3S1QH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1qH00
1K73C 1WI5A 4LF5L 4OO1G 4JI1L 2K75A 2XGTA 4UY8C 3HOXG 3PF4A 1YZ6A 3D0FA 1H95A 4DR7Q 1N32L 4LF8Q 5IYCG 3KJOA 2YTVA 4KI0A 1YI2A 4B3RQ 2R7DA 4QJFA 4DUYQ 2NVQH 2HIVA 1P16A 2C35B 3GTLH 2IHFA 2JEBI 3U50C 1GVPA 5AJ3Q 4A76A 2IY5B 4Y52H 3S24A 3BU2A 3AYHB 4LUZA 4PG3A 3S14H 3M85A 1N33L 1B8AA 2AWNA 4A3IG 1X56A 2N8NA 3RLFA 1IYJB 1OXUA 3K7AH 4LF7L 1VQEA 2R92H 1JJ2A 1PFSA 1BBUA 1WJJA 2K5HA 4A3MH 4A3LG 4DV2Q 4IOCA 4QL5A 5GAEC 1K83H 2AHOB 4POFA 4DR5Q 4C3IH 3RZOH 1UE1A 4OONA 4DV5Q 1D7QA 1Z47A 3M4QA 4HJAA 4IJLA 3CC2A 1FGUA 4AQYQ 1MJCA 5J3BA 3PIOA 3BZKA 4DAYB 3A5UA 1Q12A 3PGZA 2NN6I 4MTNA 2HHHL 1C0AA 5IYBG 3M9BA 5C3EH 3S1NH 2EQSA 5BR8Q 1XNRQ 3M3YH 2LSSA 5M3MG 4GKKQ 1CKMA 3K0XA 1YJ9A 1SN8A 2F3IA 2I5LX 2Z0SA 2VW9A 2ZTEA 2PMZE 5H1SE 3TS2A 2YYZA 1YIJA 1I50H 1C9OA 1NBWA 3PUXA 1X6OA 1VQFA 5IY0A 4DR1Q 1IBLL 2GVAA 4HJ9A 1QZHA 1K3RA 1VQJA 1IXRA 5ELOA 1BBWA 1OXXK 3FKIG 1N34Q 1IBMQ 1QVFA 2WFWA 3HOUH 4IFDJ 5JJLA 1AH9A 4DR7L 2WP8J 4LF8L 2ZJQA 5LMNQ 2VL6A 1KAWA 1N9WA 2D0OA 4IPHA 4DUYL 2UUCQ 4LF9Q 2VUMH 1EWIA 2BH2A 3HOUG 4QGUA 1XPUA 5LMUQ 1Q82C 4TVAB 1HZAA 2A8VA 2HIXA 1PH8A 3I4OA 5AJ3L 1Q1EA 2WB1G 3KF6A 2E5LQ 1PHJA 4B3SQ 3HOVH 2R7ZG 3PIPA 4B3MQ 4A3EG 2ASBA 5HY6A 4NPSA 4WJ3M 2JA6G 2I5MX 4C3JH 4YCWA 2Q2IA 1V43A 1M90C 1E22A 4JOIC 1HZBA 4BA1I 2YV5A 3J7A5 2N49A 4GN4B 4PZ7A 5GROA 1I3QH 3H0GG 1VCIA 1T9HA 4LWCA 4BY1G 3UE1A 2RCNA 5FLMH 4DV2L 3GTOH 1L1OA 4BBRH 4DR5L 1Z9FA 4DV5L 2JA8H 1QZGA 1HZ9A 3EN2A 3K8AA 3KF6B 3CAMA 4AQYL 5FLMG 3ULPA 1S40A 4IJHA 3RLNA 1YJNA 1L0WA 1L2FA 3J80i 3KJPA 3G4SA 1EQQA 1Q81C 3CCMA 2JA8G 3I4MH 2R93H 5BR8L 5IT9c 1XNRL 4GKKL 1G6PA 1WOCA 3E9IA 1SFOH 1QVGA 2AKWB 4XTCS 3I4MG 3PV0A 4DR1L 1VQKA 1X3EA 1XNQL 5DLQE 2PQAA 2ZM6Q 3F2BA 1N34L 4UP8A 1SRUA 3ZJYC 5FLXc 1IBML 1VQ5A 3TQYA 4BXXG 4A3DH 3ICEA 3D31A 2OTJA 4R1JA 3GO5A 2UUCL 5C44H 4JBKA 5LMUL 2CWPA 3J80c 1PH7A 4A3DG 2E5LL 1NY4A 3I56A 4B3SL 4QQBX 5IP9H 5C44G 2ES2A 5IWAQ 4GLAC 4LUVA 3HOYH 2PQAB 2K5NA 4GNXC 2HHHQ 4MNOA 3RN5A 2KCMA 5IP9G 4O2DA 1VQGA 4OX9Q 3FHWA 4OWTB 3MXNB 2B3GA 2VQEQ 3SGIA 4JOIA 1NMFA 1GD7A 1YBYA 1UWVA 2ALYB 2BH8A 2K4KA 3CPWA 1SMXA 4TQUS 2IX0A 1B7YB 4L5QA 3BZCA 4JI3Q 3K7UC 1I94Q 4HJ8A 1WCMG 3T1HQ 4A3JG 3FP9A 1S72A 1MJEA 1Q86C 4H02A 4EX5A 2VNUD 1JT8A 4A3IH 5JEAJ 4JYAQ 1Q1BA 4OXPA 1YITA 1GM5A 4O0AA 1WYDA 2LXKA 2NN6G 4JI8Q 4ALPA 1NMGA 4A3LH 2UUAQ 3HKZG 3H3VH 4OWXB 4X66Q 2ZM6L 2CWAA 2EIFA 4R4QA 2IHEA 4IPGA 4A4IA 2NVTH 2YU9H 4JI0Q 3CPFA 3JAMi 1K8AC 1W2BA 2MO0A 1HZCA 4DK3C 4A3KG 1I6HH 1SLJA 4WJ4A 4DR4Q 4DV6Q 1JMCA 3NBHB 2MNAA 3GTMH 3CXCA 5IYBH 4HJ7A 4GOPC 2ZTDA 4BY7G 5M3MH 3HOZH 2WAQG 2NVYH 5IWAL 4POGA 1HNZQ 1G291 1C7YA 4A3GG 4X6AH 1VQHA 4DV7Q 1VQNA 2H5XA 1JJGA 5FJ8G 2UXBQ 1EQRA 3BJUA 3W1GA 4OX9L 3HOZG 4OO1I 3FKIH 3RZDH 1DGSA 4ME3A 2VQEL 1PH6A 3I4NG 1G51A 4GN5A 3ER0A 4LFBQ 3L0OA 1UE5A 4L5TA 1XNQQ 3G71A 3A0JA 1YNXA 4IOAA 2B29A 4JC0A 1XPOA 2CQOA 4JCVE 4JI3L 1OTCA 4JBWA 1I94L 1N36Q 2R7ZH 4MZ9A 1NTGA 3AFPA 1VQAA 1S3OA 3T1HL 4A3EH 2R6GA 5ELNA 3MEFA 2KCTA 1TWHH 2JA6H 4AYBE 1VQ6A 3NEMA 4P71A 1J5EQ 4JYAL 3UDGA 3K80C 4GNXB 3TS0A 4IFDG 1E1OA 2OCEA 3ULJA 4BY1H 1EIFA 4DV0Q 1XMQQ 2DGYA 2I5HA 3H0GH 4JI8L 1HR0W 1Y1VH 2ZJPA 4LUOA 4P72A 4X66L 2UUAL 2NVXH 2VY3A 2LXJA 1VS0A 3UDFA 1A62A 3PSIA 4JI0L 3HKZE 3M4PA 1Y1VG 4OWWB 2JE6I 3AFQA 5JJIA 1V9PA 2GVBA 1YEZA 4DV6L 4DR4L 1X55A 1K8GA 3W5OA 2CFMA 1SR3A 1VQCA 2IT1A 3K81C 3KLWA 3E9HA 1U0LA 3CP0A 3GTPH 1GKHA 1PYBA 1LUZA 1X54A 2XTIA 1HNZL 4P73A 1VQMA 2OWOA 5IYDH 4DV7L 5C4XH 4IPCA 1P8LA 2WAQE 2VQFQ 1X65A 4DV3Q 2UXBL 4YWMA 3U4VA 3F2CA 2ZJRA 2PI2A 3ERSX 4X65Q 4KHPQ 2PI2E 3PUVA 4GLXA 1D8LA 5IP7G 5IYDG 1KIXA 1HNWQ 4L5RC 1VQ9A 5C4XG 3UDIA 4R4IA 4DUZQ 4HJ5A 4BXXH 3EBEA 3KF8B 5C0XI 3J81j 4LFBL 4DV1Q 1ASYA 1MKHA 3S15H 3CCVA 1EUJA 1VQ4A 3GDEA 4K0KQ 2MO1A 3I55A 2KBNA 1CKOA 1Q8KA 3CCRA 2JJQA 4JI2Q 1N36L 1XTDA 4GS3A 1KHIA 3PO2H 4LW1A 5M5YH 2N3SA 4DR3L 2HT1A 2B63G 1CSPA 4GOPB 2JA7G 3S1RH 4YHHQ 1SROA 1QVCA 1J5EL 2D62A 3J81i 4IO9A 2K14A 2N78A 4B3RL 4DV0L 1XMQL 1HH2P 2ID0A 1UE7A 1K9MC 2OQKA 3PUZA 5E7NA 3KYHC 4LNQA 3GTKH 3DM3A 4RG1A 1HNXQ 1TWAH 2Q2TA 4AIMA 3GTGH 3TREA 5IE8A 4NXMQ 2JK8A 4UP7A 1WCMH 4A93G 3JC66 4DK6C 5GADC 4A3JH 1EFWA 1X9NA 1B70B 4HIDA 3OW2A 1OXSC 5C4JH 4UPAA 4B3TQ 3STBD 1VQBA 4AYBG 1VQLA 3EIVA 4JI6Q 1LTLA 3IRBA 1WFQA 1A63A 3PF5A 3AEVA 4LF6Q 2VQFL 4DV3L 2FXQA 4JG2A 1TWGH 3RLOA 3CCUA 2CKZB 3U4ZA 4X65L 1IBKQ 4KHPL 1HNWL 1E7ZA 4YCUA 1VQOA 4YWLA 3GTQH 4NB3A 1O7IA 5LMNW 4DUZL 4A3CG 1TWCH 3S17H 2HQLA 4DV1L 2NZHA 1UEBA 2Z6KC 4X64Q 1AE2A 4A3KH 4A3FG 1VQ7A 1Y1WG 2E2HH 4K0KL 4KHZA 4YWKA 3STBC 2E2IH 3PO3H 3OTOQ 4R4TA 1PH5A 1QUQA 3DLLA 1W3SA 4JI2L 2QEXA 3S1MH 5JEAG 1PH1A 1KRSA 2JA5G 4FDBA 4JI7Q 4HIMA 1Q7YC 3PUYA 4BY7H 2K52A 1PA6A 2RHSB 3PO3G 1OXTA 2DUDA 4JI5Q 1AE3A 2RF4A 3NENA 4YHHL 1NJIC 4BBSH 3HKSA 3PCOB 4A3GH 2Q2UA 4GLVB 2IX1A 1E3PA 5FJ8H 1HJPA 3CCEA 2CCZA 1K0RA 1CSQA 4LF4Q 4AH6A 1X3FA 4DR6Q 2F4VL 4BBSG 3M7NA 4QY7A 3I4NH 1L1OC 3AQQA 1QUQB 1IL2A 2UXDL 1M1KC 3CC7A 4QIWE 1HNXL 3Q8DA 4HIKA 4HIOA 3RNUA 2E8GA 4GNXA 2BA1A 4JV5Q 4NXML 2AMCB 4R4CA 4XIGS 1HR0L 3HOWH 1XMOL 3JAMc 2R7FA 4LFAQ 4L5SA 4PZ8A 2R92G 4KLKA 4A3MG 2K50A 1A8VA 2A1AA 4B3TL 2YTYA 4RMFA 1GO3E 3HOWG 4DV4Q 3KDFA 4JI6L 4LFCQ 1KXLA 1FJGQ 4DR3Q 4LF6L 1BKBA 1KL9A 2L15A 1IBKL 1YHAA 3S2DH 1YHBA 1PH3A 5C0XJ 3CCSA 3S2HH 1EOVA 4EQ5A 1VQDA 3CC4A 3H3VI 4X64L 3I7FA 3L2PA 5C3EG 5EAYA 1RL2A 1UE6A 3GD7A 1PH9A 4R4OA 2Y0SE 4P75A 4P74A 1NE3A 1CKNA 5M5XH 3OTOL 2Q2HA 2BA0A 3KDFB 4JI7L 1KRTA 2Z6KA 2UXCQ 1I5FA 5C0XG 2AWOA 1PYSB 2YTXA 4JI5L 2UU9Q 1CUKA 1E24A 1FVIA 3I2ZA 4JI4Q 4DPGA 3CQZH 1PVOA 5GAHC 3RR5A 3T1YQ 2MQHA 4APVA 2UUBQ 2QGQA 4DR2Q 2OTLA 3G48A 4LF4L 1FL0A 1SE8A 4DR6L 1V1QA 3PO2G 5K36G 3A74A 5IP7H 2KHJA 2VUMG 1ASZA 3S1QH 2PNHA 1TWFH 1CKNB 4YY3Q 3E0EA 4GOPA 1PH2A 2D0PA 3HOVG 2RHQB 2MFIA 2NZOA 3H15A 4JBJA 3TRZA 2E2JH 4GKJQ 4X62Q 3VDYA 4JV5L 3LGJA 4A75A 3HFZB 1VQPA 3TEHB 4NXNQ 4Y7NH 4LFAL 3U58A 3F8TA 3W1BA 2B63H 2JA7H 1R9TH 3PUWA 4J15A 4LF5Q 4JI1Q 4BBRG 1U5KA 4DV4L 1JB7A 4LFCL 1BVSA 3NELA 4C3HH 4IFDI 1FJGL 1N32Q 1KC8C 1YVCA 3CD6A 5M3FH 4YCVA 3L7ZC 2KHIA 4UP9A 1IZ6A 1PV4A 2VS1A 1L1OB 2K5VA 1OXVA 2ZTCA 3UDXA 5M3FG 4JBMA 2F4VQ 1LM0A 2R93G 3F2DA 3CCLA 1N33Q 1VQ8A 3RN2A 1E1TA 3B6YA 3A5ZB 2UXDQ 1RIPA 2QA4A 2JEAI 1N8RC 3GTJH 4LF7Q 4A93H 2OQ0A 2ATWA 3CMAA 1YJWA 2UXCL 2EXDA 1Q46A 2GN5A 5JJKA 3S16H 1TXYA 5LMNL 2UU9L 4LF9L 4A3BH 1HR0Q 3CMEA 4JI4L 1XJVA 1XMOQ 3T1YL 4GN3B 1YHQA 2UUBL 3ULLA 1Y14B 5HGQA 4PZ6A 4DR2L 1X3GA 1KQSA 1XPRA 3WWVA 4B3ML 2VZAA 5GQOA 3G6EA 4A3BG 3CW2C 3CF5A 1KD1C 3J81c 3CCQA 5GAGC 4C2MH 2WB1E 3M4OH 4YY3L 1EIYB 1LYLA 3F1ZA 1VQIA 4A3CH 3UE0A 1EYGA 1A0IA 4PMWA 2KENA 4A3FH 4BA2I 2V1CC 1JE5A 2F52A 3CCJA 3OYYA 1Y1WH 4GKJL 4X62L 3HOYG 4IPDA 1JJCB 2A19A 2Y0SG 4DKAC 1MIUA 3KFUA 2JA5H 1PH4A 2JQOA 4DNIA 3KOJA 4NXNL 3J7ZC 4DAMA 3HOXH 1IBLQ 2I0QA 5M5WH 5IYCH 1J6QA 2JA9A
chains in the Genus database with same CATH superfamily
1BO0A 4OO1G 2CW0C 1H9SA 3MVVA 4XXEA 3TSSA 3HOXG 2WB1B 1AZQA 1N32L 4A3EB 1YI2A 4IUTA 3BVZA 1PFMA 1P16A 2JA6B 1HXYD 2IHFA 2IY5B 1EU4A 4PG3A 2AWNA 1STHA 4A3IG 1H9SB 1OXUA 3NWSA 4EQOA 2RQXA 2R92H 4A3LG 2K5HA 2EYFA 3RD4A 4CJ2C 3QOJA 4IOCA 2JA8B 4ZKCB 1MI2A 1STYA 1SYBA 1UE1A 4DV5Q 1EL0A 3T51B 4ZUIA 5I6YA 1CTMA 3I4MB 1BDOA 1TY0A 2FFKB 1STNA 4OIJA 2LSSA 5KYIA 3IAYA 1YJ9A 3SK5A 2JSOA 2Q8TA 2PMZE 1X6OA 1VQFA 5IY0A 2K5QA 4HJ9A 2ICIA 5L37A 1GHKA 4G7HC 4IFDJ 1QVFA 2WFWA 1UUPA 1RTNA 2KOLA 2RVLA 5K5PA 4UHVA 3OSOA 1PFNA 5C44B 2CH4A 3PO2H 2VUMH 4QGUA 2A8VA 2Z6BA 2HIXA 2PMZB 3I4OA 2E5LQ 3HOVH 1JOOA 3PIPA 3HOYB 4NPSA 1M90C 4JW0A 2N88A 1HZBA 2B8FA 3GTKB 2N49A 5FLXc 1VCIA 5FLMH 2A73B 1I4HA 1CA6A 4BBRH 4DV5L 4ZLTF 1PRTD 1HZ9A 3CAMA 1ET6A 5FLMG 2R61A 1YJNA 2NTSA 1SEBD 1EQQA 1BXTA 3CCMA 5T1IA 5I6WA 3OPOA 1SYCA 3E9IA 1SFOH 5FK9C 1QVGA 3GTQB 1PRTC 2PZTA 1TWCB 1HQMC 4PNYA 2ZM6Q 4FF2A 5G3LF 3QB3A 1SJHD 1DJRD 4WRDA 3GO5A 1PH7A 4B9WA 2PO4A 3VR3A 2E5LL 3I56A 3PIP3 3MA2B 2HDLA 2PYKA 2K5NA 1YNJD 4GNXC 3I72A 4L63B 2KCMA 1STGA 3BG3A 3FHWA 1PRTF 5LL6S 1PFBA 2VQEQ 3KBXA 2JP1A 4OELB 3NE5B 2K4KA 4RKBA 3CPWA 4KK7A 1YNJC 4DA2A 3K7UC 1I94Q 5LHY1 3ERQA 3T1HQ 1LTRD 1KDCA 1L0YB 3A7LA 4Z9CB 4EX5A 3NBHA 1JT8A 3GP7A 1F9RA 3I4LA 5JEAJ 1B50A 4JYAQ 1GM5A 3H0GB 4DK0A 1WYDA 2NN6G 3MFGA 5COYA 3ND8A 4X66Q 2ZM6L 2NVTH 2IHEA 3OMCA 4A4IA 3W2DA 1XTCD 2YU9H 3CPFA 5CBEE 2MO0A 4DAPA 4A3KG 3NBHB 2KA7A 5IYBH 5M3MH 2WAQG 4R9WA 1HNZQ 1G291 4A3GG 5C4XB 2M00A 1VQNA 2B2WC 1PRTB 5FJ8G 1SNCA 4ULLA 3RZDH 2NB0A 1DGSA 2VQEL 1SYGA 1PH6A 3EJIA 3ER0A 4LFBQ 3D4WA 1XNQQ 1TS3A 3OIQA 1YNXA 4H0LC 3HS0C 1OTCA 1HTLD 2HD3A 1I94L 4C3HB 1AZPA 4MZ9A 1U4LA 3T1HL 3OMGA 4IFDH 5I2XA 1Y69U 3VR5A 2KCTA 1CHQD 1TWHH 4AYBE 2F0SA 3HGBA 4JYAL 3E3XA 3EFXD 3K80C 5EKKA 4GNXB 4IFDG 2B2TA 3BZDB 1Y1VH 2ZJPA 4LUOA 4P72A 4X66L 3IKJA 1KNEA 1IYUA 3HKZE 1IHZA 3M4PA 1Y1VG 3AFQA 3PMFA 2LMCB 1V9PA 1AFPA 3HZXA 4AYBB 4BS9A 1VQCA 4TKOB 3J81L 2IT1A 5CYUA 1DD2A 2EJFC 2K03A 3E9HA 3GTPH 3I90A 1LUZA 1X54A 1FR3A 2DNEA 1HNZL 3M4OB 1H9JA 2VQFQ 3HKZB 5A35A 2ZJRA 4RGNA 1Y1WB 2PI2A 2PI2E 3PUVA 1HA5A 3I8ZA 1B1ZA 3D6WA 3UDIA 4CDDC 5J39A 4DUZQ 5C0XI 4LFBL 2F0FA 5A2QE 4XT1B 2KBNA 1LT5D 4P2CB 4DXGA 2VB3X 4RAUC 3SHLA 1PDQA 2DY7A 1KHIA 4LW1A 5M5YH 4HMJA 1CSPA 2J4XA 2JA7G 5KNCA 3MZ5A 4YHHQ 1I4RA 3UI2A 2L5TA 1DM0B 4FF4A 5C5LA 1S5FD 4IURA 3H94A 1QILA 3KYHC 3IFDA 2R92B 2Q2TA 4AIMA 3GTGH 4NXMQ 5IT9E 3HOWB 5JPNC 2JK8A 4A93G 2MGSA 2K6AA 1JWUD 1B70B 4RWSC 3J7YW 1O7ZA 1WFQA 1Y8OB 1ICFB 2VQFL 2FXQA 2KCNA 4DU9A 2E74C 3CRKC 1Z7TA 4IQZA 4DUZL 1O7IA 1FNWA 4A3CG 1QJOA 4KKUA 4X64Q 4KHZA 3OTOQ 4R4TA 4C56C 1J8IA 3NXWA 5JEAG 1E2WA 1KRSA 1PH1A 4HCEA 2PZUA 4BY7H 4CGYB 1OXTA 3NENA 4YHHL 3HOVB 3V05A 1UNSA 1CSQA 5FLXL 1EY9A 2F4VL 4QY7A 5ELFA 3BYYB 2UXDL 1M1KC 3DEOA 4HIKA 2BA1A 2Z8LA 1PTOB 4NXML 1CK1A 2AMCB 3MWYW 4Y7NB 1HR0L 3J7AV 1XMOL 4PZ8A 1EQVA 2WV6D 1A8VA 2YTYA 4RMFA 3Q22A 1KXLA 4DV4Q 4KTAA 4LFCQ 4DR3Q 2L55A 1BKBA 1GUOA 1A3TA 1G2TA 1SFOB 1PH3A 1VQDA 3KLSA 3H3VI 4X64L 3GD7A 5M5XH 3OTOL 2A6ED 3MXUA 2BA0A 4CHTB 4U68A 4TRDA 3S16B 4JK1C 4M1UB 4G7OC 1CUKA 1FVIA 3I2ZA 4IUUA 3A8KE 4HN7A 3CQZH 1SNQA 1PVOA 3RR5A 1QNKA 4APVA 2B2UC 5M9OA 3A74A 5NUCA 2A6EC 3SXHA 5KIXA 3NTHA 3MEHA 3KK7A 3EROA 1U4RA 1ZKOA 2NZOA 4DK1A 1PMRA 4JBJA 3SR1A 1HUNA 4X62Q 3FDTA 1JORA 2JA5B 3N52A 1IKMA 4ZRZA 1JOQA 2NZ1D 3GQBA 4FF3A 4RFBA 4J8QA 4JI1Q 1JB7A 1U5KA 4DV4L 4LFCL 1B3QA 5FLXE 4YCVA 2E75C 3K5OA 1PV4A 2B2YA 3UDXA 4JBMA 1LM0A 2F03A 3CCLA 1SE3A 1VQ8A 1XWEA 3NQTA 2O5JC 2E2DC 1D5ZC 3A5ZB 3M7GA 2J7ZA 4LF7Q 1YJWA 2EXDA 4N9PA 4LF9L 1JOKA 1TS5A 4NDXA 3URYA 3KLRA 4PZ6A 5M3MB 1TIID 4DNRB 4C2MH 1JB3A 5GAGC 1LYLA 1BBXC 3S1NB 2TSSA 3TP6A 2XRSD 1J9OA 1H9MA 1W6JA 4IPDA 4X62L 1BUVT 3DEPA 1A2TA 3RZDB 3HOYG 5CBAE 5J22A 4OL7A 1BOSA 4FNFA 3ITPA 4JI1L 1F9SA 1D1KA 3AB9A 4UY8C 3PF4A 3D0FA 4CJ1B 1X32A 3KJOA 4KI0A 2FJ2A 4ME5A 2LS01 4B3RQ 4OGQC 2NVQH 3GTLH 3U50C 2L11A 2QDBA 3S24A 3BU2A 2SNMA 3AYHB 4DAYA 3S14H 3M85A 2R3ZA 1B8AA 2DJGC 2N8NA 3PQIA 1G6ZA 1LV9A 3K7AH 4M8AA 3EA6A 4JPBW 4LF7L 3H3VC 1VQEA 1ILQA 1PFSA 4EQNA 4A3MH 1EY4A 1B2TA 2BCOA 4QL5A 5GAEC 2AHOB 4DR5Q 4HTHA 4C3IH 1Z6HA 3RZOH 4B9XA 4HJAA 1PYWD 4IJLA 1LTAD 1MHWC 3CC2A 1FGUA 4AQYQ 1MJCA 5J3BA 5BN4A 2WKDA 3PIOA 3BZKA 4DAYB 3T4AC 3A5UA 3PGZA 5F2DA 1C0AA 1F2MA 4RGMA 1SN8A 2I5LX 2Z0SA 1CFMA 3MHBA 2ZTEA 4K6DA 1C9OA 1NBWA 3PUXA 4KKSA 5I2YA 2F1MA 2GVAA 1QZHA 1K3RA 5D14A 1IXRA 3TZDA 1IBMQ 3HOUH 4A3DB 1WTQA 2KQ3A 2WP8J 2ZJQA 5LMNQ 2VL6A 4B3RL 1EWIA 3HOUG 1Q82C 2RA4A 1PH8A 2ICEC 2R7ZG 1PHJA 4B3MQ 2Z1CA 3JAME 2ASBA 1EU3A 5FO8B 1TT2A 2I5MX 1PXUA 1EIGA 4YCWA 2Q2IA 5IGEA 4JOIC 3G6JB 3OWEB 4PZ7A 4BY1G 5GROA 4LWCA 3H0GG 4I65A 2K05A 3KBGA 3GTGB 1L1OA 4DR5L 1Z9FA 1O78A 3EN2A 3EVQA 4K2KA 3PIO3 4AQYL 1WD0A 4HCSA 1EFID 5E3FA 1WTXA 1L2FA 3KJPA 1Q81C 1JC7A 3L9AX 2ENBA 3AMUA 5IT9c 3F2UA 1G6PA 3OWFA 2PZWA 2QDLA 1X3EA 5C3XA 1S5DD 2PQAA 3CKIB 1IBML 1HQRD 3TQYA 1K8MA 3K5NA 2WIIB 5KNBA 4XYOA 4BY7B 4R1JA 3MXNA 1SE4A 1GUGA 4JBKA 3GTMB 4CKEA 1BF4A 1NY4A 5ELBA 3HOZB 4HMIA 4LUVA 5IWAQ 5C4ZA 2PQAB 4HEDA 4OX9Q 1D2BA 3SVMA 3FKIB 3MXNB 4QCLA 2WINB 4JOIA 1GD7A 1YBYA 1SMXA 4TQUS 2I46A 2LKVA 3BZCA 4JI3Q 2A5HA 2BDNA 5IIFA 5CV7A 4A3JG 1Q86C 5IGGA 1LO5D 4ABNA 4DFAA 1QB5D 4PMCA 4WORA 4A3IH 2X6GA 1EY5A 3P20A 2O5IC 2LXKA 4JI8Q 4A3LH 1NMGA 3HKZG 2L4NA 5CV6A 2NVXB 5EBDA 2EIFA 1DONA 5M5XB 1QG7A 4JI0Q 1GUSA 2ZXOA 4WJ4A 1EOTA 1SLJA 4DR4Q 1IW7D 4HSVA 5CR3A 1JMCA 4UDUC 1ENCA 3CQZB 1IYVA 3DXJC 3CRLC 4NKLA 3D3RA 3CXCA 1ICWA 1TR5A 4GOPC 2HCIA 2NVYH 4QUCA 5IWAL 2MJ8A 3SE0A 4OX9L 1IW7C 4OO1I 2AUKA 4PQXA 4MN3A 5JVH3 4ME3A 1G51A 4GN5A 1KLUD 3GV6A 3L0OA 4L5TA 3G71A 3A0JA 4FVMA 1O7YA 4DGZA 3RMHA 4IOAA 1EIHA 4JC0A 4JCVE 4JI3L 4JBWA 4XYQA 3SK8A 1VQ6A 2M2LA 3IL8A 1PZID 2OCEA 3FPPA 1XMQQ 4JI8L 3WOFA 2VY3A 2PCFB 3C2PA 1A62A 4JI0L 1ML0D 1ZYRD 1C4QA 4OWWB 4DR4L 1LLRD 1MD2D 1WCMB 4LAAA 1SDFA 5J1ZA 3K81C 4C1NK 2X6LA 3CP0A 4P73A 1EY8A 3R93A 1ZYRC 1WTHA 1X65A 3TBIB 2SNSA 3TMEA 4GLXA 5IP7G 1HNWQ 1KIXA 1ESRA 5IOCA 3EBEA 4DV1Q 1ASYA 2E2IB 2O4XA 3I55A 1CKOA 1Q8KA 3TP7A 3S1MB 2JJQA 2F0WA 3D4RA 2EY5A 2RDHA 4X3UA 2B63G 4GOPB 4BBSB 1QE6A 2NVQB 3S1RH 3BS1A 1SROA 3GTLB 1WD1A 3D4DA 3QJYA 3J81i 3C1FA 3X3NA 5JAVA 1XMQL 1PLFA 1HH2P 3S14B 3I4NB 1K9MC 2OQKA 2L12A 2OEOA 3PUZA 3K7AB 2KCCA 4LNQA 2RKSA 1Q90A 3K0YA 4RCOA 4A3MB 1GXDC 3MXPA 3NQIA 5IE8A 1AP0A 3RZOB 2XN9C 3NSWA 1CA5A 2QW7A 4HIDA 3SK4A 5C4JH 2PQEA 4B3TQ 2I07B 1VQLA 1A63A 3EIVA 3TN2A 1LTLA 4MIUA 3AEVA 2NN6H 4JG2A 1TWGH 5KNDA 1HNWL 1VQOA 4YWLA 4NB3A 5LMNW 3I3CA 3S17H 4DV1L 2NZHA 2Z6KC 2F0TA 4G57A 4A3FG 1SJED 4IUVA 4A3KH 2E2HH 3PO3H 1PH5A 2CH4W 2JA5G 5A2QL 3PUYA 3PO3G 3W3AA 1AE3A 4A3GH 5DM73 2Q2UA 4LMQD 5FJ8H 1JE4A 1HJPA 4PMBA 2CCZA 4AH6A 3K58A 2E76C 2FMMA 2Q8RE 4KN4C 4IN3A 4ZK9B 2F0LA 3TP5A 1IL2A 3CC7A 3Q8DA 3VR2A 1LT3D 4HIOA 2E8GA 2FHTA 4FXGC 4GNXA 3NTIA 2NWGA 2F0DA 4R4CA 4K5WA 3JAMc 4L5SA 4ODGA 1JWMD 2K50A 5IT9L 1XX8A 2A1AA 4CKCA 4B3TL 1BNZA 2QEJC 1FJGQ 3K59A 5M3FB 3MTSA 1FGBD 2G9DA 3S2DH 1F2ZA 3S2HH 2BDOA 1VDZA 3CCSA 1SYDA 5C3EG 5EAYA 1UE6A 4P75A 2PW5A 4P74A 1NE3A 5JJZA 3GTJB 2Q2HA 2SEBD 5ISRA 2Z6KA 1BCPD 2UXCQ 5C0XG 1CHPD 1PYSB 2XIWA 2UU9Q 1E24A 1JQYD 5DEHA 2UUBQ 1TKWB 2C5CA 1V1QA 2IPKD 1DOMA 1ASZA 3S1QH 2PNHA 4K5VA 4YY3Q 1BCPC 1EY0A 2B8GA 3TRZA 3LGJA 2B2WA 4C3JG 4A75A 3HFZB 3HOXB 1VQPA 5M5WB 1XXGA 1FYCA 3U58A 3F8TA 2JA7H 1R9TH 3VR6A 4IFDI 2EYLA 1FJGL 1YVCA 4R8NA 3CD6A 3K57A 5BN3A 3D6CA 4A3IB 3SEBA 1I4XA 1NNXA 2VS1A 2K5VA 1E2VA 2XRQD 2F4VQ 2R93G 3F2DA 2F0EA 1N33Q 1DOLA 1BCPF 4PV1C 2UXDQ 4HR7B 4A93H 2ATWA 2UXCL 5JJKA 2GN5A 2AQ1B 2UU9L 4A3BH 1HR0Q 3CMEA 1XMOQ 3MFYA 2UUBL 3TP8A 1XPRA 2IL8A 4A3BG 3OW7A 1KD1C 3Q23A 3CCQA 3H91A 4YY3L 4A3CH 3F1ZA 1WVLA 3UE0A 3T56B 1A0IA 1U4MA 3RUZA 2F0KA 2V1CC 1JE5A 2F52A 3CCJA 2IW3A 2A19A 2Y0SG 1O7LA 5JEAH 1PH4A 1KDBA 2JQOA 4DNIA 1IBLQ 4RCNA 2I0QA 2VXWA 2EJGC 5IYCH 1J6QA 2JA9A 2K01A 5CV9A 1WI5A 4F87A 3ZYYX 1A15A 1STEA 2F0UA 4DR7Q 5C5MA 4LF8Q 5IYCG 3PO2B 1EZ6A 2YTVA 2VUMB 2F3WA 4QJFA 2HIVA 4RA8A 1SBBB 4A76A 1GVPA 2F0JA 3FVQA 1RKNA 3KLSX 1U9RA 1N33L 1JWSD 1GOZA 1V1PB 1X56A 2F0QA 1JJ2A 1BBUA 3I70A 1BR9A 4BBRB 1K83H 4OONA 1NR4A 1EYAA 4E6IA 1CQFA 4XQQA 4MTNA 2HHHL 5ELEA 4ZKBB 5CV8A 1XNRQ 3M3YH 1CKMA 4RGOS 1CZWA 2F3IA 1WTVA 1JR0D 2VW9A 5H1SE 3BDOA 3H6MA 1IBLL 1ENFA 4QMGA 5ELOA 3MXGA 1OXXK 3FKIG 5JJLA 1AH9A 2EXZA 4DR7L 3ONAB 4LF8L 2F0MA 4LF9Q 4IPHA 1KAWA 1N9WA 3VR4A 3S1RB 2UUCQ 2EE1A 1DZ1A 2IWHA 5LMUQ 4TVAB 1HZAA 4KY6A 1Q1EA 2WB1G 4B3SQ 4A3EG 2J0TD 4WJ3M 4Q5VA 2DJFC 2JA6G 1F2YA 1KLGD 1V43A 1E22A 1A3VA 2YV5A 3J7A5 1T9HA 4LK1C 3GTOH 1S4ZA 2JA8H 2K5DA 1KABA 1QZGA 1HTPA 3K8AA 4G4KA 4CBVA 4IJHA 3RLNA 1KDAA 5C4JB 4F8MA 4KD4A 1GJXA 3J80i 2JA8G 1TY2A 3I4MH 3EQLC 1TWGB 1XNRL 4U673 2EZVA 1WOCA 3I4MG 2JYOA 3S17B 1KTKA 5KGUA 2E2HB 1QOHA 5DLQE 2NVTB 5DM63 3F2BA 2YU9B 3ZJYC 1SE2A 1VQ5A 4BXXG 3K5MA 1B4OA 3D31A 1FNUA 2OTJA 3DMUA 4EGVA 2UUCL 5C44H 1FNVA 4A3GB 5LMUL 2CWPA 4B3SL 3LWUA 3WDNA 3NBIA 4DF7A 5IP9H 5C44G 3A56A 4XQJA 3HOYH 4GLAC 3CU7A 3HRZC 3H09A 2B2UA 3RN5A 1C48A 3JAML 5IP9G 1T5EA 1NCVA 3SGIA 1UWVA 2SDFA 5I9OA 2ALYB 2BH8A 2D5DA 3E6ZX 1WCMG 1X3PA 2A6HD 5D65A 3FP9A 1TWHB 4H02A 4ILWA 2JN4A 1GUTA 1Q1BA 2MHVA 4F88A 4OXPA 4LJZC 1Y1VB 2UUAQ 4OWXB 1F77A 5JOBA 1EEID 2L9HA 2A6HC 1K8AC 1HZCA 2K32A 3R2TA 2MNAA 4N8FA 3GTPB 2F0VA 2EVBA 2ZTDA 4IALA 2QF7A 1K0SA 2C9OA 4OEMB 4POGA 1C7YA 4X6AH 1GUWA 3WOEA 2H5XA 2LFNA 3BJUA 3I4NG 3BVGA 4B08A 3C46A 1SAPA 2K5WA 2JA7B 1R9TB 1CM9A 1I4GA 5M5YB 1A6XA 2R7ZH 3M4YA 1NTGA 1S3OA 2F3VA 2R6GA 3QG1A 1B3AA 1X3QA 3NEMA 1Q8IA 1J5EQ 1E1OA 3ULJA 3C3LA 4BY1H 2EYPA 4FP5D 4DV0Q 1LACA 3H0GH 5KYLA 1HR0W 1ONLA 2UUAL 1FD7D 1VMPA 1RDPD 3ND9A 1B44D 2F0PA 2LXJA 3UDFA 3PSIA 4A93B 3BVMA 2JE6I 3I91A 1CQVA 4L6TB 5JJIA 3MAQA 1K8GA 3BDLA 2CFMA 4FO2A 1SR3A 1U4PA 3KF8A 1ESFA 1ZXTA 4ZUJA 1U0LA 1RHPA 1PYBA 1D5XC 5E4WC 2XTIA 2OWOA 2ZXRA 5C4XH 4IPCA 1P8LA 1SYEA 1S5CD 5LL6X 3U4VA 4KHPQ 3ERSX 2XSCA 1D8LA 1GHJA 4L5RC 5C4XG 4R4IA 4HJ5A 3KF8B 3J81j 4H13C 1MKHA 3K5LA 3S15H 3CCVA 5AFWA 1EUJA 1VQ4A 3GDEA 4K0KQ 2MO1A 2HQEA 5C4HA 4JI2Q 1XTDA 3AU7A 2N3SA 5TSSA 2Z4IA 2CQAA 4KJNA 1QVCA 1J5EL 2D62A 4C3HG 3A8IE 1AW7A 4DV0L 2F0HA 1UE7A 4ZQ3A 1C8CA 1AN8A 1M4VA 5E7NA 3L3OC 3OIPA 4RG1A 1HNXQ 1TWAH 3NUCA 4UP7A 3CHBD 3JC66 4DK6C 5GADC 4A3JH 1X9NA 3P75A 4UPAA 4FYDA 1VQBA 4K8IA 3DHQA 1CI3M 4AYBG 1W6KA 4LF6Q 4X3TA 4TSSA 3RLOA 4KHPL 3U4ZA 1IBKQ 3M3YB 2RDFA 3E0JA 1E7ZA 4RHSA 2HQLA 3G7LA 1UEBA 3NTKA 5I9PA 2XNAC 1Y1WG 4K0KL 1QUQA 1W3SA 4JI2L 4FDBA 4JI7Q 1Q7YC 2VB2X 4K5XA 4X3KA 2K52A 4JI5Q 2HDMA 2IX1A 4GLVB 1DOKA 1E3PA 5D3IB 1K0RA 4LF4Q 4DR6Q 5EPJA 4NP5A 3T13A 2ZT9C 3NK9A 2G5DA 3AQQA 1QUQB 4FXKC 4QIWE 1HNXL 5EKIA 3RNUA 3GTOB 1ET9A 1SSOA 2PNRC 1SYFA 2N55A 1MBYA 4XIGS 3HOWH 4G7ZC 4LFAQ 1STAA 2R92G 3HOWG 3KDFA 3OHXC 4O42A 4LF6L 4QIWB 1Q3LA 1IBKL 3SDZA 1YHBA 5T1GA 3V96A 4FF1A 5C0XJ 4KN7C 5FOBB 4EQ5A 1JICA 3CC4A 1EEFD 1RL2A 1EQTA 1TS4A 2KVMA 4DAVA 2PPBC 1CKNA 5EBCA 2EOTA 3KDFB 1T5XD 2G9HD 4JI7L 1KRTA 1R4QB 4J6HA 2AWOA 1A3UA 4JI5L 1RODA 5K36H 4JI4Q 4DPGA 2CHBD 5GAHC 5G3LD 2MQHA 2O2LD 2QGQA 1DYQA 4DN4M 4DR2Q 3G48A 2OTLA 4LF4L 1FL0A 4DR6L 3PO2G 5K36G 5IP7H 4C2MB 2KHJA 2VUMG 1TS2A 4ID6A 1TWFH 1CKNB 3E0EA 3TDQA 4GOPA 2D0PA 1PH2A 2RHQB 3HOVG 2AUJD 5I4DA 3BYTB 2E2JH 4GKJQ 3VDYA 3QOLA 4MHEA 1PTOH 3TEHB 4Y7NH 4LFAL 1DXMA 1TQOA 2B63H 3W1BA 2EYOA 4L8JA 4J15A 4LF5Q 2XVSA 1LTID 3I73A 4BBRG 1BVSA 3HEJA 4HAEA 3FPUB 1KAAA 1KC8C 1NAPA 2QCPX 3D8GA 5JPMC 5CORA 4UP9A 1IZ6A 4RH6A 1HFNA 3P1HA 1E1TA 3FEWX 1RIPA 1SXTA 1CZGA 2OQ0A 3CMAA 1LT6D 2AQ3B 1EYCA 1Q46A 1K3BC 1TXYA 4C3IB 4CJ0B 5EPKA 3S16H 5KEEA 1MSHA 4YIJA 4JI4L 3HP3A 1YHQA 3ULLA 3X3MA 5HGQA 4DR2L 4KY7A 1X3GA 1RD9D 2VZAA 5GQOA 4UAIA 3CW2C 2V4DA 1VQIA 1EYGA 4PMWA 2KENA 4A3FH 2RCFA 4BA2I 1HA6A 3OYYA 4GKJL 4KMUC 1JJCB 2IX3A 1MIUA 3KFUA 2JA5H 1LTGD 3KOJA 3TZUA 4JVZA 4QUFA 1K73C 4LF5L 3HOUB 2K75A 2XGTA 2P5ZX 1YZ6A 2R7ZB 1H95A 2B2TC 1PZJD 2F0GA 2R7DA 4DUYQ 2C35B 1L0XB 1QCBD 4GZYC 2JEBI 5AJ3Q 1OO9B 2XWJB 4Y52H 4BY1B 2PW7A 1LTTD 4LUZA 2B39A 5JVG3 3RLFA 1IYJB 3A54A 4ZAIA 2NBFA 1WJJA 4DV2Q 2ZXPA 1D7QA 4POFA 2EYHA 5EQ0A 4CKBA 4BWGB 5CC4A 1Z47A 2RDGA 3M4QA 3U9OA 4CDEC 3FRPB 1A2UA 4KD3A 2KEEA 5C6AA 1Q12A 5E1FA 2MP1A 2NN6I 3NPPA 4CDFC 1LABA 5IYBG 3M9BA 5C3EH 3S1NH 2EQSA 5BR8Q 5CGKA 4Q0FA 4K6LA 5M3MG 4GKKQ 2D9UA 2H4OA 3K0XA 3O13A 5IODA 3TS2A 2YYZA 1YIJA 1I50H 5CMDA 4DR1Q 2K7VA 3S15B 3VYTA 2A69D 5C0XH 1VQJA 3A7AB 1N34Q 1BBWA 3DM1A 1K28A 1EY7A 2D0OA 2M9VA 2GA4B 4QB4A 4DUYL 2BH2A 4OHJA 1XPUA 2F4IA 5AJ3L 2BE5D 3KF6A 2A69C 1EY6A 5HY6A 5HURA 3DUZA 4C3JH 1TU2B 1H9RA 3IFTA 4BA1I 4IUPA 1I4QA 4GN4B 1HRJA 1I3QH 3UE1A 1TWAB 4WJWA 1JCKB 2RCNA 3NWTA 2FINB 4DV2L 2BE5C 3QIAA 1WTOA 4A3JB 2IJ0A 4R8IA 3KF6B 3ULPA 1B9NA 1S40A 1HFGA 2B2VC 1L0WA 3VYRA 2CVRA 4S3SA 3G4SA 3OOCA 1PTOD 4IZ8A 1RF2D 5KRUA 2R93H 5D3DA 5BR8L 2RSNA 2Z9HA 1B53A 2LY7A 2KECA 4GKKL 2TMPA 1E0BA 2AKWB 4XTCS 3PV0A 4H7BA 4DR1L 1VQKA 5ELCA 1XNQL 1N34L 4UP8A 1SRUA 1PTOC 2NUCA 4A3DH 2OXPA 3ICEA 1HUMA 4F7XA 3J80c 4A3DG 1II3A 1AEXA 4ZYSA 2NVYB 4QQBX 2ES2A 1WTWA 2HHHQ 3QO2A 1F2LA 4MNOA 2F0OA 4O2DA 1VQGA 4OWTB 1SNMA 2B3GA 1Y8NB 2KHSA 1F9QA 1NMFA 1PTOF 1V1PA 2IX0A 1B7YB 4L5QA 3KUPA 1PZKD 3Q0AA 4HJ8A 3FMCA 1S72A 1MJEA 2VNUD 2B2VA 2L0CA 1YITA 4O0AA 3NHHA 1BCPB 3VYSA 4ALPA 3H3VH 2EPBA 2A68D 2CWAA 4R4QA 4IPGA 4ZCKA 1D5MC 3J81E 1UAPA 3JAMi 1W2BA 4DK3C 1I6HH 2EY2A 4KHVA 4DV6Q 3GTMH 2NTTA 4HJ7A 3DWAA 2WKCA 4BY7G 2A68C 3HOZH 3VA7A 1LT4D 1VQHA 4DV7Q 1V1OA 1TWFB 1JJGA 1WTRA 2FMCA 2UXBQ 1EQRA 3W1GA 3HOZG 1I4PA 1EYDA 5ELDA 2E2JB 1MGSA 3FKIH 1RCVD 1UE5A 3R3OA 1XYIA 3C1EA 2B63B 2B29A 1XPOA 2CQOA 4J1MA 2DNCA 1N36Q 4K14A 3AFPA 1VQAA 2B2YC 4OIKA 4A3EH 1NR2A 1F9PA 5ELNA 1YNND 3MEFA 1V8QA 2JA6H 4P71A 1SMYD 1D1IA 3UDGA 3TS0A 5IGFA 1RJTA 3DWQA 5DAUA 1VF7A 1EIFA 2DGYA 2I5HA 4QF4A 5BN5A 2WACA 1Y8PB 2MPMA 2NVXH 1STBA 2EYJA 1TVXA 1SNPA 1VS0A 1LTBD 1YNNC 2QKIC 4RGTA 3A8JE 2GVBA 1SMYC 1YEZA 4DV6L 1X55A 4EVOA 3W5OA 1EWCA 3KLWA 1GKHA 3VA5A 4DNTB 1VQMA 3SK6A 2F0IA 5IYDH 4DV7L 2D2CC 2WAQE 2UXBL 4DV3Q 4A3FB 4YWMA 3F2CA 3E5SA 4X65Q 5IYDG 1VQ9A 2DN8A 4RHRA 1D6EC 4BXXH 4A3KB 5FO9B 4RKLA 3PO3B 3CCRA 4O1NA 1O80A 4KV6A 1N36L 4GS3A 4MTKA 1CT1D 1S5ED 3N6RA 2WAQB 1G2SA 4DR3L 2HT1A 4IO9A 1IKLA 2K14A 2N78A 2ID0A 3GV3A 2K04A 1HCZA 3R8BA 3GTKH 3DM3A 1IL8A 3TREA 3BDCA 2KJXA 1WCMH 1K8OA 5FKAC 1B9MA 1EFWA 3QWNA 4V0BA 3OW2A 2X69A 1OXSC 4WFN3 3STBD 4JI6Q 3IRBA 4CDCC 1QNUA 1ENAA 3PF5A 4KJOA 4DV3L 5C3EB 3S2DB 2RSOA 3CCUA 2CKZB 4X65L 3DWPA 3S2HB 3K6OA 4K8JA 4YCUA 1HHVA 3GTQH 4IUNA 1I50B 1QWYA 1TWCH 1WTPA 4KY5A 2H1EA 1AE2A 1VQ7A 3STBC 4YWKA 4KKTA 2E2IH 2L1BA 3DLLA 3S1MH 2QEXA 4X3SA 2HCCA 1SNDA 4HIMA 1PA6A 2RHSB 2DUDA 1DCZA 2RF4A 4BBSH 1NJIC 3HKSA 3PCOB 5EPLA 2EY6A 4K2LA 3CCEA 1MSGA 1X3FA 2EYMA 1NSNS 4BBSG 3M7NA 3S1QB 2KUMA 4C3JB 3I4NH 1L1OC 2NYZD 3S9WA 3R2IA 2DY8A 3U9SA 1I3QB 3T16A 3NP8A 2EY1A 3J7AF 4JV5Q 1G91A 5IGBA 5EGTA 5IGDA 1EZ8A 5C3WA 4XDXA 1G8ZD 1S5BD 2R7FA 4KLKA 4A3MG 1GO3E 4C3IG 1EWHA 4JI6L 2K33A 3LWEA 4V190 1KL9A 2R93B 1LTSD 2L15A 4XQNA 1H9KA 1YHAA 3Q24A 1M8AA 1EOVA 1BQQT 5FO7B 3I7FA 3L2PA 1PH9A 4R4OA 2Y0SE 3V2TA 2Z4HA 4I7ZC 3J80L 2OF1A 2A74C 1I6VC 5EJWA 1I5FA 4A3BB 2YTXA 4H44C 4HSPA 5E4XA 3T1YQ 4FXDA 4NMZA 5DNFA 1SE8A 1RTOA 1HPCA 2Y0SB 1R4PB 3LNNA 3T53B 1SNOA 2EDGA 2MFIA 3H15A 3P7JA 5CV4A 1ZEQX 5EKLA 1E2ZA 4JV5L 4EQPA 4IUQA 5IGCA 4NXNQ 3A55A 4NW2A 4C1NI 3PUWA 2SOBA 1ILPA 3NELA 4C3HH 5HGTA 1KNAA 2RBMA 2F0NA 1N32Q 2KEDA 5M3FH 2JXMB 3LX0A 2AQ2B 3L7ZC 2KHIA 1VF5C 1L1OB 2ZTCA 1OXVA 4XT3B 4N9TA 5M3FG 1NUCA 2MUYA 3RN2A 3B6YA 1GUNA 2OT2A 3HG9A 2BOSA 2QA4A 2JEAI 1N8RC 3GTJH 1VMCA 3MC0B 4N8X1 1I6HB 1K83B 5LMNL 2QILA 3QR8A 1XJVA 2HUGA 3T1YL 2K28A 4GN3B 1Y14B 1KQSA 3WWVA 4B3ML 3G6EA 3CF5A 3J81c 3M4OH 2CW0D 2WB1E 5CV5A 1EIYB 4I7AA 1UEAB 1Y1WH 4DXFA 2EJMA 2K1BA 4DKAC 4OO1H 2XWBB 3J80E 2Q8IB 3J7ZC 3Q6SA 4NXNL 3VYUA 3HOXH 4DAMA 5M5WH
chains in the Genus database with same CATH topology
1K73C 1WI5A 4LF5L 4OO1G 4JI1L 2K75A 2XGTA 4UY8C 3HOXG 3PF4A 1YZ6A 3D0FA 1H95A 4DR7Q 1N32L 4LF8Q 5IYCG 3KJOA 2YTVA 4KI0A 1YI2A 4B3RQ 2R7DA 4QJFA 4DUYQ 2NVQH 2HIVA 1P16A 2C35B 3GTLH 2IHFA 2JEBI 3U50C 1GVPA 5AJ3Q 4A76A 2IY5B 4Y52H 3S24A 3BU2A 3AYHB 4LUZA 4PG3A 3S14H 3M85A 1N33L 1B8AA 2AWNA 4A3IG 1X56A 2N8NA 3RLFA 1IYJB 1OXUA 3K7AH 4LF7L 1VQEA 2R92H 1JJ2A 1PFSA 1BBUA 1WJJA 2K5HA 4A3MH 4A3LG 4DV2Q 4IOCA 4QL5A 5GAEC 1K83H 2AHOB 4POFA 4DR5Q 4C3IH 3RZOH 1UE1A 4OONA 4DV5Q 1D7QA 1Z47A 3M4QA 4HJAA 4IJLA 3CC2A 1FGUA 4AQYQ 1MJCA 5J3BA 3PIOA 3BZKA 4DAYB 3A5UA 1Q12A 3PGZA 2NN6I 4MTNA 2HHHL 1C0AA 5IYBG 3M9BA 5C3EH 3S1NH 2EQSA 5BR8Q 1XNRQ 3M3YH 2LSSA 5M3MG 4GKKQ 1CKMA 3K0XA 1YJ9A 1SN8A 2F3IA 2I5LX 2Z0SA 2VW9A 2ZTEA 2PMZE 5H1SE 3TS2A 2YYZA 1YIJA 1I50H 1C9OA 1NBWA 3PUXA 1X6OA 1VQFA 5IY0A 4DR1Q 1IBLL 2GVAA 4HJ9A 1QZHA 1K3RA 1VQJA 1IXRA 5ELOA 1BBWA 1OXXK 3FKIG 1N34Q 1IBMQ 1QVFA 2WFWA 3HOUH 4IFDJ 5JJLA 1AH9A 4DR7L 2WP8J 4LF8L 2ZJQA 5LMNQ 2VL6A 1KAWA 1N9WA 2D0OA 4IPHA 4DUYL 2UUCQ 4LF9Q 2VUMH 1EWIA 2BH2A 3HOUG 4QGUA 1XPUA 5LMUQ 1Q82C 4TVAB 1HZAA 2A8VA 2HIXA 1PH8A 3I4OA 5AJ3L 1Q1EA 2WB1G 3KF6A 2E5LQ 1PHJA 4B3SQ 3HOVH 2R7ZG 3PIPA 4B3MQ 4A3EG 2ASBA 5HY6A 4NPSA 4WJ3M 2JA6G 2I5MX 4C3JH 4YCWA 2Q2IA 1V43A 1M90C 1E22A 4JOIC 1HZBA 4BA1I 2YV5A 3J7A5 2N49A 4GN4B 4PZ7A 5GROA 1I3QH 3H0GG 1VCIA 1T9HA 4LWCA 4BY1G 3UE1A 2RCNA 5FLMH 4DV2L 3GTOH 1L1OA 4BBRH 4DR5L 1Z9FA 4DV5L 2JA8H 1QZGA 1HZ9A 3EN2A 3K8AA 3KF6B 3CAMA 4AQYL 5FLMG 3ULPA 1S40A 4IJHA 3RLNA 1YJNA 1L0WA 1L2FA 3J80i 3KJPA 3G4SA 1EQQA 1Q81C 3CCMA 2JA8G 3I4MH 2R93H 5BR8L 5IT9c 1XNRL 4GKKL 1G6PA 1WOCA 3E9IA 1SFOH 1QVGA 2AKWB 4XTCS 3I4MG 3PV0A 4DR1L 1VQKA 1X3EA 1XNQL 5DLQE 2PQAA 2ZM6Q 3F2BA 1N34L 4UP8A 1SRUA 3ZJYC 5FLXc 1IBML 1VQ5A 3TQYA 4BXXG 4A3DH 3ICEA 3D31A 2OTJA 4R1JA 3GO5A 2UUCL 5C44H 4JBKA 5LMUL 2CWPA 3J80c 1PH7A 4A3DG 2E5LL 1NY4A 3I56A 4B3SL 4QQBX 5IP9H 5C44G 2ES2A 5IWAQ 4GLAC 4LUVA 3HOYH 2PQAB 2K5NA 4GNXC 2HHHQ 4MNOA 3RN5A 2KCMA 5IP9G 4O2DA 1VQGA 4OX9Q 3FHWA 4OWTB 3MXNB 2B3GA 2VQEQ 3SGIA 4JOIA 1NMFA 1GD7A 1YBYA 1UWVA 2ALYB 2BH8A 2K4KA 3CPWA 1SMXA 4TQUS 2IX0A 1B7YB 4L5QA 3BZCA 4JI3Q 3K7UC 1I94Q 4HJ8A 1WCMG 3T1HQ 4A3JG 3FP9A 1S72A 1MJEA 1Q86C 4H02A 4EX5A 2VNUD 1JT8A 4A3IH 5JEAJ 4JYAQ 1Q1BA 4OXPA 1YITA 1GM5A 4O0AA 1WYDA 2LXKA 2NN6G 4JI8Q 4ALPA 1NMGA 4A3LH 2UUAQ 3HKZG 3H3VH 4OWXB 4X66Q 2ZM6L 2CWAA 2EIFA 4R4QA 2IHEA 4IPGA 4A4IA 2NVTH 2YU9H 4JI0Q 3CPFA 3JAMi 1K8AC 1W2BA 2MO0A 1HZCA 4DK3C 4A3KG 1I6HH 1SLJA 4WJ4A 4DR4Q 4DV6Q 1JMCA 3NBHB 2MNAA 3GTMH 3CXCA 5IYBH 4HJ7A 4GOPC 2ZTDA 4BY7G 5M3MH 3HOZH 2WAQG 2NVYH 5IWAL 4POGA 1HNZQ 1G291 1C7YA 4A3GG 4X6AH 1VQHA 4DV7Q 1VQNA 2H5XA 1JJGA 5FJ8G 2UXBQ 1EQRA 3BJUA 3W1GA 4OX9L 3HOZG 4OO1I 3FKIH 3RZDH 1DGSA 4ME3A 2VQEL 1PH6A 3I4NG 1G51A 4GN5A 3ER0A 4LFBQ 3L0OA 1UE5A 4L5TA 1XNQQ 3G71A 3A0JA 1YNXA 4IOAA 2B29A 4JC0A 1XPOA 2CQOA 4JCVE 4JI3L 1OTCA 4JBWA 1I94L 1N36Q 2R7ZH 4MZ9A 1NTGA 3AFPA 1VQAA 1S3OA 3T1HL 4A3EH 2R6GA 5ELNA 3MEFA 2KCTA 1TWHH 2JA6H 4AYBE 1VQ6A 3NEMA 4P71A 1J5EQ 4JYAL 3UDGA 3K80C 4GNXB 3TS0A 4IFDG 1E1OA 2OCEA 3ULJA 4BY1H 1EIFA 4DV0Q 1XMQQ 2DGYA 2I5HA 3H0GH 4JI8L 1HR0W 1Y1VH 2ZJPA 4LUOA 4P72A 4X66L 2UUAL 2NVXH 2VY3A 2LXJA 1VS0A 3UDFA 1A62A 3PSIA 4JI0L 3HKZE 3M4PA 1Y1VG 4OWWB 2JE6I 3AFQA 5JJIA 1V9PA 2GVBA 1YEZA 4DV6L 4DR4L 1X55A 1K8GA 3W5OA 2CFMA 1SR3A 1VQCA 2IT1A 3K81C 3KLWA 3E9HA 1U0LA 3CP0A 3GTPH 1GKHA 1PYBA 1LUZA 1X54A 2XTIA 1HNZL 4P73A 1VQMA 2OWOA 5IYDH 4DV7L 5C4XH 4IPCA 1P8LA 2WAQE 2VQFQ 1X65A 4DV3Q 2UXBL 4YWMA 3U4VA 3F2CA 2ZJRA 2PI2A 3ERSX 4X65Q 4KHPQ 2PI2E 3PUVA 4GLXA 1D8LA 5IP7G 5IYDG 1KIXA 1HNWQ 4L5RC 1VQ9A 5C4XG 3UDIA 4R4IA 4DUZQ 4HJ5A 4BXXH 3EBEA 3KF8B 5C0XI 3J81j 4LFBL 4DV1Q 1ASYA 1MKHA 3S15H 3CCVA 1EUJA 1VQ4A 3GDEA 4K0KQ 2MO1A 3I55A 2KBNA 1CKOA 1Q8KA 3CCRA 2JJQA 4JI2Q 1N36L 1XTDA 4GS3A 1KHIA 3PO2H 4LW1A 5M5YH 2N3SA 4DR3L 2HT1A 2B63G 1CSPA 4GOPB 2JA7G 3S1RH 4YHHQ 1SROA 1QVCA 1J5EL 2D62A 3J81i 4IO9A 2K14A 2N78A 4B3RL 4DV0L 1XMQL 1HH2P 2ID0A 1UE7A 1K9MC 2OQKA 3PUZA 5E7NA 3KYHC 4LNQA 3GTKH 3DM3A 4RG1A 1HNXQ 1TWAH 2Q2TA 4AIMA 3GTGH 3TREA 5IE8A 4NXMQ 2JK8A 4UP7A 1WCMH 4A93G 3JC66 4DK6C 5GADC 4A3JH 1EFWA 1X9NA 1B70B 4HIDA 3OW2A 1OXSC 5C4JH 4UPAA 4B3TQ 3STBD 1VQBA 4AYBG 1VQLA 3EIVA 4JI6Q 1LTLA 3IRBA 1WFQA 1A63A 3PF5A 3AEVA 4LF6Q 2VQFL 4DV3L 2FXQA 4JG2A 1TWGH 3RLOA 3CCUA 2CKZB 3U4ZA 4X65L 1IBKQ 4KHPL 1HNWL 1E7ZA 4YCUA 1VQOA 4YWLA 3GTQH 4NB3A 1O7IA 5LMNW 4DUZL 4A3CG 1TWCH 3S17H 2HQLA 4DV1L 2NZHA 1UEBA 2Z6KC 4X64Q 1AE2A 4A3KH 4A3FG 1VQ7A 1Y1WG 2E2HH 4K0KL 4KHZA 4YWKA 3STBC 2E2IH 3PO3H 3OTOQ 4R4TA 1PH5A 1QUQA 3DLLA 1W3SA 4JI2L 2QEXA 3S1MH 5JEAG 1PH1A 1KRSA 2JA5G 4FDBA 4JI7Q 4HIMA 1Q7YC 3PUYA 4BY7H 2K52A 1PA6A 2RHSB 3PO3G 1OXTA 2DUDA 4JI5Q 1AE3A 2RF4A 3NENA 4YHHL 1NJIC 4BBSH 3HKSA 3PCOB 4A3GH 2Q2UA 4GLVB 2IX1A 1E3PA 5FJ8H 1HJPA 3CCEA 2CCZA 1K0RA 1CSQA 4LF4Q 4AH6A 1X3FA 4DR6Q 2F4VL 4BBSG 3M7NA 4QY7A 3I4NH 1L1OC 3AQQA 1QUQB 1IL2A 2UXDL 1M1KC 3CC7A 4QIWE 1HNXL 3Q8DA 4HIKA 4HIOA 3RNUA 2E8GA 4GNXA 2BA1A 4JV5Q 4NXML 2AMCB 4R4CA 4XIGS 1HR0L 3HOWH 1XMOL 3JAMc 2R7FA 4LFAQ 4L5SA 4PZ8A 2R92G 4KLKA 4A3MG 2K50A 1A8VA 2A1AA 4B3TL 2YTYA 4RMFA 1GO3E 3HOWG 4DV4Q 3KDFA 4JI6L 4LFCQ 1KXLA 1FJGQ 4DR3Q 4LF6L 1BKBA 1KL9A 2L15A 1IBKL 1YHAA 3S2DH 1YHBA 1PH3A 5C0XJ 3CCSA 3S2HH 1EOVA 4EQ5A 1VQDA 3CC4A 3H3VI 4X64L 3I7FA 3L2PA 5C3EG 5EAYA 1RL2A 1UE6A 3GD7A 1PH9A 4R4OA 2Y0SE 4P75A 4P74A 1NE3A 1CKNA 5M5XH 3OTOL 2Q2HA 2BA0A 3KDFB 4JI7L 1KRTA 2Z6KA 2UXCQ 1I5FA 5C0XG 2AWOA 1PYSB 2YTXA 4JI5L 2UU9Q 1CUKA 1E24A 1FVIA 3I2ZA 4JI4Q 4DPGA 3CQZH 1PVOA 5GAHC 3RR5A 3T1YQ 2MQHA 4APVA 2UUBQ 2QGQA 4DR2Q 2OTLA 3G48A 4LF4L 1FL0A 1SE8A 4DR6L 1V1QA 3PO2G 5K36G 3A74A 5IP7H 2KHJA 2VUMG 1ASZA 3S1QH 2PNHA 1TWFH 1CKNB 4YY3Q 3E0EA 4GOPA 1PH2A 2D0PA 3HOVG 2RHQB 2MFIA 2NZOA 3H15A 4JBJA 3TRZA 2E2JH 4GKJQ 4X62Q 3VDYA 4JV5L 3LGJA 4A75A 3HFZB 1VQPA 3TEHB 4NXNQ 4Y7NH 4LFAL 3U58A 3F8TA 3W1BA 2B63H 2JA7H 1R9TH 3PUWA 4J15A 4LF5Q 4JI1Q 4BBRG 1U5KA 4DV4L 1JB7A 4LFCL 1BVSA 3NELA 4C3HH 4IFDI 1FJGL 1N32Q 1KC8C 1YVCA 3CD6A 5M3FH 4YCVA 3L7ZC 2KHIA 4UP9A 1IZ6A 1PV4A 2VS1A 1L1OB 2K5VA 1OXVA 2ZTCA 3UDXA 5M3FG 4JBMA 2F4VQ 1LM0A 2R93G 3F2DA 3CCLA 1N33Q 1VQ8A 3RN2A 1E1TA 3B6YA 3A5ZB 2UXDQ 1RIPA 2QA4A 2JEAI 1N8RC 3GTJH 4LF7Q 4A93H 2OQ0A 2ATWA 3CMAA 1YJWA 2UXCL 2EXDA 1Q46A 2GN5A 5JJKA 3S16H 1TXYA 5LMNL 2UU9L 4LF9L 4A3BH 1HR0Q 3CMEA 4JI4L 1XJVA 1XMOQ 3T1YL 4GN3B 1YHQA 2UUBL 3ULLA 1Y14B 5HGQA 4PZ6A 4DR2L 1X3GA 1KQSA 1XPRA 3WWVA 4B3ML 2VZAA 5GQOA 3G6EA 4A3BG 3CW2C 3CF5A 1KD1C 3J81c 3CCQA 5GAGC 4C2MH 2WB1E 3M4OH 4YY3L 1EIYB 1LYLA 3F1ZA 1VQIA 4A3CH 3UE0A 1EYGA 1A0IA 4PMWA 2KENA 4A3FH 4BA2I 2V1CC 1JE5A 2F52A 3CCJA 3OYYA 1Y1WH 4GKJL 4X62L 3HOYG 4IPDA 1JJCB 2A19A 2Y0SG 4DKAC 1MIUA 3KFUA 2JA5H 1PH4A 2JQOA 4DNIA 3KOJA 4NXNL 3J7ZC 4DAMA 3HOXH 1IBLQ 2I0QA 5M5WH 5IYCH 1J6QA 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 C;  1WI5 A;  4LF5 L;  4OO1 G;  4JI1 L;  2K75 A;  2XGT A;  4UY8 C;  3HOX G;  3PF4 A;  1YZ6 A;  3D0F A;  1H95 A;  4DR7 Q;  1N32 L;  4LF8 Q;  5IYC G;  3KJO A;  2YTV A;  4KI0 A;  1YI2 A;  4B3R Q;  2R7D A;  4QJF A;  4DUY Q;  2NVQ H;  2HIV A;  1P16 A;  2C35 B;  3GTL H;  2IHF A;  2JEB I;  3U50 C;  1GVP A;  5AJ3 Q;  4A76 A;  2IY5 B;  4Y52 H;  3S24 A;  3BU2 A;  3AYH B;  4LUZ A;  4PG3 A;  3S14 H;  3M85 A;  1N33 L;  1B8A A;  2AWN A;  4A3I G;  1X56 A;  2N8N A;  3RLF A;  1IYJ B;  1OXU A;  3K7A H;  4LF7 L;  1VQE A;  2R92 H;  1JJ2 A;  1PFS A;  1BBU A;  1WJJ A;  2K5H A;  4A3M H;  4A3L G;  4DV2 Q;  4IOC A;  4QL5 A;  5GAE C;  1K83 H;  2AHO B;  4POF A;  4DR5 Q;  4C3I H;  3RZO H;  1UE1 A;  4OON A;  4DV5 Q;  1D7Q A;  1Z47 A;  3M4Q A;  4HJA A;  4IJL A;  3CC2 A;  1FGU A;  4AQY Q;  1MJC A;  5J3B A;  3PIO A;  3BZK A;  4DAY B;  3A5U A;  1Q12 A;  3PGZ A;  2NN6 I;  4MTN A;  2HHH L;  1C0A A;  5IYB G;  3M9B A;  5C3E H;  3S1N H;  2EQS A;  5BR8 Q;  1XNR Q;  3M3Y H;  2LSS A;  5M3M G;  4GKK Q;  1CKM A;  3K0X A;  1YJ9 A;  1SN8 A;  2F3I A;  2I5L X;  2Z0S A;  2VW9 A;  2ZTE A;  2PMZ E;  5H1S E;  3TS2 A;  2YYZ A;  1YIJ A;  1I50 H;  1C9O A;  1NBW A;  3PUX A;  1X6O A;  1VQF A;  5IY0 A;  4DR1 Q;  1IBL L;  2GVA A;  4HJ9 A;  1QZH A;  1K3R A;  1VQJ A;  1IXR A;  5ELO A;  1BBW A;  1OXX K;  3FKI G;  1N34 Q;  1IBM Q;  1QVF A;  2WFW A;  3HOU H;  4IFD J;  5JJL A;  1AH9 A;  4DR7 L;  2WP8 J;  4LF8 L;  2ZJQ A;  5LMN Q;  2VL6 A;  1KAW A;  1N9W A;  2D0O A;  4IPH A;  4DUY L;  2UUC Q;  4LF9 Q;  2VUM H;  1EWI A;  2BH2 A;  3HOU G;  4QGU A;  1XPU A;  5LMU Q;  1Q82 C;  4TVA B;  1HZA A;  2A8V A;  2HIX A;  1PH8 A;  3I4O A;  5AJ3 L;  1Q1E A;  2WB1 G;  3KF6 A;  2E5L Q;  1PHJ A;  4B3S Q;  3HOV H;  2R7Z G;  3PIP A;  4B3M Q;  4A3E G;  2ASB A;  5HY6 A;  4NPS A;  4WJ3 M;  2JA6 G;  2I5M X;  4C3J H;  4YCW A;  2Q2I A;  1V43 A;  1M90 C;  1E22 A;  4JOI C;  1HZB A;  4BA1 I;  2YV5 A;  3J7A 5;  2N49 A;  4GN4 B;  4PZ7 A;  5GRO A;  1I3Q H;  3H0G G;  1VCI A;  1T9H A;  4LWC A;  4BY1 G;  3UE1 A;  2RCN A;  5FLM H;  4DV2 L;  3GTO H;  1L1O A;  4BBR H;  4DR5 L;  1Z9F A;  4DV5 L;  2JA8 H;  1QZG A;  1HZ9 A;  3EN2 A;  3K8A A;  3KF6 B;  3CAM A;  4AQY L;  5FLM G;  3ULP A;  1S40 A;  4IJH A;  3RLN A;  1YJN A;  1L0W A;  1L2F A;  3J80 i;  3KJP A;  3G4S A;  1EQQ A;  1Q81 C;  3CCM A;  2JA8 G;  3I4M H;  2R93 H;  5BR8 L;  5IT9 c;  1XNR L;  4GKK L;  1G6P A;  1WOC A;  3E9I A;  1SFO H;  1QVG A;  2AKW B;  4XTC S;  3I4M G;  3PV0 A;  4DR1 L;  1VQK A;  1X3E A;  1XNQ L;  5DLQ E;  2PQA A;  2ZM6 Q;  3F2B A;  1N34 L;  4UP8 A;  1SRU A;  3ZJY C;  5FLX c;  1IBM L;  1VQ5 A;  3TQY A;  4BXX G;  4A3D H;  3ICE A;  3D31 A;  2OTJ A;  4R1J A;  3GO5 A;  2UUC L;  5C44 H;  4JBK A;  5LMU L;  2CWP A;  3J80 c;  1PH7 A;  4A3D G;  2E5L L;  1NY4 A;  3I56 A;  4B3S L;  4QQB X;  5IP9 H;  5C44 G;  2ES2 A;  5IWA Q;  4GLA C;  4LUV A;  3HOY H;  2PQA B;  2K5N A;  4GNX C;  2HHH Q;  4MNO A;  3RN5 A;  2KCM A;  5IP9 G;  4O2D A;  1VQG A;  4OX9 Q;  3FHW A;  4OWT B;  3MXN B;  2B3G A;  2VQE Q;  3SGI A;  4JOI A;  1NMF A;  1GD7 A;  1YBY A;  1UWV A;  2ALY B;  2BH8 A;  2K4K A;  3CPW A;  1SMX A;  4TQU S;  2IX0 A;  1B7Y B;  4L5Q A;  3BZC A;  4JI3 Q;  3K7U C;  1I94 Q;  4HJ8 A;  1WCM G;  3T1H Q;  4A3J G;  3FP9 A;  1S72 A;  1MJE A;  1Q86 C;  4H02 A;  4EX5 A;  2VNU D;  1JT8 A;  4A3I H;  5JEA J;  4JYA Q;  1Q1B A;  4OXP A;  1YIT A;  1GM5 A;  4O0A A;  1WYD A;  2LXK A;  2NN6 G;  4JI8 Q;  4ALP A;  1NMG A;  4A3L H;  2UUA Q;  3HKZ G;  3H3V H;  4OWX B;  4X66 Q;  2ZM6 L;  2CWA A;  2EIF A;  4R4Q A;  2IHE A;  4IPG A;  4A4I A;  2NVT H;  2YU9 H;  4JI0 Q;  3CPF A;  3JAM i;  1K8A C;  1W2B A;  2MO0 A;  1HZC A;  4DK3 C;  4A3K G;  1I6H H;  1SLJ A;  4WJ4 A;  4DR4 Q;  4DV6 Q;  1JMC A;  3NBH B;  2MNA A;  3GTM H;  3CXC A;  5IYB H;  4HJ7 A;  4GOP C;  2ZTD A;  4BY7 G;  5M3M H;  3HOZ H;  2WAQ G;  2NVY H;  5IWA L;  4POG A;  1HNZ Q;  1G29 1;  1C7Y A;  4A3G G;  4X6A H;  1VQH A;  4DV7 Q;  1VQN A;  2H5X A;  1JJG A;  5FJ8 G;  2UXB Q;  1EQR A;  3BJU A;  3W1G A;  4OX9 L;  3HOZ G;  4OO1 I;  3FKI H;  3RZD H;  1DGS A;  4ME3 A;  2VQE L;  1PH6 A;  3I4N G;  1G51 A;  4GN5 A;  3ER0 A;  4LFB Q;  3L0O A;  1UE5 A;  4L5T A;  1XNQ Q;  3G71 A;  3A0J A;  1YNX A;  4IOA A;  2B29 A;  4JC0 A;  1XPO A;  2CQO A;  4JCV E;  4JI3 L;  1OTC A;  4JBW A;  1I94 L;  1N36 Q;  2R7Z H;  4MZ9 A;  1NTG A;  3AFP A;  1VQA A;  1S3O A;  3T1H L;  4A3E H;  2R6G A;  5ELN A;  3MEF A;  2KCT A;  1TWH H;  2JA6 H;  4AYB E;  1VQ6 A;  3NEM A;  4P71 A;  1J5E Q;  4JYA L;  3UDG A;  3K80 C;  4GNX B;  3TS0 A;  4IFD G;  1E1O A;  2OCE A;  3ULJ A;  4BY1 H;  1EIF A;  4DV0 Q;  1XMQ Q;  2DGY A;  2I5H A;  3H0G H;  4JI8 L;  1HR0 W;  1Y1V H;  2ZJP A;  4LUO A;  4P72 A;  4X66 L;  2UUA L;  2NVX H;  2VY3 A;  2LXJ A;  1VS0 A;  3UDF A;  1A62 A;  3PSI A;  4JI0 L;  3HKZ E;  3M4P A;  1Y1V G;  4OWW B;  2JE6 I;  3AFQ A;  5JJI A;  1V9P A;  2GVB A;  1YEZ A;  4DV6 L;  4DR4 L;  1X55 A;  1K8G A;  3W5O A;  2CFM A;  1SR3 A;  1VQC A;  2IT1 A;  3K81 C;  3KLW A;  3E9H A;  1U0L A;  3CP0 A;  3GTP H;  1GKH A;  1PYB A;  1LUZ A;  1X54 A;  2XTI A;  1HNZ L;  4P73 A;  1VQM A;  2OWO A;  5IYD H;  4DV7 L;  5C4X H;  4IPC A;  1P8L A;  2WAQ E;  2VQF Q;  1X65 A;  4DV3 Q;  2UXB L;  4YWM A;  3U4V A;  3F2C A;  2ZJR A;  2PI2 A;  3ERS X;  4X65 Q;  4KHP Q;  2PI2 E;  3PUV A;  4GLX A;  1D8L A;  5IP7 G;  5IYD G;  1KIX A;  1HNW Q;  4L5R C;  1VQ9 A;  5C4X G;  3UDI A;  4R4I A;  4DUZ Q;  4HJ5 A;  4BXX H;  3EBE A;  3KF8 B;  5C0X I;  3J81 j;  4LFB L;  4DV1 Q;  1ASY A;  1MKH A;  3S15 H;  3CCV A;  1EUJ A;  1VQ4 A;  3GDE A;  4K0K Q;  2MO1 A;  3I55 A;  2KBN A;  1CKO A;  1Q8K A;  3CCR A;  2JJQ A;  4JI2 Q;  1N36 L;  1XTD A;  4GS3 A;  1KHI A;  3PO2 H;  4LW1 A;  5M5Y H;  2N3S A;  4DR3 L;  2HT1 A;  2B63 G;  1CSP A;  4GOP B;  2JA7 G;  3S1R H;  4YHH Q;  1SRO A;  1QVC A;  1J5E L;  2D62 A;  3J81 i;  4IO9 A;  2K14 A;  2N78 A;  4B3R L;  4DV0 L;  1XMQ L;  1HH2 P;  2ID0 A;  1UE7 A;  1K9M C;  2OQK A;  3PUZ A;  5E7N A;  3KYH C;  4LNQ A;  3GTK H;  3DM3 A;  4RG1 A;  1HNX Q;  1TWA H;  2Q2T A;  4AIM A;  3GTG H;  3TRE A;  5IE8 A;  4NXM Q;  2JK8 A;  4UP7 A;  1WCM H;  4A93 G;  3JC6 6;  4DK6 C;  5GAD C;  4A3J H;  1EFW A;  1X9N A;  1B70 B;  4HID A;  3OW2 A;  1OXS C;  5C4J H;  4UPA A;  4B3T Q;  3STB D;  1VQB A;  4AYB G;  1VQL A;  3EIV A;  4JI6 Q;  1LTL A;  3IRB A;  1WFQ A;  1A63 A;  3PF5 A;  3AEV A;  4LF6 Q;  2VQF L;  4DV3 L;  2FXQ A;  4JG2 A;  1TWG H;  3RLO A;  3CCU A;  2CKZ B;  3U4Z A;  4X65 L;  1IBK Q;  4KHP L;  1HNW L;  1E7Z A;  4YCU A;  1VQO A;  4YWL A;  3GTQ H;  4NB3 A;  1O7I A;  5LMN W;  4DUZ L;  4A3C G;  1TWC H;  3S17 H;  2HQL A;  4DV1 L;  2NZH A;  1UEB A;  2Z6K C;  4X64 Q;  1AE2 A;  4A3K H;  4A3F G;  1VQ7 A;  1Y1W G;  2E2H H;  4K0K L;  4KHZ A;  4YWK A;  3STB C;  2E2I H;  3PO3 H;  3OTO Q;  4R4T A;  1PH5 A;  1QUQ A;  3DLL A;  1W3S A;  4JI2 L;  2QEX A;  3S1M H;  5JEA G;  1PH1 A;  1KRS A;  2JA5 G;  4FDB A;  4JI7 Q;  4HIM A;  1Q7Y C;  3PUY A;  4BY7 H;  2K52 A;  1PA6 A;  2RHS B;  3PO3 G;  1OXT A;  2DUD A;  4JI5 Q;  1AE3 A;  2RF4 A;  3NEN A;  4YHH L;  1NJI C;  4BBS H;  3HKS A;  3PCO B;  4A3G H;  2Q2U A;  4GLV B;  2IX1 A;  1E3P A;  5FJ8 H;  1HJP A;  3CCE A;  2CCZ A;  1K0R A;  1CSQ A;  4LF4 Q;  4AH6 A;  1X3F A;  4DR6 Q;  2F4V L;  4BBS G;  3M7N A;  4QY7 A;  3I4N H;  1L1O C;  3AQQ A;  1QUQ B;  1IL2 A;  2UXD L;  1M1K C;  3CC7 A;  4QIW E;  1HNX L;  3Q8D A;  4HIK A;  4HIO A;  3RNU A;  2E8G A;  4GNX A;  2BA1 A;  4JV5 Q;  4NXM L;  2AMC B;  4R4C A;  4XIG S;  1HR0 L;  3HOW H;  1XMO L;  3JAM c;  2R7F A;  4LFA Q;  4L5S A;  4PZ8 A;  2R92 G;  4KLK A;  4A3M G;  2K50 A;  1A8V A;  2A1A A;  4B3T L;  2YTY A;  4RMF A;  1GO3 E;  3HOW G;  4DV4 Q;  3KDF A;  4JI6 L;  4LFC Q;  1KXL A;  1FJG Q;  4DR3 Q;  4LF6 L;  1BKB A;  1KL9 A;  2L15 A;  1IBK L;  1YHA A;  3S2D H;  1YHB A;  1PH3 A;  5C0X J;  3CCS A;  3S2H H;  1EOV A;  4EQ5 A;  1VQD A;  3CC4 A;  3H3V I;  4X64 L;  3I7F A;  3L2P A;  5C3E G;  5EAY A;  1RL2 A;  1UE6 A;  3GD7 A;  1PH9 A;  4R4O A;  2Y0S E;  4P75 A;  4P74 A;  1NE3 A;  1CKN A;  5M5X H;  3OTO L;  2Q2H A;  2BA0 A;  3KDF B;  4JI7 L;  1KRT A;  2Z6K A;  2UXC Q;  1I5F A;  5C0X G;  2AWO A;  1PYS B;  2YTX A;  4JI5 L;  2UU9 Q;  1CUK A;  1E24 A;  1FVI A;  3I2Z A;  4JI4 Q;  4DPG A;  3CQZ H;  1PVO A;  5GAH C;  3RR5 A;  3T1Y Q;  2MQH A;  4APV A;  2UUB Q;  2QGQ A;  4DR2 Q;  2OTL A;  3G48 A;  4LF4 L;  1FL0 A;  1SE8 A;  4DR6 L;  1V1Q A;  3PO2 G;  5K36 G;  3A74 A;  5IP7 H;  2KHJ A;  2VUM G;  1ASZ A;  3S1Q H;  2PNH A;  1TWF H;  1CKN B;  4YY3 Q;  3E0E A;  4GOP A;  1PH2 A;  2D0P A;  3HOV G;  2RHQ B;  2MFI A;  2NZO A;  3H15 A;  4JBJ A;  3TRZ A;  2E2J H;  4GKJ Q;  4X62 Q;  3VDY A;  4JV5 L;  3LGJ A;  4A75 A;  3HFZ B;  1VQP A;  3TEH B;  4NXN Q;  4Y7N H;  4LFA L;  3U58 A;  3F8T A;  3W1B A;  2B63 H;  2JA7 H;  1R9T H;  3PUW A;  4J15 A;  4LF5 Q;  4JI1 Q;  4BBR G;  1U5K A;  4DV4 L;  1JB7 A;  4LFC L;  1BVS A;  3NEL A;  4C3H H;  4IFD I;  1FJG L;  1N32 Q;  1KC8 C;  1YVC A;  3CD6 A;  5M3F H;  4YCV A;  3L7Z C;  2KHI A;  4UP9 A;  1IZ6 A;  1PV4 A;  2VS1 A;  1L1O B;  2K5V A;  1OXV A;  2ZTC A;  3UDX A;  5M3F G;  4JBM A;  2F4V Q;  1LM0 A;  2R93 G;  3F2D A;  3CCL A;  1N33 Q;  1VQ8 A;  3RN2 A;  1E1T A;  3B6Y A;  3A5Z B;  2UXD Q;  1RIP A;  2QA4 A;  2JEA I;  1N8R C;  3GTJ H;  4LF7 Q;  4A93 H;  2OQ0 A;  2ATW A;  3CMA A;  1YJW A;  2UXC L;  2EXD A;  1Q46 A;  2GN5 A;  5JJK A;  3S16 H;  1TXY A;  5LMN L;  2UU9 L;  4LF9 L;  4A3B H;  1HR0 Q;  3CME A;  4JI4 L;  1XJV A;  1XMO Q;  3T1Y L;  4GN3 B;  1YHQ A;  2UUB L;  3ULL A;  1Y14 B;  5HGQ A;  4PZ6 A;  4DR2 L;  1X3G A;  1KQS A;  1XPR A;  3WWV A;  4B3M L;  2VZA A;  5GQO A;  3G6E A;  4A3B G;  3CW2 C;  3CF5 A;  1KD1 C;  3J81 c;  3CCQ A;  5GAG C;  4C2M H;  2WB1 E;  3M4O H;  4YY3 L;  1EIY B;  1LYL A;  3F1Z A;  1VQI A;  4A3C H;  3UE0 A;  1EYG A;  1A0I A;  4PMW A;  2KEN A;  4A3F H;  4BA2 I;  2V1C C;  1JE5 A;  2F52 A;  3CCJ A;  3OYY A;  1Y1W H;  4GKJ L;  4X62 L;  3HOY G;  4IPD A;  1JJC B;  2A19 A;  2Y0S G;  4DKA C;  1MIU A;  3KFU A;  2JA5 H;  1PH4 A;  2JQO A;  4DNI A;  3KOJ A;  4NXN L;  3J7Z C;  4DAM A;  3HOX H;  1IBL Q;  2I0Q A;  5M5W H;  5IYC H;  1J6Q A;  2JA9 A; 
#chains in the Genus database with same CATH topology
 1BO0 A;  4OO1 G;  2CW0 C;  1H9S A;  3MVV A;  4XXE A;  3TSS A;  3HOX G;  2WB1 B;  1AZQ A;  1N32 L;  4A3E B;  1YI2 A;  4IUT A;  3BVZ A;  1PFM A;  1P16 A;  2JA6 B;  1HXY D;  2IHF A;  2IY5 B;  1EU4 A;  4PG3 A;  2AWN A;  1STH A;  4A3I G;  1H9S B;  1OXU A;  3NWS A;  4EQO A;  2RQX A;  2R92 H;  4A3L G;  2K5H A;  2EYF A;  3RD4 A;  4CJ2 C;  3QOJ A;  4IOC A;  2JA8 B;  4ZKC B;  1MI2 A;  1STY A;  1SYB A;  1UE1 A;  4DV5 Q;  1EL0 A;  3T51 B;  4ZUI A;  5I6Y A;  1CTM A;  3I4M B;  1BDO A;  1TY0 A;  2FFK B;  1STN A;  4OIJ A;  2LSS A;  5KYI A;  3IAY A;  1YJ9 A;  3SK5 A;  2JSO A;  2Q8T A;  2PMZ E;  1X6O A;  1VQF A;  5IY0 A;  2K5Q A;  4HJ9 A;  2ICI A;  5L37 A;  1GHK A;  4G7H C;  4IFD J;  1QVF A;  2WFW A;  1UUP A;  1RTN A;  2KOL A;  2RVL A;  5K5P A;  4UHV A;  3OSO A;  1PFN A;  5C44 B;  2CH4 A;  3PO2 H;  2VUM H;  4QGU A;  2A8V A;  2Z6B A;  2HIX A;  2PMZ B;  3I4O A;  2E5L Q;  3HOV H;  1JOO A;  3PIP A;  3HOY B;  4NPS A;  1M90 C;  4JW0 A;  2N88 A;  1HZB A;  2B8F A;  3GTK B;  2N49 A;  5FLX c;  1VCI A;  5FLM H;  2A73 B;  1I4H A;  1CA6 A;  4BBR H;  4DV5 L;  4ZLT F;  1PRT D;  1HZ9 A;  3CAM A;  1ET6 A;  5FLM G;  2R61 A;  1YJN A;  2NTS A;  1SEB D;  1EQQ A;  1BXT A;  3CCM A;  5T1I A;  5I6W A;  3OPO A;  1SYC A;  3E9I A;  1SFO H;  5FK9 C;  1QVG A;  3GTQ B;  1PRT C;  2PZT A;  1TWC B;  1HQM C;  4PNY A;  2ZM6 Q;  4FF2 A;  5G3L F;  3QB3 A;  1SJH D;  1DJR D;  4WRD A;  3GO5 A;  1PH7 A;  4B9W A;  2PO4 A;  3VR3 A;  2E5L L;  3I56 A;  3PIP 3;  3MA2 B;  2HDL A;  2PYK A;  2K5N A;  1YNJ D;  4GNX C;  3I72 A;  4L63 B;  2KCM A;  1STG A;  3BG3 A;  3FHW A;  1PRT F;  5LL6 S;  1PFB A;  2VQE Q;  3KBX A;  2JP1 A;  4OEL B;  3NE5 B;  2K4K A;  4RKB A;  3CPW A;  4KK7 A;  1YNJ C;  4DA2 A;  3K7U C;  1I94 Q;  5LHY 1;  3ERQ A;  3T1H Q;  1LTR D;  1KDC A;  1L0Y B;  3A7L A;  4Z9C B;  4EX5 A;  3NBH A;  1JT8 A;  3GP7 A;  1F9R A;  3I4L A;  5JEA J;  1B50 A;  4JYA Q;  1GM5 A;  3H0G B;  4DK0 A;  1WYD A;  2NN6 G;  3MFG A;  5COY A;  3ND8 A;  4X66 Q;  2ZM6 L;  2NVT H;  2IHE A;  3OMC A;  4A4I A;  3W2D A;  1XTC D;  2YU9 H;  3CPF A;  5CBE E;  2MO0 A;  4DAP A;  4A3K G;  3NBH B;  2KA7 A;  5IYB H;  5M3M H;  2WAQ G;  4R9W A;  1HNZ Q;  1G29 1;  4A3G G;  5C4X B;  2M00 A;  1VQN A;  2B2W C;  1PRT B;  5FJ8 G;  1SNC A;  4ULL A;  3RZD H;  2NB0 A;  1DGS A;  2VQE L;  1SYG A;  1PH6 A;  3EJI A;  3ER0 A;  4LFB Q;  3D4W A;  1XNQ Q;  1TS3 A;  3OIQ A;  1YNX A;  4H0L C;  3HS0 C;  1OTC A;  1HTL D;  2HD3 A;  1I94 L;  4C3H B;  1AZP A;  4MZ9 A;  1U4L A;  3T1H L;  3OMG A;  4IFD H;  5I2X A;  1Y69 U;  3VR5 A;  2KCT A;  1CHQ D;  1TWH H;  4AYB E;  2F0S A;  3HGB A;  4JYA L;  3E3X A;  3EFX D;  3K80 C;  5EKK A;  4GNX B;  4IFD G;  2B2T A;  3BZD B;  1Y1V H;  2ZJP A;  4LUO A;  4P72 A;  4X66 L;  3IKJ A;  1KNE A;  1IYU A;  3HKZ E;  1IHZ A;  3M4P A;  1Y1V G;  3AFQ A;  3PMF A;  2LMC B;  1V9P A;  1AFP A;  3HZX A;  4AYB B;  4BS9 A;  1VQC A;  4TKO B;  3J81 L;  2IT1 A;  5CYU A;  1DD2 A;  2EJF C;  2K03 A;  3E9H A;  3GTP H;  3I90 A;  1LUZ A;  1X54 A;  1FR3 A;  2DNE A;  1HNZ L;  3M4O B;  1H9J A;  2VQF Q;  3HKZ B;  5A35 A;  2ZJR A;  4RGN A;  1Y1W B;  2PI2 A;  2PI2 E;  3PUV A;  1HA5 A;  3I8Z A;  1B1Z A;  3D6W A;  3UDI A;  4CDD C;  5J39 A;  4DUZ Q;  5C0X I;  4LFB L;  2F0F A;  5A2Q E;  4XT1 B;  2KBN A;  1LT5 D;  4P2C B;  4DXG A;  2VB3 X;  4RAU C;  3SHL A;  1PDQ A;  2DY7 A;  1KHI A;  4LW1 A;  5M5Y H;  4HMJ A;  1CSP A;  2J4X A;  2JA7 G;  5KNC A;  3MZ5 A;  4YHH Q;  1I4R A;  3UI2 A;  2L5T A;  1DM0 B;  4FF4 A;  5C5L A;  1S5F D;  4IUR A;  3H94 A;  1QIL A;  3KYH C;  3IFD A;  2R92 B;  2Q2T A;  4AIM A;  3GTG H;  4NXM Q;  5IT9 E;  3HOW B;  5JPN C;  2JK8 A;  4A93 G;  2MGS A;  2K6A A;  1JWU D;  1B70 B;  4RWS C;  3J7Y W;  1O7Z A;  1WFQ A;  1Y8O B;  1ICF B;  2VQF L;  2FXQ A;  2KCN A;  4DU9 A;  2E74 C;  3CRK C;  1Z7T A;  4IQZ A;  4DUZ L;  1O7I A;  1FNW A;  4A3C G;  1QJO A;  4KKU A;  4X64 Q;  4KHZ A;  3OTO Q;  4R4T A;  4C56 C;  1J8I A;  3NXW A;  5JEA G;  1E2W A;  1KRS A;  1PH1 A;  4HCE A;  2PZU A;  4BY7 H;  4CGY B;  1OXT A;  3NEN A;  4YHH L;  3HOV B;  3V05 A;  1UNS A;  1CSQ A;  5FLX L;  1EY9 A;  2F4V L;  4QY7 A;  5ELF A;  3BYY B;  2UXD L;  1M1K C;  3DEO A;  4HIK A;  2BA1 A;  2Z8L A;  1PTO B;  4NXM L;  1CK1 A;  2AMC B;  3MWY W;  4Y7N B;  1HR0 L;  3J7A V;  1XMO L;  4PZ8 A;  1EQV A;  2WV6 D;  1A8V A;  2YTY A;  4RMF A;  3Q22 A;  1KXL A;  4DV4 Q;  4KTA A;  4LFC Q;  4DR3 Q;  2L55 A;  1BKB A;  1GUO A;  1A3T A;  1G2T A;  1SFO B;  1PH3 A;  1VQD A;  3KLS A;  3H3V I;  4X64 L;  3GD7 A;  5M5X H;  3OTO L;  2A6E D;  3MXU A;  2BA0 A;  4CHT B;  4U68 A;  4TRD A;  3S16 B;  4JK1 C;  4M1U B;  4G7O C;  1CUK A;  1FVI A;  3I2Z A;  4IUU A;  3A8K E;  4HN7 A;  3CQZ H;  1SNQ A;  1PVO A;  3RR5 A;  1QNK A;  4APV A;  2B2U C;  5M9O A;  3A74 A;  5NUC A;  2A6E C;  3SXH A;  5KIX A;  3NTH A;  3MEH A;  3KK7 A;  3ERO A;  1U4R A;  1ZKO A;  2NZO A;  4DK1 A;  1PMR A;  4JBJ A;  3SR1 A;  1HUN A;  4X62 Q;  3FDT A;  1JOR A;  2JA5 B;  3N52 A;  1IKM A;  4ZRZ A;  1JOQ A;  2NZ1 D;  3GQB A;  4FF3 A;  4RFB A;  4J8Q A;  4JI1 Q;  1JB7 A;  1U5K A;  4DV4 L;  4LFC L;  1B3Q A;  5FLX E;  4YCV A;  2E75 C;  3K5O A;  1PV4 A;  2B2Y A;  3UDX A;  4JBM A;  1LM0 A;  2F03 A;  3CCL A;  1SE3 A;  1VQ8 A;  1XWE A;  3NQT A;  2O5J C;  2E2D C;  1D5Z C;  3A5Z B;  3M7G A;  2J7Z A;  4LF7 Q;  1YJW A;  2EXD A;  4N9P A;  4LF9 L;  1JOK A;  1TS5 A;  4NDX A;  3URY A;  3KLR A;  4PZ6 A;  5M3M B;  1TII D;  4DNR B;  4C2M H;  1JB3 A;  5GAG C;  1LYL A;  1BBX C;  3S1N B;  2TSS A;  3TP6 A;  2XRS D;  1J9O A;  1H9M A;  1W6J A;  4IPD A;  4X62 L;  1BUV T;  3DEP A;  1A2T A;  3RZD B;  3HOY G;  5CBA E;  5J22 A;  4OL7 A;  1BOS A;  4FNF A;  3ITP A;  4JI1 L;  1F9S A;  1D1K A;  3AB9 A;  4UY8 C;  3PF4 A;  3D0F A;  4CJ1 B;  1X32 A;  3KJO A;  4KI0 A;  2FJ2 A;  4ME5 A;  2LS0 1;  4B3R Q;  4OGQ C;  2NVQ H;  3GTL H;  3U50 C;  2L11 A;  2QDB A;  3S24 A;  3BU2 A;  2SNM A;  3AYH B;  4DAY A;  3S14 H;  3M85 A;  2R3Z A;  1B8A A;  2DJG C;  2N8N A;  3PQI A;  1G6Z A;  1LV9 A;  3K7A H;  4M8A A;  3EA6 A;  4JPB W;  4LF7 L;  3H3V C;  1VQE A;  1ILQ A;  1PFS A;  4EQN A;  4A3M H;  1EY4 A;  1B2T A;  2BCO A;  4QL5 A;  5GAE C;  2AHO B;  4DR5 Q;  4HTH A;  4C3I H;  1Z6H A;  3RZO H;  4B9X A;  4HJA A;  1PYW D;  4IJL A;  1LTA D;  1MHW C;  3CC2 A;  1FGU A;  4AQY Q;  1MJC A;  5J3B A;  5BN4 A;  2WKD A;  3PIO A;  3BZK A;  4DAY B;  3T4A C;  3A5U A;  3PGZ A;  5F2D A;  1C0A A;  1F2M A;  4RGM A;  1SN8 A;  2I5L X;  2Z0S A;  1CFM A;  3MHB A;  2ZTE A;  4K6D A;  1C9O A;  1NBW A;  3PUX A;  4KKS A;  5I2Y A;  2F1M A;  2GVA A;  1QZH A;  1K3R A;  5D14 A;  1IXR A;  3TZD A;  1IBM Q;  3HOU H;  4A3D B;  1WTQ A;  2KQ3 A;  2WP8 J;  2ZJQ A;  5LMN Q;  2VL6 A;  4B3R L;  1EWI A;  3HOU G;  1Q82 C;  2RA4 A;  1PH8 A;  2ICE C;  2R7Z G;  1PHJ A;  4B3M Q;  2Z1C A;  3JAM E;  2ASB A;  1EU3 A;  5FO8 B;  1TT2 A;  2I5M X;  1PXU A;  1EIG A;  4YCW A;  2Q2I A;  5IGE A;  4JOI C;  3G6J B;  3OWE B;  4PZ7 A;  4BY1 G;  5GRO A;  4LWC A;  3H0G G;  4I65 A;  2K05 A;  3KBG A;  3GTG B;  1L1O A;  4DR5 L;  1Z9F A;  1O78 A;  3EN2 A;  3EVQ A;  4K2K A;  3PIO 3;  4AQY L;  1WD0 A;  4HCS A;  1EFI D;  5E3F A;  1WTX A;  1L2F A;  3KJP A;  1Q81 C;  1JC7 A;  3L9A X;  2ENB A;  3AMU A;  5IT9 c;  3F2U A;  1G6P A;  3OWF A;  2PZW A;  2QDL A;  1X3E A;  5C3X A;  1S5D D;  2PQA A;  3CKI B;  1IBM L;  1HQR D;  3TQY A;  1K8M A;  3K5N A;  2WII B;  5KNB A;  4XYO A;  4BY7 B;  4R1J A;  3MXN A;  1SE4 A;  1GUG A;  4JBK A;  3GTM B;  4CKE A;  1BF4 A;  1NY4 A;  5ELB A;  3HOZ B;  4HMI A;  4LUV A;  5IWA Q;  5C4Z A;  2PQA B;  4HED A;  4OX9 Q;  1D2B A;  3SVM A;  3FKI B;  3MXN B;  4QCL A;  2WIN B;  4JOI A;  1GD7 A;  1YBY A;  1SMX A;  4TQU S;  2I46 A;  2LKV A;  3BZC A;  4JI3 Q;  2A5H A;  2BDN A;  5IIF A;  5CV7 A;  4A3J G;  1Q86 C;  5IGG A;  1LO5 D;  4ABN A;  4DFA A;  1QB5 D;  4PMC A;  4WOR A;  4A3I H;  2X6G A;  1EY5 A;  3P20 A;  2O5I C;  2LXK A;  4JI8 Q;  4A3L H;  1NMG A;  3HKZ G;  2L4N A;  5CV6 A;  2NVX B;  5EBD A;  2EIF A;  1DON A;  5M5X B;  1QG7 A;  4JI0 Q;  1GUS A;  2ZXO A;  4WJ4 A;  1EOT A;  1SLJ A;  4DR4 Q;  1IW7 D;  4HSV A;  5CR3 A;  1JMC A;  4UDU C;  1ENC A;  3CQZ B;  1IYV A;  3DXJ C;  3CRL C;  4NKL A;  3D3R A;  3CXC A;  1ICW A;  1TR5 A;  4GOP C;  2HCI A;  2NVY H;  4QUC A;  5IWA L;  2MJ8 A;  3SE0 A;  4OX9 L;  1IW7 C;  4OO1 I;  2AUK A;  4PQX A;  4MN3 A;  5JVH 3;  4ME3 A;  1G51 A;  4GN5 A;  1KLU D;  3GV6 A;  3L0O A;  4L5T A;  3G71 A;  3A0J A;  4FVM A;  1O7Y A;  4DGZ A;  3RMH A;  4IOA A;  1EIH A;  4JC0 A;  4JCV E;  4JI3 L;  4JBW A;  4XYQ A;  3SK8 A;  1VQ6 A;  2M2L A;  3IL8 A;  1PZI D;  2OCE A;  3FPP A;  1XMQ Q;  4JI8 L;  3WOF A;  2VY3 A;  2PCF B;  3C2P A;  1A62 A;  4JI0 L;  1ML0 D;  1ZYR D;  1C4Q A;  4OWW B;  4DR4 L;  1LLR D;  1MD2 D;  1WCM B;  4LAA A;  1SDF A;  5J1Z A;  3K81 C;  4C1N K;  2X6L A;  3CP0 A;  4P73 A;  1EY8 A;  3R93 A;  1ZYR C;  1WTH A;  1X65 A;  3TBI B;  2SNS A;  3TME A;  4GLX A;  5IP7 G;  1HNW Q;  1KIX A;  1ESR A;  5IOC A;  3EBE A;  4DV1 Q;  1ASY A;  2E2I B;  2O4X A;  3I55 A;  1CKO A;  1Q8K A;  3TP7 A;  3S1M B;  2JJQ A;  2F0W A;  3D4R A;  2EY5 A;  2RDH A;  4X3U A;  2B63 G;  4GOP B;  4BBS B;  1QE6 A;  2NVQ B;  3S1R H;  3BS1 A;  1SRO A;  3GTL B;  1WD1 A;  3D4D A;  3QJY A;  3J81 i;  3C1F A;  3X3N A;  5JAV A;  1XMQ L;  1PLF A;  1HH2 P;  3S14 B;  3I4N B;  1K9M C;  2OQK A;  2L12 A;  2OEO A;  3PUZ A;  3K7A B;  2KCC A;  4LNQ A;  2RKS A;  1Q90 A;  3K0Y A;  4RCO A;  4A3M B;  1GXD C;  3MXP A;  3NQI A;  5IE8 A;  1AP0 A;  3RZO B;  2XN9 C;  3NSW A;  1CA5 A;  2QW7 A;  4HID A;  3SK4 A;  5C4J H;  2PQE A;  4B3T Q;  2I07 B;  1VQL A;  1A63 A;  3EIV A;  3TN2 A;  1LTL A;  4MIU A;  3AEV A;  2NN6 H;  4JG2 A;  1TWG H;  5KND A;  1HNW L;  1VQO A;  4YWL A;  4NB3 A;  5LMN W;  3I3C A;  3S17 H;  4DV1 L;  2NZH A;  2Z6K C;  2F0T A;  4G57 A;  4A3F G;  1SJE D;  4IUV A;  4A3K H;  2E2H H;  3PO3 H;  1PH5 A;  2CH4 W;  2JA5 G;  5A2Q L;  3PUY A;  3PO3 G;  3W3A A;  1AE3 A;  4A3G H;  5DM7 3;  2Q2U A;  4LMQ D;  5FJ8 H;  1JE4 A;  1HJP A;  4PMB A;  2CCZ A;  4AH6 A;  3K58 A;  2E76 C;  2FMM A;  2Q8R E;  4KN4 C;  4IN3 A;  4ZK9 B;  2F0L A;  3TP5 A;  1IL2 A;  3CC7 A;  3Q8D A;  3VR2 A;  1LT3 D;  4HIO A;  2E8G A;  2FHT A;  4FXG C;  4GNX A;  3NTI A;  2NWG A;  2F0D A;  4R4C A;  4K5W A;  3JAM c;  4L5S A;  4ODG A;  1JWM D;  2K50 A;  5IT9 L;  1XX8 A;  2A1A A;  4CKC A;  4B3T L;  1BNZ A;  2QEJ C;  1FJG Q;  3K59 A;  5M3F B;  3MTS A;  1FGB D;  2G9D A;  3S2D H;  1F2Z A;  3S2H H;  2BDO A;  1VDZ A;  3CCS A;  1SYD A;  5C3E G;  5EAY A;  1UE6 A;  4P75 A;  2PW5 A;  4P74 A;  1NE3 A;  5JJZ A;  3GTJ B;  2Q2H A;  2SEB D;  5ISR A;  2Z6K A;  1BCP D;  2UXC Q;  5C0X G;  1CHP D;  1PYS B;  2XIW A;  2UU9 Q;  1E24 A;  1JQY D;  5DEH A;  2UUB Q;  1TKW B;  2C5C A;  1V1Q A;  2IPK D;  1DOM A;  1ASZ A;  3S1Q H;  2PNH A;  4K5V A;  4YY3 Q;  1BCP C;  1EY0 A;  2B8G A;  3TRZ A;  3LGJ A;  2B2W A;  4C3J G;  4A75 A;  3HFZ B;  3HOX B;  1VQP A;  5M5W B;  1XXG A;  1FYC A;  3U58 A;  3F8T A;  2JA7 H;  1R9T H;  3VR6 A;  4IFD I;  2EYL A;  1FJG L;  1YVC A;  4R8N A;  3CD6 A;  3K57 A;  5BN3 A;  3D6C A;  4A3I B;  3SEB A;  1I4X A;  1NNX A;  2VS1 A;  2K5V A;  1E2V A;  2XRQ D;  2F4V Q;  2R93 G;  3F2D A;  2F0E A;  1N33 Q;  1DOL A;  1BCP F;  4PV1 C;  2UXD Q;  4HR7 B;  4A93 H;  2ATW A;  2UXC L;  5JJK A;  2GN5 A;  2AQ1 B;  2UU9 L;  4A3B H;  1HR0 Q;  3CME A;  1XMO Q;  3MFY A;  2UUB L;  3TP8 A;  1XPR A;  2IL8 A;  4A3B G;  3OW7 A;  1KD1 C;  3Q23 A;  3CCQ A;  3H91 A;  4YY3 L;  4A3C H;  3F1Z A;  1WVL A;  3UE0 A;  3T56 B;  1A0I A;  1U4M A;  3RUZ A;  2F0K A;  2V1C C;  1JE5 A;  2F52 A;  3CCJ A;  2IW3 A;  2A19 A;  2Y0S G;  1O7L A;  5JEA H;  1PH4 A;  1KDB A;  2JQO A;  4DNI A;  1IBL Q;  4RCN A;  2I0Q A;  2VXW A;  2EJG C;  5IYC H;  1J6Q A;  2JA9 A;  2K01 A;  5CV9 A;  1WI5 A;  4F87 A;  3ZYY X;  1A15 A;  1STE A;  2F0U A;  4DR7 Q;  5C5M A;  4LF8 Q;  5IYC G;  3PO2 B;  1EZ6 A;  2YTV A;  2VUM B;  2F3W A;  4QJF A;  2HIV A;  4RA8 A;  1SBB B;  4A76 A;  1GVP A;  2F0J A;  3FVQ A;  1RKN A;  3KLS X;  1U9R A;  1N33 L;  1JWS D;  1GOZ A;  1V1P B;  1X56 A;  2F0Q A;  1JJ2 A;  1BBU A;  3I70 A;  1BR9 A;  4BBR B;  1K83 H;  4OON A;  1NR4 A;  1EYA A;  4E6I A;  1CQF A;  4XQQ A;  4MTN A;  2HHH L;  5ELE A;  4ZKB B;  5CV8 A;  1XNR Q;  3M3Y H;  1CKM A;  4RGO S;  1CZW A;  2F3I A;  1WTV A;  1JR0 D;  2VW9 A;  5H1S E;  3BDO A;  3H6M A;  1IBL L;  1ENF A;  4QMG A;  5ELO A;  3MXG A;  1OXX K;  3FKI G;  5JJL A;  1AH9 A;  2EXZ A;  4DR7 L;  3ONA B;  4LF8 L;  2F0M A;  4LF9 Q;  4IPH A;  1KAW A;  1N9W A;  3VR4 A;  3S1R B;  2UUC Q;  2EE1 A;  1DZ1 A;  2IWH A;  5LMU Q;  4TVA B;  1HZA A;  4KY6 A;  1Q1E A;  2WB1 G;  4B3S Q;  4A3E G;  2J0T D;  4WJ3 M;  4Q5V A;  2DJF C;  2JA6 G;  1F2Y A;  1KLG D;  1V43 A;  1E22 A;  1A3V A;  2YV5 A;  3J7A 5;  1T9H A;  4LK1 C;  3GTO H;  1S4Z A;  2JA8 H;  2K5D A;  1KAB A;  1QZG A;  1HTP A;  3K8A A;  4G4K A;  4CBV A;  4IJH A;  3RLN A;  1KDA A;  5C4J B;  4F8M A;  4KD4 A;  1GJX A;  3J80 i;  2JA8 G;  1TY2 A;  3I4M H;  3EQL C;  1TWG B;  1XNR L;  4U67 3;  2EZV A;  1WOC A;  3I4M G;  2JYO A;  3S17 B;  1KTK A;  5KGU A;  2E2H B;  1QOH A;  5DLQ E;  2NVT B;  5DM6 3;  3F2B A;  2YU9 B;  3ZJY C;  1SE2 A;  1VQ5 A;  4BXX G;  3K5M A;  1B4O A;  3D31 A;  1FNU A;  2OTJ A;  3DMU A;  4EGV A;  2UUC L;  5C44 H;  1FNV A;  4A3G B;  5LMU L;  2CWP A;  4B3S L;  3LWU A;  3WDN A;  3NBI A;  4DF7 A;  5IP9 H;  5C44 G;  3A56 A;  4XQJ A;  3HOY H;  4GLA C;  3CU7 A;  3HRZ C;  3H09 A;  2B2U A;  3RN5 A;  1C48 A;  3JAM L;  5IP9 G;  1T5E A;  1NCV A;  3SGI A;  1UWV A;  2SDF A;  5I9O A;  2ALY B;  2BH8 A;  2D5D A;  3E6Z X;  1WCM G;  1X3P A;  2A6H D;  5D65 A;  3FP9 A;  1TWH B;  4H02 A;  4ILW A;  2JN4 A;  1GUT A;  1Q1B A;  2MHV A;  4F88 A;  4OXP A;  4LJZ C;  1Y1V B;  2UUA Q;  4OWX B;  1F77 A;  5JOB A;  1EEI D;  2L9H A;  2A6H C;  1K8A C;  1HZC A;  2K32 A;  3R2T A;  2MNA A;  4N8F A;  3GTP B;  2F0V A;  2EVB A;  2ZTD A;  4IAL A;  2QF7 A;  1K0S A;  2C9O A;  4OEM B;  4POG A;  1C7Y A;  4X6A H;  1GUW A;  3WOE A;  2H5X A;  2LFN A;  3BJU A;  3I4N G;  3BVG A;  4B08 A;  3C46 A;  1SAP A;  2K5W A;  2JA7 B;  1R9T B;  1CM9 A;  1I4G A;  5M5Y B;  1A6X A;  2R7Z H;  3M4Y A;  1NTG A;  1S3O A;  2F3V A;  2R6G A;  3QG1 A;  1B3A A;  1X3Q A;  3NEM A;  1Q8I A;  1J5E Q;  1E1O A;  3ULJ A;  3C3L A;  4BY1 H;  2EYP A;  4FP5 D;  4DV0 Q;  1LAC A;  3H0G H;  5KYL A;  1HR0 W;  1ONL A;  2UUA L;  1FD7 D;  1VMP A;  1RDP D;  3ND9 A;  1B44 D;  2F0P A;  2LXJ A;  3UDF A;  3PSI A;  4A93 B;  3BVM A;  2JE6 I;  3I91 A;  1CQV A;  4L6T B;  5JJI A;  3MAQ A;  1K8G A;  3BDL A;  2CFM A;  4FO2 A;  1SR3 A;  1U4P A;  3KF8 A;  1ESF A;  1ZXT A;  4ZUJ A;  1U0L A;  1RHP A;  1PYB A;  1D5X C;  5E4W C;  2XTI A;  2OWO A;  2ZXR A;  5C4X H;  4IPC A;  1P8L A;  1SYE A;  1S5C D;  5LL6 X;  3U4V A;  4KHP Q;  3ERS X;  2XSC A;  1D8L A;  1GHJ A;  4L5R C;  5C4X G;  4R4I A;  4HJ5 A;  3KF8 B;  3J81 j;  4H13 C;  1MKH A;  3K5L A;  3S15 H;  3CCV A;  5AFW A;  1EUJ A;  1VQ4 A;  3GDE A;  4K0K Q;  2MO1 A;  2HQE A;  5C4H A;  4JI2 Q;  1XTD A;  3AU7 A;  2N3S A;  5TSS A;  2Z4I A;  2CQA A;  4KJN A;  1QVC A;  1J5E L;  2D62 A;  4C3H G;  3A8I E;  1AW7 A;  4DV0 L;  2F0H A;  1UE7 A;  4ZQ3 A;  1C8C A;  1AN8 A;  1M4V A;  5E7N A;  3L3O C;  3OIP A;  4RG1 A;  1HNX Q;  1TWA H;  3NUC A;  4UP7 A;  3CHB D;  3JC6 6;  4DK6 C;  5GAD C;  4A3J H;  1X9N A;  3P75 A;  4UPA A;  4FYD A;  1VQB A;  4K8I A;  3DHQ A;  1CI3 M;  4AYB G;  1W6K A;  4LF6 Q;  4X3T A;  4TSS A;  3RLO A;  4KHP L;  3U4Z A;  1IBK Q;  3M3Y B;  2RDF A;  3E0J A;  1E7Z A;  4RHS A;  2HQL A;  3G7L A;  1UEB A;  3NTK A;  5I9P A;  2XNA C;  1Y1W G;  4K0K L;  1QUQ A;  1W3S A;  4JI2 L;  4FDB A;  4JI7 Q;  1Q7Y C;  2VB2 X;  4K5X A;  4X3K A;  2K52 A;  4JI5 Q;  2HDM A;  2IX1 A;  4GLV B;  1DOK A;  1E3P A;  5D3I B;  1K0R A;  4LF4 Q;  4DR6 Q;  5EPJ A;  4NP5 A;  3T13 A;  2ZT9 C;  3NK9 A;  2G5D A;  3AQQ A;  1QUQ B;  4FXK C;  4QIW E;  1HNX L;  5EKI A;  3RNU A;  3GTO B;  1ET9 A;  1SSO A;  2PNR C;  1SYF A;  2N55 A;  1MBY A;  4XIG S;  3HOW H;  4G7Z C;  4LFA Q;  1STA A;  2R92 G;  3HOW G;  3KDF A;  3OHX C;  4O42 A;  4LF6 L;  4QIW B;  1Q3L A;  1IBK L;  3SDZ A;  1YHB A;  5T1G A;  3V96 A;  4FF1 A;  5C0X J;  4KN7 C;  5FOB B;  4EQ5 A;  1JIC A;  3CC4 A;  1EEF D;  1RL2 A;  1EQT A;  1TS4 A;  2KVM A;  4DAV A;  2PPB C;  1CKN A;  5EBC A;  2EOT A;  3KDF B;  1T5X D;  2G9H D;  4JI7 L;  1KRT A;  1R4Q B;  4J6H A;  2AWO A;  1A3U A;  4JI5 L;  1ROD A;  5K36 H;  4JI4 Q;  4DPG A;  2CHB D;  5GAH C;  5G3L D;  2MQH A;  2O2L D;  2QGQ A;  1DYQ A;  4DN4 M;  4DR2 Q;  3G48 A;  2OTL A;  4LF4 L;  1FL0 A;  4DR6 L;  3PO2 G;  5K36 G;  5IP7 H;  4C2M B;  2KHJ A;  2VUM G;  1TS2 A;  4ID6 A;  1TWF H;  1CKN B;  3E0E A;  3TDQ A;  4GOP A;  2D0P A;  1PH2 A;  2RHQ B;  3HOV G;  2AUJ D;  5I4D A;  3BYT B;  2E2J H;  4GKJ Q;  3VDY A;  3QOL A;  4MHE A;  1PTO H;  3TEH B;  4Y7N H;  4LFA L;  1DXM A;  1TQO A;  2B63 H;  3W1B A;  2EYO A;  4L8J A;  4J15 A;  4LF5 Q;  2XVS A;  1LTI D;  3I73 A;  4BBR G;  1BVS A;  3HEJ A;  4HAE A;  3FPU B;  1KAA A;  1KC8 C;  1NAP A;  2QCP X;  3D8G A;  5JPM C;  5COR A;  4UP9 A;  1IZ6 A;  4RH6 A;  1HFN A;  3P1H A;  1E1T A;  3FEW X;  1RIP A;  1SXT A;  1CZG A;  2OQ0 A;  3CMA A;  1LT6 D;  2AQ3 B;  1EYC A;  1Q46 A;  1K3B C;  1TXY A;  4C3I B;  4CJ0 B;  5EPK A;  3S16 H;  5KEE A;  1MSH A;  4YIJ A;  4JI4 L;  3HP3 A;  1YHQ A;  3ULL A;  3X3M A;  5HGQ A;  4DR2 L;  4KY7 A;  1X3G A;  1RD9 D;  2VZA A;  5GQO A;  4UAI A;  3CW2 C;  2V4D A;  1VQI A;  1EYG A;  4PMW A;  2KEN A;  4A3F H;  2RCF A;  4BA2 I;  1HA6 A;  3OYY A;  4GKJ L;  4KMU C;  1JJC B;  2IX3 A;  1MIU A;  3KFU A;  2JA5 H;  1LTG D;  3KOJ A;  3TZU A;  4JVZ A;  4QUF A;  1K73 C;  4LF5 L;  3HOU B;  2K75 A;  2XGT A;  2P5Z X;  1YZ6 A;  2R7Z B;  1H95 A;  2B2T C;  1PZJ D;  2F0G A;  2R7D A;  4DUY Q;  2C35 B;  1L0X B;  1QCB D;  4GZY C;  2JEB I;  5AJ3 Q;  1OO9 B;  2XWJ B;  4Y52 H;  4BY1 B;  2PW7 A;  1LTT D;  4LUZ A;  2B39 A;  5JVG 3;  3RLF A;  1IYJ B;  3A54 A;  4ZAI A;  2NBF A;  1WJJ A;  4DV2 Q;  2ZXP A;  1D7Q A;  4POF A;  2EYH A;  5EQ0 A;  4CKB A;  4BWG B;  5CC4 A;  1Z47 A;  2RDG A;  3M4Q A;  3U9O A;  4CDE C;  3FRP B;  1A2U A;  4KD3 A;  2KEE A;  5C6A A;  1Q12 A;  5E1F A;  2MP1 A;  2NN6 I;  3NPP A;  4CDF C;  1LAB A;  5IYB G;  3M9B A;  5C3E H;  3S1N H;  2EQS A;  5BR8 Q;  5CGK A;  4Q0F A;  4K6L A;  5M3M G;  4GKK Q;  2D9U A;  2H4O A;  3K0X A;  3O13 A;  5IOD A;  3TS2 A;  2YYZ A;  1YIJ A;  1I50 H;  5CMD A;  4DR1 Q;  2K7V A;  3S15 B;  3VYT A;  2A69 D;  5C0X H;  1VQJ A;  3A7A B;  1N34 Q;  1BBW A;  3DM1 A;  1K28 A;  1EY7 A;  2D0O A;  2M9V A;  2GA4 B;  4QB4 A;  4DUY L;  2BH2 A;  4OHJ A;  1XPU A;  2F4I A;  5AJ3 L;  2BE5 D;  3KF6 A;  2A69 C;  1EY6 A;  5HY6 A;  5HUR A;  3DUZ A;  4C3J H;  1TU2 B;  1H9R A;  3IFT A;  4BA1 I;  4IUP A;  1I4Q A;  4GN4 B;  1HRJ A;  1I3Q H;  3UE1 A;  1TWA B;  4WJW A;  1JCK B;  2RCN A;  3NWT A;  2FIN B;  4DV2 L;  2BE5 C;  3QIA A;  1WTO A;  4A3J B;  2IJ0 A;  4R8I A;  3KF6 B;  3ULP A;  1B9N A;  1S40 A;  1HFG A;  2B2V C;  1L0W A;  3VYR A;  2CVR A;  4S3S A;  3G4S A;  3OOC A;  1PTO D;  4IZ8 A;  1RF2 D;  5KRU A;  2R93 H;  5D3D A;  5BR8 L;  2RSN A;  2Z9H A;  1B53 A;  2LY7 A;  2KEC A;  4GKK L;  2TMP A;  1E0B A;  2AKW B;  4XTC S;  3PV0 A;  4H7B A;  4DR1 L;  1VQK A;  5ELC A;  1XNQ L;  1N34 L;  4UP8 A;  1SRU A;  1PTO C;  2NUC A;  4A3D H;  2OXP A;  3ICE A;  1HUM A;  4F7X A;  3J80 c;  4A3D G;  1II3 A;  1AEX A;  4ZYS A;  2NVY B;  4QQB X;  2ES2 A;  1WTW A;  2HHH Q;  3QO2 A;  1F2L A;  4MNO A;  2F0O A;  4O2D A;  1VQG A;  4OWT B;  1SNM A;  2B3G A;  1Y8N B;  2KHS A;  1F9Q A;  1NMF A;  1PTO F;  1V1P A;  2IX0 A;  1B7Y B;  4L5Q A;  3KUP A;  1PZK D;  3Q0A A;  4HJ8 A;  3FMC A;  1S72 A;  1MJE A;  2VNU D;  2B2V A;  2L0C A;  1YIT A;  4O0A A;  3NHH A;  1BCP B;  3VYS A;  4ALP A;  3H3V H;  2EPB A;  2A68 D;  2CWA A;  4R4Q A;  4IPG A;  4ZCK A;  1D5M C;  3J81 E;  1UAP A;  3JAM i;  1W2B A;  4DK3 C;  1I6H H;  2EY2 A;  4KHV A;  4DV6 Q;  3GTM H;  2NTT A;  4HJ7 A;  3DWA A;  2WKC A;  4BY7 G;  2A68 C;  3HOZ H;  3VA7 A;  1LT4 D;  1VQH A;  4DV7 Q;  1V1O A;  1TWF B;  1JJG A;  1WTR A;  2FMC A;  2UXB Q;  1EQR A;  3W1G A;  3HOZ G;  1I4P A;  1EYD A;  5ELD A;  2E2J B;  1MGS A;  3FKI H;  1RCV D;  1UE5 A;  3R3O A;  1XYI A;  3C1E A;  2B63 B;  2B29 A;  1XPO A;  2CQO A;  4J1M A;  2DNC A;  1N36 Q;  4K14 A;  3AFP A;  1VQA A;  2B2Y C;  4OIK A;  4A3E H;  1NR2 A;  1F9P A;  5ELN A;  1YNN D;  3MEF A;  1V8Q A;  2JA6 H;  4P71 A;  1SMY D;  1D1I A;  3UDG A;  3TS0 A;  5IGF A;  1RJT A;  3DWQ A;  5DAU A;  1VF7 A;  1EIF A;  2DGY A;  2I5H A;  4QF4 A;  5BN5 A;  2WAC A;  1Y8P B;  2MPM A;  2NVX H;  1STB A;  2EYJ A;  1TVX A;  1SNP A;  1VS0 A;  1LTB D;  1YNN C;  2QKI C;  4RGT A;  3A8J E;  2GVB A;  1SMY C;  1YEZ A;  4DV6 L;  1X55 A;  4EVO A;  3W5O A;  1EWC A;  3KLW A;  1GKH A;  3VA5 A;  4DNT B;  1VQM A;  3SK6 A;  2F0I A;  5IYD H;  4DV7 L;  2D2C C;  2WAQ E;  2UXB L;  4DV3 Q;  4A3F B;  4YWM A;  3F2C A;  3E5S A;  4X65 Q;  5IYD G;  1VQ9 A;  2DN8 A;  4RHR A;  1D6E C;  4BXX H;  4A3K B;  5FO9 B;  4RKL A;  3PO3 B;  3CCR A;  4O1N A;  1O80 A;  4KV6 A;  1N36 L;  4GS3 A;  4MTK A;  1CT1 D;  1S5E D;  3N6R A;  2WAQ B;  1G2S A;  4DR3 L;  2HT1 A;  4IO9 A;  1IKL A;  2K14 A;  2N78 A;  2ID0 A;  3GV3 A;  2K04 A;  1HCZ A;  3R8B A;  3GTK H;  3DM3 A;  1IL8 A;  3TRE A;  3BDC A;  2KJX A;  1WCM H;  1K8O A;  5FKA C;  1B9M A;  1EFW A;  3QWN A;  4V0B A;  3OW2 A;  2X69 A;  1OXS C;  4WFN 3;  3STB D;  4JI6 Q;  3IRB A;  4CDC C;  1QNU A;  1ENA A;  3PF5 A;  4KJO A;  4DV3 L;  5C3E B;  3S2D B;  2RSO A;  3CCU A;  2CKZ B;  4X65 L;  3DWP A;  3S2H B;  3K6O A;  4K8J A;  4YCU A;  1HHV A;  3GTQ H;  4IUN A;  1I50 B;  1QWY A;  1TWC H;  1WTP A;  4KY5 A;  2H1E A;  1AE2 A;  1VQ7 A;  3STB C;  4YWK A;  4KKT A;  2E2I H;  2L1B A;  3DLL A;  3S1M H;  2QEX A;  4X3S A;  2HCC A;  1SND A;  4HIM A;  1PA6 A;  2RHS B;  2DUD A;  1DCZ A;  2RF4 A;  4BBS H;  1NJI C;  3HKS A;  3PCO B;  5EPL A;  2EY6 A;  4K2L A;  3CCE A;  1MSG A;  1X3F A;  2EYM A;  1NSN S;  4BBS G;  3M7N A;  3S1Q B;  2KUM A;  4C3J B;  3I4N H;  1L1O C;  2NYZ D;  3S9W A;  3R2I A;  2DY8 A;  3U9S A;  1I3Q B;  3T16 A;  3NP8 A;  2EY1 A;  3J7A F;  4JV5 Q;  1G91 A;  5IGB A;  5EGT A;  5IGD A;  1EZ8 A;  5C3W A;  4XDX A;  1G8Z D;  1S5B D;  2R7F A;  4KLK A;  4A3M G;  1GO3 E;  4C3I G;  1EWH A;  4JI6 L;  2K33 A;  3LWE A;  4V19 0;  1KL9 A;  2R93 B;  1LTS D;  2L15 A;  4XQN A;  1H9K A;  1YHA A;  3Q24 A;  1M8A A;  1EOV A;  1BQQ T;  5FO7 B;  3I7F A;  3L2P A;  1PH9 A;  4R4O A;  2Y0S E;  3V2T A;  2Z4H A;  4I7Z C;  3J80 L;  2OF1 A;  2A74 C;  1I6V C;  5EJW A;  1I5F A;  4A3B B;  2YTX A;  4H44 C;  4HSP A;  5E4X A;  3T1Y Q;  4FXD A;  4NMZ A;  5DNF A;  1SE8 A;  1RTO A;  1HPC A;  2Y0S B;  1R4P B;  3LNN A;  3T53 B;  1SNO A;  2EDG A;  2MFI A;  3H15 A;  3P7J A;  5CV4 A;  1ZEQ X;  5EKL A;  1E2Z A;  4JV5 L;  4EQP A;  4IUQ A;  5IGC A;  4NXN Q;  3A55 A;  4NW2 A;  4C1N I;  3PUW A;  2SOB A;  1ILP A;  3NEL A;  4C3H H;  5HGT A;  1KNA A;  2RBM A;  2F0N A;  1N32 Q;  2KED A;  5M3F H;  2JXM B;  3LX0 A;  2AQ2 B;  3L7Z C;  2KHI A;  1VF5 C;  1L1O B;  2ZTC A;  1OXV A;  4XT3 B;  4N9T A;  5M3F G;  1NUC A;  2MUY A;  3RN2 A;  3B6Y A;  1GUN A;  2OT2 A;  3HG9 A;  2BOS A;  2QA4 A;  2JEA I;  1N8R C;  3GTJ H;  1VMC A;  3MC0 B;  4N8X 1;  1I6H B;  1K83 B;  5LMN L;  2QIL A;  3QR8 A;  1XJV A;  2HUG A;  3T1Y L;  2K28 A;  4GN3 B;  1Y14 B;  1KQS A;  3WWV A;  4B3M L;  3G6E A;  3CF5 A;  3J81 c;  3M4O H;  2CW0 D;  2WB1 E;  5CV5 A;  1EIY B;  4I7A A;  1UEA B;  1Y1W H;  4DXF A;  2EJM A;  2K1B A;  4DKA C;  4OO1 H;  2XWB B;  3J80 E;  2Q8I B;  3J7Z C;  3Q6S A;  4NXN L;  3VYU A;  3HOX H;  4DAM A;  5M5W H; 
#chains in the Genus database with same CATH homology
 1K73 C;  1WI5 A;  4LF5 L;  4OO1 G;  4JI1 L;  2K75 A;  2XGT A;  4UY8 C;  3HOX G;  3PF4 A;  1YZ6 A;  3D0F A;  1H95 A;  4DR7 Q;  1N32 L;  4LF8 Q;  5IYC G;  3KJO A;  2YTV A;  4KI0 A;  1YI2 A;  4B3R Q;  2R7D A;  4QJF A;  4DUY Q;  2NVQ H;  2HIV A;  1P16 A;  2C35 B;  3GTL H;  2IHF A;  2JEB I;  3U50 C;  1GVP A;  5AJ3 Q;  4A76 A;  2IY5 B;  4Y52 H;  3S24 A;  3BU2 A;  3AYH B;  4LUZ A;  4PG3 A;  3S14 H;  3M85 A;  1N33 L;  1B8A A;  2AWN A;  4A3I G;  1X56 A;  2N8N A;  3RLF A;  1IYJ B;  1OXU A;  3K7A H;  4LF7 L;  1VQE A;  2R92 H;  1JJ2 A;  1PFS A;  1BBU A;  1WJJ A;  2K5H A;  4A3M H;  4A3L G;  4DV2 Q;  4IOC A;  4QL5 A;  5GAE C;  1K83 H;  2AHO B;  4POF A;  4DR5 Q;  4C3I H;  3RZO H;  1UE1 A;  4OON A;  4DV5 Q;  1D7Q A;  1Z47 A;  3M4Q A;  4HJA A;  4IJL A;  3CC2 A;  1FGU A;  4AQY Q;  1MJC A;  5J3B A;  3PIO A;  3BZK A;  4DAY B;  3A5U A;  1Q12 A;  3PGZ A;  2NN6 I;  4MTN A;  2HHH L;  1C0A A;  5IYB G;  3M9B A;  5C3E H;  3S1N H;  2EQS A;  5BR8 Q;  1XNR Q;  3M3Y H;  2LSS A;  5M3M G;  4GKK Q;  1CKM A;  3K0X A;  1YJ9 A;  1SN8 A;  2F3I A;  2I5L X;  2Z0S A;  2VW9 A;  2ZTE A;  2PMZ E;  5H1S E;  3TS2 A;  2YYZ A;  1YIJ A;  1I50 H;  1C9O A;  1NBW A;  3PUX A;  1X6O A;  1VQF A;  5IY0 A;  4DR1 Q;  1IBL L;  2GVA A;  4HJ9 A;  1QZH A;  1K3R A;  1VQJ A;  1IXR A;  5ELO A;  1BBW A;  1OXX K;  3FKI G;  1N34 Q;  1IBM Q;  1QVF A;  2WFW A;  3HOU H;  4IFD J;  5JJL A;  1AH9 A;  4DR7 L;  2WP8 J;  4LF8 L;  2ZJQ A;  5LMN Q;  2VL6 A;  1KAW A;  1N9W A;  2D0O A;  4IPH A;  4DUY L;  2UUC Q;  4LF9 Q;  2VUM H;  1EWI A;  2BH2 A;  3HOU G;  4QGU A;  1XPU A;  5LMU Q;  1Q82 C;  4TVA B;  1HZA A;  2A8V A;  2HIX A;  1PH8 A;  3I4O A;  5AJ3 L;  1Q1E A;  2WB1 G;  3KF6 A;  2E5L Q;  1PHJ A;  4B3S Q;  3HOV H;  2R7Z G;  3PIP A;  4B3M Q;  4A3E G;  2ASB A;  5HY6 A;  4NPS A;  4WJ3 M;  2JA6 G;  2I5M X;  4C3J H;  4YCW A;  2Q2I A;  1V43 A;  1M90 C;  1E22 A;  4JOI C;  1HZB A;  4BA1 I;  2YV5 A;  3J7A 5;  2N49 A;  4GN4 B;  4PZ7 A;  5GRO A;  1I3Q H;  3H0G G;  1VCI A;  1T9H A;  4LWC A;  4BY1 G;  3UE1 A;  2RCN A;  5FLM H;  4DV2 L;  3GTO H;  1L1O A;  4BBR H;  4DR5 L;  1Z9F A;  4DV5 L;  2JA8 H;  1QZG A;  1HZ9 A;  3EN2 A;  3K8A A;  3KF6 B;  3CAM A;  4AQY L;  5FLM G;  3ULP A;  1S40 A;  4IJH A;  3RLN A;  1YJN A;  1L0W A;  1L2F A;  3J80 i;  3KJP A;  3G4S A;  1EQQ A;  1Q81 C;  3CCM A;  2JA8 G;  3I4M H;  2R93 H;  5BR8 L;  5IT9 c;  1XNR L;  4GKK L;  1G6P A;  1WOC A;  3E9I A;  1SFO H;  1QVG A;  2AKW B;  4XTC S;  3I4M G;  3PV0 A;  4DR1 L;  1VQK A;  1X3E A;  1XNQ L;  5DLQ E;  2PQA A;  2ZM6 Q;  3F2B A;  1N34 L;  4UP8 A;  1SRU A;  3ZJY C;  5FLX c;  1IBM L;  1VQ5 A;  3TQY A;  4BXX G;  4A3D H;  3ICE A;  3D31 A;  2OTJ A;  4R1J A;  3GO5 A;  2UUC L;  5C44 H;  4JBK A;  5LMU L;  2CWP A;  3J80 c;  1PH7 A;  4A3D G;  2E5L L;  1NY4 A;  3I56 A;  4B3S L;  4QQB X;  5IP9 H;  5C44 G;  2ES2 A;  5IWA Q;  4GLA C;  4LUV A;  3HOY H;  2PQA B;  2K5N A;  4GNX C;  2HHH Q;  4MNO A;  3RN5 A;  2KCM A;  5IP9 G;  4O2D A;  1VQG A;  4OX9 Q;  3FHW A;  4OWT B;  3MXN B;  2B3G A;  2VQE Q;  3SGI A;  4JOI A;  1NMF A;  1GD7 A;  1YBY A;  1UWV A;  2ALY B;  2BH8 A;  2K4K A;  3CPW A;  1SMX A;  4TQU S;  2IX0 A;  1B7Y B;  4L5Q A;  3BZC A;  4JI3 Q;  3K7U C;  1I94 Q;  4HJ8 A;  1WCM G;  3T1H Q;  4A3J G;  3FP9 A;  1S72 A;  1MJE A;  1Q86 C;  4H02 A;  4EX5 A;  2VNU D;  1JT8 A;  4A3I H;  5JEA J;  4JYA Q;  1Q1B A;  4OXP A;  1YIT A;  1GM5 A;  4O0A A;  1WYD A;  2LXK A;  2NN6 G;  4JI8 Q;  4ALP A;  1NMG A;  4A3L H;  2UUA Q;  3HKZ G;  3H3V H;  4OWX B;  4X66 Q;  2ZM6 L;  2CWA A;  2EIF A;  4R4Q A;  2IHE A;  4IPG A;  4A4I A;  2NVT H;  2YU9 H;  4JI0 Q;  3CPF A;  3JAM i;  1K8A C;  1W2B A;  2MO0 A;  1HZC A;  4DK3 C;  4A3K G;  1I6H H;  1SLJ A;  4WJ4 A;  4DR4 Q;  4DV6 Q;  1JMC A;  3NBH B;  2MNA A;  3GTM H;  3CXC A;  5IYB H;  4HJ7 A;  4GOP C;  2ZTD A;  4BY7 G;  5M3M H;  3HOZ H;  2WAQ G;  2NVY H;  5IWA L;  4POG A;  1HNZ Q;  1G29 1;  1C7Y A;  4A3G G;  4X6A H;  1VQH A;  4DV7 Q;  1VQN A;  2H5X A;  1JJG A;  5FJ8 G;  2UXB Q;  1EQR A;  3BJU A;  3W1G A;  4OX9 L;  3HOZ G;  4OO1 I;  3FKI H;  3RZD H;  1DGS A;  4ME3 A;  2VQE L;  1PH6 A;  3I4N G;  1G51 A;  4GN5 A;  3ER0 A;  4LFB Q;  3L0O A;  1UE5 A;  4L5T A;  1XNQ Q;  3G71 A;  3A0J A;  1YNX A;  4IOA A;  2B29 A;  4JC0 A;  1XPO A;  2CQO A;  4JCV E;  4JI3 L;  1OTC A;  4JBW A;  1I94 L;  1N36 Q;  2R7Z H;  4MZ9 A;  1NTG A;  3AFP A;  1VQA A;  1S3O A;  3T1H L;  4A3E H;  2R6G A;  5ELN A;  3MEF A;  2KCT A;  1TWH H;  2JA6 H;  4AYB E;  1VQ6 A;  3NEM A;  4P71 A;  1J5E Q;  4JYA L;  3UDG A;  3K80 C;  4GNX B;  3TS0 A;  4IFD G;  1E1O A;  2OCE A;  3ULJ A;  4BY1 H;  1EIF A;  4DV0 Q;  1XMQ Q;  2DGY A;  2I5H A;  3H0G H;  4JI8 L;  1HR0 W;  1Y1V H;  2ZJP A;  4LUO A;  4P72 A;  4X66 L;  2UUA L;  2NVX H;  2VY3 A;  2LXJ A;  1VS0 A;  3UDF A;  1A62 A;  3PSI A;  4JI0 L;  3HKZ E;  3M4P A;  1Y1V G;  4OWW B;  2JE6 I;  3AFQ A;  5JJI A;  1V9P A;  2GVB A;  1YEZ A;  4DV6 L;  4DR4 L;  1X55 A;  1K8G A;  3W5O A;  2CFM A;  1SR3 A;  1VQC A;  2IT1 A;  3K81 C;  3KLW A;  3E9H A;  1U0L A;  3CP0 A;  3GTP H;  1GKH A;  1PYB A;  1LUZ A;  1X54 A;  2XTI A;  1HNZ L;  4P73 A;  1VQM A;  2OWO A;  5IYD H;  4DV7 L;  5C4X H;  4IPC A;  1P8L A;  2WAQ E;  2VQF Q;  1X65 A;  4DV3 Q;  2UXB L;  4YWM A;  3U4V A;  3F2C A;  2ZJR A;  2PI2 A;  3ERS X;  4X65 Q;  4KHP Q;  2PI2 E;  3PUV A;  4GLX A;  1D8L A;  5IP7 G;  5IYD G;  1KIX A;  1HNW Q;  4L5R C;  1VQ9 A;  5C4X G;  3UDI A;  4R4I A;  4DUZ Q;  4HJ5 A;  4BXX H;  3EBE A;  3KF8 B;  5C0X I;  3J81 j;  4LFB L;  4DV1 Q;  1ASY A;  1MKH A;  3S15 H;  3CCV A;  1EUJ A;  1VQ4 A;  3GDE A;  4K0K Q;  2MO1 A;  3I55 A;  2KBN A;  1CKO A;  1Q8K A;  3CCR A;  2JJQ A;  4JI2 Q;  1N36 L;  1XTD A;  4GS3 A;  1KHI A;  3PO2 H;  4LW1 A;  5M5Y H;  2N3S A;  4DR3 L;  2HT1 A;  2B63 G;  1CSP A;  4GOP B;  2JA7 G;  3S1R H;  4YHH Q;  1SRO A;  1QVC A;  1J5E L;  2D62 A;  3J81 i;  4IO9 A;  2K14 A;  2N78 A;  4B3R L;  4DV0 L;  1XMQ L;  1HH2 P;  2ID0 A;  1UE7 A;  1K9M C;  2OQK A;  3PUZ A;  5E7N A;  3KYH C;  4LNQ A;  3GTK H;  3DM3 A;  4RG1 A;  1HNX Q;  1TWA H;  2Q2T A;  4AIM A;  3GTG H;  3TRE A;  5IE8 A;  4NXM Q;  2JK8 A;  4UP7 A;  1WCM H;  4A93 G;  3JC6 6;  4DK6 C;  5GAD C;  4A3J H;  1EFW A;  1X9N A;  1B70 B;  4HID A;  3OW2 A;  1OXS C;  5C4J H;  4UPA A;  4B3T Q;  3STB D;  1VQB A;  4AYB G;  1VQL A;  3EIV A;  4JI6 Q;  1LTL A;  3IRB A;  1WFQ A;  1A63 A;  3PF5 A;  3AEV A;  4LF6 Q;  2VQF L;  4DV3 L;  2FXQ A;  4JG2 A;  1TWG H;  3RLO A;  3CCU A;  2CKZ B;  3U4Z A;  4X65 L;  1IBK Q;  4KHP L;  1HNW L;  1E7Z A;  4YCU A;  1VQO A;  4YWL A;  3GTQ H;  4NB3 A;  1O7I A;  5LMN W;  4DUZ L;  4A3C G;  1TWC H;  3S17 H;  2HQL A;  4DV1 L;  2NZH A;  1UEB A;  2Z6K C;  4X64 Q;  1AE2 A;  4A3K H;  4A3F G;  1VQ7 A;  1Y1W G;  2E2H H;  4K0K L;  4KHZ A;  4YWK A;  3STB C;  2E2I H;  3PO3 H;  3OTO Q;  4R4T A;  1PH5 A;  1QUQ A;  3DLL A;  1W3S A;  4JI2 L;  2QEX A;  3S1M H;  5JEA G;  1PH1 A;  1KRS A;  2JA5 G;  4FDB A;  4JI7 Q;  4HIM A;  1Q7Y C;  3PUY A;  4BY7 H;  2K52 A;  1PA6 A;  2RHS B;  3PO3 G;  1OXT A;  2DUD A;  4JI5 Q;  1AE3 A;  2RF4 A;  3NEN A;  4YHH L;  1NJI C;  4BBS H;  3HKS A;  3PCO B;  4A3G H;  2Q2U A;  4GLV B;  2IX1 A;  1E3P A;  5FJ8 H;  1HJP A;  3CCE A;  2CCZ A;  1K0R A;  1CSQ A;  4LF4 Q;  4AH6 A;  1X3F A;  4DR6 Q;  2F4V L;  4BBS G;  3M7N A;  4QY7 A;  3I4N H;  1L1O C;  3AQQ A;  1QUQ B;  1IL2 A;  2UXD L;  1M1K C;  3CC7 A;  4QIW E;  1HNX L;  3Q8D A;  4HIK A;  4HIO A;  3RNU A;  2E8G A;  4GNX A;  2BA1 A;  4JV5 Q;  4NXM L;  2AMC B;  4R4C A;  4XIG S;  1HR0 L;  3HOW H;  1XMO L;  3JAM c;  2R7F A;  4LFA Q;  4L5S A;  4PZ8 A;  2R92 G;  4KLK A;  4A3M G;  2K50 A;  1A8V A;  2A1A A;  4B3T L;  2YTY A;  4RMF A;  1GO3 E;  3HOW G;  4DV4 Q;  3KDF A;  4JI6 L;  4LFC Q;  1KXL A;  1FJG Q;  4DR3 Q;  4LF6 L;  1BKB A;  1KL9 A;  2L15 A;  1IBK L;  1YHA A;  3S2D H;  1YHB A;  1PH3 A;  5C0X J;  3CCS A;  3S2H H;  1EOV A;  4EQ5 A;  1VQD A;  3CC4 A;  3H3V I;  4X64 L;  3I7F A;  3L2P A;  5C3E G;  5EAY A;  1RL2 A;  1UE6 A;  3GD7 A;  1PH9 A;  4R4O A;  2Y0S E;  4P75 A;  4P74 A;  1NE3 A;  1CKN A;  5M5X H;  3OTO L;  2Q2H A;  2BA0 A;  3KDF B;  4JI7 L;  1KRT A;  2Z6K A;  2UXC Q;  1I5F A;  5C0X G;  2AWO A;  1PYS B;  2YTX A;  4JI5 L;  2UU9 Q;  1CUK A;  1E24 A;  1FVI A;  3I2Z A;  4JI4 Q;  4DPG A;  3CQZ H;  1PVO A;  5GAH C;  3RR5 A;  3T1Y Q;  2MQH A;  4APV A;  2UUB Q;  2QGQ A;  4DR2 Q;  2OTL A;  3G48 A;  4LF4 L;  1FL0 A;  1SE8 A;  4DR6 L;  1V1Q A;  3PO2 G;  5K36 G;  3A74 A;  5IP7 H;  2KHJ A;  2VUM G;  1ASZ A;  3S1Q H;  2PNH A;  1TWF H;  1CKN B;  4YY3 Q;  3E0E A;  4GOP A;  1PH2 A;  2D0P A;  3HOV G;  2RHQ B;  2MFI A;  2NZO A;  3H15 A;  4JBJ A;  3TRZ A;  2E2J H;  4GKJ Q;  4X62 Q;  3VDY A;  4JV5 L;  3LGJ A;  4A75 A;  3HFZ B;  1VQP A;  3TEH B;  4NXN Q;  4Y7N H;  4LFA L;  3U58 A;  3F8T A;  3W1B A;  2B63 H;  2JA7 H;  1R9T H;  3PUW A;  4J15 A;  4LF5 Q;  4JI1 Q;  4BBR G;  1U5K A;  4DV4 L;  1JB7 A;  4LFC L;  1BVS A;  3NEL A;  4C3H H;  4IFD I;  1FJG L;  1N32 Q;  1KC8 C;  1YVC A;  3CD6 A;  5M3F H;  4YCV A;  3L7Z C;  2KHI A;  4UP9 A;  1IZ6 A;  1PV4 A;  2VS1 A;  1L1O B;  2K5V A;  1OXV A;  2ZTC A;  3UDX A;  5M3F G;  4JBM A;  2F4V Q;  1LM0 A;  2R93 G;  3F2D A;  3CCL A;  1N33 Q;  1VQ8 A;  3RN2 A;  1E1T A;  3B6Y A;  3A5Z B;  2UXD Q;  1RIP A;  2QA4 A;  2JEA I;  1N8R C;  3GTJ H;  4LF7 Q;  4A93 H;  2OQ0 A;  2ATW A;  3CMA A;  1YJW A;  2UXC L;  2EXD A;  1Q46 A;  2GN5 A;  5JJK A;  3S16 H;  1TXY A;  5LMN L;  2UU9 L;  4LF9 L;  4A3B H;  1HR0 Q;  3CME A;  4JI4 L;  1XJV A;  1XMO Q;  3T1Y L;  4GN3 B;  1YHQ A;  2UUB L;  3ULL A;  1Y14 B;  5HGQ A;  4PZ6 A;  4DR2 L;  1X3G A;  1KQS A;  1XPR A;  3WWV A;  4B3M L;  2VZA A;  5GQO A;  3G6E A;  4A3B G;  3CW2 C;  3CF5 A;  1KD1 C;  3J81 c;  3CCQ A;  5GAG C;  4C2M H;  2WB1 E;  3M4O H;  4YY3 L;  1EIY B;  1LYL A;  3F1Z A;  1VQI A;  4A3C H;  3UE0 A;  1EYG A;  1A0I A;  4PMW A;  2KEN A;  4A3F H;  4BA2 I;  2V1C C;  1JE5 A;  2F52 A;  3CCJ A;  3OYY A;  1Y1W H;  4GKJ L;  4X62 L;  3HOY G;  4IPD A;  1JJC B;  2A19 A;  2Y0S G;  4DKA C;  1MIU A;  3KFU A;  2JA5 H;  1PH4 A;  2JQO A;  4DNI A;  3KOJ A;  4NXN L;  3J7Z C;  4DAM A;  3HOX H;  1IBL Q;  2I0Q A;  5M5W H;  5IYC H;  1J6Q A;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...