4LFAL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaL00
4A3MH 1Y1WG 1GD7A 3HOYH 3UDFA 1HZAA 3L7ZC 2JK8A 3J81i 3CCSA 4JI8Q 4QL5A 5IE8A 1B8AA 4GKKQ 3HOWH 4GN4B 1GKHA 2VQEQ 5C4JH 2CFMA 4LFAQ 1ASYA 3KF6B 1ASZA 4BY1G 3A5ZB 2CCZA 3RR5A 4HJ5A 3FHWA 1C7YA 2B63H 2UUBQ 4B3RL 3AYHB 4X65Q 3CPWA 1Q86C 1PVOA 4GLXA 4A76A 4A3EH 4LUOA 2IY5B 3MEFA 4OO1G 2IHEA 5C0XG 1KRSA 2EXDA 1YJWA 1S72A 1KIXA 3CCRA 1AE2A 4Y52H 1VQLA 4O0AA 3CPFA 1L1OA 2K5NA 3AFPA 3NENA 3UE0A 3CP0A 1BKBA 4P73A 4DAYB 2MO0A 2N8NA 3DLLA 3KYHC 1I5FA 4A3DG 2UXDL 4P74A 3OYYA 2V1CC 3UDIA 2E2JH 4A3BG 4JI6L 1X55A 1J6QA 1VQ5A 1O7IA 2JA8H 1K73C 1HR0W 2UXDQ 3GD7A 3PUXA 2MO1A 1IBKL 4GNXB 3PO3G 2HIVA 2NVQH 4OWWB 3CMEA 4JI6Q 1R9TH 1CSQA 2OTLA 1HNZL 1SRUA 4KHPL 1GVPA 4DR6L 1AH9A 3UDGA 2MNAA 1Y14B 1SROA 1IBKQ 2OQ0A 1NE3A 4DV4L 1XNRL 4IFDG 5IP9G 3BU2A 1P16A 2A19A 1E24A 2I5LX 1HNZQ 1LTLA 1XTDA 4DR7L 4KHPQ 4C3IH 4DR6Q 1UE7A 2RF4A 4BBRH 4P72A 1QUQB 4OWXB 1XNRQ 2GVAA 3KF6A 4DV4Q 2JQOA 4JI0L 3FKIG 3BZKA 4AQYL 2K4KA 4AH6A 3PF5A 2ZTEA 4DKAC 3NBHB 5LMNQ 3NELA 1E7ZA 4JG2A 3J7A5 3GTGH 2R93G 1EFWA 2B29A 5JJKA 1VQHA 4JI0Q 4AQYQ 4BA1I 5C3EH 2XTIA 1PH5A 1NTGA 3PO2H 2K14A 2PQAB 3LGJA 1SFOH 3M4OH 3K7UC 3M85A 2GVBA 1VQ7A 4LF6L 3PF4A 2UXBQ 5JJLA 1A8VA 2R7ZG 1K8AC 1CKOA 3UDXA 1WI5A 2K52A 4UP7A 4OX9Q 2AWNA 2VY3A 1OXSC 3TQYA 4DV3L 1PV4A 3HKZG 4JV5L 1SN8A 4IPDA 4LF6Q 2EQSA 1PFSA 4A3MG 3EIVA 3CCUA 2ES2A 4GNXA 4C2MH 3HOZH 1YBYA 1YEZA 3HFZB 3HOWG 2C35B 3VDYA 1P8LA 3J81j 4DV3Q 4LFBL 4JV5Q 4DV1L 4LNQA 3EBEA 2B63G 4UP8A 2NVYH 4X66L 2UUAL 1C9OA 2ZJRA 2UUCL 4JBMA 1KQSA 5M5XH 4A3EG 3MXNB 2VZAA 4B3SL 4LFBQ 4DV1Q 1FJGL 5IP7H 1B7YB 3CCVA 4X66Q 2BH2A 1L2FA 5GAHC 3E9IA 2QA4A 2UUAQ 2UUCQ 1HR0L 5M5YH 2VNUD 3GTJH 4A4IA 3U50C 2Q2HA 2A8VA 2YTYA 3RZOH 5GAGC 1BBUA 1TXYA 1Q81C 4DV0L 1FJGQ 1G6PA 3GTMH 1PYSB 2CQOA 1J5EL 1EYGA 4UP9A 4NPSA 4IO9A 2JA8G 5FLMH 1E1TA 3CAMA 5M3FH 5M3MG 4JI2L 3J80c 4YCUA 1L0WA 4DV0Q 1K83H 4GOPB 4A3LH 2JA5H 2PQAA 2QEXA 1LM0A 3CD6A 1J5EQ 3I4NH 1V1QA 2CWAA 4JI3L 1W2BA 4POGA 4QIWE 2JJQA 4O2DA 3HKZE 4JI2Q 4L5TA 4OWTB 4R4QA 4A75A 5LMNW 1S3OA 4JI3Q 1HZ9A 3S14H 2Q2IA 3W1BA 4DK3C 1GM5A 1PH1A 1N34L 4YY3Q 4BBRG 1EQRA 1Q1BA 1KHIA 1VQBA 1TWCH 4YWLA 4A3JH 2R7DA 1M1KC 4DUYL 1EQQA 2H5XA 1XMOL 2I5HA 2VQEL 1N34Q 4LF9L 3M3YH 1CKMA 2K5VA 4B3ML 4GKJL 2R6GA 4H02A 2LXJA 1UE1A 3U4ZA 2UUBL 2R92H 4X65L 4DUYQ 1JMCA 1OXXK 2CKZB 3G48A 5C3EG 1XMOQ 1M90C 3ICEA 4LF9Q 4NXML 3PO2G 1JT8A 1X54A 4B3MQ 4GKJQ 3F1ZA 3KDFA 1Y1VH 3GO5A 3PGZA 3K80C 1MJEA 4DR1L 4JI4Q 1U0LA 4PZ6A 4BBSH 1VQEA 5H1SE 4DV6L 4A3IH 3E9HA 4AIMA 4NXMQ 5IYBH 1X9NA 2QGQA 3ER0A 4BY7H 1K0RA 4X6AH 4KI0A 4DR1Q 3PUZA 4HIMA 1VQKA 1YJNA 2N78A 2IX0A 2IX1A 1A63A 2KCMA 4DV6Q 2HHHL 1C0AA 4NXNL 3FP9A 3K81C 1SMXA 1WOCA 2AKWB 1PYBA 3JC66 1K8GA 4MZ9A 4YHHL 4IJHA 2HHHQ 1SR3A 2JA9A 4IPCA 1YHAA 5M3MH 1MJCA 3CCEA 4DV2L 4A3KH 4TQUS 4TVAB 4NXNQ 2VUMH 3CMAA 1YZ6A 2IHFA 5IP7G 1WFQA 5DLQE 4WJ3M 3H0GH 4QJFA 1TWGH 3TS0A 4YHHQ 1UWVA 4A93G 4KHZA 2Q2UA 5IT9c 4DV2Q 1IBML 2NVTH 4LUZA 2E5LQ 1V9PA 4RMFA 2WAQG 3CCQA 3CC7A 1N9WA 4C3HH 3I56A 4JBKA 3BJUA 4YCWA 5LMNL 5FLMG 1NMGA 1IBMQ 2NN6I 5M3FG 4A3LG 1E22A 2JA5G 4ALPA 2BA0A 2A1AA 3S1MH 4WJ4A 3I4NG 1X6OA 3OW2A 5EAYA 2PNHA 4R4OA 3J7ZC 1PHJA 2N49A 3WWVA 4R1JA 2UXBL 1L1OC 4QQBX 3Q8DA 2XGTA 1OTCA 1OXTA 1YIJA 5HY6A 2KHIA 4JBWA 2WFWA 4OX9L 1CSPA 3I2ZA 1AE3A 3D31A 3K0XA 1YITA 1NBWA 1KD1C 3RLOA 1H95A 4LF7L 4A3JG 1U5KA 1IZ6A 1QZGA 2HIXA 2YTXA 4OONA 4Y7NH 3F2CA 1PH6A 1RL2A 4PG3A 3AEVA 2UXCL 3PCOB 4HJ7A 1VQGA 4JCVE 3DM3A 3PSIA 4LF7Q 2R92G 5AJ3L 4XTCS 3I4OA 2YYZA 1MIUA 2PMZE 2VW9A 2YU9H 4IOAA 4JOIA 4K0KL 2KBNA 2RHSB 2VS1A 4C3JH 2HT1A 1N36L 1PH3A 2UXCQ 2WP8J 4MNOA 2WAQE 3W1GA 1WJJA 1JJ2A 3I4MH 1Y1VG 5AJ3Q 1T9HA 4A3GH 1QVCA 3H15A 4K0KQ 4BBSG 2ZJPA 1Q8KA 4A3IG 4MTNA 1N36Q 5IYBG 2Y0SG 3BZCA 4GS3A 4BY7G 1QUQA 2RCNA 1EIYB 4P71A 2ZJQA 4UPAA 1Q7YC 3K8AA 1XPRA 4GN5A 2AHOB 3ULJA 2F3IA 1YI2A 5JJIA 4EQ5A 5GADC 3F2BA 2OTJA 1NMFA 3T1YL 3AQQA 2D0OA 2PI2E 1SLJA 4KLKA 5ELNA 5GQOA 1D7QA 3TREA 3HOZG 4L5QA 4A3KG 2VL6A 4LWCA 2VUMG 4BXXH 1I94L 5IY0A 1XJVA 1E3PA 1B70B 1Q46A 1G291 1X56A 3HKSA 4JC0A 1XMQL 1PH2A 3H0GG 4GLAC 5ELOA 3T1YQ 4POFA 2Q2TA 4YY3L 2JA6H 4GNXC 3GTPH 1TWFH 3RLNA 4FDBA 1I94Q 2ID0A 4JOIC 1XMQQ 4DR4Q 4HIDA 3CCMA 3KFUA 5C4XH 5C44H 1IXRA 3U58A 3HOUH 3RZDH 3S2HH 3TEHB 2RHQB 4YWMA 4YWKA 5M5WH 3CXCA 3TRZA 1NY4A 1Z47A 5IYCH 3RN2A 1SE8A 2UU9L 1JJCB 1UE5A 4IOCA 3ULPA 2F4VL 3S2DH 2CWPA 4JI1Q 2Y0SE 1WCMH 4R4IA 2ATWA 4JI4L 1VQAA 4HIOA 2GN5A 4DAMA 2UU9Q 3RNUA 4DV5L 2F4VQ 1N32L 1HH2P 2FXQA 3L0OA 3NEMA 2PI2A 1YHBA 3JAMc 2KENA 3CF5A 1PH7A 1A62A 3PIPA 4JYAL 5IYDH 1XPOA 1A0IA 4DV5Q 2BH8A 3M7NA 1JB7A 1EWIA 1X65A 4XIGS 4LF5Q 1I6HH 3SGIA 4DR3Q 2E2IH 3HOVH 1N32Q 3PIOA 3ERSX 3ZJYC 1EUJA 3PUVA 1V43A 1IL2A 3H3VI 1OXUA 4GOPA 4JYAQ 3PUWA 4EX5A 2AWOA 2OQKA 1LYLA 3JAMi 3KJPA 4A3FH 2JA7H 2R7FA 1JJGA 1IYJB 2LXKA 4IJLA 4YCVA 5FJ8H 3T1HL 1VQOA 1RIPA 4L5RC 3I4MG 2YTVA 3AFQA 1G51A 5E7NA 1KAWA 1KRTA 4A3GG 1VQ9A 2Z0SA 4DV7L 1VQ4A 1I3QH 2L15A 3B6YA 2YV5A 1VQ6A 3T1HQ 2E5LL 4A93H 4HJ8A 1BVSA 3I7FA 1YHQA 4LF4L 3GTOH 4DV7Q 1TWHH 2WB1E 1VQ8A 4B3RQ 4R4CA 1Q1EA 4LUVA 4P75A 3G4SA 3CW2C 4JI5L 2K5HA 4LF8L 2JE6I 1VQNA 4IPHA 4B3TL 1BBWA 1KL9A 1W3SA 1HJPA 4AYBG 3H3VH 1LUZA 4LF4Q 4QY7A 1CUKA 1WYDA 4DUZL 1I50H 4LF8Q 1HZCA 3KJOA 4JI5Q 1FL0A 3D0FA 1QZHA 4B3TQ 3M9BA 3K7AH 4BXXG 1HNWL 4LFCL 1FGUA 3CCJA 2N3SA 1VQPA 2KHJA 4DUZQ 5GROA 1PH9A 1DGSA 4GOPC 4L5SA 2JA6G 4HJ9A 5HGQA 1K3RA 2NZHA 5IWAL 3G71A 1HNWQ 2AMCB 4LFCQ 5C0XJ 1E1OA 2Z6KA 4PMWA 3S24A 1FVIA 3KOJA 5LMUL 5C44G 4A3CH 5C4XG 3HOUG 3E0EA 1OXVA 1VCIA 3S1RH 4OO1I 5IYCG 5IWAQ 5C0XI 3HOXH 1VQJA 2DGYA 3STBC 5LMUQ 2K50A 3PV0A 2E8GA 1VQMA 3A0JA 3UE1A 2VQFL 1WCMG 1X3GA 1YVCA 4OXPA 1VQDA 3I55A 1QVFA 2JEAI 3S15H 4DR7Q 1PH4A 3KF8B 5FLXc 4X64L 3KLWA 2F52A 1Y1WH 2ZM6L 1HZBA 1CKNB 4J15A 5JEAG 2VQFQ 1YNXA 3S16H 3CCLA 3S1NH 2BA1A 4AYBE 2D0PA 4BY1H 5IYDG 4X64Q 1PA6A 2OWOA 1TWAH 3OTOL 2ZM6Q 4IFDJ 4RG1A 3U4VA 1UE6A 2HQLA 1UEBA 1YJ9A 2JEBI 3HOVG 1VQCA 3GTLH 3ULLA 4UY8C 4IFDI 1N8RC 4A3FG 4BA2I 2JA7G 3OTOQ 1Z9FA 4X62L 4DK6C 3GTQH 3STBD 3HOYG 3S17H 2Z6KC 5BR8L 5FJ8G 4LW1A 4DR2L 4A3DH 2B3GA 1MKHA 4PZ7A 2KCTA 3CC4A 2NZOA 2IT1A 3PUYA 5JEAJ 4X62Q 4GLVB 3W5OA 4A3BH 1XPUA 2I0QA 5BR8Q 2MFIA 4DR4L 4DR2Q 3A5UA 1PH8A 1X3EA 4APVA 3PO3H 1KC8C 2ZTDA 3GDEA 3M4QA 2ALYB 3M4PA 2E2HH 1X3FA 4ME3A 1EIFA 3TS2A 2OCEA 3KDFB 1S40A 4B3SQ 3CC2A 1VS0A 3RN5A 5IP9H 5J3BA 4JI1L 1VQIA 1HR0Q 3IRBA 1CKNA 1JE5A 5K36G 3CQZH 1D8LA 4JBJA 3L2PA 1IBLL 4QGUA 2I5MX 2WB1G 4DR5L 1NJIC 3FKIH 1GO3E 1K9MC 1L1OB 3G6EA 1HNXL 1N33L 4JI7L 2R93H 1IBLQ 3EN2A 1Q82C 2ASBA 4A3CG 1XNQL 4GN3B 1VQFA 4DNIA 2DUDA 2LSSA 4DR5Q 4LF5L 1QVGA 3F8TA 4HIKA 4R4TA 4DR3L 1HNXQ 3GTKH 4PZ8A 3J80i 1EOVA 1N33Q 4IPGA 4JI7Q 3J81c 3HOXG 2D62A 2NVXH 3S1QH 4DPGA 1XNQQ 2K75A 2ZTCA 5GAEC 2MQHA 2R7ZH 3RLFA 3F2DA 4JI8L 4GKKL 2NN6G 2EIFA 1KXLA 1Q12A 4LFAL 3A74A 4NB3A 4HJAA
chains in the Genus database with same CATH superfamily
1GD7A 3UDFA 5I4DA 3Q6SA 4BY1G 2B63H 3FHWA 2PZTA 1XWEA 1R9TB 2EXZA 4H44C 4A76A 3E5SA 1YJWA 2EYHA 1FR3A 2JXMB 2KVMA 1AE2A 3TZDA 3C46A 4QB4A 4UDUC 2OEOA 3SR1A 1EQVA 4DAYB 3CP0A 2MO0A 2N8NA 2UXDL 3W3AA 1JOKA 4P74A 2HUGA 2QF7A 1ET6A 3C2PA 1SEBD 3NBIA 1HR0W 2UXDQ 3GD7A 5DM63 3CMEA 3R8BA 3A8IE 1R9TH 1WTHA 2OTLA 3PO2B 4RGTA 4KMUC 1SFOB 3M4OB 1Y14B 2LS01 4IFDG 2JP1A 3BU2A 2OF1A 2LFNA 2I5LX 2IL8A 3A8JE 1LTID 4K8IA 1X32A 4P72A 5ELCA 2GVAA 1X3QA 2K4KA 1PFMA 1IW7C 1D6EC 3K5LA 3PO2H 2B2YA 2K14A 1BUVT 2QKIC 2PQAB 1SFOH 3M4OH 3K7UC 5C3XA 3M85A 1SE3A 3PF4A 5NUCA 3GV6A 1HQMC 3UDXA 4QCLA 1F9SA 4UP7A 2AWNA 2LY7A 3I8ZA 1NNXA 2F0HA 4JV5L 3GTMB 4A3MG 3OMCA 3EIVA 1YEZA 3J81j 4JV5Q 2X6LA 2D9UA 4ZUJA 5KIXA 1TIID 2R93B 4B3SL 3MTSA 1B7YB 3CCVA 5GAHC 2F0UA 2QA4A 4F88A 3GTMH 1O7ZA 4A3JB 1PYSB 2B2YC 1LTTD 2K01A 1HQRD 2JA8G 1Q3LA 5M3MG 1I4PA 4IUPA 4Q0FA 4KY5A 1LM0A 3DM1A 1CQVA 4UAIA 2IPKD 3FDTA 3HKZE 4N9PA 1H9SA 1Y1VB 3LNNA 5A35A 1LT6D 1S3OA 4BBSB 4DK3C 1N34L 2Y0SB 1Q1BA 4BY7B 2NB0A 4A3JH 3SE0A 4CDEC 3ZYYX 2H5XA 2IX3A 2I5HA 1N34Q 2F0JA 2M2LA 4B3ML 3MXNA 2LXJA 2UUBL 2F0VA 1JMCA 3QOJA 4B3MQ 4A3KB 3F1ZA 1Y1VH 4EQNA 1EWCA 1STNA 3H0GB 4JI4Q 4BBSH 5FK9C 1QB5D 5IYBH 2O5JC 4BY7H 4CHTB 3KBGA 2KA7A 4KI0A 5C6AA 4HIMA 1YJNA 5KGUA 4QMGA 3FP9A 4R8NA 1YNNC 2PW7A 3OHXC 1SMXA 1EYAA 2PCFB 2AKWB 4HEDA 1K8GA 3MHBA 3CHBD 2JA9A 4IPCA 4DV2L 1AN8A 3GTGB 4A3KH 4TQUS 4TVAB 3CMAA 5IP7G 4KK7A 5DLQE 2BDNA 3H0GH 4QJFA 1UWVA 4KHZA 4XYOA 4DV2Q 1IBML 3P1HA 2I46A 3I4LA 2DJFC 1CK1A 1STEA 2B2TA 1IBMQ 1PRTB 1S5ED 4HR7B 1CA5A 2PPBC 1S5CD 2CW0C 5FO9B 4ALPA 3I4NG 1AEXA 2F0SA 2XVSA 2KJXA 4C3JB 2XSCA 3D3RA 3WWVA 1GUGA 2AQ2B 3DXJC 1L1OC 4QQBX 2UXBL 4A3GB 4JPBW 5HY6A 5M5XB 5T1GA 1RKNA 1WTPA 4JBWA 1TT2A 4K2LA 3WOFA 1ESRA 3K0XA 1DONA 1KD1C 1KLUD 2PMZB 1HA5A 4KKTA 1VQGA 3DM3A 1JWSD 5G3LD 2F0DA 2YYZA 3A56A 2EOTA 5FO8B 2RHSB 4C3JH 3E0JA 2DNCA 2WP8J 4BWGB 4A3GH 1KTKA 1QVCA 2B2TC 2F0MA 2HDLA 1DOMA 3H15A 1F9QA 4A3IG 1U4RA 3JAML 3CU7A 1NAPA 2RCNA 5C4XB 2A5HA 3RZDB 1Q7YC 2F0IA 4OHJA 1YI2A 1PTOC 5J22A 5GADC 1NMFA 1BCPC 5ELNA 1SLJA 3TREA 1CZGA 1K3BC 5IY0A 4A93G 1XMQL 3HKSA 2A6EC 1PDQA 1GUSA 4YY3L 5EGTA 5A2QE 1U4LA 1XMQQ 1PZID 3KFUA 5C4XH 2F0OA 1IXRA 1SXTA 3RZDH 3TEHB 4RAUC 2F0TA 3ND8A 3NE5B 1VF7A 2UU9L 4JI1Q 4R4IA 1VMCA 4HIOA 2UU9Q 3QB3A 3AMUA 3Q22A 3VA5A 5JEAH 1HH2P 2FXQA 1IKLA 4JYAL 4FF1A 3OSOA 3EA6A 1A0IA 1XPOA 1RJTA 1V1PA 1JB7A 1JOOA 4RGOS 1EUJA 1V43A 1GHKA 4JYAQ 2NBFA 3JAMi 1Y8OB 2R7FA 2FJ2A 1IYJB 4YCVA 5FJ8H 3T53B 1RIPA 2ICIA 3I4MG 3AFQA 5E7NA 1KAWA 1NSNS 1A3UA 1U9RA 1VQ9A 5D3DA 2KECA 3B6YA 4HAEA 3PIP3 5D14A 5I6YA 2SOBA 1Q90A 4LF8L 3CW2C 4JI5L 2K33A 4YIJA 1W3SA 4O42A 4C1NI 2XNAC 1RODA 1EQTA 1ML0D 4LF8Q 4JI5Q 5K36H 3K6OA 3EQLC 4B9WA 1VQPA 1STYA 2KHJA 2AQ1B 4IUUA 4L5SA 1MD2D 1SNMA 5HGQA 3S16B 3DEOA 1E1OA 5LMUL 1ILPA 1TWAB 5C44G 3HOUG 1QG7A 1VCIA 1ET9A 3GTLB 5C0XI 3TSSA 4RFBA 1U4PA 2DGYA 5D3IB 2MHVA 5LMUQ 2K50A 2E8GA 4TKOB 4L6TB 1BDOA 4KJOA 1WCMG 1YVCA 4OXPA 3SVMA 3I55A 2JEAI 1QVFA 4A3DB 2XIWA 2AUJD 3MXUA 1HZBA 2LKVA 3MWYW 3S16H 5D65A 3T16A 4FNFA 2BA1A 4AYBE 3T56B 3PO3B 1PA6A 1TWAH 3OTOL 3U4VA 3GTPB 4HMIA 2JEBI 1VQCA 3GTLH 2RBMA 1V8QA 3J81L 2K28A 3NUCA 1N8RC 4BA2I 3OTOQ 4A3DH 4DR2L 2B3GA 1W6KA 1MKHA 2KCTA 2NZOA 1B3QA 3PUYA 2I0QA 1NR4A 1KDBA 4DR4L 4DR2Q 2F0EA 3FEWX 3PO3H 1KC8C 1EIHA 2ZTDA 3GTKB 4XT1B 3M4QA 1H9RA 4LMQD 1X3FA 3S1QB 4X3UA 1VS0A 1JWMD 1RF2D 4PV1C 2RCFA 4FXGC 4CDDC 3IRBA 1CKNA 1CM9A 2N88A 4JBJA 1IBLL 2I5MX 1K9MC 1L1OB 3G6EA 4KY7A 3HOWB 5C4JB 4HMJA 1IBLQ 1Q82C 2ASBA 4A3CG 1XNQL 1VQFA 1WD1A 3GTKH 3F8TA 3I3CA 4HIKA 3GV3A 4A3EB 4IPGA 3HOXG 3S1QH 1A3TA 5IIFA 2XWJB 1XNQQ 2EYJA 3F2DA 2WIIB 3L9AX 1KXLA 1Q12A 4NB3A 4HJAA 1Y1WG 3J81i 2JK8A 4NMZA 1RTOA 3HOWH 4GN4B 1GKHA 5JAVA 2CFMA 5C4JH 3IKJA 1SMYC 4B3RL 4FVMA 2RKSA 3AYHB 5C4ZA 3CPWA 1Q86C 2A74C 4A3EH 2IY5B 4LUOA 2RA4A 1F9PA 2QDLA 4DAVA 4WJWA 5C0XG 1KRSA 1S72A 3CCRA 5LL6S 4HSPA 1PTOB 3AFPA 3UE0A 1BCPB 4P73A 4C3IB 1BNZA 3KYHC 4A3BG 3DWPA 3QJYA 1XXGA 1SNOA 2MO1A 2KHSA 3KLRA 2F0WA 2HIVA 1IBKL 4JW0A 1CSQA 2OXPA 5DNFA 3VR4A 5JJZA 4K14A 1SYBA 1IBKQ 4DV4L 3QOLA 5IP9G 2A19A 3D4DA 1PTOH 1LTLA 3PQIA 4DR7L 4C3IH 1UE7A 2RF4A 4DNRB 5CC4A 4DV4Q 3KF6A 3X3NA 2JQOA 3FKIG 4AQYL 1YNND 4AH6A 5KRUA 3NBHB 5LMNQ 4GZYC 3NELA 4FF2A 3J7A5 2BE5C 2R93G 4KV6A 4AQYQ 4BA1I 5K5PA 2J0TD 5LHY1 2JYOA 2R7ZG 5M5YB 4OGQC 2VY3A 5DEHA 1PV4A 2CHBD 4IPDA 4KTAA 2FMCA 2B39A 2EQSA 1PFSA 2ES2A 4GNXA 4FXDA 1ICFB 3VYTA 2WKDA 1EFID 3VDYA 3H3VC 5M3FB 4ZLTF 3EBEA 2J7ZA 4X66L 1C9OA 2UUCL 2EYOA 2O2LD 4RWSC 3EFXD 3QWNA 4X66Q 2BH2A 2Z8LA 5CV7A 3SK6A 2UUCQ 1HR0L 1TU2B 5M5YH 3VR5A 3GQBA 3S14B 2Q2HA 2YTYA 4PMBA 2HCIA 4K5VA 4DV0L 3P7JA 3KF8A 4F7XA 1V1PB 2PQEA 4UP9A 4NPSA 1EL0A 1AFPA 5FLMH 3M3YB 4EGVA 1E1TA 5M3FH 4JI2L 3J80c 1L0WA 1EWHA 4DV0Q 4A3LH 2FFKB 2CWAA 3VYRA 4QIWE 2JJQA 3BYTB 4JI2Q 4L5TA 4R4QA 2RDFA 4WFN3 5LMNW 2EE1A 1KDAA 2K03A 3S14H 1CHQD 1PH1A 4BBRG 3SK8A 3D6CA 1A3VA 1KNAA 3NWSA 3M3YH 2K5VA 1PTOD 4GKJL 3RMHA 3U4ZA 1QCBD 3V2TA 2QDBA 3TN2A 2L4NA 5C3EG 1M90C 1TKWB 4GKJQ 4IUNA 2VUMB 3R93A 3GO5A 4PZ6A 2KOLA 4DV6L 1STAA 5JOBA 1X9NA 2RVLA 1K0RA 4H13C 2R61A 5CV4A 2KCMA 4DV6Q 4NXNL 4G57A 3H6MA 3K81C 4UHVA 1HFGA 3D6WA 4MZ9A 1SR3A 1YHAA 1MJCA 4NXNQ 4IALA 2VUMH 1YZ6A 2IHFA 3NTKA 1HFNA 3H91A 2E5LQ 4RMFA 1LTGD 3CCQA 3I72A 3CC7A 1EEFD 4Y7NB 2C9OA 3NXWA 1Y8NB 2X6GA 2JA5G 2BA0A 4WJ4A 3NPPA 2YU9B 1DOLA 5EAYA 2N49A 1IYUA 3H09A 1B4OA 1WTRA 3ITPA 3Q8DA 1OTCA 2HCCA 2KHIA 1HRJA 2PNRC 4I7ZC 2BOSA 3I2ZA 4U68A 4QUFA 3D31A 1YITA 1BR9A 1ZXTA 3RLOA 4LF7L 5CV5A 2LMCB 4V190 2HIXA 4Y7NH 5G3LF 4PG3A 3A55A 3D4WA 3PCOB 5EKIA 2A69C 4HJ7A 4G7OC 4I7AA 2WAQB 2L0CA 4LF7Q 3A7LA 2R92G 4AYBB 4M8AA 4MIUA 3KLSA 1BXTA 2YU9H 2Q8RE 1SE2A 1PH3A 4MNOA 4DK0A 3NQIA 1ILQA 3MEHA 2ZJPA 1Q8KA 2Z1CA 5ELFA 1QUQA 4DA2A 2K5QA 1EIYB 4V0BA 2ZJQA 5M5WB 2Q8IB 4G7ZC 2AHOB 4K6DA 3ULJA 3Q0AA 1BO0A 4EQ5A 2QCPX 3F2BA 1KLGD 3DHQA 2PI2E 1DYQA 1D7QA 3HOZG 4ZRZA 5C3WA 1I94L 5JJIA 1XJVA 1E3PA 1Q46A 1X56A 1LLRD 1LO5D 4F8MA 1STGA 1CA6A 3RLNA 1I94Q 4TSSA 4C3HG 3U58A 1K8MA 1ENFA 5IT9L 1M8AA 5KYIA 4YWMA 5M5WH 3CXCA 2E2IB 1AW7A 1NY4A 3RN2A 4K6LA 4HSVA 1JE4A 2JA7B 2CWPA 3P75A 2ICEC 3DWAA 4JI4L 3RNUA 1IL8A 3BDLA 1SYEA 4JK1C 2M9VA 1YHBA 2PI2A 1O80A 5IYDH 1JWUD 1TWHB 4RA8A 2ZXPA 2E2IH 2EJMA 3QO2A 1JCKB 3PUVA 1IL2A 1YNJC 2AWOA 2OQKA 2JA7H 1I50B 1G8ZD 5I9PA 1EU3A 3DUZA 2YTVA 1DOKA 1H9MA 5FLXL 2WB1B 3MC0B 1MSHA 1VQ6A 2YV5A 3MXGA 1L0YB 2F4IA 4XT3B 1BVSA 3I7FA 2EPBA 1EY9A 2MJ8A 3GTOH 2AQ3B 1TWHH 1VQ8A 2F0FA 4N8FA 3T13A 4P75A 2CVRA 3QG1A 2Z9HA 1UEAB 1KL9A 4JVZA 1HJPA 2Q8TA 3H3VH 3I90A 1CUKA 1WYDA 4DUZL 3ERQA 1I50H 4FF4A 1HZCA 3KJOA 1QZHA 1LT3D 4BXXG 3M9BA 1FGUA 2WINB 1CZWA 4DUZQ 2JA6G 1SMYD 3DWQA 4RH6A 4BY1B 5KNBA 3TMEA 2Z6KA 3OOCA 3VR2A 5E1FA 4OO1I 2RSOA 5IYCG 4U673 3STBC 2K6AA 2F0QA 1GXDC 5ELEA 3A0JA 2VQFL 1X3GA 3HEJA 4ZKCB 4B08A 2F0LA 2NN6H 3KF8B 2RDGA 4K2KA 2XRQD 3KLWA 3Q23A 1R4QB 2VQFQ 1YNXA 2EYMA 4DXFA 1E2ZA 1LT5D 4BY1H 1SNCA 1UE6A 3HOVG 2B2WA 2L11A 2ZXRA 3FPPA 4ABNA 2A6HC 2EY1A 4A3FG 4X62L 3CKIB 2F0NA 2Z6KC 3CQZB 1S4ZA 3LWEA 4LW1A 3K0YA 2KUMA 2E76C 2G5DA 4PNYA 4X62Q 4GLVB 1STHA 2BE5D 5I6WA 3X3MA 2MFIA 2HQEA 1XX8A 2SNMA 3GDEA 3M4PA 2OCEA 2Z4IA 3CC2A 1E0BA 4IFDH 3E6ZX 4FF3A 5J3BA 5CBAE 4JI1L 1B9NA 1DD2A 2E74C 3U9OA 4CKCA 3CQZH 4QIWB 2PZUA 3L2PA 4G7HC 4QGUA 1K0SA 4A3MB 2B2WC 2A68D 1A6XA 4DR5L 1GO3E 2ENBA 3M7GA 2K32A 1N33L 4ODGA 1UNSA 4JI7L 1JORA 1T5EA 4RCNA 4GN3B 4DNIA 2KEEA 4DR5Q 2LSSA 1S5FD 1QVGA 3E3XA 3J80i 1N33Q 1EOVA 4JI7Q 3AU7A 2D62A 2MP1A 4QF4A 4ZCKA 1B2TA 1EZ8A 2ZTCA 2RSNA 3SK5A 3R2TA 1D5XC 2EIFA 3FMCA 4ID6A 4A3MH 5ISRA 2K05A 1HZAA 3L7ZC 4QL5A 2JA8B 1PRTD 5I2XA 2VQEQ 3A8KE 2CH4A 1PVOA 4X65Q 3UI2A 3IAYA 4GLXA 1GUWA 1TQOA 3DMUA 3MEFA 4OO1G 2IHEA 3RD4A 1I4XA 4C56C 3MFYA 2DY8A 2F0KA 4Y52H 3CPFA 2K5NA 3K58A 3NENA 4XXEA 3HP3A 3DLLA 2L5TA 3OYYA 3UDIA 2L12A 1J6QA 3OWFA 1O7IA 2JA8H 4I65A 1K73C 2SNSA 4K5WA 3PUXA 1QNUA 2B8GA 2WV6D 1SRUA 4KHPL 1GVPA 1PYWD 1ZEQX 4L63B 1AH9A 3UDGA 1BOSA 3J7AV 2MNAA 1SROA 1XNRL 2OQ0A 1I4RA 4KN7C 4TRDA 3VR6A 1E24A 1F2ZA 2F3VA 1XTDA 4KHPQ 2G9HD 1QUQB 1XNRQ 3HRZC 4JI0L 4C2MB 1HUNA 2ZTEA 4DKAC 1B50A 3ND9A 2EYPA 2B29A 2NVYB 5JJKA 1VQHA 4JI0Q 2MUYA 2XTIA 1QE6A 1STBA 3LGJA 4KJNA 5JJLA 1VQ7A 4LF6L 3MVVA 1F77A 3C3LA 4IURA 1CKOA 1WI5A 1WTOA 3RZOB 1H9KA 4OX9Q 1H9SB 1OXSC 4FYDA 5JPNC 4DV3L 1SN8A 4LF6Q 3L3OC 4OIKA 3CCUA 4C2MH 1B9MA 1YBYA 2C35B 1P8LA 1FD7D 4DV3Q 1KNEA 4DV1L 4LNQA 2B63G 1IW7D 1AZQA 2NVYH 4JBMA 1D5ZC 1KQSA 5COYA 3MXNB 2VZAA 3NP8A 4DV1Q 1FJGL 5IP7H 3QR8A 1L2FA 2VNUD 2KQ3A 3RZOH 2A8VA 4KKSA 4FO2A 1Q81C 1ENAA 1FJGQ 1C4QA 1G6PA 2CQOA 3BZDB 4IO9A 3SEBA 2B2UA 3HKZB 3CAMA 4YCUA 2VB2X 4S3SA 5TSSA 2PQAA 3CD6A 3CRKC 3I4NH 1V1QA 4Z9CB 4JI3L 1NR2A 4N8X1 1W2BA 4POGA 1FNWA 1G2SA 4OWTB 4A75A 4JI3Q 2RDHA 1GJXA 4A3IB 1GM5A 1HPCA 3K5MA 1EQRA 1VQBA 1VDZA 1C48A 1M1KC 4IUTA 1PTOF 2DJGC 4DUYL 1EQQA 1BCPF 4PQXA 3BG3A 1XMOL 4LF9L 1JB3A 1CKMA 4IN3A 4H02A 2VB3X 3CRLC 4DUYQ 1T5XD 1OXXK 3G48A 1XMOQ 3SK4A 4LF9Q 4FXKC 4NXML 3PO2G 1JT8A 3OPOA 1FNUA 3PGZA 3K80C 3WDNA 1GUOA 4DR1L 1U0LA 1TWGB 1VQEA 5H1SE 4A3IH 4AIMA 4NXMQ 3K5NA 2NVTB 4H0LC 1DCZA 5IGDA 1F2YA 4X6AH 1VF5C 4DR1Q 3PUZA 3K59A 1VQKA 2IX0A 2IX1A 1A63A 1HHVA 3MZ5A 5EKLA 3SXHA 1HTLD 1MGSA 4RGMA 5KNDA 4KN4C 3S1MB 1WOCA 1M4VA 1CT1D 2E75C 3JC66 1E2WA 1FGBD 5EPKA 1WTXA 4R8IA 5EKKA 1TWGH 5IT9c 5T1IA 2NVTH 1KAAA 4LUZA 2WAQG 3KLSX 4JBKA 3BJUA 5LMNL 1NMGA 2K7VA 2NN6I 1F9RA 4ME5A 2R3ZA 5A2QL 1E22A 2A1AA 3S1MH 4CJ1B 4RGNA 3OW2A 2PNHA 5IT9E 1PHJA 3T51B 2KCNA 3I4MB 3TP7A 2WFWA 4IUQA 3LWUA 1AE3A 1NBWA 4A3JG 1IKMA 1IZ6A 2YTXA 2UXCL 3AEVA 5EPLA 4JCVE 5IGEA 1EY8A 1MSGA 2M00A 1SNDA 1EY5A 3I4OA 4K0KL 1MIUA 2PMZE 2VW9A 1Y69U 4IOAA 2CW0D 2UXCQ 2HT1A 1IYVA 4RHRA 3W1GA 2NZ1D 1WJJA 5JPMC 3I4MH 1Y1VG 3F2UA 3EROA 1T9HA 2L9HA 4K0KQ 4BBSG 4MTNA 5IYBG 2Y0SG 2KCCA 4OELB 4BY7G 5DM73 2L55A 5C44B 4UPAA 3HOUB 3S2HB 3K8AA 3OIPA 4EVOA 4HTHA 1SAPA 4LAAA 1KDCA 2K5DA 4KKUA 2OTJA 3T1YL 3AQQA 3S2DB 2QILA 4KLKA 5GQOA 1I6VC 1WCMB 4L5QA 4A3KG 1KABA 3N52A 3IL8A 1PFNA 1G291 4JC0A 1WTVA 3H0GG 4ZQ3A 5ELOA 1B44D 3T1YQ 2Q2TA 5CV9A 4GNXC 1EY7A 3CCMA 5C44H 3HOUH 1F2LA 4CKEA 2A6HD 2IW3A 3G6JB 3S2HH 4YWKA 3TRZA 3TDQA 1SE8A 3G7LA 1L0XB 4IQZA 1JJCB 3MFGA 4IOCA 3ULPA 1D2BA 3S2DH 4H7BA 5FOBB 1WCMH 1BCPD 3NWTA 5IODA 4DAMA 1SDFA 1QOHA 4DV5L 1N32L 2A6ED 3JAMc 4Q5VA 1EY4A 1A62A 4X3TA 2J4XA 2BH8A 4DV5Q 1PFBA 1EWIA 1X65A 4LF5Q 3M7NA 1N32Q 3SGIA 4DR3Q 1JR0D 3ERSX 3ZJYC 1OXUA 5ELDA 4GOPA 4EX5A 1LYLA 3KJPA 1NUCA 2V4DA 4C3JG 2LXKA 1CI3M 1GUTA 3JAME 1MI2A 5J1ZA 1VQOA 4L5RC 3K7AB 2SEBD 1G51A 4A3GG 2BDOA 4XQJA 4DV7L 1Q8IA 2E5LL 4DN4M 3HZXA 1YHQA 1DJRD 1QJOA 4LF4L 4DV7Q 3N6RA 4R4CA 1Q1EA 4XYQA 4LUVA 3G4SA 1MBYA 2K5HA 1D5MC 1VQNA 2K5WA 4IPHA 4DAPA 4B3TL 3HOXB 4CJ2C 1F2MA 1LUZA 1TY0A 4LF4Q 1SJHD 1ZYRC 2AUKA 1EOTA 1K8OA 5DAUA 3S15B 4B3TQ 3K7AH 2IWHA 3CCJA 2N3SA 1TS4A 1Y1WB 1G6ZA 4GOPC 1SYDA 2Z6BA 1K3RA 2NZHA 3S1NB 2O4XA 3MAQA 4PMWA 5EQ0A 4A3CH 5C4XG 1SNPA 1O7YA 3E0EA 1OXVA 3NTHA 2FMMA 1TVXA 3HOXH 3SDZA 1VQJA 2NTTA 4LK1C 4J6HA 1VQMA 1RHPA 3GTQB 3S17B 1TS3A 3S15H 1HA6A 3A54A 4F87A 3HG9A 4DK1A 1PH4A 4X64L 1Y1WH 4A3BB 4HN7A 5E4WC 1CKNB 4J15A 5JEAG 4WRDA 3CCLA 3S1NH 2D0PA 1SYGA 4X64Q 4IFDJ 2OWOA 3T4AC 2HQLA 2O5IC 5IGGA 4UY8C 1PLFA 3BDCA 1R4PB 5C0XH 1Z9FA 3GTQH 1LTRD 5C4HA 3S17H 3J7YW 5FJ8G 2B2VA 3CC4A 3KK7A 4A3BH 4RKLA 3FKIB 5JEAJ 2EY2A 4DGZA 2F0GA 2PW5A 3DEPA 3A5UA 3OIQA 4DU9A 2CQAA 1B53A 4RCOA 1EIFA 2NVXB 1S40A 4B3SQ 1CHPD 3P20A 3RN5A 3U9SA 5IP9H 2R7ZB 2C5CA 4N9TA 4OIJA 1I4GA 4KD4A 1JE5A 4ZYSA 5K36G 2P5ZX 1D8LA 1UAPA 5ELBA 2NVQB 1LTSD 3M4YA 3HOYB 1NJIC 3FKIH 2F0PA 4QUCA 1ONLA 2R93H 3EN2A 2DUDA 3LX0A 4R4TA 2B2VC 3EJIA 1VMPA 3BDOA 3J81c 4CKBA 2NVXH 5F2DA 3GTOB 4DPGA 2F1MA 2K75A 3KUPA 2R7ZH 3RLFA 4JI8L 5CMDA 4NKLA 4OL7A 4GKKL 3HGBA 4LFAL 3A74A 2NVQH 4NDXA 1UUPA 1PRTF 2E2JB 3HOYH 3CCSA 1B3AA 4G4KA 4JI8Q 5IE8A 1B8AA 4GKKQ 1RCVD 3J81E 1SSOA 2XWBB 5BN5A 1ASYA 1ASZA 3BVGA 4LFAQ 2EYLA 2FHTA 3KF6B 3A5ZB 1G2TA 4ZK9B 3RR5A 4HJ5A 2CCZA 3FVQA 1C7YA 2UUBQ 4M1UB 1SE4A 4L8JA 5HURA 5C5MA 3R3OA 3URYA 1EY0A 2FINB 3OMGA 2EXDA 1TS2A 2EDGA 1KIXA 1VQLA 4O0AA 3VR3A 2TSSA 1L1OA 1X3PA 1BKBA 4BBRB 4A3DG 1I5FA 2OT2A 2EJGC 2V1CC 4RKBA 2E2JH 4JI6L 1X55A 1VQ5A 3VA7A 2H4OA 2DN8A 1D1IA 3NSWA 4GNXB 3PO3G 4OWWB 4JI6Q 5C3EB 1HXYD 4J8QA 1HNZL 4DR6L 1NE3A 3FPUB 1S5BD 2A73B 1P16A 1II3A 1HNZQ 5M9OA 4DR6Q 4BBRH 4OWXB 3OWEB 1SYCA 1DM0B 3BZKA 3MA2B 5KYLA 3PF5A 1E7ZA 4JG2A 3GTGH 3J80L 1EFWA 1E2VA 5E3FA 3C1FA 4IZ8A 5C3EH 4DF7A 1NTGA 1PH5A 4NP5A 1DXMA 4XQQA 2GVBA 2UXBQ 1A8VA 1QNKA 1K8AC 3GTJB 2K52A 1A15A 2N55A 3TQYA 3HKZG 2PYKA 3HFZB 2RQXA 3FRPB 2F03A 3HOWG 1CQFA 2QW7A 1BBXC 4LFBL 1K83B 2JA5B 4UP8A 2UUAL 2ZJRA 5M5XH 4A3EG 5FO7B 4LFBQ 2UUAQ 2WKCA 3E9IA 1TS5A 3MXPA 4IUVA 4XQNA 3GTJH 4A4IA 3U50C 5BN3A 5CGKA 2HDMA 3AB9A 1BBUA 1TXYA 2GA4B 5GAGC 3NBHA 1TWCB 1PXUA 2I07B 3EVQA 4E6IA 1J5EL 2DY7A 1EYGA 3I70A 1Y8PB 1K83H 4GOPB 1EYDA 2JA5H 2R92B 2QEXA 1RDPD 1J5EQ 4K5XA 2NTSA 4O2DA 4KD3A 4X3SA 5CR3A 5BN4A 1EYCA 2ZT9C 1HZ9A 2Q2IA 3W1BA 4C3IG 4YY3Q 1KHIA 4ZKBB 1TWCH 4YWLA 2R7DA 3NK9A 5IOCA 1SYFA 1BF4A 2VQEL 2JN4A 1LTBD 2K1BA 1A2TA 5I9OA 2R6GA 1UE1A 2R92H 3C1EA 4X65L 2CKZB 2EY5A 1SJED 5KEEA 3ICEA 2F3WA 5M3MB 3HOZB 1X54A 1RD9D 3IFTA 3KDFA 4ILWA 1FYCA 1MJEA 4HCSA 3E9HA 5EBDA 1HUMA 2QGQA 3ER0A 3TP8A 4PMCA 5FKAC 1IHZA 4DNTB 4CDCC 2ZXOA 4EQPA 4C3HB 5CYUA 2N78A 4DXGA 1HCZA 2HHHL 1C0AA 1EIGA 1A2UA 1J9OA 1I4HA 1PYBA 5AFWA 2B8FA 3NHHA 4IJHA 4YHHL 2HHHQ 5M3MH 3CCEA 3HOZH 1EY6A 2K04A 1WFQA 1SBBB 3K5OA 4WJ3M 1S5DD 2EJFC 3TS0A 4YHHQ 2Q2UA 3PIO3 2Z4HA 4KY6A 3ONAB 1ZKOA 2WACA 1V9PA 4P2CB 5EPJA 3WOEA 1N9WA 4C3HH 2EVBA 3I56A 1WVLA 1QILA 4YCWA 1XTCD 5FLMG 1BQQT 5M3FG 5L37A 4A3LG 1FNVA 4B9XA 4ULLA 1X6OA 5IGCA 1ENCA 1GHJA 4R4OA 3S9WA 3J7ZC 5J39A 3PMFA 4R1JA 3K57A 1O7LA 2XGTA 3HS0C 1OXTA 1YIJA 1O78A 4WORA 3V96A 4ZAIA 1WD0A 4OX9L 1CSPA 5CV8A 4DAYA 1Z6HA 1H95A 1U5KA 1PMRA 1B1ZA 1SNQA 1QZGA 2EY6A 4OONA 3F2CA 1PH6A 2HD3A 1RL2A 2VXWA 1RTNA 1ZYRD 3PSIA 1DZ1A 5AJ3L 4XTCS 3QIAA 1EEID 1LABA 2NUCA 4JOIA 1U4MA 2KBNA 2VS1A 1LACA 1N36L 1WTWA 2EYFA 2WAQE 1JJ2A 3I4NB 4HCEA 5AJ3Q 1AZPA 1JOQA 1JC7A 2H1EA 1N36Q 2JA6B 3W2DA 1TY2A 3BZCA 4GS3A 1TWFB 4K8JA 1I4QA 2KEDA 4P71A 5IGBA 1XPRA 4GN5A 2F3IA 2D5DA 2A69D 2PO4A 4LJZC 2D0OA 3Q24A 5JVH3 2VL6A 4LWCA 2VUMG 4BXXH 1B70B 1PH2A 4DFAA 4GLAC 1EU4A 4POFA 1JQYD 4MN3A 2JA6H 3GTPH 5CBEE 1EZ6A 1TWFH 4FDBA 5EBCA 2ID0A 4JOIC 4BS9A 4HIDA 4DR4Q 1W6JA 5KNCA 1I6HB 2RHQB 3NTIA 3HOVB 1Z47A 5IYCH 3R2IA 4A3FB 1XYIA 1J8IA 1UE5A 4MHEA 2F4VL 3D8GA 2MGSA 2Y0SE 2ATWA 4R9WA 1VQAA 2GN5A 5CV6A 2F4VQ 1I3QB 4CGYB 3L0OA 2IJ0A 3NEMA 4ZUIA 3CF5A 1PH7A 2MPMA 2KENA 4A93B 4MTKA 2B2UC 3PIPA 3A7AB 4FP5D 3SHLA 4XIGS 1I6HH 3HOVH 4O1NA 3PIOA 2L1BA 3H3VI 3PUWA 4A3FH 1JJGA 3IFDA 1C8CA 4IJLA 3TP6A 3T1HL 1KRTA 1LTAD 2Z0SA 1VQ4A 1I3QH 2L15A 3I73A 5HGTA 3T1HQ 3BVMA 4A93H 4HJ8A 3GP7A 3H94A 2G9DA 4EQOA 2WB1E 4B3RQ 2EZVA 3S1RB 3BS1A 2JE6I 1QWYA 1BBWA 4KHVA 4AYBG 4RHSA 4QY7A 4XDXA 1YNJD 4J1MA 1FL0A 3D0FA 1K28A 1HNWL 1ESFA 2XN9C 1ICWA 4LFCL 1H9JA 2D2CC 5JVG3 1HTPA 5GROA 1PH9A 3OW7A 1DGSA 1G91A 2XRSD 4HJ9A 5IWAL 3G71A 1HNWQ 1JICA 2AMCB 4LFCQ 5C0XJ 1AP0A 1TR5A 3S24A 1FVIA 3KOJA 1CTMA 1Z7TA 3S1RH 4OEMB 3BYYB 5IWAQ 3J7AF 3PV0A 5CORA 3UE1A 1PZKD 5C5LA 1VQDA 2SDFA 4DR7Q 2QEJC 5FLXc 3TP5A 2F52A 1GUNA 2ZM6L 5EJWA 5IYDG 5I2YA 1LT4D 2ZM6Q 3D4RA 3VYSA 4RG1A 1UEBA 1YJ9A 2E2HB 3ULLA 4CDFC 4OO1H 4IFDI 5FLXE 1D1KA 2NWGA 2JA7G 3KBXA 4DK6C 1V1OA 3STBD 3HOYG 5BR8L 2A68C 4CBVA 1CFMA 4PZ7A 2IT1A 2X69A 5E4XA 3W5OA 1XPUA 4NW2A 3TZUA 5BR8Q 5LL6X 2E2DC 1OO9B 1PH8A 1X3EA 4APVA 2PZWA 3RUZA 3O13A 1NCVA 2ALYB 2E2HH 4ME3A 3TS2A 3KDFB 3TBIB 2DNEA 3NQTA 5IGFA 1VQIA 1HR0Q 1LV9A 2BCOA 2WB1G 1PRTC 1HNXL 2CH4W 1WTQA 2TMPA 3V05A 3BVZA 2B63B 4LF5L 1GOZA 4X3KA 4DR3L 1HNXQ 3I91A 4PZ8A 4C1NK 2NYZD 3VYUA 3J80E 5GAEC 2MQHA 4CJ0B 1MHWC 2JSOA 2NN6G 1PZJD
chains in the Genus database with same CATH topology
4A3MH 1Y1WG 1GD7A 3HOYH 3UDFA 1HZAA 3L7ZC 2JK8A 3J81i 3CCSA 4JI8Q 4QL5A 5IE8A 1B8AA 4GKKQ 3HOWH 4GN4B 1GKHA 2VQEQ 5C4JH 2CFMA 4LFAQ 1ASYA 3KF6B 1ASZA 4BY1G 3A5ZB 2CCZA 3RR5A 4HJ5A 3FHWA 1C7YA 2B63H 2UUBQ 4B3RL 3AYHB 4X65Q 3CPWA 1Q86C 1PVOA 4GLXA 4A76A 4A3EH 4LUOA 2IY5B 3MEFA 4OO1G 2IHEA 5C0XG 1KRSA 2EXDA 1YJWA 1S72A 1KIXA 3CCRA 1AE2A 4Y52H 1VQLA 4O0AA 3CPFA 1L1OA 2K5NA 3AFPA 3NENA 3UE0A 3CP0A 1BKBA 4P73A 4DAYB 2MO0A 2N8NA 3DLLA 3KYHC 1I5FA 4A3DG 2UXDL 4P74A 3OYYA 2V1CC 3UDIA 2E2JH 4A3BG 4JI6L 1X55A 1J6QA 1VQ5A 1O7IA 2JA8H 1K73C 1HR0W 2UXDQ 3GD7A 3PUXA 2MO1A 1IBKL 4GNXB 3PO3G 2HIVA 2NVQH 4OWWB 3CMEA 4JI6Q 1R9TH 1CSQA 2OTLA 1HNZL 1SRUA 4KHPL 1GVPA 4DR6L 1AH9A 3UDGA 2MNAA 1Y14B 1SROA 1IBKQ 2OQ0A 1NE3A 4DV4L 1XNRL 4IFDG 5IP9G 3BU2A 1P16A 2A19A 1E24A 2I5LX 1HNZQ 1LTLA 1XTDA 4DR7L 4KHPQ 4C3IH 4DR6Q 1UE7A 2RF4A 4BBRH 4P72A 1QUQB 4OWXB 1XNRQ 2GVAA 3KF6A 4DV4Q 2JQOA 4JI0L 3FKIG 3BZKA 4AQYL 2K4KA 4AH6A 3PF5A 2ZTEA 4DKAC 3NBHB 5LMNQ 3NELA 1E7ZA 4JG2A 3J7A5 3GTGH 2R93G 1EFWA 2B29A 5JJKA 1VQHA 4JI0Q 4AQYQ 4BA1I 5C3EH 2XTIA 1PH5A 1NTGA 3PO2H 2K14A 2PQAB 3LGJA 1SFOH 3M4OH 3K7UC 3M85A 2GVBA 1VQ7A 4LF6L 3PF4A 2UXBQ 5JJLA 1A8VA 2R7ZG 1K8AC 1CKOA 3UDXA 1WI5A 2K52A 4UP7A 4OX9Q 2AWNA 2VY3A 1OXSC 3TQYA 4DV3L 1PV4A 3HKZG 4JV5L 1SN8A 4IPDA 4LF6Q 2EQSA 1PFSA 4A3MG 3EIVA 3CCUA 2ES2A 4GNXA 4C2MH 3HOZH 1YBYA 1YEZA 3HFZB 3HOWG 2C35B 3VDYA 1P8LA 3J81j 4DV3Q 4LFBL 4JV5Q 4DV1L 4LNQA 3EBEA 2B63G 4UP8A 2NVYH 4X66L 2UUAL 1C9OA 2ZJRA 2UUCL 4JBMA 1KQSA 5M5XH 4A3EG 3MXNB 2VZAA 4B3SL 4LFBQ 4DV1Q 1FJGL 5IP7H 1B7YB 3CCVA 4X66Q 2BH2A 1L2FA 5GAHC 3E9IA 2QA4A 2UUAQ 2UUCQ 1HR0L 5M5YH 2VNUD 3GTJH 4A4IA 3U50C 2Q2HA 2A8VA 2YTYA 3RZOH 5GAGC 1BBUA 1TXYA 1Q81C 4DV0L 1FJGQ 1G6PA 3GTMH 1PYSB 2CQOA 1J5EL 1EYGA 4UP9A 4NPSA 4IO9A 2JA8G 5FLMH 1E1TA 3CAMA 5M3FH 5M3MG 4JI2L 3J80c 4YCUA 1L0WA 4DV0Q 1K83H 4GOPB 4A3LH 2JA5H 2PQAA 2QEXA 1LM0A 3CD6A 1J5EQ 3I4NH 1V1QA 2CWAA 4JI3L 1W2BA 4POGA 4QIWE 2JJQA 4O2DA 3HKZE 4JI2Q 4L5TA 4OWTB 4R4QA 4A75A 5LMNW 1S3OA 4JI3Q 1HZ9A 3S14H 2Q2IA 3W1BA 4DK3C 1GM5A 1PH1A 1N34L 4YY3Q 4BBRG 1EQRA 1Q1BA 1KHIA 1VQBA 1TWCH 4YWLA 4A3JH 2R7DA 1M1KC 4DUYL 1EQQA 2H5XA 1XMOL 2I5HA 2VQEL 1N34Q 4LF9L 3M3YH 1CKMA 2K5VA 4B3ML 4GKJL 2R6GA 4H02A 2LXJA 1UE1A 3U4ZA 2UUBL 2R92H 4X65L 4DUYQ 1JMCA 1OXXK 2CKZB 3G48A 5C3EG 1XMOQ 1M90C 3ICEA 4LF9Q 4NXML 3PO2G 1JT8A 1X54A 4B3MQ 4GKJQ 3F1ZA 3KDFA 1Y1VH 3GO5A 3PGZA 3K80C 1MJEA 4DR1L 4JI4Q 1U0LA 4PZ6A 4BBSH 1VQEA 5H1SE 4DV6L 4A3IH 3E9HA 4AIMA 4NXMQ 5IYBH 1X9NA 2QGQA 3ER0A 4BY7H 1K0RA 4X6AH 4KI0A 4DR1Q 3PUZA 4HIMA 1VQKA 1YJNA 2N78A 2IX0A 2IX1A 1A63A 2KCMA 4DV6Q 2HHHL 1C0AA 4NXNL 3FP9A 3K81C 1SMXA 1WOCA 2AKWB 1PYBA 3JC66 1K8GA 4MZ9A 4YHHL 4IJHA 2HHHQ 1SR3A 2JA9A 4IPCA 1YHAA 5M3MH 1MJCA 3CCEA 4DV2L 4A3KH 4TQUS 4TVAB 4NXNQ 2VUMH 3CMAA 1YZ6A 2IHFA 5IP7G 1WFQA 5DLQE 4WJ3M 3H0GH 4QJFA 1TWGH 3TS0A 4YHHQ 1UWVA 4A93G 4KHZA 2Q2UA 5IT9c 4DV2Q 1IBML 2NVTH 4LUZA 2E5LQ 1V9PA 4RMFA 2WAQG 3CCQA 3CC7A 1N9WA 4C3HH 3I56A 4JBKA 3BJUA 4YCWA 5LMNL 5FLMG 1NMGA 1IBMQ 2NN6I 5M3FG 4A3LG 1E22A 2JA5G 4ALPA 2BA0A 2A1AA 3S1MH 4WJ4A 3I4NG 1X6OA 3OW2A 5EAYA 2PNHA 4R4OA 3J7ZC 1PHJA 2N49A 3WWVA 4R1JA 2UXBL 1L1OC 4QQBX 3Q8DA 2XGTA 1OTCA 1OXTA 1YIJA 5HY6A 2KHIA 4JBWA 2WFWA 4OX9L 1CSPA 3I2ZA 1AE3A 3D31A 3K0XA 1YITA 1NBWA 1KD1C 3RLOA 1H95A 4LF7L 4A3JG 1U5KA 1IZ6A 1QZGA 2HIXA 2YTXA 4OONA 4Y7NH 3F2CA 1PH6A 1RL2A 4PG3A 3AEVA 2UXCL 3PCOB 4HJ7A 1VQGA 4JCVE 3DM3A 3PSIA 4LF7Q 2R92G 5AJ3L 4XTCS 3I4OA 2YYZA 1MIUA 2PMZE 2VW9A 2YU9H 4IOAA 4JOIA 4K0KL 2KBNA 2RHSB 2VS1A 4C3JH 2HT1A 1N36L 1PH3A 2UXCQ 2WP8J 4MNOA 2WAQE 3W1GA 1WJJA 1JJ2A 3I4MH 1Y1VG 5AJ3Q 1T9HA 4A3GH 1QVCA 3H15A 4K0KQ 4BBSG 2ZJPA 1Q8KA 4A3IG 4MTNA 1N36Q 5IYBG 2Y0SG 3BZCA 4GS3A 4BY7G 1QUQA 2RCNA 1EIYB 4P71A 2ZJQA 4UPAA 1Q7YC 3K8AA 1XPRA 4GN5A 2AHOB 3ULJA 2F3IA 1YI2A 5JJIA 4EQ5A 5GADC 3F2BA 2OTJA 1NMFA 3T1YL 3AQQA 2D0OA 2PI2E 1SLJA 4KLKA 5ELNA 5GQOA 1D7QA 3TREA 3HOZG 4L5QA 4A3KG 2VL6A 4LWCA 2VUMG 4BXXH 1I94L 5IY0A 1XJVA 1E3PA 1B70B 1Q46A 1G291 1X56A 3HKSA 4JC0A 1XMQL 1PH2A 3H0GG 4GLAC 5ELOA 3T1YQ 4POFA 2Q2TA 4YY3L 2JA6H 4GNXC 3GTPH 1TWFH 3RLNA 4FDBA 1I94Q 2ID0A 4JOIC 1XMQQ 4DR4Q 4HIDA 3CCMA 3KFUA 5C4XH 5C44H 1IXRA 3U58A 3HOUH 3RZDH 3S2HH 3TEHB 2RHQB 4YWMA 4YWKA 5M5WH 3CXCA 3TRZA 1NY4A 1Z47A 5IYCH 3RN2A 1SE8A 2UU9L 1JJCB 1UE5A 4IOCA 3ULPA 2F4VL 3S2DH 2CWPA 4JI1Q 2Y0SE 1WCMH 4R4IA 2ATWA 4JI4L 1VQAA 4HIOA 2GN5A 4DAMA 2UU9Q 3RNUA 4DV5L 2F4VQ 1N32L 1HH2P 2FXQA 3L0OA 3NEMA 2PI2A 1YHBA 3JAMc 2KENA 3CF5A 1PH7A 1A62A 3PIPA 4JYAL 5IYDH 1XPOA 1A0IA 4DV5Q 2BH8A 3M7NA 1JB7A 1EWIA 1X65A 4XIGS 4LF5Q 1I6HH 3SGIA 4DR3Q 2E2IH 3HOVH 1N32Q 3PIOA 3ERSX 3ZJYC 1EUJA 3PUVA 1V43A 1IL2A 3H3VI 1OXUA 4GOPA 4JYAQ 3PUWA 4EX5A 2AWOA 2OQKA 1LYLA 3JAMi 3KJPA 4A3FH 2JA7H 2R7FA 1JJGA 1IYJB 2LXKA 4IJLA 4YCVA 5FJ8H 3T1HL 1VQOA 1RIPA 4L5RC 3I4MG 2YTVA 3AFQA 1G51A 5E7NA 1KAWA 1KRTA 4A3GG 1VQ9A 2Z0SA 4DV7L 1VQ4A 1I3QH 2L15A 3B6YA 2YV5A 1VQ6A 3T1HQ 2E5LL 4A93H 4HJ8A 1BVSA 3I7FA 1YHQA 4LF4L 3GTOH 4DV7Q 1TWHH 2WB1E 1VQ8A 4B3RQ 4R4CA 1Q1EA 4LUVA 4P75A 3G4SA 3CW2C 4JI5L 2K5HA 4LF8L 2JE6I 1VQNA 4IPHA 4B3TL 1BBWA 1KL9A 1W3SA 1HJPA 4AYBG 3H3VH 1LUZA 4LF4Q 4QY7A 1CUKA 1WYDA 4DUZL 1I50H 4LF8Q 1HZCA 3KJOA 4JI5Q 1FL0A 3D0FA 1QZHA 4B3TQ 3M9BA 3K7AH 4BXXG 1HNWL 4LFCL 1FGUA 3CCJA 2N3SA 1VQPA 2KHJA 4DUZQ 5GROA 1PH9A 1DGSA 4GOPC 4L5SA 2JA6G 4HJ9A 5HGQA 1K3RA 2NZHA 5IWAL 3G71A 1HNWQ 2AMCB 4LFCQ 5C0XJ 1E1OA 2Z6KA 4PMWA 3S24A 1FVIA 3KOJA 5LMUL 5C44G 4A3CH 5C4XG 3HOUG 3E0EA 1OXVA 1VCIA 3S1RH 4OO1I 5IYCG 5IWAQ 5C0XI 3HOXH 1VQJA 2DGYA 3STBC 5LMUQ 2K50A 3PV0A 2E8GA 1VQMA 3A0JA 3UE1A 2VQFL 1WCMG 1X3GA 1YVCA 4OXPA 1VQDA 3I55A 1QVFA 2JEAI 3S15H 4DR7Q 1PH4A 3KF8B 5FLXc 4X64L 3KLWA 2F52A 1Y1WH 2ZM6L 1HZBA 1CKNB 4J15A 5JEAG 2VQFQ 1YNXA 3S16H 3CCLA 3S1NH 2BA1A 4AYBE 2D0PA 4BY1H 5IYDG 4X64Q 1PA6A 2OWOA 1TWAH 3OTOL 2ZM6Q 4IFDJ 4RG1A 3U4VA 1UE6A 2HQLA 1UEBA 1YJ9A 2JEBI 3HOVG 1VQCA 3GTLH 3ULLA 4UY8C 4IFDI 1N8RC 4A3FG 4BA2I 2JA7G 3OTOQ 1Z9FA 4X62L 4DK6C 3GTQH 3STBD 3HOYG 3S17H 2Z6KC 5BR8L 5FJ8G 4LW1A 4DR2L 4A3DH 2B3GA 1MKHA 4PZ7A 2KCTA 3CC4A 2NZOA 2IT1A 3PUYA 5JEAJ 4X62Q 4GLVB 3W5OA 4A3BH 1XPUA 2I0QA 5BR8Q 2MFIA 4DR4L 4DR2Q 3A5UA 1PH8A 1X3EA 4APVA 3PO3H 1KC8C 2ZTDA 3GDEA 3M4QA 2ALYB 3M4PA 2E2HH 1X3FA 4ME3A 1EIFA 3TS2A 2OCEA 3KDFB 1S40A 4B3SQ 3CC2A 1VS0A 3RN5A 5IP9H 5J3BA 4JI1L 1VQIA 1HR0Q 3IRBA 1CKNA 1JE5A 5K36G 3CQZH 1D8LA 4JBJA 3L2PA 1IBLL 4QGUA 2I5MX 2WB1G 4DR5L 1NJIC 3FKIH 1GO3E 1K9MC 1L1OB 3G6EA 1HNXL 1N33L 4JI7L 2R93H 1IBLQ 3EN2A 1Q82C 2ASBA 4A3CG 1XNQL 4GN3B 1VQFA 4DNIA 2DUDA 2LSSA 4DR5Q 4LF5L 1QVGA 3F8TA 4HIKA 4R4TA 4DR3L 1HNXQ 3GTKH 4PZ8A 3J80i 1EOVA 1N33Q 4IPGA 4JI7Q 3J81c 3HOXG 2D62A 2NVXH 3S1QH 4DPGA 1XNQQ 2K75A 2ZTCA 5GAEC 2MQHA 2R7ZH 3RLFA 3F2DA 4JI8L 4GKKL 2NN6G 2EIFA 1KXLA 1Q12A 4LFAL 3A74A 4NB3A 4HJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M H;  1Y1W G;  1GD7 A;  3HOY H;  3UDF A;  1HZA A;  3L7Z C;  2JK8 A;  3J81 i;  3CCS A;  4JI8 Q;  4QL5 A;  5IE8 A;  1B8A A;  4GKK Q;  3HOW H;  4GN4 B;  1GKH A;  2VQE Q;  5C4J H;  2CFM A;  4LFA Q;  1ASY A;  3KF6 B;  1ASZ A;  4BY1 G;  3A5Z B;  2CCZ A;  3RR5 A;  4HJ5 A;  3FHW A;  1C7Y A;  2B63 H;  2UUB Q;  4B3R L;  3AYH B;  4X65 Q;  3CPW A;  1Q86 C;  1PVO A;  4GLX A;  4A76 A;  4A3E H;  4LUO A;  2IY5 B;  3MEF A;  4OO1 G;  2IHE A;  5C0X G;  1KRS A;  2EXD A;  1YJW A;  1S72 A;  1KIX A;  3CCR A;  1AE2 A;  4Y52 H;  1VQL A;  4O0A A;  3CPF A;  1L1O A;  2K5N A;  3AFP A;  3NEN A;  3UE0 A;  3CP0 A;  1BKB A;  4P73 A;  4DAY B;  2MO0 A;  2N8N A;  3DLL A;  3KYH C;  1I5F A;  4A3D G;  2UXD L;  4P74 A;  3OYY A;  2V1C C;  3UDI A;  2E2J H;  4A3B G;  4JI6 L;  1X55 A;  1J6Q A;  1VQ5 A;  1O7I A;  2JA8 H;  1K73 C;  1HR0 W;  2UXD Q;  3GD7 A;  3PUX A;  2MO1 A;  1IBK L;  4GNX B;  3PO3 G;  2HIV A;  2NVQ H;  4OWW B;  3CME A;  4JI6 Q;  1R9T H;  1CSQ A;  2OTL A;  1HNZ L;  1SRU A;  4KHP L;  1GVP A;  4DR6 L;  1AH9 A;  3UDG A;  2MNA A;  1Y14 B;  1SRO A;  1IBK Q;  2OQ0 A;  1NE3 A;  4DV4 L;  1XNR L;  4IFD G;  5IP9 G;  3BU2 A;  1P16 A;  2A19 A;  1E24 A;  2I5L X;  1HNZ Q;  1LTL A;  1XTD A;  4DR7 L;  4KHP Q;  4C3I H;  4DR6 Q;  1UE7 A;  2RF4 A;  4BBR H;  4P72 A;  1QUQ B;  4OWX B;  1XNR Q;  2GVA A;  3KF6 A;  4DV4 Q;  2JQO A;  4JI0 L;  3FKI G;  3BZK A;  4AQY L;  2K4K A;  4AH6 A;  3PF5 A;  2ZTE A;  4DKA C;  3NBH B;  5LMN Q;  3NEL A;  1E7Z A;  4JG2 A;  3J7A 5;  3GTG H;  2R93 G;  1EFW A;  2B29 A;  5JJK A;  1VQH A;  4JI0 Q;  4AQY Q;  4BA1 I;  5C3E H;  2XTI A;  1PH5 A;  1NTG A;  3PO2 H;  2K14 A;  2PQA B;  3LGJ A;  1SFO H;  3M4O H;  3K7U C;  3M85 A;  2GVB A;  1VQ7 A;  4LF6 L;  3PF4 A;  2UXB Q;  5JJL A;  1A8V A;  2R7Z G;  1K8A C;  1CKO A;  3UDX A;  1WI5 A;  2K52 A;  4UP7 A;  4OX9 Q;  2AWN A;  2VY3 A;  1OXS C;  3TQY A;  4DV3 L;  1PV4 A;  3HKZ G;  4JV5 L;  1SN8 A;  4IPD A;  4LF6 Q;  2EQS A;  1PFS A;  4A3M G;  3EIV A;  3CCU A;  2ES2 A;  4GNX A;  4C2M H;  3HOZ H;  1YBY A;  1YEZ A;  3HFZ B;  3HOW G;  2C35 B;  3VDY A;  1P8L A;  3J81 j;  4DV3 Q;  4LFB L;  4JV5 Q;  4DV1 L;  4LNQ A;  3EBE A;  2B63 G;  4UP8 A;  2NVY H;  4X66 L;  2UUA L;  1C9O A;  2ZJR A;  2UUC L;  4JBM A;  1KQS A;  5M5X H;  4A3E G;  3MXN B;  2VZA A;  4B3S L;  4LFB Q;  4DV1 Q;  1FJG L;  5IP7 H;  1B7Y B;  3CCV A;  4X66 Q;  2BH2 A;  1L2F A;  5GAH C;  3E9I A;  2QA4 A;  2UUA Q;  2UUC Q;  1HR0 L;  5M5Y H;  2VNU D;  3GTJ H;  4A4I A;  3U50 C;  2Q2H A;  2A8V A;  2YTY A;  3RZO H;  5GAG C;  1BBU A;  1TXY A;  1Q81 C;  4DV0 L;  1FJG Q;  1G6P A;  3GTM H;  1PYS B;  2CQO A;  1J5E L;  1EYG A;  4UP9 A;  4NPS A;  4IO9 A;  2JA8 G;  5FLM H;  1E1T A;  3CAM A;  5M3F H;  5M3M G;  4JI2 L;  3J80 c;  4YCU A;  1L0W A;  4DV0 Q;  1K83 H;  4GOP B;  4A3L H;  2JA5 H;  2PQA A;  2QEX A;  1LM0 A;  3CD6 A;  1J5E Q;  3I4N H;  1V1Q A;  2CWA A;  4JI3 L;  1W2B A;  4POG A;  4QIW E;  2JJQ A;  4O2D A;  3HKZ E;  4JI2 Q;  4L5T A;  4OWT B;  4R4Q A;  4A75 A;  5LMN W;  1S3O A;  4JI3 Q;  1HZ9 A;  3S14 H;  2Q2I A;  3W1B A;  4DK3 C;  1GM5 A;  1PH1 A;  1N34 L;  4YY3 Q;  4BBR G;  1EQR A;  1Q1B A;  1KHI A;  1VQB A;  1TWC H;  4YWL A;  4A3J H;  2R7D A;  1M1K C;  4DUY L;  1EQQ A;  2H5X A;  1XMO L;  2I5H A;  2VQE L;  1N34 Q;  4LF9 L;  3M3Y H;  1CKM A;  2K5V A;  4B3M L;  4GKJ L;  2R6G A;  4H02 A;  2LXJ A;  1UE1 A;  3U4Z A;  2UUB L;  2R92 H;  4X65 L;  4DUY Q;  1JMC A;  1OXX K;  2CKZ B;  3G48 A;  5C3E G;  1XMO Q;  1M90 C;  3ICE A;  4LF9 Q;  4NXM L;  3PO2 G;  1JT8 A;  1X54 A;  4B3M Q;  4GKJ Q;  3F1Z A;  3KDF A;  1Y1V H;  3GO5 A;  3PGZ A;  3K80 C;  1MJE A;  4DR1 L;  4JI4 Q;  1U0L A;  4PZ6 A;  4BBS H;  1VQE A;  5H1S E;  4DV6 L;  4A3I H;  3E9H A;  4AIM A;  4NXM Q;  5IYB H;  1X9N A;  2QGQ A;  3ER0 A;  4BY7 H;  1K0R A;  4X6A H;  4KI0 A;  4DR1 Q;  3PUZ A;  4HIM A;  1VQK A;  1YJN A;  2N78 A;  2IX0 A;  2IX1 A;  1A63 A;  2KCM A;  4DV6 Q;  2HHH L;  1C0A A;  4NXN L;  3FP9 A;  3K81 C;  1SMX A;  1WOC A;  2AKW B;  1PYB A;  3JC6 6;  1K8G A;  4MZ9 A;  4YHH L;  4IJH A;  2HHH Q;  1SR3 A;  2JA9 A;  4IPC A;  1YHA A;  5M3M H;  1MJC A;  3CCE A;  4DV2 L;  4A3K H;  4TQU S;  4TVA B;  4NXN Q;  2VUM H;  3CMA A;  1YZ6 A;  2IHF A;  5IP7 G;  1WFQ A;  5DLQ E;  4WJ3 M;  3H0G H;  4QJF A;  1TWG H;  3TS0 A;  4YHH Q;  1UWV A;  4A93 G;  4KHZ A;  2Q2U A;  5IT9 c;  4DV2 Q;  1IBM L;  2NVT H;  4LUZ A;  2E5L Q;  1V9P A;  4RMF A;  2WAQ G;  3CCQ A;  3CC7 A;  1N9W A;  4C3H H;  3I56 A;  4JBK A;  3BJU A;  4YCW A;  5LMN L;  5FLM G;  1NMG A;  1IBM Q;  2NN6 I;  5M3F G;  4A3L G;  1E22 A;  2JA5 G;  4ALP A;  2BA0 A;  2A1A A;  3S1M H;  4WJ4 A;  3I4N G;  1X6O A;  3OW2 A;  5EAY A;  2PNH A;  4R4O A;  3J7Z C;  1PHJ A;  2N49 A;  3WWV A;  4R1J A;  2UXB L;  1L1O C;  4QQB X;  3Q8D A;  2XGT A;  1OTC A;  1OXT A;  1YIJ A;  5HY6 A;  2KHI A;  4JBW A;  2WFW A;  4OX9 L;  1CSP A;  3I2Z A;  1AE3 A;  3D31 A;  3K0X A;  1YIT A;  1NBW A;  1KD1 C;  3RLO A;  1H95 A;  4LF7 L;  4A3J G;  1U5K A;  1IZ6 A;  1QZG A;  2HIX A;  2YTX A;  4OON A;  4Y7N H;  3F2C A;  1PH6 A;  1RL2 A;  4PG3 A;  3AEV A;  2UXC L;  3PCO B;  4HJ7 A;  1VQG A;  4JCV E;  3DM3 A;  3PSI A;  4LF7 Q;  2R92 G;  5AJ3 L;  4XTC S;  3I4O A;  2YYZ A;  1MIU A;  2PMZ E;  2VW9 A;  2YU9 H;  4IOA A;  4JOI A;  4K0K L;  2KBN A;  2RHS B;  2VS1 A;  4C3J H;  2HT1 A;  1N36 L;  1PH3 A;  2UXC Q;  2WP8 J;  4MNO A;  2WAQ E;  3W1G A;  1WJJ A;  1JJ2 A;  3I4M H;  1Y1V G;  5AJ3 Q;  1T9H A;  4A3G H;  1QVC A;  3H15 A;  4K0K Q;  4BBS G;  2ZJP A;  1Q8K A;  4A3I G;  4MTN A;  1N36 Q;  5IYB G;  2Y0S G;  3BZC A;  4GS3 A;  4BY7 G;  1QUQ A;  2RCN A;  1EIY B;  4P71 A;  2ZJQ A;  4UPA A;  1Q7Y C;  3K8A A;  1XPR A;  4GN5 A;  2AHO B;  3ULJ A;  2F3I A;  1YI2 A;  5JJI A;  4EQ5 A;  5GAD C;  3F2B A;  2OTJ A;  1NMF A;  3T1Y L;  3AQQ A;  2D0O A;  2PI2 E;  1SLJ A;  4KLK A;  5ELN A;  5GQO A;  1D7Q A;  3TRE A;  3HOZ G;  4L5Q A;  4A3K G;  2VL6 A;  4LWC A;  2VUM G;  4BXX H;  1I94 L;  5IY0 A;  1XJV A;  1E3P A;  1B70 B;  1Q46 A;  1G29 1;  1X56 A;  3HKS A;  4JC0 A;  1XMQ L;  1PH2 A;  3H0G G;  4GLA C;  5ELO A;  3T1Y Q;  4POF A;  2Q2T A;  4YY3 L;  2JA6 H;  4GNX C;  3GTP H;  1TWF H;  3RLN A;  4FDB A;  1I94 Q;  2ID0 A;  4JOI C;  1XMQ Q;  4DR4 Q;  4HID A;  3CCM A;  3KFU A;  5C4X H;  5C44 H;  1IXR A;  3U58 A;  3HOU H;  3RZD H;  3S2H H;  3TEH B;  2RHQ B;  4YWM A;  4YWK A;  5M5W H;  3CXC A;  3TRZ A;  1NY4 A;  1Z47 A;  5IYC H;  3RN2 A;  1SE8 A;  2UU9 L;  1JJC B;  1UE5 A;  4IOC A;  3ULP A;  2F4V L;  3S2D H;  2CWP A;  4JI1 Q;  2Y0S E;  1WCM H;  4R4I A;  2ATW A;  4JI4 L;  1VQA A;  4HIO A;  2GN5 A;  4DAM A;  2UU9 Q;  3RNU A;  4DV5 L;  2F4V Q;  1N32 L;  1HH2 P;  2FXQ A;  3L0O A;  3NEM A;  2PI2 A;  1YHB A;  3JAM c;  2KEN A;  3CF5 A;  1PH7 A;  1A62 A;  3PIP A;  4JYA L;  5IYD H;  1XPO A;  1A0I A;  4DV5 Q;  2BH8 A;  3M7N A;  1JB7 A;  1EWI A;  1X65 A;  4XIG S;  4LF5 Q;  1I6H H;  3SGI A;  4DR3 Q;  2E2I H;  3HOV H;  1N32 Q;  3PIO A;  3ERS X;  3ZJY C;  1EUJ A;  3PUV A;  1V43 A;  1IL2 A;  3H3V I;  1OXU A;  4GOP A;  4JYA Q;  3PUW A;  4EX5 A;  2AWO A;  2OQK A;  1LYL A;  3JAM i;  3KJP A;  4A3F H;  2JA7 H;  2R7F A;  1JJG A;  1IYJ B;  2LXK A;  4IJL A;  4YCV A;  5FJ8 H;  3T1H L;  1VQO A;  1RIP A;  4L5R C;  3I4M G;  2YTV A;  3AFQ A;  1G51 A;  5E7N A;  1KAW A;  1KRT A;  4A3G G;  1VQ9 A;  2Z0S A;  4DV7 L;  1VQ4 A;  1I3Q H;  2L15 A;  3B6Y A;  2YV5 A;  1VQ6 A;  3T1H Q;  2E5L L;  4A93 H;  4HJ8 A;  1BVS A;  3I7F A;  1YHQ A;  4LF4 L;  3GTO H;  4DV7 Q;  1TWH H;  2WB1 E;  1VQ8 A;  4B3R Q;  4R4C A;  1Q1E A;  4LUV A;  4P75 A;  3G4S A;  3CW2 C;  4JI5 L;  2K5H A;  4LF8 L;  2JE6 I;  1VQN A;  4IPH A;  4B3T L;  1BBW A;  1KL9 A;  1W3S A;  1HJP A;  4AYB G;  3H3V H;  1LUZ A;  4LF4 Q;  4QY7 A;  1CUK A;  1WYD A;  4DUZ L;  1I50 H;  4LF8 Q;  1HZC A;  3KJO A;  4JI5 Q;  1FL0 A;  3D0F A;  1QZH A;  4B3T Q;  3M9B A;  3K7A H;  4BXX G;  1HNW L;  4LFC L;  1FGU A;  3CCJ A;  2N3S A;  1VQP A;  2KHJ A;  4DUZ Q;  5GRO A;  1PH9 A;  1DGS A;  4GOP C;  4L5S A;  2JA6 G;  4HJ9 A;  5HGQ A;  1K3R A;  2NZH A;  5IWA L;  3G71 A;  1HNW Q;  2AMC B;  4LFC Q;  5C0X J;  1E1O A;  2Z6K A;  4PMW A;  3S24 A;  1FVI A;  3KOJ A;  5LMU L;  5C44 G;  4A3C H;  5C4X G;  3HOU G;  3E0E A;  1OXV A;  1VCI A;  3S1R H;  4OO1 I;  5IYC G;  5IWA Q;  5C0X I;  3HOX H;  1VQJ A;  2DGY A;  3STB C;  5LMU Q;  2K50 A;  3PV0 A;  2E8G A;  1VQM A;  3A0J A;  3UE1 A;  2VQF L;  1WCM G;  1X3G A;  1YVC A;  4OXP A;  1VQD A;  3I55 A;  1QVF A;  2JEA I;  3S15 H;  4DR7 Q;  1PH4 A;  3KF8 B;  5FLX c;  4X64 L;  3KLW A;  2F52 A;  1Y1W H;  2ZM6 L;  1HZB A;  1CKN B;  4J15 A;  5JEA G;  2VQF Q;  1YNX A;  3S16 H;  3CCL A;  3S1N H;  2BA1 A;  4AYB E;  2D0P A;  4BY1 H;  5IYD G;  4X64 Q;  1PA6 A;  2OWO A;  1TWA H;  3OTO L;  2ZM6 Q;  4IFD J;  4RG1 A;  3U4V A;  1UE6 A;  2HQL A;  1UEB A;  1YJ9 A;  2JEB I;  3HOV G;  1VQC A;  3GTL H;  3ULL A;  4UY8 C;  4IFD I;  1N8R C;  4A3F G;  4BA2 I;  2JA7 G;  3OTO Q;  1Z9F A;  4X62 L;  4DK6 C;  3GTQ H;  3STB D;  3HOY G;  3S17 H;  2Z6K C;  5BR8 L;  5FJ8 G;  4LW1 A;  4DR2 L;  4A3D H;  2B3G A;  1MKH A;  4PZ7 A;  2KCT A;  3CC4 A;  2NZO A;  2IT1 A;  3PUY A;  5JEA J;  4X62 Q;  4GLV B;  3W5O A;  4A3B H;  1XPU A;  2I0Q A;  5BR8 Q;  2MFI A;  4DR4 L;  4DR2 Q;  3A5U A;  1PH8 A;  1X3E A;  4APV A;  3PO3 H;  1KC8 C;  2ZTD A;  3GDE A;  3M4Q A;  2ALY B;  3M4P A;  2E2H H;  1X3F A;  4ME3 A;  1EIF A;  3TS2 A;  2OCE A;  3KDF B;  1S40 A;  4B3S Q;  3CC2 A;  1VS0 A;  3RN5 A;  5IP9 H;  5J3B A;  4JI1 L;  1VQI A;  1HR0 Q;  3IRB A;  1CKN A;  1JE5 A;  5K36 G;  3CQZ H;  1D8L A;  4JBJ A;  3L2P A;  1IBL L;  4QGU A;  2I5M X;  2WB1 G;  4DR5 L;  1NJI C;  3FKI H;  1GO3 E;  1K9M C;  1L1O B;  3G6E A;  1HNX L;  1N33 L;  4JI7 L;  2R93 H;  1IBL Q;  3EN2 A;  1Q82 C;  2ASB A;  4A3C G;  1XNQ L;  4GN3 B;  1VQF A;  4DNI A;  2DUD A;  2LSS A;  4DR5 Q;  4LF5 L;  1QVG A;  3F8T A;  4HIK A;  4R4T A;  4DR3 L;  1HNX Q;  3GTK H;  4PZ8 A;  3J80 i;  1EOV A;  1N33 Q;  4IPG A;  4JI7 Q;  3J81 c;  3HOX G;  2D62 A;  2NVX H;  3S1Q H;  4DPG A;  1XNQ Q;  2K75 A;  2ZTC A;  5GAE C;  2MQH A;  2R7Z H;  3RLF A;  3F2D A;  4JI8 L;  4GKK L;  2NN6 G;  2EIF A;  1KXL A;  1Q12 A;  4LFA L;  3A74 A;  4NB3 A;  4HJA A; 
#chains in the Genus database with same CATH topology
 1GD7 A;  3UDF A;  5I4D A;  3Q6S A;  4BY1 G;  2B63 H;  3FHW A;  2PZT A;  1XWE A;  1R9T B;  2EXZ A;  4H44 C;  4A76 A;  3E5S A;  1YJW A;  2EYH A;  1FR3 A;  2JXM B;  2KVM A;  1AE2 A;  3TZD A;  3C46 A;  4QB4 A;  4UDU C;  2OEO A;  3SR1 A;  1EQV A;  4DAY B;  3CP0 A;  2MO0 A;  2N8N A;  2UXD L;  3W3A A;  1JOK A;  4P74 A;  2HUG A;  2QF7 A;  1ET6 A;  3C2P A;  1SEB D;  3NBI A;  1HR0 W;  2UXD Q;  3GD7 A;  5DM6 3;  3CME A;  3R8B A;  3A8I E;  1R9T H;  1WTH A;  2OTL A;  3PO2 B;  4RGT A;  4KMU C;  1SFO B;  3M4O B;  1Y14 B;  2LS0 1;  4IFD G;  2JP1 A;  3BU2 A;  2OF1 A;  2LFN A;  2I5L X;  2IL8 A;  3A8J E;  1LTI D;  4K8I A;  1X32 A;  4P72 A;  5ELC A;  2GVA A;  1X3Q A;  2K4K A;  1PFM A;  1IW7 C;  1D6E C;  3K5L A;  3PO2 H;  2B2Y A;  2K14 A;  1BUV T;  2QKI C;  2PQA B;  1SFO H;  3M4O H;  3K7U C;  5C3X A;  3M85 A;  1SE3 A;  3PF4 A;  5NUC A;  3GV6 A;  1HQM C;  3UDX A;  4QCL A;  1F9S A;  4UP7 A;  2AWN A;  2LY7 A;  3I8Z A;  1NNX A;  2F0H A;  4JV5 L;  3GTM B;  4A3M G;  3OMC A;  3EIV A;  1YEZ A;  3J81 j;  4JV5 Q;  2X6L A;  2D9U A;  4ZUJ A;  5KIX A;  1TII D;  2R93 B;  4B3S L;  3MTS A;  1B7Y B;  3CCV A;  5GAH C;  2F0U A;  2QA4 A;  4F88 A;  3GTM H;  1O7Z A;  4A3J B;  1PYS B;  2B2Y C;  1LTT D;  2K01 A;  1HQR D;  2JA8 G;  1Q3L A;  5M3M G;  1I4P A;  4IUP A;  4Q0F A;  4KY5 A;  1LM0 A;  3DM1 A;  1CQV A;  4UAI A;  2IPK D;  3FDT A;  3HKZ E;  4N9P A;  1H9S A;  1Y1V B;  3LNN A;  5A35 A;  1LT6 D;  1S3O A;  4BBS B;  4DK3 C;  1N34 L;  2Y0S B;  1Q1B A;  4BY7 B;  2NB0 A;  4A3J H;  3SE0 A;  4CDE C;  3ZYY X;  2H5X A;  2IX3 A;  2I5H A;  1N34 Q;  2F0J A;  2M2L A;  4B3M L;  3MXN A;  2LXJ A;  2UUB L;  2F0V A;  1JMC A;  3QOJ A;  4B3M Q;  4A3K B;  3F1Z A;  1Y1V H;  4EQN A;  1EWC A;  1STN A;  3H0G B;  4JI4 Q;  4BBS H;  5FK9 C;  1QB5 D;  5IYB H;  2O5J C;  4BY7 H;  4CHT B;  3KBG A;  2KA7 A;  4KI0 A;  5C6A A;  4HIM A;  1YJN A;  5KGU A;  4QMG A;  3FP9 A;  4R8N A;  1YNN C;  2PW7 A;  3OHX C;  1SMX A;  1EYA A;  2PCF B;  2AKW B;  4HED A;  1K8G A;  3MHB A;  3CHB D;  2JA9 A;  4IPC A;  4DV2 L;  1AN8 A;  3GTG B;  4A3K H;  4TQU S;  4TVA B;  3CMA A;  5IP7 G;  4KK7 A;  5DLQ E;  2BDN A;  3H0G H;  4QJF A;  1UWV A;  4KHZ A;  4XYO A;  4DV2 Q;  1IBM L;  3P1H A;  2I46 A;  3I4L A;  2DJF C;  1CK1 A;  1STE A;  2B2T A;  1IBM Q;  1PRT B;  1S5E D;  4HR7 B;  1CA5 A;  2PPB C;  1S5C D;  2CW0 C;  5FO9 B;  4ALP A;  3I4N G;  1AEX A;  2F0S A;  2XVS A;  2KJX A;  4C3J B;  2XSC A;  3D3R A;  3WWV A;  1GUG A;  2AQ2 B;  3DXJ C;  1L1O C;  4QQB X;  2UXB L;  4A3G B;  4JPB W;  5HY6 A;  5M5X B;  5T1G A;  1RKN A;  1WTP A;  4JBW A;  1TT2 A;  4K2L A;  3WOF A;  1ESR A;  3K0X A;  1DON A;  1KD1 C;  1KLU D;  2PMZ B;  1HA5 A;  4KKT A;  1VQG A;  3DM3 A;  1JWS D;  5G3L D;  2F0D A;  2YYZ A;  3A56 A;  2EOT A;  5FO8 B;  2RHS B;  4C3J H;  3E0J A;  2DNC A;  2WP8 J;  4BWG B;  4A3G H;  1KTK A;  1QVC A;  2B2T C;  2F0M A;  2HDL A;  1DOM A;  3H15 A;  1F9Q A;  4A3I G;  1U4R A;  3JAM L;  3CU7 A;  1NAP A;  2RCN A;  5C4X B;  2A5H A;  3RZD B;  1Q7Y C;  2F0I A;  4OHJ A;  1YI2 A;  1PTO C;  5J22 A;  5GAD C;  1NMF A;  1BCP C;  5ELN A;  1SLJ A;  3TRE A;  1CZG A;  1K3B C;  5IY0 A;  4A93 G;  1XMQ L;  3HKS A;  2A6E C;  1PDQ A;  1GUS A;  4YY3 L;  5EGT A;  5A2Q E;  1U4L A;  1XMQ Q;  1PZI D;  3KFU A;  5C4X H;  2F0O A;  1IXR A;  1SXT A;  3RZD H;  3TEH B;  4RAU C;  2F0T A;  3ND8 A;  3NE5 B;  1VF7 A;  2UU9 L;  4JI1 Q;  4R4I A;  1VMC A;  4HIO A;  2UU9 Q;  3QB3 A;  3AMU A;  3Q22 A;  3VA5 A;  5JEA H;  1HH2 P;  2FXQ A;  1IKL A;  4JYA L;  4FF1 A;  3OSO A;  3EA6 A;  1A0I A;  1XPO A;  1RJT A;  1V1P A;  1JB7 A;  1JOO A;  4RGO S;  1EUJ A;  1V43 A;  1GHK A;  4JYA Q;  2NBF A;  3JAM i;  1Y8O B;  2R7F A;  2FJ2 A;  1IYJ B;  4YCV A;  5FJ8 H;  3T53 B;  1RIP A;  2ICI A;  3I4M G;  3AFQ A;  5E7N A;  1KAW A;  1NSN S;  1A3U A;  1U9R A;  1VQ9 A;  5D3D A;  2KEC A;  3B6Y A;  4HAE A;  3PIP 3;  5D14 A;  5I6Y A;  2SOB A;  1Q90 A;  4LF8 L;  3CW2 C;  4JI5 L;  2K33 A;  4YIJ A;  1W3S A;  4O42 A;  4C1N I;  2XNA C;  1ROD A;  1EQT A;  1ML0 D;  4LF8 Q;  4JI5 Q;  5K36 H;  3K6O A;  3EQL C;  4B9W A;  1VQP A;  1STY A;  2KHJ A;  2AQ1 B;  4IUU A;  4L5S A;  1MD2 D;  1SNM A;  5HGQ A;  3S16 B;  3DEO A;  1E1O A;  5LMU L;  1ILP A;  1TWA B;  5C44 G;  3HOU G;  1QG7 A;  1VCI A;  1ET9 A;  3GTL B;  5C0X I;  3TSS A;  4RFB A;  1U4P A;  2DGY A;  5D3I B;  2MHV A;  5LMU Q;  2K50 A;  2E8G A;  4TKO B;  4L6T B;  1BDO A;  4KJO A;  1WCM G;  1YVC A;  4OXP A;  3SVM A;  3I55 A;  2JEA I;  1QVF A;  4A3D B;  2XIW A;  2AUJ D;  3MXU A;  1HZB A;  2LKV A;  3MWY W;  3S16 H;  5D65 A;  3T16 A;  4FNF A;  2BA1 A;  4AYB E;  3T56 B;  3PO3 B;  1PA6 A;  1TWA H;  3OTO L;  3U4V A;  3GTP B;  4HMI A;  2JEB I;  1VQC A;  3GTL H;  2RBM A;  1V8Q A;  3J81 L;  2K28 A;  3NUC A;  1N8R C;  4BA2 I;  3OTO Q;  4A3D H;  4DR2 L;  2B3G A;  1W6K A;  1MKH A;  2KCT A;  2NZO A;  1B3Q A;  3PUY A;  2I0Q A;  1NR4 A;  1KDB A;  4DR4 L;  4DR2 Q;  2F0E A;  3FEW X;  3PO3 H;  1KC8 C;  1EIH A;  2ZTD A;  3GTK B;  4XT1 B;  3M4Q A;  1H9R A;  4LMQ D;  1X3F A;  3S1Q B;  4X3U A;  1VS0 A;  1JWM D;  1RF2 D;  4PV1 C;  2RCF A;  4FXG C;  4CDD C;  3IRB A;  1CKN A;  1CM9 A;  2N88 A;  4JBJ A;  1IBL L;  2I5M X;  1K9M C;  1L1O B;  3G6E A;  4KY7 A;  3HOW B;  5C4J B;  4HMJ A;  1IBL Q;  1Q82 C;  2ASB A;  4A3C G;  1XNQ L;  1VQF A;  1WD1 A;  3GTK H;  3F8T A;  3I3C A;  4HIK A;  3GV3 A;  4A3E B;  4IPG A;  3HOX G;  3S1Q H;  1A3T A;  5IIF A;  2XWJ B;  1XNQ Q;  2EYJ A;  3F2D A;  2WII B;  3L9A X;  1KXL A;  1Q12 A;  4NB3 A;  4HJA A;  1Y1W G;  3J81 i;  2JK8 A;  4NMZ A;  1RTO A;  3HOW H;  4GN4 B;  1GKH A;  5JAV A;  2CFM A;  5C4J H;  3IKJ A;  1SMY C;  4B3R L;  4FVM A;  2RKS A;  3AYH B;  5C4Z A;  3CPW A;  1Q86 C;  2A74 C;  4A3E H;  2IY5 B;  4LUO A;  2RA4 A;  1F9P A;  2QDL A;  4DAV A;  4WJW A;  5C0X G;  1KRS A;  1S72 A;  3CCR A;  5LL6 S;  4HSP A;  1PTO B;  3AFP A;  3UE0 A;  1BCP B;  4P73 A;  4C3I B;  1BNZ A;  3KYH C;  4A3B G;  3DWP A;  3QJY A;  1XXG A;  1SNO A;  2MO1 A;  2KHS A;  3KLR A;  2F0W A;  2HIV A;  1IBK L;  4JW0 A;  1CSQ A;  2OXP A;  5DNF A;  3VR4 A;  5JJZ A;  4K14 A;  1SYB A;  1IBK Q;  4DV4 L;  3QOL A;  5IP9 G;  2A19 A;  3D4D A;  1PTO H;  1LTL A;  3PQI A;  4DR7 L;  4C3I H;  1UE7 A;  2RF4 A;  4DNR B;  5CC4 A;  4DV4 Q;  3KF6 A;  3X3N A;  2JQO A;  3FKI G;  4AQY L;  1YNN D;  4AH6 A;  5KRU A;  3NBH B;  5LMN Q;  4GZY C;  3NEL A;  4FF2 A;  3J7A 5;  2BE5 C;  2R93 G;  4KV6 A;  4AQY Q;  4BA1 I;  5K5P A;  2J0T D;  5LHY 1;  2JYO A;  2R7Z G;  5M5Y B;  4OGQ C;  2VY3 A;  5DEH A;  1PV4 A;  2CHB D;  4IPD A;  4KTA A;  2FMC A;  2B39 A;  2EQS A;  1PFS A;  2ES2 A;  4GNX A;  4FXD A;  1ICF B;  3VYT A;  2WKD A;  1EFI D;  3VDY A;  3H3V C;  5M3F B;  4ZLT F;  3EBE A;  2J7Z A;  4X66 L;  1C9O A;  2UUC L;  2EYO A;  2O2L D;  4RWS C;  3EFX D;  3QWN A;  4X66 Q;  2BH2 A;  2Z8L A;  5CV7 A;  3SK6 A;  2UUC Q;  1HR0 L;  1TU2 B;  5M5Y H;  3VR5 A;  3GQB A;  3S14 B;  2Q2H A;  2YTY A;  4PMB A;  2HCI A;  4K5V A;  4DV0 L;  3P7J A;  3KF8 A;  4F7X A;  1V1P B;  2PQE A;  4UP9 A;  4NPS A;  1EL0 A;  1AFP A;  5FLM H;  3M3Y B;  4EGV A;  1E1T A;  5M3F H;  4JI2 L;  3J80 c;  1L0W A;  1EWH A;  4DV0 Q;  4A3L H;  2FFK B;  2CWA A;  3VYR A;  4QIW E;  2JJQ A;  3BYT B;  4JI2 Q;  4L5T A;  4R4Q A;  2RDF A;  4WFN 3;  5LMN W;  2EE1 A;  1KDA A;  2K03 A;  3S14 H;  1CHQ D;  1PH1 A;  4BBR G;  3SK8 A;  3D6C A;  1A3V A;  1KNA A;  3NWS A;  3M3Y H;  2K5V A;  1PTO D;  4GKJ L;  3RMH A;  3U4Z A;  1QCB D;  3V2T A;  2QDB A;  3TN2 A;  2L4N A;  5C3E G;  1M90 C;  1TKW B;  4GKJ Q;  4IUN A;  2VUM B;  3R93 A;  3GO5 A;  4PZ6 A;  2KOL A;  4DV6 L;  1STA A;  5JOB A;  1X9N A;  2RVL A;  1K0R A;  4H13 C;  2R61 A;  5CV4 A;  2KCM A;  4DV6 Q;  4NXN L;  4G57 A;  3H6M A;  3K81 C;  4UHV A;  1HFG A;  3D6W A;  4MZ9 A;  1SR3 A;  1YHA A;  1MJC A;  4NXN Q;  4IAL A;  2VUM H;  1YZ6 A;  2IHF A;  3NTK A;  1HFN A;  3H91 A;  2E5L Q;  4RMF A;  1LTG D;  3CCQ A;  3I72 A;  3CC7 A;  1EEF D;  4Y7N B;  2C9O A;  3NXW A;  1Y8N B;  2X6G A;  2JA5 G;  2BA0 A;  4WJ4 A;  3NPP A;  2YU9 B;  1DOL A;  5EAY A;  2N49 A;  1IYU A;  3H09 A;  1B4O A;  1WTR A;  3ITP A;  3Q8D A;  1OTC A;  2HCC A;  2KHI A;  1HRJ A;  2PNR C;  4I7Z C;  2BOS A;  3I2Z A;  4U68 A;  4QUF A;  3D31 A;  1YIT A;  1BR9 A;  1ZXT A;  3RLO A;  4LF7 L;  5CV5 A;  2LMC B;  4V19 0;  2HIX A;  4Y7N H;  5G3L F;  4PG3 A;  3A55 A;  3D4W A;  3PCO B;  5EKI A;  2A69 C;  4HJ7 A;  4G7O C;  4I7A A;  2WAQ B;  2L0C A;  4LF7 Q;  3A7L A;  2R92 G;  4AYB B;  4M8A A;  4MIU A;  3KLS A;  1BXT A;  2YU9 H;  2Q8R E;  1SE2 A;  1PH3 A;  4MNO A;  4DK0 A;  3NQI A;  1ILQ A;  3MEH A;  2ZJP A;  1Q8K A;  2Z1C A;  5ELF A;  1QUQ A;  4DA2 A;  2K5Q A;  1EIY B;  4V0B A;  2ZJQ A;  5M5W B;  2Q8I B;  4G7Z C;  2AHO B;  4K6D A;  3ULJ A;  3Q0A A;  1BO0 A;  4EQ5 A;  2QCP X;  3F2B A;  1KLG D;  3DHQ A;  2PI2 E;  1DYQ A;  1D7Q A;  3HOZ G;  4ZRZ A;  5C3W A;  1I94 L;  5JJI A;  1XJV A;  1E3P A;  1Q46 A;  1X56 A;  1LLR D;  1LO5 D;  4F8M A;  1STG A;  1CA6 A;  3RLN A;  1I94 Q;  4TSS A;  4C3H G;  3U58 A;  1K8M A;  1ENF A;  5IT9 L;  1M8A A;  5KYI A;  4YWM A;  5M5W H;  3CXC A;  2E2I B;  1AW7 A;  1NY4 A;  3RN2 A;  4K6L A;  4HSV A;  1JE4 A;  2JA7 B;  2CWP A;  3P75 A;  2ICE C;  3DWA A;  4JI4 L;  3RNU A;  1IL8 A;  3BDL A;  1SYE A;  4JK1 C;  2M9V A;  1YHB A;  2PI2 A;  1O80 A;  5IYD H;  1JWU D;  1TWH B;  4RA8 A;  2ZXP A;  2E2I H;  2EJM A;  3QO2 A;  1JCK B;  3PUV A;  1IL2 A;  1YNJ C;  2AWO A;  2OQK A;  2JA7 H;  1I50 B;  1G8Z D;  5I9P A;  1EU3 A;  3DUZ A;  2YTV A;  1DOK A;  1H9M A;  5FLX L;  2WB1 B;  3MC0 B;  1MSH A;  1VQ6 A;  2YV5 A;  3MXG A;  1L0Y B;  2F4I A;  4XT3 B;  1BVS A;  3I7F A;  2EPB A;  1EY9 A;  2MJ8 A;  3GTO H;  2AQ3 B;  1TWH H;  1VQ8 A;  2F0F A;  4N8F A;  3T13 A;  4P75 A;  2CVR A;  3QG1 A;  2Z9H A;  1UEA B;  1KL9 A;  4JVZ A;  1HJP A;  2Q8T A;  3H3V H;  3I90 A;  1CUK A;  1WYD A;  4DUZ L;  3ERQ A;  1I50 H;  4FF4 A;  1HZC A;  3KJO A;  1QZH A;  1LT3 D;  4BXX G;  3M9B A;  1FGU A;  2WIN B;  1CZW A;  4DUZ Q;  2JA6 G;  1SMY D;  3DWQ A;  4RH6 A;  4BY1 B;  5KNB A;  3TME A;  2Z6K A;  3OOC A;  3VR2 A;  5E1F A;  4OO1 I;  2RSO A;  5IYC G;  4U67 3;  3STB C;  2K6A A;  2F0Q A;  1GXD C;  5ELE A;  3A0J A;  2VQF L;  1X3G A;  3HEJ A;  4ZKC B;  4B08 A;  2F0L A;  2NN6 H;  3KF8 B;  2RDG A;  4K2K A;  2XRQ D;  3KLW A;  3Q23 A;  1R4Q B;  2VQF Q;  1YNX A;  2EYM A;  4DXF A;  1E2Z A;  1LT5 D;  4BY1 H;  1SNC A;  1UE6 A;  3HOV G;  2B2W A;  2L11 A;  2ZXR A;  3FPP A;  4ABN A;  2A6H C;  2EY1 A;  4A3F G;  4X62 L;  3CKI B;  2F0N A;  2Z6K C;  3CQZ B;  1S4Z A;  3LWE A;  4LW1 A;  3K0Y A;  2KUM A;  2E76 C;  2G5D A;  4PNY A;  4X62 Q;  4GLV B;  1STH A;  2BE5 D;  5I6W A;  3X3M A;  2MFI A;  2HQE A;  1XX8 A;  2SNM A;  3GDE A;  3M4P A;  2OCE A;  2Z4I A;  3CC2 A;  1E0B A;  4IFD H;  3E6Z X;  4FF3 A;  5J3B A;  5CBA E;  4JI1 L;  1B9N A;  1DD2 A;  2E74 C;  3U9O A;  4CKC A;  3CQZ H;  4QIW B;  2PZU A;  3L2P A;  4G7H C;  4QGU A;  1K0S A;  4A3M B;  2B2W C;  2A68 D;  1A6X A;  4DR5 L;  1GO3 E;  2ENB A;  3M7G A;  2K32 A;  1N33 L;  4ODG A;  1UNS A;  4JI7 L;  1JOR A;  1T5E A;  4RCN A;  4GN3 B;  4DNI A;  2KEE A;  4DR5 Q;  2LSS A;  1S5F D;  1QVG A;  3E3X A;  3J80 i;  1N33 Q;  1EOV A;  4JI7 Q;  3AU7 A;  2D62 A;  2MP1 A;  4QF4 A;  4ZCK A;  1B2T A;  1EZ8 A;  2ZTC A;  2RSN A;  3SK5 A;  3R2T A;  1D5X C;  2EIF A;  3FMC A;  4ID6 A;  4A3M H;  5ISR A;  2K05 A;  1HZA A;  3L7Z C;  4QL5 A;  2JA8 B;  1PRT D;  5I2X A;  2VQE Q;  3A8K E;  2CH4 A;  1PVO A;  4X65 Q;  3UI2 A;  3IAY A;  4GLX A;  1GUW A;  1TQO A;  3DMU A;  3MEF A;  4OO1 G;  2IHE A;  3RD4 A;  1I4X A;  4C56 C;  3MFY A;  2DY8 A;  2F0K A;  4Y52 H;  3CPF A;  2K5N A;  3K58 A;  3NEN A;  4XXE A;  3HP3 A;  3DLL A;  2L5T A;  3OYY A;  3UDI A;  2L12 A;  1J6Q A;  3OWF A;  1O7I A;  2JA8 H;  4I65 A;  1K73 C;  2SNS A;  4K5W A;  3PUX A;  1QNU A;  2B8G A;  2WV6 D;  1SRU A;  4KHP L;  1GVP A;  1PYW D;  1ZEQ X;  4L63 B;  1AH9 A;  3UDG A;  1BOS A;  3J7A V;  2MNA A;  1SRO A;  1XNR L;  2OQ0 A;  1I4R A;  4KN7 C;  4TRD A;  3VR6 A;  1E24 A;  1F2Z A;  2F3V A;  1XTD A;  4KHP Q;  2G9H D;  1QUQ B;  1XNR Q;  3HRZ C;  4JI0 L;  4C2M B;  1HUN A;  2ZTE A;  4DKA C;  1B50 A;  3ND9 A;  2EYP A;  2B29 A;  2NVY B;  5JJK A;  1VQH A;  4JI0 Q;  2MUY A;  2XTI A;  1QE6 A;  1STB A;  3LGJ A;  4KJN A;  5JJL A;  1VQ7 A;  4LF6 L;  3MVV A;  1F77 A;  3C3L A;  4IUR A;  1CKO A;  1WI5 A;  1WTO A;  3RZO B;  1H9K A;  4OX9 Q;  1H9S B;  1OXS C;  4FYD A;  5JPN C;  4DV3 L;  1SN8 A;  4LF6 Q;  3L3O C;  4OIK A;  3CCU A;  4C2M H;  1B9M A;  1YBY A;  2C35 B;  1P8L A;  1FD7 D;  4DV3 Q;  1KNE A;  4DV1 L;  4LNQ A;  2B63 G;  1IW7 D;  1AZQ A;  2NVY H;  4JBM A;  1D5Z C;  1KQS A;  5COY A;  3MXN B;  2VZA A;  3NP8 A;  4DV1 Q;  1FJG L;  5IP7 H;  3QR8 A;  1L2F A;  2VNU D;  2KQ3 A;  3RZO H;  2A8V A;  4KKS A;  4FO2 A;  1Q81 C;  1ENA A;  1FJG Q;  1C4Q A;  1G6P A;  2CQO A;  3BZD B;  4IO9 A;  3SEB A;  2B2U A;  3HKZ B;  3CAM A;  4YCU A;  2VB2 X;  4S3S A;  5TSS A;  2PQA A;  3CD6 A;  3CRK C;  3I4N H;  1V1Q A;  4Z9C B;  4JI3 L;  1NR2 A;  4N8X 1;  1W2B A;  4POG A;  1FNW A;  1G2S A;  4OWT B;  4A75 A;  4JI3 Q;  2RDH A;  1GJX A;  4A3I B;  1GM5 A;  1HPC A;  3K5M A;  1EQR A;  1VQB A;  1VDZ A;  1C48 A;  1M1K C;  4IUT A;  1PTO F;  2DJG C;  4DUY L;  1EQQ A;  1BCP F;  4PQX A;  3BG3 A;  1XMO L;  4LF9 L;  1JB3 A;  1CKM A;  4IN3 A;  4H02 A;  2VB3 X;  3CRL C;  4DUY Q;  1T5X D;  1OXX K;  3G48 A;  1XMO Q;  3SK4 A;  4LF9 Q;  4FXK C;  4NXM L;  3PO2 G;  1JT8 A;  3OPO A;  1FNU A;  3PGZ A;  3K80 C;  3WDN A;  1GUO A;  4DR1 L;  1U0L A;  1TWG B;  1VQE A;  5H1S E;  4A3I H;  4AIM A;  4NXM Q;  3K5N A;  2NVT B;  4H0L C;  1DCZ A;  5IGD A;  1F2Y A;  4X6A H;  1VF5 C;  4DR1 Q;  3PUZ A;  3K59 A;  1VQK A;  2IX0 A;  2IX1 A;  1A63 A;  1HHV A;  3MZ5 A;  5EKL A;  3SXH A;  1HTL D;  1MGS A;  4RGM A;  5KND A;  4KN4 C;  3S1M B;  1WOC A;  1M4V A;  1CT1 D;  2E75 C;  3JC6 6;  1E2W A;  1FGB D;  5EPK A;  1WTX A;  4R8I A;  5EKK A;  1TWG H;  5IT9 c;  5T1I A;  2NVT H;  1KAA A;  4LUZ A;  2WAQ G;  3KLS X;  4JBK A;  3BJU A;  5LMN L;  1NMG A;  2K7V A;  2NN6 I;  1F9R A;  4ME5 A;  2R3Z A;  5A2Q L;  1E22 A;  2A1A A;  3S1M H;  4CJ1 B;  4RGN A;  3OW2 A;  2PNH A;  5IT9 E;  1PHJ A;  3T51 B;  2KCN A;  3I4M B;  3TP7 A;  2WFW A;  4IUQ A;  3LWU A;  1AE3 A;  1NBW A;  4A3J G;  1IKM A;  1IZ6 A;  2YTX A;  2UXC L;  3AEV A;  5EPL A;  4JCV E;  5IGE A;  1EY8 A;  1MSG A;  2M00 A;  1SND A;  1EY5 A;  3I4O A;  4K0K L;  1MIU A;  2PMZ E;  2VW9 A;  1Y69 U;  4IOA A;  2CW0 D;  2UXC Q;  2HT1 A;  1IYV A;  4RHR A;  3W1G A;  2NZ1 D;  1WJJ A;  5JPM C;  3I4M H;  1Y1V G;  3F2U A;  3ERO A;  1T9H A;  2L9H A;  4K0K Q;  4BBS G;  4MTN A;  5IYB G;  2Y0S G;  2KCC A;  4OEL B;  4BY7 G;  5DM7 3;  2L55 A;  5C44 B;  4UPA A;  3HOU B;  3S2H B;  3K8A A;  3OIP A;  4EVO A;  4HTH A;  1SAP A;  4LAA A;  1KDC A;  2K5D A;  4KKU A;  2OTJ A;  3T1Y L;  3AQQ A;  3S2D B;  2QIL A;  4KLK A;  5GQO A;  1I6V C;  1WCM B;  4L5Q A;  4A3K G;  1KAB A;  3N52 A;  3IL8 A;  1PFN A;  1G29 1;  4JC0 A;  1WTV A;  3H0G G;  4ZQ3 A;  5ELO A;  1B44 D;  3T1Y Q;  2Q2T A;  5CV9 A;  4GNX C;  1EY7 A;  3CCM A;  5C44 H;  3HOU H;  1F2L A;  4CKE A;  2A6H D;  2IW3 A;  3G6J B;  3S2H H;  4YWK A;  3TRZ A;  3TDQ A;  1SE8 A;  3G7L A;  1L0X B;  4IQZ A;  1JJC B;  3MFG A;  4IOC A;  3ULP A;  1D2B A;  3S2D H;  4H7B A;  5FOB B;  1WCM H;  1BCP D;  3NWT A;  5IOD A;  4DAM A;  1SDF A;  1QOH A;  4DV5 L;  1N32 L;  2A6E D;  3JAM c;  4Q5V A;  1EY4 A;  1A62 A;  4X3T A;  2J4X A;  2BH8 A;  4DV5 Q;  1PFB A;  1EWI A;  1X65 A;  4LF5 Q;  3M7N A;  1N32 Q;  3SGI A;  4DR3 Q;  1JR0 D;  3ERS X;  3ZJY C;  1OXU A;  5ELD A;  4GOP A;  4EX5 A;  1LYL A;  3KJP A;  1NUC A;  2V4D A;  4C3J G;  2LXK A;  1CI3 M;  1GUT A;  3JAM E;  1MI2 A;  5J1Z A;  1VQO A;  4L5R C;  3K7A B;  2SEB D;  1G51 A;  4A3G G;  2BDO A;  4XQJ A;  4DV7 L;  1Q8I A;  2E5L L;  4DN4 M;  3HZX A;  1YHQ A;  1DJR D;  1QJO A;  4LF4 L;  4DV7 Q;  3N6R A;  4R4C A;  1Q1E A;  4XYQ A;  4LUV A;  3G4S A;  1MBY A;  2K5H A;  1D5M C;  1VQN A;  2K5W A;  4IPH A;  4DAP A;  4B3T L;  3HOX B;  4CJ2 C;  1F2M A;  1LUZ A;  1TY0 A;  4LF4 Q;  1SJH D;  1ZYR C;  2AUK A;  1EOT A;  1K8O A;  5DAU A;  3S15 B;  4B3T Q;  3K7A H;  2IWH A;  3CCJ A;  2N3S A;  1TS4 A;  1Y1W B;  1G6Z A;  4GOP C;  1SYD A;  2Z6B A;  1K3R A;  2NZH A;  3S1N B;  2O4X A;  3MAQ A;  4PMW A;  5EQ0 A;  4A3C H;  5C4X G;  1SNP A;  1O7Y A;  3E0E A;  1OXV A;  3NTH A;  2FMM A;  1TVX A;  3HOX H;  3SDZ A;  1VQJ A;  2NTT A;  4LK1 C;  4J6H A;  1VQM A;  1RHP A;  3GTQ B;  3S17 B;  1TS3 A;  3S15 H;  1HA6 A;  3A54 A;  4F87 A;  3HG9 A;  4DK1 A;  1PH4 A;  4X64 L;  1Y1W H;  4A3B B;  4HN7 A;  5E4W C;  1CKN B;  4J15 A;  5JEA G;  4WRD A;  3CCL A;  3S1N H;  2D0P A;  1SYG A;  4X64 Q;  4IFD J;  2OWO A;  3T4A C;  2HQL A;  2O5I C;  5IGG A;  4UY8 C;  1PLF A;  3BDC A;  1R4P B;  5C0X H;  1Z9F A;  3GTQ H;  1LTR D;  5C4H A;  3S17 H;  3J7Y W;  5FJ8 G;  2B2V A;  3CC4 A;  3KK7 A;  4A3B H;  4RKL A;  3FKI B;  5JEA J;  2EY2 A;  4DGZ A;  2F0G A;  2PW5 A;  3DEP A;  3A5U A;  3OIQ A;  4DU9 A;  2CQA A;  1B53 A;  4RCO A;  1EIF A;  2NVX B;  1S40 A;  4B3S Q;  1CHP D;  3P20 A;  3RN5 A;  3U9S A;  5IP9 H;  2R7Z B;  2C5C A;  4N9T A;  4OIJ A;  1I4G A;  4KD4 A;  1JE5 A;  4ZYS A;  5K36 G;  2P5Z X;  1D8L A;  1UAP A;  5ELB A;  2NVQ B;  1LTS D;  3M4Y A;  3HOY B;  1NJI C;  3FKI H;  2F0P A;  4QUC A;  1ONL A;  2R93 H;  3EN2 A;  2DUD A;  3LX0 A;  4R4T A;  2B2V C;  3EJI A;  1VMP A;  3BDO A;  3J81 c;  4CKB A;  2NVX H;  5F2D A;  3GTO B;  4DPG A;  2F1M A;  2K75 A;  3KUP A;  2R7Z H;  3RLF A;  4JI8 L;  5CMD A;  4NKL A;  4OL7 A;  4GKK L;  3HGB A;  4LFA L;  3A74 A;  2NVQ H;  4NDX A;  1UUP A;  1PRT F;  2E2J B;  3HOY H;  3CCS A;  1B3A A;  4G4K A;  4JI8 Q;  5IE8 A;  1B8A A;  4GKK Q;  1RCV D;  3J81 E;  1SSO A;  2XWB B;  5BN5 A;  1ASY A;  1ASZ A;  3BVG A;  4LFA Q;  2EYL A;  2FHT A;  3KF6 B;  3A5Z B;  1G2T A;  4ZK9 B;  3RR5 A;  4HJ5 A;  2CCZ A;  3FVQ A;  1C7Y A;  2UUB Q;  4M1U B;  1SE4 A;  4L8J A;  5HUR A;  5C5M A;  3R3O A;  3URY A;  1EY0 A;  2FIN B;  3OMG A;  2EXD A;  1TS2 A;  2EDG A;  1KIX A;  1VQL A;  4O0A A;  3VR3 A;  2TSS A;  1L1O A;  1X3P A;  1BKB A;  4BBR B;  4A3D G;  1I5F A;  2OT2 A;  2EJG C;  2V1C C;  4RKB A;  2E2J H;  4JI6 L;  1X55 A;  1VQ5 A;  3VA7 A;  2H4O A;  2DN8 A;  1D1I A;  3NSW A;  4GNX B;  3PO3 G;  4OWW B;  4JI6 Q;  5C3E B;  1HXY D;  4J8Q A;  1HNZ L;  4DR6 L;  1NE3 A;  3FPU B;  1S5B D;  2A73 B;  1P16 A;  1II3 A;  1HNZ Q;  5M9O A;  4DR6 Q;  4BBR H;  4OWX B;  3OWE B;  1SYC A;  1DM0 B;  3BZK A;  3MA2 B;  5KYL A;  3PF5 A;  1E7Z A;  4JG2 A;  3GTG H;  3J80 L;  1EFW A;  1E2V A;  5E3F A;  3C1F A;  4IZ8 A;  5C3E H;  4DF7 A;  1NTG A;  1PH5 A;  4NP5 A;  1DXM A;  4XQQ A;  2GVB A;  2UXB Q;  1A8V A;  1QNK A;  1K8A C;  3GTJ B;  2K52 A;  1A15 A;  2N55 A;  3TQY A;  3HKZ G;  2PYK A;  3HFZ B;  2RQX A;  3FRP B;  2F03 A;  3HOW G;  1CQF A;  2QW7 A;  1BBX C;  4LFB L;  1K83 B;  2JA5 B;  4UP8 A;  2UUA L;  2ZJR A;  5M5X H;  4A3E G;  5FO7 B;  4LFB Q;  2UUA Q;  2WKC A;  3E9I A;  1TS5 A;  3MXP A;  4IUV A;  4XQN A;  3GTJ H;  4A4I A;  3U50 C;  5BN3 A;  5CGK A;  2HDM A;  3AB9 A;  1BBU A;  1TXY A;  2GA4 B;  5GAG C;  3NBH A;  1TWC B;  1PXU A;  2I07 B;  3EVQ A;  4E6I A;  1J5E L;  2DY7 A;  1EYG A;  3I70 A;  1Y8P B;  1K83 H;  4GOP B;  1EYD A;  2JA5 H;  2R92 B;  2QEX A;  1RDP D;  1J5E Q;  4K5X A;  2NTS A;  4O2D A;  4KD3 A;  4X3S A;  5CR3 A;  5BN4 A;  1EYC A;  2ZT9 C;  1HZ9 A;  2Q2I A;  3W1B A;  4C3I G;  4YY3 Q;  1KHI A;  4ZKB B;  1TWC H;  4YWL A;  2R7D A;  3NK9 A;  5IOC A;  1SYF A;  1BF4 A;  2VQE L;  2JN4 A;  1LTB D;  2K1B A;  1A2T A;  5I9O A;  2R6G A;  1UE1 A;  2R92 H;  3C1E A;  4X65 L;  2CKZ B;  2EY5 A;  1SJE D;  5KEE A;  3ICE A;  2F3W A;  5M3M B;  3HOZ B;  1X54 A;  1RD9 D;  3IFT A;  3KDF A;  4ILW A;  1FYC A;  1MJE A;  4HCS A;  3E9H A;  5EBD A;  1HUM A;  2QGQ A;  3ER0 A;  3TP8 A;  4PMC A;  5FKA C;  1IHZ A;  4DNT B;  4CDC C;  2ZXO A;  4EQP A;  4C3H B;  5CYU A;  2N78 A;  4DXG A;  1HCZ A;  2HHH L;  1C0A A;  1EIG A;  1A2U A;  1J9O A;  1I4H A;  1PYB A;  5AFW A;  2B8F A;  3NHH A;  4IJH A;  4YHH L;  2HHH Q;  5M3M H;  3CCE A;  3HOZ H;  1EY6 A;  2K04 A;  1WFQ A;  1SBB B;  3K5O A;  4WJ3 M;  1S5D D;  2EJF C;  3TS0 A;  4YHH Q;  2Q2U A;  3PIO 3;  2Z4H A;  4KY6 A;  3ONA B;  1ZKO A;  2WAC A;  1V9P A;  4P2C B;  5EPJ A;  3WOE A;  1N9W A;  4C3H H;  2EVB A;  3I56 A;  1WVL A;  1QIL A;  4YCW A;  1XTC D;  5FLM G;  1BQQ T;  5M3F G;  5L37 A;  4A3L G;  1FNV A;  4B9X A;  4ULL A;  1X6O A;  5IGC A;  1ENC A;  1GHJ A;  4R4O A;  3S9W A;  3J7Z C;  5J39 A;  3PMF A;  4R1J A;  3K57 A;  1O7L A;  2XGT A;  3HS0 C;  1OXT A;  1YIJ A;  1O78 A;  4WOR A;  3V96 A;  4ZAI A;  1WD0 A;  4OX9 L;  1CSP A;  5CV8 A;  4DAY A;  1Z6H A;  1H95 A;  1U5K A;  1PMR A;  1B1Z A;  1SNQ A;  1QZG A;  2EY6 A;  4OON A;  3F2C A;  1PH6 A;  2HD3 A;  1RL2 A;  2VXW A;  1RTN A;  1ZYR D;  3PSI A;  1DZ1 A;  5AJ3 L;  4XTC S;  3QIA A;  1EEI D;  1LAB A;  2NUC A;  4JOI A;  1U4M A;  2KBN A;  2VS1 A;  1LAC A;  1N36 L;  1WTW A;  2EYF A;  2WAQ E;  1JJ2 A;  3I4N B;  4HCE A;  5AJ3 Q;  1AZP A;  1JOQ A;  1JC7 A;  2H1E A;  1N36 Q;  2JA6 B;  3W2D A;  1TY2 A;  3BZC A;  4GS3 A;  1TWF B;  4K8J A;  1I4Q A;  2KED A;  4P71 A;  5IGB A;  1XPR A;  4GN5 A;  2F3I A;  2D5D A;  2A69 D;  2PO4 A;  4LJZ C;  2D0O A;  3Q24 A;  5JVH 3;  2VL6 A;  4LWC A;  2VUM G;  4BXX H;  1B70 B;  1PH2 A;  4DFA A;  4GLA C;  1EU4 A;  4POF A;  1JQY D;  4MN3 A;  2JA6 H;  3GTP H;  5CBE E;  1EZ6 A;  1TWF H;  4FDB A;  5EBC A;  2ID0 A;  4JOI C;  4BS9 A;  4HID A;  4DR4 Q;  1W6J A;  5KNC A;  1I6H B;  2RHQ B;  3NTI A;  3HOV B;  1Z47 A;  5IYC H;  3R2I A;  4A3F B;  1XYI A;  1J8I A;  1UE5 A;  4MHE A;  2F4V L;  3D8G A;  2MGS A;  2Y0S E;  2ATW A;  4R9W A;  1VQA A;  2GN5 A;  5CV6 A;  2F4V Q;  1I3Q B;  4CGY B;  3L0O A;  2IJ0 A;  3NEM A;  4ZUI A;  3CF5 A;  1PH7 A;  2MPM A;  2KEN A;  4A93 B;  4MTK A;  2B2U C;  3PIP A;  3A7A B;  4FP5 D;  3SHL A;  4XIG S;  1I6H H;  3HOV H;  4O1N A;  3PIO A;  2L1B A;  3H3V I;  3PUW A;  4A3F H;  1JJG A;  3IFD A;  1C8C A;  4IJL A;  3TP6 A;  3T1H L;  1KRT A;  1LTA D;  2Z0S A;  1VQ4 A;  1I3Q H;  2L15 A;  3I73 A;  5HGT A;  3T1H Q;  3BVM A;  4A93 H;  4HJ8 A;  3GP7 A;  3H94 A;  2G9D A;  4EQO A;  2WB1 E;  4B3R Q;  2EZV A;  3S1R B;  3BS1 A;  2JE6 I;  1QWY A;  1BBW A;  4KHV A;  4AYB G;  4RHS A;  4QY7 A;  4XDX A;  1YNJ D;  4J1M A;  1FL0 A;  3D0F A;  1K28 A;  1HNW L;  1ESF A;  2XN9 C;  1ICW A;  4LFC L;  1H9J A;  2D2C C;  5JVG 3;  1HTP A;  5GRO A;  1PH9 A;  3OW7 A;  1DGS A;  1G91 A;  2XRS D;  4HJ9 A;  5IWA L;  3G71 A;  1HNW Q;  1JIC A;  2AMC B;  4LFC Q;  5C0X J;  1AP0 A;  1TR5 A;  3S24 A;  1FVI A;  3KOJ A;  1CTM A;  1Z7T A;  3S1R H;  4OEM B;  3BYY B;  5IWA Q;  3J7A F;  3PV0 A;  5COR A;  3UE1 A;  1PZK D;  5C5L A;  1VQD A;  2SDF A;  4DR7 Q;  2QEJ C;  5FLX c;  3TP5 A;  2F52 A;  1GUN A;  2ZM6 L;  5EJW A;  5IYD G;  5I2Y A;  1LT4 D;  2ZM6 Q;  3D4R A;  3VYS A;  4RG1 A;  1UEB A;  1YJ9 A;  2E2H B;  3ULL A;  4CDF C;  4OO1 H;  4IFD I;  5FLX E;  1D1K A;  2NWG A;  2JA7 G;  3KBX A;  4DK6 C;  1V1O A;  3STB D;  3HOY G;  5BR8 L;  2A68 C;  4CBV A;  1CFM A;  4PZ7 A;  2IT1 A;  2X69 A;  5E4X A;  3W5O A;  1XPU A;  4NW2 A;  3TZU A;  5BR8 Q;  5LL6 X;  2E2D C;  1OO9 B;  1PH8 A;  1X3E A;  4APV A;  2PZW A;  3RUZ A;  3O13 A;  1NCV A;  2ALY B;  2E2H H;  4ME3 A;  3TS2 A;  3KDF B;  3TBI B;  2DNE A;  3NQT A;  5IGF A;  1VQI A;  1HR0 Q;  1LV9 A;  2BCO A;  2WB1 G;  1PRT C;  1HNX L;  2CH4 W;  1WTQ A;  2TMP A;  3V05 A;  3BVZ A;  2B63 B;  4LF5 L;  1GOZ A;  4X3K A;  4DR3 L;  1HNX Q;  3I91 A;  4PZ8 A;  4C1N K;  2NYZ D;  3VYU A;  3J80 E;  5GAE C;  2MQH A;  4CJ0 B;  1MHW C;  2JSO A;  2NN6 G;  1PZJ D; 
#chains in the Genus database with same CATH homology
 4A3M H;  1Y1W G;  1GD7 A;  3HOY H;  3UDF A;  1HZA A;  3L7Z C;  2JK8 A;  3J81 i;  3CCS A;  4JI8 Q;  4QL5 A;  5IE8 A;  1B8A A;  4GKK Q;  3HOW H;  4GN4 B;  1GKH A;  2VQE Q;  5C4J H;  2CFM A;  4LFA Q;  1ASY A;  3KF6 B;  1ASZ A;  4BY1 G;  3A5Z B;  2CCZ A;  3RR5 A;  4HJ5 A;  3FHW A;  1C7Y A;  2B63 H;  2UUB Q;  4B3R L;  3AYH B;  4X65 Q;  3CPW A;  1Q86 C;  1PVO A;  4GLX A;  4A76 A;  4A3E H;  4LUO A;  2IY5 B;  3MEF A;  4OO1 G;  2IHE A;  5C0X G;  1KRS A;  2EXD A;  1YJW A;  1S72 A;  1KIX A;  3CCR A;  1AE2 A;  4Y52 H;  1VQL A;  4O0A A;  3CPF A;  1L1O A;  2K5N A;  3AFP A;  3NEN A;  3UE0 A;  3CP0 A;  1BKB A;  4P73 A;  4DAY B;  2MO0 A;  2N8N A;  3DLL A;  3KYH C;  1I5F A;  4A3D G;  2UXD L;  4P74 A;  3OYY A;  2V1C C;  3UDI A;  2E2J H;  4A3B G;  4JI6 L;  1X55 A;  1J6Q A;  1VQ5 A;  1O7I A;  2JA8 H;  1K73 C;  1HR0 W;  2UXD Q;  3GD7 A;  3PUX A;  2MO1 A;  1IBK L;  4GNX B;  3PO3 G;  2HIV A;  2NVQ H;  4OWW B;  3CME A;  4JI6 Q;  1R9T H;  1CSQ A;  2OTL A;  1HNZ L;  1SRU A;  4KHP L;  1GVP A;  4DR6 L;  1AH9 A;  3UDG A;  2MNA A;  1Y14 B;  1SRO A;  1IBK Q;  2OQ0 A;  1NE3 A;  4DV4 L;  1XNR L;  4IFD G;  5IP9 G;  3BU2 A;  1P16 A;  2A19 A;  1E24 A;  2I5L X;  1HNZ Q;  1LTL A;  1XTD A;  4DR7 L;  4KHP Q;  4C3I H;  4DR6 Q;  1UE7 A;  2RF4 A;  4BBR H;  4P72 A;  1QUQ B;  4OWX B;  1XNR Q;  2GVA A;  3KF6 A;  4DV4 Q;  2JQO A;  4JI0 L;  3FKI G;  3BZK A;  4AQY L;  2K4K A;  4AH6 A;  3PF5 A;  2ZTE A;  4DKA C;  3NBH B;  5LMN Q;  3NEL A;  1E7Z A;  4JG2 A;  3J7A 5;  3GTG H;  2R93 G;  1EFW A;  2B29 A;  5JJK A;  1VQH A;  4JI0 Q;  4AQY Q;  4BA1 I;  5C3E H;  2XTI A;  1PH5 A;  1NTG A;  3PO2 H;  2K14 A;  2PQA B;  3LGJ A;  1SFO H;  3M4O H;  3K7U C;  3M85 A;  2GVB A;  1VQ7 A;  4LF6 L;  3PF4 A;  2UXB Q;  5JJL A;  1A8V A;  2R7Z G;  1K8A C;  1CKO A;  3UDX A;  1WI5 A;  2K52 A;  4UP7 A;  4OX9 Q;  2AWN A;  2VY3 A;  1OXS C;  3TQY A;  4DV3 L;  1PV4 A;  3HKZ G;  4JV5 L;  1SN8 A;  4IPD A;  4LF6 Q;  2EQS A;  1PFS A;  4A3M G;  3EIV A;  3CCU A;  2ES2 A;  4GNX A;  4C2M H;  3HOZ H;  1YBY A;  1YEZ A;  3HFZ B;  3HOW G;  2C35 B;  3VDY A;  1P8L A;  3J81 j;  4DV3 Q;  4LFB L;  4JV5 Q;  4DV1 L;  4LNQ A;  3EBE A;  2B63 G;  4UP8 A;  2NVY H;  4X66 L;  2UUA L;  1C9O A;  2ZJR A;  2UUC L;  4JBM A;  1KQS A;  5M5X H;  4A3E G;  3MXN B;  2VZA A;  4B3S L;  4LFB Q;  4DV1 Q;  1FJG L;  5IP7 H;  1B7Y B;  3CCV A;  4X66 Q;  2BH2 A;  1L2F A;  5GAH C;  3E9I A;  2QA4 A;  2UUA Q;  2UUC Q;  1HR0 L;  5M5Y H;  2VNU D;  3GTJ H;  4A4I A;  3U50 C;  2Q2H A;  2A8V A;  2YTY A;  3RZO H;  5GAG C;  1BBU A;  1TXY A;  1Q81 C;  4DV0 L;  1FJG Q;  1G6P A;  3GTM H;  1PYS B;  2CQO A;  1J5E L;  1EYG A;  4UP9 A;  4NPS A;  4IO9 A;  2JA8 G;  5FLM H;  1E1T A;  3CAM A;  5M3F H;  5M3M G;  4JI2 L;  3J80 c;  4YCU A;  1L0W A;  4DV0 Q;  1K83 H;  4GOP B;  4A3L H;  2JA5 H;  2PQA A;  2QEX A;  1LM0 A;  3CD6 A;  1J5E Q;  3I4N H;  1V1Q A;  2CWA A;  4JI3 L;  1W2B A;  4POG A;  4QIW E;  2JJQ A;  4O2D A;  3HKZ E;  4JI2 Q;  4L5T A;  4OWT B;  4R4Q A;  4A75 A;  5LMN W;  1S3O A;  4JI3 Q;  1HZ9 A;  3S14 H;  2Q2I A;  3W1B A;  4DK3 C;  1GM5 A;  1PH1 A;  1N34 L;  4YY3 Q;  4BBR G;  1EQR A;  1Q1B A;  1KHI A;  1VQB A;  1TWC H;  4YWL A;  4A3J H;  2R7D A;  1M1K C;  4DUY L;  1EQQ A;  2H5X A;  1XMO L;  2I5H A;  2VQE L;  1N34 Q;  4LF9 L;  3M3Y H;  1CKM A;  2K5V A;  4B3M L;  4GKJ L;  2R6G A;  4H02 A;  2LXJ A;  1UE1 A;  3U4Z A;  2UUB L;  2R92 H;  4X65 L;  4DUY Q;  1JMC A;  1OXX K;  2CKZ B;  3G48 A;  5C3E G;  1XMO Q;  1M90 C;  3ICE A;  4LF9 Q;  4NXM L;  3PO2 G;  1JT8 A;  1X54 A;  4B3M Q;  4GKJ Q;  3F1Z A;  3KDF A;  1Y1V H;  3GO5 A;  3PGZ A;  3K80 C;  1MJE A;  4DR1 L;  4JI4 Q;  1U0L A;  4PZ6 A;  4BBS H;  1VQE A;  5H1S E;  4DV6 L;  4A3I H;  3E9H A;  4AIM A;  4NXM Q;  5IYB H;  1X9N A;  2QGQ A;  3ER0 A;  4BY7 H;  1K0R A;  4X6A H;  4KI0 A;  4DR1 Q;  3PUZ A;  4HIM A;  1VQK A;  1YJN A;  2N78 A;  2IX0 A;  2IX1 A;  1A63 A;  2KCM A;  4DV6 Q;  2HHH L;  1C0A A;  4NXN L;  3FP9 A;  3K81 C;  1SMX A;  1WOC A;  2AKW B;  1PYB A;  3JC6 6;  1K8G A;  4MZ9 A;  4YHH L;  4IJH A;  2HHH Q;  1SR3 A;  2JA9 A;  4IPC A;  1YHA A;  5M3M H;  1MJC A;  3CCE A;  4DV2 L;  4A3K H;  4TQU S;  4TVA B;  4NXN Q;  2VUM H;  3CMA A;  1YZ6 A;  2IHF A;  5IP7 G;  1WFQ A;  5DLQ E;  4WJ3 M;  3H0G H;  4QJF A;  1TWG H;  3TS0 A;  4YHH Q;  1UWV A;  4A93 G;  4KHZ A;  2Q2U A;  5IT9 c;  4DV2 Q;  1IBM L;  2NVT H;  4LUZ A;  2E5L Q;  1V9P A;  4RMF A;  2WAQ G;  3CCQ A;  3CC7 A;  1N9W A;  4C3H H;  3I56 A;  4JBK A;  3BJU A;  4YCW A;  5LMN L;  5FLM G;  1NMG A;  1IBM Q;  2NN6 I;  5M3F G;  4A3L G;  1E22 A;  2JA5 G;  4ALP A;  2BA0 A;  2A1A A;  3S1M H;  4WJ4 A;  3I4N G;  1X6O A;  3OW2 A;  5EAY A;  2PNH A;  4R4O A;  3J7Z C;  1PHJ A;  2N49 A;  3WWV A;  4R1J A;  2UXB L;  1L1O C;  4QQB X;  3Q8D A;  2XGT A;  1OTC A;  1OXT A;  1YIJ A;  5HY6 A;  2KHI A;  4JBW A;  2WFW A;  4OX9 L;  1CSP A;  3I2Z A;  1AE3 A;  3D31 A;  3K0X A;  1YIT A;  1NBW A;  1KD1 C;  3RLO A;  1H95 A;  4LF7 L;  4A3J G;  1U5K A;  1IZ6 A;  1QZG A;  2HIX A;  2YTX A;  4OON A;  4Y7N H;  3F2C A;  1PH6 A;  1RL2 A;  4PG3 A;  3AEV A;  2UXC L;  3PCO B;  4HJ7 A;  1VQG A;  4JCV E;  3DM3 A;  3PSI A;  4LF7 Q;  2R92 G;  5AJ3 L;  4XTC S;  3I4O A;  2YYZ A;  1MIU A;  2PMZ E;  2VW9 A;  2YU9 H;  4IOA A;  4JOI A;  4K0K L;  2KBN A;  2RHS B;  2VS1 A;  4C3J H;  2HT1 A;  1N36 L;  1PH3 A;  2UXC Q;  2WP8 J;  4MNO A;  2WAQ E;  3W1G A;  1WJJ A;  1JJ2 A;  3I4M H;  1Y1V G;  5AJ3 Q;  1T9H A;  4A3G H;  1QVC A;  3H15 A;  4K0K Q;  4BBS G;  2ZJP A;  1Q8K A;  4A3I G;  4MTN A;  1N36 Q;  5IYB G;  2Y0S G;  3BZC A;  4GS3 A;  4BY7 G;  1QUQ A;  2RCN A;  1EIY B;  4P71 A;  2ZJQ A;  4UPA A;  1Q7Y C;  3K8A A;  1XPR A;  4GN5 A;  2AHO B;  3ULJ A;  2F3I A;  1YI2 A;  5JJI A;  4EQ5 A;  5GAD C;  3F2B A;  2OTJ A;  1NMF A;  3T1Y L;  3AQQ A;  2D0O A;  2PI2 E;  1SLJ A;  4KLK A;  5ELN A;  5GQO A;  1D7Q A;  3TRE A;  3HOZ G;  4L5Q A;  4A3K G;  2VL6 A;  4LWC A;  2VUM G;  4BXX H;  1I94 L;  5IY0 A;  1XJV A;  1E3P A;  1B70 B;  1Q46 A;  1G29 1;  1X56 A;  3HKS A;  4JC0 A;  1XMQ L;  1PH2 A;  3H0G G;  4GLA C;  5ELO A;  3T1Y Q;  4POF A;  2Q2T A;  4YY3 L;  2JA6 H;  4GNX C;  3GTP H;  1TWF H;  3RLN A;  4FDB A;  1I94 Q;  2ID0 A;  4JOI C;  1XMQ Q;  4DR4 Q;  4HID A;  3CCM A;  3KFU A;  5C4X H;  5C44 H;  1IXR A;  3U58 A;  3HOU H;  3RZD H;  3S2H H;  3TEH B;  2RHQ B;  4YWM A;  4YWK A;  5M5W H;  3CXC A;  3TRZ A;  1NY4 A;  1Z47 A;  5IYC H;  3RN2 A;  1SE8 A;  2UU9 L;  1JJC B;  1UE5 A;  4IOC A;  3ULP A;  2F4V L;  3S2D H;  2CWP A;  4JI1 Q;  2Y0S E;  1WCM H;  4R4I A;  2ATW A;  4JI4 L;  1VQA A;  4HIO A;  2GN5 A;  4DAM A;  2UU9 Q;  3RNU A;  4DV5 L;  2F4V Q;  1N32 L;  1HH2 P;  2FXQ A;  3L0O A;  3NEM A;  2PI2 A;  1YHB A;  3JAM c;  2KEN A;  3CF5 A;  1PH7 A;  1A62 A;  3PIP A;  4JYA L;  5IYD H;  1XPO A;  1A0I A;  4DV5 Q;  2BH8 A;  3M7N A;  1JB7 A;  1EWI A;  1X65 A;  4XIG S;  4LF5 Q;  1I6H H;  3SGI A;  4DR3 Q;  2E2I H;  3HOV H;  1N32 Q;  3PIO A;  3ERS X;  3ZJY C;  1EUJ A;  3PUV A;  1V43 A;  1IL2 A;  3H3V I;  1OXU A;  4GOP A;  4JYA Q;  3PUW A;  4EX5 A;  2AWO A;  2OQK A;  1LYL A;  3JAM i;  3KJP A;  4A3F H;  2JA7 H;  2R7F A;  1JJG A;  1IYJ B;  2LXK A;  4IJL A;  4YCV A;  5FJ8 H;  3T1H L;  1VQO A;  1RIP A;  4L5R C;  3I4M G;  2YTV A;  3AFQ A;  1G51 A;  5E7N A;  1KAW A;  1KRT A;  4A3G G;  1VQ9 A;  2Z0S A;  4DV7 L;  1VQ4 A;  1I3Q H;  2L15 A;  3B6Y A;  2YV5 A;  1VQ6 A;  3T1H Q;  2E5L L;  4A93 H;  4HJ8 A;  1BVS A;  3I7F A;  1YHQ A;  4LF4 L;  3GTO H;  4DV7 Q;  1TWH H;  2WB1 E;  1VQ8 A;  4B3R Q;  4R4C A;  1Q1E A;  4LUV A;  4P75 A;  3G4S A;  3CW2 C;  4JI5 L;  2K5H A;  4LF8 L;  2JE6 I;  1VQN A;  4IPH A;  4B3T L;  1BBW A;  1KL9 A;  1W3S A;  1HJP A;  4AYB G;  3H3V H;  1LUZ A;  4LF4 Q;  4QY7 A;  1CUK A;  1WYD A;  4DUZ L;  1I50 H;  4LF8 Q;  1HZC A;  3KJO A;  4JI5 Q;  1FL0 A;  3D0F A;  1QZH A;  4B3T Q;  3M9B A;  3K7A H;  4BXX G;  1HNW L;  4LFC L;  1FGU A;  3CCJ A;  2N3S A;  1VQP A;  2KHJ A;  4DUZ Q;  5GRO A;  1PH9 A;  1DGS A;  4GOP C;  4L5S A;  2JA6 G;  4HJ9 A;  5HGQ A;  1K3R A;  2NZH A;  5IWA L;  3G71 A;  1HNW Q;  2AMC B;  4LFC Q;  5C0X J;  1E1O A;  2Z6K A;  4PMW A;  3S24 A;  1FVI A;  3KOJ A;  5LMU L;  5C44 G;  4A3C H;  5C4X G;  3HOU G;  3E0E A;  1OXV A;  1VCI A;  3S1R H;  4OO1 I;  5IYC G;  5IWA Q;  5C0X I;  3HOX H;  1VQJ A;  2DGY A;  3STB C;  5LMU Q;  2K50 A;  3PV0 A;  2E8G A;  1VQM A;  3A0J A;  3UE1 A;  2VQF L;  1WCM G;  1X3G A;  1YVC A;  4OXP A;  1VQD A;  3I55 A;  1QVF A;  2JEA I;  3S15 H;  4DR7 Q;  1PH4 A;  3KF8 B;  5FLX c;  4X64 L;  3KLW A;  2F52 A;  1Y1W H;  2ZM6 L;  1HZB A;  1CKN B;  4J15 A;  5JEA G;  2VQF Q;  1YNX A;  3S16 H;  3CCL A;  3S1N H;  2BA1 A;  4AYB E;  2D0P A;  4BY1 H;  5IYD G;  4X64 Q;  1PA6 A;  2OWO A;  1TWA H;  3OTO L;  2ZM6 Q;  4IFD J;  4RG1 A;  3U4V A;  1UE6 A;  2HQL A;  1UEB A;  1YJ9 A;  2JEB I;  3HOV G;  1VQC A;  3GTL H;  3ULL A;  4UY8 C;  4IFD I;  1N8R C;  4A3F G;  4BA2 I;  2JA7 G;  3OTO Q;  1Z9F A;  4X62 L;  4DK6 C;  3GTQ H;  3STB D;  3HOY G;  3S17 H;  2Z6K C;  5BR8 L;  5FJ8 G;  4LW1 A;  4DR2 L;  4A3D H;  2B3G A;  1MKH A;  4PZ7 A;  2KCT A;  3CC4 A;  2NZO A;  2IT1 A;  3PUY A;  5JEA J;  4X62 Q;  4GLV B;  3W5O A;  4A3B H;  1XPU A;  2I0Q A;  5BR8 Q;  2MFI A;  4DR4 L;  4DR2 Q;  3A5U A;  1PH8 A;  1X3E A;  4APV A;  3PO3 H;  1KC8 C;  2ZTD A;  3GDE A;  3M4Q A;  2ALY B;  3M4P A;  2E2H H;  1X3F A;  4ME3 A;  1EIF A;  3TS2 A;  2OCE A;  3KDF B;  1S40 A;  4B3S Q;  3CC2 A;  1VS0 A;  3RN5 A;  5IP9 H;  5J3B A;  4JI1 L;  1VQI A;  1HR0 Q;  3IRB A;  1CKN A;  1JE5 A;  5K36 G;  3CQZ H;  1D8L A;  4JBJ A;  3L2P A;  1IBL L;  4QGU A;  2I5M X;  2WB1 G;  4DR5 L;  1NJI C;  3FKI H;  1GO3 E;  1K9M C;  1L1O B;  3G6E A;  1HNX L;  1N33 L;  4JI7 L;  2R93 H;  1IBL Q;  3EN2 A;  1Q82 C;  2ASB A;  4A3C G;  1XNQ L;  4GN3 B;  1VQF A;  4DNI A;  2DUD A;  2LSS A;  4DR5 Q;  4LF5 L;  1QVG A;  3F8T A;  4HIK A;  4R4T A;  4DR3 L;  1HNX Q;  3GTK H;  4PZ8 A;  3J80 i;  1EOV A;  1N33 Q;  4IPG A;  4JI7 Q;  3J81 c;  3HOX G;  2D62 A;  2NVX H;  3S1Q H;  4DPG A;  1XNQ Q;  2K75 A;  2ZTC A;  5GAE C;  2MQH A;  2R7Z H;  3RLF A;  3F2D A;  4JI8 L;  4GKK L;  2NN6 G;  2EIF A;  1KXL A;  1Q12 A;  4LFA L;  3A74 A;  4NB3 A;  4HJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...