3S1QH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1qH00
4LF5Q 3PCOB 2KHIA 1J5EL 4C3HH 4A3KH 1SR3A 3ZJYC 3OYYA 2A1AA 1BBUA 1NY4A 4GOPC 2OQ0A 5DLQE 1XPUA 2WP8J 1LTLA 2LSSA 3CPFA 1I94Q 1VQOA 3GTOH 3BJUA 3LGJA 4A3BG 2KCTA 2BH2A 3HOZG 3UDFA 3H3VI 5IP7G 2N78A 4C3JH 1YHQA 1BBWA 4DPGA 1A8VA 1QZGA 4DR2Q 4OWWB 1CKOA 4P71A 1PH2A 4B3TL 4JBMA 4JOIC 1VQKA 3KFUA 4PMWA 2Z6KC 4IO9A 1M90C 2UU9L 2GN5A 3KF6A 5IP9G 1K0RA 2IHEA 4YHHL 5C0XJ 4GS3A 2N8NA 2AMCB 3HOUG 2NZHA 3G6EA 3PO2G 1Y14B 4EX5A 4P72A 1YIJA 2E5LQ 3CF5A 5IYCG 3HOXG 4R4CA 1NE3A 4ALPA 4DV1L 1PV4A 1JB7A 2JA5G 2D0PA 1FJGL 4DR4Q 4X6AH 4BBRG 5C4JH 3JAMc 2Q2IA 3M7NA 2NVYH 4JC0A 2UXCL 1PH8A 4IPHA 4R4QA 1VQ6A 3EN2A 1QUQA 3D31A 4X62Q 5M5XH 1OXVA 5HY6A 3PUWA 4B3RQ 3HOZH 1CKNA 1TWCH 5IP7H 4QGUA 1YJWA 3TREA 3EIVA 5FLXc 1OXUA 1MJCA 2LXJA 2F4VQ 5M3FG 3HKZG 2VQFL 2IY5B 4X66Q 1IBMQ 4OWTB 4DUYQ 1K73C 2PQAA 4DV6L 2YYZA 3F2BA 2Z0SA 3I55A 3S17H 2UXDL 1U0LA 3J81i 4POGA 4LF8Q 2MNAA 4UP9A 5FLMG 1PH9A 2IX0A 1L0WA 3STBC 3I7FA 4X64L 4B3ML 3HOUH 1E1OA 2OTLA 3T1HL 1N32Q 4AIMA 2ZJPA 3S15H 1VQBA 2NN6G 4R1JA 1C0AA 3CCMA 1AH9A 1XMQL 3GO5A 2JA6G 3KJPA 2DGYA 2I0QA 3HOWH 1HNXQ 4BBSG 3M4PA 3K81C 2EIFA 4GLAC 1TWHH 4DV3L 3U50C 3T1YQ 1IBLL 1EFWA 4OX9L 1Q12A 3M9BA 1XNQQ 1Q86C 2E2HH 4LFBL 4NXML 3D0FA 3UDIA 1NMFA 4JI5Q 3HOVG 3SGIA 1WJJA 3J80c 4JI8L 2WAQG 2UXBL 1A0IA 5HGQA 5GROA 3L2PA 5M3FH 4AQYQ 3S1MH 2R93G 1P16A 2GVAA 2CFMA 2ATWA 2AKWB 3TS0A 2UUCQ 2HT1A 4X65Q 1VQAA 5AJ3Q 3S16H 4HJ9A 3RN5A 1K83H 4JYAL 3I4NG 4OO1I 3KF6B 5FJ8H 5IWAQ 2PMZE 1I3QH 2JA9A 4MTNA 1IZ6A 1UWVA 4QJFA 3K0XA 3TEHB 5FLMH 3RLFA 4LNQA 3CD6A 3S1NH 3L0OA 3TS2A 3PUYA 4IOAA 4L5QA 1N33Q 4R4TA 4UP8A 3G4SA 2DUDA 1GD7A 4LF4L 3PV0A 3S2HH 4JI6L 3H3VH 5IY0A 2JA6H 1G6PA 4LFCL 4YWKA 1FGUA 1SN8A 1Y1WG 1YNXA 4LFAQ 1Q82C 1N34Q 2K50A 2E2JH 4BBSH 4POFA 4A3IH 2B3GA 1X3FA 4QQBX 3H0GG 4LF7L 4JI0L 1YZ6A 1QUQB 1PYSB 5GAEC 1XJVA 3CC2A 3S1RH 1X3EA 2ZJQA 1CKNB 4LUOA 1VQCA 4A3GG 4DUZL 1KIXA 2ALYB 2A8VA 2ASBA 3DM3A 5LMUQ 4KI0A 5J3BA 2JEAI 2AWNA 4ME3A 4LUZA 2HIXA 2K5HA 4YY3L 3GTJH 3OW2A 1SROA 3G71A 5LMNQ 4DAMA 4A4IA 3UE1A 2PQAB 3CXCA 4A93H 1K8AC 2VUMH 4XTCS 3PO3G 1HNWL 1LYLA 5M5WH 5C4XG 4JI1L 4A3DG 4HIKA 2ZM6Q 1DGSA 4A3JG 1CSQA 2N49A 1X56A 4AYBG 2ZTDA 4HIDA 3GTMH 1EWIA 1HR0W 4DR1L 4JG2A 3B6YA 3PIPA 1K3RA 4K0KL 4B3SQ 3RLOA 3W5OA 1HNZQ 4AH6A 2VQEL 1Y1WH 2K52A 4L5SA 5JEAJ 1VQ9A 2Q2TA 3CCRA 3H0GH 4OONA 1EQQA 1PH3A 2KCMA 1OXXK 2R7FA 4OXPA 5LMNW 2B63G 3HOYH 1QVFA 2NN6I 2E8GA 3L7ZC 4OO1G 3U58A 2IT1A 4A3GH 2QEXA 1XNRQ 2HQLA 5GAGC 1X3GA 4HJ5A 2Q2UA 2C35B 3VDYA 1WYDA 2K5VA 3A5ZB 1PH5A 3W1GA 1TWFH 4DV6Q 4DR6Q 3J7ZC 4DR7L 3I4MH 4L5RC 3DLLA 4PZ8A 3RLNA 1Q1BA 5C4XH 3RNUA 4JBJA 4A3DH 5JJLA 2L15A 3CW2C 4A3JH 4X64Q 4B3MQ 4WJ4A 4JI3Q 2WFWA 2R7ZG 4KHPL 3JAMi 2JA7H 3T1HQ 3FKIH 5JJKA 1KD1C 1IXRA 2RCNA 2F3IA 1Y1VG 1E22A 1VQGA 1QZHA 4P75A 3AFQA 1OXSC 2ES2A 4DV3Q 1CUKA 3PGZA 5GADC 4OX9Q 4GKKQ 4KHZA 3ULJA 3CQZH 5BR8L 2I5HA 4NXMQ 3NEMA 4BA2I 3F8TA 2B63H 4A3BH 4NB3A 2K75A 3AEVA 4JI8Q 4EQ5A 2NVQH 1XPRA 2D62A 1PH4A 1FL0A 2AWOA 4JI7Q 2FXQA 1VQJA 4GKJL 1J6QA 2R92G 3M4QA 3GTPH 2HHHQ 4LF6L 2RHQB 3UDGA 3RR5A 5GAHC 1IYJB 1VQ8A 2KHJA 3UE0A 1NMGA 3A0JA 4GLVB 3KJOA 5IP9H 1KRTA 1N36Q 4JI2L 3A5UA 4DV5Q 1E3PA 4DV7Q 4HJ8A 4LF5L 1RL2A 2JQOA 4LF4Q 2JA8G 1HZCA 4JI6Q 3PO2H 3CC7A 1I94L 3NELA 1W3SA 2CQOA 5IYCH 3UDXA 3CAMA 3HOXH 2N3SA 2JA5H 4A3MG 1S72A 2PNHA 1IBKQ 3IRBA 3J80i 4IFDI 4BBRH 4DV0Q 3E9IA 3GDEA 2VW9A 2YTVA 2UUAQ 2OTJA 5C3EG 3J7A5 2B29A 2WB1E 2YV5A 4UY8C 4DR2L 4DV2Q 1VQPA 1ASZA 1UE5A 4IJLA 4DR3Q 2MO1A 3ERSX 3K7UC 5E7NA 1V9PA 2R92H 4DK3C 3CCEA 3CCSA 1HJPA 4DV4Q 4NXNQ 4HIMA 4DK6C 3OTOQ 3ICEA 4HJ7A 3K8AA 1WI5A 1EUJA 1V43A 4BY7G 1L2FA 1SLJA 5M3MG 2E5LL 3S14H 4DR1Q 1XPOA 3CMEA 4J15A 4DR4L 4WJ3M 3A74A 5IYDG 3J81j 4K0KQ 2MFIA 4A75A 1N9WA 1WCMG 3JC66 1EOVA 1J5EQ 1VQ5A 4R4OA 2A19A 2E2IH 1SFOH 4A3MH 2VL6A 4B3RL 4A3CG 1EIFA 1I5FA 1VQEA 2CWPA 3E0EA 3CCQA 2F4VL 4A3FG 1KQSA 1X55A 1AE2A 3BZKA 4QY7A 3M4OH 1B7YB 5C0XG 1IBML 2CCZA 1PHJA 2UUBL 3HOVH 4DUYL 1VQLA 2JEBI 1FVIA 1E1TA 1P8LA 1PFSA 4LUVA 3I56A 4MZ9A 4RG1A 1WFQA 1N8RC 3KLWA 4B3TQ 4DR7Q 1KHIA 2R93H 1YBYA 2Y0SE 1WOCA 3BZCA 1UEBA 1Z47A 4QIWE 4BY1G 1YITA 1KC8C 3EBEA 2UU9Q 3AQQA 4LWCA 3NBHB 3F2CA 3I4NH 3KYHC 2YTXA 1N32L 4A3KG 5M3MH 4YHHQ 4UPAA 1L1OA 4IFDG 2KBNA 3Q8DA 1SRUA 1KRSA 4IOCA 2D0OA 5JJIA 2XGTA 1VQ7A 3ULLA 2I5LX 4YWLA 1HNXL 1GO3E 2ID0A 2MQHA 4DV1Q 3GTQH 4IPGA 3T1YL 1FJGQ 4O2DA 1LUZA 1TXYA 2R7DA 2ZTCA 1XNQL 1X54A 4A3CH 4A3EG 3I4OA 5BR8Q 2UXCQ 4JI5L 3CCVA 4GNXC 4Y7NH 1O7IA 5M5YH 4TQUS 3CPWA 1KAWA 1Q8KA 1GM5A 4DNIA 1K8GA 3MEFA 2ZTEA 1X65A 2F52A 1ASYA 1NBWA 2JE6I 5AJ3L 2VQFQ 1PA6A 4JV5L 1D7QA 1VQFA 4LF6Q 5IWAL 4JI4L 4BY1H 1VQDA 3KDFA 4BA1I 1Q81C 2UXDQ 2VNUD 4JCVE 4LF9L 1IL2A 1N33L 1MIUA 4QL5A 3PO3H 4JI2Q 1XTDA 2CKZB 4LW1A 1B70B 1B8AA 1UE7A 3TRZA 3E9HA 3PF5A 4DR5L 1TWGH 3F1ZA 4HIOA 1C9OA 1S3OA 2I5MX 5IYBG 3PIOA 1N34L 4LFAL 1PH7A 2QGQA 1HR0L 4IPCA 1I50H 3ER0A 2Q2HA 1XMQQ 1JJ2A 1MKHA 2OCEA 3GD7A 3WWVA 4HJAA 1EQRA 2K14A 1IBLQ 4A3EH 1U5KA 1M1KC 3PSIA 1YJ9A 1VCIA 1XMOL 3GTKH 5LMUL 4LFBQ 1A62A 2YTYA 2OWOA 3RZDH 4BXXG 1GVPA 1PYBA 5LMNL 5ELNA 4GNXA 2UXBQ 1SMXA 1A63A 3M85A 1YHBA 3AFPA 2BA0A 1YEZA 5IT9c 1GKHA 1UE6A 2ZM6L 1TWAH 3S24A 3W1BA 3GTGH 4P73A 4JYAQ 5GQOA 3K80C 1JJCB 1LM0A 3HKSA 3HKZE 1AE3A 5C0XI 4APVA 2RHSB 2BA1A 4R4IA 3MXNB 2JK8A 1L1OB 4B3SL 3H15A 1HNZL 1JT8A 1VQ4A 2R7ZH 1K9MC 3HOWG 2IX1A 5IYBH 2RF4A 4YCVA 3HFZB 4GOPA 1Y1VH 1JMCA 4LFCQ 4IFDJ 3PF4A 3KOJA 5C44G 1JE5A 1G51A 3ULPA 4UP7A 4LF7Q 1X9NA 4JI0Q 1X6OA 2OQKA 1VQMA 1XNRL 2UUBQ 4DAYB 4BXXH 1VQNA 4DUZQ 1H95A 2XTIA 4MNOA 4DR6L 5IE8A 1T9HA 1EIYB 2VY3A 3U4ZA 1E7ZA 4JBWA 1KL9A 2EXDA 4XIGS 4YY3Q 5FJ8G 2QA4A 4JOIA 3KDFB 1S40A 3PUVA 1C7YA 2Z6KA 4JI3L 4JBKA 1HNWQ 3G48A 1L1OC 1HZ9A 2BH8A 2WAQE 4JI1Q 5JEAG 4FDBA 2LXKA 4GN3B 3CCLA 4PZ7A 2JJQA 1Q7YC 4H02A 3NENA 4NPSA 1YI2A 3J81c 1RIPA 4PZ6A 3S1QH 1OTCA 2WB1G 4A3IG 1QVGA 2JA8H 4GKKL 2PI2A 3TQYA 2VQEQ 1NTGA 1HZAA 1BKBA 3KF8B 2H5XA 2GVBA 1SE8A 4X62L 5C44H 4IPDA 4YCWA 1PH1A 4C2MH 4RMFA 3CC4A 1YHAA 3AYHB 2PI2E 4A3LG 1CSPA 2IHFA 1R9TH 1BVSA 2HIVA 5C3EH 1E24A 1PH6A 4JI7L 2VS1A 1EYGA 4A93G 1YJNA 3CCUA 4X66L 1MJEA 2VUMG 2HHHL 4JV5Q 4GNXB 1Z9FA 3PUXA 4OWXB 4JI4Q 1UE1A 1Q46A 4GN4B 4YCUA 1CKMA 4YWMA 3CMAA 2KENA 3K7AH 2VZAA 4LF9Q 4IJHA 1N36L 1D8LA 1V1QA 5ELOA 4DV5L 4DV7L 4LF8L 4Y52H 5EAYA 3I2ZA 4BY7H 2YU9H 4DR5Q 2K4KA 4KHPQ 1G291 1OXTA 2EQSA 3PUZA 4PG3A 3U4VA 3S2DH 3RZOH 2ZJRA 1YVCA 3F2DA 5K36G 1HR0Q 1IBKL 5H1SE 5IYDH 1I6HH 1QVCA 4P74A 4C3IH 4DV0L 1HH2P 1W2BA 1WCMH 1KXLA 4AYBE 4GOPB 3RN2A 3HOYG 3FP9A 1JJGA 2UUAL 4L5TA 1XMOQ 2Y0SG 4DV2L 2NVXH 4GN5A 3BU2A 4A3LH 4KLKA 2R6GA 4DR3L 1Q1EA 1NJIC 1VQIA 4A3FH 2V1CC 2NVTH 2MO0A 4AQYL 3I4MG 3M3YH 2AHOB 4NXNL 4DV4L 4DKAC 3OTOL 3GTLH 2UUCL 2CWAA 4O0AA 4GKJQ 4TVAB 1VQHA 4X65L 1PVOA 4A76A 2JA7G 2K5NA 1HZBA 3STBD 3FKIG 2NZOA 4GLXA 3CCJA 1VS0A 3CP0A 3FHWA
chains in the Genus database with same CATH superfamily
3RMHA 3PCOB 4ZRZA 2KHIA 1J5EL 4A3KH 1LTTD 2DY7A 2A1AA 5K36H 3GTQB 1UNSA 1PTOC 3CPFA 4A3BG 1PRTC 3VR5A 1PTOF 3UDFA 5IP7G 2QF7A 3FEWX 1PRTF 1KLUD 1YHQA 3I91A 3GTLB 4OWWB 2I07B 1CKOA 4B3TL 4K8IA 5FK9C 5JVG3 1EZ8A 1IHZA 4JOIC 3KFUA 1RKNA 1R4PB 1M90C 2J7ZA 3K5OA 2GN5A 5DM63 2EYHA 1K0RA 4XXEA 3HRZC 4GS3A 2N8NA 3G6EA 1Y14B 3CF5A 2B2WC 4R4CA 1NE3A 1PV4A 1IKMA 1M4VA 5IOCA 4JC0A 3UI2A 1VQ6A 4ZKBB 4X62Q 5EPJA 1OXVA 5HY6A 4B3RQ 3C3LA 3HOZH 2R3ZA 3GTKB 1TWCH 5E4WC 3EIVA 2LXJA 3CRLC 3HKZG 3MZ5A 2IY5B 2NYZD 1K73C 2XWBB 4TKOB 3W2DA 2UXDL 3I55A 1U0LA 3SK4A 1WTOA 5BN4A 5FLMG 3D6CA 1PH9A 3STBC 3HOUH 3NSWA 2OTLA 1GHKA 2IL8A 2TMPA 2AQ3B 3KJPA 2DGYA 3HOWH 1HNXQ 1M8AA 2XVSA 3TDQA 2EIFA 1TWHH 2B2WA 1XNQQ 2E2HH 4LFBL 2RSNA 3D0FA 1G6ZA 3HOVG 4JI5Q 1B4OA 2K7VA 2WAQG 1B3AA 5HGQA 3L2PA 1BCPC 1HXYD 5D14A 3S16H 2K01A 3MFYA 3J7YW 1Y8OB 3J7AV 1IZ6A 2VB3X 4ME5A 4MN3A 3QO2A 1HQMC 1SNMA 1GD7A 4RWSC 3S1QB 1TS4A 2LS01 1BF4A 3H3VH 3D3RA 5LL6S 3OHXC 4YWKA 3R8BA 3VA7A 4KJOA 4QQBX 4LF7L 5C44B 1S5DD 1YZ6A 1QUQB 3ND9A 1TS5A 1PMRA 3NWSA 4JI0L 1EU3A 3S1RH 2KEDA 1TKWB 4DUZL 1KIXA 2A8VA 3DM3A 4LJZC 4KI0A 2FMCA 2SEBD 2JEAI 2AWNA 1WTVA 2K5HA 3OW2A 1K83B 1SROA 4DXGA 5LMNQ 3PQIA 2EPBA 3UE1A 4XTCS 1LYLA 5C4XG 4A3DG 4HIKA 4E6IA 2ZM6Q 4AYBG 4HIDA 1EWIA 1SAPA 1DONA 3VYSA 4K0KL 2QEJC 1G2TA 2QDLA 1KTKA 1WCMB 3NQTA 1WTHA 2CH4W 2NB0A 3H0GH 3NP8A 4OONA 2X6LA 1TR5A 1EQQA 1G91A 1OXXK 2R7FA 2B63G 3I3CA 2IT1A 2I46A 1TVXA 1XNRQ 2HQLA 3SK5A 4A93B 3TP8A 1X3GA 1IKLA 1QJOA 2C35B 2K5VA 4DR6Q 3I4MH 1VDZA 2N88A 4ZKCB 4L5RC 5I2YA 4FF2A 3GTMB 2HD3A 3A54A 3GV3A 5T1GA 4A3JH 4B3MQ 4WJ4A 1MHWC 4KHPL 2JA7H 5DEHA 4G7OC 4A3KB 1KD1C 2AQ2B 2RCNA 4NP5A 1CHPD 1QE6A 4QCLA 4KK7A 1CUKA 3PGZA 5GADC 4GKKQ 4KY6A 3FPPA 4KHZA 1FGBD 4U673 1WTQA 3PIO3 4NXMQ 5BR8L 4Q5VA 1BDOA 4PV1C 4OO1H 4EQ5A 2NVQH 3HS0C 1XPRA 2D62A 2F0UA 1FL0A 3E3XA 2X69A 2KJXA 1VF5C 2QILA 2HHHQ 5CMDA 1NMGA 3A0JA 1LO5D 3FKIB 1SE4A 2EJMA 4CHTB 3NTKA 5IP9H 3KJOA 4LF5L 4DV5Q 1E3PA 1AEXA 5JPNC 1LTBD 2HUGA 2PZTA 2A6HD 4JI6Q 3NELA 3UDXA 3FDTA 2PNHA 4XQNA 3J80i 3G6JB 2K6AA 3GDEA 2YTVA 3HOZB 3L9AX 1TWCB 3V05A 2B29A 4N8FA 1JB3A 3VYUA 4DR3Q 1JWSD 3ERSX 2ENBA 2R92H 1HCZA 1TU2B 1HJPA 1U9RA 4DK6C 5IT9L 1T5XD 3K8AA 4Z9CB 1WI5A 4BY7G 3HOUB 2WACA 2KVMA 1WCMG 1J5EQ 1IW7D 1VQ5A 1PFMA 4OIKA 3HOWB 4DFAA 1TWHB 1W6KA 4A3MH 1RTNA 2VL6A 1EIFA 4X3SA 1I5FA 2E2HB 2CWPA 2X6GA 4QY7A 2K1BA 2CCZA 4DUYL 4O1NA 4CJ2C 2Z9HA 3QJYA 1N8RC 3S16B 3KLWA 5CV9A 4B3TQ 4DR7Q 1YBYA 2Y0SE 4K6DA 1Z47A 1A3TA 4IUPA 4QIWE 3EBEA 3C1EA 4LWCA 1EL0A 4F8MA 2KECA 3KYHC 3K57A 1N32L 3K0YA 5M3MH 4A3KG 4UPAA 1L1OA 2KBNA 3Q8DA 2XGTA 1LLRD 3KUPA 2A6HC 3ULLA 1DOLA 4YWLA 5JPMC 2SNSA 5FO8B 1GO3E 3NWTA 2PPBC 2G5DA 1TXYA 1ESRA 4ABNA 4IUUA 1X54A 5C5MA 3WDNA 3M4OB 3BYYB 3O13A 2C5CA 1KAWA 1GJXA 2QW7A 1GM5A 2LFNA 4IURA 2F52A 2JE6I 1PA6A 4NDXA 3S9WA 2IX3A 1VQFA 5IWAL 1JOKA 1VQDA 4BY1H 2UXDQ 2VNUD 4JCVE 1IL2A 1MIUA 4IN3A 1XTDA 4LW1A 1B8AA 4IFDH 3SHLA 5EBCA 3E9HA 1CT1D 3HGBA 1D5XC 1C9OA 1S3OA 3DEOA 1N34L 4IPCA 1IW7C 1I50H 3CKIB 3KF8A 4ZYSA 3H0GB 2HCIA 1RCVD 2JYOA 5ELCA 5FO7B 4LFBQ 2YTYA 2Y0SB 3RZDH 1STHA 4QIWB 2IWHA 1ET9A 1TT2A 3I4MB 1CTMA 3PO3B 4P73A 4ILWA 4A3JB 3K80C 2L0CA 1JJCB 2JA7B 4HCEA 2RHSB 2BA1A 3HOWG 1Z6HA 2IX1A 5IYBH 2RF4A 1EEID 4IALA 4KKUA 3HFZB 1HTLD 4IUVA 3T56B 4X3KA 3NTIA 3ULPA 4LF7Q 4JI0Q 1X6OA 3KLRA 2NVQB 4DUZQ 1H95A 5IE8A 1EIYB 4PMBA 1K3BC 1HZ9A 2CQAA 2LXKA 1NNXA 2R7ZB 3CCLA 3VR2A 1Q7YC 3NENA 1IYVA 2ICIA 2OEOA 2L4NA 2JA8H 2DNEA 3OWFA 1BNZA 1BXTA 4X62L 2GVBA 2EDGA 5KNCA 1YHAA 3AYHB 5F2DA 5IGFA 4GZYC 1R9TH 2VS1A 1EYGA 1BO0A 1MJEA 3R2TA 3PUXA 2R92B 3BDOA 2M00A 2E74C 1S5ED 3CMAA 3K7AH 3N6RA 5E3FA 1DD2A 4KHPQ 1G291 1OXTA 3PUZA 4PG3A 3FMCA 1YVCA 3AMUA 1HR0Q 3CHBD 5H1SE 1I6HH 1XYIA 1GUTA 4A3MB 1HH2P 1W2BA 1XTCD 1JJGA 2NZ1D 4L5TA 2PQEA 2Y0SG 4DV2L 2NVXH 4GN5A 3BU2A 3FRPB 4A3LH 3VYRA 1Q1EA 3J80L 4KD4A 4IZ8A 2NVTH 4YIJA 3I4MG 4RGOS 4H44C 4NXNL 5IGGA 4DKAC 4I7AA 2K33A 5C0XH 3F2UA 3GTLH 3R3OA 4CDEC 1EIHA 3U9SA 2JA7G 2FMMA 1HZBA 4S3SA 5M3MB 1Q90A 2BE5D 5EQ0A 2K5QA 4LF5Q 4C3HH 3ZJYC 3OYYA 4GOPC 1XPUA 2WP8J 2ICEC 2EYLA 3PMFA 1VQOA 3GTOH 3LGJA 3LNNA 4DNTB 3H3VI 4V190 1PLFA 1QZGA 4K6LA 1PH2A 2D5DA 4KKTA 1VQKA 3J80E 4PMWA 2RBMA 2Z6KC 5C5LA 4BY1B 1NAPA 5IP9G 3DWPA 4CBVA 1HFNA 2AQ1B 2YU9B 1W6JA 1I4HA 4YHHL 3VA5A 2AMCB 2B2YC 1JICA 2HCCA 3VR4A 2NZHA 4EX5A 4P72A 1YIJA 3BVZA 2HDMA 1I50B 3X3NA 1B9MA 3JAMc 2Q2IA 1JR0D 3EN2A 1QUQA 3GQBA 5M5XH 3PUWA 3OOCA 3TREA 3M4YA 1OXUA 3RZDB 1D5ZC 5M3FG 2VQFL 4B9XA 3Q23A 5CV7A 4DUYQ 1PFNA 1XXGA 3F2BA 1AZPA 3J81i 1SNCA 4UP9A 1MSGA 1RTOA 4B3ML 4TSSA 2BE5C 1N32Q 5CORA 2WV6D 2JA6G 3GO5A 4BBSG 3K81C 2OT2A 4GLAC 1EFWA 2PYKA 3SE0A 5C4ZA 2Z4IA 5CV6A 2F4IA 3M9BA 1Q86C 4BWGB 4NXML 2Q8TA 3QB3A 4J6HA 1NMFA 3UDIA 1SNPA 4C56C 1STGA 3BVMA 1SYCA 2RDGA 4MTKA 5GROA 4AQYQ 1SNOA 2CFMA 4N9TA 2AKWB 2UUCQ 4HJ9A 1K83H 4JYAL 4OO1I 4TRDA 5IWAQ 2PMZE 3RNUA 4MTNA 1UWVA 3CD6A 4OIJA 4IOAA 3RLFA 3L0OA 3PUYA 1ICWA 4L5QA 4UAIA 2Z6BA 1ML0D 1MBYA 2P5ZX 4QUFA 3ERQA 1E0BA 4JW0A 5HGTA 4JI6L 2JA8B 1V8QA 1N34Q 4POFA 2B3GA 1HUMA 1CHQD 4ZUJA 1EFID 1PYSB 1XJVA 1CKNB 1MSHA 4LUOA 1R9TB 4A3GG 2KHSA 4HSVA 2ALYB 1XX8A 5E4XA 5C6AA 2F0JA 3GTJH 4KY5A 1EYAA 4A4IA 1I3QB 4A93H 1GXDC 1K8AC 4DNRB 4NMZA 1HNWL 3K7AB 4R8IA 1CSQA 4O42A 4JPBW 1HHVA 3GTMH 5EJWA 1EOTA 1K0SA 2K5WA 3OMGA 4AH6A 1I6HB 2O5IC 3BDLA 2XRQD 2K52A 1Y1WH 2Q2TA 2RQXA 3NQIA 2F0SA 3HOYH 2KCMA 4OXPA 5LMNW 2NVXB 2NBFA 1CK1A 4RHSA 1RHPA 1SJHD 1QVFA 1CA6A 2QEXA 2NVTB 2E75C 2PMZB 1C4QA 4HJ5A 4FF3A 3VDYA 2QKIC 3A5ZB 2IJ0A 3W1GA 1TWFH 4DV6Q 4DR7L 2EYMA 4JBJA 5JOBA 5JJLA 3CW2C 5NUCA 4X64Q 2EYJA 1SNQA 3T1HQ 1PZID 3FKIH 5JJKA 4C3HB 3NK9A 5ELDA 4ZCKA 1SJED 1E22A 1VQGA 1JOQA 1I6VC 4FVMA 4P75A 1OXSC 2ES2A 2RCFA 3GTOB 1QG7A 1I4QA 3VR6A 3ULJA 1EY7A 2I5HA 2K75A 1EQTA 2BDNA 1PH4A 3GTPH 3DXJC 2G9DA 5GAHC 1VQ8A 4R9WA 2LY7A 4GLVB 5CC4A 1JCKB 4LF4Q 2JA8G 5KYLA 5EKLA 5L37A 1W3SA 2CQOA 2L1BA 3CAMA 2JA5H 1SYGA 4IFDI 4BBRH 2EJFC 5M5XB 2BCOA 2ZT9C 3SEBA 2DY8A 1LT5D 4UY8C 4DV2Q 1VQPA 1WD0A 1ASZA 1FR3A 1NR2A 1HA5A 5CV4A 5E7NA 4WORA 4DK3C 4NXNQ 4HAEA 4HIMA 1B1ZA 1V43A 1L2FA 1E2VA 1FNVA 1SLJA 3PO2B 4DR1Q 4J15A 2PZWA 4K5WA 4DR4L 1ZKOA 5LHY1 2K32A 3A74A 4JK1C 4A75A 1FNWA 1CM9A 2A19A 2E2IH 1EQVA 4HCSA 1EIGA 2O5JC 5KRUA 4A3CG 1VQEA 3T16A 4LK1C 1RODA 3CCQA 4WJWA 3BZKA 3M4OH 4RGNA 4EVOA 5C0XG 1EWCA 2F0LA 3I56A 1P8LA 4LUVA 4IUNA 1WFQA 3HEJA 5D3IB 3A56A 3N52A 1A6XA 2R93H 1KC8C 1UEBA 1SXTA 4IQZA 3TMEA 1ILQA 3F2CA 4YHHQ 1QWYA 1F9QA 4C1NK 5JJIA 1CQFA 3J81L 2I5LX 1STEA 4O2DA 4PNYA 1X3QA 3OSOA 1WTXA 1VMPA 3SXHA 3Q0AA 5M5YH 1F2MA 3A55A 4TQUS 4F88A 3LWUA 1K8GA 3MEFA 3GTJB 1WTWA 1NBWA 1D7QA 2VQFQ 4LF6Q 2F0VA 3HP3A 1X32A 4QL5A 3PO3H 4JI2Q 2CKZB 1UE7A 1EY6A 3PF5A 1TWGH 2Q8RE 4HMJA 4HIOA 2I5MX 3PIOA 3FPUB 1KDBA 1HR0L 1Y1WB 3HG9A 1JJ2A 4M1UB 3J81E 4A3EH 3HOYB 1M1KC 1S5FD 5A35A 2OWOA 1GUGA 3KBXA 3MWYW 1A63A 1JC7A 2F0FA 5G3LD 1TWFB 3AFPA 1YEZA 4FF1A 5IT9c 1GKHA 4JYAQ 5CV5A 5GQOA 3A7LA 1Q8IA 1WTRA 5C0XI 3WOEA 3MXNB 2JK8A 2B2TA 4B3SL 1HNZL 2R7ZH 1K9MC 5D65A 4L63B 2F3WA 4IFDJ 1VMCA 3QG1A 5I9PA 1HRJA 1SE2A 5C44G 1JE5A 5DM73 4Q0FA 1ENFA 1ZEQX 4DAYB 4BXXH 1VQNA 2F1MA 3RD4A 5J39A 1SDFA 1U4PA 2K28A 1KL9A 3GTPB 2QA4A 3ZYYX 2R61A 1AN8A 3NUCA 3PUVA 1C7YA 4JBKA 1I4XA 1D6EC 3G48A 1L1OC 1HNWQ 5JEAG 4FDBA 4FXGC 4H02A 3A7AB 2PW7A 4UDUC 1U4MA 3TP5A 1RIPA 4PZ6A 1WTPA 1QNUA 1X3PA 2JA5B 1NTGA 4FO2A 4BBRB 4KKSA 1O80A 5HURA 2H5XA 1SE8A 1PH1A 4A93G 4JV5Q 1KNAA 4OL7A 1Z9FA 4OWXB 1A15A 1EY9A 2KENA 1MD2D 1D8LA 5G3LF 4DV7L 1N36L 1PZKD 1E2ZA 1ONLA 2O2LD 4DR5Q 2K4KA 5IT9E 2EQSA 3U4VA 3RZOH 2F0IA 5K36G 1IBKL 2E2IB 4P74A 5EKKA 2EVBA 1KXLA 3RN2A 3HOYG 2LKVA 1NUCA 4KV6A 5C3EB 3T4AC 1K28A 1RJTA 3LWEA 1EWHA 1PRTB 1S5CD 4AQYL 4XYQA 1B44D 4HTHA 2DNCA 3BS1A 3GP7A 4EQOA 2R93B 4OELB 2UUCL 4O0AA 1PVOA 1CZWA 4A76A 1C48A 1GHJA 4H0LC 3K5MA 1UAPA 3FKIG 4GLXA 2YU9H 4C1NI 4C3IB 3K5LA 1BBUA 1NY4A 2MGSA 2OQ0A 5DLQE 5ISRA 1LTLA 2EXZA 2LSSA 1S5BD 1PZJD 2DN8A 3PIP3 2KCTA 5IGDA 2BH2A 3HOZG 1WVLA 5M5YB 3M7GA 5TSSA 2Z1CA 2XWJB 4G57A 2EZVA 1BUVT 4P71A 5EPKA 2MP1A 4FP5D 4CDCC 5KIXA 2UU9L 1ENAA 2CHBD 1LV9A 2A69D 2M9VA 5C0XJ 3HOUG 1AFPA 1WD1A 1R4QB 1TWGB 1Z7TA 4DR4Q 2JA5G 1JB7A 1FJGL 1LABA 4BBRG 3SVMA 2CVRA 2RSOA 3M7NA 5BN5A 1O78A 3D31A 4A3EB 1CKNA 5IP7H 4QGUA 5JJZA 4OGQC 3DM1A 4X66Q 4OWTB 4DV6L 2YYZA 1BCPB 3S17H 2IW3A 4POGA 2E76C 3TSSA 1JE4A 2IX0A 2JP1A 2RDFA 5CGKA 4X64L 3I7FA 1E1OA 1NCVA 3C2PA 3T1HL 4AIMA 4B9WA 2ZJPA 1SYFA 4R1JA 5C4JB 1C0AA 2ZXPA 2I0QA 3M4PA 3QOLA 1GOZA 3U50C 1Q12A 4OEMB 1S4ZA 1SSOA 3J80c 2UXBL 1A0IA 4MHEA 2R93G 1RF2D 1OO9B 1P16A 2GVAA 2ATWA 3MFGA 2KQ3A 3TS0A 2HQEA 1SNDA 1BBXC 3KF6B 1U4RA 2MPMA 1I3QH 2JA9A 1NR4A 4QJFA 3TS2A 3K0XA 5FLMH 2N55A 2LMCB 1I4PA 4K2KA 4UP8A 4LF4L 3PV0A 3S2HH 5IY0A 4IUTA 4LFCL 1G6PA 2F0OA 1FGUA 1SN8A 2E2JH 1FD7D 2F03A 4A3IH 2A68D 3H0GG 4G7HC 5GAEC 3CC2A 2RA4A 4KHVA 4L6TB 1G8ZD 1VQCA 3MAQA 4CKBA 5J3BA 5KNBA 4LUZA 2HIXA 4YY3L 3G71A 2PQAB 5BN3A 2VUMH 4HMIA 3BVGA 3PO3G 3S1NB 2SNMA 5M5WH 4JI1L 3CU7A 1DGSA 4A3JG 1STYA 1KDCA 2N49A 1X56A 5IGEA 4DR1L 1U4LA 1DCZA 3RZOB 4B3SQ 1RD9D 1HNZQ 4RCOA 2B2UA 4L5SA 5JEAJ 1VQ9A 3CCRA 1HA6A 1LT6D 4ZQ3A 3KLSX 3TP6A 3BZDB 3L7ZC 4H13C 4OO1G 3LX0A 2B39A 1A2TA 2V4DA 4QF4A 1ET6A 4DAVA 1WYDA 4J1MA 3NBIA 3DLLA 2B8GA 3KBGA 4PZ8A 3RLNA 1XWEA 5C4XH 4A3DH 2L15A 3NTHA 2WFWA 2R7ZG 3KK7A 2XNAC 2F3IA 3ND8A 2GA4B 2NWGA 3AFQA 4DV3Q 4OX9Q 2IPKD 4U68A 2A68C 4EQPA 3NEMA 4BA2I 2B63H 3AEVA 4JI8Q 1JWMD 1K8MA 2MHVA 3CRKC 1CFMA 2AWOA 1H9RA 1VQJA 4GKJL 1J6QA 2R92G 1B50A 3M4QA 2EYFA 1TS3A 3V2TA 4LF6L 1IYJB 3UE0A 3TP7A 2Q8IB 1N36Q 4JI2L 3A5UA 4DV7Q 5C3WA 4HJ8A 1PYWD 2EOTA 3PO2H 3MHBA 3NPPA 1I94L 1JQYD 5IYCH 3HOXH 5EKIA 4A3MG 1IBKQ 1EU4A 2K04A 3IRBA 5FO9B 5AFWA 3R2IA 3DMUA 4DF7A 2OTJA 1H9MA 1H9SB 2KOLA 4DR2L 3K7UC 3OIQA 1V9PA 3SK8A 4G4KA 3ICEA 3D4WA 3S17B 1V1PB 1UEAB 2ZXRA 2H1EA 1DZ1A 4B08A 2F0KA 2JSOA 1EUJA 3QWNA 2L9HA 5IGCA 1AZQA 2XRSD 1EY8A 5M3MG 2E5LL 1XPOA 4HN7A 4WJ3M 3I72A 4RFBA 3ONAB 2NN6H 4R4OA 3Q24A 1LTID 3E0EA 3VR3A 3NXWA 4MIUA 2F4VL 1KQSA 1X55A 1AE2A 1J8IA 4NKLA 1B7YB 1SYBA 1IBML 4CDDC 1HUNA 1IYUA 2JEBI 1FVIA 1E1TA 1VQLA 4MZ9A 2TSSA 4BY1G 1YITA 2AUKA 3S14B 2UU9Q 3MA2B 3NBHB 3RUZA 3I4NH 3OPOA 2YTXA 1QCBD 3MXNA 4IFDG 1SRUA 1KRSA 1LT4D 3S2HB 1JOOA 3BDCA 3QOJA 2E2JB 1FJGQ 3T1YL 3G7LA 1LUZA 3DWQA 4A3IB 2ZTCA 1HFGA 3I4OA 3CCVA 2XIWA 3HOVB 3OWEB 4DAYA 2SOBA 2WAQB 1B9NA 1ASYA 1G2SA 5AJ3L 4DU9A 4JV5L 2VUMB 3MXUA 5M5WB 4PQXA 1Q81C 3MTSA 1N33L 1YNJD 3H3VC 1DOKA 3P75A 3A8IE 3TRZA 4K2LA 4DR5L 3OMCA 3F1ZA 5IYBG 1MI2A 4LFAL 1PH7A 3ER0A 1SE3A 1V1OA 1B53A 2OCEA 3A8JE 3MVVA 4KJNA 4P2CB 5KEEA 4Y7NB 2K14A 3PSIA 1YJ9A 1Y69U 2KCNA 5LMUL 1A62A 1BCPD 5M9OA 1GVPA 1PYBA 4M8AA 2UXBQ 1SMXA 2M2LA 1YHBA 1C8CA 3S24A 3GTGH 5C4XB 2RKSA 4A3DB 1B3QA 5CBEE 3HKSA 4AYBB 1AE3A 3GV6A 3K6OA 2F0GA 5FLXL 1JT8A 3A8KE 3EFXD 4OHJA 4FNFA 2O4XA 4DN4M 5JVH3 1JMCA 1Y1VH 4LFCQ 5D3DA 4RHRA 4KY7A 1E2WA 3IAYA 4UP7A 2B63B 1X9NA 4I7ZC 4UHVA 2OQKA 2UUBQ 2F0EA 1EY5A 3TZDA 1GUSA 1T9HA 1TWAB 1E7ZA 4JBWA 4YY3Q 5I9OA 1CZGA 4JOIA 3KDFB 1S40A 4JI3L 2BH8A 4JI1Q 4GN3B 4HEDA 1YNJC 4PZ7A 2VB2X 4NPSA 1YI2A 3J81c 3I4LA 5ELBA 4BS9A 4LAAA 5EPLA 1OTCA 5COYA 4A3IG 5FLXE 3HOXB 3TQYA 1ICFB 1HZAA 3I90A 4ZLTF 1QNKA 4YCWA 4C2MH 4RMFA 4A3LG 1K8OA 1PTOH 2PI2E 1TS2A 1CSPA 5KYIA 4KN7C 1BVSA 2HIVA 4CJ0B 5C3EH 4JI7L 1YJNA 3D4RA 4KMUC 4ULLA 4X66L 2VUMG 4QB4A 4GNXB 1BCPF 4JI4Q 1HTPA 4GN4B 4YCUA 2PCFB 1SMYD 4YWMA 4LF9Q 4IJHA 3MEHA 3V96A 2EY1A 3FVQA 1KDAA 3I73A 5EAYA 3I2ZA 1D1KA 4CGYB 2F0WA 4C3HG 3S2DH 2ZJRA 5IYDH 1TQOA 1A3UA 1QVCA 5T1IA 4C3IH 4DV0L 3E0JA 5FOBB 4GOPB 3FP9A 1AP0A 2WINB 2UUAL 4F87A 1CI3M 5A2QL 1XMOQ 1LTRD 4RH6A 2Z8LA 5IGBA 1L0XB 1VQIA 4A3FH 3M3YH 1KLGD 2MO0A 1F2LA 2WKCA 4DV4L 2EE1A 3BYTB 3OTOL 4GKJQ 3H6MA 2K5NA 4BY7B 4JVZA 3I4NB 2B2TC 2NZOA 3FHWA 1ZYRD 4DGZA 4X3UA 2E2DC 2KA7A 1SR3A 5DNFA 5JAVA 2F0DA 1DOMA 3R93A 1I94Q 1EY0A 2PW5A 3BJUA 1F77A 1GUNA 2KEEA 1QB5D 3T13A 3URYA 2N78A 1D1IA 4C3JH 5A2QE 1BBWA 3OW7A 4DPGA 1A8VA 3MXGA 4DR2Q 1QOHA 4JBMA 1TY0A 1B2TA 4IO9A 1EYDA 3KF6A 1SMYC 2IHEA 2F0HA 3PO2G 4R8NA 2KUMA 2E5LQ 5IYCG 2AUJD 3HOXG 4ALPA 4DV1L 2D0PA 4X6AH 3EQLC 3Q22A 4XQJA 5C4JH 4DK1A 2NVYH 4KN4C 2UXCL 1PH8A 4IPHA 4R4QA 5EBDA 2CW0D 3SK6A 1SBBB 1YJWA 1BQQT 1LTGD 1HQRD 1MJCA 4KD3A 2F4VQ 4LMQD 1O7LA 1SYEA 4K8JA 1IBMQ 1D5MC 4HSPA 4FF4A 4EGVA 2PQAA 1DM0B 1J9OA 3H09A 1F9PA 2Z0SA 3GTGB 3ITPA 4LF8Q 2MNAA 1L0WA 2WKDA 1ZYRC 2DJGC 3S15H 1VQBA 2NN6G 3CCMA 1AH9A 3D6WA 1XMQL 1Y1VB 4DV3L 1IBLL 3T1YQ 4OX9L 1JORA 4RGTA 2F0QA 2K05A 1MGSA 3E6ZX 3SGIA 1WJJA 4JI8L 5M3FH 3S1MH 2J4XA 2K03A 3IL8A 2HT1A 4X65Q 1VQAA 5AJ3Q 4N8X1 2BDOA 1A3VA 4N9PA 5I6WA 1LTAD 3RN5A 3I4NG 5FJ8H 3TEHB 4I65A 1JWUD 4LNQA 3S1NH 2J0TD 5E1FA 1N33Q 5C4HA 4R4TA 3AU7A 1ESFA 3G4SA 2DUDA 2VXWA 5IIFA 4V0BA 2MUYA 2JA6H 1ILPA 1KNEA 1Y1WG 1YNXA 4LFAQ 1Q82C 3SDZA 2K50A 4BBSH 1X3FA 4RKBA 4C2MB 5J22A 5K5PA 2CW0C 1X3EA 3DHQA 1PTOB 4H7BA 2ZJQA 2FHTA 2ASBA 3MC0B 1H9JA 5LMUQ 1KABA 4ME3A 4F7XA 1FNUA 4DAPA 4DAMA 3CXCA 1GUWA 2JN4A 4KTAA 4RCNA 5KNDA 5FKAC 4J8QA 2ZTDA 1HR0W 4JG2A 4ODGA 3B6YA 3PIPA 1K3RA 3S2DB 4DA2A 3RLOA 3W5OA 2VQEL 2KCCA 1EY4A 3HZXA 4L8JA 5C3XA 3S1RB 2EYOA 5I2XA 4WRDA 1PH3A 1H9SA 4DXFA 2NN6I 2E8GA 3U58A 4A3GH 1O7YA 4CKEA 1Y8PB 5GAGC 4A3FB 3M3YB 1LACA 2Q2UA 4NW2A 5CYUA 1PH5A 4XT1B 3J7ZC 1T5EA 1V1PA 2F0NA 1I4GA 1EEFD 1Q1BA 2L55A 2RDHA 2EY2A 4XDXA 4JI3Q 3P7JA 3JAMi 4WFN3 4CDFC 1IXRA 1DXMA 1Y1VG 2L5TA 4XYOA 1QZHA 2QCPX 2C9OA 1STNA 3H91A 3MXPA 1STAA 3CQZH 3F8TA 1AW7A 3IFDA 4A3BH 4NB3A 2OF1A 4C3JB 2L11A 3AB9A 4JI7Q 2FXQA 2NUCA 4ZUIA 2FJ2A 4HR7B 2RHQB 3UDGA 3RR5A 2A5HA 2KHJA 3NBHA 4FXDA 3OIPA 1KRTA 1RL2A 2F0MA 2JQOA 2D9UA 1Q3LA 1O7ZA 1HZCA 3CC7A 4QMGA 2N3SA 2NVYB 3T51B 1S72A 4DV0Q 3E9IA 3J7AF 2VW9A 4RKLA 2UUAQ 2B2VC 5C3EG 3J7A5 2WB1E 2YV5A 3T53B 1UE5A 4IJLA 3K59A 4RA8A 2MO1A 4XQQA 3CCEA 4IUQA 3CCSA 4DV4Q 1PFBA 2FFKB 2K5DA 3OTOQ 1F9RA 4HJ7A 3TBIB 2Z4HA 5CV8A 1DJRD 3TN2A 3QR8A 3S14H 2OXPA 3CMEA 3S15B 2A69C 5IYDG 3J81j 4K0KQ 2MFIA 1N9WA 2B2UC 4C3IG 3JC66 1EOVA 2XSCA 4FYDA 2A73B 1SFOH 2HDLA 4B3RL 2F0TA 3EROA 1UUPA 3P20A 4K14A 1ZXTA 1GUOA 5J1ZA 4A3FG 1F9SA 3C46A 2UUBL 5M3FB 3S1MB 1PHJA 3HOVH 3EJIA 1PFSA 2B2VA 2NTSA 4RG1A 5KGUA 3TZUA 1KHIA 1A2UA 3BZCA 1WOCA 1CQVA 1TIID 3AQQA 3D8GA 3SR1A 1CA5A 1DYQA 1TY2A 2MJ8A 4IOCA 2D0OA 1VQ7A 1HNXL 2JA6B 2ID0A 2MQHA 4DV1Q 3GTQH 4IPGA 4BBSB 2WB1B 1L0YB 2R7DA 1XNQL 1Y8NB 4A3CH 4A3EG 5BR8Q 2UXCQ 3K58A 1RDPD 4JI5L 3EA6A 3IKJA 3KLSA 4X3TA 4C3JG 4Y7NH 1O7IA 2QDBA 4GNXC 3VYTA 3CPWA 3IFTA 1Q8KA 4DNIA 2ZTEA 1X65A 3C1FA 1II3A 1STBA 5I4DA 4JI4L 3KDFA 4BA1I 2A6ED 4LF9L 2F0PA 5ELEA 1B70B 1EZ6A 4G7ZC 1BOSA 1F2ZA 1SYDA 3EVQA 2QGQA 2A74C 5IODA 2Q2HA 1XMQQ 1MKHA 3GD7A 3WWVA 5LL6X 4HJAA 1EQRA 2EY5A 1IBLQ 1U5KA 3DWAA 4K5XA 4EQNA 2PZUA 1VCIA 1XMOL 3GTKH 5ELFA 4A3GB 4BXXG 1YNND 4ZK9B 1I4RA 2SDFA 5LMNL 5ELNA 4GNXA 3M85A 2BA0A 4DK0A 1UE6A 2BOSA 1TWAH 2ZM6L 3W1BA 1LM0A 3HKZE 4APVA 5CR3A 4R4IA 5I6YA 3U9OA 1L1OB 3H15A 1VQ4A 1PXUA 4YCVA 3BG3A 1BR9A 5CBAE 4GOPA 2PO4A 1FYCA 3PF4A 3KOJA 2EY6A 3CQZB 1G51A 2CH4A 2RVLA 4A3BB 1VQMA 1XNRL 3QIAA 1HPCA 2XTIA 4MNOA 4DR6L 2VY3A 3U4ZA 3W3AA 2EXDA 3E5SA 4K5VA 4XIGS 5FJ8G 4RGMA 2FINB 2D2CC 4XT3B 2B8FA 2Z6KA 2A6EC 2WAQE 3L3OC 4RAUC 4QUCA 1LTSD 2ZXOA 3H94A 2JJQA 1F2YA 2B2YA 1EYCA 3K5NA 3S1QH 3X3MA 3I70A 1PTOD 2WB1G 1QVGA 4GKKL 2PI2A 1LT3D 2VQEQ 3DEPA 1BKBA 3P1HA 3JAML 4ID6A 1PRTD 3KF8B 4CKCA 5C44H 4IPDA 2NTTA 1H9KA 3CC4A 1IL8A 2IHFA 1PH6A 1E24A 3NE5B 1YNNC 4ZAIA 3CCUA 2EJGC 2HHHL 3HKZB 2L12A 2JXMB 1D2BA 5DAUA 1UE1A 1Q46A 4CJ1B 1CKMA 2H4OA 2VZAA 2XN9C 5ELOA 1V1QA 4DV5L 4LF8L 4Y52H 5JEAH 1ENCA 4BY7H 1VF7A 3F2DA 2DJFC 1SFOB 3I8ZA 1PDQA 1WCMH 4AYBE 3D4DA 1NSNS 4PMCA 3JAME 3NHHA 4KLKA 2PNRC 2R6GA 4DR3L 3DUZA 1NJIC 2F3VA 2EYPA 2V1CC 3WOFA 2AHOB 2CWAA 4TVAB 1VQHA 4X65L 1KAAA 3Q6SA 2G9HD 4FXKC 5EGTA 3STBD 1QILA 1SEBD 3CCJA 1VS0A 3CP0A 5FLXc 2WIIB
chains in the Genus database with same CATH topology
4LF5Q 3PCOB 2KHIA 1J5EL 4C3HH 4A3KH 1SR3A 3ZJYC 3OYYA 2A1AA 1BBUA 1NY4A 4GOPC 2OQ0A 5DLQE 1XPUA 2WP8J 1LTLA 2LSSA 3CPFA 1I94Q 1VQOA 3GTOH 3BJUA 3LGJA 4A3BG 2KCTA 2BH2A 3HOZG 3UDFA 3H3VI 5IP7G 2N78A 4C3JH 1YHQA 1BBWA 4DPGA 1A8VA 1QZGA 4DR2Q 4OWWB 1CKOA 4P71A 1PH2A 4B3TL 4JBMA 4JOIC 1VQKA 3KFUA 4PMWA 2Z6KC 4IO9A 1M90C 2UU9L 2GN5A 3KF6A 5IP9G 1K0RA 2IHEA 4YHHL 5C0XJ 4GS3A 2N8NA 2AMCB 3HOUG 2NZHA 3G6EA 3PO2G 1Y14B 4EX5A 4P72A 1YIJA 2E5LQ 3CF5A 5IYCG 3HOXG 4R4CA 1NE3A 4ALPA 4DV1L 1PV4A 1JB7A 2JA5G 2D0PA 1FJGL 4DR4Q 4X6AH 4BBRG 5C4JH 3JAMc 2Q2IA 3M7NA 2NVYH 4JC0A 2UXCL 1PH8A 4IPHA 4R4QA 1VQ6A 3EN2A 1QUQA 3D31A 4X62Q 5M5XH 1OXVA 5HY6A 3PUWA 4B3RQ 3HOZH 1CKNA 1TWCH 5IP7H 4QGUA 1YJWA 3TREA 3EIVA 5FLXc 1OXUA 1MJCA 2LXJA 2F4VQ 5M3FG 3HKZG 2VQFL 2IY5B 4X66Q 1IBMQ 4OWTB 4DUYQ 1K73C 2PQAA 4DV6L 2YYZA 3F2BA 2Z0SA 3I55A 3S17H 2UXDL 1U0LA 3J81i 4POGA 4LF8Q 2MNAA 4UP9A 5FLMG 1PH9A 2IX0A 1L0WA 3STBC 3I7FA 4X64L 4B3ML 3HOUH 1E1OA 2OTLA 3T1HL 1N32Q 4AIMA 2ZJPA 3S15H 1VQBA 2NN6G 4R1JA 1C0AA 3CCMA 1AH9A 1XMQL 3GO5A 2JA6G 3KJPA 2DGYA 2I0QA 3HOWH 1HNXQ 4BBSG 3M4PA 3K81C 2EIFA 4GLAC 1TWHH 4DV3L 3U50C 3T1YQ 1IBLL 1EFWA 4OX9L 1Q12A 3M9BA 1XNQQ 1Q86C 2E2HH 4LFBL 4NXML 3D0FA 3UDIA 1NMFA 4JI5Q 3HOVG 3SGIA 1WJJA 3J80c 4JI8L 2WAQG 2UXBL 1A0IA 5HGQA 5GROA 3L2PA 5M3FH 4AQYQ 3S1MH 2R93G 1P16A 2GVAA 2CFMA 2ATWA 2AKWB 3TS0A 2UUCQ 2HT1A 4X65Q 1VQAA 5AJ3Q 3S16H 4HJ9A 3RN5A 1K83H 4JYAL 3I4NG 4OO1I 3KF6B 5FJ8H 5IWAQ 2PMZE 1I3QH 2JA9A 4MTNA 1IZ6A 1UWVA 4QJFA 3K0XA 3TEHB 5FLMH 3RLFA 4LNQA 3CD6A 3S1NH 3L0OA 3TS2A 3PUYA 4IOAA 4L5QA 1N33Q 4R4TA 4UP8A 3G4SA 2DUDA 1GD7A 4LF4L 3PV0A 3S2HH 4JI6L 3H3VH 5IY0A 2JA6H 1G6PA 4LFCL 4YWKA 1FGUA 1SN8A 1Y1WG 1YNXA 4LFAQ 1Q82C 1N34Q 2K50A 2E2JH 4BBSH 4POFA 4A3IH 2B3GA 1X3FA 4QQBX 3H0GG 4LF7L 4JI0L 1YZ6A 1QUQB 1PYSB 5GAEC 1XJVA 3CC2A 3S1RH 1X3EA 2ZJQA 1CKNB 4LUOA 1VQCA 4A3GG 4DUZL 1KIXA 2ALYB 2A8VA 2ASBA 3DM3A 5LMUQ 4KI0A 5J3BA 2JEAI 2AWNA 4ME3A 4LUZA 2HIXA 2K5HA 4YY3L 3GTJH 3OW2A 1SROA 3G71A 5LMNQ 4DAMA 4A4IA 3UE1A 2PQAB 3CXCA 4A93H 1K8AC 2VUMH 4XTCS 3PO3G 1HNWL 1LYLA 5M5WH 5C4XG 4JI1L 4A3DG 4HIKA 2ZM6Q 1DGSA 4A3JG 1CSQA 2N49A 1X56A 4AYBG 2ZTDA 4HIDA 3GTMH 1EWIA 1HR0W 4DR1L 4JG2A 3B6YA 3PIPA 1K3RA 4K0KL 4B3SQ 3RLOA 3W5OA 1HNZQ 4AH6A 2VQEL 1Y1WH 2K52A 4L5SA 5JEAJ 1VQ9A 2Q2TA 3CCRA 3H0GH 4OONA 1EQQA 1PH3A 2KCMA 1OXXK 2R7FA 4OXPA 5LMNW 2B63G 3HOYH 1QVFA 2NN6I 2E8GA 3L7ZC 4OO1G 3U58A 2IT1A 4A3GH 2QEXA 1XNRQ 2HQLA 5GAGC 1X3GA 4HJ5A 2Q2UA 2C35B 3VDYA 1WYDA 2K5VA 3A5ZB 1PH5A 3W1GA 1TWFH 4DV6Q 4DR6Q 3J7ZC 4DR7L 3I4MH 4L5RC 3DLLA 4PZ8A 3RLNA 1Q1BA 5C4XH 3RNUA 4JBJA 4A3DH 5JJLA 2L15A 3CW2C 4A3JH 4X64Q 4B3MQ 4WJ4A 4JI3Q 2WFWA 2R7ZG 4KHPL 3JAMi 2JA7H 3T1HQ 3FKIH 5JJKA 1KD1C 1IXRA 2RCNA 2F3IA 1Y1VG 1E22A 1VQGA 1QZHA 4P75A 3AFQA 1OXSC 2ES2A 4DV3Q 1CUKA 3PGZA 5GADC 4OX9Q 4GKKQ 4KHZA 3ULJA 3CQZH 5BR8L 2I5HA 4NXMQ 3NEMA 4BA2I 3F8TA 2B63H 4A3BH 4NB3A 2K75A 3AEVA 4JI8Q 4EQ5A 2NVQH 1XPRA 2D62A 1PH4A 1FL0A 2AWOA 4JI7Q 2FXQA 1VQJA 4GKJL 1J6QA 2R92G 3M4QA 3GTPH 2HHHQ 4LF6L 2RHQB 3UDGA 3RR5A 5GAHC 1IYJB 1VQ8A 2KHJA 3UE0A 1NMGA 3A0JA 4GLVB 3KJOA 5IP9H 1KRTA 1N36Q 4JI2L 3A5UA 4DV5Q 1E3PA 4DV7Q 4HJ8A 4LF5L 1RL2A 2JQOA 4LF4Q 2JA8G 1HZCA 4JI6Q 3PO2H 3CC7A 1I94L 3NELA 1W3SA 2CQOA 5IYCH 3UDXA 3CAMA 3HOXH 2N3SA 2JA5H 4A3MG 1S72A 2PNHA 1IBKQ 3IRBA 3J80i 4IFDI 4BBRH 4DV0Q 3E9IA 3GDEA 2VW9A 2YTVA 2UUAQ 2OTJA 5C3EG 3J7A5 2B29A 2WB1E 2YV5A 4UY8C 4DR2L 4DV2Q 1VQPA 1ASZA 1UE5A 4IJLA 4DR3Q 2MO1A 3ERSX 3K7UC 5E7NA 1V9PA 2R92H 4DK3C 3CCEA 3CCSA 1HJPA 4DV4Q 4NXNQ 4HIMA 4DK6C 3OTOQ 3ICEA 4HJ7A 3K8AA 1WI5A 1EUJA 1V43A 4BY7G 1L2FA 1SLJA 5M3MG 2E5LL 3S14H 4DR1Q 1XPOA 3CMEA 4J15A 4DR4L 4WJ3M 3A74A 5IYDG 3J81j 4K0KQ 2MFIA 4A75A 1N9WA 1WCMG 3JC66 1EOVA 1J5EQ 1VQ5A 4R4OA 2A19A 2E2IH 1SFOH 4A3MH 2VL6A 4B3RL 4A3CG 1EIFA 1I5FA 1VQEA 2CWPA 3E0EA 3CCQA 2F4VL 4A3FG 1KQSA 1X55A 1AE2A 3BZKA 4QY7A 3M4OH 1B7YB 5C0XG 1IBML 2CCZA 1PHJA 2UUBL 3HOVH 4DUYL 1VQLA 2JEBI 1FVIA 1E1TA 1P8LA 1PFSA 4LUVA 3I56A 4MZ9A 4RG1A 1WFQA 1N8RC 3KLWA 4B3TQ 4DR7Q 1KHIA 2R93H 1YBYA 2Y0SE 1WOCA 3BZCA 1UEBA 1Z47A 4QIWE 4BY1G 1YITA 1KC8C 3EBEA 2UU9Q 3AQQA 4LWCA 3NBHB 3F2CA 3I4NH 3KYHC 2YTXA 1N32L 4A3KG 5M3MH 4YHHQ 4UPAA 1L1OA 4IFDG 2KBNA 3Q8DA 1SRUA 1KRSA 4IOCA 2D0OA 5JJIA 2XGTA 1VQ7A 3ULLA 2I5LX 4YWLA 1HNXL 1GO3E 2ID0A 2MQHA 4DV1Q 3GTQH 4IPGA 3T1YL 1FJGQ 4O2DA 1LUZA 1TXYA 2R7DA 2ZTCA 1XNQL 1X54A 4A3CH 4A3EG 3I4OA 5BR8Q 2UXCQ 4JI5L 3CCVA 4GNXC 4Y7NH 1O7IA 5M5YH 4TQUS 3CPWA 1KAWA 1Q8KA 1GM5A 4DNIA 1K8GA 3MEFA 2ZTEA 1X65A 2F52A 1ASYA 1NBWA 2JE6I 5AJ3L 2VQFQ 1PA6A 4JV5L 1D7QA 1VQFA 4LF6Q 5IWAL 4JI4L 4BY1H 1VQDA 3KDFA 4BA1I 1Q81C 2UXDQ 2VNUD 4JCVE 4LF9L 1IL2A 1N33L 1MIUA 4QL5A 3PO3H 4JI2Q 1XTDA 2CKZB 4LW1A 1B70B 1B8AA 1UE7A 3TRZA 3E9HA 3PF5A 4DR5L 1TWGH 3F1ZA 4HIOA 1C9OA 1S3OA 2I5MX 5IYBG 3PIOA 1N34L 4LFAL 1PH7A 2QGQA 1HR0L 4IPCA 1I50H 3ER0A 2Q2HA 1XMQQ 1JJ2A 1MKHA 2OCEA 3GD7A 3WWVA 4HJAA 1EQRA 2K14A 1IBLQ 4A3EH 1U5KA 1M1KC 3PSIA 1YJ9A 1VCIA 1XMOL 3GTKH 5LMUL 4LFBQ 1A62A 2YTYA 2OWOA 3RZDH 4BXXG 1GVPA 1PYBA 5LMNL 5ELNA 4GNXA 2UXBQ 1SMXA 1A63A 3M85A 1YHBA 3AFPA 2BA0A 1YEZA 5IT9c 1GKHA 1UE6A 2ZM6L 1TWAH 3S24A 3W1BA 3GTGH 4P73A 4JYAQ 5GQOA 3K80C 1JJCB 1LM0A 3HKSA 3HKZE 1AE3A 5C0XI 4APVA 2RHSB 2BA1A 4R4IA 3MXNB 2JK8A 1L1OB 4B3SL 3H15A 1HNZL 1JT8A 1VQ4A 2R7ZH 1K9MC 3HOWG 2IX1A 5IYBH 2RF4A 4YCVA 3HFZB 4GOPA 1Y1VH 1JMCA 4LFCQ 4IFDJ 3PF4A 3KOJA 5C44G 1JE5A 1G51A 3ULPA 4UP7A 4LF7Q 1X9NA 4JI0Q 1X6OA 2OQKA 1VQMA 1XNRL 2UUBQ 4DAYB 4BXXH 1VQNA 4DUZQ 1H95A 2XTIA 4MNOA 4DR6L 5IE8A 1T9HA 1EIYB 2VY3A 3U4ZA 1E7ZA 4JBWA 1KL9A 2EXDA 4XIGS 4YY3Q 5FJ8G 2QA4A 4JOIA 3KDFB 1S40A 3PUVA 1C7YA 2Z6KA 4JI3L 4JBKA 1HNWQ 3G48A 1L1OC 1HZ9A 2BH8A 2WAQE 4JI1Q 5JEAG 4FDBA 2LXKA 4GN3B 3CCLA 4PZ7A 2JJQA 1Q7YC 4H02A 3NENA 4NPSA 1YI2A 3J81c 1RIPA 4PZ6A 3S1QH 1OTCA 2WB1G 4A3IG 1QVGA 2JA8H 4GKKL 2PI2A 3TQYA 2VQEQ 1NTGA 1HZAA 1BKBA 3KF8B 2H5XA 2GVBA 1SE8A 4X62L 5C44H 4IPDA 4YCWA 1PH1A 4C2MH 4RMFA 3CC4A 1YHAA 3AYHB 2PI2E 4A3LG 1CSPA 2IHFA 1R9TH 1BVSA 2HIVA 5C3EH 1E24A 1PH6A 4JI7L 2VS1A 1EYGA 4A93G 1YJNA 3CCUA 4X66L 1MJEA 2VUMG 2HHHL 4JV5Q 4GNXB 1Z9FA 3PUXA 4OWXB 4JI4Q 1UE1A 1Q46A 4GN4B 4YCUA 1CKMA 4YWMA 3CMAA 2KENA 3K7AH 2VZAA 4LF9Q 4IJHA 1N36L 1D8LA 1V1QA 5ELOA 4DV5L 4DV7L 4LF8L 4Y52H 5EAYA 3I2ZA 4BY7H 2YU9H 4DR5Q 2K4KA 4KHPQ 1G291 1OXTA 2EQSA 3PUZA 4PG3A 3U4VA 3S2DH 3RZOH 2ZJRA 1YVCA 3F2DA 5K36G 1HR0Q 1IBKL 5H1SE 5IYDH 1I6HH 1QVCA 4P74A 4C3IH 4DV0L 1HH2P 1W2BA 1WCMH 1KXLA 4AYBE 4GOPB 3RN2A 3HOYG 3FP9A 1JJGA 2UUAL 4L5TA 1XMOQ 2Y0SG 4DV2L 2NVXH 4GN5A 3BU2A 4A3LH 4KLKA 2R6GA 4DR3L 1Q1EA 1NJIC 1VQIA 4A3FH 2V1CC 2NVTH 2MO0A 4AQYL 3I4MG 3M3YH 2AHOB 4NXNL 4DV4L 4DKAC 3OTOL 3GTLH 2UUCL 2CWAA 4O0AA 4GKJQ 4TVAB 1VQHA 4X65L 1PVOA 4A76A 2JA7G 2K5NA 1HZBA 3STBD 3FKIG 2NZOA 4GLXA 3CCJA 1VS0A 3CP0A 3FHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 Q;  3PCO B;  2KHI A;  1J5E L;  4C3H H;  4A3K H;  1SR3 A;  3ZJY C;  3OYY A;  2A1A A;  1BBU A;  1NY4 A;  4GOP C;  2OQ0 A;  5DLQ E;  1XPU A;  2WP8 J;  1LTL A;  2LSS A;  3CPF A;  1I94 Q;  1VQO A;  3GTO H;  3BJU A;  3LGJ A;  4A3B G;  2KCT A;  2BH2 A;  3HOZ G;  3UDF A;  3H3V I;  5IP7 G;  2N78 A;  4C3J H;  1YHQ A;  1BBW A;  4DPG A;  1A8V A;  1QZG A;  4DR2 Q;  4OWW B;  1CKO A;  4P71 A;  1PH2 A;  4B3T L;  4JBM A;  4JOI C;  1VQK A;  3KFU A;  4PMW A;  2Z6K C;  4IO9 A;  1M90 C;  2UU9 L;  2GN5 A;  3KF6 A;  5IP9 G;  1K0R A;  2IHE A;  4YHH L;  5C0X J;  4GS3 A;  2N8N A;  2AMC B;  3HOU G;  2NZH A;  3G6E A;  3PO2 G;  1Y14 B;  4EX5 A;  4P72 A;  1YIJ A;  2E5L Q;  3CF5 A;  5IYC G;  3HOX G;  4R4C A;  1NE3 A;  4ALP A;  4DV1 L;  1PV4 A;  1JB7 A;  2JA5 G;  2D0P A;  1FJG L;  4DR4 Q;  4X6A H;  4BBR G;  5C4J H;  3JAM c;  2Q2I A;  3M7N A;  2NVY H;  4JC0 A;  2UXC L;  1PH8 A;  4IPH A;  4R4Q A;  1VQ6 A;  3EN2 A;  1QUQ A;  3D31 A;  4X62 Q;  5M5X H;  1OXV A;  5HY6 A;  3PUW A;  4B3R Q;  3HOZ H;  1CKN A;  1TWC H;  5IP7 H;  4QGU A;  1YJW A;  3TRE A;  3EIV A;  5FLX c;  1OXU A;  1MJC A;  2LXJ A;  2F4V Q;  5M3F G;  3HKZ G;  2VQF L;  2IY5 B;  4X66 Q;  1IBM Q;  4OWT B;  4DUY Q;  1K73 C;  2PQA A;  4DV6 L;  2YYZ A;  3F2B A;  2Z0S A;  3I55 A;  3S17 H;  2UXD L;  1U0L A;  3J81 i;  4POG A;  4LF8 Q;  2MNA A;  4UP9 A;  5FLM G;  1PH9 A;  2IX0 A;  1L0W A;  3STB C;  3I7F A;  4X64 L;  4B3M L;  3HOU H;  1E1O A;  2OTL A;  3T1H L;  1N32 Q;  4AIM A;  2ZJP A;  3S15 H;  1VQB A;  2NN6 G;  4R1J A;  1C0A A;  3CCM A;  1AH9 A;  1XMQ L;  3GO5 A;  2JA6 G;  3KJP A;  2DGY A;  2I0Q A;  3HOW H;  1HNX Q;  4BBS G;  3M4P A;  3K81 C;  2EIF A;  4GLA C;  1TWH H;  4DV3 L;  3U50 C;  3T1Y Q;  1IBL L;  1EFW A;  4OX9 L;  1Q12 A;  3M9B A;  1XNQ Q;  1Q86 C;  2E2H H;  4LFB L;  4NXM L;  3D0F A;  3UDI A;  1NMF A;  4JI5 Q;  3HOV G;  3SGI A;  1WJJ A;  3J80 c;  4JI8 L;  2WAQ G;  2UXB L;  1A0I A;  5HGQ A;  5GRO A;  3L2P A;  5M3F H;  4AQY Q;  3S1M H;  2R93 G;  1P16 A;  2GVA A;  2CFM A;  2ATW A;  2AKW B;  3TS0 A;  2UUC Q;  2HT1 A;  4X65 Q;  1VQA A;  5AJ3 Q;  3S16 H;  4HJ9 A;  3RN5 A;  1K83 H;  4JYA L;  3I4N G;  4OO1 I;  3KF6 B;  5FJ8 H;  5IWA Q;  2PMZ E;  1I3Q H;  2JA9 A;  4MTN A;  1IZ6 A;  1UWV A;  4QJF A;  3K0X A;  3TEH B;  5FLM H;  3RLF A;  4LNQ A;  3CD6 A;  3S1N H;  3L0O A;  3TS2 A;  3PUY A;  4IOA A;  4L5Q A;  1N33 Q;  4R4T A;  4UP8 A;  3G4S A;  2DUD A;  1GD7 A;  4LF4 L;  3PV0 A;  3S2H H;  4JI6 L;  3H3V H;  5IY0 A;  2JA6 H;  1G6P A;  4LFC L;  4YWK A;  1FGU A;  1SN8 A;  1Y1W G;  1YNX A;  4LFA Q;  1Q82 C;  1N34 Q;  2K50 A;  2E2J H;  4BBS H;  4POF A;  4A3I H;  2B3G A;  1X3F A;  4QQB X;  3H0G G;  4LF7 L;  4JI0 L;  1YZ6 A;  1QUQ B;  1PYS B;  5GAE C;  1XJV A;  3CC2 A;  3S1R H;  1X3E A;  2ZJQ A;  1CKN B;  4LUO A;  1VQC A;  4A3G G;  4DUZ L;  1KIX A;  2ALY B;  2A8V A;  2ASB A;  3DM3 A;  5LMU Q;  4KI0 A;  5J3B A;  2JEA I;  2AWN A;  4ME3 A;  4LUZ A;  2HIX A;  2K5H A;  4YY3 L;  3GTJ H;  3OW2 A;  1SRO A;  3G71 A;  5LMN Q;  4DAM A;  4A4I A;  3UE1 A;  2PQA B;  3CXC A;  4A93 H;  1K8A C;  2VUM H;  4XTC S;  3PO3 G;  1HNW L;  1LYL A;  5M5W H;  5C4X G;  4JI1 L;  4A3D G;  4HIK A;  2ZM6 Q;  1DGS A;  4A3J G;  1CSQ A;  2N49 A;  1X56 A;  4AYB G;  2ZTD A;  4HID A;  3GTM H;  1EWI A;  1HR0 W;  4DR1 L;  4JG2 A;  3B6Y A;  3PIP A;  1K3R A;  4K0K L;  4B3S Q;  3RLO A;  3W5O A;  1HNZ Q;  4AH6 A;  2VQE L;  1Y1W H;  2K52 A;  4L5S A;  5JEA J;  1VQ9 A;  2Q2T A;  3CCR A;  3H0G H;  4OON A;  1EQQ A;  1PH3 A;  2KCM A;  1OXX K;  2R7F A;  4OXP A;  5LMN W;  2B63 G;  3HOY H;  1QVF A;  2NN6 I;  2E8G A;  3L7Z C;  4OO1 G;  3U58 A;  2IT1 A;  4A3G H;  2QEX A;  1XNR Q;  2HQL A;  5GAG C;  1X3G A;  4HJ5 A;  2Q2U A;  2C35 B;  3VDY A;  1WYD A;  2K5V A;  3A5Z B;  1PH5 A;  3W1G A;  1TWF H;  4DV6 Q;  4DR6 Q;  3J7Z C;  4DR7 L;  3I4M H;  4L5R C;  3DLL A;  4PZ8 A;  3RLN A;  1Q1B A;  5C4X H;  3RNU A;  4JBJ A;  4A3D H;  5JJL A;  2L15 A;  3CW2 C;  4A3J H;  4X64 Q;  4B3M Q;  4WJ4 A;  4JI3 Q;  2WFW A;  2R7Z G;  4KHP L;  3JAM i;  2JA7 H;  3T1H Q;  3FKI H;  5JJK A;  1KD1 C;  1IXR A;  2RCN A;  2F3I A;  1Y1V G;  1E22 A;  1VQG A;  1QZH A;  4P75 A;  3AFQ A;  1OXS C;  2ES2 A;  4DV3 Q;  1CUK A;  3PGZ A;  5GAD C;  4OX9 Q;  4GKK Q;  4KHZ A;  3ULJ A;  3CQZ H;  5BR8 L;  2I5H A;  4NXM Q;  3NEM A;  4BA2 I;  3F8T A;  2B63 H;  4A3B H;  4NB3 A;  2K75 A;  3AEV A;  4JI8 Q;  4EQ5 A;  2NVQ H;  1XPR A;  2D62 A;  1PH4 A;  1FL0 A;  2AWO A;  4JI7 Q;  2FXQ A;  1VQJ A;  4GKJ L;  1J6Q A;  2R92 G;  3M4Q A;  3GTP H;  2HHH Q;  4LF6 L;  2RHQ B;  3UDG A;  3RR5 A;  5GAH C;  1IYJ B;  1VQ8 A;  2KHJ A;  3UE0 A;  1NMG A;  3A0J A;  4GLV B;  3KJO A;  5IP9 H;  1KRT A;  1N36 Q;  4JI2 L;  3A5U A;  4DV5 Q;  1E3P A;  4DV7 Q;  4HJ8 A;  4LF5 L;  1RL2 A;  2JQO A;  4LF4 Q;  2JA8 G;  1HZC A;  4JI6 Q;  3PO2 H;  3CC7 A;  1I94 L;  3NEL A;  1W3S A;  2CQO A;  5IYC H;  3UDX A;  3CAM A;  3HOX H;  2N3S A;  2JA5 H;  4A3M G;  1S72 A;  2PNH A;  1IBK Q;  3IRB A;  3J80 i;  4IFD I;  4BBR H;  4DV0 Q;  3E9I A;  3GDE A;  2VW9 A;  2YTV A;  2UUA Q;  2OTJ A;  5C3E G;  3J7A 5;  2B29 A;  2WB1 E;  2YV5 A;  4UY8 C;  4DR2 L;  4DV2 Q;  1VQP A;  1ASZ A;  1UE5 A;  4IJL A;  4DR3 Q;  2MO1 A;  3ERS X;  3K7U C;  5E7N A;  1V9P A;  2R92 H;  4DK3 C;  3CCE A;  3CCS A;  1HJP A;  4DV4 Q;  4NXN Q;  4HIM A;  4DK6 C;  3OTO Q;  3ICE A;  4HJ7 A;  3K8A A;  1WI5 A;  1EUJ A;  1V43 A;  4BY7 G;  1L2F A;  1SLJ A;  5M3M G;  2E5L L;  3S14 H;  4DR1 Q;  1XPO A;  3CME A;  4J15 A;  4DR4 L;  4WJ3 M;  3A74 A;  5IYD G;  3J81 j;  4K0K Q;  2MFI A;  4A75 A;  1N9W A;  1WCM G;  3JC6 6;  1EOV A;  1J5E Q;  1VQ5 A;  4R4O A;  2A19 A;  2E2I H;  1SFO H;  4A3M H;  2VL6 A;  4B3R L;  4A3C G;  1EIF A;  1I5F A;  1VQE A;  2CWP A;  3E0E A;  3CCQ A;  2F4V L;  4A3F G;  1KQS A;  1X55 A;  1AE2 A;  3BZK A;  4QY7 A;  3M4O H;  1B7Y B;  5C0X G;  1IBM L;  2CCZ A;  1PHJ A;  2UUB L;  3HOV H;  4DUY L;  1VQL A;  2JEB I;  1FVI A;  1E1T A;  1P8L A;  1PFS A;  4LUV A;  3I56 A;  4MZ9 A;  4RG1 A;  1WFQ A;  1N8R C;  3KLW A;  4B3T Q;  4DR7 Q;  1KHI A;  2R93 H;  1YBY A;  2Y0S E;  1WOC A;  3BZC A;  1UEB A;  1Z47 A;  4QIW E;  4BY1 G;  1YIT A;  1KC8 C;  3EBE A;  2UU9 Q;  3AQQ A;  4LWC A;  3NBH B;  3F2C A;  3I4N H;  3KYH C;  2YTX A;  1N32 L;  4A3K G;  5M3M H;  4YHH Q;  4UPA A;  1L1O A;  4IFD G;  2KBN A;  3Q8D A;  1SRU A;  1KRS A;  4IOC A;  2D0O A;  5JJI A;  2XGT A;  1VQ7 A;  3ULL A;  2I5L X;  4YWL A;  1HNX L;  1GO3 E;  2ID0 A;  2MQH A;  4DV1 Q;  3GTQ H;  4IPG A;  3T1Y L;  1FJG Q;  4O2D A;  1LUZ A;  1TXY A;  2R7D A;  2ZTC A;  1XNQ L;  1X54 A;  4A3C H;  4A3E G;  3I4O A;  5BR8 Q;  2UXC Q;  4JI5 L;  3CCV A;  4GNX C;  4Y7N H;  1O7I A;  5M5Y H;  4TQU S;  3CPW A;  1KAW A;  1Q8K A;  1GM5 A;  4DNI A;  1K8G A;  3MEF A;  2ZTE A;  1X65 A;  2F52 A;  1ASY A;  1NBW A;  2JE6 I;  5AJ3 L;  2VQF Q;  1PA6 A;  4JV5 L;  1D7Q A;  1VQF A;  4LF6 Q;  5IWA L;  4JI4 L;  4BY1 H;  1VQD A;  3KDF A;  4BA1 I;  1Q81 C;  2UXD Q;  2VNU D;  4JCV E;  4LF9 L;  1IL2 A;  1N33 L;  1MIU A;  4QL5 A;  3PO3 H;  4JI2 Q;  1XTD A;  2CKZ B;  4LW1 A;  1B70 B;  1B8A A;  1UE7 A;  3TRZ A;  3E9H A;  3PF5 A;  4DR5 L;  1TWG H;  3F1Z A;  4HIO A;  1C9O A;  1S3O A;  2I5M X;  5IYB G;  3PIO A;  1N34 L;  4LFA L;  1PH7 A;  2QGQ A;  1HR0 L;  4IPC A;  1I50 H;  3ER0 A;  2Q2H A;  1XMQ Q;  1JJ2 A;  1MKH A;  2OCE A;  3GD7 A;  3WWV A;  4HJA A;  1EQR A;  2K14 A;  1IBL Q;  4A3E H;  1U5K A;  1M1K C;  3PSI A;  1YJ9 A;  1VCI A;  1XMO L;  3GTK H;  5LMU L;  4LFB Q;  1A62 A;  2YTY A;  2OWO A;  3RZD H;  4BXX G;  1GVP A;  1PYB A;  5LMN L;  5ELN A;  4GNX A;  2UXB Q;  1SMX A;  1A63 A;  3M85 A;  1YHB A;  3AFP A;  2BA0 A;  1YEZ A;  5IT9 c;  1GKH A;  1UE6 A;  2ZM6 L;  1TWA H;  3S24 A;  3W1B A;  3GTG H;  4P73 A;  4JYA Q;  5GQO A;  3K80 C;  1JJC B;  1LM0 A;  3HKS A;  3HKZ E;  1AE3 A;  5C0X I;  4APV A;  2RHS B;  2BA1 A;  4R4I A;  3MXN B;  2JK8 A;  1L1O B;  4B3S L;  3H15 A;  1HNZ L;  1JT8 A;  1VQ4 A;  2R7Z H;  1K9M C;  3HOW G;  2IX1 A;  5IYB H;  2RF4 A;  4YCV A;  3HFZ B;  4GOP A;  1Y1V H;  1JMC A;  4LFC Q;  4IFD J;  3PF4 A;  3KOJ A;  5C44 G;  1JE5 A;  1G51 A;  3ULP A;  4UP7 A;  4LF7 Q;  1X9N A;  4JI0 Q;  1X6O A;  2OQK A;  1VQM A;  1XNR L;  2UUB Q;  4DAY B;  4BXX H;  1VQN A;  4DUZ Q;  1H95 A;  2XTI A;  4MNO A;  4DR6 L;  5IE8 A;  1T9H A;  1EIY B;  2VY3 A;  3U4Z A;  1E7Z A;  4JBW A;  1KL9 A;  2EXD A;  4XIG S;  4YY3 Q;  5FJ8 G;  2QA4 A;  4JOI A;  3KDF B;  1S40 A;  3PUV A;  1C7Y A;  2Z6K A;  4JI3 L;  4JBK A;  1HNW Q;  3G48 A;  1L1O C;  1HZ9 A;  2BH8 A;  2WAQ E;  4JI1 Q;  5JEA G;  4FDB A;  2LXK A;  4GN3 B;  3CCL A;  4PZ7 A;  2JJQ A;  1Q7Y C;  4H02 A;  3NEN A;  4NPS A;  1YI2 A;  3J81 c;  1RIP A;  4PZ6 A;  3S1Q H;  1OTC A;  2WB1 G;  4A3I G;  1QVG A;  2JA8 H;  4GKK L;  2PI2 A;  3TQY A;  2VQE Q;  1NTG A;  1HZA A;  1BKB A;  3KF8 B;  2H5X A;  2GVB A;  1SE8 A;  4X62 L;  5C44 H;  4IPD A;  4YCW A;  1PH1 A;  4C2M H;  4RMF A;  3CC4 A;  1YHA A;  3AYH B;  2PI2 E;  4A3L G;  1CSP A;  2IHF A;  1R9T H;  1BVS A;  2HIV A;  5C3E H;  1E24 A;  1PH6 A;  4JI7 L;  2VS1 A;  1EYG A;  4A93 G;  1YJN A;  3CCU A;  4X66 L;  1MJE A;  2VUM G;  2HHH L;  4JV5 Q;  4GNX B;  1Z9F A;  3PUX A;  4OWX B;  4JI4 Q;  1UE1 A;  1Q46 A;  4GN4 B;  4YCU A;  1CKM A;  4YWM A;  3CMA A;  2KEN A;  3K7A H;  2VZA A;  4LF9 Q;  4IJH A;  1N36 L;  1D8L A;  1V1Q A;  5ELO A;  4DV5 L;  4DV7 L;  4LF8 L;  4Y52 H;  5EAY A;  3I2Z A;  4BY7 H;  2YU9 H;  4DR5 Q;  2K4K A;  4KHP Q;  1G29 1;  1OXT A;  2EQS A;  3PUZ A;  4PG3 A;  3U4V A;  3S2D H;  3RZO H;  2ZJR A;  1YVC A;  3F2D A;  5K36 G;  1HR0 Q;  1IBK L;  5H1S E;  5IYD H;  1I6H H;  1QVC A;  4P74 A;  4C3I H;  4DV0 L;  1HH2 P;  1W2B A;  1WCM H;  1KXL A;  4AYB E;  4GOP B;  3RN2 A;  3HOY G;  3FP9 A;  1JJG A;  2UUA L;  4L5T A;  1XMO Q;  2Y0S G;  4DV2 L;  2NVX H;  4GN5 A;  3BU2 A;  4A3L H;  4KLK A;  2R6G A;  4DR3 L;  1Q1E A;  1NJI C;  1VQI A;  4A3F H;  2V1C C;  2NVT H;  2MO0 A;  4AQY L;  3I4M G;  3M3Y H;  2AHO B;  4NXN L;  4DV4 L;  4DKA C;  3OTO L;  3GTL H;  2UUC L;  2CWA A;  4O0A A;  4GKJ Q;  4TVA B;  1VQH A;  4X65 L;  1PVO A;  4A76 A;  2JA7 G;  2K5N A;  1HZB A;  3STB D;  3FKI G;  2NZO A;  4GLX A;  3CCJ A;  1VS0 A;  3CP0 A;  3FHW A; 
#chains in the Genus database with same CATH topology
 3RMH A;  3PCO B;  4ZRZ A;  2KHI A;  1J5E L;  4A3K H;  1LTT D;  2DY7 A;  2A1A A;  5K36 H;  3GTQ B;  1UNS A;  1PTO C;  3CPF A;  4A3B G;  1PRT C;  3VR5 A;  1PTO F;  3UDF A;  5IP7 G;  2QF7 A;  3FEW X;  1PRT F;  1KLU D;  1YHQ A;  3I91 A;  3GTL B;  4OWW B;  2I07 B;  1CKO A;  4B3T L;  4K8I A;  5FK9 C;  5JVG 3;  1EZ8 A;  1IHZ A;  4JOI C;  3KFU A;  1RKN A;  1R4P B;  1M90 C;  2J7Z A;  3K5O A;  2GN5 A;  5DM6 3;  2EYH A;  1K0R A;  4XXE A;  3HRZ C;  4GS3 A;  2N8N A;  3G6E A;  1Y14 B;  3CF5 A;  2B2W C;  4R4C A;  1NE3 A;  1PV4 A;  1IKM A;  1M4V A;  5IOC A;  4JC0 A;  3UI2 A;  1VQ6 A;  4ZKB B;  4X62 Q;  5EPJ A;  1OXV A;  5HY6 A;  4B3R Q;  3C3L A;  3HOZ H;  2R3Z A;  3GTK B;  1TWC H;  5E4W C;  3EIV A;  2LXJ A;  3CRL C;  3HKZ G;  3MZ5 A;  2IY5 B;  2NYZ D;  1K73 C;  2XWB B;  4TKO B;  3W2D A;  2UXD L;  3I55 A;  1U0L A;  3SK4 A;  1WTO A;  5BN4 A;  5FLM G;  3D6C A;  1PH9 A;  3STB C;  3HOU H;  3NSW A;  2OTL A;  1GHK A;  2IL8 A;  2TMP A;  2AQ3 B;  3KJP A;  2DGY A;  3HOW H;  1HNX Q;  1M8A A;  2XVS A;  3TDQ A;  2EIF A;  1TWH H;  2B2W A;  1XNQ Q;  2E2H H;  4LFB L;  2RSN A;  3D0F A;  1G6Z A;  3HOV G;  4JI5 Q;  1B4O A;  2K7V A;  2WAQ G;  1B3A A;  5HGQ A;  3L2P A;  1BCP C;  1HXY D;  5D14 A;  3S16 H;  2K01 A;  3MFY A;  3J7Y W;  1Y8O B;  3J7A V;  1IZ6 A;  2VB3 X;  4ME5 A;  4MN3 A;  3QO2 A;  1HQM C;  1SNM A;  1GD7 A;  4RWS C;  3S1Q B;  1TS4 A;  2LS0 1;  1BF4 A;  3H3V H;  3D3R A;  5LL6 S;  3OHX C;  4YWK A;  3R8B A;  3VA7 A;  4KJO A;  4QQB X;  4LF7 L;  5C44 B;  1S5D D;  1YZ6 A;  1QUQ B;  3ND9 A;  1TS5 A;  1PMR A;  3NWS A;  4JI0 L;  1EU3 A;  3S1R H;  2KED A;  1TKW B;  4DUZ L;  1KIX A;  2A8V A;  3DM3 A;  4LJZ C;  4KI0 A;  2FMC A;  2SEB D;  2JEA I;  2AWN A;  1WTV A;  2K5H A;  3OW2 A;  1K83 B;  1SRO A;  4DXG A;  5LMN Q;  3PQI A;  2EPB A;  3UE1 A;  4XTC S;  1LYL A;  5C4X G;  4A3D G;  4HIK A;  4E6I A;  2ZM6 Q;  4AYB G;  4HID A;  1EWI A;  1SAP A;  1DON A;  3VYS A;  4K0K L;  2QEJ C;  1G2T A;  2QDL A;  1KTK A;  1WCM B;  3NQT A;  1WTH A;  2CH4 W;  2NB0 A;  3H0G H;  3NP8 A;  4OON A;  2X6L A;  1TR5 A;  1EQQ A;  1G91 A;  1OXX K;  2R7F A;  2B63 G;  3I3C A;  2IT1 A;  2I46 A;  1TVX A;  1XNR Q;  2HQL A;  3SK5 A;  4A93 B;  3TP8 A;  1X3G A;  1IKL A;  1QJO A;  2C35 B;  2K5V A;  4DR6 Q;  3I4M H;  1VDZ A;  2N88 A;  4ZKC B;  4L5R C;  5I2Y A;  4FF2 A;  3GTM B;  2HD3 A;  3A54 A;  3GV3 A;  5T1G A;  4A3J H;  4B3M Q;  4WJ4 A;  1MHW C;  4KHP L;  2JA7 H;  5DEH A;  4G7O C;  4A3K B;  1KD1 C;  2AQ2 B;  2RCN A;  4NP5 A;  1CHP D;  1QE6 A;  4QCL A;  4KK7 A;  1CUK A;  3PGZ A;  5GAD C;  4GKK Q;  4KY6 A;  3FPP A;  4KHZ A;  1FGB D;  4U67 3;  1WTQ A;  3PIO 3;  4NXM Q;  5BR8 L;  4Q5V A;  1BDO A;  4PV1 C;  4OO1 H;  4EQ5 A;  2NVQ H;  3HS0 C;  1XPR A;  2D62 A;  2F0U A;  1FL0 A;  3E3X A;  2X69 A;  2KJX A;  1VF5 C;  2QIL A;  2HHH Q;  5CMD A;  1NMG A;  3A0J A;  1LO5 D;  3FKI B;  1SE4 A;  2EJM A;  4CHT B;  3NTK A;  5IP9 H;  3KJO A;  4LF5 L;  4DV5 Q;  1E3P A;  1AEX A;  5JPN C;  1LTB D;  2HUG A;  2PZT A;  2A6H D;  4JI6 Q;  3NEL A;  3UDX A;  3FDT A;  2PNH A;  4XQN A;  3J80 i;  3G6J B;  2K6A A;  3GDE A;  2YTV A;  3HOZ B;  3L9A X;  1TWC B;  3V05 A;  2B29 A;  4N8F A;  1JB3 A;  3VYU A;  4DR3 Q;  1JWS D;  3ERS X;  2ENB A;  2R92 H;  1HCZ A;  1TU2 B;  1HJP A;  1U9R A;  4DK6 C;  5IT9 L;  1T5X D;  3K8A A;  4Z9C B;  1WI5 A;  4BY7 G;  3HOU B;  2WAC A;  2KVM A;  1WCM G;  1J5E Q;  1IW7 D;  1VQ5 A;  1PFM A;  4OIK A;  3HOW B;  4DFA A;  1TWH B;  1W6K A;  4A3M H;  1RTN A;  2VL6 A;  1EIF A;  4X3S A;  1I5F A;  2E2H B;  2CWP A;  2X6G A;  4QY7 A;  2K1B A;  2CCZ A;  4DUY L;  4O1N A;  4CJ2 C;  2Z9H A;  3QJY A;  1N8R C;  3S16 B;  3KLW A;  5CV9 A;  4B3T Q;  4DR7 Q;  1YBY A;  2Y0S E;  4K6D A;  1Z47 A;  1A3T A;  4IUP A;  4QIW E;  3EBE A;  3C1E A;  4LWC A;  1EL0 A;  4F8M A;  2KEC A;  3KYH C;  3K57 A;  1N32 L;  3K0Y A;  5M3M H;  4A3K G;  4UPA A;  1L1O A;  2KBN A;  3Q8D A;  2XGT A;  1LLR D;  3KUP A;  2A6H C;  3ULL A;  1DOL A;  4YWL A;  5JPM C;  2SNS A;  5FO8 B;  1GO3 E;  3NWT A;  2PPB C;  2G5D A;  1TXY A;  1ESR A;  4ABN A;  4IUU A;  1X54 A;  5C5M A;  3WDN A;  3M4O B;  3BYY B;  3O13 A;  2C5C A;  1KAW A;  1GJX A;  2QW7 A;  1GM5 A;  2LFN A;  4IUR A;  2F52 A;  2JE6 I;  1PA6 A;  4NDX A;  3S9W A;  2IX3 A;  1VQF A;  5IWA L;  1JOK A;  1VQD A;  4BY1 H;  2UXD Q;  2VNU D;  4JCV E;  1IL2 A;  1MIU A;  4IN3 A;  1XTD A;  4LW1 A;  1B8A A;  4IFD H;  3SHL A;  5EBC A;  3E9H A;  1CT1 D;  3HGB A;  1D5X C;  1C9O A;  1S3O A;  3DEO A;  1N34 L;  4IPC A;  1IW7 C;  1I50 H;  3CKI B;  3KF8 A;  4ZYS A;  3H0G B;  2HCI A;  1RCV D;  2JYO A;  5ELC A;  5FO7 B;  4LFB Q;  2YTY A;  2Y0S B;  3RZD H;  1STH A;  4QIW B;  2IWH A;  1ET9 A;  1TT2 A;  3I4M B;  1CTM A;  3PO3 B;  4P73 A;  4ILW A;  4A3J B;  3K80 C;  2L0C A;  1JJC B;  2JA7 B;  4HCE A;  2RHS B;  2BA1 A;  3HOW G;  1Z6H A;  2IX1 A;  5IYB H;  2RF4 A;  1EEI D;  4IAL A;  4KKU A;  3HFZ B;  1HTL D;  4IUV A;  3T56 B;  4X3K A;  3NTI A;  3ULP A;  4LF7 Q;  4JI0 Q;  1X6O A;  3KLR A;  2NVQ B;  4DUZ Q;  1H95 A;  5IE8 A;  1EIY B;  4PMB A;  1K3B C;  1HZ9 A;  2CQA A;  2LXK A;  1NNX A;  2R7Z B;  3CCL A;  3VR2 A;  1Q7Y C;  3NEN A;  1IYV A;  2ICI A;  2OEO A;  2L4N A;  2JA8 H;  2DNE A;  3OWF A;  1BNZ A;  1BXT A;  4X62 L;  2GVB A;  2EDG A;  5KNC A;  1YHA A;  3AYH B;  5F2D A;  5IGF A;  4GZY C;  1R9T H;  2VS1 A;  1EYG A;  1BO0 A;  1MJE A;  3R2T A;  3PUX A;  2R92 B;  3BDO A;  2M00 A;  2E74 C;  1S5E D;  3CMA A;  3K7A H;  3N6R A;  5E3F A;  1DD2 A;  4KHP Q;  1G29 1;  1OXT A;  3PUZ A;  4PG3 A;  3FMC A;  1YVC A;  3AMU A;  1HR0 Q;  3CHB D;  5H1S E;  1I6H H;  1XYI A;  1GUT A;  4A3M B;  1HH2 P;  1W2B A;  1XTC D;  1JJG A;  2NZ1 D;  4L5T A;  2PQE A;  2Y0S G;  4DV2 L;  2NVX H;  4GN5 A;  3BU2 A;  3FRP B;  4A3L H;  3VYR A;  1Q1E A;  3J80 L;  4KD4 A;  4IZ8 A;  2NVT H;  4YIJ A;  3I4M G;  4RGO S;  4H44 C;  4NXN L;  5IGG A;  4DKA C;  4I7A A;  2K33 A;  5C0X H;  3F2U A;  3GTL H;  3R3O A;  4CDE C;  1EIH A;  3U9S A;  2JA7 G;  2FMM A;  1HZB A;  4S3S A;  5M3M B;  1Q90 A;  2BE5 D;  5EQ0 A;  2K5Q A;  4LF5 Q;  4C3H H;  3ZJY C;  3OYY A;  4GOP C;  1XPU A;  2WP8 J;  2ICE C;  2EYL A;  3PMF A;  1VQO A;  3GTO H;  3LGJ A;  3LNN A;  4DNT B;  3H3V I;  4V19 0;  1PLF A;  1QZG A;  4K6L A;  1PH2 A;  2D5D A;  4KKT A;  1VQK A;  3J80 E;  4PMW A;  2RBM A;  2Z6K C;  5C5L A;  4BY1 B;  1NAP A;  5IP9 G;  3DWP A;  4CBV A;  1HFN A;  2AQ1 B;  2YU9 B;  1W6J A;  1I4H A;  4YHH L;  3VA5 A;  2AMC B;  2B2Y C;  1JIC A;  2HCC A;  3VR4 A;  2NZH A;  4EX5 A;  4P72 A;  1YIJ A;  3BVZ A;  2HDM A;  1I50 B;  3X3N A;  1B9M A;  3JAM c;  2Q2I A;  1JR0 D;  3EN2 A;  1QUQ A;  3GQB A;  5M5X H;  3PUW A;  3OOC A;  3TRE A;  3M4Y A;  1OXU A;  3RZD B;  1D5Z C;  5M3F G;  2VQF L;  4B9X A;  3Q23 A;  5CV7 A;  4DUY Q;  1PFN A;  1XXG A;  3F2B A;  1AZP A;  3J81 i;  1SNC A;  4UP9 A;  1MSG A;  1RTO A;  4B3M L;  4TSS A;  2BE5 C;  1N32 Q;  5COR A;  2WV6 D;  2JA6 G;  3GO5 A;  4BBS G;  3K81 C;  2OT2 A;  4GLA C;  1EFW A;  2PYK A;  3SE0 A;  5C4Z A;  2Z4I A;  5CV6 A;  2F4I A;  3M9B A;  1Q86 C;  4BWG B;  4NXM L;  2Q8T A;  3QB3 A;  4J6H A;  1NMF A;  3UDI A;  1SNP A;  4C56 C;  1STG A;  3BVM A;  1SYC A;  2RDG A;  4MTK A;  5GRO A;  4AQY Q;  1SNO A;  2CFM A;  4N9T A;  2AKW B;  2UUC Q;  4HJ9 A;  1K83 H;  4JYA L;  4OO1 I;  4TRD A;  5IWA Q;  2PMZ E;  3RNU A;  4MTN A;  1UWV A;  3CD6 A;  4OIJ A;  4IOA A;  3RLF A;  3L0O A;  3PUY A;  1ICW A;  4L5Q A;  4UAI A;  2Z6B A;  1ML0 D;  1MBY A;  2P5Z X;  4QUF A;  3ERQ A;  1E0B A;  4JW0 A;  5HGT A;  4JI6 L;  2JA8 B;  1V8Q A;  1N34 Q;  4POF A;  2B3G A;  1HUM A;  1CHQ D;  4ZUJ A;  1EFI D;  1PYS B;  1XJV A;  1CKN B;  1MSH A;  4LUO A;  1R9T B;  4A3G G;  2KHS A;  4HSV A;  2ALY B;  1XX8 A;  5E4X A;  5C6A A;  2F0J A;  3GTJ H;  4KY5 A;  1EYA A;  4A4I A;  1I3Q B;  4A93 H;  1GXD C;  1K8A C;  4DNR B;  4NMZ A;  1HNW L;  3K7A B;  4R8I A;  1CSQ A;  4O42 A;  4JPB W;  1HHV A;  3GTM H;  5EJW A;  1EOT A;  1K0S A;  2K5W A;  3OMG A;  4AH6 A;  1I6H B;  2O5I C;  3BDL A;  2XRQ D;  2K52 A;  1Y1W H;  2Q2T A;  2RQX A;  3NQI A;  2F0S A;  3HOY H;  2KCM A;  4OXP A;  5LMN W;  2NVX B;  2NBF A;  1CK1 A;  4RHS A;  1RHP A;  1SJH D;  1QVF A;  1CA6 A;  2QEX A;  2NVT B;  2E75 C;  2PMZ B;  1C4Q A;  4HJ5 A;  4FF3 A;  3VDY A;  2QKI C;  3A5Z B;  2IJ0 A;  3W1G A;  1TWF H;  4DV6 Q;  4DR7 L;  2EYM A;  4JBJ A;  5JOB A;  5JJL A;  3CW2 C;  5NUC A;  4X64 Q;  2EYJ A;  1SNQ A;  3T1H Q;  1PZI D;  3FKI H;  5JJK A;  4C3H B;  3NK9 A;  5ELD A;  4ZCK A;  1SJE D;  1E22 A;  1VQG A;  1JOQ A;  1I6V C;  4FVM A;  4P75 A;  1OXS C;  2ES2 A;  2RCF A;  3GTO B;  1QG7 A;  1I4Q A;  3VR6 A;  3ULJ A;  1EY7 A;  2I5H A;  2K75 A;  1EQT A;  2BDN A;  1PH4 A;  3GTP H;  3DXJ C;  2G9D A;  5GAH C;  1VQ8 A;  4R9W A;  2LY7 A;  4GLV B;  5CC4 A;  1JCK B;  4LF4 Q;  2JA8 G;  5KYL A;  5EKL A;  5L37 A;  1W3S A;  2CQO A;  2L1B A;  3CAM A;  2JA5 H;  1SYG A;  4IFD I;  4BBR H;  2EJF C;  5M5X B;  2BCO A;  2ZT9 C;  3SEB A;  2DY8 A;  1LT5 D;  4UY8 C;  4DV2 Q;  1VQP A;  1WD0 A;  1ASZ A;  1FR3 A;  1NR2 A;  1HA5 A;  5CV4 A;  5E7N A;  4WOR A;  4DK3 C;  4NXN Q;  4HAE A;  4HIM A;  1B1Z A;  1V43 A;  1L2F A;  1E2V A;  1FNV A;  1SLJ A;  3PO2 B;  4DR1 Q;  4J15 A;  2PZW A;  4K5W A;  4DR4 L;  1ZKO A;  5LHY 1;  2K32 A;  3A74 A;  4JK1 C;  4A75 A;  1FNW A;  1CM9 A;  2A19 A;  2E2I H;  1EQV A;  4HCS A;  1EIG A;  2O5J C;  5KRU A;  4A3C G;  1VQE A;  3T16 A;  4LK1 C;  1ROD A;  3CCQ A;  4WJW A;  3BZK A;  3M4O H;  4RGN A;  4EVO A;  5C0X G;  1EWC A;  2F0L A;  3I56 A;  1P8L A;  4LUV A;  4IUN A;  1WFQ A;  3HEJ A;  5D3I B;  3A56 A;  3N52 A;  1A6X A;  2R93 H;  1KC8 C;  1UEB A;  1SXT A;  4IQZ A;  3TME A;  1ILQ A;  3F2C A;  4YHH Q;  1QWY A;  1F9Q A;  4C1N K;  5JJI A;  1CQF A;  3J81 L;  2I5L X;  1STE A;  4O2D A;  4PNY A;  1X3Q A;  3OSO A;  1WTX A;  1VMP A;  3SXH A;  3Q0A A;  5M5Y H;  1F2M A;  3A55 A;  4TQU S;  4F88 A;  3LWU A;  1K8G A;  3MEF A;  3GTJ B;  1WTW A;  1NBW A;  1D7Q A;  2VQF Q;  4LF6 Q;  2F0V A;  3HP3 A;  1X32 A;  4QL5 A;  3PO3 H;  4JI2 Q;  2CKZ B;  1UE7 A;  1EY6 A;  3PF5 A;  1TWG H;  2Q8R E;  4HMJ A;  4HIO A;  2I5M X;  3PIO A;  3FPU B;  1KDB A;  1HR0 L;  1Y1W B;  3HG9 A;  1JJ2 A;  4M1U B;  3J81 E;  4A3E H;  3HOY B;  1M1K C;  1S5F D;  5A35 A;  2OWO A;  1GUG A;  3KBX A;  3MWY W;  1A63 A;  1JC7 A;  2F0F A;  5G3L D;  1TWF B;  3AFP A;  1YEZ A;  4FF1 A;  5IT9 c;  1GKH A;  4JYA Q;  5CV5 A;  5GQO A;  3A7L A;  1Q8I A;  1WTR A;  5C0X I;  3WOE A;  3MXN B;  2JK8 A;  2B2T A;  4B3S L;  1HNZ L;  2R7Z H;  1K9M C;  5D65 A;  4L63 B;  2F3W A;  4IFD J;  1VMC A;  3QG1 A;  5I9P A;  1HRJ A;  1SE2 A;  5C44 G;  1JE5 A;  5DM7 3;  4Q0F A;  1ENF A;  1ZEQ X;  4DAY B;  4BXX H;  1VQN A;  2F1M A;  3RD4 A;  5J39 A;  1SDF A;  1U4P A;  2K28 A;  1KL9 A;  3GTP B;  2QA4 A;  3ZYY X;  2R61 A;  1AN8 A;  3NUC A;  3PUV A;  1C7Y A;  4JBK A;  1I4X A;  1D6E C;  3G48 A;  1L1O C;  1HNW Q;  5JEA G;  4FDB A;  4FXG C;  4H02 A;  3A7A B;  2PW7 A;  4UDU C;  1U4M A;  3TP5 A;  1RIP A;  4PZ6 A;  1WTP A;  1QNU A;  1X3P A;  2JA5 B;  1NTG A;  4FO2 A;  4BBR B;  4KKS A;  1O80 A;  5HUR A;  2H5X A;  1SE8 A;  1PH1 A;  4A93 G;  4JV5 Q;  1KNA A;  4OL7 A;  1Z9F A;  4OWX B;  1A15 A;  1EY9 A;  2KEN A;  1MD2 D;  1D8L A;  5G3L F;  4DV7 L;  1N36 L;  1PZK D;  1E2Z A;  1ONL A;  2O2L D;  4DR5 Q;  2K4K A;  5IT9 E;  2EQS A;  3U4V A;  3RZO H;  2F0I A;  5K36 G;  1IBK L;  2E2I B;  4P74 A;  5EKK A;  2EVB A;  1KXL A;  3RN2 A;  3HOY G;  2LKV A;  1NUC A;  4KV6 A;  5C3E B;  3T4A C;  1K28 A;  1RJT A;  3LWE A;  1EWH A;  1PRT B;  1S5C D;  4AQY L;  4XYQ A;  1B44 D;  4HTH A;  2DNC A;  3BS1 A;  3GP7 A;  4EQO A;  2R93 B;  4OEL B;  2UUC L;  4O0A A;  1PVO A;  1CZW A;  4A76 A;  1C48 A;  1GHJ A;  4H0L C;  3K5M A;  1UAP A;  3FKI G;  4GLX A;  2YU9 H;  4C1N I;  4C3I B;  3K5L A;  1BBU A;  1NY4 A;  2MGS A;  2OQ0 A;  5DLQ E;  5ISR A;  1LTL A;  2EXZ A;  2LSS A;  1S5B D;  1PZJ D;  2DN8 A;  3PIP 3;  2KCT A;  5IGD A;  2BH2 A;  3HOZ G;  1WVL A;  5M5Y B;  3M7G A;  5TSS A;  2Z1C A;  2XWJ B;  4G57 A;  2EZV A;  1BUV T;  4P71 A;  5EPK A;  2MP1 A;  4FP5 D;  4CDC C;  5KIX A;  2UU9 L;  1ENA A;  2CHB D;  1LV9 A;  2A69 D;  2M9V A;  5C0X J;  3HOU G;  1AFP A;  1WD1 A;  1R4Q B;  1TWG B;  1Z7T A;  4DR4 Q;  2JA5 G;  1JB7 A;  1FJG L;  1LAB A;  4BBR G;  3SVM A;  2CVR A;  2RSO A;  3M7N A;  5BN5 A;  1O78 A;  3D31 A;  4A3E B;  1CKN A;  5IP7 H;  4QGU A;  5JJZ A;  4OGQ C;  3DM1 A;  4X66 Q;  4OWT B;  4DV6 L;  2YYZ A;  1BCP B;  3S17 H;  2IW3 A;  4POG A;  2E76 C;  3TSS A;  1JE4 A;  2IX0 A;  2JP1 A;  2RDF A;  5CGK A;  4X64 L;  3I7F A;  1E1O A;  1NCV A;  3C2P A;  3T1H L;  4AIM A;  4B9W A;  2ZJP A;  1SYF A;  4R1J A;  5C4J B;  1C0A A;  2ZXP A;  2I0Q A;  3M4P A;  3QOL A;  1GOZ A;  3U50 C;  1Q12 A;  4OEM B;  1S4Z A;  1SSO A;  3J80 c;  2UXB L;  1A0I A;  4MHE A;  2R93 G;  1RF2 D;  1OO9 B;  1P16 A;  2GVA A;  2ATW A;  3MFG A;  2KQ3 A;  3TS0 A;  2HQE A;  1SND A;  1BBX C;  3KF6 B;  1U4R A;  2MPM A;  1I3Q H;  2JA9 A;  1NR4 A;  4QJF A;  3TS2 A;  3K0X A;  5FLM H;  2N55 A;  2LMC B;  1I4P A;  4K2K A;  4UP8 A;  4LF4 L;  3PV0 A;  3S2H H;  5IY0 A;  4IUT A;  4LFC L;  1G6P A;  2F0O A;  1FGU A;  1SN8 A;  2E2J H;  1FD7 D;  2F03 A;  4A3I H;  2A68 D;  3H0G G;  4G7H C;  5GAE C;  3CC2 A;  2RA4 A;  4KHV A;  4L6T B;  1G8Z D;  1VQC A;  3MAQ A;  4CKB A;  5J3B A;  5KNB A;  4LUZ A;  2HIX A;  4YY3 L;  3G71 A;  2PQA B;  5BN3 A;  2VUM H;  4HMI A;  3BVG A;  3PO3 G;  3S1N B;  2SNM A;  5M5W H;  4JI1 L;  3CU7 A;  1DGS A;  4A3J G;  1STY A;  1KDC A;  2N49 A;  1X56 A;  5IGE A;  4DR1 L;  1U4L A;  1DCZ A;  3RZO B;  4B3S Q;  1RD9 D;  1HNZ Q;  4RCO A;  2B2U A;  4L5S A;  5JEA J;  1VQ9 A;  3CCR A;  1HA6 A;  1LT6 D;  4ZQ3 A;  3KLS X;  3TP6 A;  3BZD B;  3L7Z C;  4H13 C;  4OO1 G;  3LX0 A;  2B39 A;  1A2T A;  2V4D A;  4QF4 A;  1ET6 A;  4DAV A;  1WYD A;  4J1M A;  3NBI A;  3DLL A;  2B8G A;  3KBG A;  4PZ8 A;  3RLN A;  1XWE A;  5C4X H;  4A3D H;  2L15 A;  3NTH A;  2WFW A;  2R7Z G;  3KK7 A;  2XNA C;  2F3I A;  3ND8 A;  2GA4 B;  2NWG A;  3AFQ A;  4DV3 Q;  4OX9 Q;  2IPK D;  4U68 A;  2A68 C;  4EQP A;  3NEM A;  4BA2 I;  2B63 H;  3AEV A;  4JI8 Q;  1JWM D;  1K8M A;  2MHV A;  3CRK C;  1CFM A;  2AWO A;  1H9R A;  1VQJ A;  4GKJ L;  1J6Q A;  2R92 G;  1B50 A;  3M4Q A;  2EYF A;  1TS3 A;  3V2T A;  4LF6 L;  1IYJ B;  3UE0 A;  3TP7 A;  2Q8I B;  1N36 Q;  4JI2 L;  3A5U A;  4DV7 Q;  5C3W A;  4HJ8 A;  1PYW D;  2EOT A;  3PO2 H;  3MHB A;  3NPP A;  1I94 L;  1JQY D;  5IYC H;  3HOX H;  5EKI A;  4A3M G;  1IBK Q;  1EU4 A;  2K04 A;  3IRB A;  5FO9 B;  5AFW A;  3R2I A;  3DMU A;  4DF7 A;  2OTJ A;  1H9M A;  1H9S B;  2KOL A;  4DR2 L;  3K7U C;  3OIQ A;  1V9P A;  3SK8 A;  4G4K A;  3ICE A;  3D4W A;  3S17 B;  1V1P B;  1UEA B;  2ZXR A;  2H1E A;  1DZ1 A;  4B08 A;  2F0K A;  2JSO A;  1EUJ A;  3QWN A;  2L9H A;  5IGC A;  1AZQ A;  2XRS D;  1EY8 A;  5M3M G;  2E5L L;  1XPO A;  4HN7 A;  4WJ3 M;  3I72 A;  4RFB A;  3ONA B;  2NN6 H;  4R4O A;  3Q24 A;  1LTI D;  3E0E A;  3VR3 A;  3NXW A;  4MIU A;  2F4V L;  1KQS A;  1X55 A;  1AE2 A;  1J8I A;  4NKL A;  1B7Y B;  1SYB A;  1IBM L;  4CDD C;  1HUN A;  1IYU A;  2JEB I;  1FVI A;  1E1T A;  1VQL A;  4MZ9 A;  2TSS A;  4BY1 G;  1YIT A;  2AUK A;  3S14 B;  2UU9 Q;  3MA2 B;  3NBH B;  3RUZ A;  3I4N H;  3OPO A;  2YTX A;  1QCB D;  3MXN A;  4IFD G;  1SRU A;  1KRS A;  1LT4 D;  3S2H B;  1JOO A;  3BDC A;  3QOJ A;  2E2J B;  1FJG Q;  3T1Y L;  3G7L A;  1LUZ A;  3DWQ A;  4A3I B;  2ZTC A;  1HFG A;  3I4O A;  3CCV A;  2XIW A;  3HOV B;  3OWE B;  4DAY A;  2SOB A;  2WAQ B;  1B9N A;  1ASY A;  1G2S A;  5AJ3 L;  4DU9 A;  4JV5 L;  2VUM B;  3MXU A;  5M5W B;  4PQX A;  1Q81 C;  3MTS A;  1N33 L;  1YNJ D;  3H3V C;  1DOK A;  3P75 A;  3A8I E;  3TRZ A;  4K2L A;  4DR5 L;  3OMC A;  3F1Z A;  5IYB G;  1MI2 A;  4LFA L;  1PH7 A;  3ER0 A;  1SE3 A;  1V1O A;  1B53 A;  2OCE A;  3A8J E;  3MVV A;  4KJN A;  4P2C B;  5KEE A;  4Y7N B;  2K14 A;  3PSI A;  1YJ9 A;  1Y69 U;  2KCN A;  5LMU L;  1A62 A;  1BCP D;  5M9O A;  1GVP A;  1PYB A;  4M8A A;  2UXB Q;  1SMX A;  2M2L A;  1YHB A;  1C8C A;  3S24 A;  3GTG H;  5C4X B;  2RKS A;  4A3D B;  1B3Q A;  5CBE E;  3HKS A;  4AYB B;  1AE3 A;  3GV6 A;  3K6O A;  2F0G A;  5FLX L;  1JT8 A;  3A8K E;  3EFX D;  4OHJ A;  4FNF A;  2O4X A;  4DN4 M;  5JVH 3;  1JMC A;  1Y1V H;  4LFC Q;  5D3D A;  4RHR A;  4KY7 A;  1E2W A;  3IAY A;  4UP7 A;  2B63 B;  1X9N A;  4I7Z C;  4UHV A;  2OQK A;  2UUB Q;  2F0E A;  1EY5 A;  3TZD A;  1GUS A;  1T9H A;  1TWA B;  1E7Z A;  4JBW A;  4YY3 Q;  5I9O A;  1CZG A;  4JOI A;  3KDF B;  1S40 A;  4JI3 L;  2BH8 A;  4JI1 Q;  4GN3 B;  4HED A;  1YNJ C;  4PZ7 A;  2VB2 X;  4NPS A;  1YI2 A;  3J81 c;  3I4L A;  5ELB A;  4BS9 A;  4LAA A;  5EPL A;  1OTC A;  5COY A;  4A3I G;  5FLX E;  3HOX B;  3TQY A;  1ICF B;  1HZA A;  3I90 A;  4ZLT F;  1QNK A;  4YCW A;  4C2M H;  4RMF A;  4A3L G;  1K8O A;  1PTO H;  2PI2 E;  1TS2 A;  1CSP A;  5KYI A;  4KN7 C;  1BVS A;  2HIV A;  4CJ0 B;  5C3E H;  4JI7 L;  1YJN A;  3D4R A;  4KMU C;  4ULL A;  4X66 L;  2VUM G;  4QB4 A;  4GNX B;  1BCP F;  4JI4 Q;  1HTP A;  4GN4 B;  4YCU A;  2PCF B;  1SMY D;  4YWM A;  4LF9 Q;  4IJH A;  3MEH A;  3V96 A;  2EY1 A;  3FVQ A;  1KDA A;  3I73 A;  5EAY A;  3I2Z A;  1D1K A;  4CGY B;  2F0W A;  4C3H G;  3S2D H;  2ZJR A;  5IYD H;  1TQO A;  1A3U A;  1QVC A;  5T1I A;  4C3I H;  4DV0 L;  3E0J A;  5FOB B;  4GOP B;  3FP9 A;  1AP0 A;  2WIN B;  2UUA L;  4F87 A;  1CI3 M;  5A2Q L;  1XMO Q;  1LTR D;  4RH6 A;  2Z8L A;  5IGB A;  1L0X B;  1VQI A;  4A3F H;  3M3Y H;  1KLG D;  2MO0 A;  1F2L A;  2WKC A;  4DV4 L;  2EE1 A;  3BYT B;  3OTO L;  4GKJ Q;  3H6M A;  2K5N A;  4BY7 B;  4JVZ A;  3I4N B;  2B2T C;  2NZO A;  3FHW A;  1ZYR D;  4DGZ A;  4X3U A;  2E2D C;  2KA7 A;  1SR3 A;  5DNF A;  5JAV A;  2F0D A;  1DOM A;  3R93 A;  1I94 Q;  1EY0 A;  2PW5 A;  3BJU A;  1F77 A;  1GUN A;  2KEE A;  1QB5 D;  3T13 A;  3URY A;  2N78 A;  1D1I A;  4C3J H;  5A2Q E;  1BBW A;  3OW7 A;  4DPG A;  1A8V A;  3MXG A;  4DR2 Q;  1QOH A;  4JBM A;  1TY0 A;  1B2T A;  4IO9 A;  1EYD A;  3KF6 A;  1SMY C;  2IHE A;  2F0H A;  3PO2 G;  4R8N A;  2KUM A;  2E5L Q;  5IYC G;  2AUJ D;  3HOX G;  4ALP A;  4DV1 L;  2D0P A;  4X6A H;  3EQL C;  3Q22 A;  4XQJ A;  5C4J H;  4DK1 A;  2NVY H;  4KN4 C;  2UXC L;  1PH8 A;  4IPH A;  4R4Q A;  5EBD A;  2CW0 D;  3SK6 A;  1SBB B;  1YJW A;  1BQQ T;  1LTG D;  1HQR D;  1MJC A;  4KD3 A;  2F4V Q;  4LMQ D;  1O7L A;  1SYE A;  4K8J A;  1IBM Q;  1D5M C;  4HSP A;  4FF4 A;  4EGV A;  2PQA A;  1DM0 B;  1J9O A;  3H09 A;  1F9P A;  2Z0S A;  3GTG B;  3ITP A;  4LF8 Q;  2MNA A;  1L0W A;  2WKD A;  1ZYR C;  2DJG C;  3S15 H;  1VQB A;  2NN6 G;  3CCM A;  1AH9 A;  3D6W A;  1XMQ L;  1Y1V B;  4DV3 L;  1IBL L;  3T1Y Q;  4OX9 L;  1JOR A;  4RGT A;  2F0Q A;  2K05 A;  1MGS A;  3E6Z X;  3SGI A;  1WJJ A;  4JI8 L;  5M3F H;  3S1M H;  2J4X A;  2K03 A;  3IL8 A;  2HT1 A;  4X65 Q;  1VQA A;  5AJ3 Q;  4N8X 1;  2BDO A;  1A3V A;  4N9P A;  5I6W A;  1LTA D;  3RN5 A;  3I4N G;  5FJ8 H;  3TEH B;  4I65 A;  1JWU D;  4LNQ A;  3S1N H;  2J0T D;  5E1F A;  1N33 Q;  5C4H A;  4R4T A;  3AU7 A;  1ESF A;  3G4S A;  2DUD A;  2VXW A;  5IIF A;  4V0B A;  2MUY A;  2JA6 H;  1ILP A;  1KNE A;  1Y1W G;  1YNX A;  4LFA Q;  1Q82 C;  3SDZ A;  2K50 A;  4BBS H;  1X3F A;  4RKB A;  4C2M B;  5J22 A;  5K5P A;  2CW0 C;  1X3E A;  3DHQ A;  1PTO B;  4H7B A;  2ZJQ A;  2FHT A;  2ASB A;  3MC0 B;  1H9J A;  5LMU Q;  1KAB A;  4ME3 A;  4F7X A;  1FNU A;  4DAP A;  4DAM A;  3CXC A;  1GUW A;  2JN4 A;  4KTA A;  4RCN A;  5KND A;  5FKA C;  4J8Q A;  2ZTD A;  1HR0 W;  4JG2 A;  4ODG A;  3B6Y A;  3PIP A;  1K3R A;  3S2D B;  4DA2 A;  3RLO A;  3W5O A;  2VQE L;  2KCC A;  1EY4 A;  3HZX A;  4L8J A;  5C3X A;  3S1R B;  2EYO A;  5I2X A;  4WRD A;  1PH3 A;  1H9S A;  4DXF A;  2NN6 I;  2E8G A;  3U58 A;  4A3G H;  1O7Y A;  4CKE A;  1Y8P B;  5GAG C;  4A3F B;  3M3Y B;  1LAC A;  2Q2U A;  4NW2 A;  5CYU A;  1PH5 A;  4XT1 B;  3J7Z C;  1T5E A;  1V1P A;  2F0N A;  1I4G A;  1EEF D;  1Q1B A;  2L55 A;  2RDH A;  2EY2 A;  4XDX A;  4JI3 Q;  3P7J A;  3JAM i;  4WFN 3;  4CDF C;  1IXR A;  1DXM A;  1Y1V G;  2L5T A;  4XYO A;  1QZH A;  2QCP X;  2C9O A;  1STN A;  3H91 A;  3MXP A;  1STA A;  3CQZ H;  3F8T A;  1AW7 A;  3IFD A;  4A3B H;  4NB3 A;  2OF1 A;  4C3J B;  2L11 A;  3AB9 A;  4JI7 Q;  2FXQ A;  2NUC A;  4ZUI A;  2FJ2 A;  4HR7 B;  2RHQ B;  3UDG A;  3RR5 A;  2A5H A;  2KHJ A;  3NBH A;  4FXD A;  3OIP A;  1KRT A;  1RL2 A;  2F0M A;  2JQO A;  2D9U A;  1Q3L A;  1O7Z A;  1HZC A;  3CC7 A;  4QMG A;  2N3S A;  2NVY B;  3T51 B;  1S72 A;  4DV0 Q;  3E9I A;  3J7A F;  2VW9 A;  4RKL A;  2UUA Q;  2B2V C;  5C3E G;  3J7A 5;  2WB1 E;  2YV5 A;  3T53 B;  1UE5 A;  4IJL A;  3K59 A;  4RA8 A;  2MO1 A;  4XQQ A;  3CCE A;  4IUQ A;  3CCS A;  4DV4 Q;  1PFB A;  2FFK B;  2K5D A;  3OTO Q;  1F9R A;  4HJ7 A;  3TBI B;  2Z4H A;  5CV8 A;  1DJR D;  3TN2 A;  3QR8 A;  3S14 H;  2OXP A;  3CME A;  3S15 B;  2A69 C;  5IYD G;  3J81 j;  4K0K Q;  2MFI A;  1N9W A;  2B2U C;  4C3I G;  3JC6 6;  1EOV A;  2XSC A;  4FYD A;  2A73 B;  1SFO H;  2HDL A;  4B3R L;  2F0T A;  3ERO A;  1UUP A;  3P20 A;  4K14 A;  1ZXT A;  1GUO A;  5J1Z A;  4A3F G;  1F9S A;  3C46 A;  2UUB L;  5M3F B;  3S1M B;  1PHJ A;  3HOV H;  3EJI A;  1PFS A;  2B2V A;  2NTS A;  4RG1 A;  5KGU A;  3TZU A;  1KHI A;  1A2U A;  3BZC A;  1WOC A;  1CQV A;  1TII D;  3AQQ A;  3D8G A;  3SR1 A;  1CA5 A;  1DYQ A;  1TY2 A;  2MJ8 A;  4IOC A;  2D0O A;  1VQ7 A;  1HNX L;  2JA6 B;  2ID0 A;  2MQH A;  4DV1 Q;  3GTQ H;  4IPG A;  4BBS B;  2WB1 B;  1L0Y B;  2R7D A;  1XNQ L;  1Y8N B;  4A3C H;  4A3E G;  5BR8 Q;  2UXC Q;  3K58 A;  1RDP D;  4JI5 L;  3EA6 A;  3IKJ A;  3KLS A;  4X3T A;  4C3J G;  4Y7N H;  1O7I A;  2QDB A;  4GNX C;  3VYT A;  3CPW A;  3IFT A;  1Q8K A;  4DNI A;  2ZTE A;  1X65 A;  3C1F A;  1II3 A;  1STB A;  5I4D A;  4JI4 L;  3KDF A;  4BA1 I;  2A6E D;  4LF9 L;  2F0P A;  5ELE A;  1B70 B;  1EZ6 A;  4G7Z C;  1BOS A;  1F2Z A;  1SYD A;  3EVQ A;  2QGQ A;  2A74 C;  5IOD A;  2Q2H A;  1XMQ Q;  1MKH A;  3GD7 A;  3WWV A;  5LL6 X;  4HJA A;  1EQR A;  2EY5 A;  1IBL Q;  1U5K A;  3DWA A;  4K5X A;  4EQN A;  2PZU A;  1VCI A;  1XMO L;  3GTK H;  5ELF A;  4A3G B;  4BXX G;  1YNN D;  4ZK9 B;  1I4R A;  2SDF A;  5LMN L;  5ELN A;  4GNX A;  3M85 A;  2BA0 A;  4DK0 A;  1UE6 A;  2BOS A;  1TWA H;  2ZM6 L;  3W1B A;  1LM0 A;  3HKZ E;  4APV A;  5CR3 A;  4R4I A;  5I6Y A;  3U9O A;  1L1O B;  3H15 A;  1VQ4 A;  1PXU A;  4YCV A;  3BG3 A;  1BR9 A;  5CBA E;  4GOP A;  2PO4 A;  1FYC A;  3PF4 A;  3KOJ A;  2EY6 A;  3CQZ B;  1G51 A;  2CH4 A;  2RVL A;  4A3B B;  1VQM A;  1XNR L;  3QIA A;  1HPC A;  2XTI A;  4MNO A;  4DR6 L;  2VY3 A;  3U4Z A;  3W3A A;  2EXD A;  3E5S A;  4K5V A;  4XIG S;  5FJ8 G;  4RGM A;  2FIN B;  2D2C C;  4XT3 B;  2B8F A;  2Z6K A;  2A6E C;  2WAQ E;  3L3O C;  4RAU C;  4QUC A;  1LTS D;  2ZXO A;  3H94 A;  2JJQ A;  1F2Y A;  2B2Y A;  1EYC A;  3K5N A;  3S1Q H;  3X3M A;  3I70 A;  1PTO D;  2WB1 G;  1QVG A;  4GKK L;  2PI2 A;  1LT3 D;  2VQE Q;  3DEP A;  1BKB A;  3P1H A;  3JAM L;  4ID6 A;  1PRT D;  3KF8 B;  4CKC A;  5C44 H;  4IPD A;  2NTT A;  1H9K A;  3CC4 A;  1IL8 A;  2IHF A;  1PH6 A;  1E24 A;  3NE5 B;  1YNN C;  4ZAI A;  3CCU A;  2EJG C;  2HHH L;  3HKZ B;  2L12 A;  2JXM B;  1D2B A;  5DAU A;  1UE1 A;  1Q46 A;  4CJ1 B;  1CKM A;  2H4O A;  2VZA A;  2XN9 C;  5ELO A;  1V1Q A;  4DV5 L;  4LF8 L;  4Y52 H;  5JEA H;  1ENC A;  4BY7 H;  1VF7 A;  3F2D A;  2DJF C;  1SFO B;  3I8Z A;  1PDQ A;  1WCM H;  4AYB E;  3D4D A;  1NSN S;  4PMC A;  3JAM E;  3NHH A;  4KLK A;  2PNR C;  2R6G A;  4DR3 L;  3DUZ A;  1NJI C;  2F3V A;  2EYP A;  2V1C C;  3WOF A;  2AHO B;  2CWA A;  4TVA B;  1VQH A;  4X65 L;  1KAA A;  3Q6S A;  2G9H D;  4FXK C;  5EGT A;  3STB D;  1QIL A;  1SEB D;  3CCJ A;  1VS0 A;  3CP0 A;  5FLX c;  2WII B; 
#chains in the Genus database with same CATH homology
 4LF5 Q;  3PCO B;  2KHI A;  1J5E L;  4C3H H;  4A3K H;  1SR3 A;  3ZJY C;  3OYY A;  2A1A A;  1BBU A;  1NY4 A;  4GOP C;  2OQ0 A;  5DLQ E;  1XPU A;  2WP8 J;  1LTL A;  2LSS A;  3CPF A;  1I94 Q;  1VQO A;  3GTO H;  3BJU A;  3LGJ A;  4A3B G;  2KCT A;  2BH2 A;  3HOZ G;  3UDF A;  3H3V I;  5IP7 G;  2N78 A;  4C3J H;  1YHQ A;  1BBW A;  4DPG A;  1A8V A;  1QZG A;  4DR2 Q;  4OWW B;  1CKO A;  4P71 A;  1PH2 A;  4B3T L;  4JBM A;  4JOI C;  1VQK A;  3KFU A;  4PMW A;  2Z6K C;  4IO9 A;  1M90 C;  2UU9 L;  2GN5 A;  3KF6 A;  5IP9 G;  1K0R A;  2IHE A;  4YHH L;  5C0X J;  4GS3 A;  2N8N A;  2AMC B;  3HOU G;  2NZH A;  3G6E A;  3PO2 G;  1Y14 B;  4EX5 A;  4P72 A;  1YIJ A;  2E5L Q;  3CF5 A;  5IYC G;  3HOX G;  4R4C A;  1NE3 A;  4ALP A;  4DV1 L;  1PV4 A;  1JB7 A;  2JA5 G;  2D0P A;  1FJG L;  4DR4 Q;  4X6A H;  4BBR G;  5C4J H;  3JAM c;  2Q2I A;  3M7N A;  2NVY H;  4JC0 A;  2UXC L;  1PH8 A;  4IPH A;  4R4Q A;  1VQ6 A;  3EN2 A;  1QUQ A;  3D31 A;  4X62 Q;  5M5X H;  1OXV A;  5HY6 A;  3PUW A;  4B3R Q;  3HOZ H;  1CKN A;  1TWC H;  5IP7 H;  4QGU A;  1YJW A;  3TRE A;  3EIV A;  5FLX c;  1OXU A;  1MJC A;  2LXJ A;  2F4V Q;  5M3F G;  3HKZ G;  2VQF L;  2IY5 B;  4X66 Q;  1IBM Q;  4OWT B;  4DUY Q;  1K73 C;  2PQA A;  4DV6 L;  2YYZ A;  3F2B A;  2Z0S A;  3I55 A;  3S17 H;  2UXD L;  1U0L A;  3J81 i;  4POG A;  4LF8 Q;  2MNA A;  4UP9 A;  5FLM G;  1PH9 A;  2IX0 A;  1L0W A;  3STB C;  3I7F A;  4X64 L;  4B3M L;  3HOU H;  1E1O A;  2OTL A;  3T1H L;  1N32 Q;  4AIM A;  2ZJP A;  3S15 H;  1VQB A;  2NN6 G;  4R1J A;  1C0A A;  3CCM A;  1AH9 A;  1XMQ L;  3GO5 A;  2JA6 G;  3KJP A;  2DGY A;  2I0Q A;  3HOW H;  1HNX Q;  4BBS G;  3M4P A;  3K81 C;  2EIF A;  4GLA C;  1TWH H;  4DV3 L;  3U50 C;  3T1Y Q;  1IBL L;  1EFW A;  4OX9 L;  1Q12 A;  3M9B A;  1XNQ Q;  1Q86 C;  2E2H H;  4LFB L;  4NXM L;  3D0F A;  3UDI A;  1NMF A;  4JI5 Q;  3HOV G;  3SGI A;  1WJJ A;  3J80 c;  4JI8 L;  2WAQ G;  2UXB L;  1A0I A;  5HGQ A;  5GRO A;  3L2P A;  5M3F H;  4AQY Q;  3S1M H;  2R93 G;  1P16 A;  2GVA A;  2CFM A;  2ATW A;  2AKW B;  3TS0 A;  2UUC Q;  2HT1 A;  4X65 Q;  1VQA A;  5AJ3 Q;  3S16 H;  4HJ9 A;  3RN5 A;  1K83 H;  4JYA L;  3I4N G;  4OO1 I;  3KF6 B;  5FJ8 H;  5IWA Q;  2PMZ E;  1I3Q H;  2JA9 A;  4MTN A;  1IZ6 A;  1UWV A;  4QJF A;  3K0X A;  3TEH B;  5FLM H;  3RLF A;  4LNQ A;  3CD6 A;  3S1N H;  3L0O A;  3TS2 A;  3PUY A;  4IOA A;  4L5Q A;  1N33 Q;  4R4T A;  4UP8 A;  3G4S A;  2DUD A;  1GD7 A;  4LF4 L;  3PV0 A;  3S2H H;  4JI6 L;  3H3V H;  5IY0 A;  2JA6 H;  1G6P A;  4LFC L;  4YWK A;  1FGU A;  1SN8 A;  1Y1W G;  1YNX A;  4LFA Q;  1Q82 C;  1N34 Q;  2K50 A;  2E2J H;  4BBS H;  4POF A;  4A3I H;  2B3G A;  1X3F A;  4QQB X;  3H0G G;  4LF7 L;  4JI0 L;  1YZ6 A;  1QUQ B;  1PYS B;  5GAE C;  1XJV A;  3CC2 A;  3S1R H;  1X3E A;  2ZJQ A;  1CKN B;  4LUO A;  1VQC A;  4A3G G;  4DUZ L;  1KIX A;  2ALY B;  2A8V A;  2ASB A;  3DM3 A;  5LMU Q;  4KI0 A;  5J3B A;  2JEA I;  2AWN A;  4ME3 A;  4LUZ A;  2HIX A;  2K5H A;  4YY3 L;  3GTJ H;  3OW2 A;  1SRO A;  3G71 A;  5LMN Q;  4DAM A;  4A4I A;  3UE1 A;  2PQA B;  3CXC A;  4A93 H;  1K8A C;  2VUM H;  4XTC S;  3PO3 G;  1HNW L;  1LYL A;  5M5W H;  5C4X G;  4JI1 L;  4A3D G;  4HIK A;  2ZM6 Q;  1DGS A;  4A3J G;  1CSQ A;  2N49 A;  1X56 A;  4AYB G;  2ZTD A;  4HID A;  3GTM H;  1EWI A;  1HR0 W;  4DR1 L;  4JG2 A;  3B6Y A;  3PIP A;  1K3R A;  4K0K L;  4B3S Q;  3RLO A;  3W5O A;  1HNZ Q;  4AH6 A;  2VQE L;  1Y1W H;  2K52 A;  4L5S A;  5JEA J;  1VQ9 A;  2Q2T A;  3CCR A;  3H0G H;  4OON A;  1EQQ A;  1PH3 A;  2KCM A;  1OXX K;  2R7F A;  4OXP A;  5LMN W;  2B63 G;  3HOY H;  1QVF A;  2NN6 I;  2E8G A;  3L7Z C;  4OO1 G;  3U58 A;  2IT1 A;  4A3G H;  2QEX A;  1XNR Q;  2HQL A;  5GAG C;  1X3G A;  4HJ5 A;  2Q2U A;  2C35 B;  3VDY A;  1WYD A;  2K5V A;  3A5Z B;  1PH5 A;  3W1G A;  1TWF H;  4DV6 Q;  4DR6 Q;  3J7Z C;  4DR7 L;  3I4M H;  4L5R C;  3DLL A;  4PZ8 A;  3RLN A;  1Q1B A;  5C4X H;  3RNU A;  4JBJ A;  4A3D H;  5JJL A;  2L15 A;  3CW2 C;  4A3J H;  4X64 Q;  4B3M Q;  4WJ4 A;  4JI3 Q;  2WFW A;  2R7Z G;  4KHP L;  3JAM i;  2JA7 H;  3T1H Q;  3FKI H;  5JJK A;  1KD1 C;  1IXR A;  2RCN A;  2F3I A;  1Y1V G;  1E22 A;  1VQG A;  1QZH A;  4P75 A;  3AFQ A;  1OXS C;  2ES2 A;  4DV3 Q;  1CUK A;  3PGZ A;  5GAD C;  4OX9 Q;  4GKK Q;  4KHZ A;  3ULJ A;  3CQZ H;  5BR8 L;  2I5H A;  4NXM Q;  3NEM A;  4BA2 I;  3F8T A;  2B63 H;  4A3B H;  4NB3 A;  2K75 A;  3AEV A;  4JI8 Q;  4EQ5 A;  2NVQ H;  1XPR A;  2D62 A;  1PH4 A;  1FL0 A;  2AWO A;  4JI7 Q;  2FXQ A;  1VQJ A;  4GKJ L;  1J6Q A;  2R92 G;  3M4Q A;  3GTP H;  2HHH Q;  4LF6 L;  2RHQ B;  3UDG A;  3RR5 A;  5GAH C;  1IYJ B;  1VQ8 A;  2KHJ A;  3UE0 A;  1NMG A;  3A0J A;  4GLV B;  3KJO A;  5IP9 H;  1KRT A;  1N36 Q;  4JI2 L;  3A5U A;  4DV5 Q;  1E3P A;  4DV7 Q;  4HJ8 A;  4LF5 L;  1RL2 A;  2JQO A;  4LF4 Q;  2JA8 G;  1HZC A;  4JI6 Q;  3PO2 H;  3CC7 A;  1I94 L;  3NEL A;  1W3S A;  2CQO A;  5IYC H;  3UDX A;  3CAM A;  3HOX H;  2N3S A;  2JA5 H;  4A3M G;  1S72 A;  2PNH A;  1IBK Q;  3IRB A;  3J80 i;  4IFD I;  4BBR H;  4DV0 Q;  3E9I A;  3GDE A;  2VW9 A;  2YTV A;  2UUA Q;  2OTJ A;  5C3E G;  3J7A 5;  2B29 A;  2WB1 E;  2YV5 A;  4UY8 C;  4DR2 L;  4DV2 Q;  1VQP A;  1ASZ A;  1UE5 A;  4IJL A;  4DR3 Q;  2MO1 A;  3ERS X;  3K7U C;  5E7N A;  1V9P A;  2R92 H;  4DK3 C;  3CCE A;  3CCS A;  1HJP A;  4DV4 Q;  4NXN Q;  4HIM A;  4DK6 C;  3OTO Q;  3ICE A;  4HJ7 A;  3K8A A;  1WI5 A;  1EUJ A;  1V43 A;  4BY7 G;  1L2F A;  1SLJ A;  5M3M G;  2E5L L;  3S14 H;  4DR1 Q;  1XPO A;  3CME A;  4J15 A;  4DR4 L;  4WJ3 M;  3A74 A;  5IYD G;  3J81 j;  4K0K Q;  2MFI A;  4A75 A;  1N9W A;  1WCM G;  3JC6 6;  1EOV A;  1J5E Q;  1VQ5 A;  4R4O A;  2A19 A;  2E2I H;  1SFO H;  4A3M H;  2VL6 A;  4B3R L;  4A3C G;  1EIF A;  1I5F A;  1VQE A;  2CWP A;  3E0E A;  3CCQ A;  2F4V L;  4A3F G;  1KQS A;  1X55 A;  1AE2 A;  3BZK A;  4QY7 A;  3M4O H;  1B7Y B;  5C0X G;  1IBM L;  2CCZ A;  1PHJ A;  2UUB L;  3HOV H;  4DUY L;  1VQL A;  2JEB I;  1FVI A;  1E1T A;  1P8L A;  1PFS A;  4LUV A;  3I56 A;  4MZ9 A;  4RG1 A;  1WFQ A;  1N8R C;  3KLW A;  4B3T Q;  4DR7 Q;  1KHI A;  2R93 H;  1YBY A;  2Y0S E;  1WOC A;  3BZC A;  1UEB A;  1Z47 A;  4QIW E;  4BY1 G;  1YIT A;  1KC8 C;  3EBE A;  2UU9 Q;  3AQQ A;  4LWC A;  3NBH B;  3F2C A;  3I4N H;  3KYH C;  2YTX A;  1N32 L;  4A3K G;  5M3M H;  4YHH Q;  4UPA A;  1L1O A;  4IFD G;  2KBN A;  3Q8D A;  1SRU A;  1KRS A;  4IOC A;  2D0O A;  5JJI A;  2XGT A;  1VQ7 A;  3ULL A;  2I5L X;  4YWL A;  1HNX L;  1GO3 E;  2ID0 A;  2MQH A;  4DV1 Q;  3GTQ H;  4IPG A;  3T1Y L;  1FJG Q;  4O2D A;  1LUZ A;  1TXY A;  2R7D A;  2ZTC A;  1XNQ L;  1X54 A;  4A3C H;  4A3E G;  3I4O A;  5BR8 Q;  2UXC Q;  4JI5 L;  3CCV A;  4GNX C;  4Y7N H;  1O7I A;  5M5Y H;  4TQU S;  3CPW A;  1KAW A;  1Q8K A;  1GM5 A;  4DNI A;  1K8G A;  3MEF A;  2ZTE A;  1X65 A;  2F52 A;  1ASY A;  1NBW A;  2JE6 I;  5AJ3 L;  2VQF Q;  1PA6 A;  4JV5 L;  1D7Q A;  1VQF A;  4LF6 Q;  5IWA L;  4JI4 L;  4BY1 H;  1VQD A;  3KDF A;  4BA1 I;  1Q81 C;  2UXD Q;  2VNU D;  4JCV E;  4LF9 L;  1IL2 A;  1N33 L;  1MIU A;  4QL5 A;  3PO3 H;  4JI2 Q;  1XTD A;  2CKZ B;  4LW1 A;  1B70 B;  1B8A A;  1UE7 A;  3TRZ A;  3E9H A;  3PF5 A;  4DR5 L;  1TWG H;  3F1Z A;  4HIO A;  1C9O A;  1S3O A;  2I5M X;  5IYB G;  3PIO A;  1N34 L;  4LFA L;  1PH7 A;  2QGQ A;  1HR0 L;  4IPC A;  1I50 H;  3ER0 A;  2Q2H A;  1XMQ Q;  1JJ2 A;  1MKH A;  2OCE A;  3GD7 A;  3WWV A;  4HJA A;  1EQR A;  2K14 A;  1IBL Q;  4A3E H;  1U5K A;  1M1K C;  3PSI A;  1YJ9 A;  1VCI A;  1XMO L;  3GTK H;  5LMU L;  4LFB Q;  1A62 A;  2YTY A;  2OWO A;  3RZD H;  4BXX G;  1GVP A;  1PYB A;  5LMN L;  5ELN A;  4GNX A;  2UXB Q;  1SMX A;  1A63 A;  3M85 A;  1YHB A;  3AFP A;  2BA0 A;  1YEZ A;  5IT9 c;  1GKH A;  1UE6 A;  2ZM6 L;  1TWA H;  3S24 A;  3W1B A;  3GTG H;  4P73 A;  4JYA Q;  5GQO A;  3K80 C;  1JJC B;  1LM0 A;  3HKS A;  3HKZ E;  1AE3 A;  5C0X I;  4APV A;  2RHS B;  2BA1 A;  4R4I A;  3MXN B;  2JK8 A;  1L1O B;  4B3S L;  3H15 A;  1HNZ L;  1JT8 A;  1VQ4 A;  2R7Z H;  1K9M C;  3HOW G;  2IX1 A;  5IYB H;  2RF4 A;  4YCV A;  3HFZ B;  4GOP A;  1Y1V H;  1JMC A;  4LFC Q;  4IFD J;  3PF4 A;  3KOJ A;  5C44 G;  1JE5 A;  1G51 A;  3ULP A;  4UP7 A;  4LF7 Q;  1X9N A;  4JI0 Q;  1X6O A;  2OQK A;  1VQM A;  1XNR L;  2UUB Q;  4DAY B;  4BXX H;  1VQN A;  4DUZ Q;  1H95 A;  2XTI A;  4MNO A;  4DR6 L;  5IE8 A;  1T9H A;  1EIY B;  2VY3 A;  3U4Z A;  1E7Z A;  4JBW A;  1KL9 A;  2EXD A;  4XIG S;  4YY3 Q;  5FJ8 G;  2QA4 A;  4JOI A;  3KDF B;  1S40 A;  3PUV A;  1C7Y A;  2Z6K A;  4JI3 L;  4JBK A;  1HNW Q;  3G48 A;  1L1O C;  1HZ9 A;  2BH8 A;  2WAQ E;  4JI1 Q;  5JEA G;  4FDB A;  2LXK A;  4GN3 B;  3CCL A;  4PZ7 A;  2JJQ A;  1Q7Y C;  4H02 A;  3NEN A;  4NPS A;  1YI2 A;  3J81 c;  1RIP A;  4PZ6 A;  3S1Q H;  1OTC A;  2WB1 G;  4A3I G;  1QVG A;  2JA8 H;  4GKK L;  2PI2 A;  3TQY A;  2VQE Q;  1NTG A;  1HZA A;  1BKB A;  3KF8 B;  2H5X A;  2GVB A;  1SE8 A;  4X62 L;  5C44 H;  4IPD A;  4YCW A;  1PH1 A;  4C2M H;  4RMF A;  3CC4 A;  1YHA A;  3AYH B;  2PI2 E;  4A3L G;  1CSP A;  2IHF A;  1R9T H;  1BVS A;  2HIV A;  5C3E H;  1E24 A;  1PH6 A;  4JI7 L;  2VS1 A;  1EYG A;  4A93 G;  1YJN A;  3CCU A;  4X66 L;  1MJE A;  2VUM G;  2HHH L;  4JV5 Q;  4GNX B;  1Z9F A;  3PUX A;  4OWX B;  4JI4 Q;  1UE1 A;  1Q46 A;  4GN4 B;  4YCU A;  1CKM A;  4YWM A;  3CMA A;  2KEN A;  3K7A H;  2VZA A;  4LF9 Q;  4IJH A;  1N36 L;  1D8L A;  1V1Q A;  5ELO A;  4DV5 L;  4DV7 L;  4LF8 L;  4Y52 H;  5EAY A;  3I2Z A;  4BY7 H;  2YU9 H;  4DR5 Q;  2K4K A;  4KHP Q;  1G29 1;  1OXT A;  2EQS A;  3PUZ A;  4PG3 A;  3U4V A;  3S2D H;  3RZO H;  2ZJR A;  1YVC A;  3F2D A;  5K36 G;  1HR0 Q;  1IBK L;  5H1S E;  5IYD H;  1I6H H;  1QVC A;  4P74 A;  4C3I H;  4DV0 L;  1HH2 P;  1W2B A;  1WCM H;  1KXL A;  4AYB E;  4GOP B;  3RN2 A;  3HOY G;  3FP9 A;  1JJG A;  2UUA L;  4L5T A;  1XMO Q;  2Y0S G;  4DV2 L;  2NVX H;  4GN5 A;  3BU2 A;  4A3L H;  4KLK A;  2R6G A;  4DR3 L;  1Q1E A;  1NJI C;  1VQI A;  4A3F H;  2V1C C;  2NVT H;  2MO0 A;  4AQY L;  3I4M G;  3M3Y H;  2AHO B;  4NXN L;  4DV4 L;  4DKA C;  3OTO L;  3GTL H;  2UUC L;  2CWA A;  4O0A A;  4GKJ Q;  4TVA B;  1VQH A;  4X65 L;  1PVO A;  4A76 A;  2JA7 G;  2K5N A;  1HZB A;  3STB D;  3FKI G;  2NZO A;  4GLX A;  3CCJ A;  1VS0 A;  3CP0 A;  3FHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...