3TMEA

Crystal structure of staphylococcal nuclease variant delta+nviagla v23e at cryogenic temperature
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGNTEKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 31
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tmeA00
2F0SA 1EQVA 5I9OA 3QB3A 4PMCA 4TRDA 1SNOA 2O4XA 5IGFA 1STGA 4KHVA 3D8GA 4KTAA 2QDBA 4NP5A 2OEOA 4ID6A 4K5XA 5E1FA 2HQEA 2PZTA 4NMZA 1SNQA 1EYAA 2F0OA 5JOBA 5C4HA 1AEXA 4DFAA 2KQ3A 3C1FA 3T16A 5CR3A 3RUZA 4EQPA 5DAUA 4RKLA 4HMJA 1JOKA 2ENBA 1NSNS 1A3UA 3SK5A 2EYLA 5NUCA 5HGTA 5CC4A 4QB4A 4IALA 4ODGA 1KDCA 4KJOA 2F0WA 3HEJA 3SXHA 2EYMA 4NKLA 4S3SA 5KYLA 5EKLA 1EZ6A 3DHQA 3R3OA 2PW5A 4YIJA 5KRUA 4KD3A 2M00A 3QOLA 5K5PA 3VA5A 1II3A 3QOJA 4K8JA 1EY8A 1KABA 2F0KA 4RKBA 4H7BA 2F0DA 2F3WA 1EY7A 1EY9A 3D4DA 5EKKA 3TP6A 4ZUIA 1JORA 2PQEA 4N9PA 4K14A 3ERQA 5CV7A 5DEHA 1A3VA 3NUCA 2PYKA 3LX0A 3E5SA 4KY7A 2SNSA 1A3TA 1EYCA 4EVOA 2EY2A 3D6CA 5EGTA 5C3XA 3BDLA 2F0JA 5IODA 4K5VA 5IGCA 5KYIA 5IIFA 1SYDA 3OMGA 1NUCA 1STNA 1U9RA 3OMCA 1STHA 4HMIA 4MIUA 1F2YA 2EYFA 3OSOA 4E6IA 4KY5A 4EQNA 5JAVA 4ZUJA 2OF1A 1SYEA 3NHHA 1JOOA 4PNYA 2RDFA 3EROA 3U9OA 2PW7A 1EY0A 4K5WA 4K2LA 4ZQ3A 3NQTA 5IGBA 3MXPA 3NXWA 2PZWA 3H6MA 3PMFA 2EYHA 4B9WA 1STYA 4K8IA 2F0QA 2EYOA 4IUNA 3TP5A 5M9OA 1TQOA 3DMUA 5C4ZA 2EY1A 1F2MA 3EJIA 1A2UA 5IGEA 1RKNA 2F0PA 2F0FA 5F2DA 4B9XA 1EYDA 2F0TA 5CV5A 5J1ZA 5I6WA 4WORA 3T13A 1TR5A 3SK6A 4DF7A 4PMBA 4EQOA 4LAAA 1F2ZA 2KHSA 5CV9A 2EY5A 2F0HA 3P1HA 3MVVA 1KAAA 2F3VA 4J1MA 4N9TA 4QMGA 3D4WA 3TP7A 4KY6A 5KGUA 5I9PA 2F0LA 3EVQA 4KJNA 5J22A 5CGKA 5KEEA 4I65A 2NUCA 4IZ8A 2RBMA 4G57A 4ME5A 3TMEA 1STAA 2EYJA 5C5LA 3V2TA 2OXPA 3OWFA 3SHLA 3SR1A 5I6YA 1EY6A 1ENCA 3SK8A 4NDXA 2F0NA 2F0UA 2PZUA 1SNCA 5E3FA 4DGZA 2EYPA 4KD4A 1ENAA 2WACA 1KDBA 1STBA 5J39A 2SOBA 5IGDA 1SNMA 2F0EA 2F0IA 4QF4A 1SYFA 2F0MA 1EY5A 2RKSA 2EY6A 5C6AA 3BDCA 4K6DA 1SNPA 4OL7A 4KV6A 1SNDA 5HURA 1JOQA 3MHBA 3NK9A 3MZ5A 2SNMA 5KIXA 2F0GA 3SK4A 5C3WA 1IHZA 1EZ8A 1SYCA 1TT2A 5ISRA 2F0VA 1EY4A 4J6HA 4HTHA 3P75A 4R8NA 5CV6A 1SYBA 5C5MA 4WRDA 1A2TA 4F7XA 2EXZA 4DU9A 3S9WA 4F8MA 3NP8A 5CV8A 1KDAA 3MEHA 2LKVA 3HZXA 3C1EA 5CV4A 4K2KA 1SYGA 5IOCA 3TP8A 5IGGA 3ITPA
chains in the Genus database with same CATH superfamily
3GO5A 2F0SA 3RN2A 3QB3A 1PA6A 1HZCA 2WB1E 3S17B 3RN5A 4DK0A 1Q8KA 4RFBA 3LWUA 4JI0L 1BCPB 2IJ0A 4LK1C 4DR1L 2KENA 1QZGA 4JI7Q 2ENBA 1FVIA 3MEFA 3J80i 1I3QH 4HJ5A 1YZ6A 3A5UA 1MSGA 2EYMA 4JI3Q 3NELA 4IFDJ 5C4JB 4DV0L 2NVXH 1DYQA 3HOVB 2E2JB 3PUZA 3GD7A 1QVFA 3I2ZA 1DD2A 5E7NA 4ZUIA 1H9MA 4N9PA 1JB3A 2FHTA 4RWSC 1WI5A 1HRJA 1EFID 5KNDA 5I4DA 1O78A 4JCVE 5IODA 1DONA 2IT1A 4OX9Q 1AW7A 3RMHA 2VQEQ 1NUCA 1F2YA 2SEBD 2ZTEA 1H9JA 4N8X1 1SYEA 3MWYW 1OXTA 4PZ7A 5D65A 3A8KE 3J7YW 3GTMB 4OWTB 3H6MA 4XTCS 1K8MA 4LJZC 3I4NB 3H91A 1ET9A 1HH2P 3GV6A 3GTJH 4DV6L 4BBSH 4WORA 1HR0L 3ULLA 1Q12A 4OXPA 4CJ0B 2QA4A 1TWGB 4JC0A 3BS1A 5GADC 2R92G 1Z9FA 3TS2A 2WAQB 1PMRA 1C48A 4FNFA 1VF5C 1BO0A 2B29A 5GROA 3CMAA 1Q90A 2A68D 4DV1L 2B63B 2KCTA 3RZDH 3H3VH 3U4ZA 1U4MA 4B3RQ 4A75A 3EN2A 3NTHA 4WRDA 1YJNA 1FJGQ 1EIGA 3EQLC 4GNXA 3FVQA 3PSIA 3PGZA 1CZGA 5I9OA 1ET6A 2R92B 2F1MA 4KHVA 1W2BA 4F87A 1BNZA 3H09A 1IBMQ 1SNQA 1EYAA 3HOZB 2A1AA 1L0YB 2YU9H 4GKJQ 4PV1C 4R9WA 4IO9A 4QJFA 4AQYL 3SXHA 1I50B 4P73A 2K50A 4X65L 4A3EH 3I4MH 4DA2A 5FLMH 1TS5A 3GTLB 4RKBA 2A6HC 1NR4A 2EQSA 4X62Q 2UXCQ 5IYBH 5L37A 2Y0SE 5LMNW 1CKNA 4HJ7A 3NUCA 5FK9C 3ULPA 3PUWA 4DR5L 3I3CA 5EBDA 1EYCA 2EY2A 1PH6A 4JI6L 2Z6KC 1DOMA 1XXGA 2A6EC 1LV9A 3S17H 4DR7Q 3UDGA 3PO2H 2OTLA 4DV3L 3OMGA 1I6HH 4HMIA 2JEAI 1Q82C 1LTAD 2VY3A 3HKZE 1VQMA 1XX8A 1BCPC 4RGNA 2ZJQA 1FL0A 4YWLA 2UXDQ 1E7ZA 2TMPA 1KNAA 5IGEA 3MXNB 4UDUC 3GTGB 3NPPA 5AJ3L 3CCQA 1J8IA 5CORA 1GKHA 1XNRQ 1A15A 1ESRA 1JE4A 1JE5A 2XIWA 5JJIA 4JPBW 4H02A 2NWGA 1SMXA 4C2MH 5C0XJ 1OXSC 1QILA 1EY6A 1Z7TA 2AQ3B 4C3HG 1B53A 1LT5D 2AMCB 1I4PA 3A5ZB 4M8AA 3S1MB 1PDQA 4C56C 3ER0A 3BYTB 2L15A 3N6RA 1D5ZC 4OL7A 1N34L 1YNNC 3ND9A 4RH6A 1JOQA 4L6TB 3MXGA 3NK9A 3T1YQ 2PNRC 3STBC 2KCCA 1A2TA 1VMCA 1D6EC 2B2UA 2EXZA 4X64Q 2B2WC 4R4QA 1JC7A 3Q24A 3VYRA 1ASYA 1H9KA 4AYBE 3MTSA 2M2LA 3K5OA 1SNOA 3SVMA 3D8GA 3S2HH 2A5HA 2QEXA 1P16A 4IFDG 5LL6S 4A3FH 3CU7A 4FF2A 3S15B 5TSSA 4A93G 2EYLA 5HGTA 3J81c 3S1RB 3PO3G 3HEJA 1TXYA 2O5IC 2B2VA 1L0XB 1X56A 3PF4A 4DV7L 1XMQL 1ASZA 5T1IA 3J81j 4XIGS 1EY8A 4DR4Q 3PIO3 2JA8G 1K0SA 4HR7B 1PH2A 3CMEA 3K7UC 1VQ4A 3NEMA 1PRTD 4WJ3M 2KBNA 4YY3Q 1XTDA 4HAEA 3I90A 1LO5D 1PYSB 2AUKA 5BN5A 1E2VA 2QW7A 4QUCA 3OTOQ 1O7YA 5JVH3 5IT9E 3A74A 1XJVA 1J6QA 1U9RA 3T1HL 1EQQA 1E2WA 4IQZA 5LMNL 3EROA 1HNZQ 2CQAA 2E5LL 4K2LA 5EKIA 3Q0AA 2G9HD 5M3FB 1QNKA 2KVMA 2DN8A 2L9HA 4B9WA 2DY8A 1PTOD 5M9OA 1E22A 3GTLH 3FPPA 3C2PA 2F0PA 3RD4A 2FMMA 1EYDA 3NBHA 3HOWG 3T13A 3SK6A 4Z9CB 5KNCA 4P72A 5DLQE 4NPSA 5KGUA 5I9PA 4LW1A 1HZBA 1IZ6A 4IPGA 5KEEA 1ZYRC 1TWAB 1AE3A 4H44C 1TWHB 1PZID 1EYGA 1HNWQ 2OQ0A 1VQJA 2UUBL 2R7DA 4C1NI 3D0FA 2AQ2B 2G5DA 2GVBA 2L55A 1PH3A 5J39A 4LFAL 4DXFA 4IOCA 4IUQA 4OGQC 2RKSA 3FKIH 3M4YA 1TKWB 2RHQB 3CCRA 5EJWA 3K57A 2XTIA 3S1NB 1B4OA 4ME3A 5C3WA 3CRLC 1TWCH 4DK3C 3FDTA 4QY7A 1IXRA 1E3PA 2JA7B 4DU9A 1T5XD 2AQ1B 2F3IA 3OW2A 2IPKD 2PCFB 1SYGA 1AP0A 2ALYB 4DAPA 4DNTB 3TDQA 1VQ5A 4ILWA 4CDFC 1SMYD 4TRDA 3T56B 5E1FA 4LUZA 1F9PA 3PUXA 1HFGA 4BA1I 3VYUA 3T16A 3BVZA 3K0XA 4TQUS 1LTTD 1AFPA 2VW9A 5JEAH 5NUCA 5JVG3 3IFTA 4NKLA 5H1SE 3F2UA 1OXVA 4GLXA 3PF5A 2A69C 1N8RC 1EY9A 1X54A 2WINB 1I94L 2ZM6Q 3CW2C 1LM0A 2J4XA 1G2SA 1C9OA 1N33L 1JCKB 1DCZA 1MKHA 2JA5B 4C3HH 3BG3A 2PI2A 3RZOB 1CZWA 5CYUA 4LFCL 2R7ZB 4ZCKA 4GN4B 3GV3A 3ICEA 4PZ8A 3S15H 4GKKL 1SRUA 1A6XA 3S1QB 2K03A 1TS2A 1CUKA 2L0CA 1PYWD 5I6WA 2KEDA 1LTID 2WB1G 4BWGB 1BVSA 2K28A 5J1ZA 4NW2A 4DAYB 3L3OC 1D1IA 4A3JG 3E9IA 5C0XG 3K81C 1F2ZA 3TEHB 4CDDC 2Z6KA 3A55A 3AB9A 5BR8L 3WWVA 1Q81C 4LF5Q 3QJYA 3PV0A 4KY6A 4K0KL 2K33A 1IBKQ 5FJ8H 4NXMQ 4P71A 1GOZA 4JBJA 1TU2B 1HZ9A 2RBMA 2EYJA 3U58A 4IFDH 4JBMA 1EWIA 3FRPB 4DUZL 2RSOA 4NDXA 3J7ZC 4A93H 4DR2Q 2NTTA 3FP9A 4KD4A 1S3OA 3CC4A 3PO3H 4A3GG 1T5EA 1B3AA 1SYFA 4DN4M 4O2DA 3KF8B 2EY6A 3PUVA 4JOIC 3FPUB 1XWEA 2WB1B 3IRBA 4ZYSA 2JA8H 2Q2TA 4C3JB 1AE2A 1GUGA 4J6HA 2K01A 3G7LA 2JA9A 4OWXB 4IUTA 3F8TA 1JMCA 4DV2L 2O5JC 5M5YH 2Q2UA 3AMUA 3C1EA 3WDNA 2B2TC 1C8CA 4LWCA 3M3YH 3G48A 2Z4IA 3VR6A 1KNEA 4A3GB 1I3QB 2Q2HA 2BOSA 4BBRG 1VDZA 2OT2A 2E2DC 4POFA 1RHPA 5IP7G 3PUYA 3R93A 4POGA 1PV4A 3HOWH 2NVXB 2I0QA 4HJ8A 4FF3A 2B2WA 2I46A 2R6GA 4RGMA 4A3IG 4K8JA 4JI2L 1VQAA 4HIMA 1CA6A 4A3DG 2DY7A 1SE3A 2F4VQ 3GTOH 4QQBX 4OELB 4GN3B 3N52A 2RDGA 3DUZA 2HDMA 2N88A 3SGIA 2L5TA 4JI4Q 3P7JA 3UDIA 3A54A 2B8FA 2A6HD 1GM5A 2FXQA 2K05A 1IBLQ 2UUCQ 1PRTC 2K5WA 1YHQA 3HOYG 1SE4A 3PQIA 1CHQD 2XRQD 3GTJB 2A6ED 4BBSB 3EA6A 2NVTH 3HGBA 1GHJA 3EJIA 4QGUA 4V190 1RKNA 4DR3L 4RCOA 3H0GG 5I2YA 1VQBA 1BCPD 3TRZA 4JBKA 2K6AA 5HGQA 3G6JB 4ALPA 3CPFA 1GUWA 2NUCA 4IZ8A 4ME5A 1MJCA 3RZOH 1DOKA 3KLSA 1HR0W 4M1UB 2JXMB 3OOCA 5E3FA 1Q86C 4R8IA 1SNMA 4DR6L 2F0MA 2Y0SG 1VQHA 4O0AA 4YWMA 4CJ1B 4DXGA 1VQPA 1NTGA 1SNDA 2EOTA 1RF2D 1HQMC 2MO0A 2N49A 3LWEA 5KIXA 3I4MG 2D0PA 4OHJA 1EEFD 5IP9G 5JEAJ 3GTQH 4IFDI 2L11A 3K5MA 4NB3A 4CJ2C 1X3PA 1XPRA 1CTMA 4KHPQ 4YHHQ 3HKZG 2X69A 2LKVA 1YNND 2E2HB 2ZTCA 3FEWX 3R2TA 2HIVA 3K7AH 3E0JA 3J81i 3STBD 3PO2G 2HCIA 4GN5A 4DKAC 2YU9B 4IN3A 4HEDA 4NMZA 5JOBA 5CBEE 5IE8A 1Q1EA 4WFN3 4RKLA 1ML0D 2C35B 5C3EG 1RJTA 2K5QA 4A3EB 3I4MB 2KJXA 4IALA 4IPHA 3CXCA 3CD6A 4UP8A 4S3SA 3MXNA 3KFUA 4A3JH 4RCNA 3QOLA 5C0XH 5GAHC 1G91A 1XTCD 3D4DA 1UE1A 4FVMA 1EL0A 3VR2A 5IT9c 3KK7A 1EWHA 4AIMA 3MFYA 1RD9D 1UNSA 1UE5A 2NBFA 1RDPD 3CCSA 1XMOL 4JYAL 1B50A 3PO2B 3W5OA 1EOVA 1I6HB 3L2PA 2SNSA 4JK1C 1IW7C 1X6OA 2F4IA 3OMCA 4A3GH 1B7YB 1EQTA 4EQNA 4IURA 3UDFA 3I7FA 2HUGA 1MGSA 3I56A 1WTWA 1TWFH 1D5XC 1VQOA 2NVYH 1B70B 2AWOA 3PMFA 3QO2A 1JB7A 1LABA 4AYBG 4Y52H 3CF5A 2CHBD 4B9XA 2K75A 1CSPA 2UUAL 3UE1A 5CV9A 1X3EA 5M5WH 1GVPA 4C2MB 2KHJA 2VXWA 4A76A 5K36G 2B39A 2Z8LA 1STEA 3KLWA 4BBRH 2EXDA 4R4CA 1HXYD 1B1ZA 4A3FG 5IP7H 1X55A 2PO4A 1F77A 1MBYA 5DM63 1SXTA 1ZYRD 3MFGA 4AYBB 4DV5L 4A3IH 4DR1Q 3QR8A 4JI8Q 2I5LX 5FOBB 4A3DH 1GO3E 1WTRA 1CKOA 4L5RC 3H15A 1H9SB 4XXEA 1SYBA 2LY7A 1UAPA 2NZHA 1KDAA 4DV0Q 4K2KA 2DNEA 4JI5L 3K8AA 5IOCA 3S2HB 1PHJA 1IYJB 5IYCH 4JVZA 3GTPH 4FYDA 5EQ0A 3CKIB 3HFZB 2QEJC 4A3FB 3ZYYX 1OTCA 4LUOA 3J7A5 1WVLA 4JOIA 2QGQA 3HOYH 1YEZA 1OXUA 4BY7G 4KK7A 4C3IG 1Z6HA 4JI1Q 1JOKA 1LT6D 2ZT9C 4GKJL 1X32A 1KL9A 4C1NK 4QB4A 1IL2A 4ODGA 3ONAB 3H0GH 3X3MA 1I4XA 3M7GA 2M00A 1II3A 4EX5A 3H3VC 3NWSA 2B2TA 1QCBD 4FXKC 1XNQL 1QUQB 4X62L 3M4QA 4RG1A 1JORA 2QILA 4KKUA 4DV6Q 2E2HH 1SDFA 1HR0Q 3TQYA 2PYKA 4F88A 1SROA 2K7VA 2N3SA 4EVOA 1I6VC 5G3LF 3PIP3 2A69D 2JK8A 4DR7L 1HZAA 2PMZB 1D7QA 4A3MG 3HOUH 2LS01 1YIJA 1F2LA 3E0EA 3FKIG 2LXKA 2I5MX 4LF6Q 5IP9H 1JR0D 2UXDL 3S2DH 1J5EQ 1VCIA 1A2UA 1R9TH 5CV5A 3CCLA 4DV1Q 2HQLA 2WIIB 3CP0A 2CH4W 4DAVA 4N9TA 1KAAA 1YNJC 2KEEA 2QF7A 3JAML 1HPCA 2PI2E 3TP7A 5J22A 4LF4Q 4CKEA 4EGVA 1MSHA 4NXNL 2OXPA 1YBYA 5BN3A 4KI0A 2KECA 2VZAA 4H0LC 3LNNA 5C3EH 3FKIB 1N9WA 5JEAG 5G3LD 4MTKA 4OO1H 2K5HA 3C46A 1TWCB 2J7ZA 2SNMA 2F0GA 2QCPX 3SK4A 2BH2A 3VA7A 4B3TL 4AQYQ 2D2CC 3CQZH 4HTHA 4HN7A 4LF8L 4X64L 3S9WA 4X3KA 2KUMA 2GN5A 1WTXA 4IUPA 3ITPA 5COYA 2EJGC 1EQVA 2LSSA 3BJUA 2ES2A 1STGA 2QDBA 2B3GA 2BH8A 2PZTA 1SE2A 4DR5Q 1KD1C 1SBBB 3C1FA 4DFAA 4JI6Q 2N8NA 2EIFA 4KKTA 5IT9L 2NZ1D 4B08A 4DV3Q 4YCVA 1A3UA 1PRTF 5BN4A 2JYOA 2KCNA 5EPLA 4XQJA 4JV5Q 3NQIA 3JAME 1Z47A 3PIOA 2MJ8A 2IX1A 5K5PA 1LUZA 2K5VA 4DR4L 4H7BA 4EQ5A 2E2IB 1K83H 3TP6A 1R4QB 1K3BC 2CW0C 5K36H 5AFWA 5EPKA 4BS9A 4C3HB 3G71A 5FJ8G 4YY3L 5AJ3Q 1A0IA 3HOXH 5CMDA 1PTOF 1A3TA 3H3VI 3RLOA 4K5VA 2BDOA 1PH5A 3OSOA 2A8VA 1S4ZA 1SSOA 1B9NA 3KF8A 2OQKA 4ZQ3A 4LF7L 1V43A 4GS3A 5IY0A 5T1GA 2EYHA 2F0QA 2EYOA 4P74A 5D3DA 4PQXA 1O7ZA 1VQDA 2E76C 1VQ6A 1N34Q 2DGYA 3A0JA 5E4XA 5ELEA 4LAAA 4WJ4A 3EBEA 4HCEA 5EBCA 3R8BA 3BVMA 3OW7A 2XGTA 4QUFA 4KJNA 4YCWA 1NJIC 2WAQE 1Q46A 3NSWA 3JAMi 4A93B 4J8QA 4YCUA 1STAA 2K14A 1PH9A 4BY7H 4GOPB 4P75A 1LTSD 4J15A 2HD3A 4C3IH 3SHLA 3F2CA 3PO3B 1G6ZA 3IFDA 3P20A 1NE3A 1VQEA 2IX3A 1R4PB 2ZJPA 1ENAA 1Y8OB 2JA6H 1PZKD 2WP8J 2JA8B 2RSNA 3IKJA 3MHBA 4DV4L 3T53B 4CKCA 4HIKA 4UPAA 1EZ8A 4G7HC 2F0VA 1UE6A 3M4PA 5M5YB 3D31A 2MHVA 2Q8TA 2E74C 4B3MQ 1PVOA 1L1OB 1A62A 3M3YB 2IHFA 1RTNA 3HZXA 3SEBA 3TN2A 4CGYB 3TP8A 1N32L 4PMCA 4A3MH 3LGJA 3DWQA 3A8IE 3BZKA 3Q22A 1O7IA 1UUPA 1D8LA 3TS0A 2MFIA 3HOWB 3T1HQ 2DUDA 3NE5B 2R61A 5LMNQ 3VDYA 2E5LQ 3DHQA 2PW5A 1V1PB 3GTOB 1U0LA 1M4VA 4KKSA 4LUVA 2V4DA 3PCOB 1X3FA 1CQFA 2R93G 2ZM6L 4IPCA 4X3UA 1NBWA 3GTKH 3CC2A 1VQGA 1NMFA 2H5XA 2KOLA 2IL8A 1ESFA 2WV6D 4KY7A 1EIHA 4TSSA 3R2IA 3Q6SA 3W1GA 5FLXL 1F9QA 4GLAC 4MIUA 1PFBA 4E6IA 2EYFA 1Q7YC 3U9OA 1VQCA 3M4OH 3TZUA 2NVTB 1RCVD 3BZCA 2UUBQ 1WTHA 2FMCA 1K0RA 5FO8B 4HSVA 1STYA 4R4TA 4XDXA 1IW7D 1EFWA 1D2BA 1QZHA 3CHBD 4LFAQ 1XPUA 3DMUA 1VQNA 3AFPA 1WCMH 2F0FA 1OXXK 2XN9C 1CHPD 3V05A 2E2IH 4P2CB 1VQIA 2C5CA 1CI3M 1M8AA 1D1KA 3D4WA 3L0OA 1QB5D 3KDFB 1IBKL 3BDOA 2VL6A 3DWPA 5C4XG 4DK6C 3KBGA 2DJGC 4ZK9B 1V1OA 3OYYA 4QIWB 1PH4A 1UEAB 2F52A 3HG9A 2NYZD 2UU9L 2EYPA 1WTOA 2R7FA 2Z4HA 2F0IA 4A4IA 1KC8C 1Y1VG 5C6AA 3BDCA 1SNPA 3GTQB 3MZ5A 1EU4A 1CT1D 1FGBD 3S14H 5FLXE 4FF4A 2SDFA 4ABNA 3K7AB 1VQFA 1KQSA 4Q0FA 2NN6G 5IWAL 1LTBD 5IGFA 3J7AV 1G6PA 1SFOH 2CFMA 2HQEA 3CPWA 1XYIA 1LTGD 2IW3A 1M90C 2HHHQ 1N33Q 1G2TA 1MD2D 3A7LA 4CHTB 1E0BA 4GOPC 1GUSA 1Y1VB 2V1CC 4L5SA 4LFCQ 1ENFA 1NSNS 3SK5A 5LMUQ 4PG3A 4A3JB 1VQKA 1QOHA 5DNFA 4GKKQ 4B3SL 1EZ6A 2JJQA 2OWOA 2NVQH 5KRUA 1KRTA 3BU2A 3QOJA 2PQAB 2VQFL 1B3QA 2F0DA 5EKKA 2F4VL 5CV7A 3K0YA 5ELCA 1BBXC 4RMFA 3LX0A 1L1OC 1X9NA 5E4WC 1DXMA 5BR8Q 5FO9B 4G7OC 1GJXA 4LNQA 4K0KQ 3FMCA 3NWTA 3B6YA 4BY1G 1GUNA 3K6OA 3G6EA 3JC66 3UE0A 1TWFB 1PZJD 4KY5A 2NVYB 3KLRA 4ZRZA 5M3MG 2OF1A 1IBLL 2UUCL 1BCPF 5JJKA 1EY0A 4DUZQ 3CCEA 5I2XA 2BA1A 5GAGC 3I91A 1AN8A 4MHEA 4UHVA 3H94A 1EU3A 4OONA 1Q1BA 1H9SA 4I7ZC 3K58A 3DWAA 3I72A 2XWJB 2LMCB 5M5WB 5JJZA 2VUMG 4DF7A 4RHSA 1HA6A 3URYA 2EY5A 2UXBL 5JPNC 5IYCG 4A3KH 5HY6A 2BDNA 4BBRB 2IWHA 2RCFA 1VQLA 1GUOA 4X66L 2F0NA 2EDGA 1HA5A 2RDHA 3OIPA 1YNJD 1STBA 4A3IB 2YTVA 1K28A 2FFKB 5IGDA 1EEID 1P8LA 4DUYL 2IY5B 4A3DB 4PZ6A 1KLUD 4LFBQ 4A3LG 4L63B 2M9VA 1TT2A 2R93H 1QUQA 1ILQA 4H13C 3HS0C 1X3GA 1HJPA 4JI2Q 1BKBA 1QVCA 3IL8A 2F03A 3GTPB 5CV4A 2MPMA 5LL6X 1MIUA 1M1KC 3MC0B 3HOYB 2O4XA 4NP5A 4KTAA 1PTOH 4RHRA 4IOAA 1VF7A 3JAMc 3HOUG 2GA4B 1J9OA 1HNXQ 5EPJA 1SJHD 1K8GA 4EQPA 4HMJA 4KN4C 3H0GB 4O1NA 3SDZA 2A74C 2LXJA 1WOCA 3VA5A 4LF9L 2RHSB 2F0KA 3CRKC 1N36L 1GD7A 3QWNA 3BVGA 3DEOA 4K14A 5C4XH 4DR3Q 1PFMA 3VR5A 1FNVA 1WTQA 2YV5A 1HHVA 2Y0SB 3J80E 3HOUB 1RTOA 4JI7L 1JWMD 1VQ7A 1STNA 4BXXG 5A35A 2CW0D 1Y1VH 4PNYA 4JI3L 1YJWA 1PYBA 4OO1G 3S2DB 1QNUA 1R9TB 1G51A 1AZQA 1TQOA 3HKZB 1D5MC 4KLKA 4ULLA 1MJEA 4QL5A 2CKZB 2HT1A 5DM73 3WOFA 4HJAA 2NN6H 3MA2B 4MNOA 4QMGA 3K59A 1X3QA 5LHY1 2F0LA 4OX9L 1JICA 1TS4A 1S5BD 4G4KA 2VQEL 2D5DA 2ZXPA 4I65A 3UDXA 3ZJYC 3HOVG 1SE8A 5C3EB 1X65A 3V2TA 1UWVA 3T4AC 3Q23A 4CDEC 1EQRA 1HTPA 2JSOA 1VS0A 2FINB 1CA5A 4YWKA 2B2YC 2JN4A 2BE5D 3AEVA 3CQZB 3SE0A 4JI8L 4IUUA 1W3SA 1H95A 1B9MA 2KHIA 2ZXRA 3U50C 4HIDA 1DOLA 1S5CD 1U4PA 3K80C 2Q8IB 3I4NG 5CV8A 3M9BA 3HOXG 5ELFA 1IYUA 4BY1H 1Y14B 4OIKA 5M3MH 1S5FD 1U5KA 4K5XA 1XMOQ 2EJMA 4R4OA 4JYAQ 2ZXOA 4JI0Q 1AEXA 2KQ3A 2QDLA 4JI1L 3V96A 4UP9A 3RLFA 2Z9HA 4APVA 4KJOA 4JBWA 1A8VA 4B3RL 2VUMH 2WAQG 1K83B 4YIJA 2RCNA 1FJGL 3KUPA 2CCZA 3CCMA 1LTLA 2BCOA 3HOXB 2JEBI 2RF4A 3ND8A 4UP7A 2B63G 1SAPA 2EVBA 5DEHA 1UE7A 3PIPA 1KHIA 2MUYA 2UUAQ 1HUNA 1IBML 1EIFA 4DNIA 3E5SA 4OIJA 4GOPA 3KF6B 4QCLA 2K4KA 2F0JA 2VB3X 3KJPA 1BUVT 2TSSA 3D3RA 1SYDA 1LT4D 4V0BA 1PXUA 2EPBA 5IIFA 3C3LA 1VQ8A 2JA6G 4F8MA 3NHHA 2E8GA 1EUJA 3HP3A 3NQTA 4A3BH 4A3LH 3NXWA 3S16H 4LF6L 2YTYA 1WD1A 2XRSD 2CWAA 2EY1A 5C4ZA 1I5FA 4Y7NH 1J5EL 3HOZG 2UXCL 4DV5Q 3EIVA 2D0OA 4UAIA 5KNBA 1GXDC 1L1OA 1XPOA 2F0HA 1I4RA 1DM0B 1H9RA 1OO9B 1V8QA 3NTIA 4J1MA 4BY7B 3W1BA 2ICEC 1UEBA 4C3IB 5C0XI 4LF4L 1SN8A 2ZJRA 4ZKCB 2JA6B 5D14A 2OTJA 1ONLA 4JI5Q 1ENCA 4G7ZC 3A7AB 2AHOB 2A19A 1K3RA 2LFNA 2NN6I 5FLXc 1YJ9A 2NTSA 3AYHB 1TY0A 1V1PA 4I7AA 2X6GA 1XNRL 1I4HA 4XQNA 5ISRA 1FGUA 1QVGA 5CV6A 1LACA 2OCEA 2IHEA 2K1BA 1LT3D 3EFXD 1YVCA 4A3MB 4GLVB 1Y1WH 1XNQQ 4ZKBB 4BXXH 2L1BA 4ID6A 3VYSA 2K52A 1S5ED 5C4HA 1WFQA 1QWYA 4RA8A 5DAUA 4XYQA 2YTXA 4JV5L 3T1YL 4X65Q 1BBUA 1WCMG 3R3OA 3E3XA 4DNRB 1IKMA 3GTKB 1IYVA 1B2TA 5C4JH 3KDFA 3HOVH 2E2JH 1KXLA 2Q8RE 3A8JE 2K04A 5C3XA 3BDLA 1F9SA 3M4OB 5FO7B 1DZ1A 2FJ2A 1STHA 3G4SA 4NXNQ 1Y8PB 4OEMB 2MNAA 4X3TA 3KJOA 4K5WA 1AH9A 2RA4A 1WD0A 4DAYA 3CCJA 1WCMB 1MHWC 1DJRD 3TP5A 2EJFC 4JW0A 1E2ZA 5ELBA 3GTMH 2GVAA 3I4NH 4IPDA 1YHBA 3I73A 1NAPA 3U4VA 4B3TQ 3J7AF 3P1HA 2F3VA 3OTOL 2JP1A 1JJGA 2WFWA 4LF8Q 4PMWA 2J0TD 3FHWA 4IUVA 5C5LA 3ULJA 1HNZL 1FNWA 3OWFA 1JWSD 1TWGH 4DGZA 1B8AA 2PZUA 2RVLA 2VNUD 1NR2A 5EAYA 2C9OA 1MI2A 4MTNA 2F0EA 3QIAA 2HCCA 2HIXA 1O7LA 3S14B 1ILPA 5HURA 2PQAA 2E75C 1ZKOA 3DXJC 2MQHA 4X3SA 5CBAE 1ICWA 4DPGA 5M3FG 2B63H 2L4NA 5C5MA 2EZVA 1CSQA 1QJOA 3L7ZC 4B3ML 1EOTA 3OHXC 1GHKA 3OIQA 2BE5C 1HNWL 4IJHA 1SR3A 2VB2X 1SFOB 5IGGA 1KIXA 3F1ZA 4MZ9A 3MAQA 1WTPA 2B8GA 2B2YA 2R92H 3BZDB 1BF4A 5CR3A 1YNXA 1KTKA 2KA7A 2ASBA 4AH6A 2R3ZA 2NVQB 5CC4A 2PNHA 3HOZH 1KAWA 2Z6BA 4RAUC 1AZPA 1CK1A 2K5DA 4DV7Q 3KLSX 4LF7Q 1XMQQ 2ID0A 5A2QL 3AQQA 1KABA 3DM1A 1SLJA 4L8JA 2F3WA 1EY7A 1I50H 1NCVA 4KHZA 4FXGC 1U4LA 4OO1I 4CBVA 2DJFC 3J80c 4HSPA 4A3CG 4A3KG 4U673 1FR3A 1A3VA 2PMZE 4LMQD 4GNXB 1BDOA 1LLRD 5EGTA 3DM3A 2JA7G 5C44G 1C7YA 3K5LA 2N78A 5JAVA 2AUJD 4FP5D 1B44D 4ZUJA 1C4QA 2RDFA 3GP7A 5IGBA 4ZLTF 1HCZA 1A63A 2PZWA 1Q8IA 5GAEC 1ICFB 4IUNA 1Y8NB 1RIPA 1ZXTA 1F2MA 1FYCA 3TSSA 1RL2A 2F0TA 4XT3B 3A56A 1PFSA 4Q5VA 4DV4Q 4A3KB 5JPMC 3RNUA 3GTGH 3W2DA 3HRZC 3WOEA 3EVQA 1CKNB 2H1EA 4R4IA 3TMEA 4G57A 5C44B 1TY2A 2A68C 3E6ZX 3SR1A 3SK8A 1N32Q 5A2QE 1K8AC 1SNCA 2ZTDA 1QG7A 2WACA 1PRTB 5IYDG 4HIOA 2JA5G 4QF4A 4R1JA 2K5NA 2R7ZG 2R93B 5M5XB 1K8OA 4KV6A 3S1MH 4DAMA 2ICIA 1PLFA 1SYCA 2A73B 1EY4A 3NTKA 4LF5L 1EWCA 2Q2IA 3ERSX 4NXML 2K32A 3NP8A 3HKSA 2CWPA 3KBXA 1KRSA 3VYTA 1PTOB 3D4RA 4DR2L 3T51B 2QKIC 3CAMA 3S24A 1PH1A 5ELOA 3D6WA 2HHHL 2F0OA 1JJCB 4FO2A 1FNUA 1V1QA 1HTLD 5LMUL 3NENA 1YI2A 3AFQA 1KDCA 1VMPA 4MN3A 1JWUD 2WKCA 2WKDA 2CVRA 1LTRD 1EIYB 1S5DD 3DLLA 1U4RA 3S1RH 1LYLA 5C4XB 4UY8C 1I94Q 1E1OA 1K9MC 3ERQA 4K6LA 1S72A 4C3JG 4KMUC 3O13A 3VR4A 3CCVA 5KYIA 4TVAB 1RODA 3W3AA 1JOOA 2PW7A 3F2BA 2D9UA 3GQBA 4FDBA 1I4GA 1WTVA 3MXUA 2UU9Q 2IX0A 1Y69U 2NB0A 2P5ZX 1BXTA 2L12A 4JG2A 4K8IA 4RGTA 3RLNA 5M3FH 5F2DA 1NNXA 4XT1B 1O80A 4PMBA 4EQOA 1JJ2A 4JI4L 1VQ9A 1JT8A 5CGKA 5JJLA 4IJLA 3J81L 1BBWA 5I6YA 4GNXC 1TWAH 1CFMA 5IWAQ 1DGSA 2F0UA 3X3NA 3OWEB 1PFNA 1TWHH 2EE1A 1I4QA 1YHAA 1KDBA 3TZDA 2SOBA 2G9DA 2HDLA 4CKBA 2PPBC 4TKOB 2AWNA 1W6JA 1PH7A 4ZAIA 4K6DA 3I55A 4LFBL 1TVXA 1BR9A 2MP1A 3I4OA 1W6KA 1IHZA 2MO1A 4XQQA 3P75A 3I8ZA 4B3SQ 4A3CH 2X6LA 1BOSA 3NBHB 4DV2Q 3S1NH 4L5QA 4BY1B 4OWWB 1BQQT 4BBSG 1CQVA 1WJJA 1SEBD 2VQFQ 5M3MB 3UI2A 2MGSA 3AU7A 3I4LA 3KF6A 2JA7H 5C44H 2N55A 2JQOA 2O2LD 2OEOA 3NBIA 3K5NA 3M85A 4X6AH 1HUMA 1HNXL 3OPOA 3RUZA 2XVSA 3J80L 4A3BG 2VUMB 3KYHC 1CM9A 5M5XH 2KCMA 1TIID 2F0WA 2D62A 5KYLA 5EKLA 1L0WA 5J3BA 2AKWB 4KHPL 4KD3A 4YHHL 1HFNA 1FD7D 4FXDA 2CQOA 3J81E 1NY4A 3M7NA 2VS1A 1SJED 4N8FA 3IAYA 4KN7C 2PQEA 2XWBB 4RGOS 2JE6I 2ATWA 3Q8DA 2XNAC 2NZOA 4L5TA 1TS3A 2I5HA 2I07B 3D6CA 2UXBQ 1HQRD 1PTOC 3BYYB 5IGCA 3TREA 3QG1A 5IYDH 2JA5H 4FF1A 4A3BB 1IKLA 1E24A 5ELDA 3S16B 2R7ZH 3CC7A 3TBIB 4X66Q 1JQYD 3MXPA 4Y7NB 4XYOA 4DK1A 1ZEQX 1KLGD 3RR5A 2XSCA 3S1QH 4DUYQ 3RZDB 1GUTA 1NMGA 1TR5A 1L2FA 4A3EG 5FKAC 2KHSA 5FLMG 4QIWE 4WJWA 3MVVA 1Y1WG 2H4OA 5IYBG 1Q3LA 3CCUA 4GZYC 2Z1CA 2B2UC 1C0AA 1S40A 3KOJA 4HCSA 2YYZA 2CH4A 4U68A 1IL8A 1PH8A 5D3IB 3F2DA 1QE6A 5ELNA 4DR6Q 1EY5A 2BA0A 1WYDA 1T9HA 1V9PA 1F9RA 3DEPA 4O42A 1CKMA 2RQXA 2Z0SA 3I70A 3L9AX 1YITA 4BA2I 3VR3A 1SMYC 3U9SA 4R8NA 5GQOA 1Y1WB 2B2VC 1K73C 4F7XA 4C3JH 4CDCC 2DNCA 4LF9Q 1G291 3GDEA 3MEHA 1N36Q 1E1TA 1G8ZD 3E9HA 4HJ9A
chains in the Genus database with same CATH topology
3GO5A 2F0SA 3QB3A 3S17B 4DK0A 4RFBA 3LWUA 1BCPB 2IJ0A 4LK1C 2ENBA 1MSGA 2EYMA 4IFDJ 5C4JB 1DYQA 3HOVB 2E2JB 3PUZA 3GD7A 1DD2A 4ZUIA 1H9MA 4N9PA 1JB3A 2FHTA 4RWSC 1HRJA 1EFID 5KNDA 5I4DA 1O78A 5IODA 1DONA 2IT1A 1AW7A 3RMHA 1NUCA 1F2YA 2SEBD 1H9JA 1SYEA 3MWYW 1OXTA 5D65A 3A8KE 3J7YW 3GTMB 3H6MA 4XTCS 1K8MA 4LJZC 3I4NB 3H91A 1ET9A 3GV6A 4WORA 1Q12A 4CJ0B 1TWGB 3BS1A 2WAQB 1PMRA 1C48A 4FNFA 1VF5C 1BO0A 1Q90A 2A68D 2B63B 1U4MA 3NTHA 4WRDA 1EIGA 3EQLC 3FVQA 1CZGA 5I9OA 1ET6A 2R92B 2F1MA 4KHVA 4F87A 1BNZA 3H09A 1SNQA 1EYAA 3HOZB 1L0YB 4PV1C 4R9WA 3SXHA 1I50B 4DA2A 3GTLB 1TS5A 4RKBA 2A6HC 1NR4A 3NUCA 5FK9C 3PUWA 3I3CA 5EBDA 1EYCA 2EY2A 1DOMA 1XXGA 2A6EC 1LV9A 3OMGA 4HMIA 2JEAI 1LTAD 1XX8A 1BCPC 4RGNA 2TMPA 1KNAA 5IGEA 4UDUC 3GTGB 3NPPA 1J8IA 5CORA 1A15A 1ESRA 1JE4A 2XIWA 2NWGA 5C0XJ 1OXSC 1QILA 1EY6A 1Z7TA 2AQ3B 4C3HG 1B53A 1LT5D 1I4PA 4M8AA 3S1MB 1PDQA 4C56C 3BYTB 3N6RA 1D5ZC 4OL7A 1YNNC 3ND9A 4RH6A 1JOQA 4L6TB 3MXGA 3NK9A 2PNRC 2KCCA 1A2TA 1VMCA 1D6EC 2B2UA 2EXZA 2B2WC 1JC7A 3Q24A 3VYRA 1H9KA 3MTSA 2M2LA 3K5OA 1SNOA 3SVMA 3D8GA 2A5HA 4IFDG 5LL6S 3CU7A 4FF2A 3S15B 5TSSA 2EYLA 5HGTA 3S1RB 3HEJA 2O5IC 2B2VA 1L0XB 5T1IA 4XIGS 1EY8A 3PIO3 4HR7B 1PRTD 4HAEA 3I90A 1LO5D 2AUKA 5BN5A 1E2VA 5IT9E 4QUCA 1O7YA 5JVH3 1U9RA 1E2WA 4IQZA 3EROA 2CQAA 4K2LA 5EKIA 3Q0AA 2G9HD 5M3FB 1QNKA 2KVMA 2DN8A 2L9HA 4B9WA 2DY8A 1PTOD 5M9OA 3FPPA 3C2PA 2F0PA 3RD4A 2FMMA 1EYDA 3NBHA 3T13A 3SK6A 4Z9CB 5KNCA 5KGUA 5I9PA 5KEEA 1ZYRC 1TWAB 4H44C 1TWHB 1PZID 4C1NI 2AQ2B 2L55A 5J39A 4DXFA 4IUQA 4OGQC 2RKSA 3M4YA 1TKWB 5EJWA 3K57A 3S1NB 1B4OA 5C3WA 3CRLC 3FDTA 2JA7B 4DU9A 1T5XD 2AQ1B 2IPKD 2PCFB 1SYGA 1AP0A 4DAPA 4DNTB 3TDQA 4ILWA 1SMYD 4TRDA 3T56B 5E1FA 1F9PA 3PUXA 1HFGA 4BA1I 3VYUA 3T16A 3BVZA 4TQUS 1LTTD 1AFPA 5JEAH 5NUCA 5JVG3 3IFTA 4NKLA 3F2UA 1OXVA 2A69C 1EY9A 2WINB 2J4XA 1G2SA 1JCKB 1DCZA 2JA5B 3BG3A 3RZOB 1CZWA 5CYUA 2R7ZB 3GV3A 1A6XA 3S1QB 2K03A 1TS2A 2L0CA 1PYWD 5I6WA 2KEDA 1LTID 4BWGB 2K28A 5J1ZA 4NW2A 3L3OC 1D1IA 5C0XG 1F2ZA 3A55A 3AB9A 3QJYA 3PV0A 4KY6A 2K33A 1GOZA 1TU2B 2RBMA 2EYJA 4IFDH 3FRPB 2RSOA 4NDXA 2NTTA 4KD4A 1T5EA 1B3AA 1SYFA 4DN4M 2EY6A 3PUVA 3FPUB 1XWEA 2WB1B 4ZYSA 4C3JB 1GUGA 4J6HA 2K01A 3G7LA 4IUTA 2O5JC 3AMUA 3C1EA 3WDNA 2B2TC 1C8CA 2Z4IA 3VR6A 1KNEA 4A3GB 1I3QB 2BOSA 1VDZA 2OT2A 2E2DC 1RHPA 3PUYA 3R93A 2NVXB 4FF3A 2B2WA 2I46A 2R6GA 4RGMA 4K8JA 1CA6A 2DY7A 1SE3A 3N52A 2RDGA 3DUZA 2HDMA 2N88A 2L5TA 3P7JA 3A54A 2B8FA 2A6HD 2K05A 1PRTC 2K5WA 1SE4A 1CHQD 2XRQD 3GTJB 2A6ED 4BBSB 3EA6A 3HGBA 1GHJA 3EJIA 4V190 1RKNA 4RCOA 5I2YA 1BCPD 2K6AA 3G6JB 1GUWA 2NUCA 4IZ8A 4ME5A 1DOKA 3KLSA 4M1UB 2JXMB 3OOCA 5E3FA 4R8IA 1SNMA 2F0MA 4CJ1B 4DXGA 1SNDA 2EOTA 1RF2D 1HQMC 3LWEA 5KIXA 4OHJA 1EEFD 4IFDI 5JEAJ 2L11A 3K5MA 4CJ2C 1X3PA 1CTMA 2X69A 2LKVA 1YNND 2E2HB 3FEWX 3R2TA 3E0JA 2HCIA 2YU9B 4IN3A 4HEDA 4NMZA 5JOBA 5CBEE 1Q1EA 4WFN3 4RKLA 1ML0D 1RJTA 2K5QA 4A3EB 3I4MB 2KJXA 4IALA 4S3SA 3MXNA 4RCNA 3QOLA 5C0XH 1G91A 1XTCD 3D4DA 4FVMA 1EL0A 3VR2A 3KK7A 1EWHA 3MFYA 1RD9D 1UNSA 2NBFA 1RDPD 1B50A 3PO2B 1I6HB 2SNSA 4JK1C 1IW7C 2F4IA 3OMCA 1EQTA 4EQNA 4IURA 2HUGA 1MGSA 1WTWA 1D5XC 2AWOA 3PMFA 3QO2A 1LABA 2CHBD 4B9XA 5CV9A 4C2MB 2VXWA 5K36G 2B39A 2Z8LA 1STEA 1HXYD 1B1ZA 2PO4A 1F77A 1MBYA 5DM63 1SXTA 1ZYRD 3MFGA 4AYBB 5FOBB 1WTRA 1H9SB 4XXEA 1SYBA 2LY7A 1UAPA 1KDAA 4K2KA 2DNEA 5IOCA 3S2HB 4FYDA 5EQ0A 3CKIB 2QEJC 4A3FB 3ZYYX 1WVLA 1OXUA 4KK7A 4C3IG 1Z6HA 1JOKA 1LT6D 2ZT9C 1X32A 4C1NK 4QB4A 4ODGA 3ONAB 3X3MA 1I4XA 3M7GA 2M00A 1II3A 3H3VC 3NWSA 2B2TA 1QCBD 4FXKC 1JORA 2QILA 4KKUA 1SDFA 2PYKA 4F88A 2K7VA 4EVOA 1I6VC 5G3LF 3PIP3 2A69D 2PMZB 2LS01 1F2LA 1JR0D 1VCIA 1A2UA 5CV5A 2WIIB 4DAVA 4N9TA 1KAAA 1YNJC 2KEEA 2QF7A 3JAML 1HPCA 3TP7A 5J22A 4CKEA 4EGVA 1MSHA 2OXPA 5BN3A 4KI0A 2KECA 4H0LC 3LNNA 3FKIB 5JEAG 5G3LD 4OO1H 3C46A 1TWCB 2J7ZA 2SNMA 2F0GA 2QCPX 3SK4A 3VA7A 2D2CC 4HTHA 4HN7A 3S9WA 4X3KA 2KUMA 1WTXA 4IUPA 3ITPA 5COYA 2EJGC 1EQVA 1STGA 2QDBA 2PZTA 1SE2A 4DFAA 1SBBB 3C1FA 4KKTA 5IT9L 2NZ1D 4B08A 1A3UA 1PRTF 5BN4A 2JYOA 2KCNA 5EPLA 4XQJA 3NQIA 3JAME 1Z47A 2MJ8A 2IX1A 5K5PA 4H7BA 2E2IB 3TP6A 1R4QB 2CW0C 5K36H 5AFWA 5EPKA 4BS9A 4C3HB 5CMDA 1PTOF 1A3TA 4K5VA 2BDOA 3OSOA 1S4ZA 1SSOA 1B9NA 3KF8A 4ZQ3A 1V43A 5T1GA 2EYHA 2F0QA 2EYOA 5D3DA 4PQXA 1O7ZA 2E76C 5E4XA 5ELEA 4LAAA 4HCEA 5EBCA 3R8BA 3BVMA 3OW7A 4QUFA 4KJNA 3NSWA 4A93B 4J8QA 1STAA 1LTSD 1G6ZA 3SHLA 3PO3B 3IFDA 3P20A 2IX3A 1R4PB 1ENAA 1Y8OB 1PZKD 2WP8J 2JA8B 2RSNA 3IKJA 3MHBA 3T53B 4CKCA 1EZ8A 4G7HC 2F0VA 5M5YB 3D31A 2MHVA 2Q8TA 2E74C 3M3YB 3SEBA 1RTNA 3HZXA 3TN2A 4CGYB 3TP8A 4PMCA 3DWQA 3A8IE 3Q22A 1UUPA 3HOWB 3NE5B 2R61A 3DHQA 2PW5A 1V1PB 3GTOB 1M4VA 4KKSA 2V4DA 1CQFA 4X3UA 2KOLA 2IL8A 1ESFA 2WV6D 4KY7A 1EIHA 4TSSA 3R2IA 3Q6SA 5FLXL 1F9QA 4MIUA 1PFBA 4E6IA 2EYFA 3U9OA 3TZUA 2NVTB 1RCVD 2FMCA 5FO8B 4HSVA 1STYA 4XDXA 1IW7D 1D2BA 3CHBD 3DMUA 2F0FA 1OXXK 2XN9C 1CHPD 3V05A 4P2CB 2C5CA 1CI3M 1M8AA 1D1KA 3D4WA 1QB5D 3BDOA 3DWPA 3KBGA 4ZK9B 1V1OA 4QIWB 1UEAB 3HG9A 2NYZD 2EYPA 1WTOA 2Z4HA 2F0IA 5C6AA 3BDCA 1SNPA 3GTQB 3MZ5A 1EU4A 1CT1D 1FGBD 5FLXE 4FF4A 2SDFA 4ABNA 3K7AB 4Q0FA 2NN6G 1LTBD 5IGFA 3J7AV 2HQEA 1XYIA 1LTGD 2IW3A 1G2TA 1MD2D 3A7LA 4CHTB 1E0BA 1GUSA 1Y1VB 1ENFA 1NSNS 3SK5A 4A3JB 1QOHA 5DNFA 1EZ6A 5KRUA 3QOJA 2F0DA 5EKKA 5CV7A 3K0YA 5ELCA 1BBXC 3LX0A 5E4WC 1DXMA 5FO9B 4G7OC 1GJXA 3FMCA 3NWTA 1GUNA 3K6OA 1TWFB 1PZJD 4KY5A 2NVYB 3KLRA 4ZRZA 2OF1A 1BCPF 1EY0A 5I2XA 2BA1A 3I91A 1AN8A 4MHEA 3H94A 1EU3A 1Q1BA 1H9SA 4I7ZC 3K58A 3DWAA 3I72A 2XWJB 2LMCB 5M5WB 5JJZA 4DF7A 4RHSA 1HA6A 3URYA 2EY5A 5JPNC 2BDNA 4BBRB 2IWHA 1GUOA 2F0NA 2EDGA 1HA5A 2RDHA 3OIPA 1YNJD 1STBA 4A3IB 5IGDA 2FFKB 1EEID 4A3DB 1KLUD 4L63B 2M9VA 1TT2A 1ILQA 4H13C 3HS0C 2F03A 3GTPB 3IL8A 5CV4A 2MPMA 5LL6X 3MC0B 3HOYB 2O4XA 4NP5A 4KTAA 1PTOH 4RHRA 1VF7A 2GA4B 1J9OA 5EPJA 1SJHD 4EQPA 4HMJA 4KN4C 3H0GB 4O1NA 3SDZA 2A74C 3VA5A 2F0KA 3CRKC 3QWNA 3BVGA 3DEOA 4K14A 1PFMA 3VR5A 1FNVA 1WTQA 1HHVA 2Y0SB 3J80E 3HOUB 1RTOA 1JWMD 1STNA 5A35A 2CW0D 4PNYA 4OO1G 3S2DB 1QNUA 1R9TB 1AZQA 1TQOA 3HKZB 1D5MC 4ULLA 5DM73 3WOFA 2NN6H 3MA2B 4QMGA 3K59A 1X3QA 5LHY1 2F0LA 1JICA 1TS4A 1S5BD 4G4KA 2D5DA 2ZXPA 4I65A 5C3EB 3V2TA 3T4AC 3Q23A 1HTPA 2JSOA 2FINB 1CA5A 2B2YC 2BE5D 3CQZB 3SE0A 4IUUA 1B9MA 2ZXRA 1DOLA 1S5CD 1U4PA 2Q8IB 5CV8A 5ELFA 1IYUA 4OIKA 1S5FD 4K5XA 2EJMA 2ZXOA 1AEXA 2KQ3A 3V96A 3RLFA 4KJOA 4JBWA 1K83B 4YIJA 3KUPA 2BCOA 3HOXB 2JEBI 3ND8A 1SAPA 2EVBA 5DEHA 2MUYA 1HUNA 3E5SA 4OIJA 4QCLA 2F0JA 2VB3X 1BUVT 2TSSA 3D3RA 1SYDA 1LT4D 4V0BA 1PXUA 2EPBA 5IIFA 3C3LA 4F8MA 3NHHA 3HP3A 3NQTA 3NXWA 1WD1A 2XRSD 5C4ZA 2EY1A 4UAIA 5KNBA 1GXDC 4J1MA 2F0HA 1I4RA 1DM0B 1H9RA 1OO9B 1V8QA 3NTIA 4BY7B 2ICEC 4C3IB 5C0XI 4ZKCB 2JA6B 5D14A 1ONLA 1ENCA 4G7ZC 3A7AB 2LFNA 2NN6I 2NTSA 1TY0A 1V1PA 2X6GA 1I4HA 4XQNA 5ISRA 5CV6A 1LACA 2K1BA 1LT3D 3EFXD 4A3MB 4ZKBB 2L1BA 4ID6A 3VYSA 1S5ED 5C4HA 1QWYA 4RA8A 5DAUA 4XYQA 3R3OA 1IKMA 4DNRB 3GTKB 1IYVA 1B2TA 2Q8RE 3A8JE 2K04A 5C3XA 3BDLA 1F9SA 3M4OB 5FO7B 1DZ1A 2FJ2A 1STHA 1Y8PB 4X3TA 4K5WA 2RA4A 1WD0A 4DAYA 1WCMB 1DJRD 3TP5A 2EJFC 5ELBA 1E2ZA 3I73A 1NAPA 3J7AF 3P1HA 2F3VA 2JP1A 4PMWA 2J0TD 4IUVA 5C5LA 1FNWA 3OWFA 1JWSD 4DGZA 2PZUA 2RVLA 2VNUD 1NR2A 2C9OA 1MI2A 2F0EA 3QIAA 2HCCA 1O7LA 3S14B 1ILPA 5HURA 2E75C 1ZKOA 3DXJC 4X3SA 5CBAE 1ICWA 2L4NA 5C5MA 2EZVA 1QJOA 3L7ZC 1EOTA 3OHXC 1GHKA 3OIQA 2BE5C 2VB2X 1SFOB 5IGGA 3MAQA 1WTPA 2B8GA 2B2YA 3BZDB 1BF4A 5CR3A 1KTKA 2KA7A 2R3ZA 2NVQB 5CC4A 4RAUC 1AZPA 1CK1A 2K5DA 3KLSX 2ID0A 5A2QL 4L8JA 1KABA 3DM1A 2F3WA 1EY7A 1NCVA 4KHZA 4FXGC 1U4LA 4OO1I 4CBVA 4HSPA 4U673 1FR3A 1A3VA 4LMQD 1BDOA 1LLRD 5EGTA 3K5LA 5JAVA 2AUJD 4FP5D 1B44D 4ZUJA 1C4QA 2RDFA 3GP7A 5IGBA 4ZLTF 1HCZA 2PZWA 1Q8IA 4IUNA 1Y8NB 1ZXTA 1F2MA 1FYCA 3TSSA 2F0TA 4XT3B 3A56A 4Q5VA 4A3KB 5JPMC 3W2DA 3HRZC 3WOEA 3EVQA 2H1EA 3TMEA 4G57A 5C44B 1TY2A 2A68C 3E6ZX 3SR1A 3SK8A 5A2QE 1SNCA 1QG7A 2WACA 1PRTB 4QF4A 2R93B 5M5XB 1K8OA 4KV6A 2ICIA 1PLFA 1SYCA 2A73B 1EY4A 3NTKA 1EWCA 2K32A 3NP8A 3KBXA 3VYTA 1PTOB 3D4RA 3T51B 2QKIC 3D6WA 2F0OA 4FO2A 1FNUA 1HTLD 1KDCA 1VMPA 4MN3A 1JWUD 2WKCA 2WKDA 2CVRA 1LTRD 1S5DD 1U4RA 5C4XB 3ERQA 4K6LA 4C3JG 4KMUC 3O13A 3VR4A 5KYIA 1RODA 3W3AA 1JOOA 2PW7A 2D9UA 3GQBA 1I4GA 1WTVA 3MXUA 2IX0A 1Y69U 2NB0A 4K8IA 1BXTA 2L12A 4RGTA 5F2DA 4XT1B 1O80A 4PMBA 4EQOA 5CGKA 3J81L 5I6YA 1CFMA 2F0UA 3X3NA 3OWEB 1PFNA 2EE1A 1I4QA 1KDBA 3TZDA 2SOBA 2G9DA 2HDLA 4CKBA 2PPBC 4TKOB 2AWNA 1W6JA 4ZAIA 4K6DA 1TVXA 1BR9A 2MP1A 1W6KA 1IHZA 4XQQA 3P75A 3I8ZA 2X6LA 1BOSA 4BY1B 1BQQT 1CQVA 1SEBD 5M3MB 3UI2A 2MGSA 3AU7A 3I4LA 2N55A 2O2LD 2OEOA 3NBIA 3K5NA 3M85A 1HUMA 3OPOA 3RUZA 2XVSA 3J80L 2VUMB 1CM9A 1TIID 2F0WA 2D62A 5KYLA 5EKLA 4KD3A 1HFNA 1FD7D 4FXDA 3J81E 3M7NA 1SJED 3IAYA 4KN7C 2PQEA 2XWBB 4RGOS 2JE6I 2XNAC 1TS3A 2I07B 3D6CA 1HQRD 1PTOC 3BYYB 5IGCA 3QG1A 4FF1A 4A3BB 1IKLA 5ELDA 3S16B 3TBIB 1JQYD 3MXPA 4Y7NB 4XYOA 4DK1A 1ZEQX 1KLGD 2XSCA 3RZDB 1GUTA 1TR5A 5FKAC 2KHSA 4WJWA 3MVVA 2H4OA 1Q3LA 4GZYC 2Z1CA 2B2UC 4HCSA 2YYZA 4U68A 1IL8A 5D3IB 1QE6A 1EY5A 2BA0A 1F9RA 3DEPA 4O42A 4BA2I 2RQXA 3I70A 3L9AX 3VR3A 1SMYC 3U9SA 4R8NA 1Y1WB 2B2VC 4F7XA 2DNCA 1G291 3MEHA 1G8ZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0S A;  1EQV A;  5I9O A;  3QB3 A;  4PMC A;  4TRD A;  1SNO A;  2O4X A;  5IGF A;  1STG A;  4KHV A;  3D8G A;  4KTA A;  2QDB A;  4NP5 A;  2OEO A;  4ID6 A;  4K5X A;  5E1F A;  2HQE A;  2PZT A;  4NMZ A;  1SNQ A;  1EYA A;  2F0O A;  5JOB A;  5C4H A;  1AEX A;  4DFA A;  2KQ3 A;  3C1F A;  3T16 A;  5CR3 A;  3RUZ A;  4EQP A;  5DAU A;  4RKL A;  4HMJ A;  1JOK A;  2ENB A;  1NSN S;  1A3U A;  3SK5 A;  2EYL A;  5NUC A;  5HGT A;  5CC4 A;  4QB4 A;  4IAL A;  4ODG A;  1KDC A;  4KJO A;  2F0W A;  3HEJ A;  3SXH A;  2EYM A;  4NKL A;  4S3S A;  5KYL A;  5EKL A;  1EZ6 A;  3DHQ A;  3R3O A;  2PW5 A;  4YIJ A;  5KRU A;  4KD3 A;  2M00 A;  3QOL A;  5K5P A;  3VA5 A;  1II3 A;  3QOJ A;  4K8J A;  1EY8 A;  1KAB A;  2F0K A;  4RKB A;  4H7B A;  2F0D A;  2F3W A;  1EY7 A;  1EY9 A;  3D4D A;  5EKK A;  3TP6 A;  4ZUI A;  1JOR A;  2PQE A;  4N9P A;  4K14 A;  3ERQ A;  5CV7 A;  5DEH A;  1A3V A;  3NUC A;  2PYK A;  3LX0 A;  3E5S A;  4KY7 A;  2SNS A;  1A3T A;  1EYC A;  4EVO A;  2EY2 A;  3D6C A;  5EGT A;  5C3X A;  3BDL A;  2F0J A;  5IOD A;  4K5V A;  5IGC A;  5KYI A;  5IIF A;  1SYD A;  3OMG A;  1NUC A;  1STN A;  1U9R A;  3OMC A;  1STH A;  4HMI A;  4MIU A;  1F2Y A;  2EYF A;  3OSO A;  4E6I A;  4KY5 A;  4EQN A;  5JAV A;  4ZUJ A;  2OF1 A;  1SYE A;  3NHH A;  1JOO A;  4PNY A;  2RDF A;  3ERO A;  3U9O A;  2PW7 A;  1EY0 A;  4K5W A;  4K2L A;  4ZQ3 A;  3NQT A;  5IGB A;  3MXP A;  3NXW A;  2PZW A;  3H6M A;  3PMF A;  2EYH A;  4B9W A;  1STY A;  4K8I A;  2F0Q A;  2EYO A;  4IUN A;  3TP5 A;  5M9O A;  1TQO A;  3DMU A;  5C4Z A;  2EY1 A;  1F2M A;  3EJI A;  1A2U A;  5IGE A;  1RKN A;  2F0P A;  2F0F A;  5F2D A;  4B9X A;  1EYD A;  2F0T A;  5CV5 A;  5J1Z A;  5I6W A;  4WOR A;  3T13 A;  1TR5 A;  3SK6 A;  4DF7 A;  4PMB A;  4EQO A;  4LAA A;  1F2Z A;  2KHS A;  5CV9 A;  2EY5 A;  2F0H A;  3P1H A;  3MVV A;  1KAA A;  2F3V A;  4J1M A;  4N9T A;  4QMG A;  3D4W A;  3TP7 A;  4KY6 A;  5KGU A;  5I9P A;  2F0L A;  3EVQ A;  4KJN A;  5J22 A;  5CGK A;  5KEE A;  4I65 A;  2NUC A;  4IZ8 A;  2RBM A;  4G57 A;  4ME5 A;  3TME A;  1STA A;  2EYJ A;  5C5L A;  3V2T A;  2OXP A;  3OWF A;  3SHL A;  3SR1 A;  5I6Y A;  1EY6 A;  1ENC A;  3SK8 A;  4NDX A;  2F0N A;  2F0U A;  2PZU A;  1SNC A;  5E3F A;  4DGZ A;  2EYP A;  4KD4 A;  1ENA A;  2WAC A;  1KDB A;  1STB A;  5J39 A;  2SOB A;  5IGD A;  1SNM A;  2F0E A;  2F0I A;  4QF4 A;  1SYF A;  2F0M A;  1EY5 A;  2RKS A;  2EY6 A;  5C6A A;  3BDC A;  4K6D A;  1SNP A;  4OL7 A;  4KV6 A;  1SND A;  5HUR A;  1JOQ A;  3MHB A;  3NK9 A;  3MZ5 A;  2SNM A;  5KIX A;  2F0G A;  3SK4 A;  5C3W A;  1IHZ A;  1EZ8 A;  1SYC A;  1TT2 A;  5ISR A;  2F0V A;  1EY4 A;  4J6H A;  4HTH A;  3P75 A;  4R8N A;  5CV6 A;  1SYB A;  5C5M A;  4WRD A;  1A2T A;  4F7X A;  2EXZ A;  4DU9 A;  3S9W A;  4F8M A;  3NP8 A;  5CV8 A;  1KDA A;  3MEH A;  2LKV A;  3HZX A;  3C1E A;  5CV4 A;  4K2K A;  1SYG A;  5IOC A;  3TP8 A;  5IGG A;  3ITP A; 
#chains in the Genus database with same CATH topology
 3GO5 A;  2F0S A;  3RN2 A;  3QB3 A;  1PA6 A;  1HZC A;  2WB1 E;  3S17 B;  3RN5 A;  4DK0 A;  1Q8K A;  4RFB A;  3LWU A;  4JI0 L;  1BCP B;  2IJ0 A;  4LK1 C;  4DR1 L;  2KEN A;  1QZG A;  4JI7 Q;  2ENB A;  1FVI A;  3MEF A;  3J80 i;  1I3Q H;  4HJ5 A;  1YZ6 A;  3A5U A;  1MSG A;  2EYM A;  4JI3 Q;  3NEL A;  4IFD J;  5C4J B;  4DV0 L;  2NVX H;  1DYQ A;  3HOV B;  2E2J B;  3PUZ A;  3GD7 A;  1QVF A;  3I2Z A;  1DD2 A;  5E7N A;  4ZUI A;  1H9M A;  4N9P A;  1JB3 A;  2FHT A;  4RWS C;  1WI5 A;  1HRJ A;  1EFI D;  5KND A;  5I4D A;  1O78 A;  4JCV E;  5IOD A;  1DON A;  2IT1 A;  4OX9 Q;  1AW7 A;  3RMH A;  2VQE Q;  1NUC A;  1F2Y A;  2SEB D;  2ZTE A;  1H9J A;  4N8X 1;  1SYE A;  3MWY W;  1OXT A;  4PZ7 A;  5D65 A;  3A8K E;  3J7Y W;  3GTM B;  4OWT B;  3H6M A;  4XTC S;  1K8M A;  4LJZ C;  3I4N B;  3H91 A;  1ET9 A;  1HH2 P;  3GV6 A;  3GTJ H;  4DV6 L;  4BBS H;  4WOR A;  1HR0 L;  3ULL A;  1Q12 A;  4OXP A;  4CJ0 B;  2QA4 A;  1TWG B;  4JC0 A;  3BS1 A;  5GAD C;  2R92 G;  1Z9F A;  3TS2 A;  2WAQ B;  1PMR A;  1C48 A;  4FNF A;  1VF5 C;  1BO0 A;  2B29 A;  5GRO A;  3CMA A;  1Q90 A;  2A68 D;  4DV1 L;  2B63 B;  2KCT A;  3RZD H;  3H3V H;  3U4Z A;  1U4M A;  4B3R Q;  4A75 A;  3EN2 A;  3NTH A;  4WRD A;  1YJN A;  1FJG Q;  1EIG A;  3EQL C;  4GNX A;  3FVQ A;  3PSI A;  3PGZ A;  1CZG A;  5I9O A;  1ET6 A;  2R92 B;  2F1M A;  4KHV A;  1W2B A;  4F87 A;  1BNZ A;  3H09 A;  1IBM Q;  1SNQ A;  1EYA A;  3HOZ B;  2A1A A;  1L0Y B;  2YU9 H;  4GKJ Q;  4PV1 C;  4R9W A;  4IO9 A;  4QJF A;  4AQY L;  3SXH A;  1I50 B;  4P73 A;  2K50 A;  4X65 L;  4A3E H;  3I4M H;  4DA2 A;  5FLM H;  1TS5 A;  3GTL B;  4RKB A;  2A6H C;  1NR4 A;  2EQS A;  4X62 Q;  2UXC Q;  5IYB H;  5L37 A;  2Y0S E;  5LMN W;  1CKN A;  4HJ7 A;  3NUC A;  5FK9 C;  3ULP A;  3PUW A;  4DR5 L;  3I3C A;  5EBD A;  1EYC A;  2EY2 A;  1PH6 A;  4JI6 L;  2Z6K C;  1DOM A;  1XXG A;  2A6E C;  1LV9 A;  3S17 H;  4DR7 Q;  3UDG A;  3PO2 H;  2OTL A;  4DV3 L;  3OMG A;  1I6H H;  4HMI A;  2JEA I;  1Q82 C;  1LTA D;  2VY3 A;  3HKZ E;  1VQM A;  1XX8 A;  1BCP C;  4RGN A;  2ZJQ A;  1FL0 A;  4YWL A;  2UXD Q;  1E7Z A;  2TMP A;  1KNA A;  5IGE A;  3MXN B;  4UDU C;  3GTG B;  3NPP A;  5AJ3 L;  3CCQ A;  1J8I A;  5COR A;  1GKH A;  1XNR Q;  1A15 A;  1ESR A;  1JE4 A;  1JE5 A;  2XIW A;  5JJI A;  4JPB W;  4H02 A;  2NWG A;  1SMX A;  4C2M H;  5C0X J;  1OXS C;  1QIL A;  1EY6 A;  1Z7T A;  2AQ3 B;  4C3H G;  1B53 A;  1LT5 D;  2AMC B;  1I4P A;  3A5Z B;  4M8A A;  3S1M B;  1PDQ A;  4C56 C;  3ER0 A;  3BYT B;  2L15 A;  3N6R A;  1D5Z C;  4OL7 A;  1N34 L;  1YNN C;  3ND9 A;  4RH6 A;  1JOQ A;  4L6T B;  3MXG A;  3NK9 A;  3T1Y Q;  2PNR C;  3STB C;  2KCC A;  1A2T A;  1VMC A;  1D6E C;  2B2U A;  2EXZ A;  4X64 Q;  2B2W C;  4R4Q A;  1JC7 A;  3Q24 A;  3VYR A;  1ASY A;  1H9K A;  4AYB E;  3MTS A;  2M2L A;  3K5O A;  1SNO A;  3SVM A;  3D8G A;  3S2H H;  2A5H A;  2QEX A;  1P16 A;  4IFD G;  5LL6 S;  4A3F H;  3CU7 A;  4FF2 A;  3S15 B;  5TSS A;  4A93 G;  2EYL A;  5HGT A;  3J81 c;  3S1R B;  3PO3 G;  3HEJ A;  1TXY A;  2O5I C;  2B2V A;  1L0X B;  1X56 A;  3PF4 A;  4DV7 L;  1XMQ L;  1ASZ A;  5T1I A;  3J81 j;  4XIG S;  1EY8 A;  4DR4 Q;  3PIO 3;  2JA8 G;  1K0S A;  4HR7 B;  1PH2 A;  3CME A;  3K7U C;  1VQ4 A;  3NEM A;  1PRT D;  4WJ3 M;  2KBN A;  4YY3 Q;  1XTD A;  4HAE A;  3I90 A;  1LO5 D;  1PYS B;  2AUK A;  5BN5 A;  1E2V A;  2QW7 A;  4QUC A;  3OTO Q;  1O7Y A;  5JVH 3;  5IT9 E;  3A74 A;  1XJV A;  1J6Q A;  1U9R A;  3T1H L;  1EQQ A;  1E2W A;  4IQZ A;  5LMN L;  3ERO A;  1HNZ Q;  2CQA A;  2E5L L;  4K2L A;  5EKI A;  3Q0A A;  2G9H D;  5M3F B;  1QNK A;  2KVM A;  2DN8 A;  2L9H A;  4B9W A;  2DY8 A;  1PTO D;  5M9O A;  1E22 A;  3GTL H;  3FPP A;  3C2P A;  2F0P A;  3RD4 A;  2FMM A;  1EYD A;  3NBH A;  3HOW G;  3T13 A;  3SK6 A;  4Z9C B;  5KNC A;  4P72 A;  5DLQ E;  4NPS A;  5KGU A;  5I9P A;  4LW1 A;  1HZB A;  1IZ6 A;  4IPG A;  5KEE A;  1ZYR C;  1TWA B;  1AE3 A;  4H44 C;  1TWH B;  1PZI D;  1EYG A;  1HNW Q;  2OQ0 A;  1VQJ A;  2UUB L;  2R7D A;  4C1N I;  3D0F A;  2AQ2 B;  2G5D A;  2GVB A;  2L55 A;  1PH3 A;  5J39 A;  4LFA L;  4DXF A;  4IOC A;  4IUQ A;  4OGQ C;  2RKS A;  3FKI H;  3M4Y A;  1TKW B;  2RHQ B;  3CCR A;  5EJW A;  3K57 A;  2XTI A;  3S1N B;  1B4O A;  4ME3 A;  5C3W A;  3CRL C;  1TWC H;  4DK3 C;  3FDT A;  4QY7 A;  1IXR A;  1E3P A;  2JA7 B;  4DU9 A;  1T5X D;  2AQ1 B;  2F3I A;  3OW2 A;  2IPK D;  2PCF B;  1SYG A;  1AP0 A;  2ALY B;  4DAP A;  4DNT B;  3TDQ A;  1VQ5 A;  4ILW A;  4CDF C;  1SMY D;  4TRD A;  3T56 B;  5E1F A;  4LUZ A;  1F9P A;  3PUX A;  1HFG A;  4BA1 I;  3VYU A;  3T16 A;  3BVZ A;  3K0X A;  4TQU S;  1LTT D;  1AFP A;  2VW9 A;  5JEA H;  5NUC A;  5JVG 3;  3IFT A;  4NKL A;  5H1S E;  3F2U A;  1OXV A;  4GLX A;  3PF5 A;  2A69 C;  1N8R C;  1EY9 A;  1X54 A;  2WIN B;  1I94 L;  2ZM6 Q;  3CW2 C;  1LM0 A;  2J4X A;  1G2S A;  1C9O A;  1N33 L;  1JCK B;  1DCZ A;  1MKH A;  2JA5 B;  4C3H H;  3BG3 A;  2PI2 A;  3RZO B;  1CZW A;  5CYU A;  4LFC L;  2R7Z B;  4ZCK A;  4GN4 B;  3GV3 A;  3ICE A;  4PZ8 A;  3S15 H;  4GKK L;  1SRU A;  1A6X A;  3S1Q B;  2K03 A;  1TS2 A;  1CUK A;  2L0C A;  1PYW D;  5I6W A;  2KED A;  1LTI D;  2WB1 G;  4BWG B;  1BVS A;  2K28 A;  5J1Z A;  4NW2 A;  4DAY B;  3L3O C;  1D1I A;  4A3J G;  3E9I A;  5C0X G;  3K81 C;  1F2Z A;  3TEH B;  4CDD C;  2Z6K A;  3A55 A;  3AB9 A;  5BR8 L;  3WWV A;  1Q81 C;  4LF5 Q;  3QJY A;  3PV0 A;  4KY6 A;  4K0K L;  2K33 A;  1IBK Q;  5FJ8 H;  4NXM Q;  4P71 A;  1GOZ A;  4JBJ A;  1TU2 B;  1HZ9 A;  2RBM A;  2EYJ A;  3U58 A;  4IFD H;  4JBM A;  1EWI A;  3FRP B;  4DUZ L;  2RSO A;  4NDX A;  3J7Z C;  4A93 H;  4DR2 Q;  2NTT A;  3FP9 A;  4KD4 A;  1S3O A;  3CC4 A;  3PO3 H;  4A3G G;  1T5E A;  1B3A A;  1SYF A;  4DN4 M;  4O2D A;  3KF8 B;  2EY6 A;  3PUV A;  4JOI C;  3FPU B;  1XWE A;  2WB1 B;  3IRB A;  4ZYS A;  2JA8 H;  2Q2T A;  4C3J B;  1AE2 A;  1GUG A;  4J6H A;  2K01 A;  3G7L A;  2JA9 A;  4OWX B;  4IUT A;  3F8T A;  1JMC A;  4DV2 L;  2O5J C;  5M5Y H;  2Q2U A;  3AMU A;  3C1E A;  3WDN A;  2B2T C;  1C8C A;  4LWC A;  3M3Y H;  3G48 A;  2Z4I A;  3VR6 A;  1KNE A;  4A3G B;  1I3Q B;  2Q2H A;  2BOS A;  4BBR G;  1VDZ A;  2OT2 A;  2E2D C;  4POF A;  1RHP A;  5IP7 G;  3PUY A;  3R93 A;  4POG A;  1PV4 A;  3HOW H;  2NVX B;  2I0Q A;  4HJ8 A;  4FF3 A;  2B2W A;  2I46 A;  2R6G A;  4RGM A;  4A3I G;  4K8J A;  4JI2 L;  1VQA A;  4HIM A;  1CA6 A;  4A3D G;  2DY7 A;  1SE3 A;  2F4V Q;  3GTO H;  4QQB X;  4OEL B;  4GN3 B;  3N52 A;  2RDG A;  3DUZ A;  2HDM A;  2N88 A;  3SGI A;  2L5T A;  4JI4 Q;  3P7J A;  3UDI A;  3A54 A;  2B8F A;  2A6H D;  1GM5 A;  2FXQ A;  2K05 A;  1IBL Q;  2UUC Q;  1PRT C;  2K5W A;  1YHQ A;  3HOY G;  1SE4 A;  3PQI A;  1CHQ D;  2XRQ D;  3GTJ B;  2A6E D;  4BBS B;  3EA6 A;  2NVT H;  3HGB A;  1GHJ A;  3EJI A;  4QGU A;  4V19 0;  1RKN A;  4DR3 L;  4RCO A;  3H0G G;  5I2Y A;  1VQB A;  1BCP D;  3TRZ A;  4JBK A;  2K6A A;  5HGQ A;  3G6J B;  4ALP A;  3CPF A;  1GUW A;  2NUC A;  4IZ8 A;  4ME5 A;  1MJC A;  3RZO H;  1DOK A;  3KLS A;  1HR0 W;  4M1U B;  2JXM B;  3OOC A;  5E3F A;  1Q86 C;  4R8I A;  1SNM A;  4DR6 L;  2F0M A;  2Y0S G;  1VQH A;  4O0A A;  4YWM A;  4CJ1 B;  4DXG A;  1VQP A;  1NTG A;  1SND A;  2EOT A;  1RF2 D;  1HQM C;  2MO0 A;  2N49 A;  3LWE A;  5KIX A;  3I4M G;  2D0P A;  4OHJ A;  1EEF D;  5IP9 G;  5JEA J;  3GTQ H;  4IFD I;  2L11 A;  3K5M A;  4NB3 A;  4CJ2 C;  1X3P A;  1XPR A;  1CTM A;  4KHP Q;  4YHH Q;  3HKZ G;  2X69 A;  2LKV A;  1YNN D;  2E2H B;  2ZTC A;  3FEW X;  3R2T A;  2HIV A;  3K7A H;  3E0J A;  3J81 i;  3STB D;  3PO2 G;  2HCI A;  4GN5 A;  4DKA C;  2YU9 B;  4IN3 A;  4HED A;  4NMZ A;  5JOB A;  5CBE E;  5IE8 A;  1Q1E A;  4WFN 3;  4RKL A;  1ML0 D;  2C35 B;  5C3E G;  1RJT A;  2K5Q A;  4A3E B;  3I4M B;  2KJX A;  4IAL A;  4IPH A;  3CXC A;  3CD6 A;  4UP8 A;  4S3S A;  3MXN A;  3KFU A;  4A3J H;  4RCN A;  3QOL A;  5C0X H;  5GAH C;  1G91 A;  1XTC D;  3D4D A;  1UE1 A;  4FVM A;  1EL0 A;  3VR2 A;  5IT9 c;  3KK7 A;  1EWH A;  4AIM A;  3MFY A;  1RD9 D;  1UNS A;  1UE5 A;  2NBF A;  1RDP D;  3CCS A;  1XMO L;  4JYA L;  1B50 A;  3PO2 B;  3W5O A;  1EOV A;  1I6H B;  3L2P A;  2SNS A;  4JK1 C;  1IW7 C;  1X6O A;  2F4I A;  3OMC A;  4A3G H;  1B7Y B;  1EQT A;  4EQN A;  4IUR A;  3UDF A;  3I7F A;  2HUG A;  1MGS A;  3I56 A;  1WTW A;  1TWF H;  1D5X C;  1VQO A;  2NVY H;  1B70 B;  2AWO A;  3PMF A;  3QO2 A;  1JB7 A;  1LAB A;  4AYB G;  4Y52 H;  3CF5 A;  2CHB D;  4B9X A;  2K75 A;  1CSP A;  2UUA L;  3UE1 A;  5CV9 A;  1X3E A;  5M5W H;  1GVP A;  4C2M B;  2KHJ A;  2VXW A;  4A76 A;  5K36 G;  2B39 A;  2Z8L A;  1STE A;  3KLW A;  4BBR H;  2EXD A;  4R4C A;  1HXY D;  1B1Z A;  4A3F G;  5IP7 H;  1X55 A;  2PO4 A;  1F77 A;  1MBY A;  5DM6 3;  1SXT A;  1ZYR D;  3MFG A;  4AYB B;  4DV5 L;  4A3I H;  4DR1 Q;  3QR8 A;  4JI8 Q;  2I5L X;  5FOB B;  4A3D H;  1GO3 E;  1WTR A;  1CKO A;  4L5R C;  3H15 A;  1H9S B;  4XXE A;  1SYB A;  2LY7 A;  1UAP A;  2NZH A;  1KDA A;  4DV0 Q;  4K2K A;  2DNE A;  4JI5 L;  3K8A A;  5IOC A;  3S2H B;  1PHJ A;  1IYJ B;  5IYC H;  4JVZ A;  3GTP H;  4FYD A;  5EQ0 A;  3CKI B;  3HFZ B;  2QEJ C;  4A3F B;  3ZYY X;  1OTC A;  4LUO A;  3J7A 5;  1WVL A;  4JOI A;  2QGQ A;  3HOY H;  1YEZ A;  1OXU A;  4BY7 G;  4KK7 A;  4C3I G;  1Z6H A;  4JI1 Q;  1JOK A;  1LT6 D;  2ZT9 C;  4GKJ L;  1X32 A;  1KL9 A;  4C1N K;  4QB4 A;  1IL2 A;  4ODG A;  3ONA B;  3H0G H;  3X3M A;  1I4X A;  3M7G A;  2M00 A;  1II3 A;  4EX5 A;  3H3V C;  3NWS A;  2B2T A;  1QCB D;  4FXK C;  1XNQ L;  1QUQ B;  4X62 L;  3M4Q A;  4RG1 A;  1JOR A;  2QIL A;  4KKU A;  4DV6 Q;  2E2H H;  1SDF A;  1HR0 Q;  3TQY A;  2PYK A;  4F88 A;  1SRO A;  2K7V A;  2N3S A;  4EVO A;  1I6V C;  5G3L F;  3PIP 3;  2A69 D;  2JK8 A;  4DR7 L;  1HZA A;  2PMZ B;  1D7Q A;  4A3M G;  3HOU H;  2LS0 1;  1YIJ A;  1F2L A;  3E0E A;  3FKI G;  2LXK A;  2I5M X;  4LF6 Q;  5IP9 H;  1JR0 D;  2UXD L;  3S2D H;  1J5E Q;  1VCI A;  1A2U A;  1R9T H;  5CV5 A;  3CCL A;  4DV1 Q;  2HQL A;  2WII B;  3CP0 A;  2CH4 W;  4DAV A;  4N9T A;  1KAA A;  1YNJ C;  2KEE A;  2QF7 A;  3JAM L;  1HPC A;  2PI2 E;  3TP7 A;  5J22 A;  4LF4 Q;  4CKE A;  4EGV A;  1MSH A;  4NXN L;  2OXP A;  1YBY A;  5BN3 A;  4KI0 A;  2KEC A;  2VZA A;  4H0L C;  3LNN A;  5C3E H;  3FKI B;  1N9W A;  5JEA G;  5G3L D;  4MTK A;  4OO1 H;  2K5H A;  3C46 A;  1TWC B;  2J7Z A;  2SNM A;  2F0G A;  2QCP X;  3SK4 A;  2BH2 A;  3VA7 A;  4B3T L;  4AQY Q;  2D2C C;  3CQZ H;  4HTH A;  4HN7 A;  4LF8 L;  4X64 L;  3S9W A;  4X3K A;  2KUM A;  2GN5 A;  1WTX A;  4IUP A;  3ITP A;  5COY A;  2EJG C;  1EQV A;  2LSS A;  3BJU A;  2ES2 A;  1STG A;  2QDB A;  2B3G A;  2BH8 A;  2PZT A;  1SE2 A;  4DR5 Q;  1KD1 C;  1SBB B;  3C1F A;  4DFA A;  4JI6 Q;  2N8N A;  2EIF A;  4KKT A;  5IT9 L;  2NZ1 D;  4B08 A;  4DV3 Q;  4YCV A;  1A3U A;  1PRT F;  5BN4 A;  2JYO A;  2KCN A;  5EPL A;  4XQJ A;  4JV5 Q;  3NQI A;  3JAM E;  1Z47 A;  3PIO A;  2MJ8 A;  2IX1 A;  5K5P A;  1LUZ A;  2K5V A;  4DR4 L;  4H7B A;  4EQ5 A;  2E2I B;  1K83 H;  3TP6 A;  1R4Q B;  1K3B C;  2CW0 C;  5K36 H;  5AFW A;  5EPK A;  4BS9 A;  4C3H B;  3G71 A;  5FJ8 G;  4YY3 L;  5AJ3 Q;  1A0I A;  3HOX H;  5CMD A;  1PTO F;  1A3T A;  3H3V I;  3RLO A;  4K5V A;  2BDO A;  1PH5 A;  3OSO A;  2A8V A;  1S4Z A;  1SSO A;  1B9N A;  3KF8 A;  2OQK A;  4ZQ3 A;  4LF7 L;  1V43 A;  4GS3 A;  5IY0 A;  5T1G A;  2EYH A;  2F0Q A;  2EYO A;  4P74 A;  5D3D A;  4PQX A;  1O7Z A;  1VQD A;  2E76 C;  1VQ6 A;  1N34 Q;  2DGY A;  3A0J A;  5E4X A;  5ELE A;  4LAA A;  4WJ4 A;  3EBE A;  4HCE A;  5EBC A;  3R8B A;  3BVM A;  3OW7 A;  2XGT A;  4QUF A;  4KJN A;  4YCW A;  1NJI C;  2WAQ E;  1Q46 A;  3NSW A;  3JAM i;  4A93 B;  4J8Q A;  4YCU A;  1STA A;  2K14 A;  1PH9 A;  4BY7 H;  4GOP B;  4P75 A;  1LTS D;  4J15 A;  2HD3 A;  4C3I H;  3SHL A;  3F2C A;  3PO3 B;  1G6Z A;  3IFD A;  3P20 A;  1NE3 A;  1VQE A;  2IX3 A;  1R4P B;  2ZJP A;  1ENA A;  1Y8O B;  2JA6 H;  1PZK D;  2WP8 J;  2JA8 B;  2RSN A;  3IKJ A;  3MHB A;  4DV4 L;  3T53 B;  4CKC A;  4HIK A;  4UPA A;  1EZ8 A;  4G7H C;  2F0V A;  1UE6 A;  3M4P A;  5M5Y B;  3D31 A;  2MHV A;  2Q8T A;  2E74 C;  4B3M Q;  1PVO A;  1L1O B;  1A62 A;  3M3Y B;  2IHF A;  1RTN A;  3HZX A;  3SEB A;  3TN2 A;  4CGY B;  3TP8 A;  1N32 L;  4PMC A;  4A3M H;  3LGJ A;  3DWQ A;  3A8I E;  3BZK A;  3Q22 A;  1O7I A;  1UUP A;  1D8L A;  3TS0 A;  2MFI A;  3HOW B;  3T1H Q;  2DUD A;  3NE5 B;  2R61 A;  5LMN Q;  3VDY A;  2E5L Q;  3DHQ A;  2PW5 A;  1V1P B;  3GTO B;  1U0L A;  1M4V A;  4KKS A;  4LUV A;  2V4D A;  3PCO B;  1X3F A;  1CQF A;  2R93 G;  2ZM6 L;  4IPC A;  4X3U A;  1NBW A;  3GTK H;  3CC2 A;  1VQG A;  1NMF A;  2H5X A;  2KOL A;  2IL8 A;  1ESF A;  2WV6 D;  4KY7 A;  1EIH A;  4TSS A;  3R2I A;  3Q6S A;  3W1G A;  5FLX L;  1F9Q A;  4GLA C;  4MIU A;  1PFB A;  4E6I A;  2EYF A;  1Q7Y C;  3U9O A;  1VQC A;  3M4O H;  3TZU A;  2NVT B;  1RCV D;  3BZC A;  2UUB Q;  1WTH A;  2FMC A;  1K0R A;  5FO8 B;  4HSV A;  1STY A;  4R4T A;  4XDX A;  1IW7 D;  1EFW A;  1D2B A;  1QZH A;  3CHB D;  4LFA Q;  1XPU A;  3DMU A;  1VQN A;  3AFP A;  1WCM H;  2F0F A;  1OXX K;  2XN9 C;  1CHP D;  3V05 A;  2E2I H;  4P2C B;  1VQI A;  2C5C A;  1CI3 M;  1M8A A;  1D1K A;  3D4W A;  3L0O A;  1QB5 D;  3KDF B;  1IBK L;  3BDO A;  2VL6 A;  3DWP A;  5C4X G;  4DK6 C;  3KBG A;  2DJG C;  4ZK9 B;  1V1O A;  3OYY A;  4QIW B;  1PH4 A;  1UEA B;  2F52 A;  3HG9 A;  2NYZ D;  2UU9 L;  2EYP A;  1WTO A;  2R7F A;  2Z4H A;  2F0I A;  4A4I A;  1KC8 C;  1Y1V G;  5C6A A;  3BDC A;  1SNP A;  3GTQ B;  3MZ5 A;  1EU4 A;  1CT1 D;  1FGB D;  3S14 H;  5FLX E;  4FF4 A;  2SDF A;  4ABN A;  3K7A B;  1VQF A;  1KQS A;  4Q0F A;  2NN6 G;  5IWA L;  1LTB D;  5IGF A;  3J7A V;  1G6P A;  1SFO H;  2CFM A;  2HQE A;  3CPW A;  1XYI A;  1LTG D;  2IW3 A;  1M90 C;  2HHH Q;  1N33 Q;  1G2T A;  1MD2 D;  3A7L A;  4CHT B;  1E0B A;  4GOP C;  1GUS A;  1Y1V B;  2V1C C;  4L5S A;  4LFC Q;  1ENF A;  1NSN S;  3SK5 A;  5LMU Q;  4PG3 A;  4A3J B;  1VQK A;  1QOH A;  5DNF A;  4GKK Q;  4B3S L;  1EZ6 A;  2JJQ A;  2OWO A;  2NVQ H;  5KRU A;  1KRT A;  3BU2 A;  3QOJ A;  2PQA B;  2VQF L;  1B3Q A;  2F0D A;  5EKK A;  2F4V L;  5CV7 A;  3K0Y A;  5ELC A;  1BBX C;  4RMF A;  3LX0 A;  1L1O C;  1X9N A;  5E4W C;  1DXM A;  5BR8 Q;  5FO9 B;  4G7O C;  1GJX A;  4LNQ A;  4K0K Q;  3FMC A;  3NWT A;  3B6Y A;  4BY1 G;  1GUN A;  3K6O A;  3G6E A;  3JC6 6;  3UE0 A;  1TWF B;  1PZJ D;  4KY5 A;  2NVY B;  3KLR A;  4ZRZ A;  5M3M G;  2OF1 A;  1IBL L;  2UUC L;  1BCP F;  5JJK A;  1EY0 A;  4DUZ Q;  3CCE A;  5I2X A;  2BA1 A;  5GAG C;  3I91 A;  1AN8 A;  4MHE A;  4UHV A;  3H94 A;  1EU3 A;  4OON A;  1Q1B A;  1H9S A;  4I7Z C;  3K58 A;  3DWA A;  3I72 A;  2XWJ B;  2LMC B;  5M5W B;  5JJZ A;  2VUM G;  4DF7 A;  4RHS A;  1HA6 A;  3URY A;  2EY5 A;  2UXB L;  5JPN C;  5IYC G;  4A3K H;  5HY6 A;  2BDN A;  4BBR B;  2IWH A;  2RCF A;  1VQL A;  1GUO A;  4X66 L;  2F0N A;  2EDG A;  1HA5 A;  2RDH A;  3OIP A;  1YNJ D;  1STB A;  4A3I B;  2YTV A;  1K28 A;  2FFK B;  5IGD A;  1EEI D;  1P8L A;  4DUY L;  2IY5 B;  4A3D B;  4PZ6 A;  1KLU D;  4LFB Q;  4A3L G;  4L63 B;  2M9V A;  1TT2 A;  2R93 H;  1QUQ A;  1ILQ A;  4H13 C;  3HS0 C;  1X3G A;  1HJP A;  4JI2 Q;  1BKB A;  1QVC A;  3IL8 A;  2F03 A;  3GTP B;  5CV4 A;  2MPM A;  5LL6 X;  1MIU A;  1M1K C;  3MC0 B;  3HOY B;  2O4X A;  4NP5 A;  4KTA A;  1PTO H;  4RHR A;  4IOA A;  1VF7 A;  3JAM c;  3HOU G;  2GA4 B;  1J9O A;  1HNX Q;  5EPJ A;  1SJH D;  1K8G A;  4EQP A;  4HMJ A;  4KN4 C;  3H0G B;  4O1N A;  3SDZ A;  2A74 C;  2LXJ A;  1WOC A;  3VA5 A;  4LF9 L;  2RHS B;  2F0K A;  3CRK C;  1N36 L;  1GD7 A;  3QWN A;  3BVG A;  3DEO A;  4K14 A;  5C4X H;  4DR3 Q;  1PFM A;  3VR5 A;  1FNV A;  1WTQ A;  2YV5 A;  1HHV A;  2Y0S B;  3J80 E;  3HOU B;  1RTO A;  4JI7 L;  1JWM D;  1VQ7 A;  1STN A;  4BXX G;  5A35 A;  2CW0 D;  1Y1V H;  4PNY A;  4JI3 L;  1YJW A;  1PYB A;  4OO1 G;  3S2D B;  1QNU A;  1R9T B;  1G51 A;  1AZQ A;  1TQO A;  3HKZ B;  1D5M C;  4KLK A;  4ULL A;  1MJE A;  4QL5 A;  2CKZ B;  2HT1 A;  5DM7 3;  3WOF A;  4HJA A;  2NN6 H;  3MA2 B;  4MNO A;  4QMG A;  3K59 A;  1X3Q A;  5LHY 1;  2F0L A;  4OX9 L;  1JIC A;  1TS4 A;  1S5B D;  4G4K A;  2VQE L;  2D5D A;  2ZXP A;  4I65 A;  3UDX A;  3ZJY C;  3HOV G;  1SE8 A;  5C3E B;  1X65 A;  3V2T A;  1UWV A;  3T4A C;  3Q23 A;  4CDE C;  1EQR A;  1HTP A;  2JSO A;  1VS0 A;  2FIN B;  1CA5 A;  4YWK A;  2B2Y C;  2JN4 A;  2BE5 D;  3AEV A;  3CQZ B;  3SE0 A;  4JI8 L;  4IUU A;  1W3S A;  1H95 A;  1B9M A;  2KHI A;  2ZXR A;  3U50 C;  4HID A;  1DOL A;  1S5C D;  1U4P A;  3K80 C;  2Q8I B;  3I4N G;  5CV8 A;  3M9B A;  3HOX G;  5ELF A;  1IYU A;  4BY1 H;  1Y14 B;  4OIK A;  5M3M H;  1S5F D;  1U5K A;  4K5X A;  1XMO Q;  2EJM A;  4R4O A;  4JYA Q;  2ZXO A;  4JI0 Q;  1AEX A;  2KQ3 A;  2QDL A;  4JI1 L;  3V96 A;  4UP9 A;  3RLF A;  2Z9H A;  4APV A;  4KJO A;  4JBW A;  1A8V A;  4B3R L;  2VUM H;  2WAQ G;  1K83 B;  4YIJ A;  2RCN A;  1FJG L;  3KUP A;  2CCZ A;  3CCM A;  1LTL A;  2BCO A;  3HOX B;  2JEB I;  2RF4 A;  3ND8 A;  4UP7 A;  2B63 G;  1SAP A;  2EVB A;  5DEH A;  1UE7 A;  3PIP A;  1KHI A;  2MUY A;  2UUA Q;  1HUN A;  1IBM L;  1EIF A;  4DNI A;  3E5S A;  4OIJ A;  4GOP A;  3KF6 B;  4QCL A;  2K4K A;  2F0J A;  2VB3 X;  3KJP A;  1BUV T;  2TSS A;  3D3R A;  1SYD A;  1LT4 D;  4V0B A;  1PXU A;  2EPB A;  5IIF A;  3C3L A;  1VQ8 A;  2JA6 G;  4F8M A;  3NHH A;  2E8G A;  1EUJ A;  3HP3 A;  3NQT A;  4A3B H;  4A3L H;  3NXW A;  3S16 H;  4LF6 L;  2YTY A;  1WD1 A;  2XRS D;  2CWA A;  2EY1 A;  5C4Z A;  1I5F A;  4Y7N H;  1J5E L;  3HOZ G;  2UXC L;  4DV5 Q;  3EIV A;  2D0O A;  4UAI A;  5KNB A;  1GXD C;  1L1O A;  1XPO A;  2F0H A;  1I4R A;  1DM0 B;  1H9R A;  1OO9 B;  1V8Q A;  3NTI A;  4J1M A;  4BY7 B;  3W1B A;  2ICE C;  1UEB A;  4C3I B;  5C0X I;  4LF4 L;  1SN8 A;  2ZJR A;  4ZKC B;  2JA6 B;  5D14 A;  2OTJ A;  1ONL A;  4JI5 Q;  1ENC A;  4G7Z C;  3A7A B;  2AHO B;  2A19 A;  1K3R A;  2LFN A;  2NN6 I;  5FLX c;  1YJ9 A;  2NTS A;  3AYH B;  1TY0 A;  1V1P A;  4I7A A;  2X6G A;  1XNR L;  1I4H A;  4XQN A;  5ISR A;  1FGU A;  1QVG A;  5CV6 A;  1LAC A;  2OCE A;  2IHE A;  2K1B A;  1LT3 D;  3EFX D;  1YVC A;  4A3M B;  4GLV B;  1Y1W H;  1XNQ Q;  4ZKB B;  4BXX H;  2L1B A;  4ID6 A;  3VYS A;  2K52 A;  1S5E D;  5C4H A;  1WFQ A;  1QWY A;  4RA8 A;  5DAU A;  4XYQ A;  2YTX A;  4JV5 L;  3T1Y L;  4X65 Q;  1BBU A;  1WCM G;  3R3O A;  3E3X A;  4DNR B;  1IKM A;  3GTK B;  1IYV A;  1B2T A;  5C4J H;  3KDF A;  3HOV H;  2E2J H;  1KXL A;  2Q8R E;  3A8J E;  2K04 A;  5C3X A;  3BDL A;  1F9S A;  3M4O B;  5FO7 B;  1DZ1 A;  2FJ2 A;  1STH A;  3G4S A;  4NXN Q;  1Y8P B;  4OEM B;  2MNA A;  4X3T A;  3KJO A;  4K5W A;  1AH9 A;  2RA4 A;  1WD0 A;  4DAY A;  3CCJ A;  1WCM B;  1MHW C;  1DJR D;  3TP5 A;  2EJF C;  4JW0 A;  1E2Z A;  5ELB A;  3GTM H;  2GVA A;  3I4N H;  4IPD A;  1YHB A;  3I73 A;  1NAP A;  3U4V A;  4B3T Q;  3J7A F;  3P1H A;  2F3V A;  3OTO L;  2JP1 A;  1JJG A;  2WFW A;  4LF8 Q;  4PMW A;  2J0T D;  3FHW A;  4IUV A;  5C5L A;  3ULJ A;  1HNZ L;  1FNW A;  3OWF A;  1JWS D;  1TWG H;  4DGZ A;  1B8A A;  2PZU A;  2RVL A;  2VNU D;  1NR2 A;  5EAY A;  2C9O A;  1MI2 A;  4MTN A;  2F0E A;  3QIA A;  2HCC A;  2HIX A;  1O7L A;  3S14 B;  1ILP A;  5HUR A;  2PQA A;  2E75 C;  1ZKO A;  3DXJ C;  2MQH A;  4X3S A;  5CBA E;  1ICW A;  4DPG A;  5M3F G;  2B63 H;  2L4N A;  5C5M A;  2EZV A;  1CSQ A;  1QJO A;  3L7Z C;  4B3M L;  1EOT A;  3OHX C;  1GHK A;  3OIQ A;  2BE5 C;  1HNW L;  4IJH A;  1SR3 A;  2VB2 X;  1SFO B;  5IGG A;  1KIX A;  3F1Z A;  4MZ9 A;  3MAQ A;  1WTP A;  2B8G A;  2B2Y A;  2R92 H;  3BZD B;  1BF4 A;  5CR3 A;  1YNX A;  1KTK A;  2KA7 A;  2ASB A;  4AH6 A;  2R3Z A;  2NVQ B;  5CC4 A;  2PNH A;  3HOZ H;  1KAW A;  2Z6B A;  4RAU C;  1AZP A;  1CK1 A;  2K5D A;  4DV7 Q;  3KLS X;  4LF7 Q;  1XMQ Q;  2ID0 A;  5A2Q L;  3AQQ A;  1KAB A;  3DM1 A;  1SLJ A;  4L8J A;  2F3W A;  1EY7 A;  1I50 H;  1NCV A;  4KHZ A;  4FXG C;  1U4L A;  4OO1 I;  4CBV A;  2DJF C;  3J80 c;  4HSP A;  4A3C G;  4A3K G;  4U67 3;  1FR3 A;  1A3V A;  2PMZ E;  4LMQ D;  4GNX B;  1BDO A;  1LLR D;  5EGT A;  3DM3 A;  2JA7 G;  5C44 G;  1C7Y A;  3K5L A;  2N78 A;  5JAV A;  2AUJ D;  4FP5 D;  1B44 D;  4ZUJ A;  1C4Q A;  2RDF A;  3GP7 A;  5IGB A;  4ZLT F;  1HCZ A;  1A63 A;  2PZW A;  1Q8I A;  5GAE C;  1ICF B;  4IUN A;  1Y8N B;  1RIP A;  1ZXT A;  1F2M A;  1FYC A;  3TSS A;  1RL2 A;  2F0T A;  4XT3 B;  3A56 A;  1PFS A;  4Q5V A;  4DV4 Q;  4A3K B;  5JPM C;  3RNU A;  3GTG H;  3W2D A;  3HRZ C;  3WOE A;  3EVQ A;  1CKN B;  2H1E A;  4R4I A;  3TME A;  4G57 A;  5C44 B;  1TY2 A;  2A68 C;  3E6Z X;  3SR1 A;  3SK8 A;  1N32 Q;  5A2Q E;  1K8A C;  1SNC A;  2ZTD A;  1QG7 A;  2WAC A;  1PRT B;  5IYD G;  4HIO A;  2JA5 G;  4QF4 A;  4R1J A;  2K5N A;  2R7Z G;  2R93 B;  5M5X B;  1K8O A;  4KV6 A;  3S1M H;  4DAM A;  2ICI A;  1PLF A;  1SYC A;  2A73 B;  1EY4 A;  3NTK A;  4LF5 L;  1EWC A;  2Q2I A;  3ERS X;  4NXM L;  2K32 A;  3NP8 A;  3HKS A;  2CWP A;  3KBX A;  1KRS A;  3VYT A;  1PTO B;  3D4R A;  4DR2 L;  3T51 B;  2QKI C;  3CAM A;  3S24 A;  1PH1 A;  5ELO A;  3D6W A;  2HHH L;  2F0O A;  1JJC B;  4FO2 A;  1FNU A;  1V1Q A;  1HTL D;  5LMU L;  3NEN A;  1YI2 A;  3AFQ A;  1KDC A;  1VMP A;  4MN3 A;  1JWU D;  2WKC A;  2WKD A;  2CVR A;  1LTR D;  1EIY B;  1S5D D;  3DLL A;  1U4R A;  3S1R H;  1LYL A;  5C4X B;  4UY8 C;  1I94 Q;  1E1O A;  1K9M C;  3ERQ A;  4K6L A;  1S72 A;  4C3J G;  4KMU C;  3O13 A;  3VR4 A;  3CCV A;  5KYI A;  4TVA B;  1ROD A;  3W3A A;  1JOO A;  2PW7 A;  3F2B A;  2D9U A;  3GQB A;  4FDB A;  1I4G A;  1WTV A;  3MXU A;  2UU9 Q;  2IX0 A;  1Y69 U;  2NB0 A;  2P5Z X;  1BXT A;  2L12 A;  4JG2 A;  4K8I A;  4RGT A;  3RLN A;  5M3F H;  5F2D A;  1NNX A;  4XT1 B;  1O80 A;  4PMB A;  4EQO A;  1JJ2 A;  4JI4 L;  1VQ9 A;  1JT8 A;  5CGK A;  5JJL A;  4IJL A;  3J81 L;  1BBW A;  5I6Y A;  4GNX C;  1TWA H;  1CFM A;  5IWA Q;  1DGS A;  2F0U A;  3X3N A;  3OWE B;  1PFN A;  1TWH H;  2EE1 A;  1I4Q A;  1YHA A;  1KDB A;  3TZD A;  2SOB A;  2G9D A;  2HDL A;  4CKB A;  2PPB C;  4TKO B;  2AWN A;  1W6J A;  1PH7 A;  4ZAI A;  4K6D A;  3I55 A;  4LFB L;  1TVX A;  1BR9 A;  2MP1 A;  3I4O A;  1W6K A;  1IHZ A;  2MO1 A;  4XQQ A;  3P75 A;  3I8Z A;  4B3S Q;  4A3C H;  2X6L A;  1BOS A;  3NBH B;  4DV2 Q;  3S1N H;  4L5Q A;  4BY1 B;  4OWW B;  1BQQ T;  4BBS G;  1CQV A;  1WJJ A;  1SEB D;  2VQF Q;  5M3M B;  3UI2 A;  2MGS A;  3AU7 A;  3I4L A;  3KF6 A;  2JA7 H;  5C44 H;  2N55 A;  2JQO A;  2O2L D;  2OEO A;  3NBI A;  3K5N A;  3M85 A;  4X6A H;  1HUM A;  1HNX L;  3OPO A;  3RUZ A;  2XVS A;  3J80 L;  4A3B G;  2VUM B;  3KYH C;  1CM9 A;  5M5X H;  2KCM A;  1TII D;  2F0W A;  2D62 A;  5KYL A;  5EKL A;  1L0W A;  5J3B A;  2AKW B;  4KHP L;  4KD3 A;  4YHH L;  1HFN A;  1FD7 D;  4FXD A;  2CQO A;  3J81 E;  1NY4 A;  3M7N A;  2VS1 A;  1SJE D;  4N8F A;  3IAY A;  4KN7 C;  2PQE A;  2XWB B;  4RGO S;  2JE6 I;  2ATW A;  3Q8D A;  2XNA C;  2NZO A;  4L5T A;  1TS3 A;  2I5H A;  2I07 B;  3D6C A;  2UXB Q;  1HQR D;  1PTO C;  3BYY B;  5IGC A;  3TRE A;  3QG1 A;  5IYD H;  2JA5 H;  4FF1 A;  4A3B B;  1IKL A;  1E24 A;  5ELD A;  3S16 B;  2R7Z H;  3CC7 A;  3TBI B;  4X66 Q;  1JQY D;  3MXP A;  4Y7N B;  4XYO A;  4DK1 A;  1ZEQ X;  1KLG D;  3RR5 A;  2XSC A;  3S1Q H;  4DUY Q;  3RZD B;  1GUT A;  1NMG A;  1TR5 A;  1L2F A;  4A3E G;  5FKA C;  2KHS A;  5FLM G;  4QIW E;  4WJW A;  3MVV A;  1Y1W G;  2H4O A;  5IYB G;  1Q3L A;  3CCU A;  4GZY C;  2Z1C A;  2B2U C;  1C0A A;  1S40 A;  3KOJ A;  4HCS A;  2YYZ A;  2CH4 A;  4U68 A;  1IL8 A;  1PH8 A;  5D3I B;  3F2D A;  1QE6 A;  5ELN A;  4DR6 Q;  1EY5 A;  2BA0 A;  1WYD A;  1T9H A;  1V9P A;  1F9R A;  3DEP A;  4O42 A;  1CKM A;  2RQX A;  2Z0S A;  3I70 A;  3L9A X;  1YIT A;  4BA2 I;  3VR3 A;  1SMY C;  3U9S A;  4R8N A;  5GQO A;  1Y1W B;  2B2V C;  1K73 C;  4F7X A;  4C3J H;  4CDC C;  2DNC A;  4LF9 Q;  1G29 1;  3GDE A;  3MEH A;  1N36 Q;  1E1T A;  1G8Z D;  3E9H A;  4HJ9 A; 
#chains in the Genus database with same CATH homology
 3GO5 A;  2F0S A;  3QB3 A;  3S17 B;  4DK0 A;  4RFB A;  3LWU A;  1BCP B;  2IJ0 A;  4LK1 C;  2ENB A;  1MSG A;  2EYM A;  4IFD J;  5C4J B;  1DYQ A;  3HOV B;  2E2J B;  3PUZ A;  3GD7 A;  1DD2 A;  4ZUI A;  1H9M A;  4N9P A;  1JB3 A;  2FHT A;  4RWS C;  1HRJ A;  1EFI D;  5KND A;  5I4D A;  1O78 A;  5IOD A;  1DON A;  2IT1 A;  1AW7 A;  3RMH A;  1NUC A;  1F2Y A;  2SEB D;  1H9J A;  1SYE A;  3MWY W;  1OXT A;  5D65 A;  3A8K E;  3J7Y W;  3GTM B;  3H6M A;  4XTC S;  1K8M A;  4LJZ C;  3I4N B;  3H91 A;  1ET9 A;  3GV6 A;  4WOR A;  1Q12 A;  4CJ0 B;  1TWG B;  3BS1 A;  2WAQ B;  1PMR A;  1C48 A;  4FNF A;  1VF5 C;  1BO0 A;  1Q90 A;  2A68 D;  2B63 B;  1U4M A;  3NTH A;  4WRD A;  1EIG A;  3EQL C;  3FVQ A;  1CZG A;  5I9O A;  1ET6 A;  2R92 B;  2F1M A;  4KHV A;  4F87 A;  1BNZ A;  3H09 A;  1SNQ A;  1EYA A;  3HOZ B;  1L0Y B;  4PV1 C;  4R9W A;  3SXH A;  1I50 B;  4DA2 A;  3GTL B;  1TS5 A;  4RKB A;  2A6H C;  1NR4 A;  3NUC A;  5FK9 C;  3PUW A;  3I3C A;  5EBD A;  1EYC A;  2EY2 A;  1DOM A;  1XXG A;  2A6E C;  1LV9 A;  3OMG A;  4HMI A;  2JEA I;  1LTA D;  1XX8 A;  1BCP C;  4RGN A;  2TMP A;  1KNA A;  5IGE A;  4UDU C;  3GTG B;  3NPP A;  1J8I A;  5COR A;  1A15 A;  1ESR A;  1JE4 A;  2XIW A;  2NWG A;  5C0X J;  1OXS C;  1QIL A;  1EY6 A;  1Z7T A;  2AQ3 B;  4C3H G;  1B53 A;  1LT5 D;  1I4P A;  4M8A A;  3S1M B;  1PDQ A;  4C56 C;  3BYT B;  3N6R A;  1D5Z C;  4OL7 A;  1YNN C;  3ND9 A;  4RH6 A;  1JOQ A;  4L6T B;  3MXG A;  3NK9 A;  2PNR C;  2KCC A;  1A2T A;  1VMC A;  1D6E C;  2B2U A;  2EXZ A;  2B2W C;  1JC7 A;  3Q24 A;  3VYR A;  1H9K A;  3MTS A;  2M2L A;  3K5O A;  1SNO A;  3SVM A;  3D8G A;  2A5H A;  4IFD G;  5LL6 S;  3CU7 A;  4FF2 A;  3S15 B;  5TSS A;  2EYL A;  5HGT A;  3S1R B;  3HEJ A;  2O5I C;  2B2V A;  1L0X B;  5T1I A;  4XIG S;  1EY8 A;  3PIO 3;  4HR7 B;  1PRT D;  4HAE A;  3I90 A;  1LO5 D;  2AUK A;  5BN5 A;  1E2V A;  5IT9 E;  4QUC A;  1O7Y A;  5JVH 3;  1U9R A;  1E2W A;  4IQZ A;  3ERO A;  2CQA A;  4K2L A;  5EKI A;  3Q0A A;  2G9H D;  5M3F B;  1QNK A;  2KVM A;  2DN8 A;  2L9H A;  4B9W A;  2DY8 A;  1PTO D;  5M9O A;  3FPP A;  3C2P A;  2F0P A;  3RD4 A;  2FMM A;  1EYD A;  3NBH A;  3T13 A;  3SK6 A;  4Z9C B;  5KNC A;  5KGU A;  5I9P A;  5KEE A;  1ZYR C;  1TWA B;  4H44 C;  1TWH B;  1PZI D;  4C1N I;  2AQ2 B;  2L55 A;  5J39 A;  4DXF A;  4IUQ A;  4OGQ C;  2RKS A;  3M4Y A;  1TKW B;  5EJW A;  3K57 A;  3S1N B;  1B4O A;  5C3W A;  3CRL C;  3FDT A;  2JA7 B;  4DU9 A;  1T5X D;  2AQ1 B;  2IPK D;  2PCF B;  1SYG A;  1AP0 A;  4DAP A;  4DNT B;  3TDQ A;  4ILW A;  1SMY D;  4TRD A;  3T56 B;  5E1F A;  1F9P A;  3PUX A;  1HFG A;  4BA1 I;  3VYU A;  3T16 A;  3BVZ A;  4TQU S;  1LTT D;  1AFP A;  5JEA H;  5NUC A;  5JVG 3;  3IFT A;  4NKL A;  3F2U A;  1OXV A;  2A69 C;  1EY9 A;  2WIN B;  2J4X A;  1G2S A;  1JCK B;  1DCZ A;  2JA5 B;  3BG3 A;  3RZO B;  1CZW A;  5CYU A;  2R7Z B;  3GV3 A;  1A6X A;  3S1Q B;  2K03 A;  1TS2 A;  2L0C A;  1PYW D;  5I6W A;  2KED A;  1LTI D;  4BWG B;  2K28 A;  5J1Z A;  4NW2 A;  3L3O C;  1D1I A;  5C0X G;  1F2Z A;  3A55 A;  3AB9 A;  3QJY A;  3PV0 A;  4KY6 A;  2K33 A;  1GOZ A;  1TU2 B;  2RBM A;  2EYJ A;  4IFD H;  3FRP B;  2RSO A;  4NDX A;  2NTT A;  4KD4 A;  1T5E A;  1B3A A;  1SYF A;  4DN4 M;  2EY6 A;  3PUV A;  3FPU B;  1XWE A;  2WB1 B;  4ZYS A;  4C3J B;  1GUG A;  4J6H A;  2K01 A;  3G7L A;  4IUT A;  2O5J C;  3AMU A;  3C1E A;  3WDN A;  2B2T C;  1C8C A;  2Z4I A;  3VR6 A;  1KNE A;  4A3G B;  1I3Q B;  2BOS A;  1VDZ A;  2OT2 A;  2E2D C;  1RHP A;  3PUY A;  3R93 A;  2NVX B;  4FF3 A;  2B2W A;  2I46 A;  2R6G A;  4RGM A;  4K8J A;  1CA6 A;  2DY7 A;  1SE3 A;  3N52 A;  2RDG A;  3DUZ A;  2HDM A;  2N88 A;  2L5T A;  3P7J A;  3A54 A;  2B8F A;  2A6H D;  2K05 A;  1PRT C;  2K5W A;  1SE4 A;  1CHQ D;  2XRQ D;  3GTJ B;  2A6E D;  4BBS B;  3EA6 A;  3HGB A;  1GHJ A;  3EJI A;  4V19 0;  1RKN A;  4RCO A;  5I2Y A;  1BCP D;  2K6A A;  3G6J B;  1GUW A;  2NUC A;  4IZ8 A;  4ME5 A;  1DOK A;  3KLS A;  4M1U B;  2JXM B;  3OOC A;  5E3F A;  4R8I A;  1SNM A;  2F0M A;  4CJ1 B;  4DXG A;  1SND A;  2EOT A;  1RF2 D;  1HQM C;  3LWE A;  5KIX A;  4OHJ A;  1EEF D;  4IFD I;  5JEA J;  2L11 A;  3K5M A;  4CJ2 C;  1X3P A;  1CTM A;  2X69 A;  2LKV A;  1YNN D;  2E2H B;  3FEW X;  3R2T A;  3E0J A;  2HCI A;  2YU9 B;  4IN3 A;  4HED A;  4NMZ A;  5JOB A;  5CBE E;  1Q1E A;  4WFN 3;  4RKL A;  1ML0 D;  1RJT A;  2K5Q A;  4A3E B;  3I4M B;  2KJX A;  4IAL A;  4S3S A;  3MXN A;  4RCN A;  3QOL A;  5C0X H;  1G91 A;  1XTC D;  3D4D A;  4FVM A;  1EL0 A;  3VR2 A;  3KK7 A;  1EWH A;  3MFY A;  1RD9 D;  1UNS A;  2NBF A;  1RDP D;  1B50 A;  3PO2 B;  1I6H B;  2SNS A;  4JK1 C;  1IW7 C;  2F4I A;  3OMC A;  1EQT A;  4EQN A;  4IUR A;  2HUG A;  1MGS A;  1WTW A;  1D5X C;  2AWO A;  3PMF A;  3QO2 A;  1LAB A;  2CHB D;  4B9X A;  5CV9 A;  4C2M B;  2VXW A;  5K36 G;  2B39 A;  2Z8L A;  1STE A;  1HXY D;  1B1Z A;  2PO4 A;  1F77 A;  1MBY A;  5DM6 3;  1SXT A;  1ZYR D;  3MFG A;  4AYB B;  5FOB B;  1WTR A;  1H9S B;  4XXE A;  1SYB A;  2LY7 A;  1UAP A;  1KDA A;  4K2K A;  2DNE A;  5IOC A;  3S2H B;  4FYD A;  5EQ0 A;  3CKI B;  2QEJ C;  4A3F B;  3ZYY X;  1WVL A;  1OXU A;  4KK7 A;  4C3I G;  1Z6H A;  1JOK A;  1LT6 D;  2ZT9 C;  1X32 A;  4C1N K;  4QB4 A;  4ODG A;  3ONA B;  3X3M A;  1I4X A;  3M7G A;  2M00 A;  1II3 A;  3H3V C;  3NWS A;  2B2T A;  1QCB D;  4FXK C;  1JOR A;  2QIL A;  4KKU A;  1SDF A;  2PYK A;  4F88 A;  2K7V A;  4EVO A;  1I6V C;  5G3L F;  3PIP 3;  2A69 D;  2PMZ B;  2LS0 1;  1F2L A;  1JR0 D;  1VCI A;  1A2U A;  5CV5 A;  2WII B;  4DAV A;  4N9T A;  1KAA A;  1YNJ C;  2KEE A;  2QF7 A;  3JAM L;  1HPC A;  3TP7 A;  5J22 A;  4CKE A;  4EGV A;  1MSH A;  2OXP A;  5BN3 A;  4KI0 A;  2KEC A;  4H0L C;  3LNN A;  3FKI B;  5JEA G;  5G3L D;  4OO1 H;  3C46 A;  1TWC B;  2J7Z A;  2SNM A;  2F0G A;  2QCP X;  3SK4 A;  3VA7 A;  2D2C C;  4HTH A;  4HN7 A;  3S9W A;  4X3K A;  2KUM A;  1WTX A;  4IUP A;  3ITP A;  5COY A;  2EJG C;  1EQV A;  1STG A;  2QDB A;  2PZT A;  1SE2 A;  4DFA A;  1SBB B;  3C1F A;  4KKT A;  5IT9 L;  2NZ1 D;  4B08 A;  1A3U A;  1PRT F;  5BN4 A;  2JYO A;  2KCN A;  5EPL A;  4XQJ A;  3NQI A;  3JAM E;  1Z47 A;  2MJ8 A;  2IX1 A;  5K5P A;  4H7B A;  2E2I B;  3TP6 A;  1R4Q B;  2CW0 C;  5K36 H;  5AFW A;  5EPK A;  4BS9 A;  4C3H B;  5CMD A;  1PTO F;  1A3T A;  4K5V A;  2BDO A;  3OSO A;  1S4Z A;  1SSO A;  1B9N A;  3KF8 A;  4ZQ3 A;  1V43 A;  5T1G A;  2EYH A;  2F0Q A;  2EYO A;  5D3D A;  4PQX A;  1O7Z A;  2E76 C;  5E4X A;  5ELE A;  4LAA A;  4HCE A;  5EBC A;  3R8B A;  3BVM A;  3OW7 A;  4QUF A;  4KJN A;  3NSW A;  4A93 B;  4J8Q A;  1STA A;  1LTS D;  1G6Z A;  3SHL A;  3PO3 B;  3IFD A;  3P20 A;  2IX3 A;  1R4P B;  1ENA A;  1Y8O B;  1PZK D;  2WP8 J;  2JA8 B;  2RSN A;  3IKJ A;  3MHB A;  3T53 B;  4CKC A;  1EZ8 A;  4G7H C;  2F0V A;  5M5Y B;  3D31 A;  2MHV A;  2Q8T A;  2E74 C;  3M3Y B;  3SEB A;  1RTN A;  3HZX A;  3TN2 A;  4CGY B;  3TP8 A;  4PMC A;  3DWQ A;  3A8I E;  3Q22 A;  1UUP A;  3HOW B;  3NE5 B;  2R61 A;  3DHQ A;  2PW5 A;  1V1P B;  3GTO B;  1M4V A;  4KKS A;  2V4D A;  1CQF A;  4X3U A;  2KOL A;  2IL8 A;  1ESF A;  2WV6 D;  4KY7 A;  1EIH A;  4TSS A;  3R2I A;  3Q6S A;  5FLX L;  1F9Q A;  4MIU A;  1PFB A;  4E6I A;  2EYF A;  3U9O A;  3TZU A;  2NVT B;  1RCV D;  2FMC A;  5FO8 B;  4HSV A;  1STY A;  4XDX A;  1IW7 D;  1D2B A;  3CHB D;  3DMU A;  2F0F A;  1OXX K;  2XN9 C;  1CHP D;  3V05 A;  4P2C B;  2C5C A;  1CI3 M;  1M8A A;  1D1K A;  3D4W A;  1QB5 D;  3BDO A;  3DWP A;  3KBG A;  4ZK9 B;  1V1O A;  4QIW B;  1UEA B;  3HG9 A;  2NYZ D;  2EYP A;  1WTO A;  2Z4H A;  2F0I A;  5C6A A;  3BDC A;  1SNP A;  3GTQ B;  3MZ5 A;  1EU4 A;  1CT1 D;  1FGB D;  5FLX E;  4FF4 A;  2SDF A;  4ABN A;  3K7A B;  4Q0F A;  2NN6 G;  1LTB D;  5IGF A;  3J7A V;  2HQE A;  1XYI A;  1LTG D;  2IW3 A;  1G2T A;  1MD2 D;  3A7L A;  4CHT B;  1E0B A;  1GUS A;  1Y1V B;  1ENF A;  1NSN S;  3SK5 A;  4A3J B;  1QOH A;  5DNF A;  1EZ6 A;  5KRU A;  3QOJ A;  2F0D A;  5EKK A;  5CV7 A;  3K0Y A;  5ELC A;  1BBX C;  3LX0 A;  5E4W C;  1DXM A;  5FO9 B;  4G7O C;  1GJX A;  3FMC A;  3NWT A;  1GUN A;  3K6O A;  1TWF B;  1PZJ D;  4KY5 A;  2NVY B;  3KLR A;  4ZRZ A;  2OF1 A;  1BCP F;  1EY0 A;  5I2X A;  2BA1 A;  3I91 A;  1AN8 A;  4MHE A;  3H94 A;  1EU3 A;  1Q1B A;  1H9S A;  4I7Z C;  3K58 A;  3DWA A;  3I72 A;  2XWJ B;  2LMC B;  5M5W B;  5JJZ A;  4DF7 A;  4RHS A;  1HA6 A;  3URY A;  2EY5 A;  5JPN C;  2BDN A;  4BBR B;  2IWH A;  1GUO A;  2F0N A;  2EDG A;  1HA5 A;  2RDH A;  3OIP A;  1YNJ D;  1STB A;  4A3I B;  5IGD A;  2FFK B;  1EEI D;  4A3D B;  1KLU D;  4L63 B;  2M9V A;  1TT2 A;  1ILQ A;  4H13 C;  3HS0 C;  2F03 A;  3GTP B;  3IL8 A;  5CV4 A;  2MPM A;  5LL6 X;  3MC0 B;  3HOY B;  2O4X A;  4NP5 A;  4KTA A;  1PTO H;  4RHR A;  1VF7 A;  2GA4 B;  1J9O A;  5EPJ A;  1SJH D;  4EQP A;  4HMJ A;  4KN4 C;  3H0G B;  4O1N A;  3SDZ A;  2A74 C;  3VA5 A;  2F0K A;  3CRK C;  3QWN A;  3BVG A;  3DEO A;  4K14 A;  1PFM A;  3VR5 A;  1FNV A;  1WTQ A;  1HHV A;  2Y0S B;  3J80 E;  3HOU B;  1RTO A;  1JWM D;  1STN A;  5A35 A;  2CW0 D;  4PNY A;  4OO1 G;  3S2D B;  1QNU A;  1R9T B;  1AZQ A;  1TQO A;  3HKZ B;  1D5M C;  4ULL A;  5DM7 3;  3WOF A;  2NN6 H;  3MA2 B;  4QMG A;  3K59 A;  1X3Q A;  5LHY 1;  2F0L A;  1JIC A;  1TS4 A;  1S5B D;  4G4K A;  2D5D A;  2ZXP A;  4I65 A;  5C3E B;  3V2T A;  3T4A C;  3Q23 A;  1HTP A;  2JSO A;  2FIN B;  1CA5 A;  2B2Y C;  2BE5 D;  3CQZ B;  3SE0 A;  4IUU A;  1B9M A;  2ZXR A;  1DOL A;  1S5C D;  1U4P A;  2Q8I B;  5CV8 A;  5ELF A;  1IYU A;  4OIK A;  1S5F D;  4K5X A;  2EJM A;  2ZXO A;  1AEX A;  2KQ3 A;  3V96 A;  3RLF A;  4KJO A;  4JBW A;  1K83 B;  4YIJ A;  3KUP A;  2BCO A;  3HOX B;  2JEB I;  3ND8 A;  1SAP A;  2EVB A;  5DEH A;  2MUY A;  1HUN A;  3E5S A;  4OIJ A;  4QCL A;  2F0J A;  2VB3 X;  1BUV T;  2TSS A;  3D3R A;  1SYD A;  1LT4 D;  4V0B A;  1PXU A;  2EPB A;  5IIF A;  3C3L A;  4F8M A;  3NHH A;  3HP3 A;  3NQT A;  3NXW A;  1WD1 A;  2XRS D;  5C4Z A;  2EY1 A;  4UAI A;  5KNB A;  1GXD C;  4J1M A;  2F0H A;  1I4R A;  1DM0 B;  1H9R A;  1OO9 B;  1V8Q A;  3NTI A;  4BY7 B;  2ICE C;  4C3I B;  5C0X I;  4ZKC B;  2JA6 B;  5D14 A;  1ONL A;  1ENC A;  4G7Z C;  3A7A B;  2LFN A;  2NN6 I;  2NTS A;  1TY0 A;  1V1P A;  2X6G A;  1I4H A;  4XQN A;  5ISR A;  5CV6 A;  1LAC A;  2K1B A;  1LT3 D;  3EFX D;  4A3M B;  4ZKB B;  2L1B A;  4ID6 A;  3VYS A;  1S5E D;  5C4H A;  1QWY A;  4RA8 A;  5DAU A;  4XYQ A;  3R3O A;  1IKM A;  4DNR B;  3GTK B;  1IYV A;  1B2T A;  2Q8R E;  3A8J E;  2K04 A;  5C3X A;  3BDL A;  1F9S A;  3M4O B;  5FO7 B;  1DZ1 A;  2FJ2 A;  1STH A;  1Y8P B;  4X3T A;  4K5W A;  2RA4 A;  1WD0 A;  4DAY A;  1WCM B;  1DJR D;  3TP5 A;  2EJF C;  5ELB A;  1E2Z A;  3I73 A;  1NAP A;  3J7A F;  3P1H A;  2F3V A;  2JP1 A;  4PMW A;  2J0T D;  4IUV A;  5C5L A;  1FNW A;  3OWF A;  1JWS D;  4DGZ A;  2PZU A;  2RVL A;  2VNU D;  1NR2 A;  2C9O A;  1MI2 A;  2F0E A;  3QIA A;  2HCC A;  1O7L A;  3S14 B;  1ILP A;  5HUR A;  2E75 C;  1ZKO A;  3DXJ C;  4X3S A;  5CBA E;  1ICW A;  2L4N A;  5C5M A;  2EZV A;  1QJO A;  3L7Z C;  1EOT A;  3OHX C;  1GHK A;  3OIQ A;  2BE5 C;  2VB2 X;  1SFO B;  5IGG A;  3MAQ A;  1WTP A;  2B8G A;  2B2Y A;  3BZD B;  1BF4 A;  5CR3 A;  1KTK A;  2KA7 A;  2R3Z A;  2NVQ B;  5CC4 A;  4RAU C;  1AZP A;  1CK1 A;  2K5D A;  3KLS X;  2ID0 A;  5A2Q L;  4L8J A;  1KAB A;  3DM1 A;  2F3W A;  1EY7 A;  1NCV A;  4KHZ A;  4FXG C;  1U4L A;  4OO1 I;  4CBV A;  4HSP A;  4U67 3;  1FR3 A;  1A3V A;  4LMQ D;  1BDO A;  1LLR D;  5EGT A;  3K5L A;  5JAV A;  2AUJ D;  4FP5 D;  1B44 D;  4ZUJ A;  1C4Q A;  2RDF A;  3GP7 A;  5IGB A;  4ZLT F;  1HCZ A;  2PZW A;  1Q8I A;  4IUN A;  1Y8N B;  1ZXT A;  1F2M A;  1FYC A;  3TSS A;  2F0T A;  4XT3 B;  3A56 A;  4Q5V A;  4A3K B;  5JPM C;  3W2D A;  3HRZ C;  3WOE A;  3EVQ A;  2H1E A;  3TME A;  4G57 A;  5C44 B;  1TY2 A;  2A68 C;  3E6Z X;  3SR1 A;  3SK8 A;  5A2Q E;  1SNC A;  1QG7 A;  2WAC A;  1PRT B;  4QF4 A;  2R93 B;  5M5X B;  1K8O A;  4KV6 A;  2ICI A;  1PLF A;  1SYC A;  2A73 B;  1EY4 A;  3NTK A;  1EWC A;  2K32 A;  3NP8 A;  3KBX A;  3VYT A;  1PTO B;  3D4R A;  3T51 B;  2QKI C;  3D6W A;  2F0O A;  4FO2 A;  1FNU A;  1HTL D;  1KDC A;  1VMP A;  4MN3 A;  1JWU D;  2WKC A;  2WKD A;  2CVR A;  1LTR D;  1S5D D;  1U4R A;  5C4X B;  3ERQ A;  4K6L A;  4C3J G;  4KMU C;  3O13 A;  3VR4 A;  5KYI A;  1ROD A;  3W3A A;  1JOO A;  2PW7 A;  2D9U A;  3GQB A;  1I4G A;  1WTV A;  3MXU A;  2IX0 A;  1Y69 U;  2NB0 A;  4K8I A;  1BXT A;  2L12 A;  4RGT A;  5F2D A;  4XT1 B;  1O80 A;  4PMB A;  4EQO A;  5CGK A;  3J81 L;  5I6Y A;  1CFM A;  2F0U A;  3X3N A;  3OWE B;  1PFN A;  2EE1 A;  1I4Q A;  1KDB A;  3TZD A;  2SOB A;  2G9D A;  2HDL A;  4CKB A;  2PPB C;  4TKO B;  2AWN A;  1W6J A;  4ZAI A;  4K6D A;  1TVX A;  1BR9 A;  2MP1 A;  1W6K A;  1IHZ A;  4XQQ A;  3P75 A;  3I8Z A;  2X6L A;  1BOS A;  4BY1 B;  1BQQ T;  1CQV A;  1SEB D;  5M3M B;  3UI2 A;  2MGS A;  3AU7 A;  3I4L A;  2N55 A;  2O2L D;  2OEO A;  3NBI A;  3K5N A;  3M85 A;  1HUM A;  3OPO A;  3RUZ A;  2XVS A;  3J80 L;  2VUM B;  1CM9 A;  1TII D;  2F0W A;  2D62 A;  5KYL A;  5EKL A;  4KD3 A;  1HFN A;  1FD7 D;  4FXD A;  3J81 E;  3M7N A;  1SJE D;  3IAY A;  4KN7 C;  2PQE A;  2XWB B;  4RGO S;  2JE6 I;  2XNA C;  1TS3 A;  2I07 B;  3D6C A;  1HQR D;  1PTO C;  3BYY B;  5IGC A;  3QG1 A;  4FF1 A;  4A3B B;  1IKL A;  5ELD A;  3S16 B;  3TBI B;  1JQY D;  3MXP A;  4Y7N B;  4XYO A;  4DK1 A;  1ZEQ X;  1KLG D;  2XSC A;  3RZD B;  1GUT A;  1TR5 A;  5FKA C;  2KHS A;  4WJW A;  3MVV A;  2H4O A;  1Q3L A;  4GZY C;  2Z1C A;  2B2U C;  4HCS A;  2YYZ A;  4U68 A;  1IL8 A;  5D3I B;  1QE6 A;  1EY5 A;  2BA0 A;  1F9R A;  3DEP A;  4O42 A;  4BA2 I;  2RQX A;  3I70 A;  3L9A X;  3VR3 A;  1SMY C;  3U9S A;  4R8N A;  1Y1W B;  2B2V C;  4F7X A;  2DNC A;  1G29 1;  3MEH A;  1G8Z D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...