2KQ3A

Solution structure of snase140
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
140
structure length
140
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Importance of the C-Terminal Loop L137-S141 for the Folding and Folding Stability of Staphylococcal Nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 25
structure length 140
sequence length 140
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kq3A00
3MZ5A 3V2TA 1JOQA 4KD4A 1EZ8A 5KIXA 1SYGA 4K2KA 3D4DA 1A2UA 1EYAA 4HMIA 4TRDA 5IGBA 4HTHA 4PMCA 5IGDA 5CC4A 4KD3A 4OL7A 1IHZA 4EQNA 4K6DA 3MEHA 5K5PA 4K14A 4RKLA 4KHVA 2F0TA 2F0OA 2RBMA 5CV9A 2QDBA 4KY6A 1STNA 2SOBA 4S3SA 2PZTA 4WRDA 5IGEA 2OEOA 4MIUA 4ID6A 1EY8A 2KHSA 3HZXA 4R8NA 4ME5A 4EVOA 5CV8A 4B9WA 1SNMA 1EQVA 5EKKA 1STBA 5I6YA 4RKBA 5KYLA 4PMBA 1SNQA 5M9OA 3MHBA 2OF1A 4K2LA 1SNPA 4HMJA 3PMFA 2F0QA 1STGA 4J6HA 4QF4A 3SR1A 3SK6A 3EJIA 1SYEA 3MVVA 2F0FA 3BDLA 3SK5A 2PYKA 5DAUA 3EVQA 3D8GA 4KTAA 5EGTA 5IGFA 1A3VA 1ENCA 1F2MA 2HQEA 2F0EA 4KJOA 5E1FA 2F0GA 2ENBA 2F0NA 2RDFA 3LX0A 4ZUJA 5IGGA 5J22A 1EYCA 1AEXA 4PNYA 3SK8A 3EROA 1EY4A 3P75A 4B9XA 1II3A 4EQPA 5C3WA 4I65A 1NUCA 2EYFA 2F0IA 5J1ZA 5C3XA 2WACA 5HURA 1JOOA 4G57A 5I6WA 3DHQA 2PZWA 5C6AA 1SNCA 2EYJA 5CV7A 2F0HA 3H6MA 3SXHA 5HGTA 3T13A 5CV4A 1SNDA 4YIJA 5EKLA 5NUCA 5KYIA 2KQ3A 3C1EA 5CV6A 3NHHA 2EY2A 4DFAA 2M00A 3TMEA 4J1MA 1KDCA 2EXZA 5C5MA 1U9RA 2O4XA 3QOLA 2EYLA 2PQEA 2F3VA 2EYOA 3P1HA 5IOCA 3TP8A 1TQOA 5JAVA 2EY6A 2RKSA 1EY7A 3NUCA 3OSOA 2LKVA 4QB4A 1EY6A 1KAAA 3HEJA 5F2DA 4IZ8A 5I9OA 1TR5A 4EQOA 3TP5A 1EY0A 3ERQA 3OMGA 4NDXA 1EY9A 3DMUA 1ENAA 3NK9A 3U9OA 4DGZA 1NSNS 1SYDA 3RUZA 4KY5A 3TP7A 1STYA 5C4HA 4IUNA 3MXPA 1KDBA 5CR3A 3NP8A 4K5WA 4LAAA 3NQTA 3S9WA 1JOKA 2F0SA 1SNOA 4QMGA 5DEHA 4ZUIA 1KABA 1KDAA 4E6IA 5IGCA 4N9PA 1EY5A 1STAA 4KV6A 4N9TA 5KRUA 1JORA 5I9PA 4ODGA 5J39A 1A3UA 2F0VA 1SYCA 3OWFA 4NMZA 5KGUA 5KEEA 2F0KA 4K8JA 4KJNA 3VA5A 1EYDA 1TT2A 3D6CA 3R3OA 4F7XA 2F0WA 4H7BA 2F0DA 3C1FA 3TP6A 2EYMA 3ITPA 5JOBA 5IODA 3E5SA 5C5LA 2EY5A 2PW7A 4NKLA 5CGKA 3NXWA 1RKNA 3QB3A 4IALA 4K5XA 3SHLA 4KY7A 4NP5A 5IIFA 5ISRA 5E3FA 2PZUA 4ZQ3A 1STHA 4WORA 2SNMA 1F2ZA 2SNSA 3OMCA 3T16A 1F2YA 4DF7A 2F0JA 1EZ6A 2F0PA 5C4ZA 2EYPA 2PW5A 1A3TA 4F8MA 1A2TA 4K8IA 2NUCA 2F3WA 3SK4A 3D4WA 1SYFA 3BDCA 2F0UA 2OXPA 4DU9A 2EYHA 2EY1A 1SYBA 2F0LA 3QOJA 2F0MA 4K5VA 5CV5A
chains in the Genus database with same CATH superfamily
4KKTA 3RZDB 1U4LA 3UDFA 3A5ZB 1FJGL 3HKSA 4EQNA 3CCEA 4OIKA 5K36H 5K5PA 1N36L 1CSQA 2DGYA 2NZOA 2F0TA 1K73C 1B50A 2JP1A 1K9MC 2IY5B 4LJZC 4N8FA 3KF8B 1EQRA 4X6AH 1WFQA 1H9JA 1HZBA 3VA7A 1AE2A 4NPSA 4C3HB 5KNDA 1VQ6A 3MFGA 5FLXE 4LUZA 3FEWX 2ZXOA 3CRKC 1YJWA 1F2MA 3QO2A 3GQBA 1KD1C 4XTCS 4FYDA 5IE8A 3K5LA 5JJKA 4H02A 4BXXH 1HTPA 1F9SA 1QWYA 4RWSC 1LT3D 2PNHA 1I94Q 5M3FH 1VQ9A 2K6AA 3S2HH 2V1CC 3JAMi 3HRZC 4KN7C 1G2SA 1J6QA 1B7YB 1JMCA 1PFMA 3QR8A 3MEFA 3UI2A 1NSNS 1QB5D 3TP7A 3EQLC 2A69D 3AU7A 4OHJA 2F0SA 1STAA 3FVQA 3ONAB 2F0VA 1SYCA 4BY1H 4A3DG 1O7LA 4GOPA 3A56A 1LTSD 1V9PA 2B2YA 4DKAC 4C3JH 3PO3B 4IQZA 2EY5A 3DWQA 2KENA 1TWCB 4YCUA 4DXGA 5IT9c 2ZTEA 4DR1Q 1PH3A 1V43A 5EJWA 3BS1A 2K5HA 1G291 4GLVB 1EEID 5E3FA 2WKCA 2Z6KA 1JICA 2KEDA 5IYBG 5C4ZA 1GOZA 2KCTA 1HZCA 1IL8A 4DR6L 4DV7L 2EY1A 1YNXA 2F0MA 3QIAA 2KCCA 3M9BA 1W6JA 5KIXA 1SYGA 1EYAA 4HMIA 1HNWL 5CC4A 1XNRL 1QOHA 1Y14B 1EFID 2JN4A 2E2HH 4K6DA 2FFKB 3I4NB 4LW1A 4K6LA 1ILPA 3I73A 4KY6A 2JK8A 1BBXC 5ELNA 1UE1A 3J7YW 4GOPB 3NBHB 1L0YB 2JQOA 1W2BA 4R9WA 3ER0A 5JEAG 3CCQA 4BY7G 2D62A 3OOCA 2IL8A 5C4XG 5M3MH 4TSSA 1TKWB 1PZID 1D6EC 3EJIA 1CTMA 2JA6B 3CCVA 2B2YC 2XIWA 2B2WA 4DUYQ 1LACA 3Q23A 1DYQA 1TU2B 1LTTD 5HY6A 1AEXA 3VDYA 2IWHA 3C46A 1BCPC 2HQLA 2YV5A 2R7ZH 1TY2A 3HFZB 1SAPA 1XMOL 5EKLA 4DR6Q 3Q22A 1E2VA 2KQ3A 3CD6A 1PTOB 2CW0D 5I2XA 2MHVA 1K8GA 1ML0D 3CCUA 3QOLA 1VQCA 1TS5A 4YWMA 1TVXA 4QUFA 2OTJA 4FXGC 2RKSA 2JEBI 1S5FD 1X65A 5A2QL 1C9OA 3PUVA 2MQHA 3TQYA 4HJ8A 1IBLQ 3TP5A 4NDXA 1XNQQ 2F4VL 1JWSD 4C2MB 4JI8Q 3PF4A 1NE3A 1I50B 1N33L 1LT4D 3V05A 5BN5A 3JAML 4ZUIA 4DNTB 3J81L 1EY5A 1YNJD 4AYBE 1GUTA 1QZGA 2CQAA 1I4RA 2WV6D 5FOBB 3HOUB 2LSSA 4CBVA 2VNUD 3HOZH 3M4OH 2VY3A 4ZRZA 4JI8L 2NVTB 3HOUG 4C3HG 2QILA 3N6RA 2NVXH 4RAUC 3QB3A 2K5NA 3PIO3 1I3QH 3SHLA 4KY7A 1GM5A 4MZ9A 3OPOA 1I6HH 3D0FA 3OMCA 5JPNC 4A3MB 3STBD 5FLXL 4LFCL 2CCZA 3D4WA 3HOVG 4L6TB 3HOVH 3GTMH 1PFNA 2PNRC 3HOZG 3K59A 2QEXA 3RN2A 2HHHQ 3KF8A 1ET9A 5G3LD 3ZJYC 3HOZB 2K5VA 4YWLA 5IGEA 3S1NH 1AW7A 2UXCQ 4LF4Q 1GUGA 1G8ZD 1CFMA 1VQ4A 2WP8J 2VQFQ 1SNMA 1O7IA 3RMHA 4RKBA 5M9OA 4DR3Q 1FYCA 1VQKA 1VQOA 4HMJA 3H3VH 3NSWA 3E9HA 1S4ZA 1T5XD 4HSPA 1A3VA 4DR7L 5H1SE 2ZTCA 4A3EH 4ZAIA 2O5IC 5J22A 3PQIA 1YNNC 4B9XA 1MJEA 4IOAA 5C3XA 1PMRA 2I5MX 1YJNA 1MHWC 1WTHA 3PIPA 1F9RA 1L1OB 1CQVA 5KYIA 4YIJA 2B2TA 1JJGA 1EL0A 3TMEA 2DNCA 4J1MA 3IKJA 1JB3A 1OXVA 2PQEA 4PV1C 1KTKA 4RHRA 2OT2A 1QVFA 1KRSA 4LF8L 1HNZL 3HP3A 2VUMB 1FR3A 3NWSA 2VZAA 5IP9H 3G48A 4GN3B 4IUNA 5COYA 1KDBA 1BO0A 1V1PB 1FVIA 1QG7A 1KDAA 1VF5C 4XQQA 4DV6L 1JR0D 2KHIA 4DUZQ 3J80c 4B3TL 5C4XH 1PA6A 4L63B 4DV4L 4O0AA 3CP0A 1OTCA 3T51B 3D6CA 4JOIC 4F7XA 4JV5L 4JI1Q 4NB3A 1WD1A 4O1NA 4IALA 1STEA 3W2DA 1Q86C 3NTIA 4DK1A 4RHSA 5C4JB 4PMWA 2UUCL 4Q0FA 4X64Q 1B9NA 1O7ZA 3M4YA 4M8AA 1PTOC 3DXJC 4DU9A 2FHTA 3I7FA 1X9NA 1TY0A 1SROA 3AB9A 4J8QA 4NXMQ 3VYSA 1A15A 1EZ8A 1FL0A 1UE6A 4CDEC 5ELBA 2QW7A 2A8VA 3R8BA 1HTLD 4DK6C 1BUVT 1AN8A 1ET6A 2A73B 3GTOH 2R93G 4IUQA 5CV9A 4QCLA 2A74C 3CC2A 2OWOA 3L7ZC 4ME5A 5E4WC 1ESFA 1Y1VB 3FHWA 2EJMA 1CZGA 5FLMG 5FJ8G 5C3EH 1P8LA 5A2QE 1EFWA 2NWGA 3IFTA 1HNXQ 3CMEA 2JA7B 3UE0A 4AQYL 1QCBD 2K52A 5E1FA 1Z6HA 2ENBA 2UU9Q 3W1BA 2A6HC 1HR0L 2JA7G 3HG9A 4XT1B 4Y7NB 2A6ED 3BYTB 2AMCB 5J1ZA 1YIJA 1AZPA 5I6WA 3TS2A 1CSPA 4DA2A 2AWNA 1E7ZA 1OXUA 4JI7Q 4C56C 4BBRB 4QIWE 3S14H 4ZYSA 2N3SA 5AFWA 3KYHC 2EVBA 5G3LF 2B63G 4QB4A 2D5DA 2N8NA 1I6VC 1DCZA 1YITA 4HJ7A 2NYZD 4G7HC 3JAME 4FF3A 3CW2C 4DV2Q 4PG3A 1JOKA 4LMQD 3A5UA 4KV6A 4P71A 1I50H 2Q8TA 4ODGA 2WFWA 2JA6G 4DAYA 4X62L 2F0KA 1DOKA 3VR6A 5DM63 4WJ3M 1B1ZA 1HPCA 5D14A 5JOBA 4RGOS 1K8AC 3E5SA 4A93B 1XTDA 4QJFA 3SEBA 4K0KL 1F2ZA 2NVQH 1F2YA 1N8RC 3A74A 3KLSX 1IW7C 1EWCA 4XQNA 1B2TA 2KBNA 4K5VA 4UP7A 1BR9A 1J5EQ 2KECA 1CA5A 1ASYA 3R93A 4JVZA 4K0KQ 2E8GA 4HJ5A 3RR5A 1B53A 1Z47A 1KIXA 4DNIA 1HZAA 4LF6L 2DY7A 4RKLA 2RBMA 5M3MB 2SOBA 2XN9C 3ERSX 2HT1A 1PH2A 3KBGA 2K5QA 2IPKD 3U4VA 3VYUA 3OWEB 2R61A 2RF4A 2OF1A 3E9IA 2JYOA 4IPGA 3SK6A 3G6EA 2VS1A 5FLXc 3BDLA 3EVQA 4H13C 3NENA 1ENCA 3AEVA 2F0GA 2AQ3B 2L4NA 3RNUA 3A54A 1EYCA 3MC0B 1KNAA 4LWCA 3KOJA 5EKIA 3S1RH 3ULLA 1LT5D 4N8X1 5CV4A 1WD0A 1S3OA 5EPKA 4DK3C 1RDPD 1VQDA 2E2IB 4OX9Q 2KCNA 1Z7TA 1TWCH 1D5MC 1X54A 4IZ8A 4OELB 1LTBD 4R4CA 1N36Q 1J8IA 5M5WB 4GN4B 4LF5L 1EY9A 5IT9E 5IGCA 1P16A 1EIFA 4BY1B 1MI2A 2Q8IB 3KK7A 4JW0A 1PDQA 2ZJPA 3S2DH 4BY1G 4A3DH 1E24A 4YWKA 2NVYB 3CCJA 1Q3LA 4GKJL 2LFNA 4KJNA 3UE1A 4A76A 5EPJA 3DM3A 2F4VQ 2RCFA 2QKIC 2Z4HA 3LWUA 3NXWA 1D2BA 1J9OA 1NJIC 1N9WA 4A3JH 1H9KA 2VXWA 1D1KA 2D0PA 2PQAA 3R2IA 3UDIA 5C0XH 2BDNA 4M1UB 1EZ6A 2F0PA 4H0LC 4K8IA 4JPBW 2FINB 4A3FH 3IL8A 1BDOA 1S72A 1XX8A 2OQ0A 1Q81C 3FMCA 3I4MB 1GUSA 5JJLA 3V2TA 1SFOB 1JOQA 4KD4A 3S1QH 3G4SA 1U4RA 4RG1A 3D4DA 2NZ1D 3KLWA 1PXUA 3G71A 4BA2I 1MJCA 4OL7A 1E1TA 1PV4A 1KAWA 3VR3A 4JI6L 3E3XA 3G7LA 1UE5A 3S15B 1HCZA 4V190 3J80i 2OEOA 2XWBB 2DNEA 2RSOA 1CQFA 2KHSA 3BU2A 5IY0A 4KI0A 4TQUS 3RLNA 4DR3L 4HJ9A 5LMNQ 1SMXA 3I70A 3I4MH 3F2UA 3RZDH 1HH2P 4CKEA 1SE4A 4LF4L 2XWJB 4C1NK 3RLFA 3CCMA 2VW9A 5A35A 4CHTB 2CWAA 1EY4A 3LWEA 4JI3L 3M4QA 2L12A 4C3IG 3CCSA 2EYFA 1UUPA 1VDZA 5IT9L 1UEAB 4A3JB 3AYHB 1I4GA 4Y7NH 4Q5VA 3GTQH 3SXHA 5ELDA 3DLLA 1H9SB 5NUCA 1VS0A 3HKZB 4A3JG 2RDGA 1EWHA 2Q2TA 1GD7A 1QNUA 1OO9B 2E2JB 5JEAH 3P1HA 1T9HA 2XRQD 1TWAB 1M90C 3NWTA 2R93H 3PO2B 3KJOA 3DEPA 4JI6Q 5M5YB 3TEHB 1IBMQ 2E2JH 4CKCA 1W6KA 5ELEA 2K1BA 2KJXA 4GNXA 3GTOB 4GKKQ 1FNUA 1WJJA 1SEBD 4C3IH 4FVMA 3GTQB 4N9PA 2AWOA 1EYGA 5M5WH 3MXNB 4DV7Q 5KGUA 3CC4A 4DV3Q 1CA6A 2JA5B 1VQEA 2E2IH 1H9MA 1DM0B 2O5JC 2F0DA 2EYMA 3HS0C 4XXEA 3U50C 2ZM6Q 2CKZB 5JVG3 3H91A 3CAMA 1SJED 1X55A 2ICIA 3T4AC 4JI0L 2AQ2B 1CHQD 1NMFA 4BA1I 1K83H 4BXXG 3UDXA 3HOXG 3M4PA 3PUZA 5I4DA 4JG2A 3S16B 3OW7A 3GV3A 2KA7A 3PUYA 4DV1Q 3PGZA 3MZ5A 3BYYB 2F3IA 4HIKA 2B3GA 3GTGH 4YHHL 3E0EA 3EN2A 2CH4W 3K81C 1VQGA 2CWPA 2LS01 4OXPA 1BVSA 3A55A 4J15A 3S1QB 3LNNA 3J81E 5J3BA 1FJGQ 2F0OA 3K0YA 1Q8IA 5LMUQ 4ID6A 1PRTC 1WYDA 3MXNA 3CPFA 4HIMA 4BY7H 1PH8A 3S17H 2PPBC 2B8GA 1X3EA 3PSIA 1IL2A 1FGBD 4B3SL 4RGMA 3VYTA 4LFAQ 5IGFA 4BS9A 2FMMA 4P74A 3KLRA 2Z6BA 2CW0C 2Y0SB 1IBLL 1XPRA 1XNQL 4A3EG 2NVQB 1ZKOA 2Z0SA 5KNBA 4DAMA 2NVYH 4BBSB 1PVOA 2R92B 1HNWQ 1HFNA 2ICEC 3R2TA 1X32A 3BZDB 2NTSA 3I3CA 2MO0A 3H0GG 2YTYA 2EYLA 1PLFA 1OXTA 3TP8A 2A68C 3VR5A 3NUCA 1OXXK 1K8MA 1NNXA 2G9HD 2BA1A 5GAHC 1EIHA 3CQZH 1KHIA 5JPMC 1HHVA 4HCSA 5GADC 1ENAA 4HEDA 5AJ3L 1IYVA 2WB1E 2Q8RE 1YNND 1G6PA 4GN5A 4HAEA 3NP8A 3BZCA 1XXGA 3NQTA 5CORA 4QMGA 3T1YQ 1TWGB 1TXYA 3SE0A 2B8FA 2N49A 2EZVA 3I55A 1R9TB 5C44B 4A3BH 1K28A 2A5HA 1NR2A 1LTLA 1TS3A 3NQIA 2WKDA 4H7BA 1UNSA 1XMOQ 3K0XA 1AE3A 2NN6I 4UAIA 1DZ1A 4RCNA 1IYJB 1F2LA 2SNMA 1Y1WG 4DV0L 2NVXB 2AKWB 4C3IB 1XPOA 3BVGA 2F3WA 2K14A 2ALYB 2CH4A 1N32L 4IUUA 2JA7H 1TS4A 3HKZG 1ZYRC 1N33Q 5FO8B 4R4OA 3ND9A 1B8AA 4V0BA 4ZKBB 2EQSA 2GVAA 4A3BG 3H3VC 2R93B 5IGDA 4QL5A 1EQQA 2A68D 3I4MG 4KD3A 2KEEA 3K58A 2D9UA 3ZYYX 2B39A 1H9RA 1I4PA 1E2WA 1F77A 5DNFA 3HZXA 2ASBA 1X56A 1D8LA 5BN4A 2DJFC 1KNEA 2CVRA 1QNKA 1WOCA 3IAYA 1S5ED 2J4XA 3M7GA 2GA4B 4A93H 3SK5A 2HIXA 2UXBQ 4CJ1B 1Y69U 3F2CA 2OCEA 3U9SA 4DK0A 3W5OA 2RDFA 3CU7A 3H0GH 5IP9G 1BBWA 1JE5A 1ESRA 4ZKCB 2R7ZB 4DXFA 1SE3A 4XYQA 1RHPA 3T1HQ 2F0IA 2WACA 3RZOB 1JOOA 4G57A 4ZK9B 1CKMA 4PZ6A 4EX5A 2C9OA 2K75A 1K0RA 1J5EL 4B3TQ 2EXZA 2XTIA 3HOYG 1X3PA 4KN4C 1I4XA 2JA8H 4HR7B 2RSNA 4X3TA 2IJ0A 3K7AB 1GXDC 1EY7A 1ENFA 1JT8A 1KL9A 1KAAA 2C5CA 5D3DA 2R7DA 4OO1G 3I56A 4U673 4RCOA 2HCIA 3P20A 3ERQA 1SYDA 4GLXA 1PTOD 1UE7A 2IX3A 2C35B 1SLJA 4ME3A 5CR3A 5DLQE 3S9WA 1TWFB 5LMNW 5FO7B 5I2YA 2CFMA 1IKLA 2Q2HA 2QDLA 3I8ZA 3GO5A 5EBDA 1I4HA 4YY3L 2EJFC 5BN3A 2E76C 4XYOA 1L0XB 1IBKL 2A19A 4GZYC 5CMDA 3TP6A 2LY7A 5JJIA 4PQXA 5ELFA 4NKLA 3TREA 3GTLB 5CGKA 2QGQA 3GTPB 4OWXB 1CUKA 2PZUA 4C3JG 2K50A 2SNSA 3T16A 1TS2A 1N34L 1E1OA 2EYPA 2L5TA 3PO3H 4C3JB 2WAQG 1CM9A 3OIPA 4LFCQ 2V4DA 2F0LA 5LL6S 5GAEC 2R7FA 1WCMH 1FNVA 3KDFB 2VL6A 4TRDA 4PMCA 1WTPA 3X3MA 2XNAC 1EEFD 1VMPA 2DUDA 3DWAA 3D31A 4B3RL 1STNA 3PUXA 1MKHA 3GTPH 2Q2IA 2DJGC 4YY3Q 3UDGA 5CV8A 5I6YA 1EWIA 3KUPA 4PMBA 3CCLA 2VQFL 1YHBA 5C4JH 3F1ZA 2NB0A 2JSOA 2F0QA 3CXCA 4QF4A 4GNXB 4WJ4A 3EIVA 4IFDJ 5EGTA 4DPGA 3Q8DA 4KJOA 3DWPA 1QVGA 4ZUJA 2K04A 4U68A 2GVBA 1V1QA 5T1IA 4I65A 3HOXB 3I90A 3KF6A 2J7ZA 3WOFA 4OO1H 1LTRD 2QCPX 4LK1C 3AMUA 4X3UA 3KJPA 2JA8G 4DFAA 4BBSG 2WINB 5EPLA 4X62Q 4A3KB 4KKSA 2F3VA 4X66Q 3HOUH 2Y0SE 3E6ZX 5DM73 5IOCA 1DOMA 5EBCA 2BOSA 1HA5A 1PYWD 5I9OA 2TMPA 3BZKA 4IPDA 4LUOA 4EQOA 5LL6X 1EY0A 4JI4L 1IBML 3IRBA 3A0JA 1TIID 3M3YB 4DR7Q 2FXQA 3I72A 4CDCC 1WTRA 1PFBA 1O7YA 2RHQB 5LMNL 2EE1A 5I9PA 4NMZA 4DUZL 2B2UA 2Z8LA 1QILA 4DR5L 4A3EB 1E3PA 5IODA 4DR4L 1EOTA 5JJZA 4QY7A 5TSSA 4UPAA 3KBXA 1DGSA 4I7ZC 1HQRD 3S1MH 2UXDL 2CQOA 4DNRB 1B3QA 1B70B 1X3GA 2F0JA 1L0WA 1U0LA 2E5LL 4X66L 3BDCA 1XWEA 4L5TA 4JCVE 1Y1WB 2JA6H 4GS3A 1PRTF 4DAVA 2I07B 3FP9A 1VQPA 4A3KH 4O2DA 1LO5D 3S24A 1C4QA 4FF1A 3BG3A 1EOVA 4RGNA 4NXNQ 4PZ7A 1LTAD 1BCPF 3HKZE 1YBYA 4B3MQ 4QGUA 4BBRH 4L5QA 4UHVA 3I4NH 4A3MH 1C0AA 2HDMA 2AQ1B 5KYLA 4GKJQ 1I6HB 3AFPA 3EA6A 2BE5C 2YYZA 4K2LA 1YI2A 1U4PA 1C8CA 3PMFA 2AUJD 4ZLTF 1X6OA 2B2UC 3A7LA 1R9TH 2PYKA 4KTAA 2NVTH 1NMGA 1SJHD 4LF5Q 3LX0A 2JA5G 5IGGA 1TWGH 1RF2D 4F87A 4X65L 1A8VA 2YTVA 3GD7A 1SSOA 1NUCA 1IXRA 1PZJD 1EU3A 4JBMA 1M1KC 1D7QA 3CQZB 5CV6A 3C1EA 4DV1L 1Q1BA 1YVCA 3L3OC 2WAQE 2D0OA 4A3IB 1A62A 5C5MA 4C2MH 5E7NA 1WCMB 4BBRG 2BDOA 1LUZA 3I4NG 4R8IA 2L15A 4DV5Q 5IYCG 2O2LD 5HGQA 2B63B 1VQAA 2BCOA 1V1OA 3D3RA 3FPUB 2XVSA 4RA8A 5M5XB 3DEOA 4OWTB 1JORA 1WTWA 4LF7Q 3OWFA 3OW2A 4K8JA 3NELA 4R4TA 5C0XG 4KMUC 4IFDI 5CYUA 2MPMA 3C1FA 2B2WC 1PYBA 4X65Q 4OONA 3NEMA 3X3NA 4R4IA 3J7ZC 2N88A 1S5CD 4NP5A 1EIGA 1GUOA 2G5DA 3KDFA 2ID0A 3I91A 3HOYH 2B2TC 4CGYB 1M4VA 3HOWG 2QA4A 3KLSA 4IJHA 2EYHA 3NBHA 3QOJA 4OGQC 5CV5A 5GROA 4DR2L 3K7AH 2RVLA 1XYIA 2ZTDA 3W3AA 2JA8B 2E2HB 2CHBD 4JK1C 4G7ZC 5IGBA 4JI5Q 3AQQA 3K8AA 4G4KA 2TSSA 2A69C 3T56B 1PZKD 2I5LX 3VR2A 4LF8Q 3A8IE 5M3MG 4DV3L 1STBA 3MHBA 2KCMA 4UP8A 1L1OA 2JA5H 2A6HD 3I4OA 3MVVA 1AZQA 2B63H 5DAUA 4JOIA 1JJCB 2F0EA 3J81j 3SK8A 4RFBA 5C3EG 1DONA 2K5DA 4A3IH 1RIPA 2WAQB 3U4ZA 2NN6G 5HGTA 3DUZA 1MBYA 5M5YH 2BA0A 3NHHA 2M00A 3S1NB 3FKIG 4MTKA 1LV9A 1G91A 2L0CA 4AIMA 1XMQL 2PMZB 3PF5A 4P2CB 1AH9A 3FKIB 5FK9C 4IPHA 3MAQA 4A3KG 3MWYW 1A63A 5M3FG 4CDFC 1TR5A 1MIUA 3U9OA 4DGZA 3GV6A 4AH6A 3S2HB 5ISRA 4WFN3 1V8QA 5M3FB 1PH7A 3GTMB 4KHPL 3MXPA 1DXMA 1ICFB 5EAYA 1QE6A 4IN3A 5DEHA 4OIJA 2RDHA 1MGSA 1GKHA 2VQEL 3PO3G 1A6XA 4DV6Q 3GTKH 1EYDA 1VQ8A 4XDXA 1PRTD 2EPBA 1RL2A 5JEAJ 3WDNA 3T1HL 2K4KA 3M4OB 3SGIA 3N52A 4FF4A 3S15H 1SDFA 1Y1WH 1D1IA 2ZM6L 5E4XA 4LNQA 4WORA 3M85A 2AUKA 2X69A 2ES2A 1BQQT 2OQKA 2HD3A 3JC66 4AQYQ 4NXML 2JEAI 2PW5A 1XMQQ 4TVAB 2F0UA 2MFIA 2NN6H 4A3LG 1M8AA 4GKKL 1Y8NB 1B4OA 1HQMC 4A3IG 2R3ZA 3NPPA 1DD2A 4FNFA 3M7NA 3GDEA 3TSSA 2F4IA 2LXKA 1F9PA 4MN3A 3WOEA 3PIP3 2DN8A 3PCOB 4G7OC 1Y8PB 4JV5Q 4EQ5A 2YU9H 1OXSC 1UEBA 2PCFB 1IBKQ 5FKAC 1EQTA 2B2VC 3OHXC 3TDQA 1E22A 4JI0Q 3L0OA 3CC7A 2R7ZG 4B3RQ 2ZT9C 2VB3X 1G2TA 2F03A 2K28A 3H3VI 1SE2A 3S2DB 1QUQA 2I46A 5LHY1 2K05A 4JI2Q 1FNWA 1VQMA 2I5HA 4YHHQ 1MD2D 2PI2A 2R6GA 2HHHL 3HOYB 1CI3M 1IKMA 5IYDG 1AP0A 1HA6A 2K01A 1NAPA 3V96A 1L2FA 5FLMH 1KDCA 3HOXH 1ILQA 3GTGB 4L8JA 2UUAQ 3EBEA 4MNOA 2EYOA 4R1JA 3OSOA 2LKVA 1HR0W 5IP7H 3ICEA 5F2DA 4KLKA 4RMFA 1WI5A 1SBBB 3TRZA 2JE6I 2MJ8A 3PUWA 3DMUA 3NK9A 4IUVA 3TS0A 5GQOA 3S1RB 1HXYD 2YTXA 2IX0A 2WB1B 1VQBA 1XTCD 4R4QA 4B08A 5KRUA 4JBKA 2Z4IA 3D4RA 4JBJA 2P5ZX 1K8OA 1I94L 2B2VA 2JA9A 1Y8OB 2WB1G 1GUWA 3RD4A 1ZYRD 4FO2A 4HIDA 3SDZA 4LFBQ 2E75C 1YJ9A 2UXCL 3ITPA 1D5XC 3F2BA 4DR4Q 1IW7D 3W1GA 3MTSA 2ZJRA 1PH1A 3TZUA 4IFDG 1STHA 4HCEA 4L5SA 5KNCA 1VQ7A 1PFSA 3H09A 2AHOB 2M9VA 5C0XI 1YHAA 2RHSB 3K5MA 1PHJA 3NTHA 1WCMG 3Q6SA 4XT3B 1TWAH 2FJ2A 1VCIA 1JWMD 3RLOA 2L9HA 3I2ZA 2K7VA 4KKUA 1A2UA 4JI4Q 3NTKA 1Q8KA 1Q1EA 2QEJC 4K14A 4KHVA 3FDTA 5BR8Q 3BVMA 4HSVA 3URYA 1EY8A 2PI2E 1LTGD 1TWFH 3Q0AA 1BNZA 2KHJA 1CZWA 1SNQA 1Q7YC 1SXTA 1AFPA 4CJ0B 4LF9L 1VQFA 1H95A 4GOPC 3GTJB 1VQ5A 4QUCA 1YNJC 2F0FA 1WTXA 3KF6B 1BBUA 3D8GA 1LLRD 2HIVA 1LM0A 2F0NA 3FRPB 2HDLA 3EROA 2OTLA 1II3A 5C3WA 1RJTA 5IWAQ 1C7YA 1XPUA 3HOWH 1BF4A 2Z6KC 5CV7A 2F0HA 1HUMA 4DV4Q 1ONLA 1SNDA 2J0TD 1B44D 3S1MB 3NBIA 1LABA 3C2PA 3RZOH 2R92G 1E0BA 4DAYB 5L37A 1SFOH 1G6ZA 1TQOA 2LMCB 5CBEE 1EY6A 3K80C 1C48A 1JQYD 1SRUA 5CBAE 3RUZA 5C4HA 1GUNA 1RTOA 2UXBL 3HGBA 1ZEQX 2K5WA 1Q46A 1KABA 4N9TA 4ILWA 2MGSA 3M3YH 1WTVA 4OWWB 3O13A 5J39A 1CHPD 4X3KA 1KLUD 1SE8A 2EOTA 4XIGS 1YZ6A 1PH4A 1ASZA 3VYRA 1VQHA 2F0WA 4A3LH 1B3AA 4RH6A 1Y1VH 2B29A 4CDDC 2X6LA 4MTNA 4OEMB 4YCVA 3QWNA 2L11A 1VQIA 2UUBQ 1E2ZA 1VF7A 2MNAA 4B3SQ 2X6GA 1SMYD 2EXDA 1JWUD 1JB7A 4F8MA 1A3TA 1Q12A 1A2TA 1S5DD 3MXGA 3CF5A 4A3CG 3QG1A 1SYBA 2SEBD 1I4QA 4FP5D 1CK1A 4K2KA 1XJVA 2UUBL 4A3GB 2D2CC 1WTOA 4EGVA 1JE4A 2JXMB 5C44H 4A3BB 4A3GG 1Y1VG 4S3SA 2PZTA 4QIWB 4WRDA 4DR2Q 1I5FA 5GAGC 3H94A 4B9WA 3G6JB 1VMCA 3K5OA 2E74C 2N55A 1NR4A 3WWVA 4JBWA 1SR3A 1T5EA 4DN4M 3SR1A 4IPCA 1H9SA 1EIYB 2IHFA 4DV0Q 3D6WA 5C4XB 4ULLA 1K3RA 2NTTA 2Q2UA 1CKNA 3MA2B 4PNYA 3P75A 3B6YA 1LTID 4TKOB 3P7JA 4KK7A 2PZWA 3CMAA 2EYJA 4JYAQ 1BKBA 3H6MA 5C0XJ 3T13A 3STBC 1KLGD 3J81c 4L5RC 3OTOQ 1U9RA 2O4XA 1HRJA 1TWHB 5JAVA 2VB2X 3GTLH 5JVH3 2E2DC 3EFXD 1V1PA 4JYAL 4B3ML 4APVA 1TWHH 5IYDH 1XNRQ 2DY8A 1S40A 3CPWA 1NY4A 4A4IA 4F88A 4WJWA 2MUYA 4BY7B 1MSGA 1O78A 2L1BA 1SNOA 3A8JE 3ULPA 5K36G 1PTOF 4GLAC 3C3LA 1CKOA 1S5BD 2G9DA 5D3IB 1L1OC 2EJGC 4IURA 4A93G 2PQAB 3L9AX 4ZCKA 3K57A 1WVLA 5C5LA 2PW7A 1RCVD 1K3BC 2Z9HA 5D65A 1DJRD 1RKNA 3Q24A 4K5XA 3A8KE 3FPPA 3OYYA 1SMYC 4IOCA 5IIFA 1KC8C 1MSHA 3HOWB 1UWVA 3S16H 2VQEQ 1JJ2A 2BH2A 1BXTA 4JC0A 4LF9Q 2MO1A 1BCPB 3GTJH 1R4PB 3K6OA 4POGA 3S14B 3H0GB 4AYBB 1QJOA 4HTHA 2KOLA 1DOLA 1U4MA 3J7AF 1IYUA 5T1GA 1IHZA 3J80E 4KHPQ 1RODA 2IW3A 2L55A 3BVZA 2QDBA 2QF7A 4DUYL 4GNXC 3F2DA 4OX9L 4OO1I 4MIUA 1I3QB 1ZXTA 4EVOA 2BE5D 2PMZE 1HNXL 2F52A 4IUTA 4FXDA 5FJ8H 3FKIH 3KFUA 4X3SA 2UXDQ 4C1NI 4DV2L 3GP7A 1G51A 3CRLC 3PO2H 5C3EB 3T1YL 2HQEA 1QVCA 5C44G 1EU4A 4IUPA 1UAPA 4EQPA 2F1MA 1W3SA 3CKIB 4JI1L 4HJAA 2A1AA 4LFAL 4P72A 2ZXRA 5C6AA 1SNCA 4NW2A 4LUVA 4CJ2C 1D5ZC 3ND8A 2EY2A 1JCKB 4A3CH 1U5KA 4UY8C 2ZXPA 4POFA 4P73A 4FXKC 3BJUA 3BDOA 4HIOA 1FGUA 1GO3E 2EY6A 1PH5A 2FMCA 4JI2L 3A7AB 3E0JA 5AJ3Q 5FO9B 1IZ6A 1FD7D 1PTOH 4HN7A 4QQBX 1NTGA 3MXUA 1HR0Q 3OMGA 3ULJA 3SVMA 1Q90A 4KY5A 2RQXA 2VUMG 4K5WA 1YHQA 1KXLA 1BOSA 4E6IA 4PZ8A 2SDFA 1PH9A 4ABNA 2IHEA 3IFDA 4XQJA 2JJQA 5EQ0A 2NZHA 1VQJA 4ALPA 3DM1A 4KHZA 2Y0SG 1Q82C 2XRSD 1GHJA 2RCNA 5HURA 3R3OA 1HJPA 1HFGA 4A3FG 2NBFA 4Y52H 3K7UC 2UU9L 4H44C 3J80L 1A0IA 1PH6A 4A3FB 1QZHA 2BH8A 4P75A 1N32Q 2K03A 3OTOL 4DAPA 2VUMH 2R92H 4LFBL 3QJYA 4BBSH 1SYFA 4JI7L 2LXJA 4FF2A 2E5LQ 2WIIB 2RA4A 1RD9D 3J7AV 4RGTA 3J81i 1HZ9A 3K5NA 5ELCA 3RN5A 4DR1L 2YU9B 4BWGB 5M5XH 3MEHA 3NE5B 2XGTA 2IT1A 5ELOA 3F8TA 4NXNL 3TN2A 1VQLA 4IJLA 5IYCH 4UDUC 3TZDA 3S17B 4CKBA 4A3DB 1O80A 4R8NA 1GJXA 4UP9A 1NBWA 1EQVA 3I4LA 5EKKA 2H4OA 2A6EC 2HUGA 1SNPA 3T53B 1STGA 4J6HA 1SN8A 1SYEA 2K33A 1KRTA 2KUMA 5BR8L 4YCWA 1CKNB 4JI3Q 2IX1A 3J7A5 4LF6Q 2KVMA 1K0SA 1EUJA 1HNZQ 3DHQA 2HCCA 5IYBH 1RTNA 4JI5L 3U58A 4DR5Q 1K83B 2H5XA 1X3FA 1ICWA 3LGJA 3TBIB 1CT1D 3PIOA 2EDGA 2MP1A 3PO2G 3CCRA 5IP7G 3GTKB 3L2PA 2EIFA 1NCVA 1X3QA 2M2LA 3HOVB 4IFDH 2I0QA 1LYLA 3HEJA 1VQNA 4A3GH 1F9QA 1BCPD 3MFYA 4AYBG 1STYA 2K32A 1GVPA 4LAAA 3H15A 1R4QB 3PV0A 1GHKA 2H1EA 1A3UA 4FDBA 4Z9CB 1HUNA 1Z9FA 5KEEA 2N78A 3VR4A 2UUCQ 4LF7L 1JC7A 4C3HH 4MHEA 4X64L 3OIQA 3VA5A 4I7AA 2ZJQA 2XSCA 1TT2A 3CHBD 2ATWA 5LMUL 1QUQB 5IWAL 2Z1CA 2GN5A 4IO9A 4A3MG 4ZQ3A 1PYSB 4O42A 1LT6D 4DV5L 2UUAL 3JAMc 1B9MA 2NUCA 3SK4A 1WTQA 1YEZA 4A75A 2OXPA 1KQSA 1N34Q 4DF7A 2PO4A 1PRTB 3AFQA
chains in the Genus database with same CATH topology
4KKTA 3RZDB 1U4LA 4EQNA 4OIKA 5K36H 5K5PA 2F0TA 1B50A 2JP1A 4LJZC 1H9JA 3VA7A 4C3HB 5KNDA 3MFGA 5FLXE 3FEWX 2ZXOA 3CRKC 1F2MA 3QO2A 3GQBA 4XTCS 4FYDA 3K5LA 1HTPA 1F9SA 1QWYA 4RWSC 1LT3D 2K6AA 3HRZC 4KN7C 1G2SA 1PFMA 3UI2A 1NSNS 1QB5D 3TP7A 3EQLC 2A69D 3AU7A 4OHJA 2F0SA 1STAA 3FVQA 3ONAB 2F0VA 1SYCA 1O7LA 3A56A 1LTSD 2B2YA 3PO3B 4IQZA 2EY5A 3DWQA 1TWCB 4DXGA 1V43A 5EJWA 3BS1A 1G291 1EEID 5E3FA 2WKCA 1JICA 2KEDA 5C4ZA 1GOZA 1IL8A 2EY1A 2F0MA 3QIAA 2KCCA 1W6JA 5KIXA 1SYGA 1EYAA 4HMIA 5CC4A 1QOHA 1EFID 4K6DA 2FFKB 3I4NB 4K6LA 1ILPA 3I73A 4KY6A 1BBXC 3J7YW 1L0YB 4R9WA 5JEAG 2D62A 3OOCA 2IL8A 4TSSA 1TKWB 1PZID 1D6EC 3EJIA 1CTMA 2JA6B 2B2YC 2XIWA 2B2WA 1LACA 3Q23A 1DYQA 1TU2B 1LTTD 1AEXA 2IWHA 3C46A 1BCPC 1TY2A 1SAPA 5EKLA 3Q22A 1E2VA 2KQ3A 1PTOB 2CW0D 5I2XA 2MHVA 1ML0D 3QOLA 1TS5A 1TVXA 4QUFA 4FXGC 2RKSA 2JEBI 1S5FD 5A2QL 3PUVA 3TP5A 4NDXA 1JWSD 4C2MB 1I50B 1LT4D 3V05A 5BN5A 3JAML 4ZUIA 4DNTB 3J81L 1EY5A 1YNJD 1GUTA 2CQAA 1I4RA 2WV6D 5FOBB 3HOUB 4CBVA 2VNUD 4ZRZA 2NVTB 4C3HG 2QILA 3N6RA 4RAUC 3QB3A 3PIO3 3SHLA 4KY7A 3OPOA 3OMCA 5JPNC 4A3MB 5FLXL 3D4WA 4L6TB 1PFNA 2PNRC 3K59A 3KF8A 1ET9A 5G3LD 3HOZB 5IGEA 1AW7A 1GUGA 1G8ZD 1CFMA 2WP8J 1SNMA 3RMHA 4RKBA 5M9OA 1FYCA 4HMJA 3NSWA 1S4ZA 1T5XD 4HSPA 1A3VA 4ZAIA 2O5IC 5J22A 1YNNC 4B9XA 5C3XA 1PMRA 1F9RA 1CQVA 5KYIA 4YIJA 2B2TA 1EL0A 3TMEA 2DNCA 4J1MA 3IKJA 1JB3A 1OXVA 2PQEA 4PV1C 1KTKA 4RHRA 2OT2A 3HP3A 2VUMB 1FR3A 3NWSA 4IUNA 5COYA 1KDBA 1BO0A 1V1PB 1QG7A 1KDAA 1VF5C 4XQQA 1JR0D 4L63B 3T51B 3D6CA 4F7XA 1WD1A 4O1NA 4IALA 1STEA 3W2DA 3NTIA 4DK1A 4RHSA 5C4JB 4PMWA 4Q0FA 1B9NA 1O7ZA 3M4YA 4M8AA 1PTOC 3DXJC 4DU9A 2FHTA 1TY0A 4J8QA 3AB9A 3VYSA 1A15A 1EZ8A 5ELBA 3R8BA 1HTLD 1BUVT 1AN8A 1ET6A 2A73B 4IUQA 5CV9A 4QCLA 2A74C 3L7ZC 4ME5A 5E4WC 1ESFA 1Y1VB 2EJMA 1CZGA 5A2QE 2NWGA 3IFTA 2JA7B 1QCBD 5E1FA 1Z6HA 2ENBA 2A6HC 3HG9A 4XT1B 4Y7NB 2A6ED 3BYTB 5J1ZA 1AZPA 5I6WA 4DA2A 2AWNA 1OXUA 4C56C 4BBRB 4ZYSA 5AFWA 2EVBA 5G3LF 4QB4A 2D5DA 1I6VC 1DCZA 2NYZD 4G7HC 3JAME 4FF3A 1JOKA 4LMQD 4KV6A 2Q8TA 4ODGA 4DAYA 2F0KA 1DOKA 3VR6A 5DM63 1B1ZA 1HPCA 5D14A 5JOBA 4RGOS 3E5SA 4A93B 3SEBA 1F2ZA 1F2YA 3KLSX 1IW7C 1EWCA 4XQNA 1B2TA 4K5VA 1BR9A 2KECA 1CA5A 3R93A 1B53A 1Z47A 2DY7A 4RKLA 2RBMA 5M3MB 2SOBA 2XN9C 3KBGA 2K5QA 2IPKD 3VYUA 3OWEB 2R61A 2OF1A 2JYOA 3SK6A 3BDLA 3EVQA 4H13C 1ENCA 2F0GA 2AQ3B 2L4NA 3A54A 1EYCA 3MC0B 1KNAA 5EKIA 1LT5D 5CV4A 1WD0A 5EPKA 1RDPD 2E2IB 2KCNA 1Z7TA 1D5MC 4IZ8A 1LTBD 1J8IA 5M5WB 1EY9A 5IT9E 5IGCA 4BY1B 1MI2A 2Q8IB 3KK7A 1PDQA 2NVYB 1Q3LA 2LFNA 4KJNA 5EPJA 2QKIC 2Z4HA 3LWUA 3NXWA 1D2BA 1J9OA 1H9KA 2VXWA 1D1KA 5C0XH 3R2IA 2BDNA 4M1UB 1EZ6A 2F0PA 4H0LC 4K8IA 2FINB 3IL8A 1BDOA 1XX8A 3FMCA 3I4MB 1GUSA 3V2TA 1SFOB 1JOQA 4KD4A 1U4RA 3D4DA 2NZ1D 1PXUA 4BA2I 4OL7A 3VR3A 3G7LA 3S15B 1HCZA 4V190 2OEOA 2XWBB 2DNEA 2RSOA 1CQFA 2KHSA 4KI0A 4TQUS 3I70A 3F2UA 4CKEA 1SE4A 2XWJB 4C1NK 3RLFA 5A35A 4CHTB 1EY4A 3LWEA 2L12A 4C3IG 2EYFA 1UUPA 1VDZA 5IT9L 1UEAB 4A3JB 1I4GA 4Q5VA 3SXHA 5ELDA 1H9SB 5NUCA 3HKZB 2RDGA 1EWHA 1QNUA 1OO9B 2E2JB 5JEAH 3P1HA 2XRQD 1TWAB 3NWTA 3PO2B 3DEPA 5M5YB 4CKCA 1W6KA 5ELEA 2K1BA 2KJXA 3GTOB 1FNUA 1SEBD 4FVMA 3GTQB 4N9PA 2AWOA 5KGUA 1CA6A 2JA5B 1H9MA 1DM0B 2O5JC 2F0DA 2EYMA 3HS0C 4XXEA 5JVG3 3H91A 1SJED 2ICIA 3T4AC 2AQ2B 1CHQD 4BA1I 3PUZA 5I4DA 3S16B 3OW7A 3GV3A 2KA7A 3PUYA 3MZ5A 3BYYB 2LS01 3A55A 3S1QB 3LNNA 3J81E 2F0OA 3K0YA 1Q8IA 4ID6A 1PRTC 3MXNA 2PPBC 2B8GA 1FGBD 4RGMA 3VYTA 5IGFA 4BS9A 2FMMA 3KLRA 2CW0C 2Y0SB 2NVQB 1ZKOA 5KNBA 4BBSB 2R92B 1HFNA 2ICEC 3R2TA 1X32A 3BZDB 2NTSA 3I3CA 2EYLA 1PLFA 1OXTA 3TP8A 2A68C 3VR5A 3NUCA 1OXXK 1K8MA 2G9HD 2BA1A 1EIHA 5JPMC 1HHVA 4HCSA 1ENAA 4HEDA 1IYVA 2Q8RE 1YNND 4HAEA 3NP8A 1XXGA 3NQTA 5CORA 4QMGA 1TWGB 3SE0A 2B8FA 2EZVA 1R9TB 5C44B 2A5HA 1NR2A 1TS3A 3NQIA 2WKDA 4H7BA 1UNSA 2NN6I 4UAIA 1DZ1A 4RCNA 1F2LA 2SNMA 2NVXB 4C3IB 3BVGA 2F3WA 4IUUA 1TS4A 1ZYRC 5FO8B 3ND9A 4V0BA 4ZKBB 3H3VC 2R93B 5IGDA 2A68D 4KD3A 2KEEA 3K58A 2D9UA 3ZYYX 2B39A 1H9RA 1I4PA 1E2WA 1F77A 5DNFA 3HZXA 5BN4A 1KNEA 2CVRA 1QNKA 3IAYA 1S5ED 2J4XA 3M7GA 2GA4B 3SK5A 4CJ1B 1Y69U 3U9SA 4DK0A 2RDFA 3CU7A 1ESRA 4ZKCB 2R7ZB 4DXFA 1SE3A 4XYQA 1RHPA 2F0IA 2WACA 3RZOB 1JOOA 4G57A 4ZK9B 2C9OA 2EXZA 1X3PA 4KN4C 1I4XA 4HR7B 2RSNA 4X3TA 2IJ0A 3K7AB 1GXDC 1EY7A 1ENFA 1KAAA 2C5CA 5D3DA 4OO1G 4U673 4RCOA 2HCIA 3P20A 3ERQA 1SYDA 1PTOD 2IX3A 5CR3A 3S9WA 1TWFB 5FO7B 5I2YA 1IKLA 3I8ZA 3GO5A 5EBDA 1I4HA 2EJFC 5BN3A 2E76C 4XYOA 1L0XB 4GZYC 5CMDA 3TP6A 2LY7A 4PQXA 5ELFA 4NKLA 3GTLB 5CGKA 3GTPB 2PZUA 4C3JG 2SNSA 3T16A 1TS2A 2EYPA 2L5TA 4C3JB 1CM9A 3OIPA 2V4DA 2F0LA 5LL6S 1FNVA 4TRDA 4PMCA 1WTPA 3X3MA 2XNAC 1EEFD 1VMPA 3DWAA 3D31A 1STNA 3PUXA 5CV8A 5I6YA 3KUPA 4PMBA 2NB0A 2JSOA 2F0QA 4QF4A 4IFDJ 5EGTA 4KJOA 3DWPA 4ZUJA 2K04A 4U68A 5T1IA 4I65A 3HOXB 3I90A 2J7ZA 3WOFA 4OO1H 1LTRD 2QCPX 4LK1C 3AMUA 4X3UA 4DFAA 2WINB 5EPLA 4A3KB 4KKSA 2F3VA 3E6ZX 5DM73 5IOCA 1DOMA 5EBCA 2BOSA 1HA5A 1PYWD 5I9OA 2TMPA 4EQOA 5LL6X 1EY0A 1TIID 3M3YB 3I72A 1WTRA 1PFBA 1O7YA 2EE1A 5I9PA 4NMZA 2B2UA 2Z8LA 1QILA 4A3EB 5IODA 1EOTA 5JJZA 5TSSA 3KBXA 4I7ZC 1HQRD 4DNRB 2F0JA 3BDCA 1XWEA 1Y1WB 1PRTF 4DAVA 2I07B 1LO5D 1C4QA 4FF1A 3BG3A 4RGNA 1LTAD 1BCPF 2HDMA 2AQ1B 5KYLA 1I6HB 3EA6A 2BE5C 2YYZA 4K2LA 1C8CA 1U4PA 3PMFA 2AUJD 4ZLTF 2B2UC 3A7LA 2PYKA 4KTAA 1SJHD 3LX0A 5IGGA 1RF2D 4F87A 3GD7A 1SSOA 1NUCA 1PZJD 1EU3A 3CQZB 5CV6A 3C1EA 1Q1BA 3L3OC 4A3IB 5C5MA 1WCMB 2BDOA 4R8IA 2O2LD 2B63B 2BCOA 3FPUB 1V1OA 3D3RA 2XVSA 4RA8A 5M5XB 3DEOA 1JORA 1WTWA 3OWFA 4K8JA 5C0XG 4KMUC 4IFDI 5CYUA 2MPMA 3C1FA 2B2WC 3X3NA 2N88A 1S5CD 4NP5A 1EIGA 1GUOA 2ID0A 3I91A 2B2TC 4CGYB 1M4VA 3KLSA 2EYHA 3NBHA 3QOJA 4OGQC 5CV5A 2RVLA 1XYIA 3W3AA 2JA8B 2E2HB 2CHBD 4JK1C 4G7ZC 5IGBA 4G4KA 2TSSA 2A69C 3T56B 1PZKD 3VR2A 3A8IE 1STBA 3MHBA 2A6HD 3MVVA 1AZQA 5DAUA 2F0EA 3SK8A 4RFBA 1DONA 2K5DA 2WAQB 2NN6G 5HGTA 3DUZA 1MBYA 2BA0A 3NHHA 2M00A 3S1NB 1LV9A 1G91A 2L0CA 2PMZB 4P2CB 3FKIB 5FK9C 3MAQA 3MWYW 1TR5A 3U9OA 4DGZA 3GV6A 3S2HB 5ISRA 4WFN3 1V8QA 5M3FB 3GTMB 3MXPA 1DXMA 1QE6A 4IN3A 5DEHA 4OIJA 2RDHA 1MGSA 1A6XA 1EYDA 4XDXA 1PRTD 2EPBA 5JEAJ 3WDNA 3M4OB 3N52A 4FF4A 1SDFA 1D1IA 5E4XA 4WORA 3M85A 2AUKA 2X69A 1BQQT 2JEAI 2PW5A 2F0UA 2NN6H 1M8AA 1Y8NB 1B4OA 1HQMC 2R3ZA 3NPPA 1DD2A 4FNFA 3M7NA 3TSSA 2F4IA 1F9PA 4MN3A 3WOEA 3PIP3 2DN8A 4G7OC 1Y8PB 1OXSC 2PCFB 5FKAC 1EQTA 2B2VC 3OHXC 3TDQA 2ZT9C 2VB3X 1G2TA 2F03A 2K28A 1SE2A 3S2DB 2I46A 5LHY1 2K05A 1FNWA 1MD2D 2R6GA 3HOYB 1CI3M 1IKMA 1AP0A 1HA6A 2K01A 1NAPA 3V96A 1KDCA 1ILQA 3GTGB 4L8JA 2EYOA 3OSOA 2LKVA 5F2DA 1SBBB 2JE6I 2MJ8A 3PUWA 3DMUA 3NK9A 4IUVA 3S1RB 1HXYD 2IX0A 2WB1B 1XTCD 4B08A 5KRUA 2Z4IA 3D4RA 1K8OA 2B2VA 1Y8OB 1GUWA 3RD4A 1ZYRD 4FO2A 3SDZA 2E75C 3ITPA 1D5XC 1IW7D 3MTSA 3TZUA 4IFDG 1STHA 4HCEA 5KNCA 3H09A 2M9VA 5C0XI 3K5MA 3NTHA 3Q6SA 4XT3B 2FJ2A 1VCIA 1JWMD 2L9HA 2K7VA 4KKUA 1A2UA 3NTKA 1Q1EA 2QEJC 4K14A 4KHVA 3FDTA 3BVMA 4HSVA 3URYA 1EY8A 1LTGD 3Q0AA 1BNZA 1CZWA 1SNQA 1SXTA 1AFPA 4CJ0B 3GTJB 4QUCA 1YNJC 2F0FA 1WTXA 3D8GA 1LLRD 2F0NA 3FRPB 2HDLA 3EROA 1II3A 5C3WA 1RJTA 1BF4A 5CV7A 2F0HA 1HUMA 1ONLA 1SNDA 2J0TD 1B44D 3S1MB 3NBIA 1LABA 3C2PA 1E0BA 1G6ZA 1TQOA 2LMCB 5CBEE 1EY6A 1C48A 1JQYD 5CBAE 3RUZA 5C4HA 1GUNA 1RTOA 3HGBA 1ZEQX 2K5WA 1KABA 4N9TA 4ILWA 2MGSA 1WTVA 3O13A 5J39A 1CHPD 4X3KA 1KLUD 2EOTA 4XIGS 3VYRA 2F0WA 1B3AA 4RH6A 2X6LA 3QWNA 2L11A 1E2ZA 1VF7A 2X6GA 1SMYD 1JWUD 4F8MA 1A3TA 1Q12A 1A2TA 1S5DD 3MXGA 3QG1A 1SYBA 2SEBD 1I4QA 4FP5D 1CK1A 4K2KA 4A3GB 2D2CC 1WTOA 4EGVA 1JE4A 2JXMB 4A3BB 4S3SA 2PZTA 4QIWB 4WRDA 3H94A 4B9WA 3G6JB 1VMCA 3K5OA 2E74C 2N55A 1NR4A 4JBWA 1T5EA 4DN4M 3SR1A 1H9SA 3D6WA 5C4XB 4ULLA 2NTTA 3MA2B 4PNYA 3P75A 4TKOB 1LTID 3P7JA 4KK7A 2PZWA 2EYJA 5C0XJ 3H6MA 3T13A 1KLGD 1U9RA 2O4XA 1HRJA 1TWHB 5JAVA 2VB2X 5JVH3 2E2DC 3EFXD 1V1PA 2DY8A 4F88A 4WJWA 2MUYA 4BY7B 1MSGA 1O78A 2L1BA 1SNOA 3A8JE 5K36G 1PTOF 3C3LA 1S5BD 2G9DA 5D3IB 2EJGC 4IURA 3L9AX 3K57A 1WVLA 5C5LA 2PW7A 1RCVD 5D65A 1DJRD 1RKNA 3Q24A 3A8KE 4K5XA 3FPPA 1SMYC 5IIFA 1MSHA 3HOWB 1BXTA 1BCPB 1R4PB 3K6OA 3S14B 3H0GB 4AYBB 1QJOA 4HTHA 2KOLA 1DOLA 1U4MA 3J7AF 1IYUA 5T1GA 1IHZA 3J80E 1RODA 2IW3A 2L55A 3BVZA 2QDBA 2QF7A 4OO1I 4MIUA 1I3QB 1ZXTA 4EVOA 2BE5D 4IUTA 4FXDA 4X3SA 4C1NI 3GP7A 3CRLC 5C3EB 2HQEA 1EU4A 4IUPA 1UAPA 4EQPA 2F1MA 3CKIB 2ZXRA 5C6AA 1SNCA 4NW2A 4CJ2C 1D5ZC 3ND8A 2EY2A 1JCKB 2ZXPA 4FXKC 3BDOA 2EY6A 2FMCA 3A7AB 3E0JA 5FO9B 1FD7D 1PTOH 4HN7A 3MXUA 3OMGA 3SVMA 1Q90A 4KY5A 2RQXA 4K5WA 1BOSA 4E6IA 2SDFA 4ABNA 3IFDA 4XQJA 5EQ0A 3DM1A 4KHZA 2XRSD 1GHJA 5HURA 3R3OA 1HFGA 2NBFA 4H44C 3J80L 4A3FB 2K03A 4DAPA 3QJYA 1SYFA 4FF2A 2WIIB 2RA4A 1RD9D 3J7AV 4RGTA 3K5NA 5ELCA 2YU9B 4BWGB 3MEHA 3NE5B 2IT1A 3TN2A 4UDUC 3TZDA 3S17B 4CKBA 4A3DB 1O80A 4R8NA 1GJXA 1EQVA 3I4LA 5EKKA 2H4OA 2A6EC 2HUGA 1SNPA 3T53B 1STGA 4J6HA 1SYEA 2K33A 2KUMA 2IX1A 2KVMA 3DHQA 2HCCA 1RTNA 1K83B 1ICWA 3TBIB 1CT1D 2EDGA 2MP1A 3GTKB 1NCVA 1X3QA 2M2LA 3HOVB 4IFDH 3HEJA 1F9QA 1BCPD 3MFYA 1STYA 2K32A 4LAAA 1R4QB 3PV0A 1GHKA 2H1EA 1A3UA 4Z9CB 1HUNA 5KEEA 3VR4A 1JC7A 4MHEA 3OIQA 3VA5A 2XSCA 1TT2A 3CHBD 2Z1CA 4ZQ3A 4O42A 1LT6D 1B9MA 2NUCA 3SK4A 1WTQA 2OXPA 4DF7A 2PO4A 1PRTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  3V2T A;  1JOQ A;  4KD4 A;  1EZ8 A;  5KIX A;  1SYG A;  4K2K A;  3D4D A;  1A2U A;  1EYA A;  4HMI A;  4TRD A;  5IGB A;  4HTH A;  4PMC A;  5IGD A;  5CC4 A;  4KD3 A;  4OL7 A;  1IHZ A;  4EQN A;  4K6D A;  3MEH A;  5K5P A;  4K14 A;  4RKL A;  4KHV A;  2F0T A;  2F0O A;  2RBM A;  5CV9 A;  2QDB A;  4KY6 A;  1STN A;  2SOB A;  4S3S A;  2PZT A;  4WRD A;  5IGE A;  2OEO A;  4MIU A;  4ID6 A;  1EY8 A;  2KHS A;  3HZX A;  4R8N A;  4ME5 A;  4EVO A;  5CV8 A;  4B9W A;  1SNM A;  1EQV A;  5EKK A;  1STB A;  5I6Y A;  4RKB A;  5KYL A;  4PMB A;  1SNQ A;  5M9O A;  3MHB A;  2OF1 A;  4K2L A;  1SNP A;  4HMJ A;  3PMF A;  2F0Q A;  1STG A;  4J6H A;  4QF4 A;  3SR1 A;  3SK6 A;  3EJI A;  1SYE A;  3MVV A;  2F0F A;  3BDL A;  3SK5 A;  2PYK A;  5DAU A;  3EVQ A;  3D8G A;  4KTA A;  5EGT A;  5IGF A;  1A3V A;  1ENC A;  1F2M A;  2HQE A;  2F0E A;  4KJO A;  5E1F A;  2F0G A;  2ENB A;  2F0N A;  2RDF A;  3LX0 A;  4ZUJ A;  5IGG A;  5J22 A;  1EYC A;  1AEX A;  4PNY A;  3SK8 A;  3ERO A;  1EY4 A;  3P75 A;  4B9X A;  1II3 A;  4EQP A;  5C3W A;  4I65 A;  1NUC A;  2EYF A;  2F0I A;  5J1Z A;  5C3X A;  2WAC A;  5HUR A;  1JOO A;  4G57 A;  5I6W A;  3DHQ A;  2PZW A;  5C6A A;  1SNC A;  2EYJ A;  5CV7 A;  2F0H A;  3H6M A;  3SXH A;  5HGT A;  3T13 A;  5CV4 A;  1SND A;  4YIJ A;  5EKL A;  5NUC A;  5KYI A;  2KQ3 A;  3C1E A;  5CV6 A;  3NHH A;  2EY2 A;  4DFA A;  2M00 A;  3TME A;  4J1M A;  1KDC A;  2EXZ A;  5C5M A;  1U9R A;  2O4X A;  3QOL A;  2EYL A;  2PQE A;  2F3V A;  2EYO A;  3P1H A;  5IOC A;  3TP8 A;  1TQO A;  5JAV A;  2EY6 A;  2RKS A;  1EY7 A;  3NUC A;  3OSO A;  2LKV A;  4QB4 A;  1EY6 A;  1KAA A;  3HEJ A;  5F2D A;  4IZ8 A;  5I9O A;  1TR5 A;  4EQO A;  3TP5 A;  1EY0 A;  3ERQ A;  3OMG A;  4NDX A;  1EY9 A;  3DMU A;  1ENA A;  3NK9 A;  3U9O A;  4DGZ A;  1NSN S;  1SYD A;  3RUZ A;  4KY5 A;  3TP7 A;  1STY A;  5C4H A;  4IUN A;  3MXP A;  1KDB A;  5CR3 A;  3NP8 A;  4K5W A;  4LAA A;  3NQT A;  3S9W A;  1JOK A;  2F0S A;  1SNO A;  4QMG A;  5DEH A;  4ZUI A;  1KAB A;  1KDA A;  4E6I A;  5IGC A;  4N9P A;  1EY5 A;  1STA A;  4KV6 A;  4N9T A;  5KRU A;  1JOR A;  5I9P A;  4ODG A;  5J39 A;  1A3U A;  2F0V A;  1SYC A;  3OWF A;  4NMZ A;  5KGU A;  5KEE A;  2F0K A;  4K8J A;  4KJN A;  3VA5 A;  1EYD A;  1TT2 A;  3D6C A;  3R3O A;  4F7X A;  2F0W A;  4H7B A;  2F0D A;  3C1F A;  3TP6 A;  2EYM A;  3ITP A;  5JOB A;  5IOD A;  3E5S A;  5C5L A;  2EY5 A;  2PW7 A;  4NKL A;  5CGK A;  3NXW A;  1RKN A;  3QB3 A;  4IAL A;  4K5X A;  3SHL A;  4KY7 A;  4NP5 A;  5IIF A;  5ISR A;  5E3F A;  2PZU A;  4ZQ3 A;  1STH A;  4WOR A;  2SNM A;  1F2Z A;  2SNS A;  3OMC A;  3T16 A;  1F2Y A;  4DF7 A;  2F0J A;  1EZ6 A;  2F0P A;  5C4Z A;  2EYP A;  2PW5 A;  1A3T A;  4F8M A;  1A2T A;  4K8I A;  2NUC A;  2F3W A;  3SK4 A;  3D4W A;  1SYF A;  3BDC A;  2F0U A;  2OXP A;  4DU9 A;  2EYH A;  2EY1 A;  1SYB A;  2F0L A;  3QOJ A;  2F0M A;  4K5V A;  5CV5 A; 
#chains in the Genus database with same CATH topology
 4KKT A;  3RZD B;  1U4L A;  3UDF A;  3A5Z B;  1FJG L;  3HKS A;  4EQN A;  3CCE A;  4OIK A;  5K36 H;  5K5P A;  1N36 L;  1CSQ A;  2DGY A;  2NZO A;  2F0T A;  1K73 C;  1B50 A;  2JP1 A;  1K9M C;  2IY5 B;  4LJZ C;  4N8F A;  3KF8 B;  1EQR A;  4X6A H;  1WFQ A;  1H9J A;  1HZB A;  3VA7 A;  1AE2 A;  4NPS A;  4C3H B;  5KND A;  1VQ6 A;  3MFG A;  5FLX E;  4LUZ A;  3FEW X;  2ZXO A;  3CRK C;  1YJW A;  1F2M A;  3QO2 A;  3GQB A;  1KD1 C;  4XTC S;  4FYD A;  5IE8 A;  3K5L A;  5JJK A;  4H02 A;  4BXX H;  1HTP A;  1F9S A;  1QWY A;  4RWS C;  1LT3 D;  2PNH A;  1I94 Q;  5M3F H;  1VQ9 A;  2K6A A;  3S2H H;  2V1C C;  3JAM i;  3HRZ C;  4KN7 C;  1G2S A;  1J6Q A;  1B7Y B;  1JMC A;  1PFM A;  3QR8 A;  3MEF A;  3UI2 A;  1NSN S;  1QB5 D;  3TP7 A;  3EQL C;  2A69 D;  3AU7 A;  4OHJ A;  2F0S A;  1STA A;  3FVQ A;  3ONA B;  2F0V A;  1SYC A;  4BY1 H;  4A3D G;  1O7L A;  4GOP A;  3A56 A;  1LTS D;  1V9P A;  2B2Y A;  4DKA C;  4C3J H;  3PO3 B;  4IQZ A;  2EY5 A;  3DWQ A;  2KEN A;  1TWC B;  4YCU A;  4DXG A;  5IT9 c;  2ZTE A;  4DR1 Q;  1PH3 A;  1V43 A;  5EJW A;  3BS1 A;  2K5H A;  1G29 1;  4GLV B;  1EEI D;  5E3F A;  2WKC A;  2Z6K A;  1JIC A;  2KED A;  5IYB G;  5C4Z A;  1GOZ A;  2KCT A;  1HZC A;  1IL8 A;  4DR6 L;  4DV7 L;  2EY1 A;  1YNX A;  2F0M A;  3QIA A;  2KCC A;  3M9B A;  1W6J A;  5KIX A;  1SYG A;  1EYA A;  4HMI A;  1HNW L;  5CC4 A;  1XNR L;  1QOH A;  1Y14 B;  1EFI D;  2JN4 A;  2E2H H;  4K6D A;  2FFK B;  3I4N B;  4LW1 A;  4K6L A;  1ILP A;  3I73 A;  4KY6 A;  2JK8 A;  1BBX C;  5ELN A;  1UE1 A;  3J7Y W;  4GOP B;  3NBH B;  1L0Y B;  2JQO A;  1W2B A;  4R9W A;  3ER0 A;  5JEA G;  3CCQ A;  4BY7 G;  2D62 A;  3OOC A;  2IL8 A;  5C4X G;  5M3M H;  4TSS A;  1TKW B;  1PZI D;  1D6E C;  3EJI A;  1CTM A;  2JA6 B;  3CCV A;  2B2Y C;  2XIW A;  2B2W A;  4DUY Q;  1LAC A;  3Q23 A;  1DYQ A;  1TU2 B;  1LTT D;  5HY6 A;  1AEX A;  3VDY A;  2IWH A;  3C46 A;  1BCP C;  2HQL A;  2YV5 A;  2R7Z H;  1TY2 A;  3HFZ B;  1SAP A;  1XMO L;  5EKL A;  4DR6 Q;  3Q22 A;  1E2V A;  2KQ3 A;  3CD6 A;  1PTO B;  2CW0 D;  5I2X A;  2MHV A;  1K8G A;  1ML0 D;  3CCU A;  3QOL A;  1VQC A;  1TS5 A;  4YWM A;  1TVX A;  4QUF A;  2OTJ A;  4FXG C;  2RKS A;  2JEB I;  1S5F D;  1X65 A;  5A2Q L;  1C9O A;  3PUV A;  2MQH A;  3TQY A;  4HJ8 A;  1IBL Q;  3TP5 A;  4NDX A;  1XNQ Q;  2F4V L;  1JWS D;  4C2M B;  4JI8 Q;  3PF4 A;  1NE3 A;  1I50 B;  1N33 L;  1LT4 D;  3V05 A;  5BN5 A;  3JAM L;  4ZUI A;  4DNT B;  3J81 L;  1EY5 A;  1YNJ D;  4AYB E;  1GUT A;  1QZG A;  2CQA A;  1I4R A;  2WV6 D;  5FOB B;  3HOU B;  2LSS A;  4CBV A;  2VNU D;  3HOZ H;  3M4O H;  2VY3 A;  4ZRZ A;  4JI8 L;  2NVT B;  3HOU G;  4C3H G;  2QIL A;  3N6R A;  2NVX H;  4RAU C;  3QB3 A;  2K5N A;  3PIO 3;  1I3Q H;  3SHL A;  4KY7 A;  1GM5 A;  4MZ9 A;  3OPO A;  1I6H H;  3D0F A;  3OMC A;  5JPN C;  4A3M B;  3STB D;  5FLX L;  4LFC L;  2CCZ A;  3D4W A;  3HOV G;  4L6T B;  3HOV H;  3GTM H;  1PFN A;  2PNR C;  3HOZ G;  3K59 A;  2QEX A;  3RN2 A;  2HHH Q;  3KF8 A;  1ET9 A;  5G3L D;  3ZJY C;  3HOZ B;  2K5V A;  4YWL A;  5IGE A;  3S1N H;  1AW7 A;  2UXC Q;  4LF4 Q;  1GUG A;  1G8Z D;  1CFM A;  1VQ4 A;  2WP8 J;  2VQF Q;  1SNM A;  1O7I A;  3RMH A;  4RKB A;  5M9O A;  4DR3 Q;  1FYC A;  1VQK A;  1VQO A;  4HMJ A;  3H3V H;  3NSW A;  3E9H A;  1S4Z A;  1T5X D;  4HSP A;  1A3V A;  4DR7 L;  5H1S E;  2ZTC A;  4A3E H;  4ZAI A;  2O5I C;  5J22 A;  3PQI A;  1YNN C;  4B9X A;  1MJE A;  4IOA A;  5C3X A;  1PMR A;  2I5M X;  1YJN A;  1MHW C;  1WTH A;  3PIP A;  1F9R A;  1L1O B;  1CQV A;  5KYI A;  4YIJ A;  2B2T A;  1JJG A;  1EL0 A;  3TME A;  2DNC A;  4J1M A;  3IKJ A;  1JB3 A;  1OXV A;  2PQE A;  4PV1 C;  1KTK A;  4RHR A;  2OT2 A;  1QVF A;  1KRS A;  4LF8 L;  1HNZ L;  3HP3 A;  2VUM B;  1FR3 A;  3NWS A;  2VZA A;  5IP9 H;  3G48 A;  4GN3 B;  4IUN A;  5COY A;  1KDB A;  1BO0 A;  1V1P B;  1FVI A;  1QG7 A;  1KDA A;  1VF5 C;  4XQQ A;  4DV6 L;  1JR0 D;  2KHI A;  4DUZ Q;  3J80 c;  4B3T L;  5C4X H;  1PA6 A;  4L63 B;  4DV4 L;  4O0A A;  3CP0 A;  1OTC A;  3T51 B;  3D6C A;  4JOI C;  4F7X A;  4JV5 L;  4JI1 Q;  4NB3 A;  1WD1 A;  4O1N A;  4IAL A;  1STE A;  3W2D A;  1Q86 C;  3NTI A;  4DK1 A;  4RHS A;  5C4J B;  4PMW A;  2UUC L;  4Q0F A;  4X64 Q;  1B9N A;  1O7Z A;  3M4Y A;  4M8A A;  1PTO C;  3DXJ C;  4DU9 A;  2FHT A;  3I7F A;  1X9N A;  1TY0 A;  1SRO A;  3AB9 A;  4J8Q A;  4NXM Q;  3VYS A;  1A15 A;  1EZ8 A;  1FL0 A;  1UE6 A;  4CDE C;  5ELB A;  2QW7 A;  2A8V A;  3R8B A;  1HTL D;  4DK6 C;  1BUV T;  1AN8 A;  1ET6 A;  2A73 B;  3GTO H;  2R93 G;  4IUQ A;  5CV9 A;  4QCL A;  2A74 C;  3CC2 A;  2OWO A;  3L7Z C;  4ME5 A;  5E4W C;  1ESF A;  1Y1V B;  3FHW A;  2EJM A;  1CZG A;  5FLM G;  5FJ8 G;  5C3E H;  1P8L A;  5A2Q E;  1EFW A;  2NWG A;  3IFT A;  1HNX Q;  3CME A;  2JA7 B;  3UE0 A;  4AQY L;  1QCB D;  2K52 A;  5E1F A;  1Z6H A;  2ENB A;  2UU9 Q;  3W1B A;  2A6H C;  1HR0 L;  2JA7 G;  3HG9 A;  4XT1 B;  4Y7N B;  2A6E D;  3BYT B;  2AMC B;  5J1Z A;  1YIJ A;  1AZP A;  5I6W A;  3TS2 A;  1CSP A;  4DA2 A;  2AWN A;  1E7Z A;  1OXU A;  4JI7 Q;  4C56 C;  4BBR B;  4QIW E;  3S14 H;  4ZYS A;  2N3S A;  5AFW A;  3KYH C;  2EVB A;  5G3L F;  2B63 G;  4QB4 A;  2D5D A;  2N8N A;  1I6V C;  1DCZ A;  1YIT A;  4HJ7 A;  2NYZ D;  4G7H C;  3JAM E;  4FF3 A;  3CW2 C;  4DV2 Q;  4PG3 A;  1JOK A;  4LMQ D;  3A5U A;  4KV6 A;  4P71 A;  1I50 H;  2Q8T A;  4ODG A;  2WFW A;  2JA6 G;  4DAY A;  4X62 L;  2F0K A;  1DOK A;  3VR6 A;  5DM6 3;  4WJ3 M;  1B1Z A;  1HPC A;  5D14 A;  5JOB A;  4RGO S;  1K8A C;  3E5S A;  4A93 B;  1XTD A;  4QJF A;  3SEB A;  4K0K L;  1F2Z A;  2NVQ H;  1F2Y A;  1N8R C;  3A74 A;  3KLS X;  1IW7 C;  1EWC A;  4XQN A;  1B2T A;  2KBN A;  4K5V A;  4UP7 A;  1BR9 A;  1J5E Q;  2KEC A;  1CA5 A;  1ASY A;  3R93 A;  4JVZ A;  4K0K Q;  2E8G A;  4HJ5 A;  3RR5 A;  1B53 A;  1Z47 A;  1KIX A;  4DNI A;  1HZA A;  4LF6 L;  2DY7 A;  4RKL A;  2RBM A;  5M3M B;  2SOB A;  2XN9 C;  3ERS X;  2HT1 A;  1PH2 A;  3KBG A;  2K5Q A;  2IPK D;  3U4V A;  3VYU A;  3OWE B;  2R61 A;  2RF4 A;  2OF1 A;  3E9I A;  2JYO A;  4IPG A;  3SK6 A;  3G6E A;  2VS1 A;  5FLX c;  3BDL A;  3EVQ A;  4H13 C;  3NEN A;  1ENC A;  3AEV A;  2F0G A;  2AQ3 B;  2L4N A;  3RNU A;  3A54 A;  1EYC A;  3MC0 B;  1KNA A;  4LWC A;  3KOJ A;  5EKI A;  3S1R H;  3ULL A;  1LT5 D;  4N8X 1;  5CV4 A;  1WD0 A;  1S3O A;  5EPK A;  4DK3 C;  1RDP D;  1VQD A;  2E2I B;  4OX9 Q;  2KCN A;  1Z7T A;  1TWC H;  1D5M C;  1X54 A;  4IZ8 A;  4OEL B;  1LTB D;  4R4C A;  1N36 Q;  1J8I A;  5M5W B;  4GN4 B;  4LF5 L;  1EY9 A;  5IT9 E;  5IGC A;  1P16 A;  1EIF A;  4BY1 B;  1MI2 A;  2Q8I B;  3KK7 A;  4JW0 A;  1PDQ A;  2ZJP A;  3S2D H;  4BY1 G;  4A3D H;  1E24 A;  4YWK A;  2NVY B;  3CCJ A;  1Q3L A;  4GKJ L;  2LFN A;  4KJN A;  3UE1 A;  4A76 A;  5EPJ A;  3DM3 A;  2F4V Q;  2RCF A;  2QKI C;  2Z4H A;  3LWU A;  3NXW A;  1D2B A;  1J9O A;  1NJI C;  1N9W A;  4A3J H;  1H9K A;  2VXW A;  1D1K A;  2D0P A;  2PQA A;  3R2I A;  3UDI A;  5C0X H;  2BDN A;  4M1U B;  1EZ6 A;  2F0P A;  4H0L C;  4K8I A;  4JPB W;  2FIN B;  4A3F H;  3IL8 A;  1BDO A;  1S72 A;  1XX8 A;  2OQ0 A;  1Q81 C;  3FMC A;  3I4M B;  1GUS A;  5JJL A;  3V2T A;  1SFO B;  1JOQ A;  4KD4 A;  3S1Q H;  3G4S A;  1U4R A;  4RG1 A;  3D4D A;  2NZ1 D;  3KLW A;  1PXU A;  3G71 A;  4BA2 I;  1MJC A;  4OL7 A;  1E1T A;  1PV4 A;  1KAW A;  3VR3 A;  4JI6 L;  3E3X A;  3G7L A;  1UE5 A;  3S15 B;  1HCZ A;  4V19 0;  3J80 i;  2OEO A;  2XWB B;  2DNE A;  2RSO A;  1CQF A;  2KHS A;  3BU2 A;  5IY0 A;  4KI0 A;  4TQU S;  3RLN A;  4DR3 L;  4HJ9 A;  5LMN Q;  1SMX A;  3I70 A;  3I4M H;  3F2U A;  3RZD H;  1HH2 P;  4CKE A;  1SE4 A;  4LF4 L;  2XWJ B;  4C1N K;  3RLF A;  3CCM A;  2VW9 A;  5A35 A;  4CHT B;  2CWA A;  1EY4 A;  3LWE A;  4JI3 L;  3M4Q A;  2L12 A;  4C3I G;  3CCS A;  2EYF A;  1UUP A;  1VDZ A;  5IT9 L;  1UEA B;  4A3J B;  3AYH B;  1I4G A;  4Y7N H;  4Q5V A;  3GTQ H;  3SXH A;  5ELD A;  3DLL A;  1H9S B;  5NUC A;  1VS0 A;  3HKZ B;  4A3J G;  2RDG A;  1EWH A;  2Q2T A;  1GD7 A;  1QNU A;  1OO9 B;  2E2J B;  5JEA H;  3P1H A;  1T9H A;  2XRQ D;  1TWA B;  1M90 C;  3NWT A;  2R93 H;  3PO2 B;  3KJO A;  3DEP A;  4JI6 Q;  5M5Y B;  3TEH B;  1IBM Q;  2E2J H;  4CKC A;  1W6K A;  5ELE A;  2K1B A;  2KJX A;  4GNX A;  3GTO B;  4GKK Q;  1FNU A;  1WJJ A;  1SEB D;  4C3I H;  4FVM A;  3GTQ B;  4N9P A;  2AWO A;  1EYG A;  5M5W H;  3MXN B;  4DV7 Q;  5KGU A;  3CC4 A;  4DV3 Q;  1CA6 A;  2JA5 B;  1VQE A;  2E2I H;  1H9M A;  1DM0 B;  2O5J C;  2F0D A;  2EYM A;  3HS0 C;  4XXE A;  3U50 C;  2ZM6 Q;  2CKZ B;  5JVG 3;  3H91 A;  3CAM A;  1SJE D;  1X55 A;  2ICI A;  3T4A C;  4JI0 L;  2AQ2 B;  1CHQ D;  1NMF A;  4BA1 I;  1K83 H;  4BXX G;  3UDX A;  3HOX G;  3M4P A;  3PUZ A;  5I4D A;  4JG2 A;  3S16 B;  3OW7 A;  3GV3 A;  2KA7 A;  3PUY A;  4DV1 Q;  3PGZ A;  3MZ5 A;  3BYY B;  2F3I A;  4HIK A;  2B3G A;  3GTG H;  4YHH L;  3E0E A;  3EN2 A;  2CH4 W;  3K81 C;  1VQG A;  2CWP A;  2LS0 1;  4OXP A;  1BVS A;  3A55 A;  4J15 A;  3S1Q B;  3LNN A;  3J81 E;  5J3B A;  1FJG Q;  2F0O A;  3K0Y A;  1Q8I A;  5LMU Q;  4ID6 A;  1PRT C;  1WYD A;  3MXN A;  3CPF A;  4HIM A;  4BY7 H;  1PH8 A;  3S17 H;  2PPB C;  2B8G A;  1X3E A;  3PSI A;  1IL2 A;  1FGB D;  4B3S L;  4RGM A;  3VYT A;  4LFA Q;  5IGF A;  4BS9 A;  2FMM A;  4P74 A;  3KLR A;  2Z6B A;  2CW0 C;  2Y0S B;  1IBL L;  1XPR A;  1XNQ L;  4A3E G;  2NVQ B;  1ZKO A;  2Z0S A;  5KNB A;  4DAM A;  2NVY H;  4BBS B;  1PVO A;  2R92 B;  1HNW Q;  1HFN A;  2ICE C;  3R2T A;  1X32 A;  3BZD B;  2NTS A;  3I3C A;  2MO0 A;  3H0G G;  2YTY A;  2EYL A;  1PLF A;  1OXT A;  3TP8 A;  2A68 C;  3VR5 A;  3NUC A;  1OXX K;  1K8M A;  1NNX A;  2G9H D;  2BA1 A;  5GAH C;  1EIH A;  3CQZ H;  1KHI A;  5JPM C;  1HHV A;  4HCS A;  5GAD C;  1ENA A;  4HED A;  5AJ3 L;  1IYV A;  2WB1 E;  2Q8R E;  1YNN D;  1G6P A;  4GN5 A;  4HAE A;  3NP8 A;  3BZC A;  1XXG A;  3NQT A;  5COR A;  4QMG A;  3T1Y Q;  1TWG B;  1TXY A;  3SE0 A;  2B8F A;  2N49 A;  2EZV A;  3I55 A;  1R9T B;  5C44 B;  4A3B H;  1K28 A;  2A5H A;  1NR2 A;  1LTL A;  1TS3 A;  3NQI A;  2WKD A;  4H7B A;  1UNS A;  1XMO Q;  3K0X A;  1AE3 A;  2NN6 I;  4UAI A;  1DZ1 A;  4RCN A;  1IYJ B;  1F2L A;  2SNM A;  1Y1W G;  4DV0 L;  2NVX B;  2AKW B;  4C3I B;  1XPO A;  3BVG A;  2F3W A;  2K14 A;  2ALY B;  2CH4 A;  1N32 L;  4IUU A;  2JA7 H;  1TS4 A;  3HKZ G;  1ZYR C;  1N33 Q;  5FO8 B;  4R4O A;  3ND9 A;  1B8A A;  4V0B A;  4ZKB B;  2EQS A;  2GVA A;  4A3B G;  3H3V C;  2R93 B;  5IGD A;  4QL5 A;  1EQQ A;  2A68 D;  3I4M G;  4KD3 A;  2KEE A;  3K58 A;  2D9U A;  3ZYY X;  2B39 A;  1H9R A;  1I4P A;  1E2W A;  1F77 A;  5DNF A;  3HZX A;  2ASB A;  1X56 A;  1D8L A;  5BN4 A;  2DJF C;  1KNE A;  2CVR A;  1QNK A;  1WOC A;  3IAY A;  1S5E D;  2J4X A;  3M7G A;  2GA4 B;  4A93 H;  3SK5 A;  2HIX A;  2UXB Q;  4CJ1 B;  1Y69 U;  3F2C A;  2OCE A;  3U9S A;  4DK0 A;  3W5O A;  2RDF A;  3CU7 A;  3H0G H;  5IP9 G;  1BBW A;  1JE5 A;  1ESR A;  4ZKC B;  2R7Z B;  4DXF A;  1SE3 A;  4XYQ A;  1RHP A;  3T1H Q;  2F0I A;  2WAC A;  3RZO B;  1JOO A;  4G57 A;  4ZK9 B;  1CKM A;  4PZ6 A;  4EX5 A;  2C9O A;  2K75 A;  1K0R A;  1J5E L;  4B3T Q;  2EXZ A;  2XTI A;  3HOY G;  1X3P A;  4KN4 C;  1I4X A;  2JA8 H;  4HR7 B;  2RSN A;  4X3T A;  2IJ0 A;  3K7A B;  1GXD C;  1EY7 A;  1ENF A;  1JT8 A;  1KL9 A;  1KAA A;  2C5C A;  5D3D A;  2R7D A;  4OO1 G;  3I56 A;  4U67 3;  4RCO A;  2HCI A;  3P20 A;  3ERQ A;  1SYD A;  4GLX A;  1PTO D;  1UE7 A;  2IX3 A;  2C35 B;  1SLJ A;  4ME3 A;  5CR3 A;  5DLQ E;  3S9W A;  1TWF B;  5LMN W;  5FO7 B;  5I2Y A;  2CFM A;  1IKL A;  2Q2H A;  2QDL A;  3I8Z A;  3GO5 A;  5EBD A;  1I4H A;  4YY3 L;  2EJF C;  5BN3 A;  2E76 C;  4XYO A;  1L0X B;  1IBK L;  2A19 A;  4GZY C;  5CMD A;  3TP6 A;  2LY7 A;  5JJI A;  4PQX A;  5ELF A;  4NKL A;  3TRE A;  3GTL B;  5CGK A;  2QGQ A;  3GTP B;  4OWX B;  1CUK A;  2PZU A;  4C3J G;  2K50 A;  2SNS A;  3T16 A;  1TS2 A;  1N34 L;  1E1O A;  2EYP A;  2L5T A;  3PO3 H;  4C3J B;  2WAQ G;  1CM9 A;  3OIP A;  4LFC Q;  2V4D A;  2F0L A;  5LL6 S;  5GAE C;  2R7F A;  1WCM H;  1FNV A;  3KDF B;  2VL6 A;  4TRD A;  4PMC A;  1WTP A;  3X3M A;  2XNA C;  1EEF D;  1VMP A;  2DUD A;  3DWA A;  3D31 A;  4B3R L;  1STN A;  3PUX A;  1MKH A;  3GTP H;  2Q2I A;  2DJG C;  4YY3 Q;  3UDG A;  5CV8 A;  5I6Y A;  1EWI A;  3KUP A;  4PMB A;  3CCL A;  2VQF L;  1YHB A;  5C4J H;  3F1Z A;  2NB0 A;  2JSO A;  2F0Q A;  3CXC A;  4QF4 A;  4GNX B;  4WJ4 A;  3EIV A;  4IFD J;  5EGT A;  4DPG A;  3Q8D A;  4KJO A;  3DWP A;  1QVG A;  4ZUJ A;  2K04 A;  4U68 A;  2GVB A;  1V1Q A;  5T1I A;  4I65 A;  3HOX B;  3I90 A;  3KF6 A;  2J7Z A;  3WOF A;  4OO1 H;  1LTR D;  2QCP X;  4LK1 C;  3AMU A;  4X3U A;  3KJP A;  2JA8 G;  4DFA A;  4BBS G;  2WIN B;  5EPL A;  4X62 Q;  4A3K B;  4KKS A;  2F3V A;  4X66 Q;  3HOU H;  2Y0S E;  3E6Z X;  5DM7 3;  5IOC A;  1DOM A;  5EBC A;  2BOS A;  1HA5 A;  1PYW D;  5I9O A;  2TMP A;  3BZK A;  4IPD A;  4LUO A;  4EQO A;  5LL6 X;  1EY0 A;  4JI4 L;  1IBM L;  3IRB A;  3A0J A;  1TII D;  3M3Y B;  4DR7 Q;  2FXQ A;  3I72 A;  4CDC C;  1WTR A;  1PFB A;  1O7Y A;  2RHQ B;  5LMN L;  2EE1 A;  5I9P A;  4NMZ A;  4DUZ L;  2B2U A;  2Z8L A;  1QIL A;  4DR5 L;  4A3E B;  1E3P A;  5IOD A;  4DR4 L;  1EOT A;  5JJZ A;  4QY7 A;  5TSS A;  4UPA A;  3KBX A;  1DGS A;  4I7Z C;  1HQR D;  3S1M H;  2UXD L;  2CQO A;  4DNR B;  1B3Q A;  1B70 B;  1X3G A;  2F0J A;  1L0W A;  1U0L A;  2E5L L;  4X66 L;  3BDC A;  1XWE A;  4L5T A;  4JCV E;  1Y1W B;  2JA6 H;  4GS3 A;  1PRT F;  4DAV A;  2I07 B;  3FP9 A;  1VQP A;  4A3K H;  4O2D A;  1LO5 D;  3S24 A;  1C4Q A;  4FF1 A;  3BG3 A;  1EOV A;  4RGN A;  4NXN Q;  4PZ7 A;  1LTA D;  1BCP F;  3HKZ E;  1YBY A;  4B3M Q;  4QGU A;  4BBR H;  4L5Q A;  4UHV A;  3I4N H;  4A3M H;  1C0A A;  2HDM A;  2AQ1 B;  5KYL A;  4GKJ Q;  1I6H B;  3AFP A;  3EA6 A;  2BE5 C;  2YYZ A;  4K2L A;  1YI2 A;  1U4P A;  1C8C A;  3PMF A;  2AUJ D;  4ZLT F;  1X6O A;  2B2U C;  3A7L A;  1R9T H;  2PYK A;  4KTA A;  2NVT H;  1NMG A;  1SJH D;  4LF5 Q;  3LX0 A;  2JA5 G;  5IGG A;  1TWG H;  1RF2 D;  4F87 A;  4X65 L;  1A8V A;  2YTV A;  3GD7 A;  1SSO A;  1NUC A;  1IXR A;  1PZJ D;  1EU3 A;  4JBM A;  1M1K C;  1D7Q A;  3CQZ B;  5CV6 A;  3C1E A;  4DV1 L;  1Q1B A;  1YVC A;  3L3O C;  2WAQ E;  2D0O A;  4A3I B;  1A62 A;  5C5M A;  4C2M H;  5E7N A;  1WCM B;  4BBR G;  2BDO A;  1LUZ A;  3I4N G;  4R8I A;  2L15 A;  4DV5 Q;  5IYC G;  2O2L D;  5HGQ A;  2B63 B;  1VQA A;  2BCO A;  1V1O A;  3D3R A;  3FPU B;  2XVS A;  4RA8 A;  5M5X B;  3DEO A;  4OWT B;  1JOR A;  1WTW A;  4LF7 Q;  3OWF A;  3OW2 A;  4K8J A;  3NEL A;  4R4T A;  5C0X G;  4KMU C;  4IFD I;  5CYU A;  2MPM A;  3C1F A;  2B2W C;  1PYB A;  4X65 Q;  4OON A;  3NEM A;  3X3N A;  4R4I A;  3J7Z C;  2N88 A;  1S5C D;  4NP5 A;  1EIG A;  1GUO A;  2G5D A;  3KDF A;  2ID0 A;  3I91 A;  3HOY H;  2B2T C;  4CGY B;  1M4V A;  3HOW G;  2QA4 A;  3KLS A;  4IJH A;  2EYH A;  3NBH A;  3QOJ A;  4OGQ C;  5CV5 A;  5GRO A;  4DR2 L;  3K7A H;  2RVL A;  1XYI A;  2ZTD A;  3W3A A;  2JA8 B;  2E2H B;  2CHB D;  4JK1 C;  4G7Z C;  5IGB A;  4JI5 Q;  3AQQ A;  3K8A A;  4G4K A;  2TSS A;  2A69 C;  3T56 B;  1PZK D;  2I5L X;  3VR2 A;  4LF8 Q;  3A8I E;  5M3M G;  4DV3 L;  1STB A;  3MHB A;  2KCM A;  4UP8 A;  1L1O A;  2JA5 H;  2A6H D;  3I4O A;  3MVV A;  1AZQ A;  2B63 H;  5DAU A;  4JOI A;  1JJC B;  2F0E A;  3J81 j;  3SK8 A;  4RFB A;  5C3E G;  1DON A;  2K5D A;  4A3I H;  1RIP A;  2WAQ B;  3U4Z A;  2NN6 G;  5HGT A;  3DUZ A;  1MBY A;  5M5Y H;  2BA0 A;  3NHH A;  2M00 A;  3S1N B;  3FKI G;  4MTK A;  1LV9 A;  1G91 A;  2L0C A;  4AIM A;  1XMQ L;  2PMZ B;  3PF5 A;  4P2C B;  1AH9 A;  3FKI B;  5FK9 C;  4IPH A;  3MAQ A;  4A3K G;  3MWY W;  1A63 A;  5M3F G;  4CDF C;  1TR5 A;  1MIU A;  3U9O A;  4DGZ A;  3GV6 A;  4AH6 A;  3S2H B;  5ISR A;  4WFN 3;  1V8Q A;  5M3F B;  1PH7 A;  3GTM B;  4KHP L;  3MXP A;  1DXM A;  1ICF B;  5EAY A;  1QE6 A;  4IN3 A;  5DEH A;  4OIJ A;  2RDH A;  1MGS A;  1GKH A;  2VQE L;  3PO3 G;  1A6X A;  4DV6 Q;  3GTK H;  1EYD A;  1VQ8 A;  4XDX A;  1PRT D;  2EPB A;  1RL2 A;  5JEA J;  3WDN A;  3T1H L;  2K4K A;  3M4O B;  3SGI A;  3N52 A;  4FF4 A;  3S15 H;  1SDF A;  1Y1W H;  1D1I A;  2ZM6 L;  5E4X A;  4LNQ A;  4WOR A;  3M85 A;  2AUK A;  2X69 A;  2ES2 A;  1BQQ T;  2OQK A;  2HD3 A;  3JC6 6;  4AQY Q;  4NXM L;  2JEA I;  2PW5 A;  1XMQ Q;  4TVA B;  2F0U A;  2MFI A;  2NN6 H;  4A3L G;  1M8A A;  4GKK L;  1Y8N B;  1B4O A;  1HQM C;  4A3I G;  2R3Z A;  3NPP A;  1DD2 A;  4FNF A;  3M7N A;  3GDE A;  3TSS A;  2F4I A;  2LXK A;  1F9P A;  4MN3 A;  3WOE A;  3PIP 3;  2DN8 A;  3PCO B;  4G7O C;  1Y8P B;  4JV5 Q;  4EQ5 A;  2YU9 H;  1OXS C;  1UEB A;  2PCF B;  1IBK Q;  5FKA C;  1EQT A;  2B2V C;  3OHX C;  3TDQ A;  1E22 A;  4JI0 Q;  3L0O A;  3CC7 A;  2R7Z G;  4B3R Q;  2ZT9 C;  2VB3 X;  1G2T A;  2F03 A;  2K28 A;  3H3V I;  1SE2 A;  3S2D B;  1QUQ A;  2I46 A;  5LHY 1;  2K05 A;  4JI2 Q;  1FNW A;  1VQM A;  2I5H A;  4YHH Q;  1MD2 D;  2PI2 A;  2R6G A;  2HHH L;  3HOY B;  1CI3 M;  1IKM A;  5IYD G;  1AP0 A;  1HA6 A;  2K01 A;  1NAP A;  3V96 A;  1L2F A;  5FLM H;  1KDC A;  3HOX H;  1ILQ A;  3GTG B;  4L8J A;  2UUA Q;  3EBE A;  4MNO A;  2EYO A;  4R1J A;  3OSO A;  2LKV A;  1HR0 W;  5IP7 H;  3ICE A;  5F2D A;  4KLK A;  4RMF A;  1WI5 A;  1SBB B;  3TRZ A;  2JE6 I;  2MJ8 A;  3PUW A;  3DMU A;  3NK9 A;  4IUV A;  3TS0 A;  5GQO A;  3S1R B;  1HXY D;  2YTX A;  2IX0 A;  2WB1 B;  1VQB A;  1XTC D;  4R4Q A;  4B08 A;  5KRU A;  4JBK A;  2Z4I A;  3D4R A;  4JBJ A;  2P5Z X;  1K8O A;  1I94 L;  2B2V A;  2JA9 A;  1Y8O B;  2WB1 G;  1GUW A;  3RD4 A;  1ZYR D;  4FO2 A;  4HID A;  3SDZ A;  4LFB Q;  2E75 C;  1YJ9 A;  2UXC L;  3ITP A;  1D5X C;  3F2B A;  4DR4 Q;  1IW7 D;  3W1G A;  3MTS A;  2ZJR A;  1PH1 A;  3TZU A;  4IFD G;  1STH A;  4HCE A;  4L5S A;  5KNC A;  1VQ7 A;  1PFS A;  3H09 A;  2AHO B;  2M9V A;  5C0X I;  1YHA A;  2RHS B;  3K5M A;  1PHJ A;  3NTH A;  1WCM G;  3Q6S A;  4XT3 B;  1TWA H;  2FJ2 A;  1VCI A;  1JWM D;  3RLO A;  2L9H A;  3I2Z A;  2K7V A;  4KKU A;  1A2U A;  4JI4 Q;  3NTK A;  1Q8K A;  1Q1E A;  2QEJ C;  4K14 A;  4KHV A;  3FDT A;  5BR8 Q;  3BVM A;  4HSV A;  3URY A;  1EY8 A;  2PI2 E;  1LTG D;  1TWF H;  3Q0A A;  1BNZ A;  2KHJ A;  1CZW A;  1SNQ A;  1Q7Y C;  1SXT A;  1AFP A;  4CJ0 B;  4LF9 L;  1VQF A;  1H95 A;  4GOP C;  3GTJ B;  1VQ5 A;  4QUC A;  1YNJ C;  2F0F A;  1WTX A;  3KF6 B;  1BBU A;  3D8G A;  1LLR D;  2HIV A;  1LM0 A;  2F0N A;  3FRP B;  2HDL A;  3ERO A;  2OTL A;  1II3 A;  5C3W A;  1RJT A;  5IWA Q;  1C7Y A;  1XPU A;  3HOW H;  1BF4 A;  2Z6K C;  5CV7 A;  2F0H A;  1HUM A;  4DV4 Q;  1ONL A;  1SND A;  2J0T D;  1B44 D;  3S1M B;  3NBI A;  1LAB A;  3C2P A;  3RZO H;  2R92 G;  1E0B A;  4DAY B;  5L37 A;  1SFO H;  1G6Z A;  1TQO A;  2LMC B;  5CBE E;  1EY6 A;  3K80 C;  1C48 A;  1JQY D;  1SRU A;  5CBA E;  3RUZ A;  5C4H A;  1GUN A;  1RTO A;  2UXB L;  3HGB A;  1ZEQ X;  2K5W A;  1Q46 A;  1KAB A;  4N9T A;  4ILW A;  2MGS A;  3M3Y H;  1WTV A;  4OWW B;  3O13 A;  5J39 A;  1CHP D;  4X3K A;  1KLU D;  1SE8 A;  2EOT A;  4XIG S;  1YZ6 A;  1PH4 A;  1ASZ A;  3VYR A;  1VQH A;  2F0W A;  4A3L H;  1B3A A;  4RH6 A;  1Y1V H;  2B29 A;  4CDD C;  2X6L A;  4MTN A;  4OEM B;  4YCV A;  3QWN A;  2L11 A;  1VQI A;  2UUB Q;  1E2Z A;  1VF7 A;  2MNA A;  4B3S Q;  2X6G A;  1SMY D;  2EXD A;  1JWU D;  1JB7 A;  4F8M A;  1A3T A;  1Q12 A;  1A2T A;  1S5D D;  3MXG A;  3CF5 A;  4A3C G;  3QG1 A;  1SYB A;  2SEB D;  1I4Q A;  4FP5 D;  1CK1 A;  4K2K A;  1XJV A;  2UUB L;  4A3G B;  2D2C C;  1WTO A;  4EGV A;  1JE4 A;  2JXM B;  5C44 H;  4A3B B;  4A3G G;  1Y1V G;  4S3S A;  2PZT A;  4QIW B;  4WRD A;  4DR2 Q;  1I5F A;  5GAG C;  3H94 A;  4B9W A;  3G6J B;  1VMC A;  3K5O A;  2E74 C;  2N55 A;  1NR4 A;  3WWV A;  4JBW A;  1SR3 A;  1T5E A;  4DN4 M;  3SR1 A;  4IPC A;  1H9S A;  1EIY B;  2IHF A;  4DV0 Q;  3D6W A;  5C4X B;  4ULL A;  1K3R A;  2NTT A;  2Q2U A;  1CKN A;  3MA2 B;  4PNY A;  3P75 A;  3B6Y A;  1LTI D;  4TKO B;  3P7J A;  4KK7 A;  2PZW A;  3CMA A;  2EYJ A;  4JYA Q;  1BKB A;  3H6M A;  5C0X J;  3T13 A;  3STB C;  1KLG D;  3J81 c;  4L5R C;  3OTO Q;  1U9R A;  2O4X A;  1HRJ A;  1TWH B;  5JAV A;  2VB2 X;  3GTL H;  5JVH 3;  2E2D C;  3EFX D;  1V1P A;  4JYA L;  4B3M L;  4APV A;  1TWH H;  5IYD H;  1XNR Q;  2DY8 A;  1S40 A;  3CPW A;  1NY4 A;  4A4I A;  4F88 A;  4WJW A;  2MUY A;  4BY7 B;  1MSG A;  1O78 A;  2L1B A;  1SNO A;  3A8J E;  3ULP A;  5K36 G;  1PTO F;  4GLA C;  3C3L A;  1CKO A;  1S5B D;  2G9D A;  5D3I B;  1L1O C;  2EJG C;  4IUR A;  4A93 G;  2PQA B;  3L9A X;  4ZCK A;  3K57 A;  1WVL A;  5C5L A;  2PW7 A;  1RCV D;  1K3B C;  2Z9H A;  5D65 A;  1DJR D;  1RKN A;  3Q24 A;  4K5X A;  3A8K E;  3FPP A;  3OYY A;  1SMY C;  4IOC A;  5IIF A;  1KC8 C;  1MSH A;  3HOW B;  1UWV A;  3S16 H;  2VQE Q;  1JJ2 A;  2BH2 A;  1BXT A;  4JC0 A;  4LF9 Q;  2MO1 A;  1BCP B;  3GTJ H;  1R4P B;  3K6O A;  4POG A;  3S14 B;  3H0G B;  4AYB B;  1QJO A;  4HTH A;  2KOL A;  1DOL A;  1U4M A;  3J7A F;  1IYU A;  5T1G A;  1IHZ A;  3J80 E;  4KHP Q;  1ROD A;  2IW3 A;  2L55 A;  3BVZ A;  2QDB A;  2QF7 A;  4DUY L;  4GNX C;  3F2D A;  4OX9 L;  4OO1 I;  4MIU A;  1I3Q B;  1ZXT A;  4EVO A;  2BE5 D;  2PMZ E;  1HNX L;  2F52 A;  4IUT A;  4FXD A;  5FJ8 H;  3FKI H;  3KFU A;  4X3S A;  2UXD Q;  4C1N I;  4DV2 L;  3GP7 A;  1G51 A;  3CRL C;  3PO2 H;  5C3E B;  3T1Y L;  2HQE A;  1QVC A;  5C44 G;  1EU4 A;  4IUP A;  1UAP A;  4EQP A;  2F1M A;  1W3S A;  3CKI B;  4JI1 L;  4HJA A;  2A1A A;  4LFA L;  4P72 A;  2ZXR A;  5C6A A;  1SNC A;  4NW2 A;  4LUV A;  4CJ2 C;  1D5Z C;  3ND8 A;  2EY2 A;  1JCK B;  4A3C H;  1U5K A;  4UY8 C;  2ZXP A;  4POF A;  4P73 A;  4FXK C;  3BJU A;  3BDO A;  4HIO A;  1FGU A;  1GO3 E;  2EY6 A;  1PH5 A;  2FMC A;  4JI2 L;  3A7A B;  3E0J A;  5AJ3 Q;  5FO9 B;  1IZ6 A;  1FD7 D;  1PTO H;  4HN7 A;  4QQB X;  1NTG A;  3MXU A;  1HR0 Q;  3OMG A;  3ULJ A;  3SVM A;  1Q90 A;  4KY5 A;  2RQX A;  2VUM G;  4K5W A;  1YHQ A;  1KXL A;  1BOS A;  4E6I A;  4PZ8 A;  2SDF A;  1PH9 A;  4ABN A;  2IHE A;  3IFD A;  4XQJ A;  2JJQ A;  5EQ0 A;  2NZH A;  1VQJ A;  4ALP A;  3DM1 A;  4KHZ A;  2Y0S G;  1Q82 C;  2XRS D;  1GHJ A;  2RCN A;  5HUR A;  3R3O A;  1HJP A;  1HFG A;  4A3F G;  2NBF A;  4Y52 H;  3K7U C;  2UU9 L;  4H44 C;  3J80 L;  1A0I A;  1PH6 A;  4A3F B;  1QZH A;  2BH8 A;  4P75 A;  1N32 Q;  2K03 A;  3OTO L;  4DAP A;  2VUM H;  2R92 H;  4LFB L;  3QJY A;  4BBS H;  1SYF A;  4JI7 L;  2LXJ A;  4FF2 A;  2E5L Q;  2WII B;  2RA4 A;  1RD9 D;  3J7A V;  4RGT A;  3J81 i;  1HZ9 A;  3K5N A;  5ELC A;  3RN5 A;  4DR1 L;  2YU9 B;  4BWG B;  5M5X H;  3MEH A;  3NE5 B;  2XGT A;  2IT1 A;  5ELO A;  3F8T A;  4NXN L;  3TN2 A;  1VQL A;  4IJL A;  5IYC H;  4UDU C;  3TZD A;  3S17 B;  4CKB A;  4A3D B;  1O80 A;  4R8N A;  1GJX A;  4UP9 A;  1NBW A;  1EQV A;  3I4L A;  5EKK A;  2H4O A;  2A6E C;  2HUG A;  1SNP A;  3T53 B;  1STG A;  4J6H A;  1SN8 A;  1SYE A;  2K33 A;  1KRT A;  2KUM A;  5BR8 L;  4YCW A;  1CKN B;  4JI3 Q;  2IX1 A;  3J7A 5;  4LF6 Q;  2KVM A;  1K0S A;  1EUJ A;  1HNZ Q;  3DHQ A;  2HCC A;  5IYB H;  1RTN A;  4JI5 L;  3U58 A;  4DR5 Q;  1K83 B;  2H5X A;  1X3F A;  1ICW A;  3LGJ A;  3TBI B;  1CT1 D;  3PIO A;  2EDG A;  2MP1 A;  3PO2 G;  3CCR A;  5IP7 G;  3GTK B;  3L2P A;  2EIF A;  1NCV A;  1X3Q A;  2M2L A;  3HOV B;  4IFD H;  2I0Q A;  1LYL A;  3HEJ A;  1VQN A;  4A3G H;  1F9Q A;  1BCP D;  3MFY A;  4AYB G;  1STY A;  2K32 A;  1GVP A;  4LAA A;  3H15 A;  1R4Q B;  3PV0 A;  1GHK A;  2H1E A;  1A3U A;  4FDB A;  4Z9C B;  1HUN A;  1Z9F A;  5KEE A;  2N78 A;  3VR4 A;  2UUC Q;  4LF7 L;  1JC7 A;  4C3H H;  4MHE A;  4X64 L;  3OIQ A;  3VA5 A;  4I7A A;  2ZJQ A;  2XSC A;  1TT2 A;  3CHB D;  2ATW A;  5LMU L;  1QUQ B;  5IWA L;  2Z1C A;  2GN5 A;  4IO9 A;  4A3M G;  4ZQ3 A;  1PYS B;  4O42 A;  1LT6 D;  4DV5 L;  2UUA L;  3JAM c;  1B9M A;  2NUC A;  3SK4 A;  1WTQ A;  1YEZ A;  4A75 A;  2OXP A;  1KQS A;  1N34 Q;  4DF7 A;  2PO4 A;  1PRT B;  3AFQ A; 
#chains in the Genus database with same CATH homology
 4KKT A;  3RZD B;  1U4L A;  4EQN A;  4OIK A;  5K36 H;  5K5P A;  2F0T A;  1B50 A;  2JP1 A;  4LJZ C;  1H9J A;  3VA7 A;  4C3H B;  5KND A;  3MFG A;  5FLX E;  3FEW X;  2ZXO A;  3CRK C;  1F2M A;  3QO2 A;  3GQB A;  4XTC S;  4FYD A;  3K5L A;  1HTP A;  1F9S A;  1QWY A;  4RWS C;  1LT3 D;  2K6A A;  3HRZ C;  4KN7 C;  1G2S A;  1PFM A;  3UI2 A;  1NSN S;  1QB5 D;  3TP7 A;  3EQL C;  2A69 D;  3AU7 A;  4OHJ A;  2F0S A;  1STA A;  3FVQ A;  3ONA B;  2F0V A;  1SYC A;  1O7L A;  3A56 A;  1LTS D;  2B2Y A;  3PO3 B;  4IQZ A;  2EY5 A;  3DWQ A;  1TWC B;  4DXG A;  1V43 A;  5EJW A;  3BS1 A;  1G29 1;  1EEI D;  5E3F A;  2WKC A;  1JIC A;  2KED A;  5C4Z A;  1GOZ A;  1IL8 A;  2EY1 A;  2F0M A;  3QIA A;  2KCC A;  1W6J A;  5KIX A;  1SYG A;  1EYA A;  4HMI A;  5CC4 A;  1QOH A;  1EFI D;  4K6D A;  2FFK B;  3I4N B;  4K6L A;  1ILP A;  3I73 A;  4KY6 A;  1BBX C;  3J7Y W;  1L0Y B;  4R9W A;  5JEA G;  2D62 A;  3OOC A;  2IL8 A;  4TSS A;  1TKW B;  1PZI D;  1D6E C;  3EJI A;  1CTM A;  2JA6 B;  2B2Y C;  2XIW A;  2B2W A;  1LAC A;  3Q23 A;  1DYQ A;  1TU2 B;  1LTT D;  1AEX A;  2IWH A;  3C46 A;  1BCP C;  1TY2 A;  1SAP A;  5EKL A;  3Q22 A;  1E2V A;  2KQ3 A;  1PTO B;  2CW0 D;  5I2X A;  2MHV A;  1ML0 D;  3QOL A;  1TS5 A;  1TVX A;  4QUF A;  4FXG C;  2RKS A;  2JEB I;  1S5F D;  5A2Q L;  3PUV A;  3TP5 A;  4NDX A;  1JWS D;  4C2M B;  1I50 B;  1LT4 D;  3V05 A;  5BN5 A;  3JAM L;  4ZUI A;  4DNT B;  3J81 L;  1EY5 A;  1YNJ D;  1GUT A;  2CQA A;  1I4R A;  2WV6 D;  5FOB B;  3HOU B;  4CBV A;  2VNU D;  4ZRZ A;  2NVT B;  4C3H G;  2QIL A;  3N6R A;  4RAU C;  3QB3 A;  3PIO 3;  3SHL A;  4KY7 A;  3OPO A;  3OMC A;  5JPN C;  4A3M B;  5FLX L;  3D4W A;  4L6T B;  1PFN A;  2PNR C;  3K59 A;  3KF8 A;  1ET9 A;  5G3L D;  3HOZ B;  5IGE A;  1AW7 A;  1GUG A;  1G8Z D;  1CFM A;  2WP8 J;  1SNM A;  3RMH A;  4RKB A;  5M9O A;  1FYC A;  4HMJ A;  3NSW A;  1S4Z A;  1T5X D;  4HSP A;  1A3V A;  4ZAI A;  2O5I C;  5J22 A;  1YNN C;  4B9X A;  5C3X A;  1PMR A;  1F9R A;  1CQV A;  5KYI A;  4YIJ A;  2B2T A;  1EL0 A;  3TME A;  2DNC A;  4J1M A;  3IKJ A;  1JB3 A;  1OXV A;  2PQE A;  4PV1 C;  1KTK A;  4RHR A;  2OT2 A;  3HP3 A;  2VUM B;  1FR3 A;  3NWS A;  4IUN A;  5COY A;  1KDB A;  1BO0 A;  1V1P B;  1QG7 A;  1KDA A;  1VF5 C;  4XQQ A;  1JR0 D;  4L63 B;  3T51 B;  3D6C A;  4F7X A;  1WD1 A;  4O1N A;  4IAL A;  1STE A;  3W2D A;  3NTI A;  4DK1 A;  4RHS A;  5C4J B;  4PMW A;  4Q0F A;  1B9N A;  1O7Z A;  3M4Y A;  4M8A A;  1PTO C;  3DXJ C;  4DU9 A;  2FHT A;  1TY0 A;  4J8Q A;  3AB9 A;  3VYS A;  1A15 A;  1EZ8 A;  5ELB A;  3R8B A;  1HTL D;  1BUV T;  1AN8 A;  1ET6 A;  2A73 B;  4IUQ A;  5CV9 A;  4QCL A;  2A74 C;  3L7Z C;  4ME5 A;  5E4W C;  1ESF A;  1Y1V B;  2EJM A;  1CZG A;  5A2Q E;  2NWG A;  3IFT A;  2JA7 B;  1QCB D;  5E1F A;  1Z6H A;  2ENB A;  2A6H C;  3HG9 A;  4XT1 B;  4Y7N B;  2A6E D;  3BYT B;  5J1Z A;  1AZP A;  5I6W A;  4DA2 A;  2AWN A;  1OXU A;  4C56 C;  4BBR B;  4ZYS A;  5AFW A;  2EVB A;  5G3L F;  4QB4 A;  2D5D A;  1I6V C;  1DCZ A;  2NYZ D;  4G7H C;  3JAM E;  4FF3 A;  1JOK A;  4LMQ D;  4KV6 A;  2Q8T A;  4ODG A;  4DAY A;  2F0K A;  1DOK A;  3VR6 A;  5DM6 3;  1B1Z A;  1HPC A;  5D14 A;  5JOB A;  4RGO S;  3E5S A;  4A93 B;  3SEB A;  1F2Z A;  1F2Y A;  3KLS X;  1IW7 C;  1EWC A;  4XQN A;  1B2T A;  4K5V A;  1BR9 A;  2KEC A;  1CA5 A;  3R93 A;  1B53 A;  1Z47 A;  2DY7 A;  4RKL A;  2RBM A;  5M3M B;  2SOB A;  2XN9 C;  3KBG A;  2K5Q A;  2IPK D;  3VYU A;  3OWE B;  2R61 A;  2OF1 A;  2JYO A;  3SK6 A;  3BDL A;  3EVQ A;  4H13 C;  1ENC A;  2F0G A;  2AQ3 B;  2L4N A;  3A54 A;  1EYC A;  3MC0 B;  1KNA A;  5EKI A;  1LT5 D;  5CV4 A;  1WD0 A;  5EPK A;  1RDP D;  2E2I B;  2KCN A;  1Z7T A;  1D5M C;  4IZ8 A;  1LTB D;  1J8I A;  5M5W B;  1EY9 A;  5IT9 E;  5IGC A;  4BY1 B;  1MI2 A;  2Q8I B;  3KK7 A;  1PDQ A;  2NVY B;  1Q3L A;  2LFN A;  4KJN A;  5EPJ A;  2QKI C;  2Z4H A;  3LWU A;  3NXW A;  1D2B A;  1J9O A;  1H9K A;  2VXW A;  1D1K A;  5C0X H;  3R2I A;  2BDN A;  4M1U B;  1EZ6 A;  2F0P A;  4H0L C;  4K8I A;  2FIN B;  3IL8 A;  1BDO A;  1XX8 A;  3FMC A;  3I4M B;  1GUS A;  3V2T A;  1SFO B;  1JOQ A;  4KD4 A;  1U4R A;  3D4D A;  2NZ1 D;  1PXU A;  4BA2 I;  4OL7 A;  3VR3 A;  3G7L A;  3S15 B;  1HCZ A;  4V19 0;  2OEO A;  2XWB B;  2DNE A;  2RSO A;  1CQF A;  2KHS A;  4KI0 A;  4TQU S;  3I70 A;  3F2U A;  4CKE A;  1SE4 A;  2XWJ B;  4C1N K;  3RLF A;  5A35 A;  4CHT B;  1EY4 A;  3LWE A;  2L12 A;  4C3I G;  2EYF A;  1UUP A;  1VDZ A;  5IT9 L;  1UEA B;  4A3J B;  1I4G A;  4Q5V A;  3SXH A;  5ELD A;  1H9S B;  5NUC A;  3HKZ B;  2RDG A;  1EWH A;  1QNU A;  1OO9 B;  2E2J B;  5JEA H;  3P1H A;  2XRQ D;  1TWA B;  3NWT A;  3PO2 B;  3DEP A;  5M5Y B;  4CKC A;  1W6K A;  5ELE A;  2K1B A;  2KJX A;  3GTO B;  1FNU A;  1SEB D;  4FVM A;  3GTQ B;  4N9P A;  2AWO A;  5KGU A;  1CA6 A;  2JA5 B;  1H9M A;  1DM0 B;  2O5J C;  2F0D A;  2EYM A;  3HS0 C;  4XXE A;  5JVG 3;  3H91 A;  1SJE D;  2ICI A;  3T4A C;  2AQ2 B;  1CHQ D;  4BA1 I;  3PUZ A;  5I4D A;  3S16 B;  3OW7 A;  3GV3 A;  2KA7 A;  3PUY A;  3MZ5 A;  3BYY B;  2LS0 1;  3A55 A;  3S1Q B;  3LNN A;  3J81 E;  2F0O A;  3K0Y A;  1Q8I A;  4ID6 A;  1PRT C;  3MXN A;  2PPB C;  2B8G A;  1FGB D;  4RGM A;  3VYT A;  5IGF A;  4BS9 A;  2FMM A;  3KLR A;  2CW0 C;  2Y0S B;  2NVQ B;  1ZKO A;  5KNB A;  4BBS B;  2R92 B;  1HFN A;  2ICE C;  3R2T A;  1X32 A;  3BZD B;  2NTS A;  3I3C A;  2EYL A;  1PLF A;  1OXT A;  3TP8 A;  2A68 C;  3VR5 A;  3NUC A;  1OXX K;  1K8M A;  2G9H D;  2BA1 A;  1EIH A;  5JPM C;  1HHV A;  4HCS A;  1ENA A;  4HED A;  1IYV A;  2Q8R E;  1YNN D;  4HAE A;  3NP8 A;  1XXG A;  3NQT A;  5COR A;  4QMG A;  1TWG B;  3SE0 A;  2B8F A;  2EZV A;  1R9T B;  5C44 B;  2A5H A;  1NR2 A;  1TS3 A;  3NQI A;  2WKD A;  4H7B A;  1UNS A;  2NN6 I;  4UAI A;  1DZ1 A;  4RCN A;  1F2L A;  2SNM A;  2NVX B;  4C3I B;  3BVG A;  2F3W A;  4IUU A;  1TS4 A;  1ZYR C;  5FO8 B;  3ND9 A;  4V0B A;  4ZKB B;  3H3V C;  2R93 B;  5IGD A;  2A68 D;  4KD3 A;  2KEE A;  3K58 A;  2D9U A;  3ZYY X;  2B39 A;  1H9R A;  1I4P A;  1E2W A;  1F77 A;  5DNF A;  3HZX A;  5BN4 A;  1KNE A;  2CVR A;  1QNK A;  3IAY A;  1S5E D;  2J4X A;  3M7G A;  2GA4 B;  3SK5 A;  4CJ1 B;  1Y69 U;  3U9S A;  4DK0 A;  2RDF A;  3CU7 A;  1ESR A;  4ZKC B;  2R7Z B;  4DXF A;  1SE3 A;  4XYQ A;  1RHP A;  2F0I A;  2WAC A;  3RZO B;  1JOO A;  4G57 A;  4ZK9 B;  2C9O A;  2EXZ A;  1X3P A;  4KN4 C;  1I4X A;  4HR7 B;  2RSN A;  4X3T A;  2IJ0 A;  3K7A B;  1GXD C;  1EY7 A;  1ENF A;  1KAA A;  2C5C A;  5D3D A;  4OO1 G;  4U67 3;  4RCO A;  2HCI A;  3P20 A;  3ERQ A;  1SYD A;  1PTO D;  2IX3 A;  5CR3 A;  3S9W A;  1TWF B;  5FO7 B;  5I2Y A;  1IKL A;  3I8Z A;  3GO5 A;  5EBD A;  1I4H A;  2EJF C;  5BN3 A;  2E76 C;  4XYO A;  1L0X B;  4GZY C;  5CMD A;  3TP6 A;  2LY7 A;  4PQX A;  5ELF A;  4NKL A;  3GTL B;  5CGK A;  3GTP B;  2PZU A;  4C3J G;  2SNS A;  3T16 A;  1TS2 A;  2EYP A;  2L5T A;  4C3J B;  1CM9 A;  3OIP A;  2V4D A;  2F0L A;  5LL6 S;  1FNV A;  4TRD A;  4PMC A;  1WTP A;  3X3M A;  2XNA C;  1EEF D;  1VMP A;  3DWA A;  3D31 A;  1STN A;  3PUX A;  5CV8 A;  5I6Y A;  3KUP A;  4PMB A;  2NB0 A;  2JSO A;  2F0Q A;  4QF4 A;  4IFD J;  5EGT A;  4KJO A;  3DWP A;  4ZUJ A;  2K04 A;  4U68 A;  5T1I A;  4I65 A;  3HOX B;  3I90 A;  2J7Z A;  3WOF A;  4OO1 H;  1LTR D;  2QCP X;  4LK1 C;  3AMU A;  4X3U A;  4DFA A;  2WIN B;  5EPL A;  4A3K B;  4KKS A;  2F3V A;  3E6Z X;  5DM7 3;  5IOC A;  1DOM A;  5EBC A;  2BOS A;  1HA5 A;  1PYW D;  5I9O A;  2TMP A;  4EQO A;  5LL6 X;  1EY0 A;  1TII D;  3M3Y B;  3I72 A;  1WTR A;  1PFB A;  1O7Y A;  2EE1 A;  5I9P A;  4NMZ A;  2B2U A;  2Z8L A;  1QIL A;  4A3E B;  5IOD A;  1EOT A;  5JJZ A;  5TSS A;  3KBX A;  4I7Z C;  1HQR D;  4DNR B;  2F0J A;  3BDC A;  1XWE A;  1Y1W B;  1PRT F;  4DAV A;  2I07 B;  1LO5 D;  1C4Q A;  4FF1 A;  3BG3 A;  4RGN A;  1LTA D;  1BCP F;  2HDM A;  2AQ1 B;  5KYL A;  1I6H B;  3EA6 A;  2BE5 C;  2YYZ A;  4K2L A;  1C8C A;  1U4P A;  3PMF A;  2AUJ D;  4ZLT F;  2B2U C;  3A7L A;  2PYK A;  4KTA A;  1SJH D;  3LX0 A;  5IGG A;  1RF2 D;  4F87 A;  3GD7 A;  1SSO A;  1NUC A;  1PZJ D;  1EU3 A;  3CQZ B;  5CV6 A;  3C1E A;  1Q1B A;  3L3O C;  4A3I B;  5C5M A;  1WCM B;  2BDO A;  4R8I A;  2O2L D;  2B63 B;  2BCO A;  3FPU B;  1V1O A;  3D3R A;  2XVS A;  4RA8 A;  5M5X B;  3DEO A;  1JOR A;  1WTW A;  3OWF A;  4K8J A;  5C0X G;  4KMU C;  4IFD I;  5CYU A;  2MPM A;  3C1F A;  2B2W C;  3X3N A;  2N88 A;  1S5C D;  4NP5 A;  1EIG A;  1GUO A;  2ID0 A;  3I91 A;  2B2T C;  4CGY B;  1M4V A;  3KLS A;  2EYH A;  3NBH A;  3QOJ A;  4OGQ C;  5CV5 A;  2RVL A;  1XYI A;  3W3A A;  2JA8 B;  2E2H B;  2CHB D;  4JK1 C;  4G7Z C;  5IGB A;  4G4K A;  2TSS A;  2A69 C;  3T56 B;  1PZK D;  3VR2 A;  3A8I E;  1STB A;  3MHB A;  2A6H D;  3MVV A;  1AZQ A;  5DAU A;  2F0E A;  3SK8 A;  4RFB A;  1DON A;  2K5D A;  2WAQ B;  2NN6 G;  5HGT A;  3DUZ A;  1MBY A;  2BA0 A;  3NHH A;  2M00 A;  3S1N B;  1LV9 A;  1G91 A;  2L0C A;  2PMZ B;  4P2C B;  3FKI B;  5FK9 C;  3MAQ A;  3MWY W;  1TR5 A;  3U9O A;  4DGZ A;  3GV6 A;  3S2H B;  5ISR A;  4WFN 3;  1V8Q A;  5M3F B;  3GTM B;  3MXP A;  1DXM A;  1QE6 A;  4IN3 A;  5DEH A;  4OIJ A;  2RDH A;  1MGS A;  1A6X A;  1EYD A;  4XDX A;  1PRT D;  2EPB A;  5JEA J;  3WDN A;  3M4O B;  3N52 A;  4FF4 A;  1SDF A;  1D1I A;  5E4X A;  4WOR A;  3M85 A;  2AUK A;  2X69 A;  1BQQ T;  2JEA I;  2PW5 A;  2F0U A;  2NN6 H;  1M8A A;  1Y8N B;  1B4O A;  1HQM C;  2R3Z A;  3NPP A;  1DD2 A;  4FNF A;  3M7N A;  3TSS A;  2F4I A;  1F9P A;  4MN3 A;  3WOE A;  3PIP 3;  2DN8 A;  4G7O C;  1Y8P B;  1OXS C;  2PCF B;  5FKA C;  1EQT A;  2B2V C;  3OHX C;  3TDQ A;  2ZT9 C;  2VB3 X;  1G2T A;  2F03 A;  2K28 A;  1SE2 A;  3S2D B;  2I46 A;  5LHY 1;  2K05 A;  1FNW A;  1MD2 D;  2R6G A;  3HOY B;  1CI3 M;  1IKM A;  1AP0 A;  1HA6 A;  2K01 A;  1NAP A;  3V96 A;  1KDC A;  1ILQ A;  3GTG B;  4L8J A;  2EYO A;  3OSO A;  2LKV A;  5F2D A;  1SBB B;  2JE6 I;  2MJ8 A;  3PUW A;  3DMU A;  3NK9 A;  4IUV A;  3S1R B;  1HXY D;  2IX0 A;  2WB1 B;  1XTC D;  4B08 A;  5KRU A;  2Z4I A;  3D4R A;  1K8O A;  2B2V A;  1Y8O B;  1GUW A;  3RD4 A;  1ZYR D;  4FO2 A;  3SDZ A;  2E75 C;  3ITP A;  1D5X C;  1IW7 D;  3MTS A;  3TZU A;  4IFD G;  1STH A;  4HCE A;  5KNC A;  3H09 A;  2M9V A;  5C0X I;  3K5M A;  3NTH A;  3Q6S A;  4XT3 B;  2FJ2 A;  1VCI A;  1JWM D;  2L9H A;  2K7V A;  4KKU A;  1A2U A;  3NTK A;  1Q1E A;  2QEJ C;  4K14 A;  4KHV A;  3FDT A;  3BVM A;  4HSV A;  3URY A;  1EY8 A;  1LTG D;  3Q0A A;  1BNZ A;  1CZW A;  1SNQ A;  1SXT A;  1AFP A;  4CJ0 B;  3GTJ B;  4QUC A;  1YNJ C;  2F0F A;  1WTX A;  3D8G A;  1LLR D;  2F0N A;  3FRP B;  2HDL A;  3ERO A;  1II3 A;  5C3W A;  1RJT A;  1BF4 A;  5CV7 A;  2F0H A;  1HUM A;  1ONL A;  1SND A;  2J0T D;  1B44 D;  3S1M B;  3NBI A;  1LAB A;  3C2P A;  1E0B A;  1G6Z A;  1TQO A;  2LMC B;  5CBE E;  1EY6 A;  1C48 A;  1JQY D;  5CBA E;  3RUZ A;  5C4H A;  1GUN A;  1RTO A;  3HGB A;  1ZEQ X;  2K5W A;  1KAB A;  4N9T A;  4ILW A;  2MGS A;  1WTV A;  3O13 A;  5J39 A;  1CHP D;  4X3K A;  1KLU D;  2EOT A;  4XIG S;  3VYR A;  2F0W A;  1B3A A;  4RH6 A;  2X6L A;  3QWN A;  2L11 A;  1E2Z A;  1VF7 A;  2X6G A;  1SMY D;  1JWU D;  4F8M A;  1A3T A;  1Q12 A;  1A2T A;  1S5D D;  3MXG A;  3QG1 A;  1SYB A;  2SEB D;  1I4Q A;  4FP5 D;  1CK1 A;  4K2K A;  4A3G B;  2D2C C;  1WTO A;  4EGV A;  1JE4 A;  2JXM B;  4A3B B;  4S3S A;  2PZT A;  4QIW B;  4WRD A;  3H94 A;  4B9W A;  3G6J B;  1VMC A;  3K5O A;  2E74 C;  2N55 A;  1NR4 A;  4JBW A;  1T5E A;  4DN4 M;  3SR1 A;  1H9S A;  3D6W A;  5C4X B;  4ULL A;  2NTT A;  3MA2 B;  4PNY A;  3P75 A;  4TKO B;  1LTI D;  3P7J A;  4KK7 A;  2PZW A;  2EYJ A;  5C0X J;  3H6M A;  3T13 A;  1KLG D;  1U9R A;  2O4X A;  1HRJ A;  1TWH B;  5JAV A;  2VB2 X;  5JVH 3;  2E2D C;  3EFX D;  1V1P A;  2DY8 A;  4F88 A;  4WJW A;  2MUY A;  4BY7 B;  1MSG A;  1O78 A;  2L1B A;  1SNO A;  3A8J E;  5K36 G;  1PTO F;  3C3L A;  1S5B D;  2G9D A;  5D3I B;  2EJG C;  4IUR A;  3L9A X;  3K57 A;  1WVL A;  5C5L A;  2PW7 A;  1RCV D;  5D65 A;  1DJR D;  1RKN A;  3Q24 A;  3A8K E;  4K5X A;  3FPP A;  1SMY C;  5IIF A;  1MSH A;  3HOW B;  1BXT A;  1BCP B;  1R4P B;  3K6O A;  3S14 B;  3H0G B;  4AYB B;  1QJO A;  4HTH A;  2KOL A;  1DOL A;  1U4M A;  3J7A F;  1IYU A;  5T1G A;  1IHZ A;  3J80 E;  1ROD A;  2IW3 A;  2L55 A;  3BVZ A;  2QDB A;  2QF7 A;  4OO1 I;  4MIU A;  1I3Q B;  1ZXT A;  4EVO A;  2BE5 D;  4IUT A;  4FXD A;  4X3S A;  4C1N I;  3GP7 A;  3CRL C;  5C3E B;  2HQE A;  1EU4 A;  4IUP A;  1UAP A;  4EQP A;  2F1M A;  3CKI B;  2ZXR A;  5C6A A;  1SNC A;  4NW2 A;  4CJ2 C;  1D5Z C;  3ND8 A;  2EY2 A;  1JCK B;  2ZXP A;  4FXK C;  3BDO A;  2EY6 A;  2FMC A;  3A7A B;  3E0J A;  5FO9 B;  1FD7 D;  1PTO H;  4HN7 A;  3MXU A;  3OMG A;  3SVM A;  1Q90 A;  4KY5 A;  2RQX A;  4K5W A;  1BOS A;  4E6I A;  2SDF A;  4ABN A;  3IFD A;  4XQJ A;  5EQ0 A;  3DM1 A;  4KHZ A;  2XRS D;  1GHJ A;  5HUR A;  3R3O A;  1HFG A;  2NBF A;  4H44 C;  3J80 L;  4A3F B;  2K03 A;  4DAP A;  3QJY A;  1SYF A;  4FF2 A;  2WII B;  2RA4 A;  1RD9 D;  3J7A V;  4RGT A;  3K5N A;  5ELC A;  2YU9 B;  4BWG B;  3MEH A;  3NE5 B;  2IT1 A;  3TN2 A;  4UDU C;  3TZD A;  3S17 B;  4CKB A;  4A3D B;  1O80 A;  4R8N A;  1GJX A;  1EQV A;  3I4L A;  5EKK A;  2H4O A;  2A6E C;  2HUG A;  1SNP A;  3T53 B;  1STG A;  4J6H A;  1SYE A;  2K33 A;  2KUM A;  2IX1 A;  2KVM A;  3DHQ A;  2HCC A;  1RTN A;  1K83 B;  1ICW A;  3TBI B;  1CT1 D;  2EDG A;  2MP1 A;  3GTK B;  1NCV A;  1X3Q A;  2M2L A;  3HOV B;  4IFD H;  3HEJ A;  1F9Q A;  1BCP D;  3MFY A;  1STY A;  2K32 A;  4LAA A;  1R4Q B;  3PV0 A;  1GHK A;  2H1E A;  1A3U A;  4Z9C B;  1HUN A;  5KEE A;  3VR4 A;  1JC7 A;  4MHE A;  3OIQ A;  3VA5 A;  2XSC A;  1TT2 A;  3CHB D;  2Z1C A;  4ZQ3 A;  4O42 A;  1LT6 D;  1B9M A;  2NUC A;  3SK4 A;  1WTQ A;  2OXP A;  4DF7 A;  2PO4 A;  1PRT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...