4LFAL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaL00
2HQLA 3L7ZC 1XNQL 4JYAL 4HIMA 4UP9A 4QGUA 3T1HQ 1OXUA 1P8LA 1VQIA 1QVCA 5HGQA 4HJ9A 1E7ZA 4DR5L 1XJVA 4LF6L 2JA7G 3PO3H 2PNHA 1L0WA 5IE8A 1A0IA 3KDFA 3STBD 3CCJA 1YBYA 1X56A 3J81j 2BA1A 4DV5L 4JI8L 3PF5A 1R9TH 2I0QA 2JA5H 1FJGL 3H3VI 4B3RQ 1WCMH 1K73C 2N78A 1W2BA 1AH9A 4DK3C 2E5LL 2MNAA 4QY7A 3U50C 2Q2TA 3GTQH 1NMFA 1VS0A 2GVAA 2E2JH 4YWMA 4BXXG 3RZOH 1Q7YC 5C44H 4UPAA 4IOAA 1LM0A 4FDBA 1LTLA 2YTXA 1I94Q 2IX1A 4A3KG 1X55A 3AEVA 5HY6A 5IP7G 3L2PA 1KL9A 4AQYL 2E2IH 4NXNQ 2LXJA 2KENA 3I2ZA 4TVAB 4DR6L 2RCNA 2WFWA 3KF6B 2MQHA 1CSPA 3J7A5 4OO1G 2KCTA 4WJ4A 1MKHA 3BJUA 2D0OA 1K9MC 3HOZH 3OYYA 3U58A 4YY3L 4A3IG 2RHQB 5IYDG 5BR8L 3CMEA 2PI2A 3RN5A 3CAMA 2HHHQ 1PH5A 2UUCQ 1UE6A 2IY5B 1NMGA 3H0GG 3KJOA 3F2DA 4BA1I 1W3SA 3PUYA 1PH9A 4IPCA 1N33L 3PCOB 5C0XI 4YCWA 3NEMA 2IHEA 1S40A 4A3BH 4A3GH 4X66Q 2FXQA 1VQ4A 4BBRH 4JI6Q 3RZDH 4B3SL 2VUMG 4WJ3M 3J80i 4JI3L 1BKBA 2NN6G 4LF8Q 1AE3A 1L2FA 3K7UC 4A3MH 2XTIA 2I5HA 5JEAJ 1PA6A 2UUAQ 3JC66 3LGJA 1YHQA 1VQ9A 1C7YA 4MTNA 2K75A 2ZJPA 1MJCA 3HOYG 3B6YA 4DUZQ 2ZTDA 3PUXA 4DV2Q 3FP9A 2YYZA 4DUYL 3AQQA 3PUZA 4HJ7A 2OWOA 4DR3L 2KBNA 1YHAA 1RIPA 1S72A 1KC8C 4LFAL 1LYLA 3W1BA 3PO3G 2VS1A 3M4PA 3AYHB 3EN2A 4A3DH 1JJGA 4DR7Q 1QZGA 4JI4L 3H3VH 2JA5G 1PH2A 4P74A 1AE2A 5AJ3Q 1WCMG 2BH8A 4YHHL 2MFIA 2NVXH 2F3IA 4LF4Q 4L5SA 1WFQA 4GOPA 1SROA 4DV1Q 4JI0L 5JEAG 4BXXH 5LMUQ 2LXKA 2KHJA 2JJQA 3PIOA 4LFBQ 4IFDJ 4OX9L 4ME3A 5C44G 2CCZA 1CKNB 3E0EA 4LF5L 2B63H 1I6HH 1X3GA 2PQAA 4DPGA 1EYGA 3DLLA 2NVQH 3U4ZA 3G4SA 2Q2HA 3HOWH 2VQFQ 3OW2A 4X64L 1CUKA 1V43A 3TRZA 2ATWA 1VQFA 2QA4A 1A8VA 2KCMA 3ICEA 5JJKA 4BBSH 1HR0L 1E22A 3HOZG 2K50A 5M3MH 3I4NH 1SRUA 4GN5A 3FKIH 3A0JA 4DV0Q 3I56A 1XNRL 4JI7Q 3H0GH 4QIWE 3S1MH 2UXCQ 4OONA 4R4OA 3G48A 1Y1WH 3CC2A 1WJJA 5LMNL 4A3BG 4QL5A 4A3GG 4K0KQ 2UXDQ 4KLKA 4BBRG 4OWXB 2R7ZG 3CXCA 1IBLQ 1N32L 1KRTA 3OTOQ 2N3SA 2JQOA 2HIVA 3M4OH 1GKHA 1X9NA 4L5RC 1L1OC 1TWFH 4DR4L 4A3MG 2YTYA 3MXNB 4JV5Q 1E3PA 3M7NA 1VQLA 2JA8H 1VQEA 3RR5A 4DK6C 5GADC 4POFA 2F4VL 1L1OB 3AFPA 4QQBX 1X65A 3TQYA 4IPDA 4PMWA 3J81c 4DV3Q 4X65L 2AMCB 3CCLA 2WP8J 3S1NH 2GN5A 2A8VA 4DV4Q 3F8TA 2UUBL 4LFCL 4JI1L 2UU9L 3L0OA 4JC0A 1J5EL 4LUZA 1N36Q 4AYBG 5IYBH 4GKKQ 3CD6A 1WOCA 1P16A 4C3IH 3HOXH 1XNQQ 1XPRA 3GTMH 1K83H 2CWPA 2A1AA 3CC4A 3HKSA 4IJLA 2CFMA 1EIYB 2OQ0A 1IBMQ 4A3DG 3IRBA 3GTLH 1MIUA 1PH3A 4DR5Q 3CCUA 3CW2C 4LF6Q 4B3MQ 1UE7A 4DR2L 1SE8A 2JK8A 4DV5Q 1KRSA 3KFUA 4JI8Q 1FJGQ 4BY7G 3T1HL 4A76A 2BA0A 2K5NA 5GAGC 4GN3B 1TWAH 1I3QH 1U0LA 4PZ6A 1YHBA 1HNZL 4A3EH 1LUZA 2C35B 3ERSX 4C3JH 1VQ6A 4QJFA 3CCEA 1VQMA 4POGA 5GAHC 3ULPA 4A3JH 2B63G 3S14H 4IO9A 2D62A 4H02A 3H15A 1N34L 3HOWG 5C3EH 1Q82C 2AHOB 4RG1A 1IXRA 1NJIC 3PF4A 4NB3A 1HZBA 4P72A 1XMOL 4AQYQ 1C9OA 3EIVA 1HNXL 4BBSG 2UXBL 1D7QA 2VY3A 5M3MG 3I4NG 4JOIA 3HOVH 3FKIG 4DR6Q 1JE5A 1B8AA 1SMXA 1FGUA 5IWAQ 3G6EA 4KHZA 4YY3Q 4PG3A 1VQNA 4NXNL 4GN4B 5BR8Q 1Y1WG 3TREA 3UE0A 1I5FA 1Z9FA 2K5VA 3RLOA 5C0XG 2VW9A 4X62L 2R7ZH 3D31A 3GD7A 2E2HH 3CPWA 3HKZG 3CPFA 3AFQA 1NE3A 1N33Q 4P73A 3A5ZB 1S3OA 5J3BA 1E1OA 4LWCA 4OO1I 3S1RH 3S2DH 4MNOA 4DV7Q 1SR3A 2UUCL 4GKJL 4JI3Q 3UE1A 4JI5L 2JA8G 4NXMQ 3RNUA 1EUJA 4DAYB 5FLXc 1PYSB 1Y14B 2L15A 4X66L 2R93H 3UDXA 3GTOH 2K4KA 4IPHA 3J81i 1GM5A 2OTJA 1CKNA 4GLAC 4OXPA 3GTGH 3GTKH 4LF8L 3K80C 1YEZA 2RHSB 3CMAA 2V1CC 4DR1Q 4PZ8A 1G51A 5IYCH 1Q86C 1UE1A 2MO1A 5IYBG 1PH1A 3EBEA 3ER0A 3HOXG 1Z47A 4A93H 1DGSA 4DR3Q 3ULJA 1PHJA 1VQ5A 4TQUS 3GTPH 4LFAQ 1HZCA 1PFSA 1WI5A 1OTCA 1FL0A 3E9HA 2LSSA 3KOJA 3TEHB 4A3LH 1VQKA 3K8AA 4EQ5A 4JI4Q 4BY7H 1VQAA 4UY8C 3S2HH 4RMFA 3S24A 1KIXA 4OWWB 1HJPA 4YWKA 4DKAC 1V1QA 5M5YH 4HIDA 4GNXC 2ID0A 2JA6H 4A3EG 1XMQQ 1KXLA 1N8RC 1XPOA 2Y0SG 2NZHA 3K7AH 1IBKL 4JI0Q 1PH8A 3Q8DA 4GNXB 4A3JG 4L5QA 3ULLA 1EFWA 2I5LX 4LF5Q 2WB1E 5C3EG 4UP8A 1X3EA 1EWIA 2B3GA 2IT1A 2KHIA 4O0AA 1L1OA 4J15A 1M90C 5LMUL 3M9BA 1G291 3RLNA 4LFBL 4JYAQ 2RF4A 4X64Q 1Y1VH 1HNWL 1TXYA 3F2BA 2IX0A 1JMCA 4YCVA 3HOVG 3SGIA 1XPUA 1SN8A 4LF9Q 1HR0Q 4JBMA 1VCIA 4HIOA 3S1QH 4IPGA 4JG2A 1XNRQ 4AYBE 3TS2A 2OQKA 4JCVE 3T1YQ 2CQOA 4JI2L 3HOUH 4DV6L 1JT8A 2EQSA 3F1ZA 4KHPL 4JI7L 2R6GA 5LMNQ 2WB1G 2VQEQ 3D0FA 1HR0W 1N32Q 3I4MH 4LF7L 1EOVA 2DGYA 3RLFA 4MZ9A 4B3TL 5IP9H 1NTGA 1PH4A 2B29A 2CKZB 3GTJH 1VQJA 2K14A 4DR4Q 5IT9c 2UXDL 1HH2P 2CWAA 2R93G 2N49A 1YJ9A 1HZAA 1IBLL 4R4TA 3BZCA 4BY1G 3HFZB 5LMNW 1QVFA 2A19A 2EXDA 1QZHA 2AWNA 5IYCG 4C3HH 3ZJYC 2UUBQ 4LFCQ 2ZM6L 1B7YB 2DUDA 3I7FA 3KF6A 3STBC 2UU9Q 1IYJB 4P71A 1QUQB 1V9PA 3BZKA 3PGZA 3JAMc 4R4QA 4A93G 1T9HA 3M85A 1YNXA 4OWTB 1VQCA 2I5MX 1VQ8A 2ES2A 4Y52H 1BBUA 4X6AH 2VZAA 3S16H 4DV4L 5C0XJ 1YITA 5C4JH 2R7DA 4R1JA 2D0PA 1E1TA 4A3LG 1VQDA 3RN2A 5K36G 4GKKL 1PVOA 5M5WH 1X6OA 1VQHA 2Z6KC 4YWLA 3VDYA 4HJ8A 4DR2Q 1VQOA 2E5LQ 1HZ9A 3BU2A 2JA6G 1E24A 4HJAA 4AH6A 3CF5A 1EQQA 1IBML 4B3RL 3HKZE 1HNZQ 1CSQA 3PUWA 1OXXK 4B3ML 1X3FA 1KHIA 1VQBA 5GROA 3PIPA 2PMZE 5ELOA 4A4IA 2E8GA 1GO3E 3GO5A 2ZJRA 1PH7A 5JJIA 4GLVB 5IY0A 1H95A 4P75A 1N34Q 3K0XA 5FLMH 4KI0A 1I94L 5JJLA 1Y1VG 3CP0A 2QGQA 2ZTCA 3PV0A 5M3FH 1XMOQ 2JEBI 1VQGA 1HNXQ 2UXBQ 1G6PA 1D8LA 3KYHC 5C4XH 1ASZA 1YI2A 4R4IA 2XGTA 1SFOH 2YV5A 2ZTEA 1Q12A 4YCUA 4A3CH 3HOUG 3NELA 2JA9A 2GVBA 2VNUD 3E9IA 2NVYH 4KHPQ 2N8NA 1UE5A 4B3SQ 3KDFB 1I50H 4O2DA 4X62Q 2YTVA 4IOCA 1Q1BA 5IWAL 2HHHL 3CCRA 2WAQE 1K8GA 4UP7A 4JBKA 3I4MG 4DNIA 4AIMA 1PV4A 4A75A 4R4CA 4EX5A 3UDIA 2ALYB 5FJ8H 1CKOA 1U5KA 2OCEA 4LUVA 5IP9G 4JI6L 2Q2IA 4GS3A 1X54A 1Q46A 5GAEC 4JI5Q 4GKJQ 1NY4A 4BY1H 4JBWA 2Y0SE 3K81C 2K52A 4GNXA 4Y7NH 4GLXA 1VQ7A 2F52A 1CKMA 1TWHH 4LW1A 4DV7L 3S15H 2UUAL 2NN6I 2R92H 1A62A 1O7IA 4NXML 4DUYQ 4HJ5A 1WYDA 4A3FH 2QEXA 3JAMi 1UWVA 4DUZL 4JOIC 3U4VA 4DV2L 3PO2H 2WAQG 1XTDA 4LUOA 1RL2A 2HIXA 1SLJA 5M5XH 2ZJQA 3PSIA 3CQZH 4DR1L 1KD1C 2K5HA 4PZ7A 2AWOA 3G71A 1C0AA 4YHHQ 1OXTA 3PUVA 3TS0A 4DR7L 4C2MH 4JBJA 3A5UA 2JA7H 3W5OA 1QVGA 2HT1A 2PI2E 3UDGA 5AJ3L 1JB7A 3I4OA 1YIJA 1M1KC 4OX9Q 3CCMA 4XTCS 5EAYA 1A63A 4LF4L 1IBKQ 1KAWA 1J6QA 1OXSC 4DV1L 3M4QA 2JE6I 1YJNA 3F2CA 1XMQL 3CCVA 5FLMG 1PYBA 4XIGS 4ALPA 2EIFA 3CCSA 2AKWB 1BBWA 2R7FA 5M3FG 1OXVA 1ASYA 3I55A 2VQFL 3KF8B 4A3KH 3S17H 3MEFA 3KJPA 2Q2UA 1HNWQ 5C4XG 3J7ZC 5IP7H 1BVSA 5DLQE 4L5TA 1QUQA 1GVPA 4A3CG 5GQOA 2IHFA 4DV0L 1Q8KA 3GDEA 1FVIA 4HIKA 1KQSA 2NZOA 4JI2Q 4IFDI 2UXCL 4LNQA 1N9WA 1MJEA 4LF9L 4DV6Q 2MO0A 4A3IH 2OTLA 2YU9H 5IYDH 1TWCH 4GOPC 1JJCB 1B70B 3UDFA 1EIFA 3M3YH 5FJ8G 2VL6A 1K3RA 1YZ6A 3T1YL 1VQPA 4K0KL 1IL2A 1Q1EA 4LF7Q 4GOPB 4B3TQ 1TWGH 3KLWA 3OTOL 1YVCA 2H5XA 2JEAI 1K0RA 3A74A 1UEBA 5H1SE 3J80c 2Z6KA 2VUMH 4X65Q 4JV5L 2VQEL 1JJ2A 2PQAB 4APVA 4DAMA 1EQRA 4JI1Q 3DM3A 4IJHA 5ELNA 2R92G 1J5EQ 1YJWA 3WWVA 4IFDG 2NVTH 1PH6A 4DV3L 4A3FG 2BH2A 1Q81C 3CC7A 3CCQA 4BA2I 2ZM6Q 3NBHB 3PO2G 1IZ6A 2F4VQ 3HOYH 3FHWA 3NENA 2ASBA 4NPSA 2Z0SA 5E7NA 1N36L 1K8AC 1GD7A 3W1GA 1NBWA
chains in the Genus database with same CATH superfamily
4HIMA 4K14A 3EVQA 3T1HQ 3FVQA 3I4MB 5A2QL 1QVCA 2JA7G 4LF6L 2F0GA 4HSVA 3KDFA 4I7AA 3DEPA 3J81j 5E3FA 1FJGL 4B3RQ 2GA4B 4ZQ3A 1V1OA 1A15A 1D6EC 2Q2TA 1QG7A 2BDOA 4B9XA 4IOAA 4XT3B 5C44H 1PMRA 3IFTA 5T1GA 4FDBA 1LTLA 1I94Q 3MEHA 4A3KG 1X55A 5HY6A 3HS0C 4AQYL 1K28A 4NXNQ 2KENA 3I2ZA 2MQHA 1ENCA 5M5WB 2KCTA 2N55A 3HOZH 4A3IG 2JN4A 4H13C 1LT5D 2PI2A 2BOSA 2D2CC 2EXZA 1ICWA 1PH5A 2UUCQ 1F2MA 1NMGA 4FF2A 3H0GG 1W3SA 4IPCA 4EQOA 4YCWA 3SXHA 2PQEA 3MXUA 3DM1A 5BN3A 4B3SL 1BKBA 3OWFA 4B9WA 1AE3A 3K7UC 2XTIA 4ZAIA 5C4HA 1YHQA 1VQ9A 1SE2A 1Z6HA 5C4XB 1TS4A 2L12A 3ZYYX 1SFOB 2M9VA 3FP9A 1NSNS 5J22A 4DR3L 1YHAA 3SDZA 1TKWB 4LFAL 1U9RA 2F0MA 4KY7A 3W1BA 1RKNA 2ICIA 5IT9E 3EN2A 3K5NA 1E0BA 4BS9A 1AE2A 3T56B 3MTSA 2XSCA 4L5SA 3S15B 4GOPA 4JI0L 5JEAG 2H4OA 3A7LA 3OPOA 1I6HH 1CKNB 4LF5L 2PQAA 3G6JB 1JWMD 3PO2B 2NVQH 2K03A 5FKAC 3U4ZA 3OW2A 2C5CA 2ATWA 2QA4A 1M8AA 5JJKA 3MHBA 4BBSH 1R4PB 2K50A 2K5QA 1PTOB 1XNRL 2F0OA 1PZKD 3H0GH 4QIWE 2JP1A 4LMQD 2MUYA 3WOFA 1N32L 3CXCA 1NR2A 2FJ2A 4OGQC 2HIVA 1V1PB 1L1OC 3MVVA 3MXNB 4JV5Q 4DFAA 1VQLA 5CV7A 4DA2A 1LABA 1W6JA 4IALA 4POFA 1EEFD 3TP6A 3TQYA 4PMWA 5C6AA 3J81c 4HCEA 2GN5A 2A8VA 1FR3A 3J7YW 4DAPA 2UU9L 1WTOA 4DXFA 4LK1C 4UDUC 1F2YA 1II3A 3SK8A 4JYAQ 2J4XA 2CWPA 4A3DG 3IRBA 3GTLH 1EY0A 2O5JC 3K5LA 4H0LC 5J39A 1WD1A 4DR2L 4DV5Q 3KFUA 3ND9A 3TZDA 4BY7G 3T1HL 2TMPA 2SEBD 2BA0A 4A76A 1TS2A 1LUZA 2H1EA 1QOHA 1FNWA 1VQMA 3IL8A 3ULPA 1G91A 2WV6D 3S14H 1Y69U 4H02A 2KVMA 1H9JA 1EZ6A 3EIVA 3BS1A 2WIIB 5M3MG 2PZWA 4DR6Q 2PYKA 5CR3A 1JE5A 1B8AA 1FGUA 4KHZA 4YY3Q 4NXNL 4K5XA 3VYUA 2JA5B 5C0XG 1I5FA 3SEBA 5I2XA 1D2BA 2B2YC 3CPWA 1CZWA 1BNZA 1A2TA 3MXGA 4OO1I 5EPKA 4DV7Q 2UUCL 1KABA 2E2JB 4JI3Q 2FHTA 1CA6A 3RNUA 3DWAA 1L0XB 3UDXA 2VB2X 1WTVA 3M4YA 4KN7C 4PQXA 3OHXC 3GTGH 2F0KA 5IYCH 1UE1A 2MO1A 2PCFB 3A7AB 3EFXD 3EBEA 4Z9CB 3ER0A 3P7JA 1Z47A 1DGSA 2L5TA 2EPBA 4DGZA 5EGTA 1VQ5A 5J1ZA 2SNSA 1HZCA 1PFSA 3E9HA 3KOJA 1VQKA 4ULLA 2SOBA 3NTKA 4BY7H 3D4RA 1SMYD 1XX8A 4RMFA 3S24A 2L9HA 4A3MB 1F9PA 1SAPA 2RA4A 1IBKL 4RCNA 4A3JG 2WB1E 1CI3M 2F0EA 5C3EG 1EWIA 1F9SA 4O0AA 2A74C 2BDNA 1G291 4X64Q 1RF2D 1Y1VH 2IX0A 4O1NA 3U9SA 1G2TA 4RWSC 2CQOA 3MWYW 3NXWA 3K59A 2A69D 4X3KA 1RCVD 4DF7A 2WB1G 1SXTA 1HR0W 3I4MH 1GUGA 4MZ9A 2B63B 1NTGA 2K01A 2K14A 4G7ZC 4DR4Q 4XQJA 1EIGA 1HH2P 1EY5A 1L0YB 3HOWB 1YJ9A 1HZAA 2PNRC 3BZCA 3DEOA 3HFZB 5LMNW 1QVFA 1E2ZA 4LFCQ 1B44D 4CKEA 3I7FA 4NMZA 2F4VL 4IFDI 1IYJB 2DN8A 4KJNA 5EPLA 3JAMc 3S1MB 1T9HA 2EE1A 4Y52H 1U4RA 2SNMA 1VQ8A 1BBUA 1SYDA 2VZAA 1EY7A 3R93A 4A3LG 1TVXA 1Q8IA 2L4NA 4HMJA 5M5WH 3M4OB 4HJ8A 3SK4A 3BU2A 4HJAA 1HA6A 4JVZA 4AH6A 3CF5A 1EQQA 3NUCA 1HTLD 3PUWA 1PLFA 1KHIA 1STYA 2PMZE 4A4IA 2HDLA 1GO3E 2ZJRA 1I4QA 5IY0A 4KMUC 4P75A 1EL0A 3P20A 4KKUA 5JJLA 3E3XA 1XMOQ 3BVMA 1NR4A 5C4XH 2NZ1D 2F4IA 2F0TA 1SFOH 2JA9A 2GVBA 2EJMA 3T16A 4KHPQ 1Y8NB 5EKIA 1GUOA 1TWAB 4IOCA 3C3LA 2Y0SB 2Z1CA 1AN8A 2ALYB 2CHBD 1U5KA 2OCEA 3CRLC 1I4HA 1IHZA 2K52A 1RDPD 1CKMA 4LW1A 3SR1A 4DV7L 3S15H 2UUAL 4C1NI 2E74C 4HJ5A 2CVRA 3NK9A 2QEXA 3AB9A 4JOIC 3U4VA 3PO2H 5CGKA 1NNXA 2R7ZB 1KDAA 3PSIA 4K2LA 1O7LA 1PFNA 1DJRD 2RVLA 3SE0A 4YHHQ 3PIO3 1OXTA 5ELDA 5JVH3 3PUVA 3S2DB 1PTOH 3K5MA 4JBJA 3A5UA 1QVGA 3S9WA 2HT1A 5BN4A 3KK7A 2PI2E 4MN3A 3UDGA 1JB7A 1XTCD 1KNEA 3RD4A 3J81E 4OX9Q 1BCPC 4JPBW 3CCMA 3RUZA 2PPBC 3GTOB 1OXSC 4CDFC 2OEOA 3SK6A 3NSWA 4DV1L 1ZYRD 3K58A 1LT6D 3GTKB 3M4QA 1SNDA 5FLMG 1BR9A 1U4MA 2EIFA 2R61A 3CHBD 1GOZA 2R7FA 3D6WA 3I55A 2VQFL 3EQLC 1B3AA 1HNWQ 2Q2UA 3J7ZC 5IP7H 1F9QA 1BVSA 5DLQE 4L5TA 1QUQA 2NUCA 3LWEA 1BQQT 5GQOA 4A3CG 1SJHD 4DV0L 3SVMA 4RA8A 1FVIA 4JI2Q 3P75A 1N9WA 5L37A 1MJEA 2JA6B 4DV6Q 4RHRA 1I6HB 4GOPC 3K7AB 5CBAE 1EIFA 2FINB 3OIPA 5FJ8G 1YZ6A 3Q6SA 4KKTA 3OTOL 3O13A 5H1SE 1UEBA 2VUMH 1ILQA 1MI2A 2NTTA 4QF4A 2KEEA 4DAMA 3DM3A 1C4QA 2B2VA 4IJHA 1J5EQ 5M9OA 4DV3L 4JK1C 5C3WA 5DM63 3S1QB 3W3AA 2ZM6Q 4NPSA 2M00A 1F2LA 3HKZB 5E7NA 3TZUA 1N36L 1K8AC 4X3SA 4XYQA 3L7ZC 4UP9A 3I3CA 2RBMA 1VQIA 4HJ9A 1E7ZA 1L0WA 5IE8A 1DCZA 1A0IA 1FNUA 1YBYA 1X56A 3PF5A 3BDOA 4JI8L 3J80L 2JA5H 2F0VA 1ILPA 4QUFA 1K73C 2NWGA 4QY7A 3U50C 4G57A 2E2JH 4BXXG 1JORA 1Q7YC 2PO4A 1LM0A 2D9UA 2YTXA 1BOSA 3J81L 3L2PA 3HRZC 2LXJA 4TVAB 2AQ3B 4ZRZA 3BVGA 1PFBA 1DZ1A 4OO1G 3J7A5 1CSPA 3L3OC 3BYYB 3BJUA 1EYAA 2D0OA 1K9MC 3OYYA 2RHQB 5EQ0A 2I07B 3RN5A 3CAMA 1RD9D 4L8JA 2HHHQ 1UE6A 3S14B 2IY5B 4RKBA 3KUPA 3KJOA 2LMCB 1ONLA 1N33L 1BBXC 5C0XI 1QCBD 4KHPL 2EYHA 4X66Q 4WJ3M 4JI6Q 2B2TA 2KEDA 4A3MH 3NBIA 5JEAJ 1KLGD 1EYDA 3FDTA 3JC66 4N8X1 4MTNA 2K75A 4V190 3DWQA 3HOYG 3D8GA 5CV4A 3FRPB 3KF8A 4DV2Q 2YYZA 3VYSA 3AQQA 2F3WA 2OWOA 4K6DA 1VF5C 1S72A 1RIPA 1LYLA 3V05A 2VS1A 3AYHB 4RFBA 4JI4L 1O7YA 3H3VH 4P74A 4BY1B 5AJ3Q 2BH8A 4YHHL 4CDDC 1BO0A 1C8CA 1TWHB 4MHEA 4LF4Q 1PRTC 2XWBB 1SROA 4BXXH 3JAME 3PIOA 1DOLA 3I70A 4OX9L 4ME3A 2MJ8A 5C44G 2K1BA 4A3FB 2B63H 3TSSA 1QB5D 4E6IA 3DLLA 3HOWH 1CUKA 4QIWB 1LTTD 1VQFA 3ICEA 1HR0L 3HOZG 4S3SA 3A0JA 4JI7Q 2UXCQ 3S1MH 4OONA 5G3LD 1WJJA 5LMNL 4K0KQ 1AZQA 1ESRA 2R7ZG 1IBLQ 2N3SA 4K2KA 3IAYA 1Y1VB 3M4OH 1GKHA 3SK5A 1TWFH 2YTYA 3A8IE 4XXEA 3M7NA 3NQTA 5T1IA 3RR5A 5GADC 2EY6A 3D4DA 1L1OB 1TY0A 1NCVA 1CFMA 4IPDA 5JPNC 4DV4Q 2UUBL 4TSSA 3L0OA 1J5EL 4LUZA 1JOOA 1E2WA 2XRSD 5I6WA 3FEWX 4AYBG 5IYBH 1UEAB 2K7VA 3CD6A 4QUCA 1XNQQ 3HG9A 1WTXA 1K83H 3PIP3 2CFMA 1EIYB 2QF7A 2VXWA 1X32A 1PH3A 4DR5Q 1JQYD 3CW2C 4B3MQ 1UE7A 3DHQA 1SE8A 2JK8A 2HD3A 1B53A 1AEXA 1B3QA 1TWAH 1U0LA 1KTKA 1YHBA 4MTKA 4PZ6A 1EQVA 4A3EH 3N52A 3ERSX 1VQ6A 4KJOA 1RTNA 4QJFA 4POGA 4FVMA 1HTPA 1CZGA 1K8OA 3H15A 2XIWA 2V4DA 1Q82C 2AHOB 3AU7A 1NJIC 1GHJA 5AFWA 2K32A 4NB3A 1HZBA 1QNKA 4P72A 1TT2A 5CV9A 4BBSG 2UXBL 4JOIA 3PO3B 2DJFC 2K05A 2FFKB 1VQNA 4GN4B 5BR8Q 1R9TB 3UE0A 1WCMB 2R7ZH 5IODA 4RHSA 3HKZG 3NPPA 4MIUA 3GTQB 3S2DH 1SR3A 4GKJL 4JI5L 2MP1A 1BCPF 1PYSB 2L15A 4X66L 3GTOH 2QILA 5JVG3 3VR4A 1ET6A 4IPHA 3GTKH 1UNSA 1EY9A 4PZ8A 5E4WC 4RGMA 4IUQA 1SJED 1WTQA 4OIKA 1PH1A 4ABNA 2G5DA 2A68C 4HR7B 2QCPX 1ZYRC 2PZTA 4WORA 3C1FA 4A3BB 3K8AA 4EQ5A 3RZDB 5JOBA 4OWWB 1KIXA 1MSGA 1U4LA 4DKAC 2JA6H 1KXLA 3K7AH 2IPKD 2FMMA 4L5QA 3ULLA 1EFWA 3VA5A 1BCPD 1B50A 1S5BD 1KDCA 4I65A 3TN2A 1PFMA 4UP8A 1X3EA 2B3GA 2KHIA 3R3OA 4IUUA 4J15A 2HQEA 2E2DC 1K8MA 4RKLA 2EY2A 2F0UA 4YCVA 1SN8A 1I4XA 3TP8A 1HRJA 1VCIA 3S1QH 4JG2A 2PW5A 3TDQA 1SNMA 4RGTA 1DOKA 2EQSA 4JI7L 2R6GA 1LTID 2HCCA 2VQEQ 4DNTB 1EOTA 2DGYA 1RHPA 5IP9H 2CKZB 1XWEA 2Q8TA 2XNAC 1IBLL 1HUNA 1GUNA 4BY1G 4FXGC 2AWNA 4H7BA 5C3XA 5IYCG 3I4NB 3ZJYC 3FKIB 2DUDA 3KF6A 4HEDA 3K6OA 1CA5A 1R4QB 4R4QA 1IL8A 4OWTB 2XRQD 3M85A 2ES2A 2X6LA 2WKCA 1BUVT 3E5SA 1Y1WB 4X6AH 4DV4L 1YITA 2VUMB 2R7DA 4R1JA 5ELFA 1PVOA 2K04A 3VDYA 1VQOA 1HZ9A 1NUCA 2JA8B 4B3RL 5IT9L 2B2VC 1CSQA 1HNZQ 1FNVA 4B3ML 5IGBA 3PIPA 2E8GA 1PH7A 5JJIA 4KV6A 1B1ZA 3QJYA 1JCKB 2KECA 1N34Q 1CM9A 1I94L 1STBA 5FO7B 1Y1VG 4C3IB 5M3FH 3HOXB 1U4PA 1VQGA 1HNXQ 2KOLA 1CHPD 1D8LA 1SNCA 2XGTA 4WJWA 2O5IC 1STEA 4YCUA 3NELA 2F0QA 3E9IA 2E75C 2N8NA 2B39A 1UE5A 3KDFB 1I50H 3PQIA 1I3QB 2YTVA 4X62Q 1Q1BA 1K8GA 3I4MG 4DNIA 4QCLA 1VMCA 4R4CA 4EX5A 1WTWA 4LUVA 4Q5VA 4CBVA 1CT1D 1H9MA 3MFGA 3VYTA 5EBDA 4BY1H 3K81C 3NTIA 4GNXA 2L11A 4Y7NH 1VQ7A 2F52A 1D1IA 1TWHH 4OHJA 1JOQA 4DUYQ 2Z4HA 3HOVB 1WYDA 1S5CD 4A3FH 2EYJA 1SE3A 2RKSA 4LUOA 3I91A 3A54A 1SLJA 3HEJA 1KD1C 2QEJC 3S1RB 2B2TC 4G7OC 5CC4A 2O2LD 3I4OA 4WRDA 2R93B 1YNNC 3X3MA 1J6QA 1BCPB 4XQQA 2JE6I 5EBCA 3CCVA 1SNOA 1PRTD 2KCNA 1PYBA 1RJTA 5E1FA 3DUZA 2AKWB 1BBWA 4A93B 4NDXA 2EY1A 3GTPB 5C4XG 1D5MC 4KTAA 3HP3A 3GDEA 1IYVA 4DK0A 4HIKA 3J7AV 2AQ2B 5M5YB 2LFNA 4CDEC 2OTLA 5IYDH 2MPMA 2L1BA 2IX3A 3NHHA 1VQPA 4LF7Q 4GOPB 4B3TQ 3PMFA 2Z6KA 2F1MA 4X65Q 3K57A 2VQEL 4JV5L 2KQ3A 2NN6H 2PQAB 4APVA 4G7HC 1EQRA 1TU2B 1YJWA 3WWVA 5DM73 2AQ1B 1PH6A 1WD0A 5FO9B 2B2WC 2BH2A 2B2UA 3CC7A 4BA2I 4IQZA 3PO2G 1S5FD 1IZ6A 3NENA 3D4WA 2HDMA 4FXKC 2TSSA 3L9AX 3K0YA 4H44C 2ASBA 3HOUB 1CHQD 4QQBX 3KLSA 2HQLA 1HFNA 4NW2A 4JYAL 1TWFB 4QGUA 3GP7A 3NWSA 1P8LA 5HGQA 2DY7A 3PO3H 4XT1B 2PNHA 5HGTA 2F03A 3GTJB 3CCJA 4DV5L 2I0QA 1R9TH 4FYDA 4RGNA 4DAYA 1WCMH 3QR8A 5CV8A 3OIQA 2MNAA 3A8KE 3GTQH 4C3HB 1NMFA 1VS0A 1K83B 4CJ0B 3HZXA 5I2YA 4HMIA 4EQPA 2IX1A 4EGVA 2F0WA 5IP7G 2WAQB 3BVZA 1KL9A 2A6EC 1Y8OB 1HQRD 3VR3A 4DR6L 1VF7A 2RCNA 2WFWA 3KF6B 4WJ4A 4A3EB 3I72A 3TP7A 5EPJA 4JW0A 3QO2A 2OT2A 4YY3L 4LAAA 1GHKA 3CMEA 1V8QA 2ENBA 1H9SA 5JPMC 3F2DA 4BA1I 3PUYA 3PCOB 3NEMA 4A3BH 4A3GH 2FXQA 3K5OA 4I7ZC 4BBRH 3RZDH 2VUMG 3J80i 4JI3L 1IW7D 3H6MA 1IKLA 1CK1A 3E6ZX 1L2FA 5CBEE 1EY8A 4IUTA 3LGJA 1LT4D 2ZJPA 1GUWA 2A73B 1SNPA 3NP8A 1EIHA 3A55A 4DUZQ 4J6HA 3PUXA 1K3BC 4DUYL 1T5XD 1KC8C 4C3IG 1B4OA 5DAUA 4N9TA 1JJGA 4DR7Q 1QZGA 2Z4IA 2A68D 1DD2A 2JA5G 5CV6A 2ZT9C 2F0FA 2QKIC 2F3IA 4N9PA 4UHVA 3G7LA 2JSOA 2R92B 3J7AF 1O80A 4LFBQ 4IFDJ 2CCZA 1X3GA 4DPGA 1SYGA 1EYGA 3G4SA 1EYCA 2Q2HA 3H94A 5M5XB 2VB3X 5EKLA 4X64L 1V43A 1TS5A 2KCMA 3NBHA 4TRDA 3I4NH 3FKIH 4C2MB 2JA7B 1DM0B 5JJZA 5KGUA 3G48A 2KCCA 4GZYC 1Y1WH 3CC2A 1O78A 4K5VA 2UXDQ 4ZLTF 4OWXB 1KRTA 4L5RC 1X9NA 4DR4L 4A3MG 2JA8H 4DK6C 4A3KB 3S17B 1DXMA 2BE5C 2CH4A 3AFPA 4R9WA 3CRKC 3IFDA 2G9DA 4X65L 2WP8J 4QMGA 3F8TA 2J7ZA 4LFCL 4A3IB 2YU9B 1P16A 1TWCB 4C3IH 3HOXH 1PDQA 4KK7A 1WTPA 1XPRA 2A1AA 3HKSA 3M3YB 2OQ0A 1IBMQ 4WFN3 3CCUA 4LF6Q 2RDHA 4OELB 4FXDA 4C56C 3D6CA 3KLSX 1FJGQ 1LTBD 1Y8PB 3P1HA 4IUVA 5GAGC 1I3QH 1HCZA 1EWHA 4C3JH 2NVTB 2F0NA 2B63G 4IO9A 1G6ZA 2D62A 1EU3A 1S4ZA 2EYOA 3HOWG 3NWTA 4RG1A 1IXRA 4ZYSA 4YIJA 3PF4A 2EYLA 2P5ZX 1I4GA 4K8JA 2QDBA 1XMOL 4AQYQ 1HPCA 1C9OA 5IGGA 2VY3A 4B08A 1A3UA 3HOVH 1KDBA 2EZVA 1SMXA 1X3PA 3OWEB 4PG3A 1TY2A 5KYLA 3I8ZA 3TREA 1PXUA 2EOTA 1Z9FA 2K5VA 3VA7A 2VW9A 3TBIB 3D31A 4O42A 4ZUJA 2DY8A 4P73A 1ICFB 1EY6A 3A5ZB 1E1OA 4LWCA 3S1RH 1BDOA 4MNOA 5M3FB 2IL8A 1STHA 5DNFA 3RZOB 2G9HD 1D1KA 4NXMQ 4DAYB 5FLXc 4IN3A 1Y14B 2NB0A 1HQMC 2R93H 5IGDA 2K4KA 2E2IB 1CKNA 4GLAC 4OXPA 1IKMA 3K80C 1I50B 2RHSB 3CMAA 2V1CC 5KNBA 1Q86C 5IYBG 1EZ8A 2QDLA 5A2QE 4NP5A 5G3LF 5LL6S 3OMCA 4A93H 4DR3Q 2X69A 3GTPH 4LFAQ 1WI5A 1SBBB 1OTCA 1FL0A 2XN9C 4Y7NB 4G4KA 1BXTA 1VQAA 1LT3D 4K6LA 1FYCA 4GNXC 1V1QA 5M5YH 4RGOS 4A3EG 2ZXOA 1N8RC 1XPOA 2Y0SG 1ZKOA 1ML0D 4JI0Q 3Q8DA 4PV1C 1V1PA 4FP5D 1VDZA 4LF5Q 2SDFA 1YNND 5KIXA 1M90C 4LFBL 2B2WA 1HNWL 1TXYA 1JMCA 4KN4C 3SGIA 4LF9Q 4JBMA 4A3DB 1KAAA 4HIOA 3QG1A 1HA5A 1XNRQ 1PZJD 1EU4A 3X3NA 4AYBE 3TS2A 4JI2L 4UAIA 4KHVA 3HOUH 1MHWC 2NVXB 4DV6L 1Z7TA 4LJZC 5D14A 3F1ZA 2K28A 1PTOD 3D0FA 3HGBA 1X3QA 1N32Q 3RLFA 1I4PA 2B29A 2A6HC 3GTJH 3BG3A 2KHSA 2UXDL 3BDLA 2DNCA 2LS01 2IJ0A 2MHVA 2CH4W 2EXDA 1KNAA 4F8MA 3C46A 5M3MB 4C3HH 4CJ1B 2Z8LA 3KBXA 4ILWA 2ZM6L 1B7YB 2UU9Q 1SEBD 1QUQB 4P71A 3BZKA 1YNXA 2I5MX 3S16H 5C0XJ 4FF1A 1AW7A 1ZXTA 2D0PA 4IURA 4PMBA 3D3RA 2O4XA 1X6OA 1VQHA 2Z6KC 4DR2Q 2K5WA 2E5LQ 2JA6G 1IBML 5C4ZA 1AZPA 3HKZE 5FO8B 1LLRD 3H09A 1OXXK 4ZKBB 3UI2A 1VQBA 2I46A 5GROA 1G2SA 2B2UC 3GO5A 5CYUA 3SHLA 3S1NB 4L63B 1H95A 1TR5A 3K0XA 4HN7A 4KI0A 2F0DA 3CP0A 3JAML 3DMUA 2KJXA 3GTMB 2JEBI 3DXJC 1XYIA 1QWYA 1HFGA 1G6PA 4M8AA 3KYHC 4R4IA 3Q23A 4F88A 1Q12A 2A6ED 1IW7C 2DNEA 2HHHL 1PYWD 1SNQA 3CCRA 4UP7A 4AIMA 1RODA 4A75A 5IP9G 3UDIA 4A3JB 4U68A 4JI6L 4GS3A 1Q3LA 1X54A 2Q2IA 5ELEA 5C3EB 2OF1A 3BZDB 3ND8A 3URYA 4GLXA 2NYZD 4L6TB 1WVLA 2R92H 1A62A 1O7IA 3A8JE 5I9PA 4NXML 4ODGA 4IFDH 1TQOA 1FGBD 2KA7A 1UWVA 4DV2L 4A3GB 4BBRB 5M5XH 1RL2A 2HIXA 2E2HB 2AWOA 3G71A 4C1NK 2WB1B 3TS0A 3EA6A 4C2MH 2JA7H 3RMHA 4U673 3W5OA 2ZXPA 4F87A 5AJ3L 3R2TA 1YIJA 4XTCS 1I4RA 4OIJA 1A63A 4LF4L 1IBKQ 1KAWA 4HSPA 4FF3A 1YJNA 4QB4A 5NUCA 2F0SA 4XIGS 4ALPA 3CCSA 2IW3A 4DAVA 5M3FG 4ZUIA 1MGSA 1QNUA 1LTGD 3KF8B 5KNDA 4A3KH 3MEFA 3KJPA 3S17H 1JE4A 4J8QA 4K8IA 1SYCA 2E76C 3QB3A 1GVPA 1M4VA 4P2CB 2IHFA 1I6VC 1Q8KA 3S2HB 1KQSA 2IWHA 2UXCL 4LF9L 2MO0A 4A3IH 2YU9H 3ONAB 1TWCH 1JJCB 1B70B 2LY7A 3M3YH 2VL6A 1K3RA 4K0KL 1IL2A 3KLWA 2H5XA 1UAPA 3J80c 1F77A 1CQFA 2LKVA 1JJ2A 4JI1Q 3Q24A 2NVTH 1CQVA 4A3FG 1EQTA 3W2DA 1Q81C 3CCQA 1J8IA 5K5PA 2F4VQ 1O7ZA 4IUPA 2BE5D 4FNFA 1EFID 1G8ZD 1UUPA 3FMCA 1DYQA 1S5DD 2JYOA 3W1GA 2RDFA 1XNQL 4CHTB 2PMZB 5EJWA 4KD4A 3KLRA 1GUTA 5FLXE 1OXUA 4DR5L 1XJVA 1ZEQX 1LTSD 3STBD 1YNJC 2BA1A 4ZK9B 3H3VI 5I6YA 2N78A 1W2BA 4XYOA 3QOJA 1AH9A 2CW0C 4DK3C 2E5LL 4PMCA 5JEAH 1HHVA 2GVAA 3A56A 4YWMA 2JXMB 2PZUA 3RZOH 4UPAA 4OL7A 1JICA 2K33A 1PZID 2WINB 1S5ED 3AEVA 1OO9B 5C4JB 3TMEA 2E2IH 3GV6A 2F0IA 2K6AA 3R8BA 1NAPA 1MKHA 1LV9A 5E4XA 4C3JB 3U58A 5IYDG 5BR8L 3R2IA 2FMCA 1PH9A 1QJOA 4ME5A 3VYRA 2B8GA 2IHEA 1S40A 1VQ4A 1PRTF 2AUJD 4KY5A 2B8FA 1D5XC 2NN6G 1JWUD 4LF8Q 3I73A 2I5HA 2EJFC 2EDGA 3OMGA 2J0TD 1PA6A 2UUAQ 3MZ5A 1C7YA 4M1UB 1T5EA 4IZ8A 1MJCA 2D5DA 3LX0A 3B6YA 5CORA 5CMDA 2ZTDA 2NVYB 3PUZA 4HJ7A 4DXGA 2KBNA 2BCOA 2DJGC 3PO3G 3M4PA 4A3DH 3FPPA 1PH2A 4ID6A 1WCMG 2NTSA 2C9OA 3GQBA 2MFIA 4KD3A 2NVXH 1E2VA 5F2DA 5FOBB 1WFQA 4DV1Q 1STNA 5LMUQ 2LXKA 2KHJA 4KY6A 2JJQA 5FLXL 1SYEA 3E0EA 5IGEA 2QW7A 3Q0AA 1F9RA 4ZKCB 1H9RA 2VQFQ 1A2UA 1STGA 3U9OA 5C5LA 4CKCA 3CQZB 5BN5A 3TRZA 1PTOC 1A8VA 1GXDC 1E22A 5M3MH 1K0SA 1SRUA 1GUSA 2MGSA 4GN5A 4DV0Q 3I56A 3AMUA 1D5ZC 5IIFA 4R4OA 1SE4A 4ZCKA 1XXGA 3DWPA 5C0XH 4RAUC 1B2TA 1LACA 4A3BG 4Q0FA 4QL5A 4A3GG 4KLKA 4BBRG 4RH6A 3OTOQ 3I90A 2EJGC 2JQOA 2RCFA 2KUMA 1AP0A 3BDCA 2ZXRA 1E3PA 2NBFA 1LO5D 1VQEA 2A6HD 3EROA 1X65A 4DV3Q 2EYMA 1A6XA 2AMCB 3CCLA 3S1NH 1MBYA 5HURA 4JI1L 4JC0A 1HUMA 1N36Q 4GKKQ 4XQNA 1WOCA 2Z6BA 3GTMH 3MC0B 3CC4A 4IJLA 4KKSA 2RDGA 1MIUA 1TWGB 4J1MA 5I9OA 1STAA 1KRSA 4JI8Q 5IGFA 1MD2D 3N6RA 2K5NA 4GN3B 1HNZL 1C48A 5KRUA 2C35B 2PW7A 3BYTB 3CCEA 1EEID 5GAHC 3T51B 4A3JH 3S16B 3HOYB 2R3ZA 1N34L 5C3EH 1JOKA 1B9MA 2N88A 5LL6X 1HNXL 2F0PA 5A35A 1D7QA 3I4NG 3FKIG 3QIAA 3G6EA 5IWAQ 3CKIB 2RSOA 5KNCA 1JB3A 2WACA 1Y1WG 3RLOA 4X62L 2Z9HA 3GD7A 2E2HH 3CPFA 1NE3A 3AFQA 3NE5B 1SSOA 1N33Q 1S3OA 5J3BA 4CGYB 2HUGA 4DN4M 4NKLA 3UE1A 5C44B 1ENFA 2JA8G 1EUJA 1TS3A 4X3UA 2HCIA 1GJXA 3J81i 1GM5A 2OTJA 1ET9A 1Q90A 4LF8L 1YEZA 1JR0D 4DR1Q 3HOZB 1G51A 3NTHA 4K5WA 1FD7D 3HOXG 3ULJA 5ELBA 1PHJA 4TQUS 4HCSA 3J80E 2LSSA 2XVSA 3TEHB 4A3LH 4JI4Q 4HAEA 4UY8C 3S2HH 5IOCA 1A3VA 2Q8IB 1HJPA 1VMPA 4YWKA 4TKOB 4HIDA 2ID0A 1XMQQ 1PRTB 4C3JG 2NZHA 1PH8A 1HXYD 4GNXB 1J9OA 1SDFA 3Q22A 2I5LX 3F2UA 4BWGB 2IT1A 5D65A 1L1OA 1QILA 3M9BA 5LMUL 3RLNA 2RF4A 1JC7A 4OEMB 4AYBB 3F2BA 3HOVG 3H3VC 1XPUA 4X3TA 1HR0Q 4EQNA 4IPGA 3MFYA 1LTRD 2OQKA 4JCVE 5DEHA 3T1YQ 1LTAD 1JT8A 5LMNQ 3KBGA 1DOMA 3NQIA 1TIID 5KEEA 1EOVA 4LF7L 4B3TL 1WTRA 2K5DA 4RCOA 1PH4A 1VQJA 2XWJB 4CKBA 4N8FA 5IT9c 2CWAA 2EY5A 2R93G 3V96A 2NVQB 2RQXA 2N49A 4R4TA 2A19A 1QZHA 5ISRA 3LWUA 4BBSB 2UUBQ 3IKJA 2CQAA 3M7GA 3OOCA 3STBC 1B9NA 1V9PA 2L0CA 3PGZA 3H0GB 4R8IA 4A93G 2F3VA 1VQCA 2F0HA 4CJ2C 4HTHA 1SYFA 5C4JH 5TSSA 1E1TA 4R8NA 1VQDA 3RN2A 5K36G 4GKKL 3C1EA 3E0JA 4FO2A 4YWLA 1E24A 2L55A 5KYIA 2M2LA 3LNNA 3OW7A 1BF4A 2B2YA 1X3FA 2ICEC 1YNJD 5ELOA 4GLVB 4DK1A 2Q8RE 2EVBA 5LHY1 2CW0D 5FLMH 4DNRB 2OXPA 1MSHA 2QGQA 2ZTCA 2F0JA 3PV0A 4IUNA 2F0LA 2UXBQ 5FK9C 3GTLB 4PNYA 1ASZA 1YI2A 1KLUD 4XDXA 2YV5A 2ZTEA 3C2PA 5IGCA 1IYUA 3HOUG 4A3CH 2VNUD 5D3DA 2NVYH 4B3SQ 4O2DA 3WDNA 5IWAL 2WAQE 1RTOA 4JBKA 1PV4A 3T13A 3QWNA 3T53B 1DONA 3VR5A 5FJ8H 1CKOA 4EVOA 3ERQA 4GKJQ 5GAEC 1Q46A 4JI5Q 4DU9A 1NY4A 4JBWA 2Y0SE 3GV3A 3MXPA 2NN6I 4C3HG 1EY4A 3TP5A 3JAMi 4DUZL 2AUKA 2X6GA 3ITPA 5I4DA 2WAQG 1XTDA 2ZJQA 3T4AC 5K36H 1PTOF 3CQZH 1CTMA 1QE6A 3I4LA 1SMYC 2K5HA 4PZ7A 5COYA 4DR1L 4FF4A 1C0AA 3VR6A 3CU7A 1H9SB 5EKKA 4DR7L 3QOLA 3H91A 5D3IB 1M1KC 3MXNA 5EAYA 3MAQA 1AFPA 3GTGB 3F2CA 1XMQL 2EYFA 1EWCA 1OXVA 1ASYA 1W6KA 3FPUB 5C5MA 3OSOA 3VR2A 4BY7B 2A69C 4OO1H 4CDCC 1WTHA 2NZOA 4V0BA 4LNQA 3V2TA 1ENAA 3WOEA 3EJIA 3UDFA 2WKDA 3T1YL 1JWSD 1SYBA 1Q1EA 1TWGH 1YVCA 2JEAI 1F2ZA 1K0RA 3A74A 5JAVA 1ESFA 2A5HA 5ELNA 2R92G 4IFDG 1A3TA 2EYPA 3MA2B 4F7XA 2RSNA 3NBHB 3HOYH 3FHWA 5CV5A 5ELCA 2Z0SA 1H9KA 1GD7A 1NBWA
chains in the Genus database with same CATH topology
2HQLA 3L7ZC 1XNQL 4JYAL 4HIMA 4UP9A 4QGUA 3T1HQ 1OXUA 1P8LA 1VQIA 1QVCA 5HGQA 4HJ9A 1E7ZA 4DR5L 1XJVA 4LF6L 2JA7G 3PO3H 2PNHA 1L0WA 5IE8A 1A0IA 3KDFA 3STBD 3CCJA 1YBYA 1X56A 3J81j 2BA1A 4DV5L 4JI8L 3PF5A 1R9TH 2I0QA 2JA5H 1FJGL 3H3VI 4B3RQ 1WCMH 1K73C 2N78A 1W2BA 1AH9A 4DK3C 2E5LL 2MNAA 4QY7A 3U50C 2Q2TA 3GTQH 1NMFA 1VS0A 2GVAA 2E2JH 4YWMA 4BXXG 3RZOH 1Q7YC 5C44H 4UPAA 4IOAA 1LM0A 4FDBA 1LTLA 2YTXA 1I94Q 2IX1A 4A3KG 1X55A 3AEVA 5HY6A 5IP7G 3L2PA 1KL9A 4AQYL 2E2IH 4NXNQ 2LXJA 2KENA 3I2ZA 4TVAB 4DR6L 2RCNA 2WFWA 3KF6B 2MQHA 1CSPA 3J7A5 4OO1G 2KCTA 4WJ4A 1MKHA 3BJUA 2D0OA 1K9MC 3HOZH 3OYYA 3U58A 4YY3L 4A3IG 2RHQB 5IYDG 5BR8L 3CMEA 2PI2A 3RN5A 3CAMA 2HHHQ 1PH5A 2UUCQ 1UE6A 2IY5B 1NMGA 3H0GG 3KJOA 3F2DA 4BA1I 1W3SA 3PUYA 1PH9A 4IPCA 1N33L 3PCOB 5C0XI 4YCWA 3NEMA 2IHEA 1S40A 4A3BH 4A3GH 4X66Q 2FXQA 1VQ4A 4BBRH 4JI6Q 3RZDH 4B3SL 2VUMG 4WJ3M 3J80i 4JI3L 1BKBA 2NN6G 4LF8Q 1AE3A 1L2FA 3K7UC 4A3MH 2XTIA 2I5HA 5JEAJ 1PA6A 2UUAQ 3JC66 3LGJA 1YHQA 1VQ9A 1C7YA 4MTNA 2K75A 2ZJPA 1MJCA 3HOYG 3B6YA 4DUZQ 2ZTDA 3PUXA 4DV2Q 3FP9A 2YYZA 4DUYL 3AQQA 3PUZA 4HJ7A 2OWOA 4DR3L 2KBNA 1YHAA 1RIPA 1S72A 1KC8C 4LFAL 1LYLA 3W1BA 3PO3G 2VS1A 3M4PA 3AYHB 3EN2A 4A3DH 1JJGA 4DR7Q 1QZGA 4JI4L 3H3VH 2JA5G 1PH2A 4P74A 1AE2A 5AJ3Q 1WCMG 2BH8A 4YHHL 2MFIA 2NVXH 2F3IA 4LF4Q 4L5SA 1WFQA 4GOPA 1SROA 4DV1Q 4JI0L 5JEAG 4BXXH 5LMUQ 2LXKA 2KHJA 2JJQA 3PIOA 4LFBQ 4IFDJ 4OX9L 4ME3A 5C44G 2CCZA 1CKNB 3E0EA 4LF5L 2B63H 1I6HH 1X3GA 2PQAA 4DPGA 1EYGA 3DLLA 2NVQH 3U4ZA 3G4SA 2Q2HA 3HOWH 2VQFQ 3OW2A 4X64L 1CUKA 1V43A 3TRZA 2ATWA 1VQFA 2QA4A 1A8VA 2KCMA 3ICEA 5JJKA 4BBSH 1HR0L 1E22A 3HOZG 2K50A 5M3MH 3I4NH 1SRUA 4GN5A 3FKIH 3A0JA 4DV0Q 3I56A 1XNRL 4JI7Q 3H0GH 4QIWE 3S1MH 2UXCQ 4OONA 4R4OA 3G48A 1Y1WH 3CC2A 1WJJA 5LMNL 4A3BG 4QL5A 4A3GG 4K0KQ 2UXDQ 4KLKA 4BBRG 4OWXB 2R7ZG 3CXCA 1IBLQ 1N32L 1KRTA 3OTOQ 2N3SA 2JQOA 2HIVA 3M4OH 1GKHA 1X9NA 4L5RC 1L1OC 1TWFH 4DR4L 4A3MG 2YTYA 3MXNB 4JV5Q 1E3PA 3M7NA 1VQLA 2JA8H 1VQEA 3RR5A 4DK6C 5GADC 4POFA 2F4VL 1L1OB 3AFPA 4QQBX 1X65A 3TQYA 4IPDA 4PMWA 3J81c 4DV3Q 4X65L 2AMCB 3CCLA 2WP8J 3S1NH 2GN5A 2A8VA 4DV4Q 3F8TA 2UUBL 4LFCL 4JI1L 2UU9L 3L0OA 4JC0A 1J5EL 4LUZA 1N36Q 4AYBG 5IYBH 4GKKQ 3CD6A 1WOCA 1P16A 4C3IH 3HOXH 1XNQQ 1XPRA 3GTMH 1K83H 2CWPA 2A1AA 3CC4A 3HKSA 4IJLA 2CFMA 1EIYB 2OQ0A 1IBMQ 4A3DG 3IRBA 3GTLH 1MIUA 1PH3A 4DR5Q 3CCUA 3CW2C 4LF6Q 4B3MQ 1UE7A 4DR2L 1SE8A 2JK8A 4DV5Q 1KRSA 3KFUA 4JI8Q 1FJGQ 4BY7G 3T1HL 4A76A 2BA0A 2K5NA 5GAGC 4GN3B 1TWAH 1I3QH 1U0LA 4PZ6A 1YHBA 1HNZL 4A3EH 1LUZA 2C35B 3ERSX 4C3JH 1VQ6A 4QJFA 3CCEA 1VQMA 4POGA 5GAHC 3ULPA 4A3JH 2B63G 3S14H 4IO9A 2D62A 4H02A 3H15A 1N34L 3HOWG 5C3EH 1Q82C 2AHOB 4RG1A 1IXRA 1NJIC 3PF4A 4NB3A 1HZBA 4P72A 1XMOL 4AQYQ 1C9OA 3EIVA 1HNXL 4BBSG 2UXBL 1D7QA 2VY3A 5M3MG 3I4NG 4JOIA 3HOVH 3FKIG 4DR6Q 1JE5A 1B8AA 1SMXA 1FGUA 5IWAQ 3G6EA 4KHZA 4YY3Q 4PG3A 1VQNA 4NXNL 4GN4B 5BR8Q 1Y1WG 3TREA 3UE0A 1I5FA 1Z9FA 2K5VA 3RLOA 5C0XG 2VW9A 4X62L 2R7ZH 3D31A 3GD7A 2E2HH 3CPWA 3HKZG 3CPFA 3AFQA 1NE3A 1N33Q 4P73A 3A5ZB 1S3OA 5J3BA 1E1OA 4LWCA 4OO1I 3S1RH 3S2DH 4MNOA 4DV7Q 1SR3A 2UUCL 4GKJL 4JI3Q 3UE1A 4JI5L 2JA8G 4NXMQ 3RNUA 1EUJA 4DAYB 5FLXc 1PYSB 1Y14B 2L15A 4X66L 2R93H 3UDXA 3GTOH 2K4KA 4IPHA 3J81i 1GM5A 2OTJA 1CKNA 4GLAC 4OXPA 3GTGH 3GTKH 4LF8L 3K80C 1YEZA 2RHSB 3CMAA 2V1CC 4DR1Q 4PZ8A 1G51A 5IYCH 1Q86C 1UE1A 2MO1A 5IYBG 1PH1A 3EBEA 3ER0A 3HOXG 1Z47A 4A93H 1DGSA 4DR3Q 3ULJA 1PHJA 1VQ5A 4TQUS 3GTPH 4LFAQ 1HZCA 1PFSA 1WI5A 1OTCA 1FL0A 3E9HA 2LSSA 3KOJA 3TEHB 4A3LH 1VQKA 3K8AA 4EQ5A 4JI4Q 4BY7H 1VQAA 4UY8C 3S2HH 4RMFA 3S24A 1KIXA 4OWWB 1HJPA 4YWKA 4DKAC 1V1QA 5M5YH 4HIDA 4GNXC 2ID0A 2JA6H 4A3EG 1XMQQ 1KXLA 1N8RC 1XPOA 2Y0SG 2NZHA 3K7AH 1IBKL 4JI0Q 1PH8A 3Q8DA 4GNXB 4A3JG 4L5QA 3ULLA 1EFWA 2I5LX 4LF5Q 2WB1E 5C3EG 4UP8A 1X3EA 1EWIA 2B3GA 2IT1A 2KHIA 4O0AA 1L1OA 4J15A 1M90C 5LMUL 3M9BA 1G291 3RLNA 4LFBL 4JYAQ 2RF4A 4X64Q 1Y1VH 1HNWL 1TXYA 3F2BA 2IX0A 1JMCA 4YCVA 3HOVG 3SGIA 1XPUA 1SN8A 4LF9Q 1HR0Q 4JBMA 1VCIA 4HIOA 3S1QH 4IPGA 4JG2A 1XNRQ 4AYBE 3TS2A 2OQKA 4JCVE 3T1YQ 2CQOA 4JI2L 3HOUH 4DV6L 1JT8A 2EQSA 3F1ZA 4KHPL 4JI7L 2R6GA 5LMNQ 2WB1G 2VQEQ 3D0FA 1HR0W 1N32Q 3I4MH 4LF7L 1EOVA 2DGYA 3RLFA 4MZ9A 4B3TL 5IP9H 1NTGA 1PH4A 2B29A 2CKZB 3GTJH 1VQJA 2K14A 4DR4Q 5IT9c 2UXDL 1HH2P 2CWAA 2R93G 2N49A 1YJ9A 1HZAA 1IBLL 4R4TA 3BZCA 4BY1G 3HFZB 5LMNW 1QVFA 2A19A 2EXDA 1QZHA 2AWNA 5IYCG 4C3HH 3ZJYC 2UUBQ 4LFCQ 2ZM6L 1B7YB 2DUDA 3I7FA 3KF6A 3STBC 2UU9Q 1IYJB 4P71A 1QUQB 1V9PA 3BZKA 3PGZA 3JAMc 4R4QA 4A93G 1T9HA 3M85A 1YNXA 4OWTB 1VQCA 2I5MX 1VQ8A 2ES2A 4Y52H 1BBUA 4X6AH 2VZAA 3S16H 4DV4L 5C0XJ 1YITA 5C4JH 2R7DA 4R1JA 2D0PA 1E1TA 4A3LG 1VQDA 3RN2A 5K36G 4GKKL 1PVOA 5M5WH 1X6OA 1VQHA 2Z6KC 4YWLA 3VDYA 4HJ8A 4DR2Q 1VQOA 2E5LQ 1HZ9A 3BU2A 2JA6G 1E24A 4HJAA 4AH6A 3CF5A 1EQQA 1IBML 4B3RL 3HKZE 1HNZQ 1CSQA 3PUWA 1OXXK 4B3ML 1X3FA 1KHIA 1VQBA 5GROA 3PIPA 2PMZE 5ELOA 4A4IA 2E8GA 1GO3E 3GO5A 2ZJRA 1PH7A 5JJIA 4GLVB 5IY0A 1H95A 4P75A 1N34Q 3K0XA 5FLMH 4KI0A 1I94L 5JJLA 1Y1VG 3CP0A 2QGQA 2ZTCA 3PV0A 5M3FH 1XMOQ 2JEBI 1VQGA 1HNXQ 2UXBQ 1G6PA 1D8LA 3KYHC 5C4XH 1ASZA 1YI2A 4R4IA 2XGTA 1SFOH 2YV5A 2ZTEA 1Q12A 4YCUA 4A3CH 3HOUG 3NELA 2JA9A 2GVBA 2VNUD 3E9IA 2NVYH 4KHPQ 2N8NA 1UE5A 4B3SQ 3KDFB 1I50H 4O2DA 4X62Q 2YTVA 4IOCA 1Q1BA 5IWAL 2HHHL 3CCRA 2WAQE 1K8GA 4UP7A 4JBKA 3I4MG 4DNIA 4AIMA 1PV4A 4A75A 4R4CA 4EX5A 3UDIA 2ALYB 5FJ8H 1CKOA 1U5KA 2OCEA 4LUVA 5IP9G 4JI6L 2Q2IA 4GS3A 1X54A 1Q46A 5GAEC 4JI5Q 4GKJQ 1NY4A 4BY1H 4JBWA 2Y0SE 3K81C 2K52A 4GNXA 4Y7NH 4GLXA 1VQ7A 2F52A 1CKMA 1TWHH 4LW1A 4DV7L 3S15H 2UUAL 2NN6I 2R92H 1A62A 1O7IA 4NXML 4DUYQ 4HJ5A 1WYDA 4A3FH 2QEXA 3JAMi 1UWVA 4DUZL 4JOIC 3U4VA 4DV2L 3PO2H 2WAQG 1XTDA 4LUOA 1RL2A 2HIXA 1SLJA 5M5XH 2ZJQA 3PSIA 3CQZH 4DR1L 1KD1C 2K5HA 4PZ7A 2AWOA 3G71A 1C0AA 4YHHQ 1OXTA 3PUVA 3TS0A 4DR7L 4C2MH 4JBJA 3A5UA 2JA7H 3W5OA 1QVGA 2HT1A 2PI2E 3UDGA 5AJ3L 1JB7A 3I4OA 1YIJA 1M1KC 4OX9Q 3CCMA 4XTCS 5EAYA 1A63A 4LF4L 1IBKQ 1KAWA 1J6QA 1OXSC 4DV1L 3M4QA 2JE6I 1YJNA 3F2CA 1XMQL 3CCVA 5FLMG 1PYBA 4XIGS 4ALPA 2EIFA 3CCSA 2AKWB 1BBWA 2R7FA 5M3FG 1OXVA 1ASYA 3I55A 2VQFL 3KF8B 4A3KH 3S17H 3MEFA 3KJPA 2Q2UA 1HNWQ 5C4XG 3J7ZC 5IP7H 1BVSA 5DLQE 4L5TA 1QUQA 1GVPA 4A3CG 5GQOA 2IHFA 4DV0L 1Q8KA 3GDEA 1FVIA 4HIKA 1KQSA 2NZOA 4JI2Q 4IFDI 2UXCL 4LNQA 1N9WA 1MJEA 4LF9L 4DV6Q 2MO0A 4A3IH 2OTLA 2YU9H 5IYDH 1TWCH 4GOPC 1JJCB 1B70B 3UDFA 1EIFA 3M3YH 5FJ8G 2VL6A 1K3RA 1YZ6A 3T1YL 1VQPA 4K0KL 1IL2A 1Q1EA 4LF7Q 4GOPB 4B3TQ 1TWGH 3KLWA 3OTOL 1YVCA 2H5XA 2JEAI 1K0RA 3A74A 1UEBA 5H1SE 3J80c 2Z6KA 2VUMH 4X65Q 4JV5L 2VQEL 1JJ2A 2PQAB 4APVA 4DAMA 1EQRA 4JI1Q 3DM3A 4IJHA 5ELNA 2R92G 1J5EQ 1YJWA 3WWVA 4IFDG 2NVTH 1PH6A 4DV3L 4A3FG 2BH2A 1Q81C 3CC7A 3CCQA 4BA2I 2ZM6Q 3NBHB 3PO2G 1IZ6A 2F4VQ 3HOYH 3FHWA 3NENA 2ASBA 4NPSA 2Z0SA 5E7NA 1N36L 1K8AC 1GD7A 3W1GA 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQL A;  3L7Z C;  1XNQ L;  4JYA L;  4HIM A;  4UP9 A;  4QGU A;  3T1H Q;  1OXU A;  1P8L A;  1VQI A;  1QVC A;  5HGQ A;  4HJ9 A;  1E7Z A;  4DR5 L;  1XJV A;  4LF6 L;  2JA7 G;  3PO3 H;  2PNH A;  1L0W A;  5IE8 A;  1A0I A;  3KDF A;  3STB D;  3CCJ A;  1YBY A;  1X56 A;  3J81 j;  2BA1 A;  4DV5 L;  4JI8 L;  3PF5 A;  1R9T H;  2I0Q A;  2JA5 H;  1FJG L;  3H3V I;  4B3R Q;  1WCM H;  1K73 C;  2N78 A;  1W2B A;  1AH9 A;  4DK3 C;  2E5L L;  2MNA A;  4QY7 A;  3U50 C;  2Q2T A;  3GTQ H;  1NMF A;  1VS0 A;  2GVA A;  2E2J H;  4YWM A;  4BXX G;  3RZO H;  1Q7Y C;  5C44 H;  4UPA A;  4IOA A;  1LM0 A;  4FDB A;  1LTL A;  2YTX A;  1I94 Q;  2IX1 A;  4A3K G;  1X55 A;  3AEV A;  5HY6 A;  5IP7 G;  3L2P A;  1KL9 A;  4AQY L;  2E2I H;  4NXN Q;  2LXJ A;  2KEN A;  3I2Z A;  4TVA B;  4DR6 L;  2RCN A;  2WFW A;  3KF6 B;  2MQH A;  1CSP A;  3J7A 5;  4OO1 G;  2KCT A;  4WJ4 A;  1MKH A;  3BJU A;  2D0O A;  1K9M C;  3HOZ H;  3OYY A;  3U58 A;  4YY3 L;  4A3I G;  2RHQ B;  5IYD G;  5BR8 L;  3CME A;  2PI2 A;  3RN5 A;  3CAM A;  2HHH Q;  1PH5 A;  2UUC Q;  1UE6 A;  2IY5 B;  1NMG A;  3H0G G;  3KJO A;  3F2D A;  4BA1 I;  1W3S A;  3PUY A;  1PH9 A;  4IPC A;  1N33 L;  3PCO B;  5C0X I;  4YCW A;  3NEM A;  2IHE A;  1S40 A;  4A3B H;  4A3G H;  4X66 Q;  2FXQ A;  1VQ4 A;  4BBR H;  4JI6 Q;  3RZD H;  4B3S L;  2VUM G;  4WJ3 M;  3J80 i;  4JI3 L;  1BKB A;  2NN6 G;  4LF8 Q;  1AE3 A;  1L2F A;  3K7U C;  4A3M H;  2XTI A;  2I5H A;  5JEA J;  1PA6 A;  2UUA Q;  3JC6 6;  3LGJ A;  1YHQ A;  1VQ9 A;  1C7Y A;  4MTN A;  2K75 A;  2ZJP A;  1MJC A;  3HOY G;  3B6Y A;  4DUZ Q;  2ZTD A;  3PUX A;  4DV2 Q;  3FP9 A;  2YYZ A;  4DUY L;  3AQQ A;  3PUZ A;  4HJ7 A;  2OWO A;  4DR3 L;  2KBN A;  1YHA A;  1RIP A;  1S72 A;  1KC8 C;  4LFA L;  1LYL A;  3W1B A;  3PO3 G;  2VS1 A;  3M4P A;  3AYH B;  3EN2 A;  4A3D H;  1JJG A;  4DR7 Q;  1QZG A;  4JI4 L;  3H3V H;  2JA5 G;  1PH2 A;  4P74 A;  1AE2 A;  5AJ3 Q;  1WCM G;  2BH8 A;  4YHH L;  2MFI A;  2NVX H;  2F3I A;  4LF4 Q;  4L5S A;  1WFQ A;  4GOP A;  1SRO A;  4DV1 Q;  4JI0 L;  5JEA G;  4BXX H;  5LMU Q;  2LXK A;  2KHJ A;  2JJQ A;  3PIO A;  4LFB Q;  4IFD J;  4OX9 L;  4ME3 A;  5C44 G;  2CCZ A;  1CKN B;  3E0E A;  4LF5 L;  2B63 H;  1I6H H;  1X3G A;  2PQA A;  4DPG A;  1EYG A;  3DLL A;  2NVQ H;  3U4Z A;  3G4S A;  2Q2H A;  3HOW H;  2VQF Q;  3OW2 A;  4X64 L;  1CUK A;  1V43 A;  3TRZ A;  2ATW A;  1VQF A;  2QA4 A;  1A8V A;  2KCM A;  3ICE A;  5JJK A;  4BBS H;  1HR0 L;  1E22 A;  3HOZ G;  2K50 A;  5M3M H;  3I4N H;  1SRU A;  4GN5 A;  3FKI H;  3A0J A;  4DV0 Q;  3I56 A;  1XNR L;  4JI7 Q;  3H0G H;  4QIW E;  3S1M H;  2UXC Q;  4OON A;  4R4O A;  3G48 A;  1Y1W H;  3CC2 A;  1WJJ A;  5LMN L;  4A3B G;  4QL5 A;  4A3G G;  4K0K Q;  2UXD Q;  4KLK A;  4BBR G;  4OWX B;  2R7Z G;  3CXC A;  1IBL Q;  1N32 L;  1KRT A;  3OTO Q;  2N3S A;  2JQO A;  2HIV A;  3M4O H;  1GKH A;  1X9N A;  4L5R C;  1L1O C;  1TWF H;  4DR4 L;  4A3M G;  2YTY A;  3MXN B;  4JV5 Q;  1E3P A;  3M7N A;  1VQL A;  2JA8 H;  1VQE A;  3RR5 A;  4DK6 C;  5GAD C;  4POF A;  2F4V L;  1L1O B;  3AFP A;  4QQB X;  1X65 A;  3TQY A;  4IPD A;  4PMW A;  3J81 c;  4DV3 Q;  4X65 L;  2AMC B;  3CCL A;  2WP8 J;  3S1N H;  2GN5 A;  2A8V A;  4DV4 Q;  3F8T A;  2UUB L;  4LFC L;  4JI1 L;  2UU9 L;  3L0O A;  4JC0 A;  1J5E L;  4LUZ A;  1N36 Q;  4AYB G;  5IYB H;  4GKK Q;  3CD6 A;  1WOC A;  1P16 A;  4C3I H;  3HOX H;  1XNQ Q;  1XPR A;  3GTM H;  1K83 H;  2CWP A;  2A1A A;  3CC4 A;  3HKS A;  4IJL A;  2CFM A;  1EIY B;  2OQ0 A;  1IBM Q;  4A3D G;  3IRB A;  3GTL H;  1MIU A;  1PH3 A;  4DR5 Q;  3CCU A;  3CW2 C;  4LF6 Q;  4B3M Q;  1UE7 A;  4DR2 L;  1SE8 A;  2JK8 A;  4DV5 Q;  1KRS A;  3KFU A;  4JI8 Q;  1FJG Q;  4BY7 G;  3T1H L;  4A76 A;  2BA0 A;  2K5N A;  5GAG C;  4GN3 B;  1TWA H;  1I3Q H;  1U0L A;  4PZ6 A;  1YHB A;  1HNZ L;  4A3E H;  1LUZ A;  2C35 B;  3ERS X;  4C3J H;  1VQ6 A;  4QJF A;  3CCE A;  1VQM A;  4POG A;  5GAH C;  3ULP A;  4A3J H;  2B63 G;  3S14 H;  4IO9 A;  2D62 A;  4H02 A;  3H15 A;  1N34 L;  3HOW G;  5C3E H;  1Q82 C;  2AHO B;  4RG1 A;  1IXR A;  1NJI C;  3PF4 A;  4NB3 A;  1HZB A;  4P72 A;  1XMO L;  4AQY Q;  1C9O A;  3EIV A;  1HNX L;  4BBS G;  2UXB L;  1D7Q A;  2VY3 A;  5M3M G;  3I4N G;  4JOI A;  3HOV H;  3FKI G;  4DR6 Q;  1JE5 A;  1B8A A;  1SMX A;  1FGU A;  5IWA Q;  3G6E A;  4KHZ A;  4YY3 Q;  4PG3 A;  1VQN A;  4NXN L;  4GN4 B;  5BR8 Q;  1Y1W G;  3TRE A;  3UE0 A;  1I5F A;  1Z9F A;  2K5V A;  3RLO A;  5C0X G;  2VW9 A;  4X62 L;  2R7Z H;  3D31 A;  3GD7 A;  2E2H H;  3CPW A;  3HKZ G;  3CPF A;  3AFQ A;  1NE3 A;  1N33 Q;  4P73 A;  3A5Z B;  1S3O A;  5J3B A;  1E1O A;  4LWC A;  4OO1 I;  3S1R H;  3S2D H;  4MNO A;  4DV7 Q;  1SR3 A;  2UUC L;  4GKJ L;  4JI3 Q;  3UE1 A;  4JI5 L;  2JA8 G;  4NXM Q;  3RNU A;  1EUJ A;  4DAY B;  5FLX c;  1PYS B;  1Y14 B;  2L15 A;  4X66 L;  2R93 H;  3UDX A;  3GTO H;  2K4K A;  4IPH A;  3J81 i;  1GM5 A;  2OTJ A;  1CKN A;  4GLA C;  4OXP A;  3GTG H;  3GTK H;  4LF8 L;  3K80 C;  1YEZ A;  2RHS B;  3CMA A;  2V1C C;  4DR1 Q;  4PZ8 A;  1G51 A;  5IYC H;  1Q86 C;  1UE1 A;  2MO1 A;  5IYB G;  1PH1 A;  3EBE A;  3ER0 A;  3HOX G;  1Z47 A;  4A93 H;  1DGS A;  4DR3 Q;  3ULJ A;  1PHJ A;  1VQ5 A;  4TQU S;  3GTP H;  4LFA Q;  1HZC A;  1PFS A;  1WI5 A;  1OTC A;  1FL0 A;  3E9H A;  2LSS A;  3KOJ A;  3TEH B;  4A3L H;  1VQK A;  3K8A A;  4EQ5 A;  4JI4 Q;  4BY7 H;  1VQA A;  4UY8 C;  3S2H H;  4RMF A;  3S24 A;  1KIX A;  4OWW B;  1HJP A;  4YWK A;  4DKA C;  1V1Q A;  5M5Y H;  4HID A;  4GNX C;  2ID0 A;  2JA6 H;  4A3E G;  1XMQ Q;  1KXL A;  1N8R C;  1XPO A;  2Y0S G;  2NZH A;  3K7A H;  1IBK L;  4JI0 Q;  1PH8 A;  3Q8D A;  4GNX B;  4A3J G;  4L5Q A;  3ULL A;  1EFW A;  2I5L X;  4LF5 Q;  2WB1 E;  5C3E G;  4UP8 A;  1X3E A;  1EWI A;  2B3G A;  2IT1 A;  2KHI A;  4O0A A;  1L1O A;  4J15 A;  1M90 C;  5LMU L;  3M9B A;  1G29 1;  3RLN A;  4LFB L;  4JYA Q;  2RF4 A;  4X64 Q;  1Y1V H;  1HNW L;  1TXY A;  3F2B A;  2IX0 A;  1JMC A;  4YCV A;  3HOV G;  3SGI A;  1XPU A;  1SN8 A;  4LF9 Q;  1HR0 Q;  4JBM A;  1VCI A;  4HIO A;  3S1Q H;  4IPG A;  4JG2 A;  1XNR Q;  4AYB E;  3TS2 A;  2OQK A;  4JCV E;  3T1Y Q;  2CQO A;  4JI2 L;  3HOU H;  4DV6 L;  1JT8 A;  2EQS A;  3F1Z A;  4KHP L;  4JI7 L;  2R6G A;  5LMN Q;  2WB1 G;  2VQE Q;  3D0F A;  1HR0 W;  1N32 Q;  3I4M H;  4LF7 L;  1EOV A;  2DGY A;  3RLF A;  4MZ9 A;  4B3T L;  5IP9 H;  1NTG A;  1PH4 A;  2B29 A;  2CKZ B;  3GTJ H;  1VQJ A;  2K14 A;  4DR4 Q;  5IT9 c;  2UXD L;  1HH2 P;  2CWA A;  2R93 G;  2N49 A;  1YJ9 A;  1HZA A;  1IBL L;  4R4T A;  3BZC A;  4BY1 G;  3HFZ B;  5LMN W;  1QVF A;  2A19 A;  2EXD A;  1QZH A;  2AWN A;  5IYC G;  4C3H H;  3ZJY C;  2UUB Q;  4LFC Q;  2ZM6 L;  1B7Y B;  2DUD A;  3I7F A;  3KF6 A;  3STB C;  2UU9 Q;  1IYJ B;  4P71 A;  1QUQ B;  1V9P A;  3BZK A;  3PGZ A;  3JAM c;  4R4Q A;  4A93 G;  1T9H A;  3M85 A;  1YNX A;  4OWT B;  1VQC A;  2I5M X;  1VQ8 A;  2ES2 A;  4Y52 H;  1BBU A;  4X6A H;  2VZA A;  3S16 H;  4DV4 L;  5C0X J;  1YIT A;  5C4J H;  2R7D A;  4R1J A;  2D0P A;  1E1T A;  4A3L G;  1VQD A;  3RN2 A;  5K36 G;  4GKK L;  1PVO A;  5M5W H;  1X6O A;  1VQH A;  2Z6K C;  4YWL A;  3VDY A;  4HJ8 A;  4DR2 Q;  1VQO A;  2E5L Q;  1HZ9 A;  3BU2 A;  2JA6 G;  1E24 A;  4HJA A;  4AH6 A;  3CF5 A;  1EQQ A;  1IBM L;  4B3R L;  3HKZ E;  1HNZ Q;  1CSQ A;  3PUW A;  1OXX K;  4B3M L;  1X3F A;  1KHI A;  1VQB A;  5GRO A;  3PIP A;  2PMZ E;  5ELO A;  4A4I A;  2E8G A;  1GO3 E;  3GO5 A;  2ZJR A;  1PH7 A;  5JJI A;  4GLV B;  5IY0 A;  1H95 A;  4P75 A;  1N34 Q;  3K0X A;  5FLM H;  4KI0 A;  1I94 L;  5JJL A;  1Y1V G;  3CP0 A;  2QGQ A;  2ZTC A;  3PV0 A;  5M3F H;  1XMO Q;  2JEB I;  1VQG A;  1HNX Q;  2UXB Q;  1G6P A;  1D8L A;  3KYH C;  5C4X H;  1ASZ A;  1YI2 A;  4R4I A;  2XGT A;  1SFO H;  2YV5 A;  2ZTE A;  1Q12 A;  4YCU A;  4A3C H;  3HOU G;  3NEL A;  2JA9 A;  2GVB A;  2VNU D;  3E9I A;  2NVY H;  4KHP Q;  2N8N A;  1UE5 A;  4B3S Q;  3KDF B;  1I50 H;  4O2D A;  4X62 Q;  2YTV A;  4IOC A;  1Q1B A;  5IWA L;  2HHH L;  3CCR A;  2WAQ E;  1K8G A;  4UP7 A;  4JBK A;  3I4M G;  4DNI A;  4AIM A;  1PV4 A;  4A75 A;  4R4C A;  4EX5 A;  3UDI A;  2ALY B;  5FJ8 H;  1CKO A;  1U5K A;  2OCE A;  4LUV A;  5IP9 G;  4JI6 L;  2Q2I A;  4GS3 A;  1X54 A;  1Q46 A;  5GAE C;  4JI5 Q;  4GKJ Q;  1NY4 A;  4BY1 H;  4JBW A;  2Y0S E;  3K81 C;  2K52 A;  4GNX A;  4Y7N H;  4GLX A;  1VQ7 A;  2F52 A;  1CKM A;  1TWH H;  4LW1 A;  4DV7 L;  3S15 H;  2UUA L;  2NN6 I;  2R92 H;  1A62 A;  1O7I A;  4NXM L;  4DUY Q;  4HJ5 A;  1WYD A;  4A3F H;  2QEX A;  3JAM i;  1UWV A;  4DUZ L;  4JOI C;  3U4V A;  4DV2 L;  3PO2 H;  2WAQ G;  1XTD A;  4LUO A;  1RL2 A;  2HIX A;  1SLJ A;  5M5X H;  2ZJQ A;  3PSI A;  3CQZ H;  4DR1 L;  1KD1 C;  2K5H A;  4PZ7 A;  2AWO A;  3G71 A;  1C0A A;  4YHH Q;  1OXT A;  3PUV A;  3TS0 A;  4DR7 L;  4C2M H;  4JBJ A;  3A5U A;  2JA7 H;  3W5O A;  1QVG A;  2HT1 A;  2PI2 E;  3UDG A;  5AJ3 L;  1JB7 A;  3I4O A;  1YIJ A;  1M1K C;  4OX9 Q;  3CCM A;  4XTC S;  5EAY A;  1A63 A;  4LF4 L;  1IBK Q;  1KAW A;  1J6Q A;  1OXS C;  4DV1 L;  3M4Q A;  2JE6 I;  1YJN A;  3F2C A;  1XMQ L;  3CCV A;  5FLM G;  1PYB A;  4XIG S;  4ALP A;  2EIF A;  3CCS A;  2AKW B;  1BBW A;  2R7F A;  5M3F G;  1OXV A;  1ASY A;  3I55 A;  2VQF L;  3KF8 B;  4A3K H;  3S17 H;  3MEF A;  3KJP A;  2Q2U A;  1HNW Q;  5C4X G;  3J7Z C;  5IP7 H;  1BVS A;  5DLQ E;  4L5T A;  1QUQ A;  1GVP A;  4A3C G;  5GQO A;  2IHF A;  4DV0 L;  1Q8K A;  3GDE A;  1FVI A;  4HIK A;  1KQS A;  2NZO A;  4JI2 Q;  4IFD I;  2UXC L;  4LNQ A;  1N9W A;  1MJE A;  4LF9 L;  4DV6 Q;  2MO0 A;  4A3I H;  2OTL A;  2YU9 H;  5IYD H;  1TWC H;  4GOP C;  1JJC B;  1B70 B;  3UDF A;  1EIF A;  3M3Y H;  5FJ8 G;  2VL6 A;  1K3R A;  1YZ6 A;  3T1Y L;  1VQP A;  4K0K L;  1IL2 A;  1Q1E A;  4LF7 Q;  4GOP B;  4B3T Q;  1TWG H;  3KLW A;  3OTO L;  1YVC A;  2H5X A;  2JEA I;  1K0R A;  3A74 A;  1UEB A;  5H1S E;  3J80 c;  2Z6K A;  2VUM H;  4X65 Q;  4JV5 L;  2VQE L;  1JJ2 A;  2PQA B;  4APV A;  4DAM A;  1EQR A;  4JI1 Q;  3DM3 A;  4IJH A;  5ELN A;  2R92 G;  1J5E Q;  1YJW A;  3WWV A;  4IFD G;  2NVT H;  1PH6 A;  4DV3 L;  4A3F G;  2BH2 A;  1Q81 C;  3CC7 A;  3CCQ A;  4BA2 I;  2ZM6 Q;  3NBH B;  3PO2 G;  1IZ6 A;  2F4V Q;  3HOY H;  3FHW A;  3NEN A;  2ASB A;  4NPS A;  2Z0S A;  5E7N A;  1N36 L;  1K8A C;  1GD7 A;  3W1G A;  1NBW A; 
#chains in the Genus database with same CATH topology
 4HIM A;  4K14 A;  3EVQ A;  3T1H Q;  3FVQ A;  3I4M B;  5A2Q L;  1QVC A;  2JA7 G;  4LF6 L;  2F0G A;  4HSV A;  3KDF A;  4I7A A;  3DEP A;  3J81 j;  5E3F A;  1FJG L;  4B3R Q;  2GA4 B;  4ZQ3 A;  1V1O A;  1A15 A;  1D6E C;  2Q2T A;  1QG7 A;  2BDO A;  4B9X A;  4IOA A;  4XT3 B;  5C44 H;  1PMR A;  3IFT A;  5T1G A;  4FDB A;  1LTL A;  1I94 Q;  3MEH A;  4A3K G;  1X55 A;  5HY6 A;  3HS0 C;  4AQY L;  1K28 A;  4NXN Q;  2KEN A;  3I2Z A;  2MQH A;  1ENC A;  5M5W B;  2KCT A;  2N55 A;  3HOZ H;  4A3I G;  2JN4 A;  4H13 C;  1LT5 D;  2PI2 A;  2BOS A;  2D2C C;  2EXZ A;  1ICW A;  1PH5 A;  2UUC Q;  1F2M A;  1NMG A;  4FF2 A;  3H0G G;  1W3S A;  4IPC A;  4EQO A;  4YCW A;  3SXH A;  2PQE A;  3MXU A;  3DM1 A;  5BN3 A;  4B3S L;  1BKB A;  3OWF A;  4B9W A;  1AE3 A;  3K7U C;  2XTI A;  4ZAI A;  5C4H A;  1YHQ A;  1VQ9 A;  1SE2 A;  1Z6H A;  5C4X B;  1TS4 A;  2L12 A;  3ZYY X;  1SFO B;  2M9V A;  3FP9 A;  1NSN S;  5J22 A;  4DR3 L;  1YHA A;  3SDZ A;  1TKW B;  4LFA L;  1U9R A;  2F0M A;  4KY7 A;  3W1B A;  1RKN A;  2ICI A;  5IT9 E;  3EN2 A;  3K5N A;  1E0B A;  4BS9 A;  1AE2 A;  3T56 B;  3MTS A;  2XSC A;  4L5S A;  3S15 B;  4GOP A;  4JI0 L;  5JEA G;  2H4O A;  3A7L A;  3OPO A;  1I6H H;  1CKN B;  4LF5 L;  2PQA A;  3G6J B;  1JWM D;  3PO2 B;  2NVQ H;  2K03 A;  5FKA C;  3U4Z A;  3OW2 A;  2C5C A;  2ATW A;  2QA4 A;  1M8A A;  5JJK A;  3MHB A;  4BBS H;  1R4P B;  2K50 A;  2K5Q A;  1PTO B;  1XNR L;  2F0O A;  1PZK D;  3H0G H;  4QIW E;  2JP1 A;  4LMQ D;  2MUY A;  3WOF A;  1N32 L;  3CXC A;  1NR2 A;  2FJ2 A;  4OGQ C;  2HIV A;  1V1P B;  1L1O C;  3MVV A;  3MXN B;  4JV5 Q;  4DFA A;  1VQL A;  5CV7 A;  4DA2 A;  1LAB A;  1W6J A;  4IAL A;  4POF A;  1EEF D;  3TP6 A;  3TQY A;  4PMW A;  5C6A A;  3J81 c;  4HCE A;  2GN5 A;  2A8V A;  1FR3 A;  3J7Y W;  4DAP A;  2UU9 L;  1WTO A;  4DXF A;  4LK1 C;  4UDU C;  1F2Y A;  1II3 A;  3SK8 A;  4JYA Q;  2J4X A;  2CWP A;  4A3D G;  3IRB A;  3GTL H;  1EY0 A;  2O5J C;  3K5L A;  4H0L C;  5J39 A;  1WD1 A;  4DR2 L;  4DV5 Q;  3KFU A;  3ND9 A;  3TZD A;  4BY7 G;  3T1H L;  2TMP A;  2SEB D;  2BA0 A;  4A76 A;  1TS2 A;  1LUZ A;  2H1E A;  1QOH A;  1FNW A;  1VQM A;  3IL8 A;  3ULP A;  1G91 A;  2WV6 D;  3S14 H;  1Y69 U;  4H02 A;  2KVM A;  1H9J A;  1EZ6 A;  3EIV A;  3BS1 A;  2WII B;  5M3M G;  2PZW A;  4DR6 Q;  2PYK A;  5CR3 A;  1JE5 A;  1B8A A;  1FGU A;  4KHZ A;  4YY3 Q;  4NXN L;  4K5X A;  3VYU A;  2JA5 B;  5C0X G;  1I5F A;  3SEB A;  5I2X A;  1D2B A;  2B2Y C;  3CPW A;  1CZW A;  1BNZ A;  1A2T A;  3MXG A;  4OO1 I;  5EPK A;  4DV7 Q;  2UUC L;  1KAB A;  2E2J B;  4JI3 Q;  2FHT A;  1CA6 A;  3RNU A;  3DWA A;  1L0X B;  3UDX A;  2VB2 X;  1WTV A;  3M4Y A;  4KN7 C;  4PQX A;  3OHX C;  3GTG H;  2F0K A;  5IYC H;  1UE1 A;  2MO1 A;  2PCF B;  3A7A B;  3EFX D;  3EBE A;  4Z9C B;  3ER0 A;  3P7J A;  1Z47 A;  1DGS A;  2L5T A;  2EPB A;  4DGZ A;  5EGT A;  1VQ5 A;  5J1Z A;  2SNS A;  1HZC A;  1PFS A;  3E9H A;  3KOJ A;  1VQK A;  4ULL A;  2SOB A;  3NTK A;  4BY7 H;  3D4R A;  1SMY D;  1XX8 A;  4RMF A;  3S24 A;  2L9H A;  4A3M B;  1F9P A;  1SAP A;  2RA4 A;  1IBK L;  4RCN A;  4A3J G;  2WB1 E;  1CI3 M;  2F0E A;  5C3E G;  1EWI A;  1F9S A;  4O0A A;  2A74 C;  2BDN A;  1G29 1;  4X64 Q;  1RF2 D;  1Y1V H;  2IX0 A;  4O1N A;  3U9S A;  1G2T A;  4RWS C;  2CQO A;  3MWY W;  3NXW A;  3K59 A;  2A69 D;  4X3K A;  1RCV D;  4DF7 A;  2WB1 G;  1SXT A;  1HR0 W;  3I4M H;  1GUG A;  4MZ9 A;  2B63 B;  1NTG A;  2K01 A;  2K14 A;  4G7Z C;  4DR4 Q;  4XQJ A;  1EIG A;  1HH2 P;  1EY5 A;  1L0Y B;  3HOW B;  1YJ9 A;  1HZA A;  2PNR C;  3BZC A;  3DEO A;  3HFZ B;  5LMN W;  1QVF A;  1E2Z A;  4LFC Q;  1B44 D;  4CKE A;  3I7F A;  4NMZ A;  2F4V L;  4IFD I;  1IYJ B;  2DN8 A;  4KJN A;  5EPL A;  3JAM c;  3S1M B;  1T9H A;  2EE1 A;  4Y52 H;  1U4R A;  2SNM A;  1VQ8 A;  1BBU A;  1SYD A;  2VZA A;  1EY7 A;  3R93 A;  4A3L G;  1TVX A;  1Q8I A;  2L4N A;  4HMJ A;  5M5W H;  3M4O B;  4HJ8 A;  3SK4 A;  3BU2 A;  4HJA A;  1HA6 A;  4JVZ A;  4AH6 A;  3CF5 A;  1EQQ A;  3NUC A;  1HTL D;  3PUW A;  1PLF A;  1KHI A;  1STY A;  2PMZ E;  4A4I A;  2HDL A;  1GO3 E;  2ZJR A;  1I4Q A;  5IY0 A;  4KMU C;  4P75 A;  1EL0 A;  3P20 A;  4KKU A;  5JJL A;  3E3X A;  1XMO Q;  3BVM A;  1NR4 A;  5C4X H;  2NZ1 D;  2F4I A;  2F0T A;  1SFO H;  2JA9 A;  2GVB A;  2EJM A;  3T16 A;  4KHP Q;  1Y8N B;  5EKI A;  1GUO A;  1TWA B;  4IOC A;  3C3L A;  2Y0S B;  2Z1C A;  1AN8 A;  2ALY B;  2CHB D;  1U5K A;  2OCE A;  3CRL C;  1I4H A;  1IHZ A;  2K52 A;  1RDP D;  1CKM A;  4LW1 A;  3SR1 A;  4DV7 L;  3S15 H;  2UUA L;  4C1N I;  2E74 C;  4HJ5 A;  2CVR A;  3NK9 A;  2QEX A;  3AB9 A;  4JOI C;  3U4V A;  3PO2 H;  5CGK A;  1NNX A;  2R7Z B;  1KDA A;  3PSI A;  4K2L A;  1O7L A;  1PFN A;  1DJR D;  2RVL A;  3SE0 A;  4YHH Q;  3PIO 3;  1OXT A;  5ELD A;  5JVH 3;  3PUV A;  3S2D B;  1PTO H;  3K5M A;  4JBJ A;  3A5U A;  1QVG A;  3S9W A;  2HT1 A;  5BN4 A;  3KK7 A;  2PI2 E;  4MN3 A;  3UDG A;  1JB7 A;  1XTC D;  1KNE A;  3RD4 A;  3J81 E;  4OX9 Q;  1BCP C;  4JPB W;  3CCM A;  3RUZ A;  2PPB C;  3GTO B;  1OXS C;  4CDF C;  2OEO A;  3SK6 A;  3NSW A;  4DV1 L;  1ZYR D;  3K58 A;  1LT6 D;  3GTK B;  3M4Q A;  1SND A;  5FLM G;  1BR9 A;  1U4M A;  2EIF A;  2R61 A;  3CHB D;  1GOZ A;  2R7F A;  3D6W A;  3I55 A;  2VQF L;  3EQL C;  1B3A A;  1HNW Q;  2Q2U A;  3J7Z C;  5IP7 H;  1F9Q A;  1BVS A;  5DLQ E;  4L5T A;  1QUQ A;  2NUC A;  3LWE A;  1BQQ T;  5GQO A;  4A3C G;  1SJH D;  4DV0 L;  3SVM A;  4RA8 A;  1FVI A;  4JI2 Q;  3P75 A;  1N9W A;  5L37 A;  1MJE A;  2JA6 B;  4DV6 Q;  4RHR A;  1I6H B;  4GOP C;  3K7A B;  5CBA E;  1EIF A;  2FIN B;  3OIP A;  5FJ8 G;  1YZ6 A;  3Q6S A;  4KKT A;  3OTO L;  3O13 A;  5H1S E;  1UEB A;  2VUM H;  1ILQ A;  1MI2 A;  2NTT A;  4QF4 A;  2KEE A;  4DAM A;  3DM3 A;  1C4Q A;  2B2V A;  4IJH A;  1J5E Q;  5M9O A;  4DV3 L;  4JK1 C;  5C3W A;  5DM6 3;  3S1Q B;  3W3A A;  2ZM6 Q;  4NPS A;  2M00 A;  1F2L A;  3HKZ B;  5E7N A;  3TZU A;  1N36 L;  1K8A C;  4X3S A;  4XYQ A;  3L7Z C;  4UP9 A;  3I3C A;  2RBM A;  1VQI A;  4HJ9 A;  1E7Z A;  1L0W A;  5IE8 A;  1DCZ A;  1A0I A;  1FNU A;  1YBY A;  1X56 A;  3PF5 A;  3BDO A;  4JI8 L;  3J80 L;  2JA5 H;  2F0V A;  1ILP A;  4QUF A;  1K73 C;  2NWG A;  4QY7 A;  3U50 C;  4G57 A;  2E2J H;  4BXX G;  1JOR A;  1Q7Y C;  2PO4 A;  1LM0 A;  2D9U A;  2YTX A;  1BOS A;  3J81 L;  3L2P A;  3HRZ C;  2LXJ A;  4TVA B;  2AQ3 B;  4ZRZ A;  3BVG A;  1PFB A;  1DZ1 A;  4OO1 G;  3J7A 5;  1CSP A;  3L3O C;  3BYY B;  3BJU A;  1EYA A;  2D0O A;  1K9M C;  3OYY A;  2RHQ B;  5EQ0 A;  2I07 B;  3RN5 A;  3CAM A;  1RD9 D;  4L8J A;  2HHH Q;  1UE6 A;  3S14 B;  2IY5 B;  4RKB A;  3KUP A;  3KJO A;  2LMC B;  1ONL A;  1N33 L;  1BBX C;  5C0X I;  1QCB D;  4KHP L;  2EYH A;  4X66 Q;  4WJ3 M;  4JI6 Q;  2B2T A;  2KED A;  4A3M H;  3NBI A;  5JEA J;  1KLG D;  1EYD A;  3FDT A;  3JC6 6;  4N8X 1;  4MTN A;  2K75 A;  4V19 0;  3DWQ A;  3HOY G;  3D8G A;  5CV4 A;  3FRP B;  3KF8 A;  4DV2 Q;  2YYZ A;  3VYS A;  3AQQ A;  2F3W A;  2OWO A;  4K6D A;  1VF5 C;  1S72 A;  1RIP A;  1LYL A;  3V05 A;  2VS1 A;  3AYH B;  4RFB A;  4JI4 L;  1O7Y A;  3H3V H;  4P74 A;  4BY1 B;  5AJ3 Q;  2BH8 A;  4YHH L;  4CDD C;  1BO0 A;  1C8C A;  1TWH B;  4MHE A;  4LF4 Q;  1PRT C;  2XWB B;  1SRO A;  4BXX H;  3JAM E;  3PIO A;  1DOL A;  3I70 A;  4OX9 L;  4ME3 A;  2MJ8 A;  5C44 G;  2K1B A;  4A3F B;  2B63 H;  3TSS A;  1QB5 D;  4E6I A;  3DLL A;  3HOW H;  1CUK A;  4QIW B;  1LTT D;  1VQF A;  3ICE A;  1HR0 L;  3HOZ G;  4S3S A;  3A0J A;  4JI7 Q;  2UXC Q;  3S1M H;  4OON A;  5G3L D;  1WJJ A;  5LMN L;  4K0K Q;  1AZQ A;  1ESR A;  2R7Z G;  1IBL Q;  2N3S A;  4K2K A;  3IAY A;  1Y1V B;  3M4O H;  1GKH A;  3SK5 A;  1TWF H;  2YTY A;  3A8I E;  4XXE A;  3M7N A;  3NQT A;  5T1I A;  3RR5 A;  5GAD C;  2EY6 A;  3D4D A;  1L1O B;  1TY0 A;  1NCV A;  1CFM A;  4IPD A;  5JPN C;  4DV4 Q;  2UUB L;  4TSS A;  3L0O A;  1J5E L;  4LUZ A;  1JOO A;  1E2W A;  2XRS D;  5I6W A;  3FEW X;  4AYB G;  5IYB H;  1UEA B;  2K7V A;  3CD6 A;  4QUC A;  1XNQ Q;  3HG9 A;  1WTX A;  1K83 H;  3PIP 3;  2CFM A;  1EIY B;  2QF7 A;  2VXW A;  1X32 A;  1PH3 A;  4DR5 Q;  1JQY D;  3CW2 C;  4B3M Q;  1UE7 A;  3DHQ A;  1SE8 A;  2JK8 A;  2HD3 A;  1B53 A;  1AEX A;  1B3Q A;  1TWA H;  1U0L A;  1KTK A;  1YHB A;  4MTK A;  4PZ6 A;  1EQV A;  4A3E H;  3N52 A;  3ERS X;  1VQ6 A;  4KJO A;  1RTN A;  4QJF A;  4POG A;  4FVM A;  1HTP A;  1CZG A;  1K8O A;  3H15 A;  2XIW A;  2V4D A;  1Q82 C;  2AHO B;  3AU7 A;  1NJI C;  1GHJ A;  5AFW A;  2K32 A;  4NB3 A;  1HZB A;  1QNK A;  4P72 A;  1TT2 A;  5CV9 A;  4BBS G;  2UXB L;  4JOI A;  3PO3 B;  2DJF C;  2K05 A;  2FFK B;  1VQN A;  4GN4 B;  5BR8 Q;  1R9T B;  3UE0 A;  1WCM B;  2R7Z H;  5IOD A;  4RHS A;  3HKZ G;  3NPP A;  4MIU A;  3GTQ B;  3S2D H;  1SR3 A;  4GKJ L;  4JI5 L;  2MP1 A;  1BCP F;  1PYS B;  2L15 A;  4X66 L;  3GTO H;  2QIL A;  5JVG 3;  3VR4 A;  1ET6 A;  4IPH A;  3GTK H;  1UNS A;  1EY9 A;  4PZ8 A;  5E4W C;  4RGM A;  4IUQ A;  1SJE D;  1WTQ A;  4OIK A;  1PH1 A;  4ABN A;  2G5D A;  2A68 C;  4HR7 B;  2QCP X;  1ZYR C;  2PZT A;  4WOR A;  3C1F A;  4A3B B;  3K8A A;  4EQ5 A;  3RZD B;  5JOB A;  4OWW B;  1KIX A;  1MSG A;  1U4L A;  4DKA C;  2JA6 H;  1KXL A;  3K7A H;  2IPK D;  2FMM A;  4L5Q A;  3ULL A;  1EFW A;  3VA5 A;  1BCP D;  1B50 A;  1S5B D;  1KDC A;  4I65 A;  3TN2 A;  1PFM A;  4UP8 A;  1X3E A;  2B3G A;  2KHI A;  3R3O A;  4IUU A;  4J15 A;  2HQE A;  2E2D C;  1K8M A;  4RKL A;  2EY2 A;  2F0U A;  4YCV A;  1SN8 A;  1I4X A;  3TP8 A;  1HRJ A;  1VCI A;  3S1Q H;  4JG2 A;  2PW5 A;  3TDQ A;  1SNM A;  4RGT A;  1DOK A;  2EQS A;  4JI7 L;  2R6G A;  1LTI D;  2HCC A;  2VQE Q;  4DNT B;  1EOT A;  2DGY A;  1RHP A;  5IP9 H;  2CKZ B;  1XWE A;  2Q8T A;  2XNA C;  1IBL L;  1HUN A;  1GUN A;  4BY1 G;  4FXG C;  2AWN A;  4H7B A;  5C3X A;  5IYC G;  3I4N B;  3ZJY C;  3FKI B;  2DUD A;  3KF6 A;  4HED A;  3K6O A;  1CA5 A;  1R4Q B;  4R4Q A;  1IL8 A;  4OWT B;  2XRQ D;  3M85 A;  2ES2 A;  2X6L A;  2WKC A;  1BUV T;  3E5S A;  1Y1W B;  4X6A H;  4DV4 L;  1YIT A;  2VUM B;  2R7D A;  4R1J A;  5ELF A;  1PVO A;  2K04 A;  3VDY A;  1VQO A;  1HZ9 A;  1NUC A;  2JA8 B;  4B3R L;  5IT9 L;  2B2V C;  1CSQ A;  1HNZ Q;  1FNV A;  4B3M L;  5IGB A;  3PIP A;  2E8G A;  1PH7 A;  5JJI A;  4KV6 A;  1B1Z A;  3QJY A;  1JCK B;  2KEC A;  1N34 Q;  1CM9 A;  1I94 L;  1STB A;  5FO7 B;  1Y1V G;  4C3I B;  5M3F H;  3HOX B;  1U4P A;  1VQG A;  1HNX Q;  2KOL A;  1CHP D;  1D8L A;  1SNC A;  2XGT A;  4WJW A;  2O5I C;  1STE A;  4YCU A;  3NEL A;  2F0Q A;  3E9I A;  2E75 C;  2N8N A;  2B39 A;  1UE5 A;  3KDF B;  1I50 H;  3PQI A;  1I3Q B;  2YTV A;  4X62 Q;  1Q1B A;  1K8G A;  3I4M G;  4DNI A;  4QCL A;  1VMC A;  4R4C A;  4EX5 A;  1WTW A;  4LUV A;  4Q5V A;  4CBV A;  1CT1 D;  1H9M A;  3MFG A;  3VYT A;  5EBD A;  4BY1 H;  3K81 C;  3NTI A;  4GNX A;  2L11 A;  4Y7N H;  1VQ7 A;  2F52 A;  1D1I A;  1TWH H;  4OHJ A;  1JOQ A;  4DUY Q;  2Z4H A;  3HOV B;  1WYD A;  1S5C D;  4A3F H;  2EYJ A;  1SE3 A;  2RKS A;  4LUO A;  3I91 A;  3A54 A;  1SLJ A;  3HEJ A;  1KD1 C;  2QEJ C;  3S1R B;  2B2T C;  4G7O C;  5CC4 A;  2O2L D;  3I4O A;  4WRD A;  2R93 B;  1YNN C;  3X3M A;  1J6Q A;  1BCP B;  4XQQ A;  2JE6 I;  5EBC A;  3CCV A;  1SNO A;  1PRT D;  2KCN A;  1PYB A;  1RJT A;  5E1F A;  3DUZ A;  2AKW B;  1BBW A;  4A93 B;  4NDX A;  2EY1 A;  3GTP B;  5C4X G;  1D5M C;  4KTA A;  3HP3 A;  3GDE A;  1IYV A;  4DK0 A;  4HIK A;  3J7A V;  2AQ2 B;  5M5Y B;  2LFN A;  4CDE C;  2OTL A;  5IYD H;  2MPM A;  2L1B A;  2IX3 A;  3NHH A;  1VQP A;  4LF7 Q;  4GOP B;  4B3T Q;  3PMF A;  2Z6K A;  2F1M A;  4X65 Q;  3K57 A;  2VQE L;  4JV5 L;  2KQ3 A;  2NN6 H;  2PQA B;  4APV A;  4G7H C;  1EQR A;  1TU2 B;  1YJW A;  3WWV A;  5DM7 3;  2AQ1 B;  1PH6 A;  1WD0 A;  5FO9 B;  2B2W C;  2BH2 A;  2B2U A;  3CC7 A;  4BA2 I;  4IQZ A;  3PO2 G;  1S5F D;  1IZ6 A;  3NEN A;  3D4W A;  2HDM A;  4FXK C;  2TSS A;  3L9A X;  3K0Y A;  4H44 C;  2ASB A;  3HOU B;  1CHQ D;  4QQB X;  3KLS A;  2HQL A;  1HFN A;  4NW2 A;  4JYA L;  1TWF B;  4QGU A;  3GP7 A;  3NWS A;  1P8L A;  5HGQ A;  2DY7 A;  3PO3 H;  4XT1 B;  2PNH A;  5HGT A;  2F03 A;  3GTJ B;  3CCJ A;  4DV5 L;  2I0Q A;  1R9T H;  4FYD A;  4RGN A;  4DAY A;  1WCM H;  3QR8 A;  5CV8 A;  3OIQ A;  2MNA A;  3A8K E;  3GTQ H;  4C3H B;  1NMF A;  1VS0 A;  1K83 B;  4CJ0 B;  3HZX A;  5I2Y A;  4HMI A;  4EQP A;  2IX1 A;  4EGV A;  2F0W A;  5IP7 G;  2WAQ B;  3BVZ A;  1KL9 A;  2A6E C;  1Y8O B;  1HQR D;  3VR3 A;  4DR6 L;  1VF7 A;  2RCN A;  2WFW A;  3KF6 B;  4WJ4 A;  4A3E B;  3I72 A;  3TP7 A;  5EPJ A;  4JW0 A;  3QO2 A;  2OT2 A;  4YY3 L;  4LAA A;  1GHK A;  3CME A;  1V8Q A;  2ENB A;  1H9S A;  5JPM C;  3F2D A;  4BA1 I;  3PUY A;  3PCO B;  3NEM A;  4A3B H;  4A3G H;  2FXQ A;  3K5O A;  4I7Z C;  4BBR H;  3RZD H;  2VUM G;  3J80 i;  4JI3 L;  1IW7 D;  3H6M A;  1IKL A;  1CK1 A;  3E6Z X;  1L2F A;  5CBE E;  1EY8 A;  4IUT A;  3LGJ A;  1LT4 D;  2ZJP A;  1GUW A;  2A73 B;  1SNP A;  3NP8 A;  1EIH A;  3A55 A;  4DUZ Q;  4J6H A;  3PUX A;  1K3B C;  4DUY L;  1T5X D;  1KC8 C;  4C3I G;  1B4O A;  5DAU A;  4N9T A;  1JJG A;  4DR7 Q;  1QZG A;  2Z4I A;  2A68 D;  1DD2 A;  2JA5 G;  5CV6 A;  2ZT9 C;  2F0F A;  2QKI C;  2F3I A;  4N9P A;  4UHV A;  3G7L A;  2JSO A;  2R92 B;  3J7A F;  1O80 A;  4LFB Q;  4IFD J;  2CCZ A;  1X3G A;  4DPG A;  1SYG A;  1EYG A;  3G4S A;  1EYC A;  2Q2H A;  3H94 A;  5M5X B;  2VB3 X;  5EKL A;  4X64 L;  1V43 A;  1TS5 A;  2KCM A;  3NBH A;  4TRD A;  3I4N H;  3FKI H;  4C2M B;  2JA7 B;  1DM0 B;  5JJZ A;  5KGU A;  3G48 A;  2KCC A;  4GZY C;  1Y1W H;  3CC2 A;  1O78 A;  4K5V A;  2UXD Q;  4ZLT F;  4OWX B;  1KRT A;  4L5R C;  1X9N A;  4DR4 L;  4A3M G;  2JA8 H;  4DK6 C;  4A3K B;  3S17 B;  1DXM A;  2BE5 C;  2CH4 A;  3AFP A;  4R9W A;  3CRK C;  3IFD A;  2G9D A;  4X65 L;  2WP8 J;  4QMG A;  3F8T A;  2J7Z A;  4LFC L;  4A3I B;  2YU9 B;  1P16 A;  1TWC B;  4C3I H;  3HOX H;  1PDQ A;  4KK7 A;  1WTP A;  1XPR A;  2A1A A;  3HKS A;  3M3Y B;  2OQ0 A;  1IBM Q;  4WFN 3;  3CCU A;  4LF6 Q;  2RDH A;  4OEL B;  4FXD A;  4C56 C;  3D6C A;  3KLS X;  1FJG Q;  1LTB D;  1Y8P B;  3P1H A;  4IUV A;  5GAG C;  1I3Q H;  1HCZ A;  1EWH A;  4C3J H;  2NVT B;  2F0N A;  2B63 G;  4IO9 A;  1G6Z A;  2D62 A;  1EU3 A;  1S4Z A;  2EYO A;  3HOW G;  3NWT A;  4RG1 A;  1IXR A;  4ZYS A;  4YIJ A;  3PF4 A;  2EYL A;  2P5Z X;  1I4G A;  4K8J A;  2QDB A;  1XMO L;  4AQY Q;  1HPC A;  1C9O A;  5IGG A;  2VY3 A;  4B08 A;  1A3U A;  3HOV H;  1KDB A;  2EZV A;  1SMX A;  1X3P A;  3OWE B;  4PG3 A;  1TY2 A;  5KYL A;  3I8Z A;  3TRE A;  1PXU A;  2EOT A;  1Z9F A;  2K5V A;  3VA7 A;  2VW9 A;  3TBI B;  3D31 A;  4O42 A;  4ZUJ A;  2DY8 A;  4P73 A;  1ICF B;  1EY6 A;  3A5Z B;  1E1O A;  4LWC A;  3S1R H;  1BDO A;  4MNO A;  5M3F B;  2IL8 A;  1STH A;  5DNF A;  3RZO B;  2G9H D;  1D1K A;  4NXM Q;  4DAY B;  5FLX c;  4IN3 A;  1Y14 B;  2NB0 A;  1HQM C;  2R93 H;  5IGD A;  2K4K A;  2E2I B;  1CKN A;  4GLA C;  4OXP A;  1IKM A;  3K80 C;  1I50 B;  2RHS B;  3CMA A;  2V1C C;  5KNB A;  1Q86 C;  5IYB G;  1EZ8 A;  2QDL A;  5A2Q E;  4NP5 A;  5G3L F;  5LL6 S;  3OMC A;  4A93 H;  4DR3 Q;  2X69 A;  3GTP H;  4LFA Q;  1WI5 A;  1SBB B;  1OTC A;  1FL0 A;  2XN9 C;  4Y7N B;  4G4K A;  1BXT A;  1VQA A;  1LT3 D;  4K6L A;  1FYC A;  4GNX C;  1V1Q A;  5M5Y H;  4RGO S;  4A3E G;  2ZXO A;  1N8R C;  1XPO A;  2Y0S G;  1ZKO A;  1ML0 D;  4JI0 Q;  3Q8D A;  4PV1 C;  1V1P A;  4FP5 D;  1VDZ A;  4LF5 Q;  2SDF A;  1YNN D;  5KIX A;  1M90 C;  4LFB L;  2B2W A;  1HNW L;  1TXY A;  1JMC A;  4KN4 C;  3SGI A;  4LF9 Q;  4JBM A;  4A3D B;  1KAA A;  4HIO A;  3QG1 A;  1HA5 A;  1XNR Q;  1PZJ D;  1EU4 A;  3X3N A;  4AYB E;  3TS2 A;  4JI2 L;  4UAI A;  4KHV A;  3HOU H;  1MHW C;  2NVX B;  4DV6 L;  1Z7T A;  4LJZ C;  5D14 A;  3F1Z A;  2K28 A;  1PTO D;  3D0F A;  3HGB A;  1X3Q A;  1N32 Q;  3RLF A;  1I4P A;  2B29 A;  2A6H C;  3GTJ H;  3BG3 A;  2KHS A;  2UXD L;  3BDL A;  2DNC A;  2LS0 1;  2IJ0 A;  2MHV A;  2CH4 W;  2EXD A;  1KNA A;  4F8M A;  3C46 A;  5M3M B;  4C3H H;  4CJ1 B;  2Z8L A;  3KBX A;  4ILW A;  2ZM6 L;  1B7Y B;  2UU9 Q;  1SEB D;  1QUQ B;  4P71 A;  3BZK A;  1YNX A;  2I5M X;  3S16 H;  5C0X J;  4FF1 A;  1AW7 A;  1ZXT A;  2D0P A;  4IUR A;  4PMB A;  3D3R A;  2O4X A;  1X6O A;  1VQH A;  2Z6K C;  4DR2 Q;  2K5W A;  2E5L Q;  2JA6 G;  1IBM L;  5C4Z A;  1AZP A;  3HKZ E;  5FO8 B;  1LLR D;  3H09 A;  1OXX K;  4ZKB B;  3UI2 A;  1VQB A;  2I46 A;  5GRO A;  1G2S A;  2B2U C;  3GO5 A;  5CYU A;  3SHL A;  3S1N B;  4L63 B;  1H95 A;  1TR5 A;  3K0X A;  4HN7 A;  4KI0 A;  2F0D A;  3CP0 A;  3JAM L;  3DMU A;  2KJX A;  3GTM B;  2JEB I;  3DXJ C;  1XYI A;  1QWY A;  1HFG A;  1G6P A;  4M8A A;  3KYH C;  4R4I A;  3Q23 A;  4F88 A;  1Q12 A;  2A6E D;  1IW7 C;  2DNE A;  2HHH L;  1PYW D;  1SNQ A;  3CCR A;  4UP7 A;  4AIM A;  1ROD A;  4A75 A;  5IP9 G;  3UDI A;  4A3J B;  4U68 A;  4JI6 L;  4GS3 A;  1Q3L A;  1X54 A;  2Q2I A;  5ELE A;  5C3E B;  2OF1 A;  3BZD B;  3ND8 A;  3URY A;  4GLX A;  2NYZ D;  4L6T B;  1WVL A;  2R92 H;  1A62 A;  1O7I A;  3A8J E;  5I9P A;  4NXM L;  4ODG A;  4IFD H;  1TQO A;  1FGB D;  2KA7 A;  1UWV A;  4DV2 L;  4A3G B;  4BBR B;  5M5X H;  1RL2 A;  2HIX A;  2E2H B;  2AWO A;  3G71 A;  4C1N K;  2WB1 B;  3TS0 A;  3EA6 A;  4C2M H;  2JA7 H;  3RMH A;  4U67 3;  3W5O A;  2ZXP A;  4F87 A;  5AJ3 L;  3R2T A;  1YIJ A;  4XTC S;  1I4R A;  4OIJ A;  1A63 A;  4LF4 L;  1IBK Q;  1KAW A;  4HSP A;  4FF3 A;  1YJN A;  4QB4 A;  5NUC A;  2F0S A;  4XIG S;  4ALP A;  3CCS A;  2IW3 A;  4DAV A;  5M3F G;  4ZUI A;  1MGS A;  1QNU A;  1LTG D;  3KF8 B;  5KND A;  4A3K H;  3MEF A;  3KJP A;  3S17 H;  1JE4 A;  4J8Q A;  4K8I A;  1SYC A;  2E76 C;  3QB3 A;  1GVP A;  1M4V A;  4P2C B;  2IHF A;  1I6V C;  1Q8K A;  3S2H B;  1KQS A;  2IWH A;  2UXC L;  4LF9 L;  2MO0 A;  4A3I H;  2YU9 H;  3ONA B;  1TWC H;  1JJC B;  1B70 B;  2LY7 A;  3M3Y H;  2VL6 A;  1K3R A;  4K0K L;  1IL2 A;  3KLW A;  2H5X A;  1UAP A;  3J80 c;  1F77 A;  1CQF A;  2LKV A;  1JJ2 A;  4JI1 Q;  3Q24 A;  2NVT H;  1CQV A;  4A3F G;  1EQT A;  3W2D A;  1Q81 C;  3CCQ A;  1J8I A;  5K5P A;  2F4V Q;  1O7Z A;  4IUP A;  2BE5 D;  4FNF A;  1EFI D;  1G8Z D;  1UUP A;  3FMC A;  1DYQ A;  1S5D D;  2JYO A;  3W1G A;  2RDF A;  1XNQ L;  4CHT B;  2PMZ B;  5EJW A;  4KD4 A;  3KLR A;  1GUT A;  5FLX E;  1OXU A;  4DR5 L;  1XJV A;  1ZEQ X;  1LTS D;  3STB D;  1YNJ C;  2BA1 A;  4ZK9 B;  3H3V I;  5I6Y A;  2N78 A;  1W2B A;  4XYO A;  3QOJ A;  1AH9 A;  2CW0 C;  4DK3 C;  2E5L L;  4PMC A;  5JEA H;  1HHV A;  2GVA A;  3A56 A;  4YWM A;  2JXM B;  2PZU A;  3RZO H;  4UPA A;  4OL7 A;  1JIC A;  2K33 A;  1PZI D;  2WIN B;  1S5E D;  3AEV A;  1OO9 B;  5C4J B;  3TME A;  2E2I H;  3GV6 A;  2F0I A;  2K6A A;  3R8B A;  1NAP A;  1MKH A;  1LV9 A;  5E4X A;  4C3J B;  3U58 A;  5IYD G;  5BR8 L;  3R2I A;  2FMC A;  1PH9 A;  1QJO A;  4ME5 A;  3VYR A;  2B8G A;  2IHE A;  1S40 A;  1VQ4 A;  1PRT F;  2AUJ D;  4KY5 A;  2B8F A;  1D5X C;  2NN6 G;  1JWU D;  4LF8 Q;  3I73 A;  2I5H A;  2EJF C;  2EDG A;  3OMG A;  2J0T D;  1PA6 A;  2UUA Q;  3MZ5 A;  1C7Y A;  4M1U B;  1T5E A;  4IZ8 A;  1MJC A;  2D5D A;  3LX0 A;  3B6Y A;  5COR A;  5CMD A;  2ZTD A;  2NVY B;  3PUZ A;  4HJ7 A;  4DXG A;  2KBN A;  2BCO A;  2DJG C;  3PO3 G;  3M4P A;  4A3D H;  3FPP A;  1PH2 A;  4ID6 A;  1WCM G;  2NTS A;  2C9O A;  3GQB A;  2MFI A;  4KD3 A;  2NVX H;  1E2V A;  5F2D A;  5FOB B;  1WFQ A;  4DV1 Q;  1STN A;  5LMU Q;  2LXK A;  2KHJ A;  4KY6 A;  2JJQ A;  5FLX L;  1SYE A;  3E0E A;  5IGE A;  2QW7 A;  3Q0A A;  1F9R A;  4ZKC B;  1H9R A;  2VQF Q;  1A2U A;  1STG A;  3U9O A;  5C5L A;  4CKC A;  3CQZ B;  5BN5 A;  3TRZ A;  1PTO C;  1A8V A;  1GXD C;  1E22 A;  5M3M H;  1K0S A;  1SRU A;  1GUS A;  2MGS A;  4GN5 A;  4DV0 Q;  3I56 A;  3AMU A;  1D5Z C;  5IIF A;  4R4O A;  1SE4 A;  4ZCK A;  1XXG A;  3DWP A;  5C0X H;  4RAU C;  1B2T A;  1LAC A;  4A3B G;  4Q0F A;  4QL5 A;  4A3G G;  4KLK A;  4BBR G;  4RH6 A;  3OTO Q;  3I90 A;  2EJG C;  2JQO A;  2RCF A;  2KUM A;  1AP0 A;  3BDC A;  2ZXR A;  1E3P A;  2NBF A;  1LO5 D;  1VQE A;  2A6H D;  3ERO A;  1X65 A;  4DV3 Q;  2EYM A;  1A6X A;  2AMC B;  3CCL A;  3S1N H;  1MBY A;  5HUR A;  4JI1 L;  4JC0 A;  1HUM A;  1N36 Q;  4GKK Q;  4XQN A;  1WOC A;  2Z6B A;  3GTM H;  3MC0 B;  3CC4 A;  4IJL A;  4KKS A;  2RDG A;  1MIU A;  1TWG B;  4J1M A;  5I9O A;  1STA A;  1KRS A;  4JI8 Q;  5IGF A;  1MD2 D;  3N6R A;  2K5N A;  4GN3 B;  1HNZ L;  1C48 A;  5KRU A;  2C35 B;  2PW7 A;  3BYT B;  3CCE A;  1EEI D;  5GAH C;  3T51 B;  4A3J H;  3S16 B;  3HOY B;  2R3Z A;  1N34 L;  5C3E H;  1JOK A;  1B9M A;  2N88 A;  5LL6 X;  1HNX L;  2F0P A;  5A35 A;  1D7Q A;  3I4N G;  3FKI G;  3QIA A;  3G6E A;  5IWA Q;  3CKI B;  2RSO A;  5KNC A;  1JB3 A;  2WAC A;  1Y1W G;  3RLO A;  4X62 L;  2Z9H A;  3GD7 A;  2E2H H;  3CPF A;  1NE3 A;  3AFQ A;  3NE5 B;  1SSO A;  1N33 Q;  1S3O A;  5J3B A;  4CGY B;  2HUG A;  4DN4 M;  4NKL A;  3UE1 A;  5C44 B;  1ENF A;  2JA8 G;  1EUJ A;  1TS3 A;  4X3U A;  2HCI A;  1GJX A;  3J81 i;  1GM5 A;  2OTJ A;  1ET9 A;  1Q90 A;  4LF8 L;  1YEZ A;  1JR0 D;  4DR1 Q;  3HOZ B;  1G51 A;  3NTH A;  4K5W A;  1FD7 D;  3HOX G;  3ULJ A;  5ELB A;  1PHJ A;  4TQU S;  4HCS A;  3J80 E;  2LSS A;  2XVS A;  3TEH B;  4A3L H;  4JI4 Q;  4HAE A;  4UY8 C;  3S2H H;  5IOC A;  1A3V A;  2Q8I B;  1HJP A;  1VMP A;  4YWK A;  4TKO B;  4HID A;  2ID0 A;  1XMQ Q;  1PRT B;  4C3J G;  2NZH A;  1PH8 A;  1HXY D;  4GNX B;  1J9O A;  1SDF A;  3Q22 A;  2I5L X;  3F2U A;  4BWG B;  2IT1 A;  5D65 A;  1L1O A;  1QIL A;  3M9B A;  5LMU L;  3RLN A;  2RF4 A;  1JC7 A;  4OEM B;  4AYB B;  3F2B A;  3HOV G;  3H3V C;  1XPU A;  4X3T A;  1HR0 Q;  4EQN A;  4IPG A;  3MFY A;  1LTR D;  2OQK A;  4JCV E;  5DEH A;  3T1Y Q;  1LTA D;  1JT8 A;  5LMN Q;  3KBG A;  1DOM A;  3NQI A;  1TII D;  5KEE A;  1EOV A;  4LF7 L;  4B3T L;  1WTR A;  2K5D A;  4RCO A;  1PH4 A;  1VQJ A;  2XWJ B;  4CKB A;  4N8F A;  5IT9 c;  2CWA A;  2EY5 A;  2R93 G;  3V96 A;  2NVQ B;  2RQX A;  2N49 A;  4R4T A;  2A19 A;  1QZH A;  5ISR A;  3LWU A;  4BBS B;  2UUB Q;  3IKJ A;  2CQA A;  3M7G A;  3OOC A;  3STB C;  1B9N A;  1V9P A;  2L0C A;  3PGZ A;  3H0G B;  4R8I A;  4A93 G;  2F3V A;  1VQC A;  2F0H A;  4CJ2 C;  4HTH A;  1SYF A;  5C4J H;  5TSS A;  1E1T A;  4R8N A;  1VQD A;  3RN2 A;  5K36 G;  4GKK L;  3C1E A;  3E0J A;  4FO2 A;  4YWL A;  1E24 A;  2L55 A;  5KYI A;  2M2L A;  3LNN A;  3OW7 A;  1BF4 A;  2B2Y A;  1X3F A;  2ICE C;  1YNJ D;  5ELO A;  4GLV B;  4DK1 A;  2Q8R E;  2EVB A;  5LHY 1;  2CW0 D;  5FLM H;  4DNR B;  2OXP A;  1MSH A;  2QGQ A;  2ZTC A;  2F0J A;  3PV0 A;  4IUN A;  2F0L A;  2UXB Q;  5FK9 C;  3GTL B;  4PNY A;  1ASZ A;  1YI2 A;  1KLU D;  4XDX A;  2YV5 A;  2ZTE A;  3C2P A;  5IGC A;  1IYU A;  3HOU G;  4A3C H;  2VNU D;  5D3D A;  2NVY H;  4B3S Q;  4O2D A;  3WDN A;  5IWA L;  2WAQ E;  1RTO A;  4JBK A;  1PV4 A;  3T13 A;  3QWN A;  3T53 B;  1DON A;  3VR5 A;  5FJ8 H;  1CKO A;  4EVO A;  3ERQ A;  4GKJ Q;  5GAE C;  1Q46 A;  4JI5 Q;  4DU9 A;  1NY4 A;  4JBW A;  2Y0S E;  3GV3 A;  3MXP A;  2NN6 I;  4C3H G;  1EY4 A;  3TP5 A;  3JAM i;  4DUZ L;  2AUK A;  2X6G A;  3ITP A;  5I4D A;  2WAQ G;  1XTD A;  2ZJQ A;  3T4A C;  5K36 H;  1PTO F;  3CQZ H;  1CTM A;  1QE6 A;  3I4L A;  1SMY C;  2K5H A;  4PZ7 A;  5COY A;  4DR1 L;  4FF4 A;  1C0A A;  3VR6 A;  3CU7 A;  1H9S B;  5EKK A;  4DR7 L;  3QOL A;  3H91 A;  5D3I B;  1M1K C;  3MXN A;  5EAY A;  3MAQ A;  1AFP A;  3GTG B;  3F2C A;  1XMQ L;  2EYF A;  1EWC A;  1OXV A;  1ASY A;  1W6K A;  3FPU B;  5C5M A;  3OSO A;  3VR2 A;  4BY7 B;  2A69 C;  4OO1 H;  4CDC C;  1WTH A;  2NZO A;  4V0B A;  4LNQ A;  3V2T A;  1ENA A;  3WOE A;  3EJI A;  3UDF A;  2WKD A;  3T1Y L;  1JWS D;  1SYB A;  1Q1E A;  1TWG H;  1YVC A;  2JEA I;  1F2Z A;  1K0R A;  3A74 A;  5JAV A;  1ESF A;  2A5H A;  5ELN A;  2R92 G;  4IFD G;  1A3T A;  2EYP A;  3MA2 B;  4F7X A;  2RSN A;  3NBH B;  3HOY H;  3FHW A;  5CV5 A;  5ELC A;  2Z0S A;  1H9K A;  1GD7 A;  1NBW A; 
#chains in the Genus database with same CATH homology
 2HQL A;  3L7Z C;  1XNQ L;  4JYA L;  4HIM A;  4UP9 A;  4QGU A;  3T1H Q;  1OXU A;  1P8L A;  1VQI A;  1QVC A;  5HGQ A;  4HJ9 A;  1E7Z A;  4DR5 L;  1XJV A;  4LF6 L;  2JA7 G;  3PO3 H;  2PNH A;  1L0W A;  5IE8 A;  1A0I A;  3KDF A;  3STB D;  3CCJ A;  1YBY A;  1X56 A;  3J81 j;  2BA1 A;  4DV5 L;  4JI8 L;  3PF5 A;  1R9T H;  2I0Q A;  2JA5 H;  1FJG L;  3H3V I;  4B3R Q;  1WCM H;  1K73 C;  2N78 A;  1W2B A;  1AH9 A;  4DK3 C;  2E5L L;  2MNA A;  4QY7 A;  3U50 C;  2Q2T A;  3GTQ H;  1NMF A;  1VS0 A;  2GVA A;  2E2J H;  4YWM A;  4BXX G;  3RZO H;  1Q7Y C;  5C44 H;  4UPA A;  4IOA A;  1LM0 A;  4FDB A;  1LTL A;  2YTX A;  1I94 Q;  2IX1 A;  4A3K G;  1X55 A;  3AEV A;  5HY6 A;  5IP7 G;  3L2P A;  1KL9 A;  4AQY L;  2E2I H;  4NXN Q;  2LXJ A;  2KEN A;  3I2Z A;  4TVA B;  4DR6 L;  2RCN A;  2WFW A;  3KF6 B;  2MQH A;  1CSP A;  3J7A 5;  4OO1 G;  2KCT A;  4WJ4 A;  1MKH A;  3BJU A;  2D0O A;  1K9M C;  3HOZ H;  3OYY A;  3U58 A;  4YY3 L;  4A3I G;  2RHQ B;  5IYD G;  5BR8 L;  3CME A;  2PI2 A;  3RN5 A;  3CAM A;  2HHH Q;  1PH5 A;  2UUC Q;  1UE6 A;  2IY5 B;  1NMG A;  3H0G G;  3KJO A;  3F2D A;  4BA1 I;  1W3S A;  3PUY A;  1PH9 A;  4IPC A;  1N33 L;  3PCO B;  5C0X I;  4YCW A;  3NEM A;  2IHE A;  1S40 A;  4A3B H;  4A3G H;  4X66 Q;  2FXQ A;  1VQ4 A;  4BBR H;  4JI6 Q;  3RZD H;  4B3S L;  2VUM G;  4WJ3 M;  3J80 i;  4JI3 L;  1BKB A;  2NN6 G;  4LF8 Q;  1AE3 A;  1L2F A;  3K7U C;  4A3M H;  2XTI A;  2I5H A;  5JEA J;  1PA6 A;  2UUA Q;  3JC6 6;  3LGJ A;  1YHQ A;  1VQ9 A;  1C7Y A;  4MTN A;  2K75 A;  2ZJP A;  1MJC A;  3HOY G;  3B6Y A;  4DUZ Q;  2ZTD A;  3PUX A;  4DV2 Q;  3FP9 A;  2YYZ A;  4DUY L;  3AQQ A;  3PUZ A;  4HJ7 A;  2OWO A;  4DR3 L;  2KBN A;  1YHA A;  1RIP A;  1S72 A;  1KC8 C;  4LFA L;  1LYL A;  3W1B A;  3PO3 G;  2VS1 A;  3M4P A;  3AYH B;  3EN2 A;  4A3D H;  1JJG A;  4DR7 Q;  1QZG A;  4JI4 L;  3H3V H;  2JA5 G;  1PH2 A;  4P74 A;  1AE2 A;  5AJ3 Q;  1WCM G;  2BH8 A;  4YHH L;  2MFI A;  2NVX H;  2F3I A;  4LF4 Q;  4L5S A;  1WFQ A;  4GOP A;  1SRO A;  4DV1 Q;  4JI0 L;  5JEA G;  4BXX H;  5LMU Q;  2LXK A;  2KHJ A;  2JJQ A;  3PIO A;  4LFB Q;  4IFD J;  4OX9 L;  4ME3 A;  5C44 G;  2CCZ A;  1CKN B;  3E0E A;  4LF5 L;  2B63 H;  1I6H H;  1X3G A;  2PQA A;  4DPG A;  1EYG A;  3DLL A;  2NVQ H;  3U4Z A;  3G4S A;  2Q2H A;  3HOW H;  2VQF Q;  3OW2 A;  4X64 L;  1CUK A;  1V43 A;  3TRZ A;  2ATW A;  1VQF A;  2QA4 A;  1A8V A;  2KCM A;  3ICE A;  5JJK A;  4BBS H;  1HR0 L;  1E22 A;  3HOZ G;  2K50 A;  5M3M H;  3I4N H;  1SRU A;  4GN5 A;  3FKI H;  3A0J A;  4DV0 Q;  3I56 A;  1XNR L;  4JI7 Q;  3H0G H;  4QIW E;  3S1M H;  2UXC Q;  4OON A;  4R4O A;  3G48 A;  1Y1W H;  3CC2 A;  1WJJ A;  5LMN L;  4A3B G;  4QL5 A;  4A3G G;  4K0K Q;  2UXD Q;  4KLK A;  4BBR G;  4OWX B;  2R7Z G;  3CXC A;  1IBL Q;  1N32 L;  1KRT A;  3OTO Q;  2N3S A;  2JQO A;  2HIV A;  3M4O H;  1GKH A;  1X9N A;  4L5R C;  1L1O C;  1TWF H;  4DR4 L;  4A3M G;  2YTY A;  3MXN B;  4JV5 Q;  1E3P A;  3M7N A;  1VQL A;  2JA8 H;  1VQE A;  3RR5 A;  4DK6 C;  5GAD C;  4POF A;  2F4V L;  1L1O B;  3AFP A;  4QQB X;  1X65 A;  3TQY A;  4IPD A;  4PMW A;  3J81 c;  4DV3 Q;  4X65 L;  2AMC B;  3CCL A;  2WP8 J;  3S1N H;  2GN5 A;  2A8V A;  4DV4 Q;  3F8T A;  2UUB L;  4LFC L;  4JI1 L;  2UU9 L;  3L0O A;  4JC0 A;  1J5E L;  4LUZ A;  1N36 Q;  4AYB G;  5IYB H;  4GKK Q;  3CD6 A;  1WOC A;  1P16 A;  4C3I H;  3HOX H;  1XNQ Q;  1XPR A;  3GTM H;  1K83 H;  2CWP A;  2A1A A;  3CC4 A;  3HKS A;  4IJL A;  2CFM A;  1EIY B;  2OQ0 A;  1IBM Q;  4A3D G;  3IRB A;  3GTL H;  1MIU A;  1PH3 A;  4DR5 Q;  3CCU A;  3CW2 C;  4LF6 Q;  4B3M Q;  1UE7 A;  4DR2 L;  1SE8 A;  2JK8 A;  4DV5 Q;  1KRS A;  3KFU A;  4JI8 Q;  1FJG Q;  4BY7 G;  3T1H L;  4A76 A;  2BA0 A;  2K5N A;  5GAG C;  4GN3 B;  1TWA H;  1I3Q H;  1U0L A;  4PZ6 A;  1YHB A;  1HNZ L;  4A3E H;  1LUZ A;  2C35 B;  3ERS X;  4C3J H;  1VQ6 A;  4QJF A;  3CCE A;  1VQM A;  4POG A;  5GAH C;  3ULP A;  4A3J H;  2B63 G;  3S14 H;  4IO9 A;  2D62 A;  4H02 A;  3H15 A;  1N34 L;  3HOW G;  5C3E H;  1Q82 C;  2AHO B;  4RG1 A;  1IXR A;  1NJI C;  3PF4 A;  4NB3 A;  1HZB A;  4P72 A;  1XMO L;  4AQY Q;  1C9O A;  3EIV A;  1HNX L;  4BBS G;  2UXB L;  1D7Q A;  2VY3 A;  5M3M G;  3I4N G;  4JOI A;  3HOV H;  3FKI G;  4DR6 Q;  1JE5 A;  1B8A A;  1SMX A;  1FGU A;  5IWA Q;  3G6E A;  4KHZ A;  4YY3 Q;  4PG3 A;  1VQN A;  4NXN L;  4GN4 B;  5BR8 Q;  1Y1W G;  3TRE A;  3UE0 A;  1I5F A;  1Z9F A;  2K5V A;  3RLO A;  5C0X G;  2VW9 A;  4X62 L;  2R7Z H;  3D31 A;  3GD7 A;  2E2H H;  3CPW A;  3HKZ G;  3CPF A;  3AFQ A;  1NE3 A;  1N33 Q;  4P73 A;  3A5Z B;  1S3O A;  5J3B A;  1E1O A;  4LWC A;  4OO1 I;  3S1R H;  3S2D H;  4MNO A;  4DV7 Q;  1SR3 A;  2UUC L;  4GKJ L;  4JI3 Q;  3UE1 A;  4JI5 L;  2JA8 G;  4NXM Q;  3RNU A;  1EUJ A;  4DAY B;  5FLX c;  1PYS B;  1Y14 B;  2L15 A;  4X66 L;  2R93 H;  3UDX A;  3GTO H;  2K4K A;  4IPH A;  3J81 i;  1GM5 A;  2OTJ A;  1CKN A;  4GLA C;  4OXP A;  3GTG H;  3GTK H;  4LF8 L;  3K80 C;  1YEZ A;  2RHS B;  3CMA A;  2V1C C;  4DR1 Q;  4PZ8 A;  1G51 A;  5IYC H;  1Q86 C;  1UE1 A;  2MO1 A;  5IYB G;  1PH1 A;  3EBE A;  3ER0 A;  3HOX G;  1Z47 A;  4A93 H;  1DGS A;  4DR3 Q;  3ULJ A;  1PHJ A;  1VQ5 A;  4TQU S;  3GTP H;  4LFA Q;  1HZC A;  1PFS A;  1WI5 A;  1OTC A;  1FL0 A;  3E9H A;  2LSS A;  3KOJ A;  3TEH B;  4A3L H;  1VQK A;  3K8A A;  4EQ5 A;  4JI4 Q;  4BY7 H;  1VQA A;  4UY8 C;  3S2H H;  4RMF A;  3S24 A;  1KIX A;  4OWW B;  1HJP A;  4YWK A;  4DKA C;  1V1Q A;  5M5Y H;  4HID A;  4GNX C;  2ID0 A;  2JA6 H;  4A3E G;  1XMQ Q;  1KXL A;  1N8R C;  1XPO A;  2Y0S G;  2NZH A;  3K7A H;  1IBK L;  4JI0 Q;  1PH8 A;  3Q8D A;  4GNX B;  4A3J G;  4L5Q A;  3ULL A;  1EFW A;  2I5L X;  4LF5 Q;  2WB1 E;  5C3E G;  4UP8 A;  1X3E A;  1EWI A;  2B3G A;  2IT1 A;  2KHI A;  4O0A A;  1L1O A;  4J15 A;  1M90 C;  5LMU L;  3M9B A;  1G29 1;  3RLN A;  4LFB L;  4JYA Q;  2RF4 A;  4X64 Q;  1Y1V H;  1HNW L;  1TXY A;  3F2B A;  2IX0 A;  1JMC A;  4YCV A;  3HOV G;  3SGI A;  1XPU A;  1SN8 A;  4LF9 Q;  1HR0 Q;  4JBM A;  1VCI A;  4HIO A;  3S1Q H;  4IPG A;  4JG2 A;  1XNR Q;  4AYB E;  3TS2 A;  2OQK A;  4JCV E;  3T1Y Q;  2CQO A;  4JI2 L;  3HOU H;  4DV6 L;  1JT8 A;  2EQS A;  3F1Z A;  4KHP L;  4JI7 L;  2R6G A;  5LMN Q;  2WB1 G;  2VQE Q;  3D0F A;  1HR0 W;  1N32 Q;  3I4M H;  4LF7 L;  1EOV A;  2DGY A;  3RLF A;  4MZ9 A;  4B3T L;  5IP9 H;  1NTG A;  1PH4 A;  2B29 A;  2CKZ B;  3GTJ H;  1VQJ A;  2K14 A;  4DR4 Q;  5IT9 c;  2UXD L;  1HH2 P;  2CWA A;  2R93 G;  2N49 A;  1YJ9 A;  1HZA A;  1IBL L;  4R4T A;  3BZC A;  4BY1 G;  3HFZ B;  5LMN W;  1QVF A;  2A19 A;  2EXD A;  1QZH A;  2AWN A;  5IYC G;  4C3H H;  3ZJY C;  2UUB Q;  4LFC Q;  2ZM6 L;  1B7Y B;  2DUD A;  3I7F A;  3KF6 A;  3STB C;  2UU9 Q;  1IYJ B;  4P71 A;  1QUQ B;  1V9P A;  3BZK A;  3PGZ A;  3JAM c;  4R4Q A;  4A93 G;  1T9H A;  3M85 A;  1YNX A;  4OWT B;  1VQC A;  2I5M X;  1VQ8 A;  2ES2 A;  4Y52 H;  1BBU A;  4X6A H;  2VZA A;  3S16 H;  4DV4 L;  5C0X J;  1YIT A;  5C4J H;  2R7D A;  4R1J A;  2D0P A;  1E1T A;  4A3L G;  1VQD A;  3RN2 A;  5K36 G;  4GKK L;  1PVO A;  5M5W H;  1X6O A;  1VQH A;  2Z6K C;  4YWL A;  3VDY A;  4HJ8 A;  4DR2 Q;  1VQO A;  2E5L Q;  1HZ9 A;  3BU2 A;  2JA6 G;  1E24 A;  4HJA A;  4AH6 A;  3CF5 A;  1EQQ A;  1IBM L;  4B3R L;  3HKZ E;  1HNZ Q;  1CSQ A;  3PUW A;  1OXX K;  4B3M L;  1X3F A;  1KHI A;  1VQB A;  5GRO A;  3PIP A;  2PMZ E;  5ELO A;  4A4I A;  2E8G A;  1GO3 E;  3GO5 A;  2ZJR A;  1PH7 A;  5JJI A;  4GLV B;  5IY0 A;  1H95 A;  4P75 A;  1N34 Q;  3K0X A;  5FLM H;  4KI0 A;  1I94 L;  5JJL A;  1Y1V G;  3CP0 A;  2QGQ A;  2ZTC A;  3PV0 A;  5M3F H;  1XMO Q;  2JEB I;  1VQG A;  1HNX Q;  2UXB Q;  1G6P A;  1D8L A;  3KYH C;  5C4X H;  1ASZ A;  1YI2 A;  4R4I A;  2XGT A;  1SFO H;  2YV5 A;  2ZTE A;  1Q12 A;  4YCU A;  4A3C H;  3HOU G;  3NEL A;  2JA9 A;  2GVB A;  2VNU D;  3E9I A;  2NVY H;  4KHP Q;  2N8N A;  1UE5 A;  4B3S Q;  3KDF B;  1I50 H;  4O2D A;  4X62 Q;  2YTV A;  4IOC A;  1Q1B A;  5IWA L;  2HHH L;  3CCR A;  2WAQ E;  1K8G A;  4UP7 A;  4JBK A;  3I4M G;  4DNI A;  4AIM A;  1PV4 A;  4A75 A;  4R4C A;  4EX5 A;  3UDI A;  2ALY B;  5FJ8 H;  1CKO A;  1U5K A;  2OCE A;  4LUV A;  5IP9 G;  4JI6 L;  2Q2I A;  4GS3 A;  1X54 A;  1Q46 A;  5GAE C;  4JI5 Q;  4GKJ Q;  1NY4 A;  4BY1 H;  4JBW A;  2Y0S E;  3K81 C;  2K52 A;  4GNX A;  4Y7N H;  4GLX A;  1VQ7 A;  2F52 A;  1CKM A;  1TWH H;  4LW1 A;  4DV7 L;  3S15 H;  2UUA L;  2NN6 I;  2R92 H;  1A62 A;  1O7I A;  4NXM L;  4DUY Q;  4HJ5 A;  1WYD A;  4A3F H;  2QEX A;  3JAM i;  1UWV A;  4DUZ L;  4JOI C;  3U4V A;  4DV2 L;  3PO2 H;  2WAQ G;  1XTD A;  4LUO A;  1RL2 A;  2HIX A;  1SLJ A;  5M5X H;  2ZJQ A;  3PSI A;  3CQZ H;  4DR1 L;  1KD1 C;  2K5H A;  4PZ7 A;  2AWO A;  3G71 A;  1C0A A;  4YHH Q;  1OXT A;  3PUV A;  3TS0 A;  4DR7 L;  4C2M H;  4JBJ A;  3A5U A;  2JA7 H;  3W5O A;  1QVG A;  2HT1 A;  2PI2 E;  3UDG A;  5AJ3 L;  1JB7 A;  3I4O A;  1YIJ A;  1M1K C;  4OX9 Q;  3CCM A;  4XTC S;  5EAY A;  1A63 A;  4LF4 L;  1IBK Q;  1KAW A;  1J6Q A;  1OXS C;  4DV1 L;  3M4Q A;  2JE6 I;  1YJN A;  3F2C A;  1XMQ L;  3CCV A;  5FLM G;  1PYB A;  4XIG S;  4ALP A;  2EIF A;  3CCS A;  2AKW B;  1BBW A;  2R7F A;  5M3F G;  1OXV A;  1ASY A;  3I55 A;  2VQF L;  3KF8 B;  4A3K H;  3S17 H;  3MEF A;  3KJP A;  2Q2U A;  1HNW Q;  5C4X G;  3J7Z C;  5IP7 H;  1BVS A;  5DLQ E;  4L5T A;  1QUQ A;  1GVP A;  4A3C G;  5GQO A;  2IHF A;  4DV0 L;  1Q8K A;  3GDE A;  1FVI A;  4HIK A;  1KQS A;  2NZO A;  4JI2 Q;  4IFD I;  2UXC L;  4LNQ A;  1N9W A;  1MJE A;  4LF9 L;  4DV6 Q;  2MO0 A;  4A3I H;  2OTL A;  2YU9 H;  5IYD H;  1TWC H;  4GOP C;  1JJC B;  1B70 B;  3UDF A;  1EIF A;  3M3Y H;  5FJ8 G;  2VL6 A;  1K3R A;  1YZ6 A;  3T1Y L;  1VQP A;  4K0K L;  1IL2 A;  1Q1E A;  4LF7 Q;  4GOP B;  4B3T Q;  1TWG H;  3KLW A;  3OTO L;  1YVC A;  2H5X A;  2JEA I;  1K0R A;  3A74 A;  1UEB A;  5H1S E;  3J80 c;  2Z6K A;  2VUM H;  4X65 Q;  4JV5 L;  2VQE L;  1JJ2 A;  2PQA B;  4APV A;  4DAM A;  1EQR A;  4JI1 Q;  3DM3 A;  4IJH A;  5ELN A;  2R92 G;  1J5E Q;  1YJW A;  3WWV A;  4IFD G;  2NVT H;  1PH6 A;  4DV3 L;  4A3F G;  2BH2 A;  1Q81 C;  3CC7 A;  3CCQ A;  4BA2 I;  2ZM6 Q;  3NBH B;  3PO2 G;  1IZ6 A;  2F4V Q;  3HOY H;  3FHW A;  3NEN A;  2ASB A;  4NPS A;  2Z0S A;  5E7N A;  1N36 L;  1K8A C;  1GD7 A;  3W1G A;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...