2KQ3A

Solution structure of snase140
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Importance of the C-Terminal Loop L137-S141 for the Folding and Folding Stability of Staphylococcal Nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 25
structure length 140
sequence length 140
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kq3A00
5IGDA 5DEHA 4ME5A 1SYFA 1EY7A 2F3WA 3SR1A 5I9PA 3EROA 5CR3A 4N9PA 2KQ3A 4MIUA 2LKVA 3D6CA 2F0JA 5I6WA 4KY5A 1KDBA 4NKLA 4DFAA 1EY6A 3D8GA 3ITPA 4ID6A 4NP5A 3S9WA 1SNQA 3HZXA 1KABA 2EY2A 3U9OA 4ZUIA 2EY1A 3MEHA 2PQEA 5EKKA 3PMFA 2HQEA 2F0EA 3E5SA 2EYMA 4IUNA 4KD3A 3SK8A 4K8JA 2F0HA 4K5WA 5KRUA 3P1HA 5M9OA 1AEXA 1STAA 4KY6A 3MXPA 5C3WA 1EYCA 2F0TA 2F3VA 4K5VA 5I9OA 5C4HA 3HEJA 4ODGA 4K6DA 2O4XA 1KAAA 1KDAA 2QDBA 1SNOA 4K8IA 3VA5A 4EVOA 5HGTA 5IGEA 1TR5A 2EYPA 3TMEA 3EVQA 3DMUA 1F2MA 5EKLA 2F0UA 2NUCA 5IOCA 2WACA 4QF4A 4RKLA 4S3SA 5CV7A 1EZ6A 4G57A 2EYJA 4IALA 2OXPA 4ZQ3A 1SYDA 3MHBA 4ZUJA 2OEOA 2EYFA 4HMIA 5CV6A 4YIJA 3QOJA 5KEEA 4QB4A 3T16A 2EXZA 3SK4A 3TP7A 1STGA 2F0DA 1STNA 5CV8A 4WORA 5KYLA 5DAUA 1A2TA 4J1MA 2OF1A 4NMZA 3C1EA 1RKNA 5EGTA 1SYCA 1II3A 4IZ8A 3SHLA 4K2KA 5KGUA 3BDLA 1STHA 5C5LA 2SOBA 3QB3A 3RUZA 5KYIA 5CC4A 5C4ZA 3NHHA 3SK6A 2F0KA 4PNYA 4NDXA 4OL7A 1F2YA 1SNCA 4HTHA 1SNMA 2F0LA 2M00A 3SK5A 3V2TA 5IGBA 4EQPA 1JORA 5J1ZA 2F0WA 1KDCA 1SYBA 3ERQA 3NUCA 4I65A 5E3FA 1SYGA 4RKBA 1NUCA 2F0FA 3MVVA 3MZ5A 4H7BA 5I6YA 3TP8A 1EY5A 1EQVA 3P75A 4KV6A 5F2DA 4KY7A 2F0IA 1IHZA 4F7XA 4R8NA 5CV5A 4EQOA 3BDCA 3NK9A 2RBMA 3H6MA 3R3OA 1EY0A 2F0GA 4J6HA 3T13A 5HURA 3OWFA 1U9RA 3TP5A 1SYEA 2RDFA 2PYKA 3OMCA 4DF7A 3D4DA 1STYA 5C5MA 5J22A 5JAVA 1EY9A 3C1FA 5ISRA 2ENBA 2F0QA 3NP8A 1A3UA 1A3TA 3NXWA 4KHVA 5IIFA 4TRDA 5J39A 1A2UA 4WRDA 4B9XA 2EYOA 1JOOA 2EYHA 2F0SA 3SXHA 2EY5A 5E1FA 1EY4A 1ENAA 4KJNA 3OMGA 4HMJA 2PZTA 1ENCA 3NQTA 5CV9A 3OSOA 5JOBA 5IGFA 5IODA 1EYDA 4KJOA 4LAAA 5C3XA 4K2LA 2PZUA 1NSNS 1EZ8A 3DHQA 3EJIA 4KTAA 4QMGA 3TP6A 2RKSA 4KD4A 2F0VA 1SNPA 3LX0A 1EY8A 4DU9A 5NUCA 2PW5A 2SNSA 2KHSA 2F0NA 4E6IA 1SNDA 5K5PA 1JOKA 4PMBA 1JOQA 1A3VA 1STBA 5C6AA 5IGGA 4K5XA 5IGCA 1F2ZA 2PW7A 5CV4A 4DGZA 4K14A 4B9WA 1TT2A 2EYLA 4N9TA 2SNMA 2F0PA 4EQNA 2F0OA 3QOLA 4PMCA 2EY6A 4F8MA 1EYAA 5CGKA 5KIXA 1TQOA 2PZWA 2F0MA 3D4WA
chains in the Genus database with same CATH superfamily
3DEPA 4ME5A 3SR1A 3ZJYC 5A35A 2KQ3A 2K32A 2LKVA 1K0RA 5GQOA 3HOYH 1KABA 2EY2A 5M5YB 3A74A 3DEOA 1AH9A 3K5OA 3I4MG 1PYSB 2HCIA 1WJJA 4R8IA 4DNRB 3RNUA 1BCPC 1QNUA 3GV6A 3DWQA 1SMYC 3PO2G 3CQZH 1TY0A 3SGIA 5T1GA 1VQ8A 1PVOA 4RH6A 5HGTA 4X62L 1Q86C 2NUCA 3KJOA 3E9IA 4JI6L 1B2TA 1TKWB 4BY1B 3MFGA 3GTQB 1SMYD 1K83B 5I2XA 1I5FA 4YHHQ 2ASBA 2JEBI 3HOZH 1X55A 1O80A 2K03A 1N32L 2H5XA 4DR2L 5LMUQ 4J1MA 2VL6A 3J7YW 3Q8DA 2QDLA 3H0GG 2MP1A 3SHLA 5KGUA 3S14H 5BR8L 1V9PA 3VR4A 5IYBG 4H13C 3X3NA 1S72A 3ZYYX 3HG9A 2AQ2B 2L4NA 1CKMA 2F0LA 3V2TA 1MBYA 3I90A 1H9SB 3J7AV 5J1ZA 2XGTA 1SYBA 2G9HD 1I3QH 3CD6A 5AJ3Q 4IUTA 3Q23A 4TSSA 1L2FA 3AB9A 5DM73 1MJCA 5M5XH 4KV6A 1CZGA 5F2DA 3EFXD 1LUZA 2B8FA 4OWTB 4GKKL 3T13A 3UDFA 4JK1C 1CSQA 2WIIB 3D4DA 4DXGA 4HIMA 4BBSB 5IWAL 1YVCA 1Q46A 1A3UA 1GOZA 2UXDQ 2EOTA 2CQOA 3EN2A 3URYA 4C3IB 3I73A 3KOJA 1ENCA 2C9OA 5GADC 4R1JA 1P8LA 1WCMG 2J7ZA 3GDEA 5DLQE 1RTOA 1XJVA 1B7YB 2RSNA 2E8GA 5IGCA 1TWCB 4PZ6A 2K33A 3AYHB 1WTPA 2MQHA 5C0XG 2G5DA 2Z0SA 2HHHL 2B3GA 2Q2IA 1GVPA 1TT2A 1B44D 4A3DG 3VYRA 1CFMA 5ELFA 2F0MA 1RL2A 4JC0A 3PIPA 4JYAQ 2Q8IB 4R4OA 4LF5Q 4A3FB 4A3MH 2CQAA 3KBXA 1I50H 5EKKA 3PMFA 1LTLA 2JA7B 1HFGA 2F0EA 1PH6A 1XNRL 3A5UA 4DV2L 1KIXA 3G7LA 3M4OH 4QUCA 2B2YA 3HEJA 2YTXA 2BH8A 3A8IE 4HSVA 3H3VC 3EVQA 3CU7A 5GROA 3SE0A 1ZKOA 2Y0SB 4L6TB 2B63G 1H9MA 3P20A 4A4IA 2EQSA 3SK4A 4DAMA 3J81j 1JCKB 2K52A 1S5FD 1QCBD 1SDFA 2CH4A 1TIID 4PV1C 1ET9A 3QB3A 4R4QA 4TKOB 1VS0A 3RUZA 3J80L 4DR5L 3HKZE 4DV0Q 4LUZA 1BBWA 1GD7A 4MN3A 1X9NA 1BCPB 1L1OA 4HIKA 1CTMA 1SXTA 2F52A 4BY1H 5GAGC 1VQNA 3GTQH 4XIGS 4I65A 4RKBA 2F0FA 2MJ8A 4AYBB 4L63B 3HKSA 3VR3A 1EQVA 2PMZE 2Z6KA 2KCCA 1ASZA 4XYQA 3GTOB 2EZVA 3K81C 4EX5A 3R3OA 2PYKA 1HQRD 1LM0A 4X64Q 3HOWB 3NWTA 5C5MA 2DNEA 3AMUA 5M3MG 1MIUA 1JR0D 3CCQA 1DD2A 1RCVD 4KHPQ 1A2UA 4ILWA 3G6EA 4XQQA 3I7FA 4KHZA 3HOVG 4B3ML 4OO1I 3D3RA 5D3DA 2XRSD 3E0EA 4JBMA 3I70A 3M7GA 4QMGA 1M8AA 1NNXA 2RKSA 3K57A 4DK6C 1GKHA 3MAQA 4GKJL 1FJGL 2SEBD 5ELBA 4BBSH 5A2QE 2PW7A 1HFNA 4POGA 2D0PA 1SFOH 3VR5A 1SRUA 3EBEA 4C3IH 4NXML 1VQKA 1DM0B 5BN3A 4P71A 4N9PA 3I4MB 4IO9A 3IRBA 4RGNA 3EA6A 3S2DH 3PO2B 4GS3A 4DK1A 1VQFA 5H1SE 2E5LQ 1YNNC 4OIKA 2FXQA 3O13A 1TWCH 3G48A 5D3IB 3E0JA 4A3JB 1XNQL 5KRUA 2B2UA 2N49A 1AEXA 1XWEA 3T51B 2AWNA 5L37A 4FF3A 1TR5A 1D8LA 4IALA 3T56B 2JXMB 4BY7G 2O5JC 1XX8A 1M1KC 4A3FH 4OXPA 3NELA 5C3EB 1PZKD 4CHTB 2V4DA 4O0AA 2KEEA 2JA7H 2OF1A 3Q24A 3A56A 4DR3L 1S4ZA 5IP7H 2K01A 2OTLA 4A3EH 2SOBA 3FEWX 2JA5H 1YHQA 1PTOH 3KLWA 4XT3B 2HT1A 3HOYG 1JB7A 4DR7L 2JA6B 1GO3E 1EIGA 5IT9E 3HOXB 2Z9HA 1HR0W 3RN5A 4C1NI 3LNNA 1LT4D 2NYZD 3I4OA 3S17B 2BDNA 3E6ZX 1UE6A 2L0CA 3W5OA 4KK7A 1HNZQ 1E2ZA 2AQ1B 2K28A 1YI2A 4HJ5A 1MGSA 1IL2A 3HOZG 3TP5A 1LTGD 1VQEA 1Y8OB 2A1AA 1EIFA 4JI4L 4IPHA 2LY7A 1HQMC 1K28A 4Z9CB 1I4QA 1G2SA 3M4QA 3R2TA 2P5ZX 1JOOA 4MTNA 2VZAA 1WD0A 4KJNA 2XNAC 1QUQB 3ULLA 5JOBA 1N34Q 4GOPC 3CC2A 3GTOH 3TP6A 1Y1WB 4OO1G 2UUAL 2PW5A 5K5PA 3HOWH 2ICEC 3GTJH 4JBJA 1NE3A 5JVG3 4A3GH 4FVMA 1QB5D 4CDFC 3CPFA 2B2VC 1QJOA 4GLVB 4DV1Q 4GLXA 2F3WA 1KTKA 2VQFQ 4RAUC 2J0TD 2OQ0A 2KOLA 4LFBL 2HIXA 2UUBQ 3U9SA 2IX1A 1F77A 3W1GA 2R92B 3HGBA 2K5QA 1FD7D 2EJFC 4KD3A 2M9VA 4K8JA 2D0OA 3QG1A 3MXPA 4LUVA 2XSCA 2R3ZA 3H91A 4JI5L 2AHOB 4EVOA 1UE5A 3OWEB 2O5IC 1VQGA 2A8VA 2CFMA 2ATWA 2I46A 2JQOA 1SJHD 1SYDA 4I7AA 3CRKC 1NCVA 3TP7A 4DK3C 5CMDA 1JE5A 5DAUA 4JI0Q 4HR7B 4A3IG 4A3JH 3CXCA 3KF8A 1ZXTA 3K0XA 3FKIG 4FO2A 2IW3A 1Z6HA 1N8RC 4XT1B 4PQXA 1B50A 5M5WB 2F0KA 2K04A 2MGSA 4OL7A 2M00A 1PV4A 4DV3Q 2N88A 3GTLH 3PIOA 3NUCA 4LNQA 4Q5VA 2R93G 5C3EH 1XTCD 4CJ1B 4B3TQ 4IOAA 5FJ8G 4LF6L 3X3MA 3RLOA 2B29A 2NVYB 4PZ7A 3S2HB 1VQMA 5CV5A 3JC66 3IAYA 5C4XG 1GUWA 2Q2TA 3CCUA 2JA6H 3A55A 2UU9Q 5IY0A 3PO3G 4DF7A 3HOXH 3K0YA 1KL9A 2KVMA 3I2ZA 5D14A 1TS5A 1WTOA 1EYGA 2ZM6Q 3P7JA 1PFMA 4C3JB 3H3VH 3WOFA 1S5BD 3S17H 2UXBL 3AU7A 1MSGA 3M4YA 2JYOA 5LL6S 1LT6D 2MO0A 2AUJD 5ELOA 2HD3A 2VUMG 3CF5A 2DY7A 3D4RA 2JA9A 1NR4A 1PH5A 4C3HG 1ENFA 1PDQA 1XMOQ 1F2ZA 4PMWA 2KJXA 4NB3A 4B08A 5TSSA 2HUGA 2NN6H 1CT1D 5I6WA 4NKLA 1IBLL 3HKZG 1HJPA 1Y1WH 3K58A 4L5SA 1SNQA 3HZXA 1X32A 4WJ3M 1RDPD 4IFDJ 2NVQB 1E1OA 4QY7A 1A63A 4GOPB 4JOIA 1JMCA 4HEDA 1QZHA 4OWWB 1QG7A 2CH4W 1I4HA 2PO4A 2B39A 2E2JB 4K8IA 1NJIC 2OCEA 3TMEA 5EKLA 3UE1A 2R6GA 4YCUA 1H9SA 2A69C 3BZCA 4WFN3 2AWOA 3CHBD 3K7UC 2LSSA 5KEEA 4QB4A 2R92H 4IJLA 3GTGB 2QKIC 1HNXQ 1BO0A 4A3BG 1RKNA 1RD9D 2N3SA 3BJUA 2A69D 3LGJA 5EQ0A 1IBKQ 5FO8B 2TMPA 5KYIA 1LTTD 1SLJA 2WAQB 2LXKA 3J80E 4CKEA 3PGZA 1CA5A 2EVBA 4YY3Q 2FFKB 1XPRA 2MUYA 1B3AA 4IFDH 3T1YQ 4P73A 4OX9Q 4YCVA 1LACA 2CHBD 4KLKA 3S24A 2L11A 4KY7A 2F0IA 4EQOA 1WTXA 3BDCA 1DJRD 2NBFA 3FPUB 3H6MA 5M5WH 3CRLC 3KDFA 1YNXA 1CKNA 1AE2A 2NVXB 1STYA 2SDFA 4OEMB 4L5RC 1D7QA 4H0LC 1QVFA 3V05A 5T1IA 5C44B 1NR2A 3KFUA 2B2WC 4U673 2XTIA 3PUWA 4JI1Q 2AMCB 2AQ3B 3T53B 2FMMA 4DV6L 3RMHA 1PTOF 2NVYH 1WVLA 2I07B 1K8GA 5EBCA 3S2HH 4LF8L 3CMEA 1NSNS 2ES2A 4DNIA 4KD4A 4OWXB 3LX0A 1K0SA 3K5LA 1W2BA 1F9PA 2VQEQ 1HXYD 4PMBA 1IYJB 3CCJA 1X3QA 1LTBD 4OHJA 2F0OA 2HQLA 1Y8NB 4C3JH 3FRPB 4OONA 1M90C 5HGQA 2WB1B 4K0KQ 2F0JA 4TQUS 3HP3A 4ID6A 2Z8LA 1BCPF 4R9WA 1G51A 2JJQA 2MFIA 4JI8L 1KLGD 5C0XI 2BE5C 2JA8G 3OW7A 3E5SA 2QW7A 1S5DD 2Q8RE 1CQVA 4DAVA 4G7OC 1KQSA 2F3VA 4HCEA 2PQAB 4NXNQ 3A7AB 3OIPA 1YEZA 1QZGA 1TY2A 4BBRB 1IBML 1BNZA 2BE5D 5CV7A 1RTNA 1K8OA 2BA0A 4JPBW 2KCMA 3PUXA 4RFBA 4PZ8A 1GUGA 2UXCQ 1STNA 2NVQH 1B9MA 1SE4A 4K2KA 3J7AF 1AN8A 1D1IA 1Q3LA 2N8NA 2QEXA 2E2JH 5JJIA 4B3RQ 3BYTB 1Q7YC 2JE6I 2HHHQ 4IOCA 1QNKA 1XPUA 3PCOB 1L0YB 3GTGH 1EIHA 4LF4Q 3G6JB 4H7BA 1U4PA 1N33L 1NMGA 5IP9H 5IYDH 1RHPA 3I55A 1I4XA 1IHZA 3ND8A 1QWYA 1AW7A 1QVGA 1EY0A 1WD1A 2RDFA 4KKSA 1E2VA 2XWJB 2F0QA 2MHVA 1V43A 4JG2A 4TRDA 3PQIA 1Y69U 4UHVA 1Q8KA 2E2IB 1C9OA 5G3LD 3UI2A 4LAAA 2FMCA 3DHQA 1DCZA 4DR1Q 2F0VA 4O42A 1VQCA 1GHKA 2YTVA 1I94L 4JBKA 1PH4A 2NVXH 3KBGA 4A93G 5C4JB 5C44H 1T9HA 3HOUB 3I4NG 3L3OC 3K7AB 3D4WA 5KNDA 2LFNA 4ZCKA 4K6LA 1UE7A 2ALYB 4JV5Q 4CKCA 3VDYA 3K8AA 4F88A 4N8FA 1UE1A 2RHSB 1X6OA 4X65Q 2WINB 1SR3A 1UAPA 1Q1BA 3J81i 4P72A 1A15A 1O78A 2A19A 2ID0A 2KHIA 4IUNA 3SK8A 1YBYA 1SE3A 1R4QB 2F0HA 4K5WA 3BZKA 3NBIA 5FLMH 1JWUD 4RWSC 4C56C 3A54A 3GTPB 3I8ZA 4FDBA 1Y1VG 4IUUA 3M3YH 1BR9A 4NPSA 2OXPA 2XN9C 4L8JA 2K5HA 1YJWA 5J3BA 5JVH3 3QOJA 4IZ8A 5LL6X 1FGUA 3BZDB 4A3LG 1H9JA 4N8X1 3CCLA 4PNYA 1IKMA 2X6GA 1DOKA 4O1NA 1SNCA 3D31A 3K5NA 2CCZA 5EAYA 3SK5A 1DZ1A 2RDGA 2BOSA 4YHHL 2ZJPA 4YWLA 1C48A 1EUJA 2XIWA 1EWHA 5LMUL 1QUQA 3ND9A 5I6YA 2JSOA 4LJZC 5M5YH 1N9WA 2HDMA 4RGMA 1TWGB 4DAYB 4GN5A 2IY5B 1PYBA 1VQPA 5I2YA 2RBMA 2NTSA 1EEID 5ELNA 1U9RA 1SYEA 4H02A 2HIVA 3BVZA 5J22A 1EY9A 5ISRA 2ENBA 4JI2Q 1B1ZA 1PFNA 3AFPA 5AJ3L 4DV7Q 3EQLC 1EY4A 1K83H 2B2TC 4DV5Q 1HZCA 3NQTA 4IPDA 3VA7A 3BYYB 4CBVA 1VF7A 4LMQD 1ASYA 2R7ZG 2DY8A 1PLFA 3A8JE 4JI3Q 1D2BA 3L7ZC 1U5KA 4DNTB 2DN8A 3TREA 3VYSA 2UXDL 4YWMA 4BXXH 1AFPA 1X3FA 4PMCA 3RLFA 1ONLA 3S1RB 2VY3A 3TEHB 1GHJA 2TSSA 4A75A 1KDBA 1J9OA 3ERSX 1GJXA 2RSOA 3M4PA 1LTRD 4IUPA 1XTDA 3UDXA 1HRJA 1Q12A 2K6AA 2M2LA 3MXGA 1NMFA 1J8IA 3BVMA 4AH6A 1VQ6A 4LF9Q 3S1NB 4JI7Q 5M9OA 1J5EQ 1KAWA 3HOUH 4QL5A 1EYCA 1QVCA 2L55A 5J39A 4JYAL 2Q2UA 5EPJA 1Z7TA 4RKLA 4LF5L 1FYCA 2OT2A 2WKCA 4HMIA 1S5ED 2NZOA 1MSHA 5AFWA 5COYA 1KHIA 3Q22A 2N55A 5CBEE 4HAEA 1PH1A 1ZEQX 5M3FG 1RJTA 3DM1A 3CKIB 4UPAA 3ULJA 3OOCA 2E75C 5JEAG 2K7VA 4NW2A 3MXNB 1U0LA 1MI2A 3GTPH 3SK6A 2Y0SE 5LMNW 1TWAB 3CCSA 4KI0A 4A3KG 3PUZA 1BQQT 5IGBA 1EOVA 2QF7A 4GNXC 3H0GB 4UDUC 4V190 2X69A 2F1MA 5EPLA 3LWUA 4TVAB 1EQQA 3FVQA 2CKZB 2YTYA 3GV3A 2DJFC 2QILA 3F2UA 2DGYA 3H09A 4DV0L 1WYDA 1EFWA 1AP0A 2Q8TA 3Q0AA 1TWHB 1B53A 1PYWD 4QIWB 4AYBE 1O7ZA 3TRZA 5E1FA 2L15A 2IHFA 5FO7B 4A3CH 1FVIA 2KBNA 1CM9A 1NTGA 3IFDA 4X64L 4GOPA 4E6IA 4DV4Q 4MNOA 5C6AA 1J6QA 2EPBA 1KNAA 3K59A 5IYCH 1PH3A 4KHPL 4AQYQ 4UP7A 4F8MA 2SNMA 1MKHA 1EYAA 1HZAA 1TQOA 5KNBA 1Q90A 2Q2HA 2XVSA 1WCMB 3SDZA 4R4IA 3AEVA 3NSWA 4DFAA 3S9WA 1HNWQ 1ZYRC 2B2VA 3B6YA 3OTOQ 2RCFA 3R8BA 2V1CC 3LWEA 1M4VA 3TS2A 4ZUIA 5FKAC 4C2MB 3MEHA 2IHEA 4P74A 1TS2A 4A3DB 4FXKC 3T1HQ 2RVLA 4KY6A 5ELCA 1ZYRD 1PFSA 4LF7Q 4DUYQ 4IJHA 1D1KA 2F4VQ 3MFYA 1TU2B 1WTHA 4ZRZA 4CKBA 1BKBA 2FJ2A 1LTID 2E5LL 1STGA 5CV8A 1H9KA 1W6JA 2J4XA 5GAEC 2R61A 1L0XB 1SYCA 2VB2X 1JB3A 3QR8A 1UUPA 5C4ZA 1H9RA 4GLAC 3KLSA 2H4OA 1C8CA 2B63B 2RCNA 3S1MB 1K3RA 3J81L 1SNMA 1JORA 1B3QA 2R7FA 3I4MH 1I6VC 2F0WA 2I5HA 1DOLA 3GTKB 1I4RA 2K5WA 2XRQD 5LMNQ 3PO2H 1PRTF 1VMCA 2JN4A 4YCWA 3PIO3 1E2WA 3GQBA 1JJCB 1N36Q 2EJMA 5FK9C 1Z47A 3NK9A 3VYUA 4XQNA 4J8QA 1TWAH 1WTVA 4A3MG 4X66Q 2Z1CA 4CJ2C 3H0GH 3SXHA 2NTTA 1ENAA 5BN4A 1BVSA 2E2HB 1F9RA 2IX0A 1S40A 4J15A 3OSOA 5IYBH 3BG3A 5IGFA 4DR4Q 3UDGA 2KECA 1HNZL 1TS3A 1HR0Q 1D5ZC 4GNXB 1X3GA 3NEMA 1EY8A 4H44C 5M3MB 2ZTDA 1SNDA 3V96A 3CCEA 5C0XJ 1A3VA 4F87A 2PQAA 3HOVB 3F2CA 4DR6Q 1RF2D 1HCZA 4LFAQ 3J81c 2K5DA 1SYFA 1X56A 2GVAA 3IL8A 1N34L 5FLXL 3C3LA 3MWYW 1I6HB 1CZWA 4P2CB 4ULLA 1K8MA 1LTSD 1XMQQ 4BY1G 1E1TA 4ABNA 4BS9A 3DUZA 1W6KA 2EYMA 3RN2A 4P75A 3NTHA 3NE5B 1BXTA 2WP8J 5C4HA 4K6DA 1KAAA 4DV1L 2VQFL 3I56A 4FF1A 4OELB 1WCMH 4QF4A 1EOTA 1A8VA 2UUBL 2OEOA 1HTPA 1O7IA 3BVGA 4UY8C 1V1PB 3WWVA 5C0XH 1ICFB 4C2MH 1YNJC 3ONAB 1D5MC 4DV6Q 5KYLA 4B3SQ 1GUNA 3MC0B 1SE8A 4NMZA 4A3DH 4HIDA 4LFCQ 4A3KB 3A0JA 3K6OA 3STBC 1YNJD 3TSSA 4BY7B 2WFWA 4Y7NB 1G6PA 4HIOA 1IW7C 2Z4IA 1G6ZA 3D6WA 4M8AA 4KN7C 4BBSG 1NUCA 5FLXc 4JI0L 5K36H 4DUZQ 3P75A 3SEBA 1VQHA 3STBD 1SJED 1YIJA 3HOYB 4C3IG 3TDQA 1IW7D 2QCPX 3S1QB 1PH7A 1X3EA 3OMCA 3CCVA 3G4SA 3ICEA 1T5XD 4DV3L 4MTKA 2VXWA 3NP8A 2D2CC 1A3TA 4KN4C 3U4VA 1FR3A 2A74C 4B3TL 1IBMQ 2UUCQ 2PPBC 1OXTA 2EYHA 4ZKBB 3J80i 4L5QA 2DJGC 3QJYA 1A0IA 2CVRA 2B2WA 3HOZB 1XXGA 1S3OA 4UP9A 4XQJA 2PNHA 2D5DA 2UU9L 1UWVA 3A5ZB 1LTAD 4A3FG 1JOKA 2VS1A 2F3IA 2JA7G 3K5MA 2ZM6L 3QOLA 5CGKA 1V1OA 4A76A 3JAMi 5IP7G 4RGTA 4OGQC 2A5HA 4A3EG 1BOSA 2BCOA 4X62Q 1CHPD 1GM5A 2E2HH 2CW0D 1G291 2JA5G 1TWFB 2L12A 1TS4A 1RIPA 5KNCA 2LXJA 4RMFA 4JI6Q 3D8GA 2YV5A 3UDIA 5I4DA 1HPCA 2Y0SG 4LK1C 3FMCA 2NZHA 1IZ6A 1XMOL 3C2PA 1N32Q 4DR2Q 1C4QA 5ELDA 5D65A 3HOVH 1JE4A 1OTCA 1OXXK 5BR8Q 3U50C 4QQBX 2DNCA 3OIQA 3TN2A 1GUTA 2PNRC 5JPMC 4G57A 5JPNC 4CDEC 3R93A 3H3VI 3MHBA 1I6HH 4MHEA 2F0DA 4DAYA 1A2TA 3M85A 3FHWA 4IPCA 1NY4A 3C1EA 4AYBG 4DKAC 2EIFA 1PZID 1VDZA 3RD4A 2HDLA 5CC4A 3NHHA 4GKKQ 3NWSA 4R4CA 2F03A 2L5TA 2AKWB 1FL0A 3UE0A 3KF6B 2BA1A 4CJ0B 3HOWG 5IWAQ 3KUPA 3ERQA 4A3IB 3CAMA 3MVVA 2NN6I 4A3GG 1HNXL 1CQFA 3FKIB 3CCRA 4XTCS 4BA1I 1Q81C 1IBKL 3F2DA 4A3MB 2RA4A 2WAQE 1PTOC 2KUMA 1F9QA 3G71A 3PF5A 3M7NA 2ZJRA 1YITA 2F0GA 4QUFA 1HUMA 3S15B 4DK0A 4BY7H 1HUNA 4Y7NH 4YY3L 5JAVA 2R93B 2KCNA 5EPKA 5IIFA 3T1YL 3PF4A 1PTOD 3D0FA 4OX9L 4X3KA 4Y52H 2F0SA 4POFA 3OMGA 4DPGA 1OO9B 1E22A 5C4XB 2A73B 2BDOA 1EYDA 1VF5C 1W3SA 2G9DA 1X3PA 3PO3B 5E7NA 3S1QH 3OPOA 4WJWA 2A68C 1G8ZD 4K5XA 1YZ6A 3TS0A 1PA6A 1XNRQ 5E4WC 4DV2Q 4B9WA 4N9TA 2JP1A 1R4PB 2N78A 4A3JG 4JI1L 1C7YA 4ZUJA 4FP5D 3W2DA 1BCPD 1X54A 1EL0A 3DXJC 2NB0A 5I9PA 3EROA 5CR3A 2A68D 3D6CA 2K50A 4IFDI 2VUMB 1Z9FA 1EY6A 4IURA 4NP5A 2K05A 4IUQA 4C3HB 3U9OA 2VQEL 1GXDC 4HJAA 1V8QA 4M1UB 4RA8A 1VQAA 3NENA 5C3EG 2GA4B 3P1HA 3MXNA 1K9MC 2F0TA 2NVTB 3WDNA 5I9OA 3Q6SA 1NAPA 1KDAA 4DR5Q 2WB1E 3HKZB 1TWFH 5IOCA 1YJ9A 4K0KL 2JA6G 4OO1H 1KNEA 3HOXG 3T16A 1BBXC 4HN7A 3NBHB 4WORA 1AE3A 2PI2A 1C0AA 3PIP3 4ZK9B 4OIJA 2PMZB 4NXNL 1KLUD 1CUKA 3W3AA 1KXLA 1SMXA 1F2YA 2CWAA 1SFOB 2D62A 1LABA 2A6HC 3FDTA 5E3FA 3J81E 2UXCL 4A3BB 3MZ5A 1ET6A 2XWBB 1EY5A 3FPPA 4B3MQ 5LHY1 3S2DB 4F7XA 1MHWC 3T4AC 4MZ9A 1JWMD 2NN6G 3KYHC 5CYUA 2A6HD 5HURA 3KDFB 1VQ5A 4B3RL 3OWFA 1CKNB 2GN5A 4G4KA 1F9SA 1Y1WG 4IN3A 1MJEA 4CGYB 4GKJQ 1FGBD 4BBRH 3TZDA 1FJGQ 2HCCA 4ME3A 4LF4L 4WRDA 4A3IH 1AZQA 3GD7A 4ZLTF 3I72A 5DM63 3FKIH 4NXMQ 2PZTA 3SVMA 5CV9A 1UEAB 1VCIA 2O2LD 1LT5D 1K73C 2B2TA 4KTAA 2ZT9C 3PSIA 1KRTA 1CHQD 3S15H 1E3PA 1K3BC 2KHSA 2ZXRA 5K36G 1QILA 4A3EB 2ZXOA 2JA5B 2R92G 2R93H 1TVXA 4LW1A 5CV4A 1PTOB 3CCMA 5FJ8H 1XNQQ 2L9HA 3AQQA 1SEBD 3OYYA 1YHBA 4LUOA 2PZWA 3MEFA 3PUYA 3RZOB 1VQDA 1R9TB 5C4XH 4DA2A 1EIYB 3PO3H 3CP0A 5FLXE 4DR1L 1ESRA 4X3TA 2E2DC 2KHJA 2B2YC 2HQEA 4IFDG 3IFTA 2ZJQA 4DR3Q 5E4XA 2CWPA 3DM3A 2QDBA 1B70B 4DR7Q 1U4RA 1F2MA 1FNUA 4JV5L 4S3SA 2VUMH 1HA6A 4Q0FA 4KKUA 2E2IH 4BA2I 2JA8B 4YIJA 3OHXC 4C3HH 4X65L 1VMPA 3F2BA 1HH2P 4DN4M 3U4ZA 3JAML 1JQYD 1CKOA 1D5XC 2RF4A 5EGTA 5C5LA 4RHRA 1L1OC 2NVTH 2BH2A 1I4PA 1WOCA 1Y8PB 4HSPA 2YU9B 5C4JH 3GTJB 1YHAA 4AIMA 1FNVA 5IE8A 5EKIA 1JT8A 4UAIA 4HJ9A 3K7AH 4A3GB 5HY6A 1NBWA 2QGQA 1EFID 1QE6A 4JI4Q 1VQJA 1EU3A 2Z6KC 1SYGA 2RDHA 2OQKA 4HJ8A 3TP8A 1O7YA 4GN4B 4C3JG 5JJKA 2WV6D 4GNXA 1XYIA 3QO2A 5EJWA 4U68A 3A7LA 3A8KE 4DXFA 3J80c 4V0BA 2UUAQ 1DGSA 2KEDA 3C1FA 1B9NA 4L5TA 1RODA 4RHSA 4JW0A 2IX3A 3QWNA 4A3BH 4B9XA 2EY5A 4RGOS 2VW9A 2L1BA 2PZUA 2NZ1D 1EZ8A 4LFBQ 2IT1A 1IYUA 3JAMc 3S16B 5NUCA 2SNSA 5FO9B 2K5NA 1VQIA 4HJ7A 1SE2A 5IGGA 1YJNA 4JI2L 2I0QA 5CBAE 4APVA 4K14A 4IUVA 3RZDB 4DV7L 1LLRD 1YNND 1EQTA 4DV5L 4JI5Q 2R7DA 1I4GA 5DEHA 1SN8A 1LO5D 4ZYSA 3GTLB 4KY5A 2QA4A 1V1PA 1TWGH 3E9HA 1L0WA 2MO1A 2B2UC 4JI3L 1VQOA 3CMAA 2EY1A 4A93B 1BDOA 1SROA 4EGVA 3I4NB 3I4LA 3E3XA 5IP9G 5IYDG 2EJGC 4GN3B 2WKDA 1PH9A 4ODGA 1HHVA 2O4XA 4FNFA 3W1BA 3RZOH 1TXYA 2F0UA 1EEFD 1R9TH 2WAQG 1CSPA 2EYJA 1BF4A 1EWIA 1WFQA 2EYFA 4XDXA 5CV6A 2OWOA 1PH8A 2I5LX 5DNFA 1B8AA 1BUVT 4LF9L 4LF6Q 4JI7L 1II3A 1J5EL 3BDLA 3L2PA 1KC8C 1OXVA 1Y1VB 2ICIA 3H94A 5JJLA 4RG1A 1CK1A 3OW2A 1G2TA 3S1RH 1G91A 1F2LA 2EXDA 4FF2A 4EQPA 2JA8H 3IKJA 1OXSC 2QEJC 1HZBA 3DLLA 5C44G 2UXBQ 1HA5A 1V1QA 1WI5A 2FINB 1HZ9A 3S1NH 4KKTA 2YU9H 2C5CA 2DUDA 1PH2A 1DOMA 1L1OB 3J7ZC 1MD2D 3NXWA 3BS1A 3C46A 2ZTEA 3TZUA 2NWGA 1ML0D 2EYOA 2RQXA 2PI2E 2K75A 1IXRA 3CC4A 5FLMG 1U4LA 4FXGC 5IODA 5CORA 3DWPA 1VQ7A 5C3XA 1VQ9A 3I91A 4K2LA 1IBLQ 2FHTA 2WB1G 4WJ4A 2F0NA 1STBA 4QIWE 3TQYA 1IL8A 4DGZA 1VQBA 4G7ZC 4FXDA 1PFBA 3PV0A 2Z4HA 5IGDA 1EY7A 3FP9A 3N52A 4R4TA 1CA6A 2Z6BA 2R7ZB 2X6LA 4BBRG 3ITPA 3NTKA 2MPMA 1Q1EA 5EBDA 3S16H 2K4KA 1ESFA 4DV4L 2PQEA 1LYLA 1BBUA 2ZXPA 1WTWA 2IJ0A 4AQYL 1STAA 1TWHH 5C3WA 3RZDH 1P16A 2I5MX 2KENA 1PMRA 3NPPA 3VA5A 5IGEA 1IKLA 2B8GA 1JJ2A 3KF6A 5FOBB 4GZYC 2WACA 2C35B 1HNWL 1EZ6A 3OTOL 1AZPA 3MA2B 4JCVE 5JJZA 4A93H 3T1HL 4QCLA 3I4NH 1PRTC 1XPOA 1STHA 2EDGA 4LF7L 3DWAA 1PHJA 4DUYL 1WTQA 1D6EC 4ALPA 1UEBA 3HS0C 3RLNA 4CDDC 3HFZB 4RCNA 2F4VL 1E24A 4YWKA 1PRTD 3MTSA 1HTLD 2LS01 4QJFA 4UP8A 3GTMB 1ILQA 1GUSA 4PG3A 2K5VA 1Q8IA 2PCFB 5M3FB 1IYVA 2VB3X 3GP7A 4BXXG 3U58A 3RR5A 4LF8Q 1EQRA 1Y1VH 4J6HA 2EE1A 3R2IA 2LMCB 3BU2A 4HCSA 2IL8A 1O7LA 1K8AC 2E76C 3AFQA 4FYDA 1CI3M 4JVZA 4KMUC 4BWGB 4X6AH 5LMNL 3HOUG 3KLRA 4HMJA 3TBIB 4X3UA 4ZAIA 4A3LH 2K14A 4C1NK 1N36L 3PUVA 1GUOA 4DU9A 1ILPA 4JI8Q 1EU4A 1LV9A 2K1BA 5A2QL 1WTRA 4QGUA 1JOQA 4X66L 3HRZC 2B63H 2AUKA 1STEA 3S1MH 4EQNA 3CC7A 3CQZB 2F0PA 3NTIA 4JBWA 1DONA 2EY6A 4XYOA 1KRSA 1JJGA 3ER0A 3MXUA 1SSOA 2A6EC 3GTKH 1OXUA 4MIUA 4DR4L 1QOHA 3VYTA 2ZTCA 1HR0L 3QIAA 3N6RA 4JOIC 3NBHA 1Q82C 3KK7A 1B4OA 1Y14B 1ICWA 2JK8A 2A6ED 3GO5A 3L0OA 2JEAI 2CW0C 1S5CD 3S14B 2VNUD 4DR6L 3CW2C 4K5VA 4LWCA 2RHQB 2E74C 3EIVA 4LFAL 1SNOA 1E7ZA 2EYPA 4DAPA 3DMUA 1JC7A 2IPKD 4X3SA 3F1ZA 2R7ZH 2KCTA 3KJPA 1PZJD 4ZQ3A 1DYQA 1PXUA 1U4MA 2MNAA 5BN5A 1I3QB 1XMQL 2EXZA 1JICA 3ULPA 2F4IA 2IWHA 1LT3D 1X65A 5M3MH 1N33Q 5M5XB 3JAME 5JEAJ 1T5EA 4RCOA 1A62A 3BDOA 3VR6A 4ZKCB 1SBBB 5IT9L 4IPGA 1E0BA 2YYZA 1VQLA 4NDXA 4A3CG 4HTHA 1EWCA 5GAHC 4FF4A 1JWSD 1KDCA 2GVBA 5IYCG 4B3SL 4EQ5A 1H95A 4LFCL 2KA7A 4R8NA 3F8TA 3KF8B 1I94Q 3KLSX 1PRTB 1DXMA 3VR2A 3L9AX 3WOEA 3GTMH 4KHVA 3NQIA 3K80C 1KD1C 3M9BA 1UNSA 4DUZL 5M3FH 3M3YB 1FNWA 4O2DA 5JEAH 3CPWA 1A6XA 2D9UA 4KJOA 3H15A 1SAPA 3EJIA 4XXEA 3J7A5 1SNPA 4A3KH 1I50B 5G3LF 4I7ZC 3I3CA 4IQZA 2OTJA 5IT9c 3M4OB 2EYLA 5ELEA 4CDCC 2UUCL 1VQ4A 2H1EA 5KIXA 4G7HC
chains in the Genus database with same CATH topology
3DEPA 4ME5A 3SR1A 5A35A 2KQ3A 2K32A 2LKVA 1KABA 2EY2A 5M5YB 3DEOA 3K5OA 2HCIA 4R8IA 4DNRB 1BCPC 1QNUA 3GV6A 3DWQA 1SMYC 1TY0A 5T1GA 4RH6A 5HGTA 2NUCA 1B2TA 1TKWB 4BY1B 3MFGA 3GTQB 1SMYD 1K83B 5I2XA 2JEBI 1O80A 2K03A 4J1MA 3J7YW 2MP1A 3SHLA 5KGUA 3VR4A 4H13C 3X3NA 3ZYYX 3HG9A 2AQ2B 2L4NA 2F0LA 3V2TA 1MBYA 3I90A 1H9SB 3J7AV 5J1ZA 1SYBA 2G9HD 4IUTA 3Q23A 4TSSA 3AB9A 5DM73 4KV6A 1CZGA 5F2DA 3EFXD 2B8FA 3T13A 4JK1C 2WIIB 3D4DA 4DXGA 4BBSB 1A3UA 1GOZA 2EOTA 3URYA 4C3IB 3I73A 1ENCA 2C9OA 2J7ZA 1RTOA 2RSNA 5IGCA 1TWCB 1WTPA 2K33A 5C0XG 1TT2A 1B44D 3VYRA 1CFMA 5ELFA 2F0MA 2Q8IB 4A3FB 2CQAA 3KBXA 5EKKA 3PMFA 2JA7B 1HFGA 2F0EA 3G7LA 4QUCA 2B2YA 3HEJA 3A8IE 4HSVA 3H3VC 3EVQA 3CU7A 3SE0A 1ZKOA 2Y0SB 4L6TB 1H9MA 3P20A 3SK4A 1JCKB 1S5FD 1QCBD 1SDFA 1TIID 4PV1C 1ET9A 3QB3A 4TKOB 3RUZA 3J80L 4MN3A 1BCPB 1CTMA 1SXTA 4XIGS 4I65A 4RKBA 2F0FA 2MJ8A 4AYBB 4L63B 3VR3A 1EQVA 2KCCA 4XYQA 3GTOB 2EZVA 3R3OA 2PYKA 1HQRD 3HOWB 3NWTA 5C5MA 2DNEA 3AMUA 1JR0D 1DD2A 1RCVD 1A2UA 4ILWA 4XQQA 4KHZA 4OO1I 3D3RA 5D3DA 2XRSD 3I70A 3M7GA 4QMGA 1M8AA 2RKSA 3K57A 3MAQA 2SEBD 5ELBA 5A2QE 2PW7A 1HFNA 3VR5A 1DM0B 5BN3A 4N9PA 3I4MB 4RGNA 3EA6A 3PO2B 4DK1A 1YNNC 4OIKA 3O13A 5D3IB 3E0JA 4A3JB 5KRUA 2B2UA 1AEXA 1XWEA 3T51B 2AWNA 4FF3A 1TR5A 4IALA 3T56B 2JXMB 2O5JC 1XX8A 5C3EB 1PZKD 4CHTB 2V4DA 2KEEA 2OF1A 3Q24A 3A56A 1S4ZA 2K01A 2SOBA 3FEWX 1PTOH 4XT3B 2JA6B 1EIGA 5IT9E 3HOXB 4C1NI 3LNNA 1LT4D 2NYZD 3S17B 2BDNA 3E6ZX 2L0CA 4KK7A 1E2ZA 2AQ1B 2K28A 1MGSA 3TP5A 1LTGD 1Y8OB 2LY7A 1HQMC 4Z9CB 1I4QA 1G2SA 3R2TA 1JOOA 1WD0A 4KJNA 2XNAC 5JOBA 3TP6A 1Y1WB 4OO1G 2PW5A 5K5PA 2ICEC 5JVG3 4FVMA 1QB5D 2B2VC 1QJOA 2F3WA 1KTKA 4RAUC 2J0TD 2KOLA 3U9SA 2IX1A 1F77A 2R92B 3HGBA 2K5QA 1FD7D 2EJFC 4KD3A 2M9VA 4K8JA 3QG1A 3MXPA 2XSCA 2R3ZA 3H91A 4EVOA 3OWEB 2O5IC 2I46A 1SJHD 1SYDA 3CRKC 1NCVA 3TP7A 5CMDA 5DAUA 4HR7B 3KF8A 1ZXTA 4FO2A 2IW3A 1Z6HA 4XT1B 4PQXA 1B50A 5M5WB 2F0KA 2K04A 2MGSA 4OL7A 2M00A 2N88A 3NUCA 4Q5VA 1XTCD 4CJ1B 3X3MA 2NVYB 3S2HB 5CV5A 3IAYA 1GUWA 3A55A 4DF7A 3K0YA 2KVMA 5D14A 1TS5A 1WTOA 3P7JA 1PFMA 4C3JB 3WOFA 1S5BD 3AU7A 1MSGA 3M4YA 2JYOA 5LL6S 1LT6D 2AUJD 2DY7A 3D4RA 1NR4A 4C3HG 1ENFA 1PDQA 1F2ZA 4PMWA 2KJXA 4B08A 5TSSA 2HUGA 2NN6H 1CT1D 5I6WA 4NKLA 3K58A 1SNQA 3HZXA 1X32A 1RDPD 4IFDJ 2NVQB 4HEDA 1QG7A 1I4HA 2PO4A 2B39A 2E2JB 4K8IA 3TMEA 5EKLA 2R6GA 1H9SA 2A69C 4WFN3 2AWOA 3CHBD 5KEEA 4QB4A 3GTGB 2QKIC 1BO0A 1RKNA 1RD9D 2A69D 5EQ0A 5FO8B 2TMPA 5KYIA 1LTTD 2WAQB 3J80E 4CKEA 1CA5A 2EVBA 2FFKB 2MUYA 1B3AA 4IFDH 1LACA 2CHBD 2L11A 4KY7A 2F0IA 4EQOA 1WTXA 3BDCA 1DJRD 2NBFA 3FPUB 3H6MA 3CRLC 2NVXB 1STYA 2SDFA 4H0LC 3V05A 5T1IA 5C44B 1NR2A 2B2WC 4U673 3PUWA 2AQ3B 3T53B 2FMMA 3RMHA 1PTOF 1WVLA 2I07B 5EBCA 1NSNS 4KD4A 3LX0A 3K5LA 1F9PA 1HXYD 4PMBA 1X3QA 1LTBD 4OHJA 2F0OA 1Y8NB 3FRPB 2WB1B 2F0JA 4TQUS 3HP3A 4ID6A 2Z8LA 1BCPF 4R9WA 1KLGD 5C0XI 2BE5C 3OW7A 3E5SA 1S5DD 2Q8RE 1CQVA 4DAVA 4G7OC 2F3VA 4HCEA 3A7AB 3OIPA 1TY2A 4BBRB 1BNZA 2BE5D 5CV7A 1RTNA 1K8OA 2BA0A 3PUXA 4RFBA 1GUGA 1STNA 1B9MA 1SE4A 4K2KA 3J7AF 1AN8A 1D1IA 1Q3LA 3BYTB 2JE6I 1QNKA 1L0YB 1EIHA 3G6JB 4H7BA 1U4PA 1RHPA 1I4XA 1IHZA 3ND8A 1QWYA 1AW7A 1EY0A 1WD1A 2RDFA 4KKSA 1E2VA 2XWJB 2F0QA 2MHVA 1V43A 4TRDA 1Y69U 2E2IB 5G3LD 3UI2A 4LAAA 2FMCA 3DHQA 1DCZA 2F0VA 4O42A 1GHKA 3KBGA 5C4JB 3HOUB 3L3OC 3K7AB 3D4WA 5KNDA 2LFNA 4K6LA 4CKCA 4F88A 2WINB 1UAPA 1Q1BA 1A15A 1O78A 2ID0A 4IUNA 3SK8A 1SE3A 1R4QB 2F0HA 4K5WA 3NBIA 1JWUD 4RWSC 4C56C 3A54A 3GTPB 3I8ZA 4IUUA 1BR9A 2OXPA 2XN9C 4L8JA 5JVH3 3QOJA 4IZ8A 5LL6X 3BZDB 1H9JA 4PNYA 1IKMA 2X6GA 1DOKA 4O1NA 1SNCA 3D31A 3K5NA 1DZ1A 3SK5A 2RDGA 2BOSA 1C48A 2XIWA 1EWHA 3ND9A 5I6YA 2JSOA 4LJZC 2HDMA 4RGMA 1TWGB 5I2YA 2RBMA 2NTSA 1EEID 1U9RA 1SYEA 3BVZA 5J22A 1EY9A 5ISRA 2ENBA 1B1ZA 1PFNA 3EQLC 1EY4A 2B2TC 3NQTA 3VA7A 3BYYB 4CBVA 1VF7A 4LMQD 2DY8A 1PLFA 3A8JE 1D2BA 3L7ZC 4DNTB 2DN8A 3VYSA 1AFPA 4PMCA 3RLFA 1ONLA 3S1RB 1GHJA 2TSSA 1KDBA 1J9OA 1GJXA 2RSOA 1LTRD 4IUPA 1HRJA 1Q12A 2K6AA 2M2LA 3MXGA 1J8IA 3BVMA 3S1NB 5M9OA 1EYCA 2L55A 5J39A 5EPJA 1Z7TA 4RKLA 1FYCA 2OT2A 2WKCA 4HMIA 1S5ED 1MSHA 5AFWA 5COYA 3Q22A 2N55A 5CBEE 4HAEA 1ZEQX 1RJTA 3DM1A 3CKIB 3OOCA 2E75C 5JEAG 2K7VA 4NW2A 1MI2A 3SK6A 1TWAB 4KI0A 3PUZA 1BQQT 5IGBA 2QF7A 3H0GB 4UDUC 4V190 2X69A 2F1MA 5EPLA 3LWUA 3FVQA 3GV3A 2QILA 3F2UA 3H09A 1AP0A 2Q8TA 3Q0AA 1TWHB 1B53A 1PYWD 4QIWB 1O7ZA 5E1FA 5FO7B 1CM9A 3IFDA 4E6IA 5C6AA 2EPBA 1KNAA 3K59A 4F8MA 2SNMA 1EYAA 1TQOA 5KNBA 1Q90A 2XVSA 1WCMB 3SDZA 3NSWA 4DFAA 3S9WA 1ZYRC 2B2VA 3R8BA 3LWEA 1M4VA 4ZUIA 5FKAC 4C2MB 3MEHA 1TS2A 4A3DB 4FXKC 2RVLA 4KY6A 5ELCA 1ZYRD 1D1KA 3MFYA 1TU2B 4ZRZA 4CKBA 2FJ2A 1LTID 1STGA 5CV8A 1H9KA 1W6JA 2J4XA 2R61A 1L0XB 1SYCA 2VB2X 1JB3A 1UUPA 5C4ZA 1H9RA 3KLSA 2H4OA 1C8CA 2B63B 3S1MB 3J81L 1SNMA 1JORA 1I6VC 2F0WA 1DOLA 3GTKB 1I4RA 2K5WA 2XRQD 1PRTF 1VMCA 3PIO3 1E2WA 3GQBA 2EJMA 5FK9C 1Z47A 3NK9A 3VYUA 4XQNA 4J8QA 1WTVA 2Z1CA 4CJ2C 3SXHA 2NTTA 1ENAA 5BN4A 2E2HB 1F9RA 2IX0A 3OSOA 3BG3A 5IGFA 2KECA 1TS3A 1D5ZC 1EY8A 4H44C 5M3MB 1SNDA 3V96A 5C0XJ 1A3VA 4F87A 3HOVB 1RF2D 1HCZA 2K5DA 1SYFA 3IL8A 5FLXL 3C3LA 3MWYW 1I6HB 1CZWA 4P2CB 4ULLA 1K8MA 1LTSD 4ABNA 4BS9A 3DUZA 1W6KA 2EYMA 3NTHA 3NE5B 1BXTA 2WP8J 5C4HA 4K6DA 1KAAA 4FF1A 4QF4A 1EOTA 2OEOA 1HTPA 3BVGA 1V1PB 5C0XH 1YNJC 3ONAB 1D5MC 5KYLA 1GUNA 3MC0B 4NMZA 4A3KB 3K6OA 3TSSA 1YNJD 4BY7B 4Y7NB 1IW7C 2Z4IA 1G6ZA 3D6WA 4M8AA 4KN7C 1NUCA 5K36H 3P75A 3SEBA 1SJED 3HOYB 4C3IG 3TDQA 1IW7D 2QCPX 3S1QB 3OMCA 1T5XD 2VXWA 3NP8A 2D2CC 1A3TA 4KN4C 1FR3A 2A74C 2PPBC 1OXTA 2EYHA 4ZKBB 3QJYA 2CVRA 2B2WA 3HOZB 1XXGA 4XQJA 2D5DA 1LTAD 1JOKA 3K5MA 3QOLA 5CGKA 1V1OA 4RGTA 4OGQC 2A5HA 1BOSA 2BCOA 1CHPD 2CW0D 1G291 1TWFB 2L12A 1TS4A 5KNCA 3D8GA 5I4DA 1HPCA 4LK1C 3FMCA 3C2PA 1C4QA 5ELDA 5D65A 1JE4A 1OXXK 2DNCA 3OIQA 3TN2A 1GUTA 5JPNC 2PNRC 4G57A 5JPMC 3R93A 3MHBA 4MHEA 2F0DA 4DAYA 1A2TA 3M85A 3C1EA 1PZID 1VDZA 3RD4A 2HDLA 5CC4A 3NHHA 3NWSA 2F03A 2L5TA 2BA1A 4CJ0B 3KUPA 3ERQA 4A3IB 3MVVA 2NN6I 1CQFA 3FKIB 4XTCS 4BA1I 4A3MB 2RA4A 1PTOC 2KUMA 1F9QA 3M7NA 2F0GA 4QUFA 1HUMA 3S15B 4DK0A 1HUNA 5JAVA 2R93B 2KCNA 5EPKA 5IIFA 1PTOD 4X3KA 2F0SA 3OMGA 1OO9B 5C4XB 2A73B 2BDOA 1EYDA 1VF5C 2G9DA 1X3PA 3PO3B 3OPOA 4WJWA 2A68C 1G8ZD 4K5XA 5E4WC 4B9WA 4N9TA 2JP1A 1R4PB 4ZUJA 4FP5D 3W2DA 1BCPD 1EL0A 3DXJC 2NB0A 5I9PA 3EROA 5CR3A 2A68D 3D6CA 4IFDI 2VUMB 1EY6A 4IURA 4NP5A 2K05A 4IUQA 4C3HB 3U9OA 1GXDC 4M1UB 1V8QA 4RA8A 2GA4B 3P1HA 3MXNA 2F0TA 2NVTB 3WDNA 5I9OA 1NAPA 3Q6SA 1KDAA 3HKZB 5IOCA 4OO1H 1KNEA 3T16A 1BBXC 4HN7A 4WORA 3PIP3 4ZK9B 4OIJA 2PMZB 1KLUD 3W3AA 1F2YA 1SFOB 2D62A 1LABA 2A6HC 3FDTA 5E3FA 3J81E 4A3BB 3MZ5A 1ET6A 2XWBB 1EY5A 3FPPA 5LHY1 3S2DB 4F7XA 3T4AC 1JWMD 2NN6G 5CYUA 5HURA 2A6HD 3OWFA 4G4KA 1F9SA 4IN3A 4CGYB 1FGBD 3TZDA 2HCCA 4WRDA 1AZQA 3GD7A 4ZLTF 3I72A 5DM63 2PZTA 3SVMA 5CV9A 1UEAB 1VCIA 2O2LD 1LT5D 2B2TA 4KTAA 2ZT9C 1CHQD 2KHSA 2ZXRA 5K36G 1QILA 4A3EB 2ZXOA 2JA5B 1TVXA 5CV4A 1PTOB 2L9HA 1SEBD 2PZWA 3PUYA 3RZOB 1R9TB 4DA2A 5FLXE 1ESRA 4X3TA 2E2DC 2B2YC 2HQEA 4IFDG 3IFTA 5E4XA 2QDBA 1U4RA 1F2MA 1FNUA 4S3SA 1HA6A 4Q0FA 4KKUA 4BA2I 2JA8B 4YIJA 3OHXC 1VMPA 4DN4M 3JAML 1JQYD 1D5XC 5EGTA 5C5LA 4RHRA 1I4PA 1Y8PB 4HSPA 2YU9B 3GTJB 1FNVA 5EKIA 4UAIA 4A3GB 1EFID 1QE6A 1EU3A 1SYGA 2RDHA 3TP8A 1O7YA 4C3JG 2WV6D 1XYIA 3QO2A 5EJWA 4U68A 3A7LA 3A8KE 4DXFA 4V0BA 2KEDA 3C1FA 1B9NA 1RODA 4RHSA 2IX3A 3QWNA 4B9XA 2EY5A 4RGOS 2L1BA 2PZUA 2NZ1D 1EZ8A 2IT1A 1IYUA 3S16B 5NUCA 2SNSA 5FO9B 1SE2A 5IGGA 5CBAE 4K14A 4IUVA 3RZDB 1LLRD 1YNND 1EQTA 5DEHA 1I4GA 1LO5D 4ZYSA 3GTLB 4KY5A 1V1PA 2B2UC 2EY1A 4A93B 1BDOA 4EGVA 3I4NB 3I4LA 2EJGC 2WKDA 4ODGA 1HHVA 2O4XA 4FNFA 2F0UA 1EEFD 2EYJA 1BF4A 2EYFA 4XDXA 5CV6A 5DNFA 1BUVT 1II3A 3BDLA 1OXVA 1Y1VB 2ICIA 3H94A 1CK1A 1G2TA 1G91A 1F2LA 4FF2A 4EQPA 3IKJA 1OXSC 2QEJC 1HA5A 2FINB 4KKTA 2C5CA 1DOMA 1MD2D 3NXWA 3BS1A 3C46A 3TZUA 2NWGA 1ML0D 2EYOA 2RQXA 1U4LA 4FXGC 5IODA 5CORA 3DWPA 5C3XA 3I91A 4K2LA 2FHTA 2F0NA 1STBA 1IL8A 4DGZA 4G7ZC 4FXDA 1PFBA 3PV0A 2Z4HA 5IGDA 1EY7A 3N52A 1CA6A 2R7ZB 2X6LA 3ITPA 3NTKA 2MPMA 1Q1EA 5EBDA 1ESFA 2PQEA 2ZXPA 1WTWA 2IJ0A 1STAA 5C3WA 1PMRA 3NPPA 3VA5A 5IGEA 1IKLA 2B8GA 4GZYC 5FOBB 2WACA 1EZ6A 1AZPA 3MA2B 5JJZA 4QCLA 1PRTC 1STHA 2EDGA 3DWAA 1WTQA 1D6EC 3HS0C 4RCNA 1PRTD 3MTSA 1HTLD 2LS01 3GTMB 1ILQA 1GUSA 1Q8IA 2PCFB 5M3FB 1IYVA 2VB3X 3GP7A 4J6HA 2EE1A 3R2IA 2LMCB 4HCSA 2IL8A 1O7LA 2E76C 4FYDA 1CI3M 4BWGB 4KMUC 3KLRA 4HMJA 3TBIB 4X3UA 4ZAIA 4C1NK 3PUVA 1GUOA 4DU9A 1ILPA 1EU4A 1LV9A 2K1BA 5A2QL 1WTRA 1JOQA 3HRZC 2AUKA 1STEA 4EQNA 1DONA 3CQZB 2F0PA 3NTIA 4JBWA 2EY6A 4XYOA 3MXUA 1SSOA 2A6EC 1OXUA 4MIUA 1QOHA 3VYTA 3QIAA 3N6RA 3NBHA 3KK7A 1B4OA 1ICWA 2A6ED 3GO5A 2JEAI 2CW0C 1S5CD 3S14B 2VNUD 4K5VA 2E74C 1SNOA 2EYPA 4DAPA 3DMUA 1JC7A 2IPKD 4X3SA 1PZJD 4ZQ3A 1DYQA 1PXUA 1U4MA 5BN5A 1I3QB 2EXZA 1JICA 2F4IA 2IWHA 1LT3D 5M5XB 3JAME 5JEAJ 1T5EA 4RCOA 3BDOA 3VR6A 4ZKCB 1SBBB 5IT9L 1E0BA 2YYZA 4NDXA 4HTHA 1EWCA 4FF4A 1JWSD 1KDCA 2KA7A 4R8NA 3KLSX 1PRTB 1DXMA 3VR2A 3L9AX 3WOEA 4KHVA 3NQIA 1UNSA 3M3YB 1FNWA 5JEAH 1A6XA 2D9UA 4KJOA 1SAPA 3EJIA 4XXEA 1SNPA 1I50B 5G3LF 4I7ZC 3I3CA 4IQZA 3M4OB 2EYLA 5ELEA 2H1EA 5KIXA 4G7HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGD A;  5DEH A;  4ME5 A;  1SYF A;  1EY7 A;  2F3W A;  3SR1 A;  5I9P A;  3ERO A;  5CR3 A;  4N9P A;  2KQ3 A;  4MIU A;  2LKV A;  3D6C A;  2F0J A;  5I6W A;  4KY5 A;  1KDB A;  4NKL A;  4DFA A;  1EY6 A;  3D8G A;  3ITP A;  4ID6 A;  4NP5 A;  3S9W A;  1SNQ A;  3HZX A;  1KAB A;  2EY2 A;  3U9O A;  4ZUI A;  2EY1 A;  3MEH A;  2PQE A;  5EKK A;  3PMF A;  2HQE A;  2F0E A;  3E5S A;  2EYM A;  4IUN A;  4KD3 A;  3SK8 A;  4K8J A;  2F0H A;  4K5W A;  5KRU A;  3P1H A;  5M9O A;  1AEX A;  1STA A;  4KY6 A;  3MXP A;  5C3W A;  1EYC A;  2F0T A;  2F3V A;  4K5V A;  5I9O A;  5C4H A;  3HEJ A;  4ODG A;  4K6D A;  2O4X A;  1KAA A;  1KDA A;  2QDB A;  1SNO A;  4K8I A;  3VA5 A;  4EVO A;  5HGT A;  5IGE A;  1TR5 A;  2EYP A;  3TME A;  3EVQ A;  3DMU A;  1F2M A;  5EKL A;  2F0U A;  2NUC A;  5IOC A;  2WAC A;  4QF4 A;  4RKL A;  4S3S A;  5CV7 A;  1EZ6 A;  4G57 A;  2EYJ A;  4IAL A;  2OXP A;  4ZQ3 A;  1SYD A;  3MHB A;  4ZUJ A;  2OEO A;  2EYF A;  4HMI A;  5CV6 A;  4YIJ A;  3QOJ A;  5KEE A;  4QB4 A;  3T16 A;  2EXZ A;  3SK4 A;  3TP7 A;  1STG A;  2F0D A;  1STN A;  5CV8 A;  4WOR A;  5KYL A;  5DAU A;  1A2T A;  4J1M A;  2OF1 A;  4NMZ A;  3C1E A;  1RKN A;  5EGT A;  1SYC A;  1II3 A;  4IZ8 A;  3SHL A;  4K2K A;  5KGU A;  3BDL A;  1STH A;  5C5L A;  2SOB A;  3QB3 A;  3RUZ A;  5KYI A;  5CC4 A;  5C4Z A;  3NHH A;  3SK6 A;  2F0K A;  4PNY A;  4NDX A;  4OL7 A;  1F2Y A;  1SNC A;  4HTH A;  1SNM A;  2F0L A;  2M00 A;  3SK5 A;  3V2T A;  5IGB A;  4EQP A;  1JOR A;  5J1Z A;  2F0W A;  1KDC A;  1SYB A;  3ERQ A;  3NUC A;  4I65 A;  5E3F A;  1SYG A;  4RKB A;  1NUC A;  2F0F A;  3MVV A;  3MZ5 A;  4H7B A;  5I6Y A;  3TP8 A;  1EY5 A;  1EQV A;  3P75 A;  4KV6 A;  5F2D A;  4KY7 A;  2F0I A;  1IHZ A;  4F7X A;  4R8N A;  5CV5 A;  4EQO A;  3BDC A;  3NK9 A;  2RBM A;  3H6M A;  3R3O A;  1EY0 A;  2F0G A;  4J6H A;  3T13 A;  5HUR A;  3OWF A;  1U9R A;  3TP5 A;  1SYE A;  2RDF A;  2PYK A;  3OMC A;  4DF7 A;  3D4D A;  1STY A;  5C5M A;  5J22 A;  5JAV A;  1EY9 A;  3C1F A;  5ISR A;  2ENB A;  2F0Q A;  3NP8 A;  1A3U A;  1A3T A;  3NXW A;  4KHV A;  5IIF A;  4TRD A;  5J39 A;  1A2U A;  4WRD A;  4B9X A;  2EYO A;  1JOO A;  2EYH A;  2F0S A;  3SXH A;  2EY5 A;  5E1F A;  1EY4 A;  1ENA A;  4KJN A;  3OMG A;  4HMJ A;  2PZT A;  1ENC A;  3NQT A;  5CV9 A;  3OSO A;  5JOB A;  5IGF A;  5IOD A;  1EYD A;  4KJO A;  4LAA A;  5C3X A;  4K2L A;  2PZU A;  1NSN S;  1EZ8 A;  3DHQ A;  3EJI A;  4KTA A;  4QMG A;  3TP6 A;  2RKS A;  4KD4 A;  2F0V A;  1SNP A;  3LX0 A;  1EY8 A;  4DU9 A;  5NUC A;  2PW5 A;  2SNS A;  2KHS A;  2F0N A;  4E6I A;  1SND A;  5K5P A;  1JOK A;  4PMB A;  1JOQ A;  1A3V A;  1STB A;  5C6A A;  5IGG A;  4K5X A;  5IGC A;  1F2Z A;  2PW7 A;  5CV4 A;  4DGZ A;  4K14 A;  4B9W A;  1TT2 A;  2EYL A;  4N9T A;  2SNM A;  2F0P A;  4EQN A;  2F0O A;  3QOL A;  4PMC A;  2EY6 A;  4F8M A;  1EYA A;  5CGK A;  5KIX A;  1TQO A;  2PZW A;  2F0M A;  3D4W A; 
#chains in the Genus database with same CATH topology
 3DEP A;  4ME5 A;  3SR1 A;  3ZJY C;  5A35 A;  2KQ3 A;  2K32 A;  2LKV A;  1K0R A;  5GQO A;  3HOY H;  1KAB A;  2EY2 A;  5M5Y B;  3A74 A;  3DEO A;  1AH9 A;  3K5O A;  3I4M G;  1PYS B;  2HCI A;  1WJJ A;  4R8I A;  4DNR B;  3RNU A;  1BCP C;  1QNU A;  3GV6 A;  3DWQ A;  1SMY C;  3PO2 G;  3CQZ H;  1TY0 A;  3SGI A;  5T1G A;  1VQ8 A;  1PVO A;  4RH6 A;  5HGT A;  4X62 L;  1Q86 C;  2NUC A;  3KJO A;  3E9I A;  4JI6 L;  1B2T A;  1TKW B;  4BY1 B;  3MFG A;  3GTQ B;  1SMY D;  1K83 B;  5I2X A;  1I5F A;  4YHH Q;  2ASB A;  2JEB I;  3HOZ H;  1X55 A;  1O80 A;  2K03 A;  1N32 L;  2H5X A;  4DR2 L;  5LMU Q;  4J1M A;  2VL6 A;  3J7Y W;  3Q8D A;  2QDL A;  3H0G G;  2MP1 A;  3SHL A;  5KGU A;  3S14 H;  5BR8 L;  1V9P A;  3VR4 A;  5IYB G;  4H13 C;  3X3N A;  1S72 A;  3ZYY X;  3HG9 A;  2AQ2 B;  2L4N A;  1CKM A;  2F0L A;  3V2T A;  1MBY A;  3I90 A;  1H9S B;  3J7A V;  5J1Z A;  2XGT A;  1SYB A;  2G9H D;  1I3Q H;  3CD6 A;  5AJ3 Q;  4IUT A;  3Q23 A;  4TSS A;  1L2F A;  3AB9 A;  5DM7 3;  1MJC A;  5M5X H;  4KV6 A;  1CZG A;  5F2D A;  3EFX D;  1LUZ A;  2B8F A;  4OWT B;  4GKK L;  3T13 A;  3UDF A;  4JK1 C;  1CSQ A;  2WII B;  3D4D A;  4DXG A;  4HIM A;  4BBS B;  5IWA L;  1YVC A;  1Q46 A;  1A3U A;  1GOZ A;  2UXD Q;  2EOT A;  2CQO A;  3EN2 A;  3URY A;  4C3I B;  3I73 A;  3KOJ A;  1ENC A;  2C9O A;  5GAD C;  4R1J A;  1P8L A;  1WCM G;  2J7Z A;  3GDE A;  5DLQ E;  1RTO A;  1XJV A;  1B7Y B;  2RSN A;  2E8G A;  5IGC A;  1TWC B;  4PZ6 A;  2K33 A;  3AYH B;  1WTP A;  2MQH A;  5C0X G;  2G5D A;  2Z0S A;  2HHH L;  2B3G A;  2Q2I A;  1GVP A;  1TT2 A;  1B44 D;  4A3D G;  3VYR A;  1CFM A;  5ELF A;  2F0M A;  1RL2 A;  4JC0 A;  3PIP A;  4JYA Q;  2Q8I B;  4R4O A;  4LF5 Q;  4A3F B;  4A3M H;  2CQA A;  3KBX A;  1I50 H;  5EKK A;  3PMF A;  1LTL A;  2JA7 B;  1HFG A;  2F0E A;  1PH6 A;  1XNR L;  3A5U A;  4DV2 L;  1KIX A;  3G7L A;  3M4O H;  4QUC A;  2B2Y A;  3HEJ A;  2YTX A;  2BH8 A;  3A8I E;  4HSV A;  3H3V C;  3EVQ A;  3CU7 A;  5GRO A;  3SE0 A;  1ZKO A;  2Y0S B;  4L6T B;  2B63 G;  1H9M A;  3P20 A;  4A4I A;  2EQS A;  3SK4 A;  4DAM A;  3J81 j;  1JCK B;  2K52 A;  1S5F D;  1QCB D;  1SDF A;  2CH4 A;  1TII D;  4PV1 C;  1ET9 A;  3QB3 A;  4R4Q A;  4TKO B;  1VS0 A;  3RUZ A;  3J80 L;  4DR5 L;  3HKZ E;  4DV0 Q;  4LUZ A;  1BBW A;  1GD7 A;  4MN3 A;  1X9N A;  1BCP B;  1L1O A;  4HIK A;  1CTM A;  1SXT A;  2F52 A;  4BY1 H;  5GAG C;  1VQN A;  3GTQ H;  4XIG S;  4I65 A;  4RKB A;  2F0F A;  2MJ8 A;  4AYB B;  4L63 B;  3HKS A;  3VR3 A;  1EQV A;  2PMZ E;  2Z6K A;  2KCC A;  1ASZ A;  4XYQ A;  3GTO B;  2EZV A;  3K81 C;  4EX5 A;  3R3O A;  2PYK A;  1HQR D;  1LM0 A;  4X64 Q;  3HOW B;  3NWT A;  5C5M A;  2DNE A;  3AMU A;  5M3M G;  1MIU A;  1JR0 D;  3CCQ A;  1DD2 A;  1RCV D;  4KHP Q;  1A2U A;  4ILW A;  3G6E A;  4XQQ A;  3I7F A;  4KHZ A;  3HOV G;  4B3M L;  4OO1 I;  3D3R A;  5D3D A;  2XRS D;  3E0E A;  4JBM A;  3I70 A;  3M7G A;  4QMG A;  1M8A A;  1NNX A;  2RKS A;  3K57 A;  4DK6 C;  1GKH A;  3MAQ A;  4GKJ L;  1FJG L;  2SEB D;  5ELB A;  4BBS H;  5A2Q E;  2PW7 A;  1HFN A;  4POG A;  2D0P A;  1SFO H;  3VR5 A;  1SRU A;  3EBE A;  4C3I H;  4NXM L;  1VQK A;  1DM0 B;  5BN3 A;  4P71 A;  4N9P A;  3I4M B;  4IO9 A;  3IRB A;  4RGN A;  3EA6 A;  3S2D H;  3PO2 B;  4GS3 A;  4DK1 A;  1VQF A;  5H1S E;  2E5L Q;  1YNN C;  4OIK A;  2FXQ A;  3O13 A;  1TWC H;  3G48 A;  5D3I B;  3E0J A;  4A3J B;  1XNQ L;  5KRU A;  2B2U A;  2N49 A;  1AEX A;  1XWE A;  3T51 B;  2AWN A;  5L37 A;  4FF3 A;  1TR5 A;  1D8L A;  4IAL A;  3T56 B;  2JXM B;  4BY7 G;  2O5J C;  1XX8 A;  1M1K C;  4A3F H;  4OXP A;  3NEL A;  5C3E B;  1PZK D;  4CHT B;  2V4D A;  4O0A A;  2KEE A;  2JA7 H;  2OF1 A;  3Q24 A;  3A56 A;  4DR3 L;  1S4Z A;  5IP7 H;  2K01 A;  2OTL A;  4A3E H;  2SOB A;  3FEW X;  2JA5 H;  1YHQ A;  1PTO H;  3KLW A;  4XT3 B;  2HT1 A;  3HOY G;  1JB7 A;  4DR7 L;  2JA6 B;  1GO3 E;  1EIG A;  5IT9 E;  3HOX B;  2Z9H A;  1HR0 W;  3RN5 A;  4C1N I;  3LNN A;  1LT4 D;  2NYZ D;  3I4O A;  3S17 B;  2BDN A;  3E6Z X;  1UE6 A;  2L0C A;  3W5O A;  4KK7 A;  1HNZ Q;  1E2Z A;  2AQ1 B;  2K28 A;  1YI2 A;  4HJ5 A;  1MGS A;  1IL2 A;  3HOZ G;  3TP5 A;  1LTG D;  1VQE A;  1Y8O B;  2A1A A;  1EIF A;  4JI4 L;  4IPH A;  2LY7 A;  1HQM C;  1K28 A;  4Z9C B;  1I4Q A;  1G2S A;  3M4Q A;  3R2T A;  2P5Z X;  1JOO A;  4MTN A;  2VZA A;  1WD0 A;  4KJN A;  2XNA C;  1QUQ B;  3ULL A;  5JOB A;  1N34 Q;  4GOP C;  3CC2 A;  3GTO H;  3TP6 A;  1Y1W B;  4OO1 G;  2UUA L;  2PW5 A;  5K5P A;  3HOW H;  2ICE C;  3GTJ H;  4JBJ A;  1NE3 A;  5JVG 3;  4A3G H;  4FVM A;  1QB5 D;  4CDF C;  3CPF A;  2B2V C;  1QJO A;  4GLV B;  4DV1 Q;  4GLX A;  2F3W A;  1KTK A;  2VQF Q;  4RAU C;  2J0T D;  2OQ0 A;  2KOL A;  4LFB L;  2HIX A;  2UUB Q;  3U9S A;  2IX1 A;  1F77 A;  3W1G A;  2R92 B;  3HGB A;  2K5Q A;  1FD7 D;  2EJF C;  4KD3 A;  2M9V A;  4K8J A;  2D0O A;  3QG1 A;  3MXP A;  4LUV A;  2XSC A;  2R3Z A;  3H91 A;  4JI5 L;  2AHO B;  4EVO A;  1UE5 A;  3OWE B;  2O5I C;  1VQG A;  2A8V A;  2CFM A;  2ATW A;  2I46 A;  2JQO A;  1SJH D;  1SYD A;  4I7A A;  3CRK C;  1NCV A;  3TP7 A;  4DK3 C;  5CMD A;  1JE5 A;  5DAU A;  4JI0 Q;  4HR7 B;  4A3I G;  4A3J H;  3CXC A;  3KF8 A;  1ZXT A;  3K0X A;  3FKI G;  4FO2 A;  2IW3 A;  1Z6H A;  1N8R C;  4XT1 B;  4PQX A;  1B50 A;  5M5W B;  2F0K A;  2K04 A;  2MGS A;  4OL7 A;  2M00 A;  1PV4 A;  4DV3 Q;  2N88 A;  3GTL H;  3PIO A;  3NUC A;  4LNQ A;  4Q5V A;  2R93 G;  5C3E H;  1XTC D;  4CJ1 B;  4B3T Q;  4IOA A;  5FJ8 G;  4LF6 L;  3X3M A;  3RLO A;  2B29 A;  2NVY B;  4PZ7 A;  3S2H B;  1VQM A;  5CV5 A;  3JC6 6;  3IAY A;  5C4X G;  1GUW A;  2Q2T A;  3CCU A;  2JA6 H;  3A55 A;  2UU9 Q;  5IY0 A;  3PO3 G;  4DF7 A;  3HOX H;  3K0Y A;  1KL9 A;  2KVM A;  3I2Z A;  5D14 A;  1TS5 A;  1WTO A;  1EYG A;  2ZM6 Q;  3P7J A;  1PFM A;  4C3J B;  3H3V H;  3WOF A;  1S5B D;  3S17 H;  2UXB L;  3AU7 A;  1MSG A;  3M4Y A;  2JYO A;  5LL6 S;  1LT6 D;  2MO0 A;  2AUJ D;  5ELO A;  2HD3 A;  2VUM G;  3CF5 A;  2DY7 A;  3D4R A;  2JA9 A;  1NR4 A;  1PH5 A;  4C3H G;  1ENF A;  1PDQ A;  1XMO Q;  1F2Z A;  4PMW A;  2KJX A;  4NB3 A;  4B08 A;  5TSS A;  2HUG A;  2NN6 H;  1CT1 D;  5I6W A;  4NKL A;  1IBL L;  3HKZ G;  1HJP A;  1Y1W H;  3K58 A;  4L5S A;  1SNQ A;  3HZX A;  1X32 A;  4WJ3 M;  1RDP D;  4IFD J;  2NVQ B;  1E1O A;  4QY7 A;  1A63 A;  4GOP B;  4JOI A;  1JMC A;  4HED A;  1QZH A;  4OWW B;  1QG7 A;  2CH4 W;  1I4H A;  2PO4 A;  2B39 A;  2E2J B;  4K8I A;  1NJI C;  2OCE A;  3TME A;  5EKL A;  3UE1 A;  2R6G A;  4YCU A;  1H9S A;  2A69 C;  3BZC A;  4WFN 3;  2AWO A;  3CHB D;  3K7U C;  2LSS A;  5KEE A;  4QB4 A;  2R92 H;  4IJL A;  3GTG B;  2QKI C;  1HNX Q;  1BO0 A;  4A3B G;  1RKN A;  1RD9 D;  2N3S A;  3BJU A;  2A69 D;  3LGJ A;  5EQ0 A;  1IBK Q;  5FO8 B;  2TMP A;  5KYI A;  1LTT D;  1SLJ A;  2WAQ B;  2LXK A;  3J80 E;  4CKE A;  3PGZ A;  1CA5 A;  2EVB A;  4YY3 Q;  2FFK B;  1XPR A;  2MUY A;  1B3A A;  4IFD H;  3T1Y Q;  4P73 A;  4OX9 Q;  4YCV A;  1LAC A;  2CHB D;  4KLK A;  3S24 A;  2L11 A;  4KY7 A;  2F0I A;  4EQO A;  1WTX A;  3BDC A;  1DJR D;  2NBF A;  3FPU B;  3H6M A;  5M5W H;  3CRL C;  3KDF A;  1YNX A;  1CKN A;  1AE2 A;  2NVX B;  1STY A;  2SDF A;  4OEM B;  4L5R C;  1D7Q A;  4H0L C;  1QVF A;  3V05 A;  5T1I A;  5C44 B;  1NR2 A;  3KFU A;  2B2W C;  4U67 3;  2XTI A;  3PUW A;  4JI1 Q;  2AMC B;  2AQ3 B;  3T53 B;  2FMM A;  4DV6 L;  3RMH A;  1PTO F;  2NVY H;  1WVL A;  2I07 B;  1K8G A;  5EBC A;  3S2H H;  4LF8 L;  3CME A;  1NSN S;  2ES2 A;  4DNI A;  4KD4 A;  4OWX B;  3LX0 A;  1K0S A;  3K5L A;  1W2B A;  1F9P A;  2VQE Q;  1HXY D;  4PMB A;  1IYJ B;  3CCJ A;  1X3Q A;  1LTB D;  4OHJ A;  2F0O A;  2HQL A;  1Y8N B;  4C3J H;  3FRP B;  4OON A;  1M90 C;  5HGQ A;  2WB1 B;  4K0K Q;  2F0J A;  4TQU S;  3HP3 A;  4ID6 A;  2Z8L A;  1BCP F;  4R9W A;  1G51 A;  2JJQ A;  2MFI A;  4JI8 L;  1KLG D;  5C0X I;  2BE5 C;  2JA8 G;  3OW7 A;  3E5S A;  2QW7 A;  1S5D D;  2Q8R E;  1CQV A;  4DAV A;  4G7O C;  1KQS A;  2F3V A;  4HCE A;  2PQA B;  4NXN Q;  3A7A B;  3OIP A;  1YEZ A;  1QZG A;  1TY2 A;  4BBR B;  1IBM L;  1BNZ A;  2BE5 D;  5CV7 A;  1RTN A;  1K8O A;  2BA0 A;  4JPB W;  2KCM A;  3PUX A;  4RFB A;  4PZ8 A;  1GUG A;  2UXC Q;  1STN A;  2NVQ H;  1B9M A;  1SE4 A;  4K2K A;  3J7A F;  1AN8 A;  1D1I A;  1Q3L A;  2N8N A;  2QEX A;  2E2J H;  5JJI A;  4B3R Q;  3BYT B;  1Q7Y C;  2JE6 I;  2HHH Q;  4IOC A;  1QNK A;  1XPU A;  3PCO B;  1L0Y B;  3GTG H;  1EIH A;  4LF4 Q;  3G6J B;  4H7B A;  1U4P A;  1N33 L;  1NMG A;  5IP9 H;  5IYD H;  1RHP A;  3I55 A;  1I4X A;  1IHZ A;  3ND8 A;  1QWY A;  1AW7 A;  1QVG A;  1EY0 A;  1WD1 A;  2RDF A;  4KKS A;  1E2V A;  2XWJ B;  2F0Q A;  2MHV A;  1V43 A;  4JG2 A;  4TRD A;  3PQI A;  1Y69 U;  4UHV A;  1Q8K A;  2E2I B;  1C9O A;  5G3L D;  3UI2 A;  4LAA A;  2FMC A;  3DHQ A;  1DCZ A;  4DR1 Q;  2F0V A;  4O42 A;  1VQC A;  1GHK A;  2YTV A;  1I94 L;  4JBK A;  1PH4 A;  2NVX H;  3KBG A;  4A93 G;  5C4J B;  5C44 H;  1T9H A;  3HOU B;  3I4N G;  3L3O C;  3K7A B;  3D4W A;  5KND A;  2LFN A;  4ZCK A;  4K6L A;  1UE7 A;  2ALY B;  4JV5 Q;  4CKC A;  3VDY A;  3K8A A;  4F88 A;  4N8F A;  1UE1 A;  2RHS B;  1X6O A;  4X65 Q;  2WIN B;  1SR3 A;  1UAP A;  1Q1B A;  3J81 i;  4P72 A;  1A15 A;  1O78 A;  2A19 A;  2ID0 A;  2KHI A;  4IUN A;  3SK8 A;  1YBY A;  1SE3 A;  1R4Q B;  2F0H A;  4K5W A;  3BZK A;  3NBI A;  5FLM H;  1JWU D;  4RWS C;  4C56 C;  3A54 A;  3GTP B;  3I8Z A;  4FDB A;  1Y1V G;  4IUU A;  3M3Y H;  1BR9 A;  4NPS A;  2OXP A;  2XN9 C;  4L8J A;  2K5H A;  1YJW A;  5J3B A;  5JVH 3;  3QOJ A;  4IZ8 A;  5LL6 X;  1FGU A;  3BZD B;  4A3L G;  1H9J A;  4N8X 1;  3CCL A;  4PNY A;  1IKM A;  2X6G A;  1DOK A;  4O1N A;  1SNC A;  3D31 A;  3K5N A;  2CCZ A;  5EAY A;  3SK5 A;  1DZ1 A;  2RDG A;  2BOS A;  4YHH L;  2ZJP A;  4YWL A;  1C48 A;  1EUJ A;  2XIW A;  1EWH A;  5LMU L;  1QUQ A;  3ND9 A;  5I6Y A;  2JSO A;  4LJZ C;  5M5Y H;  1N9W A;  2HDM A;  4RGM A;  1TWG B;  4DAY B;  4GN5 A;  2IY5 B;  1PYB A;  1VQP A;  5I2Y A;  2RBM A;  2NTS A;  1EEI D;  5ELN A;  1U9R A;  1SYE A;  4H02 A;  2HIV A;  3BVZ A;  5J22 A;  1EY9 A;  5ISR A;  2ENB A;  4JI2 Q;  1B1Z A;  1PFN A;  3AFP A;  5AJ3 L;  4DV7 Q;  3EQL C;  1EY4 A;  1K83 H;  2B2T C;  4DV5 Q;  1HZC A;  3NQT A;  4IPD A;  3VA7 A;  3BYY B;  4CBV A;  1VF7 A;  4LMQ D;  1ASY A;  2R7Z G;  2DY8 A;  1PLF A;  3A8J E;  4JI3 Q;  1D2B A;  3L7Z C;  1U5K A;  4DNT B;  2DN8 A;  3TRE A;  3VYS A;  2UXD L;  4YWM A;  4BXX H;  1AFP A;  1X3F A;  4PMC A;  3RLF A;  1ONL A;  3S1R B;  2VY3 A;  3TEH B;  1GHJ A;  2TSS A;  4A75 A;  1KDB A;  1J9O A;  3ERS X;  1GJX A;  2RSO A;  3M4P A;  1LTR D;  4IUP A;  1XTD A;  3UDX A;  1HRJ A;  1Q12 A;  2K6A A;  2M2L A;  3MXG A;  1NMF A;  1J8I A;  3BVM A;  4AH6 A;  1VQ6 A;  4LF9 Q;  3S1N B;  4JI7 Q;  5M9O A;  1J5E Q;  1KAW A;  3HOU H;  4QL5 A;  1EYC A;  1QVC A;  2L55 A;  5J39 A;  4JYA L;  2Q2U A;  5EPJ A;  1Z7T A;  4RKL A;  4LF5 L;  1FYC A;  2OT2 A;  2WKC A;  4HMI A;  1S5E D;  2NZO A;  1MSH A;  5AFW A;  5COY A;  1KHI A;  3Q22 A;  2N55 A;  5CBE E;  4HAE A;  1PH1 A;  1ZEQ X;  5M3F G;  1RJT A;  3DM1 A;  3CKI B;  4UPA A;  3ULJ A;  3OOC A;  2E75 C;  5JEA G;  2K7V A;  4NW2 A;  3MXN B;  1U0L A;  1MI2 A;  3GTP H;  3SK6 A;  2Y0S E;  5LMN W;  1TWA B;  3CCS A;  4KI0 A;  4A3K G;  3PUZ A;  1BQQ T;  5IGB A;  1EOV A;  2QF7 A;  4GNX C;  3H0G B;  4UDU C;  4V19 0;  2X69 A;  2F1M A;  5EPL A;  3LWU A;  4TVA B;  1EQQ A;  3FVQ A;  2CKZ B;  2YTY A;  3GV3 A;  2DJF C;  2QIL A;  3F2U A;  2DGY A;  3H09 A;  4DV0 L;  1WYD A;  1EFW A;  1AP0 A;  2Q8T A;  3Q0A A;  1TWH B;  1B53 A;  1PYW D;  4QIW B;  4AYB E;  1O7Z A;  3TRZ A;  5E1F A;  2L15 A;  2IHF A;  5FO7 B;  4A3C H;  1FVI A;  2KBN A;  1CM9 A;  1NTG A;  3IFD A;  4X64 L;  4GOP A;  4E6I A;  4DV4 Q;  4MNO A;  5C6A A;  1J6Q A;  2EPB A;  1KNA A;  3K59 A;  5IYC H;  1PH3 A;  4KHP L;  4AQY Q;  4UP7 A;  4F8M A;  2SNM A;  1MKH A;  1EYA A;  1HZA A;  1TQO A;  5KNB A;  1Q90 A;  2Q2H A;  2XVS A;  1WCM B;  3SDZ A;  4R4I A;  3AEV A;  3NSW A;  4DFA A;  3S9W A;  1HNW Q;  1ZYR C;  2B2V A;  3B6Y A;  3OTO Q;  2RCF A;  3R8B A;  2V1C C;  3LWE A;  1M4V A;  3TS2 A;  4ZUI A;  5FKA C;  4C2M B;  3MEH A;  2IHE A;  4P74 A;  1TS2 A;  4A3D B;  4FXK C;  3T1H Q;  2RVL A;  4KY6 A;  5ELC A;  1ZYR D;  1PFS A;  4LF7 Q;  4DUY Q;  4IJH A;  1D1K A;  2F4V Q;  3MFY A;  1TU2 B;  1WTH A;  4ZRZ A;  4CKB A;  1BKB A;  2FJ2 A;  1LTI D;  2E5L L;  1STG A;  5CV8 A;  1H9K A;  1W6J A;  2J4X A;  5GAE C;  2R61 A;  1L0X B;  1SYC A;  2VB2 X;  1JB3 A;  3QR8 A;  1UUP A;  5C4Z A;  1H9R A;  4GLA C;  3KLS A;  2H4O A;  1C8C A;  2B63 B;  2RCN A;  3S1M B;  1K3R A;  3J81 L;  1SNM A;  1JOR A;  1B3Q A;  2R7F A;  3I4M H;  1I6V C;  2F0W A;  2I5H A;  1DOL A;  3GTK B;  1I4R A;  2K5W A;  2XRQ D;  5LMN Q;  3PO2 H;  1PRT F;  1VMC A;  2JN4 A;  4YCW A;  3PIO 3;  1E2W A;  3GQB A;  1JJC B;  1N36 Q;  2EJM A;  5FK9 C;  1Z47 A;  3NK9 A;  3VYU A;  4XQN A;  4J8Q A;  1TWA H;  1WTV A;  4A3M G;  4X66 Q;  2Z1C A;  4CJ2 C;  3H0G H;  3SXH A;  2NTT A;  1ENA A;  5BN4 A;  1BVS A;  2E2H B;  1F9R A;  2IX0 A;  1S40 A;  4J15 A;  3OSO A;  5IYB H;  3BG3 A;  5IGF A;  4DR4 Q;  3UDG A;  2KEC A;  1HNZ L;  1TS3 A;  1HR0 Q;  1D5Z C;  4GNX B;  1X3G A;  3NEM A;  1EY8 A;  4H44 C;  5M3M B;  2ZTD A;  1SND A;  3V96 A;  3CCE A;  5C0X J;  1A3V A;  4F87 A;  2PQA A;  3HOV B;  3F2C A;  4DR6 Q;  1RF2 D;  1HCZ A;  4LFA Q;  3J81 c;  2K5D A;  1SYF A;  1X56 A;  2GVA A;  3IL8 A;  1N34 L;  5FLX L;  3C3L A;  3MWY W;  1I6H B;  1CZW A;  4P2C B;  4ULL A;  1K8M A;  1LTS D;  1XMQ Q;  4BY1 G;  1E1T A;  4ABN A;  4BS9 A;  3DUZ A;  1W6K A;  2EYM A;  3RN2 A;  4P75 A;  3NTH A;  3NE5 B;  1BXT A;  2WP8 J;  5C4H A;  4K6D A;  1KAA A;  4DV1 L;  2VQF L;  3I56 A;  4FF1 A;  4OEL B;  1WCM H;  4QF4 A;  1EOT A;  1A8V A;  2UUB L;  2OEO A;  1HTP A;  1O7I A;  3BVG A;  4UY8 C;  1V1P B;  3WWV A;  5C0X H;  1ICF B;  4C2M H;  1YNJ C;  3ONA B;  1D5M C;  4DV6 Q;  5KYL A;  4B3S Q;  1GUN A;  3MC0 B;  1SE8 A;  4NMZ A;  4A3D H;  4HID A;  4LFC Q;  4A3K B;  3A0J A;  3K6O A;  3STB C;  1YNJ D;  3TSS A;  4BY7 B;  2WFW A;  4Y7N B;  1G6P A;  4HIO A;  1IW7 C;  2Z4I A;  1G6Z A;  3D6W A;  4M8A A;  4KN7 C;  4BBS G;  1NUC A;  5FLX c;  4JI0 L;  5K36 H;  4DUZ Q;  3P75 A;  3SEB A;  1VQH A;  3STB D;  1SJE D;  1YIJ A;  3HOY B;  4C3I G;  3TDQ A;  1IW7 D;  2QCP X;  3S1Q B;  1PH7 A;  1X3E A;  3OMC A;  3CCV A;  3G4S A;  3ICE A;  1T5X D;  4DV3 L;  4MTK A;  2VXW A;  3NP8 A;  2D2C C;  1A3T A;  4KN4 C;  3U4V A;  1FR3 A;  2A74 C;  4B3T L;  1IBM Q;  2UUC Q;  2PPB C;  1OXT A;  2EYH A;  4ZKB B;  3J80 i;  4L5Q A;  2DJG C;  3QJY A;  1A0I A;  2CVR A;  2B2W A;  3HOZ B;  1XXG A;  1S3O A;  4UP9 A;  4XQJ A;  2PNH A;  2D5D A;  2UU9 L;  1UWV A;  3A5Z B;  1LTA D;  4A3F G;  1JOK A;  2VS1 A;  2F3I A;  2JA7 G;  3K5M A;  2ZM6 L;  3QOL A;  5CGK A;  1V1O A;  4A76 A;  3JAM i;  5IP7 G;  4RGT A;  4OGQ C;  2A5H A;  4A3E G;  1BOS A;  2BCO A;  4X62 Q;  1CHP D;  1GM5 A;  2E2H H;  2CW0 D;  1G29 1;  2JA5 G;  1TWF B;  2L12 A;  1TS4 A;  1RIP A;  5KNC A;  2LXJ A;  4RMF A;  4JI6 Q;  3D8G A;  2YV5 A;  3UDI A;  5I4D A;  1HPC A;  2Y0S G;  4LK1 C;  3FMC A;  2NZH A;  1IZ6 A;  1XMO L;  3C2P A;  1N32 Q;  4DR2 Q;  1C4Q A;  5ELD A;  5D65 A;  3HOV H;  1JE4 A;  1OTC A;  1OXX K;  5BR8 Q;  3U50 C;  4QQB X;  2DNC A;  3OIQ A;  3TN2 A;  1GUT A;  2PNR C;  5JPM C;  4G57 A;  5JPN C;  4CDE C;  3R93 A;  3H3V I;  3MHB A;  1I6H H;  4MHE A;  2F0D A;  4DAY A;  1A2T A;  3M85 A;  3FHW A;  4IPC A;  1NY4 A;  3C1E A;  4AYB G;  4DKA C;  2EIF A;  1PZI D;  1VDZ A;  3RD4 A;  2HDL A;  5CC4 A;  3NHH A;  4GKK Q;  3NWS A;  4R4C A;  2F03 A;  2L5T A;  2AKW B;  1FL0 A;  3UE0 A;  3KF6 B;  2BA1 A;  4CJ0 B;  3HOW G;  5IWA Q;  3KUP A;  3ERQ A;  4A3I B;  3CAM A;  3MVV A;  2NN6 I;  4A3G G;  1HNX L;  1CQF A;  3FKI B;  3CCR A;  4XTC S;  4BA1 I;  1Q81 C;  1IBK L;  3F2D A;  4A3M B;  2RA4 A;  2WAQ E;  1PTO C;  2KUM A;  1F9Q A;  3G71 A;  3PF5 A;  3M7N A;  2ZJR A;  1YIT A;  2F0G A;  4QUF A;  1HUM A;  3S15 B;  4DK0 A;  4BY7 H;  1HUN A;  4Y7N H;  4YY3 L;  5JAV A;  2R93 B;  2KCN A;  5EPK A;  5IIF A;  3T1Y L;  3PF4 A;  1PTO D;  3D0F A;  4OX9 L;  4X3K A;  4Y52 H;  2F0S A;  4POF A;  3OMG A;  4DPG A;  1OO9 B;  1E22 A;  5C4X B;  2A73 B;  2BDO A;  1EYD A;  1VF5 C;  1W3S A;  2G9D A;  1X3P A;  3PO3 B;  5E7N A;  3S1Q H;  3OPO A;  4WJW A;  2A68 C;  1G8Z D;  4K5X A;  1YZ6 A;  3TS0 A;  1PA6 A;  1XNR Q;  5E4W C;  4DV2 Q;  4B9W A;  4N9T A;  2JP1 A;  1R4P B;  2N78 A;  4A3J G;  4JI1 L;  1C7Y A;  4ZUJ A;  4FP5 D;  3W2D A;  1BCP D;  1X54 A;  1EL0 A;  3DXJ C;  2NB0 A;  5I9P A;  3ERO A;  5CR3 A;  2A68 D;  3D6C A;  2K50 A;  4IFD I;  2VUM B;  1Z9F A;  1EY6 A;  4IUR A;  4NP5 A;  2K05 A;  4IUQ A;  4C3H B;  3U9O A;  2VQE L;  1GXD C;  4HJA A;  1V8Q A;  4M1U B;  4RA8 A;  1VQA A;  3NEN A;  5C3E G;  2GA4 B;  3P1H A;  3MXN A;  1K9M C;  2F0T A;  2NVT B;  3WDN A;  5I9O A;  3Q6S A;  1NAP A;  1KDA A;  4DR5 Q;  2WB1 E;  3HKZ B;  1TWF H;  5IOC A;  1YJ9 A;  4K0K L;  2JA6 G;  4OO1 H;  1KNE A;  3HOX G;  3T16 A;  1BBX C;  4HN7 A;  3NBH B;  4WOR A;  1AE3 A;  2PI2 A;  1C0A A;  3PIP 3;  4ZK9 B;  4OIJ A;  2PMZ B;  4NXN L;  1KLU D;  1CUK A;  3W3A A;  1KXL A;  1SMX A;  1F2Y A;  2CWA A;  1SFO B;  2D62 A;  1LAB A;  2A6H C;  3FDT A;  5E3F A;  3J81 E;  2UXC L;  4A3B B;  3MZ5 A;  1ET6 A;  2XWB B;  1EY5 A;  3FPP A;  4B3M Q;  5LHY 1;  3S2D B;  4F7X A;  1MHW C;  3T4A C;  4MZ9 A;  1JWM D;  2NN6 G;  3KYH C;  5CYU A;  2A6H D;  5HUR A;  3KDF B;  1VQ5 A;  4B3R L;  3OWF A;  1CKN B;  2GN5 A;  4G4K A;  1F9S A;  1Y1W G;  4IN3 A;  1MJE A;  4CGY B;  4GKJ Q;  1FGB D;  4BBR H;  3TZD A;  1FJG Q;  2HCC A;  4ME3 A;  4LF4 L;  4WRD A;  4A3I H;  1AZQ A;  3GD7 A;  4ZLT F;  3I72 A;  5DM6 3;  3FKI H;  4NXM Q;  2PZT A;  3SVM A;  5CV9 A;  1UEA B;  1VCI A;  2O2L D;  1LT5 D;  1K73 C;  2B2T A;  4KTA A;  2ZT9 C;  3PSI A;  1KRT A;  1CHQ D;  3S15 H;  1E3P A;  1K3B C;  2KHS A;  2ZXR A;  5K36 G;  1QIL A;  4A3E B;  2ZXO A;  2JA5 B;  2R92 G;  2R93 H;  1TVX A;  4LW1 A;  5CV4 A;  1PTO B;  3CCM A;  5FJ8 H;  1XNQ Q;  2L9H A;  3AQQ A;  1SEB D;  3OYY A;  1YHB A;  4LUO A;  2PZW A;  3MEF A;  3PUY A;  3RZO B;  1VQD A;  1R9T B;  5C4X H;  4DA2 A;  1EIY B;  3PO3 H;  3CP0 A;  5FLX E;  4DR1 L;  1ESR A;  4X3T A;  2E2D C;  2KHJ A;  2B2Y C;  2HQE A;  4IFD G;  3IFT A;  2ZJQ A;  4DR3 Q;  5E4X A;  2CWP A;  3DM3 A;  2QDB A;  1B70 B;  4DR7 Q;  1U4R A;  1F2M A;  1FNU A;  4JV5 L;  4S3S A;  2VUM H;  1HA6 A;  4Q0F A;  4KKU A;  2E2I H;  4BA2 I;  2JA8 B;  4YIJ A;  3OHX C;  4C3H H;  4X65 L;  1VMP A;  3F2B A;  1HH2 P;  4DN4 M;  3U4Z A;  3JAM L;  1JQY D;  1CKO A;  1D5X C;  2RF4 A;  5EGT A;  5C5L A;  4RHR A;  1L1O C;  2NVT H;  2BH2 A;  1I4P A;  1WOC A;  1Y8P B;  4HSP A;  2YU9 B;  5C4J H;  3GTJ B;  1YHA A;  4AIM A;  1FNV A;  5IE8 A;  5EKI A;  1JT8 A;  4UAI A;  4HJ9 A;  3K7A H;  4A3G B;  5HY6 A;  1NBW A;  2QGQ A;  1EFI D;  1QE6 A;  4JI4 Q;  1VQJ A;  1EU3 A;  2Z6K C;  1SYG A;  2RDH A;  2OQK A;  4HJ8 A;  3TP8 A;  1O7Y A;  4GN4 B;  4C3J G;  5JJK A;  2WV6 D;  4GNX A;  1XYI A;  3QO2 A;  5EJW A;  4U68 A;  3A7L A;  3A8K E;  4DXF A;  3J80 c;  4V0B A;  2UUA Q;  1DGS A;  2KED A;  3C1F A;  1B9N A;  4L5T A;  1ROD A;  4RHS A;  4JW0 A;  2IX3 A;  3QWN A;  4A3B H;  4B9X A;  2EY5 A;  4RGO S;  2VW9 A;  2L1B A;  2PZU A;  2NZ1 D;  1EZ8 A;  4LFB Q;  2IT1 A;  1IYU A;  3JAM c;  3S16 B;  5NUC A;  2SNS A;  5FO9 B;  2K5N A;  1VQI A;  4HJ7 A;  1SE2 A;  5IGG A;  1YJN A;  4JI2 L;  2I0Q A;  5CBA E;  4APV A;  4K14 A;  4IUV A;  3RZD B;  4DV7 L;  1LLR D;  1YNN D;  1EQT A;  4DV5 L;  4JI5 Q;  2R7D A;  1I4G A;  5DEH A;  1SN8 A;  1LO5 D;  4ZYS A;  3GTL B;  4KY5 A;  2QA4 A;  1V1P A;  1TWG H;  3E9H A;  1L0W A;  2MO1 A;  2B2U C;  4JI3 L;  1VQO A;  3CMA A;  2EY1 A;  4A93 B;  1BDO A;  1SRO A;  4EGV A;  3I4N B;  3I4L A;  3E3X A;  5IP9 G;  5IYD G;  2EJG C;  4GN3 B;  2WKD A;  1PH9 A;  4ODG A;  1HHV A;  2O4X A;  4FNF A;  3W1B A;  3RZO H;  1TXY A;  2F0U A;  1EEF D;  1R9T H;  2WAQ G;  1CSP A;  2EYJ A;  1BF4 A;  1EWI A;  1WFQ A;  2EYF A;  4XDX A;  5CV6 A;  2OWO A;  1PH8 A;  2I5L X;  5DNF A;  1B8A A;  1BUV T;  4LF9 L;  4LF6 Q;  4JI7 L;  1II3 A;  1J5E L;  3BDL A;  3L2P A;  1KC8 C;  1OXV A;  1Y1V B;  2ICI A;  3H94 A;  5JJL A;  4RG1 A;  1CK1 A;  3OW2 A;  1G2T A;  3S1R H;  1G91 A;  1F2L A;  2EXD A;  4FF2 A;  4EQP A;  2JA8 H;  3IKJ A;  1OXS C;  2QEJ C;  1HZB A;  3DLL A;  5C44 G;  2UXB Q;  1HA5 A;  1V1Q A;  1WI5 A;  2FIN B;  1HZ9 A;  3S1N H;  4KKT A;  2YU9 H;  2C5C A;  2DUD A;  1PH2 A;  1DOM A;  1L1O B;  3J7Z C;  1MD2 D;  3NXW A;  3BS1 A;  3C46 A;  2ZTE A;  3TZU A;  2NWG A;  1ML0 D;  2EYO A;  2RQX A;  2PI2 E;  2K75 A;  1IXR A;  3CC4 A;  5FLM G;  1U4L A;  4FXG C;  5IOD A;  5COR A;  3DWP A;  1VQ7 A;  5C3X A;  1VQ9 A;  3I91 A;  4K2L A;  1IBL Q;  2FHT A;  2WB1 G;  4WJ4 A;  2F0N A;  1STB A;  4QIW E;  3TQY A;  1IL8 A;  4DGZ A;  1VQB A;  4G7Z C;  4FXD A;  1PFB A;  3PV0 A;  2Z4H A;  5IGD A;  1EY7 A;  3FP9 A;  3N52 A;  4R4T A;  1CA6 A;  2Z6B A;  2R7Z B;  2X6L A;  4BBR G;  3ITP A;  3NTK A;  2MPM A;  1Q1E A;  5EBD A;  3S16 H;  2K4K A;  1ESF A;  4DV4 L;  2PQE A;  1LYL A;  1BBU A;  2ZXP A;  1WTW A;  2IJ0 A;  4AQY L;  1STA A;  1TWH H;  5C3W A;  3RZD H;  1P16 A;  2I5M X;  2KEN A;  1PMR A;  3NPP A;  3VA5 A;  5IGE A;  1IKL A;  2B8G A;  1JJ2 A;  3KF6 A;  5FOB B;  4GZY C;  2WAC A;  2C35 B;  1HNW L;  1EZ6 A;  3OTO L;  1AZP A;  3MA2 B;  4JCV E;  5JJZ A;  4A93 H;  3T1H L;  4QCL A;  3I4N H;  1PRT C;  1XPO A;  1STH A;  2EDG A;  4LF7 L;  3DWA A;  1PHJ A;  4DUY L;  1WTQ A;  1D6E C;  4ALP A;  1UEB A;  3HS0 C;  3RLN A;  4CDD C;  3HFZ B;  4RCN A;  2F4V L;  1E24 A;  4YWK A;  1PRT D;  3MTS A;  1HTL D;  2LS0 1;  4QJF A;  4UP8 A;  3GTM B;  1ILQ A;  1GUS A;  4PG3 A;  2K5V A;  1Q8I A;  2PCF B;  5M3F B;  1IYV A;  2VB3 X;  3GP7 A;  4BXX G;  3U58 A;  3RR5 A;  4LF8 Q;  1EQR A;  1Y1V H;  4J6H A;  2EE1 A;  3R2I A;  2LMC B;  3BU2 A;  4HCS A;  2IL8 A;  1O7L A;  1K8A C;  2E76 C;  3AFQ A;  4FYD A;  1CI3 M;  4JVZ A;  4KMU C;  4BWG B;  4X6A H;  5LMN L;  3HOU G;  3KLR A;  4HMJ A;  3TBI B;  4X3U A;  4ZAI A;  4A3L H;  2K14 A;  4C1N K;  1N36 L;  3PUV A;  1GUO A;  4DU9 A;  1ILP A;  4JI8 Q;  1EU4 A;  1LV9 A;  2K1B A;  5A2Q L;  1WTR A;  4QGU A;  1JOQ A;  4X66 L;  3HRZ C;  2B63 H;  2AUK A;  1STE A;  3S1M H;  4EQN A;  3CC7 A;  3CQZ B;  2F0P A;  3NTI A;  4JBW A;  1DON A;  2EY6 A;  4XYO A;  1KRS A;  1JJG A;  3ER0 A;  3MXU A;  1SSO A;  2A6E C;  3GTK H;  1OXU A;  4MIU A;  4DR4 L;  1QOH A;  3VYT A;  2ZTC A;  1HR0 L;  3QIA A;  3N6R A;  4JOI C;  3NBH A;  1Q82 C;  3KK7 A;  1B4O A;  1Y14 B;  1ICW A;  2JK8 A;  2A6E D;  3GO5 A;  3L0O A;  2JEA I;  2CW0 C;  1S5C D;  3S14 B;  2VNU D;  4DR6 L;  3CW2 C;  4K5V A;  4LWC A;  2RHQ B;  2E74 C;  3EIV A;  4LFA L;  1SNO A;  1E7Z A;  2EYP A;  4DAP A;  3DMU A;  1JC7 A;  2IPK D;  4X3S A;  3F1Z A;  2R7Z H;  2KCT A;  3KJP A;  1PZJ D;  4ZQ3 A;  1DYQ A;  1PXU A;  1U4M A;  2MNA A;  5BN5 A;  1I3Q B;  1XMQ L;  2EXZ A;  1JIC A;  3ULP A;  2F4I A;  2IWH A;  1LT3 D;  1X65 A;  5M3M H;  1N33 Q;  5M5X B;  3JAM E;  5JEA J;  1T5E A;  4RCO A;  1A62 A;  3BDO A;  3VR6 A;  4ZKC B;  1SBB B;  5IT9 L;  4IPG A;  1E0B A;  2YYZ A;  1VQL A;  4NDX A;  4A3C G;  4HTH A;  1EWC A;  5GAH C;  4FF4 A;  1JWS D;  1KDC A;  2GVB A;  5IYC G;  4B3S L;  4EQ5 A;  1H95 A;  4LFC L;  2KA7 A;  4R8N A;  3F8T A;  3KF8 B;  1I94 Q;  3KLS X;  1PRT B;  1DXM A;  3VR2 A;  3L9A X;  3WOE A;  3GTM H;  4KHV A;  3NQI A;  3K80 C;  1KD1 C;  3M9B A;  1UNS A;  4DUZ L;  5M3F H;  3M3Y B;  1FNW A;  4O2D A;  5JEA H;  3CPW A;  1A6X A;  2D9U A;  4KJO A;  3H15 A;  1SAP A;  3EJI A;  4XXE A;  3J7A 5;  1SNP A;  4A3K H;  1I50 B;  5G3L F;  4I7Z C;  3I3C A;  4IQZ A;  2OTJ A;  5IT9 c;  3M4O B;  2EYL A;  5ELE A;  4CDC C;  2UUC L;  1VQ4 A;  2H1E A;  5KIX A;  4G7H C; 
#chains in the Genus database with same CATH homology
 3DEP A;  4ME5 A;  3SR1 A;  5A35 A;  2KQ3 A;  2K32 A;  2LKV A;  1KAB A;  2EY2 A;  5M5Y B;  3DEO A;  3K5O A;  2HCI A;  4R8I A;  4DNR B;  1BCP C;  1QNU A;  3GV6 A;  3DWQ A;  1SMY C;  1TY0 A;  5T1G A;  4RH6 A;  5HGT A;  2NUC A;  1B2T A;  1TKW B;  4BY1 B;  3MFG A;  3GTQ B;  1SMY D;  1K83 B;  5I2X A;  2JEB I;  1O80 A;  2K03 A;  4J1M A;  3J7Y W;  2MP1 A;  3SHL A;  5KGU A;  3VR4 A;  4H13 C;  3X3N A;  3ZYY X;  3HG9 A;  2AQ2 B;  2L4N A;  2F0L A;  3V2T A;  1MBY A;  3I90 A;  1H9S B;  3J7A V;  5J1Z A;  1SYB A;  2G9H D;  4IUT A;  3Q23 A;  4TSS A;  3AB9 A;  5DM7 3;  4KV6 A;  1CZG A;  5F2D A;  3EFX D;  2B8F A;  3T13 A;  4JK1 C;  2WII B;  3D4D A;  4DXG A;  4BBS B;  1A3U A;  1GOZ A;  2EOT A;  3URY A;  4C3I B;  3I73 A;  1ENC A;  2C9O A;  2J7Z A;  1RTO A;  2RSN A;  5IGC A;  1TWC B;  1WTP A;  2K33 A;  5C0X G;  1TT2 A;  1B44 D;  3VYR A;  1CFM A;  5ELF A;  2F0M A;  2Q8I B;  4A3F B;  2CQA A;  3KBX A;  5EKK A;  3PMF A;  2JA7 B;  1HFG A;  2F0E A;  3G7L A;  4QUC A;  2B2Y A;  3HEJ A;  3A8I E;  4HSV A;  3H3V C;  3EVQ A;  3CU7 A;  3SE0 A;  1ZKO A;  2Y0S B;  4L6T B;  1H9M A;  3P20 A;  3SK4 A;  1JCK B;  1S5F D;  1QCB D;  1SDF A;  1TII D;  4PV1 C;  1ET9 A;  3QB3 A;  4TKO B;  3RUZ A;  3J80 L;  4MN3 A;  1BCP B;  1CTM A;  1SXT A;  4XIG S;  4I65 A;  4RKB A;  2F0F A;  2MJ8 A;  4AYB B;  4L63 B;  3VR3 A;  1EQV A;  2KCC A;  4XYQ A;  3GTO B;  2EZV A;  3R3O A;  2PYK A;  1HQR D;  3HOW B;  3NWT A;  5C5M A;  2DNE A;  3AMU A;  1JR0 D;  1DD2 A;  1RCV D;  1A2U A;  4ILW A;  4XQQ A;  4KHZ A;  4OO1 I;  3D3R A;  5D3D A;  2XRS D;  3I70 A;  3M7G A;  4QMG A;  1M8A A;  2RKS A;  3K57 A;  3MAQ A;  2SEB D;  5ELB A;  5A2Q E;  2PW7 A;  1HFN A;  3VR5 A;  1DM0 B;  5BN3 A;  4N9P A;  3I4M B;  4RGN A;  3EA6 A;  3PO2 B;  4DK1 A;  1YNN C;  4OIK A;  3O13 A;  5D3I B;  3E0J A;  4A3J B;  5KRU A;  2B2U A;  1AEX A;  1XWE A;  3T51 B;  2AWN A;  4FF3 A;  1TR5 A;  4IAL A;  3T56 B;  2JXM B;  2O5J C;  1XX8 A;  5C3E B;  1PZK D;  4CHT B;  2V4D A;  2KEE A;  2OF1 A;  3Q24 A;  3A56 A;  1S4Z A;  2K01 A;  2SOB A;  3FEW X;  1PTO H;  4XT3 B;  2JA6 B;  1EIG A;  5IT9 E;  3HOX B;  4C1N I;  3LNN A;  1LT4 D;  2NYZ D;  3S17 B;  2BDN A;  3E6Z X;  2L0C A;  4KK7 A;  1E2Z A;  2AQ1 B;  2K28 A;  1MGS A;  3TP5 A;  1LTG D;  1Y8O B;  2LY7 A;  1HQM C;  4Z9C B;  1I4Q A;  1G2S A;  3R2T A;  1JOO A;  1WD0 A;  4KJN A;  2XNA C;  5JOB A;  3TP6 A;  1Y1W B;  4OO1 G;  2PW5 A;  5K5P A;  2ICE C;  5JVG 3;  4FVM A;  1QB5 D;  2B2V C;  1QJO A;  2F3W A;  1KTK A;  4RAU C;  2J0T D;  2KOL A;  3U9S A;  2IX1 A;  1F77 A;  2R92 B;  3HGB A;  2K5Q A;  1FD7 D;  2EJF C;  4KD3 A;  2M9V A;  4K8J A;  3QG1 A;  3MXP A;  2XSC A;  2R3Z A;  3H91 A;  4EVO A;  3OWE B;  2O5I C;  2I46 A;  1SJH D;  1SYD A;  3CRK C;  1NCV A;  3TP7 A;  5CMD A;  5DAU A;  4HR7 B;  3KF8 A;  1ZXT A;  4FO2 A;  2IW3 A;  1Z6H A;  4XT1 B;  4PQX A;  1B50 A;  5M5W B;  2F0K A;  2K04 A;  2MGS A;  4OL7 A;  2M00 A;  2N88 A;  3NUC A;  4Q5V A;  1XTC D;  4CJ1 B;  3X3M A;  2NVY B;  3S2H B;  5CV5 A;  3IAY A;  1GUW A;  3A55 A;  4DF7 A;  3K0Y A;  2KVM A;  5D14 A;  1TS5 A;  1WTO A;  3P7J A;  1PFM A;  4C3J B;  3WOF A;  1S5B D;  3AU7 A;  1MSG A;  3M4Y A;  2JYO A;  5LL6 S;  1LT6 D;  2AUJ D;  2DY7 A;  3D4R A;  1NR4 A;  4C3H G;  1ENF A;  1PDQ A;  1F2Z A;  4PMW A;  2KJX A;  4B08 A;  5TSS A;  2HUG A;  2NN6 H;  1CT1 D;  5I6W A;  4NKL A;  3K58 A;  1SNQ A;  3HZX A;  1X32 A;  1RDP D;  4IFD J;  2NVQ B;  4HED A;  1QG7 A;  1I4H A;  2PO4 A;  2B39 A;  2E2J B;  4K8I A;  3TME A;  5EKL A;  2R6G A;  1H9S A;  2A69 C;  4WFN 3;  2AWO A;  3CHB D;  5KEE A;  4QB4 A;  3GTG B;  2QKI C;  1BO0 A;  1RKN A;  1RD9 D;  2A69 D;  5EQ0 A;  5FO8 B;  2TMP A;  5KYI A;  1LTT D;  2WAQ B;  3J80 E;  4CKE A;  1CA5 A;  2EVB A;  2FFK B;  2MUY A;  1B3A A;  4IFD H;  1LAC A;  2CHB D;  2L11 A;  4KY7 A;  2F0I A;  4EQO A;  1WTX A;  3BDC A;  1DJR D;  2NBF A;  3FPU B;  3H6M A;  3CRL C;  2NVX B;  1STY A;  2SDF A;  4H0L C;  3V05 A;  5T1I A;  5C44 B;  1NR2 A;  2B2W C;  4U67 3;  3PUW A;  2AQ3 B;  3T53 B;  2FMM A;  3RMH A;  1PTO F;  1WVL A;  2I07 B;  5EBC A;  1NSN S;  4KD4 A;  3LX0 A;  3K5L A;  1F9P A;  1HXY D;  4PMB A;  1X3Q A;  1LTB D;  4OHJ A;  2F0O A;  1Y8N B;  3FRP B;  2WB1 B;  2F0J A;  4TQU S;  3HP3 A;  4ID6 A;  2Z8L A;  1BCP F;  4R9W A;  1KLG D;  5C0X I;  2BE5 C;  3OW7 A;  3E5S A;  1S5D D;  2Q8R E;  1CQV A;  4DAV A;  4G7O C;  2F3V A;  4HCE A;  3A7A B;  3OIP A;  1TY2 A;  4BBR B;  1BNZ A;  2BE5 D;  5CV7 A;  1RTN A;  1K8O A;  2BA0 A;  3PUX A;  4RFB A;  1GUG A;  1STN A;  1B9M A;  1SE4 A;  4K2K A;  3J7A F;  1AN8 A;  1D1I A;  1Q3L A;  3BYT B;  2JE6 I;  1QNK A;  1L0Y B;  1EIH A;  3G6J B;  4H7B A;  1U4P A;  1RHP A;  1I4X A;  1IHZ A;  3ND8 A;  1QWY A;  1AW7 A;  1EY0 A;  1WD1 A;  2RDF A;  4KKS A;  1E2V A;  2XWJ B;  2F0Q A;  2MHV A;  1V43 A;  4TRD A;  1Y69 U;  2E2I B;  5G3L D;  3UI2 A;  4LAA A;  2FMC A;  3DHQ A;  1DCZ A;  2F0V A;  4O42 A;  1GHK A;  3KBG A;  5C4J B;  3HOU B;  3L3O C;  3K7A B;  3D4W A;  5KND A;  2LFN A;  4K6L A;  4CKC A;  4F88 A;  2WIN B;  1UAP A;  1Q1B A;  1A15 A;  1O78 A;  2ID0 A;  4IUN A;  3SK8 A;  1SE3 A;  1R4Q B;  2F0H A;  4K5W A;  3NBI A;  1JWU D;  4RWS C;  4C56 C;  3A54 A;  3GTP B;  3I8Z A;  4IUU A;  1BR9 A;  2OXP A;  2XN9 C;  4L8J A;  5JVH 3;  3QOJ A;  4IZ8 A;  5LL6 X;  3BZD B;  1H9J A;  4PNY A;  1IKM A;  2X6G A;  1DOK A;  4O1N A;  1SNC A;  3D31 A;  3K5N A;  1DZ1 A;  3SK5 A;  2RDG A;  2BOS A;  1C48 A;  2XIW A;  1EWH A;  3ND9 A;  5I6Y A;  2JSO A;  4LJZ C;  2HDM A;  4RGM A;  1TWG B;  5I2Y A;  2RBM A;  2NTS A;  1EEI D;  1U9R A;  1SYE A;  3BVZ A;  5J22 A;  1EY9 A;  5ISR A;  2ENB A;  1B1Z A;  1PFN A;  3EQL C;  1EY4 A;  2B2T C;  3NQT A;  3VA7 A;  3BYY B;  4CBV A;  1VF7 A;  4LMQ D;  2DY8 A;  1PLF A;  3A8J E;  1D2B A;  3L7Z C;  4DNT B;  2DN8 A;  3VYS A;  1AFP A;  4PMC A;  3RLF A;  1ONL A;  3S1R B;  1GHJ A;  2TSS A;  1KDB A;  1J9O A;  1GJX A;  2RSO A;  1LTR D;  4IUP A;  1HRJ A;  1Q12 A;  2K6A A;  2M2L A;  3MXG A;  1J8I A;  3BVM A;  3S1N B;  5M9O A;  1EYC A;  2L55 A;  5J39 A;  5EPJ A;  1Z7T A;  4RKL A;  1FYC A;  2OT2 A;  2WKC A;  4HMI A;  1S5E D;  1MSH A;  5AFW A;  5COY A;  3Q22 A;  2N55 A;  5CBE E;  4HAE A;  1ZEQ X;  1RJT A;  3DM1 A;  3CKI B;  3OOC A;  2E75 C;  5JEA G;  2K7V A;  4NW2 A;  1MI2 A;  3SK6 A;  1TWA B;  4KI0 A;  3PUZ A;  1BQQ T;  5IGB A;  2QF7 A;  3H0G B;  4UDU C;  4V19 0;  2X69 A;  2F1M A;  5EPL A;  3LWU A;  3FVQ A;  3GV3 A;  2QIL A;  3F2U A;  3H09 A;  1AP0 A;  2Q8T A;  3Q0A A;  1TWH B;  1B53 A;  1PYW D;  4QIW B;  1O7Z A;  5E1F A;  5FO7 B;  1CM9 A;  3IFD A;  4E6I A;  5C6A A;  2EPB A;  1KNA A;  3K59 A;  4F8M A;  2SNM A;  1EYA A;  1TQO A;  5KNB A;  1Q90 A;  2XVS A;  1WCM B;  3SDZ A;  3NSW A;  4DFA A;  3S9W A;  1ZYR C;  2B2V A;  3R8B A;  3LWE A;  1M4V A;  4ZUI A;  5FKA C;  4C2M B;  3MEH A;  1TS2 A;  4A3D B;  4FXK C;  2RVL A;  4KY6 A;  5ELC A;  1ZYR D;  1D1K A;  3MFY A;  1TU2 B;  4ZRZ A;  4CKB A;  2FJ2 A;  1LTI D;  1STG A;  5CV8 A;  1H9K A;  1W6J A;  2J4X A;  2R61 A;  1L0X B;  1SYC A;  2VB2 X;  1JB3 A;  1UUP A;  5C4Z A;  1H9R A;  3KLS A;  2H4O A;  1C8C A;  2B63 B;  3S1M B;  3J81 L;  1SNM A;  1JOR A;  1I6V C;  2F0W A;  1DOL A;  3GTK B;  1I4R A;  2K5W A;  2XRQ D;  1PRT F;  1VMC A;  3PIO 3;  1E2W A;  3GQB A;  2EJM A;  5FK9 C;  1Z47 A;  3NK9 A;  3VYU A;  4XQN A;  4J8Q A;  1WTV A;  2Z1C A;  4CJ2 C;  3SXH A;  2NTT A;  1ENA A;  5BN4 A;  2E2H B;  1F9R A;  2IX0 A;  3OSO A;  3BG3 A;  5IGF A;  2KEC A;  1TS3 A;  1D5Z C;  1EY8 A;  4H44 C;  5M3M B;  1SND A;  3V96 A;  5C0X J;  1A3V A;  4F87 A;  3HOV B;  1RF2 D;  1HCZ A;  2K5D A;  1SYF A;  3IL8 A;  5FLX L;  3C3L A;  3MWY W;  1I6H B;  1CZW A;  4P2C B;  4ULL A;  1K8M A;  1LTS D;  4ABN A;  4BS9 A;  3DUZ A;  1W6K A;  2EYM A;  3NTH A;  3NE5 B;  1BXT A;  2WP8 J;  5C4H A;  4K6D A;  1KAA A;  4FF1 A;  4QF4 A;  1EOT A;  2OEO A;  1HTP A;  3BVG A;  1V1P B;  5C0X H;  1YNJ C;  3ONA B;  1D5M C;  5KYL A;  1GUN A;  3MC0 B;  4NMZ A;  4A3K B;  3K6O A;  3TSS A;  1YNJ D;  4BY7 B;  4Y7N B;  1IW7 C;  2Z4I A;  1G6Z A;  3D6W A;  4M8A A;  4KN7 C;  1NUC A;  5K36 H;  3P75 A;  3SEB A;  1SJE D;  3HOY B;  4C3I G;  3TDQ A;  1IW7 D;  2QCP X;  3S1Q B;  3OMC A;  1T5X D;  2VXW A;  3NP8 A;  2D2C C;  1A3T A;  4KN4 C;  1FR3 A;  2A74 C;  2PPB C;  1OXT A;  2EYH A;  4ZKB B;  3QJY A;  2CVR A;  2B2W A;  3HOZ B;  1XXG A;  4XQJ A;  2D5D A;  1LTA D;  1JOK A;  3K5M A;  3QOL A;  5CGK A;  1V1O A;  4RGT A;  4OGQ C;  2A5H A;  1BOS A;  2BCO A;  1CHP D;  2CW0 D;  1G29 1;  1TWF B;  2L12 A;  1TS4 A;  5KNC A;  3D8G A;  5I4D A;  1HPC A;  4LK1 C;  3FMC A;  3C2P A;  1C4Q A;  5ELD A;  5D65 A;  1JE4 A;  1OXX K;  2DNC A;  3OIQ A;  3TN2 A;  1GUT A;  5JPN C;  2PNR C;  4G57 A;  5JPM C;  3R93 A;  3MHB A;  4MHE A;  2F0D A;  4DAY A;  1A2T A;  3M85 A;  3C1E A;  1PZI D;  1VDZ A;  3RD4 A;  2HDL A;  5CC4 A;  3NHH A;  3NWS A;  2F03 A;  2L5T A;  2BA1 A;  4CJ0 B;  3KUP A;  3ERQ A;  4A3I B;  3MVV A;  2NN6 I;  1CQF A;  3FKI B;  4XTC S;  4BA1 I;  4A3M B;  2RA4 A;  1PTO C;  2KUM A;  1F9Q A;  3M7N A;  2F0G A;  4QUF A;  1HUM A;  3S15 B;  4DK0 A;  1HUN A;  5JAV A;  2R93 B;  2KCN A;  5EPK A;  5IIF A;  1PTO D;  4X3K A;  2F0S A;  3OMG A;  1OO9 B;  5C4X B;  2A73 B;  2BDO A;  1EYD A;  1VF5 C;  2G9D A;  1X3P A;  3PO3 B;  3OPO A;  4WJW A;  2A68 C;  1G8Z D;  4K5X A;  5E4W C;  4B9W A;  4N9T A;  2JP1 A;  1R4P B;  4ZUJ A;  4FP5 D;  3W2D A;  1BCP D;  1EL0 A;  3DXJ C;  2NB0 A;  5I9P A;  3ERO A;  5CR3 A;  2A68 D;  3D6C A;  4IFD I;  2VUM B;  1EY6 A;  4IUR A;  4NP5 A;  2K05 A;  4IUQ A;  4C3H B;  3U9O A;  1GXD C;  4M1U B;  1V8Q A;  4RA8 A;  2GA4 B;  3P1H A;  3MXN A;  2F0T A;  2NVT B;  3WDN A;  5I9O A;  1NAP A;  3Q6S A;  1KDA A;  3HKZ B;  5IOC A;  4OO1 H;  1KNE A;  3T16 A;  1BBX C;  4HN7 A;  4WOR A;  3PIP 3;  4ZK9 B;  4OIJ A;  2PMZ B;  1KLU D;  3W3A A;  1F2Y A;  1SFO B;  2D62 A;  1LAB A;  2A6H C;  3FDT A;  5E3F A;  3J81 E;  4A3B B;  3MZ5 A;  1ET6 A;  2XWB B;  1EY5 A;  3FPP A;  5LHY 1;  3S2D B;  4F7X A;  3T4A C;  1JWM D;  2NN6 G;  5CYU A;  5HUR A;  2A6H D;  3OWF A;  4G4K A;  1F9S A;  4IN3 A;  4CGY B;  1FGB D;  3TZD A;  2HCC A;  4WRD A;  1AZQ A;  3GD7 A;  4ZLT F;  3I72 A;  5DM6 3;  2PZT A;  3SVM A;  5CV9 A;  1UEA B;  1VCI A;  2O2L D;  1LT5 D;  2B2T A;  4KTA A;  2ZT9 C;  1CHQ D;  2KHS A;  2ZXR A;  5K36 G;  1QIL A;  4A3E B;  2ZXO A;  2JA5 B;  1TVX A;  5CV4 A;  1PTO B;  2L9H A;  1SEB D;  2PZW A;  3PUY A;  3RZO B;  1R9T B;  4DA2 A;  5FLX E;  1ESR A;  4X3T A;  2E2D C;  2B2Y C;  2HQE A;  4IFD G;  3IFT A;  5E4X A;  2QDB A;  1U4R A;  1F2M A;  1FNU A;  4S3S A;  1HA6 A;  4Q0F A;  4KKU A;  4BA2 I;  2JA8 B;  4YIJ A;  3OHX C;  1VMP A;  4DN4 M;  3JAM L;  1JQY D;  1D5X C;  5EGT A;  5C5L A;  4RHR A;  1I4P A;  1Y8P B;  4HSP A;  2YU9 B;  3GTJ B;  1FNV A;  5EKI A;  4UAI A;  4A3G B;  1EFI D;  1QE6 A;  1EU3 A;  1SYG A;  2RDH A;  3TP8 A;  1O7Y A;  4C3J G;  2WV6 D;  1XYI A;  3QO2 A;  5EJW A;  4U68 A;  3A7L A;  3A8K E;  4DXF A;  4V0B A;  2KED A;  3C1F A;  1B9N A;  1ROD A;  4RHS A;  2IX3 A;  3QWN A;  4B9X A;  2EY5 A;  4RGO S;  2L1B A;  2PZU A;  2NZ1 D;  1EZ8 A;  2IT1 A;  1IYU A;  3S16 B;  5NUC A;  2SNS A;  5FO9 B;  1SE2 A;  5IGG A;  5CBA E;  4K14 A;  4IUV A;  3RZD B;  1LLR D;  1YNN D;  1EQT A;  5DEH A;  1I4G A;  1LO5 D;  4ZYS A;  3GTL B;  4KY5 A;  1V1P A;  2B2U C;  2EY1 A;  4A93 B;  1BDO A;  4EGV A;  3I4N B;  3I4L A;  2EJG C;  2WKD A;  4ODG A;  1HHV A;  2O4X A;  4FNF A;  2F0U A;  1EEF D;  2EYJ A;  1BF4 A;  2EYF A;  4XDX A;  5CV6 A;  5DNF A;  1BUV T;  1II3 A;  3BDL A;  1OXV A;  1Y1V B;  2ICI A;  3H94 A;  1CK1 A;  1G2T A;  1G91 A;  1F2L A;  4FF2 A;  4EQP A;  3IKJ A;  1OXS C;  2QEJ C;  1HA5 A;  2FIN B;  4KKT A;  2C5C A;  1DOM A;  1MD2 D;  3NXW A;  3BS1 A;  3C46 A;  3TZU A;  2NWG A;  1ML0 D;  2EYO A;  2RQX A;  1U4L A;  4FXG C;  5IOD A;  5COR A;  3DWP A;  5C3X A;  3I91 A;  4K2L A;  2FHT A;  2F0N A;  1STB A;  1IL8 A;  4DGZ A;  4G7Z C;  4FXD A;  1PFB A;  3PV0 A;  2Z4H A;  5IGD A;  1EY7 A;  3N52 A;  1CA6 A;  2R7Z B;  2X6L A;  3ITP A;  3NTK A;  2MPM A;  1Q1E A;  5EBD A;  1ESF A;  2PQE A;  2ZXP A;  1WTW A;  2IJ0 A;  1STA A;  5C3W A;  1PMR A;  3NPP A;  3VA5 A;  5IGE A;  1IKL A;  2B8G A;  4GZY C;  5FOB B;  2WAC A;  1EZ6 A;  1AZP A;  3MA2 B;  5JJZ A;  4QCL A;  1PRT C;  1STH A;  2EDG A;  3DWA A;  1WTQ A;  1D6E C;  3HS0 C;  4RCN A;  1PRT D;  3MTS A;  1HTL D;  2LS0 1;  3GTM B;  1ILQ A;  1GUS A;  1Q8I A;  2PCF B;  5M3F B;  1IYV A;  2VB3 X;  3GP7 A;  4J6H A;  2EE1 A;  3R2I A;  2LMC B;  4HCS A;  2IL8 A;  1O7L A;  2E76 C;  4FYD A;  1CI3 M;  4BWG B;  4KMU C;  3KLR A;  4HMJ A;  3TBI B;  4X3U A;  4ZAI A;  4C1N K;  3PUV A;  1GUO A;  4DU9 A;  1ILP A;  1EU4 A;  1LV9 A;  2K1B A;  5A2Q L;  1WTR A;  1JOQ A;  3HRZ C;  2AUK A;  1STE A;  4EQN A;  1DON A;  3CQZ B;  2F0P A;  3NTI A;  4JBW A;  2EY6 A;  4XYO A;  3MXU A;  1SSO A;  2A6E C;  1OXU A;  4MIU A;  1QOH A;  3VYT A;  3QIA A;  3N6R A;  3NBH A;  3KK7 A;  1B4O A;  1ICW A;  2A6E D;  3GO5 A;  2JEA I;  2CW0 C;  1S5C D;  3S14 B;  2VNU D;  4K5V A;  2E74 C;  1SNO A;  2EYP A;  4DAP A;  3DMU A;  1JC7 A;  2IPK D;  4X3S A;  1PZJ D;  4ZQ3 A;  1DYQ A;  1PXU A;  1U4M A;  5BN5 A;  1I3Q B;  2EXZ A;  1JIC A;  2F4I A;  2IWH A;  1LT3 D;  5M5X B;  3JAM E;  5JEA J;  1T5E A;  4RCO A;  3BDO A;  3VR6 A;  4ZKC B;  1SBB B;  5IT9 L;  1E0B A;  2YYZ A;  4NDX A;  4HTH A;  1EWC A;  4FF4 A;  1JWS D;  1KDC A;  2KA7 A;  4R8N A;  3KLS X;  1PRT B;  1DXM A;  3VR2 A;  3L9A X;  3WOE A;  4KHV A;  3NQI A;  1UNS A;  3M3Y B;  1FNW A;  5JEA H;  1A6X A;  2D9U A;  4KJO A;  1SAP A;  3EJI A;  4XXE A;  1SNP A;  1I50 B;  5G3L F;  4I7Z C;  3I3C A;  4IQZ A;  3M4O B;  2EYL A;  5ELE A;  2H1E A;  5KIX A;  4G7H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...