA 1MI2A 2XRQD 1ILQA 2EYLA 3L9AX 3J81L 4JVZA 1K8MA 1BQQT 3HRZC 1E2ZA 4JI6Q 3H09A 4QL5A 1KTKA 2NVQB 4NP5A 4A3DH 5GROA 4KN4C 1A62A 1Q8IA 1SAPA 5IGFA 4EQOA 2CQAA 3S1QH 2KQ3A 3ERQA 3PQIA 5CGKA 1KDCA 1ICFB 5C3EG 3GO5A 4DR5Q 4R1JA 5FK9C 4AQYQ 1IYJB 5BN3A 2B2TA 1YJ9A 5IWAL 4H44C 3N6RA 2B39A 2LXJA 1I4HA 5ELFA 4DK3C 4LMQD 1IKLA 1FVIA 2K03A 2KVMA 4P71A 2A68D 2CQOA 1I4PA 4MHEA 5FLMH 5D65A 5M5WH 3GV3A 1MSHA 1X55A 3BZKA 4DV1Q 3S2DB 1II3A 2NN6I 3ER0A 5FO7B 5CR3A 3VR5A 4XQNA 5IYDH 3W5OA 4JBKA 1SNPA 4A3IG 4CDEC 1HJPA 4IOAA 4QUFA 1EOVA 1XMOQ 1JWMD 4OWXB 3ULPA 1HTLD 1STBA 1JCKB 2AWNA 1KD1C 1TWHH 1GKHA 1DCZA 3E6ZX 1B3QA 2C9OA 2A74C 3FKIG 4NB3A 1WVLA 1XYIA 1DOMA 2TMPA 4J6HA 4OL7A 4JV5L 1LABA 1Y8OB 2NBFA 1TVXA 1JT8A 3T1HQ 5K36G 3GTJB 2JJQA 3I56A 2NVXH 1Y1WG 4X3TA 4UP9A 3ULLA 1LYLA 3IL8A 4ODGA 1BKBA 3BVMA 3AEVA 1BCPC 3R2TA 3K5OA 4A3EH 2DGYA 4JI8Q 1VS0A 4JI7L 1A8VA 2JA8G 5HY6A 1PYBA 4DF7A 1V1QA 2K01A 4AIMA 4OWTB 5C4JH 3GD7A 1HNWQ 1U4LA 1Z47A 3NBHA 4P74A 2QDBA 4IJHA 2EE1A 1NMGA 3CMAA 2DJGC 3QR8A 1HFGA 4FF4A 2UUCL 1E1OA 3G6JB 2SDFA 4DPGA 1VQOA 3TZDA 2RDHA 4ME5A 1MSGA 2N49A 1H9SB 4JI6L 4DV2L 4JBMA 3PSIA 3VYRA 3NTKA 1F2YA 2NZ1D 4C2MB 2OT2A 3A54A 5IT9c 1PH4A 1J5EL 3S1NH 2V4DA 5C0XG 5EKLA 5M3FH 3S2HH 3H3VC 2A73B 5I2YA 1WOCA 3GTKH 3GV6A 4K14A 4TKOB 3VYSA 3CPFA 4NXNL 3S1MB 5D3DA 2B2UA 4B3RQ 2B2WA 1LO5D 3G71A 5CYUA 4GNXA 2Y0SB 4TSSA 1SMYC 5KYLA 4FP5D 2XRSD 1OXUA 1VF7A 4GS3A 4OHJA 4DR2Q 1D6EC 5BN4A 3CKIB 3SHLA 3HOWB 3CF5A 1FYCA 3BG3A 1EY5A 2M00A 1YNJC 2E76C 3S15B 4BY7G 3RLNA 3KF8A 1BNZA 2GA4B 1W6KA 2Z9HA 3M3YH 3VDYA 2KCMA 2VB3X 3MFYA 3CRLC 5JEAH 1XJVA 4JI2Q 1A3UA 5IT9E 1JICA 2R92G 2KJXA 3A8JE 4A3LG 1AZPA 2EVBA 1XNQL 3I4MB 1EUJA 2Z6BA 1BR9A 3CRKC 2Z1CA 3MXNA 2IX3A 3PO3B 2WV6D 4B08A 4R9WA 1I5FA 5LMNL 1X32A 2QEJC 1LT3D 2XTIA 3TP5A 4HSPA 2O5IC 4IPHA 2EYJA 1FGUA 1EY9A 4JI7Q 4KHPL 2A69C 2EYOA 4QCLA 4TQUS 4JCVE 4BXXH 1B53A 2BH8A 4LUVA 1Y1VG 1AN8A 1EWHA 2FJ2A 1Y1VH 4HCSA 4IUTA 1BBUA 3I4OA 1SR3A 1TQOA 2F0PA 4YHHQ 4QMGA 3CCRA 2K04A 2PQAB 2VQEL 3ZYYX 2B2TC 3OMGA 1QJOA 1RIPA 2K5NA 3J7YW 4P73A 4ZUJA 2F0QA 2F0LA 2HDLA 1N34Q 2JXMB 1VQ6A 2VB2X 3C1FA 4BY1G 1D5ZC 2QCPX 4GN5A 3GTQB 1YIJA 1DOLA 3PV0A 2E2IH 4CJ0B 4A3DB 1R4QB 3OPOA 3SR1A 5FO9B 3D0FA 3JAML 4L6TB 2E2IB 1CKNA 5JAVA 1I4QA 4A4IA 3AYHB 4EX5A 3I90A 2F0GA 3OWEB 2K28A 2HD3A 1WTWA 2B8FA 3URYA 4PZ6A 4A76A 1VQPA 5I2XA 4CDDC 2YTXA 2LKVA 1ENFA 2UXBQ 3HOWG 1KRSA 4H02A 2RDFA 3NQTA 4X66Q 3CC7A 1PTOD 2EXZA 1KC8C 2QW7A 2J4XA 2K5HA 2IW3A 3CCLA 2AUJD 1XTDA 4GKKQ 2K05A 3J80L 1SE8A 3UDXA 3S1MH 3E0EA 3F2DA 4DR4L 3KF6B 4Y7NB 1PLFA 4OX9L 3QWNA 1PRTB 3T1YL 4DR1L 2AQ2B 1F2LA 1YHBA 1IZ6A 5IE8A 4KK7A 5ELBA 2A6EC 5A35A 1TWCB 3HOZH 2L5TA 5D3IB 2E5LL 1HR0Q 4IUVA 4BBSB 5M3MB 1U9RA 2B2UC 1SMYD 3E9IA 3TDQA 1LTAD 4R8NA 2Z0SA 5IGDA 5EAYA 5KYIA 4HMIA 5C44H 1HCZA 3I3CA 1MBYA 3H0GB 3MA2B 1QB5D 1FJGQ 3CC2A 4GN4B 3GTOH 2K5DA 4QJFA 4C3JB 4ZKBB 1JB7A 1IW7C 2R92B 1EY4A 1J6QA 1FGBD 2MPMA 1YNXA 2KCTA 4PMWA 3EN2A 1AH9A 3NPPA 4Y52H 3M4YA 1NY4A 3I55A 1G6PA 5LMUQ 5J1ZA 3KJOA 1K0RA 5NUCA 4JYAQ 1YNNC 2EY1A 2KENA 1GUWA 3PIO3 5IT9L 2KEDA 2Q2UA 1CKNB 1R9TH 4C1NK 3BZCA 1JMCA 1IBKQ 3S16H 1CA5A 2CH4A 1VDZA 2L55A 4C3IH 1X3EA 1NAPA 2B2VA 2HQLA 4LFAL 3F1ZA 2WAQB 2IHFA 1VQ5A 3HOUB 4GLVB 4FDBA 1STHA 2ZM6L 3RZDH 3B6YA 4UP8A 3F2BA 5EKKA 3S24A 1ICWA 1STAA 5E3FA 3GTGB 3MEHA 2ATWA 1KAAA 2ES2A 3A8IE 1FJGL 4R4IA 4L5RC 2EYMA 3GTGH 1JOOA 4JI4L 4A3IB 1CQFA 4IO9A 5CV7A 5FO8B 2BCOA 5EPKA 1HR0W 3A7LA 4DA2A 3K5NA 3SVMA 4RHSA 1LTSD 1Z9FA 2F0VA 3SK8A 4XTCS 1SYCA 1CSPA 3FKIB 3GTPB 3ULJA 4RGNA 2B63H 1K8GA 4XYOA 4AYBB 1PH2A 2JSOA 4MNOA 4A3MB 1SNDA 2Z4HA 2KA7A 1O7YA 2MGSA 4YCVA 4BA1I 1LM0A 2VUMG 4GKKL 2F4VL 3I7FA 2IHEA 3HKSA 2E2JB 1OXVA 4A3FG 1AP0A 2IT1A 3TREA 1C8CA 4LF6Q 2UU9Q 3MWYW 4LF8Q 2GVBA 4X66L 1B3AA 2CKZB 3AFPA 2X69A 3W1BA 1QVGA 4C3JG 5JJLA 4I7ZC 3NBHB 1PH1A 2JA5B 3OTOL 4F87A 1G2TA 4X64L 2TSSA 1KDAA 1D8LA 4L5TA 3S17B 3FPUB 5BN5A 4BXXG 3I4NG 3N52A 5IIFA 1JWSD 2UU9L 1YEZA 4A3KB 3LNNA 1TWGH 4ALPA 1FR3A 2MP1A 3HKZG 1UE7A 4K8JA 4UDUC 1P8LA 4GLAC 4QIWE 5DM63 5EBCA 3J81i 1UEBA 2VQFQ 1EQQA 1VMCA 1G2SA 3R93A 1I94L 1LV9A 5IYDG 1VQDA 2EIFA 5I9PA 1SNOA 4A3LH 3PO3G 3D3RA 2HT1A 1MGSA 1F2MA 4B3ML 1K8OA 4G4KA 1T9HA 1IHZA 1P16A 3BZDB 3CW2C 1LT5D 3OIPA 2R93H 2KOLA 3MXPA 1R4PB 1WFQA 5AJ3L 3J81c 1QVFA 4S3SA 1CZWA 1YI2A 1NJIC 1IXRA 1SN8A 1VQJA 2JEBI 2DY8A 2GN5A 1DJRD 2WB1B 2NVYB 2UXCL 4ILWA 5CBEE 1E1TA 1K73C 1ESFA 2SNSA 4FVMA 3I4MG 1A2UA 3QB3A 2PO4A 4HJ9A 1GUGA 3HOWH 4LUZA 4EQ5A 1IYVA 1QUQA 1XTCD 1JR0D 1RL2A 4PZ8A 2E2DC 1LT6D 1BOSA 1MKHA 3GTMB 3Q6SA 3TEHB 2R7ZH 4FYDA 2DNEA 5IYBG 3J7A5 1HNZL 3U50C 1D5MC 4V190 2KBNA 4L5QA 4DKAC 4GKJL 1L0WA 1K83B 1HRJA 2JA7B 4QGUA 3H0GG 4BY1H 1NUCA 2Q2TA 2K5VA 2K14A 1E3PA 1BCPB 3I73A 1T5EA 4IFDH 1XXGA 2B2VC 2VW9A 3CCUA 2KHJA 1SXTA 1GOZA 1YHQA 2K33A 2JA8H 1IBMQ 2Z8LA 4A3JB 1BXTA 3IFDA 1K83H 2A5HA 1D1IA 5DNFA 1S5FD 3PO2G 1J8IA 1VQIA 1XPRA 3QJYA 1E7ZA 5JPMC 2L11A 2HHHQ 4A93H 1EY8A 2DNCA 5KRUA 1SYDA 1EWIA 1PYSB 5M5XB 2ASBA 1SBBB 1YHAA 3Q24A 2XVSA 2VZAA 3NWTA 4A3MG 1U4MA 3I91A 1UEAB 1OO9B 2A6ED 1E0BA 2LS01 4PQXA 1RF2D 4WORA 4LFBQ 1DONA 1CUKA 4FXGC 4L63B 2EQSA 2H1EA 3E3XA 2ZTDA 4QB4A 3ICEA 2I07B 4UPAA 5M3FB 3CQZB 5EQ0A 4LWCA 4DV6Q 1SRUA 4YWLA 3HEJA 2ZJRA 1B1ZA 2AMCB 4JK1C 1BUVT 1BVSA 1PMRA 2EJFC 4JOIC 3PGZA 2VL6A 1EYCA 1L0XB 1HNZQ 4X65Q 3A8KE 3STBC 3K7UC 2D9UA 1J9OA 1EY6A 1S5BD 1IBLQ 2R7FA 1GHKA 3HZXA 1L1OB 2L9HA 2A8VA 3KYHC 1VQ9A 3D8GA 4IFDI 3JAMi 4HIDA 3C3LA 2PCFB 5IP9H 5C3EB 2JA7H 5FLXL 5IP7G 1ZEQX 2L4NA 3HFZB 3BYYB 2RSOA 4H7BA 3CD6A 3O13A 2BH2A 1SJHD 1VQGA 2F0DA 3T13A 1VQ7A 1TWAB 2KCCA 1KHIA 3ND9A 3S17H 1S5DD 1PZID 3UDGA 5C6AA 1B9MA 3JAMc 2P5ZX 3E9HA 2UUAQ 4LF4Q 3NK9A 3V05A 2M9VA 5E1FA 5E4XA 2Z6KC 4C3HH 2EDGA 2UUAL 2IX1A 1JOQA 1Q3LA 2K32A 1QG7A 3NXWA 5C44B 1Q46A 2X6GA 1V1PA 3KLWA 1AE2A 2K75A 2H4OA 4DR5L 3JC66 4O1NA 2F0EA 1QZGA 3WOEA 4A3CG 5M5YB 1V43A 2VQFL 4NXML 4C3IB 1YITA 5C4XG 2WAQG 3F2UA 1ASYA 3MC0B 4P72A 2CW0D 1Q7YC 3K7AH 4PMCA 4KMUC 4KTAA 2RHSB 3HOXH 2G5DA 4H0LC 3RD4A 2WFWA 1WTHA 3TS2A 1X54A 3J7ZC 5K36H 5A2QL 5HURA 2D62A 2FMCA 2PI2E 4DAYB 4RWSC 1VQLA 5KGUA 2F0KA 1VQMA 3Q8DA 2SOBA 2DJFC 3HG9A 4KY6A 3PIPA 2B2YC 5IGBA 3CCSA 3K0YA 4DV3L 3GTQH 1JORA 4B3RL 2Z6KA 4JBJA 1VQBA 2ID0A 5KNDA 4C2MH 3MVVA 5C0XH 1X9NA 1HHVA 1DM0B 1H9MA 3KF8B 1AZQA 5C3WA 2RCFA 1STNA 2F0HA 1SE3A 4ZCKA 2KHSA 3NELA 3G6EA 2F0OA 3NP8A 1M4VA 4NPSA 5LL6X 1IL2A 3EA6A 2WP8J 4BBSG 4DGZA 1V9PA 5FLMG 1A2TA 2JEAI 1TS2A 4MTNA 2HDMA 3LWUA 3VR4A 3MXNB 4DV2Q 2HHHL 2R7ZB 2QF7A 4C56C 1HNXL 2BDNA 4OWWB 1WCMB 1W2BA 2WB1E 2MNAA 4BA2I 4ZAIA 4JI3L 3S15H 4R4CA 2LSSA 1GJXA 3BDOA 1VF5C 1V1OA 5EGTA 4KHZA 5CORA 3MZ5A 2B29A 4BBRH 1GHJA 4P2CB 4DV7Q 3ITPA 1N8RC 1NCVA 1HNWL 4K5VA 4DK6C 4LNQA 1EEID 3WWVA 2KHIA 1KNAA 5COYA 3CMEA 2YTVA 1A3TA 2RCNA 3SEBA 4LF5L 1HZBA 1JE5A 5HGQA 2L15A 3AU7A 1VQCA 2E2HB 4KKTA 1O80A 4YWKA 4DR3Q 1SYEA 4LFAQ 1X56A 3I4NH 3A5ZB 2ZJPA 3BDLA 2I5LX 2RBMA 3T1HL 1XMQL 2SEBD 2F52A 4L5SA 3HOZB 4N9PA 4C3IG 5M5YH 1OXXK 4DU9A 1VQ4A 5J3BA 1WD1A 3RLOA 2F3VA 3P20A 3J81j 5C0XI 5IGGA 5ELEA 2PZUA 4K2KA 1SYGA 1QNUA 2A19A 4XT1B 5C4XH 1Y1VB 4RG1A 5M9OA 2UXCQ 2O5JC 3G7LA 3BJUA 4N8X1 3T51B 1JQYD 4A3EB 1XPOA 1CK1A 1BDOA 2N55A 2N8NA 2A6HC 2F3WA 4L8JA 1S4ZA 3FPPA 1Y1WB 5CBAE 4R4TA 3K8AA 3TZUA 4HJ8A 1WJJA 3I8ZA 3PF4A 4RCOA 4KY7A 4RA8A 2HIXA 2B63G 2PMZE 1VQHA 1GUTA 1S3OA 3P75A 1WYDA 2NVYH 4Q0FA 4N8FA 4DXFA 4JI1L 1SFOB 3HOVG 4K6DA 1I94Q 3L2PA 1HTPA 1TS4A 1WTOA 4MZ9A 4LF9Q 4NKLA 4DR4Q 4CKCA 4FF3A 2ZJQA 3HOYG 1F9QA 1I3QB 1GO3E 2NN6H 2RKSA 4E6IA 5IP7H 4C1NI 1ASZA 3MHBA 3E5SA 1S5CD 4JC0A 2UUBQ 3ZJYC 1UAPA 3EBEA 3H3VH 3TRZA 2OTJA 1TIID 1CHPD 1STEA 4GOPB 3W3AA 3DUZA 1HPCA 4LF7L 1ONLA 3M4QA 2ENBA 2LFNA 4HMJA 5I4DA 2JA8B 1EWCA 2K5QA 3HOUG 1KXLA 1YJNA 2QKIC 5CC4A 2YV5A 3T53B 1N32L 1PRTD 1Q1BA 1WD0A 1SE2A 3K58A 4IUPA 4LF6L 5JVG3 5CV4A 5I6WA 2JE6I 1WTVA 1SYBA 1T5XD 4A3CH 1BCPD 1SNMA 4RKBA 2NZHA 2WKCA 5FKAC 1EYGA 3M7GA 2EY5A 1UNSA 3U4ZA 3M4PA 3H94A 1STYA 3VA5A 1XMQQ 2Q8IB 4TVAB 4J15A 1BBXC 1CT1D 1LLRD 4Q5VA 3ND8A 5IODA 5AFWA 1B7YB 1EQTA 1NTGA 4XQQA 1DZ1A 3TP6A 1TS5A 1DOKA 1TXYA 1EIHA 3HOYH 4WJ4A 1B70B 3DHQA 3KOJA 2L12A 1Q1EA 3FDTA 3P1HA 4A93B 1EU3A 4PG3A 1ENCA 2WIIB 3CCJA 1SROA 4A3FB 5ELDA 3J80i 1HUMA 1TU2B 3CXCA 5IP9G 1EU4A 4QQBX 4YWMA 2NTTA 3HOXB 2A69D 4ZKCB 3SK4A 4DAPA 3K57A 1W3SA 4Z9CB 2EJMA 3PUVA 5IYCH 4X62Q 4B3TQ 3P7JA 2JP1A 2N78A 4A3GH 4FO2A 1I4GA 2KEEA 1M90C 1G51A 2H5XA 4XXEA 4DN4M 3KK7A 3ONAB 4A3GB 1I6HB 3RNUA 1MIUA 4CBVA 3DEPA 3Q22A 4LK1C 3PUZA 1O7IA 3HS0C 2ICIA 2XGTA 4I7AA 4UHVA 4JYAL 2RQXA 2YYZA 3K0XA 4CDCC 4A3BH 3TP7A 4APVA 1DD2A 4NMZA 4BY7B 1KQSA 4G57A 3RZOH 1EY7A 4CHTB 4OO1G 1N32Q 5GQOA 4A3MH 1I6HH 4DXGA 3L0OA 2PW5A 1D5XC 1PV4A 1STGA 2CFMA 4DNIA 5JEAJ 5EPJA 4KKUA 1CKMA 1F77A 1HR0L 4A3JH 2NUCA 2Q8RE 4MTKA 2UUBL 1K0SA 5CV9A 3PIOA 1VQAA 2G9HD 3BYTB 4X62L 1N9WA 5H1SE 4KI0A 1B4OA 3T16A 3T1YQ 2K50A 1LTLA 2K7VA 4ZK9B 1K3BC 3EVQA 1Y8NB 4DV4L 1CA6A 1A0IA 4QF4A 2IWHA 5DEHA 4FNFA 1KLUD 4OEMB 4IPCA 4LF9L 1B9NA 1M8AA 1EZ8A 4F7XA 2KUMA 4DUYQ 2JA6B 4KKSA 3A5UA 1A63A 3KLRA 1EIYB 3S1QB 2CWPA 1GVPA 4HIKA 2EPBA 2BE5C 2JA5G 4YY3Q 3H3VI 1TS3A 2EYHA 3DWAA 1FL0A 4JG2A 5M5XH 4DR6Q 3GDEA 5M3MG 2J7ZA 1VQEA 5G3LD 1G8ZD 4GN3B 1CHQD 5FLXc 4LF4L 2A1AA 1HH2P 4RHRA 1ENAA 2Q2IA 4B9WA 5C4JB 3X3MA 2IY5B 2K52A 4G7HC 2PW7A 2ZXRA 4HSVA 1PH9A 1PZKD 2ZTEA 1UE6A 2F03A 5C3XA 1H9RA 3UDIA 4XT3B 3STBD 4HJAA 3FKIH 3K6OA 3GTPH 2AHOB 3S2HB 1LTID 1FD7D 2F0MA 3T4AC 5ELNA 1XMOL 2A68C 3VYUA 2J0TD 3HP3A 1AFPA 4POGA 4O42A 4G7OC 3S9WA 5KNCA 1TWHB 1AEXA 1ET9A 2G9DA 1JOKA 2B3GA 4YHHL 2GVAA 4BWGB 2WINB 4RH6A 4A3KG 2AUKA 4LF7Q 1SNQA 4GLXA 3H91A 4KD3A 2PZWA 4AYBG 3MFGA 2O4XA 1A3VA 5IWAQ 1XWEA 3BVZA 2HUGA 4H13C 2NTSA 1WCMH 5IYCG 1CSQA 3NHHA 5K5PA 3VR6A 4LFBL 4A3BB 1WI5A 4DUYL 1JC7A 3MXUA 1RDPD 1PTOB 5C3EH 1YJWA 1C9OA 2XIWA 2JQOA 1XNQQ 1UWVA 4OXPA 1BBWA 2C5CA 1TKWB 4QY7A 3TSSA 1JJGA 4JI1Q 2EOTA 2QILA 4JI2L 1I50H 4RKLA 4XYQA 3PO2B 1JWUD 1EFWA 4DAMA 4V0BA 5A2QE 3WOFA 5FJ8G 2R93B 2NVTB 2OF1A 2MO0A 3WDNA 5CV5A 3EJIA 1WTXA 3ERSX 4DR7Q 3J80c 3EROA 1BF4A 1NE3A 4KJNA 2R6GA 2NZOA 3BU2A 3MEFA 4OO1H 4CKBA 1JE4A 1OXSC 3K59A 4A3FH 4DAYA 1GUNA 5EBDA 4RAUC 4UP7A 4X6AH 1J5EQ 4WJ3M 1PTOC 1N33L 2X6LA 5JEAG 2YU9H 4DV5Q 2F0JA 4IOCA 5I6YA 2F0FA 4JI5Q 3D4WA 3A7AB 3DLLA 2ICEC 3QOLA 4BY7H 1M1KC 1SSOA 4EVOA 1UUPA 1A15A 3GTKB 2BA0A 4JI0L 3AQQA 3SK6A 4DR3L 5ELCA 2EYPA 4KHVA 2V1CC 2F0WA 4DUZL 2VNUD 4LF5Q 2UXDL 5C0XJ 5I9OA 1I3QH 3IAYA 5M3FG 4G7ZC 1ESRA 1K9MC 1PVOA 1SLJA 1PH6A 4JI8L 3PCOB 4J1MA 3M7NA 2F3IA 1G6ZA 1NMFA 2L0CA 4EQPA 2HCCA 1HUNA 5FJ8H 3HOVH 1X6OA 3LWEA 4ZYSA 3DEOA 1TWAH 3I70A 3S14H 2VY3A 4K6LA 3J81E 2EY2A 3K80C 3Q23A 3GTLH 1ILPA 3J80E 1CKOA 1AW7A 1HZAA 2RVLA 1D1KA 5DAUA 4KV6A 2FHTA 3OSOA 1R9TB 4ZUIA 2F0IA 4LFCL 1HZCA 2PI2A 1PFNA 4YCUA 3SDZA 3EIVA 1HXYD 3H0GH 3DM3A 5J22A 4IJLA 4LJZC 3RN2A 3VR3A 1X65A 3I4NB 1SNCA 1JJ2A 2R92H 3RZDB 1IBLL 3UDFA 2I5HA 2NVTH 5IYBH 4X65L 3CHBD 3Q0AA 3D4DA 4HTHA 2R7ZG 4EGVA 2E75C 3UE1A 2OTLA 2OQ0A 2F0SA 4IUQA 1H9JA 4DK1A 1TY0A 1LTRD 1L2FA 4GOPC 4PV1C 3M4OH 1GUSA 1GM5A 4JPBW 1A6XA 3NEMA 3C46A 3HOYB 4XDXA 2QA4A 4AQYL 2RSNA 3CCQA 4HJ7A 2JK8A 1QWYA 4O2DA 3L7ZC 1D7QA 1LT4D 1N36Q 1V8QA 1EYDA 3VYTA 2CW0C 3A55A 2NN6G 3RUZA 4NXMQ 3H6MA 4IALA 5JOBA 4FF1A 4QUCA 4U68A 2L1BA 1QCBD 3J7AF 4X3UA 2AKWB 2PMZB 3NBIA 2PNHA 3KLSX 5IGCA 1WTRA 1F9RA 3W1GA 2D0PA 4EQNA 4ZRZA 3PO3H 4ZQ3A 1Q81C 2FMMA 1TWCH 4DV0L 1RCVD 4FXKC 2KECA 4AH6A 5EPLA 1IBML 1E2VA 3H15A 2JA5H 4GZYC 2CVRA 3G4SA 3TBIB 4PNYA 4YIJA 3VR2A 4JOIA 1S40A 1U5KA 1PTOF 2NYZD 2RHQB 2QEXA 2R7DA 2CH4W 3CAMA 1XNRL 5HGTA 5EKIA 1B8AA 4A3EG 1JJCB 1SMXA 1I4RA 1OTCA 3UI2A 3GTJH 4CJ1B 3KF6A 4HJ5A 1X3QA 1V1PB 5FLXE 3BS1A 1X3FA 2QGQA 4C3JH 3J7AV 3IFTA 4KLKA 2QDLA 1PFSA 1X3GA 2RA4A 5L37A 1PFMA 3NWSA 1ZKOA 1U4PA 1LUZA 1KLGD 3K7AB 4DV6L 3AFQA 1AE3A 4IFDJ 1XNRQ 1YNND 5GADC 2CHBD 4UAIA 2VUMH 3C2PA 3U4VA 4HN7A 3D6CA 5LL6S 5IY0A 3KDFA 4PZ7A 3KDFB 4P75A 3U58A 1WCMG 3NTIA 3R2IA 1L1OC 3MXGA 3HOUH 4DR7L 5IOCA 3GP7A 1O78A 4B3SQ 3HOZG 1PH7A 1C0AA 4A3KH 1C48A 2E5LQ 1L1OA 4R4QA 1HNXQ 4IZ8A 4B3MQ 1Y1WH 5CMDA 2PQEA 5JJZA 3KLSA 4ABNA 5C4HA 2LMCB 4DR1Q 2OXPA 3U9OA 3HKZE 2IJ0A 4OO1I 3KBGA 1YZ6A 1IW7D 5M5WB 1N36L 2LXKA 1SYFA 3FHWA 1Y14B 1MJCA 2RDGA 2OEOA 2BOSA 1QILA 1QUQB 3QG1A 3V96A 2PPBC 4U673 1L0YB 3S1RH 1KL9A 1O7ZA 5TSSA 4A3IH 4JW0A 3PMFA 4B9XA 1SFOH 3NSWA 1FNUA 4RFBA 1EL0A 4GKJQ 3T56B 1B2TA 5BR8Q 3KFUA 1LTBD 3QIAA 4BY1B 1Z7TA 5LHY1 1E22A 2EZVA 2A6HD 1PA6A 4BBRB 3SE0A 1K3RA 3CPWA 2RF4A 4POFA 1HFNA 2CWAA 2PZTA 1BCPF 4F88A 3DXJC 2ZTCA 3S1RB 3GTLB 2N88A 4CDFC 2IL8A 3AMUA 1KRTA 3TQYA 1NR2A 1TWFB 1BO0A 3GTOB 3GTMH 4DNTB 5C44G 1TWGB 2IPKD 2DN8A 3JAME 2EJGC 2JN4A 5DLQE 5G3LF 1CZGA 4TRDA 3HKZB 1LACA 5IGEA 2AQ1B 1EZ6A 1PYWD 5EJWA 2VQEQ 2HQEA 4RGOS 1PH3A 2XNAC 3CCEA 2MQHA 2FINB 4BS9A 1GXDC 1RODA 3K5MA 4A3JG 1EFID 3F2CA 5ELOA 1XX8A 1JB3A 3TMEA 4FF2A 4HR7B 2OQKA 4DR6L 1KABA 3M85A 3NTHA 5E4WC 1C7YA 3PUWA 3A0JA 2NVQH 3GQBA 1LTTD 1W6JA 2Y0SG 1Q8KA 1Q86C 2PNRC 1GD7A 1F9PA 4XIGS 3HGBA 1PH5A 3BVGA 4DUZQ 4K0KL 4CJ2C 1HQMC 2OWOA 4DV4Q 3U9SA 2EYFA 4JI0Q 2ALYB 4K2LA 2EY6A 5C5MA 3PIP3 2F0NA 2YU9B 1SEBD 1NBWA 1EQRA 1Y69U 1IBKL 3UE0A 3DM1A 2WACA 4RCNA 4KN7C 3S1NB 1QE6A 4HEDA 1EIGA 4A3GG 1RD9D 2E74C 1U4RA 5C4ZA 5LMNW 2CCZA 1CI3M 1SDFA 1E2WA 2R3ZA 1ZYRD 1WTQA 1DXMA 2N3SA 1PRTC 3NQIA 4C3HB 1PXUA 1TR5A 4RGMA 2K6AA 1CM9A 3FMCA 1G91A 1GUOA 1YVCA 3A56A 5JVH3 3I4MH 3DMUA 1D2BA 4CKEA 1I50B 1VMPA 2F4IA 4DNRB 4A3DG 3W2DA 4K5WA 4OELB 1QNKA 1VQFA 2K4KA 3TP8A 2PYKA 4PMBA 2E2JH 1FNWA 4Y7NH 2MJ8A 3CCMA 2NB0A 2I0QA 3OIQA 4M1UB 4A75A 3A74A 3HOXG 3MAQA 1PZJD 4CGYB 1RKNA 2I46A 3LX0A 4OGQC 2UUCQ 4OX9Q 4LW1A 3D31A 1QOHA 3L3OC 1WTPA 1NSNS 5ISRA 1PHJA 2FXQA 3TN2A 1K8AC 3OOCA 1I6VC 4XQJA 1CTMA 2NVXB 1LTGD 3DWPA 1EEFD 2WKDA 2AQ3B 2E2HH 1EY0A 1KNEA 2PQAA 3EQLC 1HZ9A 4MN3A 2XSCA 1IYUA 2DY7A 1QVCA 4M8AA 1E24A 3RR5A 3V2TA 3DWQA 2MFIA 4KD4A 3S16B 3M4OB 4QIWB 4OONA 2BDOA 5T1GA 1U0LA 4LAAA 3X3NA 3R3OA 4JV5Q 4KJOA 3OW2A 3S2DH 3D4RA 1VQNA 3RMHA 1Y8PB 3FEWX 1PRTF 5CV8A 4A3BG 5LMUL 4K0KQ 4IPGA 2B63B 4FXDA 1KIXA 1RTOA 4NDXA 1EIFA 2HCIA 2XWJB 1CQVA 2OCEA 1NNXA 3HOVB 2FFKB 4GOPA 4DV1L 3NE5B 2K5WA 1B50A 2D0OA 3G48A 4F8MA 3MTSA 4OIKA 5M3MH 1I4XA 4X3KA 1KDBA 4WJWA 4N9TA 3RLFA 4IUNA 5AJ3Q 1ML0D 1X3PA 2MHVA 2BA1A 3KUPA 1VQ8A 1UE1A 3CU7A 4I65A 2I5MX 4KHPQ 1F2ZA 4ID6A 1Q82C 3NENA 2R93G 4YY3L 4NW2A 2YTYA 3SGIA 5LMNQ 4K8IA 4BBSH 2MUYA 2VXWA 1DYQA 1EYAA 1CFMA 1IL8A 1G291 2MO1A 4DFAA 1OXTA 3AB9A 4IURA 2D5DA 1VCIA 3M3YB 1RHPA 4R8IA 2D2CC 2SNMA 4KY5A 2F0UA 5C4XB 1O7LA 2UXBL 2VS1A 3EFXD 1S5ED 5GAEC 5BR8L 1MD2D 2B8GA 3OYYA 3PUYA 1H95A 4OIJA 5T1IA 3SXHA 5D14A 4X64Q 1B44D 4DR2L 3S14B 2LY7A 3OTOQ 1HA6A 4AYBE 3PUXA 3OHXC 1PFBA 4J8QA 4UY8C 3OMCA 1MHWC 3KJPA 2WAQE 4HIOA 2XN9C 4HCEA 1HQRD 4IPDA 3CCVA 2HIVA 3PF5A 1ZXTA 3FVQA 4LF8L 3IKJA 2VUMB 4X3SA 1EOTA 4IN3A 4IUUA
chains in the Genus database with same CATH topology
3LGJA 3CC4A 2JA6H 2JA7G 3K81C 5C4XH 4C3IH 4RG1A 3M9BA 2F4VQ 1L2FA 1X3EA 2DUDA 4GOPC 3M4OH 2UXCQ 2HQLA 1GM5A 4LFAL 3F1ZA 3BJUA 2IHFA 3NEMA 1VQ5A 1XPOA 3I2ZA 1N34L 4GLVB 4FDBA 4BBRG 2QA4A 2N8NA 4HIMA 4AQYL 3CCQA 1KAWA 2ZM6L 4HJ7A 4LFCQ 2JK8A 3CQZH 4O2DA 3L7ZC 1D7QA 3RZDH 3B6YA 4UP8A 3F2BA 3CP0A 3S24A 4R4TA 3K8AA 4HJ8A 1WJJA 1DGSA 1N36Q 3PF4A 4ME3A 4B3TL 4LUOA 2HIXA 2NN6G 3RN5A 4NXMQ 2ATWA 2UXBQ 2ES2A 2AWOA 4B3SL 1FJGL 2B63G 2PMZE 4R4IA 4L5RC 3GTGH 1VQHA 1S3OA 4JI4L 2Q2HA 1WYDA 2NVYH 4IO9A 2AKWB 1YBYA 4JI1L 3HOVG 1HR0W 4GNXB 2WB1G 3L2PA 1I94Q 4JI4Q 2PNHA 4MZ9A 5E7NA 4LF9Q 4DR4Q 1Z9FA 3W1GA 2D0PA 4XTCS 5JJKA 1CSPA 2ZJQA 3ULJA 3HOYG 2B63H 1GO3E 1K8GA 4RMFA 3PO3H 1Q81C 1TWCH 5IP7H 4JBWA 4DV0L 4DV7L 1PH2A 4MNOA 1ASZA 4AH6A 2UXDQ 1IBML 3H15A 2JA5H 4JC0A 2ZM6Q 2UUBQ 3G4SA 4YCVA 3ZJYC 4BA1I 1LM0A 2JA9A 2Y0SE 3F8TA 2VUMG 4A93G 3EBEA 3H3VH 4JI3Q 4JOIA 3TRZA 2OTJA 1S40A 4GKKL 1U5KA 2F4VL 3I7FA 2IHEA 3HKSA 2RHQB 2QEXA 2R7DA 1OXVA 4GOPB 3PO2H 4A3FG 1N32L 3IRBA 3CAMA 4O0AA 5GAGC 4LF7L 2IT1A 3TREA 1XNRL 4LF6Q 3TS0A 3M4QA 1B8AA 2C35B 2UU9Q 4A3EG 4LF8Q 3HOUG 1KXLA 2GVBA 4JI5L 5GAHC 4X66L 1YJNA 2CKZB 2YV5A 3FP9A 1JJCB 3AFPA 2E8GA 4DV5L 1SMXA 3W1BA 4GNXC 1VQKA 1N33Q 1Q1BA 1QVGA 1TWFH 5JJLA 3NBHB 1PH8A 1OTCA 2JA6G 1PH1A 4YCWA 3GTJH 3OTOL 3KF6A 4HJ5A 4IFDG 4LF6L 4X64L 4R4OA 1X3FA 2QGQA 4C3JH 2JE6I 1D8LA 1UE5A 2EXDA 4NXNQ 4KLKA 1PFSA 4A3CH 1X3GA 2IX0A 4L5TA 1MJEA 1Q12A 4DV3Q 4BXXG 3I4NG 2NZHA 1LUZA 1EYGA 1XMQL 2UU9L 4DV6L 1YEZA 1S72A 3U4ZA 3AFQA 1AE3A 4IFDJ 1TWGH 3M4PA 5GADC 4DV0Q 4ALPA 1XNRQ 3HKZG 1XMQQ 1QZHA 2VUMH 4TVAB 1UE7A 4J15A 3U4VA 1P8LA 4GLAC 4QIWE 1XPUA 5IY0A 3J81i 1UEBA 2VQFQ 1EQQA 1B7YB 4JI6Q 3KDFA 4PZ7A 1I94L 1NTGA 3KDFB 4QL5A 4P75A 5IYDG 1VQDA 3U58A 2EIFA 1TXYA 1WCMG 3PO3G 4A3LH 1L1OC 3HOYH 4WJ4A 1B70B 3HOUH 5GROA 2HT1A 4DR7L 4A3DH 1A62A 4B3ML 3KOJA 1Q1EA 1T9HA 4PG3A 4B3SQ 3HOZG 1P16A 3S1QH 3CCJA 1SROA 3CW2C 1PH7A 1C0AA 2R93H 3J80i 4A3KH 2E5LQ 1L1OA 4R4QA 1WFQA 1HNXQ 5AJ3L 4B3MQ 1Y1WH 3J81c 1QVFA 5C3EG 3CXCA 5IP9G 4QQBX 4YWMA 1YI2A 1NJIC 1IXRA 3GO5A 1SN8A 4DR1Q 1VQJA 4R1JA 4DR5Q 4AQYQ 2JEBI 1IYJB 1YJ9A 3HKZE 1W3SA 3PUVA 5IWAL 2GN5A 4OO1I 1YZ6A 5IYCH 4X62Q 2LXJA 2UXCL 4B3TQ 2N78A 4DK3C 4A3GH 1E1TA 1FVIA 1N36L 2LXKA 1K73C 1M90C 1G51A 2H5XA 3I4MG 4P71A 3FHWA 2CQOA 4HJ9A 1Y14B 5FLMH 3HOWH 4LUZA 1MJCA 4EQ5A 5M5WH 1QUQA 3RNUA 1MIUA 1QUQB 1X55A 3BZKA 4DV1Q 3PUZA 2NN6I 3S1RH 1KL9A 1O7IA 1RL2A 3ER0A 4PZ8A 5IYDH 4A3IH 3W5OA 4JBKA 2XGTA 4JYAL 4A3IG 1SFOH 2YYZA 1MKHA 1HJPA 4IOAA 3K0XA 3TEHB 1EOVA 2R7ZH 1XMOQ 4OWXB 4A3BH 4APVA 3ULPA 4GKJQ 5IYBG 5BR8Q 1KQSA 2AWNA 3J7A5 1KD1C 1HNZL 3U50C 3KFUA 3RZOH 1TWHH 1GKHA 2KBNA 4L5QA 4DKAC 3FKIG 4GKJL 1L0WA 1E22A 4NB3A 4OO1G 1N32Q 5GQOA 1PA6A 1K3RA 3CPWA 4QGUA 2RF4A 4POFA 4A3MH 2CWAA 3H0GG 4BY1H 4JV5L 1I6HH 2Q2TA 3L0OA 2K5VA 1JT8A 2ZTCA 2K14A 1E3PA 1PV4A 3T1HQ 5K36G 2JJQA 1KRTA 3TQYA 3I56A 2CFMA 2NVXH 4DNIA 5JEAJ 1Y1WG 1CKMA 3GTMH 1HR0L 4UP9A 3ULLA 5C44G 2VW9A 3CCUA 1LYLA 2KHJA 4A3JH 2UUBL 1BKBA 1YHQA 3PIOA 2JA8H 1IBMQ 1VQAA 5DLQE 3AEVA 4X62L 1N9WA 5H1SE 4KI0A 3T1YQ 4A3EH 2DGYA 4JI8Q 2K50A 2VQEQ 1VS0A 1LTLA 1PH3A 1K83H 4JI7L 3CCEA 1A8VA 4DV4L 2MQHA 1A0IA 2JA8G 5HY6A 3PO2G 1PYBA 4A3JG 1V1QA 1VQIA 4IPCA 5ELOA 4OWTB 4AIMA 3GD7A 5C4JH 3F2CA 1XPRA 4LF9L 1Z47A 1HNWQ 4DUYQ 1E7ZA 2HHHQ 4P74A 4A93H 3A5UA 2OQKA 1A63A 4IJHA 1EIYB 4DR6L 2CWPA 1GVPA 4HIKA 1NMGA 1EWIA 1PYSB 3M85A 3PUWA 3CMAA 3A0JA 1C7YA 1YHAA 4YY3Q 2JA5G 2ASBA 3H3VI 2UUCL 1E1OA 2VZAA 2NVQH 4A3MG 4DPGA 1FL0A 1VQOA 2Y0SG 4JG2A 1Q8KA 5M5XH 4DR6Q 1Q86C 3GDEA 2N49A 1GD7A 4XIGS 5M3MG 1PH5A 1VQEA 4GN3B 4JI6L 4DV2L 5FLXc 4JBMA 3PSIA 4LF4L 2A1AA 4DUZQ 4LFBQ 1HH2P 4K0KL 2OWOA 1CUKA 4DV4Q 2Q2IA 2EQSA 3ICEA 2ZTDA 4UPAA 4JI0Q 2ALYB 2K52A 2IY5B 4LWCA 4DV6Q 5IT9c 1PH9A 1PH4A 1SRUA 4YWLA 1J5EL 2ZJRA 1NBWA 2AMCB 1EQRA 3S1NH 5C0XG 1BVSA 2ZTEA 4JOIC 1UE6A 5M3FH 3UE0A 3PGZA 2VL6A 1IBKL 3S2HH 1WOCA 3GTKH 3CPFA 3UDIA 1HNZQ 4NXNL 3STBD 4X65Q 4HJAA 3STBC 3FKIH 3K7UC 3GTPH 2AHOB 4B3RQ 4A3GG 3G71A 2OTLA 4GNXA 5ELNA 1XMOL 1IBLQ 5LMNW 2R7FA 2CCZA 4POGA 1OXUA 4GS3A 1L1OB 4DR2Q 2A8VA 3KYHC 1VQ9A 3CF5A 4IFDI 2N3SA 3JAMi 2B3GA 4HIDA 4YHHL 4BY7G 3RLNA 2GVAA 5IP9H 2JA7H 5IP7G 3HFZB 3M3YH 3VDYA 2KCMA 4A3KG 3CD6A 4LF7Q 2BH2A 5JJIA 4GLXA 1VQGA 1YVCA 1XJVA 4AYBG 4JI2Q 1VQ7A 3I4MH 1KHIA 5IWAQ 2R92G 3S17H 4A3DG 1WCMH 4A3LG 1VQFA 2K4KA 1CSQA 5IYCG 3UDGA 1XNQL 1EUJA 3S16H 3JAMc 4LFBL 3E9HA 2E2JH 2UUAQ 4LF4Q 4Y7NH 3CCMA 1WI5A 4DUYL 2I0QA 1I5FA 5LMNL 2Z6KC 4C3HH 2XTIA 5C3EH 4A75A 1YJWA 2UUAL 2IX1A 1C9OA 3A74A 2A19A 4IPHA 3HOXG 2JQOA 1XNQQ 1UWVA 1BBWA 1FGUA 4OXPA 2UUCQ 4JI7Q 4OX9Q 1Q46A 3KLWA 1AE2A 2K75A 4KHPL 4QY7A 4DR5L 4LW1A 3D31A 3JC66 4TQUS 4JCVE 4JI1Q 1JJGA 4BXXH 4JI2L 2BH8A 4LUVA 1QZGA 1PHJA 1I50H 2FXQA 4A3CG 1Y1VG 1K8AC 1EFWA 1V43A 2VQFL 4DAMA 4NXML 1Y1VH 1YITA 5C4XG 5FJ8G 2WAQG 1BBUA 3I4OA 1SR3A 1ASYA 2E2HH 2PQAA 2MO0A 4YHHQ 3CCRA 2VQEL 1HZ9A 2PQAB 4P72A 3ERSX 4DR7Q 1Q7YC 1RIPA 3K7AH 3J80c 2K5NA 1QVCA 4P73A 2RHSB 3HOXH 1E24A 3RR5A 1NE3A 2WFWA 3TS2A 1N34Q 1X54A 2R6GA 2MFIA 2NZOA 3BU2A 3J7ZC 2D62A 2PI2E 3MEFA 1VQ6A 4DAYB 1OXSC 1VQLA 4A3FH 4OONA 4BY1G 1VQMA 3Q8DA 4UP7A 4GN5A 1U0LA 4X6AH 1YIJA 1IBKQ 3PIPA 4JV5Q 3PV0A 1J5EQ 2E2IH 4WJ3M 3OW2A 3S2DH 3CCSA 4DV3L 3D0FA 1N33L 3GTQH 5JEAG 1VQNA 4B3RL 2YU9H 2Z6KA 4DV5Q 4JBJA 1VQBA 4IOCA 2ID0A 4JI5Q 1CKNA 4A3BG 4C2MH 5LMUL 1HNWL 4K0KQ 4A4IA 1X9NA 3AYHB 4EX5A 3KF8B 4IPGA 3DLLA 1KIXA 4BY7H 1M1KC 4PZ6A 1EIFA 3NELA 3G6EA 4A76A 1VQPA 2OCEA 2BA0A 2YTXA 4NPSA 4JI0L 1IL2A 3AQQA 2WP8J 4DR3L 3HOWG 1KRSA 1V9PA 4BBSG 4H02A 5FLMG 4GOPA 2JEAI 4DV1L 4X66Q 2D0OA 3G48A 4MTNA 3CC7A 2V1CC 1KC8C 4DUZL 5M3MH 2VNUD 4LF5Q 2UXDL 3MXNB 5C0XJ 3RLFA 4DV2Q 2HHHL 2K5HA 3CCLA 5AJ3Q 1XTDA 1I3QH 1HNXL 4OWWB 3S1MH 1W2BA 2WB1E 2MNAA 5M3FG 4GKKQ 2BA1A 4BA2I 1SE8A 4JI3L 3UDXA 1UE1A 1VQ8A 3S15H 4R4CA 1K9MC 2LSSA 3E0EA 2I5MX 4KHPQ 3F2DA 4DR4L 3KF6B 1PVOA 1Q82C 4OX9L 3NENA 1SLJA 2R93G 4KHZA 4JI8L 3PCOB 4YY3L 1PH6A 3T1YL 2B29A 2F3IA 4DR1L 3M7NA 1NMFA 4BBRH 2YTYA 3SGIA 1YHBA 1IZ6A 5IE8A 5LMNQ 4BBSH 4DV7Q 5FJ8H 1N8RC 1X6OA 3HOVH 1TWAH 3S14H 3HOZH 2VY3A 2E5LL 1G291 3K80C 4DK6C 4LNQA 1HR0Q 3GTLH 2MO1A 1CKOA 1HZAA 3WWVA 1OXTA 2KHIA 3E9IA 1VCIA 3CMEA 2YTVA 2RCNA 2Z0SA 4LF5L 5EAYA 1HZBA 5C44H 1JE5A 5HGQA 2L15A 1VQCA 4LFCL 1HZCA 2PI2A 4YCUA 4YWKA 1FJGQ 3CC2A 4DR3Q 2UXBL 2VS1A 4LFAQ 1X56A 4GN4B 5GAEC 3I4NH 3A5ZB 3GTOH 2ZJPA 4QJFA 3EIVA 1JB7A 5BR8L 1J6QA 2I5LX 3H0GH 3T1HL 3DM3A 1YNXA 2KCTA 2F52A 3EN2A 3OYYA 3PUYA 4IJLA 4PMWA 4X64Q 3RN2A 4L5SA 4DR2L 4Y52H 1X65A 1AH9A 1H95A 1NY4A 5M5YH 3OTOQ 1OXXK 3I55A 1G6PA 4AYBE 1VQ4A 3PUXA 1JJ2A 5J3BA 5LMUQ 1IBLL 3KJOA 1K0RA 4UY8C 2R92H 4JYAQ 3KJPA 3RLOA 2WAQE 2KENA 4HIOA 3UDFA 2I5HA 5C0XI 3J81j 2NVTH 5IYBH 4IPDA 3CCVA 2HIVA 4X65L 3PF5A 4LF8L 2Q2UA 1CKNB 2R7ZG 1R9TH 3BZCA 3UE1A 1JMCA 2OQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGJ A;  3CC4 A;  2JA6 H;  2JA7 G;  3K81 C;  5C4X H;  4C3I H;  4RG1 A;  3M9B A;  2F4V Q;  1L2F A;  1X3E A;  2DUD A;  4GOP C;  3M4O H;  2UXC Q;  2HQL A;  1GM5 A;  4LFA L;  3F1Z A;  3BJU A;  2IHF A;  3NEM A;  1VQ5 A;  1XPO A;  3I2Z A;  1N34 L;  4GLV B;  4FDB A;  4BBR G;  2QA4 A;  2N8N A;  4HIM A;  4AQY L;  3CCQ A;  1KAW A;  2ZM6 L;  4HJ7 A;  4LFC Q;  2JK8 A;  3CQZ H;  4O2D A;  3L7Z C;  1D7Q A;  3RZD H;  3B6Y A;  4UP8 A;  3F2B A;  3CP0 A;  3S24 A;  4R4T A;  3K8A A;  4HJ8 A;  1WJJ A;  1DGS A;  1N36 Q;  3PF4 A;  4ME3 A;  4B3T L;  4LUO A;  2HIX A;  2NN6 G;  3RN5 A;  4NXM Q;  2ATW A;  2UXB Q;  2ES2 A;  2AWO A;  4B3S L;  1FJG L;  2B63 G;  2PMZ E;  4R4I A;  4L5R C;  3GTG H;  1VQH A;  1S3O A;  4JI4 L;  2Q2H A;  1WYD A;  2NVY H;  4IO9 A;  2AKW B;  1YBY A;  4JI1 L;  3HOV G;  1HR0 W;  4GNX B;  2WB1 G;  3L2P A;  1I94 Q;  4JI4 Q;  2PNH A;  4MZ9 A;  5E7N A;  4LF9 Q;  4DR4 Q;  1Z9F A;  3W1G A;  2D0P A;  4XTC S;  5JJK A;  1CSP A;  2ZJQ A;  3ULJ A;  3HOY G;  2B63 H;  1GO3 E;  1K8G A;  4RMF A;  3PO3 H;  1Q81 C;  1TWC H;  5IP7 H;  4JBW A;  4DV0 L;  4DV7 L;  1PH2 A;  4MNO A;  1ASZ A;  4AH6 A;  2UXD Q;  1IBM L;  3H15 A;  2JA5 H;  4JC0 A;  2ZM6 Q;  2UUB Q;  3G4S A;  4YCV A;  3ZJY C;  4BA1 I;  1LM0 A;  2JA9 A;  2Y0S E;  3F8T A;  2VUM G;  4A93 G;  3EBE A;  3H3V H;  4JI3 Q;  4JOI A;  3TRZ A;  2OTJ A;  1S40 A;  4GKK L;  1U5K A;  2F4V L;  3I7F A;  2IHE A;  3HKS A;  2RHQ B;  2QEX A;  2R7D A;  1OXV A;  4GOP B;  3PO2 H;  4A3F G;  1N32 L;  3IRB A;  3CAM A;  4O0A A;  5GAG C;  4LF7 L;  2IT1 A;  3TRE A;  1XNR L;  4LF6 Q;  3TS0 A;  3M4Q A;  1B8A A;  2C35 B;  2UU9 Q;  4A3E G;  4LF8 Q;  3HOU G;  1KXL A;  2GVB A;  4JI5 L;  5GAH C;  4X66 L;  1YJN A;  2CKZ B;  2YV5 A;  3FP9 A;  1JJC B;  3AFP A;  2E8G A;  4DV5 L;  1SMX A;  3W1B A;  4GNX C;  1VQK A;  1N33 Q;  1Q1B A;  1QVG A;  1TWF H;  5JJL A;  3NBH B;  1PH8 A;  1OTC A;  2JA6 G;  1PH1 A;  4YCW A;  3GTJ H;  3OTO L;  3KF6 A;  4HJ5 A;  4IFD G;  4LF6 L;  4X64 L;  4R4O A;  1X3F A;  2QGQ A;  4C3J H;  2JE6 I;  1D8L A;  1UE5 A;  2EXD A;  4NXN Q;  4KLK A;  1PFS A;  4A3C H;  1X3G A;  2IX0 A;  4L5T A;  1MJE A;  1Q12 A;  4DV3 Q;  4BXX G;  3I4N G;  2NZH A;  1LUZ A;  1EYG A;  1XMQ L;  2UU9 L;  4DV6 L;  1YEZ A;  1S72 A;  3U4Z A;  3AFQ A;  1AE3 A;  4IFD J;  1TWG H;  3M4P A;  5GAD C;  4DV0 Q;  4ALP A;  1XNR Q;  3HKZ G;  1XMQ Q;  1QZH A;  2VUM H;  4TVA B;  1UE7 A;  4J15 A;  3U4V A;  1P8L A;  4GLA C;  4QIW E;  1XPU A;  5IY0 A;  3J81 i;  1UEB A;  2VQF Q;  1EQQ A;  1B7Y B;  4JI6 Q;  3KDF A;  4PZ7 A;  1I94 L;  1NTG A;  3KDF B;  4QL5 A;  4P75 A;  5IYD G;  1VQD A;  3U58 A;  2EIF A;  1TXY A;  1WCM G;  3PO3 G;  4A3L H;  1L1O C;  3HOY H;  4WJ4 A;  1B70 B;  3HOU H;  5GRO A;  2HT1 A;  4DR7 L;  4A3D H;  1A62 A;  4B3M L;  3KOJ A;  1Q1E A;  1T9H A;  4PG3 A;  4B3S Q;  3HOZ G;  1P16 A;  3S1Q H;  3CCJ A;  1SRO A;  3CW2 C;  1PH7 A;  1C0A A;  2R93 H;  3J80 i;  4A3K H;  2E5L Q;  1L1O A;  4R4Q A;  1WFQ A;  1HNX Q;  5AJ3 L;  4B3M Q;  1Y1W H;  3J81 c;  1QVF A;  5C3E G;  3CXC A;  5IP9 G;  4QQB X;  4YWM A;  1YI2 A;  1NJI C;  1IXR A;  3GO5 A;  1SN8 A;  4DR1 Q;  1VQJ A;  4R1J A;  4DR5 Q;  4AQY Q;  2JEB I;  1IYJ B;  1YJ9 A;  3HKZ E;  1W3S A;  3PUV A;  5IWA L;  2GN5 A;  4OO1 I;  1YZ6 A;  5IYC H;  4X62 Q;  2LXJ A;  2UXC L;  4B3T Q;  2N78 A;  4DK3 C;  4A3G H;  1E1T A;  1FVI A;  1N36 L;  2LXK A;  1K73 C;  1M90 C;  1G51 A;  2H5X A;  3I4M G;  4P71 A;  3FHW A;  2CQO A;  4HJ9 A;  1Y14 B;  5FLM H;  3HOW H;  4LUZ A;  1MJC A;  4EQ5 A;  5M5W H;  1QUQ A;  3RNU A;  1MIU A;  1QUQ B;  1X55 A;  3BZK A;  4DV1 Q;  3PUZ A;  2NN6 I;  3S1R H;  1KL9 A;  1O7I A;  1RL2 A;  3ER0 A;  4PZ8 A;  5IYD H;  4A3I H;  3W5O A;  4JBK A;  2XGT A;  4JYA L;  4A3I G;  1SFO H;  2YYZ A;  1MKH A;  1HJP A;  4IOA A;  3K0X A;  3TEH B;  1EOV A;  2R7Z H;  1XMO Q;  4OWX B;  4A3B H;  4APV A;  3ULP A;  4GKJ Q;  5IYB G;  5BR8 Q;  1KQS A;  2AWN A;  3J7A 5;  1KD1 C;  1HNZ L;  3U50 C;  3KFU A;  3RZO H;  1TWH H;  1GKH A;  2KBN A;  4L5Q A;  4DKA C;  3FKI G;  4GKJ L;  1L0W A;  1E22 A;  4NB3 A;  4OO1 G;  1N32 Q;  5GQO A;  1PA6 A;  1K3R A;  3CPW A;  4QGU A;  2RF4 A;  4POF A;  4A3M H;  2CWA A;  3H0G G;  4BY1 H;  4JV5 L;  1I6H H;  2Q2T A;  3L0O A;  2K5V A;  1JT8 A;  2ZTC A;  2K14 A;  1E3P A;  1PV4 A;  3T1H Q;  5K36 G;  2JJQ A;  1KRT A;  3TQY A;  3I56 A;  2CFM A;  2NVX H;  4DNI A;  5JEA J;  1Y1W G;  1CKM A;  3GTM H;  1HR0 L;  4UP9 A;  3ULL A;  5C44 G;  2VW9 A;  3CCU A;  1LYL A;  2KHJ A;  4A3J H;  2UUB L;  1BKB A;  1YHQ A;  3PIO A;  2JA8 H;  1IBM Q;  1VQA A;  5DLQ E;  3AEV A;  4X62 L;  1N9W A;  5H1S E;  4KI0 A;  3T1Y Q;  4A3E H;  2DGY A;  4JI8 Q;  2K50 A;  2VQE Q;  1VS0 A;  1LTL A;  1PH3 A;  1K83 H;  4JI7 L;  3CCE A;  1A8V A;  4DV4 L;  2MQH A;  1A0I A;  2JA8 G;  5HY6 A;  3PO2 G;  1PYB A;  4A3J G;  1V1Q A;  1VQI A;  4IPC A;  5ELO A;  4OWT B;  4AIM A;  3GD7 A;  5C4J H;  3F2C A;  1XPR A;  4LF9 L;  1Z47 A;  1HNW Q;  4DUY Q;  1E7Z A;  2HHH Q;  4P74 A;  4A93 H;  3A5U A;  2OQK A;  1A63 A;  4IJH A;  1EIY B;  4DR6 L;  2CWP A;  1GVP A;  4HIK A;  1NMG A;  1EWI A;  1PYS B;  3M85 A;  3PUW A;  3CMA A;  3A0J A;  1C7Y A;  1YHA A;  4YY3 Q;  2JA5 G;  2ASB A;  3H3V I;  2UUC L;  1E1O A;  2VZA A;  2NVQ H;  4A3M G;  4DPG A;  1FL0 A;  1VQO A;  2Y0S G;  4JG2 A;  1Q8K A;  5M5X H;  4DR6 Q;  1Q86 C;  3GDE A;  2N49 A;  1GD7 A;  4XIG S;  5M3M G;  1PH5 A;  1VQE A;  4GN3 B;  4JI6 L;  4DV2 L;  5FLX c;  4JBM A;  3PSI A;  4LF4 L;  2A1A A;  4DUZ Q;  4LFB Q;  1HH2 P;  4K0K L;  2OWO A;  1CUK A;  4DV4 Q;  2Q2I A;  2EQS A;  3ICE A;  2ZTD A;  4UPA A;  4JI0 Q;  2ALY B;  2K52 A;  2IY5 B;  4LWC A;  4DV6 Q;  5IT9 c;  1PH9 A;  1PH4 A;  1SRU A;  4YWL A;  1J5E L;  2ZJR A;  1NBW A;  2AMC B;  1EQR A;  3S1N H;  5C0X G;  1BVS A;  2ZTE A;  4JOI C;  1UE6 A;  5M3F H;  3UE0 A;  3PGZ A;  2VL6 A;  1IBK L;  3S2H H;  1WOC A;  3GTK H;  3CPF A;  3UDI A;  1HNZ Q;  4NXN L;  3STB D;  4X65 Q;  4HJA A;  3STB C;  3FKI H;  3K7U C;  3GTP H;  2AHO B;  4B3R Q;  4A3G G;  3G71 A;  2OTL A;  4GNX A;  5ELN A;  1XMO L;  1IBL Q;  5LMN W;  2R7F A;  2CCZ A;  4POG A;  1OXU A;  4GS3 A;  1L1O B;  4DR2 Q;  2A8V A;  3KYH C;  1VQ9 A;  3CF5 A;  4IFD I;  2N3S A;  3JAM i;  2B3G A;  4HID A;  4YHH L;  4BY7 G;  3RLN A;  2GVA A;  5IP9 H;  2JA7 H;  5IP7 G;  3HFZ B;  3M3Y H;  3VDY A;  2KCM A;  4A3K G;  3CD6 A;  4LF7 Q;  2BH2 A;  5JJI A;  4GLX A;  1VQG A;  1YVC A;  1XJV A;  4AYB G;  4JI2 Q;  1VQ7 A;  3I4M H;  1KHI A;  5IWA Q;  2R92 G;  3S17 H;  4A3D G;  1WCM H;  4A3L G;  1VQF A;  2K4K A;  1CSQ A;  5IYC G;  3UDG A;  1XNQ L;  1EUJ A;  3S16 H;  3JAM c;  4LFB L;  3E9H A;  2E2J H;  2UUA Q;  4LF4 Q;  4Y7N H;  3CCM A;  1WI5 A;  4DUY L;  2I0Q A;  1I5F A;  5LMN L;  2Z6K C;  4C3H H;  2XTI A;  5C3E H;  4A75 A;  1YJW A;  2UUA L;  2IX1 A;  1C9O A;  3A74 A;  2A19 A;  4IPH A;  3HOX G;  2JQO A;  1XNQ Q;  1UWV A;  1BBW A;  1FGU A;  4OXP A;  2UUC Q;  4JI7 Q;  4OX9 Q;  1Q46 A;  3KLW A;  1AE2 A;  2K75 A;  4KHP L;  4QY7 A;  4DR5 L;  4LW1 A;  3D31 A;  3JC6 6;  4TQU S;  4JCV E;  4JI1 Q;  1JJG A;  4BXX H;  4JI2 L;  2BH8 A;  4LUV A;  1QZG A;  1PHJ A;  1I50 H;  2FXQ A;  4A3C G;  1Y1V G;  1K8A C;  1EFW A;  1V43 A;  2VQF L;  4DAM A;  4NXM L;  1Y1V H;  1YIT A;  5C4X G;  5FJ8 G;  2WAQ G;  1BBU A;  3I4O A;  1SR3 A;  1ASY A;  2E2H H;  2PQA A;  2MO0 A;  4YHH Q;  3CCR A;  2VQE L;  1HZ9 A;  2PQA B;  4P72 A;  3ERS X;  4DR7 Q;  1Q7Y C;  1RIP A;  3K7A H;  3J80 c;  2K5N A;  1QVC A;  4P73 A;  2RHS B;  3HOX H;  1E24 A;  3RR5 A;  1NE3 A;  2WFW A;  3TS2 A;  1N34 Q;  1X54 A;  2R6G A;  2MFI A;  2NZO A;  3BU2 A;  3J7Z C;  2D62 A;  2PI2 E;  3MEF A;  1VQ6 A;  4DAY B;  1OXS C;  1VQL A;  4A3F H;  4OON A;  4BY1 G;  1VQM A;  3Q8D A;  4UP7 A;  4GN5 A;  1U0L A;  4X6A H;  1YIJ A;  1IBK Q;  3PIP A;  4JV5 Q;  3PV0 A;  1J5E Q;  2E2I H;  4WJ3 M;  3OW2 A;  3S2D H;  3CCS A;  4DV3 L;  3D0F A;  1N33 L;  3GTQ H;  5JEA G;  1VQN A;  4B3R L;  2YU9 H;  2Z6K A;  4DV5 Q;  4JBJ A;  1VQB A;  4IOC A;  2ID0 A;  4JI5 Q;  1CKN A;  4A3B G;  4C2M H;  5LMU L;  1HNW L;  4K0K Q;  4A4I A;  1X9N A;  3AYH B;  4EX5 A;  3KF8 B;  4IPG A;  3DLL A;  1KIX A;  4BY7 H;  1M1K C;  4PZ6 A;  1EIF A;  3NEL A;  3G6E A;  4A76 A;  1VQP A;  2OCE A;  2BA0 A;  2YTX A;  4NPS A;  4JI0 L;  1IL2 A;  3AQQ A;  2WP8 J;  4DR3 L;  3HOW G;  1KRS A;  1V9P A;  4BBS G;  4H02 A;  5FLM G;  4GOP A;  2JEA I;  4DV1 L;  4X66 Q;  2D0O A;  3G48 A;  4MTN A;  3CC7 A;  2V1C C;  1KC8 C;  4DUZ L;  5M3M H;  2VNU D;  4LF5 Q;  2UXD L;  3MXN B;  5C0X J;  3RLF A;  4DV2 Q;  2HHH L;  2K5H A;  3CCL A;  5AJ3 Q;  1XTD A;  1I3Q H;  1HNX L;  4OWW B;  3S1M H;  1W2B A;  2WB1 E;  2MNA A;  5M3F G;  4GKK Q;  2BA1 A;  4BA2 I;  1SE8 A;  4JI3 L;  3UDX A;  1UE1 A;  1VQ8 A;  3S15 H;  4R4C A;  1K9M C;  2LSS A;  3E0E A;  2I5M X;  4KHP Q;  3F2D A;  4DR4 L;  3KF6 B;  1PVO A;  1Q82 C;  4OX9 L;  3NEN A;  1SLJ A;  2R93 G;  4KHZ A;  4JI8 L;  3PCO B;  4YY3 L;  1PH6 A;  3T1Y L;  2B29 A;  2F3I A;  4DR1 L;  3M7N A;  1NMF A;  4BBR H;  2YTY A;  3SGI A;  1YHB A;  1IZ6 A;  5IE8 A;  5LMN Q;  4BBS H;  4DV7 Q;  5FJ8 H;  1N8R C;  1X6O A;  3HOV H;  1TWA H;  3S14 H;  3HOZ H;  2VY3 A;  2E5L L;  1G29 1;  3K80 C;  4DK6 C;  4LNQ A;  1HR0 Q;  3GTL H;  2MO1 A;  1CKO A;  1HZA A;  3WWV A;  1OXT A;  2KHI A;  3E9I A;  1VCI A;  3CME A;  2YTV A;  2RCN A;  2Z0S A;  4LF5 L;  5EAY A;  1HZB A;  5C44 H;  1JE5 A;  5HGQ A;  2L15 A;  1VQC A;  4LFC L;  1HZC A;  2PI2 A;  4YCU A;  4YWK A;  1FJG Q;  3CC2 A;  4DR3 Q;  2UXB L;  2VS1 A;  4LFA Q;  1X56 A;  4GN4 B;  5GAE C;  3I4N H;  3A5Z B;  3GTO H;  2ZJP A;  4QJF A;  3EIV A;  1JB7 A;  5BR8 L;  1J6Q A;  2I5L X;  3H0G H;  3T1H L;  3DM3 A;  1YNX A;  2KCT A;  2F52 A;  3EN2 A;  3OYY A;  3PUY A;  4IJL A;  4PMW A;  4X64 Q;  3RN2 A;  4L5S A;  4DR2 L;  4Y52 H;  1X65 A;  1AH9 A;  1H95 A;  1NY4 A;  5M5Y H;  3OTO Q;  1OXX K;  3I55 A;  1G6P A;  4AYB E;  1VQ4 A;  3PUX A;  1JJ2 A;  5J3B A;  5LMU Q;  1IBL L;  3KJO A;  1K0R A;  4UY8 C;  2R92 H;  4JYA Q;  3KJP A;  3RLO A;  2WAQ E;  2KEN A;  4HIO A;  3UDF A;  2I5H A;  5C0X I;  3J81 j;  2NVT H;  5IYB H;  4IPD A;  3CCV A;  2HIV A;  4X65 L;  3PF5 A;  4LF8 L;  2Q2U A;  1CKN B;  2R7Z G;  1R9T H;  3BZC A;  3UE1 A;  1JMC A;  2OQ0 A; 
#chains in the Genus database with same CATH topology
 3LGJ A;  3CC4 A;  2JA6 H;  2JA7 G;  3C1E A;  1Z6H A;  3K81 C;  3QOJ A;  2F0T A;  1SJE D;  2XWB B;  3M9B A;  2F4V Q;  1RJT A;  2DUD A;  1H9S A;  2NWG A;  3I2Z A;  1N34 L;  5JJI A;  4BBR G;  4LFC Q;  4HIM A;  1KAW A;  3VA7 A;  3CQZ H;  2ZXO A;  3CP0 A;  5C5L A;  4K5X A;  5J39 A;  1DGS A;  4ME3 A;  4B3T L;  4LUO A;  5CV6 A;  3E0J A;  3RN5 A;  1SE4 A;  2Z4I A;  1TY2 A;  3K5L A;  2AWO A;  2M2L A;  1C4Q A;  4B3S L;  1K28 A;  3BDC A;  3FRP B;  1F9S A;  2F1M A;  2Q2H A;  4DAV A;  3NUC A;  1YBY A;  1H9K A;  2O2L D;  2ZT9 C;  4GNX B;  2WB1 G;  4JI4 Q;  5E7N A;  1FNV A;  4RGT A;  3I4L A;  4HAE A;  5JJK A;  2ZXP A;  3RZO B;  3QO2 A;  4RMF A;  2R61 A;  3OWF A;  1NR4 A;  4DV7 L;  3I72 A;  4JBW A;  5DM7 3;  2UXD Q;  2B2Y A;  2KCN A;  1EQV A;  5F2D A;  5FOB B;  2ZM6 Q;  2JA9 A;  1TT2 A;  1RTN A;  2Y0S E;  3F8T A;  2Q8T A;  4A93 G;  4JI3 Q;  5KEE A;  3R8B A;  3D6W A;  3PO2 H;  3IRB A;  4O0A A;  5GAG C;  3TS0 A;  2B2W C;  4MIU A;  4ULL A;  2C35 B;  4IQZ A;  4JI5 L;  5GAH C;  1IKM A;  4DV5 L;  3FP9 A;  2K1B A;  3SK5 A;  2E8G A;  5KNB A;  4GNX C;  5JPN C;  1VQK A;  1N33 Q;  1TWF H;  1PH8 A;  2JA6 G;  1Q90 A;  4YCW A;  5KIX A;  1YNJ D;  4DK0 A;  4IFD G;  2BE5 D;  2JYO A;  1PTO H;  4R4O A;  4ZLT F;  3KBX A;  1UE5 A;  2EXD A;  4WRD A;  1PDQ A;  4NXN Q;  2IX0 A;  1HA5 A;  1MJE A;  1Q12 A;  4DV3 Q;  1ET6 A;  1S72 A;  4DV0 Q;  4WFN 3;  3OW7 A;  1ZYR C;  1QZH A;  4C3H G;  1XPU A;  1MI2 A;  2XRQ D;  1ILQ A;  2EYL A;  3L9A X;  3J81 L;  4JVZ A;  1K8M A;  1BQQ T;  3HRZ C;  1E2Z A;  4JI6 Q;  3H09 A;  4QL5 A;  1KTK A;  2NVQ B;  4NP5 A;  4A3D H;  5GRO A;  4KN4 C;  1A62 A;  1Q8I A;  1SAP A;  5IGF A;  4EQO A;  2CQA A;  3S1Q H;  2KQ3 A;  3ERQ A;  3PQI A;  5CGK A;  1KDC A;  1ICF B;  5C3E G;  3GO5 A;  4DR5 Q;  4R1J A;  5FK9 C;  4AQY Q;  1IYJ B;  5BN3 A;  2B2T A;  1YJ9 A;  5IWA L;  4H44 C;  3N6R A;  2B39 A;  2LXJ A;  1I4H A;  5ELF A;  4DK3 C;  4LMQ D;  1IKL A;  1FVI A;  2K03 A;  2KVM A;  4P71 A;  2A68 D;  2CQO A;  1I4P A;  4MHE A;  5FLM H;  5D65 A;  5M5W H;  3GV3 A;  1MSH A;  1X55 A;  3BZK A;  4DV1 Q;  3S2D B;  1II3 A;  2NN6 I;  3ER0 A;  5FO7 B;  5CR3 A;  3VR5 A;  4XQN A;  5IYD H;  3W5O A;  4JBK A;  1SNP A;  4A3I G;  4CDE C;  1HJP A;  4IOA A;  4QUF A;  1EOV A;  1XMO Q;  1JWM D;  4OWX B;  3ULP A;  1HTL D;  1STB A;  1JCK B;  2AWN A;  1KD1 C;  1TWH H;  1GKH A;  1DCZ A;  3E6Z X;  1B3Q A;  2C9O A;  2A74 C;  3FKI G;  4NB3 A;  1WVL A;  1XYI A;  1DOM A;  2TMP A;  4J6H A;  4OL7 A;  4JV5 L;  1LAB A;  1Y8O B;  2NBF A;  1TVX A;  1JT8 A;  3T1H Q;  5K36 G;  3GTJ B;  2JJQ A;  3I56 A;  2NVX H;  1Y1W G;  4X3T A;  4UP9 A;  3ULL A;  1LYL A;  3IL8 A;  4ODG A;  1BKB A;  3BVM A;  3AEV A;  1BCP C;  3R2T A;  3K5O A;  4A3E H;  2DGY A;  4JI8 Q;  1VS0 A;  4JI7 L;  1A8V A;  2JA8 G;  5HY6 A;  1PYB A;  4DF7 A;  1V1Q A;  2K01 A;  4AIM A;  4OWT B;  5C4J H;  3GD7 A;  1HNW Q;  1U4L A;  1Z47 A;  3NBH A;  4P74 A;  2QDB A;  4IJH A;  2EE1 A;  1NMG A;  3CMA A;  2DJG C;  3QR8 A;  1HFG A;  4FF4 A;  2UUC L;  1E1O A;  3G6J B;  2SDF A;  4DPG A;  1VQO A;  3TZD A;  2RDH A;  4ME5 A;  1MSG A;  2N49 A;  1H9S B;  4JI6 L;  4DV2 L;  4JBM A;  3PSI A;  3VYR A;  3NTK A;  1F2Y A;  2NZ1 D;  4C2M B;  2OT2 A;  3A54 A;  5IT9 c;  1PH4 A;  1J5E L;  3S1N H;  2V4D A;  5C0X G;  5EKL A;  5M3F H;  3S2H H;  3H3V C;  2A73 B;  5I2Y A;  1WOC A;  3GTK H;  3GV6 A;  4K14 A;  4TKO B;  3VYS A;  3CPF A;  4NXN L;  3S1M B;  5D3D A;  2B2U A;  4B3R Q;  2B2W A;  1LO5 D;  3G71 A;  5CYU A;  4GNX A;  2Y0S B;  4TSS A;  1SMY C;  5KYL A;  4FP5 D;  2XRS D;  1OXU A;  1VF7 A;  4GS3 A;  4OHJ A;  4DR2 Q;  1D6E C;  5BN4 A;  3CKI B;  3SHL A;  3HOW B;  3CF5 A;  1FYC A;  3BG3 A;  1EY5 A;  2M00 A;  1YNJ C;  2E76 C;  3S15 B;  4BY7 G;  3RLN A;  3KF8 A;  1BNZ A;  2GA4 B;  1W6K A;  2Z9H A;  3M3Y H;  3VDY A;  2KCM A;  2VB3 X;  3MFY A;  3CRL C;  5JEA H;  1XJV A;  4JI2 Q;  1A3U A;  5IT9 E;  1JIC A;  2R92 G;  2KJX A;  3A8J E;  4A3L G;  1AZP A;  2EVB A;  1XNQ L;  3I4M B;  1EUJ A;  2Z6B A;  1BR9 A;  3CRK C;  2Z1C A;  3MXN A;  2IX3 A;  3PO3 B;  2WV6 D;  4B08 A;  4R9W A;  1I5F A;  5LMN L;  1X32 A;  2QEJ C;  1LT3 D;  2XTI A;  3TP5 A;  4HSP A;  2O5I C;  4IPH A;  2EYJ A;  1FGU A;  1EY9 A;  4JI7 Q;  4KHP L;  2A69 C;  2EYO A;  4QCL A;  4TQU S;  4JCV E;  4BXX H;  1B53 A;  2BH8 A;  4LUV A;  1Y1V G;  1AN8 A;  1EWH A;  2FJ2 A;  1Y1V H;  4HCS A;  4IUT A;  1BBU A;  3I4O A;  1SR3 A;  1TQO A;  2F0P A;  4YHH Q;  4QMG A;  3CCR A;  2K04 A;  2PQA B;  2VQE L;  3ZYY X;  2B2T C;  3OMG A;  1QJO A;  1RIP A;  2K5N A;  3J7Y W;  4P73 A;  4ZUJ A;  2F0Q A;  2F0L A;  2HDL A;  1N34 Q;  2JXM B;  1VQ6 A;  2VB2 X;  3C1F A;  4BY1 G;  1D5Z C;  2QCP X;  4GN5 A;  3GTQ B;  1YIJ A;  1DOL A;  3PV0 A;  2E2I H;  4CJ0 B;  4A3D B;  1R4Q B;  3OPO A;  3SR1 A;  5FO9 B;  3D0F A;  3JAM L;  4L6T B;  2E2I B;  1CKN A;  5JAV A;  1I4Q A;  4A4I A;  3AYH B;  4EX5 A;  3I90 A;  2F0G A;  3OWE B;  2K28 A;  2HD3 A;  1WTW A;  2B8F A;  3URY A;  4PZ6 A;  4A76 A;  1VQP A;  5I2X A;  4CDD C;  2YTX A;  2LKV A;  1ENF A;  2UXB Q;  3HOW G;  1KRS A;  4H02 A;  2RDF A;  3NQT A;  4X66 Q;  3CC7 A;  1PTO D;  2EXZ A;  1KC8 C;  2QW7 A;  2J4X A;  2K5H A;  2IW3 A;  3CCL A;  2AUJ D;  1XTD A;  4GKK Q;  2K05 A;  3J80 L;  1SE8 A;  3UDX A;  3S1M H;  3E0E A;  3F2D A;  4DR4 L;  3KF6 B;  4Y7N B;  1PLF A;  4OX9 L;  3QWN A;  1PRT B;  3T1Y L;  4DR1 L;  2AQ2 B;  1F2L A;  1YHB A;  1IZ6 A;  5IE8 A;  4KK7 A;  5ELB A;  2A6E C;  5A35 A;  1TWC B;  3HOZ H;  2L5T A;  5D3I B;  2E5L L;  1HR0 Q;  4IUV A;  4BBS B;  5M3M B;  1U9R A;  2B2U C;  1SMY D;  3E9I A;  3TDQ A;  1LTA D;  4R8N A;  2Z0S A;  5IGD A;  5EAY A;  5KYI A;  4HMI A;  5C44 H;  1HCZ A;  3I3C A;  1MBY A;  3H0G B;  3MA2 B;  1QB5 D;  1FJG Q;  3CC2 A;  4GN4 B;  3GTO H;  2K5D A;  4QJF A;  4C3J B;  4ZKB B;  1JB7 A;  1IW7 C;  2R92 B;  1EY4 A;  1J6Q A;  1FGB D;  2MPM A;  1YNX A;  2KCT A;  4PMW A;  3EN2 A;  1AH9 A;  3NPP A;  4Y52 H;  3M4Y A;  1NY4 A;  3I55 A;  1G6P A;  5LMU Q;  5J1Z A;  3KJO A;  1K0R A;  5NUC A;  4JYA Q;  1YNN C;  2EY1 A;  2KEN A;  1GUW A;  3PIO 3;  5IT9 L;  2KED A;  2Q2U A;  1CKN B;  1R9T H;  4C1N K;  3BZC A;  1JMC A;  1IBK Q;  3S16 H;  1CA5 A;  2CH4 A;  1VDZ A;  2L55 A;  4C3I H;  1X3E A;  1NAP A;  2B2V A;  2HQL A;  4LFA L;  3F1Z A;  2WAQ B;  2IHF A;  1VQ5 A;  3HOU B;  4GLV B;  4FDB A;  1STH A;  2ZM6 L;  3RZD H;  3B6Y A;  4UP8 A;  3F2B A;  5EKK A;  3S24 A;  1ICW A;  1STA A;  5E3F A;  3GTG B;  3MEH A;  2ATW A;  1KAA A;  2ES2 A;  3A8I E;  1FJG L;  4R4I A;  4L5R C;  2EYM A;  3GTG H;  1JOO A;  4JI4 L;  4A3I B;  1CQF A;  4IO9 A;  5CV7 A;  5FO8 B;  2BCO A;  5EPK A;  1HR0 W;  3A7L A;  4DA2 A;  3K5N A;  3SVM A;  4RHS A;  1LTS D;  1Z9F A;  2F0V A;  3SK8 A;  4XTC S;  1SYC A;  1CSP A;  3FKI B;  3GTP B;  3ULJ A;  4RGN A;  2B63 H;  1K8G A;  4XYO A;  4AYB B;  1PH2 A;  2JSO A;  4MNO A;  4A3M B;  1SND A;  2Z4H A;  2KA7 A;  1O7Y A;  2MGS A;  4YCV A;  4BA1 I;  1LM0 A;  2VUM G;  4GKK L;  2F4V L;  3I7F A;  2IHE A;  3HKS A;  2E2J B;  1OXV A;  4A3F G;  1AP0 A;  2IT1 A;  3TRE A;  1C8C A;  4LF6 Q;  2UU9 Q;  3MWY W;  4LF8 Q;  2GVB A;  4X66 L;  1B3A A;  2CKZ B;  3AFP A;  2X69 A;  3W1B A;  1QVG A;  4C3J G;  5JJL A;  4I7Z C;  3NBH B;  1PH1 A;  2JA5 B;  3OTO L;  4F87 A;  1G2T A;  4X64 L;  2TSS A;  1KDA A;  1D8L A;  4L5T A;  3S17 B;  3FPU B;  5BN5 A;  4BXX G;  3I4N G;  3N52 A;  5IIF A;  1JWS D;  2UU9 L;  1YEZ A;  4A3K B;  3LNN A;  1TWG H;  4ALP A;  1FR3 A;  2MP1 A;  3HKZ G;  1UE7 A;  4K8J A;  4UDU C;  1P8L A;  4GLA C;  4QIW E;  5DM6 3;  5EBC A;  3J81 i;  1UEB A;  2VQF Q;  1EQQ A;  1VMC A;  1G2S A;  3R93 A;  1I94 L;  1LV9 A;  5IYD G;  1VQD A;  2EIF A;  5I9P A;  1SNO A;  4A3L H;  3PO3 G;  3D3R A;  2HT1 A;  1MGS A;  1F2M A;  4B3M L;  1K8O A;  4G4K A;  1T9H A;  1IHZ A;  1P16 A;  3BZD B;  3CW2 C;  1LT5 D;  3OIP A;  2R93 H;  2KOL A;  3MXP A;  1R4P B;  1WFQ A;  5AJ3 L;  3J81 c;  1QVF A;  4S3S A;  1CZW A;  1YI2 A;  1NJI C;  1IXR A;  1SN8 A;  1VQJ A;  2JEB I;  2DY8 A;  2GN5 A;  1DJR D;  2WB1 B;  2NVY B;  2UXC L;  4ILW A;  5CBE E;  1E1T A;  1K73 C;  1ESF A;  2SNS A;  4FVM A;  3I4M G;  1A2U A;  3QB3 A;  2PO4 A;  4HJ9 A;  1GUG A;  3HOW H;  4LUZ A;  4EQ5 A;  1IYV A;  1QUQ A;  1XTC D;  1JR0 D;  1RL2 A;  4PZ8 A;  2E2D C;  1LT6 D;  1BOS A;  1MKH A;  3GTM B;  3Q6S A;  3TEH B;  2R7Z H;  4FYD A;  2DNE A;  5IYB G;  3J7A 5;  1HNZ L;  3U50 C;  1D5M C;  4V19 0;  2KBN A;  4L5Q A;  4DKA C;  4GKJ L;  1L0W A;  1K83 B;  1HRJ A;  2JA7 B;  4QGU A;  3H0G G;  4BY1 H;  1NUC A;  2Q2T A;  2K5V A;  2K14 A;  1E3P A;  1BCP B;  3I73 A;  1T5E A;  4IFD H;  1XXG A;  2B2V C;  2VW9 A;  3CCU A;  2KHJ A;  1SXT A;  1GOZ A;  1YHQ A;  2K33 A;  2JA8 H;  1IBM Q;  2Z8L A;  4A3J B;  1BXT A;  3IFD A;  1K83 H;  2A5H A;  1D1I A;  5DNF A;  1S5F D;  3PO2 G;  1J8I A;  1VQI A;  1XPR A;  3QJY A;  1E7Z A;  5JPM C;  2L11 A;  2HHH Q;  4A93 H;  1EY8 A;  2DNC A;  5KRU A;  1SYD A;  1EWI A;  1PYS B;  5M5X B;  2ASB A;  1SBB B;  1YHA A;  3Q24 A;  2XVS A;  2VZA A;  3NWT A;  4A3M G;  1U4M A;  3I91 A;  1UEA B;  1OO9 B;  2A6E D;  1E0B A;  2LS0 1;  4PQX A;  1RF2 D;  4WOR A;  4LFB Q;  1DON A;  1CUK A;  4FXG C;  4L63 B;  2EQS A;  2H1E A;  3E3X A;  2ZTD A;  4QB4 A;  3ICE A;  2I07 B;  4UPA A;  5M3F B;  3CQZ B;  5EQ0 A;  4LWC A;  4DV6 Q;  1SRU A;  4YWL A;  3HEJ A;  2ZJR A;  1B1Z A;  2AMC B;  4JK1 C;  1BUV T;  1BVS A;  1PMR A;  2EJF C;  4JOI C;  3PGZ A;  2VL6 A;  1EYC A;  1L0X B;  1HNZ Q;  4X65 Q;  3A8K E;  3STB C;  3K7U C;  2D9U A;  1J9O A;  1EY6 A;  1S5B D;  1IBL Q;  2R7F A;  1GHK A;  3HZX A;  1L1O B;  2L9H A;  2A8V A;  3KYH C;  1VQ9 A;  3D8G A;  4IFD I;  3JAM i;  4HID A;  3C3L A;  2PCF B;  5IP9 H;  5C3E B;  2JA7 H;  5FLX L;  5IP7 G;  1ZEQ X;  2L4N A;  3HFZ B;  3BYY B;  2RSO A;  4H7B A;  3CD6 A;  3O13 A;  2BH2 A;  1SJH D;  1VQG A;  2F0D A;  3T13 A;  1VQ7 A;  1TWA B;  2KCC A;  1KHI A;  3ND9 A;  3S17 H;  1S5D D;  1PZI D;  3UDG A;  5C6A A;  1B9M A;  3JAM c;  2P5Z X;  3E9H A;  2UUA Q;  4LF4 Q;  3NK9 A;  3V05 A;  2M9V A;  5E1F A;  5E4X A;  2Z6K C;  4C3H H;  2EDG A;  2UUA L;  2IX1 A;  1JOQ A;  1Q3L A;  2K32 A;  1QG7 A;  3NXW A;  5C44 B;  1Q46 A;  2X6G A;  1V1P A;  3KLW A;  1AE2 A;  2K75 A;  2H4O A;  4DR5 L;  3JC6 6;  4O1N A;  2F0E A;  1QZG A;  3WOE A;  4A3C G;  5M5Y B;  1V43 A;  2VQF L;  4NXM L;  4C3I B;  1YIT A;  5C4X G;  2WAQ G;  3F2U A;  1ASY A;  3MC0 B;  4P72 A;  2CW0 D;  1Q7Y C;  3K7A H;  4PMC A;  4KMU C;  4KTA A;  2RHS B;  3HOX H;  2G5D A;  4H0L C;  3RD4 A;  2WFW A;  1WTH A;  3TS2 A;  1X54 A;  3J7Z C;  5K36 H;  5A2Q L;  5HUR A;  2D62 A;  2FMC A;  2PI2 E;  4DAY B;  4RWS C;  1VQL A;  5KGU A;  2F0K A;  1VQM A;  3Q8D A;  2SOB A;  2DJF C;  3HG9 A;  4KY6 A;  3PIP A;  2B2Y C;  5IGB A;  3CCS A;  3K0Y A;  4DV3 L;  3GTQ H;  1JOR A;  4B3R L;  2Z6K A;  4JBJ A;  1VQB A;  2ID0 A;  5KND A;  4C2M H;  3MVV A;  5C0X H;  1X9N A;  1HHV A;  1DM0 B;  1H9M A;  3KF8 B;  1AZQ A;  5C3W A;  2RCF A;  1STN A;  2F0H A;  1SE3 A;  4ZCK A;  2KHS A;  3NEL A;  3G6E A;  2F0O A;  3NP8 A;  1M4V A;  4NPS A;  5LL6 X;  1IL2 A;  3EA6 A;  2WP8 J;  4BBS G;  4DGZ A;  1V9P A;  5FLM G;  1A2T A;  2JEA I;  1TS2 A;  4MTN A;  2HDM A;  3LWU A;  3VR4 A;  3MXN B;  4DV2 Q;  2HHH L;  2R7Z B;  2QF7 A;  4C56 C;  1HNX L;  2BDN A;  4OWW B;  1WCM B;  1W2B A;  2WB1 E;  2MNA A;  4BA2 I;  4ZAI A;  4JI3 L;  3S15 H;  4R4C A;  2LSS A;  1GJX A;  3BDO A;  1VF5 C;  1V1O A;  5EGT A;  4KHZ A;  5COR A;  3MZ5 A;  2B29 A;  4BBR H;  1GHJ A;  4P2C B;  4DV7 Q;  3ITP A;  1N8R C;  1NCV A;  1HNW L;  4K5V A;  4DK6 C;  4LNQ A;  1EEI D;  3WWV A;  2KHI A;  1KNA A;  5COY A;  3CME A;  2YTV A;  1A3T A;  2RCN A;  3SEB A;  4LF5 L;  1HZB A;  1JE5 A;  5HGQ A;  2L15 A;  3AU7 A;  1VQC A;  2E2H B;  4KKT A;  1O80 A;  4YWK A;  4DR3 Q;  1SYE A;  4LFA Q;  1X56 A;  3I4N H;  3A5Z B;  2ZJP A;  3BDL A;  2I5L X;  2RBM A;  3T1H L;  1XMQ L;  2SEB D;  2F52 A;  4L5S A;  3HOZ B;  4N9P A;  4C3I G;  5M5Y H;  1OXX K;  4DU9 A;  1VQ4 A;  5J3B A;  1WD1 A;  3RLO A;  2F3V A;  3P20 A;  3J81 j;  5C0X I;  5IGG A;  5ELE A;  2PZU A;  4K2K A;  1SYG A;  1QNU A;  2A19 A;  4XT1 B;  5C4X H;  1Y1V B;  4RG1 A;  5M9O A;  2UXC Q;  2O5J C;  3G7L A;  3BJU A;  4N8X 1;  3T51 B;  1JQY D;  4A3E B;  1XPO A;  1CK1 A;  1BDO A;  2N55 A;  2N8N A;  2A6H C;  2F3W A;  4L8J A;  1S4Z A;  3FPP A;  1Y1W B;  5CBA E;  4R4T A;  3K8A A;  3TZU A;  4HJ8 A;  1WJJ A;  3I8Z A;  3PF4 A;  4RCO A;  4KY7 A;  4RA8 A;  2HIX A;  2B63 G;  2PMZ E;  1VQH A;  1GUT A;  1S3O A;  3P75 A;  1WYD A;  2NVY H;  4Q0F A;  4N8F A;  4DXF A;  4JI1 L;  1SFO B;  3HOV G;  4K6D A;  1I94 Q;  3L2P A;  1HTP A;  1TS4 A;  1WTO A;  4MZ9 A;  4LF9 Q;  4NKL A;  4DR4 Q;  4CKC A;  4FF3 A;  2ZJQ A;  3HOY G;  1F9Q A;  1I3Q B;  1GO3 E;  2NN6 H;  2RKS A;  4E6I A;  5IP7 H;  4C1N I;  1ASZ A;  3MHB A;  3E5S A;  1S5C D;  4JC0 A;  2UUB Q;  3ZJY C;  1UAP A;  3EBE A;  3H3V H;  3TRZ A;  2OTJ A;  1TII D;  1CHP D;  1STE A;  4GOP B;  3W3A A;  3DUZ A;  1HPC A;  4LF7 L;  1ONL A;  3M4Q A;  2ENB A;  2LFN A;  4HMJ A;  5I4D A;  2JA8 B;  1EWC A;  2K5Q A;  3HOU G;  1KXL A;  1YJN A;  2QKI C;  5CC4 A;  2YV5 A;  3T53 B;  1N32 L;  1PRT D;  1Q1B A;  1WD0 A;  1SE2 A;  3K58 A;  4IUP A;  4LF6 L;  5JVG 3;  5CV4 A;  5I6W A;  2JE6 I;  1WTV A;  1SYB A;  1T5X D;  4A3C H;  1BCP D;  1SNM A;  4RKB A;  2NZH A;  2WKC A;  5FKA C;  1EYG A;  3M7G A;  2EY5 A;  1UNS A;  3U4Z A;  3M4P A;  3H94 A;  1STY A;  3VA5 A;  1XMQ Q;  2Q8I B;  4TVA B;  4J15 A;  1BBX C;  1CT1 D;  1LLR D;  4Q5V A;  3ND8 A;  5IOD A;  5AFW A;  1B7Y B;  1EQT A;  1NTG A;  4XQQ A;  1DZ1 A;  3TP6 A;  1TS5 A;  1DOK A;  1TXY A;  1EIH A;  3HOY H;  4WJ4 A;  1B70 B;  3DHQ A;  3KOJ A;  2L12 A;  1Q1E A;  3FDT A;  3P1H A;  4A93 B;  1EU3 A;  4PG3 A;  1ENC A;  2WII B;  3CCJ A;  1SRO A;  4A3F B;  5ELD A;  3J80 i;  1HUM A;  1TU2 B;  3CXC A;  5IP9 G;  1EU4 A;  4QQB X;  4YWM A;  2NTT A;  3HOX B;  2A69 D;  4ZKC B;  3SK4 A;  4DAP A;  3K57 A;  1W3S A;  4Z9C B;  2EJM A;  3PUV A;  5IYC H;  4X62 Q;  4B3T Q;  3P7J A;  2JP1 A;  2N78 A;  4A3G H;  4FO2 A;  1I4G A;  2KEE A;  1M90 C;  1G51 A;  2H5X A;  4XXE A;  4DN4 M;  3KK7 A;  3ONA B;  4A3G B;  1I6H B;  3RNU A;  1MIU A;  4CBV A;  3DEP A;  3Q22 A;  4LK1 C;  3PUZ A;  1O7I A;  3HS0 C;  2ICI A;  2XGT A;  4I7A A;  4UHV A;  4JYA L;  2RQX A;  2YYZ A;  3K0X A;  4CDC C;  4A3B H;  3TP7 A;  4APV A;  1DD2 A;  4NMZ A;  4BY7 B;  1KQS A;  4G57 A;  3RZO H;  1EY7 A;  4CHT B;  4OO1 G;  1N32 Q;  5GQO A;  4A3M H;  1I6H H;  4DXG A;  3L0O A;  2PW5 A;  1D5X C;  1PV4 A;  1STG A;  2CFM A;  4DNI A;  5JEA J;  5EPJ A;  4KKU A;  1CKM A;  1F77 A;  1HR0 L;  4A3J H;  2NUC A;  2Q8R E;  4MTK A;  2UUB L;  1K0S A;  5CV9 A;  3PIO A;  1VQA A;  2G9H D;  3BYT B;  4X62 L;  1N9W A;  5H1S E;  4KI0 A;  1B4O A;  3T16 A;  3T1Y Q;  2K50 A;  1LTL A;  2K7V A;  4ZK9 B;  1K3B C;  3EVQ A;  1Y8N B;  4DV4 L;  1CA6 A;  1A0I A;  4QF4 A;  2IWH A;  5DEH A;  4FNF A;  1KLU D;  4OEM B;  4IPC A;  4LF9 L;  1B9N A;  1M8A A;  1EZ8 A;  4F7X A;  2KUM A;  4DUY Q;  2JA6 B;  4KKS A;  3A5U A;  1A63 A;  3KLR A;  1EIY B;  3S1Q B;  2CWP A;  1GVP A;  4HIK A;  2EPB A;  2BE5 C;  2JA5 G;  4YY3 Q;  3H3V I;  1TS3 A;  2EYH A;  3DWA A;  1FL0 A;  4JG2 A;  5M5X H;  4DR6 Q;  3GDE A;  5M3M G;  2J7Z A;  1VQE A;  5G3L D;  1G8Z D;  4GN3 B;  1CHQ D;  5FLX c;  4LF4 L;  2A1A A;  1HH2 P;  4RHR A;  1ENA A;  2Q2I A;  4B9W A;  5C4J B;  3X3M A;  2IY5 B;  2K52 A;  4G7H C;  2PW7 A;  2ZXR A;  4HSV A;  1PH9 A;  1PZK D;  2ZTE A;  1UE6 A;  2F03 A;  5C3X A;  1H9R A;  3UDI A;  4XT3 B;  3STB D;  4HJA A;  3FKI H;  3K6O A;  3GTP H;  2AHO B;  3S2H B;  1LTI D;  1FD7 D;  2F0M A;  3T4A C;  5ELN A;  1XMO L;  2A68 C;  3VYU A;  2J0T D;  3HP3 A;  1AFP A;  4POG A;  4O42 A;  4G7O C;  3S9W A;  5KNC A;  1TWH B;  1AEX A;  1ET9 A;  2G9D A;  1JOK A;  2B3G A;  4YHH L;  2GVA A;  4BWG B;  2WIN B;  4RH6 A;  4A3K G;  2AUK A;  4LF7 Q;  1SNQ A;  4GLX A;  3H91 A;  4KD3 A;  2PZW A;  4AYB G;  3MFG A;  2O4X A;  1A3V A;  5IWA Q;  1XWE A;  3BVZ A;  2HUG A;  4H13 C;  2NTS A;  1WCM H;  5IYC G;  1CSQ A;  3NHH A;  5K5P A;  3VR6 A;  4LFB L;  4A3B B;  1WI5 A;  4DUY L;  1JC7 A;  3MXU A;  1RDP D;  1PTO B;  5C3E H;  1YJW A;  1C9O A;  2XIW A;  2JQO A;  1XNQ Q;  1UWV A;  4OXP A;  1BBW A;  2C5C A;  1TKW B;  4QY7 A;  3TSS A;  1JJG A;  4JI1 Q;  2EOT A;  2QIL A;  4JI2 L;  1I50 H;  4RKL A;  4XYQ A;  3PO2 B;  1JWU D;  1EFW A;  4DAM A;  4V0B A;  5A2Q E;  3WOF A;  5FJ8 G;  2R93 B;  2NVT B;  2OF1 A;  2MO0 A;  3WDN A;  5CV5 A;  3EJI A;  1WTX A;  3ERS X;  4DR7 Q;  3J80 c;  3ERO A;  1BF4 A;  1NE3 A;  4KJN A;  2R6G A;  2NZO A;  3BU2 A;  3MEF A;  4OO1 H;  4CKB A;  1JE4 A;  1OXS C;  3K59 A;  4A3F H;  4DAY A;  1GUN A;  5EBD A;  4RAU C;  4UP7 A;  4X6A H;  1J5E Q;  4WJ3 M;  1PTO C;  1N33 L;  2X6L A;  5JEA G;  2YU9 H;  4DV5 Q;  2F0J A;  4IOC A;  5I6Y A;  2F0F A;  4JI5 Q;  3D4W A;  3A7A B;  3DLL A;  2ICE C;  3QOL A;  4BY7 H;  1M1K C;  1SSO A;  4EVO A;  1UUP A;  1A15 A;  3GTK B;  2BA0 A;  4JI0 L;  3AQQ A;  3SK6 A;  4DR3 L;  5ELC A;  2EYP A;  4KHV A;  2V1C C;  2F0W A;  4DUZ L;  2VNU D;  4LF5 Q;  2UXD L;  5C0X J;  5I9O A;  1I3Q H;  3IAY A;  5M3F G;  4G7Z C;  1ESR A;  1K9M C;  1PVO A;  1SLJ A;  1PH6 A;  4JI8 L;  3PCO B;  4J1M A;  3M7N A;  2F3I A;  1G6Z A;  1NMF A;  2L0C A;  4EQP A;  2HCC A;  1HUN A;  5FJ8 H;  3HOV H;  1X6O A;  3LWE A;  4ZYS A;  3DEO A;  1TWA H;  3I70 A;  3S14 H;  2VY3 A;  4K6L A;  3J81 E;  2EY2 A;  3K80 C;  3Q23 A;  3GTL H;  1ILP A;  3J80 E;  1CKO A;  1AW7 A;  1HZA A;  2RVL A;  1D1K A;  5DAU A;  4KV6 A;  2FHT A;  3OSO A;  1R9T B;  4ZUI A;  2F0I A;  4LFC L;  1HZC A;  2PI2 A;  1PFN A;  4YCU A;  3SDZ A;  3EIV A;  1HXY D;  3H0G H;  3DM3 A;  5J22 A;  4IJL A;  4LJZ C;  3RN2 A;  3VR3 A;  1X65 A;  3I4N B;  1SNC A;  1JJ2 A;  2R92 H;  3RZD B;  1IBL L;  3UDF A;  2I5H A;  2NVT H;  5IYB H;  4X65 L;  3CHB D;  3Q0A A;  3D4D A;  4HTH A;  2R7Z G;  4EGV A;  2E75 C;  3UE1 A;  2OTL A;  2OQ0 A;  2F0S A;  4IUQ A;  1H9J A;  4DK1 A;  1TY0 A;  1LTR D;  1L2F A;  4GOP C;  4PV1 C;  3M4O H;  1GUS A;  1GM5 A;  4JPB W;  1A6X A;  3NEM A;  3C46 A;  3HOY B;  4XDX A;  2QA4 A;  4AQY L;  2RSN A;  3CCQ A;  4HJ7 A;  2JK8 A;  1QWY A;  4O2D A;  3L7Z C;  1D7Q A;  1LT4 D;  1N36 Q;  1V8Q A;  1EYD A;  3VYT A;  2CW0 C;  3A55 A;  2NN6 G;  3RUZ A;  4NXM Q;  3H6M A;  4IAL A;  5JOB A;  4FF1 A;  4QUC A;  4U68 A;  2L1B A;  1QCB D;  3J7A F;  4X3U A;  2AKW B;  2PMZ B;  3NBI A;  2PNH A;  3KLS X;  5IGC A;  1WTR A;  1F9R A;  3W1G A;  2D0P A;  4EQN A;  4ZRZ A;  3PO3 H;  4ZQ3 A;  1Q81 C;  2FMM A;  1TWC H;  4DV0 L;  1RCV D;  4FXK C;  2KEC A;  4AH6 A;  5EPL A;  1IBM L;  1E2V A;  3H15 A;  2JA5 H;  4GZY C;  2CVR A;  3G4S A;  3TBI B;  4PNY A;  4YIJ A;  3VR2 A;  4JOI A;  1S40 A;  1U5K A;  1PTO F;  2NYZ D;  2RHQ B;  2QEX A;  2R7D A;  2CH4 W;  3CAM A;  1XNR L;  5HGT A;  5EKI A;  1B8A A;  4A3E G;  1JJC B;  1SMX A;  1I4R A;  1OTC A;  3UI2 A;  3GTJ H;  4CJ1 B;  3KF6 A;  4HJ5 A;  1X3Q A;  1V1P B;  5FLX E;  3BS1 A;  1X3F A;  2QGQ A;  4C3J H;  3J7A V;  3IFT A;  4KLK A;  2QDL A;  1PFS A;  1X3G A;  2RA4 A;  5L37 A;  1PFM A;  3NWS A;  1ZKO A;  1U4P A;  1LUZ A;  1KLG D;  3K7A B;  4DV6 L;  3AFQ A;  1AE3 A;  4IFD J;  1XNR Q;  1YNN D;  5GAD C;  2CHB D;  4UAI A;  2VUM H;  3C2P A;  3U4V A;  4HN7 A;  3D6C A;  5LL6 S;  5IY0 A;  3KDF A;  4PZ7 A;  3KDF B;  4P75 A;  3U58 A;  1WCM G;  3NTI A;  3R2I A;  1L1O C;  3MXG A;  3HOU H;  4DR7 L;  5IOC A;  3GP7 A;  1O78 A;  4B3S Q;  3HOZ G;  1PH7 A;  1C0A A;  4A3K H;  1C48 A;  2E5L Q;  1L1O A;  4R4Q A;  1HNX Q;  4IZ8 A;  4B3M Q;  1Y1W H;  5CMD A;  2PQE A;  5JJZ A;  3KLS A;  4ABN A;  5C4H A;  2LMC B;  4DR1 Q;  2OXP A;  3U9O A;  3HKZ E;  2IJ0 A;  4OO1 I;  3KBG A;  1YZ6 A;  1IW7 D;  5M5W B;  1N36 L;  2LXK A;  1SYF A;  3FHW A;  1Y14 B;  1MJC A;  2RDG A;  2OEO A;  2BOS A;  1QIL A;  1QUQ B;  3QG1 A;  3V96 A;  2PPB C;  4U67 3;  1L0Y B;  3S1R H;  1KL9 A;  1O7Z A;  5TSS A;  4A3I H;  4JW0 A;  3PMF A;  4B9X A;  1SFO H;  3NSW A;  1FNU A;  4RFB A;  1EL0 A;  4GKJ Q;  3T56 B;  1B2T A;  5BR8 Q;  3KFU A;  1LTB D;  3QIA A;  4BY1 B;  1Z7T A;  5LHY 1;  1E22 A;  2EZV A;  2A6H D;  1PA6 A;  4BBR B;  3SE0 A;  1K3R A;  3CPW A;  2RF4 A;  4POF A;  1HFN A;  2CWA A;  2PZT A;  1BCP F;  4F88 A;  3DXJ C;  2ZTC A;  3S1R B;  3GTL B;  2N88 A;  4CDF C;  2IL8 A;  3AMU A;  1KRT A;  3TQY A;  1NR2 A;  1TWF B;  1BO0 A;  3GTO B;  3GTM H;  4DNT B;  5C44 G;  1TWG B;  2IPK D;  2DN8 A;  3JAM E;  2EJG C;  2JN4 A;  5DLQ E;  5G3L F;  1CZG A;  4TRD A;  3HKZ B;  1LAC A;  5IGE A;  2AQ1 B;  1EZ6 A;  1PYW D;  5EJW A;  2VQE Q;  2HQE A;  4RGO S;  1PH3 A;  2XNA C;  3CCE A;  2MQH A;  2FIN B;  4BS9 A;  1GXD C;  1ROD A;  3K5M A;  4A3J G;  1EFI D;  3F2C A;  5ELO A;  1XX8 A;  1JB3 A;  3TME A;  4FF2 A;  4HR7 B;  2OQK A;  4DR6 L;  1KAB A;  3M85 A;  3NTH A;  5E4W C;  1C7Y A;  3PUW A;  3A0J A;  2NVQ H;  3GQB A;  1LTT D;  1W6J A;  2Y0S G;  1Q8K A;  1Q86 C;  2PNR C;  1GD7 A;  1F9P A;  4XIG S;  3HGB A;  1PH5 A;  3BVG A;  4DUZ Q;  4K0K L;  4CJ2 C;  1HQM C;  2OWO A;  4DV4 Q;  3U9S A;  2EYF A;  4JI0 Q;  2ALY B;  4K2L A;  2EY6 A;  5C5M A;  3PIP 3;  2F0N A;  2YU9 B;  1SEB D;  1NBW A;  1EQR A;  1Y69 U;  1IBK L;  3UE0 A;  3DM1 A;  2WAC A;  4RCN A;  4KN7 C;  3S1N B;  1QE6 A;  4HED A;  1EIG A;  4A3G G;  1RD9 D;  2E74 C;  1U4R A;  5C4Z A;  5LMN W;  2CCZ A;  1CI3 M;  1SDF A;  1E2W A;  2R3Z A;  1ZYR D;  1WTQ A;  1DXM A;  2N3S A;  1PRT C;  3NQI A;  4C3H B;  1PXU A;  1TR5 A;  4RGM A;  2K6A A;  1CM9 A;  3FMC A;  1G91 A;  1GUO A;  1YVC A;  3A56 A;  5JVH 3;  3I4M H;  3DMU A;  1D2B A;  4CKE A;  1I50 B;  1VMP A;  2F4I A;  4DNR B;  4A3D G;  3W2D A;  4K5W A;  4OEL B;  1QNK A;  1VQF A;  2K4K A;  3TP8 A;  2PYK A;  4PMB A;  2E2J H;  1FNW A;  4Y7N H;  2MJ8 A;  3CCM A;  2NB0 A;  2I0Q A;  3OIQ A;  4M1U B;  4A75 A;  3A74 A;  3HOX G;  3MAQ A;  1PZJ D;  4CGY B;  1RKN A;  2I46 A;  3LX0 A;  4OGQ C;  2UUC Q;  4OX9 Q;  4LW1 A;  3D31 A;  1QOH A;  3L3O C;  1WTP A;  1NSN S;  5ISR A;  1PHJ A;  2FXQ A;  3TN2 A;  1K8A C;  3OOC A;  1I6V C;  4XQJ A;  1CTM A;  2NVX B;  1LTG D;  3DWP A;  1EEF D;  2WKD A;  2AQ3 B;  2E2H H;  1EY0 A;  1KNE A;  2PQA A;  3EQL C;  1HZ9 A;  4MN3 A;  2XSC A;  1IYU A;  2DY7 A;  1QVC A;  4M8A A;  1E24 A;  3RR5 A;  3V2T A;  3DWQ A;  2MFI A;  4KD4 A;  3S16 B;  3M4O B;  4QIW B;  4OON A;  2BDO A;  5T1G A;  1U0L A;  4LAA A;  3X3N A;  3R3O A;  4JV5 Q;  4KJO A;  3OW2 A;  3S2D H;  3D4R A;  1VQN A;  3RMH A;  1Y8P B;  3FEW X;  1PRT F;  5CV8 A;  4A3B G;  5LMU L;  4K0K Q;  4IPG A;  2B63 B;  4FXD A;  1KIX A;  1RTO A;  4NDX A;  1EIF A;  2HCI A;  2XWJ B;  1CQV A;  2OCE A;  1NNX A;  3HOV B;  2FFK B;  4GOP A;  4DV1 L;  3NE5 B;  2K5W A;  1B50 A;  2D0O A;  3G48 A;  4F8M A;  3MTS A;  4OIK A;  5M3M H;  1I4X A;  4X3K A;  1KDB A;  4WJW A;  4N9T A;  3RLF A;  4IUN A;  5AJ3 Q;  1ML0 D;  1X3P A;  2MHV A;  2BA1 A;  3KUP A;  1VQ8 A;  1UE1 A;  3CU7 A;  4I65 A;  2I5M X;  4KHP Q;  1F2Z A;  4ID6 A;  1Q82 C;  3NEN A;  2R93 G;  4YY3 L;  4NW2 A;  2YTY A;  3SGI A;  5LMN Q;  4K8I A;  4BBS H;  2MUY A;  2VXW A;  1DYQ A;  1EYA A;  1CFM A;  1IL8 A;  1G29 1;  2MO1 A;  4DFA A;  1OXT A;  3AB9 A;  4IUR A;  2D5D A;  1VCI A;  3M3Y B;  1RHP A;  4R8I A;  2D2C C;  2SNM A;  4KY5 A;  2F0U A;  5C4X B;  1O7L A;  2UXB L;  2VS1 A;  3EFX D;  1S5E D;  5GAE C;  5BR8 L;  1MD2 D;  2B8G A;  3OYY A;  3PUY A;  1H95 A;  4OIJ A;  5T1I A;  3SXH A;  5D14 A;  4X64 Q;  1B44 D;  4DR2 L;  3S14 B;  2LY7 A;  3OTO Q;  1HA6 A;  4AYB E;  3PUX A;  3OHX C;  1PFB A;  4J8Q A;  4UY8 C;  3OMC A;  1MHW C;  3KJP A;  2WAQ E;  4HIO A;  2XN9 C;  4HCE A;  1HQR D;  4IPD A;  3CCV A;  2HIV A;  3PF5 A;  1ZXT A;  3FVQ A;  4LF8 L;  3IKJ A;  2VUM B;  4X3S A;  1EOT A;  4IN3 A;  4IUU A; 
#chains in the Genus database with same CATH homology
 3LGJ A;  3CC4 A;  2JA6 H;  2JA7 G;  3K81 C;  5C4X H;  4C3I H;  4RG1 A;  3M9B A;  2F4V Q;  1L2F A;  1X3E A;  2DUD A;  4GOP C;  3M4O H;  2UXC Q;  2HQL A;  1GM5 A;  4LFA L;  3F1Z A;  3BJU A;  2IHF A;  3NEM A;  1VQ5 A;  1XPO A;  3I2Z A;  1N34 L;  4GLV B;  4FDB A;  4BBR G;  2QA4 A;  2N8N A;  4HIM A;  4AQY L;  3CCQ A;  1KAW A;  2ZM6 L;  4HJ7 A;  4LFC Q;  2JK8 A;  3CQZ H;  4O2D A;  3L7Z C;  1D7Q A;  3RZD H;  3B6Y A;  4UP8 A;  3F2B A;  3CP0 A;  3S24 A;  4R4T A;  3K8A A;  4HJ8 A;  1WJJ A;  1DGS A;  1N36 Q;  3PF4 A;  4ME3 A;  4B3T L;  4LUO A;  2HIX A;  2NN6 G;  3RN5 A;  4NXM Q;  2ATW A;  2UXB Q;  2ES2 A;  2AWO A;  4B3S L;  1FJG L;  2B63 G;  2PMZ E;  4R4I A;  4L5R C;  3GTG H;  1VQH A;  1S3O A;  4JI4 L;  2Q2H A;  1WYD A;  2NVY H;  4IO9 A;  2AKW B;  1YBY A;  4JI1 L;  3HOV G;  1HR0 W;  4GNX B;  2WB1 G;  3L2P A;  1I94 Q;  4JI4 Q;  2PNH A;  4MZ9 A;  5E7N A;  4LF9 Q;  4DR4 Q;  1Z9F A;  3W1G A;  2D0P A;  4XTC S;  5JJK A;  1CSP A;  2ZJQ A;  3ULJ A;  3HOY G;  2B63 H;  1GO3 E;  1K8G A;  4RMF A;  3PO3 H;  1Q81 C;  1TWC H;  5IP7 H;  4JBW A;  4DV0 L;  4DV7 L;  1PH2 A;  4MNO A;  1ASZ A;  4AH6 A;  2UXD Q;  1IBM L;  3H15 A;  2JA5 H;  4JC0 A;  2ZM6 Q;  2UUB Q;  3G4S A;  4YCV A;  3ZJY C;  4BA1 I;  1LM0 A;  2JA9 A;  2Y0S E;  3F8T A;  2VUM G;  4A93 G;  3EBE A;  3H3V H;  4JI3 Q;  4JOI A;  3TRZ A;  2OTJ A;  1S40 A;  4GKK L;  1U5K A;  2F4V L;  3I7F A;  2IHE A;  3HKS A;  2RHQ B;  2QEX A;  2R7D A;  1OXV A;  4GOP B;  3PO2 H;  4A3F G;  1N32 L;  3IRB A;  3CAM A;  4O0A A;  5GAG C;  4LF7 L;  2IT1 A;  3TRE A;  1XNR L;  4LF6 Q;  3TS0 A;  3M4Q A;  1B8A A;  2C35 B;  2UU9 Q;  4A3E G;  4LF8 Q;  3HOU G;  1KXL A;  2GVB A;  4JI5 L;  5GAH C;  4X66 L;  1YJN A;  2CKZ B;  2YV5 A;  3FP9 A;  1JJC B;  3AFP A;  2E8G A;  4DV5 L;  1SMX A;  3W1B A;  4GNX C;  1VQK A;  1N33 Q;  1Q1B A;  1QVG A;  1TWF H;  5JJL A;  3NBH B;  1PH8 A;  1OTC A;  2JA6 G;  1PH1 A;  4YCW A;  3GTJ H;  3OTO L;  3KF6 A;  4HJ5 A;  4IFD G;  4LF6 L;  4X64 L;  4R4O A;  1X3F A;  2QGQ A;  4C3J H;  2JE6 I;  1D8L A;  1UE5 A;  2EXD A;  4NXN Q;  4KLK A;  1PFS A;  4A3C H;  1X3G A;  2IX0 A;  4L5T A;  1MJE A;  1Q12 A;  4DV3 Q;  4BXX G;  3I4N G;  2NZH A;  1LUZ A;  1EYG A;  1XMQ L;  2UU9 L;  4DV6 L;  1YEZ A;  1S72 A;  3U4Z A;  3AFQ A;  1AE3 A;  4IFD J;  1TWG H;  3M4P A;  5GAD C;  4DV0 Q;  4ALP A;  1XNR Q;  3HKZ G;  1XMQ Q;  1QZH A;  2VUM H;  4TVA B;  1UE7 A;  4J15 A;  3U4V A;  1P8L A;  4GLA C;  4QIW E;  1XPU A;  5IY0 A;  3J81 i;  1UEB A;  2VQF Q;  1EQQ A;  1B7Y B;  4JI6 Q;  3KDF A;  4PZ7 A;  1I94 L;  1NTG A;  3KDF B;  4QL5 A;  4P75 A;  5IYD G;  1VQD A;  3U58 A;  2EIF A;  1TXY A;  1WCM G;  3PO3 G;  4A3L H;  1L1O C;  3HOY H;  4WJ4 A;  1B70 B;  3HOU H;  5GRO A;  2HT1 A;  4DR7 L;  4A3D H;  1A62 A;  4B3M L;  3KOJ A;  1Q1E A;  1T9H A;  4PG3 A;  4B3S Q;  3HOZ G;  1P16 A;  3S1Q H;  3CCJ A;  1SRO A;  3CW2 C;  1PH7 A;  1C0A A;  2R93 H;  3J80 i;  4A3K H;  2E5L Q;  1L1O A;  4R4Q A;  1WFQ A;  1HNX Q;  5AJ3 L;  4B3M Q;  1Y1W H;  3J81 c;  1QVF A;  5C3E G;  3CXC A;  5IP9 G;  4QQB X;  4YWM A;  1YI2 A;  1NJI C;  1IXR A;  3GO5 A;  1SN8 A;  4DR1 Q;  1VQJ A;  4R1J A;  4DR5 Q;  4AQY Q;  2JEB I;  1IYJ B;  1YJ9 A;  3HKZ E;  1W3S A;  3PUV A;  5IWA L;  2GN5 A;  4OO1 I;  1YZ6 A;  5IYC H;  4X62 Q;  2LXJ A;  2UXC L;  4B3T Q;  2N78 A;  4DK3 C;  4A3G H;  1E1T A;  1FVI A;  1N36 L;  2LXK A;  1K73 C;  1M90 C;  1G51 A;  2H5X A;  3I4M G;  4P71 A;  3FHW A;  2CQO A;  4HJ9 A;  1Y14 B;  5FLM H;  3HOW H;  4LUZ A;  1MJC A;  4EQ5 A;  5M5W H;  1QUQ A;  3RNU A;  1MIU A;  1QUQ B;  1X55 A;  3BZK A;  4DV1 Q;  3PUZ A;  2NN6 I;  3S1R H;  1KL9 A;  1O7I A;  1RL2 A;  3ER0 A;  4PZ8 A;  5IYD H;  4A3I H;  3W5O A;  4JBK A;  2XGT A;  4JYA L;  4A3I G;  1SFO H;  2YYZ A;  1MKH A;  1HJP A;  4IOA A;  3K0X A;  3TEH B;  1EOV A;  2R7Z H;  1XMO Q;  4OWX B;  4A3B H;  4APV A;  3ULP A;  4GKJ Q;  5IYB G;  5BR8 Q;  1KQS A;  2AWN A;  3J7A 5;  1KD1 C;  1HNZ L;  3U50 C;  3KFU A;  3RZO H;  1TWH H;  1GKH A;  2KBN A;  4L5Q A;  4DKA C;  3FKI G;  4GKJ L;  1L0W A;  1E22 A;  4NB3 A;  4OO1 G;  1N32 Q;  5GQO A;  1PA6 A;  1K3R A;  3CPW A;  4QGU A;  2RF4 A;  4POF A;  4A3M H;  2CWA A;  3H0G G;  4BY1 H;  4JV5 L;  1I6H H;  2Q2T A;  3L0O A;  2K5V A;  1JT8 A;  2ZTC A;  2K14 A;  1E3P A;  1PV4 A;  3T1H Q;  5K36 G;  2JJQ A;  1KRT A;  3TQY A;  3I56 A;  2CFM A;  2NVX H;  4DNI A;  5JEA J;  1Y1W G;  1CKM A;  3GTM H;  1HR0 L;  4UP9 A;  3ULL A;  5C44 G;  2VW9 A;  3CCU A;  1LYL A;  2KHJ A;  4A3J H;  2UUB L;  1BKB A;  1YHQ A;  3PIO A;  2JA8 H;  1IBM Q;  1VQA A;  5DLQ E;  3AEV A;  4X62 L;  1N9W A;  5H1S E;  4KI0 A;  3T1Y Q;  4A3E H;  2DGY A;  4JI8 Q;  2K50 A;  2VQE Q;  1VS0 A;  1LTL A;  1PH3 A;  1K83 H;  4JI7 L;  3CCE A;  1A8V A;  4DV4 L;  2MQH A;  1A0I A;  2JA8 G;  5HY6 A;  3PO2 G;  1PYB A;  4A3J G;  1V1Q A;  1VQI A;  4IPC A;  5ELO A;  4OWT B;  4AIM A;  3GD7 A;  5C4J H;  3F2C A;  1XPR A;  4LF9 L;  1Z47 A;  1HNW Q;  4DUY Q;  1E7Z A;  2HHH Q;  4P74 A;  4A93 H;  3A5U A;  2OQK A;  1A63 A;  4IJH A;  1EIY B;  4DR6 L;  2CWP A;  1GVP A;  4HIK A;  1NMG A;  1EWI A;  1PYS B;  3M85 A;  3PUW A;  3CMA A;  3A0J A;  1C7Y A;  1YHA A;  4YY3 Q;  2JA5 G;  2ASB A;  3H3V I;  2UUC L;  1E1O A;  2VZA A;  2NVQ H;  4A3M G;  4DPG A;  1FL0 A;  1VQO A;  2Y0S G;  4JG2 A;  1Q8K A;  5M5X H;  4DR6 Q;  1Q86 C;  3GDE A;  2N49 A;  1GD7 A;  4XIG S;  5M3M G;  1PH5 A;  1VQE A;  4GN3 B;  4JI6 L;  4DV2 L;  5FLX c;  4JBM A;  3PSI A;  4LF4 L;  2A1A A;  4DUZ Q;  4LFB Q;  1HH2 P;  4K0K L;  2OWO A;  1CUK A;  4DV4 Q;  2Q2I A;  2EQS A;  3ICE A;  2ZTD A;  4UPA A;  4JI0 Q;  2ALY B;  2K52 A;  2IY5 B;  4LWC A;  4DV6 Q;  5IT9 c;  1PH9 A;  1PH4 A;  1SRU A;  4YWL A;  1J5E L;  2ZJR A;  1NBW A;  2AMC B;  1EQR A;  3S1N H;  5C0X G;  1BVS A;  2ZTE A;  4JOI C;  1UE6 A;  5M3F H;  3UE0 A;  3PGZ A;  2VL6 A;  1IBK L;  3S2H H;  1WOC A;  3GTK H;  3CPF A;  3UDI A;  1HNZ Q;  4NXN L;  3STB D;  4X65 Q;  4HJA A;  3STB C;  3FKI H;  3K7U C;  3GTP H;  2AHO B;  4B3R Q;  4A3G G;  3G71 A;  2OTL A;  4GNX A;  5ELN A;  1XMO L;  1IBL Q;  5LMN W;  2R7F A;  2CCZ A;  4POG A;  1OXU A;  4GS3 A;  1L1O B;  4DR2 Q;  2A8V A;  3KYH C;  1VQ9 A;  3CF5 A;  4IFD I;  2N3S A;  3JAM i;  2B3G A;  4HID A;  4YHH L;  4BY7 G;  3RLN A;  2GVA A;  5IP9 H;  2JA7 H;  5IP7 G;  3HFZ B;  3M3Y H;  3VDY A;  2KCM A;  4A3K G;  3CD6 A;  4LF7 Q;  2BH2 A;  5JJI A;  4GLX A;  1VQG A;  1YVC A;  1XJV A;  4AYB G;  4JI2 Q;  1VQ7 A;  3I4M H;  1KHI A;  5IWA Q;  2R92 G;  3S17 H;  4A3D G;  1WCM H;  4A3L G;  1VQF A;  2K4K A;  1CSQ A;  5IYC G;  3UDG A;  1XNQ L;  1EUJ A;  3S16 H;  3JAM c;  4LFB L;  3E9H A;  2E2J H;  2UUA Q;  4LF4 Q;  4Y7N H;  3CCM A;  1WI5 A;  4DUY L;  2I0Q A;  1I5F A;  5LMN L;  2Z6K C;  4C3H H;  2XTI A;  5C3E H;  4A75 A;  1YJW A;  2UUA L;  2IX1 A;  1C9O A;  3A74 A;  2A19 A;  4IPH A;  3HOX G;  2JQO A;  1XNQ Q;  1UWV A;  1BBW A;  1FGU A;  4OXP A;  2UUC Q;  4JI7 Q;  4OX9 Q;  1Q46 A;  3KLW A;  1AE2 A;  2K75 A;  4KHP L;  4QY7 A;  4DR5 L;  4LW1 A;  3D31 A;  3JC6 6;  4TQU S;  4JCV E;  4JI1 Q;  1JJG A;  4BXX H;  4JI2 L;  2BH8 A;  4LUV A;  1QZG A;  1PHJ A;  1I50 H;  2FXQ A;  4A3C G;  1Y1V G;  1K8A C;  1EFW A;  1V43 A;  2VQF L;  4DAM A;  4NXM L;  1Y1V H;  1YIT A;  5C4X G;  5FJ8 G;  2WAQ G;  1BBU A;  3I4O A;  1SR3 A;  1ASY A;  2E2H H;  2PQA A;  2MO0 A;  4YHH Q;  3CCR A;  2VQE L;  1HZ9 A;  2PQA B;  4P72 A;  3ERS X;  4DR7 Q;  1Q7Y C;  1RIP A;  3K7A H;  3J80 c;  2K5N A;  1QVC A;  4P73 A;  2RHS B;  3HOX H;  1E24 A;  3RR5 A;  1NE3 A;  2WFW A;  3TS2 A;  1N34 Q;  1X54 A;  2R6G A;  2MFI A;  2NZO A;  3BU2 A;  3J7Z C;  2D62 A;  2PI2 E;  3MEF A;  1VQ6 A;  4DAY B;  1OXS C;  1VQL A;  4A3F H;  4OON A;  4BY1 G;  1VQM A;  3Q8D A;  4UP7 A;  4GN5 A;  1U0L A;  4X6A H;  1YIJ A;  1IBK Q;  3PIP A;  4JV5 Q;  3PV0 A;  1J5E Q;  2E2I H;  4WJ3 M;  3OW2 A;  3S2D H;  3CCS A;  4DV3 L;  3D0F A;  1N33 L;  3GTQ H;  5JEA G;  1VQN A;  4B3R L;  2YU9 H;  2Z6K A;  4DV5 Q;  4JBJ A;  1VQB A;  4IOC A;  2ID0 A;  4JI5 Q;  1CKN A;  4A3B G;  4C2M H;  5LMU L;  1HNW L;  4K0K Q;  4A4I A;  1X9N A;  3AYH B;  4EX5 A;  3KF8 B;  4IPG A;  3DLL A;  1KIX A;  4BY7 H;  1M1K C;  4PZ6 A;  1EIF A;  3NEL A;  3G6E A;  4A76 A;  1VQP A;  2OCE A;  2BA0 A;  2YTX A;  4NPS A;  4JI0 L;  1IL2 A;  3AQQ A;  2WP8 J;  4DR3 L;  3HOW G;  1KRS A;  1V9P A;  4BBS G;  4H02 A;  5FLM G;  4GOP A;  2JEA I;  4DV1 L;  4X66 Q;  2D0O A;  3G48 A;  4MTN A;  3CC7 A;  2V1C C;  1KC8 C;  4DUZ L;  5M3M H;  2VNU D;  4LF5 Q;  2UXD L;  3MXN B;  5C0X J;  3RLF A;  4DV2 Q;  2HHH L;  2K5H A;  3CCL A;  5AJ3 Q;  1XTD A;  1I3Q H;  1HNX L;  4OWW B;  3S1M H;  1W2B A;  2WB1 E;  2MNA A;  5M3F G;  4GKK Q;  2BA1 A;  4BA2 I;  1SE8 A;  4JI3 L;  3UDX A;  1UE1 A;  1VQ8 A;  3S15 H;  4R4C A;  1K9M C;  2LSS A;  3E0E A;  2I5M X;  4KHP Q;  3F2D A;  4DR4 L;  3KF6 B;  1PVO A;  1Q82 C;  4OX9 L;  3NEN A;  1SLJ A;  2R93 G;  4KHZ A;  4JI8 L;  3PCO B;  4YY3 L;  1PH6 A;  3T1Y L;  2B29 A;  2F3I A;  4DR1 L;  3M7N A;  1NMF A;  4BBR H;  2YTY A;  3SGI A;  1YHB A;  1IZ6 A;  5IE8 A;  5LMN Q;  4BBS H;  4DV7 Q;  5FJ8 H;  1N8R C;  1X6O A;  3HOV H;  1TWA H;  3S14 H;  3HOZ H;  2VY3 A;  2E5L L;  1G29 1;  3K80 C;  4DK6 C;  4LNQ A;  1HR0 Q;  3GTL H;  2MO1 A;  1CKO A;  1HZA A;  3WWV A;  1OXT A;  2KHI A;  3E9I A;  1VCI A;  3CME A;  2YTV A;  2RCN A;  2Z0S A;  4LF5 L;  5EAY A;  1HZB A;  5C44 H;  1JE5 A;  5HGQ A;  2L15 A;  1VQC A;  4LFC L;  1HZC A;  2PI2 A;  4YCU A;  4YWK A;  1FJG Q;  3CC2 A;  4DR3 Q;  2UXB L;  2VS1 A;  4LFA Q;  1X56 A;  4GN4 B;  5GAE C;  3I4N H;  3A5Z B;  3GTO H;  2ZJP A;  4QJF A;  3EIV A;  1JB7 A;  5BR8 L;  1J6Q A;  2I5L X;  3H0G H;  3T1H L;  3DM3 A;  1YNX A;  2KCT A;  2F52 A;  3EN2 A;  3OYY A;  3PUY A;  4IJL A;  4PMW A;  4X64 Q;  3RN2 A;  4L5S A;  4DR2 L;  4Y52 H;  1X65 A;  1AH9 A;  1H95 A;  1NY4 A;  5M5Y H;  3OTO Q;  1OXX K;  3I55 A;  1G6P A;  4AYB E;  1VQ4 A;  3PUX A;  1JJ2 A;  5J3B A;  5LMU Q;  1IBL L;  3KJO A;  1K0R A;  4UY8 C;  2R92 H;  4JYA Q;  3KJP A;  3RLO A;  2WAQ E;  2KEN A;  4HIO A;  3UDF A;  2I5H A;  5C0X I;  3J81 j;  2NVT H;  5IYB H;  4IPD A;  3CCV A;  2HIV A;  4X65 L;  3PF5 A;  4LF8 L;  2Q2U A;  1CKN B;  2R7Z G;  1R9T H;  3BZC A;  3UE1 A;  1JMC A;  2OQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...