3TMEA

Crystal structure of staphylococcal nuclease variant delta+nviagla v23e at cryogenic temperature
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 31
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tmeA00
4ZUJA 5JOBA 4DF7A 3R3OA 4EQPA 4J6HA 3H6MA 1JOOA 2EYLA 5CR3A 2F0KA 2EYMA 3OWFA 4R8NA 2PQEA 3NP8A 4TRDA 1EY8A 3BDLA 5IODA 3T13A 1U9RA 5HGTA 5ISRA 1F2YA 5K5PA 1EZ6A 4KD4A 4E6IA 3D4DA 5C4HA 1SNOA 4NMZA 5IGBA 4RKBA 5CC4A 2EYPA 2F0DA 4J1MA 3EROA 2F0TA 3T16A 2RKSA 1STHA 1SYFA 2O4XA 2WACA 3P75A 4N9TA 3OSOA 1A2UA 1EY7A 2F0NA 4ME5A 2F0HA 4ODGA 4PMBA 3D8GA 5C3XA 2OF1A 5I6WA 5IGEA 4S3SA 5KYLA 2PW7A 1NUCA 3BDCA 3OMCA 2F0SA 4HMIA 3SK8A 4DU9A 2SNMA 3MEHA 1TT2A 1A3UA 2F0WA 3U9OA 5I6YA 5IGGA 2OEOA 4KV6A 5IGCA 1A2TA 1SYGA 4KTAA 1SYBA 5J22A 4QB4A 3TP7A 5M9OA 4K2LA 4ZUIA 3NK9A 1KDCA 1EY4A 1SNDA 1EYCA 1SYDA 3MVVA 1AEXA 3QOJA 4H7BA 5F2DA 1KDAA 2EY2A 1IHZA 4ID6A 2EYFA 2F0VA 5KIXA 5CGKA 3OMGA 2F0OA 5CV6A 3D4WA 5E1FA 2ENBA 4HTHA 5CV4A 2F0LA 3TMEA 3DHQA 3MXPA 3TP5A 1JOQA 4LAAA 1II3A 4PNYA 2F3VA 1NSNS 5DAUA 2F0QA 1EY6A 3C1EA 3QOLA 4DGZA 2EYJA 3V2TA 4I65A 5KYIA 5JAVA 3D6CA 3C1FA 4WRDA 5CV5A 5EKKA 4F8MA 4K5XA 4KJNA 2PZWA 1STYA 5I9PA 1EQVA 3VA5A 1EYAA 3DMUA 3MZ5A 1JOKA 2KHSA 3SK4A 5KGUA 2PZTA 4QMGA 3SK6A 4F7XA 5I9OA 4K14A 4ZQ3A 5HURA 5KEEA 2F3WA 5C4ZA 2F0FA 4K8IA 5KRUA 4K5VA 2F0GA 2OXPA 2F0MA 3NQTA 4K8JA 2EYOA 2M00A 1KABA 5E3FA 5IIFA 3EJIA 5CV9A 1A3TA 5C3WA 2RBMA 2RDFA 4KJOA 1F2MA 3NXWA 2EY6A 3EVQA 4KY5A 1STAA 1KDBA 4NP5A 4EVOA 3SR1A 2PZUA 4DFAA 1EYDA 4IUNA 5IOCA 1TQOA 3HZXA 3SXHA 5IGFA 3TP6A 1EY0A 3MHBA 5C6AA 3NUCA 4QF4A 2F0IA 1JORA 1STBA 1A3VA 3NHHA 3RUZA 3P1HA 4KD3A 1EY9A 2F0PA 2SOBA 2LKVA 4NKLA 1SNMA 5C5LA 5CV8A 2PW5A 1STNA 2PYKA 3E5SA 4B9XA 3SHLA 4WORA 3ITPA 3HEJA 1RKNA 4HMJA 1STGA 2HQEA 2EYHA 2SNSA 4MIUA 1EY5A 4K6DA 5DEHA 5NUCA 2F0EA 5J1ZA 1KAAA 2QDBA 4NDXA 5EGTA 2EY5A 4B9WA 4G57A 4KY7A 4RKLA 5EKLA 4K5WA 3S9WA 2F0JA 1SYEA 5C5MA 4EQOA 4EQNA 4IZ8A 1EZ8A 4N9PA 1TR5A 3SK5A 4IALA 2EY1A 1SNCA 3ERQA 3LX0A 3PMFA 4KY6A 5CV7A 3TP8A 5J39A 3QB3A 4PMCA 1ENCA 1SNQA 4KHVA 4YIJA 2NUCA 1F2ZA 1SYCA 2EXZA 2F0UA 2KQ3A 4K2KA 4OL7A 5IGDA 1ENAA 1SNPA
chains in the Genus database with same CATH superfamily
4RGMA 3T53B 1RL2A 2WAQB 5I2XA 3K80C 4HJ8A 3G48A 1TU2B 2L12A 5ISRA 2VQEL 5BN3A 1M90C 2QW7A 4A4IA 5M3FG 1B2TA 4JOIA 5D65A 5C4XH 4OHJA 1YHBA 1LTSD 3A5ZB 1QNUA 1UE5A 1JC7A 3LWUA 3A8KE 3JC66 1IL2A 3FKIB 1N32Q 3STBC 1SYBA 3N52A 3CPWA 4K2LA 1EU3A 1SMYD 4GN4B 1A15A 1HZAA 3E0JA 4BA1I 2TMPA 4BA2I 5FLMG 1JE5A 1GVPA 2DNCA 1I4RA 3CC7A 2JA6G 2F3VA 3F2BA 2IWHA 4LFCQ 3G6EA 3U4ZA 1JMCA 1E1TA 4K5XA 4KJNA 1TWHH 1HCZA 3HOWG 2D62A 1QE6A 3NENA 4A3KG 4XQNA 2E2IB 1SR3A 4K14A 2VY3A 5KEEA 4A3IG 2VW9A 1HHVA 4U68A 1K8MA 5IIFA 4Y52H 3S1NH 3WWVA 2UUBQ 5C3WA 5G3LD 1ET9A 3K0XA 4FO2A 4X66Q 1P8LA 4DV1L 1WCMG 2IX1A 1J8IA 4CDFC 1WD0A 2ZT9C 5JEAJ 4EQ5A 1WYDA 3CCVA 3CD6A 1H9KA 3OIPA 4DUYL 2Z6BA 2UXBQ 2PW5A 1XNQL 3AFQA 3A74A 2G9DA 4ZKCB 4R4IA 2VQFL 4DR1L 1N33Q 4NPSA 4OIJA 2G5DA 1B4OA 5EGTA 4GNXA 2PI2E 3IL8A 3GTPB 3PF4A 5C0XG 2OQ0A 1LTTD 3FEWX 5IYBG 4IURA 1OXTA 2BH8A 5C44G 1CK1A 3AYHB 2CQOA 2KQ3A 4N8FA 3S24A 3L2PA 2B2UC 4JW0A 5C4XB 3CHBD 1L0XB 3OIQA 3DEOA 2EOTA 1U9RA 5HGTA 4DAVA 2UXCL 4XQJA 1SFOH 2BOSA 3KLRA 1NE3A 2D2CC 1B3QA 3Q23A 2RDGA 2WV6D 4C2MH 2PW7A 4I7AA 3CCEA 1TT2A 3RN5A 2Y0SB 3FMCA 2KHIA 2B2WC 4RAUC 2EVBA 2MFIA 4IPDA 4Z9CB 1JCKB 1TWHB 5FJ8G 1YNJD 4JI3Q 2ENBA 3TP5A 4XIGS 1Q86C 3Q0AA 4LF9Q 1KC8C 1X3EA 3FP9A 1DZ1A 2NYZD 1BCPC 4LUOA 4GZYC 4DK3C 2GVBA 5IT9c 3RN2A 1OXVA 2QF7A 4DV7L 3MZ5A 3ND9A 4ALPA 4DR6L 2KHSA 2B8GA 5I9OA 4LW1A 1CSPA 2F03A 1V1OA 1PH3A 1RF2D 1HTPA 4OGQC 1PLFA 1CHPD 2WINB 3UDIA 3I55A 1FJGQ 1SLJA 1I6HH 2PZUA 1VQOA 2YTXA 4DK1A 2FFKB 2HT1A 2B39A 4TQUS 2R93H 5L37A 3LWEA 2GVAA 4JI5Q 4A3DH 3R2IA 3T1YQ 2ZJRA 4RGTA 2JEAI 1C0AA 4RMFA 4AQYQ 4JYAL 1PRTB 4BBRG 5ELEA 1PTOC 3KK7A 4YCVA 2Z1CA 1RODA 4FNFA 4XYQA 1PMRA 4K6DA 1P16A 5LL6X 3K5LA 3HOZG 2F0JA 3A7AB 1E22A 4P2CB 3W1GA 4X65Q 4A3LG 1SE4A 3K7UC 3M4OH 2EY1A 4TKOB 1Y8PB 1CKOA 2R6GA 1W6KA 4K2KA 4DNIA 1ENAA 4A3MH 3BJUA 3PO2H 1X54A 1Q3LA 2K1BA 3A0JA 1K73C 3CC2A 3D31A 4KD4A 2Q8IB 2D5DA 1F9RA 1CZWA 2Q2HA 3OTOL 4Y7NH 3S2DB 1A6XA 4DUZQ 3TQYA 5I6WA 4ODGA 3K57A 1HR0W 2RQXA 4HSPA 2WB1E 1MKHA 5KNCA 1PFMA 1CM9A 3CXCA 3T56B 4CKBA 1PA6A 4X6AH 2L1BA 1LT3D 3PO3B 2QKIC 3UE1A 3D6WA 2QILA 2DY7A 1GKHA 1DONA 3EIVA 4A75A 5LMNQ 1MIUA 1MSGA 2FJ2A 5M5WH 4ME3A 4LF4L 3KOJA 2AUKA 5M5XH 4GOPB 1EY6A 1EWCA 2KBNA 1K3RA 4A3GG 1KIXA 1J6QA 5E7NA 4C3HH 2EYJA 3F2CA 1PDQA 2YYZA 1PRTF 4DR2Q 3ULLA 1I6HB 1Z6HA 4A3FB 3DUZA 3NPPA 2H1EA 3OW7A 2AUJD 2R93B 2WFWA 2IJ0A 2K75A 4A3DB 4LF7L 4K5VA 3J7YW 3AFPA 1Y1WH 2ICIA 4AYBB 1ONLA 1HZBA 5EBCA 3NXWA 1B50A 1YJNA 3S16B 1EFWA 1XNRQ 4N8X1 3J7AV 2LFNA 1BNZA 1RIPA 4HN7A 5IP7G 1VS0A 3PCOB 1IBKQ 1VQ9A 3ICEA 4A3MB 1YVCA 4GKKL 1F9QA 3PO2B 1BF4A 1LTBD 4QIWE 3DLLA 1AE3A 1LM0A 2KCNA 3C46A 2R92B 4LF8Q 2AWOA 1TIID 1KTKA 2K5NA 2MJ8A 1W3SA 3DWAA 1KLGD 4QL5A 3A56A 1XMOQ 4ZUJA 4V0BA 2PPBC 4C3JB 3Q22A 3NTHA 3J81j 3RR5A 2EYMA 4JBWA 2RCNA 4BBSH 2B2YA 1XTCD 2KUMA 1YNND 1F2YA 3I56A 3E6ZX 1O7YA 1QUQA 1VQPA 5IGBA 1QB5D 2NN6I 2EYPA 3U9SA 1STHA 2D0PA 4DA2A 2R7FA 1BBUA 2OQKA 2Q2IA 1U4RA 2MO0A 5EPKA 4JI8L 1IBMQ 5IP9H 3JAMc 1SYGA 3KF8B 5J22A 4RFBA 4C3HB 1C48A 4LWCA 5KIXA 1IHZA 3MC0B 1O78A 1TWGB 3TN2A 3I4NH 5CV6A 4NXNQ 4HTHA 1HA5A 1BBXC 3KJPA 2R7ZH 1II3A 3GQBA 3I7FA 4WJWA 2F4VQ 3HGBA 2VB3X 1I94Q 3HKZE 1RHPA 4JPBW 4JI1L 1PH6A 1HRJA 5CYUA 2B2VC 4O42A 1EQVA 5M3MH 3SVMA 3RMHA 3C3LA 5ELNA 3ZJYC 4IN3A 2WKDA 1F9SA 4A3JG 3NQTA 3PUZA 3U50C 4OO1G 4BY7H 1EIFA 1VF5C 2K28A 2RDFA 4JI4L 1SJED 1KDBA 1STAA 5KYIA 1LLRD 3PIP3 3ERSX 1UEBA 3FVQA 3HOYH 1LV9A 1HNZQ 3CW2C 1STBA 2KCCA 3A7LA 1DM0B 4POGA 2WP8J 2LKVA 3DM1A 1VQMA 2IL8A 2PMZB 2CHBD 4B9XA 2CWAA 2DNEA 1QOHA 3HEJA 1UEAB 4J8QA 1SE8A 4XTCS 3FPPA 3HS0C 1FGBD 1HR0L 1X6OA 2RSOA 2B29A 3HKZG 1GUTA 2QCPX 2CWPA 1CHQD 4IALA 1UAPA 3D3RA 1N36L 1CA5A 4YIJA 4A3BH 4F7XA 2LMCB 5IGDA 1N9WA 3J80c 4DV2L 3I2ZA 2O2LD 4EQPA 2PO4A 1D5XC 3HOVG 1V9PA 3VR6A 4G7OC 1OXSC 3BDLA 4RH6A 1D5MC 4X62Q 5EBDA 3FPUB 2A69D 3GO5A 4R4CA 3K5NA 1HFGA 4RGOS 3I4MH 3CCQA 4CHTB 1VQ6A 1WTOA 4KKUA 4N9TA 2V1CC 3AU7A 3I4NB 2XIWA 2A6HC 3Q8DA 3X3MA 3BDCA 2PQAA 1CZGA 3CCUA 1N32L 1AFPA 1MI2A 4JBKA 4KTAA 2WAQE 3ER0A 3TP7A 2CVRA 2OTLA 3GTQH 4ZUIA 3TS0A 1TY2A 3QOJA 1X55A 1BDOA 3GTKB 2A1AA 1PH7A 3MAQA 5M3MB 1I5FA 4MTNA 4G4KA 2X69A 1DJRD 4LFCL 3PIPA 4L8JA 3PUXA 1D7QA 5A2QL 5EKKA 4BY7B 2CKZB 1JR0D 2JA5G 4UAIA 5IE8A 3SGIA 3MXNB 5LL6S 1SMYC 4BXXH 4KK7A 2K5HA 1LACA 2QA4A 1MBYA 1U0LA 5BN4A 4L5RC 4YHHQ 1B8AA 5LMNW 2UUBL 4X66L 2RBMA 2JQOA 2EY6A 3FKIH 1Y1VG 3IFDA 5IGFA 3AEVA 4LF6L 3QG1A 2Q8RE 2UU9L 2F0PA 2UXBL 4UPAA 1TWAB 1GD7A 5CV8A 1TS5A 1N33L 4A3BB 3ITPA 3DXJC 1KAWA 3U4VA 4MTKA 3GTMH 1CFMA 2F0EA 3TRZA 2K01A 3J80i 4G57A 3G4SA 1DXMA 1Z47A 1VQIA 1PRTD 2I46A 2IX3A 2N78A 1EZ8A 4GLAC 3SK5A 4GNXC 5J39A 1SNCA 4KY6A 4ZCKA 3UDGA 2XN9C 2E2IH 5IT9E 1U4PA 3M4PA 3I4MB 3AQQA 3KUPA 4JVZA 2I0QA 4A93G 3DWPA 2IHFA 3OWFA 4R8NA 1QUQB 2VS1A 1D1KA 5IODA 3T13A 4Q5VA 4DAPA 1BR9A 1MHWC 5AJ3Q 4CJ1B 1SNOA 3GP7A 4NMZA 4A3EG 3GTQB 3NBIA 1FNVA 2F0DA 1IL8A 2XWBB 1G8ZD 2RKSA 4DR3L 3KBXA 1I6VC 2WACA 1FNUA 4GN5A 4CJ0B 5GAEC 1XX8A 4CBVA 3MFYA 3MEHA 1XMQQ 4B08A 1JB3A 4ZK9B 4NXMQ 1A62A 3M4QA 1WTVA 5EQ0A 1LUZA 3P20A 1GUSA 1YHAA 2X6LA 1CT1D 4JI3L 3GTPH 3WOEA 2MNAA 2F0OA 2K4KA 5M3FH 2VUMG 1IW7D 5CV4A 4JV5Q 1VQAA 1KNEA 5ELDA 4LF9L 4B3SQ 4RCNA 1ET6A 1KLUD 4R1JA 2KA7A 3TZDA 4FXKC 3GDEA 1SAPA 2NB0A 1IBLQ 3TEHB 2EQSA 2PZWA 2ICEC 1EQQA 3VA5A 5BR8Q 5HGQA 4DV4L 2AQ1B 3K5MA 4QMGA 2JA7B 1Q1EA 5J3BA 5FLMH 3M4YA 2VXWA 5C4ZA 4KI0A 5KRUA 2F0GA 2OXPA 1F77A 1YNJC 2DY8A 2ID0A 2JA6H 1X65A 1XTDA 5EPLA 4DXFA 4DN4M 5I4DA 1FJGL 3S17B 3L7ZC 3VYUA 1S4ZA 1HQRD 4DFAA 4GOPA 3GTMB 3S15H 3PUYA 4JI5L 2KEDA 3FRPB 1PYSB 2MPMA 1VQKA 3S2HH 3T1YL 2J7ZA 1A3VA 3NHHA 3HOUG 1K83B 3P1HA 1ICFB 3HP3A 1HJPA 4AQYL 3H0GB 4NKLA 4KKSA 1CI3M 5T1GA 3I73A 4NB3A 3M3YB 4HR7B 1GOZA 5K36H 2WKCA 4IFDI 4HSVA 4KY7A 1DOKA 4X65L 1WOCA 2OT2A 1LTLA 4LMQD 2RDHA 2ES2A 1G91A 1BUVT 3W1BA 4QCLA 2O5IC 1E2WA 1A8VA 3UDFA 1I50H 5ELBA 1RD9D 4ME5A 5FLXE 1K3BC 3R3OA 1ASZA 4K0KQ 4OX9Q 1Q8KA 2UUAQ 5E4WC 4B3RL 2JEBI 2N55A 4XT1B 1LT5D 4RKBA 2AKWB 5IYBH 3EROA 2YU9B 1LABA 1A2UA 2PQAB 1B3AA 4FF2A 2F0HA 4PMBA 5M3FB 2K6AA 1JWSD 1FYCA 2FMMA 4DNTB 3A8IE 1I3QH 2E76C 2JYOA 5ELFA 4LNQA 3KF6B 4X64L 4F88A 1PYWD 4YY3Q 1AEXA 1XXGA 5LMNL 2EY2A 4JI2Q 3WOFA 3PUVA 1TWCH 4JC0A 4KHPQ 3D4WA 5ELCA 1QVCA 4AIMA 3GTLB 4RA8A 2OTJA 5AFWA 2NVXB 2K52A 4IUVA 1PH8A 2ZXPA 4JBMA 3K58A 5CMDA 2JA6B 4CDCC 3D6CA 3L3OC 4DR2L 2NWGA 4C1NK 1C9OA 2HUGA 1PFSA 5KGUA 2JP1A 1EQRA 1WTXA 3S15B 2B63G 2HD3A 3HOWB 4A3KB 3S2HB 3KF8A 3H94A 3NWSA 3S2DH 1IZ6A 5HY6A 4A3IB 5E4XA 1RJTA 1VQFA 2E2HH 4HJ5A 1KQSA 4L5QA 1JJCB 3CF5A 1VF7A 1YNXA 2TSSA 3PO3H 3MFGA 1XNRL 2I07B 3E0EA 3CCRA 5C6AA 3MEFA 1CA6A 1JICA 1WCMB 2F0IA 4O2DA 4UP8A 3JAME 3RUZA 4DV3Q 1EY9A 4RCOA 5KNBA 4WJ3M 3BZCA 4M1UB 2KENA 3R8BA 1I50B 2DUDA 2VQEQ 1LTRD 3CPFA 2HCCA 2YTVA 1EY5A 4CJ2C 2Z6KA 4LF8L 5C0XI 1SSOA 2K32A 3EFXD 2VB2X 5JPNC 4A3FH 5CV7A 1XMOL 1G2SA 1SYCA 3H3VH 3NBHB 5C44B 1QJOA 1QVGA 3O13A 1UUPA 2F0KA 3J81E 1MJEA 4U673 5JJLA 2L9HA 1I3QB 4PQXA 4LUZA 3HOZH 2CW0D 3S16H 1EEID 2B2YC 3K7AB 4A3LH 3T16A 2B2TA 4CGYB 2UXDQ 3OSOA 2A19A 1TWCB 1R9TB 2IT1A 3RLOA 3OMCA 2BH2A 4DU9A 4R9WA 4ZLTF 1J5EQ 5DNFA 3BVMA 5GADC 2ZXRA 2B3GA 5F2DA 1LT6D 1NR2A 1VQCA 4H7BA 1U4LA 2Z4IA 2R92H 2Q8TA 4QGUA 1YNNC 1PH1A 1JOQA 1C8CA 2F4VL 3CRLC 1VMCA 1K0SA 2I5MX 2JA9A 4CDDC 4C3JH 3C1FA 3S14B 5I9PA 3V96A 2E2HB 1S5FD 3BZKA 3J80E 1G6ZA 1PZID 3J7ZC 4DR4Q 2MGSA 1X9NA 3CRKC 3SK6A 4DAYB 1NCVA 2K33A 3S1MB 5HURA 4ZQ3A 1SDFA 1VCIA 2AMCB 2F0MA 3CCLA 2NN6H 3K59A 1AH9A 5JVH3 4A3GH 1H9SA 1YHQA 4UDUC 4KY5A 2QEJC 2RF4A 4NP5A 1Y69U 1KXLA 3BZDB 5IOCA 1YZ6A 3BVZA 1TXYA 3MA2B 3NELA 2A6ED 1HNZL 1EY0A 3MHBA 3NUCA 2EE1A 1TWGH 3H3VI 1AP0A 2E5LQ 4BY1G 2LXJA 2PNHA 1WFQA 3SHLA 3RZDB 2HQEA 3MXNA 3V05A 4BBRB 5DEHA 2QDBA 4NDXA 4B9WA 1NMGA 4K5WA 2WB1G 4H44C 1QCBD 1Q82C 3HOZB 5IP7H 3E9IA 2QGQA 2BDNA 2RA4A 2CH4W 1BQQT 1EFID 5ELOA 2Z4HA 2EJFC 2PMZE 4O1NA 4UP9A 4OWWB 1U5KA 1WTWA 4IFDJ 4HIKA 3VR4A 5C4JB 1EUJA 3D4DA 2DN8A 1H9MA 2H4OA 1Y1WG 1S5BD 2HHHQ 1W6JA 5DLQE 4C3IG 1N34L 1TS2A 2OWOA 4JI6Q 1EY7A 2R7DA 1H9RA 3D8GA 1TKWB 3CU7A 1HZ9A 3GV6A 4HMIA 5I6YA 1A3UA 3U9OA 1GUGA 4QUFA 2KCTA 2OEOA 3S1QH 1PZKD 1G2TA 4B3TL 4H0LC 4XQQA 1S5CD 3CAMA 3EA6A 1N8RC 3RD4A 1PH4A 2XSCA 4L5SA 2EPBA 4H13C 4JBJA 1KDAA 4ID6A 3UE0A 3GTJH 1VQ7A 2F0VA 5E1FA 4L63B 3TMEA 2A69C 4DAMA 3DHQA 1SJHD 4LAAA 3PQIA 1NTGA 3CMEA 2XTIA 2HDMA 3K0YA 1SRUA 2HQLA 4DK6C 3HG9A 3HFZB 3GTGB 3EBEA 4F8MA 4A3GB 1GM5A 1ZXTA 3KFUA 1BOSA 2PZTA 5JEAG 5FKAC 1O7ZA 5EAYA 2BCOA 4YHHL 4DR7Q 4BBSG 2BA0A 2XNAC 3N6RA 2NBFA 1IKMA 1WI5A 1FVIA 4NW2A 3KBGA 2FHTA 4OWTB 4B3MQ 1IXRA 4FXDA 2Q2TA 2GA4B 4PG3A 2N3SA 3GTKH 3KLWA 1OXUA 4FYDA 2F52A 5IP9G 4IUQA 3HRZC 3PF5A 3NSWA 4DXGA 4A76A 4P75A 3CCJA 4HMJA 5DM63 1M4VA 2K03A 1BXTA 1Y8OB 1FNWA 3PIOA 1B1ZA 2R7ZG 1SYEA 5JJIA 3F2UA 3K81C 1B9MA 4R4TA 1EOVA 4YWLA 2JA8G 4OL7A 5A35A 1Y14B 5I2YA 3FDTA 3ND8A 2ZXOA 3QO2A 4DR5Q 1IYVA 2V4DA 5C3EG 3CKIB 1JT8A 1D1IA 2A73B 4C1NI 1MD2D 5AJ3L 5C0XJ 3S1QB 4E6IA 4HIMA 5LMUQ 4LF4Q 1M8AA 1R4QB 1VQGA 3W5OA 3OW2A 4YCUA 2E2DC 4GKJQ 1U4MA 3GTJB 2A68D 1PRTC 1HQMC 3ULPA 5C3XA 1WTRA 3BYYB 1TWAH 5GAHC 1XMQL 3SK8A 4NXML 1O7IA 3DM3A 3HOYG 1ESRA 1EU4A 2J0TD 3FHWA 2K5VA 2F4IA 1WTQA 5M5YB 2N8NA 1SNDA 2VL6A 2NZOA 5GQOA 2MUYA 4LF7Q 4JV5L 1K8AC 3MXPA 4B3SL 1B44D 3M9BA 5IYDG 1BVSA 1NSNS 4EGVA 1VQHA 5JAVA 1CSQA 5BR8L 2L55A 4JOIC 4LJZC 1K8OA 3K5OA 1VQBA 4K6LA 2NVTB 4HEDA 2F3WA 1TVXA 3KF6A 3AB9A 2M00A 1H9SB 4GKKQ 4O0AA 1IW7C 4OO1I 5CV9A 4A3JB 3HKSA 4LFAQ 3I91A 4KJOA 2LS01 3EVQA 5CC4A 1CTMA 4IUTA 4A3CH 1GUNA 1SXTA 4IUNA 1S72A 1TQOA 3HZXA 3SXHA 1IYJB 1S5DD 3G6JB 4DV5Q 1W2BA 3QJYA 2KCMA 4GOPC 3K6OA 3R2TA 1KRSA 4EX5A 1STNA 3T1HQ 2ZJQA 5JJZA 4ZAIA 1HNXQ 5IYCH 1XWEA 2B8FA 2F1MA 4P74A 4ULLA 3VDYA 1Y1VH 4UHVA 1ENFA 5FO8B 1EEFD 3H3VC 2MP1A 2ZTDA 3HKZB 4CKCA 3PMFA 3EQLC 1PH9A 2JA7H 4EVOA 3NTIA 1F2ZA 2WAQG 1Q90A 4JI8Q 1FR3A 4PMWA 4K0KL 4OX9L 1KD1C 4YWMA 2Z0SA 2C35B 2UUAL 4DV6Q 2EYLA 1OXXK 1MJCA 3NP8A 1BCPB 3S17H 4XDXA 3HOVB 1UE6A 1SE2A 5K5PA 4BXXG 1EZ6A 3M7NA 1SEBD 2NTSA 2X6GA 1E2VA 3T51B 3SDZA 3P7JA 3CC4A 4GS3A 1L0YB 2B2VA 2UUCQ 4DV0Q 1K83H 4IO9A 3FKIG 3H0GH 4OIKA 4PZ7A 1ILPA 5FO9B 1EWIA 4LK1C 1B53A 3M3YH 1A2TA 2ASBA 1M1KC 4YY3L 1A0IA 1JJ2A 2R3ZA 3NBHA 1VQEA 4R8IA 3X3NA 2EYFA 4KHPL 3IAYA 1R4PB 5EKIA 2JE6I 4IFDH 4MHEA 2ZTCA 4PV1C 4RG1A 1QWYA 4JI4Q 1D6EC 3VYTA 4AH6A 3VA7A 1PTOB 4JI7Q 1NR4A 4X3UA 2E75C 1JJGA 1PV4A 3VR3A 4RHRA 4PZ8A 1S3OA 2JA5B 2F0FA 2YU9H 2PCFB 1SROA 1OTCA 1KABA 4JCVE 5FOBB 4IUUA 4CDEC 2PI2A 3HOXG 4Q0FA 3CMAA 3KLSA 1EIHA 2K5QA 1BCPF 1Y1VB 4DV3L 2Y0SE 3BDOA 1TWFB 3GD7A 2BE5D 1VMPA 4KD3A 4DV2Q 1RTNA 3TSSA 3CP0A 3RLFA 3A8JE 1LT4D 3GTLH 4FDBA 2IW3A 2NVXH 1Q7YC 1QZGA 4DAYA 1E7ZA 1EIYB 1RCVD 2FXQA 3QWNA 1AN8A 3SE0A 4DK0A 4P72A 2A74C 3ULJA 1D8LA 2AWNA 1GHKA 2M9VA 2Z6KC 3ERQA 1TS4A 3HOUH 5C4XG 4PMCA 1ENCA 3M85A 3HOWH 1WJJA 2F0UA 4A3KH 5JOBA 4DF7A 1NBWA 1HXYD 4LF5Q 4JI0Q 4A3IH 2ZTEA 1E24A 4A93B 2NVQB 1L1OA 2HIVA 4OXPA 4X3TA 3E9HA 1UWVA 4GLVB 5EPJA 2UXDL 1PTOF 3L9AX 3IKJA 1YJ9A 1YIJA 1WCMH 4A3EB 2HIXA 5KYLA 1HZCA 2Y0SG 2B2TC 4X3SA 2K7VA 5IT9L 1J5EL 5IWAQ 2NTTA 5IGGA 3F8TA 2SEBD 4QY7A 1T5XD 4QB4A 2CCZA 3NK9A 1EY4A 1S40A 1KNAA 5H1SE 2AHOB 1AE2A 4QQBX 5JPMC 1D2BA 3I3CA 2ZM6Q 2CW0C 4XXEA 2KJXA 5C0XH 5K36G 2VUMB 1X3PA 4FF1A 4DUZL 5C44H 2E2JH 4LFBQ 5JJKA 3A55A 3PUWA 3V2TA 1AZPA 3TBIB 1G51A 2D9UA 3HOXB 4LF6Q 4IOCA 4WJ4A 1EYAA 3H15A 4V190 4DR4L 2UU9Q 3I72A 3I8ZA 3MWYW 2BA1A 5LHY1 3KDFB 1ZYRD 3K7AH 1B7YB 1NY4A 1V1PA 1VQ5A 1KRTA 1R9TH 3GTOH 4ZKBB 4ZYSA 2K04A 4CKEA 3A54A 1L0WA 1GJXA 4OONA 4J15A 1HA6A 3PV0A 3BU2A 4JK1C 4L6TB 5T1IA 2B63H 2E5LL 1DGSA 1SNMA 3HOUB 2GN5A 5FJ8H 3K8AA 1OO9B 1HNWQ 1ASYA 1RKNA 1E2ZA 1VQDA 1PZJD 4MIUA 2SNSA 2LY7A 1DOMA 5EKLA 3S14H 4DR3Q 4MNOA 3F2DA 5C5MA 1WTPA 1Q1BA 1QZHA 1EL0A 3L0OA 5FO7B 4EQOA 1Z7TA 2A6EC 2KHJA 3S1MH 2K14A 1I4PA 1AZQA 3STBD 1CQFA 4J6HA 1ICWA 1IBKL 1JOOA 3DWQA 1QNKA 1E1OA 4QJFA 4APVA 5CBAE 2L0CA 1UE1A 1BKBA 4AYBE 1Q46A 5C4HA 1G6PA 2HHHL 2IY5B 1GXDC 1K8GA 4OELB 4ABNA 2O5JC 4KN4C 4JI6L 2G9HD 5D3DA 3TP6A 2F0NA 3S1NB 2HCIA 3TZUA 2OF1A 3PO3G 3C2PA 1K28A 5EJWA 5DM73 1G291 4DV4Q 5FLXL 3RZDH 2E2JB 5M9OA 4BBRH 2EZVA 1EYCA 1CKNA 2MHVA 3I70A 3OMGA 4IPCA 1XJVA 4HJ7A 4FF4A 1PH5A 1K9MC 1K0RA 1JQYD 1VQ8A 2KEEA 4RHSA 1BO0A 2EXDA 3URYA 5DAUA 3BVGA 3NQIA 2F0QA 1YEZA 1ILQA 1GUWA 3QOLA 2K50A 3GTOB 1PYBA 1RDPD 4I65A 5CV5A 4A3FG 1GO3E 1IBML 4UP7A 4POFA 1JOKA 1QG7A 5C4JH 2R93G 1SE3A 1HPCA 4A3DG 1UNSA 4M8AA 4DR7L 2DJGC 4AYBG 4K8IA 2RCFA 3U58A 2N88A 2B63B 5E3FA 4NXNL 4R4QA 2EDGA 1MGSA 4RGNA 3VR5A 1HFNA 3NEMA 2H5XA 1QVFA 2KECA 3PGZA 1H95A 4XT3B 5CBEE 3SR1A 1I94L 4B3ML 1SFOB 1EQTA 4DV1Q 5TSSA 3AMUA 2E8GA 4C2MB 1O80A 4KN7C 1CUKA 3OYYA 3B6YA 2XGTA 4DUYQ 4TSSA 4A3MG 1KL9A 1XNQQ 1SMXA 2YV5A 3PO2G 4WORA 3Q24A 1VQLA 4B3RQ 2VQFQ 4DR1Q 2IPKD 5NUCA 1T5EA 2R92G 5J1ZA 3GTGH 5D14A 1KHIA 1V43A 2B2UA 1WTHA 1VQJA 3ZYYX 1I4XA 4C3JG 2A5HA 4KHVA 1NMFA 2EXZA 3IRBA 1YJWA 4BY1H 3JAML 3OHXC 1NAPA 4DR5L 1XPRA 4KMUC 3H6MA 4X64Q 1L1OB 1EY8A 3G7LA 2VZAA 2Z9HA 5LMUL 2UXCQ 2K5WA 2LXKA 4PZ6A 4GKJL 4G7ZC 2NN6G 2F0TA 2JK8A 2QEXA 1XPUA 1BCPD 4IUPA 3D4RA 1C7YA 2B2WA 4S3SA 1FL0A 4DKAC 2F0SA 1X32A 1IYUA 2F0WA 2BDOA 2CH4A 3SEBA 4C3HG 1YITA 5FLXc 3S1RH 3TS2A 4IPHA 4KV6A 4BWGB 4HIOA 1HTLD 2DGYA 1KDCA 2EJGC 4IQZA 3MXGA 3J81L 3ONAB 4X62L 2YTYA 4C3IH 2F0LA 1GUOA 4PNYA 3PIO3 4ZRZA 3MXUA 2A68C 1X3QA 2ALYB 4OEMB 4DGZA 4XYOA 2RVLA 4YCWA 1GHJA 3DMUA 4DV7Q 3M4OB 1LTGD 1ML0D 2KVMA 3M7GA 3SK4A 2JSOA 4DR6Q 4KLKA 3I4LA 1V1PB 1S5ED 3CCMA 3G71A 1PTOD 4GNXB 4LUVA 4HJ9A 1VQNA 5IY0A 1Q12A 2RSNA 4LFAL 2XWJB 1SN8A 4HCSA 5FK9C 1F2MA 3A5UA 3H91A 3I90A 3IFTA 1A63A 4GLXA 2L11A 1B9NA 3H09A 5M5YH 4DV5L 4Y7NB 4QF4A 2M2LA 5JEAH 2R61A 4WFN3 1JORA 3J80L 1V8QA 3QR8A 2SOBA 4KKTA 1Q81C 2EIFA 3T1HL 2L15A 1HNXL 1PHJA 4JYAQ 4KHZA 4BY1B 3E3XA 5GROA 2C9OA 3QIAA 1X56A 3KJOA 3T4AC 1O7LA 1HUNA 3S9WA 5M5WB 1TR5A 5M5XB 2WB1B 1T9HA 2NVTH 4F87A 3NWTA 3TREA 4MZ9A 2NUCA 1NJIC 4FXGC 4N9PA 2FMCA 4DV6L 3BYTB 2Q2UA 4A3JH 2HDLA 1JE4A 4TRDA 1AW7A 3S1RB 3OOCA 3RLNA 4OO1H 2XRSD 1X3FA 3I4NG 2AQ3B 2UUCL 4DV0L 3OTOQ 1Y1WB 2JA8H 5IGEA 2I5LX 1L2FA 4C3IB 2JJQA 5A2QE 2L5TA 3D0FA 5G3LF 5JVG3 2A8VA 2SNMA 3PSIA 5C3EH 2EJMA 2K5DA 1CKNB 1E0BA 3I4OA 5M3MG 4FP5D 3J81c 3UI2A 1SYDA 3MVVA 2XVSA 2RHSB 1EYGA 1VDZA 2N49A 2J4XA 5D3IB 1LTID 3DEPA 3LGJA 1FGUA 1H9JA 5COYA 3C1EA 4BY7G 4YWKA 2K05A 4JI7L 3RZOH 1EOTA 2NVYH 3NTKA 2CQAA 1PVOA 3HOVH 2KOLA 4I7ZC 1V1QA 1JWUD 1LYLA 1HUMA 1WVLA 1F9PA 1CKMA 4K8JA 5IYDH 1WD1A 4QIWB 4OWXB 4GN3B 4BBSB 1A3TA 1I4QA 4TVAB 1FD7D 4R4OA 3OPOA 2ZJPA 1EYDA 5CORA 2C5CA 1IBLL 1DYQA 2AQ2B 1UE7A 2OCEA 2SDFA 3KYHC 4A3BG 4RWSC 5C5LA 2VNUD 1YBYA 1DOLA 3E5SA 3OWEB 1EWHA 3J7A5 1STGA 1RTOA 3KDFA 4IJHA 4C56C 1F2LA 1SBBB 2XRQD 4HAEA 1PH2A 3JAMi 1YI2A 2JXMB 5KNDA 3J7AF 1PTOH 1N34Q 1IKLA 3VYSA 2NZHA 4IPGA 3Q6SA 3I4MG 4FVMA 2R7ZB 3QB3A 1SNQA 3CQZH 4JG2A 2JA5H 4LF5L 1JWMD 1NNXA 2BE5C 4JI0L 2JA8B 4B3TQ 5CR3A 3NE5B 4MN3A 1ZKOA 2PQEA 1I4GA 1TY0A 5C3EB 4H02A 3EN2A 3MTSA 5BN5A 4J1MA 2CFMA 3CCSA 1L1OC 1SYFA 2O4XA 3P75A 1TWFH 3J81i 4HJAA 5IWAL 4IOAA 4A3CG 1NUCA 2QDLA 2E74C 5IGCA 3KLSX 2L4NA 2MQHA 2PNRC 1CQVA 3HOYB 3RZOB 2NVYB 1ESFA 4P71A 2IHEA 3BS1A 2I5HA 1J9OA 5CGKA 1Z9FA 3RNUA 2ZM6L 5GAGC 3WDNA 4G7HC 1HH2P 4IJLA 1PFNA 5IYCG 1D5ZC 1ZEQX 1VQ4A 1LTAD 2ATWA 2NZ1D 4LFBL 3LNNA 4JI1Q 1BBWA 4WRDA 1TS3A 1STYA 4A93H 2MO1A 1XYIA 2NVQH 2JA7G 1DCZA 1XPOA 2WIIB 2DJFC 2RHQB 1PFBA 1MSHA 4UY8C 3W3AA 4JI2L 4X3KA 4ILWA 4A3EH 2EYOA 4HCEA 3TDQA 2IX0A 3UDXA 1DD2A 3EJIA 4HIDA 4P73A 2JN4A 2F3IA 2Z8LA 1JB7A 3BG3A 1I4HA 2FINB 1LO5D 3W2DA 3R93A 1EIGA 3H0GG 1PXUA 2P5ZX 1Q8IA 4FF3A 1STEA 1B70B 4BS9A 4DPGA 1ZYRC 2PYKA 1HNWL 3CQZB 2VUMH 4L5TA 3GV3A 1Y8NB 1X3GA 2EYHA 3VR2A 3VYRA 1C4QA 1KAAA 1E3PA 4QUCA 2EY5A 1HR0Q 4RKLA 3HOXH 4IFDG 4EQNA 1QILA 4IZ8A 3TP8A 2A6HD 3LX0A 4DNRB 2D0OA 3F1ZA 1N36Q 2LSSA 1SNPA
chains in the Genus database with same CATH topology
4RGMA 3T53B 2WAQB 5I2XA 1TU2B 2L12A 5ISRA 5BN3A 1B2TA 5D65A 4OHJA 1LTSD 1QNUA 1JC7A 3LWUA 3A8KE 3FKIB 1SYBA 3N52A 4K2LA 1EU3A 1SMYD 1A15A 3E0JA 4BA1I 2TMPA 4BA2I 2DNCA 1I4RA 2F3VA 2IWHA 4K5XA 4KJNA 1HCZA 2D62A 1QE6A 4XQNA 2E2IB 4K14A 5KEEA 1HHVA 4U68A 1K8MA 5IIFA 5C3WA 5G3LD 1ET9A 4FO2A 2IX1A 1J8IA 1WD0A 2ZT9C 5JEAJ 1H9KA 3OIPA 2PW5A 2G9DA 4ZKCB 4OIJA 1B4OA 5EGTA 3IL8A 3GTPB 5C0XG 1LTTD 3FEWX 4IURA 1OXTA 1CK1A 2KQ3A 2B2UC 5C4XB 3CHBD 1L0XB 3OIQA 3DEOA 2EOTA 1U9RA 5HGTA 4DAVA 4XQJA 2BOSA 3KLRA 2D2CC 3Q23A 2RDGA 2WV6D 2PW7A 1TT2A 2Y0SB 3FMCA 2B2WC 4RAUC 2EVBA 4Z9CB 1JCKB 1TWHB 1YNJD 2ENBA 3TP5A 4XIGS 3Q0AA 1DZ1A 2NYZD 1BCPC 4GZYC 1OXVA 2QF7A 3MZ5A 3ND9A 2KHSA 2B8GA 5I9OA 2F03A 1V1OA 1RF2D 1HTPA 4OGQC 1PLFA 1CHPD 2WINB 2PZUA 4DK1A 2FFKB 2B39A 4TQUS 3LWEA 3R2IA 4RGTA 2JEAI 1PRTB 5ELEA 1PTOC 3KK7A 2Z1CA 1RODA 4FNFA 4XYQA 1PMRA 4K6DA 5LL6X 3K5LA 2F0JA 3A7AB 4P2CB 1SE4A 2EY1A 4TKOB 1Y8PB 2R6GA 1W6KA 4K2KA 1ENAA 1Q3LA 2K1BA 3D31A 2Q8IB 4KD4A 2D5DA 1F9RA 1CZWA 3S2DB 1A6XA 5I6WA 4ODGA 3K57A 2RQXA 4HSPA 5KNCA 1PFMA 1CM9A 3T56B 4CKBA 2L1BA 1LT3D 3PO3B 2QKIC 3D6WA 2QILA 2DY7A 1DONA 1MSGA 2FJ2A 2AUKA 1EY6A 1EWCA 2EYJA 1PDQA 2YYZA 1PRTF 1I6HB 1Z6HA 4A3FB 3DUZA 3NPPA 2H1EA 3OW7A 2AUJD 2R93B 2IJ0A 4A3DB 4K5VA 3J7YW 2ICIA 4AYBB 1ONLA 5EBCA 3NXWA 1B50A 3S16B 3J7AV 2LFNA 1BNZA 4HN7A 4A3MB 1F9QA 3PO2B 1BF4A 1LTBD 2KCNA 3C46A 2R92B 2AWOA 1TIID 1KTKA 2MJ8A 3DWAA 1KLGD 3A56A 4ZUJA 4V0BA 2PPBC 4C3JB 3Q22A 3NTHA 2EYMA 4JBWA 2B2YA 1XTCD 2KUMA 1YNND 1F2YA 3E6ZX 1O7YA 5IGBA 1QB5D 2NN6I 2EYPA 3U9SA 1STHA 4DA2A 1U4RA 5EPKA 1SYGA 5J22A 4RFBA 4C3HB 1C48A 5KIXA 1IHZA 3MC0B 1O78A 1TWGB 3TN2A 5CV6A 4HTHA 1HA5A 1BBXC 1II3A 3GQBA 4WJWA 3HGBA 2VB3X 1RHPA 1HRJA 5CYUA 2B2VC 4O42A 1EQVA 3SVMA 3RMHA 3C3LA 4IN3A 2WKDA 1F9SA 3NQTA 3PUZA 4OO1G 1VF5C 2K28A 2RDFA 1SJED 1KDBA 1STAA 5KYIA 1LLRD 3PIP3 3FVQA 1LV9A 1STBA 2KCCA 3A7LA 1DM0B 2WP8J 2LKVA 3DM1A 2IL8A 2PMZB 2CHBD 4B9XA 2DNEA 1QOHA 3HEJA 1UEAB 4J8QA 4XTCS 3FPPA 3HS0C 1FGBD 2RSOA 1GUTA 2QCPX 1CHQD 4IALA 1UAPA 3D3RA 1CA5A 4YIJA 4F7XA 5IGDA 2LMCB 2O2LD 4EQPA 2PO4A 1D5XC 3VR6A 4G7OC 1OXSC 3BDLA 4RH6A 1D5MC 5EBDA 3FPUB 2A69D 3GO5A 3K5NA 1HFGA 4RGOS 4CHTB 1WTOA 4KKUA 4N9TA 3I4NB 3AU7A 2XIWA 2A6HC 3X3MA 3BDCA 1CZGA 1AFPA 1MI2A 4KTAA 3TP7A 2CVRA 4ZUIA 1TY2A 3QOJA 1BDOA 3GTKB 3MAQA 5M3MB 4G4KA 2X69A 1DJRD 4L8JA 3PUXA 5A2QL 5EKKA 4BY7B 1JR0D 4UAIA 5LL6S 1SMYC 4KK7A 1LACA 1MBYA 5BN4A 2RBMA 2EY6A 3IFDA 5IGFA 3QG1A 2Q8RE 2F0PA 1TWAB 5CV8A 1TS5A 4A3BB 3ITPA 3DXJC 1CFMA 2F0EA 2K01A 4G57A 1DXMA 1Z47A 1PRTD 2I46A 2IX3A 1EZ8A 3SK5A 5J39A 1SNCA 4KY6A 2XN9C 5IT9E 1U4PA 3I4MB 3KUPA 3DWPA 3OWFA 4R8NA 1D1KA 5IODA 3T13A 4Q5VA 4DAPA 1BR9A 4CJ1B 1SNOA 3GP7A 4NMZA 3GTQB 3NBIA 1FNVA 2F0DA 1IL8A 2XWBB 1G8ZD 2RKSA 3KBXA 1I6VC 2WACA 1FNUA 4CJ0B 1XX8A 4CBVA 3MFYA 3MEHA 4B08A 1JB3A 4ZK9B 1WTVA 5EQ0A 3P20A 1GUSA 2X6LA 1CT1D 3WOEA 2F0OA 1IW7D 5CV4A 1KNEA 5ELDA 4RCNA 1ET6A 1KLUD 2KA7A 3TZDA 4FXKC 1SAPA 2NB0A 2PZWA 2ICEC 3VA5A 2AQ1B 3K5MA 4QMGA 2JA7B 1Q1EA 3M4YA 2VXWA 5C4ZA 4KI0A 5KRUA 2F0GA 2OXPA 1F77A 1YNJC 2DY8A 2ID0A 5EPLA 4DXFA 4DN4M 5I4DA 3S17B 3L7ZC 3VYUA 1S4ZA 1HQRD 4DFAA 3GTMB 3PUYA 2KEDA 3FRPB 2MPMA 2J7ZA 1A3VA 3NHHA 1K83B 3P1HA 3HP3A 3H0GB 4NKLA 4KKSA 1CI3M 5T1GA 3I73A 3M3YB 4HR7B 1GOZA 5K36H 2WKCA 4IFDI 4HSVA 4KY7A 1DOKA 2OT2A 4LMQD 2RDHA 1G91A 1BUVT 4QCLA 2O5IC 1E2WA 5ELBA 1RD9D 4ME5A 5FLXE 3R3OA 5E4WC 2JEBI 2N55A 4XT1B 1LT5D 4RKBA 3EROA 2YU9B 1LABA 1A2UA 4FF2A 1B3AA 2F0HA 4PMBA 5M3FB 2K6AA 1JWSD 1FYCA 2FMMA 4DNTB 3A8IE 2E76C 2JYOA 5ELFA 4F88A 1PYWD 1AEXA 1XXGA 2EY2A 3WOFA 3PUVA 3D4WA 5ELCA 3GTLB 4RA8A 2NVXB 5AFWA 4IUVA 2ZXPA 3K58A 5CMDA 2JA6B 3D6CA 3L3OC 2NWGA 4C1NK 2HUGA 5KGUA 2JP1A 1WTXA 3S15B 3HOWB 4A3KB 3S2HB 3KF8A 3H94A 3NWSA 4A3IB 5E4XA 1RJTA 1VF7A 2TSSA 3MFGA 2I07B 5C6AA 1CA6A 1JICA 1WCMB 2F0IA 3JAME 3RUZA 1EY9A 4RCOA 5KNBA 4M1UB 3R8BA 1I50B 1LTRD 2HCCA 1EY5A 4CJ2C 5C0XI 1SSOA 2K32A 3EFXD 5JPNC 2VB2X 5CV7A 1G2SA 1SYCA 5C44B 1QJOA 3O13A 1UUPA 2F0KA 3J81E 4U673 2L9HA 1I3QB 4PQXA 2CW0D 1EEID 2B2YC 3K7AB 3T16A 2B2TA 4CGYB 3OSOA 1TWCB 1R9TB 2IT1A 3OMCA 4DU9A 4R9WA 4ZLTF 5DNFA 3BVMA 2ZXRA 5F2DA 1LT6D 1NR2A 4H7BA 1U4LA 2Z4IA 2Q8TA 1YNNC 1JOQA 1C8CA 3CRLC 1VMCA 3C1FA 3S14B 5I9PA 3V96A 2E2HB 1S5FD 3J80E 1G6ZA 1PZID 2MGSA 3CRKC 3SK6A 1NCVA 2K33A 3S1MB 5HURA 4ZQ3A 1SDFA 1VCIA 2F0MA 2NN6H 3K59A 5JVH3 1H9SA 4UDUC 4KY5A 2QEJC 4NP5A 1Y69U 3BZDB 5IOCA 3BVZA 3MA2B 2A6ED 1EY0A 3MHBA 3NUCA 2EE1A 1AP0A 3SHLA 3RZDB 2HQEA 3V05A 3MXNA 4BBRB 5DEHA 2QDBA 4NDXA 4B9WA 4K5WA 4H44C 1QCBD 3HOZB 2BDNA 2RA4A 1BQQT 1EFID 2Z4HA 2EJFC 4O1NA 1WTWA 4IFDJ 3VR4A 5C4JB 3D4DA 2DN8A 1H9MA 2H4OA 1S5BD 1W6JA 4C3IG 1TS2A 1EY7A 1H9RA 3D8GA 1TKWB 3CU7A 3GV6A 4HMIA 5I6YA 1A3UA 3U9OA 1GUGA 4QUFA 2OEOA 1PZKD 1G2TA 4H0LC 4XQQA 1S5CD 3EA6A 3RD4A 2XSCA 2EPBA 4H13C 1KDAA 4ID6A 2F0VA 5E1FA 4L63B 3TMEA 2A69C 3DHQA 1SJHD 4LAAA 2HDMA 3K0YA 3HG9A 3GTGB 4F8MA 4A3GB 1ZXTA 1BOSA 2PZTA 5JEAG 5FKAC 1O7ZA 2BCOA 2BA0A 2XNAC 3N6RA 2NBFA 1IKMA 4NW2A 3KBGA 2FHTA 4FXDA 2GA4B 1OXUA 4FYDA 4IUQA 3HRZC 3NSWA 4DXGA 4HMJA 5DM63 1M4VA 2K03A 1BXTA 1Y8OB 1FNWA 1B1ZA 1SYEA 3F2UA 1B9MA 4OL7A 5A35A 5I2YA 3FDTA 3ND8A 2ZXOA 3QO2A 1IYVA 2V4DA 3CKIB 1D1IA 2A73B 4C1NI 1MD2D 5C0XJ 3S1QB 4E6IA 1M8AA 1R4QB 2E2DC 1U4MA 3GTJB 2A68D 1PRTC 1HQMC 5C3XA 1WTRA 3BYYB 3SK8A 1ESRA 1EU4A 2J0TD 2F4IA 1WTQA 5M5YB 1SNDA 2MUYA 3MXPA 1B44D 1NSNS 4EGVA 5JAVA 2L55A 4LJZC 1K8OA 3K5OA 4K6LA 2NVTB 4HEDA 2F3WA 1TVXA 3AB9A 2M00A 1H9SB 1IW7C 4OO1I 5CV9A 4A3JB 3I91A 4KJOA 2LS01 3EVQA 5CC4A 1CTMA 4IUTA 1GUNA 1SXTA 4IUNA 1TQOA 3HZXA 3SXHA 1S5DD 3G6JB 3QJYA 3K6OA 3R2TA 1STNA 5JJZA 4ZAIA 1XWEA 2B8FA 2F1MA 4ULLA 1ENFA 5FO8B 1EEFD 3H3VC 2MP1A 3HKZB 4CKCA 3PMFA 3EQLC 4EVOA 3NTIA 1F2ZA 1Q90A 1FR3A 4PMWA 2EYLA 1OXXK 3NP8A 1BCPB 4XDXA 3HOVB 1SE2A 5K5PA 1EZ6A 3M7NA 1SEBD 2NTSA 2X6GA 1E2VA 3T51B 3SDZA 3P7JA 1L0YB 2B2VA 4OIKA 1ILPA 5FO9B 4LK1C 1B53A 1A2TA 2R3ZA 3NBHA 4R8IA 3X3NA 2EYFA 3IAYA 1R4PB 5EKIA 2JE6I 4IFDH 4MHEA 4PV1C 1QWYA 1D6EC 3VYTA 3VA7A 1PTOB 1NR4A 4X3UA 2E75C 3VR3A 4RHRA 2JA5B 2F0FA 2PCFB 1KABA 5FOBB 4IUUA 4Q0FA 3KLSA 1EIHA 2K5QA 1BCPF 1Y1VB 3BDOA 1TWFB 3GD7A 2BE5D 1VMPA 4KD3A 1RTNA 3TSSA 3RLFA 3A8JE 1LT4D 2IW3A 4DAYA 1RCVD 3QWNA 1AN8A 3SE0A 4DK0A 2A74C 1GHKA 2AWNA 2M9VA 3ERQA 1TS4A 4PMCA 1ENCA 3M85A 2F0UA 5JOBA 4DF7A 1HXYD 4A93B 2NVQB 4X3TA 5EPJA 1PTOF 3L9AX 3IKJA 4A3EB 5KYLA 2B2TC 4X3SA 2K7VA 5IT9L 2NTTA 5IGGA 2SEBD 1T5XD 4QB4A 3NK9A 1EY4A 1KNAA 5JPMC 1D2BA 3I3CA 2CW0C 4XXEA 2KJXA 5C0XH 5K36G 2VUMB 1X3PA 4FF1A 3A55A 3PUWA 3V2TA 1AZPA 3TBIB 2D9UA 3HOXB 1EYAA 4V190 3I72A 3I8ZA 3MWYW 2BA1A 5LHY1 1ZYRD 1V1PA 4ZKBB 4ZYSA 2K04A 4CKEA 3A54A 1GJXA 1HA6A 3PV0A 4JK1C 4L6TB 5T1IA 1SNMA 3HOUB 1OO9B 1RKNA 1E2ZA 1PZJD 4MIUA 2SNSA 2LY7A 1DOMA 5EKLA 5C5MA 1WTPA 1Q1BA 1EL0A 5FO7B 4EQOA 1Z7TA 2A6EC 1I4PA 1AZQA 1CQFA 4J6HA 1ICWA 1JOOA 3DWQA 1QNKA 5CBAE 2L0CA 5C4HA 1GXDC 4ABNA 2O5JC 4KN4C 2G9HD 5D3DA 3TP6A 2F0NA 3S1NB 2HCIA 3TZUA 2OF1A 3C2PA 5DM73 5EJWA 1G291 5FLXL 2E2JB 5M9OA 2EZVA 1EYCA 2MHVA 3I70A 3OMGA 4FF4A 1JQYD 2KEEA 4RHSA 1BO0A 3URYA 5DAUA 3BVGA 3NQIA 2F0QA 1ILQA 1GUWA 3QOLA 3GTOB 1RDPD 4I65A 5CV5A 1JOKA 1QG7A 1SE3A 1HPCA 1UNSA 4M8AA 4K8IA 2N88A 2B63B 5E3FA 3VR5A 2EDGA 1MGSA 4RGNA 1HFNA 2KECA 4XT3B 5CBEE 3SR1A 1SFOB 1EQTA 5TSSA 3AMUA 4C2MB 1O80A 4KN7C 4TSSA 4WORA 3Q24A 2IPKD 5NUCA 1T5EA 5J1ZA 5D14A 1V43A 2B2UA 3ZYYX 1I4XA 4C3JG 2A5HA 4KHVA 2EXZA 3JAML 3OHXC 1NAPA 4KMUC 3H6MA 1EY8A 3G7LA 2K5WA 4G7ZC 2NN6G 2F0TA 1BCPD 4IUPA 3D4RA 2B2WA 4S3SA 2F0SA 1X32A 1IYUA 2F0WA 2BDOA 4C3HG 3SEBA 4KV6A 4BWGB 1HTLD 1KDCA 2EJGC 4IQZA 3MXGA 3J81L 3ONAB 2F0LA 1GUOA 4PNYA 3PIO3 4ZRZA 3MXUA 2A68C 1X3QA 4DGZA 4XYOA 2RVLA 1GHJA 3DMUA 3M4OB 1LTGD 1ML0D 2KVMA 3M7GA 3SK4A 2JSOA 3I4LA 1V1PB 1S5ED 1PTOD 1Q12A 2RSNA 2XWJB 4HCSA 5FK9C 1F2MA 3H91A 3I90A 3IFTA 2L11A 1B9NA 3H09A 4Y7NB 4QF4A 2M2LA 5JEAH 2R61A 4WFN3 1JORA 3J80L 1V8QA 4KKTA 2SOBA 4KHZA 4BY1B 2C9OA 3QIAA 3T4AC 1O7LA 1HUNA 3S9WA 5M5WB 1TR5A 5M5XB 2WB1B 4F87A 3NWTA 2NUCA 4FXGC 4N9PA 2FMCA 3BYTB 2HDLA 1JE4A 4TRDA 1AW7A 3S1RB 3OOCA 4OO1H 2XRSD 2AQ3B 1Y1WB 5IGEA 4C3IB 5A2QE 2L5TA 5G3LF 5JVG3 2SNMA 2EJMA 2K5DA 1E0BA 4FP5D 3UI2A 1SYDA 3MVVA 2XVSA 1VDZA 5D3IB 2J4XA 1LTID 3DEPA 1H9JA 5COYA 3C1EA 2K05A 1EOTA 3NTKA 2CQAA 2KOLA 4I7ZC 1JWUD 1HUMA 1WVLA 1F9PA 4K8JA 1WD1A 4QIWB 4BBSB 1A3TA 1I4QA 1FD7D 3OPOA 1EYDA 5CORA 2C5CA 1DYQA 2AQ2B 2SDFA 4RWSC 5C5LA 2VNUD 1DOLA 3E5SA 3OWEB 1EWHA 1STGA 1RTOA 4C56C 1SBBB 1F2LA 2XRQD 4HAEA 2JXMB 5KNDA 3J7AF 1PTOH 1IKLA 3VYSA 3Q6SA 4FVMA 2R7ZB 3QB3A 1SNQA 1JWMD 2BE5C 2JA8B 5CR3A 3NE5B 4MN3A 1ZKOA 2PQEA 1I4GA 1TY0A 5C3EB 3MTSA 5BN5A 4J1MA 1SYFA 2O4XA 3P75A 1NUCA 2E74C 5IGCA 3KLSX 2L4NA 3HOYB 2PNRC 1CQVA 3RZOB 2NVYB 1ESFA 3BS1A 1J9OA 5CGKA 3WDNA 4G7HC 1PFNA 1D5ZC 1ZEQX 1LTAD 2NZ1D 3LNNA 4WRDA 1TS3A 1STYA 1XYIA 1DCZA 2WIIB 1PFBA 1MSHA 3W3AA 4X3KA 4ILWA 2EYOA 4HCEA 3TDQA 2IX0A 1DD2A 3EJIA 2Z8LA 3BG3A 1I4HA 2FINB 1LO5D 3W2DA 3R93A 1EIGA 1PXUA 1Q8IA 4FF3A 1STEA 4BS9A 1ZYRC 2PYKA 3CQZB 3GV3A 1Y8NB 2EYHA 3VR2A 3VYRA 1C4QA 1KAAA 4QUCA 2EY5A 4RKLA 4IFDG 4EQNA 1QILA 4IZ8A 3TP8A 2A6HD 3LX0A 4DNRB 1SNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUJ A;  5JOB A;  4DF7 A;  3R3O A;  4EQP A;  4J6H A;  3H6M A;  1JOO A;  2EYL A;  5CR3 A;  2F0K A;  2EYM A;  3OWF A;  4R8N A;  2PQE A;  3NP8 A;  4TRD A;  1EY8 A;  3BDL A;  5IOD A;  3T13 A;  1U9R A;  5HGT A;  5ISR A;  1F2Y A;  5K5P A;  1EZ6 A;  4KD4 A;  4E6I A;  3D4D A;  5C4H A;  1SNO A;  4NMZ A;  5IGB A;  4RKB A;  5CC4 A;  2EYP A;  2F0D A;  4J1M A;  3ERO A;  2F0T A;  3T16 A;  2RKS A;  1STH A;  1SYF A;  2O4X A;  2WAC A;  3P75 A;  4N9T A;  3OSO A;  1A2U A;  1EY7 A;  2F0N A;  4ME5 A;  2F0H A;  4ODG A;  4PMB A;  3D8G A;  5C3X A;  2OF1 A;  5I6W A;  5IGE A;  4S3S A;  5KYL A;  2PW7 A;  1NUC A;  3BDC A;  3OMC A;  2F0S A;  4HMI A;  3SK8 A;  4DU9 A;  2SNM A;  3MEH A;  1TT2 A;  1A3U A;  2F0W A;  3U9O A;  5I6Y A;  5IGG A;  2OEO A;  4KV6 A;  5IGC A;  1A2T A;  1SYG A;  4KTA A;  1SYB A;  5J22 A;  4QB4 A;  3TP7 A;  5M9O A;  4K2L A;  4ZUI A;  3NK9 A;  1KDC A;  1EY4 A;  1SND A;  1EYC A;  1SYD A;  3MVV A;  1AEX A;  3QOJ A;  4H7B A;  5F2D A;  1KDA A;  2EY2 A;  1IHZ A;  4ID6 A;  2EYF A;  2F0V A;  5KIX A;  5CGK A;  3OMG A;  2F0O A;  5CV6 A;  3D4W A;  5E1F A;  2ENB A;  4HTH A;  5CV4 A;  2F0L A;  3TME A;  3DHQ A;  3MXP A;  3TP5 A;  1JOQ A;  4LAA A;  1II3 A;  4PNY A;  2F3V A;  1NSN S;  5DAU A;  2F0Q A;  1EY6 A;  3C1E A;  3QOL A;  4DGZ A;  2EYJ A;  3V2T A;  4I65 A;  5KYI A;  5JAV A;  3D6C A;  3C1F A;  4WRD A;  5CV5 A;  5EKK A;  4F8M A;  4K5X A;  4KJN A;  2PZW A;  1STY A;  5I9P A;  1EQV A;  3VA5 A;  1EYA A;  3DMU A;  3MZ5 A;  1JOK A;  2KHS A;  3SK4 A;  5KGU A;  2PZT A;  4QMG A;  3SK6 A;  4F7X A;  5I9O A;  4K14 A;  4ZQ3 A;  5HUR A;  5KEE A;  2F3W A;  5C4Z A;  2F0F A;  4K8I A;  5KRU A;  4K5V A;  2F0G A;  2OXP A;  2F0M A;  3NQT A;  4K8J A;  2EYO A;  2M00 A;  1KAB A;  5E3F A;  5IIF A;  3EJI A;  5CV9 A;  1A3T A;  5C3W A;  2RBM A;  2RDF A;  4KJO A;  1F2M A;  3NXW A;  2EY6 A;  3EVQ A;  4KY5 A;  1STA A;  1KDB A;  4NP5 A;  4EVO A;  3SR1 A;  2PZU A;  4DFA A;  1EYD A;  4IUN A;  5IOC A;  1TQO A;  3HZX A;  3SXH A;  5IGF A;  3TP6 A;  1EY0 A;  3MHB A;  5C6A A;  3NUC A;  4QF4 A;  2F0I A;  1JOR A;  1STB A;  1A3V A;  3NHH A;  3RUZ A;  3P1H A;  4KD3 A;  1EY9 A;  2F0P A;  2SOB A;  2LKV A;  4NKL A;  1SNM A;  5C5L A;  5CV8 A;  2PW5 A;  1STN A;  2PYK A;  3E5S A;  4B9X A;  3SHL A;  4WOR A;  3ITP A;  3HEJ A;  1RKN A;  4HMJ A;  1STG A;  2HQE A;  2EYH A;  2SNS A;  4MIU A;  1EY5 A;  4K6D A;  5DEH A;  5NUC A;  2F0E A;  5J1Z A;  1KAA A;  2QDB A;  4NDX A;  5EGT A;  2EY5 A;  4B9W A;  4G57 A;  4KY7 A;  4RKL A;  5EKL A;  4K5W A;  3S9W A;  2F0J A;  1SYE A;  5C5M A;  4EQO A;  4EQN A;  4IZ8 A;  1EZ8 A;  4N9P A;  1TR5 A;  3SK5 A;  4IAL A;  2EY1 A;  1SNC A;  3ERQ A;  3LX0 A;  3PMF A;  4KY6 A;  5CV7 A;  3TP8 A;  5J39 A;  3QB3 A;  4PMC A;  1ENC A;  1SNQ A;  4KHV A;  4YIJ A;  2NUC A;  1F2Z A;  1SYC A;  2EXZ A;  2F0U A;  2KQ3 A;  4K2K A;  4OL7 A;  5IGD A;  1ENA A;  1SNP A; 
#chains in the Genus database with same CATH topology
 4RGM A;  3T53 B;  1RL2 A;  2WAQ B;  5I2X A;  3K80 C;  4HJ8 A;  3G48 A;  1TU2 B;  2L12 A;  5ISR A;  2VQE L;  5BN3 A;  1M90 C;  2QW7 A;  4A4I A;  5M3F G;  1B2T A;  4JOI A;  5D65 A;  5C4X H;  4OHJ A;  1YHB A;  1LTS D;  3A5Z B;  1QNU A;  1UE5 A;  1JC7 A;  3LWU A;  3A8K E;  3JC6 6;  1IL2 A;  3FKI B;  1N32 Q;  3STB C;  1SYB A;  3N52 A;  3CPW A;  4K2L A;  1EU3 A;  1SMY D;  4GN4 B;  1A15 A;  1HZA A;  3E0J A;  4BA1 I;  2TMP A;  4BA2 I;  5FLM G;  1JE5 A;  1GVP A;  2DNC A;  1I4R A;  3CC7 A;  2JA6 G;  2F3V A;  3F2B A;  2IWH A;  4LFC Q;  3G6E A;  3U4Z A;  1JMC A;  1E1T A;  4K5X A;  4KJN A;  1TWH H;  1HCZ A;  3HOW G;  2D62 A;  1QE6 A;  3NEN A;  4A3K G;  4XQN A;  2E2I B;  1SR3 A;  4K14 A;  2VY3 A;  5KEE A;  4A3I G;  2VW9 A;  1HHV A;  4U68 A;  1K8M A;  5IIF A;  4Y52 H;  3S1N H;  3WWV A;  2UUB Q;  5C3W A;  5G3L D;  1ET9 A;  3K0X A;  4FO2 A;  4X66 Q;  1P8L A;  4DV1 L;  1WCM G;  2IX1 A;  1J8I A;  4CDF C;  1WD0 A;  2ZT9 C;  5JEA J;  4EQ5 A;  1WYD A;  3CCV A;  3CD6 A;  1H9K A;  3OIP A;  4DUY L;  2Z6B A;  2UXB Q;  2PW5 A;  1XNQ L;  3AFQ A;  3A74 A;  2G9D A;  4ZKC B;  4R4I A;  2VQF L;  4DR1 L;  1N33 Q;  4NPS A;  4OIJ A;  2G5D A;  1B4O A;  5EGT A;  4GNX A;  2PI2 E;  3IL8 A;  3GTP B;  3PF4 A;  5C0X G;  2OQ0 A;  1LTT D;  3FEW X;  5IYB G;  4IUR A;  1OXT A;  2BH8 A;  5C44 G;  1CK1 A;  3AYH B;  2CQO A;  2KQ3 A;  4N8F A;  3S24 A;  3L2P A;  2B2U C;  4JW0 A;  5C4X B;  3CHB D;  1L0X B;  3OIQ A;  3DEO A;  2EOT A;  1U9R A;  5HGT A;  4DAV A;  2UXC L;  4XQJ A;  1SFO H;  2BOS A;  3KLR A;  1NE3 A;  2D2C C;  1B3Q A;  3Q23 A;  2RDG A;  2WV6 D;  4C2M H;  2PW7 A;  4I7A A;  3CCE A;  1TT2 A;  3RN5 A;  2Y0S B;  3FMC A;  2KHI A;  2B2W C;  4RAU C;  2EVB A;  2MFI A;  4IPD A;  4Z9C B;  1JCK B;  1TWH B;  5FJ8 G;  1YNJ D;  4JI3 Q;  2ENB A;  3TP5 A;  4XIG S;  1Q86 C;  3Q0A A;  4LF9 Q;  1KC8 C;  1X3E A;  3FP9 A;  1DZ1 A;  2NYZ D;  1BCP C;  4LUO A;  4GZY C;  4DK3 C;  2GVB A;  5IT9 c;  3RN2 A;  1OXV A;  2QF7 A;  4DV7 L;  3MZ5 A;  3ND9 A;  4ALP A;  4DR6 L;  2KHS A;  2B8G A;  5I9O A;  4LW1 A;  1CSP A;  2F03 A;  1V1O A;  1PH3 A;  1RF2 D;  1HTP A;  4OGQ C;  1PLF A;  1CHP D;  2WIN B;  3UDI A;  3I55 A;  1FJG Q;  1SLJ A;  1I6H H;  2PZU A;  1VQO A;  2YTX A;  4DK1 A;  2FFK B;  2HT1 A;  2B39 A;  4TQU S;  2R93 H;  5L37 A;  3LWE A;  2GVA A;  4JI5 Q;  4A3D H;  3R2I A;  3T1Y Q;  2ZJR A;  4RGT A;  2JEA I;  1C0A A;  4RMF A;  4AQY Q;  4JYA L;  1PRT B;  4BBR G;  5ELE A;  1PTO C;  3KK7 A;  4YCV A;  2Z1C A;  1ROD A;  4FNF A;  4XYQ A;  1PMR A;  4K6D A;  1P16 A;  5LL6 X;  3K5L A;  3HOZ G;  2F0J A;  3A7A B;  1E22 A;  4P2C B;  3W1G A;  4X65 Q;  4A3L G;  1SE4 A;  3K7U C;  3M4O H;  2EY1 A;  4TKO B;  1Y8P B;  1CKO A;  2R6G A;  1W6K A;  4K2K A;  4DNI A;  1ENA A;  4A3M H;  3BJU A;  3PO2 H;  1X54 A;  1Q3L A;  2K1B A;  3A0J A;  1K73 C;  3CC2 A;  3D31 A;  4KD4 A;  2Q8I B;  2D5D A;  1F9R A;  1CZW A;  2Q2H A;  3OTO L;  4Y7N H;  3S2D B;  1A6X A;  4DUZ Q;  3TQY A;  5I6W A;  4ODG A;  3K57 A;  1HR0 W;  2RQX A;  4HSP A;  2WB1 E;  1MKH A;  5KNC A;  1PFM A;  1CM9 A;  3CXC A;  3T56 B;  4CKB A;  1PA6 A;  4X6A H;  2L1B A;  1LT3 D;  3PO3 B;  2QKI C;  3UE1 A;  3D6W A;  2QIL A;  2DY7 A;  1GKH A;  1DON A;  3EIV A;  4A75 A;  5LMN Q;  1MIU A;  1MSG A;  2FJ2 A;  5M5W H;  4ME3 A;  4LF4 L;  3KOJ A;  2AUK A;  5M5X H;  4GOP B;  1EY6 A;  1EWC A;  2KBN A;  1K3R A;  4A3G G;  1KIX A;  1J6Q A;  5E7N A;  4C3H H;  2EYJ A;  3F2C A;  1PDQ A;  2YYZ A;  1PRT F;  4DR2 Q;  3ULL A;  1I6H B;  1Z6H A;  4A3F B;  3DUZ A;  3NPP A;  2H1E A;  3OW7 A;  2AUJ D;  2R93 B;  2WFW A;  2IJ0 A;  2K75 A;  4A3D B;  4LF7 L;  4K5V A;  3J7Y W;  3AFP A;  1Y1W H;  2ICI A;  4AYB B;  1ONL A;  1HZB A;  5EBC A;  3NXW A;  1B50 A;  1YJN A;  3S16 B;  1EFW A;  1XNR Q;  4N8X 1;  3J7A V;  2LFN A;  1BNZ A;  1RIP A;  4HN7 A;  5IP7 G;  1VS0 A;  3PCO B;  1IBK Q;  1VQ9 A;  3ICE A;  4A3M B;  1YVC A;  4GKK L;  1F9Q A;  3PO2 B;  1BF4 A;  1LTB D;  4QIW E;  3DLL A;  1AE3 A;  1LM0 A;  2KCN A;  3C46 A;  2R92 B;  4LF8 Q;  2AWO A;  1TII D;  1KTK A;  2K5N A;  2MJ8 A;  1W3S A;  3DWA A;  1KLG D;  4QL5 A;  3A56 A;  1XMO Q;  4ZUJ A;  4V0B A;  2PPB C;  4C3J B;  3Q22 A;  3NTH A;  3J81 j;  3RR5 A;  2EYM A;  4JBW A;  2RCN A;  4BBS H;  2B2Y A;  1XTC D;  2KUM A;  1YNN D;  1F2Y A;  3I56 A;  3E6Z X;  1O7Y A;  1QUQ A;  1VQP A;  5IGB A;  1QB5 D;  2NN6 I;  2EYP A;  3U9S A;  1STH A;  2D0P A;  4DA2 A;  2R7F A;  1BBU A;  2OQK A;  2Q2I A;  1U4R A;  2MO0 A;  5EPK A;  4JI8 L;  1IBM Q;  5IP9 H;  3JAM c;  1SYG A;  3KF8 B;  5J22 A;  4RFB A;  4C3H B;  1C48 A;  4LWC A;  5KIX A;  1IHZ A;  3MC0 B;  1O78 A;  1TWG B;  3TN2 A;  3I4N H;  5CV6 A;  4NXN Q;  4HTH A;  1HA5 A;  1BBX C;  3KJP A;  2R7Z H;  1II3 A;  3GQB A;  3I7F A;  4WJW A;  2F4V Q;  3HGB A;  2VB3 X;  1I94 Q;  3HKZ E;  1RHP A;  4JPB W;  4JI1 L;  1PH6 A;  1HRJ A;  5CYU A;  2B2V C;  4O42 A;  1EQV A;  5M3M H;  3SVM A;  3RMH A;  3C3L A;  5ELN A;  3ZJY C;  4IN3 A;  2WKD A;  1F9S A;  4A3J G;  3NQT A;  3PUZ A;  3U50 C;  4OO1 G;  4BY7 H;  1EIF A;  1VF5 C;  2K28 A;  2RDF A;  4JI4 L;  1SJE D;  1KDB A;  1STA A;  5KYI A;  1LLR D;  3PIP 3;  3ERS X;  1UEB A;  3FVQ A;  3HOY H;  1LV9 A;  1HNZ Q;  3CW2 C;  1STB A;  2KCC A;  3A7L A;  1DM0 B;  4POG A;  2WP8 J;  2LKV A;  3DM1 A;  1VQM A;  2IL8 A;  2PMZ B;  2CHB D;  4B9X A;  2CWA A;  2DNE A;  1QOH A;  3HEJ A;  1UEA B;  4J8Q A;  1SE8 A;  4XTC S;  3FPP A;  3HS0 C;  1FGB D;  1HR0 L;  1X6O A;  2RSO A;  2B29 A;  3HKZ G;  1GUT A;  2QCP X;  2CWP A;  1CHQ D;  4IAL A;  1UAP A;  3D3R A;  1N36 L;  1CA5 A;  4YIJ A;  4A3B H;  4F7X A;  2LMC B;  5IGD A;  1N9W A;  3J80 c;  4DV2 L;  3I2Z A;  2O2L D;  4EQP A;  2PO4 A;  1D5X C;  3HOV G;  1V9P A;  3VR6 A;  4G7O C;  1OXS C;  3BDL A;  4RH6 A;  1D5M C;  4X62 Q;  5EBD A;  3FPU B;  2A69 D;  3GO5 A;  4R4C A;  3K5N A;  1HFG A;  4RGO S;  3I4M H;  3CCQ A;  4CHT B;  1VQ6 A;  1WTO A;  4KKU A;  4N9T A;  2V1C C;  3AU7 A;  3I4N B;  2XIW A;  2A6H C;  3Q8D A;  3X3M A;  3BDC A;  2PQA A;  1CZG A;  3CCU A;  1N32 L;  1AFP A;  1MI2 A;  4JBK A;  4KTA A;  2WAQ E;  3ER0 A;  3TP7 A;  2CVR A;  2OTL A;  3GTQ H;  4ZUI A;  3TS0 A;  1TY2 A;  3QOJ A;  1X55 A;  1BDO A;  3GTK B;  2A1A A;  1PH7 A;  3MAQ A;  5M3M B;  1I5F A;  4MTN A;  4G4K A;  2X69 A;  1DJR D;  4LFC L;  3PIP A;  4L8J A;  3PUX A;  1D7Q A;  5A2Q L;  5EKK A;  4BY7 B;  2CKZ B;  1JR0 D;  2JA5 G;  4UAI A;  5IE8 A;  3SGI A;  3MXN B;  5LL6 S;  1SMY C;  4BXX H;  4KK7 A;  2K5H A;  1LAC A;  2QA4 A;  1MBY A;  1U0L A;  5BN4 A;  4L5R C;  4YHH Q;  1B8A A;  5LMN W;  2UUB L;  4X66 L;  2RBM A;  2JQO A;  2EY6 A;  3FKI H;  1Y1V G;  3IFD A;  5IGF A;  3AEV A;  4LF6 L;  3QG1 A;  2Q8R E;  2UU9 L;  2F0P A;  2UXB L;  4UPA A;  1TWA B;  1GD7 A;  5CV8 A;  1TS5 A;  1N33 L;  4A3B B;  3ITP A;  3DXJ C;  1KAW A;  3U4V A;  4MTK A;  3GTM H;  1CFM A;  2F0E A;  3TRZ A;  2K01 A;  3J80 i;  4G57 A;  3G4S A;  1DXM A;  1Z47 A;  1VQI A;  1PRT D;  2I46 A;  2IX3 A;  2N78 A;  1EZ8 A;  4GLA C;  3SK5 A;  4GNX C;  5J39 A;  1SNC A;  4KY6 A;  4ZCK A;  3UDG A;  2XN9 C;  2E2I H;  5IT9 E;  1U4P A;  3M4P A;  3I4M B;  3AQQ A;  3KUP A;  4JVZ A;  2I0Q A;  4A93 G;  3DWP A;  2IHF A;  3OWF A;  4R8N A;  1QUQ B;  2VS1 A;  1D1K A;  5IOD A;  3T13 A;  4Q5V A;  4DAP A;  1BR9 A;  1MHW C;  5AJ3 Q;  4CJ1 B;  1SNO A;  3GP7 A;  4NMZ A;  4A3E G;  3GTQ B;  3NBI A;  1FNV A;  2F0D A;  1IL8 A;  2XWB B;  1G8Z D;  2RKS A;  4DR3 L;  3KBX A;  1I6V C;  2WAC A;  1FNU A;  4GN5 A;  4CJ0 B;  5GAE C;  1XX8 A;  4CBV A;  3MFY A;  3MEH A;  1XMQ Q;  4B08 A;  1JB3 A;  4ZK9 B;  4NXM Q;  1A62 A;  3M4Q A;  1WTV A;  5EQ0 A;  1LUZ A;  3P20 A;  1GUS A;  1YHA A;  2X6L A;  1CT1 D;  4JI3 L;  3GTP H;  3WOE A;  2MNA A;  2F0O A;  2K4K A;  5M3F H;  2VUM G;  1IW7 D;  5CV4 A;  4JV5 Q;  1VQA A;  1KNE A;  5ELD A;  4LF9 L;  4B3S Q;  4RCN A;  1ET6 A;  1KLU D;  4R1J A;  2KA7 A;  3TZD A;  4FXK C;  3GDE A;  1SAP A;  2NB0 A;  1IBL Q;  3TEH B;  2EQS A;  2PZW A;  2ICE C;  1EQQ A;  3VA5 A;  5BR8 Q;  5HGQ A;  4DV4 L;  2AQ1 B;  3K5M A;  4QMG A;  2JA7 B;  1Q1E A;  5J3B A;  5FLM H;  3M4Y A;  2VXW A;  5C4Z A;  4KI0 A;  5KRU A;  2F0G A;  2OXP A;  1F77 A;  1YNJ C;  2DY8 A;  2ID0 A;  2JA6 H;  1X65 A;  1XTD A;  5EPL A;  4DXF A;  4DN4 M;  5I4D A;  1FJG L;  3S17 B;  3L7Z C;  3VYU A;  1S4Z A;  1HQR D;  4DFA A;  4GOP A;  3GTM B;  3S15 H;  3PUY A;  4JI5 L;  2KED A;  3FRP B;  1PYS B;  2MPM A;  1VQK A;  3S2H H;  3T1Y L;  2J7Z A;  1A3V A;  3NHH A;  3HOU G;  1K83 B;  3P1H A;  1ICF B;  3HP3 A;  1HJP A;  4AQY L;  3H0G B;  4NKL A;  4KKS A;  1CI3 M;  5T1G A;  3I73 A;  4NB3 A;  3M3Y B;  4HR7 B;  1GOZ A;  5K36 H;  2WKC A;  4IFD I;  4HSV A;  4KY7 A;  1DOK A;  4X65 L;  1WOC A;  2OT2 A;  1LTL A;  4LMQ D;  2RDH A;  2ES2 A;  1G91 A;  1BUV T;  3W1B A;  4QCL A;  2O5I C;  1E2W A;  1A8V A;  3UDF A;  1I50 H;  5ELB A;  1RD9 D;  4ME5 A;  5FLX E;  1K3B C;  3R3O A;  1ASZ A;  4K0K Q;  4OX9 Q;  1Q8K A;  2UUA Q;  5E4W C;  4B3R L;  2JEB I;  2N55 A;  4XT1 B;  1LT5 D;  4RKB A;  2AKW B;  5IYB H;  3ERO A;  2YU9 B;  1LAB A;  1A2U A;  2PQA B;  1B3A A;  4FF2 A;  2F0H A;  4PMB A;  5M3F B;  2K6A A;  1JWS D;  1FYC A;  2FMM A;  4DNT B;  3A8I E;  1I3Q H;  2E76 C;  2JYO A;  5ELF A;  4LNQ A;  3KF6 B;  4X64 L;  4F88 A;  1PYW D;  4YY3 Q;  1AEX A;  1XXG A;  5LMN L;  2EY2 A;  4JI2 Q;  3WOF A;  3PUV A;  1TWC H;  4JC0 A;  4KHP Q;  3D4W A;  5ELC A;  1QVC A;  4AIM A;  3GTL B;  4RA8 A;  2OTJ A;  5AFW A;  2NVX B;  2K52 A;  4IUV A;  1PH8 A;  2ZXP A;  4JBM A;  3K58 A;  5CMD A;  2JA6 B;  4CDC C;  3D6C A;  3L3O C;  4DR2 L;  2NWG A;  4C1N K;  1C9O A;  2HUG A;  1PFS A;  5KGU A;  2JP1 A;  1EQR A;  1WTX A;  3S15 B;  2B63 G;  2HD3 A;  3HOW B;  4A3K B;  3S2H B;  3KF8 A;  3H94 A;  3NWS A;  3S2D H;  1IZ6 A;  5HY6 A;  4A3I B;  5E4X A;  1RJT A;  1VQF A;  2E2H H;  4HJ5 A;  1KQS A;  4L5Q A;  1JJC B;  3CF5 A;  1VF7 A;  1YNX A;  2TSS A;  3PO3 H;  3MFG A;  1XNR L;  2I07 B;  3E0E A;  3CCR A;  5C6A A;  3MEF A;  1CA6 A;  1JIC A;  1WCM B;  2F0I A;  4O2D A;  4UP8 A;  3JAM E;  3RUZ A;  4DV3 Q;  1EY9 A;  4RCO A;  5KNB A;  4WJ3 M;  3BZC A;  4M1U B;  2KEN A;  3R8B A;  1I50 B;  2DUD A;  2VQE Q;  1LTR D;  3CPF A;  2HCC A;  2YTV A;  1EY5 A;  4CJ2 C;  2Z6K A;  4LF8 L;  5C0X I;  1SSO A;  2K32 A;  3EFX D;  2VB2 X;  5JPN C;  4A3F H;  5CV7 A;  1XMO L;  1G2S A;  1SYC A;  3H3V H;  3NBH B;  5C44 B;  1QJO A;  1QVG A;  3O13 A;  1UUP A;  2F0K A;  3J81 E;  1MJE A;  4U67 3;  5JJL A;  2L9H A;  1I3Q B;  4PQX A;  4LUZ A;  3HOZ H;  2CW0 D;  3S16 H;  1EEI D;  2B2Y C;  3K7A B;  4A3L H;  3T16 A;  2B2T A;  4CGY B;  2UXD Q;  3OSO A;  2A19 A;  1TWC B;  1R9T B;  2IT1 A;  3RLO A;  3OMC A;  2BH2 A;  4DU9 A;  4R9W A;  4ZLT F;  1J5E Q;  5DNF A;  3BVM A;  5GAD C;  2ZXR A;  2B3G A;  5F2D A;  1LT6 D;  1NR2 A;  1VQC A;  4H7B A;  1U4L A;  2Z4I A;  2R92 H;  2Q8T A;  4QGU A;  1YNN C;  1PH1 A;  1JOQ A;  1C8C A;  2F4V L;  3CRL C;  1VMC A;  1K0S A;  2I5M X;  2JA9 A;  4CDD C;  4C3J H;  3C1F A;  3S14 B;  5I9P A;  3V96 A;  2E2H B;  1S5F D;  3BZK A;  3J80 E;  1G6Z A;  1PZI D;  3J7Z C;  4DR4 Q;  2MGS A;  1X9N A;  3CRK C;  3SK6 A;  4DAY B;  1NCV A;  2K33 A;  3S1M B;  5HUR A;  4ZQ3 A;  1SDF A;  1VCI A;  2AMC B;  2F0M A;  3CCL A;  2NN6 H;  3K59 A;  1AH9 A;  5JVH 3;  4A3G H;  1H9S A;  1YHQ A;  4UDU C;  4KY5 A;  2QEJ C;  2RF4 A;  4NP5 A;  1Y69 U;  1KXL A;  3BZD B;  5IOC A;  1YZ6 A;  3BVZ A;  1TXY A;  3MA2 B;  3NEL A;  2A6E D;  1HNZ L;  1EY0 A;  3MHB A;  3NUC A;  2EE1 A;  1TWG H;  3H3V I;  1AP0 A;  2E5L Q;  4BY1 G;  2LXJ A;  2PNH A;  1WFQ A;  3SHL A;  3RZD B;  2HQE A;  3MXN A;  3V05 A;  4BBR B;  5DEH A;  2QDB A;  4NDX A;  4B9W A;  1NMG A;  4K5W A;  2WB1 G;  4H44 C;  1QCB D;  1Q82 C;  3HOZ B;  5IP7 H;  3E9I A;  2QGQ A;  2BDN A;  2RA4 A;  2CH4 W;  1BQQ T;  1EFI D;  5ELO A;  2Z4H A;  2EJF C;  2PMZ E;  4O1N A;  4UP9 A;  4OWW B;  1U5K A;  1WTW A;  4IFD J;  4HIK A;  3VR4 A;  5C4J B;  1EUJ A;  3D4D A;  2DN8 A;  1H9M A;  2H4O A;  1Y1W G;  1S5B D;  2HHH Q;  1W6J A;  5DLQ E;  4C3I G;  1N34 L;  1TS2 A;  2OWO A;  4JI6 Q;  1EY7 A;  2R7D A;  1H9R A;  3D8G A;  1TKW B;  3CU7 A;  1HZ9 A;  3GV6 A;  4HMI A;  5I6Y A;  1A3U A;  3U9O A;  1GUG A;  4QUF A;  2KCT A;  2OEO A;  3S1Q H;  1PZK D;  1G2T A;  4B3T L;  4H0L C;  4XQQ A;  1S5C D;  3CAM A;  3EA6 A;  1N8R C;  3RD4 A;  1PH4 A;  2XSC A;  4L5S A;  2EPB A;  4H13 C;  4JBJ A;  1KDA A;  4ID6 A;  3UE0 A;  3GTJ H;  1VQ7 A;  2F0V A;  5E1F A;  4L63 B;  3TME A;  2A69 C;  4DAM A;  3DHQ A;  1SJH D;  4LAA A;  3PQI A;  1NTG A;  3CME A;  2XTI A;  2HDM A;  3K0Y A;  1SRU A;  2HQL A;  4DK6 C;  3HG9 A;  3HFZ B;  3GTG B;  3EBE A;  4F8M A;  4A3G B;  1GM5 A;  1ZXT A;  3KFU A;  1BOS A;  2PZT A;  5JEA G;  5FKA C;  1O7Z A;  5EAY A;  2BCO A;  4YHH L;  4DR7 Q;  4BBS G;  2BA0 A;  2XNA C;  3N6R A;  2NBF A;  1IKM A;  1WI5 A;  1FVI A;  4NW2 A;  3KBG A;  2FHT A;  4OWT B;  4B3M Q;  1IXR A;  4FXD A;  2Q2T A;  2GA4 B;  4PG3 A;  2N3S A;  3GTK H;  3KLW A;  1OXU A;  4FYD A;  2F52 A;  5IP9 G;  4IUQ A;  3HRZ C;  3PF5 A;  3NSW A;  4DXG A;  4A76 A;  4P75 A;  3CCJ A;  4HMJ A;  5DM6 3;  1M4V A;  2K03 A;  1BXT A;  1Y8O B;  1FNW A;  3PIO A;  1B1Z A;  2R7Z G;  1SYE A;  5JJI A;  3F2U A;  3K81 C;  1B9M A;  4R4T A;  1EOV A;  4YWL A;  2JA8 G;  4OL7 A;  5A35 A;  1Y14 B;  5I2Y A;  3FDT A;  3ND8 A;  2ZXO A;  3QO2 A;  4DR5 Q;  1IYV A;  2V4D A;  5C3E G;  3CKI B;  1JT8 A;  1D1I A;  2A73 B;  4C1N I;  1MD2 D;  5AJ3 L;  5C0X J;  3S1Q B;  4E6I A;  4HIM A;  5LMU Q;  4LF4 Q;  1M8A A;  1R4Q B;  1VQG A;  3W5O A;  3OW2 A;  4YCU A;  2E2D C;  4GKJ Q;  1U4M A;  3GTJ B;  2A68 D;  1PRT C;  1HQM C;  3ULP A;  5C3X A;  1WTR A;  3BYY B;  1TWA H;  5GAH C;  1XMQ L;  3SK8 A;  4NXM L;  1O7I A;  3DM3 A;  3HOY G;  1ESR A;  1EU4 A;  2J0T D;  3FHW A;  2K5V A;  2F4I A;  1WTQ A;  5M5Y B;  2N8N A;  1SND A;  2VL6 A;  2NZO A;  5GQO A;  2MUY A;  4LF7 Q;  4JV5 L;  1K8A C;  3MXP A;  4B3S L;  1B44 D;  3M9B A;  5IYD G;  1BVS A;  1NSN S;  4EGV A;  1VQH A;  5JAV A;  1CSQ A;  5BR8 L;  2L55 A;  4JOI C;  4LJZ C;  1K8O A;  3K5O A;  1VQB A;  4K6L A;  2NVT B;  4HED A;  2F3W A;  1TVX A;  3KF6 A;  3AB9 A;  2M00 A;  1H9S B;  4GKK Q;  4O0A A;  1IW7 C;  4OO1 I;  5CV9 A;  4A3J B;  3HKS A;  4LFA Q;  3I91 A;  4KJO A;  2LS0 1;  3EVQ A;  5CC4 A;  1CTM A;  4IUT A;  4A3C H;  1GUN A;  1SXT A;  4IUN A;  1S72 A;  1TQO A;  3HZX A;  3SXH A;  1IYJ B;  1S5D D;  3G6J B;  4DV5 Q;  1W2B A;  3QJY A;  2KCM A;  4GOP C;  3K6O A;  3R2T A;  1KRS A;  4EX5 A;  1STN A;  3T1H Q;  2ZJQ A;  5JJZ A;  4ZAI A;  1HNX Q;  5IYC H;  1XWE A;  2B8F A;  2F1M A;  4P74 A;  4ULL A;  3VDY A;  1Y1V H;  4UHV A;  1ENF A;  5FO8 B;  1EEF D;  3H3V C;  2MP1 A;  2ZTD A;  3HKZ B;  4CKC A;  3PMF A;  3EQL C;  1PH9 A;  2JA7 H;  4EVO A;  3NTI A;  1F2Z A;  2WAQ G;  1Q90 A;  4JI8 Q;  1FR3 A;  4PMW A;  4K0K L;  4OX9 L;  1KD1 C;  4YWM A;  2Z0S A;  2C35 B;  2UUA L;  4DV6 Q;  2EYL A;  1OXX K;  1MJC A;  3NP8 A;  1BCP B;  3S17 H;  4XDX A;  3HOV B;  1UE6 A;  1SE2 A;  5K5P A;  4BXX G;  1EZ6 A;  3M7N A;  1SEB D;  2NTS A;  2X6G A;  1E2V A;  3T51 B;  3SDZ A;  3P7J A;  3CC4 A;  4GS3 A;  1L0Y B;  2B2V A;  2UUC Q;  4DV0 Q;  1K83 H;  4IO9 A;  3FKI G;  3H0G H;  4OIK A;  4PZ7 A;  1ILP A;  5FO9 B;  1EWI A;  4LK1 C;  1B53 A;  3M3Y H;  1A2T A;  2ASB A;  1M1K C;  4YY3 L;  1A0I A;  1JJ2 A;  2R3Z A;  3NBH A;  1VQE A;  4R8I A;  3X3N A;  2EYF A;  4KHP L;  3IAY A;  1R4P B;  5EKI A;  2JE6 I;  4IFD H;  4MHE A;  2ZTC A;  4PV1 C;  4RG1 A;  1QWY A;  4JI4 Q;  1D6E C;  3VYT A;  4AH6 A;  3VA7 A;  1PTO B;  4JI7 Q;  1NR4 A;  4X3U A;  2E75 C;  1JJG A;  1PV4 A;  3VR3 A;  4RHR A;  4PZ8 A;  1S3O A;  2JA5 B;  2F0F A;  2YU9 H;  2PCF B;  1SRO A;  1OTC A;  1KAB A;  4JCV E;  5FOB B;  4IUU A;  4CDE C;  2PI2 A;  3HOX G;  4Q0F A;  3CMA A;  3KLS A;  1EIH A;  2K5Q A;  1BCP F;  1Y1V B;  4DV3 L;  2Y0S E;  3BDO A;  1TWF B;  3GD7 A;  2BE5 D;  1VMP A;  4KD3 A;  4DV2 Q;  1RTN A;  3TSS A;  3CP0 A;  3RLF A;  3A8J E;  1LT4 D;  3GTL H;  4FDB A;  2IW3 A;  2NVX H;  1Q7Y C;  1QZG A;  4DAY A;  1E7Z A;  1EIY B;  1RCV D;  2FXQ A;  3QWN A;  1AN8 A;  3SE0 A;  4DK0 A;  4P72 A;  2A74 C;  3ULJ A;  1D8L A;  2AWN A;  1GHK A;  2M9V A;  2Z6K C;  3ERQ A;  1TS4 A;  3HOU H;  5C4X G;  4PMC A;  1ENC A;  3M85 A;  3HOW H;  1WJJ A;  2F0U A;  4A3K H;  5JOB A;  4DF7 A;  1NBW A;  1HXY D;  4LF5 Q;  4JI0 Q;  4A3I H;  2ZTE A;  1E24 A;  4A93 B;  2NVQ B;  1L1O A;  2HIV A;  4OXP A;  4X3T A;  3E9H A;  1UWV A;  4GLV B;  5EPJ A;  2UXD L;  1PTO F;  3L9A X;  3IKJ A;  1YJ9 A;  1YIJ A;  1WCM H;  4A3E B;  2HIX A;  5KYL A;  1HZC A;  2Y0S G;  2B2T C;  4X3S A;  2K7V A;  5IT9 L;  1J5E L;  5IWA Q;  2NTT A;  5IGG A;  3F8T A;  2SEB D;  4QY7 A;  1T5X D;  4QB4 A;  2CCZ A;  3NK9 A;  1EY4 A;  1S40 A;  1KNA A;  5H1S E;  2AHO B;  1AE2 A;  4QQB X;  5JPM C;  1D2B A;  3I3C A;  2ZM6 Q;  2CW0 C;  4XXE A;  2KJX A;  5C0X H;  5K36 G;  2VUM B;  1X3P A;  4FF1 A;  4DUZ L;  5C44 H;  2E2J H;  4LFB Q;  5JJK A;  3A55 A;  3PUW A;  3V2T A;  1AZP A;  3TBI B;  1G51 A;  2D9U A;  3HOX B;  4LF6 Q;  4IOC A;  4WJ4 A;  1EYA A;  3H15 A;  4V19 0;  4DR4 L;  2UU9 Q;  3I72 A;  3I8Z A;  3MWY W;  2BA1 A;  5LHY 1;  3KDF B;  1ZYR D;  3K7A H;  1B7Y B;  1NY4 A;  1V1P A;  1VQ5 A;  1KRT A;  1R9T H;  3GTO H;  4ZKB B;  4ZYS A;  2K04 A;  4CKE A;  3A54 A;  1L0W A;  1GJX A;  4OON A;  4J15 A;  1HA6 A;  3PV0 A;  3BU2 A;  4JK1 C;  4L6T B;  5T1I A;  2B63 H;  2E5L L;  1DGS A;  1SNM A;  3HOU B;  2GN5 A;  5FJ8 H;  3K8A A;  1OO9 B;  1HNW Q;  1ASY A;  1RKN A;  1E2Z A;  1VQD A;  1PZJ D;  4MIU A;  2SNS A;  2LY7 A;  1DOM A;  5EKL A;  3S14 H;  4DR3 Q;  4MNO A;  3F2D A;  5C5M A;  1WTP A;  1Q1B A;  1QZH A;  1EL0 A;  3L0O A;  5FO7 B;  4EQO A;  1Z7T A;  2A6E C;  2KHJ A;  3S1M H;  2K14 A;  1I4P A;  1AZQ A;  3STB D;  1CQF A;  4J6H A;  1ICW A;  1IBK L;  1JOO A;  3DWQ A;  1QNK A;  1E1O A;  4QJF A;  4APV A;  5CBA E;  2L0C A;  1UE1 A;  1BKB A;  4AYB E;  1Q46 A;  5C4H A;  1G6P A;  2HHH L;  2IY5 B;  1GXD C;  1K8G A;  4OEL B;  4ABN A;  2O5J C;  4KN4 C;  4JI6 L;  2G9H D;  5D3D A;  3TP6 A;  2F0N A;  3S1N B;  2HCI A;  3TZU A;  2OF1 A;  3PO3 G;  3C2P A;  1K28 A;  5EJW A;  5DM7 3;  1G29 1;  4DV4 Q;  5FLX L;  3RZD H;  2E2J B;  5M9O A;  4BBR H;  2EZV A;  1EYC A;  1CKN A;  2MHV A;  3I70 A;  3OMG A;  4IPC A;  1XJV A;  4HJ7 A;  4FF4 A;  1PH5 A;  1K9M C;  1K0R A;  1JQY D;  1VQ8 A;  2KEE A;  4RHS A;  1BO0 A;  2EXD A;  3URY A;  5DAU A;  3BVG A;  3NQI A;  2F0Q A;  1YEZ A;  1ILQ A;  1GUW A;  3QOL A;  2K50 A;  3GTO B;  1PYB A;  1RDP D;  4I65 A;  5CV5 A;  4A3F G;  1GO3 E;  1IBM L;  4UP7 A;  4POF A;  1JOK A;  1QG7 A;  5C4J H;  2R93 G;  1SE3 A;  1HPC A;  4A3D G;  1UNS A;  4M8A A;  4DR7 L;  2DJG C;  4AYB G;  4K8I A;  2RCF A;  3U58 A;  2N88 A;  2B63 B;  5E3F A;  4NXN L;  4R4Q A;  2EDG A;  1MGS A;  4RGN A;  3VR5 A;  1HFN A;  3NEM A;  2H5X A;  1QVF A;  2KEC A;  3PGZ A;  1H95 A;  4XT3 B;  5CBE E;  3SR1 A;  1I94 L;  4B3M L;  1SFO B;  1EQT A;  4DV1 Q;  5TSS A;  3AMU A;  2E8G A;  4C2M B;  1O80 A;  4KN7 C;  1CUK A;  3OYY A;  3B6Y A;  2XGT A;  4DUY Q;  4TSS A;  4A3M G;  1KL9 A;  1XNQ Q;  1SMX A;  2YV5 A;  3PO2 G;  4WOR A;  3Q24 A;  1VQL A;  4B3R Q;  2VQF Q;  4DR1 Q;  2IPK D;  5NUC A;  1T5E A;  2R92 G;  5J1Z A;  3GTG H;  5D14 A;  1KHI A;  1V43 A;  2B2U A;  1WTH A;  1VQJ A;  3ZYY X;  1I4X A;  4C3J G;  2A5H A;  4KHV A;  1NMF A;  2EXZ A;  3IRB A;  1YJW A;  4BY1 H;  3JAM L;  3OHX C;  1NAP A;  4DR5 L;  1XPR A;  4KMU C;  3H6M A;  4X64 Q;  1L1O B;  1EY8 A;  3G7L A;  2VZA A;  2Z9H A;  5LMU L;  2UXC Q;  2K5W A;  2LXK A;  4PZ6 A;  4GKJ L;  4G7Z C;  2NN6 G;  2F0T A;  2JK8 A;  2QEX A;  1XPU A;  1BCP D;  4IUP A;  3D4R A;  1C7Y A;  2B2W A;  4S3S A;  1FL0 A;  4DKA C;  2F0S A;  1X32 A;  1IYU A;  2F0W A;  2BDO A;  2CH4 A;  3SEB A;  4C3H G;  1YIT A;  5FLX c;  3S1R H;  3TS2 A;  4IPH A;  4KV6 A;  4BWG B;  4HIO A;  1HTL D;  2DGY A;  1KDC A;  2EJG C;  4IQZ A;  3MXG A;  3J81 L;  3ONA B;  4X62 L;  2YTY A;  4C3I H;  2F0L A;  1GUO A;  4PNY A;  3PIO 3;  4ZRZ A;  3MXU A;  2A68 C;  1X3Q A;  2ALY B;  4OEM B;  4DGZ A;  4XYO A;  2RVL A;  4YCW A;  1GHJ A;  3DMU A;  4DV7 Q;  3M4O B;  1LTG D;  1ML0 D;  2KVM A;  3M7G A;  3SK4 A;  2JSO A;  4DR6 Q;  4KLK A;  3I4L A;  1V1P B;  1S5E D;  3CCM A;  3G71 A;  1PTO D;  4GNX B;  4LUV A;  4HJ9 A;  1VQN A;  5IY0 A;  1Q12 A;  2RSN A;  4LFA L;  2XWJ B;  1SN8 A;  4HCS A;  5FK9 C;  1F2M A;  3A5U A;  3H91 A;  3I90 A;  3IFT A;  1A63 A;  4GLX A;  2L11 A;  1B9N A;  3H09 A;  5M5Y H;  4DV5 L;  4Y7N B;  4QF4 A;  2M2L A;  5JEA H;  2R61 A;  4WFN 3;  1JOR A;  3J80 L;  1V8Q A;  3QR8 A;  2SOB A;  4KKT A;  1Q81 C;  2EIF A;  3T1H L;  2L15 A;  1HNX L;  1PHJ A;  4JYA Q;  4KHZ A;  4BY1 B;  3E3X A;  5GRO A;  2C9O A;  3QIA A;  1X56 A;  3KJO A;  3T4A C;  1O7L A;  1HUN A;  3S9W A;  5M5W B;  1TR5 A;  5M5X B;  2WB1 B;  1T9H A;  2NVT H;  4F87 A;  3NWT A;  3TRE A;  4MZ9 A;  2NUC A;  1NJI C;  4FXG C;  4N9P A;  2FMC A;  4DV6 L;  3BYT B;  2Q2U A;  4A3J H;  2HDL A;  1JE4 A;  4TRD A;  1AW7 A;  3S1R B;  3OOC A;  3RLN A;  4OO1 H;  2XRS D;  1X3F A;  3I4N G;  2AQ3 B;  2UUC L;  4DV0 L;  3OTO Q;  1Y1W B;  2JA8 H;  5IGE A;  2I5L X;  1L2F A;  4C3I B;  2JJQ A;  5A2Q E;  2L5T A;  3D0F A;  5G3L F;  5JVG 3;  2A8V A;  2SNM A;  3PSI A;  5C3E H;  2EJM A;  2K5D A;  1CKN B;  1E0B A;  3I4O A;  5M3M G;  4FP5 D;  3J81 c;  3UI2 A;  1SYD A;  3MVV A;  2XVS A;  2RHS B;  1EYG A;  1VDZ A;  2N49 A;  2J4X A;  5D3I B;  1LTI D;  3DEP A;  3LGJ A;  1FGU A;  1H9J A;  5COY A;  3C1E A;  4BY7 G;  4YWK A;  2K05 A;  4JI7 L;  3RZO H;  1EOT A;  2NVY H;  3NTK A;  2CQA A;  1PVO A;  3HOV H;  2KOL A;  4I7Z C;  1V1Q A;  1JWU D;  1LYL A;  1HUM A;  1WVL A;  1F9P A;  1CKM A;  4K8J A;  5IYD H;  1WD1 A;  4QIW B;  4OWX B;  4GN3 B;  4BBS B;  1A3T A;  1I4Q A;  4TVA B;  1FD7 D;  4R4O A;  3OPO A;  2ZJP A;  1EYD A;  5COR A;  2C5C A;  1IBL L;  1DYQ A;  2AQ2 B;  1UE7 A;  2OCE A;  2SDF A;  3KYH C;  4A3B G;  4RWS C;  5C5L A;  2VNU D;  1YBY A;  1DOL A;  3E5S A;  3OWE B;  1EWH A;  3J7A 5;  1STG A;  1RTO A;  3KDF A;  4IJH A;  4C56 C;  1F2L A;  1SBB B;  2XRQ D;  4HAE A;  1PH2 A;  3JAM i;  1YI2 A;  2JXM B;  5KND A;  3J7A F;  1PTO H;  1N34 Q;  1IKL A;  3VYS A;  2NZH A;  4IPG A;  3Q6S A;  3I4M G;  4FVM A;  2R7Z B;  3QB3 A;  1SNQ A;  3CQZ H;  4JG2 A;  2JA5 H;  4LF5 L;  1JWM D;  1NNX A;  2BE5 C;  4JI0 L;  2JA8 B;  4B3T Q;  5CR3 A;  3NE5 B;  4MN3 A;  1ZKO A;  2PQE A;  1I4G A;  1TY0 A;  5C3E B;  4H02 A;  3EN2 A;  3MTS A;  5BN5 A;  4J1M A;  2CFM A;  3CCS A;  1L1O C;  1SYF A;  2O4X A;  3P75 A;  1TWF H;  3J81 i;  4HJA A;  5IWA L;  4IOA A;  4A3C G;  1NUC A;  2QDL A;  2E74 C;  5IGC A;  3KLS X;  2L4N A;  2MQH A;  2PNR C;  1CQV A;  3HOY B;  3RZO B;  2NVY B;  1ESF A;  4P71 A;  2IHE A;  3BS1 A;  2I5H A;  1J9O A;  5CGK A;  1Z9F A;  3RNU A;  2ZM6 L;  5GAG C;  3WDN A;  4G7H C;  1HH2 P;  4IJL A;  1PFN A;  5IYC G;  1D5Z C;  1ZEQ X;  1VQ4 A;  1LTA D;  2ATW A;  2NZ1 D;  4LFB L;  3LNN A;  4JI1 Q;  1BBW A;  4WRD A;  1TS3 A;  1STY A;  4A93 H;  2MO1 A;  1XYI A;  2NVQ H;  2JA7 G;  1DCZ A;  1XPO A;  2WII B;  2DJF C;  2RHQ B;  1PFB A;  1MSH A;  4UY8 C;  3W3A A;  4JI2 L;  4X3K A;  4ILW A;  4A3E H;  2EYO A;  4HCE A;  3TDQ A;  2IX0 A;  3UDX A;  1DD2 A;  3EJI A;  4HID A;  4P73 A;  2JN4 A;  2F3I A;  2Z8L A;  1JB7 A;  3BG3 A;  1I4H A;  2FIN B;  1LO5 D;  3W2D A;  3R93 A;  1EIG A;  3H0G G;  1PXU A;  2P5Z X;  1Q8I A;  4FF3 A;  1STE A;  1B70 B;  4BS9 A;  4DPG A;  1ZYR C;  2PYK A;  1HNW L;  3CQZ B;  2VUM H;  4L5T A;  3GV3 A;  1Y8N B;  1X3G A;  2EYH A;  3VR2 A;  3VYR A;  1C4Q A;  1KAA A;  1E3P A;  4QUC A;  2EY5 A;  1HR0 Q;  4RKL A;  3HOX H;  4IFD G;  4EQN A;  1QIL A;  4IZ8 A;  3TP8 A;  2A6H D;  3LX0 A;  4DNR B;  2D0O A;  3F1Z A;  1N36 Q;  2LSS A;  1SNP A; 
#chains in the Genus database with same CATH homology
 4RGM A;  3T53 B;  2WAQ B;  5I2X A;  1TU2 B;  2L12 A;  5ISR A;  5BN3 A;  1B2T A;  5D65 A;  4OHJ A;  1LTS D;  1QNU A;  1JC7 A;  3LWU A;  3A8K E;  3FKI B;  1SYB A;  3N52 A;  4K2L A;  1EU3 A;  1SMY D;  1A15 A;  3E0J A;  4BA1 I;  2TMP A;  4BA2 I;  2DNC A;  1I4R A;  2F3V A;  2IWH A;  4K5X A;  4KJN A;  1HCZ A;  2D62 A;  1QE6 A;  4XQN A;  2E2I B;  4K14 A;  5KEE A;  1HHV A;  4U68 A;  1K8M A;  5IIF A;  5C3W A;  5G3L D;  1ET9 A;  4FO2 A;  2IX1 A;  1J8I A;  1WD0 A;  2ZT9 C;  5JEA J;  1H9K A;  3OIP A;  2PW5 A;  2G9D A;  4ZKC B;  4OIJ A;  1B4O A;  5EGT A;  3IL8 A;  3GTP B;  5C0X G;  1LTT D;  3FEW X;  4IUR A;  1OXT A;  1CK1 A;  2KQ3 A;  2B2U C;  5C4X B;  3CHB D;  1L0X B;  3OIQ A;  3DEO A;  2EOT A;  1U9R A;  5HGT A;  4DAV A;  4XQJ A;  2BOS A;  3KLR A;  2D2C C;  3Q23 A;  2RDG A;  2WV6 D;  2PW7 A;  1TT2 A;  2Y0S B;  3FMC A;  2B2W C;  4RAU C;  2EVB A;  4Z9C B;  1JCK B;  1TWH B;  1YNJ D;  2ENB A;  3TP5 A;  4XIG S;  3Q0A A;  1DZ1 A;  2NYZ D;  1BCP C;  4GZY C;  1OXV A;  2QF7 A;  3MZ5 A;  3ND9 A;  2KHS A;  2B8G A;  5I9O A;  2F03 A;  1V1O A;  1RF2 D;  1HTP A;  4OGQ C;  1PLF A;  1CHP D;  2WIN B;  2PZU A;  4DK1 A;  2FFK B;  2B39 A;  4TQU S;  3LWE A;  3R2I A;  4RGT A;  2JEA I;  1PRT B;  5ELE A;  1PTO C;  3KK7 A;  2Z1C A;  1ROD A;  4FNF A;  4XYQ A;  1PMR A;  4K6D A;  5LL6 X;  3K5L A;  2F0J A;  3A7A B;  4P2C B;  1SE4 A;  2EY1 A;  4TKO B;  1Y8P B;  2R6G A;  1W6K A;  4K2K A;  1ENA A;  1Q3L A;  2K1B A;  3D31 A;  2Q8I B;  4KD4 A;  2D5D A;  1F9R A;  1CZW A;  3S2D B;  1A6X A;  5I6W A;  4ODG A;  3K57 A;  2RQX A;  4HSP A;  5KNC A;  1PFM A;  1CM9 A;  3T56 B;  4CKB A;  2L1B A;  1LT3 D;  3PO3 B;  2QKI C;  3D6W A;  2QIL A;  2DY7 A;  1DON A;  1MSG A;  2FJ2 A;  2AUK A;  1EY6 A;  1EWC A;  2EYJ A;  1PDQ A;  2YYZ A;  1PRT F;  1I6H B;  1Z6H A;  4A3F B;  3DUZ A;  3NPP A;  2H1E A;  3OW7 A;  2AUJ D;  2R93 B;  2IJ0 A;  4A3D B;  4K5V A;  3J7Y W;  2ICI A;  4AYB B;  1ONL A;  5EBC A;  3NXW A;  1B50 A;  3S16 B;  3J7A V;  2LFN A;  1BNZ A;  4HN7 A;  4A3M B;  1F9Q A;  3PO2 B;  1BF4 A;  1LTB D;  2KCN A;  3C46 A;  2R92 B;  2AWO A;  1TII D;  1KTK A;  2MJ8 A;  3DWA A;  1KLG D;  3A56 A;  4ZUJ A;  4V0B A;  2PPB C;  4C3J B;  3Q22 A;  3NTH A;  2EYM A;  4JBW A;  2B2Y A;  1XTC D;  2KUM A;  1YNN D;  1F2Y A;  3E6Z X;  1O7Y A;  5IGB A;  1QB5 D;  2NN6 I;  2EYP A;  3U9S A;  1STH A;  4DA2 A;  1U4R A;  5EPK A;  1SYG A;  5J22 A;  4RFB A;  4C3H B;  1C48 A;  5KIX A;  1IHZ A;  3MC0 B;  1O78 A;  1TWG B;  3TN2 A;  5CV6 A;  4HTH A;  1HA5 A;  1BBX C;  1II3 A;  3GQB A;  4WJW A;  3HGB A;  2VB3 X;  1RHP A;  1HRJ A;  5CYU A;  2B2V C;  4O42 A;  1EQV A;  3SVM A;  3RMH A;  3C3L A;  4IN3 A;  2WKD A;  1F9S A;  3NQT A;  3PUZ A;  4OO1 G;  1VF5 C;  2K28 A;  2RDF A;  1SJE D;  1KDB A;  1STA A;  5KYI A;  1LLR D;  3PIP 3;  3FVQ A;  1LV9 A;  1STB A;  2KCC A;  3A7L A;  1DM0 B;  2WP8 J;  2LKV A;  3DM1 A;  2IL8 A;  2PMZ B;  2CHB D;  4B9X A;  2DNE A;  1QOH A;  3HEJ A;  1UEA B;  4J8Q A;  4XTC S;  3FPP A;  3HS0 C;  1FGB D;  2RSO A;  1GUT A;  2QCP X;  1CHQ D;  4IAL A;  1UAP A;  3D3R A;  1CA5 A;  4YIJ A;  4F7X A;  5IGD A;  2LMC B;  2O2L D;  4EQP A;  2PO4 A;  1D5X C;  3VR6 A;  4G7O C;  1OXS C;  3BDL A;  4RH6 A;  1D5M C;  5EBD A;  3FPU B;  2A69 D;  3GO5 A;  3K5N A;  1HFG A;  4RGO S;  4CHT B;  1WTO A;  4KKU A;  4N9T A;  3I4N B;  3AU7 A;  2XIW A;  2A6H C;  3X3M A;  3BDC A;  1CZG A;  1AFP A;  1MI2 A;  4KTA A;  3TP7 A;  2CVR A;  4ZUI A;  1TY2 A;  3QOJ A;  1BDO A;  3GTK B;  3MAQ A;  5M3M B;  4G4K A;  2X69 A;  1DJR D;  4L8J A;  3PUX A;  5A2Q L;  5EKK A;  4BY7 B;  1JR0 D;  4UAI A;  5LL6 S;  1SMY C;  4KK7 A;  1LAC A;  1MBY A;  5BN4 A;  2RBM A;  2EY6 A;  3IFD A;  5IGF A;  3QG1 A;  2Q8R E;  2F0P A;  1TWA B;  5CV8 A;  1TS5 A;  4A3B B;  3ITP A;  3DXJ C;  1CFM A;  2F0E A;  2K01 A;  4G57 A;  1DXM A;  1Z47 A;  1PRT D;  2I46 A;  2IX3 A;  1EZ8 A;  3SK5 A;  5J39 A;  1SNC A;  4KY6 A;  2XN9 C;  5IT9 E;  1U4P A;  3I4M B;  3KUP A;  3DWP A;  3OWF A;  4R8N A;  1D1K A;  5IOD A;  3T13 A;  4Q5V A;  4DAP A;  1BR9 A;  4CJ1 B;  1SNO A;  3GP7 A;  4NMZ A;  3GTQ B;  3NBI A;  1FNV A;  2F0D A;  1IL8 A;  2XWB B;  1G8Z D;  2RKS A;  3KBX A;  1I6V C;  2WAC A;  1FNU A;  4CJ0 B;  1XX8 A;  4CBV A;  3MFY A;  3MEH A;  4B08 A;  1JB3 A;  4ZK9 B;  1WTV A;  5EQ0 A;  3P20 A;  1GUS A;  2X6L A;  1CT1 D;  3WOE A;  2F0O A;  1IW7 D;  5CV4 A;  1KNE A;  5ELD A;  4RCN A;  1ET6 A;  1KLU D;  2KA7 A;  3TZD A;  4FXK C;  1SAP A;  2NB0 A;  2PZW A;  2ICE C;  3VA5 A;  2AQ1 B;  3K5M A;  4QMG A;  2JA7 B;  1Q1E A;  3M4Y A;  2VXW A;  5C4Z A;  4KI0 A;  5KRU A;  2F0G A;  2OXP A;  1F77 A;  1YNJ C;  2DY8 A;  2ID0 A;  5EPL A;  4DXF A;  4DN4 M;  5I4D A;  3S17 B;  3L7Z C;  3VYU A;  1S4Z A;  1HQR D;  4DFA A;  3GTM B;  3PUY A;  2KED A;  3FRP B;  2MPM A;  2J7Z A;  1A3V A;  3NHH A;  1K83 B;  3P1H A;  3HP3 A;  3H0G B;  4NKL A;  4KKS A;  1CI3 M;  5T1G A;  3I73 A;  3M3Y B;  4HR7 B;  1GOZ A;  5K36 H;  2WKC A;  4IFD I;  4HSV A;  4KY7 A;  1DOK A;  2OT2 A;  4LMQ D;  2RDH A;  1G91 A;  1BUV T;  4QCL A;  2O5I C;  1E2W A;  5ELB A;  1RD9 D;  4ME5 A;  5FLX E;  3R3O A;  5E4W C;  2JEB I;  2N55 A;  4XT1 B;  1LT5 D;  4RKB A;  3ERO A;  2YU9 B;  1LAB A;  1A2U A;  4FF2 A;  1B3A A;  2F0H A;  4PMB A;  5M3F B;  2K6A A;  1JWS D;  1FYC A;  2FMM A;  4DNT B;  3A8I E;  2E76 C;  2JYO A;  5ELF A;  4F88 A;  1PYW D;  1AEX A;  1XXG A;  2EY2 A;  3WOF A;  3PUV A;  3D4W A;  5ELC A;  3GTL B;  4RA8 A;  2NVX B;  5AFW A;  4IUV A;  2ZXP A;  3K58 A;  5CMD A;  2JA6 B;  3D6C A;  3L3O C;  2NWG A;  4C1N K;  2HUG A;  5KGU A;  2JP1 A;  1WTX A;  3S15 B;  3HOW B;  4A3K B;  3S2H B;  3KF8 A;  3H94 A;  3NWS A;  4A3I B;  5E4X A;  1RJT A;  1VF7 A;  2TSS A;  3MFG A;  2I07 B;  5C6A A;  1CA6 A;  1JIC A;  1WCM B;  2F0I A;  3JAM E;  3RUZ A;  1EY9 A;  4RCO A;  5KNB A;  4M1U B;  3R8B A;  1I50 B;  1LTR D;  2HCC A;  1EY5 A;  4CJ2 C;  5C0X I;  1SSO A;  2K32 A;  3EFX D;  5JPN C;  2VB2 X;  5CV7 A;  1G2S A;  1SYC A;  5C44 B;  1QJO A;  3O13 A;  1UUP A;  2F0K A;  3J81 E;  4U67 3;  2L9H A;  1I3Q B;  4PQX A;  2CW0 D;  1EEI D;  2B2Y C;  3K7A B;  3T16 A;  2B2T A;  4CGY B;  3OSO A;  1TWC B;  1R9T B;  2IT1 A;  3OMC A;  4DU9 A;  4R9W A;  4ZLT F;  5DNF A;  3BVM A;  2ZXR A;  5F2D A;  1LT6 D;  1NR2 A;  4H7B A;  1U4L A;  2Z4I A;  2Q8T A;  1YNN C;  1JOQ A;  1C8C A;  3CRL C;  1VMC A;  3C1F A;  3S14 B;  5I9P A;  3V96 A;  2E2H B;  1S5F D;  3J80 E;  1G6Z A;  1PZI D;  2MGS A;  3CRK C;  3SK6 A;  1NCV A;  2K33 A;  3S1M B;  5HUR A;  4ZQ3 A;  1SDF A;  1VCI A;  2F0M A;  2NN6 H;  3K59 A;  5JVH 3;  1H9S A;  4UDU C;  4KY5 A;  2QEJ C;  4NP5 A;  1Y69 U;  3BZD B;  5IOC A;  3BVZ A;  3MA2 B;  2A6E D;  1EY0 A;  3MHB A;  3NUC A;  2EE1 A;  1AP0 A;  3SHL A;  3RZD B;  2HQE A;  3V05 A;  3MXN A;  4BBR B;  5DEH A;  2QDB A;  4NDX A;  4B9W A;  4K5W A;  4H44 C;  1QCB D;  3HOZ B;  2BDN A;  2RA4 A;  1BQQ T;  1EFI D;  2Z4H A;  2EJF C;  4O1N A;  1WTW A;  4IFD J;  3VR4 A;  5C4J B;  3D4D A;  2DN8 A;  1H9M A;  2H4O A;  1S5B D;  1W6J A;  4C3I G;  1TS2 A;  1EY7 A;  1H9R A;  3D8G A;  1TKW B;  3CU7 A;  3GV6 A;  4HMI A;  5I6Y A;  1A3U A;  3U9O A;  1GUG A;  4QUF A;  2OEO A;  1PZK D;  1G2T A;  4H0L C;  4XQQ A;  1S5C D;  3EA6 A;  3RD4 A;  2XSC A;  2EPB A;  4H13 C;  1KDA A;  4ID6 A;  2F0V A;  5E1F A;  4L63 B;  3TME A;  2A69 C;  3DHQ A;  1SJH D;  4LAA A;  2HDM A;  3K0Y A;  3HG9 A;  3GTG B;  4F8M A;  4A3G B;  1ZXT A;  1BOS A;  2PZT A;  5JEA G;  5FKA C;  1O7Z A;  2BCO A;  2BA0 A;  2XNA C;  3N6R A;  2NBF A;  1IKM A;  4NW2 A;  3KBG A;  2FHT A;  4FXD A;  2GA4 B;  1OXU A;  4FYD A;  4IUQ A;  3HRZ C;  3NSW A;  4DXG A;  4HMJ A;  5DM6 3;  1M4V A;  2K03 A;  1BXT A;  1Y8O B;  1FNW A;  1B1Z A;  1SYE A;  3F2U A;  1B9M A;  4OL7 A;  5A35 A;  5I2Y A;  3FDT A;  3ND8 A;  2ZXO A;  3QO2 A;  1IYV A;  2V4D A;  3CKI B;  1D1I A;  2A73 B;  4C1N I;  1MD2 D;  5C0X J;  3S1Q B;  4E6I A;  1M8A A;  1R4Q B;  2E2D C;  1U4M A;  3GTJ B;  2A68 D;  1PRT C;  1HQM C;  5C3X A;  1WTR A;  3BYY B;  3SK8 A;  1ESR A;  1EU4 A;  2J0T D;  2F4I A;  1WTQ A;  5M5Y B;  1SND A;  2MUY A;  3MXP A;  1B44 D;  1NSN S;  4EGV A;  5JAV A;  2L55 A;  4LJZ C;  1K8O A;  3K5O A;  4K6L A;  2NVT B;  4HED A;  2F3W A;  1TVX A;  3AB9 A;  2M00 A;  1H9S B;  1IW7 C;  4OO1 I;  5CV9 A;  4A3J B;  3I91 A;  4KJO A;  2LS0 1;  3EVQ A;  5CC4 A;  1CTM A;  4IUT A;  1GUN A;  1SXT A;  4IUN A;  1TQO A;  3HZX A;  3SXH A;  1S5D D;  3G6J B;  3QJY A;  3K6O A;  3R2T A;  1STN A;  5JJZ A;  4ZAI A;  1XWE A;  2B8F A;  2F1M A;  4ULL A;  1ENF A;  5FO8 B;  1EEF D;  3H3V C;  2MP1 A;  3HKZ B;  4CKC A;  3PMF A;  3EQL C;  4EVO A;  3NTI A;  1F2Z A;  1Q90 A;  1FR3 A;  4PMW A;  2EYL A;  1OXX K;  3NP8 A;  1BCP B;  4XDX A;  3HOV B;  1SE2 A;  5K5P A;  1EZ6 A;  3M7N A;  1SEB D;  2NTS A;  2X6G A;  1E2V A;  3T51 B;  3SDZ A;  3P7J A;  1L0Y B;  2B2V A;  4OIK A;  1ILP A;  5FO9 B;  4LK1 C;  1B53 A;  1A2T A;  2R3Z A;  3NBH A;  4R8I A;  3X3N A;  2EYF A;  3IAY A;  1R4P B;  5EKI A;  2JE6 I;  4IFD H;  4MHE A;  4PV1 C;  1QWY A;  1D6E C;  3VYT A;  3VA7 A;  1PTO B;  1NR4 A;  4X3U A;  2E75 C;  3VR3 A;  4RHR A;  2JA5 B;  2F0F A;  2PCF B;  1KAB A;  5FOB B;  4IUU A;  4Q0F A;  3KLS A;  1EIH A;  2K5Q A;  1BCP F;  1Y1V B;  3BDO A;  1TWF B;  3GD7 A;  2BE5 D;  1VMP A;  4KD3 A;  1RTN A;  3TSS A;  3RLF A;  3A8J E;  1LT4 D;  2IW3 A;  4DAY A;  1RCV D;  3QWN A;  1AN8 A;  3SE0 A;  4DK0 A;  2A74 C;  1GHK A;  2AWN A;  2M9V A;  3ERQ A;  1TS4 A;  4PMC A;  1ENC A;  3M85 A;  2F0U A;  5JOB A;  4DF7 A;  1HXY D;  4A93 B;  2NVQ B;  4X3T A;  5EPJ A;  1PTO F;  3L9A X;  3IKJ A;  4A3E B;  5KYL A;  2B2T C;  4X3S A;  2K7V A;  5IT9 L;  2NTT A;  5IGG A;  2SEB D;  1T5X D;  4QB4 A;  3NK9 A;  1EY4 A;  1KNA A;  5JPM C;  1D2B A;  3I3C A;  2CW0 C;  4XXE A;  2KJX A;  5C0X H;  5K36 G;  2VUM B;  1X3P A;  4FF1 A;  3A55 A;  3PUW A;  3V2T A;  1AZP A;  3TBI B;  2D9U A;  3HOX B;  1EYA A;  4V19 0;  3I72 A;  3I8Z A;  3MWY W;  2BA1 A;  5LHY 1;  1ZYR D;  1V1P A;  4ZKB B;  4ZYS A;  2K04 A;  4CKE A;  3A54 A;  1GJX A;  1HA6 A;  3PV0 A;  4JK1 C;  4L6T B;  5T1I A;  1SNM A;  3HOU B;  1OO9 B;  1RKN A;  1E2Z A;  1PZJ D;  4MIU A;  2SNS A;  2LY7 A;  1DOM A;  5EKL A;  5C5M A;  1WTP A;  1Q1B A;  1EL0 A;  5FO7 B;  4EQO A;  1Z7T A;  2A6E C;  1I4P A;  1AZQ A;  1CQF A;  4J6H A;  1ICW A;  1JOO A;  3DWQ A;  1QNK A;  5CBA E;  2L0C A;  5C4H A;  1GXD C;  4ABN A;  2O5J C;  4KN4 C;  2G9H D;  5D3D A;  3TP6 A;  2F0N A;  3S1N B;  2HCI A;  3TZU A;  2OF1 A;  3C2P A;  5DM7 3;  5EJW A;  1G29 1;  5FLX L;  2E2J B;  5M9O A;  2EZV A;  1EYC A;  2MHV A;  3I70 A;  3OMG A;  4FF4 A;  1JQY D;  2KEE A;  4RHS A;  1BO0 A;  3URY A;  5DAU A;  3BVG A;  3NQI A;  2F0Q A;  1ILQ A;  1GUW A;  3QOL A;  3GTO B;  1RDP D;  4I65 A;  5CV5 A;  1JOK A;  1QG7 A;  1SE3 A;  1HPC A;  1UNS A;  4M8A A;  4K8I A;  2N88 A;  2B63 B;  5E3F A;  3VR5 A;  2EDG A;  1MGS A;  4RGN A;  1HFN A;  2KEC A;  4XT3 B;  5CBE E;  3SR1 A;  1SFO B;  1EQT A;  5TSS A;  3AMU A;  4C2M B;  1O80 A;  4KN7 C;  4TSS A;  4WOR A;  3Q24 A;  2IPK D;  5NUC A;  1T5E A;  5J1Z A;  5D14 A;  1V43 A;  2B2U A;  3ZYY X;  1I4X A;  4C3J G;  2A5H A;  4KHV A;  2EXZ A;  3JAM L;  3OHX C;  1NAP A;  4KMU C;  3H6M A;  1EY8 A;  3G7L A;  2K5W A;  4G7Z C;  2NN6 G;  2F0T A;  1BCP D;  4IUP A;  3D4R A;  2B2W A;  4S3S A;  2F0S A;  1X32 A;  1IYU A;  2F0W A;  2BDO A;  4C3H G;  3SEB A;  4KV6 A;  4BWG B;  1HTL D;  1KDC A;  2EJG C;  4IQZ A;  3MXG A;  3J81 L;  3ONA B;  2F0L A;  1GUO A;  4PNY A;  3PIO 3;  4ZRZ A;  3MXU A;  2A68 C;  1X3Q A;  4DGZ A;  4XYO A;  2RVL A;  1GHJ A;  3DMU A;  3M4O B;  1LTG D;  1ML0 D;  2KVM A;  3M7G A;  3SK4 A;  2JSO A;  3I4L A;  1V1P B;  1S5E D;  1PTO D;  1Q12 A;  2RSN A;  2XWJ B;  4HCS A;  5FK9 C;  1F2M A;  3H91 A;  3I90 A;  3IFT A;  2L11 A;  1B9N A;  3H09 A;  4Y7N B;  4QF4 A;  2M2L A;  5JEA H;  2R61 A;  4WFN 3;  1JOR A;  3J80 L;  1V8Q A;  4KKT A;  2SOB A;  4KHZ A;  4BY1 B;  2C9O A;  3QIA A;  3T4A C;  1O7L A;  1HUN A;  3S9W A;  5M5W B;  1TR5 A;  5M5X B;  2WB1 B;  4F87 A;  3NWT A;  2NUC A;  4FXG C;  4N9P A;  2FMC A;  3BYT B;  2HDL A;  1JE4 A;  4TRD A;  1AW7 A;  3S1R B;  3OOC A;  4OO1 H;  2XRS D;  2AQ3 B;  1Y1W B;  5IGE A;  4C3I B;  5A2Q E;  2L5T A;  5G3L F;  5JVG 3;  2SNM A;  2EJM A;  2K5D A;  1E0B A;  4FP5 D;  3UI2 A;  1SYD A;  3MVV A;  2XVS A;  1VDZ A;  5D3I B;  2J4X A;  1LTI D;  3DEP A;  1H9J A;  5COY A;  3C1E A;  2K05 A;  1EOT A;  3NTK A;  2CQA A;  2KOL A;  4I7Z C;  1JWU D;  1HUM A;  1WVL A;  1F9P A;  4K8J A;  1WD1 A;  4QIW B;  4BBS B;  1A3T A;  1I4Q A;  1FD7 D;  3OPO A;  1EYD A;  5COR A;  2C5C A;  1DYQ A;  2AQ2 B;  2SDF A;  4RWS C;  5C5L A;  2VNU D;  1DOL A;  3E5S A;  3OWE B;  1EWH A;  1STG A;  1RTO A;  4C56 C;  1SBB B;  1F2L A;  2XRQ D;  4HAE A;  2JXM B;  5KND A;  3J7A F;  1PTO H;  1IKL A;  3VYS A;  3Q6S A;  4FVM A;  2R7Z B;  3QB3 A;  1SNQ A;  1JWM D;  2BE5 C;  2JA8 B;  5CR3 A;  3NE5 B;  4MN3 A;  1ZKO A;  2PQE A;  1I4G A;  1TY0 A;  5C3E B;  3MTS A;  5BN5 A;  4J1M A;  1SYF A;  2O4X A;  3P75 A;  1NUC A;  2E74 C;  5IGC A;  3KLS X;  2L4N A;  3HOY B;  2PNR C;  1CQV A;  3RZO B;  2NVY B;  1ESF A;  3BS1 A;  1J9O A;  5CGK A;  3WDN A;  4G7H C;  1PFN A;  1D5Z C;  1ZEQ X;  1LTA D;  2NZ1 D;  3LNN A;  4WRD A;  1TS3 A;  1STY A;  1XYI A;  1DCZ A;  2WII B;  1PFB A;  1MSH A;  3W3A A;  4X3K A;  4ILW A;  2EYO A;  4HCE A;  3TDQ A;  2IX0 A;  1DD2 A;  3EJI A;  2Z8L A;  3BG3 A;  1I4H A;  2FIN B;  1LO5 D;  3W2D A;  3R93 A;  1EIG A;  1PXU A;  1Q8I A;  4FF3 A;  1STE A;  4BS9 A;  1ZYR C;  2PYK A;  3CQZ B;  3GV3 A;  1Y8N B;  2EYH A;  3VR2 A;  3VYR A;  1C4Q A;  1KAA A;  4QUC A;  2EY5 A;  4RKL A;  4IFD G;  4EQN A;  1QIL A;  4IZ8 A;  3TP8 A;  2A6H D;  3LX0 A;  4DNR B;  1SNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...