2KQ3A

Solution structure of snase140
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Importance of the C-Terminal Loop L137-S141 for the Folding and Folding Stability of Staphylococcal Nuclease
pubmed doi rcsb
total genus 25
structure length 140
sequence length 140
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kq3A00
1STYA 3SK5A 1STBA 4KV6A 1STGA 3E5SA 2HQEA 1A2UA 3C1FA 5IGCA 2PQEA 4R8NA 2RBMA 4KJNA 1KDBA 2F3VA 5I9OA 4F8MA 5I6WA 1EY7A 1SYEA 2KQ3A 5CGKA 5NUCA 3SR1A 3MVVA 5HGTA 1SNMA 1EYAA 2PZWA 2PYKA 4HMJA 4PMCA 1EY6A 3MZ5A 2WACA 4LAAA 5E1FA 1ENAA 2EYHA 2F0WA 3VA5A 1KAAA 3P75A 4KY5A 4DU9A 4EVOA 3T13A 5C6AA 2QDBA 1JORA 1AEXA 3D8GA 1SYFA 2O4XA 4RKBA 3MEHA 4ZQ3A 4NMZA 1JOOA 4K6DA 2EY6A 3TP7A 5KRUA 4KHVA 4MIUA 4G57A 2F0OA 1SNDA 2F0LA 2F0NA 3DMUA 4KY7A 1EYDA 1EY4A 2EY2A 4J1MA 1SNQA 1STNA 2KHSA 2RKSA 2F0PA 4QMGA 5I9PA 3HEJA 5DEHA 4WORA 2SNMA 3NK9A 2F0TA 2OEOA 3TMEA 4IZ8A 5EKKA 3NUCA 2F0VA 4S3SA 3TP8A 3SK4A 2F3WA 2SOBA 4OL7A 3PMFA 4H7BA 4K14A 5J1ZA 1JOQA 4DFAA 2EYJA 4KD4A 5IGDA 4K8IA 5IGFA 1EY8A 2EYLA 3SXHA 3DHQA 3HZXA 5KYIA 1F2MA 1EY9A 5IOCA 2EXZA 1NSNS 4WRDA 4NDXA 5IODA 3QB3A 3MHBA 5CV5A 5M9OA 4KD3A 1ENCA 3R3OA 4PNYA 2EYPA 5CR3A 2F0EA 2F0MA 1JOKA 5CV4A 3QOJA 4ME5A 1II3A 5E3FA 3RUZA 3SK6A 2F0GA 1KABA 3T16A 5IGEA 1EYCA 3BDLA 3OMGA 4IALA 2F0IA 4TRDA 5C5LA 3TP5A 4NKLA 4EQPA 1A2TA 5JOBA 1A3UA 4KTAA 5CV9A 4HTHA 5F2DA 2EY5A 3NQTA 3U9OA 4F7XA 5IGGA 4ID6A 5C3XA 1RKNA 5CV6A 3SHLA 3EROA 5ISRA 1STHA 1EZ6A 5JAVA 2PZTA 1SYBA 4DGZA 1SYCA 4I65A 2F0HA 4ODGA 5C5MA 3QOLA 2PW5A 2F0UA 4K5XA 1TT2A 2F0JA 4N9TA 4N9PA 3D4DA 3LX0A 4K2LA 4QB4A 4ZUJA 2F0DA 5EGTA 4EQOA 2EYFA 1SNOA 3C1EA 3TP6A 4IUNA 3EVQA 3OMCA 1F2ZA 5C4HA 5DAUA 1STAA 1KDAA 2F0KA 4K5VA 4KJOA 2F0FA 5HURA 4EQNA 3S9WA 1EQVA 5CC4A 4YIJA 1F2YA 3MXPA 3EJIA 2F0SA 3NXWA 4DF7A 4HMIA 1IHZA 4B9WA 5K5PA 5KIXA 2LKVA 4ZUIA 4K8JA 1TR5A 3H6MA 2F0QA 2M00A 2SNSA 4KY6A 3BDCA 5EKLA 5IGBA 1SNPA 1TQOA 1A3VA 2OF1A 3D4WA 4PMBA 5KYLA 3NHHA 2ENBA 3ITPA 4K5WA 3D6CA 4E6IA 5C3WA 1KDCA 1SYDA 5C4ZA 5IIFA 5KEEA 5J39A 5J22A 5I6YA 1SNCA 1U9RA 2OXPA 3OSOA 4RKLA 1EY5A 3P1HA 1A3TA 2NUCA 4NP5A 3SK8A 2PZUA 4K2KA 3OWFA 4J6HA 4B9XA 3NP8A 4QF4A 5CV7A 3V2TA 1SYGA 2EYOA 5KGUA 1NUCA 2EYMA 1EZ8A 2RDFA 2EY1A 2PW7A 1EY0A 3ERQA 5CV8A
chains in the Genus database with same CATH superfamily
1D7QA 3RLFA 5KNBA 3GV6A 5LL6X 1SN8A 4DKAC 3HOZH 3PV0A 3S1NH 3HOWH 4BY7G 1NAPA 2R93B 3FVQA 5M3MG 1MJEA 1N33L 2SEBD 4A4IA 5CGKA 1ZKOA 4K6LA 2XTIA 2HCCA 2MP1A 1SNMA 3S1RH 3VYSA 4XYQA 2F0WA 2OQKA 1KAAA 1Y1VB 2LXJA 4DK3C 1PH9A 1X3FA 1ESRA 1CUKA 4KHVA 4G57A 5M5XB 1K8OA 1JB7A 1EYDA 4NXNL 1DOMA 2Z8LA 3TREA 1GHKA 2F0PA 2JE6I 3AFPA 4GNXC 4DV1L 3EFXD 1X3EA 2BE5C 2ES2A 4UPAA 4C3JG 3BYYB 1LT4D 2B2VC 4OIKA 4OEMB 4XT1B 3TEHB 5I2XA 4UAIA 1E2WA 4IFDI 1ET9A 1HZAA 2VUMG 2Y0SB 3VYTA 2MO1A 1LV9A 2SDFA 4DV5L 4DPGA 1B8AA 1ENCA 3PIP3 3A8IE 1UNSA 3K0XA 2E2JB 4X3SA 1QNUA 1EIGA 1QG7A 1XTDA 4LUOA 3KLWA 5COYA 1Y8OB 2JA5B 4V0BA 1K9MC 4KMUC 3CCSA 3A56A 5A2QE 3BZDB 3I56A 1E7ZA 5D14A 2NWGA 3EROA 2EOTA 2R7FA 5LMNL 2UXBQ 3ND9A 1NTGA 2MGSA 1HNZQ 4K5XA 3MXNB 1K28A 4ZKBB 1SNOA 1WTXA 1VQLA 2VUMB 1WTOA 3K7UC 3NSWA 3UE1A 3J80L 3VYRA 2IJ0A 4RMFA 4IPCA 1IHZA 2XN9C 1CKNB 4K8JA 5GAGC 2AQ3B 3CHBD 2M00A 1AE3A 2VQEL 4DV7L 1JE4A 3D3RA 1JQYD 1RD9D 1Z6HA 4A93G 5KEEA 3S1NB 1BBWA 3HOZB 3HP3A 2WKDA 3PIOA 4DXFA 1UE1A 2A68C 4QF4A 1IW7D 4A3EB 3DWAA 1NUCA 3X3MA 1STYA 3A54A 1EWCA 1FVIA 5TSSA 1IBKQ 1TWCB 4R8NA 2RBMA 5CORA 3I4NB 2YYZA 1TS4A 3E9HA 2FMCA 1R9TB 3P7JA 3GTPB 3I4MB 2OTLA 1Q8IA 4Z9CB 4A3LG 3L3OC 1SXTA 1VDZA 2A69D 5G3LD 1IYUA 2LS01 3QG1A 1IW7C 3BVGA 1CZWA 4ZRZA 4BBRB 1DONA 3PO2G 2EY2A 3CAMA 3NQIA 5I9PA 1CFMA 3M4OB 3I7FA 3GD7A 4X66L 4OIJA 3SK4A 3CRLC 5J1ZA 1WTHA 2K01A 2MFIA 3SE0A 1VQDA 4A3LH 1ICFB 5T1IA 3QB3A 3RR5A 2N3SA 5IP7H 2Q2UA 3MFYA 4KD3A 1U5KA 1W2BA 1HH2P 4GS3A 4C2MH 4BBRG 3ERSX 3OHXC 3VR5A 4KTAA 5CV9A 3JAME 1LTTD 2ZT9C 2KA7A 3CC2A 1JJCB 1CA6A 4A3DB 2WAQE 1PTOD 4MNOA 2P5ZX 3PO3H 1O80A 4ZLTF 5LHY1 2XVSA 3OIQA 2OCEA 1H9KA 2A74C 3GDEA 1LM0A 1XTCD 3KLSA 1HUMA 4OELB 4C56C 1C9OA 2AWOA 3UDFA 3J81E 1OXTA 4LFAL 2NVQB 1BXTA 2I46A 4DF7A 4RH6A 1G8ZD 2G5DA 2FJ2A 5EBCA 5BR8Q 3LWUA 3KBXA 5JVH3 2VXWA 1GO3E 2Q8RE 4BXXH 3HOVG 1ONLA 2JXMB 4GLAC 1V1QA 1K8AC 1T5EA 3KF6B 3M3YH 3KF6A 4WJ3M 3OW7A 5DNFA 2Z6KC 2YTYA 2K50A 3NTKA 2ZTDA 4PMWA 3DWQA 3EN2A 2KCNA 4O2DA 2EY1A 3NE5B 1T9HA 1YITA 2HQEA 1H9SB 2WIIB 4BY7B 3G6JB 4DR3Q 2K5QA 2MJ8A 4A3DG 5E4WC 4X3TA 1KC8C 2NN6I 2NTSA 2JJQA 1WTWA 1WTPA 1SEBD 3KK7A 3H15A 2YV5A 5M5WB 2PZWA 5CMDA 4AQYQ 2RA4A 2H5XA 4A3MG 3VA5A 3IRBA 5C3EB 4EVOA 1BR9A 3TZUA 4L5RC 2QDBA 5C3EH 4DK0A 5G3LF 4WJ4A 4HJ7A 4MIUA 4A3BG 2F0OA 2A68D 2F0LA 5C4XB 1EY4A 4GOPB 3HEJA 1D8LA 3J7YW 1M8AA 3I4OA 4IZ8A 4ZYSA 5BN3A 1YIJA 1PMRA 5E7NA 1ZEQX 4R9WA 5IGDA 2PMZE 1HTPA 1TVXA 3CQZB 3DHQA 1VQKA 1W6JA 3RMHA 1CHQD 3R8BA 2NZHA 3T56B 2VQFQ 4DR5L 5CV4A 3S17H 1VQCA 5M3MH 3BDLA 5C5LA 2TSSA 2FMMA 4EGVA 2UXDQ 3NELA 1HQRD 3T1HQ 1PH4A 2PI2A 5BR8L 3GTKH 3ULPA 3N52A 4ULLA 1HNXL 1KNAA 4DGZA 3QOLA 4C3IH 2ZM6Q 2F0JA 1XWEA 3C1EA 3HOYG 2NVQH 1MJCA 2BOSA 5C0XI 1JCKB 1VQMA 3R93A 4K5VA 4DV2L 1Y1VG 2F0FA 5HURA 3V96A 1VS0A 1C0AA 2BDNA 2E2IH 4G7HC 3HOUH 2VQFL 4LF6Q 1TQOA 3J80i 2OF1A 3GTLB 1G91A 1FNWA 3C46A 4E6IA 1LABA 1PRTD 1STEA 1FD7D 5IIFA 4JBMA 5FO8B 1DOLA 1HNWQ 1TS2A 1QILA 1RJTA 4JBWA 1CHPD 1N36L 1NJIC 3GTJB 5KGUA 1LT6D 1WTVA 2L1BA 3H94A 1HPCA 3SK5A 2IX3A 2PQEA 1JT8A 3KOJA 1G2SA 2K5HA 5FJ8H 1B4OA 2RQXA 4KK7A 5IT9E 4JBKA 4X64L 2KQ3A 5I2YA 3M4OH 3BDOA 4B3RL 4TVAB 2AUJD 4LF5L 4V190 4JV5Q 1VQHA 3K5NA 1JICA 3PQIA 1VF5C 3HOXB 4A3GG 2NTTA 4PZ7A 1E22A 1JOOA 4R4OA 3PUWA 4J1MA 3L7ZC 1MI2A 3NWTA 2Z6KA 4WORA 4LF7Q 1DM0B 3TMEA 5FJ8G 1QJOA 4M8AA 1FL0A 3GQBA 1UEBA 4IPDA 2EYLA 4CDDC 5EPJA 1PV4A 2JYOA 5M3MB 2F03A 1O7IA 4X6AH 3MHBA 4LF9L 1V1PB 3OTOL 5LMNQ 4WFN3 1F77A 1E24A 2F0MA 1GUTA 2B29A 2MQHA 3K5OA 3Q22A 2L5TA 5AJ3Q 3RZDB 3S2HH 5IGGA 2JA6G 2K5VA 2Q2HA 1ASZA 3SHLA 4YY3L 2VB3X 1TWFB 4JBJA 4P74A 2ZM6L 3GTOB 1ESFA 4UP9A 2BA0A 1HZBA 5HY6A 1TT2A 2EZVA 5LMUL 2ATWA 1H9JA 2WV6D 3KBGA 1HXYD 3EVQA 4TQUS 1STAA 4HSVA 4CJ2C 4UY8C 1FYCA 2XRQD 1Q46A 4YIJA 2A8VA 3QWNA 3S1MH 2F0SA 1B1ZA 2E76C 4HJ5A 2A5HA 3NTIA 2A6EC 3STBD 1PA6A 3HOYB 2DNEA 4JC0A 3BDCA 3F2DA 1U4RA 2I07B 2ZJQA 1JC7A 2UU9L 3CU7A 1H9RA 2UUBQ 3ITPA 2LSSA 1ASYA 3SK8A 4NP5A 4FVMA 1Z47A 2L12A 4XT3B 1AN8A 2E2JH 5IWAL 2RDFA 1I3QH 1X54A 4IO9A 1PH3A 1VF7A 3KDFA 4A3BB 3IL8A 4A3KH 4KHZA 2Q8IB 4DN4M 1Q82C 3ND8A 4I7ZC 5GAHC 5M3FG 5LL6S 2JA7G 5C0XJ 1N32L 4YCWA 4FNFA 3WWVA 3K5LA 1IKLA 1TWHB 4HIKA 2I5MX 4Y52H 2B63G 4RWSC 4ZCKA 1QZGA 1PLFA 4B3SQ 5E1FA 5C6AA 1BOSA 3D8GA 4RKBA 3J81c 4O0AA 4KY7A 2NVXB 2RSOA 1HFGA 4NXML 3NK9A 4A3DH 2OEOA 5C44G 1ILPA 2F0VA 2J7ZA 2WAQG 5M3FB 2KHIA 2Q2TA 3KLSX 3HKZB 2F3WA 2DN8A 3J81j 2R7ZH 2IWHA 1DJRD 1G6ZA 2EYJA 5IGFA 2F1MA 5ELEA 1WTRA 3UDXA 2DY7A 2EXZA 3JAMc 3CD6A 1I4RA 1PYBA 1RTOA 1VQAA 3NENA 2LXKA 3RUZA 2F0GA 4JCVE 4JK1C 3FDTA 2Z4HA 1HJPA 1A3UA 2PO4A 4A75A 3U9OA 4DUZQ 3I2ZA 2KECA 5EAYA 1RKNA 4MHEA 4BA2I 2CW0C 2UXCQ 3MXNA 5JAVA 4ODGA 3BS1A 1XPUA 1FGBD 2BH8A 2F0DA 3NBHB 1VQEA 2QF7A 4X64Q 2F0KA 4LFBL 3F2BA 4EQNA 1SFOB 1EQVA 1MSHA 1X55A 1IYVA 4JOIA 1WYDA 2NBFA 1MIUA 2LKVA 3WOFA 1PH7A 5BN5A 1VQ9A 4KY6A 1X9NA 1YZ6A 3D4WA 4YWLA 2NN6G 1KDCA 1WCMB 1Q12A 1L0XB 4LMQD 2ZXPA 1XMQL 2YU9B 1TY0A 2AMCB 3J7AV 1BCPD 3KUPA 2RHSB 1LTLA 3E3XA 1A8VA 1STBA 3DWPA 4IUTA 2HHHQ 2N8NA 3C1FA 2BH2A 1D1KA 4P2CB 4GN3B 4B3TQ 1G51A 1KDBA 4DUZL 2N49A 4XQNA 3IFTA 3MWYW 4JI0L 2GVBA 4NPSA 2I5LX 1HFNA 4AIMA 2EJGC 4PMCA 3UI2A 3S1MB 4LAAA 2I0QA 2EYHA 2MO0A 4J15A 1TWAB 1QWYA 1GM5A 3SVMA 2QILA 1SYFA 5JJIA 4NMZA 3J81i 4RHSA 2B3GA 3CCLA 3F2UA 1KNEA 1SNQA 1WD0A 1J6QA 2SNMA 3GTOH 3UDGA 1BBXC 1PZKD 5EKKA 4GNXA 1X32A 3AU7A 2B2WA 2JA5G 1CQVA 3ZJYC 4DV0Q 4LNQA 4DV7Q 3CC4A 3WDNA 2VQEQ 3CCRA 1MBYA 1HR0W 1NY4A 4O1NA 4PNYA 1RCVD 2F0EA 2JA8B 3ER0A 2QGQA 1GHJA 4IALA 3OMGA 1D2BA 3DEOA 2OTJA 4BY1H 1V1OA 1UEAB 1GVPA 1K3BC 4HTHA 5FLMG 3CPWA 4YCVA 2R92H 1LTID 4JG2A 4R4CA 3W2DA 1VQJA 1CSPA 4KKSA 4A93B 1YEZA 2UUAQ 4CKCA 3I73A 4IUUA 4LFCL 2F0UA 4N9TA 3CXCA 3CCEA 1CA5A 4HIDA 4IUNA 1K0SA 4DR6L 4QGUA 5C44H 3I72A 3HOXG 4QUFA 3ULJA 3N6RA 2Y0SE 2BDOA 2K52A 3QO2A 2X6LA 1LTSD 2HCIA 1YI2A 2F0QA 2N55A 1D5ZC 2F3IA 4OXPA 1VQ8A 3TZDA 4CDFC 3ICEA 4JV5L 4BXXG 1V8QA 2N78A 1LUZA 2K6AA 2WB1E 5J3BA 1FJGL 1EY5A 3S15B 1QOHA 3U50C 2PZUA 5I4DA 4NXMQ 1O7ZA 2EE1A 2ZXRA 2XGTA 3I4MG 1N8RC 4M1UB 3KF8A 5FLXL 4BBSB 5BN4A 4CDCC 1VQGA 2K1BA 1TIID 1XNRQ 5CV8A 1E3PA 3T1YL 5JEAJ 2HIXA 3CCVA 1KTKA 4X3UA 5IE8A 1CTMA 2CQOA 2A6HC 1A6XA 4FXDA 4C3HH 4X3KA 2IHEA 4X65Q 3CMEA 1SE4A 4A3IH 4TKOB 3G6EA 2DGYA 4JOIC 1LTRD 1EEFD 2WACA 2ZTCA 4BBRH 1WVLA 1UWVA 3A7LA 3T13A 2R93G 1JORA 4LK1C 2O4XA 5GAEC 1HA6A 1TKWB 2KHSA 1I6HB 1KRTA 4F88A 4L5QA 2CH4A 4JI7L 4IPHA 3RN2A 4LFAQ 2RF4A 2K5WA 3FMCA 4JI2Q 2D2CC 1QE6A 1UE6A 5EPLA 3GTKB 3CP0A 1GOZA 1HTLD 1HZCA 2K14A 4OL7A 1JOQA 2O5JC 2F4IA 2B2WC 1PVOA 1SE8A 4UHVA 1EY9A 5IP9H 2IW3A 4IJLA 3PO2H 1J8IA 4NDXA 5IODA 4U68A 3VR6A 3W1GA 4BBSG 3VR3A 2NN6H 4A3CG 3TQYA 5E3FA 4DV4L 1D5MC 2MPMA 3PUXA 3GO5A 3A55A 5EJWA 4TRDA 3S15H 2EIFA 1K3RA 4ZK9B 1W3SA 1PFSA 4ALPA 4Q0FA 3NEMA 5C0XH 5ISRA 4JI2L 2Y0SG 3CRKC 1RODA 3H91A 3L0OA 5T1GA 3S14H 1I4HA 5C44B 1PRTB 2HT1A 1BCPC 3EJIA 4RGTA 2E75C 3SGIA 1WOCA 2KJXA 5JVG3 1KL9A 4GLXA 1YVCA 4A93H 1IZ6A 2B8GA 1ICWA 1BNZA 1GKHA 3PF5A 1YHAA 2O5IC 2M9VA 3J7A5 1QZHA 3V2TA 4C1NI 3I55A 1E2VA 1LTAD 2VL6A 4AH6A 4KKTA 4X66Q 1HNWL 2B2UC 2O2LD 4YHHL 3AYHB 3CCUA 2F3VA 2K05A 3I4NG 2HUGA 1YHQA 1AE2A 3FHWA 1SJHD 1I4PA 4DAPA 2PNRC 2ZJPA 2MUYA 5D3DA 2HQLA 2PQAB 2B63H 1A0IA 1RHPA 1Y8NB 3FPPA 3HGBA 2HD3A 1QUQB 5EBDA 1YNNC 1JWSD 2K03A 4FYDA 2K32A 1QVFA 1TWAH 4ZQ3A 4DV3L 3JAML 1B50A 1TS3A 1IXRA 2IPKD 2B39A 4UDUC 5FK9C 4A3KG 1STNA 4N8X1 4B3TL 1BO0A 3PO3B 4DR6Q 3I70A 1UUPA 3MFGA 1P8LA 2GN5A 4JI5L 2CCZA 2QKIC 1YHBA 4GNXB 1EY8A 4C3IG 3TS0A 1B3QA 4RHRA 4C2MB 3Q8DA 2E2HH 3G7LA 2DJGC 3PO2B 1SE3A 3T16A 2D62A 3E6ZX 3C2PA 3I91A 3GV3A 5C3XA 1PTOF 2E2DC 1EFID 3W3AA 3T1YQ 4DV0L 2VW9A 5C5MA 1I6HH 1BKBA 1C8CA 1OXVA 1NMGA 4JI6Q 1W6KA 1L1OC 4XQJA 1LYLA 4U673 2F4VQ 3HRZC 1LTBD 2UXBL 1SE2A 1S5DD 2JA6H 1EOTA 2VY3A 5K5PA 1XMOQ 3OPOA 1SMYC 5DLQE 1C7YA 3IAYA 4FF3A 4LW1A 3UE0A 4PMBA 4POGA 2LFNA 3T51B 1ZYRC 5GQOA 4A3FH 5C3WA 4A3MH 5C4ZA 5JPMC 2V4DA 5I6YA 4MZ9A 3I4NH 1UE7A 3H3VI 3OSOA 5EPKA 3RLNA 2WINB 5JEAG 4FP5D 1SMYD 5K36G 2HDLA 1X65A 3LGJA 4IN3A 1KXLA 2PYKA 4XYOA 5JPNC 3ULLA 4AYBB 4EX5A 1PYWD 4LJZC 1A2UA 4LF6L 4GOPC 1U4MA 2B2UA 1XYIA 1CKNA 1SYEA 3FPUB 4MTKA 5ELOA 1I4XA 4DV2Q 2NVTH 2J4XA 4IOCA 4CKEA 4DU9A 2DY8A 1BDOA 4YY3Q 4JYAQ 4HJ8A 3QR8A 2PNHA 1ZXTA 2WKCA 3MEHA 3BZKA 3E0EA 2B63B 2Z4IA 2ID0A 4QMGA 2A6ED 4LUZA 1VMCA 1JJ2A 3R2IA 1R4PB 4CHTB 1B53A 1Q86C 4A3KB 1HNZL 4POFA 4BY1B 3PO3G 1CT1D 3JAMi 1RL2A 1NR4A 5CV5A 1EQRA 1U4PA 5CR3A 1EIYB 4OWWB 4OHJA 4P72A 3FKIH 3OIPA 5IGBA 2YTVA 3FRPB 2EY5A 2Z1CA 1VQ7A 1I4QA 1LT3D 2OWOA 4LF5Q 3K0YA 3A5UA 1SYCA 2IL8A 2JA8G 4YCUA 5M9OA 3HOYH 2GVAA 5IGEA 4FF1A 3T4AC 2N88A 4RAUC 1ENFA 1ILQA 4NXNQ 4GLVB 4PZ8A 2D9UA 4BS9A 3ZYYX 1VQIA 1OXSC 3MXPA 4HMIA 1KD1C 2R61A 2NVTB 3M7NA 4PZ6A 4A3JB 3PGZA 1EU3A 4K5WA 2RDGA 1DXMA 4GN5A 3HOWB 2E74C 1OO9B 1EWIA 3OTOQ 2UUAL 3M7GA 3P1HA 4IQZA 4GKKL 1N33Q 4DV6Q 3NP8A 4RCNA 2EYOA 1S5BD 4XXEA 3ERQA 1AP0A 3R2TA 2L9HA 4C1NK 2KENA 1STGA 1I94Q 2K75A 2E5LL 1IBMQ 2EJFC 4RFBA 4OWXB 4B3MQ 4JI3L 3MA2B 1PZJD 4LWCA 1TS5A 4IFDH 1DOKA 5E4XA 1L1OA 1HNXQ 1GD7A 1GJXA 2MNAA 1YJWA 3AMUA 3CW2C 1C4QA 1B2TA 1EY6A 1I50B 2PMZB 1GUWA 2PQAA 3GTMB 4KY5A 4XQQA 4QY7A 1SFOH 1R4QB 1SROA 3HOXH 2WB1G 1J5EL 2AWNA 3BYTB 1KHIA 3RZOB 5CYUA 2RKSA 2RHQB 4NB3A 5DEHA 1KAWA 1VQFA 1S5ED 1D5XC 2R6GA 4P71A 4C3HB 4I7AA 4H44C 1L0WA 3TSSA 4DFAA 4KD4A 1PXUA 1G6PA 3HZXA 4R4QA 4G4KA 2VNUD 3OW2A 3G48A 3M4PA 4GOPA 3HOVH 3R3OA 2FFKB 4IJHA 5IY0A 2E2HB 4Y7NB 4ME5A 2WB1B 4YWKA 3TP5A 1RF2D 3M4YA 2AKWB 3NQTA 3CPFA 2KVMA 1YJNA 2JA7H 4IURA 5CV6A 1F9RA 5EQ0A 5M3FH 4JI1Q 1E1OA 4IUQA 3K5MA 1CI3M 2XSCA 4G7OC 4N9PA 4QB4A 5EGTA 3X3NA 3OMCA 1XXGA 1K83H 4O42A 2IHFA 1PH2A 3EBEA 3NXWA 2DNCA 3F1ZA 5DM63 1MGSA 2SNSA 4EQ5A 1CQFA 2ICIA 3PSIA 3K81C 2JQOA 4RGNA 5J39A 2Q2IA 2JP1A 1SNCA 1Y14B 1KLUD 4R8IA 1A3TA 2EJMA 1DZ1A 4J6HA 1I3QB 2WFWA 2JA8H 1KQSA 1AZQA 2WAQB 1UE5A 3EA6A 2K7VA 2Z0SA 1OXUA 3HOZG 3U4ZA 1JE5A 3CQZH 5AJ3L 3AQQA 1CKMA 4DAVA 2JN4A 1EL0A 1UAPA 4DR4L 1PTOB 1AFPA 1SAPA 4LFBQ 3FP9A 2VS1A 1AH9A 1HQMC 3M9BA 1EIHA 1Y69U 5IYDG 2EPBA 4DXGA 4DA2A 3J7ZC 1ENAA 1QUQA 1LTGD 2JK8A 5ELFA 2A1AA 2AQ2B 3S14B 3PIO3 1RTNA 2DUDA 3LNNA 1OTCA 1TY2A 3EIVA 4KN7C 1QB5D 1TWFH 2PCFB 1A62A 3F2CA 1PH5A 4HSPA 4P73A 1N32Q 2MHVA 2CH4W 3U4VA 1L2FA 4F87A 5IOCA 1EIFA 4L5TA 1S4ZA 3RNUA 2B8FA 2ALYB 1A63A 2KCMA 2YU9H 5GADC 4OX9Q 1KABA 2JSOA 1VCIA 2X69A 5KNCA 2NZOA 1O7YA 4BA1I 5JOBA 4GKKQ 5AFWA 3J80c 3FEWX 5JJLA 3BJUA 1EZ6A 2Z6BA 4AYBG 3G4SA 3JC66 4JI3Q 1B3AA 3HFZB 4R4IA 4MTNA 5DAUA 4QUCA 4A3EG 3HKZG 3S9WA 5CC4A 1TWGB 3STBC 5KIXA 4KHPQ 4A3IB 3BVZA 1S5FD 5EKLA 4R4TA 3BVMA 2CKZB 2ENBA 2G9DA 2KCTA 1SLJA 5A2QL 5C4JB 5FKAC 1U9RA 1WJJA 5H1SE 4RKLA 1E0BA 1SJED 3NTHA 4WJWA 4FF4A 4KI0A 4CKBA 1BBUA 1X3QA 1SYGA 1N9WA 2EYMA 3K6OA 4C3JH 4R1JA 2KEEA 2PW7A 3J80E 1J9OA 1N34L 3TRZA 2D5DA 4H0LC 1XNQQ 1I5FA 4F8MA 2R7ZB 1HR0Q 4DK1A 4DV4Q 1GUNA 4DK6C 3GTGB 2ZTEA 4KHPL 1X6OA 1Q8KA 3HOUB 2K4KA 1V9PA 2UUCL 1Q3LA 1EYAA 3LWEA 4RGMA 1NNXA 2NVXH 1S72A 4YHHQ 3PUVA 1C48A 5FOBB 2KUMA 3RD4A 1YNXA 3HOWG 1F9QA 1LO5D 4QIWB 1TWHH 5IYCH 1IBML 4B3ML 5D3IB 2IX0A 2RCNA 2RVLA 2B2VA 3Q23A 1KRSA 3KDFB 1NMFA 1R9TH 1FR3A 1L1OB 1K8MA 1PZID 4A76A 2R92B 3UDIA 1TWCH 1XPOA 4A3BH 3SDZA 4J8QA 3L9AX 3NBHA 3IFDA 1FGUA 3S17B 1I6VC 1M90C 2KCCA 3OYYA 2C5CA 3TP7A 2LMCB 1F2LA 3CCJA 3CCMA 3QOJA 3E0JA 4CDEC 3K59A 2F0IA 1MD2D 3AB9A 4JYAL 1HRJA 3BG3A 4FDBA 1YJ9A 2WP8J 2K5NA 3DM1A 2CWPA 4QJFA 3HKZE 4A3JH 4DV3Q 3AEVA 4HJAA 1YNJC 1I4GA 3D4DA 4K2LA 5C4XH 3CKIB 3I4LA 2F52A 1IL8A 5FLXE 3A5ZB 2L0CA 1PRTC 5C4HA 1KDAA 2CWAA 3Q24A 4CGYB 2AQ1B 1BUVT 1S5CD 2QCPX 3H6MA 2XWJB 4FO2A 4OO1H 1PTOH 1V43A 3K8AA 1JB3A 1EYGA 3S2HB 3K80C 1B9MA 3H0GB 1IYJB 2OT2A 4ABNA 4RGOS 4CJ1B 5CBEE 4LFCQ 1B44D 2ZJRA 3Q0AA 2AHOB 2K04A 3I3CA 1YNND 4L63B 5L37A 1Y8PB 1DYQA 2E8GA 5ELBA 1SR3A 1KIXA 5C4XG 3J81L 2B2YC 1KLGD 1WCMH 5I9OA 2G9HD 1E2ZA 5LMUQ 5I6WA 3CC7A 4JI6L 2NVYB 1FNVA 2K28A 1WFQA 1LT5D 5A35A 3MZ5A 5M5XH 4ZKCB 1L0YB 2C35B 5IYBG 1YBYA 5IP7G 1IL2A 5ELNA 2L11A 1QNKA 1GXDC 1Y1VH 3VR4A 3PIPA 5KRUA 3A74A 4JI4Q 4LF8L 5IYDH 1ZYRD 3KYHC 3NBIA 5IT9c 2D0OA 2CHBD 2VB2X 3GTGH 2H1EA 2F4VL 4S3SA 3TP8A 2A73B 4IFDJ 5IP9G 4H13C 1WTQA 2R93H 2JA7B 4K14A 4H7BA 3K57A 4Q5VA 1DD2A 5IYCG 1ML0D 1EEID 3VR2A 2CQAA 1N34Q 1NSNS 5ELCA 4A3IG 1QCBD 2ASBA 3D31A 3HOVB 2A69C 1BCPB 4HCEA 1VMPA 3SK6A 4C3HG 1PHJA 4RCOA 4JW0A 1BF4A 1O78A 5C4JH 2E5LQ 1XX8A 1HUNA 4A3FB 2NYZD 1STHA 2L55A 1FJGQ 1GUGA 1SYBA 3GTLH 4HJ9A 1EUJA 2PW5A 1XJVA 4B3RQ 2E2IB 1HR0L 3RZOH 4APVA 1LLRD 3NPPA 4FXGC 1PH6A 2PPBC 1DCZA 3D4RA 2K33A 5C3EG 3BU2A 1MSGA 4P75A 2ICEC 4LF8Q 2PI2E 2R3ZA 3A8JE 1VQ4A 1JWMD 2QA4A 5DM73 1MKHA 3DLLA 1RDPD 4HR7B 5KYLA 2QEJC 3GTQB 3NHHA 3GTPH 2NVYH 3I4MH 1CSQA 5FO7B 5J22A 2CFMA 3B6YA 1IBKL 3HG9A 2UXDL 1A15A 1FNUA 3OOCA 2BE5D 4LUVA 4B9XA 4LF9Q 5CV7A 2DJFC 1EZ8A 4DV1Q 4A3EH 1EY0A 2J0TD 3NUCA 1X3PA 1SRUA 2UXCL 3H0GG 5IWAQ 1EQQA 4KV6A 4LF7L 3O13A 5FLMH 3H0GH 2CW0D 4JI8L 2R7DA 4RG1A 4A3GB 4DR1L 4NW2A 3SEBA 3CCQA 4GZYC 5NUCA 3DUZA 3SR1A 2UU9Q 3MVVA 5HGTA 4XIGS 4BWGB 1S40A 4HMJA 1HA5A 1Q90A 4L8JA 3G71A 1Z7TA 2R92G 2VUMH 4BY1G 3DMUA 1HHVA 1JR0D 3WOEA 2D0PA 5GROA 4MN3A 4HAEA 2NB0A 1EU4A 2X6GA 1X56A 1P16A 1GUOA 2SOBA 4HEDA 5LMNW 4GN4B 1NCVA 3OWEB 4IPGA 3A0JA 3RZDH 1K73C 4DNTB 5IT9L 3SXHA 3TN2A 1OXXK 4QL5A 1V1PA 3FKIB 2JA5H 2A19A 4OONA 3GP7A 2B2YA 4JI7Q 4OO1I 4DR2Q 3CF5A 2XWBB 1II3A 1VQBA 1H95A 1EYCA 5FLXc 1PH8A 1T5XD 3MTSA 3CMAA 5JJZA 3EQLC 2I5HA 4ID6A 1PTOC 2BCOA 3M3YB 3W5OA 3T53B 1NE3A 4YWMA 4AQYL 2RCFA 2PZTA 4DNIA 1VQOA 2JEBI 4I65A 3HKSA 4FF2A 4ZUJA 3LX0A 2V1CC 4JI5Q 2EYFA 1TXYA 4K0KL 3QIAA 2IT1A 1F9PA 2EXDA 2JA9A 1K83B 2LY7A 4CJ0B 1E1TA 1F2YA 1AW7A 1SBBB 2FXQA 2Z9HA 3S1RB 1BVSA 2BA1A 4DV5Q 1TR5A 3NWSA 1SNPA 2NZ1D 3L2PA 1SYDA 3P20A 4DR5Q 5JJKA 1U4LA 1U0LA 2KEDA 4H02A 4Y7NH 3K7AB 4PG3A 4C3JB 4AYBE 1CM9A 3GTJH 4L6TB 4DR2L 2EDGA 1VQPA 3S2DH 4DUYQ 1B9NA 1Y1WB 3PUZA 4G7ZC 4IUPA 2Q8TA 3S24A 1G2TA 3E9IA 4OWTB 1PFMA 4KN4C 3S1QB 4KJNA 2GA4B 5CBAE 1VQ6A 1EY7A 2EQSA 4A3MB 4GKJL 5HGQA 4DAYA 1IBLL 4JVZA 3S16H 1TWGH 5FO9B 4JI1L 5KNDA 3P75A 1XMQQ 1AEXA 1Q81C 1PDQA 3DEPA 1B70B 2EY6A 1I50H 1SNDA 2F0NA 2XRSD 2IY5B 3D0FA 3KF8B 4C3IB 3S16B 4X62Q 4B3SL 3H3VC 1PRTF 2AUKA 1EWHA 2EVBA 2OQ0A 2QDLA 3RN5A 4K8IA 1XNRL 5KYIA 4A3JG 1Y1WH 2R7ZG 1TU2B 3S2DB 3M85A 2UUCQ 2EYPA 3K7AH 1JOKA 1PH1A 5JEAH 1PYSB 2TMPA 4QIWE 4ILWA 4NKLA 1NR2A 3PCOB 5F2DA 3V05A 4F7XA 1XNQL 2B2TA 4IFDG 1SDFA 3MAQA 1D6EC 1F9SA 4DAYB 3VA7A 4HCSA 4KKUA 1XPRA 5EKIA 3TP6A 2CVRA 1K0RA 1HZ9A 1F2ZA 3H3VH 1HCZA 4QCLA 1B7YB 2C9OA 2VZAA 3K58A 1EOVA 5M5WH 4ZUIA 1WD1A 2KOLA 2KHJA 3DXJC 1JMCA 2YTXA 4DNRB 3H09A 2QEXA 3D6CA 1X3GA 1CK1A 4BY7H 3HS0C 2QW7A 1YNJD 4DAMA 4IUVA 4QQBX 5M5YB 3I8ZA 3MEFA 4N8FA 1N36Q 4L5SA 3PUYA 5M5YH 1Q7YC 4LF4Q 3VYUA 3E5SA 3D6WA 1PFBA 5IGCA 1H9SA 3PF4A 3T1HL 2ZXOA 4OX9L 3MXUA 1QVCA 4FXKC 1BQQT 1VQNA 3U58A 1JJGA 1Q1EA 2H4OA 4KLKA 5IYBH 1SMXA 4ZAIA 3ONAB 1M1KC 1CKOA 4X65L 1SSOA 2RSNA 3FKIG 2A6HD 2RDHA 1D1IA 4DR3L 1EFWA 1Y1WG 4K6DA 1QVGA 4PQXA 3C3LA 2M2LA 1WCMG 4JI0Q 3QJYA 4DR7Q 3TS2A 4K0KQ 1Z9FA 3A7AB 1DGSA 4TSSA 4JI8Q 2L15A 3A8KE 4HIMA 2F0TA 2L4NA 3URYA 1I94L 3KFUA 1M4VA 1XMOL 3KJPA 4A3GH 2HHHL 4RA8A 1EQTA 1MHWC 1PFNA 3PMFA 5D65A 2KBNA 1K8GA 3W1BA 1IKMA 1F2MA 4UP8A 3I90A 4HN7A 2XIWA 4WRDA 4HIOA 2JEAI 4DV6L 2HIVA 3MXGA 1AZPA 3TDQA 4GKJQ 3MC0B 4OO1G 1IBLQ 4EQPA 4LF4L 4UP7A 3J7AF 4DR4Q 1A2TA 4ME3A 1RIPA 4JI4L 1H9MA 3TBIB 4DR7L 4DUYL 2HDMA 2FHTA 3DM3A 1JWUD 3U9SA 4B08A 3GTQH 2B2TC 2F0HA 4OGQC 3BZCA 1S3OA 4EQOA 3AFQA 4XDXA 2JA6B 2FINB 3KLRA 1LACA 3F8TA 4KJOA 1J5EQ 3GTMH 5K36H 5ELDA 4B9WA 3M4QA 3HOUG 4PV1C 2IX1A 4JPBW 1CZGA 1A3VA 5C0XG 3IKJA 1WI5A 3RLOA 4A3FG 1NBWA 3S1QH 2OXPA 3VDYA 2XNAC 2K5DA 1G291 4XTCS 2UUBL 2NUCA 4IOAA 1ET6A 4CBVA 4X62L 3Q6SA 4K2KA 1GUSA 3OWFA 1O7LA 4DR1Q 4A3CH 4BBSH 1BCPF 3KJOA 1Q1BA 1VQ5A
chains in the Genus database with same CATH topology
3RLFA 5KNBA 3GV6A 5LL6X 3PV0A 1NAPA 2R93B 3FVQA 2SEBD 5CGKA 1ZKOA 4K6LA 2HCCA 2MP1A 1SNMA 3VYSA 4XYQA 2F0WA 1KAAA 1Y1VB 1ESRA 4KHVA 4G57A 5M5XB 1K8OA 1EYDA 1DOMA 2Z8LA 1GHKA 2F0PA 2JE6I 3EFXD 2BE5C 4C3JG 3BYYB 1LT4D 2B2VC 4OIKA 4XT1B 5I2XA 4UAIA 1E2WA 4IFDI 1ET9A 2Y0SB 3VYTA 1LV9A 2SDFA 1ENCA 3PIP3 3A8IE 1UNSA 2E2JB 4X3SA 1QNUA 1EIGA 1QG7A 5COYA 2JA5B 1Y8OB 4V0BA 4KMUC 3A56A 5A2QE 3BZDB 5D14A 2NWGA 3EROA 2EOTA 3ND9A 2MGSA 4K5XA 4ZKBB 1SNOA 1WTXA 2VUMB 1WTOA 3NSWA 3J80L 3VYRA 2IJ0A 1IHZA 2XN9C 4K8JA 2AQ3B 3CHBD 2M00A 1JE4A 3D3RA 1JQYD 1RD9D 1Z6HA 5KEEA 3S1NB 3HOZB 3HP3A 2WKDA 4DXFA 2A68C 4QF4A 1IW7D 4A3EB 3DWAA 1NUCA 3X3MA 1STYA 3A54A 1EWCA 5TSSA 1TWCB 4R8NA 3I4NB 2RBMA 5CORA 2YYZA 1TS4A 2FMCA 1R9TB 3P7JA 3GTPB 3I4MB 1Q8IA 4Z9CB 3L3OC 1SXTA 1VDZA 2A69D 5G3LD 1IYUA 2LS01 3QG1A 1IW7C 3BVGA 1CZWA 4ZRZA 4BBRB 1DONA 2EY2A 3NQIA 5I9PA 1CFMA 3M4OB 3GD7A 4OIJA 3SK4A 3CRLC 5J1ZA 2K01A 3SE0A 5T1IA 3QB3A 3MFYA 4KD3A 3OHXC 3VR5A 4KTAA 5CV9A 3JAME 1LTTD 2ZT9C 2KA7A 1CA6A 4A3DB 1PTOD 4ZLTF 1O80A 5LHY1 2XVSA 3OIQA 1H9KA 2A74C 1XTCD 3KLSA 1HUMA 4C56C 2AWOA 3J81E 1OXTA 2NVQB 1BXTA 2I46A 4DF7A 4RH6A 1G8ZD 2FJ2A 5EBCA 3LWUA 3KBXA 5JVH3 2VXWA 2Q8RE 1ONLA 2JXMB 1T5EA 3OW7A 5DNFA 3NTKA 4PMWA 3DWQA 2KCNA 2EY1A 3NE5B 2HQEA 1H9SB 2WIIB 4BY7B 3G6JB 2K5QA 2MJ8A 5E4WC 4X3TA 2NN6I 2NTSA 1WTWA 1WTPA 1SEBD 3KK7A 5M5WB 2PZWA 5CMDA 2RA4A 3VA5A 5C3EB 4EVOA 1BR9A 3TZUA 2QDBA 4DK0A 5G3LF 4MIUA 2F0OA 2A68D 2F0LA 5C4XB 1EY4A 3HEJA 3J7YW 1M8AA 4IZ8A 4ZYSA 5BN3A 1PMRA 1ZEQX 4R9WA 5IGDA 1HTPA 1TVXA 3CQZB 3DHQA 1W6JA 3RMHA 1CHQD 3R8BA 3T56B 5CV4A 3BDLA 5C5LA 2TSSA 2FMMA 4EGVA 1HQRD 3N52A 4ULLA 1KNAA 4DGZA 3QOLA 2F0JA 1XWEA 3C1EA 2BOSA 5C0XI 1JCKB 3R93A 4K5VA 2F0FA 5HURA 3V96A 2BDNA 4G7HC 1TQOA 2OF1A 3GTLB 1G91A 1FNWA 3C46A 4E6IA 1LABA 1PRTD 1STEA 1FD7D 5IIFA 5FO8B 1DOLA 1TS2A 1QILA 1RJTA 4JBWA 1CHPD 3GTJB 5KGUA 1LT6D 1WTVA 2L1BA 3H94A 1HPCA 3SK5A 2IX3A 2PQEA 1G2SA 1B4OA 2RQXA 4KK7A 5IT9E 2KQ3A 5I2YA 3BDOA 2AUJD 4V190 3K5NA 1JICA 1VF5C 3HOXB 2NTTA 1JOOA 3PUWA 4J1MA 3L7ZC 1MI2A 3NWTA 4WORA 1DM0B 3TMEA 1QJOA 4M8AA 3GQBA 2EYLA 5EPJA 2JYOA 5M3MB 2F03A 3MHBA 1V1PB 4WFN3 1F77A 2F0MA 1GUTA 3K5OA 3Q22A 2L5TA 3RZDB 5IGGA 3SHLA 2VB3X 1TWFB 3GTOB 1ESFA 2BA0A 1TT2A 2EZVA 1H9JA 2WV6D 3KBGA 1HXYD 3EVQA 4TQUS 1STAA 4HSVA 4CJ2C 1FYCA 2XRQD 4YIJA 3QWNA 2F0SA 1B1ZA 2E76C 2A5HA 3NTIA 2A6EC 3HOYB 2DNEA 3BDCA 1U4RA 2I07B 1JC7A 3CU7A 1H9RA 3ITPA 3SK8A 4NP5A 4FVMA 1Z47A 2L12A 4XT3B 1AN8A 2RDFA 1VF7A 4A3BB 3IL8A 4KHZA 2Q8IB 4DN4M 3ND8A 4I7ZC 5LL6S 5C0XJ 4FNFA 3K5LA 1IKLA 1TWHB 4RWSC 1PLFA 5E1FA 5C6AA 1BOSA 3D8GA 4RKBA 4KY7A 2NVXB 2RSOA 1HFGA 3NK9A 2OEOA 1ILPA 2F0VA 2J7ZA 5M3FB 3KLSX 3HKZB 2F3WA 2DN8A 2IWHA 1DJRD 1G6ZA 2EYJA 5IGFA 2F1MA 5ELEA 1WTRA 2DY7A 2EXZA 1I4RA 3RUZA 1RTOA 2F0GA 4JK1C 3FDTA 2Z4HA 1A3UA 2PO4A 3U9OA 2KECA 1RKNA 4MHEA 4BA2I 2CW0C 3MXNA 5JAVA 4ODGA 3BS1A 1FGBD 2F0DA 2QF7A 2F0KA 4EQNA 1SFOB 1EQVA 1MSHA 1IYVA 2NBFA 2LKVA 3WOFA 5BN5A 4KY6A 3D4WA 2NN6G 1KDCA 1WCMB 1Q12A 1L0XB 4LMQD 2ZXPA 2YU9B 1TY0A 3J7AV 1BCPD 3KUPA 1STBA 3DWPA 4IUTA 3C1FA 1D1KA 4P2CB 1KDBA 4XQNA 3IFTA 3MWYW 1HFNA 2EJGC 4PMCA 3UI2A 3S1MB 4LAAA 2EYHA 1TWAB 1QWYA 3SVMA 2QILA 1SYFA 4NMZA 4RHSA 3F2UA 1KNEA 1SNQA 1WD0A 2SNMA 1BBXC 1PZKD 5EKKA 1X32A 3AU7A 2B2WA 1CQVA 3WDNA 1MBYA 4O1NA 4PNYA 1RCVD 2F0EA 2JA8B 1GHJA 4IALA 3OMGA 1D2BA 3DEOA 1V1OA 1UEAB 4HTHA 1LTID 3W2DA 4KKSA 4A93B 4CKCA 3I73A 4IUUA 2F0UA 4N9TA 1CA5A 4IUNA 3I72A 4QUFA 3N6RA 2BDOA 3QO2A 2X6LA 1LTSD 2HCIA 2F0QA 2N55A 1D5ZC 3TZDA 1V8QA 2K6AA 1EY5A 3S15B 1QOHA 2PZUA 5I4DA 1O7ZA 2EE1A 2ZXRA 4M1UB 3KF8A 5FLXL 4BBSB 5BN4A 2K1BA 1TIID 5CV8A 5JEAJ 1KTKA 4X3UA 1CTMA 2A6HC 1A6XA 4FXDA 4X3KA 1SE4A 4TKOB 1LTRD 1EEFD 2WACA 1WVLA 3A7LA 3T13A 1JORA 4LK1C 2O4XA 1HA6A 1TKWB 2KHSA 1I6HB 4F88A 3FMCA 2K5WA 2D2CC 1QE6A 5EPLA 3GTKB 1GOZA 1HTLD 4OL7A 1JOQA 2O5JC 2F4IA 2B2WC 1EY9A 2IW3A 1J8IA 4NDXA 5IODA 4U68A 3VR6A 3VR3A 2NN6H 5E3FA 1D5MC 2MPMA 3PUXA 3GO5A 3A55A 5EJWA 4TRDA 4ZK9B 4Q0FA 5C0XH 5ISRA 3CRKC 1RODA 3H91A 5T1GA 1I4HA 5C44B 1PRTB 1BCPC 3EJIA 4RGTA 2E75C 2KJXA 5JVG3 1BNZA 2B8GA 1ICWA 2O5IC 2M9VA 3V2TA 4C1NI 1E2VA 1LTAD 4KKTA 2B2UC 2O2LD 2F3VA 2K05A 2HUGA 1SJHD 1I4PA 4DAPA 2PNRC 2MUYA 5D3DA 1RHPA 1Y8NB 3FPPA 3HGBA 5EBDA 1YNNC 1JWSD 2K03A 4FYDA 2K32A 4ZQ3A 3JAML 1B50A 1TS3A 2IPKD 2B39A 4UDUC 5FK9C 1STNA 3PO3B 1BO0A 3I70A 1UUPA 3MFGA 2QKIC 1EY8A 4C3IG 4RHRA 4C2MB 3G7LA 3PO2B 1SE3A 3T16A 2D62A 3E6ZX 3C2PA 3I91A 3GV3A 5C3XA 1PTOF 2E2DC 1EFID 3W3AA 5C5MA 1C8CA 1OXVA 1W6KA 4XQJA 4U673 3HRZC 1LTBD 1SE2A 1S5DD 1EOTA 5K5PA 3OPOA 1SMYC 3IAYA 4FF3A 4PMBA 2LFNA 3T51B 1ZYRC 5C3WA 5C4ZA 5JPMC 2V4DA 5I6YA 3OSOA 5EPKA 5JEAG 2WINB 4FP5D 1SMYD 5K36G 2HDLA 4IN3A 2PYKA 4XYOA 5JPNC 4AYBB 1PYWD 4LJZC 1A2UA 1U4MA 2B2UA 1XYIA 1SYEA 3FPUB 1I4XA 2J4XA 4CKEA 4DU9A 2DY8A 1BDOA 1ZXTA 2WKCA 3MEHA 2B63B 2Z4IA 2ID0A 4QMGA 2A6ED 1VMCA 3R2IA 1R4PB 4CHTB 1B53A 4A3KB 4BY1B 1CT1D 1NR4A 5CV5A 1U4PA 5CR3A 4OHJA 3OIPA 5IGBA 3FRPB 2EY5A 2Z1CA 1I4QA 1LT3D 3K0YA 1SYCA 2IL8A 5M9OA 5IGEA 4FF1A 3T4AC 2N88A 4RAUC 1ENFA 1ILQA 2D9UA 4BS9A 3ZYYX 1OXSC 3MXPA 4HMIA 2R61A 2NVTB 3M7NA 4A3JB 1EU3A 4K5WA 2RDGA 1DXMA 3HOWB 2E74C 1OO9B 3M7GA 3P1HA 4IQZA 3NP8A 4RCNA 2EYOA 1S5BD 4XXEA 3ERQA 1AP0A 3R2TA 2L9HA 4C1NK 1STGA 2EJFC 4RFBA 3MA2B 1PZJD 1TS5A 4IFDH 1DOKA 5E4XA 1GJXA 3AMUA 1C4QA 1B2TA 1EY6A 1I50B 2PMZB 1GUWA 3GTMB 4KY5A 4XQQA 1R4QB 2AWNA 3BYTB 3RZOB 5CYUA 2RKSA 5DEHA 2R6GA 1S5ED 1D5XC 4C3HB 3TSSA 4H44C 4DFAA 4KD4A 1PXUA 3HZXA 4G4KA 2VNUD 3R3OA 2FFKB 2E2HB 4Y7NB 4ME5A 2WB1B 3TP5A 1RF2D 3M4YA 3NQTA 2KVMA 4IURA 5CV6A 1F9RA 5EQ0A 4IUQA 3K5MA 1CI3M 2XSCA 4G7OC 4N9PA 4QB4A 5EGTA 3X3NA 3OMCA 1XXGA 4O42A 3NXWA 2DNCA 5DM63 1MGSA 2SNSA 1CQFA 2ICIA 4RGNA 5J39A 2JP1A 1SNCA 1KLUD 4R8IA 1A3TA 2EJMA 1DZ1A 4J6HA 1I3QB 1AZQA 2WAQB 3EA6A 2K7VA 1OXUA 4DAVA 1EL0A 1UAPA 1PTOB 1AFPA 1SAPA 1HQMC 1EIHA 1Y69U 2EPBA 4DXGA 4DA2A 1ENAA 1LTGD 5ELFA 2AQ2B 3S14B 3PIO3 1RTNA 3LNNA 1TY2A 4KN7C 1QB5D 2PCFB 4HSPA 2MHVA 5IOCA 4F87A 1S4ZA 2B8FA 1KABA 2JSOA 1VCIA 2X69A 5KNCA 1O7YA 4BA1I 5JOBA 5AFWA 3FEWX 1EZ6A 1B3AA 5DAUA 4QUCA 3S9WA 5CC4A 1TWGB 5KIXA 4A3IB 3BVZA 1S5FD 5EKLA 3BVMA 2ENBA 2G9DA 5A2QL 5C4JB 5FKAC 1U9RA 4RKLA 1E0BA 1SJED 3NTHA 4WJWA 4FF4A 4KI0A 4CKBA 1X3QA 1SYGA 3K6OA 2EYMA 2KEEA 2PW7A 3J80E 1J9OA 2D5DA 4H0LC 4F8MA 2R7ZB 4DK1A 1GUNA 3GTGB 3HOUB 1Q3LA 1EYAA 3LWEA 4RGMA 3PUVA 1C48A 5FOBB 2KUMA 3RD4A 1F9QA 1LO5D 4QIWB 5D3IB 2IX0A 2RVLA 2B2VA 3Q23A 1FR3A 1K8MA 1PZID 2R92B 3SDZA 4J8QA 3L9AX 3NBHA 3IFDA 3S17B 1I6VC 2KCCA 2C5CA 3TP7A 2LMCB 1F2LA 3QOJA 3E0JA 3K59A 2F0IA 1MD2D 3AB9A 1HRJA 3BG3A 2WP8J 3DM1A 1YNJC 1I4GA 3D4DA 4K2LA 3CKIB 3I4LA 1IL8A 5FLXE 2L0CA 1PRTC 5C4HA 1KDAA 3Q24A 4CGYB 2AQ1B 1BUVT 1S5CD 2QCPX 3H6MA 2XWJB 4FO2A 4OO1H 1PTOH 1V43A 1JB3A 3S2HB 1B9MA 3H0GB 2OT2A 4ABNA 4RGOS 4CJ1B 5CBEE 1B44D 3Q0AA 2K04A 3I3CA 1YNND 4L63B 1Y8PB 1DYQA 5ELBA 3J81L 2B2YC 1KLGD 5I9OA 2G9HD 1E2ZA 5I6WA 2NVYB 1FNVA 2K28A 1LT5D 5A35A 3MZ5A 4ZKCB 1L0YB 2L11A 1QNKA 1GXDC 3VR4A 5KRUA 1ZYRD 3NBIA 2CHBD 2VB2X 2H1EA 4S3SA 3TP8A 2A73B 4IFDJ 4H13C 1WTQA 2JA7B 4K14A 4H7BA 3K57A 4Q5VA 1DD2A 1ML0D 1EEID 3VR2A 2CQAA 1NSNS 5ELCA 1QCBD 3D31A 3HOVB 2A69C 1BCPB 4HCEA 1VMPA 3SK6A 4C3HG 4RCOA 1BF4A 1O78A 1XX8A 1HUNA 4A3FB 2NYZD 1STHA 2L55A 1GUGA 1SYBA 2PW5A 2E2IB 1LLRD 3NPPA 4FXGC 2PPBC 1DCZA 3D4RA 2K33A 1MSGA 2ICEC 2R3ZA 3A8JE 1JWMD 5DM73 1RDPD 4HR7B 5KYLA 2QEJC 3GTQB 3NHHA 5FO7B 5J22A 3HG9A 1A15A 1FNUA 3OOCA 2BE5D 4B9XA 5CV7A 1EZ8A 1EY0A 2J0TD 3NUCA 1X3PA 4KV6A 3O13A 2CW0D 4A3GB 4NW2A 3SEBA 4GZYC 5NUCA 3DUZA 3SR1A 3MVVA 5HGTA 4XIGS 4BWGB 4HMJA 1HA5A 1Q90A 4L8JA 1Z7TA 3DMUA 1HHVA 1JR0D 3WOEA 4MN3A 4HAEA 2NB0A 1EU4A 2X6GA 1GUOA 2SOBA 4HEDA 1NCVA 3OWEB 4DNTB 5IT9L 3SXHA 3TN2A 1OXXK 1V1PA 3FKIB 3GP7A 2B2YA 4OO1I 2XWBB 1II3A 1EYCA 1T5XD 3MTSA 5JJZA 3EQLC 4ID6A 3M3YB 1PTOC 2BCOA 3T53B 2PZTA 2JEBI 4I65A 4FF2A 4ZUJA 3LX0A 2EYFA 3QIAA 2IT1A 1F9PA 1K83B 2LY7A 4CJ0B 1F2YA 1AW7A 1SBBB 3S1RB 2BA1A 1TR5A 3NWSA 1SNPA 2NZ1D 1SYDA 3P20A 1U4LA 2KEDA 3K7AB 4C3JB 1CM9A 4L6TB 2EDGA 1B9NA 1Y1WB 3PUZA 4G7ZC 4IUPA 2Q8TA 1G2TA 1PFMA 4KN4C 3S1QB 4KJNA 2GA4B 5CBAE 1EY7A 4A3MB 4DAYA 5FO9B 5KNDA 3P75A 1AEXA 1PDQA 3DEPA 2EY6A 1SNDA 2F0NA 2XRSD 4C3IB 3S16B 3H3VC 1PRTF 2AUKA 1EWHA 2EVBA 4K8IA 5KYIA 1TU2B 3S2DB 3M85A 2EYPA 1JOKA 5JEAH 2TMPA 4ILWA 4NKLA 1NR2A 5F2DA 3V05A 4F7XA 2B2TA 4IFDG 1SDFA 3MAQA 1D6EC 1F9SA 3VA7A 4HCSA 4KKUA 5EKIA 3TP6A 2CVRA 1F2ZA 1HCZA 4QCLA 2C9OA 3K58A 4ZUIA 1WD1A 2KOLA 3DXJC 4DNRB 3H09A 3D6CA 1CK1A 3HS0C 1YNJD 4IUVA 5M5YB 3I8ZA 3PUYA 3VYUA 3E5SA 3D6WA 1PFBA 5IGCA 1H9SA 2ZXOA 3MXUA 4FXKC 1BQQT 1Q1EA 2H4OA 4ZAIA 3ONAB 1SSOA 2RSNA 2A6HD 2RDHA 1D1IA 4K6DA 4PQXA 3C3LA 2M2LA 3QJYA 3A7AB 4TSSA 3A8KE 2F0TA 2L4NA 3URYA 1M4VA 4RA8A 1EQTA 1PFNA 3PMFA 5D65A 1IKMA 1F2MA 3I90A 4HN7A 2XIWA 4WRDA 2JEAI 3MXGA 1AZPA 3TDQA 3MC0B 4OO1G 4EQPA 3J7AF 1A2TA 1H9MA 3TBIB 2HDMA 2FHTA 3U9SA 1JWUD 4B08A 2B2TC 2F0HA 4OGQC 4EQOA 4XDXA 2JA6B 2FINB 3KLRA 1LACA 4KJOA 5K36H 5ELDA 4B9WA 4PV1C 2IX1A 1CZGA 1A3VA 5C0XG 3IKJA 2OXPA 2XNAC 2K5DA 1G291 4XTCS 2NUCA 1ET6A 4CBVA 3Q6SA 4K2KA 1GUSA 3OWFA 1O7LA 1BCPF 1Q1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STY A;  3SK5 A;  1STB A;  4KV6 A;  1STG A;  3E5S A;  2HQE A;  1A2U A;  3C1F A;  5IGC A;  2PQE A;  4R8N A;  2RBM A;  4KJN A;  1KDB A;  2F3V A;  5I9O A;  4F8M A;  5I6W A;  1EY7 A;  1SYE A;  2KQ3 A;  5CGK A;  5NUC A;  3SR1 A;  3MVV A;  5HGT A;  1SNM A;  1EYA A;  2PZW A;  2PYK A;  4HMJ A;  4PMC A;  1EY6 A;  3MZ5 A;  2WAC A;  4LAA A;  5E1F A;  1ENA A;  2EYH A;  2F0W A;  3VA5 A;  1KAA A;  3P75 A;  4KY5 A;  4DU9 A;  4EVO A;  3T13 A;  5C6A A;  2QDB A;  1JOR A;  1AEX A;  3D8G A;  1SYF A;  2O4X A;  4RKB A;  3MEH A;  4ZQ3 A;  4NMZ A;  1JOO A;  4K6D A;  2EY6 A;  3TP7 A;  5KRU A;  4KHV A;  4MIU A;  4G57 A;  2F0O A;  1SND A;  2F0L A;  2F0N A;  3DMU A;  4KY7 A;  1EYD A;  1EY4 A;  2EY2 A;  4J1M A;  1SNQ A;  1STN A;  2KHS A;  2RKS A;  2F0P A;  4QMG A;  5I9P A;  3HEJ A;  5DEH A;  4WOR A;  2SNM A;  3NK9 A;  2F0T A;  2OEO A;  3TME A;  4IZ8 A;  5EKK A;  3NUC A;  2F0V A;  4S3S A;  3TP8 A;  3SK4 A;  2F3W A;  2SOB A;  4OL7 A;  3PMF A;  4H7B A;  4K14 A;  5J1Z A;  1JOQ A;  4DFA A;  2EYJ A;  4KD4 A;  5IGD A;  4K8I A;  5IGF A;  1EY8 A;  2EYL A;  3SXH A;  3DHQ A;  3HZX A;  5KYI A;  1F2M A;  1EY9 A;  5IOC A;  2EXZ A;  1NSN S;  4WRD A;  4NDX A;  5IOD A;  3QB3 A;  3MHB A;  5CV5 A;  5M9O A;  4KD3 A;  1ENC A;  3R3O A;  4PNY A;  2EYP A;  5CR3 A;  2F0E A;  2F0M A;  1JOK A;  5CV4 A;  3QOJ A;  4ME5 A;  1II3 A;  5E3F A;  3RUZ A;  3SK6 A;  2F0G A;  1KAB A;  3T16 A;  5IGE A;  1EYC A;  3BDL A;  3OMG A;  4IAL A;  2F0I A;  4TRD A;  5C5L A;  3TP5 A;  4NKL A;  4EQP A;  1A2T A;  5JOB A;  1A3U A;  4KTA A;  5CV9 A;  4HTH A;  5F2D A;  2EY5 A;  3NQT A;  3U9O A;  4F7X A;  5IGG A;  4ID6 A;  5C3X A;  1RKN A;  5CV6 A;  3SHL A;  3ERO A;  5ISR A;  1STH A;  1EZ6 A;  5JAV A;  2PZT A;  1SYB A;  4DGZ A;  1SYC A;  4I65 A;  2F0H A;  4ODG A;  5C5M A;  3QOL A;  2PW5 A;  2F0U A;  4K5X A;  1TT2 A;  2F0J A;  4N9T A;  4N9P A;  3D4D A;  3LX0 A;  4K2L A;  4QB4 A;  4ZUJ A;  2F0D A;  5EGT A;  4EQO A;  2EYF A;  1SNO A;  3C1E A;  3TP6 A;  4IUN A;  3EVQ A;  3OMC A;  1F2Z A;  5C4H A;  5DAU A;  1STA A;  1KDA A;  2F0K A;  4K5V A;  4KJO A;  2F0F A;  5HUR A;  4EQN A;  3S9W A;  1EQV A;  5CC4 A;  4YIJ A;  1F2Y A;  3MXP A;  3EJI A;  2F0S A;  3NXW A;  4DF7 A;  4HMI A;  1IHZ A;  4B9W A;  5K5P A;  5KIX A;  2LKV A;  4ZUI A;  4K8J A;  1TR5 A;  3H6M A;  2F0Q A;  2M00 A;  2SNS A;  4KY6 A;  3BDC A;  5EKL A;  5IGB A;  1SNP A;  1TQO A;  1A3V A;  2OF1 A;  3D4W A;  4PMB A;  5KYL A;  3NHH A;  2ENB A;  3ITP A;  4K5W A;  3D6C A;  4E6I A;  5C3W A;  1KDC A;  1SYD A;  5C4Z A;  5IIF A;  5KEE A;  5J39 A;  5J22 A;  5I6Y A;  1SNC A;  1U9R A;  2OXP A;  3OSO A;  4RKL A;  1EY5 A;  3P1H A;  1A3T A;  2NUC A;  4NP5 A;  3SK8 A;  2PZU A;  4K2K A;  3OWF A;  4J6H A;  4B9X A;  3NP8 A;  4QF4 A;  5CV7 A;  3V2T A;  1SYG A;  2EYO A;  5KGU A;  1NUC A;  2EYM A;  1EZ8 A;  2RDF A;  2EY1 A;  2PW7 A;  1EY0 A;  3ERQ A;  5CV8 A; 
#chains in the Genus database with same CATH topology
 1D7Q A;  3RLF A;  5KNB A;  3GV6 A;  5LL6 X;  1SN8 A;  4DKA C;  3HOZ H;  3PV0 A;  3S1N H;  3HOW H;  4BY7 G;  1NAP A;  2R93 B;  3FVQ A;  5M3M G;  1MJE A;  1N33 L;  2SEB D;  4A4I A;  5CGK A;  1ZKO A;  4K6L A;  2XTI A;  2HCC A;  2MP1 A;  1SNM A;  3S1R H;  3VYS A;  4XYQ A;  2F0W A;  2OQK A;  1KAA A;  1Y1V B;  2LXJ A;  4DK3 C;  1PH9 A;  1X3F A;  1ESR A;  1CUK A;  4KHV A;  4G57 A;  5M5X B;  1K8O A;  1JB7 A;  1EYD A;  4NXN L;  1DOM A;  2Z8L A;  3TRE A;  1GHK A;  2F0P A;  2JE6 I;  3AFP A;  4GNX C;  4DV1 L;  3EFX D;  1X3E A;  2BE5 C;  2ES2 A;  4UPA A;  4C3J G;  3BYY B;  1LT4 D;  2B2V C;  4OIK A;  4OEM B;  4XT1 B;  3TEH B;  5I2X A;  4UAI A;  1E2W A;  4IFD I;  1ET9 A;  1HZA A;  2VUM G;  2Y0S B;  3VYT A;  2MO1 A;  1LV9 A;  2SDF A;  4DV5 L;  4DPG A;  1B8A A;  1ENC A;  3PIP 3;  3A8I E;  1UNS A;  3K0X A;  2E2J B;  4X3S A;  1QNU A;  1EIG A;  1QG7 A;  1XTD A;  4LUO A;  3KLW A;  5COY A;  1Y8O B;  2JA5 B;  4V0B A;  1K9M C;  4KMU C;  3CCS A;  3A56 A;  5A2Q E;  3BZD B;  3I56 A;  1E7Z A;  5D14 A;  2NWG A;  3ERO A;  2EOT A;  2R7F A;  5LMN L;  2UXB Q;  3ND9 A;  1NTG A;  2MGS A;  1HNZ Q;  4K5X A;  3MXN B;  1K28 A;  4ZKB B;  1SNO A;  1WTX A;  1VQL A;  2VUM B;  1WTO A;  3K7U C;  3NSW A;  3UE1 A;  3J80 L;  3VYR A;  2IJ0 A;  4RMF A;  4IPC A;  1IHZ A;  2XN9 C;  1CKN B;  4K8J A;  5GAG C;  2AQ3 B;  3CHB D;  2M00 A;  1AE3 A;  2VQE L;  4DV7 L;  1JE4 A;  3D3R A;  1JQY D;  1RD9 D;  1Z6H A;  4A93 G;  5KEE A;  3S1N B;  1BBW A;  3HOZ B;  3HP3 A;  2WKD A;  3PIO A;  4DXF A;  1UE1 A;  2A68 C;  4QF4 A;  1IW7 D;  4A3E B;  3DWA A;  1NUC A;  3X3M A;  1STY A;  3A54 A;  1EWC A;  1FVI A;  5TSS A;  1IBK Q;  1TWC B;  4R8N A;  2RBM A;  5COR A;  3I4N B;  2YYZ A;  1TS4 A;  3E9H A;  2FMC A;  1R9T B;  3P7J A;  3GTP B;  3I4M B;  2OTL A;  1Q8I A;  4Z9C B;  4A3L G;  3L3O C;  1SXT A;  1VDZ A;  2A69 D;  5G3L D;  1IYU A;  2LS0 1;  3QG1 A;  1IW7 C;  3BVG A;  1CZW A;  4ZRZ A;  4BBR B;  1DON A;  3PO2 G;  2EY2 A;  3CAM A;  3NQI A;  5I9P A;  1CFM A;  3M4O B;  3I7F A;  3GD7 A;  4X66 L;  4OIJ A;  3SK4 A;  3CRL C;  5J1Z A;  1WTH A;  2K01 A;  2MFI A;  3SE0 A;  1VQD A;  4A3L H;  1ICF B;  5T1I A;  3QB3 A;  3RR5 A;  2N3S A;  5IP7 H;  2Q2U A;  3MFY A;  4KD3 A;  1U5K A;  1W2B A;  1HH2 P;  4GS3 A;  4C2M H;  4BBR G;  3ERS X;  3OHX C;  3VR5 A;  4KTA A;  5CV9 A;  3JAM E;  1LTT D;  2ZT9 C;  2KA7 A;  3CC2 A;  1JJC B;  1CA6 A;  4A3D B;  2WAQ E;  1PTO D;  4MNO A;  2P5Z X;  3PO3 H;  1O80 A;  4ZLT F;  5LHY 1;  2XVS A;  3OIQ A;  2OCE A;  1H9K A;  2A74 C;  3GDE A;  1LM0 A;  1XTC D;  3KLS A;  1HUM A;  4OEL B;  4C56 C;  1C9O A;  2AWO A;  3UDF A;  3J81 E;  1OXT A;  4LFA L;  2NVQ B;  1BXT A;  2I46 A;  4DF7 A;  4RH6 A;  1G8Z D;  2G5D A;  2FJ2 A;  5EBC A;  5BR8 Q;  3LWU A;  3KBX A;  5JVH 3;  2VXW A;  1GO3 E;  2Q8R E;  4BXX H;  3HOV G;  1ONL A;  2JXM B;  4GLA C;  1V1Q A;  1K8A C;  1T5E A;  3KF6 B;  3M3Y H;  3KF6 A;  4WJ3 M;  3OW7 A;  5DNF A;  2Z6K C;  2YTY A;  2K50 A;  3NTK A;  2ZTD A;  4PMW A;  3DWQ A;  3EN2 A;  2KCN A;  4O2D A;  2EY1 A;  3NE5 B;  1T9H A;  1YIT A;  2HQE A;  1H9S B;  2WII B;  4BY7 B;  3G6J B;  4DR3 Q;  2K5Q A;  2MJ8 A;  4A3D G;  5E4W C;  4X3T A;  1KC8 C;  2NN6 I;  2NTS A;  2JJQ A;  1WTW A;  1WTP A;  1SEB D;  3KK7 A;  3H15 A;  2YV5 A;  5M5W B;  2PZW A;  5CMD A;  4AQY Q;  2RA4 A;  2H5X A;  4A3M G;  3VA5 A;  3IRB A;  5C3E B;  4EVO A;  1BR9 A;  3TZU A;  4L5R C;  2QDB A;  5C3E H;  4DK0 A;  5G3L F;  4WJ4 A;  4HJ7 A;  4MIU A;  4A3B G;  2F0O A;  2A68 D;  2F0L A;  5C4X B;  1EY4 A;  4GOP B;  3HEJ A;  1D8L A;  3J7Y W;  1M8A A;  3I4O A;  4IZ8 A;  4ZYS A;  5BN3 A;  1YIJ A;  1PMR A;  5E7N A;  1ZEQ X;  4R9W A;  5IGD A;  2PMZ E;  1HTP A;  1TVX A;  3CQZ B;  3DHQ A;  1VQK A;  1W6J A;  3RMH A;  1CHQ D;  3R8B A;  2NZH A;  3T56 B;  2VQF Q;  4DR5 L;  5CV4 A;  3S17 H;  1VQC A;  5M3M H;  3BDL A;  5C5L A;  2TSS A;  2FMM A;  4EGV A;  2UXD Q;  3NEL A;  1HQR D;  3T1H Q;  1PH4 A;  2PI2 A;  5BR8 L;  3GTK H;  3ULP A;  3N52 A;  4ULL A;  1HNX L;  1KNA A;  4DGZ A;  3QOL A;  4C3I H;  2ZM6 Q;  2F0J A;  1XWE A;  3C1E A;  3HOY G;  2NVQ H;  1MJC A;  2BOS A;  5C0X I;  1JCK B;  1VQM A;  3R93 A;  4K5V A;  4DV2 L;  1Y1V G;  2F0F A;  5HUR A;  3V96 A;  1VS0 A;  1C0A A;  2BDN A;  2E2I H;  4G7H C;  3HOU H;  2VQF L;  4LF6 Q;  1TQO A;  3J80 i;  2OF1 A;  3GTL B;  1G91 A;  1FNW A;  3C46 A;  4E6I A;  1LAB A;  1PRT D;  1STE A;  1FD7 D;  5IIF A;  4JBM A;  5FO8 B;  1DOL A;  1HNW Q;  1TS2 A;  1QIL A;  1RJT A;  4JBW A;  1CHP D;  1N36 L;  1NJI C;  3GTJ B;  5KGU A;  1LT6 D;  1WTV A;  2L1B A;  3H94 A;  1HPC A;  3SK5 A;  2IX3 A;  2PQE A;  1JT8 A;  3KOJ A;  1G2S A;  2K5H A;  5FJ8 H;  1B4O A;  2RQX A;  4KK7 A;  5IT9 E;  4JBK A;  4X64 L;  2KQ3 A;  5I2Y A;  3M4O H;  3BDO A;  4B3R L;  4TVA B;  2AUJ D;  4LF5 L;  4V19 0;  4JV5 Q;  1VQH A;  3K5N A;  1JIC A;  3PQI A;  1VF5 C;  3HOX B;  4A3G G;  2NTT A;  4PZ7 A;  1E22 A;  1JOO A;  4R4O A;  3PUW A;  4J1M A;  3L7Z C;  1MI2 A;  3NWT A;  2Z6K A;  4WOR A;  4LF7 Q;  1DM0 B;  3TME A;  5FJ8 G;  1QJO A;  4M8A A;  1FL0 A;  3GQB A;  1UEB A;  4IPD A;  2EYL A;  4CDD C;  5EPJ A;  1PV4 A;  2JYO A;  5M3M B;  2F03 A;  1O7I A;  4X6A H;  3MHB A;  4LF9 L;  1V1P B;  3OTO L;  5LMN Q;  4WFN 3;  1F77 A;  1E24 A;  2F0M A;  1GUT A;  2B29 A;  2MQH A;  3K5O A;  3Q22 A;  2L5T A;  5AJ3 Q;  3RZD B;  3S2H H;  5IGG A;  2JA6 G;  2K5V A;  2Q2H A;  1ASZ A;  3SHL A;  4YY3 L;  2VB3 X;  1TWF B;  4JBJ A;  4P74 A;  2ZM6 L;  3GTO B;  1ESF A;  4UP9 A;  2BA0 A;  1HZB A;  5HY6 A;  1TT2 A;  2EZV A;  5LMU L;  2ATW A;  1H9J A;  2WV6 D;  3KBG A;  1HXY D;  3EVQ A;  4TQU S;  1STA A;  4HSV A;  4CJ2 C;  4UY8 C;  1FYC A;  2XRQ D;  1Q46 A;  4YIJ A;  2A8V A;  3QWN A;  3S1M H;  2F0S A;  1B1Z A;  2E76 C;  4HJ5 A;  2A5H A;  3NTI A;  2A6E C;  3STB D;  1PA6 A;  3HOY B;  2DNE A;  4JC0 A;  3BDC A;  3F2D A;  1U4R A;  2I07 B;  2ZJQ A;  1JC7 A;  2UU9 L;  3CU7 A;  1H9R A;  2UUB Q;  3ITP A;  2LSS A;  1ASY A;  3SK8 A;  4NP5 A;  4FVM A;  1Z47 A;  2L12 A;  4XT3 B;  1AN8 A;  2E2J H;  5IWA L;  2RDF A;  1I3Q H;  1X54 A;  4IO9 A;  1PH3 A;  1VF7 A;  3KDF A;  4A3B B;  3IL8 A;  4A3K H;  4KHZ A;  2Q8I B;  4DN4 M;  1Q82 C;  3ND8 A;  4I7Z C;  5GAH C;  5M3F G;  5LL6 S;  2JA7 G;  5C0X J;  1N32 L;  4YCW A;  4FNF A;  3WWV A;  3K5L A;  1IKL A;  1TWH B;  4HIK A;  2I5M X;  4Y52 H;  2B63 G;  4RWS C;  4ZCK A;  1QZG A;  1PLF A;  4B3S Q;  5E1F A;  5C6A A;  1BOS A;  3D8G A;  4RKB A;  3J81 c;  4O0A A;  4KY7 A;  2NVX B;  2RSO A;  1HFG A;  4NXM L;  3NK9 A;  4A3D H;  2OEO A;  5C44 G;  1ILP A;  2F0V A;  2J7Z A;  2WAQ G;  5M3F B;  2KHI A;  2Q2T A;  3KLS X;  3HKZ B;  2F3W A;  2DN8 A;  3J81 j;  2R7Z H;  2IWH A;  1DJR D;  1G6Z A;  2EYJ A;  5IGF A;  2F1M A;  5ELE A;  1WTR A;  3UDX A;  2DY7 A;  2EXZ A;  3JAM c;  3CD6 A;  1I4R A;  1PYB A;  1RTO A;  1VQA A;  3NEN A;  2LXK A;  3RUZ A;  2F0G A;  4JCV E;  4JK1 C;  3FDT A;  2Z4H A;  1HJP A;  1A3U A;  2PO4 A;  4A75 A;  3U9O A;  4DUZ Q;  3I2Z A;  2KEC A;  5EAY A;  1RKN A;  4MHE A;  4BA2 I;  2CW0 C;  2UXC Q;  3MXN A;  5JAV A;  4ODG A;  3BS1 A;  1XPU A;  1FGB D;  2BH8 A;  2F0D A;  3NBH B;  1VQE A;  2QF7 A;  4X64 Q;  2F0K A;  4LFB L;  3F2B A;  4EQN A;  1SFO B;  1EQV A;  1MSH A;  1X55 A;  1IYV A;  4JOI A;  1WYD A;  2NBF A;  1MIU A;  2LKV A;  3WOF A;  1PH7 A;  5BN5 A;  1VQ9 A;  4KY6 A;  1X9N A;  1YZ6 A;  3D4W A;  4YWL A;  2NN6 G;  1KDC A;  1WCM B;  1Q12 A;  1L0X B;  4LMQ D;  2ZXP A;  1XMQ L;  2YU9 B;  1TY0 A;  2AMC B;  3J7A V;  1BCP D;  3KUP A;  2RHS B;  1LTL A;  3E3X A;  1A8V A;  1STB A;  3DWP A;  4IUT A;  2HHH Q;  2N8N A;  3C1F A;  2BH2 A;  1D1K A;  4P2C B;  4GN3 B;  4B3T Q;  1G51 A;  1KDB A;  4DUZ L;  2N49 A;  4XQN A;  3IFT A;  3MWY W;  4JI0 L;  2GVB A;  4NPS A;  2I5L X;  1HFN A;  4AIM A;  2EJG C;  4PMC A;  3UI2 A;  3S1M B;  4LAA A;  2I0Q A;  2EYH A;  2MO0 A;  4J15 A;  1TWA B;  1QWY A;  1GM5 A;  3SVM A;  2QIL A;  1SYF A;  5JJI A;  4NMZ A;  3J81 i;  4RHS A;  2B3G A;  3CCL A;  3F2U A;  1KNE A;  1SNQ A;  1WD0 A;  1J6Q A;  2SNM A;  3GTO H;  3UDG A;  1BBX C;  1PZK D;  5EKK A;  4GNX A;  1X32 A;  3AU7 A;  2B2W A;  2JA5 G;  1CQV A;  3ZJY C;  4DV0 Q;  4LNQ A;  4DV7 Q;  3CC4 A;  3WDN A;  2VQE Q;  3CCR A;  1MBY A;  1HR0 W;  1NY4 A;  4O1N A;  4PNY A;  1RCV D;  2F0E A;  2JA8 B;  3ER0 A;  2QGQ A;  1GHJ A;  4IAL A;  3OMG A;  1D2B A;  3DEO A;  2OTJ A;  4BY1 H;  1V1O A;  1UEA B;  1GVP A;  1K3B C;  4HTH A;  5FLM G;  3CPW A;  4YCV A;  2R92 H;  1LTI D;  4JG2 A;  4R4C A;  3W2D A;  1VQJ A;  1CSP A;  4KKS A;  4A93 B;  1YEZ A;  2UUA Q;  4CKC A;  3I73 A;  4IUU A;  4LFC L;  2F0U A;  4N9T A;  3CXC A;  3CCE A;  1CA5 A;  4HID A;  4IUN A;  1K0S A;  4DR6 L;  4QGU A;  5C44 H;  3I72 A;  3HOX G;  4QUF A;  3ULJ A;  3N6R A;  2Y0S E;  2BDO A;  2K52 A;  3QO2 A;  2X6L A;  1LTS D;  2HCI A;  1YI2 A;  2F0Q A;  2N55 A;  1D5Z C;  2F3I A;  4OXP A;  1VQ8 A;  3TZD A;  4CDF C;  3ICE A;  4JV5 L;  4BXX G;  1V8Q A;  2N78 A;  1LUZ A;  2K6A A;  2WB1 E;  5J3B A;  1FJG L;  1EY5 A;  3S15 B;  1QOH A;  3U50 C;  2PZU A;  5I4D A;  4NXM Q;  1O7Z A;  2EE1 A;  2ZXR A;  2XGT A;  3I4M G;  1N8R C;  4M1U B;  3KF8 A;  5FLX L;  4BBS B;  5BN4 A;  4CDC C;  1VQG A;  2K1B A;  1TII D;  1XNR Q;  5CV8 A;  1E3P A;  3T1Y L;  5JEA J;  2HIX A;  3CCV A;  1KTK A;  4X3U A;  5IE8 A;  1CTM A;  2CQO A;  2A6H C;  1A6X A;  4FXD A;  4C3H H;  4X3K A;  2IHE A;  4X65 Q;  3CME A;  1SE4 A;  4A3I H;  4TKO B;  3G6E A;  2DGY A;  4JOI C;  1LTR D;  1EEF D;  2WAC A;  2ZTC A;  4BBR H;  1WVL A;  1UWV A;  3A7L A;  3T13 A;  2R93 G;  1JOR A;  4LK1 C;  2O4X A;  5GAE C;  1HA6 A;  1TKW B;  2KHS A;  1I6H B;  1KRT A;  4F88 A;  4L5Q A;  2CH4 A;  4JI7 L;  4IPH A;  3RN2 A;  4LFA Q;  2RF4 A;  2K5W A;  3FMC A;  4JI2 Q;  2D2C C;  1QE6 A;  1UE6 A;  5EPL A;  3GTK B;  3CP0 A;  1GOZ A;  1HTL D;  1HZC A;  2K14 A;  4OL7 A;  1JOQ A;  2O5J C;  2F4I A;  2B2W C;  1PVO A;  1SE8 A;  4UHV A;  1EY9 A;  5IP9 H;  2IW3 A;  4IJL A;  3PO2 H;  1J8I A;  4NDX A;  5IOD A;  4U68 A;  3VR6 A;  3W1G A;  4BBS G;  3VR3 A;  2NN6 H;  4A3C G;  3TQY A;  5E3F A;  4DV4 L;  1D5M C;  2MPM A;  3PUX A;  3GO5 A;  3A55 A;  5EJW A;  4TRD A;  3S15 H;  2EIF A;  1K3R A;  4ZK9 B;  1W3S A;  1PFS A;  4ALP A;  4Q0F A;  3NEM A;  5C0X H;  5ISR A;  4JI2 L;  2Y0S G;  3CRK C;  1ROD A;  3H91 A;  3L0O A;  5T1G A;  3S14 H;  1I4H A;  5C44 B;  1PRT B;  2HT1 A;  1BCP C;  3EJI A;  4RGT A;  2E75 C;  3SGI A;  1WOC A;  2KJX A;  5JVG 3;  1KL9 A;  4GLX A;  1YVC A;  4A93 H;  1IZ6 A;  2B8G A;  1ICW A;  1BNZ A;  1GKH A;  3PF5 A;  1YHA A;  2O5I C;  2M9V A;  3J7A 5;  1QZH A;  3V2T A;  4C1N I;  3I55 A;  1E2V A;  1LTA D;  2VL6 A;  4AH6 A;  4KKT A;  4X66 Q;  1HNW L;  2B2U C;  2O2L D;  4YHH L;  3AYH B;  3CCU A;  2F3V A;  2K05 A;  3I4N G;  2HUG A;  1YHQ A;  1AE2 A;  3FHW A;  1SJH D;  1I4P A;  4DAP A;  2PNR C;  2ZJP A;  2MUY A;  5D3D A;  2HQL A;  2PQA B;  2B63 H;  1A0I A;  1RHP A;  1Y8N B;  3FPP A;  3HGB A;  2HD3 A;  1QUQ B;  5EBD A;  1YNN C;  1JWS D;  2K03 A;  4FYD A;  2K32 A;  1QVF A;  1TWA H;  4ZQ3 A;  4DV3 L;  3JAM L;  1B50 A;  1TS3 A;  1IXR A;  2IPK D;  2B39 A;  4UDU C;  5FK9 C;  4A3K G;  1STN A;  4N8X 1;  4B3T L;  1BO0 A;  3PO3 B;  4DR6 Q;  3I70 A;  1UUP A;  3MFG A;  1P8L A;  2GN5 A;  4JI5 L;  2CCZ A;  2QKI C;  1YHB A;  4GNX B;  1EY8 A;  4C3I G;  3TS0 A;  1B3Q A;  4RHR A;  4C2M B;  3Q8D A;  2E2H H;  3G7L A;  2DJG C;  3PO2 B;  1SE3 A;  3T16 A;  2D62 A;  3E6Z X;  3C2P A;  3I91 A;  3GV3 A;  5C3X A;  1PTO F;  2E2D C;  1EFI D;  3W3A A;  3T1Y Q;  4DV0 L;  2VW9 A;  5C5M A;  1I6H H;  1BKB A;  1C8C A;  1OXV A;  1NMG A;  4JI6 Q;  1W6K A;  1L1O C;  4XQJ A;  1LYL A;  4U67 3;  2F4V Q;  3HRZ C;  1LTB D;  2UXB L;  1SE2 A;  1S5D D;  2JA6 H;  1EOT A;  2VY3 A;  5K5P A;  1XMO Q;  3OPO A;  1SMY C;  5DLQ E;  1C7Y A;  3IAY A;  4FF3 A;  4LW1 A;  3UE0 A;  4PMB A;  4POG A;  2LFN A;  3T51 B;  1ZYR C;  5GQO A;  4A3F H;  5C3W A;  4A3M H;  5C4Z A;  5JPM C;  2V4D A;  5I6Y A;  4MZ9 A;  3I4N H;  1UE7 A;  3H3V I;  3OSO A;  5EPK A;  3RLN A;  2WIN B;  5JEA G;  4FP5 D;  1SMY D;  5K36 G;  2HDL A;  1X65 A;  3LGJ A;  4IN3 A;  1KXL A;  2PYK A;  4XYO A;  5JPN C;  3ULL A;  4AYB B;  4EX5 A;  1PYW D;  4LJZ C;  1A2U A;  4LF6 L;  4GOP C;  1U4M A;  2B2U A;  1XYI A;  1CKN A;  1SYE A;  3FPU B;  4MTK A;  5ELO A;  1I4X A;  4DV2 Q;  2NVT H;  2J4X A;  4IOC A;  4CKE A;  4DU9 A;  2DY8 A;  1BDO A;  4YY3 Q;  4JYA Q;  4HJ8 A;  3QR8 A;  2PNH A;  1ZXT A;  2WKC A;  3MEH A;  3BZK A;  3E0E A;  2B63 B;  2Z4I A;  2ID0 A;  4QMG A;  2A6E D;  4LUZ A;  1VMC A;  1JJ2 A;  3R2I A;  1R4P B;  4CHT B;  1B53 A;  1Q86 C;  4A3K B;  1HNZ L;  4POF A;  4BY1 B;  3PO3 G;  1CT1 D;  3JAM i;  1RL2 A;  1NR4 A;  5CV5 A;  1EQR A;  1U4P A;  5CR3 A;  1EIY B;  4OWW B;  4OHJ A;  4P72 A;  3FKI H;  3OIP A;  5IGB A;  2YTV A;  3FRP B;  2EY5 A;  2Z1C A;  1VQ7 A;  1I4Q A;  1LT3 D;  2OWO A;  4LF5 Q;  3K0Y A;  3A5U A;  1SYC A;  2IL8 A;  2JA8 G;  4YCU A;  5M9O A;  3HOY H;  2GVA A;  5IGE A;  4FF1 A;  3T4A C;  2N88 A;  4RAU C;  1ENF A;  1ILQ A;  4NXN Q;  4GLV B;  4PZ8 A;  2D9U A;  4BS9 A;  3ZYY X;  1VQI A;  1OXS C;  3MXP A;  4HMI A;  1KD1 C;  2R61 A;  2NVT B;  3M7N A;  4PZ6 A;  4A3J B;  3PGZ A;  1EU3 A;  4K5W A;  2RDG A;  1DXM A;  4GN5 A;  3HOW B;  2E74 C;  1OO9 B;  1EWI A;  3OTO Q;  2UUA L;  3M7G A;  3P1H A;  4IQZ A;  4GKK L;  1N33 Q;  4DV6 Q;  3NP8 A;  4RCN A;  2EYO A;  1S5B D;  4XXE A;  3ERQ A;  1AP0 A;  3R2T A;  2L9H A;  4C1N K;  2KEN A;  1STG A;  1I94 Q;  2K75 A;  2E5L L;  1IBM Q;  2EJF C;  4RFB A;  4OWX B;  4B3M Q;  4JI3 L;  3MA2 B;  1PZJ D;  4LWC A;  1TS5 A;  4IFD H;  1DOK A;  5E4X A;  1L1O A;  1HNX Q;  1GD7 A;  1GJX A;  2MNA A;  1YJW A;  3AMU A;  3CW2 C;  1C4Q A;  1B2T A;  1EY6 A;  1I50 B;  2PMZ B;  1GUW A;  2PQA A;  3GTM B;  4KY5 A;  4XQQ A;  4QY7 A;  1SFO H;  1R4Q B;  1SRO A;  3HOX H;  2WB1 G;  1J5E L;  2AWN A;  3BYT B;  1KHI A;  3RZO B;  5CYU A;  2RKS A;  2RHQ B;  4NB3 A;  5DEH A;  1KAW A;  1VQF A;  1S5E D;  1D5X C;  2R6G A;  4P71 A;  4C3H B;  4I7A A;  4H44 C;  1L0W A;  3TSS A;  4DFA A;  4KD4 A;  1PXU A;  1G6P A;  3HZX A;  4R4Q A;  4G4K A;  2VNU D;  3OW2 A;  3G48 A;  3M4P A;  4GOP A;  3HOV H;  3R3O A;  2FFK B;  4IJH A;  5IY0 A;  2E2H B;  4Y7N B;  4ME5 A;  2WB1 B;  4YWK A;  3TP5 A;  1RF2 D;  3M4Y A;  2AKW B;  3NQT A;  3CPF A;  2KVM A;  1YJN A;  2JA7 H;  4IUR A;  5CV6 A;  1F9R A;  5EQ0 A;  5M3F H;  4JI1 Q;  1E1O A;  4IUQ A;  3K5M A;  1CI3 M;  2XSC A;  4G7O C;  4N9P A;  4QB4 A;  5EGT A;  3X3N A;  3OMC A;  1XXG A;  1K83 H;  4O42 A;  2IHF A;  1PH2 A;  3EBE A;  3NXW A;  2DNC A;  3F1Z A;  5DM6 3;  1MGS A;  2SNS A;  4EQ5 A;  1CQF A;  2ICI A;  3PSI A;  3K81 C;  2JQO A;  4RGN A;  5J39 A;  2Q2I A;  2JP1 A;  1SNC A;  1Y14 B;  1KLU D;  4R8I A;  1A3T A;  2EJM A;  1DZ1 A;  4J6H A;  1I3Q B;  2WFW A;  2JA8 H;  1KQS A;  1AZQ A;  2WAQ B;  1UE5 A;  3EA6 A;  2K7V A;  2Z0S A;  1OXU A;  3HOZ G;  3U4Z A;  1JE5 A;  3CQZ H;  5AJ3 L;  3AQQ A;  1CKM A;  4DAV A;  2JN4 A;  1EL0 A;  1UAP A;  4DR4 L;  1PTO B;  1AFP A;  1SAP A;  4LFB Q;  3FP9 A;  2VS1 A;  1AH9 A;  1HQM C;  3M9B A;  1EIH A;  1Y69 U;  5IYD G;  2EPB A;  4DXG A;  4DA2 A;  3J7Z C;  1ENA A;  1QUQ A;  1LTG D;  2JK8 A;  5ELF A;  2A1A A;  2AQ2 B;  3S14 B;  3PIO 3;  1RTN A;  2DUD A;  3LNN A;  1OTC A;  1TY2 A;  3EIV A;  4KN7 C;  1QB5 D;  1TWF H;  2PCF B;  1A62 A;  3F2C A;  1PH5 A;  4HSP A;  4P73 A;  1N32 Q;  2MHV A;  2CH4 W;  3U4V A;  1L2F A;  4F87 A;  5IOC A;  1EIF A;  4L5T A;  1S4Z A;  3RNU A;  2B8F A;  2ALY B;  1A63 A;  2KCM A;  2YU9 H;  5GAD C;  4OX9 Q;  1KAB A;  2JSO A;  1VCI A;  2X69 A;  5KNC A;  2NZO A;  1O7Y A;  4BA1 I;  5JOB A;  4GKK Q;  5AFW A;  3J80 c;  3FEW X;  5JJL A;  3BJU A;  1EZ6 A;  2Z6B A;  4AYB G;  3G4S A;  3JC6 6;  4JI3 Q;  1B3A A;  3HFZ B;  4R4I A;  4MTN A;  5DAU A;  4QUC A;  4A3E G;  3HKZ G;  3S9W A;  5CC4 A;  1TWG B;  3STB C;  5KIX A;  4KHP Q;  4A3I B;  3BVZ A;  1S5F D;  5EKL A;  4R4T A;  3BVM A;  2CKZ B;  2ENB A;  2G9D A;  2KCT A;  1SLJ A;  5A2Q L;  5C4J B;  5FKA C;  1U9R A;  1WJJ A;  5H1S E;  4RKL A;  1E0B A;  1SJE D;  3NTH A;  4WJW A;  4FF4 A;  4KI0 A;  4CKB A;  1BBU A;  1X3Q A;  1SYG A;  1N9W A;  2EYM A;  3K6O A;  4C3J H;  4R1J A;  2KEE A;  2PW7 A;  3J80 E;  1J9O A;  1N34 L;  3TRZ A;  2D5D A;  4H0L C;  1XNQ Q;  1I5F A;  4F8M A;  2R7Z B;  1HR0 Q;  4DK1 A;  4DV4 Q;  1GUN A;  4DK6 C;  3GTG B;  2ZTE A;  4KHP L;  1X6O A;  1Q8K A;  3HOU B;  2K4K A;  1V9P A;  2UUC L;  1Q3L A;  1EYA A;  3LWE A;  4RGM A;  1NNX A;  2NVX H;  1S72 A;  4YHH Q;  3PUV A;  1C48 A;  5FOB B;  2KUM A;  3RD4 A;  1YNX A;  3HOW G;  1F9Q A;  1LO5 D;  4QIW B;  1TWH H;  5IYC H;  1IBM L;  4B3M L;  5D3I B;  2IX0 A;  2RCN A;  2RVL A;  2B2V A;  3Q23 A;  1KRS A;  3KDF B;  1NMF A;  1R9T H;  1FR3 A;  1L1O B;  1K8M A;  1PZI D;  4A76 A;  2R92 B;  3UDI A;  1TWC H;  1XPO A;  4A3B H;  3SDZ A;  4J8Q A;  3L9A X;  3NBH A;  3IFD A;  1FGU A;  3S17 B;  1I6V C;  1M90 C;  2KCC A;  3OYY A;  2C5C A;  3TP7 A;  2LMC B;  1F2L A;  3CCJ A;  3CCM A;  3QOJ A;  3E0J A;  4CDE C;  3K59 A;  2F0I A;  1MD2 D;  3AB9 A;  4JYA L;  1HRJ A;  3BG3 A;  4FDB A;  1YJ9 A;  2WP8 J;  2K5N A;  3DM1 A;  2CWP A;  4QJF A;  3HKZ E;  4A3J H;  4DV3 Q;  3AEV A;  4HJA A;  1YNJ C;  1I4G A;  3D4D A;  4K2L A;  5C4X H;  3CKI B;  3I4L A;  2F52 A;  1IL8 A;  5FLX E;  3A5Z B;  2L0C A;  1PRT C;  5C4H A;  1KDA A;  2CWA A;  3Q24 A;  4CGY B;  2AQ1 B;  1BUV T;  1S5C D;  2QCP X;  3H6M A;  2XWJ B;  4FO2 A;  4OO1 H;  1PTO H;  1V43 A;  3K8A A;  1JB3 A;  1EYG A;  3S2H B;  3K80 C;  1B9M A;  3H0G B;  1IYJ B;  2OT2 A;  4ABN A;  4RGO S;  4CJ1 B;  5CBE E;  4LFC Q;  1B44 D;  2ZJR A;  3Q0A A;  2AHO B;  2K04 A;  3I3C A;  1YNN D;  4L63 B;  5L37 A;  1Y8P B;  1DYQ A;  2E8G A;  5ELB A;  1SR3 A;  1KIX A;  5C4X G;  3J81 L;  2B2Y C;  1KLG D;  1WCM H;  5I9O A;  2G9H D;  1E2Z A;  5LMU Q;  5I6W A;  3CC7 A;  4JI6 L;  2NVY B;  1FNV A;  2K28 A;  1WFQ A;  1LT5 D;  5A35 A;  3MZ5 A;  5M5X H;  4ZKC B;  1L0Y B;  2C35 B;  5IYB G;  1YBY A;  5IP7 G;  1IL2 A;  5ELN A;  2L11 A;  1QNK A;  1GXD C;  1Y1V H;  3VR4 A;  3PIP A;  5KRU A;  3A74 A;  4JI4 Q;  4LF8 L;  5IYD H;  1ZYR D;  3KYH C;  3NBI A;  5IT9 c;  2D0O A;  2CHB D;  2VB2 X;  3GTG H;  2H1E A;  2F4V L;  4S3S A;  3TP8 A;  2A73 B;  4IFD J;  5IP9 G;  4H13 C;  1WTQ A;  2R93 H;  2JA7 B;  4K14 A;  4H7B A;  3K57 A;  4Q5V A;  1DD2 A;  5IYC G;  1ML0 D;  1EEI D;  3VR2 A;  2CQA A;  1N34 Q;  1NSN S;  5ELC A;  4A3I G;  1QCB D;  2ASB A;  3D31 A;  3HOV B;  2A69 C;  1BCP B;  4HCE A;  1VMP A;  3SK6 A;  4C3H G;  1PHJ A;  4RCO A;  4JW0 A;  1BF4 A;  1O78 A;  5C4J H;  2E5L Q;  1XX8 A;  1HUN A;  4A3F B;  2NYZ D;  1STH A;  2L55 A;  1FJG Q;  1GUG A;  1SYB A;  3GTL H;  4HJ9 A;  1EUJ A;  2PW5 A;  1XJV A;  4B3R Q;  2E2I B;  1HR0 L;  3RZO H;  4APV A;  1LLR D;  3NPP A;  4FXG C;  1PH6 A;  2PPB C;  1DCZ A;  3D4R A;  2K33 A;  5C3E G;  3BU2 A;  1MSG A;  4P75 A;  2ICE C;  4LF8 Q;  2PI2 E;  2R3Z A;  3A8J E;  1VQ4 A;  1JWM D;  2QA4 A;  5DM7 3;  1MKH A;  3DLL A;  1RDP D;  4HR7 B;  5KYL A;  2QEJ C;  3GTQ B;  3NHH A;  3GTP H;  2NVY H;  3I4M H;  1CSQ A;  5FO7 B;  5J22 A;  2CFM A;  3B6Y A;  1IBK L;  3HG9 A;  2UXD L;  1A15 A;  1FNU A;  3OOC A;  2BE5 D;  4LUV A;  4B9X A;  4LF9 Q;  5CV7 A;  2DJF C;  1EZ8 A;  4DV1 Q;  4A3E H;  1EY0 A;  2J0T D;  3NUC A;  1X3P A;  1SRU A;  2UXC L;  3H0G G;  5IWA Q;  1EQQ A;  4KV6 A;  4LF7 L;  3O13 A;  5FLM H;  3H0G H;  2CW0 D;  4JI8 L;  2R7D A;  4RG1 A;  4A3G B;  4DR1 L;  4NW2 A;  3SEB A;  3CCQ A;  4GZY C;  5NUC A;  3DUZ A;  3SR1 A;  2UU9 Q;  3MVV A;  5HGT A;  4XIG S;  4BWG B;  1S40 A;  4HMJ A;  1HA5 A;  1Q90 A;  4L8J A;  3G71 A;  1Z7T A;  2R92 G;  2VUM H;  4BY1 G;  3DMU A;  1HHV A;  1JR0 D;  3WOE A;  2D0P A;  5GRO A;  4MN3 A;  4HAE A;  2NB0 A;  1EU4 A;  2X6G A;  1X56 A;  1P16 A;  1GUO A;  2SOB A;  4HED A;  5LMN W;  4GN4 B;  1NCV A;  3OWE B;  4IPG A;  3A0J A;  3RZD H;  1K73 C;  4DNT B;  5IT9 L;  3SXH A;  3TN2 A;  1OXX K;  4QL5 A;  1V1P A;  3FKI B;  2JA5 H;  2A19 A;  4OON A;  3GP7 A;  2B2Y A;  4JI7 Q;  4OO1 I;  4DR2 Q;  3CF5 A;  2XWB B;  1II3 A;  1VQB A;  1H95 A;  1EYC A;  5FLX c;  1PH8 A;  1T5X D;  3MTS A;  3CMA A;  5JJZ A;  3EQL C;  2I5H A;  4ID6 A;  1PTO C;  2BCO A;  3M3Y B;  3W5O A;  3T53 B;  1NE3 A;  4YWM A;  4AQY L;  2RCF A;  2PZT A;  4DNI A;  1VQO A;  2JEB I;  4I65 A;  3HKS A;  4FF2 A;  4ZUJ A;  3LX0 A;  2V1C C;  4JI5 Q;  2EYF A;  1TXY A;  4K0K L;  3QIA A;  2IT1 A;  1F9P A;  2EXD A;  2JA9 A;  1K83 B;  2LY7 A;  4CJ0 B;  1E1T A;  1F2Y A;  1AW7 A;  1SBB B;  2FXQ A;  2Z9H A;  3S1R B;  1BVS A;  2BA1 A;  4DV5 Q;  1TR5 A;  3NWS A;  1SNP A;  2NZ1 D;  3L2P A;  1SYD A;  3P20 A;  4DR5 Q;  5JJK A;  1U4L A;  1U0L A;  2KED A;  4H02 A;  4Y7N H;  3K7A B;  4PG3 A;  4C3J B;  4AYB E;  1CM9 A;  3GTJ H;  4L6T B;  4DR2 L;  2EDG A;  1VQP A;  3S2D H;  4DUY Q;  1B9N A;  1Y1W B;  3PUZ A;  4G7Z C;  4IUP A;  2Q8T A;  3S24 A;  1G2T A;  3E9I A;  4OWT B;  1PFM A;  4KN4 C;  3S1Q B;  4KJN A;  2GA4 B;  5CBA E;  1VQ6 A;  1EY7 A;  2EQS A;  4A3M B;  4GKJ L;  5HGQ A;  4DAY A;  1IBL L;  4JVZ A;  3S16 H;  1TWG H;  5FO9 B;  4JI1 L;  5KND A;  3P75 A;  1XMQ Q;  1AEX A;  1Q81 C;  1PDQ A;  3DEP A;  1B70 B;  2EY6 A;  1I50 H;  1SND A;  2F0N A;  2XRS D;  2IY5 B;  3D0F A;  3KF8 B;  4C3I B;  3S16 B;  4X62 Q;  4B3S L;  3H3V C;  1PRT F;  2AUK A;  1EWH A;  2EVB A;  2OQ0 A;  2QDL A;  3RN5 A;  4K8I A;  1XNR L;  5KYI A;  4A3J G;  1Y1W H;  2R7Z G;  1TU2 B;  3S2D B;  3M85 A;  2UUC Q;  2EYP A;  3K7A H;  1JOK A;  1PH1 A;  5JEA H;  1PYS B;  2TMP A;  4QIW E;  4ILW A;  4NKL A;  1NR2 A;  3PCO B;  5F2D A;  3V05 A;  4F7X A;  1XNQ L;  2B2T A;  4IFD G;  1SDF A;  3MAQ A;  1D6E C;  1F9S A;  4DAY B;  3VA7 A;  4HCS A;  4KKU A;  1XPR A;  5EKI A;  3TP6 A;  2CVR A;  1K0R A;  1HZ9 A;  1F2Z A;  3H3V H;  1HCZ A;  4QCL A;  1B7Y B;  2C9O A;  2VZA A;  3K58 A;  1EOV A;  5M5W H;  4ZUI A;  1WD1 A;  2KOL A;  2KHJ A;  3DXJ C;  1JMC A;  2YTX A;  4DNR B;  3H09 A;  2QEX A;  3D6C A;  1X3G A;  1CK1 A;  4BY7 H;  3HS0 C;  2QW7 A;  1YNJ D;  4DAM A;  4IUV A;  4QQB X;  5M5Y B;  3I8Z A;  3MEF A;  4N8F A;  1N36 Q;  4L5S A;  3PUY A;  5M5Y H;  1Q7Y C;  4LF4 Q;  3VYU A;  3E5S A;  3D6W A;  1PFB A;  5IGC A;  1H9S A;  3PF4 A;  3T1H L;  2ZXO A;  4OX9 L;  3MXU A;  1QVC A;  4FXK C;  1BQQ T;  1VQN A;  3U58 A;  1JJG A;  1Q1E A;  2H4O A;  4KLK A;  5IYB H;  1SMX A;  4ZAI A;  3ONA B;  1M1K C;  1CKO A;  4X65 L;  1SSO A;  2RSN A;  3FKI G;  2A6H D;  2RDH A;  1D1I A;  4DR3 L;  1EFW A;  1Y1W G;  4K6D A;  1QVG A;  4PQX A;  3C3L A;  2M2L A;  1WCM G;  4JI0 Q;  3QJY A;  4DR7 Q;  3TS2 A;  4K0K Q;  1Z9F A;  3A7A B;  1DGS A;  4TSS A;  4JI8 Q;  2L15 A;  3A8K E;  4HIM A;  2F0T A;  2L4N A;  3URY A;  1I94 L;  3KFU A;  1M4V A;  1XMO L;  3KJP A;  4A3G H;  2HHH L;  4RA8 A;  1EQT A;  1MHW C;  1PFN A;  3PMF A;  5D65 A;  2KBN A;  1K8G A;  3W1B A;  1IKM A;  1F2M A;  4UP8 A;  3I90 A;  4HN7 A;  2XIW A;  4WRD A;  4HIO A;  2JEA I;  4DV6 L;  2HIV A;  3MXG A;  1AZP A;  3TDQ A;  4GKJ Q;  3MC0 B;  4OO1 G;  1IBL Q;  4EQP A;  4LF4 L;  4UP7 A;  3J7A F;  4DR4 Q;  1A2T A;  4ME3 A;  1RIP A;  4JI4 L;  1H9M A;  3TBI B;  4DR7 L;  4DUY L;  2HDM A;  2FHT A;  3DM3 A;  1JWU D;  3U9S A;  4B08 A;  3GTQ H;  2B2T C;  2F0H A;  4OGQ C;  3BZC A;  1S3O A;  4EQO A;  3AFQ A;  4XDX A;  2JA6 B;  2FIN B;  3KLR A;  1LAC A;  3F8T A;  4KJO A;  1J5E Q;  3GTM H;  5K36 H;  5ELD A;  4B9W A;  3M4Q A;  3HOU G;  4PV1 C;  2IX1 A;  4JPB W;  1CZG A;  1A3V A;  5C0X G;  3IKJ A;  1WI5 A;  3RLO A;  4A3F G;  1NBW A;  3S1Q H;  2OXP A;  3VDY A;  2XNA C;  2K5D A;  1G29 1;  4XTC S;  2UUB L;  2NUC A;  4IOA A;  1ET6 A;  4CBV A;  4X62 L;  3Q6S A;  4K2K A;  1GUS A;  3OWF A;  1O7L A;  4DR1 Q;  4A3C H;  4BBS H;  1BCP F;  3KJO A;  1Q1B A;  1VQ5 A; 
#chains in the Genus database with same CATH homology
 3RLF A;  5KNB A;  3GV6 A;  5LL6 X;  3PV0 A;  1NAP A;  2R93 B;  3FVQ A;  2SEB D;  5CGK A;  1ZKO A;  4K6L A;  2HCC A;  2MP1 A;  1SNM A;  3VYS A;  4XYQ A;  2F0W A;  1KAA A;  1Y1V B;  1ESR A;  4KHV A;  4G57 A;  5M5X B;  1K8O A;  1EYD A;  1DOM A;  2Z8L A;  1GHK A;  2F0P A;  2JE6 I;  3EFX D;  2BE5 C;  4C3J G;  3BYY B;  1LT4 D;  2B2V C;  4OIK A;  4XT1 B;  5I2X A;  4UAI A;  1E2W A;  4IFD I;  1ET9 A;  2Y0S B;  3VYT A;  1LV9 A;  2SDF A;  1ENC A;  3PIP 3;  3A8I E;  1UNS A;  2E2J B;  4X3S A;  1QNU A;  1EIG A;  1QG7 A;  5COY A;  2JA5 B;  1Y8O B;  4V0B A;  4KMU C;  3A56 A;  5A2Q E;  3BZD B;  5D14 A;  2NWG A;  3ERO A;  2EOT A;  3ND9 A;  2MGS A;  4K5X A;  4ZKB B;  1SNO A;  1WTX A;  2VUM B;  1WTO A;  3NSW A;  3J80 L;  3VYR A;  2IJ0 A;  1IHZ A;  2XN9 C;  4K8J A;  2AQ3 B;  3CHB D;  2M00 A;  1JE4 A;  3D3R A;  1JQY D;  1RD9 D;  1Z6H A;  5KEE A;  3S1N B;  3HOZ B;  3HP3 A;  2WKD A;  4DXF A;  2A68 C;  4QF4 A;  1IW7 D;  4A3E B;  3DWA A;  1NUC A;  3X3M A;  1STY A;  3A54 A;  1EWC A;  5TSS A;  1TWC B;  4R8N A;  3I4N B;  2RBM A;  5COR A;  2YYZ A;  1TS4 A;  2FMC A;  1R9T B;  3P7J A;  3GTP B;  3I4M B;  1Q8I A;  4Z9C B;  3L3O C;  1SXT A;  1VDZ A;  2A69 D;  5G3L D;  1IYU A;  2LS0 1;  3QG1 A;  1IW7 C;  3BVG A;  1CZW A;  4ZRZ A;  4BBR B;  1DON A;  2EY2 A;  3NQI A;  5I9P A;  1CFM A;  3M4O B;  3GD7 A;  4OIJ A;  3SK4 A;  3CRL C;  5J1Z A;  2K01 A;  3SE0 A;  5T1I A;  3QB3 A;  3MFY A;  4KD3 A;  3OHX C;  3VR5 A;  4KTA A;  5CV9 A;  3JAM E;  1LTT D;  2ZT9 C;  2KA7 A;  1CA6 A;  4A3D B;  1PTO D;  4ZLT F;  1O80 A;  5LHY 1;  2XVS A;  3OIQ A;  1H9K A;  2A74 C;  1XTC D;  3KLS A;  1HUM A;  4C56 C;  2AWO A;  3J81 E;  1OXT A;  2NVQ B;  1BXT A;  2I46 A;  4DF7 A;  4RH6 A;  1G8Z D;  2FJ2 A;  5EBC A;  3LWU A;  3KBX A;  5JVH 3;  2VXW A;  2Q8R E;  1ONL A;  2JXM B;  1T5E A;  3OW7 A;  5DNF A;  3NTK A;  4PMW A;  3DWQ A;  2KCN A;  2EY1 A;  3NE5 B;  2HQE A;  1H9S B;  2WII B;  4BY7 B;  3G6J B;  2K5Q A;  2MJ8 A;  5E4W C;  4X3T A;  2NN6 I;  2NTS A;  1WTW A;  1WTP A;  1SEB D;  3KK7 A;  5M5W B;  2PZW A;  5CMD A;  2RA4 A;  3VA5 A;  5C3E B;  4EVO A;  1BR9 A;  3TZU A;  2QDB A;  4DK0 A;  5G3L F;  4MIU A;  2F0O A;  2A68 D;  2F0L A;  5C4X B;  1EY4 A;  3HEJ A;  3J7Y W;  1M8A A;  4IZ8 A;  4ZYS A;  5BN3 A;  1PMR A;  1ZEQ X;  4R9W A;  5IGD A;  1HTP A;  1TVX A;  3CQZ B;  3DHQ A;  1W6J A;  3RMH A;  1CHQ D;  3R8B A;  3T56 B;  5CV4 A;  3BDL A;  5C5L A;  2TSS A;  2FMM A;  4EGV A;  1HQR D;  3N52 A;  4ULL A;  1KNA A;  4DGZ A;  3QOL A;  2F0J A;  1XWE A;  3C1E A;  2BOS A;  5C0X I;  1JCK B;  3R93 A;  4K5V A;  2F0F A;  5HUR A;  3V96 A;  2BDN A;  4G7H C;  1TQO A;  2OF1 A;  3GTL B;  1G91 A;  1FNW A;  3C46 A;  4E6I A;  1LAB A;  1PRT D;  1STE A;  1FD7 D;  5IIF A;  5FO8 B;  1DOL A;  1TS2 A;  1QIL A;  1RJT A;  4JBW A;  1CHP D;  3GTJ B;  5KGU A;  1LT6 D;  1WTV A;  2L1B A;  3H94 A;  1HPC A;  3SK5 A;  2IX3 A;  2PQE A;  1G2S A;  1B4O A;  2RQX A;  4KK7 A;  5IT9 E;  2KQ3 A;  5I2Y A;  3BDO A;  2AUJ D;  4V19 0;  3K5N A;  1JIC A;  1VF5 C;  3HOX B;  2NTT A;  1JOO A;  3PUW A;  4J1M A;  3L7Z C;  1MI2 A;  3NWT A;  4WOR A;  1DM0 B;  3TME A;  1QJO A;  4M8A A;  3GQB A;  2EYL A;  5EPJ A;  2JYO A;  5M3M B;  2F03 A;  3MHB A;  1V1P B;  4WFN 3;  1F77 A;  2F0M A;  1GUT A;  3K5O A;  3Q22 A;  2L5T A;  3RZD B;  5IGG A;  3SHL A;  2VB3 X;  1TWF B;  3GTO B;  1ESF A;  2BA0 A;  1TT2 A;  2EZV A;  1H9J A;  2WV6 D;  3KBG A;  1HXY D;  3EVQ A;  4TQU S;  1STA A;  4HSV A;  4CJ2 C;  1FYC A;  2XRQ D;  4YIJ A;  3QWN A;  2F0S A;  1B1Z A;  2E76 C;  2A5H A;  3NTI A;  2A6E C;  3HOY B;  2DNE A;  3BDC A;  1U4R A;  2I07 B;  1JC7 A;  3CU7 A;  1H9R A;  3ITP A;  3SK8 A;  4NP5 A;  4FVM A;  1Z47 A;  2L12 A;  4XT3 B;  1AN8 A;  2RDF A;  1VF7 A;  4A3B B;  3IL8 A;  4KHZ A;  2Q8I B;  4DN4 M;  3ND8 A;  4I7Z C;  5LL6 S;  5C0X J;  4FNF A;  3K5L A;  1IKL A;  1TWH B;  4RWS C;  1PLF A;  5E1F A;  5C6A A;  1BOS A;  3D8G A;  4RKB A;  4KY7 A;  2NVX B;  2RSO A;  1HFG A;  3NK9 A;  2OEO A;  1ILP A;  2F0V A;  2J7Z A;  5M3F B;  3KLS X;  3HKZ B;  2F3W A;  2DN8 A;  2IWH A;  1DJR D;  1G6Z A;  2EYJ A;  5IGF A;  2F1M A;  5ELE A;  1WTR A;  2DY7 A;  2EXZ A;  1I4R A;  3RUZ A;  1RTO A;  2F0G A;  4JK1 C;  3FDT A;  2Z4H A;  1A3U A;  2PO4 A;  3U9O A;  2KEC A;  1RKN A;  4MHE A;  4BA2 I;  2CW0 C;  3MXN A;  5JAV A;  4ODG A;  3BS1 A;  1FGB D;  2F0D A;  2QF7 A;  2F0K A;  4EQN A;  1SFO B;  1EQV A;  1MSH A;  1IYV A;  2NBF A;  2LKV A;  3WOF A;  5BN5 A;  4KY6 A;  3D4W A;  2NN6 G;  1KDC A;  1WCM B;  1Q12 A;  1L0X B;  4LMQ D;  2ZXP A;  2YU9 B;  1TY0 A;  3J7A V;  1BCP D;  3KUP A;  1STB A;  3DWP A;  4IUT A;  3C1F A;  1D1K A;  4P2C B;  1KDB A;  4XQN A;  3IFT A;  3MWY W;  1HFN A;  2EJG C;  4PMC A;  3UI2 A;  3S1M B;  4LAA A;  2EYH A;  1TWA B;  1QWY A;  3SVM A;  2QIL A;  1SYF A;  4NMZ A;  4RHS A;  3F2U A;  1KNE A;  1SNQ A;  1WD0 A;  2SNM A;  1BBX C;  1PZK D;  5EKK A;  1X32 A;  3AU7 A;  2B2W A;  1CQV A;  3WDN A;  1MBY A;  4O1N A;  4PNY A;  1RCV D;  2F0E A;  2JA8 B;  1GHJ A;  4IAL A;  3OMG A;  1D2B A;  3DEO A;  1V1O A;  1UEA B;  4HTH A;  1LTI D;  3W2D A;  4KKS A;  4A93 B;  4CKC A;  3I73 A;  4IUU A;  2F0U A;  4N9T A;  1CA5 A;  4IUN A;  3I72 A;  4QUF A;  3N6R A;  2BDO A;  3QO2 A;  2X6L A;  1LTS D;  2HCI A;  2F0Q A;  2N55 A;  1D5Z C;  3TZD A;  1V8Q A;  2K6A A;  1EY5 A;  3S15 B;  1QOH A;  2PZU A;  5I4D A;  1O7Z A;  2EE1 A;  2ZXR A;  4M1U B;  3KF8 A;  5FLX L;  4BBS B;  5BN4 A;  2K1B A;  1TII D;  5CV8 A;  5JEA J;  1KTK A;  4X3U A;  1CTM A;  2A6H C;  1A6X A;  4FXD A;  4X3K A;  1SE4 A;  4TKO B;  1LTR D;  1EEF D;  2WAC A;  1WVL A;  3A7L A;  3T13 A;  1JOR A;  4LK1 C;  2O4X A;  1HA6 A;  1TKW B;  2KHS A;  1I6H B;  4F88 A;  3FMC A;  2K5W A;  2D2C C;  1QE6 A;  5EPL A;  3GTK B;  1GOZ A;  1HTL D;  4OL7 A;  1JOQ A;  2O5J C;  2F4I A;  2B2W C;  1EY9 A;  2IW3 A;  1J8I A;  4NDX A;  5IOD A;  4U68 A;  3VR6 A;  3VR3 A;  2NN6 H;  5E3F A;  1D5M C;  2MPM A;  3PUX A;  3GO5 A;  3A55 A;  5EJW A;  4TRD A;  4ZK9 B;  4Q0F A;  5C0X H;  5ISR A;  3CRK C;  1ROD A;  3H91 A;  5T1G A;  1I4H A;  5C44 B;  1PRT B;  1BCP C;  3EJI A;  4RGT A;  2E75 C;  2KJX A;  5JVG 3;  1BNZ A;  2B8G A;  1ICW A;  2O5I C;  2M9V A;  3V2T A;  4C1N I;  1E2V A;  1LTA D;  4KKT A;  2B2U C;  2O2L D;  2F3V A;  2K05 A;  2HUG A;  1SJH D;  1I4P A;  4DAP A;  2PNR C;  2MUY A;  5D3D A;  1RHP A;  1Y8N B;  3FPP A;  3HGB A;  5EBD A;  1YNN C;  1JWS D;  2K03 A;  4FYD A;  2K32 A;  4ZQ3 A;  3JAM L;  1B50 A;  1TS3 A;  2IPK D;  2B39 A;  4UDU C;  5FK9 C;  1STN A;  3PO3 B;  1BO0 A;  3I70 A;  1UUP A;  3MFG A;  2QKI C;  1EY8 A;  4C3I G;  4RHR A;  4C2M B;  3G7L A;  3PO2 B;  1SE3 A;  3T16 A;  2D62 A;  3E6Z X;  3C2P A;  3I91 A;  3GV3 A;  5C3X A;  1PTO F;  2E2D C;  1EFI D;  3W3A A;  5C5M A;  1C8C A;  1OXV A;  1W6K A;  4XQJ A;  4U67 3;  3HRZ C;  1LTB D;  1SE2 A;  1S5D D;  1EOT A;  5K5P A;  3OPO A;  1SMY C;  3IAY A;  4FF3 A;  4PMB A;  2LFN A;  3T51 B;  1ZYR C;  5C3W A;  5C4Z A;  5JPM C;  2V4D A;  5I6Y A;  3OSO A;  5EPK A;  5JEA G;  2WIN B;  4FP5 D;  1SMY D;  5K36 G;  2HDL A;  4IN3 A;  2PYK A;  4XYO A;  5JPN C;  4AYB B;  1PYW D;  4LJZ C;  1A2U A;  1U4M A;  2B2U A;  1XYI A;  1SYE A;  3FPU B;  1I4X A;  2J4X A;  4CKE A;  4DU9 A;  2DY8 A;  1BDO A;  1ZXT A;  2WKC A;  3MEH A;  2B63 B;  2Z4I A;  2ID0 A;  4QMG A;  2A6E D;  1VMC A;  3R2I A;  1R4P B;  4CHT B;  1B53 A;  4A3K B;  4BY1 B;  1CT1 D;  1NR4 A;  5CV5 A;  1U4P A;  5CR3 A;  4OHJ A;  3OIP A;  5IGB A;  3FRP B;  2EY5 A;  2Z1C A;  1I4Q A;  1LT3 D;  3K0Y A;  1SYC A;  2IL8 A;  5M9O A;  5IGE A;  4FF1 A;  3T4A C;  2N88 A;  4RAU C;  1ENF A;  1ILQ A;  2D9U A;  4BS9 A;  3ZYY X;  1OXS C;  3MXP A;  4HMI A;  2R61 A;  2NVT B;  3M7N A;  4A3J B;  1EU3 A;  4K5W A;  2RDG A;  1DXM A;  3HOW B;  2E74 C;  1OO9 B;  3M7G A;  3P1H A;  4IQZ A;  3NP8 A;  4RCN A;  2EYO A;  1S5B D;  4XXE A;  3ERQ A;  1AP0 A;  3R2T A;  2L9H A;  4C1N K;  1STG A;  2EJF C;  4RFB A;  3MA2 B;  1PZJ D;  1TS5 A;  4IFD H;  1DOK A;  5E4X A;  1GJX A;  3AMU A;  1C4Q A;  1B2T A;  1EY6 A;  1I50 B;  2PMZ B;  1GUW A;  3GTM B;  4KY5 A;  4XQQ A;  1R4Q B;  2AWN A;  3BYT B;  3RZO B;  5CYU A;  2RKS A;  5DEH A;  2R6G A;  1S5E D;  1D5X C;  4C3H B;  3TSS A;  4H44 C;  4DFA A;  4KD4 A;  1PXU A;  3HZX A;  4G4K A;  2VNU D;  3R3O A;  2FFK B;  2E2H B;  4Y7N B;  4ME5 A;  2WB1 B;  3TP5 A;  1RF2 D;  3M4Y A;  3NQT A;  2KVM A;  4IUR A;  5CV6 A;  1F9R A;  5EQ0 A;  4IUQ A;  3K5M A;  1CI3 M;  2XSC A;  4G7O C;  4N9P A;  4QB4 A;  5EGT A;  3X3N A;  3OMC A;  1XXG A;  4O42 A;  3NXW A;  2DNC A;  5DM6 3;  1MGS A;  2SNS A;  1CQF A;  2ICI A;  4RGN A;  5J39 A;  2JP1 A;  1SNC A;  1KLU D;  4R8I A;  1A3T A;  2EJM A;  1DZ1 A;  4J6H A;  1I3Q B;  1AZQ A;  2WAQ B;  3EA6 A;  2K7V A;  1OXU A;  4DAV A;  1EL0 A;  1UAP A;  1PTO B;  1AFP A;  1SAP A;  1HQM C;  1EIH A;  1Y69 U;  2EPB A;  4DXG A;  4DA2 A;  1ENA A;  1LTG D;  5ELF A;  2AQ2 B;  3S14 B;  3PIO 3;  1RTN A;  3LNN A;  1TY2 A;  4KN7 C;  1QB5 D;  2PCF B;  4HSP A;  2MHV A;  5IOC A;  4F87 A;  1S4Z A;  2B8F A;  1KAB A;  2JSO A;  1VCI A;  2X69 A;  5KNC A;  1O7Y A;  4BA1 I;  5JOB A;  5AFW A;  3FEW X;  1EZ6 A;  1B3A A;  5DAU A;  4QUC A;  3S9W A;  5CC4 A;  1TWG B;  5KIX A;  4A3I B;  3BVZ A;  1S5F D;  5EKL A;  3BVM A;  2ENB A;  2G9D A;  5A2Q L;  5C4J B;  5FKA C;  1U9R A;  4RKL A;  1E0B A;  1SJE D;  3NTH A;  4WJW A;  4FF4 A;  4KI0 A;  4CKB A;  1X3Q A;  1SYG A;  3K6O A;  2EYM A;  2KEE A;  2PW7 A;  3J80 E;  1J9O A;  2D5D A;  4H0L C;  4F8M A;  2R7Z B;  4DK1 A;  1GUN A;  3GTG B;  3HOU B;  1Q3L A;  1EYA A;  3LWE A;  4RGM A;  3PUV A;  1C48 A;  5FOB B;  2KUM A;  3RD4 A;  1F9Q A;  1LO5 D;  4QIW B;  5D3I B;  2IX0 A;  2RVL A;  2B2V A;  3Q23 A;  1FR3 A;  1K8M A;  1PZI D;  2R92 B;  3SDZ A;  4J8Q A;  3L9A X;  3NBH A;  3IFD A;  3S17 B;  1I6V C;  2KCC A;  2C5C A;  3TP7 A;  2LMC B;  1F2L A;  3QOJ A;  3E0J A;  3K59 A;  2F0I A;  1MD2 D;  3AB9 A;  1HRJ A;  3BG3 A;  2WP8 J;  3DM1 A;  1YNJ C;  1I4G A;  3D4D A;  4K2L A;  3CKI B;  3I4L A;  1IL8 A;  5FLX E;  2L0C A;  1PRT C;  5C4H A;  1KDA A;  3Q24 A;  4CGY B;  2AQ1 B;  1BUV T;  1S5C D;  2QCP X;  3H6M A;  2XWJ B;  4FO2 A;  4OO1 H;  1PTO H;  1V43 A;  1JB3 A;  3S2H B;  1B9M A;  3H0G B;  2OT2 A;  4ABN A;  4RGO S;  4CJ1 B;  5CBE E;  1B44 D;  3Q0A A;  2K04 A;  3I3C A;  1YNN D;  4L63 B;  1Y8P B;  1DYQ A;  5ELB A;  3J81 L;  2B2Y C;  1KLG D;  5I9O A;  2G9H D;  1E2Z A;  5I6W A;  2NVY B;  1FNV A;  2K28 A;  1LT5 D;  5A35 A;  3MZ5 A;  4ZKC B;  1L0Y B;  2L11 A;  1QNK A;  1GXD C;  3VR4 A;  5KRU A;  1ZYR D;  3NBI A;  2CHB D;  2VB2 X;  2H1E A;  4S3S A;  3TP8 A;  2A73 B;  4IFD J;  4H13 C;  1WTQ A;  2JA7 B;  4K14 A;  4H7B A;  3K57 A;  4Q5V A;  1DD2 A;  1ML0 D;  1EEI D;  3VR2 A;  2CQA A;  1NSN S;  5ELC A;  1QCB D;  3D31 A;  3HOV B;  2A69 C;  1BCP B;  4HCE A;  1VMP A;  3SK6 A;  4C3H G;  4RCO A;  1BF4 A;  1O78 A;  1XX8 A;  1HUN A;  4A3F B;  2NYZ D;  1STH A;  2L55 A;  1GUG A;  1SYB A;  2PW5 A;  2E2I B;  1LLR D;  3NPP A;  4FXG C;  2PPB C;  1DCZ A;  3D4R A;  2K33 A;  1MSG A;  2ICE C;  2R3Z A;  3A8J E;  1JWM D;  5DM7 3;  1RDP D;  4HR7 B;  5KYL A;  2QEJ C;  3GTQ B;  3NHH A;  5FO7 B;  5J22 A;  3HG9 A;  1A15 A;  1FNU A;  3OOC A;  2BE5 D;  4B9X A;  5CV7 A;  1EZ8 A;  1EY0 A;  2J0T D;  3NUC A;  1X3P A;  4KV6 A;  3O13 A;  2CW0 D;  4A3G B;  4NW2 A;  3SEB A;  4GZY C;  5NUC A;  3DUZ A;  3SR1 A;  3MVV A;  5HGT A;  4XIG S;  4BWG B;  4HMJ A;  1HA5 A;  1Q90 A;  4L8J A;  1Z7T A;  3DMU A;  1HHV A;  1JR0 D;  3WOE A;  4MN3 A;  4HAE A;  2NB0 A;  1EU4 A;  2X6G A;  1GUO A;  2SOB A;  4HED A;  1NCV A;  3OWE B;  4DNT B;  5IT9 L;  3SXH A;  3TN2 A;  1OXX K;  1V1P A;  3FKI B;  3GP7 A;  2B2Y A;  4OO1 I;  2XWB B;  1II3 A;  1EYC A;  1T5X D;  3MTS A;  5JJZ A;  3EQL C;  4ID6 A;  3M3Y B;  1PTO C;  2BCO A;  3T53 B;  2PZT A;  2JEB I;  4I65 A;  4FF2 A;  4ZUJ A;  3LX0 A;  2EYF A;  3QIA A;  2IT1 A;  1F9P A;  1K83 B;  2LY7 A;  4CJ0 B;  1F2Y A;  1AW7 A;  1SBB B;  3S1R B;  2BA1 A;  1TR5 A;  3NWS A;  1SNP A;  2NZ1 D;  1SYD A;  3P20 A;  1U4L A;  2KED A;  3K7A B;  4C3J B;  1CM9 A;  4L6T B;  2EDG A;  1B9N A;  1Y1W B;  3PUZ A;  4G7Z C;  4IUP A;  2Q8T A;  1G2T A;  1PFM A;  4KN4 C;  3S1Q B;  4KJN A;  2GA4 B;  5CBA E;  1EY7 A;  4A3M B;  4DAY A;  5FO9 B;  5KND A;  3P75 A;  1AEX A;  1PDQ A;  3DEP A;  2EY6 A;  1SND A;  2F0N A;  2XRS D;  4C3I B;  3S16 B;  3H3V C;  1PRT F;  2AUK A;  1EWH A;  2EVB A;  4K8I A;  5KYI A;  1TU2 B;  3S2D B;  3M85 A;  2EYP A;  1JOK A;  5JEA H;  2TMP A;  4ILW A;  4NKL A;  1NR2 A;  5F2D A;  3V05 A;  4F7X A;  2B2T A;  4IFD G;  1SDF A;  3MAQ A;  1D6E C;  1F9S A;  3VA7 A;  4HCS A;  4KKU A;  5EKI A;  3TP6 A;  2CVR A;  1F2Z A;  1HCZ A;  4QCL A;  2C9O A;  3K58 A;  4ZUI A;  1WD1 A;  2KOL A;  3DXJ C;  4DNR B;  3H09 A;  3D6C A;  1CK1 A;  3HS0 C;  1YNJ D;  4IUV A;  5M5Y B;  3I8Z A;  3PUY A;  3VYU A;  3E5S A;  3D6W A;  1PFB A;  5IGC A;  1H9S A;  2ZXO A;  3MXU A;  4FXK C;  1BQQ T;  1Q1E A;  2H4O A;  4ZAI A;  3ONA B;  1SSO A;  2RSN A;  2A6H D;  2RDH A;  1D1I A;  4K6D A;  4PQX A;  3C3L A;  2M2L A;  3QJY A;  3A7A B;  4TSS A;  3A8K E;  2F0T A;  2L4N A;  3URY A;  1M4V A;  4RA8 A;  1EQT A;  1PFN A;  3PMF A;  5D65 A;  1IKM A;  1F2M A;  3I90 A;  4HN7 A;  2XIW A;  4WRD A;  2JEA I;  3MXG A;  1AZP A;  3TDQ A;  3MC0 B;  4OO1 G;  4EQP A;  3J7A F;  1A2T A;  1H9M A;  3TBI B;  2HDM A;  2FHT A;  3U9S A;  1JWU D;  4B08 A;  2B2T C;  2F0H A;  4OGQ C;  4EQO A;  4XDX A;  2JA6 B;  2FIN B;  3KLR A;  1LAC A;  4KJO A;  5K36 H;  5ELD A;  4B9W A;  4PV1 C;  2IX1 A;  1CZG A;  1A3V A;  5C0X G;  3IKJ A;  2OXP A;  2XNA C;  2K5D A;  1G29 1;  4XTC S;  2NUC A;  1ET6 A;  4CBV A;  3Q6S A;  4K2K A;  1GUS A;  3OWF A;  1O7L A;  1BCP F;  1Q1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...