2KQ3A

Solution structure of snase140
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Importance of the C-Terminal Loop L137-S141 for the Folding and Folding Stability of Staphylococcal Nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 25
structure length 140
sequence length 140
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kq3A00
1A3TA 4PMBA 4NDXA 3SK5A 5IOCA 4H7BA 5EKLA 4KJOA 2PYKA 5DAUA 4RKBA 4RKLA 5CV9A 1SNDA 1SNMA 5C4HA 3T13A 4EQNA 1EY8A 3MVVA 5C3XA 1STYA 2PQEA 2EY1A 2SNMA 3P1HA 1KABA 3OMGA 1STHA 2RDFA 1JOKA 3PMFA 4KHVA 1TT2A 2EY6A 4NP5A 4S3SA 3V2TA 2EYLA 1NUCA 2PW5A 5C5LA 3NQTA 4PMCA 5K5PA 2ENBA 3RUZA 5M9OA 3NK9A 1SNQA 4ZQ3A 3NP8A 5KYLA 3C1FA 5C6AA 3SK6A 3T16A 4ODGA 3D4WA 2F0VA 3ERQA 5IIFA 5KYIA 5F2DA 3QB3A 1EY4A 2OXPA 4J1MA 4KV6A 3DMUA 5HURA 3HZXA 1EYDA 2HQEA 3TP7A 1JOOA 4K5XA 1EY7A 4R8NA 2F0NA 2EYOA 3LX0A 4IALA 3QOLA 4LAAA 2F0SA 3D8GA 3MHBA 3BDLA 3QOJA 3P75A 2EYJA 5C4ZA 1U9RA 4NKLA 5I6WA 1SNCA 2F0UA 3H6MA 4MIUA 4YIJA 5E1FA 2F0LA 3TP8A 4F7XA 4ZUIA 4EVOA 4KD3A 2OEOA 5I9PA 1A3UA 5JOBA 2F0DA 4DFAA 5DEHA 1IHZA 2EYPA 2PZTA 3OSOA 3U9OA 5KRUA 4DGZA 2F0MA 5KGUA 4ID6A 5IGFA 1SYFA 2EY2A 3MZ5A 5JAVA 2EYFA 4WORA 5CV6A 4EQPA 1SYDA 1A3VA 1SYEA 1SYBA 4PNYA 1EYCA 3NUCA 4K2LA 5IGGA 3S9WA 2F0IA 3ITPA 3SHLA 5IODA 1EY6A 2F0JA 4I65A 2F0QA 2PZWA 4K6DA 4G57A 3TP5A 3VA5A 5CV4A 1AEXA 4J6HA 2F0KA 1STNA 2M00A 3EJIA 5C5MA 3C1EA 2F0GA 1ENCA 3DHQA 3D4DA 1A2UA 1STGA 1SYCA 3OWFA 4HMJA 3SR1A 3SXHA 4B9WA 1A2TA 1II3A 1KDCA 2EYHA 2RBMA 4ME5A 5IGBA 2LKVA 2OF1A 5CGKA 5ISRA 2F0FA 4KTAA 2PW7A 4KY5A 4KJNA 1F2MA 1EZ6A 2F3WA 5KEEA 1F2ZA 4QMGA 1SYGA 1JOQA 5CC4A 1JORA 2F0EA 1TR5A 5EGTA 4DU9A 2F0PA 2PZUA 4N9TA 3BDCA 1EZ8A 2WACA 3NHHA 1TQOA 4KY6A 1SNOA 4F8MA 1KDBA 1STBA 3MXPA 4HTHA 3OMCA 5I9OA 1ENAA 2KQ3A 4K14A 1STAA 5HGTA 1SNPA 2F0HA 1EY5A 5KIXA 4OL7A 2KHSA 4QF4A 5E3FA 4EQOA 2F3VA 5CV5A 1EQVA 4ZUJA 5J39A 3EVQA 2F0TA 5IGDA 5IGCA 2SOBA 3MEHA 3NXWA 2O4XA 4QB4A 1NSNS 1EYAA 2F0OA 4KY7A 5CV7A 5J1ZA 3R3OA 4DF7A 4NMZA 4N9PA 2F0WA 4TRDA 5C3WA 5IGEA 3EROA 3D6CA 4K2KA 3TMEA 4K5VA 4K8IA 5NUCA 4IUNA 4K8JA 3TP6A 4WRDA 2NUCA 2RKSA 1KAAA 1EY9A 3E5SA 2SNSA 2EYMA 4HMIA 3SK4A 5J22A 1RKNA 4KD4A 5CR3A 3SK8A 4B9XA 3HEJA 5I6YA 2EY5A 1KDAA 4E6IA 4IZ8A 2QDBA 2EXZA 4K5WA 5CV8A 5EKKA 1EY0A 1F2YA
chains in the Genus database with same CATH superfamily
4C3HH 3SK5A 1STEA 1D1IA 1TIID 2PYKA 1T5XD 1HA5A 1N9WA 3T13A 4JBMA 1U4PA 3DWAA 2EY1A 1VQDA 4HIMA 3CF5A 3X3NA 5C5LA 3S1MB 3PO3B 1SNQA 4ZQ3A 3NP8A 4DR1Q 4ODGA 3OPOA 1X54A 3I72A 1WTQA 4C3IB 1Q8IA 1Y8OB 2A74C 5ELDA 1GHKA 4JBWA 3DXJC 3FKIH 2YU9B 2Q2TA 2V1CC 4C3JG 3CC7A 4LF7Q 2JA6G 4AQYQ 4KHZA 2EYJA 1PYBA 1QILA 1E1OA 1VQNA 1BBWA 3KF6A 2JA9A 1JJCB 1N32Q 5JVG3 2Q2UA 1SROA 4A3IG 2C35B 4QGUA 5HY6A 4H13C 2NTTA 3MXNB 2KCTA 5L37A 1WTHA 1OXVA 4BWGB 1VQMA 4G7HC 2WINB 3EJIA 2MFIA 2RSNA 5C44G 2K32A 3OW2A 1KDCA 1B70B 3RLOA 1GO3E 5LHY1 2CH4W 4OO1H 2VL6A 3QWNA 4X66Q 2VQFQ 1F2LA 3K8AA 3J7YW 1SFOH 1JORA 5EGTA 2VUMH 3I4NG 2B2UC 2PMZB 1UUPA 1VQHA 3BDCA 1EZ8A 4GOPC 1B53A 4DV1L 1F9PA 1W6JA 5HGQA 4P72A 1NY4A 2Q8TA 2KEDA 1XPOA 4LJZC 4JV5Q 3OIPA 4X64Q 3AFQA 1MD2D 4A3JH 2SEBD 4DAYA 4A3JB 4Q5VA 3FPUB 5JEAJ 3GTPB 2EIFA 3VYRA 4HSPA 4UY8C 1BBXC 1I3QB 4K2KA 4OO1G 1LV9A 2H5XA 3F8TA 1SMYC 1PFNA 4WRDA 3RZOH 2E2HH 3GV6A 2EPBA 2RKSA 1R9TH 2GVAA 4GLAC 2CW0D 1XNRL 3RMHA 1EIFA 3VYSA 3PIP3 4X3KA 4POFA 1F2YA 4JBJA 5EPKA 1IZ6A 2JA8G 4IUTA 5DAUA 5FK9C 1QJOA 1C0AA 1SNDA 5C4HA 4XDXA 5JJKA 5E4XA 3BYYB 4X3UA 5JJLA 2IY5B 2SNMA 4IOAA 4IFDI 4KMUC 1BDOA 4A3DH 1PHJA 2YTXA 2R7ZB 1S5DD 1UE5A 2R6GA 4H44C 3T16A 1CFMA 5IIFA 1YHBA 2JA6H 4J1MA 4G7ZC 4LF9Q 4B3SQ 1N8RC 4IALA 2ZJQA 4FF1A 1EQQA 3A7AB 3CMAA 3QOJA 4KI0A 3H0GG 4DR7L 4LF8Q 1WTWA 2ES2A 3D0FA 3CC4A 2EYPA 2E2JB 2AKWB 4DAVA 2EY2A 1ASZA 2AQ3B 1LT3D 2EYFA 1U0LA 4CBVA 2JN4A 1GOZA 3TEHB 1ZYRC 3HKZG 2K5VA 1KNAA 2JA5G 1DOKA 3OWFA 1PRTC 4PV1C 3SR1A 3SXHA 3S1MH 3H94A 1OTCA 4X6AH 1CTMA 5M5WB 1NMFA 4KLKA 1B7YB 3DEPA 4LF4L 3TZUA 1PA6A 4CDEC 1I6HH 1PFBA 4C1NI 2JA5B 4CHTB 1P8LA 1K0SA 4N9TA 3R2IA 3J81E 2WACA 4A3BG 2IHFA 1SXTA 3VYTA 2KQ3A 3HKZE 1CKMA 2K5HA 1NJIC 3I73A 2PO4A 3F1ZA 2ZM6Q 4KY7A 1XJVA 2PNRC 4DUZL 3MA2B 4HR7B 4LNQA 2SDFA 2NZOA 1H9MA 4QIWB 4A3FB 2Z4HA 3R93A 1CKNB 1K8AC 4GZYC 4E6IA 3OTOQ 5EKKA 1HNZL 1R9TB 3T1YQ 3K0YA 1PRTD 2KECA 1VF5C 5IP7G 1VQ8A 3K0XA 3MVVA 5C3XA 5M3FG 1VMCA 1HR0Q 4DV7Q 1PZJD 2A6HD 2KCMA 5BN5A 4RCOA 1KRTA 3K57A 3NK9A 1O80A 1JE5A 3DM1A 4CDDC 3KK7A 3HS0C 3I8ZA 3SK6A 2RHSB 2F0VA 3CCRA 1S5BD 3K5OA 4IUPA 1HR0L 4FF2A 3TP7A 1EY7A 1I50B 1O7ZA 3QOLA 2WAQG 1I4PA 4C1NK 3T1YL 4PG3A 2I5MX 3PUWA 4ZUIA 2NVXH 3FEWX 4LK1C 3UDIA 4XQJA 4U673 1IHZA 1Q7YC 4O2DA 4POGA 3CRKC 4JI1Q 2GVBA 1DYQA 4DR6L 1SEBD 2CQAA 1QG7A 4EQPA 2WP8J 2CH4A 2AQ2B 1D8LA 4RHRA 4C3HB 3T51B 3J81L 3H3VH 4A3KB 1N33Q 2UUAL 3CD6A 3LGJA 1XPRA 1B44D 2IT1A 5ELFA 1Y1VG 4HJ8A 5ISRA 4YHHQ 1ICWA 2K52A 3BZCA 3Q22A 3NE5B 4A3DB 5EQ0A 2K33A 1R4QB 4RWSC 1AFPA 5M3MH 1OXSC 2D9UA 4OONA 1KDBA 1Q46A 3BG3A 3MC0B 4LF4Q 2A69C 1VQAA 3HOXB 4QY7A 1I6VC 3S15H 1B4OA 4QF4A 1NMGA 3EFXD 5J39A 1Y1WH 1AE3A 2ZJPA 2QEXA 2SOBA 1X32A 2VUMB 2Z6KC 2HHHQ 4A3BH 2RF4A 1GUOA 1EIHA 2O2LD 4OGQC 5T1IA 1VQ7A 1C8CA 3PUXA 3AEVA 1N36Q 3F2DA 1BXTA 5FOBB 2NVTH 1EEID 2BOSA 3S24A 3D31A 5I6YA 3I4NB 1TS3A 3GTOH 2Q2HA 1KD1C 3PO3G 4H7BA 2TMPA 4HJ5A 1TWCH 4DK1A 2PI2E 4Y52H 4A3GG 1STHA 5BN4A 4AYBE 3HOYB 3T1HL 1KIXA 4ZKCB 1IBML 4C3JB 4OWXB 4X62L 2X6GA 1KLUD 3CCUA 2DN8A 1WCMB 4QUFA 5LL6S 1G51A 3DMUA 2HQEA 3MAQA 2NVQH 1MSHA 2F0NA 4LAAA 5C4ZA 5I6WA 2AWOA 4H02A 2LSSA 4JBKA 1V1QA 3WOFA 2Y0SG 4JI2L 3A5ZB 2PZTA 4AYBG 3PO3H 3I4MH 3KLWA 1GUWA 5KGUA 1J8IA 1MSGA 2CWAA 3KF8A 1U4LA 2UUCQ 2Y0SB 4LUVA 1KL9A 2F0IA 3E9HA 1OXXK 1B2TA 3N52A 2G5DA 2DGYA 4DK6C 3OHXC 1ENCA 4B9WA 4CJ2C 4HMJA 2N55A 1OXUA 5JPNC 1LTGD 1YEZA 1EEFD 4X62Q 3A56A 2F3WA 1IBMQ 5IP9H 1S72A 5CBAE 2L4NA 4R4OA 1Z7TA 4CKBA 3C46A 1QUQA 4DV6L 3I4MG 1PMRA 1XX8A 2E5LQ 4FYDA 4BY7G 1X3QA 1B9NA 2K6AA 4A3CG 5ELCA 4GKJQ 2EJGC 4OEMB 1ILPA 4IQZA 1SNPA 2N78A 2XRQD 5GAGC 1N34Q 2JP1A 1D5ZC 3F2UA 3G6JB 1AH9A 3R3OA 2PQAA 4L63B 3I55A 1YIJA 2WKCA 2XSCA 3HGBA 2QCPX 1V9PA 1A63A 1KRSA 4A3GH 1SMXA 5IYDG 2R7DA 3E6ZX 4B3TQ 1K8MA 3J7AV 3TREA 1PLFA 4GN5A 3PO2B 1E2WA 2AHOB 4B9XA 1UE6A 1ZXTA 3J80c 2NVTB 3MWYW 2ID0A 4MNOA 1EY0A 2AQ1B 2R7ZG 1AZQA 5KNCA 1EOTA 3NTHA 4JOIA 3L7ZC 2PQEA 4A3IH 1K9MC 2E2IH 2MP1A 1SE8A 2RDFA 1DGSA 2AUJD 1FGBD 2B2VA 2I5LX 2KEEA 3SDZA 5C4XH 2KHIA 5IT9L 5KYLA 1ILQA 1X3PA 1HR0W 4IFDJ 4HAEA 3HOVB 4GKJL 2OXPA 4DAPA 2MO0A 5DM63 4JI5L 1DOLA 3V05A 4CGYB 4Y7NH 4YCVA 2UXDQ 4NKLA 1JWUD 1GUGA 2F0UA 4F7XA 4A3FG 2FMCA 3GTGH 3HOVG 4A3EG 4DXGA 4NXMQ 3M7NA 4A76A 1YNJD 4DR6Q 2N49A 3A74A 5JAVA 5IYCG 1IBKQ 5EBCA 4X3TA 2FJ2A 2MGSA 4HJ9A 5I2YA 4AH6A 4K0KL 3BU2A 3ITPA 2K03A 3HOWG 1E0BA 5M5WH 3NBHA 1CQFA 3RN5A 3A8JE 2UUCL 4BBSG 3G7LA 3NPPA 1CUKA 4DA2A 1STNA 5M5XB 1KQSA 2F0GA 4I7AA 1I94L 4A3CH 3AFPA 4DR3L 1Z9FA 2IX1A 5I4DA 2F4IA 2K4KA 3UE0A 3TS2A 5C0XJ 3M4OB 4RMFA 2LFNA 4DU9A 3NEMA 4IPCA 1O7IA 2BDOA 3OW7A 3NHHA 3OMCA 1MGSA 1K73C 1RJTA 1SBBB 1STAA 2E2DC 4JI4L 4LMQD 5D3IB 4JW0A 5KIXA 3FPPA 4UHVA 1HZCA 1G6ZA 2JSOA 2NZHA 1Q1BA 2HCCA 2A68D 3W1BA 1WI5A 4JI7Q 4CJ0B 3UE1A 3KLSX 1I4RA 2IL8A 1RDPD 2HIVA 2QA4A 3M3YB 3PUVA 2JQOA 4IJHA 1WFQA 1VS0A 2EXZA 3FDTA 5J3BA 1EFWA 1M8AA 4RFBA 2H4OA 3KOJA 1YI2A 1CHQD 3TSSA 4RKLA 2O5IC 3PSIA 3UDFA 4EQNA 4DXFA 1H9SA 4CKEA 4KHVA 1PH1A 4DUYQ 1U5KA 2R93H 2PW5A 3KDFA 2ENBA 3RUZA 2B2VC 4JG2A 3HOXH 4EGVA 1PH6A 4NW2A 2Q8IB 3TRZA 3BZKA 1Y69U 2FMMA 3ZYYX 1M4VA 5GQOA 1A6XA 4DNRB 1RCVD 1SNCA 5K5PA 2R61A 2BDNA 4IURA 2PPBC 3T56B 3U58A 3HKSA 4H0LC 1B3AA 1L1OC 1TVXA 4YHHL 1G8ZD 2XN9C 4NXNQ 4LFBL 1VQEA 1I5FA 5E4WC 1PH8A 3T53B 1HNXL 3GQBA 1A8VA 3JAME 2XVSA 4DV2Q 4IUVA 1TS2A 3D3RA 2A6HC 2YTVA 3ND9A 1FYCA 4XQQA 3OWEB 2F0QA 4DKAC 5IYBG 3F2BA 2F0KA 1QNUA 1NCVA 2IJ0A 3MTSA 3F2CA 1STGA 4ZLTF 3MXUA 1CQVA 4DR2Q 1VQGA 5CGKA 5FLXE 1RL2A 3RNUA 2K50A 2WV6D 2C5CA 4HN7A 3CQZH 4JYAL 4IUQA 1MJEA 2B3GA 1K83H 4PZ7A 2GA4B 3GTQB 2ICIA 4KY6A 3FP9A 2VUMG 3K5NA 2XWBB 4OL7A 2A19A 2DJGC 4C3IH 1K8GA 1PTOF 2NZ1D 4XTCS 5C4JB 3HRZC 1J6QA 2A68C 4B08A 4Q0FA 1RHPA 4YY3Q 5C0XG 4FXKC 1SAPA 2K7VA 3JC66 3RZDB 2NWGA 1X55A 1JC7A 3DLLA 3E5SA 3FVQA 4LF5Q 5EPLA 3TN2A 2MQHA 5A2QE 5DLQE 4EQ5A 3PQIA 3HOYG 4DAYB 1W6KA 3W2DA 4PMBA 3I7FA 1RTOA 5IOCA 3SGIA 1WCMG 4DV1Q 1G291 3NWSA 1G2TA 1PFSA 4N8FA 3GTMB 1TT2A 2YV5A 4JI5Q 5M9OA 2JA7B 2B2WC 3D4WA 1SJED 1Q12A 4Z9CB 4JI7L 1Q1EA 2LMCB 2X69A 1NBWA 2XRSD 3AQQA 1AP0A 1CK1A 4KD3A 3S15B 1B1ZA 3PO2G 1PH7A 3K7AH 5C4XB 3U9OA 2IPKD 4C3HG 1VQ9A 1LTRD 5GROA 1Y1VH 1WVLA 3HOVH 4A3MG 4WORA 4A3EH 3KBGA 3S14H 1AN8A 2YTYA 5IYBH 4LFAL 3V96A 3C2PA 2NVQB 1QUQB 1RF2D 5I2XA 2A6EC 2K14A 4B3TL 4O1NA 2F0JA 1QB5D 2F03A 4AQYL 1LTSD 3I91A 2I07B 3WWVA 5T1GA 1G91A 3VR4A 4JI0L 1JWMD 3FRPB 2N8NA 4DR4L 1EU3A 1EYGA 4R8IA 1X65A 2L12A 3PIO3 2NYZD 4DR1L 1NNXA 2V4DA 1R4PB 4YWLA 3K7UC 3M4YA 1SYGA 2VS1A 4A3LG 3BVMA 1G2SA 1CT1D 1YJ9A 2EJFC 4RGTA 1E3PA 4XT1B 1JR0D 5I9OA 1ENAA 1S5FD 4C2MH 1EY5A 4R4TA 3KF6B 4EQOA 1SE4A 3L9AX 5EPJA 1V8QA 1EQVA 1DONA 4NB3A 4C3JH 5JEAG 1FGUA 3RZDH 4DN4M 4FXDA 2F0WA 1K8OA 3KLSA 5IP7H 2OWOA 3PO2H 2XIWA 3WOEA 2CCZA 3DWQA 3Q23A 3PV0A 2NBFA 1XNRQ 3UDXA 3CMEA 5KNBA 3A55A 5C3EG 2WFWA 1VQBA 4BY7H 3AU7A 2QKIC 4JI2Q 4WJ3M 4GOPA 2HD3A 1EIYB 4HIKA 3S16B 1JT8A 3OMGA 1FR3A 2EY6A 4OIKA 4X3SA 4L5RC 3IAYA 2ZTEA 1JB3A 4HEDA 4ILWA 2WB1B 5C44B 3STBC 1PXUA 2R92G 1LM0A 3EIVA 1EYDA 2EYOA 4A4IA 1FNUA 5M3MB 2HT1A 4A3IB 4EVOA 5CORA 4P75A 1DZ1A 4A75A 3K5MA 4X66L 1L0XB 1NE3A 5DEHA 1LACA 1TY2A 1LTTD 4R4QA 3U4VA 2Z0SA 1J5EL 2E5LL 2CHBD 1FD7D 5CV6A 1SYDA 1A3VA 3ERSX 4GNXC 1TWHH 1HZAA 5IGGA 2K5NA 1D5XC 1HA6A 1VQCA 4A3JG 1VQFA 4KKTA 1B50A 1E7ZA 2H1EA 3PF4A 3D4DA 1I4HA 2KVMA 4ME5A 1S4ZA 2F0FA 3A0JA 3I4NH 3P20A 4KY5A 2RQXA 2WAQB 1ENFA 3STBD 1TU2B 4CJ1B 4A3FH 1EWCA 1SE2A 1EL0A 1JOQA 1K3RA 1TR5A 1BF4A 1IW7D 4V0BA 3SE0A 5AJ3Q 1PH2A 1LTID 3J80E 3MXPA 1MI2A 1HXYD 4F88A 2KA7A 3MXGA 2KUMA 4GKKL 1VF7A 4P2CB 1L0YB 2CWPA 1SJHD 1GVPA 1NTGA 3WDNA 4OX9Q 4M1UB 3Q6SA 4A3KG 1JQYD 4GN4B 4UP8A 1TS4A 2R92H 4JYAQ 1N33L 2UUBL 1BO0A 1A15A 3H09A 2DNEA 1LUZA 2N3SA 3T1HQ 2BA0A 3SEBA 1AW7A 3NSWA 2JA5H 1VQLA 5CR3A 2B39A 4IZ8A 4BS9A 1VQIA 3CU7A 4QJFA 2B2UA 1A3TA 1BCPC 5G3LF 5EKLA 4BBRG 1E1TA 4BY1B 1AZPA 1WD0A 3S1QH 2Z6BA 1YHQA 1GXDC 1XMOL 2D2CC 2KCNA 3HOWH 1DD2A 1IXRA 1W3SA 2IHEA 2AMCB 3ERQA 4PQXA 1EU4A 4LUOA 1JOOA 5CMDA 5C4JH 1RD9D 2L55A 1JCKB 3D8GA 3BDLA 2DJFC 2F4VL 4BXXH 4MIUA 1VQKA 3VR2A 5E1FA 4KHPQ 2OEOA 1A3UA 3VR5A 2NN6G 3UI2A 1FNVA 5D3DA 1B3QA 4O42A 5FO8B 2K04A 3OTOL 1QWYA 4C56C 4DUYL 4RGOS 4L5SA 3S2DH 4PNYA 5KNDA 5M3FB 5JJZA 5CBEE 3PIPA 1Q90A 1V1PA 2ZT9C 2ZTCA 4GLVB 1PTOC 4JVZA 2B63G 2ZM6L 1A2TA 1IYJB 2EYHA 2UUAQ 2OQKA 2QW7A 4OELB 1TWAB 2B29A 1Q82C 1F2ZA 1LABA 4LF6Q 4QMGA 5FJ8G 1SE3A 4WFN3 3S1NH 1YNXA 2EVBA 2I46A 2J7ZA 1GUSA 1SSOA 2JK8A 4JI8L 1JMCA 3H3VI 3KYHC 2DY8A 4LF5L 3IKJA 2LXKA 3GD7A 4TKOB 4K6LA 1TKWB 1EIGA 5FLXc 3NELA 1TWCB 4OO1I 1TWGH 1XYIA 4YY3L 4ZK9B 4KN4C 1F9QA 1LT6D 2PNHA 1E24A 5ELOA 2IX0A 1XNQQ 1Z47A 1H9RA 3L0OA 4XXEA 1PYWD 4ALPA 4DV7L 1RKNA 2YYZA 4HCSA 3PF5A 4NDXA 5GAHC 4J8QA 2UXCL 5C0XI 1HNZQ 4DR7Q 4K0KQ 3KJOA 3MEFA 2A73B 2B2TA 2EYLA 1UAPA 3K6OA 2OQ0A 2B2YA 3ULLA 2NN6I 1I3QH 5KYIA 2QGQA 1C48A 2A1AA 2D0OA 2RDHA 5C0XH 3I3CA 1S40A 3BVGA 5K36G 4DUZQ 4K5XA 4G7OC 2UXDL 1JICA 2UUBQ 2HQLA 3O13A 3P75A 4L5QA 1U9RA 4DPGA 4EX5A 1LLRD 3H6MA 1D2BA 3CRLC 2WKDA 4C3IG 4NXNL 1LYLA 3OSOA 3NENA 2VNUD 2E8GA 2JA6B 4GKKQ 3W5OA 3HOZG 2AUKA 4BA2I 1WTPA 4TVAB 2ZXRA 4F87A 2FXQA 5AJ3L 4GOPB 4PZ8A 1PZKD 2EDGA 1KXLA 2L1BA 2D0PA 3DHQA 2WB1G 4B3MQ 3K7AB 4DNIA 3J81c 1QNKA 3I4OA 2OF1A 5TSSA 1B9MA 3CCLA 2CFMA 4ZKBB 4KTAA 4UP7A 1OO9B 4BY1H 1XTDA 1HTPA 1TWHB 1PRTF 1CKNA 2C9OA 2F0EA 3PUYA 4CDFC 1VQPA 2PZUA 4J15A 2CW0C 3CPWA 2I5HA 5JPMC 1BQQT 1TQOA 1TY0A 3H3VC 3KUPA 3UDGA 5D14A 4HIOA 3GTKB 4K14A 1SMYD 3AYHB 4A3GB 1E2ZA 1L0WA 5IWAQ 3K59A 4LUZA 3BDOA 1UNSA 5ELNA 3NXWA 3A8KE 3CW2C 3RN2A 1SN8A 4LF9L 4MHEA 4NMZA 4N9PA 4QL5A 1PTOH 1OXTA 1T9HA 3JAMi 2JE6I 1GM5A 1VDZA 1IYUA 1TS5A 3FKIG 4C2MB 2R93G 1MKHA 1Q8KA 3J80i 3SK8A 1WD1A 2BCOA 1N32L 1WOCA 2BE5D 4JCVE 1O78A 2VB3X 1ZYRD 1ET9A 1JB7A 3BZDB 2ATWA 1EFID 3QO2A 1AE2A 3NTIA 3BVZA 1PZID 1HZ9A 4LF7L 4PMCA 4JPBW 4BA1I 4B3RL 1HFNA 1P16A 5IT9E 1I94Q 2R7FA 2Z4IA 4HSVA 3QB3A 5C4XG 1MIUA 2K01A 2IWHA 1BCPF 4MTNA 3CCJA 2JJQA 2VQEL 2K5DA 5JOBA 4FVMA 4FO2A 2XGTA 4NXML 4QQBX 3ONAB 2R7ZH 2BH8A 4N8X1 1Y1WG 3U4ZA 2F0MA 1X3FA 3KBXA 3MZ5A 1YNNC 4G4KA 4MN3A 4DV4L 1XXGA 5IODA 1EY6A 4BXXG 2UXBQ 2D62A 2O5JC 2QF7A 1EWIA 5EJWA 2RCNA 1E2VA 3NBHB 3H91A 4RGMA 4AIMA 5JJIA 3TQYA 1ZKOA 1SR3A 2FFKB 4BY7B 1SDFA 2M9VA 3HOUB 4OXPA 2Q2IA 1F2MA 2FHTA 4DR4Q 3RR5A 4YWKA 3E3XA 3H0GB 4JI0Q 5JEAH 4R1JA 1GUTA 1CM9A 4OHJA 4LFAQ 3GV3A 1GD7A 2MO1A 3KDFB 1Y8PB 2UU9Q 2NB0A 1JWSD 2B63B 1FJGL 3R2TA 5M5YH 3CCSA 2MHVA 1WCMH 1HCZA 3TMEA 4K5VA 3R8BA 3IFTA 3QJYA 4KN7C 1DM0B 4IUNA 1VQJA 1N34L 1S5ED 3TDQA 3HFZB 3HOYH 3FHWA 1KAAA 3GTKH 3GDEA 1D5MC 1K0RA 1QCBD 4KD4A 4KKUA 2EY5A 3VDYA 5CV8A 4LW1A 2MJ8A 2E2JH 4DV6Q 1ICFB 4KJOA 4QCLA 4DV5L 2LS01 1YHAA 2R92B 3URYA 1IKMA 4P73A 2ZXPA 1JOKA 5BN3A 1H9SB 2R3ZA 2XNAC 4UPAA 2RSOA 4JI1L 3HKZB 3GTLH 2MUYA 4I7ZC 2LY7A 1ZEQX 1EQTA 1YITA 4KV6A 2Z8LA 1HNWQ 2F0SA 1UE7A 2NVYB 4DK3C 5IT9c 5EKIA 5LMUL 2I0QA 3GTJB 1V43A 4KK7A 5HURA 3KJPA 3GTJH 2CKZB 4QUCA 1GKHA 3U50C 5IYCH 2K05A 4DFAA 4FP5D 2DNCA 1K28A 5KRUA 2DY7A 1F9SA 1H9KA 1QZHA 1Q81C 4V190 4DK0A 4QIWE 3CP0A 2A5HA 2JXMB 3PCOB 3S16H 1RODA 3J80L 3OOCA 4K2LA 1NR2A 1I50H 5COYA 1PH9A 3GTOB 1KTKA 1AEXA 3A7LA 3IL8A 5A35A 4XT3B 1F9RA 1EOVA 2E75C 4LWCA 5IGBA 3DEOA 2PW7A 4JI8Q 1EUJA 4KJNA 4DV0Q 3C3LA 1H95A 1EQRA 1WTXA 5G3LD 4IPHA 5AFWA 3CCVA 3NTKA 4MZ9A 2HCIA 3S1QB 2EE1A 4DV5Q 1LT5D 1X3GA 1STBA 1JJGA 3E0EA 3ND8A 1SLJA 3HOZH 5FLXL 1FVIA 3FMCA 4IN3A 2E74C 2KHSA 3HOZB 1FNWA 1N36L 3VYUA 5DNFA 1NR4A 2B8FA 1YJNA 3NBIA 2F0TA 1MHWC 1LT4D 4P74A 2VW9A 2ZJRA 2F0OA 4JK1C 3PGZA 3H0GH 1CKOA 4TRDA 5C3WA 4PZ6A 1EWHA 1QVCA 1IW7C 1QE6A 4O0AA 2GN5A 2UU9L 3J81j 5GADC 2ZXOA 4LFCL 3G4SA 2HIXA 3S2DB 4RH6A 3EQLC 3HOUH 1K83B 1U4MA 2F4VQ 3I56A 2EZVA 4RGNA 3CKIB 5FO9B 1X56A 2HDMA 1SNMA 1I4QA 1SRUA 4RCNA 3P1HA 3V2TA 4JC0A 3KFUA 4A93B 4NP5A 1H9JA 1LTLA 3LNNA 4FF4A 3M3YH 3W3AA 3S2HH 5LL6X 1CA6A 1TWAH 5C6AA 5FLMG 1IL8A 4HJAA 3M4PA 1BR9A 3M9BA 3ULJA 5IE8A 3P7JA 4UDUC 1GJXA 1VQ4A 3RLFA 2B2YC 2QDLA 1MJCA 1WTRA 2NVXB 2UXBL 4YIJA 1ET6A 3A54A 4DV4Q 1BKBA 3OYYA 1HQMC 3Q24A 5A2QL 4DR5L 4XYQA 1TXYA 5CYUA 5IGFA 1B8AA 1J9OA 3U9SA 1PV4A 1GHJA 4RAUC 1PDQA 2Z9HA 1C4QA 2CQOA 1SYBA 2VQEQ 3S9WA 3S14B 2OCEA 1C7YA 3J7ZC 1Y8NB 3TP5A 3MXNA 2L9HA 4J6HA 4OX9L 2M00A 2ASBA 5C5MA 3C1EA 4FNFA 1QZGA 1ESFA 5K36H 4UAIA 1SYCA 4IPGA 2E76C 2RBMA 1PFMA 4RG1A 4DR3Q 4A93H 2LKVA 1JE4A 2E2IB 1M1KC 5FKAC 1BBUA 1EZ6A 1JJ2A 2XWJB 5KEEA 2QEJC 5LMUQ 4IFDG 1WYDA 3HG9A 4PMWA 1C9OA 4AYBB 5GAEC 4F8MA 3VR3A 4FXGC 1UEAB 4X64L 2TSSA 5E3FA 1IBKL 2ZTDA 4X65Q 3BS1A 3H15A 2BE5C 1V1PB 2Q8RE 2HDLA 5IGDA 4ZAIA 2R93B 1T5EA 2A69D 1XTCD 2OTLA 3G71A 1CSPA 3Q0AA 1WTOA 1VQOA 3M4QA 4K8JA 1Z6HA 2VQFL 1PVOA 5BR8L 3JAML 4RHSA 3I90A 2WAQE 2NTSA 1HZBA 5IWAL 1YVCA 1KNEA 3NWTA 4JI3Q 3HEJA 2MNAA 2QDBA 1QOHA 4K5WA 2X6LA 4WJ4A 4R4CA 4RKBA 2RVLA 3B6YA 5H1SE 1FJGQ 3G48A 1PTOB 1BCPB 5ELBA 1HH2P 1IBLQ 3I2ZA 1CSQA 2B2TC 3NQTA 2IX3A 3C1FA 2VXWA 1KHIA 2DUDA 3LWUA 5C44H 4GNXB 2JA7H 1YBYA 4ZYSA 4ABNA 3TP8A 2PI2A 3EA6A 1WJJA 4A3DG 4IOCA 3GTMH 1BNZA 1BUVT 3I4MB 4A3LH 1HUNA 2YU9H 1CZGA 1UEBA 4DGZA 4U68A 4ID6A 1SYFA 3LWEA 1GUNA 4LF8L 2NN6H 1DCZA 4L6TB 4BY1G 1PH3A 5BR8Q 4A3EB 4IFDH 3N6RA 3L3OC 4I65A 3VA5A 5CV4A 3QG1A 3QR8A 3W1GA 3M7GA 1A2UA 1ESRA 1D7QA 2B2WA 4UP9A 1II3A 3VR6A 1KC8C 4GS3A 2K5WA 3JAMc 3GTLB 5IYDH 1L1OA 3Q8DA 5M3MG 1ASYA 3VA7A 2L11A 5EBDA 3S17H 4ME3A 1HFGA 2UXCQ 3J7AF 1SNOA 1HUMA 1FL0A 3L2PA 1HPCA 4B3RQ 2L5TA 3SVMA 1LO5D 2KENA 4A3BB 3HOWB 1DJRD 2EQSA 3FKIB 2RA4A 3M85A 3HP3A 3MEHA 4QB4A 2F1MA 4JI6Q 1VCIA 1PRTB 2L15A 4DF7A 1XNQL 1BCPD 5E7NA 3K5LA 5C3EB 3D6CA 2J4XA 3TS0A 1LTBD 3DUZA 3TP6A 4CKCA 1F77A 4A3KH 1ONLA 2K1BA 3D4RA 1VMPA 2B63H 4JV5L 2JEAI 2SNSA 3A8IE 1A0IA 2EJMA 1IBLL 4FDBA 2PMZE 4RA8A 2KHJA 2HUGA 5ELEA 3BYTB 1BOSA 1L1OB 4NPSA 4WJWA 1E22A 4L8JA 1Q86C 1EY8A 4APVA 4JI3L 3PMFA 1KABA 4MTKA 2OT2A 4S3SA 2Z6KA 1K3BC 1X6OA 4R4IA 4HIDA 1VQ5A 3CQZB 3S17B 4OWWB 2F3IA 5M3FH 2JA8B 3CHBD 3K80C 1PTOD 4DV3Q 3GTQH 1CI3M 1RIPA 2QILA 3I70A 5F2DA 4A3MH 3ICEA 4R8NA 4Y7NB 1S3OA 3LX0A 3MHBA 1HRJA 2PCFB 2PQAB 2K5QA 2KCCA 3S1RB 3GTGB 2WIIB 2HHHL 4GN3B 4OIJA 3AMUA 2F0LA 3GO5A 4X65L 3CPFA 3MFGA 4TSSA 5D65A 2OTJA 3M4OH 2F0DA 3G6EA 3TBIB 1ML0D 3IRBA 4BBRH 2LXJA 4IPDA 4B3ML 4BBRB 1TWFH 1BVSA 1EYCA 4LFCQ 1PH5A 4KHPL 2BA1A 4K6DA 2E2HB 1YZ6A 2JYOA 1M90C 4IUUA 3AB9A 2VZAA 2ALYB 1V1OA 1UWVA 5IP9G 3EN2A 5JVH3 1QVFA 5LMNQ 2KOLA 1O7YA 1XMOQ 2JA8H 1D6EC 1HQRD 1L2FA 1YJWA 1HJPA 1Y1VB 3A5UA 1W2BA 1CA5A 4HTHA 4ZRZA 4DR5Q 3KLRA 3BJUA 4DR2L 1IYVA 4CDCC 4IO9A 2RDGA 1WTVA 3EVQA 1IL2A 1S5CD 4GNXA 3E0JA 5C3EH 2JEBI 5IGCA 3HOXG 2B8GA 1LTAD 1NSNS 2WB1E 1O7LA 3DM3A 1G6PA 4DV2L 3CXCA 3D6WA 4P71A 5NUCA 1D1KA 3OIQA 2RCFA 1HNXQ 5LMNL 2M2LA 4LFBQ 3DWPA 1VQ6A 1XMQQ 2G9HD 3ER0A 3CAMA 4HMIA 3SK4A 3RLNA 2G9DA 5J22A 5M5XH 4OWTB 1KDAA 2CVRA 4TQUS 2AWNA 1XPUA 4JOIC 3J7A5 2IW3A 5CV9A 4GLXA 5FJ8H 4YCUA 1STYA 3QIAA 4YWMA 2FINB 3RD4A 1NUCA 1IKLA 2K28A 4BBSB 1Y14B 2P5ZX 1DXMA 1YNJC 5M5YB 1EY4A 2A8VA 3HZXA 1PH4A 1SFOB 2EOTA 1A62A 3CCEA 2Z1CA 2EXDA 1UE1A 2JA7G 1RTNA 3X3MA 4LF6L 5I9PA 3K58A 4DV3L 2D5DA 1KLGD 3GP7A 1J5EQ 3T4AC 1I4XA 2N88A 3K81C 4FF3A 4DAMA 1SYEA 3EBEA 3NUCA 4BBSH 1X3EA 4XIGS 1I6HB 1X9NA 2A6ED 3ULPA 3SHLA 2VB2X 4HJ7A 2PZWA 5EAYA 4G57A 4DV0L 2MPMA 1PYSB 1YNND 3ZJYC 3J81i 5LMNW 3NQIA 3MFYA 3PIOA 2BH2A 4JI4Q 4XQNA 1QVGA 3E9IA 4R9WA 3GTPH 1HTLD 2NVYH 4KKSA 2VY3A 2L0CA 4DNTB 2XTIA 2K75A 1TWFB 5CC4A 1XWEA 2F0PA 5FO7B 2RHQB 3PUZA 2ICEC 3S1RH 4JI6L 1Y1WB 3IFDA 3TZDA 3S2HB 1HHVA 3S1NB 5DM73 5HGTA 2F0HA 5FLMH 4A3MB 1XMQL 1CZWA 2F3VA 5CV5A 4IJLA 4ZUJA 2KJXA 2F52A 4M8AA 1U4RA 1NAPA 1HNWL 5CV7A 1MBYA 2O4XA 3KF8B 1EYAA 2J0TD 5J1ZA 4ULLA 1DOMA 1TWGB 5IGEA 3RZOB 1CHPD 3EROA 2KBNA 3CCMA 1KAWA 4K8IA 3I4LA 4B3SL 2NUCA 4XYOA 3HOUG 3CC2A 4HCEA 5IY0A 1I4GA 1EY9A 4L5TA 3CCQA 2EYMA 4YCWA 2Y0SE 4A93G 4ZCKA 1Q3LA
chains in the Genus database with same CATH topology
3SK5A 1STEA 1D1IA 1TIID 2PYKA 1T5XD 1HA5A 3T13A 1U4PA 3DWAA 2EY1A 3X3NA 5C5LA 3S1MB 3PO3B 1SNQA 4ZQ3A 3NP8A 4ODGA 3OPOA 3I72A 1WTQA 4C3IB 1Q8IA 1Y8OB 2A74C 5ELDA 1GHKA 4JBWA 3DXJC 2YU9B 4C3JG 4KHZA 2EYJA 1QILA 5JVG3 4H13C 2NTTA 1OXVA 4BWGB 4G7HC 2WINB 3EJIA 2RSNA 2K32A 1KDCA 5LHY1 4OO1H 3QWNA 1F2LA 3J7YW 1JORA 5EGTA 2B2UC 2PMZB 1UUPA 3BDCA 1EZ8A 1B53A 1F9PA 1W6JA 2Q8TA 2KEDA 4LJZC 3OIPA 1MD2D 2SEBD 4DAYA 4A3JB 4Q5VA 3FPUB 5JEAJ 3GTPB 3VYRA 4HSPA 1BBXC 1I3QB 4K2KA 4OO1G 1LV9A 1SMYC 1PFNA 4WRDA 3GV6A 2EPBA 2RKSA 2CW0D 3VYSA 3RMHA 3PIP3 4X3KA 1F2YA 5EPKA 4IUTA 5DAUA 5FK9C 1QJOA 1SNDA 5C4HA 4XDXA 5E4XA 3BYYB 4X3UA 2SNMA 4IFDI 4KMUC 1BDOA 2R7ZB 1S5DD 4H44C 2R6GA 3T16A 1CFMA 5IIFA 4J1MA 4G7ZC 4IALA 4FF1A 3A7AB 3QOJA 4KI0A 1WTWA 2EYPA 2E2JB 4DAVA 2EY2A 2AQ3B 1LT3D 2EYFA 4CBVA 1GOZA 1ZYRC 1KNAA 1DOKA 3OWFA 1PRTC 4PV1C 3SR1A 3SXHA 3H94A 1CTMA 5M5WB 3DEPA 3TZUA 1PFBA 4C1NI 2JA5B 4CHTB 4N9TA 3R2IA 3J81E 2WACA 3VYTA 1SXTA 2KQ3A 3I73A 2PO4A 4KY7A 2PNRC 3MA2B 4HR7B 2SDFA 1H9MA 4QIWB 4A3FB 2Z4HA 3R93A 4GZYC 4E6IA 5EKKA 1R9TB 3K0YA 1PRTD 2KECA 1VF5C 3MVVA 5C3XA 1VMCA 1PZJD 2A6HD 5BN5A 4RCOA 3K57A 3NK9A 1O80A 3DM1A 3KK7A 3HS0C 3I8ZA 3SK6A 2F0VA 1S5BD 3K5OA 4IUPA 4FF2A 3TP7A 1EY7A 1I50B 1O7ZA 3QOLA 1I4PA 4C1NK 3PUWA 4ZUIA 3FEWX 4LK1C 4XQJA 4U673 1IHZA 3CRKC 1DYQA 1SEBD 2CQAA 1QG7A 4EQPA 2WP8J 2AQ2B 4RHRA 4C3HB 3T51B 3J81L 4A3KB 1B44D 2IT1A 5ELFA 5ISRA 1ICWA 3Q22A 3NE5B 4A3DB 5EQ0A 2K33A 1R4QB 4RWSC 1AFPA 1OXSC 2D9UA 1KDBA 3MC0B 3BG3A 2A69C 3HOXB 1I6VC 1B4OA 4QF4A 3EFXD 5J39A 2SOBA 1X32A 2VUMB 1GUOA 1EIHA 2O2LD 4OGQC 5T1IA 1C8CA 3PUXA 1BXTA 5FOBB 1EEID 2BOSA 3D31A 5I6YA 3I4NB 1TS3A 4H7BA 2TMPA 4DK1A 1STHA 5BN4A 3HOYB 4ZKCB 4C3JB 2X6GA 1KLUD 2DN8A 1WCMB 4QUFA 5LL6S 3DMUA 2HQEA 3MAQA 1MSHA 2F0NA 4LAAA 5C4ZA 5I6WA 2AWOA 3WOFA 2PZTA 1GUWA 5KGUA 1J8IA 1MSGA 3KF8A 1U4LA 2Y0SB 2F0IA 1OXXK 1B2TA 3N52A 3OHXC 1ENCA 4B9WA 4CJ2C 4HMJA 2N55A 1OXUA 5JPNC 1LTGD 1EEFD 3A56A 2F3WA 5CBAE 2L4NA 1Z7TA 4CKBA 3C46A 1PMRA 1XX8A 4FYDA 1X3QA 1B9NA 2K6AA 5ELCA 2EJGC 1ILPA 1SNPA 4IQZA 2XRQD 2JP1A 1D5ZC 3F2UA 3G6JB 3R3OA 4L63B 2WKCA 2XSCA 3HGBA 2QCPX 3J7AV 3E6ZX 1K8MA 1PLFA 3PO2B 1E2WA 4B9XA 1ZXTA 2NVTB 3MWYW 2ID0A 1EY0A 2AQ1B 1AZQA 5KNCA 1EOTA 3NTHA 3L7ZC 2PQEA 2MP1A 2RDFA 2AUJD 1FGBD 2B2VA 2KEEA 3SDZA 5IT9L 5KYLA 1ILQA 1X3PA 4IFDJ 4HAEA 3HOVB 2OXPA 4DAPA 5DM63 1DOLA 3V05A 4CGYB 4NKLA 1JWUD 1GUGA 2F0UA 4F7XA 2FMCA 4DXGA 3M7NA 1YNJD 5JAVA 5EBCA 4X3TA 2FJ2A 2MGSA 5I2YA 3ITPA 2K03A 1E0BA 3NBHA 1CQFA 3A8JE 3G7LA 3NPPA 4DA2A 1STNA 5M5XB 2F0GA 2IX1A 5I4DA 2F4IA 5C0XJ 3M4OB 2LFNA 4DU9A 2BDOA 3OW7A 3NHHA 3OMCA 1MGSA 1RJTA 1SBBB 1STAA 2E2DC 4LMQD 5D3IB 5KIXA 3FPPA 1G6ZA 2JSOA 1Q1BA 2HCCA 2A68D 4CJ0B 3KLSX 1I4RA 2IL8A 1RDPD 3M3YB 3PUVA 2EXZA 3FDTA 1M8AA 4RFBA 2H4OA 1CHQD 3TSSA 4RKLA 2O5IC 4EQNA 4DXFA 1H9SA 4CKEA 4KHVA 2PW5A 2ENBA 3RUZA 2B2VC 4EGVA 4NW2A 2Q8IB 1Y69U 2FMMA 3ZYYX 1M4VA 1A6XA 4DNRB 1RCVD 1SNCA 5K5PA 2R61A 2BDNA 4IURA 2PPBC 3T56B 4H0LC 1B3AA 1TVXA 1G8ZD 2XN9C 5E4WC 3T53B 3GQBA 3JAME 2XVSA 4IUVA 1TS2A 3D3RA 2A6HC 3ND9A 1FYCA 4XQQA 3OWEB 2F0QA 2F0KA 1QNUA 1NCVA 2IJ0A 3MTSA 1STGA 4ZLTF 3MXUA 1CQVA 5CGKA 5FLXE 2WV6D 2C5CA 4HN7A 4IUQA 2GA4B 3GTQB 2ICIA 4KY6A 3K5NA 2XWBB 4OL7A 1PTOF 2NZ1D 4XTCS 5C4JB 3HRZC 2A68C 4B08A 4Q0FA 1RHPA 5C0XG 4FXKC 1SAPA 2K7VA 3RZDB 2NWGA 1JC7A 3E5SA 3FVQA 5EPLA 3TN2A 5A2QE 1W6KA 3W2DA 4PMBA 1RTOA 5IOCA 1G291 3NWSA 1G2TA 3GTMB 1TT2A 5M9OA 2JA7B 2B2WC 3D4WA 1SJED 1Q12A 4Z9CB 1Q1EA 2LMCB 2X69A 2XRSD 1AP0A 1CK1A 4KD3A 3S15B 1B1ZA 5C4XB 3U9OA 2IPKD 4C3HG 1LTRD 1WVLA 4WORA 3KBGA 1AN8A 3V96A 3C2PA 2NVQB 1RF2D 5I2XA 2A6EC 4O1NA 2F0JA 1QB5D 2F03A 1LTSD 3I91A 2I07B 1G91A 5T1GA 3VR4A 1JWMD 3FRPB 1EU3A 4R8IA 2L12A 3PIO3 2NYZD 2V4DA 1R4PB 3M4YA 1SYGA 3BVMA 1G2SA 1CT1D 2EJFC 4RGTA 4XT1B 1JR0D 5I9OA 1ENAA 1S5FD 1EY5A 4EQOA 1SE4A 3L9AX 5EPJA 1V8QA 1EQVA 1DONA 5JEAG 4DN4M 4FXDA 2F0WA 1K8OA 3KLSA 2XIWA 3WOEA 3DWQA 3Q23A 3PV0A 2NBFA 5KNBA 3A55A 3AU7A 2QKIC 3S16B 3OMGA 1FR3A 2EY6A 4OIKA 4X3SA 3IAYA 1JB3A 4HEDA 4ILWA 2WB1B 5C44B 1PXUA 1EYDA 2EYOA 1FNUA 5M3MB 4A3IB 4EVOA 5CORA 1DZ1A 3K5MA 1L0XB 5DEHA 1LACA 1TY2A 1LTTD 2CHBD 1FD7D 5CV6A 1SYDA 1A3VA 5IGGA 1D5XC 1HA6A 4KKTA 1B50A 2H1EA 3D4DA 1I4HA 2KVMA 4ME5A 1S4ZA 2F0FA 3P20A 4KY5A 2RQXA 2WAQB 1ENFA 1TU2B 4CJ1B 1EWCA 1SE2A 1EL0A 1JOQA 1TR5A 1BF4A 1IW7D 4V0BA 3SE0A 1LTID 3J80E 3MXPA 1MI2A 1HXYD 4F88A 2KA7A 3MXGA 2KUMA 1VF7A 4P2CB 1L0YB 1SJHD 3WDNA 4M1UB 3Q6SA 1JQYD 1TS4A 1BO0A 1A15A 3H09A 2DNEA 2BA0A 3SEBA 1AW7A 3NSWA 5CR3A 2B39A 4IZ8A 4BS9A 3CU7A 2B2UA 1A3TA 1BCPC 5G3LF 5EKLA 4BY1B 1AZPA 1WD0A 1GXDC 2D2CC 2KCNA 1DD2A 3ERQA 4PQXA 1EU4A 1JOOA 5CMDA 1RD9D 2L55A 1JCKB 3D8GA 3BDLA 4MIUA 3VR2A 5E1FA 2OEOA 1A3UA 3VR5A 2NN6G 3UI2A 1FNVA 5D3DA 4O42A 5FO8B 2K04A 1QWYA 4C56C 4RGOS 4PNYA 5KNDA 5M3FB 5JJZA 5CBEE 1Q90A 1V1PA 2ZT9C 1PTOC 1A2TA 2EYHA 1TWAB 1F2ZA 1LABA 4QMGA 1SE3A 4WFN3 2EVBA 2I46A 2J7ZA 1GUSA 1SSOA 2DY8A 3IKJA 3GD7A 4TKOB 4K6LA 1TKWB 1EIGA 1TWCB 4OO1I 1XYIA 4ZK9B 4KN4C 1F9QA 1LT6D 2IX0A 1Z47A 1H9RA 4XXEA 1PYWD 1RKNA 2YYZA 4HCSA 4NDXA 4J8QA 5C0XI 2A73B 2B2TA 2EYLA 1UAPA 3K6OA 2B2YA 2NN6I 5KYIA 1C48A 5C0XH 2RDHA 3I3CA 3BVGA 5K36G 4K5XA 4G7OC 1JICA 3O13A 3P75A 1D2BA 1U9RA 1LLRD 3H6MA 3CRLC 2WKDA 4C3IG 3OSOA 2VNUD 2JA6B 4BA2I 2AUKA 1WTPA 2ZXRA 4F87A 1PZKD 2EDGA 2L1BA 3DHQA 3K7AB 1QNKA 2OF1A 5TSSA 1B9MA 4ZKBB 4KTAA 1OO9B 1HTPA 1TWHB 1PRTF 2C9OA 2F0EA 3PUYA 2PZUA 2CW0C 5JPMC 1BQQT 1TY0A 1TQOA 3H3VC 3KUPA 5D14A 3GTKB 4K14A 1SMYD 4A3GB 1E2ZA 3K59A 3BDOA 1UNSA 3A8KE 3NXWA 4MHEA 4NMZA 4N9PA 1PTOH 1OXTA 2JE6I 1VDZA 1IYUA 1TS5A 4C2MB 3SK8A 1WD1A 2BCOA 2BE5D 1O78A 2VB3X 1ZYRD 1ET9A 3BZDB 1EFID 3QO2A 3NTIA 3BVZA 1PZID 4PMCA 4BA1I 1HFNA 5IT9E 2Z4IA 4HSVA 3QB3A 2K01A 2IWHA 1BCPF 2K5DA 5JOBA 4FVMA 4FO2A 3ONAB 2F0MA 3KBXA 3MZ5A 1YNNC 4G4KA 4MN3A 1XXGA 5IODA 1EY6A 2D62A 2O5JC 2QF7A 5EJWA 1E2VA 3H91A 4RGMA 1ZKOA 2FFKB 4BY7B 1SDFA 2M9VA 3HOUB 1F2MA 2FHTA 3H0GB 5JEAH 1GUTA 1CM9A 4OHJA 3GV3A 1Y8PB 2NB0A 1JWSD 2B63B 3R2TA 2MHVA 1HCZA 3TMEA 4K5VA 3R8BA 3IFTA 3QJYA 1DM0B 4IUNA 4KN7C 1S5ED 3TDQA 1KAAA 1D5MC 1QCBD 4KD4A 4KKUA 2EY5A 5CV8A 2MJ8A 4QCLA 4KJOA 2LS01 2R92B 3URYA 1IKMA 2ZXPA 1JOKA 5BN3A 1H9SB 2R3ZA 2XNAC 2RSOA 3HKZB 2MUYA 4I7ZC 2LY7A 1ZEQX 1EQTA 4KV6A 2Z8LA 2F0SA 2NVYB 5EKIA 3GTJB 1V43A 4KK7A 5HURA 4QUCA 2K05A 4DFAA 4FP5D 2DNCA 5KRUA 2DY7A 1F9SA 1H9KA 4V190 4DK0A 2A5HA 2JXMB 1RODA 3J80L 3OOCA 4K2LA 1NR2A 5COYA 3GTOB 1KTKA 1AEXA 3A7LA 3IL8A 5A35A 4XT3B 1F9RA 2E75C 5IGBA 3DEOA 2PW7A 4KJNA 3C3LA 1WTXA 5G3LD 5AFWA 3NTKA 2HCIA 3S1QB 2EE1A 1LT5D 1STBA 3ND8A 5FLXL 3FMCA 4IN3A 2E74C 2KHSA 3HOZB 1FNWA 3VYUA 5DNFA 1NR4A 2B8FA 3NBIA 2F0TA 1LT4D 2F0OA 4JK1C 4TRDA 5C3WA 1EWHA 1IW7C 1QE6A 2ZXOA 3S2DB 4RH6A 3EQLC 1K83B 1U4MA 2EZVA 4RGNA 3CKIB 5FO9B 2HDMA 1SNMA 1I4QA 4RCNA 3P1HA 3V2TA 4A93B 4NP5A 1H9JA 3LNNA 4FF4A 3W3AA 5LL6X 1CA6A 5C6AA 1IL8A 1BR9A 3P7JA 4UDUC 1GJXA 3RLFA 2B2YC 1WTRA 2NVXB 4YIJA 1ET6A 3A54A 1HQMC 3Q24A 5A2QL 4XYQA 5CYUA 5IGFA 1J9OA 3U9SA 1GHJA 4RAUC 1PDQA 1C4QA 1SYBA 3S9WA 3S14B 1Y8NB 3TP5A 3MXNA 2L9HA 4J6HA 2M00A 5C5MA 3C1EA 4FNFA 1ESFA 5K36H 4UAIA 1SYCA 2E76C 2RBMA 1PFMA 2LKVA 1JE4A 2E2IB 5FKAC 1EZ6A 2XWJB 5KEEA 2QEJC 4IFDG 3HG9A 4PMWA 4AYBB 4F8MA 3VR3A 4FXGC 1UEAB 2TSSA 5E3FA 3BS1A 2BE5C 1V1PB 2Q8RE 2HDLA 5IGDA 4ZAIA 2R93B 1T5EA 2A69D 1XTCD 1WTOA 3Q0AA 4K8JA 1Z6HA 3JAML 4RHSA 3I90A 2NTSA 1KNEA 3NWTA 3HEJA 2QDBA 1QOHA 4K5WA 2X6LA 4RKBA 2RVLA 1PTOB 1BCPB 5ELBA 2B2TC 3NQTA 2IX3A 3C1FA 2VXWA 3LWUA 4ZYSA 4ABNA 3TP8A 3EA6A 1BNZA 1BUVT 3I4MB 1HUNA 1CZGA 4DGZA 4U68A 4ID6A 1SYFA 3LWEA 1GUNA 2NN6H 1DCZA 4L6TB 4A3EB 4IFDH 3N6RA 3L3OC 4I65A 3VA5A 5CV4A 3QG1A 3M7GA 1A2UA 1ESRA 2B2WA 1II3A 3VR6A 2K5WA 3GTLB 3VA7A 2L11A 5EBDA 1HFGA 3J7AF 1SNOA 1HUMA 1HPCA 2L5TA 3SVMA 1LO5D 4A3BB 3HOWB 1DJRD 3FKIB 2RA4A 3M85A 3HP3A 3MEHA 4QB4A 2F1MA 1VCIA 1PRTB 4DF7A 1BCPD 3K5LA 5C3EB 3D6CA 2J4XA 1LTBD 3DUZA 3TP6A 4CKCA 1F77A 1ONLA 2K1BA 3D4RA 1VMPA 2JEAI 2SNSA 3A8IE 2EJMA 4RA8A 2HUGA 5ELEA 3BYTB 1BOSA 4WJWA 4L8JA 1EY8A 3PMFA 1KABA 4S3SA 2OT2A 3S17B 3CQZB 2JA8B 3CHBD 1PTOD 1CI3M 2QILA 3I70A 5F2DA 4R8NA 4Y7NB 3LX0A 3MHBA 1HRJA 2PCFB 2K5QA 2KCCA 3S1RB 3GTGB 2WIIB 4OIJA 3AMUA 2F0LA 3GO5A 3MFGA 4TSSA 5D65A 2F0DA 3TBIB 1ML0D 4BBRB 1EYCA 2BA1A 4K6DA 2E2HB 2JYOA 4IUUA 3AB9A 1V1OA 5JVH3 2KOLA 1O7YA 1D6EC 1HQRD 1Y1VB 1CA5A 4HTHA 4ZRZA 3KLRA 1IYVA 2RDGA 1WTVA 3EVQA 1S5CD 3E0JA 2JEBI 5IGCA 2B8GA 1LTAD 1NSNS 1O7LA 3D6WA 5NUCA 1D1KA 3OIQA 2M2LA 3DWPA 2G9HD 4HMIA 3SK4A 5J22A 2G9DA 1KDAA 2CVRA 4TQUS 2AWNA 2IW3A 5CV9A 1STYA 3QIAA 2FINB 3RD4A 1NUCA 1IKLA 2K28A 4BBSB 1DXMA 1YNJC 5M5YB 1EY4A 3HZXA 1SFOB 2EOTA 2Z1CA 1RTNA 3X3MA 5I9PA 3K58A 2D5DA 1KLGD 3GP7A 3T4AC 1I4XA 2N88A 4FF3A 1SYEA 3NUCA 4XIGS 1I6HB 2A6ED 3SHLA 2VB2X 2PZWA 4G57A 2MPMA 1YNND 3NQIA 3MFYA 4XQNA 4R9WA 1HTLD 4KKSA 4DNTB 2L0CA 1TWFB 5CC4A 1XWEA 2F0PA 5FO7B 3PUZA 2ICEC 1Y1WB 3IFDA 3TZDA 3S2HB 1HHVA 3S1NB 4A3MB 5DM73 5HGTA 2F0HA 1CZWA 2F3VA 5CV5A 4ZUJA 2KJXA 4M8AA 1U4RA 1NAPA 5CV7A 1MBYA 2O4XA 5J1ZA 1EYAA 2J0TD 4ULLA 1DOMA 1TWGB 5IGEA 3RZOB 1CHPD 3EROA 4K8IA 3I4LA 2NUCA 4XYOA 4HCEA 1I4GA 1EY9A 2EYMA 1Q3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3T A;  4PMB A;  4NDX A;  3SK5 A;  5IOC A;  4H7B A;  5EKL A;  4KJO A;  2PYK A;  5DAU A;  4RKB A;  4RKL A;  5CV9 A;  1SND A;  1SNM A;  5C4H A;  3T13 A;  4EQN A;  1EY8 A;  3MVV A;  5C3X A;  1STY A;  2PQE A;  2EY1 A;  2SNM A;  3P1H A;  1KAB A;  3OMG A;  1STH A;  2RDF A;  1JOK A;  3PMF A;  4KHV A;  1TT2 A;  2EY6 A;  4NP5 A;  4S3S A;  3V2T A;  2EYL A;  1NUC A;  2PW5 A;  5C5L A;  3NQT A;  4PMC A;  5K5P A;  2ENB A;  3RUZ A;  5M9O A;  3NK9 A;  1SNQ A;  4ZQ3 A;  3NP8 A;  5KYL A;  3C1F A;  5C6A A;  3SK6 A;  3T16 A;  4ODG A;  3D4W A;  2F0V A;  3ERQ A;  5IIF A;  5KYI A;  5F2D A;  3QB3 A;  1EY4 A;  2OXP A;  4J1M A;  4KV6 A;  3DMU A;  5HUR A;  3HZX A;  1EYD A;  2HQE A;  3TP7 A;  1JOO A;  4K5X A;  1EY7 A;  4R8N A;  2F0N A;  2EYO A;  3LX0 A;  4IAL A;  3QOL A;  4LAA A;  2F0S A;  3D8G A;  3MHB A;  3BDL A;  3QOJ A;  3P75 A;  2EYJ A;  5C4Z A;  1U9R A;  4NKL A;  5I6W A;  1SNC A;  2F0U A;  3H6M A;  4MIU A;  4YIJ A;  5E1F A;  2F0L A;  3TP8 A;  4F7X A;  4ZUI A;  4EVO A;  4KD3 A;  2OEO A;  5I9P A;  1A3U A;  5JOB A;  2F0D A;  4DFA A;  5DEH A;  1IHZ A;  2EYP A;  2PZT A;  3OSO A;  3U9O A;  5KRU A;  4DGZ A;  2F0M A;  5KGU A;  4ID6 A;  5IGF A;  1SYF A;  2EY2 A;  3MZ5 A;  5JAV A;  2EYF A;  4WOR A;  5CV6 A;  4EQP A;  1SYD A;  1A3V A;  1SYE A;  1SYB A;  4PNY A;  1EYC A;  3NUC A;  4K2L A;  5IGG A;  3S9W A;  2F0I A;  3ITP A;  3SHL A;  5IOD A;  1EY6 A;  2F0J A;  4I65 A;  2F0Q A;  2PZW A;  4K6D A;  4G57 A;  3TP5 A;  3VA5 A;  5CV4 A;  1AEX A;  4J6H A;  2F0K A;  1STN A;  2M00 A;  3EJI A;  5C5M A;  3C1E A;  2F0G A;  1ENC A;  3DHQ A;  3D4D A;  1A2U A;  1STG A;  1SYC A;  3OWF A;  4HMJ A;  3SR1 A;  3SXH A;  4B9W A;  1A2T A;  1II3 A;  1KDC A;  2EYH A;  2RBM A;  4ME5 A;  5IGB A;  2LKV A;  2OF1 A;  5CGK A;  5ISR A;  2F0F A;  4KTA A;  2PW7 A;  4KY5 A;  4KJN A;  1F2M A;  1EZ6 A;  2F3W A;  5KEE A;  1F2Z A;  4QMG A;  1SYG A;  1JOQ A;  5CC4 A;  1JOR A;  2F0E A;  1TR5 A;  5EGT A;  4DU9 A;  2F0P A;  2PZU A;  4N9T A;  3BDC A;  1EZ8 A;  2WAC A;  3NHH A;  1TQO A;  4KY6 A;  1SNO A;  4F8M A;  1KDB A;  1STB A;  3MXP A;  4HTH A;  3OMC A;  5I9O A;  1ENA A;  2KQ3 A;  4K14 A;  1STA A;  5HGT A;  1SNP A;  2F0H A;  1EY5 A;  5KIX A;  4OL7 A;  2KHS A;  4QF4 A;  5E3F A;  4EQO A;  2F3V A;  5CV5 A;  1EQV A;  4ZUJ A;  5J39 A;  3EVQ A;  2F0T A;  5IGD A;  5IGC A;  2SOB A;  3MEH A;  3NXW A;  2O4X A;  4QB4 A;  1NSN S;  1EYA A;  2F0O A;  4KY7 A;  5CV7 A;  5J1Z A;  3R3O A;  4DF7 A;  4NMZ A;  4N9P A;  2F0W A;  4TRD A;  5C3W A;  5IGE A;  3ERO A;  3D6C A;  4K2K A;  3TME A;  4K5V A;  4K8I A;  5NUC A;  4IUN A;  4K8J A;  3TP6 A;  4WRD A;  2NUC A;  2RKS A;  1KAA A;  1EY9 A;  3E5S A;  2SNS A;  2EYM A;  4HMI A;  3SK4 A;  5J22 A;  1RKN A;  4KD4 A;  5CR3 A;  3SK8 A;  4B9X A;  3HEJ A;  5I6Y A;  2EY5 A;  1KDA A;  4E6I A;  4IZ8 A;  2QDB A;  2EXZ A;  4K5W A;  5CV8 A;  5EKK A;  1EY0 A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 4C3H H;  3SK5 A;  1STE A;  1D1I A;  1TII D;  2PYK A;  1T5X D;  1HA5 A;  1N9W A;  3T13 A;  4JBM A;  1U4P A;  3DWA A;  2EY1 A;  1VQD A;  4HIM A;  3CF5 A;  3X3N A;  5C5L A;  3S1M B;  3PO3 B;  1SNQ A;  4ZQ3 A;  3NP8 A;  4DR1 Q;  4ODG A;  3OPO A;  1X54 A;  3I72 A;  1WTQ A;  4C3I B;  1Q8I A;  1Y8O B;  2A74 C;  5ELD A;  1GHK A;  4JBW A;  3DXJ C;  3FKI H;  2YU9 B;  2Q2T A;  2V1C C;  4C3J G;  3CC7 A;  4LF7 Q;  2JA6 G;  4AQY Q;  4KHZ A;  2EYJ A;  1PYB A;  1QIL A;  1E1O A;  1VQN A;  1BBW A;  3KF6 A;  2JA9 A;  1JJC B;  1N32 Q;  5JVG 3;  2Q2U A;  1SRO A;  4A3I G;  2C35 B;  4QGU A;  5HY6 A;  4H13 C;  2NTT A;  3MXN B;  2KCT A;  5L37 A;  1WTH A;  1OXV A;  4BWG B;  1VQM A;  4G7H C;  2WIN B;  3EJI A;  2MFI A;  2RSN A;  5C44 G;  2K32 A;  3OW2 A;  1KDC A;  1B70 B;  3RLO A;  1GO3 E;  5LHY 1;  2CH4 W;  4OO1 H;  2VL6 A;  3QWN A;  4X66 Q;  2VQF Q;  1F2L A;  3K8A A;  3J7Y W;  1SFO H;  1JOR A;  5EGT A;  2VUM H;  3I4N G;  2B2U C;  2PMZ B;  1UUP A;  1VQH A;  3BDC A;  1EZ8 A;  4GOP C;  1B53 A;  4DV1 L;  1F9P A;  1W6J A;  5HGQ A;  4P72 A;  1NY4 A;  2Q8T A;  2KED A;  1XPO A;  4LJZ C;  4JV5 Q;  3OIP A;  4X64 Q;  3AFQ A;  1MD2 D;  4A3J H;  2SEB D;  4DAY A;  4A3J B;  4Q5V A;  3FPU B;  5JEA J;  3GTP B;  2EIF A;  3VYR A;  4HSP A;  4UY8 C;  1BBX C;  1I3Q B;  4K2K A;  4OO1 G;  1LV9 A;  2H5X A;  3F8T A;  1SMY C;  1PFN A;  4WRD A;  3RZO H;  2E2H H;  3GV6 A;  2EPB A;  2RKS A;  1R9T H;  2GVA A;  4GLA C;  2CW0 D;  1XNR L;  3RMH A;  1EIF A;  3VYS A;  3PIP 3;  4X3K A;  4POF A;  1F2Y A;  4JBJ A;  5EPK A;  1IZ6 A;  2JA8 G;  4IUT A;  5DAU A;  5FK9 C;  1QJO A;  1C0A A;  1SND A;  5C4H A;  4XDX A;  5JJK A;  5E4X A;  3BYY B;  4X3U A;  5JJL A;  2IY5 B;  2SNM A;  4IOA A;  4IFD I;  4KMU C;  1BDO A;  4A3D H;  1PHJ A;  2YTX A;  2R7Z B;  1S5D D;  1UE5 A;  2R6G A;  4H44 C;  3T16 A;  1CFM A;  5IIF A;  1YHB A;  2JA6 H;  4J1M A;  4G7Z C;  4LF9 Q;  4B3S Q;  1N8R C;  4IAL A;  2ZJQ A;  4FF1 A;  1EQQ A;  3A7A B;  3CMA A;  3QOJ A;  4KI0 A;  3H0G G;  4DR7 L;  4LF8 Q;  1WTW A;  2ES2 A;  3D0F A;  3CC4 A;  2EYP A;  2E2J B;  2AKW B;  4DAV A;  2EY2 A;  1ASZ A;  2AQ3 B;  1LT3 D;  2EYF A;  1U0L A;  4CBV A;  2JN4 A;  1GOZ A;  3TEH B;  1ZYR C;  3HKZ G;  2K5V A;  1KNA A;  2JA5 G;  1DOK A;  3OWF A;  1PRT C;  4PV1 C;  3SR1 A;  3SXH A;  3S1M H;  3H94 A;  1OTC A;  4X6A H;  1CTM A;  5M5W B;  1NMF A;  4KLK A;  1B7Y B;  3DEP A;  4LF4 L;  3TZU A;  1PA6 A;  4CDE C;  1I6H H;  1PFB A;  4C1N I;  2JA5 B;  4CHT B;  1P8L A;  1K0S A;  4N9T A;  3R2I A;  3J81 E;  2WAC A;  4A3B G;  2IHF A;  1SXT A;  3VYT A;  2KQ3 A;  3HKZ E;  1CKM A;  2K5H A;  1NJI C;  3I73 A;  2PO4 A;  3F1Z A;  2ZM6 Q;  4KY7 A;  1XJV A;  2PNR C;  4DUZ L;  3MA2 B;  4HR7 B;  4LNQ A;  2SDF A;  2NZO A;  1H9M A;  4QIW B;  4A3F B;  2Z4H A;  3R93 A;  1CKN B;  1K8A C;  4GZY C;  4E6I A;  3OTO Q;  5EKK A;  1HNZ L;  1R9T B;  3T1Y Q;  3K0Y A;  1PRT D;  2KEC A;  1VF5 C;  5IP7 G;  1VQ8 A;  3K0X A;  3MVV A;  5C3X A;  5M3F G;  1VMC A;  1HR0 Q;  4DV7 Q;  1PZJ D;  2A6H D;  2KCM A;  5BN5 A;  4RCO A;  1KRT A;  3K57 A;  3NK9 A;  1O80 A;  1JE5 A;  3DM1 A;  4CDD C;  3KK7 A;  3HS0 C;  3I8Z A;  3SK6 A;  2RHS B;  2F0V A;  3CCR A;  1S5B D;  3K5O A;  4IUP A;  1HR0 L;  4FF2 A;  3TP7 A;  1EY7 A;  1I50 B;  1O7Z A;  3QOL A;  2WAQ G;  1I4P A;  4C1N K;  3T1Y L;  4PG3 A;  2I5M X;  3PUW A;  4ZUI A;  2NVX H;  3FEW X;  4LK1 C;  3UDI A;  4XQJ A;  4U67 3;  1IHZ A;  1Q7Y C;  4O2D A;  4POG A;  3CRK C;  4JI1 Q;  2GVB A;  1DYQ A;  4DR6 L;  1SEB D;  2CQA A;  1QG7 A;  4EQP A;  2WP8 J;  2CH4 A;  2AQ2 B;  1D8L A;  4RHR A;  4C3H B;  3T51 B;  3J81 L;  3H3V H;  4A3K B;  1N33 Q;  2UUA L;  3CD6 A;  3LGJ A;  1XPR A;  1B44 D;  2IT1 A;  5ELF A;  1Y1V G;  4HJ8 A;  5ISR A;  4YHH Q;  1ICW A;  2K52 A;  3BZC A;  3Q22 A;  3NE5 B;  4A3D B;  5EQ0 A;  2K33 A;  1R4Q B;  4RWS C;  1AFP A;  5M3M H;  1OXS C;  2D9U A;  4OON A;  1KDB A;  1Q46 A;  3BG3 A;  3MC0 B;  4LF4 Q;  2A69 C;  1VQA A;  3HOX B;  4QY7 A;  1I6V C;  3S15 H;  1B4O A;  4QF4 A;  1NMG A;  3EFX D;  5J39 A;  1Y1W H;  1AE3 A;  2ZJP A;  2QEX A;  2SOB A;  1X32 A;  2VUM B;  2Z6K C;  2HHH Q;  4A3B H;  2RF4 A;  1GUO A;  1EIH A;  2O2L D;  4OGQ C;  5T1I A;  1VQ7 A;  1C8C A;  3PUX A;  3AEV A;  1N36 Q;  3F2D A;  1BXT A;  5FOB B;  2NVT H;  1EEI D;  2BOS A;  3S24 A;  3D31 A;  5I6Y A;  3I4N B;  1TS3 A;  3GTO H;  2Q2H A;  1KD1 C;  3PO3 G;  4H7B A;  2TMP A;  4HJ5 A;  1TWC H;  4DK1 A;  2PI2 E;  4Y52 H;  4A3G G;  1STH A;  5BN4 A;  4AYB E;  3HOY B;  3T1H L;  1KIX A;  4ZKC B;  1IBM L;  4C3J B;  4OWX B;  4X62 L;  2X6G A;  1KLU D;  3CCU A;  2DN8 A;  1WCM B;  4QUF A;  5LL6 S;  1G51 A;  3DMU A;  2HQE A;  3MAQ A;  2NVQ H;  1MSH A;  2F0N A;  4LAA A;  5C4Z A;  5I6W A;  2AWO A;  4H02 A;  2LSS A;  4JBK A;  1V1Q A;  3WOF A;  2Y0S G;  4JI2 L;  3A5Z B;  2PZT A;  4AYB G;  3PO3 H;  3I4M H;  3KLW A;  1GUW A;  5KGU A;  1J8I A;  1MSG A;  2CWA A;  3KF8 A;  1U4L A;  2UUC Q;  2Y0S B;  4LUV A;  1KL9 A;  2F0I A;  3E9H A;  1OXX K;  1B2T A;  3N52 A;  2G5D A;  2DGY A;  4DK6 C;  3OHX C;  1ENC A;  4B9W A;  4CJ2 C;  4HMJ A;  2N55 A;  1OXU A;  5JPN C;  1LTG D;  1YEZ A;  1EEF D;  4X62 Q;  3A56 A;  2F3W A;  1IBM Q;  5IP9 H;  1S72 A;  5CBA E;  2L4N A;  4R4O A;  1Z7T A;  4CKB A;  3C46 A;  1QUQ A;  4DV6 L;  3I4M G;  1PMR A;  1XX8 A;  2E5L Q;  4FYD A;  4BY7 G;  1X3Q A;  1B9N A;  2K6A A;  4A3C G;  5ELC A;  4GKJ Q;  2EJG C;  4OEM B;  1ILP A;  4IQZ A;  1SNP A;  2N78 A;  2XRQ D;  5GAG C;  1N34 Q;  2JP1 A;  1D5Z C;  3F2U A;  3G6J B;  1AH9 A;  3R3O A;  2PQA A;  4L63 B;  3I55 A;  1YIJ A;  2WKC A;  2XSC A;  3HGB A;  2QCP X;  1V9P A;  1A63 A;  1KRS A;  4A3G H;  1SMX A;  5IYD G;  2R7D A;  3E6Z X;  4B3T Q;  1K8M A;  3J7A V;  3TRE A;  1PLF A;  4GN5 A;  3PO2 B;  1E2W A;  2AHO B;  4B9X A;  1UE6 A;  1ZXT A;  3J80 c;  2NVT B;  3MWY W;  2ID0 A;  4MNO A;  1EY0 A;  2AQ1 B;  2R7Z G;  1AZQ A;  5KNC A;  1EOT A;  3NTH A;  4JOI A;  3L7Z C;  2PQE A;  4A3I H;  1K9M C;  2E2I H;  2MP1 A;  1SE8 A;  2RDF A;  1DGS A;  2AUJ D;  1FGB D;  2B2V A;  2I5L X;  2KEE A;  3SDZ A;  5C4X H;  2KHI A;  5IT9 L;  5KYL A;  1ILQ A;  1X3P A;  1HR0 W;  4IFD J;  4HAE A;  3HOV B;  4GKJ L;  2OXP A;  4DAP A;  2MO0 A;  5DM6 3;  4JI5 L;  1DOL A;  3V05 A;  4CGY B;  4Y7N H;  4YCV A;  2UXD Q;  4NKL A;  1JWU D;  1GUG A;  2F0U A;  4F7X A;  4A3F G;  2FMC A;  3GTG H;  3HOV G;  4A3E G;  4DXG A;  4NXM Q;  3M7N A;  4A76 A;  1YNJ D;  4DR6 Q;  2N49 A;  3A74 A;  5JAV A;  5IYC G;  1IBK Q;  5EBC A;  4X3T A;  2FJ2 A;  2MGS A;  4HJ9 A;  5I2Y A;  4AH6 A;  4K0K L;  3BU2 A;  3ITP A;  2K03 A;  3HOW G;  1E0B A;  5M5W H;  3NBH A;  1CQF A;  3RN5 A;  3A8J E;  2UUC L;  4BBS G;  3G7L A;  3NPP A;  1CUK A;  4DA2 A;  1STN A;  5M5X B;  1KQS A;  2F0G A;  4I7A A;  1I94 L;  4A3C H;  3AFP A;  4DR3 L;  1Z9F A;  2IX1 A;  5I4D A;  2F4I A;  2K4K A;  3UE0 A;  3TS2 A;  5C0X J;  3M4O B;  4RMF A;  2LFN A;  4DU9 A;  3NEM A;  4IPC A;  1O7I A;  2BDO A;  3OW7 A;  3NHH A;  3OMC A;  1MGS A;  1K73 C;  1RJT A;  1SBB B;  1STA A;  2E2D C;  4JI4 L;  4LMQ D;  5D3I B;  4JW0 A;  5KIX A;  3FPP A;  4UHV A;  1HZC A;  1G6Z A;  2JSO A;  2NZH A;  1Q1B A;  2HCC A;  2A68 D;  3W1B A;  1WI5 A;  4JI7 Q;  4CJ0 B;  3UE1 A;  3KLS X;  1I4R A;  2IL8 A;  1RDP D;  2HIV A;  2QA4 A;  3M3Y B;  3PUV A;  2JQO A;  4IJH A;  1WFQ A;  1VS0 A;  2EXZ A;  3FDT A;  5J3B A;  1EFW A;  1M8A A;  4RFB A;  2H4O A;  3KOJ A;  1YI2 A;  1CHQ D;  3TSS A;  4RKL A;  2O5I C;  3PSI A;  3UDF A;  4EQN A;  4DXF A;  1H9S A;  4CKE A;  4KHV A;  1PH1 A;  4DUY Q;  1U5K A;  2R93 H;  2PW5 A;  3KDF A;  2ENB A;  3RUZ A;  2B2V C;  4JG2 A;  3HOX H;  4EGV A;  1PH6 A;  4NW2 A;  2Q8I B;  3TRZ A;  3BZK A;  1Y69 U;  2FMM A;  3ZYY X;  1M4V A;  5GQO A;  1A6X A;  4DNR B;  1RCV D;  1SNC A;  5K5P A;  2R61 A;  2BDN A;  4IUR A;  2PPB C;  3T56 B;  3U58 A;  3HKS A;  4H0L C;  1B3A A;  1L1O C;  1TVX A;  4YHH L;  1G8Z D;  2XN9 C;  4NXN Q;  4LFB L;  1VQE A;  1I5F A;  5E4W C;  1PH8 A;  3T53 B;  1HNX L;  3GQB A;  1A8V A;  3JAM E;  2XVS A;  4DV2 Q;  4IUV A;  1TS2 A;  3D3R A;  2A6H C;  2YTV A;  3ND9 A;  1FYC A;  4XQQ A;  3OWE B;  2F0Q A;  4DKA C;  5IYB G;  3F2B A;  2F0K A;  1QNU A;  1NCV A;  2IJ0 A;  3MTS A;  3F2C A;  1STG A;  4ZLT F;  3MXU A;  1CQV A;  4DR2 Q;  1VQG A;  5CGK A;  5FLX E;  1RL2 A;  3RNU A;  2K50 A;  2WV6 D;  2C5C A;  4HN7 A;  3CQZ H;  4JYA L;  4IUQ A;  1MJE A;  2B3G A;  1K83 H;  4PZ7 A;  2GA4 B;  3GTQ B;  2ICI A;  4KY6 A;  3FP9 A;  2VUM G;  3K5N A;  2XWB B;  4OL7 A;  2A19 A;  2DJG C;  4C3I H;  1K8G A;  1PTO F;  2NZ1 D;  4XTC S;  5C4J B;  3HRZ C;  1J6Q A;  2A68 C;  4B08 A;  4Q0F A;  1RHP A;  4YY3 Q;  5C0X G;  4FXK C;  1SAP A;  2K7V A;  3JC6 6;  3RZD B;  2NWG A;  1X55 A;  1JC7 A;  3DLL A;  3E5S A;  3FVQ A;  4LF5 Q;  5EPL A;  3TN2 A;  2MQH A;  5A2Q E;  5DLQ E;  4EQ5 A;  3PQI A;  3HOY G;  4DAY B;  1W6K A;  3W2D A;  4PMB A;  3I7F A;  1RTO A;  5IOC A;  3SGI A;  1WCM G;  4DV1 Q;  1G29 1;  3NWS A;  1G2T A;  1PFS A;  4N8F A;  3GTM B;  1TT2 A;  2YV5 A;  4JI5 Q;  5M9O A;  2JA7 B;  2B2W C;  3D4W A;  1SJE D;  1Q12 A;  4Z9C B;  4JI7 L;  1Q1E A;  2LMC B;  2X69 A;  1NBW A;  2XRS D;  3AQQ A;  1AP0 A;  1CK1 A;  4KD3 A;  3S15 B;  1B1Z A;  3PO2 G;  1PH7 A;  3K7A H;  5C4X B;  3U9O A;  2IPK D;  4C3H G;  1VQ9 A;  1LTR D;  5GRO A;  1Y1V H;  1WVL A;  3HOV H;  4A3M G;  4WOR A;  4A3E H;  3KBG A;  3S14 H;  1AN8 A;  2YTY A;  5IYB H;  4LFA L;  3V96 A;  3C2P A;  2NVQ B;  1QUQ B;  1RF2 D;  5I2X A;  2A6E C;  2K14 A;  4B3T L;  4O1N A;  2F0J A;  1QB5 D;  2F03 A;  4AQY L;  1LTS D;  3I91 A;  2I07 B;  3WWV A;  5T1G A;  1G91 A;  3VR4 A;  4JI0 L;  1JWM D;  3FRP B;  2N8N A;  4DR4 L;  1EU3 A;  1EYG A;  4R8I A;  1X65 A;  2L12 A;  3PIO 3;  2NYZ D;  4DR1 L;  1NNX A;  2V4D A;  1R4P B;  4YWL A;  3K7U C;  3M4Y A;  1SYG A;  2VS1 A;  4A3L G;  3BVM A;  1G2S A;  1CT1 D;  1YJ9 A;  2EJF C;  4RGT A;  1E3P A;  4XT1 B;  1JR0 D;  5I9O A;  1ENA A;  1S5F D;  4C2M H;  1EY5 A;  4R4T A;  3KF6 B;  4EQO A;  1SE4 A;  3L9A X;  5EPJ A;  1V8Q A;  1EQV A;  1DON A;  4NB3 A;  4C3J H;  5JEA G;  1FGU A;  3RZD H;  4DN4 M;  4FXD A;  2F0W A;  1K8O A;  3KLS A;  5IP7 H;  2OWO A;  3PO2 H;  2XIW A;  3WOE A;  2CCZ A;  3DWQ A;  3Q23 A;  3PV0 A;  2NBF A;  1XNR Q;  3UDX A;  3CME A;  5KNB A;  3A55 A;  5C3E G;  2WFW A;  1VQB A;  4BY7 H;  3AU7 A;  2QKI C;  4JI2 Q;  4WJ3 M;  4GOP A;  2HD3 A;  1EIY B;  4HIK A;  3S16 B;  1JT8 A;  3OMG A;  1FR3 A;  2EY6 A;  4OIK A;  4X3S A;  4L5R C;  3IAY A;  2ZTE A;  1JB3 A;  4HED A;  4ILW A;  2WB1 B;  5C44 B;  3STB C;  1PXU A;  2R92 G;  1LM0 A;  3EIV A;  1EYD A;  2EYO A;  4A4I A;  1FNU A;  5M3M B;  2HT1 A;  4A3I B;  4EVO A;  5COR A;  4P75 A;  1DZ1 A;  4A75 A;  3K5M A;  4X66 L;  1L0X B;  1NE3 A;  5DEH A;  1LAC A;  1TY2 A;  1LTT D;  4R4Q A;  3U4V A;  2Z0S A;  1J5E L;  2E5L L;  2CHB D;  1FD7 D;  5CV6 A;  1SYD A;  1A3V A;  3ERS X;  4GNX C;  1TWH H;  1HZA A;  5IGG A;  2K5N A;  1D5X C;  1HA6 A;  1VQC A;  4A3J G;  1VQF A;  4KKT A;  1B50 A;  1E7Z A;  2H1E A;  3PF4 A;  3D4D A;  1I4H A;  2KVM A;  4ME5 A;  1S4Z A;  2F0F A;  3A0J A;  3I4N H;  3P20 A;  4KY5 A;  2RQX A;  2WAQ B;  1ENF A;  3STB D;  1TU2 B;  4CJ1 B;  4A3F H;  1EWC A;  1SE2 A;  1EL0 A;  1JOQ A;  1K3R A;  1TR5 A;  1BF4 A;  1IW7 D;  4V0B A;  3SE0 A;  5AJ3 Q;  1PH2 A;  1LTI D;  3J80 E;  3MXP A;  1MI2 A;  1HXY D;  4F88 A;  2KA7 A;  3MXG A;  2KUM A;  4GKK L;  1VF7 A;  4P2C B;  1L0Y B;  2CWP A;  1SJH D;  1GVP A;  1NTG A;  3WDN A;  4OX9 Q;  4M1U B;  3Q6S A;  4A3K G;  1JQY D;  4GN4 B;  4UP8 A;  1TS4 A;  2R92 H;  4JYA Q;  1N33 L;  2UUB L;  1BO0 A;  1A15 A;  3H09 A;  2DNE A;  1LUZ A;  2N3S A;  3T1H Q;  2BA0 A;  3SEB A;  1AW7 A;  3NSW A;  2JA5 H;  1VQL A;  5CR3 A;  2B39 A;  4IZ8 A;  4BS9 A;  1VQI A;  3CU7 A;  4QJF A;  2B2U A;  1A3T A;  1BCP C;  5G3L F;  5EKL A;  4BBR G;  1E1T A;  4BY1 B;  1AZP A;  1WD0 A;  3S1Q H;  2Z6B A;  1YHQ A;  1GXD C;  1XMO L;  2D2C C;  2KCN A;  3HOW H;  1DD2 A;  1IXR A;  1W3S A;  2IHE A;  2AMC B;  3ERQ A;  4PQX A;  1EU4 A;  4LUO A;  1JOO A;  5CMD A;  5C4J H;  1RD9 D;  2L55 A;  1JCK B;  3D8G A;  3BDL A;  2DJF C;  2F4V L;  4BXX H;  4MIU A;  1VQK A;  3VR2 A;  5E1F A;  4KHP Q;  2OEO A;  1A3U A;  3VR5 A;  2NN6 G;  3UI2 A;  1FNV A;  5D3D A;  1B3Q A;  4O42 A;  5FO8 B;  2K04 A;  3OTO L;  1QWY A;  4C56 C;  4DUY L;  4RGO S;  4L5S A;  3S2D H;  4PNY A;  5KND A;  5M3F B;  5JJZ A;  5CBE E;  3PIP A;  1Q90 A;  1V1P A;  2ZT9 C;  2ZTC A;  4GLV B;  1PTO C;  4JVZ A;  2B63 G;  2ZM6 L;  1A2T A;  1IYJ B;  2EYH A;  2UUA Q;  2OQK A;  2QW7 A;  4OEL B;  1TWA B;  2B29 A;  1Q82 C;  1F2Z A;  1LAB A;  4LF6 Q;  4QMG A;  5FJ8 G;  1SE3 A;  4WFN 3;  3S1N H;  1YNX A;  2EVB A;  2I46 A;  2J7Z A;  1GUS A;  1SSO A;  2JK8 A;  4JI8 L;  1JMC A;  3H3V I;  3KYH C;  2DY8 A;  4LF5 L;  3IKJ A;  2LXK A;  3GD7 A;  4TKO B;  4K6L A;  1TKW B;  1EIG A;  5FLX c;  3NEL A;  1TWC B;  4OO1 I;  1TWG H;  1XYI A;  4YY3 L;  4ZK9 B;  4KN4 C;  1F9Q A;  1LT6 D;  2PNH A;  1E24 A;  5ELO A;  2IX0 A;  1XNQ Q;  1Z47 A;  1H9R A;  3L0O A;  4XXE A;  1PYW D;  4ALP A;  4DV7 L;  1RKN A;  2YYZ A;  4HCS A;  3PF5 A;  4NDX A;  5GAH C;  4J8Q A;  2UXC L;  5C0X I;  1HNZ Q;  4DR7 Q;  4K0K Q;  3KJO A;  3MEF A;  2A73 B;  2B2T A;  2EYL A;  1UAP A;  3K6O A;  2OQ0 A;  2B2Y A;  3ULL A;  2NN6 I;  1I3Q H;  5KYI A;  2QGQ A;  1C48 A;  2A1A A;  2D0O A;  2RDH A;  5C0X H;  3I3C A;  1S40 A;  3BVG A;  5K36 G;  4DUZ Q;  4K5X A;  4G7O C;  2UXD L;  1JIC A;  2UUB Q;  2HQL A;  3O13 A;  3P75 A;  4L5Q A;  1U9R A;  4DPG A;  4EX5 A;  1LLR D;  3H6M A;  1D2B A;  3CRL C;  2WKD A;  4C3I G;  4NXN L;  1LYL A;  3OSO A;  3NEN A;  2VNU D;  2E8G A;  2JA6 B;  4GKK Q;  3W5O A;  3HOZ G;  2AUK A;  4BA2 I;  1WTP A;  4TVA B;  2ZXR A;  4F87 A;  2FXQ A;  5AJ3 L;  4GOP B;  4PZ8 A;  1PZK D;  2EDG A;  1KXL A;  2L1B A;  2D0P A;  3DHQ A;  2WB1 G;  4B3M Q;  3K7A B;  4DNI A;  3J81 c;  1QNK A;  3I4O A;  2OF1 A;  5TSS A;  1B9M A;  3CCL A;  2CFM A;  4ZKB B;  4KTA A;  4UP7 A;  1OO9 B;  4BY1 H;  1XTD A;  1HTP A;  1TWH B;  1PRT F;  1CKN A;  2C9O A;  2F0E A;  3PUY A;  4CDF C;  1VQP A;  2PZU A;  4J15 A;  2CW0 C;  3CPW A;  2I5H A;  5JPM C;  1BQQ T;  1TQO A;  1TY0 A;  3H3V C;  3KUP A;  3UDG A;  5D14 A;  4HIO A;  3GTK B;  4K14 A;  1SMY D;  3AYH B;  4A3G B;  1E2Z A;  1L0W A;  5IWA Q;  3K59 A;  4LUZ A;  3BDO A;  1UNS A;  5ELN A;  3NXW A;  3A8K E;  3CW2 C;  3RN2 A;  1SN8 A;  4LF9 L;  4MHE A;  4NMZ A;  4N9P A;  4QL5 A;  1PTO H;  1OXT A;  1T9H A;  3JAM i;  2JE6 I;  1GM5 A;  1VDZ A;  1IYU A;  1TS5 A;  3FKI G;  4C2M B;  2R93 G;  1MKH A;  1Q8K A;  3J80 i;  3SK8 A;  1WD1 A;  2BCO A;  1N32 L;  1WOC A;  2BE5 D;  4JCV E;  1O78 A;  2VB3 X;  1ZYR D;  1ET9 A;  1JB7 A;  3BZD B;  2ATW A;  1EFI D;  3QO2 A;  1AE2 A;  3NTI A;  3BVZ A;  1PZI D;  1HZ9 A;  4LF7 L;  4PMC A;  4JPB W;  4BA1 I;  4B3R L;  1HFN A;  1P16 A;  5IT9 E;  1I94 Q;  2R7F A;  2Z4I A;  4HSV A;  3QB3 A;  5C4X G;  1MIU A;  2K01 A;  2IWH A;  1BCP F;  4MTN A;  3CCJ A;  2JJQ A;  2VQE L;  2K5D A;  5JOB A;  4FVM A;  4FO2 A;  2XGT A;  4NXM L;  4QQB X;  3ONA B;  2R7Z H;  2BH8 A;  4N8X 1;  1Y1W G;  3U4Z A;  2F0M A;  1X3F A;  3KBX A;  3MZ5 A;  1YNN C;  4G4K A;  4MN3 A;  4DV4 L;  1XXG A;  5IOD A;  1EY6 A;  4BXX G;  2UXB Q;  2D62 A;  2O5J C;  2QF7 A;  1EWI A;  5EJW A;  2RCN A;  1E2V A;  3NBH B;  3H91 A;  4RGM A;  4AIM A;  5JJI A;  3TQY A;  1ZKO A;  1SR3 A;  2FFK B;  4BY7 B;  1SDF A;  2M9V A;  3HOU B;  4OXP A;  2Q2I A;  1F2M A;  2FHT A;  4DR4 Q;  3RR5 A;  4YWK A;  3E3X A;  3H0G B;  4JI0 Q;  5JEA H;  4R1J A;  1GUT A;  1CM9 A;  4OHJ A;  4LFA Q;  3GV3 A;  1GD7 A;  2MO1 A;  3KDF B;  1Y8P B;  2UU9 Q;  2NB0 A;  1JWS D;  2B63 B;  1FJG L;  3R2T A;  5M5Y H;  3CCS A;  2MHV A;  1WCM H;  1HCZ A;  3TME A;  4K5V A;  3R8B A;  3IFT A;  3QJY A;  4KN7 C;  1DM0 B;  4IUN A;  1VQJ A;  1N34 L;  1S5E D;  3TDQ A;  3HFZ B;  3HOY H;  3FHW A;  1KAA A;  3GTK H;  3GDE A;  1D5M C;  1K0R A;  1QCB D;  4KD4 A;  4KKU A;  2EY5 A;  3VDY A;  5CV8 A;  4LW1 A;  2MJ8 A;  2E2J H;  4DV6 Q;  1ICF B;  4KJO A;  4QCL A;  4DV5 L;  2LS0 1;  1YHA A;  2R92 B;  3URY A;  1IKM A;  4P73 A;  2ZXP A;  1JOK A;  5BN3 A;  1H9S B;  2R3Z A;  2XNA C;  4UPA A;  2RSO A;  4JI1 L;  3HKZ B;  3GTL H;  2MUY A;  4I7Z C;  2LY7 A;  1ZEQ X;  1EQT A;  1YIT A;  4KV6 A;  2Z8L A;  1HNW Q;  2F0S A;  1UE7 A;  2NVY B;  4DK3 C;  5IT9 c;  5EKI A;  5LMU L;  2I0Q A;  3GTJ B;  1V43 A;  4KK7 A;  5HUR A;  3KJP A;  3GTJ H;  2CKZ B;  4QUC A;  1GKH A;  3U50 C;  5IYC H;  2K05 A;  4DFA A;  4FP5 D;  2DNC A;  1K28 A;  5KRU A;  2DY7 A;  1F9S A;  1H9K A;  1QZH A;  1Q81 C;  4V19 0;  4DK0 A;  4QIW E;  3CP0 A;  2A5H A;  2JXM B;  3PCO B;  3S16 H;  1ROD A;  3J80 L;  3OOC A;  4K2L A;  1NR2 A;  1I50 H;  5COY A;  1PH9 A;  3GTO B;  1KTK A;  1AEX A;  3A7L A;  3IL8 A;  5A35 A;  4XT3 B;  1F9R A;  1EOV A;  2E75 C;  4LWC A;  5IGB A;  3DEO A;  2PW7 A;  4JI8 Q;  1EUJ A;  4KJN A;  4DV0 Q;  3C3L A;  1H95 A;  1EQR A;  1WTX A;  5G3L D;  4IPH A;  5AFW A;  3CCV A;  3NTK A;  4MZ9 A;  2HCI A;  3S1Q B;  2EE1 A;  4DV5 Q;  1LT5 D;  1X3G A;  1STB A;  1JJG A;  3E0E A;  3ND8 A;  1SLJ A;  3HOZ H;  5FLX L;  1FVI A;  3FMC A;  4IN3 A;  2E74 C;  2KHS A;  3HOZ B;  1FNW A;  1N36 L;  3VYU A;  5DNF A;  1NR4 A;  2B8F A;  1YJN A;  3NBI A;  2F0T A;  1MHW C;  1LT4 D;  4P74 A;  2VW9 A;  2ZJR A;  2F0O A;  4JK1 C;  3PGZ A;  3H0G H;  1CKO A;  4TRD A;  5C3W A;  4PZ6 A;  1EWH A;  1QVC A;  1IW7 C;  1QE6 A;  4O0A A;  2GN5 A;  2UU9 L;  3J81 j;  5GAD C;  2ZXO A;  4LFC L;  3G4S A;  2HIX A;  3S2D B;  4RH6 A;  3EQL C;  3HOU H;  1K83 B;  1U4M A;  2F4V Q;  3I56 A;  2EZV A;  4RGN A;  3CKI B;  5FO9 B;  1X56 A;  2HDM A;  1SNM A;  1I4Q A;  1SRU A;  4RCN A;  3P1H A;  3V2T A;  4JC0 A;  3KFU A;  4A93 B;  4NP5 A;  1H9J A;  1LTL A;  3LNN A;  4FF4 A;  3M3Y H;  3W3A A;  3S2H H;  5LL6 X;  1CA6 A;  1TWA H;  5C6A A;  5FLM G;  1IL8 A;  4HJA A;  3M4P A;  1BR9 A;  3M9B A;  3ULJ A;  5IE8 A;  3P7J A;  4UDU C;  1GJX A;  1VQ4 A;  3RLF A;  2B2Y C;  2QDL A;  1MJC A;  1WTR A;  2NVX B;  2UXB L;  4YIJ A;  1ET6 A;  3A54 A;  4DV4 Q;  1BKB A;  3OYY A;  1HQM C;  3Q24 A;  5A2Q L;  4DR5 L;  4XYQ A;  1TXY A;  5CYU A;  5IGF A;  1B8A A;  1J9O A;  3U9S A;  1PV4 A;  1GHJ A;  4RAU C;  1PDQ A;  2Z9H A;  1C4Q A;  2CQO A;  1SYB A;  2VQE Q;  3S9W A;  3S14 B;  2OCE A;  1C7Y A;  3J7Z C;  1Y8N B;  3TP5 A;  3MXN A;  2L9H A;  4J6H A;  4OX9 L;  2M00 A;  2ASB A;  5C5M A;  3C1E A;  4FNF A;  1QZG A;  1ESF A;  5K36 H;  4UAI A;  1SYC A;  4IPG A;  2E76 C;  2RBM A;  1PFM A;  4RG1 A;  4DR3 Q;  4A93 H;  2LKV A;  1JE4 A;  2E2I B;  1M1K C;  5FKA C;  1BBU A;  1EZ6 A;  1JJ2 A;  2XWJ B;  5KEE A;  2QEJ C;  5LMU Q;  4IFD G;  1WYD A;  3HG9 A;  4PMW A;  1C9O A;  4AYB B;  5GAE C;  4F8M A;  3VR3 A;  4FXG C;  1UEA B;  4X64 L;  2TSS A;  5E3F A;  1IBK L;  2ZTD A;  4X65 Q;  3BS1 A;  3H15 A;  2BE5 C;  1V1P B;  2Q8R E;  2HDL A;  5IGD A;  4ZAI A;  2R93 B;  1T5E A;  2A69 D;  1XTC D;  2OTL A;  3G71 A;  1CSP A;  3Q0A A;  1WTO A;  1VQO A;  3M4Q A;  4K8J A;  1Z6H A;  2VQF L;  1PVO A;  5BR8 L;  3JAM L;  4RHS A;  3I90 A;  2WAQ E;  2NTS A;  1HZB A;  5IWA L;  1YVC A;  1KNE A;  3NWT A;  4JI3 Q;  3HEJ A;  2MNA A;  2QDB A;  1QOH A;  4K5W A;  2X6L A;  4WJ4 A;  4R4C A;  4RKB A;  2RVL A;  3B6Y A;  5H1S E;  1FJG Q;  3G48 A;  1PTO B;  1BCP B;  5ELB A;  1HH2 P;  1IBL Q;  3I2Z A;  1CSQ A;  2B2T C;  3NQT A;  2IX3 A;  3C1F A;  2VXW A;  1KHI A;  2DUD A;  3LWU A;  5C44 H;  4GNX B;  2JA7 H;  1YBY A;  4ZYS A;  4ABN A;  3TP8 A;  2PI2 A;  3EA6 A;  1WJJ A;  4A3D G;  4IOC A;  3GTM H;  1BNZ A;  1BUV T;  3I4M B;  4A3L H;  1HUN A;  2YU9 H;  1CZG A;  1UEB A;  4DGZ A;  4U68 A;  4ID6 A;  1SYF A;  3LWE A;  1GUN A;  4LF8 L;  2NN6 H;  1DCZ A;  4L6T B;  4BY1 G;  1PH3 A;  5BR8 Q;  4A3E B;  4IFD H;  3N6R A;  3L3O C;  4I65 A;  3VA5 A;  5CV4 A;  3QG1 A;  3QR8 A;  3W1G A;  3M7G A;  1A2U A;  1ESR A;  1D7Q A;  2B2W A;  4UP9 A;  1II3 A;  3VR6 A;  1KC8 C;  4GS3 A;  2K5W A;  3JAM c;  3GTL B;  5IYD H;  1L1O A;  3Q8D A;  5M3M G;  1ASY A;  3VA7 A;  2L11 A;  5EBD A;  3S17 H;  4ME3 A;  1HFG A;  2UXC Q;  3J7A F;  1SNO A;  1HUM A;  1FL0 A;  3L2P A;  1HPC A;  4B3R Q;  2L5T A;  3SVM A;  1LO5 D;  2KEN A;  4A3B B;  3HOW B;  1DJR D;  2EQS A;  3FKI B;  2RA4 A;  3M85 A;  3HP3 A;  3MEH A;  4QB4 A;  2F1M A;  4JI6 Q;  1VCI A;  1PRT B;  2L15 A;  4DF7 A;  1XNQ L;  1BCP D;  5E7N A;  3K5L A;  5C3E B;  3D6C A;  2J4X A;  3TS0 A;  1LTB D;  3DUZ A;  3TP6 A;  4CKC A;  1F77 A;  4A3K H;  1ONL A;  2K1B A;  3D4R A;  1VMP A;  2B63 H;  4JV5 L;  2JEA I;  2SNS A;  3A8I E;  1A0I A;  2EJM A;  1IBL L;  4FDB A;  2PMZ E;  4RA8 A;  2KHJ A;  2HUG A;  5ELE A;  3BYT B;  1BOS A;  1L1O B;  4NPS A;  4WJW A;  1E22 A;  4L8J A;  1Q86 C;  1EY8 A;  4APV A;  4JI3 L;  3PMF A;  1KAB A;  4MTK A;  2OT2 A;  4S3S A;  2Z6K A;  1K3B C;  1X6O A;  4R4I A;  4HID A;  1VQ5 A;  3CQZ B;  3S17 B;  4OWW B;  2F3I A;  5M3F H;  2JA8 B;  3CHB D;  3K80 C;  1PTO D;  4DV3 Q;  3GTQ H;  1CI3 M;  1RIP A;  2QIL A;  3I70 A;  5F2D A;  4A3M H;  3ICE A;  4R8N A;  4Y7N B;  1S3O A;  3LX0 A;  3MHB A;  1HRJ A;  2PCF B;  2PQA B;  2K5Q A;  2KCC A;  3S1R B;  3GTG B;  2WII B;  2HHH L;  4GN3 B;  4OIJ A;  3AMU A;  2F0L A;  3GO5 A;  4X65 L;  3CPF A;  3MFG A;  4TSS A;  5D65 A;  2OTJ A;  3M4O H;  2F0D A;  3G6E A;  3TBI B;  1ML0 D;  3IRB A;  4BBR H;  2LXJ A;  4IPD A;  4B3M L;  4BBR B;  1TWF H;  1BVS A;  1EYC A;  4LFC Q;  1PH5 A;  4KHP L;  2BA1 A;  4K6D A;  2E2H B;  1YZ6 A;  2JYO A;  1M90 C;  4IUU A;  3AB9 A;  2VZA A;  2ALY B;  1V1O A;  1UWV A;  5IP9 G;  3EN2 A;  5JVH 3;  1QVF A;  5LMN Q;  2KOL A;  1O7Y A;  1XMO Q;  2JA8 H;  1D6E C;  1HQR D;  1L2F A;  1YJW A;  1HJP A;  1Y1V B;  3A5U A;  1W2B A;  1CA5 A;  4HTH A;  4ZRZ A;  4DR5 Q;  3KLR A;  3BJU A;  4DR2 L;  1IYV A;  4CDC C;  4IO9 A;  2RDG A;  1WTV A;  3EVQ A;  1IL2 A;  1S5C D;  4GNX A;  3E0J A;  5C3E H;  2JEB I;  5IGC A;  3HOX G;  2B8G A;  1LTA D;  1NSN S;  2WB1 E;  1O7L A;  3DM3 A;  1G6P A;  4DV2 L;  3CXC A;  3D6W A;  4P71 A;  5NUC A;  1D1K A;  3OIQ A;  2RCF A;  1HNX Q;  5LMN L;  2M2L A;  4LFB Q;  3DWP A;  1VQ6 A;  1XMQ Q;  2G9H D;  3ER0 A;  3CAM A;  4HMI A;  3SK4 A;  3RLN A;  2G9D A;  5J22 A;  5M5X H;  4OWT B;  1KDA A;  2CVR A;  4TQU S;  2AWN A;  1XPU A;  4JOI C;  3J7A 5;  2IW3 A;  5CV9 A;  4GLX A;  5FJ8 H;  4YCU A;  1STY A;  3QIA A;  4YWM A;  2FIN B;  3RD4 A;  1NUC A;  1IKL A;  2K28 A;  4BBS B;  1Y14 B;  2P5Z X;  1DXM A;  1YNJ C;  5M5Y B;  1EY4 A;  2A8V A;  3HZX A;  1PH4 A;  1SFO B;  2EOT A;  1A62 A;  3CCE A;  2Z1C A;  2EXD A;  1UE1 A;  2JA7 G;  1RTN A;  3X3M A;  4LF6 L;  5I9P A;  3K58 A;  4DV3 L;  2D5D A;  1KLG D;  3GP7 A;  1J5E Q;  3T4A C;  1I4X A;  2N88 A;  3K81 C;  4FF3 A;  4DAM A;  1SYE A;  3EBE A;  3NUC A;  4BBS H;  1X3E A;  4XIG S;  1I6H B;  1X9N A;  2A6E D;  3ULP A;  3SHL A;  2VB2 X;  4HJ7 A;  2PZW A;  5EAY A;  4G57 A;  4DV0 L;  2MPM A;  1PYS B;  1YNN D;  3ZJY C;  3J81 i;  5LMN W;  3NQI A;  3MFY A;  3PIO A;  2BH2 A;  4JI4 Q;  4XQN A;  1QVG A;  3E9I A;  4R9W A;  3GTP H;  1HTL D;  2NVY H;  4KKS A;  2VY3 A;  2L0C A;  4DNT B;  2XTI A;  2K75 A;  1TWF B;  5CC4 A;  1XWE A;  2F0P A;  5FO7 B;  2RHQ B;  3PUZ A;  2ICE C;  3S1R H;  4JI6 L;  1Y1W B;  3IFD A;  3TZD A;  3S2H B;  1HHV A;  3S1N B;  5DM7 3;  5HGT A;  2F0H A;  5FLM H;  4A3M B;  1XMQ L;  1CZW A;  2F3V A;  5CV5 A;  4IJL A;  4ZUJ A;  2KJX A;  2F52 A;  4M8A A;  1U4R A;  1NAP A;  1HNW L;  5CV7 A;  1MBY A;  2O4X A;  3KF8 B;  1EYA A;  2J0T D;  5J1Z A;  4ULL A;  1DOM A;  1TWG B;  5IGE A;  3RZO B;  1CHP D;  3ERO A;  2KBN A;  3CCM A;  1KAW A;  4K8I A;  3I4L A;  4B3S L;  2NUC A;  4XYO A;  3HOU G;  3CC2 A;  4HCE A;  5IY0 A;  1I4G A;  1EY9 A;  4L5T A;  3CCQ A;  2EYM A;  4YCW A;  2Y0S E;  4A93 G;  4ZCK A;  1Q3L A; 
#chains in the Genus database with same CATH homology
 3SK5 A;  1STE A;  1D1I A;  1TII D;  2PYK A;  1T5X D;  1HA5 A;  3T13 A;  1U4P A;  3DWA A;  2EY1 A;  3X3N A;  5C5L A;  3S1M B;  3PO3 B;  1SNQ A;  4ZQ3 A;  3NP8 A;  4ODG A;  3OPO A;  3I72 A;  1WTQ A;  4C3I B;  1Q8I A;  1Y8O B;  2A74 C;  5ELD A;  1GHK A;  4JBW A;  3DXJ C;  2YU9 B;  4C3J G;  4KHZ A;  2EYJ A;  1QIL A;  5JVG 3;  4H13 C;  2NTT A;  1OXV A;  4BWG B;  4G7H C;  2WIN B;  3EJI A;  2RSN A;  2K32 A;  1KDC A;  5LHY 1;  4OO1 H;  3QWN A;  1F2L A;  3J7Y W;  1JOR A;  5EGT A;  2B2U C;  2PMZ B;  1UUP A;  3BDC A;  1EZ8 A;  1B53 A;  1F9P A;  1W6J A;  2Q8T A;  2KED A;  4LJZ C;  3OIP A;  1MD2 D;  2SEB D;  4DAY A;  4A3J B;  4Q5V A;  3FPU B;  5JEA J;  3GTP B;  3VYR A;  4HSP A;  1BBX C;  1I3Q B;  4K2K A;  4OO1 G;  1LV9 A;  1SMY C;  1PFN A;  4WRD A;  3GV6 A;  2EPB A;  2RKS A;  2CW0 D;  3VYS A;  3RMH A;  3PIP 3;  4X3K A;  1F2Y A;  5EPK A;  4IUT A;  5DAU A;  5FK9 C;  1QJO A;  1SND A;  5C4H A;  4XDX A;  5E4X A;  3BYY B;  4X3U A;  2SNM A;  4IFD I;  4KMU C;  1BDO A;  2R7Z B;  1S5D D;  4H44 C;  2R6G A;  3T16 A;  1CFM A;  5IIF A;  4J1M A;  4G7Z C;  4IAL A;  4FF1 A;  3A7A B;  3QOJ A;  4KI0 A;  1WTW A;  2EYP A;  2E2J B;  4DAV A;  2EY2 A;  2AQ3 B;  1LT3 D;  2EYF A;  4CBV A;  1GOZ A;  1ZYR C;  1KNA A;  1DOK A;  3OWF A;  1PRT C;  4PV1 C;  3SR1 A;  3SXH A;  3H94 A;  1CTM A;  5M5W B;  3DEP A;  3TZU A;  1PFB A;  4C1N I;  2JA5 B;  4CHT B;  4N9T A;  3R2I A;  3J81 E;  2WAC A;  3VYT A;  1SXT A;  2KQ3 A;  3I73 A;  2PO4 A;  4KY7 A;  2PNR C;  3MA2 B;  4HR7 B;  2SDF A;  1H9M A;  4QIW B;  4A3F B;  2Z4H A;  3R93 A;  4GZY C;  4E6I A;  5EKK A;  1R9T B;  3K0Y A;  1PRT D;  2KEC A;  1VF5 C;  3MVV A;  5C3X A;  1VMC A;  1PZJ D;  2A6H D;  5BN5 A;  4RCO A;  3K57 A;  3NK9 A;  1O80 A;  3DM1 A;  3KK7 A;  3HS0 C;  3I8Z A;  3SK6 A;  2F0V A;  1S5B D;  3K5O A;  4IUP A;  4FF2 A;  3TP7 A;  1EY7 A;  1I50 B;  1O7Z A;  3QOL A;  1I4P A;  4C1N K;  3PUW A;  4ZUI A;  3FEW X;  4LK1 C;  4XQJ A;  4U67 3;  1IHZ A;  3CRK C;  1DYQ A;  1SEB D;  2CQA A;  1QG7 A;  4EQP A;  2WP8 J;  2AQ2 B;  4RHR A;  4C3H B;  3T51 B;  3J81 L;  4A3K B;  1B44 D;  2IT1 A;  5ELF A;  5ISR A;  1ICW A;  3Q22 A;  3NE5 B;  4A3D B;  5EQ0 A;  2K33 A;  1R4Q B;  4RWS C;  1AFP A;  1OXS C;  2D9U A;  1KDB A;  3MC0 B;  3BG3 A;  2A69 C;  3HOX B;  1I6V C;  1B4O A;  4QF4 A;  3EFX D;  5J39 A;  2SOB A;  1X32 A;  2VUM B;  1GUO A;  1EIH A;  2O2L D;  4OGQ C;  5T1I A;  1C8C A;  3PUX A;  1BXT A;  5FOB B;  1EEI D;  2BOS A;  3D31 A;  5I6Y A;  3I4N B;  1TS3 A;  4H7B A;  2TMP A;  4DK1 A;  1STH A;  5BN4 A;  3HOY B;  4ZKC B;  4C3J B;  2X6G A;  1KLU D;  2DN8 A;  1WCM B;  4QUF A;  5LL6 S;  3DMU A;  2HQE A;  3MAQ A;  1MSH A;  2F0N A;  4LAA A;  5C4Z A;  5I6W A;  2AWO A;  3WOF A;  2PZT A;  1GUW A;  5KGU A;  1J8I A;  1MSG A;  3KF8 A;  1U4L A;  2Y0S B;  2F0I A;  1OXX K;  1B2T A;  3N52 A;  3OHX C;  1ENC A;  4B9W A;  4CJ2 C;  4HMJ A;  2N55 A;  1OXU A;  5JPN C;  1LTG D;  1EEF D;  3A56 A;  2F3W A;  5CBA E;  2L4N A;  1Z7T A;  4CKB A;  3C46 A;  1PMR A;  1XX8 A;  4FYD A;  1X3Q A;  1B9N A;  2K6A A;  5ELC A;  2EJG C;  1ILP A;  1SNP A;  4IQZ A;  2XRQ D;  2JP1 A;  1D5Z C;  3F2U A;  3G6J B;  3R3O A;  4L63 B;  2WKC A;  2XSC A;  3HGB A;  2QCP X;  3J7A V;  3E6Z X;  1K8M A;  1PLF A;  3PO2 B;  1E2W A;  4B9X A;  1ZXT A;  2NVT B;  3MWY W;  2ID0 A;  1EY0 A;  2AQ1 B;  1AZQ A;  5KNC A;  1EOT A;  3NTH A;  3L7Z C;  2PQE A;  2MP1 A;  2RDF A;  2AUJ D;  1FGB D;  2B2V A;  2KEE A;  3SDZ A;  5IT9 L;  5KYL A;  1ILQ A;  1X3P A;  4IFD J;  4HAE A;  3HOV B;  2OXP A;  4DAP A;  5DM6 3;  1DOL A;  3V05 A;  4CGY B;  4NKL A;  1JWU D;  1GUG A;  2F0U A;  4F7X A;  2FMC A;  4DXG A;  3M7N A;  1YNJ D;  5JAV A;  5EBC A;  4X3T A;  2FJ2 A;  2MGS A;  5I2Y A;  3ITP A;  2K03 A;  1E0B A;  3NBH A;  1CQF A;  3A8J E;  3G7L A;  3NPP A;  4DA2 A;  1STN A;  5M5X B;  2F0G A;  2IX1 A;  5I4D A;  2F4I A;  5C0X J;  3M4O B;  2LFN A;  4DU9 A;  2BDO A;  3OW7 A;  3NHH A;  3OMC A;  1MGS A;  1RJT A;  1SBB B;  1STA A;  2E2D C;  4LMQ D;  5D3I B;  5KIX A;  3FPP A;  1G6Z A;  2JSO A;  1Q1B A;  2HCC A;  2A68 D;  4CJ0 B;  3KLS X;  1I4R A;  2IL8 A;  1RDP D;  3M3Y B;  3PUV A;  2EXZ A;  3FDT A;  1M8A A;  4RFB A;  2H4O A;  1CHQ D;  3TSS A;  4RKL A;  2O5I C;  4EQN A;  4DXF A;  1H9S A;  4CKE A;  4KHV A;  2PW5 A;  2ENB A;  3RUZ A;  2B2V C;  4EGV A;  4NW2 A;  2Q8I B;  1Y69 U;  2FMM A;  3ZYY X;  1M4V A;  1A6X A;  4DNR B;  1RCV D;  1SNC A;  5K5P A;  2R61 A;  2BDN A;  4IUR A;  2PPB C;  3T56 B;  4H0L C;  1B3A A;  1TVX A;  1G8Z D;  2XN9 C;  5E4W C;  3T53 B;  3GQB A;  3JAM E;  2XVS A;  4IUV A;  1TS2 A;  3D3R A;  2A6H C;  3ND9 A;  1FYC A;  4XQQ A;  3OWE B;  2F0Q A;  2F0K A;  1QNU A;  1NCV A;  2IJ0 A;  3MTS A;  1STG A;  4ZLT F;  3MXU A;  1CQV A;  5CGK A;  5FLX E;  2WV6 D;  2C5C A;  4HN7 A;  4IUQ A;  2GA4 B;  3GTQ B;  2ICI A;  4KY6 A;  3K5N A;  2XWB B;  4OL7 A;  1PTO F;  2NZ1 D;  4XTC S;  5C4J B;  3HRZ C;  2A68 C;  4B08 A;  4Q0F A;  1RHP A;  5C0X G;  4FXK C;  1SAP A;  2K7V A;  3RZD B;  2NWG A;  1JC7 A;  3E5S A;  3FVQ A;  5EPL A;  3TN2 A;  5A2Q E;  1W6K A;  3W2D A;  4PMB A;  1RTO A;  5IOC A;  1G29 1;  3NWS A;  1G2T A;  3GTM B;  1TT2 A;  5M9O A;  2JA7 B;  2B2W C;  3D4W A;  1SJE D;  1Q12 A;  4Z9C B;  1Q1E A;  2LMC B;  2X69 A;  2XRS D;  1AP0 A;  1CK1 A;  4KD3 A;  3S15 B;  1B1Z A;  5C4X B;  3U9O A;  2IPK D;  4C3H G;  1LTR D;  1WVL A;  4WOR A;  3KBG A;  1AN8 A;  3V96 A;  3C2P A;  2NVQ B;  1RF2 D;  5I2X A;  2A6E C;  4O1N A;  2F0J A;  1QB5 D;  2F03 A;  1LTS D;  3I91 A;  2I07 B;  1G91 A;  5T1G A;  3VR4 A;  1JWM D;  3FRP B;  1EU3 A;  4R8I A;  2L12 A;  3PIO 3;  2NYZ D;  2V4D A;  1R4P B;  3M4Y A;  1SYG A;  3BVM A;  1G2S A;  1CT1 D;  2EJF C;  4RGT A;  4XT1 B;  1JR0 D;  5I9O A;  1ENA A;  1S5F D;  1EY5 A;  4EQO A;  1SE4 A;  3L9A X;  5EPJ A;  1V8Q A;  1EQV A;  1DON A;  5JEA G;  4DN4 M;  4FXD A;  2F0W A;  1K8O A;  3KLS A;  2XIW A;  3WOE A;  3DWQ A;  3Q23 A;  3PV0 A;  2NBF A;  5KNB A;  3A55 A;  3AU7 A;  2QKI C;  3S16 B;  3OMG A;  1FR3 A;  2EY6 A;  4OIK A;  4X3S A;  3IAY A;  1JB3 A;  4HED A;  4ILW A;  2WB1 B;  5C44 B;  1PXU A;  1EYD A;  2EYO A;  1FNU A;  5M3M B;  4A3I B;  4EVO A;  5COR A;  1DZ1 A;  3K5M A;  1L0X B;  5DEH A;  1LAC A;  1TY2 A;  1LTT D;  2CHB D;  1FD7 D;  5CV6 A;  1SYD A;  1A3V A;  5IGG A;  1D5X C;  1HA6 A;  4KKT A;  1B50 A;  2H1E A;  3D4D A;  1I4H A;  2KVM A;  4ME5 A;  1S4Z A;  2F0F A;  3P20 A;  4KY5 A;  2RQX A;  2WAQ B;  1ENF A;  1TU2 B;  4CJ1 B;  1EWC A;  1SE2 A;  1EL0 A;  1JOQ A;  1TR5 A;  1BF4 A;  1IW7 D;  4V0B A;  3SE0 A;  1LTI D;  3J80 E;  3MXP A;  1MI2 A;  1HXY D;  4F88 A;  2KA7 A;  3MXG A;  2KUM A;  1VF7 A;  4P2C B;  1L0Y B;  1SJH D;  3WDN A;  4M1U B;  3Q6S A;  1JQY D;  1TS4 A;  1BO0 A;  1A15 A;  3H09 A;  2DNE A;  2BA0 A;  3SEB A;  1AW7 A;  3NSW A;  5CR3 A;  2B39 A;  4IZ8 A;  4BS9 A;  3CU7 A;  2B2U A;  1A3T A;  1BCP C;  5G3L F;  5EKL A;  4BY1 B;  1AZP A;  1WD0 A;  1GXD C;  2D2C C;  2KCN A;  1DD2 A;  3ERQ A;  4PQX A;  1EU4 A;  1JOO A;  5CMD A;  1RD9 D;  2L55 A;  1JCK B;  3D8G A;  3BDL A;  4MIU A;  3VR2 A;  5E1F A;  2OEO A;  1A3U A;  3VR5 A;  2NN6 G;  3UI2 A;  1FNV A;  5D3D A;  4O42 A;  5FO8 B;  2K04 A;  1QWY A;  4C56 C;  4RGO S;  4PNY A;  5KND A;  5M3F B;  5JJZ A;  5CBE E;  1Q90 A;  1V1P A;  2ZT9 C;  1PTO C;  1A2T A;  2EYH A;  1TWA B;  1F2Z A;  1LAB A;  4QMG A;  1SE3 A;  4WFN 3;  2EVB A;  2I46 A;  2J7Z A;  1GUS A;  1SSO A;  2DY8 A;  3IKJ A;  3GD7 A;  4TKO B;  4K6L A;  1TKW B;  1EIG A;  1TWC B;  4OO1 I;  1XYI A;  4ZK9 B;  4KN4 C;  1F9Q A;  1LT6 D;  2IX0 A;  1Z47 A;  1H9R A;  4XXE A;  1PYW D;  1RKN A;  2YYZ A;  4HCS A;  4NDX A;  4J8Q A;  5C0X I;  2A73 B;  2B2T A;  2EYL A;  1UAP A;  3K6O A;  2B2Y A;  2NN6 I;  5KYI A;  1C48 A;  5C0X H;  2RDH A;  3I3C A;  3BVG A;  5K36 G;  4K5X A;  4G7O C;  1JIC A;  3O13 A;  3P75 A;  1D2B A;  1U9R A;  1LLR D;  3H6M A;  3CRL C;  2WKD A;  4C3I G;  3OSO A;  2VNU D;  2JA6 B;  4BA2 I;  2AUK A;  1WTP A;  2ZXR A;  4F87 A;  1PZK D;  2EDG A;  2L1B A;  3DHQ A;  3K7A B;  1QNK A;  2OF1 A;  5TSS A;  1B9M A;  4ZKB B;  4KTA A;  1OO9 B;  1HTP A;  1TWH B;  1PRT F;  2C9O A;  2F0E A;  3PUY A;  2PZU A;  2CW0 C;  5JPM C;  1BQQ T;  1TY0 A;  1TQO A;  3H3V C;  3KUP A;  5D14 A;  3GTK B;  4K14 A;  1SMY D;  4A3G B;  1E2Z A;  3K59 A;  3BDO A;  1UNS A;  3A8K E;  3NXW A;  4MHE A;  4NMZ A;  4N9P A;  1PTO H;  1OXT A;  2JE6 I;  1VDZ A;  1IYU A;  1TS5 A;  4C2M B;  3SK8 A;  1WD1 A;  2BCO A;  2BE5 D;  1O78 A;  2VB3 X;  1ZYR D;  1ET9 A;  3BZD B;  1EFI D;  3QO2 A;  3NTI A;  3BVZ A;  1PZI D;  4PMC A;  4BA1 I;  1HFN A;  5IT9 E;  2Z4I A;  4HSV A;  3QB3 A;  2K01 A;  2IWH A;  1BCP F;  2K5D A;  5JOB A;  4FVM A;  4FO2 A;  3ONA B;  2F0M A;  3KBX A;  3MZ5 A;  1YNN C;  4G4K A;  4MN3 A;  1XXG A;  5IOD A;  1EY6 A;  2D62 A;  2O5J C;  2QF7 A;  5EJW A;  1E2V A;  3H91 A;  4RGM A;  1ZKO A;  2FFK B;  4BY7 B;  1SDF A;  2M9V A;  3HOU B;  1F2M A;  2FHT A;  3H0G B;  5JEA H;  1GUT A;  1CM9 A;  4OHJ A;  3GV3 A;  1Y8P B;  2NB0 A;  1JWS D;  2B63 B;  3R2T A;  2MHV A;  1HCZ A;  3TME A;  4K5V A;  3R8B A;  3IFT A;  3QJY A;  1DM0 B;  4IUN A;  4KN7 C;  1S5E D;  3TDQ A;  1KAA A;  1D5M C;  1QCB D;  4KD4 A;  4KKU A;  2EY5 A;  5CV8 A;  2MJ8 A;  4QCL A;  4KJO A;  2LS0 1;  2R92 B;  3URY A;  1IKM A;  2ZXP A;  1JOK A;  5BN3 A;  1H9S B;  2R3Z A;  2XNA C;  2RSO A;  3HKZ B;  2MUY A;  4I7Z C;  2LY7 A;  1ZEQ X;  1EQT A;  4KV6 A;  2Z8L A;  2F0S A;  2NVY B;  5EKI A;  3GTJ B;  1V43 A;  4KK7 A;  5HUR A;  4QUC A;  2K05 A;  4DFA A;  4FP5 D;  2DNC A;  5KRU A;  2DY7 A;  1F9S A;  1H9K A;  4V19 0;  4DK0 A;  2A5H A;  2JXM B;  1ROD A;  3J80 L;  3OOC A;  4K2L A;  1NR2 A;  5COY A;  3GTO B;  1KTK A;  1AEX A;  3A7L A;  3IL8 A;  5A35 A;  4XT3 B;  1F9R A;  2E75 C;  5IGB A;  3DEO A;  2PW7 A;  4KJN A;  3C3L A;  1WTX A;  5G3L D;  5AFW A;  3NTK A;  2HCI A;  3S1Q B;  2EE1 A;  1LT5 D;  1STB A;  3ND8 A;  5FLX L;  3FMC A;  4IN3 A;  2E74 C;  2KHS A;  3HOZ B;  1FNW A;  3VYU A;  5DNF A;  1NR4 A;  2B8F A;  3NBI A;  2F0T A;  1LT4 D;  2F0O A;  4JK1 C;  4TRD A;  5C3W A;  1EWH A;  1IW7 C;  1QE6 A;  2ZXO A;  3S2D B;  4RH6 A;  3EQL C;  1K83 B;  1U4M A;  2EZV A;  4RGN A;  3CKI B;  5FO9 B;  2HDM A;  1SNM A;  1I4Q A;  4RCN A;  3P1H A;  3V2T A;  4A93 B;  4NP5 A;  1H9J A;  3LNN A;  4FF4 A;  3W3A A;  5LL6 X;  1CA6 A;  5C6A A;  1IL8 A;  1BR9 A;  3P7J A;  4UDU C;  1GJX A;  3RLF A;  2B2Y C;  1WTR A;  2NVX B;  4YIJ A;  1ET6 A;  3A54 A;  1HQM C;  3Q24 A;  5A2Q L;  4XYQ A;  5CYU A;  5IGF A;  1J9O A;  3U9S A;  1GHJ A;  4RAU C;  1PDQ A;  1C4Q A;  1SYB A;  3S9W A;  3S14 B;  1Y8N B;  3TP5 A;  3MXN A;  2L9H A;  4J6H A;  2M00 A;  5C5M A;  3C1E A;  4FNF A;  1ESF A;  5K36 H;  4UAI A;  1SYC A;  2E76 C;  2RBM A;  1PFM A;  2LKV A;  1JE4 A;  2E2I B;  5FKA C;  1EZ6 A;  2XWJ B;  5KEE A;  2QEJ C;  4IFD G;  3HG9 A;  4PMW A;  4AYB B;  4F8M A;  3VR3 A;  4FXG C;  1UEA B;  2TSS A;  5E3F A;  3BS1 A;  2BE5 C;  1V1P B;  2Q8R E;  2HDL A;  5IGD A;  4ZAI A;  2R93 B;  1T5E A;  2A69 D;  1XTC D;  1WTO A;  3Q0A A;  4K8J A;  1Z6H A;  3JAM L;  4RHS A;  3I90 A;  2NTS A;  1KNE A;  3NWT A;  3HEJ A;  2QDB A;  1QOH A;  4K5W A;  2X6L A;  4RKB A;  2RVL A;  1PTO B;  1BCP B;  5ELB A;  2B2T C;  3NQT A;  2IX3 A;  3C1F A;  2VXW A;  3LWU A;  4ZYS A;  4ABN A;  3TP8 A;  3EA6 A;  1BNZ A;  1BUV T;  3I4M B;  1HUN A;  1CZG A;  4DGZ A;  4U68 A;  4ID6 A;  1SYF A;  3LWE A;  1GUN A;  2NN6 H;  1DCZ A;  4L6T B;  4A3E B;  4IFD H;  3N6R A;  3L3O C;  4I65 A;  3VA5 A;  5CV4 A;  3QG1 A;  3M7G A;  1A2U A;  1ESR A;  2B2W A;  1II3 A;  3VR6 A;  2K5W A;  3GTL B;  3VA7 A;  2L11 A;  5EBD A;  1HFG A;  3J7A F;  1SNO A;  1HUM A;  1HPC A;  2L5T A;  3SVM A;  1LO5 D;  4A3B B;  3HOW B;  1DJR D;  3FKI B;  2RA4 A;  3M85 A;  3HP3 A;  3MEH A;  4QB4 A;  2F1M A;  1VCI A;  1PRT B;  4DF7 A;  1BCP D;  3K5L A;  5C3E B;  3D6C A;  2J4X A;  1LTB D;  3DUZ A;  3TP6 A;  4CKC A;  1F77 A;  1ONL A;  2K1B A;  3D4R A;  1VMP A;  2JEA I;  2SNS A;  3A8I E;  2EJM A;  4RA8 A;  2HUG A;  5ELE A;  3BYT B;  1BOS A;  4WJW A;  4L8J A;  1EY8 A;  3PMF A;  1KAB A;  4S3S A;  2OT2 A;  3S17 B;  3CQZ B;  2JA8 B;  3CHB D;  1PTO D;  1CI3 M;  2QIL A;  3I70 A;  5F2D A;  4R8N A;  4Y7N B;  3LX0 A;  3MHB A;  1HRJ A;  2PCF B;  2K5Q A;  2KCC A;  3S1R B;  3GTG B;  2WII B;  4OIJ A;  3AMU A;  2F0L A;  3GO5 A;  3MFG A;  4TSS A;  5D65 A;  2F0D A;  3TBI B;  1ML0 D;  4BBR B;  1EYC A;  2BA1 A;  4K6D A;  2E2H B;  2JYO A;  4IUU A;  3AB9 A;  1V1O A;  5JVH 3;  2KOL A;  1O7Y A;  1D6E C;  1HQR D;  1Y1V B;  1CA5 A;  4HTH A;  4ZRZ A;  3KLR A;  1IYV A;  2RDG A;  1WTV A;  3EVQ A;  1S5C D;  3E0J A;  2JEB I;  5IGC A;  2B8G A;  1LTA D;  1NSN S;  1O7L A;  3D6W A;  5NUC A;  1D1K A;  3OIQ A;  2M2L A;  3DWP A;  2G9H D;  4HMI A;  3SK4 A;  5J22 A;  2G9D A;  1KDA A;  2CVR A;  4TQU S;  2AWN A;  2IW3 A;  5CV9 A;  1STY A;  3QIA A;  2FIN B;  3RD4 A;  1NUC A;  1IKL A;  2K28 A;  4BBS B;  1DXM A;  1YNJ C;  5M5Y B;  1EY4 A;  3HZX A;  1SFO B;  2EOT A;  2Z1C A;  1RTN A;  3X3M A;  5I9P A;  3K58 A;  2D5D A;  1KLG D;  3GP7 A;  3T4A C;  1I4X A;  2N88 A;  4FF3 A;  1SYE A;  3NUC A;  4XIG S;  1I6H B;  2A6E D;  3SHL A;  2VB2 X;  2PZW A;  4G57 A;  2MPM A;  1YNN D;  3NQI A;  3MFY A;  4XQN A;  4R9W A;  1HTL D;  4KKS A;  4DNT B;  2L0C A;  1TWF B;  5CC4 A;  1XWE A;  2F0P A;  5FO7 B;  3PUZ A;  2ICE C;  1Y1W B;  3IFD A;  3TZD A;  3S2H B;  1HHV A;  3S1N B;  4A3M B;  5DM7 3;  5HGT A;  2F0H A;  1CZW A;  2F3V A;  5CV5 A;  4ZUJ A;  2KJX A;  4M8A A;  1U4R A;  1NAP A;  5CV7 A;  1MBY A;  2O4X A;  5J1Z A;  1EYA A;  2J0T D;  4ULL A;  1DOM A;  1TWG B;  5IGE A;  3RZO B;  1CHP D;  3ERO A;  4K8I A;  3I4L A;  2NUC A;  4XYO A;  4HCE A;  1I4G A;  1EY9 A;  2EYM A;  1Q3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...