3S1QH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1qH00
1UE6A 1IBKL 2N8NA 4FDBA 1KXLA 3L0OA 2ZTDA 1HNXL 4KHPQ 4LF9L 2AWOA 2F4VQ 5C4XG 2IX0A 1VQIA 4A3CH 4QL5A 2EIFA 4KLKA 4DNIA 4LFBQ 3K8AA 4L5TA 3EBEA 1VQ4A 4A3FH 1SRUA 4JI1L 1AH9A 4A76A 4BBSH 1CKMA 4OX9Q 3PO3G 5ELOA 2D0OA 1PH3A 3PF4A 1J5EL 1XNRQ 3W1GA 1AE3A 2D0PA 1HZCA 3F1ZA 5IP7H 3GTOH 2H5XA 5M5XH 2JA5G 2K5VA 4A3IG 1N8RC 3GTMH 2BH8A 3T1YQ 1QUQA 1SN8A 4GLAC 3UDIA 1YITA 1IBMQ 1YHAA 4A3BH 4A3EG 4JBKA 3CAMA 1PA6A 1HJPA 1PH4A 3RZDH 4WJ3M 2E2HH 4X64L 1XMQQ 1B70B 1PYBA 3GDEA 1PH5A 1E24A 3F8TA 4X66L 4EX5A 2RHSB 3T1HQ 4OO1G 1VQCA 1K83H 1E3PA 2ATWA 4H02A 4RMFA 1JJCB 2F52A 3STBC 4DV7L 1IXRA 4O2DA 4JV5Q 4OO1I 4BY1H 3GTGH 4A3DH 2N78A 1IYJB 1Q8KA 4L5QA 1BVSA 1UEBA 4K0KL 4L5SA 3S15H 4LF8Q 3KF8B 1W2BA 4JOIA 4JI6Q 4DR4Q 1PH9A 4KHPL 1KHIA 1VQAA 3KLWA 1TWAH 1EUJA 3F2CA 1Q1EA 5FJ8H 4YY3Q 1FVIA 4A3JG 1C9OA 4DK6C 2F4VL 4IOAA 4UP8A 4LFBL 2K5HA 3MXNB 4A93G 3FP9A 2NVXH 4GLVB 1XPRA 1S40A 2AKWB 4DAYB 1SR3A 1D7QA 1KL9A 3PF5A 1MIUA 4JI8L 5GAEC 1M90C 4GN4B 4R1JA 2ALYB 3PUVA 4DV2Q 1E7ZA 2R6GA 3PGZA 1XMOQ 4A3CG 2R7FA 5DLQE 3ZJYC 3K0XA 1L2FA 3CPFA 4P73A 4DAMA 4DUZQ 3T1YL 3HOWH 4A3FG 4DR3Q 3S17H 1PV4A 1IBML 4BBSG 1JB7A 4B3RQ 4WJ4A 2CKZB 5M3MH 3S1RH 4DR7Q 4XTCS 3M4QA 4LUOA 1XMQL 5IP7G 1L1OA 2MFIA 3PUWA 3CCEA 4P71A 3T1HL 3S2DH 2QGQA 3HKSA 3U4ZA 1Y1WH 3S16H 3RLNA 4JI4Q 2AWNA 1V43A 2LSSA 1KQSA 3RZOH 5JJLA 4A3BG 4JV5L 2Q2IA 4UP9A 3AQQA 2KHIA 1PH2A 4DR1Q 1P16A 1L0WA 4NXNQ 2KCTA 3I7FA 3STBD 3CCSA 1I6HH 3PIOA 1NTGA 4UP7A 1OXVA 2D62A 1OTCA 1GM5A 1U5KA 4MZ9A 4LF4Q 2BA1A 4LF8L 2R93H 2K52A 5C44H 2CFMA 3OYYA 4C3IH 4BXXH 4DR4L 1VQ9A 3PO2H 3S24A 4LWCA 3CCUA 2Q2HA 3GTJH 4YY3L 4BY1G 5FLXc 2RCNA 4A3DG 4B3TL 1I94Q 3G48A 4L5RC 3RR5A 1HH2P 1X54A 2VY3A 5JJKA 1IBLQ 4HJ9A 5C3EH 5LMNQ 2ZTEA 2UUAQ 2IHFA 4HIKA 4GN5A 1YJNA 4GKJQ 5FJ8G 4DV2L 4IO9A 1S72A 4IFDI 5JJIA 1C7YA 3UDGA 4DUZL 1VQ5A 1CKNB 2YYZA 1N34Q 1XPOA 1EOVA 1VQMA 4B3RL 2HT1A 3J7A5 1K3RA 1YHQA 1KRTA 3E0EA 5M5WH 2WAQE 2PQAB 4DR7L 1QZHA 3KF6B 1SFOH 2ES2A 4R4OA 3PIPA 1PFSA 4JI7Q 2R92H 3HOWG 2E5LQ 2OQKA 4JI4L 3CCQA 3KJPA 3AEVA 1X3GA 2WAQG 3PCOB 3CXCA 1B8AA 4OWXB 1MJEA 3NEMA 2NZHA 3S14H 4PG3A 1WFQA 4LUVA 4NXNL 5IY0A 5M3MG 4DV1Q 5GAGC 5AJ3L 1NJIC 2UXBQ 3ERSX 1IZ6A 2NN6G 4R4TA 1VQJA 3CCMA 4GOPB 1Y1WG 1E1TA 4LF4L 3BZKA 1UE5A 1VQOA 2MNAA 3TS0A 1PH7A 2UXDQ 1S3OA 1QVGA 1N9WA 1EFWA 4QIWE 2PI2A 3ER0A 1N32L 4YHHQ 1I94L 2B29A 1VS0A 1LYLA 3CMAA 2NVYH 1IBLL 2R93G 5C44G 4PZ7A 5LMNL 4LF5L 4BXXG 2UUAL 1HNWQ 3PO2G 4B3SQ 2HIXA 2IHEA 3S1MH 3TREA 3G71A 4DR2Q 3AFQA 3BU2A 2HQLA 1Q81C 4B3MQ 1N34L 1VCIA 2VUMH 2DGYA 1K8AC 3WWVA 1VQ6A 5C3EG 1VQFA 3KFUA 1JE5A 1QUQB 3CP0A 3K7AH 3U4VA 2GVBA 3W1BA 4ALPA 1WI5A 3CC4A 4JI7L 4HJAA 1C0AA 5HGQA 2UUCQ 4AIMA 1LUZA 2MO1A 3DLLA 3L2PA 3GTQH 1QVCA 4IJHA 3H15A 4QGUA 1VQ7A 4DV1L 1N36Q 4LW1A 2Z6KC 4R4CA 4IPCA 2E2IH 3OTOQ 2PI2E 1YNXA 2QEXA 2UXBL 4JC0A 2F3IA 4YCVA 2NVTH 1RL2A 2R92G 4JI2Q 3D31A 3J81c 4A3MH 4Y52H 3JAMc 4JI3Q 2YTXA 4A3KH 1HZAA 3KYHC 2UXDL 4C2MH 1HR0W 3M7NA 2DUDA 4O0AA 3J81i 3JAMi 1WCMH 3EIVA 3GD7A 4NB3A 4DV3Q 4A75A 4GOPC 4OX9L 4QJFA 3ICEA 5LMUQ 2JA9A 2OQ0A 4AH6A 1XNRL 3JC66 1A8VA 4AQYQ 1EIYB 4IPHA 4BA1I 1NE3A 4GKKQ 1QVFA 4OWWB 1G6PA 4LF7Q 1JT8A 1SLJA 1E22A 1Q82C 1BBUA 1NY4A 1OXXK 1YJ9A 1T9HA 1X65A 2JA8H 4B3SL 3RN5A 3GTKH 4DR2L 4R4IA 4LFCQ 2A19A 2WB1G 1JJ2A 1HR0Q 4B3ML 2MQHA 2HHHQ 2A8VA 2R7ZH 2JEBI 1VQDA 3CC2A 4IPGA 1X3FA 3M4OH 3A74A 3KDFB 2RHQB 5IYCH 3I4NH 1JJGA 2ZJPA 2EQSA 1PH8A 1YIJA 3A5ZB 5M5YH 2IX1A 2Y0SE 3F2DA 3CQZH 3RNUA 1EQQA 2UUCL 1VQBA 2VUMG 4Y7NH 4TQUS 4EQ5A 3GO5A 1L1OB 2JA6H 3I4MH 1VQPA 3H0GH 1PH1A 1N36L 2Y0SG 4JI6L 3OTOL 4PZ6A 4DUYQ 4DV6Q 3KOJA 2UU9Q 4UY8C 3NBHB 1EQRA 4BY7H 2KHJA 4DV5Q 4JI2L 4JI3L 1KAWA 4P75A 3ULPA 3BZCA 5ELNA 4X62Q 4DV3L 1EYGA 1XPUA 3HOYH 2UXCQ 1Q46A 4TVAB 1Y1VH 4LFAQ 4C3HH 2EXDA 5GAHC 5LMUL 4GNXB 3J80c 2XGTA 5C4JH 1GO3E 3PSIA 2HIVA 2VS1A 4GKKL 1BKBA 2AHOB 1XNQQ 5IE8A 2VQEQ 3CF5A 3J80i 3M4PA 4A3MG 1XMOL 4POFA 4LF7L 4JOIC 4A3KG 4JBWA 3M3YH 2IY5B 2BH2A 4DR3L 3W5OA 1K73C 1WCMG 2OWOA 1PYSB 1UE1A 3M9BA 4LFCL 3S1NH 2WP8J 2IT1A 3I56A 2L15A 1E1OA 3PV0A 1YI2A 1CKNA 1UWVA 3U58A 4JG2A 2OTJA 2YTYA 3A0JA 3HOVH 5JEAG 2MO0A 3B6YA 1X56A 2JE6I 4AYBG 2AMCB 2E2JH 4NPSA 2PQAA 4BBRH 2CQOA 4JYAQ 4DR1L 3KF6A 1WJJA 2R7ZG 1YEZA 2LXKA 2PMZE 3U50C 2Z6KA 1HNZQ 2WFWA 2B63H 2JA7H 4IFDG 3F2BA 1HZ9A 1TWGH 1LTLA 3PUYA 3RLOA 1PVOA 2UU9L 5IYCG 1R9TH 4X66Q 3FHWA 3I4NG 4DUYL 5IP9H 1L1OC 4X65Q 4LUZA 3EN2A 2NN6I 1YVCA 2OCEA 2PNHA 5GADC 3G4SA 2VQFQ 5M3FH 3H3VH 2I5HA 1SROA 1TXYA 1IL2A 1VQHA 2GN5A 3OW2A 5FLMH 4GOPA 1CKOA 5J3BA 2JA6G 2B3GA 3I4MG 4A93H 1BBWA 3E9IA 5IT9c 4X62L 3H0GG 2UXCL 4GLXA 2VW9A 4LFAL 1DGSA 4POGA 1SMXA 1G51A 1P8LA 1HZBA 1YZ6A 4DK3C 3HOZH 4GKJL 3HOXH 1X9NA 1XNQL 3NELA 4BY7G 2VQEL 3TQYA 3HKZE 2QA4A 4GNXC 2I5MX 2JJQA 1Q1BA 4DKAC 1FJGQ 1KRSA 4HIMA 2OTLA 3HOUH 2K5NA 3HOYG 3PUXA 2YTVA 4JBJA 5E7NA 2CCZA 1Y1VG 4LF6Q 2Q2UA 5HY6A 4HJ5A 4JCVE 3HKZG 1ASYA 1Q86C 4JBMA 4JI8Q 1KIXA 4A3GH 1TWHH 1Q12A 3PUZA 1Q7YC 4JI0Q 5BR8Q 1N33Q 1EWIA 2E5LL 3I4OA 5GROA 4JI5Q 2V1CC 2K50A 4MNOA 4PZ8A 1X55A 4YWMA 2I0QA 4JYAL 1OXSC 1Z9FA 2Q2TA 3CPWA 1HNZL 3L7ZC 1A62A 5C0XG 1XTDA 3HOVG 4NXMQ 4YCUA 1X6OA 3KJOA 1YJWA 4X65L 2RF4A 4A4IA 5C0XI 4BBRG 5IWAQ 2VQFL 3RLFA 2NVQH 4HIDA 3LGJA 1QZGA 3GTPH 4YHHL 3UE1A 4YWKA 2YU9H 2B63G 2K4KA 2JA7G 2A1AA 2WB1E 4DPGA 3IRBA 1HNWL 3CC7A 2ZJRA 2KENA 5JEAJ 2UUBQ 1UE7A 1W3SA 1CSQA 1K0RA 5IP9G 4DV4Q 2JK8A 2JQOA 4HJ7A 1K9MC 1I3QH 5M3FG 1FGUA 4YWLA 1I5FA 2N3SA 2XTIA 2ZJQA 5FLMG 3J81j 3H3VI 1FJGL 2FXQA 3UE0A 3CW2C 3G6EA 4B3TQ 5IYBH 4QQBX 4IFDJ 1XJVA 4LF6L 1CSPA 4DV0Q 4DR6Q 1VQNA 1KD1C 3HOZG 3K81C 4IJLA 3HOXG 3MEFA 1EIFA 5H1SE 2JEAI 1VQ8A 2BA0A 1VQGA 4XIGS 3TEHB 3CCRA 4JI0L 5BR8L 4MTNA 4HJ8A 1N33L 3AYHB 3D0FA 3I2ZA 4JI5L 5IYDH 3FKIH 4C3JH 1FL0A 1LM0A 3SGIA 3HOUG 4A3LH 3KDFA 1I50H 4BA2I 4HIOA 1NMGA 4YCWA 1B7YB 4P74A 2LXJA 3HFZB 4A3GG 2ZTCA 4QY7A 3BJUA 2ASBA 2K75A 1VQKA 3CD6A 4NXML 4PMWA 2K14A 4J15A 1V1QA 2ZM6Q 4DR5Q 1JMCA 5C4XH 1ASZA 3TRZA 4APVA 1GKHA 1Y14B 3K80C 5IWAL 3UDFA 2YV5A 3K7UC 1TWCH 2E8GA 4OXPA 1A0IA 4RG1A 5GQOA 3CMEA 3CCVA 3CCLA 2R7DA 1X3EA 3AFPA 3ULJA 1Z47A 1G291 2KCMA 2VL6A 3E9HA 3A5UA 1IBKQ 4OWTB 5LMNW 4AQYL 1K8GA 1AE2A 1OXTA 5AJ3Q 3PO3H 5K36G 4GS3A 4R4QA 5EAYA 1HNXQ 4GN3B 1RIPA 2CWAA 2UUBL 4DV4L 4LF9Q 2JA5H 1MKHA 1H95A 4A3IH 1YHBA 4GNXA 1VQLA 2GVAA 4JI1Q 1HR0L 4AYBE 1M1KC 4KHZA 1VQEA 1O7IA 1MJCA 2NZOA 4A3EH 2HHHL 1J6QA 2KBNA 1N32Q 2C35B 5C0XJ 3S1QH 1J5EQ 3M85A 2CWPA 1NMFA 2I5LX 3DM3A 4DV0L 2ID0A 3GTLH 4OONA 4IPDA 1GVPA 4DR6L 3UDXA 1GD7A 2N49A 4X6AH 4LF5Q 3VDYA 1YBYA 3Q8DA 1CUKA 1NBWA 4KI0A 3TS2A 1TWFH 5IYBG 3I55A 1WOCA 3NENA 4P72A 4X64Q 3S2HH 3J7ZC 3ULLA 4UPAA 4DV6L 1D8LA 2JA8G 1OXUA 2VNUD 4DV5L 5IYDG 4IOCA 4DV7Q 3FKIG 2ZM6L 1KC8C 1A63A 4DR5L 3RN2A 4A3JH 4A3LG 1SE8A 4LNQA 1PHJA 2VZAA 2Z0SA 1PH6A 1WYDA 3CCJA 4ME3A 1U0LA 4K0KQ 1V9PA
chains in the Genus database with same CATH superfamily
2HD3A 3E0JA 1STNA 3P20A 4QUCA 3SK5A 3S14B 1S5FD 1HNXL 4LJZC 2EYJA 2G5DA 5C4XG 4LFBQ 1BR9A 3MXPA 4KLKA 4QL5A 1QNUA 3EBEA 1AH9A 2NTTA 2FHTA 1ICFB 1ZKOA 1NSNS 1EY6A 1HZCA 1STBA 3ITPA 5KRUA 1SN8A 4GLAC 4HCSA 1IBMQ 2HCIA 1HUMA 2SDFA 1PA6A 1F77A 3RZDH 3BS1A 1F2YA 1V8QA 3BZDB 1EIHA 1B70B 3QJYA 4EX5A 5I9OA 2D2CC 1VQCA 1JJCB 3K5NA 4MHEA 4OO1I 1D5XC 1CQVA 4BY1H 3A56A 1Q8KA 3FPPA 1UEBA 2RSOA 4K0KL 3GTQB 4LF8Q 2BCOA 3KF8B 1KLGD 4JI6Q 2O5IC 2Q8IB 2QCPX 4IOAA 3J7AV 2B2UC 1EYDA 4UP8A 5G3LF 3FP9A 3QOLA 1S40A 5BN5A 2HCCA 3VYRA 3EQLC 4GN4B 3PUVA 2ICIA 1XMOQ 4A3CG 1ILPA 1MBYA 3T1YL 3CPFA 3QB3A 4DR3Q 4CKBA 1JB7A 5CBEE 4AYBB 3S2DH 1BXTA 3HKSA 1VF7A 1Y1WH 3RLNA 1EEFD 4JPBW 1H9SB 4IUUA 5EBCA 3RZOH 3CRKC 2Z8LA 1CZWA 4UP9A 4JV5L 2KHIA 3CHBD 3I4NB 1V1OA 1KNEA 1GJXA 4UP7A 4FF3A 3V2TA 2BA1A 4BXXH 2PW7A 3OYYA 5DNFA 4C3IH 2JA6B 3PO2H 3CCUA 1STEA 3I90A 1B3QA 3LX0A 4L5RC 1HH2P 1SYGA 1IBLQ 2F0SA 5C3EH 1TIID 2ZTEA 2IHFA 3MA2B 1EWHA 5CMDA 5FJ8G 4DV2L 4ZUIA 4IO9A 5JJIA 1GHKA 3KLRA 2AUKA 4J1MA 2YYZA 2L0CA 1EOVA 4B3RL 1A15A 2VB2X 2ZXOA 2PPBC 4OELB 1OO9B 3IFTA 4R4OA 4Q5VA 2F03A 3LWUA 1IYVA 4OWXB 3WDNA 4PG3A 5M3MG 1J9OA 1EY7A 1SYCA 5GAGC 1NJIC 3ERSX 1IZ6A 2NN6G 1I4PA 4R4TA 1SNCA 4ZAIA 4LF4L 2LS01 2RVLA 1PH7A 3FVQA 1HTPA 1MSHA 2F0KA 4RGTA 1EFWA 1DOKA 2MUYA 2PI2A 2AQ1B 1I94L 1JWUD 1B2TA 1JR0D 4LF5L 3NE5B 1QG7A 5IOCA 3M7GA 4DNTB 4B3SQ 3S1MH 3BDOA 3TREA 1Q81C 2VUMH 2NWGA 1ESFA 3WWVA 2Z9HA 1BCPF 1LT4D 2N55A 3K5OA 1VQFA 1VQ6A 3KFUA 5EJWA 4G4KA 1I4QA 3CP0A 2EVBA 4ZRZA 2RQXA 5D3DA 4R9WA 3IAYA 4JI7L 1C0AA 1S5CD 2UUCQ 4AIMA 1LUZA 5IGGA 4XQQA 2J4XA 3GTOB 4F88A 1JB3A 1SDFA 4MIUA 2Z6KC 3DWAA 5IIFA 2E2IH 2MGSA 2F3IA 4JC0A 2NVTH 4JI2Q 3JAMc 4JI3Q 3I91A 4TKOB 2SEBD 1HR0W 2PCFB 4X3KA 3JAMi 3SK4A 4A75A 2ZXRA 2NVQB 4IUPA 1XNRL 3JC66 4AQYQ 3K6OA 2M9VA 4LF7Q 3TZUA 1E22A 5CV4A 1Q82C 3H3VC 1U4MA 1OXXK 4CDDC 5JEAH 1GUWA 4LFCQ 3CC2A 1EY5A 4IPGA 3M4OH 3KDFB 1VMPA 1D6EC 1SJHD 2EY2A 2RHQB 1YIJA 1SAPA 2K05A 2IX1A 1JWSD 3RNUA 2FMCA 4Y7NH 3GO5A 1I4GA 3NSWA 1SSOA 1VQPA 4CBVA 1N36L 1EIGA 3C3LA 3GV3A 2Y0SG 4Q0FA 1I50B 1PFBA 2NZ1D 3KOJA 3NBHB 4BY7H 2CW0D 1B53A 2CH4A 2KHJA 4K6DA 1EQTA 1F2LA 3ULPA 3BZCA 5ELNA 4X62Q 1EYGA 3HOYH 5GAHC 4LFAQ 4DAPA 5LMUL 2EXDA 1TWCB 4GNXB 2XGTA 4FXKC 5EKKA 2VQEQ 5I4DA 4JOIC 4A3KG 4JBWA 1G2SA 3W5OA 2F0DA 1WCMG 2OWOA 1UE1A 3S1NH 4A3IB 5ELEA 2L15A 3QR8A 4IURA 1UWVA 2RA4A 5C0XH 1RJTA 2OTJA 3HOVH 1ZXTA 3S1QB 2E2JH 2CQOA 4DR1L 3Q22A 2OEOA 4V190 2F0OA 2PMZE 4RCNA 1PVOA 5IYCG 2B2TA 4DUYL 3G4SA 1JICA 1YVCA 3H3VH 3C1FA 1TXYA 1IL2A 1YNNC 4PNYA 1HPCA 2L12A 5K5PA 5J3BA 2B3GA 3E9IA 3H0GG 2MJ8A 1CK1A 2IW3A 1GUOA 1G51A 1R4QB 1P8LA 1YZ6A 4PMBA 3HOXH 3CRLC 3HKZE 4ULLA 3TMEA 4OEMB 1Q1BA 4EGVA 4DKAC 2OTLA 4HIMA 3P7JA 5E7NA 2CCZA 4JBJA 4C3HG 2DJFC 4HJ5A 5DAUA 2CH4W 4BS9A 4JBMA 1KIXA 3PUZA 3BVMA 2E5LL 4PQXA 5EBDA 4MNOA 3D4RA 5EKLA 1WD0A 4JYAL 1IW7D 5IGBA 5F2DA 4I65A 3CPWA 2QDLA 2WINB 3QO2A 1BNZA 4XDXA 2IWHA 1A62A 4JVZA 1XWEA 4DK1A 1QOHA 4K5WA 1IL8A 4NXMQ 3EJIA 3RZDB 2EOTA 3SK8A 3W3AA 5C0XI 4BBRG 5IWAQ 2VQFL 3RLFA 3GTPH 1JE4A 2O2LD 3UE1A 3P75A 1MI2A 2A1AA 4BY1B 1PFNA 2UUBQ 1K0RA 2JK8A 2JQOA 5M3FG 4O42A 4YWLA 1EY8A 1SEBD 3J81j 4K14A 3H3VI 1XJVA 4KKTA 4LF6L 4DR6Q 3IFDA 2CHBD 1KD1C 1VQNA 2KHSA 3MEFA 1A6XA 5H1SE 5BN3A 1VQGA 4HJ8A 4MTNA 5DM73 4CJ1B 3FKIH 4QMGA 4DN4M 3HOUG 3CKIB 3KDFA 4YCWA 2J0TD 3HFZB 4A3GG 2F0QA 1H9JA 4HSPA 1VQKA 1VDZA 3TZDA 2K14A 4XQNA 1O7LA 1V1QA 3P1HA 2QW7A 3TRZA 4X3SA 1Y14B 3RUZA 1STYA 3NK9A 3UDFA 4F7XA 2E8GA 4G7HC 3S2DB 1A0IA 3CMEA 2N88A 3MWYW 1Y1WB 1U4LA 3AMUA 2E76C 3ULJA 1Z47A 1ONLA 3V96A 3A5UA 4XQJA 3RZOB 1SYDA 1YNJC 5LMNW 1K8GA 3PO3H 2PMZB 4GS3A 1RIPA 1GUTA 4DV4L 1H95A 1YHBA 4GNXA 1FD7D 1VQLA 4C3IB 1PTOC 1RHPA 3PO2B 1MJCA 4DXFA 1PRTD 2KBNA 5E1FA 3M85A 2CWPA 1NMFA 3NTKA 2ID0A 2EPBA 5IODA 3UDXA 2N49A 1CA6A 4X6AH 1AFPA 4LF5Q 4ZK9B 3VDYA 3R2IA 3OHXC 4NKLA 2F0UA 5C3EB 2Z4IA 1DYQA 1DJRD 3NENA 1PFMA 1PZJD 2G9DA 4L63B 4P72A 4X64Q 3MFYA 1U9RA 3I8ZA 3K59A 1EWCA 4UPAA 1QWYA 2F0TA 2PYKA 4DV6L 4G7ZC 4FXDA 3KK7A 2VNUD 3OSOA 4K2KA 2F0FA 4C3JG 1DONA 4LNQA 1U0LA 1V9PA 4ILWA 1UE6A 5COYA 4FDBA 1KXLA 1S4ZA 2ZTDA 3VA5A 3KLSA 2AWOA 2F4VQ 4KTAA 2B63B 1D1KA 3K8AA 3KBGA 1VQ4A 2C5CA 1PH3A 2D0OA 1J5EL 1XNRQ 3W1GA 3DEOA 2D0PA 3GTOH 2JA5G 1LT3D 2A6EC 3QWNA 4H7BA 1QUQA 1ZYRD 5EPJA 4A3EG 1FR3A 4JBKA 3CAMA 3NQIA 1HJPA 4WJ3M 3S1MB 2B2YC 1XMQQ 2SNMA 1PYBA 2XVSA 3F8TA 3T1HQ 4RWSC 4KK7A 2WKCA 2ATWA 4H02A 4RMFA 2F52A 2KOLA 4XT3B 4DV7L 1IXRA 1AW7A 4O2DA 4A3DH 4HCEA 1V1PB 1PTOH 3A8KE 5KYIA 2ICEC 3I4LA 3S15H 3A55A 3I73A 5JVH3 2FINB 2FMMA 4KHPL 4A3JG 1EUJA 3SK6A 1FVIA 4DK6C 4A93G 2E2IB 3MXNB 4HEDA 2NVXH 4G7OC 4GLVB 2NVTB 1RDPD 1K0SA 1D7QA 1NAPA 1D5MC 2XSCA 1DOLA 5FKAC 4P73A 4DUZQ 4A3FG 4BBSG 3BVZA 4DU9A 2A68C 1D2BA 1JC7A 1M8AA 2K5QA 1JQYD 5IP7G 1L1OA 4KHVA 2QGQA 3S16H 4EVOA 2B39A 1GHJA 2LSSA 2TSSA 4IUVA 4A3BG 3M4OB 2Q2IA 2L55A 3AQQA 4DR1Q 3FPUB 1L0WA 4NXNQ 1L0YB 1NTGA 1OTCA 1X3PA 1U5KA 2E75C 2JYOA 3MC0B 4Y7NB 1FNVA 2K52A 3MXUA 5C44H 3RD4A 4DR4L 4NDXA 5IT9E 4YY3L 2PO4A 4IQZA 2JN4A 5FOBB 3RR5A 4BY7B 1X54A 1A2TA 2KCNA 2VY3A 2HDMA 5IGFA 5EPKA 4ZKBB 5LMNQ 2F3WA 5G3LD 3SR1A 1O7ZA 1WTQA 3HOYB 1YJNA 4GN5A 2RKSA 4LK1C 4OIKA 1EY9A 1CFMA 1CKNB 4HTHA 3GQBA 1VQMA 2HT1A 3E0EA 5M5WH 2EY5A 4DR7L 1QZHA 1GOZA 3S1NB 4G57A 4WFN3 2VXWA 5EPLA 3PIPA 2K1BA 4KN4C 3HOWG 1LACA 2OQKA 2E5LQ 4JI4L 2WAQG 1CHPD 3HG9A 2NZHA 3HOVB 3IKJA 2E2JB 5AJ3L 1RD9D 1E1TA 5CORA 2B2UA 2UXDQ 1EU3A 1S3OA 1D1IA 1QVGA 5A35A 4B08A 2I07B 3ER0A 2FJ2A 2F0EA 5E4XA 4DF7A 1TU2B 3FDTA 2R93G 4FF4A 1Y8OB 3MFGA 2UUAL 3VA7A 4IN3A 4OL7A 1F2MA 3T53B 3NHHA 1E0BA 1ENCA 2IHEA 3AFQA 1GXDC 2D9UA 2HQLA 2WV6D 2D5DA 3HOXB 1N34L 3BDCA 2DGYA 2DY8A 4FP5D 3URYA 5L37A 3K7AH 3U4VA 4XYQA 4ALPA 4B9XA 4HJAA 4IJHA 3LNNA 4DV1L 3KUPA 4LW1A 2PNRC 4IPCA 2IPKD 2OXPA 1YNXA 5TSSA 2UXBL 1GUGA 2R92G 3D31A 4A3MH 4Y52H 1PYWD 4I7AA 2YTXA 3M7NA 2F0VA 4O0AA 4DV3Q 4QJFA 2OQ0A 5C6AA 3GTPB 2BE5D 3MXNA 1EIYB 4GKKQ 1QVFA 2MPMA 1EOTA 4EQNA 1BBUA 1T9HA 1RTOA 2K04A 4DR2L 1LTSD 5J39A 1JJ2A 4B3ML 1ILQA 3KLSX 2A8VA 2R7ZH 1E2WA 1WVLA 1CM9A 1Z6HA 1HXYD 1X3FA 3MEHA 2XRQD 5C5MA 1BCPD 1PLFA 3A5ZB 5M5YH 2Y0SE 1VQBA 2A6HC 4EQ5A 3I4MH 3FKIB 5AFWA 5KIXA 3MVVA 3TBIB 3OTOL 1XYIA 3E6ZX 1TT2A 4PZ6A 3V05A 5JJZA 4DV6Q 2UU9Q 1EQRA 2HQEA 3C2PA 1B4OA 4WJWA 4TSSA 1Y1VH 5C4JH 1GO3E 3PSIA 2HIVA 1XNQQ 5IE8A 3M4PA 1FNUA 1RKNA 3PO3B 4PMCA 1Z7TA 1K28A 4FNFA 3M9BA 3I56A 2B2VC 3DWPA 1E1OA 3PV0A 1CKNA 4JG2A 3A0JA 5CYUA 1FYCA 1X56A 2JE6I 4AYBG 5IGEA 3PQIA 4WRDA 1YEZA 4I7ZC 2F4IA 2EZVA 2B63H 2Z6KA 3MXGA 2JA7H 4IFDG 1HZ9A 1LTLA 4CDCC 1SE2A 4LAAA 3N52A 3I4NG 5IP9H 3DUZA 2PNHA 3BYYB 2OCEA 3EN2A 4UDUC 4XXEA 1VQHA 3OW2A 5FLMH 1CI3M 2DY7A 1CKOA 3L9AX 2JA6G 4A93H 3TSSA 2UXCL 2IX3A 1DGSA 1SMXA 1SNPA 3SEBA 4DK3C 3HOZH 4GKJL 2EY6A 2BOSA 4N9PA 4KMUC 1DXMA 4M8AA 2YTVA 5HY6A 1ASYA 5BN4A 3GP7A 3K0YA 3ZYYX 3H09A 3A8IE 5JPNC 1Q12A 3G7LA 5BR8Q 1N33Q 2G9HD 5DEHA 5GROA 4YWMA 1X55A 4M1UB 1X3QA 2DNCA 1BF4A 1HNZL 3VR3A 5I2XA 5K36H 1U4RA 5CGKA 4KY6A 3KJOA 2L9HA 1TS3A 2QEJC 2RF4A 1QNKA 3D4WA 3KF8A 4X65L 3LGJA 1QZGA 2PZTA 5IT9L 2YU9H 1EQVA 2K4KA 3Q23A 1GUNA 2WB1E 4A3DB 3IRBA 1HNWL 5FLXE 1PTOB 5D65A 1CSQA 4U68A 5CC4A 4ID6A 1FGUA 1LTAD 3S15B 2N3SA 4NP5A 2ZJQA 2P5ZX 1FJGL 4OIJA 5IYBH 4QQBX 4IFDJ 2OT2A 3BVGA 1SJED 2K7VA 2NVXB 4IJLA 2RCFA 2JEAI 3CCRA 1Q8IA 4JK1C 4XIGS 3TEHB 3PIP3 4JI0L 2JA8H 2A69D 3AYHB 3D0FA 3I2ZA 4IUNA 4JI5L 1FL0A 1LM0A 3SGIA 5LL6X 4A3LH 5JAVA 2XRSD 5NUCA 3R8BA 1H9SA 3NTHA 5FK9C 1B7YB 4UHVA 2KECA 4P74A 3HEJA 1CT1D 2LXJA 1CZGA 2ASBA 2MHVA 2K01A 2XNAC 4J15A 4CGYB 3AU7A 3A7AB 4DR5Q 5C4XH 1ASZA 1TY0A 1HA5A 1S5DD 1ZEQX 5I6WA 5D3IB 1AZPA 3S16B 1IKMA 1MSGA 1K8OA 4C56C 4OWTB 1AE2A 1OXTA 5AJ3Q 1W6KA 1HNXQ 3EA6A 1S5BD 5C3XA 1SYEA 4B9WA 4GZYC 2RDHA 2GVAA 5C44B 1O7IA 2NZOA 4RGMA 1WTPA 1I6HH 3DM3A 4DV0L 1STAA 1GVPA 3VYSA 1C48A 3E3XA 4DGZA 1X32A 3Q8DA 4KI0A 3WOEA 3OOCA 5A2QE 2MP1A 3ULLA 1UEAB 4CKEA 3SDZA 1NUCA 5IYDG 1LO5D 4DV5L 4IOCA 5I2YA 1KC8C 4X3TA 2ZM6L 5M5WB 1A63A 3LWEA 1SE8A 5D14A 1PHJA 1Y8PB 1WYDA 3CCJA 5JPMC 4ME3A 4K0KQ 1SNQA 1ENFA 1IBKL 2N8NA 4RGNA 4RHSA 4LF9L 2IX0A 1VQIA 4A3CH 1WTRA 2EIFA 3C1EA 4DNIA 1ET6A 4L5TA 1TWGB 1SRUA 4JI1L 4A76A 2AUJD 1CKMA 2Z1CA 3NXWA 1DOMA 5ELOA 3F1ZA 2H5XA 2KEEA 2WB1B 4KKUA 3OMCA 4A3IG 3T1YQ 1EZ8A 3UDIA 1YITA 1YHAA 2L11A 4DK0A 2I46A 3T4AC 1PH4A 3BG3A 5KEEA 1H9RA 2E2HH 2EYPA 1PH5A 3H6MA 4X66L 2RHSB 4OO1G 2QF7A 1E3PA 5J1ZA 3STBC 4L8JA 4JV5Q 2XWJB 5JOBA 3K7AB 1DCZA 1BVSA 1ENAA 1LABA 4L5SA 3J7AF 2CW0C 1W2BA 3X3MA 1PH9A 1KHIA 3KLWA 3F2CA 1Q1EA 5FJ8H 1C9OA 4KJNA 4LFBL 1DM0B 4A3MB 2AKWB 4DAYB 1BOSA 1SR3A 2X6LA 3FRPB 1KL9A 1MIUA 2BDNA 3RMHA 1M90C 2ALYB 5KYLA 2DNEA 4DV2Q 1E7ZA 1SNOA 2R6GA 3PGZA 4ZLTF 1L2FA 4DAMA 3U9SA 1PV4A 1IBML 4B3RQ 2A6ED 4H13C 1W6JA 3Q0AA 1C8CA 5M3MH 3S1RH 1JOOA 5FO7B 2MFIA 3PUWA 3CCEA 2R7ZB 1O78A 2NN6H 2K5WA 2O5JC 2X69A 2AWNA 1V43A 1KQSA 5JJLA 1NR4A 1XTCD 3NBHA 2KCTA 3I7FA 1I4XA 5M5YB 2EYOA 4LF4Q 4LF8L 4C1NI 3I4MB 1VQ9A 2Q8TA 3N6RA 4LWCA 2AQ2B 4K2LA 1PTOF 4BY1G 2RCNA 2A74C 4B3TL 1I94Q 1F9QA 4HJ9A 5EQ0A 1SMYD 2B2WA 3Q24A 4HIKA 4GKJQ 1Y1VB 2F0IA 1S72A 1QJOA 5C4JB 3HKZB 1C7YA 4FXGC 3T16A 1VQ5A 2DN8A 2C9OA 2B2YA 2WAQE 2PQAB 3A7LA 1EYCA 3KF6B 2ES2A 4DAVA 4JI7Q 1PFSA 4KD3A 1H9KA 3KJPA 1X3GA 4MTKA 4LUVA 2EJFC 2XN9C 1O7YA 2B8FA 2NBFA 1VQJA 1Y1WG 3VR2A 1UE5A 3NBIA 5HGTA 4L6TB 1TS4A 5FLXL 2MNAA 3TS0A 2JA7B 1N9WA 4QIWE 3QOJA 2F0HA 2SOBA 1N32L 2NYZD 2B29A 1VS0A 2EY1A 1FGBD 2NVYH 3W2DA 3CMAA 1IBLL 4PZ7A 4BXXG 4C3IG 1HHVA 4A93B 1HNWQ 3PO2G 1SE4A 3H91A 1QILA 5CV6A 5LL6S 3OIPA 1IKLA 1SYBA 4TRDA 3G71A 1EU4A 3TDQA 3HOZB 5CV8A 1K8AC 3H94A 2EJMA 2SNSA 5C3EG 2WACA 2JSOA 2LMCB 2GVBA 3W1BA 2ZXPA 1WI5A 3CC4A 1E2VA 2MO1A 4YIJA 3DLLA 1PZID 1N36Q 4R4CA 3PIO3 2PI2E 4RA8A 4YCVA 4Z9CB 5ELDA 5EKIA 1B1ZA 4A3KH 4C2MH 1Y8NB 2DUDA 3GV6A 1WCMH 1G8ZD 2LKVA 4NB3A 4GOPC 4OX9L 1K83B 3ICEA 5LMUQ 4AH6A 1A8VA 4IPHA 1NE3A 3M4YA 4OWWB 3X3NA 2YU9B 3DMUA 1SLJA 3ERQA 1NY4A 1ESRA 1PRTC 4B3SL 3GTKH 4R4IA 1EY0A 2MQHA 2HDLA 4ZQ3A 2F0LA 1HA6A 1VQDA 1WTVA 1LTRD 5A2QL 1STHA 1E2ZA 5IYCH 1JJGA 1HRJA 2EQSA 3I72A 1EQQA 3F2DA 3CQZH 2UUCL 4ME5A 3NQTA 1I6VC 2VUMG 3K5MA 2JA8B 2K32A 4IZ8A 2EYFA 2KUMA 3H0GH 5HURA 5E3FA 1ET9A 4CKCA 3J81L 4DUYQ 3ONAB 4DV5Q 4JI2L 3A8JE 4JI3L 1KDBA 1U4PA 1BBXC 3BYTB 1QE6A 3WOFA 1XPUA 4HMIA 5C4XB 4C3HH 4X3UA 1CQFA 4RAUC 2K03A 2VS1A 2AHOB 1QCBD 3Q6SA 4ZUJA 4LF7L 2EYHA 2IY5B 1AP0A 1FNWA 3R93A 1K8MA 1PDQA 1K73C 1PYSB 1XX8A 1TR5A 1MGSA 4PV1C 4LFCL 4QIWB 5T1IA 4EQPA 1NNXA 1ZYRC 1LTBD 1CTMA 5JEAG 3B6YA 1I6HB 4OO1H 2E74C 2AMCB 2M00A 4NPSA 2LFNA 2PQAA 4BBRH 3HP3A 4JYAQ 3EROA 3KF6A 1WJJA 3U50C 3F2BA 1TWGH 3RLOA 3PUYA 2A6HD 1R9TH 4X66Q 2RDGA 3FHWA 1HQRD 4J6HA 1L1OC 5GADC 4LUZA 2VQFQ 5M3FH 2I5HA 1SROA 1B3AA 2L1BA 4F87A 5IT9c 4X62L 3MZ5A 3NPPA 3J80L 4GLXA 2VW9A 4LFAL 3NELA 4BY7G 1TQOA 3TP7A 2VQEL 3TQYA 2RBMA 2I5MX 2KJXA 1HUNA 4E6IA 5CR3A 4KN7C 4ABNA 5JVG3 2K5NA 3HOUH 3PUXA 3HOYG 1XXGA 4KD4A 4LF6Q 1UNSA 1Q86C 2NUCA 4A3GH 1TWHH 1Q7YC 1F2ZA 3I4OA 4S3SA 2I0QA 1BQQT 1TKWB 1OXSC 4LMQD 1II3A 1V1PA 1UAPA 3L7ZC 5C0XG 1XTDA 3HOVG 2ENBA 2VB3X 1YJWA 4A4IA 3D3RA 2E2HB 4HIDA 3I3CA 4YHHL 2F0PA 4YWKA 1WTXA 3HGBA 1KLUD 5E4WC 2EYMA 2ZJRA 1QB5D 5JEAJ 2K6AA 1HCZA 1UE7A 1W3SA 4DV4Q 1KDAA 1I3QH 1I5FA 1I4RA 1B9MA 2FXQA 4B3TQ 2B2VA 4HN7A 3K81C 3HOXG 4H44C 1EIFA 1A2UA 5CBAE 1VQ8A 2BA0A 2RDFA 5ELFA 2IJ0A 4QF4A 4C3JH 3ND9A 3QG1A 4BA2I 4HIOA 4RKBA 1NMGA 2ZTCA 4QY7A 4NXML 2TMPA 4PMWA 5M3MB 4QB4A 3S1RB 5IWAL 4K6LA 5GQOA 3CCVA 2QDBA 5ELCA 2WKDA 3AFPA 3HRZC 1G291 5EAYA 3OWFA 4GN3B 2CWAA 2UUBL 4RCOA 5EGTA 1TY2A 2JA5H 4F8MA 4HSVA 1CA5A 1WD1A 4QCLA 1HR0L 2HHHL 4KHZA 1VQEA 4A3EH 1N32Q 1J6QA 4KJOA 2C35B 5C0XJ 1G91A 1J5EQ 1RODA 2I5LX 3EFXD 3HZXA 3GTLH 4IPDA 4DR6L 1RTNA 4RGOS 1CUKA 1NBWA 4O1NA 1TWFH 2Q8RE 3S2HH 3SHLA 3M3YB 3O13A 1OXUA 4FF2A 4DV7Q 3FKIG 1EFID 4A3JH 3DHQA 2WIIB 2Z0SA 1TVXA 3SVMA 4HMJA 3CCMA 3JAME 1EZ6A 3L0OA 3ND8A 4KHPQ 1TS5A 1AEXA 3NTIA 1RF2D 2EJGC 4IALA 4DXGA 4A3FH 1D5ZC 2BE5C 4BBSH 3MAQA 4OX9Q 3PO3G 3VR5A 3PF4A 5CV7A 3J7YW 1B50A 1AE3A 1G6ZA 5I6YA 5IP7H 5M5XH 2K5VA 1N8RC 3GTMH 2BH8A 1KNAA 2NVYB 4A3BH 1S5ED 2XIWA 2XWBB 1SBBB 3U9OA 4X64L 3GDEA 1E24A 1BCPC 1K83H 1O80A 3TN2A 1L0XB 1HTLD 2BDOA 2Y0SB 1M4VA 4KY5A 3GTGH 2N78A 1IYJB 4CHTB 1HQMC 4L5QA 1YNND 2F0NA 5DM63 4JOIA 4DR4Q 3TP5A 5KNBA 5C4ZA 1VQAA 1TWAH 2KA7A 2JP1A 4YY3Q 4R8IA 2F4VL 2K5HA 3PMFA 1XPRA 3NUCA 1PXUA 4A3KB 4NMZA 4C2MB 4JI8L 1EEID 5GAEC 1WCMB 3R2TA 1Q90A 4CJ0B 1DD2A 4R1JA 2QKIC 1H9MA 1IYUA 2R7FA 1LTID 5DLQE 3K0XA 3ZJYC 3HOWH 3S17H 1JOQA 3DM1A 1LLRD 5IGDA 4WJ4A 3TP6A 1SXTA 2CKZB 2PZWA 3GTKB 4DR7Q 4XTCS 3M4QA 4LUOA 5ELBA 1F9PA 1XMQL 4P71A 1SE3A 3T1HL 1KDCA 3U4ZA 1LTGD 4JI4Q 1HFGA 2H1EA 1PH2A 1P16A 4XT1B 1EL0A 3STBD 3CCSA 3PIOA 1OXVA 3CQZB 2D62A 1GM5A 4MZ9A 3K57A 2R93H 2CFMA 3CU7A 3S24A 3H0GB 2Q2HA 1LT5D 2X6GA 3K58A 3GTJH 5FLXc 4A3DG 3OW7A 3S9WA 1F9RA 3G48A 1EYAA 5JJKA 1AN8A 3D4DA 2UUAQ 1C4QA 2KEDA 3TP8A 1G2TA 4C3HB 1LV9A 4ZKCB 4KY7A 3UDGA 4DUZL 4RHRA 1N34Q 1XPOA 3J7A5 1K3RA 1JCKB 1YHQA 1KRTA 1R4PB 2K28A 4J8QA 1SFOH 4IUTA 4DA2A 2R92H 4U673 3CCQA 3AEVA 3CXCA 3HS0C 3PCOB 1B8AA 1MJEA 5C3WA 3NEMA 2CVRA 3S14H 1WFQA 3J81E 4NXNL 5IY0A 2R3ZA 4DV1Q 4BBRB 2UXBQ 5T1GA 2A73B 4GOPB 2V4DA 1JWMD 3BZKA 1SNDA 1YNJD 2EXZA 3R3OA 1VQOA 1UUPA 2L4NA 1R9TB 4ZCKA 4YHHQ 5M3FB 1LYLA 1PTOD 1PRTB 4QUFA 5C44G 2F0MA 5KGUA 5LMNL 4RFBA 1I4HA 2HIXA 2KVMA 4HAEA 4DR2Q 2F0JA 3BU2A 2KQ3A 4B3MQ 5IGCA 1VCIA 2NTSA 3E5SA 4CJ2C 1JE5A 5J22A 2A69C 1QUQB 5CV9A 3HOUB 2E2DC 1A3TA 3C46A 4WORA 1MD2D 5HGQA 3F2UA 4A3GB 1TWHB 4FVMA 3L2PA 3GTQH 1QVCA 2F0GA 4OHJA 3H15A 3D6CA 4QGUA 1VQ7A 3A54A 3OTOQ 2QEXA 2B2TC 1RL2A 4N9TA 3J81c 1ICWA 3FMCA 1VMCA 5FO8B 2B8GA 3J80E 1HZAA 3KYHC 2UXDL 3J81i 3EIVA 3GD7A 2JA9A 5FO9B 3T56B 1B44D 4BA1I 1G6PA 1JT8A 3VYTA 1YJ9A 1X65A 3RN5A 2A19A 2WB1G 3T13A 1HR0Q 1I3QB 3D6WA 2HHHQ 4EQOA 2JEBI 1WTHA 5ISRA 4IFDH 1STGA 3A74A 2IL8A 3SXHA 2OF1A 3DEPA 3I4NH 2ZJPA 3L3OC 1PH8A 2HUGA 2AQ3B 2EE1A 4FO2A 3VYUA 1KTKA 4TQUS 1L1OB 2JA6H 2NB0A 4C3JB 1PH1A 1ML0D 2ZT9C 4JI6L 3JAML 4UY8C 5C4HA 1LTTD 3NWSA 1KAWA 2Z6BA 4P75A 3FEWX 3KBXA 4K8JA 2UXCQ 4DV3L 1Q46A 4TVAB 4N8FA 3J80c 1EY4A 4GKKL 1BKBA 1MHWC 4A3MG 3CF5A 1XMOL 3J80i 4POFA 3M3YH 2BH2A 4DR3L 3OIQA 4V0BA 2WP8J 2IT1A 2JA5B 1PZKD 4CDFC 1YI2A 2A68D 4KKSA 3U58A 2R61A 4A3EB 4JW0A 2YTYA 1IW7C 3AB9A 4N8X1 2MO0A 3GTLB 3T51B 2R7ZG 2F3VA 3MHBA 1A3UA 2LXKA 1WTOA 1HNZQ 2WFWA 4KV6A 2K33A 4ZYSA 1TWFB 4DNRB 4IFDI 3VR4A 2J7ZA 4X65Q 2UU9L 2NN6I 3S2HB 2GN5A 4GOPA 3I4MG 1CHQD 1RCVD 1BBWA 2A5HA 4A3JB 1GUSA 2F1MA 4POGA 1T5EA 2Z4HA 4RH6A 1HZBA 2PW5A 3D8GA 1X9NA 4H0LC 1XNQL 1DZ1A 3SE0A 2QA4A 4GNXC 2JJQA 1KABA 1FJGQ 1A3VA 1KRSA 1Y1VG 3OPOA 2Q2UA 4JCVE 3HKZG 2KCCA 4A3FB 4JI8Q 4BBSB 3MTSA 4JI0Q 1VF5C 1EWIA 2B2WC 4DFAA 4JI5Q 2V1CC 4P2CB 4K5XA 1B9NA 2K50A 4OGQC 5I9PA 4PZ8A 4HR7B 5M5XB 1PMRA 1Z9FA 4K8IA 3GTMB 2Q2TA 2H4OA 1WTWA 2CQAA 2QILA 4A3BB 1BO0A 4K5VA 4R8NA 4YCUA 1X6OA 3EVQA 3DWQA 4UAIA 4FYDA 2VUMB 3I70A 2NVQH 1JORA 2EDGA 3BDLA 2PZUA 2B63G 1NCVA 2JA7G 1BUVT 2F0WA 5KNDA 4DPGA 4NW2A 3GTGB 2L5TA 3CC7A 4DAYA 2KENA 4BWGB 3OMGA 5IP9G 1K9MC 1PRTF 4HJ7A 2XTIA 3OWEB 5KNCA 5FLMG 5M9OA 3UE0A 3CW2C 1SMYC 3G6EA 1TWAB 2DJGC 2LY7A 3UI2A 1CSPA 4DV0Q 2RSNA 3HOZG 5CV5A 1IHZA 4IUQA 5BR8L 1N33L 5IYDH 4CDEC 5LHY1 4C1NK 1K3BC 1TS2A 2EYLA 3VR6A 1I50H 3HOWB 3S17B 3DXJC 2WAQB 3BJUA 1T5XD 2K5DA 4MN3A 2K75A 3CD6A 1Q3LA 2ZM6Q 1LT6D 1SNMA 1JMCA 4APVA 1GKHA 3K80C 1HFNA 2YV5A 3K7UC 1TWCH 4OXPA 3PF5A 4XYOA 4RG1A 3CCLA 2R7DA 3IL8A 1X3EA 2KCMA 2VL6A 1NR2A 3E9HA 1IBKQ 4AQYL 1JOKA 5K36G 4R4QA 4LF9Q 1MKHA 4A3IH 2FFKB 2R93B 2PQEA 4JI1Q 2M2LA 4AYBE 1F9SA 1M1KC 2GA4B 2O4XA 3GTJB 1Y69U 3S1QH 4OONA 1GD7A 1SYFA 3QIAA 1YBYA 3NWTA 1AZQA 3TS2A 1KAAA 1BCPB 5IYBG 4ODGA 3I55A 1J8IA 1WOCA 2JXMB 3J7ZC 4RKLA 1BDOA 1D8LA 3G6JB 2JA8G 5C5LA 3NP8A 4FF1A 4DR5L 3RN2A 4A3LG 1SFOB 2VZAA 1PH6A 3K5LA 2R92B
chains in the Genus database with same CATH topology
1UE6A 1IBKL 2N8NA 4FDBA 1KXLA 3L0OA 2ZTDA 1HNXL 4KHPQ 4LF9L 2AWOA 2F4VQ 5C4XG 2IX0A 1VQIA 4A3CH 4QL5A 2EIFA 4KLKA 4DNIA 4LFBQ 3K8AA 4L5TA 3EBEA 1VQ4A 4A3FH 1SRUA 4JI1L 1AH9A 4A76A 4BBSH 1CKMA 4OX9Q 3PO3G 5ELOA 2D0OA 1PH3A 3PF4A 1J5EL 1XNRQ 3W1GA 1AE3A 2D0PA 1HZCA 3F1ZA 5IP7H 3GTOH 2H5XA 5M5XH 2JA5G 2K5VA 4A3IG 1N8RC 3GTMH 2BH8A 3T1YQ 1QUQA 1SN8A 4GLAC 3UDIA 1YITA 1IBMQ 1YHAA 4A3BH 4A3EG 4JBKA 3CAMA 1PA6A 1HJPA 1PH4A 3RZDH 4WJ3M 2E2HH 4X64L 1XMQQ 1B70B 1PYBA 3GDEA 1PH5A 1E24A 3F8TA 4X66L 4EX5A 2RHSB 3T1HQ 4OO1G 1VQCA 1K83H 1E3PA 2ATWA 4H02A 4RMFA 1JJCB 2F52A 3STBC 4DV7L 1IXRA 4O2DA 4JV5Q 4OO1I 4BY1H 3GTGH 4A3DH 2N78A 1IYJB 1Q8KA 4L5QA 1BVSA 1UEBA 4K0KL 4L5SA 3S15H 4LF8Q 3KF8B 1W2BA 4JOIA 4JI6Q 4DR4Q 1PH9A 4KHPL 1KHIA 1VQAA 3KLWA 1TWAH 1EUJA 3F2CA 1Q1EA 5FJ8H 4YY3Q 1FVIA 4A3JG 1C9OA 4DK6C 2F4VL 4IOAA 4UP8A 4LFBL 2K5HA 3MXNB 4A93G 3FP9A 2NVXH 4GLVB 1XPRA 1S40A 2AKWB 4DAYB 1SR3A 1D7QA 1KL9A 3PF5A 1MIUA 4JI8L 5GAEC 1M90C 4GN4B 4R1JA 2ALYB 3PUVA 4DV2Q 1E7ZA 2R6GA 3PGZA 1XMOQ 4A3CG 2R7FA 5DLQE 3ZJYC 3K0XA 1L2FA 3CPFA 4P73A 4DAMA 4DUZQ 3T1YL 3HOWH 4A3FG 4DR3Q 3S17H 1PV4A 1IBML 4BBSG 1JB7A 4B3RQ 4WJ4A 2CKZB 5M3MH 3S1RH 4DR7Q 4XTCS 3M4QA 4LUOA 1XMQL 5IP7G 1L1OA 2MFIA 3PUWA 3CCEA 4P71A 3T1HL 3S2DH 2QGQA 3HKSA 3U4ZA 1Y1WH 3S16H 3RLNA 4JI4Q 2AWNA 1V43A 2LSSA 1KQSA 3RZOH 5JJLA 4A3BG 4JV5L 2Q2IA 4UP9A 3AQQA 2KHIA 1PH2A 4DR1Q 1P16A 1L0WA 4NXNQ 2KCTA 3I7FA 3STBD 3CCSA 1I6HH 3PIOA 1NTGA 4UP7A 1OXVA 2D62A 1OTCA 1GM5A 1U5KA 4MZ9A 4LF4Q 2BA1A 4LF8L 2R93H 2K52A 5C44H 2CFMA 3OYYA 4C3IH 4BXXH 4DR4L 1VQ9A 3PO2H 3S24A 4LWCA 3CCUA 2Q2HA 3GTJH 4YY3L 4BY1G 5FLXc 2RCNA 4A3DG 4B3TL 1I94Q 3G48A 4L5RC 3RR5A 1HH2P 1X54A 2VY3A 5JJKA 1IBLQ 4HJ9A 5C3EH 5LMNQ 2ZTEA 2UUAQ 2IHFA 4HIKA 4GN5A 1YJNA 4GKJQ 5FJ8G 4DV2L 4IO9A 1S72A 4IFDI 5JJIA 1C7YA 3UDGA 4DUZL 1VQ5A 1CKNB 2YYZA 1N34Q 1XPOA 1EOVA 1VQMA 4B3RL 2HT1A 3J7A5 1K3RA 1YHQA 1KRTA 3E0EA 5M5WH 2WAQE 2PQAB 4DR7L 1QZHA 3KF6B 1SFOH 2ES2A 4R4OA 3PIPA 1PFSA 4JI7Q 2R92H 3HOWG 2E5LQ 2OQKA 4JI4L 3CCQA 3KJPA 3AEVA 1X3GA 2WAQG 3PCOB 3CXCA 1B8AA 4OWXB 1MJEA 3NEMA 2NZHA 3S14H 4PG3A 1WFQA 4LUVA 4NXNL 5IY0A 5M3MG 4DV1Q 5GAGC 5AJ3L 1NJIC 2UXBQ 3ERSX 1IZ6A 2NN6G 4R4TA 1VQJA 3CCMA 4GOPB 1Y1WG 1E1TA 4LF4L 3BZKA 1UE5A 1VQOA 2MNAA 3TS0A 1PH7A 2UXDQ 1S3OA 1QVGA 1N9WA 1EFWA 4QIWE 2PI2A 3ER0A 1N32L 4YHHQ 1I94L 2B29A 1VS0A 1LYLA 3CMAA 2NVYH 1IBLL 2R93G 5C44G 4PZ7A 5LMNL 4LF5L 4BXXG 2UUAL 1HNWQ 3PO2G 4B3SQ 2HIXA 2IHEA 3S1MH 3TREA 3G71A 4DR2Q 3AFQA 3BU2A 2HQLA 1Q81C 4B3MQ 1N34L 1VCIA 2VUMH 2DGYA 1K8AC 3WWVA 1VQ6A 5C3EG 1VQFA 3KFUA 1JE5A 1QUQB 3CP0A 3K7AH 3U4VA 2GVBA 3W1BA 4ALPA 1WI5A 3CC4A 4JI7L 4HJAA 1C0AA 5HGQA 2UUCQ 4AIMA 1LUZA 2MO1A 3DLLA 3L2PA 3GTQH 1QVCA 4IJHA 3H15A 4QGUA 1VQ7A 4DV1L 1N36Q 4LW1A 2Z6KC 4R4CA 4IPCA 2E2IH 3OTOQ 2PI2E 1YNXA 2QEXA 2UXBL 4JC0A 2F3IA 4YCVA 2NVTH 1RL2A 2R92G 4JI2Q 3D31A 3J81c 4A3MH 4Y52H 3JAMc 4JI3Q 2YTXA 4A3KH 1HZAA 3KYHC 2UXDL 4C2MH 1HR0W 3M7NA 2DUDA 4O0AA 3J81i 3JAMi 1WCMH 3EIVA 3GD7A 4NB3A 4DV3Q 4A75A 4GOPC 4OX9L 4QJFA 3ICEA 5LMUQ 2JA9A 2OQ0A 4AH6A 1XNRL 3JC66 1A8VA 4AQYQ 1EIYB 4IPHA 4BA1I 1NE3A 4GKKQ 1QVFA 4OWWB 1G6PA 4LF7Q 1JT8A 1SLJA 1E22A 1Q82C 1BBUA 1NY4A 1OXXK 1YJ9A 1T9HA 1X65A 2JA8H 4B3SL 3RN5A 3GTKH 4DR2L 4R4IA 4LFCQ 2A19A 2WB1G 1JJ2A 1HR0Q 4B3ML 2MQHA 2HHHQ 2A8VA 2R7ZH 2JEBI 1VQDA 3CC2A 4IPGA 1X3FA 3M4OH 3A74A 3KDFB 2RHQB 5IYCH 3I4NH 1JJGA 2ZJPA 2EQSA 1PH8A 1YIJA 3A5ZB 5M5YH 2IX1A 2Y0SE 3F2DA 3CQZH 3RNUA 1EQQA 2UUCL 1VQBA 2VUMG 4Y7NH 4TQUS 4EQ5A 3GO5A 1L1OB 2JA6H 3I4MH 1VQPA 3H0GH 1PH1A 1N36L 2Y0SG 4JI6L 3OTOL 4PZ6A 4DUYQ 4DV6Q 3KOJA 2UU9Q 4UY8C 3NBHB 1EQRA 4BY7H 2KHJA 4DV5Q 4JI2L 4JI3L 1KAWA 4P75A 3ULPA 3BZCA 5ELNA 4X62Q 4DV3L 1EYGA 1XPUA 3HOYH 2UXCQ 1Q46A 4TVAB 1Y1VH 4LFAQ 4C3HH 2EXDA 5GAHC 5LMUL 4GNXB 3J80c 2XGTA 5C4JH 1GO3E 3PSIA 2HIVA 2VS1A 4GKKL 1BKBA 2AHOB 1XNQQ 5IE8A 2VQEQ 3CF5A 3J80i 3M4PA 4A3MG 1XMOL 4POFA 4LF7L 4JOIC 4A3KG 4JBWA 3M3YH 2IY5B 2BH2A 4DR3L 3W5OA 1K73C 1WCMG 2OWOA 1PYSB 1UE1A 3M9BA 4LFCL 3S1NH 2WP8J 2IT1A 3I56A 2L15A 1E1OA 3PV0A 1YI2A 1CKNA 1UWVA 3U58A 4JG2A 2OTJA 2YTYA 3A0JA 3HOVH 5JEAG 2MO0A 3B6YA 1X56A 2JE6I 4AYBG 2AMCB 2E2JH 4NPSA 2PQAA 4BBRH 2CQOA 4JYAQ 4DR1L 3KF6A 1WJJA 2R7ZG 1YEZA 2LXKA 2PMZE 3U50C 2Z6KA 1HNZQ 2WFWA 2B63H 2JA7H 4IFDG 3F2BA 1HZ9A 1TWGH 1LTLA 3PUYA 3RLOA 1PVOA 2UU9L 5IYCG 1R9TH 4X66Q 3FHWA 3I4NG 4DUYL 5IP9H 1L1OC 4X65Q 4LUZA 3EN2A 2NN6I 1YVCA 2OCEA 2PNHA 5GADC 3G4SA 2VQFQ 5M3FH 3H3VH 2I5HA 1SROA 1TXYA 1IL2A 1VQHA 2GN5A 3OW2A 5FLMH 4GOPA 1CKOA 5J3BA 2JA6G 2B3GA 3I4MG 4A93H 1BBWA 3E9IA 5IT9c 4X62L 3H0GG 2UXCL 4GLXA 2VW9A 4LFAL 1DGSA 4POGA 1SMXA 1G51A 1P8LA 1HZBA 1YZ6A 4DK3C 3HOZH 4GKJL 3HOXH 1X9NA 1XNQL 3NELA 4BY7G 2VQEL 3TQYA 3HKZE 2QA4A 4GNXC 2I5MX 2JJQA 1Q1BA 4DKAC 1FJGQ 1KRSA 4HIMA 2OTLA 3HOUH 2K5NA 3HOYG 3PUXA 2YTVA 4JBJA 5E7NA 2CCZA 1Y1VG 4LF6Q 2Q2UA 5HY6A 4HJ5A 4JCVE 3HKZG 1ASYA 1Q86C 4JBMA 4JI8Q 1KIXA 4A3GH 1TWHH 1Q12A 3PUZA 1Q7YC 4JI0Q 5BR8Q 1N33Q 1EWIA 2E5LL 3I4OA 5GROA 4JI5Q 2V1CC 2K50A 4MNOA 4PZ8A 1X55A 4YWMA 2I0QA 4JYAL 1OXSC 1Z9FA 2Q2TA 3CPWA 1HNZL 3L7ZC 1A62A 5C0XG 1XTDA 3HOVG 4NXMQ 4YCUA 1X6OA 3KJOA 1YJWA 4X65L 2RF4A 4A4IA 5C0XI 4BBRG 5IWAQ 2VQFL 3RLFA 2NVQH 4HIDA 3LGJA 1QZGA 3GTPH 4YHHL 3UE1A 4YWKA 2YU9H 2B63G 2K4KA 2JA7G 2A1AA 2WB1E 4DPGA 3IRBA 1HNWL 3CC7A 2ZJRA 2KENA 5JEAJ 2UUBQ 1UE7A 1W3SA 1CSQA 1K0RA 5IP9G 4DV4Q 2JK8A 2JQOA 4HJ7A 1K9MC 1I3QH 5M3FG 1FGUA 4YWLA 1I5FA 2N3SA 2XTIA 2ZJQA 5FLMG 3J81j 3H3VI 1FJGL 2FXQA 3UE0A 3CW2C 3G6EA 4B3TQ 5IYBH 4QQBX 4IFDJ 1XJVA 4LF6L 1CSPA 4DV0Q 4DR6Q 1VQNA 1KD1C 3HOZG 3K81C 4IJLA 3HOXG 3MEFA 1EIFA 5H1SE 2JEAI 1VQ8A 2BA0A 1VQGA 4XIGS 3TEHB 3CCRA 4JI0L 5BR8L 4MTNA 4HJ8A 1N33L 3AYHB 3D0FA 3I2ZA 4JI5L 5IYDH 3FKIH 4C3JH 1FL0A 1LM0A 3SGIA 3HOUG 4A3LH 3KDFA 1I50H 4BA2I 4HIOA 1NMGA 4YCWA 1B7YB 4P74A 2LXJA 3HFZB 4A3GG 2ZTCA 4QY7A 3BJUA 2ASBA 2K75A 1VQKA 3CD6A 4NXML 4PMWA 2K14A 4J15A 1V1QA 2ZM6Q 4DR5Q 1JMCA 5C4XH 1ASZA 3TRZA 4APVA 1GKHA 1Y14B 3K80C 5IWAL 3UDFA 2YV5A 3K7UC 1TWCH 2E8GA 4OXPA 1A0IA 4RG1A 5GQOA 3CMEA 3CCVA 3CCLA 2R7DA 1X3EA 3AFPA 3ULJA 1Z47A 1G291 2KCMA 2VL6A 3E9HA 3A5UA 1IBKQ 4OWTB 5LMNW 4AQYL 1K8GA 1AE2A 1OXTA 5AJ3Q 3PO3H 5K36G 4GS3A 4R4QA 5EAYA 1HNXQ 4GN3B 1RIPA 2CWAA 2UUBL 4DV4L 4LF9Q 2JA5H 1MKHA 1H95A 4A3IH 1YHBA 4GNXA 1VQLA 2GVAA 4JI1Q 1HR0L 4AYBE 1M1KC 4KHZA 1VQEA 1O7IA 1MJCA 2NZOA 4A3EH 2HHHL 1J6QA 2KBNA 1N32Q 2C35B 5C0XJ 3S1QH 1J5EQ 3M85A 2CWPA 1NMFA 2I5LX 3DM3A 4DV0L 2ID0A 3GTLH 4OONA 4IPDA 1GVPA 4DR6L 3UDXA 1GD7A 2N49A 4X6AH 4LF5Q 3VDYA 1YBYA 3Q8DA 1CUKA 1NBWA 4KI0A 3TS2A 1TWFH 5IYBG 3I55A 1WOCA 3NENA 4P72A 4X64Q 3S2HH 3J7ZC 3ULLA 4UPAA 4DV6L 1D8LA 2JA8G 1OXUA 2VNUD 4DV5L 5IYDG 4IOCA 4DV7Q 3FKIG 2ZM6L 1KC8C 1A63A 4DR5L 3RN2A 4A3JH 4A3LG 1SE8A 4LNQA 1PHJA 2VZAA 2Z0SA 1PH6A 1WYDA 3CCJA 4ME3A 1U0LA 4K0KQ 1V9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE6 A;  1IBK L;  2N8N A;  4FDB A;  1KXL A;  3L0O A;  2ZTD A;  1HNX L;  4KHP Q;  4LF9 L;  2AWO A;  2F4V Q;  5C4X G;  2IX0 A;  1VQI A;  4A3C H;  4QL5 A;  2EIF A;  4KLK A;  4DNI A;  4LFB Q;  3K8A A;  4L5T A;  3EBE A;  1VQ4 A;  4A3F H;  1SRU A;  4JI1 L;  1AH9 A;  4A76 A;  4BBS H;  1CKM A;  4OX9 Q;  3PO3 G;  5ELO A;  2D0O A;  1PH3 A;  3PF4 A;  1J5E L;  1XNR Q;  3W1G A;  1AE3 A;  2D0P A;  1HZC A;  3F1Z A;  5IP7 H;  3GTO H;  2H5X A;  5M5X H;  2JA5 G;  2K5V A;  4A3I G;  1N8R C;  3GTM H;  2BH8 A;  3T1Y Q;  1QUQ A;  1SN8 A;  4GLA C;  3UDI A;  1YIT A;  1IBM Q;  1YHA A;  4A3B H;  4A3E G;  4JBK A;  3CAM A;  1PA6 A;  1HJP A;  1PH4 A;  3RZD H;  4WJ3 M;  2E2H H;  4X64 L;  1XMQ Q;  1B70 B;  1PYB A;  3GDE A;  1PH5 A;  1E24 A;  3F8T A;  4X66 L;  4EX5 A;  2RHS B;  3T1H Q;  4OO1 G;  1VQC A;  1K83 H;  1E3P A;  2ATW A;  4H02 A;  4RMF A;  1JJC B;  2F52 A;  3STB C;  4DV7 L;  1IXR A;  4O2D A;  4JV5 Q;  4OO1 I;  4BY1 H;  3GTG H;  4A3D H;  2N78 A;  1IYJ B;  1Q8K A;  4L5Q A;  1BVS A;  1UEB A;  4K0K L;  4L5S A;  3S15 H;  4LF8 Q;  3KF8 B;  1W2B A;  4JOI A;  4JI6 Q;  4DR4 Q;  1PH9 A;  4KHP L;  1KHI A;  1VQA A;  3KLW A;  1TWA H;  1EUJ A;  3F2C A;  1Q1E A;  5FJ8 H;  4YY3 Q;  1FVI A;  4A3J G;  1C9O A;  4DK6 C;  2F4V L;  4IOA A;  4UP8 A;  4LFB L;  2K5H A;  3MXN B;  4A93 G;  3FP9 A;  2NVX H;  4GLV B;  1XPR A;  1S40 A;  2AKW B;  4DAY B;  1SR3 A;  1D7Q A;  1KL9 A;  3PF5 A;  1MIU A;  4JI8 L;  5GAE C;  1M90 C;  4GN4 B;  4R1J A;  2ALY B;  3PUV A;  4DV2 Q;  1E7Z A;  2R6G A;  3PGZ A;  1XMO Q;  4A3C G;  2R7F A;  5DLQ E;  3ZJY C;  3K0X A;  1L2F A;  3CPF A;  4P73 A;  4DAM A;  4DUZ Q;  3T1Y L;  3HOW H;  4A3F G;  4DR3 Q;  3S17 H;  1PV4 A;  1IBM L;  4BBS G;  1JB7 A;  4B3R Q;  4WJ4 A;  2CKZ B;  5M3M H;  3S1R H;  4DR7 Q;  4XTC S;  3M4Q A;  4LUO A;  1XMQ L;  5IP7 G;  1L1O A;  2MFI A;  3PUW A;  3CCE A;  4P71 A;  3T1H L;  3S2D H;  2QGQ A;  3HKS A;  3U4Z A;  1Y1W H;  3S16 H;  3RLN A;  4JI4 Q;  2AWN A;  1V43 A;  2LSS A;  1KQS A;  3RZO H;  5JJL A;  4A3B G;  4JV5 L;  2Q2I A;  4UP9 A;  3AQQ A;  2KHI A;  1PH2 A;  4DR1 Q;  1P16 A;  1L0W A;  4NXN Q;  2KCT A;  3I7F A;  3STB D;  3CCS A;  1I6H H;  3PIO A;  1NTG A;  4UP7 A;  1OXV A;  2D62 A;  1OTC A;  1GM5 A;  1U5K A;  4MZ9 A;  4LF4 Q;  2BA1 A;  4LF8 L;  2R93 H;  2K52 A;  5C44 H;  2CFM A;  3OYY A;  4C3I H;  4BXX H;  4DR4 L;  1VQ9 A;  3PO2 H;  3S24 A;  4LWC A;  3CCU A;  2Q2H A;  3GTJ H;  4YY3 L;  4BY1 G;  5FLX c;  2RCN A;  4A3D G;  4B3T L;  1I94 Q;  3G48 A;  4L5R C;  3RR5 A;  1HH2 P;  1X54 A;  2VY3 A;  5JJK A;  1IBL Q;  4HJ9 A;  5C3E H;  5LMN Q;  2ZTE A;  2UUA Q;  2IHF A;  4HIK A;  4GN5 A;  1YJN A;  4GKJ Q;  5FJ8 G;  4DV2 L;  4IO9 A;  1S72 A;  4IFD I;  5JJI A;  1C7Y A;  3UDG A;  4DUZ L;  1VQ5 A;  1CKN B;  2YYZ A;  1N34 Q;  1XPO A;  1EOV A;  1VQM A;  4B3R L;  2HT1 A;  3J7A 5;  1K3R A;  1YHQ A;  1KRT A;  3E0E A;  5M5W H;  2WAQ E;  2PQA B;  4DR7 L;  1QZH A;  3KF6 B;  1SFO H;  2ES2 A;  4R4O A;  3PIP A;  1PFS A;  4JI7 Q;  2R92 H;  3HOW G;  2E5L Q;  2OQK A;  4JI4 L;  3CCQ A;  3KJP A;  3AEV A;  1X3G A;  2WAQ G;  3PCO B;  3CXC A;  1B8A A;  4OWX B;  1MJE A;  3NEM A;  2NZH A;  3S14 H;  4PG3 A;  1WFQ A;  4LUV A;  4NXN L;  5IY0 A;  5M3M G;  4DV1 Q;  5GAG C;  5AJ3 L;  1NJI C;  2UXB Q;  3ERS X;  1IZ6 A;  2NN6 G;  4R4T A;  1VQJ A;  3CCM A;  4GOP B;  1Y1W G;  1E1T A;  4LF4 L;  3BZK A;  1UE5 A;  1VQO A;  2MNA A;  3TS0 A;  1PH7 A;  2UXD Q;  1S3O A;  1QVG A;  1N9W A;  1EFW A;  4QIW E;  2PI2 A;  3ER0 A;  1N32 L;  4YHH Q;  1I94 L;  2B29 A;  1VS0 A;  1LYL A;  3CMA A;  2NVY H;  1IBL L;  2R93 G;  5C44 G;  4PZ7 A;  5LMN L;  4LF5 L;  4BXX G;  2UUA L;  1HNW Q;  3PO2 G;  4B3S Q;  2HIX A;  2IHE A;  3S1M H;  3TRE A;  3G71 A;  4DR2 Q;  3AFQ A;  3BU2 A;  2HQL A;  1Q81 C;  4B3M Q;  1N34 L;  1VCI A;  2VUM H;  2DGY A;  1K8A C;  3WWV A;  1VQ6 A;  5C3E G;  1VQF A;  3KFU A;  1JE5 A;  1QUQ B;  3CP0 A;  3K7A H;  3U4V A;  2GVB A;  3W1B A;  4ALP A;  1WI5 A;  3CC4 A;  4JI7 L;  4HJA A;  1C0A A;  5HGQ A;  2UUC Q;  4AIM A;  1LUZ A;  2MO1 A;  3DLL A;  3L2P A;  3GTQ H;  1QVC A;  4IJH A;  3H15 A;  4QGU A;  1VQ7 A;  4DV1 L;  1N36 Q;  4LW1 A;  2Z6K C;  4R4C A;  4IPC A;  2E2I H;  3OTO Q;  2PI2 E;  1YNX A;  2QEX A;  2UXB L;  4JC0 A;  2F3I A;  4YCV A;  2NVT H;  1RL2 A;  2R92 G;  4JI2 Q;  3D31 A;  3J81 c;  4A3M H;  4Y52 H;  3JAM c;  4JI3 Q;  2YTX A;  4A3K H;  1HZA A;  3KYH C;  2UXD L;  4C2M H;  1HR0 W;  3M7N A;  2DUD A;  4O0A A;  3J81 i;  3JAM i;  1WCM H;  3EIV A;  3GD7 A;  4NB3 A;  4DV3 Q;  4A75 A;  4GOP C;  4OX9 L;  4QJF A;  3ICE A;  5LMU Q;  2JA9 A;  2OQ0 A;  4AH6 A;  1XNR L;  3JC6 6;  1A8V A;  4AQY Q;  1EIY B;  4IPH A;  4BA1 I;  1NE3 A;  4GKK Q;  1QVF A;  4OWW B;  1G6P A;  4LF7 Q;  1JT8 A;  1SLJ A;  1E22 A;  1Q82 C;  1BBU A;  1NY4 A;  1OXX K;  1YJ9 A;  1T9H A;  1X65 A;  2JA8 H;  4B3S L;  3RN5 A;  3GTK H;  4DR2 L;  4R4I A;  4LFC Q;  2A19 A;  2WB1 G;  1JJ2 A;  1HR0 Q;  4B3M L;  2MQH A;  2HHH Q;  2A8V A;  2R7Z H;  2JEB I;  1VQD A;  3CC2 A;  4IPG A;  1X3F A;  3M4O H;  3A74 A;  3KDF B;  2RHQ B;  5IYC H;  3I4N H;  1JJG A;  2ZJP A;  2EQS A;  1PH8 A;  1YIJ A;  3A5Z B;  5M5Y H;  2IX1 A;  2Y0S E;  3F2D A;  3CQZ H;  3RNU A;  1EQQ A;  2UUC L;  1VQB A;  2VUM G;  4Y7N H;  4TQU S;  4EQ5 A;  3GO5 A;  1L1O B;  2JA6 H;  3I4M H;  1VQP A;  3H0G H;  1PH1 A;  1N36 L;  2Y0S G;  4JI6 L;  3OTO L;  4PZ6 A;  4DUY Q;  4DV6 Q;  3KOJ A;  2UU9 Q;  4UY8 C;  3NBH B;  1EQR A;  4BY7 H;  2KHJ A;  4DV5 Q;  4JI2 L;  4JI3 L;  1KAW A;  4P75 A;  3ULP A;  3BZC A;  5ELN A;  4X62 Q;  4DV3 L;  1EYG A;  1XPU A;  3HOY H;  2UXC Q;  1Q46 A;  4TVA B;  1Y1V H;  4LFA Q;  4C3H H;  2EXD A;  5GAH C;  5LMU L;  4GNX B;  3J80 c;  2XGT A;  5C4J H;  1GO3 E;  3PSI A;  2HIV A;  2VS1 A;  4GKK L;  1BKB A;  2AHO B;  1XNQ Q;  5IE8 A;  2VQE Q;  3CF5 A;  3J80 i;  3M4P A;  4A3M G;  1XMO L;  4POF A;  4LF7 L;  4JOI C;  4A3K G;  4JBW A;  3M3Y H;  2IY5 B;  2BH2 A;  4DR3 L;  3W5O A;  1K73 C;  1WCM G;  2OWO A;  1PYS B;  1UE1 A;  3M9B A;  4LFC L;  3S1N H;  2WP8 J;  2IT1 A;  3I56 A;  2L15 A;  1E1O A;  3PV0 A;  1YI2 A;  1CKN A;  1UWV A;  3U58 A;  4JG2 A;  2OTJ A;  2YTY A;  3A0J A;  3HOV H;  5JEA G;  2MO0 A;  3B6Y A;  1X56 A;  2JE6 I;  4AYB G;  2AMC B;  2E2J H;  4NPS A;  2PQA A;  4BBR H;  2CQO A;  4JYA Q;  4DR1 L;  3KF6 A;  1WJJ A;  2R7Z G;  1YEZ A;  2LXK A;  2PMZ E;  3U50 C;  2Z6K A;  1HNZ Q;  2WFW A;  2B63 H;  2JA7 H;  4IFD G;  3F2B A;  1HZ9 A;  1TWG H;  1LTL A;  3PUY A;  3RLO A;  1PVO A;  2UU9 L;  5IYC G;  1R9T H;  4X66 Q;  3FHW A;  3I4N G;  4DUY L;  5IP9 H;  1L1O C;  4X65 Q;  4LUZ A;  3EN2 A;  2NN6 I;  1YVC A;  2OCE A;  2PNH A;  5GAD C;  3G4S A;  2VQF Q;  5M3F H;  3H3V H;  2I5H A;  1SRO A;  1TXY A;  1IL2 A;  1VQH A;  2GN5 A;  3OW2 A;  5FLM H;  4GOP A;  1CKO A;  5J3B A;  2JA6 G;  2B3G A;  3I4M G;  4A93 H;  1BBW A;  3E9I A;  5IT9 c;  4X62 L;  3H0G G;  2UXC L;  4GLX A;  2VW9 A;  4LFA L;  1DGS A;  4POG A;  1SMX A;  1G51 A;  1P8L A;  1HZB A;  1YZ6 A;  4DK3 C;  3HOZ H;  4GKJ L;  3HOX H;  1X9N A;  1XNQ L;  3NEL A;  4BY7 G;  2VQE L;  3TQY A;  3HKZ E;  2QA4 A;  4GNX C;  2I5M X;  2JJQ A;  1Q1B A;  4DKA C;  1FJG Q;  1KRS A;  4HIM A;  2OTL A;  3HOU H;  2K5N A;  3HOY G;  3PUX A;  2YTV A;  4JBJ A;  5E7N A;  2CCZ A;  1Y1V G;  4LF6 Q;  2Q2U A;  5HY6 A;  4HJ5 A;  4JCV E;  3HKZ G;  1ASY A;  1Q86 C;  4JBM A;  4JI8 Q;  1KIX A;  4A3G H;  1TWH H;  1Q12 A;  3PUZ A;  1Q7Y C;  4JI0 Q;  5BR8 Q;  1N33 Q;  1EWI A;  2E5L L;  3I4O A;  5GRO A;  4JI5 Q;  2V1C C;  2K50 A;  4MNO A;  4PZ8 A;  1X55 A;  4YWM A;  2I0Q A;  4JYA L;  1OXS C;  1Z9F A;  2Q2T A;  3CPW A;  1HNZ L;  3L7Z C;  1A62 A;  5C0X G;  1XTD A;  3HOV G;  4NXM Q;  4YCU A;  1X6O A;  3KJO A;  1YJW A;  4X65 L;  2RF4 A;  4A4I A;  5C0X I;  4BBR G;  5IWA Q;  2VQF L;  3RLF A;  2NVQ H;  4HID A;  3LGJ A;  1QZG A;  3GTP H;  4YHH L;  3UE1 A;  4YWK A;  2YU9 H;  2B63 G;  2K4K A;  2JA7 G;  2A1A A;  2WB1 E;  4DPG A;  3IRB A;  1HNW L;  3CC7 A;  2ZJR A;  2KEN A;  5JEA J;  2UUB Q;  1UE7 A;  1W3S A;  1CSQ A;  1K0R A;  5IP9 G;  4DV4 Q;  2JK8 A;  2JQO A;  4HJ7 A;  1K9M C;  1I3Q H;  5M3F G;  1FGU A;  4YWL A;  1I5F A;  2N3S A;  2XTI A;  2ZJQ A;  5FLM G;  3J81 j;  3H3V I;  1FJG L;  2FXQ A;  3UE0 A;  3CW2 C;  3G6E A;  4B3T Q;  5IYB H;  4QQB X;  4IFD J;  1XJV A;  4LF6 L;  1CSP A;  4DV0 Q;  4DR6 Q;  1VQN A;  1KD1 C;  3HOZ G;  3K81 C;  4IJL A;  3HOX G;  3MEF A;  1EIF A;  5H1S E;  2JEA I;  1VQ8 A;  2BA0 A;  1VQG A;  4XIG S;  3TEH B;  3CCR A;  4JI0 L;  5BR8 L;  4MTN A;  4HJ8 A;  1N33 L;  3AYH B;  3D0F A;  3I2Z A;  4JI5 L;  5IYD H;  3FKI H;  4C3J H;  1FL0 A;  1LM0 A;  3SGI A;  3HOU G;  4A3L H;  3KDF A;  1I50 H;  4BA2 I;  4HIO A;  1NMG A;  4YCW A;  1B7Y B;  4P74 A;  2LXJ A;  3HFZ B;  4A3G G;  2ZTC A;  4QY7 A;  3BJU A;  2ASB A;  2K75 A;  1VQK A;  3CD6 A;  4NXM L;  4PMW A;  2K14 A;  4J15 A;  1V1Q A;  2ZM6 Q;  4DR5 Q;  1JMC A;  5C4X H;  1ASZ A;  3TRZ A;  4APV A;  1GKH A;  1Y14 B;  3K80 C;  5IWA L;  3UDF A;  2YV5 A;  3K7U C;  1TWC H;  2E8G A;  4OXP A;  1A0I A;  4RG1 A;  5GQO A;  3CME A;  3CCV A;  3CCL A;  2R7D A;  1X3E A;  3AFP A;  3ULJ A;  1Z47 A;  1G29 1;  2KCM A;  2VL6 A;  3E9H A;  3A5U A;  1IBK Q;  4OWT B;  5LMN W;  4AQY L;  1K8G A;  1AE2 A;  1OXT A;  5AJ3 Q;  3PO3 H;  5K36 G;  4GS3 A;  4R4Q A;  5EAY A;  1HNX Q;  4GN3 B;  1RIP A;  2CWA A;  2UUB L;  4DV4 L;  4LF9 Q;  2JA5 H;  1MKH A;  1H95 A;  4A3I H;  1YHB A;  4GNX A;  1VQL A;  2GVA A;  4JI1 Q;  1HR0 L;  4AYB E;  1M1K C;  4KHZ A;  1VQE A;  1O7I A;  1MJC A;  2NZO A;  4A3E H;  2HHH L;  1J6Q A;  2KBN A;  1N32 Q;  2C35 B;  5C0X J;  3S1Q H;  1J5E Q;  3M85 A;  2CWP A;  1NMF A;  2I5L X;  3DM3 A;  4DV0 L;  2ID0 A;  3GTL H;  4OON A;  4IPD A;  1GVP A;  4DR6 L;  3UDX A;  1GD7 A;  2N49 A;  4X6A H;  4LF5 Q;  3VDY A;  1YBY A;  3Q8D A;  1CUK A;  1NBW A;  4KI0 A;  3TS2 A;  1TWF H;  5IYB G;  3I55 A;  1WOC A;  3NEN A;  4P72 A;  4X64 Q;  3S2H H;  3J7Z C;  3ULL A;  4UPA A;  4DV6 L;  1D8L A;  2JA8 G;  1OXU A;  2VNU D;  4DV5 L;  5IYD G;  4IOC A;  4DV7 Q;  3FKI G;  2ZM6 L;  1KC8 C;  1A63 A;  4DR5 L;  3RN2 A;  4A3J H;  4A3L G;  1SE8 A;  4LNQ A;  1PHJ A;  2VZA A;  2Z0S A;  1PH6 A;  1WYD A;  3CCJ A;  4ME3 A;  1U0L A;  4K0K Q;  1V9P A; 
#chains in the Genus database with same CATH topology
 2HD3 A;  3E0J A;  1STN A;  3P20 A;  4QUC A;  3SK5 A;  3S14 B;  1S5F D;  1HNX L;  4LJZ C;  2EYJ A;  2G5D A;  5C4X G;  4LFB Q;  1BR9 A;  3MXP A;  4KLK A;  4QL5 A;  1QNU A;  3EBE A;  1AH9 A;  2NTT A;  2FHT A;  1ICF B;  1ZKO A;  1NSN S;  1EY6 A;  1HZC A;  1STB A;  3ITP A;  5KRU A;  1SN8 A;  4GLA C;  4HCS A;  1IBM Q;  2HCI A;  1HUM A;  2SDF A;  1PA6 A;  1F77 A;  3RZD H;  3BS1 A;  1F2Y A;  1V8Q A;  3BZD B;  1EIH A;  1B70 B;  3QJY A;  4EX5 A;  5I9O A;  2D2C C;  1VQC A;  1JJC B;  3K5N A;  4MHE A;  4OO1 I;  1D5X C;  1CQV A;  4BY1 H;  3A56 A;  1Q8K A;  3FPP A;  1UEB A;  2RSO A;  4K0K L;  3GTQ B;  4LF8 Q;  2BCO A;  3KF8 B;  1KLG D;  4JI6 Q;  2O5I C;  2Q8I B;  2QCP X;  4IOA A;  3J7A V;  2B2U C;  1EYD A;  4UP8 A;  5G3L F;  3FP9 A;  3QOL A;  1S40 A;  5BN5 A;  2HCC A;  3VYR A;  3EQL C;  4GN4 B;  3PUV A;  2ICI A;  1XMO Q;  4A3C G;  1ILP A;  1MBY A;  3T1Y L;  3CPF A;  3QB3 A;  4DR3 Q;  4CKB A;  1JB7 A;  5CBE E;  4AYB B;  3S2D H;  1BXT A;  3HKS A;  1VF7 A;  1Y1W H;  3RLN A;  1EEF D;  4JPB W;  1H9S B;  4IUU A;  5EBC A;  3RZO H;  3CRK C;  2Z8L A;  1CZW A;  4UP9 A;  4JV5 L;  2KHI A;  3CHB D;  3I4N B;  1V1O A;  1KNE A;  1GJX A;  4UP7 A;  4FF3 A;  3V2T A;  2BA1 A;  4BXX H;  2PW7 A;  3OYY A;  5DNF A;  4C3I H;  2JA6 B;  3PO2 H;  3CCU A;  1STE A;  3I90 A;  1B3Q A;  3LX0 A;  4L5R C;  1HH2 P;  1SYG A;  1IBL Q;  2F0S A;  5C3E H;  1TII D;  2ZTE A;  2IHF A;  3MA2 B;  1EWH A;  5CMD A;  5FJ8 G;  4DV2 L;  4ZUI A;  4IO9 A;  5JJI A;  1GHK A;  3KLR A;  2AUK A;  4J1M A;  2YYZ A;  2L0C A;  1EOV A;  4B3R L;  1A15 A;  2VB2 X;  2ZXO A;  2PPB C;  4OEL B;  1OO9 B;  3IFT A;  4R4O A;  4Q5V A;  2F03 A;  3LWU A;  1IYV A;  4OWX B;  3WDN A;  4PG3 A;  5M3M G;  1J9O A;  1EY7 A;  1SYC A;  5GAG C;  1NJI C;  3ERS X;  1IZ6 A;  2NN6 G;  1I4P A;  4R4T A;  1SNC A;  4ZAI A;  4LF4 L;  2LS0 1;  2RVL A;  1PH7 A;  3FVQ A;  1HTP A;  1MSH A;  2F0K A;  4RGT A;  1EFW A;  1DOK A;  2MUY A;  2PI2 A;  2AQ1 B;  1I94 L;  1JWU D;  1B2T A;  1JR0 D;  4LF5 L;  3NE5 B;  1QG7 A;  5IOC A;  3M7G A;  4DNT B;  4B3S Q;  3S1M H;  3BDO A;  3TRE A;  1Q81 C;  2VUM H;  2NWG A;  1ESF A;  3WWV A;  2Z9H A;  1BCP F;  1LT4 D;  2N55 A;  3K5O A;  1VQF A;  1VQ6 A;  3KFU A;  5EJW A;  4G4K A;  1I4Q A;  3CP0 A;  2EVB A;  4ZRZ A;  2RQX A;  5D3D A;  4R9W A;  3IAY A;  4JI7 L;  1C0A A;  1S5C D;  2UUC Q;  4AIM A;  1LUZ A;  5IGG A;  4XQQ A;  2J4X A;  3GTO B;  4F88 A;  1JB3 A;  1SDF A;  4MIU A;  2Z6K C;  3DWA A;  5IIF A;  2E2I H;  2MGS A;  2F3I A;  4JC0 A;  2NVT H;  4JI2 Q;  3JAM c;  4JI3 Q;  3I91 A;  4TKO B;  2SEB D;  1HR0 W;  2PCF B;  4X3K A;  3JAM i;  3SK4 A;  4A75 A;  2ZXR A;  2NVQ B;  4IUP A;  1XNR L;  3JC6 6;  4AQY Q;  3K6O A;  2M9V A;  4LF7 Q;  3TZU A;  1E22 A;  5CV4 A;  1Q82 C;  3H3V C;  1U4M A;  1OXX K;  4CDD C;  5JEA H;  1GUW A;  4LFC Q;  3CC2 A;  1EY5 A;  4IPG A;  3M4O H;  3KDF B;  1VMP A;  1D6E C;  1SJH D;  2EY2 A;  2RHQ B;  1YIJ A;  1SAP A;  2K05 A;  2IX1 A;  1JWS D;  3RNU A;  2FMC A;  4Y7N H;  3GO5 A;  1I4G A;  3NSW A;  1SSO A;  1VQP A;  4CBV A;  1N36 L;  1EIG A;  3C3L A;  3GV3 A;  2Y0S G;  4Q0F A;  1I50 B;  1PFB A;  2NZ1 D;  3KOJ A;  3NBH B;  4BY7 H;  2CW0 D;  1B53 A;  2CH4 A;  2KHJ A;  4K6D A;  1EQT A;  1F2L A;  3ULP A;  3BZC A;  5ELN A;  4X62 Q;  1EYG A;  3HOY H;  5GAH C;  4LFA Q;  4DAP A;  5LMU L;  2EXD A;  1TWC B;  4GNX B;  2XGT A;  4FXK C;  5EKK A;  2VQE Q;  5I4D A;  4JOI C;  4A3K G;  4JBW A;  1G2S A;  3W5O A;  2F0D A;  1WCM G;  2OWO A;  1UE1 A;  3S1N H;  4A3I B;  5ELE A;  2L15 A;  3QR8 A;  4IUR A;  1UWV A;  2RA4 A;  5C0X H;  1RJT A;  2OTJ A;  3HOV H;  1ZXT A;  3S1Q B;  2E2J H;  2CQO A;  4DR1 L;  3Q22 A;  2OEO A;  4V19 0;  2F0O A;  2PMZ E;  4RCN A;  1PVO A;  5IYC G;  2B2T A;  4DUY L;  3G4S A;  1JIC A;  1YVC A;  3H3V H;  3C1F A;  1TXY A;  1IL2 A;  1YNN C;  4PNY A;  1HPC A;  2L12 A;  5K5P A;  5J3B A;  2B3G A;  3E9I A;  3H0G G;  2MJ8 A;  1CK1 A;  2IW3 A;  1GUO A;  1G51 A;  1R4Q B;  1P8L A;  1YZ6 A;  4PMB A;  3HOX H;  3CRL C;  3HKZ E;  4ULL A;  3TME A;  4OEM B;  1Q1B A;  4EGV A;  4DKA C;  2OTL A;  4HIM A;  3P7J A;  5E7N A;  2CCZ A;  4JBJ A;  4C3H G;  2DJF C;  4HJ5 A;  5DAU A;  2CH4 W;  4BS9 A;  4JBM A;  1KIX A;  3PUZ A;  3BVM A;  2E5L L;  4PQX A;  5EBD A;  4MNO A;  3D4R A;  5EKL A;  1WD0 A;  4JYA L;  1IW7 D;  5IGB A;  5F2D A;  4I65 A;  3CPW A;  2QDL A;  2WIN B;  3QO2 A;  1BNZ A;  4XDX A;  2IWH A;  1A62 A;  4JVZ A;  1XWE A;  4DK1 A;  1QOH A;  4K5W A;  1IL8 A;  4NXM Q;  3EJI A;  3RZD B;  2EOT A;  3SK8 A;  3W3A A;  5C0X I;  4BBR G;  5IWA Q;  2VQF L;  3RLF A;  3GTP H;  1JE4 A;  2O2L D;  3UE1 A;  3P75 A;  1MI2 A;  2A1A A;  4BY1 B;  1PFN A;  2UUB Q;  1K0R A;  2JK8 A;  2JQO A;  5M3F G;  4O42 A;  4YWL A;  1EY8 A;  1SEB D;  3J81 j;  4K14 A;  3H3V I;  1XJV A;  4KKT A;  4LF6 L;  4DR6 Q;  3IFD A;  2CHB D;  1KD1 C;  1VQN A;  2KHS A;  3MEF A;  1A6X A;  5H1S E;  5BN3 A;  1VQG A;  4HJ8 A;  4MTN A;  5DM7 3;  4CJ1 B;  3FKI H;  4QMG A;  4DN4 M;  3HOU G;  3CKI B;  3KDF A;  4YCW A;  2J0T D;  3HFZ B;  4A3G G;  2F0Q A;  1H9J A;  4HSP A;  1VQK A;  1VDZ A;  3TZD A;  2K14 A;  4XQN A;  1O7L A;  1V1Q A;  3P1H A;  2QW7 A;  3TRZ A;  4X3S A;  1Y14 B;  3RUZ A;  1STY A;  3NK9 A;  3UDF A;  4F7X A;  2E8G A;  4G7H C;  3S2D B;  1A0I A;  3CME A;  2N88 A;  3MWY W;  1Y1W B;  1U4L A;  3AMU A;  2E76 C;  3ULJ A;  1Z47 A;  1ONL A;  3V96 A;  3A5U A;  4XQJ A;  3RZO B;  1SYD A;  1YNJ C;  5LMN W;  1K8G A;  3PO3 H;  2PMZ B;  4GS3 A;  1RIP A;  1GUT A;  4DV4 L;  1H95 A;  1YHB A;  4GNX A;  1FD7 D;  1VQL A;  4C3I B;  1PTO C;  1RHP A;  3PO2 B;  1MJC A;  4DXF A;  1PRT D;  2KBN A;  5E1F A;  3M85 A;  2CWP A;  1NMF A;  3NTK A;  2ID0 A;  2EPB A;  5IOD A;  3UDX A;  2N49 A;  1CA6 A;  4X6A H;  1AFP A;  4LF5 Q;  4ZK9 B;  3VDY A;  3R2I A;  3OHX C;  4NKL A;  2F0U A;  5C3E B;  2Z4I A;  1DYQ A;  1DJR D;  3NEN A;  1PFM A;  1PZJ D;  2G9D A;  4L63 B;  4P72 A;  4X64 Q;  3MFY A;  1U9R A;  3I8Z A;  3K59 A;  1EWC A;  4UPA A;  1QWY A;  2F0T A;  2PYK A;  4DV6 L;  4G7Z C;  4FXD A;  3KK7 A;  2VNU D;  3OSO A;  4K2K A;  2F0F A;  4C3J G;  1DON A;  4LNQ A;  1U0L A;  1V9P A;  4ILW A;  1UE6 A;  5COY A;  4FDB A;  1KXL A;  1S4Z A;  2ZTD A;  3VA5 A;  3KLS A;  2AWO A;  2F4V Q;  4KTA A;  2B63 B;  1D1K A;  3K8A A;  3KBG A;  1VQ4 A;  2C5C A;  1PH3 A;  2D0O A;  1J5E L;  1XNR Q;  3W1G A;  3DEO A;  2D0P A;  3GTO H;  2JA5 G;  1LT3 D;  2A6E C;  3QWN A;  4H7B A;  1QUQ A;  1ZYR D;  5EPJ A;  4A3E G;  1FR3 A;  4JBK A;  3CAM A;  3NQI A;  1HJP A;  4WJ3 M;  3S1M B;  2B2Y C;  1XMQ Q;  2SNM A;  1PYB A;  2XVS A;  3F8T A;  3T1H Q;  4RWS C;  4KK7 A;  2WKC A;  2ATW A;  4H02 A;  4RMF A;  2F52 A;  2KOL A;  4XT3 B;  4DV7 L;  1IXR A;  1AW7 A;  4O2D A;  4A3D H;  4HCE A;  1V1P B;  1PTO H;  3A8K E;  5KYI A;  2ICE C;  3I4L A;  3S15 H;  3A55 A;  3I73 A;  5JVH 3;  2FIN B;  2FMM A;  4KHP L;  4A3J G;  1EUJ A;  3SK6 A;  1FVI A;  4DK6 C;  4A93 G;  2E2I B;  3MXN B;  4HED A;  2NVX H;  4G7O C;  4GLV B;  2NVT B;  1RDP D;  1K0S A;  1D7Q A;  1NAP A;  1D5M C;  2XSC A;  1DOL A;  5FKA C;  4P73 A;  4DUZ Q;  4A3F G;  4BBS G;  3BVZ A;  4DU9 A;  2A68 C;  1D2B A;  1JC7 A;  1M8A A;  2K5Q A;  1JQY D;  5IP7 G;  1L1O A;  4KHV A;  2QGQ A;  3S16 H;  4EVO A;  2B39 A;  1GHJ A;  2LSS A;  2TSS A;  4IUV A;  4A3B G;  3M4O B;  2Q2I A;  2L55 A;  3AQQ A;  4DR1 Q;  3FPU B;  1L0W A;  4NXN Q;  1L0Y B;  1NTG A;  1OTC A;  1X3P A;  1U5K A;  2E75 C;  2JYO A;  3MC0 B;  4Y7N B;  1FNV A;  2K52 A;  3MXU A;  5C44 H;  3RD4 A;  4DR4 L;  4NDX A;  5IT9 E;  4YY3 L;  2PO4 A;  4IQZ A;  2JN4 A;  5FOB B;  3RR5 A;  4BY7 B;  1X54 A;  1A2T A;  2KCN A;  2VY3 A;  2HDM A;  5IGF A;  5EPK A;  4ZKB B;  5LMN Q;  2F3W A;  5G3L D;  3SR1 A;  1O7Z A;  1WTQ A;  3HOY B;  1YJN A;  4GN5 A;  2RKS A;  4LK1 C;  4OIK A;  1EY9 A;  1CFM A;  1CKN B;  4HTH A;  3GQB A;  1VQM A;  2HT1 A;  3E0E A;  5M5W H;  2EY5 A;  4DR7 L;  1QZH A;  1GOZ A;  3S1N B;  4G57 A;  4WFN 3;  2VXW A;  5EPL A;  3PIP A;  2K1B A;  4KN4 C;  3HOW G;  1LAC A;  2OQK A;  2E5L Q;  4JI4 L;  2WAQ G;  1CHP D;  3HG9 A;  2NZH A;  3HOV B;  3IKJ A;  2E2J B;  5AJ3 L;  1RD9 D;  1E1T A;  5COR A;  2B2U A;  2UXD Q;  1EU3 A;  1S3O A;  1D1I A;  1QVG A;  5A35 A;  4B08 A;  2I07 B;  3ER0 A;  2FJ2 A;  2F0E A;  5E4X A;  4DF7 A;  1TU2 B;  3FDT A;  2R93 G;  4FF4 A;  1Y8O B;  3MFG A;  2UUA L;  3VA7 A;  4IN3 A;  4OL7 A;  1F2M A;  3T53 B;  3NHH A;  1E0B A;  1ENC A;  2IHE A;  3AFQ A;  1GXD C;  2D9U A;  2HQL A;  2WV6 D;  2D5D A;  3HOX B;  1N34 L;  3BDC A;  2DGY A;  2DY8 A;  4FP5 D;  3URY A;  5L37 A;  3K7A H;  3U4V A;  4XYQ A;  4ALP A;  4B9X A;  4HJA A;  4IJH A;  3LNN A;  4DV1 L;  3KUP A;  4LW1 A;  2PNR C;  4IPC A;  2IPK D;  2OXP A;  1YNX A;  5TSS A;  2UXB L;  1GUG A;  2R92 G;  3D31 A;  4A3M H;  4Y52 H;  1PYW D;  4I7A A;  2YTX A;  3M7N A;  2F0V A;  4O0A A;  4DV3 Q;  4QJF A;  2OQ0 A;  5C6A A;  3GTP B;  2BE5 D;  3MXN A;  1EIY B;  4GKK Q;  1QVF A;  2MPM A;  1EOT A;  4EQN A;  1BBU A;  1T9H A;  1RTO A;  2K04 A;  4DR2 L;  1LTS D;  5J39 A;  1JJ2 A;  4B3M L;  1ILQ A;  3KLS X;  2A8V A;  2R7Z H;  1E2W A;  1WVL A;  1CM9 A;  1Z6H A;  1HXY D;  1X3F A;  3MEH A;  2XRQ D;  5C5M A;  1BCP D;  1PLF A;  3A5Z B;  5M5Y H;  2Y0S E;  1VQB A;  2A6H C;  4EQ5 A;  3I4M H;  3FKI B;  5AFW A;  5KIX A;  3MVV A;  3TBI B;  3OTO L;  1XYI A;  3E6Z X;  1TT2 A;  4PZ6 A;  3V05 A;  5JJZ A;  4DV6 Q;  2UU9 Q;  1EQR A;  2HQE A;  3C2P A;  1B4O A;  4WJW A;  4TSS A;  1Y1V H;  5C4J H;  1GO3 E;  3PSI A;  2HIV A;  1XNQ Q;  5IE8 A;  3M4P A;  1FNU A;  1RKN A;  3PO3 B;  4PMC A;  1Z7T A;  1K28 A;  4FNF A;  3M9B A;  3I56 A;  2B2V C;  3DWP A;  1E1O A;  3PV0 A;  1CKN A;  4JG2 A;  3A0J A;  5CYU A;  1FYC A;  1X56 A;  2JE6 I;  4AYB G;  5IGE A;  3PQI A;  4WRD A;  1YEZ A;  4I7Z C;  2F4I A;  2EZV A;  2B63 H;  2Z6K A;  3MXG A;  2JA7 H;  4IFD G;  1HZ9 A;  1LTL A;  4CDC C;  1SE2 A;  4LAA A;  3N52 A;  3I4N G;  5IP9 H;  3DUZ A;  2PNH A;  3BYY B;  2OCE A;  3EN2 A;  4UDU C;  4XXE A;  1VQH A;  3OW2 A;  5FLM H;  1CI3 M;  2DY7 A;  1CKO A;  3L9A X;  2JA6 G;  4A93 H;  3TSS A;  2UXC L;  2IX3 A;  1DGS A;  1SMX A;  1SNP A;  3SEB A;  4DK3 C;  3HOZ H;  4GKJ L;  2EY6 A;  2BOS A;  4N9P A;  4KMU C;  1DXM A;  4M8A A;  2YTV A;  5HY6 A;  1ASY A;  5BN4 A;  3GP7 A;  3K0Y A;  3ZYY X;  3H09 A;  3A8I E;  5JPN C;  1Q12 A;  3G7L A;  5BR8 Q;  1N33 Q;  2G9H D;  5DEH A;  5GRO A;  4YWM A;  1X55 A;  4M1U B;  1X3Q A;  2DNC A;  1BF4 A;  1HNZ L;  3VR3 A;  5I2X A;  5K36 H;  1U4R A;  5CGK A;  4KY6 A;  3KJO A;  2L9H A;  1TS3 A;  2QEJ C;  2RF4 A;  1QNK A;  3D4W A;  3KF8 A;  4X65 L;  3LGJ A;  1QZG A;  2PZT A;  5IT9 L;  2YU9 H;  1EQV A;  2K4K A;  3Q23 A;  1GUN A;  2WB1 E;  4A3D B;  3IRB A;  1HNW L;  5FLX E;  1PTO B;  5D65 A;  1CSQ A;  4U68 A;  5CC4 A;  4ID6 A;  1FGU A;  1LTA D;  3S15 B;  2N3S A;  4NP5 A;  2ZJQ A;  2P5Z X;  1FJG L;  4OIJ A;  5IYB H;  4QQB X;  4IFD J;  2OT2 A;  3BVG A;  1SJE D;  2K7V A;  2NVX B;  4IJL A;  2RCF A;  2JEA I;  3CCR A;  1Q8I A;  4JK1 C;  4XIG S;  3TEH B;  3PIP 3;  4JI0 L;  2JA8 H;  2A69 D;  3AYH B;  3D0F A;  3I2Z A;  4IUN A;  4JI5 L;  1FL0 A;  1LM0 A;  3SGI A;  5LL6 X;  4A3L H;  5JAV A;  2XRS D;  5NUC A;  3R8B A;  1H9S A;  3NTH A;  5FK9 C;  1B7Y B;  4UHV A;  2KEC A;  4P74 A;  3HEJ A;  1CT1 D;  2LXJ A;  1CZG A;  2ASB A;  2MHV A;  2K01 A;  2XNA C;  4J15 A;  4CGY B;  3AU7 A;  3A7A B;  4DR5 Q;  5C4X H;  1ASZ A;  1TY0 A;  1HA5 A;  1S5D D;  1ZEQ X;  5I6W A;  5D3I B;  1AZP A;  3S16 B;  1IKM A;  1MSG A;  1K8O A;  4C56 C;  4OWT B;  1AE2 A;  1OXT A;  5AJ3 Q;  1W6K A;  1HNX Q;  3EA6 A;  1S5B D;  5C3X A;  1SYE A;  4B9W A;  4GZY C;  2RDH A;  2GVA A;  5C44 B;  1O7I A;  2NZO A;  4RGM A;  1WTP A;  1I6H H;  3DM3 A;  4DV0 L;  1STA A;  1GVP A;  3VYS A;  1C48 A;  3E3X A;  4DGZ A;  1X32 A;  3Q8D A;  4KI0 A;  3WOE A;  3OOC A;  5A2Q E;  2MP1 A;  3ULL A;  1UEA B;  4CKE A;  3SDZ A;  1NUC A;  5IYD G;  1LO5 D;  4DV5 L;  4IOC A;  5I2Y A;  1KC8 C;  4X3T A;  2ZM6 L;  5M5W B;  1A63 A;  3LWE A;  1SE8 A;  5D14 A;  1PHJ A;  1Y8P B;  1WYD A;  3CCJ A;  5JPM C;  4ME3 A;  4K0K Q;  1SNQ A;  1ENF A;  1IBK L;  2N8N A;  4RGN A;  4RHS A;  4LF9 L;  2IX0 A;  1VQI A;  4A3C H;  1WTR A;  2EIF A;  3C1E A;  4DNI A;  1ET6 A;  4L5T A;  1TWG B;  1SRU A;  4JI1 L;  4A76 A;  2AUJ D;  1CKM A;  2Z1C A;  3NXW A;  1DOM A;  5ELO A;  3F1Z A;  2H5X A;  2KEE A;  2WB1 B;  4KKU A;  3OMC A;  4A3I G;  3T1Y Q;  1EZ8 A;  3UDI A;  1YIT A;  1YHA A;  2L11 A;  4DK0 A;  2I46 A;  3T4A C;  1PH4 A;  3BG3 A;  5KEE A;  1H9R A;  2E2H H;  2EYP A;  1PH5 A;  3H6M A;  4X66 L;  2RHS B;  4OO1 G;  2QF7 A;  1E3P A;  5J1Z A;  3STB C;  4L8J A;  4JV5 Q;  2XWJ B;  5JOB A;  3K7A B;  1DCZ A;  1BVS A;  1ENA A;  1LAB A;  4L5S A;  3J7A F;  2CW0 C;  1W2B A;  3X3M A;  1PH9 A;  1KHI A;  3KLW A;  3F2C A;  1Q1E A;  5FJ8 H;  1C9O A;  4KJN A;  4LFB L;  1DM0 B;  4A3M B;  2AKW B;  4DAY B;  1BOS A;  1SR3 A;  2X6L A;  3FRP B;  1KL9 A;  1MIU A;  2BDN A;  3RMH A;  1M90 C;  2ALY B;  5KYL A;  2DNE A;  4DV2 Q;  1E7Z A;  1SNO A;  2R6G A;  3PGZ A;  4ZLT F;  1L2F A;  4DAM A;  3U9S A;  1PV4 A;  1IBM L;  4B3R Q;  2A6E D;  4H13 C;  1W6J A;  3Q0A A;  1C8C A;  5M3M H;  3S1R H;  1JOO A;  5FO7 B;  2MFI A;  3PUW A;  3CCE A;  2R7Z B;  1O78 A;  2NN6 H;  2K5W A;  2O5J C;  2X69 A;  2AWN A;  1V43 A;  1KQS A;  5JJL A;  1NR4 A;  1XTC D;  3NBH A;  2KCT A;  3I7F A;  1I4X A;  5M5Y B;  2EYO A;  4LF4 Q;  4LF8 L;  4C1N I;  3I4M B;  1VQ9 A;  2Q8T A;  3N6R A;  4LWC A;  2AQ2 B;  4K2L A;  1PTO F;  4BY1 G;  2RCN A;  2A74 C;  4B3T L;  1I94 Q;  1F9Q A;  4HJ9 A;  5EQ0 A;  1SMY D;  2B2W A;  3Q24 A;  4HIK A;  4GKJ Q;  1Y1V B;  2F0I A;  1S72 A;  1QJO A;  5C4J B;  3HKZ B;  1C7Y A;  4FXG C;  3T16 A;  1VQ5 A;  2DN8 A;  2C9O A;  2B2Y A;  2WAQ E;  2PQA B;  3A7L A;  1EYC A;  3KF6 B;  2ES2 A;  4DAV A;  4JI7 Q;  1PFS A;  4KD3 A;  1H9K A;  3KJP A;  1X3G A;  4MTK A;  4LUV A;  2EJF C;  2XN9 C;  1O7Y A;  2B8F A;  2NBF A;  1VQJ A;  1Y1W G;  3VR2 A;  1UE5 A;  3NBI A;  5HGT A;  4L6T B;  1TS4 A;  5FLX L;  2MNA A;  3TS0 A;  2JA7 B;  1N9W A;  4QIW E;  3QOJ A;  2F0H A;  2SOB A;  1N32 L;  2NYZ D;  2B29 A;  1VS0 A;  2EY1 A;  1FGB D;  2NVY H;  3W2D A;  3CMA A;  1IBL L;  4PZ7 A;  4BXX G;  4C3I G;  1HHV A;  4A93 B;  1HNW Q;  3PO2 G;  1SE4 A;  3H91 A;  1QIL A;  5CV6 A;  5LL6 S;  3OIP A;  1IKL A;  1SYB A;  4TRD A;  3G71 A;  1EU4 A;  3TDQ A;  3HOZ B;  5CV8 A;  1K8A C;  3H94 A;  2EJM A;  2SNS A;  5C3E G;  2WAC A;  2JSO A;  2LMC B;  2GVB A;  3W1B A;  2ZXP A;  1WI5 A;  3CC4 A;  1E2V A;  2MO1 A;  4YIJ A;  3DLL A;  1PZI D;  1N36 Q;  4R4C A;  3PIO 3;  2PI2 E;  4RA8 A;  4YCV A;  4Z9C B;  5ELD A;  5EKI A;  1B1Z A;  4A3K H;  4C2M H;  1Y8N B;  2DUD A;  3GV6 A;  1WCM H;  1G8Z D;  2LKV A;  4NB3 A;  4GOP C;  4OX9 L;  1K83 B;  3ICE A;  5LMU Q;  4AH6 A;  1A8V A;  4IPH A;  1NE3 A;  3M4Y A;  4OWW B;  3X3N A;  2YU9 B;  3DMU A;  1SLJ A;  3ERQ A;  1NY4 A;  1ESR A;  1PRT C;  4B3S L;  3GTK H;  4R4I A;  1EY0 A;  2MQH A;  2HDL A;  4ZQ3 A;  2F0L A;  1HA6 A;  1VQD A;  1WTV A;  1LTR D;  5A2Q L;  1STH A;  1E2Z A;  5IYC H;  1JJG A;  1HRJ A;  2EQS A;  3I72 A;  1EQQ A;  3F2D A;  3CQZ H;  2UUC L;  4ME5 A;  3NQT A;  1I6V C;  2VUM G;  3K5M A;  2JA8 B;  2K32 A;  4IZ8 A;  2EYF A;  2KUM A;  3H0G H;  5HUR A;  5E3F A;  1ET9 A;  4CKC A;  3J81 L;  4DUY Q;  3ONA B;  4DV5 Q;  4JI2 L;  3A8J E;  4JI3 L;  1KDB A;  1U4P A;  1BBX C;  3BYT B;  1QE6 A;  3WOF A;  1XPU A;  4HMI A;  5C4X B;  4C3H H;  4X3U A;  1CQF A;  4RAU C;  2K03 A;  2VS1 A;  2AHO B;  1QCB D;  3Q6S A;  4ZUJ A;  4LF7 L;  2EYH A;  2IY5 B;  1AP0 A;  1FNW A;  3R93 A;  1K8M A;  1PDQ A;  1K73 C;  1PYS B;  1XX8 A;  1TR5 A;  1MGS A;  4PV1 C;  4LFC L;  4QIW B;  5T1I A;  4EQP A;  1NNX A;  1ZYR C;  1LTB D;  1CTM A;  5JEA G;  3B6Y A;  1I6H B;  4OO1 H;  2E74 C;  2AMC B;  2M00 A;  4NPS A;  2LFN A;  2PQA A;  4BBR H;  3HP3 A;  4JYA Q;  3ERO A;  3KF6 A;  1WJJ A;  3U50 C;  3F2B A;  1TWG H;  3RLO A;  3PUY A;  2A6H D;  1R9T H;  4X66 Q;  2RDG A;  3FHW A;  1HQR D;  4J6H A;  1L1O C;  5GAD C;  4LUZ A;  2VQF Q;  5M3F H;  2I5H A;  1SRO A;  1B3A A;  2L1B A;  4F87 A;  5IT9 c;  4X62 L;  3MZ5 A;  3NPP A;  3J80 L;  4GLX A;  2VW9 A;  4LFA L;  3NEL A;  4BY7 G;  1TQO A;  3TP7 A;  2VQE L;  3TQY A;  2RBM A;  2I5M X;  2KJX A;  1HUN A;  4E6I A;  5CR3 A;  4KN7 C;  4ABN A;  5JVG 3;  2K5N A;  3HOU H;  3PUX A;  3HOY G;  1XXG A;  4KD4 A;  4LF6 Q;  1UNS A;  1Q86 C;  2NUC A;  4A3G H;  1TWH H;  1Q7Y C;  1F2Z A;  3I4O A;  4S3S A;  2I0Q A;  1BQQ T;  1TKW B;  1OXS C;  4LMQ D;  1II3 A;  1V1P A;  1UAP A;  3L7Z C;  5C0X G;  1XTD A;  3HOV G;  2ENB A;  2VB3 X;  1YJW A;  4A4I A;  3D3R A;  2E2H B;  4HID A;  3I3C A;  4YHH L;  2F0P A;  4YWK A;  1WTX A;  3HGB A;  1KLU D;  5E4W C;  2EYM A;  2ZJR A;  1QB5 D;  5JEA J;  2K6A A;  1HCZ A;  1UE7 A;  1W3S A;  4DV4 Q;  1KDA A;  1I3Q H;  1I5F A;  1I4R A;  1B9M A;  2FXQ A;  4B3T Q;  2B2V A;  4HN7 A;  3K81 C;  3HOX G;  4H44 C;  1EIF A;  1A2U A;  5CBA E;  1VQ8 A;  2BA0 A;  2RDF A;  5ELF A;  2IJ0 A;  4QF4 A;  4C3J H;  3ND9 A;  3QG1 A;  4BA2 I;  4HIO A;  4RKB A;  1NMG A;  2ZTC A;  4QY7 A;  4NXM L;  2TMP A;  4PMW A;  5M3M B;  4QB4 A;  3S1R B;  5IWA L;  4K6L A;  5GQO A;  3CCV A;  2QDB A;  5ELC A;  2WKD A;  3AFP A;  3HRZ C;  1G29 1;  5EAY A;  3OWF A;  4GN3 B;  2CWA A;  2UUB L;  4RCO A;  5EGT A;  1TY2 A;  2JA5 H;  4F8M A;  4HSV A;  1CA5 A;  1WD1 A;  4QCL A;  1HR0 L;  2HHH L;  4KHZ A;  1VQE A;  4A3E H;  1N32 Q;  1J6Q A;  4KJO A;  2C35 B;  5C0X J;  1G91 A;  1J5E Q;  1ROD A;  2I5L X;  3EFX D;  3HZX A;  3GTL H;  4IPD A;  4DR6 L;  1RTN A;  4RGO S;  1CUK A;  1NBW A;  4O1N A;  1TWF H;  2Q8R E;  3S2H H;  3SHL A;  3M3Y B;  3O13 A;  1OXU A;  4FF2 A;  4DV7 Q;  3FKI G;  1EFI D;  4A3J H;  3DHQ A;  2WII B;  2Z0S A;  1TVX A;  3SVM A;  4HMJ A;  3CCM A;  3JAM E;  1EZ6 A;  3L0O A;  3ND8 A;  4KHP Q;  1TS5 A;  1AEX A;  3NTI A;  1RF2 D;  2EJG C;  4IAL A;  4DXG A;  4A3F H;  1D5Z C;  2BE5 C;  4BBS H;  3MAQ A;  4OX9 Q;  3PO3 G;  3VR5 A;  3PF4 A;  5CV7 A;  3J7Y W;  1B50 A;  1AE3 A;  1G6Z A;  5I6Y A;  5IP7 H;  5M5X H;  2K5V A;  1N8R C;  3GTM H;  2BH8 A;  1KNA A;  2NVY B;  4A3B H;  1S5E D;  2XIW A;  2XWB B;  1SBB B;  3U9O A;  4X64 L;  3GDE A;  1E24 A;  1BCP C;  1K83 H;  1O80 A;  3TN2 A;  1L0X B;  1HTL D;  2BDO A;  2Y0S B;  1M4V A;  4KY5 A;  3GTG H;  2N78 A;  1IYJ B;  4CHT B;  1HQM C;  4L5Q A;  1YNN D;  2F0N A;  5DM6 3;  4JOI A;  4DR4 Q;  3TP5 A;  5KNB A;  5C4Z A;  1VQA A;  1TWA H;  2KA7 A;  2JP1 A;  4YY3 Q;  4R8I A;  2F4V L;  2K5H A;  3PMF A;  1XPR A;  3NUC A;  1PXU A;  4A3K B;  4NMZ A;  4C2M B;  4JI8 L;  1EEI D;  5GAE C;  1WCM B;  3R2T A;  1Q90 A;  4CJ0 B;  1DD2 A;  4R1J A;  2QKI C;  1H9M A;  1IYU A;  2R7F A;  1LTI D;  5DLQ E;  3K0X A;  3ZJY C;  3HOW H;  3S17 H;  1JOQ A;  3DM1 A;  1LLR D;  5IGD A;  4WJ4 A;  3TP6 A;  1SXT A;  2CKZ B;  2PZW A;  3GTK B;  4DR7 Q;  4XTC S;  3M4Q A;  4LUO A;  5ELB A;  1F9P A;  1XMQ L;  4P71 A;  1SE3 A;  3T1H L;  1KDC A;  3U4Z A;  1LTG D;  4JI4 Q;  1HFG A;  2H1E A;  1PH2 A;  1P16 A;  4XT1 B;  1EL0 A;  3STB D;  3CCS A;  3PIO A;  1OXV A;  3CQZ B;  2D62 A;  1GM5 A;  4MZ9 A;  3K57 A;  2R93 H;  2CFM A;  3CU7 A;  3S24 A;  3H0G B;  2Q2H A;  1LT5 D;  2X6G A;  3K58 A;  3GTJ H;  5FLX c;  4A3D G;  3OW7 A;  3S9W A;  1F9R A;  3G48 A;  1EYA A;  5JJK A;  1AN8 A;  3D4D A;  2UUA Q;  1C4Q A;  2KED A;  3TP8 A;  1G2T A;  4C3H B;  1LV9 A;  4ZKC B;  4KY7 A;  3UDG A;  4DUZ L;  4RHR A;  1N34 Q;  1XPO A;  3J7A 5;  1K3R A;  1JCK B;  1YHQ A;  1KRT A;  1R4P B;  2K28 A;  4J8Q A;  1SFO H;  4IUT A;  4DA2 A;  2R92 H;  4U67 3;  3CCQ A;  3AEV A;  3CXC A;  3HS0 C;  3PCO B;  1B8A A;  1MJE A;  5C3W A;  3NEM A;  2CVR A;  3S14 H;  1WFQ A;  3J81 E;  4NXN L;  5IY0 A;  2R3Z A;  4DV1 Q;  4BBR B;  2UXB Q;  5T1G A;  2A73 B;  4GOP B;  2V4D A;  1JWM D;  3BZK A;  1SND A;  1YNJ D;  2EXZ A;  3R3O A;  1VQO A;  1UUP A;  2L4N A;  1R9T B;  4ZCK A;  4YHH Q;  5M3F B;  1LYL A;  1PTO D;  1PRT B;  4QUF A;  5C44 G;  2F0M A;  5KGU A;  5LMN L;  4RFB A;  1I4H A;  2HIX A;  2KVM A;  4HAE A;  4DR2 Q;  2F0J A;  3BU2 A;  2KQ3 A;  4B3M Q;  5IGC A;  1VCI A;  2NTS A;  3E5S A;  4CJ2 C;  1JE5 A;  5J22 A;  2A69 C;  1QUQ B;  5CV9 A;  3HOU B;  2E2D C;  1A3T A;  3C46 A;  4WOR A;  1MD2 D;  5HGQ A;  3F2U A;  4A3G B;  1TWH B;  4FVM A;  3L2P A;  3GTQ H;  1QVC A;  2F0G A;  4OHJ A;  3H15 A;  3D6C A;  4QGU A;  1VQ7 A;  3A54 A;  3OTO Q;  2QEX A;  2B2T C;  1RL2 A;  4N9T A;  3J81 c;  1ICW A;  3FMC A;  1VMC A;  5FO8 B;  2B8G A;  3J80 E;  1HZA A;  3KYH C;  2UXD L;  3J81 i;  3EIV A;  3GD7 A;  2JA9 A;  5FO9 B;  3T56 B;  1B44 D;  4BA1 I;  1G6P A;  1JT8 A;  3VYT A;  1YJ9 A;  1X65 A;  3RN5 A;  2A19 A;  2WB1 G;  3T13 A;  1HR0 Q;  1I3Q B;  3D6W A;  2HHH Q;  4EQO A;  2JEB I;  1WTH A;  5ISR A;  4IFD H;  1STG A;  3A74 A;  2IL8 A;  3SXH A;  2OF1 A;  3DEP A;  3I4N H;  2ZJP A;  3L3O C;  1PH8 A;  2HUG A;  2AQ3 B;  2EE1 A;  4FO2 A;  3VYU A;  1KTK A;  4TQU S;  1L1O B;  2JA6 H;  2NB0 A;  4C3J B;  1PH1 A;  1ML0 D;  2ZT9 C;  4JI6 L;  3JAM L;  4UY8 C;  5C4H A;  1LTT D;  3NWS A;  1KAW A;  2Z6B A;  4P75 A;  3FEW X;  3KBX A;  4K8J A;  2UXC Q;  4DV3 L;  1Q46 A;  4TVA B;  4N8F A;  3J80 c;  1EY4 A;  4GKK L;  1BKB A;  1MHW C;  4A3M G;  3CF5 A;  1XMO L;  3J80 i;  4POF A;  3M3Y H;  2BH2 A;  4DR3 L;  3OIQ A;  4V0B A;  2WP8 J;  2IT1 A;  2JA5 B;  1PZK D;  4CDF C;  1YI2 A;  2A68 D;  4KKS A;  3U58 A;  2R61 A;  4A3E B;  4JW0 A;  2YTY A;  1IW7 C;  3AB9 A;  4N8X 1;  2MO0 A;  3GTL B;  3T51 B;  2R7Z G;  2F3V A;  3MHB A;  1A3U A;  2LXK A;  1WTO A;  1HNZ Q;  2WFW A;  4KV6 A;  2K33 A;  4ZYS A;  1TWF B;  4DNR B;  4IFD I;  3VR4 A;  2J7Z A;  4X65 Q;  2UU9 L;  2NN6 I;  3S2H B;  2GN5 A;  4GOP A;  3I4M G;  1CHQ D;  1RCV D;  1BBW A;  2A5H A;  4A3J B;  1GUS A;  2F1M A;  4POG A;  1T5E A;  2Z4H A;  4RH6 A;  1HZB A;  2PW5 A;  3D8G A;  1X9N A;  4H0L C;  1XNQ L;  1DZ1 A;  3SE0 A;  2QA4 A;  4GNX C;  2JJQ A;  1KAB A;  1FJG Q;  1A3V A;  1KRS A;  1Y1V G;  3OPO A;  2Q2U A;  4JCV E;  3HKZ G;  2KCC A;  4A3F B;  4JI8 Q;  4BBS B;  3MTS A;  4JI0 Q;  1VF5 C;  1EWI A;  2B2W C;  4DFA A;  4JI5 Q;  2V1C C;  4P2C B;  4K5X A;  1B9N A;  2K50 A;  4OGQ C;  5I9P A;  4PZ8 A;  4HR7 B;  5M5X B;  1PMR A;  1Z9F A;  4K8I A;  3GTM B;  2Q2T A;  2H4O A;  1WTW A;  2CQA A;  2QIL A;  4A3B B;  1BO0 A;  4K5V A;  4R8N A;  4YCU A;  1X6O A;  3EVQ A;  3DWQ A;  4UAI A;  4FYD A;  2VUM B;  3I70 A;  2NVQ H;  1JOR A;  2EDG A;  3BDL A;  2PZU A;  2B63 G;  1NCV A;  2JA7 G;  1BUV T;  2F0W A;  5KND A;  4DPG A;  4NW2 A;  3GTG B;  2L5T A;  3CC7 A;  4DAY A;  2KEN A;  4BWG B;  3OMG A;  5IP9 G;  1K9M C;  1PRT F;  4HJ7 A;  2XTI A;  3OWE B;  5KNC A;  5FLM G;  5M9O A;  3UE0 A;  3CW2 C;  1SMY C;  3G6E A;  1TWA B;  2DJG C;  2LY7 A;  3UI2 A;  1CSP A;  4DV0 Q;  2RSN A;  3HOZ G;  5CV5 A;  1IHZ A;  4IUQ A;  5BR8 L;  1N33 L;  5IYD H;  4CDE C;  5LHY 1;  4C1N K;  1K3B C;  1TS2 A;  2EYL A;  3VR6 A;  1I50 H;  3HOW B;  3S17 B;  3DXJ C;  2WAQ B;  3BJU A;  1T5X D;  2K5D A;  4MN3 A;  2K75 A;  3CD6 A;  1Q3L A;  2ZM6 Q;  1LT6 D;  1SNM A;  1JMC A;  4APV A;  1GKH A;  3K80 C;  1HFN A;  2YV5 A;  3K7U C;  1TWC H;  4OXP A;  3PF5 A;  4XYO A;  4RG1 A;  3CCL A;  2R7D A;  3IL8 A;  1X3E A;  2KCM A;  2VL6 A;  1NR2 A;  3E9H A;  1IBK Q;  4AQY L;  1JOK A;  5K36 G;  4R4Q A;  4LF9 Q;  1MKH A;  4A3I H;  2FFK B;  2R93 B;  2PQE A;  4JI1 Q;  2M2L A;  4AYB E;  1F9S A;  1M1K C;  2GA4 B;  2O4X A;  3GTJ B;  1Y69 U;  3S1Q H;  4OON A;  1GD7 A;  1SYF A;  3QIA A;  1YBY A;  3NWT A;  1AZQ A;  3TS2 A;  1KAA A;  1BCP B;  5IYB G;  4ODG A;  3I55 A;  1J8I A;  1WOC A;  2JXM B;  3J7Z C;  4RKL A;  1BDO A;  1D8L A;  3G6J B;  2JA8 G;  5C5L A;  3NP8 A;  4FF1 A;  4DR5 L;  3RN2 A;  4A3L G;  1SFO B;  2VZA A;  1PH6 A;  3K5L A;  2R92 B; 
#chains in the Genus database with same CATH homology
 1UE6 A;  1IBK L;  2N8N A;  4FDB A;  1KXL A;  3L0O A;  2ZTD A;  1HNX L;  4KHP Q;  4LF9 L;  2AWO A;  2F4V Q;  5C4X G;  2IX0 A;  1VQI A;  4A3C H;  4QL5 A;  2EIF A;  4KLK A;  4DNI A;  4LFB Q;  3K8A A;  4L5T A;  3EBE A;  1VQ4 A;  4A3F H;  1SRU A;  4JI1 L;  1AH9 A;  4A76 A;  4BBS H;  1CKM A;  4OX9 Q;  3PO3 G;  5ELO A;  2D0O A;  1PH3 A;  3PF4 A;  1J5E L;  1XNR Q;  3W1G A;  1AE3 A;  2D0P A;  1HZC A;  3F1Z A;  5IP7 H;  3GTO H;  2H5X A;  5M5X H;  2JA5 G;  2K5V A;  4A3I G;  1N8R C;  3GTM H;  2BH8 A;  3T1Y Q;  1QUQ A;  1SN8 A;  4GLA C;  3UDI A;  1YIT A;  1IBM Q;  1YHA A;  4A3B H;  4A3E G;  4JBK A;  3CAM A;  1PA6 A;  1HJP A;  1PH4 A;  3RZD H;  4WJ3 M;  2E2H H;  4X64 L;  1XMQ Q;  1B70 B;  1PYB A;  3GDE A;  1PH5 A;  1E24 A;  3F8T A;  4X66 L;  4EX5 A;  2RHS B;  3T1H Q;  4OO1 G;  1VQC A;  1K83 H;  1E3P A;  2ATW A;  4H02 A;  4RMF A;  1JJC B;  2F52 A;  3STB C;  4DV7 L;  1IXR A;  4O2D A;  4JV5 Q;  4OO1 I;  4BY1 H;  3GTG H;  4A3D H;  2N78 A;  1IYJ B;  1Q8K A;  4L5Q A;  1BVS A;  1UEB A;  4K0K L;  4L5S A;  3S15 H;  4LF8 Q;  3KF8 B;  1W2B A;  4JOI A;  4JI6 Q;  4DR4 Q;  1PH9 A;  4KHP L;  1KHI A;  1VQA A;  3KLW A;  1TWA H;  1EUJ A;  3F2C A;  1Q1E A;  5FJ8 H;  4YY3 Q;  1FVI A;  4A3J G;  1C9O A;  4DK6 C;  2F4V L;  4IOA A;  4UP8 A;  4LFB L;  2K5H A;  3MXN B;  4A93 G;  3FP9 A;  2NVX H;  4GLV B;  1XPR A;  1S40 A;  2AKW B;  4DAY B;  1SR3 A;  1D7Q A;  1KL9 A;  3PF5 A;  1MIU A;  4JI8 L;  5GAE C;  1M90 C;  4GN4 B;  4R1J A;  2ALY B;  3PUV A;  4DV2 Q;  1E7Z A;  2R6G A;  3PGZ A;  1XMO Q;  4A3C G;  2R7F A;  5DLQ E;  3ZJY C;  3K0X A;  1L2F A;  3CPF A;  4P73 A;  4DAM A;  4DUZ Q;  3T1Y L;  3HOW H;  4A3F G;  4DR3 Q;  3S17 H;  1PV4 A;  1IBM L;  4BBS G;  1JB7 A;  4B3R Q;  4WJ4 A;  2CKZ B;  5M3M H;  3S1R H;  4DR7 Q;  4XTC S;  3M4Q A;  4LUO A;  1XMQ L;  5IP7 G;  1L1O A;  2MFI A;  3PUW A;  3CCE A;  4P71 A;  3T1H L;  3S2D H;  2QGQ A;  3HKS A;  3U4Z A;  1Y1W H;  3S16 H;  3RLN A;  4JI4 Q;  2AWN A;  1V43 A;  2LSS A;  1KQS A;  3RZO H;  5JJL A;  4A3B G;  4JV5 L;  2Q2I A;  4UP9 A;  3AQQ A;  2KHI A;  1PH2 A;  4DR1 Q;  1P16 A;  1L0W A;  4NXN Q;  2KCT A;  3I7F A;  3STB D;  3CCS A;  1I6H H;  3PIO A;  1NTG A;  4UP7 A;  1OXV A;  2D62 A;  1OTC A;  1GM5 A;  1U5K A;  4MZ9 A;  4LF4 Q;  2BA1 A;  4LF8 L;  2R93 H;  2K52 A;  5C44 H;  2CFM A;  3OYY A;  4C3I H;  4BXX H;  4DR4 L;  1VQ9 A;  3PO2 H;  3S24 A;  4LWC A;  3CCU A;  2Q2H A;  3GTJ H;  4YY3 L;  4BY1 G;  5FLX c;  2RCN A;  4A3D G;  4B3T L;  1I94 Q;  3G48 A;  4L5R C;  3RR5 A;  1HH2 P;  1X54 A;  2VY3 A;  5JJK A;  1IBL Q;  4HJ9 A;  5C3E H;  5LMN Q;  2ZTE A;  2UUA Q;  2IHF A;  4HIK A;  4GN5 A;  1YJN A;  4GKJ Q;  5FJ8 G;  4DV2 L;  4IO9 A;  1S72 A;  4IFD I;  5JJI A;  1C7Y A;  3UDG A;  4DUZ L;  1VQ5 A;  1CKN B;  2YYZ A;  1N34 Q;  1XPO A;  1EOV A;  1VQM A;  4B3R L;  2HT1 A;  3J7A 5;  1K3R A;  1YHQ A;  1KRT A;  3E0E A;  5M5W H;  2WAQ E;  2PQA B;  4DR7 L;  1QZH A;  3KF6 B;  1SFO H;  2ES2 A;  4R4O A;  3PIP A;  1PFS A;  4JI7 Q;  2R92 H;  3HOW G;  2E5L Q;  2OQK A;  4JI4 L;  3CCQ A;  3KJP A;  3AEV A;  1X3G A;  2WAQ G;  3PCO B;  3CXC A;  1B8A A;  4OWX B;  1MJE A;  3NEM A;  2NZH A;  3S14 H;  4PG3 A;  1WFQ A;  4LUV A;  4NXN L;  5IY0 A;  5M3M G;  4DV1 Q;  5GAG C;  5AJ3 L;  1NJI C;  2UXB Q;  3ERS X;  1IZ6 A;  2NN6 G;  4R4T A;  1VQJ A;  3CCM A;  4GOP B;  1Y1W G;  1E1T A;  4LF4 L;  3BZK A;  1UE5 A;  1VQO A;  2MNA A;  3TS0 A;  1PH7 A;  2UXD Q;  1S3O A;  1QVG A;  1N9W A;  1EFW A;  4QIW E;  2PI2 A;  3ER0 A;  1N32 L;  4YHH Q;  1I94 L;  2B29 A;  1VS0 A;  1LYL A;  3CMA A;  2NVY H;  1IBL L;  2R93 G;  5C44 G;  4PZ7 A;  5LMN L;  4LF5 L;  4BXX G;  2UUA L;  1HNW Q;  3PO2 G;  4B3S Q;  2HIX A;  2IHE A;  3S1M H;  3TRE A;  3G71 A;  4DR2 Q;  3AFQ A;  3BU2 A;  2HQL A;  1Q81 C;  4B3M Q;  1N34 L;  1VCI A;  2VUM H;  2DGY A;  1K8A C;  3WWV A;  1VQ6 A;  5C3E G;  1VQF A;  3KFU A;  1JE5 A;  1QUQ B;  3CP0 A;  3K7A H;  3U4V A;  2GVB A;  3W1B A;  4ALP A;  1WI5 A;  3CC4 A;  4JI7 L;  4HJA A;  1C0A A;  5HGQ A;  2UUC Q;  4AIM A;  1LUZ A;  2MO1 A;  3DLL A;  3L2P A;  3GTQ H;  1QVC A;  4IJH A;  3H15 A;  4QGU A;  1VQ7 A;  4DV1 L;  1N36 Q;  4LW1 A;  2Z6K C;  4R4C A;  4IPC A;  2E2I H;  3OTO Q;  2PI2 E;  1YNX A;  2QEX A;  2UXB L;  4JC0 A;  2F3I A;  4YCV A;  2NVT H;  1RL2 A;  2R92 G;  4JI2 Q;  3D31 A;  3J81 c;  4A3M H;  4Y52 H;  3JAM c;  4JI3 Q;  2YTX A;  4A3K H;  1HZA A;  3KYH C;  2UXD L;  4C2M H;  1HR0 W;  3M7N A;  2DUD A;  4O0A A;  3J81 i;  3JAM i;  1WCM H;  3EIV A;  3GD7 A;  4NB3 A;  4DV3 Q;  4A75 A;  4GOP C;  4OX9 L;  4QJF A;  3ICE A;  5LMU Q;  2JA9 A;  2OQ0 A;  4AH6 A;  1XNR L;  3JC6 6;  1A8V A;  4AQY Q;  1EIY B;  4IPH A;  4BA1 I;  1NE3 A;  4GKK Q;  1QVF A;  4OWW B;  1G6P A;  4LF7 Q;  1JT8 A;  1SLJ A;  1E22 A;  1Q82 C;  1BBU A;  1NY4 A;  1OXX K;  1YJ9 A;  1T9H A;  1X65 A;  2JA8 H;  4B3S L;  3RN5 A;  3GTK H;  4DR2 L;  4R4I A;  4LFC Q;  2A19 A;  2WB1 G;  1JJ2 A;  1HR0 Q;  4B3M L;  2MQH A;  2HHH Q;  2A8V A;  2R7Z H;  2JEB I;  1VQD A;  3CC2 A;  4IPG A;  1X3F A;  3M4O H;  3A74 A;  3KDF B;  2RHQ B;  5IYC H;  3I4N H;  1JJG A;  2ZJP A;  2EQS A;  1PH8 A;  1YIJ A;  3A5Z B;  5M5Y H;  2IX1 A;  2Y0S E;  3F2D A;  3CQZ H;  3RNU A;  1EQQ A;  2UUC L;  1VQB A;  2VUM G;  4Y7N H;  4TQU S;  4EQ5 A;  3GO5 A;  1L1O B;  2JA6 H;  3I4M H;  1VQP A;  3H0G H;  1PH1 A;  1N36 L;  2Y0S G;  4JI6 L;  3OTO L;  4PZ6 A;  4DUY Q;  4DV6 Q;  3KOJ A;  2UU9 Q;  4UY8 C;  3NBH B;  1EQR A;  4BY7 H;  2KHJ A;  4DV5 Q;  4JI2 L;  4JI3 L;  1KAW A;  4P75 A;  3ULP A;  3BZC A;  5ELN A;  4X62 Q;  4DV3 L;  1EYG A;  1XPU A;  3HOY H;  2UXC Q;  1Q46 A;  4TVA B;  1Y1V H;  4LFA Q;  4C3H H;  2EXD A;  5GAH C;  5LMU L;  4GNX B;  3J80 c;  2XGT A;  5C4J H;  1GO3 E;  3PSI A;  2HIV A;  2VS1 A;  4GKK L;  1BKB A;  2AHO B;  1XNQ Q;  5IE8 A;  2VQE Q;  3CF5 A;  3J80 i;  3M4P A;  4A3M G;  1XMO L;  4POF A;  4LF7 L;  4JOI C;  4A3K G;  4JBW A;  3M3Y H;  2IY5 B;  2BH2 A;  4DR3 L;  3W5O A;  1K73 C;  1WCM G;  2OWO A;  1PYS B;  1UE1 A;  3M9B A;  4LFC L;  3S1N H;  2WP8 J;  2IT1 A;  3I56 A;  2L15 A;  1E1O A;  3PV0 A;  1YI2 A;  1CKN A;  1UWV A;  3U58 A;  4JG2 A;  2OTJ A;  2YTY A;  3A0J A;  3HOV H;  5JEA G;  2MO0 A;  3B6Y A;  1X56 A;  2JE6 I;  4AYB G;  2AMC B;  2E2J H;  4NPS A;  2PQA A;  4BBR H;  2CQO A;  4JYA Q;  4DR1 L;  3KF6 A;  1WJJ A;  2R7Z G;  1YEZ A;  2LXK A;  2PMZ E;  3U50 C;  2Z6K A;  1HNZ Q;  2WFW A;  2B63 H;  2JA7 H;  4IFD G;  3F2B A;  1HZ9 A;  1TWG H;  1LTL A;  3PUY A;  3RLO A;  1PVO A;  2UU9 L;  5IYC G;  1R9T H;  4X66 Q;  3FHW A;  3I4N G;  4DUY L;  5IP9 H;  1L1O C;  4X65 Q;  4LUZ A;  3EN2 A;  2NN6 I;  1YVC A;  2OCE A;  2PNH A;  5GAD C;  3G4S A;  2VQF Q;  5M3F H;  3H3V H;  2I5H A;  1SRO A;  1TXY A;  1IL2 A;  1VQH A;  2GN5 A;  3OW2 A;  5FLM H;  4GOP A;  1CKO A;  5J3B A;  2JA6 G;  2B3G A;  3I4M G;  4A93 H;  1BBW A;  3E9I A;  5IT9 c;  4X62 L;  3H0G G;  2UXC L;  4GLX A;  2VW9 A;  4LFA L;  1DGS A;  4POG A;  1SMX A;  1G51 A;  1P8L A;  1HZB A;  1YZ6 A;  4DK3 C;  3HOZ H;  4GKJ L;  3HOX H;  1X9N A;  1XNQ L;  3NEL A;  4BY7 G;  2VQE L;  3TQY A;  3HKZ E;  2QA4 A;  4GNX C;  2I5M X;  2JJQ A;  1Q1B A;  4DKA C;  1FJG Q;  1KRS A;  4HIM A;  2OTL A;  3HOU H;  2K5N A;  3HOY G;  3PUX A;  2YTV A;  4JBJ A;  5E7N A;  2CCZ A;  1Y1V G;  4LF6 Q;  2Q2U A;  5HY6 A;  4HJ5 A;  4JCV E;  3HKZ G;  1ASY A;  1Q86 C;  4JBM A;  4JI8 Q;  1KIX A;  4A3G H;  1TWH H;  1Q12 A;  3PUZ A;  1Q7Y C;  4JI0 Q;  5BR8 Q;  1N33 Q;  1EWI A;  2E5L L;  3I4O A;  5GRO A;  4JI5 Q;  2V1C C;  2K50 A;  4MNO A;  4PZ8 A;  1X55 A;  4YWM A;  2I0Q A;  4JYA L;  1OXS C;  1Z9F A;  2Q2T A;  3CPW A;  1HNZ L;  3L7Z C;  1A62 A;  5C0X G;  1XTD A;  3HOV G;  4NXM Q;  4YCU A;  1X6O A;  3KJO A;  1YJW A;  4X65 L;  2RF4 A;  4A4I A;  5C0X I;  4BBR G;  5IWA Q;  2VQF L;  3RLF A;  2NVQ H;  4HID A;  3LGJ A;  1QZG A;  3GTP H;  4YHH L;  3UE1 A;  4YWK A;  2YU9 H;  2B63 G;  2K4K A;  2JA7 G;  2A1A A;  2WB1 E;  4DPG A;  3IRB A;  1HNW L;  3CC7 A;  2ZJR A;  2KEN A;  5JEA J;  2UUB Q;  1UE7 A;  1W3S A;  1CSQ A;  1K0R A;  5IP9 G;  4DV4 Q;  2JK8 A;  2JQO A;  4HJ7 A;  1K9M C;  1I3Q H;  5M3F G;  1FGU A;  4YWL A;  1I5F A;  2N3S A;  2XTI A;  2ZJQ A;  5FLM G;  3J81 j;  3H3V I;  1FJG L;  2FXQ A;  3UE0 A;  3CW2 C;  3G6E A;  4B3T Q;  5IYB H;  4QQB X;  4IFD J;  1XJV A;  4LF6 L;  1CSP A;  4DV0 Q;  4DR6 Q;  1VQN A;  1KD1 C;  3HOZ G;  3K81 C;  4IJL A;  3HOX G;  3MEF A;  1EIF A;  5H1S E;  2JEA I;  1VQ8 A;  2BA0 A;  1VQG A;  4XIG S;  3TEH B;  3CCR A;  4JI0 L;  5BR8 L;  4MTN A;  4HJ8 A;  1N33 L;  3AYH B;  3D0F A;  3I2Z A;  4JI5 L;  5IYD H;  3FKI H;  4C3J H;  1FL0 A;  1LM0 A;  3SGI A;  3HOU G;  4A3L H;  3KDF A;  1I50 H;  4BA2 I;  4HIO A;  1NMG A;  4YCW A;  1B7Y B;  4P74 A;  2LXJ A;  3HFZ B;  4A3G G;  2ZTC A;  4QY7 A;  3BJU A;  2ASB A;  2K75 A;  1VQK A;  3CD6 A;  4NXM L;  4PMW A;  2K14 A;  4J15 A;  1V1Q A;  2ZM6 Q;  4DR5 Q;  1JMC A;  5C4X H;  1ASZ A;  3TRZ A;  4APV A;  1GKH A;  1Y14 B;  3K80 C;  5IWA L;  3UDF A;  2YV5 A;  3K7U C;  1TWC H;  2E8G A;  4OXP A;  1A0I A;  4RG1 A;  5GQO A;  3CME A;  3CCV A;  3CCL A;  2R7D A;  1X3E A;  3AFP A;  3ULJ A;  1Z47 A;  1G29 1;  2KCM A;  2VL6 A;  3E9H A;  3A5U A;  1IBK Q;  4OWT B;  5LMN W;  4AQY L;  1K8G A;  1AE2 A;  1OXT A;  5AJ3 Q;  3PO3 H;  5K36 G;  4GS3 A;  4R4Q A;  5EAY A;  1HNX Q;  4GN3 B;  1RIP A;  2CWA A;  2UUB L;  4DV4 L;  4LF9 Q;  2JA5 H;  1MKH A;  1H95 A;  4A3I H;  1YHB A;  4GNX A;  1VQL A;  2GVA A;  4JI1 Q;  1HR0 L;  4AYB E;  1M1K C;  4KHZ A;  1VQE A;  1O7I A;  1MJC A;  2NZO A;  4A3E H;  2HHH L;  1J6Q A;  2KBN A;  1N32 Q;  2C35 B;  5C0X J;  3S1Q H;  1J5E Q;  3M85 A;  2CWP A;  1NMF A;  2I5L X;  3DM3 A;  4DV0 L;  2ID0 A;  3GTL H;  4OON A;  4IPD A;  1GVP A;  4DR6 L;  3UDX A;  1GD7 A;  2N49 A;  4X6A H;  4LF5 Q;  3VDY A;  1YBY A;  3Q8D A;  1CUK A;  1NBW A;  4KI0 A;  3TS2 A;  1TWF H;  5IYB G;  3I55 A;  1WOC A;  3NEN A;  4P72 A;  4X64 Q;  3S2H H;  3J7Z C;  3ULL A;  4UPA A;  4DV6 L;  1D8L A;  2JA8 G;  1OXU A;  2VNU D;  4DV5 L;  5IYD G;  4IOC A;  4DV7 Q;  3FKI G;  2ZM6 L;  1KC8 C;  1A63 A;  4DR5 L;  3RN2 A;  4A3J H;  4A3L G;  1SE8 A;  4LNQ A;  1PHJ A;  2VZA A;  2Z0S A;  1PH6 A;  1WYD A;  3CCJ A;  4ME3 A;  1U0L A;  4K0K Q;  1V9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...