1AP0A

Structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the chromatin binding (chromo) domain from mouse modifier protein 1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chromatin-binding
molecule keywords MODIFIER PROTEIN 1
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ap0A00
5EKIA 2L12A 3HP3A 1X32A 4IURA 2EPBA 2HDLA 2L4NA 3IL8A 4QUCA 1EL0A 1AZQA 1WTVA 1EQTA 1HUMA 1X3QA 1B53A 2RSOA 4RA8A 5D14A 5COYA 1HFNA 3MTSA 1X3PA 2KEEA 3DEPA 2Q8RE 5JJZA 1HRJA 1F2LA 2K1BA 4RAUC 3DM1A 3SVMA 1MSHA 1U4RA 1PDQA 2RSNA 3I3CA 3N52A 4X3UA 4HAEA 2RA4A 1WTPA 2HCCA 2Q8TA 1GUWA 1F9SA 4OIKA 1G91A 2MGSA 3KBXA 2B2VA 2IL8A 1WTOA 2HCIA 2B2UC 3FPUB 5D65A 1O7YA 3KUPA 1CA6A 2K04A 1PFNA 1SSOA 1PFMA 1RTOA 2B2YA 5EPJA 2EOTA 3P7JA 3TZDA 4CJ2C 2B2WC 1B50A 1DONA 4HCSA 1QG7A 2K03A 2SDFA 2HUGA 2RVLA 4X3KA 5EPLA 1HA6A 2MPMA 1MSGA 5E4XA 2K05A 2K01A 3I8ZA 4RWSC 5T1GA 2CVRA 1TVXA 1S4ZA 1J9OA 1PLFA 3DEOA 1DOMA 1NR2A 1ZXTA 2VXWA 3Q6SA 3IFDA 3MWYW 1DOKA 1B4OA 3GV3A 4OIJA 3TN2A 2B2WA 4XT1B 4IUPA 3LWEA 5DNFA 5E4WC 1WTQA 2NYZD 1RHPA 4CJ1B 1PFBA 1BBXC 1F9QA 1U4MA 4R8IA 3I90A 1B3AA 1HFGA 4HSVA 1IKMA 2KUMA 4ZAIA 1LV9A 2K28A 1VMPA 2N55A 2KOLA 1CM9A 1O7ZA 1ICWA 3FDTA 1DZ1A 1G2SA 2J7ZA 5CBEE 3QO2A 1IL8A 1C8CA 1IKLA 2L1BA 2FINB 3GV6A 3H91A 4XT3B 4UAIA 3G7LA 4NW2A 1XYIA 1SAPA 1Q3LA 2MJ8A 1RJTA 2FFKB 5CMDA 2DY7A 2X69A 4MHEA 4X3TA 2B2TC 2B2YC 4ZLTF 1WTRA 2N88A 1F9PA 2FJ2A 1BO0A 2XIWA 3F2UA 1EIHA 2B2UA 4HEDA 2FMMA 1NAPA 1MI2A 1JE4A 2B2TA 2L9HA 1ILQA 3ONAB 1G6ZA 2R3ZA 1E0BA 1DOLA 2DY8A 1HHVA 4X3SA 1F9RA 4O42A 1CA5A 4IUTA 4ZK9B 1WD0A 1U4PA 1XX8A 1RTNA 4ZKCB 2NWGA 2JYOA 1SDFA 2X6LA 1A15A 1EOTA 5EQ0A 3UI2A 1VMCA 4U68A 1M8AA 1O80A 1ML0D 1QE6A 1RODA 3D6WA 2M2LA 1AZPA 5CBAE 1KNAA 1U4LA 2MP1A 4MN3A 3I91A 1BNZA 1G2TA 1ILPA 1ESRA 1J8IA 2KECA 2L11A 4R9WA 1JICA 1B2TA 4QUFA 2H1EA 5EJWA 3R93A 1WTXA 2NZ1D 2X6GA 1MGSA 2D9UA 4LMQD 4XDXA 5AFWA 1WTWA 1AP0A 1EIGA 1BF4A 5CORA 2HDMA 2KEDA 1KNEA 1NCVA 4DN4M 5EPKA 2KVMA 2JP1A 2B2VC 4ZKBB 1WVLA 4CJ0B 1HUNA 1QNKA 2BDNA 4IUVA 4IUQA 1WD1A 5T1IA 1NR4A 2EE1A 4IUUA 2FHTA
chains in the Genus database with same CATH superfamily
2UXBL 4IJLA 4K2LA 1E3PA 4DKAC 1D1IA 5HURA 3UDFA 4Q0FA 2RSOA 2OQ0A 5ELEA 1PFSA 2E74C 3GTGB 1HRJA 5FLXL 3P20A 3HOUH 2MO1A 2R7ZG 4GS3A 3D6CA 1PHJA 5FJ8G 2B2UC 1CA6A 1PFNA 4X64Q 1RTOA 4CDFC 1QG7A 2OF1A 4I7ZC 5JPNC 1GJXA 4EQOA 1A0IA 4YHHL 3OSOA 5IY0A 2F0SA 1N36L 4POFA 4DV0L 3IFDA 1HNZL 1ICFB 4UP9A 4IPGA 1ZKOA 2WINB 3GTPH 5FO9B 3NPPA 4DV2Q 3TREA 1N9WA 4WJ3M 1PFBA 4IPDA 2NVTB 3VYUA 1VQJA 3I90A 3LWUA 1KRTA 1KC8C 3GD7A 4K2KA 1NTGA 3CRLC 1DZ1A 1G2SA 1WTHA 1IW7D 4FP5D 3MFGA 3PO3H 1EQVA 5EGTA 1CKMA 3KBGA 1CTMA 3HOXG 1YNJC 2QCPX 1A8VA 3CU7A 4LUVA 4BY7B 1TWFH 3S2DH 4R4CA 1TXYA 1LT5D 2B63B 4A3IB 2IT1A 3AB9A 4C3JB 5ELFA 3MEHA 4NXNQ 4YCUA 4BBRB 3ICEA 3P75A 2F0KA 1RIPA 4DNTB 4A3LH 5C4JB 4JI2Q 1TWCB 4DV5Q 2XGTA 5KNBA 2YYZA 2NN6H 5ELBA 3G4SA 1U4LA 1G2TA 1PRTB 4MNOA 2E75C 1C7YA 1OXXK 4R9WA 1SFOH 1RF2D 3BVZA 4X65L 2ZTDA 4FNFA 4OXPA 1SYFA 2F52A 4A93G 1BF4A 3P1HA 2HDMA 1CKNB 1JR0D 1N32Q 2QEJC 4CJ0B 3CMEA 4X6AH 4G4KA 1HQMC 3PIOA 4IUUA 2L12A 2QDBA 4H0LC 3IL8A 3NSWA 1PV4A 4OONA 1LTTD 2ALYB 5IYBG 4TQUS 4A3KB 4QJFA 1K3BC 1PH7A 1Y1WB 3J81L 3U9SA 4S3SA 2Y0SB 1ENAA 3SVMA 2UUCQ 3OOCA 5I6YA 1Y8PB 2G9DA 1Q82C 3AMUA 4YHHQ 1PH6A 3NWSA 2AQ1B 4B3TQ 2B2VA 4DA2A 3S2HB 4J8QA 1SMYC 1O7YA 4LF5Q 1FGBD 3PGZA 4FXKC 2HT1A 1KTKA 4PQXA 2R92G 1X54A 1SJHD 2DNCA 5IWAL 1E24A 1TWGB 1YITA 2OT2A 4M1UB 3HOWH 4JI5L 4Y7NH 3S1MH 5I9PA 4BBRG 1AE2A 4JOIC 2AHOB 5EKKA 5NUCA 2AKWB 1R9TH 2E8GA 2CFMA 4IQZA 4PZ8A 4GN3B 5DNFA 2NYZD 1AW7A 3PUWA 3T53B 4UP8A 4KKUA 4GZYC 4JPBW 1LACA 3FDTA 3J7ZC 1VF5C 3EN2A 4AQYQ 5JJLA 2EXDA 1E1OA 1PTOC 1TU2B 3H91A 4CKEA 1P16A 4K0KQ 1YIJA 3KLWA 3J7A5 1H9RA 4C3HG 5IOCA 2FJ2A 4HEDA 4HIKA 1TWAH 4JVZA 4RKBA 3E0EA 1JE4A 1VQHA 1ILQA 4R1JA 2RDFA 2IX3A 3CCUA 2EY6A 3STBC 1B44D 5JEAG 1IBMQ 2F0DA 1D5XC 1XX8A 3HOUG 3Q22A 4DNRB 1X65A 2NUCA 2C9OA 2KENA 1PRTD 2R7FA 4APVA 1AZPA 2MP1A 4B9WA 4L5SA 3LNNA 3NK9A 3NBHB 1XMQQ 3FKIB 4JI0L 2X6GA 2D9UA 4LMQD 1WTWA 1JMCA 2IX0A 4ODGA 3PSIA 4F8MA 4A3FH 1NCVA 3TEHB 1I6HH 1C0AA 2VQFQ 1EYAA 2B2VC 3A56A 1QZGA 1JQYD 3RLFA 1PH1A 1JOKA 2JE6I 1FJGL 1G6PA 3BYYB 5HGQA 3KF6A 1EYCA 3VDYA 3SK4A 3A8KE 4RGNA 2ZTEA 3D3RA 1FGUA 3PIP3 1JB7A 4BBSG 5C44G 1BCPF 1D7QA 1H9KA 2BA1A 4GKKQ 3T1HQ 4DR6Q 1CQVA 2RA4A 3PUVA 3NWTA 1LTAD 5C4XG 4ZYSA 3AU7A 4NMZA 2K7VA 3J81j 4P74A 5KIXA 3PO2G 2R92H 3TZDA 2UXCL 4X66Q 4JC0A 3HOVB 4UDUC 3HRZC 3I8ZA 4LWCA 4HIDA 5EAYA 1W6KA 1WJJA 5C0XG 2B63H 3UDIA 3ULLA 5IIFA 1A62A 4BBRH 2QKIC 4RH6A 2R93B 3MAQA 1L2FA 2ID0A 4LFBL 1U4MA 1TWCH 2YTXA 5IYBH 2UUBL 2DUDA 1EEFD 4DK6C 2HQLA 2PQAB 1EUJA 1K3RA 1BCPB 1E1TA 5KGUA 3NHHA 4P71A 1SR3A 1E2WA 2F0WA 4M8AA 5ELOA 4JI8L 4JI3Q 4YCVA 3EROA 5JVH3 2C35B 3M4OH 4DXGA 4FXGC 1SE2A 4N9PA 5H1SE 1L1OB 5C3EG 2QDLA 1VQFA 2WACA 4B3RL 1WCMH 2B2TA 3PUYA 3FVQA 2R3ZA 1B70B 3BJUA 4LNQA 1V1OA 3DUZA 1CA5A 1HZ9A 4IUTA 4DV3Q 1VQBA 4BXXH 4QY7A 4ZKCB 1NSNS 1TQOA 1FNWA 1O80A 4HSPA 3J80L 3TZUA 3TP5A 1VQNA 1KNAA 5JJKA 3I91A 4IPHA 3MFYA 1BBWA 1SNQA 2ZT9C 4XQJA 2ZXRA 3PO2B 1M4VA 3R93A 3PMFA 1Y14B 5DM73 3VA5A 1DXMA 3J81c 2KVMA 5D3DA 2O2LD 4X66L 3LGJA 2UUBQ 1SMYD 1HUNA 2JA5H 2OWOA 1K8OA 4A3CH 3S9WA 5EKIA 1VQ7A 2RF4A 4F88A 3HOWB 3J81E 3S1MB 3Q24A 4JBWA 5IT9c 4K8IA 1SNDA 1SNCA 3M3YB 1MIUA 2B8GA 3DWPA 1R4PB 1HFNA 3DLLA 1Y1WG 4OL7A 1STBA 2IX1A 2K1BA 1C48A 2PCFB 1GUWA 4FF3A 2QW7A 1YNNC 5M5YB 1B7YB 5IT9E 1I94L 5EPLA 2HUGA 2CVRA 5F2DA 3F1ZA 2L55A 1HZCA 1W2BA 5FO7B 3A8IE 2SEBD 2E2IH 4I7AA 4LF7L 3NE5B 2MQHA 5M3MH 1LTBD 2EYMA 1A2UA 4OIJA 3X3MA 4AYBG 2NTSA 4B3ML 4C1NI 3S1NB 5IP7H 2NVXB 2PYKA 4FYDA 1E2VA 5JJIA 1I3QH 4C3IH 3JAMi 1CHQD 5ELDA 2NZOA 1IBKQ 2LXKA 1KRSA 2Z6BA 3FKIH 4DPGA 1VQLA 1X3GA 2NVQB 3G6EA 2IJ0A 3CCEA 2PPBC 1STYA 3NP8A 1JC7A 4JYAQ 2WAQE 1EFID 3F2CA 1D5ZC 4ZK9B 3AYHB 4DV4L 3OMGA 3H0GH 3PQIA 4A3BH 5M3FB 1YNJD 2YTVA 4IO9A 5K36H 2K50A 4QGUA 4ILWA 3K58A 3G48A 4MN3A 1SYEA 1WYDA 1N33Q 1EEID 3K5LA 4K0KL 4N8X1 4DV6L 4K5WA 2BCOA 5AFWA 4AIMA 2HD3A 1EU4A 4EVOA 4CDEC 1IYUA 5JEAH 2ZJQA 1QILA 4A3IG 2XWBB 1NMGA 1RCVD 2JQOA 2F0OA 4B9XA 2F0MA 3CCQA 1ESFA 1VCIA 4KHZA 1DYQA 3HZXA 1U9RA 1EY8A 2EE1A 4LF8Q 3OIQA 3S1RB 5KYIA 2LS01 3J7AF 2YU9B 4XIGS 4JK1C 2OTJA 2AUJD 1I4XA 5EBCA 5AJ3L 4OWTB 1FNUA 3BDOA 3GTLB 1HNXL 3DEPA 2I5LX 3G71A 1JJ2A 4JI8Q 4RAUC 4L5QA 3I3CA 1X6OA 4TKOB 4DAPA 2HCCA 2JA9A 3NQTA 4JI4L 3SHLA 4L5RC 2IL8A 5DM63 5EPJA 3V2TA 2B2WC 1YJNA 3GTGH 4KV6A 2D62A 2K05A 4RWSC 5C4XB 1GKHA 1KQSA 3NUCA 1EOVA 2MHVA 4KJOA 1WCMB 2Z6KA 1BVSA 1G291 2GN5A 2I5HA 2D0OA 3GDEA 1H95A 1UE7A 3HFZB 4B3RQ 3HOZB 3S1QH 1A2TA 1EZ8A 1HFGA 1IKMA 2PI2A 2D5DA 3MXUA 1XNQQ 2K52A 2F0HA 1QNUA 1BCPD 4L6TB 4GOPB 2N49A 5CMDA 3GTJB 1PH4A 1TWHH 1UWVA 4CHTB 1YI2A 4EQNA 4QIWE 4A3GH 4HTHA 1EYDA 1PZJD 4WRDA 4OELB 5C44H 5BR8L 4DF7A 4KN7C 3C1EA 5C3EB 1B1ZA 1RTNA 1EQRA 4A4IA 1MJCA 1EOTA 2ZTCA 1VMCA 3S15H 1JWUD 4GN4B 4BS9A 3G6JB 4GNXB 4BY1B 4V0BA 5CBAE 2WAQG 1DD2A 1VQGA 3I70A 4FDBA 4DV0Q 4PZ7A 2I07B 2L11A 1YHQA 1B2TA 1FL0A 1PTOB 4DNIA 2E2HH 4LF9Q 1PH3A 3VYTA 2KEDA 2EYOA 4DR3L 5HY6A 4GNXA 2UXDQ 4JBJA 3W5OA 3A5ZB 1OXTA 1SMXA 4RFBA 1X32A 4QUCA 1EL0A 1MJEA 2AMCB 3CPFA 2IWHA 2EXZA 5GROA 1EQQA 1Q46A 2Q2UA 1N36Q 5DLQE 3BS1A 5JOBA 1Y1VB 4YY3L 1V1PA 4HAEA 5BN5A 5M5WH 2Q8TA 5J1ZA 1XTCD 1S5DD 3QWNA 1FVIA 4X64L 3U9OA 1PA6A 3H3VC 4C3IB 2VUMB 5D65A 2EJMA 2J0TD 2K04A 3DMUA 4ME3A 1H9MA 2EJGC 2K03A 2QF7A 1AFPA 2WKCA 1B8AA 4OO1I 5E4XA 1RKNA 3W1GA 1UNSA 4O2DA 4OWXB 3Q6SA 3ERSX 2BH2A 4OGQC 3GTKH 2F3VA 1QZHA 1B4OA 3CPWA 3IRBA 3CKIB 3RZOH 3H0GB 1TS5A 1W6JA 2PQAA 1JB3A 1B3AA 1LO5D 4LFCL 5KRUA 2XRSD 4EQ5A 1PH8A 2QGQA 4B3TL 1O7ZA 2J7ZA 3T51B 3OTOQ 1VQCA 1O78A 5IGFA 2IPKD 4N9TA 4MHEA 4LFCQ 4JI1Q 2MNAA 1HTLD 2N88A 3EA6A 3OWEB 1I4RA 1NAPA 4G57A 2F4IA 4G7HC 2A68D 3QB3A 1NMFA 1YVCA 2Z4IA 2NWGA 3CCLA 2EYFA 3QIAA 1KXLA 1QE6A 5IYDG 5EKLA 1XNRQ 1SBBB 1BQQT 1KABA 4KMUC 4DV3L 4DR5L 2E76C 1JICA 3E5SA 4A93H 4G7OC 1GUGA 3OIPA 4A3FG 1N8RC 2N78A 2F0FA 4DN4M 1WVLA 2LSSA 4JV5L 1UE1A 5ELCA 1XXGA 3PIO3 3D8GA 2RCFA 1BOSA 2HDLA 1AZQA 2EQSA 1ET9A 2Z1CA 1FYCA 3PUZA 4DUYL 1SE8A 1HCZA 2CW0C 1XPUA 3MZ5A 2UXDL 3HOZH 1PMRA 2ES2A 3A0JA 4FF1A 3J80i 1F2LA 4A3BG 4QMGA 4KN4C 5CV4A 4C1NK 5FLXE 1KDCA 2F1MA 2WV6D 4X65Q 3MC0B 1ASYA 1G91A 4DR2Q 3HKSA 2ASBA 2CWPA 1HR0W 3FPPA 2F3IA 1X56A 1SSOA 1PVOA 4HJAA 2XWJB 1QVFA 4EX5A 1HA6A 4X3KA 4WFN3 3NEMA 3M85A 3AFQA 2B63G 5I2YA 1LT3D 4JW0A 4WORA 1DOMA 2F0EA 1OO9B 1Q1EA 4QF4A 4C3JG 4A3IH 3I4NH 4DR7Q 4A3GB 4JBKA 4TRDA 2VQEL 3TN2A 3T16A 3VYSA 4XT1B 5FJ8H 2E2JB 3ITPA 2J4XA 2IW3A 2VS1A 3W3AA 5C3EH 3OTOL 4FF2A 4K5VA 1D2BA 3S15B 5DEHA 4KKSA 3V96A 1I4GA 4BY1H 1EY0A 1CM9A 5LMUQ 5C5MA 4NDXA 3HOVG 4OHJA 2RQXA 3N6RA 2R93H 1XMOL 1PYSB 3BDCA 4RHSA 1HNXQ 4GN5A 5IWAQ 1C9OA 2KJXA 1F9PA 1BO0A 1GUSA 2QILA 3TP7A 5M5XB 3T1HL 3EQLC 1PH2A 3T4AC 1STHA 2L5TA 4DV1L 1V9PA 4LFBQ 4DUYQ 1IBKL 2CCZA 2EY2A 4KY6A 1KAAA 1K28A 4OEMB 3J7AV 2A6HD 4X62L 2P5ZX 2PZWA 1ET6A 2KECA 1Q86C 2RHSB 3VR3A 1LM0A 1SEBD 2JA7H 1QUQA 1QVCA 3L3OC 2JP1A 5DAUA 4KHPQ 4DR5Q 2BDNA 1GM5A 3S14H 3BDLA 2MGSA 3KBXA 3PO2H 2FHTA 2Q2IA 1VQIA 4IURA 1K73C 4NPSA 3EVQA 3JAML 5K5PA 5I9OA 1K8MA 3M7GA 3OWFA 4I65A 4GKKL 2UUAL 2Q8RE 3R2IA 3E0JA 1IYJB 3KJOA 4CKBA 3Q0AA 3W1BA 3N52A 1Q7YC 1E2ZA 1QWYA 4GLAC 3TS0A 1GVPA 4KY7A 3JC66 1Q1BA 2NB0A 1HZAA 1L0WA 3GTOH 3BZCA 2AUKA 1BDOA 2MPMA 1Z6HA 4ULLA 4C3IG 3A7AB 3UE1A 5M5YH 3I4LA 1ZXTA 4BY7G 3F2DA 2GVBA 3RD4A 1PTOF 2I5MX 1SN8A 3GV3A 4HMJA 3L9AX 4EGVA 1SNOA 2B2WA 1GUOA 1IYVA 5GQOA 3HG9A 3L0OA 1XPRA 3PUXA 3S17H 3HOYH 4QCLA 4HSVA 2KQ3A 4NKLA 1A63A 3KLRA 1VMPA 2XSCA 4A3DH 3KK7A 2EYJA 2WFWA 2TSSA 5LHY1 1S5FD 1IL8A 2Z4HA 3C3LA 3OPOA 3K7AB 1XMQL 2JA6G 1SRUA 3A74A 1S40A 2FFKB 2K6AA 3T1YQ 4P72A 4GOPC 4L63B 4X3TA 3F8TA 4QQBX 2BH8A 3K0YA 1ONLA 3I72A 3FEWX 4A3MG 2DY8A 4JG2A 2ICEC 2KCTA 1F9RA 1WD0A 3VR2A 3U4ZA 1SDFA 2XN9C 3ULPA 2N8NA 1M8AA 1JJCB 5BN3A 1I94Q 1PH5A 1GD7A 2CQAA 3K80C 5IYDH 2E2DC 4LFAQ 1J8IA 5C4HA 4DXFA 4OX9Q 5HGTA 2NZ1D 4V190 5C0XJ 3VYRA 1S5ED 2KHJA 2R92B 1I5FA 2OCEA 1OXUA 2K32A 3SK8A 1S3OA 1S72A 4FO2A 3NQIA 3TP6A 3CCVA 3Q8DA 4RG1A 1DONA 3I4NB 2EPBA 2L4NA 5IT9L 1YNND 1WTVA 4RKLA 4OO1H 2UU9Q 4IALA 2G5DA 1HUMA 4OO1G 3OW7A 2VZAA 1B53A 1F77A 4RA8A 2E2JH 3H09A 1SNMA 2A68C 3UE0A 4H44C 2HHHQ 1MSHA 4K6LA 2RSNA 1VQ5A 2EZVA 2F0QA 4DFAA 1ENCA 1Z7TA 4LF5L 2HCIA 1STAA 1PFMA 3DM3A 3GTPB 4HCSA 2PO4A 5A2QE 3HS0C 2K14A 2G9HD 2N3SA 1CZWA 2H4OA 2F0TA 4PMWA 4KHVA 1N33L 1O7LA 1SYCA 4LFAL 2RCNA 4RHRA 3K57A 1K83H 5JEAJ 1NE3A 2VQFL 1DOKA 4PV1C 4ALPA 5IYCH 1V1QA 3CC4A 2PW7A 2RBMA 5M3MG 1KLUD 3WWVA 1WTQA 5IGGA 5KNCA 3STBD 1Y69U 3D31A 3I55A 1NNXA 1U0LA 2F03A 2N55A 2K5VA 3S2DB 5AJ3Q 3A5UA 4IN3A 3FKIG 4DR3Q 1D8LA 2A8VA 3MXNB 1NBWA 3PF5A 3KLSA 3X3NA 4C3JH 4BA2I 4IPCA 4UAIA 4NW2A 3ER0A 3SE0A 2NVTH 4CDCC 3H15A 4DV5L 5IODA 5G3LF 2JA5B 1BCPC 4MZ9A 3NXWA 3U58A 1S5BD 3K7UC 3PO3B 3PIPA 3MHBA 5CV6A 1ASZA 3CC2A 1TWHB 4B3MQ 4BY7H 1LTSD 5D3IB 4A3JH 2NVYB 2IHEA 1T5EA 1RODA 5C44B 1VQDA 2WB1E 4DAYB 4LF7Q 3QJYA 2I46A 3A8JE 3NBIA 5CV9A 1UE6A 1BXTA 4QUFA 4HCEA 3TSSA 3IFTA 4XDXA 4A3DG 1I50B 2PZTA 5GAEC 3GTOB 4JYAL 4A3KH 5CORA 2K5QA 3R3OA 3E9IA 1NJIC 3M7NA 3TS2A 1Y1WH 1H9JA 1L0YB 4DAMA 2EY1A 4JI6L 1PZID 2B8FA 2BE5D 4K6DA 1ENFA 2FMCA 4KD4A 3T13A 2B29A 1HTPA 3QG1A 4K5XA 5EBDA 1II3A 2XTIA 3DM1A 2VB3X 2NVXH 1Q12A 3FRPB 2VUMG 4DV7L 1VQAA 3CQZH 3FPUB 4UP7A 4YCWA 4CDDC 3BVGA 2YTYA 3MXNA 4FXDA 2MUYA 1Z9FA 1S5CD 3W2DA 1CZGA 2K01A 3CCSA 5IGBA 3S24A 4TVAB 4MTKA 4P2CB 3RLNA 3PO3G 1FNVA 3S2HH 1NR2A 2VXWA 3KOJA 4X62Q 5C0XI 3EJIA 1Y1VG 3RN2A 1HR0L 4YWKA 3WOEA 4CJ1B 4DV1Q 4HJ8A 2K75A 1TWGH 5J22A 3KLSX 1Q8IA 1LUZA 1L1OA 3QO2A 2M00A 1IKLA 2CH4A 2FINB 3GV6A 2F0GA 4J6HA 2PW5A 3A55A 1V8QA 5FLMG 1JWSD 1PYBA 1LYLA 2DY7A 1TT2A 2X69A 2HQEA 2WKDA 3NENA 2B2YC 5FO8B 1RD9D 5FOBB 1VQMA 2L9HA 4DAYA 1IBLL 3I4MB 2ENBA 4BBSH 3QR8A 2RDGA 2MO0A 4K14A 2WB1B 3C46A 2YU9H 4DR4Q 2K33A 2PNRC 5LMNW 3HOWG 2JA6H 2OEOA 4U68A 4R4TA 2Z9HA 3AQQA 5GAGC 5IP7G 2QEXA 3GP7A 1UEBA 4DR6L 4O0AA 5JPMC 4DR7L 4RGMA 1ESRA 1EWIA 4DR4L 4F87A 3HOXB 4R4OA 1UAPA 2VQEQ 2CHBD 3NBHA 3J81i 3Q23A 1FJGQ 1EY4A 3DWQA 5C4XH 4PZ6A 4KY5A 2Z8LA 3OW2A 5IP9G 2WIIB 1FR3A 2Z6KC 4A93B 2PQEA 3I4MG 2EJFC 1DCZA 3FMCA 2JJQA 3AFPA 3BG3A 4NB3A 5COYA 3URYA 4IZ8A 4DR2L 3S1QB 2D0PA 2M9VA 1GUNA 3OHXC 4GLVB 3HOVH 4R4IA 1SE3A 2JA8H 2LFNA 1CFMA 3J80c 4DUZL 5IP9H 1OTCA 3GTMH 5LMNL 4C3HH 2A6HC 1XNQL 5A2QL 3R2TA 4KJNA 3CCJA 4C2MH 4CJ2C 3P7JA 1B50A 2CH4W 2FXQA 3GTJH 1TIID 4DV2L 3M4YA 2V1CC 4PNYA 1F2ZA 4KI0A 2UXBQ 1J9OA 3DEOA 5CV8A 4IJHA 4RGOS 3CAMA 1FD7D 1A3VA 3V05A 2Z0SA 1B3QA 5E4WC 2B3GA 2A6ED 2XVSA 4B08A 4YY3Q 3AEVA 2KUMA 2OQKA 2VNUD 4LK1C 2KOLA 1EFWA 3O13A 3DXJC 1C8CA 2L1BA 2PMZE 1A3TA 2WAQB 2D2CC 3G7LA 2JXMB 1L1OC 2A6EC 5KEEA 1RJTA 2V4DA 4DV4Q 4HIMA 5E3FA 3BZDB 4GNXC 2O5JC 4A3EH 1EIHA 3IKJA 2EVBA 1K0RA 3QOJA 2EYLA 2AQ2B 4QB4A 1I6VC 2ZM6Q 4A76A 1PYWD 1C4QA 1VDZA 5KYLA 1KAWA 2F4VL 1HPCA 1Y1VH 1B9MA 4A3MB 1MHWC 3UDXA 1VQOA 1VQ8A 5J3BA 4EQPA 5L37A 1M90C 3D6WA 1E22A 4K8JA 3UDGA 1IBML 5GAHC 3D4DA 3M9BA 1W3SA 3A7LA 2H1EA 1XMOQ 2DGYA 1J5EQ 3RZDH 2JSOA 1EY9A 2CW0D 3K5OA 1CUKA 2VB2X 3BVMA 2NN6G 2A69D 1VQ9A 3TBIB 2F0LA 5E7NA 4Z9CB 2DJGC 3K59A 1VQ6A 2A74C 4DUZQ 1TS2A 1JOQA 2A1AA 2EYHA 5D14A 2Q8IB 5C4JH 1PZKD 1X3PA 1GXDC 1I4HA 1GHJA 1CI3M 1TS4A 1MBYA 1HH2P 4RCOA 5FLMH 1EWHA 3EIVA 4OIKA 2E2IB 2KHIA 5KNDA 4KK7A 3PF4A 5LMNQ 1CT1D 2TMPA 1GOZA 3KF8A 4CBVA 5BR8Q 1MSGA 3RR5A 3NELA 1S4ZA 2F0PA 3S1NH 3MA2B 1Q8KA 3BZKA 2R7ZH 1JE5A 2A5HA 2RKSA 1K9MC 1PRTF 2R7DA 2BA0A 4HJ7A 5CC4A 1Y8OB 4JI5Q 4NXNL 1E7ZA 4JI1L 2L15A 5M3MB 2JK8A 1ICWA 4H7BA 1YEZA 3DHQA 3HKZG 1IXRA 3OYYA 1LTLA 2SNSA 3S17B 1SAPA 1G8ZD 1YJWA 5C6AA 1BBUA 1IHZA 4JOIA 2PNHA 1HR0Q 4Y52H 4O42A 4U673 1U4PA 1LTID 1R9TB 4DV6Q 1EIYB 2KBNA 1DJRD 3M4QA 1HJPA 4XQNA 1ML0D 2JN4A 2JEAI 4UHVA 1O7IA 3C1FA 1EU3A 4A3BB 3SXHA 2AQ3B 4PG3A 2XNAC 5J39A 4C2MB 4ZUJA 4IFDG 4B3SL 1CHPD 1X9NA 3KFUA 1YHAA 1JT8A 1KNEA 5A35A 2CWAA 5EPKA 1A3UA 3WDNA 1F2YA 3CD6A 4LF8L 1TWAB 5E1FA 4LUOA 1JCKB 3HP3A 3NTIA 1PTOD 1LT6D 2EY5A 3TQYA 3J7YW 2Q2TA 1AEXA 3SR1A 2EIFA 2IHFA 5JJZA 1NY4A 2R6GA 4GOPA 4X3UA 1WTPA 1EY6A 3RNUA 1KLGD 2VL6A 3CXCA 3HKZB 5IGEA 4L5TA 1N34L 3B6YA 3D0FA 1WTOA 4LF9L 1OXSC 5JAVA 1CKOA 4DGZA 1YHBA 2Y0SE 3RLOA 3GTQB 4YWMA 4FVMA 4RMFA 5G3LD 1H9SB 4LJZC 4WJ4A 1HNWL 4GKJQ 1TKWB 3QOLA 2F4VQ 3GO5A 1PLFA 1WOCA 2JEBI 4N8FA 1X3EA 1X55A 3MWYW 1CQFA 3K6OA 3LWEA 4PMCA 1SYGA 2A73B 4JI6Q 3BU2A 2BOSA 3U4VA 1H9SA 1BBXC 4A3MH 3LX0A 4ZAIA 4ZRZA 2VW9A 1HNZQ 4DK1A 1MKHA 1A6XA 2NBFA 1TWFB 2ZXOA 3I4NG 3JAMc 1TS3A 4AYBB 1D1KA 4DAVA 4KKTA 1KD1C 1HNWQ 3OMCA 2ZXPA 2B39A 3A54A 1UUPA 3K5MA 4A3JG 2K5NA 4DK3C 3ND8A 3MXPA 1KDAA 1QOHA 2DNEA 2B2UA 5CR3A 3S14B 3ULJA 4KLKA 1IW7C 4IOAA 3HKZE 4XYQA 1G6ZA 4X3SA 4HN7A 4R8NA 1SFOB 4POGA 1VQPA 3J80E 4ZCKA 1PTOH 1GUTA 2DJFC 4OWWB 3BYTB 4A3LG 2DN8A 1BNZA 2A69C 1ILPA 1HQRD 1B9NA 1F2MA 1TY0A 3F2BA 4YIJA 4JI7Q 1VQ4A 3K81C 4LF4L 3CHBD 3D4RA 4HR7B 1K8GA 2F0JA 4A3JB 3M4OB 4NXML 1HA5A 4J1MA 4ZQ3A 4IFDJ 3H6MA 5ELNA 1QNKA 2GA4B 3S16H 2F3WA 4IUQA 3CRKC 2E2HB 3K0XA 4XYOA 1TR5A 2R7ZB 5CV7A 3SEBA 4LF6Q 1X3QA 1ZYRC 2GVAA 2F0NA 2VY3A 2HHHL 5CGKA 3JAME 1TY2A 4BXXG 1I4PA 4IUNA 1R4QB 1XPOA 2YV5A 2MFIA 1CSQA 2LXJA 2JA5G 3H3VI 3ZYYX 4UY8C 4A75A 4QIWB 4P75A 3RUZA 5C4ZA 5C3XA 1T5XD 1JWMD 1SNPA 3K7AH 2B2YA 2EOTA 5C3WA 3RZOB 3MXGA 1K8AC 3HOYG 3SGIA 1TVXA 2F0IA 4J15A 3MEFA 4NP5A 2EDGA 3CQZB 3L2PA 4HJ9A 2VUMH 2K5DA 1JORA 3RN5A 2F0UA 1NUCA 3I7FA 4Q5VA 1KHIA 4DU9A 5IE8A 1Y8NB 2H5XA 1RHPA 1WCMG 4GLXA 3R8BA 1LV9A 3E9HA 3ND9A 3GTKB 4DV7Q 4XXEA 3H0GG 2PI2E 1RL2A 4LUZA 1YNXA 2KCMA 2SOBA 3C2PA 5K36G 3CF5A 1XYIA 4TSSA 2AWOA 2XIWA 4BWGB 4H02A 3TMEA 2CKZB 2ICIA 4CKCA 3ONAB 5FK9C 1E0BA 1DOLA 3NTHA 3HOZG 1IZ6A 5BN4A 4JI3L 4G7ZC 1SLJA 2KA7A 2UU9L 2JYOA 3SK5A 2CQOA 1STGA 2NTTA 5LMUL 4A3FB 4LF4Q 1I6HB 1LABA 3I4MH 4BBSB 1Q81C 2ATWA 2LMCB 4AH6A 4ID6A 1UEAB 1WTXA 3HGBA 1YJ9A 1MGSA 1QJOA 2NVQH 1AP0A 1EIGA 4JI2L 3GTQH 1DGSA 4XQQA 2Q2HA 4A3KG 1M1KC 5I2XA 4JBMA 1ZYRD 4RGTA 4IUVA 2WB1G 4F7XA 5T1IA 4QL5A 3HOXH 5M3FG 5ISRA 1K83B 1VF7A 1EQTA 5TSSA 1EYGA 3KDFB 3D4WA 1X3FA 1V43A 1SROA 2RDHA 3I4OA 2O5IC 1N34Q 1BKBA 5C5LA 2R93G 4E6IA 2WP8J 1BUVT 4ME5A 2HIXA 2NZHA 4LAAA 1EY7A 4A3CG 1IBLQ 3KDFA 5IGDA 2JA8B 5T1GA 3GTMB 1STEA 3SK6A 4C3HB 1EIFA 2RHQB 4PMBA 4GKJL 3TDQA 4IUPA 4B3SQ 1AN8A 1U5KA 4YWLA 4CGYB 4DK0A 4A3EG 3GTLH 1VQEA 3PCOB 4A3GG 4R8IA 2A19A 2UUCL 1G51A 3HOUB 4KHPL 1UE5A 1EZ6A 2NVYH 1QVGA 1QUQB 2PZUA 3KF8B 1T9HA 5M5XH 1HXYD 3I73A 1JOOA 1I4QA 1I50H 1Q3LA 3TP8A 2BE5C 2K4KA 3I56A 4IOCA 2R61A 2B2TC 2ZJRA 2KHSA 2FMMA 1WFQA 3S16B 3CP0A 1MI2A 1QB5D 4MTNA 1OXVA 3CCRA 1LTGD 2O4XA 2JA7G 5C0XH 1LLRD 3VR6A 3M4PA 2X6LA 1KDBA 1IL2A 1VQKA 4A3EB 5EQ0A 3UI2A 5FLXc 1PH9A 1J6QA 4R4QA 2M2LA 2K5HA 2OXPA 1MD2D 4L8JA 1Z47A 4WJWA 1BR9A 3I2ZA 5EJWA 3H3VH 4O1NA 4HJ5A 3PV0A 4LF6L 4H13C 2JA8G 4HIOA 5LL6S 3M3YH 1AH9A 2NN6I 3E3XA 3SDZA 1WD1A 4FF4A 2OTLA 1SE4A 4AYBE 1HZBA 1YZ6A 3CCMA 3VR5A 2E5LL 3RZDB 3H94A 2JA7B 3K5NA 4BY1G 3RMHA 5JVG3 2Y0SG 3L7ZC 4UPAA 3VA7A 3MTSA 3T1YL 2KEEA 5CYUA 1VS0A 1D6EC 1SJED 4ZUIA 3T56B 3FHWA 1PXUA 1DM0B 3EFXD 1U4RA 1AE3A 1PDQA 1EWCA 3FP9A 4LW1A 1F9SA 4OX9L 5IGCA 5M9OA 3HEJA 4C56C 2KCNA 3KUPA 4DR1Q 1RDPD 3TRZA 1L0XB 1SYDA 1P8LA 1XJVA 2SDFA 2RVLA 2E5LQ 3K8AA 3EBEA 3CC7A 3CMAA 1CK1A 3HOYB 1SYBA 1ZEQX 1N32L 3NTKA 1GO3E 1I3QB 3ZJYC 1XNRL 4RCNA 5I4DA 1KIXA 2PMZB 2HIVA 2IY5B 2AWNA 2C5CA 1STNA 2SNMA 1F9QA 2QA4A 2JA6B 4DR1L 2K28A 5M5WB 1K0SA 1Q90A 3KYHC 1GHKA 3VR4A 3E6ZX 1LTRD 1YBYA 5CBEE 1CSPA 1WI5A 4HMIA 2UXCQ 4XT3B 3DWAA 1SXTA 4AQYL 3ERQA 1XWEA 2MJ8A 4JI0Q 2ZM6L 1CKNA 1PRTC 3GQBA 4ZLTF 5IYCG 1WTRA 4A3DB 5M3FH 4KTAA 4NXMQ 3F2UA 5LL6X 3KJPA 4MIUA 5CV5A 2F0VA 1D5MC 5I6WA 4Y7NB 5FKAC 2XRQD 1HHVA 2LY7A 4KD3A 3CW2C 4ABNA 4JI4Q 3KF6B 1V1PB 4BA1I 1KL9A 1A15A 1LT4D 1J5EL 3U50C 2BDOA 1EY5A 4JCVE 3MVVA 4JV5Q 4XTCS 2L0CA 2EYPA 1JJGA 4IFDH 2LKVA 4IFDI 3S1RH 2ZJPA 2I0QA 2K5WA 4JI7L 4ZKBB 3WOFA 4P73A 2UUAQ 3IAYA 1QCBD 1NR4A 1XTDA 2KCCA 5GADC
chains in the Genus database with same CATH topology
4K2LA 1D1IA 5HURA 4Q0FA 2RSOA 5ELEA 2E74C 3GTGB 1HRJA 5FLXL 3P20A 3D6CA 2B2UC 1CA6A 1PFNA 1RTOA 1QG7A 2OF1A 4I7ZC 5JPNC 1GJXA 4EQOA 3OSOA 2F0SA 3IFDA 1ZKOA 2WINB 5FO9B 3NPPA 1PFBA 2NVTB 3VYUA 3I90A 3LWUA 3GD7A 4K2KA 3CRLC 1DZ1A 1G2SA 1IW7D 4FP5D 3MFGA 1EQVA 5EGTA 3KBGA 1CTMA 1YNJC 2QCPX 3CU7A 4BY7B 1LT5D 2B63B 4A3IB 2IT1A 3AB9A 4C3JB 5ELFA 3MEHA 4BBRB 3P75A 2F0KA 4DNTB 5C4JB 1TWCB 5KNBA 2YYZA 2NN6H 5ELBA 1U4LA 1G2TA 1PRTB 2E75C 1OXXK 4R9WA 1RF2D 3BVZA 4FNFA 1SYFA 1BF4A 3P1HA 2HDMA 1JR0D 2QEJC 4CJ0B 4G4KA 1HQMC 4IUUA 2L12A 2QDBA 4H0LC 3IL8A 3NSWA 1LTTD 4TQUS 4A3KB 1Y1WB 3J81L 3U9SA 4S3SA 2Y0SB 1ENAA 3SVMA 3OOCA 5I6YA 1Y8PB 2G9DA 3AMUA 3NWSA 2AQ1B 2B2VA 4DA2A 3S2HB 4J8QA 1SMYC 1O7YA 1FGBD 4FXKC 1KTKA 4PQXA 1SJHD 2DNCA 1TWGB 2OT2A 4M1UB 5I9PA 5EKKA 5NUCA 4IQZA 5DNFA 2NYZD 1AW7A 3PUWA 3T53B 4KKUA 4GZYC 1LACA 3FDTA 1VF5C 1PTOC 1TU2B 3H91A 4CKEA 1H9RA 4C3HG 5IOCA 2FJ2A 4HEDA 4RKBA 1JE4A 1ILQA 2RDFA 2IX3A 2EY6A 1B44D 5JEAG 2F0DA 1D5XC 1XX8A 3Q22A 4DNRB 2NUCA 2C9OA 1PRTD 1AZPA 2MP1A 4B9WA 3LNNA 3NK9A 3FKIB 2X6GA 2D9UA 4LMQD 1WTWA 2IX0A 4ODGA 4F8MA 1NCVA 1EYAA 2B2VC 3A56A 1JQYD 3RLFA 1JOKA 2JE6I 3BYYB 1EYCA 3SK4A 3A8KE 4RGNA 3D3RA 3PIP3 1BCPF 1H9KA 2BA1A 1CQVA 2RA4A 3PUVA 3NWTA 1LTAD 4ZYSA 3AU7A 4NMZA 2K7VA 5KIXA 3TZDA 3HOVB 4UDUC 3HRZC 3I8ZA 1W6KA 5C0XG 5IIFA 2QKIC 4RH6A 2R93B 3MAQA 2ID0A 1U4MA 1EEFD 1BCPB 5KGUA 3NHHA 1E2WA 2F0WA 4M8AA 3EROA 5JVH3 4DXGA 4FXGC 1SE2A 4N9PA 2WACA 2B2TA 3PUYA 3FVQA 2R3ZA 1V1OA 3DUZA 1CA5A 4IUTA 4ZKCB 1NSNS 1TQOA 1FNWA 1O80A 4HSPA 3J80L 3TZUA 3TP5A 1KNAA 3I91A 3MFYA 1SNQA 2ZT9C 4XQJA 2ZXRA 3PO2B 1M4VA 3R93A 3PMFA 5DM73 3VA5A 1DXMA 2KVMA 5D3DA 2O2LD 1SMYD 1HUNA 1K8OA 3S9WA 5EKIA 4F88A 3HOWB 3J81E 3S1MB 3Q24A 4JBWA 4K8IA 1SNDA 1SNCA 3M3YB 2B8GA 3DWPA 1R4PB 1HFNA 4OL7A 1STBA 2IX1A 2K1BA 1C48A 2PCFB 1GUWA 4FF3A 1YNNC 5M5YB 5IT9E 5EPLA 2HUGA 2CVRA 5F2DA 2L55A 5FO7B 3A8IE 2SEBD 3NE5B 1LTBD 2EYMA 1A2UA 4OIJA 3X3MA 2NTSA 4C1NI 3S1NB 2NVXB 2PYKA 4FYDA 1E2VA 1CHQD 5ELDA 2NVQB 2IJ0A 2PPBC 1STYA 3NP8A 1JC7A 1EFID 1D5ZC 4ZK9B 3OMGA 5M3FB 1YNJD 5K36H 4ILWA 3K58A 4MN3A 1SYEA 1EEID 3K5LA 4K5WA 2BCOA 5AFWA 1EU4A 4EVOA 1IYUA 5JEAH 1QILA 2XWBB 1RCVD 2F0OA 4B9XA 2F0MA 1ESFA 1VCIA 4KHZA 1DYQA 3HZXA 1U9RA 1EY8A 2EE1A 3OIQA 3S1RB 5KYIA 2LS01 3J7AF 2YU9B 4XIGS 4JK1C 2AUJD 1I4XA 5EBCA 1FNUA 3BDOA 3GTLB 3DEPA 4RAUC 3I3CA 4TKOB 4DAPA 2HCCA 3NQTA 3SHLA 2IL8A 5DM63 5EPJA 3V2TA 2B2WC 4KV6A 2D62A 2K05A 4RWSC 5C4XB 3NUCA 2MHVA 4KJOA 1WCMB 1G291 3HOZB 1A2TA 1EZ8A 1HFGA 1IKMA 2D5DA 3MXUA 2F0HA 1QNUA 1BCPD 4L6TB 5CMDA 3GTJB 4CHTB 4EQNA 4HTHA 1EYDA 1PZJD 4WRDA 4DF7A 4KN7C 3C1EA 5C3EB 1B1ZA 1RTNA 1EOTA 1VMCA 1JWUD 4BS9A 3G6JB 4BY1B 4V0BA 5CBAE 1DD2A 3I70A 2I07B 2L11A 1B2TA 1PTOB 3VYTA 2KEDA 2EYOA 1OXTA 4RFBA 1X32A 4QUCA 1EL0A 2IWHA 2EXZA 3BS1A 5JOBA 1Y1VB 1V1PA 4HAEA 5BN5A 2Q8TA 5J1ZA 1XTCD 1S5DD 3QWNA 3U9OA 3H3VC 4C3IB 2VUMB 5D65A 2EJMA 2J0TD 2K04A 3DMUA 1H9MA 2EJGC 2K03A 2QF7A 1AFPA 2WKCA 4OO1I 5E4XA 1RKNA 1UNSA 3Q6SA 4OGQC 2F3VA 1B4OA 3CKIB 3H0GB 1TS5A 1W6JA 1JB3A 1B3AA 1LO5D 5KRUA 2XRSD 1O7ZA 2J7ZA 3T51B 1O78A 5IGFA 2IPKD 4N9TA 4MHEA 1HTLD 2N88A 3EA6A 3OWEB 1I4RA 1NAPA 4G57A 2F4IA 4G7HC 2A68D 3QB3A 2Z4IA 2NWGA 2EYFA 3QIAA 1QE6A 5EKLA 1SBBB 1BQQT 1KABA 4KMUC 2E76C 1JICA 3E5SA 4G7OC 1GUGA 3OIPA 2F0FA 4DN4M 1WVLA 5ELCA 1XXGA 3PIO3 3D8GA 1BOSA 2HDLA 1AZQA 1ET9A 2Z1CA 1FYCA 3PUZA 1HCZA 2CW0C 3MZ5A 1PMRA 4FF1A 1F2LA 4QMGA 4KN4C 5CV4A 4C1NK 5FLXE 1KDCA 2F1MA 2WV6D 1G91A 3MC0B 3FPPA 1SSOA 2XWJB 1HA6A 4X3KA 4WFN3 3M85A 5I2YA 1LT3D 4WORA 1DOMA 2F0EA 1OO9B 1Q1EA 4QF4A 4C3JG 4A3GB 4TRDA 3TN2A 3T16A 3VYSA 4XT1B 2E2JB 3ITPA 2J4XA 2IW3A 3W3AA 4FF2A 4K5VA 1D2BA 3S15B 5DEHA 4KKSA 3V96A 1I4GA 1EY0A 1CM9A 5C5MA 4NDXA 4OHJA 2RQXA 3N6RA 3BDCA 4RHSA 2KJXA 1F9PA 1BO0A 1GUSA 2QILA 3TP7A 5M5XB 3EQLC 3T4AC 1STHA 2L5TA 2EY2A 4KY6A 1KAAA 3J7AV 2A6HD 2PZWA 1ET6A 2KECA 3VR3A 1SEBD 3L3OC 2JP1A 5DAUA 2BDNA 3BDLA 2MGSA 3KBXA 2FHTA 4IURA 3EVQA 3JAML 5K5PA 5I9OA 1K8MA 3M7GA 3OWFA 4I65A 2Q8RE 3R2IA 3E0JA 4CKBA 3Q0AA 3N52A 1E2ZA 1QWYA 4KY7A 1Q1BA 2NB0A 2AUKA 1BDOA 2MPMA 1Z6HA 4ULLA 4C3IG 3A7AB 3I4LA 1ZXTA 3RD4A 1PTOF 3GV3A 4HMJA 3L9AX 4EGVA 1SNOA 2B2WA 1GUOA 1IYVA 3HG9A 3PUXA 4QCLA 4HSVA 2KQ3A 4NKLA 3KLRA 1VMPA 2XSCA 3KK7A 2EYJA 2TSSA 5LHY1 1S5FD 1IL8A 2Z4HA 3C3LA 3OPOA 3K7AB 2FFKB 2K6AA 4L63B 4X3TA 3K0YA 1ONLA 3I72A 3FEWX 2DY8A 2ICEC 1F9RA 1WD0A 3VR2A 1SDFA 2XN9C 1M8AA 5BN3A 2CQAA 2E2DC 1J8IA 5C4HA 4DXFA 5HGTA 2NZ1D 4V190 5C0XJ 3VYRA 1S5ED 2R92B 1OXUA 2K32A 3SK8A 4FO2A 3NQIA 3TP6A 1DONA 3I4NB 2EPBA 2L4NA 5IT9L 1YNND 1WTVA 4RKLA 4OO1H 4IALA 1HUMA 4OO1G 3OW7A 1B53A 1F77A 4RA8A 3H09A 1SNMA 2A68C 4H44C 1MSHA 4K6LA 2RSNA 2EZVA 2F0QA 4DFAA 1ENCA 1Z7TA 2HCIA 1STAA 1PFMA 3GTPB 4HCSA 2PO4A 5A2QE 3HS0C 2G9HD 1CZWA 2H4OA 2F0TA 4PMWA 4KHVA 1O7LA 1SYCA 4RHRA 3K57A 5JEAJ 1DOKA 4PV1C 2PW7A 2RBMA 1KLUD 1WTQA 5IGGA 5KNCA 1Y69U 3D31A 2F03A 2N55A 3S2DB 4IN3A 3KLSA 3X3NA 4BA2I 3SE0A 4UAIA 4NW2A 5IODA 5G3LF 2JA5B 1BCPC 3NXWA 1S5BD 3PO3B 3MHBA 5CV6A 1TWHB 1LTSD 5D3IB 2NVYB 1T5EA 1RODA 5C44B 3QJYA 2I46A 3A8JE 3NBIA 5CV9A 1BXTA 4QUFA 4HCEA 3TSSA 3IFTA 4XDXA 1I50B 2PZTA 3GTOB 5CORA 2K5QA 3R3OA 3M7NA 1H9JA 1L0YB 2EY1A 1PZID 2B8FA 2BE5D 4K6DA 1ENFA 2FMCA 4KD4A 3T13A 1HTPA 3QG1A 4K5XA 5EBDA 1II3A 3DM1A 2VB3X 1Q12A 3FRPB 3FPUB 3BVGA 3MXNA 4FXDA 2MUYA 3W2DA 1S5CD 1CZGA 2K01A 5IGBA 4P2CB 1FNVA 1NR2A 2VXWA 5C0XI 3EJIA 3WOEA 4CJ1B 5J22A 3KLSX 1Q8IA 3QO2A 2M00A 1IKLA 2FINB 3GV6A 2F0GA 2PW5A 4J6HA 3A55A 1V8QA 1JWSD 2DY7A 1TT2A 2X69A 2HQEA 2WKDA 2B2YC 5FO8B 1RD9D 5FOBB 2L9HA 4DAYA 3I4MB 2ENBA 2RDGA 4K14A 2WB1B 3C46A 2K33A 2PNRC 2OEOA 4U68A 3GP7A 5JPMC 4RGMA 1ESRA 4F87A 3HOXB 1UAPA 2CHBD 3NBHA 3Q23A 1EY4A 3DWQA 4KY5A 2Z8LA 2WIIB 1FR3A 4A93B 2PQEA 2EJFC 1DCZA 3FMCA 3BG3A 3URYA 5COYA 4IZ8A 3S1QB 2M9VA 1GUNA 3OHXC 1SE3A 2LFNA 1CFMA 2A6HC 5A2QL 3R2TA 4KJNA 4CJ2C 3P7JA 1B50A 1TIID 3M4YA 4PNYA 1F2ZA 4KI0A 1J9OA 5CV8A 3DEOA 4RGOS 1FD7D 1A3VA 3V05A 5E4WC 2A6ED 2XVSA 4B08A 2KUMA 2VNUD 4LK1C 2KOLA 3O13A 3DXJC 1C8CA 2L1BA 1A3TA 2WAQB 2D2CC 3G7LA 2JXMB 5KEEA 2A6EC 1RJTA 2V4DA 5E3FA 3BZDB 2O5JC 1EIHA 3IKJA 2EVBA 3QOJA 2EYLA 2AQ2B 4QB4A 1I6VC 1PYWD 1C4QA 1VDZA 5KYLA 1HPCA 1B9MA 4A3MB 4EQPA 3D6WA 4K8JA 3D4DA 3A7LA 2H1EA 2JSOA 1EY9A 2CW0D 3K5OA 2VB2X 3BVMA 2NN6G 2A69D 3TBIB 2F0LA 4Z9CB 3K59A 2A74C 1TS2A 1JOQA 2EYHA 5D14A 2Q8IB 1PZKD 1X3PA 1GXDC 1I4HA 1TS4A 1GHJA 1CI3M 1MBYA 4RCOA 1EWHA 4OIKA 2E2IB 5KNDA 4KK7A 1CT1D 2TMPA 1GOZA 3KF8A 4CBVA 1MSGA 1S4ZA 2F0PA 3MA2B 2A5HA 2RKSA 1PRTF 2BA0A 5CC4A 1Y8OB 5M3MB 1ICWA 4H7BA 3DHQA 2SNSA 3S17B 1SAPA 1G8ZD 5C6AA 1IHZA 4O42A 4U673 1U4PA 1LTID 1R9TB 1DJRD 4XQNA 1ML0D 2JEAI 3C1FA 1EU3A 4A3BB 3SXHA 2AQ3B 2XNAC 5J39A 4C2MB 4ZUJA 4IFDG 1CHPD 1KNEA 5A35A 5EPKA 1A3UA 3WDNA 1F2YA 1TWAB 5E1FA 1JCKB 3HP3A 3NTIA 1PTOD 1LT6D 2EY5A 3J7YW 1AEXA 3SR1A 5JJZA 2R6GA 4X3UA 1WTPA 1EY6A 1KLGD 3HKZB 5IGEA 1WTOA 1OXSC 5JAVA 4DGZA 3GTQB 4FVMA 5G3LD 1H9SB 4LJZC 1TKWB 3QOLA 3GO5A 1PLFA 2JEBI 3MWYW 1CQFA 3K6OA 3LWEA 4PMCA 1SYGA 2A73B 2BOSA 1H9SA 1BBXC 3LX0A 4ZAIA 4ZRZA 4DK1A 1A6XA 2NBFA 1TWFB 2ZXOA 1TS3A 4AYBB 1D1KA 4DAVA 4KKTA 3OMCA 2ZXPA 2B39A 3A54A 1UUPA 3K5MA 3ND8A 3MXPA 1KDAA 1QOHA 2DNEA 2B2UA 5CR3A 3S14B 1IW7C 4XYQA 1G6ZA 4X3SA 4HN7A 4R8NA 1SFOB 3J80E 1PTOH 1GUTA 3BYTB 2DN8A 1BNZA 2A69C 1ILPA 1HQRD 1B9NA 1F2MA 1TY0A 4YIJA 3CHBD 3D4RA 4HR7B 2F0JA 4A3JB 3M4OB 1HA5A 4J1MA 4ZQ3A 4IFDJ 3H6MA 1QNKA 2GA4B 2F3WA 4IUQA 3CRKC 2E2HB 4XYOA 1TR5A 2R7ZB 5CV7A 3SEBA 1X3QA 1ZYRC 2F0NA 5CGKA 3JAME 1TY2A 1I4PA 4IUNA 1R4QB 3ZYYX 4QIWB 3RUZA 5C4ZA 5C3XA 1T5XD 1JWMD 1SNPA 2B2YA 2EOTA 5C3WA 3RZOB 3MXGA 1TVXA 2F0IA 4NP5A 2EDGA 3CQZB 2K5DA 1JORA 2F0UA 1NUCA 4Q5VA 4DU9A 1Y8NB 1RHPA 3R8BA 1LV9A 3ND9A 3GTKB 4XXEA 2SOBA 3C2PA 5K36G 1XYIA 4TSSA 2AWOA 2XIWA 4BWGB 3TMEA 4CKCA 2ICIA 3ONAB 5FK9C 1E0BA 1DOLA 3NTHA 5BN4A 4G7ZC 2KA7A 2JYOA 3SK5A 1STGA 2NTTA 4A3FB 1I6HB 1LABA 4BBSB 2LMCB 4ID6A 1UEAB 1WTXA 3HGBA 1MGSA 1QJOA 1AP0A 1EIGA 4XQQA 5I2XA 1ZYRD 4RGTA 4IUVA 4F7XA 5T1IA 5ISRA 1K83B 1VF7A 1EQTA 5TSSA 3D4WA 1V43A 2RDHA 2O5IC 5C5LA 4E6IA 2WP8J 1BUVT 4ME5A 4LAAA 1EY7A 5IGDA 2JA8B 5T1GA 3GTMB 1STEA 3SK6A 4C3HB 4PMBA 3TDQA 4IUPA 1AN8A 4CGYB 4DK0A 4R8IA 3HOUB 1EZ6A 2PZUA 1HXYD 3I73A 1JOOA 1I4QA 1Q3LA 3TP8A 2BE5C 2R61A 2B2TC 2KHSA 2FMMA 3S16B 1MI2A 1QB5D 1OXVA 1LTGD 2O4XA 5C0XH 1LLRD 3VR6A 2X6LA 1KDBA 4A3EB 5EQ0A 3UI2A 2M2LA 2OXPA 1MD2D 4L8JA 1Z47A 4WJWA 1BR9A 5EJWA 4O1NA 3PV0A 4H13C 5LL6S 2NN6I 3SDZA 1WD1A 4FF4A 1SE4A 3VR5A 3RZDB 3H94A 2JA7B 3K5NA 3RMHA 5JVG3 3L7ZC 3VA7A 3MTSA 2KEEA 5CYUA 3T56B 1D6EC 4ZUIA 1SJED 1PXUA 1DM0B 3EFXD 1U4RA 1PDQA 1EWCA 1F9SA 5IGCA 5M9OA 3HEJA 4C56C 2KCNA 3KUPA 1RDPD 1L0XB 1SYDA 2SDFA 2RVLA 1CK1A 3HOYB 1SYBA 1ZEQX 3NTKA 1I3QB 4RCNA 5I4DA 2PMZB 2AWNA 2C5CA 1STNA 2SNMA 1F9QA 2JA6B 2K28A 5M5WB 1Q90A 1GHKA 3VR4A 3E6ZX 1LTRD 5CBEE 4HMIA 4XT3B 3DWAA 1SXTA 3ERQA 1XWEA 2MJ8A 1PRTC 3GQBA 4ZLTF 1WTRA 4A3DB 4KTAA 3F2UA 5LL6X 4MIUA 5CV5A 2F0VA 1D5MC 5I6WA 4Y7NB 5FKAC 2XRQD 1HHVA 2LY7A 4KD3A 4ABNA 1V1PB 4BA1I 1A15A 1LT4D 2BDOA 1EY5A 3MVVA 4XTCS 2L0CA 2EYPA 4IFDH 2LKVA 4IFDI 2K5WA 4ZKBB 3WOFA 3IAYA 1QCBD 1NR4A 2KCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKI A;  2L12 A;  3HP3 A;  1X32 A;  4IUR A;  2EPB A;  2HDL A;  2L4N A;  3IL8 A;  4QUC A;  1EL0 A;  1AZQ A;  1WTV A;  1EQT A;  1HUM A;  1X3Q A;  1B53 A;  2RSO A;  4RA8 A;  5D14 A;  5COY A;  1HFN A;  3MTS A;  1X3P A;  2KEE A;  3DEP A;  2Q8R E;  5JJZ A;  1HRJ A;  1F2L A;  2K1B A;  4RAU C;  3DM1 A;  3SVM A;  1MSH A;  1U4R A;  1PDQ A;  2RSN A;  3I3C A;  3N52 A;  4X3U A;  4HAE A;  2RA4 A;  1WTP A;  2HCC A;  2Q8T A;  1GUW A;  1F9S A;  4OIK A;  1G91 A;  2MGS A;  3KBX A;  2B2V A;  2IL8 A;  1WTO A;  2HCI A;  2B2U C;  3FPU B;  5D65 A;  1O7Y A;  3KUP A;  1CA6 A;  2K04 A;  1PFN A;  1SSO A;  1PFM A;  1RTO A;  2B2Y A;  5EPJ A;  2EOT A;  3P7J A;  3TZD A;  4CJ2 C;  2B2W C;  1B50 A;  1DON A;  4HCS A;  1QG7 A;  2K03 A;  2SDF A;  2HUG A;  2RVL A;  4X3K A;  5EPL A;  1HA6 A;  2MPM A;  1MSG A;  5E4X A;  2K05 A;  2K01 A;  3I8Z A;  4RWS C;  5T1G A;  2CVR A;  1TVX A;  1S4Z A;  1J9O A;  1PLF A;  3DEO A;  1DOM A;  1NR2 A;  1ZXT A;  2VXW A;  3Q6S A;  3IFD A;  3MWY W;  1DOK A;  1B4O A;  3GV3 A;  4OIJ A;  3TN2 A;  2B2W A;  4XT1 B;  4IUP A;  3LWE A;  5DNF A;  5E4W C;  1WTQ A;  2NYZ D;  1RHP A;  4CJ1 B;  1PFB A;  1BBX C;  1F9Q A;  1U4M A;  4R8I A;  3I90 A;  1B3A A;  1HFG A;  4HSV A;  1IKM A;  2KUM A;  4ZAI A;  1LV9 A;  2K28 A;  1VMP A;  2N55 A;  2KOL A;  1CM9 A;  1O7Z A;  1ICW A;  3FDT A;  1DZ1 A;  1G2S A;  2J7Z A;  5CBE E;  3QO2 A;  1IL8 A;  1C8C A;  1IKL A;  2L1B A;  2FIN B;  3GV6 A;  3H91 A;  4XT3 B;  4UAI A;  3G7L A;  4NW2 A;  1XYI A;  1SAP A;  1Q3L A;  2MJ8 A;  1RJT A;  2FFK B;  5CMD A;  2DY7 A;  2X69 A;  4MHE A;  4X3T A;  2B2T C;  2B2Y C;  4ZLT F;  1WTR A;  2N88 A;  1F9P A;  2FJ2 A;  1BO0 A;  2XIW A;  3F2U A;  1EIH A;  2B2U A;  4HED A;  2FMM A;  1NAP A;  1MI2 A;  1JE4 A;  2B2T A;  2L9H A;  1ILQ A;  3ONA B;  1G6Z A;  2R3Z A;  1E0B A;  1DOL A;  2DY8 A;  1HHV A;  4X3S A;  1F9R A;  4O42 A;  1CA5 A;  4IUT A;  4ZK9 B;  1WD0 A;  1U4P A;  1XX8 A;  1RTN A;  4ZKC B;  2NWG A;  2JYO A;  1SDF A;  2X6L A;  1A15 A;  1EOT A;  5EQ0 A;  3UI2 A;  1VMC A;  4U68 A;  1M8A A;  1O80 A;  1ML0 D;  1QE6 A;  1ROD A;  3D6W A;  2M2L A;  1AZP A;  5CBA E;  1KNA A;  1U4L A;  2MP1 A;  4MN3 A;  3I91 A;  1BNZ A;  1G2T A;  1ILP A;  1ESR A;  1J8I A;  2KEC A;  2L11 A;  4R9W A;  1JIC A;  1B2T A;  4QUF A;  2H1E A;  5EJW A;  3R93 A;  1WTX A;  2NZ1 D;  2X6G A;  1MGS A;  2D9U A;  4LMQ D;  4XDX A;  5AFW A;  1WTW A;  1AP0 A;  1EIG A;  1BF4 A;  5COR A;  2HDM A;  2KED A;  1KNE A;  1NCV A;  4DN4 M;  5EPK A;  2KVM A;  2JP1 A;  2B2V C;  4ZKB B;  1WVL A;  4CJ0 B;  1HUN A;  1QNK A;  2BDN A;  4IUV A;  4IUQ A;  1WD1 A;  5T1I A;  1NR4 A;  2EE1 A;  4IUU A;  2FHT A; 
#chains in the Genus database with same CATH topology
 2UXB L;  4IJL A;  4K2L A;  1E3P A;  4DKA C;  1D1I A;  5HUR A;  3UDF A;  4Q0F A;  2RSO A;  2OQ0 A;  5ELE A;  1PFS A;  2E74 C;  3GTG B;  1HRJ A;  5FLX L;  3P20 A;  3HOU H;  2MO1 A;  2R7Z G;  4GS3 A;  3D6C A;  1PHJ A;  5FJ8 G;  2B2U C;  1CA6 A;  1PFN A;  4X64 Q;  1RTO A;  4CDF C;  1QG7 A;  2OF1 A;  4I7Z C;  5JPN C;  1GJX A;  4EQO A;  1A0I A;  4YHH L;  3OSO A;  5IY0 A;  2F0S A;  1N36 L;  4POF A;  4DV0 L;  3IFD A;  1HNZ L;  1ICF B;  4UP9 A;  4IPG A;  1ZKO A;  2WIN B;  3GTP H;  5FO9 B;  3NPP A;  4DV2 Q;  3TRE A;  1N9W A;  4WJ3 M;  1PFB A;  4IPD A;  2NVT B;  3VYU A;  1VQJ A;  3I90 A;  3LWU A;  1KRT A;  1KC8 C;  3GD7 A;  4K2K A;  1NTG A;  3CRL C;  1DZ1 A;  1G2S A;  1WTH A;  1IW7 D;  4FP5 D;  3MFG A;  3PO3 H;  1EQV A;  5EGT A;  1CKM A;  3KBG A;  1CTM A;  3HOX G;  1YNJ C;  2QCP X;  1A8V A;  3CU7 A;  4LUV A;  4BY7 B;  1TWF H;  3S2D H;  4R4C A;  1TXY A;  1LT5 D;  2B63 B;  4A3I B;  2IT1 A;  3AB9 A;  4C3J B;  5ELF A;  3MEH A;  4NXN Q;  4YCU A;  4BBR B;  3ICE A;  3P75 A;  2F0K A;  1RIP A;  4DNT B;  4A3L H;  5C4J B;  4JI2 Q;  1TWC B;  4DV5 Q;  2XGT A;  5KNB A;  2YYZ A;  2NN6 H;  5ELB A;  3G4S A;  1U4L A;  1G2T A;  1PRT B;  4MNO A;  2E75 C;  1C7Y A;  1OXX K;  4R9W A;  1SFO H;  1RF2 D;  3BVZ A;  4X65 L;  2ZTD A;  4FNF A;  4OXP A;  1SYF A;  2F52 A;  4A93 G;  1BF4 A;  3P1H A;  2HDM A;  1CKN B;  1JR0 D;  1N32 Q;  2QEJ C;  4CJ0 B;  3CME A;  4X6A H;  4G4K A;  1HQM C;  3PIO A;  4IUU A;  2L12 A;  2QDB A;  4H0L C;  3IL8 A;  3NSW A;  1PV4 A;  4OON A;  1LTT D;  2ALY B;  5IYB G;  4TQU S;  4A3K B;  4QJF A;  1K3B C;  1PH7 A;  1Y1W B;  3J81 L;  3U9S A;  4S3S A;  2Y0S B;  1ENA A;  3SVM A;  2UUC Q;  3OOC A;  5I6Y A;  1Y8P B;  2G9D A;  1Q82 C;  3AMU A;  4YHH Q;  1PH6 A;  3NWS A;  2AQ1 B;  4B3T Q;  2B2V A;  4DA2 A;  3S2H B;  4J8Q A;  1SMY C;  1O7Y A;  4LF5 Q;  1FGB D;  3PGZ A;  4FXK C;  2HT1 A;  1KTK A;  4PQX A;  2R92 G;  1X54 A;  1SJH D;  2DNC A;  5IWA L;  1E24 A;  1TWG B;  1YIT A;  2OT2 A;  4M1U B;  3HOW H;  4JI5 L;  4Y7N H;  3S1M H;  5I9P A;  4BBR G;  1AE2 A;  4JOI C;  2AHO B;  5EKK A;  5NUC A;  2AKW B;  1R9T H;  2E8G A;  2CFM A;  4IQZ A;  4PZ8 A;  4GN3 B;  5DNF A;  2NYZ D;  1AW7 A;  3PUW A;  3T53 B;  4UP8 A;  4KKU A;  4GZY C;  4JPB W;  1LAC A;  3FDT A;  3J7Z C;  1VF5 C;  3EN2 A;  4AQY Q;  5JJL A;  2EXD A;  1E1O A;  1PTO C;  1TU2 B;  3H91 A;  4CKE A;  1P16 A;  4K0K Q;  1YIJ A;  3KLW A;  3J7A 5;  1H9R A;  4C3H G;  5IOC A;  2FJ2 A;  4HED A;  4HIK A;  1TWA H;  4JVZ A;  4RKB A;  3E0E A;  1JE4 A;  1VQH A;  1ILQ A;  4R1J A;  2RDF A;  2IX3 A;  3CCU A;  2EY6 A;  3STB C;  1B44 D;  5JEA G;  1IBM Q;  2F0D A;  1D5X C;  1XX8 A;  3HOU G;  3Q22 A;  4DNR B;  1X65 A;  2NUC A;  2C9O A;  2KEN A;  1PRT D;  2R7F A;  4APV A;  1AZP A;  2MP1 A;  4B9W A;  4L5S A;  3LNN A;  3NK9 A;  3NBH B;  1XMQ Q;  3FKI B;  4JI0 L;  2X6G A;  2D9U A;  4LMQ D;  1WTW A;  1JMC A;  2IX0 A;  4ODG A;  3PSI A;  4F8M A;  4A3F H;  1NCV A;  3TEH B;  1I6H H;  1C0A A;  2VQF Q;  1EYA A;  2B2V C;  3A56 A;  1QZG A;  1JQY D;  3RLF A;  1PH1 A;  1JOK A;  2JE6 I;  1FJG L;  1G6P A;  3BYY B;  5HGQ A;  3KF6 A;  1EYC A;  3VDY A;  3SK4 A;  3A8K E;  4RGN A;  2ZTE A;  3D3R A;  1FGU A;  3PIP 3;  1JB7 A;  4BBS G;  5C44 G;  1BCP F;  1D7Q A;  1H9K A;  2BA1 A;  4GKK Q;  3T1H Q;  4DR6 Q;  1CQV A;  2RA4 A;  3PUV A;  3NWT A;  1LTA D;  5C4X G;  4ZYS A;  3AU7 A;  4NMZ A;  2K7V A;  3J81 j;  4P74 A;  5KIX A;  3PO2 G;  2R92 H;  3TZD A;  2UXC L;  4X66 Q;  4JC0 A;  3HOV B;  4UDU C;  3HRZ C;  3I8Z A;  4LWC A;  4HID A;  5EAY A;  1W6K A;  1WJJ A;  5C0X G;  2B63 H;  3UDI A;  3ULL A;  5IIF A;  1A62 A;  4BBR H;  2QKI C;  4RH6 A;  2R93 B;  3MAQ A;  1L2F A;  2ID0 A;  4LFB L;  1U4M A;  1TWC H;  2YTX A;  5IYB H;  2UUB L;  2DUD A;  1EEF D;  4DK6 C;  2HQL A;  2PQA B;  1EUJ A;  1K3R A;  1BCP B;  1E1T A;  5KGU A;  3NHH A;  4P71 A;  1SR3 A;  1E2W A;  2F0W A;  4M8A A;  5ELO A;  4JI8 L;  4JI3 Q;  4YCV A;  3ERO A;  5JVH 3;  2C35 B;  3M4O H;  4DXG A;  4FXG C;  1SE2 A;  4N9P A;  5H1S E;  1L1O B;  5C3E G;  2QDL A;  1VQF A;  2WAC A;  4B3R L;  1WCM H;  2B2T A;  3PUY A;  3FVQ A;  2R3Z A;  1B70 B;  3BJU A;  4LNQ A;  1V1O A;  3DUZ A;  1CA5 A;  1HZ9 A;  4IUT A;  4DV3 Q;  1VQB A;  4BXX H;  4QY7 A;  4ZKC B;  1NSN S;  1TQO A;  1FNW A;  1O80 A;  4HSP A;  3J80 L;  3TZU A;  3TP5 A;  1VQN A;  1KNA A;  5JJK A;  3I91 A;  4IPH A;  3MFY A;  1BBW A;  1SNQ A;  2ZT9 C;  4XQJ A;  2ZXR A;  3PO2 B;  1M4V A;  3R93 A;  3PMF A;  1Y14 B;  5DM7 3;  3VA5 A;  1DXM A;  3J81 c;  2KVM A;  5D3D A;  2O2L D;  4X66 L;  3LGJ A;  2UUB Q;  1SMY D;  1HUN A;  2JA5 H;  2OWO A;  1K8O A;  4A3C H;  3S9W A;  5EKI A;  1VQ7 A;  2RF4 A;  4F88 A;  3HOW B;  3J81 E;  3S1M B;  3Q24 A;  4JBW A;  5IT9 c;  4K8I A;  1SND A;  1SNC A;  3M3Y B;  1MIU A;  2B8G A;  3DWP A;  1R4P B;  1HFN A;  3DLL A;  1Y1W G;  4OL7 A;  1STB A;  2IX1 A;  2K1B A;  1C48 A;  2PCF B;  1GUW A;  4FF3 A;  2QW7 A;  1YNN C;  5M5Y B;  1B7Y B;  5IT9 E;  1I94 L;  5EPL A;  2HUG A;  2CVR A;  5F2D A;  3F1Z A;  2L55 A;  1HZC A;  1W2B A;  5FO7 B;  3A8I E;  2SEB D;  2E2I H;  4I7A A;  4LF7 L;  3NE5 B;  2MQH A;  5M3M H;  1LTB D;  2EYM A;  1A2U A;  4OIJ A;  3X3M A;  4AYB G;  2NTS A;  4B3M L;  4C1N I;  3S1N B;  5IP7 H;  2NVX B;  2PYK A;  4FYD A;  1E2V A;  5JJI A;  1I3Q H;  4C3I H;  3JAM i;  1CHQ D;  5ELD A;  2NZO A;  1IBK Q;  2LXK A;  1KRS A;  2Z6B A;  3FKI H;  4DPG A;  1VQL A;  1X3G A;  2NVQ B;  3G6E A;  2IJ0 A;  3CCE A;  2PPB C;  1STY A;  3NP8 A;  1JC7 A;  4JYA Q;  2WAQ E;  1EFI D;  3F2C A;  1D5Z C;  4ZK9 B;  3AYH B;  4DV4 L;  3OMG A;  3H0G H;  3PQI A;  4A3B H;  5M3F B;  1YNJ D;  2YTV A;  4IO9 A;  5K36 H;  2K50 A;  4QGU A;  4ILW A;  3K58 A;  3G48 A;  4MN3 A;  1SYE A;  1WYD A;  1N33 Q;  1EEI D;  3K5L A;  4K0K L;  4N8X 1;  4DV6 L;  4K5W A;  2BCO A;  5AFW A;  4AIM A;  2HD3 A;  1EU4 A;  4EVO A;  4CDE C;  1IYU A;  5JEA H;  2ZJQ A;  1QIL A;  4A3I G;  2XWB B;  1NMG A;  1RCV D;  2JQO A;  2F0O A;  4B9X A;  2F0M A;  3CCQ A;  1ESF A;  1VCI A;  4KHZ A;  1DYQ A;  3HZX A;  1U9R A;  1EY8 A;  2EE1 A;  4LF8 Q;  3OIQ A;  3S1R B;  5KYI A;  2LS0 1;  3J7A F;  2YU9 B;  4XIG S;  4JK1 C;  2OTJ A;  2AUJ D;  1I4X A;  5EBC A;  5AJ3 L;  4OWT B;  1FNU A;  3BDO A;  3GTL B;  1HNX L;  3DEP A;  2I5L X;  3G71 A;  1JJ2 A;  4JI8 Q;  4RAU C;  4L5Q A;  3I3C A;  1X6O A;  4TKO B;  4DAP A;  2HCC A;  2JA9 A;  3NQT A;  4JI4 L;  3SHL A;  4L5R C;  2IL8 A;  5DM6 3;  5EPJ A;  3V2T A;  2B2W C;  1YJN A;  3GTG H;  4KV6 A;  2D62 A;  2K05 A;  4RWS C;  5C4X B;  1GKH A;  1KQS A;  3NUC A;  1EOV A;  2MHV A;  4KJO A;  1WCM B;  2Z6K A;  1BVS A;  1G29 1;  2GN5 A;  2I5H A;  2D0O A;  3GDE A;  1H95 A;  1UE7 A;  3HFZ B;  4B3R Q;  3HOZ B;  3S1Q H;  1A2T A;  1EZ8 A;  1HFG A;  1IKM A;  2PI2 A;  2D5D A;  3MXU A;  1XNQ Q;  2K52 A;  2F0H A;  1QNU A;  1BCP D;  4L6T B;  4GOP B;  2N49 A;  5CMD A;  3GTJ B;  1PH4 A;  1TWH H;  1UWV A;  4CHT B;  1YI2 A;  4EQN A;  4QIW E;  4A3G H;  4HTH A;  1EYD A;  1PZJ D;  4WRD A;  4OEL B;  5C44 H;  5BR8 L;  4DF7 A;  4KN7 C;  3C1E A;  5C3E B;  1B1Z A;  1RTN A;  1EQR A;  4A4I A;  1MJC A;  1EOT A;  2ZTC A;  1VMC A;  3S15 H;  1JWU D;  4GN4 B;  4BS9 A;  3G6J B;  4GNX B;  4BY1 B;  4V0B A;  5CBA E;  2WAQ G;  1DD2 A;  1VQG A;  3I70 A;  4FDB A;  4DV0 Q;  4PZ7 A;  2I07 B;  2L11 A;  1YHQ A;  1B2T A;  1FL0 A;  1PTO B;  4DNI A;  2E2H H;  4LF9 Q;  1PH3 A;  3VYT A;  2KED A;  2EYO A;  4DR3 L;  5HY6 A;  4GNX A;  2UXD Q;  4JBJ A;  3W5O A;  3A5Z B;  1OXT A;  1SMX A;  4RFB A;  1X32 A;  4QUC A;  1EL0 A;  1MJE A;  2AMC B;  3CPF A;  2IWH A;  2EXZ A;  5GRO A;  1EQQ A;  1Q46 A;  2Q2U A;  1N36 Q;  5DLQ E;  3BS1 A;  5JOB A;  1Y1V B;  4YY3 L;  1V1P A;  4HAE A;  5BN5 A;  5M5W H;  2Q8T A;  5J1Z A;  1XTC D;  1S5D D;  3QWN A;  1FVI A;  4X64 L;  3U9O A;  1PA6 A;  3H3V C;  4C3I B;  2VUM B;  5D65 A;  2EJM A;  2J0T D;  2K04 A;  3DMU A;  4ME3 A;  1H9M A;  2EJG C;  2K03 A;  2QF7 A;  1AFP A;  2WKC A;  1B8A A;  4OO1 I;  5E4X A;  1RKN A;  3W1G A;  1UNS A;  4O2D A;  4OWX B;  3Q6S A;  3ERS X;  2BH2 A;  4OGQ C;  3GTK H;  2F3V A;  1QZH A;  1B4O A;  3CPW A;  3IRB A;  3CKI B;  3RZO H;  3H0G B;  1TS5 A;  1W6J A;  2PQA A;  1JB3 A;  1B3A A;  1LO5 D;  4LFC L;  5KRU A;  2XRS D;  4EQ5 A;  1PH8 A;  2QGQ A;  4B3T L;  1O7Z A;  2J7Z A;  3T51 B;  3OTO Q;  1VQC A;  1O78 A;  5IGF A;  2IPK D;  4N9T A;  4MHE A;  4LFC Q;  4JI1 Q;  2MNA A;  1HTL D;  2N88 A;  3EA6 A;  3OWE B;  1I4R A;  1NAP A;  4G57 A;  2F4I A;  4G7H C;  2A68 D;  3QB3 A;  1NMF A;  1YVC A;  2Z4I A;  2NWG A;  3CCL A;  2EYF A;  3QIA A;  1KXL A;  1QE6 A;  5IYD G;  5EKL A;  1XNR Q;  1SBB B;  1BQQ T;  1KAB A;  4KMU C;  4DV3 L;  4DR5 L;  2E76 C;  1JIC A;  3E5S A;  4A93 H;  4G7O C;  1GUG A;  3OIP A;  4A3F G;  1N8R C;  2N78 A;  2F0F A;  4DN4 M;  1WVL A;  2LSS A;  4JV5 L;  1UE1 A;  5ELC A;  1XXG A;  3PIO 3;  3D8G A;  2RCF A;  1BOS A;  2HDL A;  1AZQ A;  2EQS A;  1ET9 A;  2Z1C A;  1FYC A;  3PUZ A;  4DUY L;  1SE8 A;  1HCZ A;  2CW0 C;  1XPU A;  3MZ5 A;  2UXD L;  3HOZ H;  1PMR A;  2ES2 A;  3A0J A;  4FF1 A;  3J80 i;  1F2L A;  4A3B G;  4QMG A;  4KN4 C;  5CV4 A;  4C1N K;  5FLX E;  1KDC A;  2F1M A;  2WV6 D;  4X65 Q;  3MC0 B;  1ASY A;  1G91 A;  4DR2 Q;  3HKS A;  2ASB A;  2CWP A;  1HR0 W;  3FPP A;  2F3I A;  1X56 A;  1SSO A;  1PVO A;  4HJA A;  2XWJ B;  1QVF A;  4EX5 A;  1HA6 A;  4X3K A;  4WFN 3;  3NEM A;  3M85 A;  3AFQ A;  2B63 G;  5I2Y A;  1LT3 D;  4JW0 A;  4WOR A;  1DOM A;  2F0E A;  1OO9 B;  1Q1E A;  4QF4 A;  4C3J G;  4A3I H;  3I4N H;  4DR7 Q;  4A3G B;  4JBK A;  4TRD A;  2VQE L;  3TN2 A;  3T16 A;  3VYS A;  4XT1 B;  5FJ8 H;  2E2J B;  3ITP A;  2J4X A;  2IW3 A;  2VS1 A;  3W3A A;  5C3E H;  3OTO L;  4FF2 A;  4K5V A;  1D2B A;  3S15 B;  5DEH A;  4KKS A;  3V96 A;  1I4G A;  4BY1 H;  1EY0 A;  1CM9 A;  5LMU Q;  5C5M A;  4NDX A;  3HOV G;  4OHJ A;  2RQX A;  3N6R A;  2R93 H;  1XMO L;  1PYS B;  3BDC A;  4RHS A;  1HNX Q;  4GN5 A;  5IWA Q;  1C9O A;  2KJX A;  1F9P A;  1BO0 A;  1GUS A;  2QIL A;  3TP7 A;  5M5X B;  3T1H L;  3EQL C;  1PH2 A;  3T4A C;  1STH A;  2L5T A;  4DV1 L;  1V9P A;  4LFB Q;  4DUY Q;  1IBK L;  2CCZ A;  2EY2 A;  4KY6 A;  1KAA A;  1K28 A;  4OEM B;  3J7A V;  2A6H D;  4X62 L;  2P5Z X;  2PZW A;  1ET6 A;  2KEC A;  1Q86 C;  2RHS B;  3VR3 A;  1LM0 A;  1SEB D;  2JA7 H;  1QUQ A;  1QVC A;  3L3O C;  2JP1 A;  5DAU A;  4KHP Q;  4DR5 Q;  2BDN A;  1GM5 A;  3S14 H;  3BDL A;  2MGS A;  3KBX A;  3PO2 H;  2FHT A;  2Q2I A;  1VQI A;  4IUR A;  1K73 C;  4NPS A;  3EVQ A;  3JAM L;  5K5P A;  5I9O A;  1K8M A;  3M7G A;  3OWF A;  4I65 A;  4GKK L;  2UUA L;  2Q8R E;  3R2I A;  3E0J A;  1IYJ B;  3KJO A;  4CKB A;  3Q0A A;  3W1B A;  3N52 A;  1Q7Y C;  1E2Z A;  1QWY A;  4GLA C;  3TS0 A;  1GVP A;  4KY7 A;  3JC6 6;  1Q1B A;  2NB0 A;  1HZA A;  1L0W A;  3GTO H;  3BZC A;  2AUK A;  1BDO A;  2MPM A;  1Z6H A;  4ULL A;  4C3I G;  3A7A B;  3UE1 A;  5M5Y H;  3I4L A;  1ZXT A;  4BY7 G;  3F2D A;  2GVB A;  3RD4 A;  1PTO F;  2I5M X;  1SN8 A;  3GV3 A;  4HMJ A;  3L9A X;  4EGV A;  1SNO A;  2B2W A;  1GUO A;  1IYV A;  5GQO A;  3HG9 A;  3L0O A;  1XPR A;  3PUX A;  3S17 H;  3HOY H;  4QCL A;  4HSV A;  2KQ3 A;  4NKL A;  1A63 A;  3KLR A;  1VMP A;  2XSC A;  4A3D H;  3KK7 A;  2EYJ A;  2WFW A;  2TSS A;  5LHY 1;  1S5F D;  1IL8 A;  2Z4H A;  3C3L A;  3OPO A;  3K7A B;  1XMQ L;  2JA6 G;  1SRU A;  3A74 A;  1S40 A;  2FFK B;  2K6A A;  3T1Y Q;  4P72 A;  4GOP C;  4L63 B;  4X3T A;  3F8T A;  4QQB X;  2BH8 A;  3K0Y A;  1ONL A;  3I72 A;  3FEW X;  4A3M G;  2DY8 A;  4JG2 A;  2ICE C;  2KCT A;  1F9R A;  1WD0 A;  3VR2 A;  3U4Z A;  1SDF A;  2XN9 C;  3ULP A;  2N8N A;  1M8A A;  1JJC B;  5BN3 A;  1I94 Q;  1PH5 A;  1GD7 A;  2CQA A;  3K80 C;  5IYD H;  2E2D C;  4LFA Q;  1J8I A;  5C4H A;  4DXF A;  4OX9 Q;  5HGT A;  2NZ1 D;  4V19 0;  5C0X J;  3VYR A;  1S5E D;  2KHJ A;  2R92 B;  1I5F A;  2OCE A;  1OXU A;  2K32 A;  3SK8 A;  1S3O A;  1S72 A;  4FO2 A;  3NQI A;  3TP6 A;  3CCV A;  3Q8D A;  4RG1 A;  1DON A;  3I4N B;  2EPB A;  2L4N A;  5IT9 L;  1YNN D;  1WTV A;  4RKL A;  4OO1 H;  2UU9 Q;  4IAL A;  2G5D A;  1HUM A;  4OO1 G;  3OW7 A;  2VZA A;  1B53 A;  1F77 A;  4RA8 A;  2E2J H;  3H09 A;  1SNM A;  2A68 C;  3UE0 A;  4H44 C;  2HHH Q;  1MSH A;  4K6L A;  2RSN A;  1VQ5 A;  2EZV A;  2F0Q A;  4DFA A;  1ENC A;  1Z7T A;  4LF5 L;  2HCI A;  1STA A;  1PFM A;  3DM3 A;  3GTP B;  4HCS A;  2PO4 A;  5A2Q E;  3HS0 C;  2K14 A;  2G9H D;  2N3S A;  1CZW A;  2H4O A;  2F0T A;  4PMW A;  4KHV A;  1N33 L;  1O7L A;  1SYC A;  4LFA L;  2RCN A;  4RHR A;  3K57 A;  1K83 H;  5JEA J;  1NE3 A;  2VQF L;  1DOK A;  4PV1 C;  4ALP A;  5IYC H;  1V1Q A;  3CC4 A;  2PW7 A;  2RBM A;  5M3M G;  1KLU D;  3WWV A;  1WTQ A;  5IGG A;  5KNC A;  3STB D;  1Y69 U;  3D31 A;  3I55 A;  1NNX A;  1U0L A;  2F03 A;  2N55 A;  2K5V A;  3S2D B;  5AJ3 Q;  3A5U A;  4IN3 A;  3FKI G;  4DR3 Q;  1D8L A;  2A8V A;  3MXN B;  1NBW A;  3PF5 A;  3KLS A;  3X3N A;  4C3J H;  4BA2 I;  4IPC A;  4UAI A;  4NW2 A;  3ER0 A;  3SE0 A;  2NVT H;  4CDC C;  3H15 A;  4DV5 L;  5IOD A;  5G3L F;  2JA5 B;  1BCP C;  4MZ9 A;  3NXW A;  3U58 A;  1S5B D;  3K7U C;  3PO3 B;  3PIP A;  3MHB A;  5CV6 A;  1ASZ A;  3CC2 A;  1TWH B;  4B3M Q;  4BY7 H;  1LTS D;  5D3I B;  4A3J H;  2NVY B;  2IHE A;  1T5E A;  1ROD A;  5C44 B;  1VQD A;  2WB1 E;  4DAY B;  4LF7 Q;  3QJY A;  2I46 A;  3A8J E;  3NBI A;  5CV9 A;  1UE6 A;  1BXT A;  4QUF A;  4HCE A;  3TSS A;  3IFT A;  4XDX A;  4A3D G;  1I50 B;  2PZT A;  5GAE C;  3GTO B;  4JYA L;  4A3K H;  5COR A;  2K5Q A;  3R3O A;  3E9I A;  1NJI C;  3M7N A;  3TS2 A;  1Y1W H;  1H9J A;  1L0Y B;  4DAM A;  2EY1 A;  4JI6 L;  1PZI D;  2B8F A;  2BE5 D;  4K6D A;  1ENF A;  2FMC A;  4KD4 A;  3T13 A;  2B29 A;  1HTP A;  3QG1 A;  4K5X A;  5EBD A;  1II3 A;  2XTI A;  3DM1 A;  2VB3 X;  2NVX H;  1Q12 A;  3FRP B;  2VUM G;  4DV7 L;  1VQA A;  3CQZ H;  3FPU B;  4UP7 A;  4YCW A;  4CDD C;  3BVG A;  2YTY A;  3MXN A;  4FXD A;  2MUY A;  1Z9F A;  1S5C D;  3W2D A;  1CZG A;  2K01 A;  3CCS A;  5IGB A;  3S24 A;  4TVA B;  4MTK A;  4P2C B;  3RLN A;  3PO3 G;  1FNV A;  3S2H H;  1NR2 A;  2VXW A;  3KOJ A;  4X62 Q;  5C0X I;  3EJI A;  1Y1V G;  3RN2 A;  1HR0 L;  4YWK A;  3WOE A;  4CJ1 B;  4DV1 Q;  4HJ8 A;  2K75 A;  1TWG H;  5J22 A;  3KLS X;  1Q8I A;  1LUZ A;  1L1O A;  3QO2 A;  2M00 A;  1IKL A;  2CH4 A;  2FIN B;  3GV6 A;  2F0G A;  4J6H A;  2PW5 A;  3A55 A;  1V8Q A;  5FLM G;  1JWS D;  1PYB A;  1LYL A;  2DY7 A;  1TT2 A;  2X69 A;  2HQE A;  2WKD A;  3NEN A;  2B2Y C;  5FO8 B;  1RD9 D;  5FOB B;  1VQM A;  2L9H A;  4DAY A;  1IBL L;  3I4M B;  2ENB A;  4BBS H;  3QR8 A;  2RDG A;  2MO0 A;  4K14 A;  2WB1 B;  3C46 A;  2YU9 H;  4DR4 Q;  2K33 A;  2PNR C;  5LMN W;  3HOW G;  2JA6 H;  2OEO A;  4U68 A;  4R4T A;  2Z9H A;  3AQQ A;  5GAG C;  5IP7 G;  2QEX A;  3GP7 A;  1UEB A;  4DR6 L;  4O0A A;  5JPM C;  4DR7 L;  4RGM A;  1ESR A;  1EWI A;  4DR4 L;  4F87 A;  3HOX B;  4R4O A;  1UAP A;  2VQE Q;  2CHB D;  3NBH A;  3J81 i;  3Q23 A;  1FJG Q;  1EY4 A;  3DWQ A;  5C4X H;  4PZ6 A;  4KY5 A;  2Z8L A;  3OW2 A;  5IP9 G;  2WII B;  1FR3 A;  2Z6K C;  4A93 B;  2PQE A;  3I4M G;  2EJF C;  1DCZ A;  3FMC A;  2JJQ A;  3AFP A;  3BG3 A;  4NB3 A;  5COY A;  3URY A;  4IZ8 A;  4DR2 L;  3S1Q B;  2D0P A;  2M9V A;  1GUN A;  3OHX C;  4GLV B;  3HOV H;  4R4I A;  1SE3 A;  2JA8 H;  2LFN A;  1CFM A;  3J80 c;  4DUZ L;  5IP9 H;  1OTC A;  3GTM H;  5LMN L;  4C3H H;  2A6H C;  1XNQ L;  5A2Q L;  3R2T A;  4KJN A;  3CCJ A;  4C2M H;  4CJ2 C;  3P7J A;  1B50 A;  2CH4 W;  2FXQ A;  3GTJ H;  1TII D;  4DV2 L;  3M4Y A;  2V1C C;  4PNY A;  1F2Z A;  4KI0 A;  2UXB Q;  1J9O A;  3DEO A;  5CV8 A;  4IJH A;  4RGO S;  3CAM A;  1FD7 D;  1A3V A;  3V05 A;  2Z0S A;  1B3Q A;  5E4W C;  2B3G A;  2A6E D;  2XVS A;  4B08 A;  4YY3 Q;  3AEV A;  2KUM A;  2OQK A;  2VNU D;  4LK1 C;  2KOL A;  1EFW A;  3O13 A;  3DXJ C;  1C8C A;  2L1B A;  2PMZ E;  1A3T A;  2WAQ B;  2D2C C;  3G7L A;  2JXM B;  1L1O C;  2A6E C;  5KEE A;  1RJT A;  2V4D A;  4DV4 Q;  4HIM A;  5E3F A;  3BZD B;  4GNX C;  2O5J C;  4A3E H;  1EIH A;  3IKJ A;  2EVB A;  1K0R A;  3QOJ A;  2EYL A;  2AQ2 B;  4QB4 A;  1I6V C;  2ZM6 Q;  4A76 A;  1PYW D;  1C4Q A;  1VDZ A;  5KYL A;  1KAW A;  2F4V L;  1HPC A;  1Y1V H;  1B9M A;  4A3M B;  1MHW C;  3UDX A;  1VQO A;  1VQ8 A;  5J3B A;  4EQP A;  5L37 A;  1M90 C;  3D6W A;  1E22 A;  4K8J A;  3UDG A;  1IBM L;  5GAH C;  3D4D A;  3M9B A;  1W3S A;  3A7L A;  2H1E A;  1XMO Q;  2DGY A;  1J5E Q;  3RZD H;  2JSO A;  1EY9 A;  2CW0 D;  3K5O A;  1CUK A;  2VB2 X;  3BVM A;  2NN6 G;  2A69 D;  1VQ9 A;  3TBI B;  2F0L A;  5E7N A;  4Z9C B;  2DJG C;  3K59 A;  1VQ6 A;  2A74 C;  4DUZ Q;  1TS2 A;  1JOQ A;  2A1A A;  2EYH A;  5D14 A;  2Q8I B;  5C4J H;  1PZK D;  1X3P A;  1GXD C;  1I4H A;  1GHJ A;  1CI3 M;  1TS4 A;  1MBY A;  1HH2 P;  4RCO A;  5FLM H;  1EWH A;  3EIV A;  4OIK A;  2E2I B;  2KHI A;  5KND A;  4KK7 A;  3PF4 A;  5LMN Q;  1CT1 D;  2TMP A;  1GOZ A;  3KF8 A;  4CBV A;  5BR8 Q;  1MSG A;  3RR5 A;  3NEL A;  1S4Z A;  2F0P A;  3S1N H;  3MA2 B;  1Q8K A;  3BZK A;  2R7Z H;  1JE5 A;  2A5H A;  2RKS A;  1K9M C;  1PRT F;  2R7D A;  2BA0 A;  4HJ7 A;  5CC4 A;  1Y8O B;  4JI5 Q;  4NXN L;  1E7Z A;  4JI1 L;  2L15 A;  5M3M B;  2JK8 A;  1ICW A;  4H7B A;  1YEZ A;  3DHQ A;  3HKZ G;  1IXR A;  3OYY A;  1LTL A;  2SNS A;  3S17 B;  1SAP A;  1G8Z D;  1YJW A;  5C6A A;  1BBU A;  1IHZ A;  4JOI A;  2PNH A;  1HR0 Q;  4Y52 H;  4O42 A;  4U67 3;  1U4P A;  1LTI D;  1R9T B;  4DV6 Q;  1EIY B;  2KBN A;  1DJR D;  3M4Q A;  1HJP A;  4XQN A;  1ML0 D;  2JN4 A;  2JEA I;  4UHV A;  1O7I A;  3C1F A;  1EU3 A;  4A3B B;  3SXH A;  2AQ3 B;  4PG3 A;  2XNA C;  5J39 A;  4C2M B;  4ZUJ A;  4IFD G;  4B3S L;  1CHP D;  1X9N A;  3KFU A;  1YHA A;  1JT8 A;  1KNE A;  5A35 A;  2CWA A;  5EPK A;  1A3U A;  3WDN A;  1F2Y A;  3CD6 A;  4LF8 L;  1TWA B;  5E1F A;  4LUO A;  1JCK B;  3HP3 A;  3NTI A;  1PTO D;  1LT6 D;  2EY5 A;  3TQY A;  3J7Y W;  2Q2T A;  1AEX A;  3SR1 A;  2EIF A;  2IHF A;  5JJZ A;  1NY4 A;  2R6G A;  4GOP A;  4X3U A;  1WTP A;  1EY6 A;  3RNU A;  1KLG D;  2VL6 A;  3CXC A;  3HKZ B;  5IGE A;  4L5T A;  1N34 L;  3B6Y A;  3D0F A;  1WTO A;  4LF9 L;  1OXS C;  5JAV A;  1CKO A;  4DGZ A;  1YHB A;  2Y0S E;  3RLO A;  3GTQ B;  4YWM A;  4FVM A;  4RMF A;  5G3L D;  1H9S B;  4LJZ C;  4WJ4 A;  1HNW L;  4GKJ Q;  1TKW B;  3QOL A;  2F4V Q;  3GO5 A;  1PLF A;  1WOC A;  2JEB I;  4N8F A;  1X3E A;  1X55 A;  3MWY W;  1CQF A;  3K6O A;  3LWE A;  4PMC A;  1SYG A;  2A73 B;  4JI6 Q;  3BU2 A;  2BOS A;  3U4V A;  1H9S A;  1BBX C;  4A3M H;  3LX0 A;  4ZAI A;  4ZRZ A;  2VW9 A;  1HNZ Q;  4DK1 A;  1MKH A;  1A6X A;  2NBF A;  1TWF B;  2ZXO A;  3I4N G;  3JAM c;  1TS3 A;  4AYB B;  1D1K A;  4DAV A;  4KKT A;  1KD1 C;  1HNW Q;  3OMC A;  2ZXP A;  2B39 A;  3A54 A;  1UUP A;  3K5M A;  4A3J G;  2K5N A;  4DK3 C;  3ND8 A;  3MXP A;  1KDA A;  1QOH A;  2DNE A;  2B2U A;  5CR3 A;  3S14 B;  3ULJ A;  4KLK A;  1IW7 C;  4IOA A;  3HKZ E;  4XYQ A;  1G6Z A;  4X3S A;  4HN7 A;  4R8N A;  1SFO B;  4POG A;  1VQP A;  3J80 E;  4ZCK A;  1PTO H;  1GUT A;  2DJF C;  4OWW B;  3BYT B;  4A3L G;  2DN8 A;  1BNZ A;  2A69 C;  1ILP A;  1HQR D;  1B9N A;  1F2M A;  1TY0 A;  3F2B A;  4YIJ A;  4JI7 Q;  1VQ4 A;  3K81 C;  4LF4 L;  3CHB D;  3D4R A;  4HR7 B;  1K8G A;  2F0J A;  4A3J B;  3M4O B;  4NXM L;  1HA5 A;  4J1M A;  4ZQ3 A;  4IFD J;  3H6M A;  5ELN A;  1QNK A;  2GA4 B;  3S16 H;  2F3W A;  4IUQ A;  3CRK C;  2E2H B;  3K0X A;  4XYO A;  1TR5 A;  2R7Z B;  5CV7 A;  3SEB A;  4LF6 Q;  1X3Q A;  1ZYR C;  2GVA A;  2F0N A;  2VY3 A;  2HHH L;  5CGK A;  3JAM E;  1TY2 A;  4BXX G;  1I4P A;  4IUN A;  1R4Q B;  1XPO A;  2YV5 A;  2MFI A;  1CSQ A;  2LXJ A;  2JA5 G;  3H3V I;  3ZYY X;  4UY8 C;  4A75 A;  4QIW B;  4P75 A;  3RUZ A;  5C4Z A;  5C3X A;  1T5X D;  1JWM D;  1SNP A;  3K7A H;  2B2Y A;  2EOT A;  5C3W A;  3RZO B;  3MXG A;  1K8A C;  3HOY G;  3SGI A;  1TVX A;  2F0I A;  4J15 A;  3MEF A;  4NP5 A;  2EDG A;  3CQZ B;  3L2P A;  4HJ9 A;  2VUM H;  2K5D A;  1JOR A;  3RN5 A;  2F0U A;  1NUC A;  3I7F A;  4Q5V A;  1KHI A;  4DU9 A;  5IE8 A;  1Y8N B;  2H5X A;  1RHP A;  1WCM G;  4GLX A;  3R8B A;  1LV9 A;  3E9H A;  3ND9 A;  3GTK B;  4DV7 Q;  4XXE A;  3H0G G;  2PI2 E;  1RL2 A;  4LUZ A;  1YNX A;  2KCM A;  2SOB A;  3C2P A;  5K36 G;  3CF5 A;  1XYI A;  4TSS A;  2AWO A;  2XIW A;  4BWG B;  4H02 A;  3TME A;  2CKZ B;  2ICI A;  4CKC A;  3ONA B;  5FK9 C;  1E0B A;  1DOL A;  3NTH A;  3HOZ G;  1IZ6 A;  5BN4 A;  4JI3 L;  4G7Z C;  1SLJ A;  2KA7 A;  2UU9 L;  2JYO A;  3SK5 A;  2CQO A;  1STG A;  2NTT A;  5LMU L;  4A3F B;  4LF4 Q;  1I6H B;  1LAB A;  3I4M H;  4BBS B;  1Q81 C;  2ATW A;  2LMC B;  4AH6 A;  4ID6 A;  1UEA B;  1WTX A;  3HGB A;  1YJ9 A;  1MGS A;  1QJO A;  2NVQ H;  1AP0 A;  1EIG A;  4JI2 L;  3GTQ H;  1DGS A;  4XQQ A;  2Q2H A;  4A3K G;  1M1K C;  5I2X A;  4JBM A;  1ZYR D;  4RGT A;  4IUV A;  2WB1 G;  4F7X A;  5T1I A;  4QL5 A;  3HOX H;  5M3F G;  5ISR A;  1K83 B;  1VF7 A;  1EQT A;  5TSS A;  1EYG A;  3KDF B;  3D4W A;  1X3F A;  1V43 A;  1SRO A;  2RDH A;  3I4O A;  2O5I C;  1N34 Q;  1BKB A;  5C5L A;  2R93 G;  4E6I A;  2WP8 J;  1BUV T;  4ME5 A;  2HIX A;  2NZH A;  4LAA A;  1EY7 A;  4A3C G;  1IBL Q;  3KDF A;  5IGD A;  2JA8 B;  5T1G A;  3GTM B;  1STE A;  3SK6 A;  4C3H B;  1EIF A;  2RHQ B;  4PMB A;  4GKJ L;  3TDQ A;  4IUP A;  4B3S Q;  1AN8 A;  1U5K A;  4YWL A;  4CGY B;  4DK0 A;  4A3E G;  3GTL H;  1VQE A;  3PCO B;  4A3G G;  4R8I A;  2A19 A;  2UUC L;  1G51 A;  3HOU B;  4KHP L;  1UE5 A;  1EZ6 A;  2NVY H;  1QVG A;  1QUQ B;  2PZU A;  3KF8 B;  1T9H A;  5M5X H;  1HXY D;  3I73 A;  1JOO A;  1I4Q A;  1I50 H;  1Q3L A;  3TP8 A;  2BE5 C;  2K4K A;  3I56 A;  4IOC A;  2R61 A;  2B2T C;  2ZJR A;  2KHS A;  2FMM A;  1WFQ A;  3S16 B;  3CP0 A;  1MI2 A;  1QB5 D;  4MTN A;  1OXV A;  3CCR A;  1LTG D;  2O4X A;  2JA7 G;  5C0X H;  1LLR D;  3VR6 A;  3M4P A;  2X6L A;  1KDB A;  1IL2 A;  1VQK A;  4A3E B;  5EQ0 A;  3UI2 A;  5FLX c;  1PH9 A;  1J6Q A;  4R4Q A;  2M2L A;  2K5H A;  2OXP A;  1MD2 D;  4L8J A;  1Z47 A;  4WJW A;  1BR9 A;  3I2Z A;  5EJW A;  3H3V H;  4O1N A;  4HJ5 A;  3PV0 A;  4LF6 L;  4H13 C;  2JA8 G;  4HIO A;  5LL6 S;  3M3Y H;  1AH9 A;  2NN6 I;  3E3X A;  3SDZ A;  1WD1 A;  4FF4 A;  2OTL A;  1SE4 A;  4AYB E;  1HZB A;  1YZ6 A;  3CCM A;  3VR5 A;  2E5L L;  3RZD B;  3H94 A;  2JA7 B;  3K5N A;  4BY1 G;  3RMH A;  5JVG 3;  2Y0S G;  3L7Z C;  4UPA A;  3VA7 A;  3MTS A;  3T1Y L;  2KEE A;  5CYU A;  1VS0 A;  1D6E C;  1SJE D;  4ZUI A;  3T56 B;  3FHW A;  1PXU A;  1DM0 B;  3EFX D;  1U4R A;  1AE3 A;  1PDQ A;  1EWC A;  3FP9 A;  4LW1 A;  1F9S A;  4OX9 L;  5IGC A;  5M9O A;  3HEJ A;  4C56 C;  2KCN A;  3KUP A;  4DR1 Q;  1RDP D;  3TRZ A;  1L0X B;  1SYD A;  1P8L A;  1XJV A;  2SDF A;  2RVL A;  2E5L Q;  3K8A A;  3EBE A;  3CC7 A;  3CMA A;  1CK1 A;  3HOY B;  1SYB A;  1ZEQ X;  1N32 L;  3NTK A;  1GO3 E;  1I3Q B;  3ZJY C;  1XNR L;  4RCN A;  5I4D A;  1KIX A;  2PMZ B;  2HIV A;  2IY5 B;  2AWN A;  2C5C A;  1STN A;  2SNM A;  1F9Q A;  2QA4 A;  2JA6 B;  4DR1 L;  2K28 A;  5M5W B;  1K0S A;  1Q90 A;  3KYH C;  1GHK A;  3VR4 A;  3E6Z X;  1LTR D;  1YBY A;  5CBE E;  1CSP A;  1WI5 A;  4HMI A;  2UXC Q;  4XT3 B;  3DWA A;  1SXT A;  4AQY L;  3ERQ A;  1XWE A;  2MJ8 A;  4JI0 Q;  2ZM6 L;  1CKN A;  1PRT C;  3GQB A;  4ZLT F;  5IYC G;  1WTR A;  4A3D B;  5M3F H;  4KTA A;  4NXM Q;  3F2U A;  5LL6 X;  3KJP A;  4MIU A;  5CV5 A;  2F0V A;  1D5M C;  5I6W A;  4Y7N B;  5FKA C;  2XRQ D;  1HHV A;  2LY7 A;  4KD3 A;  3CW2 C;  4ABN A;  4JI4 Q;  3KF6 B;  1V1P B;  4BA1 I;  1KL9 A;  1A15 A;  1LT4 D;  1J5E L;  3U50 C;  2BDO A;  1EY5 A;  4JCV E;  3MVV A;  4JV5 Q;  4XTC S;  2L0C A;  2EYP A;  1JJG A;  4IFD H;  2LKV A;  4IFD I;  3S1R H;  2ZJP A;  2I0Q A;  2K5W A;  4JI7 L;  4ZKB B;  3WOF A;  4P73 A;  2UUA Q;  3IAY A;  1QCB D;  1NR4 A;  1XTD A;  2KCC A;  5GAD C; 
#chains in the Genus database with same CATH homology
 4K2L A;  1D1I A;  5HUR A;  4Q0F A;  2RSO A;  5ELE A;  2E74 C;  3GTG B;  1HRJ A;  5FLX L;  3P20 A;  3D6C A;  2B2U C;  1CA6 A;  1PFN A;  1RTO A;  1QG7 A;  2OF1 A;  4I7Z C;  5JPN C;  1GJX A;  4EQO A;  3OSO A;  2F0S A;  3IFD A;  1ZKO A;  2WIN B;  5FO9 B;  3NPP A;  1PFB A;  2NVT B;  3VYU A;  3I90 A;  3LWU A;  3GD7 A;  4K2K A;  3CRL C;  1DZ1 A;  1G2S A;  1IW7 D;  4FP5 D;  3MFG A;  1EQV A;  5EGT A;  3KBG A;  1CTM A;  1YNJ C;  2QCP X;  3CU7 A;  4BY7 B;  1LT5 D;  2B63 B;  4A3I B;  2IT1 A;  3AB9 A;  4C3J B;  5ELF A;  3MEH A;  4BBR B;  3P75 A;  2F0K A;  4DNT B;  5C4J B;  1TWC B;  5KNB A;  2YYZ A;  2NN6 H;  5ELB A;  1U4L A;  1G2T A;  1PRT B;  2E75 C;  1OXX K;  4R9W A;  1RF2 D;  3BVZ A;  4FNF A;  1SYF A;  1BF4 A;  3P1H A;  2HDM A;  1JR0 D;  2QEJ C;  4CJ0 B;  4G4K A;  1HQM C;  4IUU A;  2L12 A;  2QDB A;  4H0L C;  3IL8 A;  3NSW A;  1LTT D;  4TQU S;  4A3K B;  1Y1W B;  3J81 L;  3U9S A;  4S3S A;  2Y0S B;  1ENA A;  3SVM A;  3OOC A;  5I6Y A;  1Y8P B;  2G9D A;  3AMU A;  3NWS A;  2AQ1 B;  2B2V A;  4DA2 A;  3S2H B;  4J8Q A;  1SMY C;  1O7Y A;  1FGB D;  4FXK C;  1KTK A;  4PQX A;  1SJH D;  2DNC A;  1TWG B;  2OT2 A;  4M1U B;  5I9P A;  5EKK A;  5NUC A;  4IQZ A;  5DNF A;  2NYZ D;  1AW7 A;  3PUW A;  3T53 B;  4KKU A;  4GZY C;  1LAC A;  3FDT A;  1VF5 C;  1PTO C;  1TU2 B;  3H91 A;  4CKE A;  1H9R A;  4C3H G;  5IOC A;  2FJ2 A;  4HED A;  4RKB A;  1JE4 A;  1ILQ A;  2RDF A;  2IX3 A;  2EY6 A;  1B44 D;  5JEA G;  2F0D A;  1D5X C;  1XX8 A;  3Q22 A;  4DNR B;  2NUC A;  2C9O A;  1PRT D;  1AZP A;  2MP1 A;  4B9W A;  3LNN A;  3NK9 A;  3FKI B;  2X6G A;  2D9U A;  4LMQ D;  1WTW A;  2IX0 A;  4ODG A;  4F8M A;  1NCV A;  1EYA A;  2B2V C;  3A56 A;  1JQY D;  3RLF A;  1JOK A;  2JE6 I;  3BYY B;  1EYC A;  3SK4 A;  3A8K E;  4RGN A;  3D3R A;  3PIP 3;  1BCP F;  1H9K A;  2BA1 A;  1CQV A;  2RA4 A;  3PUV A;  3NWT A;  1LTA D;  4ZYS A;  3AU7 A;  4NMZ A;  2K7V A;  5KIX A;  3TZD A;  3HOV B;  4UDU C;  3HRZ C;  3I8Z A;  1W6K A;  5C0X G;  5IIF A;  2QKI C;  4RH6 A;  2R93 B;  3MAQ A;  2ID0 A;  1U4M A;  1EEF D;  1BCP B;  5KGU A;  3NHH A;  1E2W A;  2F0W A;  4M8A A;  3ERO A;  5JVH 3;  4DXG A;  4FXG C;  1SE2 A;  4N9P A;  2WAC A;  2B2T A;  3PUY A;  3FVQ A;  2R3Z A;  1V1O A;  3DUZ A;  1CA5 A;  4IUT A;  4ZKC B;  1NSN S;  1TQO A;  1FNW A;  1O80 A;  4HSP A;  3J80 L;  3TZU A;  3TP5 A;  1KNA A;  3I91 A;  3MFY A;  1SNQ A;  2ZT9 C;  4XQJ A;  2ZXR A;  3PO2 B;  1M4V A;  3R93 A;  3PMF A;  5DM7 3;  3VA5 A;  1DXM A;  2KVM A;  5D3D A;  2O2L D;  1SMY D;  1HUN A;  1K8O A;  3S9W A;  5EKI A;  4F88 A;  3HOW B;  3J81 E;  3S1M B;  3Q24 A;  4JBW A;  4K8I A;  1SND A;  1SNC A;  3M3Y B;  2B8G A;  3DWP A;  1R4P B;  1HFN A;  4OL7 A;  1STB A;  2IX1 A;  2K1B A;  1C48 A;  2PCF B;  1GUW A;  4FF3 A;  1YNN C;  5M5Y B;  5IT9 E;  5EPL A;  2HUG A;  2CVR A;  5F2D A;  2L55 A;  5FO7 B;  3A8I E;  2SEB D;  3NE5 B;  1LTB D;  2EYM A;  1A2U A;  4OIJ A;  3X3M A;  2NTS A;  4C1N I;  3S1N B;  2NVX B;  2PYK A;  4FYD A;  1E2V A;  1CHQ D;  5ELD A;  2NVQ B;  2IJ0 A;  2PPB C;  1STY A;  3NP8 A;  1JC7 A;  1EFI D;  1D5Z C;  4ZK9 B;  3OMG A;  5M3F B;  1YNJ D;  5K36 H;  4ILW A;  3K58 A;  4MN3 A;  1SYE A;  1EEI D;  3K5L A;  4K5W A;  2BCO A;  5AFW A;  1EU4 A;  4EVO A;  1IYU A;  5JEA H;  1QIL A;  2XWB B;  1RCV D;  2F0O A;  4B9X A;  2F0M A;  1ESF A;  1VCI A;  4KHZ A;  1DYQ A;  3HZX A;  1U9R A;  1EY8 A;  2EE1 A;  3OIQ A;  3S1R B;  5KYI A;  2LS0 1;  3J7A F;  2YU9 B;  4XIG S;  4JK1 C;  2AUJ D;  1I4X A;  5EBC A;  1FNU A;  3BDO A;  3GTL B;  3DEP A;  4RAU C;  3I3C A;  4TKO B;  4DAP A;  2HCC A;  3NQT A;  3SHL A;  2IL8 A;  5DM6 3;  5EPJ A;  3V2T A;  2B2W C;  4KV6 A;  2D62 A;  2K05 A;  4RWS C;  5C4X B;  3NUC A;  2MHV A;  4KJO A;  1WCM B;  1G29 1;  3HOZ B;  1A2T A;  1EZ8 A;  1HFG A;  1IKM A;  2D5D A;  3MXU A;  2F0H A;  1QNU A;  1BCP D;  4L6T B;  5CMD A;  3GTJ B;  4CHT B;  4EQN A;  4HTH A;  1EYD A;  1PZJ D;  4WRD A;  4DF7 A;  4KN7 C;  3C1E A;  5C3E B;  1B1Z A;  1RTN A;  1EOT A;  1VMC A;  1JWU D;  4BS9 A;  3G6J B;  4BY1 B;  4V0B A;  5CBA E;  1DD2 A;  3I70 A;  2I07 B;  2L11 A;  1B2T A;  1PTO B;  3VYT A;  2KED A;  2EYO A;  1OXT A;  4RFB A;  1X32 A;  4QUC A;  1EL0 A;  2IWH A;  2EXZ A;  3BS1 A;  5JOB A;  1Y1V B;  1V1P A;  4HAE A;  5BN5 A;  2Q8T A;  5J1Z A;  1XTC D;  1S5D D;  3QWN A;  3U9O A;  3H3V C;  4C3I B;  2VUM B;  5D65 A;  2EJM A;  2J0T D;  2K04 A;  3DMU A;  1H9M A;  2EJG C;  2K03 A;  2QF7 A;  1AFP A;  2WKC A;  4OO1 I;  5E4X A;  1RKN A;  1UNS A;  3Q6S A;  4OGQ C;  2F3V A;  1B4O A;  3CKI B;  3H0G B;  1TS5 A;  1W6J A;  1JB3 A;  1B3A A;  1LO5 D;  5KRU A;  2XRS D;  1O7Z A;  2J7Z A;  3T51 B;  1O78 A;  5IGF A;  2IPK D;  4N9T A;  4MHE A;  1HTL D;  2N88 A;  3EA6 A;  3OWE B;  1I4R A;  1NAP A;  4G57 A;  2F4I A;  4G7H C;  2A68 D;  3QB3 A;  2Z4I A;  2NWG A;  2EYF A;  3QIA A;  1QE6 A;  5EKL A;  1SBB B;  1BQQ T;  1KAB A;  4KMU C;  2E76 C;  1JIC A;  3E5S A;  4G7O C;  1GUG A;  3OIP A;  2F0F A;  4DN4 M;  1WVL A;  5ELC A;  1XXG A;  3PIO 3;  3D8G A;  1BOS A;  2HDL A;  1AZQ A;  1ET9 A;  2Z1C A;  1FYC A;  3PUZ A;  1HCZ A;  2CW0 C;  3MZ5 A;  1PMR A;  4FF1 A;  1F2L A;  4QMG A;  4KN4 C;  5CV4 A;  4C1N K;  5FLX E;  1KDC A;  2F1M A;  2WV6 D;  1G91 A;  3MC0 B;  3FPP A;  1SSO A;  2XWJ B;  1HA6 A;  4X3K A;  4WFN 3;  3M85 A;  5I2Y A;  1LT3 D;  4WOR A;  1DOM A;  2F0E A;  1OO9 B;  1Q1E A;  4QF4 A;  4C3J G;  4A3G B;  4TRD A;  3TN2 A;  3T16 A;  3VYS A;  4XT1 B;  2E2J B;  3ITP A;  2J4X A;  2IW3 A;  3W3A A;  4FF2 A;  4K5V A;  1D2B A;  3S15 B;  5DEH A;  4KKS A;  3V96 A;  1I4G A;  1EY0 A;  1CM9 A;  5C5M A;  4NDX A;  4OHJ A;  2RQX A;  3N6R A;  3BDC A;  4RHS A;  2KJX A;  1F9P A;  1BO0 A;  1GUS A;  2QIL A;  3TP7 A;  5M5X B;  3EQL C;  3T4A C;  1STH A;  2L5T A;  2EY2 A;  4KY6 A;  1KAA A;  3J7A V;  2A6H D;  2PZW A;  1ET6 A;  2KEC A;  3VR3 A;  1SEB D;  3L3O C;  2JP1 A;  5DAU A;  2BDN A;  3BDL A;  2MGS A;  3KBX A;  2FHT A;  4IUR A;  3EVQ A;  3JAM L;  5K5P A;  5I9O A;  1K8M A;  3M7G A;  3OWF A;  4I65 A;  2Q8R E;  3R2I A;  3E0J A;  4CKB A;  3Q0A A;  3N52 A;  1E2Z A;  1QWY A;  4KY7 A;  1Q1B A;  2NB0 A;  2AUK A;  1BDO A;  2MPM A;  1Z6H A;  4ULL A;  4C3I G;  3A7A B;  3I4L A;  1ZXT A;  3RD4 A;  1PTO F;  3GV3 A;  4HMJ A;  3L9A X;  4EGV A;  1SNO A;  2B2W A;  1GUO A;  1IYV A;  3HG9 A;  3PUX A;  4QCL A;  4HSV A;  2KQ3 A;  4NKL A;  3KLR A;  1VMP A;  2XSC A;  3KK7 A;  2EYJ A;  2TSS A;  5LHY 1;  1S5F D;  1IL8 A;  2Z4H A;  3C3L A;  3OPO A;  3K7A B;  2FFK B;  2K6A A;  4L63 B;  4X3T A;  3K0Y A;  1ONL A;  3I72 A;  3FEW X;  2DY8 A;  2ICE C;  1F9R A;  1WD0 A;  3VR2 A;  1SDF A;  2XN9 C;  1M8A A;  5BN3 A;  2CQA A;  2E2D C;  1J8I A;  5C4H A;  4DXF A;  5HGT A;  2NZ1 D;  4V19 0;  5C0X J;  3VYR A;  1S5E D;  2R92 B;  1OXU A;  2K32 A;  3SK8 A;  4FO2 A;  3NQI A;  3TP6 A;  1DON A;  3I4N B;  2EPB A;  2L4N A;  5IT9 L;  1YNN D;  1WTV A;  4RKL A;  4OO1 H;  4IAL A;  1HUM A;  4OO1 G;  3OW7 A;  1B53 A;  1F77 A;  4RA8 A;  3H09 A;  1SNM A;  2A68 C;  4H44 C;  1MSH A;  4K6L A;  2RSN A;  2EZV A;  2F0Q A;  4DFA A;  1ENC A;  1Z7T A;  2HCI A;  1STA A;  1PFM A;  3GTP B;  4HCS A;  2PO4 A;  5A2Q E;  3HS0 C;  2G9H D;  1CZW A;  2H4O A;  2F0T A;  4PMW A;  4KHV A;  1O7L A;  1SYC A;  4RHR A;  3K57 A;  5JEA J;  1DOK A;  4PV1 C;  2PW7 A;  2RBM A;  1KLU D;  1WTQ A;  5IGG A;  5KNC A;  1Y69 U;  3D31 A;  2F03 A;  2N55 A;  3S2D B;  4IN3 A;  3KLS A;  3X3N A;  4BA2 I;  3SE0 A;  4UAI A;  4NW2 A;  5IOD A;  5G3L F;  2JA5 B;  1BCP C;  3NXW A;  1S5B D;  3PO3 B;  3MHB A;  5CV6 A;  1TWH B;  1LTS D;  5D3I B;  2NVY B;  1T5E A;  1ROD A;  5C44 B;  3QJY A;  2I46 A;  3A8J E;  3NBI A;  5CV9 A;  1BXT A;  4QUF A;  4HCE A;  3TSS A;  3IFT A;  4XDX A;  1I50 B;  2PZT A;  3GTO B;  5COR A;  2K5Q A;  3R3O A;  3M7N A;  1H9J A;  1L0Y B;  2EY1 A;  1PZI D;  2B8F A;  2BE5 D;  4K6D A;  1ENF A;  2FMC A;  4KD4 A;  3T13 A;  1HTP A;  3QG1 A;  4K5X A;  5EBD A;  1II3 A;  3DM1 A;  2VB3 X;  1Q12 A;  3FRP B;  3FPU B;  3BVG A;  3MXN A;  4FXD A;  2MUY A;  3W2D A;  1S5C D;  1CZG A;  2K01 A;  5IGB A;  4P2C B;  1FNV A;  1NR2 A;  2VXW A;  5C0X I;  3EJI A;  3WOE A;  4CJ1 B;  5J22 A;  3KLS X;  1Q8I A;  3QO2 A;  2M00 A;  1IKL A;  2FIN B;  3GV6 A;  2F0G A;  2PW5 A;  4J6H A;  3A55 A;  1V8Q A;  1JWS D;  2DY7 A;  1TT2 A;  2X69 A;  2HQE A;  2WKD A;  2B2Y C;  5FO8 B;  1RD9 D;  5FOB B;  2L9H A;  4DAY A;  3I4M B;  2ENB A;  2RDG A;  4K14 A;  2WB1 B;  3C46 A;  2K33 A;  2PNR C;  2OEO A;  4U68 A;  3GP7 A;  5JPM C;  4RGM A;  1ESR A;  4F87 A;  3HOX B;  1UAP A;  2CHB D;  3NBH A;  3Q23 A;  1EY4 A;  3DWQ A;  4KY5 A;  2Z8L A;  2WII B;  1FR3 A;  4A93 B;  2PQE A;  2EJF C;  1DCZ A;  3FMC A;  3BG3 A;  3URY A;  5COY A;  4IZ8 A;  3S1Q B;  2M9V A;  1GUN A;  3OHX C;  1SE3 A;  2LFN A;  1CFM A;  2A6H C;  5A2Q L;  3R2T A;  4KJN A;  4CJ2 C;  3P7J A;  1B50 A;  1TII D;  3M4Y A;  4PNY A;  1F2Z A;  4KI0 A;  1J9O A;  5CV8 A;  3DEO A;  4RGO S;  1FD7 D;  1A3V A;  3V05 A;  5E4W C;  2A6E D;  2XVS A;  4B08 A;  2KUM A;  2VNU D;  4LK1 C;  2KOL A;  3O13 A;  3DXJ C;  1C8C A;  2L1B A;  1A3T A;  2WAQ B;  2D2C C;  3G7L A;  2JXM B;  5KEE A;  2A6E C;  1RJT A;  2V4D A;  5E3F A;  3BZD B;  2O5J C;  1EIH A;  3IKJ A;  2EVB A;  3QOJ A;  2EYL A;  2AQ2 B;  4QB4 A;  1I6V C;  1PYW D;  1C4Q A;  1VDZ A;  5KYL A;  1HPC A;  1B9M A;  4A3M B;  4EQP A;  3D6W A;  4K8J A;  3D4D A;  3A7L A;  2H1E A;  2JSO A;  1EY9 A;  2CW0 D;  3K5O A;  2VB2 X;  3BVM A;  2NN6 G;  2A69 D;  3TBI B;  2F0L A;  4Z9C B;  3K59 A;  2A74 C;  1TS2 A;  1JOQ A;  2EYH A;  5D14 A;  2Q8I B;  1PZK D;  1X3P A;  1GXD C;  1I4H A;  1TS4 A;  1GHJ A;  1CI3 M;  1MBY A;  4RCO A;  1EWH A;  4OIK A;  2E2I B;  5KND A;  4KK7 A;  1CT1 D;  2TMP A;  1GOZ A;  3KF8 A;  4CBV A;  1MSG A;  1S4Z A;  2F0P A;  3MA2 B;  2A5H A;  2RKS A;  1PRT F;  2BA0 A;  5CC4 A;  1Y8O B;  5M3M B;  1ICW A;  4H7B A;  3DHQ A;  2SNS A;  3S17 B;  1SAP A;  1G8Z D;  5C6A A;  1IHZ A;  4O42 A;  4U67 3;  1U4P A;  1LTI D;  1R9T B;  1DJR D;  4XQN A;  1ML0 D;  2JEA I;  3C1F A;  1EU3 A;  4A3B B;  3SXH A;  2AQ3 B;  2XNA C;  5J39 A;  4C2M B;  4ZUJ A;  4IFD G;  1CHP D;  1KNE A;  5A35 A;  5EPK A;  1A3U A;  3WDN A;  1F2Y A;  1TWA B;  5E1F A;  1JCK B;  3HP3 A;  3NTI A;  1PTO D;  1LT6 D;  2EY5 A;  3J7Y W;  1AEX A;  3SR1 A;  5JJZ A;  2R6G A;  4X3U A;  1WTP A;  1EY6 A;  1KLG D;  3HKZ B;  5IGE A;  1WTO A;  1OXS C;  5JAV A;  4DGZ A;  3GTQ B;  4FVM A;  5G3L D;  1H9S B;  4LJZ C;  1TKW B;  3QOL A;  3GO5 A;  1PLF A;  2JEB I;  3MWY W;  1CQF A;  3K6O A;  3LWE A;  4PMC A;  1SYG A;  2A73 B;  2BOS A;  1H9S A;  1BBX C;  3LX0 A;  4ZAI A;  4ZRZ A;  4DK1 A;  1A6X A;  2NBF A;  1TWF B;  2ZXO A;  1TS3 A;  4AYB B;  1D1K A;  4DAV A;  4KKT A;  3OMC A;  2ZXP A;  2B39 A;  3A54 A;  1UUP A;  3K5M A;  3ND8 A;  3MXP A;  1KDA A;  1QOH A;  2DNE A;  2B2U A;  5CR3 A;  3S14 B;  1IW7 C;  4XYQ A;  1G6Z A;  4X3S A;  4HN7 A;  4R8N A;  1SFO B;  3J80 E;  1PTO H;  1GUT A;  3BYT B;  2DN8 A;  1BNZ A;  2A69 C;  1ILP A;  1HQR D;  1B9N A;  1F2M A;  1TY0 A;  4YIJ A;  3CHB D;  3D4R A;  4HR7 B;  2F0J A;  4A3J B;  3M4O B;  1HA5 A;  4J1M A;  4ZQ3 A;  4IFD J;  3H6M A;  1QNK A;  2GA4 B;  2F3W A;  4IUQ A;  3CRK C;  2E2H B;  4XYO A;  1TR5 A;  2R7Z B;  5CV7 A;  3SEB A;  1X3Q A;  1ZYR C;  2F0N A;  5CGK A;  3JAM E;  1TY2 A;  1I4P A;  4IUN A;  1R4Q B;  3ZYY X;  4QIW B;  3RUZ A;  5C4Z A;  5C3X A;  1T5X D;  1JWM D;  1SNP A;  2B2Y A;  2EOT A;  5C3W A;  3RZO B;  3MXG A;  1TVX A;  2F0I A;  4NP5 A;  2EDG A;  3CQZ B;  2K5D A;  1JOR A;  2F0U A;  1NUC A;  4Q5V A;  4DU9 A;  1Y8N B;  1RHP A;  3R8B A;  1LV9 A;  3ND9 A;  3GTK B;  4XXE A;  2SOB A;  3C2P A;  5K36 G;  1XYI A;  4TSS A;  2AWO A;  2XIW A;  4BWG B;  3TME A;  4CKC A;  2ICI A;  3ONA B;  5FK9 C;  1E0B A;  1DOL A;  3NTH A;  5BN4 A;  4G7Z C;  2KA7 A;  2JYO A;  3SK5 A;  1STG A;  2NTT A;  4A3F B;  1I6H B;  1LAB A;  4BBS B;  2LMC B;  4ID6 A;  1UEA B;  1WTX A;  3HGB A;  1MGS A;  1QJO A;  1AP0 A;  1EIG A;  4XQQ A;  5I2X A;  1ZYR D;  4RGT A;  4IUV A;  4F7X A;  5T1I A;  5ISR A;  1K83 B;  1VF7 A;  1EQT A;  5TSS A;  3D4W A;  1V43 A;  2RDH A;  2O5I C;  5C5L A;  4E6I A;  2WP8 J;  1BUV T;  4ME5 A;  4LAA A;  1EY7 A;  5IGD A;  2JA8 B;  5T1G A;  3GTM B;  1STE A;  3SK6 A;  4C3H B;  4PMB A;  3TDQ A;  4IUP A;  1AN8 A;  4CGY B;  4DK0 A;  4R8I A;  3HOU B;  1EZ6 A;  2PZU A;  1HXY D;  3I73 A;  1JOO A;  1I4Q A;  1Q3L A;  3TP8 A;  2BE5 C;  2R61 A;  2B2T C;  2KHS A;  2FMM A;  3S16 B;  1MI2 A;  1QB5 D;  1OXV A;  1LTG D;  2O4X A;  5C0X H;  1LLR D;  3VR6 A;  2X6L A;  1KDB A;  4A3E B;  5EQ0 A;  3UI2 A;  2M2L A;  2OXP A;  1MD2 D;  4L8J A;  1Z47 A;  4WJW A;  1BR9 A;  5EJW A;  4O1N A;  3PV0 A;  4H13 C;  5LL6 S;  2NN6 I;  3SDZ A;  1WD1 A;  4FF4 A;  1SE4 A;  3VR5 A;  3RZD B;  3H94 A;  2JA7 B;  3K5N A;  3RMH A;  5JVG 3;  3L7Z C;  3VA7 A;  3MTS A;  2KEE A;  5CYU A;  3T56 B;  1D6E C;  4ZUI A;  1SJE D;  1PXU A;  1DM0 B;  3EFX D;  1U4R A;  1PDQ A;  1EWC A;  1F9S A;  5IGC A;  5M9O A;  3HEJ A;  4C56 C;  2KCN A;  3KUP A;  1RDP D;  1L0X B;  1SYD A;  2SDF A;  2RVL A;  1CK1 A;  3HOY B;  1SYB A;  1ZEQ X;  3NTK A;  1I3Q B;  4RCN A;  5I4D A;  2PMZ B;  2AWN A;  2C5C A;  1STN A;  2SNM A;  1F9Q A;  2JA6 B;  2K28 A;  5M5W B;  1Q90 A;  1GHK A;  3VR4 A;  3E6Z X;  1LTR D;  5CBE E;  4HMI A;  4XT3 B;  3DWA A;  1SXT A;  3ERQ A;  1XWE A;  2MJ8 A;  1PRT C;  3GQB A;  4ZLT F;  1WTR A;  4A3D B;  4KTA A;  3F2U A;  5LL6 X;  4MIU A;  5CV5 A;  2F0V A;  1D5M C;  5I6W A;  4Y7N B;  5FKA C;  2XRQ D;  1HHV A;  2LY7 A;  4KD3 A;  4ABN A;  1V1P B;  4BA1 I;  1A15 A;  1LT4 D;  2BDO A;  1EY5 A;  3MVV A;  4XTC S;  2L0C A;  2EYP A;  4IFD H;  2LKV A;  4IFD I;  2K5W A;  4ZKB B;  3WOF A;  3IAY A;  1QCB D;  1NR4 A;  2KCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...