3TMEA

Crystal structure of staphylococcal nuclease variant delta+nviagla v23e at cryogenic temperature
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 31
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tmeA00
5CV8A 2M00A 2PZTA 5IGCA 1ENAA 2F0VA 4QB4A 1EYCA 5CV6A 3EROA 5K5PA 5IGEA 4ODGA 1U9RA 4DFAA 4ME5A 5CV4A 5CV5A 3DHQA 3U9OA 5HGTA 3SK8A 5J22A 1SYBA 1A2UA 5JAVA 5J39A 4F7XA 3LX0A 1EZ8A 4K2KA 1EQVA 1A2TA 5CC4A 2F0KA 5CV7A 3SK5A 4KV6A 1NUCA 4QMGA 4DU9A 1SYDA 5C5LA 4HMJA 2RKSA 3D6CA 5I9OA 1SNDA 4NDXA 2EYPA 3HZXA 3PMFA 2F0GA 4H7BA 5EKLA 1TT2A 5KYIA 2KHSA 5IOCA 1EY5A 2EYLA 2PYKA 1SNOA 2EYJA 5C3WA 2PW5A 1II3A 3SHLA 1JORA 2F3WA 3OWFA 3BDLA 4PNYA 1RKNA 3TP6A 4HMIA 5KYLA 3NP8A 4PMCA 1STHA 4RKLA 5IODA 2F0JA 2F0OA 2EYHA 2HQEA 3C1FA 2F0WA 4I65A 3TP7A 5IIFA 4KHVA 4YIJA 3S9WA 2EY1A 4DGZA 1A3UA 1A3VA 1STAA 2F0MA 4KY5A 5J1ZA 1ENCA 5E1FA 2SNSA 1EY7A 3NUCA 4K5VA 4DF7A 5KGUA 4HTHA 2F0EA 2EXZA 3T13A 1EY0A 5I6WA 1F2ZA 4EQPA 3SR1A 2OXPA 4S3SA 5KRUA 4J6HA 3QOJA 4KJNA 3MZ5A 1KABA 4KY6A 4R8NA 3TP8A 3OSOA 1STNA 4K5XA 2SNMA 4WRDA 2O4XA 2KQ3A 3OMCA 3SK4A 1SYGA 1KAAA 1STBA 4IUNA 4N9TA 5M9OA 5CR3A 3MXPA 3EJIA 2QDBA 4QF4A 4OL7A 1STGA 5NUCA 3MVVA 2NUCA 2PZWA 4EQOA 5JOBA 3D4DA 4KY7A 3H6MA 4KJOA 4LAAA 3EVQA 5ISRA 4WORA 5IGDA 3T16A 4IZ8A 2F0UA 4NP5A 3QOLA 2F0HA 3ERQA 4IALA 4ZUIA 1SYFA 4K5WA 5C3XA 3TMEA 1IHZA 2EY6A 4N9PA 1SNQA 4K2LA 3ITPA 3TP5A 4K8IA 3MEHA 2EYMA 4MIUA 2PQEA 4EVOA 5C4HA 2EYOA 5KEEA 3MHBA 3SK6A 3R3OA 1JOKA 5EGTA 3HEJA 4ID6A 2F3VA 1JOQA 2WACA 2F0TA 4K6DA 2RDFA 1A3TA 1KDCA 1SYCA 3BDCA 3NQTA 3NK9A 2EY5A 4J1MA 1EZ6A 1TQOA 3P75A 2F0LA 3OMGA 3RUZA 3VA5A 2F0PA 1JOOA 4KD4A 3E5SA 5EKKA 4KTAA 4KD3A 1STYA 4NMZA 3SXHA 5CV9A 5IGBA 1NSNS 1EY8A 5I9PA 1EYAA 1KDBA 1EY6A 5CGKA 2F0DA 2LKVA 5DEHA 5E3FA 2EY2A 3V2TA 1EY4A 1TR5A 1SYEA 4TRDA 1SNCA 1F2YA 1AEXA 2EYFA 2RBMA 5IGGA 5KIXA 2F0FA 4F8MA 5F2DA 3DMUA 2SOBA 4B9XA 3P1HA 4G57A 4E6IA 5C5MA 5DAUA 2PW7A 4RKBA 4K14A 4ZUJA 1KDAA 2OEOA 2ENBA 5HURA 1F2MA 3C1EA 3NHHA 1SNMA 3QB3A 4EQNA 5C4ZA 2F0IA 1EY9A 2OF1A 4K8JA 4ZQ3A 4B9WA 5IGFA 2F0QA 1SNPA 2PZUA 3D4WA 1EYDA 4PMBA 3NXWA 5I6YA 5C6AA 2F0NA 2F0SA 3D8GA 4NKLA
chains in the Genus database with same CATH superfamily
1K8OA 2PZTA 5IGCA 1D5MC 3J80i 5I4DA 5CV6A 4JI1L 4EGVA 5IWAQ 5LMNL 4A3LH 4UY8C 4KMUC 3SK8A 1SYBA 4APVA 1PRTC 4F87A 1R4PB 3KK7A 1PV4A 1CI3M 2JSOA 1LTRD 4XIGS 2JA8H 5CV7A 1NUCA 3RN2A 3ULPA 4DAYB 3MC0B 2BDOA 4BBRH 2WAQE 1HRJA 2UXCQ 1ZYRC 1C0AA 4C2MH 2BE5D 1UE5A 2PW5A 1QVGA 4JYAL 4A93B 3DWQA 1GHKA 3FP9A 5M3MH 2IL8A 3CPFA 5IIFA 1Q81C 4KHVA 1B44D 2CFMA 1EIHA 2M9VA 1KTKA 1A0IA 4KHZA 1AP0A 3OIPA 5DM63 1WTQA 5C4XH 3KLRA 1SMXA 1P16A 4IUUA 3HOUB 1I4XA 2K50A 2SNMA 5M3FB 3OMCA 4JI8L 2WB1G 3KDFB 1RODA 2HQLA 2P5ZX 5G3LF 2OCEA 1HTPA 1I50B 3I4NG 3EN2A 3I4MH 4RHSA 4FF3A 4YCVA 4IZ8A 2F0HA 1B7YB 2EY6A 5JJZA 1J5EL 1BBXC 1E2VA 4GLVB 2EIFA 3CF5A 1O80A 5KEEA 1RF2D 2LY7A 1EOVA 4DNIA 1LACA 2I0QA 2B2UC 2F0TA 4DV6L 1G2SA 1Y1WG 1KDCA 1KRTA 4GNXB 4A93H 2VNUD 4DUYQ 4M1UB 1CQFA 4DXFA 2VS1A 4OWWB 1B4OA 4DN4M 2Z6KA 4P73A 3HOUH 4JI6Q 2RBMA 3CAMA 3PCOB 1IBKQ 3W1BA 2WAQB 3J81j 2L15A 3WWVA 2B2YA 1CHQD 2NN6G 1XMOQ 2B2TA 1L0XB 3OTOL 1B50A 3NTHA 5IT9E 3H0GG 2FXQA 5IP7G 5FLMG 1IYJB 1V9PA 3NBHB 4NXNQ 4ULLA 1A62A 1WI5A 1ILQA 5M3FG 5JAVA 1N36L 2JK8A 1VQ5A 3U58A 4LF5L 4JG2A 4A3JH 2MUYA 4IFDJ 3D0FA 4A3FG 3A0JA 1QB5D 3L9AX 1D5XC 2ZM6Q 4DR3L 5M5WB 4YY3L 3NEMA 1OTCA 1TU2B 3GTQH 5J3BA 2A8VA 1UWVA 4PNYA 1RKNA 3J81c 1NMGA 1V43A 3KYHC 1I4HA 1TIID 2F0JA 2UUBL 2R7ZG 2ZXPA 4DV3Q 5ELOA 3PUXA 3EFXD 1H9SA 3H94A 1HNWQ 1ZEQX 1MJEA 3QIAA 3SR1A 1HA6A 4J6HA 3QOJA 3IL8A 3RZOB 3TP8A 2XN9C 4A3BG 2Z9HA 2UXDQ 4G4KA 1IBML 2L0CA 1G6ZA 4QF4A 4PMWA 4DV2Q 2HHHQ 3U9SA 3RLNA 3K7UC 1BKBA 2H4OA 1D1IA 3HRZC 2TSSA 3O13A 4IALA 1HZ9A 1PTOF 2DGYA 3NQIA 5JEAH 4MIUA 4BY7B 5IY0A 1WTVA 1JOKA 1E22A 2K52A 4CGYB 1HJPA 3PUYA 4DXGA 2UUCQ 3GD7A 5FO7B 4A3KB 1PTOH 4RH6A 1EYGA 5CV9A 1U4LA 1VQNA 4X65L 2F0DA 5DEHA 1UUPA 2YTVA 5C0XH 1SNCA 2R93G 1G51A 4P74A 1N32Q 2K05A 3TZDA 4OWTB 5I2XA 4QUFA 2MO0A 1IKLA 2JE6I 1QILA 1B1ZA 1BXTA 2L5TA 4DUZL 4H13C 5IGFA 5DNFA 4X3UA 4GNXC 1S5DD 1JR0D 2WKCA 5FO9B 2EJMA 4JI0Q 1JWUD 3R8BA 2I5LX 4C1NK 3HOYB 1VCIA 5C3EG 3K0YA 5J39A 4LF4Q 1I94L 2PQAA 2Z4HA 4A4IA 1CTMA 4A3KH 2BDNA 1PZKD 4XDXA 1IZ6A 1O7LA 4A3DB 4DK0A 2KCCA 1N9WA 1BCPB 3R2TA 1NAPA 2LMCB 1SNOA 3CQZH 3DXJC 3IFDA 1GUSA 2N88A 1QE6A 1YHQA 3OWFA 5KYLA 3GTOH 5IODA 1VQKA 1ET9A 1I5FA 3TP7A 2F0WA 2I07B 4G7HC 1ENCA 2SNSA 2DJFC 2GA4B 4JV5L 4X62L 3P7JA 5M5YH 1F2ZA 1LABA 3S2DH 4UP7A 2DN8A 1PFSA 3VR3A 4HJ9A 3RR5A 1N8RC 2C9OA 1LTSD 1HFNA 2MNAA 2ZTEA 3EJIA 5FJ8H 4UAIA 4A76A 2NUCA 4EQOA 1RHPA 3WOEA 3HOYH 3MWYW 1SDFA 2O5IC 3A8IE 1TWCH 3S1QB 1JC7A 3TMEA 2SDFA 3T1YL 1RL2A 1SNQA 3OYYA 2CH4A 2YTXA 3J7AF 1FR3A 2EYOA 3MHBA 2A68C 5D3IB 3GTPH 2Z6BA 1Y1VB 2R6GA 4BBSB 2EJGC 1QG7A 4HIMA 4JI2L 5IYCG 1VQFA 1PH1A 3PIP3 3GTKH 2HIVA 3AYHB 3VYSA 1YNXA 5E4WC 1QZGA 4Q5VA 1M1KC 3T53B 4A3IG 1Y69U 4LUZA 1D5ZC 4R9WA 4L5SA 3NE5B 3OOCA 2K5NA 2Q8RE 4JI3Q 4A3DG 4DKAC 4B9XA 5JVH3 3PGZA 1VQCA 4ZUJA 1YBYA 3UDFA 3BG3A 4G7ZC 3HOVB 4NPSA 3S1QH 2UUCL 1XPOA 4DR7Q 2RSOA 1XTCD 2AKWB 1E0BA 4B3TQ 1JE5A 1QNKA 2FMMA 1Z47A 2QILA 5CV4A 2RCNA 3DHQA 5HGTA 2E2IB 3OHXC 4XTCS 3VR2A 4B3SQ 2AWOA 5EKIA 3D31A 1Q46A 1N32L 2F0KA 4A3MB 1NTGA 1D8LA 4GKJL 3MEFA 2MGSA 2SEBD 2NVYB 4JK1C 4MHEA 1VQIA 2NVXH 1HTLD 3BVGA 4BBSG 1LM0A 2JEBI 2C5CA 3U4VA 4JBMA 4B3ML 5JJKA 3GQBA 1EY7A 3AU7A 3KUPA 2RVLA 3FRPB 1F2LA 1SR3A 4LK1C 4EQPA 2NVTB 1KQSA 1HZAA 4KJNA 4O42A 4OEMB 1U0LA 1GHJA 1STBA 4IUNA 1STEA 5HY6A 4A3EG 1I3QB 2ATWA 2B2VC 2L9HA 1BCPC 4LAAA 4WORA 2K6AA 2EE1A 1K8GA 3ERQA 1PH8A 2JA6B 4DAYA 4N9PA 1WVLA 2B63B 2FHTA 1CUKA 4A3MH 3HOVG 4IO9A 1V1QA 3SK6A 3R3OA 4K0KQ 4H44C 2NVYH 1XMQL 1JJCB 1VS0A 3S16H 1Z6HA 2CW0D 1D7QA 4GKKQ 3NQTA 3A5ZB 4R4OA 1EZ6A 4U68A 5IE8A 3CCRA 4N8FA 2R3ZA 1E1TA 5IGBA 1B9MA 1B9NA 1XNRQ 3T1HL 3V2TA 1BDOA 2NVTH 2D0PA 2N55A 2E2JB 5EBDA 1FVIA 3KDFA 2KBNA 1D6EC 2F3IA 2NVQH 3P1HA 4R4TA 1R9TH 2YTYA 4Z9CB 2J4XA 4C3HB 1X3QA 1F2MA 4AQYL 3QB3A 4YHHQ 5JJLA 5FLXc 3V05A 3D4WA 3CXCA 4BXXG 5BN4A 2JA6H 3D4RA 2XNAC 4C3JB 1SLJA 3D8GA 4IJLA 4LF8L 2XVSA 4JI1Q 5LMNQ 4C3IG 4RGOS 4DFAA 2VQFL 4GNXA 1U4PA 3R93A 5AFWA 3M9BA 2OTJA 3JAMc 1XNQL 4V190 1K83B 3J81i 4FXKC 4OHJA 2K5VA 2K28A 4RG1A 1A63A 1TWFB 5KYIA 1SMYC 2R7DA 4C1NI 2MPMA 4JYAQ 2GVAA 3ULLA 1C9OA 3HOXG 1L1OB 2E2JH 1CM9A 3MA2B 3UE1A 3GTJH 1S40A 4POGA 1X3EA 2Z1CA 4YIJA 1A3UA 1A3VA 4RGTA 4K5VA 5BR8L 2VUMB 1PRTF 1PYWD 4IPDA 1LTID 2E2HB 2A19A 4JI8Q 4HSVA 4UPAA 3NBHA 1T5EA 1QNUA 3SK4A 4C3JH 4N9TA 1ZYRD 3K5LA 2RCFA 5CR3A 2UU9L 4V0BA 3MVVA 4CKEA 2ZJRA 3K80C 1DD2A 3VYUA 2F52A 2A5HA 1KHIA 2E2DC 1AFPA 1J5EQ 2B2WA 4C3HG 3HOWB 2L12A 1K83H 5M9OA 2PQEA 3ONAB 4GLXA 1YHAA 4DV0L 1TWFH 3KF6A 3K58A 4DV6Q 3J80L 4P75A 2RSNA 1KAWA 2WACA 1TS2A 4IOCA 1V1PB 1K28A 2ZJQA 4J1MA 4JCVE 1DCZA 3EQLC 1EEFD 3E5SA 1PYSB 3SXHA 2D5DA 1GUTA 1NSNS 1P8LA 3SDZA 5CGKA 3GTMB 1HXYD 4L63B 2SOBA 1K73C 4IPGA 3OTOQ 2IT1A 1SFOH 4FF1A 3IRBA 3S24A 3NHHA 1OXXK 1E24A 1JMCA 2ICIA 5AJ3L 5GAEC 5CMDA 4BWGB 1VQ4A 2H5XA 3M4QA 3HOWH 2VUMG 3BS1A 1XWEA 4OO1G 3KFUA 1N36Q 3OW7A 5FOBB 4RGNA 3IFTA 4LF5Q 3L3OC 4IFDG 2JQOA 3I4OA 1HUNA 3MXGA 5C5LA 2WIIB 4DR3Q 3D6CA 1YJNA 3PMFA 4YY3Q 3URYA 3J7A5 2EPBA 2WKDA 1EIYB 3BU2A 1DONA 3CCVA 3KF8B 1SSOA 2UUBQ 1Y1WB 4A75A 4OIJA 1MIUA 4LFAL 2R92G 1WFQA 3K59A 1SAPA 4CJ2C 4CDCC 2K5WA 2OXPA 1PFBA 4JI4L 1IBMQ 3PQIA 2N49A 4M8AA 2UXBL 1AE3A 3CPWA 3D4DA 2A6EC 4HR7B 2CWPA 3T16A 1M90C 3I4NH 3FKIB 1IHZA 1TWAH 2OQ0A 4K2LA 2KUMA 2B2VA 3CHBD 2PNRC 1JJGA 3HOZB 1YEZA 3H0GB 3UDIA 1I6HB 1B53A 1JCKB 3OPOA 3KJPA 1HUMA 4KLKA 4X6AH 3TN2A 4L6TB 2JEAI 5IP9G 2JYOA 2A69D 3KLWA 2RDFA 2K1BA 3K7AB 3S1NH 3WDNA 4QIWB 5G3LD 1T5XD 5TSSA 1Y1WH 2VY3A 1F77A 1STYA 2KCNA 3M7GA 4NMZA 4X65Q 1EY8A 4A3FB 2LKVA 1B8AA 5IGGA 5KIXA 1AEXA 1TY0A 2X6LA 2F4IA 1FJGL 2A6HD 5DAUA 2PW7A 4CJ1B 2PPBC 1L0YB 3VDYA 3GTGB 3VYTA 4DUZQ 2R7ZB 1YJ9A 4LF6L 2NN6H 4K8JA 2K32A 2EQSA 4MNOA 1F9RA 1LTGD 4B9WA 3LGJA 3NSWA 5DM73 1J8IA 1EYDA 2DY8A 4PMBA 2X69A 5C6AA 1KNAA 2F3VA 4XQNA 5IYDG 4CJ0B 4A3BB 1ENAA 4LJZC 3H0GH 2HD3A 1EYCA 5JVG3 1I6HH 5IP7H 5FLMH 2Q2IA 2MJ8A 2HIXA 1U9RA 4HIDA 5A2QL 5CV5A 3U9OA 1JB7A 1I94Q 2KCTA 5CBAE 4KKSA 4Y7NB 4TQUS 5M3FH 2NTTA 3SK5A 4KV6A 5IT9c 1EIGA 2KVMA 3CRKC 4EX5A 1I50H 3I4MG 3FKIG 4AIMA 4OELB 5IOCA 4LF7L 4DA2A 2PYKA 4P2CB 4A3FH 3HOZG 1HCZA 2EVBA 3SHLA 1FGUA 1OXUA 2EYHA 4AYBB 3ERSX 4X66Q 2MFIA 4JV5Q 4X62Q 4DF7A 2JA9A 2R7ZH 2F0EA 4HN7A 1GO3E 2BOSA 1LV9A 4OXPA 1XYIA 2Q2UA 3DUZA 1JB3A 2R93B 2XRSD 1K8MA 4CHTB 4WJ3M 4O0AA 5JPNC 4OL7A 4DV4L 3BYTB 4A3BH 4A3GB 1K0RA 3EVQA 3KF6B 2Q8IB 2ZXOA 1EFWA 2Q2TA 3T1YQ 4K5WA 4OX9L 3TP5A 4HCEA 3F8TA 5GROA 1LTBD 4CKBA 1AE2A 4ZAIA 1JWMD 4QY7A 4JI2Q 2VQEL 1AH9A 5D65A 3TRZA 2NN6I 5C3EB 4RCOA 2PO4A 2JP1A 1B3AA 2UUAL 3S1RB 1Q7YC 1EYAA 1PTOD 3AMUA 2B8GA 2XGTA 3TBIB 1QCBD 1VQGA 4DR2L 3DWPA 1LT5D 1A6XA 2R93H 4RKBA 3F2UA 3UI2A 3CCEA 3GO5A 1UNSA 5M5WH 3SE0A 3LWEA 4BY1G 3TQYA 2EOTA 2F0IA 2Q2HA 2DUDA 1EQTA 1F9PA 2F0QA 2PZUA 1I4RA 4KK7A 4AYBG 1B70B 1CQVA 3JAMi 2QKIC 1E3PA 4IQZA 4JW0A 1IYUA 3DLLA 2DNEA 3BJUA 2KHJA 3I72A 4R4IA 3CKIB 1Q1EA 1FGBD 4ME5A 2J0TD 4FYDA 1RD9D 5IYBG 1SJED 4KN7C 3RZOH 3LX0A 2I5MX 5C3EH 4WJ4A 1EZ8A 4A3GG 3R2IA 2IY5B 3PSIA 4YCUA 4QCLA 1WTOA 4GKJQ 2CCZA 2V4DA 3W1GA 5I9OA 1U4RA 1HFGA 4NDXA 3HZXA 5E7NA 2F0GA 4U673 2GVBA 1W6KA 4LFBL 4JI5L 1HR0L 2D0OA 1X54A 3PUWA 2Q8TA 1PMRA 2F03A 3Q24A 1S5BD 3PO3G 3CW2C 2PMZB 3BZCA 4BY7H 3NP8A 1HA5A 4BA1I 2FJ2A 2OQKA 4B3MQ 1TKWB 3M3YB 4GZYC 1UE1A 3CMAA 5E1FA 1FYCA 1VF7A 1EY0A 4A3IB 4S3SA 4DR6L 1ET6A 2QEXA 4K5XA 4XQJA 1KNEA 1SYGA 1KAAA 2KEDA 3V96A 2KHIA 1WOCA 4KJOA 2CH4W 3S15B 2MP1A 1ONLA 4HIOA 5C0XG 2QCPX 4ZUIA 3MXNB 2NZOA 1Q12A 3G6JB 1VQ7A 3CD6A 2EYMA 1JQYD 1PLFA 4X66L 2A1AA 1J9OA 1XMQQ 3I91A 2QW7A 1VMPA 3KJOA 1G91A 2WINB 4HCSA 1L1OA 4HJ7A 1H95A 1A3TA 1IKMA 1GXDC 3CMEA 1WD1A 3OW2A 3RLOA 2B2WC 2EY5A 1D1KA 5IYCH 1CSPA 1Q8IA 1S4ZA 1BCPF 2JN4A 3NELA 5EPJA 4PQXA 5ELEA 3T1HQ 3PO2G 3FHWA 4JC0A 4XT3B 4C56C 2IW3A 4GN3B 2VZAA 4QJFA 4IURA 4A3DH 3S2HB 4DR5L 4AQYQ 5C44G 1KDAA 3QJYA 1M4VA 1SNMA 4LFCQ 5KNBA 1EY9A 1KC8C 2XWBB 2B3GA 4KHPQ 4ABNA 3J80E 3K57A 4LF8Q 1IBLL 1VQ8A 1XPUA 4TVAB 2VQFQ 3EROA 1RCVD 2IHEA 4KN4C 4A3EB 1V1PA 2R7FA 1F9QA 1TWGB 1XNQQ 3FPPA 4RAUC 3I2ZA 2MQHA 5A35A 2CQAA 3AQQA 4XQQA 2RKSA 3ULJA 3M85A 1ASYA 1FD7D 5EKLA 3EBEA 4DV5L 2PNHA 1GVPA 4GS3A 1JORA 1VQJA 1STHA 5CORA 4I65A 2K03A 1PFMA 1Y1VH 4DGZA 4KY5A 3HKZE 5BR8Q 1C8CA 4BBSH 1HNXL 2Y0SE 1SE3A 1MSGA 1LO5D 1Q86C 5I6WA 1MJCA 4MTNA 1TVXA 5K36G 4UHVA 2N78A 3W2DA 2NYZD 2O4XA 1G8ZD 5EPLA 2UU9Q 1SMYD 4UDUC 2B29A 3MXPA 2QDBA 2RDGA 3S17B 1G291 2PZWA 1DM0B 4K6LA 3H6MA 4IPCA 4F88A 4A3EH 1E2WA 2MO1A 1F9SA 1PXUA 3I73A 1XXGA 2GN5A 3VR4A 4XT1B 5C4HA 1MKHA 4EVOA 4IUQA 5JEAJ 4DV0Q 3DEOA 2D62A 2E75C 3HOVH 2JA5B 3KF8A 4C3IB 3L7ZC 3NTIA 3E0JA 1EQQA 4TSSA 1WCMB 1ZKOA 4FO2A 4DAPA 1AW7A 2F0PA 4QQBX 1GJXA 1JOOA 4KD4A 3J81L 4FP5D 2K04A 3NPPA 1Y8PB 2E2IH 1QJOA 1N33L 1X65A 3HS0C 1QUQB 1I4PA 5BN5A 5JPMC 3TS0A 3RN5A 1BO0A 5C0XJ 2OTLA 1VQDA 3HOXB 1H9JA 2EJFC 4K14A 2PCFB 3S17H 4XXEA 2EDGA 2IX0A 2VB2X 5AJ3Q 5GAGC 4ZKCB 3E3XA 3CU7A 4TKOB 1CT1D 1SNPA 1YJWA 3A74A 5ELBA 3HKZB 1HNZL 2Y0SB 5LL6S 2BH2A 4P71A 4RA8A 4BXXH 4POFA 1EWCA 5D3DA 4L5TA 1Z7TA 1DZ1A 2ZT9C 1VQEA 1W3SA 2ZXRA 4K2KA 4LF9L 2VW9A 4QMGA 1I3QH 5LL6X 3STBC 5BN3A 2RHQB 1SNDA 5H1SE 4ILWA 2KENA 5M5XB 4LFCL 3G4SA 2JA7G 2EYJA 3CCQA 3DM1A 1XPRA 4KHPL 2F3WA 2B63H 3BDLA 4LFAQ 1JE4A 2F4VL 3HOXH 4KI0A 4ZYSA 2JA5G 1IW7C 2L11A 2K7VA 4RMFA 2Z0SA 4IN3A 3NUCA 3RNUA 3C3LA 1U5KA 1WCMG 3JC66 2V1CC 2AMCB 3T56B 1S72A 4JI4Q 5KRUA 1H9MA 1SE4A 4KY6A 5A2QE 3OSOA 1JJ2A 3H3VI 2KQ3A 2UXBQ 1BVSA 2RDHA 5FO8B 3J7ZC 2K14A 4L8JA 1NMFA 4YWKA 3F2BA 2VXWA 1XJVA 4ME3A 1IL8A 2M2LA 5IGDA 3H3VC 1WTHA 1W2BA 4HEDA 5C3XA 3KBXA 2IWHA 1J6QA 4K8IA 4LUOA 4C3HH 1PRTD 4FNFA 4MN3A 1SEBD 2IX3A 5M5XH 1K0SA 3HKZG 3ND9A 4K6DA 2Y0SG 3EA6A 3KBGA 1NY4A 1PZID 4PZ6A 4DV1L 4Y52H 2A6ED 1VQ6A 3I90A 5EKKA 2R61A 4JPBW 5CYUA 2NB0A 5I9PA 1YNNC 1C7YA 4OONA 2EY2A 3RZDB 1FJGQ 4GLAC 4F8MA 1FNUA 1PHJA 4IUVA 5CBEE 3H15A 5FKAC 4LF6Q 2R92B 1PH5A 1DOMA 2OF1A 1QOHA 4DR4L 3M4OB 5I6YA 3K6OA 5LMUL 3F2DA 4FXDA 5ELNA 5I2YA 1WD0A 1C4QA 3UDGA 3VR5A 4ZCKA 2YU9B 4B3RL 4YWMA 4JI7L 1T9HA 1SBBB 1X3PA 4R4QA 2VUMH 3NTKA 3QWNA 4OO1H 1Q8KA 2E2HH 2QF7A 1VQPA 4OGQC 3SEBA 3W3AA 3K0XA 5T1GA 1EQVA 2G9HD 4H02A 2AWNA 4DU9A 3J7AV 3S1MB 2CW0C 4IFDH 1VQ9A 3GP7A 2FMCA 4QGUA 4LF7Q 4HJ8A 4PZ8A 4GN4B 1YI2A 4B08A 3A56A 3AFPA 2IPKD 2CWAA 3A55A 2LFNA 1SN8A 1K9MC 4X64L 1JICA 4PV1C 2KA7A 3F2CA 2D2CC 3E0EA 4QIWE 3EIVA 3FDTA 5ELCA 3T51B 2ASBA 4A3CH 2WP8J 2HCIA 2AUJD 1YVCA 2NZ1D 2RHSB 2HCCA 1I4GA 3I4LA 2AQ1B 4WRDA 1WTRA 1GKHA 2JA8B 4DV4Q 4ALPA 3NWTA 3TSSA 2RF4A 4NXML 4DK6C 4GN5A 2CKZB 4BBRB 3GTMH 1RJTA 1FL0A 1SE8A 2F0UA 4C2MB 4OX9Q 1UE6A 5E4XA 2KJXA 4X3TA 1OO9B 2KOLA 5M3MB 3S1MH 1SROA 1CK1A 3SGIA 2VQEQ 1MD2D 1X3GA 3DM3A 4ID6A 3AFQA 5GQOA 5C4JB 3U50C 4DR1L 1L0WA 1WTWA 1GUGA 3I56A 1ASZA 3CC2A 4CDEC 4G7OC 3CRLC 3C2PA 1HH2P 4CDFC 1WJJA 4JOIA 4IOAA 1HZBA 1M8AA 2UUAQ 1K8AC 5LHY1 4NB3A 4KTAA 4KD3A 2AQ3B 4DNRB 4DAVA 4L5QA 1VQOA 1EWHA 1EL0A 1O78A 3I4MB 1L1OC 4OO1I 1GUOA 2B8FA 3ER0A 4R1JA 1TR5A 1K3RA 2E74C 2E8GA 4DR2Q 1QVFA 2VL6A 1CKMA 4I7ZC 1VQBA 3LNNA 1LTTD 3ZYYX 4AYBE 3AEVA 4DV7L 4IFDI 3W5OA 3MXNA 1YZ6A 1KIXA 2NWGA 3RMHA 3NXWA 4CBVA 1HPCA 1NBWA 4A3LG 2K75A 2JXMB 2F0VA 1PZJD 5IYDH 4ODGA 3GTLB 5J22A 1LT6D 2NTSA 5C4JH 2JA8G 1CKNB 1UAPA 3PIO3 4WJWA 4BBRG 1I6VC 1YNJC 4HMJA 4LFBQ 1OXSC 4JI5Q 3VA7A 1HR0Q 1EY5A 1ICWA 1JWSD 3FKIH 5M3MG 2WFWA 1II3A 2QEJC 4HIKA 4BS9A 3TP6A 3HOZH 2F0OA 2HQEA 2ZTDA 2QGQA 1GUWA 5C4XG 4P72A 3T13A 4DR6Q 3K7AH 1LTLA 2K4KA 4HJAA 3QR8A 4PZ7A 3CC7A 2CVRA 1PH4A 5FLXL 1U4MA 1V1OA 1PYBA 1EQRA 3P20A 2L1BA 3FMCA 4A3JB 1D2BA 3G6EA 4KY7A 2NZHA 2AHOB 4IUPA 3GTLH 5ISRA 1MHWC 4NP5A 4Q0FA 4BY1B 1SYFA 4N8X1 3GTQB 1RTOA 2MHVA 3JAML 3GTGH 3WOFA 1Y8OB 4A93G 3VYRA 1X56A 4AH6A 1O7IA 1B3QA 1EIFA 3FEWX 1GD7A 1SRUA 4KKTA 1C48A 4FXGC 3DEPA 3TS2A 1N34L 3HOUG 2ES2A 3G7LA 4Y7NH 1EY4A 4TRDA 1SYEA 2EYFA 1HQMC 1ENFA 4DR5Q 3PO3B 2PMZE 5EQ0A 2N8NA 3BYYB 4WFN3 2HT1A 1VQHA 4R4CA 4EQNA 2IX1A 2G9DA 4DAMA 2K33A 1CHPD 4BY1H 3K5NA 4HJ5A 1IBLQ 1A15A 1BR9A 5J1ZA 2BE5C 3MAQA 1PTOB 2LSSA 3MFYA 1S5ED 1MBYA 3ZJYC 3A5UA 1TS4A 5IWAL 2L4NA 3PIPA 1ESFA 3J81E 1B2TA 1PH3A 2A68D 1E1OA 2LS01 4A3JG 5IYBH 3M7NA 1Q82C 5CC4A 3AB9A 4YWLA 1S5CD 4HAEA 2A69C 4A3GH 1WTXA 2XTIA 1X6OA 1TT2A 1QUQA 2LXKA 4DV5Q 2E5LQ 2UXCL 3ICEA 2WAQG 3G48A 4ZK9B 1SE2A 3KLSA 1VF5C 1RDPD 4RKLA 1X3FA 4I7AA 2ALYB 4FVMA 3S9WA 3PO3H 1HNXQ 2F0MA 4X3KA 4HTHA 1UEAB 5FK9C 2A6HC 5LMNW 1CZGA 1XX8A 3PV0A 1G2TA 5EAYA 3PO2B 3GV3A 4RCNA 1S3OA 2NBFA 1DOLA 3CCMA 3S1RH 5HGQA 5C44B 4LNQA 3DWAA 3CQZB 3QOLA 5JEAG 1CFMA 1LUZA 1PA6A 2A74C 3GTOB 3N6RA 3H09A 1EEID 4RGMA 4IPHA 2BH8A 2FFKB 5M5YB 3S2DB 3L2PA 4GOPA 1HZCA 1MGSA 1R4QB 1UEBA 4RHRA 2F0LA 3OMGA 4DUYL 3KOJA 1N33Q 3MXUA 1EY6A 2XIWA 2H1EA 3PO2H 5T1IA 1NNXA 1TWCB 1Y14B 1PDQA 4JI6L 1IBKL 5C5MA 4J15A 1ESRA 1YHBA 1LT3D 1X9NA 3D6WA 1VDZA 1TWHB 3GTPB 1XMOL 3HGBA 3C1EA 3HG9A 5C44H 3A8KE 3L0OA 1HNZQ 1BOSA 4BY7G 1BCPD 1ML0D 3GTKB 2E76C 4JBWA 1PH7A 3M3YH 4H0LC 4DK3C 2KEEA 4QB4A 4NXNL 4JBKA 3N52A 5K5PA 2J7ZA 3UE0A 3GDEA 4A3IH 1ZXTA 4A3KG 4IUTA 4LF9Q 2IJ0A 2YV5A 1BNZA 4UP8A 3J80c 5DLQE 2EYPA 3S15H 4ZLTF 3X3MA 4CDDC 2ZM6L 2EYLA 3BZDB 5C3WA 5ELFA 2F4VQ 1A8VA 4LUVA 4PMCA 1PTOC 2VB3X 5C0XI 4EQ5A 4J8QA 1ILPA 5ELDA 3A54A 4DV3L 2B39A 1TWHH 2ZJPA 1PFNA 3FVQA 1YIJA 2EXZA 3QO2A 2QDLA 1GUNA 1PH6A 3Q22A 4FF2A 3STBD 1HNWL 1IYVA 3M4YA 3MZ5A 3E9IA 1O7ZA 5FJ8G 1IXRA 5K36H 3KLSX 3HOYG 2UXDL 1DOKA 5NUCA 4CKCA 1TS3A 1RIPA 3Q8DA 4DV2L 2E5LL 2B2UA 2HHHL 3K8AA 1I4QA 4MTKA 1IW7D 1K3BC 3BZKA 2NVXB 3S2HH 2OWOA 1ICFB 3D3RA 1S5FD 2D9UA 5EJWA 4FDBA 5IT9L 3MFGA 4NW2A 4O2DA 5GADC 4DV1Q 3FPUB 2RA4A 1Y8NB 2DJGC 3ND8A 2ID0A 2BCOA 3RUZA 1BBUA 3Q23A 4R8IA 3TREA 1BQQT 1TWGH 4O1NA 3PF5A 1AN8A 1AZPA 1KLUD 2JA7B 4LMQD 2Z8LA 2F0FA 1AZQA 1KRSA 3DMUA 4ZKBB 2FINB 3M4PA 1PH2A 4JOIC 2ENBA 5KNDA 1VMCA 4JVZA 4DR4Q 1PVOA 3HP3A 2N3SA 3H3VH 4ZQ3A 4YCWA 3S16B 5LMUQ 1H9SB 3BVMA 2O2LD 3NWSA 4L5RC 4B3RQ 1KL9A 1MI2A 2F0SA 2F0NA 1YNND 1Y1VG 1TXYA 5CV8A 2EXDA 2M00A 4JI7Q 3PUVA 3I3CA 5IGEA 1X32A 1CKOA 4JI0L 2KECA 3IKJA 1A2UA 2AQ2B 1WTPA 4F7XA 3Q0AA 4LF4L 1A2TA 2A73B 2YYZA 3GV6A 2NVQB 3CCJA 1SYDA 2RQXA 1R9TB 1NR4A 3HFZB 3S14B 5JJIA 2HUGA 1NR2A 1Q1BA 2XSCA 4XYOA 3TEHB 3C46A 1CA5A 4X64Q 3LWUA 4LW1A 3K5OA 2JA7H 1HR0W 3I55A 3CC4A 4QL5A 4DK1A 3QG1A 3H91A 5KGUA 2JA5H 4C3IH 5GAHC 1SXTA 2PI2A 1KABA 1WCMH 1KLGD 4R8NA 2TMPA 1STNA 1GM5A 1LYLA 1L2FA 3VR6A 2BA1A 2HDLA 4NXMQ 1H9KA 1STGA 2C35B 4KKUA 1Q3LA 1CKNA 3F1ZA 3CCSA 4A3MG 1EU3A 3I8ZA 5L37A 1EFID 3Q6SA 1PH9A 3GTJB 3MEHA 3RLFA 4GOPB 2G5DA 1RTNA 5EGTA 3S14H 1HQRD 4DR1Q 4DPGA 4QUCA 1JOQA 2Z6KC 2ZTCA 3K81C 4IJHA 2F1MA 1OXVA 2PQAB 1G6PA 2QA4A 1TY2A 2I46A 3A7AB 1QWYA 5FLXE 3J7YW 2B2YC 2B2TC 5E3FA 1VQAA 1PRTB 1NJIC 4JI3L 4DNTB 3CCLA 1DYQA 4G57A 3RD4A 4E6IA 4OIKA 2JJQA 4DV7Q 5HURA 1LLRD 1QVCA 2IHFA 5C4ZA 2K5DA 3JAME 2JA6G 3TZUA 1SJHD 3X3NA 3PF4A 2B63G 3OIQA 3E9HA 2L55A 3MTSA 4DR7L 1EWIA 1EU4A 3I70A 3HKSA 2LXJA 1DJRD 2DY7A 4B3TL 3PUZA 1TS5A 1CA6A 2WB1E 4B3SL 1BUVT 3NENA 5EPKA 1IL2A 1XTDA 3K5MA 4LWCA 4H7BA 1SFOB 2KHSA 1FNVA 1LTAD 2DNCA 3CCUA 3BVZA 3PIOA 1QZHA 4UP9A 2CQOA 4HMIA 3IAYA 1KD1C 3C1FA 4OWXB 1H9RA 2OT2A 2EY1A 2Z4IA 3I7FA 4XYQA 1STAA 4HSPA 3U4ZA 1DXMA 3NBIA 1E2ZA 5COYA 1O7YA 4C3JG 1YNJD 5KNCA 3G71A 2HDMA 1NE3A 1Q90A 1CSQA 2CHBD 4ZRZA 3CP0A 3T4AC 1EUJA 1VQMA 5JOBA 1YITA 1E7ZA 1Z9FA 3RZDH 3BDOA 3UDXA 2K5QA 4X3SA 3ITPA 1NCVA 2PI2E 2KCMA 1LT4D 2X6GA 2R92H 3HEJA 3A8JE 5EBCA 1CZWA 4K0KL 2AUKA 1GOZA 2ICEC 3M4OH 1OXTA 1SYCA 3BDCA 3A7LA 1W6JA 4PG3A 3E6ZX 3NK9A 5D14A 1EOTA 4GKKL 2YU9H 1HHVA 1TQOA 3P75A 3VA5A 1V8QA 1X55A 1UE7A 2K01A 2BA0A 1N34Q 4MZ9A 1VQLA 1DGSA 1BF4A 2XWJB 1JT8A 1KDBA 2WB1B 1FNWA 1XNRL 1F2YA 4BA2I 3I4NB 2I5HA 5F2DA 2XRQD 1TWAB 4GOPC 4RWSC 1BBWA 3B6YA 2OEOA 1KXLA 3SVMA 5C4XB 1WYDA 3TDQA 3OWEB 1MSHA 5IP9H 4JBJA 4YHHL 2EZVA 2K5HA 3HOWG 4FF4A 3S1NB 2O5JC 4RFBA 4A3CG 2WV6D 4NKLA
chains in the Genus database with same CATH topology
1K8OA 2PZTA 5IGCA 1D5MC 5I4DA 5CV6A 4EGVA 4KMUC 3SK8A 1SYBA 1PRTC 4F87A 1R4PB 3KK7A 1CI3M 2JSOA 1LTRD 4XIGS 5CV7A 1NUCA 3MC0B 2BDOA 1HRJA 1ZYRC 2BE5D 2PW5A 4A93B 3DWQA 1GHKA 2IL8A 5IIFA 4KHVA 1B44D 1EIHA 2M9VA 1KTKA 4KHZA 1AP0A 3OIPA 5DM63 1WTQA 3KLRA 4IUUA 3HOUB 1I4XA 2SNMA 5M3FB 3OMCA 1RODA 5G3LF 1HTPA 1I50B 4RHSA 4FF3A 4IZ8A 2F0HA 2EY6A 5JJZA 1BBXC 1E2VA 1O80A 5KEEA 1RF2D 2LY7A 1LACA 2B2UC 2F0TA 1G2SA 1KDCA 2VNUD 4M1UB 1CQFA 4DXFA 1B4OA 4DN4M 2RBMA 2WAQB 2B2YA 1CHQD 2NN6G 2B2TA 1L0XB 1B50A 3NTHA 5IT9E 4ULLA 1ILQA 5JAVA 2MUYA 4IFDJ 1QB5D 3L9AX 1D5XC 5M5WB 1TU2B 4PNYA 1RKNA 1V43A 1I4HA 1TIID 2F0JA 2ZXPA 3PUXA 3EFXD 1H9SA 3H94A 1ZEQX 3QIAA 3SR1A 1HA6A 4J6HA 3QOJA 3IL8A 3RZOB 3TP8A 2XN9C 4G4KA 2L0CA 1G6ZA 4QF4A 4PMWA 3U9SA 2H4OA 1D1IA 3HRZC 2TSSA 3O13A 4IALA 1PTOF 3NQIA 5JEAH 4MIUA 4BY7B 1WTVA 1JOKA 4CGYB 3PUYA 4DXGA 3GD7A 5FO7B 4A3KB 1PTOH 4RH6A 5CV9A 1U4LA 2F0DA 5DEHA 1UUPA 5C0XH 1SNCA 2K05A 3TZDA 5I2XA 4QUFA 1IKLA 2JE6I 1QILA 1B1ZA 1BXTA 2L5TA 4H13C 5IGFA 5DNFA 4X3UA 1S5DD 1JR0D 2WKCA 5FO9B 2EJMA 1JWUD 3R8BA 4C1NK 3HOYB 1VCIA 3K0YA 5J39A 2Z4HA 1CTMA 2BDNA 1PZKD 4XDXA 1O7LA 4A3DB 4DK0A 2KCCA 1BCPB 3R2TA 1NAPA 2LMCB 1SNOA 3DXJC 3IFDA 1GUSA 2N88A 1QE6A 3OWFA 5KYLA 5IODA 1ET9A 3TP7A 2F0WA 2I07B 4G7HC 1ENCA 2SNSA 2GA4B 3P7JA 1F2ZA 1LABA 2DN8A 3VR3A 2C9OA 1LTSD 1HFNA 3EJIA 4UAIA 2NUCA 4EQOA 1RHPA 3WOEA 3MWYW 1SDFA 2O5IC 3A8IE 3S1QB 1JC7A 3TMEA 2SDFA 1SNQA 3J7AF 1FR3A 2EYOA 3MHBA 2A68C 5D3IB 4BBSB 1Y1VB 2R6GA 2EJGC 1QG7A 3PIP3 3VYSA 5E4WC 4Q5VA 3T53B 1Y69U 1D5ZC 4R9WA 3NE5B 3OOCA 2Q8RE 4B9XA 5JVH3 4ZUJA 3BG3A 4G7ZC 3HOVB 2RSOA 1XTCD 1E0BA 1QNKA 2FMMA 1Z47A 2QILA 5HGTA 5CV4A 3DHQA 2E2IB 3OHXC 4XTCS 3VR2A 2AWOA 5EKIA 3D31A 2F0KA 4A3MB 2MGSA 2SEBD 2NVYB 4JK1C 4MHEA 1HTLD 3BVGA 2JEBI 2C5CA 3GQBA 1EY7A 3AU7A 3KUPA 2RVLA 3FRPB 1F2LA 4LK1C 4EQPA 2NVTB 4KJNA 4O42A 1GHJA 1STBA 4IUNA 1STEA 1I3QB 2B2VC 2L9HA 1BCPC 4LAAA 4WORA 2K6AA 2EE1A 3ERQA 2JA6B 4DAYA 4N9PA 1WVLA 2B63B 2FHTA 3SK6A 3R3OA 4H44C 1Z6HA 2CW0D 3NQTA 1EZ6A 4U68A 2R3ZA 5IGBA 1B9MA 1B9NA 3V2TA 1BDOA 2N55A 2E2JB 5EBDA 1D6EC 3P1HA 4Z9CB 2J4XA 4C3HB 1X3QA 1F2MA 3QB3A 3V05A 3D4WA 5BN4A 3D4RA 2XNAC 4C3JB 3D8GA 2XVSA 4C3IG 4RGOS 4DFAA 1U4PA 3R93A 5AFWA 4V190 1K83B 4FXKC 4OHJA 2K28A 1TWFB 5KYIA 1SMYC 4C1NI 2MPMA 1CM9A 3MA2B 2Z1CA 4YIJA 1A3UA 1A3VA 4RGTA 4K5VA 2VUMB 1PRTF 1PYWD 1LTID 2E2HB 4HSVA 3NBHA 1T5EA 1QNUA 3SK4A 4N9TA 1ZYRD 3K5LA 5CR3A 4V0BA 3MVVA 4CKEA 1DD2A 3VYUA 2A5HA 2E2DC 1AFPA 2B2WA 4C3HG 3HOWB 2L12A 5M9OA 2PQEA 3ONAB 3K58A 3J80L 2RSNA 2WACA 1TS2A 1V1PB 4J1MA 1DCZA 3EQLC 1EEFD 3E5SA 3SXHA 2D5DA 1GUTA 1NSNS 3SDZA 5CGKA 3GTMB 1HXYD 4L63B 2SOBA 2IT1A 4FF1A 3NHHA 1OXXK 2ICIA 5CMDA 4BWGB 3BS1A 1XWEA 4OO1G 3OW7A 5FOBB 4RGNA 3IFTA 3L3OC 4IFDG 1HUNA 3MXGA 5C5LA 2WIIB 3D6CA 3PMFA 3URYA 2EPBA 2WKDA 1DONA 1SSOA 1Y1WB 4OIJA 3K59A 1SAPA 4CJ2C 2K5WA 2OXPA 1PFBA 4M8AA 3D4DA 2A6EC 4HR7B 3T16A 3FKIB 1IHZA 4K2LA 2KUMA 2B2VA 3CHBD 2PNRC 3HOZB 3H0GB 1I6HB 1B53A 1JCKB 3OPOA 1HUMA 3TN2A 4L6TB 2JEAI 2JYOA 2A69D 2RDFA 2K1BA 3K7AB 3WDNA 4QIWB 5G3LD 1T5XD 5TSSA 1F77A 1STYA 2KCNA 3M7GA 4NMZA 1EY8A 4A3FB 2LKVA 5IGGA 5KIXA 1AEXA 1TY0A 2X6LA 2F4IA 2A6HD 5DAUA 2PW7A 4CJ1B 2PPBC 1L0YB 3GTGB 3VYTA 2R7ZB 2NN6H 4K8JA 2K32A 4B9WA 1F9RA 1LTGD 3NSWA 5DM73 1J8IA 1EYDA 2DY8A 4PMBA 2X69A 5C6AA 1KNAA 2F3VA 4XQNA 4CJ0B 4A3BB 1ENAA 4LJZC 5JVG3 1EYCA 2MJ8A 1U9RA 5A2QL 5CV5A 3U9OA 5CBAE 4KKSA 4Y7NB 4TQUS 2NTTA 3SK5A 4KV6A 1EIGA 2KVMA 3CRKC 5IOCA 4DA2A 2PYKA 4P2CB 1HCZA 2EVBA 3SHLA 1OXUA 2EYHA 4AYBB 4DF7A 2F0EA 4HN7A 2BOSA 1LV9A 1XYIA 3DUZA 1JB3A 2R93B 2XRSD 1K8MA 4CHTB 5JPNC 4OL7A 3BYTB 4A3GB 3EVQA 2Q8IB 2ZXOA 4K5WA 3TP5A 4HCEA 1LTBD 4CKBA 4ZAIA 1JWMD 5D65A 2NN6I 5C3EB 4RCOA 2PO4A 2JP1A 1B3AA 3S1RB 1EYAA 1PTOD 3AMUA 2B8GA 3TBIB 1QCBD 3DWPA 1LT5D 1A6XA 4RKBA 3F2UA 3UI2A 3GO5A 1UNSA 3SE0A 3LWEA 2EOTA 2F0IA 2F0QA 1EQTA 1F9PA 2PZUA 4KK7A 1I4RA 1CQVA 2QKIC 4IQZA 1IYUA 2DNEA 3I72A 3CKIB 1Q1EA 1FGBD 4ME5A 2J0TD 4FYDA 1RD9D 1SJED 4KN7C 3LX0A 1EZ8A 3R2IA 4QCLA 1WTOA 2V4DA 5I9OA 1U4RA 1HFGA 4NDXA 3HZXA 4U673 2F0GA 1W6KA 3PUWA 2Q8TA 1PMRA 2F03A 3Q24A 1S5BD 2PMZB 3NP8A 1HA5A 4BA1I 2FJ2A 1TKWB 3M3YB 4GZYC 5E1FA 1FYCA 1VF7A 1EY0A 4A3IB 4S3SA 1ET6A 4K5XA 4XQJA 1KNEA 1SYGA 1KAAA 2KEDA 3V96A 4KJOA 3S15B 2MP1A 1ONLA 5C0XG 2QCPX 4ZUIA 1Q12A 3G6JB 2EYMA 1JQYD 1PLFA 1J9OA 3I91A 1VMPA 1G91A 2WINB 4HCSA 1A3TA 1IKMA 1GXDC 1WD1A 2B2WC 2EY5A 1D1KA 1Q8IA 1S4ZA 1BCPF 5EPJA 4PQXA 5ELEA 4XT3B 4C56C 2IW3A 4IURA 3S2HB 1KDAA 3QJYA 1M4VA 1SNMA 5KNBA 1EY9A 2XWBB 4ABNA 3J80E 3K57A 3EROA 1RCVD 4A3EB 4KN4C 1V1PA 1F9QA 1TWGB 3FPPA 4RAUC 5A35A 2CQAA 4XQQA 2RKSA 3M85A 1FD7D 5EKLA 1JORA 1STHA 5CORA 4I65A 2K03A 1PFMA 4DGZA 1C8CA 4KY5A 1SE3A 1MSGA 1LO5D 5I6WA 1TVXA 5K36G 3W2DA 2NYZD 2O4XA 1G8ZD 5EPLA 1SMYD 4UDUC 3MXPA 2QDBA 2RDGA 3S17B 1G291 2PZWA 1DM0B 4K6LA 3H6MA 4F88A 1E2WA 1F9SA 1PXUA 3I73A 1XXGA 3VR4A 4XT1B 5C4HA 4EVOA 4IUQA 5JEAJ 3DEOA 2D62A 2E75C 2JA5B 3KF8A 4C3IB 3L7ZC 3NTIA 3E0JA 4TSSA 1WCMB 1ZKOA 4FO2A 4DAPA 1AW7A 2F0PA 1GJXA 1JOOA 4KD4A 3J81L 4FP5D 2K04A 3NPPA 1Y8PB 1QJOA 3HS0C 1I4PA 5BN5A 5JPMC 1BO0A 5C0XJ 3HOXB 1H9JA 2EJFC 4K14A 2PCFB 4XXEA 2EDGA 2IX0A 2VB2X 4ZKCB 3CU7A 4TKOB 1CT1D 1SNPA 5ELBA 3HKZB 2Y0SB 5LL6S 4RA8A 1EWCA 5D3DA 1Z7TA 1DZ1A 2ZT9C 2ZXRA 4K2KA 4QMGA 5LL6X 5BN3A 1SNDA 4ILWA 5M5XB 2EYJA 3DM1A 2F3WA 3BDLA 1JE4A 4KI0A 4ZYSA 1IW7C 2L11A 2K7VA 4IN3A 3NUCA 3C3LA 3T56B 5KRUA 1H9MA 1SE4A 4KY6A 5A2QE 3OSOA 2KQ3A 2RDHA 5FO8B 4L8JA 2VXWA 1IL8A 2M2LA 5IGDA 3H3VC 4HEDA 5C3XA 3KBXA 2IWHA 4K8IA 1PRTD 4FNFA 4MN3A 1SEBD 2IX3A 3ND9A 4K6DA 3EA6A 3KBGA 1PZID 2A6ED 3I90A 5EKKA 2R61A 5CYUA 2NB0A 5I9PA 1YNNC 2EY2A 3RZDB 4F8MA 1FNUA 4IUVA 5CBEE 5FKAC 2R92B 1DOMA 2OF1A 1QOHA 3M4OB 5I6YA 3K6OA 4FXDA 5I2YA 1WD0A 1C4QA 2YU9B 3VR5A 1SBBB 1X3PA 3NTKA 3QWNA 4OO1H 2QF7A 4OGQC 3SEBA 3W3AA 5T1GA 1EQVA 2G9HD 4DU9A 2AWNA 3J7AV 3S1MB 2CW0C 4IFDH 3GP7A 2FMCA 4B08A 3A56A 2IPKD 3A55A 2LFNA 1JICA 4PV1C 2KA7A 2D2CC 5ELCA 3T51B 3FDTA 2WP8J 2HCIA 2AUJD 2NZ1D 2HCCA 1I4GA 3I4LA 2AQ1B 4WRDA 1WTRA 2JA8B 3NWTA 3TSSA 4BBRB 1RJTA 2F0UA 4C2MB 5E4XA 2KJXA 4X3TA 1OO9B 2KOLA 5M3MB 1CK1A 1MD2D 4ID6A 5C4JB 1WTWA 1GUGA 4G7OC 3CRLC 3C2PA 1M8AA 5LHY1 4KTAA 4KD3A 2AQ3B 4DNRB 4DAVA 1EWHA 1EL0A 1O78A 3I4MB 4OO1I 1GUOA 2B8FA 1TR5A 2E74C 4I7ZC 3LNNA 1LTTD 3ZYYX 4IFDI 3MXNA 2NWGA 3RMHA 3NXWA 4CBVA 1HPCA 2JXMB 2F0VA 1PZJD 4ODGA 3GTLB 5J22A 1LT6D 2NTSA 1UAPA 3PIO3 4WJWA 1I6VC 1YNJC 4HMJA 1OXSC 3VA7A 1EY5A 1ICWA 1JWSD 1II3A 2QEJC 4BS9A 3TP6A 2F0OA 2HQEA 1GUWA 3T13A 2CVRA 5FLXL 1U4MA 1V1OA 3P20A 2L1BA 3FMCA 4A3JB 1D2BA 4KY7A 4IUPA 5ISRA 4NP5A 4Q0FA 4BY1B 1SYFA 3GTQB 1RTOA 2MHVA 3JAML 3WOFA 1Y8OB 3VYRA 3FEWX 4KKTA 1C48A 4FXGC 3DEPA 3G7LA 1EY4A 4TRDA 1SYEA 2EYFA 1HQMC 1ENFA 3PO3B 5EQ0A 3BYYB 4WFN3 4EQNA 2IX1A 2G9DA 2K33A 1CHPD 3K5NA 1A15A 1BR9A 5J1ZA 2BE5C 3MAQA 1PTOB 3MFYA 1S5ED 1MBYA 1TS4A 2L4NA 1ESFA 3J81E 1B2TA 2A68D 2LS01 3M7NA 5CC4A 3AB9A 1S5CD 4HAEA 2A69C 1WTXA 1TT2A 4ZK9B 1SE2A 3KLSA 1VF5C 1RDPD 4RKLA 4FVMA 3S9WA 2F0MA 4X3KA 4HTHA 1UEAB 5FK9C 2A6HC 1CZGA 1XX8A 3PV0A 1G2TA 3PO2B 3GV3A 4RCNA 2NBFA 1DOLA 5C44B 3DWAA 3CQZB 3QOLA 5JEAG 1CFMA 2A74C 3GTOB 3N6RA 3H09A 1EEID 4RGMA 2FFKB 5M5YB 3S2DB 1MGSA 1R4QB 4RHRA 2F0LA 3OMGA 3MXUA 1EY6A 2XIWA 2H1EA 5T1IA 1TWCB 1PDQA 5C5MA 1ESRA 1LT3D 3D6WA 1VDZA 1TWHB 3GTPB 3HGBA 3C1EA 3HG9A 3A8KE 1BOSA 1BCPD 1ML0D 3GTKB 2E76C 4JBWA 4H0LC 2KEEA 4QB4A 3N52A 5K5PA 2J7ZA 1ZXTA 4IUTA 2IJ0A 1BNZA 2EYPA 4ZLTF 3X3MA 2EYLA 3BZDB 5C3WA 5ELFA 4PMCA 1PTOC 2VB3X 5C0XI 1ILPA 4J8QA 5ELDA 3A54A 2B39A 1PFNA 3FVQA 2EXZA 3QO2A 1GUNA 3Q22A 4FF2A 1IYVA 3M4YA 3MZ5A 1O7ZA 5K36H 3KLSX 1DOKA 5NUCA 4CKCA 1TS3A 2B2UA 1I4QA 1IW7D 2NVXB 3D3RA 1S5FD 2D9UA 5EJWA 5IT9L 3MFGA 4NW2A 3FPUB 2RA4A 1Y8NB 3ND8A 2ID0A 2BCOA 3RUZA 3Q23A 4R8IA 1BQQT 4O1NA 1AN8A 1AZPA 1KLUD 2JA7B 4LMQD 2Z8LA 2F0FA 1AZQA 3DMUA 4ZKBB 2FINB 2ENBA 5KNDA 1VMCA 3HP3A 4ZQ3A 3S16B 1H9SB 3BVMA 2O2LD 3NWSA 1MI2A 2F0SA 2F0NA 1YNND 5CV8A 2M00A 3PUVA 3I3CA 5IGEA 1X32A 2KECA 3IKJA 1A2UA 2AQ2B 1WTPA 4F7XA 3Q0AA 1A2TA 2A73B 2YYZA 3GV6A 2NVQB 1SYDA 2RQXA 1R9TB 1NR4A 3S14B 2HUGA 1NR2A 1Q1BA 2XSCA 4XYOA 3C46A 1CA5A 3LWUA 3K5OA 4DK1A 3QG1A 3H91A 5KGUA 1SXTA 1KABA 4R8NA 1KLGD 2TMPA 1STNA 3VR6A 2BA1A 2HDLA 1H9KA 1STGA 4KKUA 1Q3LA 1EU3A 3I8ZA 1EFID 3Q6SA 3GTJB 3MEHA 3RLFA 1RTNA 5EGTA 1HQRD 4QUCA 1JOQA 2F1MA 1OXVA 1TY2A 2I46A 3A7AB 1QWYA 5FLXE 3J7YW 2B2YC 2B2TC 5E3FA 1PRTB 4DNTB 1DYQA 4G57A 3RD4A 4E6IA 4OIKA 5HURA 1LLRD 5C4ZA 2K5DA 3JAME 3TZUA 1SJHD 3X3NA 3OIQA 2L55A 3MTSA 1EU4A 3I70A 1DJRD 2DY7A 3PUZA 1TS5A 1CA6A 1BUVT 5EPKA 3K5MA 4H7BA 1SFOB 2KHSA 1FNVA 1LTAD 2DNCA 3BVZA 4HMIA 3IAYA 3C1FA 1H9RA 2OT2A 2EY1A 2Z4IA 4XYQA 1STAA 4HSPA 1DXMA 3NBIA 1E2ZA 5COYA 1O7YA 4C3JG 1YNJD 5KNCA 2HDMA 1Q90A 2CHBD 4ZRZA 3T4AC 5JOBA 3BDOA 2K5QA 4X3SA 3ITPA 1NCVA 1LT4D 2X6GA 3HEJA 3A8JE 5EBCA 1CZWA 2AUKA 1GOZA 2ICEC 1OXTA 1SYCA 3BDCA 3A7LA 1W6JA 3E6ZX 3NK9A 5D14A 1EOTA 1HHVA 1TQOA 3P75A 3VA5A 1V8QA 2K01A 2BA0A 1BF4A 2XWJB 1KDBA 2WB1B 1FNWA 1F2YA 4BA2I 3I4NB 5F2DA 2XRQD 1TWAB 4RWSC 2OEOA 3SVMA 5C4XB 3TDQA 3OWEB 1MSHA 2EZVA 4FF4A 3S1NB 2O5JC 4RFBA 2WV6D 4NKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV8 A;  2M00 A;  2PZT A;  5IGC A;  1ENA A;  2F0V A;  4QB4 A;  1EYC A;  5CV6 A;  3ERO A;  5K5P A;  5IGE A;  4ODG A;  1U9R A;  4DFA A;  4ME5 A;  5CV4 A;  5CV5 A;  3DHQ A;  3U9O A;  5HGT A;  3SK8 A;  5J22 A;  1SYB A;  1A2U A;  5JAV A;  5J39 A;  4F7X A;  3LX0 A;  1EZ8 A;  4K2K A;  1EQV A;  1A2T A;  5CC4 A;  2F0K A;  5CV7 A;  3SK5 A;  4KV6 A;  1NUC A;  4QMG A;  4DU9 A;  1SYD A;  5C5L A;  4HMJ A;  2RKS A;  3D6C A;  5I9O A;  1SND A;  4NDX A;  2EYP A;  3HZX A;  3PMF A;  2F0G A;  4H7B A;  5EKL A;  1TT2 A;  5KYI A;  2KHS A;  5IOC A;  1EY5 A;  2EYL A;  2PYK A;  1SNO A;  2EYJ A;  5C3W A;  2PW5 A;  1II3 A;  3SHL A;  1JOR A;  2F3W A;  3OWF A;  3BDL A;  4PNY A;  1RKN A;  3TP6 A;  4HMI A;  5KYL A;  3NP8 A;  4PMC A;  1STH A;  4RKL A;  5IOD A;  2F0J A;  2F0O A;  2EYH A;  2HQE A;  3C1F A;  2F0W A;  4I65 A;  3TP7 A;  5IIF A;  4KHV A;  4YIJ A;  3S9W A;  2EY1 A;  4DGZ A;  1A3U A;  1A3V A;  1STA A;  2F0M A;  4KY5 A;  5J1Z A;  1ENC A;  5E1F A;  2SNS A;  1EY7 A;  3NUC A;  4K5V A;  4DF7 A;  5KGU A;  4HTH A;  2F0E A;  2EXZ A;  3T13 A;  1EY0 A;  5I6W A;  1F2Z A;  4EQP A;  3SR1 A;  2OXP A;  4S3S A;  5KRU A;  4J6H A;  3QOJ A;  4KJN A;  3MZ5 A;  1KAB A;  4KY6 A;  4R8N A;  3TP8 A;  3OSO A;  1STN A;  4K5X A;  2SNM A;  4WRD A;  2O4X A;  2KQ3 A;  3OMC A;  3SK4 A;  1SYG A;  1KAA A;  1STB A;  4IUN A;  4N9T A;  5M9O A;  5CR3 A;  3MXP A;  3EJI A;  2QDB A;  4QF4 A;  4OL7 A;  1STG A;  5NUC A;  3MVV A;  2NUC A;  2PZW A;  4EQO A;  5JOB A;  3D4D A;  4KY7 A;  3H6M A;  4KJO A;  4LAA A;  3EVQ A;  5ISR A;  4WOR A;  5IGD A;  3T16 A;  4IZ8 A;  2F0U A;  4NP5 A;  3QOL A;  2F0H A;  3ERQ A;  4IAL A;  4ZUI A;  1SYF A;  4K5W A;  5C3X A;  3TME A;  1IHZ A;  2EY6 A;  4N9P A;  1SNQ A;  4K2L A;  3ITP A;  3TP5 A;  4K8I A;  3MEH A;  2EYM A;  4MIU A;  2PQE A;  4EVO A;  5C4H A;  2EYO A;  5KEE A;  3MHB A;  3SK6 A;  3R3O A;  1JOK A;  5EGT A;  3HEJ A;  4ID6 A;  2F3V A;  1JOQ A;  2WAC A;  2F0T A;  4K6D A;  2RDF A;  1A3T A;  1KDC A;  1SYC A;  3BDC A;  3NQT A;  3NK9 A;  2EY5 A;  4J1M A;  1EZ6 A;  1TQO A;  3P75 A;  2F0L A;  3OMG A;  3RUZ A;  3VA5 A;  2F0P A;  1JOO A;  4KD4 A;  3E5S A;  5EKK A;  4KTA A;  4KD3 A;  1STY A;  4NMZ A;  3SXH A;  5CV9 A;  5IGB A;  1NSN S;  1EY8 A;  5I9P A;  1EYA A;  1KDB A;  1EY6 A;  5CGK A;  2F0D A;  2LKV A;  5DEH A;  5E3F A;  2EY2 A;  3V2T A;  1EY4 A;  1TR5 A;  1SYE A;  4TRD A;  1SNC A;  1F2Y A;  1AEX A;  2EYF A;  2RBM A;  5IGG A;  5KIX A;  2F0F A;  4F8M A;  5F2D A;  3DMU A;  2SOB A;  4B9X A;  3P1H A;  4G57 A;  4E6I A;  5C5M A;  5DAU A;  2PW7 A;  4RKB A;  4K14 A;  4ZUJ A;  1KDA A;  2OEO A;  2ENB A;  5HUR A;  1F2M A;  3C1E A;  3NHH A;  1SNM A;  3QB3 A;  4EQN A;  5C4Z A;  2F0I A;  1EY9 A;  2OF1 A;  4K8J A;  4ZQ3 A;  4B9W A;  5IGF A;  2F0Q A;  1SNP A;  2PZU A;  3D4W A;  1EYD A;  4PMB A;  3NXW A;  5I6Y A;  5C6A A;  2F0N A;  2F0S A;  3D8G A;  4NKL A; 
#chains in the Genus database with same CATH topology
 1K8O A;  2PZT A;  5IGC A;  1D5M C;  3J80 i;  5I4D A;  5CV6 A;  4JI1 L;  4EGV A;  5IWA Q;  5LMN L;  4A3L H;  4UY8 C;  4KMU C;  3SK8 A;  1SYB A;  4APV A;  1PRT C;  4F87 A;  1R4P B;  3KK7 A;  1PV4 A;  1CI3 M;  2JSO A;  1LTR D;  4XIG S;  2JA8 H;  5CV7 A;  1NUC A;  3RN2 A;  3ULP A;  4DAY B;  3MC0 B;  2BDO A;  4BBR H;  2WAQ E;  1HRJ A;  2UXC Q;  1ZYR C;  1C0A A;  4C2M H;  2BE5 D;  1UE5 A;  2PW5 A;  1QVG A;  4JYA L;  4A93 B;  3DWQ A;  1GHK A;  3FP9 A;  5M3M H;  2IL8 A;  3CPF A;  5IIF A;  1Q81 C;  4KHV A;  1B44 D;  2CFM A;  1EIH A;  2M9V A;  1KTK A;  1A0I A;  4KHZ A;  1AP0 A;  3OIP A;  5DM6 3;  1WTQ A;  5C4X H;  3KLR A;  1SMX A;  1P16 A;  4IUU A;  3HOU B;  1I4X A;  2K50 A;  2SNM A;  5M3F B;  3OMC A;  4JI8 L;  2WB1 G;  3KDF B;  1ROD A;  2HQL A;  2P5Z X;  5G3L F;  2OCE A;  1HTP A;  1I50 B;  3I4N G;  3EN2 A;  3I4M H;  4RHS A;  4FF3 A;  4YCV A;  4IZ8 A;  2F0H A;  1B7Y B;  2EY6 A;  5JJZ A;  1J5E L;  1BBX C;  1E2V A;  4GLV B;  2EIF A;  3CF5 A;  1O80 A;  5KEE A;  1RF2 D;  2LY7 A;  1EOV A;  4DNI A;  1LAC A;  2I0Q A;  2B2U C;  2F0T A;  4DV6 L;  1G2S A;  1Y1W G;  1KDC A;  1KRT A;  4GNX B;  4A93 H;  2VNU D;  4DUY Q;  4M1U B;  1CQF A;  4DXF A;  2VS1 A;  4OWW B;  1B4O A;  4DN4 M;  2Z6K A;  4P73 A;  3HOU H;  4JI6 Q;  2RBM A;  3CAM A;  3PCO B;  1IBK Q;  3W1B A;  2WAQ B;  3J81 j;  2L15 A;  3WWV A;  2B2Y A;  1CHQ D;  2NN6 G;  1XMO Q;  2B2T A;  1L0X B;  3OTO L;  1B50 A;  3NTH A;  5IT9 E;  3H0G G;  2FXQ A;  5IP7 G;  5FLM G;  1IYJ B;  1V9P A;  3NBH B;  4NXN Q;  4ULL A;  1A62 A;  1WI5 A;  1ILQ A;  5M3F G;  5JAV A;  1N36 L;  2JK8 A;  1VQ5 A;  3U58 A;  4LF5 L;  4JG2 A;  4A3J H;  2MUY A;  4IFD J;  3D0F A;  4A3F G;  3A0J A;  1QB5 D;  3L9A X;  1D5X C;  2ZM6 Q;  4DR3 L;  5M5W B;  4YY3 L;  3NEM A;  1OTC A;  1TU2 B;  3GTQ H;  5J3B A;  2A8V A;  1UWV A;  4PNY A;  1RKN A;  3J81 c;  1NMG A;  1V43 A;  3KYH C;  1I4H A;  1TII D;  2F0J A;  2UUB L;  2R7Z G;  2ZXP A;  4DV3 Q;  5ELO A;  3PUX A;  3EFX D;  1H9S A;  3H94 A;  1HNW Q;  1ZEQ X;  1MJE A;  3QIA A;  3SR1 A;  1HA6 A;  4J6H A;  3QOJ A;  3IL8 A;  3RZO B;  3TP8 A;  2XN9 C;  4A3B G;  2Z9H A;  2UXD Q;  4G4K A;  1IBM L;  2L0C A;  1G6Z A;  4QF4 A;  4PMW A;  4DV2 Q;  2HHH Q;  3U9S A;  3RLN A;  3K7U C;  1BKB A;  2H4O A;  1D1I A;  3HRZ C;  2TSS A;  3O13 A;  4IAL A;  1HZ9 A;  1PTO F;  2DGY A;  3NQI A;  5JEA H;  4MIU A;  4BY7 B;  5IY0 A;  1WTV A;  1JOK A;  1E22 A;  2K52 A;  4CGY B;  1HJP A;  3PUY A;  4DXG A;  2UUC Q;  3GD7 A;  5FO7 B;  4A3K B;  1PTO H;  4RH6 A;  1EYG A;  5CV9 A;  1U4L A;  1VQN A;  4X65 L;  2F0D A;  5DEH A;  1UUP A;  2YTV A;  5C0X H;  1SNC A;  2R93 G;  1G51 A;  4P74 A;  1N32 Q;  2K05 A;  3TZD A;  4OWT B;  5I2X A;  4QUF A;  2MO0 A;  1IKL A;  2JE6 I;  1QIL A;  1B1Z A;  1BXT A;  2L5T A;  4DUZ L;  4H13 C;  5IGF A;  5DNF A;  4X3U A;  4GNX C;  1S5D D;  1JR0 D;  2WKC A;  5FO9 B;  2EJM A;  4JI0 Q;  1JWU D;  3R8B A;  2I5L X;  4C1N K;  3HOY B;  1VCI A;  5C3E G;  3K0Y A;  5J39 A;  4LF4 Q;  1I94 L;  2PQA A;  2Z4H A;  4A4I A;  1CTM A;  4A3K H;  2BDN A;  1PZK D;  4XDX A;  1IZ6 A;  1O7L A;  4A3D B;  4DK0 A;  2KCC A;  1N9W A;  1BCP B;  3R2T A;  1NAP A;  2LMC B;  1SNO A;  3CQZ H;  3DXJ C;  3IFD A;  1GUS A;  2N88 A;  1QE6 A;  1YHQ A;  3OWF A;  5KYL A;  3GTO H;  5IOD A;  1VQK A;  1ET9 A;  1I5F A;  3TP7 A;  2F0W A;  2I07 B;  4G7H C;  1ENC A;  2SNS A;  2DJF C;  2GA4 B;  4JV5 L;  4X62 L;  3P7J A;  5M5Y H;  1F2Z A;  1LAB A;  3S2D H;  4UP7 A;  2DN8 A;  1PFS A;  3VR3 A;  4HJ9 A;  3RR5 A;  1N8R C;  2C9O A;  1LTS D;  1HFN A;  2MNA A;  2ZTE A;  3EJI A;  5FJ8 H;  4UAI A;  4A76 A;  2NUC A;  4EQO A;  1RHP A;  3WOE A;  3HOY H;  3MWY W;  1SDF A;  2O5I C;  3A8I E;  1TWC H;  3S1Q B;  1JC7 A;  3TME A;  2SDF A;  3T1Y L;  1RL2 A;  1SNQ A;  3OYY A;  2CH4 A;  2YTX A;  3J7A F;  1FR3 A;  2EYO A;  3MHB A;  2A68 C;  5D3I B;  3GTP H;  2Z6B A;  1Y1V B;  2R6G A;  4BBS B;  2EJG C;  1QG7 A;  4HIM A;  4JI2 L;  5IYC G;  1VQF A;  1PH1 A;  3PIP 3;  3GTK H;  2HIV A;  3AYH B;  3VYS A;  1YNX A;  5E4W C;  1QZG A;  4Q5V A;  1M1K C;  3T53 B;  4A3I G;  1Y69 U;  4LUZ A;  1D5Z C;  4R9W A;  4L5S A;  3NE5 B;  3OOC A;  2K5N A;  2Q8R E;  4JI3 Q;  4A3D G;  4DKA C;  4B9X A;  5JVH 3;  3PGZ A;  1VQC A;  4ZUJ A;  1YBY A;  3UDF A;  3BG3 A;  4G7Z C;  3HOV B;  4NPS A;  3S1Q H;  2UUC L;  1XPO A;  4DR7 Q;  2RSO A;  1XTC D;  2AKW B;  1E0B A;  4B3T Q;  1JE5 A;  1QNK A;  2FMM A;  1Z47 A;  2QIL A;  5CV4 A;  2RCN A;  3DHQ A;  5HGT A;  2E2I B;  3OHX C;  4XTC S;  3VR2 A;  4B3S Q;  2AWO A;  5EKI A;  3D31 A;  1Q46 A;  1N32 L;  2F0K A;  4A3M B;  1NTG A;  1D8L A;  4GKJ L;  3MEF A;  2MGS A;  2SEB D;  2NVY B;  4JK1 C;  4MHE A;  1VQI A;  2NVX H;  1HTL D;  3BVG A;  4BBS G;  1LM0 A;  2JEB I;  2C5C A;  3U4V A;  4JBM A;  4B3M L;  5JJK A;  3GQB A;  1EY7 A;  3AU7 A;  3KUP A;  2RVL A;  3FRP B;  1F2L A;  1SR3 A;  4LK1 C;  4EQP A;  2NVT B;  1KQS A;  1HZA A;  4KJN A;  4O42 A;  4OEM B;  1U0L A;  1GHJ A;  1STB A;  4IUN A;  1STE A;  5HY6 A;  4A3E G;  1I3Q B;  2ATW A;  2B2V C;  2L9H A;  1BCP C;  4LAA A;  4WOR A;  2K6A A;  2EE1 A;  1K8G A;  3ERQ A;  1PH8 A;  2JA6 B;  4DAY A;  4N9P A;  1WVL A;  2B63 B;  2FHT A;  1CUK A;  4A3M H;  3HOV G;  4IO9 A;  1V1Q A;  3SK6 A;  3R3O A;  4K0K Q;  4H44 C;  2NVY H;  1XMQ L;  1JJC B;  1VS0 A;  3S16 H;  1Z6H A;  2CW0 D;  1D7Q A;  4GKK Q;  3NQT A;  3A5Z B;  4R4O A;  1EZ6 A;  4U68 A;  5IE8 A;  3CCR A;  4N8F A;  2R3Z A;  1E1T A;  5IGB A;  1B9M A;  1B9N A;  1XNR Q;  3T1H L;  3V2T A;  1BDO A;  2NVT H;  2D0P A;  2N55 A;  2E2J B;  5EBD A;  1FVI A;  3KDF A;  2KBN A;  1D6E C;  2F3I A;  2NVQ H;  3P1H A;  4R4T A;  1R9T H;  2YTY A;  4Z9C B;  2J4X A;  4C3H B;  1X3Q A;  1F2M A;  4AQY L;  3QB3 A;  4YHH Q;  5JJL A;  5FLX c;  3V05 A;  3D4W A;  3CXC A;  4BXX G;  5BN4 A;  2JA6 H;  3D4R A;  2XNA C;  4C3J B;  1SLJ A;  3D8G A;  4IJL A;  4LF8 L;  2XVS A;  4JI1 Q;  5LMN Q;  4C3I G;  4RGO S;  4DFA A;  2VQF L;  4GNX A;  1U4P A;  3R93 A;  5AFW A;  3M9B A;  2OTJ A;  3JAM c;  1XNQ L;  4V19 0;  1K83 B;  3J81 i;  4FXK C;  4OHJ A;  2K5V A;  2K28 A;  4RG1 A;  1A63 A;  1TWF B;  5KYI A;  1SMY C;  2R7D A;  4C1N I;  2MPM A;  4JYA Q;  2GVA A;  3ULL A;  1C9O A;  3HOX G;  1L1O B;  2E2J H;  1CM9 A;  3MA2 B;  3UE1 A;  3GTJ H;  1S40 A;  4POG A;  1X3E A;  2Z1C A;  4YIJ A;  1A3U A;  1A3V A;  4RGT A;  4K5V A;  5BR8 L;  2VUM B;  1PRT F;  1PYW D;  4IPD A;  1LTI D;  2E2H B;  2A19 A;  4JI8 Q;  4HSV A;  4UPA A;  3NBH A;  1T5E A;  1QNU A;  3SK4 A;  4C3J H;  4N9T A;  1ZYR D;  3K5L A;  2RCF A;  5CR3 A;  2UU9 L;  4V0B A;  3MVV A;  4CKE A;  2ZJR A;  3K80 C;  1DD2 A;  3VYU A;  2F52 A;  2A5H A;  1KHI A;  2E2D C;  1AFP A;  1J5E Q;  2B2W A;  4C3H G;  3HOW B;  2L12 A;  1K83 H;  5M9O A;  2PQE A;  3ONA B;  4GLX A;  1YHA A;  4DV0 L;  1TWF H;  3KF6 A;  3K58 A;  4DV6 Q;  3J80 L;  4P75 A;  2RSN A;  1KAW A;  2WAC A;  1TS2 A;  4IOC A;  1V1P B;  1K28 A;  2ZJQ A;  4J1M A;  4JCV E;  1DCZ A;  3EQL C;  1EEF D;  3E5S A;  1PYS B;  3SXH A;  2D5D A;  1GUT A;  1NSN S;  1P8L A;  3SDZ A;  5CGK A;  3GTM B;  1HXY D;  4L63 B;  2SOB A;  1K73 C;  4IPG A;  3OTO Q;  2IT1 A;  1SFO H;  4FF1 A;  3IRB A;  3S24 A;  3NHH A;  1OXX K;  1E24 A;  1JMC A;  2ICI A;  5AJ3 L;  5GAE C;  5CMD A;  4BWG B;  1VQ4 A;  2H5X A;  3M4Q A;  3HOW H;  2VUM G;  3BS1 A;  1XWE A;  4OO1 G;  3KFU A;  1N36 Q;  3OW7 A;  5FOB B;  4RGN A;  3IFT A;  4LF5 Q;  3L3O C;  4IFD G;  2JQO A;  3I4O A;  1HUN A;  3MXG A;  5C5L A;  2WII B;  4DR3 Q;  3D6C A;  1YJN A;  3PMF A;  4YY3 Q;  3URY A;  3J7A 5;  2EPB A;  2WKD A;  1EIY B;  3BU2 A;  1DON A;  3CCV A;  3KF8 B;  1SSO A;  2UUB Q;  1Y1W B;  4A75 A;  4OIJ A;  1MIU A;  4LFA L;  2R92 G;  1WFQ A;  3K59 A;  1SAP A;  4CJ2 C;  4CDC C;  2K5W A;  2OXP A;  1PFB A;  4JI4 L;  1IBM Q;  3PQI A;  2N49 A;  4M8A A;  2UXB L;  1AE3 A;  3CPW A;  3D4D A;  2A6E C;  4HR7 B;  2CWP A;  3T16 A;  1M90 C;  3I4N H;  3FKI B;  1IHZ A;  1TWA H;  2OQ0 A;  4K2L A;  2KUM A;  2B2V A;  3CHB D;  2PNR C;  1JJG A;  3HOZ B;  1YEZ A;  3H0G B;  3UDI A;  1I6H B;  1B53 A;  1JCK B;  3OPO A;  3KJP A;  1HUM A;  4KLK A;  4X6A H;  3TN2 A;  4L6T B;  2JEA I;  5IP9 G;  2JYO A;  2A69 D;  3KLW A;  2RDF A;  2K1B A;  3K7A B;  3S1N H;  3WDN A;  4QIW B;  5G3L D;  1T5X D;  5TSS A;  1Y1W H;  2VY3 A;  1F77 A;  1STY A;  2KCN A;  3M7G A;  4NMZ A;  4X65 Q;  1EY8 A;  4A3F B;  2LKV A;  1B8A A;  5IGG A;  5KIX A;  1AEX A;  1TY0 A;  2X6L A;  2F4I A;  1FJG L;  2A6H D;  5DAU A;  2PW7 A;  4CJ1 B;  2PPB C;  1L0Y B;  3VDY A;  3GTG B;  3VYT A;  4DUZ Q;  2R7Z B;  1YJ9 A;  4LF6 L;  2NN6 H;  4K8J A;  2K32 A;  2EQS A;  4MNO A;  1F9R A;  1LTG D;  4B9W A;  3LGJ A;  3NSW A;  5DM7 3;  1J8I A;  1EYD A;  2DY8 A;  4PMB A;  2X69 A;  5C6A A;  1KNA A;  2F3V A;  4XQN A;  5IYD G;  4CJ0 B;  4A3B B;  1ENA A;  4LJZ C;  3H0G H;  2HD3 A;  1EYC A;  5JVG 3;  1I6H H;  5IP7 H;  5FLM H;  2Q2I A;  2MJ8 A;  2HIX A;  1U9R A;  4HID A;  5A2Q L;  5CV5 A;  3U9O A;  1JB7 A;  1I94 Q;  2KCT A;  5CBA E;  4KKS A;  4Y7N B;  4TQU S;  5M3F H;  2NTT A;  3SK5 A;  4KV6 A;  5IT9 c;  1EIG A;  2KVM A;  3CRK C;  4EX5 A;  1I50 H;  3I4M G;  3FKI G;  4AIM A;  4OEL B;  5IOC A;  4LF7 L;  4DA2 A;  2PYK A;  4P2C B;  4A3F H;  3HOZ G;  1HCZ A;  2EVB A;  3SHL A;  1FGU A;  1OXU A;  2EYH A;  4AYB B;  3ERS X;  4X66 Q;  2MFI A;  4JV5 Q;  4X62 Q;  4DF7 A;  2JA9 A;  2R7Z H;  2F0E A;  4HN7 A;  1GO3 E;  2BOS A;  1LV9 A;  4OXP A;  1XYI A;  2Q2U A;  3DUZ A;  1JB3 A;  2R93 B;  2XRS D;  1K8M A;  4CHT B;  4WJ3 M;  4O0A A;  5JPN C;  4OL7 A;  4DV4 L;  3BYT B;  4A3B H;  4A3G B;  1K0R A;  3EVQ A;  3KF6 B;  2Q8I B;  2ZXO A;  1EFW A;  2Q2T A;  3T1Y Q;  4K5W A;  4OX9 L;  3TP5 A;  4HCE A;  3F8T A;  5GRO A;  1LTB D;  4CKB A;  1AE2 A;  4ZAI A;  1JWM D;  4QY7 A;  4JI2 Q;  2VQE L;  1AH9 A;  5D65 A;  3TRZ A;  2NN6 I;  5C3E B;  4RCO A;  2PO4 A;  2JP1 A;  1B3A A;  2UUA L;  3S1R B;  1Q7Y C;  1EYA A;  1PTO D;  3AMU A;  2B8G A;  2XGT A;  3TBI B;  1QCB D;  1VQG A;  4DR2 L;  3DWP A;  1LT5 D;  1A6X A;  2R93 H;  4RKB A;  3F2U A;  3UI2 A;  3CCE A;  3GO5 A;  1UNS A;  5M5W H;  3SE0 A;  3LWE A;  4BY1 G;  3TQY A;  2EOT A;  2F0I A;  2Q2H A;  2DUD A;  1EQT A;  1F9P A;  2F0Q A;  2PZU A;  1I4R A;  4KK7 A;  4AYB G;  1B70 B;  1CQV A;  3JAM i;  2QKI C;  1E3P A;  4IQZ A;  4JW0 A;  1IYU A;  3DLL A;  2DNE A;  3BJU A;  2KHJ A;  3I72 A;  4R4I A;  3CKI B;  1Q1E A;  1FGB D;  4ME5 A;  2J0T D;  4FYD A;  1RD9 D;  5IYB G;  1SJE D;  4KN7 C;  3RZO H;  3LX0 A;  2I5M X;  5C3E H;  4WJ4 A;  1EZ8 A;  4A3G G;  3R2I A;  2IY5 B;  3PSI A;  4YCU A;  4QCL A;  1WTO A;  4GKJ Q;  2CCZ A;  2V4D A;  3W1G A;  5I9O A;  1U4R A;  1HFG A;  4NDX A;  3HZX A;  5E7N A;  2F0G A;  4U67 3;  2GVB A;  1W6K A;  4LFB L;  4JI5 L;  1HR0 L;  2D0O A;  1X54 A;  3PUW A;  2Q8T A;  1PMR A;  2F03 A;  3Q24 A;  1S5B D;  3PO3 G;  3CW2 C;  2PMZ B;  3BZC A;  4BY7 H;  3NP8 A;  1HA5 A;  4BA1 I;  2FJ2 A;  2OQK A;  4B3M Q;  1TKW B;  3M3Y B;  4GZY C;  1UE1 A;  3CMA A;  5E1F A;  1FYC A;  1VF7 A;  1EY0 A;  4A3I B;  4S3S A;  4DR6 L;  1ET6 A;  2QEX A;  4K5X A;  4XQJ A;  1KNE A;  1SYG A;  1KAA A;  2KED A;  3V96 A;  2KHI A;  1WOC A;  4KJO A;  2CH4 W;  3S15 B;  2MP1 A;  1ONL A;  4HIO A;  5C0X G;  2QCP X;  4ZUI A;  3MXN B;  2NZO A;  1Q12 A;  3G6J B;  1VQ7 A;  3CD6 A;  2EYM A;  1JQY D;  1PLF A;  4X66 L;  2A1A A;  1J9O A;  1XMQ Q;  3I91 A;  2QW7 A;  1VMP A;  3KJO A;  1G91 A;  2WIN B;  4HCS A;  1L1O A;  4HJ7 A;  1H95 A;  1A3T A;  1IKM A;  1GXD C;  3CME A;  1WD1 A;  3OW2 A;  3RLO A;  2B2W C;  2EY5 A;  1D1K A;  5IYC H;  1CSP A;  1Q8I A;  1S4Z A;  1BCP F;  2JN4 A;  3NEL A;  5EPJ A;  4PQX A;  5ELE A;  3T1H Q;  3PO2 G;  3FHW A;  4JC0 A;  4XT3 B;  4C56 C;  2IW3 A;  4GN3 B;  2VZA A;  4QJF A;  4IUR A;  4A3D H;  3S2H B;  4DR5 L;  4AQY Q;  5C44 G;  1KDA A;  3QJY A;  1M4V A;  1SNM A;  4LFC Q;  5KNB A;  1EY9 A;  1KC8 C;  2XWB B;  2B3G A;  4KHP Q;  4ABN A;  3J80 E;  3K57 A;  4LF8 Q;  1IBL L;  1VQ8 A;  1XPU A;  4TVA B;  2VQF Q;  3ERO A;  1RCV D;  2IHE A;  4KN4 C;  4A3E B;  1V1P A;  2R7F A;  1F9Q A;  1TWG B;  1XNQ Q;  3FPP A;  4RAU C;  3I2Z A;  2MQH A;  5A35 A;  2CQA A;  3AQQ A;  4XQQ A;  2RKS A;  3ULJ A;  3M85 A;  1ASY A;  1FD7 D;  5EKL A;  3EBE A;  4DV5 L;  2PNH A;  1GVP A;  4GS3 A;  1JOR A;  1VQJ A;  1STH A;  5COR A;  4I65 A;  2K03 A;  1PFM A;  1Y1V H;  4DGZ A;  4KY5 A;  3HKZ E;  5BR8 Q;  1C8C A;  4BBS H;  1HNX L;  2Y0S E;  1SE3 A;  1MSG A;  1LO5 D;  1Q86 C;  5I6W A;  1MJC A;  4MTN A;  1TVX A;  5K36 G;  4UHV A;  2N78 A;  3W2D A;  2NYZ D;  2O4X A;  1G8Z D;  5EPL A;  2UU9 Q;  1SMY D;  4UDU C;  2B29 A;  3MXP A;  2QDB A;  2RDG A;  3S17 B;  1G29 1;  2PZW A;  1DM0 B;  4K6L A;  3H6M A;  4IPC A;  4F88 A;  4A3E H;  1E2W A;  2MO1 A;  1F9S A;  1PXU A;  3I73 A;  1XXG A;  2GN5 A;  3VR4 A;  4XT1 B;  5C4H A;  1MKH A;  4EVO A;  4IUQ A;  5JEA J;  4DV0 Q;  3DEO A;  2D62 A;  2E75 C;  3HOV H;  2JA5 B;  3KF8 A;  4C3I B;  3L7Z C;  3NTI A;  3E0J A;  1EQQ A;  4TSS A;  1WCM B;  1ZKO A;  4FO2 A;  4DAP A;  1AW7 A;  2F0P A;  4QQB X;  1GJX A;  1JOO A;  4KD4 A;  3J81 L;  4FP5 D;  2K04 A;  3NPP A;  1Y8P B;  2E2I H;  1QJO A;  1N33 L;  1X65 A;  3HS0 C;  1QUQ B;  1I4P A;  5BN5 A;  5JPM C;  3TS0 A;  3RN5 A;  1BO0 A;  5C0X J;  2OTL A;  1VQD A;  3HOX B;  1H9J A;  2EJF C;  4K14 A;  2PCF B;  3S17 H;  4XXE A;  2EDG A;  2IX0 A;  2VB2 X;  5AJ3 Q;  5GAG C;  4ZKC B;  3E3X A;  3CU7 A;  4TKO B;  1CT1 D;  1SNP A;  1YJW A;  3A74 A;  5ELB A;  3HKZ B;  1HNZ L;  2Y0S B;  5LL6 S;  2BH2 A;  4P71 A;  4RA8 A;  4BXX H;  4POF A;  1EWC A;  5D3D A;  4L5T A;  1Z7T A;  1DZ1 A;  2ZT9 C;  1VQE A;  1W3S A;  2ZXR A;  4K2K A;  4LF9 L;  2VW9 A;  4QMG A;  1I3Q H;  5LL6 X;  3STB C;  5BN3 A;  2RHQ B;  1SND A;  5H1S E;  4ILW A;  2KEN A;  5M5X B;  4LFC L;  3G4S A;  2JA7 G;  2EYJ A;  3CCQ A;  3DM1 A;  1XPR A;  4KHP L;  2F3W A;  2B63 H;  3BDL A;  4LFA Q;  1JE4 A;  2F4V L;  3HOX H;  4KI0 A;  4ZYS A;  2JA5 G;  1IW7 C;  2L11 A;  2K7V A;  4RMF A;  2Z0S A;  4IN3 A;  3NUC A;  3RNU A;  3C3L A;  1U5K A;  1WCM G;  3JC6 6;  2V1C C;  2AMC B;  3T56 B;  1S72 A;  4JI4 Q;  5KRU A;  1H9M A;  1SE4 A;  4KY6 A;  5A2Q E;  3OSO A;  1JJ2 A;  3H3V I;  2KQ3 A;  2UXB Q;  1BVS A;  2RDH A;  5FO8 B;  3J7Z C;  2K14 A;  4L8J A;  1NMF A;  4YWK A;  3F2B A;  2VXW A;  1XJV A;  4ME3 A;  1IL8 A;  2M2L A;  5IGD A;  3H3V C;  1WTH A;  1W2B A;  4HED A;  5C3X A;  3KBX A;  2IWH A;  1J6Q A;  4K8I A;  4LUO A;  4C3H H;  1PRT D;  4FNF A;  4MN3 A;  1SEB D;  2IX3 A;  5M5X H;  1K0S A;  3HKZ G;  3ND9 A;  4K6D A;  2Y0S G;  3EA6 A;  3KBG A;  1NY4 A;  1PZI D;  4PZ6 A;  4DV1 L;  4Y52 H;  2A6E D;  1VQ6 A;  3I90 A;  5EKK A;  2R61 A;  4JPB W;  5CYU A;  2NB0 A;  5I9P A;  1YNN C;  1C7Y A;  4OON A;  2EY2 A;  3RZD B;  1FJG Q;  4GLA C;  4F8M A;  1FNU A;  1PHJ A;  4IUV A;  5CBE E;  3H15 A;  5FKA C;  4LF6 Q;  2R92 B;  1PH5 A;  1DOM A;  2OF1 A;  1QOH A;  4DR4 L;  3M4O B;  5I6Y A;  3K6O A;  5LMU L;  3F2D A;  4FXD A;  5ELN A;  5I2Y A;  1WD0 A;  1C4Q A;  3UDG A;  3VR5 A;  4ZCK A;  2YU9 B;  4B3R L;  4YWM A;  4JI7 L;  1T9H A;  1SBB B;  1X3P A;  4R4Q A;  2VUM H;  3NTK A;  3QWN A;  4OO1 H;  1Q8K A;  2E2H H;  2QF7 A;  1VQP A;  4OGQ C;  3SEB A;  3W3A A;  3K0X A;  5T1G A;  1EQV A;  2G9H D;  4H02 A;  2AWN A;  4DU9 A;  3J7A V;  3S1M B;  2CW0 C;  4IFD H;  1VQ9 A;  3GP7 A;  2FMC A;  4QGU A;  4LF7 Q;  4HJ8 A;  4PZ8 A;  4GN4 B;  1YI2 A;  4B08 A;  3A56 A;  3AFP A;  2IPK D;  2CWA A;  3A55 A;  2LFN A;  1SN8 A;  1K9M C;  4X64 L;  1JIC A;  4PV1 C;  2KA7 A;  3F2C A;  2D2C C;  3E0E A;  4QIW E;  3EIV A;  3FDT A;  5ELC A;  3T51 B;  2ASB A;  4A3C H;  2WP8 J;  2HCI A;  2AUJ D;  1YVC A;  2NZ1 D;  2RHS B;  2HCC A;  1I4G A;  3I4L A;  2AQ1 B;  4WRD A;  1WTR A;  1GKH A;  2JA8 B;  4DV4 Q;  4ALP A;  3NWT A;  3TSS A;  2RF4 A;  4NXM L;  4DK6 C;  4GN5 A;  2CKZ B;  4BBR B;  3GTM H;  1RJT A;  1FL0 A;  1SE8 A;  2F0U A;  4C2M B;  4OX9 Q;  1UE6 A;  5E4X A;  2KJX A;  4X3T A;  1OO9 B;  2KOL A;  5M3M B;  3S1M H;  1SRO A;  1CK1 A;  3SGI A;  2VQE Q;  1MD2 D;  1X3G A;  3DM3 A;  4ID6 A;  3AFQ A;  5GQO A;  5C4J B;  3U50 C;  4DR1 L;  1L0W A;  1WTW A;  1GUG A;  3I56 A;  1ASZ A;  3CC2 A;  4CDE C;  4G7O C;  3CRL C;  3C2P A;  1HH2 P;  4CDF C;  1WJJ A;  4JOI A;  4IOA A;  1HZB A;  1M8A A;  2UUA Q;  1K8A C;  5LHY 1;  4NB3 A;  4KTA A;  4KD3 A;  2AQ3 B;  4DNR B;  4DAV A;  4L5Q A;  1VQO A;  1EWH A;  1EL0 A;  1O78 A;  3I4M B;  1L1O C;  4OO1 I;  1GUO A;  2B8F A;  3ER0 A;  4R1J A;  1TR5 A;  1K3R A;  2E74 C;  2E8G A;  4DR2 Q;  1QVF A;  2VL6 A;  1CKM A;  4I7Z C;  1VQB A;  3LNN A;  1LTT D;  3ZYY X;  4AYB E;  3AEV A;  4DV7 L;  4IFD I;  3W5O A;  3MXN A;  1YZ6 A;  1KIX A;  2NWG A;  3RMH A;  3NXW A;  4CBV A;  1HPC A;  1NBW A;  4A3L G;  2K75 A;  2JXM B;  2F0V A;  1PZJ D;  5IYD H;  4ODG A;  3GTL B;  5J22 A;  1LT6 D;  2NTS A;  5C4J H;  2JA8 G;  1CKN B;  1UAP A;  3PIO 3;  4WJW A;  4BBR G;  1I6V C;  1YNJ C;  4HMJ A;  4LFB Q;  1OXS C;  4JI5 Q;  3VA7 A;  1HR0 Q;  1EY5 A;  1ICW A;  1JWS D;  3FKI H;  5M3M G;  2WFW A;  1II3 A;  2QEJ C;  4HIK A;  4BS9 A;  3TP6 A;  3HOZ H;  2F0O A;  2HQE A;  2ZTD A;  2QGQ A;  1GUW A;  5C4X G;  4P72 A;  3T13 A;  4DR6 Q;  3K7A H;  1LTL A;  2K4K A;  4HJA A;  3QR8 A;  4PZ7 A;  3CC7 A;  2CVR A;  1PH4 A;  5FLX L;  1U4M A;  1V1O A;  1PYB A;  1EQR A;  3P20 A;  2L1B A;  3FMC A;  4A3J B;  1D2B A;  3G6E A;  4KY7 A;  2NZH A;  2AHO B;  4IUP A;  3GTL H;  5ISR A;  1MHW C;  4NP5 A;  4Q0F A;  4BY1 B;  1SYF A;  4N8X 1;  3GTQ B;  1RTO A;  2MHV A;  3JAM L;  3GTG H;  3WOF A;  1Y8O B;  4A93 G;  3VYR A;  1X56 A;  4AH6 A;  1O7I A;  1B3Q A;  1EIF A;  3FEW X;  1GD7 A;  1SRU A;  4KKT A;  1C48 A;  4FXG C;  3DEP A;  3TS2 A;  1N34 L;  3HOU G;  2ES2 A;  3G7L A;  4Y7N H;  1EY4 A;  4TRD A;  1SYE A;  2EYF A;  1HQM C;  1ENF A;  4DR5 Q;  3PO3 B;  2PMZ E;  5EQ0 A;  2N8N A;  3BYY B;  4WFN 3;  2HT1 A;  1VQH A;  4R4C A;  4EQN A;  2IX1 A;  2G9D A;  4DAM A;  2K33 A;  1CHP D;  4BY1 H;  3K5N A;  4HJ5 A;  1IBL Q;  1A15 A;  1BR9 A;  5J1Z A;  2BE5 C;  3MAQ A;  1PTO B;  2LSS A;  3MFY A;  1S5E D;  1MBY A;  3ZJY C;  3A5U A;  1TS4 A;  5IWA L;  2L4N A;  3PIP A;  1ESF A;  3J81 E;  1B2T A;  1PH3 A;  2A68 D;  1E1O A;  2LS0 1;  4A3J G;  5IYB H;  3M7N A;  1Q82 C;  5CC4 A;  3AB9 A;  4YWL A;  1S5C D;  4HAE A;  2A69 C;  4A3G H;  1WTX A;  2XTI A;  1X6O A;  1TT2 A;  1QUQ A;  2LXK A;  4DV5 Q;  2E5L Q;  2UXC L;  3ICE A;  2WAQ G;  3G48 A;  4ZK9 B;  1SE2 A;  3KLS A;  1VF5 C;  1RDP D;  4RKL A;  1X3F A;  4I7A A;  2ALY B;  4FVM A;  3S9W A;  3PO3 H;  1HNX Q;  2F0M A;  4X3K A;  4HTH A;  1UEA B;  5FK9 C;  2A6H C;  5LMN W;  1CZG A;  1XX8 A;  3PV0 A;  1G2T A;  5EAY A;  3PO2 B;  3GV3 A;  4RCN A;  1S3O A;  2NBF A;  1DOL A;  3CCM A;  3S1R H;  5HGQ A;  5C44 B;  4LNQ A;  3DWA A;  3CQZ B;  3QOL A;  5JEA G;  1CFM A;  1LUZ A;  1PA6 A;  2A74 C;  3GTO B;  3N6R A;  3H09 A;  1EEI D;  4RGM A;  4IPH A;  2BH8 A;  2FFK B;  5M5Y B;  3S2D B;  3L2P A;  4GOP A;  1HZC A;  1MGS A;  1R4Q B;  1UEB A;  4RHR A;  2F0L A;  3OMG A;  4DUY L;  3KOJ A;  1N33 Q;  3MXU A;  1EY6 A;  2XIW A;  2H1E A;  3PO2 H;  5T1I A;  1NNX A;  1TWC B;  1Y14 B;  1PDQ A;  4JI6 L;  1IBK L;  5C5M A;  4J15 A;  1ESR A;  1YHB A;  1LT3 D;  1X9N A;  3D6W A;  1VDZ A;  1TWH B;  3GTP B;  1XMO L;  3HGB A;  3C1E A;  3HG9 A;  5C44 H;  3A8K E;  3L0O A;  1HNZ Q;  1BOS A;  4BY7 G;  1BCP D;  1ML0 D;  3GTK B;  2E76 C;  4JBW A;  1PH7 A;  3M3Y H;  4H0L C;  4DK3 C;  2KEE A;  4QB4 A;  4NXN L;  4JBK A;  3N52 A;  5K5P A;  2J7Z A;  3UE0 A;  3GDE A;  4A3I H;  1ZXT A;  4A3K G;  4IUT A;  4LF9 Q;  2IJ0 A;  2YV5 A;  1BNZ A;  4UP8 A;  3J80 c;  5DLQ E;  2EYP A;  3S15 H;  4ZLT F;  3X3M A;  4CDD C;  2ZM6 L;  2EYL A;  3BZD B;  5C3W A;  5ELF A;  2F4V Q;  1A8V A;  4LUV A;  4PMC A;  1PTO C;  2VB3 X;  5C0X I;  4EQ5 A;  4J8Q A;  1ILP A;  5ELD A;  3A54 A;  4DV3 L;  2B39 A;  1TWH H;  2ZJP A;  1PFN A;  3FVQ A;  1YIJ A;  2EXZ A;  3QO2 A;  2QDL A;  1GUN A;  1PH6 A;  3Q22 A;  4FF2 A;  3STB D;  1HNW L;  1IYV A;  3M4Y A;  3MZ5 A;  3E9I A;  1O7Z A;  5FJ8 G;  1IXR A;  5K36 H;  3KLS X;  3HOY G;  2UXD L;  1DOK A;  5NUC A;  4CKC A;  1TS3 A;  1RIP A;  3Q8D A;  4DV2 L;  2E5L L;  2B2U A;  2HHH L;  3K8A A;  1I4Q A;  4MTK A;  1IW7 D;  1K3B C;  3BZK A;  2NVX B;  3S2H H;  2OWO A;  1ICF B;  3D3R A;  1S5F D;  2D9U A;  5EJW A;  4FDB A;  5IT9 L;  3MFG A;  4NW2 A;  4O2D A;  5GAD C;  4DV1 Q;  3FPU B;  2RA4 A;  1Y8N B;  2DJG C;  3ND8 A;  2ID0 A;  2BCO A;  3RUZ A;  1BBU A;  3Q23 A;  4R8I A;  3TRE A;  1BQQ T;  1TWG H;  4O1N A;  3PF5 A;  1AN8 A;  1AZP A;  1KLU D;  2JA7 B;  4LMQ D;  2Z8L A;  2F0F A;  1AZQ A;  1KRS A;  3DMU A;  4ZKB B;  2FIN B;  3M4P A;  1PH2 A;  4JOI C;  2ENB A;  5KND A;  1VMC A;  4JVZ A;  4DR4 Q;  1PVO A;  3HP3 A;  2N3S A;  3H3V H;  4ZQ3 A;  4YCW A;  3S16 B;  5LMU Q;  1H9S B;  3BVM A;  2O2L D;  3NWS A;  4L5R C;  4B3R Q;  1KL9 A;  1MI2 A;  2F0S A;  2F0N A;  1YNN D;  1Y1V G;  1TXY A;  5CV8 A;  2EXD A;  2M00 A;  4JI7 Q;  3PUV A;  3I3C A;  5IGE A;  1X32 A;  1CKO A;  4JI0 L;  2KEC A;  3IKJ A;  1A2U A;  2AQ2 B;  1WTP A;  4F7X A;  3Q0A A;  4LF4 L;  1A2T A;  2A73 B;  2YYZ A;  3GV6 A;  2NVQ B;  3CCJ A;  1SYD A;  2RQX A;  1R9T B;  1NR4 A;  3HFZ B;  3S14 B;  5JJI A;  2HUG A;  1NR2 A;  1Q1B A;  2XSC A;  4XYO A;  3TEH B;  3C46 A;  1CA5 A;  4X64 Q;  3LWU A;  4LW1 A;  3K5O A;  2JA7 H;  1HR0 W;  3I55 A;  3CC4 A;  4QL5 A;  4DK1 A;  3QG1 A;  3H91 A;  5KGU A;  2JA5 H;  4C3I H;  5GAH C;  1SXT A;  2PI2 A;  1KAB A;  1WCM H;  1KLG D;  4R8N A;  2TMP A;  1STN A;  1GM5 A;  1LYL A;  1L2F A;  3VR6 A;  2BA1 A;  2HDL A;  4NXM Q;  1H9K A;  1STG A;  2C35 B;  4KKU A;  1Q3L A;  1CKN A;  3F1Z A;  3CCS A;  4A3M G;  1EU3 A;  3I8Z A;  5L37 A;  1EFI D;  3Q6S A;  1PH9 A;  3GTJ B;  3MEH A;  3RLF A;  4GOP B;  2G5D A;  1RTN A;  5EGT A;  3S14 H;  1HQR D;  4DR1 Q;  4DPG A;  4QUC A;  1JOQ A;  2Z6K C;  2ZTC A;  3K81 C;  4IJH A;  2F1M A;  1OXV A;  2PQA B;  1G6P A;  2QA4 A;  1TY2 A;  2I46 A;  3A7A B;  1QWY A;  5FLX E;  3J7Y W;  2B2Y C;  2B2T C;  5E3F A;  1VQA A;  1PRT B;  1NJI C;  4JI3 L;  4DNT B;  3CCL A;  1DYQ A;  4G57 A;  3RD4 A;  4E6I A;  4OIK A;  2JJQ A;  4DV7 Q;  5HUR A;  1LLR D;  1QVC A;  2IHF A;  5C4Z A;  2K5D A;  3JAM E;  2JA6 G;  3TZU A;  1SJH D;  3X3N A;  3PF4 A;  2B63 G;  3OIQ A;  3E9H A;  2L55 A;  3MTS A;  4DR7 L;  1EWI A;  1EU4 A;  3I70 A;  3HKS A;  2LXJ A;  1DJR D;  2DY7 A;  4B3T L;  3PUZ A;  1TS5 A;  1CA6 A;  2WB1 E;  4B3S L;  1BUV T;  3NEN A;  5EPK A;  1IL2 A;  1XTD A;  3K5M A;  4LWC A;  4H7B A;  1SFO B;  2KHS A;  1FNV A;  1LTA D;  2DNC A;  3CCU A;  3BVZ A;  3PIO A;  1QZH A;  4UP9 A;  2CQO A;  4HMI A;  3IAY A;  1KD1 C;  3C1F A;  4OWX B;  1H9R A;  2OT2 A;  2EY1 A;  2Z4I A;  3I7F A;  4XYQ A;  1STA A;  4HSP A;  3U4Z A;  1DXM A;  3NBI A;  1E2Z A;  5COY A;  1O7Y A;  4C3J G;  1YNJ D;  5KNC A;  3G71 A;  2HDM A;  1NE3 A;  1Q90 A;  1CSQ A;  2CHB D;  4ZRZ A;  3CP0 A;  3T4A C;  1EUJ A;  1VQM A;  5JOB A;  1YIT A;  1E7Z A;  1Z9F A;  3RZD H;  3BDO A;  3UDX A;  2K5Q A;  4X3S A;  3ITP A;  1NCV A;  2PI2 E;  2KCM A;  1LT4 D;  2X6G A;  2R92 H;  3HEJ A;  3A8J E;  5EBC A;  1CZW A;  4K0K L;  2AUK A;  1GOZ A;  2ICE C;  3M4O H;  1OXT A;  1SYC A;  3BDC A;  3A7L A;  1W6J A;  4PG3 A;  3E6Z X;  3NK9 A;  5D14 A;  1EOT A;  4GKK L;  2YU9 H;  1HHV A;  1TQO A;  3P75 A;  3VA5 A;  1V8Q A;  1X55 A;  1UE7 A;  2K01 A;  2BA0 A;  1N34 Q;  4MZ9 A;  1VQL A;  1DGS A;  1BF4 A;  2XWJ B;  1JT8 A;  1KDB A;  2WB1 B;  1FNW A;  1XNR L;  1F2Y A;  4BA2 I;  3I4N B;  2I5H A;  5F2D A;  2XRQ D;  1TWA B;  4GOP C;  4RWS C;  1BBW A;  3B6Y A;  2OEO A;  1KXL A;  3SVM A;  5C4X B;  1WYD A;  3TDQ A;  3OWE B;  1MSH A;  5IP9 H;  4JBJ A;  4YHH L;  2EZV A;  2K5H A;  3HOW G;  4FF4 A;  3S1N B;  2O5J C;  4RFB A;  4A3C G;  2WV6 D;  4NKL A; 
#chains in the Genus database with same CATH homology
 1K8O A;  2PZT A;  5IGC A;  1D5M C;  5I4D A;  5CV6 A;  4EGV A;  4KMU C;  3SK8 A;  1SYB A;  1PRT C;  4F87 A;  1R4P B;  3KK7 A;  1CI3 M;  2JSO A;  1LTR D;  4XIG S;  5CV7 A;  1NUC A;  3MC0 B;  2BDO A;  1HRJ A;  1ZYR C;  2BE5 D;  2PW5 A;  4A93 B;  3DWQ A;  1GHK A;  2IL8 A;  5IIF A;  4KHV A;  1B44 D;  1EIH A;  2M9V A;  1KTK A;  4KHZ A;  1AP0 A;  3OIP A;  5DM6 3;  1WTQ A;  3KLR A;  4IUU A;  3HOU B;  1I4X A;  2SNM A;  5M3F B;  3OMC A;  1ROD A;  5G3L F;  1HTP A;  1I50 B;  4RHS A;  4FF3 A;  4IZ8 A;  2F0H A;  2EY6 A;  5JJZ A;  1BBX C;  1E2V A;  1O80 A;  5KEE A;  1RF2 D;  2LY7 A;  1LAC A;  2B2U C;  2F0T A;  1G2S A;  1KDC A;  2VNU D;  4M1U B;  1CQF A;  4DXF A;  1B4O A;  4DN4 M;  2RBM A;  2WAQ B;  2B2Y A;  1CHQ D;  2NN6 G;  2B2T A;  1L0X B;  1B50 A;  3NTH A;  5IT9 E;  4ULL A;  1ILQ A;  5JAV A;  2MUY A;  4IFD J;  1QB5 D;  3L9A X;  1D5X C;  5M5W B;  1TU2 B;  4PNY A;  1RKN A;  1V43 A;  1I4H A;  1TII D;  2F0J A;  2ZXP A;  3PUX A;  3EFX D;  1H9S A;  3H94 A;  1ZEQ X;  3QIA A;  3SR1 A;  1HA6 A;  4J6H A;  3QOJ A;  3IL8 A;  3RZO B;  3TP8 A;  2XN9 C;  4G4K A;  2L0C A;  1G6Z A;  4QF4 A;  4PMW A;  3U9S A;  2H4O A;  1D1I A;  3HRZ C;  2TSS A;  3O13 A;  4IAL A;  1PTO F;  3NQI A;  5JEA H;  4MIU A;  4BY7 B;  1WTV A;  1JOK A;  4CGY B;  3PUY A;  4DXG A;  3GD7 A;  5FO7 B;  4A3K B;  1PTO H;  4RH6 A;  5CV9 A;  1U4L A;  2F0D A;  5DEH A;  1UUP A;  5C0X H;  1SNC A;  2K05 A;  3TZD A;  5I2X A;  4QUF A;  1IKL A;  2JE6 I;  1QIL A;  1B1Z A;  1BXT A;  2L5T A;  4H13 C;  5IGF A;  5DNF A;  4X3U A;  1S5D D;  1JR0 D;  2WKC A;  5FO9 B;  2EJM A;  1JWU D;  3R8B A;  4C1N K;  3HOY B;  1VCI A;  3K0Y A;  5J39 A;  2Z4H A;  1CTM A;  2BDN A;  1PZK D;  4XDX A;  1O7L A;  4A3D B;  4DK0 A;  2KCC A;  1BCP B;  3R2T A;  1NAP A;  2LMC B;  1SNO A;  3DXJ C;  3IFD A;  1GUS A;  2N88 A;  1QE6 A;  3OWF A;  5KYL A;  5IOD A;  1ET9 A;  3TP7 A;  2F0W A;  2I07 B;  4G7H C;  1ENC A;  2SNS A;  2GA4 B;  3P7J A;  1F2Z A;  1LAB A;  2DN8 A;  3VR3 A;  2C9O A;  1LTS D;  1HFN A;  3EJI A;  4UAI A;  2NUC A;  4EQO A;  1RHP A;  3WOE A;  3MWY W;  1SDF A;  2O5I C;  3A8I E;  3S1Q B;  1JC7 A;  3TME A;  2SDF A;  1SNQ A;  3J7A F;  1FR3 A;  2EYO A;  3MHB A;  2A68 C;  5D3I B;  4BBS B;  1Y1V B;  2R6G A;  2EJG C;  1QG7 A;  3PIP 3;  3VYS A;  5E4W C;  4Q5V A;  3T53 B;  1Y69 U;  1D5Z C;  4R9W A;  3NE5 B;  3OOC A;  2Q8R E;  4B9X A;  5JVH 3;  4ZUJ A;  3BG3 A;  4G7Z C;  3HOV B;  2RSO A;  1XTC D;  1E0B A;  1QNK A;  2FMM A;  1Z47 A;  2QIL A;  5HGT A;  5CV4 A;  3DHQ A;  2E2I B;  3OHX C;  4XTC S;  3VR2 A;  2AWO A;  5EKI A;  3D31 A;  2F0K A;  4A3M B;  2MGS A;  2SEB D;  2NVY B;  4JK1 C;  4MHE A;  1HTL D;  3BVG A;  2JEB I;  2C5C A;  3GQB A;  1EY7 A;  3AU7 A;  3KUP A;  2RVL A;  3FRP B;  1F2L A;  4LK1 C;  4EQP A;  2NVT B;  4KJN A;  4O42 A;  1GHJ A;  1STB A;  4IUN A;  1STE A;  1I3Q B;  2B2V C;  2L9H A;  1BCP C;  4LAA A;  4WOR A;  2K6A A;  2EE1 A;  3ERQ A;  2JA6 B;  4DAY A;  4N9P A;  1WVL A;  2B63 B;  2FHT A;  3SK6 A;  3R3O A;  4H44 C;  1Z6H A;  2CW0 D;  3NQT A;  1EZ6 A;  4U68 A;  2R3Z A;  5IGB A;  1B9M A;  1B9N A;  3V2T A;  1BDO A;  2N55 A;  2E2J B;  5EBD A;  1D6E C;  3P1H A;  4Z9C B;  2J4X A;  4C3H B;  1X3Q A;  1F2M A;  3QB3 A;  3V05 A;  3D4W A;  5BN4 A;  3D4R A;  2XNA C;  4C3J B;  3D8G A;  2XVS A;  4C3I G;  4RGO S;  4DFA A;  1U4P A;  3R93 A;  5AFW A;  4V19 0;  1K83 B;  4FXK C;  4OHJ A;  2K28 A;  1TWF B;  5KYI A;  1SMY C;  4C1N I;  2MPM A;  1CM9 A;  3MA2 B;  2Z1C A;  4YIJ A;  1A3U A;  1A3V A;  4RGT A;  4K5V A;  2VUM B;  1PRT F;  1PYW D;  1LTI D;  2E2H B;  4HSV A;  3NBH A;  1T5E A;  1QNU A;  3SK4 A;  4N9T A;  1ZYR D;  3K5L A;  5CR3 A;  4V0B A;  3MVV A;  4CKE A;  1DD2 A;  3VYU A;  2A5H A;  2E2D C;  1AFP A;  2B2W A;  4C3H G;  3HOW B;  2L12 A;  5M9O A;  2PQE A;  3ONA B;  3K58 A;  3J80 L;  2RSN A;  2WAC A;  1TS2 A;  1V1P B;  4J1M A;  1DCZ A;  3EQL C;  1EEF D;  3E5S A;  3SXH A;  2D5D A;  1GUT A;  1NSN S;  3SDZ A;  5CGK A;  3GTM B;  1HXY D;  4L63 B;  2SOB A;  2IT1 A;  4FF1 A;  3NHH A;  1OXX K;  2ICI A;  5CMD A;  4BWG B;  3BS1 A;  1XWE A;  4OO1 G;  3OW7 A;  5FOB B;  4RGN A;  3IFT A;  3L3O C;  4IFD G;  1HUN A;  3MXG A;  5C5L A;  2WII B;  3D6C A;  3PMF A;  3URY A;  2EPB A;  2WKD A;  1DON A;  1SSO A;  1Y1W B;  4OIJ A;  3K59 A;  1SAP A;  4CJ2 C;  2K5W A;  2OXP A;  1PFB A;  4M8A A;  3D4D A;  2A6E C;  4HR7 B;  3T16 A;  3FKI B;  1IHZ A;  4K2L A;  2KUM A;  2B2V A;  3CHB D;  2PNR C;  3HOZ B;  3H0G B;  1I6H B;  1B53 A;  1JCK B;  3OPO A;  1HUM A;  3TN2 A;  4L6T B;  2JEA I;  2JYO A;  2A69 D;  2RDF A;  2K1B A;  3K7A B;  3WDN A;  4QIW B;  5G3L D;  1T5X D;  5TSS A;  1F77 A;  1STY A;  2KCN A;  3M7G A;  4NMZ A;  1EY8 A;  4A3F B;  2LKV A;  5IGG A;  5KIX A;  1AEX A;  1TY0 A;  2X6L A;  2F4I A;  2A6H D;  5DAU A;  2PW7 A;  4CJ1 B;  2PPB C;  1L0Y B;  3GTG B;  3VYT A;  2R7Z B;  2NN6 H;  4K8J A;  2K32 A;  4B9W A;  1F9R A;  1LTG D;  3NSW A;  5DM7 3;  1J8I A;  1EYD A;  2DY8 A;  4PMB A;  2X69 A;  5C6A A;  1KNA A;  2F3V A;  4XQN A;  4CJ0 B;  4A3B B;  1ENA A;  4LJZ C;  5JVG 3;  1EYC A;  2MJ8 A;  1U9R A;  5A2Q L;  5CV5 A;  3U9O A;  5CBA E;  4KKS A;  4Y7N B;  4TQU S;  2NTT A;  3SK5 A;  4KV6 A;  1EIG A;  2KVM A;  3CRK C;  5IOC A;  4DA2 A;  2PYK A;  4P2C B;  1HCZ A;  2EVB A;  3SHL A;  1OXU A;  2EYH A;  4AYB B;  4DF7 A;  2F0E A;  4HN7 A;  2BOS A;  1LV9 A;  1XYI A;  3DUZ A;  1JB3 A;  2R93 B;  2XRS D;  1K8M A;  4CHT B;  5JPN C;  4OL7 A;  3BYT B;  4A3G B;  3EVQ A;  2Q8I B;  2ZXO A;  4K5W A;  3TP5 A;  4HCE A;  1LTB D;  4CKB A;  4ZAI A;  1JWM D;  5D65 A;  2NN6 I;  5C3E B;  4RCO A;  2PO4 A;  2JP1 A;  1B3A A;  3S1R B;  1EYA A;  1PTO D;  3AMU A;  2B8G A;  3TBI B;  1QCB D;  3DWP A;  1LT5 D;  1A6X A;  4RKB A;  3F2U A;  3UI2 A;  3GO5 A;  1UNS A;  3SE0 A;  3LWE A;  2EOT A;  2F0I A;  2F0Q A;  1EQT A;  1F9P A;  2PZU A;  4KK7 A;  1I4R A;  1CQV A;  2QKI C;  4IQZ A;  1IYU A;  2DNE A;  3I72 A;  3CKI B;  1Q1E A;  1FGB D;  4ME5 A;  2J0T D;  4FYD A;  1RD9 D;  1SJE D;  4KN7 C;  3LX0 A;  1EZ8 A;  3R2I A;  4QCL A;  1WTO A;  2V4D A;  5I9O A;  1U4R A;  1HFG A;  4NDX A;  3HZX A;  4U67 3;  2F0G A;  1W6K A;  3PUW A;  2Q8T A;  1PMR A;  2F03 A;  3Q24 A;  1S5B D;  2PMZ B;  3NP8 A;  1HA5 A;  4BA1 I;  2FJ2 A;  1TKW B;  3M3Y B;  4GZY C;  5E1F A;  1FYC A;  1VF7 A;  1EY0 A;  4A3I B;  4S3S A;  1ET6 A;  4K5X A;  4XQJ A;  1KNE A;  1SYG A;  1KAA A;  2KED A;  3V96 A;  4KJO A;  3S15 B;  2MP1 A;  1ONL A;  5C0X G;  2QCP X;  4ZUI A;  1Q12 A;  3G6J B;  2EYM A;  1JQY D;  1PLF A;  1J9O A;  3I91 A;  1VMP A;  1G91 A;  2WIN B;  4HCS A;  1A3T A;  1IKM A;  1GXD C;  1WD1 A;  2B2W C;  2EY5 A;  1D1K A;  1Q8I A;  1S4Z A;  1BCP F;  5EPJ A;  4PQX A;  5ELE A;  4XT3 B;  4C56 C;  2IW3 A;  4IUR A;  3S2H B;  1KDA A;  3QJY A;  1M4V A;  1SNM A;  5KNB A;  1EY9 A;  2XWB B;  4ABN A;  3J80 E;  3K57 A;  3ERO A;  1RCV D;  4A3E B;  4KN4 C;  1V1P A;  1F9Q A;  1TWG B;  3FPP A;  4RAU C;  5A35 A;  2CQA A;  4XQQ A;  2RKS A;  3M85 A;  1FD7 D;  5EKL A;  1JOR A;  1STH A;  5COR A;  4I65 A;  2K03 A;  1PFM A;  4DGZ A;  1C8C A;  4KY5 A;  1SE3 A;  1MSG A;  1LO5 D;  5I6W A;  1TVX A;  5K36 G;  3W2D A;  2NYZ D;  2O4X A;  1G8Z D;  5EPL A;  1SMY D;  4UDU C;  3MXP A;  2QDB A;  2RDG A;  3S17 B;  1G29 1;  2PZW A;  1DM0 B;  4K6L A;  3H6M A;  4F88 A;  1E2W A;  1F9S A;  1PXU A;  3I73 A;  1XXG A;  3VR4 A;  4XT1 B;  5C4H A;  4EVO A;  4IUQ A;  5JEA J;  3DEO A;  2D62 A;  2E75 C;  2JA5 B;  3KF8 A;  4C3I B;  3L7Z C;  3NTI A;  3E0J A;  4TSS A;  1WCM B;  1ZKO A;  4FO2 A;  4DAP A;  1AW7 A;  2F0P A;  1GJX A;  1JOO A;  4KD4 A;  3J81 L;  4FP5 D;  2K04 A;  3NPP A;  1Y8P B;  1QJO A;  3HS0 C;  1I4P A;  5BN5 A;  5JPM C;  1BO0 A;  5C0X J;  3HOX B;  1H9J A;  2EJF C;  4K14 A;  2PCF B;  4XXE A;  2EDG A;  2IX0 A;  2VB2 X;  4ZKC B;  3CU7 A;  4TKO B;  1CT1 D;  1SNP A;  5ELB A;  3HKZ B;  2Y0S B;  5LL6 S;  4RA8 A;  1EWC A;  5D3D A;  1Z7T A;  1DZ1 A;  2ZT9 C;  2ZXR A;  4K2K A;  4QMG A;  5LL6 X;  5BN3 A;  1SND A;  4ILW A;  5M5X B;  2EYJ A;  3DM1 A;  2F3W A;  3BDL A;  1JE4 A;  4KI0 A;  4ZYS A;  1IW7 C;  2L11 A;  2K7V A;  4IN3 A;  3NUC A;  3C3L A;  3T56 B;  5KRU A;  1H9M A;  1SE4 A;  4KY6 A;  5A2Q E;  3OSO A;  2KQ3 A;  2RDH A;  5FO8 B;  4L8J A;  2VXW A;  1IL8 A;  2M2L A;  5IGD A;  3H3V C;  4HED A;  5C3X A;  3KBX A;  2IWH A;  4K8I A;  1PRT D;  4FNF A;  4MN3 A;  1SEB D;  2IX3 A;  3ND9 A;  4K6D A;  3EA6 A;  3KBG A;  1PZI D;  2A6E D;  3I90 A;  5EKK A;  2R61 A;  5CYU A;  2NB0 A;  5I9P A;  1YNN C;  2EY2 A;  3RZD B;  4F8M A;  1FNU A;  4IUV A;  5CBE E;  5FKA C;  2R92 B;  1DOM A;  2OF1 A;  1QOH A;  3M4O B;  5I6Y A;  3K6O A;  4FXD A;  5I2Y A;  1WD0 A;  1C4Q A;  2YU9 B;  3VR5 A;  1SBB B;  1X3P A;  3NTK A;  3QWN A;  4OO1 H;  2QF7 A;  4OGQ C;  3SEB A;  3W3A A;  5T1G A;  1EQV A;  2G9H D;  4DU9 A;  2AWN A;  3J7A V;  3S1M B;  2CW0 C;  4IFD H;  3GP7 A;  2FMC A;  4B08 A;  3A56 A;  2IPK D;  3A55 A;  2LFN A;  1JIC A;  4PV1 C;  2KA7 A;  2D2C C;  5ELC A;  3T51 B;  3FDT A;  2WP8 J;  2HCI A;  2AUJ D;  2NZ1 D;  2HCC A;  1I4G A;  3I4L A;  2AQ1 B;  4WRD A;  1WTR A;  2JA8 B;  3NWT A;  3TSS A;  4BBR B;  1RJT A;  2F0U A;  4C2M B;  5E4X A;  2KJX A;  4X3T A;  1OO9 B;  2KOL A;  5M3M B;  1CK1 A;  1MD2 D;  4ID6 A;  5C4J B;  1WTW A;  1GUG A;  4G7O C;  3CRL C;  3C2P A;  1M8A A;  5LHY 1;  4KTA A;  4KD3 A;  2AQ3 B;  4DNR B;  4DAV A;  1EWH A;  1EL0 A;  1O78 A;  3I4M B;  4OO1 I;  1GUO A;  2B8F A;  1TR5 A;  2E74 C;  4I7Z C;  3LNN A;  1LTT D;  3ZYY X;  4IFD I;  3MXN A;  2NWG A;  3RMH A;  3NXW A;  4CBV A;  1HPC A;  2JXM B;  2F0V A;  1PZJ D;  4ODG A;  3GTL B;  5J22 A;  1LT6 D;  2NTS A;  1UAP A;  3PIO 3;  4WJW A;  1I6V C;  1YNJ C;  4HMJ A;  1OXS C;  3VA7 A;  1EY5 A;  1ICW A;  1JWS D;  1II3 A;  2QEJ C;  4BS9 A;  3TP6 A;  2F0O A;  2HQE A;  1GUW A;  3T13 A;  2CVR A;  5FLX L;  1U4M A;  1V1O A;  3P20 A;  2L1B A;  3FMC A;  4A3J B;  1D2B A;  4KY7 A;  4IUP A;  5ISR A;  4NP5 A;  4Q0F A;  4BY1 B;  1SYF A;  3GTQ B;  1RTO A;  2MHV A;  3JAM L;  3WOF A;  1Y8O B;  3VYR A;  3FEW X;  4KKT A;  1C48 A;  4FXG C;  3DEP A;  3G7L A;  1EY4 A;  4TRD A;  1SYE A;  2EYF A;  1HQM C;  1ENF A;  3PO3 B;  5EQ0 A;  3BYY B;  4WFN 3;  4EQN A;  2IX1 A;  2G9D A;  2K33 A;  1CHP D;  3K5N A;  1A15 A;  1BR9 A;  5J1Z A;  2BE5 C;  3MAQ A;  1PTO B;  3MFY A;  1S5E D;  1MBY A;  1TS4 A;  2L4N A;  1ESF A;  3J81 E;  1B2T A;  2A68 D;  2LS0 1;  3M7N A;  5CC4 A;  3AB9 A;  1S5C D;  4HAE A;  2A69 C;  1WTX A;  1TT2 A;  4ZK9 B;  1SE2 A;  3KLS A;  1VF5 C;  1RDP D;  4RKL A;  4FVM A;  3S9W A;  2F0M A;  4X3K A;  4HTH A;  1UEA B;  5FK9 C;  2A6H C;  1CZG A;  1XX8 A;  3PV0 A;  1G2T A;  3PO2 B;  3GV3 A;  4RCN A;  2NBF A;  1DOL A;  5C44 B;  3DWA A;  3CQZ B;  3QOL A;  5JEA G;  1CFM A;  2A74 C;  3GTO B;  3N6R A;  3H09 A;  1EEI D;  4RGM A;  2FFK B;  5M5Y B;  3S2D B;  1MGS A;  1R4Q B;  4RHR A;  2F0L A;  3OMG A;  3MXU A;  1EY6 A;  2XIW A;  2H1E A;  5T1I A;  1TWC B;  1PDQ A;  5C5M A;  1ESR A;  1LT3 D;  3D6W A;  1VDZ A;  1TWH B;  3GTP B;  3HGB A;  3C1E A;  3HG9 A;  3A8K E;  1BOS A;  1BCP D;  1ML0 D;  3GTK B;  2E76 C;  4JBW A;  4H0L C;  2KEE A;  4QB4 A;  3N52 A;  5K5P A;  2J7Z A;  1ZXT A;  4IUT A;  2IJ0 A;  1BNZ A;  2EYP A;  4ZLT F;  3X3M A;  2EYL A;  3BZD B;  5C3W A;  5ELF A;  4PMC A;  1PTO C;  2VB3 X;  5C0X I;  1ILP A;  4J8Q A;  5ELD A;  3A54 A;  2B39 A;  1PFN A;  3FVQ A;  2EXZ A;  3QO2 A;  1GUN A;  3Q22 A;  4FF2 A;  1IYV A;  3M4Y A;  3MZ5 A;  1O7Z A;  5K36 H;  3KLS X;  1DOK A;  5NUC A;  4CKC A;  1TS3 A;  2B2U A;  1I4Q A;  1IW7 D;  2NVX B;  3D3R A;  1S5F D;  2D9U A;  5EJW A;  5IT9 L;  3MFG A;  4NW2 A;  3FPU B;  2RA4 A;  1Y8N B;  3ND8 A;  2ID0 A;  2BCO A;  3RUZ A;  3Q23 A;  4R8I A;  1BQQ T;  4O1N A;  1AN8 A;  1AZP A;  1KLU D;  2JA7 B;  4LMQ D;  2Z8L A;  2F0F A;  1AZQ A;  3DMU A;  4ZKB B;  2FIN B;  2ENB A;  5KND A;  1VMC A;  3HP3 A;  4ZQ3 A;  3S16 B;  1H9S B;  3BVM A;  2O2L D;  3NWS A;  1MI2 A;  2F0S A;  2F0N A;  1YNN D;  5CV8 A;  2M00 A;  3PUV A;  3I3C A;  5IGE A;  1X32 A;  2KEC A;  3IKJ A;  1A2U A;  2AQ2 B;  1WTP A;  4F7X A;  3Q0A A;  1A2T A;  2A73 B;  2YYZ A;  3GV6 A;  2NVQ B;  1SYD A;  2RQX A;  1R9T B;  1NR4 A;  3S14 B;  2HUG A;  1NR2 A;  1Q1B A;  2XSC A;  4XYO A;  3C46 A;  1CA5 A;  3LWU A;  3K5O A;  4DK1 A;  3QG1 A;  3H91 A;  5KGU A;  1SXT A;  1KAB A;  4R8N A;  1KLG D;  2TMP A;  1STN A;  3VR6 A;  2BA1 A;  2HDL A;  1H9K A;  1STG A;  4KKU A;  1Q3L A;  1EU3 A;  3I8Z A;  1EFI D;  3Q6S A;  3GTJ B;  3MEH A;  3RLF A;  1RTN A;  5EGT A;  1HQR D;  4QUC A;  1JOQ A;  2F1M A;  1OXV A;  1TY2 A;  2I46 A;  3A7A B;  1QWY A;  5FLX E;  3J7Y W;  2B2Y C;  2B2T C;  5E3F A;  1PRT B;  4DNT B;  1DYQ A;  4G57 A;  3RD4 A;  4E6I A;  4OIK A;  5HUR A;  1LLR D;  5C4Z A;  2K5D A;  3JAM E;  3TZU A;  1SJH D;  3X3N A;  3OIQ A;  2L55 A;  3MTS A;  1EU4 A;  3I70 A;  1DJR D;  2DY7 A;  3PUZ A;  1TS5 A;  1CA6 A;  1BUV T;  5EPK A;  3K5M A;  4H7B A;  1SFO B;  2KHS A;  1FNV A;  1LTA D;  2DNC A;  3BVZ A;  4HMI A;  3IAY A;  3C1F A;  1H9R A;  2OT2 A;  2EY1 A;  2Z4I A;  4XYQ A;  1STA A;  4HSP A;  1DXM A;  3NBI A;  1E2Z A;  5COY A;  1O7Y A;  4C3J G;  1YNJ D;  5KNC A;  2HDM A;  1Q90 A;  2CHB D;  4ZRZ A;  3T4A C;  5JOB A;  3BDO A;  2K5Q A;  4X3S A;  3ITP A;  1NCV A;  1LT4 D;  2X6G A;  3HEJ A;  3A8J E;  5EBC A;  1CZW A;  2AUK A;  1GOZ A;  2ICE C;  1OXT A;  1SYC A;  3BDC A;  3A7L A;  1W6J A;  3E6Z X;  3NK9 A;  5D14 A;  1EOT A;  1HHV A;  1TQO A;  3P75 A;  3VA5 A;  1V8Q A;  2K01 A;  2BA0 A;  1BF4 A;  2XWJ B;  1KDB A;  2WB1 B;  1FNW A;  1F2Y A;  4BA2 I;  3I4N B;  5F2D A;  2XRQ D;  1TWA B;  4RWS C;  2OEO A;  3SVM A;  5C4X B;  3TDQ A;  3OWE B;  1MSH A;  2EZV A;  4FF4 A;  3S1N B;  2O5J C;  4RFB A;  2WV6 D;  4NKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...