1AP0A

Structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFIER PROTEIN 1
publication title Structure of the chromatin binding (chromo) domain from mouse modifier protein 1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chromatin-binding
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ap0A00
1IKLA 1U4RA 1QNKA 2L11A 4ZAIA 1EIGA 3HP3A 1JICA 1ML0D 2K01A 2L4NA 3P7JA 2L12A 5E4XA 1F9RA 2Q8TA 1DONA 1WTOA 4NW2A 2CVRA 3D6WA 4OIJA 4XDXA 2B2TA 1CM9A 2K1BA 5EPKA 4ZKCB 4X3SA 3DEPA 2FINB 1BO0A 4R8IA 2FHTA 3G7LA 2NWGA 4HEDA 1HA6A 1AZPA 4ZK9B 1B50A 5COYA 3MWYW 1SAPA 5CORA 2NYZD 1WTQA 3KUPA 1IKMA 2HDMA 2B2UA 2K28A 4OIKA 5CBEE 1RJTA 1JE4A 2B2YC 2K05A 2XIWA 1DOMA 1LV9A 1NR2A 1J9OA 1M8AA 1VMCA 2K03A 4RWSC 1G91A 1QE6A 1U4PA 2MP1A 2R3ZA 1ZXTA 1PFNA 3H91A 3LWEA 4IUPA 5EPJA 2JP1A 4XT3B 3GV3A 3I90A 4IUTA 1ICWA 2VXWA 4LMQD 1ILPA 1RTOA 1EQTA 1DOLA 2L9HA 1S4ZA 2B2TC 3ONAB 3Q6SA 4MHEA 1BNZA 1MSGA 1F2LA 5EQ0A 4DN4M 4HCSA 1F9PA 2B2VA 1O7ZA 4ZKBB 4RAUC 1J8IA 1SSOA 3IFDA 1HFNA 2FJ2A 1HFGA 4X3KA 1WTWA 2RSOA 1C8CA 2HUGA 2KUMA 1BBXC 1F9QA 2B2UC 2DY8A 3KBXA 1HHVA 2KEDA 1PDQA 1PFMA 1CA5A 1XYIA 3UI2A 1ILQA 1WD0A 2RVLA 1QG7A 1KNEA 1HUMA 1U4MA 1O80A 2MGSA 3N52A 2EOTA 4HSVA 2KEEA 3R93A 5EJWA 4O42A 1WTPA 1AZQA 1CA6A 1F9SA 3IL8A 5T1IA 1WTXA 1VMPA 1IL8A 2D9UA 2DY7A 2Q8RE 2EE1A 2RA4A 4MN3A 2N88A 4RA8A 1WTRA 1MI2A 1DOKA 2HDLA 3I91A 4X3TA 1GUWA 1B53A 5AFWA 5D65A 2B2VC 2N55A 5E4WC 1B4OA 4ZLTF 1WVLA 1WD1A 2KVMA 1NAPA 5DNFA 2HCIA 4X3UA 2B2WA 1WTVA 2NZ1D 3QO2A 5CBAE 3TZDA 4CJ2C 3FPUB 3TN2A 1RTNA 3FDTA 1MGSA 4U68A 1X3PA 1NR4A 1KNAA 2FFKB 4IUUA 1NCVA 1A15A 2HCCA 2MPMA 4QUFA 4IUQA 2K04A 2EPBA 3F2UA 1HUNA 5D14A 2FMMA 4IUVA 1AP0A 2X69A 5T1GA 1BF4A 5EKIA 1PLFA 1TVXA 5CMDA 1G2SA 2X6LA 3I8ZA 1HRJA 1E0BA 1RHPA 2H1EA 2L1BA 2B2WC 3I3CA 2KECA 3DEOA 1B2TA 5JJZA 1ESRA 1Q3LA 1RODA 2KOLA 2MJ8A 1U4LA 2JYOA 2X6GA 4IURA 1MSHA 1SDFA 5EPLA 1EIHA 1EOTA 2RSNA 3GV6A 1B3AA 2BDNA 3MTSA 3DM1A 3SVMA 1EL0A 2J7ZA 1X3QA 4CJ0B 1X32A 2SDFA 1DZ1A 4HAEA 1G2TA 1G6ZA 4R9WA 2B2YA 4XT1B 2IL8A 1XX8A 1PFBA 4QUCA 2M2LA 4CJ1B 4UAIA 1O7YA
chains in the Genus database with same CATH superfamily
1I6HH 3SK4A 3ZJYC 3J7AV 2Y0SB 2SOBA 5E4XA 1WTOA 4XDXA 3J80c 1ZYRC 1UE1A 2EY5A 5EKKA 2CH4A 3J7YW 4C1NK 3HOXH 1AZPA 1B50A 4QB4A 4POGA 1FVIA 4LF4L 2L15A 2Q2TA 4BBRG 4GKJQ 1PH2A 1I94L 4CDDC 1KRSA 3W3AA 4P73A 1ENFA 3ND8A 2F0JA 1HPCA 5AJ3Q 1Q8IA 3QOLA 1IW7D 1OXXK 1TY0A 4EVOA 2NVTB 1EUJA 2JE6I 3VR3A 3W2DA 4K5XA 2QW7A 2E74C 1PH1A 1GUTA 1VQDA 1NSNS 2F0WA 2R7DA 4ZCKA 2DUDA 1HHVA 1SE3A 1PDQA 5FLMG 2EYLA 3UI2A 4AYBE 3Q8DA 1I50H 1F2YA 1WYDA 2IHEA 3L2PA 1VQLA 2E2JB 4L8JA 3TP5A 3OOCA 4YWLA 3GTKB 3OW7A 2Q8RE 1IL8A 5LMUQ 2OF1A 2RA4A 3D6CA 4O2DA 4X66L 1B4OA 3DWPA 1TQOA 1P16A 2JA6G 1HH2P 4LF7L 2B8GA 3HKZE 3QOJA 3TMEA 3K7AB 4DK0A 3QB3A 2JEAI 1QVFA 4RGOS 3PO2B 3TN2A 2AMCB 4GLVB 1B70B 1NCVA 3NWSA 2PPBC 4BY7G 3S2HB 2NTTA 2FMMA 1D5XC 1U0LA 4K2KA 2K5WA 2QEJC 4JOIA 4RCNA 1X6OA 3OWEB 1B2TA 2EYHA 4IFDG 2ZJRA 1SE8A 3T1HQ 4BA2I 4L5SA 2UXCQ 5HGTA 4OWXB 1IYUA 1PH7A 4L63B 2B63H 4QMGA 1EWHA 3HOVG 2UUCL 4XT1B 1AE3A 2BDOA 3R8BA 1DZ1A 1CHQD 1O7YA 2RDGA 1IKLA 3VYSA 4UY8C 4IO9A 3C1EA 3D6WA 5I2XA 1KD1C 4CDCC 5KRUA 1JC7A 3ULLA 2FHTA 3VYTA 5L37A 1G51A 1EYDA 1YNNC 1QNUA 1YVCA 1GOZA 4DAYA 1N9WA 1I5FA 3S1MB 1VQOA 2J0TD 4B3MQ 4B3SL 1SYBA 3HOXG 1OXTA 1V1PA 3S15B 2K7VA 2F0MA 3Q6SA 2VL6A 4CKBA 1ESFA 5FOBB 4IPDA 1FNVA 3FKIB 5KEEA 1ASZA 4JYAL 2KUMA 3KJOA 4QJFA 1FNUA 2E2DC 2A8VA 5IGCA 2B39A 2ID0A 4HTHA 4BWGB 4J1MA 4GLXA 3M9BA 2IPKD 2V1CC 4A3EH 2QF7A 4DV5L 2DJFC 1PYBA 5DNFA 3KDFB 2LSSA 2NZ1D 2NVYH 4NKLA 1L0YB 3DUZA 3HZXA 3J7A5 2BCOA 1K3RA 1NJIC 2RCNA 4UP9A 5EKLA 1SNDA 1MGSA 3TP6A 4IPCA 4NXNL 1N36Q 2JA8G 1AN8A 1D7QA 3FP9A 4LF5Q 3MXGA 5D14A 4DK6C 1BCPD 5T1GA 2KCMA 1KRTA 4A93G 2F0NA 3ULPA 4XYOA 3NTHA 1QJOA 3NBHA 3J80E 4QF4A 2IWHA 1XPRA 1YI2A 1BR9A 5M3MB 2EYPA 1BQQT 1B8AA 4BBSH 2F0KA 3NHHA 4DUYL 1CZWA 2L11A 2VNUD 3HOWB 3LX0A 1ML0D 4L5TA 4GLAC 3MFGA 4G57A 4WJ4A 2YTYA 3FRPB 4PMBA 2B63G 4R8IA 2JJQA 1OXUA 4KV6A 5IYBH 2HHHQ 5DM63 3HS0C 1JWMD 1AE2A 1SYCA 2VZAA 3KUPA 2HDMA 5G3LD 1UNSA 2PZUA 1TS2A 3J81c 3CCRA 1ET6A 3H91A 3MC0B 1I4QA 2MO0A 5ELFA 4EQOA 1LM0A 4GOPC 3QJYA 4JI2Q 3DM3A 3NTIA 1GJXA 3H09A 2NN6G 1VQBA 3CRKC 4JW0A 1Y8PB 3G6EA 2OWOA 5C6AA 4L6TB 3MXNB 4OWTB 5C0XH 1HUMA 1SLJA 5IGBA 1BBUA 4NXML 5DM73 2ZTEA 1Y1WH 2I5HA 2JSOA 2XNAC 1EU3A 4LUVA 1GD7A 2VQFL 1JR0D 3PMFA 2CWAA 4OWWB 1SBBB 2HCIA 4DXGA 2R6GA 2JA9A 5M5XB 1VQKA 2E5LQ 3CF5A 3KBGA 2B29A 1STHA 4K8JA 3A8KE 5JJLA 1D2BA 5C4HA 2G9DA 2Z6KA 3A55A 4GN5A 2Z0SA 4OGQC 1IBKL 4GKJL 2D62A 2OCEA 1TWGH 4LNQA 1GUNA 1W3SA 2E2IB 4YHHQ 3SR1A 3K5OA 2WB1B 1BBWA 5IP9H 1TY2A 5AJ3L 1PH5A 5KNDA 1RHPA 4C3HH 1E24A 5FLXL 1PFSA 2KECA 5C44H 1LTID 1V1OA 4IURA 1IL2A 1B9MA 1EOTA 2RSNA 4CDEC 4DV1L 4G7OC 5JEAG 1PRTD 4HMJA 1HNXQ 1U5KA 1L1OA 1S5BD 1RCVD 2DJGC 3CMAA 3D4WA 4A3FH 5IY0A 3TSSA 2HQEA 1I4GA 2L4NA 2BE5D 4M8AA 3OHXC 2PNRC 4KY6A 5LMUL 5KGUA 1LLRD 5CV5A 1UE6A 1BKBA 4ALPA 1VS0A 2R7ZH 3CMEA 3PO3H 3TP7A 4N8X1 2YU9B 1DOMA 2ZM6L 1DCZA 1U4PA 3KF8A 4A3KB 2UUBQ 1DM0B 4ZUIA 4X65Q 4X66Q 4A3GH 1JWSD 1E2VA 3GTJH 4GNXB 1VQMA 3X3MA 4TQUS 5IYBG 2F0SA 1BNZA 1HNZQ 3HOZG 1LABA 4A3IG 2OTLA 3ZYYX 1IXRA 1HZCA 1YHBA 2PMZB 3CP0A 1X9NA 2CCZA 2KEDA 4P72A 3HGBA 3SE0A 3T1HL 1WFQA 3NSWA 5F2DA 4C3IH 1CA6A 1VQFA 1F9SA 5T1IA 3SGIA 5CBEE 2EE1A 1WTRA 4X62L 5IIFA 3CCEA 4JI1L 4ZLTF 1WVLA 4Y7NH 2HIXA 4ME3A 4PZ7A 4OX9Q 3H0GH 2MO1A 1H95A 1VQ5A 5D3DA 2D0PA 2KENA 4P2CB 1Y1WG 4APVA 1M90C 2PQAB 5ELCA 1S5ED 5M5WB 1PA6A 3NWTA 1SXTA 5M5YB 4ABNA 4YWKA 2R93H 2K14A 5I6WA 1FD7D 1UEAB 2ZXPA 4A3JH 4POFA 1ZEQX 1TKWB 1J5EQ 4IUQA 2YTXA 4C3JB 2OT2A 3W1BA 2XWJB 1PHJA 4C2MH 2JA7B 3D4RA 3IRBA 4JI5L 1Q3LA 3IFTA 4CJ0B 1HR0L 1U4LA 2UXBQ 2K75A 2I07B 4QIWB 1XTDA 3T51B 1A62A 1H9SA 4KHVA 1QCBD 4UP8A 1BCPC 2WINB 5IP9G 1HZBA 2R92H 1E1OA 1C48A 3T53B 4DV7Q 1I50B 5TSSA 3U4VA 3OTOQ 3MEFA 4DPGA 5EBDA 4RGNA 4P71A 2K01A 3J81E 4A3MH 2SNMA 4I7AA 4MZ9A 4LF6Q 4JYAQ 3CHBD 3A8IE 3H3VH 4JI3Q 5ELDA 1VQ9A 1HA6A 4AH6A 4KKTA 3VA5A 4JBMA 1SRUA 2B2UA 3ERQA 3S1NB 3AB9A 3QIAA 3Q23A 1CFMA 1ZXTA 2PYKA 1FR3A 3K5NA 2NZOA 3GD7A 2VXWA 1JOKA 3NK9A 3Q0AA 4LUOA 3CQZB 4DV2L 3M3YH 1KAWA 4BBRH 1Y8NB 1RDPD 1N36L 1JMCA 1F2LA 1D6EC 2F0GA 4HCSA 5ELBA 4A3LH 1HFGA 4KJOA 1WOCA 1C8CA 3DWQA 4A3GG 3OIQA 1VQAA 1XNRL 2ICEC 1R4QB 4H02A 3S17H 4AQYQ 3KLWA 1HTLD 2MGSA 3E9IA 2KEEA 3CAMA 3K7UC 3IL8A 5E7NA 3PUYA 5CV9A 3HKSA 3CC7A 3R2TA 4RA8A 1TWAB 1EEID 2E8GA 1VQ8A 4R8NA 2ZXOA 3ND9A 1EY8A 1GXDC 2B2WA 2WFWA 1HNWL 1PTOB 2NB0A 4C3IG 3TZUA 4HIDA 1WCMH 1E7ZA 3M4OH 1QZHA 3NENA 3FDTA 3J80L 1NMFA 2JA6H 2NVXB 2NN6I 1SNMA 4B3RL 2CQAA 1EQRA 5C0XJ 3GTOB 4PZ6A 3H0GG 1PZID 1D5ZC 3BZDB 1AP0A 4K5VA 2C35B 3QG1A 1HRJA 4B9WA 4JI2L 3I3CA 5GQOA 4KHPQ 2Q8IB 3RLNA 1GUSA 2LFNA 1RODA 4P75A 2X6GA 2ZT9C 4A3JG 1EFID 4AYBB 1JOQA 2F03A 5ELOA 2LXJA 3RZOH 3S2DH 1EWCA 2N78A 1K73C 1SNQA 1QILA 1MHWC 4ME5A 3RD4A 4IFDH 4DU9A 1RF2D 3IAYA 4GN4B 3GTMH 1X56A 1TS4A 4F8MA 1BDOA 2L0CA 2AWNA 2K6AA 3HKZB 4V190 3OMGA 1PRTC 4JOIC 1N8RC 4KY5A 3HOVH 3TRZA 1X65A 5C4JB 3DEPA 3TEHB 5C3EB 1U9RA 4DR3Q 4PMCA 2R92G 1K28A 1K83H 3VR2A 1YITA 5COYA 1SAPA 3VR5A 1JQYD 4JG2A 3BYYB 2BE5C 3GP7A 2ENBA 4A3MG 4R4CA 3A54A 1QE6A 2R3ZA 5J3BA 4FF3A 3EVQA 4XYQA 4HJ8A 3HOUH 3GV3A 3I90A 4IUTA 2LKVA 1ILPA 2PZWA 2FXQA 1HQMC 4DGZA 2L9HA 1CI3M 4YHHL 3GTQB 2IW3A 2UUAQ 2JK8A 1PTOF 3PUVA 4LJZC 3GTGH 2FJ2A 3A8JE 1WTWA 4Q5VA 5IE8A 1BBXC 3KBXA 1I4XA 1IBKQ 3BVMA 4DR5Q 2QA4A 1A3UA 2EQSA 4LFBL 1B7YB 1HNXL 2O5JC 4BBSB 4A3LG 3HOYG 2IX0A 1DOKA 2EIFA 2F0UA 4K8IA 3DLLA 4JI6L 5E4WC 4DV1Q 2CW0D 1STYA 5IGDA 5C3WA 5FO8B 2Q2IA 1JE5A 3OIPA 2DNEA 5CBAE 1SFOH 4X6AH 1RL2A 4R4QA 3FPUB 1E2WA 5A2QE 1RTNA 3S1QH 1I6VC 3F2BA 5LL6X 4R4OA 3I4MG 4NPSA 4QUFA 1I3QB 2K04A 3OSOA 1HUNA 4K14A 2UUBL 1S5CD 2LMCB 4WJ3M 5GAGC 3OW2A 4X65L 2UU9L 1WCMG 2H1EA 4OO1G 5NUCA 2JA8H 1V9PA 4RH6A 2N49A 4RHSA 1HNZL 3PIP3 3NXWA 3VYRA 5ISRA 3T1YQ 2ZM6Q 1ONLA 4A93H 1STAA 3SK8A 3SK5A 4HN7A 4KK7A 1H9JA 1G2TA 4KTAA 2JA5H 5C0XI 3TS0A 2EYJA 3B6YA 2BA1A 3D31A 3KLSX 4XQNA 5I4DA 3OPOA 4JCVE 1XJVA 1SNCA 2AKWB 1Q81C 4OIJA 4DA2A 1SYGA 4I65A 1SEBD 3ICEA 3G7LA 4OXPA 2KHJA 1JORA 1JT8A 3S1RH 2RDFA 2IX1A 1X54A 4OX9L 2YV5A 2B8FA 4ZK9B 2XGTA 4LK1C 2HT1A 5EPJA 4IUPA 3D3RA 3PUXA 4X62Q 3A5UA 4XQJA 4JI1Q 2ICIA 1EZ8A 3WOFA 1C4QA 3DMUA 1MSGA 4JK1C 5I6YA 1J5EL 1X3FA 1KLGD 3LNNA 4IPGA 1TWFB 4RG1A 4C3HB 4EX5A 5I9OA 3IFDA 2MQHA 3QR8A 3HOUG 4GKKQ 4BXXH 4TVAB 2NN6H 5CR3A 4DV3Q 2UXBL 3T13A 1IYJB 1O80A 4J8QA 5IWAL 1EYCA 1KIXA 3PUWA 1CUKA 4A3FB 2ZXRA 3AU7A 2HDLA 4LAAA 4DV7L 4JI5Q 3CCLA 3OTOL 2EY2A 1HR0Q 5HURA 5LL6S 2KHIA 1WTVA 1QUQA 3STBC 4LF6L 1SNOA 3J7AF 5KYLA 3MXPA 3I4NB 2QDBA 4YWMA 2A69C 4JI3L 4K6LA 3PO3B 3SXHA 1PH8A 1Q1EA 4IJHA 2KQ3A 5FKAC 5IYCH 1Y1VG 2H4OA 2Z1CA 3CCQA 3H94A 5M3FB 4A3CG 1F2MA 3L0OA 3J7ZC 1E0BA 5C4XH 2PQEA 2A1AA 3J81L 1N32Q 3BDCA 1C9OA 1Q90A 2JYOA 4LFCL 1JJCB 2Z6KC 4JI0L 1E3PA 3BG3A 2J7ZA 5JVG3 4GN3B 5JAVA 1GKHA 3F2DA 1Q86C 1C7YA 1XX8A 4DV2Q 2RF4A 1R9TH 2E75C 3P20A 5BR8L 5FJ8G 1W6JA 1CQFA 4AQYL 1L0XB 1OO9B 5JEAH 3K58A 1ENAA 5IODA 2KA7A 2CVRA 5EPKA 3GO5A 4ZKCB 5IGEA 4RHRA 2VS1A 3WDNA 4A3BH 3CKIB 3PV0A 2JA5G 4JBWA 1XNRQ 4K5WA 2Z4HA 4MIUA 1IBML 5CORA 4C1NI 3EIVA 4YCVA 4GOPB 1L1OC 1RIPA 1KDCA 5E3FA 1LT5D 1M8AA 2MP1A 2DN8A 4HJ7A 1DGSA 3RZDB 2R93B 2GN5A 3ER0A 3I7FA 1EY4A 3RLOA 2AHOB 2AWOA 2CH4W 4IFDJ 1HNWQ 4BY1B 3P75A 3RMHA 5IGFA 1QOHA 2PW7A 3T4AC 4XQQA 4X3KA 4WORA 1Z7TA 1GHJA 4KHPL 3HOZH 4B3RQ 1G6PA 1ILQA 2RVLA 4A3IH 2HIVA 2CFMA 4QY7A 1HA5A 1PH6A 4A3DB 1QB5D 3LGJA 3CPFA 4BXXG 1UE5A 1JWUD 1TS3A 5D65A 3PQIA 3AEVA 1SMXA 2KVMA 2QKIC 1PVOA 3H6MA 5JPNC 3EFXD 1B1ZA 4FVMA 4GZYC 2Q2UA 1TIID 1A0IA 2F0HA 3G48A 3H3VI 4DR3L 3VA7A 1S5FD 4DK1A 3MAQA 2VUMB 1CKMA 1YBYA 3GTKH 2AUJD 2CW0C 1EFWA 1JB7A 1VQNA 3L7ZC 4N8FA 4KI0A 1KL9A 2A19A 3GTLB 1PLFA 3C3LA 1EIFA 3K5MA 3MEHA 2F0IA 2RKSA 3K6OA 1TU2B 1XNQL 3F2CA 4DFAA 2XVSA 5IYCG 1W6KA 5BN4A 2UUAL 3NQIA 2NZHA 1GUOA 2SDFA 2B2YA 4AYBG 5C4XG 4A4IA 4J15A 3TP8A 1A3VA 1G8ZD 3H3VC 4ZAIA 4NP5A 2A6ED 2RCFA 3KJPA 4DR5L 3S14H 5IT9E 4PG3A 2K1BA 2AQ3B 2OXPA 1MJEA 4NB3A 4HJAA 2BA0A 4LUZA 1LTLA 2NWGA 4FXDA 4O0AA 3L3OC 4A76A 1EOVA 3PIO3 3BYTB 5K5PA 4LFBQ 4EGVA 1VMCA 5CC4A 4KMUC 2AUKA 3CRLC 4DR1L 3LWEA 1J6QA 1HQRD 1XPOA 4LMQD 1ICWA 4JI6Q 4A3BG 2KCTA 3DHQA 1SJHD 3FMCA 4P74A 2WAQE 3NPPA 1CSQA 1D5MC 2V4DA 2RBMA 3PGZA 4WJWA 2RQXA 2OEOA 3ERSX 2Y0SG 3PIPA 3RLFA 4ID6A 4R1JA 2ALYB 2B2UC 2DY8A 3WWVA 4ZUJA 4BY7B 1KDBA 3T16A 4DAPA 1LT3D 4Z9CB 3S1MH 3RZOB 3T1YL 2H5XA 3M4QA 5GADC 3KDFA 3N52A 1Q12A 2G9HD 2GVBA 2JN4A 2MUYA 4O42A 3S15H 1D1IA 2UU9Q 2PZTA 5A2QL 4G7HC 4RKBA 1YNXA 4IFDI 2O2LD 3FKIH 1B53A 3S16H 1A63A 5HY6A 1NAPA 1TWHH 3BZKA 3HOVB 3TZDA 1BUVT 1N34Q 3GTPH 4DR2L 2F4IA 2FFKB 1H9KA 3URYA 2WV6D 1E22A 2PI2A 4CHTB 4HJ9A 4FDBA 4ZYSA 4JV5Q 4PQXA 1SYFA 1BF4A 5CMDA 4H0LC 1S72A 3A5ZB 1I6HB 1G2SA 2B2WC 1BCPB 1E2ZA 2K5NA 1MSHA 4H44C 2QCPX 4HCEA 4UP7A 3T56B 2PO4A 3M7GA 4KKSA 1X3QA 3HOXB 1X32A 4FYDA 3CCVA 4DV4L 4GKKL 1DJRD 4CBVA 3O13A 1MJCA 4HR7B 4MTNA 4DV3L 1QNKA 2IT1A 3SK6A 2LS01 3SVMA 3PO2G 1PV4A 1VQCA 1PH3A 1P8LA 2B2TA 3JC66 3JAMi 4LWCA 3SHLA 4DAMA 1K8GA 1K8AC 2ES2A 5M3MH 2NYZD 3CCMA 1EY7A 1TT2A 5IWAQ 5BN3A 2VB2X 1VQ6A 1EU4A 1JJGA 5CYUA 4F87A 1I4HA 3A74A 3D8GA 4XT3B 4DF7A 3S1QB 4OL7A 4KLKA 1CKOA 3MXNA 1L2FA 1S4ZA 1STBA 4FO2A 5EQ0A 4PNYA 1F9PA 5JEAJ 1O7ZA 3A7AB 1KABA 3U50C 4DNTB 5FO7B 4B9XA 4RGMA 2JA8B 3U9SA 4DR7Q 1N32L 2KHSA 4X64Q 1WD0A 2QGQA 1QVGA 2R61A 4A93B 4OHJA 4PMWA 4QL5A 3K57A 5EJWA 1WTPA 2G5DA 1PH4A 2PNHA 5GROA 4MN3A 1V8QA 1T5XD 2XTIA 2N88A 1MI2A 2BOSA 3TBIB 4LFCQ 1UE7A 1EY6A 2ZTCA 1O7LA 2F4VL 4JI0Q 1CSPA 3G71A 1H9RA 3QO2A 3I56A 3HOYH 1ENCA 3Q22A 5ELNA 3NUCA 2VY3A 5BR8Q 3FKIG 2F0EA 2F52A 2EJMA 1KHIA 1IBLL 1FGBD 3I4NG 2B63B 3STBD 4NMZA 2C5CA 1Y8OB 3M7NA 4ZQ3A 2A69D 5IGGA 4I7ZC 3R2IA 3V05A 3KYHC 2AQ2B 1IBMQ 3I4MH 5M3FG 3GV6A 3BU2A 5KYIA 2VQEQ 4U673 1B44D 1D1KA 1PZJD 1VQ4A 4OO1H 3TREA 2NVQH 4CDFC 2E2IH 1PRTB 2ZJPA 3P1HA 2JEBI 1YNJD 4DNIA 5GAEC 1EIGA 1S3OA 1JICA 3HP3A 1VF5C 1HJPA 3MA2B 3KF6A 5BN5A 3CC4A 4DV6Q 4BA1I 3VR6A 4B08A 3OWFA 3JAMc 1H9MA 2A6EC 1YJNA 1VCIA 1IKMA 1GM5A 3S24A 2IHFA 2K03A 5LHY1 1A2TA 1NE3A 3QWNA 2P5ZX 5HGQA 1WJJA 1CK1A 1EIYB 4MNOA 5C5MA 5M9OA 4DUZQ 5M3MG 4KD4A 1DD2A 2B2VA 4QQBX 4C56C 4DAYB 3HOWG 5GAHC 1J8IA 4A3EB 2YU9H 1F9QA 1CZGA 1JJ2A 3C2PA 1V1PB 2EJFC 2NVYB 3CCJA 1PXUA 1QG7A 2EY6A 5A35A 1U4MA 3KLSA 2KCCA 3K81C 2F3VA 2OTJA 2Z8LA 2O4XA 3RN2A 1WTXA 4RGTA 4UPAA 2PQAA 1JOOA 2EY1A 1XNQQ 5IOCA 1V43A 3AFQA 5JJIA 2F0OA 3NELA 1K0SA 2NTSA 5IP7H 2CQOA 4N9TA 5C4ZA 3PIOA 3K0XA 1NBWA 5CV4A 1PH9A 1WI5A 1PRTF 1X3PA 1HTPA 1M4VA 2B3GA 4IUUA 1N33Q 3D0FA 4LF9L 2K5QA 1EYGA 5ELEA 5JVH3 3I4OA 4ZRZA 4OEMB 2VUMG 1CKNA 3FVQA 3K8AA 5EKIA 4HIOA 2X6LA 1A8VA 2L1BA 3NTKA 5KNBA 1Y1VH 2KOLA 5EPLA 1LYLA 1EIHA 5M5WH 1SYEA 5IT9L 1HZAA 1SYDA 5M5YH 4XXEA 4A3CH 1A6XA 1EL0A 3DM1A 3E6ZX 4DR1Q 2SNSA 4V0BA 3NEMA 4HJ5A 3HOZB 1G6ZA 1KXLA 4C3JH 3AFPA 1RKNA 4K0KL 4IPHA 2M2LA 4A3IB 1S40A 4UAIA 5EBCA 3NBHB 2JA7H 1PZKD 3W5OA 2L12A 1DONA 3A7LA 3PUZA 1D8LA 2TMPA 3U4ZA 5FJ8H 2KJXA 4DNRB 2WB1G 2IY5B 1EWIA 2K32A 4O1NA 4WRDA 4JBKA 3UE1A 1QZGA 2I5MX 1VDZA 3L9AX 1N34L 4K6DA 1LUZA 1G291 2CKZB 1EQTA 4LFAQ 3ONAB 1Y1WB 1NUCA 1M1KC 1Y14B 4R4TA 4DN4M 1MD2D 3G6JB 3BZCA 3U9OA 1KQSA 4R4IA 1II3A 2ATWA 4JV5L 1K3BC 1LTAD 2KCNA 4RAUC 4BS9A 3S1NH 5C3XA 2RSOA 2Z6BA 2YTVA 4ULLA 4DR2Q 3R3OA 1T5EA 4B3TL 1PMRA 2M00A 3CQZH 4YY3Q 4DR6L 3VR4A 3TQYA 5IT9c 1TWCH 3BJUA 3CU7A 3Q24A 2D9UA 2I46A 1C0AA 1TWGB 2F1MA 5AFWA 4A3KG 2CWPA 2FMCA 3A0JA 3S14B 2Y0SE 3E9HA 4CKEA 2D0OA 4OELB 1I4PA 4DV4Q 5C44B 1BVSA 2ASBA 4UHVA 1LTTD 1IHZA 1O78A 4U68A 1NMGA 1TWAH 2PCFB 3E5SA 4IALA 2MPMA 4JPBW 5CV6A 2YYZA 4MTKA 3UDGA 5IP7G 1VQIA 3MFYA 2XSCA 3K80C 2F0TA 1Q46A 4UDUC 1PTOH 4YIJA 1MBYA 2F3WA 1WTHA 3I72A 2E76C 4DK3C 3J81i 4AIMA 2L5TA 1HXYD 2NVXH 5DLQE 2A68D 3GTOH 2R7ZB 4HAEA 1EZ6A 3JAME 1PFBA 4DR7L 3FHWA 1OXSC 1TS5A 1FL0A 3SEBA 4X64L 1A2UA 3G4SA 4KKUA 3A56A 4JI4L 1X3GA 1I4RA 3LWUA 4A3GB 4NW2A 3GTJB 1CM9A 1SJED 4H7BA 1L1OB 3EA6A 4FP5D 3S16B 4GS3A 4Q0FA 4C3JG 1TWHB 5JJKA 2M9VA 1B9NA 3MWYW 1YNJC 2JA7G 1Z6HA 1W2BA 1JE4A 2B2YC 2DGYA 1G91A 1J9OA 1UUPA 2QILA 4XIGS 1PFNA 3GTPB 2JP1A 2K5HA 1ZKOA 5J1ZA 2QEXA 1V1QA 4E6IA 2VW9A 2UXDQ 2A74C 5E1FA 2L55A 3DWAA 5C4JH 4C3IB 2F4VQ 5C3EH 4KD3A 1DXMA 1Z9FA 5LMNW 1K9MC 3KF8B 4RFBA 5CV7A 4Y7NB 2EYMA 3X3NA 2E2HH 3MXUA 2RHSB 1NY4A 2EDGA 3H0GB 4IQZA 4F88A 4JI7Q 1IBLQ 2XRSD 3UDIA 3TS2A 5KIXA 2VQEL 1MKHA 1CT1D 1UAPA 4H13C 4YCWA 5DAUA 4A3JB 1GUWA 4X3TA 1SN8A 4FNFA 3GTQH 1XMOL 1VQHA 1SROA 1KLUD 3F8TA 3AMUA 2JXMB 3J81j 4IOAA 4C2MB 3CCSA 4HMIA 1RD9D 4KJNA 1KTKA 2RHQB 5LMNL 4DV6L 3V96A 2IX3A 1K8OA 1X3EA 4IN3A 2NVTH 3H15A 2HCCA 3OMCA 2WAQB 3OYYA 1KC8C 1GHKA 3HEJA 1LTGD 2R92B 3M4PA 1SNPA 3EBEA 3K0YA 3VDYA 1K8MA 4JI8L 4LF8L 4A3MB 4DUZL 1ASYA 3NQTA 4F7XA 2MJ8A 3RNUA 1SDFA 1SE2A 1PYWD 4XTCS 3MZ5A 2A6HD 3MTSA 2E2JH 1XPUA 3W1GA 1Y69U 1I3QH 3EQLC 4NDXA 2IL8A 1AEXA 5CGKA 1UEBA 3P7JA 1H9SB 4DV0Q 3M3YB 4X3SA 4BBRB 4L5QA 2FINB 2Q2HA 2HQLA 2WKDA 1BO0A 1IW7C 1SE4A 1XTCD 3K7AH 5I2YA 2O5IC 4DR4L 1NNXA 1XMQQ 3PO2H 3NE5B 2CHBD 2EYOA 4JBJA 3HOYB 4HIMA 1LV9A 4FF4A 1VQGA 3S2HH 2A73B 3S17B 3BDOA 1B3QA 4TRDA 1LACA 2EYFA 1DOLA 1FJGQ 2B2TC 4FXGC 4TKOB 2NBFA 1N33L 1STNA 1EEFD 3KLRA 1KAAA 4ZKBB 2ZTDA 1SSOA 3I4MB 4CKCA 3HKZG 3AYHB 4WFN3 2Z4IA 1SMYD 1F77A 2F3IA 1XYIA 1CA5A 1AH9A 3K59A 2K5VA 5C3EG 2PI2E 1WCMB 2EOTA 1FGUA 1UWVA 4A3EG 1Q82C 4LF9Q 3M4OB 3R93A 4OO1I 2NVQB 5EGTA 4K2LA 2JA6B 2EZVA 1YJ9A 4FF2A 1STEA 1BOSA 3I4LA 1TWFH 2EJGC 2KBNA 1LTBD 2TSSA 4JC0A 2GVAA 1PTOD 4LF4Q 1FYCA 4X3UA 3HRZC 3C46A 1I94Q 2F0VA 4EQ5A 3HG9A 3CXCA 4K0KQ 2R7FA 3S2DB 4CGYB 4HSPA 3EJIA 1KNAA 2EVBA 1S5DD 2F0PA 5D3IB 1TR5A 4N9PA 4IUVA 3M85A 4KN7C 1KDAA 3I8ZA 3GTMB 2OQKA 3DEOA 3CPWA 3TDQA 3I4NH 5JJZA 3VYUA 4LFAL 4BBSG 3GDEA 1VQEA 3SDZA 4DKAC 3BS1A 1YIJA 1B3AA 2BDNA 1IZ6A 4PV1C 3ITPA 1K83B 1EY9A 1ZYRD 5K36H 3KF6B 1JB3A 2MNAA 3E3XA 1R4PB 4QCLA 4M1UB 4RCOA 4CJ1B 5M3FH 2XRQD 1SR3A 1U4RA 2I5LX 2I0QA 2GA4B 2WKCA 5JOBA 4GOPA 3HOUB 4YY3L 4LF7Q 3C1FA 2A68C 2K4KA 3CCUA 3PF5A 4RMFA 2SEBD 1LTSD 1BXTA 4RKLA 4B3TQ 4IOCA 2BH2A 2A5HA 1MIUA 3GTGB 2WP8J 2K28A 2NUCA 3MHBA 1CTMA 1T9HA 4PZ8A 1CHPD 4IJLA 2F0DA 2XIWA 5FLXc 1NR2A 1EY5A 2BH8A 2UXCL 2WIIB 4FF1A 1LO5D 1YHQA 2K52A 3PCOB 5JPMC 4IUNA 3KK7A 2JQOA 3F1ZA 1HR0W 1VQPA 1AFPA 4A75A 3PSIA 1ICFB 5C0XG 5IYDH 1STGA 3D4DA 1YZ6A 2WB1E 3EN2A 4QGUA 4GNXC 1HFNA 3NP8A 1Y1VB 2HUGA 1LT6D 3E0EA 2UUCQ 3I70A 2D2CC 1L0WA 1PFMA 3RZDH 3FEWX 1SFOB 1KNEA 4HSVA 3HOWH 3FPPA 1GO3E 2J4XA 4BY1H 1E1TA 3KFUA 5J22A 4B3ML 4JVZA 1FNWA 2B2VC 1EQQA 1WD1A 1EYAA 3I2ZA 3PF4A 2K33A 5CV8A 1JCKB 5DEHA 1VQJA 2XWBB 3CC2A 1GVPA 1TXYA 1CKNB 2IJ0A 2MHVA 2VB3X 3I73A 4C3HG 4B3SQ 4A3DH 4YCUA 5C44G 1A15A 1QWYA 4JI4Q 1GUGA 2AQ1B 2F0FA 3F2UA 5J39A 2JA5B 5H1SE 3JAML 1OTCA 2X69A 3UDXA 3GQBA 1TVXA 3KOJA 2UXDL 1BCPF 3EROA 1NTGA 4DAVA 3RUZA 5KNCA 1YJWA 4A3FG 4HIKA 1CQVA 4FXKC 2VUMH 1Z47A 1AW7A 3MVVA 2PMZE 3S1RB 3I55A 3M4YA 1Q1BA 4JI7L 5I9PA 3GTLH 3BVGA 3J80i 1ET9A 2PW5A 3NBIA 4DV5Q 4G7ZC 2R7ZG 2Q8TA 1YEZA 3PO3G 1F9RA 1TWCB 1EY0A 1VF7A 2A6HC 1YNND 4LF5L 5M5XH 1XWEA 2DNCA 1PYSB 2EXZA 5K36G 2MFIA 4G4KA 4HEDA 1LT4D 2OQ0A 5C5LA 1WTQA 4NXNQ 4OIKA 1RJTA 2K05A 4RWSC 5G3LF 1QVCA 1Q8KA 3CD6A 1XMOQ 1O7IA 2ZJQA 5FLMH 1RTOA 3UE0A 1HCZA 4MHEA 4KHZA 2K50A 3DXJC 1XXGA 3CW2C 2D5DA 1DYQA 5LMNQ 3S9WA 4GNXA 3ULJA 3V2TA 4TSSA 2EXDA 4DUYQ 1EQVA 2HHHL 4QIWE 5IYDG 3RR5A 3AQQA 3E0JA 1AZQA 3UDFA 4L5RC 1VMPA 2DY7A 4JI8Q 4LF8Q 3I91A 2F0QA 1SMYC 2N3SA 1X55A 4OONA 2N55A 4S3SA 1LTRD 2LY7A 2R93G 4DV0L 4BY7H 4DXFA 3IKJA 1A3TA 2F0LA 5C4XB 3BVZA 1VQ7A 2HD3A 4CJ2C 4BY1G 3WOEA 3HFZB 4EQNA 4A3KH 2RDHA 5EAYA 2Z9HA 4IZ8A 1XMQL 2XN9C 1NR4A 5FK9C 1Q7YC 1PTOC 4LW1A 1K0RA 3U58A 1QUQB 2EPBA 1R9TB 3BDLA 4J6HA 4DR6Q 4ILWA 4DR4Q 1OXVA 2WAQG 1FJGL 2K5DA 1ESRA 3K5LA 4A3DG 2N8NA 1HZ9A 1IYVA 1F2ZA 1YHAA 4ODGA 4KN4C 2E5LL 4A3BB 3RN5A 4NXMQ 3N6RA 5FO9B 2E2HB 2LXKA 2QDLA 4Y52H 4R9WA 2C9OA 2WACA 4QUCA 2VQFQ 4EQPA 4KY7A 5FLXE
chains in the Genus database with same CATH topology
3SK4A 3J7AV 2Y0SB 2SOBA 5E4XA 1WTOA 4XDXA 1ZYRC 2EY5A 5EKKA 3J7YW 4C1NK 1AZPA 1B50A 4QB4A 3W3AA 1ENFA 3ND8A 2F0JA 1HPCA 1Q8IA 3QOLA 1IW7D 1OXXK 1TY0A 4EVOA 2NVTB 2JE6I 3VR3A 3W2DA 4K5XA 2E74C 1GUTA 1NSNS 2F0WA 1HHVA 1SE3A 1PDQA 2EYLA 3UI2A 1F2YA 2E2JB 4L8JA 3TP5A 3OOCA 3GTKB 3OW7A 2Q8RE 1IL8A 2OF1A 2RA4A 3D6CA 1B4OA 3DWPA 1TQOA 2B8GA 3QOJA 3TMEA 3K7AB 4DK0A 3QB3A 2JEAI 4RGOS 3PO2B 3TN2A 1NCVA 3NWSA 2PPBC 3S2HB 2NTTA 2FMMA 1D5XC 4K2KA 2K5WA 2QEJC 4RCNA 3OWEB 1B2TA 2EYHA 4IFDG 4BA2I 5HGTA 1IYUA 4L63B 4QMGA 1EWHA 4XT1B 2BDOA 3R8BA 1DZ1A 1CHQD 1O7YA 2RDGA 1IKLA 3VYSA 3C1EA 3D6WA 5I2XA 5KRUA 1JC7A 2FHTA 3VYTA 1EYDA 1YNNC 1QNUA 1GOZA 4DAYA 3S1MB 2J0TD 1SYBA 1OXTA 1V1PA 3S15B 2K7VA 2F0MA 3Q6SA 4CKBA 1ESFA 5FOBB 1FNVA 3FKIB 5KEEA 2KUMA 1FNUA 2E2DC 5IGCA 2B39A 2ID0A 4HTHA 4BWGB 4J1MA 2IPKD 2QF7A 5DNFA 2NZ1D 4NKLA 1L0YB 3DUZA 3HZXA 2BCOA 5EKLA 1SNDA 1MGSA 3TP6A 1AN8A 3MXGA 5D14A 1BCPD 5T1GA 2F0NA 4XYOA 3NTHA 1QJOA 3NBHA 3J80E 4QF4A 2IWHA 1BR9A 5M3MB 2EYPA 1BQQT 2F0KA 3NHHA 1CZWA 2L11A 2VNUD 3HOWB 3LX0A 1ML0D 3MFGA 4G57A 3FRPB 4PMBA 4R8IA 1OXUA 4KV6A 5DM63 1JWMD 1SYCA 3HS0C 3KUPA 2HDMA 5G3LD 1UNSA 2PZUA 1TS2A 1ET6A 3H91A 3MC0B 1I4QA 5ELFA 4EQOA 3QJYA 3NTIA 1GJXA 3H09A 2NN6G 3CRKC 1Y8PB 5C6AA 4L6TB 5C0XH 1HUMA 5IGBA 5DM73 2JSOA 2XNAC 1EU3A 1JR0D 3PMFA 1SBBB 2HCIA 4DXGA 2R6GA 5M5XB 3KBGA 1STHA 4K8JA 3A8KE 1D2BA 5C4HA 2G9DA 3A55A 4OGQC 2D62A 1GUNA 2E2IB 3SR1A 3K5OA 2WB1B 1TY2A 5KNDA 1RHPA 5FLXL 2KECA 1LTID 1V1OA 4IURA 1B9MA 1EOTA 2RSNA 4G7OC 5JEAG 1PRTD 4HMJA 1S5BD 1RCVD 3D4WA 3TSSA 2HQEA 1I4GA 2L4NA 2BE5D 4M8AA 3OHXC 2PNRC 4KY6A 5KGUA 1LLRD 5CV5A 3TP7A 2YU9B 1DOMA 1DCZA 1U4PA 3KF8A 4A3KB 1DM0B 4ZUIA 1JWSD 1E2VA 3X3MA 4TQUS 2F0SA 1BNZA 1LABA 3ZYYX 2PMZB 2KEDA 3HGBA 3SE0A 3NSWA 5F2DA 1CA6A 1F9SA 5T1IA 5CBEE 2EE1A 1WTRA 5IIFA 4ZLTF 1WVLA 5D3DA 4P2CB 5ELCA 1S5ED 5M5WB 3NWTA 1SXTA 5M5YB 4ABNA 5I6WA 1FD7D 1UEAB 2ZXPA 1ZEQX 1TKWB 4IUQA 4C3JB 2OT2A 2XWJB 2JA7B 3D4RA 1Q3LA 3IFTA 4CJ0B 1U4LA 2I07B 4QIWB 3T51B 1H9SA 4KHVA 1QCBD 1BCPC 2WINB 1C48A 3T53B 5TSSA 1I50B 5EBDA 4RGNA 3J81E 2K01A 2SNMA 3CHBD 3A8IE 5ELDA 1HA6A 4KKTA 3VA5A 2B2UA 3ERQA 3S1NB 3AB9A 3QIAA 3Q23A 1CFMA 1ZXTA 2PYKA 1FR3A 3K5NA 3GD7A 2VXWA 1JOKA 3NK9A 3Q0AA 3CQZB 1Y8NB 1RDPD 1F2LA 1D6EC 2F0GA 4HCSA 5ELBA 1HFGA 4KJOA 1C8CA 3DWQA 3OIQA 2ICEC 1R4QB 1HTLD 2MGSA 2KEEA 3IL8A 3PUYA 5CV9A 3R2TA 4RA8A 1TWAB 1EEID 4R8NA 2ZXOA 3ND9A 1EY8A 1GXDC 2B2WA 1PTOB 2NB0A 4C3IG 3TZUA 3FDTA 3J80L 2NVXB 2NN6I 1SNMA 2CQAA 5C0XJ 3GTOB 1PZID 1D5ZC 3BZDB 1AP0A 4K5VA 3QG1A 1HRJA 4B9WA 3I3CA 2Q8IB 1GUSA 2LFNA 1RODA 2X6GA 2ZT9C 1EFID 4AYBB 1JOQA 2F03A 1EWCA 1SNQA 1QILA 4ME5A 3RD4A 4IFDH 4DU9A 1RF2D 3IAYA 1TS4A 4F8MA 1BDOA 2L0CA 2AWNA 2K6AA 3HKZB 4V190 3OMGA 1PRTC 4KY5A 5C4JB 3DEPA 5C3EB 1U9RA 4PMCA 3VR2A 5COYA 1SAPA 3VR5A 1JQYD 3BYYB 2BE5C 3GP7A 2ENBA 3A54A 1QE6A 2R3ZA 4FF3A 3EVQA 4XYQA 3GV3A 3I90A 4IUTA 2LKVA 1ILPA 2PZWA 1HQMC 4DGZA 2L9HA 1CI3M 3GTQB 2IW3A 1PTOF 3PUVA 4LJZC 2FJ2A 3A8JE 1WTWA 4Q5VA 1BBXC 3KBXA 1I4XA 3BVMA 1A3UA 2O5JC 4BBSB 2IX0A 1DOKA 2F0UA 4K8IA 5E4WC 2CW0D 1STYA 5IGDA 5C3WA 5FO8B 3OIPA 2DNEA 5CBAE 3FPUB 1E2WA 5A2QE 1RTNA 1I6VC 5LL6X 4QUFA 1I3QB 2K04A 3OSOA 1HUNA 4K14A 1S5CD 2LMCB 2H1EA 4OO1G 5NUCA 4RH6A 4RHSA 3PIP3 3NXWA 3VYRA 5ISRA 1ONLA 1STAA 3SK8A 3SK5A 4HN7A 4KK7A 1H9JA 1G2TA 4KTAA 5C0XI 2EYJA 2BA1A 3D31A 3KLSX 4XQNA 5I4DA 3OPOA 1SNCA 4OIJA 4DA2A 1SYGA 4I65A 1SEBD 3G7LA 1JORA 2RDFA 2IX1A 2B8FA 4ZK9B 4LK1C 5EPJA 4IUPA 3D3RA 3PUXA 4XQJA 2ICIA 1EZ8A 3WOFA 1C4QA 3DMUA 1MSGA 4JK1C 5I6YA 1KLGD 3LNNA 1TWFB 4C3HB 5I9OA 3IFDA 2NN6H 5CR3A 3T13A 1O80A 4J8QA 1EYCA 3PUWA 4A3FB 2ZXRA 3AU7A 2HDLA 4LAAA 2EY2A 5HURA 5LL6S 1WTVA 1SNOA 3J7AF 5KYLA 3MXPA 3I4NB 2QDBA 2A69C 4K6LA 3PO3B 3SXHA 1Q1EA 2KQ3A 5FKAC 2H4OA 2Z1CA 3H94A 5M3FB 1F2MA 1E0BA 2PQEA 3J81L 3BDCA 1Q90A 2JYOA 3BG3A 2J7ZA 5JVG3 5JAVA 1XX8A 2E75C 3P20A 1W6JA 1CQFA 1L0XB 1OO9B 5JEAH 3K58A 1ENAA 5IODA 2KA7A 2CVRA 5EPKA 3GO5A 4ZKCB 5IGEA 4RHRA 3WDNA 3CKIB 3PV0A 4JBWA 4K5WA 2Z4HA 4MIUA 5CORA 4C1NI 1KDCA 5E3FA 1LT5D 1M8AA 2MP1A 2DN8A 3RZDB 2R93B 1EY4A 2AWOA 4IFDJ 4BY1B 3P75A 3RMHA 5IGFA 1QOHA 2PW7A 3T4AC 4XQQA 4X3KA 4WORA 1Z7TA 1GHJA 1ILQA 2RVLA 1HA5A 4A3DB 1QB5D 1JWUD 1TS3A 5D65A 2KVMA 2QKIC 3H6MA 5JPNC 3EFXD 1B1ZA 4FVMA 4GZYC 1TIID 2F0HA 3VA7A 1S5FD 4DK1A 3MAQA 2VUMB 2AUJD 2CW0C 3L7ZC 4KI0A 3GTLB 1PLFA 3C3LA 3K5MA 3MEHA 2F0IA 2RKSA 3K6OA 1TU2B 4DFAA 2XVSA 1W6KA 5BN4A 3NQIA 1GUOA 2SDFA 2B2YA 3TP8A 1A3VA 1G8ZD 3H3VC 4ZAIA 4NP5A 2A6ED 5IT9E 2K1BA 2AQ3B 2OXPA 2BA0A 2NWGA 4FXDA 3L3OC 3PIO3 3BYTB 5K5PA 4EGVA 1VMCA 5CC4A 4KMUC 2AUKA 3CRLC 3LWEA 1HQRD 4LMQD 1ICWA 3DHQA 1SJHD 3FMCA 3NPPA 1D5MC 2V4DA 2RBMA 4WJWA 2RQXA 2OEOA 3RLFA 4ID6A 2B2UC 2DY8A 4BY7B 4ZUJA 1KDBA 3T16A 4DAPA 1LT3D 4Z9CB 3RZOB 3N52A 1Q12A 2G9HD 2MUYA 4O42A 1D1IA 2PZTA 5A2QL 4G7HC 4RKBA 4IFDI 2O2LD 1B53A 1NAPA 3HOVB 3TZDA 1BUVT 2F4IA 2FFKB 1H9KA 3URYA 2WV6D 4CHTB 4ZYSA 4PQXA 1SYFA 1BF4A 5CMDA 4H0LC 1I6HB 1G2SA 2B2WC 1BCPB 1E2ZA 1MSHA 4H44C 2QCPX 4HCEA 3T56B 2PO4A 3M7GA 4KKSA 1X3QA 3HOXB 1X32A 4FYDA 1DJRD 4CBVA 3O13A 4HR7B 1QNKA 2IT1A 3SK6A 2LS01 3SVMA 2B2TA 3SHLA 2NYZD 1EY7A 1TT2A 5BN3A 2VB2X 1EU4A 5CYUA 4F87A 1I4HA 3D8GA 4XT3B 4DF7A 3S1QB 4OL7A 3MXNA 1S4ZA 1STBA 4FO2A 5EQ0A 4PNYA 1F9PA 5JEAJ 1O7ZA 3A7AB 1KABA 4DNTB 5FO7B 4B9XA 4RGMA 2JA8B 3U9SA 2KHSA 1WD0A 2R61A 4A93B 4OHJA 4PMWA 3K57A 5EJWA 1WTPA 4MN3A 1V8QA 1T5XD 2N88A 1MI2A 2BOSA 3TBIB 1EY6A 1O7LA 1H9RA 3QO2A 1ENCA 3Q22A 3NUCA 2F0EA 2EJMA 1FGBD 2B63B 4NMZA 2C5CA 1Y8OB 3M7NA 4ZQ3A 2A69D 5IGGA 4I7ZC 3R2IA 3V05A 2AQ2B 3GV6A 5KYIA 4U673 1B44D 1D1KA 1PZJD 4OO1H 1PRTB 3P1HA 2JEBI 1YNJD 1EIGA 3HP3A 1JICA 1VF5C 3MA2B 5BN5A 4BA1I 3VR6A 4B08A 3OWFA 1H9MA 2A6EC 1VCIA 1IKMA 2K03A 5LHY1 1A2TA 3QWNA 1CK1A 5C5MA 5M9OA 4KD4A 1DD2A 2B2VA 4C56C 1J8IA 4A3EB 1F9QA 1CZGA 3C2PA 1V1PB 2EJFC 2NVYB 1PXUA 1QG7A 2EY6A 5A35A 1U4MA 3KLSA 2KCCA 2F3VA 2Z8LA 2O4XA 1WTXA 4RGTA 1JOOA 2EY1A 5IOCA 1V43A 2F0OA 2NTSA 4N9TA 5C4ZA 5CV4A 1PRTF 1X3PA 1HTPA 1M4VA 4IUUA 2K5QA 5ELEA 5JVH3 4ZRZA 3FVQA 5EKIA 2X6LA 2L1BA 3NTKA 5KNBA 2KOLA 5EPLA 1EIHA 1SYEA 5IT9L 1SYDA 4XXEA 1A6XA 1EL0A 3DM1A 3E6ZX 2SNSA 4V0BA 1G6ZA 3HOZB 1RKNA 2M2LA 4A3IB 4UAIA 5EBCA 1PZKD 2L12A 1DONA 3A7LA 3PUZA 2TMPA 2KJXA 4DNRB 2K32A 4O1NA 4WRDA 3L9AX 1VDZA 4K6DA 1G291 1EQTA 3ONAB 1Y1WB 1NUCA 4DN4M 1MD2D 3G6JB 3U9OA 1II3A 2KCNA 1LTAD 4RAUC 4BS9A 5C3XA 2RSOA 4ULLA 3R3OA 1T5EA 1PMRA 2M00A 3VR4A 3Q24A 3CU7A 2D9UA 2I46A 1TWGB 2F1MA 5AFWA 2FMCA 3S14B 4CKEA 1I4PA 5C44B 1LTTD 1IHZA 1O78A 4U68A 2PCFB 3E5SA 4IALA 2MPMA 5CV6A 2YYZA 3MFYA 2XSCA 2F0TA 4UDUC 1PTOH 4YIJA 1MBYA 2F3WA 3I72A 2E76C 2L5TA 1HXYD 2A68D 2R7ZB 4HAEA 1EZ6A 3JAME 1PFBA 1OXSC 1TS5A 3SEBA 1A2UA 4KKUA 3A56A 3LWUA 1I4RA 4A3GB 4NW2A 3GTJB 1CM9A 1SJED 4H7BA 3EA6A 4FP5D 3S16B 4Q0FA 4C3JG 1TWHB 2M9VA 1B9NA 3MWYW 1YNJC 1Z6HA 1JE4A 2B2YC 1G91A 1J9OA 1UUPA 2QILA 4XIGS 1PFNA 3GTPB 2JP1A 1ZKOA 5J1ZA 4E6IA 2A74C 5E1FA 2L55A 3DWAA 4C3IB 4KD3A 1DXMA 4RFBA 5CV7A 4Y7NB 2EYMA 3X3NA 3MXUA 2EDGA 3H0GB 4IQZA 4F88A 2XRSD 5KIXA 1CT1D 1UAPA 4H13C 5DAUA 4A3JB 1GUWA 4X3TA 4FNFA 1KLUD 3AMUA 2JXMB 4C2MB 4HMIA 1RD9D 4KJNA 1KTKA 3V96A 2IX3A 1K8OA 4IN3A 2HCCA 3OMCA 2WAQB 1GHKA 3HEJA 1LTGD 2R92B 1SNPA 3K0YA 1K8MA 4A3MB 3NQTA 4F7XA 2MJ8A 1SDFA 1SE2A 1PYWD 4XTCS 3MZ5A 2A6HD 3MTSA 1Y69U 3EQLC 4NDXA 2IL8A 1AEXA 5CGKA 3P7JA 1H9SB 3M3YB 4X3SA 4BBRB 2FINB 2WKDA 1BO0A 1IW7C 1SE4A 1XTCD 5I2YA 2O5IC 3NE5B 2CHBD 2EYOA 3HOYB 1LV9A 4FF4A 2A73B 3S17B 3BDOA 4TRDA 1LACA 2EYFA 1DOLA 2B2TC 4FXGC 4TKOB 2NBFA 1STNA 1EEFD 3KLRA 1KAAA 4ZKBB 1SSOA 3I4MB 4CKCA 4WFN3 2Z4IA 1SMYD 1F77A 1CA5A 1XYIA 3K59A 1WCMB 2EOTA 3M4OB 3R93A 4OO1I 2NVQB 5EGTA 4K2LA 2JA6B 2EZVA 4FF2A 1STEA 1BOSA 3I4LA 2EJGC 1LTBD 2TSSA 1PTOD 1FYCA 4X3UA 3HRZC 3C46A 2F0VA 3HG9A 3S2DB 4CGYB 4HSPA 3EJIA 1KNAA 2EVBA 1S5DD 2F0PA 5D3IB 1TR5A 4N9PA 4IUVA 3M85A 4KN7C 1KDAA 3I8ZA 3GTMB 3DEOA 3TDQA 5JJZA 3VYUA 3SDZA 3BS1A 1B3AA 2BDNA 4PV1C 3ITPA 1K83B 1EY9A 1ZYRD 5K36H 1JB3A 1R4PB 4QCLA 4M1UB 4RCOA 4CJ1B 2XRQD 1U4RA 2GA4B 2WKCA 5JOBA 3HOUB 3C1FA 2A68C 2SEBD 1LTSD 1BXTA 4RKLA 2A5HA 3GTGB 2WP8J 2K28A 2NUCA 3MHBA 1CTMA 1CHPD 2F0DA 2XIWA 1NR2A 1EY5A 2WIIB 4FF1A 1LO5D 5JPMC 4IUNA 3KK7A 1AFPA 5C0XG 1STGA 3D4DA 1HFNA 3NP8A 1Y1VB 2HUGA 1LT6D 3I70A 2D2CC 1PFMA 3FEWX 1SFOB 1KNEA 4HSVA 3FPPA 2J4XA 5J22A 1FNWA 2B2VC 1WD1A 1EYAA 2K33A 5CV8A 1JCKB 5DEHA 2XWBB 2IJ0A 2MHVA 2VB3X 3I73A 4C3HG 1A15A 1QWYA 1GUGA 2AQ1B 2F0FA 3F2UA 5J39A 2JA5B 3JAML 2X69A 3GQBA 1TVXA 1BCPF 3EROA 4DAVA 3RUZA 5KNCA 1CQVA 4FXKC 1Z47A 1AW7A 3MVVA 3S1RB 3M4YA 1Q1BA 5I9PA 3BVGA 1ET9A 2PW5A 3NBIA 4G7ZC 2Q8TA 1F9RA 1TWCB 1EY0A 1VF7A 2A6HC 1YNND 1XWEA 2DNCA 5K36G 2EXZA 4G4KA 4HEDA 1LT4D 5C5LA 1WTQA 4OIKA 1RJTA 2K05A 4RWSC 5G3LF 1RTOA 1HCZA 4MHEA 4KHZA 3DXJC 1XXGA 2D5DA 1DYQA 3S9WA 3V2TA 4TSSA 1EQVA 3E0JA 1AZQA 1VMPA 2DY7A 3I91A 2F0QA 1SMYC 2N55A 4S3SA 1LTRD 2LY7A 4DXFA 3IKJA 1A3TA 2F0LA 5C4XB 3BVZA 4CJ2C 3WOEA 4EQNA 2RDHA 4IZ8A 2XN9C 1NR4A 5FK9C 1PTOC 2EPBA 1R9TB 3BDLA 4J6HA 4ILWA 1OXVA 2K5DA 1ESRA 3K5LA 1IYVA 1F2ZA 4ODGA 4KN4C 4A3BB 2E2HB 3N6RA 5FO9B 4R9WA 2C9OA 2WACA 4QUCA 4EQPA 4KY7A 5FLXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKL A;  1U4R A;  1QNK A;  2L11 A;  4ZAI A;  1EIG A;  3HP3 A;  1JIC A;  1ML0 D;  2K01 A;  2L4N A;  3P7J A;  2L12 A;  5E4X A;  1F9R A;  2Q8T A;  1DON A;  1WTO A;  4NW2 A;  2CVR A;  3D6W A;  4OIJ A;  4XDX A;  2B2T A;  1CM9 A;  2K1B A;  5EPK A;  4ZKC B;  4X3S A;  3DEP A;  2FIN B;  1BO0 A;  4R8I A;  2FHT A;  3G7L A;  2NWG A;  4HED A;  1HA6 A;  1AZP A;  4ZK9 B;  1B50 A;  5COY A;  3MWY W;  1SAP A;  5COR A;  2NYZ D;  1WTQ A;  3KUP A;  1IKM A;  2HDM A;  2B2U A;  2K28 A;  4OIK A;  5CBE E;  1RJT A;  1JE4 A;  2B2Y C;  2K05 A;  2XIW A;  1DOM A;  1LV9 A;  1NR2 A;  1J9O A;  1M8A A;  1VMC A;  2K03 A;  4RWS C;  1G91 A;  1QE6 A;  1U4P A;  2MP1 A;  2R3Z A;  1ZXT A;  1PFN A;  3H91 A;  3LWE A;  4IUP A;  5EPJ A;  2JP1 A;  4XT3 B;  3GV3 A;  3I90 A;  4IUT A;  1ICW A;  2VXW A;  4LMQ D;  1ILP A;  1RTO A;  1EQT A;  1DOL A;  2L9H A;  1S4Z A;  2B2T C;  3ONA B;  3Q6S A;  4MHE A;  1BNZ A;  1MSG A;  1F2L A;  5EQ0 A;  4DN4 M;  4HCS A;  1F9P A;  2B2V A;  1O7Z A;  4ZKB B;  4RAU C;  1J8I A;  1SSO A;  3IFD A;  1HFN A;  2FJ2 A;  1HFG A;  4X3K A;  1WTW A;  2RSO A;  1C8C A;  2HUG A;  2KUM A;  1BBX C;  1F9Q A;  2B2U C;  2DY8 A;  3KBX A;  1HHV A;  2KED A;  1PDQ A;  1PFM A;  1CA5 A;  1XYI A;  3UI2 A;  1ILQ A;  1WD0 A;  2RVL A;  1QG7 A;  1KNE A;  1HUM A;  1U4M A;  1O80 A;  2MGS A;  3N52 A;  2EOT A;  4HSV A;  2KEE A;  3R93 A;  5EJW A;  4O42 A;  1WTP A;  1AZQ A;  1CA6 A;  1F9S A;  3IL8 A;  5T1I A;  1WTX A;  1VMP A;  1IL8 A;  2D9U A;  2DY7 A;  2Q8R E;  2EE1 A;  2RA4 A;  4MN3 A;  2N88 A;  4RA8 A;  1WTR A;  1MI2 A;  1DOK A;  2HDL A;  3I91 A;  4X3T A;  1GUW A;  1B53 A;  5AFW A;  5D65 A;  2B2V C;  2N55 A;  5E4W C;  1B4O A;  4ZLT F;  1WVL A;  1WD1 A;  2KVM A;  1NAP A;  5DNF A;  2HCI A;  4X3U A;  2B2W A;  1WTV A;  2NZ1 D;  3QO2 A;  5CBA E;  3TZD A;  4CJ2 C;  3FPU B;  3TN2 A;  1RTN A;  3FDT A;  1MGS A;  4U68 A;  1X3P A;  1NR4 A;  1KNA A;  2FFK B;  4IUU A;  1NCV A;  1A15 A;  2HCC A;  2MPM A;  4QUF A;  4IUQ A;  2K04 A;  2EPB A;  3F2U A;  1HUN A;  5D14 A;  2FMM A;  4IUV A;  1AP0 A;  2X69 A;  5T1G A;  1BF4 A;  5EKI A;  1PLF A;  1TVX A;  5CMD A;  1G2S A;  2X6L A;  3I8Z A;  1HRJ A;  1E0B A;  1RHP A;  2H1E A;  2L1B A;  2B2W C;  3I3C A;  2KEC A;  3DEO A;  1B2T A;  5JJZ A;  1ESR A;  1Q3L A;  1ROD A;  2KOL A;  2MJ8 A;  1U4L A;  2JYO A;  2X6G A;  4IUR A;  1MSH A;  1SDF A;  5EPL A;  1EIH A;  1EOT A;  2RSN A;  3GV6 A;  1B3A A;  2BDN A;  3MTS A;  3DM1 A;  3SVM A;  1EL0 A;  2J7Z A;  1X3Q A;  4CJ0 B;  1X32 A;  2SDF A;  1DZ1 A;  4HAE A;  1G2T A;  1G6Z A;  4R9W A;  2B2Y A;  4XT1 B;  2IL8 A;  1XX8 A;  1PFB A;  4QUC A;  2M2L A;  4CJ1 B;  4UAI A;  1O7Y A; 
#chains in the Genus database with same CATH topology
 1I6H H;  3SK4 A;  3ZJY C;  3J7A V;  2Y0S B;  2SOB A;  5E4X A;  1WTO A;  4XDX A;  3J80 c;  1ZYR C;  1UE1 A;  2EY5 A;  5EKK A;  2CH4 A;  3J7Y W;  4C1N K;  3HOX H;  1AZP A;  1B50 A;  4QB4 A;  4POG A;  1FVI A;  4LF4 L;  2L15 A;  2Q2T A;  4BBR G;  4GKJ Q;  1PH2 A;  1I94 L;  4CDD C;  1KRS A;  3W3A A;  4P73 A;  1ENF A;  3ND8 A;  2F0J A;  1HPC A;  5AJ3 Q;  1Q8I A;  3QOL A;  1IW7 D;  1OXX K;  1TY0 A;  4EVO A;  2NVT B;  1EUJ A;  2JE6 I;  3VR3 A;  3W2D A;  4K5X A;  2QW7 A;  2E74 C;  1PH1 A;  1GUT A;  1VQD A;  1NSN S;  2F0W A;  2R7D A;  4ZCK A;  2DUD A;  1HHV A;  1SE3 A;  1PDQ A;  5FLM G;  2EYL A;  3UI2 A;  4AYB E;  3Q8D A;  1I50 H;  1F2Y A;  1WYD A;  2IHE A;  3L2P A;  1VQL A;  2E2J B;  4L8J A;  3TP5 A;  3OOC A;  4YWL A;  3GTK B;  3OW7 A;  2Q8R E;  1IL8 A;  5LMU Q;  2OF1 A;  2RA4 A;  3D6C A;  4O2D A;  4X66 L;  1B4O A;  3DWP A;  1TQO A;  1P16 A;  2JA6 G;  1HH2 P;  4LF7 L;  2B8G A;  3HKZ E;  3QOJ A;  3TME A;  3K7A B;  4DK0 A;  3QB3 A;  2JEA I;  1QVF A;  4RGO S;  3PO2 B;  3TN2 A;  2AMC B;  4GLV B;  1B70 B;  1NCV A;  3NWS A;  2PPB C;  4BY7 G;  3S2H B;  2NTT A;  2FMM A;  1D5X C;  1U0L A;  4K2K A;  2K5W A;  2QEJ C;  4JOI A;  4RCN A;  1X6O A;  3OWE B;  1B2T A;  2EYH A;  4IFD G;  2ZJR A;  1SE8 A;  3T1H Q;  4BA2 I;  4L5S A;  2UXC Q;  5HGT A;  4OWX B;  1IYU A;  1PH7 A;  4L63 B;  2B63 H;  4QMG A;  1EWH A;  3HOV G;  2UUC L;  4XT1 B;  1AE3 A;  2BDO A;  3R8B A;  1DZ1 A;  1CHQ D;  1O7Y A;  2RDG A;  1IKL A;  3VYS A;  4UY8 C;  4IO9 A;  3C1E A;  3D6W A;  5I2X A;  1KD1 C;  4CDC C;  5KRU A;  1JC7 A;  3ULL A;  2FHT A;  3VYT A;  5L37 A;  1G51 A;  1EYD A;  1YNN C;  1QNU A;  1YVC A;  1GOZ A;  4DAY A;  1N9W A;  1I5F A;  3S1M B;  1VQO A;  2J0T D;  4B3M Q;  4B3S L;  1SYB A;  3HOX G;  1OXT A;  1V1P A;  3S15 B;  2K7V A;  2F0M A;  3Q6S A;  2VL6 A;  4CKB A;  1ESF A;  5FOB B;  4IPD A;  1FNV A;  3FKI B;  5KEE A;  1ASZ A;  4JYA L;  2KUM A;  3KJO A;  4QJF A;  1FNU A;  2E2D C;  2A8V A;  5IGC A;  2B39 A;  2ID0 A;  4HTH A;  4BWG B;  4J1M A;  4GLX A;  3M9B A;  2IPK D;  2V1C C;  4A3E H;  2QF7 A;  4DV5 L;  2DJF C;  1PYB A;  5DNF A;  3KDF B;  2LSS A;  2NZ1 D;  2NVY H;  4NKL A;  1L0Y B;  3DUZ A;  3HZX A;  3J7A 5;  2BCO A;  1K3R A;  1NJI C;  2RCN A;  4UP9 A;  5EKL A;  1SND A;  1MGS A;  3TP6 A;  4IPC A;  4NXN L;  1N36 Q;  2JA8 G;  1AN8 A;  1D7Q A;  3FP9 A;  4LF5 Q;  3MXG A;  5D14 A;  4DK6 C;  1BCP D;  5T1G A;  2KCM A;  1KRT A;  4A93 G;  2F0N A;  3ULP A;  4XYO A;  3NTH A;  1QJO A;  3NBH A;  3J80 E;  4QF4 A;  2IWH A;  1XPR A;  1YI2 A;  1BR9 A;  5M3M B;  2EYP A;  1BQQ T;  1B8A A;  4BBS H;  2F0K A;  3NHH A;  4DUY L;  1CZW A;  2L11 A;  2VNU D;  3HOW B;  3LX0 A;  1ML0 D;  4L5T A;  4GLA C;  3MFG A;  4G57 A;  4WJ4 A;  2YTY A;  3FRP B;  4PMB A;  2B63 G;  4R8I A;  2JJQ A;  1OXU A;  4KV6 A;  5IYB H;  2HHH Q;  5DM6 3;  3HS0 C;  1JWM D;  1AE2 A;  1SYC A;  2VZA A;  3KUP A;  2HDM A;  5G3L D;  1UNS A;  2PZU A;  1TS2 A;  3J81 c;  3CCR A;  1ET6 A;  3H91 A;  3MC0 B;  1I4Q A;  2MO0 A;  5ELF A;  4EQO A;  1LM0 A;  4GOP C;  3QJY A;  4JI2 Q;  3DM3 A;  3NTI A;  1GJX A;  3H09 A;  2NN6 G;  1VQB A;  3CRK C;  4JW0 A;  1Y8P B;  3G6E A;  2OWO A;  5C6A A;  4L6T B;  3MXN B;  4OWT B;  5C0X H;  1HUM A;  1SLJ A;  5IGB A;  1BBU A;  4NXM L;  5DM7 3;  2ZTE A;  1Y1W H;  2I5H A;  2JSO A;  2XNA C;  1EU3 A;  4LUV A;  1GD7 A;  2VQF L;  1JR0 D;  3PMF A;  2CWA A;  4OWW B;  1SBB B;  2HCI A;  4DXG A;  2R6G A;  2JA9 A;  5M5X B;  1VQK A;  2E5L Q;  3CF5 A;  3KBG A;  2B29 A;  1STH A;  4K8J A;  3A8K E;  5JJL A;  1D2B A;  5C4H A;  2G9D A;  2Z6K A;  3A55 A;  4GN5 A;  2Z0S A;  4OGQ C;  1IBK L;  4GKJ L;  2D62 A;  2OCE A;  1TWG H;  4LNQ A;  1GUN A;  1W3S A;  2E2I B;  4YHH Q;  3SR1 A;  3K5O A;  2WB1 B;  1BBW A;  5IP9 H;  1TY2 A;  5AJ3 L;  1PH5 A;  5KND A;  1RHP A;  4C3H H;  1E24 A;  5FLX L;  1PFS A;  2KEC A;  5C44 H;  1LTI D;  1V1O A;  4IUR A;  1IL2 A;  1B9M A;  1EOT A;  2RSN A;  4CDE C;  4DV1 L;  4G7O C;  5JEA G;  1PRT D;  4HMJ A;  1HNX Q;  1U5K A;  1L1O A;  1S5B D;  1RCV D;  2DJG C;  3CMA A;  3D4W A;  4A3F H;  5IY0 A;  3TSS A;  2HQE A;  1I4G A;  2L4N A;  2BE5 D;  4M8A A;  3OHX C;  2PNR C;  4KY6 A;  5LMU L;  5KGU A;  1LLR D;  5CV5 A;  1UE6 A;  1BKB A;  4ALP A;  1VS0 A;  2R7Z H;  3CME A;  3PO3 H;  3TP7 A;  4N8X 1;  2YU9 B;  1DOM A;  2ZM6 L;  1DCZ A;  1U4P A;  3KF8 A;  4A3K B;  2UUB Q;  1DM0 B;  4ZUI A;  4X65 Q;  4X66 Q;  4A3G H;  1JWS D;  1E2V A;  3GTJ H;  4GNX B;  1VQM A;  3X3M A;  4TQU S;  5IYB G;  2F0S A;  1BNZ A;  1HNZ Q;  3HOZ G;  1LAB A;  4A3I G;  2OTL A;  3ZYY X;  1IXR A;  1HZC A;  1YHB A;  2PMZ B;  3CP0 A;  1X9N A;  2CCZ A;  2KED A;  4P72 A;  3HGB A;  3SE0 A;  3T1H L;  1WFQ A;  3NSW A;  5F2D A;  4C3I H;  1CA6 A;  1VQF A;  1F9S A;  5T1I A;  3SGI A;  5CBE E;  2EE1 A;  1WTR A;  4X62 L;  5IIF A;  3CCE A;  4JI1 L;  4ZLT F;  1WVL A;  4Y7N H;  2HIX A;  4ME3 A;  4PZ7 A;  4OX9 Q;  3H0G H;  2MO1 A;  1H95 A;  1VQ5 A;  5D3D A;  2D0P A;  2KEN A;  4P2C B;  1Y1W G;  4APV A;  1M90 C;  2PQA B;  5ELC A;  1S5E D;  5M5W B;  1PA6 A;  3NWT A;  1SXT A;  5M5Y B;  4ABN A;  4YWK A;  2R93 H;  2K14 A;  5I6W A;  1FD7 D;  1UEA B;  2ZXP A;  4A3J H;  4POF A;  1ZEQ X;  1TKW B;  1J5E Q;  4IUQ A;  2YTX A;  4C3J B;  2OT2 A;  3W1B A;  2XWJ B;  1PHJ A;  4C2M H;  2JA7 B;  3D4R A;  3IRB A;  4JI5 L;  1Q3L A;  3IFT A;  4CJ0 B;  1HR0 L;  1U4L A;  2UXB Q;  2K75 A;  2I07 B;  4QIW B;  1XTD A;  3T51 B;  1A62 A;  1H9S A;  4KHV A;  1QCB D;  4UP8 A;  1BCP C;  2WIN B;  5IP9 G;  1HZB A;  2R92 H;  1E1O A;  1C48 A;  3T53 B;  4DV7 Q;  1I50 B;  5TSS A;  3U4V A;  3OTO Q;  3MEF A;  4DPG A;  5EBD A;  4RGN A;  4P71 A;  2K01 A;  3J81 E;  4A3M H;  2SNM A;  4I7A A;  4MZ9 A;  4LF6 Q;  4JYA Q;  3CHB D;  3A8I E;  3H3V H;  4JI3 Q;  5ELD A;  1VQ9 A;  1HA6 A;  4AH6 A;  4KKT A;  3VA5 A;  4JBM A;  1SRU A;  2B2U A;  3ERQ A;  3S1N B;  3AB9 A;  3QIA A;  3Q23 A;  1CFM A;  1ZXT A;  2PYK A;  1FR3 A;  3K5N A;  2NZO A;  3GD7 A;  2VXW A;  1JOK A;  3NK9 A;  3Q0A A;  4LUO A;  3CQZ B;  4DV2 L;  3M3Y H;  1KAW A;  4BBR H;  1Y8N B;  1RDP D;  1N36 L;  1JMC A;  1F2L A;  1D6E C;  2F0G A;  4HCS A;  5ELB A;  4A3L H;  1HFG A;  4KJO A;  1WOC A;  1C8C A;  3DWQ A;  4A3G G;  3OIQ A;  1VQA A;  1XNR L;  2ICE C;  1R4Q B;  4H02 A;  3S17 H;  4AQY Q;  3KLW A;  1HTL D;  2MGS A;  3E9I A;  2KEE A;  3CAM A;  3K7U C;  3IL8 A;  5E7N A;  3PUY A;  5CV9 A;  3HKS A;  3CC7 A;  3R2T A;  4RA8 A;  1TWA B;  1EEI D;  2E8G A;  1VQ8 A;  4R8N A;  2ZXO A;  3ND9 A;  1EY8 A;  1GXD C;  2B2W A;  2WFW A;  1HNW L;  1PTO B;  2NB0 A;  4C3I G;  3TZU A;  4HID A;  1WCM H;  1E7Z A;  3M4O H;  1QZH A;  3NEN A;  3FDT A;  3J80 L;  1NMF A;  2JA6 H;  2NVX B;  2NN6 I;  1SNM A;  4B3R L;  2CQA A;  1EQR A;  5C0X J;  3GTO B;  4PZ6 A;  3H0G G;  1PZI D;  1D5Z C;  3BZD B;  1AP0 A;  4K5V A;  2C35 B;  3QG1 A;  1HRJ A;  4B9W A;  4JI2 L;  3I3C A;  5GQO A;  4KHP Q;  2Q8I B;  3RLN A;  1GUS A;  2LFN A;  1ROD A;  4P75 A;  2X6G A;  2ZT9 C;  4A3J G;  1EFI D;  4AYB B;  1JOQ A;  2F03 A;  5ELO A;  2LXJ A;  3RZO H;  3S2D H;  1EWC A;  2N78 A;  1K73 C;  1SNQ A;  1QIL A;  1MHW C;  4ME5 A;  3RD4 A;  4IFD H;  4DU9 A;  1RF2 D;  3IAY A;  4GN4 B;  3GTM H;  1X56 A;  1TS4 A;  4F8M A;  1BDO A;  2L0C A;  2AWN A;  2K6A A;  3HKZ B;  4V19 0;  3OMG A;  1PRT C;  4JOI C;  1N8R C;  4KY5 A;  3HOV H;  3TRZ A;  1X65 A;  5C4J B;  3DEP A;  3TEH B;  5C3E B;  1U9R A;  4DR3 Q;  4PMC A;  2R92 G;  1K28 A;  1K83 H;  3VR2 A;  1YIT A;  5COY A;  1SAP A;  3VR5 A;  1JQY D;  4JG2 A;  3BYY B;  2BE5 C;  3GP7 A;  2ENB A;  4A3M G;  4R4C A;  3A54 A;  1QE6 A;  2R3Z A;  5J3B A;  4FF3 A;  3EVQ A;  4XYQ A;  4HJ8 A;  3HOU H;  3GV3 A;  3I90 A;  4IUT A;  2LKV A;  1ILP A;  2PZW A;  2FXQ A;  1HQM C;  4DGZ A;  2L9H A;  1CI3 M;  4YHH L;  3GTQ B;  2IW3 A;  2UUA Q;  2JK8 A;  1PTO F;  3PUV A;  4LJZ C;  3GTG H;  2FJ2 A;  3A8J E;  1WTW A;  4Q5V A;  5IE8 A;  1BBX C;  3KBX A;  1I4X A;  1IBK Q;  3BVM A;  4DR5 Q;  2QA4 A;  1A3U A;  2EQS A;  4LFB L;  1B7Y B;  1HNX L;  2O5J C;  4BBS B;  4A3L G;  3HOY G;  2IX0 A;  1DOK A;  2EIF A;  2F0U A;  4K8I A;  3DLL A;  4JI6 L;  5E4W C;  4DV1 Q;  2CW0 D;  1STY A;  5IGD A;  5C3W A;  5FO8 B;  2Q2I A;  1JE5 A;  3OIP A;  2DNE A;  5CBA E;  1SFO H;  4X6A H;  1RL2 A;  4R4Q A;  3FPU B;  1E2W A;  5A2Q E;  1RTN A;  3S1Q H;  1I6V C;  3F2B A;  5LL6 X;  4R4O A;  3I4M G;  4NPS A;  4QUF A;  1I3Q B;  2K04 A;  3OSO A;  1HUN A;  4K14 A;  2UUB L;  1S5C D;  2LMC B;  4WJ3 M;  5GAG C;  3OW2 A;  4X65 L;  2UU9 L;  1WCM G;  2H1E A;  4OO1 G;  5NUC A;  2JA8 H;  1V9P A;  4RH6 A;  2N49 A;  4RHS A;  1HNZ L;  3PIP 3;  3NXW A;  3VYR A;  5ISR A;  3T1Y Q;  2ZM6 Q;  1ONL A;  4A93 H;  1STA A;  3SK8 A;  3SK5 A;  4HN7 A;  4KK7 A;  1H9J A;  1G2T A;  4KTA A;  2JA5 H;  5C0X I;  3TS0 A;  2EYJ A;  3B6Y A;  2BA1 A;  3D31 A;  3KLS X;  4XQN A;  5I4D A;  3OPO A;  4JCV E;  1XJV A;  1SNC A;  2AKW B;  1Q81 C;  4OIJ A;  4DA2 A;  1SYG A;  4I65 A;  1SEB D;  3ICE A;  3G7L A;  4OXP A;  2KHJ A;  1JOR A;  1JT8 A;  3S1R H;  2RDF A;  2IX1 A;  1X54 A;  4OX9 L;  2YV5 A;  2B8F A;  4ZK9 B;  2XGT A;  4LK1 C;  2HT1 A;  5EPJ A;  4IUP A;  3D3R A;  3PUX A;  4X62 Q;  3A5U A;  4XQJ A;  4JI1 Q;  2ICI A;  1EZ8 A;  3WOF A;  1C4Q A;  3DMU A;  1MSG A;  4JK1 C;  5I6Y A;  1J5E L;  1X3F A;  1KLG D;  3LNN A;  4IPG A;  1TWF B;  4RG1 A;  4C3H B;  4EX5 A;  5I9O A;  3IFD A;  2MQH A;  3QR8 A;  3HOU G;  4GKK Q;  4BXX H;  4TVA B;  2NN6 H;  5CR3 A;  4DV3 Q;  2UXB L;  3T13 A;  1IYJ B;  1O80 A;  4J8Q A;  5IWA L;  1EYC A;  1KIX A;  3PUW A;  1CUK A;  4A3F B;  2ZXR A;  3AU7 A;  2HDL A;  4LAA A;  4DV7 L;  4JI5 Q;  3CCL A;  3OTO L;  2EY2 A;  1HR0 Q;  5HUR A;  5LL6 S;  2KHI A;  1WTV A;  1QUQ A;  3STB C;  4LF6 L;  1SNO A;  3J7A F;  5KYL A;  3MXP A;  3I4N B;  2QDB A;  4YWM A;  2A69 C;  4JI3 L;  4K6L A;  3PO3 B;  3SXH A;  1PH8 A;  1Q1E A;  4IJH A;  2KQ3 A;  5FKA C;  5IYC H;  1Y1V G;  2H4O A;  2Z1C A;  3CCQ A;  3H94 A;  5M3F B;  4A3C G;  1F2M A;  3L0O A;  3J7Z C;  1E0B A;  5C4X H;  2PQE A;  2A1A A;  3J81 L;  1N32 Q;  3BDC A;  1C9O A;  1Q90 A;  2JYO A;  4LFC L;  1JJC B;  2Z6K C;  4JI0 L;  1E3P A;  3BG3 A;  2J7Z A;  5JVG 3;  4GN3 B;  5JAV A;  1GKH A;  3F2D A;  1Q86 C;  1C7Y A;  1XX8 A;  4DV2 Q;  2RF4 A;  1R9T H;  2E75 C;  3P20 A;  5BR8 L;  5FJ8 G;  1W6J A;  1CQF A;  4AQY L;  1L0X B;  1OO9 B;  5JEA H;  3K58 A;  1ENA A;  5IOD A;  2KA7 A;  2CVR A;  5EPK A;  3GO5 A;  4ZKC B;  5IGE A;  4RHR A;  2VS1 A;  3WDN A;  4A3B H;  3CKI B;  3PV0 A;  2JA5 G;  4JBW A;  1XNR Q;  4K5W A;  2Z4H A;  4MIU A;  1IBM L;  5COR A;  4C1N I;  3EIV A;  4YCV A;  4GOP B;  1L1O C;  1RIP A;  1KDC A;  5E3F A;  1LT5 D;  1M8A A;  2MP1 A;  2DN8 A;  4HJ7 A;  1DGS A;  3RZD B;  2R93 B;  2GN5 A;  3ER0 A;  3I7F A;  1EY4 A;  3RLO A;  2AHO B;  2AWO A;  2CH4 W;  4IFD J;  1HNW Q;  4BY1 B;  3P75 A;  3RMH A;  5IGF A;  1QOH A;  2PW7 A;  3T4A C;  4XQQ A;  4X3K A;  4WOR A;  1Z7T A;  1GHJ A;  4KHP L;  3HOZ H;  4B3R Q;  1G6P A;  1ILQ A;  2RVL A;  4A3I H;  2HIV A;  2CFM A;  4QY7 A;  1HA5 A;  1PH6 A;  4A3D B;  1QB5 D;  3LGJ A;  3CPF A;  4BXX G;  1UE5 A;  1JWU D;  1TS3 A;  5D65 A;  3PQI A;  3AEV A;  1SMX A;  2KVM A;  2QKI C;  1PVO A;  3H6M A;  5JPN C;  3EFX D;  1B1Z A;  4FVM A;  4GZY C;  2Q2U A;  1TII D;  1A0I A;  2F0H A;  3G48 A;  3H3V I;  4DR3 L;  3VA7 A;  1S5F D;  4DK1 A;  3MAQ A;  2VUM B;  1CKM A;  1YBY A;  3GTK H;  2AUJ D;  2CW0 C;  1EFW A;  1JB7 A;  1VQN A;  3L7Z C;  4N8F A;  4KI0 A;  1KL9 A;  2A19 A;  3GTL B;  1PLF A;  3C3L A;  1EIF A;  3K5M A;  3MEH A;  2F0I A;  2RKS A;  3K6O A;  1TU2 B;  1XNQ L;  3F2C A;  4DFA A;  2XVS A;  5IYC G;  1W6K A;  5BN4 A;  2UUA L;  3NQI A;  2NZH A;  1GUO A;  2SDF A;  2B2Y A;  4AYB G;  5C4X G;  4A4I A;  4J15 A;  3TP8 A;  1A3V A;  1G8Z D;  3H3V C;  4ZAI A;  4NP5 A;  2A6E D;  2RCF A;  3KJP A;  4DR5 L;  3S14 H;  5IT9 E;  4PG3 A;  2K1B A;  2AQ3 B;  2OXP A;  1MJE A;  4NB3 A;  4HJA A;  2BA0 A;  4LUZ A;  1LTL A;  2NWG A;  4FXD A;  4O0A A;  3L3O C;  4A76 A;  1EOV A;  3PIO 3;  3BYT B;  5K5P A;  4LFB Q;  4EGV A;  1VMC A;  5CC4 A;  4KMU C;  2AUK A;  3CRL C;  4DR1 L;  3LWE A;  1J6Q A;  1HQR D;  1XPO A;  4LMQ D;  1ICW A;  4JI6 Q;  4A3B G;  2KCT A;  3DHQ A;  1SJH D;  3FMC A;  4P74 A;  2WAQ E;  3NPP A;  1CSQ A;  1D5M C;  2V4D A;  2RBM A;  3PGZ A;  4WJW A;  2RQX A;  2OEO A;  3ERS X;  2Y0S G;  3PIP A;  3RLF A;  4ID6 A;  4R1J A;  2ALY B;  2B2U C;  2DY8 A;  3WWV A;  4ZUJ A;  4BY7 B;  1KDB A;  3T16 A;  4DAP A;  1LT3 D;  4Z9C B;  3S1M H;  3RZO B;  3T1Y L;  2H5X A;  3M4Q A;  5GAD C;  3KDF A;  3N52 A;  1Q12 A;  2G9H D;  2GVB A;  2JN4 A;  2MUY A;  4O42 A;  3S15 H;  1D1I A;  2UU9 Q;  2PZT A;  5A2Q L;  4G7H C;  4RKB A;  1YNX A;  4IFD I;  2O2L D;  3FKI H;  1B53 A;  3S16 H;  1A63 A;  5HY6 A;  1NAP A;  1TWH H;  3BZK A;  3HOV B;  3TZD A;  1BUV T;  1N34 Q;  3GTP H;  4DR2 L;  2F4I A;  2FFK B;  1H9K A;  3URY A;  2WV6 D;  1E22 A;  2PI2 A;  4CHT B;  4HJ9 A;  4FDB A;  4ZYS A;  4JV5 Q;  4PQX A;  1SYF A;  1BF4 A;  5CMD A;  4H0L C;  1S72 A;  3A5Z B;  1I6H B;  1G2S A;  2B2W C;  1BCP B;  1E2Z A;  2K5N A;  1MSH A;  4H44 C;  2QCP X;  4HCE A;  4UP7 A;  3T56 B;  2PO4 A;  3M7G A;  4KKS A;  1X3Q A;  3HOX B;  1X32 A;  4FYD A;  3CCV A;  4DV4 L;  4GKK L;  1DJR D;  4CBV A;  3O13 A;  1MJC A;  4HR7 B;  4MTN A;  4DV3 L;  1QNK A;  2IT1 A;  3SK6 A;  2LS0 1;  3SVM A;  3PO2 G;  1PV4 A;  1VQC A;  1PH3 A;  1P8L A;  2B2T A;  3JC6 6;  3JAM i;  4LWC A;  3SHL A;  4DAM A;  1K8G A;  1K8A C;  2ES2 A;  5M3M H;  2NYZ D;  3CCM A;  1EY7 A;  1TT2 A;  5IWA Q;  5BN3 A;  2VB2 X;  1VQ6 A;  1EU4 A;  1JJG A;  5CYU A;  4F87 A;  1I4H A;  3A74 A;  3D8G A;  4XT3 B;  4DF7 A;  3S1Q B;  4OL7 A;  4KLK A;  1CKO A;  3MXN A;  1L2F A;  1S4Z A;  1STB A;  4FO2 A;  5EQ0 A;  4PNY A;  1F9P A;  5JEA J;  1O7Z A;  3A7A B;  1KAB A;  3U50 C;  4DNT B;  5FO7 B;  4B9X A;  4RGM A;  2JA8 B;  3U9S A;  4DR7 Q;  1N32 L;  2KHS A;  4X64 Q;  1WD0 A;  2QGQ A;  1QVG A;  2R61 A;  4A93 B;  4OHJ A;  4PMW A;  4QL5 A;  3K57 A;  5EJW A;  1WTP A;  2G5D A;  1PH4 A;  2PNH A;  5GRO A;  4MN3 A;  1V8Q A;  1T5X D;  2XTI A;  2N88 A;  1MI2 A;  2BOS A;  3TBI B;  4LFC Q;  1UE7 A;  1EY6 A;  2ZTC A;  1O7L A;  2F4V L;  4JI0 Q;  1CSP A;  3G71 A;  1H9R A;  3QO2 A;  3I56 A;  3HOY H;  1ENC A;  3Q22 A;  5ELN A;  3NUC A;  2VY3 A;  5BR8 Q;  3FKI G;  2F0E A;  2F52 A;  2EJM A;  1KHI A;  1IBL L;  1FGB D;  3I4N G;  2B63 B;  3STB D;  4NMZ A;  2C5C A;  1Y8O B;  3M7N A;  4ZQ3 A;  2A69 D;  5IGG A;  4I7Z C;  3R2I A;  3V05 A;  3KYH C;  2AQ2 B;  1IBM Q;  3I4M H;  5M3F G;  3GV6 A;  3BU2 A;  5KYI A;  2VQE Q;  4U67 3;  1B44 D;  1D1K A;  1PZJ D;  1VQ4 A;  4OO1 H;  3TRE A;  2NVQ H;  4CDF C;  2E2I H;  1PRT B;  2ZJP A;  3P1H A;  2JEB I;  1YNJ D;  4DNI A;  5GAE C;  1EIG A;  1S3O A;  1JIC A;  3HP3 A;  1VF5 C;  1HJP A;  3MA2 B;  3KF6 A;  5BN5 A;  3CC4 A;  4DV6 Q;  4BA1 I;  3VR6 A;  4B08 A;  3OWF A;  3JAM c;  1H9M A;  2A6E C;  1YJN A;  1VCI A;  1IKM A;  1GM5 A;  3S24 A;  2IHF A;  2K03 A;  5LHY 1;  1A2T A;  1NE3 A;  3QWN A;  2P5Z X;  5HGQ A;  1WJJ A;  1CK1 A;  1EIY B;  4MNO A;  5C5M A;  5M9O A;  4DUZ Q;  5M3M G;  4KD4 A;  1DD2 A;  2B2V A;  4QQB X;  4C56 C;  4DAY B;  3HOW G;  5GAH C;  1J8I A;  4A3E B;  2YU9 H;  1F9Q A;  1CZG A;  1JJ2 A;  3C2P A;  1V1P B;  2EJF C;  2NVY B;  3CCJ A;  1PXU A;  1QG7 A;  2EY6 A;  5A35 A;  1U4M A;  3KLS A;  2KCC A;  3K81 C;  2F3V A;  2OTJ A;  2Z8L A;  2O4X A;  3RN2 A;  1WTX A;  4RGT A;  4UPA A;  2PQA A;  1JOO A;  2EY1 A;  1XNQ Q;  5IOC A;  1V43 A;  3AFQ A;  5JJI A;  2F0O A;  3NEL A;  1K0S A;  2NTS A;  5IP7 H;  2CQO A;  4N9T A;  5C4Z A;  3PIO A;  3K0X A;  1NBW A;  5CV4 A;  1PH9 A;  1WI5 A;  1PRT F;  1X3P A;  1HTP A;  1M4V A;  2B3G A;  4IUU A;  1N33 Q;  3D0F A;  4LF9 L;  2K5Q A;  1EYG A;  5ELE A;  5JVH 3;  3I4O A;  4ZRZ A;  4OEM B;  2VUM G;  1CKN A;  3FVQ A;  3K8A A;  5EKI A;  4HIO A;  2X6L A;  1A8V A;  2L1B A;  3NTK A;  5KNB A;  1Y1V H;  2KOL A;  5EPL A;  1LYL A;  1EIH A;  5M5W H;  1SYE A;  5IT9 L;  1HZA A;  1SYD A;  5M5Y H;  4XXE A;  4A3C H;  1A6X A;  1EL0 A;  3DM1 A;  3E6Z X;  4DR1 Q;  2SNS A;  4V0B A;  3NEM A;  4HJ5 A;  3HOZ B;  1G6Z A;  1KXL A;  4C3J H;  3AFP A;  1RKN A;  4K0K L;  4IPH A;  2M2L A;  4A3I B;  1S40 A;  4UAI A;  5EBC A;  3NBH B;  2JA7 H;  1PZK D;  3W5O A;  2L12 A;  1DON A;  3A7L A;  3PUZ A;  1D8L A;  2TMP A;  3U4Z A;  5FJ8 H;  2KJX A;  4DNR B;  2WB1 G;  2IY5 B;  1EWI A;  2K32 A;  4O1N A;  4WRD A;  4JBK A;  3UE1 A;  1QZG A;  2I5M X;  1VDZ A;  3L9A X;  1N34 L;  4K6D A;  1LUZ A;  1G29 1;  2CKZ B;  1EQT A;  4LFA Q;  3ONA B;  1Y1W B;  1NUC A;  1M1K C;  1Y14 B;  4R4T A;  4DN4 M;  1MD2 D;  3G6J B;  3BZC A;  3U9O A;  1KQS A;  4R4I A;  1II3 A;  2ATW A;  4JV5 L;  1K3B C;  1LTA D;  2KCN A;  4RAU C;  4BS9 A;  3S1N H;  5C3X A;  2RSO A;  2Z6B A;  2YTV A;  4ULL A;  4DR2 Q;  3R3O A;  1T5E A;  4B3T L;  1PMR A;  2M00 A;  3CQZ H;  4YY3 Q;  4DR6 L;  3VR4 A;  3TQY A;  5IT9 c;  1TWC H;  3BJU A;  3CU7 A;  3Q24 A;  2D9U A;  2I46 A;  1C0A A;  1TWG B;  2F1M A;  5AFW A;  4A3K G;  2CWP A;  2FMC A;  3A0J A;  3S14 B;  2Y0S E;  3E9H A;  4CKE A;  2D0O A;  4OEL B;  1I4P A;  4DV4 Q;  5C44 B;  1BVS A;  2ASB A;  4UHV A;  1LTT D;  1IHZ A;  1O78 A;  4U68 A;  1NMG A;  1TWA H;  2PCF B;  3E5S A;  4IAL A;  2MPM A;  4JPB W;  5CV6 A;  2YYZ A;  4MTK A;  3UDG A;  5IP7 G;  1VQI A;  3MFY A;  2XSC A;  3K80 C;  2F0T A;  1Q46 A;  4UDU C;  1PTO H;  4YIJ A;  1MBY A;  2F3W A;  1WTH A;  3I72 A;  2E76 C;  4DK3 C;  3J81 i;  4AIM A;  2L5T A;  1HXY D;  2NVX H;  5DLQ E;  2A68 D;  3GTO H;  2R7Z B;  4HAE A;  1EZ6 A;  3JAM E;  1PFB A;  4DR7 L;  3FHW A;  1OXS C;  1TS5 A;  1FL0 A;  3SEB A;  4X64 L;  1A2U A;  3G4S A;  4KKU A;  3A56 A;  4JI4 L;  1X3G A;  1I4R A;  3LWU A;  4A3G B;  4NW2 A;  3GTJ B;  1CM9 A;  1SJE D;  4H7B A;  1L1O B;  3EA6 A;  4FP5 D;  3S16 B;  4GS3 A;  4Q0F A;  4C3J G;  1TWH B;  5JJK A;  2M9V A;  1B9N A;  3MWY W;  1YNJ C;  2JA7 G;  1Z6H A;  1W2B A;  1JE4 A;  2B2Y C;  2DGY A;  1G91 A;  1J9O A;  1UUP A;  2QIL A;  4XIG S;  1PFN A;  3GTP B;  2JP1 A;  2K5H A;  1ZKO A;  5J1Z A;  2QEX A;  1V1Q A;  4E6I A;  2VW9 A;  2UXD Q;  2A74 C;  5E1F A;  2L55 A;  3DWA A;  5C4J H;  4C3I B;  2F4V Q;  5C3E H;  4KD3 A;  1DXM A;  1Z9F A;  5LMN W;  1K9M C;  3KF8 B;  4RFB A;  5CV7 A;  4Y7N B;  2EYM A;  3X3N A;  2E2H H;  3MXU A;  2RHS B;  1NY4 A;  2EDG A;  3H0G B;  4IQZ A;  4F88 A;  4JI7 Q;  1IBL Q;  2XRS D;  3UDI A;  3TS2 A;  5KIX A;  2VQE L;  1MKH A;  1CT1 D;  1UAP A;  4H13 C;  4YCW A;  5DAU A;  4A3J B;  1GUW A;  4X3T A;  1SN8 A;  4FNF A;  3GTQ H;  1XMO L;  1VQH A;  1SRO A;  1KLU D;  3F8T A;  3AMU A;  2JXM B;  3J81 j;  4IOA A;  4C2M B;  3CCS A;  4HMI A;  1RD9 D;  4KJN A;  1KTK A;  2RHQ B;  5LMN L;  4DV6 L;  3V96 A;  2IX3 A;  1K8O A;  1X3E A;  4IN3 A;  2NVT H;  3H15 A;  2HCC A;  3OMC A;  2WAQ B;  3OYY A;  1KC8 C;  1GHK A;  3HEJ A;  1LTG D;  2R92 B;  3M4P A;  1SNP A;  3EBE A;  3K0Y A;  3VDY A;  1K8M A;  4JI8 L;  4LF8 L;  4A3M B;  4DUZ L;  1ASY A;  3NQT A;  4F7X A;  2MJ8 A;  3RNU A;  1SDF A;  1SE2 A;  1PYW D;  4XTC S;  3MZ5 A;  2A6H D;  3MTS A;  2E2J H;  1XPU A;  3W1G A;  1Y69 U;  1I3Q H;  3EQL C;  4NDX A;  2IL8 A;  1AEX A;  5CGK A;  1UEB A;  3P7J A;  1H9S B;  4DV0 Q;  3M3Y B;  4X3S A;  4BBR B;  4L5Q A;  2FIN B;  2Q2H A;  2HQL A;  2WKD A;  1BO0 A;  1IW7 C;  1SE4 A;  1XTC D;  3K7A H;  5I2Y A;  2O5I C;  4DR4 L;  1NNX A;  1XMQ Q;  3PO2 H;  3NE5 B;  2CHB D;  2EYO A;  4JBJ A;  3HOY B;  4HIM A;  1LV9 A;  4FF4 A;  1VQG A;  3S2H H;  2A73 B;  3S17 B;  3BDO A;  1B3Q A;  4TRD A;  1LAC A;  2EYF A;  1DOL A;  1FJG Q;  2B2T C;  4FXG C;  4TKO B;  2NBF A;  1N33 L;  1STN A;  1EEF D;  3KLR A;  1KAA A;  4ZKB B;  2ZTD A;  1SSO A;  3I4M B;  4CKC A;  3HKZ G;  3AYH B;  4WFN 3;  2Z4I A;  1SMY D;  1F77 A;  2F3I A;  1XYI A;  1CA5 A;  1AH9 A;  3K59 A;  2K5V A;  5C3E G;  2PI2 E;  1WCM B;  2EOT A;  1FGU A;  1UWV A;  4A3E G;  1Q82 C;  4LF9 Q;  3M4O B;  3R93 A;  4OO1 I;  2NVQ B;  5EGT A;  4K2L A;  2JA6 B;  2EZV A;  1YJ9 A;  4FF2 A;  1STE A;  1BOS A;  3I4L A;  1TWF H;  2EJG C;  2KBN A;  1LTB D;  2TSS A;  4JC0 A;  2GVA A;  1PTO D;  4LF4 Q;  1FYC A;  4X3U A;  3HRZ C;  3C46 A;  1I94 Q;  2F0V A;  4EQ5 A;  3HG9 A;  3CXC A;  4K0K Q;  2R7F A;  3S2D B;  4CGY B;  4HSP A;  3EJI A;  1KNA A;  2EVB A;  1S5D D;  2F0P A;  5D3I B;  1TR5 A;  4N9P A;  4IUV A;  3M85 A;  4KN7 C;  1KDA A;  3I8Z A;  3GTM B;  2OQK A;  3DEO A;  3CPW A;  3TDQ A;  3I4N H;  5JJZ A;  3VYU A;  4LFA L;  4BBS G;  3GDE A;  1VQE A;  3SDZ A;  4DKA C;  3BS1 A;  1YIJ A;  1B3A A;  2BDN A;  1IZ6 A;  4PV1 C;  3ITP A;  1K83 B;  1EY9 A;  1ZYR D;  5K36 H;  3KF6 B;  1JB3 A;  2MNA A;  3E3X A;  1R4P B;  4QCL A;  4M1U B;  4RCO A;  4CJ1 B;  5M3F H;  2XRQ D;  1SR3 A;  1U4R A;  2I5L X;  2I0Q A;  2GA4 B;  2WKC A;  5JOB A;  4GOP A;  3HOU B;  4YY3 L;  4LF7 Q;  3C1F A;  2A68 C;  2K4K A;  3CCU A;  3PF5 A;  4RMF A;  2SEB D;  1LTS D;  1BXT A;  4RKL A;  4B3T Q;  4IOC A;  2BH2 A;  2A5H A;  1MIU A;  3GTG B;  2WP8 J;  2K28 A;  2NUC A;  3MHB A;  1CTM A;  1T9H A;  4PZ8 A;  1CHP D;  4IJL A;  2F0D A;  2XIW A;  5FLX c;  1NR2 A;  1EY5 A;  2BH8 A;  2UXC L;  2WII B;  4FF1 A;  1LO5 D;  1YHQ A;  2K52 A;  3PCO B;  5JPM C;  4IUN A;  3KK7 A;  2JQO A;  3F1Z A;  1HR0 W;  1VQP A;  1AFP A;  4A75 A;  3PSI A;  1ICF B;  5C0X G;  5IYD H;  1STG A;  3D4D A;  1YZ6 A;  2WB1 E;  3EN2 A;  4QGU A;  4GNX C;  1HFN A;  3NP8 A;  1Y1V B;  2HUG A;  1LT6 D;  3E0E A;  2UUC Q;  3I70 A;  2D2C C;  1L0W A;  1PFM A;  3RZD H;  3FEW X;  1SFO B;  1KNE A;  4HSV A;  3HOW H;  3FPP A;  1GO3 E;  2J4X A;  4BY1 H;  1E1T A;  3KFU A;  5J22 A;  4B3M L;  4JVZ A;  1FNW A;  2B2V C;  1EQQ A;  1WD1 A;  1EYA A;  3I2Z A;  3PF4 A;  2K33 A;  5CV8 A;  1JCK B;  5DEH A;  1VQJ A;  2XWB B;  3CC2 A;  1GVP A;  1TXY A;  1CKN B;  2IJ0 A;  2MHV A;  2VB3 X;  3I73 A;  4C3H G;  4B3S Q;  4A3D H;  4YCU A;  5C44 G;  1A15 A;  1QWY A;  4JI4 Q;  1GUG A;  2AQ1 B;  2F0F A;  3F2U A;  5J39 A;  2JA5 B;  5H1S E;  3JAM L;  1OTC A;  2X69 A;  3UDX A;  3GQB A;  1TVX A;  3KOJ A;  2UXD L;  1BCP F;  3ERO A;  1NTG A;  4DAV A;  3RUZ A;  5KNC A;  1YJW A;  4A3F G;  4HIK A;  1CQV A;  4FXK C;  2VUM H;  1Z47 A;  1AW7 A;  3MVV A;  2PMZ E;  3S1R B;  3I55 A;  3M4Y A;  1Q1B A;  4JI7 L;  5I9P A;  3GTL H;  3BVG A;  3J80 i;  1ET9 A;  2PW5 A;  3NBI A;  4DV5 Q;  4G7Z C;  2R7Z G;  2Q8T A;  1YEZ A;  3PO3 G;  1F9R A;  1TWC B;  1EY0 A;  1VF7 A;  2A6H C;  1YNN D;  4LF5 L;  5M5X H;  1XWE A;  2DNC A;  1PYS B;  2EXZ A;  5K36 G;  2MFI A;  4G4K A;  4HED A;  1LT4 D;  2OQ0 A;  5C5L A;  1WTQ A;  4NXN Q;  4OIK A;  1RJT A;  2K05 A;  4RWS C;  5G3L F;  1QVC A;  1Q8K A;  3CD6 A;  1XMO Q;  1O7I A;  2ZJQ A;  5FLM H;  1RTO A;  3UE0 A;  1HCZ A;  4MHE A;  4KHZ A;  2K50 A;  3DXJ C;  1XXG A;  3CW2 C;  2D5D A;  1DYQ A;  5LMN Q;  3S9W A;  4GNX A;  3ULJ A;  3V2T A;  4TSS A;  2EXD A;  4DUY Q;  1EQV A;  2HHH L;  4QIW E;  5IYD G;  3RR5 A;  3AQQ A;  3E0J A;  1AZQ A;  3UDF A;  4L5R C;  1VMP A;  2DY7 A;  4JI8 Q;  4LF8 Q;  3I91 A;  2F0Q A;  1SMY C;  2N3S A;  1X55 A;  4OON A;  2N55 A;  4S3S A;  1LTR D;  2LY7 A;  2R93 G;  4DV0 L;  4BY7 H;  4DXF A;  3IKJ A;  1A3T A;  2F0L A;  5C4X B;  3BVZ A;  1VQ7 A;  2HD3 A;  4CJ2 C;  4BY1 G;  3WOE A;  3HFZ B;  4EQN A;  4A3K H;  2RDH A;  5EAY A;  2Z9H A;  4IZ8 A;  1XMQ L;  2XN9 C;  1NR4 A;  5FK9 C;  1Q7Y C;  1PTO C;  4LW1 A;  1K0R A;  3U58 A;  1QUQ B;  2EPB A;  1R9T B;  3BDL A;  4J6H A;  4DR6 Q;  4ILW A;  4DR4 Q;  1OXV A;  2WAQ G;  1FJG L;  2K5D A;  1ESR A;  3K5L A;  4A3D G;  2N8N A;  1HZ9 A;  1IYV A;  1F2Z A;  1YHA A;  4ODG A;  4KN4 C;  2E5L L;  4A3B B;  3RN5 A;  4NXM Q;  3N6R A;  5FO9 B;  2E2H B;  2LXK A;  2QDL A;  4Y52 H;  4R9W A;  2C9O A;  2WAC A;  4QUC A;  2VQF Q;  4EQP A;  4KY7 A;  5FLX E; 
#chains in the Genus database with same CATH homology
 3SK4 A;  3J7A V;  2Y0S B;  2SOB A;  5E4X A;  1WTO A;  4XDX A;  1ZYR C;  2EY5 A;  5EKK A;  3J7Y W;  4C1N K;  1AZP A;  1B50 A;  4QB4 A;  3W3A A;  1ENF A;  3ND8 A;  2F0J A;  1HPC A;  1Q8I A;  3QOL A;  1IW7 D;  1OXX K;  1TY0 A;  4EVO A;  2NVT B;  2JE6 I;  3VR3 A;  3W2D A;  4K5X A;  2E74 C;  1GUT A;  1NSN S;  2F0W A;  1HHV A;  1SE3 A;  1PDQ A;  2EYL A;  3UI2 A;  1F2Y A;  2E2J B;  4L8J A;  3TP5 A;  3OOC A;  3GTK B;  3OW7 A;  2Q8R E;  1IL8 A;  2OF1 A;  2RA4 A;  3D6C A;  1B4O A;  3DWP A;  1TQO A;  2B8G A;  3QOJ A;  3TME A;  3K7A B;  4DK0 A;  3QB3 A;  2JEA I;  4RGO S;  3PO2 B;  3TN2 A;  1NCV A;  3NWS A;  2PPB C;  3S2H B;  2NTT A;  2FMM A;  1D5X C;  4K2K A;  2K5W A;  2QEJ C;  4RCN A;  3OWE B;  1B2T A;  2EYH A;  4IFD G;  4BA2 I;  5HGT A;  1IYU A;  4L63 B;  4QMG A;  1EWH A;  4XT1 B;  2BDO A;  3R8B A;  1DZ1 A;  1CHQ D;  1O7Y A;  2RDG A;  1IKL A;  3VYS A;  3C1E A;  3D6W A;  5I2X A;  5KRU A;  1JC7 A;  2FHT A;  3VYT A;  1EYD A;  1YNN C;  1QNU A;  1GOZ A;  4DAY A;  3S1M B;  2J0T D;  1SYB A;  1OXT A;  1V1P A;  3S15 B;  2K7V A;  2F0M A;  3Q6S A;  4CKB A;  1ESF A;  5FOB B;  1FNV A;  3FKI B;  5KEE A;  2KUM A;  1FNU A;  2E2D C;  5IGC A;  2B39 A;  2ID0 A;  4HTH A;  4BWG B;  4J1M A;  2IPK D;  2QF7 A;  5DNF A;  2NZ1 D;  4NKL A;  1L0Y B;  3DUZ A;  3HZX A;  2BCO A;  5EKL A;  1SND A;  1MGS A;  3TP6 A;  1AN8 A;  3MXG A;  5D14 A;  1BCP D;  5T1G A;  2F0N A;  4XYO A;  3NTH A;  1QJO A;  3NBH A;  3J80 E;  4QF4 A;  2IWH A;  1BR9 A;  5M3M B;  2EYP A;  1BQQ T;  2F0K A;  3NHH A;  1CZW A;  2L11 A;  2VNU D;  3HOW B;  3LX0 A;  1ML0 D;  3MFG A;  4G57 A;  3FRP B;  4PMB A;  4R8I A;  1OXU A;  4KV6 A;  5DM6 3;  1JWM D;  1SYC A;  3HS0 C;  3KUP A;  2HDM A;  5G3L D;  1UNS A;  2PZU A;  1TS2 A;  1ET6 A;  3H91 A;  3MC0 B;  1I4Q A;  5ELF A;  4EQO A;  3QJY A;  3NTI A;  1GJX A;  3H09 A;  2NN6 G;  3CRK C;  1Y8P B;  5C6A A;  4L6T B;  5C0X H;  1HUM A;  5IGB A;  5DM7 3;  2JSO A;  2XNA C;  1EU3 A;  1JR0 D;  3PMF A;  1SBB B;  2HCI A;  4DXG A;  2R6G A;  5M5X B;  3KBG A;  1STH A;  4K8J A;  3A8K E;  1D2B A;  5C4H A;  2G9D A;  3A55 A;  4OGQ C;  2D62 A;  1GUN A;  2E2I B;  3SR1 A;  3K5O A;  2WB1 B;  1TY2 A;  5KND A;  1RHP A;  5FLX L;  2KEC A;  1LTI D;  1V1O A;  4IUR A;  1B9M A;  1EOT A;  2RSN A;  4G7O C;  5JEA G;  1PRT D;  4HMJ A;  1S5B D;  1RCV D;  3D4W A;  3TSS A;  2HQE A;  1I4G A;  2L4N A;  2BE5 D;  4M8A A;  3OHX C;  2PNR C;  4KY6 A;  5KGU A;  1LLR D;  5CV5 A;  3TP7 A;  2YU9 B;  1DOM A;  1DCZ A;  1U4P A;  3KF8 A;  4A3K B;  1DM0 B;  4ZUI A;  1JWS D;  1E2V A;  3X3M A;  4TQU S;  2F0S A;  1BNZ A;  1LAB A;  3ZYY X;  2PMZ B;  2KED A;  3HGB A;  3SE0 A;  3NSW A;  5F2D A;  1CA6 A;  1F9S A;  5T1I A;  5CBE E;  2EE1 A;  1WTR A;  5IIF A;  4ZLT F;  1WVL A;  5D3D A;  4P2C B;  5ELC A;  1S5E D;  5M5W B;  3NWT A;  1SXT A;  5M5Y B;  4ABN A;  5I6W A;  1FD7 D;  1UEA B;  2ZXP A;  1ZEQ X;  1TKW B;  4IUQ A;  4C3J B;  2OT2 A;  2XWJ B;  2JA7 B;  3D4R A;  1Q3L A;  3IFT A;  4CJ0 B;  1U4L A;  2I07 B;  4QIW B;  3T51 B;  1H9S A;  4KHV A;  1QCB D;  1BCP C;  2WIN B;  1C48 A;  3T53 B;  5TSS A;  1I50 B;  5EBD A;  4RGN A;  3J81 E;  2K01 A;  2SNM A;  3CHB D;  3A8I E;  5ELD A;  1HA6 A;  4KKT A;  3VA5 A;  2B2U A;  3ERQ A;  3S1N B;  3AB9 A;  3QIA A;  3Q23 A;  1CFM A;  1ZXT A;  2PYK A;  1FR3 A;  3K5N A;  3GD7 A;  2VXW A;  1JOK A;  3NK9 A;  3Q0A A;  3CQZ B;  1Y8N B;  1RDP D;  1F2L A;  1D6E C;  2F0G A;  4HCS A;  5ELB A;  1HFG A;  4KJO A;  1C8C A;  3DWQ A;  3OIQ A;  2ICE C;  1R4Q B;  1HTL D;  2MGS A;  2KEE A;  3IL8 A;  3PUY A;  5CV9 A;  3R2T A;  4RA8 A;  1TWA B;  1EEI D;  4R8N A;  2ZXO A;  3ND9 A;  1EY8 A;  1GXD C;  2B2W A;  1PTO B;  2NB0 A;  4C3I G;  3TZU A;  3FDT A;  3J80 L;  2NVX B;  2NN6 I;  1SNM A;  2CQA A;  5C0X J;  3GTO B;  1PZI D;  1D5Z C;  3BZD B;  1AP0 A;  4K5V A;  3QG1 A;  1HRJ A;  4B9W A;  3I3C A;  2Q8I B;  1GUS A;  2LFN A;  1ROD A;  2X6G A;  2ZT9 C;  1EFI D;  4AYB B;  1JOQ A;  2F03 A;  1EWC A;  1SNQ A;  1QIL A;  4ME5 A;  3RD4 A;  4IFD H;  4DU9 A;  1RF2 D;  3IAY A;  1TS4 A;  4F8M A;  1BDO A;  2L0C A;  2AWN A;  2K6A A;  3HKZ B;  4V19 0;  3OMG A;  1PRT C;  4KY5 A;  5C4J B;  3DEP A;  5C3E B;  1U9R A;  4PMC A;  3VR2 A;  5COY A;  1SAP A;  3VR5 A;  1JQY D;  3BYY B;  2BE5 C;  3GP7 A;  2ENB A;  3A54 A;  1QE6 A;  2R3Z A;  4FF3 A;  3EVQ A;  4XYQ A;  3GV3 A;  3I90 A;  4IUT A;  2LKV A;  1ILP A;  2PZW A;  1HQM C;  4DGZ A;  2L9H A;  1CI3 M;  3GTQ B;  2IW3 A;  1PTO F;  3PUV A;  4LJZ C;  2FJ2 A;  3A8J E;  1WTW A;  4Q5V A;  1BBX C;  3KBX A;  1I4X A;  3BVM A;  1A3U A;  2O5J C;  4BBS B;  2IX0 A;  1DOK A;  2F0U A;  4K8I A;  5E4W C;  2CW0 D;  1STY A;  5IGD A;  5C3W A;  5FO8 B;  3OIP A;  2DNE A;  5CBA E;  3FPU B;  1E2W A;  5A2Q E;  1RTN A;  1I6V C;  5LL6 X;  4QUF A;  1I3Q B;  2K04 A;  3OSO A;  1HUN A;  4K14 A;  1S5C D;  2LMC B;  2H1E A;  4OO1 G;  5NUC A;  4RH6 A;  4RHS A;  3PIP 3;  3NXW A;  3VYR A;  5ISR A;  1ONL A;  1STA A;  3SK8 A;  3SK5 A;  4HN7 A;  4KK7 A;  1H9J A;  1G2T A;  4KTA A;  5C0X I;  2EYJ A;  2BA1 A;  3D31 A;  3KLS X;  4XQN A;  5I4D A;  3OPO A;  1SNC A;  4OIJ A;  4DA2 A;  1SYG A;  4I65 A;  1SEB D;  3G7L A;  1JOR A;  2RDF A;  2IX1 A;  2B8F A;  4ZK9 B;  4LK1 C;  5EPJ A;  4IUP A;  3D3R A;  3PUX A;  4XQJ A;  2ICI A;  1EZ8 A;  3WOF A;  1C4Q A;  3DMU A;  1MSG A;  4JK1 C;  5I6Y A;  1KLG D;  3LNN A;  1TWF B;  4C3H B;  5I9O A;  3IFD A;  2NN6 H;  5CR3 A;  3T13 A;  1O80 A;  4J8Q A;  1EYC A;  3PUW A;  4A3F B;  2ZXR A;  3AU7 A;  2HDL A;  4LAA A;  2EY2 A;  5HUR A;  5LL6 S;  1WTV A;  1SNO A;  3J7A F;  5KYL A;  3MXP A;  3I4N B;  2QDB A;  2A69 C;  4K6L A;  3PO3 B;  3SXH A;  1Q1E A;  2KQ3 A;  5FKA C;  2H4O A;  2Z1C A;  3H94 A;  5M3F B;  1F2M A;  1E0B A;  2PQE A;  3J81 L;  3BDC A;  1Q90 A;  2JYO A;  3BG3 A;  2J7Z A;  5JVG 3;  5JAV A;  1XX8 A;  2E75 C;  3P20 A;  1W6J A;  1CQF A;  1L0X B;  1OO9 B;  5JEA H;  3K58 A;  1ENA A;  5IOD A;  2KA7 A;  2CVR A;  5EPK A;  3GO5 A;  4ZKC B;  5IGE A;  4RHR A;  3WDN A;  3CKI B;  3PV0 A;  4JBW A;  4K5W A;  2Z4H A;  4MIU A;  5COR A;  4C1N I;  1KDC A;  5E3F A;  1LT5 D;  1M8A A;  2MP1 A;  2DN8 A;  3RZD B;  2R93 B;  1EY4 A;  2AWO A;  4IFD J;  4BY1 B;  3P75 A;  3RMH A;  5IGF A;  1QOH A;  2PW7 A;  3T4A C;  4XQQ A;  4X3K A;  4WOR A;  1Z7T A;  1GHJ A;  1ILQ A;  2RVL A;  1HA5 A;  4A3D B;  1QB5 D;  1JWU D;  1TS3 A;  5D65 A;  2KVM A;  2QKI C;  3H6M A;  5JPN C;  3EFX D;  1B1Z A;  4FVM A;  4GZY C;  1TII D;  2F0H A;  3VA7 A;  1S5F D;  4DK1 A;  3MAQ A;  2VUM B;  2AUJ D;  2CW0 C;  3L7Z C;  4KI0 A;  3GTL B;  1PLF A;  3C3L A;  3K5M A;  3MEH A;  2F0I A;  2RKS A;  3K6O A;  1TU2 B;  4DFA A;  2XVS A;  1W6K A;  5BN4 A;  3NQI A;  1GUO A;  2SDF A;  2B2Y A;  3TP8 A;  1A3V A;  1G8Z D;  3H3V C;  4ZAI A;  4NP5 A;  2A6E D;  5IT9 E;  2K1B A;  2AQ3 B;  2OXP A;  2BA0 A;  2NWG A;  4FXD A;  3L3O C;  3PIO 3;  3BYT B;  5K5P A;  4EGV A;  1VMC A;  5CC4 A;  4KMU C;  2AUK A;  3CRL C;  3LWE A;  1HQR D;  4LMQ D;  1ICW A;  3DHQ A;  1SJH D;  3FMC A;  3NPP A;  1D5M C;  2V4D A;  2RBM A;  4WJW A;  2RQX A;  2OEO A;  3RLF A;  4ID6 A;  2B2U C;  2DY8 A;  4BY7 B;  4ZUJ A;  1KDB A;  3T16 A;  4DAP A;  1LT3 D;  4Z9C B;  3RZO B;  3N52 A;  1Q12 A;  2G9H D;  2MUY A;  4O42 A;  1D1I A;  2PZT A;  5A2Q L;  4G7H C;  4RKB A;  4IFD I;  2O2L D;  1B53 A;  1NAP A;  3HOV B;  3TZD A;  1BUV T;  2F4I A;  2FFK B;  1H9K A;  3URY A;  2WV6 D;  4CHT B;  4ZYS A;  4PQX A;  1SYF A;  1BF4 A;  5CMD A;  4H0L C;  1I6H B;  1G2S A;  2B2W C;  1BCP B;  1E2Z A;  1MSH A;  4H44 C;  2QCP X;  4HCE A;  3T56 B;  2PO4 A;  3M7G A;  4KKS A;  1X3Q A;  3HOX B;  1X32 A;  4FYD A;  1DJR D;  4CBV A;  3O13 A;  4HR7 B;  1QNK A;  2IT1 A;  3SK6 A;  2LS0 1;  3SVM A;  2B2T A;  3SHL A;  2NYZ D;  1EY7 A;  1TT2 A;  5BN3 A;  2VB2 X;  1EU4 A;  5CYU A;  4F87 A;  1I4H A;  3D8G A;  4XT3 B;  4DF7 A;  3S1Q B;  4OL7 A;  3MXN A;  1S4Z A;  1STB A;  4FO2 A;  5EQ0 A;  4PNY A;  1F9P A;  5JEA J;  1O7Z A;  3A7A B;  1KAB A;  4DNT B;  5FO7 B;  4B9X A;  4RGM A;  2JA8 B;  3U9S A;  2KHS A;  1WD0 A;  2R61 A;  4A93 B;  4OHJ A;  4PMW A;  3K57 A;  5EJW A;  1WTP A;  4MN3 A;  1V8Q A;  1T5X D;  2N88 A;  1MI2 A;  2BOS A;  3TBI B;  1EY6 A;  1O7L A;  1H9R A;  3QO2 A;  1ENC A;  3Q22 A;  3NUC A;  2F0E A;  2EJM A;  1FGB D;  2B63 B;  4NMZ A;  2C5C A;  1Y8O B;  3M7N A;  4ZQ3 A;  2A69 D;  5IGG A;  4I7Z C;  3R2I A;  3V05 A;  2AQ2 B;  3GV6 A;  5KYI A;  4U67 3;  1B44 D;  1D1K A;  1PZJ D;  4OO1 H;  1PRT B;  3P1H A;  2JEB I;  1YNJ D;  1EIG A;  3HP3 A;  1JIC A;  1VF5 C;  3MA2 B;  5BN5 A;  4BA1 I;  3VR6 A;  4B08 A;  3OWF A;  1H9M A;  2A6E C;  1VCI A;  1IKM A;  2K03 A;  5LHY 1;  1A2T A;  3QWN A;  1CK1 A;  5C5M A;  5M9O A;  4KD4 A;  1DD2 A;  2B2V A;  4C56 C;  1J8I A;  4A3E B;  1F9Q A;  1CZG A;  3C2P A;  1V1P B;  2EJF C;  2NVY B;  1PXU A;  1QG7 A;  2EY6 A;  5A35 A;  1U4M A;  3KLS A;  2KCC A;  2F3V A;  2Z8L A;  2O4X A;  1WTX A;  4RGT A;  1JOO A;  2EY1 A;  5IOC A;  1V43 A;  2F0O A;  2NTS A;  4N9T A;  5C4Z A;  5CV4 A;  1PRT F;  1X3P A;  1HTP A;  1M4V A;  4IUU A;  2K5Q A;  5ELE A;  5JVH 3;  4ZRZ A;  3FVQ A;  5EKI A;  2X6L A;  2L1B A;  3NTK A;  5KNB A;  2KOL A;  5EPL A;  1EIH A;  1SYE A;  5IT9 L;  1SYD A;  4XXE A;  1A6X A;  1EL0 A;  3DM1 A;  3E6Z X;  2SNS A;  4V0B A;  1G6Z A;  3HOZ B;  1RKN A;  2M2L A;  4A3I B;  4UAI A;  5EBC A;  1PZK D;  2L12 A;  1DON A;  3A7L A;  3PUZ A;  2TMP A;  2KJX A;  4DNR B;  2K32 A;  4O1N A;  4WRD A;  3L9A X;  1VDZ A;  4K6D A;  1G29 1;  1EQT A;  3ONA B;  1Y1W B;  1NUC A;  4DN4 M;  1MD2 D;  3G6J B;  3U9O A;  1II3 A;  2KCN A;  1LTA D;  4RAU C;  4BS9 A;  5C3X A;  2RSO A;  4ULL A;  3R3O A;  1T5E A;  1PMR A;  2M00 A;  3VR4 A;  3Q24 A;  3CU7 A;  2D9U A;  2I46 A;  1TWG B;  2F1M A;  5AFW A;  2FMC A;  3S14 B;  4CKE A;  1I4P A;  5C44 B;  1LTT D;  1IHZ A;  1O78 A;  4U68 A;  2PCF B;  3E5S A;  4IAL A;  2MPM A;  5CV6 A;  2YYZ A;  3MFY A;  2XSC A;  2F0T A;  4UDU C;  1PTO H;  4YIJ A;  1MBY A;  2F3W A;  3I72 A;  2E76 C;  2L5T A;  1HXY D;  2A68 D;  2R7Z B;  4HAE A;  1EZ6 A;  3JAM E;  1PFB A;  1OXS C;  1TS5 A;  3SEB A;  1A2U A;  4KKU A;  3A56 A;  3LWU A;  1I4R A;  4A3G B;  4NW2 A;  3GTJ B;  1CM9 A;  1SJE D;  4H7B A;  3EA6 A;  4FP5 D;  3S16 B;  4Q0F A;  4C3J G;  1TWH B;  2M9V A;  1B9N A;  3MWY W;  1YNJ C;  1Z6H A;  1JE4 A;  2B2Y C;  1G91 A;  1J9O A;  1UUP A;  2QIL A;  4XIG S;  1PFN A;  3GTP B;  2JP1 A;  1ZKO A;  5J1Z A;  4E6I A;  2A74 C;  5E1F A;  2L55 A;  3DWA A;  4C3I B;  4KD3 A;  1DXM A;  4RFB A;  5CV7 A;  4Y7N B;  2EYM A;  3X3N A;  3MXU A;  2EDG A;  3H0G B;  4IQZ A;  4F88 A;  2XRS D;  5KIX A;  1CT1 D;  1UAP A;  4H13 C;  5DAU A;  4A3J B;  1GUW A;  4X3T A;  4FNF A;  1KLU D;  3AMU A;  2JXM B;  4C2M B;  4HMI A;  1RD9 D;  4KJN A;  1KTK A;  3V96 A;  2IX3 A;  1K8O A;  4IN3 A;  2HCC A;  3OMC A;  2WAQ B;  1GHK A;  3HEJ A;  1LTG D;  2R92 B;  1SNP A;  3K0Y A;  1K8M A;  4A3M B;  3NQT A;  4F7X A;  2MJ8 A;  1SDF A;  1SE2 A;  1PYW D;  4XTC S;  3MZ5 A;  2A6H D;  3MTS A;  1Y69 U;  3EQL C;  4NDX A;  2IL8 A;  1AEX A;  5CGK A;  3P7J A;  1H9S B;  3M3Y B;  4X3S A;  4BBR B;  2FIN B;  2WKD A;  1BO0 A;  1IW7 C;  1SE4 A;  1XTC D;  5I2Y A;  2O5I C;  3NE5 B;  2CHB D;  2EYO A;  3HOY B;  1LV9 A;  4FF4 A;  2A73 B;  3S17 B;  3BDO A;  4TRD A;  1LAC A;  2EYF A;  1DOL A;  2B2T C;  4FXG C;  4TKO B;  2NBF A;  1STN A;  1EEF D;  3KLR A;  1KAA A;  4ZKB B;  1SSO A;  3I4M B;  4CKC A;  4WFN 3;  2Z4I A;  1SMY D;  1F77 A;  1CA5 A;  1XYI A;  3K59 A;  1WCM B;  2EOT A;  3M4O B;  3R93 A;  4OO1 I;  2NVQ B;  5EGT A;  4K2L A;  2JA6 B;  2EZV A;  4FF2 A;  1STE A;  1BOS A;  3I4L A;  2EJG C;  1LTB D;  2TSS A;  1PTO D;  1FYC A;  4X3U A;  3HRZ C;  3C46 A;  2F0V A;  3HG9 A;  3S2D B;  4CGY B;  4HSP A;  3EJI A;  1KNA A;  2EVB A;  1S5D D;  2F0P A;  5D3I B;  1TR5 A;  4N9P A;  4IUV A;  3M85 A;  4KN7 C;  1KDA A;  3I8Z A;  3GTM B;  3DEO A;  3TDQ A;  5JJZ A;  3VYU A;  3SDZ A;  3BS1 A;  1B3A A;  2BDN A;  4PV1 C;  3ITP A;  1K83 B;  1EY9 A;  1ZYR D;  5K36 H;  1JB3 A;  1R4P B;  4QCL A;  4M1U B;  4RCO A;  4CJ1 B;  2XRQ D;  1U4R A;  2GA4 B;  2WKC A;  5JOB A;  3HOU B;  3C1F A;  2A68 C;  2SEB D;  1LTS D;  1BXT A;  4RKL A;  2A5H A;  3GTG B;  2WP8 J;  2K28 A;  2NUC A;  3MHB A;  1CTM A;  1CHP D;  2F0D A;  2XIW A;  1NR2 A;  1EY5 A;  2WII B;  4FF1 A;  1LO5 D;  5JPM C;  4IUN A;  3KK7 A;  1AFP A;  5C0X G;  1STG A;  3D4D A;  1HFN A;  3NP8 A;  1Y1V B;  2HUG A;  1LT6 D;  3I70 A;  2D2C C;  1PFM A;  3FEW X;  1SFO B;  1KNE A;  4HSV A;  3FPP A;  2J4X A;  5J22 A;  1FNW A;  2B2V C;  1WD1 A;  1EYA A;  2K33 A;  5CV8 A;  1JCK B;  5DEH A;  2XWB B;  2IJ0 A;  2MHV A;  2VB3 X;  3I73 A;  4C3H G;  1A15 A;  1QWY A;  1GUG A;  2AQ1 B;  2F0F A;  3F2U A;  5J39 A;  2JA5 B;  3JAM L;  2X69 A;  3GQB A;  1TVX A;  1BCP F;  3ERO A;  4DAV A;  3RUZ A;  5KNC A;  1CQV A;  4FXK C;  1Z47 A;  1AW7 A;  3MVV A;  3S1R B;  3M4Y A;  1Q1B A;  5I9P A;  3BVG A;  1ET9 A;  2PW5 A;  3NBI A;  4G7Z C;  2Q8T A;  1F9R A;  1TWC B;  1EY0 A;  1VF7 A;  2A6H C;  1YNN D;  1XWE A;  2DNC A;  5K36 G;  2EXZ A;  4G4K A;  4HED A;  1LT4 D;  5C5L A;  1WTQ A;  4OIK A;  1RJT A;  2K05 A;  4RWS C;  5G3L F;  1RTO A;  1HCZ A;  4MHE A;  4KHZ A;  3DXJ C;  1XXG A;  2D5D A;  1DYQ A;  3S9W A;  3V2T A;  4TSS A;  1EQV A;  3E0J A;  1AZQ A;  1VMP A;  2DY7 A;  3I91 A;  2F0Q A;  1SMY C;  2N55 A;  4S3S A;  1LTR D;  2LY7 A;  4DXF A;  3IKJ A;  1A3T A;  2F0L A;  5C4X B;  3BVZ A;  4CJ2 C;  3WOE A;  4EQN A;  2RDH A;  4IZ8 A;  2XN9 C;  1NR4 A;  5FK9 C;  1PTO C;  2EPB A;  1R9T B;  3BDL A;  4J6H A;  4ILW A;  1OXV A;  2K5D A;  1ESR A;  3K5L A;  1IYV A;  1F2Z A;  4ODG A;  4KN4 C;  4A3B B;  2E2H B;  3N6R A;  5FO9 B;  4R9W A;  2C9O A;  2WAC A;  4QUC A;  4EQP A;  4KY7 A;  5FLX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...