4LFAL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaL00
3HOYG 1Y1VG 4APVA 3HOXH 2JEBI 1XJVA 5LMUL 3GTGH 4YHHL 4YCVA 4DR4L 1YHAA 4P71A 5FJ8G 1A0IA 1J5EL 3GTLH 4WJ3M 3RLNA 1VS0A 1J6QA 4BBRH 2VL6A 2B63G 2E8GA 1EQRA 2MNAA 4GLXA 1NJIC 1KIXA 3PUYA 5FLXc 4HIDA 4JI7Q 4LF4L 5C44H 1XPOA 4YHHQ 1AE3A 1JJ2A 4DR4Q 1Q46A 2B3GA 4FDBA 3H15A 3TRZA 1E24A 1T9HA 4IJHA 4DR5L 3I7FA 1VQ8A 4DV3L 4LF4Q 1N8RC 2BA0A 4MZ9A 3CCSA 1E1TA 4L5TA 3OTOL 5IWAL 1I50H 1QZHA 4GS3A 4EX5A 4DV1L 3NBHB 5LMNL 4DR5Q 1XPRA 1KD1C 4YCUA 4LW1A 4DUYL 4DV3Q 5GAHC 2JA7H 1UE5A 1IYJB 2PMZE 1BKBA 2OQKA 3KDFA 1FGUA 4A3GH 3CW2C 2EXDA 2EQSA 4DV1Q 5LMNQ 4BA1I 4HJ5A 4QQBX 3EIVA 4DUYQ 1H95A 2H5XA 3CCJA 2Q2TA 1YVCA 2K50A 2K75A 2Y0SE 1GO3E 3W1BA 4GKJL 2RF4A 1HR0L 4B3RQ 2ALYB 4GLAC 5ELNA 4A3EH 1IZ6A 3K7UC 1VQ7A 1LYLA 1HR0Q 1IL2A 5JEAJ 3UE1A 1WYDA 4A93H 3HOXG 4LFAL 3NENA 2QEXA 2Q2IA 1HZBA 2JQOA 1OXTA 2NVQH 3HOWH 3M7NA 1UE7A 1TWGH 4LUZA 3CF5A 5C4XH 1VQ4A 4JBKA 4JV5Q 4GOPA 4JBWA 4BBRG 4DR2L 4JI2L 2ZTEA 4AIMA 2WAQG 4UP9A 2PNHA 2UXBQ 2NVTH 5C44G 1GVPA 2GVBA 1MIUA 5JEAG 2VQFL 3OW2A 3S1MH 4JI4L 3TS2A 4DV7L 4BY7H 1PYBA 2UXBL 4JI2Q 3FP9A 2XGTA 5AJ3L 1XTDA 2KHJA 3UDXA 2K5VA 1KXLA 1FJGQ 2VW9A 1YEZA 2VQFQ 3CCQA 1EOVA 1PFSA 2N8NA 2NZHA 4MNOA 4UP7A 4XTCS 5GADC 5IY0A 4DV7Q 4JI4Q 4DV0Q 1PV4A 1M90C 4OWWB 2VUMH 5AJ3Q 4LUVA 2D0PA 3CCRA 2N78A 3I4NH 3T1HL 4A3GG 3DLLA 2ZTDA 3I2ZA 3RR5A 4LUOA 2IY5B 2F3IA 3KF6A 5GAGC 2UXDQ 3A74A 3AQQA 3CMEA 3S24A 5IYCH 4IPGA 2IT1A 3CQZH 4IPHA 4KI0A 2HHHL 4OWXB 3U4VA 3W5OA 1VQIA 4KLKA 1QUQB 4DUZL 4DR3L 1SFOH 3PUZA 3IRBA 5M3FH 2HHHQ 4Y7NH 4A3BH 1VQCA 1N32L 1VQJA 3M4QA 1P8LA 2PQAA 4AYBE 2OTJA 5K36G 4A93G 5LMNW 4JI5L 1YITA 4DUZQ 4DR3Q 3HOWG 4AH6A 1UE1A 5M5YH 5C4XG 4DV2L 1ASZA 2KCTA 1K8AC 2WP8J 1N32Q 1B8AA 1SMXA 2D62A 2NN6I 2ZJRA 2ZJPA 3A0JA 2IX1A 2NN6G 1VQPA 2IX0A 2FXQA 2AHOB 4NPSA 4DV2Q 1EIFA 1HNXL 1V1QA 3GTMH 2WB1E 4BY7G 3F8TA 1XMQL 3PF5A 3J81j 1HR0W 1CKMA 1A63A 4JI1Q 3J7A5 2F52A 3I56A 4KHPL 1R9TH 3T1YL 2UUAL 1XPUA 3KYHC 1K0RA 3MEFA 4P72A 5ELOA 1PH3A 2VUMG 1PH1A 1GM5A 4DR6Q 1L1OC 1KQSA 2GVAA 1IBML 2NVYH 2HT1A 1N34Q 3I4NG 4KHPQ 3FHWA 3T1YQ 2UUAQ 1TWAH 2CQOA 2K52A 3KF8B 2OWOA 1G6PA 3S15H 5IYCG 4A3KH 1PH4A 4C3IH 4LFBL 2JA6H 2VQEL 1PA6A 1GKHA 2R7DA 4DPGA 3VDYA 3AEVA 3H3VI 4DR7L 1YJNA 1Q8KA 2ZTCA 3DM3A 4JC0A 4A76A 3W1GA 4GOPC 1VQNA 4JOIA 4DV4L 4BXXH 1N9WA 5M3FG 5E7NA 1I94L 4A3BG 1NBWA 1X55A 1KAWA 5C3EG 1OTCA 1N33L 3KDFB 1CKNB 2D0OA 5LMUQ 2UU9L 1VQAA 3PUWA 4DV4Q 5JJIA 1S40A 4B3TL 1J5EQ 1I94Q 1HJPA 2YTXA 3CP0A 3GD7A 2I5LX 1VQFA 1FL0A 3G48A 1CUKA 1YI2A 2UU9Q 4IPDA 1L1OB 3KOJA 3J80i 4B3TQ 3PF4A 2KHIA 4DAYB 1JB7A 1X6OA 2Z6KA 4L5QA 1QZGA 4POFA 3CXCA 1Q82C 4PG3A 3CPWA 3F2DA 3OTOQ 1VQMA 5IWAQ 3ULLA 3ERSX 4GNXA 1CSPA 1U5KA 2ID0A 2KBNA 1X3GA 3ULPA 2CCZA 1JJGA 1E7ZA 1RIPA 3WWVA 2OQ0A 4XIGS 4LFCL 2WAQE 1B70B 1OXUA 2ATWA 1WJJA 2E2IH 2ZJQA 3CC4A 5J3BA 2JK8A 4NB3A 2CWAA 4NXNL 5FLMH 1L0WA 1TWCH 3MXNB 3PUXA 4LFCQ 2MQHA 1Q12A 3UE0A 4A3KG 4GKJQ 2JA6G 1G51A 1QVFA 5JJLA 3M3YH 4O2DA 4BA2I 1SR3A 4HJ7A 2E2HH 3GTJH 4OXPA 3B6YA 3E9HA 5C0XJ 3CC2A 3F2CA 3JC66 4BXXG 3GO5A 4A75A 4LF7L 2N3SA 5H1SE 3H0GH 3S16H 4KHZA 1VQBA 2RHSB 3HKSA 2IHEA 4LFAQ 1K9MC 4JI0L 5C0XI 4LF7Q 1X65A 4HIOA 5C0XG 4DR2Q 2F4VL 4JI0Q 4JYAL 4R4TA 4YWKA 1HNZL 4X62L 4NXML 3NELA 3ER0A 4A3FH 4L5SA 1HNWL 4DR1L 1N36L 2JA8H 2F4VQ 1HZCA 1LUZA 1X3FA 2YTYA 3G4SA 4DV5L 4AQYL 3S1RH 1PHJA 2UUCL 3A5ZB 3NEMA 5IE8A 3CAMA 1SN8A 1V43A 1HNZQ 1Z47A 2PQAB 2JA9A 4X62Q 3CMAA 2A8VA 1HNWQ 4LNQA 2MFIA 4DR1Q 1N36Q 3J81i 4DV5Q 1NMFA 4LF5L 1GD7A 3GTKH 1UEBA 4QJFA 4IOAA 2AWOA 3T1HQ 1Y14B 2YV5A 4IO9A 4A3MH 3M85A 1K8GA 5FLMG 2MO1A 3UDFA 3H3VH 1MKHA 3CCVA 4X64L 1EFWA 2VS1A 2UXCL 4QL5A 2RHQB 5C3EH 3L2PA 1EQQA 2ES2A 4QGUA 1G291 4JBJA 4X64Q 2UXCQ 1HZAA 2UUBL 1PYSB 4JG2A 4HJAA 3H0GG 1NY4A 4DK6C 4IOCA 2BH2A 1WI5A 1I6HH 4JI5Q 4HIMA 5IYBH 2I0QA 3CD6A 2V1CC 3TS0A 2UUBQ 4TVAB 4GN5A 4O0AA 5HY6A 4H02A 3HOZH 1LM0A 1EWIA 2JE6I 4BY1H 4K0KL 3PO2H 4A3DH 3BJUA 1Q7YC 4C3HH 1K83H 3UDGA 3ICEA 2N49A 3AYHB 2ZM6L 4MTNA 1FVIA 3JAMi 1PH7A 4A3FG 1S72A 1NMGA 1HNXQ 3RLOA 1YJWA 1XMQQ 4K0KQ 2JA8G 3K80C 3K8AA 4GKKL 2B29A 2A1AA 4X66L 2ZM6Q 2NZOA 4YWLA 1VQDA 2LXKA 1XNQL 3GTOH 2K5HA 3E9IA 3PIOA 1P16A 3HFZB 4GKKQ 2I5MX 2JJQA 1C9OA 1EIYB 1QUQA 3PUVA 1IBMQ 4X66Q 3GTPH 2Z0SA 1Y1WH 3I4MH 1E22A 5IYDH 4A3MG 1Z9FA 2YYZA 1PVOA 1WOCA 1XNQQ 2QA4A 3RZOH 4HJ8A 2R7ZH 1A8VA 1KL9A 2ASBA 2WFWA 4PZ7A 4UP8A 2VQEQ 4LFBQ 3OYYA 4ALPA 4DR7Q 1KC8C 3PIPA 1VQ9A 3J80c 4IPCA 5IP9H 3U4ZA 3E0EA 2Q2UA 2HIVA 3ULJA 3I55A 4R4IA 5M5WH 4ME3A 2L15A 1BVSA 4QY7A 1N33Q 1DGSA 5IYBG 5M3MH 4JI3L 3J7ZC 2GN5A 1YNXA 3HOZG 2YTVA 3STBC 1UWVA 3CCMA 2OCEA 4HJ9A 1JJCB 4JI7L 3HOVH 2EIFA 3CPFA 4BY1G 4C2MH 2JA5H 3PO2G 4A3DG 2KCMA 3ZJYC 1Q1BA 1YJ9A 3K7AH 4JI3Q 1I3QH 1PH2A 1XNRL 1X9NA 1VQLA 4PMWA 4A3IH 4UPAA 3FKIH 4A3JH 3PCOB 4LWCA 1TXYA 3TEHB 4GOPB 1MJEA 3PGZA 3RLFA 1TWHH 1K73C 1VQOA 1XNRQ 1VQGA 1YIJA 4DKAC 2MO0A 2E5LL 5M5XH 2VY3A 3EBEA 3A5UA 3HKZG 1U0LA 1X3EA 3EN2A 1RL2A 4LF6L 4X65L 1AE2A 1HH2P 1Y1WG 3I4MG 2E5LQ 5IYDG 4NXNQ 3GTQH 3S2DH 3D0FA 1E1OA 4YCWA 2R7FA 2K4KA 1CSQA 2BH8A 3Q8DA 2R7ZG 1CKNA 1B7YB 3AFQA 5GROA 4LF6Q 1HZ9A 2K14A 2XTIA 4X65Q 4B3RL 2R6GA 3PO3H 4GLVB 3CCUA 1QVCA 5BR8L 1OXVA 1YHBA 2C35B 4B3ML 4P75A 5IP9G 3TREA 2JEAI 4R4OA 1IXRA 1L1OA 3BZKA 3KF6B 3L7ZC 2E2JH 1CKOA 3KLWA 4DV6L 4JCVE 1VCIA 5BR8Q 1NE3A 1PH8A 4B3MQ 4JV5L 4A4IA 1C7YA 2CKZB 2PI2E 5M3MG 4R1JA 4BBSH 4DK3C 2R92H 3J81c 1TWFH 2RCNA 3HOVG 4DV6Q 2JA5G 2DUDA 2Q2HA 4C3JH 4JYAQ 4DNIA 4PZ8A 4NXMQ 3I4OA 1EUJA 4OWTB 2YU9H 2DGYA 3CCLA 4A3IG 2PI2A 3FKIG 4A3JG 4AQYQ 3LGJA 4YY3L 1FJGL 4J15A 2Y0SG 2UUCQ 3M4PA 4R4CA 1OXXK 1NTGA 1JE5A 1IBKL 4DV0L 4JI6L 3PV0A 4EQ5A 4LF8L 3U58A 4JOIC 4L5RC 4P73A 2A19A 1Q81C 1JMCA 2QGQA 3STBD 4YY3Q 3G6EA 4LF5Q 1SE8A 2AMCB 4QIWE 4RMFA 5C4JH 3RZDH 1W2BA 2VNUD 1O7IA 4GN3B 1IBKQ 1WCMH 5GAEC 4JI6Q 4WJ4A 4LF8Q 1L2FA 4A3LH 2UXDL 3L0OA 4A3CH 4OONA 1PH5A 1SROA 2JA7G 1JT8A 3SGIA 1VQHA 1PH9A 4PZ6A 1AH9A 4X6AH 1BBUA 2K5NA 1VQKA 2HIXA 3BZCA 2R93H 3BU2A 5IT9c 1OXSC 3HOUH 5IP7H 3PO3G 3M4OH 4B3SL 3GDEA 3JAMc 1MJCA 3S2HH 2Z6KC 4OO1I 3CC7A 1V9PA 3KJOA 3HOYH 1Y1VH 1K3RA 4OO1G 4IFDJ 1BBWA 1W3SA 3M9BA 4A3EG 1EYGA 5DLQE 4JI8L 1Q1EA 4GNXC 4B3SQ 3S1NH 5FJ8H 3PSIA 4BBSG 3RN5A 3S1QH 1YZ6A 3TQYA 3CCEA 2R92G 2B63H 4POGA 4P74A 4JI8Q 1X54A 4LF9L 4IFDI 1VQ5A 3AFPA 3F1ZA 1D8LA 4DAMA 4HIKA 4IFDG 4YWMA 1I5FA 1KRSA 1SLJA 1YBYA 3RN2A 1UE6A 4OX9L 5EAYA 1QVGA 4LF9Q 4JI1L 3RNUA 1M1KC 4IJLA 1X56A 3G71A 2LXJA 5GQOA 1PH6A 4OX9Q 1D7QA 2CFMA 4GN4B 1E3PA 5HGQA 1VQ6A 4DR6L 2OTLA 3F2BA 1KRTA 2NVXH 2KENA 1WFQA 2WB1G 4TQUS 1N34L 2I5HA 1VQEA 2CWPA 3S17H 1WCMG 3K81C 3UDIA 4AYBG 4RG1A 1ASYA 2VZAA 4UY8C 1XMOL 1IBLL 4A3LG 5JJKA 4A3CG 3KFUA 4GNXB 1C0AA 4R4QA 1YHQA 1LTLA 4Y52H 3S14H 4JBMA 3D31A 2LSSA 2HQLA 2AKWB 1Q86C 1KHIA 2R93G 2IHFA 1XMOQ 1IBLQ 3HOUG 5IP7G 1A62A 1SRUA 3HKZE 3KJPA 2BA1A 3K0XA 2AWNA 3U50C 1S3OA
chains in the Genus database with same CATH superfamily
2JEBI 3MEHA 2Q8RE 4IUPA 2C5CA 1YHAA 4E6IA 1A0IA 4BWGB 1J5EL 3RLNA 3OWEB 1V1PA 2H4OA 4HIDA 5FLXc 4LF4L 5C44H 1XPOA 2B2YA 1JJ2A 2TSSA 2FMCA 3NTHA 3KF8A 1I50B 3I7FA 3D6WA 4KD4A 4L5TA 4FP5D 1T5EA 5IWAL 1I50H 1QZHA 1EOTA 4RAUC 4LW1A 4NW2A 4DUYL 5GAHC 5CV4A 5A2QL 4FF4A 3KDFA 1BKBA 1WTPA 1FGUA 2EQSA 5LMNQ 1LLRD 4JVZA 1AFPA 5D3DA 3AMUA 5ELFA 3CCJA 2C9OA 4R8NA 2K05A 2RVLA 4EVOA 4B3RQ 4R9WA 4RWSC 1BCPD 1UEAB 1PZKD 5JOBA 1VDZA 5JEAJ 3UE1A 4PMBA 4LFAL 3S16B 2Q2IA 1B53A 3IFDA 4JBKA 3U9SA 5DNFA 1OO9B 2F0HA 3KBXA 1STAA 2ZTEA 1QCBD 4BY7B 4UP9A 3Q22A 2UXBQ 1GUGA 5JEAG 1TS4A 2AQ1B 4JI4L 4BY7H 2XGTA 1PTOC 1ENFA 1YEZA 4MNOA 2WV6D 1WD0A 2VUMH 5AJ3Q 1LT4D 2R3ZA 2D0PA 3AB9A 3SXHA 3SK5A 3T1HL 3DLLA 3I2ZA 1CHQD 4LUOA 3KF6A 5IODA 1FYCA 3AQQA 3R2IA 4CKCA 5IYCH 4K6DA 4KI0A 4F88A 5ELCA 3QR8A 1KNAA 3FDTA 3I73A 4A3BB 1VQIA 1QUQB 4DR3L 3PUZA 5I2XA 3BYYB 5M3FH 4A3BH 3QIAA 1O78A 2SEBD 2PQAA 3M4QA 5K36G 1XXGA 3K5NA 1SBBB 4A93G 4DUZQ 3HOWG 5C4XG 1JOOA 4DV2L 2KVMA 2WP8J 2ZJPA 2L1BA 2IX1A 1A15A 1F9PA 4BY1B 4U68A 4A3DB 2FXQA 4NPSA 1I6VC 1BCPC 1G8ZD 3PF5A 1Z7TA 1EIHA 5BN5A 3J7AF 4JI1Q 3I56A 1XPUA 1DYQA 2UUAL 1K0RA 4P72A 5ELOA 1BQQT 1V1PB 5C4ZA 1IBML 2F0PA 2CQOA 3KF8B 2LMCB 2SNSA 4A3KH 4LFBL 2JA6H 2VQEL 4DR7L 1YJNA 2ZTCA 5EKLA 4K5XA 3W1GA 4JOIA 4DV4L 4KY5A 4WJWA 5E7NA 1OTCA 3I90A 1N33L 3KDFB 2EXZA 5M5WB 2D0OA 5LMUQ 1MGSA 3PUWA 3WDNA 5JPNC 2FHTA 4ZCKA 4B3TL 2YTXA 3GD7A 1FL0A 2BE5D 3G48A 3HOVB 1YI2A 1U9RA 4ZQ3A 3J80i 3VR2A 2KHIA 3PF4A 2EDGA 3EA6A 5EKKA 3CPWA 1TQOA 4L63B 1GUNA 3ULLA 2A5HA 3ERSX 1CSPA 2KBNA 1X3GA 2CCZA 1JJGA 1RIPA 3I72A 1YNJD 2NB0A 4XIGS 2WAQE 1B70B 1QJOA 1DD2A 3CC4A 4IUVA 1TWCH 1BUVT 2JP1A 1H9SA 3EQLC 3PUXA 1Y69U 1S5DD 5C6AA 2XVSA 4RCOA 4C3IG 5DEHA 5M9OA 3LWUA 1QVFA 5JJLA 4OXPA 1CI3M 3JC66 3GO5A 3NK9A 2L5TA 1EY9A 1V1OA 4EQNA 2RHSB 4JI0L 3WOEA 3NHHA 3N52A 4G4KA 4HIOA 4I7AA 2F4VL 4JYAL 1CK1A 4R4TA 1CM9A 4YWKA 5C5LA 4C3JB 4ZRZA 2F03A 4NXML 3JAME 3ER0A 1X3FA 3G4SA 1LT6D 4KK7A 3V96A 1SN8A 2PQAB 4X62Q 5T1GA 2A8VA 1HNWQ 1N36Q 3J81i 5CC4A 3OOCA 1LT3D 1GD7A 1XWEA 3T16A 1SNDA 2BE5C 4IOAA 1Y14B 1LTID 1TKWB 1K8GA 3QO2A 3CCVA 3J7YW 1EFWA 3VA7A 1A3TA 2F0SA 2RDGA 4XYQA 1TS5A 1PTOB 3HGBA 1YNJC 2PYKA 1PTOH 2WB1B 1PRTB 4DK6C 1I6HH 3HOYB 4JI5Q 4HIMA 1EY7A 3CD6A 3TS0A 2UUBQ 2ZXOA 5HY6A 1AZQA 3HOZH 4F87A 3S1QB 1XYIA 2B63B 1E2WA 5LHY1 1JICA 4DFAA 1MI2A 1FVIA 4A3FG 1NMGA 5A35A 3RLOA 1YJWA 1XMQQ 2JA8G 5DM63 4YWLA 1FGBD 2LXKA 4XQJA 2EJGC 3HFZB 2I5MX 2JJQA 3V2TA 4RHSA 3RZOB 2DNEA 3GTPH 5IYDH 4RA8A 4A3MG 1XNQQ 2QA4A 4J1MA 3RZOH 4HJ8A 3NTKA 4KKSA 2LS01 4DK1A 1PZJD 3PIPA 4M8AA 1SEBD 4IPCA 3CKIB 1DJRD 3E0EA 2Q2UA 3ULJA 1G2TA 3HOXB 4NMZA 5IYBG 3GTGB 5M3MH 4JI3L 1W6KA 3J7ZC 2OCEA 5LL6S 4BBRB 4C2MH 1A3VA 2KCMA 3FMCA 2DY7A 1EQVA 1PH2A 3T13A 3A8JE 4A3IH 4UPAA 3FKIH 1TXYA 2F3VA 1GHJA 3PGZA 1K73C 2HCCA 3EVQA 2EJMA 3EBEA 3TSSA 3HKZG 1X3EA 1RL2A 1Y8NB 4ZUJA 4RKLA 1F2YA 2RDHA 3I4MG 1E1OA 1HPCA 4FXKC 3AFQA 2L0CA 4B3RL 2PNRC 1QVCA 2NTTA 1B50A 2F0DA 5IP9G 3OSOA 2K5DA 2B2WC 1L1OA 4KKUA 3L7ZC 2IJ0A 4OO1H 2F0FA 1VCIA 1WTRA 1BBXC 1JWSD 2PI2E 4BBSH 2EPBA 3WOFA 4DV6Q 4X3KA 4K6LA 2Q2HA 3H3VC 1IYVA 2YU9H 2DGYA 1Q90A 4AQYQ 2J0TD 3M4PA 1OXXK 1STGA 4JI6L 2QW7A 4O42A 3PV0A 4RFBA 2QDLA 1MSHA 3G6EA 5C4JH 3RZDH 1WCMH 3I4NB 1L2FA 4A3CH 1DOKA 1SROA 1PH9A 1TS2A 3R8BA 2PZTA 1BBUA 1EZ6A 2K5NA 1OXSC 5IP7H 4H13C 4MTKA 1Y1VB 2HUGA 3GDEA 3NQTA 3JAMc 1MJCA 2OXPA 1DCZA 3OPOA 1IHZA 4OO1I 3KJOA 1Y1VH 5DLQE 4B3SQ 3S1NH 5IGFA 1ET6A 1CZWA 5M5YB 1C4QA 3ND8A 4LF9L 3AFPA 3BZDB 1EQTA 1SNQA 2O5IC 3HP3A 1J9OA 1I5FA 1SLJA 1YBYA 4HEDA 3GTMB 4ODGA 4JI1L 2AQ3B 1X56A 5CBAE 1MD2D 2CFMA 3MWYW 4GN4B 1R9TB 2OTLA 1BCPF 1BR9A 3F2BA 3S17H 3K81C 4WRDA 3UDIA 4UY8C 3R3OA 4RG1A 2VZAA 1UNSA 3RD4A 1TR5A 1IBLL 4FF3A 1C0AA 1NAPA 4Y52H 2Z4IA 3S15B 2HQLA 2AKWB 3FVQA 1E2VA 1KHIA 2A69D 5IIFA 3MFYA 1CA6A 2Z9HA 2F0WA 1EYCA 3G7LA 4EQOA 4ZYSA 2AWNA 3VYTA 1S3OA 3GTLB 4R8IA 5LMUL 4YHHL 4DR4L 5FJ8G 5CGKA 3GTLH 1VS0A 2EYJA 2E8GA 1EQRA 1STNA 2MNAA 1KIXA 3PUYA 1AE3A 1Q46A 4KKTA 4FDBA 3TRZA 1E24A 1T9HA 4IJHA 4DR5L 1VQ8A 4DV3L 2BA0A 5IGCA 2HQEA 4YIJA 1E1TA 2K32A 2Z1CA 4EQPA 2O4XA 4EX5A 1BO0A 3NBHB 4DV1L 4IALA 3VA5A 1KD1C 5EGTA 5E3FA 2KOLA 3CW2C 4QQBX 4NP5A 5CV5A 2JN4A 1SNMA 2RA4A 5EQ0A 2IWHA 2NZ1D 2Q2TA 2K75A 3QB3A 2Y0SE 3W1BA 4WFN3 2RF4A 1MSGA 4HCSA 1GXDC 4RCNA 1IZ6A 4CDEC 2E2HB 2F0LA 3K7UC 1VQ7A 1HR0Q 2QEXA 2NVQH 2K04A 3M7NA 4LUZA 4GOPA 2O5JC 2KEDA 4JI2L 2NN6H 2WAQG 2PNHA 4N9TA 5C44G 2B2TC 2F0GA 2PZWA 2VQFL 2A69C 3TS2A 1SDFA 3R2TA 3HEJA 1CT1D 1JB3A 2CH4A 3S1RB 3MXUA 2VW9A 4S3SA 3CCQA 1EOVA 2NZHA 4XTCS 1AZPA 5IY0A 1GUSA 4DV7Q 4DV0Q 4OWWB 3DEPA 3VYUA 4O1NA 4LUVA 3OHXC 2IPKD 1ICFB 4XDXA 1PXUA 1CTMA 3D4WA 3GTKB 3I3CA 1D2BA 2IY5B 5GAGC 2UXDQ 3A74A 3D4RA 3S24A 5IGBA 4TRDA 4IPGA 2IT1A 1QOHA 4IPHA 1G91A 4OWXB 1WTWA 1KTKA 5KEEA 4OHJA 3W3AA 5C3EB 3GQBA 2HHHQ 4KY7A 5DM73 1N32L 2B2YC 1P8LA 5JVG3 4JI5L 2Q8IB 3MZ5A 3VYSA 2KCTA 1K8AC 1SMXA 2NN6I 2X6GA 3QOJA 2ZJRA 5JPMC 5I4DA 1VQPA 3DXJC 2AHOB 2QILA 2EYMA 1V1QA 4BY7G 1GJXA 1G2SA 3F8TA 4RGOS 1XMQL 1GUWA 3K58A 1Z6HA 2EE1A 4KV6A 3T1YL 5J39A 2NBFA 2VUMG 5EPJA 1BOSA 1GM5A 4K2LA 2WINB 2HT1A 4KHPQ 1JWMD 5FO9B 2VXWA 1XTCD 3SEBA 2OWOA 3A56A 5IYCG 1W6JA 1PH4A 2R7ZB 2EYPA 1PA6A 3H3VI 1GKHA 3VDYA 1Q8KA 1NR2A 1VQNA 3NQIA 2F0TA 4BXXH 1PRTD 5M3FG 4A3BG 1NBWA 5G3LD 2MPMA 2UU9L 2B8FA 1S40A 2P5ZX 1I94Q 4FYDA 1BNZA 1VF7A 3MAQA 2V4DA 2JA5B 4OIKA 2F0JA 2PMZB 1JB7A 3D6CA 2Z6KA 4HTHA 1FR3A 1Q82C 2J4XA 3FEWX 3F2DA 3OTOQ 3E6ZX 1SMYD 4GNXA 1U5KA 2ID0A 1TWHB 2E2IB 2VB2X 2OQ0A 1HRJA 1QWYA 1OXUA 2ATWA 2E2IH 1D5XC 2ZJQA 3GV3A 5FLMH 1UUPA 4LFCQ 2MQHA 3GTQB 1Q12A 3DWAA 4A3KG 4GKJQ 2JA6G 3KLRA 1SR3A 3H0GB 3PO3B 3FPPA 4A75A 4LF7L 4ID6A 3H0GH 3S16H 5ISRA 1VQBA 3HKSA 2IHEA 1K9MC 3P1HA 2GA4B 1X65A 2RQXA 1F2ZA 3MVVA 3W2DA 4RHRA 1J8IA 5C4HA 2CVRA 1GHKA 1GUOA 1SYGA 1HNZL 3NELA 2VB3X 3BVZA 4L5SA 4DR1L 2MGSA 1PRTC 2YTYA 4AQYL 5ELBA 5LL6X 2JYOA 3A5ZB 5IE8A 3CAMA 1Z47A 2EY1A 2JA9A 1TIID 2MFIA 4DV5Q 1EY6A 1GOZA 4QJFA 2FFKB 1SNOA 4LJZC 5HURA 1DOMA 2YV5A 2QCPX 3M85A 3KK7A 4AYBB 1HFNA 4X64L 4HCEA 4MIUA 2VS1A 2F3WA 3Q24A 1ONLA 1SMYC 2ES2A 1G291 4JBJA 2R93B 2UXCQ 3Q23A 4B9XA 3P75A 4IOCA 1WI5A 2F0KA 1U4RA 3PO2B 1IKMA 4C3HB 1Q3LA 3NXWA 1LTGD 4BY1H 3MFGA 3PO2H 4A3DH 1STHA 3DMUA 3TZDA 4C3HH 3C2PA 3T4AC 3AYHB 2ZM6L 1HNXQ 3ONAB 1HFGA 4K0KQ 2EOTA 4C3JG 3K8AA 4GKKL 4CKEA 4OEMB 3EJIA 1Y1WB 2EZVA 3PIOA 2K1BA 1RODA 5I2YA 1LABA 4X66Q 1Y1WH 1Z9FA 4CBVA 1WOCA 3H6MA 2WFWA 5EPKA 4PZ7A 1IKLA 1M4VA 4ALPA 4NKLA 3D8GA 3J80c 5EBCA 1A6XA 1V8QA 1ENAA 3U4ZA 1HTPA 1ILPA 2KHSA 3OMCA 4R4IA 5M5WH 3TP5A 2L15A 1K83B 1DGSA 2M00A 1BDOA 3U9OA 2NUCA 3HOZG 3HOVH 4HJ9A 5JJIA 1JJCB 1U4LA 3ZJYC 5FLXL 4ZKBB 4A3JB 3X3MA 1ENCA 4HMJA 1GUTA 2F0EA 3RUZA 2PZUA 3PCOB 4DNRB 4A3JH 3TEHB 4OELB 5M5XB 4ZKCB 3NSWA 1VQOA 1XNRQ 4Q5VA 1RDPD 4DKAC 1TVXA 5M5XH 2VY3A 2JA7B 1LV9A 4X65L 2IL8A 1FD7D 4QMGA 2E5LQ 5IYDG 2B8GA 3K5OA 4NXNQ 1AEXA 2R7FA 1CSQA 2K4KA 1CKNA 1B7YB 4LF6Q 2XTIA 4B3ML 1G6ZA 5I6WA 4RKBA 1STBA 3DWPA 4A3EB 2JEAI 1MBYA 1ESRA 5D14A 1ESFA 3KF6B 2KCCA 2R92B 4RGTA 5BR8Q 2B2UC 2H1EA 3O13A 4A93B 3AU7A 1C7YA 2CKZB 4JPBW 5M3MG 3HOWB 4IUQA 2R92H 1SE4A 2RCNA 3J81c 5C4XB 4G7OC 2A73B 2PPBC 2DUDA 4C3JH 1PZID 4DNIA 4PZ8A 1VF5C 2NVTB 4IFDH 1ML0D 3I4OA 4DA2A 3CCLA 4A3IG 3FKIG 3LGJA 4KJOA 2Y0SG 3MXNA 2HDLA 5FOBB 4DV0L 1DM0B 1KABA 4LF8L 3U58A 4P73A 2A19A 4YY3Q 3MA2B 1SE8A 2IX3A 1IBKQ 4A3LH 2UXDL 3L0OA 4OONA 1X3PA 4IURA 3HOUB 3X3NA 2EY5A 3M4OB 1EYDA 4X6AH 1QNUA 2HIXA 3CQZB 4IUNA 5IT9c 3HOUH 3M4OH 2XRQD 1FNUA 1SFOB 3CC7A 1D5ZC 3HOYH 1K3RA 1AN8A 4OO1G 5E4WC 3M9BA 1ZYRD 1WTOA 1HUNA 4JI8L 2D9UA 3Q6SA 4BBSG 3S1QH 5CORA 4N8FA 4F8MA 2B63H 2QF7A 4IFDI 2FINB 3P20A 2DY8A 1UE6A 3BVMA 4CJ0B 4UHVA 1QVGA 1JQYD 2LXJA 2K03A 2XIWA 4OX9Q 2KCNA 3A8KE 3LWEA 2KENA 2I5HA 1WCMG 1WTVA 1EY0A 3T51B 4A3CG 1K3BC 2Z6BA 1LTLA 3GP7A 3HRZC 3QWNA 2LSSA 1HA6A 4TSSA 1Q86C 3SR1A 4C3IB 1XMOQ 5CV6A 5IP7G 5A2QE 3A8IE 1SNPA 2KEEA 3E3XA 2BA1A 4CDCC 1H9SB 3NP8A 1Y1VG 3HOXH 3MHBA 4CDDC 3GTGH 4WJ3M 1J6QA 1STYA 4BBRH 2RBMA 1NR4A 1S4ZA 3FRPB 1TT2A 1LT5D 4LF4Q 1N8RC 4MZ9A 3CCSA 1NCVA 2NYZD 3OTOL 2EY2A 4GS3A 3OW7A 1ZYRC 1RF2D 5LMNL 1TY2A 4A3GB 1SJHD 1SYBA 1UE5A 1IYJB 4WORA 2OQKA 4A3GH 2EXDA 1EWHA 4BA1I 3K5MA 3EIVA 4DUYQ 2A74C 2EYOA 2H5XA 3LX0A 2K50A 1GO3E 4GKJL 2OT2A 4GLAC 1EEFD 2L9HA 4DAYA 4HAEA 5IGDA 4H7BA 1IL8A 2BDNA 5E4XA 1WYDA 4XYOA 3NENA 2JQOA 2UXBL 1KNEA 1OXTA 2F4IA 4JBWA 3S1MB 5I9OA 2XN9C 2TMPA 1GVPA 3I4LA 1MIUA 3S1MH 4QIWB 1JORA 1A2TA 5AJ3L 3UDXA 4A3FB 2K5VA 2JA8B 1S5ED 1FJGQ 2N8NA 4UP7A 5FKAC 5GADC 4C1NK 4JI4Q 1PTOF 1PV4A 2Z4HA 4X3UA 1EEID 2Z8LA 1DONA 2BCOA 1WVLA 3I4NH 1IYUA 1NNXA 2PW5A 2ZTDA 4XXEA 1LACA 5G3LF 3RR5A 2F3IA 2X6LA 4A3MB 1CQFA 1SE3A 4KLKA 3VR5A 4DUZL 2WACA 1EU3A 3IRBA 2F0QA 3A7AB 3I70A 1VQCA 2ENBA 3C46A 4FXDA 2OTJA 5LMNW 4IZ8A 4DR3Q 1UE1A 5M5YH 1F9RA 1ET9A 1ASZA 1PVOA 1B8AA 2WKDA 2MUYA 2NN6G 4K5VA 2IX0A 3QOLA 2HD3A 4DV2Q 1HNXL 3GTMH 2WB1E 1BF4A 1A63A 2NTSA 1JE4A 2F52A 2G9DA 5TSSA 2KQ3A 1R9TH 3MXGA 2NVYB 3KYHC 3URYA 1PH3A 5IGEA 1PH1A 1TWAB 1KQSA 1B4OA 4FXGC 3GTOB 5KNDA 2NVYH 3FHWA 2XRSD 2UUAQ 1TWAH 4JK1C 4CKBA 2K52A 3I4MB 1B1ZA 3S15H 1I4GA 4P2CB 5ELEA 4DPGA 2B2VA 2KA7A 3FPUB 4JC0A 4GOPC 3ND9A 2R61A 1D1KA 3IAYA 1EL0A 2A6ED 5C3EG 1HCZA 1KDCA 3BYTB 4DV4Q 3TDQA 1NSNS 2PW7A 3EROA 1HJPA 5C0XH 2I5LX 2ICIA 2KJXA 1HXYD 1CUKA 5JAVA 4IPDA 1L1OB 1JC7A 5EPLA 4B3TQ 1D5MC 3K7AB 4DAYB 1I3QB 4POFA 1II3A 1QG7A 5COYA 1O7YA 1E7ZA 2LKVA 2F0IA 1B9NA 5D3IB 1EZ8A 4NDXA 2K01A 3P7JA 3L9AX 1D6EC 4LAAA 2JK8A 5CV7A 5J3BA 4NB3A 2CWAA 4NXNL 3CHBD 2O2LD 4KMUC 4FVMA 1ICWA 4B08A 3S2DB 1G51A 2JSOA 4O2DA 4BA2I 4HJ7A 2E2HH 2B39A 4V0BA 4CHTB 4BXXG 5H1SE 1A2UA 2E2DC 3TMEA 4KHZA 4BS9A 3GV6A 3MC0B 3CRLC 5C0XI 4DR2Q 1VMCA 5C3XA 3K57A 4JI0Q 2LFNA 1RJTA 2IW3A 1M8AA 4X62L 2A68D 3I8ZA 4OGQC 1HNWL 1N36L 2F4VQ 1HZCA 1LUZA 3S1RH 1PHJA 4ZUIA 5FO7B 4XT1B 1KDAA 1V43A 4HSVA 2A6EC 5CMDA 3CMAA 4U673 3K0YA 3C3LA 2ZXPA 1NMFA 5AFWA 4MN3A 3GTKH 1UEBA 1H9MA 1O7ZA 5FLMG 2MO1A 3UDFA 3H3VH 4ME5A 1EY4A 3TN2A 5KGUA 1Y8PB 2AUKA 2BOSA 4QL5A 2RHQB 5C3EH 2K6AA 4QGUA 4FNFA 3HG9A 5J1ZA 2UUBL 1PYSB 4JG2A 3JAML 4HJAA 3S2HB 3H0GG 1NY4A 1HTLD 2BH2A 1JCKB 1KLGD 3J80E 3DM1A 4O0AA 4H02A 1LM0A 4L8JA 1B44D 1QE6A 3UDGA 3K6OA 3ICEA 1PMRA 4MTNA 3KUPA 1ILQA 3PIP3 3IKJA 1FNVA 3K80C 3E5SA 2A1AA 4TKOB 2XWBB 1VQDA 1XNQL 2F1MA 3E9IA 1LTRD 3BDLA 1C9OA 1SYCA 1EIYB 1QUQA 2Z0SA 3DHQA 1EYAA 1E22A 2YYZA 2A68C 2PQEA 2R7ZH 2ASBA 4IQZA 1KAAA 4UP8A 3S14B 3OYYA 4CJ1B 1RCVD 3MTSA 2MP1A 1IW7D 2HIVA 1K8MA 1I4QA 4ME3A 1BVSA 4QY7A 1PFMA 2GN5A 2Q8TA 3STBC 4PQXA 1UWVA 3CCMA 3CPFA 2JA5H 4BY1G 3T53B 3PO2G 4CGYB 4A3DG 2CH4W 1Q1BA 1YJ9A 2WAQB 1ZKOA 4I7ZC 4C3HG 4JI3Q 5C44B 5EJWA 1CZGA 4PMWA 3J81E 4GOPB 2N55A 1TWHH 2MO0A 3SK6A 1X3QA 4RH6A 1R4PB 1KLUD 1U0LA 5CV8A 1HHVA 2G5DA 4DXFA 1HH2P 1Y1WG 3A54A 1TY0A 3L3OC 3GTQH 3D0FA 3Q8DA 1HZ9A 2K14A 1BXTA 2RDFA 3HZXA 3PO3H 1YHBA 4ZK9B 2E2JB 4P75A 3TREA 1IXRA 2E2JH 3KLWA 1E2ZA 4DV6L 1F2MA 1TWFB 1S5CD 1PLFA 1NE3A 3NBIA 5IT9E 4A4IA 3D3RA 4R1JA 4DK3C 1TWFH 3HOVG 1A3UA 4QB4A 3CRKC 4G57A 1SSOA 4OIJA 1H9RA 1EUJA 2EYLA 3K5LA 1IW7C 2PI2A 4A3JG 1FJGL 3NWTA 4CDFC 2I46A 3PMFA 2UUCQ 1JE5A 4EQ5A 4JOIC 1Q81C 5CR3A 1JMCA 2VUMB 2RKSA 4LF5Q 2AMCB 4RMFA 2VNUD 3SK8A 1W2BA 1O7IA 2EYFA 2CW0D 4JI6Q 5GAEC 4HR7B 4F7XA 2JA7G 4FF1A 1JT8A 3SGIA 3D4DA 3G6JB 4PZ6A 4Z9CB 1U4MA 4DU9A 1RTNA 1AH9A 4UDUC 1VQKA 2R93H 4B3SL 3KLSX 1V9PA 5M3FB 2G9HD 4IFDJ 1BBWA 1EWCA 4XQNA 4A3EG 1EYGA 1O80A 4FO2A 3BVGA 5JVH3 2DJFC 2CHBD 3PSIA 3RN5A 1YZ6A 2R92G 4P74A 2D2CC 3R93A 1L0XB 1WD1A 4QUCA 4CJ2C 1X54A 4JW0A 1VQ5A 4HIKA 4IFDG 2SNMA 5EAYA 1LO5D 5EBDA 4LF9Q 1M1KC 3G71A 2FMMA 5GQOA 1PH6A 1E3PA 3OWFA 1AW7A 3BS1A 1EY5A 1B9MA 1KRTA 1VQEA 2CWPA 3TP6A 4J8QA 4A3LG 5I6YA 5ELDA 5JJKA 1K28A 3KFUA 3QG1A 4GNXB 3D31A 1SAPA 4A3KB 2JA6B 2IHFA 1IBLQ 3HOUG 1A62A 2KUMA 4QF4A 1Q8IA 3TZUA 3KJPA 1EU4A 1PFNA 3U50C 2WB1G 2OF1A 1K83H 3HOYG 4APVA 1XJVA 2CW0C 4YCVA 4P71A 2VL6A 2B63G 1NUCA 5KIXA 4GLXA 1NJIC 4JI7Q 4YHHQ 3IFTA 5JEAH 4DR4Q 2B3GA 3C1EA 3H15A 4QUFA 1F9SA 4DR5Q 1XPRA 3H09A 4RGNA 4YCUA 4DV3Q 2JA7H 3NUCA 1CQVA 2PMZE 1SYDA 4DV1Q 4HJ5A 2X69A 1H95A 3BG3A 1YVCA 4QCLA 1TWCB 2SDFA 5E1FA 4L6TB 1HR0L 2ALYB 5ELNA 4A3EH 1F9QA 3UI2A 3H94A 4KY6A 4K14A 4DAPA 1TWGB 1LYLA 4PV1C 1IL2A 5K36H 4A93H 2EVBA 3HOXG 1HZBA 3HOWH 4JV5Q 1UE7A 1TWGH 5K5PA 3CF5A 5C4XH 1VQ4A 1SNCA 4HMIA 1B3QA 4BBRG 4DR2L 2E75C 1JOKA 4AIMA 4DN4M 2NVTH 2GVBA 2WIIB 3OW2A 4DV7L 3I91A 1PYBA 4JI2Q 1RD9D 3FP9A 1TS3A 1XTDA 2KHJA 1KXLA 2MJ8A 2VQFQ 1PFSA 5FO8B 2D5DA 2AUJD 3K59A 1M90C 3VR6A 3V05A 4DGZA 3CCRA 2N78A 2ZT9C 4A3GG 3H91A 4B9WA 5KNBA 1H9JA 4N9PA 3CMEA 3ZYYX 3S9WA 3CQZH 2HHHL 5C3WA 3OMGA 2N88A 3U4VA 4Y7NB 3W5OA 1SFOH 4Y7NH 3Q0AA 1VQJA 1YNND 4AYBE 1YITA 2XWJB 4AH6A 1LTBD 4OL7A 4K5WA 5F2DA 5T1IA 1I6HB 1JOQA 2MHVA 1KDBA 1N32Q 2F0OA 2D62A 3HOZB 3A0JA 1WTHA 1CFMA 2ICEC 2FJ2A 3PQIA 1EIFA 4V190 1K0SA 3J81j 3IL8A 1HR0W 1CKMA 3J7A5 2B2UA 3QJYA 4KHPL 1F2LA 3MEFA 3SVMA 2PO4A 4DR6Q 1L1OC 5IGGA 4ILWA 2GVAA 2F0NA 1N34Q 3I4NG 3T1YQ 3GTPB 4KN4C 2HDMA 5CYUA 1G6PA 1X32A 4C3IH 1SE2A 3AEVA 2R7DA 3DM3A 4A76A 1AP0A 4KD3A 3J80L 1ZEQX 1N9WA 1I94L 1BCPB 2M2LA 1X55A 1KAWA 3J7AV 3DEOA 1CKNB 4K8IA 1H9KA 1VQAA 1J5EQ 5M3MB 1B2TA 3E0JA 3CP0A 3SHLA 1VQFA 1SYFA 2UU9Q 4C2MB 3KOJA 3NPPA 3T56B 2NWGA 3VR4A 1X6OA 4L5QA 1QZGA 3CXCA 4PG3A 4A3IB 3FKIB 1VQMA 5IWAQ 2SOBA 2K5WA 1YNNC 2Y0SB 1ZXTA 3ULPA 3WWVA 4K8JA 4LFCL 1QILA 2I07B 1WJJA 5JJZA 4ZAIA 2XNAC 1L0WA 3MXNB 3M3YB 4IUTA 4HN7A 3GTJB 2EYHA 3UE0A 4IN3A 3M3YH 1I4XA 3RMHA 2EJFC 3GTJH 3B6YA 3E9HA 5C0XJ 3CC2A 1I4HA 1SXTA 4M1UB 3F2CA 2QDBA 2N3SA 3A7LA 4LFAQ 4DK0A 3SK4A 2HCIA 4LF7Q 2RSNA 4DNTB 4BBSB 5C0XG 1JWUD 3J81L 1MHWC 3NBHA 1LTAD 1RTOA 4KJNA 2JXMB 5BN3A 4ULLA 3LNNA 4A3FH 2OEOA 3OIPA 1QNKA 2DJGC 2E76C 2JA8H 2YU9B 4DV5L 2UUCL 3NEMA 1HNZQ 1PRTF 2BDOA 4LNQA 4DR1Q 5CBEE 3SE0A 5KYLA 1B3AA 2EY6A 4LF5L 2QKIC 2L4NA 4H44C 2B2VC 5DAUA 1HA5A 2AWOA 5C4JB 3T1HQ 3RZDB 1DOLA 4IO9A 4A3MH 1WCMB 1MKHA 2UXCL 1RHPA 1EQQA 3L2PA 5KNCA 2K5QA 4X64Q 5IT9L 1HZAA 1STEA 1K8OA 3OIQA 3NWSA 4XT3B 3PIO3 2ZXRA 1F77A 5IYBH 2I0QA 5EKIA 2V1CC 4TVAB 4GN5A 3S1NB 4I65A 5CV9A 1EWIA 2JE6I 2B2WA 4K0KL 1TU2B 3BDCA 3BJUA 4UAIA 1Q7YC 3EFXD 1UAPA 2N49A 2K28A 3JAMi 1PH7A 1S72A 4KN7C 1LTTD 4DAVA 4X3SA 3ERQA 1QB5D 2B29A 1HUMA 4X66L 2ZM6Q 3HKZB 1PDQA 2NZOA 1PYWD 1C48A 2F0UA 4XQQA 1LTSD 3N6RA 3GTOH 2K5HA 1P16A 4GKKQ 5FLXE 3DUZA 5I9PA 3PUVA 1IBMQ 3I4MH 4PNYA 3S17B 1R4QB 3TBIB 1EIGA 1A8VA 1KL9A 3BDOA 4Q0FA 4DXGA 4C1NI 4LFBQ 2VQEQ 2L12A 3SDZA 1KC8C 4DR7Q 5BN4A 1VQ9A 5IP9H 1T5XD 2E74C 1D1IA 3I55A 1N33Q 1YNXA 2YTVA 3A55A 1Y8OB 4JI7L 2EIFA 3K7AH 4EGVA 1I3QH 4G7HC 1XNRL 1X9NA 1VQLA 1HQRD 3TP7A 1S5FD 3KBGA 2RSOA 4MHEA 4LWCA 1MJEA 3RLFA 4DF7A 1VQGA 3NTIA 3M7GA 1YIJA 1I4RA 5KYIA 2E5LL 4HSPA 2M9VA 3A5UA 3C1FA 3EN2A 4LF6L 1AE2A 2K33A 3MXPA 3S2DH 4YCWA 2BH8A 2R7ZG 5GROA 4X65Q 4KTAA 2R6GA 2WKCA 4GLVB 4K2KA 3CCUA 4IUUA 1OXVA 2C35B 2DNCA 5BR8L 4R4OA 4X3TA 3BZKA 4KHVA 1CKOA 1FNWA 4JCVE 4B3MQ 1PH8A 3F2UA 3HS0C 2K7VA 4JV5L 2NVQB 3VYRA 2DN8A 3NE5B 2L11A 4LMQD 4ABNA 2JA5G 1PFBA 5NUCA 4JYAQ 2KECA 4NXMQ 2L55A 2A6HD 2XSCA 2LY7A 4OWTB 1C8CA 1EFID 4YY3L 4GZYC 3VR3A 4J15A 4N8X1 4R4CA 1NTGA 5D65A 1O7LA 2CQAA 1IBKL 4L5RC 1EY8A 2QGQA 3STBD 3CU7A 4QIWE 5HGTA 1DXMA 1SJED 4GN3B 4WJ4A 4LF8Q 3TP8A 1PH5A 5IOCA 1VQHA 4PMCA 2QEJC 3BZCA 3BU2A 1JR0D 2J7ZA 2F0MA 3PO3G 5L37A 4RGMA 3S2HH 2PCFB 2Z6KC 2AQ2B 4C56C 1RKNA 1W3SA 1Q1EA 4GNXC 5FJ8H 3TQYA 3CCEA 5C5MA 1XX8A 1E0BA 4POGA 2F0VA 4JI8Q 3ITPA 4ZLTF 1SYEA 1D8LA 3F1ZA 4DAMA 4YWMA 1KRSA 3RN2A 5KRUA 4H0LC 4OX9L 4LK1C 1WTXA 4J6HA 2RCFA 5FK9C 4FF2A 3RNUA 4IJLA 2B2TA 2NVXB 1WTQA 1D7QA 5HGQA 1VQ6A 4DR6L 1S5BD 5J22A 2NVXH 1WFQA 4TQUS 1N34L 1VMPA 1I4PA 4AYBG 1ASYA 1U4PA 1XMOL 2A6HC 4R4QA 1YHQA 1DZ1A 3M4YA 4JBMA 3S14H 1HQMC 3DWQA 2R93G 3KLSA 1CA5A 1SRUA 3HKZE 4G7ZC 1CHPD 1L0YB 1PTOD 3K0XA
chains in the Genus database with same CATH topology
3HOYG 1Y1VG 4APVA 3HOXH 2JEBI 1XJVA 5LMUL 3GTGH 4YHHL 4YCVA 4DR4L 1YHAA 4P71A 5FJ8G 1A0IA 1J5EL 3GTLH 4WJ3M 3RLNA 1VS0A 1J6QA 4BBRH 2VL6A 2B63G 2E8GA 1EQRA 2MNAA 4GLXA 1NJIC 1KIXA 3PUYA 5FLXc 4HIDA 4JI7Q 4LF4L 5C44H 1XPOA 4YHHQ 1AE3A 1JJ2A 4DR4Q 1Q46A 2B3GA 4FDBA 3H15A 3TRZA 1E24A 1T9HA 4IJHA 4DR5L 3I7FA 1VQ8A 4DV3L 4LF4Q 1N8RC 2BA0A 4MZ9A 3CCSA 1E1TA 4L5TA 3OTOL 5IWAL 1I50H 1QZHA 4GS3A 4EX5A 4DV1L 3NBHB 5LMNL 4DR5Q 1XPRA 1KD1C 4YCUA 4LW1A 4DUYL 4DV3Q 5GAHC 2JA7H 1UE5A 1IYJB 2PMZE 1BKBA 2OQKA 3KDFA 1FGUA 4A3GH 3CW2C 2EXDA 2EQSA 4DV1Q 5LMNQ 4BA1I 4HJ5A 4QQBX 3EIVA 4DUYQ 1H95A 2H5XA 3CCJA 2Q2TA 1YVCA 2K50A 2K75A 2Y0SE 1GO3E 3W1BA 4GKJL 2RF4A 1HR0L 4B3RQ 2ALYB 4GLAC 5ELNA 4A3EH 1IZ6A 3K7UC 1VQ7A 1LYLA 1HR0Q 1IL2A 5JEAJ 3UE1A 1WYDA 4A93H 3HOXG 4LFAL 3NENA 2QEXA 2Q2IA 1HZBA 2JQOA 1OXTA 2NVQH 3HOWH 3M7NA 1UE7A 1TWGH 4LUZA 3CF5A 5C4XH 1VQ4A 4JBKA 4JV5Q 4GOPA 4JBWA 4BBRG 4DR2L 4JI2L 2ZTEA 4AIMA 2WAQG 4UP9A 2PNHA 2UXBQ 2NVTH 5C44G 1GVPA 2GVBA 1MIUA 5JEAG 2VQFL 3OW2A 3S1MH 4JI4L 3TS2A 4DV7L 4BY7H 1PYBA 2UXBL 4JI2Q 3FP9A 2XGTA 5AJ3L 1XTDA 2KHJA 3UDXA 2K5VA 1KXLA 1FJGQ 2VW9A 1YEZA 2VQFQ 3CCQA 1EOVA 1PFSA 2N8NA 2NZHA 4MNOA 4UP7A 4XTCS 5GADC 5IY0A 4DV7Q 4JI4Q 4DV0Q 1PV4A 1M90C 4OWWB 2VUMH 5AJ3Q 4LUVA 2D0PA 3CCRA 2N78A 3I4NH 3T1HL 4A3GG 3DLLA 2ZTDA 3I2ZA 3RR5A 4LUOA 2IY5B 2F3IA 3KF6A 5GAGC 2UXDQ 3A74A 3AQQA 3CMEA 3S24A 5IYCH 4IPGA 2IT1A 3CQZH 4IPHA 4KI0A 2HHHL 4OWXB 3U4VA 3W5OA 1VQIA 4KLKA 1QUQB 4DUZL 4DR3L 1SFOH 3PUZA 3IRBA 5M3FH 2HHHQ 4Y7NH 4A3BH 1VQCA 1N32L 1VQJA 3M4QA 1P8LA 2PQAA 4AYBE 2OTJA 5K36G 4A93G 5LMNW 4JI5L 1YITA 4DUZQ 4DR3Q 3HOWG 4AH6A 1UE1A 5M5YH 5C4XG 4DV2L 1ASZA 2KCTA 1K8AC 2WP8J 1N32Q 1B8AA 1SMXA 2D62A 2NN6I 2ZJRA 2ZJPA 3A0JA 2IX1A 2NN6G 1VQPA 2IX0A 2FXQA 2AHOB 4NPSA 4DV2Q 1EIFA 1HNXL 1V1QA 3GTMH 2WB1E 4BY7G 3F8TA 1XMQL 3PF5A 3J81j 1HR0W 1CKMA 1A63A 4JI1Q 3J7A5 2F52A 3I56A 4KHPL 1R9TH 3T1YL 2UUAL 1XPUA 3KYHC 1K0RA 3MEFA 4P72A 5ELOA 1PH3A 2VUMG 1PH1A 1GM5A 4DR6Q 1L1OC 1KQSA 2GVAA 1IBML 2NVYH 2HT1A 1N34Q 3I4NG 4KHPQ 3FHWA 3T1YQ 2UUAQ 1TWAH 2CQOA 2K52A 3KF8B 2OWOA 1G6PA 3S15H 5IYCG 4A3KH 1PH4A 4C3IH 4LFBL 2JA6H 2VQEL 1PA6A 1GKHA 2R7DA 4DPGA 3VDYA 3AEVA 3H3VI 4DR7L 1YJNA 1Q8KA 2ZTCA 3DM3A 4JC0A 4A76A 3W1GA 4GOPC 1VQNA 4JOIA 4DV4L 4BXXH 1N9WA 5M3FG 5E7NA 1I94L 4A3BG 1NBWA 1X55A 1KAWA 5C3EG 1OTCA 1N33L 3KDFB 1CKNB 2D0OA 5LMUQ 2UU9L 1VQAA 3PUWA 4DV4Q 5JJIA 1S40A 4B3TL 1J5EQ 1I94Q 1HJPA 2YTXA 3CP0A 3GD7A 2I5LX 1VQFA 1FL0A 3G48A 1CUKA 1YI2A 2UU9Q 4IPDA 1L1OB 3KOJA 3J80i 4B3TQ 3PF4A 2KHIA 4DAYB 1JB7A 1X6OA 2Z6KA 4L5QA 1QZGA 4POFA 3CXCA 1Q82C 4PG3A 3CPWA 3F2DA 3OTOQ 1VQMA 5IWAQ 3ULLA 3ERSX 4GNXA 1CSPA 1U5KA 2ID0A 2KBNA 1X3GA 3ULPA 2CCZA 1JJGA 1E7ZA 1RIPA 3WWVA 2OQ0A 4XIGS 4LFCL 2WAQE 1B70B 1OXUA 2ATWA 1WJJA 2E2IH 2ZJQA 3CC4A 5J3BA 2JK8A 4NB3A 2CWAA 4NXNL 5FLMH 1L0WA 1TWCH 3MXNB 3PUXA 4LFCQ 2MQHA 1Q12A 3UE0A 4A3KG 4GKJQ 2JA6G 1G51A 1QVFA 5JJLA 3M3YH 4O2DA 4BA2I 1SR3A 4HJ7A 2E2HH 3GTJH 4OXPA 3B6YA 3E9HA 5C0XJ 3CC2A 3F2CA 3JC66 4BXXG 3GO5A 4A75A 4LF7L 2N3SA 5H1SE 3H0GH 3S16H 4KHZA 1VQBA 2RHSB 3HKSA 2IHEA 4LFAQ 1K9MC 4JI0L 5C0XI 4LF7Q 1X65A 4HIOA 5C0XG 4DR2Q 2F4VL 4JI0Q 4JYAL 4R4TA 4YWKA 1HNZL 4X62L 4NXML 3NELA 3ER0A 4A3FH 4L5SA 1HNWL 4DR1L 1N36L 2JA8H 2F4VQ 1HZCA 1LUZA 1X3FA 2YTYA 3G4SA 4DV5L 4AQYL 3S1RH 1PHJA 2UUCL 3A5ZB 3NEMA 5IE8A 3CAMA 1SN8A 1V43A 1HNZQ 1Z47A 2PQAB 2JA9A 4X62Q 3CMAA 2A8VA 1HNWQ 4LNQA 2MFIA 4DR1Q 1N36Q 3J81i 4DV5Q 1NMFA 4LF5L 1GD7A 3GTKH 1UEBA 4QJFA 4IOAA 2AWOA 3T1HQ 1Y14B 2YV5A 4IO9A 4A3MH 3M85A 1K8GA 5FLMG 2MO1A 3UDFA 3H3VH 1MKHA 3CCVA 4X64L 1EFWA 2VS1A 2UXCL 4QL5A 2RHQB 5C3EH 3L2PA 1EQQA 2ES2A 4QGUA 1G291 4JBJA 4X64Q 2UXCQ 1HZAA 2UUBL 1PYSB 4JG2A 4HJAA 3H0GG 1NY4A 4DK6C 4IOCA 2BH2A 1WI5A 1I6HH 4JI5Q 4HIMA 5IYBH 2I0QA 3CD6A 2V1CC 3TS0A 2UUBQ 4TVAB 4GN5A 4O0AA 5HY6A 4H02A 3HOZH 1LM0A 1EWIA 2JE6I 4BY1H 4K0KL 3PO2H 4A3DH 3BJUA 1Q7YC 4C3HH 1K83H 3UDGA 3ICEA 2N49A 3AYHB 2ZM6L 4MTNA 1FVIA 3JAMi 1PH7A 4A3FG 1S72A 1NMGA 1HNXQ 3RLOA 1YJWA 1XMQQ 4K0KQ 2JA8G 3K80C 3K8AA 4GKKL 2B29A 2A1AA 4X66L 2ZM6Q 2NZOA 4YWLA 1VQDA 2LXKA 1XNQL 3GTOH 2K5HA 3E9IA 3PIOA 1P16A 3HFZB 4GKKQ 2I5MX 2JJQA 1C9OA 1EIYB 1QUQA 3PUVA 1IBMQ 4X66Q 3GTPH 2Z0SA 1Y1WH 3I4MH 1E22A 5IYDH 4A3MG 1Z9FA 2YYZA 1PVOA 1WOCA 1XNQQ 2QA4A 3RZOH 4HJ8A 2R7ZH 1A8VA 1KL9A 2ASBA 2WFWA 4PZ7A 4UP8A 2VQEQ 4LFBQ 3OYYA 4ALPA 4DR7Q 1KC8C 3PIPA 1VQ9A 3J80c 4IPCA 5IP9H 3U4ZA 3E0EA 2Q2UA 2HIVA 3ULJA 3I55A 4R4IA 5M5WH 4ME3A 2L15A 1BVSA 4QY7A 1N33Q 1DGSA 5IYBG 5M3MH 4JI3L 3J7ZC 2GN5A 1YNXA 3HOZG 2YTVA 3STBC 1UWVA 3CCMA 2OCEA 4HJ9A 1JJCB 4JI7L 3HOVH 2EIFA 3CPFA 4BY1G 4C2MH 2JA5H 3PO2G 4A3DG 2KCMA 3ZJYC 1Q1BA 1YJ9A 3K7AH 4JI3Q 1I3QH 1PH2A 1XNRL 1X9NA 1VQLA 4PMWA 4A3IH 4UPAA 3FKIH 4A3JH 3PCOB 4LWCA 1TXYA 3TEHB 4GOPB 1MJEA 3PGZA 3RLFA 1TWHH 1K73C 1VQOA 1XNRQ 1VQGA 1YIJA 4DKAC 2MO0A 2E5LL 5M5XH 2VY3A 3EBEA 3A5UA 3HKZG 1U0LA 1X3EA 3EN2A 1RL2A 4LF6L 4X65L 1AE2A 1HH2P 1Y1WG 3I4MG 2E5LQ 5IYDG 4NXNQ 3GTQH 3S2DH 3D0FA 1E1OA 4YCWA 2R7FA 2K4KA 1CSQA 2BH8A 3Q8DA 2R7ZG 1CKNA 1B7YB 3AFQA 5GROA 4LF6Q 1HZ9A 2K14A 2XTIA 4X65Q 4B3RL 2R6GA 3PO3H 4GLVB 3CCUA 1QVCA 5BR8L 1OXVA 1YHBA 2C35B 4B3ML 4P75A 5IP9G 3TREA 2JEAI 4R4OA 1IXRA 1L1OA 3BZKA 3KF6B 3L7ZC 2E2JH 1CKOA 3KLWA 4DV6L 4JCVE 1VCIA 5BR8Q 1NE3A 1PH8A 4B3MQ 4JV5L 4A4IA 1C7YA 2CKZB 2PI2E 5M3MG 4R1JA 4BBSH 4DK3C 2R92H 3J81c 1TWFH 2RCNA 3HOVG 4DV6Q 2JA5G 2DUDA 2Q2HA 4C3JH 4JYAQ 4DNIA 4PZ8A 4NXMQ 3I4OA 1EUJA 4OWTB 2YU9H 2DGYA 3CCLA 4A3IG 2PI2A 3FKIG 4A3JG 4AQYQ 3LGJA 4YY3L 1FJGL 4J15A 2Y0SG 2UUCQ 3M4PA 4R4CA 1OXXK 1NTGA 1JE5A 1IBKL 4DV0L 4JI6L 3PV0A 4EQ5A 4LF8L 3U58A 4JOIC 4L5RC 4P73A 2A19A 1Q81C 1JMCA 2QGQA 3STBD 4YY3Q 3G6EA 4LF5Q 1SE8A 2AMCB 4QIWE 4RMFA 5C4JH 3RZDH 1W2BA 2VNUD 1O7IA 4GN3B 1IBKQ 1WCMH 5GAEC 4JI6Q 4WJ4A 4LF8Q 1L2FA 4A3LH 2UXDL 3L0OA 4A3CH 4OONA 1PH5A 1SROA 2JA7G 1JT8A 3SGIA 1VQHA 1PH9A 4PZ6A 1AH9A 4X6AH 1BBUA 2K5NA 1VQKA 2HIXA 3BZCA 2R93H 3BU2A 5IT9c 1OXSC 3HOUH 5IP7H 3PO3G 3M4OH 4B3SL 3GDEA 3JAMc 1MJCA 3S2HH 2Z6KC 4OO1I 3CC7A 1V9PA 3KJOA 3HOYH 1Y1VH 1K3RA 4OO1G 4IFDJ 1BBWA 1W3SA 3M9BA 4A3EG 1EYGA 5DLQE 4JI8L 1Q1EA 4GNXC 4B3SQ 3S1NH 5FJ8H 3PSIA 4BBSG 3RN5A 3S1QH 1YZ6A 3TQYA 3CCEA 2R92G 2B63H 4POGA 4P74A 4JI8Q 1X54A 4LF9L 4IFDI 1VQ5A 3AFPA 3F1ZA 1D8LA 4DAMA 4HIKA 4IFDG 4YWMA 1I5FA 1KRSA 1SLJA 1YBYA 3RN2A 1UE6A 4OX9L 5EAYA 1QVGA 4LF9Q 4JI1L 3RNUA 1M1KC 4IJLA 1X56A 3G71A 2LXJA 5GQOA 1PH6A 4OX9Q 1D7QA 2CFMA 4GN4B 1E3PA 5HGQA 1VQ6A 4DR6L 2OTLA 3F2BA 1KRTA 2NVXH 2KENA 1WFQA 2WB1G 4TQUS 1N34L 2I5HA 1VQEA 2CWPA 3S17H 1WCMG 3K81C 3UDIA 4AYBG 4RG1A 1ASYA 2VZAA 4UY8C 1XMOL 1IBLL 4A3LG 5JJKA 4A3CG 3KFUA 4GNXB 1C0AA 4R4QA 1YHQA 1LTLA 4Y52H 3S14H 4JBMA 3D31A 2LSSA 2HQLA 2AKWB 1Q86C 1KHIA 2R93G 2IHFA 1XMOQ 1IBLQ 3HOUG 5IP7G 1A62A 1SRUA 3HKZE 3KJPA 2BA1A 3K0XA 2AWNA 3U50C 1S3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY G;  1Y1V G;  4APV A;  3HOX H;  2JEB I;  1XJV A;  5LMU L;  3GTG H;  4YHH L;  4YCV A;  4DR4 L;  1YHA A;  4P71 A;  5FJ8 G;  1A0I A;  1J5E L;  3GTL H;  4WJ3 M;  3RLN A;  1VS0 A;  1J6Q A;  4BBR H;  2VL6 A;  2B63 G;  2E8G A;  1EQR A;  2MNA A;  4GLX A;  1NJI C;  1KIX A;  3PUY A;  5FLX c;  4HID A;  4JI7 Q;  4LF4 L;  5C44 H;  1XPO A;  4YHH Q;  1AE3 A;  1JJ2 A;  4DR4 Q;  1Q46 A;  2B3G A;  4FDB A;  3H15 A;  3TRZ A;  1E24 A;  1T9H A;  4IJH A;  4DR5 L;  3I7F A;  1VQ8 A;  4DV3 L;  4LF4 Q;  1N8R C;  2BA0 A;  4MZ9 A;  3CCS A;  1E1T A;  4L5T A;  3OTO L;  5IWA L;  1I50 H;  1QZH A;  4GS3 A;  4EX5 A;  4DV1 L;  3NBH B;  5LMN L;  4DR5 Q;  1XPR A;  1KD1 C;  4YCU A;  4LW1 A;  4DUY L;  4DV3 Q;  5GAH C;  2JA7 H;  1UE5 A;  1IYJ B;  2PMZ E;  1BKB A;  2OQK A;  3KDF A;  1FGU A;  4A3G H;  3CW2 C;  2EXD A;  2EQS A;  4DV1 Q;  5LMN Q;  4BA1 I;  4HJ5 A;  4QQB X;  3EIV A;  4DUY Q;  1H95 A;  2H5X A;  3CCJ A;  2Q2T A;  1YVC A;  2K50 A;  2K75 A;  2Y0S E;  1GO3 E;  3W1B A;  4GKJ L;  2RF4 A;  1HR0 L;  4B3R Q;  2ALY B;  4GLA C;  5ELN A;  4A3E H;  1IZ6 A;  3K7U C;  1VQ7 A;  1LYL A;  1HR0 Q;  1IL2 A;  5JEA J;  3UE1 A;  1WYD A;  4A93 H;  3HOX G;  4LFA L;  3NEN A;  2QEX A;  2Q2I A;  1HZB A;  2JQO A;  1OXT A;  2NVQ H;  3HOW H;  3M7N A;  1UE7 A;  1TWG H;  4LUZ A;  3CF5 A;  5C4X H;  1VQ4 A;  4JBK A;  4JV5 Q;  4GOP A;  4JBW A;  4BBR G;  4DR2 L;  4JI2 L;  2ZTE A;  4AIM A;  2WAQ G;  4UP9 A;  2PNH A;  2UXB Q;  2NVT H;  5C44 G;  1GVP A;  2GVB A;  1MIU A;  5JEA G;  2VQF L;  3OW2 A;  3S1M H;  4JI4 L;  3TS2 A;  4DV7 L;  4BY7 H;  1PYB A;  2UXB L;  4JI2 Q;  3FP9 A;  2XGT A;  5AJ3 L;  1XTD A;  2KHJ A;  3UDX A;  2K5V A;  1KXL A;  1FJG Q;  2VW9 A;  1YEZ A;  2VQF Q;  3CCQ A;  1EOV A;  1PFS A;  2N8N A;  2NZH A;  4MNO A;  4UP7 A;  4XTC S;  5GAD C;  5IY0 A;  4DV7 Q;  4JI4 Q;  4DV0 Q;  1PV4 A;  1M90 C;  4OWW B;  2VUM H;  5AJ3 Q;  4LUV A;  2D0P A;  3CCR A;  2N78 A;  3I4N H;  3T1H L;  4A3G G;  3DLL A;  2ZTD A;  3I2Z A;  3RR5 A;  4LUO A;  2IY5 B;  2F3I A;  3KF6 A;  5GAG C;  2UXD Q;  3A74 A;  3AQQ A;  3CME A;  3S24 A;  5IYC H;  4IPG A;  2IT1 A;  3CQZ H;  4IPH A;  4KI0 A;  2HHH L;  4OWX B;  3U4V A;  3W5O A;  1VQI A;  4KLK A;  1QUQ B;  4DUZ L;  4DR3 L;  1SFO H;  3PUZ A;  3IRB A;  5M3F H;  2HHH Q;  4Y7N H;  4A3B H;  1VQC A;  1N32 L;  1VQJ A;  3M4Q A;  1P8L A;  2PQA A;  4AYB E;  2OTJ A;  5K36 G;  4A93 G;  5LMN W;  4JI5 L;  1YIT A;  4DUZ Q;  4DR3 Q;  3HOW G;  4AH6 A;  1UE1 A;  5M5Y H;  5C4X G;  4DV2 L;  1ASZ A;  2KCT A;  1K8A C;  2WP8 J;  1N32 Q;  1B8A A;  1SMX A;  2D62 A;  2NN6 I;  2ZJR A;  2ZJP A;  3A0J A;  2IX1 A;  2NN6 G;  1VQP A;  2IX0 A;  2FXQ A;  2AHO B;  4NPS A;  4DV2 Q;  1EIF A;  1HNX L;  1V1Q A;  3GTM H;  2WB1 E;  4BY7 G;  3F8T A;  1XMQ L;  3PF5 A;  3J81 j;  1HR0 W;  1CKM A;  1A63 A;  4JI1 Q;  3J7A 5;  2F52 A;  3I56 A;  4KHP L;  1R9T H;  3T1Y L;  2UUA L;  1XPU A;  3KYH C;  1K0R A;  3MEF A;  4P72 A;  5ELO A;  1PH3 A;  2VUM G;  1PH1 A;  1GM5 A;  4DR6 Q;  1L1O C;  1KQS A;  2GVA A;  1IBM L;  2NVY H;  2HT1 A;  1N34 Q;  3I4N G;  4KHP Q;  3FHW A;  3T1Y Q;  2UUA Q;  1TWA H;  2CQO A;  2K52 A;  3KF8 B;  2OWO A;  1G6P A;  3S15 H;  5IYC G;  4A3K H;  1PH4 A;  4C3I H;  4LFB L;  2JA6 H;  2VQE L;  1PA6 A;  1GKH A;  2R7D A;  4DPG A;  3VDY A;  3AEV A;  3H3V I;  4DR7 L;  1YJN A;  1Q8K A;  2ZTC A;  3DM3 A;  4JC0 A;  4A76 A;  3W1G A;  4GOP C;  1VQN A;  4JOI A;  4DV4 L;  4BXX H;  1N9W A;  5M3F G;  5E7N A;  1I94 L;  4A3B G;  1NBW A;  1X55 A;  1KAW A;  5C3E G;  1OTC A;  1N33 L;  3KDF B;  1CKN B;  2D0O A;  5LMU Q;  2UU9 L;  1VQA A;  3PUW A;  4DV4 Q;  5JJI A;  1S40 A;  4B3T L;  1J5E Q;  1I94 Q;  1HJP A;  2YTX A;  3CP0 A;  3GD7 A;  2I5L X;  1VQF A;  1FL0 A;  3G48 A;  1CUK A;  1YI2 A;  2UU9 Q;  4IPD A;  1L1O B;  3KOJ A;  3J80 i;  4B3T Q;  3PF4 A;  2KHI A;  4DAY B;  1JB7 A;  1X6O A;  2Z6K A;  4L5Q A;  1QZG A;  4POF A;  3CXC A;  1Q82 C;  4PG3 A;  3CPW A;  3F2D A;  3OTO Q;  1VQM A;  5IWA Q;  3ULL A;  3ERS X;  4GNX A;  1CSP A;  1U5K A;  2ID0 A;  2KBN A;  1X3G A;  3ULP A;  2CCZ A;  1JJG A;  1E7Z A;  1RIP A;  3WWV A;  2OQ0 A;  4XIG S;  4LFC L;  2WAQ E;  1B70 B;  1OXU A;  2ATW A;  1WJJ A;  2E2I H;  2ZJQ A;  3CC4 A;  5J3B A;  2JK8 A;  4NB3 A;  2CWA A;  4NXN L;  5FLM H;  1L0W A;  1TWC H;  3MXN B;  3PUX A;  4LFC Q;  2MQH A;  1Q12 A;  3UE0 A;  4A3K G;  4GKJ Q;  2JA6 G;  1G51 A;  1QVF A;  5JJL A;  3M3Y H;  4O2D A;  4BA2 I;  1SR3 A;  4HJ7 A;  2E2H H;  3GTJ H;  4OXP A;  3B6Y A;  3E9H A;  5C0X J;  3CC2 A;  3F2C A;  3JC6 6;  4BXX G;  3GO5 A;  4A75 A;  4LF7 L;  2N3S A;  5H1S E;  3H0G H;  3S16 H;  4KHZ A;  1VQB A;  2RHS B;  3HKS A;  2IHE A;  4LFA Q;  1K9M C;  4JI0 L;  5C0X I;  4LF7 Q;  1X65 A;  4HIO A;  5C0X G;  4DR2 Q;  2F4V L;  4JI0 Q;  4JYA L;  4R4T A;  4YWK A;  1HNZ L;  4X62 L;  4NXM L;  3NEL A;  3ER0 A;  4A3F H;  4L5S A;  1HNW L;  4DR1 L;  1N36 L;  2JA8 H;  2F4V Q;  1HZC A;  1LUZ A;  1X3F A;  2YTY A;  3G4S A;  4DV5 L;  4AQY L;  3S1R H;  1PHJ A;  2UUC L;  3A5Z B;  3NEM A;  5IE8 A;  3CAM A;  1SN8 A;  1V43 A;  1HNZ Q;  1Z47 A;  2PQA B;  2JA9 A;  4X62 Q;  3CMA A;  2A8V A;  1HNW Q;  4LNQ A;  2MFI A;  4DR1 Q;  1N36 Q;  3J81 i;  4DV5 Q;  1NMF A;  4LF5 L;  1GD7 A;  3GTK H;  1UEB A;  4QJF A;  4IOA A;  2AWO A;  3T1H Q;  1Y14 B;  2YV5 A;  4IO9 A;  4A3M H;  3M85 A;  1K8G A;  5FLM G;  2MO1 A;  3UDF A;  3H3V H;  1MKH A;  3CCV A;  4X64 L;  1EFW A;  2VS1 A;  2UXC L;  4QL5 A;  2RHQ B;  5C3E H;  3L2P A;  1EQQ A;  2ES2 A;  4QGU A;  1G29 1;  4JBJ A;  4X64 Q;  2UXC Q;  1HZA A;  2UUB L;  1PYS B;  4JG2 A;  4HJA A;  3H0G G;  1NY4 A;  4DK6 C;  4IOC A;  2BH2 A;  1WI5 A;  1I6H H;  4JI5 Q;  4HIM A;  5IYB H;  2I0Q A;  3CD6 A;  2V1C C;  3TS0 A;  2UUB Q;  4TVA B;  4GN5 A;  4O0A A;  5HY6 A;  4H02 A;  3HOZ H;  1LM0 A;  1EWI A;  2JE6 I;  4BY1 H;  4K0K L;  3PO2 H;  4A3D H;  3BJU A;  1Q7Y C;  4C3H H;  1K83 H;  3UDG A;  3ICE A;  2N49 A;  3AYH B;  2ZM6 L;  4MTN A;  1FVI A;  3JAM i;  1PH7 A;  4A3F G;  1S72 A;  1NMG A;  1HNX Q;  3RLO A;  1YJW A;  1XMQ Q;  4K0K Q;  2JA8 G;  3K80 C;  3K8A A;  4GKK L;  2B29 A;  2A1A A;  4X66 L;  2ZM6 Q;  2NZO A;  4YWL A;  1VQD A;  2LXK A;  1XNQ L;  3GTO H;  2K5H A;  3E9I A;  3PIO A;  1P16 A;  3HFZ B;  4GKK Q;  2I5M X;  2JJQ A;  1C9O A;  1EIY B;  1QUQ A;  3PUV A;  1IBM Q;  4X66 Q;  3GTP H;  2Z0S A;  1Y1W H;  3I4M H;  1E22 A;  5IYD H;  4A3M G;  1Z9F A;  2YYZ A;  1PVO A;  1WOC A;  1XNQ Q;  2QA4 A;  3RZO H;  4HJ8 A;  2R7Z H;  1A8V A;  1KL9 A;  2ASB A;  2WFW A;  4PZ7 A;  4UP8 A;  2VQE Q;  4LFB Q;  3OYY A;  4ALP A;  4DR7 Q;  1KC8 C;  3PIP A;  1VQ9 A;  3J80 c;  4IPC A;  5IP9 H;  3U4Z A;  3E0E A;  2Q2U A;  2HIV A;  3ULJ A;  3I55 A;  4R4I A;  5M5W H;  4ME3 A;  2L15 A;  1BVS A;  4QY7 A;  1N33 Q;  1DGS A;  5IYB G;  5M3M H;  4JI3 L;  3J7Z C;  2GN5 A;  1YNX A;  3HOZ G;  2YTV A;  3STB C;  1UWV A;  3CCM A;  2OCE A;  4HJ9 A;  1JJC B;  4JI7 L;  3HOV H;  2EIF A;  3CPF A;  4BY1 G;  4C2M H;  2JA5 H;  3PO2 G;  4A3D G;  2KCM A;  3ZJY C;  1Q1B A;  1YJ9 A;  3K7A H;  4JI3 Q;  1I3Q H;  1PH2 A;  1XNR L;  1X9N A;  1VQL A;  4PMW A;  4A3I H;  4UPA A;  3FKI H;  4A3J H;  3PCO B;  4LWC A;  1TXY A;  3TEH B;  4GOP B;  1MJE A;  3PGZ A;  3RLF A;  1TWH H;  1K73 C;  1VQO A;  1XNR Q;  1VQG A;  1YIJ A;  4DKA C;  2MO0 A;  2E5L L;  5M5X H;  2VY3 A;  3EBE A;  3A5U A;  3HKZ G;  1U0L A;  1X3E A;  3EN2 A;  1RL2 A;  4LF6 L;  4X65 L;  1AE2 A;  1HH2 P;  1Y1W G;  3I4M G;  2E5L Q;  5IYD G;  4NXN Q;  3GTQ H;  3S2D H;  3D0F A;  1E1O A;  4YCW A;  2R7F A;  2K4K A;  1CSQ A;  2BH8 A;  3Q8D A;  2R7Z G;  1CKN A;  1B7Y B;  3AFQ A;  5GRO A;  4LF6 Q;  1HZ9 A;  2K14 A;  2XTI A;  4X65 Q;  4B3R L;  2R6G A;  3PO3 H;  4GLV B;  3CCU A;  1QVC A;  5BR8 L;  1OXV A;  1YHB A;  2C35 B;  4B3M L;  4P75 A;  5IP9 G;  3TRE A;  2JEA I;  4R4O A;  1IXR A;  1L1O A;  3BZK A;  3KF6 B;  3L7Z C;  2E2J H;  1CKO A;  3KLW A;  4DV6 L;  4JCV E;  1VCI A;  5BR8 Q;  1NE3 A;  1PH8 A;  4B3M Q;  4JV5 L;  4A4I A;  1C7Y A;  2CKZ B;  2PI2 E;  5M3M G;  4R1J A;  4BBS H;  4DK3 C;  2R92 H;  3J81 c;  1TWF H;  2RCN A;  3HOV G;  4DV6 Q;  2JA5 G;  2DUD A;  2Q2H A;  4C3J H;  4JYA Q;  4DNI A;  4PZ8 A;  4NXM Q;  3I4O A;  1EUJ A;  4OWT B;  2YU9 H;  2DGY A;  3CCL A;  4A3I G;  2PI2 A;  3FKI G;  4A3J G;  4AQY Q;  3LGJ A;  4YY3 L;  1FJG L;  4J15 A;  2Y0S G;  2UUC Q;  3M4P A;  4R4C A;  1OXX K;  1NTG A;  1JE5 A;  1IBK L;  4DV0 L;  4JI6 L;  3PV0 A;  4EQ5 A;  4LF8 L;  3U58 A;  4JOI C;  4L5R C;  4P73 A;  2A19 A;  1Q81 C;  1JMC A;  2QGQ A;  3STB D;  4YY3 Q;  3G6E A;  4LF5 Q;  1SE8 A;  2AMC B;  4QIW E;  4RMF A;  5C4J H;  3RZD H;  1W2B A;  2VNU D;  1O7I A;  4GN3 B;  1IBK Q;  1WCM H;  5GAE C;  4JI6 Q;  4WJ4 A;  4LF8 Q;  1L2F A;  4A3L H;  2UXD L;  3L0O A;  4A3C H;  4OON A;  1PH5 A;  1SRO A;  2JA7 G;  1JT8 A;  3SGI A;  1VQH A;  1PH9 A;  4PZ6 A;  1AH9 A;  4X6A H;  1BBU A;  2K5N A;  1VQK A;  2HIX A;  3BZC A;  2R93 H;  3BU2 A;  5IT9 c;  1OXS C;  3HOU H;  5IP7 H;  3PO3 G;  3M4O H;  4B3S L;  3GDE A;  3JAM c;  1MJC A;  3S2H H;  2Z6K C;  4OO1 I;  3CC7 A;  1V9P A;  3KJO A;  3HOY H;  1Y1V H;  1K3R A;  4OO1 G;  4IFD J;  1BBW A;  1W3S A;  3M9B A;  4A3E G;  1EYG A;  5DLQ E;  4JI8 L;  1Q1E A;  4GNX C;  4B3S Q;  3S1N H;  5FJ8 H;  3PSI A;  4BBS G;  3RN5 A;  3S1Q H;  1YZ6 A;  3TQY A;  3CCE A;  2R92 G;  2B63 H;  4POG A;  4P74 A;  4JI8 Q;  1X54 A;  4LF9 L;  4IFD I;  1VQ5 A;  3AFP A;  3F1Z A;  1D8L A;  4DAM A;  4HIK A;  4IFD G;  4YWM A;  1I5F A;  1KRS A;  1SLJ A;  1YBY A;  3RN2 A;  1UE6 A;  4OX9 L;  5EAY A;  1QVG A;  4LF9 Q;  4JI1 L;  3RNU A;  1M1K C;  4IJL A;  1X56 A;  3G71 A;  2LXJ A;  5GQO A;  1PH6 A;  4OX9 Q;  1D7Q A;  2CFM A;  4GN4 B;  1E3P A;  5HGQ A;  1VQ6 A;  4DR6 L;  2OTL A;  3F2B A;  1KRT A;  2NVX H;  2KEN A;  1WFQ A;  2WB1 G;  4TQU S;  1N34 L;  2I5H A;  1VQE A;  2CWP A;  3S17 H;  1WCM G;  3K81 C;  3UDI A;  4AYB G;  4RG1 A;  1ASY A;  2VZA A;  4UY8 C;  1XMO L;  1IBL L;  4A3L G;  5JJK A;  4A3C G;  3KFU A;  4GNX B;  1C0A A;  4R4Q A;  1YHQ A;  1LTL A;  4Y52 H;  3S14 H;  4JBM A;  3D31 A;  2LSS A;  2HQL A;  2AKW B;  1Q86 C;  1KHI A;  2R93 G;  2IHF A;  1XMO Q;  1IBL Q;  3HOU G;  5IP7 G;  1A62 A;  1SRU A;  3HKZ E;  3KJP A;  2BA1 A;  3K0X A;  2AWN A;  3U50 C;  1S3O A; 
#chains in the Genus database with same CATH topology
 2JEB I;  3MEH A;  2Q8R E;  4IUP A;  2C5C A;  1YHA A;  4E6I A;  1A0I A;  4BWG B;  1J5E L;  3RLN A;  3OWE B;  1V1P A;  2H4O A;  4HID A;  5FLX c;  4LF4 L;  5C44 H;  1XPO A;  2B2Y A;  1JJ2 A;  2TSS A;  2FMC A;  3NTH A;  3KF8 A;  1I50 B;  3I7F A;  3D6W A;  4KD4 A;  4L5T A;  4FP5 D;  1T5E A;  5IWA L;  1I50 H;  1QZH A;  1EOT A;  4RAU C;  4LW1 A;  4NW2 A;  4DUY L;  5GAH C;  5CV4 A;  5A2Q L;  4FF4 A;  3KDF A;  1BKB A;  1WTP A;  1FGU A;  2EQS A;  5LMN Q;  1LLR D;  4JVZ A;  1AFP A;  5D3D A;  3AMU A;  5ELF A;  3CCJ A;  2C9O A;  4R8N A;  2K05 A;  2RVL A;  4EVO A;  4B3R Q;  4R9W A;  4RWS C;  1BCP D;  1UEA B;  1PZK D;  5JOB A;  1VDZ A;  5JEA J;  3UE1 A;  4PMB A;  4LFA L;  3S16 B;  2Q2I A;  1B53 A;  3IFD A;  4JBK A;  3U9S A;  5DNF A;  1OO9 B;  2F0H A;  3KBX A;  1STA A;  2ZTE A;  1QCB D;  4BY7 B;  4UP9 A;  3Q22 A;  2UXB Q;  1GUG A;  5JEA G;  1TS4 A;  2AQ1 B;  4JI4 L;  4BY7 H;  2XGT A;  1PTO C;  1ENF A;  1YEZ A;  4MNO A;  2WV6 D;  1WD0 A;  2VUM H;  5AJ3 Q;  1LT4 D;  2R3Z A;  2D0P A;  3AB9 A;  3SXH A;  3SK5 A;  3T1H L;  3DLL A;  3I2Z A;  1CHQ D;  4LUO A;  3KF6 A;  5IOD A;  1FYC A;  3AQQ A;  3R2I A;  4CKC A;  5IYC H;  4K6D A;  4KI0 A;  4F88 A;  5ELC A;  3QR8 A;  1KNA A;  3FDT A;  3I73 A;  4A3B B;  1VQI A;  1QUQ B;  4DR3 L;  3PUZ A;  5I2X A;  3BYY B;  5M3F H;  4A3B H;  3QIA A;  1O78 A;  2SEB D;  2PQA A;  3M4Q A;  5K36 G;  1XXG A;  3K5N A;  1SBB B;  4A93 G;  4DUZ Q;  3HOW G;  5C4X G;  1JOO A;  4DV2 L;  2KVM A;  2WP8 J;  2ZJP A;  2L1B A;  2IX1 A;  1A15 A;  1F9P A;  4BY1 B;  4U68 A;  4A3D B;  2FXQ A;  4NPS A;  1I6V C;  1BCP C;  1G8Z D;  3PF5 A;  1Z7T A;  1EIH A;  5BN5 A;  3J7A F;  4JI1 Q;  3I56 A;  1XPU A;  1DYQ A;  2UUA L;  1K0R A;  4P72 A;  5ELO A;  1BQQ T;  1V1P B;  5C4Z A;  1IBM L;  2F0P A;  2CQO A;  3KF8 B;  2LMC B;  2SNS A;  4A3K H;  4LFB L;  2JA6 H;  2VQE L;  4DR7 L;  1YJN A;  2ZTC A;  5EKL A;  4K5X A;  3W1G A;  4JOI A;  4DV4 L;  4KY5 A;  4WJW A;  5E7N A;  1OTC A;  3I90 A;  1N33 L;  3KDF B;  2EXZ A;  5M5W B;  2D0O A;  5LMU Q;  1MGS A;  3PUW A;  3WDN A;  5JPN C;  2FHT A;  4ZCK A;  4B3T L;  2YTX A;  3GD7 A;  1FL0 A;  2BE5 D;  3G48 A;  3HOV B;  1YI2 A;  1U9R A;  4ZQ3 A;  3J80 i;  3VR2 A;  2KHI A;  3PF4 A;  2EDG A;  3EA6 A;  5EKK A;  3CPW A;  1TQO A;  4L63 B;  1GUN A;  3ULL A;  2A5H A;  3ERS X;  1CSP A;  2KBN A;  1X3G A;  2CCZ A;  1JJG A;  1RIP A;  3I72 A;  1YNJ D;  2NB0 A;  4XIG S;  2WAQ E;  1B70 B;  1QJO A;  1DD2 A;  3CC4 A;  4IUV A;  1TWC H;  1BUV T;  2JP1 A;  1H9S A;  3EQL C;  3PUX A;  1Y69 U;  1S5D D;  5C6A A;  2XVS A;  4RCO A;  4C3I G;  5DEH A;  5M9O A;  3LWU A;  1QVF A;  5JJL A;  4OXP A;  1CI3 M;  3JC6 6;  3GO5 A;  3NK9 A;  2L5T A;  1EY9 A;  1V1O A;  4EQN A;  2RHS B;  4JI0 L;  3WOE A;  3NHH A;  3N52 A;  4G4K A;  4HIO A;  4I7A A;  2F4V L;  4JYA L;  1CK1 A;  4R4T A;  1CM9 A;  4YWK A;  5C5L A;  4C3J B;  4ZRZ A;  2F03 A;  4NXM L;  3JAM E;  3ER0 A;  1X3F A;  3G4S A;  1LT6 D;  4KK7 A;  3V96 A;  1SN8 A;  2PQA B;  4X62 Q;  5T1G A;  2A8V A;  1HNW Q;  1N36 Q;  3J81 i;  5CC4 A;  3OOC A;  1LT3 D;  1GD7 A;  1XWE A;  3T16 A;  1SND A;  2BE5 C;  4IOA A;  1Y14 B;  1LTI D;  1TKW B;  1K8G A;  3QO2 A;  3CCV A;  3J7Y W;  1EFW A;  3VA7 A;  1A3T A;  2F0S A;  2RDG A;  4XYQ A;  1TS5 A;  1PTO B;  3HGB A;  1YNJ C;  2PYK A;  1PTO H;  2WB1 B;  1PRT B;  4DK6 C;  1I6H H;  3HOY B;  4JI5 Q;  4HIM A;  1EY7 A;  3CD6 A;  3TS0 A;  2UUB Q;  2ZXO A;  5HY6 A;  1AZQ A;  3HOZ H;  4F87 A;  3S1Q B;  1XYI A;  2B63 B;  1E2W A;  5LHY 1;  1JIC A;  4DFA A;  1MI2 A;  1FVI A;  4A3F G;  1NMG A;  5A35 A;  3RLO A;  1YJW A;  1XMQ Q;  2JA8 G;  5DM6 3;  4YWL A;  1FGB D;  2LXK A;  4XQJ A;  2EJG C;  3HFZ B;  2I5M X;  2JJQ A;  3V2T A;  4RHS A;  3RZO B;  2DNE A;  3GTP H;  5IYD H;  4RA8 A;  4A3M G;  1XNQ Q;  2QA4 A;  4J1M A;  3RZO H;  4HJ8 A;  3NTK A;  4KKS A;  2LS0 1;  4DK1 A;  1PZJ D;  3PIP A;  4M8A A;  1SEB D;  4IPC A;  3CKI B;  1DJR D;  3E0E A;  2Q2U A;  3ULJ A;  1G2T A;  3HOX B;  4NMZ A;  5IYB G;  3GTG B;  5M3M H;  4JI3 L;  1W6K A;  3J7Z C;  2OCE A;  5LL6 S;  4BBR B;  4C2M H;  1A3V A;  2KCM A;  3FMC A;  2DY7 A;  1EQV A;  1PH2 A;  3T13 A;  3A8J E;  4A3I H;  4UPA A;  3FKI H;  1TXY A;  2F3V A;  1GHJ A;  3PGZ A;  1K73 C;  2HCC A;  3EVQ A;  2EJM A;  3EBE A;  3TSS A;  3HKZ G;  1X3E A;  1RL2 A;  1Y8N B;  4ZUJ A;  4RKL A;  1F2Y A;  2RDH A;  3I4M G;  1E1O A;  1HPC A;  4FXK C;  3AFQ A;  2L0C A;  4B3R L;  2PNR C;  1QVC A;  2NTT A;  1B50 A;  2F0D A;  5IP9 G;  3OSO A;  2K5D A;  2B2W C;  1L1O A;  4KKU A;  3L7Z C;  2IJ0 A;  4OO1 H;  2F0F A;  1VCI A;  1WTR A;  1BBX C;  1JWS D;  2PI2 E;  4BBS H;  2EPB A;  3WOF A;  4DV6 Q;  4X3K A;  4K6L A;  2Q2H A;  3H3V C;  1IYV A;  2YU9 H;  2DGY A;  1Q90 A;  4AQY Q;  2J0T D;  3M4P A;  1OXX K;  1STG A;  4JI6 L;  2QW7 A;  4O42 A;  3PV0 A;  4RFB A;  2QDL A;  1MSH A;  3G6E A;  5C4J H;  3RZD H;  1WCM H;  3I4N B;  1L2F A;  4A3C H;  1DOK A;  1SRO A;  1PH9 A;  1TS2 A;  3R8B A;  2PZT A;  1BBU A;  1EZ6 A;  2K5N A;  1OXS C;  5IP7 H;  4H13 C;  4MTK A;  1Y1V B;  2HUG A;  3GDE A;  3NQT A;  3JAM c;  1MJC A;  2OXP A;  1DCZ A;  3OPO A;  1IHZ A;  4OO1 I;  3KJO A;  1Y1V H;  5DLQ E;  4B3S Q;  3S1N H;  5IGF A;  1ET6 A;  1CZW A;  5M5Y B;  1C4Q A;  3ND8 A;  4LF9 L;  3AFP A;  3BZD B;  1EQT A;  1SNQ A;  2O5I C;  3HP3 A;  1J9O A;  1I5F A;  1SLJ A;  1YBY A;  4HED A;  3GTM B;  4ODG A;  4JI1 L;  2AQ3 B;  1X56 A;  5CBA E;  1MD2 D;  2CFM A;  3MWY W;  4GN4 B;  1R9T B;  2OTL A;  1BCP F;  1BR9 A;  3F2B A;  3S17 H;  3K81 C;  4WRD A;  3UDI A;  4UY8 C;  3R3O A;  4RG1 A;  2VZA A;  1UNS A;  3RD4 A;  1TR5 A;  1IBL L;  4FF3 A;  1C0A A;  1NAP A;  4Y52 H;  2Z4I A;  3S15 B;  2HQL A;  2AKW B;  3FVQ A;  1E2V A;  1KHI A;  2A69 D;  5IIF A;  3MFY A;  1CA6 A;  2Z9H A;  2F0W A;  1EYC A;  3G7L A;  4EQO A;  4ZYS A;  2AWN A;  3VYT A;  1S3O A;  3GTL B;  4R8I A;  5LMU L;  4YHH L;  4DR4 L;  5FJ8 G;  5CGK A;  3GTL H;  1VS0 A;  2EYJ A;  2E8G A;  1EQR A;  1STN A;  2MNA A;  1KIX A;  3PUY A;  1AE3 A;  1Q46 A;  4KKT A;  4FDB A;  3TRZ A;  1E24 A;  1T9H A;  4IJH A;  4DR5 L;  1VQ8 A;  4DV3 L;  2BA0 A;  5IGC A;  2HQE A;  4YIJ A;  1E1T A;  2K32 A;  2Z1C A;  4EQP A;  2O4X A;  4EX5 A;  1BO0 A;  3NBH B;  4DV1 L;  4IAL A;  3VA5 A;  1KD1 C;  5EGT A;  5E3F A;  2KOL A;  3CW2 C;  4QQB X;  4NP5 A;  5CV5 A;  2JN4 A;  1SNM A;  2RA4 A;  5EQ0 A;  2IWH A;  2NZ1 D;  2Q2T A;  2K75 A;  3QB3 A;  2Y0S E;  3W1B A;  4WFN 3;  2RF4 A;  1MSG A;  4HCS A;  1GXD C;  4RCN A;  1IZ6 A;  4CDE C;  2E2H B;  2F0L A;  3K7U C;  1VQ7 A;  1HR0 Q;  2QEX A;  2NVQ H;  2K04 A;  3M7N A;  4LUZ A;  4GOP A;  2O5J C;  2KED A;  4JI2 L;  2NN6 H;  2WAQ G;  2PNH A;  4N9T A;  5C44 G;  2B2T C;  2F0G A;  2PZW A;  2VQF L;  2A69 C;  3TS2 A;  1SDF A;  3R2T A;  3HEJ A;  1CT1 D;  1JB3 A;  2CH4 A;  3S1R B;  3MXU A;  2VW9 A;  4S3S A;  3CCQ A;  1EOV A;  2NZH A;  4XTC S;  1AZP A;  5IY0 A;  1GUS A;  4DV7 Q;  4DV0 Q;  4OWW B;  3DEP A;  3VYU A;  4O1N A;  4LUV A;  3OHX C;  2IPK D;  1ICF B;  4XDX A;  1PXU A;  1CTM A;  3D4W A;  3GTK B;  3I3C A;  1D2B A;  2IY5 B;  5GAG C;  2UXD Q;  3A74 A;  3D4R A;  3S24 A;  5IGB A;  4TRD A;  4IPG A;  2IT1 A;  1QOH A;  4IPH A;  1G91 A;  4OWX B;  1WTW A;  1KTK A;  5KEE A;  4OHJ A;  3W3A A;  5C3E B;  3GQB A;  2HHH Q;  4KY7 A;  5DM7 3;  1N32 L;  2B2Y C;  1P8L A;  5JVG 3;  4JI5 L;  2Q8I B;  3MZ5 A;  3VYS A;  2KCT A;  1K8A C;  1SMX A;  2NN6 I;  2X6G A;  3QOJ A;  2ZJR A;  5JPM C;  5I4D A;  1VQP A;  3DXJ C;  2AHO B;  2QIL A;  2EYM A;  1V1Q A;  4BY7 G;  1GJX A;  1G2S A;  3F8T A;  4RGO S;  1XMQ L;  1GUW A;  3K58 A;  1Z6H A;  2EE1 A;  4KV6 A;  3T1Y L;  5J39 A;  2NBF A;  2VUM G;  5EPJ A;  1BOS A;  1GM5 A;  4K2L A;  2WIN B;  2HT1 A;  4KHP Q;  1JWM D;  5FO9 B;  2VXW A;  1XTC D;  3SEB A;  2OWO A;  3A56 A;  5IYC G;  1W6J A;  1PH4 A;  2R7Z B;  2EYP A;  1PA6 A;  3H3V I;  1GKH A;  3VDY A;  1Q8K A;  1NR2 A;  1VQN A;  3NQI A;  2F0T A;  4BXX H;  1PRT D;  5M3F G;  4A3B G;  1NBW A;  5G3L D;  2MPM A;  2UU9 L;  2B8F A;  1S40 A;  2P5Z X;  1I94 Q;  4FYD A;  1BNZ A;  1VF7 A;  3MAQ A;  2V4D A;  2JA5 B;  4OIK A;  2F0J A;  2PMZ B;  1JB7 A;  3D6C A;  2Z6K A;  4HTH A;  1FR3 A;  1Q82 C;  2J4X A;  3FEW X;  3F2D A;  3OTO Q;  3E6Z X;  1SMY D;  4GNX A;  1U5K A;  2ID0 A;  1TWH B;  2E2I B;  2VB2 X;  2OQ0 A;  1HRJ A;  1QWY A;  1OXU A;  2ATW A;  2E2I H;  1D5X C;  2ZJQ A;  3GV3 A;  5FLM H;  1UUP A;  4LFC Q;  2MQH A;  3GTQ B;  1Q12 A;  3DWA A;  4A3K G;  4GKJ Q;  2JA6 G;  3KLR A;  1SR3 A;  3H0G B;  3PO3 B;  3FPP A;  4A75 A;  4LF7 L;  4ID6 A;  3H0G H;  3S16 H;  5ISR A;  1VQB A;  3HKS A;  2IHE A;  1K9M C;  3P1H A;  2GA4 B;  1X65 A;  2RQX A;  1F2Z A;  3MVV A;  3W2D A;  4RHR A;  1J8I A;  5C4H A;  2CVR A;  1GHK A;  1GUO A;  1SYG A;  1HNZ L;  3NEL A;  2VB3 X;  3BVZ A;  4L5S A;  4DR1 L;  2MGS A;  1PRT C;  2YTY A;  4AQY L;  5ELB A;  5LL6 X;  2JYO A;  3A5Z B;  5IE8 A;  3CAM A;  1Z47 A;  2EY1 A;  2JA9 A;  1TII D;  2MFI A;  4DV5 Q;  1EY6 A;  1GOZ A;  4QJF A;  2FFK B;  1SNO A;  4LJZ C;  5HUR A;  1DOM A;  2YV5 A;  2QCP X;  3M85 A;  3KK7 A;  4AYB B;  1HFN A;  4X64 L;  4HCE A;  4MIU A;  2VS1 A;  2F3W A;  3Q24 A;  1ONL A;  1SMY C;  2ES2 A;  1G29 1;  4JBJ A;  2R93 B;  2UXC Q;  3Q23 A;  4B9X A;  3P75 A;  4IOC A;  1WI5 A;  2F0K A;  1U4R A;  3PO2 B;  1IKM A;  4C3H B;  1Q3L A;  3NXW A;  1LTG D;  4BY1 H;  3MFG A;  3PO2 H;  4A3D H;  1STH A;  3DMU A;  3TZD A;  4C3H H;  3C2P A;  3T4A C;  3AYH B;  2ZM6 L;  1HNX Q;  3ONA B;  1HFG A;  4K0K Q;  2EOT A;  4C3J G;  3K8A A;  4GKK L;  4CKE A;  4OEM B;  3EJI A;  1Y1W B;  2EZV A;  3PIO A;  2K1B A;  1ROD A;  5I2Y A;  1LAB A;  4X66 Q;  1Y1W H;  1Z9F A;  4CBV A;  1WOC A;  3H6M A;  2WFW A;  5EPK A;  4PZ7 A;  1IKL A;  1M4V A;  4ALP A;  4NKL A;  3D8G A;  3J80 c;  5EBC A;  1A6X A;  1V8Q A;  1ENA A;  3U4Z A;  1HTP A;  1ILP A;  2KHS A;  3OMC A;  4R4I A;  5M5W H;  3TP5 A;  2L15 A;  1K83 B;  1DGS A;  2M00 A;  1BDO A;  3U9O A;  2NUC A;  3HOZ G;  3HOV H;  4HJ9 A;  5JJI A;  1JJC B;  1U4L A;  3ZJY C;  5FLX L;  4ZKB B;  4A3J B;  3X3M A;  1ENC A;  4HMJ A;  1GUT A;  2F0E A;  3RUZ A;  2PZU A;  3PCO B;  4DNR B;  4A3J H;  3TEH B;  4OEL B;  5M5X B;  4ZKC B;  3NSW A;  1VQO A;  1XNR Q;  4Q5V A;  1RDP D;  4DKA C;  1TVX A;  5M5X H;  2VY3 A;  2JA7 B;  1LV9 A;  4X65 L;  2IL8 A;  1FD7 D;  4QMG A;  2E5L Q;  5IYD G;  2B8G A;  3K5O A;  4NXN Q;  1AEX A;  2R7F A;  1CSQ A;  2K4K A;  1CKN A;  1B7Y B;  4LF6 Q;  2XTI A;  4B3M L;  1G6Z A;  5I6W A;  4RKB A;  1STB A;  3DWP A;  4A3E B;  2JEA I;  1MBY A;  1ESR A;  5D14 A;  1ESF A;  3KF6 B;  2KCC A;  2R92 B;  4RGT A;  5BR8 Q;  2B2U C;  2H1E A;  3O13 A;  4A93 B;  3AU7 A;  1C7Y A;  2CKZ B;  4JPB W;  5M3M G;  3HOW B;  4IUQ A;  2R92 H;  1SE4 A;  2RCN A;  3J81 c;  5C4X B;  4G7O C;  2A73 B;  2PPB C;  2DUD A;  4C3J H;  1PZI D;  4DNI A;  4PZ8 A;  1VF5 C;  2NVT B;  4IFD H;  1ML0 D;  3I4O A;  4DA2 A;  3CCL A;  4A3I G;  3FKI G;  3LGJ A;  4KJO A;  2Y0S G;  3MXN A;  2HDL A;  5FOB B;  4DV0 L;  1DM0 B;  1KAB A;  4LF8 L;  3U58 A;  4P73 A;  2A19 A;  4YY3 Q;  3MA2 B;  1SE8 A;  2IX3 A;  1IBK Q;  4A3L H;  2UXD L;  3L0O A;  4OON A;  1X3P A;  4IUR A;  3HOU B;  3X3N A;  2EY5 A;  3M4O B;  1EYD A;  4X6A H;  1QNU A;  2HIX A;  3CQZ B;  4IUN A;  5IT9 c;  3HOU H;  3M4O H;  2XRQ D;  1FNU A;  1SFO B;  3CC7 A;  1D5Z C;  3HOY H;  1K3R A;  1AN8 A;  4OO1 G;  5E4W C;  3M9B A;  1ZYR D;  1WTO A;  1HUN A;  4JI8 L;  2D9U A;  3Q6S A;  4BBS G;  3S1Q H;  5COR A;  4N8F A;  4F8M A;  2B63 H;  2QF7 A;  4IFD I;  2FIN B;  3P20 A;  2DY8 A;  1UE6 A;  3BVM A;  4CJ0 B;  4UHV A;  1QVG A;  1JQY D;  2LXJ A;  2K03 A;  2XIW A;  4OX9 Q;  2KCN A;  3A8K E;  3LWE A;  2KEN A;  2I5H A;  1WCM G;  1WTV A;  1EY0 A;  3T51 B;  4A3C G;  1K3B C;  2Z6B A;  1LTL A;  3GP7 A;  3HRZ C;  3QWN A;  2LSS A;  1HA6 A;  4TSS A;  1Q86 C;  3SR1 A;  4C3I B;  1XMO Q;  5CV6 A;  5IP7 G;  5A2Q E;  3A8I E;  1SNP A;  2KEE A;  3E3X A;  2BA1 A;  4CDC C;  1H9S B;  3NP8 A;  1Y1V G;  3HOX H;  3MHB A;  4CDD C;  3GTG H;  4WJ3 M;  1J6Q A;  1STY A;  4BBR H;  2RBM A;  1NR4 A;  1S4Z A;  3FRP B;  1TT2 A;  1LT5 D;  4LF4 Q;  1N8R C;  4MZ9 A;  3CCS A;  1NCV A;  2NYZ D;  3OTO L;  2EY2 A;  4GS3 A;  3OW7 A;  1ZYR C;  1RF2 D;  5LMN L;  1TY2 A;  4A3G B;  1SJH D;  1SYB A;  1UE5 A;  1IYJ B;  4WOR A;  2OQK A;  4A3G H;  2EXD A;  1EWH A;  4BA1 I;  3K5M A;  3EIV A;  4DUY Q;  2A74 C;  2EYO A;  2H5X A;  3LX0 A;  2K50 A;  1GO3 E;  4GKJ L;  2OT2 A;  4GLA C;  1EEF D;  2L9H A;  4DAY A;  4HAE A;  5IGD A;  4H7B A;  1IL8 A;  2BDN A;  5E4X A;  1WYD A;  4XYO A;  3NEN A;  2JQO A;  2UXB L;  1KNE A;  1OXT A;  2F4I A;  4JBW A;  3S1M B;  5I9O A;  2XN9 C;  2TMP A;  1GVP A;  3I4L A;  1MIU A;  3S1M H;  4QIW B;  1JOR A;  1A2T A;  5AJ3 L;  3UDX A;  4A3F B;  2K5V A;  2JA8 B;  1S5E D;  1FJG Q;  2N8N A;  4UP7 A;  5FKA C;  5GAD C;  4C1N K;  4JI4 Q;  1PTO F;  1PV4 A;  2Z4H A;  4X3U A;  1EEI D;  2Z8L A;  1DON A;  2BCO A;  1WVL A;  3I4N H;  1IYU A;  1NNX A;  2PW5 A;  2ZTD A;  4XXE A;  1LAC A;  5G3L F;  3RR5 A;  2F3I A;  2X6L A;  4A3M B;  1CQF A;  1SE3 A;  4KLK A;  3VR5 A;  4DUZ L;  2WAC A;  1EU3 A;  3IRB A;  2F0Q A;  3A7A B;  3I70 A;  1VQC A;  2ENB A;  3C46 A;  4FXD A;  2OTJ A;  5LMN W;  4IZ8 A;  4DR3 Q;  1UE1 A;  5M5Y H;  1F9R A;  1ET9 A;  1ASZ A;  1PVO A;  1B8A A;  2WKD A;  2MUY A;  2NN6 G;  4K5V A;  2IX0 A;  3QOL A;  2HD3 A;  4DV2 Q;  1HNX L;  3GTM H;  2WB1 E;  1BF4 A;  1A63 A;  2NTS A;  1JE4 A;  2F52 A;  2G9D A;  5TSS A;  2KQ3 A;  1R9T H;  3MXG A;  2NVY B;  3KYH C;  3URY A;  1PH3 A;  5IGE A;  1PH1 A;  1TWA B;  1KQS A;  1B4O A;  4FXG C;  3GTO B;  5KND A;  2NVY H;  3FHW A;  2XRS D;  2UUA Q;  1TWA H;  4JK1 C;  4CKB A;  2K52 A;  3I4M B;  1B1Z A;  3S15 H;  1I4G A;  4P2C B;  5ELE A;  4DPG A;  2B2V A;  2KA7 A;  3FPU B;  4JC0 A;  4GOP C;  3ND9 A;  2R61 A;  1D1K A;  3IAY A;  1EL0 A;  2A6E D;  5C3E G;  1HCZ A;  1KDC A;  3BYT B;  4DV4 Q;  3TDQ A;  1NSN S;  2PW7 A;  3ERO A;  1HJP A;  5C0X H;  2I5L X;  2ICI A;  2KJX A;  1HXY D;  1CUK A;  5JAV A;  4IPD A;  1L1O B;  1JC7 A;  5EPL A;  4B3T Q;  1D5M C;  3K7A B;  4DAY B;  1I3Q B;  4POF A;  1II3 A;  1QG7 A;  5COY A;  1O7Y A;  1E7Z A;  2LKV A;  2F0I A;  1B9N A;  5D3I B;  1EZ8 A;  4NDX A;  2K01 A;  3P7J A;  3L9A X;  1D6E C;  4LAA A;  2JK8 A;  5CV7 A;  5J3B A;  4NB3 A;  2CWA A;  4NXN L;  3CHB D;  2O2L D;  4KMU C;  4FVM A;  1ICW A;  4B08 A;  3S2D B;  1G51 A;  2JSO A;  4O2D A;  4BA2 I;  4HJ7 A;  2E2H H;  2B39 A;  4V0B A;  4CHT B;  4BXX G;  5H1S E;  1A2U A;  2E2D C;  3TME A;  4KHZ A;  4BS9 A;  3GV6 A;  3MC0 B;  3CRL C;  5C0X I;  4DR2 Q;  1VMC A;  5C3X A;  3K57 A;  4JI0 Q;  2LFN A;  1RJT A;  2IW3 A;  1M8A A;  4X62 L;  2A68 D;  3I8Z A;  4OGQ C;  1HNW L;  1N36 L;  2F4V Q;  1HZC A;  1LUZ A;  3S1R H;  1PHJ A;  4ZUI A;  5FO7 B;  4XT1 B;  1KDA A;  1V43 A;  4HSV A;  2A6E C;  5CMD A;  3CMA A;  4U67 3;  3K0Y A;  3C3L A;  2ZXP A;  1NMF A;  5AFW A;  4MN3 A;  3GTK H;  1UEB A;  1H9M A;  1O7Z A;  5FLM G;  2MO1 A;  3UDF A;  3H3V H;  4ME5 A;  1EY4 A;  3TN2 A;  5KGU A;  1Y8P B;  2AUK A;  2BOS A;  4QL5 A;  2RHQ B;  5C3E H;  2K6A A;  4QGU A;  4FNF A;  3HG9 A;  5J1Z A;  2UUB L;  1PYS B;  4JG2 A;  3JAM L;  4HJA A;  3S2H B;  3H0G G;  1NY4 A;  1HTL D;  2BH2 A;  1JCK B;  1KLG D;  3J80 E;  3DM1 A;  4O0A A;  4H02 A;  1LM0 A;  4L8J A;  1B44 D;  1QE6 A;  3UDG A;  3K6O A;  3ICE A;  1PMR A;  4MTN A;  3KUP A;  1ILQ A;  3PIP 3;  3IKJ A;  1FNV A;  3K80 C;  3E5S A;  2A1A A;  4TKO B;  2XWB B;  1VQD A;  1XNQ L;  2F1M A;  3E9I A;  1LTR D;  3BDL A;  1C9O A;  1SYC A;  1EIY B;  1QUQ A;  2Z0S A;  3DHQ A;  1EYA A;  1E22 A;  2YYZ A;  2A68 C;  2PQE A;  2R7Z H;  2ASB A;  4IQZ A;  1KAA A;  4UP8 A;  3S14 B;  3OYY A;  4CJ1 B;  1RCV D;  3MTS A;  2MP1 A;  1IW7 D;  2HIV A;  1K8M A;  1I4Q A;  4ME3 A;  1BVS A;  4QY7 A;  1PFM A;  2GN5 A;  2Q8T A;  3STB C;  4PQX A;  1UWV A;  3CCM A;  3CPF A;  2JA5 H;  4BY1 G;  3T53 B;  3PO2 G;  4CGY B;  4A3D G;  2CH4 W;  1Q1B A;  1YJ9 A;  2WAQ B;  1ZKO A;  4I7Z C;  4C3H G;  4JI3 Q;  5C44 B;  5EJW A;  1CZG A;  4PMW A;  3J81 E;  4GOP B;  2N55 A;  1TWH H;  2MO0 A;  3SK6 A;  1X3Q A;  4RH6 A;  1R4P B;  1KLU D;  1U0L A;  5CV8 A;  1HHV A;  2G5D A;  4DXF A;  1HH2 P;  1Y1W G;  3A54 A;  1TY0 A;  3L3O C;  3GTQ H;  3D0F A;  3Q8D A;  1HZ9 A;  2K14 A;  1BXT A;  2RDF A;  3HZX A;  3PO3 H;  1YHB A;  4ZK9 B;  2E2J B;  4P75 A;  3TRE A;  1IXR A;  2E2J H;  3KLW A;  1E2Z A;  4DV6 L;  1F2M A;  1TWF B;  1S5C D;  1PLF A;  1NE3 A;  3NBI A;  5IT9 E;  4A4I A;  3D3R A;  4R1J A;  4DK3 C;  1TWF H;  3HOV G;  1A3U A;  4QB4 A;  3CRK C;  4G57 A;  1SSO A;  4OIJ A;  1H9R A;  1EUJ A;  2EYL A;  3K5L A;  1IW7 C;  2PI2 A;  4A3J G;  1FJG L;  3NWT A;  4CDF C;  2I46 A;  3PMF A;  2UUC Q;  1JE5 A;  4EQ5 A;  4JOI C;  1Q81 C;  5CR3 A;  1JMC A;  2VUM B;  2RKS A;  4LF5 Q;  2AMC B;  4RMF A;  2VNU D;  3SK8 A;  1W2B A;  1O7I A;  2EYF A;  2CW0 D;  4JI6 Q;  5GAE C;  4HR7 B;  4F7X A;  2JA7 G;  4FF1 A;  1JT8 A;  3SGI A;  3D4D A;  3G6J B;  4PZ6 A;  4Z9C B;  1U4M A;  4DU9 A;  1RTN A;  1AH9 A;  4UDU C;  1VQK A;  2R93 H;  4B3S L;  3KLS X;  1V9P A;  5M3F B;  2G9H D;  4IFD J;  1BBW A;  1EWC A;  4XQN A;  4A3E G;  1EYG A;  1O80 A;  4FO2 A;  3BVG A;  5JVH 3;  2DJF C;  2CHB D;  3PSI A;  3RN5 A;  1YZ6 A;  2R92 G;  4P74 A;  2D2C C;  3R93 A;  1L0X B;  1WD1 A;  4QUC A;  4CJ2 C;  1X54 A;  4JW0 A;  1VQ5 A;  4HIK A;  4IFD G;  2SNM A;  5EAY A;  1LO5 D;  5EBD A;  4LF9 Q;  1M1K C;  3G71 A;  2FMM A;  5GQO A;  1PH6 A;  1E3P A;  3OWF A;  1AW7 A;  3BS1 A;  1EY5 A;  1B9M A;  1KRT A;  1VQE A;  2CWP A;  3TP6 A;  4J8Q A;  4A3L G;  5I6Y A;  5ELD A;  5JJK A;  1K28 A;  3KFU A;  3QG1 A;  4GNX B;  3D31 A;  1SAP A;  4A3K B;  2JA6 B;  2IHF A;  1IBL Q;  3HOU G;  1A62 A;  2KUM A;  4QF4 A;  1Q8I A;  3TZU A;  3KJP A;  1EU4 A;  1PFN A;  3U50 C;  2WB1 G;  2OF1 A;  1K83 H;  3HOY G;  4APV A;  1XJV A;  2CW0 C;  4YCV A;  4P71 A;  2VL6 A;  2B63 G;  1NUC A;  5KIX A;  4GLX A;  1NJI C;  4JI7 Q;  4YHH Q;  3IFT A;  5JEA H;  4DR4 Q;  2B3G A;  3C1E A;  3H15 A;  4QUF A;  1F9S A;  4DR5 Q;  1XPR A;  3H09 A;  4RGN A;  4YCU A;  4DV3 Q;  2JA7 H;  3NUC A;  1CQV A;  2PMZ E;  1SYD A;  4DV1 Q;  4HJ5 A;  2X69 A;  1H95 A;  3BG3 A;  1YVC A;  4QCL A;  1TWC B;  2SDF A;  5E1F A;  4L6T B;  1HR0 L;  2ALY B;  5ELN A;  4A3E H;  1F9Q A;  3UI2 A;  3H94 A;  4KY6 A;  4K14 A;  4DAP A;  1TWG B;  1LYL A;  4PV1 C;  1IL2 A;  5K36 H;  4A93 H;  2EVB A;  3HOX G;  1HZB A;  3HOW H;  4JV5 Q;  1UE7 A;  1TWG H;  5K5P A;  3CF5 A;  5C4X H;  1VQ4 A;  1SNC A;  4HMI A;  1B3Q A;  4BBR G;  4DR2 L;  2E75 C;  1JOK A;  4AIM A;  4DN4 M;  2NVT H;  2GVB A;  2WII B;  3OW2 A;  4DV7 L;  3I91 A;  1PYB A;  4JI2 Q;  1RD9 D;  3FP9 A;  1TS3 A;  1XTD A;  2KHJ A;  1KXL A;  2MJ8 A;  2VQF Q;  1PFS A;  5FO8 B;  2D5D A;  2AUJ D;  3K59 A;  1M90 C;  3VR6 A;  3V05 A;  4DGZ A;  3CCR A;  2N78 A;  2ZT9 C;  4A3G G;  3H91 A;  4B9W A;  5KNB A;  1H9J A;  4N9P A;  3CME A;  3ZYY X;  3S9W A;  3CQZ H;  2HHH L;  5C3W A;  3OMG A;  2N88 A;  3U4V A;  4Y7N B;  3W5O A;  1SFO H;  4Y7N H;  3Q0A A;  1VQJ A;  1YNN D;  4AYB E;  1YIT A;  2XWJ B;  4AH6 A;  1LTB D;  4OL7 A;  4K5W A;  5F2D A;  5T1I A;  1I6H B;  1JOQ A;  2MHV A;  1KDB A;  1N32 Q;  2F0O A;  2D62 A;  3HOZ B;  3A0J A;  1WTH A;  1CFM A;  2ICE C;  2FJ2 A;  3PQI A;  1EIF A;  4V19 0;  1K0S A;  3J81 j;  3IL8 A;  1HR0 W;  1CKM A;  3J7A 5;  2B2U A;  3QJY A;  4KHP L;  1F2L A;  3MEF A;  3SVM A;  2PO4 A;  4DR6 Q;  1L1O C;  5IGG A;  4ILW A;  2GVA A;  2F0N A;  1N34 Q;  3I4N G;  3T1Y Q;  3GTP B;  4KN4 C;  2HDM A;  5CYU A;  1G6P A;  1X32 A;  4C3I H;  1SE2 A;  3AEV A;  2R7D A;  3DM3 A;  4A76 A;  1AP0 A;  4KD3 A;  3J80 L;  1ZEQ X;  1N9W A;  1I94 L;  1BCP B;  2M2L A;  1X55 A;  1KAW A;  3J7A V;  3DEO A;  1CKN B;  4K8I A;  1H9K A;  1VQA A;  1J5E Q;  5M3M B;  1B2T A;  3E0J A;  3CP0 A;  3SHL A;  1VQF A;  1SYF A;  2UU9 Q;  4C2M B;  3KOJ A;  3NPP A;  3T56 B;  2NWG A;  3VR4 A;  1X6O A;  4L5Q A;  1QZG A;  3CXC A;  4PG3 A;  4A3I B;  3FKI B;  1VQM A;  5IWA Q;  2SOB A;  2K5W A;  1YNN C;  2Y0S B;  1ZXT A;  3ULP A;  3WWV A;  4K8J A;  4LFC L;  1QIL A;  2I07 B;  1WJJ A;  5JJZ A;  4ZAI A;  2XNA C;  1L0W A;  3MXN B;  3M3Y B;  4IUT A;  4HN7 A;  3GTJ B;  2EYH A;  3UE0 A;  4IN3 A;  3M3Y H;  1I4X A;  3RMH A;  2EJF C;  3GTJ H;  3B6Y A;  3E9H A;  5C0X J;  3CC2 A;  1I4H A;  1SXT A;  4M1U B;  3F2C A;  2QDB A;  2N3S A;  3A7L A;  4LFA Q;  4DK0 A;  3SK4 A;  2HCI A;  4LF7 Q;  2RSN A;  4DNT B;  4BBS B;  5C0X G;  1JWU D;  3J81 L;  1MHW C;  3NBH A;  1LTA D;  1RTO A;  4KJN A;  2JXM B;  5BN3 A;  4ULL A;  3LNN A;  4A3F H;  2OEO A;  3OIP A;  1QNK A;  2DJG C;  2E76 C;  2JA8 H;  2YU9 B;  4DV5 L;  2UUC L;  3NEM A;  1HNZ Q;  1PRT F;  2BDO A;  4LNQ A;  4DR1 Q;  5CBE E;  3SE0 A;  5KYL A;  1B3A A;  2EY6 A;  4LF5 L;  2QKI C;  2L4N A;  4H44 C;  2B2V C;  5DAU A;  1HA5 A;  2AWO A;  5C4J B;  3T1H Q;  3RZD B;  1DOL A;  4IO9 A;  4A3M H;  1WCM B;  1MKH A;  2UXC L;  1RHP A;  1EQQ A;  3L2P A;  5KNC A;  2K5Q A;  4X64 Q;  5IT9 L;  1HZA A;  1STE A;  1K8O A;  3OIQ A;  3NWS A;  4XT3 B;  3PIO 3;  2ZXR A;  1F77 A;  5IYB H;  2I0Q A;  5EKI A;  2V1C C;  4TVA B;  4GN5 A;  3S1N B;  4I65 A;  5CV9 A;  1EWI A;  2JE6 I;  2B2W A;  4K0K L;  1TU2 B;  3BDC A;  3BJU A;  4UAI A;  1Q7Y C;  3EFX D;  1UAP A;  2N49 A;  2K28 A;  3JAM i;  1PH7 A;  1S72 A;  4KN7 C;  1LTT D;  4DAV A;  4X3S A;  3ERQ A;  1QB5 D;  2B29 A;  1HUM A;  4X66 L;  2ZM6 Q;  3HKZ B;  1PDQ A;  2NZO A;  1PYW D;  1C48 A;  2F0U A;  4XQQ A;  1LTS D;  3N6R A;  3GTO H;  2K5H A;  1P16 A;  4GKK Q;  5FLX E;  3DUZ A;  5I9P A;  3PUV A;  1IBM Q;  3I4M H;  4PNY A;  3S17 B;  1R4Q B;  3TBI B;  1EIG A;  1A8V A;  1KL9 A;  3BDO A;  4Q0F A;  4DXG A;  4C1N I;  4LFB Q;  2VQE Q;  2L12 A;  3SDZ A;  1KC8 C;  4DR7 Q;  5BN4 A;  1VQ9 A;  5IP9 H;  1T5X D;  2E74 C;  1D1I A;  3I55 A;  1N33 Q;  1YNX A;  2YTV A;  3A55 A;  1Y8O B;  4JI7 L;  2EIF A;  3K7A H;  4EGV A;  1I3Q H;  4G7H C;  1XNR L;  1X9N A;  1VQL A;  1HQR D;  3TP7 A;  1S5F D;  3KBG A;  2RSO A;  4MHE A;  4LWC A;  1MJE A;  3RLF A;  4DF7 A;  1VQG A;  3NTI A;  3M7G A;  1YIJ A;  1I4R A;  5KYI A;  2E5L L;  4HSP A;  2M9V A;  3A5U A;  3C1F A;  3EN2 A;  4LF6 L;  1AE2 A;  2K33 A;  3MXP A;  3S2D H;  4YCW A;  2BH8 A;  2R7Z G;  5GRO A;  4X65 Q;  4KTA A;  2R6G A;  2WKC A;  4GLV B;  4K2K A;  3CCU A;  4IUU A;  1OXV A;  2C35 B;  2DNC A;  5BR8 L;  4R4O A;  4X3T A;  3BZK A;  4KHV A;  1CKO A;  1FNW A;  4JCV E;  4B3M Q;  1PH8 A;  3F2U A;  3HS0 C;  2K7V A;  4JV5 L;  2NVQ B;  3VYR A;  2DN8 A;  3NE5 B;  2L11 A;  4LMQ D;  4ABN A;  2JA5 G;  1PFB A;  5NUC A;  4JYA Q;  2KEC A;  4NXM Q;  2L55 A;  2A6H D;  2XSC A;  2LY7 A;  4OWT B;  1C8C A;  1EFI D;  4YY3 L;  4GZY C;  3VR3 A;  4J15 A;  4N8X 1;  4R4C A;  1NTG A;  5D65 A;  1O7L A;  2CQA A;  1IBK L;  4L5R C;  1EY8 A;  2QGQ A;  3STB D;  3CU7 A;  4QIW E;  5HGT A;  1DXM A;  1SJE D;  4GN3 B;  4WJ4 A;  4LF8 Q;  3TP8 A;  1PH5 A;  5IOC A;  1VQH A;  4PMC A;  2QEJ C;  3BZC A;  3BU2 A;  1JR0 D;  2J7Z A;  2F0M A;  3PO3 G;  5L37 A;  4RGM A;  3S2H H;  2PCF B;  2Z6K C;  2AQ2 B;  4C56 C;  1RKN A;  1W3S A;  1Q1E A;  4GNX C;  5FJ8 H;  3TQY A;  3CCE A;  5C5M A;  1XX8 A;  1E0B A;  4POG A;  2F0V A;  4JI8 Q;  3ITP A;  4ZLT F;  1SYE A;  1D8L A;  3F1Z A;  4DAM A;  4YWM A;  1KRS A;  3RN2 A;  5KRU A;  4H0L C;  4OX9 L;  4LK1 C;  1WTX A;  4J6H A;  2RCF A;  5FK9 C;  4FF2 A;  3RNU A;  4IJL A;  2B2T A;  2NVX B;  1WTQ A;  1D7Q A;  5HGQ A;  1VQ6 A;  4DR6 L;  1S5B D;  5J22 A;  2NVX H;  1WFQ A;  4TQU S;  1N34 L;  1VMP A;  1I4P A;  4AYB G;  1ASY A;  1U4P A;  1XMO L;  2A6H C;  4R4Q A;  1YHQ A;  1DZ1 A;  3M4Y A;  4JBM A;  3S14 H;  1HQM C;  3DWQ A;  2R93 G;  3KLS A;  1CA5 A;  1SRU A;  3HKZ E;  4G7Z C;  1CHP D;  1L0Y B;  1PTO D;  3K0X A; 
#chains in the Genus database with same CATH homology
 3HOY G;  1Y1V G;  4APV A;  3HOX H;  2JEB I;  1XJV A;  5LMU L;  3GTG H;  4YHH L;  4YCV A;  4DR4 L;  1YHA A;  4P71 A;  5FJ8 G;  1A0I A;  1J5E L;  3GTL H;  4WJ3 M;  3RLN A;  1VS0 A;  1J6Q A;  4BBR H;  2VL6 A;  2B63 G;  2E8G A;  1EQR A;  2MNA A;  4GLX A;  1NJI C;  1KIX A;  3PUY A;  5FLX c;  4HID A;  4JI7 Q;  4LF4 L;  5C44 H;  1XPO A;  4YHH Q;  1AE3 A;  1JJ2 A;  4DR4 Q;  1Q46 A;  2B3G A;  4FDB A;  3H15 A;  3TRZ A;  1E24 A;  1T9H A;  4IJH A;  4DR5 L;  3I7F A;  1VQ8 A;  4DV3 L;  4LF4 Q;  1N8R C;  2BA0 A;  4MZ9 A;  3CCS A;  1E1T A;  4L5T A;  3OTO L;  5IWA L;  1I50 H;  1QZH A;  4GS3 A;  4EX5 A;  4DV1 L;  3NBH B;  5LMN L;  4DR5 Q;  1XPR A;  1KD1 C;  4YCU A;  4LW1 A;  4DUY L;  4DV3 Q;  5GAH C;  2JA7 H;  1UE5 A;  1IYJ B;  2PMZ E;  1BKB A;  2OQK A;  3KDF A;  1FGU A;  4A3G H;  3CW2 C;  2EXD A;  2EQS A;  4DV1 Q;  5LMN Q;  4BA1 I;  4HJ5 A;  4QQB X;  3EIV A;  4DUY Q;  1H95 A;  2H5X A;  3CCJ A;  2Q2T A;  1YVC A;  2K50 A;  2K75 A;  2Y0S E;  1GO3 E;  3W1B A;  4GKJ L;  2RF4 A;  1HR0 L;  4B3R Q;  2ALY B;  4GLA C;  5ELN A;  4A3E H;  1IZ6 A;  3K7U C;  1VQ7 A;  1LYL A;  1HR0 Q;  1IL2 A;  5JEA J;  3UE1 A;  1WYD A;  4A93 H;  3HOX G;  4LFA L;  3NEN A;  2QEX A;  2Q2I A;  1HZB A;  2JQO A;  1OXT A;  2NVQ H;  3HOW H;  3M7N A;  1UE7 A;  1TWG H;  4LUZ A;  3CF5 A;  5C4X H;  1VQ4 A;  4JBK A;  4JV5 Q;  4GOP A;  4JBW A;  4BBR G;  4DR2 L;  4JI2 L;  2ZTE A;  4AIM A;  2WAQ G;  4UP9 A;  2PNH A;  2UXB Q;  2NVT H;  5C44 G;  1GVP A;  2GVB A;  1MIU A;  5JEA G;  2VQF L;  3OW2 A;  3S1M H;  4JI4 L;  3TS2 A;  4DV7 L;  4BY7 H;  1PYB A;  2UXB L;  4JI2 Q;  3FP9 A;  2XGT A;  5AJ3 L;  1XTD A;  2KHJ A;  3UDX A;  2K5V A;  1KXL A;  1FJG Q;  2VW9 A;  1YEZ A;  2VQF Q;  3CCQ A;  1EOV A;  1PFS A;  2N8N A;  2NZH A;  4MNO A;  4UP7 A;  4XTC S;  5GAD C;  5IY0 A;  4DV7 Q;  4JI4 Q;  4DV0 Q;  1PV4 A;  1M90 C;  4OWW B;  2VUM H;  5AJ3 Q;  4LUV A;  2D0P A;  3CCR A;  2N78 A;  3I4N H;  3T1H L;  4A3G G;  3DLL A;  2ZTD A;  3I2Z A;  3RR5 A;  4LUO A;  2IY5 B;  2F3I A;  3KF6 A;  5GAG C;  2UXD Q;  3A74 A;  3AQQ A;  3CME A;  3S24 A;  5IYC H;  4IPG A;  2IT1 A;  3CQZ H;  4IPH A;  4KI0 A;  2HHH L;  4OWX B;  3U4V A;  3W5O A;  1VQI A;  4KLK A;  1QUQ B;  4DUZ L;  4DR3 L;  1SFO H;  3PUZ A;  3IRB A;  5M3F H;  2HHH Q;  4Y7N H;  4A3B H;  1VQC A;  1N32 L;  1VQJ A;  3M4Q A;  1P8L A;  2PQA A;  4AYB E;  2OTJ A;  5K36 G;  4A93 G;  5LMN W;  4JI5 L;  1YIT A;  4DUZ Q;  4DR3 Q;  3HOW G;  4AH6 A;  1UE1 A;  5M5Y H;  5C4X G;  4DV2 L;  1ASZ A;  2KCT A;  1K8A C;  2WP8 J;  1N32 Q;  1B8A A;  1SMX A;  2D62 A;  2NN6 I;  2ZJR A;  2ZJP A;  3A0J A;  2IX1 A;  2NN6 G;  1VQP A;  2IX0 A;  2FXQ A;  2AHO B;  4NPS A;  4DV2 Q;  1EIF A;  1HNX L;  1V1Q A;  3GTM H;  2WB1 E;  4BY7 G;  3F8T A;  1XMQ L;  3PF5 A;  3J81 j;  1HR0 W;  1CKM A;  1A63 A;  4JI1 Q;  3J7A 5;  2F52 A;  3I56 A;  4KHP L;  1R9T H;  3T1Y L;  2UUA L;  1XPU A;  3KYH C;  1K0R A;  3MEF A;  4P72 A;  5ELO A;  1PH3 A;  2VUM G;  1PH1 A;  1GM5 A;  4DR6 Q;  1L1O C;  1KQS A;  2GVA A;  1IBM L;  2NVY H;  2HT1 A;  1N34 Q;  3I4N G;  4KHP Q;  3FHW A;  3T1Y Q;  2UUA Q;  1TWA H;  2CQO A;  2K52 A;  3KF8 B;  2OWO A;  1G6P A;  3S15 H;  5IYC G;  4A3K H;  1PH4 A;  4C3I H;  4LFB L;  2JA6 H;  2VQE L;  1PA6 A;  1GKH A;  2R7D A;  4DPG A;  3VDY A;  3AEV A;  3H3V I;  4DR7 L;  1YJN A;  1Q8K A;  2ZTC A;  3DM3 A;  4JC0 A;  4A76 A;  3W1G A;  4GOP C;  1VQN A;  4JOI A;  4DV4 L;  4BXX H;  1N9W A;  5M3F G;  5E7N A;  1I94 L;  4A3B G;  1NBW A;  1X55 A;  1KAW A;  5C3E G;  1OTC A;  1N33 L;  3KDF B;  1CKN B;  2D0O A;  5LMU Q;  2UU9 L;  1VQA A;  3PUW A;  4DV4 Q;  5JJI A;  1S40 A;  4B3T L;  1J5E Q;  1I94 Q;  1HJP A;  2YTX A;  3CP0 A;  3GD7 A;  2I5L X;  1VQF A;  1FL0 A;  3G48 A;  1CUK A;  1YI2 A;  2UU9 Q;  4IPD A;  1L1O B;  3KOJ A;  3J80 i;  4B3T Q;  3PF4 A;  2KHI A;  4DAY B;  1JB7 A;  1X6O A;  2Z6K A;  4L5Q A;  1QZG A;  4POF A;  3CXC A;  1Q82 C;  4PG3 A;  3CPW A;  3F2D A;  3OTO Q;  1VQM A;  5IWA Q;  3ULL A;  3ERS X;  4GNX A;  1CSP A;  1U5K A;  2ID0 A;  2KBN A;  1X3G A;  3ULP A;  2CCZ A;  1JJG A;  1E7Z A;  1RIP A;  3WWV A;  2OQ0 A;  4XIG S;  4LFC L;  2WAQ E;  1B70 B;  1OXU A;  2ATW A;  1WJJ A;  2E2I H;  2ZJQ A;  3CC4 A;  5J3B A;  2JK8 A;  4NB3 A;  2CWA A;  4NXN L;  5FLM H;  1L0W A;  1TWC H;  3MXN B;  3PUX A;  4LFC Q;  2MQH A;  1Q12 A;  3UE0 A;  4A3K G;  4GKJ Q;  2JA6 G;  1G51 A;  1QVF A;  5JJL A;  3M3Y H;  4O2D A;  4BA2 I;  1SR3 A;  4HJ7 A;  2E2H H;  3GTJ H;  4OXP A;  3B6Y A;  3E9H A;  5C0X J;  3CC2 A;  3F2C A;  3JC6 6;  4BXX G;  3GO5 A;  4A75 A;  4LF7 L;  2N3S A;  5H1S E;  3H0G H;  3S16 H;  4KHZ A;  1VQB A;  2RHS B;  3HKS A;  2IHE A;  4LFA Q;  1K9M C;  4JI0 L;  5C0X I;  4LF7 Q;  1X65 A;  4HIO A;  5C0X G;  4DR2 Q;  2F4V L;  4JI0 Q;  4JYA L;  4R4T A;  4YWK A;  1HNZ L;  4X62 L;  4NXM L;  3NEL A;  3ER0 A;  4A3F H;  4L5S A;  1HNW L;  4DR1 L;  1N36 L;  2JA8 H;  2F4V Q;  1HZC A;  1LUZ A;  1X3F A;  2YTY A;  3G4S A;  4DV5 L;  4AQY L;  3S1R H;  1PHJ A;  2UUC L;  3A5Z B;  3NEM A;  5IE8 A;  3CAM A;  1SN8 A;  1V43 A;  1HNZ Q;  1Z47 A;  2PQA B;  2JA9 A;  4X62 Q;  3CMA A;  2A8V A;  1HNW Q;  4LNQ A;  2MFI A;  4DR1 Q;  1N36 Q;  3J81 i;  4DV5 Q;  1NMF A;  4LF5 L;  1GD7 A;  3GTK H;  1UEB A;  4QJF A;  4IOA A;  2AWO A;  3T1H Q;  1Y14 B;  2YV5 A;  4IO9 A;  4A3M H;  3M85 A;  1K8G A;  5FLM G;  2MO1 A;  3UDF A;  3H3V H;  1MKH A;  3CCV A;  4X64 L;  1EFW A;  2VS1 A;  2UXC L;  4QL5 A;  2RHQ B;  5C3E H;  3L2P A;  1EQQ A;  2ES2 A;  4QGU A;  1G29 1;  4JBJ A;  4X64 Q;  2UXC Q;  1HZA A;  2UUB L;  1PYS B;  4JG2 A;  4HJA A;  3H0G G;  1NY4 A;  4DK6 C;  4IOC A;  2BH2 A;  1WI5 A;  1I6H H;  4JI5 Q;  4HIM A;  5IYB H;  2I0Q A;  3CD6 A;  2V1C C;  3TS0 A;  2UUB Q;  4TVA B;  4GN5 A;  4O0A A;  5HY6 A;  4H02 A;  3HOZ H;  1LM0 A;  1EWI A;  2JE6 I;  4BY1 H;  4K0K L;  3PO2 H;  4A3D H;  3BJU A;  1Q7Y C;  4C3H H;  1K83 H;  3UDG A;  3ICE A;  2N49 A;  3AYH B;  2ZM6 L;  4MTN A;  1FVI A;  3JAM i;  1PH7 A;  4A3F G;  1S72 A;  1NMG A;  1HNX Q;  3RLO A;  1YJW A;  1XMQ Q;  4K0K Q;  2JA8 G;  3K80 C;  3K8A A;  4GKK L;  2B29 A;  2A1A A;  4X66 L;  2ZM6 Q;  2NZO A;  4YWL A;  1VQD A;  2LXK A;  1XNQ L;  3GTO H;  2K5H A;  3E9I A;  3PIO A;  1P16 A;  3HFZ B;  4GKK Q;  2I5M X;  2JJQ A;  1C9O A;  1EIY B;  1QUQ A;  3PUV A;  1IBM Q;  4X66 Q;  3GTP H;  2Z0S A;  1Y1W H;  3I4M H;  1E22 A;  5IYD H;  4A3M G;  1Z9F A;  2YYZ A;  1PVO A;  1WOC A;  1XNQ Q;  2QA4 A;  3RZO H;  4HJ8 A;  2R7Z H;  1A8V A;  1KL9 A;  2ASB A;  2WFW A;  4PZ7 A;  4UP8 A;  2VQE Q;  4LFB Q;  3OYY A;  4ALP A;  4DR7 Q;  1KC8 C;  3PIP A;  1VQ9 A;  3J80 c;  4IPC A;  5IP9 H;  3U4Z A;  3E0E A;  2Q2U A;  2HIV A;  3ULJ A;  3I55 A;  4R4I A;  5M5W H;  4ME3 A;  2L15 A;  1BVS A;  4QY7 A;  1N33 Q;  1DGS A;  5IYB G;  5M3M H;  4JI3 L;  3J7Z C;  2GN5 A;  1YNX A;  3HOZ G;  2YTV A;  3STB C;  1UWV A;  3CCM A;  2OCE A;  4HJ9 A;  1JJC B;  4JI7 L;  3HOV H;  2EIF A;  3CPF A;  4BY1 G;  4C2M H;  2JA5 H;  3PO2 G;  4A3D G;  2KCM A;  3ZJY C;  1Q1B A;  1YJ9 A;  3K7A H;  4JI3 Q;  1I3Q H;  1PH2 A;  1XNR L;  1X9N A;  1VQL A;  4PMW A;  4A3I H;  4UPA A;  3FKI H;  4A3J H;  3PCO B;  4LWC A;  1TXY A;  3TEH B;  4GOP B;  1MJE A;  3PGZ A;  3RLF A;  1TWH H;  1K73 C;  1VQO A;  1XNR Q;  1VQG A;  1YIJ A;  4DKA C;  2MO0 A;  2E5L L;  5M5X H;  2VY3 A;  3EBE A;  3A5U A;  3HKZ G;  1U0L A;  1X3E A;  3EN2 A;  1RL2 A;  4LF6 L;  4X65 L;  1AE2 A;  1HH2 P;  1Y1W G;  3I4M G;  2E5L Q;  5IYD G;  4NXN Q;  3GTQ H;  3S2D H;  3D0F A;  1E1O A;  4YCW A;  2R7F A;  2K4K A;  1CSQ A;  2BH8 A;  3Q8D A;  2R7Z G;  1CKN A;  1B7Y B;  3AFQ A;  5GRO A;  4LF6 Q;  1HZ9 A;  2K14 A;  2XTI A;  4X65 Q;  4B3R L;  2R6G A;  3PO3 H;  4GLV B;  3CCU A;  1QVC A;  5BR8 L;  1OXV A;  1YHB A;  2C35 B;  4B3M L;  4P75 A;  5IP9 G;  3TRE A;  2JEA I;  4R4O A;  1IXR A;  1L1O A;  3BZK A;  3KF6 B;  3L7Z C;  2E2J H;  1CKO A;  3KLW A;  4DV6 L;  4JCV E;  1VCI A;  5BR8 Q;  1NE3 A;  1PH8 A;  4B3M Q;  4JV5 L;  4A4I A;  1C7Y A;  2CKZ B;  2PI2 E;  5M3M G;  4R1J A;  4BBS H;  4DK3 C;  2R92 H;  3J81 c;  1TWF H;  2RCN A;  3HOV G;  4DV6 Q;  2JA5 G;  2DUD A;  2Q2H A;  4C3J H;  4JYA Q;  4DNI A;  4PZ8 A;  4NXM Q;  3I4O A;  1EUJ A;  4OWT B;  2YU9 H;  2DGY A;  3CCL A;  4A3I G;  2PI2 A;  3FKI G;  4A3J G;  4AQY Q;  3LGJ A;  4YY3 L;  1FJG L;  4J15 A;  2Y0S G;  2UUC Q;  3M4P A;  4R4C A;  1OXX K;  1NTG A;  1JE5 A;  1IBK L;  4DV0 L;  4JI6 L;  3PV0 A;  4EQ5 A;  4LF8 L;  3U58 A;  4JOI C;  4L5R C;  4P73 A;  2A19 A;  1Q81 C;  1JMC A;  2QGQ A;  3STB D;  4YY3 Q;  3G6E A;  4LF5 Q;  1SE8 A;  2AMC B;  4QIW E;  4RMF A;  5C4J H;  3RZD H;  1W2B A;  2VNU D;  1O7I A;  4GN3 B;  1IBK Q;  1WCM H;  5GAE C;  4JI6 Q;  4WJ4 A;  4LF8 Q;  1L2F A;  4A3L H;  2UXD L;  3L0O A;  4A3C H;  4OON A;  1PH5 A;  1SRO A;  2JA7 G;  1JT8 A;  3SGI A;  1VQH A;  1PH9 A;  4PZ6 A;  1AH9 A;  4X6A H;  1BBU A;  2K5N A;  1VQK A;  2HIX A;  3BZC A;  2R93 H;  3BU2 A;  5IT9 c;  1OXS C;  3HOU H;  5IP7 H;  3PO3 G;  3M4O H;  4B3S L;  3GDE A;  3JAM c;  1MJC A;  3S2H H;  2Z6K C;  4OO1 I;  3CC7 A;  1V9P A;  3KJO A;  3HOY H;  1Y1V H;  1K3R A;  4OO1 G;  4IFD J;  1BBW A;  1W3S A;  3M9B A;  4A3E G;  1EYG A;  5DLQ E;  4JI8 L;  1Q1E A;  4GNX C;  4B3S Q;  3S1N H;  5FJ8 H;  3PSI A;  4BBS G;  3RN5 A;  3S1Q H;  1YZ6 A;  3TQY A;  3CCE A;  2R92 G;  2B63 H;  4POG A;  4P74 A;  4JI8 Q;  1X54 A;  4LF9 L;  4IFD I;  1VQ5 A;  3AFP A;  3F1Z A;  1D8L A;  4DAM A;  4HIK A;  4IFD G;  4YWM A;  1I5F A;  1KRS A;  1SLJ A;  1YBY A;  3RN2 A;  1UE6 A;  4OX9 L;  5EAY A;  1QVG A;  4LF9 Q;  4JI1 L;  3RNU A;  1M1K C;  4IJL A;  1X56 A;  3G71 A;  2LXJ A;  5GQO A;  1PH6 A;  4OX9 Q;  1D7Q A;  2CFM A;  4GN4 B;  1E3P A;  5HGQ A;  1VQ6 A;  4DR6 L;  2OTL A;  3F2B A;  1KRT A;  2NVX H;  2KEN A;  1WFQ A;  2WB1 G;  4TQU S;  1N34 L;  2I5H A;  1VQE A;  2CWP A;  3S17 H;  1WCM G;  3K81 C;  3UDI A;  4AYB G;  4RG1 A;  1ASY A;  2VZA A;  4UY8 C;  1XMO L;  1IBL L;  4A3L G;  5JJK A;  4A3C G;  3KFU A;  4GNX B;  1C0A A;  4R4Q A;  1YHQ A;  1LTL A;  4Y52 H;  3S14 H;  4JBM A;  3D31 A;  2LSS A;  2HQL A;  2AKW B;  1Q86 C;  1KHI A;  2R93 G;  2IHF A;  1XMO Q;  1IBL Q;  3HOU G;  5IP7 G;  1A62 A;  1SRU A;  3HKZ E;  3KJP A;  2BA1 A;  3K0X A;  2AWN A;  3U50 C;  1S3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...