1AP0A

Structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chromatin-binding
molecule keywords MODIFIER PROTEIN 1
publication title Structure of the chromatin binding (chromo) domain from mouse modifier protein 1.
pubmed doi rcsb
source organism Mus musculus
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ap0A00
2L9HA 1EQTA 2RVLA 4HAEA 5EPKA 3SVMA 1Q3LA 3F2UA 1KNAA 2IL8A 3UI2A 1S4ZA 4R9WA 1O80A 1VMCA 2J7ZA 2K28A 4IUPA 2Q8TA 2HDMA 3IFDA 1PFNA 1CM9A 2M2LA 2FMMA 2NYZD 1HFNA 2N88A 1F2LA 2MP1A 5CMDA 1SAPA 2KVMA 2N55A 4X3UA 5EPJA 1F9RA 2JP1A 4RA8A 1AP0A 1NR4A 4NW2A 1B53A 2KEDA 2Q8RE 1RJTA 3I91A 2B2WC 2B2YC 1TVXA 1M8AA 2L4NA 2B2UC 2DY8A 1X3QA 2R3ZA 2K04A 1G91A 4IUQA 1IL8A 1U4RA 1ML0D 4U68A 1WTOA 1NCVA 2VXWA 1KNEA 1MGSA 1MI2A 1ILQA 2K03A 3FPUB 3I90A 3KBXA 4RWSC 3FDTA 5AFWA 3P7JA 4X3KA 1HA6A 1RHPA 2FHTA 5EKIA 4ZLTF 3D6WA 4O42A 1QE6A 2K01A 4R8IA 1WTXA 1J9OA 5T1IA 1B2TA 1ESRA 1MSGA 4MN3A 4ZKCB 5D14A 2DY7A 2MPMA 3Q6SA 4QUCA 2MJ8A 1WTQA 1EIGA 2B2VC 2X69A 1AZPA 1DONA 5EPLA 4DN4M 2BDNA 3N52A 1QG7A 1X32A 4CJ1B 4IUUA 4QUFA 1WTPA 5CBAE 1ZXTA 2HUGA 1DOKA 2HCIA 1WTWA 1CA5A 2FINB 2HCCA 1WD1A 4LMQD 4MHEA 3KUPA 1SSOA 2B2WA 2B2YA 1WTVA 4X3SA 2RSNA 1EL0A 2B2UA 1F9SA 1PFMA 5JJZA 1GUWA 5EQ0A 1BF4A 2L12A 2RSOA 3QO2A 4RAUC 3DEPA 1WVLA 3GV6A 1IKMA 1G2SA 1ICWA 4OIJA 1JICA 2NWGA 5DNFA 4ZAIA 3TZDA 1HUNA 3I8ZA 2KUMA 1O7YA 1SDFA 2EPBA 1B4OA 4CJ0B 1BNZA 4CJ2C 5EJWA 1BBXC 1F9PA 3IL8A 1XX8A 4HEDA 1C8CA 1DOMA 2H1EA 1A15A 1IKLA 3MTSA 1G2TA 2KECA 2B2VA 3DEOA 1RTNA 2EE1A 4HCSA 4X3TA 2B2TC 2X6GA 2NZ1D 5COYA 4ZKBB 5CBEE 4IUTA 1HHVA 1DZ1A 2FFKB 1DOLA 1G6ZA 1JE4A 1NAPA 4XT3B 1ILPA 1HUMA 1MSHA 1U4PA 2K1BA 3I3CA 1HRJA 3G7LA 3R93A 1EOTA 2L11A 2L1BA 1NR2A 3HP3A 1RTOA 5E4XA 1QNKA 2D9UA 4ZK9B 1B50A 2SDFA 1LV9A 5D65A 1EIHA 5T1GA 2RA4A 4IURA 1RODA 4UAIA 4XDXA 1F9QA 1WTRA 1E0BA 2EOTA 1PDQA 2X6LA 4OIKA 1WD0A 2HDLA 2KOLA 1U4LA 3GV3A 3H91A 2K05A 1PFBA 2FJ2A 4XT1B 5CORA 1O7ZA 1HFGA 3ONAB 2B2TA 5E4WC 3DM1A 1B3AA 4HSVA 2XIWA 1J8IA 1U4MA 1VMPA 2JYOA 2KEEA 3MWYW 1XYIA 1X3PA 2MGSA 1BO0A 1AZQA 4IUVA 3TN2A 1PLFA 2CVRA 1CA6A 3LWEA
chains in the Genus database with same CATH superfamily
2L9HA 3F2UA 4HTHA 4LK1C 1D1KA 2XTIA 2OQKA 3UI2A 4LF4L 4IUPA 2I5MX 1V8QA 1STEA 4BBSG 1JJ2A 4BY1H 4B3SQ 3QJYA 5EPJA 2FMCA 3EBEA 4CHTB 3J81c 3EN2A 1NR4A 2Q8RE 3RLFA 1PH3A 2MFIA 2L15A 2EQSA 2K04A 3PO2B 3CPWA 1XPOA 2UXDL 1ML0D 5FLXE 1PH5A 3KLRA 5C44G 2JA6G 1RHPA 5IP7G 4BY7G 5A2QE 4YHHQ 1T9HA 2RHQB 3NBHA 1IW7C 1NMFA 2WV6D 4L5RC 2DY7A 1L0WA 2HIVA 1GUSA 1F2ZA 3GP7A 1QG7A 5M5WH 1TXYA 2UU9Q 1MJEA 4DV6Q 1BCPB 1LTAD 2UXBL 1SEBD 3HOUB 1WTVA 1Q8IA 5NUCA 2J4XA 1ASYA 2F52A 4R4OA 4B3TL 4A3LG 3ULJA 1BF4A 2NWGA 4JI6Q 3MA2B 3A5ZB 1LT4D 1TS5A 3CAMA 2CH4W 4X64Q 1RD9D 3TMEA 2JSOA 3QG1A 4DR7L 4NDXA 2KECA 3GTKH 3HOWH 4HJ9A 1I4PA 4KN7C 3SDZA 3BDCA 5FO8B 4IOAA 1CHQD 1BVSA 1X3FA 3H0GG 2VS1A 2QDLA 1BCPD 2JA7G 1KL9A 3ULLA 3S1MB 1ZYRD 4DR6Q 1SROA 1Q90A 2EYOA 1NMGA 3HOXG 2LXJA 1LV9A 4IURA 3IKJA 2CQAA 2K5NA 2D2CC 2KOLA 1Y1WH 3K5LA 2QEXA 4DR3L 2GN5A 1JE5A 5IGGA 1TWAH 1YNXA 3A8KE 3EA6A 3F8TA 2QGQA 1O78A 3MWYW 2NVTB 2HD3A 4NKLA 3PF5A 5JEAG 1EY5A 5EBDA 1PH6A 1ENAA 1E2VA 3J80i 4BBRG 4R4QA 2VB3X 3GTJH 1N8RC 3PSIA 3S14H 2ID0A 3KFUA 1TY0A 4LFBQ 5M3FB 4PZ6A 4OGQC 4P2CB 1F9RA 1LT6D 2B2WC 1QVCA 2D5DA 4IZ8A 3HOYG 4WJWA 2JA5G 2A1AA 1KNEA 1UNSA 1N36Q 3I4NH 4X3KA 1R4QB 3H6MA 1HNXQ 4LF7Q 4DK6C 1A3VA 2VQEQ 2HIXA 1I94Q 4JI3Q 2XN9C 1PTOB 2O5JC 1VS0A 4IQZA 2VQFL 3VYTA 3GTOB 4KHPQ 3BZDB 2ZJRA 1J5EQ 4HIOA 4IFDJ 1IZ6A 4A3BG 2WAQB 3I4MH 1VQHA 4XQQA 3C2PA 3S9WA 3HOVH 2NBFA 1NY4A 1PFMA 1Y69U 1GUWA 2KENA 3TP8A 4AIMA 1EOVA 4NB3A 5C3EH 1EY0A 1XNRL 3BZCA 2E74C 5C4JH 2PNRC 1XX8A 1PH1A 2GVAA 2R7FA 1PTOD 1OXTA 5I9OA 4OO1I 2EYJA 3K0XA 3KLSA 1VQGA 3MTSA 3M85A 2B2VA 1OO9B 3FKIB 1TT2A 4P71A 3GTLH 4F7XA 5JPNC 2F0QA 2CCZA 4L5SA 2QDBA 4JYAL 1HUMA 4HJ5A 4C2MB 3D6CA 2MHVA 1HJPA 1UEAB 1HR0L 5FJ8H 1AFPA 4JI0L 3J81i 4OIKA 4IOCA 4A93H 1FNVA 3M4OH 3H91A 2K05A 1TKWB 2F0MA 3P75A 1EWIA 4G4KA 4WFN3 1ASZA 3BG3A 4EX5A 2AUKA 2WKCA 4K5WA 1J8IA 1EY6A 1GHKA 5J22A 1VMPA 4BS9A 4F88A 2J0TD 4BBSH 5EKLA 3ND9A 2EY1A 1KQSA 4JI8Q 2VB2X 2MQHA 4LUVA 3FP9A 4N8FA 5EGTA 3W1GA 5KYIA 2IL8A 3MFGA 3SK5A 3F2BA 2R93G 2YU9H 2UUBQ 2E2JH 5D3IB 5C44H 2Y0SE 4BY7H 5IP7H 4ME3A 3J7ZC 1SMYC 1LO5D 2BE5C 3JAMc 1STNA 5LL6S 5DAUA 3VR4A 2XNAC 1GOZA 4JPBW 4C3JB 5CC4A 3G4SA 1IL8A 5C5MA 5FO9B 4X66Q 1GKHA 2K4KA 1UUPA 3TEHB 3AB9A 1XJVA 4DR1Q 2F03A 4A3LH 4ZKCB 3OWEB 4LF8Q 2EZVA 4B3RQ 3O13A 4KKTA 4WRDA 1X55A 3U4ZA 1K83H 4JI4L 1KLUD 2K5VA 4G57A 4LF4Q 1A6XA 4CDDC 1BCPC 1KTKA 3T4AC 4ABNA 2SEBD 2K75A 3UE1A 2TSSA 2NVYB 3L7ZC 4KI0A 2KUMA 1O7YA 4A3IB 1LYLA 2A19A 3H0GH 1LTRD 2K32A 2JA7H 1A2TA 1CKOA 2JEAI 2UXDQ 2H1EA 2K5HA 1YHAA 3J81j 1CT1D 2RF4A 3HOXH 3K81C 2R6GA 4OWTB 4A3JG 1I6HB 4IUTA 4DUYL 3S1RB 3HEJA 1EFWA 1AW7A 5M3MG 2LMCB 2R61A 5E1FA 3CCLA 2ZTDA 2F0EA 5BN5A 1B50A 4DU9A 4B08A 1NE3A 2UXBQ 2LS01 2IX1A 4IPGA 4LF6L 1QCBD 1Y8PB 5JEAH 4BY1B 3L3OC 3DWPA 1VQ6A 1KIXA 1GHJA 2XIWA 4JOIC 2RDGA 3GTPH 1X3GA 5I2XA 2F3VA 3GTMH 1BO0A 4HIKA 3A8IE 4DR7Q 1GD7A 3TN2A 2E5LQ 1S5BD 3M7GA 4B3SL 3PO3B 1CK1A 3D31A 4YY3L 3HOYH 4Q5VA 2JA5H 2MP1A 1SAPA 5M5WB 3RD4A 3CCVA 4K8IA 2XSCA 5CV4A 3S16H 1S5CD 4NW2A 4OONA 2L4NA 4GKKL 2B2UC 4YHHL 4J6HA 4C3IB 1JOKA 1VQ4A 3K6OA 1HA6A 4HIMA 3E0JA 2KQ3A 3D6WA 4A3BH 2RHSB 1DJRD 1YNND 2YTVA 3X3MA 1IBML 4QCLA 1MSGA 5IWAL 1P8LA 1Z7TA 4ILWA 3OTOL 1WTQA 3GTKB 2F0OA 4KLKA 1ZXTA 4CKBA 3NTHA 4HMJA 3LGJA 4R8NA 4MHEA 5BR8L 1SSOA 1RDPD 1EQQA 1QUQA 4H0LC 1IBKQ 2K7VA 3W3AA 3OMCA 3I4LA 3HKSA 1MKHA 3KDFB 4CKCA 1WVLA 5IOCA 2EYFA 1G2SA 4E6IA 3KDFA 2ASBA 3FPPA 3K7UC 1ONLA 2QF7A 1SE4A 1YJWA 3S17H 2Y0SG 3TRZA 1WYDA 3HKZE 5FO7B 3I56A 5COYA 4H7BA 2EJMA 2YTYA 3KLSX 1W3SA 2CFMA 2F4VL 1E7ZA 3S2DH 4POFA 2F0GA 3CCRA 1SYGA 1U5KA 2VZAA 1OXSC 1UE5A 1XTDA 3GTJB 2A68C 4GN5A 2G9HD 4O0AA 3S14B 2OQ0A 1IW7D 3JAMi 4UP8A 1WD0A 1EYGA 3FMCA 2RQXA 3VR2A 4GOPB 2F0LA 2A8VA 1SYFA 1RF2D 3DM1A 1XNRQ 3G6EA 4KD3A 2EXDA 2BDOA 1IYVA 3TDQA 5JJIA 3BYTB 2E8GA 1N34L 3H3VC 2PZUA 1C4QA 3I4NB 2R93H 2E75C 2J7ZA 3HOWG 3S1QB 3MZ5A 1K8GA 2KJXA 3HG9A 1Y14B 3D8GA 3DHQA 3CXCA 4JYAQ 4DK0A 1LTTD 5KNBA 3A55A 1SNOA 3BDLA 2Z6BA 3GTGH 1AP0A 1QWYA 3HOVB 2VQEL 1I94L 3ERSX 3RR5A 4JI0Q 3BVZA 3I2ZA 4PMBA 1LM0A 4U68A 1NCVA 5C3EB 1MI2A 2WB1B 1EIFA 5CV5A 1JOOA 1VQAA 3K7AH 1Q46A 2F0VA 4EVOA 4DF7A 2ENBA 4IUNA 3UDFA 3SXHA 4A3KG 5D14A 2MPMA 1WCMB 5D3DA 1H9MA 4HMIA 2CW0D 4IUUA 4M1UB 2PQEA 1VQ9A 4ZUJA 3GTLB 3EROA 1QJOA 2HUGA 3NELA 2UUAL 1SYBA 4PMCA 2B2WA 3TS0A 4GS3A 3EVQA 3K5MA 1X6OA 2RSNA 3TS2A 1F9SA 1EYAA 1C48A 3DUZA 3KBGA 3H94A 5C4XG 3GV6A 2C9OA 2EDGA 2AWOA 4A3JH 1S72A 1JWSD 1SDFA 1JQYD 1XWEA 1F9PA 4A93B 5M3MH 2VUMB 3SEBA 3PIP3 2SNSA 1GUOA 3FRPB 1KRTA 1RTNA 2Z0SA 4K14A 2Z9HA 1MJCA 2D62A 5E7NA 5EBCA 4FF4A 3CHBD 1EUJA 1EY8A 4BBSB 1EWCA 4ULLA 3CMEA 3CCMA 1HQMC 1NNXA 1HQRD 4JK1C 4DPGA 1STGA 5E4XA 5ELOA 4JI4Q 4IPDA 1TS3A 1A3TA 1TWFB 3LWUA 1FVIA 5C44B 1B7YB 2JA6B 4BY7B 3M9BA 2TMPA 3WWVA 1TWHH 1ENFA 3GDEA 1I4GA 3SHLA 1HR0W 1U4MA 1YHBA 3E3XA 2CH4A 2CWPA 4HJAA 3M3YB 2VNUD 5F2DA 1Q1BA 1L2FA 3OYYA 3NXWA 2QA4A 1X9NA 3CC4A 1MBYA 4MTNA 3K58A 2IPKD 3VA7A 1EQTA 1EYDA 1PYSB 5IGCA 2RVLA 4DUYQ 1RIPA 2F0FA 1K0SA 4QIWE 3L9AX 5C4ZA 4ZUIA 3HKZG 2EJGC 4ZCKA 1UWVA 1AN8A 4LW1A 1K83B 2QEJC 1HZBA 1KDCA 4C3HG 2DY8A 1SE8A 3LNNA 4IUQA 4LF6Q 4Y7NB 1VQKA 3I90A 3KF6B 1TS2A 5ELDA 4L8JA 3KF6A 2BOSA 1B9MA 3ER0A 5I6YA 4A75A 3H0GB 2XGTA 1WTXA 1B2TA 2EYLA 2YTXA 3PIOA 2JA7B 4F87A 3CF5A 1QVFA 2PO4A 3AFQA 4S3SA 5I9PA 2AQ1B 4AYBE 3HOXB 1SNPA 2KHSA 1H9JA 4BA1I 4JI7Q 1CA5A 2K52A 1GUTA 4LMQD 5ELNA 5LMNW 4YY3Q 5IYDG 1JB3A 3A0JA 2R92G 3S1NH 4H44C 4YCWA 1F77A 4JW0A 1YJ9A 3RLNA 3OHXC 2DJFC 1IYJB 1FGBD 3WOEA 3NPPA 1L0XB 1LTSD 4YWKA 1A3UA 3HS0C 5EJWA 3G48A 1IHZA 3RUZA 4GKKQ 2ZXPA 3C3LA 4IPCA 3TP7A 5C6AA 3E9HA 1DOMA 1G2TA 1SJED 4K2LA 2JJQA 1LTBD 5IT9E 3CQZB 2O4XA 3W5OA 4LWCA 4BBRB 1FR3A 1HTPA 2HHHQ 1SMYD 3GQBA 3HGBA 1IBMQ 1VQEA 3MC0B 2BE5D 3I73A 5IWAQ 4LJZC 1WI5A 1MSHA 3A74A 3OTOQ 2L1BA 4LF5L 4UHVA 3ICEA 4A3GG 1SFOH 1Q12A 2SDFA 3P1HA 3NENA 4N8X1 5BR8Q 1RODA 1BBWA 2JA5B 3PUYA 4MIUA 1QB5D 1VQ5A 1U4LA 3GV3A 3Q0AA 3S16B 2F0DA 1L0YB 2E5LL 2NUCA 4GOPC 2VY3A 4P75A 2R7ZG 1FGUA 2EY6A 3J7A5 3SR1A 5GAHC 1Y1VG 2WINB 3N6RA 5IGDA 4DAYB 4QL5A 3J7AV 1K3BC 2V1CC 2AKWB 1EY4A 1K3RA 3T56B 4DAYA 2CVRA 3RN5A 1N33L 5LMUL 1V9PA 2DJGC 5LL6X 3TQYA 1S40A 4A3DG 2E2IH 2K28A 2OF1A 4H13C 2MO1A 1PFNA 2N88A 2F4VQ 5CMDA 3T1YQ 4EGVA 2CW0C 3D4RA 1STBA 4AQYQ 4RA8A 2EJFC 4JOIA 4J1MA 1M8AA 3ND8A 4A3KH 1KRSA 4FF2A 2Z4IA 4UY8C 4DGZA 3OWFA 4O42A 4FXDA 1STAA 1ZEQX 3S17B 2Q2HA 3D3RA 2LFNA 1N34Q 1IBKL 1HCZA 2F0IA 1YZ6A 4JV5L 4A4IA 2RCFA 5C4XH 5IP9G 4OHJA 1X32A 4HSPA 1CSQA 4QUFA 2AWNA 1BR9A 2B2UA 3S2DB 1AE2A 2E2DC 5C4HA 2BCOA 4RAUC 3NWTA 1QILA 4ZQ3A 5M5YH 4KD4A 4JI1L 2JA8G 1SR3A 2CKZB 3TP6A 1EYCA 1UEBA 3HOUG 3CW2C 1LABA 4FVMA 1S5ED 1SMXA 3MAQA 1STYA 1PH9A 1JOQA 2A73B 3DEOA 4I7AA 4A3EG 3NTIA 2FFKB 1LUZA 1QVGA 4DAPA 4RKLA 1EEFD 1JE4A 2R93B 3AMUA 1HRJA 1U4PA 2ICIA 1OXVA 2UUAQ 1XXGA 3T1HL 3S2HH 2ZTCA 1Q7YC 1YIJA 1B3QA 1A0IA 4XIGS 2AUJD 4AYBG 1BOSA 1I50H 2NVXH 3F2DA 3GTGB 2N8NA 5HGTA 1HFGA 1STHA 4HSVA 2BH2A 3CC2A 5C0XG 2IHEA 3V05A 3U9SA 2MNAA 1TIID 1J6QA 2Z6KA 4GLVB 4J15A 1EZ6A 4KY6A 3I91A 3GD7A 3K7AB 1CA6A 3VYRA 3SVMA 5FLXc 2ZJQA 4C3HH 5KYLA 1R9TH 5IGBA 1Q81C 1O80A 5C0XI 5IYBH 2LXKA 2M2LA 4NP5A 3L2PA 2Z4HA 3NQIA 2C5CA 4GLAC 3URYA 3J80L 4X3UA 3T13A 1D5ZC 3UDIA 1I4RA 2R3ZA 1FYCA 4K6LA 1T5EA 2BA0A 2VXWA 5ELEA 4QF4A 3FPUB 3WOFA 1CZGA 4JBWA 1D6EC 4A3JB 1PZKD 2A5HA 3G6JB 3V96A 1FNWA 5BN4A 4GZYC 5IYDH 1L1OB 4ME5A 4MN3A 2A68D 2DNEA 2R92H 3TP5A 1MHWC 3ULPA 2M9VA 3CU7A 2X69A 1L1OA 4LUZA 5EPLA 2DUDA 1HTLD 3OIPA 4OWXB 1PYBA 2HCIA 3QB3A 4X3SA 2WACA 1O7IA 1IKMA 3NSWA 1YBYA 2NN6G 4KMUC 1VQCA 1X65A 4CJ2C 1TWCH 4KY5A 1HNWL 4LF9L 2B63G 4HEDA 2OXPA 3IFTA 3DM3A 4HCSA 4A3GH 1DD2A 2NZ1D 5IE8A 1YEZA 1DZ1A 1VQJA 1K8OA 2E2HH 4OL7A 1W6KA 4HIDA 1IBLQ 4OX9L 1NR2A 4I7ZC 4C1NI 5J3BA 2JN4A 1K28A 2IHFA 2KA7A 2R7ZH 4XDXA 1Y1VH 4DA2A 1WTRA 2X6LA 3M4QA 4R1JA 3OPOA 4EQPA 1BKBA 1KD1C 3HOZH 1HNZQ 4FYDA 2QCPX 1SBBB 2JXMB 5FKAC 3J81L 2EY2A 3OMGA 5CV6A 4A3DH 3TZUA 2IY5B 1A2UA 5DM63 1JJCB 1LTID 3RMHA 1QOHA 4DV1L 5K36H 4EQOA 4L63B 3E5SA 4LF5Q 1FJGQ 4CKEA 2JP1A 3GTQH 5G3LF 2EY5A 2RBMA 3S1NB 2Y0SB 2WKDA 2C35B 2SOBA 2IX3A 1MGSA 1JORA 1ILQA 3KBXA 5IP9H 1U0LA 4B3MQ 5KEEA 1QE6A 2K01A 2JK8A 5TSSA 4JI7L 2DGYA 2IW3A 2IJ0A 4C3JG 1KXLA 4TSSA 2PYKA 1DONA 1N33Q 5LMUQ 1UE1A 2JA8H 4A76A 2FXQA 1S3OA 3ZJYC 3HOUH 4LUOA 3BJUA 4TVAB 3K0YA 3KK7A 3A7LA 3KF8B 1XPUA 2SNMA 1SFOB 4NPSA 3KF8A 4A3EH 2EPBA 4CJ0B 1JC7A 1B70B 1ET6A 2H5XA 5I4DA 3J80E 2HHHL 3A5UA 1BBXC 4QGUA 3VR3A 5ISRA 3HOWB 2LSSA 3I70A 2B2TC 4PZ7A 1SNQA 3RN2A 4CDCC 3R2IA 2F0PA 3PUVA 4FO2A 2ALYB 2F3WA 1NAPA 1GJXA 4JV5Q 3IRBA 1EZ8A 1EIHA 3TSSA 2RA4A 2E2IB 5C0XH 4KKUA 1PDQA 5EKKA 3NBIA 5GROA 4EQNA 1Y1WB 1V43A 3Q8DA 2XRSD 3ONAB 4JI1Q 1I4HA 4KY7A 5E4WC 3L0OA 3DMUA 5HURA 4DV0L 1TWAB 1SE2A 3D4WA 4A3KB 2EIFA 4K0KL 2NTSA 2Z6KC 5JEAJ 2NVTH 4RGOS 3T1YL 1B8AA 2B8FA 3QOJA 3K80C 2PI2E 4AQYL 1K0RA 5EPKA 3C46A 1GO3E 1S4ZA 2A6ED 4R9WA 2Q8TA 5GAGC 2HDMA 2PCFB 3WDNA 2FMMA 1XNQL 1DYQA 2Q2UA 5C4XB 3U4VA 1VQDA 5M3FH 5FK9C 1XPRA 4DUZL 2HQEA 2EYPA 3T1HQ 4GOPA 3RNUA 1BXTA 1CSPA 2DNCA 3D4DA 1HZCA 1U4RA 4DN4M 4DR5L 1BQQT 3NTKA 5M5YB 2FHTA 4N9TA 1Q1EA 2PMZE 3I55A 4QMGA 1PTOH 5I2YA 3NP8A 1K8AC 3RLOA 4A3MG 3GTOH 1VQ7A 1JB7A 4JBKA 4C3IG 4PNYA 1AZPA 4IFDG 1L1OC 2I5LX 2NN6H 5BN3A 1YNJC 3I4MB 1M1KC 5CGKA 2N3SA 1H9SB 4TRDA 4IO9A 3BZKA 1H9SA 5M5XH 2B63H 5EQ0A 3QO2A 4IFDI 1ZKOA 1JICA 2RDHA 5DNFA 3Q23A 4A3FG 3T16A 3S2HB 1B9NA 5C4JB 1I50B 3MXNB 1Q82C 2Q2TA 1VCIA 5A2QL 3MXNA 2F0JA 2L5TA 4HR7B 4A3CG 1EIYB 3K5OA 2JQOA 1PH7A 1E2WA 2F0NA 1II3A 3HKZB 4KJNA 1D7QA 1KABA 2AMCB 3PUXA 1NBWA 1S5DD 1N32L 1OXUA 1MIUA 3AU7A 2WP8J 3CRKC 4C2MH 3HP3A 4K5VA 1VF5C 2GA4B 4C3HB 4ZK9B 1R9TB 1FD7D 4JI2L 4UAIA 4KHVA 1CFMA 2EOTA 1IYUA 5C5LA 3M4OB 2UUCL 2MO0A 1TQOA 1K9MC 5CORA 4FF1A 3OW7A 1A62A 1KHIA 3SE0A 3CPFA 1EFID 3MEFA 4DV5L 1HNWQ 2B39A 2WFWA 3JAML 4LF9Q 2JYOA 4KK7A 2RKSA 4C56C 4TQUS 5IGEA 1E3PA 1GVPA 3VYUA 3LX0A 1PRTF 1VQIA 2EYMA 4ZRZA 4LFAL 3NEMA 2R92B 3C1FA 5JJLA 1I4XA 2IT1A 2Q2IA 1C9OA 3F1ZA 1SLJA 1SXTA 2YU9B 4OX9Q 2E2JB 1E1TA 5IGFA 1CHPD 4PZ8A 2ZTEA 1B53A 5KIXA 2UXCL 3SK6A 4POGA 3H15A 4C3JH 2F4IA 2A69D 1GUGA 3EIVA 4QY7A 1WTOA 1PTOF 2PPBC 4GLXA 2K33A 3OSOA 3MVVA 5EKIA 5G3LD 4RG1A 1TWCB 1CQFA 4PG3A 5KNDA 1I3QH 4QUCA 1SNDA 1EIGA 2WB1G 4KHZA 4DXGA 3VDYA 3UE0A 1WTPA 4DV1Q 2G5DA 2OCEA 3F2CA 1WD1A 4LFCL 4UP7A 3FEWX 1X3EA 2B3GA 2CHBD 5IYBG 1AE3A 2P5ZX 3BYYB 2R7ZB 1M4VA 1BNZA 4JI5L 4R4IA 4XTCS 1PVOA 1A63A 4BXXG 5HGQA 1F2YA 1RL2A 5JOBA 2NTTA 3KOJA 1A15A 3DWQA 2VW9A 1IBLL 3P20A 3MXGA 1PZJD 2N78A 2X6GA 3EJIA 5C3XA 4DV2L 1I6HH 3VR6A 1V1QA 3MXPA 5IODA 4XYQA 3I3CA 2VUMG 1LACA 1MD2D 4RKBA 1HNZL 2K6AA 1EEID 2XRQD 3AYHB 5DM73 1QNKA 2BH8A 1G6PA 3KYHC 2A6EC 1F9QA 2HT1A 1EQVA 2F1MA 1I4QA 1W6JA 2VL6A 3QOLA 3BS1A 5JVG3 3GTQB 3ITPA 1H9RA 1TU2B 4QQBX 1HZ9A 1VQPA 4DNTB 2B8GA 4DV3L 3PCOB 4WORA 3GTPB 3GTMB 1AZQA 5ELBA 3LWEA 3NBHB 1FJGL 4Y52H 1XMOL 3DLLA 3PO3H 4GKJL 1KNAA 1WFQA 2O5IC 2PNHA 3HOYB 2K5DA 5FLMG 2NYZD 1HZAA 1HFNA 1QZGA 1F2LA 4CDEC 2KVMA 4MTKA 1WTHA 4Q0FA 4B9WA 2JA8B 3CCSA 1PHJA 4QIWB 1X56A 4B3ML 3MFYA 4DR4L 1D5MC 4A3MH 1BBUA 1WOCA 4C3IH 3HOZG 4J8QA 3K5NA 4IFDH 3P7JA 5I6WA 4A3EB 4K6DA 4A3BB 1E22A 2IX0A 2N49A 1JR0D 4DV0Q 1C0AA 3A8JE 1J9OA 4DFAA 4N9PA 2AHOB 1ESRA 4GNXB 2WAQE 2CQOA 1PA6A 4K0KQ 4GNXA 1CI3M 2MJ8A 2PW5A 3JAME 4RGMA 4A3FH 1H9KA 4RMFA 2NZOA 1DOKA 5JVH3 5K36G 3W1BA 4ZYSA 3I7FA 4BWGB 3C1EA 4AYBB 4ID6A 3S24A 1SYCA 1XNQQ 1D1IA 2RSOA 2AQ3B 2F0WA 4B9XA 5M9OA 5HY6A 5IYCG 4DUZQ 4ZAIA 4A3CH 3I8ZA 5AJ3Q 4IPHA 4KV6A 1VQNA 3NWSA 3PO2G 3MHBA 4JBMA 2F0SA 1C8CA 4DR5Q 3JC66 5GQOA 3CMAA 1HHVA 1SYDA 2BA1A 1BDOA 3DWAA 3GO5A 1ILPA 1PYWD 3PV0A 5J39A 2NB0A 4JBJA 1BUVT 2F0KA 4HJ7A 1UE6A 2QW7A 1PRTB 4KN4C 2HDLA 1YI2A 2FJ2A 2I5HA 2B2TA 1EQRA 2OTLA 1N9WA 3BU2A 1CZWA 2OT2A 1YVCA 1UAPA 1LT3D 1A8VA 2A69C 4NXNL 2I46A 4YIJA 4FDBA 3PF4A 4HN7A 2I0QA 1E1OA 3W2DA 1HXYD 4DR2L 3S1QH 2NVQH 1AH9A 4IJLA 4X65L 3M7NA 2DN8A 1N32Q 1D2BA 2PZTA 4Z9CB 2N55A 1PFSA 1EY9A 1PRTD 1DGSA 1RJTA 2B2YC 4JI2Q 4DXFA 5M5XB 2B63B 1KC8C 4OO1G 2UUCQ 3FDTA 1R4PB 3A54A 4ZLTF 3J7AF 3BDOA 4ODGA 3PIO3 3CCQA 1PH8A 1AEXA 4DV5Q 3RZOH 1E24A 3CD6A 1KAAA 1B1ZA 1V1OA 5CV9A 2YV5A 1WCMH 4PV1C 3T53B 3N52A 4WJ3M 3Q24A 4NXML 2M00A 5IT9c 4LFAQ 1ENCA 4YCVA 2ZM6L 1Z6HA 4BXXH 1EU3A 3Q22A 1GM5A 5DEHA 1XMQL 1VF7A 1EWHA 2L55A 2AQ2B 4OIJA 5M3FG 3FHWA 3T51B 2I07B 4YCUA 1B4OA 1TY2A 4RHSA 2UXCQ 3IL8A 5M3MB 1PXUA 2LY7A 4CDFC 2VUMH 2A6HD 1I6VC 3VA5A 1Z9FA 1TS4A 5ELCA 4X3TA 4O1NA 3E0EA 3VR5A 1EY7A 4DV7L 1K73C 1VQMA 3CCUA 1TWGH 2YYZA 3IAYA 1EU4A 1JWMD 4RHRA 4M8AA 3VYSA 5D65A 2WAQG 5T1GA 4DK3C 4LFCQ 3AQQA 1CKNB 4RFBA 1E0BA 1TWFH 2KCNA 1CKNA 1PH2A 2JA6H 4XT1B 3PQIA 4RGTA 4G7ZC 1V1PB 1TWHB 4X62Q 3QWNA 2NN6I 1YNJD 1PH4A 2G9DA 4JI5Q 1SNMA 1V1PA 3M3YH 1Z47A 5FLMH 3HFZB 4LNQA 4JCVE 4IUVA 4L5TA 3KJPA 1PLFA 5LMNL 3NHHA 4DV2Q 4JC0A 1B44D 1KLGD 4HAEA 4V190 2XWBB 3FKIG 4BA2I 5FOBB 3UDGA 4MNOA 3U9OA 3V2TA 1I3QB 2F0TA 3PUZA 1Y8NB 3OIQA 4IN3A 4P74A 3OOCA 5KRUA 2B29A 4RGNA 4K8JA 1H95A 2IWHA 3I4OA 3PGZA 1X3QA 1PZID 1ZYRC 4Y7NH 1PMRA 5CV7A 2K03A 3EQLC 1I5FA 1CTMA 1O7LA 2HQLA 3S15H 3RZDH 1M90C 1QNUA 5GADC 3CRLC 4MZ9A 3B6YA 4R8IA 4DV3Q 3CCJA 4DV4L 1SN8A 2V4DA 4GNXC 1YHQA 4WJ4A 1VQ8A 1JJGA 3HZXA 4CJ1B 5IYCH 5CR3A 1XMOQ 4GKJQ 2O2LD 2GVBA 1G291 1EL0A 4RCNA 3H3VI 2K5WA 1RKNA 1S5FD 3PO2H 2L12A 4FXGC 5EAYA 3DEPA 4F8MA 1ICWA 2WIIB 4DK1A 1U9RA 5JJKA 1X54A 1VDZA 5C3WA 4DR4Q 1XTCD 4B3TQ 5LHY1 1JT8A 4FF3A 1YITA 2ES2A 3R3OA 4K5XA 3CQZH 2EE1A 3PIPA 2A74C 1HH2P 3I72A 4BBRH 3U58A 1DOLA 1G6ZA 1SRUA 4XT3B 4G7HC 1K8MA 4HCEA 3G7LA 1D5XC 1KAWA 1SYEA 3R93A 2L11A 3ZYYX 4XXEA 1RTOA 1QZHA 2Z1CA 5JPMC 2KCMA 4PQXA 1DM0B 5K5PA 4I65A 1FL0A 4EQ5A 4H02A 4CBVA 2D0OA 1PRTC 1O7ZA 4UPAA 1B3AA 4FNFA 4A3MB 4A3IG 4RCOA 3NUCA 2QKIC 3TBIB 4DAMA 3S1MH 4QJFA 4X6AH 4DR3Q 2UU9L 3CC7A 4DV6L 5IY0A 2KCCA 1D8LA 1VMCA 4JG2A 1PTOC 4OO1H 1CM9A 2CWAA 1C7YA 1KDAA 2PW7A 4A3FB 3PUWA 1QUQB 4JI6L 3BVGA 3DXJC 2WB1E 3STBD 3D0FA 1TVXA 1G8ZD 5L37A 4X64L 3NQTA 1Q86C 4RWSC 4BY1G 1UE7A 4U673 4RH6A 1Q8KA 4XYOA 1E2ZA 1W2BA 1GXDC 3H09A 3BVMA 3R8BA 2A6HC 4NXNQ 3Q6SA 4DR6L 4NMZA 2B2VC 4DAVA 2BDNA 2MUYA 1NTGA 4DR2Q 3TREA 2FINB 1F2MA 3K57A 2VQFQ 3PO3G 2F0UA 5AJ3L 4X65Q 1FNUA 3AEVA 4TKOB 5DLQE 4P72A 1HUNA 4UDUC 4OXPA 3MXUA 1YJNA 1PV4A 2H4OA 1JMCA 4L6TB 1BCPF 3J81E 1IKLA 3E6ZX 3QIAA 4DNRB 1NJIC 4ZKBB 4QB4A 4GN3B 4KJOA 1Y8OB 2K1BA 2ZXOA 2EXZA 4CGYB 3EFXD 4LFBL 2F3IA 5KGUA 3KLWA 4NXMQ 2D9UA 2Q8IB 2OWOA 2NVQB 3K8AA 2K5QA 2RDFA 5GAEC 4OWWB 5FLXL 1P16A 2ZM6Q 4C1NK 4YWLA 1OXXK 1NSNS 1N36L 2QILA 2NVXB 4DNIA 1XMQQ 4O2DA 4DKAC 1HR0Q 5H1SE 4ALPA 1HNXL 2KBNA 3NK9A 4LF7L 4JI3L 3FKIH 4R4CA 1T5XD 1TR5A 5C0XJ 5IT9L 3SK4A 3J7YW 2K14A 4FP5D 4KHPL 4UP9A 1KDBA 2Z8LA 4IJHA 1J5EL 4R4TA 1HA5A 4K2KA 5E3FA 4XQJA 4AH6A 1VQFA 3X3NA 1LTLA 1Y1WG 3AFPA 3U50C 3RZOB 1Q3LA 4DV7Q 1ET9A 2OTJA 1SJHD 2KHJA 3OW2A 3IFDA 1LTGD 1CQVA 2JEBI 5JAVA 2PI2A 1LT5D 5IIFA 4P73A 1CUKA 3K59A 2D0PA 2KEDA 2XVSA 2ZXRA 3KJOA 3H3VH 1ICFB 1G91A 4KTAA 1JWUD 5AFWA 1VQOA 5CYUA 3MEHA 4G7OC 1HPCA 1SE3A 2XWJB 3FVQA 5T1IA 4FXKC 3UDXA 2OEOA 2ZT9C 2LKVA 5A35A 2PMZB 3J80c 2ICEC 3I4NG 5LMNQ 1IXRA 3ERQA 5CBAE 1G51A 1WTWA 2EVBA 2HCCA 3CKIB 3KUPA 2F0HA 5KNCA 2B2YA 1TWGB 2JA9A 2PZWA 5JJZA 3NE5B 1VQBA 3G71A 1NUCA 4KKSA 3TZDA 4IALA 4V0BA 3I4MG 2K50A 1LLRD 3SK8A 1RCVD 3CP0A 3HOVG 1JCKB 2NZHA 2ZJPA 4GN4B 3A7AB 5J1ZA 4YWMA 3QR8A 5C3EG 4JI8L 4A3GB 5CBEE 2L0CA 3M4YA 2EYHA 1WJJA 1DXMA 4L5QA 3HRZC 3R2TA 4DV4Q 4HJ8A 2E2HB 4XQNA 2PQAB 1EOTA 2UUBL 1WCMG 2RCNA 1YNNC 2PQAA 2KHIA 4X62L 3M4PA 2NVYH 2JE6I 1OTCA 4A3IH 4PMWA 1Y1VB 1IL2A 1DCZA 1ESFA 2ATWA 4OELB 3SGIA 1SNCA 5CV8A 3HOZB 4X66L 1PFBA 4OEMB 5ELFA 4APVA 3STBC 2KCTA 1CKMA 3PMFA 5FJ8G 2R7DA 3CCEA 1VQLA 3E9IA 3S1RH 1GUNA 4A3DB 4JVZA 4DR1L 3A56A 2KEEA 2E76C 1XYIA 4A93G 1X3PA 2MGSA 4LF8L 4LAAA 4B3RL 3S15B 3RZDB
chains in the Genus database with same CATH topology
2L9HA 3F2UA 4HTHA 4LK1C 1D1KA 3UI2A 4IUPA 1V8QA 1STEA 3QJYA 5EPJA 2FMCA 4CHTB 1NR4A 2Q8RE 3RLFA 2K04A 3PO2B 1ML0D 5FLXE 3KLRA 1RHPA 5A2QE 3NBHA 1IW7C 2WV6D 2DY7A 1GUSA 1F2ZA 3GP7A 1QG7A 1BCPB 1LTAD 1SEBD 3HOUB 1WTVA 1Q8IA 5NUCA 2J4XA 1BF4A 2NWGA 3MA2B 1LT4D 1TS5A 1RD9D 3TMEA 2JSOA 3QG1A 4NDXA 2KECA 1I4PA 4KN7C 3SDZA 3BDCA 5FO8B 1CHQD 1BCPD 3S1MB 1ZYRD 1Q90A 2EYOA 1LV9A 4IURA 3IKJA 2CQAA 2D2CC 2KOLA 3K5LA 5IGGA 3A8KE 3EA6A 1O78A 3MWYW 2NVTB 4NKLA 5JEAG 1EY5A 5EBDA 1ENAA 1E2VA 2VB3X 2ID0A 1TY0A 5M3FB 4OGQC 4P2CB 1F9RA 1LT6D 2B2WC 2D5DA 4IZ8A 4WJWA 1KNEA 1UNSA 4X3KA 1R4QB 3H6MA 1A3VA 2XN9C 1PTOB 2O5JC 4IQZA 3VYTA 3GTOB 3BZDB 4IFDJ 2WAQB 4XQQA 3C2PA 3S9WA 2NBFA 1PFMA 1Y69U 1GUWA 3TP8A 1EY0A 2E74C 2PNRC 1XX8A 1PTOD 1OXTA 5I9OA 4OO1I 2EYJA 3KLSA 3MTSA 3M85A 2B2VA 1OO9B 3FKIB 1TT2A 4F7XA 5JPNC 2F0QA 2QDBA 1HUMA 4C2MB 3D6CA 2MHVA 1UEAB 1AFPA 4OIKA 1FNVA 3H91A 2K05A 1TKWB 2F0MA 3P75A 4G4KA 4WFN3 3BG3A 2AUKA 2WKCA 4K5WA 1J8IA 1EY6A 1GHKA 5J22A 1VMPA 4BS9A 4F88A 2J0TD 5EKLA 3ND9A 2EY1A 2VB2X 5EGTA 5KYIA 2IL8A 3MFGA 3SK5A 5D3IB 1SMYC 1LO5D 2BE5C 1STNA 5LL6S 5DAUA 3VR4A 2XNAC 1GOZA 4C3JB 5CC4A 1IL8A 5C5MA 5FO9B 1UUPA 3AB9A 2F03A 4ZKCB 3OWEB 2EZVA 3O13A 4KKTA 4WRDA 1KLUD 4G57A 1A6XA 1BCPC 1KTKA 3T4AC 4ABNA 2SEBD 2TSSA 2NVYB 3L7ZC 4KI0A 2KUMA 1O7YA 4A3IB 1LTRD 2K32A 1A2TA 2JEAI 2H1EA 1CT1D 2R6GA 1I6HB 4IUTA 3S1RB 3HEJA 1AW7A 2LMCB 2R61A 5E1FA 2F0EA 5BN5A 1B50A 4DU9A 4B08A 2LS01 2IX1A 1QCBD 1Y8PB 5JEAH 4BY1B 3L3OC 3DWPA 1GHJA 2XIWA 2RDGA 5I2XA 2F3VA 1BO0A 3A8IE 3TN2A 1S5BD 3M7GA 3PO3B 1CK1A 3D31A 4Q5VA 2MP1A 1SAPA 5M5WB 3RD4A 4K8IA 2XSCA 5CV4A 1S5CD 4NW2A 2L4NA 2B2UC 4J6HA 4C3IB 1JOKA 3K6OA 1HA6A 3E0JA 2KQ3A 3D6WA 1DJRD 1YNND 3X3MA 4QCLA 1MSGA 1Z7TA 4ILWA 1WTQA 3GTKB 2F0OA 1ZXTA 4CKBA 3NTHA 4HMJA 4R8NA 4MHEA 1SSOA 1RDPD 4H0LC 2K7VA 3W3AA 3OMCA 3I4LA 4CKCA 1WVLA 5IOCA 2EYFA 1G2SA 4E6IA 3FPPA 1ONLA 2QF7A 1SE4A 5FO7B 5COYA 4H7BA 2EJMA 3KLSX 2F0GA 1SYGA 1OXSC 3GTJB 2A68C 2G9HD 3S14B 1IW7D 1WD0A 3FMCA 2RQXA 3VR2A 2F0LA 1SYFA 1RF2D 3DM1A 4KD3A 2BDOA 1IYVA 3TDQA 3BYTB 3H3VC 2PZUA 1C4QA 3I4NB 2E75C 2J7ZA 3S1QB 3MZ5A 2KJXA 3HG9A 3D8GA 3DHQA 4DK0A 1LTTD 5KNBA 3A55A 1SNOA 3BDLA 1AP0A 1QWYA 3HOVB 3BVZA 4PMBA 4U68A 1NCVA 5C3EB 1MI2A 2WB1B 5CV5A 1JOOA 2F0VA 4EVOA 4DF7A 2ENBA 4IUNA 3SXHA 5D14A 2MPMA 1WCMB 5D3DA 1H9MA 4HMIA 2CW0D 4IUUA 4M1UB 2PQEA 4ZUJA 3GTLB 3EROA 1QJOA 2HUGA 1SYBA 4PMCA 2B2WA 3EVQA 3K5MA 2RSNA 1F9SA 1EYAA 1C48A 3DUZA 3KBGA 3H94A 3GV6A 2C9OA 2EDGA 2AWOA 1JWSD 1SDFA 1JQYD 1XWEA 1F9PA 4A93B 2VUMB 3SEBA 3PIP3 2SNSA 1GUOA 3FRPB 1RTNA 4K14A 2D62A 5EBCA 4FF4A 3CHBD 1EY8A 4BBSB 1EWCA 4ULLA 1HQMC 1HQRD 4JK1C 1STGA 5E4XA 1TS3A 1A3TA 1TWFB 3LWUA 5C44B 2JA6B 4BY7B 2TMPA 1ENFA 1I4GA 3SHLA 1U4MA 3M3YB 2VNUD 5F2DA 1Q1BA 3NXWA 1MBYA 3K58A 2IPKD 3VA7A 1EQTA 1EYDA 5IGCA 2RVLA 2F0FA 3L9AX 5C4ZA 4ZUIA 2EJGC 1AN8A 1K83B 2QEJC 1KDCA 4C3HG 2DY8A 3LNNA 4IUQA 4Y7NB 3I90A 1TS2A 5ELDA 4L8JA 2BOSA 1B9MA 5I6YA 3H0GB 1WTXA 1B2TA 2EYLA 2JA7B 4F87A 2PO4A 4S3SA 5I9PA 2AQ1B 3HOXB 1SNPA 2KHSA 1H9JA 4BA1I 1CA5A 1GUTA 4LMQD 1JB3A 4H44C 1F77A 3OHXC 1FGBD 3WOEA 3NPPA 1L0XB 1LTSD 1A3UA 3HS0C 5EJWA 3RUZA 1IHZA 2ZXPA 3C3LA 3TP7A 5C6AA 1DOMA 1G2TA 1SJED 4K2LA 1LTBD 5IT9E 3CQZB 2O4XA 4BBRB 1FR3A 1HTPA 1SMYD 3GQBA 3HGBA 3MC0B 2BE5D 3I73A 4LJZC 1MSHA 2L1BA 1Q12A 2SDFA 3P1HA 1RODA 2JA5B 3PUYA 4MIUA 1QB5D 1U4LA 3GV3A 3Q0AA 3S16B 2F0DA 1L0YB 2NUCA 2EY6A 3SR1A 2WINB 3N6RA 5IGDA 3J7AV 1EY4A 3T56B 4DAYA 2CVRA 5LL6X 2K28A 2OF1A 4H13C 1PFNA 2N88A 5CMDA 4EGVA 2CW0C 3D4RA 1STBA 4RA8A 2EJFC 4J1MA 1M8AA 3ND8A 4FF2A 2Z4IA 4DGZA 3OWFA 4O42A 4FXDA 1STAA 1ZEQX 3S17B 3D3RA 2LFNA 1HCZA 2F0IA 4OHJA 1X32A 4HSPA 4QUFA 2AWNA 1BR9A 2B2UA 3S2DB 2E2DC 5C4HA 2BCOA 4RAUC 3NWTA 1QILA 4ZQ3A 4KD4A 3TP6A 1EYCA 1LABA 4FVMA 1S5ED 3MAQA 1STYA 1JOQA 2A73B 3DEOA 3NTIA 2FFKB 4DAPA 4RKLA 1EEFD 1JE4A 2R93B 3AMUA 1HRJA 1U4PA 2ICIA 1OXVA 1XXGA 4XIGS 2AUJD 1BOSA 3GTGB 5HGTA 1HFGA 1STHA 4HSVA 5C0XG 3V05A 3U9SA 1TIID 1EZ6A 4KY6A 3I91A 3GD7A 3K7AB 1CA6A 3VYRA 3SVMA 5KYLA 5IGBA 1O80A 5C0XI 2M2LA 4NP5A 2Z4HA 3NQIA 2C5CA 3URYA 3J80L 4X3UA 3T13A 1D5ZC 1I4RA 2R3ZA 1FYCA 4K6LA 1T5EA 2BA0A 2VXWA 5ELEA 3WOFA 4QF4A 3FPUB 1CZGA 4JBWA 1D6EC 4A3JB 1PZKD 2A5HA 3G6JB 3V96A 1FNWA 5BN4A 4GZYC 4ME5A 4MN3A 2A68D 2DNEA 3TP5A 2M9VA 3CU7A 2X69A 5EPLA 1HTLD 3OIPA 2HCIA 3QB3A 4X3SA 2WACA 1IKMA 3NSWA 2NN6G 4KMUC 4CJ2C 4KY5A 4HEDA 2OXPA 3IFTA 4HCSA 1DD2A 2NZ1D 1DZ1A 1K8OA 4OL7A 1W6KA 1NR2A 4I7ZC 4C1NI 2KA7A 4XDXA 4DA2A 1WTRA 2X6LA 4EQPA 3OPOA 4FYDA 2QCPX 1SBBB 2JXMB 5FKAC 3J81L 2EY2A 3OMGA 5CV6A 3TZUA 1A2UA 5DM63 1LTID 3RMHA 1QOHA 5K36H 4EQOA 4L63B 3E5SA 4CKEA 2JP1A 5G3LF 2EY5A 2RBMA 3S1NB 2Y0SB 2WKDA 2SOBA 2IX3A 1MGSA 1JORA 1ILQA 3KBXA 5KEEA 1QE6A 2K01A 5TSSA 2IW3A 2IJ0A 4C3JG 4TSSA 2PYKA 1DONA 3K0YA 3KK7A 3A7LA 2SNMA 1SFOB 3KF8A 2EPBA 4CJ0B 1JC7A 1ET6A 5I4DA 3J80E 1BBXC 3VR3A 5ISRA 3HOWB 3I70A 2B2TC 1SNQA 3R2IA 2F0PA 3PUVA 4FO2A 2F3WA 1NAPA 1GJXA 1EZ8A 1EIHA 3TSSA 2RA4A 2E2IB 5C0XH 4KKUA 1PDQA 5EKKA 3NBIA 4EQNA 1Y1WB 1V43A 2XRSD 3ONAB 1I4HA 4KY7A 5E4WC 3DMUA 5HURA 1TWAB 1SE2A 3D4WA 4A3KB 2NTSA 5JEAJ 4RGOS 2B8FA 3QOJA 5EPKA 3C46A 1S4ZA 2A6ED 4R9WA 2Q8TA 2HDMA 2PCFB 3WDNA 2FMMA 5C4XB 1DYQA 5FK9C 2HQEA 2EYPA 1BXTA 2DNCA 3D4DA 1U4RA 4DN4M 1BQQT 3NTKA 5M5YB 2FHTA 4N9TA 1Q1EA 4QMGA 1PTOH 5I2YA 3NP8A 4C3IG 4PNYA 1AZPA 4IFDG 2NN6H 5BN3A 1YNJC 3I4MB 5CGKA 1H9SB 4TRDA 1H9SA 5EQ0A 3QO2A 4IFDI 1ZKOA 1JICA 2RDHA 5DNFA 3Q23A 3T16A 3S2HB 1B9NA 5C4JB 1I50B 1VCIA 5A2QL 3MXNA 2F0JA 2L5TA 4HR7B 3K5OA 1E2WA 2F0NA 1II3A 3HKZB 4KJNA 1KABA 3PUXA 1S5DD 1OXUA 3AU7A 2WP8J 3CRKC 3HP3A 4K5VA 1VF5C 2GA4B 4C3HB 4ZK9B 1R9TB 1FD7D 4UAIA 4KHVA 1CFMA 2EOTA 1IYUA 5C5LA 3M4OB 1TQOA 5CORA 4FF1A 3OW7A 3SE0A 1EFID 2B39A 3JAML 2JYOA 4KK7A 2RKSA 4C56C 4TQUS 5IGEA 3VYUA 3LX0A 1PRTF 2EYMA 4ZRZA 2R92B 3C1FA 1I4XA 2IT1A 2YU9B 1SXTA 2E2JB 5IGFA 1CHPD 1B53A 5KIXA 3SK6A 2F4IA 2A69D 1GUGA 1WTOA 2PPBC 1PTOF 2K33A 3OSOA 3MVVA 5EKIA 5G3LD 1TWCB 1CQFA 5KNDA 4QUCA 1SNDA 1EIGA 4KHZA 4DXGA 1WTPA 1WD1A 3FEWX 2CHBD 3BYYB 2R7ZB 1M4VA 1BNZA 4XTCS 1F2YA 5JOBA 2NTTA 1A15A 3DWQA 3P20A 3MXGA 1PZJD 2X6GA 3EJIA 5C3XA 3VR6A 3MXPA 5IODA 4XYQA 3I3CA 1LACA 1MD2D 4RKBA 2K6AA 1EEID 2XRQD 5DM73 1QNKA 2A6EC 1F9QA 1EQVA 2F1MA 1I4QA 1W6JA 3QOLA 3BS1A 5JVG3 3GTQB 3ITPA 1H9RA 1TU2B 4DNTB 2B8GA 4WORA 3GTPB 3GTMB 1AZQA 5ELBA 3LWEA 1KNAA 2O5IC 3HOYB 2K5DA 2NYZD 1HFNA 1F2LA 2KVMA 4Q0FA 4B9WA 2JA8B 4QIWB 3MFYA 1D5MC 4J8QA 3K5NA 4IFDH 3P7JA 5I6WA 4A3EB 4K6DA 4A3BB 2IX0A 1JR0D 3A8JE 1J9OA 4DFAA 4N9PA 1ESRA 1CI3M 2MJ8A 2PW5A 3JAME 4RGMA 1H9KA 1DOKA 5JVH3 5K36G 4ZYSA 4BWGB 3C1EA 4AYBB 4ID6A 1SYCA 1D1IA 2RSOA 2AQ3B 2F0WA 4B9XA 5M9OA 4ZAIA 3I8ZA 4KV6A 3NWSA 3MHBA 2F0SA 1C8CA 1HHVA 1SYDA 2BA1A 1BDOA 3DWAA 3GO5A 1ILPA 1PYWD 3PV0A 5J39A 2NB0A 1BUVT 2F0KA 1PRTB 4KN4C 2HDLA 2FJ2A 2B2TA 1CZWA 2OT2A 1UAPA 1LT3D 2A69C 2I46A 4YIJA 4HN7A 3W2DA 1HXYD 3M7NA 2DN8A 1D2BA 2PZTA 4Z9CB 2N55A 1EY9A 1PRTD 1RJTA 2B2YC 4DXFA 5M5XB 2B63B 4OO1G 3FDTA 1R4PB 3A54A 4ZLTF 3J7AF 3BDOA 4ODGA 3PIO3 1AEXA 1KAAA 1B1ZA 1V1OA 5CV9A 4PV1C 3T53B 3N52A 3Q24A 2M00A 1ENCA 1Z6HA 1EU3A 3Q22A 5DEHA 1VF7A 1EWHA 2L55A 2AQ2B 4OIJA 3T51B 2I07B 1B4OA 1TY2A 4RHSA 3IL8A 5M3MB 1PXUA 2LY7A 2A6HD 1I6VC 3VA5A 1TS4A 5ELCA 4X3TA 4O1NA 3VR5A 1EY7A 2YYZA 3IAYA 1EU4A 1JWMD 4RHRA 4M8AA 3VYSA 5D65A 5T1GA 4RFBA 1E0BA 2KCNA 4XT1B 4G7ZC 4RGTA 1V1PB 1TWHB 3QWNA 2NN6I 1YNJD 2G9DA 1SNMA 1V1PA 1Z47A 4IUVA 1PLFA 3NHHA 1B44D 1KLGD 4HAEA 4V190 2XWBB 4BA2I 5FOBB 3U9OA 3V2TA 1I3QB 2F0TA 3PUZA 1Y8NB 3OIQA 4IN3A 3OOCA 5KRUA 4RGNA 4K8JA 2IWHA 1X3QA 1PZID 1ZYRC 1PMRA 5CV7A 2K03A 3EQLC 1CTMA 1O7LA 1QNUA 3CRLC 4R8IA 2V4DA 3HZXA 4CJ1B 5CR3A 2O2LD 1G291 1EL0A 4RCNA 2K5WA 1RKNA 1S5FD 2L12A 4FXGC 3DEPA 4F8MA 1ICWA 2WIIB 4DK1A 1U9RA 5C3WA 1VDZA 1XTCD 5LHY1 4FF3A 3R3OA 4K5XA 2EE1A 2A74C 3I72A 1DOLA 1G6ZA 4XT3B 4G7HC 1K8MA 4HCEA 3G7LA 1D5XC 1SYEA 3ZYYX 3R93A 2L11A 4XXEA 1RTOA 2Z1CA 5JPMC 4PQXA 1DM0B 5K5PA 4I65A 4CBVA 1PRTC 1O7ZA 1B3AA 4FNFA 4A3MB 4RCOA 3NUCA 2QKIC 3TBIB 2KCCA 1VMCA 1PTOC 4OO1H 1CM9A 1KDAA 2PW7A 4A3FB 3PUWA 3BVGA 3DXJC 1TVXA 1G8ZD 3NQTA 4RWSC 4U673 4RH6A 4XYOA 1E2ZA 1GXDC 3H09A 3BVMA 3R8BA 2A6HC 3Q6SA 4NMZA 2B2VC 4DAVA 2BDNA 2MUYA 2FINB 1F2MA 3K57A 2F0UA 1FNUA 4TKOB 1HUNA 4UDUC 3MXUA 2H4OA 4L6TB 1BCPF 3J81E 1IKLA 3E6ZX 3QIAA 4DNRB 4ZKBB 4QB4A 4KJOA 1Y8OB 2K1BA 2ZXOA 2EXZA 4CGYB 3EFXD 5KGUA 2D9UA 2Q8IB 2NVQB 2K5QA 2RDFA 5FLXL 4C1NK 1OXXK 1NSNS 2NVXB 2QILA 3NK9A 1T5XD 1TR5A 5C0XJ 5IT9L 3SK4A 3J7YW 4FP5D 1KDBA 2Z8LA 1HA5A 4K2KA 5E3FA 4XQJA 3X3NA 3RZOB 1Q3LA 1ET9A 1SJHD 3IFDA 1LTGD 1CQVA 2JEBI 5JAVA 1LT5D 5IIFA 3K59A 2KEDA 2XVSA 2ZXRA 1G91A 4KTAA 1JWUD 5AFWA 5CYUA 3MEHA 4G7OC 1HPCA 1SE3A 2XWJB 3FVQA 5T1IA 4FXKC 2OEOA 2ZT9C 2LKVA 5A35A 2PMZB 2ICEC 3ERQA 5CBAE 1WTWA 2EVBA 2HCCA 3CKIB 3KUPA 5KNCA 2F0HA 2B2YA 1TWGB 2PZWA 5JJZA 3NE5B 1NUCA 4KKSA 3TZDA 4IALA 4V0BA 1LLRD 3SK8A 1RCVD 1JCKB 3A7AB 5J1ZA 4A3GB 5CBEE 2L0CA 3M4YA 2EYHA 1DXMA 3HRZC 3R2TA 2E2HB 4XQNA 1EOTA 1YNNC 2JE6I 4PMWA 1Y1VB 1DCZA 1ESFA 1SNCA 5CV8A 3HOZB 1PFBA 5ELFA 3PMFA 4A3DB 1GUNA 3A56A 2KEEA 2E76C 1XYIA 1X3PA 2MGSA 4LAAA 3S15B 3RZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9H A;  1EQT A;  2RVL A;  4HAE A;  5EPK A;  3SVM A;  1Q3L A;  3F2U A;  1KNA A;  2IL8 A;  3UI2 A;  1S4Z A;  4R9W A;  1O80 A;  1VMC A;  2J7Z A;  2K28 A;  4IUP A;  2Q8T A;  2HDM A;  3IFD A;  1PFN A;  1CM9 A;  2M2L A;  2FMM A;  2NYZ D;  1HFN A;  2N88 A;  1F2L A;  2MP1 A;  5CMD A;  1SAP A;  2KVM A;  2N55 A;  4X3U A;  5EPJ A;  1F9R A;  2JP1 A;  4RA8 A;  1AP0 A;  1NR4 A;  4NW2 A;  1B53 A;  2KED A;  2Q8R E;  1RJT A;  3I91 A;  2B2W C;  2B2Y C;  1TVX A;  1M8A A;  2L4N A;  2B2U C;  2DY8 A;  1X3Q A;  2R3Z A;  2K04 A;  1G91 A;  4IUQ A;  1IL8 A;  1U4R A;  1ML0 D;  4U68 A;  1WTO A;  1NCV A;  2VXW A;  1KNE A;  1MGS A;  1MI2 A;  1ILQ A;  2K03 A;  3FPU B;  3I90 A;  3KBX A;  4RWS C;  3FDT A;  5AFW A;  3P7J A;  4X3K A;  1HA6 A;  1RHP A;  2FHT A;  5EKI A;  4ZLT F;  3D6W A;  4O42 A;  1QE6 A;  2K01 A;  4R8I A;  1WTX A;  1J9O A;  5T1I A;  1B2T A;  1ESR A;  1MSG A;  4MN3 A;  4ZKC B;  5D14 A;  2DY7 A;  2MPM A;  3Q6S A;  4QUC A;  2MJ8 A;  1WTQ A;  1EIG A;  2B2V C;  2X69 A;  1AZP A;  1DON A;  5EPL A;  4DN4 M;  2BDN A;  3N52 A;  1QG7 A;  1X32 A;  4CJ1 B;  4IUU A;  4QUF A;  1WTP A;  5CBA E;  1ZXT A;  2HUG A;  1DOK A;  2HCI A;  1WTW A;  1CA5 A;  2FIN B;  2HCC A;  1WD1 A;  4LMQ D;  4MHE A;  3KUP A;  1SSO A;  2B2W A;  2B2Y A;  1WTV A;  4X3S A;  2RSN A;  1EL0 A;  2B2U A;  1F9S A;  1PFM A;  5JJZ A;  1GUW A;  5EQ0 A;  1BF4 A;  2L12 A;  2RSO A;  3QO2 A;  4RAU C;  3DEP A;  1WVL A;  3GV6 A;  1IKM A;  1G2S A;  1ICW A;  4OIJ A;  1JIC A;  2NWG A;  5DNF A;  4ZAI A;  3TZD A;  1HUN A;  3I8Z A;  2KUM A;  1O7Y A;  1SDF A;  2EPB A;  1B4O A;  4CJ0 B;  1BNZ A;  4CJ2 C;  5EJW A;  1BBX C;  1F9P A;  3IL8 A;  1XX8 A;  4HED A;  1C8C A;  1DOM A;  2H1E A;  1A15 A;  1IKL A;  3MTS A;  1G2T A;  2KEC A;  2B2V A;  3DEO A;  1RTN A;  2EE1 A;  4HCS A;  4X3T A;  2B2T C;  2X6G A;  2NZ1 D;  5COY A;  4ZKB B;  5CBE E;  4IUT A;  1HHV A;  1DZ1 A;  2FFK B;  1DOL A;  1G6Z A;  1JE4 A;  1NAP A;  4XT3 B;  1ILP A;  1HUM A;  1MSH A;  1U4P A;  2K1B A;  3I3C A;  1HRJ A;  3G7L A;  3R93 A;  1EOT A;  2L11 A;  2L1B A;  1NR2 A;  3HP3 A;  1RTO A;  5E4X A;  1QNK A;  2D9U A;  4ZK9 B;  1B50 A;  2SDF A;  1LV9 A;  5D65 A;  1EIH A;  5T1G A;  2RA4 A;  4IUR A;  1ROD A;  4UAI A;  4XDX A;  1F9Q A;  1WTR A;  1E0B A;  2EOT A;  1PDQ A;  2X6L A;  4OIK A;  1WD0 A;  2HDL A;  2KOL A;  1U4L A;  3GV3 A;  3H91 A;  2K05 A;  1PFB A;  2FJ2 A;  4XT1 B;  5COR A;  1O7Z A;  1HFG A;  3ONA B;  2B2T A;  5E4W C;  3DM1 A;  1B3A A;  4HSV A;  2XIW A;  1J8I A;  1U4M A;  1VMP A;  2JYO A;  2KEE A;  3MWY W;  1XYI A;  1X3P A;  2MGS A;  1BO0 A;  1AZQ A;  4IUV A;  3TN2 A;  1PLF A;  2CVR A;  1CA6 A;  3LWE A; 
#chains in the Genus database with same CATH topology
 2L9H A;  3F2U A;  4HTH A;  4LK1 C;  1D1K A;  2XTI A;  2OQK A;  3UI2 A;  4LF4 L;  4IUP A;  2I5M X;  1V8Q A;  1STE A;  4BBS G;  1JJ2 A;  4BY1 H;  4B3S Q;  3QJY A;  5EPJ A;  2FMC A;  3EBE A;  4CHT B;  3J81 c;  3EN2 A;  1NR4 A;  2Q8R E;  3RLF A;  1PH3 A;  2MFI A;  2L15 A;  2EQS A;  2K04 A;  3PO2 B;  3CPW A;  1XPO A;  2UXD L;  1ML0 D;  5FLX E;  1PH5 A;  3KLR A;  5C44 G;  2JA6 G;  1RHP A;  5IP7 G;  4BY7 G;  5A2Q E;  4YHH Q;  1T9H A;  2RHQ B;  3NBH A;  1IW7 C;  1NMF A;  2WV6 D;  4L5R C;  2DY7 A;  1L0W A;  2HIV A;  1GUS A;  1F2Z A;  3GP7 A;  1QG7 A;  5M5W H;  1TXY A;  2UU9 Q;  1MJE A;  4DV6 Q;  1BCP B;  1LTA D;  2UXB L;  1SEB D;  3HOU B;  1WTV A;  1Q8I A;  5NUC A;  2J4X A;  1ASY A;  2F52 A;  4R4O A;  4B3T L;  4A3L G;  3ULJ A;  1BF4 A;  2NWG A;  4JI6 Q;  3MA2 B;  3A5Z B;  1LT4 D;  1TS5 A;  3CAM A;  2CH4 W;  4X64 Q;  1RD9 D;  3TME A;  2JSO A;  3QG1 A;  4DR7 L;  4NDX A;  2KEC A;  3GTK H;  3HOW H;  4HJ9 A;  1I4P A;  4KN7 C;  3SDZ A;  3BDC A;  5FO8 B;  4IOA A;  1CHQ D;  1BVS A;  1X3F A;  3H0G G;  2VS1 A;  2QDL A;  1BCP D;  2JA7 G;  1KL9 A;  3ULL A;  3S1M B;  1ZYR D;  4DR6 Q;  1SRO A;  1Q90 A;  2EYO A;  1NMG A;  3HOX G;  2LXJ A;  1LV9 A;  4IUR A;  3IKJ A;  2CQA A;  2K5N A;  2D2C C;  2KOL A;  1Y1W H;  3K5L A;  2QEX A;  4DR3 L;  2GN5 A;  1JE5 A;  5IGG A;  1TWA H;  1YNX A;  3A8K E;  3EA6 A;  3F8T A;  2QGQ A;  1O78 A;  3MWY W;  2NVT B;  2HD3 A;  4NKL A;  3PF5 A;  5JEA G;  1EY5 A;  5EBD A;  1PH6 A;  1ENA A;  1E2V A;  3J80 i;  4BBR G;  4R4Q A;  2VB3 X;  3GTJ H;  1N8R C;  3PSI A;  3S14 H;  2ID0 A;  3KFU A;  1TY0 A;  4LFB Q;  5M3F B;  4PZ6 A;  4OGQ C;  4P2C B;  1F9R A;  1LT6 D;  2B2W C;  1QVC A;  2D5D A;  4IZ8 A;  3HOY G;  4WJW A;  2JA5 G;  2A1A A;  1KNE A;  1UNS A;  1N36 Q;  3I4N H;  4X3K A;  1R4Q B;  3H6M A;  1HNX Q;  4LF7 Q;  4DK6 C;  1A3V A;  2VQE Q;  2HIX A;  1I94 Q;  4JI3 Q;  2XN9 C;  1PTO B;  2O5J C;  1VS0 A;  4IQZ A;  2VQF L;  3VYT A;  3GTO B;  4KHP Q;  3BZD B;  2ZJR A;  1J5E Q;  4HIO A;  4IFD J;  1IZ6 A;  4A3B G;  2WAQ B;  3I4M H;  1VQH A;  4XQQ A;  3C2P A;  3S9W A;  3HOV H;  2NBF A;  1NY4 A;  1PFM A;  1Y69 U;  1GUW A;  2KEN A;  3TP8 A;  4AIM A;  1EOV A;  4NB3 A;  5C3E H;  1EY0 A;  1XNR L;  3BZC A;  2E74 C;  5C4J H;  2PNR C;  1XX8 A;  1PH1 A;  2GVA A;  2R7F A;  1PTO D;  1OXT A;  5I9O A;  4OO1 I;  2EYJ A;  3K0X A;  3KLS A;  1VQG A;  3MTS A;  3M85 A;  2B2V A;  1OO9 B;  3FKI B;  1TT2 A;  4P71 A;  3GTL H;  4F7X A;  5JPN C;  2F0Q A;  2CCZ A;  4L5S A;  2QDB A;  4JYA L;  1HUM A;  4HJ5 A;  4C2M B;  3D6C A;  2MHV A;  1HJP A;  1UEA B;  1HR0 L;  5FJ8 H;  1AFP A;  4JI0 L;  3J81 i;  4OIK A;  4IOC A;  4A93 H;  1FNV A;  3M4O H;  3H91 A;  2K05 A;  1TKW B;  2F0M A;  3P75 A;  1EWI A;  4G4K A;  4WFN 3;  1ASZ A;  3BG3 A;  4EX5 A;  2AUK A;  2WKC A;  4K5W A;  1J8I A;  1EY6 A;  1GHK A;  5J22 A;  1VMP A;  4BS9 A;  4F88 A;  2J0T D;  4BBS H;  5EKL A;  3ND9 A;  2EY1 A;  1KQS A;  4JI8 Q;  2VB2 X;  2MQH A;  4LUV A;  3FP9 A;  4N8F A;  5EGT A;  3W1G A;  5KYI A;  2IL8 A;  3MFG A;  3SK5 A;  3F2B A;  2R93 G;  2YU9 H;  2UUB Q;  2E2J H;  5D3I B;  5C44 H;  2Y0S E;  4BY7 H;  5IP7 H;  4ME3 A;  3J7Z C;  1SMY C;  1LO5 D;  2BE5 C;  3JAM c;  1STN A;  5LL6 S;  5DAU A;  3VR4 A;  2XNA C;  1GOZ A;  4JPB W;  4C3J B;  5CC4 A;  3G4S A;  1IL8 A;  5C5M A;  5FO9 B;  4X66 Q;  1GKH A;  2K4K A;  1UUP A;  3TEH B;  3AB9 A;  1XJV A;  4DR1 Q;  2F03 A;  4A3L H;  4ZKC B;  3OWE B;  4LF8 Q;  2EZV A;  4B3R Q;  3O13 A;  4KKT A;  4WRD A;  1X55 A;  3U4Z A;  1K83 H;  4JI4 L;  1KLU D;  2K5V A;  4G57 A;  4LF4 Q;  1A6X A;  4CDD C;  1BCP C;  1KTK A;  3T4A C;  4ABN A;  2SEB D;  2K75 A;  3UE1 A;  2TSS A;  2NVY B;  3L7Z C;  4KI0 A;  2KUM A;  1O7Y A;  4A3I B;  1LYL A;  2A19 A;  3H0G H;  1LTR D;  2K32 A;  2JA7 H;  1A2T A;  1CKO A;  2JEA I;  2UXD Q;  2H1E A;  2K5H A;  1YHA A;  3J81 j;  1CT1 D;  2RF4 A;  3HOX H;  3K81 C;  2R6G A;  4OWT B;  4A3J G;  1I6H B;  4IUT A;  4DUY L;  3S1R B;  3HEJ A;  1EFW A;  1AW7 A;  5M3M G;  2LMC B;  2R61 A;  5E1F A;  3CCL A;  2ZTD A;  2F0E A;  5BN5 A;  1B50 A;  4DU9 A;  4B08 A;  1NE3 A;  2UXB Q;  2LS0 1;  2IX1 A;  4IPG A;  4LF6 L;  1QCB D;  1Y8P B;  5JEA H;  4BY1 B;  3L3O C;  3DWP A;  1VQ6 A;  1KIX A;  1GHJ A;  2XIW A;  4JOI C;  2RDG A;  3GTP H;  1X3G A;  5I2X A;  2F3V A;  3GTM H;  1BO0 A;  4HIK A;  3A8I E;  4DR7 Q;  1GD7 A;  3TN2 A;  2E5L Q;  1S5B D;  3M7G A;  4B3S L;  3PO3 B;  1CK1 A;  3D31 A;  4YY3 L;  3HOY H;  4Q5V A;  2JA5 H;  2MP1 A;  1SAP A;  5M5W B;  3RD4 A;  3CCV A;  4K8I A;  2XSC A;  5CV4 A;  3S16 H;  1S5C D;  4NW2 A;  4OON A;  2L4N A;  4GKK L;  2B2U C;  4YHH L;  4J6H A;  4C3I B;  1JOK A;  1VQ4 A;  3K6O A;  1HA6 A;  4HIM A;  3E0J A;  2KQ3 A;  3D6W A;  4A3B H;  2RHS B;  1DJR D;  1YNN D;  2YTV A;  3X3M A;  1IBM L;  4QCL A;  1MSG A;  5IWA L;  1P8L A;  1Z7T A;  4ILW A;  3OTO L;  1WTQ A;  3GTK B;  2F0O A;  4KLK A;  1ZXT A;  4CKB A;  3NTH A;  4HMJ A;  3LGJ A;  4R8N A;  4MHE A;  5BR8 L;  1SSO A;  1RDP D;  1EQQ A;  1QUQ A;  4H0L C;  1IBK Q;  2K7V A;  3W3A A;  3OMC A;  3I4L A;  3HKS A;  1MKH A;  3KDF B;  4CKC A;  1WVL A;  5IOC A;  2EYF A;  1G2S A;  4E6I A;  3KDF A;  2ASB A;  3FPP A;  3K7U C;  1ONL A;  2QF7 A;  1SE4 A;  1YJW A;  3S17 H;  2Y0S G;  3TRZ A;  1WYD A;  3HKZ E;  5FO7 B;  3I56 A;  5COY A;  4H7B A;  2EJM A;  2YTY A;  3KLS X;  1W3S A;  2CFM A;  2F4V L;  1E7Z A;  3S2D H;  4POF A;  2F0G A;  3CCR A;  1SYG A;  1U5K A;  2VZA A;  1OXS C;  1UE5 A;  1XTD A;  3GTJ B;  2A68 C;  4GN5 A;  2G9H D;  4O0A A;  3S14 B;  2OQ0 A;  1IW7 D;  3JAM i;  4UP8 A;  1WD0 A;  1EYG A;  3FMC A;  2RQX A;  3VR2 A;  4GOP B;  2F0L A;  2A8V A;  1SYF A;  1RF2 D;  3DM1 A;  1XNR Q;  3G6E A;  4KD3 A;  2EXD A;  2BDO A;  1IYV A;  3TDQ A;  5JJI A;  3BYT B;  2E8G A;  1N34 L;  3H3V C;  2PZU A;  1C4Q A;  3I4N B;  2R93 H;  2E75 C;  2J7Z A;  3HOW G;  3S1Q B;  3MZ5 A;  1K8G A;  2KJX A;  3HG9 A;  1Y14 B;  3D8G A;  3DHQ A;  3CXC A;  4JYA Q;  4DK0 A;  1LTT D;  5KNB A;  3A55 A;  1SNO A;  3BDL A;  2Z6B A;  3GTG H;  1AP0 A;  1QWY A;  3HOV B;  2VQE L;  1I94 L;  3ERS X;  3RR5 A;  4JI0 Q;  3BVZ A;  3I2Z A;  4PMB A;  1LM0 A;  4U68 A;  1NCV A;  5C3E B;  1MI2 A;  2WB1 B;  1EIF A;  5CV5 A;  1JOO A;  1VQA A;  3K7A H;  1Q46 A;  2F0V A;  4EVO A;  4DF7 A;  2ENB A;  4IUN A;  3UDF A;  3SXH A;  4A3K G;  5D14 A;  2MPM A;  1WCM B;  5D3D A;  1H9M A;  4HMI A;  2CW0 D;  4IUU A;  4M1U B;  2PQE A;  1VQ9 A;  4ZUJ A;  3GTL B;  3ERO A;  1QJO A;  2HUG A;  3NEL A;  2UUA L;  1SYB A;  4PMC A;  2B2W A;  3TS0 A;  4GS3 A;  3EVQ A;  3K5M A;  1X6O A;  2RSN A;  3TS2 A;  1F9S A;  1EYA A;  1C48 A;  3DUZ A;  3KBG A;  3H94 A;  5C4X G;  3GV6 A;  2C9O A;  2EDG A;  2AWO A;  4A3J H;  1S72 A;  1JWS D;  1SDF A;  1JQY D;  1XWE A;  1F9P A;  4A93 B;  5M3M H;  2VUM B;  3SEB A;  3PIP 3;  2SNS A;  1GUO A;  3FRP B;  1KRT A;  1RTN A;  2Z0S A;  4K14 A;  2Z9H A;  1MJC A;  2D62 A;  5E7N A;  5EBC A;  4FF4 A;  3CHB D;  1EUJ A;  1EY8 A;  4BBS B;  1EWC A;  4ULL A;  3CME A;  3CCM A;  1HQM C;  1NNX A;  1HQR D;  4JK1 C;  4DPG A;  1STG A;  5E4X A;  5ELO A;  4JI4 Q;  4IPD A;  1TS3 A;  1A3T A;  1TWF B;  3LWU A;  1FVI A;  5C44 B;  1B7Y B;  2JA6 B;  4BY7 B;  3M9B A;  2TMP A;  3WWV A;  1TWH H;  1ENF A;  3GDE A;  1I4G A;  3SHL A;  1HR0 W;  1U4M A;  1YHB A;  3E3X A;  2CH4 A;  2CWP A;  4HJA A;  3M3Y B;  2VNU D;  5F2D A;  1Q1B A;  1L2F A;  3OYY A;  3NXW A;  2QA4 A;  1X9N A;  3CC4 A;  1MBY A;  4MTN A;  3K58 A;  2IPK D;  3VA7 A;  1EQT A;  1EYD A;  1PYS B;  5IGC A;  2RVL A;  4DUY Q;  1RIP A;  2F0F A;  1K0S A;  4QIW E;  3L9A X;  5C4Z A;  4ZUI A;  3HKZ G;  2EJG C;  4ZCK A;  1UWV A;  1AN8 A;  4LW1 A;  1K83 B;  2QEJ C;  1HZB A;  1KDC A;  4C3H G;  2DY8 A;  1SE8 A;  3LNN A;  4IUQ A;  4LF6 Q;  4Y7N B;  1VQK A;  3I90 A;  3KF6 B;  1TS2 A;  5ELD A;  4L8J A;  3KF6 A;  2BOS A;  1B9M A;  3ER0 A;  5I6Y A;  4A75 A;  3H0G B;  2XGT A;  1WTX A;  1B2T A;  2EYL A;  2YTX A;  3PIO A;  2JA7 B;  4F87 A;  3CF5 A;  1QVF A;  2PO4 A;  3AFQ A;  4S3S A;  5I9P A;  2AQ1 B;  4AYB E;  3HOX B;  1SNP A;  2KHS A;  1H9J A;  4BA1 I;  4JI7 Q;  1CA5 A;  2K52 A;  1GUT A;  4LMQ D;  5ELN A;  5LMN W;  4YY3 Q;  5IYD G;  1JB3 A;  3A0J A;  2R92 G;  3S1N H;  4H44 C;  4YCW A;  1F77 A;  4JW0 A;  1YJ9 A;  3RLN A;  3OHX C;  2DJF C;  1IYJ B;  1FGB D;  3WOE A;  3NPP A;  1L0X B;  1LTS D;  4YWK A;  1A3U A;  3HS0 C;  5EJW A;  3G48 A;  1IHZ A;  3RUZ A;  4GKK Q;  2ZXP A;  3C3L A;  4IPC A;  3TP7 A;  5C6A A;  3E9H A;  1DOM A;  1G2T A;  1SJE D;  4K2L A;  2JJQ A;  1LTB D;  5IT9 E;  3CQZ B;  2O4X A;  3W5O A;  4LWC A;  4BBR B;  1FR3 A;  1HTP A;  2HHH Q;  1SMY D;  3GQB A;  3HGB A;  1IBM Q;  1VQE A;  3MC0 B;  2BE5 D;  3I73 A;  5IWA Q;  4LJZ C;  1WI5 A;  1MSH A;  3A74 A;  3OTO Q;  2L1B A;  4LF5 L;  4UHV A;  3ICE A;  4A3G G;  1SFO H;  1Q12 A;  2SDF A;  3P1H A;  3NEN A;  4N8X 1;  5BR8 Q;  1ROD A;  1BBW A;  2JA5 B;  3PUY A;  4MIU A;  1QB5 D;  1VQ5 A;  1U4L A;  3GV3 A;  3Q0A A;  3S16 B;  2F0D A;  1L0Y B;  2E5L L;  2NUC A;  4GOP C;  2VY3 A;  4P75 A;  2R7Z G;  1FGU A;  2EY6 A;  3J7A 5;  3SR1 A;  5GAH C;  1Y1V G;  2WIN B;  3N6R A;  5IGD A;  4DAY B;  4QL5 A;  3J7A V;  1K3B C;  2V1C C;  2AKW B;  1EY4 A;  1K3R A;  3T56 B;  4DAY A;  2CVR A;  3RN5 A;  1N33 L;  5LMU L;  1V9P A;  2DJG C;  5LL6 X;  3TQY A;  1S40 A;  4A3D G;  2E2I H;  2K28 A;  2OF1 A;  4H13 C;  2MO1 A;  1PFN A;  2N88 A;  2F4V Q;  5CMD A;  3T1Y Q;  4EGV A;  2CW0 C;  3D4R A;  1STB A;  4AQY Q;  4RA8 A;  2EJF C;  4JOI A;  4J1M A;  1M8A A;  3ND8 A;  4A3K H;  1KRS A;  4FF2 A;  2Z4I A;  4UY8 C;  4DGZ A;  3OWF A;  4O42 A;  4FXD A;  1STA A;  1ZEQ X;  3S17 B;  2Q2H A;  3D3R A;  2LFN A;  1N34 Q;  1IBK L;  1HCZ A;  2F0I A;  1YZ6 A;  4JV5 L;  4A4I A;  2RCF A;  5C4X H;  5IP9 G;  4OHJ A;  1X32 A;  4HSP A;  1CSQ A;  4QUF A;  2AWN A;  1BR9 A;  2B2U A;  3S2D B;  1AE2 A;  2E2D C;  5C4H A;  2BCO A;  4RAU C;  3NWT A;  1QIL A;  4ZQ3 A;  5M5Y H;  4KD4 A;  4JI1 L;  2JA8 G;  1SR3 A;  2CKZ B;  3TP6 A;  1EYC A;  1UEB A;  3HOU G;  3CW2 C;  1LAB A;  4FVM A;  1S5E D;  1SMX A;  3MAQ A;  1STY A;  1PH9 A;  1JOQ A;  2A73 B;  3DEO A;  4I7A A;  4A3E G;  3NTI A;  2FFK B;  1LUZ A;  1QVG A;  4DAP A;  4RKL A;  1EEF D;  1JE4 A;  2R93 B;  3AMU A;  1HRJ A;  1U4P A;  2ICI A;  1OXV A;  2UUA Q;  1XXG A;  3T1H L;  3S2H H;  2ZTC A;  1Q7Y C;  1YIJ A;  1B3Q A;  1A0I A;  4XIG S;  2AUJ D;  4AYB G;  1BOS A;  1I50 H;  2NVX H;  3F2D A;  3GTG B;  2N8N A;  5HGT A;  1HFG A;  1STH A;  4HSV A;  2BH2 A;  3CC2 A;  5C0X G;  2IHE A;  3V05 A;  3U9S A;  2MNA A;  1TII D;  1J6Q A;  2Z6K A;  4GLV B;  4J15 A;  1EZ6 A;  4KY6 A;  3I91 A;  3GD7 A;  3K7A B;  1CA6 A;  3VYR A;  3SVM A;  5FLX c;  2ZJQ A;  4C3H H;  5KYL A;  1R9T H;  5IGB A;  1Q81 C;  1O80 A;  5C0X I;  5IYB H;  2LXK A;  2M2L A;  4NP5 A;  3L2P A;  2Z4H A;  3NQI A;  2C5C A;  4GLA C;  3URY A;  3J80 L;  4X3U A;  3T13 A;  1D5Z C;  3UDI A;  1I4R A;  2R3Z A;  1FYC A;  4K6L A;  1T5E A;  2BA0 A;  2VXW A;  5ELE A;  4QF4 A;  3FPU B;  3WOF A;  1CZG A;  4JBW A;  1D6E C;  4A3J B;  1PZK D;  2A5H A;  3G6J B;  3V96 A;  1FNW A;  5BN4 A;  4GZY C;  5IYD H;  1L1O B;  4ME5 A;  4MN3 A;  2A68 D;  2DNE A;  2R92 H;  3TP5 A;  1MHW C;  3ULP A;  2M9V A;  3CU7 A;  2X69 A;  1L1O A;  4LUZ A;  5EPL A;  2DUD A;  1HTL D;  3OIP A;  4OWX B;  1PYB A;  2HCI A;  3QB3 A;  4X3S A;  2WAC A;  1O7I A;  1IKM A;  3NSW A;  1YBY A;  2NN6 G;  4KMU C;  1VQC A;  1X65 A;  4CJ2 C;  1TWC H;  4KY5 A;  1HNW L;  4LF9 L;  2B63 G;  4HED A;  2OXP A;  3IFT A;  3DM3 A;  4HCS A;  4A3G H;  1DD2 A;  2NZ1 D;  5IE8 A;  1YEZ A;  1DZ1 A;  1VQJ A;  1K8O A;  2E2H H;  4OL7 A;  1W6K A;  4HID A;  1IBL Q;  4OX9 L;  1NR2 A;  4I7Z C;  4C1N I;  5J3B A;  2JN4 A;  1K28 A;  2IHF A;  2KA7 A;  2R7Z H;  4XDX A;  1Y1V H;  4DA2 A;  1WTR A;  2X6L A;  3M4Q A;  4R1J A;  3OPO A;  4EQP A;  1BKB A;  1KD1 C;  3HOZ H;  1HNZ Q;  4FYD A;  2QCP X;  1SBB B;  2JXM B;  5FKA C;  3J81 L;  2EY2 A;  3OMG A;  5CV6 A;  4A3D H;  3TZU A;  2IY5 B;  1A2U A;  5DM6 3;  1JJC B;  1LTI D;  3RMH A;  1QOH A;  4DV1 L;  5K36 H;  4EQO A;  4L63 B;  3E5S A;  4LF5 Q;  1FJG Q;  4CKE A;  2JP1 A;  3GTQ H;  5G3L F;  2EY5 A;  2RBM A;  3S1N B;  2Y0S B;  2WKD A;  2C35 B;  2SOB A;  2IX3 A;  1MGS A;  1JOR A;  1ILQ A;  3KBX A;  5IP9 H;  1U0L A;  4B3M Q;  5KEE A;  1QE6 A;  2K01 A;  2JK8 A;  5TSS A;  4JI7 L;  2DGY A;  2IW3 A;  2IJ0 A;  4C3J G;  1KXL A;  4TSS A;  2PYK A;  1DON A;  1N33 Q;  5LMU Q;  1UE1 A;  2JA8 H;  4A76 A;  2FXQ A;  1S3O A;  3ZJY C;  3HOU H;  4LUO A;  3BJU A;  4TVA B;  3K0Y A;  3KK7 A;  3A7L A;  3KF8 B;  1XPU A;  2SNM A;  1SFO B;  4NPS A;  3KF8 A;  4A3E H;  2EPB A;  4CJ0 B;  1JC7 A;  1B70 B;  1ET6 A;  2H5X A;  5I4D A;  3J80 E;  2HHH L;  3A5U A;  1BBX C;  4QGU A;  3VR3 A;  5ISR A;  3HOW B;  2LSS A;  3I70 A;  2B2T C;  4PZ7 A;  1SNQ A;  3RN2 A;  4CDC C;  3R2I A;  2F0P A;  3PUV A;  4FO2 A;  2ALY B;  2F3W A;  1NAP A;  1GJX A;  4JV5 Q;  3IRB A;  1EZ8 A;  1EIH A;  3TSS A;  2RA4 A;  2E2I B;  5C0X H;  4KKU A;  1PDQ A;  5EKK A;  3NBI A;  5GRO A;  4EQN A;  1Y1W B;  1V43 A;  3Q8D A;  2XRS D;  3ONA B;  4JI1 Q;  1I4H A;  4KY7 A;  5E4W C;  3L0O A;  3DMU A;  5HUR A;  4DV0 L;  1TWA B;  1SE2 A;  3D4W A;  4A3K B;  2EIF A;  4K0K L;  2NTS A;  2Z6K C;  5JEA J;  2NVT H;  4RGO S;  3T1Y L;  1B8A A;  2B8F A;  3QOJ A;  3K80 C;  2PI2 E;  4AQY L;  1K0R A;  5EPK A;  3C46 A;  1GO3 E;  1S4Z A;  2A6E D;  4R9W A;  2Q8T A;  5GAG C;  2HDM A;  2PCF B;  3WDN A;  2FMM A;  1XNQ L;  1DYQ A;  2Q2U A;  5C4X B;  3U4V A;  1VQD A;  5M3F H;  5FK9 C;  1XPR A;  4DUZ L;  2HQE A;  2EYP A;  3T1H Q;  4GOP A;  3RNU A;  1BXT A;  1CSP A;  2DNC A;  3D4D A;  1HZC A;  1U4R A;  4DN4 M;  4DR5 L;  1BQQ T;  3NTK A;  5M5Y B;  2FHT A;  4N9T A;  1Q1E A;  2PMZ E;  3I55 A;  4QMG A;  1PTO H;  5I2Y A;  3NP8 A;  1K8A C;  3RLO A;  4A3M G;  3GTO H;  1VQ7 A;  1JB7 A;  4JBK A;  4C3I G;  4PNY A;  1AZP A;  4IFD G;  1L1O C;  2I5L X;  2NN6 H;  5BN3 A;  1YNJ C;  3I4M B;  1M1K C;  5CGK A;  2N3S A;  1H9S B;  4TRD A;  4IO9 A;  3BZK A;  1H9S A;  5M5X H;  2B63 H;  5EQ0 A;  3QO2 A;  4IFD I;  1ZKO A;  1JIC A;  2RDH A;  5DNF A;  3Q23 A;  4A3F G;  3T16 A;  3S2H B;  1B9N A;  5C4J B;  1I50 B;  3MXN B;  1Q82 C;  2Q2T A;  1VCI A;  5A2Q L;  3MXN A;  2F0J A;  2L5T A;  4HR7 B;  4A3C G;  1EIY B;  3K5O A;  2JQO A;  1PH7 A;  1E2W A;  2F0N A;  1II3 A;  3HKZ B;  4KJN A;  1D7Q A;  1KAB A;  2AMC B;  3PUX A;  1NBW A;  1S5D D;  1N32 L;  1OXU A;  1MIU A;  3AU7 A;  2WP8 J;  3CRK C;  4C2M H;  3HP3 A;  4K5V A;  1VF5 C;  2GA4 B;  4C3H B;  4ZK9 B;  1R9T B;  1FD7 D;  4JI2 L;  4UAI A;  4KHV A;  1CFM A;  2EOT A;  1IYU A;  5C5L A;  3M4O B;  2UUC L;  2MO0 A;  1TQO A;  1K9M C;  5COR A;  4FF1 A;  3OW7 A;  1A62 A;  1KHI A;  3SE0 A;  3CPF A;  1EFI D;  3MEF A;  4DV5 L;  1HNW Q;  2B39 A;  2WFW A;  3JAM L;  4LF9 Q;  2JYO A;  4KK7 A;  2RKS A;  4C56 C;  4TQU S;  5IGE A;  1E3P A;  1GVP A;  3VYU A;  3LX0 A;  1PRT F;  1VQI A;  2EYM A;  4ZRZ A;  4LFA L;  3NEM A;  2R92 B;  3C1F A;  5JJL A;  1I4X A;  2IT1 A;  2Q2I A;  1C9O A;  3F1Z A;  1SLJ A;  1SXT A;  2YU9 B;  4OX9 Q;  2E2J B;  1E1T A;  5IGF A;  1CHP D;  4PZ8 A;  2ZTE A;  1B53 A;  5KIX A;  2UXC L;  3SK6 A;  4POG A;  3H15 A;  4C3J H;  2F4I A;  2A69 D;  1GUG A;  3EIV A;  4QY7 A;  1WTO A;  1PTO F;  2PPB C;  4GLX A;  2K33 A;  3OSO A;  3MVV A;  5EKI A;  5G3L D;  4RG1 A;  1TWC B;  1CQF A;  4PG3 A;  5KND A;  1I3Q H;  4QUC A;  1SND A;  1EIG A;  2WB1 G;  4KHZ A;  4DXG A;  3VDY A;  3UE0 A;  1WTP A;  4DV1 Q;  2G5D A;  2OCE A;  3F2C A;  1WD1 A;  4LFC L;  4UP7 A;  3FEW X;  1X3E A;  2B3G A;  2CHB D;  5IYB G;  1AE3 A;  2P5Z X;  3BYY B;  2R7Z B;  1M4V A;  1BNZ A;  4JI5 L;  4R4I A;  4XTC S;  1PVO A;  1A63 A;  4BXX G;  5HGQ A;  1F2Y A;  1RL2 A;  5JOB A;  2NTT A;  3KOJ A;  1A15 A;  3DWQ A;  2VW9 A;  1IBL L;  3P20 A;  3MXG A;  1PZJ D;  2N78 A;  2X6G A;  3EJI A;  5C3X A;  4DV2 L;  1I6H H;  3VR6 A;  1V1Q A;  3MXP A;  5IOD A;  4XYQ A;  3I3C A;  2VUM G;  1LAC A;  1MD2 D;  4RKB A;  1HNZ L;  2K6A A;  1EEI D;  2XRQ D;  3AYH B;  5DM7 3;  1QNK A;  2BH8 A;  1G6P A;  3KYH C;  2A6E C;  1F9Q A;  2HT1 A;  1EQV A;  2F1M A;  1I4Q A;  1W6J A;  2VL6 A;  3QOL A;  3BS1 A;  5JVG 3;  3GTQ B;  3ITP A;  1H9R A;  1TU2 B;  4QQB X;  1HZ9 A;  1VQP A;  4DNT B;  2B8G A;  4DV3 L;  3PCO B;  4WOR A;  3GTP B;  3GTM B;  1AZQ A;  5ELB A;  3LWE A;  3NBH B;  1FJG L;  4Y52 H;  1XMO L;  3DLL A;  3PO3 H;  4GKJ L;  1KNA A;  1WFQ A;  2O5I C;  2PNH A;  3HOY B;  2K5D A;  5FLM G;  2NYZ D;  1HZA A;  1HFN A;  1QZG A;  1F2L A;  4CDE C;  2KVM A;  4MTK A;  1WTH A;  4Q0F A;  4B9W A;  2JA8 B;  3CCS A;  1PHJ A;  4QIW B;  1X56 A;  4B3M L;  3MFY A;  4DR4 L;  1D5M C;  4A3M H;  1BBU A;  1WOC A;  4C3I H;  3HOZ G;  4J8Q A;  3K5N A;  4IFD H;  3P7J A;  5I6W A;  4A3E B;  4K6D A;  4A3B B;  1E22 A;  2IX0 A;  2N49 A;  1JR0 D;  4DV0 Q;  1C0A A;  3A8J E;  1J9O A;  4DFA A;  4N9P A;  2AHO B;  1ESR A;  4GNX B;  2WAQ E;  2CQO A;  1PA6 A;  4K0K Q;  4GNX A;  1CI3 M;  2MJ8 A;  2PW5 A;  3JAM E;  4RGM A;  4A3F H;  1H9K A;  4RMF A;  2NZO A;  1DOK A;  5JVH 3;  5K36 G;  3W1B A;  4ZYS A;  3I7F A;  4BWG B;  3C1E A;  4AYB B;  4ID6 A;  3S24 A;  1SYC A;  1XNQ Q;  1D1I A;  2RSO A;  2AQ3 B;  2F0W A;  4B9X A;  5M9O A;  5HY6 A;  5IYC G;  4DUZ Q;  4ZAI A;  4A3C H;  3I8Z A;  5AJ3 Q;  4IPH A;  4KV6 A;  1VQN A;  3NWS A;  3PO2 G;  3MHB A;  4JBM A;  2F0S A;  1C8C A;  4DR5 Q;  3JC6 6;  5GQO A;  3CMA A;  1HHV A;  1SYD A;  2BA1 A;  1BDO A;  3DWA A;  3GO5 A;  1ILP A;  1PYW D;  3PV0 A;  5J39 A;  2NB0 A;  4JBJ A;  1BUV T;  2F0K A;  4HJ7 A;  1UE6 A;  2QW7 A;  1PRT B;  4KN4 C;  2HDL A;  1YI2 A;  2FJ2 A;  2I5H A;  2B2T A;  1EQR A;  2OTL A;  1N9W A;  3BU2 A;  1CZW A;  2OT2 A;  1YVC A;  1UAP A;  1LT3 D;  1A8V A;  2A69 C;  4NXN L;  2I46 A;  4YIJ A;  4FDB A;  3PF4 A;  4HN7 A;  2I0Q A;  1E1O A;  3W2D A;  1HXY D;  4DR2 L;  3S1Q H;  2NVQ H;  1AH9 A;  4IJL A;  4X65 L;  3M7N A;  2DN8 A;  1N32 Q;  1D2B A;  2PZT A;  4Z9C B;  2N55 A;  1PFS A;  1EY9 A;  1PRT D;  1DGS A;  1RJT A;  2B2Y C;  4JI2 Q;  4DXF A;  5M5X B;  2B63 B;  1KC8 C;  4OO1 G;  2UUC Q;  3FDT A;  1R4P B;  3A54 A;  4ZLT F;  3J7A F;  3BDO A;  4ODG A;  3PIO 3;  3CCQ A;  1PH8 A;  1AEX A;  4DV5 Q;  3RZO H;  1E24 A;  3CD6 A;  1KAA A;  1B1Z A;  1V1O A;  5CV9 A;  2YV5 A;  1WCM H;  4PV1 C;  3T53 B;  3N52 A;  4WJ3 M;  3Q24 A;  4NXM L;  2M00 A;  5IT9 c;  4LFA Q;  1ENC A;  4YCV A;  2ZM6 L;  1Z6H A;  4BXX H;  1EU3 A;  3Q22 A;  1GM5 A;  5DEH A;  1XMQ L;  1VF7 A;  1EWH A;  2L55 A;  2AQ2 B;  4OIJ A;  5M3F G;  3FHW A;  3T51 B;  2I07 B;  4YCU A;  1B4O A;  1TY2 A;  4RHS A;  2UXC Q;  3IL8 A;  5M3M B;  1PXU A;  2LY7 A;  4CDF C;  2VUM H;  2A6H D;  1I6V C;  3VA5 A;  1Z9F A;  1TS4 A;  5ELC A;  4X3T A;  4O1N A;  3E0E A;  3VR5 A;  1EY7 A;  4DV7 L;  1K73 C;  1VQM A;  3CCU A;  1TWG H;  2YYZ A;  3IAY A;  1EU4 A;  1JWM D;  4RHR A;  4M8A A;  3VYS A;  5D65 A;  2WAQ G;  5T1G A;  4DK3 C;  4LFC Q;  3AQQ A;  1CKN B;  4RFB A;  1E0B A;  1TWF H;  2KCN A;  1CKN A;  1PH2 A;  2JA6 H;  4XT1 B;  3PQI A;  4RGT A;  4G7Z C;  1V1P B;  1TWH B;  4X62 Q;  3QWN A;  2NN6 I;  1YNJ D;  1PH4 A;  2G9D A;  4JI5 Q;  1SNM A;  1V1P A;  3M3Y H;  1Z47 A;  5FLM H;  3HFZ B;  4LNQ A;  4JCV E;  4IUV A;  4L5T A;  3KJP A;  1PLF A;  5LMN L;  3NHH A;  4DV2 Q;  4JC0 A;  1B44 D;  1KLG D;  4HAE A;  4V19 0;  2XWB B;  3FKI G;  4BA2 I;  5FOB B;  3UDG A;  4MNO A;  3U9O A;  3V2T A;  1I3Q B;  2F0T A;  3PUZ A;  1Y8N B;  3OIQ A;  4IN3 A;  4P74 A;  3OOC A;  5KRU A;  2B29 A;  4RGN A;  4K8J A;  1H95 A;  2IWH A;  3I4O A;  3PGZ A;  1X3Q A;  1PZI D;  1ZYR C;  4Y7N H;  1PMR A;  5CV7 A;  2K03 A;  3EQL C;  1I5F A;  1CTM A;  1O7L A;  2HQL A;  3S15 H;  3RZD H;  1M90 C;  1QNU A;  5GAD C;  3CRL C;  4MZ9 A;  3B6Y A;  4R8I A;  4DV3 Q;  3CCJ A;  4DV4 L;  1SN8 A;  2V4D A;  4GNX C;  1YHQ A;  4WJ4 A;  1VQ8 A;  1JJG A;  3HZX A;  4CJ1 B;  5IYC H;  5CR3 A;  1XMO Q;  4GKJ Q;  2O2L D;  2GVB A;  1G29 1;  1EL0 A;  4RCN A;  3H3V I;  2K5W A;  1RKN A;  1S5F D;  3PO2 H;  2L12 A;  4FXG C;  5EAY A;  3DEP A;  4F8M A;  1ICW A;  2WII B;  4DK1 A;  1U9R A;  5JJK A;  1X54 A;  1VDZ A;  5C3W A;  4DR4 Q;  1XTC D;  4B3T Q;  5LHY 1;  1JT8 A;  4FF3 A;  1YIT A;  2ES2 A;  3R3O A;  4K5X A;  3CQZ H;  2EE1 A;  3PIP A;  2A74 C;  1HH2 P;  3I72 A;  4BBR H;  3U58 A;  1DOL A;  1G6Z A;  1SRU A;  4XT3 B;  4G7H C;  1K8M A;  4HCE A;  3G7L A;  1D5X C;  1KAW A;  1SYE A;  3R93 A;  2L11 A;  3ZYY X;  4XXE A;  1RTO A;  1QZH A;  2Z1C A;  5JPM C;  2KCM A;  4PQX A;  1DM0 B;  5K5P A;  4I65 A;  1FL0 A;  4EQ5 A;  4H02 A;  4CBV A;  2D0O A;  1PRT C;  1O7Z A;  4UPA A;  1B3A A;  4FNF A;  4A3M B;  4A3I G;  4RCO A;  3NUC A;  2QKI C;  3TBI B;  4DAM A;  3S1M H;  4QJF A;  4X6A H;  4DR3 Q;  2UU9 L;  3CC7 A;  4DV6 L;  5IY0 A;  2KCC A;  1D8L A;  1VMC A;  4JG2 A;  1PTO C;  4OO1 H;  1CM9 A;  2CWA A;  1C7Y A;  1KDA A;  2PW7 A;  4A3F B;  3PUW A;  1QUQ B;  4JI6 L;  3BVG A;  3DXJ C;  2WB1 E;  3STB D;  3D0F A;  1TVX A;  1G8Z D;  5L37 A;  4X64 L;  3NQT A;  1Q86 C;  4RWS C;  4BY1 G;  1UE7 A;  4U67 3;  4RH6 A;  1Q8K A;  4XYO A;  1E2Z A;  1W2B A;  1GXD C;  3H09 A;  3BVM A;  3R8B A;  2A6H C;  4NXN Q;  3Q6S A;  4DR6 L;  4NMZ A;  2B2V C;  4DAV A;  2BDN A;  2MUY A;  1NTG A;  4DR2 Q;  3TRE A;  2FIN B;  1F2M A;  3K57 A;  2VQF Q;  3PO3 G;  2F0U A;  5AJ3 L;  4X65 Q;  1FNU A;  3AEV A;  4TKO B;  5DLQ E;  4P72 A;  1HUN A;  4UDU C;  4OXP A;  3MXU A;  1YJN A;  1PV4 A;  2H4O A;  1JMC A;  4L6T B;  1BCP F;  3J81 E;  1IKL A;  3E6Z X;  3QIA A;  4DNR B;  1NJI C;  4ZKB B;  4QB4 A;  4GN3 B;  4KJO A;  1Y8O B;  2K1B A;  2ZXO A;  2EXZ A;  4CGY B;  3EFX D;  4LFB L;  2F3I A;  5KGU A;  3KLW A;  4NXM Q;  2D9U A;  2Q8I B;  2OWO A;  2NVQ B;  3K8A A;  2K5Q A;  2RDF A;  5GAE C;  4OWW B;  5FLX L;  1P16 A;  2ZM6 Q;  4C1N K;  4YWL A;  1OXX K;  1NSN S;  1N36 L;  2QIL A;  2NVX B;  4DNI A;  1XMQ Q;  4O2D A;  4DKA C;  1HR0 Q;  5H1S E;  4ALP A;  1HNX L;  2KBN A;  3NK9 A;  4LF7 L;  4JI3 L;  3FKI H;  4R4C A;  1T5X D;  1TR5 A;  5C0X J;  5IT9 L;  3SK4 A;  3J7Y W;  2K14 A;  4FP5 D;  4KHP L;  4UP9 A;  1KDB A;  2Z8L A;  4IJH A;  1J5E L;  4R4T A;  1HA5 A;  4K2K A;  5E3F A;  4XQJ A;  4AH6 A;  1VQF A;  3X3N A;  1LTL A;  1Y1W G;  3AFP A;  3U50 C;  3RZO B;  1Q3L A;  4DV7 Q;  1ET9 A;  2OTJ A;  1SJH D;  2KHJ A;  3OW2 A;  3IFD A;  1LTG D;  1CQV A;  2JEB I;  5JAV A;  2PI2 A;  1LT5 D;  5IIF A;  4P73 A;  1CUK A;  3K59 A;  2D0P A;  2KED A;  2XVS A;  2ZXR A;  3KJO A;  3H3V H;  1ICF B;  1G91 A;  4KTA A;  1JWU D;  5AFW A;  1VQO A;  5CYU A;  3MEH A;  4G7O C;  1HPC A;  1SE3 A;  2XWJ B;  3FVQ A;  5T1I A;  4FXK C;  3UDX A;  2OEO A;  2ZT9 C;  2LKV A;  5A35 A;  2PMZ B;  3J80 c;  2ICE C;  3I4N G;  5LMN Q;  1IXR A;  3ERQ A;  5CBA E;  1G51 A;  1WTW A;  2EVB A;  2HCC A;  3CKI B;  3KUP A;  2F0H A;  5KNC A;  2B2Y A;  1TWG B;  2JA9 A;  2PZW A;  5JJZ A;  3NE5 B;  1VQB A;  3G71 A;  1NUC A;  4KKS A;  3TZD A;  4IAL A;  4V0B A;  3I4M G;  2K50 A;  1LLR D;  3SK8 A;  1RCV D;  3CP0 A;  3HOV G;  1JCK B;  2NZH A;  2ZJP A;  4GN4 B;  3A7A B;  5J1Z A;  4YWM A;  3QR8 A;  5C3E G;  4JI8 L;  4A3G B;  5CBE E;  2L0C A;  3M4Y A;  2EYH A;  1WJJ A;  1DXM A;  4L5Q A;  3HRZ C;  3R2T A;  4DV4 Q;  4HJ8 A;  2E2H B;  4XQN A;  2PQA B;  1EOT A;  2UUB L;  1WCM G;  2RCN A;  1YNN C;  2PQA A;  2KHI A;  4X62 L;  3M4P A;  2NVY H;  2JE6 I;  1OTC A;  4A3I H;  4PMW A;  1Y1V B;  1IL2 A;  1DCZ A;  1ESF A;  2ATW A;  4OEL B;  3SGI A;  1SNC A;  5CV8 A;  3HOZ B;  4X66 L;  1PFB A;  4OEM B;  5ELF A;  4APV A;  3STB C;  2KCT A;  1CKM A;  3PMF A;  5FJ8 G;  2R7D A;  3CCE A;  1VQL A;  3E9I A;  3S1R H;  1GUN A;  4A3D B;  4JVZ A;  4DR1 L;  3A56 A;  2KEE A;  2E76 C;  1XYI A;  4A93 G;  1X3P A;  2MGS A;  4LF8 L;  4LAA A;  4B3R L;  3S15 B;  3RZD B; 
#chains in the Genus database with same CATH homology
 2L9H A;  3F2U A;  4HTH A;  4LK1 C;  1D1K A;  3UI2 A;  4IUP A;  1V8Q A;  1STE A;  3QJY A;  5EPJ A;  2FMC A;  4CHT B;  1NR4 A;  2Q8R E;  3RLF A;  2K04 A;  3PO2 B;  1ML0 D;  5FLX E;  3KLR A;  1RHP A;  5A2Q E;  3NBH A;  1IW7 C;  2WV6 D;  2DY7 A;  1GUS A;  1F2Z A;  3GP7 A;  1QG7 A;  1BCP B;  1LTA D;  1SEB D;  3HOU B;  1WTV A;  1Q8I A;  5NUC A;  2J4X A;  1BF4 A;  2NWG A;  3MA2 B;  1LT4 D;  1TS5 A;  1RD9 D;  3TME A;  2JSO A;  3QG1 A;  4NDX A;  2KEC A;  1I4P A;  4KN7 C;  3SDZ A;  3BDC A;  5FO8 B;  1CHQ D;  1BCP D;  3S1M B;  1ZYR D;  1Q90 A;  2EYO A;  1LV9 A;  4IUR A;  3IKJ A;  2CQA A;  2D2C C;  2KOL A;  3K5L A;  5IGG A;  3A8K E;  3EA6 A;  1O78 A;  3MWY W;  2NVT B;  4NKL A;  5JEA G;  1EY5 A;  5EBD A;  1ENA A;  1E2V A;  2VB3 X;  2ID0 A;  1TY0 A;  5M3F B;  4OGQ C;  4P2C B;  1F9R A;  1LT6 D;  2B2W C;  2D5D A;  4IZ8 A;  4WJW A;  1KNE A;  1UNS A;  4X3K A;  1R4Q B;  3H6M A;  1A3V A;  2XN9 C;  1PTO B;  2O5J C;  4IQZ A;  3VYT A;  3GTO B;  3BZD B;  4IFD J;  2WAQ B;  4XQQ A;  3C2P A;  3S9W A;  2NBF A;  1PFM A;  1Y69 U;  1GUW A;  3TP8 A;  1EY0 A;  2E74 C;  2PNR C;  1XX8 A;  1PTO D;  1OXT A;  5I9O A;  4OO1 I;  2EYJ A;  3KLS A;  3MTS A;  3M85 A;  2B2V A;  1OO9 B;  3FKI B;  1TT2 A;  4F7X A;  5JPN C;  2F0Q A;  2QDB A;  1HUM A;  4C2M B;  3D6C A;  2MHV A;  1UEA B;  1AFP A;  4OIK A;  1FNV A;  3H91 A;  2K05 A;  1TKW B;  2F0M A;  3P75 A;  4G4K A;  4WFN 3;  3BG3 A;  2AUK A;  2WKC A;  4K5W A;  1J8I A;  1EY6 A;  1GHK A;  5J22 A;  1VMP A;  4BS9 A;  4F88 A;  2J0T D;  5EKL A;  3ND9 A;  2EY1 A;  2VB2 X;  5EGT A;  5KYI A;  2IL8 A;  3MFG A;  3SK5 A;  5D3I B;  1SMY C;  1LO5 D;  2BE5 C;  1STN A;  5LL6 S;  5DAU A;  3VR4 A;  2XNA C;  1GOZ A;  4C3J B;  5CC4 A;  1IL8 A;  5C5M A;  5FO9 B;  1UUP A;  3AB9 A;  2F03 A;  4ZKC B;  3OWE B;  2EZV A;  3O13 A;  4KKT A;  4WRD A;  1KLU D;  4G57 A;  1A6X A;  1BCP C;  1KTK A;  3T4A C;  4ABN A;  2SEB D;  2TSS A;  2NVY B;  3L7Z C;  4KI0 A;  2KUM A;  1O7Y A;  4A3I B;  1LTR D;  2K32 A;  1A2T A;  2JEA I;  2H1E A;  1CT1 D;  2R6G A;  1I6H B;  4IUT A;  3S1R B;  3HEJ A;  1AW7 A;  2LMC B;  2R61 A;  5E1F A;  2F0E A;  5BN5 A;  1B50 A;  4DU9 A;  4B08 A;  2LS0 1;  2IX1 A;  1QCB D;  1Y8P B;  5JEA H;  4BY1 B;  3L3O C;  3DWP A;  1GHJ A;  2XIW A;  2RDG A;  5I2X A;  2F3V A;  1BO0 A;  3A8I E;  3TN2 A;  1S5B D;  3M7G A;  3PO3 B;  1CK1 A;  3D31 A;  4Q5V A;  2MP1 A;  1SAP A;  5M5W B;  3RD4 A;  4K8I A;  2XSC A;  5CV4 A;  1S5C D;  4NW2 A;  2L4N A;  2B2U C;  4J6H A;  4C3I B;  1JOK A;  3K6O A;  1HA6 A;  3E0J A;  2KQ3 A;  3D6W A;  1DJR D;  1YNN D;  3X3M A;  4QCL A;  1MSG A;  1Z7T A;  4ILW A;  1WTQ A;  3GTK B;  2F0O A;  1ZXT A;  4CKB A;  3NTH A;  4HMJ A;  4R8N A;  4MHE A;  1SSO A;  1RDP D;  4H0L C;  2K7V A;  3W3A A;  3OMC A;  3I4L A;  4CKC A;  1WVL A;  5IOC A;  2EYF A;  1G2S A;  4E6I A;  3FPP A;  1ONL A;  2QF7 A;  1SE4 A;  5FO7 B;  5COY A;  4H7B A;  2EJM A;  3KLS X;  2F0G A;  1SYG A;  1OXS C;  3GTJ B;  2A68 C;  2G9H D;  3S14 B;  1IW7 D;  1WD0 A;  3FMC A;  2RQX A;  3VR2 A;  2F0L A;  1SYF A;  1RF2 D;  3DM1 A;  4KD3 A;  2BDO A;  1IYV A;  3TDQ A;  3BYT B;  3H3V C;  2PZU A;  1C4Q A;  3I4N B;  2E75 C;  2J7Z A;  3S1Q B;  3MZ5 A;  2KJX A;  3HG9 A;  3D8G A;  3DHQ A;  4DK0 A;  1LTT D;  5KNB A;  3A55 A;  1SNO A;  3BDL A;  1AP0 A;  1QWY A;  3HOV B;  3BVZ A;  4PMB A;  4U68 A;  1NCV A;  5C3E B;  1MI2 A;  2WB1 B;  5CV5 A;  1JOO A;  2F0V A;  4EVO A;  4DF7 A;  2ENB A;  4IUN A;  3SXH A;  5D14 A;  2MPM A;  1WCM B;  5D3D A;  1H9M A;  4HMI A;  2CW0 D;  4IUU A;  4M1U B;  2PQE A;  4ZUJ A;  3GTL B;  3ERO A;  1QJO A;  2HUG A;  1SYB A;  4PMC A;  2B2W A;  3EVQ A;  3K5M A;  2RSN A;  1F9S A;  1EYA A;  1C48 A;  3DUZ A;  3KBG A;  3H94 A;  3GV6 A;  2C9O A;  2EDG A;  2AWO A;  1JWS D;  1SDF A;  1JQY D;  1XWE A;  1F9P A;  4A93 B;  2VUM B;  3SEB A;  3PIP 3;  2SNS A;  1GUO A;  3FRP B;  1RTN A;  4K14 A;  2D62 A;  5EBC A;  4FF4 A;  3CHB D;  1EY8 A;  4BBS B;  1EWC A;  4ULL A;  1HQM C;  1HQR D;  4JK1 C;  1STG A;  5E4X A;  1TS3 A;  1A3T A;  1TWF B;  3LWU A;  5C44 B;  2JA6 B;  4BY7 B;  2TMP A;  1ENF A;  1I4G A;  3SHL A;  1U4M A;  3M3Y B;  2VNU D;  5F2D A;  1Q1B A;  3NXW A;  1MBY A;  3K58 A;  2IPK D;  3VA7 A;  1EQT A;  1EYD A;  5IGC A;  2RVL A;  2F0F A;  3L9A X;  5C4Z A;  4ZUI A;  2EJG C;  1AN8 A;  1K83 B;  2QEJ C;  1KDC A;  4C3H G;  2DY8 A;  3LNN A;  4IUQ A;  4Y7N B;  3I90 A;  1TS2 A;  5ELD A;  4L8J A;  2BOS A;  1B9M A;  5I6Y A;  3H0G B;  1WTX A;  1B2T A;  2EYL A;  2JA7 B;  4F87 A;  2PO4 A;  4S3S A;  5I9P A;  2AQ1 B;  3HOX B;  1SNP A;  2KHS A;  1H9J A;  4BA1 I;  1CA5 A;  1GUT A;  4LMQ D;  1JB3 A;  4H44 C;  1F77 A;  3OHX C;  1FGB D;  3WOE A;  3NPP A;  1L0X B;  1LTS D;  1A3U A;  3HS0 C;  5EJW A;  3RUZ A;  1IHZ A;  2ZXP A;  3C3L A;  3TP7 A;  5C6A A;  1DOM A;  1G2T A;  1SJE D;  4K2L A;  1LTB D;  5IT9 E;  3CQZ B;  2O4X A;  4BBR B;  1FR3 A;  1HTP A;  1SMY D;  3GQB A;  3HGB A;  3MC0 B;  2BE5 D;  3I73 A;  4LJZ C;  1MSH A;  2L1B A;  1Q12 A;  2SDF A;  3P1H A;  1ROD A;  2JA5 B;  3PUY A;  4MIU A;  1QB5 D;  1U4L A;  3GV3 A;  3Q0A A;  3S16 B;  2F0D A;  1L0Y B;  2NUC A;  2EY6 A;  3SR1 A;  2WIN B;  3N6R A;  5IGD A;  3J7A V;  1EY4 A;  3T56 B;  4DAY A;  2CVR A;  5LL6 X;  2K28 A;  2OF1 A;  4H13 C;  1PFN A;  2N88 A;  5CMD A;  4EGV A;  2CW0 C;  3D4R A;  1STB A;  4RA8 A;  2EJF C;  4J1M A;  1M8A A;  3ND8 A;  4FF2 A;  2Z4I A;  4DGZ A;  3OWF A;  4O42 A;  4FXD A;  1STA A;  1ZEQ X;  3S17 B;  3D3R A;  2LFN A;  1HCZ A;  2F0I A;  4OHJ A;  1X32 A;  4HSP A;  4QUF A;  2AWN A;  1BR9 A;  2B2U A;  3S2D B;  2E2D C;  5C4H A;  2BCO A;  4RAU C;  3NWT A;  1QIL A;  4ZQ3 A;  4KD4 A;  3TP6 A;  1EYC A;  1LAB A;  4FVM A;  1S5E D;  3MAQ A;  1STY A;  1JOQ A;  2A73 B;  3DEO A;  3NTI A;  2FFK B;  4DAP A;  4RKL A;  1EEF D;  1JE4 A;  2R93 B;  3AMU A;  1HRJ A;  1U4P A;  2ICI A;  1OXV A;  1XXG A;  4XIG S;  2AUJ D;  1BOS A;  3GTG B;  5HGT A;  1HFG A;  1STH A;  4HSV A;  5C0X G;  3V05 A;  3U9S A;  1TII D;  1EZ6 A;  4KY6 A;  3I91 A;  3GD7 A;  3K7A B;  1CA6 A;  3VYR A;  3SVM A;  5KYL A;  5IGB A;  1O80 A;  5C0X I;  2M2L A;  4NP5 A;  2Z4H A;  3NQI A;  2C5C A;  3URY A;  3J80 L;  4X3U A;  3T13 A;  1D5Z C;  1I4R A;  2R3Z A;  1FYC A;  4K6L A;  1T5E A;  2BA0 A;  2VXW A;  5ELE A;  3WOF A;  4QF4 A;  3FPU B;  1CZG A;  4JBW A;  1D6E C;  4A3J B;  1PZK D;  2A5H A;  3G6J B;  3V96 A;  1FNW A;  5BN4 A;  4GZY C;  4ME5 A;  4MN3 A;  2A68 D;  2DNE A;  3TP5 A;  2M9V A;  3CU7 A;  2X69 A;  5EPL A;  1HTL D;  3OIP A;  2HCI A;  3QB3 A;  4X3S A;  2WAC A;  1IKM A;  3NSW A;  2NN6 G;  4KMU C;  4CJ2 C;  4KY5 A;  4HED A;  2OXP A;  3IFT A;  4HCS A;  1DD2 A;  2NZ1 D;  1DZ1 A;  1K8O A;  4OL7 A;  1W6K A;  1NR2 A;  4I7Z C;  4C1N I;  2KA7 A;  4XDX A;  4DA2 A;  1WTR A;  2X6L A;  4EQP A;  3OPO A;  4FYD A;  2QCP X;  1SBB B;  2JXM B;  5FKA C;  3J81 L;  2EY2 A;  3OMG A;  5CV6 A;  3TZU A;  1A2U A;  5DM6 3;  1LTI D;  3RMH A;  1QOH A;  5K36 H;  4EQO A;  4L63 B;  3E5S A;  4CKE A;  2JP1 A;  5G3L F;  2EY5 A;  2RBM A;  3S1N B;  2Y0S B;  2WKD A;  2SOB A;  2IX3 A;  1MGS A;  1JOR A;  1ILQ A;  3KBX A;  5KEE A;  1QE6 A;  2K01 A;  5TSS A;  2IW3 A;  2IJ0 A;  4C3J G;  4TSS A;  2PYK A;  1DON A;  3K0Y A;  3KK7 A;  3A7L A;  2SNM A;  1SFO B;  3KF8 A;  2EPB A;  4CJ0 B;  1JC7 A;  1ET6 A;  5I4D A;  3J80 E;  1BBX C;  3VR3 A;  5ISR A;  3HOW B;  3I70 A;  2B2T C;  1SNQ A;  3R2I A;  2F0P A;  3PUV A;  4FO2 A;  2F3W A;  1NAP A;  1GJX A;  1EZ8 A;  1EIH A;  3TSS A;  2RA4 A;  2E2I B;  5C0X H;  4KKU A;  1PDQ A;  5EKK A;  3NBI A;  4EQN A;  1Y1W B;  1V43 A;  2XRS D;  3ONA B;  1I4H A;  4KY7 A;  5E4W C;  3DMU A;  5HUR A;  1TWA B;  1SE2 A;  3D4W A;  4A3K B;  2NTS A;  5JEA J;  4RGO S;  2B8F A;  3QOJ A;  5EPK A;  3C46 A;  1S4Z A;  2A6E D;  4R9W A;  2Q8T A;  2HDM A;  2PCF B;  3WDN A;  2FMM A;  5C4X B;  1DYQ A;  5FK9 C;  2HQE A;  2EYP A;  1BXT A;  2DNC A;  3D4D A;  1U4R A;  4DN4 M;  1BQQ T;  3NTK A;  5M5Y B;  2FHT A;  4N9T A;  1Q1E A;  4QMG A;  1PTO H;  5I2Y A;  3NP8 A;  4C3I G;  4PNY A;  1AZP A;  4IFD G;  2NN6 H;  5BN3 A;  1YNJ C;  3I4M B;  5CGK A;  1H9S B;  4TRD A;  1H9S A;  5EQ0 A;  3QO2 A;  4IFD I;  1ZKO A;  1JIC A;  2RDH A;  5DNF A;  3Q23 A;  3T16 A;  3S2H B;  1B9N A;  5C4J B;  1I50 B;  1VCI A;  5A2Q L;  3MXN A;  2F0J A;  2L5T A;  4HR7 B;  3K5O A;  1E2W A;  2F0N A;  1II3 A;  3HKZ B;  4KJN A;  1KAB A;  3PUX A;  1S5D D;  1OXU A;  3AU7 A;  2WP8 J;  3CRK C;  3HP3 A;  4K5V A;  1VF5 C;  2GA4 B;  4C3H B;  4ZK9 B;  1R9T B;  1FD7 D;  4UAI A;  4KHV A;  1CFM A;  2EOT A;  1IYU A;  5C5L A;  3M4O B;  1TQO A;  5COR A;  4FF1 A;  3OW7 A;  3SE0 A;  1EFI D;  2B39 A;  3JAM L;  2JYO A;  4KK7 A;  2RKS A;  4C56 C;  4TQU S;  5IGE A;  3VYU A;  3LX0 A;  1PRT F;  2EYM A;  4ZRZ A;  2R92 B;  3C1F A;  1I4X A;  2IT1 A;  2YU9 B;  1SXT A;  2E2J B;  5IGF A;  1CHP D;  1B53 A;  5KIX A;  3SK6 A;  2F4I A;  2A69 D;  1GUG A;  1WTO A;  2PPB C;  1PTO F;  2K33 A;  3OSO A;  3MVV A;  5EKI A;  5G3L D;  1TWC B;  1CQF A;  5KND A;  4QUC A;  1SND A;  1EIG A;  4KHZ A;  4DXG A;  1WTP A;  1WD1 A;  3FEW X;  2CHB D;  3BYY B;  2R7Z B;  1M4V A;  1BNZ A;  4XTC S;  1F2Y A;  5JOB A;  2NTT A;  1A15 A;  3DWQ A;  3P20 A;  3MXG A;  1PZJ D;  2X6G A;  3EJI A;  5C3X A;  3VR6 A;  3MXP A;  5IOD A;  4XYQ A;  3I3C A;  1LAC A;  1MD2 D;  4RKB A;  2K6A A;  1EEI D;  2XRQ D;  5DM7 3;  1QNK A;  2A6E C;  1F9Q A;  1EQV A;  2F1M A;  1I4Q A;  1W6J A;  3QOL A;  3BS1 A;  5JVG 3;  3GTQ B;  3ITP A;  1H9R A;  1TU2 B;  4DNT B;  2B8G A;  4WOR A;  3GTP B;  3GTM B;  1AZQ A;  5ELB A;  3LWE A;  1KNA A;  2O5I C;  3HOY B;  2K5D A;  2NYZ D;  1HFN A;  1F2L A;  2KVM A;  4Q0F A;  4B9W A;  2JA8 B;  4QIW B;  3MFY A;  1D5M C;  4J8Q A;  3K5N A;  4IFD H;  3P7J A;  5I6W A;  4A3E B;  4K6D A;  4A3B B;  2IX0 A;  1JR0 D;  3A8J E;  1J9O A;  4DFA A;  4N9P A;  1ESR A;  1CI3 M;  2MJ8 A;  2PW5 A;  3JAM E;  4RGM A;  1H9K A;  1DOK A;  5JVH 3;  5K36 G;  4ZYS A;  4BWG B;  3C1E A;  4AYB B;  4ID6 A;  1SYC A;  1D1I A;  2RSO A;  2AQ3 B;  2F0W A;  4B9X A;  5M9O A;  4ZAI A;  3I8Z A;  4KV6 A;  3NWS A;  3MHB A;  2F0S A;  1C8C A;  1HHV A;  1SYD A;  2BA1 A;  1BDO A;  3DWA A;  3GO5 A;  1ILP A;  1PYW D;  3PV0 A;  5J39 A;  2NB0 A;  1BUV T;  2F0K A;  1PRT B;  4KN4 C;  2HDL A;  2FJ2 A;  2B2T A;  1CZW A;  2OT2 A;  1UAP A;  1LT3 D;  2A69 C;  2I46 A;  4YIJ A;  4HN7 A;  3W2D A;  1HXY D;  3M7N A;  2DN8 A;  1D2B A;  2PZT A;  4Z9C B;  2N55 A;  1EY9 A;  1PRT D;  1RJT A;  2B2Y C;  4DXF A;  5M5X B;  2B63 B;  4OO1 G;  3FDT A;  1R4P B;  3A54 A;  4ZLT F;  3J7A F;  3BDO A;  4ODG A;  3PIO 3;  1AEX A;  1KAA A;  1B1Z A;  1V1O A;  5CV9 A;  4PV1 C;  3T53 B;  3N52 A;  3Q24 A;  2M00 A;  1ENC A;  1Z6H A;  1EU3 A;  3Q22 A;  5DEH A;  1VF7 A;  1EWH A;  2L55 A;  2AQ2 B;  4OIJ A;  3T51 B;  2I07 B;  1B4O A;  1TY2 A;  4RHS A;  3IL8 A;  5M3M B;  1PXU A;  2LY7 A;  2A6H D;  1I6V C;  3VA5 A;  1TS4 A;  5ELC A;  4X3T A;  4O1N A;  3VR5 A;  1EY7 A;  2YYZ A;  3IAY A;  1EU4 A;  1JWM D;  4RHR A;  4M8A A;  3VYS A;  5D65 A;  5T1G A;  4RFB A;  1E0B A;  2KCN A;  4XT1 B;  4G7Z C;  4RGT A;  1V1P B;  1TWH B;  3QWN A;  2NN6 I;  1YNJ D;  2G9D A;  1SNM A;  1V1P A;  1Z47 A;  4IUV A;  1PLF A;  3NHH A;  1B44 D;  1KLG D;  4HAE A;  4V19 0;  2XWB B;  4BA2 I;  5FOB B;  3U9O A;  3V2T A;  1I3Q B;  2F0T A;  3PUZ A;  1Y8N B;  3OIQ A;  4IN3 A;  3OOC A;  5KRU A;  4RGN A;  4K8J A;  2IWH A;  1X3Q A;  1PZI D;  1ZYR C;  1PMR A;  5CV7 A;  2K03 A;  3EQL C;  1CTM A;  1O7L A;  1QNU A;  3CRL C;  4R8I A;  2V4D A;  3HZX A;  4CJ1 B;  5CR3 A;  2O2L D;  1G29 1;  1EL0 A;  4RCN A;  2K5W A;  1RKN A;  1S5F D;  2L12 A;  4FXG C;  3DEP A;  4F8M A;  1ICW A;  2WII B;  4DK1 A;  1U9R A;  5C3W A;  1VDZ A;  1XTC D;  5LHY 1;  4FF3 A;  3R3O A;  4K5X A;  2EE1 A;  2A74 C;  3I72 A;  1DOL A;  1G6Z A;  4XT3 B;  4G7H C;  1K8M A;  4HCE A;  3G7L A;  1D5X C;  1SYE A;  3ZYY X;  3R93 A;  2L11 A;  4XXE A;  1RTO A;  2Z1C A;  5JPM C;  4PQX A;  1DM0 B;  5K5P A;  4I65 A;  4CBV A;  1PRT C;  1O7Z A;  1B3A A;  4FNF A;  4A3M B;  4RCO A;  3NUC A;  2QKI C;  3TBI B;  2KCC A;  1VMC A;  1PTO C;  4OO1 H;  1CM9 A;  1KDA A;  2PW7 A;  4A3F B;  3PUW A;  3BVG A;  3DXJ C;  1TVX A;  1G8Z D;  3NQT A;  4RWS C;  4U67 3;  4RH6 A;  4XYO A;  1E2Z A;  1GXD C;  3H09 A;  3BVM A;  3R8B A;  2A6H C;  3Q6S A;  4NMZ A;  2B2V C;  4DAV A;  2BDN A;  2MUY A;  2FIN B;  1F2M A;  3K57 A;  2F0U A;  1FNU A;  4TKO B;  1HUN A;  4UDU C;  3MXU A;  2H4O A;  4L6T B;  1BCP F;  3J81 E;  1IKL A;  3E6Z X;  3QIA A;  4DNR B;  4ZKB B;  4QB4 A;  4KJO A;  1Y8O B;  2K1B A;  2ZXO A;  2EXZ A;  4CGY B;  3EFX D;  5KGU A;  2D9U A;  2Q8I B;  2NVQ B;  2K5Q A;  2RDF A;  5FLX L;  4C1N K;  1OXX K;  1NSN S;  2NVX B;  2QIL A;  3NK9 A;  1T5X D;  1TR5 A;  5C0X J;  5IT9 L;  3SK4 A;  3J7Y W;  4FP5 D;  1KDB A;  2Z8L A;  1HA5 A;  4K2K A;  5E3F A;  4XQJ A;  3X3N A;  3RZO B;  1Q3L A;  1ET9 A;  1SJH D;  3IFD A;  1LTG D;  1CQV A;  2JEB I;  5JAV A;  1LT5 D;  5IIF A;  3K59 A;  2KED A;  2XVS A;  2ZXR A;  1G91 A;  4KTA A;  1JWU D;  5AFW A;  5CYU A;  3MEH A;  4G7O C;  1HPC A;  1SE3 A;  2XWJ B;  3FVQ A;  5T1I A;  4FXK C;  2OEO A;  2ZT9 C;  2LKV A;  5A35 A;  2PMZ B;  2ICE C;  3ERQ A;  5CBA E;  1WTW A;  2EVB A;  2HCC A;  3CKI B;  3KUP A;  5KNC A;  2F0H A;  2B2Y A;  1TWG B;  2PZW A;  5JJZ A;  3NE5 B;  1NUC A;  4KKS A;  3TZD A;  4IAL A;  4V0B A;  1LLR D;  3SK8 A;  1RCV D;  1JCK B;  3A7A B;  5J1Z A;  4A3G B;  5CBE E;  2L0C A;  3M4Y A;  2EYH A;  1DXM A;  3HRZ C;  3R2T A;  2E2H B;  4XQN A;  1EOT A;  1YNN C;  2JE6 I;  4PMW A;  1Y1V B;  1DCZ A;  1ESF A;  1SNC A;  5CV8 A;  3HOZ B;  1PFB A;  5ELF A;  3PMF A;  4A3D B;  1GUN A;  3A56 A;  2KEE A;  2E76 C;  1XYI A;  1X3P A;  2MGS A;  4LAA A;  3S15 B;  3RZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...