3TMEA

Crystal structure of staphylococcal nuclease variant delta+nviagla v23e at cryogenic temperature
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 31
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tmeA00
4NKLA 3SK5A 4R8NA 2O4XA 2F0JA 2F0FA 4LAAA 4J6HA 1KDBA 4HMIA 2F0IA 4IZ8A 5CGKA 1EY5A 4KHVA 4G57A 3DHQA 5IGEA 3C1FA 3SK4A 1KABA 1SYFA 3SK6A 1ENCA 2KHSA 4K5VA 3OWFA 2QDBA 4KD3A 3P1HA 4KY7A 1TR5A 5DEHA 2F0UA 2F0TA 2PZWA 3MEHA 1KDCA 1STBA 4ODGA 3TP8A 4EVOA 1STNA 5JOBA 1AEXA 3BDCA 2EXZA 2M00A 3ITPA 3ERQA 1EQVA 1EY8A 2EYLA 2OEOA 2RKSA 5CV5A 5CV9A 3OMGA 2KQ3A 3SK8A 2EY1A 1SNCA 5K5PA 5I9OA 5C6AA 3MHBA 3MVVA 2F0PA 1TT2A 5F2DA 5KGUA 1A2UA 2RDFA 2F3WA 1EY4A 4PMBA 5I6YA 5JAVA 4NMZA 5M9OA 3S9WA 2ENBA 3D8GA 4RKBA 5C5MA 2HQEA 4KJOA 4QF4A 1NSNS 4N9PA 2EYMA 4ZUIA 4DF7A 4RKLA 4NP5A 4EQNA 1II3A 5IGGA 2F0HA 4HTHA 4K5WA 2PYKA 3SR1A 2EYJA 4QB4A 4ME5A 1SNDA 3D4WA 1U9RA 1STGA 1KDAA 5CV7A 3SHLA 2F0GA 4K8JA 1STAA 2F0WA 2SOBA 2WACA 3PMFA 2EY6A 4ID6A 4E6IA 4F8MA 1F2MA 1A3UA 2EYHA 5DAUA 5EKLA 2PQEA 3TP6A 3NK9A 4DFAA 3U9OA 4F7XA 5IGCA 2EY5A 2F0NA 3TP7A 3TP5A 5IOCA 5C3WA 5C3XA 1EYAA 4KY6A 3QB3A 5KEEA 1A2TA 2EYOA 3MXPA 3EJIA 3OSOA 4N9TA 5CV8A 1EYDA 2F0SA 1SYEA 2F0MA 3R3OA 4KD4A 4B9WA 1A3VA 1F2YA 3D6CA 1SNQA 5EGTA 3TMEA 5KYLA 5C4ZA 1TQOA 3EROA 3LX0A 4K2LA 5IGBA 2F0EA 4K14A 5C5LA 5ISRA 2EYFA 2F0LA 5IODA 1SYBA 2OF1A 3RUZA 1EZ6A 4IUNA 5E1FA 3MZ5A 3OMCA 4KTAA 4EQPA 5J22A 5CV4A 3NUCA 3C1EA 3VA5A 1NUCA 1EY0A 3BDLA 2NUCA 3V2TA 3HZXA 4K8IA 1EY6A 1A3TA 2SNMA 4DGZA 2PZUA 4KY5A 5KIXA 3NXWA 1STYA 3T16A 3EVQA 1F2ZA 4IALA 2F0QA 4PNYA 5CV6A 5HGTA 3P75A 4NDXA 4K6DA 1SNOA 1SYGA 4QMGA 2RBMA 5HURA 5KRUA 4EQOA 4OL7A 3QOJA 4DU9A 5J39A 2F0KA 1STHA 3DMUA 4YIJA 3NQTA 2EYPA 2F0OA 1EYCA 4I65A 4K2KA 4KV6A 4TRDA 1SYDA 4WORA 1ENAA 3NHHA 2SNSA 3T13A 2F3VA 1EY9A 5NUCA 1EY7A 4WRDA 1IHZA 5C4HA 1JOQA 1KAAA 5IGFA 2OXPA 4PMCA 1JORA 3QOLA 1JOKA 5I9PA 4KJNA 1SYCA 4K5XA 4HMJA 5CC4A 1RKNA 2F0DA 1SNMA 4ZUJA 3NP8A 2LKVA 4ZQ3A 5I6WA 3SXHA 3E5SA 4J1MA 5CR3A 5KYIA 2EY2A 3D4DA 5IGDA 4MIUA 1JOOA 5E3FA 2PW5A 5EKKA 3HEJA 3H6MA 5J1ZA 4H7BA 1SNPA 1EZ8A 2F0VA 4B9XA 2PZTA 4S3SA 5IIFA 2PW7A
chains in the Genus database with same CATH superfamily
3SK5A 1K0SA 2AUJD 4C3JH 2OQ0A 3PO3H 3BS1A 2F3IA 4L5TA 4B3RQ 3I2ZA 1W3SA 2DGYA 1L0WA 1VQOA 1ENCA 3UDGA 1LTTD 4KD3A 4NB3A 3TSSA 1B2TA 2M00A 1I3QB 2M9VA 4XT1B 5M3FG 3GQBA 4XXEA 1QE6A 3PUYA 3M4OB 1JB3A 3AFPA 4RGOS 1N9WA 4C3HB 1KL9A 2WFWA 3NBHA 3SEBA 1DZ1A 2MO0A 2OTJA 3CRKC 3KFUA 1N32Q 1E2WA 2LS01 4R4CA 2R7FA 2B63B 4A3FG 3SHLA 3CC4A 1H9JA 4XDXA 4HCEA 1CUKA 1IYUA 2Q2TA 2PQEA 4Y52H 1K0RA 4A3EB 3HKSA 1FJGL 1EYAA 3KLSA 3K0XA 4HCSA 4DAPA 1SBBB 3PGZA 2F0SA 2PCFB 5IT9E 4WJWA 4OHJA 4IJHA 1J8IA 1UEAB 2K28A 1PH5A 5J3BA 4DAYB 4P73A 3IFTA 1XPRA 2PMZB 3RZDB 4UP8A 1T5EA 1TS2A 5IYBG 2JA8H 3M3YB 1BO0A 5FJ8G 2Z6KA 3CCRA 2JEAI 3CW2C 2TSSA 5LMNQ 2FHTA 4GKKQ 3RLFA 1S5FD 1PZKD 4X62Q 1Q12A 3H91A 4EQOA 2RDHA 1X9NA 3I91A 1QZGA 1MJEA 2IL8A 2FJ2A 4L6TB 5L37A 4A3IB 4K6LA 2JQOA 4DAVA 1S5CD 3F2BA 3MTSA 2UUAQ 5I9PA 1UWVA 2RHSB 3KLWA 2JA9A 4L5SA 2L9HA 1V1OA 2QILA 4A93B 1Q90A 1FVIA 4C2MB 1O80A 2NVXB 4GN3B 5T1IA 4BWGB 2N55A 4NKLA 1SE2A 4LF7Q 3AB9A 2UUCQ 3RLNA 4GZYC 1QJOA 4BBSB 2F0IA 1JICA 1VMCA 3UDIA 4CJ0B 1Q46A 1SYFA 1XTCD 1CA5A 3CRLC 3Q23A 3TP8A 3UDFA 2R7DA 1VQ8A 1STNA 2B2WC 2NVQB 2A19A 2EYLA 2RVLA 4PQXA 1IBML 2I5HA 2FMMA 5BN5A 3GV3A 2WB1B 1TT2A 1GOZA 2XGTA 2CQAA 1EY4A 3GD7A 3J81E 1EUJA 2ENBA 4KKSA 3CCQA 1AP0A 1EIFA 1GXDC 3KK7A 1GUNA 4K5WA 3CCVA 1TWCB 1A6XA 3TEHB 2JE6I 4ME5A 3AMUA 3KF8A 1CA6A 2ZTDA 4DUZL 5M3MG 5EKLA 2C9OA 3V05A 5T1GA 3BZDB 1T5XD 4C3JB 1CKNB 1PFMA 4JI3Q 1EYDA 5EGTA 1VQMA 1TQOA 1HZAA 2F0EA 5C5LA 2N3SA 4QUFA 1F9PA 4JI2Q 3NE5B 1JQYD 2SDFA 2V1CC 5IODA 4DV6L 3T1HL 4FF3A 1HQMC 2KUMA 1EY0A 4A3EG 2Q8IB 1A3TA 2KCCA 2RF4A 3OTOL 4JI8Q 1RL2A 2DUDA 1VQIA 4IALA 5GAEC 3VR6A 4K0KL 1M1KC 4JOIA 2B29A 2QKIC 1UE6A 1S5BD 3K0YA 4A3GH 1EWCA 1K83H 1VF7A 2F3VA 2QEXA 1YJ9A 1EY7A 4C56C 1KD1C 1JOQA 2R7ZH 4JI4L 4UPAA 4A3CH 4P75A 3CQZH 4A3MH 3PIOA 4HIMA 1L1OC 3J7A5 2EY2A 5IGDA 2OTLA 3RLOA 1JOOA 2EQSA 3J7AF 2B2YA 1RTOA 3HOVH 2H4OA 1SR3A 1PRTC 1YNXA 2Z6BA 1N36Q 4Q5VA 1GJXA 5C0XH 2EPBA 1TS3A 2F4VQ 4FYDA 4BBRH 1LM0A 2A69D 3CCUA 4DUYL 1HPCA 1JR0D 2PZWA 3RZDH 3S15H 1Y1WB 3OOCA 1VDZA 4HIDA 3WDNA 4ALPA 1NTGA 1TWHB 1BDOA 3SK8A 5AJ3L 5JJLA 2A68C 2K33A 3HOUH 4TQUS 2NZOA 1LTSD 3F2DA 4A3CG 4ZUIA 2EVBA 2VUMB 1PFNA 2OCEA 2XIWA 2Q2UA 1U9RA 3VR2A 1Q81C 4DR5Q 4Z9CB 1FGBD 1Q1EA 1E3PA 2WACA 3UE1A 1VQAA 2LSSA 1F2MA 1KRTA 4A93H 4LFBQ 2EIFA 5FO8B 2K5HA 3ULPA 3J81L 4LNQA 4ME3A 1QOHA 2ZXPA 1YVCA 5G3LF 4PZ8A 5JJZA 4QQBX 5GROA 4QCLA 5M5YH 4CDCC 2R92G 2E2DC 4JI3L 5FK9C 3X3MA 3LX0A 4BY7G 1VQ4A 1SYBA 1V1PA 3ZYYX 5D65A 4GNXC 3OMCA 2QGQA 3Q24A 3ULJA 4DV1L 2UU9L 4A3GB 1O7LA 4KY5A 2XSCA 3T53B 1PRTD 3T16A 3WOFA 1SE4A 1CZGA 1X32A 1VS0A 2LXJA 3P75A 4UP7A 4K6DA 3L0OA 1SNOA 4YHHL 1I94L 1X3EA 2ZJQA 4P71A 4R4TA 5I6WA 4HIKA 4OWTB 3U4ZA 2JSOA 1SYDA 4QY7A 3M3YH 1GM5A 3S16H 1HH2P 1NMFA 1VQLA 1EWHA 4X65L 1HFGA 2A68D 1N34L 1D1IA 3STBC 1ZEQX 4ILWA 1KIXA 4DNIA 4C3IB 1QB5D 3I4MH 4FNFA 4DV3L 1XTDA 5K36H 1ESRA 2QDLA 3M4PA 5J1ZA 3M4OH 2PZTA 5CGKA 1XPOA 4R8NA 2UUCL 2K75A 2NBFA 2E2IH 3PO2B 1EEFD 4JG2A 3TDQA 5IGEA 1YIJA 1KABA 1GO3E 1MD2D 4DR2L 2EOTA 2F0UA 1X56A 3MEHA 5C44B 4YWMA 4DV4L 1EQVA 2NTTA 1OXSC 4KHPL 1PYBA 1JE4A 3BYTB 3FKIH 4C1NI 3M7NA 4GKJQ 2F0PA 1PTOC 2RDFA 5GQOA 2J0TD 3RNUA 4QF4A 1NSNS 1PA6A 4H44C 1L0YB 3NTIA 4B3SQ 1HNWL 3RD4A 1KDAA 2I5MX 3J81j 4K8JA 3S24A 2EY6A 4ID6A 3VR5A 3J80E 1TWCH 1I6HB 3NTHA 5IYBH 2K5WA 3MXNA 1I4PA 4OO1H 1BBUA 1A62A 4NXML 1ASYA 4DR6L 4BBRB 1Y69U 1AE3A 2KBNA 3FPUB 2EYFA 2F0LA 3TQYA 2PNRC 1ET6A 4RAUC 1X3PA 4KTAA 1NE3A 3HOXH 1JJCB 1TWHH 3V2TA 3ZJYC 3J7YW 1RHPA 3F2CA 1NBWA 2VS1A 1P8LA 4LF9L 3JAME 5HURA 4DUZQ 3G7LA 3O13A 4KN4C 4UP9A 3DMUA 2EYPA 1SSOA 5C3EG 3S1NH 1ZKOA 2CH4W 1IL2A 1A0IA 1U4MA 3CP0A 4GOPB 1H9SB 4CDEC 3I7FA 3N52A 1PTOH 3QOLA 3H0GH 5EQ0A 4X64Q 2PO4A 3I3CA 5CC4A 2C5CA 4O1NA 4JW0A 3K80C 3U9SA 1I4RA 1BCPB 3EFXD 5KYIA 1M90C 2PPBC 3ERSX 4IUPA 1J5EL 4HSVA 2GVBA 3Q22A 3H6MA 3A5ZB 1E1TA 1B7YB 3KDFA 2DNCA 1I5FA 2HDLA 4H7BA 1HZBA 1EQTA 2PW7A 4P72A 1U4RA 3FKIB 2N8NA 4IZ8A 1A15A 1EY5A 2IX1A 2NVTH 4G57A 1J6QA 1BF4A 3U4VA 4ZKBB 2KHSA 2XRSD 3DLLA 3HOWG 2HD3A 1IYVA 1EY8A 3TBIB 4FF1A 2RHQB 1N33L 4DAYA 3GTGH 1ONLA 1Z9FA 2F3WA 1PDQA 3GTKB 1BBXC 1Y1VG 2IW3A 3BVZA 3D8GA 5C5MA 3X3NA 3A8JE 1BUVT 3SR1A 3K57A 3MXNB 1HNXQ 3KF8B 4B3TQ 1PYSB 2ZTEA 2K52A 4ZK9B 2UXBQ 2F0GA 5M5WB 2I5LX 1STAA 2F0WA 5IT9c 4A3DG 1GKHA 1YHQA 4FP5D 4TVAB 1GUGA 2KHIA 4HJ5A 1ET9A 2VUMG 2R6GA 2FFKB 3VYSA 2RDGA 5CORA 2QCPX 2O2LD 4P2CB 5AFWA 1PHJA 3IAYA 1SE8A 3ER0A 5CV8A 3PIO3 1EIYB 5CBAE 1VQNA 2NWGA 1KLUD 5IP7G 2OF1A 4DNTB 4RGTA 2IY5B 3D31A 1E24A 4LW1A 1IYJB 3QIAA 2HHHQ 3I4NB 4Q0FA 4A3DH 4JI1L 1EU4A 2EJGC 3FP9A 5FLXL 4LF4L 3RZOB 3PCOB 1YHAA 1HZCA 4NDXA 2NYZD 2LFNA 3QOJA 4IUTA 4IFDH 4APVA 1F9RA 2VL6A 2E5LQ 1RIPA 1PH8A 2FINB 1I94Q 1Y1VH 5NUCA 4PV1C 1U4LA 1GUSA 2VNUD 1I50H 1V1PB 4KJNA 2RSNA 1CKMA 4X3TA 4DK3C 2JXMB 1YBYA 3DM1A 3KUPA 5M3MH 4RMFA 1G6PA 5I2YA 3B6YA 2JK8A 5E3FA 1JC7A 1I4XA 3PIPA 1VQCA 1Z6HA 1SFOH 4DR3Q 5IIFA 4R4OA 1KLGD 4I7AA 3S14B 2A6HD 1EIHA 3M85A 1DD2A 3I4MB 3R2IA 2AQ2B 4LFAQ 3HOXB 4BXXG 2J4XA 3A8IE 5M5XH 4DV4Q 2WKDA 4P74A 4HJ9A 2MQHA 3T1YL 1HTLD 1I4QA 5CV5A 5I9OA 4OWWB 1UNSA 1WFQA 3T56B 3M7GA 5M9OA 2YTXA 4B08A 2B2UC 4DNRB 3S1NB 3I4OA 5LMUL 5C3EH 3AYHB 4LK1C 4HIOA 1PFBA 1BR9A 3T51B 5LHY1 3NTKA 5G3LD 3U50C 4BS9A 4JI7L 3HOWB 1X3QA 3G4SA 3HOYB 4IFDG 1AW7A 2E2JH 1BOSA 3HOXG 2HQLA 1AH9A 2Y0SB 1UE1A 5DAUA 5IGCA 2ZJRA 1RF2D 1TWGH 1QG7A 2F0NA 3T1HQ 1Q8IA 3CAMA 3H3VC 3DEOA 2NTSA 3D3RA 1UAPA 4A75A 1RD9D 1PRTB 4JYAL 5ELDA 1LT5D 1F2YA 2ZJPA 3PUXA 1PXUA 4HJAA 4DR1Q 3RN5A 3M9BA 4K2LA 2K7VA 5ISRA 5JJKA 4UY8C 1I6VC 4O2DA 3AFQA 3NUCA 3HP3A 4OO1I 2F52A 4I7ZC 2C35B 1H9KA 4DN4M 1MHWC 1K28A 5GAHC 1HNXL 2N78A 1NAPA 5JVH3 1QNUA 3HOZH 1HQRD 3PF5A 2PNHA 3A7LA 1D8LA 3G48A 1CSPA 3OIPA 1BVSA 2OXPA 1SMXA 1JOKA 1SYCA 1VF5C 3E9HA 5FLMG 2FXQA 3LWEA 3SXHA 1QVCA 2XRQD 2K32A 4DR5L 2NVYH 3D4DA 1Y8OB 3C46A 4L8JA 2KCTA 1O78A 5EKKA 4A3FH 1KC8C 1SNPA 4LWCA 2PMZE 5JVG3 3BJUA 2Z9HA 3NBHB 5CBEE 1C0AA 4XQNA 1LV9A 4KKTA 1WTQA 3NENA 1FNWA 4JBWA 3SK6A 3UDXA 2VQFQ 2X6GA 4RCOA 4YCVA 2K5VA 2NZ1D 4JC0A 1STBA 1PH4A 3CMAA 2WV6D 2OEOA 5CV9A 5K5PA 1PH7A 2B63G 4XT3B 3F1ZA 1WTPA 3HOWH 4H13C 1K8GA 1I6HH 2CHBD 1KHIA 1IKLA 3S9WA 5IYCG 3TP5A 1E0BA 2B39A 4QIWE 4RKLA 5IGGA 2JYOA 1J5EQ 4FF2A 1YNJD 1PH1A 5JEAG 2G9DA 5IE8A 1Q8KA 5LMNL 4A76A 1I50B 2MP1A 1EQRA 1XMQL 2DN8A 1XPUA 5EAYA 2KCNA 4A3MB 1C48A 2H1EA 3K5OA 1D5XC 4X64L 3LWUA 1BCPC 2EYHA 3TP6A 1K8MA 5FLMH 3VA7A 3CD6A 3U9OA 1WCMG 2JA8B 4JI6Q 1KTKA 4G4KA 3HOVB 1VQDA 1F9QA 1X65A 3NWSA 4DR6Q 2VZAA 2ZT9C 4LF5L 2JEBI 1EFWA 4L63B 1MJCA 5KYLA 2Z4IA 2B2VA 2JA7B 1CQFA 5IGBA 4FXKC 3VYTA 1R9TB 5ELCA 5C4JH 5DNFA 1QILA 3GTMH 4DXFA 1DM0B 2UXDQ 2PZUA 5KIXA 2OQKA 1STYA 1CSQA 1WJJA 2XWJB 1FD7D 3BDOA 2FMCA 2A6ED 3DWQA 1GHKA 1XJVA 1UE7A 2B2VC 1I3QH 3BYYB 1ICWA 4WORA 4K2KA 3S1QH 4KV6A 1LTID 4DV5Q 5JEAJ 1U0LA 1C9OA 2NVYB 1D7QA 4WJ4A 2IT1A 3UI2A 3RZOH 2E8GA 2D0PA 1K73C 2JN4A 3HOYG 4BY7B 4A3JB 2BDNA 2YTVA 4GLXA 2JJQA 4BBRG 3EIVA 1VQGA 4JCVE 3FHWA 3ULLA 4B9XA 5IWAQ 1K8AC 4AIMA 1G2TA 5EPLA 1A8VA 1KDBA 2BOSA 3RN2A 1FJGQ 3ICEA 1AZPA 1BCPD 3OWFA 1AE2A 2QDBA 4KI0A 1N33Q 3CC7A 4RFBA 3FDTA 2EXZA 3ERQA 2R92B 3OMGA 1MSGA 1SNCA 1LTGD 4HR7B 4EX5A 4JBJA 3J80i 3PQIA 1LLRD 4YY3Q 5BR8Q 4IN3A 4QUCA 4A3LH 1TXYA 3H94A 4IURA 1QVGA 3VR3A 5GADC 2R93B 3BU2A 1SNDA 3D4WA 5FLXc 1OO9B 3I90A 1B50A 3H0GG 1HNZQ 3IKJA 2M2LA 1Y1WG 1MGSA 1SEBD 2UUAL 1TWAB 3TP7A 1M4VA 1CM9A 3VYRA 3D0FA 2K01A 5COYA 1IKMA 4MTKA 4FO2A 3DXJC 3OSOA 4UHVA 3TN2A 1MKHA 4YHHQ 4MN3A 2A6EC 1B70B 4DV2Q 3W5OA 2K5QA 1K83B 4LF9Q 3TS2A 1HR0Q 3RUZA 1ESFA 5E1FA 1HUNA 5J22A 3GDEA 3S2DH 2L55A 4DAMA 3S1QB 1OXUA 3C1EA 2CQOA 1Q82C 2L5TA 3NXWA 1XNRL 4CHTB 3A5UA 2WB1G 1X3GA 2B2TC 1Q1BA 4PNYA 1F77A 3DWPA 4DU9A 2JP1A 4WJ3M 3VYUA 3A55A 1K3BC 1W6JA 4I65A 4AH6A 5KNCA 1ENAA 1N32L 3TZUA 1D1KA 2NN6H 3OHXC 3GP7A 2D62A 1UUPA 2VQEL 2PQAA 1B3QA 2A8VA 1I4GA 2AHOB 5ELNA 3JAMi 1QWYA 4KLKA 3GTJH 4NXNL 3G71A 2R93G 5DM73 3SVMA 1AN8A 5KGUA 4IPCA 1GD7A 4LAAA 2AQ1B 1N36L 1WTWA 1O7IA 1FL0A 1B9MA 4RGNA 2JA7G 1JCKB 4DV7L 1RTNA 1EFID 2CFMA 4DA2A 5LL6S 3T1YQ 1B1ZA 5C4JB 4EQ5A 3NSWA 2BH2A 1PVOA 3OYYA 3HOYH 4QL5A 4A3JG 2E2JB 2R93H 1K8OA 3J7ZC 5DM63 2VB3X 3CCJA 4C3HG 4PMBA 1CKOA 2BH8A 1D5MC 4IUUA 4X65Q 4R4IA 1QZHA 2I0QA 4Y7NB 4EQNA 3H15A 4M8AA 2UXCL 2E75C 3Q6SA 4X3UA 2UUBQ 1MSHA 2K04A 4DV3Q 1VQ7A 4JI4Q 4DUYQ 3KOJA 4A3BB 2JA6H 5IP9H 4XYOA 3J81i 1R4PB 3CHBD 5M3FB 2R7ZG 4UDUC 4KY6A 1S72A 2EYOA 1TVXA 1PMRA 4N9TA 1YNND 4MTNA 2XTIA 3A7AB 3HOZB 3ONAB 4YCWA 3CCSA 1C7YA 4LF4Q 3DUZA 1VCIA 4IJLA 4HAEA 4K14A 4NPSA 3H3VH 3DWAA 1SAPA 3K58A 4CJ1B 1NCVA 2L12A 4K8IA 1HR0L 4OX9L 3U58A 1LTBD 1F2ZA 1FNUA 4PMWA 2CW0D 1IW7C 3CPFA 1Y1WH 4C3IG 5DEHA 3QG1A 1XMOQ 2B2UA 5KNBA 1ENFA 2B2YC 4WRDA 1IHZA 5IGFA 2E76C 4DR3L 1QCBD 4A3LG 3F2UA 3PO2G 1NJIC 5FO9B 4POFA 2UXBL 1PH6A 1VQ5A 3HGBA 5D3DA 4KHZA 3D4RA 2PW5A 2KECA 1S40A 3HEJA 3PF4A 1VQ9A 2XNAC 2F4VL 1IBLQ 3FMCA 1FR3A 1F2LA 4A3JH 2B8FA 3I70A 1PLFA 3R8BA 3PSIA 5AJ3Q 3P1HA 3S1MH 1NR2A 1JMCA 5D3IB 1WI5A 1DGSA 4JI1Q 3MVVA 1LTAD 3W1BA 4V190 2CH4A 3JAML 4CDDC 3GTLH 1A2UA 3T4AC 4IO9A 3IFDA 1GUWA 2ZTCA 1VQEA 1Z47A 3PUWA 1X6OA 4N9PA 2IX3A 4AYBE 4A3BH 4NP5A 1II3A 4DPGA 2F0HA 3W1GA 4CBVA 4R4QA 1RODA 1WTOA 1XXGA 1YJWA 1ILPA 1YNNC 4NXNQ 1E2ZA 4GLVB 1R9TH 2RQXA 4GN4B 4C2MH 1FYCA 1TU2B 3I4MG 4M1UB 3C2PA 4KN7C 1QVFA 1ZXTA 3TS0A 4A3GG 1STEA 4BA2I 2VQEQ 3E0JA 1B8AA 2LMCB 4OELB 1SYEA 2F0MA 4NXMQ 4B9WA 3TMEA 1X55A 1SNQA 4H02A 1EIGA 3EROA 1H9MA 1LO5D 4HJ8A 1L2FA 3D6WA 4K0KQ 2RCFA 1PH2A 2NB0A 1O7YA 2R3ZA 3PO3B 2Q8TA 3BDLA 4DGZA 3MAQA 1SN8A 2WB1E 3GV6A 1SJHD 2OT2A 4OGQC 1DOLA 2HHHL 3EVQA 3EQLC 4DV6Q 2HCCA 3Q0AA 2A6HC 3WOEA 4CKEA 4A3IG 4JI2L 4X66L 4OL7A 1EYCA 3KBGA 3GTOB 2Q2IA 3NHHA 2SNSA 4GKKL 2KEEA 2NVTB 1HHVA 5IYDH 4LF7L 2QA4A 3L9AX 1FGUA 3E9IA 1WOCA 2KJXA 1ML0D 4A93G 1U5KA 4FVMA 4XQQA 3MC0B 3PIP3 5M3FH 4ZKCB 1G8ZD 3K7AB 4PZ6A 1U4PA 3E0EA 2F0VA 4LMQD 5JAVA 1ICFB 2A69C 3BZKA 4HMIA 3OWEB 4FXDA 1MIUA 1TY2A 3DHQA 3ND8A 1C8CA 1VQHA 4BY1G 1SDFA 1KDCA 1DXMA 1LYLA 1P16A 4RG1A 3LNNA 2P5ZX 2ZXOA 2WIIB 1S4ZA 2VQFL 2K05A 5C6AA 2MGSA 1S5DD 3I4NG 1E22A 4CJ2C 3OPOA 2K4KA 1XNQQ 4U68A 5I6YA 4NMZA 1H9SA 1PYWD 3L2PA 4KJOA 4FF4A 4G7OC 2O5IC 1JWSD 2IX0A 2GA4B 4X3SA 1VMPA 4NW2A 2B2TA 3KLSX 2HIVA 3KF6B 1HZ9A 4F87A 2IJ0A 1OXXK 2K6AA 1N34Q 1TIID 4A3IH 1YI2A 1C4QA 3DM3A 1A63A 3A74A 2EJMA 3NK9A 5IP7H 3H0GB 5TSSA 3G6EA 1GHJA 1A2TA 3MXPA 2RSOA 5LMNW 1SJED 4B3SL 4DV2L 4KD4A 1TWFH 2NVQH 1NMGA 3BVGA 2AWOA 5JJIA 1D2BA 4JI6L 1OXVA 1V8QA 3J81c 1CK1A 1KRSA 5ELOA 2L0CA 4N8FA 2WP8J 3RR5A 3VA5A 4BBSH 4A3EH 2Y0SG 1HR0W 1WTRA 4X6AH 2VXWA 5CV6A 4OIJA 1YHBA 1PZJD 2KHJA 4QMGA 3CU7A 2K5NA 5EKIA 1PH9A 3MFYA 3I4LA 1WCMH 3T13A 1SE3A 1Q7YC 3K59A 1BQQT 1CT1D 4CKBA 3GTGB 5BR8L 5C4HA 3A56A 4UAIA 3GTQB 4A3BG 1BBWA 2VW9A 1WD1A 1EYGA 4ZQ3A 1SLJA 2E74C 5ELFA 3Q8DA 1KQSA 4JVZA 1CTMA 3I56A 4U673 4GOPC 4IOAA 1CHPD 4CDFC 4S3SA 4C3JG 1B3AA 3IL8A 4XYQA 3BZCA 1IBLL 3I4NH 4J6HA 3I73A 4FXGC 2XVSA 4LFCQ 1B9NA 2HCIA 3NPPA 4K5VA 5IWAL 3GTPB 4IFDJ 3R2TA 5GAGC 2Z0SA 4LUZA 1IL8A 4RCNA 1WVLA 1N8RC 1MI2A 5H1SE 2K03A 1BNZA 2EY1A 1G291 1X3FA 3MHBA 5F2DA 1CHQD 4HEDA 2WINB 3J7AV 4B3RL 2HIXA 4AYBG 2ZM6Q 3GTOH 1PTOD 4ZYSA 4HTHA 4RWSC 3K6OA 3M4QA 2EYJA 4DV5L 3CF5A 1STGA 2D0OA 4BY1B 1ZYRD 4OEMB 2CKZB 1DONA 3K5LA 4RH6A 3OW7A 4E6IA 4G7HC 2MNAA 3S1RH 4DR4L 5I4DA 5E4WC 1BKBA 1RDPD 2AUKA 2ID0A 3KJOA 3CKIB 3N6RA 4GNXB 5C3XA 4BBSG 3QB3A 3CQZB 3CPWA 4OXPA 4JYAQ 1VQKA 3S15B 5FO7B 1BCPF 2HUGA 1EU3A 4J15A 1A3VA 2X6LA 4N8X1 4LF5Q 2DNEA 4IUNA 4RGMA 1EY6A 2KVMA 2UU9Q 4MHEA 3M4YA 4JI7Q 3KDFB 2OWOA 1WYDA 1EL0A 1K9MC 1PRTF 2RBMA 5KRUA 4A3FB 2ES2A 4RHSA 1PZID 2TMPA 3KBXA 5EBDA 2LY7A 2HT1A 2MHVA 3HOUB 2O5JC 5HY6A 1YEZA 2A5HA 4DV0Q 3S17H 2D5DA 4POGA 4ZRZA 3AEVA 4LFBL 1GVPA 2ALYB 1Q86C 3PUZA 4HMJA 4IOCA 1HNZL 2VUMH 2JA5G 1SMYC 1SXTA 2HDMA 4RHRA 2ASBA 2F1MA 1QUQA 1B53A 2X69A 3NELA 3HKZB 3GTPH 2AQ3B 3GTLB 1UE5A 4DV7Q 5ELEA 2IHFA 4QJFA 2F0JA 3HRZC 3L7ZC 4AQYQ 1KNEA 3QJYA 4QGUA 1MBYA 2BA0A 3J80c 2BA1A 3FKIG 5BN3A 1YJNA 1Y14B 1HA5A 1YITA 1I4HA 4TSSA 3E6ZX 4KY7A 5FLXE 1JE5A 3JC66 1AEXA 3BDCA 5FOBB 4HN7A 1E7ZA 2YU9B 1EOTA 1TY0A 1JB7A 4DXGA 4BY1H 3QWNA 1VQFA 2I07B 3K5MA 5K36G 2J7ZA 1WCMB 2Q2HA 4C3IH 1DCZA 1JWUD 5IYDG 1XMOL 1S3OA 5EBCA 3GTQH 1VQ6A 2MPMA 5C44G 2KEDA 4R8IA 3GTJB 3GTMB 3HKZE 1A3UA 4C1NK 1LABA 5C3WA 1M8AA 3VR4A 4LUOA 2A74C 2EXDA 3I72A 4PZ7A 2MO1A 1OXTA 4IPDA 1IXRA 2JA5B 4X3KA 5LL6X 1Y8NB 1SMYD 2UXDL 3HG9A 2L4NA 1Y8PB 3I8ZA 4JI8L 2V4DA 1NUCA 4FDBA 2Y0SE 4DR7L 3HZXA 5IY0A 4BY7H 1LT3D 1TWFB 1IBMQ 3NBIA 4B3MQ 3FEWX 2F0QA 2XN9C 5HGTA 2BCOA 1YNJC 3G6JB 5EPKA 1STHA 3NQTA 4TRDA 1NNXA 2UXCQ 2IPKD 2IWHA 2F4IA 1DJRD 4OIKA 4OO1G 1V43A 1RCVD 1S5ED 2B8GA 3MWYW 3WWVA 4JBMA 3HKZG 4EGVA 2LKVA 1CFMA 3S1RB 1XMQQ 3E5SA 5CR3A 2QW7A 1SROA 2JA7H 3K8AA 3EBEA 5HGQA 4ABNA 3HFZB 3DEPA 3CXCA 4O42A 4CKCA 4XTCS 3I55A 4LFCL 2ICIA 1V9PA 3HOUG 2YU9H 5JPNC 4A3KG 5A35A 3S16B 2BE5C 1CI3M 3SK4A 1LTRD 4KHPQ 1TR5A 4HSPA 1W2BA 1B44D 4OONA 1PV4A 2MUYA 2WAQB 3K81C 1GUOA 5BN4A 4A3MG 4RA8A 4DR2Q 4JPBW 3MEFA 3J80L 2DJFC 2SEBD 5C4XH 1YZ6A 2CWPA 2DY8A 1NY4A 3QR8A 4V0BA 1PTOB 3MFGA 3HOVG 2CCZA 3PO2H 1CQVA 2E2IB 2YYZA 5E7NA 2GN5A 2MFIA 3C3LA 4WFN3 2WKCA 1QNKA 4QB4A 4ULLA 4OWXB 3SGIA 2ATWA 4KKUA 5CV7A 2R7ZB 1Q3LA 3L3OC 1IW7D 2SOBA 1V1QA 3IRBA 1KNAA 4XIGS 4F7XA 3ND9A 4A4IA 4CGYB 1AFPA 2EY5A 3FPPA 1L1OA 4DK0A 2E2HB 1CZWA 5A2QE 3AU7A 1E2VA 2NZHA 2CVRA 4BA1I 3CC2A 3CMEA 1X54A 2D9UA 4X62L 1XX8A 3JAMc 1WTXA 2WAQE 1EZ6A 4DV1Q 4R1JA 1G2SA 1VQJA 5CV4A 1D6EC 1LTLA 4JBKA 2SNMA 1KAWA 3QO2A 4GN5A 1HNWQ 2AMCB 5IP9G 4ZLTF 2MJ8A 3BVMA 1DOMA 3W2DA 4B3TL 4L5QA 1F9SA 2EZVA 1HRJA 5J39A 5KEEA 5M5WH 2R92H 2Q8RE 1IZ6A 3PV0A 1HA6A 1EY9A 4JI0L 4HJ7A 4KK7A 1DYQA 2AWNA 4YY3L 2F03A 3MXGA 2PI2A 2CWAA 2XWBB 2F0DA 5IYCH 4ZUJA 5C0XI 2JA6G 3MA2B 4JOIC 2A73B 3F8TA 3P7JA 4LJZC 3PUVA 1HUMA 2NN6I 1O7ZA 1G91A 1L1OB 3A0JA 3S17B 4A3KH 5IT9L 3S2DB 1WD0A 5C4XG 4AQYL 2RA4A 3KYHC 4KHVA 1H95A 1TWAH 2KENA 3C1FA 3MXUA 5CMDA 3KF6A 2Z8LA 4C3HH 1PTOF 2F0TA 2K1BA 4LF6Q 2R61A 3S2HH 4GKJL 1TS4A 4EVOA 5E4XA 3CCEA 4B3ML 1TKWB 1L0XB 4LFAL 2DY7A 2IHEA 2KQ3A 2JA6B 2N49A 1FNVA 1EWIA 3STBD 2H5XA 5ELBA 3EN2A 4DF7A 2HQEA 4A3DB 5C0XG 1HFNA 2YTYA 2PYKA 4LUVA 5M3MB 2NN6G 1PH3A 1BXTA 2G5DA 1T9HA 1QUQB 3OW2A 1JT8A 4OX9Q 3HOZG 1H9RA 5D14A 1SFOB 5KNDA 5CYUA 4LF8L 1Y1VB 4ZCKA 4DV0L 3GO5A 1JJ2A 4PG3A 4DFAA 5IOCA 4KMUC 3EJIA 2EJFC 1ZYRC 2VB2X 1DOKA 5EPJA 1KXLA 5FJ8H 4X66Q 5C0XJ 1G6ZA 2L1BA 3RMHA 4JK1C 2G9HD 4YCUA 3VDYA 1R4QB 3FRPB 3S14H 2L15A 3K7UC 4AYBB 4JV5L 4Y7NH 5DLQE 5C44H 4DR7Q 2UUBL 4O0AA 5C4XB 5JEAH 1LT4D 2EDGA 5M5XB 2GVAA 2AKWB 3HS0C 3NWTA 1VQBA 4YIJA 2I46A 2D2CC 2L11A 3LGJA 1WTVA 4GNXA 2B2WA 3KLRA 5A2QL 2ZM6L 3FVQA 4GOPA 3E3XA 1KAAA 2BDOA 2B63H 4PMCA 4LF8Q 2Z4HA 5C3EB 1IBKL 3S1MB 2ICEC 1RKNA 3W3AA 4GLAC 4IFDI 2PI2E 4IUVA 4IPGA 3TZDA 3EA6A 2LXKA 1IBKQ 1Z7TA 3S2HB 1EZ8A 2K50A 2O4XA 4BXXH 1SRUA 1CKNA 1GUTA 2F0FA 2K5DA 4QIWB 1HCZA 3TREA 1TWGB 4R9WA 1JWMD 1LACA 2K14A 4JI5L 2RCNA 4H0LC 3URYA 1AZQA 1HTPA 4ODGA 5JOBA 4TKOB 3SE0A 4LF6L 3ITPA 1ILQA 2RKSA 1NR4A 4JI5Q 3PO3G 1EQQA 4ZAIA 4J8QA 1K3RA 5FKAC 5LMUQ 3CCMA 4RKBA 1LT6D 2Z6KC 2EYMA 2N88A 5JPMC 4YWLA 4MNOA 3SDZA 1VQPA 4IQZA 2JA5H 1PFSA 2Z1CA 1UEBA 4IPHA 4L5RC 3PMFA 2BE5D 4F8MA 4F88A 1G51A 1HXYD 2VY3A 2PQAB 4JI0Q 1D5ZC 5EJWA 2QEJC 2NVXH 4A3KB 3UE0A 4G7ZC 4DK6C 1B4OA 5I2XA 1OTCA 1EOVA 3TRZA 1HJPA 3R3OA 4DKAC 4MZ9A 4DR1L 3D6CA 3H09A 5C4ZA 4DK1A 3K5NA 2WAQG 4XQJA 1XYIA 3OTOQ 3MZ5A 4EQPA 2E2HH 3V96A 1LUZA 2JA8G 2NUCA 1EEID 4JV5Q 4IUQA 1E1OA 1TS5A 3CCLA 4YWKA 1J9OA 2ZXRA 3AQQA 3R93A 1SYGA 3K7AH 2E5LL 3GTKH 2F0KA 5M5YB 2F0OA 2B3GA 2CW0C 3A54A 2A1AA 4GS3A 1XNRQ 2KOLA 1XWEA 2QF7A 3A8KE 3NEMA 1JORA 1XNQL 3NQIA 3OIQA 4DR4Q 4K5XA 1ASZA 1SNMA 2EE1A 2KCMA 3NP8A 1WTHA 2YV5A 4J1MA 2DJGC 2KA7A 3BG3A 1RJTA 3KJPA 4MIUA 3P20A 3H3VI 1JJGA 1W6KA
chains in the Genus database with same CATH topology
3SK5A 2AUJD 3BS1A 1ENCA 1LTTD 4KD3A 3TSSA 1B2TA 2M00A 1I3QB 2M9VA 4XT1B 3GQBA 4XXEA 1QE6A 3PUYA 3M4OB 1JB3A 4RGOS 4C3HB 3NBHA 3SEBA 1DZ1A 3CRKC 1E2WA 2LS01 2B63B 3SHLA 1H9JA 4XDXA 4HCEA 1IYUA 2PQEA 4A3EB 1EYAA 3KLSA 4HCSA 4DAPA 1SBBB 2F0SA 2PCFB 5IT9E 4WJWA 4OHJA 1J8IA 1UEAB 2K28A 3IFTA 2PMZB 3RZDB 1T5EA 1TS2A 3M3YB 1BO0A 2JEAI 2TSSA 2FHTA 3RLFA 1S5FD 1PZKD 1Q12A 3H91A 4EQOA 2RDHA 3I91A 2IL8A 2FJ2A 4L6TB 4A3IB 4K6LA 4DAVA 1S5CD 3MTSA 5I9PA 2L9HA 1V1OA 2QILA 4A93B 1Q90A 1O80A 2NVXB 5T1IA 4BWGB 2N55A 4NKLA 1SE2A 3AB9A 4GZYC 1QJOA 4BBSB 2F0IA 1JICA 1VMCA 4CJ0B 1SYFA 1XTCD 1CA5A 3CRLC 3Q23A 3TP8A 1STNA 2B2WC 2NVQB 2EYLA 2RVLA 4PQXA 2FMMA 5BN5A 3GV3A 2WB1B 1TT2A 1GOZA 2CQAA 3J81E 1EY4A 3GD7A 2ENBA 4KKSA 1AP0A 1GXDC 3KK7A 1GUNA 4K5WA 1TWCB 1A6XA 3AMUA 2JE6I 4ME5A 3KF8A 1CA6A 5EKLA 2C9OA 3V05A 5T1GA 3BZDB 1T5XD 4C3JB 1PFMA 1EYDA 5EGTA 1TQOA 2F0EA 5C5LA 4QUFA 1F9PA 5IODA 3NE5B 1JQYD 2SDFA 4FF3A 1HQMC 2KUMA 1EY0A 2Q8IB 1A3TA 2KCCA 4IALA 3VR6A 2QKIC 1S5BD 3K0YA 1EWCA 1VF7A 2F3VA 1EY7A 4C56C 1JOQA 2EY2A 5IGDA 1JOOA 3J7AF 2B2YA 1RTOA 2H4OA 1PRTC 4Q5VA 1GJXA 5C0XH 2EPBA 1TS3A 4FYDA 2A69D 1HPCA 1JR0D 2PZWA 1Y1WB 3OOCA 1VDZA 3WDNA 1TWHB 1BDOA 3SK8A 2A68C 2K33A 4TQUS 1LTSD 4ZUIA 2EVBA 2VUMB 1PFNA 2XIWA 1U9RA 3VR2A 4Z9CB 1FGBD 1Q1EA 2WACA 1F2MA 5FO8B 3J81L 1QOHA 2ZXPA 5G3LF 5JJZA 4QCLA 2E2DC 5FK9C 3X3MA 3LX0A 1SYBA 1V1PA 3ZYYX 5D65A 3OMCA 3Q24A 4A3GB 1O7LA 4KY5A 2XSCA 3T53B 1PRTD 3T16A 3WOFA 1SE4A 1CZGA 1X32A 3P75A 4K6DA 1SNOA 5I6WA 2JSOA 1SYDA 1EWHA 1HFGA 2A68D 1D1IA 1ZEQX 4ILWA 4C3IB 1QB5D 4FNFA 5K36H 1ESRA 5J1ZA 2PZTA 5CGKA 4R8NA 2NBFA 3PO2B 1EEFD 3TDQA 5IGEA 1KABA 1MD2D 2EOTA 2F0UA 3MEHA 5C44B 1EQVA 2NTTA 1OXSC 1JE4A 3BYTB 4C1NI 3M7NA 2F0PA 1PTOC 2RDFA 2J0TD 4QF4A 1NSNS 4H44C 1L0YB 3NTIA 3RD4A 1KDAA 4K8JA 2EY6A 4ID6A 3VR5A 3J80E 1W6KA 1I6HB 3NTHA 2K5WA 3MXNA 1I4PA 4OO1H 4BBRB 1Y69U 3FPUB 2EYFA 2F0LA 2PNRC 1ET6A 4RAUC 1X3PA 4KTAA 3V2TA 3J7YW 1RHPA 3JAME 5HURA 3G7LA 3O13A 4KN4C 3DMUA 2EYPA 1SSOA 1ZKOA 1U4MA 1H9SB 3N52A 1PTOH 3QOLA 5EQ0A 2PO4A 3I3CA 5CC4A 2C5CA 4O1NA 3U9SA 2PPBC 1I4RA 1BCPB 3EFXD 5KYIA 4IUPA 4HSVA 3Q22A 3H6MA 4H7BA 2DNCA 2HDLA 1EQTA 2PW7A 1U4RA 3FKIB 4IZ8A 1A15A 1EY5A 2IX1A 4G57A 1BF4A 4ZKBB 2KHSA 2XRSD 1IYVA 1EY8A 3TBIB 4FF1A 4DAYA 1ONLA 2F3WA 1PDQA 3GTKB 1BBXC 2IW3A 3BVZA 3D8GA 5C5MA 3X3NA 3A8JE 1BUVT 3SR1A 3K57A 4ZK9B 2F0GA 5M5WB 1STAA 2F0WA 4FP5D 1GUGA 1ET9A 2R6GA 2FFKB 3VYSA 2RDGA 5CORA 2QCPX 2O2LD 4P2CB 5AFWA 3IAYA 5CV8A 3PIO3 5CBAE 2NWGA 1KLUD 2OF1A 4DNTB 4RGTA 3D31A 3QIAA 3I4NB 4Q0FA 1EU4A 2EJGC 5FLXL 3RZOB 4NDXA 2NYZD 2LFNA 3QOJA 4IUTA 4IFDH 1F9RA 2FINB 5NUCA 4PV1C 1U4LA 1GUSA 2VNUD 4KJNA 1V1PB 2RSNA 4X3TA 2JXMB 3DM1A 3KUPA 5I2YA 5E3FA 1JC7A 1I4XA 1Z6HA 5IIFA 1KLGD 3S14B 2A6HD 1EIHA 3M85A 1DD2A 3I4MB 3R2IA 2AQ2B 3HOXB 2J4XA 3A8IE 2WKDA 1HTLD 1I4QA 5CV5A 5I9OA 1UNSA 5M9OA 3T56B 3M7GA 4B08A 2B2UC 4DNRB 3S1NB 4LK1C 1PFBA 1BR9A 3T51B 5LHY1 3NTKA 5G3LD 4BS9A 3HOWB 1X3QA 3HOYB 4IFDG 1AW7A 1BOSA 2Y0SB 5DAUA 5IGCA 1RF2D 1QG7A 2F0NA 1Q8IA 3H3VC 3DEOA 2NTSA 3D3RA 1UAPA 1RD9D 1PRTB 5ELDA 1LT5D 1F2YA 3PUXA 1PXUA 4K2LA 2K7VA 5ISRA 1I6VC 3NUCA 3HP3A 4OO1I 4I7ZC 1H9KA 4DN4M 1NAPA 5JVH3 1QNUA 1HQRD 3A7LA 3OIPA 2OXPA 1JOKA 1SYCA 1VF5C 3LWEA 3SXHA 2XRQD 2K32A 3D4DA 1Y8OB 3C46A 4L8JA 1O78A 5EKKA 1SNPA 5JVG3 5CBEE 4XQNA 1LV9A 4KKTA 1WTQA 1FNWA 4JBWA 3SK6A 2X6GA 4RCOA 2NZ1D 1STBA 2WV6D 2OEOA 5CV9A 5K5PA 4XT3B 1WTPA 4H13C 2CHBD 1IKLA 3S9WA 3TP5A 1E0BA 2B39A 4RKLA 5IGGA 2JYOA 4FF2A 1YNJD 5JEAG 2G9DA 1I50B 2MP1A 2DN8A 2KCNA 4A3MB 1C48A 2H1EA 3K5OA 1D5XC 3LWUA 1BCPC 2EYHA 3TP6A 1K8MA 3VA7A 2JA8B 3U9OA 1KTKA 4G4KA 3HOVB 1F9QA 3NWSA 2ZT9C 2JEBI 4L63B 5KYLA 2Z4IA 2B2VA 2JA7B 1CQFA 5IGBA 4FXKC 3VYTA 1R9TB 5ELCA 5DNFA 1QILA 4DXFA 1DM0B 2PZUA 5KIXA 1STYA 2XWJB 1FD7D 3BDOA 2FMCA 2A6ED 3DWQA 1GHKA 2B2VC 3BYYB 1ICWA 4WORA 4K2KA 4KV6A 1LTID 5JEAJ 2NVYB 2IT1A 3UI2A 4BY7B 4A3JB 2BDNA 4B9XA 1G2TA 5EPLA 1KDBA 2BOSA 1AZPA 1BCPD 3OWFA 2QDBA 4KI0A 4RFBA 3FDTA 2EXZA 3ERQA 2R92B 3OMGA 1MSGA 1SNCA 1LTGD 4HR7B 1LLRD 4IN3A 4QUCA 3H94A 4IURA 3VR3A 2R93B 1SNDA 3D4WA 1OO9B 3I90A 1B50A 3IKJA 2M2LA 1MGSA 1SEBD 1TWAB 3TP7A 1M4VA 1CM9A 3VYRA 2K01A 5COYA 1IKMA 4FO2A 3DXJC 3OSOA 3TN2A 4MN3A 2A6EC 2K5QA 1K83B 3RUZA 1ESFA 5E1FA 1HUNA 5J22A 2L55A 3S1QB 1OXUA 3C1EA 2L5TA 3NXWA 4CHTB 2B2TC 1Q1BA 4PNYA 1F77A 3DWPA 4DU9A 2JP1A 3VYUA 3A55A 4I65A 1W6JA 5KNCA 1ENAA 3TZUA 1D1KA 2NN6H 3OHXC 3GP7A 2D62A 1UUPA 1I4GA 1QWYA 5DM73 3SVMA 1AN8A 5KGUA 4LAAA 2AQ1B 1WTWA 1B9MA 4RGNA 1JCKB 1RTNA 1EFID 4DA2A 5LL6S 1B1ZA 5C4JB 3NSWA 2E2JB 1K8OA 5DM63 2VB3X 4C3HG 4PMBA 1D5MC 4IUUA 4Y7NB 4EQNA 4M8AA 2E75C 3Q6SA 4X3UA 1MSHA 2K04A 4A3BB 4XYOA 1R4PB 3CHBD 5M3FB 4UDUC 4KY6A 2EYOA 1TVXA 1PMRA 4N9TA 1YNND 3A7AB 3HOZB 3ONAB 3DUZA 1VCIA 4HAEA 4K14A 3DWAA 1SAPA 3K58A 4CJ1B 1NCVA 2L12A 4K8IA 1LTBD 1F2ZA 1FNUA 4PMWA 2CW0D 1IW7C 4C3IG 5DEHA 3QG1A 2B2UA 5KNBA 1ENFA 2B2YC 4WRDA 1IHZA 5IGFA 2E76C 1QCBD 3F2UA 5FO9B 3HGBA 5D3DA 4KHZA 3D4RA 2PW5A 2KECA 3HEJA 2XNAC 3FMCA 1FR3A 1F2LA 2B8FA 3I70A 1PLFA 3R8BA 3P1HA 1NR2A 5D3IB 3MVVA 1LTAD 4V190 3JAML 1A2UA 3T4AC 1GUWA 3IFDA 3PUWA 1Z47A 4N9PA 2IX3A 4NP5A 1II3A 2F0HA 4CBVA 1RODA 1WTOA 1XXGA 1ILPA 1YNNC 1E2ZA 2RQXA 1FYCA 1TU2B 4M1UB 3C2PA 4KN7C 1ZXTA 1STEA 4BA2I 3E0JA 2LMCB 1SYEA 2F0MA 4B9WA 3TMEA 1SNQA 1EIGA 3EROA 1H9MA 1LO5D 3D6WA 2NB0A 1O7YA 2R3ZA 3PO3B 2Q8TA 3BDLA 4DGZA 3MAQA 3GV6A 1SJHD 2OT2A 4OGQC 1DOLA 3EVQA 3EQLC 2HCCA 3Q0AA 2A6HC 3WOEA 4CKEA 4OL7A 1EYCA 3KBGA 3GTOB 3NHHA 2SNSA 2KEEA 2NVTB 1HHVA 3L9AX 2KJXA 1ML0D 4FVMA 4XQQA 3MC0B 3PIP3 4ZKCB 1G8ZD 3K7AB 1U4PA 2F0VA 4LMQD 5JAVA 2A69C 4HMIA 3OWEB 4FXDA 1TY2A 3DHQA 3ND8A 1C8CA 1SDFA 1KDCA 1DXMA 3LNNA 2ZXOA 2WIIB 1S4ZA 2K05A 5C6AA 2MGSA 1S5DD 4CJ2C 3OPOA 4U68A 5I6YA 4NMZA 1H9SA 1PYWD 4KJOA 4FF4A 4G7OC 2O5IC 1JWSD 2IX0A 2GA4B 4X3SA 1VMPA 4NW2A 2B2TA 3KLSX 4F87A 2IJ0A 1OXXK 2K6AA 1TIID 1C4QA 2EJMA 3NK9A 3H0GB 5TSSA 1GHJA 1A2TA 3MXPA 2RSOA 1SJED 4KD4A 3BVGA 2AWOA 1D2BA 1OXVA 1V8QA 1CK1A 2L0CA 2WP8J 3VA5A 1WTRA 5CV6A 2VXWA 4OIJA 1PZJD 4QMGA 3CU7A 5EKIA 3MFYA 3I4LA 3T13A 1SE3A 3K59A 1BQQT 1CT1D 4CKBA 3GTGB 5C4HA 3A56A 4UAIA 3GTQB 1WD1A 4ZQ3A 2E74C 5ELFA 1CTMA 4U673 1CHPD 4S3SA 4C3JG 4XYQA 1B3AA 3IL8A 4J6HA 3I73A 4FXGC 2XVSA 1B9NA 2HCIA 3NPPA 4K5VA 3GTPB 4IFDJ 3R2TA 1IL8A 4RCNA 1WVLA 1MI2A 2K03A 1BNZA 2EY1A 1G291 3MHBA 5F2DA 1CHQD 4HEDA 2WINB 3J7AV 1PTOD 4ZYSA 4HTHA 4RWSC 3K6OA 2EYJA 1STGA 4BY1B 1ZYRD 1DONA 3K5LA 4RH6A 3OW7A 4E6IA 4G7HC 5I4DA 5E4WC 1RDPD 2ID0A 2AUKA 3CKIB 3N6RA 5C3XA 3QB3A 3CQZB 3S15B 5FO7B 1BCPF 2HUGA 1EU3A 1A3VA 2X6LA 2DNEA 4IUNA 4RGMA 1EY6A 2KVMA 4MHEA 3M4YA 1EL0A 1PRTF 2RBMA 5KRUA 4A3FB 4RHSA 1PZID 2TMPA 3KBXA 5EBDA 2LY7A 2MHVA 3HOUB 2O5JC 2A5HA 2D5DA 4ZRZA 3PUZA 4HMJA 1SMYC 1SXTA 4RHRA 2HDMA 2F1MA 1B53A 2X69A 3HKZB 2AQ3B 3GTLB 5ELEA 2F0JA 3HRZC 3L7ZC 1KNEA 3QJYA 1MBYA 2BA0A 2BA1A 5BN3A 1HA5A 1I4HA 4TSSA 3E6ZX 4KY7A 5FLXE 1AEXA 3BDCA 5FOBB 4HN7A 2YU9B 1EOTA 1TY0A 4DXGA 3QWNA 2I07B 3K5MA 5K36G 2J7ZA 1WCMB 1DCZA 1JWUD 5EBCA 2MPMA 2KEDA 4R8IA 3GTJB 3GTMB 1A3UA 4C1NK 1LABA 5C3WA 1M8AA 3VR4A 2A74C 3I72A 1OXTA 2JA5B 4X3KA 5LL6X 1Y8NB 1SMYD 3HG9A 2L4NA 1Y8PB 3I8ZA 2V4DA 1NUCA 3HZXA 1LT3D 1TWFB 3NBIA 3FEWX 2F0QA 2XN9C 5HGTA 2BCOA 1YNJC 3G6JB 5EPKA 1STHA 3NQTA 4TRDA 2IPKD 2IWHA 2F4IA 1DJRD 4OIKA 4OO1G 1V43A 1RCVD 1S5ED 2B8GA 3MWYW 4EGVA 2LKVA 1CFMA 3S1RB 3E5SA 5CR3A 4ABNA 3DEPA 4O42A 4CKCA 4XTCS 2ICIA 5JPNC 5A35A 3S16B 2BE5C 1CI3M 3SK4A 1LTRD 1TR5A 4HSPA 1B44D 2MUYA 2WAQB 1GUOA 5BN4A 4RA8A 3J80L 2SEBD 2DY8A 4V0BA 1PTOB 3MFGA 2E2IB 1CQVA 2YYZA 3C3LA 4WFN3 2WKCA 1QNKA 4QB4A 4ULLA 4KKUA 5CV7A 2R7ZB 1Q3LA 3L3OC 1IW7D 2SOBA 1KNAA 4XIGS 4F7XA 3ND9A 4CGYB 1AFPA 2EY5A 3FPPA 4DK0A 2E2HB 1CZWA 5A2QE 3AU7A 1E2VA 2CVRA 4BA1I 2D9UA 1XX8A 1WTXA 1EZ6A 1G2SA 5CV4A 1D6EC 2SNMA 3QO2A 4ZLTF 2MJ8A 3BVMA 1DOMA 3W2DA 1F9SA 2EZVA 1HRJA 5J39A 5KEEA 2Q8RE 3PV0A 1HA6A 1EY9A 4KK7A 1DYQA 2AWNA 2F03A 3MXGA 2XWBB 2F0DA 4ZUJA 5C0XI 3MA2B 2A73B 3P7JA 4LJZC 3PUVA 1HUMA 2NN6I 1O7ZA 1G91A 3S17B 5IT9L 3S2DB 1WD0A 2RA4A 4KHVA 3C1FA 3MXUA 5CMDA 2Z8LA 1PTOF 2F0TA 2K1BA 2R61A 1TS4A 4EVOA 5E4XA 1TKWB 1L0XB 2DY7A 2KQ3A 2JA6B 1FNVA 5ELBA 4DF7A 2HQEA 4A3DB 5C0XG 1HFNA 2PYKA 5M3MB 2NN6G 1BXTA 1H9RA 5D14A 1SFOB 5KNDA 5CYUA 1Y1VB 3GO5A 4DFAA 5IOCA 4KMUC 3EJIA 2EJFC 1ZYRC 2VB2X 1DOKA 5EPJA 1G6ZA 5C0XJ 2L1BA 3RMHA 4JK1C 2G9HD 1R4QB 3FRPB 4AYBB 5C4XB 5JEAH 1LT4D 2EDGA 5M5XB 3HS0C 3NWTA 4YIJA 2I46A 2D2CC 2L11A 1WTVA 2B2WA 3KLRA 5A2QL 3FVQA 1KAAA 2BDOA 4PMCA 2Z4HA 5C3EB 3S1MB 2ICEC 1RKNA 3W3AA 4IFDI 4IUVA 3TZDA 3EA6A 1Z7TA 3S2HB 1EZ8A 2O4XA 1GUTA 2F0FA 2K5DA 4QIWB 1HCZA 1TWGB 4R9WA 1JWMD 1LACA 4H0LC 3URYA 1AZQA 1HTPA 4ODGA 5JOBA 4TKOB 3SE0A 3ITPA 1ILQA 2RKSA 1NR4A 4ZAIA 4J8QA 5FKAC 4RKBA 1LT6D 5JPMC 2EYMA 2N88A 3SDZA 4IQZA 2Z1CA 3PMFA 2BE5D 4F8MA 4F88A 1HXYD 1D5ZC 5EJWA 2QEJC 4A3KB 4G7ZC 1B4OA 5I2XA 3R3OA 3D6CA 3H09A 5C4ZA 4DK1A 3K5NA 4XQJA 1XYIA 3MZ5A 4EQPA 3V96A 2NUCA 1EEID 4IUQA 1TS5A 1J9OA 2ZXRA 3R93A 1SYGA 2F0KA 5M5YB 2F0OA 2CW0C 3A54A 2KOLA 1XWEA 2QF7A 3A8KE 1JORA 3NQIA 3OIQA 4K5XA 1SNMA 2EE1A 3NP8A 4J1MA 2KA7A 3BG3A 1RJTA 4MIUA 3P20A 4C2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKL A;  3SK5 A;  4R8N A;  2O4X A;  2F0J A;  2F0F A;  4LAA A;  4J6H A;  1KDB A;  4HMI A;  2F0I A;  4IZ8 A;  5CGK A;  1EY5 A;  4KHV A;  4G57 A;  3DHQ A;  5IGE A;  3C1F A;  3SK4 A;  1KAB A;  1SYF A;  3SK6 A;  1ENC A;  2KHS A;  4K5V A;  3OWF A;  2QDB A;  4KD3 A;  3P1H A;  4KY7 A;  1TR5 A;  5DEH A;  2F0U A;  2F0T A;  2PZW A;  3MEH A;  1KDC A;  1STB A;  4ODG A;  3TP8 A;  4EVO A;  1STN A;  5JOB A;  1AEX A;  3BDC A;  2EXZ A;  2M00 A;  3ITP A;  3ERQ A;  1EQV A;  1EY8 A;  2EYL A;  2OEO A;  2RKS A;  5CV5 A;  5CV9 A;  3OMG A;  2KQ3 A;  3SK8 A;  2EY1 A;  1SNC A;  5K5P A;  5I9O A;  5C6A A;  3MHB A;  3MVV A;  2F0P A;  1TT2 A;  5F2D A;  5KGU A;  1A2U A;  2RDF A;  2F3W A;  1EY4 A;  4PMB A;  5I6Y A;  5JAV A;  4NMZ A;  5M9O A;  3S9W A;  2ENB A;  3D8G A;  4RKB A;  5C5M A;  2HQE A;  4KJO A;  4QF4 A;  1NSN S;  4N9P A;  2EYM A;  4ZUI A;  4DF7 A;  4RKL A;  4NP5 A;  4EQN A;  1II3 A;  5IGG A;  2F0H A;  4HTH A;  4K5W A;  2PYK A;  3SR1 A;  2EYJ A;  4QB4 A;  4ME5 A;  1SND A;  3D4W A;  1U9R A;  1STG A;  1KDA A;  5CV7 A;  3SHL A;  2F0G A;  4K8J A;  1STA A;  2F0W A;  2SOB A;  2WAC A;  3PMF A;  2EY6 A;  4ID6 A;  4E6I A;  4F8M A;  1F2M A;  1A3U A;  2EYH A;  5DAU A;  5EKL A;  2PQE A;  3TP6 A;  3NK9 A;  4DFA A;  3U9O A;  4F7X A;  5IGC A;  2EY5 A;  2F0N A;  3TP7 A;  3TP5 A;  5IOC A;  5C3W A;  5C3X A;  1EYA A;  4KY6 A;  3QB3 A;  5KEE A;  1A2T A;  2EYO A;  3MXP A;  3EJI A;  3OSO A;  4N9T A;  5CV8 A;  1EYD A;  2F0S A;  1SYE A;  2F0M A;  3R3O A;  4KD4 A;  4B9W A;  1A3V A;  1F2Y A;  3D6C A;  1SNQ A;  5EGT A;  3TME A;  5KYL A;  5C4Z A;  1TQO A;  3ERO A;  3LX0 A;  4K2L A;  5IGB A;  2F0E A;  4K14 A;  5C5L A;  5ISR A;  2EYF A;  2F0L A;  5IOD A;  1SYB A;  2OF1 A;  3RUZ A;  1EZ6 A;  4IUN A;  5E1F A;  3MZ5 A;  3OMC A;  4KTA A;  4EQP A;  5J22 A;  5CV4 A;  3NUC A;  3C1E A;  3VA5 A;  1NUC A;  1EY0 A;  3BDL A;  2NUC A;  3V2T A;  3HZX A;  4K8I A;  1EY6 A;  1A3T A;  2SNM A;  4DGZ A;  2PZU A;  4KY5 A;  5KIX A;  3NXW A;  1STY A;  3T16 A;  3EVQ A;  1F2Z A;  4IAL A;  2F0Q A;  4PNY A;  5CV6 A;  5HGT A;  3P75 A;  4NDX A;  4K6D A;  1SNO A;  1SYG A;  4QMG A;  2RBM A;  5HUR A;  5KRU A;  4EQO A;  4OL7 A;  3QOJ A;  4DU9 A;  5J39 A;  2F0K A;  1STH A;  3DMU A;  4YIJ A;  3NQT A;  2EYP A;  2F0O A;  1EYC A;  4I65 A;  4K2K A;  4KV6 A;  4TRD A;  1SYD A;  4WOR A;  1ENA A;  3NHH A;  2SNS A;  3T13 A;  2F3V A;  1EY9 A;  5NUC A;  1EY7 A;  4WRD A;  1IHZ A;  5C4H A;  1JOQ A;  1KAA A;  5IGF A;  2OXP A;  4PMC A;  1JOR A;  3QOL A;  1JOK A;  5I9P A;  4KJN A;  1SYC A;  4K5X A;  4HMJ A;  5CC4 A;  1RKN A;  2F0D A;  1SNM A;  4ZUJ A;  3NP8 A;  2LKV A;  4ZQ3 A;  5I6W A;  3SXH A;  3E5S A;  4J1M A;  5CR3 A;  5KYI A;  2EY2 A;  3D4D A;  5IGD A;  4MIU A;  1JOO A;  5E3F A;  2PW5 A;  5EKK A;  3HEJ A;  3H6M A;  5J1Z A;  4H7B A;  1SNP A;  1EZ8 A;  2F0V A;  4B9X A;  2PZT A;  4S3S A;  5IIF A;  2PW7 A; 
#chains in the Genus database with same CATH topology
 3SK5 A;  1K0S A;  2AUJ D;  4C3J H;  2OQ0 A;  3PO3 H;  3BS1 A;  2F3I A;  4L5T A;  4B3R Q;  3I2Z A;  1W3S A;  2DGY A;  1L0W A;  1VQO A;  1ENC A;  3UDG A;  1LTT D;  4KD3 A;  4NB3 A;  3TSS A;  1B2T A;  2M00 A;  1I3Q B;  2M9V A;  4XT1 B;  5M3F G;  3GQB A;  4XXE A;  1QE6 A;  3PUY A;  3M4O B;  1JB3 A;  3AFP A;  4RGO S;  1N9W A;  4C3H B;  1KL9 A;  2WFW A;  3NBH A;  3SEB A;  1DZ1 A;  2MO0 A;  2OTJ A;  3CRK C;  3KFU A;  1N32 Q;  1E2W A;  2LS0 1;  4R4C A;  2R7F A;  2B63 B;  4A3F G;  3SHL A;  3CC4 A;  1H9J A;  4XDX A;  4HCE A;  1CUK A;  1IYU A;  2Q2T A;  2PQE A;  4Y52 H;  1K0R A;  4A3E B;  3HKS A;  1FJG L;  1EYA A;  3KLS A;  3K0X A;  4HCS A;  4DAP A;  1SBB B;  3PGZ A;  2F0S A;  2PCF B;  5IT9 E;  4WJW A;  4OHJ A;  4IJH A;  1J8I A;  1UEA B;  2K28 A;  1PH5 A;  5J3B A;  4DAY B;  4P73 A;  3IFT A;  1XPR A;  2PMZ B;  3RZD B;  4UP8 A;  1T5E A;  1TS2 A;  5IYB G;  2JA8 H;  3M3Y B;  1BO0 A;  5FJ8 G;  2Z6K A;  3CCR A;  2JEA I;  3CW2 C;  2TSS A;  5LMN Q;  2FHT A;  4GKK Q;  3RLF A;  1S5F D;  1PZK D;  4X62 Q;  1Q12 A;  3H91 A;  4EQO A;  2RDH A;  1X9N A;  3I91 A;  1QZG A;  1MJE A;  2IL8 A;  2FJ2 A;  4L6T B;  5L37 A;  4A3I B;  4K6L A;  2JQO A;  4DAV A;  1S5C D;  3F2B A;  3MTS A;  2UUA Q;  5I9P A;  1UWV A;  2RHS B;  3KLW A;  2JA9 A;  4L5S A;  2L9H A;  1V1O A;  2QIL A;  4A93 B;  1Q90 A;  1FVI A;  4C2M B;  1O80 A;  2NVX B;  4GN3 B;  5T1I A;  4BWG B;  2N55 A;  4NKL A;  1SE2 A;  4LF7 Q;  3AB9 A;  2UUC Q;  3RLN A;  4GZY C;  1QJO A;  4BBS B;  2F0I A;  1JIC A;  1VMC A;  3UDI A;  4CJ0 B;  1Q46 A;  1SYF A;  1XTC D;  1CA5 A;  3CRL C;  3Q23 A;  3TP8 A;  3UDF A;  2R7D A;  1VQ8 A;  1STN A;  2B2W C;  2NVQ B;  2A19 A;  2EYL A;  2RVL A;  4PQX A;  1IBM L;  2I5H A;  2FMM A;  5BN5 A;  3GV3 A;  2WB1 B;  1TT2 A;  1GOZ A;  2XGT A;  2CQA A;  1EY4 A;  3GD7 A;  3J81 E;  1EUJ A;  2ENB A;  4KKS A;  3CCQ A;  1AP0 A;  1EIF A;  1GXD C;  3KK7 A;  1GUN A;  4K5W A;  3CCV A;  1TWC B;  1A6X A;  3TEH B;  2JE6 I;  4ME5 A;  3AMU A;  3KF8 A;  1CA6 A;  2ZTD A;  4DUZ L;  5M3M G;  5EKL A;  2C9O A;  3V05 A;  5T1G A;  3BZD B;  1T5X D;  4C3J B;  1CKN B;  1PFM A;  4JI3 Q;  1EYD A;  5EGT A;  1VQM A;  1TQO A;  1HZA A;  2F0E A;  5C5L A;  2N3S A;  4QUF A;  1F9P A;  4JI2 Q;  3NE5 B;  1JQY D;  2SDF A;  2V1C C;  5IOD A;  4DV6 L;  3T1H L;  4FF3 A;  1HQM C;  2KUM A;  1EY0 A;  4A3E G;  2Q8I B;  1A3T A;  2KCC A;  2RF4 A;  3OTO L;  4JI8 Q;  1RL2 A;  2DUD A;  1VQI A;  4IAL A;  5GAE C;  3VR6 A;  4K0K L;  1M1K C;  4JOI A;  2B29 A;  2QKI C;  1UE6 A;  1S5B D;  3K0Y A;  4A3G H;  1EWC A;  1K83 H;  1VF7 A;  2F3V A;  2QEX A;  1YJ9 A;  1EY7 A;  4C56 C;  1KD1 C;  1JOQ A;  2R7Z H;  4JI4 L;  4UPA A;  4A3C H;  4P75 A;  3CQZ H;  4A3M H;  3PIO A;  4HIM A;  1L1O C;  3J7A 5;  2EY2 A;  5IGD A;  2OTL A;  3RLO A;  1JOO A;  2EQS A;  3J7A F;  2B2Y A;  1RTO A;  3HOV H;  2H4O A;  1SR3 A;  1PRT C;  1YNX A;  2Z6B A;  1N36 Q;  4Q5V A;  1GJX A;  5C0X H;  2EPB A;  1TS3 A;  2F4V Q;  4FYD A;  4BBR H;  1LM0 A;  2A69 D;  3CCU A;  4DUY L;  1HPC A;  1JR0 D;  2PZW A;  3RZD H;  3S15 H;  1Y1W B;  3OOC A;  1VDZ A;  4HID A;  3WDN A;  4ALP A;  1NTG A;  1TWH B;  1BDO A;  3SK8 A;  5AJ3 L;  5JJL A;  2A68 C;  2K33 A;  3HOU H;  4TQU S;  2NZO A;  1LTS D;  3F2D A;  4A3C G;  4ZUI A;  2EVB A;  2VUM B;  1PFN A;  2OCE A;  2XIW A;  2Q2U A;  1U9R A;  3VR2 A;  1Q81 C;  4DR5 Q;  4Z9C B;  1FGB D;  1Q1E A;  1E3P A;  2WAC A;  3UE1 A;  1VQA A;  2LSS A;  1F2M A;  1KRT A;  4A93 H;  4LFB Q;  2EIF A;  5FO8 B;  2K5H A;  3ULP A;  3J81 L;  4LNQ A;  4ME3 A;  1QOH A;  2ZXP A;  1YVC A;  5G3L F;  4PZ8 A;  5JJZ A;  4QQB X;  5GRO A;  4QCL A;  5M5Y H;  4CDC C;  2R92 G;  2E2D C;  4JI3 L;  5FK9 C;  3X3M A;  3LX0 A;  4BY7 G;  1VQ4 A;  1SYB A;  1V1P A;  3ZYY X;  5D65 A;  4GNX C;  3OMC A;  2QGQ A;  3Q24 A;  3ULJ A;  4DV1 L;  2UU9 L;  4A3G B;  1O7L A;  4KY5 A;  2XSC A;  3T53 B;  1PRT D;  3T16 A;  3WOF A;  1SE4 A;  1CZG A;  1X32 A;  1VS0 A;  2LXJ A;  3P75 A;  4UP7 A;  4K6D A;  3L0O A;  1SNO A;  4YHH L;  1I94 L;  1X3E A;  2ZJQ A;  4P71 A;  4R4T A;  5I6W A;  4HIK A;  4OWT B;  3U4Z A;  2JSO A;  1SYD A;  4QY7 A;  3M3Y H;  1GM5 A;  3S16 H;  1HH2 P;  1NMF A;  1VQL A;  1EWH A;  4X65 L;  1HFG A;  2A68 D;  1N34 L;  1D1I A;  3STB C;  1ZEQ X;  4ILW A;  1KIX A;  4DNI A;  4C3I B;  1QB5 D;  3I4M H;  4FNF A;  4DV3 L;  1XTD A;  5K36 H;  1ESR A;  2QDL A;  3M4P A;  5J1Z A;  3M4O H;  2PZT A;  5CGK A;  1XPO A;  4R8N A;  2UUC L;  2K75 A;  2NBF A;  2E2I H;  3PO2 B;  1EEF D;  4JG2 A;  3TDQ A;  5IGE A;  1YIJ A;  1KAB A;  1GO3 E;  1MD2 D;  4DR2 L;  2EOT A;  2F0U A;  1X56 A;  3MEH A;  5C44 B;  4YWM A;  4DV4 L;  1EQV A;  2NTT A;  1OXS C;  4KHP L;  1PYB A;  1JE4 A;  3BYT B;  3FKI H;  4C1N I;  3M7N A;  4GKJ Q;  2F0P A;  1PTO C;  2RDF A;  5GQO A;  2J0T D;  3RNU A;  4QF4 A;  1NSN S;  1PA6 A;  4H44 C;  1L0Y B;  3NTI A;  4B3S Q;  1HNW L;  3RD4 A;  1KDA A;  2I5M X;  3J81 j;  4K8J A;  3S24 A;  2EY6 A;  4ID6 A;  3VR5 A;  3J80 E;  1TWC H;  1I6H B;  3NTH A;  5IYB H;  2K5W A;  3MXN A;  1I4P A;  4OO1 H;  1BBU A;  1A62 A;  4NXM L;  1ASY A;  4DR6 L;  4BBR B;  1Y69 U;  1AE3 A;  2KBN A;  3FPU B;  2EYF A;  2F0L A;  3TQY A;  2PNR C;  1ET6 A;  4RAU C;  1X3P A;  4KTA A;  1NE3 A;  3HOX H;  1JJC B;  1TWH H;  3V2T A;  3ZJY C;  3J7Y W;  1RHP A;  3F2C A;  1NBW A;  2VS1 A;  1P8L A;  4LF9 L;  3JAM E;  5HUR A;  4DUZ Q;  3G7L A;  3O13 A;  4KN4 C;  4UP9 A;  3DMU A;  2EYP A;  1SSO A;  5C3E G;  3S1N H;  1ZKO A;  2CH4 W;  1IL2 A;  1A0I A;  1U4M A;  3CP0 A;  4GOP B;  1H9S B;  4CDE C;  3I7F A;  3N52 A;  1PTO H;  3QOL A;  3H0G H;  5EQ0 A;  4X64 Q;  2PO4 A;  3I3C A;  5CC4 A;  2C5C A;  4O1N A;  4JW0 A;  3K80 C;  3U9S A;  1I4R A;  1BCP B;  3EFX D;  5KYI A;  1M90 C;  2PPB C;  3ERS X;  4IUP A;  1J5E L;  4HSV A;  2GVB A;  3Q22 A;  3H6M A;  3A5Z B;  1E1T A;  1B7Y B;  3KDF A;  2DNC A;  1I5F A;  2HDL A;  4H7B A;  1HZB A;  1EQT A;  2PW7 A;  4P72 A;  1U4R A;  3FKI B;  2N8N A;  4IZ8 A;  1A15 A;  1EY5 A;  2IX1 A;  2NVT H;  4G57 A;  1J6Q A;  1BF4 A;  3U4V A;  4ZKB B;  2KHS A;  2XRS D;  3DLL A;  3HOW G;  2HD3 A;  1IYV A;  1EY8 A;  3TBI B;  4FF1 A;  2RHQ B;  1N33 L;  4DAY A;  3GTG H;  1ONL A;  1Z9F A;  2F3W A;  1PDQ A;  3GTK B;  1BBX C;  1Y1V G;  2IW3 A;  3BVZ A;  3D8G A;  5C5M A;  3X3N A;  3A8J E;  1BUV T;  3SR1 A;  3K57 A;  3MXN B;  1HNX Q;  3KF8 B;  4B3T Q;  1PYS B;  2ZTE A;  2K52 A;  4ZK9 B;  2UXB Q;  2F0G A;  5M5W B;  2I5L X;  1STA A;  2F0W A;  5IT9 c;  4A3D G;  1GKH A;  1YHQ A;  4FP5 D;  4TVA B;  1GUG A;  2KHI A;  4HJ5 A;  1ET9 A;  2VUM G;  2R6G A;  2FFK B;  3VYS A;  2RDG A;  5COR A;  2QCP X;  2O2L D;  4P2C B;  5AFW A;  1PHJ A;  3IAY A;  1SE8 A;  3ER0 A;  5CV8 A;  3PIO 3;  1EIY B;  5CBA E;  1VQN A;  2NWG A;  1KLU D;  5IP7 G;  2OF1 A;  4DNT B;  4RGT A;  2IY5 B;  3D31 A;  1E24 A;  4LW1 A;  1IYJ B;  3QIA A;  2HHH Q;  3I4N B;  4Q0F A;  4A3D H;  4JI1 L;  1EU4 A;  2EJG C;  3FP9 A;  5FLX L;  4LF4 L;  3RZO B;  3PCO B;  1YHA A;  1HZC A;  4NDX A;  2NYZ D;  2LFN A;  3QOJ A;  4IUT A;  4IFD H;  4APV A;  1F9R A;  2VL6 A;  2E5L Q;  1RIP A;  1PH8 A;  2FIN B;  1I94 Q;  1Y1V H;  5NUC A;  4PV1 C;  1U4L A;  1GUS A;  2VNU D;  1I50 H;  1V1P B;  4KJN A;  2RSN A;  1CKM A;  4X3T A;  4DK3 C;  2JXM B;  1YBY A;  3DM1 A;  3KUP A;  5M3M H;  4RMF A;  1G6P A;  5I2Y A;  3B6Y A;  2JK8 A;  5E3F A;  1JC7 A;  1I4X A;  3PIP A;  1VQC A;  1Z6H A;  1SFO H;  4DR3 Q;  5IIF A;  4R4O A;  1KLG D;  4I7A A;  3S14 B;  2A6H D;  1EIH A;  3M85 A;  1DD2 A;  3I4M B;  3R2I A;  2AQ2 B;  4LFA Q;  3HOX B;  4BXX G;  2J4X A;  3A8I E;  5M5X H;  4DV4 Q;  2WKD A;  4P74 A;  4HJ9 A;  2MQH A;  3T1Y L;  1HTL D;  1I4Q A;  5CV5 A;  5I9O A;  4OWW B;  1UNS A;  1WFQ A;  3T56 B;  3M7G A;  5M9O A;  2YTX A;  4B08 A;  2B2U C;  4DNR B;  3S1N B;  3I4O A;  5LMU L;  5C3E H;  3AYH B;  4LK1 C;  4HIO A;  1PFB A;  1BR9 A;  3T51 B;  5LHY 1;  3NTK A;  5G3L D;  3U50 C;  4BS9 A;  4JI7 L;  3HOW B;  1X3Q A;  3G4S A;  3HOY B;  4IFD G;  1AW7 A;  2E2J H;  1BOS A;  3HOX G;  2HQL A;  1AH9 A;  2Y0S B;  1UE1 A;  5DAU A;  5IGC A;  2ZJR A;  1RF2 D;  1TWG H;  1QG7 A;  2F0N A;  3T1H Q;  1Q8I A;  3CAM A;  3H3V C;  3DEO A;  2NTS A;  3D3R A;  1UAP A;  4A75 A;  1RD9 D;  1PRT B;  4JYA L;  5ELD A;  1LT5 D;  1F2Y A;  2ZJP A;  3PUX A;  1PXU A;  4HJA A;  4DR1 Q;  3RN5 A;  3M9B A;  4K2L A;  2K7V A;  5ISR A;  5JJK A;  4UY8 C;  1I6V C;  4O2D A;  3AFQ A;  3NUC A;  3HP3 A;  4OO1 I;  2F52 A;  4I7Z C;  2C35 B;  1H9K A;  4DN4 M;  1MHW C;  1K28 A;  5GAH C;  1HNX L;  2N78 A;  1NAP A;  5JVH 3;  1QNU A;  3HOZ H;  1HQR D;  3PF5 A;  2PNH A;  3A7L A;  1D8L A;  3G48 A;  1CSP A;  3OIP A;  1BVS A;  2OXP A;  1SMX A;  1JOK A;  1SYC A;  1VF5 C;  3E9H A;  5FLM G;  2FXQ A;  3LWE A;  3SXH A;  1QVC A;  2XRQ D;  2K32 A;  4DR5 L;  2NVY H;  3D4D A;  1Y8O B;  3C46 A;  4L8J A;  2KCT A;  1O78 A;  5EKK A;  4A3F H;  1KC8 C;  1SNP A;  4LWC A;  2PMZ E;  5JVG 3;  3BJU A;  2Z9H A;  3NBH B;  5CBE E;  1C0A A;  4XQN A;  1LV9 A;  4KKT A;  1WTQ A;  3NEN A;  1FNW A;  4JBW A;  3SK6 A;  3UDX A;  2VQF Q;  2X6G A;  4RCO A;  4YCV A;  2K5V A;  2NZ1 D;  4JC0 A;  1STB A;  1PH4 A;  3CMA A;  2WV6 D;  2OEO A;  5CV9 A;  5K5P A;  1PH7 A;  2B63 G;  4XT3 B;  3F1Z A;  1WTP A;  3HOW H;  4H13 C;  1K8G A;  1I6H H;  2CHB D;  1KHI A;  1IKL A;  3S9W A;  5IYC G;  3TP5 A;  1E0B A;  2B39 A;  4QIW E;  4RKL A;  5IGG A;  2JYO A;  1J5E Q;  4FF2 A;  1YNJ D;  1PH1 A;  5JEA G;  2G9D A;  5IE8 A;  1Q8K A;  5LMN L;  4A76 A;  1I50 B;  2MP1 A;  1EQR A;  1XMQ L;  2DN8 A;  1XPU A;  5EAY A;  2KCN A;  4A3M B;  1C48 A;  2H1E A;  3K5O A;  1D5X C;  4X64 L;  3LWU A;  1BCP C;  2EYH A;  3TP6 A;  1K8M A;  5FLM H;  3VA7 A;  3CD6 A;  3U9O A;  1WCM G;  2JA8 B;  4JI6 Q;  1KTK A;  4G4K A;  3HOV B;  1VQD A;  1F9Q A;  1X65 A;  3NWS A;  4DR6 Q;  2VZA A;  2ZT9 C;  4LF5 L;  2JEB I;  1EFW A;  4L63 B;  1MJC A;  5KYL A;  2Z4I A;  2B2V A;  2JA7 B;  1CQF A;  5IGB A;  4FXK C;  3VYT A;  1R9T B;  5ELC A;  5C4J H;  5DNF A;  1QIL A;  3GTM H;  4DXF A;  1DM0 B;  2UXD Q;  2PZU A;  5KIX A;  2OQK A;  1STY A;  1CSQ A;  1WJJ A;  2XWJ B;  1FD7 D;  3BDO A;  2FMC A;  2A6E D;  3DWQ A;  1GHK A;  1XJV A;  1UE7 A;  2B2V C;  1I3Q H;  3BYY B;  1ICW A;  4WOR A;  4K2K A;  3S1Q H;  4KV6 A;  1LTI D;  4DV5 Q;  5JEA J;  1U0L A;  1C9O A;  2NVY B;  1D7Q A;  4WJ4 A;  2IT1 A;  3UI2 A;  3RZO H;  2E8G A;  2D0P A;  1K73 C;  2JN4 A;  3HOY G;  4BY7 B;  4A3J B;  2BDN A;  2YTV A;  4GLX A;  2JJQ A;  4BBR G;  3EIV A;  1VQG A;  4JCV E;  3FHW A;  3ULL A;  4B9X A;  5IWA Q;  1K8A C;  4AIM A;  1G2T A;  5EPL A;  1A8V A;  1KDB A;  2BOS A;  3RN2 A;  1FJG Q;  3ICE A;  1AZP A;  1BCP D;  3OWF A;  1AE2 A;  2QDB A;  4KI0 A;  1N33 Q;  3CC7 A;  4RFB A;  3FDT A;  2EXZ A;  3ERQ A;  2R92 B;  3OMG A;  1MSG A;  1SNC A;  1LTG D;  4HR7 B;  4EX5 A;  4JBJ A;  3J80 i;  3PQI A;  1LLR D;  4YY3 Q;  5BR8 Q;  4IN3 A;  4QUC A;  4A3L H;  1TXY A;  3H94 A;  4IUR A;  1QVG A;  3VR3 A;  5GAD C;  2R93 B;  3BU2 A;  1SND A;  3D4W A;  5FLX c;  1OO9 B;  3I90 A;  1B50 A;  3H0G G;  1HNZ Q;  3IKJ A;  2M2L A;  1Y1W G;  1MGS A;  1SEB D;  2UUA L;  1TWA B;  3TP7 A;  1M4V A;  1CM9 A;  3VYR A;  3D0F A;  2K01 A;  5COY A;  1IKM A;  4MTK A;  4FO2 A;  3DXJ C;  3OSO A;  4UHV A;  3TN2 A;  1MKH A;  4YHH Q;  4MN3 A;  2A6E C;  1B70 B;  4DV2 Q;  3W5O A;  2K5Q A;  1K83 B;  4LF9 Q;  3TS2 A;  1HR0 Q;  3RUZ A;  1ESF A;  5E1F A;  1HUN A;  5J22 A;  3GDE A;  3S2D H;  2L55 A;  4DAM A;  3S1Q B;  1OXU A;  3C1E A;  2CQO A;  1Q82 C;  2L5T A;  3NXW A;  1XNR L;  4CHT B;  3A5U A;  2WB1 G;  1X3G A;  2B2T C;  1Q1B A;  4PNY A;  1F77 A;  3DWP A;  4DU9 A;  2JP1 A;  4WJ3 M;  3VYU A;  3A55 A;  1K3B C;  1W6J A;  4I65 A;  4AH6 A;  5KNC A;  1ENA A;  1N32 L;  3TZU A;  1D1K A;  2NN6 H;  3OHX C;  3GP7 A;  2D62 A;  1UUP A;  2VQE L;  2PQA A;  1B3Q A;  2A8V A;  1I4G A;  2AHO B;  5ELN A;  3JAM i;  1QWY A;  4KLK A;  3GTJ H;  4NXN L;  3G71 A;  2R93 G;  5DM7 3;  3SVM A;  1AN8 A;  5KGU A;  4IPC A;  1GD7 A;  4LAA A;  2AQ1 B;  1N36 L;  1WTW A;  1O7I A;  1FL0 A;  1B9M A;  4RGN A;  2JA7 G;  1JCK B;  4DV7 L;  1RTN A;  1EFI D;  2CFM A;  4DA2 A;  5LL6 S;  3T1Y Q;  1B1Z A;  5C4J B;  4EQ5 A;  3NSW A;  2BH2 A;  1PVO A;  3OYY A;  3HOY H;  4QL5 A;  4A3J G;  2E2J B;  2R93 H;  1K8O A;  3J7Z C;  5DM6 3;  2VB3 X;  3CCJ A;  4C3H G;  4PMB A;  1CKO A;  2BH8 A;  1D5M C;  4IUU A;  4X65 Q;  4R4I A;  1QZH A;  2I0Q A;  4Y7N B;  4EQN A;  3H15 A;  4M8A A;  2UXC L;  2E75 C;  3Q6S A;  4X3U A;  2UUB Q;  1MSH A;  2K04 A;  4DV3 Q;  1VQ7 A;  4JI4 Q;  4DUY Q;  3KOJ A;  4A3B B;  2JA6 H;  5IP9 H;  4XYO A;  3J81 i;  1R4P B;  3CHB D;  5M3F B;  2R7Z G;  4UDU C;  4KY6 A;  1S72 A;  2EYO A;  1TVX A;  1PMR A;  4N9T A;  1YNN D;  4MTN A;  2XTI A;  3A7A B;  3HOZ B;  3ONA B;  4YCW A;  3CCS A;  1C7Y A;  4LF4 Q;  3DUZ A;  1VCI A;  4IJL A;  4HAE A;  4K14 A;  4NPS A;  3H3V H;  3DWA A;  1SAP A;  3K58 A;  4CJ1 B;  1NCV A;  2L12 A;  4K8I A;  1HR0 L;  4OX9 L;  3U58 A;  1LTB D;  1F2Z A;  1FNU A;  4PMW A;  2CW0 D;  1IW7 C;  3CPF A;  1Y1W H;  4C3I G;  5DEH A;  3QG1 A;  1XMO Q;  2B2U A;  5KNB A;  1ENF A;  2B2Y C;  4WRD A;  1IHZ A;  5IGF A;  2E76 C;  4DR3 L;  1QCB D;  4A3L G;  3F2U A;  3PO2 G;  1NJI C;  5FO9 B;  4POF A;  2UXB L;  1PH6 A;  1VQ5 A;  3HGB A;  5D3D A;  4KHZ A;  3D4R A;  2PW5 A;  2KEC A;  1S40 A;  3HEJ A;  3PF4 A;  1VQ9 A;  2XNA C;  2F4V L;  1IBL Q;  3FMC A;  1FR3 A;  1F2L A;  4A3J H;  2B8F A;  3I70 A;  1PLF A;  3R8B A;  3PSI A;  5AJ3 Q;  3P1H A;  3S1M H;  1NR2 A;  1JMC A;  5D3I B;  1WI5 A;  1DGS A;  4JI1 Q;  3MVV A;  1LTA D;  3W1B A;  4V19 0;  2CH4 A;  3JAM L;  4CDD C;  3GTL H;  1A2U A;  3T4A C;  4IO9 A;  3IFD A;  1GUW A;  2ZTC A;  1VQE A;  1Z47 A;  3PUW A;  1X6O A;  4N9P A;  2IX3 A;  4AYB E;  4A3B H;  4NP5 A;  1II3 A;  4DPG A;  2F0H A;  3W1G A;  4CBV A;  4R4Q A;  1ROD A;  1WTO A;  1XXG A;  1YJW A;  1ILP A;  1YNN C;  4NXN Q;  1E2Z A;  4GLV B;  1R9T H;  2RQX A;  4GN4 B;  4C2M H;  1FYC A;  1TU2 B;  3I4M G;  4M1U B;  3C2P A;  4KN7 C;  1QVF A;  1ZXT A;  3TS0 A;  4A3G G;  1STE A;  4BA2 I;  2VQE Q;  3E0J A;  1B8A A;  2LMC B;  4OEL B;  1SYE A;  2F0M A;  4NXM Q;  4B9W A;  3TME A;  1X55 A;  1SNQ A;  4H02 A;  1EIG A;  3ERO A;  1H9M A;  1LO5 D;  4HJ8 A;  1L2F A;  3D6W A;  4K0K Q;  2RCF A;  1PH2 A;  2NB0 A;  1O7Y A;  2R3Z A;  3PO3 B;  2Q8T A;  3BDL A;  4DGZ A;  3MAQ A;  1SN8 A;  2WB1 E;  3GV6 A;  1SJH D;  2OT2 A;  4OGQ C;  1DOL A;  2HHH L;  3EVQ A;  3EQL C;  4DV6 Q;  2HCC A;  3Q0A A;  2A6H C;  3WOE A;  4CKE A;  4A3I G;  4JI2 L;  4X66 L;  4OL7 A;  1EYC A;  3KBG A;  3GTO B;  2Q2I A;  3NHH A;  2SNS A;  4GKK L;  2KEE A;  2NVT B;  1HHV A;  5IYD H;  4LF7 L;  2QA4 A;  3L9A X;  1FGU A;  3E9I A;  1WOC A;  2KJX A;  1ML0 D;  4A93 G;  1U5K A;  4FVM A;  4XQQ A;  3MC0 B;  3PIP 3;  5M3F H;  4ZKC B;  1G8Z D;  3K7A B;  4PZ6 A;  1U4P A;  3E0E A;  2F0V A;  4LMQ D;  5JAV A;  1ICF B;  2A69 C;  3BZK A;  4HMI A;  3OWE B;  4FXD A;  1MIU A;  1TY2 A;  3DHQ A;  3ND8 A;  1C8C A;  1VQH A;  4BY1 G;  1SDF A;  1KDC A;  1DXM A;  1LYL A;  1P16 A;  4RG1 A;  3LNN A;  2P5Z X;  2ZXO A;  2WII B;  1S4Z A;  2VQF L;  2K05 A;  5C6A A;  2MGS A;  1S5D D;  3I4N G;  1E22 A;  4CJ2 C;  3OPO A;  2K4K A;  1XNQ Q;  4U68 A;  5I6Y A;  4NMZ A;  1H9S A;  1PYW D;  3L2P A;  4KJO A;  4FF4 A;  4G7O C;  2O5I C;  1JWS D;  2IX0 A;  2GA4 B;  4X3S A;  1VMP A;  4NW2 A;  2B2T A;  3KLS X;  2HIV A;  3KF6 B;  1HZ9 A;  4F87 A;  2IJ0 A;  1OXX K;  2K6A A;  1N34 Q;  1TII D;  4A3I H;  1YI2 A;  1C4Q A;  3DM3 A;  1A63 A;  3A74 A;  2EJM A;  3NK9 A;  5IP7 H;  3H0G B;  5TSS A;  3G6E A;  1GHJ A;  1A2T A;  3MXP A;  2RSO A;  5LMN W;  1SJE D;  4B3S L;  4DV2 L;  4KD4 A;  1TWF H;  2NVQ H;  1NMG A;  3BVG A;  2AWO A;  5JJI A;  1D2B A;  4JI6 L;  1OXV A;  1V8Q A;  3J81 c;  1CK1 A;  1KRS A;  5ELO A;  2L0C A;  4N8F A;  2WP8 J;  3RR5 A;  3VA5 A;  4BBS H;  4A3E H;  2Y0S G;  1HR0 W;  1WTR A;  4X6A H;  2VXW A;  5CV6 A;  4OIJ A;  1YHB A;  1PZJ D;  2KHJ A;  4QMG A;  3CU7 A;  2K5N A;  5EKI A;  1PH9 A;  3MFY A;  3I4L A;  1WCM H;  3T13 A;  1SE3 A;  1Q7Y C;  3K59 A;  1BQQ T;  1CT1 D;  4CKB A;  3GTG B;  5BR8 L;  5C4H A;  3A56 A;  4UAI A;  3GTQ B;  4A3B G;  1BBW A;  2VW9 A;  1WD1 A;  1EYG A;  4ZQ3 A;  1SLJ A;  2E74 C;  5ELF A;  3Q8D A;  1KQS A;  4JVZ A;  1CTM A;  3I56 A;  4U67 3;  4GOP C;  4IOA A;  1CHP D;  4CDF C;  4S3S A;  4C3J G;  1B3A A;  3IL8 A;  4XYQ A;  3BZC A;  1IBL L;  3I4N H;  4J6H A;  3I73 A;  4FXG C;  2XVS A;  4LFC Q;  1B9N A;  2HCI A;  3NPP A;  4K5V A;  5IWA L;  3GTP B;  4IFD J;  3R2T A;  5GAG C;  2Z0S A;  4LUZ A;  1IL8 A;  4RCN A;  1WVL A;  1N8R C;  1MI2 A;  5H1S E;  2K03 A;  1BNZ A;  2EY1 A;  1G29 1;  1X3F A;  3MHB A;  5F2D A;  1CHQ D;  4HED A;  2WIN B;  3J7A V;  4B3R L;  2HIX A;  4AYB G;  2ZM6 Q;  3GTO H;  1PTO D;  4ZYS A;  4HTH A;  4RWS C;  3K6O A;  3M4Q A;  2EYJ A;  4DV5 L;  3CF5 A;  1STG A;  2D0O A;  4BY1 B;  1ZYR D;  4OEM B;  2CKZ B;  1DON A;  3K5L A;  4RH6 A;  3OW7 A;  4E6I A;  4G7H C;  2MNA A;  3S1R H;  4DR4 L;  5I4D A;  5E4W C;  1BKB A;  1RDP D;  2AUK A;  2ID0 A;  3KJO A;  3CKI B;  3N6R A;  4GNX B;  5C3X A;  4BBS G;  3QB3 A;  3CQZ B;  3CPW A;  4OXP A;  4JYA Q;  1VQK A;  3S15 B;  5FO7 B;  1BCP F;  2HUG A;  1EU3 A;  4J15 A;  1A3V A;  2X6L A;  4N8X 1;  4LF5 Q;  2DNE A;  4IUN A;  4RGM A;  1EY6 A;  2KVM A;  2UU9 Q;  4MHE A;  3M4Y A;  4JI7 Q;  3KDF B;  2OWO A;  1WYD A;  1EL0 A;  1K9M C;  1PRT F;  2RBM A;  5KRU A;  4A3F B;  2ES2 A;  4RHS A;  1PZI D;  2TMP A;  3KBX A;  5EBD A;  2LY7 A;  2HT1 A;  2MHV A;  3HOU B;  2O5J C;  5HY6 A;  1YEZ A;  2A5H A;  4DV0 Q;  3S17 H;  2D5D A;  4POG A;  4ZRZ A;  3AEV A;  4LFB L;  1GVP A;  2ALY B;  1Q86 C;  3PUZ A;  4HMJ A;  4IOC A;  1HNZ L;  2VUM H;  2JA5 G;  1SMY C;  1SXT A;  2HDM A;  4RHR A;  2ASB A;  2F1M A;  1QUQ A;  1B53 A;  2X69 A;  3NEL A;  3HKZ B;  3GTP H;  2AQ3 B;  3GTL B;  1UE5 A;  4DV7 Q;  5ELE A;  2IHF A;  4QJF A;  2F0J A;  3HRZ C;  3L7Z C;  4AQY Q;  1KNE A;  3QJY A;  4QGU A;  1MBY A;  2BA0 A;  3J80 c;  2BA1 A;  3FKI G;  5BN3 A;  1YJN A;  1Y14 B;  1HA5 A;  1YIT A;  1I4H A;  4TSS A;  3E6Z X;  4KY7 A;  5FLX E;  1JE5 A;  3JC6 6;  1AEX A;  3BDC A;  5FOB B;  4HN7 A;  1E7Z A;  2YU9 B;  1EOT A;  1TY0 A;  1JB7 A;  4DXG A;  4BY1 H;  3QWN A;  1VQF A;  2I07 B;  3K5M A;  5K36 G;  2J7Z A;  1WCM B;  2Q2H A;  4C3I H;  1DCZ A;  1JWU D;  5IYD G;  1XMO L;  1S3O A;  5EBC A;  3GTQ H;  1VQ6 A;  2MPM A;  5C44 G;  2KED A;  4R8I A;  3GTJ B;  3GTM B;  3HKZ E;  1A3U A;  4C1N K;  1LAB A;  5C3W A;  1M8A A;  3VR4 A;  4LUO A;  2A74 C;  2EXD A;  3I72 A;  4PZ7 A;  2MO1 A;  1OXT A;  4IPD A;  1IXR A;  2JA5 B;  4X3K A;  5LL6 X;  1Y8N B;  1SMY D;  2UXD L;  3HG9 A;  2L4N A;  1Y8P B;  3I8Z A;  4JI8 L;  2V4D A;  1NUC A;  4FDB A;  2Y0S E;  4DR7 L;  3HZX A;  5IY0 A;  4BY7 H;  1LT3 D;  1TWF B;  1IBM Q;  3NBI A;  4B3M Q;  3FEW X;  2F0Q A;  2XN9 C;  5HGT A;  2BCO A;  1YNJ C;  3G6J B;  5EPK A;  1STH A;  3NQT A;  4TRD A;  1NNX A;  2UXC Q;  2IPK D;  2IWH A;  2F4I A;  1DJR D;  4OIK A;  4OO1 G;  1V43 A;  1RCV D;  1S5E D;  2B8G A;  3MWY W;  3WWV A;  4JBM A;  3HKZ G;  4EGV A;  2LKV A;  1CFM A;  3S1R B;  1XMQ Q;  3E5S A;  5CR3 A;  2QW7 A;  1SRO A;  2JA7 H;  3K8A A;  3EBE A;  5HGQ A;  4ABN A;  3HFZ B;  3DEP A;  3CXC A;  4O42 A;  4CKC A;  4XTC S;  3I55 A;  4LFC L;  2ICI A;  1V9P A;  3HOU G;  2YU9 H;  5JPN C;  4A3K G;  5A35 A;  3S16 B;  2BE5 C;  1CI3 M;  3SK4 A;  1LTR D;  4KHP Q;  1TR5 A;  4HSP A;  1W2B A;  1B44 D;  4OON A;  1PV4 A;  2MUY A;  2WAQ B;  3K81 C;  1GUO A;  5BN4 A;  4A3M G;  4RA8 A;  4DR2 Q;  4JPB W;  3MEF A;  3J80 L;  2DJF C;  2SEB D;  5C4X H;  1YZ6 A;  2CWP A;  2DY8 A;  1NY4 A;  3QR8 A;  4V0B A;  1PTO B;  3MFG A;  3HOV G;  2CCZ A;  3PO2 H;  1CQV A;  2E2I B;  2YYZ A;  5E7N A;  2GN5 A;  2MFI A;  3C3L A;  4WFN 3;  2WKC A;  1QNK A;  4QB4 A;  4ULL A;  4OWX B;  3SGI A;  2ATW A;  4KKU A;  5CV7 A;  2R7Z B;  1Q3L A;  3L3O C;  1IW7 D;  2SOB A;  1V1Q A;  3IRB A;  1KNA A;  4XIG S;  4F7X A;  3ND9 A;  4A4I A;  4CGY B;  1AFP A;  2EY5 A;  3FPP A;  1L1O A;  4DK0 A;  2E2H B;  1CZW A;  5A2Q E;  3AU7 A;  1E2V A;  2NZH A;  2CVR A;  4BA1 I;  3CC2 A;  3CME A;  1X54 A;  2D9U A;  4X62 L;  1XX8 A;  3JAM c;  1WTX A;  2WAQ E;  1EZ6 A;  4DV1 Q;  4R1J A;  1G2S A;  1VQJ A;  5CV4 A;  1D6E C;  1LTL A;  4JBK A;  2SNM A;  1KAW A;  3QO2 A;  4GN5 A;  1HNW Q;  2AMC B;  5IP9 G;  4ZLT F;  2MJ8 A;  3BVM A;  1DOM A;  3W2D A;  4B3T L;  4L5Q A;  1F9S A;  2EZV A;  1HRJ A;  5J39 A;  5KEE A;  5M5W H;  2R92 H;  2Q8R E;  1IZ6 A;  3PV0 A;  1HA6 A;  1EY9 A;  4JI0 L;  4HJ7 A;  4KK7 A;  1DYQ A;  2AWN A;  4YY3 L;  2F03 A;  3MXG A;  2PI2 A;  2CWA A;  2XWB B;  2F0D A;  5IYC H;  4ZUJ A;  5C0X I;  2JA6 G;  3MA2 B;  4JOI C;  2A73 B;  3F8T A;  3P7J A;  4LJZ C;  3PUV A;  1HUM A;  2NN6 I;  1O7Z A;  1G91 A;  1L1O B;  3A0J A;  3S17 B;  4A3K H;  5IT9 L;  3S2D B;  1WD0 A;  5C4X G;  4AQY L;  2RA4 A;  3KYH C;  4KHV A;  1H95 A;  1TWA H;  2KEN A;  3C1F A;  3MXU A;  5CMD A;  3KF6 A;  2Z8L A;  4C3H H;  1PTO F;  2F0T A;  2K1B A;  4LF6 Q;  2R61 A;  3S2H H;  4GKJ L;  1TS4 A;  4EVO A;  5E4X A;  3CCE A;  4B3M L;  1TKW B;  1L0X B;  4LFA L;  2DY7 A;  2IHE A;  2KQ3 A;  2JA6 B;  2N49 A;  1FNV A;  1EWI A;  3STB D;  2H5X A;  5ELB A;  3EN2 A;  4DF7 A;  2HQE A;  4A3D B;  5C0X G;  1HFN A;  2YTY A;  2PYK A;  4LUV A;  5M3M B;  2NN6 G;  1PH3 A;  1BXT A;  2G5D A;  1T9H A;  1QUQ B;  3OW2 A;  1JT8 A;  4OX9 Q;  3HOZ G;  1H9R A;  5D14 A;  1SFO B;  5KND A;  5CYU A;  4LF8 L;  1Y1V B;  4ZCK A;  4DV0 L;  3GO5 A;  1JJ2 A;  4PG3 A;  4DFA A;  5IOC A;  4KMU C;  3EJI A;  2EJF C;  1ZYR C;  2VB2 X;  1DOK A;  5EPJ A;  1KXL A;  5FJ8 H;  4X66 Q;  5C0X J;  1G6Z A;  2L1B A;  3RMH A;  4JK1 C;  2G9H D;  4YCU A;  3VDY A;  1R4Q B;  3FRP B;  3S14 H;  2L15 A;  3K7U C;  4AYB B;  4JV5 L;  4Y7N H;  5DLQ E;  5C44 H;  4DR7 Q;  2UUB L;  4O0A A;  5C4X B;  5JEA H;  1LT4 D;  2EDG A;  5M5X B;  2GVA A;  2AKW B;  3HS0 C;  3NWT A;  1VQB A;  4YIJ A;  2I46 A;  2D2C C;  2L11 A;  3LGJ A;  1WTV A;  4GNX A;  2B2W A;  3KLR A;  5A2Q L;  2ZM6 L;  3FVQ A;  4GOP A;  3E3X A;  1KAA A;  2BDO A;  2B63 H;  4PMC A;  4LF8 Q;  2Z4H A;  5C3E B;  1IBK L;  3S1M B;  2ICE C;  1RKN A;  3W3A A;  4GLA C;  4IFD I;  2PI2 E;  4IUV A;  4IPG A;  3TZD A;  3EA6 A;  2LXK A;  1IBK Q;  1Z7T A;  3S2H B;  1EZ8 A;  2K50 A;  2O4X A;  4BXX H;  1SRU A;  1CKN A;  1GUT A;  2F0F A;  2K5D A;  4QIW B;  1HCZ A;  3TRE A;  1TWG B;  4R9W A;  1JWM D;  1LAC A;  2K14 A;  4JI5 L;  2RCN A;  4H0L C;  3URY A;  1AZQ A;  1HTP A;  4ODG A;  5JOB A;  4TKO B;  3SE0 A;  4LF6 L;  3ITP A;  1ILQ A;  2RKS A;  1NR4 A;  4JI5 Q;  3PO3 G;  1EQQ A;  4ZAI A;  4J8Q A;  1K3R A;  5FKA C;  5LMU Q;  3CCM A;  4RKB A;  1LT6 D;  2Z6K C;  2EYM A;  2N88 A;  5JPM C;  4YWL A;  4MNO A;  3SDZ A;  1VQP A;  4IQZ A;  2JA5 H;  1PFS A;  2Z1C A;  1UEB A;  4IPH A;  4L5R C;  3PMF A;  2BE5 D;  4F8M A;  4F88 A;  1G51 A;  1HXY D;  2VY3 A;  2PQA B;  4JI0 Q;  1D5Z C;  5EJW A;  2QEJ C;  2NVX H;  4A3K B;  3UE0 A;  4G7Z C;  4DK6 C;  1B4O A;  5I2X A;  1OTC A;  1EOV A;  3TRZ A;  1HJP A;  3R3O A;  4DKA C;  4MZ9 A;  4DR1 L;  3D6C A;  3H09 A;  5C4Z A;  4DK1 A;  3K5N A;  2WAQ G;  4XQJ A;  1XYI A;  3OTO Q;  3MZ5 A;  4EQP A;  2E2H H;  3V96 A;  1LUZ A;  2JA8 G;  2NUC A;  1EEI D;  4JV5 Q;  4IUQ A;  1E1O A;  1TS5 A;  3CCL A;  4YWK A;  1J9O A;  2ZXR A;  3AQQ A;  3R93 A;  1SYG A;  3K7A H;  2E5L L;  3GTK H;  2F0K A;  5M5Y B;  2F0O A;  2B3G A;  2CW0 C;  3A54 A;  2A1A A;  4GS3 A;  1XNR Q;  2KOL A;  1XWE A;  2QF7 A;  3A8K E;  3NEM A;  1JOR A;  1XNQ L;  3NQI A;  3OIQ A;  4DR4 Q;  4K5X A;  1ASZ A;  1SNM A;  2EE1 A;  2KCM A;  3NP8 A;  1WTH A;  2YV5 A;  4J1M A;  2DJG C;  2KA7 A;  3BG3 A;  1RJT A;  3KJP A;  4MIU A;  3P20 A;  3H3V I;  1JJG A;  1W6K A; 
#chains in the Genus database with same CATH homology
 3SK5 A;  2AUJ D;  3BS1 A;  1ENC A;  1LTT D;  4KD3 A;  3TSS A;  1B2T A;  2M00 A;  1I3Q B;  2M9V A;  4XT1 B;  3GQB A;  4XXE A;  1QE6 A;  3PUY A;  3M4O B;  1JB3 A;  4RGO S;  4C3H B;  3NBH A;  3SEB A;  1DZ1 A;  3CRK C;  1E2W A;  2LS0 1;  2B63 B;  3SHL A;  1H9J A;  4XDX A;  4HCE A;  1IYU A;  2PQE A;  4A3E B;  1EYA A;  3KLS A;  4HCS A;  4DAP A;  1SBB B;  2F0S A;  2PCF B;  5IT9 E;  4WJW A;  4OHJ A;  1J8I A;  1UEA B;  2K28 A;  3IFT A;  2PMZ B;  3RZD B;  1T5E A;  1TS2 A;  3M3Y B;  1BO0 A;  2JEA I;  2TSS A;  2FHT A;  3RLF A;  1S5F D;  1PZK D;  1Q12 A;  3H91 A;  4EQO A;  2RDH A;  3I91 A;  2IL8 A;  2FJ2 A;  4L6T B;  4A3I B;  4K6L A;  4DAV A;  1S5C D;  3MTS A;  5I9P A;  2L9H A;  1V1O A;  2QIL A;  4A93 B;  1Q90 A;  1O80 A;  2NVX B;  5T1I A;  4BWG B;  2N55 A;  4NKL A;  1SE2 A;  3AB9 A;  4GZY C;  1QJO A;  4BBS B;  2F0I A;  1JIC A;  1VMC A;  4CJ0 B;  1SYF A;  1XTC D;  1CA5 A;  3CRL C;  3Q23 A;  3TP8 A;  1STN A;  2B2W C;  2NVQ B;  2EYL A;  2RVL A;  4PQX A;  2FMM A;  5BN5 A;  3GV3 A;  2WB1 B;  1TT2 A;  1GOZ A;  2CQA A;  3J81 E;  1EY4 A;  3GD7 A;  2ENB A;  4KKS A;  1AP0 A;  1GXD C;  3KK7 A;  1GUN A;  4K5W A;  1TWC B;  1A6X A;  3AMU A;  2JE6 I;  4ME5 A;  3KF8 A;  1CA6 A;  5EKL A;  2C9O A;  3V05 A;  5T1G A;  3BZD B;  1T5X D;  4C3J B;  1PFM A;  1EYD A;  5EGT A;  1TQO A;  2F0E A;  5C5L A;  4QUF A;  1F9P A;  5IOD A;  3NE5 B;  1JQY D;  2SDF A;  4FF3 A;  1HQM C;  2KUM A;  1EY0 A;  2Q8I B;  1A3T A;  2KCC A;  4IAL A;  3VR6 A;  2QKI C;  1S5B D;  3K0Y A;  1EWC A;  1VF7 A;  2F3V A;  1EY7 A;  4C56 C;  1JOQ A;  2EY2 A;  5IGD A;  1JOO A;  3J7A F;  2B2Y A;  1RTO A;  2H4O A;  1PRT C;  4Q5V A;  1GJX A;  5C0X H;  2EPB A;  1TS3 A;  4FYD A;  2A69 D;  1HPC A;  1JR0 D;  2PZW A;  1Y1W B;  3OOC A;  1VDZ A;  3WDN A;  1TWH B;  1BDO A;  3SK8 A;  2A68 C;  2K33 A;  4TQU S;  1LTS D;  4ZUI A;  2EVB A;  2VUM B;  1PFN A;  2XIW A;  1U9R A;  3VR2 A;  4Z9C B;  1FGB D;  1Q1E A;  2WAC A;  1F2M A;  5FO8 B;  3J81 L;  1QOH A;  2ZXP A;  5G3L F;  5JJZ A;  4QCL A;  2E2D C;  5FK9 C;  3X3M A;  3LX0 A;  1SYB A;  1V1P A;  3ZYY X;  5D65 A;  3OMC A;  3Q24 A;  4A3G B;  1O7L A;  4KY5 A;  2XSC A;  3T53 B;  1PRT D;  3T16 A;  3WOF A;  1SE4 A;  1CZG A;  1X32 A;  3P75 A;  4K6D A;  1SNO A;  5I6W A;  2JSO A;  1SYD A;  1EWH A;  1HFG A;  2A68 D;  1D1I A;  1ZEQ X;  4ILW A;  4C3I B;  1QB5 D;  4FNF A;  5K36 H;  1ESR A;  5J1Z A;  2PZT A;  5CGK A;  4R8N A;  2NBF A;  3PO2 B;  1EEF D;  3TDQ A;  5IGE A;  1KAB A;  1MD2 D;  2EOT A;  2F0U A;  3MEH A;  5C44 B;  1EQV A;  2NTT A;  1OXS C;  1JE4 A;  3BYT B;  4C1N I;  3M7N A;  2F0P A;  1PTO C;  2RDF A;  2J0T D;  4QF4 A;  1NSN S;  4H44 C;  1L0Y B;  3NTI A;  3RD4 A;  1KDA A;  4K8J A;  2EY6 A;  4ID6 A;  3VR5 A;  3J80 E;  1W6K A;  1I6H B;  3NTH A;  2K5W A;  3MXN A;  1I4P A;  4OO1 H;  4BBR B;  1Y69 U;  3FPU B;  2EYF A;  2F0L A;  2PNR C;  1ET6 A;  4RAU C;  1X3P A;  4KTA A;  3V2T A;  3J7Y W;  1RHP A;  3JAM E;  5HUR A;  3G7L A;  3O13 A;  4KN4 C;  3DMU A;  2EYP A;  1SSO A;  1ZKO A;  1U4M A;  1H9S B;  3N52 A;  1PTO H;  3QOL A;  5EQ0 A;  2PO4 A;  3I3C A;  5CC4 A;  2C5C A;  4O1N A;  3U9S A;  2PPB C;  1I4R A;  1BCP B;  3EFX D;  5KYI A;  4IUP A;  4HSV A;  3Q22 A;  3H6M A;  4H7B A;  2DNC A;  2HDL A;  1EQT A;  2PW7 A;  1U4R A;  3FKI B;  4IZ8 A;  1A15 A;  1EY5 A;  2IX1 A;  4G57 A;  1BF4 A;  4ZKB B;  2KHS A;  2XRS D;  1IYV A;  1EY8 A;  3TBI B;  4FF1 A;  4DAY A;  1ONL A;  2F3W A;  1PDQ A;  3GTK B;  1BBX C;  2IW3 A;  3BVZ A;  3D8G A;  5C5M A;  3X3N A;  3A8J E;  1BUV T;  3SR1 A;  3K57 A;  4ZK9 B;  2F0G A;  5M5W B;  1STA A;  2F0W A;  4FP5 D;  1GUG A;  1ET9 A;  2R6G A;  2FFK B;  3VYS A;  2RDG A;  5COR A;  2QCP X;  2O2L D;  4P2C B;  5AFW A;  3IAY A;  5CV8 A;  3PIO 3;  5CBA E;  2NWG A;  1KLU D;  2OF1 A;  4DNT B;  4RGT A;  3D31 A;  3QIA A;  3I4N B;  4Q0F A;  1EU4 A;  2EJG C;  5FLX L;  3RZO B;  4NDX A;  2NYZ D;  2LFN A;  3QOJ A;  4IUT A;  4IFD H;  1F9R A;  2FIN B;  5NUC A;  4PV1 C;  1U4L A;  1GUS A;  2VNU D;  4KJN A;  1V1P B;  2RSN A;  4X3T A;  2JXM B;  3DM1 A;  3KUP A;  5I2Y A;  5E3F A;  1JC7 A;  1I4X A;  1Z6H A;  5IIF A;  1KLG D;  3S14 B;  2A6H D;  1EIH A;  3M85 A;  1DD2 A;  3I4M B;  3R2I A;  2AQ2 B;  3HOX B;  2J4X A;  3A8I E;  2WKD A;  1HTL D;  1I4Q A;  5CV5 A;  5I9O A;  1UNS A;  5M9O A;  3T56 B;  3M7G A;  4B08 A;  2B2U C;  4DNR B;  3S1N B;  4LK1 C;  1PFB A;  1BR9 A;  3T51 B;  5LHY 1;  3NTK A;  5G3L D;  4BS9 A;  3HOW B;  1X3Q A;  3HOY B;  4IFD G;  1AW7 A;  1BOS A;  2Y0S B;  5DAU A;  5IGC A;  1RF2 D;  1QG7 A;  2F0N A;  1Q8I A;  3H3V C;  3DEO A;  2NTS A;  3D3R A;  1UAP A;  1RD9 D;  1PRT B;  5ELD A;  1LT5 D;  1F2Y A;  3PUX A;  1PXU A;  4K2L A;  2K7V A;  5ISR A;  1I6V C;  3NUC A;  3HP3 A;  4OO1 I;  4I7Z C;  1H9K A;  4DN4 M;  1NAP A;  5JVH 3;  1QNU A;  1HQR D;  3A7L A;  3OIP A;  2OXP A;  1JOK A;  1SYC A;  1VF5 C;  3LWE A;  3SXH A;  2XRQ D;  2K32 A;  3D4D A;  1Y8O B;  3C46 A;  4L8J A;  1O78 A;  5EKK A;  1SNP A;  5JVG 3;  5CBE E;  4XQN A;  1LV9 A;  4KKT A;  1WTQ A;  1FNW A;  4JBW A;  3SK6 A;  2X6G A;  4RCO A;  2NZ1 D;  1STB A;  2WV6 D;  2OEO A;  5CV9 A;  5K5P A;  4XT3 B;  1WTP A;  4H13 C;  2CHB D;  1IKL A;  3S9W A;  3TP5 A;  1E0B A;  2B39 A;  4RKL A;  5IGG A;  2JYO A;  4FF2 A;  1YNJ D;  5JEA G;  2G9D A;  1I50 B;  2MP1 A;  2DN8 A;  2KCN A;  4A3M B;  1C48 A;  2H1E A;  3K5O A;  1D5X C;  3LWU A;  1BCP C;  2EYH A;  3TP6 A;  1K8M A;  3VA7 A;  2JA8 B;  3U9O A;  1KTK A;  4G4K A;  3HOV B;  1F9Q A;  3NWS A;  2ZT9 C;  2JEB I;  4L63 B;  5KYL A;  2Z4I A;  2B2V A;  2JA7 B;  1CQF A;  5IGB A;  4FXK C;  3VYT A;  1R9T B;  5ELC A;  5DNF A;  1QIL A;  4DXF A;  1DM0 B;  2PZU A;  5KIX A;  1STY A;  2XWJ B;  1FD7 D;  3BDO A;  2FMC A;  2A6E D;  3DWQ A;  1GHK A;  2B2V C;  3BYY B;  1ICW A;  4WOR A;  4K2K A;  4KV6 A;  1LTI D;  5JEA J;  2NVY B;  2IT1 A;  3UI2 A;  4BY7 B;  4A3J B;  2BDN A;  4B9X A;  1G2T A;  5EPL A;  1KDB A;  2BOS A;  1AZP A;  1BCP D;  3OWF A;  2QDB A;  4KI0 A;  4RFB A;  3FDT A;  2EXZ A;  3ERQ A;  2R92 B;  3OMG A;  1MSG A;  1SNC A;  1LTG D;  4HR7 B;  1LLR D;  4IN3 A;  4QUC A;  3H94 A;  4IUR A;  3VR3 A;  2R93 B;  1SND A;  3D4W A;  1OO9 B;  3I90 A;  1B50 A;  3IKJ A;  2M2L A;  1MGS A;  1SEB D;  1TWA B;  3TP7 A;  1M4V A;  1CM9 A;  3VYR A;  2K01 A;  5COY A;  1IKM A;  4FO2 A;  3DXJ C;  3OSO A;  3TN2 A;  4MN3 A;  2A6E C;  2K5Q A;  1K83 B;  3RUZ A;  1ESF A;  5E1F A;  1HUN A;  5J22 A;  2L55 A;  3S1Q B;  1OXU A;  3C1E A;  2L5T A;  3NXW A;  4CHT B;  2B2T C;  1Q1B A;  4PNY A;  1F77 A;  3DWP A;  4DU9 A;  2JP1 A;  3VYU A;  3A55 A;  4I65 A;  1W6J A;  5KNC A;  1ENA A;  3TZU A;  1D1K A;  2NN6 H;  3OHX C;  3GP7 A;  2D62 A;  1UUP A;  1I4G A;  1QWY A;  5DM7 3;  3SVM A;  1AN8 A;  5KGU A;  4LAA A;  2AQ1 B;  1WTW A;  1B9M A;  4RGN A;  1JCK B;  1RTN A;  1EFI D;  4DA2 A;  5LL6 S;  1B1Z A;  5C4J B;  3NSW A;  2E2J B;  1K8O A;  5DM6 3;  2VB3 X;  4C3H G;  4PMB A;  1D5M C;  4IUU A;  4Y7N B;  4EQN A;  4M8A A;  2E75 C;  3Q6S A;  4X3U A;  1MSH A;  2K04 A;  4A3B B;  4XYO A;  1R4P B;  3CHB D;  5M3F B;  4UDU C;  4KY6 A;  2EYO A;  1TVX A;  1PMR A;  4N9T A;  1YNN D;  3A7A B;  3HOZ B;  3ONA B;  3DUZ A;  1VCI A;  4HAE A;  4K14 A;  3DWA A;  1SAP A;  3K58 A;  4CJ1 B;  1NCV A;  2L12 A;  4K8I A;  1LTB D;  1F2Z A;  1FNU A;  4PMW A;  2CW0 D;  1IW7 C;  4C3I G;  5DEH A;  3QG1 A;  2B2U A;  5KNB A;  1ENF A;  2B2Y C;  4WRD A;  1IHZ A;  5IGF A;  2E76 C;  1QCB D;  3F2U A;  5FO9 B;  3HGB A;  5D3D A;  4KHZ A;  3D4R A;  2PW5 A;  2KEC A;  3HEJ A;  2XNA C;  3FMC A;  1FR3 A;  1F2L A;  2B8F A;  3I70 A;  1PLF A;  3R8B A;  3P1H A;  1NR2 A;  5D3I B;  3MVV A;  1LTA D;  4V19 0;  3JAM L;  1A2U A;  3T4A C;  1GUW A;  3IFD A;  3PUW A;  1Z47 A;  4N9P A;  2IX3 A;  4NP5 A;  1II3 A;  2F0H A;  4CBV A;  1ROD A;  1WTO A;  1XXG A;  1ILP A;  1YNN C;  1E2Z A;  2RQX A;  1FYC A;  1TU2 B;  4M1U B;  3C2P A;  4KN7 C;  1ZXT A;  1STE A;  4BA2 I;  3E0J A;  2LMC B;  1SYE A;  2F0M A;  4B9W A;  3TME A;  1SNQ A;  1EIG A;  3ERO A;  1H9M A;  1LO5 D;  3D6W A;  2NB0 A;  1O7Y A;  2R3Z A;  3PO3 B;  2Q8T A;  3BDL A;  4DGZ A;  3MAQ A;  3GV6 A;  1SJH D;  2OT2 A;  4OGQ C;  1DOL A;  3EVQ A;  3EQL C;  2HCC A;  3Q0A A;  2A6H C;  3WOE A;  4CKE A;  4OL7 A;  1EYC A;  3KBG A;  3GTO B;  3NHH A;  2SNS A;  2KEE A;  2NVT B;  1HHV A;  3L9A X;  2KJX A;  1ML0 D;  4FVM A;  4XQQ A;  3MC0 B;  3PIP 3;  4ZKC B;  1G8Z D;  3K7A B;  1U4P A;  2F0V A;  4LMQ D;  5JAV A;  2A69 C;  4HMI A;  3OWE B;  4FXD A;  1TY2 A;  3DHQ A;  3ND8 A;  1C8C A;  1SDF A;  1KDC A;  1DXM A;  3LNN A;  2ZXO A;  2WII B;  1S4Z A;  2K05 A;  5C6A A;  2MGS A;  1S5D D;  4CJ2 C;  3OPO A;  4U68 A;  5I6Y A;  4NMZ A;  1H9S A;  1PYW D;  4KJO A;  4FF4 A;  4G7O C;  2O5I C;  1JWS D;  2IX0 A;  2GA4 B;  4X3S A;  1VMP A;  4NW2 A;  2B2T A;  3KLS X;  4F87 A;  2IJ0 A;  1OXX K;  2K6A A;  1TII D;  1C4Q A;  2EJM A;  3NK9 A;  3H0G B;  5TSS A;  1GHJ A;  1A2T A;  3MXP A;  2RSO A;  1SJE D;  4KD4 A;  3BVG A;  2AWO A;  1D2B A;  1OXV A;  1V8Q A;  1CK1 A;  2L0C A;  2WP8 J;  3VA5 A;  1WTR A;  5CV6 A;  2VXW A;  4OIJ A;  1PZJ D;  4QMG A;  3CU7 A;  5EKI A;  3MFY A;  3I4L A;  3T13 A;  1SE3 A;  3K59 A;  1BQQ T;  1CT1 D;  4CKB A;  3GTG B;  5C4H A;  3A56 A;  4UAI A;  3GTQ B;  1WD1 A;  4ZQ3 A;  2E74 C;  5ELF A;  1CTM A;  4U67 3;  1CHP D;  4S3S A;  4C3J G;  4XYQ A;  1B3A A;  3IL8 A;  4J6H A;  3I73 A;  4FXG C;  2XVS A;  1B9N A;  2HCI A;  3NPP A;  4K5V A;  3GTP B;  4IFD J;  3R2T A;  1IL8 A;  4RCN A;  1WVL A;  1MI2 A;  2K03 A;  1BNZ A;  2EY1 A;  1G29 1;  3MHB A;  5F2D A;  1CHQ D;  4HED A;  2WIN B;  3J7A V;  1PTO D;  4ZYS A;  4HTH A;  4RWS C;  3K6O A;  2EYJ A;  1STG A;  4BY1 B;  1ZYR D;  1DON A;  3K5L A;  4RH6 A;  3OW7 A;  4E6I A;  4G7H C;  5I4D A;  5E4W C;  1RDP D;  2ID0 A;  2AUK A;  3CKI B;  3N6R A;  5C3X A;  3QB3 A;  3CQZ B;  3S15 B;  5FO7 B;  1BCP F;  2HUG A;  1EU3 A;  1A3V A;  2X6L A;  2DNE A;  4IUN A;  4RGM A;  1EY6 A;  2KVM A;  4MHE A;  3M4Y A;  1EL0 A;  1PRT F;  2RBM A;  5KRU A;  4A3F B;  4RHS A;  1PZI D;  2TMP A;  3KBX A;  5EBD A;  2LY7 A;  2MHV A;  3HOU B;  2O5J C;  2A5H A;  2D5D A;  4ZRZ A;  3PUZ A;  4HMJ A;  1SMY C;  1SXT A;  4RHR A;  2HDM A;  2F1M A;  1B53 A;  2X69 A;  3HKZ B;  2AQ3 B;  3GTL B;  5ELE A;  2F0J A;  3HRZ C;  3L7Z C;  1KNE A;  3QJY A;  1MBY A;  2BA0 A;  2BA1 A;  5BN3 A;  1HA5 A;  1I4H A;  4TSS A;  3E6Z X;  4KY7 A;  5FLX E;  1AEX A;  3BDC A;  5FOB B;  4HN7 A;  2YU9 B;  1EOT A;  1TY0 A;  4DXG A;  3QWN A;  2I07 B;  3K5M A;  5K36 G;  2J7Z A;  1WCM B;  1DCZ A;  1JWU D;  5EBC A;  2MPM A;  2KED A;  4R8I A;  3GTJ B;  3GTM B;  1A3U A;  4C1N K;  1LAB A;  5C3W A;  1M8A A;  3VR4 A;  2A74 C;  3I72 A;  1OXT A;  2JA5 B;  4X3K A;  5LL6 X;  1Y8N B;  1SMY D;  3HG9 A;  2L4N A;  1Y8P B;  3I8Z A;  2V4D A;  1NUC A;  3HZX A;  1LT3 D;  1TWF B;  3NBI A;  3FEW X;  2F0Q A;  2XN9 C;  5HGT A;  2BCO A;  1YNJ C;  3G6J B;  5EPK A;  1STH A;  3NQT A;  4TRD A;  2IPK D;  2IWH A;  2F4I A;  1DJR D;  4OIK A;  4OO1 G;  1V43 A;  1RCV D;  1S5E D;  2B8G A;  3MWY W;  4EGV A;  2LKV A;  1CFM A;  3S1R B;  3E5S A;  5CR3 A;  4ABN A;  3DEP A;  4O42 A;  4CKC A;  4XTC S;  2ICI A;  5JPN C;  5A35 A;  3S16 B;  2BE5 C;  1CI3 M;  3SK4 A;  1LTR D;  1TR5 A;  4HSP A;  1B44 D;  2MUY A;  2WAQ B;  1GUO A;  5BN4 A;  4RA8 A;  3J80 L;  2SEB D;  2DY8 A;  4V0B A;  1PTO B;  3MFG A;  2E2I B;  1CQV A;  2YYZ A;  3C3L A;  4WFN 3;  2WKC A;  1QNK A;  4QB4 A;  4ULL A;  4KKU A;  5CV7 A;  2R7Z B;  1Q3L A;  3L3O C;  1IW7 D;  2SOB A;  1KNA A;  4XIG S;  4F7X A;  3ND9 A;  4CGY B;  1AFP A;  2EY5 A;  3FPP A;  4DK0 A;  2E2H B;  1CZW A;  5A2Q E;  3AU7 A;  1E2V A;  2CVR A;  4BA1 I;  2D9U A;  1XX8 A;  1WTX A;  1EZ6 A;  1G2S A;  5CV4 A;  1D6E C;  2SNM A;  3QO2 A;  4ZLT F;  2MJ8 A;  3BVM A;  1DOM A;  3W2D A;  1F9S A;  2EZV A;  1HRJ A;  5J39 A;  5KEE A;  2Q8R E;  3PV0 A;  1HA6 A;  1EY9 A;  4KK7 A;  1DYQ A;  2AWN A;  2F03 A;  3MXG A;  2XWB B;  2F0D A;  4ZUJ A;  5C0X I;  3MA2 B;  2A73 B;  3P7J A;  4LJZ C;  3PUV A;  1HUM A;  2NN6 I;  1O7Z A;  1G91 A;  3S17 B;  5IT9 L;  3S2D B;  1WD0 A;  2RA4 A;  4KHV A;  3C1F A;  3MXU A;  5CMD A;  2Z8L A;  1PTO F;  2F0T A;  2K1B A;  2R61 A;  1TS4 A;  4EVO A;  5E4X A;  1TKW B;  1L0X B;  2DY7 A;  2KQ3 A;  2JA6 B;  1FNV A;  5ELB A;  4DF7 A;  2HQE A;  4A3D B;  5C0X G;  1HFN A;  2PYK A;  5M3M B;  2NN6 G;  1BXT A;  1H9R A;  5D14 A;  1SFO B;  5KND A;  5CYU A;  1Y1V B;  3GO5 A;  4DFA A;  5IOC A;  4KMU C;  3EJI A;  2EJF C;  1ZYR C;  2VB2 X;  1DOK A;  5EPJ A;  1G6Z A;  5C0X J;  2L1B A;  3RMH A;  4JK1 C;  2G9H D;  1R4Q B;  3FRP B;  4AYB B;  5C4X B;  5JEA H;  1LT4 D;  2EDG A;  5M5X B;  3HS0 C;  3NWT A;  4YIJ A;  2I46 A;  2D2C C;  2L11 A;  1WTV A;  2B2W A;  3KLR A;  5A2Q L;  3FVQ A;  1KAA A;  2BDO A;  4PMC A;  2Z4H A;  5C3E B;  3S1M B;  2ICE C;  1RKN A;  3W3A A;  4IFD I;  4IUV A;  3TZD A;  3EA6 A;  1Z7T A;  3S2H B;  1EZ8 A;  2O4X A;  1GUT A;  2F0F A;  2K5D A;  4QIW B;  1HCZ A;  1TWG B;  4R9W A;  1JWM D;  1LAC A;  4H0L C;  3URY A;  1AZQ A;  1HTP A;  4ODG A;  5JOB A;  4TKO B;  3SE0 A;  3ITP A;  1ILQ A;  2RKS A;  1NR4 A;  4ZAI A;  4J8Q A;  5FKA C;  4RKB A;  1LT6 D;  5JPM C;  2EYM A;  2N88 A;  3SDZ A;  4IQZ A;  2Z1C A;  3PMF A;  2BE5 D;  4F8M A;  4F88 A;  1HXY D;  1D5Z C;  5EJW A;  2QEJ C;  4A3K B;  4G7Z C;  1B4O A;  5I2X A;  3R3O A;  3D6C A;  3H09 A;  5C4Z A;  4DK1 A;  3K5N A;  4XQJ A;  1XYI A;  3MZ5 A;  4EQP A;  3V96 A;  2NUC A;  1EEI D;  4IUQ A;  1TS5 A;  1J9O A;  2ZXR A;  3R93 A;  1SYG A;  2F0K A;  5M5Y B;  2F0O A;  2CW0 C;  3A54 A;  2KOL A;  1XWE A;  2QF7 A;  3A8K E;  1JOR A;  3NQI A;  3OIQ A;  4K5X A;  1SNM A;  2EE1 A;  3NP8 A;  4J1M A;  2KA7 A;  3BG3 A;  1RJT A;  4MIU A;  3P20 A;  4C2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...