1FGUA

Ssdna-binding domain of the large subunit of replication protein a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
MSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the major single-stranded DNA-binding domain of replication protein A suggests a dynamic mechanism for DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT
total genus 49
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF16900 REPA_OB_2 Replication protein A OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fguA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fguA02
4X64L 1QVGA 4DR5Q 2D62A 3S14H 1X6OA 1AH9A 5IE8A 3HOZH 1X3EA 1YBYA 1AE2A 1PH1A 1SROA 2AMCB 1N32Q 1S3OA 3T1HL 2R6GA 4BY7G 2UUCL 2MQHA 4L5TA 5IT9c 2IY5B 5C44G 1LTLA 3HOXG 4LF8Q 2MFIA 1EIYB 5C44H 3HOXH 3HOWH 4KHPL 1YNXA 5C0XJ 1JJ2A 4JI2L 2VUMH 4IOAA 2AKWB 1E22A 4IO9A 4JI8L 5ELNA 4DR1L 4YHHL 3T1YL 3I4NH 3L2PA 1JJGA 3M4PA 4X66L 3VDYA 2CCZA 3G4SA 3S1RH 1A62A 1OXVA 1I94L 1N33L 1L1OB 3S1NH 5BR8L 1CSPA 3GTPH 4IPHA 5IP9G 1PA6A 2R7DA 3KF6A 4DNIA 4IOCA 1WCMG 3JAMi 4YCVA 1L1OC 5IYCH 1CSQA 4MNOA 4XIGS 4JG2A 4AIMA 4JI3L 1MJEA 2WAQG 4OX9Q 4DV2Q 2WB1E 4JYAQ 2QEXA 1YVCA 4X64Q 2K5NA 1CKNB 2Z6KA 3BZKA 3HOZG 3W5OA 1QUQB 1QVFA 1HJPA 4YCUA 1Q1EA 2KHJA 2VY3A 2YTVA 5ELOA 4YY3L 3JAMc 3S2DH 4GLVB 2OCEA 4DUYQ 1LM0A 3KDFB 1XMQQ 4A3EH 3M9BA 4QL5A 4HJ7A 5AJ3L 3PO3G 4BY7H 2UXCL 1JT8A 4X62Q 4LF7Q 5M3MG 4GKJL 4R4OA 4DAMA 1YJNA 1HZCA 3S16H 2IHEA 2ATWA 2VUMG 1U5KA 4MTNA 1K83H 3K7UC 1L2FA 4PMWA 2E2JH 3U50C 2UXBQ 4GNXB 2CFMA 1N8RC 2Y0SG 3AYHB 1VQ4A 1Q46A 2QGQA 1HR0W 1HR0Q 4R1JA 2ZM6L 1VQCA 4O0AA 2HHHQ 4RG1A 2PQAA 1Z9FA 1J5EQ 4JBMA 1FVIA 5IP9H 2EXDA 5GAGC 2VW9A 4IFDG 4HJAA 3GO5A 1RL2A 1FJGQ 4B3SL 4EQ5A 1PVOA 3L0OA 1EQRA 5K36G 1VQ8A 2IHFA 3A0JA 2LXKA 2VQEQ 3S1MH 1XPUA 1K0RA 2EIFA 1BKBA 2MO1A 3DM3A 3PCOB 1XPRA 1U0LA 3UE0A 1W2BA 3STBD 2N8NA 5IYBG 2IX1A 4YHHQ 3LGJA 5GAHC 3I56A 4B3TL 1TWGH 2OTLA 5DLQE 4A3FG 2JA9A 1GO3E 2F3IA 1XMOQ 4JI0Q 2WFWA 4DV1Q 1H95A 4AH6A 3FKIG 3RN2A 2V1CC 4HIKA 2K5VA 2MO0A 1W3SA 4LF9Q 4GOPB 2PI2E 1PH7A 3PIPA 4UY8C 1XMOL 4JI0L 4A3LH 1ASZA 1N32L 5M5WH 3WWVA 4BY1H 3PGZA 3CMAA 1D7QA 2WP8J 2BH8A 4WJ3M 5M5YH 1WCMH 4QJFA 4HJ9A 5M3FG 1OTCA 3GTGH 3HOUH 3RZOH 2E5LL 1YJ9A 1KAWA 3FP9A 1JJCB 5E7NA 3ULJA 2LSSA 1X55A 2PNHA 5C3EG 3F8TA 5C0XI 1N36L 4OO1I 3CCUA 4O2DA 1LYLA 3A5ZB 4A3IG 2R92H 4X65L 4R4TA 3HOVG 1C0AA 2AWOA 4JI1Q 1X3FA 3H3VH 1YHBA 1E1TA 1HZBA 2RHSB 3ULPA 1K73C 2A8VA 2BA0A 2N78A 1QVCA 3I55A 1X56A 2ASBA 4POFA 4OWTB 1VQ7A 2JA8H 2UXDQ 1C9OA 2C35B 3JC66 4R4CA 3S24A 2I5MX 1SFOH 1NTGA 3B6YA 2RCNA 1XNRL 1B8AA 3KJOA 4DUZL 1S40A 3GTKH 4BXXH 1X54A 4DV4Q 1IBMQ 4JCVE 4DAYB 4B3RL 4GLXA 3RN5A 1VCIA 4IPCA 3RNUA 4GKKQ 4JI6Q 1N34Q 3K7AH 2UXCQ 5JJIA 4LFBQ 3A5UA 4KHZA 2ALYB 2Q2HA 4PG3A 4C3JH 1NBWA 3TS0A 1A8VA 3F1ZA 4JI8Q 3CPWA 2R92G 3HOVH 2KENA 4IFDJ 2R93H 4LUOA 2RHQB 4A3CH 3KDFA 1HR0L 1B7YB 3GDEA 3J80i 4LF6Q 4K0KQ 1B70B 1HZAA 1IBKQ 4QQBX 1MIUA 4DPGA 1JMCA 1CKNA 5IYDH 3OW2A 4A3MH 4JI3Q 3ER0A 2HIXA 1WJJA 2K4KA 3EBEA 2UUAL 1PH2A 3CC2A 3U4ZA 2I0QA 3K81C 3L7ZC 1CKOA 2NZHA 2JA5G 4L5QA 1HH2P 1V9PA 3K80C 2Q2IA 4KHPQ 1Q12A 4OO1G 1OXSC 1VQFA 4BXXG 2BA1A 1HNWQ 4DK3C 3T1YQ 4UPAA 1VQBA 2I5HA 3PUVA 1VQDA 4GN4B 3M4OH 2ZTDA 4DV2L 3HOWG 3GTJH 3MXNB 3E0EA 1HNXQ 3NENA 4JI7L 2NN6I 3UDGA 4JV5L 4JOIC 1PH6A 1V1QA 4LUVA 3HOYH 3I4MH 4DR2Q 3GTOH 3M85A 1NE3A 1Q82C 2NVQH 4GLAC 3ICEA 2K75A 4IPDA 2UU9L 2ZJQA 5BR8Q 3CQZH 4DV0Q 5LMNQ 1K9MC 1T9HA 1N33Q 4JBKA 3NBHB 2CQOA 3CMEA 1HZ9A 4LW1A 4P74A 2NZOA 1Z47A 5M3FH 3PUXA 3G6EA 2K52A 2E8GA 5IYBH 2B63H 4MZ9A 2JEBI 1K8GA 4KI0A 1IL2A 4L5SA 1VQ6A 2Z0SA 4YY3Q 4AQYQ 1MJCA 1NJIC 1XPOA 3RLOA 3CCQA 3PIOA 1C7YA 3K8AA 2KCTA 4Y52H 4Y7NH 5H1SE 4A75A 5LMNL 2F4VL 1E1OA 2VS1A 1IBLL 2OQKA 4OONA 1K8AC 1FL0A 2JEAI 1PYBA 3K0XA 3CCEA 1Q7YC 3J81i 2F4VQ 2N49A 2JA6H 2GN5A 2D0OA 4C3HH 2AWNA 2NVXH 3E9HA 1HNXL 1G51A 4LFBL 1QZGA 2D0PA 2FXQA 4AYBG 3F2BA 4KLKA 3M3YH 5GROA 2HT1A 3S2HH 1HNWL 2B63G 4GKKL 1Q8KA 3CCJA 1XNQQ 1KHIA 5FLMH 4A3DH 4X66Q 4DV4L 4APVA 1X3GA 3M7NA 3U4VA 4DR3L 2B3GA 2BH2A 4LFAL 3H3VI 1TXYA 2OQ0A 4GNXC 2JA5H 1KXLA 3KF6B 2CKZB 2UUCQ 1RIPA 4BBRG 4JV5Q 4NXNQ 4JI1L 1P8LA 4JI4Q 4LF9L 5C4JH 2JA7G 2KHIA 2WB1G 4LWCA 1SR3A 1SN8A 3G71A 1N36Q 1SE8A 3CW2C 4P73A 4BBSG 4DR6Q 2JK8A 4QIWE 1I5FA 2WAQE 2GVAA 3E9IA 4A93H 5JEAJ 4A3LG 4QY7A 4BBRH 5JEAG 3CAMA 1EUJA 1R9TH 3TEHB 1VQMA 1A0IA 4JI5Q 4JI6L 3I7FA 2XTIA 3RLFA 1BVSA 2ID0A 2VL6A 4YWKA 3UE1A 4A3FH 1VQNA 4DV3Q 2E2HH 2JA7H 3J7A5 5LMUQ 4BBSH 3FHWA 4GS3A 1IBKL 3S1QH 2JJQA 1YEZA 1IYJB 1J5EL 3RZDH 1UE5A 2I5LX 1KC8C 1ASYA 3J7ZC 2Z6KC 5IWAQ 4QGUA 2JE6I 1EQQA 4R4QA 4K0KL 1EYGA 3CC4A 4DV6L 3CXCA 3KF8B 4HIMA 2R93G 4A3JG 5HGQA 3AQQA 3UDIA 3HFZB 3RR5A 1WYDA 4GKJQ 4IJHA 4X62L 4LF7L 3S15H 1I6HH 1IXRA 2LXJA 4DR4Q 3SGIA 2JQOA 3S17H 2NVYH 2R7ZG 3CCRA 1IBML 2EQSA 2A19A 4A3MG 2PI2A 1G6PA 2B29A 4B3MQ 4GN3B 1VQJA 5IY0A 4YWLA 1Y1VH 3CF5A 3AEVA 4XTCS 3HOYG 4DV6Q 1WI5A 1MKHA 3PV0A 1GKHA 4DKAC 4DV7L 5FJ8H 1XNRQ 2N3SA 4DR7Q 5IYCG 1E24A 4OX9L 4LFCL 1YI2A 1EFWA 1XJVA 3KJPA 1NMFA 2IX0A 1KIXA 4DR2L 1SMXA 1I3QH 4HJ8A 4DV5Q 2NVTH 2VNUD 2GVBA 4A3JH 4P72A 2K50A 1PH4A 2AHOB 4DR4L 3D0FA 3FKIH 3J81c 3DLLA 1EIFA 3I4MG 2UUBL 4NXML 1PYSB 4L5RC 4YCWA 3A74A 2IT1A 4EX5A 4A3GH 1L1OA 3J81j 1VQHA 2H5XA 3KOJA 4P71A 2MNAA 1UWVA 2PMZE 1HNZL 4DUZQ 2ES2A 4GOPA 5IWAL 1BBWA 1UE6A 3W1BA 1Y1WG 1EOVA 3CD6A 2UXDL 4OWWB 4X6AH 4DV5L 4JBJA 2QA4A 1UE1A 4PZ7A 1VQKA 3H15A 3ULLA 3I4NG 2YTXA 3OTOQ 1PV4A 1YHAA 3TREA 5JJLA 5LMNW 1SLJA 3KLWA 3UDFA 2KCMA 1CKMA 2Q2TA 3KFUA 3STBC 1PH8A 1TWHH 2NN6G 1KD1C 2UUBQ 1QZHA 5GAEC 1PFSA 4FDBA 3EIVA 4DR5L 3UDXA 1IZ6A 4B3ML 4A3BG 2RF4A 4A3GG 1DGSA 1YIJA 2PQAB 4OWXB 1SRUA 3AFQA 3F2CA 1VQ5A 4B3SQ 4LF4L 1FJGL 3PF5A 1XNQL 4DR6L 3H0GH 2L15A 2K5HA 3CCMA 3NELA 1WFQA 3I2ZA 2UUAQ 3NEMA 4A3CG 3I4OA 4GNXA 5FLXc 3OTOL 1N9WA 3T1HQ 3TS2A 4J15A 1PHJA 1VQEA 5EAYA 4LFCQ 1I50H 1NY4A 1V43A 2DGYA 1VS0A 1Y14B 1AE3A 2ZTCA 5FJ8G 2KBNA 1TWFH 4DV1L 1K3RA 4LFAQ 4LF5L 4DR3Q 3CCVA 1L0WA 4DR7L 1YJWA 3CCSA 1VQOA 4B3TQ 4NB3A 3HKZG 4IPGA 3M4QA 2UXBL 2JA6G 5AJ3Q 2F52A 4A3KH 4HIOA 1QUQA 1M90C 1CUKA 5GADC 3HOUG 2JA8G 4ALPA 4H02A 4AQYL 2CWPA 4A3EG 3PO3H 4LUZA 4A76A 2K14A 1OXXK 5M5XH 4B3RQ 1Q86C 1OXTA 1KQSA 2E5LQ 3J80c 4JBWA 5IP7H 4LF5Q 2YTYA 2ZM6Q 2ZTEA 5GQOA 4A3IH 3CCLA 1X65A 4ME3A 1PH5A 1LUZA 4A3KG 4TVAB 3TRZA 4DV0L 4A3BH 1EWIA 2UU9Q 4DK6C 3PO2H 1KL9A 4BA1I 4GOPC 4DV3L 1Q1BA 3BZCA 1YHQA 2R7ZH 1GVPA 4WJ4A 3EN2A 1NMGA 2A1AA 3HKZE 1D8LA 1I94Q 4PZ8A 4P75A 3Q8DA 1PH9A 3MEFA 1Q81C 2DUDA 3PUZA 4DR1Q 3GTMH 1TWAH 3OYYA 4A4IA 1HNZQ 4JI2Q 4GN5A 5HY6A 2ZJRA 5JJKA 4A93G 4POGA 4R4IA 4NXMQ 1S72A 2HIVA 3PUWA 2VZAA 1GD7A 1VQPA 4JI4L 1JB7A 2VQFL 3AFPA 3ERSX 3PSIA 4NXNL 4JC0A 3W1GA 4AYBE 1VQLA 3GTQH 3G48A 4HJ5A 3PO2G 3PUYA 5LMUL 1VQIA 3ZJYC 1IBLQ 1VQAA 5C3EH 3CP0A 4JI5L 5IP7G 1M1KC 4LF6L 4DV7Q 3HKSA 4C2MH 4LNQA 1P16A 1E7ZA 1Y1WH 3TQYA 2VQEL 3GD7A 2CWAA 2E2IH 1GM5A 3CPFA 5C4XG 1E3PA 4BA2I 3RLNA 1VQGA 1WOCA 3IRBA 1KRTA 4BY1G 2XGTA 3F2DA 4DUYL 5M3MH 1N34L 3CC7A 1KRSA 4UP7A 4HIDA 1VQ9A 4LF8L 3PF4A 2ZJPA 2YU9H 1G291 4OXPA 2HHHL 1X9NA 4C3IH 4UP8A 5J3BA 3GTLH 1UEBA 2Q2UA 4RMFA 1OXUA 3BU2A 4IFDI 4JYAL 2HQLA 3KYHC 1PH3A 5FLMG 2OWOA 4A3DG 1TWCH 4NPSA 1FGUA 1YZ6A 2YYZA 5C0XG 2OTJA 3H0GG 3D31A 4TQUS 1Y1VG 2R7FA 1BBUA 1A63A 4JI7Q 2VQFQ 4UP9A 1XMQL 4X65Q 5IYDG 4IJLA 1UE7A 1XTDA 1J6QA 5C4XH 1JE5A 1O7IA 3BJUA 4JOIA 2Y0SE 3U58A 4YWMA 1YITA 4PZ6A 2YV5A 4LF4Q
chains in the Genus database with same CATH superfamily
4X64L 4KD3A 4IUPA 2F0DA 1X6OA 3QOJA 1AE2A 1A2TA 1SROA 2P5ZX 5KNBA 4RH6A 3U9SA 2CW0D 5C5LA 4BY7G 1TY2A 4L5TA 4A3FB 2IY5B 5C44G 1Q90A 1VF7A 4LF8Q 3HOWH 4JI2L 1NUCA 3T1YL 4YHHL 4X66L 3G4SA 3K5NA 3S1RH 4KMUC 4FYDA 3A8JE 1L1OB 3S1NH 4FF4A 4DXFA 1PA6A 5IGCA 2R7DA 2F0EA 4G4KA 3JAMi 1CSQA 4XQQA 4JG2A 1MJEA 3VYRA 3DWQA 2VUMB 5IGBA 3ZYYX 4XT3B 2JA5B 4J8QA 2QEXA 3CQZB 3A7AB 3HOZG 1QVFA 1HJPA 2KHJA 1EFID 3OHXC 4C3JG 3VYTA 3PO3G 3M9BA 4ULLA 5IT9L 1JWMD 3X3MA 2F0QA 3KLSA 2UXCL 2RBMA 4LF7Q 5IGFA 3S16H 1HZCA 2WACA 1U5KA 4DAPA 3K7UC 4KY7A 5BN5A 4H13C 4GNXB 2CFMA 4OIKA 4NW2A 5EJWA 4O0AA 1TWHB 4RG1A 2PQAA 1MHWC 5IP9H 4K5XA 2VW9A 1FJGQ 1RL2A 1JWUD 5K36G 2IHFA 3C46A 3S1MH 3C1EA 4KY6A 1J8IA 3STBD 3LGJA 4CDFC 4C2MB 2JA9A 5AFWA 2F3IA 4DV1Q 3DEPA 1H95A 2V1CC 4MIUA 4HIKA 5IGEA 2PI2E 1RF2D 1WTWA 1PH7A 3J80L 1SNPA 1ASZA 1T5EA 5M5WH 3WWVA 3CMAA 4H0LC 2B2YA 2XVSA 4WJ3M 1PTOD 3M4OB 1WCMH 3GTGH 4I7ZC 1RJTA 2NZ1D 3FP9A 1QE6A 2N55A 2ZXOA 2LSSA 5C3EG 3L3OC 1SE2A 1QCBD 4O2DA 3A5ZB 4CDEC 4EVOA 4X65L 4R4TA 2R92H 3HOVG 1Q8IA 3DEOA 3PQIA 1MI2A 2B39A 1OO9B 1S5FD 1E2ZA 2ASBA 5M5XB 4OWTB 2E2IB 2UXDQ 4R4CA 3TDQA 2I5MX 1I4PA 1DOLA 2RCNA 3KJOA 4DUZL 2I07B 4DV4Q 4DAYB 1LT5D 1VCIA 2EDGA 1ONLA 4IPCA 5CV9A 1ET9A 4Q5VA 2UXCQ 3E3XA 3A5UA 1BCPB 2A6HD 1PDQA 1NBWA 2LMCB 3TS0A 3GTLB 4GZYC 1SYBA 3SHLA 2KENA 4RGNA 1F2MA 2R93H 4LUOA 1H9JA 3GTKB 1YNNC 3KDFA 3I3CA 1B7YB 3MC0B 4LF6Q 3D4DA 2EY5A 4QUCA 1WTXA 1CKNA 3EBEA 1WJJA 2RVLA 2JYOA 4OIJA 3R3OA 4HCEA 5C4ZA 1CQVA 3H09A 5G3LD 1QNKA 3UI2A 1PRTB 3K81C 1CKOA 5K36H 2JA5G 1HH2P 2Q2IA 4OO1G 2E2JB 2HD3A 1OXSC 4DXGA 2L12A 1NCVA 4DK3C 3T1YQ 3PUVA 2K01A 5L37A 1D1IA 3E0EA 1HNXQ 1PTOC 1EZ8A 3I4MH 5A35A 3A8IE 1Q82C 1SYFA 1EOTA 1TWAB 5NUCA 3SK6A 1WTRA 4IPDA 2A5HA 3SDZA 1BO0A 5LMNQ 1K9MC 2D5DA 1FNVA 2K5QA 1EY5A 2CQOA 3CMEA 1HZ9A 4LW1A 1B2TA 2CHBD 4DFAA 3PUXA 4FXDA 1HRJA 3I72A 2NUCA 4L5SA 1NJIC 1MJCA 3V2TA 4CJ2C 1XPOA 3RLOA 3CCQA 3PIOA 2E76C 5H1SE 5LMNL 1XXGA 1JCKB 1IBLL 3TP6A 1Q7YC 2JA6H 4C3IG 1EIGA 3NBHA 5FO8B 4AYBG 2KOLA 4GKKL 1Q8KA 1KHIA 2C9OA 1HTPA 3U4VA 3M7NA 3HOUB 3NTIA 2QW7A 2F0PA 3SK4A 4GNXC 3A55A 1X32A 1S5CD 1X3QA 1YNJC 1C4QA 5FKAC 5C4JH 2JA7B 1SR3A 4P73A 1STGA 4X3SA 4FXKC 2B63B 3EA6A 3E9IA 2K28A 3I4NB 5JEAJ 4A93H 1IYVA 3DHQA 1A0IA 1SMYC 2F0MA 2F0KA 2XTIA 3KK7A 3MZ5A 4YWKA 1VQNA 2E2HH 4GS3A 1BQQT 2Z8LA 2BOSA 3TMEA 1IYJB 3TN2A 4KK7A 2I5LX 1ASYA 1TR5A 4K6DA 4IURA 2JE6I 3VR4A 4K2KA 3CC4A 3CXCA 4X3UA 2R93G 4F7XA 1K3BC 3UDIA 3S15H 2FHTA 2LXJA 1L0XB 4DR4Q 3HS0C 3MHBA 4MTKA 2NVYH 2R7ZG 1EYAA 1IBML 4A3MG 2B29A 1VQJA 5IY0A 1STBA 1EY7A 4DKAC 1MKHA 3PV0A 1GKHA 2QDLA 5FJ8H 1KLUD 4DR7Q 5IYCG 4OX9L 4NP5A 1XJVA 1JOKA 3K57A 1I3QH 1LT4D 3FMCA 4DV5Q 2NVTH 2VNUD 1F77A 1G8ZD 2GVBA 4A3JH 5G3LF 1PH4A 2A68C 3MTSA 3I4MG 2UUBL 4NXML 1PYSB 1S5DD 4YCWA 4CGYB 1L1OA 1EEID 1VF5C 4P71A 3K58A 1UWVA 2LS01 2PMZE 3CKIB 5IWAL 2XN9C 3LWEA 3W1BA 4A3JB 4QCLA 1RD9D 4X6AH 5D3DA 4DV5L 3TP8A 5CORA 2RA4A 1VQKA 3ULLA 3IKJA 2YTXA 5J39A 3OTOQ 3TREA 1SLJA 2D9UA 1WTOA 1ZKOA 3KFUA 1GXDC 5GAEC 1PFSA 5IYDH 2RF4A 4FP5D 3AFQA 1VQ5A 2CVRA 4ZUIA 4H44C 1FJGL 1O7ZA 2K5HA 2E74C 1WFQA 1DJRD 1LT6D 2KECA 1PTOB 3OTOL 1N9WA 3TS2A 4LFCQ 1S5ED 2QCPX 1EYDA 3L9AX 1TIID 2ZTCA 2DY7A 1K3RA 3BVZA 3RD4A 1YNND 1BCPD 3H94A 4DR3Q 5J22A 2R61A 3JAME 3QO2A 5AJ3Q 2F52A 2BE5C 1M90C 1B3QA 4A3EG 4LUZA 5ELFA 1OXXK 4B3RQ 2RQXA 1KQSA 3E6ZX 3BDCA 1X3PA 3J80c 1Y8PB 2EY1A 4JBWA 5IP7H 2ZM6Q 1GJXA 1X65A 4TVAB 4DV0L 4DK6C 3PO2H 1K0SA 2A1AA 1D8LA 1QJOA 2DUDA 3GTMH 1TWAH 1J9OA 2XWJB 4OHJA 3Q23A 1TVXA 5EPJA 1S72A 3PUWA 3EJIA 1A3TA 2E2DC 2VQFL 5KYIA 3NP8A 3GTQH 3G48A 1FYCA 1GOZA 3AB9A 4HJ5A 2PPBC 1RKNA 3KLSX 4ME5A 1GUTA 5C3EH 4JI5L 5IP7G 4LF6L 1Q3LA 1P16A 1EY6A 2B2YC 3S1NB 5CV8A 1GM5A 3CPFA 1EY0A 2PZUA 1KRTA 3F2DA 3VA7A 1VQ9A 1UNSA 1N34L 4LF8L 3CC7A 2M00A 4HIDA 3PF4A 1JOOA 4OXPA 1X9NA 1R4QB 1WD1A 4CDDC 1F9RA 1DZ1A 3GTLH 3MXPA 3BU2A 3I8ZA 3K7AB 3R8BA 1SAPA 2MJ8A 3K5OA 4NPSA 5C0XG 1FGUA 1JC7A 3AU7A 1A2UA 4JI7Q 4X65Q 1M8AA 5C4XH 1G2TA 4UHVA 1D1KA 1I4QA 2UXBQ 2Q8RE 2O2LD 1XYIA 3S14H 1AH9A 5IE8A 2QDBA 1LABA 2L1BA 2AMCB 3CU7A 1S3OA 3T1HL 2RSNA 1XTCD 2A6EC 2IX3A 2MQHA 2UUCL 3VYUA 4N9TA 3HOXB 2ENBA 1EIYB 1E0BA 1SNMA 3MFGA 3OOCA 4HCSA 3JAML 3HOXH 3OWFA 1DOMA 1JJ2A 4IO9A 3I4NH 4DR1L 3L2PA 1KDCA 3M4PA 2CCZA 2ZXRA 1A62A 1OXVA 2F0OA 1I94L 2DNCA 2B2VA 4IFDH 3GTPH 4IPHA 1YNJD 2EJMA 2NTSA 3KF6A 4CKEA 4DNIA 4IOCA 4XIGS 4JI3L 3NE5B 4UAIA 2F0VA 4JYAQ 2B8GA 4RKLA 3H3VC 1PFMA 2Z6KA 3W5OA 1QUQB 2RCFA 1U4RA 4LMQD 1TKWB 5ELOA 3OMCA 2SEBD 1XMQQ 4QL5A 4BY7H 4V190 3HOZB 1JOQA 2PQEA 4TKOB 5C3WA 2NWGA 2ATWA 4BY1B 1K83H 2KVMA 1L2FA 3U50C 3BDLA 3MVVA 1Q46A 2IW3A 2NTTA 4TRDA 4JBMA 1FVIA 4RGTA 1MD2D 3HZXA 2A74C 3GO5A 4HSPA 4B3SL 1EQRA 1VQ8A 2FFKB 3A0JA 2LXKA 1PZKD 4XYOA 1K0RA 1XPUA 3EQLC 1BKBA 3PCOB 1W2BA 2IJ0A 4FVMA 2N8NA 5IYBG 1L0YB 5GAHC 4B3TL 1TWGH 5I6YA 2OTLA 4A3FG 4LJZC 1GO3E 5C4JB 3MWYW 3EFXD 3RN2A 1SJHD 2KCCA 3CHBD 3PIPA 4UY8C 1MBYA 3E0JA 1XMOL 4JI0L 1WD0A 1EWHA 1PTOH 5COYA 5M5YH 4QJFA 3HOUH 5M3FG 4HN7A 2EYHA 4L8JA 2E5LL 1KNEA 3J80E 2JA8B 5E7NA 1SYDA 3BZDB 3ULJA 3F8TA 5C0XI 1FNWA 4FF3A 4OO1I 4ZYSA 1LYLA 4A3IG 2AWOA 2EYOA 3MAQA 1X3FA 3ULPA 1E1TA 1K73C 2A8VA 2R7ZB 2BA0A 1HA6A 3I55A 1X56A 2JA8H 3ITPA 4UDUC 4QB4A 4RKBA 1Z7TA 3JC66 1SFOH 1LLRD 1XNRL 1S40A 3GTKH 5E3FA 2L55A 4GLXA 2RSOA 4XXEA 1N34Q 2Q2HA 4PG3A 4C3JH 5KYLA 1G6ZA 4JI8Q 3BVGA 1M4VA 2RHQB 5M3MB 1HR0L 3H0GB 4CHTB 2F0GA 1B70B 4A3DB 3PO3B 3ND9A 2PW5A 4B08A 4U68A 3OW2A 4A3MH 4JI3Q 2UUAL 4F88A 2EPBA 3D4WA 3U4ZA 2X69A 2I0QA 5KNDA 3L7ZC 2Z4HA 1DYQA 1C8CA 3PMFA 3K5LA 1AW7A 1I4HA 5I9PA 1EY8A 4B9WA 1VQBA 4GN4B 3M4OH 1VQDA 2ZTDA 1HUNA 4L6TB 2M9VA 3UDGA 3WDNA 1PH6A 2NBFA 3VA5A 2OEOA 1O7YA 3ICEA 2K75A 2ZJQA 1IKLA 4DV0Q 1N33Q 2JXMB 1T9HA 5CR3A 3NBHB 1II3A 3SXHA 5IYBH 3GTOB 2B63H 1DM0B 3HOYB 2CW0C 3OMGA 4PMBA 4A3KB 4QUFA 1B4OA 5I2XA 3S9WA 4FF2A 3C1FA 4Y7NH 4MN3A 2Z9HA 1UUPA 1ZYRD 3SR1A 1K8OA 1PYBA 4QF4A 5EKIA 4NKLA 2B2UA 2F4VQ 2GN5A 2D0OA 2AWNA 3HKZB 3T51B 2NVXH 1QZGA 2D0PA 2FINB 5GROA 4A3MB 2HT1A 3CCJA 1XNQQ 4XQNA 3S15B 4X66Q 1X3GA 1Y8OB 4DR3L 3QR8A 2BH2A 1GUGA 3OW7A 1WVLA 2JA5H 2WIIB 1KXLA 3GQBA 3A54A 4JV5Q 4A3BB 4RHRA 4ID6A 1STEA 2E2HB 2KHIA 4LWCA 1DOKA 4BBSG 4CBVA 4QIWE 1ICWA 4KKTA 1WTPA 4A3LG 4QY7A 1NNXA 1EUJA 3CAMA 1R9TH 5JVH3 4HTHA 4JI5Q 4JK1C 3I7FA 4RWSC 3RLFA 2VL6A 3SK5A 4DV3Q 2WB1B 5LMUQ 4BBSH 2A68D 4P2CB 2JJQA 3S17B 1J5EL 4A93B 3RZDH 1KC8C 3I4MB 3GTMB 3J7ZC 2RDGA 5IWAQ 1EQQA 1BUVT 4DV6L 1MSGA 2CH4W 4A3JG 5HGQA 1XWEA 3AQQA 2K04A 4X62L 1JORA 1V8QA 1SSOA 1IXRA 3RZDB 3SGIA 3CCRA 4K5VA 2A19A 1RODA 5ELBA 4GN3B 1H9KA 4YWLA 2EJFC 1ILPA 1KNAA 1H9RA 1XNRQ 1YI2A 4ZQ3A 1EFWA 3C3LA 1DD2A 3KLRA 2X6GA 4DR2L 4HJ8A 2R93B 2K50A 3DMUA 2HCIA 1EWCA 3D0FA 2IT1A 4A3GH 2F4IA 1VDZA 4DUZQ 2ES2A 1NAPA 2NVTB 1UE6A 3Q24A 4G7OC 3FRPB 3FPUB 3CD6A 3R93A 4JBJA 5IT9E 4PZ7A 4EGVA 2NVQB 3T53B 3H15A 3I4NG 3H6MA 2EYPA 1PV4A 3TP7A 2J4XA 2KCMA 2Q2TA 2R92B 3BG3A 3HEJA 1KD1C 1V1PA 3VR3A 4DNTB 1YIJA 3F2CA 1XNQL 4DR6L 1K83B 3CCMA 3J81E 2PMZB 3I4OA 5FLXc 3GTPB 4J15A 1PHJA 5M5WB 1NY4A 1CA5A 1VS0A 3IL8A 3S1QB 1I4XA 1TWFH 1U9RA 2EYLA 4LFAQ 4IN3A 3MA2B 3Q0AA 3CCVA 1BR9A 4AYBB 1VQOA 5ELCA 4NB3A 3HKZG 2MP1A 4IPGA 3M4QA 4RCOA 2UXBL 4A3KH 1QUQA 1CUKA 2F0LA 3HOUG 4H02A 1CHQD 1TT2A 3I91A 1QB5D 2E5LQ 1JQYD 3GP7A 2YTYA 2ZTEA 2K32A 4ME3A 1S5BD 3TRZA 3HG9A 2UU9Q 1KL9A 3VR5A 5C0XH 5K5PA 1YHQA 4WJ4A 4K8JA 1I94Q 1W6JA 4PZ8A 5EPLA 3A56A 1HA5A 3TZDA 1KDBA 2ZJRA 3M3YB 2DNEA 4NXMQ 2HIVA 3P7JA 3QWNA 4JI4L 4KN4C 5EKKA 5T1IA 4AYBE 3ERSX 3TP5A 5FOBB 4KHVA 3I4LA 3PUYA 5M9OA 1FR3A 2PZTA 2EJGC 1I6VC 5LMUL 1IBLQ 1VQAA 1GUSA 4DV7Q 2F0UA 4DN4M 4C2MH 4LNQA 1Y1WH 1QNUA 5CV4A 1SE4A 4C3JB 5HGTA 3GD7A 3O13A 2AQ3B 2F0NA 5C4XG 1E3PA 3IFTA 4HMIA 2XGTA 5M3MH 4UP7A 2BDNA 2V4DA 2YU9H 2K33A 1O78A 4UP8A 5T1GA 5J3BA 2BE5D 1CTMA 1UEBA 3SK8A 1OXUA 1CZGA 4JYAL 3HP3A 1CA6A 1G2SA 5FLMG 2OWOA 4A3DG 1TWCH 2OTJA 3H0GG 1AZQA 2N88A 1HQMC 4UP9A 5CMDA 1XMQL 5IYDG 4IJLA 2KQ3A 2XRQD 3KF8A 1O7IA 3BJUA 1Y8NB 3GV6A 2Y0SE 1SYGA 4PZ6A 1QVGA 4IZ8A 4DR5Q 3NSWA 3DXJC 1X3EA 1KABA 4TSSA 1N32Q 3HRZC 2R6GA 1LTLA 5C44B 2MFIA 1F2ZA 5C44H 4KHPL 1YNXA 5C0XJ 4IOAA 2VUMH 2AKWB 1E22A 5LL6S 4OGQC 1AFPA 1JJGA 1SDFA 3NUCA 1WCMG 4BY7B 2JSOA 4AIMA 1ENFA 4OX9Q 2WB1E 4DA2A 1LV9A 2K5NA 1CKNB 1HXYD 3BZKA 4KD4A 2G9HD 2J0TD 1B9MA 2VY3A 4KJNA 1STNA 3H91A 3M4YA 4YY3L 4GLVB 3JAMc 1LM0A 4A3EH 5AJ3L 3GTGB 3RZOB 4C3HB 4GKJL 4DAMA 1D5MC 3J81L 1YJNA 4I7AA 3GV3A 2VUMG 4MTNA 2E2JH 2L9HA 4X3TA 1AEXA 1N8RC 2SDFA 2Y0SG 2H4OA 2JN4A 2SNSA 4G7ZC 2EE1A 2VB3X 1HR0Q 2ZM6L 1ZEQX 1J5EQ 1Z9FA 1SYCA 1TS3A 5GAGC 4IFDG 4HJAA 1PVOA 4ZLTF 4EQ5A 3DWAA 3L0OA 3RMHA 3NTHA 1XX8A 1SE3A 4M1UB 1EYCA 4HSVA 2MO1A 4F8MA 1U0LA 3UE0A 1XPRA 1GHKA 2IX1A 2AQ1B 3I56A 1SJED 3Q6SA 4IQZA 1LTID 3FKIG 2KEDA 2A73B 1W3SA 1LTAD 4F87A 3A7LA 4A3LH 4KJOA 4BY1H 1D7QA 3KBXA 2WP8J 2BH8A 2FMMA 4HJ9A 1OTCA 2TSSA 4RA8A 4A3EB 2RDHA 3QB3A 3NPPA 3NWSA 1X55A 2PNHA 3PIP3 3CCUA 1RTOA 1BOSA 4JI1Q 3H3VH 1YHBA 4DNRB 2RHSB 3W2DA 2N78A 4POFA 1SNDA 1C9OA 2C35B 1H9SA 3S24A 2KEEA 4BXXH 2MPMA 1ENCA 2QEJC 3RN5A 4JI6Q 4A3GB 4V0BA 3K7AH 3NQTA 3K0YA 4KHZA 2EY6A 3CRLC 2QKIC 1A8VA 3F1ZA 3CPWA 1AP0A 2B2UC 3J80i 2JP1A 4K0KQ 1HZAA 3D3RA 5CYUA 2PW7A 3K59A 1LTBD 5C4HA 3ER0A 3SEBA 5A2QE 1T5XD 5I9OA 2ZT9C 4CJ0B 3V05A 3A8KE 1PH2A 2XNAC 3CC2A 5FK9C 1EL0A 4L5QA 5FO9B 3K80C 1PYWD 4KHPQ 1Q12A 5JVG3 2A6ED 1DCZA 1HNWQ 2LY7A 2EXZA 4JPBW 2KJXA 3GTJH 5LHY1 3MXGA 3NENA 4ZRZA 4JI7L 1TWCB 2NN6I 5HURA 4JV5L 4JOIC 3D6WA 4LUVA 3M85A 4K5WA 2NVQH 2UU9L 5BR8Q 3CQZH 4QIWB 4JBKA 4CKBA 1D2BA 4P74A 1C48A 2HUGA 4RHSA 5M3FH 1TY0A 2JEBI 4KI0A 1BCPC 1IL2A 1VQ6A 2B2TC 3VR6A 4YY3Q 3K5MA 4AQYQ 2FMCA 1SBBB 5KIXA 1C7YA 4Y52H 2XWBB 3FVQA 2O5IC 2OQKA 4LK1C 1FL0A 1H9SB 3K0XA 3CCEA 2DN8A 4YIJA 2N49A 1U4LA 2MGSA 3M7GA 1KDAA 3E9HA 1G51A 2EVBA 4KLKA 1PRTC 1HQRD 3S2HH 5FO7B 1HNWL 4KV6A 4BS9A 1ET6A 5M5YB 3I70A 1PLFA 2B2WC 1TXYA 2F1MA 2OQ0A 4I65A 1A3UA 3KF6B 1STAA 2B8FA 4BBRG 2WKDA 2NYZD 4NXNQ 2EY2A 4K6LA 1P8LA 2JA7G 4DR6Q 1SN8A 3OIQA 1SE8A 3NTKA 4XQJA 4KN7C 1F9SA 4CKCA 1I5FA 3D8GA 2WAQE 5FLXL 1GUWA 4BBRB 2O4XA 1F9PA 5JEAG 4KKUA 4IALA 3TEHB 4X3KA 2B2WA 2NB0A 1BVSA 4DK1A 1FGBD 4R9WA 3FHWA 1PMRA 1O7LA 3DM1A 5E1FA 3S1QH 2Z6KC 4N8X1 4R4QA 4XDXA 4EQNA 4CDCC 1CHPD 3KF8B 5DAUA 1A15A 3HFZB 2Z4IA 4LF7L 1F2YA 1F2LA 2JQOA 5BN3A 1STHA 2D2CC 4B3MQ 2NVXB 1SYEA 2X6LA 4WRDA 1Y1VH 3BYYB 3AEVA 3D6CA 1D5XC 1U4MA 4DV6Q 4DV7L 5CBEE 3V96A 2F3WA 1CI3M 2N3SA 5EBCA 1NMFA 1BF4A 1CQFA 1SMXA 1ZYRC 5EKLA 4P72A 5JOBA 4CJ1B 1S4ZA 2AHOB 4DR4L 2I46A 1DONA 4ZKBB 3DLLA 1EIFA 4EX5A 3J81j 3KOJA 4ZAIA 1TQOA 1BBWA 2DJGC 5JPNC 3OPOA 1Y1WG 1CZWA 3DUZA 1R4PB 5IODA 4WORA 1UE1A 3AMUA 1F9QA 1V1OA 2XRSD 1I4GA 1YHAA 5JJLA 2HCCA 4JVZA 3UDFA 1CKMA 2K1BA 3FEWX 3STBC 1TWHH 2NN6G 3T56B 2UUBQ 1QZHA 1GUNA 4FDBA 1RHPA 3UDXA 1IZ6A 1JWSD 1WTVA 1BNZA 4A3BG 1DGSA 1HFNA 3EROA 2PQAB 4O42A 1I4RA 2PNRC 4OWXB 4B3SQ 4LF4L 4OO1H 2FJ2A 3H0GH 3NELA 2UUAQ 3I2ZA 3NEMA 4A3CG 4GNXA 2PYKA 5C3XA 5EAYA 2Z1CA 3MXUA 1V43A 2L4NA 1Y14B 1AE3A 2F3VA 4LF5L 1YJWA 4C56C 3N6RA 2K5WA 2JA6G 5IGDA 5GADC 4ALPA 4AQYL 3PO3H 2IWHA 2TMPA 2K14A 2MHVA 2Q8IB 4LF5Q 4A3IH 5GQOA 2OF1A 5C3EB 4A3KG 1PH5A 5DEHA 3S1RB 4A3BH 2RDFA 3FKIB 4BA1I 4GOPC 4DV3L 1Q1BA 3BZCA 2LKVA 2R7ZH 1GVPA 2KHSA 3J7AF 1NMGA 4J1MA 3HOWB 3I73A 3FPPA 1PH9A 3MEHA 3MEFA 1SFOB 3PUZA 4DR1Q 1HUMA 5HY6A 4A93G 5IOCA 2K03A 2VZAA 3KUPA 1GD7A 3TZUA 1VQPA 3GTJB 4FF1A 4FNFA 1TWGB 1KTKA 3PSIA 4NXNL 4JC0A 3W1GA 1VQLA 1EU4A 2G5DA 1WTHA 3PO2G 1LO5D 1H9MA 2K5DA 5DM63 5C5MA 3CP0A 1M1KC 1EY9A 1E7ZA 1PFBA 3NQIA 1ML0D 4J6HA 3TQYA 2VQEL 5I2YA 2R3ZA 2Y0SB 2CWAA 2E2IH 3DWPA 1VQGA 3IRBA 4BY1G 1DXMA 4DUYL 1ENAA 4FXGC 1KRSA 2ZJPA 5CGKA 4WFN3 4C3IH 4K14A 2XIWA 4RGOS 2Q2UA 3J7AV 4RMFA 4IFDI 1BXTA 2C5CA 1CFMA 1PH3A 1SMYD 2YYZA 3D31A 4PNYA 1PRTF 4TQUS 1Y1VG 1A63A 5IIFA 2HDLA 4JW0A 2WAQB 1XTDA 1J6QA 3U58A 4HR7B 1YITA 4LF4Q 3OSOA 2YV5A 3N52A 4Z9CB 5ELEA 2D62A 3T4AC 1SNQA 1V1PB 3HOZH 5E4XA 1SEBD 1YBYA 5I4DA 1SNOA 1NR2A 1PH1A 1EQTA 2F0JA 1KLGD 3RUZA 3ND8A 3S1MB 4LAAA 3QIAA 4C1NK 1PRTD 4ILWA 5IT9c 4OL7A 4ZCKA 4DGZA 3HOXG 3NHHA 2F0IA 4JI8L 3ONAB 5ELNA 4B9XA 3VDYA 3MXNA 3F2UA 1N33L 3NXWA 5BR8L 1CSPA 4RFBA 1QOHA 3K6OA 5IP9G 3OWEB 1GHJA 4YCVA 1L1OC 5IYCH 4MNOA 2PZWA 3C2PA 2WAQG 1BBXC 2EZVA 4DV2Q 1TS2A 1YVCA 1LTTD 1Y1VB 4X64Q 2A6HC 1E2WA 4YCUA 1JICA 1Q1EA 2WINB 2YTVA 3S2DH 2HDMA 4DUYQ 2OCEA 3KDFB 3WOFA 2L11A 4HJ7A 3G6JB 1JT8A 4X62Q 2QF7A 3T16A 5M3MG 1K28A 4R4OA 2IHEA 1IHZA 4C3HG 5EPKA 4PMWA 3Q22A 3PO2B 3AYHB 1VQ4A 3LX0A 2QGQA 1HR0W 4R1JA 1VQCA 2F0WA 2HHHQ 1G91A 2EXDA 4KTAA 5KRUA 2DJFC 1IW7D 2VQEQ 1EEFD 2EIFA 3DM3A 5ELDA 4OEMB 2KUMA 3R2IA 4YHHQ 4KY5A 5KEEA 5DLQE 4PV1C 1JB3A 1XMOQ 4JI0Q 3HOVB 2WFWA 3FDTA 3J7YW 4AH6A 4S3SA 2K5VA 2MO0A 4LF9Q 4GOPB 1WTQA 1FD7D 1IW7C 4ZKCB 1N32L 3E5SA 3PGZA 1QILA 5JJZA 4DAVA 1B53A 3RZOH 1YJ9A 1KAWA 2SNMA 1JJCB 2IPKD 1N36L 1EZ6A 1C0AA 3KBGA 5D65A 1KAAA 4N8FA 3BDOA 1HZBA 1QVCA 1VQ7A 1MSHA 5CC4A 1NTGA 1FNUA 3B6YA 1B8AA 2YU9B 5J1ZA 1X54A 2MUYA 2B2TA 1IBMQ 4JCVE 4B3RL 4NMZA 3RNUA 4GKKQ 1LTGD 1IYUA 4DAYA 4EQPA 5JJIA 4LFBQ 4IUVA 2ALYB 3T13A 2H1EA 1O80A 2R92G 3HOVH 4IFDJ 2O5JC 4A3CH 3IAYA 4R8IA 2F0SA 3GDEA 4XYQA 1R9TB 1IBKQ 4QQBX 1MIUA 5TSSA 4DPGA 1JMCA 4H7BA 3S2DB 2HIXA 2K4KA 1Y1WB 2RKSA 4G57A 1RTNA 4Q0FA 4EQOA 1ESFA 1HTLD 3WOEA 1PFNA 3QOLA 3IFDA 2NZHA 5E4WC 2K6AA 1V9PA 1PTOF 1VQFA 4BXXG 1WCMB 2BA1A 4UPAA 1RDPD 2I5HA 4PQXA 4ZUJA 1EIHA 4DV2L 3HOWG 1TS5A 3MXNB 2LFNA 2XSCA 1LTSD 1V1QA 3HOYH 2F0HA 4DR2Q 3GTOH 1B9NA 1NE3A 1HFGA 4GLAC 1PZJD 2WKCA 1SNCA 3BS1A 5EBDA 2NZOA 1Z47A 2L5TA 2KCNA 2K52A 3PIO3 3G6EA 2E8GA 3NBIA 5KNCA 4MZ9A 1K8GA 2Z0SA 5D14A 1ILQA 2F0TA 3K8AA 2KCTA 3CRKC 4A75A 1ESRA 2F4VL 3LWUA 5KGUA 2M2LA 1E1OA 2VS1A 4OONA 1K8AC 4HAEA 4QMGA 1TS4A 2B2VC 2L0CA 2JEAI 3GTQB 3S16B 3J81i 1EY4A 4C3HH 5CV6A 1HNXL 4IUTA 4LFBL 1ZXTA 2FXQA 3F2BA 3M3YH 2VB2X 1D5ZC 2B63G 2BCOA 5FLMH 4A3DH 1MGSA 4DV4L 4APVA 3G7LA 1AZPA 3X3NA 2B3GA 3URYA 4LFAL 3H3VI 2CQAA 2CKZB 2UUCQ 1RIPA 5C4XB 5FLXE 4C1NI 4ZK9B 4JI1L 1LT3D 1Y69U 4JI4Q 4LF9L 4O1NA 1N36Q 2WB1G 3G71A 3CW2C 2JK8A 4ODGA 3QJYA 5EGTA 2GVAA 5JEAH 4BBRH 3P1HA 1VQMA 4C3IB 4JI6L 1TU2B 2ID0A 2Z6BA 3UE1A 4A3FH 4XT1B 2JA7H 3J7A5 1RCVD 4WJWA 1IBKL 1PZID 1YEZA 1TWFB 3HGBA 5BN4A 1W6KA 1UE5A 2ICIA 3SVMA 4OELB 4KKSA 1UAPA 1A6XA 2F03A 2WV6D 1STYA 4QGUA 1IKMA 4K0KL 1EYGA 3BVMA 3W3AA 1PXUA 4HIMA 2IL8A 1LACA 4GKJQ 3RR5A 1WYDA 2SOBA 4IJHA 1I6HH 4ABNA 3R2TA 1I6HB 4U673 3S17H 1QWYA 1CM9A 2EQSA 2PI2A 4HMJA 1G6PA 1EQVA 4A3IB 3CF5A 4IUUA 4XTCS 3HOYG 1WI5A 4RGMA 1GUOA 3S2HB 2G9DA 1E24A 4IUNA 4LFCL 4M8AA 3KJPA 5M3FB 4PMCA 5EQ0A 2IX0A 1JR0D 1KIXA 2J7ZA 1HPCA 4DK0A 3VYSA 2JA6B 4L63B 2BDOA 3NWTA 4HEDA 1EU3A 4K2LA 4N9PA 4MHEA 3FKIH 1A3VA 3J81c 1B50A 4L5RC 3A74A 1VQHA 2H5XA 4BBSB 2MNAA 5D3IB 1HNZL 5JAVA 2OXPA 4GOPA 2EYMA 3I90A 1ICFB 1EOVA 2UXDL 4OWWB 3TBIB 2VXWA 2QA4A 5F2DA 1SXTA 2Q8TA 5C6AA 1QG7A 2DY8A 5LMNW 2AQ2B 3KLWA 5DNFA 1B44D 2PCFB 3LNNA 5A2QL 1PH8A 1VMPA 2NVYB 4DR5L 3EIVA 4B3ML 4A3GG 1SRUA 1Z6HA 5I6WA 3PF5A 2L15A 4RAUC 2OT2A 1E2VA 3NK9A 1VMCA 2EYJA 5DM73 3T1HQ 1VQEA 4E6IA 1I50H 4RCNA 2DGYA 3TSSA 5FJ8G 2KBNA 4DV1L 1L0WA 4DR7L 2CH4A 3CCSA 4B3TQ 3VR2A 1CT1D 5CV5A 4HIOA 3P75A 2JA8G 2CWPA 3U9OA 3SE0A 4A76A 5M5XH 1Q86C 1OXTA 3S14B 3MFYA 1HHVA 5LL6X 3CCLA 2PO4A 4K8IA 1LUZA 2HQEA 5ISRA 2A69C 1D6EC 1EWIA 4NDXA 1I50B 5CV7A 3D4RA 3EN2A 3HKZE 1NSNS 4R8NA 3P20A 1I3QB 4P75A 3Q8DA 1Q81C 1B3AA 5CBAE 3ERQA 3OYYA 4A4IA 1HNZQ 4JI2Q 4GN5A 5JJKA 1AN8A 4IUQA 4POGA 4R4IA 2GA4B 4BWGB 1JB7A 2NN6H 1HCZA 3AFPA 1IL8A 4G7HC 1UEAB 2K05A 1VQIA 3ZJYC 4FO2A 4Y7NB 2KA7A 2K7VA 1U4PA 2AUJD 3HKSA 5JPMC 1BCPF 1B1ZA 4BA2I 3RLNA 1WOCA 3BYTB 3OIPA 4DF7A 1G291 2HHHL 2E75C 2EOTA 2HQLA 3KYHC 2ZXPA 4DU9A 2ICEC 1LTRD 1YZ6A 2R7FA 1BBUA 1K8MA 2EYFA 1NR4A 2VQFQ 1BDOA 3QG1A 1UE7A 1JE4A 1CK1A 2AUKA 2A69D 2F0FA 1JE5A 4JOIA 5IGGA 2QILA 4YWMA 3EVQA
chains in the Genus database with same CATH topology
4X64L 1QVGA 4DR5Q 2D62A 3S14H 1X6OA 1AH9A 5IE8A 3HOZH 1X3EA 1YBYA 1AE2A 1PH1A 1SROA 2AMCB 1N32Q 1S3OA 3T1HL 2R6GA 4BY7G 2UUCL 2MQHA 4L5TA 5IT9c 2IY5B 5C44G 1LTLA 3HOXG 4LF8Q 2MFIA 1EIYB 5C44H 3HOXH 3HOWH 4KHPL 1YNXA 5C0XJ 1JJ2A 4JI2L 2VUMH 4IOAA 2AKWB 1E22A 4IO9A 4JI8L 5ELNA 4DR1L 4YHHL 3T1YL 3I4NH 3L2PA 1JJGA 3M4PA 4X66L 3VDYA 2CCZA 3G4SA 3S1RH 1A62A 1OXVA 1I94L 1N33L 1L1OB 3S1NH 5BR8L 1CSPA 3GTPH 4IPHA 5IP9G 1PA6A 2R7DA 3KF6A 4DNIA 4IOCA 1WCMG 3JAMi 4YCVA 1L1OC 5IYCH 1CSQA 4MNOA 4XIGS 4JG2A 4AIMA 4JI3L 1MJEA 2WAQG 4OX9Q 4DV2Q 2WB1E 4JYAQ 2QEXA 1YVCA 4X64Q 2K5NA 1CKNB 2Z6KA 3BZKA 3HOZG 3W5OA 1QUQB 1QVFA 1HJPA 4YCUA 1Q1EA 2KHJA 2VY3A 2YTVA 5ELOA 4YY3L 3JAMc 3S2DH 4GLVB 2OCEA 4DUYQ 1LM0A 3KDFB 1XMQQ 4A3EH 3M9BA 4QL5A 4HJ7A 5AJ3L 3PO3G 4BY7H 2UXCL 1JT8A 4X62Q 4LF7Q 5M3MG 4GKJL 4R4OA 4DAMA 1YJNA 1HZCA 3S16H 2IHEA 2ATWA 2VUMG 1U5KA 4MTNA 1K83H 3K7UC 1L2FA 4PMWA 2E2JH 3U50C 2UXBQ 4GNXB 2CFMA 1N8RC 2Y0SG 3AYHB 1VQ4A 1Q46A 2QGQA 1HR0W 1HR0Q 4R1JA 2ZM6L 1VQCA 4O0AA 2HHHQ 4RG1A 2PQAA 1Z9FA 1J5EQ 4JBMA 1FVIA 5IP9H 2EXDA 5GAGC 2VW9A 4IFDG 4HJAA 3GO5A 1RL2A 1FJGQ 4B3SL 4EQ5A 1PVOA 3L0OA 1EQRA 5K36G 1VQ8A 2IHFA 3A0JA 2LXKA 2VQEQ 3S1MH 1XPUA 1K0RA 2EIFA 1BKBA 2MO1A 3DM3A 3PCOB 1XPRA 1U0LA 3UE0A 1W2BA 3STBD 2N8NA 5IYBG 2IX1A 4YHHQ 3LGJA 5GAHC 3I56A 4B3TL 1TWGH 2OTLA 5DLQE 4A3FG 2JA9A 1GO3E 2F3IA 1XMOQ 4JI0Q 2WFWA 4DV1Q 1H95A 4AH6A 3FKIG 3RN2A 2V1CC 4HIKA 2K5VA 2MO0A 1W3SA 4LF9Q 4GOPB 2PI2E 1PH7A 3PIPA 4UY8C 1XMOL 4JI0L 4A3LH 1ASZA 1N32L 5M5WH 3WWVA 4BY1H 3PGZA 3CMAA 1D7QA 2WP8J 2BH8A 4WJ3M 5M5YH 1WCMH 4QJFA 4HJ9A 5M3FG 1OTCA 3GTGH 3HOUH 3RZOH 2E5LL 1YJ9A 1KAWA 3FP9A 1JJCB 5E7NA 3ULJA 2LSSA 1X55A 2PNHA 5C3EG 3F8TA 5C0XI 1N36L 4OO1I 3CCUA 4O2DA 1LYLA 3A5ZB 4A3IG 2R92H 4X65L 4R4TA 3HOVG 1C0AA 2AWOA 4JI1Q 1X3FA 3H3VH 1YHBA 1E1TA 1HZBA 2RHSB 3ULPA 1K73C 2A8VA 2BA0A 2N78A 1QVCA 3I55A 1X56A 2ASBA 4POFA 4OWTB 1VQ7A 2JA8H 2UXDQ 1C9OA 2C35B 3JC66 4R4CA 3S24A 2I5MX 1SFOH 1NTGA 3B6YA 2RCNA 1XNRL 1B8AA 3KJOA 4DUZL 1S40A 3GTKH 4BXXH 1X54A 4DV4Q 1IBMQ 4JCVE 4DAYB 4B3RL 4GLXA 3RN5A 1VCIA 4IPCA 3RNUA 4GKKQ 4JI6Q 1N34Q 3K7AH 2UXCQ 5JJIA 4LFBQ 3A5UA 4KHZA 2ALYB 2Q2HA 4PG3A 4C3JH 1NBWA 3TS0A 1A8VA 3F1ZA 4JI8Q 3CPWA 2R92G 3HOVH 2KENA 4IFDJ 2R93H 4LUOA 2RHQB 4A3CH 3KDFA 1HR0L 1B7YB 3GDEA 3J80i 4LF6Q 4K0KQ 1B70B 1HZAA 1IBKQ 4QQBX 1MIUA 4DPGA 1JMCA 1CKNA 5IYDH 3OW2A 4A3MH 4JI3Q 3ER0A 2HIXA 1WJJA 2K4KA 3EBEA 2UUAL 1PH2A 3CC2A 3U4ZA 2I0QA 3K81C 3L7ZC 1CKOA 2NZHA 2JA5G 4L5QA 1HH2P 1V9PA 3K80C 2Q2IA 4KHPQ 1Q12A 4OO1G 1OXSC 1VQFA 4BXXG 2BA1A 1HNWQ 4DK3C 3T1YQ 4UPAA 1VQBA 2I5HA 3PUVA 1VQDA 4GN4B 3M4OH 2ZTDA 4DV2L 3HOWG 3GTJH 3MXNB 3E0EA 1HNXQ 3NENA 4JI7L 2NN6I 3UDGA 4JV5L 4JOIC 1PH6A 1V1QA 4LUVA 3HOYH 3I4MH 4DR2Q 3GTOH 3M85A 1NE3A 1Q82C 2NVQH 4GLAC 3ICEA 2K75A 4IPDA 2UU9L 2ZJQA 5BR8Q 3CQZH 4DV0Q 5LMNQ 1K9MC 1T9HA 1N33Q 4JBKA 3NBHB 2CQOA 3CMEA 1HZ9A 4LW1A 4P74A 2NZOA 1Z47A 5M3FH 3PUXA 3G6EA 2K52A 2E8GA 5IYBH 2B63H 4MZ9A 2JEBI 1K8GA 4KI0A 1IL2A 4L5SA 1VQ6A 2Z0SA 4YY3Q 4AQYQ 1MJCA 1NJIC 1XPOA 3RLOA 3CCQA 3PIOA 1C7YA 3K8AA 2KCTA 4Y52H 4Y7NH 5H1SE 4A75A 5LMNL 2F4VL 1E1OA 2VS1A 1IBLL 2OQKA 4OONA 1K8AC 1FL0A 2JEAI 1PYBA 3K0XA 3CCEA 1Q7YC 3J81i 2F4VQ 2N49A 2JA6H 2GN5A 2D0OA 4C3HH 2AWNA 2NVXH 3E9HA 1HNXL 1G51A 4LFBL 1QZGA 2D0PA 2FXQA 4AYBG 3F2BA 4KLKA 3M3YH 5GROA 2HT1A 3S2HH 1HNWL 2B63G 4GKKL 1Q8KA 3CCJA 1XNQQ 1KHIA 5FLMH 4A3DH 4X66Q 4DV4L 4APVA 1X3GA 3M7NA 3U4VA 4DR3L 2B3GA 2BH2A 4LFAL 3H3VI 1TXYA 2OQ0A 4GNXC 2JA5H 1KXLA 3KF6B 2CKZB 2UUCQ 1RIPA 4BBRG 4JV5Q 4NXNQ 4JI1L 1P8LA 4JI4Q 4LF9L 5C4JH 2JA7G 2KHIA 2WB1G 4LWCA 1SR3A 1SN8A 3G71A 1N36Q 1SE8A 3CW2C 4P73A 4BBSG 4DR6Q 2JK8A 4QIWE 1I5FA 2WAQE 2GVAA 3E9IA 4A93H 5JEAJ 4A3LG 4QY7A 4BBRH 5JEAG 3CAMA 1EUJA 1R9TH 3TEHB 1VQMA 1A0IA 4JI5Q 4JI6L 3I7FA 2XTIA 3RLFA 1BVSA 2ID0A 2VL6A 4YWKA 3UE1A 4A3FH 1VQNA 4DV3Q 2E2HH 2JA7H 3J7A5 5LMUQ 4BBSH 3FHWA 4GS3A 1IBKL 3S1QH 2JJQA 1YEZA 1IYJB 1J5EL 3RZDH 1UE5A 2I5LX 1KC8C 1ASYA 3J7ZC 2Z6KC 5IWAQ 4QGUA 2JE6I 1EQQA 4R4QA 4K0KL 1EYGA 3CC4A 4DV6L 3CXCA 3KF8B 4HIMA 2R93G 4A3JG 5HGQA 3AQQA 3UDIA 3HFZB 3RR5A 1WYDA 4GKJQ 4IJHA 4X62L 4LF7L 3S15H 1I6HH 1IXRA 2LXJA 4DR4Q 3SGIA 2JQOA 3S17H 2NVYH 2R7ZG 3CCRA 1IBML 2EQSA 2A19A 4A3MG 2PI2A 1G6PA 2B29A 4B3MQ 4GN3B 1VQJA 5IY0A 4YWLA 1Y1VH 3CF5A 3AEVA 4XTCS 3HOYG 4DV6Q 1WI5A 1MKHA 3PV0A 1GKHA 4DKAC 4DV7L 5FJ8H 1XNRQ 2N3SA 4DR7Q 5IYCG 1E24A 4OX9L 4LFCL 1YI2A 1EFWA 1XJVA 3KJPA 1NMFA 2IX0A 1KIXA 4DR2L 1SMXA 1I3QH 4HJ8A 4DV5Q 2NVTH 2VNUD 2GVBA 4A3JH 4P72A 2K50A 1PH4A 2AHOB 4DR4L 3D0FA 3FKIH 3J81c 3DLLA 1EIFA 3I4MG 2UUBL 4NXML 1PYSB 4L5RC 4YCWA 3A74A 2IT1A 4EX5A 4A3GH 1L1OA 3J81j 1VQHA 2H5XA 3KOJA 4P71A 2MNAA 1UWVA 2PMZE 1HNZL 4DUZQ 2ES2A 4GOPA 5IWAL 1BBWA 1UE6A 3W1BA 1Y1WG 1EOVA 3CD6A 2UXDL 4OWWB 4X6AH 4DV5L 4JBJA 2QA4A 1UE1A 4PZ7A 1VQKA 3H15A 3ULLA 3I4NG 2YTXA 3OTOQ 1PV4A 1YHAA 3TREA 5JJLA 5LMNW 1SLJA 3KLWA 3UDFA 2KCMA 1CKMA 2Q2TA 3KFUA 3STBC 1PH8A 1TWHH 2NN6G 1KD1C 2UUBQ 1QZHA 5GAEC 1PFSA 4FDBA 3EIVA 4DR5L 3UDXA 1IZ6A 4B3ML 4A3BG 2RF4A 4A3GG 1DGSA 1YIJA 2PQAB 4OWXB 1SRUA 3AFQA 3F2CA 1VQ5A 4B3SQ 4LF4L 1FJGL 3PF5A 1XNQL 4DR6L 3H0GH 2L15A 2K5HA 3CCMA 3NELA 1WFQA 3I2ZA 2UUAQ 3NEMA 4A3CG 3I4OA 4GNXA 5FLXc 3OTOL 1N9WA 3T1HQ 3TS2A 4J15A 1PHJA 1VQEA 5EAYA 4LFCQ 1I50H 1NY4A 1V43A 2DGYA 1VS0A 1Y14B 1AE3A 2ZTCA 5FJ8G 2KBNA 1TWFH 4DV1L 1K3RA 4LFAQ 4LF5L 4DR3Q 3CCVA 1L0WA 4DR7L 1YJWA 3CCSA 1VQOA 4B3TQ 4NB3A 3HKZG 4IPGA 3M4QA 2UXBL 2JA6G 5AJ3Q 2F52A 4A3KH 4HIOA 1QUQA 1M90C 1CUKA 5GADC 3HOUG 2JA8G 4ALPA 4H02A 4AQYL 2CWPA 4A3EG 3PO3H 4LUZA 4A76A 2K14A 1OXXK 5M5XH 4B3RQ 1Q86C 1OXTA 1KQSA 2E5LQ 3J80c 4JBWA 5IP7H 4LF5Q 2YTYA 2ZM6Q 2ZTEA 5GQOA 4A3IH 3CCLA 1X65A 4ME3A 1PH5A 1LUZA 4A3KG 4TVAB 3TRZA 4DV0L 4A3BH 1EWIA 2UU9Q 4DK6C 3PO2H 1KL9A 4BA1I 4GOPC 4DV3L 1Q1BA 3BZCA 1YHQA 2R7ZH 1GVPA 4WJ4A 3EN2A 1NMGA 2A1AA 3HKZE 1D8LA 1I94Q 4PZ8A 4P75A 3Q8DA 1PH9A 3MEFA 1Q81C 2DUDA 3PUZA 4DR1Q 3GTMH 1TWAH 3OYYA 4A4IA 1HNZQ 4JI2Q 4GN5A 5HY6A 2ZJRA 5JJKA 4A93G 4POGA 4R4IA 4NXMQ 1S72A 2HIVA 3PUWA 2VZAA 1GD7A 1VQPA 4JI4L 1JB7A 2VQFL 3AFPA 3ERSX 3PSIA 4NXNL 4JC0A 3W1GA 4AYBE 1VQLA 3GTQH 3G48A 4HJ5A 3PO2G 3PUYA 5LMUL 1VQIA 3ZJYC 1IBLQ 1VQAA 5C3EH 3CP0A 4JI5L 5IP7G 1M1KC 4LF6L 4DV7Q 3HKSA 4C2MH 4LNQA 1P16A 1E7ZA 1Y1WH 3TQYA 2VQEL 3GD7A 2CWAA 2E2IH 1GM5A 3CPFA 5C4XG 1E3PA 4BA2I 3RLNA 1VQGA 1WOCA 3IRBA 1KRTA 4BY1G 2XGTA 3F2DA 4DUYL 5M3MH 1N34L 3CC7A 1KRSA 4UP7A 4HIDA 1VQ9A 4LF8L 3PF4A 2ZJPA 2YU9H 1G291 4OXPA 2HHHL 1X9NA 4C3IH 4UP8A 5J3BA 3GTLH 1UEBA 2Q2UA 4RMFA 1OXUA 3BU2A 4IFDI 4JYAL 2HQLA 3KYHC 1PH3A 5FLMG 2OWOA 4A3DG 1TWCH 4NPSA 1FGUA 1YZ6A 2YYZA 5C0XG 2OTJA 3H0GG 3D31A 4TQUS 1Y1VG 2R7FA 1BBUA 1A63A 4JI7Q 2VQFQ 4UP9A 1XMQL 4X65Q 5IYDG 4IJLA 1UE7A 1XTDA 1J6QA 5C4XH 1JE5A 1O7IA 3BJUA 4JOIA 2Y0SE 3U58A 4YWMA 1YITA 4PZ6A 2YV5A 4LF4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 L;  1QVG A;  4DR5 Q;  2D62 A;  3S14 H;  1X6O A;  1AH9 A;  5IE8 A;  3HOZ H;  1X3E A;  1YBY A;  1AE2 A;  1PH1 A;  1SRO A;  2AMC B;  1N32 Q;  1S3O A;  3T1H L;  2R6G A;  4BY7 G;  2UUC L;  2MQH A;  4L5T A;  5IT9 c;  2IY5 B;  5C44 G;  1LTL A;  3HOX G;  4LF8 Q;  2MFI A;  1EIY B;  5C44 H;  3HOX H;  3HOW H;  4KHP L;  1YNX A;  5C0X J;  1JJ2 A;  4JI2 L;  2VUM H;  4IOA A;  2AKW B;  1E22 A;  4IO9 A;  4JI8 L;  5ELN A;  4DR1 L;  4YHH L;  3T1Y L;  3I4N H;  3L2P A;  1JJG A;  3M4P A;  4X66 L;  3VDY A;  2CCZ A;  3G4S A;  3S1R H;  1A62 A;  1OXV A;  1I94 L;  1N33 L;  1L1O B;  3S1N H;  5BR8 L;  1CSP A;  3GTP H;  4IPH A;  5IP9 G;  1PA6 A;  2R7D A;  3KF6 A;  4DNI A;  4IOC A;  1WCM G;  3JAM i;  4YCV A;  1L1O C;  5IYC H;  1CSQ A;  4MNO A;  4XIG S;  4JG2 A;  4AIM A;  4JI3 L;  1MJE A;  2WAQ G;  4OX9 Q;  4DV2 Q;  2WB1 E;  4JYA Q;  2QEX A;  1YVC A;  4X64 Q;  2K5N A;  1CKN B;  2Z6K A;  3BZK A;  3HOZ G;  3W5O A;  1QUQ B;  1QVF A;  1HJP A;  4YCU A;  1Q1E A;  2KHJ A;  2VY3 A;  2YTV A;  5ELO A;  4YY3 L;  3JAM c;  3S2D H;  4GLV B;  2OCE A;  4DUY Q;  1LM0 A;  3KDF B;  1XMQ Q;  4A3E H;  3M9B A;  4QL5 A;  4HJ7 A;  5AJ3 L;  3PO3 G;  4BY7 H;  2UXC L;  1JT8 A;  4X62 Q;  4LF7 Q;  5M3M G;  4GKJ L;  4R4O A;  4DAM A;  1YJN A;  1HZC A;  3S16 H;  2IHE A;  2ATW A;  2VUM G;  1U5K A;  4MTN A;  1K83 H;  3K7U C;  1L2F A;  4PMW A;  2E2J H;  3U50 C;  2UXB Q;  4GNX B;  2CFM A;  1N8R C;  2Y0S G;  3AYH B;  1VQ4 A;  1Q46 A;  2QGQ A;  1HR0 W;  1HR0 Q;  4R1J A;  2ZM6 L;  1VQC A;  4O0A A;  2HHH Q;  4RG1 A;  2PQA A;  1Z9F A;  1J5E Q;  4JBM A;  1FVI A;  5IP9 H;  2EXD A;  5GAG C;  2VW9 A;  4IFD G;  4HJA A;  3GO5 A;  1RL2 A;  1FJG Q;  4B3S L;  4EQ5 A;  1PVO A;  3L0O A;  1EQR A;  5K36 G;  1VQ8 A;  2IHF A;  3A0J A;  2LXK A;  2VQE Q;  3S1M H;  1XPU A;  1K0R A;  2EIF A;  1BKB A;  2MO1 A;  3DM3 A;  3PCO B;  1XPR A;  1U0L A;  3UE0 A;  1W2B A;  3STB D;  2N8N A;  5IYB G;  2IX1 A;  4YHH Q;  3LGJ A;  5GAH C;  3I56 A;  4B3T L;  1TWG H;  2OTL A;  5DLQ E;  4A3F G;  2JA9 A;  1GO3 E;  2F3I A;  1XMO Q;  4JI0 Q;  2WFW A;  4DV1 Q;  1H95 A;  4AH6 A;  3FKI G;  3RN2 A;  2V1C C;  4HIK A;  2K5V A;  2MO0 A;  1W3S A;  4LF9 Q;  4GOP B;  2PI2 E;  1PH7 A;  3PIP A;  4UY8 C;  1XMO L;  4JI0 L;  4A3L H;  1ASZ A;  1N32 L;  5M5W H;  3WWV A;  4BY1 H;  3PGZ A;  3CMA A;  1D7Q A;  2WP8 J;  2BH8 A;  4WJ3 M;  5M5Y H;  1WCM H;  4QJF A;  4HJ9 A;  5M3F G;  1OTC A;  3GTG H;  3HOU H;  3RZO H;  2E5L L;  1YJ9 A;  1KAW A;  3FP9 A;  1JJC B;  5E7N A;  3ULJ A;  2LSS A;  1X55 A;  2PNH A;  5C3E G;  3F8T A;  5C0X I;  1N36 L;  4OO1 I;  3CCU A;  4O2D A;  1LYL A;  3A5Z B;  4A3I G;  2R92 H;  4X65 L;  4R4T A;  3HOV G;  1C0A A;  2AWO A;  4JI1 Q;  1X3F A;  3H3V H;  1YHB A;  1E1T A;  1HZB A;  2RHS B;  3ULP A;  1K73 C;  2A8V A;  2BA0 A;  2N78 A;  1QVC A;  3I55 A;  1X56 A;  2ASB A;  4POF A;  4OWT B;  1VQ7 A;  2JA8 H;  2UXD Q;  1C9O A;  2C35 B;  3JC6 6;  4R4C A;  3S24 A;  2I5M X;  1SFO H;  1NTG A;  3B6Y A;  2RCN A;  1XNR L;  1B8A A;  3KJO A;  4DUZ L;  1S40 A;  3GTK H;  4BXX H;  1X54 A;  4DV4 Q;  1IBM Q;  4JCV E;  4DAY B;  4B3R L;  4GLX A;  3RN5 A;  1VCI A;  4IPC A;  3RNU A;  4GKK Q;  4JI6 Q;  1N34 Q;  3K7A H;  2UXC Q;  5JJI A;  4LFB Q;  3A5U A;  4KHZ A;  2ALY B;  2Q2H A;  4PG3 A;  4C3J H;  1NBW A;  3TS0 A;  1A8V A;  3F1Z A;  4JI8 Q;  3CPW A;  2R92 G;  3HOV H;  2KEN A;  4IFD J;  2R93 H;  4LUO A;  2RHQ B;  4A3C H;  3KDF A;  1HR0 L;  1B7Y B;  3GDE A;  3J80 i;  4LF6 Q;  4K0K Q;  1B70 B;  1HZA A;  1IBK Q;  4QQB X;  1MIU A;  4DPG A;  1JMC A;  1CKN A;  5IYD H;  3OW2 A;  4A3M H;  4JI3 Q;  3ER0 A;  2HIX A;  1WJJ A;  2K4K A;  3EBE A;  2UUA L;  1PH2 A;  3CC2 A;  3U4Z A;  2I0Q A;  3K81 C;  3L7Z C;  1CKO A;  2NZH A;  2JA5 G;  4L5Q A;  1HH2 P;  1V9P A;  3K80 C;  2Q2I A;  4KHP Q;  1Q12 A;  4OO1 G;  1OXS C;  1VQF A;  4BXX G;  2BA1 A;  1HNW Q;  4DK3 C;  3T1Y Q;  4UPA A;  1VQB A;  2I5H A;  3PUV A;  1VQD A;  4GN4 B;  3M4O H;  2ZTD A;  4DV2 L;  3HOW G;  3GTJ H;  3MXN B;  3E0E A;  1HNX Q;  3NEN A;  4JI7 L;  2NN6 I;  3UDG A;  4JV5 L;  4JOI C;  1PH6 A;  1V1Q A;  4LUV A;  3HOY H;  3I4M H;  4DR2 Q;  3GTO H;  3M85 A;  1NE3 A;  1Q82 C;  2NVQ H;  4GLA C;  3ICE A;  2K75 A;  4IPD A;  2UU9 L;  2ZJQ A;  5BR8 Q;  3CQZ H;  4DV0 Q;  5LMN Q;  1K9M C;  1T9H A;  1N33 Q;  4JBK A;  3NBH B;  2CQO A;  3CME A;  1HZ9 A;  4LW1 A;  4P74 A;  2NZO A;  1Z47 A;  5M3F H;  3PUX A;  3G6E A;  2K52 A;  2E8G A;  5IYB H;  2B63 H;  4MZ9 A;  2JEB I;  1K8G A;  4KI0 A;  1IL2 A;  4L5S A;  1VQ6 A;  2Z0S A;  4YY3 Q;  4AQY Q;  1MJC A;  1NJI C;  1XPO A;  3RLO A;  3CCQ A;  3PIO A;  1C7Y A;  3K8A A;  2KCT A;  4Y52 H;  4Y7N H;  5H1S E;  4A75 A;  5LMN L;  2F4V L;  1E1O A;  2VS1 A;  1IBL L;  2OQK A;  4OON A;  1K8A C;  1FL0 A;  2JEA I;  1PYB A;  3K0X A;  3CCE A;  1Q7Y C;  3J81 i;  2F4V Q;  2N49 A;  2JA6 H;  2GN5 A;  2D0O A;  4C3H H;  2AWN A;  2NVX H;  3E9H A;  1HNX L;  1G51 A;  4LFB L;  1QZG A;  2D0P A;  2FXQ A;  4AYB G;  3F2B A;  4KLK A;  3M3Y H;  5GRO A;  2HT1 A;  3S2H H;  1HNW L;  2B63 G;  4GKK L;  1Q8K A;  3CCJ A;  1XNQ Q;  1KHI A;  5FLM H;  4A3D H;  4X66 Q;  4DV4 L;  4APV A;  1X3G A;  3M7N A;  3U4V A;  4DR3 L;  2B3G A;  2BH2 A;  4LFA L;  3H3V I;  1TXY A;  2OQ0 A;  4GNX C;  2JA5 H;  1KXL A;  3KF6 B;  2CKZ B;  2UUC Q;  1RIP A;  4BBR G;  4JV5 Q;  4NXN Q;  4JI1 L;  1P8L A;  4JI4 Q;  4LF9 L;  5C4J H;  2JA7 G;  2KHI A;  2WB1 G;  4LWC A;  1SR3 A;  1SN8 A;  3G71 A;  1N36 Q;  1SE8 A;  3CW2 C;  4P73 A;  4BBS G;  4DR6 Q;  2JK8 A;  4QIW E;  1I5F A;  2WAQ E;  2GVA A;  3E9I A;  4A93 H;  5JEA J;  4A3L G;  4QY7 A;  4BBR H;  5JEA G;  3CAM A;  1EUJ A;  1R9T H;  3TEH B;  1VQM A;  1A0I A;  4JI5 Q;  4JI6 L;  3I7F A;  2XTI A;  3RLF A;  1BVS A;  2ID0 A;  2VL6 A;  4YWK A;  3UE1 A;  4A3F H;  1VQN A;  4DV3 Q;  2E2H H;  2JA7 H;  3J7A 5;  5LMU Q;  4BBS H;  3FHW A;  4GS3 A;  1IBK L;  3S1Q H;  2JJQ A;  1YEZ A;  1IYJ B;  1J5E L;  3RZD H;  1UE5 A;  2I5L X;  1KC8 C;  1ASY A;  3J7Z C;  2Z6K C;  5IWA Q;  4QGU A;  2JE6 I;  1EQQ A;  4R4Q A;  4K0K L;  1EYG A;  3CC4 A;  4DV6 L;  3CXC A;  3KF8 B;  4HIM A;  2R93 G;  4A3J G;  5HGQ A;  3AQQ A;  3UDI A;  3HFZ B;  3RR5 A;  1WYD A;  4GKJ Q;  4IJH A;  4X62 L;  4LF7 L;  3S15 H;  1I6H H;  1IXR A;  2LXJ A;  4DR4 Q;  3SGI A;  2JQO A;  3S17 H;  2NVY H;  2R7Z G;  3CCR A;  1IBM L;  2EQS A;  2A19 A;  4A3M G;  2PI2 A;  1G6P A;  2B29 A;  4B3M Q;  4GN3 B;  1VQJ A;  5IY0 A;  4YWL A;  1Y1V H;  3CF5 A;  3AEV A;  4XTC S;  3HOY G;  4DV6 Q;  1WI5 A;  1MKH A;  3PV0 A;  1GKH A;  4DKA C;  4DV7 L;  5FJ8 H;  1XNR Q;  2N3S A;  4DR7 Q;  5IYC G;  1E24 A;  4OX9 L;  4LFC L;  1YI2 A;  1EFW A;  1XJV A;  3KJP A;  1NMF A;  2IX0 A;  1KIX A;  4DR2 L;  1SMX A;  1I3Q H;  4HJ8 A;  4DV5 Q;  2NVT H;  2VNU D;  2GVB A;  4A3J H;  4P72 A;  2K50 A;  1PH4 A;  2AHO B;  4DR4 L;  3D0F A;  3FKI H;  3J81 c;  3DLL A;  1EIF A;  3I4M G;  2UUB L;  4NXM L;  1PYS B;  4L5R C;  4YCW A;  3A74 A;  2IT1 A;  4EX5 A;  4A3G H;  1L1O A;  3J81 j;  1VQH A;  2H5X A;  3KOJ A;  4P71 A;  2MNA A;  1UWV A;  2PMZ E;  1HNZ L;  4DUZ Q;  2ES2 A;  4GOP A;  5IWA L;  1BBW A;  1UE6 A;  3W1B A;  1Y1W G;  1EOV A;  3CD6 A;  2UXD L;  4OWW B;  4X6A H;  4DV5 L;  4JBJ A;  2QA4 A;  1UE1 A;  4PZ7 A;  1VQK A;  3H15 A;  3ULL A;  3I4N G;  2YTX A;  3OTO Q;  1PV4 A;  1YHA A;  3TRE A;  5JJL A;  5LMN W;  1SLJ A;  3KLW A;  3UDF A;  2KCM A;  1CKM A;  2Q2T A;  3KFU A;  3STB C;  1PH8 A;  1TWH H;  2NN6 G;  1KD1 C;  2UUB Q;  1QZH A;  5GAE C;  1PFS A;  4FDB A;  3EIV A;  4DR5 L;  3UDX A;  1IZ6 A;  4B3M L;  4A3B G;  2RF4 A;  4A3G G;  1DGS A;  1YIJ A;  2PQA B;  4OWX B;  1SRU A;  3AFQ A;  3F2C A;  1VQ5 A;  4B3S Q;  4LF4 L;  1FJG L;  3PF5 A;  1XNQ L;  4DR6 L;  3H0G H;  2L15 A;  2K5H A;  3CCM A;  3NEL A;  1WFQ A;  3I2Z A;  2UUA Q;  3NEM A;  4A3C G;  3I4O A;  4GNX A;  5FLX c;  3OTO L;  1N9W A;  3T1H Q;  3TS2 A;  4J15 A;  1PHJ A;  1VQE A;  5EAY A;  4LFC Q;  1I50 H;  1NY4 A;  1V43 A;  2DGY A;  1VS0 A;  1Y14 B;  1AE3 A;  2ZTC A;  5FJ8 G;  2KBN A;  1TWF H;  4DV1 L;  1K3R A;  4LFA Q;  4LF5 L;  4DR3 Q;  3CCV A;  1L0W A;  4DR7 L;  1YJW A;  3CCS A;  1VQO A;  4B3T Q;  4NB3 A;  3HKZ G;  4IPG A;  3M4Q A;  2UXB L;  2JA6 G;  5AJ3 Q;  2F52 A;  4A3K H;  4HIO A;  1QUQ A;  1M90 C;  1CUK A;  5GAD C;  3HOU G;  2JA8 G;  4ALP A;  4H02 A;  4AQY L;  2CWP A;  4A3E G;  3PO3 H;  4LUZ A;  4A76 A;  2K14 A;  1OXX K;  5M5X H;  4B3R Q;  1Q86 C;  1OXT A;  1KQS A;  2E5L Q;  3J80 c;  4JBW A;  5IP7 H;  4LF5 Q;  2YTY A;  2ZM6 Q;  2ZTE A;  5GQO A;  4A3I H;  3CCL A;  1X65 A;  4ME3 A;  1PH5 A;  1LUZ A;  4A3K G;  4TVA B;  3TRZ A;  4DV0 L;  4A3B H;  1EWI A;  2UU9 Q;  4DK6 C;  3PO2 H;  1KL9 A;  4BA1 I;  4GOP C;  4DV3 L;  1Q1B A;  3BZC A;  1YHQ A;  2R7Z H;  1GVP A;  4WJ4 A;  3EN2 A;  1NMG A;  2A1A A;  3HKZ E;  1D8L A;  1I94 Q;  4PZ8 A;  4P75 A;  3Q8D A;  1PH9 A;  3MEF A;  1Q81 C;  2DUD A;  3PUZ A;  4DR1 Q;  3GTM H;  1TWA H;  3OYY A;  4A4I A;  1HNZ Q;  4JI2 Q;  4GN5 A;  5HY6 A;  2ZJR A;  5JJK A;  4A93 G;  4POG A;  4R4I A;  4NXM Q;  1S72 A;  2HIV A;  3PUW A;  2VZA A;  1GD7 A;  1VQP A;  4JI4 L;  1JB7 A;  2VQF L;  3AFP A;  3ERS X;  3PSI A;  4NXN L;  4JC0 A;  3W1G A;  4AYB E;  1VQL A;  3GTQ H;  3G48 A;  4HJ5 A;  3PO2 G;  3PUY A;  5LMU L;  1VQI A;  3ZJY C;  1IBL Q;  1VQA A;  5C3E H;  3CP0 A;  4JI5 L;  5IP7 G;  1M1K C;  4LF6 L;  4DV7 Q;  3HKS A;  4C2M H;  4LNQ A;  1P16 A;  1E7Z A;  1Y1W H;  3TQY A;  2VQE L;  3GD7 A;  2CWA A;  2E2I H;  1GM5 A;  3CPF A;  5C4X G;  1E3P A;  4BA2 I;  3RLN A;  1VQG A;  1WOC A;  3IRB A;  1KRT A;  4BY1 G;  2XGT A;  3F2D A;  4DUY L;  5M3M H;  1N34 L;  3CC7 A;  1KRS A;  4UP7 A;  4HID A;  1VQ9 A;  4LF8 L;  3PF4 A;  2ZJP A;  2YU9 H;  1G29 1;  4OXP A;  2HHH L;  1X9N A;  4C3I H;  4UP8 A;  5J3B A;  3GTL H;  1UEB A;  2Q2U A;  4RMF A;  1OXU A;  3BU2 A;  4IFD I;  4JYA L;  2HQL A;  3KYH C;  1PH3 A;  5FLM G;  2OWO A;  4A3D G;  1TWC H;  4NPS A;  1FGU A;  1YZ6 A;  2YYZ A;  5C0X G;  2OTJ A;  3H0G G;  3D31 A;  4TQU S;  1Y1V G;  2R7F A;  1BBU A;  1A63 A;  4JI7 Q;  2VQF Q;  4UP9 A;  1XMQ L;  4X65 Q;  5IYD G;  4IJL A;  1UE7 A;  1XTD A;  1J6Q A;  5C4X H;  1JE5 A;  1O7I A;  3BJU A;  4JOI A;  2Y0S E;  3U58 A;  4YWM A;  1YIT A;  4PZ6 A;  2YV5 A;  4LF4 Q; 
#chains in the Genus database with same CATH topology
 4X64 L;  4KD3 A;  4IUP A;  2F0D A;  1X6O A;  3QOJ A;  1AE2 A;  1A2T A;  1SRO A;  2P5Z X;  5KNB A;  4RH6 A;  3U9S A;  2CW0 D;  5C5L A;  4BY7 G;  1TY2 A;  4L5T A;  4A3F B;  2IY5 B;  5C44 G;  1Q90 A;  1VF7 A;  4LF8 Q;  3HOW H;  4JI2 L;  1NUC A;  3T1Y L;  4YHH L;  4X66 L;  3G4S A;  3K5N A;  3S1R H;  4KMU C;  4FYD A;  3A8J E;  1L1O B;  3S1N H;  4FF4 A;  4DXF A;  1PA6 A;  5IGC A;  2R7D A;  2F0E A;  4G4K A;  3JAM i;  1CSQ A;  4XQQ A;  4JG2 A;  1MJE A;  3VYR A;  3DWQ A;  2VUM B;  5IGB A;  3ZYY X;  4XT3 B;  2JA5 B;  4J8Q A;  2QEX A;  3CQZ B;  3A7A B;  3HOZ G;  1QVF A;  1HJP A;  2KHJ A;  1EFI D;  3OHX C;  4C3J G;  3VYT A;  3PO3 G;  3M9B A;  4ULL A;  5IT9 L;  1JWM D;  3X3M A;  2F0Q A;  3KLS A;  2UXC L;  2RBM A;  4LF7 Q;  5IGF A;  3S16 H;  1HZC A;  2WAC A;  1U5K A;  4DAP A;  3K7U C;  4KY7 A;  5BN5 A;  4H13 C;  4GNX B;  2CFM A;  4OIK A;  4NW2 A;  5EJW A;  4O0A A;  1TWH B;  4RG1 A;  2PQA A;  1MHW C;  5IP9 H;  4K5X A;  2VW9 A;  1FJG Q;  1RL2 A;  1JWU D;  5K36 G;  2IHF A;  3C46 A;  3S1M H;  3C1E A;  4KY6 A;  1J8I A;  3STB D;  3LGJ A;  4CDF C;  4C2M B;  2JA9 A;  5AFW A;  2F3I A;  4DV1 Q;  3DEP A;  1H95 A;  2V1C C;  4MIU A;  4HIK A;  5IGE A;  2PI2 E;  1RF2 D;  1WTW A;  1PH7 A;  3J80 L;  1SNP A;  1ASZ A;  1T5E A;  5M5W H;  3WWV A;  3CMA A;  4H0L C;  2B2Y A;  2XVS A;  4WJ3 M;  1PTO D;  3M4O B;  1WCM H;  3GTG H;  4I7Z C;  1RJT A;  2NZ1 D;  3FP9 A;  1QE6 A;  2N55 A;  2ZXO A;  2LSS A;  5C3E G;  3L3O C;  1SE2 A;  1QCB D;  4O2D A;  3A5Z B;  4CDE C;  4EVO A;  4X65 L;  4R4T A;  2R92 H;  3HOV G;  1Q8I A;  3DEO A;  3PQI A;  1MI2 A;  2B39 A;  1OO9 B;  1S5F D;  1E2Z A;  2ASB A;  5M5X B;  4OWT B;  2E2I B;  2UXD Q;  4R4C A;  3TDQ A;  2I5M X;  1I4P A;  1DOL A;  2RCN A;  3KJO A;  4DUZ L;  2I07 B;  4DV4 Q;  4DAY B;  1LT5 D;  1VCI A;  2EDG A;  1ONL A;  4IPC A;  5CV9 A;  1ET9 A;  4Q5V A;  2UXC Q;  3E3X A;  3A5U A;  1BCP B;  2A6H D;  1PDQ A;  1NBW A;  2LMC B;  3TS0 A;  3GTL B;  4GZY C;  1SYB A;  3SHL A;  2KEN A;  4RGN A;  1F2M A;  2R93 H;  4LUO A;  1H9J A;  3GTK B;  1YNN C;  3KDF A;  3I3C A;  1B7Y B;  3MC0 B;  4LF6 Q;  3D4D A;  2EY5 A;  4QUC A;  1WTX A;  1CKN A;  3EBE A;  1WJJ A;  2RVL A;  2JYO A;  4OIJ A;  3R3O A;  4HCE A;  5C4Z A;  1CQV A;  3H09 A;  5G3L D;  1QNK A;  3UI2 A;  1PRT B;  3K81 C;  1CKO A;  5K36 H;  2JA5 G;  1HH2 P;  2Q2I A;  4OO1 G;  2E2J B;  2HD3 A;  1OXS C;  4DXG A;  2L12 A;  1NCV A;  4DK3 C;  3T1Y Q;  3PUV A;  2K01 A;  5L37 A;  1D1I A;  3E0E A;  1HNX Q;  1PTO C;  1EZ8 A;  3I4M H;  5A35 A;  3A8I E;  1Q82 C;  1SYF A;  1EOT A;  1TWA B;  5NUC A;  3SK6 A;  1WTR A;  4IPD A;  2A5H A;  3SDZ A;  1BO0 A;  5LMN Q;  1K9M C;  2D5D A;  1FNV A;  2K5Q A;  1EY5 A;  2CQO A;  3CME A;  1HZ9 A;  4LW1 A;  1B2T A;  2CHB D;  4DFA A;  3PUX A;  4FXD A;  1HRJ A;  3I72 A;  2NUC A;  4L5S A;  1NJI C;  1MJC A;  3V2T A;  4CJ2 C;  1XPO A;  3RLO A;  3CCQ A;  3PIO A;  2E76 C;  5H1S E;  5LMN L;  1XXG A;  1JCK B;  1IBL L;  3TP6 A;  1Q7Y C;  2JA6 H;  4C3I G;  1EIG A;  3NBH A;  5FO8 B;  4AYB G;  2KOL A;  4GKK L;  1Q8K A;  1KHI A;  2C9O A;  1HTP A;  3U4V A;  3M7N A;  3HOU B;  3NTI A;  2QW7 A;  2F0P A;  3SK4 A;  4GNX C;  3A55 A;  1X32 A;  1S5C D;  1X3Q A;  1YNJ C;  1C4Q A;  5FKA C;  5C4J H;  2JA7 B;  1SR3 A;  4P73 A;  1STG A;  4X3S A;  4FXK C;  2B63 B;  3EA6 A;  3E9I A;  2K28 A;  3I4N B;  5JEA J;  4A93 H;  1IYV A;  3DHQ A;  1A0I A;  1SMY C;  2F0M A;  2F0K A;  2XTI A;  3KK7 A;  3MZ5 A;  4YWK A;  1VQN A;  2E2H H;  4GS3 A;  1BQQ T;  2Z8L A;  2BOS A;  3TME A;  1IYJ B;  3TN2 A;  4KK7 A;  2I5L X;  1ASY A;  1TR5 A;  4K6D A;  4IUR A;  2JE6 I;  3VR4 A;  4K2K A;  3CC4 A;  3CXC A;  4X3U A;  2R93 G;  4F7X A;  1K3B C;  3UDI A;  3S15 H;  2FHT A;  2LXJ A;  1L0X B;  4DR4 Q;  3HS0 C;  3MHB A;  4MTK A;  2NVY H;  2R7Z G;  1EYA A;  1IBM L;  4A3M G;  2B29 A;  1VQJ A;  5IY0 A;  1STB A;  1EY7 A;  4DKA C;  1MKH A;  3PV0 A;  1GKH A;  2QDL A;  5FJ8 H;  1KLU D;  4DR7 Q;  5IYC G;  4OX9 L;  4NP5 A;  1XJV A;  1JOK A;  3K57 A;  1I3Q H;  1LT4 D;  3FMC A;  4DV5 Q;  2NVT H;  2VNU D;  1F77 A;  1G8Z D;  2GVB A;  4A3J H;  5G3L F;  1PH4 A;  2A68 C;  3MTS A;  3I4M G;  2UUB L;  4NXM L;  1PYS B;  1S5D D;  4YCW A;  4CGY B;  1L1O A;  1EEI D;  1VF5 C;  4P71 A;  3K58 A;  1UWV A;  2LS0 1;  2PMZ E;  3CKI B;  5IWA L;  2XN9 C;  3LWE A;  3W1B A;  4A3J B;  4QCL A;  1RD9 D;  4X6A H;  5D3D A;  4DV5 L;  3TP8 A;  5COR A;  2RA4 A;  1VQK A;  3ULL A;  3IKJ A;  2YTX A;  5J39 A;  3OTO Q;  3TRE A;  1SLJ A;  2D9U A;  1WTO A;  1ZKO A;  3KFU A;  1GXD C;  5GAE C;  1PFS A;  5IYD H;  2RF4 A;  4FP5 D;  3AFQ A;  1VQ5 A;  2CVR A;  4ZUI A;  4H44 C;  1FJG L;  1O7Z A;  2K5H A;  2E74 C;  1WFQ A;  1DJR D;  1LT6 D;  2KEC A;  1PTO B;  3OTO L;  1N9W A;  3TS2 A;  4LFC Q;  1S5E D;  2QCP X;  1EYD A;  3L9A X;  1TII D;  2ZTC A;  2DY7 A;  1K3R A;  3BVZ A;  3RD4 A;  1YNN D;  1BCP D;  3H94 A;  4DR3 Q;  5J22 A;  2R61 A;  3JAM E;  3QO2 A;  5AJ3 Q;  2F52 A;  2BE5 C;  1M90 C;  1B3Q A;  4A3E G;  4LUZ A;  5ELF A;  1OXX K;  4B3R Q;  2RQX A;  1KQS A;  3E6Z X;  3BDC A;  1X3P A;  3J80 c;  1Y8P B;  2EY1 A;  4JBW A;  5IP7 H;  2ZM6 Q;  1GJX A;  1X65 A;  4TVA B;  4DV0 L;  4DK6 C;  3PO2 H;  1K0S A;  2A1A A;  1D8L A;  1QJO A;  2DUD A;  3GTM H;  1TWA H;  1J9O A;  2XWJ B;  4OHJ A;  3Q23 A;  1TVX A;  5EPJ A;  1S72 A;  3PUW A;  3EJI A;  1A3T A;  2E2D C;  2VQF L;  5KYI A;  3NP8 A;  3GTQ H;  3G48 A;  1FYC A;  1GOZ A;  3AB9 A;  4HJ5 A;  2PPB C;  1RKN A;  3KLS X;  4ME5 A;  1GUT A;  5C3E H;  4JI5 L;  5IP7 G;  4LF6 L;  1Q3L A;  1P16 A;  1EY6 A;  2B2Y C;  3S1N B;  5CV8 A;  1GM5 A;  3CPF A;  1EY0 A;  2PZU A;  1KRT A;  3F2D A;  3VA7 A;  1VQ9 A;  1UNS A;  1N34 L;  4LF8 L;  3CC7 A;  2M00 A;  4HID A;  3PF4 A;  1JOO A;  4OXP A;  1X9N A;  1R4Q B;  1WD1 A;  4CDD C;  1F9R A;  1DZ1 A;  3GTL H;  3MXP A;  3BU2 A;  3I8Z A;  3K7A B;  3R8B A;  1SAP A;  2MJ8 A;  3K5O A;  4NPS A;  5C0X G;  1FGU A;  1JC7 A;  3AU7 A;  1A2U A;  4JI7 Q;  4X65 Q;  1M8A A;  5C4X H;  1G2T A;  4UHV A;  1D1K A;  1I4Q A;  2UXB Q;  2Q8R E;  2O2L D;  1XYI A;  3S14 H;  1AH9 A;  5IE8 A;  2QDB A;  1LAB A;  2L1B A;  2AMC B;  3CU7 A;  1S3O A;  3T1H L;  2RSN A;  1XTC D;  2A6E C;  2IX3 A;  2MQH A;  2UUC L;  3VYU A;  4N9T A;  3HOX B;  2ENB A;  1EIY B;  1E0B A;  1SNM A;  3MFG A;  3OOC A;  4HCS A;  3JAM L;  3HOX H;  3OWF A;  1DOM A;  1JJ2 A;  4IO9 A;  3I4N H;  4DR1 L;  3L2P A;  1KDC A;  3M4P A;  2CCZ A;  2ZXR A;  1A62 A;  1OXV A;  2F0O A;  1I94 L;  2DNC A;  2B2V A;  4IFD H;  3GTP H;  4IPH A;  1YNJ D;  2EJM A;  2NTS A;  3KF6 A;  4CKE A;  4DNI A;  4IOC A;  4XIG S;  4JI3 L;  3NE5 B;  4UAI A;  2F0V A;  4JYA Q;  2B8G A;  4RKL A;  3H3V C;  1PFM A;  2Z6K A;  3W5O A;  1QUQ B;  2RCF A;  1U4R A;  4LMQ D;  1TKW B;  5ELO A;  3OMC A;  2SEB D;  1XMQ Q;  4QL5 A;  4BY7 H;  4V19 0;  3HOZ B;  1JOQ A;  2PQE A;  4TKO B;  5C3W A;  2NWG A;  2ATW A;  4BY1 B;  1K83 H;  2KVM A;  1L2F A;  3U50 C;  3BDL A;  3MVV A;  1Q46 A;  2IW3 A;  2NTT A;  4TRD A;  4JBM A;  1FVI A;  4RGT A;  1MD2 D;  3HZX A;  2A74 C;  3GO5 A;  4HSP A;  4B3S L;  1EQR A;  1VQ8 A;  2FFK B;  3A0J A;  2LXK A;  1PZK D;  4XYO A;  1K0R A;  1XPU A;  3EQL C;  1BKB A;  3PCO B;  1W2B A;  2IJ0 A;  4FVM A;  2N8N A;  5IYB G;  1L0Y B;  5GAH C;  4B3T L;  1TWG H;  5I6Y A;  2OTL A;  4A3F G;  4LJZ C;  1GO3 E;  5C4J B;  3MWY W;  3EFX D;  3RN2 A;  1SJH D;  2KCC A;  3CHB D;  3PIP A;  4UY8 C;  1MBY A;  3E0J A;  1XMO L;  4JI0 L;  1WD0 A;  1EWH A;  1PTO H;  5COY A;  5M5Y H;  4QJF A;  3HOU H;  5M3F G;  4HN7 A;  2EYH A;  4L8J A;  2E5L L;  1KNE A;  3J80 E;  2JA8 B;  5E7N A;  1SYD A;  3BZD B;  3ULJ A;  3F8T A;  5C0X I;  1FNW A;  4FF3 A;  4OO1 I;  4ZYS A;  1LYL A;  4A3I G;  2AWO A;  2EYO A;  3MAQ A;  1X3F A;  3ULP A;  1E1T A;  1K73 C;  2A8V A;  2R7Z B;  2BA0 A;  1HA6 A;  3I55 A;  1X56 A;  2JA8 H;  3ITP A;  4UDU C;  4QB4 A;  4RKB A;  1Z7T A;  3JC6 6;  1SFO H;  1LLR D;  1XNR L;  1S40 A;  3GTK H;  5E3F A;  2L55 A;  4GLX A;  2RSO A;  4XXE A;  1N34 Q;  2Q2H A;  4PG3 A;  4C3J H;  5KYL A;  1G6Z A;  4JI8 Q;  3BVG A;  1M4V A;  2RHQ B;  5M3M B;  1HR0 L;  3H0G B;  4CHT B;  2F0G A;  1B70 B;  4A3D B;  3PO3 B;  3ND9 A;  2PW5 A;  4B08 A;  4U68 A;  3OW2 A;  4A3M H;  4JI3 Q;  2UUA L;  4F88 A;  2EPB A;  3D4W A;  3U4Z A;  2X69 A;  2I0Q A;  5KND A;  3L7Z C;  2Z4H A;  1DYQ A;  1C8C A;  3PMF A;  3K5L A;  1AW7 A;  1I4H A;  5I9P A;  1EY8 A;  4B9W A;  1VQB A;  4GN4 B;  3M4O H;  1VQD A;  2ZTD A;  1HUN A;  4L6T B;  2M9V A;  3UDG A;  3WDN A;  1PH6 A;  2NBF A;  3VA5 A;  2OEO A;  1O7Y A;  3ICE A;  2K75 A;  2ZJQ A;  1IKL A;  4DV0 Q;  1N33 Q;  2JXM B;  1T9H A;  5CR3 A;  3NBH B;  1II3 A;  3SXH A;  5IYB H;  3GTO B;  2B63 H;  1DM0 B;  3HOY B;  2CW0 C;  3OMG A;  4PMB A;  4A3K B;  4QUF A;  1B4O A;  5I2X A;  3S9W A;  4FF2 A;  3C1F A;  4Y7N H;  4MN3 A;  2Z9H A;  1UUP A;  1ZYR D;  3SR1 A;  1K8O A;  1PYB A;  4QF4 A;  5EKI A;  4NKL A;  2B2U A;  2F4V Q;  2GN5 A;  2D0O A;  2AWN A;  3HKZ B;  3T51 B;  2NVX H;  1QZG A;  2D0P A;  2FIN B;  5GRO A;  4A3M B;  2HT1 A;  3CCJ A;  1XNQ Q;  4XQN A;  3S15 B;  4X66 Q;  1X3G A;  1Y8O B;  4DR3 L;  3QR8 A;  2BH2 A;  1GUG A;  3OW7 A;  1WVL A;  2JA5 H;  2WII B;  1KXL A;  3GQB A;  3A54 A;  4JV5 Q;  4A3B B;  4RHR A;  4ID6 A;  1STE A;  2E2H B;  2KHI A;  4LWC A;  1DOK A;  4BBS G;  4CBV A;  4QIW E;  1ICW A;  4KKT A;  1WTP A;  4A3L G;  4QY7 A;  1NNX A;  1EUJ A;  3CAM A;  1R9T H;  5JVH 3;  4HTH A;  4JI5 Q;  4JK1 C;  3I7F A;  4RWS C;  3RLF A;  2VL6 A;  3SK5 A;  4DV3 Q;  2WB1 B;  5LMU Q;  4BBS H;  2A68 D;  4P2C B;  2JJQ A;  3S17 B;  1J5E L;  4A93 B;  3RZD H;  1KC8 C;  3I4M B;  3GTM B;  3J7Z C;  2RDG A;  5IWA Q;  1EQQ A;  1BUV T;  4DV6 L;  1MSG A;  2CH4 W;  4A3J G;  5HGQ A;  1XWE A;  3AQQ A;  2K04 A;  4X62 L;  1JOR A;  1V8Q A;  1SSO A;  1IXR A;  3RZD B;  3SGI A;  3CCR A;  4K5V A;  2A19 A;  1ROD A;  5ELB A;  4GN3 B;  1H9K A;  4YWL A;  2EJF C;  1ILP A;  1KNA A;  1H9R A;  1XNR Q;  1YI2 A;  4ZQ3 A;  1EFW A;  3C3L A;  1DD2 A;  3KLR A;  2X6G A;  4DR2 L;  4HJ8 A;  2R93 B;  2K50 A;  3DMU A;  2HCI A;  1EWC A;  3D0F A;  2IT1 A;  4A3G H;  2F4I A;  1VDZ A;  4DUZ Q;  2ES2 A;  1NAP A;  2NVT B;  1UE6 A;  3Q24 A;  4G7O C;  3FRP B;  3FPU B;  3CD6 A;  3R93 A;  4JBJ A;  5IT9 E;  4PZ7 A;  4EGV A;  2NVQ B;  3T53 B;  3H15 A;  3I4N G;  3H6M A;  2EYP A;  1PV4 A;  3TP7 A;  2J4X A;  2KCM A;  2Q2T A;  2R92 B;  3BG3 A;  3HEJ A;  1KD1 C;  1V1P A;  3VR3 A;  4DNT B;  1YIJ A;  3F2C A;  1XNQ L;  4DR6 L;  1K83 B;  3CCM A;  3J81 E;  2PMZ B;  3I4O A;  5FLX c;  3GTP B;  4J15 A;  1PHJ A;  5M5W B;  1NY4 A;  1CA5 A;  1VS0 A;  3IL8 A;  3S1Q B;  1I4X A;  1TWF H;  1U9R A;  2EYL A;  4LFA Q;  4IN3 A;  3MA2 B;  3Q0A A;  3CCV A;  1BR9 A;  4AYB B;  1VQO A;  5ELC A;  4NB3 A;  3HKZ G;  2MP1 A;  4IPG A;  3M4Q A;  4RCO A;  2UXB L;  4A3K H;  1QUQ A;  1CUK A;  2F0L A;  3HOU G;  4H02 A;  1CHQ D;  1TT2 A;  3I91 A;  1QB5 D;  2E5L Q;  1JQY D;  3GP7 A;  2YTY A;  2ZTE A;  2K32 A;  4ME3 A;  1S5B D;  3TRZ A;  3HG9 A;  2UU9 Q;  1KL9 A;  3VR5 A;  5C0X H;  5K5P A;  1YHQ A;  4WJ4 A;  4K8J A;  1I94 Q;  1W6J A;  4PZ8 A;  5EPL A;  3A56 A;  1HA5 A;  3TZD A;  1KDB A;  2ZJR A;  3M3Y B;  2DNE A;  4NXM Q;  2HIV A;  3P7J A;  3QWN A;  4JI4 L;  4KN4 C;  5EKK A;  5T1I A;  4AYB E;  3ERS X;  3TP5 A;  5FOB B;  4KHV A;  3I4L A;  3PUY A;  5M9O A;  1FR3 A;  2PZT A;  2EJG C;  1I6V C;  5LMU L;  1IBL Q;  1VQA A;  1GUS A;  4DV7 Q;  2F0U A;  4DN4 M;  4C2M H;  4LNQ A;  1Y1W H;  1QNU A;  5CV4 A;  1SE4 A;  4C3J B;  5HGT A;  3GD7 A;  3O13 A;  2AQ3 B;  2F0N A;  5C4X G;  1E3P A;  3IFT A;  4HMI A;  2XGT A;  5M3M H;  4UP7 A;  2BDN A;  2V4D A;  2YU9 H;  2K33 A;  1O78 A;  4UP8 A;  5T1G A;  5J3B A;  2BE5 D;  1CTM A;  1UEB A;  3SK8 A;  1OXU A;  1CZG A;  4JYA L;  3HP3 A;  1CA6 A;  1G2S A;  5FLM G;  2OWO A;  4A3D G;  1TWC H;  2OTJ A;  3H0G G;  1AZQ A;  2N88 A;  1HQM C;  4UP9 A;  5CMD A;  1XMQ L;  5IYD G;  4IJL A;  2KQ3 A;  2XRQ D;  3KF8 A;  1O7I A;  3BJU A;  1Y8N B;  3GV6 A;  2Y0S E;  1SYG A;  4PZ6 A;  1QVG A;  4IZ8 A;  4DR5 Q;  3NSW A;  3DXJ C;  1X3E A;  1KAB A;  4TSS A;  1N32 Q;  3HRZ C;  2R6G A;  1LTL A;  5C44 B;  2MFI A;  1F2Z A;  5C44 H;  4KHP L;  1YNX A;  5C0X J;  4IOA A;  2VUM H;  2AKW B;  1E22 A;  5LL6 S;  4OGQ C;  1AFP A;  1JJG A;  1SDF A;  3NUC A;  1WCM G;  4BY7 B;  2JSO A;  4AIM A;  1ENF A;  4OX9 Q;  2WB1 E;  4DA2 A;  1LV9 A;  2K5N A;  1CKN B;  1HXY D;  3BZK A;  4KD4 A;  2G9H D;  2J0T D;  1B9M A;  2VY3 A;  4KJN A;  1STN A;  3H91 A;  3M4Y A;  4YY3 L;  4GLV B;  3JAM c;  1LM0 A;  4A3E H;  5AJ3 L;  3GTG B;  3RZO B;  4C3H B;  4GKJ L;  4DAM A;  1D5M C;  3J81 L;  1YJN A;  4I7A A;  3GV3 A;  2VUM G;  4MTN A;  2E2J H;  2L9H A;  4X3T A;  1AEX A;  1N8R C;  2SDF A;  2Y0S G;  2H4O A;  2JN4 A;  2SNS A;  4G7Z C;  2EE1 A;  2VB3 X;  1HR0 Q;  2ZM6 L;  1ZEQ X;  1J5E Q;  1Z9F A;  1SYC A;  1TS3 A;  5GAG C;  4IFD G;  4HJA A;  1PVO A;  4ZLT F;  4EQ5 A;  3DWA A;  3L0O A;  3RMH A;  3NTH A;  1XX8 A;  1SE3 A;  4M1U B;  1EYC A;  4HSV A;  2MO1 A;  4F8M A;  1U0L A;  3UE0 A;  1XPR A;  1GHK A;  2IX1 A;  2AQ1 B;  3I56 A;  1SJE D;  3Q6S A;  4IQZ A;  1LTI D;  3FKI G;  2KED A;  2A73 B;  1W3S A;  1LTA D;  4F87 A;  3A7L A;  4A3L H;  4KJO A;  4BY1 H;  1D7Q A;  3KBX A;  2WP8 J;  2BH8 A;  2FMM A;  4HJ9 A;  1OTC A;  2TSS A;  4RA8 A;  4A3E B;  2RDH A;  3QB3 A;  3NPP A;  3NWS A;  1X55 A;  2PNH A;  3PIP 3;  3CCU A;  1RTO A;  1BOS A;  4JI1 Q;  3H3V H;  1YHB A;  4DNR B;  2RHS B;  3W2D A;  2N78 A;  4POF A;  1SND A;  1C9O A;  2C35 B;  1H9S A;  3S24 A;  2KEE A;  4BXX H;  2MPM A;  1ENC A;  2QEJ C;  3RN5 A;  4JI6 Q;  4A3G B;  4V0B A;  3K7A H;  3NQT A;  3K0Y A;  4KHZ A;  2EY6 A;  3CRL C;  2QKI C;  1A8V A;  3F1Z A;  3CPW A;  1AP0 A;  2B2U C;  3J80 i;  2JP1 A;  4K0K Q;  1HZA A;  3D3R A;  5CYU A;  2PW7 A;  3K59 A;  1LTB D;  5C4H A;  3ER0 A;  3SEB A;  5A2Q E;  1T5X D;  5I9O A;  2ZT9 C;  4CJ0 B;  3V05 A;  3A8K E;  1PH2 A;  2XNA C;  3CC2 A;  5FK9 C;  1EL0 A;  4L5Q A;  5FO9 B;  3K80 C;  1PYW D;  4KHP Q;  1Q12 A;  5JVG 3;  2A6E D;  1DCZ A;  1HNW Q;  2LY7 A;  2EXZ A;  4JPB W;  2KJX A;  3GTJ H;  5LHY 1;  3MXG A;  3NEN A;  4ZRZ A;  4JI7 L;  1TWC B;  2NN6 I;  5HUR A;  4JV5 L;  4JOI C;  3D6W A;  4LUV A;  3M85 A;  4K5W A;  2NVQ H;  2UU9 L;  5BR8 Q;  3CQZ H;  4QIW B;  4JBK A;  4CKB A;  1D2B A;  4P74 A;  1C48 A;  2HUG A;  4RHS A;  5M3F H;  1TY0 A;  2JEB I;  4KI0 A;  1BCP C;  1IL2 A;  1VQ6 A;  2B2T C;  3VR6 A;  4YY3 Q;  3K5M A;  4AQY Q;  2FMC A;  1SBB B;  5KIX A;  1C7Y A;  4Y52 H;  2XWB B;  3FVQ A;  2O5I C;  2OQK A;  4LK1 C;  1FL0 A;  1H9S B;  3K0X A;  3CCE A;  2DN8 A;  4YIJ A;  2N49 A;  1U4L A;  2MGS A;  3M7G A;  1KDA A;  3E9H A;  1G51 A;  2EVB A;  4KLK A;  1PRT C;  1HQR D;  3S2H H;  5FO7 B;  1HNW L;  4KV6 A;  4BS9 A;  1ET6 A;  5M5Y B;  3I70 A;  1PLF A;  2B2W C;  1TXY A;  2F1M A;  2OQ0 A;  4I65 A;  1A3U A;  3KF6 B;  1STA A;  2B8F A;  4BBR G;  2WKD A;  2NYZ D;  4NXN Q;  2EY2 A;  4K6L A;  1P8L A;  2JA7 G;  4DR6 Q;  1SN8 A;  3OIQ A;  1SE8 A;  3NTK A;  4XQJ A;  4KN7 C;  1F9S A;  4CKC A;  1I5F A;  3D8G A;  2WAQ E;  5FLX L;  1GUW A;  4BBR B;  2O4X A;  1F9P A;  5JEA G;  4KKU A;  4IAL A;  3TEH B;  4X3K A;  2B2W A;  2NB0 A;  1BVS A;  4DK1 A;  1FGB D;  4R9W A;  3FHW A;  1PMR A;  1O7L A;  3DM1 A;  5E1F A;  3S1Q H;  2Z6K C;  4N8X 1;  4R4Q A;  4XDX A;  4EQN A;  4CDC C;  1CHP D;  3KF8 B;  5DAU A;  1A15 A;  3HFZ B;  2Z4I A;  4LF7 L;  1F2Y A;  1F2L A;  2JQO A;  5BN3 A;  1STH A;  2D2C C;  4B3M Q;  2NVX B;  1SYE A;  2X6L A;  4WRD A;  1Y1V H;  3BYY B;  3AEV A;  3D6C A;  1D5X C;  1U4M A;  4DV6 Q;  4DV7 L;  5CBE E;  3V96 A;  2F3W A;  1CI3 M;  2N3S A;  5EBC A;  1NMF A;  1BF4 A;  1CQF A;  1SMX A;  1ZYR C;  5EKL A;  4P72 A;  5JOB A;  4CJ1 B;  1S4Z A;  2AHO B;  4DR4 L;  2I46 A;  1DON A;  4ZKB B;  3DLL A;  1EIF A;  4EX5 A;  3J81 j;  3KOJ A;  4ZAI A;  1TQO A;  1BBW A;  2DJG C;  5JPN C;  3OPO A;  1Y1W G;  1CZW A;  3DUZ A;  1R4P B;  5IOD A;  4WOR A;  1UE1 A;  3AMU A;  1F9Q A;  1V1O A;  2XRS D;  1I4G A;  1YHA A;  5JJL A;  2HCC A;  4JVZ A;  3UDF A;  1CKM A;  2K1B A;  3FEW X;  3STB C;  1TWH H;  2NN6 G;  3T56 B;  2UUB Q;  1QZH A;  1GUN A;  4FDB A;  1RHP A;  3UDX A;  1IZ6 A;  1JWS D;  1WTV A;  1BNZ A;  4A3B G;  1DGS A;  1HFN A;  3ERO A;  2PQA B;  4O42 A;  1I4R A;  2PNR C;  4OWX B;  4B3S Q;  4LF4 L;  4OO1 H;  2FJ2 A;  3H0G H;  3NEL A;  2UUA Q;  3I2Z A;  3NEM A;  4A3C G;  4GNX A;  2PYK A;  5C3X A;  5EAY A;  2Z1C A;  3MXU A;  1V43 A;  2L4N A;  1Y14 B;  1AE3 A;  2F3V A;  4LF5 L;  1YJW A;  4C56 C;  3N6R A;  2K5W A;  2JA6 G;  5IGD A;  5GAD C;  4ALP A;  4AQY L;  3PO3 H;  2IWH A;  2TMP A;  2K14 A;  2MHV A;  2Q8I B;  4LF5 Q;  4A3I H;  5GQO A;  2OF1 A;  5C3E B;  4A3K G;  1PH5 A;  5DEH A;  3S1R B;  4A3B H;  2RDF A;  3FKI B;  4BA1 I;  4GOP C;  4DV3 L;  1Q1B A;  3BZC A;  2LKV A;  2R7Z H;  1GVP A;  2KHS A;  3J7A F;  1NMG A;  4J1M A;  3HOW B;  3I73 A;  3FPP A;  1PH9 A;  3MEH A;  3MEF A;  1SFO B;  3PUZ A;  4DR1 Q;  1HUM A;  5HY6 A;  4A93 G;  5IOC A;  2K03 A;  2VZA A;  3KUP A;  1GD7 A;  3TZU A;  1VQP A;  3GTJ B;  4FF1 A;  4FNF A;  1TWG B;  1KTK A;  3PSI A;  4NXN L;  4JC0 A;  3W1G A;  1VQL A;  1EU4 A;  2G5D A;  1WTH A;  3PO2 G;  1LO5 D;  1H9M A;  2K5D A;  5DM6 3;  5C5M A;  3CP0 A;  1M1K C;  1EY9 A;  1E7Z A;  1PFB A;  3NQI A;  1ML0 D;  4J6H A;  3TQY A;  2VQE L;  5I2Y A;  2R3Z A;  2Y0S B;  2CWA A;  2E2I H;  3DWP A;  1VQG A;  3IRB A;  4BY1 G;  1DXM A;  4DUY L;  1ENA A;  4FXG C;  1KRS A;  2ZJP A;  5CGK A;  4WFN 3;  4C3I H;  4K14 A;  2XIW A;  4RGO S;  2Q2U A;  3J7A V;  4RMF A;  4IFD I;  1BXT A;  2C5C A;  1CFM A;  1PH3 A;  1SMY D;  2YYZ A;  3D31 A;  4PNY A;  1PRT F;  4TQU S;  1Y1V G;  1A63 A;  5IIF A;  2HDL A;  4JW0 A;  2WAQ B;  1XTD A;  1J6Q A;  3U58 A;  4HR7 B;  1YIT A;  4LF4 Q;  3OSO A;  2YV5 A;  3N52 A;  4Z9C B;  5ELE A;  2D62 A;  3T4A C;  1SNQ A;  1V1P B;  3HOZ H;  5E4X A;  1SEB D;  1YBY A;  5I4D A;  1SNO A;  1NR2 A;  1PH1 A;  1EQT A;  2F0J A;  1KLG D;  3RUZ A;  3ND8 A;  3S1M B;  4LAA A;  3QIA A;  4C1N K;  1PRT D;  4ILW A;  5IT9 c;  4OL7 A;  4ZCK A;  4DGZ A;  3HOX G;  3NHH A;  2F0I A;  4JI8 L;  3ONA B;  5ELN A;  4B9X A;  3VDY A;  3MXN A;  3F2U A;  1N33 L;  3NXW A;  5BR8 L;  1CSP A;  4RFB A;  1QOH A;  3K6O A;  5IP9 G;  3OWE B;  1GHJ A;  4YCV A;  1L1O C;  5IYC H;  4MNO A;  2PZW A;  3C2P A;  2WAQ G;  1BBX C;  2EZV A;  4DV2 Q;  1TS2 A;  1YVC A;  1LTT D;  1Y1V B;  4X64 Q;  2A6H C;  1E2W A;  4YCU A;  1JIC A;  1Q1E A;  2WIN B;  2YTV A;  3S2D H;  2HDM A;  4DUY Q;  2OCE A;  3KDF B;  3WOF A;  2L11 A;  4HJ7 A;  3G6J B;  1JT8 A;  4X62 Q;  2QF7 A;  3T16 A;  5M3M G;  1K28 A;  4R4O A;  2IHE A;  1IHZ A;  4C3H G;  5EPK A;  4PMW A;  3Q22 A;  3PO2 B;  3AYH B;  1VQ4 A;  3LX0 A;  2QGQ A;  1HR0 W;  4R1J A;  1VQC A;  2F0W A;  2HHH Q;  1G91 A;  2EXD A;  4KTA A;  5KRU A;  2DJF C;  1IW7 D;  2VQE Q;  1EEF D;  2EIF A;  3DM3 A;  5ELD A;  4OEM B;  2KUM A;  3R2I A;  4YHH Q;  4KY5 A;  5KEE A;  5DLQ E;  4PV1 C;  1JB3 A;  1XMO Q;  4JI0 Q;  3HOV B;  2WFW A;  3FDT A;  3J7Y W;  4AH6 A;  4S3S A;  2K5V A;  2MO0 A;  4LF9 Q;  4GOP B;  1WTQ A;  1FD7 D;  1IW7 C;  4ZKC B;  1N32 L;  3E5S A;  3PGZ A;  1QIL A;  5JJZ A;  4DAV A;  1B53 A;  3RZO H;  1YJ9 A;  1KAW A;  2SNM A;  1JJC B;  2IPK D;  1N36 L;  1EZ6 A;  1C0A A;  3KBG A;  5D65 A;  1KAA A;  4N8F A;  3BDO A;  1HZB A;  1QVC A;  1VQ7 A;  1MSH A;  5CC4 A;  1NTG A;  1FNU A;  3B6Y A;  1B8A A;  2YU9 B;  5J1Z A;  1X54 A;  2MUY A;  2B2T A;  1IBM Q;  4JCV E;  4B3R L;  4NMZ A;  3RNU A;  4GKK Q;  1LTG D;  1IYU A;  4DAY A;  4EQP A;  5JJI A;  4LFB Q;  4IUV A;  2ALY B;  3T13 A;  2H1E A;  1O80 A;  2R92 G;  3HOV H;  4IFD J;  2O5J C;  4A3C H;  3IAY A;  4R8I A;  2F0S A;  3GDE A;  4XYQ A;  1R9T B;  1IBK Q;  4QQB X;  1MIU A;  5TSS A;  4DPG A;  1JMC A;  4H7B A;  3S2D B;  2HIX A;  2K4K A;  1Y1W B;  2RKS A;  4G57 A;  1RTN A;  4Q0F A;  4EQO A;  1ESF A;  1HTL D;  3WOE A;  1PFN A;  3QOL A;  3IFD A;  2NZH A;  5E4W C;  2K6A A;  1V9P A;  1PTO F;  1VQF A;  4BXX G;  1WCM B;  2BA1 A;  4UPA A;  1RDP D;  2I5H A;  4PQX A;  4ZUJ A;  1EIH A;  4DV2 L;  3HOW G;  1TS5 A;  3MXN B;  2LFN A;  2XSC A;  1LTS D;  1V1Q A;  3HOY H;  2F0H A;  4DR2 Q;  3GTO H;  1B9N A;  1NE3 A;  1HFG A;  4GLA C;  1PZJ D;  2WKC A;  1SNC A;  3BS1 A;  5EBD A;  2NZO A;  1Z47 A;  2L5T A;  2KCN A;  2K52 A;  3PIO 3;  3G6E A;  2E8G A;  3NBI A;  5KNC A;  4MZ9 A;  1K8G A;  2Z0S A;  5D14 A;  1ILQ A;  2F0T A;  3K8A A;  2KCT A;  3CRK C;  4A75 A;  1ESR A;  2F4V L;  3LWU A;  5KGU A;  2M2L A;  1E1O A;  2VS1 A;  4OON A;  1K8A C;  4HAE A;  4QMG A;  1TS4 A;  2B2V C;  2L0C A;  2JEA I;  3GTQ B;  3S16 B;  3J81 i;  1EY4 A;  4C3H H;  5CV6 A;  1HNX L;  4IUT A;  4LFB L;  1ZXT A;  2FXQ A;  3F2B A;  3M3Y H;  2VB2 X;  1D5Z C;  2B63 G;  2BCO A;  5FLM H;  4A3D H;  1MGS A;  4DV4 L;  4APV A;  3G7L A;  1AZP A;  3X3N A;  2B3G A;  3URY A;  4LFA L;  3H3V I;  2CQA A;  2CKZ B;  2UUC Q;  1RIP A;  5C4X B;  5FLX E;  4C1N I;  4ZK9 B;  4JI1 L;  1LT3 D;  1Y69 U;  4JI4 Q;  4LF9 L;  4O1N A;  1N36 Q;  2WB1 G;  3G71 A;  3CW2 C;  2JK8 A;  4ODG A;  3QJY A;  5EGT A;  2GVA A;  5JEA H;  4BBR H;  3P1H A;  1VQM A;  4C3I B;  4JI6 L;  1TU2 B;  2ID0 A;  2Z6B A;  3UE1 A;  4A3F H;  4XT1 B;  2JA7 H;  3J7A 5;  1RCV D;  4WJW A;  1IBK L;  1PZI D;  1YEZ A;  1TWF B;  3HGB A;  5BN4 A;  1W6K A;  1UE5 A;  2ICI A;  3SVM A;  4OEL B;  4KKS A;  1UAP A;  1A6X A;  2F03 A;  2WV6 D;  1STY A;  4QGU A;  1IKM A;  4K0K L;  1EYG A;  3BVM A;  3W3A A;  1PXU A;  4HIM A;  2IL8 A;  1LAC A;  4GKJ Q;  3RR5 A;  1WYD A;  2SOB A;  4IJH A;  1I6H H;  4ABN A;  3R2T A;  1I6H B;  4U67 3;  3S17 H;  1QWY A;  1CM9 A;  2EQS A;  2PI2 A;  4HMJ A;  1G6P A;  1EQV A;  4A3I B;  3CF5 A;  4IUU A;  4XTC S;  3HOY G;  1WI5 A;  4RGM A;  1GUO A;  3S2H B;  2G9D A;  1E24 A;  4IUN A;  4LFC L;  4M8A A;  3KJP A;  5M3F B;  4PMC A;  5EQ0 A;  2IX0 A;  1JR0 D;  1KIX A;  2J7Z A;  1HPC A;  4DK0 A;  3VYS A;  2JA6 B;  4L63 B;  2BDO A;  3NWT A;  4HED A;  1EU3 A;  4K2L A;  4N9P A;  4MHE A;  3FKI H;  1A3V A;  3J81 c;  1B50 A;  4L5R C;  3A74 A;  1VQH A;  2H5X A;  4BBS B;  2MNA A;  5D3I B;  1HNZ L;  5JAV A;  2OXP A;  4GOP A;  2EYM A;  3I90 A;  1ICF B;  1EOV A;  2UXD L;  4OWW B;  3TBI B;  2VXW A;  2QA4 A;  5F2D A;  1SXT A;  2Q8T A;  5C6A A;  1QG7 A;  2DY8 A;  5LMN W;  2AQ2 B;  3KLW A;  5DNF A;  1B44 D;  2PCF B;  3LNN A;  5A2Q L;  1PH8 A;  1VMP A;  2NVY B;  4DR5 L;  3EIV A;  4B3M L;  4A3G G;  1SRU A;  1Z6H A;  5I6W A;  3PF5 A;  2L15 A;  4RAU C;  2OT2 A;  1E2V A;  3NK9 A;  1VMC A;  2EYJ A;  5DM7 3;  3T1H Q;  1VQE A;  4E6I A;  1I50 H;  4RCN A;  2DGY A;  3TSS A;  5FJ8 G;  2KBN A;  4DV1 L;  1L0W A;  4DR7 L;  2CH4 A;  3CCS A;  4B3T Q;  3VR2 A;  1CT1 D;  5CV5 A;  4HIO A;  3P75 A;  2JA8 G;  2CWP A;  3U9O A;  3SE0 A;  4A76 A;  5M5X H;  1Q86 C;  1OXT A;  3S14 B;  3MFY A;  1HHV A;  5LL6 X;  3CCL A;  2PO4 A;  4K8I A;  1LUZ A;  2HQE A;  5ISR A;  2A69 C;  1D6E C;  1EWI A;  4NDX A;  1I50 B;  5CV7 A;  3D4R A;  3EN2 A;  3HKZ E;  1NSN S;  4R8N A;  3P20 A;  1I3Q B;  4P75 A;  3Q8D A;  1Q81 C;  1B3A A;  5CBA E;  3ERQ A;  3OYY A;  4A4I A;  1HNZ Q;  4JI2 Q;  4GN5 A;  5JJK A;  1AN8 A;  4IUQ A;  4POG A;  4R4I A;  2GA4 B;  4BWG B;  1JB7 A;  2NN6 H;  1HCZ A;  3AFP A;  1IL8 A;  4G7H C;  1UEA B;  2K05 A;  1VQI A;  3ZJY C;  4FO2 A;  4Y7N B;  2KA7 A;  2K7V A;  1U4P A;  2AUJ D;  3HKS A;  5JPM C;  1BCP F;  1B1Z A;  4BA2 I;  3RLN A;  1WOC A;  3BYT B;  3OIP A;  4DF7 A;  1G29 1;  2HHH L;  2E75 C;  2EOT A;  2HQL A;  3KYH C;  2ZXP A;  4DU9 A;  2ICE C;  1LTR D;  1YZ6 A;  2R7F A;  1BBU A;  1K8M A;  2EYF A;  1NR4 A;  2VQF Q;  1BDO A;  3QG1 A;  1UE7 A;  1JE4 A;  1CK1 A;  2AUK A;  2A69 D;  2F0F A;  1JE5 A;  4JOI A;  5IGG A;  2QIL A;  4YWM A;  3EVQ A; 
#chains in the Genus database with same CATH homology
 4X64 L;  1QVG A;  4DR5 Q;  2D62 A;  3S14 H;  1X6O A;  1AH9 A;  5IE8 A;  3HOZ H;  1X3E A;  1YBY A;  1AE2 A;  1PH1 A;  1SRO A;  2AMC B;  1N32 Q;  1S3O A;  3T1H L;  2R6G A;  4BY7 G;  2UUC L;  2MQH A;  4L5T A;  5IT9 c;  2IY5 B;  5C44 G;  1LTL A;  3HOX G;  4LF8 Q;  2MFI A;  1EIY B;  5C44 H;  3HOX H;  3HOW H;  4KHP L;  1YNX A;  5C0X J;  1JJ2 A;  4JI2 L;  2VUM H;  4IOA A;  2AKW B;  1E22 A;  4IO9 A;  4JI8 L;  5ELN A;  4DR1 L;  4YHH L;  3T1Y L;  3I4N H;  3L2P A;  1JJG A;  3M4P A;  4X66 L;  3VDY A;  2CCZ A;  3G4S A;  3S1R H;  1A62 A;  1OXV A;  1I94 L;  1N33 L;  1L1O B;  3S1N H;  5BR8 L;  1CSP A;  3GTP H;  4IPH A;  5IP9 G;  1PA6 A;  2R7D A;  3KF6 A;  4DNI A;  4IOC A;  1WCM G;  3JAM i;  4YCV A;  1L1O C;  5IYC H;  1CSQ A;  4MNO A;  4XIG S;  4JG2 A;  4AIM A;  4JI3 L;  1MJE A;  2WAQ G;  4OX9 Q;  4DV2 Q;  2WB1 E;  4JYA Q;  2QEX A;  1YVC A;  4X64 Q;  2K5N A;  1CKN B;  2Z6K A;  3BZK A;  3HOZ G;  3W5O A;  1QUQ B;  1QVF A;  1HJP A;  4YCU A;  1Q1E A;  2KHJ A;  2VY3 A;  2YTV A;  5ELO A;  4YY3 L;  3JAM c;  3S2D H;  4GLV B;  2OCE A;  4DUY Q;  1LM0 A;  3KDF B;  1XMQ Q;  4A3E H;  3M9B A;  4QL5 A;  4HJ7 A;  5AJ3 L;  3PO3 G;  4BY7 H;  2UXC L;  1JT8 A;  4X62 Q;  4LF7 Q;  5M3M G;  4GKJ L;  4R4O A;  4DAM A;  1YJN A;  1HZC A;  3S16 H;  2IHE A;  2ATW A;  2VUM G;  1U5K A;  4MTN A;  1K83 H;  3K7U C;  1L2F A;  4PMW A;  2E2J H;  3U50 C;  2UXB Q;  4GNX B;  2CFM A;  1N8R C;  2Y0S G;  3AYH B;  1VQ4 A;  1Q46 A;  2QGQ A;  1HR0 W;  1HR0 Q;  4R1J A;  2ZM6 L;  1VQC A;  4O0A A;  2HHH Q;  4RG1 A;  2PQA A;  1Z9F A;  1J5E Q;  4JBM A;  1FVI A;  5IP9 H;  2EXD A;  5GAG C;  2VW9 A;  4IFD G;  4HJA A;  3GO5 A;  1RL2 A;  1FJG Q;  4B3S L;  4EQ5 A;  1PVO A;  3L0O A;  1EQR A;  5K36 G;  1VQ8 A;  2IHF A;  3A0J A;  2LXK A;  2VQE Q;  3S1M H;  1XPU A;  1K0R A;  2EIF A;  1BKB A;  2MO1 A;  3DM3 A;  3PCO B;  1XPR A;  1U0L A;  3UE0 A;  1W2B A;  3STB D;  2N8N A;  5IYB G;  2IX1 A;  4YHH Q;  3LGJ A;  5GAH C;  3I56 A;  4B3T L;  1TWG H;  2OTL A;  5DLQ E;  4A3F G;  2JA9 A;  1GO3 E;  2F3I A;  1XMO Q;  4JI0 Q;  2WFW A;  4DV1 Q;  1H95 A;  4AH6 A;  3FKI G;  3RN2 A;  2V1C C;  4HIK A;  2K5V A;  2MO0 A;  1W3S A;  4LF9 Q;  4GOP B;  2PI2 E;  1PH7 A;  3PIP A;  4UY8 C;  1XMO L;  4JI0 L;  4A3L H;  1ASZ A;  1N32 L;  5M5W H;  3WWV A;  4BY1 H;  3PGZ A;  3CMA A;  1D7Q A;  2WP8 J;  2BH8 A;  4WJ3 M;  5M5Y H;  1WCM H;  4QJF A;  4HJ9 A;  5M3F G;  1OTC A;  3GTG H;  3HOU H;  3RZO H;  2E5L L;  1YJ9 A;  1KAW A;  3FP9 A;  1JJC B;  5E7N A;  3ULJ A;  2LSS A;  1X55 A;  2PNH A;  5C3E G;  3F8T A;  5C0X I;  1N36 L;  4OO1 I;  3CCU A;  4O2D A;  1LYL A;  3A5Z B;  4A3I G;  2R92 H;  4X65 L;  4R4T A;  3HOV G;  1C0A A;  2AWO A;  4JI1 Q;  1X3F A;  3H3V H;  1YHB A;  1E1T A;  1HZB A;  2RHS B;  3ULP A;  1K73 C;  2A8V A;  2BA0 A;  2N78 A;  1QVC A;  3I55 A;  1X56 A;  2ASB A;  4POF A;  4OWT B;  1VQ7 A;  2JA8 H;  2UXD Q;  1C9O A;  2C35 B;  3JC6 6;  4R4C A;  3S24 A;  2I5M X;  1SFO H;  1NTG A;  3B6Y A;  2RCN A;  1XNR L;  1B8A A;  3KJO A;  4DUZ L;  1S40 A;  3GTK H;  4BXX H;  1X54 A;  4DV4 Q;  1IBM Q;  4JCV E;  4DAY B;  4B3R L;  4GLX A;  3RN5 A;  1VCI A;  4IPC A;  3RNU A;  4GKK Q;  4JI6 Q;  1N34 Q;  3K7A H;  2UXC Q;  5JJI A;  4LFB Q;  3A5U A;  4KHZ A;  2ALY B;  2Q2H A;  4PG3 A;  4C3J H;  1NBW A;  3TS0 A;  1A8V A;  3F1Z A;  4JI8 Q;  3CPW A;  2R92 G;  3HOV H;  2KEN A;  4IFD J;  2R93 H;  4LUO A;  2RHQ B;  4A3C H;  3KDF A;  1HR0 L;  1B7Y B;  3GDE A;  3J80 i;  4LF6 Q;  4K0K Q;  1B70 B;  1HZA A;  1IBK Q;  4QQB X;  1MIU A;  4DPG A;  1JMC A;  1CKN A;  5IYD H;  3OW2 A;  4A3M H;  4JI3 Q;  3ER0 A;  2HIX A;  1WJJ A;  2K4K A;  3EBE A;  2UUA L;  1PH2 A;  3CC2 A;  3U4Z A;  2I0Q A;  3K81 C;  3L7Z C;  1CKO A;  2NZH A;  2JA5 G;  4L5Q A;  1HH2 P;  1V9P A;  3K80 C;  2Q2I A;  4KHP Q;  1Q12 A;  4OO1 G;  1OXS C;  1VQF A;  4BXX G;  2BA1 A;  1HNW Q;  4DK3 C;  3T1Y Q;  4UPA A;  1VQB A;  2I5H A;  3PUV A;  1VQD A;  4GN4 B;  3M4O H;  2ZTD A;  4DV2 L;  3HOW G;  3GTJ H;  3MXN B;  3E0E A;  1HNX Q;  3NEN A;  4JI7 L;  2NN6 I;  3UDG A;  4JV5 L;  4JOI C;  1PH6 A;  1V1Q A;  4LUV A;  3HOY H;  3I4M H;  4DR2 Q;  3GTO H;  3M85 A;  1NE3 A;  1Q82 C;  2NVQ H;  4GLA C;  3ICE A;  2K75 A;  4IPD A;  2UU9 L;  2ZJQ A;  5BR8 Q;  3CQZ H;  4DV0 Q;  5LMN Q;  1K9M C;  1T9H A;  1N33 Q;  4JBK A;  3NBH B;  2CQO A;  3CME A;  1HZ9 A;  4LW1 A;  4P74 A;  2NZO A;  1Z47 A;  5M3F H;  3PUX A;  3G6E A;  2K52 A;  2E8G A;  5IYB H;  2B63 H;  4MZ9 A;  2JEB I;  1K8G A;  4KI0 A;  1IL2 A;  4L5S A;  1VQ6 A;  2Z0S A;  4YY3 Q;  4AQY Q;  1MJC A;  1NJI C;  1XPO A;  3RLO A;  3CCQ A;  3PIO A;  1C7Y A;  3K8A A;  2KCT A;  4Y52 H;  4Y7N H;  5H1S E;  4A75 A;  5LMN L;  2F4V L;  1E1O A;  2VS1 A;  1IBL L;  2OQK A;  4OON A;  1K8A C;  1FL0 A;  2JEA I;  1PYB A;  3K0X A;  3CCE A;  1Q7Y C;  3J81 i;  2F4V Q;  2N49 A;  2JA6 H;  2GN5 A;  2D0O A;  4C3H H;  2AWN A;  2NVX H;  3E9H A;  1HNX L;  1G51 A;  4LFB L;  1QZG A;  2D0P A;  2FXQ A;  4AYB G;  3F2B A;  4KLK A;  3M3Y H;  5GRO A;  2HT1 A;  3S2H H;  1HNW L;  2B63 G;  4GKK L;  1Q8K A;  3CCJ A;  1XNQ Q;  1KHI A;  5FLM H;  4A3D H;  4X66 Q;  4DV4 L;  4APV A;  1X3G A;  3M7N A;  3U4V A;  4DR3 L;  2B3G A;  2BH2 A;  4LFA L;  3H3V I;  1TXY A;  2OQ0 A;  4GNX C;  2JA5 H;  1KXL A;  3KF6 B;  2CKZ B;  2UUC Q;  1RIP A;  4BBR G;  4JV5 Q;  4NXN Q;  4JI1 L;  1P8L A;  4JI4 Q;  4LF9 L;  5C4J H;  2JA7 G;  2KHI A;  2WB1 G;  4LWC A;  1SR3 A;  1SN8 A;  3G71 A;  1N36 Q;  1SE8 A;  3CW2 C;  4P73 A;  4BBS G;  4DR6 Q;  2JK8 A;  4QIW E;  1I5F A;  2WAQ E;  2GVA A;  3E9I A;  4A93 H;  5JEA J;  4A3L G;  4QY7 A;  4BBR H;  5JEA G;  3CAM A;  1EUJ A;  1R9T H;  3TEH B;  1VQM A;  1A0I A;  4JI5 Q;  4JI6 L;  3I7F A;  2XTI A;  3RLF A;  1BVS A;  2ID0 A;  2VL6 A;  4YWK A;  3UE1 A;  4A3F H;  1VQN A;  4DV3 Q;  2E2H H;  2JA7 H;  3J7A 5;  5LMU Q;  4BBS H;  3FHW A;  4GS3 A;  1IBK L;  3S1Q H;  2JJQ A;  1YEZ A;  1IYJ B;  1J5E L;  3RZD H;  1UE5 A;  2I5L X;  1KC8 C;  1ASY A;  3J7Z C;  2Z6K C;  5IWA Q;  4QGU A;  2JE6 I;  1EQQ A;  4R4Q A;  4K0K L;  1EYG A;  3CC4 A;  4DV6 L;  3CXC A;  3KF8 B;  4HIM A;  2R93 G;  4A3J G;  5HGQ A;  3AQQ A;  3UDI A;  3HFZ B;  3RR5 A;  1WYD A;  4GKJ Q;  4IJH A;  4X62 L;  4LF7 L;  3S15 H;  1I6H H;  1IXR A;  2LXJ A;  4DR4 Q;  3SGI A;  2JQO A;  3S17 H;  2NVY H;  2R7Z G;  3CCR A;  1IBM L;  2EQS A;  2A19 A;  4A3M G;  2PI2 A;  1G6P A;  2B29 A;  4B3M Q;  4GN3 B;  1VQJ A;  5IY0 A;  4YWL A;  1Y1V H;  3CF5 A;  3AEV A;  4XTC S;  3HOY G;  4DV6 Q;  1WI5 A;  1MKH A;  3PV0 A;  1GKH A;  4DKA C;  4DV7 L;  5FJ8 H;  1XNR Q;  2N3S A;  4DR7 Q;  5IYC G;  1E24 A;  4OX9 L;  4LFC L;  1YI2 A;  1EFW A;  1XJV A;  3KJP A;  1NMF A;  2IX0 A;  1KIX A;  4DR2 L;  1SMX A;  1I3Q H;  4HJ8 A;  4DV5 Q;  2NVT H;  2VNU D;  2GVB A;  4A3J H;  4P72 A;  2K50 A;  1PH4 A;  2AHO B;  4DR4 L;  3D0F A;  3FKI H;  3J81 c;  3DLL A;  1EIF A;  3I4M G;  2UUB L;  4NXM L;  1PYS B;  4L5R C;  4YCW A;  3A74 A;  2IT1 A;  4EX5 A;  4A3G H;  1L1O A;  3J81 j;  1VQH A;  2H5X A;  3KOJ A;  4P71 A;  2MNA A;  1UWV A;  2PMZ E;  1HNZ L;  4DUZ Q;  2ES2 A;  4GOP A;  5IWA L;  1BBW A;  1UE6 A;  3W1B A;  1Y1W G;  1EOV A;  3CD6 A;  2UXD L;  4OWW B;  4X6A H;  4DV5 L;  4JBJ A;  2QA4 A;  1UE1 A;  4PZ7 A;  1VQK A;  3H15 A;  3ULL A;  3I4N G;  2YTX A;  3OTO Q;  1PV4 A;  1YHA A;  3TRE A;  5JJL A;  5LMN W;  1SLJ A;  3KLW A;  3UDF A;  2KCM A;  1CKM A;  2Q2T A;  3KFU A;  3STB C;  1PH8 A;  1TWH H;  2NN6 G;  1KD1 C;  2UUB Q;  1QZH A;  5GAE C;  1PFS A;  4FDB A;  3EIV A;  4DR5 L;  3UDX A;  1IZ6 A;  4B3M L;  4A3B G;  2RF4 A;  4A3G G;  1DGS A;  1YIJ A;  2PQA B;  4OWX B;  1SRU A;  3AFQ A;  3F2C A;  1VQ5 A;  4B3S Q;  4LF4 L;  1FJG L;  3PF5 A;  1XNQ L;  4DR6 L;  3H0G H;  2L15 A;  2K5H A;  3CCM A;  3NEL A;  1WFQ A;  3I2Z A;  2UUA Q;  3NEM A;  4A3C G;  3I4O A;  4GNX A;  5FLX c;  3OTO L;  1N9W A;  3T1H Q;  3TS2 A;  4J15 A;  1PHJ A;  1VQE A;  5EAY A;  4LFC Q;  1I50 H;  1NY4 A;  1V43 A;  2DGY A;  1VS0 A;  1Y14 B;  1AE3 A;  2ZTC A;  5FJ8 G;  2KBN A;  1TWF H;  4DV1 L;  1K3R A;  4LFA Q;  4LF5 L;  4DR3 Q;  3CCV A;  1L0W A;  4DR7 L;  1YJW A;  3CCS A;  1VQO A;  4B3T Q;  4NB3 A;  3HKZ G;  4IPG A;  3M4Q A;  2UXB L;  2JA6 G;  5AJ3 Q;  2F52 A;  4A3K H;  4HIO A;  1QUQ A;  1M90 C;  1CUK A;  5GAD C;  3HOU G;  2JA8 G;  4ALP A;  4H02 A;  4AQY L;  2CWP A;  4A3E G;  3PO3 H;  4LUZ A;  4A76 A;  2K14 A;  1OXX K;  5M5X H;  4B3R Q;  1Q86 C;  1OXT A;  1KQS A;  2E5L Q;  3J80 c;  4JBW A;  5IP7 H;  4LF5 Q;  2YTY A;  2ZM6 Q;  2ZTE A;  5GQO A;  4A3I H;  3CCL A;  1X65 A;  4ME3 A;  1PH5 A;  1LUZ A;  4A3K G;  4TVA B;  3TRZ A;  4DV0 L;  4A3B H;  1EWI A;  2UU9 Q;  4DK6 C;  3PO2 H;  1KL9 A;  4BA1 I;  4GOP C;  4DV3 L;  1Q1B A;  3BZC A;  1YHQ A;  2R7Z H;  1GVP A;  4WJ4 A;  3EN2 A;  1NMG A;  2A1A A;  3HKZ E;  1D8L A;  1I94 Q;  4PZ8 A;  4P75 A;  3Q8D A;  1PH9 A;  3MEF A;  1Q81 C;  2DUD A;  3PUZ A;  4DR1 Q;  3GTM H;  1TWA H;  3OYY A;  4A4I A;  1HNZ Q;  4JI2 Q;  4GN5 A;  5HY6 A;  2ZJR A;  5JJK A;  4A93 G;  4POG A;  4R4I A;  4NXM Q;  1S72 A;  2HIV A;  3PUW A;  2VZA A;  1GD7 A;  1VQP A;  4JI4 L;  1JB7 A;  2VQF L;  3AFP A;  3ERS X;  3PSI A;  4NXN L;  4JC0 A;  3W1G A;  4AYB E;  1VQL A;  3GTQ H;  3G48 A;  4HJ5 A;  3PO2 G;  3PUY A;  5LMU L;  1VQI A;  3ZJY C;  1IBL Q;  1VQA A;  5C3E H;  3CP0 A;  4JI5 L;  5IP7 G;  1M1K C;  4LF6 L;  4DV7 Q;  3HKS A;  4C2M H;  4LNQ A;  1P16 A;  1E7Z A;  1Y1W H;  3TQY A;  2VQE L;  3GD7 A;  2CWA A;  2E2I H;  1GM5 A;  3CPF A;  5C4X G;  1E3P A;  4BA2 I;  3RLN A;  1VQG A;  1WOC A;  3IRB A;  1KRT A;  4BY1 G;  2XGT A;  3F2D A;  4DUY L;  5M3M H;  1N34 L;  3CC7 A;  1KRS A;  4UP7 A;  4HID A;  1VQ9 A;  4LF8 L;  3PF4 A;  2ZJP A;  2YU9 H;  1G29 1;  4OXP A;  2HHH L;  1X9N A;  4C3I H;  4UP8 A;  5J3B A;  3GTL H;  1UEB A;  2Q2U A;  4RMF A;  1OXU A;  3BU2 A;  4IFD I;  4JYA L;  2HQL A;  3KYH C;  1PH3 A;  5FLM G;  2OWO A;  4A3D G;  1TWC H;  4NPS A;  1FGU A;  1YZ6 A;  2YYZ A;  5C0X G;  2OTJ A;  3H0G G;  3D31 A;  4TQU S;  1Y1V G;  2R7F A;  1BBU A;  1A63 A;  4JI7 Q;  2VQF Q;  4UP9 A;  1XMQ L;  4X65 Q;  5IYD G;  4IJL A;  1UE7 A;  1XTD A;  1J6Q A;  5C4X H;  1JE5 A;  1O7I A;  3BJU A;  4JOI A;  2Y0S E;  3U58 A;  4YWM A;  1YIT A;  4PZ6 A;  2YV5 A;  4LF4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...