1FGUA

Ssdna-binding domain of the large subunit of replication protein a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
MSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT
publication title Structure of the major single-stranded DNA-binding domain of replication protein A suggests a dynamic mechanism for DNA binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF16900 REPA_OB_2 Replication protein A OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fguA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fguA02
4PMWA 1L1OA 3G71A 1YEZA 2EXDA 2PI2E 2ZM6L 2FXQA 3VDYA 3G6EA 1GKHA 4A3LG 4YWLA 3F2CA 2OWOA 4IFDJ 2KHIA 3T1YL 1MIUA 2IY5B 1OXTA 1TWCH 1PH4A 4AYBG 3CC2A 1W2BA 1QVGA 4LF8L 1I5FA 5IYBG 1PYBA 1UE1A 5HY6A 3J81j 4A3JH 4LF4L 4LF6L 2E2IH 3EBEA 2F3IA 3AEVA 1PH6A 2ATWA 4BBRH 3J7ZC 4DV5Q 2VL6A 4QY7A 2VS1A 3I55A 1XNQL 4IFDI 2BH8A 1PH9A 1VQIA 4YCUA 5M5XH 4DR1Q 4UP7A 5M5WH 5LMUL 1E24A 1W3SA 4RMFA 4DV4L 1GM5A 3GTGH 3ICEA 4JI5L 3K0XA 4DV2L 4BY7H 4LF7Q 2BA1A 3I56A 1XNRL 2I5HA 1YHAA 2UUCQ 1PFSA 4MTNA 1CKNB 1N36Q 1X3GA 1N32L 1QVCA 4L5TA 2B3GA 4QL5A 3IRBA 4JI7L 3A74A 2AWNA 1HNZQ 3I2ZA 4EQ5A 3KJOA 5JEAG 3KDFB 4GOPA 1C7YA 4JI3L 3HOVG 1Q1EA 1YHQA 1I50H 1KHIA 2R7ZH 2PNHA 2JA7H 4GKJL 4B3SL 3PIOA 3CCUA 1ASZA 3KYHC 4GN5A 1N34Q 3TEHB 2NN6G 3ULLA 3CCMA 1CUKA 4GLXA 4PZ8A 5BR8L 1K83H 4X64L 2ZJRA 3CAMA 3ER0A 3CPFA 2I5LX 3M7NA 1VQ8A 1V43A 2JA8H 4A76A 1E3PA 4DV1Q 2YU9H 1VQLA 1WI5A 3CCVA 1PH5A 2JA9A 4BBSH 1HNWL 4X62L 3KFUA 4UPAA 4DUYL 1JJCB 1RIPA 1VQCA 4QGUA 2MNAA 2PMZE 2HIXA 3TREA 4DV7Q 4AH6A 4IJHA 2JA5G 5FJ8G 1LM0A 5IWAQ 2Y0SG 1J5EL 2AKWB 3K8AA 3CD6A 4LUVA 5IY0A 2Q2UA 1IBLQ 1LTLA 1YNXA 3NEMA 4Y7NH 1L0WA 1M1KC 4IOAA 3HOUH 3FKIH 2PQAB 1GVPA 1KC8C 4HJ9A 4MNOA 3UE0A 4OX9Q 1XTDA 5IP9H 2B29A 2NVQH 1PVOA 3CC4A 1PH8A 1VQNA 4UP9A 3T1HL 2LXKA 4JI0Q 1QZGA 3TS2A 4YHHL 3PUVA 4PG3A 4JI1L 4BA1I 1PH2A 2KCMA 3PUXA 2JA6H 2HIVA 1UWVA 3RR5A 1N8RC 4YCWA 5M3MH 4A3CH 5GADC 1VQOA 3M4OH 1SFOH 3HOWG 4JV5L 4BY1G 1JT8A 2JE6I 4LFBL 4A3BH 3PV0A 3S24A 1K73C 3G48A 4EX5A 4JBJA 3OYYA 4IPHA 5C4XH 5FLMH 4DV3L 4POGA 1HZAA 1V1QA 3HOYH 4DV5L 1EIYB 4DR4Q 4IPDA 1D8LA 1FL0A 3HOXH 1A8VA 4A3KG 2DUDA 1OXSC 2EIFA 3ZJYC 3RN5A 4B3MQ 2ID0A 4WJ4A 4NXML 3GTMH 1Q8KA 1Y1WG 3UE1A 4GS3A 4C3JH 3J81c 2UUBQ 1G51A 1PH3A 3I4NG 1JJGA 3M4PA 3CCEA 2Q2IA 2E5LL 4OWXB 2VZAA 4GNXA 4LF7L 3F2DA 1KD1C 1HR0L 4JI6Q 1CKOA 3KDFA 1IL2A 3HOZG 3S1QH 1Y1VH 2N78A 3S14H 1N33Q 4DUZL 5AJ3L 1Z9FA 1O7IA 3GTKH 3TQYA 2RCNA 3H3VH 1VQGA 4HIMA 4X6AH 4A3FG 2C35B 4L5SA 4A3EG 3CMEA 3GTJH 1DGSA 1EIFA 2N49A 3FKIG 4DR5Q 4JI4L 4NXNQ 4P73A 3PUWA 2GN5A 2HQLA 4A3IH 3S2HH 2N3SA 5EAYA 2I5MX 5IP9G 5JJLA 4PZ7A 1XMQL 5GAEC 1K9MC 2RHQB 2VW9A 1B70B 2JQOA 1WCMH 1E7ZA 3RLFA 4DNIA 3CF5A 1QUQB 4GN4B 1Q1BA 3G4SA 1KL9A 3U4ZA 5M3FG 5LMNL 1P16A 2UXBQ 2D62A 3A5UA 3PUZA 2MO0A 3S1RH 2AWOA 5IP7G 3W1GA 2QA4A 4X66L 1PYSB 4DV1L 1XPOA 1JE5A 4JI2Q 1M90C 2R92H 3H0GH 3CMAA 2K14A 1VQ5A 3HOYG 2IT1A 1EOVA 3D31A 1SMXA 2UXDL 4H02A 4XIGS 4UY8C 4B3TL 2VNUD 4DK6C 3CW2C 4IO9A 4P71A 1VQDA 4LNQA 5IWAL 5M5YH 4OONA 3RZOH 4IPGA 4TVAB 2V1CC 4NPSA 3ULPA 1G6PA 1IBLL 1T9HA 2R93G 4XTCS 3KF6A 2VQEQ 3STBD 1WYDA 2UU9Q 4LUOA 3BZKA 5DLQE 3GTQH 5ELOA 4YY3L 2Q2HA 5C44H 1HNXL 2CQOA 3UDIA 1VQ4A 2HHHQ 1KAWA 4DR6L 1SROA 2D0OA 4DV0L 4A3MH 4JI0L 3J80c 1PH7A 4DR7Q 3E0EA 4HIOA 3PO3G 3ULJA 4LF9L 2Q2TA 4OWWB 2WP8J 1YHBA 2NVTH 1NMFA 2ALYB 1IBKL 2YYZA 4JOIA 2BH2A 1XPUA 5K36G 3PSIA 1WCMG 3UDFA 5JJKA 1IBMQ 4DR3L 1S72A 4LFAL 2UXCQ 2Z6KA 4A93H 1FVIA 3E9IA 4UP8A 1EYGA 1FJGL 1BBUA 2UUAL 2ZJPA 2HT1A 2L15A 3U4VA 5IYDH 2KENA 3GO5A 3MEFA 2EQSA 4J15A 2OQ0A 4LW1A 1LUZA 1EQQA 4AYBE 1I94Q 1X56A 2UUBL 1G291 3PGZA 4A3JG 3WWVA 2LSSA 4GKKQ 3H0GG 3CPWA 1HZCA 1PA6A 3HFZB 1AH9A 3KLWA 1Q86C 2CFMA 3FP9A 3NENA 5J3BA 4BBRG 2WB1G 1A62A 1TWHH 4R4TA 4YWMA 1XMOQ 3PO2H 3OTOL 1X55A 4GLAC 3CC7A 2K5HA 3S1NH 4OO1I 4DR5L 4NXNL 2ZM6Q 1MJCA 3DLLA 4JG2A 4K0KL 4BY7G 4R4IA 1C0AA 3A5ZB 1A0IA 1YZ6A 4X65L 1VQ7A 2CCZA 4B3RL 2MO1A 3I4MH 5C44G 1NMGA 2WAQG 3H3VI 1L1OC 5C0XG 4DR2Q 5GAHC 4LF8Q 4A3DH 4IPCA 1AE2A 4P74A 4LF6Q 1OXXK 3B6YA 1MJEA 4JYAQ 3J80i 3UDXA 1HR0W 1XPRA 1VQHA 1CSQA 1BBWA 1Z47A 2NVYH 2B63H 2R7ZG 1YITA 3L0OA 2JA7G 4JI2L 4BXXH 5C3EH 4R1JA 1KRSA 4BA2I 1VQFA 4YWKA 1S3OA 3HKZE 1Q46A 5JEAJ 3GTOH 2YV5A 4DV4Q 4DKAC 3TRZA 1E1TA 4A3GH 2OTJA 1YJ9A 4LFCQ 4QQBX 1CKNA 1SRUA 4O2DA 2A19A 4L5RC 4OXPA 1BKBA 4DV6Q 4IFDG 4C3HH 2OCEA 4HIDA 4DR1L 1JJ2A 3U50C 2JA8G 1N32Q 4BBSG 1X3FA 3AYHB 1CKMA 5ELNA 5IYCH 2UU9L 1YIJA 4C3IH 3BJUA 4HJ5A 3RNUA 4A3LH 1BVSA 3AQQA 2UUCL 2K4KA 4JBMA 2HHHL 5LMNW 2IHFA 1N36L 2H5XA 2RF4A 4DK3C 1TWAH 2RHSB 2Y0SE 3CCJA 2R7FA 5IYBH 1VQ6A 3K7AH 2VUMH 2A8VA 2NN6I 3CCQA 1UE7A 2PI2A 4DAYB 1YJWA 1HNZL 2ZTCA 1JMCA 4B3SQ 3HOUG 4GOPC 3KF8B 1SLJA 4JC0A 3M85A 2E8GA 3BU2A 1WJJA 4X64Q 1IBML 1UEBA 2MQHA 5HGQA 1H95A 2IHEA 2R7DA 1K0RA 1Q7YC 1VQBA 3SGIA 1OTCA 3K7UC 3I7FA 3UDGA 1N34L 1TXYA 1VCIA 3DM3A 2JA6G 1HNWQ 5M3MG 4A3CG 1LYLA 4X62Q 4DUYQ 5H1SE 2JEBI 1YI2A 1YBYA 3M4QA 2IX1A 4A3BG 1E1OA 3J7A5 1UE6A 1VQ9A 3PIPA 1J5EQ 5C4XG 3CP0A 4JI8Q 5FLMG 2E2JH 1Q81C 2CWAA 4KHPQ 3PCOB 2PQAA 1HZBA 4R4CA 3HOXG 1X6OA 1X65A 2CKZB 4DV7L 1XMOL 1PHJA 3PUYA 3S15H 1QZHA 1HH2P 1X54A 2OQKA 3EN2A 4O0AA 4R4QA 2JEAI 3M3YH 1KRTA 3HOVH 3I4OA 5IYCG 4OO1G 3T1HQ 1SR3A 1NJIC 2F4VQ 4L5QA 1VQEA 4YHHQ 2YTYA 4JI1Q 3J81i 1Y1VG 4OX9L 4HIKA 4KI0A 4HJ8A 1SE8A 4AIMA 4DR2L 1VQKA 1OXVA 4JV5Q 1FGUA 4LFBQ 1K3RA 4JYAL 4JBKA 5E7NA 2VUMG 2ZTEA 3RZDH 4RG1A 2OTLA 3U58A 1VQJA 4LF5Q 1CSPA 3MXNB 3F2BA 2YTXA 1VQMA 4DV3Q 2VQFQ 4A3IG 2AMCB 1PH1A 4MZ9A 1B8AA 4WJ3M 2I0QA 3JAMc 4Y52H 1GD7A 2VY3A 4JBWA 3CXCA 2JA5H 5FJ8H 4AQYQ 1EWIA 4A4IA 3A0JA 1EUJA 1N9WA 4NXMQ 1YVCA 1KQSA 3NELA 4DR4L 3GDEA 4LFCL 3AFPA 2K50A 4HJ7A 3EIVA 3L2PA 2E5LQ 4B3ML 1VQAA 1HR0Q 3S1MH 3S16H 4PZ6A 4YCVA 3JC66 1WOCA 4DV6L 2R6GA 4DUZQ 3F1ZA 3W5OA 5AJ3Q 1P8LA 1V9PA 3S2DH 2XTIA 3L7ZC 1NBWA 3M9BA 4IOCA 4A75A 4GNXC 2R92G 1SN8A 4JI6L 3ERSX 2A1AA 4NB3A 4GNXB 5IT9c 1N33L 4JI4Q 3GTLH 1PV4A 2K5NA 3HOWH 4BY1H 4LUZA 3HKSA 2MFIA 3CCSA 2NZHA 3PF4A 1L2FA 1XMQQ 3HKZG 3H15A 2D0PA 1QUQA 1C9OA 5FLXc 2ES2A 2KHJA 3LGJA 1EFWA 2GVBA 5LMNQ 1S40A 4A3KH 1MKHA 3T1YQ 4A3MG 2IX0A 5C4JH 1NTGA 2QGQA 3W1BA 4APVA 1K8AC 1KIXA 1L1OB 2KCTA 4X66Q 1Y1WH 3FHWA 4LF4Q 3I4NH 4P75A 2UXBL 3F8TA 4R4OA 5IE8A 2LXJA 2UXDQ 3HOZH 4B3TQ 3RLOA 2KBNA 1OXUA 1ASYA 4JI8L 1XNQQ 3RLNA 3JAMi 1KXLA 4A3FH 4KHPL 4A93G 2ZTDA 4A3EH 2NZOA 1R9TH 4KHZA 1U5KA 3E9HA 5LMUQ 2BA0A 3KJPA 2AHOB 5IYDG 4JI5Q 4DV2Q 2K75A 4QJFA 4YY3Q 4ALPA 1XNRQ 1HNXQ 2DGYA 2F4VL 1VQPA 3CCRA 4DR6Q 4DV0Q 1IYJB 5JJIA 4GN3B 2VQEL 2ASBA 2N8NA 4P72A 3OW2A 3KF6B 4LWCA 4KLKA 3CCLA 2Z0SA 2JJQA 1EQRA 4LF9Q 1RL2A 5M3FH 5GROA 1X9NA 3PO2G 4JI7Q 1NE3A 2QEXA 2WB1E 2K5VA 4HJAA 1X3EA 3D0FA 1Q82C 1A63A 5IP7H 1IBKQ 3K81C 4GLVB 3AFQA 4JI3Q 1TWGH 4DR7L 3TS0A 4DR3Q 4LF5L 4LFAQ 2K52A 2VQFL 1JB7A 4GKJQ 1WFQA 4DPGA 3I4MG 1FJGQ 1IZ6A 1HZ9A 3BZCA 2WFWA 3GD7A 4JOIC 2UUAQ 1D7QA 5BR8Q 1J6QA 2WAQE 4TQUS 4C2MH 4GOPB 3CQZH 3STBC 4AQYL 4JCVE 3PF5A 2UXCL 2Z6KC 1TWFH 2YTVA 3NBHB 3RN2A 4A3DG 1AE3A 1I3QH 5GAGC 2R93H 3K80C 3KOJA 2NVXH 5C0XJ 4QIWE 1XJVA 1Q12A 1YJNA 2JK8A 3GTPH 1I94L 2CWPA 1VS0A 2E2HH 2ZJQA 2B63G 1HJPA 1Y14B 4BXXG 1NY4A 4OWTB 5C3EG 1GO3E 2XGTA 3Q8DA 3OTOQ 4GKKL 1K8GA 1IXRA 5GQOA 1B7YB 1I6HH 4FDBA 1UE5A 2F52A 3PO3H 4DAMA 4A3GG 4K0KQ 4ME3A 4B3RQ 1E22A 4X65Q 3S17H 1U0LA 2GVAA 4IJLA 5C0XI 4POFA 1QVFA
chains in the Genus database with same CATH superfamily
1CA5A 1NCVA 2EXDA 2PI2E 2FXQA 3H6MA 1BDOA 2AQ2B 4K2KA 1CA6A 2O5IC 4A3JB 3T56B 3F2CA 1PH4A 3CC2A 1W2BA 4LF8L 5IYBG 5HY6A 4A3JH 4HN7A 2F3WA 5CBAE 1PH6A 3GTGB 1LTGD 2HCIA 5C5LA 3DEOA 2VL6A 3I55A 4R8IA 2VXWA 2MPMA 1X3QA 2Q8IB 3GTGH 4JI5L 4DV2L 4LF7Q 1YHAA 3NP8A 1PFSA 1JC7A 2EYFA 1Q90A 4L5TA 3J7AV 1LT4D 2B3GA 2B39A 1I50B 5JAVA 1H9JA 4ID6A 3IRBA 4IN3A 4QL5A 5ELCA 4DXGA 3SXHA 1YNND 3HOVG 1BXTA 1YHQA 1I50H 3ITPA 1WTXA 5CORA 3MA2B 2FHTA 1LO5D 4ZKBB 2NN6G 3CCMA 1CUKA 4X64L 4XYQA 3M7NA 4DXFA 3E5SA 2WIIB 4DV1Q 3X3NA 3CCVA 2JA9A 3VR5A 3KFUA 1RIPA 4ZRZA 5IGBA 3TREA 2WKDA 4AH6A 4IJHA 4UHVA 5FJ8G 2L11A 3CD6A 4OELB 2NVQB 2Q2UA 4DAPA 3NEMA 5EPKA 5M3MB 1CZWA 1JWUD 2NVQH 5IGCA 3IFDA 2ZXOA 1PH8A 2IL8A 4PG3A 5T1IA 1G6ZA 3PUXA 1F2YA 2Z6BA 4YCWA 2C9OA 4XYOA 5M3MH 1I4XA 4A3CH 1JT8A 2JE6I 1S4ZA 3HOXB 1K73C 3ERQA 3TMEA 4NKLA 3GTMB 1ILPA 4POGA 4DV3L 1HZAA 5EGTA 2A6HD 1EIYB 3HOXH 3RN5A 3S1QB 1SE2A 3GTMH 3H3VC 3MEHA 5D65A 2F0QA 3UE1A 1QE6A 4IUQA 3I4NG 1JJGA 3M4PA 3CCEA 4KJOA 2E5LL 4OWXB 4GNXA 3S1QH 1IL2A 4K5VA 5AJ3L 1XX8A 2PMZB 2EXZA 3R3OA 5A35A 1PTOC 4A3EG 4CGYB 2BDNA 1NUCA 1BCPB 4C56C 1B44D 3OMCA 4RKBA 2I5MX 5EAYA 1M4VA 5JJLA 4PZ7A 4YIJA 2EJFC 4K5XA 3S1RB 3HRZC 1E7ZA 3CF5A 3G4SA 2QDLA 2V4DA 1P16A 3H0GB 3S1RH 2MJ8A 5IP7G 5JVG3 2QA4A 1PYSB 3HZXA 3RZOB 3H0GH 3HOYG 1EFID 1SMXA 4H02A 4P2CB 3SE0A 4UY8C 3TZUA 4X3UA 1PFMA 5IWAL 1QWYA 4OONA 3RZOH 5C3WA 2A5HA 1B2TA 2R93G 4QB4A 4OL7A 2UU9Q 5DLQE 1HNXL 2HHHQ 2CQOA 4DR6L 1SROA 4ZCKA 1TIID 2EPBA 4X3SA 3E0EA 3SK4A 5IGFA 3ULJA 5BN5A 3EA6A 4A93B 2NBFA 1YHBA 3HGBA 3KBGA 2K6AA 1C8CA 1MGSA 3NBHA 1S72A 2Z6KA 2EYPA 4A93H 4L8JA 1KNEA 4UP8A 1GHKA 2HT1A 2KENA 2EQSA 1LUZA 1I94Q 3DM1A 2UUBL 1G291 3WWVA 2LSSA 3L3OC 3CPWA 3I70A 4RA8A 1HA6A 3OW7A 2F1MA 3NENA 4BBRG 4R4TA 4KY7A 4ZUJA 4FF4A 2IWHA 4CJ0B 1EWHA 1BUVT 1C0AA 4A3DB 2DY8A 3A5ZB 2WAQG 3H3VI 2RKSA 3M4YA 1A15A 4DR2Q 5COYA 1HPCA 3J7AF 2BCOA 4NDXA 4LF8Q 4A3DH 4P74A 4R8NA 3NWSA 3GTOB 4WFN3 3UDXA 3SK8A 2QILA 1LTAD 1VQHA 1CSQA 3MFYA 4O1NA 2R7ZG 2QDBA 1DOLA 1BNZA 4K6LA 4R1JA 3GTOH 1S3OA 1ML0D 4RGMA 2CHBD 2PYKA 1F9RA 4LFCQ 2XRQD 4QQBX 3TP8A 4OXPA 4DV6Q 5EBCA 5J22A 4DR1L 1TWAB 4BBSG 1X3FA 1DOKA 3EVQA 3A8IE 3NSWA 3M7GA 1SYBA 3SHLA 1TWAH 3BDOA 3HG9A 1EU3A 5IYBH 1AZQA 2NN6I 3QR8A 1QJOA 1RDPD 3CCQA 2A74C 3HOUG 1II3A 1PTOB 3NPPA 3BU2A 1WJJA 1V1PA 2EYJA 1UUPA 4X64Q 1QB5D 2KCCA 1PRTC 1UEBA 5IOCA 1IBML 1H95A 2IHEA 2CH4W 1VQBA 1OTCA 1N34L 1PTOH 2JA6G 2X6LA 4HCSA 4J8QA 1YBYA 3V96A 3QOLA 3IAYA 1DCZA 1VQ9A 1ENCA 1HFGA 3HOVB 4JI8Q 5FLMG 2X6GA 1Q81C 1GUNA 4PMCA 1XMOL 4R4CA 1PHJA 2CKZB 4DV7L 5DM73 3FVQA 1QZHA 3EN2A 4O0AA 2OQKA 2P5ZX 4UAIA 5BN3A 1EL0A 4H0LC 1KRTA 3HOVH 3I4OA 4C3JG 4OO1G 1NJIC 1LTID 4JK1C 2F0IA 2NN6H 2IX3A 3K58A 1Y8PB 5FK9C 4DK1A 1TS3A 2HD3A 1OXVA 3FDTA 4HMJA 1K3RA 2VUMG 2ZXRA 1VQJA 1TT2A 4MIUA 1SXTA 4N9TA 5L37A 4DV3Q 2AMCB 3OHXC 2I0QA 3S1MB 1LTSD 5FJ8H 1B3AA 1HA5A 2ZT9C 1KQSA 1DOMA 3AMUA 3NELA 2E5LQ 3L2PA 3S1MH 1U4RA 4HR7B 4QIWB 4F88A 2KHSA 2CH4A 3GTLB 5AJ3Q 4DNTB 1AEXA 4DU9A 3GTLH 1PV4A 4LUZA 3HKSA 2NZHA 4OGQC 1QUQA 1C9OA 2ES2A 1BCPF 5CV9A 1JCKB 3I4NB 1S40A 1MKHA 3T1YQ 4A3MG 2IX0A 2RDHA 4APVA 1KIXA 2RSNA 3I4NH 4HTHA 4A3EB 1PMRA 1ICFB 5I9PA 1HRJA 4ZK9B 1XNQQ 5ELBA 1I4HA 5D3IB 1RD9D 1JOKA 4A3EH 4KHZA 1U5KA 3BG3A 4WORA 5LMUQ 3GP7A 4DK0A 4RAUC 1TS4A 2XSCA 5FO8B 1SNQA 1F77A 1HNXQ 2F4VL 4DR6Q 1IYJB 5JJIA 2ASBA 4HSVA 1RL2A 2R3ZA 2MGSA 1X9NA 3PO2G 4JI7Q 3HOYB 4HJAA 2K5VA 3HP3A 3K5MA 1X3EA 1Q82C 5IP7H 3K81C 4GLVB 3AFQA 4UDUC 4G7OC 1F9PA 1JORA 2D2CC 1EZ8A 5FO9B 2K52A 4FXGC 1TWFB 1I3QB 4DPGA 1SEBD 2R93B 2WFWA 2EYMA 5FKAC 5LL6X 1D7QA 4AQYL 4TQUS 1SE3A 5EPLA 3STBC 5KNBA 3VR6A 1TWFH 3I8ZA 3RN2A 3A7AB 5KNCA 1I3QH 5GAGC 2R93H 1IKLA 4TKOB 2BDOA 4ZUIA 2B63G 4BXXG 1LV9A 1NY4A 5C3EG 1GO3E 4ABNA 1I4GA 5ELFA 1D5ZC 2XVSA 1IXRA 1G8ZD 2LFNA 1UE5A 4A3GG 1TY2A 4ME3A 2R61A 4IJLA 4U673 4EVOA 1L1OA 2ZM6L 3VDYA 1DYQA 4C3IG 1GKHA 1RCVD 4KTAA 2KHIA 3PQIA 1F2ZA 4AYBG 2B2VC 1QVGA 3TP5A 2KCNA 4BBRB 3J81j 1UE1A 3D6WA 2WKCA 2F3IA 2PW7A 2EY6A 2J7ZA 3AEVA 3U9SA 2ATWA 4KKSA 2KECA 4BBRH 1STAA 4DV5Q 5KNDA 2BH8A 1PH9A 3I91A 2WAQB 4YCUA 4DR1Q 4UP7A 4RMFA 1PRTD 1GM5A 3K0XA 1LTBD 3I56A 2I5HA 1ONLA 1KTKA 2B2TA 1CKNB 1QVCA 4XT3B 2R7ZB 3HS0C 4DAYA 4IZ8A 2B2UA 3I2ZA 3KJOA 5JEAG 4GOPA 2Z9HA 4FXDA 2F0NA 4ZAIA 1Q1EA 2R7ZH 1KHIA 2PNHA 1E2VA 2X69A 4B3SL 3PIOA 5EKLA 3IKJA 1N34Q 2TMPA 4BBSB 2HUGA 2ZJRA 1EY8A 1WI5A 4BBSH 1BO0A 4X62L 3DWQA 4DUYL 1JJCB 2PMZE 4DV7Q 3HOUB 3FKIB 2JA5G 1EU4A 2Y0SG 3QG1A 3K8AA 4M1UB 5C6AA 1IBLQ 4V0BA 2K05A 1L0WA 1M1KC 1JWSD 3FKIH 3HOUH 2PQAB 3H09A 1SDFA 4HJ9A 2JA6B 3UE0A 1I6VC 5IP9H 2B29A 1GJXA 3M4OB 1SFOB 4KN4C 4UP9A 1LT6D 4JI0Q 1QZGA 1MBYA 3TS2A 1QILA 3PUVA 5JPMC 1STYA 2JA6H 3MXNA 1UWVA 1N8RC 2J0TD 5GADC 3M4OH 1XYIA 1SFOH 4JV5L 2NUCA 4FYDA 4JW0A 4LFBL 3RD4A 2ICIA 1B1ZA 3PV0A 3S24A 1NR4A 1MI2A 4IPHA 5DNFA 5FLMH 4C3JB 1G2SA 1V1QA 5C3XA 2EIFA 2ID0A 4NXML 1Y1WG 3Q0AA 4KK7A 2RDFA 4C3JH 1G51A 1PH3A 3KLRA 2Q2IA 2B8FA 3KK7A 2F0UA 1KD1C 3W2DA 1CKOA 2BE5C 3I4LA 1ENAA 2EE1A 2KQ3A 2N78A 3KLSX 1Q8IA 3GTJB 1Z9FA 1S5DD 2JSOA 5T1GA 2C35B 1Y8OB 1JR0D 1BCPC 4XQNA 1EY4A 3GTJH 3CMEA 1EIFA 4DR5Q 2N49A 2QCPX 2GN5A 3NQTA 1MD2D 2N3SA 1K9MC 2RHQB 1R4QB 3NTHA 2VW9A 1WCMH 3Q6SA 4DNIA 2M2LA 2K1BA 3VA5A 3NTKA 5LMNL 3BVZA 1EY5A 5KIXA 2GA4B 1YNJD 2IT1A 1EOVA 2L55A 3D31A 2UXDL 1GUOA 4XIGS 1VMCA 4DK6C 3CW2C 4LNQA 1SMYC 2TSSA 3DEPA 4TVAB 3QIAA 4NPSA 3T13A 3T4AC 4A3MB 4TRDA 4MTKA 3KF6A 3STBD 1EEID 1KDBA 3BZKA 4YY3L 2Q2HA 3UDIA 1C4QA 1DXMA 4A3MH 1PXUA 1PH7A 4HIOA 4LF9L 5CV4A 2Q2TA 4OWWB 1H9SB 4JOIA 1XPUA 1KNAA 3UDFA 2XWJB 2AQ3B 2M00A 1BBUA 3A8KE 2UUAL 2L15A 5C5MA 3G6JB 5AFWA 3PO2B 1TWHB 1D5MC 3PGZA 1WTOA 1PA6A 3S1NB 1VF7A 4DNRB 3E0JA 5J3BA 3PO2H 2WB1G 1T5XD 1TWHH 4E6IA 3OTOL 1X55A 3K5NA 2EOTA 3S1NH 4NXNL 2ZM6Q 1MJCA 4K0KL 4BY7G 4R4IA 1VQ7A 1A0IA 3D8GA 1STBA 1FNUA 1SBBB 5C44G 2EY1A 5C0XG 3U9OA 4DGZA 5GAHC 2B63B 2XNAC 5C3EB 3RMHA 3I73A 1LACA 4CKCA 2B63H 4A3GB 1YITA 3L0OA 1IL8A 1JB3A 4JI2L 2JA7G 2Z8LA 2VB3X 5C3EH 4BXXH 4BA2I 3HKZE 5JEAJ 1E0BA 2YV5A 5BN4A 1KAAA 2KJXA 1F2MA 1E1TA 4A3GH 3VYSA 4C3IB 4S3SA 4O2DA 4L5RC 2JA8G 2EY2A 1EOTA 1Z7TA 3AYHB 4AYBB 5IYCH 1YIJA 4C3IH 3BJUA 4HJ5A 3RNUA 2UUCL 3LWEA 2K4KA 4JBMA 5LMNW 4DK3C 2QF7A 5E1FA 3K0YA 4KD4A 3I3CA 2RHSB 2PI2A 1HNZL 4B3SQ 1HQRD 2WV6D 2EJMA 3KF8B 1Y69U 2RVLA 2MQHA 1B53A 2G9DA 3PIO3 4G7HC 4MHEA 3UDGA 1O7YA 3K6OA 4RCOA 3DM3A 5G3LD 1LYLA 1PFNA 4X62Q 4DUYQ 5H1SE 3M4QA 1EIHA 2F0JA 4A3BG 1E1OA 3S15B 3PIPA 5C4XG 1IKMA 2O2LD 1BOSA 2NB0A 3S15H 4FVMA 5JEAH 1HH2P 5I4DA 4QMGA 3A55A 3P1HA 5CC4A 3URYA 1SYCA 3P20A 1Y1VG 2A69D 4OX9L 1SE8A 4JV5Q 4L63B 1LABA 2PQEA 4LFBQ 2BE5D 4JYAL 5HGTA 4RG1A 2JA5B 3U58A 1CTMA 2Y0SB 4LF5Q 1O78A 1CSPA 3J81E 4A3IG 1R4PB 1BCPD 3ND8A 2K5DA 3CXCA 2JA5H 3S16B 1EWIA 3A0JA 4NXMQ 5LL6S 2D9UA 1CT1D 3S2DB 4DR4L 3AFPA 3EIVA 3KUPA 3S16H 3ONAB 3JC66 3J80L 1UAPA 3S2DH 1NBWA 2F0GA 4IOCA 2R92G 1DONA 1B9NA 2M9VA 3ERSX 4GNXB 1H9KA 1GOZA 1V8QA 1N33L 1BR9A 3VR2A 1MSGA 2MFIA 3TBIB 1BF4A 1L2FA 1PZKD 1Y8NB 2ICEC 1SMYD 2D0PA 3RUZA 2EJGC 2NTTA 1XTCD 4R9WA 1Y1WB 1S5BD 2F0FA 1EFWA 5LMNQ 2F0OA 3FPUB 1XWEA 2L0CA 1K8AC 2KCTA 1Y1WH 3FHWA 3S9WA 2SEBD 2D5DA 2UXBL 3F8TA 2VB2X 4ULLA 5IE8A 1LLRD 2LXJA 2B2YC 2UXDQ 4EQNA 3RLOA 1I4PA 3CHBD 1XXGA 3MXPA 4OIKA 4KHPL 2ZTDA 5EKIA 1JOQA 1HUMA 5IODA 2XRSD 3J80E 3KJPA 4IUPA 4JI5Q 4DV2Q 4LJZC 1NNXA 4BWGB 4YY3Q 3H94A 3FRPB 2HDLA 1HFNA 3JAME 1Z6HA 4OHJA 1PYWD 5EPJA 3R8BA 2IPKD 3TSSA 3OW2A 2A68C 1U9RA 1A3VA 2JJQA 1EQRA 2Z0SA 4LF9Q 5GROA 4CKEA 1TU2B 5TSSA 4C1NK 3D0FA 1A63A 2NZ1D 4FF3A 3TS0A 2C5CA 1AP0A 2E2DC 2VQFL 4RHRA 1WFQA 3I72A 1J9OA 3I4MG 1HZ9A 2UUAQ 1J6QA 2WAQE 5JPNC 3S14B 4RKLA 2UXCL 3NK9A 3NBHB 2YTVA 3DHQA 2FJ2A 1HXYD 5C0XJ 1DZ1A 2JP1A 4RHSA 1QNKA 1VS0A 4FF2A 4K2LA 1DJRD 4GKKL 3Q8DA 3OTOQ 3OMGA 1K8GA 3QOJA 1EIGA 2F52A 4Q0FA 4K0KQ 3QWNA 2GVAA 5C0XI 4C3HG 1EY7A 1YEZA 2KOLA 2QEJC 2HQEA 3G6EA 1WTQA 2PPBC 2OWOA 3A7LA 1MIUA 2IY5B 1OXTA 4ZLTF 4RH6A 2WB1B 4LF4L 5DEHA 1NSNS 4LF6L 2KEEA 3MC0B 2PO4A 4RGOS 2K28A 5M5WB 3A8JE 1AZPA 2RSOA 3J7ZC 1PTOD 2XWBB 4BY7B 2VS1A 1VQIA 4CDFC 2K03A 5M5WH 1E24A 3ICEA 2PNRC 4BY7H 2BA1A 1XNRL 1VMPA 2UUCQ 3WOEA 4MTNA 5C0XH 1X3GA 2RA4A 1AN8A 4XQQA 4I7ZC 2JA7B 2MUYA 3A74A 1ZYRC 2AWNA 3PMFA 1HNZQ 4EQ5A 3KDFB 1CZGA 1FD7D 4JI3L 1K83B 1X32A 2JA7H 5K5PA 4GKJL 1ASZA 3CCUA 3KYHC 5D3DA 4JPBW 4FF1A 3ULLA 2JA8B 2YU9B 5BR8L 1K83H 4MN3A 1QOHA 5DM63 1RF2D 3CAMA 3ER0A 1V1PB 3CPFA 4Q5VA 1VQ8A 1V43A 3KLSA 2JA8H 3E3XA 1E3PA 5IT9L 1LTRD 2YU9H 1A3TA 1HNWL 1ILQA 3VYRA 3VR3A 1V1OA 1VQCA 4QGUA 2HIXA 4IUVA 1LT5D 3PIP3 1LM0A 2IJ0A 5IWAQ 5FLXL 4LUVA 5IY0A 1LTLA 4PQXA 4IOAA 1KC8C 4U68A 4KY5A 4OX9Q 1XTDA 1VQNA 4PNYA 2CVRA 5CV5A 3T1HL 4A3BB 1PH2A 4BA1I 4KKTA 2HIVA 2E75C 3RR5A 5C4XB 3VR4A 1EY6A 2G9HD 1SYDA 4LK1C 3HOWG 1DM0B 4BY1G 1WTPA 4DAVA 3K5OA 4A3BH 4TSSA 3BS1A 4JBJA 5C4XH 2PZWA 4G7ZC 3HOYH 4DR4Q 2LKVA 1D8LA 5IIFA 2CW0C 4ME5A 1OXSC 4EGVA 1Y1VB 5IT9E 1Q8KA 4GS3A 3J81c 2UUBQ 3GTKB 4LF7L 1D1KA 5J1ZA 3EJIA 3HOZG 1Y1VH 3D4WA 1N33Q 4DUZL 4ZKCB 5FLXE 1O7IA 3GTKH 3TQYA 2RCNA 1VQGA 4A3IB 3S2HB 4A3FG 4L5SA 3ZYYX 1DGSA 4JI4L 4CJ1B 3QJYA 2I07B 4K8JA 4A3IH 3S2HH 1WTRA 1XMQL 5GAEC 2JQOA 1L0XB 4G4KA 4J1MA 1ZEQX 2KUMA 1QUQB 3IFTA 4GN4B 1KL9A 2NTSA 2R92B 2UXBQ 3MHBA 3A5UA 3PUZA 2MO0A 2K7VA 3SR1A 5CYUA 1GUSA 1F9QA 2AWOA 5KGUA 1NR2A 2A68D 2F0HA 4OIJA 3W1GA 4X66L 4DV1L 2EZVA 1XPOA 3SK5A 1JE5A 5M5YB 2R92H 2L1BA 3CMAA 2K14A 3BZDB 4KMUC 2VNUD 4B3TL 4FP5D 3UI2A 3X3MA 1VQDA 3VYTA 5M5YH 3QB3A 1G6PA 1T9HA 1ESRA 2DNCA 1WYDA 4LUOA 5ELOA 1ESFA 4FNFA 1U4LA 4B08A 2I46A 1VQ4A 1KAWA 4DV0L 3J80c 2IW3A 2OF1A 2WP8J 4QF4A 1BQQT 1S5ED 5ELEA 1NMFA 2YYZA 4HMIA 5K36G 3PSIA 5JJKA 1IBMQ 4LFAL 2UXCQ 2B2WC 1CFMA 1O7ZA 2F3VA 1FVIA 3TZDA 1FJGL 1EYGA 1SYGA 3U4VA 1RTNA 2LS01 3GO5A 3MEFA 1EQQA 2OQ0A 4HEDA 4AYBE 4EQOA 2K04A 4GKKQ 3H0GG 5CR3A 1WD1A 4KV6A 1AH9A 1D5XC 1A62A 1XMOQ 2PZTA 3BDLA 3I4MB 2E74C 5I9OA 2K5HA 3CKIB 4OO1I 1RKNA 1IW7C 5KRUA 4DF7A 3DLLA 4JG2A 1YZ6A 4B3RL 2K33A 1SYEA 3K5LA 3I4MH 1GXDC 1VF5C 4IUTA 4I7AA 3E6ZX 4HAEA 2B2VA 4KD3A 2SNSA 2NVYB 1SYFA 4LF6Q 3OSOA 1OXXK 2K32A 1WVLA 1MJEA 3J80i 1XPRA 1B9MA 2XIWA 4XQJA 2L12A 1H9RA 2NVYH 3SDZA 3Q23A 1Q46A 4XT1B 1NAPA 4C3HB 5JOBA 3TRZA 4DKAC 1EQTA 5CV7A 2OTJA 3L9AX 3A56A 3OWFA 4H44C 5JJZA 1SAPA 4IFDG 4C3HH 2OCEA 4HIDA 1JJ2A 1H9MA 3U50C 5A2QL 4X3TA 1CKMA 2UU9L 4OO1H 4IUNA 3C46A 1BVSA 3AQQA 2VUMB 2HHHL 1N36L 2QKIC 2F0WA 1EEFD 1E2ZA 2Y0SE 1VQ6A 5EJWA 2VUMH 2A8VA 1UE7A 4DAYB 1JMCA 1HHVA 4JC0A 1SLJA 3M85A 3MWYW 3DWPA 1Q3LA 4V190 4LMQD 1TXYA 2AQ1B 1VCIA 2EY5A 1HNWQ 1D1IA 3C2PA 4FXKC 2RDGA 1YI2A 2F0PA 4HSPA 1TVXA 1GUWA 4B9WA 4G57A 3CP0A 3M3YB 3Q24A 2CWAA 1KLGD 1STGA 3T16A 1X6OA 3T51B 4R4QA 2JEAI 5A2QE 3M3YH 5CMDA 3K59A 2CW0D 3T1HQ 2F4VQ 1GHJA 4FO2A 4L5QA 1JQYD 2YTYA 3RZDB 3SEBA 2RBMA 3NXWA 5CBEE 4HIKA 4HJ8A 4DR2L 1VQKA 1TR5A 1F2LA 2H1EA 4I65A 4JBKA 5CGKA 3RZDH 4L6TB 5KEEA 1L0YB 2K01A 3MXNB 3F2BA 1VQMA 4WJ3M 4MZ9A 1B8AA 4Y52H 3TN2A 2VY3A 3FPPA 4AQYQ 4N8FA 1EUJA 3MVVA 4PMBA 1I4RA 1UNSA 3FMCA 1EWCA 4WJ4A 4LFCL 4HJ7A 2K50A 1B4OA 4B3ML 3GV3A 4PZ6A 4QUFA 4YCVA 4DV6L 5EKKA 2R6GA 4DUZQ 3F1ZA 3W5OA 2F4IA 3DXJC 1P8LA 3HOWB 1IYVA 1K3BC 2XTIA 2NYZD 4BY1B 4GNXC 2PCFB 1SN8A 4JI6L 1KLUD 3AU7A 4NB3A 3KF8A 5IT9c 3R2TA 3F2UA 3EQLC 4JI4Q 1LT3D 1ENFA 3D6CA 4O42A 3HOWH 4BY1H 1CHPD 1XMQQ 3HKZG 3H15A 4C1NI 2PZUA 5C4JB 1QG7A 5FLXc 2KHJA 2GVBA 1PRTF 5C4JH 1NTGA 3HOZB 3W1BA 1B3QA 4X66Q 1ZKOA 1WD0A 4A3FB 4K8IA 1TY0A 3CU7A 2FMCA 3HOZH 2QW7A 1R9TB 4B3TQ 1RTOA 3CRKC 1ASYA 4JI8L 4A3FH 4LAAA 1UEAB 2NZOA 1R9TH 4N8X1 2AHOB 5IYDG 4QJFA 3AB9A 1GUTA 1SNDA 3TP7A 3CCRA 2F03A 4DV0Q 3NWTA 3C3LA 3EFXD 3MZ5A 2VQEL 3KF6B 4KKUA 1NE3A 2WB1E 1IYUA 1W6KA 4DR7L 4C2MB 1EYCA 5DAUA 1SJED 4PV1C 4LFAQ 3NQIA 3G7LA 1FJGQ 5CV8A 1IW7D 3N6RA 2O4XA 4C2MH 1SNPA 3J81L 1ICWA 2Z6KC 1KDCA 1BBXC 3K80C 3KOJA 4DA2A 3LX0A 3WOFA 4QIWE 1RODA 4QUCA 1Q12A 1XJVA 3BYYB 1I6HB 2CWPA 2ZJQA 1Y14B 2DNEA 2A6EC 1ZXTA 4OWTB 2BOSA 2XGTA 4WJWA 3WDNA 3S17B 5JVH3 5GQOA 1B7YB 3DMUA 1I6HH 1PFBA 4DAMA 4B3RQ 1E22A 3S17H 1U0LA 1O7LA 2EVBA 4POFA 1D6EC 5K36H 4PMWA 1CQFA 3G71A 1TWCB 4M8AA 1AFPA 1ET6A 2EYHA 4A3LG 4YWLA 2E2IB 4IFDJ 4CJ2C 3DUZA 3T1YL 5M9OA 1TWCH 1HTPA 1I5FA 1PZID 1PYBA 2E2IH 3EBEA 3MFGA 5M5XB 5E4WC 1TKWB 4QY7A 1XNQL 4HCEA 4IFDI 5M5XH 5LMUL 3BVGA 1W3SA 4DV4L 1FNWA 4CDDC 1FR3A 1PDQA 1STEA 1LTTD 1N36Q 2F0MA 4RGNA 1N32L 3OWEB 1U4MA 4F8MA 3JAML 3O13A 4JI7L 1C7YA 4J6HA 1SNOA 1E2WA 1EY0A 1OO9B 1W6JA 1FGBD 4GN5A 3MAQA 3TEHB 5I6WA 2LMCB 3TP6A 4GLXA 4PZ8A 2L5TA 3HEJA 4CDEC 2I5LX 4KY6A 2KA7A 4IFDH 4A76A 1JE4A 1VQLA 1PH5A 4KN7C 4UPAA 2MNAA 4Y7NB 2Z1CA 4K6DA 1J5EL 2AKWB 1EYDA 1RJTA 2F0SA 1YNXA 4Y7NH 3R2IA 4NW2A 5LHY1 1GVPA 4MNOA 1HQMC 1PVOA 3CC4A 2LXKA 3V05A 1JICA 4YHHL 1SNMA 4F7XA 4JI1L 4B9XA 2KCMA 4JVZA 2ZXPA 1VQOA 1DD2A 1K8MA 3W3AA 3D3RA 3G48A 4EX5A 3CRLC 3OYYA 1IHZA 2CQAA 1B50A 4DV5L 3GV6A 1RHPA 4IPDA 1FL0A 1A8VA 2KEDA 2L4NA 4A3KG 2DUDA 3ZJYC 2ENBA 4B3MQ 5C4HA 3OIPA 4KJNA 1CI3M 1A6XA 2VZAA 3C1EA 1PLFA 3F2DA 1HR0L 4JI6Q 3KDFA 2DJFC 2L9HA 3S14H 3H3VH 4HIMA 4X6AH 3EROA 2Q8RE 3FKIG 4NXNQ 4P73A 3PUWA 2HQLA 5IP9G 3D4RA 3BVMA 2HCCA 5E3FA 3DWAA 1B70B 3RLFA 4K14A 4XDXA 4ZYSA 1KDAA 1Q1BA 3VYUA 3U4ZA 4IURA 3P7JA 5M3FG 4IQZA 2D62A 2JXMB 1SSOA 2B2YA 5F2DA 2F0EA 1G2TA 3NE5B 4JI2Q 1M90C 1VQ5A 3HKZB 4NMZA 4X3KA 4IO9A 4P71A 3GTQB 1SNCA 4IPGA 4ODGA 1SE4A 2V1CC 3ULPA 5C44B 1WTVA 1IBLL 1JWMD 4XTCS 2B8GA 2EYLA 2VQEQ 3GTQH 5HURA 5C44H 5G3LF 2D0OA 4JI0L 2NVTB 1K0SA 4DR7Q 3TDQA 3PO3G 2A6ED 4F87A 2NVTH 2F0TA 5CV6A 1STNA 2ALYB 2DY7A 1IBKL 2BH2A 1WCMG 4DR3L 5C4ZA 4IUUA 3E9IA 4RCNA 3J7YW 2ZJPA 5IYDH 4OEMB 4J15A 4LW1A 1X56A 4CHTB 4A3JG 3A54A 3NTIA 3IL8A 1HZCA 3MXUA 1U4PA 5EQ0A 3HFZB 3KLWA 1Q86C 2CFMA 5EBDA 3FP9A 3NBIA 3NHHA 3V2TA 1G91A 4YWMA 2WACA 1KABA 1TS5A 4GLAC 5E4XA 3CC7A 4DR5L 1KXLA 4X65L 2CCZA 2MO1A 3I90A 1NMGA 1L1OC 1STHA 2DN8A 3NUCA 4IPCA 1AE2A 4JYAQ 1HCZA 3B6YA 4WRDA 2O5JC 2Q8TA 1HR0W 3LWUA 3KBXA 1O80A 1A2UA 1BBWA 1Z47A 1FYCA 1KRSA 1VQFA 4YWKA 3K57A 1EZ6A 4DV4Q 2OEOA 4IALA 1YJ9A 1CM9A 1CKNA 1SRUA 2A19A 1C48A 1BKBA 2SDFA 1EYAA 2RQXA 1HTLD 2K5QA 1N32Q 5ELNA 5ISRA 3OIQA 1EQVA 4A3LH 1ET9A 3K7AB 5NUCA 3BYTB 2B2TC 2N88A 2IHFA 2H5XA 2RF4A 2EYOA 1YNJC 4KHVA 1M8AA 2OT2A 4H7BA 3CCJA 2R7FA 3K7AH 5J39A 3R93A 1YJWA 2ZTCA 2B2UC 2XN9C 2J4XA 4GOPC 1TQOA 2F0VA 2E8GA 5IGEA 5HGQA 5FOBB 2R7DA 1K0RA 1Q7YC 3SGIA 4EQPA 1PRTB 1AW7A 3K7UC 3I7FA 4Z9CB 5M3MG 4A3CG 2JYOA 3VA7A 1PZJD 2E2JB 4CDCC 2JEBI 2IX1A 2AUJD 3J7A5 1UE6A 1J5EQ 3GQBA 1CQVA 2HDMA 2E2JH 1YNNC 4KHPQ 3C1FA 3PCOB 2PQAA 1HZBA 3HOXG 1X65A 3PUYA 3OPOA 1X54A 2LY7A 1A2TA 5KYIA 5IYCG 1WTWA 1FNVA 1SR3A 1TS2A 1VQEA 4YHHQ 2AUKA 1T5EA 4JI1Q 2EDGA 4DFAA 3J81i 4KI0A 1WTHA 4NP5A 4AIMA 2A73B 1FGUA 1X3PA 5E7NA 1A3UA 1VDZA 2ZTEA 4BS9A 1F9SA 2OTLA 2Z4IA 2N55A 2SOBA 3FEWX 4CKBA 2YTXA 4K5WA 2VQFQ 1PH1A 3JAMc 1GD7A 4JBWA 5IGGA 5IGDA 1J8IA 4A4IA 1N9WA 1YVCA 3BDCA 1I4QA 5D14A 3GDEA 1D2BA 1VQAA 4N9PA 1HR0Q 3SK6A 3LNNA 1CK1A 1WOCA 2FMMA 1V9PA 4A75A 3L7ZC 3M9BA 1QNUA 4ZQ3A 2E76C 2A1AA 3D4DA 5I6YA 3P75A 2DJGC 2WINB 2K5NA 1MSHA 3CCSA 3PF4A 2A6HC 4A3KB 3QO2A 2K5WA 1K28A 1PTOF 2G5DA 3MXGA 3LGJA 4A3KH 2PW5A 1CHQD 2QGQA 1L1OB 4LF4Q 4P75A 2MHVA 4R4OA 4RWSC 4RGTA 2Z4HA 1MHWC 3Q22A 2KBNA 1OXUA 1QCBD 1ZYRD 3RLNA 3JAMi 4A93G 3SVMA 3E9HA 5I2XA 2BA0A 1JOOA 2F0LA 2K75A 1XNRQ 4ALPA 5M3FB 2MP1A 2JN4A 1S5CD 2DGYA 1VQPA 4RFBA 4GN3B 2SNMA 3H91A 2N8NA 4P72A 4GZYC 1TWGB 3ND9A 4KLKA 4LWCA 3CCLA 1HUNA 4QCLA 3OOCA 5M3FH 1H9SA 1K8OA 2QEXA 2F0KA 1IBKQ 4JI3Q 1TWGH 3CQZB 4DR3Q 4LF5L 2B2WA 2H4OA 1JB7A 4GKJQ 3N52A 2FINB 1GUGA 1IZ6A 3BZCA 4DN4M 3GD7A 4JOIC 2NVXB 5KYLA 2KVMA 5BR8Q 2RCFA 4GOPB 3CQZH 3PF5A 4JCVE 4XXEA 5FO7B 5I2YA 3GTPB 2E2HB 2FFKB 2A69C 1EY9A 4A3DG 1AE3A 4H13C 2NVXH 5ELDA 1S5FD 1YJNA 2JK8A 3GTPH 1I94L 2E2HH 3PO3B 1HJPA 2OXPA 2NWGA 4CBVA 1WCMB 4FDBA 3PO3H 1SJHD 3T53B 4X65Q 2F0DA 4ILWA 1QVFA 3MTSA
chains in the Genus database with same CATH topology
4PMWA 1L1OA 3G71A 1YEZA 2EXDA 2PI2E 2ZM6L 2FXQA 3VDYA 3G6EA 1GKHA 4A3LG 4YWLA 3F2CA 2OWOA 4IFDJ 2KHIA 3T1YL 1MIUA 2IY5B 1OXTA 1TWCH 1PH4A 4AYBG 3CC2A 1W2BA 1QVGA 4LF8L 1I5FA 5IYBG 1PYBA 1UE1A 5HY6A 3J81j 4A3JH 4LF4L 4LF6L 2E2IH 3EBEA 2F3IA 3AEVA 1PH6A 2ATWA 4BBRH 3J7ZC 4DV5Q 2VL6A 4QY7A 2VS1A 3I55A 1XNQL 4IFDI 2BH8A 1PH9A 1VQIA 4YCUA 5M5XH 4DR1Q 4UP7A 5M5WH 5LMUL 1E24A 1W3SA 4RMFA 4DV4L 1GM5A 3GTGH 3ICEA 4JI5L 3K0XA 4DV2L 4BY7H 4LF7Q 2BA1A 3I56A 1XNRL 2I5HA 1YHAA 2UUCQ 1PFSA 4MTNA 1CKNB 1N36Q 1X3GA 1N32L 1QVCA 4L5TA 2B3GA 4QL5A 3IRBA 4JI7L 3A74A 2AWNA 1HNZQ 3I2ZA 4EQ5A 3KJOA 5JEAG 3KDFB 4GOPA 1C7YA 4JI3L 3HOVG 1Q1EA 1YHQA 1I50H 1KHIA 2R7ZH 2PNHA 2JA7H 4GKJL 4B3SL 3PIOA 3CCUA 1ASZA 3KYHC 4GN5A 1N34Q 3TEHB 2NN6G 3ULLA 3CCMA 1CUKA 4GLXA 4PZ8A 5BR8L 1K83H 4X64L 2ZJRA 3CAMA 3ER0A 3CPFA 2I5LX 3M7NA 1VQ8A 1V43A 2JA8H 4A76A 1E3PA 4DV1Q 2YU9H 1VQLA 1WI5A 3CCVA 1PH5A 2JA9A 4BBSH 1HNWL 4X62L 3KFUA 4UPAA 4DUYL 1JJCB 1RIPA 1VQCA 4QGUA 2MNAA 2PMZE 2HIXA 3TREA 4DV7Q 4AH6A 4IJHA 2JA5G 5FJ8G 1LM0A 5IWAQ 2Y0SG 1J5EL 2AKWB 3K8AA 3CD6A 4LUVA 5IY0A 2Q2UA 1IBLQ 1LTLA 1YNXA 3NEMA 4Y7NH 1L0WA 1M1KC 4IOAA 3HOUH 3FKIH 2PQAB 1GVPA 1KC8C 4HJ9A 4MNOA 3UE0A 4OX9Q 1XTDA 5IP9H 2B29A 2NVQH 1PVOA 3CC4A 1PH8A 1VQNA 4UP9A 3T1HL 2LXKA 4JI0Q 1QZGA 3TS2A 4YHHL 3PUVA 4PG3A 4JI1L 4BA1I 1PH2A 2KCMA 3PUXA 2JA6H 2HIVA 1UWVA 3RR5A 1N8RC 4YCWA 5M3MH 4A3CH 5GADC 1VQOA 3M4OH 1SFOH 3HOWG 4JV5L 4BY1G 1JT8A 2JE6I 4LFBL 4A3BH 3PV0A 3S24A 1K73C 3G48A 4EX5A 4JBJA 3OYYA 4IPHA 5C4XH 5FLMH 4DV3L 4POGA 1HZAA 1V1QA 3HOYH 4DV5L 1EIYB 4DR4Q 4IPDA 1D8LA 1FL0A 3HOXH 1A8VA 4A3KG 2DUDA 1OXSC 2EIFA 3ZJYC 3RN5A 4B3MQ 2ID0A 4WJ4A 4NXML 3GTMH 1Q8KA 1Y1WG 3UE1A 4GS3A 4C3JH 3J81c 2UUBQ 1G51A 1PH3A 3I4NG 1JJGA 3M4PA 3CCEA 2Q2IA 2E5LL 4OWXB 2VZAA 4GNXA 4LF7L 3F2DA 1KD1C 1HR0L 4JI6Q 1CKOA 3KDFA 1IL2A 3HOZG 3S1QH 1Y1VH 2N78A 3S14H 1N33Q 4DUZL 5AJ3L 1Z9FA 1O7IA 3GTKH 3TQYA 2RCNA 3H3VH 1VQGA 4HIMA 4X6AH 4A3FG 2C35B 4L5SA 4A3EG 3CMEA 3GTJH 1DGSA 1EIFA 2N49A 3FKIG 4DR5Q 4JI4L 4NXNQ 4P73A 3PUWA 2GN5A 2HQLA 4A3IH 3S2HH 2N3SA 5EAYA 2I5MX 5IP9G 5JJLA 4PZ7A 1XMQL 5GAEC 1K9MC 2RHQB 2VW9A 1B70B 2JQOA 1WCMH 1E7ZA 3RLFA 4DNIA 3CF5A 1QUQB 4GN4B 1Q1BA 3G4SA 1KL9A 3U4ZA 5M3FG 5LMNL 1P16A 2UXBQ 2D62A 3A5UA 3PUZA 2MO0A 3S1RH 2AWOA 5IP7G 3W1GA 2QA4A 4X66L 1PYSB 4DV1L 1XPOA 1JE5A 4JI2Q 1M90C 2R92H 3H0GH 3CMAA 2K14A 1VQ5A 3HOYG 2IT1A 1EOVA 3D31A 1SMXA 2UXDL 4H02A 4XIGS 4UY8C 4B3TL 2VNUD 4DK6C 3CW2C 4IO9A 4P71A 1VQDA 4LNQA 5IWAL 5M5YH 4OONA 3RZOH 4IPGA 4TVAB 2V1CC 4NPSA 3ULPA 1G6PA 1IBLL 1T9HA 2R93G 4XTCS 3KF6A 2VQEQ 3STBD 1WYDA 2UU9Q 4LUOA 3BZKA 5DLQE 3GTQH 5ELOA 4YY3L 2Q2HA 5C44H 1HNXL 2CQOA 3UDIA 1VQ4A 2HHHQ 1KAWA 4DR6L 1SROA 2D0OA 4DV0L 4A3MH 4JI0L 3J80c 1PH7A 4DR7Q 3E0EA 4HIOA 3PO3G 3ULJA 4LF9L 2Q2TA 4OWWB 2WP8J 1YHBA 2NVTH 1NMFA 2ALYB 1IBKL 2YYZA 4JOIA 2BH2A 1XPUA 5K36G 3PSIA 1WCMG 3UDFA 5JJKA 1IBMQ 4DR3L 1S72A 4LFAL 2UXCQ 2Z6KA 4A93H 1FVIA 3E9IA 4UP8A 1EYGA 1FJGL 1BBUA 2UUAL 2ZJPA 2HT1A 2L15A 3U4VA 5IYDH 2KENA 3GO5A 3MEFA 2EQSA 4J15A 2OQ0A 4LW1A 1LUZA 1EQQA 4AYBE 1I94Q 1X56A 2UUBL 1G291 3PGZA 4A3JG 3WWVA 2LSSA 4GKKQ 3H0GG 3CPWA 1HZCA 1PA6A 3HFZB 1AH9A 3KLWA 1Q86C 2CFMA 3FP9A 3NENA 5J3BA 4BBRG 2WB1G 1A62A 1TWHH 4R4TA 4YWMA 1XMOQ 3PO2H 3OTOL 1X55A 4GLAC 3CC7A 2K5HA 3S1NH 4OO1I 4DR5L 4NXNL 2ZM6Q 1MJCA 3DLLA 4JG2A 4K0KL 4BY7G 4R4IA 1C0AA 3A5ZB 1A0IA 1YZ6A 4X65L 1VQ7A 2CCZA 4B3RL 2MO1A 3I4MH 5C44G 1NMGA 2WAQG 3H3VI 1L1OC 5C0XG 4DR2Q 5GAHC 4LF8Q 4A3DH 4IPCA 1AE2A 4P74A 4LF6Q 1OXXK 3B6YA 1MJEA 4JYAQ 3J80i 3UDXA 1HR0W 1XPRA 1VQHA 1CSQA 1BBWA 1Z47A 2NVYH 2B63H 2R7ZG 1YITA 3L0OA 2JA7G 4JI2L 4BXXH 5C3EH 4R1JA 1KRSA 4BA2I 1VQFA 4YWKA 1S3OA 3HKZE 1Q46A 5JEAJ 3GTOH 2YV5A 4DV4Q 4DKAC 3TRZA 1E1TA 4A3GH 2OTJA 1YJ9A 4LFCQ 4QQBX 1CKNA 1SRUA 4O2DA 2A19A 4L5RC 4OXPA 1BKBA 4DV6Q 4IFDG 4C3HH 2OCEA 4HIDA 4DR1L 1JJ2A 3U50C 2JA8G 1N32Q 4BBSG 1X3FA 3AYHB 1CKMA 5ELNA 5IYCH 2UU9L 1YIJA 4C3IH 3BJUA 4HJ5A 3RNUA 4A3LH 1BVSA 3AQQA 2UUCL 2K4KA 4JBMA 2HHHL 5LMNW 2IHFA 1N36L 2H5XA 2RF4A 4DK3C 1TWAH 2RHSB 2Y0SE 3CCJA 2R7FA 5IYBH 1VQ6A 3K7AH 2VUMH 2A8VA 2NN6I 3CCQA 1UE7A 2PI2A 4DAYB 1YJWA 1HNZL 2ZTCA 1JMCA 4B3SQ 3HOUG 4GOPC 3KF8B 1SLJA 4JC0A 3M85A 2E8GA 3BU2A 1WJJA 4X64Q 1IBML 1UEBA 2MQHA 5HGQA 1H95A 2IHEA 2R7DA 1K0RA 1Q7YC 1VQBA 3SGIA 1OTCA 3K7UC 3I7FA 3UDGA 1N34L 1TXYA 1VCIA 3DM3A 2JA6G 1HNWQ 5M3MG 4A3CG 1LYLA 4X62Q 4DUYQ 5H1SE 2JEBI 1YI2A 1YBYA 3M4QA 2IX1A 4A3BG 1E1OA 3J7A5 1UE6A 1VQ9A 3PIPA 1J5EQ 5C4XG 3CP0A 4JI8Q 5FLMG 2E2JH 1Q81C 2CWAA 4KHPQ 3PCOB 2PQAA 1HZBA 4R4CA 3HOXG 1X6OA 1X65A 2CKZB 4DV7L 1XMOL 1PHJA 3PUYA 3S15H 1QZHA 1HH2P 1X54A 2OQKA 3EN2A 4O0AA 4R4QA 2JEAI 3M3YH 1KRTA 3HOVH 3I4OA 5IYCG 4OO1G 3T1HQ 1SR3A 1NJIC 2F4VQ 4L5QA 1VQEA 4YHHQ 2YTYA 4JI1Q 3J81i 1Y1VG 4OX9L 4HIKA 4KI0A 4HJ8A 1SE8A 4AIMA 4DR2L 1VQKA 1OXVA 4JV5Q 1FGUA 4LFBQ 1K3RA 4JYAL 4JBKA 5E7NA 2VUMG 2ZTEA 3RZDH 4RG1A 2OTLA 3U58A 1VQJA 4LF5Q 1CSPA 3MXNB 3F2BA 2YTXA 1VQMA 4DV3Q 2VQFQ 4A3IG 2AMCB 1PH1A 4MZ9A 1B8AA 4WJ3M 2I0QA 3JAMc 4Y52H 1GD7A 2VY3A 4JBWA 3CXCA 2JA5H 5FJ8H 4AQYQ 1EWIA 4A4IA 3A0JA 1EUJA 1N9WA 4NXMQ 1YVCA 1KQSA 3NELA 4DR4L 3GDEA 4LFCL 3AFPA 2K50A 4HJ7A 3EIVA 3L2PA 2E5LQ 4B3ML 1VQAA 1HR0Q 3S1MH 3S16H 4PZ6A 4YCVA 3JC66 1WOCA 4DV6L 2R6GA 4DUZQ 3F1ZA 3W5OA 5AJ3Q 1P8LA 1V9PA 3S2DH 2XTIA 3L7ZC 1NBWA 3M9BA 4IOCA 4A75A 4GNXC 2R92G 1SN8A 4JI6L 3ERSX 2A1AA 4NB3A 4GNXB 5IT9c 1N33L 4JI4Q 3GTLH 1PV4A 2K5NA 3HOWH 4BY1H 4LUZA 3HKSA 2MFIA 3CCSA 2NZHA 3PF4A 1L2FA 1XMQQ 3HKZG 3H15A 2D0PA 1QUQA 1C9OA 5FLXc 2ES2A 2KHJA 3LGJA 1EFWA 2GVBA 5LMNQ 1S40A 4A3KH 1MKHA 3T1YQ 4A3MG 2IX0A 5C4JH 1NTGA 2QGQA 3W1BA 4APVA 1K8AC 1KIXA 1L1OB 2KCTA 4X66Q 1Y1WH 3FHWA 4LF4Q 3I4NH 4P75A 2UXBL 3F8TA 4R4OA 5IE8A 2LXJA 2UXDQ 3HOZH 4B3TQ 3RLOA 2KBNA 1OXUA 1ASYA 4JI8L 1XNQQ 3RLNA 3JAMi 1KXLA 4A3FH 4KHPL 4A93G 2ZTDA 4A3EH 2NZOA 1R9TH 4KHZA 1U5KA 3E9HA 5LMUQ 2BA0A 3KJPA 2AHOB 5IYDG 4JI5Q 4DV2Q 2K75A 4QJFA 4YY3Q 4ALPA 1XNRQ 1HNXQ 2DGYA 2F4VL 1VQPA 3CCRA 4DR6Q 4DV0Q 1IYJB 5JJIA 4GN3B 2VQEL 2ASBA 2N8NA 4P72A 3OW2A 3KF6B 4LWCA 4KLKA 3CCLA 2Z0SA 2JJQA 1EQRA 4LF9Q 1RL2A 5M3FH 5GROA 1X9NA 3PO2G 4JI7Q 1NE3A 2QEXA 2WB1E 2K5VA 4HJAA 1X3EA 3D0FA 1Q82C 1A63A 5IP7H 1IBKQ 3K81C 4GLVB 3AFQA 4JI3Q 1TWGH 4DR7L 3TS0A 4DR3Q 4LF5L 4LFAQ 2K52A 2VQFL 1JB7A 4GKJQ 1WFQA 4DPGA 3I4MG 1FJGQ 1IZ6A 1HZ9A 3BZCA 2WFWA 3GD7A 4JOIC 2UUAQ 1D7QA 5BR8Q 1J6QA 2WAQE 4TQUS 4C2MH 4GOPB 3CQZH 3STBC 4AQYL 4JCVE 3PF5A 2UXCL 2Z6KC 1TWFH 2YTVA 3NBHB 3RN2A 4A3DG 1AE3A 1I3QH 5GAGC 2R93H 3K80C 3KOJA 2NVXH 5C0XJ 4QIWE 1XJVA 1Q12A 1YJNA 2JK8A 3GTPH 1I94L 2CWPA 1VS0A 2E2HH 2ZJQA 2B63G 1HJPA 1Y14B 4BXXG 1NY4A 4OWTB 5C3EG 1GO3E 2XGTA 3Q8DA 3OTOQ 4GKKL 1K8GA 1IXRA 5GQOA 1B7YB 1I6HH 4FDBA 1UE5A 2F52A 3PO3H 4DAMA 4A3GG 4K0KQ 4ME3A 4B3RQ 1E22A 4X65Q 3S17H 1U0LA 2GVAA 4IJLA 5C0XI 4POFA 1QVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMW A;  1L1O A;  3G71 A;  1YEZ A;  2EXD A;  2PI2 E;  2ZM6 L;  2FXQ A;  3VDY A;  3G6E A;  1GKH A;  4A3L G;  4YWL A;  3F2C A;  2OWO A;  4IFD J;  2KHI A;  3T1Y L;  1MIU A;  2IY5 B;  1OXT A;  1TWC H;  1PH4 A;  4AYB G;  3CC2 A;  1W2B A;  1QVG A;  4LF8 L;  1I5F A;  5IYB G;  1PYB A;  1UE1 A;  5HY6 A;  3J81 j;  4A3J H;  4LF4 L;  4LF6 L;  2E2I H;  3EBE A;  2F3I A;  3AEV A;  1PH6 A;  2ATW A;  4BBR H;  3J7Z C;  4DV5 Q;  2VL6 A;  4QY7 A;  2VS1 A;  3I55 A;  1XNQ L;  4IFD I;  2BH8 A;  1PH9 A;  1VQI A;  4YCU A;  5M5X H;  4DR1 Q;  4UP7 A;  5M5W H;  5LMU L;  1E24 A;  1W3S A;  4RMF A;  4DV4 L;  1GM5 A;  3GTG H;  3ICE A;  4JI5 L;  3K0X A;  4DV2 L;  4BY7 H;  4LF7 Q;  2BA1 A;  3I56 A;  1XNR L;  2I5H A;  1YHA A;  2UUC Q;  1PFS A;  4MTN A;  1CKN B;  1N36 Q;  1X3G A;  1N32 L;  1QVC A;  4L5T A;  2B3G A;  4QL5 A;  3IRB A;  4JI7 L;  3A74 A;  2AWN A;  1HNZ Q;  3I2Z A;  4EQ5 A;  3KJO A;  5JEA G;  3KDF B;  4GOP A;  1C7Y A;  4JI3 L;  3HOV G;  1Q1E A;  1YHQ A;  1I50 H;  1KHI A;  2R7Z H;  2PNH A;  2JA7 H;  4GKJ L;  4B3S L;  3PIO A;  3CCU A;  1ASZ A;  3KYH C;  4GN5 A;  1N34 Q;  3TEH B;  2NN6 G;  3ULL A;  3CCM A;  1CUK A;  4GLX A;  4PZ8 A;  5BR8 L;  1K83 H;  4X64 L;  2ZJR A;  3CAM A;  3ER0 A;  3CPF A;  2I5L X;  3M7N A;  1VQ8 A;  1V43 A;  2JA8 H;  4A76 A;  1E3P A;  4DV1 Q;  2YU9 H;  1VQL A;  1WI5 A;  3CCV A;  1PH5 A;  2JA9 A;  4BBS H;  1HNW L;  4X62 L;  3KFU A;  4UPA A;  4DUY L;  1JJC B;  1RIP A;  1VQC A;  4QGU A;  2MNA A;  2PMZ E;  2HIX A;  3TRE A;  4DV7 Q;  4AH6 A;  4IJH A;  2JA5 G;  5FJ8 G;  1LM0 A;  5IWA Q;  2Y0S G;  1J5E L;  2AKW B;  3K8A A;  3CD6 A;  4LUV A;  5IY0 A;  2Q2U A;  1IBL Q;  1LTL A;  1YNX A;  3NEM A;  4Y7N H;  1L0W A;  1M1K C;  4IOA A;  3HOU H;  3FKI H;  2PQA B;  1GVP A;  1KC8 C;  4HJ9 A;  4MNO A;  3UE0 A;  4OX9 Q;  1XTD A;  5IP9 H;  2B29 A;  2NVQ H;  1PVO A;  3CC4 A;  1PH8 A;  1VQN A;  4UP9 A;  3T1H L;  2LXK A;  4JI0 Q;  1QZG A;  3TS2 A;  4YHH L;  3PUV A;  4PG3 A;  4JI1 L;  4BA1 I;  1PH2 A;  2KCM A;  3PUX A;  2JA6 H;  2HIV A;  1UWV A;  3RR5 A;  1N8R C;  4YCW A;  5M3M H;  4A3C H;  5GAD C;  1VQO A;  3M4O H;  1SFO H;  3HOW G;  4JV5 L;  4BY1 G;  1JT8 A;  2JE6 I;  4LFB L;  4A3B H;  3PV0 A;  3S24 A;  1K73 C;  3G48 A;  4EX5 A;  4JBJ A;  3OYY A;  4IPH A;  5C4X H;  5FLM H;  4DV3 L;  4POG A;  1HZA A;  1V1Q A;  3HOY H;  4DV5 L;  1EIY B;  4DR4 Q;  4IPD A;  1D8L A;  1FL0 A;  3HOX H;  1A8V A;  4A3K G;  2DUD A;  1OXS C;  2EIF A;  3ZJY C;  3RN5 A;  4B3M Q;  2ID0 A;  4WJ4 A;  4NXM L;  3GTM H;  1Q8K A;  1Y1W G;  3UE1 A;  4GS3 A;  4C3J H;  3J81 c;  2UUB Q;  1G51 A;  1PH3 A;  3I4N G;  1JJG A;  3M4P A;  3CCE A;  2Q2I A;  2E5L L;  4OWX B;  2VZA A;  4GNX A;  4LF7 L;  3F2D A;  1KD1 C;  1HR0 L;  4JI6 Q;  1CKO A;  3KDF A;  1IL2 A;  3HOZ G;  3S1Q H;  1Y1V H;  2N78 A;  3S14 H;  1N33 Q;  4DUZ L;  5AJ3 L;  1Z9F A;  1O7I A;  3GTK H;  3TQY A;  2RCN A;  3H3V H;  1VQG A;  4HIM A;  4X6A H;  4A3F G;  2C35 B;  4L5S A;  4A3E G;  3CME A;  3GTJ H;  1DGS A;  1EIF A;  2N49 A;  3FKI G;  4DR5 Q;  4JI4 L;  4NXN Q;  4P73 A;  3PUW A;  2GN5 A;  2HQL A;  4A3I H;  3S2H H;  2N3S A;  5EAY A;  2I5M X;  5IP9 G;  5JJL A;  4PZ7 A;  1XMQ L;  5GAE C;  1K9M C;  2RHQ B;  2VW9 A;  1B70 B;  2JQO A;  1WCM H;  1E7Z A;  3RLF A;  4DNI A;  3CF5 A;  1QUQ B;  4GN4 B;  1Q1B A;  3G4S A;  1KL9 A;  3U4Z A;  5M3F G;  5LMN L;  1P16 A;  2UXB Q;  2D62 A;  3A5U A;  3PUZ A;  2MO0 A;  3S1R H;  2AWO A;  5IP7 G;  3W1G A;  2QA4 A;  4X66 L;  1PYS B;  4DV1 L;  1XPO A;  1JE5 A;  4JI2 Q;  1M90 C;  2R92 H;  3H0G H;  3CMA A;  2K14 A;  1VQ5 A;  3HOY G;  2IT1 A;  1EOV A;  3D31 A;  1SMX A;  2UXD L;  4H02 A;  4XIG S;  4UY8 C;  4B3T L;  2VNU D;  4DK6 C;  3CW2 C;  4IO9 A;  4P71 A;  1VQD A;  4LNQ A;  5IWA L;  5M5Y H;  4OON A;  3RZO H;  4IPG A;  4TVA B;  2V1C C;  4NPS A;  3ULP A;  1G6P A;  1IBL L;  1T9H A;  2R93 G;  4XTC S;  3KF6 A;  2VQE Q;  3STB D;  1WYD A;  2UU9 Q;  4LUO A;  3BZK A;  5DLQ E;  3GTQ H;  5ELO A;  4YY3 L;  2Q2H A;  5C44 H;  1HNX L;  2CQO A;  3UDI A;  1VQ4 A;  2HHH Q;  1KAW A;  4DR6 L;  1SRO A;  2D0O A;  4DV0 L;  4A3M H;  4JI0 L;  3J80 c;  1PH7 A;  4DR7 Q;  3E0E A;  4HIO A;  3PO3 G;  3ULJ A;  4LF9 L;  2Q2T A;  4OWW B;  2WP8 J;  1YHB A;  2NVT H;  1NMF A;  2ALY B;  1IBK L;  2YYZ A;  4JOI A;  2BH2 A;  1XPU A;  5K36 G;  3PSI A;  1WCM G;  3UDF A;  5JJK A;  1IBM Q;  4DR3 L;  1S72 A;  4LFA L;  2UXC Q;  2Z6K A;  4A93 H;  1FVI A;  3E9I A;  4UP8 A;  1EYG A;  1FJG L;  1BBU A;  2UUA L;  2ZJP A;  2HT1 A;  2L15 A;  3U4V A;  5IYD H;  2KEN A;  3GO5 A;  3MEF A;  2EQS A;  4J15 A;  2OQ0 A;  4LW1 A;  1LUZ A;  1EQQ A;  4AYB E;  1I94 Q;  1X56 A;  2UUB L;  1G29 1;  3PGZ A;  4A3J G;  3WWV A;  2LSS A;  4GKK Q;  3H0G G;  3CPW A;  1HZC A;  1PA6 A;  3HFZ B;  1AH9 A;  3KLW A;  1Q86 C;  2CFM A;  3FP9 A;  3NEN A;  5J3B A;  4BBR G;  2WB1 G;  1A62 A;  1TWH H;  4R4T A;  4YWM A;  1XMO Q;  3PO2 H;  3OTO L;  1X55 A;  4GLA C;  3CC7 A;  2K5H A;  3S1N H;  4OO1 I;  4DR5 L;  4NXN L;  2ZM6 Q;  1MJC A;  3DLL A;  4JG2 A;  4K0K L;  4BY7 G;  4R4I A;  1C0A A;  3A5Z B;  1A0I A;  1YZ6 A;  4X65 L;  1VQ7 A;  2CCZ A;  4B3R L;  2MO1 A;  3I4M H;  5C44 G;  1NMG A;  2WAQ G;  3H3V I;  1L1O C;  5C0X G;  4DR2 Q;  5GAH C;  4LF8 Q;  4A3D H;  4IPC A;  1AE2 A;  4P74 A;  4LF6 Q;  1OXX K;  3B6Y A;  1MJE A;  4JYA Q;  3J80 i;  3UDX A;  1HR0 W;  1XPR A;  1VQH A;  1CSQ A;  1BBW A;  1Z47 A;  2NVY H;  2B63 H;  2R7Z G;  1YIT A;  3L0O A;  2JA7 G;  4JI2 L;  4BXX H;  5C3E H;  4R1J A;  1KRS A;  4BA2 I;  1VQF A;  4YWK A;  1S3O A;  3HKZ E;  1Q46 A;  5JEA J;  3GTO H;  2YV5 A;  4DV4 Q;  4DKA C;  3TRZ A;  1E1T A;  4A3G H;  2OTJ A;  1YJ9 A;  4LFC Q;  4QQB X;  1CKN A;  1SRU A;  4O2D A;  2A19 A;  4L5R C;  4OXP A;  1BKB A;  4DV6 Q;  4IFD G;  4C3H H;  2OCE A;  4HID A;  4DR1 L;  1JJ2 A;  3U50 C;  2JA8 G;  1N32 Q;  4BBS G;  1X3F A;  3AYH B;  1CKM A;  5ELN A;  5IYC H;  2UU9 L;  1YIJ A;  4C3I H;  3BJU A;  4HJ5 A;  3RNU A;  4A3L H;  1BVS A;  3AQQ A;  2UUC L;  2K4K A;  4JBM A;  2HHH L;  5LMN W;  2IHF A;  1N36 L;  2H5X A;  2RF4 A;  4DK3 C;  1TWA H;  2RHS B;  2Y0S E;  3CCJ A;  2R7F A;  5IYB H;  1VQ6 A;  3K7A H;  2VUM H;  2A8V A;  2NN6 I;  3CCQ A;  1UE7 A;  2PI2 A;  4DAY B;  1YJW A;  1HNZ L;  2ZTC A;  1JMC A;  4B3S Q;  3HOU G;  4GOP C;  3KF8 B;  1SLJ A;  4JC0 A;  3M85 A;  2E8G A;  3BU2 A;  1WJJ A;  4X64 Q;  1IBM L;  1UEB A;  2MQH A;  5HGQ A;  1H95 A;  2IHE A;  2R7D A;  1K0R A;  1Q7Y C;  1VQB A;  3SGI A;  1OTC A;  3K7U C;  3I7F A;  3UDG A;  1N34 L;  1TXY A;  1VCI A;  3DM3 A;  2JA6 G;  1HNW Q;  5M3M G;  4A3C G;  1LYL A;  4X62 Q;  4DUY Q;  5H1S E;  2JEB I;  1YI2 A;  1YBY A;  3M4Q A;  2IX1 A;  4A3B G;  1E1O A;  3J7A 5;  1UE6 A;  1VQ9 A;  3PIP A;  1J5E Q;  5C4X G;  3CP0 A;  4JI8 Q;  5FLM G;  2E2J H;  1Q81 C;  2CWA A;  4KHP Q;  3PCO B;  2PQA A;  1HZB A;  4R4C A;  3HOX G;  1X6O A;  1X65 A;  2CKZ B;  4DV7 L;  1XMO L;  1PHJ A;  3PUY A;  3S15 H;  1QZH A;  1HH2 P;  1X54 A;  2OQK A;  3EN2 A;  4O0A A;  4R4Q A;  2JEA I;  3M3Y H;  1KRT A;  3HOV H;  3I4O A;  5IYC G;  4OO1 G;  3T1H Q;  1SR3 A;  1NJI C;  2F4V Q;  4L5Q A;  1VQE A;  4YHH Q;  2YTY A;  4JI1 Q;  3J81 i;  1Y1V G;  4OX9 L;  4HIK A;  4KI0 A;  4HJ8 A;  1SE8 A;  4AIM A;  4DR2 L;  1VQK A;  1OXV A;  4JV5 Q;  1FGU A;  4LFB Q;  1K3R A;  4JYA L;  4JBK A;  5E7N A;  2VUM G;  2ZTE A;  3RZD H;  4RG1 A;  2OTL A;  3U58 A;  1VQJ A;  4LF5 Q;  1CSP A;  3MXN B;  3F2B A;  2YTX A;  1VQM A;  4DV3 Q;  2VQF Q;  4A3I G;  2AMC B;  1PH1 A;  4MZ9 A;  1B8A A;  4WJ3 M;  2I0Q A;  3JAM c;  4Y52 H;  1GD7 A;  2VY3 A;  4JBW A;  3CXC A;  2JA5 H;  5FJ8 H;  4AQY Q;  1EWI A;  4A4I A;  3A0J A;  1EUJ A;  1N9W A;  4NXM Q;  1YVC A;  1KQS A;  3NEL A;  4DR4 L;  3GDE A;  4LFC L;  3AFP A;  2K50 A;  4HJ7 A;  3EIV A;  3L2P A;  2E5L Q;  4B3M L;  1VQA A;  1HR0 Q;  3S1M H;  3S16 H;  4PZ6 A;  4YCV A;  3JC6 6;  1WOC A;  4DV6 L;  2R6G A;  4DUZ Q;  3F1Z A;  3W5O A;  5AJ3 Q;  1P8L A;  1V9P A;  3S2D H;  2XTI A;  3L7Z C;  1NBW A;  3M9B A;  4IOC A;  4A75 A;  4GNX C;  2R92 G;  1SN8 A;  4JI6 L;  3ERS X;  2A1A A;  4NB3 A;  4GNX B;  5IT9 c;  1N33 L;  4JI4 Q;  3GTL H;  1PV4 A;  2K5N A;  3HOW H;  4BY1 H;  4LUZ A;  3HKS A;  2MFI A;  3CCS A;  2NZH A;  3PF4 A;  1L2F A;  1XMQ Q;  3HKZ G;  3H15 A;  2D0P A;  1QUQ A;  1C9O A;  5FLX c;  2ES2 A;  2KHJ A;  3LGJ A;  1EFW A;  2GVB A;  5LMN Q;  1S40 A;  4A3K H;  1MKH A;  3T1Y Q;  4A3M G;  2IX0 A;  5C4J H;  1NTG A;  2QGQ A;  3W1B A;  4APV A;  1K8A C;  1KIX A;  1L1O B;  2KCT A;  4X66 Q;  1Y1W H;  3FHW A;  4LF4 Q;  3I4N H;  4P75 A;  2UXB L;  3F8T A;  4R4O A;  5IE8 A;  2LXJ A;  2UXD Q;  3HOZ H;  4B3T Q;  3RLO A;  2KBN A;  1OXU A;  1ASY A;  4JI8 L;  1XNQ Q;  3RLN A;  3JAM i;  1KXL A;  4A3F H;  4KHP L;  4A93 G;  2ZTD A;  4A3E H;  2NZO A;  1R9T H;  4KHZ A;  1U5K A;  3E9H A;  5LMU Q;  2BA0 A;  3KJP A;  2AHO B;  5IYD G;  4JI5 Q;  4DV2 Q;  2K75 A;  4QJF A;  4YY3 Q;  4ALP A;  1XNR Q;  1HNX Q;  2DGY A;  2F4V L;  1VQP A;  3CCR A;  4DR6 Q;  4DV0 Q;  1IYJ B;  5JJI A;  4GN3 B;  2VQE L;  2ASB A;  2N8N A;  4P72 A;  3OW2 A;  3KF6 B;  4LWC A;  4KLK A;  3CCL A;  2Z0S A;  2JJQ A;  1EQR A;  4LF9 Q;  1RL2 A;  5M3F H;  5GRO A;  1X9N A;  3PO2 G;  4JI7 Q;  1NE3 A;  2QEX A;  2WB1 E;  2K5V A;  4HJA A;  1X3E A;  3D0F A;  1Q82 C;  1A63 A;  5IP7 H;  1IBK Q;  3K81 C;  4GLV B;  3AFQ A;  4JI3 Q;  1TWG H;  4DR7 L;  3TS0 A;  4DR3 Q;  4LF5 L;  4LFA Q;  2K52 A;  2VQF L;  1JB7 A;  4GKJ Q;  1WFQ A;  4DPG A;  3I4M G;  1FJG Q;  1IZ6 A;  1HZ9 A;  3BZC A;  2WFW A;  3GD7 A;  4JOI C;  2UUA Q;  1D7Q A;  5BR8 Q;  1J6Q A;  2WAQ E;  4TQU S;  4C2M H;  4GOP B;  3CQZ H;  3STB C;  4AQY L;  4JCV E;  3PF5 A;  2UXC L;  2Z6K C;  1TWF H;  2YTV A;  3NBH B;  3RN2 A;  4A3D G;  1AE3 A;  1I3Q H;  5GAG C;  2R93 H;  3K80 C;  3KOJ A;  2NVX H;  5C0X J;  4QIW E;  1XJV A;  1Q12 A;  1YJN A;  2JK8 A;  3GTP H;  1I94 L;  2CWP A;  1VS0 A;  2E2H H;  2ZJQ A;  2B63 G;  1HJP A;  1Y14 B;  4BXX G;  1NY4 A;  4OWT B;  5C3E G;  1GO3 E;  2XGT A;  3Q8D A;  3OTO Q;  4GKK L;  1K8G A;  1IXR A;  5GQO A;  1B7Y B;  1I6H H;  4FDB A;  1UE5 A;  2F52 A;  3PO3 H;  4DAM A;  4A3G G;  4K0K Q;  4ME3 A;  4B3R Q;  1E22 A;  4X65 Q;  3S17 H;  1U0L A;  2GVA A;  4IJL A;  5C0X I;  4POF A;  1QVF A; 
#chains in the Genus database with same CATH topology
 1CA5 A;  1NCV A;  2EXD A;  2PI2 E;  2FXQ A;  3H6M A;  1BDO A;  2AQ2 B;  4K2K A;  1CA6 A;  2O5I C;  4A3J B;  3T56 B;  3F2C A;  1PH4 A;  3CC2 A;  1W2B A;  4LF8 L;  5IYB G;  5HY6 A;  4A3J H;  4HN7 A;  2F3W A;  5CBA E;  1PH6 A;  3GTG B;  1LTG D;  2HCI A;  5C5L A;  3DEO A;  2VL6 A;  3I55 A;  4R8I A;  2VXW A;  2MPM A;  1X3Q A;  2Q8I B;  3GTG H;  4JI5 L;  4DV2 L;  4LF7 Q;  1YHA A;  3NP8 A;  1PFS A;  1JC7 A;  2EYF A;  1Q90 A;  4L5T A;  3J7A V;  1LT4 D;  2B3G A;  2B39 A;  1I50 B;  5JAV A;  1H9J A;  4ID6 A;  3IRB A;  4IN3 A;  4QL5 A;  5ELC A;  4DXG A;  3SXH A;  1YNN D;  3HOV G;  1BXT A;  1YHQ A;  1I50 H;  3ITP A;  1WTX A;  5COR A;  3MA2 B;  2FHT A;  1LO5 D;  4ZKB B;  2NN6 G;  3CCM A;  1CUK A;  4X64 L;  4XYQ A;  3M7N A;  4DXF A;  3E5S A;  2WII B;  4DV1 Q;  3X3N A;  3CCV A;  2JA9 A;  3VR5 A;  3KFU A;  1RIP A;  4ZRZ A;  5IGB A;  3TRE A;  2WKD A;  4AH6 A;  4IJH A;  4UHV A;  5FJ8 G;  2L11 A;  3CD6 A;  4OEL B;  2NVQ B;  2Q2U A;  4DAP A;  3NEM A;  5EPK A;  5M3M B;  1CZW A;  1JWU D;  2NVQ H;  5IGC A;  3IFD A;  2ZXO A;  1PH8 A;  2IL8 A;  4PG3 A;  5T1I A;  1G6Z A;  3PUX A;  1F2Y A;  2Z6B A;  4YCW A;  2C9O A;  4XYO A;  5M3M H;  1I4X A;  4A3C H;  1JT8 A;  2JE6 I;  1S4Z A;  3HOX B;  1K73 C;  3ERQ A;  3TME A;  4NKL A;  3GTM B;  1ILP A;  4POG A;  4DV3 L;  1HZA A;  5EGT A;  2A6H D;  1EIY B;  3HOX H;  3RN5 A;  3S1Q B;  1SE2 A;  3GTM H;  3H3V C;  3MEH A;  5D65 A;  2F0Q A;  3UE1 A;  1QE6 A;  4IUQ A;  3I4N G;  1JJG A;  3M4P A;  3CCE A;  4KJO A;  2E5L L;  4OWX B;  4GNX A;  3S1Q H;  1IL2 A;  4K5V A;  5AJ3 L;  1XX8 A;  2PMZ B;  2EXZ A;  3R3O A;  5A35 A;  1PTO C;  4A3E G;  4CGY B;  2BDN A;  1NUC A;  1BCP B;  4C56 C;  1B44 D;  3OMC A;  4RKB A;  2I5M X;  5EAY A;  1M4V A;  5JJL A;  4PZ7 A;  4YIJ A;  2EJF C;  4K5X A;  3S1R B;  3HRZ C;  1E7Z A;  3CF5 A;  3G4S A;  2QDL A;  2V4D A;  1P16 A;  3H0G B;  3S1R H;  2MJ8 A;  5IP7 G;  5JVG 3;  2QA4 A;  1PYS B;  3HZX A;  3RZO B;  3H0G H;  3HOY G;  1EFI D;  1SMX A;  4H02 A;  4P2C B;  3SE0 A;  4UY8 C;  3TZU A;  4X3U A;  1PFM A;  5IWA L;  1QWY A;  4OON A;  3RZO H;  5C3W A;  2A5H A;  1B2T A;  2R93 G;  4QB4 A;  4OL7 A;  2UU9 Q;  5DLQ E;  1HNX L;  2HHH Q;  2CQO A;  4DR6 L;  1SRO A;  4ZCK A;  1TII D;  2EPB A;  4X3S A;  3E0E A;  3SK4 A;  5IGF A;  3ULJ A;  5BN5 A;  3EA6 A;  4A93 B;  2NBF A;  1YHB A;  3HGB A;  3KBG A;  2K6A A;  1C8C A;  1MGS A;  3NBH A;  1S72 A;  2Z6K A;  2EYP A;  4A93 H;  4L8J A;  1KNE A;  4UP8 A;  1GHK A;  2HT1 A;  2KEN A;  2EQS A;  1LUZ A;  1I94 Q;  3DM1 A;  2UUB L;  1G29 1;  3WWV A;  2LSS A;  3L3O C;  3CPW A;  3I70 A;  4RA8 A;  1HA6 A;  3OW7 A;  2F1M A;  3NEN A;  4BBR G;  4R4T A;  4KY7 A;  4ZUJ A;  4FF4 A;  2IWH A;  4CJ0 B;  1EWH A;  1BUV T;  1C0A A;  4A3D B;  2DY8 A;  3A5Z B;  2WAQ G;  3H3V I;  2RKS A;  3M4Y A;  1A15 A;  4DR2 Q;  5COY A;  1HPC A;  3J7A F;  2BCO A;  4NDX A;  4LF8 Q;  4A3D H;  4P74 A;  4R8N A;  3NWS A;  3GTO B;  4WFN 3;  3UDX A;  3SK8 A;  2QIL A;  1LTA D;  1VQH A;  1CSQ A;  3MFY A;  4O1N A;  2R7Z G;  2QDB A;  1DOL A;  1BNZ A;  4K6L A;  4R1J A;  3GTO H;  1S3O A;  1ML0 D;  4RGM A;  2CHB D;  2PYK A;  1F9R A;  4LFC Q;  2XRQ D;  4QQB X;  3TP8 A;  4OXP A;  4DV6 Q;  5EBC A;  5J22 A;  4DR1 L;  1TWA B;  4BBS G;  1X3F A;  1DOK A;  3EVQ A;  3A8I E;  3NSW A;  3M7G A;  1SYB A;  3SHL A;  1TWA H;  3BDO A;  3HG9 A;  1EU3 A;  5IYB H;  1AZQ A;  2NN6 I;  3QR8 A;  1QJO A;  1RDP D;  3CCQ A;  2A74 C;  3HOU G;  1II3 A;  1PTO B;  3NPP A;  3BU2 A;  1WJJ A;  1V1P A;  2EYJ A;  1UUP A;  4X64 Q;  1QB5 D;  2KCC A;  1PRT C;  1UEB A;  5IOC A;  1IBM L;  1H95 A;  2IHE A;  2CH4 W;  1VQB A;  1OTC A;  1N34 L;  1PTO H;  2JA6 G;  2X6L A;  4HCS A;  4J8Q A;  1YBY A;  3V96 A;  3QOL A;  3IAY A;  1DCZ A;  1VQ9 A;  1ENC A;  1HFG A;  3HOV B;  4JI8 Q;  5FLM G;  2X6G A;  1Q81 C;  1GUN A;  4PMC A;  1XMO L;  4R4C A;  1PHJ A;  2CKZ B;  4DV7 L;  5DM7 3;  3FVQ A;  1QZH A;  3EN2 A;  4O0A A;  2OQK A;  2P5Z X;  4UAI A;  5BN3 A;  1EL0 A;  4H0L C;  1KRT A;  3HOV H;  3I4O A;  4C3J G;  4OO1 G;  1NJI C;  1LTI D;  4JK1 C;  2F0I A;  2NN6 H;  2IX3 A;  3K58 A;  1Y8P B;  5FK9 C;  4DK1 A;  1TS3 A;  2HD3 A;  1OXV A;  3FDT A;  4HMJ A;  1K3R A;  2VUM G;  2ZXR A;  1VQJ A;  1TT2 A;  4MIU A;  1SXT A;  4N9T A;  5L37 A;  4DV3 Q;  2AMC B;  3OHX C;  2I0Q A;  3S1M B;  1LTS D;  5FJ8 H;  1B3A A;  1HA5 A;  2ZT9 C;  1KQS A;  1DOM A;  3AMU A;  3NEL A;  2E5L Q;  3L2P A;  3S1M H;  1U4R A;  4HR7 B;  4QIW B;  4F88 A;  2KHS A;  2CH4 A;  3GTL B;  5AJ3 Q;  4DNT B;  1AEX A;  4DU9 A;  3GTL H;  1PV4 A;  4LUZ A;  3HKS A;  2NZH A;  4OGQ C;  1QUQ A;  1C9O A;  2ES2 A;  1BCP F;  5CV9 A;  1JCK B;  3I4N B;  1S40 A;  1MKH A;  3T1Y Q;  4A3M G;  2IX0 A;  2RDH A;  4APV A;  1KIX A;  2RSN A;  3I4N H;  4HTH A;  4A3E B;  1PMR A;  1ICF B;  5I9P A;  1HRJ A;  4ZK9 B;  1XNQ Q;  5ELB A;  1I4H A;  5D3I B;  1RD9 D;  1JOK A;  4A3E H;  4KHZ A;  1U5K A;  3BG3 A;  4WOR A;  5LMU Q;  3GP7 A;  4DK0 A;  4RAU C;  1TS4 A;  2XSC A;  5FO8 B;  1SNQ A;  1F77 A;  1HNX Q;  2F4V L;  4DR6 Q;  1IYJ B;  5JJI A;  2ASB A;  4HSV A;  1RL2 A;  2R3Z A;  2MGS A;  1X9N A;  3PO2 G;  4JI7 Q;  3HOY B;  4HJA A;  2K5V A;  3HP3 A;  3K5M A;  1X3E A;  1Q82 C;  5IP7 H;  3K81 C;  4GLV B;  3AFQ A;  4UDU C;  4G7O C;  1F9P A;  1JOR A;  2D2C C;  1EZ8 A;  5FO9 B;  2K52 A;  4FXG C;  1TWF B;  1I3Q B;  4DPG A;  1SEB D;  2R93 B;  2WFW A;  2EYM A;  5FKA C;  5LL6 X;  1D7Q A;  4AQY L;  4TQU S;  1SE3 A;  5EPL A;  3STB C;  5KNB A;  3VR6 A;  1TWF H;  3I8Z A;  3RN2 A;  3A7A B;  5KNC A;  1I3Q H;  5GAG C;  2R93 H;  1IKL A;  4TKO B;  2BDO A;  4ZUI A;  2B63 G;  4BXX G;  1LV9 A;  1NY4 A;  5C3E G;  1GO3 E;  4ABN A;  1I4G A;  5ELF A;  1D5Z C;  2XVS A;  1IXR A;  1G8Z D;  2LFN A;  1UE5 A;  4A3G G;  1TY2 A;  4ME3 A;  2R61 A;  4IJL A;  4U67 3;  4EVO A;  1L1O A;  2ZM6 L;  3VDY A;  1DYQ A;  4C3I G;  1GKH A;  1RCV D;  4KTA A;  2KHI A;  3PQI A;  1F2Z A;  4AYB G;  2B2V C;  1QVG A;  3TP5 A;  2KCN A;  4BBR B;  3J81 j;  1UE1 A;  3D6W A;  2WKC A;  2F3I A;  2PW7 A;  2EY6 A;  2J7Z A;  3AEV A;  3U9S A;  2ATW A;  4KKS A;  2KEC A;  4BBR H;  1STA A;  4DV5 Q;  5KND A;  2BH8 A;  1PH9 A;  3I91 A;  2WAQ B;  4YCU A;  4DR1 Q;  4UP7 A;  4RMF A;  1PRT D;  1GM5 A;  3K0X A;  1LTB D;  3I56 A;  2I5H A;  1ONL A;  1KTK A;  2B2T A;  1CKN B;  1QVC A;  4XT3 B;  2R7Z B;  3HS0 C;  4DAY A;  4IZ8 A;  2B2U A;  3I2Z A;  3KJO A;  5JEA G;  4GOP A;  2Z9H A;  4FXD A;  2F0N A;  4ZAI A;  1Q1E A;  2R7Z H;  1KHI A;  2PNH A;  1E2V A;  2X69 A;  4B3S L;  3PIO A;  5EKL A;  3IKJ A;  1N34 Q;  2TMP A;  4BBS B;  2HUG A;  2ZJR A;  1EY8 A;  1WI5 A;  4BBS H;  1BO0 A;  4X62 L;  3DWQ A;  4DUY L;  1JJC B;  2PMZ E;  4DV7 Q;  3HOU B;  3FKI B;  2JA5 G;  1EU4 A;  2Y0S G;  3QG1 A;  3K8A A;  4M1U B;  5C6A A;  1IBL Q;  4V0B A;  2K05 A;  1L0W A;  1M1K C;  1JWS D;  3FKI H;  3HOU H;  2PQA B;  3H09 A;  1SDF A;  4HJ9 A;  2JA6 B;  3UE0 A;  1I6V C;  5IP9 H;  2B29 A;  1GJX A;  3M4O B;  1SFO B;  4KN4 C;  4UP9 A;  1LT6 D;  4JI0 Q;  1QZG A;  1MBY A;  3TS2 A;  1QIL A;  3PUV A;  5JPM C;  1STY A;  2JA6 H;  3MXN A;  1UWV A;  1N8R C;  2J0T D;  5GAD C;  3M4O H;  1XYI A;  1SFO H;  4JV5 L;  2NUC A;  4FYD A;  4JW0 A;  4LFB L;  3RD4 A;  2ICI A;  1B1Z A;  3PV0 A;  3S24 A;  1NR4 A;  1MI2 A;  4IPH A;  5DNF A;  5FLM H;  4C3J B;  1G2S A;  1V1Q A;  5C3X A;  2EIF A;  2ID0 A;  4NXM L;  1Y1W G;  3Q0A A;  4KK7 A;  2RDF A;  4C3J H;  1G51 A;  1PH3 A;  3KLR A;  2Q2I A;  2B8F A;  3KK7 A;  2F0U A;  1KD1 C;  3W2D A;  1CKO A;  2BE5 C;  3I4L A;  1ENA A;  2EE1 A;  2KQ3 A;  2N78 A;  3KLS X;  1Q8I A;  3GTJ B;  1Z9F A;  1S5D D;  2JSO A;  5T1G A;  2C35 B;  1Y8O B;  1JR0 D;  1BCP C;  4XQN A;  1EY4 A;  3GTJ H;  3CME A;  1EIF A;  4DR5 Q;  2N49 A;  2QCP X;  2GN5 A;  3NQT A;  1MD2 D;  2N3S A;  1K9M C;  2RHQ B;  1R4Q B;  3NTH A;  2VW9 A;  1WCM H;  3Q6S A;  4DNI A;  2M2L A;  2K1B A;  3VA5 A;  3NTK A;  5LMN L;  3BVZ A;  1EY5 A;  5KIX A;  2GA4 B;  1YNJ D;  2IT1 A;  1EOV A;  2L55 A;  3D31 A;  2UXD L;  1GUO A;  4XIG S;  1VMC A;  4DK6 C;  3CW2 C;  4LNQ A;  1SMY C;  2TSS A;  3DEP A;  4TVA B;  3QIA A;  4NPS A;  3T13 A;  3T4A C;  4A3M B;  4TRD A;  4MTK A;  3KF6 A;  3STB D;  1EEI D;  1KDB A;  3BZK A;  4YY3 L;  2Q2H A;  3UDI A;  1C4Q A;  1DXM A;  4A3M H;  1PXU A;  1PH7 A;  4HIO A;  4LF9 L;  5CV4 A;  2Q2T A;  4OWW B;  1H9S B;  4JOI A;  1XPU A;  1KNA A;  3UDF A;  2XWJ B;  2AQ3 B;  2M00 A;  1BBU A;  3A8K E;  2UUA L;  2L15 A;  5C5M A;  3G6J B;  5AFW A;  3PO2 B;  1TWH B;  1D5M C;  3PGZ A;  1WTO A;  1PA6 A;  3S1N B;  1VF7 A;  4DNR B;  3E0J A;  5J3B A;  3PO2 H;  2WB1 G;  1T5X D;  1TWH H;  4E6I A;  3OTO L;  1X55 A;  3K5N A;  2EOT A;  3S1N H;  4NXN L;  2ZM6 Q;  1MJC A;  4K0K L;  4BY7 G;  4R4I A;  1VQ7 A;  1A0I A;  3D8G A;  1STB A;  1FNU A;  1SBB B;  5C44 G;  2EY1 A;  5C0X G;  3U9O A;  4DGZ A;  5GAH C;  2B63 B;  2XNA C;  5C3E B;  3RMH A;  3I73 A;  1LAC A;  4CKC A;  2B63 H;  4A3G B;  1YIT A;  3L0O A;  1IL8 A;  1JB3 A;  4JI2 L;  2JA7 G;  2Z8L A;  2VB3 X;  5C3E H;  4BXX H;  4BA2 I;  3HKZ E;  5JEA J;  1E0B A;  2YV5 A;  5BN4 A;  1KAA A;  2KJX A;  1F2M A;  1E1T A;  4A3G H;  3VYS A;  4C3I B;  4S3S A;  4O2D A;  4L5R C;  2JA8 G;  2EY2 A;  1EOT A;  1Z7T A;  3AYH B;  4AYB B;  5IYC H;  1YIJ A;  4C3I H;  3BJU A;  4HJ5 A;  3RNU A;  2UUC L;  3LWE A;  2K4K A;  4JBM A;  5LMN W;  4DK3 C;  2QF7 A;  5E1F A;  3K0Y A;  4KD4 A;  3I3C A;  2RHS B;  2PI2 A;  1HNZ L;  4B3S Q;  1HQR D;  2WV6 D;  2EJM A;  3KF8 B;  1Y69 U;  2RVL A;  2MQH A;  1B53 A;  2G9D A;  3PIO 3;  4G7H C;  4MHE A;  3UDG A;  1O7Y A;  3K6O A;  4RCO A;  3DM3 A;  5G3L D;  1LYL A;  1PFN A;  4X62 Q;  4DUY Q;  5H1S E;  3M4Q A;  1EIH A;  2F0J A;  4A3B G;  1E1O A;  3S15 B;  3PIP A;  5C4X G;  1IKM A;  2O2L D;  1BOS A;  2NB0 A;  3S15 H;  4FVM A;  5JEA H;  1HH2 P;  5I4D A;  4QMG A;  3A55 A;  3P1H A;  5CC4 A;  3URY A;  1SYC A;  3P20 A;  1Y1V G;  2A69 D;  4OX9 L;  1SE8 A;  4JV5 Q;  4L63 B;  1LAB A;  2PQE A;  4LFB Q;  2BE5 D;  4JYA L;  5HGT A;  4RG1 A;  2JA5 B;  3U58 A;  1CTM A;  2Y0S B;  4LF5 Q;  1O78 A;  1CSP A;  3J81 E;  4A3I G;  1R4P B;  1BCP D;  3ND8 A;  2K5D A;  3CXC A;  2JA5 H;  3S16 B;  1EWI A;  3A0J A;  4NXM Q;  5LL6 S;  2D9U A;  1CT1 D;  3S2D B;  4DR4 L;  3AFP A;  3EIV A;  3KUP A;  3S16 H;  3ONA B;  3JC6 6;  3J80 L;  1UAP A;  3S2D H;  1NBW A;  2F0G A;  4IOC A;  2R92 G;  1DON A;  1B9N A;  2M9V A;  3ERS X;  4GNX B;  1H9K A;  1GOZ A;  1V8Q A;  1N33 L;  1BR9 A;  3VR2 A;  1MSG A;  2MFI A;  3TBI B;  1BF4 A;  1L2F A;  1PZK D;  1Y8N B;  2ICE C;  1SMY D;  2D0P A;  3RUZ A;  2EJG C;  2NTT A;  1XTC D;  4R9W A;  1Y1W B;  1S5B D;  2F0F A;  1EFW A;  5LMN Q;  2F0O A;  3FPU B;  1XWE A;  2L0C A;  1K8A C;  2KCT A;  1Y1W H;  3FHW A;  3S9W A;  2SEB D;  2D5D A;  2UXB L;  3F8T A;  2VB2 X;  4ULL A;  5IE8 A;  1LLR D;  2LXJ A;  2B2Y C;  2UXD Q;  4EQN A;  3RLO A;  1I4P A;  3CHB D;  1XXG A;  3MXP A;  4OIK A;  4KHP L;  2ZTD A;  5EKI A;  1JOQ A;  1HUM A;  5IOD A;  2XRS D;  3J80 E;  3KJP A;  4IUP A;  4JI5 Q;  4DV2 Q;  4LJZ C;  1NNX A;  4BWG B;  4YY3 Q;  3H94 A;  3FRP B;  2HDL A;  1HFN A;  3JAM E;  1Z6H A;  4OHJ A;  1PYW D;  5EPJ A;  3R8B A;  2IPK D;  3TSS A;  3OW2 A;  2A68 C;  1U9R A;  1A3V A;  2JJQ A;  1EQR A;  2Z0S A;  4LF9 Q;  5GRO A;  4CKE A;  1TU2 B;  5TSS A;  4C1N K;  3D0F A;  1A63 A;  2NZ1 D;  4FF3 A;  3TS0 A;  2C5C A;  1AP0 A;  2E2D C;  2VQF L;  4RHR A;  1WFQ A;  3I72 A;  1J9O A;  3I4M G;  1HZ9 A;  2UUA Q;  1J6Q A;  2WAQ E;  5JPN C;  3S14 B;  4RKL A;  2UXC L;  3NK9 A;  3NBH B;  2YTV A;  3DHQ A;  2FJ2 A;  1HXY D;  5C0X J;  1DZ1 A;  2JP1 A;  4RHS A;  1QNK A;  1VS0 A;  4FF2 A;  4K2L A;  1DJR D;  4GKK L;  3Q8D A;  3OTO Q;  3OMG A;  1K8G A;  3QOJ A;  1EIG A;  2F52 A;  4Q0F A;  4K0K Q;  3QWN A;  2GVA A;  5C0X I;  4C3H G;  1EY7 A;  1YEZ A;  2KOL A;  2QEJ C;  2HQE A;  3G6E A;  1WTQ A;  2PPB C;  2OWO A;  3A7L A;  1MIU A;  2IY5 B;  1OXT A;  4ZLT F;  4RH6 A;  2WB1 B;  4LF4 L;  5DEH A;  1NSN S;  4LF6 L;  2KEE A;  3MC0 B;  2PO4 A;  4RGO S;  2K28 A;  5M5W B;  3A8J E;  1AZP A;  2RSO A;  3J7Z C;  1PTO D;  2XWB B;  4BY7 B;  2VS1 A;  1VQI A;  4CDF C;  2K03 A;  5M5W H;  1E24 A;  3ICE A;  2PNR C;  4BY7 H;  2BA1 A;  1XNR L;  1VMP A;  2UUC Q;  3WOE A;  4MTN A;  5C0X H;  1X3G A;  2RA4 A;  1AN8 A;  4XQQ A;  4I7Z C;  2JA7 B;  2MUY A;  3A74 A;  1ZYR C;  2AWN A;  3PMF A;  1HNZ Q;  4EQ5 A;  3KDF B;  1CZG A;  1FD7 D;  4JI3 L;  1K83 B;  1X32 A;  2JA7 H;  5K5P A;  4GKJ L;  1ASZ A;  3CCU A;  3KYH C;  5D3D A;  4JPB W;  4FF1 A;  3ULL A;  2JA8 B;  2YU9 B;  5BR8 L;  1K83 H;  4MN3 A;  1QOH A;  5DM6 3;  1RF2 D;  3CAM A;  3ER0 A;  1V1P B;  3CPF A;  4Q5V A;  1VQ8 A;  1V43 A;  3KLS A;  2JA8 H;  3E3X A;  1E3P A;  5IT9 L;  1LTR D;  2YU9 H;  1A3T A;  1HNW L;  1ILQ A;  3VYR A;  3VR3 A;  1V1O A;  1VQC A;  4QGU A;  2HIX A;  4IUV A;  1LT5 D;  3PIP 3;  1LM0 A;  2IJ0 A;  5IWA Q;  5FLX L;  4LUV A;  5IY0 A;  1LTL A;  4PQX A;  4IOA A;  1KC8 C;  4U68 A;  4KY5 A;  4OX9 Q;  1XTD A;  1VQN A;  4PNY A;  2CVR A;  5CV5 A;  3T1H L;  4A3B B;  1PH2 A;  4BA1 I;  4KKT A;  2HIV A;  2E75 C;  3RR5 A;  5C4X B;  3VR4 A;  1EY6 A;  2G9H D;  1SYD A;  4LK1 C;  3HOW G;  1DM0 B;  4BY1 G;  1WTP A;  4DAV A;  3K5O A;  4A3B H;  4TSS A;  3BS1 A;  4JBJ A;  5C4X H;  2PZW A;  4G7Z C;  3HOY H;  4DR4 Q;  2LKV A;  1D8L A;  5IIF A;  2CW0 C;  4ME5 A;  1OXS C;  4EGV A;  1Y1V B;  5IT9 E;  1Q8K A;  4GS3 A;  3J81 c;  2UUB Q;  3GTK B;  4LF7 L;  1D1K A;  5J1Z A;  3EJI A;  3HOZ G;  1Y1V H;  3D4W A;  1N33 Q;  4DUZ L;  4ZKC B;  5FLX E;  1O7I A;  3GTK H;  3TQY A;  2RCN A;  1VQG A;  4A3I B;  3S2H B;  4A3F G;  4L5S A;  3ZYY X;  1DGS A;  4JI4 L;  4CJ1 B;  3QJY A;  2I07 B;  4K8J A;  4A3I H;  3S2H H;  1WTR A;  1XMQ L;  5GAE C;  2JQO A;  1L0X B;  4G4K A;  4J1M A;  1ZEQ X;  2KUM A;  1QUQ B;  3IFT A;  4GN4 B;  1KL9 A;  2NTS A;  2R92 B;  2UXB Q;  3MHB A;  3A5U A;  3PUZ A;  2MO0 A;  2K7V A;  3SR1 A;  5CYU A;  1GUS A;  1F9Q A;  2AWO A;  5KGU A;  1NR2 A;  2A68 D;  2F0H A;  4OIJ A;  3W1G A;  4X66 L;  4DV1 L;  2EZV A;  1XPO A;  3SK5 A;  1JE5 A;  5M5Y B;  2R92 H;  2L1B A;  3CMA A;  2K14 A;  3BZD B;  4KMU C;  2VNU D;  4B3T L;  4FP5 D;  3UI2 A;  3X3M A;  1VQD A;  3VYT A;  5M5Y H;  3QB3 A;  1G6P A;  1T9H A;  1ESR A;  2DNC A;  1WYD A;  4LUO A;  5ELO A;  1ESF A;  4FNF A;  1U4L A;  4B08 A;  2I46 A;  1VQ4 A;  1KAW A;  4DV0 L;  3J80 c;  2IW3 A;  2OF1 A;  2WP8 J;  4QF4 A;  1BQQ T;  1S5E D;  5ELE A;  1NMF A;  2YYZ A;  4HMI A;  5K36 G;  3PSI A;  5JJK A;  1IBM Q;  4LFA L;  2UXC Q;  2B2W C;  1CFM A;  1O7Z A;  2F3V A;  1FVI A;  3TZD A;  1FJG L;  1EYG A;  1SYG A;  3U4V A;  1RTN A;  2LS0 1;  3GO5 A;  3MEF A;  1EQQ A;  2OQ0 A;  4HED A;  4AYB E;  4EQO A;  2K04 A;  4GKK Q;  3H0G G;  5CR3 A;  1WD1 A;  4KV6 A;  1AH9 A;  1D5X C;  1A62 A;  1XMO Q;  2PZT A;  3BDL A;  3I4M B;  2E74 C;  5I9O A;  2K5H A;  3CKI B;  4OO1 I;  1RKN A;  1IW7 C;  5KRU A;  4DF7 A;  3DLL A;  4JG2 A;  1YZ6 A;  4B3R L;  2K33 A;  1SYE A;  3K5L A;  3I4M H;  1GXD C;  1VF5 C;  4IUT A;  4I7A A;  3E6Z X;  4HAE A;  2B2V A;  4KD3 A;  2SNS A;  2NVY B;  1SYF A;  4LF6 Q;  3OSO A;  1OXX K;  2K32 A;  1WVL A;  1MJE A;  3J80 i;  1XPR A;  1B9M A;  2XIW A;  4XQJ A;  2L12 A;  1H9R A;  2NVY H;  3SDZ A;  3Q23 A;  1Q46 A;  4XT1 B;  1NAP A;  4C3H B;  5JOB A;  3TRZ A;  4DKA C;  1EQT A;  5CV7 A;  2OTJ A;  3L9A X;  3A56 A;  3OWF A;  4H44 C;  5JJZ A;  1SAP A;  4IFD G;  4C3H H;  2OCE A;  4HID A;  1JJ2 A;  1H9M A;  3U50 C;  5A2Q L;  4X3T A;  1CKM A;  2UU9 L;  4OO1 H;  4IUN A;  3C46 A;  1BVS A;  3AQQ A;  2VUM B;  2HHH L;  1N36 L;  2QKI C;  2F0W A;  1EEF D;  1E2Z A;  2Y0S E;  1VQ6 A;  5EJW A;  2VUM H;  2A8V A;  1UE7 A;  4DAY B;  1JMC A;  1HHV A;  4JC0 A;  1SLJ A;  3M85 A;  3MWY W;  3DWP A;  1Q3L A;  4V19 0;  4LMQ D;  1TXY A;  2AQ1 B;  1VCI A;  2EY5 A;  1HNW Q;  1D1I A;  3C2P A;  4FXK C;  2RDG A;  1YI2 A;  2F0P A;  4HSP A;  1TVX A;  1GUW A;  4B9W A;  4G57 A;  3CP0 A;  3M3Y B;  3Q24 A;  2CWA A;  1KLG D;  1STG A;  3T16 A;  1X6O A;  3T51 B;  4R4Q A;  2JEA I;  5A2Q E;  3M3Y H;  5CMD A;  3K59 A;  2CW0 D;  3T1H Q;  2F4V Q;  1GHJ A;  4FO2 A;  4L5Q A;  1JQY D;  2YTY A;  3RZD B;  3SEB A;  2RBM A;  3NXW A;  5CBE E;  4HIK A;  4HJ8 A;  4DR2 L;  1VQK A;  1TR5 A;  1F2L A;  2H1E A;  4I65 A;  4JBK A;  5CGK A;  3RZD H;  4L6T B;  5KEE A;  1L0Y B;  2K01 A;  3MXN B;  3F2B A;  1VQM A;  4WJ3 M;  4MZ9 A;  1B8A A;  4Y52 H;  3TN2 A;  2VY3 A;  3FPP A;  4AQY Q;  4N8F A;  1EUJ A;  3MVV A;  4PMB A;  1I4R A;  1UNS A;  3FMC A;  1EWC A;  4WJ4 A;  4LFC L;  4HJ7 A;  2K50 A;  1B4O A;  4B3M L;  3GV3 A;  4PZ6 A;  4QUF A;  4YCV A;  4DV6 L;  5EKK A;  2R6G A;  4DUZ Q;  3F1Z A;  3W5O A;  2F4I A;  3DXJ C;  1P8L A;  3HOW B;  1IYV A;  1K3B C;  2XTI A;  2NYZ D;  4BY1 B;  4GNX C;  2PCF B;  1SN8 A;  4JI6 L;  1KLU D;  3AU7 A;  4NB3 A;  3KF8 A;  5IT9 c;  3R2T A;  3F2U A;  3EQL C;  4JI4 Q;  1LT3 D;  1ENF A;  3D6C A;  4O42 A;  3HOW H;  4BY1 H;  1CHP D;  1XMQ Q;  3HKZ G;  3H15 A;  4C1N I;  2PZU A;  5C4J B;  1QG7 A;  5FLX c;  2KHJ A;  2GVB A;  1PRT F;  5C4J H;  1NTG A;  3HOZ B;  3W1B A;  1B3Q A;  4X66 Q;  1ZKO A;  1WD0 A;  4A3F B;  4K8I A;  1TY0 A;  3CU7 A;  2FMC A;  3HOZ H;  2QW7 A;  1R9T B;  4B3T Q;  1RTO A;  3CRK C;  1ASY A;  4JI8 L;  4A3F H;  4LAA A;  1UEA B;  2NZO A;  1R9T H;  4N8X 1;  2AHO B;  5IYD G;  4QJF A;  3AB9 A;  1GUT A;  1SND A;  3TP7 A;  3CCR A;  2F03 A;  4DV0 Q;  3NWT A;  3C3L A;  3EFX D;  3MZ5 A;  2VQE L;  3KF6 B;  4KKU A;  1NE3 A;  2WB1 E;  1IYU A;  1W6K A;  4DR7 L;  4C2M B;  1EYC A;  5DAU A;  1SJE D;  4PV1 C;  4LFA Q;  3NQI A;  3G7L A;  1FJG Q;  5CV8 A;  1IW7 D;  3N6R A;  2O4X A;  4C2M H;  1SNP A;  3J81 L;  1ICW A;  2Z6K C;  1KDC A;  1BBX C;  3K80 C;  3KOJ A;  4DA2 A;  3LX0 A;  3WOF A;  4QIW E;  1ROD A;  4QUC A;  1Q12 A;  1XJV A;  3BYY B;  1I6H B;  2CWP A;  2ZJQ A;  1Y14 B;  2DNE A;  2A6E C;  1ZXT A;  4OWT B;  2BOS A;  2XGT A;  4WJW A;  3WDN A;  3S17 B;  5JVH 3;  5GQO A;  1B7Y B;  3DMU A;  1I6H H;  1PFB A;  4DAM A;  4B3R Q;  1E22 A;  3S17 H;  1U0L A;  1O7L A;  2EVB A;  4POF A;  1D6E C;  5K36 H;  4PMW A;  1CQF A;  3G71 A;  1TWC B;  4M8A A;  1AFP A;  1ET6 A;  2EYH A;  4A3L G;  4YWL A;  2E2I B;  4IFD J;  4CJ2 C;  3DUZ A;  3T1Y L;  5M9O A;  1TWC H;  1HTP A;  1I5F A;  1PZI D;  1PYB A;  2E2I H;  3EBE A;  3MFG A;  5M5X B;  5E4W C;  1TKW B;  4QY7 A;  1XNQ L;  4HCE A;  4IFD I;  5M5X H;  5LMU L;  3BVG A;  1W3S A;  4DV4 L;  1FNW A;  4CDD C;  1FR3 A;  1PDQ A;  1STE A;  1LTT D;  1N36 Q;  2F0M A;  4RGN A;  1N32 L;  3OWE B;  1U4M A;  4F8M A;  3JAM L;  3O13 A;  4JI7 L;  1C7Y A;  4J6H A;  1SNO A;  1E2W A;  1EY0 A;  1OO9 B;  1W6J A;  1FGB D;  4GN5 A;  3MAQ A;  3TEH B;  5I6W A;  2LMC B;  3TP6 A;  4GLX A;  4PZ8 A;  2L5T A;  3HEJ A;  4CDE C;  2I5L X;  4KY6 A;  2KA7 A;  4IFD H;  4A76 A;  1JE4 A;  1VQL A;  1PH5 A;  4KN7 C;  4UPA A;  2MNA A;  4Y7N B;  2Z1C A;  4K6D A;  1J5E L;  2AKW B;  1EYD A;  1RJT A;  2F0S A;  1YNX A;  4Y7N H;  3R2I A;  4NW2 A;  5LHY 1;  1GVP A;  4MNO A;  1HQM C;  1PVO A;  3CC4 A;  2LXK A;  3V05 A;  1JIC A;  4YHH L;  1SNM A;  4F7X A;  4JI1 L;  4B9X A;  2KCM A;  4JVZ A;  2ZXP A;  1VQO A;  1DD2 A;  1K8M A;  3W3A A;  3D3R A;  3G48 A;  4EX5 A;  3CRL C;  3OYY A;  1IHZ A;  2CQA A;  1B50 A;  4DV5 L;  3GV6 A;  1RHP A;  4IPD A;  1FL0 A;  1A8V A;  2KED A;  2L4N A;  4A3K G;  2DUD A;  3ZJY C;  2ENB A;  4B3M Q;  5C4H A;  3OIP A;  4KJN A;  1CI3 M;  1A6X A;  2VZA A;  3C1E A;  1PLF A;  3F2D A;  1HR0 L;  4JI6 Q;  3KDF A;  2DJF C;  2L9H A;  3S14 H;  3H3V H;  4HIM A;  4X6A H;  3ERO A;  2Q8R E;  3FKI G;  4NXN Q;  4P73 A;  3PUW A;  2HQL A;  5IP9 G;  3D4R A;  3BVM A;  2HCC A;  5E3F A;  3DWA A;  1B70 B;  3RLF A;  4K14 A;  4XDX A;  4ZYS A;  1KDA A;  1Q1B A;  3VYU A;  3U4Z A;  4IUR A;  3P7J A;  5M3F G;  4IQZ A;  2D62 A;  2JXM B;  1SSO A;  2B2Y A;  5F2D A;  2F0E A;  1G2T A;  3NE5 B;  4JI2 Q;  1M90 C;  1VQ5 A;  3HKZ B;  4NMZ A;  4X3K A;  4IO9 A;  4P71 A;  3GTQ B;  1SNC A;  4IPG A;  4ODG A;  1SE4 A;  2V1C C;  3ULP A;  5C44 B;  1WTV A;  1IBL L;  1JWM D;  4XTC S;  2B8G A;  2EYL A;  2VQE Q;  3GTQ H;  5HUR A;  5C44 H;  5G3L F;  2D0O A;  4JI0 L;  2NVT B;  1K0S A;  4DR7 Q;  3TDQ A;  3PO3 G;  2A6E D;  4F87 A;  2NVT H;  2F0T A;  5CV6 A;  1STN A;  2ALY B;  2DY7 A;  1IBK L;  2BH2 A;  1WCM G;  4DR3 L;  5C4Z A;  4IUU A;  3E9I A;  4RCN A;  3J7Y W;  2ZJP A;  5IYD H;  4OEM B;  4J15 A;  4LW1 A;  1X56 A;  4CHT B;  4A3J G;  3A54 A;  3NTI A;  3IL8 A;  1HZC A;  3MXU A;  1U4P A;  5EQ0 A;  3HFZ B;  3KLW A;  1Q86 C;  2CFM A;  5EBD A;  3FP9 A;  3NBI A;  3NHH A;  3V2T A;  1G91 A;  4YWM A;  2WAC A;  1KAB A;  1TS5 A;  4GLA C;  5E4X A;  3CC7 A;  4DR5 L;  1KXL A;  4X65 L;  2CCZ A;  2MO1 A;  3I90 A;  1NMG A;  1L1O C;  1STH A;  2DN8 A;  3NUC A;  4IPC A;  1AE2 A;  4JYA Q;  1HCZ A;  3B6Y A;  4WRD A;  2O5J C;  2Q8T A;  1HR0 W;  3LWU A;  3KBX A;  1O80 A;  1A2U A;  1BBW A;  1Z47 A;  1FYC A;  1KRS A;  1VQF A;  4YWK A;  3K57 A;  1EZ6 A;  4DV4 Q;  2OEO A;  4IAL A;  1YJ9 A;  1CM9 A;  1CKN A;  1SRU A;  2A19 A;  1C48 A;  1BKB A;  2SDF A;  1EYA A;  2RQX A;  1HTL D;  2K5Q A;  1N32 Q;  5ELN A;  5ISR A;  3OIQ A;  1EQV A;  4A3L H;  1ET9 A;  3K7A B;  5NUC A;  3BYT B;  2B2T C;  2N88 A;  2IHF A;  2H5X A;  2RF4 A;  2EYO A;  1YNJ C;  4KHV A;  1M8A A;  2OT2 A;  4H7B A;  3CCJ A;  2R7F A;  3K7A H;  5J39 A;  3R93 A;  1YJW A;  2ZTC A;  2B2U C;  2XN9 C;  2J4X A;  4GOP C;  1TQO A;  2F0V A;  2E8G A;  5IGE A;  5HGQ A;  5FOB B;  2R7D A;  1K0R A;  1Q7Y C;  3SGI A;  4EQP A;  1PRT B;  1AW7 A;  3K7U C;  3I7F A;  4Z9C B;  5M3M G;  4A3C G;  2JYO A;  3VA7 A;  1PZJ D;  2E2J B;  4CDC C;  2JEB I;  2IX1 A;  2AUJ D;  3J7A 5;  1UE6 A;  1J5E Q;  3GQB A;  1CQV A;  2HDM A;  2E2J H;  1YNN C;  4KHP Q;  3C1F A;  3PCO B;  2PQA A;  1HZB A;  3HOX G;  1X65 A;  3PUY A;  3OPO A;  1X54 A;  2LY7 A;  1A2T A;  5KYI A;  5IYC G;  1WTW A;  1FNV A;  1SR3 A;  1TS2 A;  1VQE A;  4YHH Q;  2AUK A;  1T5E A;  4JI1 Q;  2EDG A;  4DFA A;  3J81 i;  4KI0 A;  1WTH A;  4NP5 A;  4AIM A;  2A73 B;  1FGU A;  1X3P A;  5E7N A;  1A3U A;  1VDZ A;  2ZTE A;  4BS9 A;  1F9S A;  2OTL A;  2Z4I A;  2N55 A;  2SOB A;  3FEW X;  4CKB A;  2YTX A;  4K5W A;  2VQF Q;  1PH1 A;  3JAM c;  1GD7 A;  4JBW A;  5IGG A;  5IGD A;  1J8I A;  4A4I A;  1N9W A;  1YVC A;  3BDC A;  1I4Q A;  5D14 A;  3GDE A;  1D2B A;  1VQA A;  4N9P A;  1HR0 Q;  3SK6 A;  3LNN A;  1CK1 A;  1WOC A;  2FMM A;  1V9P A;  4A75 A;  3L7Z C;  3M9B A;  1QNU A;  4ZQ3 A;  2E76 C;  2A1A A;  3D4D A;  5I6Y A;  3P75 A;  2DJG C;  2WIN B;  2K5N A;  1MSH A;  3CCS A;  3PF4 A;  2A6H C;  4A3K B;  3QO2 A;  2K5W A;  1K28 A;  1PTO F;  2G5D A;  3MXG A;  3LGJ A;  4A3K H;  2PW5 A;  1CHQ D;  2QGQ A;  1L1O B;  4LF4 Q;  4P75 A;  2MHV A;  4R4O A;  4RWS C;  4RGT A;  2Z4H A;  1MHW C;  3Q22 A;  2KBN A;  1OXU A;  1QCB D;  1ZYR D;  3RLN A;  3JAM i;  4A93 G;  3SVM A;  3E9H A;  5I2X A;  2BA0 A;  1JOO A;  2F0L A;  2K75 A;  1XNR Q;  4ALP A;  5M3F B;  2MP1 A;  2JN4 A;  1S5C D;  2DGY A;  1VQP A;  4RFB A;  4GN3 B;  2SNM A;  3H91 A;  2N8N A;  4P72 A;  4GZY C;  1TWG B;  3ND9 A;  4KLK A;  4LWC A;  3CCL A;  1HUN A;  4QCL A;  3OOC A;  5M3F H;  1H9S A;  1K8O A;  2QEX A;  2F0K A;  1IBK Q;  4JI3 Q;  1TWG H;  3CQZ B;  4DR3 Q;  4LF5 L;  2B2W A;  2H4O A;  1JB7 A;  4GKJ Q;  3N52 A;  2FIN B;  1GUG A;  1IZ6 A;  3BZC A;  4DN4 M;  3GD7 A;  4JOI C;  2NVX B;  5KYL A;  2KVM A;  5BR8 Q;  2RCF A;  4GOP B;  3CQZ H;  3PF5 A;  4JCV E;  4XXE A;  5FO7 B;  5I2Y A;  3GTP B;  2E2H B;  2FFK B;  2A69 C;  1EY9 A;  4A3D G;  1AE3 A;  4H13 C;  2NVX H;  5ELD A;  1S5F D;  1YJN A;  2JK8 A;  3GTP H;  1I94 L;  2E2H H;  3PO3 B;  1HJP A;  2OXP A;  2NWG A;  4CBV A;  1WCM B;  4FDB A;  3PO3 H;  1SJH D;  3T53 B;  4X65 Q;  2F0D A;  4ILW A;  1QVF A;  3MTS A; 
#chains in the Genus database with same CATH homology
 4PMW A;  1L1O A;  3G71 A;  1YEZ A;  2EXD A;  2PI2 E;  2ZM6 L;  2FXQ A;  3VDY A;  3G6E A;  1GKH A;  4A3L G;  4YWL A;  3F2C A;  2OWO A;  4IFD J;  2KHI A;  3T1Y L;  1MIU A;  2IY5 B;  1OXT A;  1TWC H;  1PH4 A;  4AYB G;  3CC2 A;  1W2B A;  1QVG A;  4LF8 L;  1I5F A;  5IYB G;  1PYB A;  1UE1 A;  5HY6 A;  3J81 j;  4A3J H;  4LF4 L;  4LF6 L;  2E2I H;  3EBE A;  2F3I A;  3AEV A;  1PH6 A;  2ATW A;  4BBR H;  3J7Z C;  4DV5 Q;  2VL6 A;  4QY7 A;  2VS1 A;  3I55 A;  1XNQ L;  4IFD I;  2BH8 A;  1PH9 A;  1VQI A;  4YCU A;  5M5X H;  4DR1 Q;  4UP7 A;  5M5W H;  5LMU L;  1E24 A;  1W3S A;  4RMF A;  4DV4 L;  1GM5 A;  3GTG H;  3ICE A;  4JI5 L;  3K0X A;  4DV2 L;  4BY7 H;  4LF7 Q;  2BA1 A;  3I56 A;  1XNR L;  2I5H A;  1YHA A;  2UUC Q;  1PFS A;  4MTN A;  1CKN B;  1N36 Q;  1X3G A;  1N32 L;  1QVC A;  4L5T A;  2B3G A;  4QL5 A;  3IRB A;  4JI7 L;  3A74 A;  2AWN A;  1HNZ Q;  3I2Z A;  4EQ5 A;  3KJO A;  5JEA G;  3KDF B;  4GOP A;  1C7Y A;  4JI3 L;  3HOV G;  1Q1E A;  1YHQ A;  1I50 H;  1KHI A;  2R7Z H;  2PNH A;  2JA7 H;  4GKJ L;  4B3S L;  3PIO A;  3CCU A;  1ASZ A;  3KYH C;  4GN5 A;  1N34 Q;  3TEH B;  2NN6 G;  3ULL A;  3CCM A;  1CUK A;  4GLX A;  4PZ8 A;  5BR8 L;  1K83 H;  4X64 L;  2ZJR A;  3CAM A;  3ER0 A;  3CPF A;  2I5L X;  3M7N A;  1VQ8 A;  1V43 A;  2JA8 H;  4A76 A;  1E3P A;  4DV1 Q;  2YU9 H;  1VQL A;  1WI5 A;  3CCV A;  1PH5 A;  2JA9 A;  4BBS H;  1HNW L;  4X62 L;  3KFU A;  4UPA A;  4DUY L;  1JJC B;  1RIP A;  1VQC A;  4QGU A;  2MNA A;  2PMZ E;  2HIX A;  3TRE A;  4DV7 Q;  4AH6 A;  4IJH A;  2JA5 G;  5FJ8 G;  1LM0 A;  5IWA Q;  2Y0S G;  1J5E L;  2AKW B;  3K8A A;  3CD6 A;  4LUV A;  5IY0 A;  2Q2U A;  1IBL Q;  1LTL A;  1YNX A;  3NEM A;  4Y7N H;  1L0W A;  1M1K C;  4IOA A;  3HOU H;  3FKI H;  2PQA B;  1GVP A;  1KC8 C;  4HJ9 A;  4MNO A;  3UE0 A;  4OX9 Q;  1XTD A;  5IP9 H;  2B29 A;  2NVQ H;  1PVO A;  3CC4 A;  1PH8 A;  1VQN A;  4UP9 A;  3T1H L;  2LXK A;  4JI0 Q;  1QZG A;  3TS2 A;  4YHH L;  3PUV A;  4PG3 A;  4JI1 L;  4BA1 I;  1PH2 A;  2KCM A;  3PUX A;  2JA6 H;  2HIV A;  1UWV A;  3RR5 A;  1N8R C;  4YCW A;  5M3M H;  4A3C H;  5GAD C;  1VQO A;  3M4O H;  1SFO H;  3HOW G;  4JV5 L;  4BY1 G;  1JT8 A;  2JE6 I;  4LFB L;  4A3B H;  3PV0 A;  3S24 A;  1K73 C;  3G48 A;  4EX5 A;  4JBJ A;  3OYY A;  4IPH A;  5C4X H;  5FLM H;  4DV3 L;  4POG A;  1HZA A;  1V1Q A;  3HOY H;  4DV5 L;  1EIY B;  4DR4 Q;  4IPD A;  1D8L A;  1FL0 A;  3HOX H;  1A8V A;  4A3K G;  2DUD A;  1OXS C;  2EIF A;  3ZJY C;  3RN5 A;  4B3M Q;  2ID0 A;  4WJ4 A;  4NXM L;  3GTM H;  1Q8K A;  1Y1W G;  3UE1 A;  4GS3 A;  4C3J H;  3J81 c;  2UUB Q;  1G51 A;  1PH3 A;  3I4N G;  1JJG A;  3M4P A;  3CCE A;  2Q2I A;  2E5L L;  4OWX B;  2VZA A;  4GNX A;  4LF7 L;  3F2D A;  1KD1 C;  1HR0 L;  4JI6 Q;  1CKO A;  3KDF A;  1IL2 A;  3HOZ G;  3S1Q H;  1Y1V H;  2N78 A;  3S14 H;  1N33 Q;  4DUZ L;  5AJ3 L;  1Z9F A;  1O7I A;  3GTK H;  3TQY A;  2RCN A;  3H3V H;  1VQG A;  4HIM A;  4X6A H;  4A3F G;  2C35 B;  4L5S A;  4A3E G;  3CME A;  3GTJ H;  1DGS A;  1EIF A;  2N49 A;  3FKI G;  4DR5 Q;  4JI4 L;  4NXN Q;  4P73 A;  3PUW A;  2GN5 A;  2HQL A;  4A3I H;  3S2H H;  2N3S A;  5EAY A;  2I5M X;  5IP9 G;  5JJL A;  4PZ7 A;  1XMQ L;  5GAE C;  1K9M C;  2RHQ B;  2VW9 A;  1B70 B;  2JQO A;  1WCM H;  1E7Z A;  3RLF A;  4DNI A;  3CF5 A;  1QUQ B;  4GN4 B;  1Q1B A;  3G4S A;  1KL9 A;  3U4Z A;  5M3F G;  5LMN L;  1P16 A;  2UXB Q;  2D62 A;  3A5U A;  3PUZ A;  2MO0 A;  3S1R H;  2AWO A;  5IP7 G;  3W1G A;  2QA4 A;  4X66 L;  1PYS B;  4DV1 L;  1XPO A;  1JE5 A;  4JI2 Q;  1M90 C;  2R92 H;  3H0G H;  3CMA A;  2K14 A;  1VQ5 A;  3HOY G;  2IT1 A;  1EOV A;  3D31 A;  1SMX A;  2UXD L;  4H02 A;  4XIG S;  4UY8 C;  4B3T L;  2VNU D;  4DK6 C;  3CW2 C;  4IO9 A;  4P71 A;  1VQD A;  4LNQ A;  5IWA L;  5M5Y H;  4OON A;  3RZO H;  4IPG A;  4TVA B;  2V1C C;  4NPS A;  3ULP A;  1G6P A;  1IBL L;  1T9H A;  2R93 G;  4XTC S;  3KF6 A;  2VQE Q;  3STB D;  1WYD A;  2UU9 Q;  4LUO A;  3BZK A;  5DLQ E;  3GTQ H;  5ELO A;  4YY3 L;  2Q2H A;  5C44 H;  1HNX L;  2CQO A;  3UDI A;  1VQ4 A;  2HHH Q;  1KAW A;  4DR6 L;  1SRO A;  2D0O A;  4DV0 L;  4A3M H;  4JI0 L;  3J80 c;  1PH7 A;  4DR7 Q;  3E0E A;  4HIO A;  3PO3 G;  3ULJ A;  4LF9 L;  2Q2T A;  4OWW B;  2WP8 J;  1YHB A;  2NVT H;  1NMF A;  2ALY B;  1IBK L;  2YYZ A;  4JOI A;  2BH2 A;  1XPU A;  5K36 G;  3PSI A;  1WCM G;  3UDF A;  5JJK A;  1IBM Q;  4DR3 L;  1S72 A;  4LFA L;  2UXC Q;  2Z6K A;  4A93 H;  1FVI A;  3E9I A;  4UP8 A;  1EYG A;  1FJG L;  1BBU A;  2UUA L;  2ZJP A;  2HT1 A;  2L15 A;  3U4V A;  5IYD H;  2KEN A;  3GO5 A;  3MEF A;  2EQS A;  4J15 A;  2OQ0 A;  4LW1 A;  1LUZ A;  1EQQ A;  4AYB E;  1I94 Q;  1X56 A;  2UUB L;  1G29 1;  3PGZ A;  4A3J G;  3WWV A;  2LSS A;  4GKK Q;  3H0G G;  3CPW A;  1HZC A;  1PA6 A;  3HFZ B;  1AH9 A;  3KLW A;  1Q86 C;  2CFM A;  3FP9 A;  3NEN A;  5J3B A;  4BBR G;  2WB1 G;  1A62 A;  1TWH H;  4R4T A;  4YWM A;  1XMO Q;  3PO2 H;  3OTO L;  1X55 A;  4GLA C;  3CC7 A;  2K5H A;  3S1N H;  4OO1 I;  4DR5 L;  4NXN L;  2ZM6 Q;  1MJC A;  3DLL A;  4JG2 A;  4K0K L;  4BY7 G;  4R4I A;  1C0A A;  3A5Z B;  1A0I A;  1YZ6 A;  4X65 L;  1VQ7 A;  2CCZ A;  4B3R L;  2MO1 A;  3I4M H;  5C44 G;  1NMG A;  2WAQ G;  3H3V I;  1L1O C;  5C0X G;  4DR2 Q;  5GAH C;  4LF8 Q;  4A3D H;  4IPC A;  1AE2 A;  4P74 A;  4LF6 Q;  1OXX K;  3B6Y A;  1MJE A;  4JYA Q;  3J80 i;  3UDX A;  1HR0 W;  1XPR A;  1VQH A;  1CSQ A;  1BBW A;  1Z47 A;  2NVY H;  2B63 H;  2R7Z G;  1YIT A;  3L0O A;  2JA7 G;  4JI2 L;  4BXX H;  5C3E H;  4R1J A;  1KRS A;  4BA2 I;  1VQF A;  4YWK A;  1S3O A;  3HKZ E;  1Q46 A;  5JEA J;  3GTO H;  2YV5 A;  4DV4 Q;  4DKA C;  3TRZ A;  1E1T A;  4A3G H;  2OTJ A;  1YJ9 A;  4LFC Q;  4QQB X;  1CKN A;  1SRU A;  4O2D A;  2A19 A;  4L5R C;  4OXP A;  1BKB A;  4DV6 Q;  4IFD G;  4C3H H;  2OCE A;  4HID A;  4DR1 L;  1JJ2 A;  3U50 C;  2JA8 G;  1N32 Q;  4BBS G;  1X3F A;  3AYH B;  1CKM A;  5ELN A;  5IYC H;  2UU9 L;  1YIJ A;  4C3I H;  3BJU A;  4HJ5 A;  3RNU A;  4A3L H;  1BVS A;  3AQQ A;  2UUC L;  2K4K A;  4JBM A;  2HHH L;  5LMN W;  2IHF A;  1N36 L;  2H5X A;  2RF4 A;  4DK3 C;  1TWA H;  2RHS B;  2Y0S E;  3CCJ A;  2R7F A;  5IYB H;  1VQ6 A;  3K7A H;  2VUM H;  2A8V A;  2NN6 I;  3CCQ A;  1UE7 A;  2PI2 A;  4DAY B;  1YJW A;  1HNZ L;  2ZTC A;  1JMC A;  4B3S Q;  3HOU G;  4GOP C;  3KF8 B;  1SLJ A;  4JC0 A;  3M85 A;  2E8G A;  3BU2 A;  1WJJ A;  4X64 Q;  1IBM L;  1UEB A;  2MQH A;  5HGQ A;  1H95 A;  2IHE A;  2R7D A;  1K0R A;  1Q7Y C;  1VQB A;  3SGI A;  1OTC A;  3K7U C;  3I7F A;  3UDG A;  1N34 L;  1TXY A;  1VCI A;  3DM3 A;  2JA6 G;  1HNW Q;  5M3M G;  4A3C G;  1LYL A;  4X62 Q;  4DUY Q;  5H1S E;  2JEB I;  1YI2 A;  1YBY A;  3M4Q A;  2IX1 A;  4A3B G;  1E1O A;  3J7A 5;  1UE6 A;  1VQ9 A;  3PIP A;  1J5E Q;  5C4X G;  3CP0 A;  4JI8 Q;  5FLM G;  2E2J H;  1Q81 C;  2CWA A;  4KHP Q;  3PCO B;  2PQA A;  1HZB A;  4R4C A;  3HOX G;  1X6O A;  1X65 A;  2CKZ B;  4DV7 L;  1XMO L;  1PHJ A;  3PUY A;  3S15 H;  1QZH A;  1HH2 P;  1X54 A;  2OQK A;  3EN2 A;  4O0A A;  4R4Q A;  2JEA I;  3M3Y H;  1KRT A;  3HOV H;  3I4O A;  5IYC G;  4OO1 G;  3T1H Q;  1SR3 A;  1NJI C;  2F4V Q;  4L5Q A;  1VQE A;  4YHH Q;  2YTY A;  4JI1 Q;  3J81 i;  1Y1V G;  4OX9 L;  4HIK A;  4KI0 A;  4HJ8 A;  1SE8 A;  4AIM A;  4DR2 L;  1VQK A;  1OXV A;  4JV5 Q;  1FGU A;  4LFB Q;  1K3R A;  4JYA L;  4JBK A;  5E7N A;  2VUM G;  2ZTE A;  3RZD H;  4RG1 A;  2OTL A;  3U58 A;  1VQJ A;  4LF5 Q;  1CSP A;  3MXN B;  3F2B A;  2YTX A;  1VQM A;  4DV3 Q;  2VQF Q;  4A3I G;  2AMC B;  1PH1 A;  4MZ9 A;  1B8A A;  4WJ3 M;  2I0Q A;  3JAM c;  4Y52 H;  1GD7 A;  2VY3 A;  4JBW A;  3CXC A;  2JA5 H;  5FJ8 H;  4AQY Q;  1EWI A;  4A4I A;  3A0J A;  1EUJ A;  1N9W A;  4NXM Q;  1YVC A;  1KQS A;  3NEL A;  4DR4 L;  3GDE A;  4LFC L;  3AFP A;  2K50 A;  4HJ7 A;  3EIV A;  3L2P A;  2E5L Q;  4B3M L;  1VQA A;  1HR0 Q;  3S1M H;  3S16 H;  4PZ6 A;  4YCV A;  3JC6 6;  1WOC A;  4DV6 L;  2R6G A;  4DUZ Q;  3F1Z A;  3W5O A;  5AJ3 Q;  1P8L A;  1V9P A;  3S2D H;  2XTI A;  3L7Z C;  1NBW A;  3M9B A;  4IOC A;  4A75 A;  4GNX C;  2R92 G;  1SN8 A;  4JI6 L;  3ERS X;  2A1A A;  4NB3 A;  4GNX B;  5IT9 c;  1N33 L;  4JI4 Q;  3GTL H;  1PV4 A;  2K5N A;  3HOW H;  4BY1 H;  4LUZ A;  3HKS A;  2MFI A;  3CCS A;  2NZH A;  3PF4 A;  1L2F A;  1XMQ Q;  3HKZ G;  3H15 A;  2D0P A;  1QUQ A;  1C9O A;  5FLX c;  2ES2 A;  2KHJ A;  3LGJ A;  1EFW A;  2GVB A;  5LMN Q;  1S40 A;  4A3K H;  1MKH A;  3T1Y Q;  4A3M G;  2IX0 A;  5C4J H;  1NTG A;  2QGQ A;  3W1B A;  4APV A;  1K8A C;  1KIX A;  1L1O B;  2KCT A;  4X66 Q;  1Y1W H;  3FHW A;  4LF4 Q;  3I4N H;  4P75 A;  2UXB L;  3F8T A;  4R4O A;  5IE8 A;  2LXJ A;  2UXD Q;  3HOZ H;  4B3T Q;  3RLO A;  2KBN A;  1OXU A;  1ASY A;  4JI8 L;  1XNQ Q;  3RLN A;  3JAM i;  1KXL A;  4A3F H;  4KHP L;  4A93 G;  2ZTD A;  4A3E H;  2NZO A;  1R9T H;  4KHZ A;  1U5K A;  3E9H A;  5LMU Q;  2BA0 A;  3KJP A;  2AHO B;  5IYD G;  4JI5 Q;  4DV2 Q;  2K75 A;  4QJF A;  4YY3 Q;  4ALP A;  1XNR Q;  1HNX Q;  2DGY A;  2F4V L;  1VQP A;  3CCR A;  4DR6 Q;  4DV0 Q;  1IYJ B;  5JJI A;  4GN3 B;  2VQE L;  2ASB A;  2N8N A;  4P72 A;  3OW2 A;  3KF6 B;  4LWC A;  4KLK A;  3CCL A;  2Z0S A;  2JJQ A;  1EQR A;  4LF9 Q;  1RL2 A;  5M3F H;  5GRO A;  1X9N A;  3PO2 G;  4JI7 Q;  1NE3 A;  2QEX A;  2WB1 E;  2K5V A;  4HJA A;  1X3E A;  3D0F A;  1Q82 C;  1A63 A;  5IP7 H;  1IBK Q;  3K81 C;  4GLV B;  3AFQ A;  4JI3 Q;  1TWG H;  4DR7 L;  3TS0 A;  4DR3 Q;  4LF5 L;  4LFA Q;  2K52 A;  2VQF L;  1JB7 A;  4GKJ Q;  1WFQ A;  4DPG A;  3I4M G;  1FJG Q;  1IZ6 A;  1HZ9 A;  3BZC A;  2WFW A;  3GD7 A;  4JOI C;  2UUA Q;  1D7Q A;  5BR8 Q;  1J6Q A;  2WAQ E;  4TQU S;  4C2M H;  4GOP B;  3CQZ H;  3STB C;  4AQY L;  4JCV E;  3PF5 A;  2UXC L;  2Z6K C;  1TWF H;  2YTV A;  3NBH B;  3RN2 A;  4A3D G;  1AE3 A;  1I3Q H;  5GAG C;  2R93 H;  3K80 C;  3KOJ A;  2NVX H;  5C0X J;  4QIW E;  1XJV A;  1Q12 A;  1YJN A;  2JK8 A;  3GTP H;  1I94 L;  2CWP A;  1VS0 A;  2E2H H;  2ZJQ A;  2B63 G;  1HJP A;  1Y14 B;  4BXX G;  1NY4 A;  4OWT B;  5C3E G;  1GO3 E;  2XGT A;  3Q8D A;  3OTO Q;  4GKK L;  1K8G A;  1IXR A;  5GQO A;  1B7Y B;  1I6H H;  4FDB A;  1UE5 A;  2F52 A;  3PO3 H;  4DAM A;  4A3G G;  4K0K Q;  4ME3 A;  4B3R Q;  1E22 A;  4X65 Q;  3S17 H;  1U0L A;  2GVA A;  4IJL A;  5C0X I;  4POF A;  1QVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...