4YHHQ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhQ00
5LMNW 1VQFA 1I6HH 2V1CC 1U0LA 3AFQA 3FP9A 3KF6A 1WFQA 3HKZE 4P72A 1V1QA 1PHJA 3J81i 1Y1WH 5IYBG 4A3MG 2UUBL 4A93G 3FKIH 4UP9A 2NN6I 4DR2L 1S40A 1FVIA 3S1QH 1VQ6A 1A8VA 1XPUA 1XNQL 2RHQB 1VQEA 1SR3A 2UXDL 5LMNQ 1Q12A 3NEMA 2EIFA 3HOUH 2ID0A 2AHOB 2R6GA 4DUZQ 4JI8L 4A3LH 1N32L 2Q2IA 2NVXH 3G6EA 4DV4Q 2HHHQ 2RF4A 2F4VL 3HOUG 4K0KL 4DV3Q 4APVA 2F52A 1XPOA 1IBKQ 1W2BA 2XTIA 1SRUA 3GTKH 4A3CH 2Q2HA 2ZJRA 1R9TH 3FHWA 1GD7A 3HOWG 3VDYA 1KQSA 1MIUA 4LFAQ 4C3IH 4R1JA 3KJPA 1HZ9A 1X6OA 2OQKA 3WWVA 2E5LL 5FLXc 2I0QA 4X66Q 4GKKL 2ES2A 1SLJA 3S2HH 1QVCA 3HKSA 4YWLA 4O0AA 2R7ZH 4LUVA 4BXXG 3EIVA 4QY7A 1H95A 2E2JH 1XNQQ 3RZOH 2L15A 1S72A 3F2BA 1Q1BA 2RCNA 2JA5G 2R93G 3BZKA 2UXDQ 2DGYA 2WP8J 3L7ZC 4JBJA 4GNXA 4IFDG 1A62A 4KLKA 4JI8Q 1N32Q 3U50C 1YITA 1K8AC 4DK6C 1E1TA 4P71A 3ULJA 4GLAC 2VQEL 3E9HA 2K4KA 2PQAA 3RLOA 2MO1A 1XMOL 4X64L 1NE3A 2VNUD 2KENA 3I4NG 4LF6L 2K5NA 2N3SA 3ULPA 5M3MH 3GTMH 2XGTA 3GO5A 1PYBA 1Y14B 3HKZG 4R4OA 5M5XH 4JBMA 4JC0A 4GKKQ 4ME3A 1PH9A 2Q2TA 3CCJA 4KHPL 4IPGA 1AE2A 2CWAA 3J7ZC 4PMWA 1W3SA 4OWXB 3I4MH 4A3GG 2MNAA 3HOZG 1Z47A 2UUAL 1RL2A 5EAYA 2DUDA 3UDXA 3RN5A 1PH3A 4DUYL 3GDEA 2UXCQ 1VCIA 3CCQA 3CQZH 4BBRH 3G48A 2CWPA 4NXNL 5M3FG 3DLLA 3HOYG 1FL0A 1G291 3EN2A 3G71A 3K81C 1WI5A 4R4TA 4LF5L 2VQEQ 2ZTCA 3PF4A 3L0OA 1Q7YC 3CCEA 4X64Q 1VQOA 5IYCH 5FLMH 2OTLA 2VQFL 1VQCA 4LF6Q 2N8NA 1EIFA 4LUOA 4BY1G 3KDFA 4A3KH 1HZAA 3PV0A 2PMZE 2OWOA 2D62A 2KBNA 1O7IA 4GN5A 1GM5A 2Z6KA 5FJ8H 1PH2A 1WOCA 1QVFA 4BY7H 1VQMA 4A3EH 1BKBA 4KHZA 4EX5A 2UUCL 3PO2G 4KHPQ 4DR6L 1G51A 3UE1A 2LXJA 1LM0A 2D0PA 2WB1E 1X3GA 4LW1A 1K0RA 3CPFA 2UUAQ 2VS1A 1SE8A 2IHEA 4JI5L 1JJ2A 4BA2I 4OO1G 4GLXA 3KF6B 4DUYQ 5C0XJ 2I5LX 1OXTA 2Z0SA 4X6AH 4JI3L 1JT8A 4NXNQ 1A0IA 1SFOH 5IE8A 4LF5Q 5C3EG 3I4OA 5IP9H 1IZ6A 3GTLH 1QZGA 2PI2A 4Y7NH 2VQFQ 3PUYA 1EUJA 1XNRL 4B3TL 3GTQH 2NVYH 1TWHH 4QGUA 4A3BG 4LFCL 4DNIA 1E7ZA 1G6PA 4YY3L 5GAHC 4A3LG 3M4OH 3CD6A 3OW2A 1MJEA 4UP7A 1VQJA 4A4IA 1YEZA 1UE7A 4KI0A 2UUCQ 4DR6Q 3ERSX 4A3CG 2WAQE 3STBD 4L5RC 1VQHA 4JOIA 4JI5Q 1PH1A 2HIXA 1P16A 1YJWA 2I5HA 3E0EA 3W1GA 3A5ZB 4GOPA 4MZ9A 3H0GH 2FXQA 5IT9c 1JMCA 4JI3Q 3ICEA 3UDFA 4DV0L 5JEAJ 3ULLA 4B3SL 3KOJA 1BBUA 4A3JH 2CCZA 3HOVG 2QEXA 4Y52H 1WJJA 1VQGA 2R7ZG 2GVAA 1ASYA 1X3EA 3PUXA 1CSQA 3HOXH 4IPHA 1YHAA 3M4PA 4L5QA 1A63A 1XNRQ 4GNXB 1LYLA 1J5EL 4B3TQ 2K50A 4AQYL 4O2DA 4LFCQ 3RNUA 2JA8H 3S16H 4YY3Q 1XJVA 3PGZA 4NB3A 2PQAB 3M85A 2IT1A 3U4VA 5HY6A 2WB1G 1Q82C 4JI0L 4DR7L 3B6YA 4DKAC 4OONA 2JJQA 1VQBA 4R4QA 3PO3G 2UXBL 3BZCA 5C0XG 1I50H 5C4XH 1SMXA 4QL5A 4LF7L 4A3DH 1L1OC 2JEBI 4YWKA 2OCEA 5IY0A 3KJOA 4AYBE 1X3FA 4XIGS 1E1OA 2RHSB 3ZJYC 2ZM6L 1QZHA 4JI7L 4BBSH 4IJLA 1M1KC 3UDGA 5JJLA 2NVTH 2CKZB 4FDBA 2NZOA 2R7FA 1KAWA 3I4MG 3TEHB 3CC4A 3K80C 4PZ8A 2I5MX 3PIOA 1J5EQ 4A3IG 1YVCA 4DV1L 1EQRA 1KL9A 4HJ9A 4AH6A 3A5UA 1EOVA 1IYJB 1K8GA 3PUZA 4BBRG 2UUBQ 4DR2Q 3CC2A 2OTJA 1V9PA 2WAQG 4HIKA 4WJ3M 1QVGA 4JI0Q 3TS2A 4DR7Q 3M7NA 4JG2A 1SN8A 5IYCG 5FLMG 3S24A 3E9IA 1WCMH 3TREA 2IX0A 3KDFB 4GKJL 4P74A 2UXBQ 1OXSC 1KD1C 4UP8A 4A3KG 5GQOA 1VQPA 1JB7A 4LF7Q 1TWAH 4K0KQ 2F4VQ 1YIJA 3RLNA 1LTLA 4AIMA 4DV5L 4JI6L 4JI4L 3F8TA 2F3IA 2ZM6Q 2K75A 4JI7Q 2E2HH 3H3VI 1MKHA 4DR4L 4MNOA 1EFWA 2NVQH 3JAMc 1AH9A 2ZJQA 4XTCS 2E5LQ 1C0AA 3A0JA 3S15H 2VW9A 4DV1Q 3NENA 1EWIA 4B3RL 2IX1A 1Y1VG 1TXYA 3D31A 3GD7A 5GADC 2JA9A 1Q8KA 5IP7H 4DV7L 1XPRA 5IYBH 4A3MH 1HNZL 5IWAL 3DM3A 4HIMA 5IP9G 1YJ9A 1JE5A 3W5OA 4A3FG 3J7A5 1E3PA 1NTGA 2YTVA 2IY5B 1T9HA 4GKJQ 3MXNB 1BBWA 2K14A 1VQ5A 2B63H 2C35B 4JI1L 1KHIA 2YV5A 4AYBG 4HJAA 1AE3A 4DV5Q 2JE6I 3I7FA 3J80c 5E7NA 4JI4Q 4JI6Q 4IFDI 3GTJH 2A8VA 1X55A 3OTOL 1XMOQ 2HT1A 2BH2A 4YWMA 1TWGH 1QUQA 1X9NA 3H3VH 3K0XA 2QGQA 4IPDA 4DR4Q 5K36G 1MJCA 1Q81C 5DLQE 4HJ5A 4P75A 1XMQL 1K83H 3HOWH 4WJ4A 4GOPB 5BR8L 3RR5A 4B3RQ 4PZ6A 4LFAL 1NMFA 1YHBA 3H0GG 2JQOA 3AFPA 4GN4B 4DR5L 2A1AA 4DV7Q 2R92H 4YCVA 2AMCB 1PFSA 5IWAQ 3S17H 4A3JG 4IPCA 1PH6A 1EQQA 2YTYA 2E8GA 3PCOB 3HOXG 3GTPH 3HFZB 5GAGC 4A76A 3J81j 1VQNA 4JI1Q 2QA4A 4DAMA 1HNXL 2JA8G 3MEFA 1Y1WG 4C3JH 4LF9L 2OQ0A 3FKIG 3TRZA 4GN3B 1VQ4A 3T1HL 2GVBA 2LSSA 3PUVA 1IL2A 3NBHB 3EBEA 4OWTB 3I4NH 1CUKA 4JBWA 1XMQQ 2B29A 5C4XG 1HNWL 1I3QH 5BR8Q 3J81c 2H5XA 1B70B 4OX9L 1KC8C 2N49A 3CCRA 4BBSG 1PVOA 1X65A 2HQLA 3I2ZA 4DR1L 2GN5A 4R4IA 1I94L 2JA6H 1EIYB 2EQSA 4NXML 1OTCA 3AEVA 2EXDA 4DV2L 4OO1I 1D7QA 1NMGA 2VL6A 1HR0L 1N8RC 1CKNA 3CMAA 4C3HH 5M3FH 4LF9Q 2NN6G 1P8LA 3PF5A 2ASBA 3K7UC 3HOYH 4QIWE 4EQ5A 5LMUL 4LF8L 2WFWA 4OXPA 3T1HQ 2MQHA 1PH7A 1M90C 1E24A 1NY4A 3T1YL 1WCMG 3AYHB 4LWCA 5IYDH 4DAYB 4H02A 3SGIA 1PH8A 4BY1H 1HNWQ 1N34L 1E22A 3UDIA 1FGUA 3CPWA 1HZCA 4ALPA 1UWVA 5GAEC 4DUZL 1HR0W 4JCVE 1UE1A 3ER0A 1GVPA 2R7DA 2K5HA 4OX9Q 1N33L 4IFDJ 4X65L 3PO2H 5M3MG 1UE6A 5HGQA 3RZDH 2JA7H 2BH8A 1I94Q 1HH2P 5C4JH 4NXMQ 3BJUA 4DV2Q 1OXUA 4L5SA 1L1OA 1Q46A 3U4ZA 1Q86C 1VQ9A 1HR0Q 4JBKA 4DV6L 4DV0Q 4B3SQ 4X66L 1VQ7A 3K8AA 2Q2UA 1OXVA 1CKMA 4BA1I 5IP7G 4JV5L 2MFIA 2KCTA 5C3EH 4P73A 5C44H 5LMUQ 4LF8Q 4JYAL 4GS3A 4LFBL 4A75A 1Z9FA 3G4SA 3M9BA 3S1RH 3TS0A 3T1YQ 2NZHA 4AQYQ 1YZ6A 3PSIA 1X56A 2VUMH 3S14H 3S2DH 3M4QA 1N34Q 2B63G 4A3BH 2YYZA 1N9WA 1KRSA 3GTOH 2A19A 1QUQB 2ZTDA 1DGSA 3M3YH 1N33Q 4HJ8A 4X65Q 2BA1A 4LUZA 3OYYA 4DK3C 1TWCH 4RMFA 4LNQA 1EYGA 5C0XI 2CFMA 2JEAI 5JEAG 3PUWA 1L0WA 1ASZA 5FJ8G 3KLWA 5GROA 4BY7G 2PI2E 1PYSB 4DV6Q 4A3EG 3CMEA 1UE5A 4B3ML 1L2FA 3AQQA 3CAMA 1JJGA 4JV5Q 2R92G 3HOVH 1IXRA 4JYAQ 3F2DA 4LFBQ 2CQOA 3I56A 4YCWA 1HZBA 1D8LA 2K5VA 3K7AH 4GNXC 4IOCA 2UXCL 4NPSA 4A93H 1YJNA 5H1SE 2YU9H 2LXKA 3D0FA 1VQAA 4IJHA 4UPAA 3KFUA 4YCUA 3PO3H 3GTGH 3CF5A 1Q1EA 2BA0A 5M5YH 1TWFH 1PV4A 2UU9L 2KHJA 4QQBX 2YTXA 2Y0SE 2N78A 4PZ7A 3TQYA 1U5KA 4DPGA 1PA6A 4B3MQ 5M5WH 4OWWB 1J6QA 4IOAA 3BU2A 4R4CA 4J15A 2KCMA 3S1MH 4LF4L 4IO9A 1XTDA 4POFA 2JA6G 4RG1A 3F2CA 3H15A 2PNHA 4A3IH 1CKNB 1VS0A 1GO3E 1PH4A 1FJGL 1HNZQ 1VQIA 2MO0A 5ELOA 4BXXH 5J3BA 5JJIA 2JA5H 3KYHC 2R93H 4X62L 4DR3L 3JAMi 1WYDA 1YHQA 5IYDG 1LUZA 1YBYA 2ALYB 2UU9Q 3CCMA 3A74A 3OTOQ 1I5FA 2Z6KC 4HIDA 2ATWA 1SROA 2JK8A 1IBLL 2K52A 2B3GA 1OXXK 3CCUA 4LF4Q 3RN2A 2JA7G 3RLFA 1CSPA 4A3DG 3I55A 1L1OB 1HJPA 1N36L 4QJFA 3KF8B 4YHHL 1IBML 5JJKA 1UEBA 4L5TA 4C2MH 4DR5Q 2E2IH 4PG3A 1V43A 4HIOA 1FJGQ 2ZTEA 1Y1VH 2AWNA 3J80i 1BVSA 1PH5A 1X54A 4JI2L 4POGA 4A3GH 1C9OA 3IRBA 5C44G 5AJ3L 4TQUS 3CXCA 3HOZH 1KRTA 1K3RA 1VQDA 3CCSA 4A3FH 4UY8C 1JJCB 4X62Q 2D0OA 2IHFA 2VZAA 3F1ZA 3CCVA 4DR3Q 1HNXQ 1NJIC 2VUMG 2Y0SG 3CW2C 3JC66 3UE0A 1GKHA 1IBLQ 3CC7A 1VQLA 2AWOA 1VQKA 3S1NH 2AKWB 5LMNL 1YNXA 1VQ8A 4TVAB 5ELNA 1KXLA 3U58A 4JOIC 4MTNA 1C7YA 1N36Q 1K9MC 3CCLA 1IBMQ 4YHHQ 2ZJPA 1CKOA 3NELA 3LGJA 3W1BA 1NBWA 3PIPA 1RIPA 3Q8DA 3STBC 4DV3L 4DV4L 4GOPC 2HHHL 1B7YB 2HIVA 2KHIA 1B8AA 3CP0A 1KIXA 4DR1Q 4JI2Q 1IBKL 4HJ7A 1S3OA 5AJ3Q 1K73C 1YI2A 4GLVB 2VY3A 3L2PA
chains in the Genus database with same CATH superfamily
1I6HH 3FP9A 2L0CA 4P72A 1V1QA 1R4QB 4A3MG 2UUBL 1UAPA 1S40A 4OEMB 4ZAIA 2DY7A 3NEMA 5KNDA 3SK6A 2AHOB 1SE3A 4DUZQ 4XT3B 2Q2IA 3IKJA 2PW5A 2HHHQ 3HOUG 3F2UA 2F52A 3OIQA 1ET9A 2ZJRA 1STNA 1YNNC 3VDYA 3VYUA 4C3IH 1SFOB 1U4RA 4R1JA 1HZ9A 1KAAA 1X3QA 1X6OA 2OQKA 4X66Q 3C1EA 4FF3A 3GTLB 5CGKA 3QOLA 4Y7NB 1SMYC 4H0LC 4QUCA 5NUCA 4YWLA 4O0AA 4LJZC 4BXXG 4QY7A 1PZID 4ZKBB 3MEHA 1Q1BA 2D5DA 2LFNA 2AQ1B 4C3JG 1AZQA 1ENCA 2K32A 4KN4C 3ERQA 1QILA 4FXGC 1K8AC 1O7LA 3ULJA 2Z1CA 4LF6L 1F9RA 3ONAB 4K8IA 4KD4A 4DAVA 4R8NA 4JBMA 2Q8IB 2FJ2A 3R8BA 4CDFC 1WTWA 1Y69U 4PMWA 1STHA 1W3SA 5J39A 2EXZA 4A3GG 2MNAA 3PQIA 1Z47A 1BR9A 1Y1WB 4UAIA 3RN5A 3MTSA 2PW7A 4I65A 5A2QE 5M3FG 4X3UA 1A2UA 1JWMD 3HOYG 1FL0A 3EN2A 1PFNA 5BN5A 3G71A 4R4TA 2ZTCA 3D4WA 1VQOA 5IYCH 4LF6Q 1LTSD 2N8NA 2XN9C 4Q5VA 4EVOA 1HZAA 4KY6A 2D62A 1S5FD 2Z6KA 5FJ8H 1PH2A 4EX5A 3PO2G 2LXJA 1RTOA 2D0PA 4KV6A 1K0RA 4OO1G 2I5LX 3TP5A 1OXTA 4C56C 5C3EG 5IP9H 1IZ6A 3BZDB 1STEA 3NUCA 4QGUA 1TWHH 3A56A 2C9OA 2L55A 4YY3L 2F4IA 4A3LG 3M4OH 3OW2A 1DCZA 1Q90A 4UP7A 1VQJA 1UE7A 2AQ2B 3K59A 3A8JE 3H6MA 4A3CG 4K5XA 2KHSA 1HTLD 4IUTA 1BCPC 1P16A 1ESFA 2I5HA 1S5CD 3A5ZB 3TZDA 4FF4A 2FXQA 2E76C 1WTVA 3HOVG 4A3JH 2QEXA 4Y52H 5F2DA 2R7ZG 4B08A 4OIJA 1YHAA 3CU7A 1MI2A 3RNUA 5E1FA 4YY3Q 3M85A 4DAPA 5K5PA 3K5NA 3HOWB 2LY7A 4DKAC 5C4HA 1RODA 5C4XH 3X3MA 4A3DH 2SDFA 5IY0A 2OCEA 4XIGS 3FDTA 2ZM6L 1QZHA 4JI7L 4BBSH 2WKCA 2NVTH 2CKZB 4FDBA 3MVVA 2R7FA 2CH4W 3I4MG 5IT9L 1QJOA 4DGZA 3C1FA 3K80C 3PIOA 2I5MX 1VMPA 1LV9A 4A3IG 1YVCA 3VYRA 4HJ9A 3A5UA 3PUZA 5JVG3 2NN6H 2RDFA 1V9PA 1QVGA 3TS2A 1AN8A 3E9IA 1SNMA 2IX0A 4GKJL 1OXSC 1KD1C 4CKBA 2BCOA 2F4VQ 5IGCA 3F8TA 4XXEA 2ZM6Q 4JI7Q 2E2HH 5M9OA 4MNOA 3VA5A 2ZJQA 4CDDC 4XTCS 2E5LQ 3C46A 1ICWA 3NENA 3FEWX 2F0MA 4ZYSA 3C3LA 1Y1VG 2IX1A 1QWYA 1B9NA 4DV7L 5IP7H 5IIFA 3JAME 1JE5A 4A3FG 3J7A5 5D3DA 2DJGC 2YTVA 4GKJQ 3FRPB 4L6TB 4L8JA 4OIKA 2B63H 2C35B 1KHIA 1PTOB 3RUZA 4IFDI 2MJ8A 4C1NI 2JA7B 3OTOL 1XMOQ 1TWGH 1X9NA 2QGQA 5K36G 2HDLA 2L5TA 1F9SA 3R3OA 5C5MA 5BR8L 3RR5A 5BN4A 4PZ6A 1KLUD 1NMFA 3KUPA 4RAUC 2JQOA 3WOEA 1D5MC 4DV7Q 2MGSA 4Q0FA 2F0UA 2VUMB 2YTYA 3GTPH 2F0JA 5E4WC 3EFXD 5GAGC 4ZK9B 2F0LA 4HMJA 4DAMA 1Y1WG 3FKIG 4KY5A 2K5QA 2Z6BA 1HA5A 2A73B 5JOBA 3I90A 2DY8A 4OWTB 3I4NH 1GUGA 4FNFA 5BR8Q 3OIPA 4H44C 2H5XA 3W3AA 1I4XA 1KDCA 3MHBA 4OX9L 5T1GA 1SNDA 2FFKB 2GN5A 2WACA 4NXML 2PQEA 3J81E 2MP1A 4A93B 5HURA 3OSOA 1NMGA 1U4MA 1GXDC 3PF5A 2XRSD 4EQ5A 5LMUL 4DXGA 1B1ZA 4LF8L 3PO3B 2L11A 3P20A 5L37A 3VYSA 1QE6A 4ALPA 3CPWA 1VF7A 1CZGA 1UE1A 2AUKA 2BE5C 2K5HA 4OX9Q 5AFWA 4IFDJ 4X65L 5M3MG 2EPBA 5DNFA 4DXFA 4O42A 1HH2P 4NXMQ 5EGTA 4L5SA 1VDZA 1AP0A 2Q2UA 2JA5B 2MFIA 5LMUQ 4LF8Q 4LFBL 4GS3A 5IODA 3M9BA 4AQYQ 2OT2A 1X56A 4IQZA 4A3BH 1HA6A 1SBBB 1EEFD 4IALA 1DGSA 3SXHA 4HJ8A 4X65Q 2BA1A 3HKZB 4DK3C 1TWCH 1B50A 2CFMA 3PUWA 1ESRA 2B2VA 2K6AA 3DXJC 3KLWA 1SYDA 5I4DA 3HOZB 3QB3A 4B3ML 1TS2A 4LFBQ 1ML0D 4YCWA 1D8LA 3S9WA 2K5VA 3K7AH 4IOCA 4G7OC 3H3VC 3NTIA 5H1SE 3CKIB 2YU9H 2LXKA 3VR5A 1IL8A 1Z7TA 3CF5A 5M5YH 1PLFA 2PPBC 1RDPD 2YTXA 4F7XA 1MSGA 1U5KA 3EJIA 3LX0A 4B3MQ 4KMUC 1HTPA 4J15A 1SYCA 1STYA 2C5CA 1I6HB 4POFA 3BVMA 4KKTA 3SE0A 5EKKA 3H15A 3QJYA 1PH4A 1HNZQ 1FD7D 5CV6A 5ELOA 1HFGA 2F0WA 1C8CA 5J3BA 3HZXA 1JWUD 2HUGA 3KYHC 1Q3LA 1V1PA 1DOLA 3JAMi 4X3KA 2ZXPA 2OXPA 1YBYA 2NYZD 1G8ZD 1STGA 3DHQA 1I5FA 2Z6KC 3Q0AA 2K52A 4X3SA 1OXXK 4C3IB 1MBYA 3RN2A 2JA7G 2PYKA 4IUPA 4J8QA 2F0HA 5A2QL 4QJFA 1JOKA 4YHHL 4DR5Q 1V43A 2AWNA 3J80i 1BVSA 2PMZB 3HG9A 1C9OA 3IRBA 5C4ZA 2ZT9C 3CCSA 4QF4A 4QQBX 2VZAA 3CCVA 1HNXQ 2VUMG 2L9HA 3CW2C 1SE4A 1PTOC 3OMCA 2EYPA 3AB9A 3U9OA 1IKMA 2AWOA 1VQKA 3S1NH 2P5ZX 4CKEA 2BE5D 4TVAB 5ELNA 4MTNA 4YHHQ 3A54A 4IN3A 3PIPA 2V4DA 1EQVA 2HIVA 1S3OA 4FF1A 1DYQA 2F0EA 4LFAL 2A68C 1RKNA 1U0LA 5FO7B 5LL6S 1EQTA 3HKZE 2K7VA 1AFPA 1PHJA 3J81i 1RF2D 5IYBG 3OOCA 4A93G 4HN7A 4UP9A 2NN6I 3EVQA 1FVIA 3S1QH 2L4NA 1VQ6A 1A8VA 1XNQL 2EE1A 4S3SA 1L0XB 1Q12A 5ELBA 2EIFA 2ID0A 3NTHA 5C6AA 4EQPA 2NVXH 2WIIB 2RF4A 2VXWA 1XPOA 1W2BA 2XTIA 4LMQD 3GTKH 2TMPA 1R9TH 4LFAQ 2I0QA 1ZYRC 3S2HH 5JJZA 3HKSA 1TWHB 3EIVA 4HMIA 2O2LD 1YNJD 1XNQQ 1V1PB 2JA5G 3F2BA 3M4OB 2DGYA 2WP8J 4FXKC 4GNXA 4IFDG 1B9MA 5ELDA 3U50C 4DK6C 4P71A 4GLAC 3E9HA 1C4QA 2MO1A 4G4KA 4X64L 3MZ5A 2K5NA 5C0XH 3DM1A 3GO5A 3QR8A 1PRTF 3HKZG 2B8FA 4R4OA 4RH6A 5ELCA 4A3JB 2Q2TA 2O5IC 4DK0A 2CWAA 3J7ZC 2EJFC 3HOZG 2UUAL 1RL2A 2Z8LA 4DUYL 3GDEA 1VCIA 2RQXA 4NXNL 5COYA 4HTHA 4CBVA 3K81C 1WI5A 3T13A 5I2YA 3NPPA 5C4XB 2BDNA 4ID6A 4X64Q 2EYLA 4G57A 4A3DB 4KY7A 4QUFA 1EWCA 3VA7A 4BY1G 2PMZE 2OWOA 2KBNA 4CDCC 4BBSB 1SJED 1O7IA 4GN5A 3SK5A 1GM5A 4BY7H 4CGYB 2NVTB 1VQMA 4A3EH 1BKBA 4KHZA 3JAML 4DR6L 3UE1A 1LM0A 4PMCA 2UUAQ 2IHEA 1JJ2A 1EEID 4BA2I 4DUYQ 1LT3D 4X6AH 2Z0SA 1S5ED 4NXNQ 3D4DA 2ENBA 3CRKC 1EY6A 3AU7A 1B44D 1PTOD 1XTCD 1KNEA 2K5DA 3J80L 3GTQH 2NVYH 2G5DA 2CQAA 4LFCL 4DNIA 4J1MA 2TSSA 2E2HB 5GAHC 1TU2B 3CD6A 4OHJA 1MJEA 2DJFC 3URYA 4A4IA 4DR6Q 1VQHA 1SNQA 4JOIA 1PH1A 1JR0D 1IYUA 2KVMA 1NR4A 5EBDA 4RGTA 3E0EA 3W1GA 4GOPA 1TS4A 5JVH3 3T51B 3ICEA 2MPMA 3AMUA 4ZUIA 2A68D 5JEAJ 3ULLA 4B3SL 3KLSX 1BBUA 3KOJA 1ASYA 1X3EA 2B63B 3HOXH 4IPHA 1A63A 2A6ED 3OWEB 4GNXB 1LYLA 3K58A 3J7YW 4O2DA 1T5XD 4LFCQ 2JA8H 1TWGB 3ND8A 3PGZA 2FHTA 5FO9B 5CBAE 2SOBA 2KCCA 4QB4A 2X6LA 1QG7A 1VQBA 4R4QA 3BZCA 1R4PB 1I50H 1SMXA 1EIGA 4QIWB 4LF7L 3HGBA 4YWKA 1E1OA 3ZJYC 5DEHA 3GTPB 1ZYRD 1GUOA 1KAWA 3CC4A 4HCSA 4PZ8A 4DV1L 1K8GA 2UUBQ 3M7GA 1MGSA 5IGDA 3I4NB 3RMHA 3M7NA 1SN8A 5IYCG 4RWSC 3S24A 1WD0A 1WCMH 5KNBA 3T53B 4LF7Q 2QDBA 1TWAH 2WINB 1FNVA 1YIJA 3RLNA 4AIMA 2B2VC 4DV5L 5CV4A 1C48A 4JI6L 1SAPA 4JI4L 4G7ZC 2F3IA 2VB3X 4IUQA 1H9RA 3H3VI 4MHEA 3JAMc 1C0AA 2A69C 3S15H 2VW9A 1ET6A 4DV1Q 1E2VA 1ILPA 1AEXA 1TXYA 3GD7A 1JOOA 4A3MH 5IWAL 3DM3A 4QCLA 5IP9G 1STAA 4E6IA 3W5OA 1E3PA 1BQQT 1NTGA 3R2IA 2IY5B 3K5OA 4XQJA 1NNXA 1VQ5A 4JI1L 2B2YA 1HCZA 1AE3A 4DV5Q 2JE6I 3J80c 4JI6Q 4JI4Q 3GTJH 2A8VA 1X55A 3HOUH 3NWTA 3K0XA 4KD3A 4BS9A 3T4AC 2QKIC 4HJ5A 1K83H 4WJ4A 4GOPB 2JXMB 1LTRD 1SEBD 4YCVA 4XQNA 3K6OA 5IWAQ 1KTKA 4A3JG 1D2BA 1EQQA 4A3BB 2F0KA 1JQYD 4JI1Q 5J1ZA 4C3JH 4LF9L 1RTNA 2RDHA 2B8GA 2NUCA 1TWCB 3TRZA 3V05A 3L3OC 4GN3B 1VQ4A 2LSSA 3PUVA 2A74C 1IL2A 5EKIA 1CUKA 4RHRA 5C4XG 1HHVA 2XIWA 3J81c 4HCEA 2EYFA 3IFDA 1KC8C 2N49A 3CCRA 4BBSG 1PVOA 1B3AA 2PCFB 3I2ZA 3K7AB 5IOCA 2JA6H 1TS5A 2IL8A 3CMAA 1QCBD 4C3HH 5I2XA 5M3FH 4LF9Q 2NN6G 2WB1B 1SE2A 3T16A 3HOYH 4QIWE 3N52A 2MHVA 1M90C 3O13A 5M5YB 5LL6X 5IYDH 1E22A 1SDFA 1Z6HA 1CQVA 2LS01 1UWVA 1LT5D 3EROA 5IGBA 1N33L 3PO2H 1SNPA 5HGQA 3RZDH 4FF2A 4OO1H 1L1OA 1PDQA 1S4ZA 1FNUA 3IFTA 3K8AA 1OXVA 5IP7G 5C3EH 2KCTA 5C44H 1Z9FA 2ZXOA 3S1RH 3TS0A 1YZ6A 3S14H 5CR3A 4Z9CB 2B63G 1LT6D 3NWSA 2YYZA 1KRSA 3BDOA 3GTOH 1N33Q 4XYOA 1PFMA 4UDUC 4LUZA 3OYYA 2XWBB 1OO9B 1ICFB 5C0XI 1WTXA 1O78A 5JEAG 5GROA 1JE4A 1UE5A 2A69D 3I72A 1L2FA 3AQQA 1W6JA 3CAMA 4F88A 1JJGA 4XDXA 3HOVH 3ZYYX 1K28A 4ODGA 1HXYD 4GNXC 2JP1A 2UXCL 2L1BA 2B2TA 5JPNC 3S1NB 2I46A 3D6WA 3SDZA 3TN2A 4RCOA 3T56B 2UU9L 4FVMA 4KHVA 1A2TA 2AUJD 2N78A 4RFBA 4PZ7A 3TQYA 2LKVA 5M5WH 4I7ZC 5JAVA 4IOAA 2DNCA 4R4CA 3S1MH 4LF4L 3KBXA 1LO5D 5T1IA 4KKUA 4A3IH 3S1QB 1GO3E 1FJGL 1TKWB 3OMGA 2QF7A 4CKCA 4RKLA 4RGNA 5JJIA 4JVZA 2HCCA 2KOLA 2R93H 4X62L 3M3YB 2NVXB 1LUZA 3A7LA 2ALYB 2UU9Q 3OTOQ 3GTKB 3NTKA 1R9TB 5EJWA 1SROA 1WTHA 1GHKA 2B39A 2SEBD 2Z9HA 4LF4Q 1CSPA 3IAYA 1L1OB 4GZYC 1HJPA 3CRLC 1N36L 3S2HB 1DZ1A 5JJKA 2KCNA 4KTAA 4C2MH 1U9RA 4PG3A 2E2IH 2KUMA 1FJGQ 2ZTEA 1Y1VH 1EY0A 4TQUS 2CVRA 1K3RA 4A3FH 1JJCB 4X62Q 2IHFA 1NJIC 1EZ6A 1GKHA 1TWFB 2F3VA 4EQOA 4HR7B 5LMNL 1LLRD 3U58A 4JOIC 4L63B 1N36Q 3CCLA 1Y8OB 2X6GA 5E3FA 4DV4L 4GOPC 4M8AA 5A35A 1KIXA 4HJ7A 2NTTA 1K73C 4IJHA 1F2YA 5LMNW 4DF7A 3DUZA 2WAQB 1F9PA 1WFQA 2F0PA 4H7BA 1Y1WH 3FKIH 4DR2L 1LTAD 2X69A 1B53A 5C3XA 1XPUA 2RHQB 1VQEA 1SR3A 1ILQA 5LMNQ 1F9QA 4BY7B 4ZLTF 2R6GA 4A3EB 4JPBW 1FYCA 4JI8L 2PO4A 3Q24A 3G6EA 4DV4Q 4K0KL 1I4PA 1I4QA 2QILA 4IURA 3QWNA 4ILWA 3HOWG 3MFGA 3PIO3 1KQSA 1MIUA 3DEOA 3MAQA 3VR2A 3KJPA 4GKKL 2ES2A 4V0BA 1V8QA 1I4RA 2F0TA 2VB2X 4DU9A 3GTQB 3BS1A 3RZOH 3QOJA 1EY4A 2L15A 1CM9A 3BZKA 5FLXE 4OELB 1YNJC 4JI8Q 2EY1A 3NK9A 4NP5A 1E1TA 3HS0C 4RHSA 2SNMA 2PQAA 3RLOA 2DN8A 2KENA 2N3SA 3ULPA 5M3MH 3BDLA 2XGTA 2NTSA 1Y14B 1SYEA 5CV5A 4GKKQ 4ME3A 3H09A 2CHBD 2IWHA 3CCJA 3KBGA 2SNSA 1PH9A 3HOXB 4IPGA 1AE2A 1KNAA 2PZTA 1BNZA 4K6LA 1PRTD 4OWXB 1EIHA 1UNSA 2JA8B 3KLRA 5G3LD 1CK1A 2F0SA 3CCQA 4BBRH 2CWPA 1WTPA 2B2YC 3LWEA 3PF4A 5CBEE 3VR6A 1PXUA 2F03A 5FLMH 2OTLA 1PFBA 1VQCA 4A3KH 3R93A 3PV0A 2ZXRA 4ULLA 1EL0A 1LTID 1K8MA 1WOCA 1TY0A 3HRZC 2UUCL 1LACA 2F0OA 1CA5A 3V2TA 4WORA 2VS1A 1SE8A 4JI5L 3VYTA 1WVLA 2EYMA 4WJWA 4K5WA 1PYWD 1A0IA 1STBA 1BDOA 5IE8A 5CMDA 1WCMB 3I4OA 1SXTA 2EJGC 1QZGA 2PI2A 1TWAB 3SEBA 1D1IA 3PUYA 4B3TL 3EA6A 3RD4A 1BCPF 1E7ZA 1Q8IA 5FOBB 1G6PA 1QB5D 1LABA 4NKLA 2UUCQ 3QIAA 2RSOA 2WAQE 3S15B 2R3ZA 4JI5Q 1ZEQX 1LTGD 4OGQC 2K28A 1JMCA 3H0GH 1SNCA 1ENFA 1T5EA 4DV0L 1J9OA 2CCZA 1WJJA 1VQGA 2GVAA 3NE5B 3PUXA 3M4PA 1J5EL 4UHVA 4B3TQ 2K50A 3GTJB 3HOUB 2I07B 5IT9E 3S16H 1XX8A 2A6EC 1HQRD 4MIUA 3DEPA 4NB3A 2PQAB 2IT1A 5HY6A 1Q82C 1K83B 3LWUA 5KYLA 1EY5A 4OONA 2JJQA 3PO3G 3NBHA 5C0XG 4N8FA 1L1OC 2JEBI 1LTTD 1X3FA 4WFN3 2HDMA 2RHSB 2K1BA 1M8AA 3FPUB 4U68A 3UDGA 5JJLA 2F0IA 2NZOA 3GP7A 1HUMA 5DM73 1I4HA 2GA4B 4C3JB 4DN4M 4RGOS 1J5EQ 1EQRA 5I9OA 4AH6A 1IYJB 1QNUA 1H9MA 3CC2A 2OTJA 2WAQG 4HIKA 3TMEA 2Z4HA 3TREA 4CJ1B 2F3WA 5GQOA 4KK7A 2K04A 1A3VA 3KLSA 1EU4A 1D5ZC 3KK7A 1X3PA 2NWGA 2JA6B 1MHWC 4DR4L 4V190 3GQBA 2NVQH 1AH9A 2FMCA 4XT1B 4C3HB 5M3FB 3A0JA 1A15A 3HOYB 1WTRA 4B3RL 2RDGA 1BO0A 1S5DD 1QNKA 2B2TC 1XPRA 5IYBH 4HIMA 3M4YA 4CJ0B 4HJAA 1EOTA 1XXGA 4I7AA 3I91A 5E7NA 2Q8TA 3PO2B 3RZDB 4JW0A 2HT1A 1O80A 4YWMA 1QUQA 4G7HC 4IPDA 4DR4Q 1MJCA 2EZVA 5C3WA 2EY5A 4B9XA 4ZRZA 1G2TA 4HSVA 4B3RQ 5C44B 5C3EB 3WDNA 3AFPA 2A1AA 1O7ZA 2R92H 3S1RB 4J6HA 3S17H 4H13C 3S14B 4N9TA 1PH6A 3PCOB 3HOXG 1D5XC 1DM0B 3J81j 3GTOB 1E2WA 4N9PA 2JA8G 4IFDH 4HSPA 5C5LA 2CW0C 4XYQA 3T1HL 3NBHB 3EBEA 4JBWA 3E6ZX 1U4LA 5FK9C 1SSOA 3K0YA 1HNWL 2H4OA 1I3QH 2XNAC 1B70B 5EPJA 1DD2A 1JC7A 1X65A 4DR1L 4B9WA 2O5JC 1DJRD 1I94L 4C3IG 2J4XA 1EIYB 3AEVA 2EYHA 3P1HA 1RD9D 1D7QA 1HR0L 1N8RC 1IKLA 4M1UB 1P8LA 2ASBA 1BBXC 2KQ3A 2PZWA 4OXPA 4FO2A 3T1HQ 1HQMC 1PH7A 2G9HD 3T1YL 1WCMG 5IGFA 4DAYB 3SGIA 4BY1H 1GUSA 1HNWQ 2HCIA 1Y8PB 5M5WB 1GOZA 1FGUA 2EVBA 3PIP3 5GAEC 4DUZL 1HR0W 4MTKA 3Q22A 3S1MB 1XWEA 1DOMA 4LK1C 3J81L 1IYVA 5EQ0A 1PZKD 3QG1A 1I94Q 5C4JH 3BJUA 2B2UA 1OXUA 1RHPA 2M00A 1Q86C 1HR0Q 4JBKA 4DV6L 1BUVT 4B3SQ 5CV7A 4X66L 1JB3A 1VQ7A 5EPLA 4DFAA 4BA1I 4JV5L 2R93B 4JYAL 4A75A 3G4SA 1PRTB 5I6YA 3T1YQ 2NZHA 3IL8A 3S2DH 4ABNA 2K33A 1EZ8A 1N9WA 4OL7A 3FVQA 2ZTDA 1QUQB 3I8ZA 4K2KA 3TP7A 3VR3A 5KIXA 1B4OA 4LAAA 4C2MB 1EYGA 2E2IB 2JEAI 3BG3A 1Y1VB 1L0WA 1ASZA 5FJ8G 4FXDA 2PI2E 1PYSB 4DV6Q 3NHHA 4A3FB 4JV5Q 4RA8A 4K5VA 1IXRA 2J7ZA 4JYAQ 2CQOA 3I56A 1HZBA 4FP5D 2G9DA 4NPSA 2RBMA 5ELFA 4P2CB 3D0FA 1VQAA 3KFUA 4UPAA 3TZUA 4YCUA 1CZWA 3GTGH 3J7AV 2BA0A 1PV4A 4BWGB 3NSWA 2OEOA 3N6RA 1PA6A 4OWWB 2B2WA 3BU2A 4IO9A 1GUNA 5FLXL 1ZKOA 3U9SA 3BYTB 2JA6G 3F2CA 3FKIB 2QDLA 1VS0A 2A6HC 4C3HG 1VQIA 4TRDA 4BXXH 2EOTA 5CC4A 1EYAA 1WYDA 4CDEC 5IYDG 1E0BA 2CW0D 1D1KA 2RVLA 3GV6A 4HIDA 2ATWA 4N8X1 1IBLL 3A55A 3OPOA 3K57A 4DNRB 2B3GA 1GHJA 1AZPA 4FYDA 3RLFA 5J22A 4A3DG 3I55A 3FMCA 5EPKA 1NCVA 4RGMA 1IBML 1UEBA 2EY6A 2BOSA 2HQEA 1PTOF 3MC0B 3RZOB 1L0YB 4JI2L 4POGA 4A3GH 5C44G 5AJ3L 1VQDA 4UY8C 1E2ZA 2D0OA 2YU9B 2F1MA 3JC66 3SVMA 1IW7C 2ICEC 3UE0A 1TS3A 5M3MB 3MXGA 1IBLQ 3CC7A 1FR3A 2QEJC 2F0GA 2AKWB 3J7AF 1VQ8A 1RCVD 1C7YA 1K9MC 1SJHD 3D4RA 2ZJPA 4K2LA 1CKOA 2IJ0A 5BN3A 3NELA 1IBMQ 3LGJA 3W1BA 1ZXTA 2D9UA 3STBC 4DV3L 3DWPA 2KHIA 3CP0A 1IBKL 1B8AA 4MN3A 4JI2Q 1WTOA 4EGVA 5AJ3Q 1O7YA 4IUUA 4RCNA 4BBRB 1YI2A 2VY3A 3L2PA 4QMGA 1VQFA 2KA7A 2V1CC 3AFQA 3KF6A 5EKLA 3DMUA 2IW3A 4A3KB 1DONA 2UXDL 4NDXA 3D3RA 4A3LH 1N32L 2QCPX 1EU3A 2F4VL 4DV3Q 5CYUA 1CT1D 4APVA 1IBKQ 1YNND 1SRUA 2KECA 4A3CH 2Q2HA 1H9SA 3E5SA 2F0QA 1GD7A 3FHWA 3TP6A 1CI3M 2E5LL 3WWVA 1SMYD 5FLXc 4DA2A 1SLJA 1QVCA 3D6CA 3NP8A 2KEEA 2R7ZH 4LUVA 1MSHA 1EY9A 4AYBB 3E3XA 1H95A 2E2JH 1EYDA 1S72A 2UXDQ 2RCNA 2R93G 3L7ZC 4JBJA 4IUNA 1JORA 1A62A 4KLKA 1N32Q 2CH4A 1KDAA 1YITA 3R2TA 2VQEL 2K4KA 1W6KA 1XMOL 1NE3A 2VNUD 3I4NG 1F2LA 4EQNA 1B2TA 3H0GB 3OHXC 3GTMH 1PYBA 3MFYA 1G6ZA 5M5XH 4JC0A 2WKDA 2XSCA 4KHPL 1HFNA 3I4MH 2A6HD 3S16B 2D2CC 4RKBA 5EAYA 2DUDA 2EYJA 1PRTC 3UDXA 1PH3A 1RJTA 2UXCQ 3CQZH 3G48A 4PV1C 3DLLA 1G291 4LF5L 1VF5C 2VQEQ 3L0OA 2M9VA 1Q7YC 3CCEA 1HUNA 2VQFL 1EIFA 1X32A 4LUOA 3KDFA 1SYFA 5KRUA 2JSOA 5JEAH 1JCKB 1K8OA 3J80E 1QVFA 1FGBD 1GJXA 5KNCA 4PMBA 4KHPQ 1G51A 1WTQA 2WB1E 1X3GA 2N55A 4LW1A 2M2LA 3CPFA 3C2PA 1SNOA 3VR4A 4GLXA 2XWJB 3KF6B 5C0XJ 4KKSA 1JICA 4JI3L 1JT8A 2HD3A 1SFOH 4LF5Q 3GTLH 1M4VA 1IW7D 4Y7NH 2VQFQ 3TP8A 3ND9A 1EUJA 1XNRL 3MXNA 4A3BG 2DNEA 1KABA 5JPMC 3K5MA 3WOFA 4ZKCB 5D3IB 2NVQB 3UI2A 1YEZA 4KI0A 5K36H 1BCPD 1H9SB 3ERSX 3Q6SA 3STBD 4HEDA 1KDBA 1PZJD 4ZCKA 4L5RC 2HIXA 2O4XA 5KYIA 4X3TA 1Y8NB 3NQTA 1YJWA 5IGEA 4MZ9A 4JI3Q 5IT9c 1D6EC 3UDFA 2QW7A 3DWQA 1G91A 1CSQA 1II3A 4L5QA 4WRDA 1XNRQ 2F0FA 4AQYL 1CFMA 1XJVA 2F0VA 1DXMA 3U4VA 2WB1G 4KJNA 5IGGA 4JI0L 4DR7L 3B6YA 2UXBL 4QL5A 2B2UC 2R92B 3KJOA 4NW2A 4AYBE 3S17B 1CHPD 5KGUA 1I4GA 4IJLA 1M1KC 4ZUJA 2RSNA 3TEHB 3LNNA 4K8JA 3V96A 1KL9A 1EOVA 3MXUA 4BBRG 3G6JB 4DR2Q 2NVYB 2KJXA 5D14A 4WJ3M 2R61A 4JI0Q 4DR7Q 2XRQD 4JG2A 5CV9A 5FLMG 1I3QB 1H9KA 3ITPA 3KDFB 1SYGA 4P74A 3A8IE 3SR1A 4DK1A 2UXBQ 4UP8A 4A3KG 1VQPA 1JB7A 4K0KQ 1PMRA 1LTLA 5CORA 1GUTA 3W2DA 2K75A 4TKOB 2H1EA 1MKHA 1V1OA 1CQFA 1EFWA 2JN4A 2PNRC 4YIJA 1TR5A 1UUPA 1EWIA 1A3UA 1LT4D 3D31A 5GADC 2JA9A 1Q8KA 2WV6D 1HNZL 1SYBA 1YJ9A 2EYOA 4BY1B 1T9HA 3MXNB 1BBWA 4HAEA 2K14A 4AYBG 2YV5A 1MD2D 4CHTB 3I7FA 1I50B 2K01A 1NSNS 2BH2A 3H3VH 4IUVA 5C4JB 4C1NK 2B2WC 1Q81C 1JWSD 4R9WA 2XVSA 5DLQE 4P75A 1XMQL 3HOWH 3Q23A 2ICIA 1KLGD 1YHBA 3H0GG 5LHY1 2IPKD 4GN4B 4DR5L 2AMCB 1K3BC 1PFSA 2FINB 3OWFA 4IPCA 3S2DB 2Y0SB 2E8GA 3E0JA 2IX3A 3HFZB 4A76A 1VQNA 1TY2A 2JYOA 2LMCB 2QA4A 1HNXL 3MEFA 3NXWA 2OQ0A 5DAUA 2EJMA 3SHLA 4F8MA 1IHZA 2GVBA 5HGTA 3H91A 1XMQQ 2B29A 4F87A 2RA4A 3P7JA 1BXTA 2E74C 1WD1A 2MUYA 3BVGA 1XYIA 2K05A 5CV8A 2HQLA 2Z4IA 1NAPA 4PNYA 4R4IA 2EQSA 1OTCA 4OO1I 2EXDA 4DV2L 4A3MB 1HRJA 1A3TA 1AW7A 2VL6A 1ENAA 1CKNA 3K7UC 1A6XA 4NMZA 2Q8RE 1TQOA 2WFWA 3P75A 4U673 3GTGB 2MQHA 2PZUA 1E24A 4R8IA 1NY4A 1K0SA 3AYHB 2K03A 4LWCA 1BF4A 4H02A 1PH8A 5D65A 2KEDA 1N34L 3UDIA 1HZCA 4JCVE 1J8IA 3ER0A 1GVPA 1PTOH 2R7DA 4JK1C 1U4PA 3BVZA 1UE6A 2JA7H 2BH8A 5E4XA 4DV2Q 3EQLC 4KN7C 1Q46A 3BDCA 3U4ZA 1VQ9A 3KF8A 3DWAA 3H94A 4DV0Q 5FO8B 3OW7A 1CKMA 2EDGA 4P73A 5I6WA 3PSIA 2VUMH 5TSSA 3M4QA 1N34Q 1EY8A 3SK4A 5KEEA 1NUCA 2A19A 3M3YH 2E75C 2A5HA 4DAYA 4RMFA 4LNQA 3TSSA 4BY7G 4A3EG 3CMEA 4A3GB 4K6DA 3MWYW 1NR2A 3TDQA 2R92G 3D8GA 3HEJA 3F2DA 4TSSA 3GV3A 4XQQA 4KJOA 1CHQD 4A93H 1YJNA 4K14A 3FPPA 1CTMA 2BDOA 2EY2A 2RKSA 1ONLA 1H9JA 5FKAC 2OF1A 3PO3H 3TBIB 4CJ2C 3I73A 1Q1EA 5ISRA 3NQIA 1TWFH 2KHJA 1F2MA 4PQXA 5ELEA 2Y0SE 3L9AX 4DPGA 5G3LF 1J6QA 1TIID 3MXPA 2KCMA 3I3CA 1BCPB 1XTDA 1EY7A 4RG1A 1EYCA 2NB0A 2PNHA 1CKNB 1VMCA 1I6VC 2MO0A 1TVXA 4ZQ3A 5EBCA 4O1NA 2FMMA 1GUWA 2JA5H 2F0DA 4DR3L 1CA6A 1YHQA 3CCMA 3A74A 1G2SA 2L12A 1BOSA 2JK8A 3CCUA 1JOQA 2E2DC 4ME5A 1UEAB 3PMFA 3SK8A 3KF8B 3HOVB 4L5TA 5I9PA 2R7ZB 1FNWA 1S5BD 4HIOA 1DOKA 2E2JB 1QOHA 1X54A 4IZ8A 3QO2A 1PH5A 1B3QA 3A8KE 3CXCA 1EWHA 3HOZH 1KRTA 4DR3Q 3F1ZA 2NBFA 1EFID 3I4LA 5DM63 2Y0SG 1HPCA 2F0NA 3NBIA 3K5LA 3MA2B 3CHBD 4DNTB 1VQLA 3GTMB 3HP3A 1F2ZA 3I70A 5M5XB 1YNXA 3X3NA 1KXLA 1F77A 1LTBD 3A7AB 1NBWA 2HHHL 1RIPA 2NZ1D 3G7LA 3Q8DA 2N88A 2RCFA 3I4MB 1B7YB 4DR1Q 4A3IB 2J0TD 2AQ3B 2K5WA 3BYYB 3CQZB 4GLVB 1TT2A
chains in the Genus database with same CATH topology
5LMNW 1VQFA 1I6HH 2V1CC 1U0LA 3AFQA 3FP9A 3KF6A 1WFQA 3HKZE 4P72A 1V1QA 1PHJA 3J81i 1Y1WH 5IYBG 4A3MG 2UUBL 4A93G 3FKIH 4UP9A 2NN6I 4DR2L 1S40A 1FVIA 3S1QH 1VQ6A 1A8VA 1XPUA 1XNQL 2RHQB 1VQEA 1SR3A 2UXDL 5LMNQ 1Q12A 3NEMA 2EIFA 3HOUH 2ID0A 2AHOB 2R6GA 4DUZQ 4JI8L 4A3LH 1N32L 2Q2IA 2NVXH 3G6EA 4DV4Q 2HHHQ 2RF4A 2F4VL 3HOUG 4K0KL 4DV3Q 4APVA 2F52A 1XPOA 1IBKQ 1W2BA 2XTIA 1SRUA 3GTKH 4A3CH 2Q2HA 2ZJRA 1R9TH 3FHWA 1GD7A 3HOWG 3VDYA 1KQSA 1MIUA 4LFAQ 4C3IH 4R1JA 3KJPA 1HZ9A 1X6OA 2OQKA 3WWVA 2E5LL 5FLXc 2I0QA 4X66Q 4GKKL 2ES2A 1SLJA 3S2HH 1QVCA 3HKSA 4YWLA 4O0AA 2R7ZH 4LUVA 4BXXG 3EIVA 4QY7A 1H95A 2E2JH 1XNQQ 3RZOH 2L15A 1S72A 3F2BA 1Q1BA 2RCNA 2JA5G 2R93G 3BZKA 2UXDQ 2DGYA 2WP8J 3L7ZC 4JBJA 4GNXA 4IFDG 1A62A 4KLKA 4JI8Q 1N32Q 3U50C 1YITA 1K8AC 4DK6C 1E1TA 4P71A 3ULJA 4GLAC 2VQEL 3E9HA 2K4KA 2PQAA 3RLOA 2MO1A 1XMOL 4X64L 1NE3A 2VNUD 2KENA 3I4NG 4LF6L 2K5NA 2N3SA 3ULPA 5M3MH 3GTMH 2XGTA 3GO5A 1PYBA 1Y14B 3HKZG 4R4OA 5M5XH 4JBMA 4JC0A 4GKKQ 4ME3A 1PH9A 2Q2TA 3CCJA 4KHPL 4IPGA 1AE2A 2CWAA 3J7ZC 4PMWA 1W3SA 4OWXB 3I4MH 4A3GG 2MNAA 3HOZG 1Z47A 2UUAL 1RL2A 5EAYA 2DUDA 3UDXA 3RN5A 1PH3A 4DUYL 3GDEA 2UXCQ 1VCIA 3CCQA 3CQZH 4BBRH 3G48A 2CWPA 4NXNL 5M3FG 3DLLA 3HOYG 1FL0A 1G291 3EN2A 3G71A 3K81C 1WI5A 4R4TA 4LF5L 2VQEQ 2ZTCA 3PF4A 3L0OA 1Q7YC 3CCEA 4X64Q 1VQOA 5IYCH 5FLMH 2OTLA 2VQFL 1VQCA 4LF6Q 2N8NA 1EIFA 4LUOA 4BY1G 3KDFA 4A3KH 1HZAA 3PV0A 2PMZE 2OWOA 2D62A 2KBNA 1O7IA 4GN5A 1GM5A 2Z6KA 5FJ8H 1PH2A 1WOCA 1QVFA 4BY7H 1VQMA 4A3EH 1BKBA 4KHZA 4EX5A 2UUCL 3PO2G 4KHPQ 4DR6L 1G51A 3UE1A 2LXJA 1LM0A 2D0PA 2WB1E 1X3GA 4LW1A 1K0RA 3CPFA 2UUAQ 2VS1A 1SE8A 2IHEA 4JI5L 1JJ2A 4BA2I 4OO1G 4GLXA 3KF6B 4DUYQ 5C0XJ 2I5LX 1OXTA 2Z0SA 4X6AH 4JI3L 1JT8A 4NXNQ 1A0IA 1SFOH 5IE8A 4LF5Q 5C3EG 3I4OA 5IP9H 1IZ6A 3GTLH 1QZGA 2PI2A 4Y7NH 2VQFQ 3PUYA 1EUJA 1XNRL 4B3TL 3GTQH 2NVYH 1TWHH 4QGUA 4A3BG 4LFCL 4DNIA 1E7ZA 1G6PA 4YY3L 5GAHC 4A3LG 3M4OH 3CD6A 3OW2A 1MJEA 4UP7A 1VQJA 4A4IA 1YEZA 1UE7A 4KI0A 2UUCQ 4DR6Q 3ERSX 4A3CG 2WAQE 3STBD 4L5RC 1VQHA 4JOIA 4JI5Q 1PH1A 2HIXA 1P16A 1YJWA 2I5HA 3E0EA 3W1GA 3A5ZB 4GOPA 4MZ9A 3H0GH 2FXQA 5IT9c 1JMCA 4JI3Q 3ICEA 3UDFA 4DV0L 5JEAJ 3ULLA 4B3SL 3KOJA 1BBUA 4A3JH 2CCZA 3HOVG 2QEXA 4Y52H 1WJJA 1VQGA 2R7ZG 2GVAA 1ASYA 1X3EA 3PUXA 1CSQA 3HOXH 4IPHA 1YHAA 3M4PA 4L5QA 1A63A 1XNRQ 4GNXB 1LYLA 1J5EL 4B3TQ 2K50A 4AQYL 4O2DA 4LFCQ 3RNUA 2JA8H 3S16H 4YY3Q 1XJVA 3PGZA 4NB3A 2PQAB 3M85A 2IT1A 3U4VA 5HY6A 2WB1G 1Q82C 4JI0L 4DR7L 3B6YA 4DKAC 4OONA 2JJQA 1VQBA 4R4QA 3PO3G 2UXBL 3BZCA 5C0XG 1I50H 5C4XH 1SMXA 4QL5A 4LF7L 4A3DH 1L1OC 2JEBI 4YWKA 2OCEA 5IY0A 3KJOA 4AYBE 1X3FA 4XIGS 1E1OA 2RHSB 3ZJYC 2ZM6L 1QZHA 4JI7L 4BBSH 4IJLA 1M1KC 3UDGA 5JJLA 2NVTH 2CKZB 4FDBA 2NZOA 2R7FA 1KAWA 3I4MG 3TEHB 3CC4A 3K80C 4PZ8A 2I5MX 3PIOA 1J5EQ 4A3IG 1YVCA 4DV1L 1EQRA 1KL9A 4HJ9A 4AH6A 3A5UA 1EOVA 1IYJB 1K8GA 3PUZA 4BBRG 2UUBQ 4DR2Q 3CC2A 2OTJA 1V9PA 2WAQG 4HIKA 4WJ3M 1QVGA 4JI0Q 3TS2A 4DR7Q 3M7NA 4JG2A 1SN8A 5IYCG 5FLMG 3S24A 3E9IA 1WCMH 3TREA 2IX0A 3KDFB 4GKJL 4P74A 2UXBQ 1OXSC 1KD1C 4UP8A 4A3KG 5GQOA 1VQPA 1JB7A 4LF7Q 1TWAH 4K0KQ 2F4VQ 1YIJA 3RLNA 1LTLA 4AIMA 4DV5L 4JI6L 4JI4L 3F8TA 2F3IA 2ZM6Q 2K75A 4JI7Q 2E2HH 3H3VI 1MKHA 4DR4L 4MNOA 1EFWA 2NVQH 3JAMc 1AH9A 2ZJQA 4XTCS 2E5LQ 1C0AA 3A0JA 3S15H 2VW9A 4DV1Q 3NENA 1EWIA 4B3RL 2IX1A 1Y1VG 1TXYA 3D31A 3GD7A 5GADC 2JA9A 1Q8KA 5IP7H 4DV7L 1XPRA 5IYBH 4A3MH 1HNZL 5IWAL 3DM3A 4HIMA 5IP9G 1YJ9A 1JE5A 3W5OA 4A3FG 3J7A5 1E3PA 1NTGA 2YTVA 2IY5B 1T9HA 4GKJQ 3MXNB 1BBWA 2K14A 1VQ5A 2B63H 2C35B 4JI1L 1KHIA 2YV5A 4AYBG 4HJAA 1AE3A 4DV5Q 2JE6I 3I7FA 3J80c 5E7NA 4JI4Q 4JI6Q 4IFDI 3GTJH 2A8VA 1X55A 3OTOL 1XMOQ 2HT1A 2BH2A 4YWMA 1TWGH 1QUQA 1X9NA 3H3VH 3K0XA 2QGQA 4IPDA 4DR4Q 5K36G 1MJCA 1Q81C 5DLQE 4HJ5A 4P75A 1XMQL 1K83H 3HOWH 4WJ4A 4GOPB 5BR8L 3RR5A 4B3RQ 4PZ6A 4LFAL 1NMFA 1YHBA 3H0GG 2JQOA 3AFPA 4GN4B 4DR5L 2A1AA 4DV7Q 2R92H 4YCVA 2AMCB 1PFSA 5IWAQ 3S17H 4A3JG 4IPCA 1PH6A 1EQQA 2YTYA 2E8GA 3PCOB 3HOXG 3GTPH 3HFZB 5GAGC 4A76A 3J81j 1VQNA 4JI1Q 2QA4A 4DAMA 1HNXL 2JA8G 3MEFA 1Y1WG 4C3JH 4LF9L 2OQ0A 3FKIG 3TRZA 4GN3B 1VQ4A 3T1HL 2GVBA 2LSSA 3PUVA 1IL2A 3NBHB 3EBEA 4OWTB 3I4NH 1CUKA 4JBWA 1XMQQ 2B29A 5C4XG 1HNWL 1I3QH 5BR8Q 3J81c 2H5XA 1B70B 4OX9L 1KC8C 2N49A 3CCRA 4BBSG 1PVOA 1X65A 2HQLA 3I2ZA 4DR1L 2GN5A 4R4IA 1I94L 2JA6H 1EIYB 2EQSA 4NXML 1OTCA 3AEVA 2EXDA 4DV2L 4OO1I 1D7QA 1NMGA 2VL6A 1HR0L 1N8RC 1CKNA 3CMAA 4C3HH 5M3FH 4LF9Q 2NN6G 1P8LA 3PF5A 2ASBA 3K7UC 3HOYH 4QIWE 4EQ5A 5LMUL 4LF8L 2WFWA 4OXPA 3T1HQ 2MQHA 1PH7A 1M90C 1E24A 1NY4A 3T1YL 1WCMG 3AYHB 4LWCA 5IYDH 4DAYB 4H02A 3SGIA 1PH8A 4BY1H 1HNWQ 1N34L 1E22A 3UDIA 1FGUA 3CPWA 1HZCA 4ALPA 1UWVA 5GAEC 4DUZL 1HR0W 4JCVE 1UE1A 3ER0A 1GVPA 2R7DA 2K5HA 4OX9Q 1N33L 4IFDJ 4X65L 3PO2H 5M3MG 1UE6A 5HGQA 3RZDH 2JA7H 2BH8A 1I94Q 1HH2P 5C4JH 4NXMQ 3BJUA 4DV2Q 1OXUA 4L5SA 1L1OA 1Q46A 3U4ZA 1Q86C 1VQ9A 1HR0Q 4JBKA 4DV6L 4DV0Q 4B3SQ 4X66L 1VQ7A 3K8AA 2Q2UA 1OXVA 1CKMA 4BA1I 5IP7G 4JV5L 2MFIA 2KCTA 5C3EH 4P73A 5C44H 5LMUQ 4LF8Q 4JYAL 4GS3A 4LFBL 4A75A 1Z9FA 3G4SA 3M9BA 3S1RH 3TS0A 3T1YQ 2NZHA 4AQYQ 1YZ6A 3PSIA 1X56A 2VUMH 3S14H 3S2DH 3M4QA 1N34Q 2B63G 4A3BH 2YYZA 1N9WA 1KRSA 3GTOH 2A19A 1QUQB 2ZTDA 1DGSA 3M3YH 1N33Q 4HJ8A 4X65Q 2BA1A 4LUZA 3OYYA 4DK3C 1TWCH 4RMFA 4LNQA 1EYGA 5C0XI 2CFMA 2JEAI 5JEAG 3PUWA 1L0WA 1ASZA 5FJ8G 3KLWA 5GROA 4BY7G 2PI2E 1PYSB 4DV6Q 4A3EG 3CMEA 1UE5A 4B3ML 1L2FA 3AQQA 3CAMA 1JJGA 4JV5Q 2R92G 3HOVH 1IXRA 4JYAQ 3F2DA 4LFBQ 2CQOA 3I56A 4YCWA 1HZBA 1D8LA 2K5VA 3K7AH 4GNXC 4IOCA 2UXCL 4NPSA 4A93H 1YJNA 5H1SE 2YU9H 2LXKA 3D0FA 1VQAA 4IJHA 4UPAA 3KFUA 4YCUA 3PO3H 3GTGH 3CF5A 1Q1EA 2BA0A 5M5YH 1TWFH 1PV4A 2UU9L 2KHJA 4QQBX 2YTXA 2Y0SE 2N78A 4PZ7A 3TQYA 1U5KA 4DPGA 1PA6A 4B3MQ 5M5WH 4OWWB 1J6QA 4IOAA 3BU2A 4R4CA 4J15A 2KCMA 3S1MH 4LF4L 4IO9A 1XTDA 4POFA 2JA6G 4RG1A 3F2CA 3H15A 2PNHA 4A3IH 1CKNB 1VS0A 1GO3E 1PH4A 1FJGL 1HNZQ 1VQIA 2MO0A 5ELOA 4BXXH 5J3BA 5JJIA 2JA5H 3KYHC 2R93H 4X62L 4DR3L 3JAMi 1WYDA 1YHQA 5IYDG 1LUZA 1YBYA 2ALYB 2UU9Q 3CCMA 3A74A 3OTOQ 1I5FA 2Z6KC 4HIDA 2ATWA 1SROA 2JK8A 1IBLL 2K52A 2B3GA 1OXXK 3CCUA 4LF4Q 3RN2A 2JA7G 3RLFA 1CSPA 4A3DG 3I55A 1L1OB 1HJPA 1N36L 4QJFA 3KF8B 4YHHL 1IBML 5JJKA 1UEBA 4L5TA 4C2MH 4DR5Q 2E2IH 4PG3A 1V43A 4HIOA 1FJGQ 2ZTEA 1Y1VH 2AWNA 3J80i 1BVSA 1PH5A 1X54A 4JI2L 4POGA 4A3GH 1C9OA 3IRBA 5C44G 5AJ3L 4TQUS 3CXCA 3HOZH 1KRTA 1K3RA 1VQDA 3CCSA 4A3FH 4UY8C 1JJCB 4X62Q 2D0OA 2IHFA 2VZAA 3F1ZA 3CCVA 4DR3Q 1HNXQ 1NJIC 2VUMG 2Y0SG 3CW2C 3JC66 3UE0A 1GKHA 1IBLQ 3CC7A 1VQLA 2AWOA 1VQKA 3S1NH 2AKWB 5LMNL 1YNXA 1VQ8A 4TVAB 5ELNA 1KXLA 3U58A 4JOIC 4MTNA 1C7YA 1N36Q 1K9MC 3CCLA 1IBMQ 4YHHQ 2ZJPA 1CKOA 3NELA 3LGJA 3W1BA 1NBWA 3PIPA 1RIPA 3Q8DA 3STBC 4DV3L 4DV4L 4GOPC 2HHHL 1B7YB 2HIVA 2KHIA 1B8AA 3CP0A 1KIXA 4DR1Q 4JI2Q 1IBKL 4HJ7A 1S3OA 5AJ3Q 1K73C 1YI2A 4GLVB 2VY3A 3L2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN W;  1VQF A;  1I6H H;  2V1C C;  1U0L A;  3AFQ A;  3FP9 A;  3KF6 A;  1WFQ A;  3HKZ E;  4P72 A;  1V1Q A;  1PHJ A;  3J81 i;  1Y1W H;  5IYB G;  4A3M G;  2UUB L;  4A93 G;  3FKI H;  4UP9 A;  2NN6 I;  4DR2 L;  1S40 A;  1FVI A;  3S1Q H;  1VQ6 A;  1A8V A;  1XPU A;  1XNQ L;  2RHQ B;  1VQE A;  1SR3 A;  2UXD L;  5LMN Q;  1Q12 A;  3NEM A;  2EIF A;  3HOU H;  2ID0 A;  2AHO B;  2R6G A;  4DUZ Q;  4JI8 L;  4A3L H;  1N32 L;  2Q2I A;  2NVX H;  3G6E A;  4DV4 Q;  2HHH Q;  2RF4 A;  2F4V L;  3HOU G;  4K0K L;  4DV3 Q;  4APV A;  2F52 A;  1XPO A;  1IBK Q;  1W2B A;  2XTI A;  1SRU A;  3GTK H;  4A3C H;  2Q2H A;  2ZJR A;  1R9T H;  3FHW A;  1GD7 A;  3HOW G;  3VDY A;  1KQS A;  1MIU A;  4LFA Q;  4C3I H;  4R1J A;  3KJP A;  1HZ9 A;  1X6O A;  2OQK A;  3WWV A;  2E5L L;  5FLX c;  2I0Q A;  4X66 Q;  4GKK L;  2ES2 A;  1SLJ A;  3S2H H;  1QVC A;  3HKS A;  4YWL A;  4O0A A;  2R7Z H;  4LUV A;  4BXX G;  3EIV A;  4QY7 A;  1H95 A;  2E2J H;  1XNQ Q;  3RZO H;  2L15 A;  1S72 A;  3F2B A;  1Q1B A;  2RCN A;  2JA5 G;  2R93 G;  3BZK A;  2UXD Q;  2DGY A;  2WP8 J;  3L7Z C;  4JBJ A;  4GNX A;  4IFD G;  1A62 A;  4KLK A;  4JI8 Q;  1N32 Q;  3U50 C;  1YIT A;  1K8A C;  4DK6 C;  1E1T A;  4P71 A;  3ULJ A;  4GLA C;  2VQE L;  3E9H A;  2K4K A;  2PQA A;  3RLO A;  2MO1 A;  1XMO L;  4X64 L;  1NE3 A;  2VNU D;  2KEN A;  3I4N G;  4LF6 L;  2K5N A;  2N3S A;  3ULP A;  5M3M H;  3GTM H;  2XGT A;  3GO5 A;  1PYB A;  1Y14 B;  3HKZ G;  4R4O A;  5M5X H;  4JBM A;  4JC0 A;  4GKK Q;  4ME3 A;  1PH9 A;  2Q2T A;  3CCJ A;  4KHP L;  4IPG A;  1AE2 A;  2CWA A;  3J7Z C;  4PMW A;  1W3S A;  4OWX B;  3I4M H;  4A3G G;  2MNA A;  3HOZ G;  1Z47 A;  2UUA L;  1RL2 A;  5EAY A;  2DUD A;  3UDX A;  3RN5 A;  1PH3 A;  4DUY L;  3GDE A;  2UXC Q;  1VCI A;  3CCQ A;  3CQZ H;  4BBR H;  3G48 A;  2CWP A;  4NXN L;  5M3F G;  3DLL A;  3HOY G;  1FL0 A;  1G29 1;  3EN2 A;  3G71 A;  3K81 C;  1WI5 A;  4R4T A;  4LF5 L;  2VQE Q;  2ZTC A;  3PF4 A;  3L0O A;  1Q7Y C;  3CCE A;  4X64 Q;  1VQO A;  5IYC H;  5FLM H;  2OTL A;  2VQF L;  1VQC A;  4LF6 Q;  2N8N A;  1EIF A;  4LUO A;  4BY1 G;  3KDF A;  4A3K H;  1HZA A;  3PV0 A;  2PMZ E;  2OWO A;  2D62 A;  2KBN A;  1O7I A;  4GN5 A;  1GM5 A;  2Z6K A;  5FJ8 H;  1PH2 A;  1WOC A;  1QVF A;  4BY7 H;  1VQM A;  4A3E H;  1BKB A;  4KHZ A;  4EX5 A;  2UUC L;  3PO2 G;  4KHP Q;  4DR6 L;  1G51 A;  3UE1 A;  2LXJ A;  1LM0 A;  2D0P A;  2WB1 E;  1X3G A;  4LW1 A;  1K0R A;  3CPF A;  2UUA Q;  2VS1 A;  1SE8 A;  2IHE A;  4JI5 L;  1JJ2 A;  4BA2 I;  4OO1 G;  4GLX A;  3KF6 B;  4DUY Q;  5C0X J;  2I5L X;  1OXT A;  2Z0S A;  4X6A H;  4JI3 L;  1JT8 A;  4NXN Q;  1A0I A;  1SFO H;  5IE8 A;  4LF5 Q;  5C3E G;  3I4O A;  5IP9 H;  1IZ6 A;  3GTL H;  1QZG A;  2PI2 A;  4Y7N H;  2VQF Q;  3PUY A;  1EUJ A;  1XNR L;  4B3T L;  3GTQ H;  2NVY H;  1TWH H;  4QGU A;  4A3B G;  4LFC L;  4DNI A;  1E7Z A;  1G6P A;  4YY3 L;  5GAH C;  4A3L G;  3M4O H;  3CD6 A;  3OW2 A;  1MJE A;  4UP7 A;  1VQJ A;  4A4I A;  1YEZ A;  1UE7 A;  4KI0 A;  2UUC Q;  4DR6 Q;  3ERS X;  4A3C G;  2WAQ E;  3STB D;  4L5R C;  1VQH A;  4JOI A;  4JI5 Q;  1PH1 A;  2HIX A;  1P16 A;  1YJW A;  2I5H A;  3E0E A;  3W1G A;  3A5Z B;  4GOP A;  4MZ9 A;  3H0G H;  2FXQ A;  5IT9 c;  1JMC A;  4JI3 Q;  3ICE A;  3UDF A;  4DV0 L;  5JEA J;  3ULL A;  4B3S L;  3KOJ A;  1BBU A;  4A3J H;  2CCZ A;  3HOV G;  2QEX A;  4Y52 H;  1WJJ A;  1VQG A;  2R7Z G;  2GVA A;  1ASY A;  1X3E A;  3PUX A;  1CSQ A;  3HOX H;  4IPH A;  1YHA A;  3M4P A;  4L5Q A;  1A63 A;  1XNR Q;  4GNX B;  1LYL A;  1J5E L;  4B3T Q;  2K50 A;  4AQY L;  4O2D A;  4LFC Q;  3RNU A;  2JA8 H;  3S16 H;  4YY3 Q;  1XJV A;  3PGZ A;  4NB3 A;  2PQA B;  3M85 A;  2IT1 A;  3U4V A;  5HY6 A;  2WB1 G;  1Q82 C;  4JI0 L;  4DR7 L;  3B6Y A;  4DKA C;  4OON A;  2JJQ A;  1VQB A;  4R4Q A;  3PO3 G;  2UXB L;  3BZC A;  5C0X G;  1I50 H;  5C4X H;  1SMX A;  4QL5 A;  4LF7 L;  4A3D H;  1L1O C;  2JEB I;  4YWK A;  2OCE A;  5IY0 A;  3KJO A;  4AYB E;  1X3F A;  4XIG S;  1E1O A;  2RHS B;  3ZJY C;  2ZM6 L;  1QZH A;  4JI7 L;  4BBS H;  4IJL A;  1M1K C;  3UDG A;  5JJL A;  2NVT H;  2CKZ B;  4FDB A;  2NZO A;  2R7F A;  1KAW A;  3I4M G;  3TEH B;  3CC4 A;  3K80 C;  4PZ8 A;  2I5M X;  3PIO A;  1J5E Q;  4A3I G;  1YVC A;  4DV1 L;  1EQR A;  1KL9 A;  4HJ9 A;  4AH6 A;  3A5U A;  1EOV A;  1IYJ B;  1K8G A;  3PUZ A;  4BBR G;  2UUB Q;  4DR2 Q;  3CC2 A;  2OTJ A;  1V9P A;  2WAQ G;  4HIK A;  4WJ3 M;  1QVG A;  4JI0 Q;  3TS2 A;  4DR7 Q;  3M7N A;  4JG2 A;  1SN8 A;  5IYC G;  5FLM G;  3S24 A;  3E9I A;  1WCM H;  3TRE A;  2IX0 A;  3KDF B;  4GKJ L;  4P74 A;  2UXB Q;  1OXS C;  1KD1 C;  4UP8 A;  4A3K G;  5GQO A;  1VQP A;  1JB7 A;  4LF7 Q;  1TWA H;  4K0K Q;  2F4V Q;  1YIJ A;  3RLN A;  1LTL A;  4AIM A;  4DV5 L;  4JI6 L;  4JI4 L;  3F8T A;  2F3I A;  2ZM6 Q;  2K75 A;  4JI7 Q;  2E2H H;  3H3V I;  1MKH A;  4DR4 L;  4MNO A;  1EFW A;  2NVQ H;  3JAM c;  1AH9 A;  2ZJQ A;  4XTC S;  2E5L Q;  1C0A A;  3A0J A;  3S15 H;  2VW9 A;  4DV1 Q;  3NEN A;  1EWI A;  4B3R L;  2IX1 A;  1Y1V G;  1TXY A;  3D31 A;  3GD7 A;  5GAD C;  2JA9 A;  1Q8K A;  5IP7 H;  4DV7 L;  1XPR A;  5IYB H;  4A3M H;  1HNZ L;  5IWA L;  3DM3 A;  4HIM A;  5IP9 G;  1YJ9 A;  1JE5 A;  3W5O A;  4A3F G;  3J7A 5;  1E3P A;  1NTG A;  2YTV A;  2IY5 B;  1T9H A;  4GKJ Q;  3MXN B;  1BBW A;  2K14 A;  1VQ5 A;  2B63 H;  2C35 B;  4JI1 L;  1KHI A;  2YV5 A;  4AYB G;  4HJA A;  1AE3 A;  4DV5 Q;  2JE6 I;  3I7F A;  3J80 c;  5E7N A;  4JI4 Q;  4JI6 Q;  4IFD I;  3GTJ H;  2A8V A;  1X55 A;  3OTO L;  1XMO Q;  2HT1 A;  2BH2 A;  4YWM A;  1TWG H;  1QUQ A;  1X9N A;  3H3V H;  3K0X A;  2QGQ A;  4IPD A;  4DR4 Q;  5K36 G;  1MJC A;  1Q81 C;  5DLQ E;  4HJ5 A;  4P75 A;  1XMQ L;  1K83 H;  3HOW H;  4WJ4 A;  4GOP B;  5BR8 L;  3RR5 A;  4B3R Q;  4PZ6 A;  4LFA L;  1NMF A;  1YHB A;  3H0G G;  2JQO A;  3AFP A;  4GN4 B;  4DR5 L;  2A1A A;  4DV7 Q;  2R92 H;  4YCV A;  2AMC B;  1PFS A;  5IWA Q;  3S17 H;  4A3J G;  4IPC A;  1PH6 A;  1EQQ A;  2YTY A;  2E8G A;  3PCO B;  3HOX G;  3GTP H;  3HFZ B;  5GAG C;  4A76 A;  3J81 j;  1VQN A;  4JI1 Q;  2QA4 A;  4DAM A;  1HNX L;  2JA8 G;  3MEF A;  1Y1W G;  4C3J H;  4LF9 L;  2OQ0 A;  3FKI G;  3TRZ A;  4GN3 B;  1VQ4 A;  3T1H L;  2GVB A;  2LSS A;  3PUV A;  1IL2 A;  3NBH B;  3EBE A;  4OWT B;  3I4N H;  1CUK A;  4JBW A;  1XMQ Q;  2B29 A;  5C4X G;  1HNW L;  1I3Q H;  5BR8 Q;  3J81 c;  2H5X A;  1B70 B;  4OX9 L;  1KC8 C;  2N49 A;  3CCR A;  4BBS G;  1PVO A;  1X65 A;  2HQL A;  3I2Z A;  4DR1 L;  2GN5 A;  4R4I A;  1I94 L;  2JA6 H;  1EIY B;  2EQS A;  4NXM L;  1OTC A;  3AEV A;  2EXD A;  4DV2 L;  4OO1 I;  1D7Q A;  1NMG A;  2VL6 A;  1HR0 L;  1N8R C;  1CKN A;  3CMA A;  4C3H H;  5M3F H;  4LF9 Q;  2NN6 G;  1P8L A;  3PF5 A;  2ASB A;  3K7U C;  3HOY H;  4QIW E;  4EQ5 A;  5LMU L;  4LF8 L;  2WFW A;  4OXP A;  3T1H Q;  2MQH A;  1PH7 A;  1M90 C;  1E24 A;  1NY4 A;  3T1Y L;  1WCM G;  3AYH B;  4LWC A;  5IYD H;  4DAY B;  4H02 A;  3SGI A;  1PH8 A;  4BY1 H;  1HNW Q;  1N34 L;  1E22 A;  3UDI A;  1FGU A;  3CPW A;  1HZC A;  4ALP A;  1UWV A;  5GAE C;  4DUZ L;  1HR0 W;  4JCV E;  1UE1 A;  3ER0 A;  1GVP A;  2R7D A;  2K5H A;  4OX9 Q;  1N33 L;  4IFD J;  4X65 L;  3PO2 H;  5M3M G;  1UE6 A;  5HGQ A;  3RZD H;  2JA7 H;  2BH8 A;  1I94 Q;  1HH2 P;  5C4J H;  4NXM Q;  3BJU A;  4DV2 Q;  1OXU A;  4L5S A;  1L1O A;  1Q46 A;  3U4Z A;  1Q86 C;  1VQ9 A;  1HR0 Q;  4JBK A;  4DV6 L;  4DV0 Q;  4B3S Q;  4X66 L;  1VQ7 A;  3K8A A;  2Q2U A;  1OXV A;  1CKM A;  4BA1 I;  5IP7 G;  4JV5 L;  2MFI A;  2KCT A;  5C3E H;  4P73 A;  5C44 H;  5LMU Q;  4LF8 Q;  4JYA L;  4GS3 A;  4LFB L;  4A75 A;  1Z9F A;  3G4S A;  3M9B A;  3S1R H;  3TS0 A;  3T1Y Q;  2NZH A;  4AQY Q;  1YZ6 A;  3PSI A;  1X56 A;  2VUM H;  3S14 H;  3S2D H;  3M4Q A;  1N34 Q;  2B63 G;  4A3B H;  2YYZ A;  1N9W A;  1KRS A;  3GTO H;  2A19 A;  1QUQ B;  2ZTD A;  1DGS A;  3M3Y H;  1N33 Q;  4HJ8 A;  4X65 Q;  2BA1 A;  4LUZ A;  3OYY A;  4DK3 C;  1TWC H;  4RMF A;  4LNQ A;  1EYG A;  5C0X I;  2CFM A;  2JEA I;  5JEA G;  3PUW A;  1L0W A;  1ASZ A;  5FJ8 G;  3KLW A;  5GRO A;  4BY7 G;  2PI2 E;  1PYS B;  4DV6 Q;  4A3E G;  3CME A;  1UE5 A;  4B3M L;  1L2F A;  3AQQ A;  3CAM A;  1JJG A;  4JV5 Q;  2R92 G;  3HOV H;  1IXR A;  4JYA Q;  3F2D A;  4LFB Q;  2CQO A;  3I56 A;  4YCW A;  1HZB A;  1D8L A;  2K5V A;  3K7A H;  4GNX C;  4IOC A;  2UXC L;  4NPS A;  4A93 H;  1YJN A;  5H1S E;  2YU9 H;  2LXK A;  3D0F A;  1VQA A;  4IJH A;  4UPA A;  3KFU A;  4YCU A;  3PO3 H;  3GTG H;  3CF5 A;  1Q1E A;  2BA0 A;  5M5Y H;  1TWF H;  1PV4 A;  2UU9 L;  2KHJ A;  4QQB X;  2YTX A;  2Y0S E;  2N78 A;  4PZ7 A;  3TQY A;  1U5K A;  4DPG A;  1PA6 A;  4B3M Q;  5M5W H;  4OWW B;  1J6Q A;  4IOA A;  3BU2 A;  4R4C A;  4J15 A;  2KCM A;  3S1M H;  4LF4 L;  4IO9 A;  1XTD A;  4POF A;  2JA6 G;  4RG1 A;  3F2C A;  3H15 A;  2PNH A;  4A3I H;  1CKN B;  1VS0 A;  1GO3 E;  1PH4 A;  1FJG L;  1HNZ Q;  1VQI A;  2MO0 A;  5ELO A;  4BXX H;  5J3B A;  5JJI A;  2JA5 H;  3KYH C;  2R93 H;  4X62 L;  4DR3 L;  3JAM i;  1WYD A;  1YHQ A;  5IYD G;  1LUZ A;  1YBY A;  2ALY B;  2UU9 Q;  3CCM A;  3A74 A;  3OTO Q;  1I5F A;  2Z6K C;  4HID A;  2ATW A;  1SRO A;  2JK8 A;  1IBL L;  2K52 A;  2B3G A;  1OXX K;  3CCU A;  4LF4 Q;  3RN2 A;  2JA7 G;  3RLF A;  1CSP A;  4A3D G;  3I55 A;  1L1O B;  1HJP A;  1N36 L;  4QJF A;  3KF8 B;  4YHH L;  1IBM L;  5JJK A;  1UEB A;  4L5T A;  4C2M H;  4DR5 Q;  2E2I H;  4PG3 A;  1V43 A;  4HIO A;  1FJG Q;  2ZTE A;  1Y1V H;  2AWN A;  3J80 i;  1BVS A;  1PH5 A;  1X54 A;  4JI2 L;  4POG A;  4A3G H;  1C9O A;  3IRB A;  5C44 G;  5AJ3 L;  4TQU S;  3CXC A;  3HOZ H;  1KRT A;  1K3R A;  1VQD A;  3CCS A;  4A3F H;  4UY8 C;  1JJC B;  4X62 Q;  2D0O A;  2IHF A;  2VZA A;  3F1Z A;  3CCV A;  4DR3 Q;  1HNX Q;  1NJI C;  2VUM G;  2Y0S G;  3CW2 C;  3JC6 6;  3UE0 A;  1GKH A;  1IBL Q;  3CC7 A;  1VQL A;  2AWO A;  1VQK A;  3S1N H;  2AKW B;  5LMN L;  1YNX A;  1VQ8 A;  4TVA B;  5ELN A;  1KXL A;  3U58 A;  4JOI C;  4MTN A;  1C7Y A;  1N36 Q;  1K9M C;  3CCL A;  1IBM Q;  4YHH Q;  2ZJP A;  1CKO A;  3NEL A;  3LGJ A;  3W1B A;  1NBW A;  3PIP A;  1RIP A;  3Q8D A;  3STB C;  4DV3 L;  4DV4 L;  4GOP C;  2HHH L;  1B7Y B;  2HIV A;  2KHI A;  1B8A A;  3CP0 A;  1KIX A;  4DR1 Q;  4JI2 Q;  1IBK L;  4HJ7 A;  1S3O A;  5AJ3 Q;  1K73 C;  1YI2 A;  4GLV B;  2VY3 A;  3L2P A; 
#chains in the Genus database with same CATH topology
 1I6H H;  3FP9 A;  2L0C A;  4P72 A;  1V1Q A;  1R4Q B;  4A3M G;  2UUB L;  1UAP A;  1S40 A;  4OEM B;  4ZAI A;  2DY7 A;  3NEM A;  5KND A;  3SK6 A;  2AHO B;  1SE3 A;  4DUZ Q;  4XT3 B;  2Q2I A;  3IKJ A;  2PW5 A;  2HHH Q;  3HOU G;  3F2U A;  2F52 A;  3OIQ A;  1ET9 A;  2ZJR A;  1STN A;  1YNN C;  3VDY A;  3VYU A;  4C3I H;  1SFO B;  1U4R A;  4R1J A;  1HZ9 A;  1KAA A;  1X3Q A;  1X6O A;  2OQK A;  4X66 Q;  3C1E A;  4FF3 A;  3GTL B;  5CGK A;  3QOL A;  4Y7N B;  1SMY C;  4H0L C;  4QUC A;  5NUC A;  4YWL A;  4O0A A;  4LJZ C;  4BXX G;  4QY7 A;  1PZI D;  4ZKB B;  3MEH A;  1Q1B A;  2D5D A;  2LFN A;  2AQ1 B;  4C3J G;  1AZQ A;  1ENC A;  2K32 A;  4KN4 C;  3ERQ A;  1QIL A;  4FXG C;  1K8A C;  1O7L A;  3ULJ A;  2Z1C A;  4LF6 L;  1F9R A;  3ONA B;  4K8I A;  4KD4 A;  4DAV A;  4R8N A;  4JBM A;  2Q8I B;  2FJ2 A;  3R8B A;  4CDF C;  1WTW A;  1Y69 U;  4PMW A;  1STH A;  1W3S A;  5J39 A;  2EXZ A;  4A3G G;  2MNA A;  3PQI A;  1Z47 A;  1BR9 A;  1Y1W B;  4UAI A;  3RN5 A;  3MTS A;  2PW7 A;  4I65 A;  5A2Q E;  5M3F G;  4X3U A;  1A2U A;  1JWM D;  3HOY G;  1FL0 A;  3EN2 A;  1PFN A;  5BN5 A;  3G71 A;  4R4T A;  2ZTC A;  3D4W A;  1VQO A;  5IYC H;  4LF6 Q;  1LTS D;  2N8N A;  2XN9 C;  4Q5V A;  4EVO A;  1HZA A;  4KY6 A;  2D62 A;  1S5F D;  2Z6K A;  5FJ8 H;  1PH2 A;  4EX5 A;  3PO2 G;  2LXJ A;  1RTO A;  2D0P A;  4KV6 A;  1K0R A;  4OO1 G;  2I5L X;  3TP5 A;  1OXT A;  4C56 C;  5C3E G;  5IP9 H;  1IZ6 A;  3BZD B;  1STE A;  3NUC A;  4QGU A;  1TWH H;  3A56 A;  2C9O A;  2L55 A;  4YY3 L;  2F4I A;  4A3L G;  3M4O H;  3OW2 A;  1DCZ A;  1Q90 A;  4UP7 A;  1VQJ A;  1UE7 A;  2AQ2 B;  3K59 A;  3A8J E;  3H6M A;  4A3C G;  4K5X A;  2KHS A;  1HTL D;  4IUT A;  1BCP C;  1P16 A;  1ESF A;  2I5H A;  1S5C D;  3A5Z B;  3TZD A;  4FF4 A;  2FXQ A;  2E76 C;  1WTV A;  3HOV G;  4A3J H;  2QEX A;  4Y52 H;  5F2D A;  2R7Z G;  4B08 A;  4OIJ A;  1YHA A;  3CU7 A;  1MI2 A;  3RNU A;  5E1F A;  4YY3 Q;  3M85 A;  4DAP A;  5K5P A;  3K5N A;  3HOW B;  2LY7 A;  4DKA C;  5C4H A;  1ROD A;  5C4X H;  3X3M A;  4A3D H;  2SDF A;  5IY0 A;  2OCE A;  4XIG S;  3FDT A;  2ZM6 L;  1QZH A;  4JI7 L;  4BBS H;  2WKC A;  2NVT H;  2CKZ B;  4FDB A;  3MVV A;  2R7F A;  2CH4 W;  3I4M G;  5IT9 L;  1QJO A;  4DGZ A;  3C1F A;  3K80 C;  3PIO A;  2I5M X;  1VMP A;  1LV9 A;  4A3I G;  1YVC A;  3VYR A;  4HJ9 A;  3A5U A;  3PUZ A;  5JVG 3;  2NN6 H;  2RDF A;  1V9P A;  1QVG A;  3TS2 A;  1AN8 A;  3E9I A;  1SNM A;  2IX0 A;  4GKJ L;  1OXS C;  1KD1 C;  4CKB A;  2BCO A;  2F4V Q;  5IGC A;  3F8T A;  4XXE A;  2ZM6 Q;  4JI7 Q;  2E2H H;  5M9O A;  4MNO A;  3VA5 A;  2ZJQ A;  4CDD C;  4XTC S;  2E5L Q;  3C46 A;  1ICW A;  3NEN A;  3FEW X;  2F0M A;  4ZYS A;  3C3L A;  1Y1V G;  2IX1 A;  1QWY A;  1B9N A;  4DV7 L;  5IP7 H;  5IIF A;  3JAM E;  1JE5 A;  4A3F G;  3J7A 5;  5D3D A;  2DJG C;  2YTV A;  4GKJ Q;  3FRP B;  4L6T B;  4L8J A;  4OIK A;  2B63 H;  2C35 B;  1KHI A;  1PTO B;  3RUZ A;  4IFD I;  2MJ8 A;  4C1N I;  2JA7 B;  3OTO L;  1XMO Q;  1TWG H;  1X9N A;  2QGQ A;  5K36 G;  2HDL A;  2L5T A;  1F9S A;  3R3O A;  5C5M A;  5BR8 L;  3RR5 A;  5BN4 A;  4PZ6 A;  1KLU D;  1NMF A;  3KUP A;  4RAU C;  2JQO A;  3WOE A;  1D5M C;  4DV7 Q;  2MGS A;  4Q0F A;  2F0U A;  2VUM B;  2YTY A;  3GTP H;  2F0J A;  5E4W C;  3EFX D;  5GAG C;  4ZK9 B;  2F0L A;  4HMJ A;  4DAM A;  1Y1W G;  3FKI G;  4KY5 A;  2K5Q A;  2Z6B A;  1HA5 A;  2A73 B;  5JOB A;  3I90 A;  2DY8 A;  4OWT B;  3I4N H;  1GUG A;  4FNF A;  5BR8 Q;  3OIP A;  4H44 C;  2H5X A;  3W3A A;  1I4X A;  1KDC A;  3MHB A;  4OX9 L;  5T1G A;  1SND A;  2FFK B;  2GN5 A;  2WAC A;  4NXM L;  2PQE A;  3J81 E;  2MP1 A;  4A93 B;  5HUR A;  3OSO A;  1NMG A;  1U4M A;  1GXD C;  3PF5 A;  2XRS D;  4EQ5 A;  5LMU L;  4DXG A;  1B1Z A;  4LF8 L;  3PO3 B;  2L11 A;  3P20 A;  5L37 A;  3VYS A;  1QE6 A;  4ALP A;  3CPW A;  1VF7 A;  1CZG A;  1UE1 A;  2AUK A;  2BE5 C;  2K5H A;  4OX9 Q;  5AFW A;  4IFD J;  4X65 L;  5M3M G;  2EPB A;  5DNF A;  4DXF A;  4O42 A;  1HH2 P;  4NXM Q;  5EGT A;  4L5S A;  1VDZ A;  1AP0 A;  2Q2U A;  2JA5 B;  2MFI A;  5LMU Q;  4LF8 Q;  4LFB L;  4GS3 A;  5IOD A;  3M9B A;  4AQY Q;  2OT2 A;  1X56 A;  4IQZ A;  4A3B H;  1HA6 A;  1SBB B;  1EEF D;  4IAL A;  1DGS A;  3SXH A;  4HJ8 A;  4X65 Q;  2BA1 A;  3HKZ B;  4DK3 C;  1TWC H;  1B50 A;  2CFM A;  3PUW A;  1ESR A;  2B2V A;  2K6A A;  3DXJ C;  3KLW A;  1SYD A;  5I4D A;  3HOZ B;  3QB3 A;  4B3M L;  1TS2 A;  4LFB Q;  1ML0 D;  4YCW A;  1D8L A;  3S9W A;  2K5V A;  3K7A H;  4IOC A;  4G7O C;  3H3V C;  3NTI A;  5H1S E;  3CKI B;  2YU9 H;  2LXK A;  3VR5 A;  1IL8 A;  1Z7T A;  3CF5 A;  5M5Y H;  1PLF A;  2PPB C;  1RDP D;  2YTX A;  4F7X A;  1MSG A;  1U5K A;  3EJI A;  3LX0 A;  4B3M Q;  4KMU C;  1HTP A;  4J15 A;  1SYC A;  1STY A;  2C5C A;  1I6H B;  4POF A;  3BVM A;  4KKT A;  3SE0 A;  5EKK A;  3H15 A;  3QJY A;  1PH4 A;  1HNZ Q;  1FD7 D;  5CV6 A;  5ELO A;  1HFG A;  2F0W A;  1C8C A;  5J3B A;  3HZX A;  1JWU D;  2HUG A;  3KYH C;  1Q3L A;  1V1P A;  1DOL A;  3JAM i;  4X3K A;  2ZXP A;  2OXP A;  1YBY A;  2NYZ D;  1G8Z D;  1STG A;  3DHQ A;  1I5F A;  2Z6K C;  3Q0A A;  2K52 A;  4X3S A;  1OXX K;  4C3I B;  1MBY A;  3RN2 A;  2JA7 G;  2PYK A;  4IUP A;  4J8Q A;  2F0H A;  5A2Q L;  4QJF A;  1JOK A;  4YHH L;  4DR5 Q;  1V43 A;  2AWN A;  3J80 i;  1BVS A;  2PMZ B;  3HG9 A;  1C9O A;  3IRB A;  5C4Z A;  2ZT9 C;  3CCS A;  4QF4 A;  4QQB X;  2VZA A;  3CCV A;  1HNX Q;  2VUM G;  2L9H A;  3CW2 C;  1SE4 A;  1PTO C;  3OMC A;  2EYP A;  3AB9 A;  3U9O A;  1IKM A;  2AWO A;  1VQK A;  3S1N H;  2P5Z X;  4CKE A;  2BE5 D;  4TVA B;  5ELN A;  4MTN A;  4YHH Q;  3A54 A;  4IN3 A;  3PIP A;  2V4D A;  1EQV A;  2HIV A;  1S3O A;  4FF1 A;  1DYQ A;  2F0E A;  4LFA L;  2A68 C;  1RKN A;  1U0L A;  5FO7 B;  5LL6 S;  1EQT A;  3HKZ E;  2K7V A;  1AFP A;  1PHJ A;  3J81 i;  1RF2 D;  5IYB G;  3OOC A;  4A93 G;  4HN7 A;  4UP9 A;  2NN6 I;  3EVQ A;  1FVI A;  3S1Q H;  2L4N A;  1VQ6 A;  1A8V A;  1XNQ L;  2EE1 A;  4S3S A;  1L0X B;  1Q12 A;  5ELB A;  2EIF A;  2ID0 A;  3NTH A;  5C6A A;  4EQP A;  2NVX H;  2WII B;  2RF4 A;  2VXW A;  1XPO A;  1W2B A;  2XTI A;  4LMQ D;  3GTK H;  2TMP A;  1R9T H;  4LFA Q;  2I0Q A;  1ZYR C;  3S2H H;  5JJZ A;  3HKS A;  1TWH B;  3EIV A;  4HMI A;  2O2L D;  1YNJ D;  1XNQ Q;  1V1P B;  2JA5 G;  3F2B A;  3M4O B;  2DGY A;  2WP8 J;  4FXK C;  4GNX A;  4IFD G;  1B9M A;  5ELD A;  3U50 C;  4DK6 C;  4P71 A;  4GLA C;  3E9H A;  1C4Q A;  2MO1 A;  4G4K A;  4X64 L;  3MZ5 A;  2K5N A;  5C0X H;  3DM1 A;  3GO5 A;  3QR8 A;  1PRT F;  3HKZ G;  2B8F A;  4R4O A;  4RH6 A;  5ELC A;  4A3J B;  2Q2T A;  2O5I C;  4DK0 A;  2CWA A;  3J7Z C;  2EJF C;  3HOZ G;  2UUA L;  1RL2 A;  2Z8L A;  4DUY L;  3GDE A;  1VCI A;  2RQX A;  4NXN L;  5COY A;  4HTH A;  4CBV A;  3K81 C;  1WI5 A;  3T13 A;  5I2Y A;  3NPP A;  5C4X B;  2BDN A;  4ID6 A;  4X64 Q;  2EYL A;  4G57 A;  4A3D B;  4KY7 A;  4QUF A;  1EWC A;  3VA7 A;  4BY1 G;  2PMZ E;  2OWO A;  2KBN A;  4CDC C;  4BBS B;  1SJE D;  1O7I A;  4GN5 A;  3SK5 A;  1GM5 A;  4BY7 H;  4CGY B;  2NVT B;  1VQM A;  4A3E H;  1BKB A;  4KHZ A;  3JAM L;  4DR6 L;  3UE1 A;  1LM0 A;  4PMC A;  2UUA Q;  2IHE A;  1JJ2 A;  1EEI D;  4BA2 I;  4DUY Q;  1LT3 D;  4X6A H;  2Z0S A;  1S5E D;  4NXN Q;  3D4D A;  2ENB A;  3CRK C;  1EY6 A;  3AU7 A;  1B44 D;  1PTO D;  1XTC D;  1KNE A;  2K5D A;  3J80 L;  3GTQ H;  2NVY H;  2G5D A;  2CQA A;  4LFC L;  4DNI A;  4J1M A;  2TSS A;  2E2H B;  5GAH C;  1TU2 B;  3CD6 A;  4OHJ A;  1MJE A;  2DJF C;  3URY A;  4A4I A;  4DR6 Q;  1VQH A;  1SNQ A;  4JOI A;  1PH1 A;  1JR0 D;  1IYU A;  2KVM A;  1NR4 A;  5EBD A;  4RGT A;  3E0E A;  3W1G A;  4GOP A;  1TS4 A;  5JVH 3;  3T51 B;  3ICE A;  2MPM A;  3AMU A;  4ZUI A;  2A68 D;  5JEA J;  3ULL A;  4B3S L;  3KLS X;  1BBU A;  3KOJ A;  1ASY A;  1X3E A;  2B63 B;  3HOX H;  4IPH A;  1A63 A;  2A6E D;  3OWE B;  4GNX B;  1LYL A;  3K58 A;  3J7Y W;  4O2D A;  1T5X D;  4LFC Q;  2JA8 H;  1TWG B;  3ND8 A;  3PGZ A;  2FHT A;  5FO9 B;  5CBA E;  2SOB A;  2KCC A;  4QB4 A;  2X6L A;  1QG7 A;  1VQB A;  4R4Q A;  3BZC A;  1R4P B;  1I50 H;  1SMX A;  1EIG A;  4QIW B;  4LF7 L;  3HGB A;  4YWK A;  1E1O A;  3ZJY C;  5DEH A;  3GTP B;  1ZYR D;  1GUO A;  1KAW A;  3CC4 A;  4HCS A;  4PZ8 A;  4DV1 L;  1K8G A;  2UUB Q;  3M7G A;  1MGS A;  5IGD A;  3I4N B;  3RMH A;  3M7N A;  1SN8 A;  5IYC G;  4RWS C;  3S24 A;  1WD0 A;  1WCM H;  5KNB A;  3T53 B;  4LF7 Q;  2QDB A;  1TWA H;  2WIN B;  1FNV A;  1YIJ A;  3RLN A;  4AIM A;  2B2V C;  4DV5 L;  5CV4 A;  1C48 A;  4JI6 L;  1SAP A;  4JI4 L;  4G7Z C;  2F3I A;  2VB3 X;  4IUQ A;  1H9R A;  3H3V I;  4MHE A;  3JAM c;  1C0A A;  2A69 C;  3S15 H;  2VW9 A;  1ET6 A;  4DV1 Q;  1E2V A;  1ILP A;  1AEX A;  1TXY A;  3GD7 A;  1JOO A;  4A3M H;  5IWA L;  3DM3 A;  4QCL A;  5IP9 G;  1STA A;  4E6I A;  3W5O A;  1E3P A;  1BQQ T;  1NTG A;  3R2I A;  2IY5 B;  3K5O A;  4XQJ A;  1NNX A;  1VQ5 A;  4JI1 L;  2B2Y A;  1HCZ A;  1AE3 A;  4DV5 Q;  2JE6 I;  3J80 c;  4JI6 Q;  4JI4 Q;  3GTJ H;  2A8V A;  1X55 A;  3HOU H;  3NWT A;  3K0X A;  4KD3 A;  4BS9 A;  3T4A C;  2QKI C;  4HJ5 A;  1K83 H;  4WJ4 A;  4GOP B;  2JXM B;  1LTR D;  1SEB D;  4YCV A;  4XQN A;  3K6O A;  5IWA Q;  1KTK A;  4A3J G;  1D2B A;  1EQQ A;  4A3B B;  2F0K A;  1JQY D;  4JI1 Q;  5J1Z A;  4C3J H;  4LF9 L;  1RTN A;  2RDH A;  2B8G A;  2NUC A;  1TWC B;  3TRZ A;  3V05 A;  3L3O C;  4GN3 B;  1VQ4 A;  2LSS A;  3PUV A;  2A74 C;  1IL2 A;  5EKI A;  1CUK A;  4RHR A;  5C4X G;  1HHV A;  2XIW A;  3J81 c;  4HCE A;  2EYF A;  3IFD A;  1KC8 C;  2N49 A;  3CCR A;  4BBS G;  1PVO A;  1B3A A;  2PCF B;  3I2Z A;  3K7A B;  5IOC A;  2JA6 H;  1TS5 A;  2IL8 A;  3CMA A;  1QCB D;  4C3H H;  5I2X A;  5M3F H;  4LF9 Q;  2NN6 G;  2WB1 B;  1SE2 A;  3T16 A;  3HOY H;  4QIW E;  3N52 A;  2MHV A;  1M90 C;  3O13 A;  5M5Y B;  5LL6 X;  5IYD H;  1E22 A;  1SDF A;  1Z6H A;  1CQV A;  2LS0 1;  1UWV A;  1LT5 D;  3ERO A;  5IGB A;  1N33 L;  3PO2 H;  1SNP A;  5HGQ A;  3RZD H;  4FF2 A;  4OO1 H;  1L1O A;  1PDQ A;  1S4Z A;  1FNU A;  3IFT A;  3K8A A;  1OXV A;  5IP7 G;  5C3E H;  2KCT A;  5C44 H;  1Z9F A;  2ZXO A;  3S1R H;  3TS0 A;  1YZ6 A;  3S14 H;  5CR3 A;  4Z9C B;  2B63 G;  1LT6 D;  3NWS A;  2YYZ A;  1KRS A;  3BDO A;  3GTO H;  1N33 Q;  4XYO A;  1PFM A;  4UDU C;  4LUZ A;  3OYY A;  2XWB B;  1OO9 B;  1ICF B;  5C0X I;  1WTX A;  1O78 A;  5JEA G;  5GRO A;  1JE4 A;  1UE5 A;  2A69 D;  3I72 A;  1L2F A;  3AQQ A;  1W6J A;  3CAM A;  4F88 A;  1JJG A;  4XDX A;  3HOV H;  3ZYY X;  1K28 A;  4ODG A;  1HXY D;  4GNX C;  2JP1 A;  2UXC L;  2L1B A;  2B2T A;  5JPN C;  3S1N B;  2I46 A;  3D6W A;  3SDZ A;  3TN2 A;  4RCO A;  3T56 B;  2UU9 L;  4FVM A;  4KHV A;  1A2T A;  2AUJ D;  2N78 A;  4RFB A;  4PZ7 A;  3TQY A;  2LKV A;  5M5W H;  4I7Z C;  5JAV A;  4IOA A;  2DNC A;  4R4C A;  3S1M H;  4LF4 L;  3KBX A;  1LO5 D;  5T1I A;  4KKU A;  4A3I H;  3S1Q B;  1GO3 E;  1FJG L;  1TKW B;  3OMG A;  2QF7 A;  4CKC A;  4RKL A;  4RGN A;  5JJI A;  4JVZ A;  2HCC A;  2KOL A;  2R93 H;  4X62 L;  3M3Y B;  2NVX B;  1LUZ A;  3A7L A;  2ALY B;  2UU9 Q;  3OTO Q;  3GTK B;  3NTK A;  1R9T B;  5EJW A;  1SRO A;  1WTH A;  1GHK A;  2B39 A;  2SEB D;  2Z9H A;  4LF4 Q;  1CSP A;  3IAY A;  1L1O B;  4GZY C;  1HJP A;  3CRL C;  1N36 L;  3S2H B;  1DZ1 A;  5JJK A;  2KCN A;  4KTA A;  4C2M H;  1U9R A;  4PG3 A;  2E2I H;  2KUM A;  1FJG Q;  2ZTE A;  1Y1V H;  1EY0 A;  4TQU S;  2CVR A;  1K3R A;  4A3F H;  1JJC B;  4X62 Q;  2IHF A;  1NJI C;  1EZ6 A;  1GKH A;  1TWF B;  2F3V A;  4EQO A;  4HR7 B;  5LMN L;  1LLR D;  3U58 A;  4JOI C;  4L63 B;  1N36 Q;  3CCL A;  1Y8O B;  2X6G A;  5E3F A;  4DV4 L;  4GOP C;  4M8A A;  5A35 A;  1KIX A;  4HJ7 A;  2NTT A;  1K73 C;  4IJH A;  1F2Y A;  5LMN W;  4DF7 A;  3DUZ A;  2WAQ B;  1F9P A;  1WFQ A;  2F0P A;  4H7B A;  1Y1W H;  3FKI H;  4DR2 L;  1LTA D;  2X69 A;  1B53 A;  5C3X A;  1XPU A;  2RHQ B;  1VQE A;  1SR3 A;  1ILQ A;  5LMN Q;  1F9Q A;  4BY7 B;  4ZLT F;  2R6G A;  4A3E B;  4JPB W;  1FYC A;  4JI8 L;  2PO4 A;  3Q24 A;  3G6E A;  4DV4 Q;  4K0K L;  1I4P A;  1I4Q A;  2QIL A;  4IUR A;  3QWN A;  4ILW A;  3HOW G;  3MFG A;  3PIO 3;  1KQS A;  1MIU A;  3DEO A;  3MAQ A;  3VR2 A;  3KJP A;  4GKK L;  2ES2 A;  4V0B A;  1V8Q A;  1I4R A;  2F0T A;  2VB2 X;  4DU9 A;  3GTQ B;  3BS1 A;  3RZO H;  3QOJ A;  1EY4 A;  2L15 A;  1CM9 A;  3BZK A;  5FLX E;  4OEL B;  1YNJ C;  4JI8 Q;  2EY1 A;  3NK9 A;  4NP5 A;  1E1T A;  3HS0 C;  4RHS A;  2SNM A;  2PQA A;  3RLO A;  2DN8 A;  2KEN A;  2N3S A;  3ULP A;  5M3M H;  3BDL A;  2XGT A;  2NTS A;  1Y14 B;  1SYE A;  5CV5 A;  4GKK Q;  4ME3 A;  3H09 A;  2CHB D;  2IWH A;  3CCJ A;  3KBG A;  2SNS A;  1PH9 A;  3HOX B;  4IPG A;  1AE2 A;  1KNA A;  2PZT A;  1BNZ A;  4K6L A;  1PRT D;  4OWX B;  1EIH A;  1UNS A;  2JA8 B;  3KLR A;  5G3L D;  1CK1 A;  2F0S A;  3CCQ A;  4BBR H;  2CWP A;  1WTP A;  2B2Y C;  3LWE A;  3PF4 A;  5CBE E;  3VR6 A;  1PXU A;  2F03 A;  5FLM H;  2OTL A;  1PFB A;  1VQC A;  4A3K H;  3R93 A;  3PV0 A;  2ZXR A;  4ULL A;  1EL0 A;  1LTI D;  1K8M A;  1WOC A;  1TY0 A;  3HRZ C;  2UUC L;  1LAC A;  2F0O A;  1CA5 A;  3V2T A;  4WOR A;  2VS1 A;  1SE8 A;  4JI5 L;  3VYT A;  1WVL A;  2EYM A;  4WJW A;  4K5W A;  1PYW D;  1A0I A;  1STB A;  1BDO A;  5IE8 A;  5CMD A;  1WCM B;  3I4O A;  1SXT A;  2EJG C;  1QZG A;  2PI2 A;  1TWA B;  3SEB A;  1D1I A;  3PUY A;  4B3T L;  3EA6 A;  3RD4 A;  1BCP F;  1E7Z A;  1Q8I A;  5FOB B;  1G6P A;  1QB5 D;  1LAB A;  4NKL A;  2UUC Q;  3QIA A;  2RSO A;  2WAQ E;  3S15 B;  2R3Z A;  4JI5 Q;  1ZEQ X;  1LTG D;  4OGQ C;  2K28 A;  1JMC A;  3H0G H;  1SNC A;  1ENF A;  1T5E A;  4DV0 L;  1J9O A;  2CCZ A;  1WJJ A;  1VQG A;  2GVA A;  3NE5 B;  3PUX A;  3M4P A;  1J5E L;  4UHV A;  4B3T Q;  2K50 A;  3GTJ B;  3HOU B;  2I07 B;  5IT9 E;  3S16 H;  1XX8 A;  2A6E C;  1HQR D;  4MIU A;  3DEP A;  4NB3 A;  2PQA B;  2IT1 A;  5HY6 A;  1Q82 C;  1K83 B;  3LWU A;  5KYL A;  1EY5 A;  4OON A;  2JJQ A;  3PO3 G;  3NBH A;  5C0X G;  4N8F A;  1L1O C;  2JEB I;  1LTT D;  1X3F A;  4WFN 3;  2HDM A;  2RHS B;  2K1B A;  1M8A A;  3FPU B;  4U68 A;  3UDG A;  5JJL A;  2F0I A;  2NZO A;  3GP7 A;  1HUM A;  5DM7 3;  1I4H A;  2GA4 B;  4C3J B;  4DN4 M;  4RGO S;  1J5E Q;  1EQR A;  5I9O A;  4AH6 A;  1IYJ B;  1QNU A;  1H9M A;  3CC2 A;  2OTJ A;  2WAQ G;  4HIK A;  3TME A;  2Z4H A;  3TRE A;  4CJ1 B;  2F3W A;  5GQO A;  4KK7 A;  2K04 A;  1A3V A;  3KLS A;  1EU4 A;  1D5Z C;  3KK7 A;  1X3P A;  2NWG A;  2JA6 B;  1MHW C;  4DR4 L;  4V19 0;  3GQB A;  2NVQ H;  1AH9 A;  2FMC A;  4XT1 B;  4C3H B;  5M3F B;  3A0J A;  1A15 A;  3HOY B;  1WTR A;  4B3R L;  2RDG A;  1BO0 A;  1S5D D;  1QNK A;  2B2T C;  1XPR A;  5IYB H;  4HIM A;  3M4Y A;  4CJ0 B;  4HJA A;  1EOT A;  1XXG A;  4I7A A;  3I91 A;  5E7N A;  2Q8T A;  3PO2 B;  3RZD B;  4JW0 A;  2HT1 A;  1O80 A;  4YWM A;  1QUQ A;  4G7H C;  4IPD A;  4DR4 Q;  1MJC A;  2EZV A;  5C3W A;  2EY5 A;  4B9X A;  4ZRZ A;  1G2T A;  4HSV A;  4B3R Q;  5C44 B;  5C3E B;  3WDN A;  3AFP A;  2A1A A;  1O7Z A;  2R92 H;  3S1R B;  4J6H A;  3S17 H;  4H13 C;  3S14 B;  4N9T A;  1PH6 A;  3PCO B;  3HOX G;  1D5X C;  1DM0 B;  3J81 j;  3GTO B;  1E2W A;  4N9P A;  2JA8 G;  4IFD H;  4HSP A;  5C5L A;  2CW0 C;  4XYQ A;  3T1H L;  3NBH B;  3EBE A;  4JBW A;  3E6Z X;  1U4L A;  5FK9 C;  1SSO A;  3K0Y A;  1HNW L;  2H4O A;  1I3Q H;  2XNA C;  1B70 B;  5EPJ A;  1DD2 A;  1JC7 A;  1X65 A;  4DR1 L;  4B9W A;  2O5J C;  1DJR D;  1I94 L;  4C3I G;  2J4X A;  1EIY B;  3AEV A;  2EYH A;  3P1H A;  1RD9 D;  1D7Q A;  1HR0 L;  1N8R C;  1IKL A;  4M1U B;  1P8L A;  2ASB A;  1BBX C;  2KQ3 A;  2PZW A;  4OXP A;  4FO2 A;  3T1H Q;  1HQM C;  1PH7 A;  2G9H D;  3T1Y L;  1WCM G;  5IGF A;  4DAY B;  3SGI A;  4BY1 H;  1GUS A;  1HNW Q;  2HCI A;  1Y8P B;  5M5W B;  1GOZ A;  1FGU A;  2EVB A;  3PIP 3;  5GAE C;  4DUZ L;  1HR0 W;  4MTK A;  3Q22 A;  3S1M B;  1XWE A;  1DOM A;  4LK1 C;  3J81 L;  1IYV A;  5EQ0 A;  1PZK D;  3QG1 A;  1I94 Q;  5C4J H;  3BJU A;  2B2U A;  1OXU A;  1RHP A;  2M00 A;  1Q86 C;  1HR0 Q;  4JBK A;  4DV6 L;  1BUV T;  4B3S Q;  5CV7 A;  4X66 L;  1JB3 A;  1VQ7 A;  5EPL A;  4DFA A;  4BA1 I;  4JV5 L;  2R93 B;  4JYA L;  4A75 A;  3G4S A;  1PRT B;  5I6Y A;  3T1Y Q;  2NZH A;  3IL8 A;  3S2D H;  4ABN A;  2K33 A;  1EZ8 A;  1N9W A;  4OL7 A;  3FVQ A;  2ZTD A;  1QUQ B;  3I8Z A;  4K2K A;  3TP7 A;  3VR3 A;  5KIX A;  1B4O A;  4LAA A;  4C2M B;  1EYG A;  2E2I B;  2JEA I;  3BG3 A;  1Y1V B;  1L0W A;  1ASZ A;  5FJ8 G;  4FXD A;  2PI2 E;  1PYS B;  4DV6 Q;  3NHH A;  4A3F B;  4JV5 Q;  4RA8 A;  4K5V A;  1IXR A;  2J7Z A;  4JYA Q;  2CQO A;  3I56 A;  1HZB A;  4FP5 D;  2G9D A;  4NPS A;  2RBM A;  5ELF A;  4P2C B;  3D0F A;  1VQA A;  3KFU A;  4UPA A;  3TZU A;  4YCU A;  1CZW A;  3GTG H;  3J7A V;  2BA0 A;  1PV4 A;  4BWG B;  3NSW A;  2OEO A;  3N6R A;  1PA6 A;  4OWW B;  2B2W A;  3BU2 A;  4IO9 A;  1GUN A;  5FLX L;  1ZKO A;  3U9S A;  3BYT B;  2JA6 G;  3F2C A;  3FKI B;  2QDL A;  1VS0 A;  2A6H C;  4C3H G;  1VQI A;  4TRD A;  4BXX H;  2EOT A;  5CC4 A;  1EYA A;  1WYD A;  4CDE C;  5IYD G;  1E0B A;  2CW0 D;  1D1K A;  2RVL A;  3GV6 A;  4HID A;  2ATW A;  4N8X 1;  1IBL L;  3A55 A;  3OPO A;  3K57 A;  4DNR B;  2B3G A;  1GHJ A;  1AZP A;  4FYD A;  3RLF A;  5J22 A;  4A3D G;  3I55 A;  3FMC A;  5EPK A;  1NCV A;  4RGM A;  1IBM L;  1UEB A;  2EY6 A;  2BOS A;  2HQE A;  1PTO F;  3MC0 B;  3RZO B;  1L0Y B;  4JI2 L;  4POG A;  4A3G H;  5C44 G;  5AJ3 L;  1VQD A;  4UY8 C;  1E2Z A;  2D0O A;  2YU9 B;  2F1M A;  3JC6 6;  3SVM A;  1IW7 C;  2ICE C;  3UE0 A;  1TS3 A;  5M3M B;  3MXG A;  1IBL Q;  3CC7 A;  1FR3 A;  2QEJ C;  2F0G A;  2AKW B;  3J7A F;  1VQ8 A;  1RCV D;  1C7Y A;  1K9M C;  1SJH D;  3D4R A;  2ZJP A;  4K2L A;  1CKO A;  2IJ0 A;  5BN3 A;  3NEL A;  1IBM Q;  3LGJ A;  3W1B A;  1ZXT A;  2D9U A;  3STB C;  4DV3 L;  3DWP A;  2KHI A;  3CP0 A;  1IBK L;  1B8A A;  4MN3 A;  4JI2 Q;  1WTO A;  4EGV A;  5AJ3 Q;  1O7Y A;  4IUU A;  4RCN A;  4BBR B;  1YI2 A;  2VY3 A;  3L2P A;  4QMG A;  1VQF A;  2KA7 A;  2V1C C;  3AFQ A;  3KF6 A;  5EKL A;  3DMU A;  2IW3 A;  4A3K B;  1DON A;  2UXD L;  4NDX A;  3D3R A;  4A3L H;  1N32 L;  2QCP X;  1EU3 A;  2F4V L;  4DV3 Q;  5CYU A;  1CT1 D;  4APV A;  1IBK Q;  1YNN D;  1SRU A;  2KEC A;  4A3C H;  2Q2H A;  1H9S A;  3E5S A;  2F0Q A;  1GD7 A;  3FHW A;  3TP6 A;  1CI3 M;  2E5L L;  3WWV A;  1SMY D;  5FLX c;  4DA2 A;  1SLJ A;  1QVC A;  3D6C A;  3NP8 A;  2KEE A;  2R7Z H;  4LUV A;  1MSH A;  1EY9 A;  4AYB B;  3E3X A;  1H95 A;  2E2J H;  1EYD A;  1S72 A;  2UXD Q;  2RCN A;  2R93 G;  3L7Z C;  4JBJ A;  4IUN A;  1JOR A;  1A62 A;  4KLK A;  1N32 Q;  2CH4 A;  1KDA A;  1YIT A;  3R2T A;  2VQE L;  2K4K A;  1W6K A;  1XMO L;  1NE3 A;  2VNU D;  3I4N G;  1F2L A;  4EQN A;  1B2T A;  3H0G B;  3OHX C;  3GTM H;  1PYB A;  3MFY A;  1G6Z A;  5M5X H;  4JC0 A;  2WKD A;  2XSC A;  4KHP L;  1HFN A;  3I4M H;  2A6H D;  3S16 B;  2D2C C;  4RKB A;  5EAY A;  2DUD A;  2EYJ A;  1PRT C;  3UDX A;  1PH3 A;  1RJT A;  2UXC Q;  3CQZ H;  3G48 A;  4PV1 C;  3DLL A;  1G29 1;  4LF5 L;  1VF5 C;  2VQE Q;  3L0O A;  2M9V A;  1Q7Y C;  3CCE A;  1HUN A;  2VQF L;  1EIF A;  1X32 A;  4LUO A;  3KDF A;  1SYF A;  5KRU A;  2JSO A;  5JEA H;  1JCK B;  1K8O A;  3J80 E;  1QVF A;  1FGB D;  1GJX A;  5KNC A;  4PMB A;  4KHP Q;  1G51 A;  1WTQ A;  2WB1 E;  1X3G A;  2N55 A;  4LW1 A;  2M2L A;  3CPF A;  3C2P A;  1SNO A;  3VR4 A;  4GLX A;  2XWJ B;  3KF6 B;  5C0X J;  4KKS A;  1JIC A;  4JI3 L;  1JT8 A;  2HD3 A;  1SFO H;  4LF5 Q;  3GTL H;  1M4V A;  1IW7 D;  4Y7N H;  2VQF Q;  3TP8 A;  3ND9 A;  1EUJ A;  1XNR L;  3MXN A;  4A3B G;  2DNE A;  1KAB A;  5JPM C;  3K5M A;  3WOF A;  4ZKC B;  5D3I B;  2NVQ B;  3UI2 A;  1YEZ A;  4KI0 A;  5K36 H;  1BCP D;  1H9S B;  3ERS X;  3Q6S A;  3STB D;  4HED A;  1KDB A;  1PZJ D;  4ZCK A;  4L5R C;  2HIX A;  2O4X A;  5KYI A;  4X3T A;  1Y8N B;  3NQT A;  1YJW A;  5IGE A;  4MZ9 A;  4JI3 Q;  5IT9 c;  1D6E C;  3UDF A;  2QW7 A;  3DWQ A;  1G91 A;  1CSQ A;  1II3 A;  4L5Q A;  4WRD A;  1XNR Q;  2F0F A;  4AQY L;  1CFM A;  1XJV A;  2F0V A;  1DXM A;  3U4V A;  2WB1 G;  4KJN A;  5IGG A;  4JI0 L;  4DR7 L;  3B6Y A;  2UXB L;  4QL5 A;  2B2U C;  2R92 B;  3KJO A;  4NW2 A;  4AYB E;  3S17 B;  1CHP D;  5KGU A;  1I4G A;  4IJL A;  1M1K C;  4ZUJ A;  2RSN A;  3TEH B;  3LNN A;  4K8J A;  3V96 A;  1KL9 A;  1EOV A;  3MXU A;  4BBR G;  3G6J B;  4DR2 Q;  2NVY B;  2KJX A;  5D14 A;  4WJ3 M;  2R61 A;  4JI0 Q;  4DR7 Q;  2XRQ D;  4JG2 A;  5CV9 A;  5FLM G;  1I3Q B;  1H9K A;  3ITP A;  3KDF B;  1SYG A;  4P74 A;  3A8I E;  3SR1 A;  4DK1 A;  2UXB Q;  4UP8 A;  4A3K G;  1VQP A;  1JB7 A;  4K0K Q;  1PMR A;  1LTL A;  5COR A;  1GUT A;  3W2D A;  2K75 A;  4TKO B;  2H1E A;  1MKH A;  1V1O A;  1CQF A;  1EFW A;  2JN4 A;  2PNR C;  4YIJ A;  1TR5 A;  1UUP A;  1EWI A;  1A3U A;  1LT4 D;  3D31 A;  5GAD C;  2JA9 A;  1Q8K A;  2WV6 D;  1HNZ L;  1SYB A;  1YJ9 A;  2EYO A;  4BY1 B;  1T9H A;  3MXN B;  1BBW A;  4HAE A;  2K14 A;  4AYB G;  2YV5 A;  1MD2 D;  4CHT B;  3I7F A;  1I50 B;  2K01 A;  1NSN S;  2BH2 A;  3H3V H;  4IUV A;  5C4J B;  4C1N K;  2B2W C;  1Q81 C;  1JWS D;  4R9W A;  2XVS A;  5DLQ E;  4P75 A;  1XMQ L;  3HOW H;  3Q23 A;  2ICI A;  1KLG D;  1YHB A;  3H0G G;  5LHY 1;  2IPK D;  4GN4 B;  4DR5 L;  2AMC B;  1K3B C;  1PFS A;  2FIN B;  3OWF A;  4IPC A;  3S2D B;  2Y0S B;  2E8G A;  3E0J A;  2IX3 A;  3HFZ B;  4A76 A;  1VQN A;  1TY2 A;  2JYO A;  2LMC B;  2QA4 A;  1HNX L;  3MEF A;  3NXW A;  2OQ0 A;  5DAU A;  2EJM A;  3SHL A;  4F8M A;  1IHZ A;  2GVB A;  5HGT A;  3H91 A;  1XMQ Q;  2B29 A;  4F87 A;  2RA4 A;  3P7J A;  1BXT A;  2E74 C;  1WD1 A;  2MUY A;  3BVG A;  1XYI A;  2K05 A;  5CV8 A;  2HQL A;  2Z4I A;  1NAP A;  4PNY A;  4R4I A;  2EQS A;  1OTC A;  4OO1 I;  2EXD A;  4DV2 L;  4A3M B;  1HRJ A;  1A3T A;  1AW7 A;  2VL6 A;  1ENA A;  1CKN A;  3K7U C;  1A6X A;  4NMZ A;  2Q8R E;  1TQO A;  2WFW A;  3P75 A;  4U67 3;  3GTG B;  2MQH A;  2PZU A;  1E24 A;  4R8I A;  1NY4 A;  1K0S A;  3AYH B;  2K03 A;  4LWC A;  1BF4 A;  4H02 A;  1PH8 A;  5D65 A;  2KED A;  1N34 L;  3UDI A;  1HZC A;  4JCV E;  1J8I A;  3ER0 A;  1GVP A;  1PTO H;  2R7D A;  4JK1 C;  1U4P A;  3BVZ A;  1UE6 A;  2JA7 H;  2BH8 A;  5E4X A;  4DV2 Q;  3EQL C;  4KN7 C;  1Q46 A;  3BDC A;  3U4Z A;  1VQ9 A;  3KF8 A;  3DWA A;  3H94 A;  4DV0 Q;  5FO8 B;  3OW7 A;  1CKM A;  2EDG A;  4P73 A;  5I6W A;  3PSI A;  2VUM H;  5TSS A;  3M4Q A;  1N34 Q;  1EY8 A;  3SK4 A;  5KEE A;  1NUC A;  2A19 A;  3M3Y H;  2E75 C;  2A5H A;  4DAY A;  4RMF A;  4LNQ A;  3TSS A;  4BY7 G;  4A3E G;  3CME A;  4A3G B;  4K6D A;  3MWY W;  1NR2 A;  3TDQ A;  2R92 G;  3D8G A;  3HEJ A;  3F2D A;  4TSS A;  3GV3 A;  4XQQ A;  4KJO A;  1CHQ D;  4A93 H;  1YJN A;  4K14 A;  3FPP A;  1CTM A;  2BDO A;  2EY2 A;  2RKS A;  1ONL A;  1H9J A;  5FKA C;  2OF1 A;  3PO3 H;  3TBI B;  4CJ2 C;  3I73 A;  1Q1E A;  5ISR A;  3NQI A;  1TWF H;  2KHJ A;  1F2M A;  4PQX A;  5ELE A;  2Y0S E;  3L9A X;  4DPG A;  5G3L F;  1J6Q A;  1TII D;  3MXP A;  2KCM A;  3I3C A;  1BCP B;  1XTD A;  1EY7 A;  4RG1 A;  1EYC A;  2NB0 A;  2PNH A;  1CKN B;  1VMC A;  1I6V C;  2MO0 A;  1TVX A;  4ZQ3 A;  5EBC A;  4O1N A;  2FMM A;  1GUW A;  2JA5 H;  2F0D A;  4DR3 L;  1CA6 A;  1YHQ A;  3CCM A;  3A74 A;  1G2S A;  2L12 A;  1BOS A;  2JK8 A;  3CCU A;  1JOQ A;  2E2D C;  4ME5 A;  1UEA B;  3PMF A;  3SK8 A;  3KF8 B;  3HOV B;  4L5T A;  5I9P A;  2R7Z B;  1FNW A;  1S5B D;  4HIO A;  1DOK A;  2E2J B;  1QOH A;  1X54 A;  4IZ8 A;  3QO2 A;  1PH5 A;  1B3Q A;  3A8K E;  3CXC A;  1EWH A;  3HOZ H;  1KRT A;  4DR3 Q;  3F1Z A;  2NBF A;  1EFI D;  3I4L A;  5DM6 3;  2Y0S G;  1HPC A;  2F0N A;  3NBI A;  3K5L A;  3MA2 B;  3CHB D;  4DNT B;  1VQL A;  3GTM B;  3HP3 A;  1F2Z A;  3I70 A;  5M5X B;  1YNX A;  3X3N A;  1KXL A;  1F77 A;  1LTB D;  3A7A B;  1NBW A;  2HHH L;  1RIP A;  2NZ1 D;  3G7L A;  3Q8D A;  2N88 A;  2RCF A;  3I4M B;  1B7Y B;  4DR1 Q;  4A3I B;  2J0T D;  2AQ3 B;  2K5W A;  3BYY B;  3CQZ B;  4GLV B;  1TT2 A; 
#chains in the Genus database with same CATH homology
 5LMN W;  1VQF A;  1I6H H;  2V1C C;  1U0L A;  3AFQ A;  3FP9 A;  3KF6 A;  1WFQ A;  3HKZ E;  4P72 A;  1V1Q A;  1PHJ A;  3J81 i;  1Y1W H;  5IYB G;  4A3M G;  2UUB L;  4A93 G;  3FKI H;  4UP9 A;  2NN6 I;  4DR2 L;  1S40 A;  1FVI A;  3S1Q H;  1VQ6 A;  1A8V A;  1XPU A;  1XNQ L;  2RHQ B;  1VQE A;  1SR3 A;  2UXD L;  5LMN Q;  1Q12 A;  3NEM A;  2EIF A;  3HOU H;  2ID0 A;  2AHO B;  2R6G A;  4DUZ Q;  4JI8 L;  4A3L H;  1N32 L;  2Q2I A;  2NVX H;  3G6E A;  4DV4 Q;  2HHH Q;  2RF4 A;  2F4V L;  3HOU G;  4K0K L;  4DV3 Q;  4APV A;  2F52 A;  1XPO A;  1IBK Q;  1W2B A;  2XTI A;  1SRU A;  3GTK H;  4A3C H;  2Q2H A;  2ZJR A;  1R9T H;  3FHW A;  1GD7 A;  3HOW G;  3VDY A;  1KQS A;  1MIU A;  4LFA Q;  4C3I H;  4R1J A;  3KJP A;  1HZ9 A;  1X6O A;  2OQK A;  3WWV A;  2E5L L;  5FLX c;  2I0Q A;  4X66 Q;  4GKK L;  2ES2 A;  1SLJ A;  3S2H H;  1QVC A;  3HKS A;  4YWL A;  4O0A A;  2R7Z H;  4LUV A;  4BXX G;  3EIV A;  4QY7 A;  1H95 A;  2E2J H;  1XNQ Q;  3RZO H;  2L15 A;  1S72 A;  3F2B A;  1Q1B A;  2RCN A;  2JA5 G;  2R93 G;  3BZK A;  2UXD Q;  2DGY A;  2WP8 J;  3L7Z C;  4JBJ A;  4GNX A;  4IFD G;  1A62 A;  4KLK A;  4JI8 Q;  1N32 Q;  3U50 C;  1YIT A;  1K8A C;  4DK6 C;  1E1T A;  4P71 A;  3ULJ A;  4GLA C;  2VQE L;  3E9H A;  2K4K A;  2PQA A;  3RLO A;  2MO1 A;  1XMO L;  4X64 L;  1NE3 A;  2VNU D;  2KEN A;  3I4N G;  4LF6 L;  2K5N A;  2N3S A;  3ULP A;  5M3M H;  3GTM H;  2XGT A;  3GO5 A;  1PYB A;  1Y14 B;  3HKZ G;  4R4O A;  5M5X H;  4JBM A;  4JC0 A;  4GKK Q;  4ME3 A;  1PH9 A;  2Q2T A;  3CCJ A;  4KHP L;  4IPG A;  1AE2 A;  2CWA A;  3J7Z C;  4PMW A;  1W3S A;  4OWX B;  3I4M H;  4A3G G;  2MNA A;  3HOZ G;  1Z47 A;  2UUA L;  1RL2 A;  5EAY A;  2DUD A;  3UDX A;  3RN5 A;  1PH3 A;  4DUY L;  3GDE A;  2UXC Q;  1VCI A;  3CCQ A;  3CQZ H;  4BBR H;  3G48 A;  2CWP A;  4NXN L;  5M3F G;  3DLL A;  3HOY G;  1FL0 A;  1G29 1;  3EN2 A;  3G71 A;  3K81 C;  1WI5 A;  4R4T A;  4LF5 L;  2VQE Q;  2ZTC A;  3PF4 A;  3L0O A;  1Q7Y C;  3CCE A;  4X64 Q;  1VQO A;  5IYC H;  5FLM H;  2OTL A;  2VQF L;  1VQC A;  4LF6 Q;  2N8N A;  1EIF A;  4LUO A;  4BY1 G;  3KDF A;  4A3K H;  1HZA A;  3PV0 A;  2PMZ E;  2OWO A;  2D62 A;  2KBN A;  1O7I A;  4GN5 A;  1GM5 A;  2Z6K A;  5FJ8 H;  1PH2 A;  1WOC A;  1QVF A;  4BY7 H;  1VQM A;  4A3E H;  1BKB A;  4KHZ A;  4EX5 A;  2UUC L;  3PO2 G;  4KHP Q;  4DR6 L;  1G51 A;  3UE1 A;  2LXJ A;  1LM0 A;  2D0P A;  2WB1 E;  1X3G A;  4LW1 A;  1K0R A;  3CPF A;  2UUA Q;  2VS1 A;  1SE8 A;  2IHE A;  4JI5 L;  1JJ2 A;  4BA2 I;  4OO1 G;  4GLX A;  3KF6 B;  4DUY Q;  5C0X J;  2I5L X;  1OXT A;  2Z0S A;  4X6A H;  4JI3 L;  1JT8 A;  4NXN Q;  1A0I A;  1SFO H;  5IE8 A;  4LF5 Q;  5C3E G;  3I4O A;  5IP9 H;  1IZ6 A;  3GTL H;  1QZG A;  2PI2 A;  4Y7N H;  2VQF Q;  3PUY A;  1EUJ A;  1XNR L;  4B3T L;  3GTQ H;  2NVY H;  1TWH H;  4QGU A;  4A3B G;  4LFC L;  4DNI A;  1E7Z A;  1G6P A;  4YY3 L;  5GAH C;  4A3L G;  3M4O H;  3CD6 A;  3OW2 A;  1MJE A;  4UP7 A;  1VQJ A;  4A4I A;  1YEZ A;  1UE7 A;  4KI0 A;  2UUC Q;  4DR6 Q;  3ERS X;  4A3C G;  2WAQ E;  3STB D;  4L5R C;  1VQH A;  4JOI A;  4JI5 Q;  1PH1 A;  2HIX A;  1P16 A;  1YJW A;  2I5H A;  3E0E A;  3W1G A;  3A5Z B;  4GOP A;  4MZ9 A;  3H0G H;  2FXQ A;  5IT9 c;  1JMC A;  4JI3 Q;  3ICE A;  3UDF A;  4DV0 L;  5JEA J;  3ULL A;  4B3S L;  3KOJ A;  1BBU A;  4A3J H;  2CCZ A;  3HOV G;  2QEX A;  4Y52 H;  1WJJ A;  1VQG A;  2R7Z G;  2GVA A;  1ASY A;  1X3E A;  3PUX A;  1CSQ A;  3HOX H;  4IPH A;  1YHA A;  3M4P A;  4L5Q A;  1A63 A;  1XNR Q;  4GNX B;  1LYL A;  1J5E L;  4B3T Q;  2K50 A;  4AQY L;  4O2D A;  4LFC Q;  3RNU A;  2JA8 H;  3S16 H;  4YY3 Q;  1XJV A;  3PGZ A;  4NB3 A;  2PQA B;  3M85 A;  2IT1 A;  3U4V A;  5HY6 A;  2WB1 G;  1Q82 C;  4JI0 L;  4DR7 L;  3B6Y A;  4DKA C;  4OON A;  2JJQ A;  1VQB A;  4R4Q A;  3PO3 G;  2UXB L;  3BZC A;  5C0X G;  1I50 H;  5C4X H;  1SMX A;  4QL5 A;  4LF7 L;  4A3D H;  1L1O C;  2JEB I;  4YWK A;  2OCE A;  5IY0 A;  3KJO A;  4AYB E;  1X3F A;  4XIG S;  1E1O A;  2RHS B;  3ZJY C;  2ZM6 L;  1QZH A;  4JI7 L;  4BBS H;  4IJL A;  1M1K C;  3UDG A;  5JJL A;  2NVT H;  2CKZ B;  4FDB A;  2NZO A;  2R7F A;  1KAW A;  3I4M G;  3TEH B;  3CC4 A;  3K80 C;  4PZ8 A;  2I5M X;  3PIO A;  1J5E Q;  4A3I G;  1YVC A;  4DV1 L;  1EQR A;  1KL9 A;  4HJ9 A;  4AH6 A;  3A5U A;  1EOV A;  1IYJ B;  1K8G A;  3PUZ A;  4BBR G;  2UUB Q;  4DR2 Q;  3CC2 A;  2OTJ A;  1V9P A;  2WAQ G;  4HIK A;  4WJ3 M;  1QVG A;  4JI0 Q;  3TS2 A;  4DR7 Q;  3M7N A;  4JG2 A;  1SN8 A;  5IYC G;  5FLM G;  3S24 A;  3E9I A;  1WCM H;  3TRE A;  2IX0 A;  3KDF B;  4GKJ L;  4P74 A;  2UXB Q;  1OXS C;  1KD1 C;  4UP8 A;  4A3K G;  5GQO A;  1VQP A;  1JB7 A;  4LF7 Q;  1TWA H;  4K0K Q;  2F4V Q;  1YIJ A;  3RLN A;  1LTL A;  4AIM A;  4DV5 L;  4JI6 L;  4JI4 L;  3F8T A;  2F3I A;  2ZM6 Q;  2K75 A;  4JI7 Q;  2E2H H;  3H3V I;  1MKH A;  4DR4 L;  4MNO A;  1EFW A;  2NVQ H;  3JAM c;  1AH9 A;  2ZJQ A;  4XTC S;  2E5L Q;  1C0A A;  3A0J A;  3S15 H;  2VW9 A;  4DV1 Q;  3NEN A;  1EWI A;  4B3R L;  2IX1 A;  1Y1V G;  1TXY A;  3D31 A;  3GD7 A;  5GAD C;  2JA9 A;  1Q8K A;  5IP7 H;  4DV7 L;  1XPR A;  5IYB H;  4A3M H;  1HNZ L;  5IWA L;  3DM3 A;  4HIM A;  5IP9 G;  1YJ9 A;  1JE5 A;  3W5O A;  4A3F G;  3J7A 5;  1E3P A;  1NTG A;  2YTV A;  2IY5 B;  1T9H A;  4GKJ Q;  3MXN B;  1BBW A;  2K14 A;  1VQ5 A;  2B63 H;  2C35 B;  4JI1 L;  1KHI A;  2YV5 A;  4AYB G;  4HJA A;  1AE3 A;  4DV5 Q;  2JE6 I;  3I7F A;  3J80 c;  5E7N A;  4JI4 Q;  4JI6 Q;  4IFD I;  3GTJ H;  2A8V A;  1X55 A;  3OTO L;  1XMO Q;  2HT1 A;  2BH2 A;  4YWM A;  1TWG H;  1QUQ A;  1X9N A;  3H3V H;  3K0X A;  2QGQ A;  4IPD A;  4DR4 Q;  5K36 G;  1MJC A;  1Q81 C;  5DLQ E;  4HJ5 A;  4P75 A;  1XMQ L;  1K83 H;  3HOW H;  4WJ4 A;  4GOP B;  5BR8 L;  3RR5 A;  4B3R Q;  4PZ6 A;  4LFA L;  1NMF A;  1YHB A;  3H0G G;  2JQO A;  3AFP A;  4GN4 B;  4DR5 L;  2A1A A;  4DV7 Q;  2R92 H;  4YCV A;  2AMC B;  1PFS A;  5IWA Q;  3S17 H;  4A3J G;  4IPC A;  1PH6 A;  1EQQ A;  2YTY A;  2E8G A;  3PCO B;  3HOX G;  3GTP H;  3HFZ B;  5GAG C;  4A76 A;  3J81 j;  1VQN A;  4JI1 Q;  2QA4 A;  4DAM A;  1HNX L;  2JA8 G;  3MEF A;  1Y1W G;  4C3J H;  4LF9 L;  2OQ0 A;  3FKI G;  3TRZ A;  4GN3 B;  1VQ4 A;  3T1H L;  2GVB A;  2LSS A;  3PUV A;  1IL2 A;  3NBH B;  3EBE A;  4OWT B;  3I4N H;  1CUK A;  4JBW A;  1XMQ Q;  2B29 A;  5C4X G;  1HNW L;  1I3Q H;  5BR8 Q;  3J81 c;  2H5X A;  1B70 B;  4OX9 L;  1KC8 C;  2N49 A;  3CCR A;  4BBS G;  1PVO A;  1X65 A;  2HQL A;  3I2Z A;  4DR1 L;  2GN5 A;  4R4I A;  1I94 L;  2JA6 H;  1EIY B;  2EQS A;  4NXM L;  1OTC A;  3AEV A;  2EXD A;  4DV2 L;  4OO1 I;  1D7Q A;  1NMG A;  2VL6 A;  1HR0 L;  1N8R C;  1CKN A;  3CMA A;  4C3H H;  5M3F H;  4LF9 Q;  2NN6 G;  1P8L A;  3PF5 A;  2ASB A;  3K7U C;  3HOY H;  4QIW E;  4EQ5 A;  5LMU L;  4LF8 L;  2WFW A;  4OXP A;  3T1H Q;  2MQH A;  1PH7 A;  1M90 C;  1E24 A;  1NY4 A;  3T1Y L;  1WCM G;  3AYH B;  4LWC A;  5IYD H;  4DAY B;  4H02 A;  3SGI A;  1PH8 A;  4BY1 H;  1HNW Q;  1N34 L;  1E22 A;  3UDI A;  1FGU A;  3CPW A;  1HZC A;  4ALP A;  1UWV A;  5GAE C;  4DUZ L;  1HR0 W;  4JCV E;  1UE1 A;  3ER0 A;  1GVP A;  2R7D A;  2K5H A;  4OX9 Q;  1N33 L;  4IFD J;  4X65 L;  3PO2 H;  5M3M G;  1UE6 A;  5HGQ A;  3RZD H;  2JA7 H;  2BH8 A;  1I94 Q;  1HH2 P;  5C4J H;  4NXM Q;  3BJU A;  4DV2 Q;  1OXU A;  4L5S A;  1L1O A;  1Q46 A;  3U4Z A;  1Q86 C;  1VQ9 A;  1HR0 Q;  4JBK A;  4DV6 L;  4DV0 Q;  4B3S Q;  4X66 L;  1VQ7 A;  3K8A A;  2Q2U A;  1OXV A;  1CKM A;  4BA1 I;  5IP7 G;  4JV5 L;  2MFI A;  2KCT A;  5C3E H;  4P73 A;  5C44 H;  5LMU Q;  4LF8 Q;  4JYA L;  4GS3 A;  4LFB L;  4A75 A;  1Z9F A;  3G4S A;  3M9B A;  3S1R H;  3TS0 A;  3T1Y Q;  2NZH A;  4AQY Q;  1YZ6 A;  3PSI A;  1X56 A;  2VUM H;  3S14 H;  3S2D H;  3M4Q A;  1N34 Q;  2B63 G;  4A3B H;  2YYZ A;  1N9W A;  1KRS A;  3GTO H;  2A19 A;  1QUQ B;  2ZTD A;  1DGS A;  3M3Y H;  1N33 Q;  4HJ8 A;  4X65 Q;  2BA1 A;  4LUZ A;  3OYY A;  4DK3 C;  1TWC H;  4RMF A;  4LNQ A;  1EYG A;  5C0X I;  2CFM A;  2JEA I;  5JEA G;  3PUW A;  1L0W A;  1ASZ A;  5FJ8 G;  3KLW A;  5GRO A;  4BY7 G;  2PI2 E;  1PYS B;  4DV6 Q;  4A3E G;  3CME A;  1UE5 A;  4B3M L;  1L2F A;  3AQQ A;  3CAM A;  1JJG A;  4JV5 Q;  2R92 G;  3HOV H;  1IXR A;  4JYA Q;  3F2D A;  4LFB Q;  2CQO A;  3I56 A;  4YCW A;  1HZB A;  1D8L A;  2K5V A;  3K7A H;  4GNX C;  4IOC A;  2UXC L;  4NPS A;  4A93 H;  1YJN A;  5H1S E;  2YU9 H;  2LXK A;  3D0F A;  1VQA A;  4IJH A;  4UPA A;  3KFU A;  4YCU A;  3PO3 H;  3GTG H;  3CF5 A;  1Q1E A;  2BA0 A;  5M5Y H;  1TWF H;  1PV4 A;  2UU9 L;  2KHJ A;  4QQB X;  2YTX A;  2Y0S E;  2N78 A;  4PZ7 A;  3TQY A;  1U5K A;  4DPG A;  1PA6 A;  4B3M Q;  5M5W H;  4OWW B;  1J6Q A;  4IOA A;  3BU2 A;  4R4C A;  4J15 A;  2KCM A;  3S1M H;  4LF4 L;  4IO9 A;  1XTD A;  4POF A;  2JA6 G;  4RG1 A;  3F2C A;  3H15 A;  2PNH A;  4A3I H;  1CKN B;  1VS0 A;  1GO3 E;  1PH4 A;  1FJG L;  1HNZ Q;  1VQI A;  2MO0 A;  5ELO A;  4BXX H;  5J3B A;  5JJI A;  2JA5 H;  3KYH C;  2R93 H;  4X62 L;  4DR3 L;  3JAM i;  1WYD A;  1YHQ A;  5IYD G;  1LUZ A;  1YBY A;  2ALY B;  2UU9 Q;  3CCM A;  3A74 A;  3OTO Q;  1I5F A;  2Z6K C;  4HID A;  2ATW A;  1SRO A;  2JK8 A;  1IBL L;  2K52 A;  2B3G A;  1OXX K;  3CCU A;  4LF4 Q;  3RN2 A;  2JA7 G;  3RLF A;  1CSP A;  4A3D G;  3I55 A;  1L1O B;  1HJP A;  1N36 L;  4QJF A;  3KF8 B;  4YHH L;  1IBM L;  5JJK A;  1UEB A;  4L5T A;  4C2M H;  4DR5 Q;  2E2I H;  4PG3 A;  1V43 A;  4HIO A;  1FJG Q;  2ZTE A;  1Y1V H;  2AWN A;  3J80 i;  1BVS A;  1PH5 A;  1X54 A;  4JI2 L;  4POG A;  4A3G H;  1C9O A;  3IRB A;  5C44 G;  5AJ3 L;  4TQU S;  3CXC A;  3HOZ H;  1KRT A;  1K3R A;  1VQD A;  3CCS A;  4A3F H;  4UY8 C;  1JJC B;  4X62 Q;  2D0O A;  2IHF A;  2VZA A;  3F1Z A;  3CCV A;  4DR3 Q;  1HNX Q;  1NJI C;  2VUM G;  2Y0S G;  3CW2 C;  3JC6 6;  3UE0 A;  1GKH A;  1IBL Q;  3CC7 A;  1VQL A;  2AWO A;  1VQK A;  3S1N H;  2AKW B;  5LMN L;  1YNX A;  1VQ8 A;  4TVA B;  5ELN A;  1KXL A;  3U58 A;  4JOI C;  4MTN A;  1C7Y A;  1N36 Q;  1K9M C;  3CCL A;  1IBM Q;  4YHH Q;  2ZJP A;  1CKO A;  3NEL A;  3LGJ A;  3W1B A;  1NBW A;  3PIP A;  1RIP A;  3Q8D A;  3STB C;  4DV3 L;  4DV4 L;  4GOP C;  2HHH L;  1B7Y B;  2HIV A;  2KHI A;  1B8A A;  3CP0 A;  1KIX A;  4DR1 Q;  4JI2 Q;  1IBK L;  4HJ7 A;  1S3O A;  5AJ3 Q;  1K73 C;  1YI2 A;  4GLV B;  2VY3 A;  3L2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...