4YHHQ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhQ00
3PUVA 4GNXC 3K7AH 3ICEA 4B3RQ 4PG3A 4BBRH 1BKBA 1IXRA 5FLMG 3AYHB 3CCJA 3B6YA 3IRBA 4JI4Q 3RLNA 1TWAH 1EFWA 1I6HH 1OXSC 4RG1A 5C3EH 1HNWL 3U58A 2UUCQ 2VUMG 3CCLA 1N36L 1LYLA 5M3FG 3BZKA 4A93G 3UDXA 1XMQQ 4DV7L 1HZCA 1B7YB 3CAMA 1KRSA 4P73A 4A3GH 1K3RA 4L5QA 2A1AA 4A3DG 4YCWA 2AWNA 1X56A 4JV5Q 4O2DA 2UU9L 2JA5G 1L1OC 2R92H 5LMNW 2VZAA 1PH2A 4XIGS 4YY3L 4BA1I 4LF9L 4BXXH 1B8AA 3TS2A 4OO1I 3CCQA 1ASZA 2QGQA 3M7NA 1EQRA 2E8GA 4BY1G 2JA7G 2KHIA 4UP9A 1OXVA 2GVBA 5IYDG 4ALPA 1B70B 1I94Q 4DUYL 4JI6L 1E24A 5IWAQ 2WAQG 1QVFA 2R93G 1N32L 2VL6A 4HJ7A 1MJCA 1VQ9A 2NVTH 4BA2I 1C9OA 3ER0A 4JOIA 2GN5A 2R7ZH 4A3FG 1UEBA 3HOZH 4OWXB 4DV4Q 4AQYL 3VDYA 3PIPA 3CW2C 3KF8B 2HQLA 4DR3Q 5BR8L 3S1RH 4B3SL 4O0AA 3KYHC 4LF8L 2JE6I 1C7YA 2BA1A 3I7FA 4R4IA 3ULLA 1P16A 1KRTA 4X66Q 1CKNB 2IT1A 1JB7A 2NVQH 3RLOA 3E9HA 1EQQA 1TWCH 3L2PA 3T1YL 4GKJQ 4DV2Q 4B3MQ 1BBWA 3J81j 1NE3A 2K14A 2RCNA 1VQHA 4R4CA 4LFBQ 3HKZE 3KF6A 1YNXA 4JG2A 2QEXA 3CCRA 3W1GA 4A3KH 3HOUG 3I4NH 1YIJA 1GM5A 2B63G 1D8LA 4KHPL 1BVSA 5IYBH 1YZ6A 2AWOA 5IY0A 4A3BH 3H0GH 4QIWE 3CCUA 2F4VL 3KF6B 4LUOA 3G6EA 4A76A 1X9NA 3S1MH 3J81c 1LM0A 4JYAL 3CC7A 3KJPA 1IYJB 4DV3L 4PZ7A 4QY7A 3GO5A 2BH8A 3UDFA 3ZJYC 5H1SE 5LMUQ 1Q7YC 1Y1VH 2B3GA 2RHQB 2Q2UA 3UDGA 4DV1Q 5JEAJ 3I4MH 3J80c 3PSIA 3BZCA 3E0EA 4UP8A 5HY6A 4DAMA 4DUZQ 1TWHH 3H3VI 4HJAA 4IOAA 2K52A 4B3RL 2K50A 3D0FA 4A3MH 3CC4A 3CC2A 3A5ZB 3RLFA 2ZJQA 3HOXG 5C0XJ 3M9BA 3PUYA 5J3BA 4X6AH 1KAWA 2VS1A 3AFQA 4WJ3M 4AYBG 1Q46A 4IPGA 4LFAQ 3CP0A 2NN6I 2V1CC 2NZOA 3F2DA 2VNUD 4HJ9A 2R6GA 3M85A 2E5LQ 4IFDI 3UE1A 1N9WA 1A63A 4HIOA 1SLJA 1GD7A 3PCOB 1I50H 2N78A 2K5VA 5FLXc 1QZGA 4KLKA 3CD6A 4A4IA 1JJCB 1HZBA 2YU9H 4JV5L 4IO9A 2EIFA 4XTCS 2UUBQ 4BBSG 3HOWG 2Q2TA 1LUZA 2VQEQ 2BA0A 2CKZB 1KL9A 1WFQA 1N8RC 4C3IH 1XNRQ 4KI0A 5JEAG 2Z0SA 3CCVA 5GAGC 4A3EH 1XPOA 4GOPA 1PH3A 4LF5Q 2JA6G 3S14H 4PZ6A 3OW2A 2E2HH 1QZHA 1I94L 3M4PA 5IWAL 3J81i 5IYCH 3CF5A 2WB1G 4JOIC 3RN2A 5C0XG 1X3FA 5M3MG 2WFWA 2VW9A 1KC8C 3HOYH 3M3YH 4NXNL 4A3IG 1GO3E 3M4QA 3A5UA 3CMAA 2OCEA 4DR3L 4OX9Q 3J80i 4C2MH 3PO3H 4HJ8A 4P72A 1VQCA 4PMWA 3PIOA 1WCMH 4JI2Q 3Q8DA 3SGIA 2N3SA 4DR6Q 4GKJL 4C3JH 4DV2L 4B3ML 4JI0Q 3FKIH 3F2CA 3GTLH 5IP9G 4B3TL 1E3PA 5GAEC 2Z6KA 4GN4B 2ES2A 3GD7A 3KOJA 1XNQQ 2KHJA 3S15H 1E7ZA 4BY7H 3BU2A 2ZTDA 2JA5H 4P75A 3EIVA 1IBMQ 5C44H 3PO2G 1E22A 4RMFA 1CUKA 2OQKA 4YHHQ 2VQFQ 2PQAB 4BBRG 1H95A 3OTOQ 4YWMA 5LMUL 1QVCA 2IY5B 1IBLQ 3WWVA 1G51A 4JI1Q 5C3EG 3I55A 1VQOA 4GKKQ 1RL2A 2ZM6Q 1NBWA 4DR1Q 4A3JH 1S40A 4DV1L 1YBYA 2Y0SE 4X64Q 4QJFA 4QGUA 4DUZL 2PI2A 3KJOA 1CKNA 4GLAC 1UE6A 1WOCA 3BJUA 3RZDH 3PGZA 4A3GG 2I5LX 3CXCA 1M90C 4DR7Q 2LXJA 4OWTB 5IT9c 2I0QA 1X65A 2F52A 4AIMA 1TWGH 2R92G 4LF4L 2R7DA 1XJVA 1NTGA 4LFAL 4BXXG 2N49A 2NZHA 5C4XH 2BH2A 4IJHA 4JI8Q 2E5LL 4OONA 2JA8H 4A3CH 3U4ZA 1N34Q 3TEHB 4POGA 3CPWA 1PHJA 3TS0A 3L0OA 3STBC 2HHHL 1AH9A 1VQ7A 1G291 1J6QA 1EWIA 4YWLA 1KIXA 1HR0Q 3RR5A 1YJ9A 3GTOH 2YTVA 2LSSA 1PH4A 1VQGA 1L0WA 4DV0Q 1FVIA 4IPDA 1YJWA 2VQEL 1YJNA 1Y1WH 3HOVH 3HOZG 2R7ZG 5JJIA 3GTQH 1EOVA 1CKOA 5ELOA 3G4SA 1XNRL 1V9PA 1ASYA 1K8GA 4LF5L 1VQJA 1VQAA 1PH6A 1Q1EA 1JJ2A 4GOPC 3ULJA 2ASBA 1WYDA 2CQOA 3GTJH 4LFCQ 1JT8A 4DR2Q 3S2DH 1IZ6A 1A8VA 1NJIC 1PH5A 3PF5A 1YITA 1Z47A 2DGYA 3W5OA 1SFOH 2WAQE 4DV7Q 1X3EA 1UWVA 4A75A 1E1TA 4NB3A 5IP7H 3G71A 1KXLA 4AH6A 3GTGH 1SR3A 5FJ8H 4OX9L 2IHFA 4A3KG 4R4OA 3I4NG 1HNZQ 3DLLA 5M5XH 3I2ZA 3STBD 3H3VH 5IYBG 1IBKQ 4JI4L 4DV6Q 1JJGA 4YY3Q 1Y14B 5GADC 5IE8A 1EIYB 4JI2L 2D0OA 3H0GG 4A3BG 2ZTEA 2WP8J 1L1OB 1EIFA 3AFPA 3MXNB 4Y7NH 4HIKA 1Q86C 2UUCL 2JQOA 4JI0L 2ALYB 2KCTA 2A8VA 1RIPA 4YCVA 1PVOA 3E9IA 5LMNQ 1XMQL 1XNQL 4GN3B 1PH7A 5DLQE 4APVA 4IJLA 1VQ8A 1N32Q 1Y1VG 2Z6KC 4L5TA 3S1QH 2UXDQ 4DK3C 2OQ0A 4FDBA 1IBML 1X6OA 2K5NA 1X55A 4YWKA 3I4MG 1SN8A 1VQMA 2YYZA 3CCEA 1FGUA 5AJ3Q 3J7A5 4DV5Q 1A62A 2FXQA 3CCSA 1C0AA 1Q12A 2VQFL 4X65Q 3NELA 4A3MG 3NEMA 2CWPA 4Y52H 2JA9A 5C0XI 2UXBQ 4P74A 3I56A 2UXCQ 3HFZB 1D7QA 3M4OH 4GS3A 1IBLL 3OYYA 4JI1L 1XPUA 2ZM6L 4DR1L 1PYSB 1LTLA 1BBUA 4X64L 4A3LH 5K36G 3K80C 2R7FA 4KHZA 3K8AA 3TRZA 3FP9A 4A3IH 3J7ZC 1FJGQ 1VQ6A 2C35B 1VQEA 4DR5Q 1AE2A 1MJEA 1CKMA 4DV4L 1QUQB 1IL2A 1XMOQ 4UPAA 4DR7L 4YCUA 5FLMH 1HNXQ 4X62Q 2PMZE 1PA6A 4R1JA 1VQ4A 2ZTCA 4X66L 4OXPA 5GROA 4JI7Q 4L5RC 4LF6Q 2VUMH 4A3EG 2IHEA 5M3FH 5GQOA 2YTYA 4LUVA 4LF7Q 2JJQA 1Z9FA 4TQUS 1N34L 3CPFA 4AYBE 4EX5A 3FHWA 3GTMH 1HR0L 2ZJPA 1I5FA 4LFBL 1MIUA 5IYCG 4A3DH 2IX1A 2PQAA 1S72A 1U0LA 2RF4A 1SROA 2PNHA 2AHOB 4DV0L 1XPRA 1OXTA 4C3HH 1E1OA 5E7NA 3HOYG 4LUZA 2K4KA 2I5MX 3U4VA 4DK6C 4DR4Q 5GAHC 3G48A 3A74A 1MKHA 4JBJA 4BY1H 2JA7H 3PO3G 2EXDA 1PV4A 5IYDH 4K0KQ 1X3GA 4LWCA 1U5KA 3NBHB 4LFCL 2MFIA 4DR2L 4JI3Q 1WCMG 3UE0A 1N33Q 2R93H 4R4TA 1YVCA 2HIVA 3HKZG 4JBWA 4DNIA 3FKIG 1NMFA 3DM3A 1KHIA 5EAYA 1OXXK 4A3FH 3T1HQ 1KD1C 2WB1E 2YV5A 3TQYA 1YI2A 3JAMc 1WI5A 4BY7G 3K7UC 3S17H 2E2JH 3K0XA 1SRUA 3K81C 1HNZL 1WJJA 5C44G 2XTIA 1IBKL 4DV6L 3LGJA 4P71A 3RNUA 1J5EQ 4IOCA 2HIXA 4QQBX 1UE7A 5HGQA 2CCZA 1OTCA 4NXMQ 3S24A 2VY3A 2MNAA 1PYBA 2H5XA 5LMNL 1VQLA 2OWOA 1HZ9A 3NENA 1Q1BA 2UUAQ 2AKWB 4ME3A 2UXDL 4OO1G 3HOUH 3UDIA 1HZAA 4A3JG 2B63H 1XTDA 2D62A 2I5HA 4JC0A 4MNOA 3S2HH 2UUBL 2EQSA 2XGTA 2OTJA 3PUXA 3U50C 4UY8C 4GNXA 4NXNQ 5AJ3L 1VQ5A 1K83H 4GLXA 4DV5L 4LW1A 1VS0A 4JI5Q 1K9MC 4OWWB 1DGSA 1YHAA 1Q82C 4X65L 3PUZA 5M5WH 1GVPA 2UXBL 1YEZA 2UXCL 1AE3A 1V1QA 2MQHA 1VCIA 2KCMA 4IPHA 4GNXB 4LNQA 1HNWQ 3JC66 1N36Q 5C4XG 2JA8G 2B29A 4A3CG 4JCVE 1TWFH 4B3TQ 3PUWA 1OXUA 1FJGL 2JK8A 2HT1A 1VQIA 4JBKA 1NY4A 4DR5L 1SMXA 4NPSA 4R4QA 1PH8A 4IPCA 1XMOL 1L1OA 2DUDA 4H02A 4QL5A 1HNXL 3F8TA 4X62L 2UU9Q 1K8AC 2ZJRA 4L5SA 3HOXH 1R9TH 2CWAA 3JAMi 3HOVG 1Y1WG 1NMGA 3PV0A 5JJKA 4WJ4A 4JI7L 4LF6L 4MTNA 4LF9Q 1VQBA 2JEBI 1O7IA 1W3SA 2L15A 3GDEA 3ULPA 4LF7L 1K0RA 1VQKA 4DR6L 2KBNA 2MO0A 4DKAC 4IFDJ 1P8LA 1UE1A 4DUYQ 4POFA 1Q81C 2OTLA 4GN5A 3RN5A 2E2IH 2A19A 2N8NA 4JI6Q 3RZOH 1CSQA 4TVAB 1CSPA 4BBSH 3AEVA 4DAYB 4HIDA 3HOWH 4GLVB 1FL0A 1JE5A 4MZ9A 2IX0A 3EBEA 1EYGA 5IP7G 4DPGA 4AQYQ 1QVGA 2JA6H 1A0IA 4A93H 5FJ8G 1K73C 4DR4L 4YHHL 1JMCA 4EQ5A 1VQNA 5BR8Q 4UP7A 4B3SQ 1YHQA 3EN2A 4K0KL 4LF8Q 3L7ZC 4LF4Q 1EUJA 1SE8A 2ID0A 2Q2IA 3A0JA 3OTOL 2JEAI 3PF4A 3W1BA 2D0PA 4JI3L 1VQPA 1N33L 4GKKL 1QUQA 2CFMA 1L2FA 1PFSA 2AMCB 3HKSA 3T1YQ 3CQZH 2LXKA 2K5HA 5M3MH 3MEFA 1X54A 1PH1A 1M1KC 3S1NH 3D31A 2K75A 2KENA 2YTXA 2HHHQ 2NVXH 3T1HL 3S16H 1T9HA 3F1ZA 2NN6G 2QA4A 1HH2P 4PZ8A 3KFUA 5JJLA 2F3IA 1VQFA 1G6PA 4J15A 3F2BA 1KQSA 4IFDG 2RHSB 4KHPQ 5C4JH 2Q2HA 2GVAA 3CCMA 2MO1A 1HR0W 3ERSX 1J5EL 1VQDA 3GTKH 1PH9A 2F4VQ 3H15A 3CMEA 4NXML 4JI8L 1GKHA 1HJPA 1TXYA 5IP9H 4JYAQ 2Y0SG 4HIMA 1I3QH 4DV3Q 3GTPH 2UUAL 3KDFA 4JBMA 1V43A 1S3OA 3AQQA 3I4OA 1Q8KA 2ATWA 4GOPB 2PI2E 4A3LG 5M5YH 1W2BA 4HJ5A 3KLWA 3PO2H 5ELNA 4JI5L 1YHBA 3TREA 2NVYH 1UE5A 3KDFB
chains in the Genus database with same CATH superfamily
3PUVA 4GNXC 4B3RQ 1SAPA 1IXRA 4RHSA 4I7ZC 5FLMG 5I9OA 3CCJA 3DXJC 4JI4Q 1EZ8A 3MEHA 1EFWA 1I6HH 1F9RA 1TS2A 4FF1A 1HTLD 1HNWL 1KLUD 3R2IA 3U58A 4LAAA 2VUMG 3BZKA 3MHBA 4RH6A 2RVLA 4KY7A 1ICWA 4ZCKA 3HOZB 2R7ZB 5EPLA 4L5QA 4A3DG 2FMMA 1X56A 3IL8A 4O2DA 3PIP3 2JA5G 2B2UA 5D14A 4BXXH 4LF9L 5IGGA 3TS2A 4RFBA 4ALPA 5IYDG 2B8FA 4R8IA 2SDFA 3W3AA 5JOBA 5I4DA 2VL6A 1VQ9A 4A3KB 1LT3D 4F7XA 4JOIA 2GN5A 3WOEA 2R7ZH 1UEBA 3HOZH 1CQFA 4DV4Q 3R8BA 4DNTB 2HQLA 3S1MB 4LF8L 2JE6I 2XWJB 4X66Q 1R4PB 1FNWA 2SNSA 1JOOA 4GKJQ 4B3MQ 1NE3A 3OMCA 3KF6A 1A2UA 4A3KH 1GM5A 4A93B 1E2ZA 1YZ6A 1BCPB 5C4HA 5JPMC 2JXMB 3H0GH 2A74C 5A35A 3BVZA 3S1MH 2RDGA 3G6EA 4A76A 3J81c 1PXUA 1LM0A 3KJPA 1IYJB 1UAPA 1MSGA 4QY7A 4DV3L 3GO5A 2BH8A 2QCPX 5H1SE 5LMUQ 1Q7YC 1CK1A 3I8ZA 5EKKA 2B2TA 3J80c 3H3VI 2C9OA 5CV5A 1CZGA 2K52A 4IUQA 3CC2A 2D5DA 2NTTA 5KNDA 5C0XJ 3HOXG 2KQ3A 1IW7C 3PUYA 1KAWA 2VS1A 3AFQA 4IQZA 3GTPB 4LFAQ 2NN6I 2WKDA 2VNUD 5K36H 4HJ9A 2R6GA 4IUPA 4KY6A 5DEHA 3PQIA 4Q5VA 3L3OC 4JV5L 4IO9A 4EQPA 3BYTB 4HSVA 3HRZC 2F0PA 4HCEA 2ZXOA 4LF5Q 5F2DA 3GTLB 2WACA 1T5XD 3CF5A 2XSCA 5C0XG 5M3MG 1JWSD 2GA4B 4J8QA 2VW9A 1KC8C 4NXNL 3MVVA 5E4WC 1F2ZA 4A3IG 3M4QA 2OCEA 3CRKC 2LKVA 3PO3H 5EBCA 2K7VA 1VQCA 2BE5C 4N9PA 1HUMA 1EY6A 2F0SA 3Q8DA 2Q8RE 2N3SA 2B39A 2RKSA 4DV2L 4NKLA 5T1GA 3GTLH 1IL8A 4E6IA 4ABNA 1O80A 2ES2A 3KOJA 1STBA 2XVSA 3A8KE 2KHJA 2EYPA 1TIID 2JA5H 5EJWA 1IBMQ 3A8JE 3PO2G 5T1IA 5I6WA 1EFID 2TSSA 1U4PA 4XQQA 2PQAB 3CHBD 5C4XB 1E2VA 3D6CA 1PFMA 1PRTB 3WWVA 5C3EG 1VQOA 1S40A 2Y0SE 2OF1A 3BDLA 2J4XA 2BE5D 3GQBA 5JJZA 3KJOA 3BJUA 4KTAA 5IT9c 1EWHA 2R7DA 4RKBA 5C4XH 1HQMC 3IKJA 3CPWA 3TS0A 3L0OA 3EVQA 1AH9A 1VQ7A 1J6QA 1HR0Q 3RR5A 5BN5A 3GTGB 2LSSA 1GUNA 1JORA 1XTCD 1YJWA 2VQEL 4FXKC 3SR1A 1G91A 1XNRL 3V2TA 1LTSD 4ZUIA 1VQJA 1LV9A 3UI2A 3ULJA 2KEEA 1DJRD 1WYDA 1ESRA 1B3AA 2EJGC 1PH5A 3PF5A 1TS3A 2DGYA 3S1QB 3W5OA 4CJ0B 4DV7Q 2A68C 3K5LA 2V4DA 5IP7H 1U4LA 3GTGH 1EEID 3MXNA 4OX9L 2IHFA 2RA4A 2B2YA 5ELCA 1HNZQ 3S14B 2KVMA 4JI4L 1EIYB 4A3BG 3HEJA 2ZTEA 2WP8J 1TS5A 4HIKA 4ID6A 2RDFA 4J1MA 4YCVA 1PVOA 1Q90A 2VB2X 3WOFA 1XNQL 4XQJA 4GN3B 4ZLTF 4APVA 4IJLA 2UXDQ 2Z6KC 3S1QH 1K8MA 4IFDH 4FDBA 1PZJD 5G3LF 4RKLA 3U9OA 1S4ZA 3J7A5 1A62A 2FXQA 3CCSA 1STHA 1G2TA 5EGTA 4PV1C 4MN3A 1RHPA 4A3MG 3NEMA 2H4OA 2JA9A 1D7QA 2UXCQ 3MFYA 1IYUA 1Y69U 1IBLL 3GTMB 1XPUA 1NNXA 1PYSB 5CBAE 2EZVA 1BBUA 4HMIA 2R7FA 2IWHA 3K8AA 1G8ZD 4CGYB 3AMUA 3FP9A 1DOLA 3A7AB 4A3IH 1VQ6A 1Q8IA 5BN4A 1LLRD 2C35B 3QOJA 3KK7A 1K28A 4DV4L 4UPAA 4OIKA 1HNXQ 2PMZE 4BY1B 2JA7B 1F2YA 3NQIA 4KN4C 4QUCA 1SE3A 2ZTCA 4X66L 2XWBB 5GROA 2EOTA 4V190 1E2WA 4A3EG 5KYIA 5M3FH 5KNCA 3FDTA 4LUVA 2JJQA 1Z9FA 4TQUS 4A3JB 1N34L 4FVMA 4N8FA 1HA6A 1ONLA 3FHWA 3GTMH 5IYCG 2PQAA 1S72A 2PNHA 5IT9L 2PZUA 3ND8A 2PQEA 3HOYG 5E7NA 1RCVD 1FGBD 2K4KA 1SE2A 4XT1B 5GAHC 4M1UB 2H1EA 4BY1H 2JA7H 1PV4A 4K0KQ 1X3GA 4LWCA 4K8IA 1MD2D 4DR2L 2HCIA 3UE0A 2K32A 1KDCA 3HKZG 4G7OC 3S2HB 3FRPB 2MGSA 5EAYA 1KD1C 2WB1E 2YV5A 3AB9A 3E0JA 1Y1WB 3K7UC 3K0XA 4H13C 4DV6L 2NTSA 3C1EA 3LGJA 1SDFA 1SJHD 1SNCA 4QQBX 3P1HA 3SXHA 2F03A 2CH4A 2L11A 5KGUA 5EBDA 2MNAA 5LMNL 4H44C 1STAA 2C5CA 2OWOA 2AKWB 3S2HH 1GUSA 2OTJA 4UY8C 1SYGA 1WTXA 4GNXA 4GLXA 1Z7TA 3HG9A 4X65L 2F0MA 4U673 2F0FA 2KJXA 2HCCA 1HNWQ 3JC66 1PFNA 4JCVE 3HOWB 4A3CG 1VQIA 5CV4A 4DR5L 4NPSA 5ELEA 5CC4A 1XMOL 1EY5A 2EDGA 2CWAA 3JAMi 3HOVG 3X3NA 2IW3A 4LF6L 3M4OB 4F87A 1VQBA 2JEBI 4LF9Q 1GJXA 4DAYA 3ULPA 3TN2A 3T56B 3F2UA 3LNNA 1Q81C 4KKSA 1CSQA 1RD9D 3EA6A 4RCNA 1EY0A 3AEVA 3HOWH 5C4JB 4P2CB 1G6ZA 1WTQA 1JMCA 1VQNA 4UP7A 1YHQA 3VA7A 4LF8Q 4LF4Q 1V1OA 3EQLC 1S5BD 2D0PA 4JI3L 4MTKA 1SNQA 3HKSA 5FKAC 3MTSA 1PH1A 3D31A 2KENA 2YTXA 4PNYA 3F1ZA 3KFUA 4C1NK 3DUZA 3F2BA 2RHSB 1D1KA 5C4JH 2GVAA 1KLGD 4HEDA 1J5EL 2L5TA 2TMPA 1F2MA 1B3QA 3CMEA 1HJPA 2SEBD 4FP5D 1I3QH 4RGTA 4DV3Q 2UUAL 3SE0A 1V43A 3AQQA 3P20A 4A3LG 2R92B 2PYKA 5FLXE 3KDFB 4KHVA 4UHVA 4IURA 3E3XA 3B6YA 1TWAH 4RG1A 1D6EC 3VR4A 4C1NI 1N36L 3HOUB 5C5LA 1B2TA 2N88A 2B63B 2RDHA 1PDQA 4DV7L 2BDOA 1HZCA 1B7YB 3CAMA 2CHBD 4P73A 4A3GH 2A1AA 1L0YB 4JV5Q 1YNJC 4B08A 1PTOF 2R92H 4C3HG 1PH2A 5C3XA 3DWPA 4CDFC 3CCQA 1TWCB 1Q3LA 1EQRA 2KHIA 4UP9A 1OXVA 2GVBA 5JVH3 4DUYL 4S3SA 1E24A 2DY8A 2WAQG 3SK8A 2R93G 5G3LD 3ER0A 4RGOS 1B1ZA 1CTMA 1A3UA 2RQXA 2MP1A 4AYBB 4PMBA 2ZJQA 3KYHC 1MSHA 3I7FA 1BUVT 2IT1A 3VA5A 3C3LA 1TWCH 1YNJD 4DV2Q 1BBWA 3FMCA 4FF4A 1O7ZA 3S9WA 2PZTA 2RCNA 4O1NA 2VB3X 3SHLA 4KY5A 1AZQA 3CCRA 1BR9A 1D8LA 4KHPL 4ZQ3A 5IYBH 1SYCA 2F4VL 3KF6B 4LUOA 5FO7B 3X3MA 3UDFA 2NBFA 2NB0A 3T51B 2P5ZX 2RHQB 1HFNA 3UDGA 3A54A 1GUTA 1WTOA 3GP7A 4UP8A 3D4WA 4IOAA 1ZEQX 2K04A 2MHVA 5EKIA 3M9BA 1EU4A 1UEAB 5J3BA 3CP0A 3O13A 5BN3A 3G6JB 4K5XA 3F2DA 3M85A 4IFDI 3UE1A 3QIAA 1A63A 1BQQT 1EYCA 4KN7C 1AFPA 1SMYC 3CD6A 5NUCA 3BS1A 1JJCB 1UUPA 2Z8LA 2A5HA 1A3TA 1GOZA 4BBSG 4KKUA 4JVZA 4RCOA 3NHHA 2VQEQ 2CKZB 1WFQA 4C3IH 1CA5A 1XNRQ 1I6HB 2Z0SA 2JA6G 4A93G 1PH3A 2L9HA 4C3JB 5CMDA 4G57A 2E74C 1I94L 3DEPA 3NPPA 4B9XA 4K14A 5I9PA 3J81i 3RN2A 3IFDA 2FHTA 2IJ0A 3OIPA 3DHQA 4V0BA 5CYUA 2F0DA 1GO3E 4MHEA 4DR3L 2OXPA 4OX9Q 3L9AX 3J80i 2RBMA 1KABA 2AQ1B 1TS4A 2F0NA 1SMYD 2F0QA 2QW7A 4DGZA 3SGIA 3VYTA 2CVRA 4C3JH 3FKIH 5GAEC 4GN4B 2Z6KA 1S5CD 1XNQQ 2WINB 2F0EA 1E7ZA 4BY7H 3R2TA 3NE5B 3BU2A 3EIVA 3QOLA 2K5WA 2KECA 5IGDA 2DN8A 3QG1A 4DK1A 3V96A 4BBRG 5DM63 1H95A 4XDXA 2JA8B 1IBLQ 3I55A 4OO1H 1RL2A 4RHRA 2ZT9C 1YBYA 3GV3A 1TY0A 1BO0A 4DUZL 1EYAA 2XIWA 5COYA 3NWTA 2CQAA 3OIQA 3H0GB 2LXJA 2I0QA 1IHZA 4AIMA 4LF4L 1XJVA 1CA6A 4OELB 3I3CA 2NZHA 1EY8A 4JI8Q 2JA8H 4OONA 1N34Q 5E1FA 2E76C 2K5DA 3STBC 1KIXA 1YJ9A 5C3WA 3TP7A 3KBGA 2RCFA 1QNKA 1FVIA 1YJNA 4FNFA 4EGVA 4PQXA 5JJIA 1EOVA 1STNA 4R9WA 3G4SA 1K8GA 3JAME 3I90A 3K58A 4K6LA 1VQAA 1PTOC 2EY1A 1HFGA 4WFN3 2QF7A 4GOPC 2ASBA 4DR2Q 1NJIC 3KUPA 5KNBA 4CDCC 2K03A 2EY2A 1X3EA 1DCZA 1E1TA 1HXYD 4NB3A 3RUZA 3DWAA 3VYRA 4DU9A 2F4IA 1KTKA 3I4NG 3STBD 4DV6Q 4YY3Q 5GADC 3VR2A 1F9QA 1OO9B 1LTBD 3AFPA 3MXNB 4JI0L 2HD3A 2JQOA 1RIPA 3E9IA 5LMNQ 4OL7A 1Y1VG 2EVBA 2B2VC 1B4OA 1PTOD 3K59A 1X6OA 2K5NA 1X55A 1H9KA 4OEMB 5EPJA 3I4MG 1VQMA 3PO3B 1TR5A 1Q12A 2ZXRA 3EJIA 5KIXA 3NELA 4X65Q 4Y52H 4XYOA 4ZRZA 3HFZB 5E4XA 4JI1L 3V05A 2ZM6L 4DR1L 4X64L 4KHZA 1JWUD 1D2BA 3TRZA 4DN4M 2JA5B 5IIFA 4DR5Q 1AE2A 1MJEA 1BXTA 1XMOQ 4DR7L 5FLMH 2M9VA 3NK9A 2F0JA 4L5RC 4LF6Q 1HUNA 2VUMH 2YTYA 3CPFA 4EX5A 5LL6S 3H3VC 2A6EC 2ZJPA 1W6KA 1MIUA 4A3DH 1SROA 5JPNC 2AHOB 2E2JB 4DV0L 1XPRA 3ONAB 3VYUA 1E1OA 1B9NA 2I5MX 1X3QA 4DK6C 3A74A 2EJFC 1JQYD 3T53B 5IYDH 2BCOA 1U5KA 2L55A 2MFIA 4KJOA 4JI3Q 1WCMG 4CDEC 4R4TA 1YVCA 2HIVA 2K6AA 4HCSA 3DM3A 1KHIA 2XN9C 3TQYA 5JVG3 1NR2A 1EQTA 2F3VA 2E2JH 5C44G 1IBKL 1S5FD 2A6ED 4DXGA 1J5EQ 4IOCA 5CGKA 3TP8A 1DD2A 2VY3A 2G5DA 1PYBA 2H5XA 1HZ9A 2UUAQ 1WVLA 1HZAA 4A3JG 1XTDA 4MNOA 3RD4A 1C4QA 2XGTA 3BYYB 3MFGA 1RDPD 3HOXB 4IUVA 4FF2A 5AJ3L 4DV5L 1K9MC 1DGSA 5J22A 2XRQD 5K5PA 3PUZA 5M5WH 1GVPA 1YEZA 3TZUA 4IUNA 1VCIA 4IPHA 4GNXB 3RZOB 1QOHA 2AUJD 1Y8PB 1N36Q 4N9TA 5IODA 3PUWA 1RJTA 1NY4A 1SMXA 4R4QA 5CORA 2DUDA 3F8TA 4LJZC 3E6ZX 2ZJRA 1K8AC 3HOXH 1IKMA 3J7AF 1Y1WG 1EYDA 2Y0SB 4H7BA 1QB5D 3T13A 3GDEA 3CQZB 2KBNA 2MO0A 5M3MB 4QF4A 2OTLA 1PMRA 4DUYQ 1L0XB 3RZOH 2N8NA 4A3IB 4UAIA 4EQNA 1I4RA 4DAYB 4CKCA 1K3BC 4MZ9A 4FO2A 4DR4L 3GTKB 3A7LA 4N8X1 5FJ8G 1K73C 3CKIB 2NWGA 5D3IB 2O5IC 1BBXC 3EN2A 5M3FB 3L7ZC 1SE8A 2ID0A 2Q2IA 1BCPF 2J7ZA 3LX0A 3MXUA 1D5MC 3W1BA 3FVQA 1SE4A 1PLFA 5I2YA 3CQZH 5C0XH 2K5HA 5M3MH 3MEFA 1M1KC 3S1NH 3J81E 2K75A 2HHHQ 3T1HL 3PO2B 4X3KA 2QA4A 2NN6G 1NUCA 3OMGA 2SNMA 2BOSA 4KHPQ 2Q2HA 1JR0D 3VR6A 3J80E 4ZK9B 1HR0W 3K5NA 1S5ED 1KNEA 3GTKH 5C3EB 2F4VQ 4WORA 4NXML 1II3A 4JI8L 1TXYA 2X6LA 1LTID 4HIMA 4JBMA 4CJ2C 1S3OA 3H09A 4GOPB 1B44D 2PI2E 5C5MA 1ZYRC 2EE1A 2K05A 3R3OA 5LHY1 4HJ5A 3PO2H 5ELNA 2F0GA 4ILWA 4JOIC 1SYEA 1UE5A 1I4GA 3K7AH 4CJ1B 4PG3A 3I91A 1BKBA 1XWEA 4HMJA 3RLNA 1NCVA 1HRJA 1OXSC 5C3EH 2RSOA 1EEFD 1EWCA 2X6GA 2UUCQ 3CCLA 2K28A 1X3PA 3H6MA 3UDXA 1XMQQ 4WJWA 3Q23A 5A2QL 1KRSA 3PMFA 3EFXD 4U68A 1K3RA 3A56A 2UU9L 3NTHA 1L1OC 2HDMA 2Z4IA 1O7LA 1A15A 4XIGS 4BA1I 4YY3L 3EROA 2NVQB 4OO1I 1ZYRD 1ASZA 3M7NA 2K1BA 1VF5C 2E8GA 1ET6A 1I94Q 4JI6L 1TT2A 2PMZB 3CU7A 2NVTH 4BA2I 1J8IA 1JOQA 4IN3A 4A3FG 1G2SA 3I73A 4AQYL 3PIPA 3CW2C 3KF8B 3MC0B 4DR3Q 3D8GA 4NDXA 4WRDA 4B3SL 3LWUA 2F0UA 4ZKCB 3ULLA 2NVQH 3RLOA 1F9SA 3E9HA 1EQQA 3T1YL 5EPKA 1CZWA 2K14A 4QUFA 4R4CA 4XT3B 3FPUB 4IUTA 1U4RA 2Z4HA 3HKZE 4LFBQ 1PZKD 1PRTF 4JG2A 3HOUG 1EQVA 2B63G 1BVSA 2AWOA 1ZKOA 1GXDC 3K0YA 5IY0A 4A3BH 4QIWE 3CCUA 2F0LA 3C1FA 2WB1B 4ODGA 5IT9E 5FLXL 3D4DA 2EYHA 2B3GA 4M8AA 2Q2UA 3BDCA 1H9MA 3T4AC 2YU9B 3MXPA 5JEAJ 3VR3A 4DAMA 3BZCA 4DUZQ 5E3FA 1KDAA 4HJAA 2JYOA 2K50A 3D0FA 4A3EB 4A3MH 3QO2A 2F0WA 3NBIA 3CC4A 3A5ZB 4H0LC 2AQ2B 2KA7A 2E2HB 1M4VA 1NR4A 4AYBG 1Q46A 4IPGA 1I3QB 2K5QA 3K57A 2NUCA 1CHPD 5IGEA 2R3ZA 4CHTB 4HIOA 4K2LA 1RODA 1SLJA 3PCOB 1QG7A 4DK0A 3HOYB 2N78A 2K5VA 1QZGA 4KLKA 2DJGC 3KLSA 2EYLA 2YU9H 1J9OA 2UUBQ 4XTCS 2Q2TA 1SYBA 1LUZA 1HTPA 2BA0A 1AW7A 4G7ZC 1N8RC 1TWAB 1DOMA 4KI0A 5JEAG 4A3EH 5GAGC 2WV6D 2EXZA 4GOPA 3VYSA 2E2HH 3TP5A 5IWAL 1DOKA 4QMGA 5IYCH 3S15B 1SEBD 4A3GB 1X3FA 1MGSA 3BZDB 2WFWA 3HOYH 3M3YH 3DEOA 1CFMA 3A5UA 1FNUA 4C2MH 4GZYC 3Q24A 1PFBA 4P72A 4PMWA 3PIOA 2EPBA 2Z6BA 5FOBB 4DR6Q 2R61A 3I72A 2LY7A 4JI0Q 3QWNA 5IP9G 1E3PA 1FYCA 4K2KA 3S15H 2EYJA 4BWGB 3RZDB 2B2WC 4P75A 3BDOA 3OHXC 4RGMA 1CUKA 1I4QA 4OIJA 3BG3A 1AZPA 4KD3A 1GUGA 3OTOQ 1QVCA 2LFNA 4KK7A 3ND9A 2IY5B 1GHJA 4JI1Q 2ZM6Q 3KF8A 4DR1Q 4G4KA 4DV1L 4X64Q 1JCKB 2PI2A 3HOVB 4GLAC 1QCBD 1WOCA 2Z9HA 3DWQA 4X3SA 3RZDH 3CXCA 5J39A 4DR7Q 1RTNA 2B2YC 4DFAA 1BCPD 1TWGH 2KEDA 3CRLC 1NTGA 1ENCA 3GTJB 1ESFA 1RF2D 1Z6HA 4BXXG 3S2DB 2N49A 2BH2A 2E5LL 4A3CH 3U4ZA 2DNCA 3TEHB 4POGA 1HPCA 2QILA 2HHHL 2KOLA 1EWIA 5CV6A 3GTOH 1HCZA 2YTVA 2JP1A 4DV0Q 5M5XB 3HOVH 3H94A 3Q0AA 2I46A 3HOZG 2R7ZG 1CKOA 1CT1D 5ELOA 1V9PA 1ASYA 1C8CA 1PH6A 1Q1EA 5IOCA 3OW7A 1JT8A 4I7AA 3GTJH 3ZYYX 3S2DH 1IZ6A 1A8VA 1SNMA 3NTKA 5M9OA 2PO4A 2MPMA 2WAQE 1F2LA 2OEOA 4A75A 2I07B 1SR3A 2PW7A 2L1BA 4A3KG 3NP8A 4C3IB 2F0HA 2PZWA 3DLLA 5M5XH 1K0SA 1IBKQ 1JJGA 1LACA 5HURA 1Y14B 1ZXTA 3OSOA 4JI2L 3H0GG 1V8QA 1L1OB 1EIFA 2UUCL 2G9HD 1Q86C 4DF7A 1JC7A 1TKWB 4X3UA 3I70A 2A8VA 1XMQL 1PH7A 1SSOA 3OOCA 1VQ8A 1N32Q 1WTPA 1XXGA 4DK3C 2OQ0A 4YWKA 4EQOA 1HQRD 3CCEA 5AJ3Q 4DV5Q 1PRTC 1C0AA 2VQFL 2E75C 2CWPA 1FD7D 5C0XI 4P74A 3FKIB 1LTGD 4CBVA 4A3LH 5K36G 3K80C 3M4YA 4ME5A 4BY7B 3OPOA 4C3HB 3C2PA 1ENAA 1VQEA 1CKMA 1QUQB 4YCUA 4TKOB 2Z1CA 4Q0FA 3SDZA 1PA6A 4R1JA 4BS9A 2WAQB 2LS01 4OXPA 2R93B 2IHEA 4KKTA 3BVMA 3OWEB 3TDQA 1TVXA 2L0CA 3TP6A 2AUKA 1PRTD 4L8JA 4LFBL 3M7GA 4CDDC 3MZ5A 1U0LA 1D1IA 4C3HH 4LUZA 1I6VC 3U4VA 4DR4Q 4DAVA 2FJ2A 3PO3G 3HZXA 4LFCL 4KD4A 2R93H 4RWSC 4HR7B 4B9WA 1DZ1A 5FO9B 3T1HQ 2WIIB 1VF7A 1YI2A 4DA2A 2FFKB 1SRUA 1WJJA 3MAQA 1WD1A 3RNUA 2HIXA 3TZDA 1RKNA 1B50A 5HGQA 1OTCA 4NXMQ 1C48A 3NENA 1Q1BA 4ME3A 3WDNA 2I5HA 4JC0A 2UUBL 2EQSA 3Q22A 3PUXA 3U50C 1R9TB 1VS0A 1Q82C 3SK4A 3TMEA 4OGQC 2UXBL 2MQHA 1QE6A 4XQNA 4LNQA 2E2IB 2KCCA 2NZ1D 1EY9A 5C4XG 2B29A 4BBSB 4B3TQ 1OXUA 1FJGL 1KNAA 2JK8A 4JBKA 3ERQA 4IPCA 2A73B 1L1OA 1LT5D 4TSSA 4H02A 2JA6B 4QL5A 4X62L 2UU9Q 4L5SA 5DAUA 2BDNA 1R9TH 4F88A 5KRUA 1LT6D 5JJKA 4WJ4A 2O2LD 3HP3A 4JI7L 1W3SA 2L15A 4DR6L 4LF7L 1K0RA 1XX8A 5IGCA 4DKAC 4IFDJ 1P8LA 4JI6Q 3S16B 4GN5A 5DNFA 3RN5A 2E2IH 4TVAB 4BBSH 4HIDA 4GLVB 4G7HC 1FL0A 1JE5A 1TU2B 2IX3A 2DNEA 2EYMA 2FMCA 5IP7G 4AQYQ 4JPBW 2JA6H 1A0IA 4A93H 1QWYA 4B3SQ 2VUMB 3C46A 2MJ8A 3A0JA 3OTOL 3PF4A 1HHVA 1VQPA 1N33L 5D3DA 1I4PA 1QUQA 2CFMA 1L2FA 2AMCB 4K5VA 3T1YQ 2KHSA 4ZYSA 4A3DB 1BF4A 5M5YB 3P7JA 3S16H 1H9SB 4IUUA 5JJLA 1HH2P 2PW5A 4IALA 1I4XA 1VQFA 4J15A 4IFDG 4BBRB 2EYOA 5I2XA 3CCMA 4UDUC 1VQDA 2A69C 3PIO3 1PH9A 2XNAC 1F9PA 2Y0SG 1AN8A 3GTPH 3SVMA 3HS0C 3I4OA 5JAVA 3N6RA 1Q8KA 2ATWA 1IW7D 5M5YH 1W2BA 3IFTA 4JI5L 3TREA 3DMUA 3ICEA 4BBRH 5EKLA 3AYHB 4ZUJA 1EY7A 3IRBA 2LMCB 1EIGA 4KV6A 2F1MA 2PNRC 1Y8OB 1STEA 4JW0A 1SNOA 1LYLA 5M3FG 4L6TB 1BNZA 5ISRA 1ICFB 2A69D 3A8IE 4RAUC 4CKBA 4HSPA 4MIUA 2AWNA 4YCWA 1WTHA 1CHQD 2JSOA 3S1RB 3SEBA 5LMNW 2VZAA 5M5WB 2G9DA 1B8AA 2QGQA 3RMHA 4BY1G 2JA7G 2DJFC 1B70B 3FPPA 5IWAQ 1QVFA 4HAEA 1N32L 2IL8A 1R4QB 4HJ7A 1MJCA 4LK1C 3I4NB 1YNNC 1C9OA 1S5DD 1EZ6A 1SJED 4C56C 4OWXB 1LTTD 3K6OA 5L37A 3VDYA 3VR5A 3J81L 5BR8L 3S1RH 4O0AA 1WTVA 2ICIA 3J7YW 2BA1A 1M8AA 1C7YA 1AP0A 4R4IA 1P16A 1KRTA 1JB7A 1CKNB 4FYDA 1Y1VB 1MHWC 3L2PA 2ICEC 3J80L 5C6AA 3J81j 3I4MB 1VQHA 1TWHB 2B2WA 1YNXA 1KDBA 3GV6A 5AFWA 3W1GA 2QEXA 5I6YA 1ILQA 2K01A 1YIJA 3I4NH 4NMZA 3D4RA 2N55A 4ZKBB 1T5EA 4FXDA 2PPBC 2VXWA 1V1PB 4KJNA 4O42A 1X9NA 3J7AV 1YNND 3MWYW 4JYAL 3K5MA 3CC7A 4YIJA 4F8MA 4PZ7A 3ZJYC 3S1NB 1I50B 1Y1VH 3E5SA 3N52A 4DV1Q 1Y8NB 3I4MH 4IZ8A 3PSIA 3E0EA 5HY6A 1TWHH 2PCFB 3ITPA 4B3RL 1IYVA 3P75A 3QJYA 3RLFA 1H9SA 4X6AH 3FEWX 4WJ3M 5LL6X 2V1CC 2NZOA 1IKLA 3NUCA 1JB3A 2E5LQ 4K8JA 1N9WA 1GD7A 1I50H 3R93A 5FLXc 1AEXA 3H91A 4A4IA 1HZBA 1ML0D 2AQ3B 2EIFA 3AU7A 3K7AB 3HOWG 1H9RA 1DXMA 2EY5A 5CR3A 3OWFA 1KL9A 1KAAA 2B2UC 1WCMB 3CCVA 3G7LA 1XPOA 3S14H 2A68D 4PZ6A 3OW2A 2F0KA 1QZHA 3M4PA 1CQVA 1GUWA 2WB1G 2MUYA 3D6WA 4TRDA 1PTOB 2M00A 4FXGC 5C44B 1BOSA 5ELFA 3CMAA 2HDLA 4HJ8A 1F77A 1WCMH 4JI2Q 1BDOA 1EIHA 4GKJL 4B3ML 3F2CA 3IAYA 1JOKA 4B3TL 2RSNA 1B9MA 2F0TA 2NVTB 3GD7A 5EQ0A 2K33A 2QDLA 1JE4A 1NAPA 2ZTDA 2SOBA 1PTOH 2F0VA 1ENFA 1DM0B 5C44H 1SNDA 3URYA 1PZID 2XRSD 1E22A 1DYQA 4RMFA 2OQKA 4YHHQ 2VQFQ 5ELDA 3MXGA 3A55A 4YWMA 4LMQD 5LMUL 4GKKQ 1G51A 1EU3A 1CM9A 1NBWA 3MA2B 4A3JH 4QGUA 4QJFA 4R8NA 1XYIA 5KYLA 1RTOA 1O78A 2B2TC 5IGBA 1CKNA 1UE6A 3GTQB 3KLSX 3PGZA 4A3GG 2I5LX 1LABA 1M90C 4A3BB 4OWTB 5CV7A 1X65A 1VMPA 2KUMA 2F52A 2R92G 4LFAL 1NSNS 1WTWA 4IJHA 2ENBA 5J1ZA 1SFOB 1PHJA 1H9JA 1G291 4YWLA 1V1PA 4I65A 2WKCA 2NYZD 1PH4A 1VQGA 2QKIC 1L0WA 3NTIA 1O7YA 4IPDA 4A3MB 1Y1WH 3GTQH 4LF5L 1K8OA 1TQOA 4Y7NB 1JJ2A 1WD0A 2CQOA 2CW0C 4LFCQ 1SNPA 1UNSA 1STYA 1YITA 1Z47A 1W6JA 1SFOH 4QB4A 1QNUA 3SK6A 1UWVA 1VDZA 3G71A 1KXLA 4AH6A 2OT2A 5FJ8H 4R4OA 3I2ZA 1FR3A 3H3VH 5IYBG 2JN4A 5A2QE 4OHJA 5IE8A 2D0OA 4Y7NH 3NXWA 1LTAD 2ALYB 2KCTA 2NN6H 5DLQE 1B53A 3M3YB 3NWSA 4L5TA 2EY6A 1A6XA 4L63B 1IBML 4C2MB 2CW0D 1SBBB 1SN8A 2YYZA 4HTHA 3TBIB 1FGUA 2HQEA 5IGFA 1VMCA 3HKZB 2UXBQ 1A3VA 3I56A 3M4OH 4GS3A 2EJMA 3OYYA 1QJOA 5KEEA 1LTLA 1D5ZC 4QIWB 3J7ZC 1FJGQ 4PMCA 1IL2A 3KLRA 4X62Q 1SYFA 1VQ4A 1FNVA 4JI7Q 4C3IG 2F3WA 5GQOA 4LF7Q 4AYBE 4A3FB 1HR0L 1BCPC 1I5FA 5D65A 4K5WA 5FK9C 2B2VA 2IX1A 2RF4A 2IPKD 3S17B 4NW2A 1OXTA 4RGNA 1TWGB 5FO8B 3G48A 4DNRB 1MKHA 1SYDA 4JBJA 2EXDA 3NBHB 3I4LA 1N33Q 1U4MA 2Q8IB 3GTOB 4JBWA 4C3JG 4DNIA 3FKIG 1NMFA 1WTRA 1OXXK 4A3FH 2F0OA 3T16A 1K83B 3TSSA 3JAMc 2QDBA 1WI5A 4BY7G 4J6HA 3S17H 3K81C 1HNZL 3K5OA 2J0TD 3DM1A 4RA8A 1LO5D 2XTIA 4P71A 4NP5A 4DAPA 3KBXA 3QB3A 1UE7A 2CCZA 3S24A 2QEJC 5DM73 1TWFB 2D2CC 3U9SA 4X3TA 1VQLA 4XYQA 1DONA 2UXDL 2EYFA 3HOUH 4OO1G 3UDIA 3NQTA 2B63H 5C4ZA 2D62A 3SK5A 1SXTA 2DY7A 4NXNQ 1VQ5A 1JICA 1K83H 2L4NA 3QR8A 4LW1A 4JI5Q 4OWWB 1YHAA 1PYWD 1TY2A 4DXFA 2M2LA 4ULLA 2UXCL 1AE3A 2CH4W 2HUGA 3LWEA 1V1QA 2KCMA 3W2DA 2JA8G 1I4HA 1TWFH 2Q8TA 3D3RA 1HA5A 1U9RA 2HT1A 2X69A 4HN7A 1PH8A 2L12A 1EL0A 1HNXL 2A6HC 4ZAIA 1JWMD 2E2DC 1NMGA 3PV0A 1ILPA 4MTNA 5CBEE 1O7IA 1STGA 1LTRD 2D9UA 1E0BA 2KCNA 1VQKA 5HGTA 5CV8A 1UE1A 4POFA 2NVXB 2A19A 1MBYA 2FINB 4EVOA 4Z9CB 4XXEA 3HGBA 1CSPA 5ELBA 2IX0A 3EBEA 1EYGA 4DPGA 1QVGA 1X32A 5JEAH 2ZXPA 4YHHL 4EQ5A 5BR8Q 4JK1C 1GUOA 4K0KL 1EUJA 2JEAI 1GHKA 4GKKL 1EY4A 1PFSA 2A6HD 2LXKA 1X54A 2NVXH 1EOTA 1MI2A 1T9HA 2O5JC 4PZ8A 4KMUC 1QILA 2NVYB 2F3IA 3BVGA 4FF3A 1G6PA 2B8GA 1KQSA 2MO1A 3ERSX 1A2TA 4CKEA 2F0IA 1ET9A 1D5XC 3H15A 1GKHA 5IP9H 2O4XA 4JYAQ 4QCLA 3KDFA 1CI3M 3JAML 5TSSA 4K6DA 1LT4D 3KLWA 3NBHA 3Q6SA 1YHBA 2NVYH 5CV9A 3NSWA
chains in the Genus database with same CATH topology
3PUVA 4GNXC 3K7AH 3ICEA 4B3RQ 4PG3A 4BBRH 1BKBA 1IXRA 5FLMG 3AYHB 3CCJA 3B6YA 3IRBA 4JI4Q 3RLNA 1TWAH 1EFWA 1I6HH 1OXSC 4RG1A 5C3EH 1HNWL 3U58A 2UUCQ 2VUMG 3CCLA 1N36L 1LYLA 5M3FG 3BZKA 4A93G 3UDXA 1XMQQ 4DV7L 1HZCA 1B7YB 3CAMA 1KRSA 4P73A 4A3GH 1K3RA 4L5QA 2A1AA 4A3DG 4YCWA 2AWNA 1X56A 4JV5Q 4O2DA 2UU9L 2JA5G 1L1OC 2R92H 5LMNW 2VZAA 1PH2A 4XIGS 4YY3L 4BA1I 4LF9L 4BXXH 1B8AA 3TS2A 4OO1I 3CCQA 1ASZA 2QGQA 3M7NA 1EQRA 2E8GA 4BY1G 2JA7G 2KHIA 4UP9A 1OXVA 2GVBA 5IYDG 4ALPA 1B70B 1I94Q 4DUYL 4JI6L 1E24A 5IWAQ 2WAQG 1QVFA 2R93G 1N32L 2VL6A 4HJ7A 1MJCA 1VQ9A 2NVTH 4BA2I 1C9OA 3ER0A 4JOIA 2GN5A 2R7ZH 4A3FG 1UEBA 3HOZH 4OWXB 4DV4Q 4AQYL 3VDYA 3PIPA 3CW2C 3KF8B 2HQLA 4DR3Q 5BR8L 3S1RH 4B3SL 4O0AA 3KYHC 4LF8L 2JE6I 1C7YA 2BA1A 3I7FA 4R4IA 3ULLA 1P16A 1KRTA 4X66Q 1CKNB 2IT1A 1JB7A 2NVQH 3RLOA 3E9HA 1EQQA 1TWCH 3L2PA 3T1YL 4GKJQ 4DV2Q 4B3MQ 1BBWA 3J81j 1NE3A 2K14A 2RCNA 1VQHA 4R4CA 4LFBQ 3HKZE 3KF6A 1YNXA 4JG2A 2QEXA 3CCRA 3W1GA 4A3KH 3HOUG 3I4NH 1YIJA 1GM5A 2B63G 1D8LA 4KHPL 1BVSA 5IYBH 1YZ6A 2AWOA 5IY0A 4A3BH 3H0GH 4QIWE 3CCUA 2F4VL 3KF6B 4LUOA 3G6EA 4A76A 1X9NA 3S1MH 3J81c 1LM0A 4JYAL 3CC7A 3KJPA 1IYJB 4DV3L 4PZ7A 4QY7A 3GO5A 2BH8A 3UDFA 3ZJYC 5H1SE 5LMUQ 1Q7YC 1Y1VH 2B3GA 2RHQB 2Q2UA 3UDGA 4DV1Q 5JEAJ 3I4MH 3J80c 3PSIA 3BZCA 3E0EA 4UP8A 5HY6A 4DAMA 4DUZQ 1TWHH 3H3VI 4HJAA 4IOAA 2K52A 4B3RL 2K50A 3D0FA 4A3MH 3CC4A 3CC2A 3A5ZB 3RLFA 2ZJQA 3HOXG 5C0XJ 3M9BA 3PUYA 5J3BA 4X6AH 1KAWA 2VS1A 3AFQA 4WJ3M 4AYBG 1Q46A 4IPGA 4LFAQ 3CP0A 2NN6I 2V1CC 2NZOA 3F2DA 2VNUD 4HJ9A 2R6GA 3M85A 2E5LQ 4IFDI 3UE1A 1N9WA 1A63A 4HIOA 1SLJA 1GD7A 3PCOB 1I50H 2N78A 2K5VA 5FLXc 1QZGA 4KLKA 3CD6A 4A4IA 1JJCB 1HZBA 2YU9H 4JV5L 4IO9A 2EIFA 4XTCS 2UUBQ 4BBSG 3HOWG 2Q2TA 1LUZA 2VQEQ 2BA0A 2CKZB 1KL9A 1WFQA 1N8RC 4C3IH 1XNRQ 4KI0A 5JEAG 2Z0SA 3CCVA 5GAGC 4A3EH 1XPOA 4GOPA 1PH3A 4LF5Q 2JA6G 3S14H 4PZ6A 3OW2A 2E2HH 1QZHA 1I94L 3M4PA 5IWAL 3J81i 5IYCH 3CF5A 2WB1G 4JOIC 3RN2A 5C0XG 1X3FA 5M3MG 2WFWA 2VW9A 1KC8C 3HOYH 3M3YH 4NXNL 4A3IG 1GO3E 3M4QA 3A5UA 3CMAA 2OCEA 4DR3L 4OX9Q 3J80i 4C2MH 3PO3H 4HJ8A 4P72A 1VQCA 4PMWA 3PIOA 1WCMH 4JI2Q 3Q8DA 3SGIA 2N3SA 4DR6Q 4GKJL 4C3JH 4DV2L 4B3ML 4JI0Q 3FKIH 3F2CA 3GTLH 5IP9G 4B3TL 1E3PA 5GAEC 2Z6KA 4GN4B 2ES2A 3GD7A 3KOJA 1XNQQ 2KHJA 3S15H 1E7ZA 4BY7H 3BU2A 2ZTDA 2JA5H 4P75A 3EIVA 1IBMQ 5C44H 3PO2G 1E22A 4RMFA 1CUKA 2OQKA 4YHHQ 2VQFQ 2PQAB 4BBRG 1H95A 3OTOQ 4YWMA 5LMUL 1QVCA 2IY5B 1IBLQ 3WWVA 1G51A 4JI1Q 5C3EG 3I55A 1VQOA 4GKKQ 1RL2A 2ZM6Q 1NBWA 4DR1Q 4A3JH 1S40A 4DV1L 1YBYA 2Y0SE 4X64Q 4QJFA 4QGUA 4DUZL 2PI2A 3KJOA 1CKNA 4GLAC 1UE6A 1WOCA 3BJUA 3RZDH 3PGZA 4A3GG 2I5LX 3CXCA 1M90C 4DR7Q 2LXJA 4OWTB 5IT9c 2I0QA 1X65A 2F52A 4AIMA 1TWGH 2R92G 4LF4L 2R7DA 1XJVA 1NTGA 4LFAL 4BXXG 2N49A 2NZHA 5C4XH 2BH2A 4IJHA 4JI8Q 2E5LL 4OONA 2JA8H 4A3CH 3U4ZA 1N34Q 3TEHB 4POGA 3CPWA 1PHJA 3TS0A 3L0OA 3STBC 2HHHL 1AH9A 1VQ7A 1G291 1J6QA 1EWIA 4YWLA 1KIXA 1HR0Q 3RR5A 1YJ9A 3GTOH 2YTVA 2LSSA 1PH4A 1VQGA 1L0WA 4DV0Q 1FVIA 4IPDA 1YJWA 2VQEL 1YJNA 1Y1WH 3HOVH 3HOZG 2R7ZG 5JJIA 3GTQH 1EOVA 1CKOA 5ELOA 3G4SA 1XNRL 1V9PA 1ASYA 1K8GA 4LF5L 1VQJA 1VQAA 1PH6A 1Q1EA 1JJ2A 4GOPC 3ULJA 2ASBA 1WYDA 2CQOA 3GTJH 4LFCQ 1JT8A 4DR2Q 3S2DH 1IZ6A 1A8VA 1NJIC 1PH5A 3PF5A 1YITA 1Z47A 2DGYA 3W5OA 1SFOH 2WAQE 4DV7Q 1X3EA 1UWVA 4A75A 1E1TA 4NB3A 5IP7H 3G71A 1KXLA 4AH6A 3GTGH 1SR3A 5FJ8H 4OX9L 2IHFA 4A3KG 4R4OA 3I4NG 1HNZQ 3DLLA 5M5XH 3I2ZA 3STBD 3H3VH 5IYBG 1IBKQ 4JI4L 4DV6Q 1JJGA 4YY3Q 1Y14B 5GADC 5IE8A 1EIYB 4JI2L 2D0OA 3H0GG 4A3BG 2ZTEA 2WP8J 1L1OB 1EIFA 3AFPA 3MXNB 4Y7NH 4HIKA 1Q86C 2UUCL 2JQOA 4JI0L 2ALYB 2KCTA 2A8VA 1RIPA 4YCVA 1PVOA 3E9IA 5LMNQ 1XMQL 1XNQL 4GN3B 1PH7A 5DLQE 4APVA 4IJLA 1VQ8A 1N32Q 1Y1VG 2Z6KC 4L5TA 3S1QH 2UXDQ 4DK3C 2OQ0A 4FDBA 1IBML 1X6OA 2K5NA 1X55A 4YWKA 3I4MG 1SN8A 1VQMA 2YYZA 3CCEA 1FGUA 5AJ3Q 3J7A5 4DV5Q 1A62A 2FXQA 3CCSA 1C0AA 1Q12A 2VQFL 4X65Q 3NELA 4A3MG 3NEMA 2CWPA 4Y52H 2JA9A 5C0XI 2UXBQ 4P74A 3I56A 2UXCQ 3HFZB 1D7QA 3M4OH 4GS3A 1IBLL 3OYYA 4JI1L 1XPUA 2ZM6L 4DR1L 1PYSB 1LTLA 1BBUA 4X64L 4A3LH 5K36G 3K80C 2R7FA 4KHZA 3K8AA 3TRZA 3FP9A 4A3IH 3J7ZC 1FJGQ 1VQ6A 2C35B 1VQEA 4DR5Q 1AE2A 1MJEA 1CKMA 4DV4L 1QUQB 1IL2A 1XMOQ 4UPAA 4DR7L 4YCUA 5FLMH 1HNXQ 4X62Q 2PMZE 1PA6A 4R1JA 1VQ4A 2ZTCA 4X66L 4OXPA 5GROA 4JI7Q 4L5RC 4LF6Q 2VUMH 4A3EG 2IHEA 5M3FH 5GQOA 2YTYA 4LUVA 4LF7Q 2JJQA 1Z9FA 4TQUS 1N34L 3CPFA 4AYBE 4EX5A 3FHWA 3GTMH 1HR0L 2ZJPA 1I5FA 4LFBL 1MIUA 5IYCG 4A3DH 2IX1A 2PQAA 1S72A 1U0LA 2RF4A 1SROA 2PNHA 2AHOB 4DV0L 1XPRA 1OXTA 4C3HH 1E1OA 5E7NA 3HOYG 4LUZA 2K4KA 2I5MX 3U4VA 4DK6C 4DR4Q 5GAHC 3G48A 3A74A 1MKHA 4JBJA 4BY1H 2JA7H 3PO3G 2EXDA 1PV4A 5IYDH 4K0KQ 1X3GA 4LWCA 1U5KA 3NBHB 4LFCL 2MFIA 4DR2L 4JI3Q 1WCMG 3UE0A 1N33Q 2R93H 4R4TA 1YVCA 2HIVA 3HKZG 4JBWA 4DNIA 3FKIG 1NMFA 3DM3A 1KHIA 5EAYA 1OXXK 4A3FH 3T1HQ 1KD1C 2WB1E 2YV5A 3TQYA 1YI2A 3JAMc 1WI5A 4BY7G 3K7UC 3S17H 2E2JH 3K0XA 1SRUA 3K81C 1HNZL 1WJJA 5C44G 2XTIA 1IBKL 4DV6L 3LGJA 4P71A 3RNUA 1J5EQ 4IOCA 2HIXA 4QQBX 1UE7A 5HGQA 2CCZA 1OTCA 4NXMQ 3S24A 2VY3A 2MNAA 1PYBA 2H5XA 5LMNL 1VQLA 2OWOA 1HZ9A 3NENA 1Q1BA 2UUAQ 2AKWB 4ME3A 2UXDL 4OO1G 3HOUH 3UDIA 1HZAA 4A3JG 2B63H 1XTDA 2D62A 2I5HA 4JC0A 4MNOA 3S2HH 2UUBL 2EQSA 2XGTA 2OTJA 3PUXA 3U50C 4UY8C 4GNXA 4NXNQ 5AJ3L 1VQ5A 1K83H 4GLXA 4DV5L 4LW1A 1VS0A 4JI5Q 1K9MC 4OWWB 1DGSA 1YHAA 1Q82C 4X65L 3PUZA 5M5WH 1GVPA 2UXBL 1YEZA 2UXCL 1AE3A 1V1QA 2MQHA 1VCIA 2KCMA 4IPHA 4GNXB 4LNQA 1HNWQ 3JC66 1N36Q 5C4XG 2JA8G 2B29A 4A3CG 4JCVE 1TWFH 4B3TQ 3PUWA 1OXUA 1FJGL 2JK8A 2HT1A 1VQIA 4JBKA 1NY4A 4DR5L 1SMXA 4NPSA 4R4QA 1PH8A 4IPCA 1XMOL 1L1OA 2DUDA 4H02A 4QL5A 1HNXL 3F8TA 4X62L 2UU9Q 1K8AC 2ZJRA 4L5SA 3HOXH 1R9TH 2CWAA 3JAMi 3HOVG 1Y1WG 1NMGA 3PV0A 5JJKA 4WJ4A 4JI7L 4LF6L 4MTNA 4LF9Q 1VQBA 2JEBI 1O7IA 1W3SA 2L15A 3GDEA 3ULPA 4LF7L 1K0RA 1VQKA 4DR6L 2KBNA 2MO0A 4DKAC 4IFDJ 1P8LA 1UE1A 4DUYQ 4POFA 1Q81C 2OTLA 4GN5A 3RN5A 2E2IH 2A19A 2N8NA 4JI6Q 3RZOH 1CSQA 4TVAB 1CSPA 4BBSH 3AEVA 4DAYB 4HIDA 3HOWH 4GLVB 1FL0A 1JE5A 4MZ9A 2IX0A 3EBEA 1EYGA 5IP7G 4DPGA 4AQYQ 1QVGA 2JA6H 1A0IA 4A93H 5FJ8G 1K73C 4DR4L 4YHHL 1JMCA 4EQ5A 1VQNA 5BR8Q 4UP7A 4B3SQ 1YHQA 3EN2A 4K0KL 4LF8Q 3L7ZC 4LF4Q 1EUJA 1SE8A 2ID0A 2Q2IA 3A0JA 3OTOL 2JEAI 3PF4A 3W1BA 2D0PA 4JI3L 1VQPA 1N33L 4GKKL 1QUQA 2CFMA 1L2FA 1PFSA 2AMCB 3HKSA 3T1YQ 3CQZH 2LXKA 2K5HA 5M3MH 3MEFA 1X54A 1PH1A 1M1KC 3S1NH 3D31A 2K75A 2KENA 2YTXA 2HHHQ 2NVXH 3T1HL 3S16H 1T9HA 3F1ZA 2NN6G 2QA4A 1HH2P 4PZ8A 3KFUA 5JJLA 2F3IA 1VQFA 1G6PA 4J15A 3F2BA 1KQSA 4IFDG 2RHSB 4KHPQ 5C4JH 2Q2HA 2GVAA 3CCMA 2MO1A 1HR0W 3ERSX 1J5EL 1VQDA 3GTKH 1PH9A 2F4VQ 3H15A 3CMEA 4NXML 4JI8L 1GKHA 1HJPA 1TXYA 5IP9H 4JYAQ 2Y0SG 4HIMA 1I3QH 4DV3Q 3GTPH 2UUAL 3KDFA 4JBMA 1V43A 1S3OA 3AQQA 3I4OA 1Q8KA 2ATWA 4GOPB 2PI2E 4A3LG 5M5YH 1W2BA 4HJ5A 3KLWA 3PO2H 5ELNA 4JI5L 1YHBA 3TREA 2NVYH 1UE5A 3KDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV A;  4GNX C;  3K7A H;  3ICE A;  4B3R Q;  4PG3 A;  4BBR H;  1BKB A;  1IXR A;  5FLM G;  3AYH B;  3CCJ A;  3B6Y A;  3IRB A;  4JI4 Q;  3RLN A;  1TWA H;  1EFW A;  1I6H H;  1OXS C;  4RG1 A;  5C3E H;  1HNW L;  3U58 A;  2UUC Q;  2VUM G;  3CCL A;  1N36 L;  1LYL A;  5M3F G;  3BZK A;  4A93 G;  3UDX A;  1XMQ Q;  4DV7 L;  1HZC A;  1B7Y B;  3CAM A;  1KRS A;  4P73 A;  4A3G H;  1K3R A;  4L5Q A;  2A1A A;  4A3D G;  4YCW A;  2AWN A;  1X56 A;  4JV5 Q;  4O2D A;  2UU9 L;  2JA5 G;  1L1O C;  2R92 H;  5LMN W;  2VZA A;  1PH2 A;  4XIG S;  4YY3 L;  4BA1 I;  4LF9 L;  4BXX H;  1B8A A;  3TS2 A;  4OO1 I;  3CCQ A;  1ASZ A;  2QGQ A;  3M7N A;  1EQR A;  2E8G A;  4BY1 G;  2JA7 G;  2KHI A;  4UP9 A;  1OXV A;  2GVB A;  5IYD G;  4ALP A;  1B70 B;  1I94 Q;  4DUY L;  4JI6 L;  1E24 A;  5IWA Q;  2WAQ G;  1QVF A;  2R93 G;  1N32 L;  2VL6 A;  4HJ7 A;  1MJC A;  1VQ9 A;  2NVT H;  4BA2 I;  1C9O A;  3ER0 A;  4JOI A;  2GN5 A;  2R7Z H;  4A3F G;  1UEB A;  3HOZ H;  4OWX B;  4DV4 Q;  4AQY L;  3VDY A;  3PIP A;  3CW2 C;  3KF8 B;  2HQL A;  4DR3 Q;  5BR8 L;  3S1R H;  4B3S L;  4O0A A;  3KYH C;  4LF8 L;  2JE6 I;  1C7Y A;  2BA1 A;  3I7F A;  4R4I A;  3ULL A;  1P16 A;  1KRT A;  4X66 Q;  1CKN B;  2IT1 A;  1JB7 A;  2NVQ H;  3RLO A;  3E9H A;  1EQQ A;  1TWC H;  3L2P A;  3T1Y L;  4GKJ Q;  4DV2 Q;  4B3M Q;  1BBW A;  3J81 j;  1NE3 A;  2K14 A;  2RCN A;  1VQH A;  4R4C A;  4LFB Q;  3HKZ E;  3KF6 A;  1YNX A;  4JG2 A;  2QEX A;  3CCR A;  3W1G A;  4A3K H;  3HOU G;  3I4N H;  1YIJ A;  1GM5 A;  2B63 G;  1D8L A;  4KHP L;  1BVS A;  5IYB H;  1YZ6 A;  2AWO A;  5IY0 A;  4A3B H;  3H0G H;  4QIW E;  3CCU A;  2F4V L;  3KF6 B;  4LUO A;  3G6E A;  4A76 A;  1X9N A;  3S1M H;  3J81 c;  1LM0 A;  4JYA L;  3CC7 A;  3KJP A;  1IYJ B;  4DV3 L;  4PZ7 A;  4QY7 A;  3GO5 A;  2BH8 A;  3UDF A;  3ZJY C;  5H1S E;  5LMU Q;  1Q7Y C;  1Y1V H;  2B3G A;  2RHQ B;  2Q2U A;  3UDG A;  4DV1 Q;  5JEA J;  3I4M H;  3J80 c;  3PSI A;  3BZC A;  3E0E A;  4UP8 A;  5HY6 A;  4DAM A;  4DUZ Q;  1TWH H;  3H3V I;  4HJA A;  4IOA A;  2K52 A;  4B3R L;  2K50 A;  3D0F A;  4A3M H;  3CC4 A;  3CC2 A;  3A5Z B;  3RLF A;  2ZJQ A;  3HOX G;  5C0X J;  3M9B A;  3PUY A;  5J3B A;  4X6A H;  1KAW A;  2VS1 A;  3AFQ A;  4WJ3 M;  4AYB G;  1Q46 A;  4IPG A;  4LFA Q;  3CP0 A;  2NN6 I;  2V1C C;  2NZO A;  3F2D A;  2VNU D;  4HJ9 A;  2R6G A;  3M85 A;  2E5L Q;  4IFD I;  3UE1 A;  1N9W A;  1A63 A;  4HIO A;  1SLJ A;  1GD7 A;  3PCO B;  1I50 H;  2N78 A;  2K5V A;  5FLX c;  1QZG A;  4KLK A;  3CD6 A;  4A4I A;  1JJC B;  1HZB A;  2YU9 H;  4JV5 L;  4IO9 A;  2EIF A;  4XTC S;  2UUB Q;  4BBS G;  3HOW G;  2Q2T A;  1LUZ A;  2VQE Q;  2BA0 A;  2CKZ B;  1KL9 A;  1WFQ A;  1N8R C;  4C3I H;  1XNR Q;  4KI0 A;  5JEA G;  2Z0S A;  3CCV A;  5GAG C;  4A3E H;  1XPO A;  4GOP A;  1PH3 A;  4LF5 Q;  2JA6 G;  3S14 H;  4PZ6 A;  3OW2 A;  2E2H H;  1QZH A;  1I94 L;  3M4P A;  5IWA L;  3J81 i;  5IYC H;  3CF5 A;  2WB1 G;  4JOI C;  3RN2 A;  5C0X G;  1X3F A;  5M3M G;  2WFW A;  2VW9 A;  1KC8 C;  3HOY H;  3M3Y H;  4NXN L;  4A3I G;  1GO3 E;  3M4Q A;  3A5U A;  3CMA A;  2OCE A;  4DR3 L;  4OX9 Q;  3J80 i;  4C2M H;  3PO3 H;  4HJ8 A;  4P72 A;  1VQC A;  4PMW A;  3PIO A;  1WCM H;  4JI2 Q;  3Q8D A;  3SGI A;  2N3S A;  4DR6 Q;  4GKJ L;  4C3J H;  4DV2 L;  4B3M L;  4JI0 Q;  3FKI H;  3F2C A;  3GTL H;  5IP9 G;  4B3T L;  1E3P A;  5GAE C;  2Z6K A;  4GN4 B;  2ES2 A;  3GD7 A;  3KOJ A;  1XNQ Q;  2KHJ A;  3S15 H;  1E7Z A;  4BY7 H;  3BU2 A;  2ZTD A;  2JA5 H;  4P75 A;  3EIV A;  1IBM Q;  5C44 H;  3PO2 G;  1E22 A;  4RMF A;  1CUK A;  2OQK A;  4YHH Q;  2VQF Q;  2PQA B;  4BBR G;  1H95 A;  3OTO Q;  4YWM A;  5LMU L;  1QVC A;  2IY5 B;  1IBL Q;  3WWV A;  1G51 A;  4JI1 Q;  5C3E G;  3I55 A;  1VQO A;  4GKK Q;  1RL2 A;  2ZM6 Q;  1NBW A;  4DR1 Q;  4A3J H;  1S40 A;  4DV1 L;  1YBY A;  2Y0S E;  4X64 Q;  4QJF A;  4QGU A;  4DUZ L;  2PI2 A;  3KJO A;  1CKN A;  4GLA C;  1UE6 A;  1WOC A;  3BJU A;  3RZD H;  3PGZ A;  4A3G G;  2I5L X;  3CXC A;  1M90 C;  4DR7 Q;  2LXJ A;  4OWT B;  5IT9 c;  2I0Q A;  1X65 A;  2F52 A;  4AIM A;  1TWG H;  2R92 G;  4LF4 L;  2R7D A;  1XJV A;  1NTG A;  4LFA L;  4BXX G;  2N49 A;  2NZH A;  5C4X H;  2BH2 A;  4IJH A;  4JI8 Q;  2E5L L;  4OON A;  2JA8 H;  4A3C H;  3U4Z A;  1N34 Q;  3TEH B;  4POG A;  3CPW A;  1PHJ A;  3TS0 A;  3L0O A;  3STB C;  2HHH L;  1AH9 A;  1VQ7 A;  1G29 1;  1J6Q A;  1EWI A;  4YWL A;  1KIX A;  1HR0 Q;  3RR5 A;  1YJ9 A;  3GTO H;  2YTV A;  2LSS A;  1PH4 A;  1VQG A;  1L0W A;  4DV0 Q;  1FVI A;  4IPD A;  1YJW A;  2VQE L;  1YJN A;  1Y1W H;  3HOV H;  3HOZ G;  2R7Z G;  5JJI A;  3GTQ H;  1EOV A;  1CKO A;  5ELO A;  3G4S A;  1XNR L;  1V9P A;  1ASY A;  1K8G A;  4LF5 L;  1VQJ A;  1VQA A;  1PH6 A;  1Q1E A;  1JJ2 A;  4GOP C;  3ULJ A;  2ASB A;  1WYD A;  2CQO A;  3GTJ H;  4LFC Q;  1JT8 A;  4DR2 Q;  3S2D H;  1IZ6 A;  1A8V A;  1NJI C;  1PH5 A;  3PF5 A;  1YIT A;  1Z47 A;  2DGY A;  3W5O A;  1SFO H;  2WAQ E;  4DV7 Q;  1X3E A;  1UWV A;  4A75 A;  1E1T A;  4NB3 A;  5IP7 H;  3G71 A;  1KXL A;  4AH6 A;  3GTG H;  1SR3 A;  5FJ8 H;  4OX9 L;  2IHF A;  4A3K G;  4R4O A;  3I4N G;  1HNZ Q;  3DLL A;  5M5X H;  3I2Z A;  3STB D;  3H3V H;  5IYB G;  1IBK Q;  4JI4 L;  4DV6 Q;  1JJG A;  4YY3 Q;  1Y14 B;  5GAD C;  5IE8 A;  1EIY B;  4JI2 L;  2D0O A;  3H0G G;  4A3B G;  2ZTE A;  2WP8 J;  1L1O B;  1EIF A;  3AFP A;  3MXN B;  4Y7N H;  4HIK A;  1Q86 C;  2UUC L;  2JQO A;  4JI0 L;  2ALY B;  2KCT A;  2A8V A;  1RIP A;  4YCV A;  1PVO A;  3E9I A;  5LMN Q;  1XMQ L;  1XNQ L;  4GN3 B;  1PH7 A;  5DLQ E;  4APV A;  4IJL A;  1VQ8 A;  1N32 Q;  1Y1V G;  2Z6K C;  4L5T A;  3S1Q H;  2UXD Q;  4DK3 C;  2OQ0 A;  4FDB A;  1IBM L;  1X6O A;  2K5N A;  1X55 A;  4YWK A;  3I4M G;  1SN8 A;  1VQM A;  2YYZ A;  3CCE A;  1FGU A;  5AJ3 Q;  3J7A 5;  4DV5 Q;  1A62 A;  2FXQ A;  3CCS A;  1C0A A;  1Q12 A;  2VQF L;  4X65 Q;  3NEL A;  4A3M G;  3NEM A;  2CWP A;  4Y52 H;  2JA9 A;  5C0X I;  2UXB Q;  4P74 A;  3I56 A;  2UXC Q;  3HFZ B;  1D7Q A;  3M4O H;  4GS3 A;  1IBL L;  3OYY A;  4JI1 L;  1XPU A;  2ZM6 L;  4DR1 L;  1PYS B;  1LTL A;  1BBU A;  4X64 L;  4A3L H;  5K36 G;  3K80 C;  2R7F A;  4KHZ A;  3K8A A;  3TRZ A;  3FP9 A;  4A3I H;  3J7Z C;  1FJG Q;  1VQ6 A;  2C35 B;  1VQE A;  4DR5 Q;  1AE2 A;  1MJE A;  1CKM A;  4DV4 L;  1QUQ B;  1IL2 A;  1XMO Q;  4UPA A;  4DR7 L;  4YCU A;  5FLM H;  1HNX Q;  4X62 Q;  2PMZ E;  1PA6 A;  4R1J A;  1VQ4 A;  2ZTC A;  4X66 L;  4OXP A;  5GRO A;  4JI7 Q;  4L5R C;  4LF6 Q;  2VUM H;  4A3E G;  2IHE A;  5M3F H;  5GQO A;  2YTY A;  4LUV A;  4LF7 Q;  2JJQ A;  1Z9F A;  4TQU S;  1N34 L;  3CPF A;  4AYB E;  4EX5 A;  3FHW A;  3GTM H;  1HR0 L;  2ZJP A;  1I5F A;  4LFB L;  1MIU A;  5IYC G;  4A3D H;  2IX1 A;  2PQA A;  1S72 A;  1U0L A;  2RF4 A;  1SRO A;  2PNH A;  2AHO B;  4DV0 L;  1XPR A;  1OXT A;  4C3H H;  1E1O A;  5E7N A;  3HOY G;  4LUZ A;  2K4K A;  2I5M X;  3U4V A;  4DK6 C;  4DR4 Q;  5GAH C;  3G48 A;  3A74 A;  1MKH A;  4JBJ A;  4BY1 H;  2JA7 H;  3PO3 G;  2EXD A;  1PV4 A;  5IYD H;  4K0K Q;  1X3G A;  4LWC A;  1U5K A;  3NBH B;  4LFC L;  2MFI A;  4DR2 L;  4JI3 Q;  1WCM G;  3UE0 A;  1N33 Q;  2R93 H;  4R4T A;  1YVC A;  2HIV A;  3HKZ G;  4JBW A;  4DNI A;  3FKI G;  1NMF A;  3DM3 A;  1KHI A;  5EAY A;  1OXX K;  4A3F H;  3T1H Q;  1KD1 C;  2WB1 E;  2YV5 A;  3TQY A;  1YI2 A;  3JAM c;  1WI5 A;  4BY7 G;  3K7U C;  3S17 H;  2E2J H;  3K0X A;  1SRU A;  3K81 C;  1HNZ L;  1WJJ A;  5C44 G;  2XTI A;  1IBK L;  4DV6 L;  3LGJ A;  4P71 A;  3RNU A;  1J5E Q;  4IOC A;  2HIX A;  4QQB X;  1UE7 A;  5HGQ A;  2CCZ A;  1OTC A;  4NXM Q;  3S24 A;  2VY3 A;  2MNA A;  1PYB A;  2H5X A;  5LMN L;  1VQL A;  2OWO A;  1HZ9 A;  3NEN A;  1Q1B A;  2UUA Q;  2AKW B;  4ME3 A;  2UXD L;  4OO1 G;  3HOU H;  3UDI A;  1HZA A;  4A3J G;  2B63 H;  1XTD A;  2D62 A;  2I5H A;  4JC0 A;  4MNO A;  3S2H H;  2UUB L;  2EQS A;  2XGT A;  2OTJ A;  3PUX A;  3U50 C;  4UY8 C;  4GNX A;  4NXN Q;  5AJ3 L;  1VQ5 A;  1K83 H;  4GLX A;  4DV5 L;  4LW1 A;  1VS0 A;  4JI5 Q;  1K9M C;  4OWW B;  1DGS A;  1YHA A;  1Q82 C;  4X65 L;  3PUZ A;  5M5W H;  1GVP A;  2UXB L;  1YEZ A;  2UXC L;  1AE3 A;  1V1Q A;  2MQH A;  1VCI A;  2KCM A;  4IPH A;  4GNX B;  4LNQ A;  1HNW Q;  3JC6 6;  1N36 Q;  5C4X G;  2JA8 G;  2B29 A;  4A3C G;  4JCV E;  1TWF H;  4B3T Q;  3PUW A;  1OXU A;  1FJG L;  2JK8 A;  2HT1 A;  1VQI A;  4JBK A;  1NY4 A;  4DR5 L;  1SMX A;  4NPS A;  4R4Q A;  1PH8 A;  4IPC A;  1XMO L;  1L1O A;  2DUD A;  4H02 A;  4QL5 A;  1HNX L;  3F8T A;  4X62 L;  2UU9 Q;  1K8A C;  2ZJR A;  4L5S A;  3HOX H;  1R9T H;  2CWA A;  3JAM i;  3HOV G;  1Y1W G;  1NMG A;  3PV0 A;  5JJK A;  4WJ4 A;  4JI7 L;  4LF6 L;  4MTN A;  4LF9 Q;  1VQB A;  2JEB I;  1O7I A;  1W3S A;  2L15 A;  3GDE A;  3ULP A;  4LF7 L;  1K0R A;  1VQK A;  4DR6 L;  2KBN A;  2MO0 A;  4DKA C;  4IFD J;  1P8L A;  1UE1 A;  4DUY Q;  4POF A;  1Q81 C;  2OTL A;  4GN5 A;  3RN5 A;  2E2I H;  2A19 A;  2N8N A;  4JI6 Q;  3RZO H;  1CSQ A;  4TVA B;  1CSP A;  4BBS H;  3AEV A;  4DAY B;  4HID A;  3HOW H;  4GLV B;  1FL0 A;  1JE5 A;  4MZ9 A;  2IX0 A;  3EBE A;  1EYG A;  5IP7 G;  4DPG A;  4AQY Q;  1QVG A;  2JA6 H;  1A0I A;  4A93 H;  5FJ8 G;  1K73 C;  4DR4 L;  4YHH L;  1JMC A;  4EQ5 A;  1VQN A;  5BR8 Q;  4UP7 A;  4B3S Q;  1YHQ A;  3EN2 A;  4K0K L;  4LF8 Q;  3L7Z C;  4LF4 Q;  1EUJ A;  1SE8 A;  2ID0 A;  2Q2I A;  3A0J A;  3OTO L;  2JEA I;  3PF4 A;  3W1B A;  2D0P A;  4JI3 L;  1VQP A;  1N33 L;  4GKK L;  1QUQ A;  2CFM A;  1L2F A;  1PFS A;  2AMC B;  3HKS A;  3T1Y Q;  3CQZ H;  2LXK A;  2K5H A;  5M3M H;  3MEF A;  1X54 A;  1PH1 A;  1M1K C;  3S1N H;  3D31 A;  2K75 A;  2KEN A;  2YTX A;  2HHH Q;  2NVX H;  3T1H L;  3S16 H;  1T9H A;  3F1Z A;  2NN6 G;  2QA4 A;  1HH2 P;  4PZ8 A;  3KFU A;  5JJL A;  2F3I A;  1VQF A;  1G6P A;  4J15 A;  3F2B A;  1KQS A;  4IFD G;  2RHS B;  4KHP Q;  5C4J H;  2Q2H A;  2GVA A;  3CCM A;  2MO1 A;  1HR0 W;  3ERS X;  1J5E L;  1VQD A;  3GTK H;  1PH9 A;  2F4V Q;  3H15 A;  3CME A;  4NXM L;  4JI8 L;  1GKH A;  1HJP A;  1TXY A;  5IP9 H;  4JYA Q;  2Y0S G;  4HIM A;  1I3Q H;  4DV3 Q;  3GTP H;  2UUA L;  3KDF A;  4JBM A;  1V43 A;  1S3O A;  3AQQ A;  3I4O A;  1Q8K A;  2ATW A;  4GOP B;  2PI2 E;  4A3L G;  5M5Y H;  1W2B A;  4HJ5 A;  3KLW A;  3PO2 H;  5ELN A;  4JI5 L;  1YHB A;  3TRE A;  2NVY H;  1UE5 A;  3KDF B; 
#chains in the Genus database with same CATH topology
 3PUV A;  4GNX C;  4B3R Q;  1SAP A;  1IXR A;  4RHS A;  4I7Z C;  5FLM G;  5I9O A;  3CCJ A;  3DXJ C;  4JI4 Q;  1EZ8 A;  3MEH A;  1EFW A;  1I6H H;  1F9R A;  1TS2 A;  4FF1 A;  1HTL D;  1HNW L;  1KLU D;  3R2I A;  3U58 A;  4LAA A;  2VUM G;  3BZK A;  3MHB A;  4RH6 A;  2RVL A;  4KY7 A;  1ICW A;  4ZCK A;  3HOZ B;  2R7Z B;  5EPL A;  4L5Q A;  4A3D G;  2FMM A;  1X56 A;  3IL8 A;  4O2D A;  3PIP 3;  2JA5 G;  2B2U A;  5D14 A;  4BXX H;  4LF9 L;  5IGG A;  3TS2 A;  4RFB A;  4ALP A;  5IYD G;  2B8F A;  4R8I A;  2SDF A;  3W3A A;  5JOB A;  5I4D A;  2VL6 A;  1VQ9 A;  4A3K B;  1LT3 D;  4F7X A;  4JOI A;  2GN5 A;  3WOE A;  2R7Z H;  1UEB A;  3HOZ H;  1CQF A;  4DV4 Q;  3R8B A;  4DNT B;  2HQL A;  3S1M B;  4LF8 L;  2JE6 I;  2XWJ B;  4X66 Q;  1R4P B;  1FNW A;  2SNS A;  1JOO A;  4GKJ Q;  4B3M Q;  1NE3 A;  3OMC A;  3KF6 A;  1A2U A;  4A3K H;  1GM5 A;  4A93 B;  1E2Z A;  1YZ6 A;  1BCP B;  5C4H A;  5JPM C;  2JXM B;  3H0G H;  2A74 C;  5A35 A;  3BVZ A;  3S1M H;  2RDG A;  3G6E A;  4A76 A;  3J81 c;  1PXU A;  1LM0 A;  3KJP A;  1IYJ B;  1UAP A;  1MSG A;  4QY7 A;  4DV3 L;  3GO5 A;  2BH8 A;  2QCP X;  5H1S E;  5LMU Q;  1Q7Y C;  1CK1 A;  3I8Z A;  5EKK A;  2B2T A;  3J80 c;  3H3V I;  2C9O A;  5CV5 A;  1CZG A;  2K52 A;  4IUQ A;  3CC2 A;  2D5D A;  2NTT A;  5KND A;  5C0X J;  3HOX G;  2KQ3 A;  1IW7 C;  3PUY A;  1KAW A;  2VS1 A;  3AFQ A;  4IQZ A;  3GTP B;  4LFA Q;  2NN6 I;  2WKD A;  2VNU D;  5K36 H;  4HJ9 A;  2R6G A;  4IUP A;  4KY6 A;  5DEH A;  3PQI A;  4Q5V A;  3L3O C;  4JV5 L;  4IO9 A;  4EQP A;  3BYT B;  4HSV A;  3HRZ C;  2F0P A;  4HCE A;  2ZXO A;  4LF5 Q;  5F2D A;  3GTL B;  2WAC A;  1T5X D;  3CF5 A;  2XSC A;  5C0X G;  5M3M G;  1JWS D;  2GA4 B;  4J8Q A;  2VW9 A;  1KC8 C;  4NXN L;  3MVV A;  5E4W C;  1F2Z A;  4A3I G;  3M4Q A;  2OCE A;  3CRK C;  2LKV A;  3PO3 H;  5EBC A;  2K7V A;  1VQC A;  2BE5 C;  4N9P A;  1HUM A;  1EY6 A;  2F0S A;  3Q8D A;  2Q8R E;  2N3S A;  2B39 A;  2RKS A;  4DV2 L;  4NKL A;  5T1G A;  3GTL H;  1IL8 A;  4E6I A;  4ABN A;  1O80 A;  2ES2 A;  3KOJ A;  1STB A;  2XVS A;  3A8K E;  2KHJ A;  2EYP A;  1TII D;  2JA5 H;  5EJW A;  1IBM Q;  3A8J E;  3PO2 G;  5T1I A;  5I6W A;  1EFI D;  2TSS A;  1U4P A;  4XQQ A;  2PQA B;  3CHB D;  5C4X B;  1E2V A;  3D6C A;  1PFM A;  1PRT B;  3WWV A;  5C3E G;  1VQO A;  1S40 A;  2Y0S E;  2OF1 A;  3BDL A;  2J4X A;  2BE5 D;  3GQB A;  5JJZ A;  3KJO A;  3BJU A;  4KTA A;  5IT9 c;  1EWH A;  2R7D A;  4RKB A;  5C4X H;  1HQM C;  3IKJ A;  3CPW A;  3TS0 A;  3L0O A;  3EVQ A;  1AH9 A;  1VQ7 A;  1J6Q A;  1HR0 Q;  3RR5 A;  5BN5 A;  3GTG B;  2LSS A;  1GUN A;  1JOR A;  1XTC D;  1YJW A;  2VQE L;  4FXK C;  3SR1 A;  1G91 A;  1XNR L;  3V2T A;  1LTS D;  4ZUI A;  1VQJ A;  1LV9 A;  3UI2 A;  3ULJ A;  2KEE A;  1DJR D;  1WYD A;  1ESR A;  1B3A A;  2EJG C;  1PH5 A;  3PF5 A;  1TS3 A;  2DGY A;  3S1Q B;  3W5O A;  4CJ0 B;  4DV7 Q;  2A68 C;  3K5L A;  2V4D A;  5IP7 H;  1U4L A;  3GTG H;  1EEI D;  3MXN A;  4OX9 L;  2IHF A;  2RA4 A;  2B2Y A;  5ELC A;  1HNZ Q;  3S14 B;  2KVM A;  4JI4 L;  1EIY B;  4A3B G;  3HEJ A;  2ZTE A;  2WP8 J;  1TS5 A;  4HIK A;  4ID6 A;  2RDF A;  4J1M A;  4YCV A;  1PVO A;  1Q90 A;  2VB2 X;  3WOF A;  1XNQ L;  4XQJ A;  4GN3 B;  4ZLT F;  4APV A;  4IJL A;  2UXD Q;  2Z6K C;  3S1Q H;  1K8M A;  4IFD H;  4FDB A;  1PZJ D;  5G3L F;  4RKL A;  3U9O A;  1S4Z A;  3J7A 5;  1A62 A;  2FXQ A;  3CCS A;  1STH A;  1G2T A;  5EGT A;  4PV1 C;  4MN3 A;  1RHP A;  4A3M G;  3NEM A;  2H4O A;  2JA9 A;  1D7Q A;  2UXC Q;  3MFY A;  1IYU A;  1Y69 U;  1IBL L;  3GTM B;  1XPU A;  1NNX A;  1PYS B;  5CBA E;  2EZV A;  1BBU A;  4HMI A;  2R7F A;  2IWH A;  3K8A A;  1G8Z D;  4CGY B;  3AMU A;  3FP9 A;  1DOL A;  3A7A B;  4A3I H;  1VQ6 A;  1Q8I A;  5BN4 A;  1LLR D;  2C35 B;  3QOJ A;  3KK7 A;  1K28 A;  4DV4 L;  4UPA A;  4OIK A;  1HNX Q;  2PMZ E;  4BY1 B;  2JA7 B;  1F2Y A;  3NQI A;  4KN4 C;  4QUC A;  1SE3 A;  2ZTC A;  4X66 L;  2XWB B;  5GRO A;  2EOT A;  4V19 0;  1E2W A;  4A3E G;  5KYI A;  5M3F H;  5KNC A;  3FDT A;  4LUV A;  2JJQ A;  1Z9F A;  4TQU S;  4A3J B;  1N34 L;  4FVM A;  4N8F A;  1HA6 A;  1ONL A;  3FHW A;  3GTM H;  5IYC G;  2PQA A;  1S72 A;  2PNH A;  5IT9 L;  2PZU A;  3ND8 A;  2PQE A;  3HOY G;  5E7N A;  1RCV D;  1FGB D;  2K4K A;  1SE2 A;  4XT1 B;  5GAH C;  4M1U B;  2H1E A;  4BY1 H;  2JA7 H;  1PV4 A;  4K0K Q;  1X3G A;  4LWC A;  4K8I A;  1MD2 D;  4DR2 L;  2HCI A;  3UE0 A;  2K32 A;  1KDC A;  3HKZ G;  4G7O C;  3S2H B;  3FRP B;  2MGS A;  5EAY A;  1KD1 C;  2WB1 E;  2YV5 A;  3AB9 A;  3E0J A;  1Y1W B;  3K7U C;  3K0X A;  4H13 C;  4DV6 L;  2NTS A;  3C1E A;  3LGJ A;  1SDF A;  1SJH D;  1SNC A;  4QQB X;  3P1H A;  3SXH A;  2F03 A;  2CH4 A;  2L11 A;  5KGU A;  5EBD A;  2MNA A;  5LMN L;  4H44 C;  1STA A;  2C5C A;  2OWO A;  2AKW B;  3S2H H;  1GUS A;  2OTJ A;  4UY8 C;  1SYG A;  1WTX A;  4GNX A;  4GLX A;  1Z7T A;  3HG9 A;  4X65 L;  2F0M A;  4U67 3;  2F0F A;  2KJX A;  2HCC A;  1HNW Q;  3JC6 6;  1PFN A;  4JCV E;  3HOW B;  4A3C G;  1VQI A;  5CV4 A;  4DR5 L;  4NPS A;  5ELE A;  5CC4 A;  1XMO L;  1EY5 A;  2EDG A;  2CWA A;  3JAM i;  3HOV G;  3X3N A;  2IW3 A;  4LF6 L;  3M4O B;  4F87 A;  1VQB A;  2JEB I;  4LF9 Q;  1GJX A;  4DAY A;  3ULP A;  3TN2 A;  3T56 B;  3F2U A;  3LNN A;  1Q81 C;  4KKS A;  1CSQ A;  1RD9 D;  3EA6 A;  4RCN A;  1EY0 A;  3AEV A;  3HOW H;  5C4J B;  4P2C B;  1G6Z A;  1WTQ A;  1JMC A;  1VQN A;  4UP7 A;  1YHQ A;  3VA7 A;  4LF8 Q;  4LF4 Q;  1V1O A;  3EQL C;  1S5B D;  2D0P A;  4JI3 L;  4MTK A;  1SNQ A;  3HKS A;  5FKA C;  3MTS A;  1PH1 A;  3D31 A;  2KEN A;  2YTX A;  4PNY A;  3F1Z A;  3KFU A;  4C1N K;  3DUZ A;  3F2B A;  2RHS B;  1D1K A;  5C4J H;  2GVA A;  1KLG D;  4HED A;  1J5E L;  2L5T A;  2TMP A;  1F2M A;  1B3Q A;  3CME A;  1HJP A;  2SEB D;  4FP5 D;  1I3Q H;  4RGT A;  4DV3 Q;  2UUA L;  3SE0 A;  1V43 A;  3AQQ A;  3P20 A;  4A3L G;  2R92 B;  2PYK A;  5FLX E;  3KDF B;  4KHV A;  4UHV A;  4IUR A;  3E3X A;  3B6Y A;  1TWA H;  4RG1 A;  1D6E C;  3VR4 A;  4C1N I;  1N36 L;  3HOU B;  5C5L A;  1B2T A;  2N88 A;  2B63 B;  2RDH A;  1PDQ A;  4DV7 L;  2BDO A;  1HZC A;  1B7Y B;  3CAM A;  2CHB D;  4P73 A;  4A3G H;  2A1A A;  1L0Y B;  4JV5 Q;  1YNJ C;  4B08 A;  1PTO F;  2R92 H;  4C3H G;  1PH2 A;  5C3X A;  3DWP A;  4CDF C;  3CCQ A;  1TWC B;  1Q3L A;  1EQR A;  2KHI A;  4UP9 A;  1OXV A;  2GVB A;  5JVH 3;  4DUY L;  4S3S A;  1E24 A;  2DY8 A;  2WAQ G;  3SK8 A;  2R93 G;  5G3L D;  3ER0 A;  4RGO S;  1B1Z A;  1CTM A;  1A3U A;  2RQX A;  2MP1 A;  4AYB B;  4PMB A;  2ZJQ A;  3KYH C;  1MSH A;  3I7F A;  1BUV T;  2IT1 A;  3VA5 A;  3C3L A;  1TWC H;  1YNJ D;  4DV2 Q;  1BBW A;  3FMC A;  4FF4 A;  1O7Z A;  3S9W A;  2PZT A;  2RCN A;  4O1N A;  2VB3 X;  3SHL A;  4KY5 A;  1AZQ A;  3CCR A;  1BR9 A;  1D8L A;  4KHP L;  4ZQ3 A;  5IYB H;  1SYC A;  2F4V L;  3KF6 B;  4LUO A;  5FO7 B;  3X3M A;  3UDF A;  2NBF A;  2NB0 A;  3T51 B;  2P5Z X;  2RHQ B;  1HFN A;  3UDG A;  3A54 A;  1GUT A;  1WTO A;  3GP7 A;  4UP8 A;  3D4W A;  4IOA A;  1ZEQ X;  2K04 A;  2MHV A;  5EKI A;  3M9B A;  1EU4 A;  1UEA B;  5J3B A;  3CP0 A;  3O13 A;  5BN3 A;  3G6J B;  4K5X A;  3F2D A;  3M85 A;  4IFD I;  3UE1 A;  3QIA A;  1A63 A;  1BQQ T;  1EYC A;  4KN7 C;  1AFP A;  1SMY C;  3CD6 A;  5NUC A;  3BS1 A;  1JJC B;  1UUP A;  2Z8L A;  2A5H A;  1A3T A;  1GOZ A;  4BBS G;  4KKU A;  4JVZ A;  4RCO A;  3NHH A;  2VQE Q;  2CKZ B;  1WFQ A;  4C3I H;  1CA5 A;  1XNR Q;  1I6H B;  2Z0S A;  2JA6 G;  4A93 G;  1PH3 A;  2L9H A;  4C3J B;  5CMD A;  4G57 A;  2E74 C;  1I94 L;  3DEP A;  3NPP A;  4B9X A;  4K14 A;  5I9P A;  3J81 i;  3RN2 A;  3IFD A;  2FHT A;  2IJ0 A;  3OIP A;  3DHQ A;  4V0B A;  5CYU A;  2F0D A;  1GO3 E;  4MHE A;  4DR3 L;  2OXP A;  4OX9 Q;  3L9A X;  3J80 i;  2RBM A;  1KAB A;  2AQ1 B;  1TS4 A;  2F0N A;  1SMY D;  2F0Q A;  2QW7 A;  4DGZ A;  3SGI A;  3VYT A;  2CVR A;  4C3J H;  3FKI H;  5GAE C;  4GN4 B;  2Z6K A;  1S5C D;  1XNQ Q;  2WIN B;  2F0E A;  1E7Z A;  4BY7 H;  3R2T A;  3NE5 B;  3BU2 A;  3EIV A;  3QOL A;  2K5W A;  2KEC A;  5IGD A;  2DN8 A;  3QG1 A;  4DK1 A;  3V96 A;  4BBR G;  5DM6 3;  1H95 A;  4XDX A;  2JA8 B;  1IBL Q;  3I55 A;  4OO1 H;  1RL2 A;  4RHR A;  2ZT9 C;  1YBY A;  3GV3 A;  1TY0 A;  1BO0 A;  4DUZ L;  1EYA A;  2XIW A;  5COY A;  3NWT A;  2CQA A;  3OIQ A;  3H0G B;  2LXJ A;  2I0Q A;  1IHZ A;  4AIM A;  4LF4 L;  1XJV A;  1CA6 A;  4OEL B;  3I3C A;  2NZH A;  1EY8 A;  4JI8 Q;  2JA8 H;  4OON A;  1N34 Q;  5E1F A;  2E76 C;  2K5D A;  3STB C;  1KIX A;  1YJ9 A;  5C3W A;  3TP7 A;  3KBG A;  2RCF A;  1QNK A;  1FVI A;  1YJN A;  4FNF A;  4EGV A;  4PQX A;  5JJI A;  1EOV A;  1STN A;  4R9W A;  3G4S A;  1K8G A;  3JAM E;  3I90 A;  3K58 A;  4K6L A;  1VQA A;  1PTO C;  2EY1 A;  1HFG A;  4WFN 3;  2QF7 A;  4GOP C;  2ASB A;  4DR2 Q;  1NJI C;  3KUP A;  5KNB A;  4CDC C;  2K03 A;  2EY2 A;  1X3E A;  1DCZ A;  1E1T A;  1HXY D;  4NB3 A;  3RUZ A;  3DWA A;  3VYR A;  4DU9 A;  2F4I A;  1KTK A;  3I4N G;  3STB D;  4DV6 Q;  4YY3 Q;  5GAD C;  3VR2 A;  1F9Q A;  1OO9 B;  1LTB D;  3AFP A;  3MXN B;  4JI0 L;  2HD3 A;  2JQO A;  1RIP A;  3E9I A;  5LMN Q;  4OL7 A;  1Y1V G;  2EVB A;  2B2V C;  1B4O A;  1PTO D;  3K59 A;  1X6O A;  2K5N A;  1X55 A;  1H9K A;  4OEM B;  5EPJ A;  3I4M G;  1VQM A;  3PO3 B;  1TR5 A;  1Q12 A;  2ZXR A;  3EJI A;  5KIX A;  3NEL A;  4X65 Q;  4Y52 H;  4XYO A;  4ZRZ A;  3HFZ B;  5E4X A;  4JI1 L;  3V05 A;  2ZM6 L;  4DR1 L;  4X64 L;  4KHZ A;  1JWU D;  1D2B A;  3TRZ A;  4DN4 M;  2JA5 B;  5IIF A;  4DR5 Q;  1AE2 A;  1MJE A;  1BXT A;  1XMO Q;  4DR7 L;  5FLM H;  2M9V A;  3NK9 A;  2F0J A;  4L5R C;  4LF6 Q;  1HUN A;  2VUM H;  2YTY A;  3CPF A;  4EX5 A;  5LL6 S;  3H3V C;  2A6E C;  2ZJP A;  1W6K A;  1MIU A;  4A3D H;  1SRO A;  5JPN C;  2AHO B;  2E2J B;  4DV0 L;  1XPR A;  3ONA B;  3VYU A;  1E1O A;  1B9N A;  2I5M X;  1X3Q A;  4DK6 C;  3A74 A;  2EJF C;  1JQY D;  3T53 B;  5IYD H;  2BCO A;  1U5K A;  2L55 A;  2MFI A;  4KJO A;  4JI3 Q;  1WCM G;  4CDE C;  4R4T A;  1YVC A;  2HIV A;  2K6A A;  4HCS A;  3DM3 A;  1KHI A;  2XN9 C;  3TQY A;  5JVG 3;  1NR2 A;  1EQT A;  2F3V A;  2E2J H;  5C44 G;  1IBK L;  1S5F D;  2A6E D;  4DXG A;  1J5E Q;  4IOC A;  5CGK A;  3TP8 A;  1DD2 A;  2VY3 A;  2G5D A;  1PYB A;  2H5X A;  1HZ9 A;  2UUA Q;  1WVL A;  1HZA A;  4A3J G;  1XTD A;  4MNO A;  3RD4 A;  1C4Q A;  2XGT A;  3BYY B;  3MFG A;  1RDP D;  3HOX B;  4IUV A;  4FF2 A;  5AJ3 L;  4DV5 L;  1K9M C;  1DGS A;  5J22 A;  2XRQ D;  5K5P A;  3PUZ A;  5M5W H;  1GVP A;  1YEZ A;  3TZU A;  4IUN A;  1VCI A;  4IPH A;  4GNX B;  3RZO B;  1QOH A;  2AUJ D;  1Y8P B;  1N36 Q;  4N9T A;  5IOD A;  3PUW A;  1RJT A;  1NY4 A;  1SMX A;  4R4Q A;  5COR A;  2DUD A;  3F8T A;  4LJZ C;  3E6Z X;  2ZJR A;  1K8A C;  3HOX H;  1IKM A;  3J7A F;  1Y1W G;  1EYD A;  2Y0S B;  4H7B A;  1QB5 D;  3T13 A;  3GDE A;  3CQZ B;  2KBN A;  2MO0 A;  5M3M B;  4QF4 A;  2OTL A;  1PMR A;  4DUY Q;  1L0X B;  3RZO H;  2N8N A;  4A3I B;  4UAI A;  4EQN A;  1I4R A;  4DAY B;  4CKC A;  1K3B C;  4MZ9 A;  4FO2 A;  4DR4 L;  3GTK B;  3A7L A;  4N8X 1;  5FJ8 G;  1K73 C;  3CKI B;  2NWG A;  5D3I B;  2O5I C;  1BBX C;  3EN2 A;  5M3F B;  3L7Z C;  1SE8 A;  2ID0 A;  2Q2I A;  1BCP F;  2J7Z A;  3LX0 A;  3MXU A;  1D5M C;  3W1B A;  3FVQ A;  1SE4 A;  1PLF A;  5I2Y A;  3CQZ H;  5C0X H;  2K5H A;  5M3M H;  3MEF A;  1M1K C;  3S1N H;  3J81 E;  2K75 A;  2HHH Q;  3T1H L;  3PO2 B;  4X3K A;  2QA4 A;  2NN6 G;  1NUC A;  3OMG A;  2SNM A;  2BOS A;  4KHP Q;  2Q2H A;  1JR0 D;  3VR6 A;  3J80 E;  4ZK9 B;  1HR0 W;  3K5N A;  1S5E D;  1KNE A;  3GTK H;  5C3E B;  2F4V Q;  4WOR A;  4NXM L;  1II3 A;  4JI8 L;  1TXY A;  2X6L A;  1LTI D;  4HIM A;  4JBM A;  4CJ2 C;  1S3O A;  3H09 A;  4GOP B;  1B44 D;  2PI2 E;  5C5M A;  1ZYR C;  2EE1 A;  2K05 A;  3R3O A;  5LHY 1;  4HJ5 A;  3PO2 H;  5ELN A;  2F0G A;  4ILW A;  4JOI C;  1SYE A;  1UE5 A;  1I4G A;  3K7A H;  4CJ1 B;  4PG3 A;  3I91 A;  1BKB A;  1XWE A;  4HMJ A;  3RLN A;  1NCV A;  1HRJ A;  1OXS C;  5C3E H;  2RSO A;  1EEF D;  1EWC A;  2X6G A;  2UUC Q;  3CCL A;  2K28 A;  1X3P A;  3H6M A;  3UDX A;  1XMQ Q;  4WJW A;  3Q23 A;  5A2Q L;  1KRS A;  3PMF A;  3EFX D;  4U68 A;  1K3R A;  3A56 A;  2UU9 L;  3NTH A;  1L1O C;  2HDM A;  2Z4I A;  1O7L A;  1A15 A;  4XIG S;  4BA1 I;  4YY3 L;  3ERO A;  2NVQ B;  4OO1 I;  1ZYR D;  1ASZ A;  3M7N A;  2K1B A;  1VF5 C;  2E8G A;  1ET6 A;  1I94 Q;  4JI6 L;  1TT2 A;  2PMZ B;  3CU7 A;  2NVT H;  4BA2 I;  1J8I A;  1JOQ A;  4IN3 A;  4A3F G;  1G2S A;  3I73 A;  4AQY L;  3PIP A;  3CW2 C;  3KF8 B;  3MC0 B;  4DR3 Q;  3D8G A;  4NDX A;  4WRD A;  4B3S L;  3LWU A;  2F0U A;  4ZKC B;  3ULL A;  2NVQ H;  3RLO A;  1F9S A;  3E9H A;  1EQQ A;  3T1Y L;  5EPK A;  1CZW A;  2K14 A;  4QUF A;  4R4C A;  4XT3 B;  3FPU B;  4IUT A;  1U4R A;  2Z4H A;  3HKZ E;  4LFB Q;  1PZK D;  1PRT F;  4JG2 A;  3HOU G;  1EQV A;  2B63 G;  1BVS A;  2AWO A;  1ZKO A;  1GXD C;  3K0Y A;  5IY0 A;  4A3B H;  4QIW E;  3CCU A;  2F0L A;  3C1F A;  2WB1 B;  4ODG A;  5IT9 E;  5FLX L;  3D4D A;  2EYH A;  2B3G A;  4M8A A;  2Q2U A;  3BDC A;  1H9M A;  3T4A C;  2YU9 B;  3MXP A;  5JEA J;  3VR3 A;  4DAM A;  3BZC A;  4DUZ Q;  5E3F A;  1KDA A;  4HJA A;  2JYO A;  2K50 A;  3D0F A;  4A3E B;  4A3M H;  3QO2 A;  2F0W A;  3NBI A;  3CC4 A;  3A5Z B;  4H0L C;  2AQ2 B;  2KA7 A;  2E2H B;  1M4V A;  1NR4 A;  4AYB G;  1Q46 A;  4IPG A;  1I3Q B;  2K5Q A;  3K57 A;  2NUC A;  1CHP D;  5IGE A;  2R3Z A;  4CHT B;  4HIO A;  4K2L A;  1ROD A;  1SLJ A;  3PCO B;  1QG7 A;  4DK0 A;  3HOY B;  2N78 A;  2K5V A;  1QZG A;  4KLK A;  2DJG C;  3KLS A;  2EYL A;  2YU9 H;  1J9O A;  2UUB Q;  4XTC S;  2Q2T A;  1SYB A;  1LUZ A;  1HTP A;  2BA0 A;  1AW7 A;  4G7Z C;  1N8R C;  1TWA B;  1DOM A;  4KI0 A;  5JEA G;  4A3E H;  5GAG C;  2WV6 D;  2EXZ A;  4GOP A;  3VYS A;  2E2H H;  3TP5 A;  5IWA L;  1DOK A;  4QMG A;  5IYC H;  3S15 B;  1SEB D;  4A3G B;  1X3F A;  1MGS A;  3BZD B;  2WFW A;  3HOY H;  3M3Y H;  3DEO A;  1CFM A;  3A5U A;  1FNU A;  4C2M H;  4GZY C;  3Q24 A;  1PFB A;  4P72 A;  4PMW A;  3PIO A;  2EPB A;  2Z6B A;  5FOB B;  4DR6 Q;  2R61 A;  3I72 A;  2LY7 A;  4JI0 Q;  3QWN A;  5IP9 G;  1E3P A;  1FYC A;  4K2K A;  3S15 H;  2EYJ A;  4BWG B;  3RZD B;  2B2W C;  4P75 A;  3BDO A;  3OHX C;  4RGM A;  1CUK A;  1I4Q A;  4OIJ A;  3BG3 A;  1AZP A;  4KD3 A;  1GUG A;  3OTO Q;  1QVC A;  2LFN A;  4KK7 A;  3ND9 A;  2IY5 B;  1GHJ A;  4JI1 Q;  2ZM6 Q;  3KF8 A;  4DR1 Q;  4G4K A;  4DV1 L;  4X64 Q;  1JCK B;  2PI2 A;  3HOV B;  4GLA C;  1QCB D;  1WOC A;  2Z9H A;  3DWQ A;  4X3S A;  3RZD H;  3CXC A;  5J39 A;  4DR7 Q;  1RTN A;  2B2Y C;  4DFA A;  1BCP D;  1TWG H;  2KED A;  3CRL C;  1NTG A;  1ENC A;  3GTJ B;  1ESF A;  1RF2 D;  1Z6H A;  4BXX G;  3S2D B;  2N49 A;  2BH2 A;  2E5L L;  4A3C H;  3U4Z A;  2DNC A;  3TEH B;  4POG A;  1HPC A;  2QIL A;  2HHH L;  2KOL A;  1EWI A;  5CV6 A;  3GTO H;  1HCZ A;  2YTV A;  2JP1 A;  4DV0 Q;  5M5X B;  3HOV H;  3H94 A;  3Q0A A;  2I46 A;  3HOZ G;  2R7Z G;  1CKO A;  1CT1 D;  5ELO A;  1V9P A;  1ASY A;  1C8C A;  1PH6 A;  1Q1E A;  5IOC A;  3OW7 A;  1JT8 A;  4I7A A;  3GTJ H;  3ZYY X;  3S2D H;  1IZ6 A;  1A8V A;  1SNM A;  3NTK A;  5M9O A;  2PO4 A;  2MPM A;  2WAQ E;  1F2L A;  2OEO A;  4A75 A;  2I07 B;  1SR3 A;  2PW7 A;  2L1B A;  4A3K G;  3NP8 A;  4C3I B;  2F0H A;  2PZW A;  3DLL A;  5M5X H;  1K0S A;  1IBK Q;  1JJG A;  1LAC A;  5HUR A;  1Y14 B;  1ZXT A;  3OSO A;  4JI2 L;  3H0G G;  1V8Q A;  1L1O B;  1EIF A;  2UUC L;  2G9H D;  1Q86 C;  4DF7 A;  1JC7 A;  1TKW B;  4X3U A;  3I70 A;  2A8V A;  1XMQ L;  1PH7 A;  1SSO A;  3OOC A;  1VQ8 A;  1N32 Q;  1WTP A;  1XXG A;  4DK3 C;  2OQ0 A;  4YWK A;  4EQO A;  1HQR D;  3CCE A;  5AJ3 Q;  4DV5 Q;  1PRT C;  1C0A A;  2VQF L;  2E75 C;  2CWP A;  1FD7 D;  5C0X I;  4P74 A;  3FKI B;  1LTG D;  4CBV A;  4A3L H;  5K36 G;  3K80 C;  3M4Y A;  4ME5 A;  4BY7 B;  3OPO A;  4C3H B;  3C2P A;  1ENA A;  1VQE A;  1CKM A;  1QUQ B;  4YCU A;  4TKO B;  2Z1C A;  4Q0F A;  3SDZ A;  1PA6 A;  4R1J A;  4BS9 A;  2WAQ B;  2LS0 1;  4OXP A;  2R93 B;  2IHE A;  4KKT A;  3BVM A;  3OWE B;  3TDQ A;  1TVX A;  2L0C A;  3TP6 A;  2AUK A;  1PRT D;  4L8J A;  4LFB L;  3M7G A;  4CDD C;  3MZ5 A;  1U0L A;  1D1I A;  4C3H H;  4LUZ A;  1I6V C;  3U4V A;  4DR4 Q;  4DAV A;  2FJ2 A;  3PO3 G;  3HZX A;  4LFC L;  4KD4 A;  2R93 H;  4RWS C;  4HR7 B;  4B9W A;  1DZ1 A;  5FO9 B;  3T1H Q;  2WII B;  1VF7 A;  1YI2 A;  4DA2 A;  2FFK B;  1SRU A;  1WJJ A;  3MAQ A;  1WD1 A;  3RNU A;  2HIX A;  3TZD A;  1RKN A;  1B50 A;  5HGQ A;  1OTC A;  4NXM Q;  1C48 A;  3NEN A;  1Q1B A;  4ME3 A;  3WDN A;  2I5H A;  4JC0 A;  2UUB L;  2EQS A;  3Q22 A;  3PUX A;  3U50 C;  1R9T B;  1VS0 A;  1Q82 C;  3SK4 A;  3TME A;  4OGQ C;  2UXB L;  2MQH A;  1QE6 A;  4XQN A;  4LNQ A;  2E2I B;  2KCC A;  2NZ1 D;  1EY9 A;  5C4X G;  2B29 A;  4BBS B;  4B3T Q;  1OXU A;  1FJG L;  1KNA A;  2JK8 A;  4JBK A;  3ERQ A;  4IPC A;  2A73 B;  1L1O A;  1LT5 D;  4TSS A;  4H02 A;  2JA6 B;  4QL5 A;  4X62 L;  2UU9 Q;  4L5S A;  5DAU A;  2BDN A;  1R9T H;  4F88 A;  5KRU A;  1LT6 D;  5JJK A;  4WJ4 A;  2O2L D;  3HP3 A;  4JI7 L;  1W3S A;  2L15 A;  4DR6 L;  4LF7 L;  1K0R A;  1XX8 A;  5IGC A;  4DKA C;  4IFD J;  1P8L A;  4JI6 Q;  3S16 B;  4GN5 A;  5DNF A;  3RN5 A;  2E2I H;  4TVA B;  4BBS H;  4HID A;  4GLV B;  4G7H C;  1FL0 A;  1JE5 A;  1TU2 B;  2IX3 A;  2DNE A;  2EYM A;  2FMC A;  5IP7 G;  4AQY Q;  4JPB W;  2JA6 H;  1A0I A;  4A93 H;  1QWY A;  4B3S Q;  2VUM B;  3C46 A;  2MJ8 A;  3A0J A;  3OTO L;  3PF4 A;  1HHV A;  1VQP A;  1N33 L;  5D3D A;  1I4P A;  1QUQ A;  2CFM A;  1L2F A;  2AMC B;  4K5V A;  3T1Y Q;  2KHS A;  4ZYS A;  4A3D B;  1BF4 A;  5M5Y B;  3P7J A;  3S16 H;  1H9S B;  4IUU A;  5JJL A;  1HH2 P;  2PW5 A;  4IAL A;  1I4X A;  1VQF A;  4J15 A;  4IFD G;  4BBR B;  2EYO A;  5I2X A;  3CCM A;  4UDU C;  1VQD A;  2A69 C;  3PIO 3;  1PH9 A;  2XNA C;  1F9P A;  2Y0S G;  1AN8 A;  3GTP H;  3SVM A;  3HS0 C;  3I4O A;  5JAV A;  3N6R A;  1Q8K A;  2ATW A;  1IW7 D;  5M5Y H;  1W2B A;  3IFT A;  4JI5 L;  3TRE A;  3DMU A;  3ICE A;  4BBR H;  5EKL A;  3AYH B;  4ZUJ A;  1EY7 A;  3IRB A;  2LMC B;  1EIG A;  4KV6 A;  2F1M A;  2PNR C;  1Y8O B;  1STE A;  4JW0 A;  1SNO A;  1LYL A;  5M3F G;  4L6T B;  1BNZ A;  5ISR A;  1ICF B;  2A69 D;  3A8I E;  4RAU C;  4CKB A;  4HSP A;  4MIU A;  2AWN A;  4YCW A;  1WTH A;  1CHQ D;  2JSO A;  3S1R B;  3SEB A;  5LMN W;  2VZA A;  5M5W B;  2G9D A;  1B8A A;  2QGQ A;  3RMH A;  4BY1 G;  2JA7 G;  2DJF C;  1B70 B;  3FPP A;  5IWA Q;  1QVF A;  4HAE A;  1N32 L;  2IL8 A;  1R4Q B;  4HJ7 A;  1MJC A;  4LK1 C;  3I4N B;  1YNN C;  1C9O A;  1S5D D;  1EZ6 A;  1SJE D;  4C56 C;  4OWX B;  1LTT D;  3K6O A;  5L37 A;  3VDY A;  3VR5 A;  3J81 L;  5BR8 L;  3S1R H;  4O0A A;  1WTV A;  2ICI A;  3J7Y W;  2BA1 A;  1M8A A;  1C7Y A;  1AP0 A;  4R4I A;  1P16 A;  1KRT A;  1JB7 A;  1CKN B;  4FYD A;  1Y1V B;  1MHW C;  3L2P A;  2ICE C;  3J80 L;  5C6A A;  3J81 j;  3I4M B;  1VQH A;  1TWH B;  2B2W A;  1YNX A;  1KDB A;  3GV6 A;  5AFW A;  3W1G A;  2QEX A;  5I6Y A;  1ILQ A;  2K01 A;  1YIJ A;  3I4N H;  4NMZ A;  3D4R A;  2N55 A;  4ZKB B;  1T5E A;  4FXD A;  2PPB C;  2VXW A;  1V1P B;  4KJN A;  4O42 A;  1X9N A;  3J7A V;  1YNN D;  3MWY W;  4JYA L;  3K5M A;  3CC7 A;  4YIJ A;  4F8M A;  4PZ7 A;  3ZJY C;  3S1N B;  1I50 B;  1Y1V H;  3E5S A;  3N52 A;  4DV1 Q;  1Y8N B;  3I4M H;  4IZ8 A;  3PSI A;  3E0E A;  5HY6 A;  1TWH H;  2PCF B;  3ITP A;  4B3R L;  1IYV A;  3P75 A;  3QJY A;  3RLF A;  1H9S A;  4X6A H;  3FEW X;  4WJ3 M;  5LL6 X;  2V1C C;  2NZO A;  1IKL A;  3NUC A;  1JB3 A;  2E5L Q;  4K8J A;  1N9W A;  1GD7 A;  1I50 H;  3R93 A;  5FLX c;  1AEX A;  3H91 A;  4A4I A;  1HZB A;  1ML0 D;  2AQ3 B;  2EIF A;  3AU7 A;  3K7A B;  3HOW G;  1H9R A;  1DXM A;  2EY5 A;  5CR3 A;  3OWF A;  1KL9 A;  1KAA A;  2B2U C;  1WCM B;  3CCV A;  3G7L A;  1XPO A;  3S14 H;  2A68 D;  4PZ6 A;  3OW2 A;  2F0K A;  1QZH A;  3M4P A;  1CQV A;  1GUW A;  2WB1 G;  2MUY A;  3D6W A;  4TRD A;  1PTO B;  2M00 A;  4FXG C;  5C44 B;  1BOS A;  5ELF A;  3CMA A;  2HDL A;  4HJ8 A;  1F77 A;  1WCM H;  4JI2 Q;  1BDO A;  1EIH A;  4GKJ L;  4B3M L;  3F2C A;  3IAY A;  1JOK A;  4B3T L;  2RSN A;  1B9M A;  2F0T A;  2NVT B;  3GD7 A;  5EQ0 A;  2K33 A;  2QDL A;  1JE4 A;  1NAP A;  2ZTD A;  2SOB A;  1PTO H;  2F0V A;  1ENF A;  1DM0 B;  5C44 H;  1SND A;  3URY A;  1PZI D;  2XRS D;  1E22 A;  1DYQ A;  4RMF A;  2OQK A;  4YHH Q;  2VQF Q;  5ELD A;  3MXG A;  3A55 A;  4YWM A;  4LMQ D;  5LMU L;  4GKK Q;  1G51 A;  1EU3 A;  1CM9 A;  1NBW A;  3MA2 B;  4A3J H;  4QGU A;  4QJF A;  4R8N A;  1XYI A;  5KYL A;  1RTO A;  1O78 A;  2B2T C;  5IGB A;  1CKN A;  1UE6 A;  3GTQ B;  3KLS X;  3PGZ A;  4A3G G;  2I5L X;  1LAB A;  1M90 C;  4A3B B;  4OWT B;  5CV7 A;  1X65 A;  1VMP A;  2KUM A;  2F52 A;  2R92 G;  4LFA L;  1NSN S;  1WTW A;  4IJH A;  2ENB A;  5J1Z A;  1SFO B;  1PHJ A;  1H9J A;  1G29 1;  4YWL A;  1V1P A;  4I65 A;  2WKC A;  2NYZ D;  1PH4 A;  1VQG A;  2QKI C;  1L0W A;  3NTI A;  1O7Y A;  4IPD A;  4A3M B;  1Y1W H;  3GTQ H;  4LF5 L;  1K8O A;  1TQO A;  4Y7N B;  1JJ2 A;  1WD0 A;  2CQO A;  2CW0 C;  4LFC Q;  1SNP A;  1UNS A;  1STY A;  1YIT A;  1Z47 A;  1W6J A;  1SFO H;  4QB4 A;  1QNU A;  3SK6 A;  1UWV A;  1VDZ A;  3G71 A;  1KXL A;  4AH6 A;  2OT2 A;  5FJ8 H;  4R4O A;  3I2Z A;  1FR3 A;  3H3V H;  5IYB G;  2JN4 A;  5A2Q E;  4OHJ A;  5IE8 A;  2D0O A;  4Y7N H;  3NXW A;  1LTA D;  2ALY B;  2KCT A;  2NN6 H;  5DLQ E;  1B53 A;  3M3Y B;  3NWS A;  4L5T A;  2EY6 A;  1A6X A;  4L63 B;  1IBM L;  4C2M B;  2CW0 D;  1SBB B;  1SN8 A;  2YYZ A;  4HTH A;  3TBI B;  1FGU A;  2HQE A;  5IGF A;  1VMC A;  3HKZ B;  2UXB Q;  1A3V A;  3I56 A;  3M4O H;  4GS3 A;  2EJM A;  3OYY A;  1QJO A;  5KEE A;  1LTL A;  1D5Z C;  4QIW B;  3J7Z C;  1FJG Q;  4PMC A;  1IL2 A;  3KLR A;  4X62 Q;  1SYF A;  1VQ4 A;  1FNV A;  4JI7 Q;  4C3I G;  2F3W A;  5GQO A;  4LF7 Q;  4AYB E;  4A3F B;  1HR0 L;  1BCP C;  1I5F A;  5D65 A;  4K5W A;  5FK9 C;  2B2V A;  2IX1 A;  2RF4 A;  2IPK D;  3S17 B;  4NW2 A;  1OXT A;  4RGN A;  1TWG B;  5FO8 B;  3G48 A;  4DNR B;  1MKH A;  1SYD A;  4JBJ A;  2EXD A;  3NBH B;  3I4L A;  1N33 Q;  1U4M A;  2Q8I B;  3GTO B;  4JBW A;  4C3J G;  4DNI A;  3FKI G;  1NMF A;  1WTR A;  1OXX K;  4A3F H;  2F0O A;  3T16 A;  1K83 B;  3TSS A;  3JAM c;  2QDB A;  1WI5 A;  4BY7 G;  4J6H A;  3S17 H;  3K81 C;  1HNZ L;  3K5O A;  2J0T D;  3DM1 A;  4RA8 A;  1LO5 D;  2XTI A;  4P71 A;  4NP5 A;  4DAP A;  3KBX A;  3QB3 A;  1UE7 A;  2CCZ A;  3S24 A;  2QEJ C;  5DM7 3;  1TWF B;  2D2C C;  3U9S A;  4X3T A;  1VQL A;  4XYQ A;  1DON A;  2UXD L;  2EYF A;  3HOU H;  4OO1 G;  3UDI A;  3NQT A;  2B63 H;  5C4Z A;  2D62 A;  3SK5 A;  1SXT A;  2DY7 A;  4NXN Q;  1VQ5 A;  1JIC A;  1K83 H;  2L4N A;  3QR8 A;  4LW1 A;  4JI5 Q;  4OWW B;  1YHA A;  1PYW D;  1TY2 A;  4DXF A;  2M2L A;  4ULL A;  2UXC L;  1AE3 A;  2CH4 W;  2HUG A;  3LWE A;  1V1Q A;  2KCM A;  3W2D A;  2JA8 G;  1I4H A;  1TWF H;  2Q8T A;  3D3R A;  1HA5 A;  1U9R A;  2HT1 A;  2X69 A;  4HN7 A;  1PH8 A;  2L12 A;  1EL0 A;  1HNX L;  2A6H C;  4ZAI A;  1JWM D;  2E2D C;  1NMG A;  3PV0 A;  1ILP A;  4MTN A;  5CBE E;  1O7I A;  1STG A;  1LTR D;  2D9U A;  1E0B A;  2KCN A;  1VQK A;  5HGT A;  5CV8 A;  1UE1 A;  4POF A;  2NVX B;  2A19 A;  1MBY A;  2FIN B;  4EVO A;  4Z9C B;  4XXE A;  3HGB A;  1CSP A;  5ELB A;  2IX0 A;  3EBE A;  1EYG A;  4DPG A;  1QVG A;  1X32 A;  5JEA H;  2ZXP A;  4YHH L;  4EQ5 A;  5BR8 Q;  4JK1 C;  1GUO A;  4K0K L;  1EUJ A;  2JEA I;  1GHK A;  4GKK L;  1EY4 A;  1PFS A;  2A6H D;  2LXK A;  1X54 A;  2NVX H;  1EOT A;  1MI2 A;  1T9H A;  2O5J C;  4PZ8 A;  4KMU C;  1QIL A;  2NVY B;  2F3I A;  3BVG A;  4FF3 A;  1G6P A;  2B8G A;  1KQS A;  2MO1 A;  3ERS X;  1A2T A;  4CKE A;  2F0I A;  1ET9 A;  1D5X C;  3H15 A;  1GKH A;  5IP9 H;  2O4X A;  4JYA Q;  4QCL A;  3KDF A;  1CI3 M;  3JAM L;  5TSS A;  4K6D A;  1LT4 D;  3KLW A;  3NBH A;  3Q6S A;  1YHB A;  2NVY H;  5CV9 A;  3NSW A; 
#chains in the Genus database with same CATH homology
 3PUV A;  4GNX C;  3K7A H;  3ICE A;  4B3R Q;  4PG3 A;  4BBR H;  1BKB A;  1IXR A;  5FLM G;  3AYH B;  3CCJ A;  3B6Y A;  3IRB A;  4JI4 Q;  3RLN A;  1TWA H;  1EFW A;  1I6H H;  1OXS C;  4RG1 A;  5C3E H;  1HNW L;  3U58 A;  2UUC Q;  2VUM G;  3CCL A;  1N36 L;  1LYL A;  5M3F G;  3BZK A;  4A93 G;  3UDX A;  1XMQ Q;  4DV7 L;  1HZC A;  1B7Y B;  3CAM A;  1KRS A;  4P73 A;  4A3G H;  1K3R A;  4L5Q A;  2A1A A;  4A3D G;  4YCW A;  2AWN A;  1X56 A;  4JV5 Q;  4O2D A;  2UU9 L;  2JA5 G;  1L1O C;  2R92 H;  5LMN W;  2VZA A;  1PH2 A;  4XIG S;  4YY3 L;  4BA1 I;  4LF9 L;  4BXX H;  1B8A A;  3TS2 A;  4OO1 I;  3CCQ A;  1ASZ A;  2QGQ A;  3M7N A;  1EQR A;  2E8G A;  4BY1 G;  2JA7 G;  2KHI A;  4UP9 A;  1OXV A;  2GVB A;  5IYD G;  4ALP A;  1B70 B;  1I94 Q;  4DUY L;  4JI6 L;  1E24 A;  5IWA Q;  2WAQ G;  1QVF A;  2R93 G;  1N32 L;  2VL6 A;  4HJ7 A;  1MJC A;  1VQ9 A;  2NVT H;  4BA2 I;  1C9O A;  3ER0 A;  4JOI A;  2GN5 A;  2R7Z H;  4A3F G;  1UEB A;  3HOZ H;  4OWX B;  4DV4 Q;  4AQY L;  3VDY A;  3PIP A;  3CW2 C;  3KF8 B;  2HQL A;  4DR3 Q;  5BR8 L;  3S1R H;  4B3S L;  4O0A A;  3KYH C;  4LF8 L;  2JE6 I;  1C7Y A;  2BA1 A;  3I7F A;  4R4I A;  3ULL A;  1P16 A;  1KRT A;  4X66 Q;  1CKN B;  2IT1 A;  1JB7 A;  2NVQ H;  3RLO A;  3E9H A;  1EQQ A;  1TWC H;  3L2P A;  3T1Y L;  4GKJ Q;  4DV2 Q;  4B3M Q;  1BBW A;  3J81 j;  1NE3 A;  2K14 A;  2RCN A;  1VQH A;  4R4C A;  4LFB Q;  3HKZ E;  3KF6 A;  1YNX A;  4JG2 A;  2QEX A;  3CCR A;  3W1G A;  4A3K H;  3HOU G;  3I4N H;  1YIJ A;  1GM5 A;  2B63 G;  1D8L A;  4KHP L;  1BVS A;  5IYB H;  1YZ6 A;  2AWO A;  5IY0 A;  4A3B H;  3H0G H;  4QIW E;  3CCU A;  2F4V L;  3KF6 B;  4LUO A;  3G6E A;  4A76 A;  1X9N A;  3S1M H;  3J81 c;  1LM0 A;  4JYA L;  3CC7 A;  3KJP A;  1IYJ B;  4DV3 L;  4PZ7 A;  4QY7 A;  3GO5 A;  2BH8 A;  3UDF A;  3ZJY C;  5H1S E;  5LMU Q;  1Q7Y C;  1Y1V H;  2B3G A;  2RHQ B;  2Q2U A;  3UDG A;  4DV1 Q;  5JEA J;  3I4M H;  3J80 c;  3PSI A;  3BZC A;  3E0E A;  4UP8 A;  5HY6 A;  4DAM A;  4DUZ Q;  1TWH H;  3H3V I;  4HJA A;  4IOA A;  2K52 A;  4B3R L;  2K50 A;  3D0F A;  4A3M H;  3CC4 A;  3CC2 A;  3A5Z B;  3RLF A;  2ZJQ A;  3HOX G;  5C0X J;  3M9B A;  3PUY A;  5J3B A;  4X6A H;  1KAW A;  2VS1 A;  3AFQ A;  4WJ3 M;  4AYB G;  1Q46 A;  4IPG A;  4LFA Q;  3CP0 A;  2NN6 I;  2V1C C;  2NZO A;  3F2D A;  2VNU D;  4HJ9 A;  2R6G A;  3M85 A;  2E5L Q;  4IFD I;  3UE1 A;  1N9W A;  1A63 A;  4HIO A;  1SLJ A;  1GD7 A;  3PCO B;  1I50 H;  2N78 A;  2K5V A;  5FLX c;  1QZG A;  4KLK A;  3CD6 A;  4A4I A;  1JJC B;  1HZB A;  2YU9 H;  4JV5 L;  4IO9 A;  2EIF A;  4XTC S;  2UUB Q;  4BBS G;  3HOW G;  2Q2T A;  1LUZ A;  2VQE Q;  2BA0 A;  2CKZ B;  1KL9 A;  1WFQ A;  1N8R C;  4C3I H;  1XNR Q;  4KI0 A;  5JEA G;  2Z0S A;  3CCV A;  5GAG C;  4A3E H;  1XPO A;  4GOP A;  1PH3 A;  4LF5 Q;  2JA6 G;  3S14 H;  4PZ6 A;  3OW2 A;  2E2H H;  1QZH A;  1I94 L;  3M4P A;  5IWA L;  3J81 i;  5IYC H;  3CF5 A;  2WB1 G;  4JOI C;  3RN2 A;  5C0X G;  1X3F A;  5M3M G;  2WFW A;  2VW9 A;  1KC8 C;  3HOY H;  3M3Y H;  4NXN L;  4A3I G;  1GO3 E;  3M4Q A;  3A5U A;  3CMA A;  2OCE A;  4DR3 L;  4OX9 Q;  3J80 i;  4C2M H;  3PO3 H;  4HJ8 A;  4P72 A;  1VQC A;  4PMW A;  3PIO A;  1WCM H;  4JI2 Q;  3Q8D A;  3SGI A;  2N3S A;  4DR6 Q;  4GKJ L;  4C3J H;  4DV2 L;  4B3M L;  4JI0 Q;  3FKI H;  3F2C A;  3GTL H;  5IP9 G;  4B3T L;  1E3P A;  5GAE C;  2Z6K A;  4GN4 B;  2ES2 A;  3GD7 A;  3KOJ A;  1XNQ Q;  2KHJ A;  3S15 H;  1E7Z A;  4BY7 H;  3BU2 A;  2ZTD A;  2JA5 H;  4P75 A;  3EIV A;  1IBM Q;  5C44 H;  3PO2 G;  1E22 A;  4RMF A;  1CUK A;  2OQK A;  4YHH Q;  2VQF Q;  2PQA B;  4BBR G;  1H95 A;  3OTO Q;  4YWM A;  5LMU L;  1QVC A;  2IY5 B;  1IBL Q;  3WWV A;  1G51 A;  4JI1 Q;  5C3E G;  3I55 A;  1VQO A;  4GKK Q;  1RL2 A;  2ZM6 Q;  1NBW A;  4DR1 Q;  4A3J H;  1S40 A;  4DV1 L;  1YBY A;  2Y0S E;  4X64 Q;  4QJF A;  4QGU A;  4DUZ L;  2PI2 A;  3KJO A;  1CKN A;  4GLA C;  1UE6 A;  1WOC A;  3BJU A;  3RZD H;  3PGZ A;  4A3G G;  2I5L X;  3CXC A;  1M90 C;  4DR7 Q;  2LXJ A;  4OWT B;  5IT9 c;  2I0Q A;  1X65 A;  2F52 A;  4AIM A;  1TWG H;  2R92 G;  4LF4 L;  2R7D A;  1XJV A;  1NTG A;  4LFA L;  4BXX G;  2N49 A;  2NZH A;  5C4X H;  2BH2 A;  4IJH A;  4JI8 Q;  2E5L L;  4OON A;  2JA8 H;  4A3C H;  3U4Z A;  1N34 Q;  3TEH B;  4POG A;  3CPW A;  1PHJ A;  3TS0 A;  3L0O A;  3STB C;  2HHH L;  1AH9 A;  1VQ7 A;  1G29 1;  1J6Q A;  1EWI A;  4YWL A;  1KIX A;  1HR0 Q;  3RR5 A;  1YJ9 A;  3GTO H;  2YTV A;  2LSS A;  1PH4 A;  1VQG A;  1L0W A;  4DV0 Q;  1FVI A;  4IPD A;  1YJW A;  2VQE L;  1YJN A;  1Y1W H;  3HOV H;  3HOZ G;  2R7Z G;  5JJI A;  3GTQ H;  1EOV A;  1CKO A;  5ELO A;  3G4S A;  1XNR L;  1V9P A;  1ASY A;  1K8G A;  4LF5 L;  1VQJ A;  1VQA A;  1PH6 A;  1Q1E A;  1JJ2 A;  4GOP C;  3ULJ A;  2ASB A;  1WYD A;  2CQO A;  3GTJ H;  4LFC Q;  1JT8 A;  4DR2 Q;  3S2D H;  1IZ6 A;  1A8V A;  1NJI C;  1PH5 A;  3PF5 A;  1YIT A;  1Z47 A;  2DGY A;  3W5O A;  1SFO H;  2WAQ E;  4DV7 Q;  1X3E A;  1UWV A;  4A75 A;  1E1T A;  4NB3 A;  5IP7 H;  3G71 A;  1KXL A;  4AH6 A;  3GTG H;  1SR3 A;  5FJ8 H;  4OX9 L;  2IHF A;  4A3K G;  4R4O A;  3I4N G;  1HNZ Q;  3DLL A;  5M5X H;  3I2Z A;  3STB D;  3H3V H;  5IYB G;  1IBK Q;  4JI4 L;  4DV6 Q;  1JJG A;  4YY3 Q;  1Y14 B;  5GAD C;  5IE8 A;  1EIY B;  4JI2 L;  2D0O A;  3H0G G;  4A3B G;  2ZTE A;  2WP8 J;  1L1O B;  1EIF A;  3AFP A;  3MXN B;  4Y7N H;  4HIK A;  1Q86 C;  2UUC L;  2JQO A;  4JI0 L;  2ALY B;  2KCT A;  2A8V A;  1RIP A;  4YCV A;  1PVO A;  3E9I A;  5LMN Q;  1XMQ L;  1XNQ L;  4GN3 B;  1PH7 A;  5DLQ E;  4APV A;  4IJL A;  1VQ8 A;  1N32 Q;  1Y1V G;  2Z6K C;  4L5T A;  3S1Q H;  2UXD Q;  4DK3 C;  2OQ0 A;  4FDB A;  1IBM L;  1X6O A;  2K5N A;  1X55 A;  4YWK A;  3I4M G;  1SN8 A;  1VQM A;  2YYZ A;  3CCE A;  1FGU A;  5AJ3 Q;  3J7A 5;  4DV5 Q;  1A62 A;  2FXQ A;  3CCS A;  1C0A A;  1Q12 A;  2VQF L;  4X65 Q;  3NEL A;  4A3M G;  3NEM A;  2CWP A;  4Y52 H;  2JA9 A;  5C0X I;  2UXB Q;  4P74 A;  3I56 A;  2UXC Q;  3HFZ B;  1D7Q A;  3M4O H;  4GS3 A;  1IBL L;  3OYY A;  4JI1 L;  1XPU A;  2ZM6 L;  4DR1 L;  1PYS B;  1LTL A;  1BBU A;  4X64 L;  4A3L H;  5K36 G;  3K80 C;  2R7F A;  4KHZ A;  3K8A A;  3TRZ A;  3FP9 A;  4A3I H;  3J7Z C;  1FJG Q;  1VQ6 A;  2C35 B;  1VQE A;  4DR5 Q;  1AE2 A;  1MJE A;  1CKM A;  4DV4 L;  1QUQ B;  1IL2 A;  1XMO Q;  4UPA A;  4DR7 L;  4YCU A;  5FLM H;  1HNX Q;  4X62 Q;  2PMZ E;  1PA6 A;  4R1J A;  1VQ4 A;  2ZTC A;  4X66 L;  4OXP A;  5GRO A;  4JI7 Q;  4L5R C;  4LF6 Q;  2VUM H;  4A3E G;  2IHE A;  5M3F H;  5GQO A;  2YTY A;  4LUV A;  4LF7 Q;  2JJQ A;  1Z9F A;  4TQU S;  1N34 L;  3CPF A;  4AYB E;  4EX5 A;  3FHW A;  3GTM H;  1HR0 L;  2ZJP A;  1I5F A;  4LFB L;  1MIU A;  5IYC G;  4A3D H;  2IX1 A;  2PQA A;  1S72 A;  1U0L A;  2RF4 A;  1SRO A;  2PNH A;  2AHO B;  4DV0 L;  1XPR A;  1OXT A;  4C3H H;  1E1O A;  5E7N A;  3HOY G;  4LUZ A;  2K4K A;  2I5M X;  3U4V A;  4DK6 C;  4DR4 Q;  5GAH C;  3G48 A;  3A74 A;  1MKH A;  4JBJ A;  4BY1 H;  2JA7 H;  3PO3 G;  2EXD A;  1PV4 A;  5IYD H;  4K0K Q;  1X3G A;  4LWC A;  1U5K A;  3NBH B;  4LFC L;  2MFI A;  4DR2 L;  4JI3 Q;  1WCM G;  3UE0 A;  1N33 Q;  2R93 H;  4R4T A;  1YVC A;  2HIV A;  3HKZ G;  4JBW A;  4DNI A;  3FKI G;  1NMF A;  3DM3 A;  1KHI A;  5EAY A;  1OXX K;  4A3F H;  3T1H Q;  1KD1 C;  2WB1 E;  2YV5 A;  3TQY A;  1YI2 A;  3JAM c;  1WI5 A;  4BY7 G;  3K7U C;  3S17 H;  2E2J H;  3K0X A;  1SRU A;  3K81 C;  1HNZ L;  1WJJ A;  5C44 G;  2XTI A;  1IBK L;  4DV6 L;  3LGJ A;  4P71 A;  3RNU A;  1J5E Q;  4IOC A;  2HIX A;  4QQB X;  1UE7 A;  5HGQ A;  2CCZ A;  1OTC A;  4NXM Q;  3S24 A;  2VY3 A;  2MNA A;  1PYB A;  2H5X A;  5LMN L;  1VQL A;  2OWO A;  1HZ9 A;  3NEN A;  1Q1B A;  2UUA Q;  2AKW B;  4ME3 A;  2UXD L;  4OO1 G;  3HOU H;  3UDI A;  1HZA A;  4A3J G;  2B63 H;  1XTD A;  2D62 A;  2I5H A;  4JC0 A;  4MNO A;  3S2H H;  2UUB L;  2EQS A;  2XGT A;  2OTJ A;  3PUX A;  3U50 C;  4UY8 C;  4GNX A;  4NXN Q;  5AJ3 L;  1VQ5 A;  1K83 H;  4GLX A;  4DV5 L;  4LW1 A;  1VS0 A;  4JI5 Q;  1K9M C;  4OWW B;  1DGS A;  1YHA A;  1Q82 C;  4X65 L;  3PUZ A;  5M5W H;  1GVP A;  2UXB L;  1YEZ A;  2UXC L;  1AE3 A;  1V1Q A;  2MQH A;  1VCI A;  2KCM A;  4IPH A;  4GNX B;  4LNQ A;  1HNW Q;  3JC6 6;  1N36 Q;  5C4X G;  2JA8 G;  2B29 A;  4A3C G;  4JCV E;  1TWF H;  4B3T Q;  3PUW A;  1OXU A;  1FJG L;  2JK8 A;  2HT1 A;  1VQI A;  4JBK A;  1NY4 A;  4DR5 L;  1SMX A;  4NPS A;  4R4Q A;  1PH8 A;  4IPC A;  1XMO L;  1L1O A;  2DUD A;  4H02 A;  4QL5 A;  1HNX L;  3F8T A;  4X62 L;  2UU9 Q;  1K8A C;  2ZJR A;  4L5S A;  3HOX H;  1R9T H;  2CWA A;  3JAM i;  3HOV G;  1Y1W G;  1NMG A;  3PV0 A;  5JJK A;  4WJ4 A;  4JI7 L;  4LF6 L;  4MTN A;  4LF9 Q;  1VQB A;  2JEB I;  1O7I A;  1W3S A;  2L15 A;  3GDE A;  3ULP A;  4LF7 L;  1K0R A;  1VQK A;  4DR6 L;  2KBN A;  2MO0 A;  4DKA C;  4IFD J;  1P8L A;  1UE1 A;  4DUY Q;  4POF A;  1Q81 C;  2OTL A;  4GN5 A;  3RN5 A;  2E2I H;  2A19 A;  2N8N A;  4JI6 Q;  3RZO H;  1CSQ A;  4TVA B;  1CSP A;  4BBS H;  3AEV A;  4DAY B;  4HID A;  3HOW H;  4GLV B;  1FL0 A;  1JE5 A;  4MZ9 A;  2IX0 A;  3EBE A;  1EYG A;  5IP7 G;  4DPG A;  4AQY Q;  1QVG A;  2JA6 H;  1A0I A;  4A93 H;  5FJ8 G;  1K73 C;  4DR4 L;  4YHH L;  1JMC A;  4EQ5 A;  1VQN A;  5BR8 Q;  4UP7 A;  4B3S Q;  1YHQ A;  3EN2 A;  4K0K L;  4LF8 Q;  3L7Z C;  4LF4 Q;  1EUJ A;  1SE8 A;  2ID0 A;  2Q2I A;  3A0J A;  3OTO L;  2JEA I;  3PF4 A;  3W1B A;  2D0P A;  4JI3 L;  1VQP A;  1N33 L;  4GKK L;  1QUQ A;  2CFM A;  1L2F A;  1PFS A;  2AMC B;  3HKS A;  3T1Y Q;  3CQZ H;  2LXK A;  2K5H A;  5M3M H;  3MEF A;  1X54 A;  1PH1 A;  1M1K C;  3S1N H;  3D31 A;  2K75 A;  2KEN A;  2YTX A;  2HHH Q;  2NVX H;  3T1H L;  3S16 H;  1T9H A;  3F1Z A;  2NN6 G;  2QA4 A;  1HH2 P;  4PZ8 A;  3KFU A;  5JJL A;  2F3I A;  1VQF A;  1G6P A;  4J15 A;  3F2B A;  1KQS A;  4IFD G;  2RHS B;  4KHP Q;  5C4J H;  2Q2H A;  2GVA A;  3CCM A;  2MO1 A;  1HR0 W;  3ERS X;  1J5E L;  1VQD A;  3GTK H;  1PH9 A;  2F4V Q;  3H15 A;  3CME A;  4NXM L;  4JI8 L;  1GKH A;  1HJP A;  1TXY A;  5IP9 H;  4JYA Q;  2Y0S G;  4HIM A;  1I3Q H;  4DV3 Q;  3GTP H;  2UUA L;  3KDF A;  4JBM A;  1V43 A;  1S3O A;  3AQQ A;  3I4O A;  1Q8K A;  2ATW A;  4GOP B;  2PI2 E;  4A3L G;  5M5Y H;  1W2B A;  4HJ5 A;  3KLW A;  3PO2 H;  5ELN A;  4JI5 L;  1YHB A;  3TRE A;  2NVY H;  1UE5 A;  3KDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...