4LFAL

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lfaL00
3W5OA 1K0RA 3F8TA 3M85A 4GNXC 1QZGA 4JCVE 3WWVA 5H1SE 2JA7H 4JYAL 5AJ3Q 5LMNL 4Y52H 5C44H 3CC2A 1D7QA 3STBD 4LF8Q 2N49A 4OX9Q 3PV0A 1DGSA 1NMFA 4QJFA 5C4JH 2CWAA 2LXKA 4DV1Q 1VQPA 4BA2I 2WB1E 1WI5A 2JEBI 4LFCQ 4AH6A 1QVCA 5JJIA 3DM3A 2IX1A 1YIJA 2AWNA 3PSIA 1PYBA 4JOIC 1N34L 1XNQL 2F4VL 1HZBA 1XMQQ 1PH4A 4JI3L 4NB3A 4GKJL 3J7ZC 4LF5Q 2R93H 2AHOB 3ERSX 1W3SA 3KDFA 3I55A 3KF6A 1SR3A 3RLFA 1SMXA 4C3HH 3NBHB 2YV5A 4DPGA 1VQ5A 4C3JH 4JI6L 4QY7A 4AQYQ 1MJCA 5IYCG 4DR4L 2MFIA 1HR0L 5J3BA 4LNQA 1EWIA 1QUQA 3I4OA 3GTJH 3AFQA 2NVYH 4A3GG 4NXNL 3KLWA 4KLKA 1N32L 2R6GA 2F4VQ 1N36L 1U0LA 2Q2IA 1X54A 4J15A 1VQJA 3S24A 3K7AH 1XMOQ 1VQ9A 2CCZA 4B3SL 4LF7L 4O0AA 1SROA 1HR0W 2N78A 2AWOA 3T1HQ 1HZAA 5M5XH 4LUVA 2R92H 2IX0A 5K36G 1UE1A 4B3SQ 1N8RC 2B3GA 4DV3Q 4A3KH 1YZ6A 3S15H 1PH5A 2VNUD 1TWHH 1C9OA 2DGYA 4RG1A 4A3FH 3TS0A 1K83H 1TXYA 3RLNA 1PH7A 4YHHQ 1IBML 4JI2L 4IFDJ 4DAYB 3CCJA 1V1QA 1ASYA 1N33L 3S1MH 1VQGA 5C0XG 1KD1C 2UUAL 4GLVB 2DUDA 1K3RA 2NN6I 5IE8A 5M3FG 2YTVA 1M90C 1G6PA 1Y1WG 3HOXH 4EX5A 2I5HA 5FLMG 2AKWB 4X65L 2D0OA 4OONA 2JE6I 4DR7Q 4AQYL 5ELOA 3CW2C 3A74A 2HIXA 3U58A 4OWTB 1TWAH 2K50A 2OQ0A 3KJPA 5LMNW 1KRSA 4JBJA 2MO1A 3IRBA 2ZTDA 1N9WA 4IOAA 3HFZB 1PH2A 2UUBQ 1YBYA 4PMWA 3F2CA 1OXUA 4QL5A 4A3IG 5IT9c 2ES2A 3S17H 3D0FA 3GTKH 5M3MG 3A5UA 1GVPA 5IYBG 2ZJPA 4A3MG 1N33Q 3L0OA 1Q86C 5C4XH 3I2ZA 2K4KA 4GLXA 1VQ6A 2C35B 4X62Q 4A3EH 1Z9FA 4BA1I 1XMQL 2BA0A 1Y1VG 2KHIA 1VQEA 3I56A 1AE3A 1LUZA 4DR3Q 1UE7A 2VQEL 1MJEA 2N3SA 3MXNB 1ASZA 1VQFA 4L5SA 3H3VH 4B3TL 1UWVA 4IJHA 4UPAA 4DR5L 3CQZH 3K7UC 3J81i 3PIPA 1XMOL 2Y0SE 4P71A 3SGIA 3I4MG 4KHPL 3G4SA 4MTNA 5LMUQ 3CP0A 1V43A 2PI2E 1UE6A 2JK8A 1QVGA 1G291 4A93G 4KHZA 4GNXA 1WJJA 1IBKQ 1YHQA 4Y7NH 1I50H 4DV3L 5IYDH 1HJPA 3OTOQ 1IBLL 2E5LQ 1N32Q 2JA8G 5JEAG 5GQOA 1YNXA 2JA5H 1RIPA 5E7NA 4GKKL 3HOWG 3HKZG 4XIGS 4X64Q 1J5EQ 1HNXL 1EIFA 1A62A 3U50C 2BA1A 4GOPB 4OXPA 2UUAQ 1FJGQ 4KI0A 3CMEA 1NE3A 4YY3Q 4LFBL 2R7ZG 4DR5Q 3PUZA 3S16H 4RMFA 3AFPA 4JV5Q 1EQQA 1MKHA 4R4IA 4DNIA 2NVXH 2HQLA 1QVFA 5C0XI 1Y14B 3NELA 2UXCQ 4DV7Q 1E3PA 1GO3E 1E24A 3M4PA 4R4OA 3JAMc 3HOXG 1JMCA 4LFAL 3KOJA 1KQSA 1LTLA 1I94Q 5M5WH 1IBMQ 1QUQB 1OXTA 4L5TA 3S14H 4BY7G 1NTGA 1HH2P 1AH9A 2UXBQ 5BR8Q 2E5LL 1Q1BA 3UE1A 4QGUA 4DV0L 1HNZQ 3GTOH 1X3EA 3I4NH 1YJNA 4IFDI 4EQ5A 4BXXH 3K80C 2OTJA 4LF6Q 5HY6A 1EFWA 3HOYG 5LMUL 2L15A 3FP9A 4A76A 4NXMQ 4LWCA 2UUCL 2UXDL 1E22A 2I5MX 3OW2A 4A3BG 5C4XG 1WCMH 4ME3A 5IYBH 3ZJYC 3CCEA 3ER0A 1GD7A 2IY5B 4JG2A 5JEAJ 1L2FA 3J81c 2E8GA 1PYSB 3UDFA 2EIFA 3CCMA 4WJ3M 4LW1A 1QZHA 3J80i 1RL2A 4JI4L 2Z0SA 2KCMA 3VDYA 1XPRA 2NVTH 3M7NA 2B29A 4DV2L 4B3ML 4WJ4A 2F3IA 2ID0A 1GM5A 1VQKA 2Q2TA 4BY1H 4B3RQ 1PVOA 2K5HA 1K73C 3HKSA 3BZKA 1D8LA 4LUOA 4BBRH 1WYDA 3PGZA 2VW9A 5JJKA 1R9TH 1Q8KA 4A75A 1NJIC 1N34Q 1XNQQ 3CC7A 4LFAQ 1HR0Q 5HGQA 1JB7A 1VQOA 4JI3Q 4K0KQ 1GKHA 1A63A 4KHPQ 3I7FA 1NBWA 1VQHA 2UXBL 3DLLA 1JJGA 1HNWL 1VQBA 4A3LG 2VQFQ 4GN4B 1IZ6A 3UDXA 2NZHA 3PO2H 2R7ZH 2UXCL 3BZCA 4JI5Q 4B3MQ 4DR4Q 2JA6H 4AYBE 1B8AA 1Z47A 2OQKA 3G48A 4DV4L 4DV5L 1PH3A 3TREA 1PV4A 1MIUA 2GN5A 1I5FA 4P74A 1VCIA 1P8LA 2VL6A 4DAMA 4A3GH 1E1OA 2CQOA 3OYYA 3KDFB 5GADC 2HT1A 4JI0L 2KCTA 2JA7G 2CFMA 1IYJB 1EOVA 3H15A 3PO3H 4X6AH 1NMGA 1X56A 2UU9Q 4NXML 2PQAB 4DV7L 3UDGA 3CXCA 4A3CG 1CSQA 2WP8J 1KRTA 1VQLA 3HOZG 3I4MH 3J81j 4IFDG 2K5VA 2YYZA 1VQIA 3AQQA 4A3DH 1JE5A 2VZAA 2H5XA 2JA6G 4BBSH 1X3GA 1HZ9A 3RZOH 4A4IA 3K0XA 4JI5L 3PIOA 4DV6Q 1VQDA 4HIMA 2A19A 2WB1G 4JOIA 4DV4Q 2JA8H 2CWPA 5AJ3L 5LMNQ 1KC8C 3MEFA 2FXQA 4B3RL 1Q1EA 1X3FA 4GLAC 2MNAA 2UUCQ 1YI2A 2UUBL 2VUMG 2UXDQ 4JI1Q 5M5YH 3HOZH 1LYLA 5IY0A 5ELNA 1SN8A 1PFSA 4MZ9A 3M3YH 4LFCL 3RZDH 4JI8L 1E1TA 1A0IA 3ULJA 4JI4Q 3HOUG 1EUJA 2XGTA 3B6YA 1BBUA 3K8AA 1SRUA 3HKZE 4YWLA 2YTXA 5IP7G 4OX9L 4GKJQ 4OO1G 3JC66 3L7ZC 4DR1L 4DR6L 4BY1G 4UP7A 5C0XJ 1IXRA 3GD7A 3W1GA 1U5KA 4JI0Q 1YJWA 3KF8B 4YCUA 2YU9H 3M4OH 2V1CC 5GROA 3TEHB 3CPFA 4L5QA 4YWKA 4A3EG 4LFBQ 4DV5Q 2ZTEA 1TWFH 3GTPH 1Y1VH 2ZTCA 4R4QA 4JI1L 5FLXc 4HJ5A 3CC4A 2R92G 1Q46A 2IHEA 2NZOA 4JV5L 4K0KL 4GOPC 2I5LX 3CPWA 1OXSC 1LM0A 2B63G 4HJ9A 1SFOH 3STBC 3LGJA 3RN2A 1EYGA 2ZJQA 2GVAA 1BBWA 1X9NA 1HNXQ 4POGA 2JA9A 4R4TA 3KJOA 4LF7Q 1YEZA 2JEAI 2IT1A 1JT8A 4DR1Q 3T1HL 4DV0Q 2A1AA 1FJGL 1N36Q 4PG3A 2E2IH 3S1RH 5M3FH 4L5RC 1IL2A 2XTIA 3GTGH 3RN5A 4QQBX 3CD6A 4X66L 3UDIA 5FLMH 5GAGC 2ALYB 2JQOA 4PZ8A 3U4VA 4BBRG 4YCVA 1KL9A 2IHFA 4X64L 3CCVA 3EBEA 2CKZB 2LSSA 1S3OA 1YJ9A 1WOCA 4LF9Q 2EXDA 4DR2L 4HIKA 4APVA 4LUZA 1CKOA 3J80c 4P75A 2PNHA 2ATWA 2WAQE 4YWMA 5IP9H 3T1YL 3K81C 1JJ2A 2GVBA 2Y0SG 5GAEC 3CMAA 2B63H 1VQMA 4TVAB 2Q2UA 1TWGH 4BXXG 2F52A 3Q8DA 1P16A 3PCOB 3RLOA 4JI7Q 3S1QH 2A8VA 2ZJRA 4HIOA 5BR8L 4JBKA 4X65Q 2QGQA 2HHHL 1PA6A 3ICEA 5IYDG 3GTLH 3H0GH 3I4NG 4C3IH 4GKKQ 4R4CA 3NENA 1XPOA 2R7FA 4GN5A 3J7A5 1L0WA 1W2BA 4C2MH 4JI8Q 1B70B 4DV1L 2QEXA 4HJ8A 1FL0A 4AYBG 3FKIH 1KHIA 3TS2A 4IJLA 4DR6Q 1YVCA 1X65A 4GS3A 4X62L 4IO9A 2I0QA 2R93G 3GO5A 4DV2Q 5DLQE 2VQEQ 1VQAA 1Q7YC 3NEMA 4IPHA 4UP9A 1AE2A 2RF4A 4OWWB 1TWCH 4QIWE 3HOVG 4A3JG 1V9PA 3KYHC 3E9IA 2E2JH 4OWXB 4X66Q 2VQFL 3CCSA 1YHAA 3OTOL 2PMZE 4IOCA 1CUKA 1IBLQ 1C0AA 1NY4A 1OXVA 3UE0A 1HZCA 1PH6A 3TRZA 4HJ7A 3FHWA 2ZM6L 4LF9L 3KF6B 2BH8A 2VS1A 4R1JA 4DUZL 2NVQH 1BVSA 2R7DA 4DR2Q 4JI7L 3M4QA 1K9MC 4O2DA 3RNUA 3HOUH 2D62A 2HHHQ 3S2HH 1L1OA 3T1YQ 3GDEA 2VY3A 3E0EA 4OO1I 3BU2A 1BKBA 2OCEA 1WFQA 4JI6Q 5JJLA 3A5ZB 2JJQA 3EN2A 4DKAC 3HOVH 2K52A 3F1ZA 2PQAA 1G51A 2KBNA 4YY3L 5IWAL 1B7YB 4A3KG 1CSPA 1J6QA 3S2DH 1KAWA 1XNRL 2ASBA 4AIMA 1X55A 3CCQA 4LF4L 5C3EG 4DK3C 4PZ7A 1HNZL 2JA5G 1S72A 2MQHA 4DV6L 1XJVA 4JC0A 3S1NH 1CKNB 2KENA 1O7IA 1L1OC 4YHHL 4GN3B 3L2PA 4FDBA 4UP8A 4DK6C 4GOPA 1A8VA 2D0PA 3CCRA 3PF5A 4A3DG 2HIVA 3M9BA 1XPUA 2LXJA 4IPGA 5C44G 3GTMH 4H02A 3H3VI 3A0JA 4DR7L 3FKIG 1VQ8A 3ULPA 1YHBA 3GTQH 3CAMA 1L1OB 2KHJA 2Z6KA 3TQYA 3H0GG 2RHSB 3BJUA 1T9HA 5FJ8H 4DUYL 4DUZQ 1PH9A 4GNXB 4BY7H 3CCLA 4LF4Q 4YCWA 1UE5A 1EQRA 3W1BA 1Q82C 1Q81C 1M1KC 2VUMH 2WAQG 4IPCA 3CCUA 4MNOA 3AYHB 2QA4A 4A3FG 3RR5A 2AMCB 4JYAQ 1VS0A 4LF5L 5C3EH 4HJAA 5IP9G 2OTLA 3PO2G 4POFA 2ZM6Q 1WCMG 4PZ6A 1OXXK 2WFWA 4A93H 2EQSA 1SLJA 4DR3L 4A3BH 1YITA 2Q2HA 3JAMi 5FJ8G 1FGUA 3G6EA 4B3TQ 2K75A 3HOWH 4DUYQ 3PF4A 1I3QH 1VQ4A 4BBSG 4JBWA 4A3LH 2RCNA 1UEBA 1HNWQ 1CKMA 2NN6G 1J5EL 3PO3G 1E7ZA 4P72A 4LF8L 1PH1A 4UY8C 1H95A 1OTCA 4A3CH 3PUXA 1IBKL 1PHJA 1KXLA 1VQNA 5IYCH 3PUVA 3EIVA 3PUWA 4XTCS 3U4ZA 1PH8A 1KIXA 3CF5A 4P73A 1FVIA 3F2BA 1VQ7A 2OWOA 1VQCA 2K14A 1Q12A 2UU9L 4A3IH 2K5NA 2YTYA 4NXNQ 3AEVA 2MO0A 5GAHC 3E9HA 4HIDA 2RHQB 2E2HH 3PUYA 5EAYA 5IWAQ 3G71A 3KFUA 4TQUS 4JBMA 1K8AC 1SE8A 1XTDA 4A3MH 1X6OA 1I6HH 1XNRQ 2PI2A 5M3MH 1JJCB 4IPDA 4JI2Q 4A3JH 4NPSA 1K8GA 2BH2A 4ALPA 4LF6L 3HOYH 1EIYB 2N8NA 3D31A 1S40A 1CKNA 1I94L 3ULLA 3F2DA 2Z6KC 5IP7H 1Y1WH 1C7YA
chains in the Genus database with same CATH superfamily
1KDAA 3F8TA 2A74C 3QR8A 1Y1WB 3KF8A 3VYTA 1BCPD 4JYAL 5AJ3Q 4Y52H 5C44H 2P5ZX 4OIJA 4LF8Q 2N49A 1B50A 4DV1Q 1MBYA 2DJFC 3RUZA 4LFCQ 2RSNA 5JJIA 5D3IB 4ZKCB 3BVMA 1XNQL 2AWNA 3PSIA 2F4VL 1B3AA 2IX1A 1JQYD 1PH4A 5EKIA 3S1NB 4C3JB 3S9WA 3I55A 3KDFA 3KF6A 3SK8A 4DPGA 5CV7A 1I4GA 4C3JH 1EEFD 4AQYQ 1MJCA 4L63B 1QNUA 2VXWA 4OO1H 4NXNL 2RSOA 3KLWA 5FO9B 1X54A 4J15A 2KUMA 4JW0A 3S24A 2CQAA 3K7AH 4LF7L 1FR3A 1WCMB 3T1HQ 2Y0SB 1I6VC 4IUTA 2Z6BA 2EY6A 1Q8IA 2J4XA 3K58A 1BCPB 5KYIA 3TP7A 2VNUD 4RA8A 4DF7A 4JI2L 1V1QA 2UUAL 1GOZA 4K5XA 1JCKB 4OONA 2JE6I 4PV1C 5C4ZA 2F0GA 2PMZB 2OQ0A 1CI3M 3TSSA 4CDEC 1KRSA 3GQBA 4JBJA 1SAPA 3IRBA 5IT9L 2ZTDA 1TWAB 1Y8OB 2TSSA 2F0EA 3HFZB 3ND9A 1YBYA 4PQXA 2UUBQ 4JK1C 3ZYYX 5M3MG 3A5UA 4OL7A 2WB1B 5C4XH 3BVZA 3VYSA 1ML0D 1Z9FA 3HOYB 1QE6A 2KHIA 1AE3A 4DR3Q 2AQ3B 1SSOA 4KD3A 4UPAA 3CQZH 3K7UC 1EQTA 2Y0SE 4P71A 1V43A 1QVGA 2MPMA 1IBKQ 2L1BA 4FF3A 5EKLA 5K36H 2WACA 2E5LQ 5C4JB 1N32Q 3MFGA 2JA5H 2EY1A 1SEBD 1JOQA 1VF7A 1EY6A 1B9NA 4GOPB 1FJGQ 4LFBL 2R7ZG 4F7XA 3I90A 4DR5Q 1QJOA 5G3LF 3S16H 3AFPA 3EA6A 1EQQA 2HQLA 1D5ZC 1RODA 5C0XI 2UXCQ 3CKIB 1GO3E 3M4PA 4R4OA 1KDCA 4IUUA 3EROA 3OWFA 2A6EC 5BR8Q 4WJWA 3AMUA 3GTJB 1HNZQ 3GTOH 4QF4A 1B3QA 4C3HG 1F2ZA 4LF6Q 1TS3A 2VB2X 2BOSA 5HY6A 3HOYG 5LMUL 4NXMQ 1STAA 3QWNA 3T16A 2UUCL 1E22A 3H94A 1H9SB 4ME3A 2PO4A 3CCEA 3HS0C 2IY5B 5M5XB 1TIID 5KNDA 1PYSB 3FPUB 3U9SA 3J80i 4JI4L 2KCMA 2B2YA 2B29A 2MHVA 4HEDA 1X3QA 2JP1A 1H9MA 2FMMA 3A8IE 1PTOF 3IFDA 3OPOA 4DV2L 5DM63 3JAME 2K5HA 2X6GA 1K73C 3J7AV 4CGYB 1WYDA 2Z1CA 1YNNC 3TP5A 5JJKA 1Q8KA 1KAAA 1CZWA 5CV6A 1XNQQ 2TMPA 1TT2A 1D6EC 1JB7A 4K0KQ 5DM73 1LV9A 4CKBA 3NTHA 5IIFA 3FEWX 2F0TA 2F0OA 1EYDA 2KOLA 3BS1A 1J9OA 1BXTA 5AFWA 4B3MQ 2OQKA 4RKLA 1SMYC 2VL6A 1CQVA 2CQOA 2HT1A 2CFMA 2LMCB 2NN6H 5KIXA 1HQRD 3FKIB 2RDGA 3UDGA 4X3TA 4A3CG 4IFDG 1KRTA 1VQLA 3P75A 1SJED 1VQIA 2H5XA 2EPBA 1BDOA 3KBGA 2B2WC 4JI5L 1ILQA 1ICFB 4DV6Q 1FGBD 1I50B 2A19A 4JOIA 3J80E 1TWCB 2Q8IB 1E0BA 1EIGA 1KTKA 1X3FA 4GLAC 1SJHD 2B39A 2WKCA 4JI1Q 3HOZH 1LYLA 2E74C 1V8QA 1PFSA 4MZ9A 3M3YH 4ID6A 3HOZB 2XWBB 1H9KA 1EUJA 1S4ZA 3B6YA 3S2HB 3K8AA 5KNBA 5C5MA 2K5DA 1STBA 2E75C 2F0QA 2HCIA 1YJWA 2HUGA 4YCUA 2YU9H 4FXDA 2K03A 3S2DB 2FFKB 1X32A 4LFBQ 2KHSA 2ZTEA 4HJ5A 2R92G 3I73A 3DHQA 4GOPC 3KLSX 1S5BD 1GUGA 3CPWA 4HJ9A 1ONLA 3LGJA 3DEOA 1KDBA 1X9NA 2B2VA 3KJOA 3TZUA 1MGSA 4DR1Q 3GTMB 4K5WA 1EL0A 4AYBB 1IL2A 2XTIA 3DEPA 4QQBX 5FLMH 3QOLA 4PZ8A 3BDLA 5I6YA 4LF9Q 1DONA 5KEEA 2LY7A 3OSOA 4DK0A 1AZQA 2F0HA 2A69D 2PNHA 3EJIA 5IP9H 4N8FA 2GVBA 4XYQA 3D4WA 1DJRD 2Y0SG 2N88A 4XDXA 3RLOA 4JI7Q 3IFTA 1I3QB 3EQLC 4JBKA 5BR8L 3QOJA 4X65Q 4OHJA 1EY8A 2EY5A 3H0GH 2JYOA 1XPOA 1ESFA 2R7FA 4U68A 1GJXA 4HAEA 3SVMA 4JI8Q 4DV1L 1PFMA 2IX3A 1EEID 5CMDA 3TS2A 4C3JG 3VR6A 4DR6Q 4EQPA 3I4LA 3GV3A 3MVVA 2RBMA 4X62L 1HUNA 2I0QA 2HDMA 3W3AA 2EYHA 4DV2Q 1MHWC 1SBBB 1G2SA 1IW7C 3R93A 2VQFL 4X66Q 4IOCA 1YHAA 4OIKA 1C0AA 1WD1A 1PH6A 3TRZA 1KNEA 4UDUC 2LS01 3KF6B 4IUNA 1BVSA 2R7DA 4DR2Q 5TSSA 3CU7A 5FK9C 5C44B 4NDXA 2F0KA 3QB3A 1IW7D 1PTOH 2JJQA 1LO5D 1PFNA 2PQAA 1J6QA 3OW7A 3R2IA 2F1MA 1X55A 1PZKD 1LTSD 4RGTA 1TS2A 4PZ7A 3Q23A 2MQHA 5CBEE 5M9OA 4FP5D 3PF5A 4A3DG 4LJZC 3M9BA 3PIP3 1XPUA 3R8BA 5M3FB 1YHBA 1I4HA 2KHJA 4S3SA 1PH9A 4KK7A 3QJYA 4RFBA 3C2PA 4MTKA 2K33A 1RTNA 4IQZA 1XYIA 2VUMH 1Q81C 2WAQG 2QA4A 3SE0A 3AYHB 1GUSA 4V0BA 2QDLA 4JYAQ 2J0TD 2HCCA 4HJAA 5CV9A 2QDBA 4POFA 4MHEA 4PZ6A 3T4AC 1PXUA 4DR3L 3ITPA 3H3VC 2PW7A 5FJ8G 1DYQA 2RCNA 1BUVT 1PH1A 4FF4A 1IBKL 1PHJA 4KY6A 1VQNA 5IYCH 3PUVA 1EY5A 1STGA 2K14A 1ILPA 1Q12A 2UU9L 4NXNQ 4E6IA 5M3MB 2RHQB 3PUYA 1GUNA 1SE8A 1XTDA 2O2LD 5C4XB 3VR5A 1XNRQ 4A3LH 3HOYH 1EIYB 2F03A 1DOKA 1ZYRD 2N8NA 1A6XA 3D31A 3MHBA 3A8JE 3W5OA 3M85A 4CKCA 4DN4M 5BN5A 3BYTB 3WWVA 2JA7H 5T1GA 3CC2A 1EYCA 3LWEA 3PV0A 1DGSA 5C4JH 2LXKA 1VQPA 3UI2A 1S5FD 4DXGA 2SEBD 3DM3A 4KV6A 1N34L 1K3BC 1R4PB 1G2TA 2R93B 1SYFA 1H9SA 4JI3L 3J7ZC 4LF5Q 3VYUA 2R93H 3NK9A 4G4KA 4NMZA 3K5NA 1W3SA 1XXGA 5JVH3 1SMXA 4C3HH 3NBHB 3EVQA 4QY7A 2ZXOA 4DR4L 1WTPA 3I4OA 4K5VA 3GTJH 3GTOB 3AFQA 5IGFA 4A3GG 3E5SA 1WTQA 2KA7A 1N36L 2Q2IA 2NVYB 3VR3A 3KLSA 1CTMA 4IUPA 1F9QA 4KKUA 3WDNA 1VQ9A 4O0AA 2AWOA 5M5XH 2R92H 2IX0A 1UE1A 2L0CA 3I91A 1YZ6A 4HSPA 3S15H 2R92B 1PH5A 1PFBA 2A68D 1O80A 1C9OA 2CVRA 2PZWA 1UUPA 1PH7A 1TXYA 2K05A 4YHHQ 4RWSC 4IFDJ 4TRDA 3CCJA 3N52A 1ASYA 2B2UA 3MXNA 4GLVB 1K3RA 5IE8A 5FLXE 1EY0A 3M7GA 1Y1WG 2I5HA 5ELOA 3A74A 5CGKA 5LMNW 1QB5D 2G9DA 3BYYB 2DNCA 1PH2A 5CV4A 1U4LA 3F2CA 4A3IG 5IT9c 1BQQT 2F3VA 3GTKH 4KY5A 3L3OC 1N33Q 3I2ZA 3E3XA 1VQ6A 4BA1I 1XMQL 2BA0A 1VQEA 3I56A 1LUZA 2VQEL 5FOBB 3MXNB 1VQFA 2RVLA 4B3TL 4C3IG 4DR5L 3J81i 1K0SA 2F0DA 1JB3A 3G4SA 4MTNA 3J80L 2JK8A 4BBSB 3SHLA 1G291 1LTTD 4A93G 4RAUC 1YHQA 4Y7NH 1I50H 1CA5A 1LT3D 4FF1A 5IYDH 3OTOQ 5GQOA 1RIPA 3HOWG 2XIWA 3HKZG 4X64Q 3M4YA 1EIFA 2CH4A 1LTGD 2BA1A 2O5JC 1PZJD 5CYUA 4KI0A 1NE3A 3KLRA 3P20A 3PUZA 4RMFA 2A6HD 3S14B 4CJ0B 1E24A 4QUFA 3KOJA 1PTOC 4ZCKA 1KQSA 5M5WH 1IBMQ 3S14H 1OXTA 4L5TA 4BY7G 4B08A 3O13A 2UXBQ 5DNFA 3M4OB 1B1ZA 3KK7A 3W2DA 1YJNA 4IFDI 4EQ5A 1W6KA 5LL6X 4BXXH 1AW7A 1BCPC 3K80C 1Y1VB 4YIJA 4A76A 2L15A 2KEEA 1TQOA 4XQQA 4A3BG 5C4XG 1D2BA 1WCMH 1S5ED 3ZJYC 2F0NA 1JWMD 5JEAJ 1STEA 1L2FA 2EZVA 1CHPD 3J81c 4WJ3M 4ZLTF 4LW1A 1RL2A 2Z0SA 4A3KB 3VDYA 2EYFA 4DXFA 4B3ML 1VQKA 4BY1H 1PVOA 2D9UA 3HKSA 2ZXRA 4KJOA 1D8LA 3BZKA 2F0VA 1N34Q 1L0XB 5J39A 3CC7A 4LFAQ 1YNJD 1HR0Q 2EYPA 3NTKA 1VQOA 4JI3Q 5L37A 4KHPQ 3I7FA 1VQHA 3DLLA 1JJGA 1E2ZA 2R7ZB 2BE5C 2B63B 2Z4IA 2VQFQ 1H9RA 3UDXA 2NZHA 4PNYA 4ZQ3A 3OWEB 4JI5Q 4DR4Q 2JA6H 1STHA 1B8AA 3G48A 4P74A 1NR2A 1P8LA 2JXMB 4CBVA 4DAMA 4A3GH 1E1OA 2F0JA 1D5XC 1IYJB 4X6AH 1NMGA 3V2TA 2DNEA 4DV7L 3CQZB 5FKAC 2I07B 2PPBC 2YYZA 3I4MH 2B8FA 5KNCA 1JE5A 3R2TA 2JA6G 2B2TA 4K6DA 1VQDA 2WB1G 2SOBA 2CWPA 1HRJA 5LMNQ 5JEAH 1KC8C 2K5WA 5C3XA 4J1MA 2JA8B 2E2JB 2VUMG 2UXDQ 2F0FA 3SEBA 5M5YH 4ME5A 1LACA 5JVG3 4IUVA 3RZDH 1SNOA 4CDCC 3A55A 2A73B 3QIAA 1FNUA 2XGTA 4YWLA 2EOTA 3HKZE 4GKJQ 3JC66 3L7ZC 4DR1L 5C4HA 2OT2A 3CHBD 1PTOB 1U5KA 4JI0Q 2EE1A 2IW3A 3T56B 5EPKA 2KECA 3OIQA 4H0LC 4YWKA 4A3EG 2D2CC 4R4QA 2ZTCA 3HP3A 3ICEA 2NZOA 3NUCA 3IAYA 2I5LX 2B63G 1ESRA 3DM1A 1SFOH 3RN2A 3K5OA 1EYGA 2ZJQA 2GVAA 4POGA 4R4TA 3S1RB 1MD2D 2JEAI 4L6TB 5C0XH 2E2IH 5IGCA 3S1RH 5M3FH 4UAIA 5HURA 4L5RC 1HPCA 4KKTA 2NYZD 2L4NA 4X66L 2E2IB 2K1BA 5GAGC 2ALYB 3U4VA 4BBRG 2VB3X 4YCVA 2KEDA 1B44D 3GTGB 4X64L 3CCVA 3EBEA 3HEJA 3AU7A 4DR2L 4F8MA 4HIKA 4APVA 1XX8A 1XWEA 3J80c 4HR7B 4IZ8A 1LLRD 4IALA 4NP5A 3CMAA 4A3BB 1VQMA 4TVAB 3U9OA 2F52A 5EPLA 1EFID 2CW0C 4JVZA 4DU9A 1KABA 2ZJRA 2QGQA 2RCFA 2HHHL 1CFMA 1QILA 3NHHA 5IYDG 2DJGC 1ET9A 4C2MB 4R8IA 1WTVA 1U4RA 4XYOA 1ZYRC 3J7A5 1W2BA 4C2MH 1GUOA 5NUCA 1RJTA 5IOCA 2QEXA 4HJ8A 1FL0A 4AYBG 4KN4C 2LKVA 3OIPA 5ISRA 3V96A 3BG3A 4IO9A 3QG1A 3J7YW 2B2YC 4K14A 1Q7YC 4H44C 4IPHA 4M8AA 1AE2A 1TWCH 3X3MA 2F0SA 4OWXB 1QOHA 1IBLQ 4B9XA 1NY4A 1OXVA 2A5HA 4ULLA 2BH8A 2VS1A 4DUZL 3M3YB 3G6JB 4ZRZA 2EVBA 4RKBA 3HOUH 3S2HH 4B9WA 3T1YQ 1BF4A 3GDEA 2VY3A 2DN8A 4OO1I 2OCEA 5C6AA 1VMPA 3A5ZB 2K52A 3F1ZA 5IWAL 1B7YB 3A8KE 3K0YA 3S2DH 2ASBA 4K2LA 3NWSA 2EYMA 3GTPB 1TWFB 2O5IC 1TKWB 1XJVA 4JC0A 3ND8A 5C3WA 1L1OC 2L9HA 4YHHL 3L2PA 2NTSA 4DK6C 4GOPA 1A8VA 3CCRA 3CRLC 5J1ZA 2HIVA 1CM9A 3MWYW 1Q3LA 3GTMH 3H3VI 3FKIG 1VQ8A 4HMIA 5ELBA 3GTQH 2RDHA 3TQYA 3H0GG 1T9HA 3IKJA 2D5DA 3GTQB 4LF4Q 1EOTA 4YCWA 1LTRD 2Q8RE 3CCUA 4PMBA 4A3FG 1M1KC 2A6HC 2KVMA 2EYOA 4DNRB 4C1NK 4X3KA 1A15A 2A69C 5C3EH 3PO2G 4WRDA 2ZM6Q 2LFNA 3D4RA 1OXXK 5C3EB 1SLJA 1YITA 3JAMi 4B3TQ 3HOWH 3T13A 4DUYQ 3PF4A 1HNWQ 2PW5A 1DM0B 2NN6G 5ELDA 4LF8L 2NB0A 2F0WA 3RMHA 3OMGA 5IGEA 4NW2A 3PUXA 2AUJD 1PH8A 1KIXA 2DY8A 3V05A 5BN3A 1VQ7A 4P73A 1FVIA 5I9PA 3F2BA 2JSOA 5ELCA 3GV6A 1VQCA 1EZ6A 4HTHA 3NPPA 4A3IH 2HD3A 2MO0A 1SNCA 2EYLA 3TP6A 1IHZA 5GAHC 4HIDA 4A3JB 3BZDB 3G71A 4TQUS 1I6HH 1YNJC 4WORA 4JI2Q 2E2HB 1E2WA 5CV5A 1Y8PB 2KCNA 3ULLA 2Z6KC 5IP7H 1DOLA 4GNXC 1QZGA 5H1SE 4G7OC 1D7QA 4KHVA 4G57A 1PTOD 4OX9Q 1G6ZA 2EDGA 5JPMC 4QJFA 3D4DA 4BA2I 3HOVB 2XRSD 2WB1E 1WI5A 2JEBI 1STYA 4IUQA 1RDPD 1YIJA 4JOIC 4BS9A 1HZBA 1EY7A 3C1FA 4LAAA 4KD4A 3P1HA 5I6WA 2KJXA 5IGBA 1VQ5A 4Q5VA 4XT1B 4CDFC 5IYCG 1WTWA 5A2QE 1HR0L 4LNQA 5J3BA 1F2YA 1I4PA 4K8JA 1EWIA 5E1FA 3I4NB 2V4DA 3Q0AA 2PYKA 1N32L 1LABA 2R6GA 1WTOA 1U0LA 1C4QA 1UEAB 1VQJA 2VUMB 1SROA 4RCOA 1HR0W 3HRZC 4ILWA 4Z9CB 4HN7A 2IJ0A 5K36G 1TWHB 1N8RC 2B3GA 4A3KH 5G3LD 1K83B 4QCLA 2QW7A 5IGGA 4O1NA 2NBFA 1TWHH 1B2TA 4A3FH 4RG1A 3TS0A 1K83H 1GHKA 2DY7A 1WD0A 2XN9C 4DAYB 1N33L 1KD1C 2HQEA 2NN6I 5M3FG 2YTVA 1M90C 2CW0D 3HOXH 4EX5A 2I46A 5FLMG 2AKWB 2D0OA 4DR7Q 2FJ2A 4AQYL 4U673 3CW2C 3U58A 4OWTB 1SYCA 1Y69U 1TWAH 1BOSA 2K50A 3OMCA 4CJ1B 4C56C 3Q22A 1EWHA 1D5MC 1E2VA 1FNWA 5LL6S 4PMWA 1SXTA 2ES2A 3S17H 3VR4A 1LTAD 4P2CB 1GVPA 1MSGA 3E0JA 2ZJPA 1TR5A 4A3MG 4GLXA 1Q86C 3S17B 1BBXC 3K6OA 1UE7A 1B53A 1JE4A 4MN3A 1MJEA 3D6CA 1C8CA 3DUZA 4L5SA 1CK1A 4O42A 3PIPA 1XMOL 1PZID 3I4MG 5LMUQ 1KNAA 3CP0A 2JA7B 1GUWA 2PZTA 3E6ZX 5I2YA 4KHZA 1WJJA 2KQ3A 4R9WA 4DV3L 1HJPA 1D1IA 4GKKL 4DK1A 5JEAG 1YNXA 3SDZA 4XIGS 3IL8A 1A62A 2FHTA 1O7ZA 4OXPA 2F0PA 3CMEA 4YY3Q 3I72A 2PQEA 2L12A 3NQIA 4JV5Q 4R4IA 1QVFA 3NELA 3HOXG 1JMCA 1MSHA 2RA4A 2EY2A 1QUQB 1HH2P 1PRTC 1Q1BA 4QGUA 4DV0L 1X3EA 2OTJA 2MUYA 3MXUA 4LWCA 3G7LA 5KYLA 2I5MX 3OW2A 5IYBH 1DXMA 4JG2A 1O78A 3UDFA 3CCMA 3RD4A 2AUKA 3M7NA 4XT3B 4WJ4A 1WTXA 2ID0A 3I3CA 2X69A 4LUOA 1PRTF 2SNMA 4BBRH 1TY2A 3BVGA 5HGTA 1JICA 5EJWA 4A75A 4HSVA 5FO7B 5HGQA 1DOMA 1NBWA 3KUPA 1H9JA 1TS4A 2ZXPA 1VQBA 4A3LG 1RF2D 3FRPB 1JR0D 4AYBE 1VF5C 1SNMA 1PH3A 2M2LA 4RGNA 2GN5A 1I5FA 1VCIA 3KDFB 5GADC 2WIIB 2KCTA 4KJNA 5JOBA 1EOVA 4FYDA 1SYEA 3PO3H 2UU9Q 5J22A 5CR3A 2PQAB 3HOZG 1VDZA 3J81j 4EQNA 4A3DH 3RZOB 4OGQC 4ZAIA 4BBSH 1X3GA 4DGZA 3RZOH 3K0XA 3PIOA 2F3WA 5BN4A 4DV4Q 3NBIA 5AJ3L 2K01A 2FXQA 1EZ8A 3DWAA 4B3RL 3HG9A 2MNAA 2UUCQ 4KMUC 2R3ZA 4IFDH 5ELNA 1PLFA 4LFCL 4XQJA 4JI8L 1A0IA 2AQ1B 3ULJA 4JI4Q 3HOUG 4ZYSA 3DMUA 1X3PA 1BBUA 1JC7A 2ICIA 4DR6L 4BY1G 3WOFA 5M5WB 5C0XJ 2WKDA 1IXRA 2XSCA 3GD7A 3W1GA 1K28A 4FVMA 3M4OH 3K59A 1F9RA 5C5LA 3N6RA 3TEHB 3CPFA 4L5QA 2QF7A 2YU9B 4DV5Q 3GTPH 1TWFH 1Y1VH 3MZ5A 4K0KL 4JV5L 1JOKA 2B2TC 1JWUD 1T5EA 1HNXQ 2JA9A 3MC0B 4DA2A 4LF7Q 3ONAB 5IGDA 3Q6SA 4DAYA 3T1HL 4DV0Q 4C1NI 2NVTB 1N36Q 4PG3A 2NZ1D 4ZUIA 3RN5A 2HDLA 3DWQA 4TSSA 4BY1B 3VA7A 1Z6HA 5D65A 1RD9D 3TDQA 1KL9A 1CT1D 2LSSA 1S3OA 2JN4A 1WOCA 1YJ9A 1NCVA 1R9TB 1PRTB 4LUZA 4CDDC 3R3OA 4IURA 4P75A 2EJFC 1MI2A 2ATWA 4YWMA 3T1YL 1JJ2A 1GUTA 4MIUA 5GAEC 2B63H 4QB4A 3S1QB 1TWGH 3PO2B 1P16A 3A7AB 3S1QH 2A8VA 2JA6B 4HIOA 2F4IA 3NE5B 2F0UA 3GTLH 3I4NG 3T51B 3NENA 1L0WA 5E4WC 1HTPA 3H0GB 1B4OA 3MFYA 4RHSA 4NKLA 1IYUA 1KHIA 3NQTA 2PZUA 4IJLA 5FLXL 1YVCA 2G5DA 1X65A 5EQ0A 3GO5A 1AP0A 4M1UB 1VQAA 2VQEQ 4DFAA 5COYA 2RF4A 4OWWB 3WOEA 3QO2A 3HOVG 1V9PA 1HUMA 5LHY1 3NBHA 1JWSD 3E9IA 2E2JH 3CCSA 2MP1A 2PMZE 2CHBD 3UE0A 5M5YB 2ZM6L 2EJMA 4R1JA 1Q90A 4I7ZC 2WINB 4JI7L 3M4QA 4O2DA 1F9PA 3RNUA 2D62A 1EU3A 1L1OA 1TU2B 3E0EA 1K8OA 1BKBA 1HA6A 1WFQA 2BCOA 4K6LA 4JI6Q 5JJLA 4RGMA 3GP7A 3HOVH 4H13C 1V1PA 4HCSA 1CSPA 3SR1A 1KAWA 1XNRL 1GXDC 4LF4L 3BDOA 1HNZL 2JA5G 2RDFA 4KKSA 1S72A 3S1NH 1CKNB 2KENA 3TMEA 3PMFA 1O7IA 1A3VA 2RQXA 2QEJC 5JPNC 4GN3B 1SFOB 5I2XA 3MAQA 3NXWA 2M9VA 4XXEA 4RHRA 4IPGA 1I4QA 3MTSA 4H02A 5EKKA 5C44G 4DR7L 4QIWB 4KY7A 3CAMA 1L1OB 4DUYL 3CD6A 4H7BA 3BJUA 1NNXA 3MXGA 4GNXB 2IPKD 3CCLA 1F77A 4IPCA 2AMCB 4R8NA 1U4PA 4LF5L 5IP9G 1J8IA 3EFXD 1KLGD 3HKZB 1WCMG 4A93H 4A3BH 2C5CA 1IL8A 4A3FB 1AN8A 1I4XA 1FGUA 3G6EA 4A93B 1SE3A 2WV6D 1VQ4A 4BBSG 4JBWA 1UEBA 1J5EL 2ICEC 2N55A 1BO0A 4X3SA 4UY8C 1IKMA 4C3IB 1H95A 2XRQD 3KBXA 1OTCA 2EJGC 2B2VC 4K2KA 3EIVA 3PUWA 5T1IA 3U4ZA 4GKKQ 5JJZA 5EBDA 4A3MB 2YTYA 3TBIB 1XTCD 3AEVA 4OX9L 3KFUA 1HQMC 2MJ8A 1K8AC 3MA2B 4A3MH 1SYGA 2L55A 2PI2A 1JJCB 1ZKOA 5M3MH 3FVQA 4NPSA 1K8GA 2BH2A 1DD2A 5E4XA 1FYCA 3F2DA 2NUCA 1C7YA 1PYWD 3T53B 1HCZA 2IWHA 1K0RA 2NVQB 3SK4A 4CKEA 4JCVE 1S5DD 1DZ1A 2XWJB 1SE4A 5LMNL 3STBD 1EIHA 5K5PA 1NMFA 2CWAA 2OF1A 1ENAA 4N9PA 4AH6A 1QVCA 2Q8TA 1PYBA 5D3DA 2ZT9C 5EBCA 1XMQQ 4NB3A 4GKJL 3I8ZA 1EYAA 3S16B 2H1EA 2AHOB 1U4MA 3ERSX 1JOOA 1SR3A 2PNRC 1ICWA 3RLFA 4DNTB 2R61A 2YV5A 4JI6L 2QKIC 3LNNA 2MFIA 1G8ZD 3A54A 1QUQA 3MEHA 2NVYH 4KLKA 2F4VQ 5JAVA 2M00A 1LT6D 3X3NA 2G9HD 1XMOQ 2CCZA 1STNA 1IKLA 1TS5A 2N78A 1HZAA 2SNSA 4LUVA 4B3SQ 3FDTA 3LX0A 4DV3Q 1SDFA 1R4QB 3S1MB 2DGYA 2NTTA 3RLNA 1IBML 3S15B 5KGUA 4BBRB 3S1MH 1VQGA 5C0XG 3OOCA 2DUDA 4DAVA 4RGOS 1G6PA 4FF2A 4X65L 2F0MA 3DWPA 2HIXA 1RCVD 1PMRA 3KJPA 2FMCA 2OEOA 4FXGC 2MO1A 4IOAA 1N9WA 1ZEQX 2Z9HA 1OXUA 4QL5A 3D0FA 4A3EB 1I4RA 1QNKA 1A3UA 5IYBG 3L0OA 2J7ZA 2K4KA 2C35B 2A6ED 1QG7A 4X62Q 4A3EH 1Y1VG 4F87A 1M8AA 4LK1C 2N3SA 4OEMB 1ASZA 3H3VH 1UWVA 4IJHA 3J81E 1B9MA 3SGIA 3C3LA 4KHPL 4EQOA 1UAPA 2PI2E 1UE6A 3H91A 4FO2A 5F2DA 1ENCA 4GNXA 1IBLL 2JA8G 5E7NA 4Y7NB 1J5EQ 1HNXL 3U50C 3PQIA 2UUAQ 2NVXB 3URYA 1II3A 1MKHA 4DNIA 2NVXH 2SDFA 1Y14B 1VMCA 3C46A 4DV7Q 1E3PA 1KLUD 3NTIA 4LFAL 1NUCA 3JAMc 1OO9B 1LTLA 1I94Q 3JAML 1NTGA 1AH9A 1WVLA 4F88A 2E5LL 3UE1A 1WTRA 4KTAA 3I4NH 4TKOB 1HHVA 4N8X1 4XQNA 1EFWA 3FP9A 1C48A 4PMCA 3K7AB 2UXDL 3ER0A 1GD7A 2GA4B 4FXKC 4ZKBB 1SNPA 1SNDA 2E8GA 2EIFA 1QZHA 1XPRA 2NVTH 3LWUA 4QMGA 2F3IA 1GM5A 2Q2TA 4B3RQ 1U9RA 3PGZA 2VW9A 3D3RA 1R9TH 1NJIC 3HOXB 1V1OA 1GKHA 1EWCA 1A63A 2K28A 2UXBL 1T5XD 4LMQD 1HNWL 4GN4B 1IZ6A 2L5TA 3PO2H 2R7ZH 2UXCL 3BZCA 1EY9A 1FD7D 1Z47A 4DV4L 4DV5L 3K5LA 5IT9E 4QUCA 3TREA 1PV4A 1MIUA 3GTLB 2B2UC 3FMCA 1M4VA 4BWGB 3OYYA 1ENFA 1K8MA 4JI0L 2JA7G 3C1EA 3HGBA 4A3GB 3H15A 3I4MB 1X56A 4NXML 1NSNS 3ERQA 3CXCA 1CSQA 2WP8J 2K5VA 3BDCA 3AQQA 3VR2A 2VZAA 4DAPA 4ABNA 1HZ9A 4A4IA 4HIMA 1AZPA 2JA8H 1SE2A 2JA5B 3MEFA 4X3UA 1Q1EA 3SK5A 1YI2A 2UUBL 1IYVA 3SK6A 5IY0A 2L11A 1SN8A 3TP8A 1TVXA 1E1TA 1AEXA 1FNVA 2E2DC 3I70A 1SRUA 3RZDB 2YTXA 5IP7G 4OO1G 1RHPA 5DAUA 3TZDA 2PCFB 5A35A 4UP7A 2K7VA 1NAPA 3VYRA 3KF8B 2V1CC 5GROA 4ZK9B 3K57A 1CHQD 2K32A 4RH6A 2BDNA 4Q0FA 3MXPA 5FLXc 3CC4A 4JI1L 4JPBW 1Q46A 2IHEA 1HA5A 1OXSC 1LM0A 1EQVA 4UHVA 4OELB 3NSWA 3STBC 3L9AX 1BBWA 1A2TA 1YEZA 1JT8A 2IT1A 2A1AA 1FJGL 4GZYC 2NWGA 1LT4D 4ZUJA 3GTGH 2K04A 3OHXC 5ELFA 3UDIA 2EXZA 2H4OA 2JQOA 2K6AA 1G91A 2IHFA 2CKZB 1A2UA 3D6WA 2EXDA 2E76C 3K5MA 1CKOA 5A2QL 2Z8LA 3D8GA 1SNQA 2WAQE 4RCNA 2BE5D 1F2MA 3A7LA 3K81C 1CA6A 1HXYD 2OXPA 5CV8A 2A68C 2Q2UA 4BXXG 1O7LA 3Q8DA 3PCOB 1A3TA 1YNND 1PA6A 3DXJC 4KN7C 1UNSA 4IN3A 4C3IH 4R4CA 1HFGA 4GN5A 5EPJA 1B70B 3PO3B 3FKIH 1WTHA 2EYJA 4A3DB 4L8JA 1GHJA 4HCEA 4GS3A 3FPPA 2K5QA 2R93G 2Z4HA 2MGSA 5DLQE 3NEMA 4UP9A 1F2LA 1LT5D 1Z7TA 4QIWE 1QWYA 4A3JG 3KYHC 3OTOL 1CUKA 1HZCA 3H09A 4HJ7A 3FHWA 4LF9L 2NVQH 4G7HC 2ENBA 1BCPF 2QCPX 5CBAE 1K9MC 3Q24A 2HHHQ 3BU2A 3HOUB 4V190 1O7YA 3EN2A 4DKAC 1G51A 2KBNA 1Y8NB 4YY3L 1RTOA 1NR4A 4A3KG 4I65A 2O4XA 1HFNA 1EU4A 4AIMA 3CCQA 5C3EG 1TY0A 5CC4A 2FINB 4DK3C 3F2UA 2RKSA 4DV6L 1DCZA 2AQ2B 5IODA 1ET6A 4FDBA 4UP8A 4C3HB 5E3FA 4EVOA 2D0PA 3VA5A 2XVSA 2X6LA 1F9SA 3HZXA 2LXJA 4J8QA 4HMJA 5KRUA 3A0JA 3NWTA 3ULPA 2C9OA 4BY7B 1RKNA 2Z6KA 2RHSB 1CZGA 5FJ8H 4I7AA 4DUZQ 4BY7H 3W1BA 1UE5A 1EQRA 1Q82C 1LTBD 2F0LA 4MNOA 3RR5A 4N9TA 1SMYD 3P7JA 1VS0A 4FNFA 1LTID 1ZXTA 2OTLA 2QILA 5FO8B 5DEHA 5I9OA 5ELEA 1S5CD 2WFWA 3HOWB 2EQSA 1AFPA 3AB9A 1SYBA 1TWGB 2Q2HA 2WAQB 1L0YB 1EY4A 5EGTA 2K75A 1D1KA 4EGVA 1I3QH 1CKMA 3PO3G 2XNAC 3A56A 4J6HA 1E7ZA 4P72A 2F0IA 2IL8A 2KCCA 4A3CH 1PRTD 4K8IA 1KXLA 4XTCS 3CRKC 3PIO3 3CF5A 2OWOA 1I6HB 2K5NA 1CQFA 2BDOA 5CORA 3GTKB 3NP8A 3E9HA 1PDQA 2E2HH 1JORA 1V1PB 5EAYA 5IWAQ 4G7ZC 4JBMA 3H6MA 4A3IB 4ODGA 1X6OA 1W6JA 4IPDA 4A3JH 1BNZA 4CHTB 5I4DA 4ALPA 4LF6L 3J81L 3J7AF 5D14A 1HTLD 1SYDA 2B8GA 1BR9A 3TN2A 1CKNA 2B2WA 1QCBD 2CH4W 1S40A 1I94L 3SXHA 1Y1WH 4CJ2C 4B3SL 4WFN3
chains in the Genus database with same CATH topology
3W5OA 1K0RA 3F8TA 3M85A 4GNXC 1QZGA 4JCVE 3WWVA 5H1SE 2JA7H 4JYAL 5AJ3Q 5LMNL 4Y52H 5C44H 3CC2A 1D7QA 3STBD 4LF8Q 2N49A 4OX9Q 3PV0A 1DGSA 1NMFA 4QJFA 5C4JH 2CWAA 2LXKA 4DV1Q 1VQPA 4BA2I 2WB1E 1WI5A 2JEBI 4LFCQ 4AH6A 1QVCA 5JJIA 3DM3A 2IX1A 1YIJA 2AWNA 3PSIA 1PYBA 4JOIC 1N34L 1XNQL 2F4VL 1HZBA 1XMQQ 1PH4A 4JI3L 4NB3A 4GKJL 3J7ZC 4LF5Q 2R93H 2AHOB 3ERSX 1W3SA 3KDFA 3I55A 3KF6A 1SR3A 3RLFA 1SMXA 4C3HH 3NBHB 2YV5A 4DPGA 1VQ5A 4C3JH 4JI6L 4QY7A 4AQYQ 1MJCA 5IYCG 4DR4L 2MFIA 1HR0L 5J3BA 4LNQA 1EWIA 1QUQA 3I4OA 3GTJH 3AFQA 2NVYH 4A3GG 4NXNL 3KLWA 4KLKA 1N32L 2R6GA 2F4VQ 1N36L 1U0LA 2Q2IA 1X54A 4J15A 1VQJA 3S24A 3K7AH 1XMOQ 1VQ9A 2CCZA 4B3SL 4LF7L 4O0AA 1SROA 1HR0W 2N78A 2AWOA 3T1HQ 1HZAA 5M5XH 4LUVA 2R92H 2IX0A 5K36G 1UE1A 4B3SQ 1N8RC 2B3GA 4DV3Q 4A3KH 1YZ6A 3S15H 1PH5A 2VNUD 1TWHH 1C9OA 2DGYA 4RG1A 4A3FH 3TS0A 1K83H 1TXYA 3RLNA 1PH7A 4YHHQ 1IBML 4JI2L 4IFDJ 4DAYB 3CCJA 1V1QA 1ASYA 1N33L 3S1MH 1VQGA 5C0XG 1KD1C 2UUAL 4GLVB 2DUDA 1K3RA 2NN6I 5IE8A 5M3FG 2YTVA 1M90C 1G6PA 1Y1WG 3HOXH 4EX5A 2I5HA 5FLMG 2AKWB 4X65L 2D0OA 4OONA 2JE6I 4DR7Q 4AQYL 5ELOA 3CW2C 3A74A 2HIXA 3U58A 4OWTB 1TWAH 2K50A 2OQ0A 3KJPA 5LMNW 1KRSA 4JBJA 2MO1A 3IRBA 2ZTDA 1N9WA 4IOAA 3HFZB 1PH2A 2UUBQ 1YBYA 4PMWA 3F2CA 1OXUA 4QL5A 4A3IG 5IT9c 2ES2A 3S17H 3D0FA 3GTKH 5M3MG 3A5UA 1GVPA 5IYBG 2ZJPA 4A3MG 1N33Q 3L0OA 1Q86C 5C4XH 3I2ZA 2K4KA 4GLXA 1VQ6A 2C35B 4X62Q 4A3EH 1Z9FA 4BA1I 1XMQL 2BA0A 1Y1VG 2KHIA 1VQEA 3I56A 1AE3A 1LUZA 4DR3Q 1UE7A 2VQEL 1MJEA 2N3SA 3MXNB 1ASZA 1VQFA 4L5SA 3H3VH 4B3TL 1UWVA 4IJHA 4UPAA 4DR5L 3CQZH 3K7UC 3J81i 3PIPA 1XMOL 2Y0SE 4P71A 3SGIA 3I4MG 4KHPL 3G4SA 4MTNA 5LMUQ 3CP0A 1V43A 2PI2E 1UE6A 2JK8A 1QVGA 1G291 4A93G 4KHZA 4GNXA 1WJJA 1IBKQ 1YHQA 4Y7NH 1I50H 4DV3L 5IYDH 1HJPA 3OTOQ 1IBLL 2E5LQ 1N32Q 2JA8G 5JEAG 5GQOA 1YNXA 2JA5H 1RIPA 5E7NA 4GKKL 3HOWG 3HKZG 4XIGS 4X64Q 1J5EQ 1HNXL 1EIFA 1A62A 3U50C 2BA1A 4GOPB 4OXPA 2UUAQ 1FJGQ 4KI0A 3CMEA 1NE3A 4YY3Q 4LFBL 2R7ZG 4DR5Q 3PUZA 3S16H 4RMFA 3AFPA 4JV5Q 1EQQA 1MKHA 4R4IA 4DNIA 2NVXH 2HQLA 1QVFA 5C0XI 1Y14B 3NELA 2UXCQ 4DV7Q 1E3PA 1GO3E 1E24A 3M4PA 4R4OA 3JAMc 3HOXG 1JMCA 4LFAL 3KOJA 1KQSA 1LTLA 1I94Q 5M5WH 1IBMQ 1QUQB 1OXTA 4L5TA 3S14H 4BY7G 1NTGA 1HH2P 1AH9A 2UXBQ 5BR8Q 2E5LL 1Q1BA 3UE1A 4QGUA 4DV0L 1HNZQ 3GTOH 1X3EA 3I4NH 1YJNA 4IFDI 4EQ5A 4BXXH 3K80C 2OTJA 4LF6Q 5HY6A 1EFWA 3HOYG 5LMUL 2L15A 3FP9A 4A76A 4NXMQ 4LWCA 2UUCL 2UXDL 1E22A 2I5MX 3OW2A 4A3BG 5C4XG 1WCMH 4ME3A 5IYBH 3ZJYC 3CCEA 3ER0A 1GD7A 2IY5B 4JG2A 5JEAJ 1L2FA 3J81c 2E8GA 1PYSB 3UDFA 2EIFA 3CCMA 4WJ3M 4LW1A 1QZHA 3J80i 1RL2A 4JI4L 2Z0SA 2KCMA 3VDYA 1XPRA 2NVTH 3M7NA 2B29A 4DV2L 4B3ML 4WJ4A 2F3IA 2ID0A 1GM5A 1VQKA 2Q2TA 4BY1H 4B3RQ 1PVOA 2K5HA 1K73C 3HKSA 3BZKA 1D8LA 4LUOA 4BBRH 1WYDA 3PGZA 2VW9A 5JJKA 1R9TH 1Q8KA 4A75A 1NJIC 1N34Q 1XNQQ 3CC7A 4LFAQ 1HR0Q 5HGQA 1JB7A 1VQOA 4JI3Q 4K0KQ 1GKHA 1A63A 4KHPQ 3I7FA 1NBWA 1VQHA 2UXBL 3DLLA 1JJGA 1HNWL 1VQBA 4A3LG 2VQFQ 4GN4B 1IZ6A 3UDXA 2NZHA 3PO2H 2R7ZH 2UXCL 3BZCA 4JI5Q 4B3MQ 4DR4Q 2JA6H 4AYBE 1B8AA 1Z47A 2OQKA 3G48A 4DV4L 4DV5L 1PH3A 3TREA 1PV4A 1MIUA 2GN5A 1I5FA 4P74A 1VCIA 1P8LA 2VL6A 4DAMA 4A3GH 1E1OA 2CQOA 3OYYA 3KDFB 5GADC 2HT1A 4JI0L 2KCTA 2JA7G 2CFMA 1IYJB 1EOVA 3H15A 3PO3H 4X6AH 1NMGA 1X56A 2UU9Q 4NXML 2PQAB 4DV7L 3UDGA 3CXCA 4A3CG 1CSQA 2WP8J 1KRTA 1VQLA 3HOZG 3I4MH 3J81j 4IFDG 2K5VA 2YYZA 1VQIA 3AQQA 4A3DH 1JE5A 2VZAA 2H5XA 2JA6G 4BBSH 1X3GA 1HZ9A 3RZOH 4A4IA 3K0XA 4JI5L 3PIOA 4DV6Q 1VQDA 4HIMA 2A19A 2WB1G 4JOIA 4DV4Q 2JA8H 2CWPA 5AJ3L 5LMNQ 1KC8C 3MEFA 2FXQA 4B3RL 1Q1EA 1X3FA 4GLAC 2MNAA 2UUCQ 1YI2A 2UUBL 2VUMG 2UXDQ 4JI1Q 5M5YH 3HOZH 1LYLA 5IY0A 5ELNA 1SN8A 1PFSA 4MZ9A 3M3YH 4LFCL 3RZDH 4JI8L 1E1TA 1A0IA 3ULJA 4JI4Q 3HOUG 1EUJA 2XGTA 3B6YA 1BBUA 3K8AA 1SRUA 3HKZE 4YWLA 2YTXA 5IP7G 4OX9L 4GKJQ 4OO1G 3JC66 3L7ZC 4DR1L 4DR6L 4BY1G 4UP7A 5C0XJ 1IXRA 3GD7A 3W1GA 1U5KA 4JI0Q 1YJWA 3KF8B 4YCUA 2YU9H 3M4OH 2V1CC 5GROA 3TEHB 3CPFA 4L5QA 4YWKA 4A3EG 4LFBQ 4DV5Q 2ZTEA 1TWFH 3GTPH 1Y1VH 2ZTCA 4R4QA 4JI1L 5FLXc 4HJ5A 3CC4A 2R92G 1Q46A 2IHEA 2NZOA 4JV5L 4K0KL 4GOPC 2I5LX 3CPWA 1OXSC 1LM0A 2B63G 4HJ9A 1SFOH 3STBC 3LGJA 3RN2A 1EYGA 2ZJQA 2GVAA 1BBWA 1X9NA 1HNXQ 4POGA 2JA9A 4R4TA 3KJOA 4LF7Q 1YEZA 2JEAI 2IT1A 1JT8A 4DR1Q 3T1HL 4DV0Q 2A1AA 1FJGL 1N36Q 4PG3A 2E2IH 3S1RH 5M3FH 4L5RC 1IL2A 2XTIA 3GTGH 3RN5A 4QQBX 3CD6A 4X66L 3UDIA 5FLMH 5GAGC 2ALYB 2JQOA 4PZ8A 3U4VA 4BBRG 4YCVA 1KL9A 2IHFA 4X64L 3CCVA 3EBEA 2CKZB 2LSSA 1S3OA 1YJ9A 1WOCA 4LF9Q 2EXDA 4DR2L 4HIKA 4APVA 4LUZA 1CKOA 3J80c 4P75A 2PNHA 2ATWA 2WAQE 4YWMA 5IP9H 3T1YL 3K81C 1JJ2A 2GVBA 2Y0SG 5GAEC 3CMAA 2B63H 1VQMA 4TVAB 2Q2UA 1TWGH 4BXXG 2F52A 3Q8DA 1P16A 3PCOB 3RLOA 4JI7Q 3S1QH 2A8VA 2ZJRA 4HIOA 5BR8L 4JBKA 4X65Q 2QGQA 2HHHL 1PA6A 3ICEA 5IYDG 3GTLH 3H0GH 3I4NG 4C3IH 4GKKQ 4R4CA 3NENA 1XPOA 2R7FA 4GN5A 3J7A5 1L0WA 1W2BA 4C2MH 4JI8Q 1B70B 4DV1L 2QEXA 4HJ8A 1FL0A 4AYBG 3FKIH 1KHIA 3TS2A 4IJLA 4DR6Q 1YVCA 1X65A 4GS3A 4X62L 4IO9A 2I0QA 2R93G 3GO5A 4DV2Q 5DLQE 2VQEQ 1VQAA 1Q7YC 3NEMA 4IPHA 4UP9A 1AE2A 2RF4A 4OWWB 1TWCH 4QIWE 3HOVG 4A3JG 1V9PA 3KYHC 3E9IA 2E2JH 4OWXB 4X66Q 2VQFL 3CCSA 1YHAA 3OTOL 2PMZE 4IOCA 1CUKA 1IBLQ 1C0AA 1NY4A 1OXVA 3UE0A 1HZCA 1PH6A 3TRZA 4HJ7A 3FHWA 2ZM6L 4LF9L 3KF6B 2BH8A 2VS1A 4R1JA 4DUZL 2NVQH 1BVSA 2R7DA 4DR2Q 4JI7L 3M4QA 1K9MC 4O2DA 3RNUA 3HOUH 2D62A 2HHHQ 3S2HH 1L1OA 3T1YQ 3GDEA 2VY3A 3E0EA 4OO1I 3BU2A 1BKBA 2OCEA 1WFQA 4JI6Q 5JJLA 3A5ZB 2JJQA 3EN2A 4DKAC 3HOVH 2K52A 3F1ZA 2PQAA 1G51A 2KBNA 4YY3L 5IWAL 1B7YB 4A3KG 1CSPA 1J6QA 3S2DH 1KAWA 1XNRL 2ASBA 4AIMA 1X55A 3CCQA 4LF4L 5C3EG 4DK3C 4PZ7A 1HNZL 2JA5G 1S72A 2MQHA 4DV6L 1XJVA 4JC0A 3S1NH 1CKNB 2KENA 1O7IA 1L1OC 4YHHL 4GN3B 3L2PA 4FDBA 4UP8A 4DK6C 4GOPA 1A8VA 2D0PA 3CCRA 3PF5A 4A3DG 2HIVA 3M9BA 1XPUA 2LXJA 4IPGA 5C44G 3GTMH 4H02A 3H3VI 3A0JA 4DR7L 3FKIG 1VQ8A 3ULPA 1YHBA 3GTQH 3CAMA 1L1OB 2KHJA 2Z6KA 3TQYA 3H0GG 2RHSB 3BJUA 1T9HA 5FJ8H 4DUYL 4DUZQ 1PH9A 4GNXB 4BY7H 3CCLA 4LF4Q 4YCWA 1UE5A 1EQRA 3W1BA 1Q82C 1Q81C 1M1KC 2VUMH 2WAQG 4IPCA 3CCUA 4MNOA 3AYHB 2QA4A 4A3FG 3RR5A 2AMCB 4JYAQ 1VS0A 4LF5L 5C3EH 4HJAA 5IP9G 2OTLA 3PO2G 4POFA 2ZM6Q 1WCMG 4PZ6A 1OXXK 2WFWA 4A93H 2EQSA 1SLJA 4DR3L 4A3BH 1YITA 2Q2HA 3JAMi 5FJ8G 1FGUA 3G6EA 4B3TQ 2K75A 3HOWH 4DUYQ 3PF4A 1I3QH 1VQ4A 4BBSG 4JBWA 4A3LH 2RCNA 1UEBA 1HNWQ 1CKMA 2NN6G 1J5EL 3PO3G 1E7ZA 4P72A 4LF8L 1PH1A 4UY8C 1H95A 1OTCA 4A3CH 3PUXA 1IBKL 1PHJA 1KXLA 1VQNA 5IYCH 3PUVA 3EIVA 3PUWA 4XTCS 3U4ZA 1PH8A 1KIXA 3CF5A 4P73A 1FVIA 3F2BA 1VQ7A 2OWOA 1VQCA 2K14A 1Q12A 2UU9L 4A3IH 2K5NA 2YTYA 4NXNQ 3AEVA 2MO0A 5GAHC 3E9HA 4HIDA 2RHQB 2E2HH 3PUYA 5EAYA 5IWAQ 3G71A 3KFUA 4TQUS 4JBMA 1K8AC 1SE8A 1XTDA 4A3MH 1X6OA 1I6HH 1XNRQ 2PI2A 5M3MH 1JJCB 4IPDA 4JI2Q 4A3JH 4NPSA 1K8GA 2BH2A 4ALPA 4LF6L 3HOYH 1EIYB 2N8NA 3D31A 1S40A 1CKNA 1I94L 3ULLA 3F2DA 2Z6KC 5IP7H 1Y1WH 1C7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5O A;  1K0R A;  3F8T A;  3M85 A;  4GNX C;  1QZG A;  4JCV E;  3WWV A;  5H1S E;  2JA7 H;  4JYA L;  5AJ3 Q;  5LMN L;  4Y52 H;  5C44 H;  3CC2 A;  1D7Q A;  3STB D;  4LF8 Q;  2N49 A;  4OX9 Q;  3PV0 A;  1DGS A;  1NMF A;  4QJF A;  5C4J H;  2CWA A;  2LXK A;  4DV1 Q;  1VQP A;  4BA2 I;  2WB1 E;  1WI5 A;  2JEB I;  4LFC Q;  4AH6 A;  1QVC A;  5JJI A;  3DM3 A;  2IX1 A;  1YIJ A;  2AWN A;  3PSI A;  1PYB A;  4JOI C;  1N34 L;  1XNQ L;  2F4V L;  1HZB A;  1XMQ Q;  1PH4 A;  4JI3 L;  4NB3 A;  4GKJ L;  3J7Z C;  4LF5 Q;  2R93 H;  2AHO B;  3ERS X;  1W3S A;  3KDF A;  3I55 A;  3KF6 A;  1SR3 A;  3RLF A;  1SMX A;  4C3H H;  3NBH B;  2YV5 A;  4DPG A;  1VQ5 A;  4C3J H;  4JI6 L;  4QY7 A;  4AQY Q;  1MJC A;  5IYC G;  4DR4 L;  2MFI A;  1HR0 L;  5J3B A;  4LNQ A;  1EWI A;  1QUQ A;  3I4O A;  3GTJ H;  3AFQ A;  2NVY H;  4A3G G;  4NXN L;  3KLW A;  4KLK A;  1N32 L;  2R6G A;  2F4V Q;  1N36 L;  1U0L A;  2Q2I A;  1X54 A;  4J15 A;  1VQJ A;  3S24 A;  3K7A H;  1XMO Q;  1VQ9 A;  2CCZ A;  4B3S L;  4LF7 L;  4O0A A;  1SRO A;  1HR0 W;  2N78 A;  2AWO A;  3T1H Q;  1HZA A;  5M5X H;  4LUV A;  2R92 H;  2IX0 A;  5K36 G;  1UE1 A;  4B3S Q;  1N8R C;  2B3G A;  4DV3 Q;  4A3K H;  1YZ6 A;  3S15 H;  1PH5 A;  2VNU D;  1TWH H;  1C9O A;  2DGY A;  4RG1 A;  4A3F H;  3TS0 A;  1K83 H;  1TXY A;  3RLN A;  1PH7 A;  4YHH Q;  1IBM L;  4JI2 L;  4IFD J;  4DAY B;  3CCJ A;  1V1Q A;  1ASY A;  1N33 L;  3S1M H;  1VQG A;  5C0X G;  1KD1 C;  2UUA L;  4GLV B;  2DUD A;  1K3R A;  2NN6 I;  5IE8 A;  5M3F G;  2YTV A;  1M90 C;  1G6P A;  1Y1W G;  3HOX H;  4EX5 A;  2I5H A;  5FLM G;  2AKW B;  4X65 L;  2D0O A;  4OON A;  2JE6 I;  4DR7 Q;  4AQY L;  5ELO A;  3CW2 C;  3A74 A;  2HIX A;  3U58 A;  4OWT B;  1TWA H;  2K50 A;  2OQ0 A;  3KJP A;  5LMN W;  1KRS A;  4JBJ A;  2MO1 A;  3IRB A;  2ZTD A;  1N9W A;  4IOA A;  3HFZ B;  1PH2 A;  2UUB Q;  1YBY A;  4PMW A;  3F2C A;  1OXU A;  4QL5 A;  4A3I G;  5IT9 c;  2ES2 A;  3S17 H;  3D0F A;  3GTK H;  5M3M G;  3A5U A;  1GVP A;  5IYB G;  2ZJP A;  4A3M G;  1N33 Q;  3L0O A;  1Q86 C;  5C4X H;  3I2Z A;  2K4K A;  4GLX A;  1VQ6 A;  2C35 B;  4X62 Q;  4A3E H;  1Z9F A;  4BA1 I;  1XMQ L;  2BA0 A;  1Y1V G;  2KHI A;  1VQE A;  3I56 A;  1AE3 A;  1LUZ A;  4DR3 Q;  1UE7 A;  2VQE L;  1MJE A;  2N3S A;  3MXN B;  1ASZ A;  1VQF A;  4L5S A;  3H3V H;  4B3T L;  1UWV A;  4IJH A;  4UPA A;  4DR5 L;  3CQZ H;  3K7U C;  3J81 i;  3PIP A;  1XMO L;  2Y0S E;  4P71 A;  3SGI A;  3I4M G;  4KHP L;  3G4S A;  4MTN A;  5LMU Q;  3CP0 A;  1V43 A;  2PI2 E;  1UE6 A;  2JK8 A;  1QVG A;  1G29 1;  4A93 G;  4KHZ A;  4GNX A;  1WJJ A;  1IBK Q;  1YHQ A;  4Y7N H;  1I50 H;  4DV3 L;  5IYD H;  1HJP A;  3OTO Q;  1IBL L;  2E5L Q;  1N32 Q;  2JA8 G;  5JEA G;  5GQO A;  1YNX A;  2JA5 H;  1RIP A;  5E7N A;  4GKK L;  3HOW G;  3HKZ G;  4XIG S;  4X64 Q;  1J5E Q;  1HNX L;  1EIF A;  1A62 A;  3U50 C;  2BA1 A;  4GOP B;  4OXP A;  2UUA Q;  1FJG Q;  4KI0 A;  3CME A;  1NE3 A;  4YY3 Q;  4LFB L;  2R7Z G;  4DR5 Q;  3PUZ A;  3S16 H;  4RMF A;  3AFP A;  4JV5 Q;  1EQQ A;  1MKH A;  4R4I A;  4DNI A;  2NVX H;  2HQL A;  1QVF A;  5C0X I;  1Y14 B;  3NEL A;  2UXC Q;  4DV7 Q;  1E3P A;  1GO3 E;  1E24 A;  3M4P A;  4R4O A;  3JAM c;  3HOX G;  1JMC A;  4LFA L;  3KOJ A;  1KQS A;  1LTL A;  1I94 Q;  5M5W H;  1IBM Q;  1QUQ B;  1OXT A;  4L5T A;  3S14 H;  4BY7 G;  1NTG A;  1HH2 P;  1AH9 A;  2UXB Q;  5BR8 Q;  2E5L L;  1Q1B A;  3UE1 A;  4QGU A;  4DV0 L;  1HNZ Q;  3GTO H;  1X3E A;  3I4N H;  1YJN A;  4IFD I;  4EQ5 A;  4BXX H;  3K80 C;  2OTJ A;  4LF6 Q;  5HY6 A;  1EFW A;  3HOY G;  5LMU L;  2L15 A;  3FP9 A;  4A76 A;  4NXM Q;  4LWC A;  2UUC L;  2UXD L;  1E22 A;  2I5M X;  3OW2 A;  4A3B G;  5C4X G;  1WCM H;  4ME3 A;  5IYB H;  3ZJY C;  3CCE A;  3ER0 A;  1GD7 A;  2IY5 B;  4JG2 A;  5JEA J;  1L2F A;  3J81 c;  2E8G A;  1PYS B;  3UDF A;  2EIF A;  3CCM A;  4WJ3 M;  4LW1 A;  1QZH A;  3J80 i;  1RL2 A;  4JI4 L;  2Z0S A;  2KCM A;  3VDY A;  1XPR A;  2NVT H;  3M7N A;  2B29 A;  4DV2 L;  4B3M L;  4WJ4 A;  2F3I A;  2ID0 A;  1GM5 A;  1VQK A;  2Q2T A;  4BY1 H;  4B3R Q;  1PVO A;  2K5H A;  1K73 C;  3HKS A;  3BZK A;  1D8L A;  4LUO A;  4BBR H;  1WYD A;  3PGZ A;  2VW9 A;  5JJK A;  1R9T H;  1Q8K A;  4A75 A;  1NJI C;  1N34 Q;  1XNQ Q;  3CC7 A;  4LFA Q;  1HR0 Q;  5HGQ A;  1JB7 A;  1VQO A;  4JI3 Q;  4K0K Q;  1GKH A;  1A63 A;  4KHP Q;  3I7F A;  1NBW A;  1VQH A;  2UXB L;  3DLL A;  1JJG A;  1HNW L;  1VQB A;  4A3L G;  2VQF Q;  4GN4 B;  1IZ6 A;  3UDX A;  2NZH A;  3PO2 H;  2R7Z H;  2UXC L;  3BZC A;  4JI5 Q;  4B3M Q;  4DR4 Q;  2JA6 H;  4AYB E;  1B8A A;  1Z47 A;  2OQK A;  3G48 A;  4DV4 L;  4DV5 L;  1PH3 A;  3TRE A;  1PV4 A;  1MIU A;  2GN5 A;  1I5F A;  4P74 A;  1VCI A;  1P8L A;  2VL6 A;  4DAM A;  4A3G H;  1E1O A;  2CQO A;  3OYY A;  3KDF B;  5GAD C;  2HT1 A;  4JI0 L;  2KCT A;  2JA7 G;  2CFM A;  1IYJ B;  1EOV A;  3H15 A;  3PO3 H;  4X6A H;  1NMG A;  1X56 A;  2UU9 Q;  4NXM L;  2PQA B;  4DV7 L;  3UDG A;  3CXC A;  4A3C G;  1CSQ A;  2WP8 J;  1KRT A;  1VQL A;  3HOZ G;  3I4M H;  3J81 j;  4IFD G;  2K5V A;  2YYZ A;  1VQI A;  3AQQ A;  4A3D H;  1JE5 A;  2VZA A;  2H5X A;  2JA6 G;  4BBS H;  1X3G A;  1HZ9 A;  3RZO H;  4A4I A;  3K0X A;  4JI5 L;  3PIO A;  4DV6 Q;  1VQD A;  4HIM A;  2A19 A;  2WB1 G;  4JOI A;  4DV4 Q;  2JA8 H;  2CWP A;  5AJ3 L;  5LMN Q;  1KC8 C;  3MEF A;  2FXQ A;  4B3R L;  1Q1E A;  1X3F A;  4GLA C;  2MNA A;  2UUC Q;  1YI2 A;  2UUB L;  2VUM G;  2UXD Q;  4JI1 Q;  5M5Y H;  3HOZ H;  1LYL A;  5IY0 A;  5ELN A;  1SN8 A;  1PFS A;  4MZ9 A;  3M3Y H;  4LFC L;  3RZD H;  4JI8 L;  1E1T A;  1A0I A;  3ULJ A;  4JI4 Q;  3HOU G;  1EUJ A;  2XGT A;  3B6Y A;  1BBU A;  3K8A A;  1SRU A;  3HKZ E;  4YWL A;  2YTX A;  5IP7 G;  4OX9 L;  4GKJ Q;  4OO1 G;  3JC6 6;  3L7Z C;  4DR1 L;  4DR6 L;  4BY1 G;  4UP7 A;  5C0X J;  1IXR A;  3GD7 A;  3W1G A;  1U5K A;  4JI0 Q;  1YJW A;  3KF8 B;  4YCU A;  2YU9 H;  3M4O H;  2V1C C;  5GRO A;  3TEH B;  3CPF A;  4L5Q A;  4YWK A;  4A3E G;  4LFB Q;  4DV5 Q;  2ZTE A;  1TWF H;  3GTP H;  1Y1V H;  2ZTC A;  4R4Q A;  4JI1 L;  5FLX c;  4HJ5 A;  3CC4 A;  2R92 G;  1Q46 A;  2IHE A;  2NZO A;  4JV5 L;  4K0K L;  4GOP C;  2I5L X;  3CPW A;  1OXS C;  1LM0 A;  2B63 G;  4HJ9 A;  1SFO H;  3STB C;  3LGJ A;  3RN2 A;  1EYG A;  2ZJQ A;  2GVA A;  1BBW A;  1X9N A;  1HNX Q;  4POG A;  2JA9 A;  4R4T A;  3KJO A;  4LF7 Q;  1YEZ A;  2JEA I;  2IT1 A;  1JT8 A;  4DR1 Q;  3T1H L;  4DV0 Q;  2A1A A;  1FJG L;  1N36 Q;  4PG3 A;  2E2I H;  3S1R H;  5M3F H;  4L5R C;  1IL2 A;  2XTI A;  3GTG H;  3RN5 A;  4QQB X;  3CD6 A;  4X66 L;  3UDI A;  5FLM H;  5GAG C;  2ALY B;  2JQO A;  4PZ8 A;  3U4V A;  4BBR G;  4YCV A;  1KL9 A;  2IHF A;  4X64 L;  3CCV A;  3EBE A;  2CKZ B;  2LSS A;  1S3O A;  1YJ9 A;  1WOC A;  4LF9 Q;  2EXD A;  4DR2 L;  4HIK A;  4APV A;  4LUZ A;  1CKO A;  3J80 c;  4P75 A;  2PNH A;  2ATW A;  2WAQ E;  4YWM A;  5IP9 H;  3T1Y L;  3K81 C;  1JJ2 A;  2GVB A;  2Y0S G;  5GAE C;  3CMA A;  2B63 H;  1VQM A;  4TVA B;  2Q2U A;  1TWG H;  4BXX G;  2F52 A;  3Q8D A;  1P16 A;  3PCO B;  3RLO A;  4JI7 Q;  3S1Q H;  2A8V A;  2ZJR A;  4HIO A;  5BR8 L;  4JBK A;  4X65 Q;  2QGQ A;  2HHH L;  1PA6 A;  3ICE A;  5IYD G;  3GTL H;  3H0G H;  3I4N G;  4C3I H;  4GKK Q;  4R4C A;  3NEN A;  1XPO A;  2R7F A;  4GN5 A;  3J7A 5;  1L0W A;  1W2B A;  4C2M H;  4JI8 Q;  1B70 B;  4DV1 L;  2QEX A;  4HJ8 A;  1FL0 A;  4AYB G;  3FKI H;  1KHI A;  3TS2 A;  4IJL A;  4DR6 Q;  1YVC A;  1X65 A;  4GS3 A;  4X62 L;  4IO9 A;  2I0Q A;  2R93 G;  3GO5 A;  4DV2 Q;  5DLQ E;  2VQE Q;  1VQA A;  1Q7Y C;  3NEM A;  4IPH A;  4UP9 A;  1AE2 A;  2RF4 A;  4OWW B;  1TWC H;  4QIW E;  3HOV G;  4A3J G;  1V9P A;  3KYH C;  3E9I A;  2E2J H;  4OWX B;  4X66 Q;  2VQF L;  3CCS A;  1YHA A;  3OTO L;  2PMZ E;  4IOC A;  1CUK A;  1IBL Q;  1C0A A;  1NY4 A;  1OXV A;  3UE0 A;  1HZC A;  1PH6 A;  3TRZ A;  4HJ7 A;  3FHW A;  2ZM6 L;  4LF9 L;  3KF6 B;  2BH8 A;  2VS1 A;  4R1J A;  4DUZ L;  2NVQ H;  1BVS A;  2R7D A;  4DR2 Q;  4JI7 L;  3M4Q A;  1K9M C;  4O2D A;  3RNU A;  3HOU H;  2D62 A;  2HHH Q;  3S2H H;  1L1O A;  3T1Y Q;  3GDE A;  2VY3 A;  3E0E A;  4OO1 I;  3BU2 A;  1BKB A;  2OCE A;  1WFQ A;  4JI6 Q;  5JJL A;  3A5Z B;  2JJQ A;  3EN2 A;  4DKA C;  3HOV H;  2K52 A;  3F1Z A;  2PQA A;  1G51 A;  2KBN A;  4YY3 L;  5IWA L;  1B7Y B;  4A3K G;  1CSP A;  1J6Q A;  3S2D H;  1KAW A;  1XNR L;  2ASB A;  4AIM A;  1X55 A;  3CCQ A;  4LF4 L;  5C3E G;  4DK3 C;  4PZ7 A;  1HNZ L;  2JA5 G;  1S72 A;  2MQH A;  4DV6 L;  1XJV A;  4JC0 A;  3S1N H;  1CKN B;  2KEN A;  1O7I A;  1L1O C;  4YHH L;  4GN3 B;  3L2P A;  4FDB A;  4UP8 A;  4DK6 C;  4GOP A;  1A8V A;  2D0P A;  3CCR A;  3PF5 A;  4A3D G;  2HIV A;  3M9B A;  1XPU A;  2LXJ A;  4IPG A;  5C44 G;  3GTM H;  4H02 A;  3H3V I;  3A0J A;  4DR7 L;  3FKI G;  1VQ8 A;  3ULP A;  1YHB A;  3GTQ H;  3CAM A;  1L1O B;  2KHJ A;  2Z6K A;  3TQY A;  3H0G G;  2RHS B;  3BJU A;  1T9H A;  5FJ8 H;  4DUY L;  4DUZ Q;  1PH9 A;  4GNX B;  4BY7 H;  3CCL A;  4LF4 Q;  4YCW A;  1UE5 A;  1EQR A;  3W1B A;  1Q82 C;  1Q81 C;  1M1K C;  2VUM H;  2WAQ G;  4IPC A;  3CCU A;  4MNO A;  3AYH B;  2QA4 A;  4A3F G;  3RR5 A;  2AMC B;  4JYA Q;  1VS0 A;  4LF5 L;  5C3E H;  4HJA A;  5IP9 G;  2OTL A;  3PO2 G;  4POF A;  2ZM6 Q;  1WCM G;  4PZ6 A;  1OXX K;  2WFW A;  4A93 H;  2EQS A;  1SLJ A;  4DR3 L;  4A3B H;  1YIT A;  2Q2H A;  3JAM i;  5FJ8 G;  1FGU A;  3G6E A;  4B3T Q;  2K75 A;  3HOW H;  4DUY Q;  3PF4 A;  1I3Q H;  1VQ4 A;  4BBS G;  4JBW A;  4A3L H;  2RCN A;  1UEB A;  1HNW Q;  1CKM A;  2NN6 G;  1J5E L;  3PO3 G;  1E7Z A;  4P72 A;  4LF8 L;  1PH1 A;  4UY8 C;  1H95 A;  1OTC A;  4A3C H;  3PUX A;  1IBK L;  1PHJ A;  1KXL A;  1VQN A;  5IYC H;  3PUV A;  3EIV A;  3PUW A;  4XTC S;  3U4Z A;  1PH8 A;  1KIX A;  3CF5 A;  4P73 A;  1FVI A;  3F2B A;  1VQ7 A;  2OWO A;  1VQC A;  2K14 A;  1Q12 A;  2UU9 L;  4A3I H;  2K5N A;  2YTY A;  4NXN Q;  3AEV A;  2MO0 A;  5GAH C;  3E9H A;  4HID A;  2RHQ B;  2E2H H;  3PUY A;  5EAY A;  5IWA Q;  3G71 A;  3KFU A;  4TQU S;  4JBM A;  1K8A C;  1SE8 A;  1XTD A;  4A3M H;  1X6O A;  1I6H H;  1XNR Q;  2PI2 A;  5M3M H;  1JJC B;  4IPD A;  4JI2 Q;  4A3J H;  4NPS A;  1K8G A;  2BH2 A;  4ALP A;  4LF6 L;  3HOY H;  1EIY B;  2N8N A;  3D31 A;  1S40 A;  1CKN A;  1I94 L;  3ULL A;  3F2D A;  2Z6K C;  5IP7 H;  1Y1W H;  1C7Y A; 
#chains in the Genus database with same CATH topology
 1KDA A;  3F8T A;  2A74 C;  3QR8 A;  1Y1W B;  3KF8 A;  3VYT A;  1BCP D;  4JYA L;  5AJ3 Q;  4Y52 H;  5C44 H;  2P5Z X;  4OIJ A;  4LF8 Q;  2N49 A;  1B50 A;  4DV1 Q;  1MBY A;  2DJF C;  3RUZ A;  4LFC Q;  2RSN A;  5JJI A;  5D3I B;  4ZKC B;  3BVM A;  1XNQ L;  2AWN A;  3PSI A;  2F4V L;  1B3A A;  2IX1 A;  1JQY D;  1PH4 A;  5EKI A;  3S1N B;  4C3J B;  3S9W A;  3I55 A;  3KDF A;  3KF6 A;  3SK8 A;  4DPG A;  5CV7 A;  1I4G A;  4C3J H;  1EEF D;  4AQY Q;  1MJC A;  4L63 B;  1QNU A;  2VXW A;  4OO1 H;  4NXN L;  2RSO A;  3KLW A;  5FO9 B;  1X54 A;  4J15 A;  2KUM A;  4JW0 A;  3S24 A;  2CQA A;  3K7A H;  4LF7 L;  1FR3 A;  1WCM B;  3T1H Q;  2Y0S B;  1I6V C;  4IUT A;  2Z6B A;  2EY6 A;  1Q8I A;  2J4X A;  3K58 A;  1BCP B;  5KYI A;  3TP7 A;  2VNU D;  4RA8 A;  4DF7 A;  4JI2 L;  1V1Q A;  2UUA L;  1GOZ A;  4K5X A;  1JCK B;  4OON A;  2JE6 I;  4PV1 C;  5C4Z A;  2F0G A;  2PMZ B;  2OQ0 A;  1CI3 M;  3TSS A;  4CDE C;  1KRS A;  3GQB A;  4JBJ A;  1SAP A;  3IRB A;  5IT9 L;  2ZTD A;  1TWA B;  1Y8O B;  2TSS A;  2F0E A;  3HFZ B;  3ND9 A;  1YBY A;  4PQX A;  2UUB Q;  4JK1 C;  3ZYY X;  5M3M G;  3A5U A;  4OL7 A;  2WB1 B;  5C4X H;  3BVZ A;  3VYS A;  1ML0 D;  1Z9F A;  3HOY B;  1QE6 A;  2KHI A;  1AE3 A;  4DR3 Q;  2AQ3 B;  1SSO A;  4KD3 A;  4UPA A;  3CQZ H;  3K7U C;  1EQT A;  2Y0S E;  4P71 A;  1V43 A;  1QVG A;  2MPM A;  1IBK Q;  2L1B A;  4FF3 A;  5EKL A;  5K36 H;  2WAC A;  2E5L Q;  5C4J B;  1N32 Q;  3MFG A;  2JA5 H;  2EY1 A;  1SEB D;  1JOQ A;  1VF7 A;  1EY6 A;  1B9N A;  4GOP B;  1FJG Q;  4LFB L;  2R7Z G;  4F7X A;  3I90 A;  4DR5 Q;  1QJO A;  5G3L F;  3S16 H;  3AFP A;  3EA6 A;  1EQQ A;  2HQL A;  1D5Z C;  1ROD A;  5C0X I;  2UXC Q;  3CKI B;  1GO3 E;  3M4P A;  4R4O A;  1KDC A;  4IUU A;  3ERO A;  3OWF A;  2A6E C;  5BR8 Q;  4WJW A;  3AMU A;  3GTJ B;  1HNZ Q;  3GTO H;  4QF4 A;  1B3Q A;  4C3H G;  1F2Z A;  4LF6 Q;  1TS3 A;  2VB2 X;  2BOS A;  5HY6 A;  3HOY G;  5LMU L;  4NXM Q;  1STA A;  3QWN A;  3T16 A;  2UUC L;  1E22 A;  3H94 A;  1H9S B;  4ME3 A;  2PO4 A;  3CCE A;  3HS0 C;  2IY5 B;  5M5X B;  1TII D;  5KND A;  1PYS B;  3FPU B;  3U9S A;  3J80 i;  4JI4 L;  2KCM A;  2B2Y A;  2B29 A;  2MHV A;  4HED A;  1X3Q A;  2JP1 A;  1H9M A;  2FMM A;  3A8I E;  1PTO F;  3IFD A;  3OPO A;  4DV2 L;  5DM6 3;  3JAM E;  2K5H A;  2X6G A;  1K73 C;  3J7A V;  4CGY B;  1WYD A;  2Z1C A;  1YNN C;  3TP5 A;  5JJK A;  1Q8K A;  1KAA A;  1CZW A;  5CV6 A;  1XNQ Q;  2TMP A;  1TT2 A;  1D6E C;  1JB7 A;  4K0K Q;  5DM7 3;  1LV9 A;  4CKB A;  3NTH A;  5IIF A;  3FEW X;  2F0T A;  2F0O A;  1EYD A;  2KOL A;  3BS1 A;  1J9O A;  1BXT A;  5AFW A;  4B3M Q;  2OQK A;  4RKL A;  1SMY C;  2VL6 A;  1CQV A;  2CQO A;  2HT1 A;  2CFM A;  2LMC B;  2NN6 H;  5KIX A;  1HQR D;  3FKI B;  2RDG A;  3UDG A;  4X3T A;  4A3C G;  4IFD G;  1KRT A;  1VQL A;  3P75 A;  1SJE D;  1VQI A;  2H5X A;  2EPB A;  1BDO A;  3KBG A;  2B2W C;  4JI5 L;  1ILQ A;  1ICF B;  4DV6 Q;  1FGB D;  1I50 B;  2A19 A;  4JOI A;  3J80 E;  1TWC B;  2Q8I B;  1E0B A;  1EIG A;  1KTK A;  1X3F A;  4GLA C;  1SJH D;  2B39 A;  2WKC A;  4JI1 Q;  3HOZ H;  1LYL A;  2E74 C;  1V8Q A;  1PFS A;  4MZ9 A;  3M3Y H;  4ID6 A;  3HOZ B;  2XWB B;  1H9K A;  1EUJ A;  1S4Z A;  3B6Y A;  3S2H B;  3K8A A;  5KNB A;  5C5M A;  2K5D A;  1STB A;  2E75 C;  2F0Q A;  2HCI A;  1YJW A;  2HUG A;  4YCU A;  2YU9 H;  4FXD A;  2K03 A;  3S2D B;  2FFK B;  1X32 A;  4LFB Q;  2KHS A;  2ZTE A;  4HJ5 A;  2R92 G;  3I73 A;  3DHQ A;  4GOP C;  3KLS X;  1S5B D;  1GUG A;  3CPW A;  4HJ9 A;  1ONL A;  3LGJ A;  3DEO A;  1KDB A;  1X9N A;  2B2V A;  3KJO A;  3TZU A;  1MGS A;  4DR1 Q;  3GTM B;  4K5W A;  1EL0 A;  4AYB B;  1IL2 A;  2XTI A;  3DEP A;  4QQB X;  5FLM H;  3QOL A;  4PZ8 A;  3BDL A;  5I6Y A;  4LF9 Q;  1DON A;  5KEE A;  2LY7 A;  3OSO A;  4DK0 A;  1AZQ A;  2F0H A;  2A69 D;  2PNH A;  3EJI A;  5IP9 H;  4N8F A;  2GVB A;  4XYQ A;  3D4W A;  1DJR D;  2Y0S G;  2N88 A;  4XDX A;  3RLO A;  4JI7 Q;  3IFT A;  1I3Q B;  3EQL C;  4JBK A;  5BR8 L;  3QOJ A;  4X65 Q;  4OHJ A;  1EY8 A;  2EY5 A;  3H0G H;  2JYO A;  1XPO A;  1ESF A;  2R7F A;  4U68 A;  1GJX A;  4HAE A;  3SVM A;  4JI8 Q;  4DV1 L;  1PFM A;  2IX3 A;  1EEI D;  5CMD A;  3TS2 A;  4C3J G;  3VR6 A;  4DR6 Q;  4EQP A;  3I4L A;  3GV3 A;  3MVV A;  2RBM A;  4X62 L;  1HUN A;  2I0Q A;  2HDM A;  3W3A A;  2EYH A;  4DV2 Q;  1MHW C;  1SBB B;  1G2S A;  1IW7 C;  3R93 A;  2VQF L;  4X66 Q;  4IOC A;  1YHA A;  4OIK A;  1C0A A;  1WD1 A;  1PH6 A;  3TRZ A;  1KNE A;  4UDU C;  2LS0 1;  3KF6 B;  4IUN A;  1BVS A;  2R7D A;  4DR2 Q;  5TSS A;  3CU7 A;  5FK9 C;  5C44 B;  4NDX A;  2F0K A;  3QB3 A;  1IW7 D;  1PTO H;  2JJQ A;  1LO5 D;  1PFN A;  2PQA A;  1J6Q A;  3OW7 A;  3R2I A;  2F1M A;  1X55 A;  1PZK D;  1LTS D;  4RGT A;  1TS2 A;  4PZ7 A;  3Q23 A;  2MQH A;  5CBE E;  5M9O A;  4FP5 D;  3PF5 A;  4A3D G;  4LJZ C;  3M9B A;  3PIP 3;  1XPU A;  3R8B A;  5M3F B;  1YHB A;  1I4H A;  2KHJ A;  4S3S A;  1PH9 A;  4KK7 A;  3QJY A;  4RFB A;  3C2P A;  4MTK A;  2K33 A;  1RTN A;  4IQZ A;  1XYI A;  2VUM H;  1Q81 C;  2WAQ G;  2QA4 A;  3SE0 A;  3AYH B;  1GUS A;  4V0B A;  2QDL A;  4JYA Q;  2J0T D;  2HCC A;  4HJA A;  5CV9 A;  2QDB A;  4POF A;  4MHE A;  4PZ6 A;  3T4A C;  1PXU A;  4DR3 L;  3ITP A;  3H3V C;  2PW7 A;  5FJ8 G;  1DYQ A;  2RCN A;  1BUV T;  1PH1 A;  4FF4 A;  1IBK L;  1PHJ A;  4KY6 A;  1VQN A;  5IYC H;  3PUV A;  1EY5 A;  1STG A;  2K14 A;  1ILP A;  1Q12 A;  2UU9 L;  4NXN Q;  4E6I A;  5M3M B;  2RHQ B;  3PUY A;  1GUN A;  1SE8 A;  1XTD A;  2O2L D;  5C4X B;  3VR5 A;  1XNR Q;  4A3L H;  3HOY H;  1EIY B;  2F03 A;  1DOK A;  1ZYR D;  2N8N A;  1A6X A;  3D31 A;  3MHB A;  3A8J E;  3W5O A;  3M85 A;  4CKC A;  4DN4 M;  5BN5 A;  3BYT B;  3WWV A;  2JA7 H;  5T1G A;  3CC2 A;  1EYC A;  3LWE A;  3PV0 A;  1DGS A;  5C4J H;  2LXK A;  1VQP A;  3UI2 A;  1S5F D;  4DXG A;  2SEB D;  3DM3 A;  4KV6 A;  1N34 L;  1K3B C;  1R4P B;  1G2T A;  2R93 B;  1SYF A;  1H9S A;  4JI3 L;  3J7Z C;  4LF5 Q;  3VYU A;  2R93 H;  3NK9 A;  4G4K A;  4NMZ A;  3K5N A;  1W3S A;  1XXG A;  5JVH 3;  1SMX A;  4C3H H;  3NBH B;  3EVQ A;  4QY7 A;  2ZXO A;  4DR4 L;  1WTP A;  3I4O A;  4K5V A;  3GTJ H;  3GTO B;  3AFQ A;  5IGF A;  4A3G G;  3E5S A;  1WTQ A;  2KA7 A;  1N36 L;  2Q2I A;  2NVY B;  3VR3 A;  3KLS A;  1CTM A;  4IUP A;  1F9Q A;  4KKU A;  3WDN A;  1VQ9 A;  4O0A A;  2AWO A;  5M5X H;  2R92 H;  2IX0 A;  1UE1 A;  2L0C A;  3I91 A;  1YZ6 A;  4HSP A;  3S15 H;  2R92 B;  1PH5 A;  1PFB A;  2A68 D;  1O80 A;  1C9O A;  2CVR A;  2PZW A;  1UUP A;  1PH7 A;  1TXY A;  2K05 A;  4YHH Q;  4RWS C;  4IFD J;  4TRD A;  3CCJ A;  3N52 A;  1ASY A;  2B2U A;  3MXN A;  4GLV B;  1K3R A;  5IE8 A;  5FLX E;  1EY0 A;  3M7G A;  1Y1W G;  2I5H A;  5ELO A;  3A74 A;  5CGK A;  5LMN W;  1QB5 D;  2G9D A;  3BYY B;  2DNC A;  1PH2 A;  5CV4 A;  1U4L A;  3F2C A;  4A3I G;  5IT9 c;  1BQQ T;  2F3V A;  3GTK H;  4KY5 A;  3L3O C;  1N33 Q;  3I2Z A;  3E3X A;  1VQ6 A;  4BA1 I;  1XMQ L;  2BA0 A;  1VQE A;  3I56 A;  1LUZ A;  2VQE L;  5FOB B;  3MXN B;  1VQF A;  2RVL A;  4B3T L;  4C3I G;  4DR5 L;  3J81 i;  1K0S A;  2F0D A;  1JB3 A;  3G4S A;  4MTN A;  3J80 L;  2JK8 A;  4BBS B;  3SHL A;  1G29 1;  1LTT D;  4A93 G;  4RAU C;  1YHQ A;  4Y7N H;  1I50 H;  1CA5 A;  1LT3 D;  4FF1 A;  5IYD H;  3OTO Q;  5GQO A;  1RIP A;  3HOW G;  2XIW A;  3HKZ G;  4X64 Q;  3M4Y A;  1EIF A;  2CH4 A;  1LTG D;  2BA1 A;  2O5J C;  1PZJ D;  5CYU A;  4KI0 A;  1NE3 A;  3KLR A;  3P20 A;  3PUZ A;  4RMF A;  2A6H D;  3S14 B;  4CJ0 B;  1E24 A;  4QUF A;  3KOJ A;  1PTO C;  4ZCK A;  1KQS A;  5M5W H;  1IBM Q;  3S14 H;  1OXT A;  4L5T A;  4BY7 G;  4B08 A;  3O13 A;  2UXB Q;  5DNF A;  3M4O B;  1B1Z A;  3KK7 A;  3W2D A;  1YJN A;  4IFD I;  4EQ5 A;  1W6K A;  5LL6 X;  4BXX H;  1AW7 A;  1BCP C;  3K80 C;  1Y1V B;  4YIJ A;  4A76 A;  2L15 A;  2KEE A;  1TQO A;  4XQQ A;  4A3B G;  5C4X G;  1D2B A;  1WCM H;  1S5E D;  3ZJY C;  2F0N A;  1JWM D;  5JEA J;  1STE A;  1L2F A;  2EZV A;  1CHP D;  3J81 c;  4WJ3 M;  4ZLT F;  4LW1 A;  1RL2 A;  2Z0S A;  4A3K B;  3VDY A;  2EYF A;  4DXF A;  4B3M L;  1VQK A;  4BY1 H;  1PVO A;  2D9U A;  3HKS A;  2ZXR A;  4KJO A;  1D8L A;  3BZK A;  2F0V A;  1N34 Q;  1L0X B;  5J39 A;  3CC7 A;  4LFA Q;  1YNJ D;  1HR0 Q;  2EYP A;  3NTK A;  1VQO A;  4JI3 Q;  5L37 A;  4KHP Q;  3I7F A;  1VQH A;  3DLL A;  1JJG A;  1E2Z A;  2R7Z B;  2BE5 C;  2B63 B;  2Z4I A;  2VQF Q;  1H9R A;  3UDX A;  2NZH A;  4PNY A;  4ZQ3 A;  3OWE B;  4JI5 Q;  4DR4 Q;  2JA6 H;  1STH A;  1B8A A;  3G48 A;  4P74 A;  1NR2 A;  1P8L A;  2JXM B;  4CBV A;  4DAM A;  4A3G H;  1E1O A;  2F0J A;  1D5X C;  1IYJ B;  4X6A H;  1NMG A;  3V2T A;  2DNE A;  4DV7 L;  3CQZ B;  5FKA C;  2I07 B;  2PPB C;  2YYZ A;  3I4M H;  2B8F A;  5KNC A;  1JE5 A;  3R2T A;  2JA6 G;  2B2T A;  4K6D A;  1VQD A;  2WB1 G;  2SOB A;  2CWP A;  1HRJ A;  5LMN Q;  5JEA H;  1KC8 C;  2K5W A;  5C3X A;  4J1M A;  2JA8 B;  2E2J B;  2VUM G;  2UXD Q;  2F0F A;  3SEB A;  5M5Y H;  4ME5 A;  1LAC A;  5JVG 3;  4IUV A;  3RZD H;  1SNO A;  4CDC C;  3A55 A;  2A73 B;  3QIA A;  1FNU A;  2XGT A;  4YWL A;  2EOT A;  3HKZ E;  4GKJ Q;  3JC6 6;  3L7Z C;  4DR1 L;  5C4H A;  2OT2 A;  3CHB D;  1PTO B;  1U5K A;  4JI0 Q;  2EE1 A;  2IW3 A;  3T56 B;  5EPK A;  2KEC A;  3OIQ A;  4H0L C;  4YWK A;  4A3E G;  2D2C C;  4R4Q A;  2ZTC A;  3HP3 A;  3ICE A;  2NZO A;  3NUC A;  3IAY A;  2I5L X;  2B63 G;  1ESR A;  3DM1 A;  1SFO H;  3RN2 A;  3K5O A;  1EYG A;  2ZJQ A;  2GVA A;  4POG A;  4R4T A;  3S1R B;  1MD2 D;  2JEA I;  4L6T B;  5C0X H;  2E2I H;  5IGC A;  3S1R H;  5M3F H;  4UAI A;  5HUR A;  4L5R C;  1HPC A;  4KKT A;  2NYZ D;  2L4N A;  4X66 L;  2E2I B;  2K1B A;  5GAG C;  2ALY B;  3U4V A;  4BBR G;  2VB3 X;  4YCV A;  2KED A;  1B44 D;  3GTG B;  4X64 L;  3CCV A;  3EBE A;  3HEJ A;  3AU7 A;  4DR2 L;  4F8M A;  4HIK A;  4APV A;  1XX8 A;  1XWE A;  3J80 c;  4HR7 B;  4IZ8 A;  1LLR D;  4IAL A;  4NP5 A;  3CMA A;  4A3B B;  1VQM A;  4TVA B;  3U9O A;  2F52 A;  5EPL A;  1EFI D;  2CW0 C;  4JVZ A;  4DU9 A;  1KAB A;  2ZJR A;  2QGQ A;  2RCF A;  2HHH L;  1CFM A;  1QIL A;  3NHH A;  5IYD G;  2DJG C;  1ET9 A;  4C2M B;  4R8I A;  1WTV A;  1U4R A;  4XYO A;  1ZYR C;  3J7A 5;  1W2B A;  4C2M H;  1GUO A;  5NUC A;  1RJT A;  5IOC A;  2QEX A;  4HJ8 A;  1FL0 A;  4AYB G;  4KN4 C;  2LKV A;  3OIP A;  5ISR A;  3V96 A;  3BG3 A;  4IO9 A;  3QG1 A;  3J7Y W;  2B2Y C;  4K14 A;  1Q7Y C;  4H44 C;  4IPH A;  4M8A A;  1AE2 A;  1TWC H;  3X3M A;  2F0S A;  4OWX B;  1QOH A;  1IBL Q;  4B9X A;  1NY4 A;  1OXV A;  2A5H A;  4ULL A;  2BH8 A;  2VS1 A;  4DUZ L;  3M3Y B;  3G6J B;  4ZRZ A;  2EVB A;  4RKB A;  3HOU H;  3S2H H;  4B9W A;  3T1Y Q;  1BF4 A;  3GDE A;  2VY3 A;  2DN8 A;  4OO1 I;  2OCE A;  5C6A A;  1VMP A;  3A5Z B;  2K52 A;  3F1Z A;  5IWA L;  1B7Y B;  3A8K E;  3K0Y A;  3S2D H;  2ASB A;  4K2L A;  3NWS A;  2EYM A;  3GTP B;  1TWF B;  2O5I C;  1TKW B;  1XJV A;  4JC0 A;  3ND8 A;  5C3W A;  1L1O C;  2L9H A;  4YHH L;  3L2P A;  2NTS A;  4DK6 C;  4GOP A;  1A8V A;  3CCR A;  3CRL C;  5J1Z A;  2HIV A;  1CM9 A;  3MWY W;  1Q3L A;  3GTM H;  3H3V I;  3FKI G;  1VQ8 A;  4HMI A;  5ELB A;  3GTQ H;  2RDH A;  3TQY A;  3H0G G;  1T9H A;  3IKJ A;  2D5D A;  3GTQ B;  4LF4 Q;  1EOT A;  4YCW A;  1LTR D;  2Q8R E;  3CCU A;  4PMB A;  4A3F G;  1M1K C;  2A6H C;  2KVM A;  2EYO A;  4DNR B;  4C1N K;  4X3K A;  1A15 A;  2A69 C;  5C3E H;  3PO2 G;  4WRD A;  2ZM6 Q;  2LFN A;  3D4R A;  1OXX K;  5C3E B;  1SLJ A;  1YIT A;  3JAM i;  4B3T Q;  3HOW H;  3T13 A;  4DUY Q;  3PF4 A;  1HNW Q;  2PW5 A;  1DM0 B;  2NN6 G;  5ELD A;  4LF8 L;  2NB0 A;  2F0W A;  3RMH A;  3OMG A;  5IGE A;  4NW2 A;  3PUX A;  2AUJ D;  1PH8 A;  1KIX A;  2DY8 A;  3V05 A;  5BN3 A;  1VQ7 A;  4P73 A;  1FVI A;  5I9P A;  3F2B A;  2JSO A;  5ELC A;  3GV6 A;  1VQC A;  1EZ6 A;  4HTH A;  3NPP A;  4A3I H;  2HD3 A;  2MO0 A;  1SNC A;  2EYL A;  3TP6 A;  1IHZ A;  5GAH C;  4HID A;  4A3J B;  3BZD B;  3G71 A;  4TQU S;  1I6H H;  1YNJ C;  4WOR A;  4JI2 Q;  2E2H B;  1E2W A;  5CV5 A;  1Y8P B;  2KCN A;  3ULL A;  2Z6K C;  5IP7 H;  1DOL A;  4GNX C;  1QZG A;  5H1S E;  4G7O C;  1D7Q A;  4KHV A;  4G57 A;  1PTO D;  4OX9 Q;  1G6Z A;  2EDG A;  5JPM C;  4QJF A;  3D4D A;  4BA2 I;  3HOV B;  2XRS D;  2WB1 E;  1WI5 A;  2JEB I;  1STY A;  4IUQ A;  1RDP D;  1YIJ A;  4JOI C;  4BS9 A;  1HZB A;  1EY7 A;  3C1F A;  4LAA A;  4KD4 A;  3P1H A;  5I6W A;  2KJX A;  5IGB A;  1VQ5 A;  4Q5V A;  4XT1 B;  4CDF C;  5IYC G;  1WTW A;  5A2Q E;  1HR0 L;  4LNQ A;  5J3B A;  1F2Y A;  1I4P A;  4K8J A;  1EWI A;  5E1F A;  3I4N B;  2V4D A;  3Q0A A;  2PYK A;  1N32 L;  1LAB A;  2R6G A;  1WTO A;  1U0L A;  1C4Q A;  1UEA B;  1VQJ A;  2VUM B;  1SRO A;  4RCO A;  1HR0 W;  3HRZ C;  4ILW A;  4Z9C B;  4HN7 A;  2IJ0 A;  5K36 G;  1TWH B;  1N8R C;  2B3G A;  4A3K H;  5G3L D;  1K83 B;  4QCL A;  2QW7 A;  5IGG A;  4O1N A;  2NBF A;  1TWH H;  1B2T A;  4A3F H;  4RG1 A;  3TS0 A;  1K83 H;  1GHK A;  2DY7 A;  1WD0 A;  2XN9 C;  4DAY B;  1N33 L;  1KD1 C;  2HQE A;  2NN6 I;  5M3F G;  2YTV A;  1M90 C;  2CW0 D;  3HOX H;  4EX5 A;  2I46 A;  5FLM G;  2AKW B;  2D0O A;  4DR7 Q;  2FJ2 A;  4AQY L;  4U67 3;  3CW2 C;  3U58 A;  4OWT B;  1SYC A;  1Y69 U;  1TWA H;  1BOS A;  2K50 A;  3OMC A;  4CJ1 B;  4C56 C;  3Q22 A;  1EWH A;  1D5M C;  1E2V A;  1FNW A;  5LL6 S;  4PMW A;  1SXT A;  2ES2 A;  3S17 H;  3VR4 A;  1LTA D;  4P2C B;  1GVP A;  1MSG A;  3E0J A;  2ZJP A;  1TR5 A;  4A3M G;  4GLX A;  1Q86 C;  3S17 B;  1BBX C;  3K6O A;  1UE7 A;  1B53 A;  1JE4 A;  4MN3 A;  1MJE A;  3D6C A;  1C8C A;  3DUZ A;  4L5S A;  1CK1 A;  4O42 A;  3PIP A;  1XMO L;  1PZI D;  3I4M G;  5LMU Q;  1KNA A;  3CP0 A;  2JA7 B;  1GUW A;  2PZT A;  3E6Z X;  5I2Y A;  4KHZ A;  1WJJ A;  2KQ3 A;  4R9W A;  4DV3 L;  1HJP A;  1D1I A;  4GKK L;  4DK1 A;  5JEA G;  1YNX A;  3SDZ A;  4XIG S;  3IL8 A;  1A62 A;  2FHT A;  1O7Z A;  4OXP A;  2F0P A;  3CME A;  4YY3 Q;  3I72 A;  2PQE A;  2L12 A;  3NQI A;  4JV5 Q;  4R4I A;  1QVF A;  3NEL A;  3HOX G;  1JMC A;  1MSH A;  2RA4 A;  2EY2 A;  1QUQ B;  1HH2 P;  1PRT C;  1Q1B A;  4QGU A;  4DV0 L;  1X3E A;  2OTJ A;  2MUY A;  3MXU A;  4LWC A;  3G7L A;  5KYL A;  2I5M X;  3OW2 A;  5IYB H;  1DXM A;  4JG2 A;  1O78 A;  3UDF A;  3CCM A;  3RD4 A;  2AUK A;  3M7N A;  4XT3 B;  4WJ4 A;  1WTX A;  2ID0 A;  3I3C A;  2X69 A;  4LUO A;  1PRT F;  2SNM A;  4BBR H;  1TY2 A;  3BVG A;  5HGT A;  1JIC A;  5EJW A;  4A75 A;  4HSV A;  5FO7 B;  5HGQ A;  1DOM A;  1NBW A;  3KUP A;  1H9J A;  1TS4 A;  2ZXP A;  1VQB A;  4A3L G;  1RF2 D;  3FRP B;  1JR0 D;  4AYB E;  1VF5 C;  1SNM A;  1PH3 A;  2M2L A;  4RGN A;  2GN5 A;  1I5F A;  1VCI A;  3KDF B;  5GAD C;  2WII B;  2KCT A;  4KJN A;  5JOB A;  1EOV A;  4FYD A;  1SYE A;  3PO3 H;  2UU9 Q;  5J22 A;  5CR3 A;  2PQA B;  3HOZ G;  1VDZ A;  3J81 j;  4EQN A;  4A3D H;  3RZO B;  4OGQ C;  4ZAI A;  4BBS H;  1X3G A;  4DGZ A;  3RZO H;  3K0X A;  3PIO A;  2F3W A;  5BN4 A;  4DV4 Q;  3NBI A;  5AJ3 L;  2K01 A;  2FXQ A;  1EZ8 A;  3DWA A;  4B3R L;  3HG9 A;  2MNA A;  2UUC Q;  4KMU C;  2R3Z A;  4IFD H;  5ELN A;  1PLF A;  4LFC L;  4XQJ A;  4JI8 L;  1A0I A;  2AQ1 B;  3ULJ A;  4JI4 Q;  3HOU G;  4ZYS A;  3DMU A;  1X3P A;  1BBU A;  1JC7 A;  2ICI A;  4DR6 L;  4BY1 G;  3WOF A;  5M5W B;  5C0X J;  2WKD A;  1IXR A;  2XSC A;  3GD7 A;  3W1G A;  1K28 A;  4FVM A;  3M4O H;  3K59 A;  1F9R A;  5C5L A;  3N6R A;  3TEH B;  3CPF A;  4L5Q A;  2QF7 A;  2YU9 B;  4DV5 Q;  3GTP H;  1TWF H;  1Y1V H;  3MZ5 A;  4K0K L;  4JV5 L;  1JOK A;  2B2T C;  1JWU D;  1T5E A;  1HNX Q;  2JA9 A;  3MC0 B;  4DA2 A;  4LF7 Q;  3ONA B;  5IGD A;  3Q6S A;  4DAY A;  3T1H L;  4DV0 Q;  4C1N I;  2NVT B;  1N36 Q;  4PG3 A;  2NZ1 D;  4ZUI A;  3RN5 A;  2HDL A;  3DWQ A;  4TSS A;  4BY1 B;  3VA7 A;  1Z6H A;  5D65 A;  1RD9 D;  3TDQ A;  1KL9 A;  1CT1 D;  2LSS A;  1S3O A;  2JN4 A;  1WOC A;  1YJ9 A;  1NCV A;  1R9T B;  1PRT B;  4LUZ A;  4CDD C;  3R3O A;  4IUR A;  4P75 A;  2EJF C;  1MI2 A;  2ATW A;  4YWM A;  3T1Y L;  1JJ2 A;  1GUT A;  4MIU A;  5GAE C;  2B63 H;  4QB4 A;  3S1Q B;  1TWG H;  3PO2 B;  1P16 A;  3A7A B;  3S1Q H;  2A8V A;  2JA6 B;  4HIO A;  2F4I A;  3NE5 B;  2F0U A;  3GTL H;  3I4N G;  3T51 B;  3NEN A;  1L0W A;  5E4W C;  1HTP A;  3H0G B;  1B4O A;  3MFY A;  4RHS A;  4NKL A;  1IYU A;  1KHI A;  3NQT A;  2PZU A;  4IJL A;  5FLX L;  1YVC A;  2G5D A;  1X65 A;  5EQ0 A;  3GO5 A;  1AP0 A;  4M1U B;  1VQA A;  2VQE Q;  4DFA A;  5COY A;  2RF4 A;  4OWW B;  3WOE A;  3QO2 A;  3HOV G;  1V9P A;  1HUM A;  5LHY 1;  3NBH A;  1JWS D;  3E9I A;  2E2J H;  3CCS A;  2MP1 A;  2PMZ E;  2CHB D;  3UE0 A;  5M5Y B;  2ZM6 L;  2EJM A;  4R1J A;  1Q90 A;  4I7Z C;  2WIN B;  4JI7 L;  3M4Q A;  4O2D A;  1F9P A;  3RNU A;  2D62 A;  1EU3 A;  1L1O A;  1TU2 B;  3E0E A;  1K8O A;  1BKB A;  1HA6 A;  1WFQ A;  2BCO A;  4K6L A;  4JI6 Q;  5JJL A;  4RGM A;  3GP7 A;  3HOV H;  4H13 C;  1V1P A;  4HCS A;  1CSP A;  3SR1 A;  1KAW A;  1XNR L;  1GXD C;  4LF4 L;  3BDO A;  1HNZ L;  2JA5 G;  2RDF A;  4KKS A;  1S72 A;  3S1N H;  1CKN B;  2KEN A;  3TME A;  3PMF A;  1O7I A;  1A3V A;  2RQX A;  2QEJ C;  5JPN C;  4GN3 B;  1SFO B;  5I2X A;  3MAQ A;  3NXW A;  2M9V A;  4XXE A;  4RHR A;  4IPG A;  1I4Q A;  3MTS A;  4H02 A;  5EKK A;  5C44 G;  4DR7 L;  4QIW B;  4KY7 A;  3CAM A;  1L1O B;  4DUY L;  3CD6 A;  4H7B A;  3BJU A;  1NNX A;  3MXG A;  4GNX B;  2IPK D;  3CCL A;  1F77 A;  4IPC A;  2AMC B;  4R8N A;  1U4P A;  4LF5 L;  5IP9 G;  1J8I A;  3EFX D;  1KLG D;  3HKZ B;  1WCM G;  4A93 H;  4A3B H;  2C5C A;  1IL8 A;  4A3F B;  1AN8 A;  1I4X A;  1FGU A;  3G6E A;  4A93 B;  1SE3 A;  2WV6 D;  1VQ4 A;  4BBS G;  4JBW A;  1UEB A;  1J5E L;  2ICE C;  2N55 A;  1BO0 A;  4X3S A;  4UY8 C;  1IKM A;  4C3I B;  1H95 A;  2XRQ D;  3KBX A;  1OTC A;  2EJG C;  2B2V C;  4K2K A;  3EIV A;  3PUW A;  5T1I A;  3U4Z A;  4GKK Q;  5JJZ A;  5EBD A;  4A3M B;  2YTY A;  3TBI B;  1XTC D;  3AEV A;  4OX9 L;  3KFU A;  1HQM C;  2MJ8 A;  1K8A C;  3MA2 B;  4A3M H;  1SYG A;  2L55 A;  2PI2 A;  1JJC B;  1ZKO A;  5M3M H;  3FVQ A;  4NPS A;  1K8G A;  2BH2 A;  1DD2 A;  5E4X A;  1FYC A;  3F2D A;  2NUC A;  1C7Y A;  1PYW D;  3T53 B;  1HCZ A;  2IWH A;  1K0R A;  2NVQ B;  3SK4 A;  4CKE A;  4JCV E;  1S5D D;  1DZ1 A;  2XWJ B;  1SE4 A;  5LMN L;  3STB D;  1EIH A;  5K5P A;  1NMF A;  2CWA A;  2OF1 A;  1ENA A;  4N9P A;  4AH6 A;  1QVC A;  2Q8T A;  1PYB A;  5D3D A;  2ZT9 C;  5EBC A;  1XMQ Q;  4NB3 A;  4GKJ L;  3I8Z A;  1EYA A;  3S16 B;  2H1E A;  2AHO B;  1U4M A;  3ERS X;  1JOO A;  1SR3 A;  2PNR C;  1ICW A;  3RLF A;  4DNT B;  2R61 A;  2YV5 A;  4JI6 L;  2QKI C;  3LNN A;  2MFI A;  1G8Z D;  3A54 A;  1QUQ A;  3MEH A;  2NVY H;  4KLK A;  2F4V Q;  5JAV A;  2M00 A;  1LT6 D;  3X3N A;  2G9H D;  1XMO Q;  2CCZ A;  1STN A;  1IKL A;  1TS5 A;  2N78 A;  1HZA A;  2SNS A;  4LUV A;  4B3S Q;  3FDT A;  3LX0 A;  4DV3 Q;  1SDF A;  1R4Q B;  3S1M B;  2DGY A;  2NTT A;  3RLN A;  1IBM L;  3S15 B;  5KGU A;  4BBR B;  3S1M H;  1VQG A;  5C0X G;  3OOC A;  2DUD A;  4DAV A;  4RGO S;  1G6P A;  4FF2 A;  4X65 L;  2F0M A;  3DWP A;  2HIX A;  1RCV D;  1PMR A;  3KJP A;  2FMC A;  2OEO A;  4FXG C;  2MO1 A;  4IOA A;  1N9W A;  1ZEQ X;  2Z9H A;  1OXU A;  4QL5 A;  3D0F A;  4A3E B;  1I4R A;  1QNK A;  1A3U A;  5IYB G;  3L0O A;  2J7Z A;  2K4K A;  2C35 B;  2A6E D;  1QG7 A;  4X62 Q;  4A3E H;  1Y1V G;  4F87 A;  1M8A A;  4LK1 C;  2N3S A;  4OEM B;  1ASZ A;  3H3V H;  1UWV A;  4IJH A;  3J81 E;  1B9M A;  3SGI A;  3C3L A;  4KHP L;  4EQO A;  1UAP A;  2PI2 E;  1UE6 A;  3H91 A;  4FO2 A;  5F2D A;  1ENC A;  4GNX A;  1IBL L;  2JA8 G;  5E7N A;  4Y7N B;  1J5E Q;  1HNX L;  3U50 C;  3PQI A;  2UUA Q;  2NVX B;  3URY A;  1II3 A;  1MKH A;  4DNI A;  2NVX H;  2SDF A;  1Y14 B;  1VMC A;  3C46 A;  4DV7 Q;  1E3P A;  1KLU D;  3NTI A;  4LFA L;  1NUC A;  3JAM c;  1OO9 B;  1LTL A;  1I94 Q;  3JAM L;  1NTG A;  1AH9 A;  1WVL A;  4F88 A;  2E5L L;  3UE1 A;  1WTR A;  4KTA A;  3I4N H;  4TKO B;  1HHV A;  4N8X 1;  4XQN A;  1EFW A;  3FP9 A;  1C48 A;  4PMC A;  3K7A B;  2UXD L;  3ER0 A;  1GD7 A;  2GA4 B;  4FXK C;  4ZKB B;  1SNP A;  1SND A;  2E8G A;  2EIF A;  1QZH A;  1XPR A;  2NVT H;  3LWU A;  4QMG A;  2F3I A;  1GM5 A;  2Q2T A;  4B3R Q;  1U9R A;  3PGZ A;  2VW9 A;  3D3R A;  1R9T H;  1NJI C;  3HOX B;  1V1O A;  1GKH A;  1EWC A;  1A63 A;  2K28 A;  2UXB L;  1T5X D;  4LMQ D;  1HNW L;  4GN4 B;  1IZ6 A;  2L5T A;  3PO2 H;  2R7Z H;  2UXC L;  3BZC A;  1EY9 A;  1FD7 D;  1Z47 A;  4DV4 L;  4DV5 L;  3K5L A;  5IT9 E;  4QUC A;  3TRE A;  1PV4 A;  1MIU A;  3GTL B;  2B2U C;  3FMC A;  1M4V A;  4BWG B;  3OYY A;  1ENF A;  1K8M A;  4JI0 L;  2JA7 G;  3C1E A;  3HGB A;  4A3G B;  3H15 A;  3I4M B;  1X56 A;  4NXM L;  1NSN S;  3ERQ A;  3CXC A;  1CSQ A;  2WP8 J;  2K5V A;  3BDC A;  3AQQ A;  3VR2 A;  2VZA A;  4DAP A;  4ABN A;  1HZ9 A;  4A4I A;  4HIM A;  1AZP A;  2JA8 H;  1SE2 A;  2JA5 B;  3MEF A;  4X3U A;  1Q1E A;  3SK5 A;  1YI2 A;  2UUB L;  1IYV A;  3SK6 A;  5IY0 A;  2L11 A;  1SN8 A;  3TP8 A;  1TVX A;  1E1T A;  1AEX A;  1FNV A;  2E2D C;  3I70 A;  1SRU A;  3RZD B;  2YTX A;  5IP7 G;  4OO1 G;  1RHP A;  5DAU A;  3TZD A;  2PCF B;  5A35 A;  4UP7 A;  2K7V A;  1NAP A;  3VYR A;  3KF8 B;  2V1C C;  5GRO A;  4ZK9 B;  3K57 A;  1CHQ D;  2K32 A;  4RH6 A;  2BDN A;  4Q0F A;  3MXP A;  5FLX c;  3CC4 A;  4JI1 L;  4JPB W;  1Q46 A;  2IHE A;  1HA5 A;  1OXS C;  1LM0 A;  1EQV A;  4UHV A;  4OEL B;  3NSW A;  3STB C;  3L9A X;  1BBW A;  1A2T A;  1YEZ A;  1JT8 A;  2IT1 A;  2A1A A;  1FJG L;  4GZY C;  2NWG A;  1LT4 D;  4ZUJ A;  3GTG H;  2K04 A;  3OHX C;  5ELF A;  3UDI A;  2EXZ A;  2H4O A;  2JQO A;  2K6A A;  1G91 A;  2IHF A;  2CKZ B;  1A2U A;  3D6W A;  2EXD A;  2E76 C;  3K5M A;  1CKO A;  5A2Q L;  2Z8L A;  3D8G A;  1SNQ A;  2WAQ E;  4RCN A;  2BE5 D;  1F2M A;  3A7L A;  3K81 C;  1CA6 A;  1HXY D;  2OXP A;  5CV8 A;  2A68 C;  2Q2U A;  4BXX G;  1O7L A;  3Q8D A;  3PCO B;  1A3T A;  1YNN D;  1PA6 A;  3DXJ C;  4KN7 C;  1UNS A;  4IN3 A;  4C3I H;  4R4C A;  1HFG A;  4GN5 A;  5EPJ A;  1B70 B;  3PO3 B;  3FKI H;  1WTH A;  2EYJ A;  4A3D B;  4L8J A;  1GHJ A;  4HCE A;  4GS3 A;  3FPP A;  2K5Q A;  2R93 G;  2Z4H A;  2MGS A;  5DLQ E;  3NEM A;  4UP9 A;  1F2L A;  1LT5 D;  1Z7T A;  4QIW E;  1QWY A;  4A3J G;  3KYH C;  3OTO L;  1CUK A;  1HZC A;  3H09 A;  4HJ7 A;  3FHW A;  4LF9 L;  2NVQ H;  4G7H C;  2ENB A;  1BCP F;  2QCP X;  5CBA E;  1K9M C;  3Q24 A;  2HHH Q;  3BU2 A;  3HOU B;  4V19 0;  1O7Y A;  3EN2 A;  4DKA C;  1G51 A;  2KBN A;  1Y8N B;  4YY3 L;  1RTO A;  1NR4 A;  4A3K G;  4I65 A;  2O4X A;  1HFN A;  1EU4 A;  4AIM A;  3CCQ A;  5C3E G;  1TY0 A;  5CC4 A;  2FIN B;  4DK3 C;  3F2U A;  2RKS A;  4DV6 L;  1DCZ A;  2AQ2 B;  5IOD A;  1ET6 A;  4FDB A;  4UP8 A;  4C3H B;  5E3F A;  4EVO A;  2D0P A;  3VA5 A;  2XVS A;  2X6L A;  1F9S A;  3HZX A;  2LXJ A;  4J8Q A;  4HMJ A;  5KRU A;  3A0J A;  3NWT A;  3ULP A;  2C9O A;  4BY7 B;  1RKN A;  2Z6K A;  2RHS B;  1CZG A;  5FJ8 H;  4I7A A;  4DUZ Q;  4BY7 H;  3W1B A;  1UE5 A;  1EQR A;  1Q82 C;  1LTB D;  2F0L A;  4MNO A;  3RR5 A;  4N9T A;  1SMY D;  3P7J A;  1VS0 A;  4FNF A;  1LTI D;  1ZXT A;  2OTL A;  2QIL A;  5FO8 B;  5DEH A;  5I9O A;  5ELE A;  1S5C D;  2WFW A;  3HOW B;  2EQS A;  1AFP A;  3AB9 A;  1SYB A;  1TWG B;  2Q2H A;  2WAQ B;  1L0Y B;  1EY4 A;  5EGT A;  2K75 A;  1D1K A;  4EGV A;  1I3Q H;  1CKM A;  3PO3 G;  2XNA C;  3A56 A;  4J6H A;  1E7Z A;  4P72 A;  2F0I A;  2IL8 A;  2KCC A;  4A3C H;  1PRT D;  4K8I A;  1KXL A;  4XTC S;  3CRK C;  3PIO 3;  3CF5 A;  2OWO A;  1I6H B;  2K5N A;  1CQF A;  2BDO A;  5COR A;  3GTK B;  3NP8 A;  3E9H A;  1PDQ A;  2E2H H;  1JOR A;  1V1P B;  5EAY A;  5IWA Q;  4G7Z C;  4JBM A;  3H6M A;  4A3I B;  4ODG A;  1X6O A;  1W6J A;  4IPD A;  4A3J H;  1BNZ A;  4CHT B;  5I4D A;  4ALP A;  4LF6 L;  3J81 L;  3J7A F;  5D14 A;  1HTL D;  1SYD A;  2B8G A;  1BR9 A;  3TN2 A;  1CKN A;  2B2W A;  1QCB D;  2CH4 W;  1S40 A;  1I94 L;  3SXH A;  1Y1W H;  4CJ2 C;  4B3S L;  4WFN 3; 
#chains in the Genus database with same CATH homology
 3W5O A;  1K0R A;  3F8T A;  3M85 A;  4GNX C;  1QZG A;  4JCV E;  3WWV A;  5H1S E;  2JA7 H;  4JYA L;  5AJ3 Q;  5LMN L;  4Y52 H;  5C44 H;  3CC2 A;  1D7Q A;  3STB D;  4LF8 Q;  2N49 A;  4OX9 Q;  3PV0 A;  1DGS A;  1NMF A;  4QJF A;  5C4J H;  2CWA A;  2LXK A;  4DV1 Q;  1VQP A;  4BA2 I;  2WB1 E;  1WI5 A;  2JEB I;  4LFC Q;  4AH6 A;  1QVC A;  5JJI A;  3DM3 A;  2IX1 A;  1YIJ A;  2AWN A;  3PSI A;  1PYB A;  4JOI C;  1N34 L;  1XNQ L;  2F4V L;  1HZB A;  1XMQ Q;  1PH4 A;  4JI3 L;  4NB3 A;  4GKJ L;  3J7Z C;  4LF5 Q;  2R93 H;  2AHO B;  3ERS X;  1W3S A;  3KDF A;  3I55 A;  3KF6 A;  1SR3 A;  3RLF A;  1SMX A;  4C3H H;  3NBH B;  2YV5 A;  4DPG A;  1VQ5 A;  4C3J H;  4JI6 L;  4QY7 A;  4AQY Q;  1MJC A;  5IYC G;  4DR4 L;  2MFI A;  1HR0 L;  5J3B A;  4LNQ A;  1EWI A;  1QUQ A;  3I4O A;  3GTJ H;  3AFQ A;  2NVY H;  4A3G G;  4NXN L;  3KLW A;  4KLK A;  1N32 L;  2R6G A;  2F4V Q;  1N36 L;  1U0L A;  2Q2I A;  1X54 A;  4J15 A;  1VQJ A;  3S24 A;  3K7A H;  1XMO Q;  1VQ9 A;  2CCZ A;  4B3S L;  4LF7 L;  4O0A A;  1SRO A;  1HR0 W;  2N78 A;  2AWO A;  3T1H Q;  1HZA A;  5M5X H;  4LUV A;  2R92 H;  2IX0 A;  5K36 G;  1UE1 A;  4B3S Q;  1N8R C;  2B3G A;  4DV3 Q;  4A3K H;  1YZ6 A;  3S15 H;  1PH5 A;  2VNU D;  1TWH H;  1C9O A;  2DGY A;  4RG1 A;  4A3F H;  3TS0 A;  1K83 H;  1TXY A;  3RLN A;  1PH7 A;  4YHH Q;  1IBM L;  4JI2 L;  4IFD J;  4DAY B;  3CCJ A;  1V1Q A;  1ASY A;  1N33 L;  3S1M H;  1VQG A;  5C0X G;  1KD1 C;  2UUA L;  4GLV B;  2DUD A;  1K3R A;  2NN6 I;  5IE8 A;  5M3F G;  2YTV A;  1M90 C;  1G6P A;  1Y1W G;  3HOX H;  4EX5 A;  2I5H A;  5FLM G;  2AKW B;  4X65 L;  2D0O A;  4OON A;  2JE6 I;  4DR7 Q;  4AQY L;  5ELO A;  3CW2 C;  3A74 A;  2HIX A;  3U58 A;  4OWT B;  1TWA H;  2K50 A;  2OQ0 A;  3KJP A;  5LMN W;  1KRS A;  4JBJ A;  2MO1 A;  3IRB A;  2ZTD A;  1N9W A;  4IOA A;  3HFZ B;  1PH2 A;  2UUB Q;  1YBY A;  4PMW A;  3F2C A;  1OXU A;  4QL5 A;  4A3I G;  5IT9 c;  2ES2 A;  3S17 H;  3D0F A;  3GTK H;  5M3M G;  3A5U A;  1GVP A;  5IYB G;  2ZJP A;  4A3M G;  1N33 Q;  3L0O A;  1Q86 C;  5C4X H;  3I2Z A;  2K4K A;  4GLX A;  1VQ6 A;  2C35 B;  4X62 Q;  4A3E H;  1Z9F A;  4BA1 I;  1XMQ L;  2BA0 A;  1Y1V G;  2KHI A;  1VQE A;  3I56 A;  1AE3 A;  1LUZ A;  4DR3 Q;  1UE7 A;  2VQE L;  1MJE A;  2N3S A;  3MXN B;  1ASZ A;  1VQF A;  4L5S A;  3H3V H;  4B3T L;  1UWV A;  4IJH A;  4UPA A;  4DR5 L;  3CQZ H;  3K7U C;  3J81 i;  3PIP A;  1XMO L;  2Y0S E;  4P71 A;  3SGI A;  3I4M G;  4KHP L;  3G4S A;  4MTN A;  5LMU Q;  3CP0 A;  1V43 A;  2PI2 E;  1UE6 A;  2JK8 A;  1QVG A;  1G29 1;  4A93 G;  4KHZ A;  4GNX A;  1WJJ A;  1IBK Q;  1YHQ A;  4Y7N H;  1I50 H;  4DV3 L;  5IYD H;  1HJP A;  3OTO Q;  1IBL L;  2E5L Q;  1N32 Q;  2JA8 G;  5JEA G;  5GQO A;  1YNX A;  2JA5 H;  1RIP A;  5E7N A;  4GKK L;  3HOW G;  3HKZ G;  4XIG S;  4X64 Q;  1J5E Q;  1HNX L;  1EIF A;  1A62 A;  3U50 C;  2BA1 A;  4GOP B;  4OXP A;  2UUA Q;  1FJG Q;  4KI0 A;  3CME A;  1NE3 A;  4YY3 Q;  4LFB L;  2R7Z G;  4DR5 Q;  3PUZ A;  3S16 H;  4RMF A;  3AFP A;  4JV5 Q;  1EQQ A;  1MKH A;  4R4I A;  4DNI A;  2NVX H;  2HQL A;  1QVF A;  5C0X I;  1Y14 B;  3NEL A;  2UXC Q;  4DV7 Q;  1E3P A;  1GO3 E;  1E24 A;  3M4P A;  4R4O A;  3JAM c;  3HOX G;  1JMC A;  4LFA L;  3KOJ A;  1KQS A;  1LTL A;  1I94 Q;  5M5W H;  1IBM Q;  1QUQ B;  1OXT A;  4L5T A;  3S14 H;  4BY7 G;  1NTG A;  1HH2 P;  1AH9 A;  2UXB Q;  5BR8 Q;  2E5L L;  1Q1B A;  3UE1 A;  4QGU A;  4DV0 L;  1HNZ Q;  3GTO H;  1X3E A;  3I4N H;  1YJN A;  4IFD I;  4EQ5 A;  4BXX H;  3K80 C;  2OTJ A;  4LF6 Q;  5HY6 A;  1EFW A;  3HOY G;  5LMU L;  2L15 A;  3FP9 A;  4A76 A;  4NXM Q;  4LWC A;  2UUC L;  2UXD L;  1E22 A;  2I5M X;  3OW2 A;  4A3B G;  5C4X G;  1WCM H;  4ME3 A;  5IYB H;  3ZJY C;  3CCE A;  3ER0 A;  1GD7 A;  2IY5 B;  4JG2 A;  5JEA J;  1L2F A;  3J81 c;  2E8G A;  1PYS B;  3UDF A;  2EIF A;  3CCM A;  4WJ3 M;  4LW1 A;  1QZH A;  3J80 i;  1RL2 A;  4JI4 L;  2Z0S A;  2KCM A;  3VDY A;  1XPR A;  2NVT H;  3M7N A;  2B29 A;  4DV2 L;  4B3M L;  4WJ4 A;  2F3I A;  2ID0 A;  1GM5 A;  1VQK A;  2Q2T A;  4BY1 H;  4B3R Q;  1PVO A;  2K5H A;  1K73 C;  3HKS A;  3BZK A;  1D8L A;  4LUO A;  4BBR H;  1WYD A;  3PGZ A;  2VW9 A;  5JJK A;  1R9T H;  1Q8K A;  4A75 A;  1NJI C;  1N34 Q;  1XNQ Q;  3CC7 A;  4LFA Q;  1HR0 Q;  5HGQ A;  1JB7 A;  1VQO A;  4JI3 Q;  4K0K Q;  1GKH A;  1A63 A;  4KHP Q;  3I7F A;  1NBW A;  1VQH A;  2UXB L;  3DLL A;  1JJG A;  1HNW L;  1VQB A;  4A3L G;  2VQF Q;  4GN4 B;  1IZ6 A;  3UDX A;  2NZH A;  3PO2 H;  2R7Z H;  2UXC L;  3BZC A;  4JI5 Q;  4B3M Q;  4DR4 Q;  2JA6 H;  4AYB E;  1B8A A;  1Z47 A;  2OQK A;  3G48 A;  4DV4 L;  4DV5 L;  1PH3 A;  3TRE A;  1PV4 A;  1MIU A;  2GN5 A;  1I5F A;  4P74 A;  1VCI A;  1P8L A;  2VL6 A;  4DAM A;  4A3G H;  1E1O A;  2CQO A;  3OYY A;  3KDF B;  5GAD C;  2HT1 A;  4JI0 L;  2KCT A;  2JA7 G;  2CFM A;  1IYJ B;  1EOV A;  3H15 A;  3PO3 H;  4X6A H;  1NMG A;  1X56 A;  2UU9 Q;  4NXM L;  2PQA B;  4DV7 L;  3UDG A;  3CXC A;  4A3C G;  1CSQ A;  2WP8 J;  1KRT A;  1VQL A;  3HOZ G;  3I4M H;  3J81 j;  4IFD G;  2K5V A;  2YYZ A;  1VQI A;  3AQQ A;  4A3D H;  1JE5 A;  2VZA A;  2H5X A;  2JA6 G;  4BBS H;  1X3G A;  1HZ9 A;  3RZO H;  4A4I A;  3K0X A;  4JI5 L;  3PIO A;  4DV6 Q;  1VQD A;  4HIM A;  2A19 A;  2WB1 G;  4JOI A;  4DV4 Q;  2JA8 H;  2CWP A;  5AJ3 L;  5LMN Q;  1KC8 C;  3MEF A;  2FXQ A;  4B3R L;  1Q1E A;  1X3F A;  4GLA C;  2MNA A;  2UUC Q;  1YI2 A;  2UUB L;  2VUM G;  2UXD Q;  4JI1 Q;  5M5Y H;  3HOZ H;  1LYL A;  5IY0 A;  5ELN A;  1SN8 A;  1PFS A;  4MZ9 A;  3M3Y H;  4LFC L;  3RZD H;  4JI8 L;  1E1T A;  1A0I A;  3ULJ A;  4JI4 Q;  3HOU G;  1EUJ A;  2XGT A;  3B6Y A;  1BBU A;  3K8A A;  1SRU A;  3HKZ E;  4YWL A;  2YTX A;  5IP7 G;  4OX9 L;  4GKJ Q;  4OO1 G;  3JC6 6;  3L7Z C;  4DR1 L;  4DR6 L;  4BY1 G;  4UP7 A;  5C0X J;  1IXR A;  3GD7 A;  3W1G A;  1U5K A;  4JI0 Q;  1YJW A;  3KF8 B;  4YCU A;  2YU9 H;  3M4O H;  2V1C C;  5GRO A;  3TEH B;  3CPF A;  4L5Q A;  4YWK A;  4A3E G;  4LFB Q;  4DV5 Q;  2ZTE A;  1TWF H;  3GTP H;  1Y1V H;  2ZTC A;  4R4Q A;  4JI1 L;  5FLX c;  4HJ5 A;  3CC4 A;  2R92 G;  1Q46 A;  2IHE A;  2NZO A;  4JV5 L;  4K0K L;  4GOP C;  2I5L X;  3CPW A;  1OXS C;  1LM0 A;  2B63 G;  4HJ9 A;  1SFO H;  3STB C;  3LGJ A;  3RN2 A;  1EYG A;  2ZJQ A;  2GVA A;  1BBW A;  1X9N A;  1HNX Q;  4POG A;  2JA9 A;  4R4T A;  3KJO A;  4LF7 Q;  1YEZ A;  2JEA I;  2IT1 A;  1JT8 A;  4DR1 Q;  3T1H L;  4DV0 Q;  2A1A A;  1FJG L;  1N36 Q;  4PG3 A;  2E2I H;  3S1R H;  5M3F H;  4L5R C;  1IL2 A;  2XTI A;  3GTG H;  3RN5 A;  4QQB X;  3CD6 A;  4X66 L;  3UDI A;  5FLM H;  5GAG C;  2ALY B;  2JQO A;  4PZ8 A;  3U4V A;  4BBR G;  4YCV A;  1KL9 A;  2IHF A;  4X64 L;  3CCV A;  3EBE A;  2CKZ B;  2LSS A;  1S3O A;  1YJ9 A;  1WOC A;  4LF9 Q;  2EXD A;  4DR2 L;  4HIK A;  4APV A;  4LUZ A;  1CKO A;  3J80 c;  4P75 A;  2PNH A;  2ATW A;  2WAQ E;  4YWM A;  5IP9 H;  3T1Y L;  3K81 C;  1JJ2 A;  2GVB A;  2Y0S G;  5GAE C;  3CMA A;  2B63 H;  1VQM A;  4TVA B;  2Q2U A;  1TWG H;  4BXX G;  2F52 A;  3Q8D A;  1P16 A;  3PCO B;  3RLO A;  4JI7 Q;  3S1Q H;  2A8V A;  2ZJR A;  4HIO A;  5BR8 L;  4JBK A;  4X65 Q;  2QGQ A;  2HHH L;  1PA6 A;  3ICE A;  5IYD G;  3GTL H;  3H0G H;  3I4N G;  4C3I H;  4GKK Q;  4R4C A;  3NEN A;  1XPO A;  2R7F A;  4GN5 A;  3J7A 5;  1L0W A;  1W2B A;  4C2M H;  4JI8 Q;  1B70 B;  4DV1 L;  2QEX A;  4HJ8 A;  1FL0 A;  4AYB G;  3FKI H;  1KHI A;  3TS2 A;  4IJL A;  4DR6 Q;  1YVC A;  1X65 A;  4GS3 A;  4X62 L;  4IO9 A;  2I0Q A;  2R93 G;  3GO5 A;  4DV2 Q;  5DLQ E;  2VQE Q;  1VQA A;  1Q7Y C;  3NEM A;  4IPH A;  4UP9 A;  1AE2 A;  2RF4 A;  4OWW B;  1TWC H;  4QIW E;  3HOV G;  4A3J G;  1V9P A;  3KYH C;  3E9I A;  2E2J H;  4OWX B;  4X66 Q;  2VQF L;  3CCS A;  1YHA A;  3OTO L;  2PMZ E;  4IOC A;  1CUK A;  1IBL Q;  1C0A A;  1NY4 A;  1OXV A;  3UE0 A;  1HZC A;  1PH6 A;  3TRZ A;  4HJ7 A;  3FHW A;  2ZM6 L;  4LF9 L;  3KF6 B;  2BH8 A;  2VS1 A;  4R1J A;  4DUZ L;  2NVQ H;  1BVS A;  2R7D A;  4DR2 Q;  4JI7 L;  3M4Q A;  1K9M C;  4O2D A;  3RNU A;  3HOU H;  2D62 A;  2HHH Q;  3S2H H;  1L1O A;  3T1Y Q;  3GDE A;  2VY3 A;  3E0E A;  4OO1 I;  3BU2 A;  1BKB A;  2OCE A;  1WFQ A;  4JI6 Q;  5JJL A;  3A5Z B;  2JJQ A;  3EN2 A;  4DKA C;  3HOV H;  2K52 A;  3F1Z A;  2PQA A;  1G51 A;  2KBN A;  4YY3 L;  5IWA L;  1B7Y B;  4A3K G;  1CSP A;  1J6Q A;  3S2D H;  1KAW A;  1XNR L;  2ASB A;  4AIM A;  1X55 A;  3CCQ A;  4LF4 L;  5C3E G;  4DK3 C;  4PZ7 A;  1HNZ L;  2JA5 G;  1S72 A;  2MQH A;  4DV6 L;  1XJV A;  4JC0 A;  3S1N H;  1CKN B;  2KEN A;  1O7I A;  1L1O C;  4YHH L;  4GN3 B;  3L2P A;  4FDB A;  4UP8 A;  4DK6 C;  4GOP A;  1A8V A;  2D0P A;  3CCR A;  3PF5 A;  4A3D G;  2HIV A;  3M9B A;  1XPU A;  2LXJ A;  4IPG A;  5C44 G;  3GTM H;  4H02 A;  3H3V I;  3A0J A;  4DR7 L;  3FKI G;  1VQ8 A;  3ULP A;  1YHB A;  3GTQ H;  3CAM A;  1L1O B;  2KHJ A;  2Z6K A;  3TQY A;  3H0G G;  2RHS B;  3BJU A;  1T9H A;  5FJ8 H;  4DUY L;  4DUZ Q;  1PH9 A;  4GNX B;  4BY7 H;  3CCL A;  4LF4 Q;  4YCW A;  1UE5 A;  1EQR A;  3W1B A;  1Q82 C;  1Q81 C;  1M1K C;  2VUM H;  2WAQ G;  4IPC A;  3CCU A;  4MNO A;  3AYH B;  2QA4 A;  4A3F G;  3RR5 A;  2AMC B;  4JYA Q;  1VS0 A;  4LF5 L;  5C3E H;  4HJA A;  5IP9 G;  2OTL A;  3PO2 G;  4POF A;  2ZM6 Q;  1WCM G;  4PZ6 A;  1OXX K;  2WFW A;  4A93 H;  2EQS A;  1SLJ A;  4DR3 L;  4A3B H;  1YIT A;  2Q2H A;  3JAM i;  5FJ8 G;  1FGU A;  3G6E A;  4B3T Q;  2K75 A;  3HOW H;  4DUY Q;  3PF4 A;  1I3Q H;  1VQ4 A;  4BBS G;  4JBW A;  4A3L H;  2RCN A;  1UEB A;  1HNW Q;  1CKM A;  2NN6 G;  1J5E L;  3PO3 G;  1E7Z A;  4P72 A;  4LF8 L;  1PH1 A;  4UY8 C;  1H95 A;  1OTC A;  4A3C H;  3PUX A;  1IBK L;  1PHJ A;  1KXL A;  1VQN A;  5IYC H;  3PUV A;  3EIV A;  3PUW A;  4XTC S;  3U4Z A;  1PH8 A;  1KIX A;  3CF5 A;  4P73 A;  1FVI A;  3F2B A;  1VQ7 A;  2OWO A;  1VQC A;  2K14 A;  1Q12 A;  2UU9 L;  4A3I H;  2K5N A;  2YTY A;  4NXN Q;  3AEV A;  2MO0 A;  5GAH C;  3E9H A;  4HID A;  2RHQ B;  2E2H H;  3PUY A;  5EAY A;  5IWA Q;  3G71 A;  3KFU A;  4TQU S;  4JBM A;  1K8A C;  1SE8 A;  1XTD A;  4A3M H;  1X6O A;  1I6H H;  1XNR Q;  2PI2 A;  5M3M H;  1JJC B;  4IPD A;  4JI2 Q;  4A3J H;  4NPS A;  1K8G A;  2BH2 A;  4ALP A;  4LF6 L;  3HOY H;  1EIY B;  2N8N A;  3D31 A;  1S40 A;  1CKN A;  1I94 L;  3ULL A;  3F2D A;  2Z6K C;  5IP7 H;  1Y1W H;  1C7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...