3S1QH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1qH00
1MJCA 4JCVE 4Y52H 4IPCA 4LUVA 4LF9Q 2R93G 2WAQE 4L5QA 3UE1A 2VNUD 4KHZA 4GOPC 1EIFA 4GN4B 3TREA 4A3CG 5BR8Q 4DAYB 4BXXH 1JJGA 2R6GA 2A8VA 1WYDA 1Z9FA 5C0XI 4DV2L 2HT1A 2DGYA 4DR2Q 1VQPA 2UXDL 4A3GH 3PO3H 1WI5A 3UDXA 4JYAL 4OO1I 4JV5L 4A3JH 1SR3A 4LFCQ 1IBKQ 1KAWA 1Z47A 2DUDA 5C44H 3TS0A 2K5NA 4B3SL 4GN3B 2ZJQA 4WJ3M 1SN8A 2AWOA 3GD7A 1JJCB 2GVBA 4KI0A 3E0EA 2WP8J 2NZHA 2AWNA 4LW1A 5IYBG 3CXCA 4DUZL 4X65L 4UPAA 2Z6KC 5BR8L 3H0GG 3M3YH 5FJ8H 1XNQL 1AH9A 1VQLA 3DM3A 3AEVA 3EBEA 5IP9G 4DR2L 3NENA 4LF5L 4BY7G 4A76A 3CPFA 1X55A 4PZ8A 1IBMQ 4P74A 1VQAA 2CWAA 1PH1A 1BBUA 1RL2A 2RHSB 3S1RH 3J81c 2JEAI 4HJ5A 1XNRQ 4LFCL 4JI6Q 3PO2H 4DV3Q 4BA1I 4LUOA 5GAHC 3J7ZC 2Y0SE 4BBSH 3J80i 4DR7Q 1B70B 3ERSX 1HZAA 1GO3E 2F4VQ 4LFAL 3S2DH 1HR0Q 2IT1A 3L2PA 3STBC 1YHBA 4Y7NH 4DR5L 1XMOQ 3F2CA 3AFPA 1W3SA 1HZCA 3S2HH 1E3PA 1EQRA 2PI2E 1YNXA 3F8TA 1IBML 2R93H 1GKHA 2K14A 4O2DA 3M4PA 1S72A 4IJLA 4IJHA 4A3CH 3LGJA 1SE8A 1Y14B 4APVA 4A3EH 1PH2A 1HNWQ 4JI6L 5IE8A 5LMNQ 3HOZH 3GTGH 3J7A5 2QGQA 4L5TA 5ELOA 5ELNA 4YCUA 4DV3L 1EQQA 1EUJA 1M90C 1QVFA 4LF7Q 2PI2A 4DV6Q 1Y1WG 1XMQQ 2ID0A 3I55A 1ASYA 4LF9L 2F4VL 2JEBI 1Q7YC 1HR0L 2PQAB 4BBSG 1LYLA 1XMOL 4DR6L 4AH6A 1SMXA 2NVYH 3GDEA 2QA4A 3W1GA 1XPRA 1KIXA 3G6EA 3FKIH 1PV4A 2XTIA 2GVAA 1LTLA 4POGA 2CWPA 2ZJRA 3I4NG 5IYBH 1IZ6A 3U50C 3H0GH 1N9WA 3B6YA 3E9IA 3PO3G 1PHJA 1K0RA 4YY3Q 1HNWL 2KBNA 4R4OA 5LMNL 4JI4Q 5C0XJ 3TEHB 4EQ5A 3KF6B 3MXNB 2ZTEA 1VQEA 2EXDA 1IL2A 3JAMi 4LF7L 4DV6L 4TQUS 1MJEA 3CCJA 4DPGA 1BVSA 5C44G 1I6HH 1YBYA 3PF4A 2MO0A 3PCOB 2LSSA 1PH3A 1L0WA 4DV0Q 5J3BA 4AYBE 5C4JH 2MNAA 3T1YQ 3CW2C 3KJOA 1L1OA 3AFQA 5GROA 3RLNA 2BA0A 1GM5A 4L5SA 4DR4Q 3GTKH 2UXDQ 2FXQA 2N8NA 5FJ8G 4QY7A 3UE0A 3U58A 3KF6A 2IHFA 2RF4A 4YWMA 1WFQA 2A1AA 3FHWA 3PIOA 2UU9Q 1G51A 3S24A 3KFUA 3OTOQ 3JC66 2R7FA 4IPDA 5M5WH 4YY3L 4LF4Q 1LUZA 2L15A 4JI4L 1VQ9A 4PG3A 4DV2Q 3Q8DA 1YI2A 1QVGA 1IBLL 1KXLA 4NXNL 1Y1VH 5C0XG 2HIXA 2OQKA 1OXXK 4MZ9A 2ZM6Q 4GLXA 1ASZA 2K4KA 4B3TQ 3RLFA 3CQZH 4JI5Q 4JBKA 3BZCA 3H3VH 3PO2G 2NVQH 4JOIA 4PMWA 3CC4A 3UDGA 5K36G 1VQOA 1J6QA 1E1TA 3BJUA 2MQHA 3D31A 1WOCA 3T1YL 4JI0L 4DR4L 2RCNA 4JV5Q 2AMCB 1Y1WH 2D0PA 1JB7A 4OXPA 2ATWA 4OO1G 3PV0A 1L2FA 4DK3C 1A0IA 1VQNA 1PH9A 3G4SA 4L5RC 3ICEA 1QZGA 4B3SQ 2UU9L 4UY8C 1SLJA 3OTOL 1B7YB 4P72A 2VQEQ 2NVTH 4GS3A 4LF4L 3CCUA 4DUZQ 4LWCA 5FLMH 1BKBA 3KF8B 4X65Q 2OQ0A 1UEBA 3RLOA 1XNQQ 3I4NH 4A3EG 4DR3L 4A3DG 2ZM6L 5EAYA 3RN2A 3CC2A 4PZ7A 1NJIC 3HOZG 4HJAA 4JI5L 2UUBQ 4A3FG 1JMCA 4B3TL 4LF5Q 5LMUL 3CD6A 3KYHC 2B29A 4R4TA 4UP7A 4JG2A 3HOXG 2N49A 3L0OA 1KL9A 4A4IA 2JA8H 3HOVH 1N34Q 3HKZG 1KQSA 3S14H 1TWGH 3STBD 2VUMH 3CCRA 4TVAB 3FKIG 1UE6A 3MEFA 4NXMQ 3PGZA 3PUWA 2VL6A 4A3IG 1QZHA 1HH2P 4A3KH 2VQEL 2ZTCA 3A5ZB 1E24A 2N3SA 1UE5A 2RHQB 2V1CC 3KDFB 4NPSA 4LFAQ 3JAMc 3CF5A 1VQ5A 1VQ7A 4GLVB 2VS1A 4DR5Q 3RZOH 1GVPA 3KJPA 4DV1L 1YJ9A 3AYHB 4C2MH 1G6PA 2JA5G 3HFZB 2UUBL 1VCIA 4R4CA 4DAMA 1EWIA 4HJ9A 4YWKA 4A93H 4DR1Q 4DNIA 1PH4A 1VQBA 1N36L 1N34L 2NN6I 1TWCH 1Q1BA 4A75A 1VS0A 3KDFA 4X64L 2H5XA 4GLAC 4NXML 4LFBQ 3S16H 3BU2A 2KCTA 3E9HA 1VQGA 1K8GA 5IP7G 1Q81C 3J81j 2E8GA 3K81C 4HJ7A 2B3GA 2MFIA 1YITA 2GN5A 3WWVA 1TWFH 2VQFQ 4DR6Q 1KC8C 4P71A 4MTNA 1BBWA 3I2ZA 4C3JH 2EQSA 2Q2UA 1X6OA 4C3HH 1YJWA 3L7ZC 1E7ZA 4GKJQ 5C4XG 1FVIA 1K3RA 4DR1L 1Y1VG 4MNOA 5M3MG 3CC7A 1IXRA 2JA7G 3ER0A 1G291 2AHOB 1V43A 4A3DH 2WFWA 4JI3L 4A3FH 1HNZQ 4LFBL 4BY1G 4YCWA 4R4QA 3HOXH 1YIJA 5AJ3Q 1GD7A 3S1NH 3F1ZA 1VQ4A 2VQFL 2CQOA 4DV7Q 1PYBA 3S17H 3CCQA 4X66Q 5FLMG 4A3IH 3GTQH 2K52A 1A8VA 1VQHA 4OONA 4A3MG 4DUYQ 4DV4Q 3I4MG 4A3BH 1JJ2A 4GKJL 3CMEA 2BH8A 1R9TH 1P8LA 1L1OB 5C3EG 4IO9A 3CCSA 1DGSA 2JA5H 2OCEA 2E2IH 2CKZB 3NEMA 4NB3A 1HNZL 2UUCQ 2JQOA 2KHJA 1XJVA 2JA8G 3HOVG 1IBLQ 1O7IA 2Z0SA 3KOJA 4NXNQ 2HQLA 5AJ3L 1OTCA 4J15A 4QQBX 2VUMG 3TS2A 1D8LA 4BA2I 2UXCQ 5GADC 1PH8A 3D0FA 1N33Q 1NMFA 4DV7L 1C0AA 4A3KG 4JI0Q 4X66L 1QUQB 1Q8KA 4JYAQ 1A62A 2PMZE 3UDFA 1YJNA 4PZ6A 2UUAQ 1IYJB 5IP7H 4DUYL 4DV4L 5IT9c 4XIGS 3I56A 3BZKA 3A74A 3G48A 1VQIA 3S15H 1WCMG 1M1KC 1I3QH 4JBWA 1CKMA 4JOIC 3K80C 2XGTA 4KLKA 1JE5A 1UE1A 1N8RC 1K83H 4A93G 3ULPA 2UUCL 1TWHH 3OYYA 1V1QA 4AQYQ 3J80c 4JI2L 2A19A 5C4XH 1KD1C 4DR3Q 1QUQA 2YTXA 5E7NA 3U4VA 5M3MH 2JA7H 4AIMA 3PUYA 2UXCL 3M85A 5LMUQ 3CPWA 3CCEA 5LMNW 2KCMA 1N33L 2UXBL 2E2HH 1E1OA 2IX0A 3NBHB 4IOCA 1OXSC 1Q1EA 5IYDG 1X65A 4JBJA 2YU9H 4BY1H 2IX1A 1PH5A 2HHHQ 1YZ6A 3S1QH 3OW2A 2UUAL 5H1SE 1VQFA 3J81i 3GO5A 2NVXH 1UE7A 1U0LA 2MO1A 1K73C 1SROA 2VY3A 3PUXA 1I94Q 3GTOH 5DLQE 4DK6C 1NTGA 3IRBA 4IPGA 1K8AC 1J5EQ 1OXVA 4K0KQ 4JI7Q 1UWVA 1CUKA 2F52A 2WB1E 3U4ZA 2I0QA 4AQYL 3GTMH 3S1MH 4GNXA 4A3MH 3I4MH 1N32L 4QJFA 2E2JH 4DV1Q 1OXUA 2WB1G 2OTLA 5IYCG 5IY0A 3I7FA 1I50H 3AQQA 3FP9A 2BA1A 5C3EH 1XPOA 1B8AA 4FDBA 4JI8Q 3HKZE 1PH7A 1YHAA 1Q12A 2R7DA 3PF5A 3RNUA 3M9BA 1N36Q 2HHHL 4GN5A 3HOYH 2K5VA 1C7YA 3GTPH 2NN6G 2VW9A 4YHHL 3VDYA 4RG1A 4BBRH 4X64Q 1I94L 3K0XA 1KRTA 3ZJYC 2OWOA 4DV5Q 1FL0A 2F3IA 4P75A 1J5EL 4A3BG 4K0KL 3T1HQ 4JI7L 2WAQG 3W5OA 2D0OA 2NZOA 4GKKQ 4IPHA 1X56A 5HY6A 5IWAL 1S40A 1EYGA 3F2DA 2JE6I 1EFWA 1WCMH 2QEXA 4JBMA 3DLLA 2JA6G 2IY5B 3K8AA 4JI8L 4GOPA 2CCZA 3CCLA 2ASBA 5M3FH 1VQKA 3K7AH 1U5KA 4B3RQ 2ZJPA 2C35B 2K5HA 1SRUA 4R4IA 2AKWB 4A3LG 1PYSB 5GAEC 5HGQA 1Q86C 1EIYB 2R7ZG 1OXTA 4JI3Q 2I5LX 2LXKA 3PSIA 1NY4A 4IOAA 1HNXQ 4DV5L 3M4OH 1YEZA 1NBWA 4UP8A 1YVCA 4LNQA 3UDIA 3T1HL 5IYDH 1A63A 3HKSA 1T9HA 4GKKL 1XPUA 1E22A 4O0AA 5M5YH 1SFOH 5GAGC 3TRZA 3CP0A 4LF8Q 1VQ8A 1VQ6A 2Z6KA 2YTYA 4B3RL 1HJPA 3HOWH 4OWTB 1IBKL 4IFDJ 1HZBA 5IYCH 4LUZA 3PIPA 4X6AH 2E5LQ 2N78A 4OX9Q 2B63H 2R92H 1X3GA 3RR5A 1CSPA 1PH6A 1HNXL 1FJGQ 2OTJA 2I5HA 2K75A 2ZTDA 1FGUA 2Y0SG 2CFMA 1AE3A 5M5XH 3GTLH 5GQOA 4X62Q 3RZDH 1CKNB 2KHIA 3CAMA 4LF8L 1NMGA 2HIVA 1JT8A 4DKAC 3W1BA 1VQDA 2VZAA 2Q2HA 5JJKA 3RN5A 1Q82C 5JJLA 2JJQA 1CKOA 1H95A 1XNRL 3GTJH 2JK8A 3CCVA 3HOUG 1TWAH 2E5LL 1L1OC 4JI2Q 2JA6H 4OX9L 1VQMA 1CKNA 1FJGL 4IFDG 4DR7L 1KRSA 2EIFA 2JA9A 4POFA 4EX5A 3HOYG 1PFSA 1D7QA 1X54A 3KLWA 3F2BA 4BBRG 3CCMA 4HJ8A 4A3LH 2BH2A 1K9MC 4OWWB 2UXBQ 4OWXB 1V9PA 1KHIA 1QVCA 4X62L 4HIOA 2R7ZH 4KHPQ 4BXXG 4HIKA 4JC0A 2LXJA 4JI1Q 2YTVA 3H15A 1X3FA 4HIMA 3CMAA 3H3VI 1C9OA 4XTCS 2YYZA 3K7UC 1HR0W 1NE3A 4A3GG 1VQJA 3PUVA 2Q2TA 4WJ4A 1P16A 5JJIA 5IP9H 4YWLA 2PQAA 4C3IH 4BY7H 1YHQA 1PA6A 5M3FG 4IFDI 1N32Q 1LM0A 1EOVA 4P73A 5JEAJ 4A3JG 1XMQL 1W2BA 2I5MX 3A0JA 1HZ9A 4B3MQ 1X3EA 1MIUA 1S3OA 1WJJA 1TXYA 1XTDA 4QL5A 4GNXB 3SGIA 3ULLA 1X9NA 2ES2A 4KHPL 1Q46A 4LF6Q 4JI1L 4GNXC 1AE2A 4AYBG 2ALYB 4HIDA 3NELA 1PVOA 3EIVA 2D62A 4QIWE 5FLXc 4YHHQ 4ALPA 1VQCA 3PUZA 2K50A 4R1JA 3EN2A 3TQYA 4YCVA 2PNHA 5IWAQ 3HOWG 2YV5A 4H02A 3I4OA 3ULJA 3G71A 3A5UA 5JEAG 4B3ML 2IHEA 4QGUA 2R92G 4DV0L 2B63G 3HOUH 3M7NA 1MKHA 4RMFA 1RIPA 2Q2IA 3M4QA 2KENA 4LF6L 1CSQA 4UP9A 4ME3A 1I5FA 4GOPB
chains in the Genus database with same CATH superfamily
1MJCA 1ZKOA 1Y8OB 4LUVA 2RKSA 4CKCA 4LF9Q 2WAQE 4FNFA 4L5QA 1D5MC 1PYWD 4GOPC 2VNUD 2B2WC 4GN4B 4A3CG 5BR8Q 4DAYB 4BXXH 2A8VA 1WYDA 1Z9FA 4DV2L 4I7ZC 2HT1A 1L0YB 4DR2Q 1VQPA 1GXDC 1F9RA 3UDXA 4KKSA 3F2UA 2Q8TA 4OO1I 4K2KA 3KF8A 3DM1A 4LFCQ 5IT9E 2FMCA 5FOBB 2AWOA 4LF9L 1JJCB 3E0EA 2WP8J 4DUZL 3CXCA 2B2VC 4UPAA 5BR8L 3DWPA 4BY7B 4V190 1VQLA 1HUNA 3ERQA 3EBEA 4RGMA 4DR2L 4LF5L 4BY7G 4K8IA 3VYTA 1CZWA 4LFCL 1EY8A 1NNXA 4LUOA 2Y0SE 1TS4A 3ERSX 2F4VQ 2K5DA 3S2DH 1HR0Q 1EY0A 4OO1H 4DR5L 5EPKA 1W3SA 2F0PA 3SXHA 2PZTA 3AMUA 2EYMA 3IFDA 3MFGA 4A3CH 5IIFA 3I8ZA 1Y14B 4APVA 5LMNQ 3SDZA 5ELNA 4YCUA 1QVFA 4UHVA 1XMQQ 3I55A 2EE1A 4QUCA 2F4VL 2JEBI 2B8FA 1HR0L 1SMXA 4IZ8A 5CV4A 2GVAA 1LTLA 3PO3B 1O78A 3DWQA 2CWPA 4POGA 3MZ5A 4DGZA 1HUMA 1IW7C 3B6YA 3PO3G 2DN8A 2KBNA 5LMNL 1XYIA 1K3BC 2EY1A 5C44B 1UUPA 1VQEA 3MWYW 3A8IE 4IALA 1MJEA 2B2YA 1I6HH 5C44G 3PCOB 2KVMA 1B53A 1YNJC 2PMZB 5GROA 3RLNA 4IUNA 1FYCA 1SXTA 3GTKH 5FJ8G 4K6DA 2IHFA 4G7ZC 1G51A 3OTOQ 4IPDA 2A68D 1KXLA 4XDXA 1NSNS 2HIXA 4F88A 4GLXA 1ASZA 3H3VH 3RLFA 4F8MA 2CQAA 1I4RA 1WTPA 3UDGA 4JI0L 1E1TA 1QNUA 2AMCB 4OXPA 2ATWA 3PV0A 4L5RC 1R4QB 1QZGA 1UAPA 4UY8C 3OTOL 3J80L 2F0JA 2EPBA 4OL7A 4A3DG 3RN2A 2EY2A 4PZ7A 5LMUL 3CD6A 2B29A 2RQXA 4UP7A 2NVYB 1I4PA 3L0OA 3FKIB 4A4IA 2JA8H 1MHWC 3EA6A 1N34Q 1KQSA 1WD0A 3GTQB 3CCRA 1FR3A 3FKIG 1UE6A 1PTOH 1BOSA 1HH2P 1G8ZD 4FF2A 2EXZA 2ZTCA 3S9WA 3AYHB 3MTSA 1EWIA 4ME5A 4DR1Q 2K7VA 1N36L 1N34L 1MSHA 3BG3A 2PNRC 2HD3A 5C4HA 1ILPA 5ELBA 1VF7A 4N8X1 2PQEA 1SNCA 5M5WB 1D5XC 1ZYRD 3J81j 3K81C 1EZ6A 4CDEC 2B3GA 1YITA 1IL8A 4P71A 4MTNA 5JAVA 2Q2UA 1X6OA 3Q23A 1VDZA 4C3HH 4GKJQ 4DR1L 4MNOA 5E4WC 2JA7G 1G291 4A3DH 4JI3L 3UI2A 4B9WA 1WTVA 1IKMA 1PRTD 5AJ3Q 3BDOA 3IL8A 4L63B 3RMHA 3F1ZA 4DV7Q 2EJFC 2XSCA 5FLMG 1IKLA 3ND9A 2EY6A 3GTQH 1VQHA 4GKJL 2L4NA 2IJ0A 1PLFA 4MIUA 2J0TD 5FK9C 3GQBA 1R9TH 2QDLA 3HOVB 3CCSA 5I4DA 1TWGB 3NEMA 1F2YA 1XXGA 3TDQA 5M9OA 3HOVG 1Q8IA 5AJ3L 4FVMA 4J15A 4QQBX 1D8LA 3EVQA 3AB9A 3RZOB 4DV7L 5JVG3 1AZQA 4C2MB 1B50A 3T51B 2TMPA 2BCOA 1VQIA 3Q0AA 3N6RA 3CRKC 1N8RC 2NTSA 3ULPA 4LK1C 3BYYB 4DR3Q 1QUQA 3U4VA 2JA7H 2KCMA 1E1OA 3NBHB 1SMYD 3MEHA 2H4OA 4YIJA 1G6ZA 3S1QH 3FVQA 2YU9H 2CH4A 2DY7A 1LV9A 4IUUA 3J81i 1ICWA 3NQTA 4P2CB 4C1NK 4IN3A 5D65A 4DK6C 3IRBA 4IPGA 5EJWA 1J5EQ 4K0KQ 3W2DA 2WB1E 3HEJA 4A3FB 1C8CA 5EQ0A 3AQQA 2BA1A 3NXWA 1YHAA 3S17B 1Q12A 3RNUA 1CZGA 3HOYH 1E2VA 2K28A 2ZT9C 2NN6G 4A3BB 2C5CA 1SMYC 2SNSA 2A6ED 4DV5Q 2RSNA 4HEDA 4ZUIA 4A3BG 1J5EL 4K0KL 3T1HQ 2E2IB 2WAQG 3P75A 2NZOA 1KNEA 1S40A 2WIIB 1SSOA 1SJED 2IY5B 1BUVT 5M3FH 1VQKA 3MAQA 2WKDA 2K5HA 3T53B 4A3LG 5GAEC 5KNCA 1BCPD 3MXGA 1L0XB 2R7ZG 1X3QA 2R3ZA 3S15B 4DV5L 3M4OH 2LFNA 2BOSA 5CMDA 3T1HL 4LNQA 1TWHB 3TZDA 4CDCC 5C4XB 2PW5A 5M3MB 1PXUA 1DCZA 3C2PA 1EY6A 1VQ6A 2RCFA 1IYVA 4I65A 1IBKL 2C9OA 3I73A 4X6AH 2Y0SB 2E5LQ 2R92H 2B63H 1DXMA 2KECA 1CSPA 2OTJA 1JR0D 1FGUA 2Y0SG 3NE5B 5T1IA 5M5XH 3GTLH 4A3MB 2NN6H 1CKNB 4X3TA 4QF4A 1EIGA 2HIVA 5C3EB 3W1BA 5JJLA 4IUQA 4KV6A 3GTJH 1XNRL 4J1MA 3IFTA 1TWAH 2E5LL 1ESRA 1L1OC 4DN4M 4BBRB 4POFA 1S4ZA 3JAME 2AQ2B 2IPKD 3BYTB 2CH4W 3F2BA 2RBMA 4BBRG 1MD2D 4A3LH 1STAA 2UXBQ 3A56A 4HIOA 4RKLA 2R7ZH 4KHPQ 1SEBD 4JPBW 1QCBD 4HSPA 1C9OA 2YYZA 5JJIA 3MFYA 2PQAA 1SYDA 3QO2A 1LM0A 1EOVA 4XT1B 2I5MX 1QE6A 2JSOA 3NK9A 1HPCA 1TXYA 1XTDA 2JXMB 3SGIA 4HCEA 5ELDA 3SR1A 5T1GA 3E6ZX 1LTSD 4KHPL 4HIDA 3QG1A 2NWGA 3V2TA 2F0UA 4QIWE 5FLXc 4YHHQ 2EJGC 1K8OA 3A54A 4CKBA 4DF7A 3EN2A 1CHQD 4YCVA 2B2TC 4H02A 1B2TA 1ONLA 5LHY1 2D9UA 5FLXL 4UP9A 3DEOA 3V05A 1STGA 4Y52H 2B2UA 1RF2D 1LT4D 1BNZA 5C0XI 2JA6B 4GZYC 2UXDL 1J9OA 1ML0D 1ET9A 4ID6A 4JV5L 4DAPA 1MSGA 1Z47A 3FEWX 2DUDA 2ZJQA 4WJ3M 1SN8A 3G7LA 2NZHA 2AWNA 1K28A 2F3VA 4X65L 3H0GG 5EKKA 4NMZA 1XNQL 1EEFD 2Z6BA 3NENA 1D1IA 4KJOA 1Q3LA 1X55A 4P74A 5I9PA 4KTAA 1CTMA 2CWAA 1PH1A 1BBUA 2SNMA 2RHSB 3S1RH 5KEEA 5C0XH 4HJ5A 5KIXA 1Q90A 3PO2H 5GAHC 4MHEA 3J7ZC 5IOCA 1FNWA 3QB3A 4BBSH 5I6WA 4DR7Q 3DUZA 1GO3E 4LFAL 4Y7NH 4S3SA 1VF5C 1SNDA 2XNAC 1U9RA 1LTBD 1W6JA 4ABNA 2K14A 4KD4A 2X69A 1KNAA 3M4PA 1XTCD 4IJHA 3FPPA 3LGJA 1EL0A 1SE8A 4CGYB 5EBDA 4A3EH 1PH2A 1G91A 1JC7A 3MA2B 1Y1WB 5IE8A 3J7A5 3E5SA 1CM9A 4L5TA 5ELOA 3TP8A 4BBSB 2J4XA 4LF7Q 2K05A 1Y1WG 3SEBA 2ID0A 5IGBA 4BBSG 1LYLA 4RKBA 3GDEA 2QA4A 3I4NB 3W1GA 1XPRA 3MXPA 1JWMD 2A73B 4DNRB 3I4NG 3H0GH 5FO7B 3GV3A 1PHJA 2DNCA 1ENFA 4RGTA 1EQVA 4JI4Q 1W6KA 3TEHB 1GOZA 1FGBD 2ZTEA 4F87A 5A2QE 1IL2A 4LF7L 4OIJA 1S5BD 1LTAD 2CW0C 3G6JB 1PH3A 3SVMA 5J3BA 1TQOA 4KKTA 4AYBE 4UDUC 3KJOA 1L1OA 1GM5A 2BA0A 2FXQA 1KLUD 2N8NA 2CVRA 2WV6D 2UU9Q 3S24A 1LUZA 4JI4L 1VQ9A 1B9MA 1OO9B 4DV2Q 2K1BA 2EYHA 1Y1VH 1T5EA 4JBKA 3KLSA 4B3TQ 5KRUA 3CQZH 4DU9A 3S2DB 1BXTA 5IT9L 1VQOA 3D31A 1SNMA 4RCNA 1WOCA 2EY5A 2RCNA 1Y1WH 2D0PA 1A2TA 4OO1G 3ICEA 3OMCA 2F0TA 4HSVA 4ZAIA 1KABA 2QCPX 4FP5D 2UU9L 1TKWB 2NVTH 4GS3A 4KY7A 3CCUA 4DUZQ 5L37A 4HN7A 3I4NH 3A7LA 3LWEA 4HJAA 4B3TL 2PPBC 4LF5Q 1NR4A 4R4TA 1GUNA 1KL9A 1TY0A 1JOOA 1STYA 2F0KA 2VUMH 2AQ3B 4PMCA 1PRTF 4TVAB 3PGZA 2RA4A 2A6HC 2GA4B 4A3KH 5LL6S 2JA5B 1E24A 2N3SA 3CF5A 1VQ5A 5I9OA 4GLVB 3QJYA 4XT3B 4DR5Q 2LMCB 1GVPA 1WTHA 4DV1L 1YJ9A 2JA5G 4E6IA 1I6HB 4HJ9A 4R4CA 4YWKA 4A93H 2O2LD 5HURA 5FO8B 1TWCH 2L11A 1SBBB 1EY5A 4A75A 3GTKB 4FXDA 4RFBA 4WFN3 3PIP3 3NWTA 4GLAC 3S16H 3E9HA 4HAEA 5IP7G 3WWVA 1KC8C 4K5VA 2SDFA 1IW7D 4LJZC 3J7YW 3BDCA 4U68A 3LX0A 1FVIA 3H3VC 1IXRA 2AHOB 4K5XA 1FNVA 5C3XA 1O80A 2I07B 1CK1A 1HNZQ 1YNJD 4R4QA 3TP7A 1GD7A 3I91A 1HTLD 5EBCA 3S1MB 2WINB 3Q24A 5CV7A 1JWUD 2K52A 1KTKA 4DUYQ 4Z9CB 1JJ2A 2BH8A 2JA8B 2F0FA 4IO9A 2JA5H 3GTPB 1HNZL 1HHVA 2JQOA 2JA8G 1PTOB 4HR7B 4NDXA 4OGQC 2O5IC 1HFGA 1O7IA 2Z0SA 1CA6A 1OTCA 1PTOC 3TS2A 4BA2I 4EVOA 1SDFA 2NUCA 1PH8A 3J7AV 2K03A 2UXCQ 4R8NA 1C0AA 5EKIA 4F7XA 4JI0Q 1ET6A 1QUQB 1Q8KA 3UDFA 4I7AA 4H44C 1EWHA 2UUAQ 5IP7H 4G7OC 4DUYL 4EGVA 1S5DD 3I56A 5D3IB 4O1NA 3RD4A 1SJHD 2E74C 1I3QH 4JBWA 4JOIC 3K80C 5CYUA 1M8AA 5E3FA 2M2LA 3J80c 4JI2L 1SE3A 2DY8A 2KQ3A 2L9HA 1I4QA 2RDGA 1S5FD 4DA2A 4AIMA 2UXCL 3M85A 5LMUQ 5LMNW 2G9DA 2HQEA 3ITPA 2A5HA 4IOCA 4NW2A 1BCPF 5IYDG 2IX1A 2HHHQ 1YZ6A 4C3HB 3OW2A 4QIWB 3VR6A 2UUAL 2MO1A 1U0LA 1SROA 5DLQE 4C3HG 2NYZD 4A3DB 4IUTA 4JI7Q 3S1MH 1I4HA 4PV1C 5IY0A 3R2IA 2PYKA 1I50H 1JOKA 1M4VA 1XPOA 2ICIA 2BE5C 4FDBA 4XYOA 4JI8Q 3HKZE 1TS3A 4IUPA 1N36Q 2HHHL 2OF1A 3IAYA 3GTPH 2VW9A 3M4YA 4KN7C 3ZJYC 1KRTA 1TR5A 1R9TB 1FL0A 4P75A 2XIWA 4JI7L 1ENAA 5DAUA 4GKKQ 1X56A 5HY6A 5IWAL 1EU3A 1EYGA 4DAVA 4B08A 4EQNA 1CT1D 1EFWA 4JBMA 3LWUA 4JI8L 4GOPA 3CCLA 2B2WA 2ASBA 5A35A 3K7AH 3VYRA 2A74C 2ZJPA 4B3RQ 2AKWB 4DAYA 1I6VC 4U673 1RHPA 2CHBD 1DZ1A 1Q86C 4JI3Q 2I5LX 3T4AC 2F0NA 4LMQD 3PSIA 1GUWA 1NY4A 1SYCA 5KNDA 3E3XA 5F2DA 1YEZA 1H9MA 1NBWA 5IYDH 3UDIA 3TP5A 2F0SA 4C3IB 3J80E 3HKSA 1T9HA 1SYEA 4GKKL 1DJRD 5D14A 1SFOH 4C3IG 3TRZA 2JA7B 2F0OA 2L0CA 5ISRA 4LF8Q 1VQ8A 2TSSA 3K57A 5ELCA 2F0GA 2B2VA 3NWSA 2YTYA 1AEXA 4B3RL 4ZQ3A 3S1QB 2YU9B 1LTTD 4LUZA 1PFNA 2IWHA 3TMEA 4FO2A 1X3GA 3R2TA 5KNBA 1WTOA 4H0LC 1D6EC 1PZKD 3RZDH 2PZUA 2KHIA 3HGBA 1SYGA 1DOLA 4LF8L 3J81L 4DKAC 3HOUB 5JJKA 2Q2HA 3NUCA 2JJQA 2OXPA 1H9SA 1CKOA 1FNUA 3EJIA 4DFAA 3HOUG 3CCVA 3HOYB 4EQPA 2O5JC 1I4GA 1VQMA 3HOYG 4O42A 1SNPA 3CCMA 1V9PA 1JOQA 3D8GA 4CJ2C 1EWCA 4HIKA 2LXJA 3H15A 4N8FA 1X3FA 4HIMA 2BDNA 5G3LD 3K5LA 3DWAA 3K7UC 3VYSA 1NE3A 1PFBA 3PIO3 5M3FB 4A3GG 4WJ4A 1P16A 3OWEB 5IP9H 4A3JB 3L9AX 4C3IH 5M3FG 1FD7D 1PDQA 3AU7A 4P73A 4A3JG 1LO5D 1O7LA 2KCCA 3A0JA 4ULLA 3M4OB 1EZ8A 1HZ9A 3ONAB 1S5ED 1WJJA 1KLGD 4GNXB 4XQJA 1DOMA 5I2YA 4GNXC 4AYBG 1UNSA 2ALYB 2MGSA 2AUJD 1VQCA 3PUZA 2D2CC 4FXKC 2DJFC 4R1JA 1HA5A 2R92B 2B63B 2YV5A 3G71A 3A5UA 1NCVA 2IHEA 4QGUA 5M5XB 4DV0L 1XWEA 2B63G 2R92G 3HOUH 4RCOA 1LABA 3GTLB 1RIPA 2P5ZX 3OHXC 1QOHA 2WAQB 4IPCA 2R93G 1EOTA 2F0WA 1EIFA 3GTJB 1BF4A 5JVH3 1TWAB 4A3GH 4JVZA 1J8IA 4CJ0B 5CBAE 4V0BA 2R7ZB 2F0VA 1QNKA 4A3JH 1LTRD 1IBKQ 3E0JA 3TS0A 4B3SL 4GN3B 5BN3A 4LW1A 3GD7A 2GVBA 2Z6KC 3HZXA 3M3YH 2E2DC 1F77A 1AH9A 3DM3A 2XWBB 1QB5D 1SE2A 3C3LA 1IBMQ 5CGKA 3NHHA 2VXWA 1CA5A 1RL2A 2JEAI 1U4LA 1Z6HA 1XNRQ 4JI6Q 4DV3Q 4DXFA 3K5MA 1F2MA 1B70B 4BS9A 1HZAA 5J22A 3GP7A 2X6GA 2IT1A 3STBC 1YHBA 1XMOQ 4FF4A 3F2CA 3WOEA 2F0MA 3S2HH 2PI2E 1YNXA 1IBML 1C48A 1GKHA 5JOBA 2R93H 4IJLA 4RWSC 2E75C 4TRDA 1HNWQ 4JI6L 3HOZH 3GTGH 2QGQA 4UAIA 4DV3L 1BCPB 1EFID 1WTRA 1ASYA 1IHZA 4CDFC 1RODA 1YNNC 4DR6L 1XMOL 4AH6A 1DYQA 3KBXA 2K01A 1KIXA 4OHJA 3G6EA 1PV4A 2XTIA 1PMRA 2ZJRA 4DK1A 1B9NA 1PZJD 1IZ6A 1JWSD 4NP5A 1B3AA 1N9WA 1V1PA 2A69C 5C4ZA 1K0RA 1HNWL 4R4OA 4KMUC 5C0XJ 3QIAA 2F0HA 3VA7A 2QDBA 5JPNC 3JAMi 3QR8A 1RTOA 4TQUS 2IX3A 2MO0A 1TY2A 2LSSA 4HCSA 5DM63 5C4JH 3T1YQ 4DR4Q 4L5SA 3TP6A 5IGCA 4QY7A 3UE0A 3U58A 3KF6A 3MXNA 1WFQA 2A1AA 3I72A 1O7ZA 4ODGA 1LTID 3JC66 5IGGA 2R7FA 3S1RB 2WACA 4LF4Q 4KK7A 1HCZA 3V96A 3CHBD 1HFNA 3X3NA 2F1MA 3PO2B 3Q8DA 3C1EA 1YI2A 1QVGA 1IBLL 4NXNL 3HRZC 5C0XG 2OQKA 1OXXK 4MZ9A 2UXDQ 5K5PA 1VMPA 4JI5Q 4ZKBB 2ICEC 3BZCA 4XQNA 1HQRD 3PO2G 2NVQH 4Y7NB 3CC4A 3BJUA 3ZYYX 2MQHA 3T1YL 3T13A 4DR4L 4JV5Q 2EOTA 1L2FA 2ZXOA 4X3UA 3NBIA 1PH9A 4C3JG 1O7YA 1SLJA 1B7YB 4KJNA 4LF4L 4A3EB 3NPPA 3KF8B 5C3WA 4X65Q 1UEBA 1XNQQ 4A3EG 3HOXB 4R8IA 1XX8A 3Q6SA 4JI5L 3HS0C 3S1NB 3HOXG 2N49A 3HKZG 3K59A 3S14H 5JJZA 3BVGA 4NXMQ 3H0GB 2MHVA 2VL6A 4CBVA 1UE5A 4NPSA 4LFAQ 2VS1A 2XVSA 4ZCKA 1WD1A 1G6PA 1VCIA 4DAMA 1A3TA 2QW7A 4DNIA 1VQBA 1VS0A 3KDFA 5FLXE 4X64L 4NXML 3BU2A 1E2ZA 1EEID 1VQGA 2Z1CA 2JP1A 3WDNA 1K8GA 2E8GA 3VR4A 2GN5A 1TWFH 2L55A 3I90A 4C3JH 4K2LA 1TS2A 2EQSA 1Y1VB 2XRQD 4G7HC 3CQZB 3L7ZC 1K3RA 1Y1VG 3DMUA 3P1HA 1RJTA 3ER0A 2XN9C 2CW0D 2WFWA 2R61A 1A2UA 2EYJA 3K5OA 3HOXH 1GHKA 1YIJA 4ZK9B 4N9TA 2NVTB 3S1NH 3BVZA 1VQ4A 1DM0B 1PYBA 4WJWA 2N55A 4C56C 2F0LA 4OONA 3I4MG 2B2YC 1LT6D 1P8LA 2QKIC 4JW0A 1DGSA 5IGDA 4OELB 4MN3A 2CKZB 1ZXTA 4CDDC 1ESFA 2VUMB 3KOJA 4A3KB 2HQLA 4DXGA 2G5DA 1NUCA 2VUMG 4M8AA 2AQ1B 5GADC 1N33Q 3D0FA 1RD9D 1F2LA 4A3KG 2K04A 4JYAQ 1DD2A 1EYCA 2EVBA 1YJNA 4PZ6A 3CU7A 1SE4A 2IL8A 5IT9c 3BZKA 3A74A 3L3OC 3G48A 4A93B 2EDGA 1WCMG 1TWCB 1JE5A 4RA8A 4Q5VA 1K83H 4A93G 3OYYA 1V1QA 4AQYQ 1MGSA 2PCFB 3DEPA 1WTXA 1KD1C 3S16B 5E7NA 3PUYA 3SK8A 3CPWA 1N33L 3EQLC 3OMGA 2E2HH 3WOFA 2IX0A 3I4LA 4JYAL 1Q1EA 2A6HD 2KA7A 4JBJA 5H1SE 1EY4A 4OIKA 1K73C 3GTOH 2VY3A 3PUXA 4IQZA 3EROA 2WB1B 1UWVA 4HMIA 1N32L 4AQYL 3GTMH 2VB3X 3I4MH 2E2JH 4DV1Q 1U4RA 2WB1G 3KLRA 3I7FA 2RVLA 3N52A 1BDOA 1Y69U 2OT2A 2RDFA 1PH7A 2R7DA 3PF5A 1JORA 3R8BA 1U4MA 3M9BA 4GN5A 2B2TA 1C7YA 1ICFB 3CKIB 4RGOS 3VDYA 3K0XA 1SAPA 1D5ZC 1NAPA 4K8JA 3W5OA 2D0OA 2XRSD 3F2DA 1WTQA 2L12A 1WCMH 1KDAA 2ZXPA 5D3DA 4QCLA 2CCZA 5EGTA 1V8QA 5CORA 2Q8IB 1AP0A 1MI2A 2OEOA 3M7GA 4R4IA 5KYLA 2IW3A 5CC4A 1PYSB 4IURA 1OXTA 1F9SA 4IOAA 4N9PA 1I3QB 4NKLA 4UP8A 5I6YA 1LLRD 2FMMA 3OWFA 1LTGD 1E22A 4O0AA 5M5YH 4KY5A 1A3VA 5G3LF 4MTKA 5C5MA 1TIID 2PZWA 3HOWH 1G2TA 1HZBA 1PTOD 3PIPA 4LAAA 1A15A 5JEAH 1WTWA 1TVXA 1H9SB 4KHVA 3RR5A 1PH6A 1FJGQ 5CV9A 3U9OA 2CFMA 1AE3A 2JN4A 2EYLA 2Z8LA 4X62Q 3CAMA 4G57A 1QILA 2VB2X 1I50B 3PMFA 2VZAA 3RN5A 5IODA 3T16A 4XXEA 2QILA 5TSSA 1H95A 1JCKB 5DEHA 4JI2Q 1FJGL 2EIFA 3K5NA 1HRJA 1PFSA 1D7QA 4HJ8A 3KLWA 2KHSA 2BH2A 1K9MC 1KHIA 1QVCA 4X62L 1LT3D 2M9VA 4B9XA 4JI1Q 2YTVA 3TN2A 2F0IA 2EJMA 3H3VI 4XTCS 2RDHA 1HR0W 2Q8RE 1VQJA 3PUVA 3K7AB 2Q2TA 4YWLA 3BDLA 4BY7H 1YHQA 2EYFA 1PA6A 2BE5D 2H1EA 4RGNA 1LACA 1W2BA 1XMQL 2LS01 5EPJA 4FXGC 3NP8A 1X3EA 3P20A 1STEA 1STHA 4QL5A 1B4OA 3ULLA 1X9NA 1SFOB 4JI1L 1AE2A 4M1UB 2G9HD 3KLSX 3NELA 5C5LA 2D62A 2BDOA 3VR2A 2F4IA 2K50A 3H09A 3VYUA 3TSSA 3VR3A 2PNHA 5IWAQ 4WRDA 3ULJA 3I4OA 3VA5A 4ZYSA 2KEDA 3OPOA 1JE4A 1MKHA 3LNNA 3RZDB 2Q2IA 2KENA 1GUGA 1CSQA 4ME3A 5J1ZA 3OOCA 1TT2A 4JCVE 1B44D 5E4XA 2NBFA 5IGEA 1IYUA 3UE1A 4KHZA 3TREA 3MC0B 1JJGA 1II3A 2R6GA 3D3RA 5DNFA 1GJXA 2DGYA 5E1FA 2QEJC 3PO3H 4L8JA 1WI5A 2A68C 1RCVD 4KY6A 2F3WA 2MP1A 5DM73 2K6AA 1RDPD 1SR3A 1GHJA 2KEEA 2HCIA 1KAWA 5C44H 2K5NA 3SK5A 1Y8NB 4KI0A 3FDTA 5IYBG 5FJ8H 1NR2A 1EIHA 4J8QA 3AEVA 5IP9G 4A76A 3CPFA 4PZ8A 2V4DA 3D6WA 1VQAA 2K32A 5EPLA 4QB4A 3J81c 1BR9A 2L1BA 3HP3A 4BA1I 2DJGC 4J6HA 3J80i 3SK4A 3SE0A 2WKCA 2L5TA 4PNYA 4XYQA 3D4DA 3L2PA 3AFPA 1H9RA 4R9WA 1HZCA 3QOLA 1E3PA 1EQRA 3F8TA 1Z7TA 2I46A 4O2DA 1S72A 1QJOA 3CRLC 2N88A 3OW7A 4FYDA 4HTHA 1SNQA 1R4PB 3T56B 1GUSA 2HCCA 1UEAB 1EQQA 2F0QA 1EUJA 1M90C 1V1PB 2PI2A 4DV6Q 3NTKA 1ENCA 1Q7YC 2PQAB 5NUCA 1A3UA 1CHPD 2NVYH 3FKIH 2F03A 4A3GB 3H94A 1ZYRC 5IYBH 3U50C 4DNTB 1F2ZA 3E9IA 5CBEE 4RHRA 4YY3Q 1Y8PB 4RHSA 3H91A 4EQ5A 3KF6B 3MXNB 2EXDA 4DV6L 3PQIA 3CCJA 4DPGA 1BVSA 1YBYA 4X3KA 3PF4A 3M3YB 1PRTB 3NQIA 3P7JA 4AYBB 1SNOA 1L0WA 5IGFA 4DV0Q 2MNAA 2F0DA 1JICA 3CW2C 1AFPA 1PRTC 3AFQA 1HXYD 4YWMA 2RF4A 3FHWA 3PIOA 3J81E 3KFUA 2XWJB 3C46A 5M5WH 4YY3L 1H9JA 2L15A 4PG3A 2K33A 1HTPA 4ILWA 2NB0A 4TSSA 3MVVA 2ZM6Q 3NSWA 2K5WA 2K4KA 4EQOA 4JOIA 2B2UC 4PMWA 5K36G 5CV8A 1J6QA 3S2HB 1GUOA 1JB7A 2R93B 3MXUA 4DK3C 1VQNA 1A0IA 3G4SA 1BO0A 2SEBD 4B3SQ 2EYOA 1EQTA 3R3OA 4P72A 2VQEQ 4JK1C 4IUVA 4LWCA 5FLMH 1BKBA 3BVMA 3HOZB 3GTGB 2OQ0A 4K5WA 3RLOA 4G4KA 4DR3L 2EZVA 2E76C 5EAYA 2ZM6L 3CC2A 1U4PA 1NJIC 3HOZG 2UUBQ 4A3FG 1JMCA 1X32A 3KYHC 4JG2A 1D2BA 3TZUA 3HOVH 4A3IB 1TWGH 4PQXA 3STBD 3TBIB 3MEFA 3H6MA 3PUWA 2PO4A 4A3IG 1QZHA 2VQEL 4FF1A 1K0SA 3A5ZB 3KDFB 2RHQB 2V1CC 3JAMc 1VQ7A 3RZOH 3NTHA 1EY7A 3KJPA 4C2MH 2KJXA 3HFZB 2UUBL 2Z4HA 1QG7A 1EU4A 1D1KA 3ND8A 1PH4A 5C4JB 3K0YA 1V1OA 3O13A 2NN6I 3J7AF 1Q1BA 1A6XA 5FO9B 1YNND 1SYFA 5CV6A 1VMCA 2H5XA 4ZRZA 4LFBQ 3JAML 2KCTA 5K36H 1Q81C 4HJ7A 2MFIA 1JB3A 4DR6Q 2VQFQ 2QF7A 1BBWA 3I2ZA 2A6EC 2A69D 2DNEA 1F9PA 3OIPA 1YJWA 1E7ZA 4XQQA 5C4XG 2NVQB 1EYAA 3BS1A 5M3MG 3CC7A 3RUZA 1LT5D 1STNA 4BY1B 1CQVA 3DXJC 1V43A 1QWYA 1AZPA 1RTNA 2FINB 4A3FH 4LFBL 4BY1G 2NVXB 4YCWA 3KBGA 1BCPC 2VQFL 2CQOA 3S17H 2O4XA 5BN4A 3CCQA 2EYPA 3A8KE 4X66Q 4A3IH 1AN8A 2ZXRA 5CV5A 2B39A 4A3MG 1A8VA 4A3BH 4DV4Q 1H9KA 2F0EA 4QUFA 1SYBA 3FRPB 1S5CD 3CMEA 1CQFA 4KN4C 1L1OB 1PZID 5C3EG 2OCEA 2E2IH 3S14B 4NB3A 2UUCQ 5JPMC 1XJVA 2KHJA 1IBLQ 4NXNQ 2ENBA 2AUKA 3A55A 1B3QA 1NMFA 2RSOA 3HG9A 2D5DA 4L6TB 4X66L 4H7BA 1BQQT 1A62A 2PMZE 3K6OA 1IYJB 4WORA 4DV4L 4XIGS 2PW7A 3I3CA 3S15H 1M1KC 1CKMA 1EYDA 2XGTA 3GV6A 4KLKA 1UE1A 2UUCL 1TWHH 2A19A 5C4XH 4H13C 2YTXA 5M3MH 3QOJA 4Q0FA 3BZDB 2UXBL 3CCEA 1TWFB 5BN5A 2KOLA 4CJ1B 1OXSC 4C3JB 4BY1H 1X65A 1ILQA 1PH5A 1VQFA 3GO5A 4QMGA 3SK6A 4C1NI 2NVXH 1UE7A 1I94Q 1NTGA 3SHLA 1K8AC 1OXVA 4OEMB 3K58A 1CUKA 2F52A 3U4ZA 2I0QA 4GNXA 1JQYD 4A3MH 4QJFA 3NBHA 1OXUA 2OTLA 2HDLA 5ELFA 2NZ1D 5IYCG 5LL6X 3FPUB 1MBYA 3FP9A 2Z4IA 2FFKB 5C3EH 3HKZB 1B8AA 1HA6A 1DONA 3OIQA 1BBXC 1PTOF 5FKAC 5I2XA 5J39A 2K5VA 4X3SA 4YHHL 4RAUC 4RG1A 4TKOB 4BBRH 4X64Q 3A7AB 1I94L 2OWOA 1HQMC 2F3IA 3U9SA 1GUTA 3NTIA 3W3AA 4IPHA 4K6LA 2JE6I 4RH6A 3VR5A 2QEXA 3DLLA 2LY7A 2JA6G 4HMJA 1DOKA 3K8AA 1C4QA 3URYA 3R93A 1U5KA 2C35B 1SRUA 3D4RA 2LKVA 5HGQA 1EIYB 3KUPA 2LXKA 2MUYA 1HNXQ 3I70A 3D6CA 1YVCA 1A63A 1K83B 5COYA 2M00A 2HDMA 1XPUA 3Q22A 5GAGC 1KDBA 1TS5A 1E0BA 1KDCA 3CP0A 2JYOA 3X3MA 2Z6KA 2E2HB 1HJPA 1STBA 4OWTB 5A2QL 4IFDJ 5IYCH 2J7ZA 3FMCA 2X6LA 2N78A 1TU2B 1E2WA 4OX9Q 3GTOB 1HNXL 2I5HA 2K75A 2ZTDA 2KUMA 2KCNA 3GTMB 3I4MB 5GQOA 2E2JB 1I4XA 1T5XD 3C1FA 1NMGA 2FJ2A 1JT8A 1VQDA 4ZLTF 1Q82C 3IKJA 3EFXD 2Z9HA 2JK8A 5AFWA 2NTTA 1ZEQX 4ZKCB 5HGTA 2JA6H 4OX9L 1CKNA 4IFDG 4DR7L 1KRSA 2JA9A 4EX5A 1G2SA 1X54A 4CKEA 1B1ZA 5KGUA 4OWWB 4OWXB 3A8JE 3KK7A 1X3PA 1RKNA 4BXXG 4JC0A 1WCMB 4FF3A 3CMAA 4KD3A 2SOBA 4K14A 4IFDI 1N32Q 2B8GA 1EY9A 5JEAJ 1PFMA 5KYIA 5C6AA 4BWGB 1CI3M 1F9QA 4CHTB 4B3MQ 1MIUA 1S3OA 1WVLA 5M5YB 2ES2A 5ELEA 1Q46A 1KAAA 4LF6Q 1PVOA 3MHBA 3EIVA 4ALPA 2K5QA 5EKLA 3DHQA 3HOWB 1K8MA 3OSOA 4PMBA 5CR3A 4ZUJA 2MJ8A 3TQYA 4KKUA 2HUGA 2MPMA 3HOWG 3QWNA 2FHTA 5JEAG 4B3ML 1AW7A 3M7NA 4RMFA 4DK0A 1CFMA 3M4QA 4LF6L 4IFDH 1I5FA 4GOPB 3D4WA
chains in the Genus database with same CATH topology
1MJCA 4JCVE 4Y52H 4IPCA 4LUVA 4LF9Q 2R93G 2WAQE 4L5QA 3UE1A 2VNUD 4KHZA 4GOPC 1EIFA 4GN4B 3TREA 4A3CG 5BR8Q 4DAYB 4BXXH 1JJGA 2R6GA 2A8VA 1WYDA 1Z9FA 5C0XI 4DV2L 2HT1A 2DGYA 4DR2Q 1VQPA 2UXDL 4A3GH 3PO3H 1WI5A 3UDXA 4JYAL 4OO1I 4JV5L 4A3JH 1SR3A 4LFCQ 1IBKQ 1KAWA 1Z47A 2DUDA 5C44H 3TS0A 2K5NA 4B3SL 4GN3B 2ZJQA 4WJ3M 1SN8A 2AWOA 3GD7A 1JJCB 2GVBA 4KI0A 3E0EA 2WP8J 2NZHA 2AWNA 4LW1A 5IYBG 3CXCA 4DUZL 4X65L 4UPAA 2Z6KC 5BR8L 3H0GG 3M3YH 5FJ8H 1XNQL 1AH9A 1VQLA 3DM3A 3AEVA 3EBEA 5IP9G 4DR2L 3NENA 4LF5L 4BY7G 4A76A 3CPFA 1X55A 4PZ8A 1IBMQ 4P74A 1VQAA 2CWAA 1PH1A 1BBUA 1RL2A 2RHSB 3S1RH 3J81c 2JEAI 4HJ5A 1XNRQ 4LFCL 4JI6Q 3PO2H 4DV3Q 4BA1I 4LUOA 5GAHC 3J7ZC 2Y0SE 4BBSH 3J80i 4DR7Q 1B70B 3ERSX 1HZAA 1GO3E 2F4VQ 4LFAL 3S2DH 1HR0Q 2IT1A 3L2PA 3STBC 1YHBA 4Y7NH 4DR5L 1XMOQ 3F2CA 3AFPA 1W3SA 1HZCA 3S2HH 1E3PA 1EQRA 2PI2E 1YNXA 3F8TA 1IBML 2R93H 1GKHA 2K14A 4O2DA 3M4PA 1S72A 4IJLA 4IJHA 4A3CH 3LGJA 1SE8A 1Y14B 4APVA 4A3EH 1PH2A 1HNWQ 4JI6L 5IE8A 5LMNQ 3HOZH 3GTGH 3J7A5 2QGQA 4L5TA 5ELOA 5ELNA 4YCUA 4DV3L 1EQQA 1EUJA 1M90C 1QVFA 4LF7Q 2PI2A 4DV6Q 1Y1WG 1XMQQ 2ID0A 3I55A 1ASYA 4LF9L 2F4VL 2JEBI 1Q7YC 1HR0L 2PQAB 4BBSG 1LYLA 1XMOL 4DR6L 4AH6A 1SMXA 2NVYH 3GDEA 2QA4A 3W1GA 1XPRA 1KIXA 3G6EA 3FKIH 1PV4A 2XTIA 2GVAA 1LTLA 4POGA 2CWPA 2ZJRA 3I4NG 5IYBH 1IZ6A 3U50C 3H0GH 1N9WA 3B6YA 3E9IA 3PO3G 1PHJA 1K0RA 4YY3Q 1HNWL 2KBNA 4R4OA 5LMNL 4JI4Q 5C0XJ 3TEHB 4EQ5A 3KF6B 3MXNB 2ZTEA 1VQEA 2EXDA 1IL2A 3JAMi 4LF7L 4DV6L 4TQUS 1MJEA 3CCJA 4DPGA 1BVSA 5C44G 1I6HH 1YBYA 3PF4A 2MO0A 3PCOB 2LSSA 1PH3A 1L0WA 4DV0Q 5J3BA 4AYBE 5C4JH 2MNAA 3T1YQ 3CW2C 3KJOA 1L1OA 3AFQA 5GROA 3RLNA 2BA0A 1GM5A 4L5SA 4DR4Q 3GTKH 2UXDQ 2FXQA 2N8NA 5FJ8G 4QY7A 3UE0A 3U58A 3KF6A 2IHFA 2RF4A 4YWMA 1WFQA 2A1AA 3FHWA 3PIOA 2UU9Q 1G51A 3S24A 3KFUA 3OTOQ 3JC66 2R7FA 4IPDA 5M5WH 4YY3L 4LF4Q 1LUZA 2L15A 4JI4L 1VQ9A 4PG3A 4DV2Q 3Q8DA 1YI2A 1QVGA 1IBLL 1KXLA 4NXNL 1Y1VH 5C0XG 2HIXA 2OQKA 1OXXK 4MZ9A 2ZM6Q 4GLXA 1ASZA 2K4KA 4B3TQ 3RLFA 3CQZH 4JI5Q 4JBKA 3BZCA 3H3VH 3PO2G 2NVQH 4JOIA 4PMWA 3CC4A 3UDGA 5K36G 1VQOA 1J6QA 1E1TA 3BJUA 2MQHA 3D31A 1WOCA 3T1YL 4JI0L 4DR4L 2RCNA 4JV5Q 2AMCB 1Y1WH 2D0PA 1JB7A 4OXPA 2ATWA 4OO1G 3PV0A 1L2FA 4DK3C 1A0IA 1VQNA 1PH9A 3G4SA 4L5RC 3ICEA 1QZGA 4B3SQ 2UU9L 4UY8C 1SLJA 3OTOL 1B7YB 4P72A 2VQEQ 2NVTH 4GS3A 4LF4L 3CCUA 4DUZQ 4LWCA 5FLMH 1BKBA 3KF8B 4X65Q 2OQ0A 1UEBA 3RLOA 1XNQQ 3I4NH 4A3EG 4DR3L 4A3DG 2ZM6L 5EAYA 3RN2A 3CC2A 4PZ7A 1NJIC 3HOZG 4HJAA 4JI5L 2UUBQ 4A3FG 1JMCA 4B3TL 4LF5Q 5LMUL 3CD6A 3KYHC 2B29A 4R4TA 4UP7A 4JG2A 3HOXG 2N49A 3L0OA 1KL9A 4A4IA 2JA8H 3HOVH 1N34Q 3HKZG 1KQSA 3S14H 1TWGH 3STBD 2VUMH 3CCRA 4TVAB 3FKIG 1UE6A 3MEFA 4NXMQ 3PGZA 3PUWA 2VL6A 4A3IG 1QZHA 1HH2P 4A3KH 2VQEL 2ZTCA 3A5ZB 1E24A 2N3SA 1UE5A 2RHQB 2V1CC 3KDFB 4NPSA 4LFAQ 3JAMc 3CF5A 1VQ5A 1VQ7A 4GLVB 2VS1A 4DR5Q 3RZOH 1GVPA 3KJPA 4DV1L 1YJ9A 3AYHB 4C2MH 1G6PA 2JA5G 3HFZB 2UUBL 1VCIA 4R4CA 4DAMA 1EWIA 4HJ9A 4YWKA 4A93H 4DR1Q 4DNIA 1PH4A 1VQBA 1N36L 1N34L 2NN6I 1TWCH 1Q1BA 4A75A 1VS0A 3KDFA 4X64L 2H5XA 4GLAC 4NXML 4LFBQ 3S16H 3BU2A 2KCTA 3E9HA 1VQGA 1K8GA 5IP7G 1Q81C 3J81j 2E8GA 3K81C 4HJ7A 2B3GA 2MFIA 1YITA 2GN5A 3WWVA 1TWFH 2VQFQ 4DR6Q 1KC8C 4P71A 4MTNA 1BBWA 3I2ZA 4C3JH 2EQSA 2Q2UA 1X6OA 4C3HH 1YJWA 3L7ZC 1E7ZA 4GKJQ 5C4XG 1FVIA 1K3RA 4DR1L 1Y1VG 4MNOA 5M3MG 3CC7A 1IXRA 2JA7G 3ER0A 1G291 2AHOB 1V43A 4A3DH 2WFWA 4JI3L 4A3FH 1HNZQ 4LFBL 4BY1G 4YCWA 4R4QA 3HOXH 1YIJA 5AJ3Q 1GD7A 3S1NH 3F1ZA 1VQ4A 2VQFL 2CQOA 4DV7Q 1PYBA 3S17H 3CCQA 4X66Q 5FLMG 4A3IH 3GTQH 2K52A 1A8VA 1VQHA 4OONA 4A3MG 4DUYQ 4DV4Q 3I4MG 4A3BH 1JJ2A 4GKJL 3CMEA 2BH8A 1R9TH 1P8LA 1L1OB 5C3EG 4IO9A 3CCSA 1DGSA 2JA5H 2OCEA 2E2IH 2CKZB 3NEMA 4NB3A 1HNZL 2UUCQ 2JQOA 2KHJA 1XJVA 2JA8G 3HOVG 1IBLQ 1O7IA 2Z0SA 3KOJA 4NXNQ 2HQLA 5AJ3L 1OTCA 4J15A 4QQBX 2VUMG 3TS2A 1D8LA 4BA2I 2UXCQ 5GADC 1PH8A 3D0FA 1N33Q 1NMFA 4DV7L 1C0AA 4A3KG 4JI0Q 4X66L 1QUQB 1Q8KA 4JYAQ 1A62A 2PMZE 3UDFA 1YJNA 4PZ6A 2UUAQ 1IYJB 5IP7H 4DUYL 4DV4L 5IT9c 4XIGS 3I56A 3BZKA 3A74A 3G48A 1VQIA 3S15H 1WCMG 1M1KC 1I3QH 4JBWA 1CKMA 4JOIC 3K80C 2XGTA 4KLKA 1JE5A 1UE1A 1N8RC 1K83H 4A93G 3ULPA 2UUCL 1TWHH 3OYYA 1V1QA 4AQYQ 3J80c 4JI2L 2A19A 5C4XH 1KD1C 4DR3Q 1QUQA 2YTXA 5E7NA 3U4VA 5M3MH 2JA7H 4AIMA 3PUYA 2UXCL 3M85A 5LMUQ 3CPWA 3CCEA 5LMNW 2KCMA 1N33L 2UXBL 2E2HH 1E1OA 2IX0A 3NBHB 4IOCA 1OXSC 1Q1EA 5IYDG 1X65A 4JBJA 2YU9H 4BY1H 2IX1A 1PH5A 2HHHQ 1YZ6A 3S1QH 3OW2A 2UUAL 5H1SE 1VQFA 3J81i 3GO5A 2NVXH 1UE7A 1U0LA 2MO1A 1K73C 1SROA 2VY3A 3PUXA 1I94Q 3GTOH 5DLQE 4DK6C 1NTGA 3IRBA 4IPGA 1K8AC 1J5EQ 1OXVA 4K0KQ 4JI7Q 1UWVA 1CUKA 2F52A 2WB1E 3U4ZA 2I0QA 4AQYL 3GTMH 3S1MH 4GNXA 4A3MH 3I4MH 1N32L 4QJFA 2E2JH 4DV1Q 1OXUA 2WB1G 2OTLA 5IYCG 5IY0A 3I7FA 1I50H 3AQQA 3FP9A 2BA1A 5C3EH 1XPOA 1B8AA 4FDBA 4JI8Q 3HKZE 1PH7A 1YHAA 1Q12A 2R7DA 3PF5A 3RNUA 3M9BA 1N36Q 2HHHL 4GN5A 3HOYH 2K5VA 1C7YA 3GTPH 2NN6G 2VW9A 4YHHL 3VDYA 4RG1A 4BBRH 4X64Q 1I94L 3K0XA 1KRTA 3ZJYC 2OWOA 4DV5Q 1FL0A 2F3IA 4P75A 1J5EL 4A3BG 4K0KL 3T1HQ 4JI7L 2WAQG 3W5OA 2D0OA 2NZOA 4GKKQ 4IPHA 1X56A 5HY6A 5IWAL 1S40A 1EYGA 3F2DA 2JE6I 1EFWA 1WCMH 2QEXA 4JBMA 3DLLA 2JA6G 2IY5B 3K8AA 4JI8L 4GOPA 2CCZA 3CCLA 2ASBA 5M3FH 1VQKA 3K7AH 1U5KA 4B3RQ 2ZJPA 2C35B 2K5HA 1SRUA 4R4IA 2AKWB 4A3LG 1PYSB 5GAEC 5HGQA 1Q86C 1EIYB 2R7ZG 1OXTA 4JI3Q 2I5LX 2LXKA 3PSIA 1NY4A 4IOAA 1HNXQ 4DV5L 3M4OH 1YEZA 1NBWA 4UP8A 1YVCA 4LNQA 3UDIA 3T1HL 5IYDH 1A63A 3HKSA 1T9HA 4GKKL 1XPUA 1E22A 4O0AA 5M5YH 1SFOH 5GAGC 3TRZA 3CP0A 4LF8Q 1VQ8A 1VQ6A 2Z6KA 2YTYA 4B3RL 1HJPA 3HOWH 4OWTB 1IBKL 4IFDJ 1HZBA 5IYCH 4LUZA 3PIPA 4X6AH 2E5LQ 2N78A 4OX9Q 2B63H 2R92H 1X3GA 3RR5A 1CSPA 1PH6A 1HNXL 1FJGQ 2OTJA 2I5HA 2K75A 2ZTDA 1FGUA 2Y0SG 2CFMA 1AE3A 5M5XH 3GTLH 5GQOA 4X62Q 3RZDH 1CKNB 2KHIA 3CAMA 4LF8L 1NMGA 2HIVA 1JT8A 4DKAC 3W1BA 1VQDA 2VZAA 2Q2HA 5JJKA 3RN5A 1Q82C 5JJLA 2JJQA 1CKOA 1H95A 1XNRL 3GTJH 2JK8A 3CCVA 3HOUG 1TWAH 2E5LL 1L1OC 4JI2Q 2JA6H 4OX9L 1VQMA 1CKNA 1FJGL 4IFDG 4DR7L 1KRSA 2EIFA 2JA9A 4POFA 4EX5A 3HOYG 1PFSA 1D7QA 1X54A 3KLWA 3F2BA 4BBRG 3CCMA 4HJ8A 4A3LH 2BH2A 1K9MC 4OWWB 2UXBQ 4OWXB 1V9PA 1KHIA 1QVCA 4X62L 4HIOA 2R7ZH 4KHPQ 4BXXG 4HIKA 4JC0A 2LXJA 4JI1Q 2YTVA 3H15A 1X3FA 4HIMA 3CMAA 3H3VI 1C9OA 4XTCS 2YYZA 3K7UC 1HR0W 1NE3A 4A3GG 1VQJA 3PUVA 2Q2TA 4WJ4A 1P16A 5JJIA 5IP9H 4YWLA 2PQAA 4C3IH 4BY7H 1YHQA 1PA6A 5M3FG 4IFDI 1N32Q 1LM0A 1EOVA 4P73A 5JEAJ 4A3JG 1XMQL 1W2BA 2I5MX 3A0JA 1HZ9A 4B3MQ 1X3EA 1MIUA 1S3OA 1WJJA 1TXYA 1XTDA 4QL5A 4GNXB 3SGIA 3ULLA 1X9NA 2ES2A 4KHPL 1Q46A 4LF6Q 4JI1L 4GNXC 1AE2A 4AYBG 2ALYB 4HIDA 3NELA 1PVOA 3EIVA 2D62A 4QIWE 5FLXc 4YHHQ 4ALPA 1VQCA 3PUZA 2K50A 4R1JA 3EN2A 3TQYA 4YCVA 2PNHA 5IWAQ 3HOWG 2YV5A 4H02A 3I4OA 3ULJA 3G71A 3A5UA 5JEAG 4B3ML 2IHEA 4QGUA 2R92G 4DV0L 2B63G 3HOUH 3M7NA 1MKHA 4RMFA 1RIPA 2Q2IA 3M4QA 2KENA 4LF6L 1CSQA 4UP9A 4ME3A 1I5FA 4GOPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJC A;  4JCV E;  4Y52 H;  4IPC A;  4LUV A;  4LF9 Q;  2R93 G;  2WAQ E;  4L5Q A;  3UE1 A;  2VNU D;  4KHZ A;  4GOP C;  1EIF A;  4GN4 B;  3TRE A;  4A3C G;  5BR8 Q;  4DAY B;  4BXX H;  1JJG A;  2R6G A;  2A8V A;  1WYD A;  1Z9F A;  5C0X I;  4DV2 L;  2HT1 A;  2DGY A;  4DR2 Q;  1VQP A;  2UXD L;  4A3G H;  3PO3 H;  1WI5 A;  3UDX A;  4JYA L;  4OO1 I;  4JV5 L;  4A3J H;  1SR3 A;  4LFC Q;  1IBK Q;  1KAW A;  1Z47 A;  2DUD A;  5C44 H;  3TS0 A;  2K5N A;  4B3S L;  4GN3 B;  2ZJQ A;  4WJ3 M;  1SN8 A;  2AWO A;  3GD7 A;  1JJC B;  2GVB A;  4KI0 A;  3E0E A;  2WP8 J;  2NZH A;  2AWN A;  4LW1 A;  5IYB G;  3CXC A;  4DUZ L;  4X65 L;  4UPA A;  2Z6K C;  5BR8 L;  3H0G G;  3M3Y H;  5FJ8 H;  1XNQ L;  1AH9 A;  1VQL A;  3DM3 A;  3AEV A;  3EBE A;  5IP9 G;  4DR2 L;  3NEN A;  4LF5 L;  4BY7 G;  4A76 A;  3CPF A;  1X55 A;  4PZ8 A;  1IBM Q;  4P74 A;  1VQA A;  2CWA A;  1PH1 A;  1BBU A;  1RL2 A;  2RHS B;  3S1R H;  3J81 c;  2JEA I;  4HJ5 A;  1XNR Q;  4LFC L;  4JI6 Q;  3PO2 H;  4DV3 Q;  4BA1 I;  4LUO A;  5GAH C;  3J7Z C;  2Y0S E;  4BBS H;  3J80 i;  4DR7 Q;  1B70 B;  3ERS X;  1HZA A;  1GO3 E;  2F4V Q;  4LFA L;  3S2D H;  1HR0 Q;  2IT1 A;  3L2P A;  3STB C;  1YHB A;  4Y7N H;  4DR5 L;  1XMO Q;  3F2C A;  3AFP A;  1W3S A;  1HZC A;  3S2H H;  1E3P A;  1EQR A;  2PI2 E;  1YNX A;  3F8T A;  1IBM L;  2R93 H;  1GKH A;  2K14 A;  4O2D A;  3M4P A;  1S72 A;  4IJL A;  4IJH A;  4A3C H;  3LGJ A;  1SE8 A;  1Y14 B;  4APV A;  4A3E H;  1PH2 A;  1HNW Q;  4JI6 L;  5IE8 A;  5LMN Q;  3HOZ H;  3GTG H;  3J7A 5;  2QGQ A;  4L5T A;  5ELO A;  5ELN A;  4YCU A;  4DV3 L;  1EQQ A;  1EUJ A;  1M90 C;  1QVF A;  4LF7 Q;  2PI2 A;  4DV6 Q;  1Y1W G;  1XMQ Q;  2ID0 A;  3I55 A;  1ASY A;  4LF9 L;  2F4V L;  2JEB I;  1Q7Y C;  1HR0 L;  2PQA B;  4BBS G;  1LYL A;  1XMO L;  4DR6 L;  4AH6 A;  1SMX A;  2NVY H;  3GDE A;  2QA4 A;  3W1G A;  1XPR A;  1KIX A;  3G6E A;  3FKI H;  1PV4 A;  2XTI A;  2GVA A;  1LTL A;  4POG A;  2CWP A;  2ZJR A;  3I4N G;  5IYB H;  1IZ6 A;  3U50 C;  3H0G H;  1N9W A;  3B6Y A;  3E9I A;  3PO3 G;  1PHJ A;  1K0R A;  4YY3 Q;  1HNW L;  2KBN A;  4R4O A;  5LMN L;  4JI4 Q;  5C0X J;  3TEH B;  4EQ5 A;  3KF6 B;  3MXN B;  2ZTE A;  1VQE A;  2EXD A;  1IL2 A;  3JAM i;  4LF7 L;  4DV6 L;  4TQU S;  1MJE A;  3CCJ A;  4DPG A;  1BVS A;  5C44 G;  1I6H H;  1YBY A;  3PF4 A;  2MO0 A;  3PCO B;  2LSS A;  1PH3 A;  1L0W A;  4DV0 Q;  5J3B A;  4AYB E;  5C4J H;  2MNA A;  3T1Y Q;  3CW2 C;  3KJO A;  1L1O A;  3AFQ A;  5GRO A;  3RLN A;  2BA0 A;  1GM5 A;  4L5S A;  4DR4 Q;  3GTK H;  2UXD Q;  2FXQ A;  2N8N A;  5FJ8 G;  4QY7 A;  3UE0 A;  3U58 A;  3KF6 A;  2IHF A;  2RF4 A;  4YWM A;  1WFQ A;  2A1A A;  3FHW A;  3PIO A;  2UU9 Q;  1G51 A;  3S24 A;  3KFU A;  3OTO Q;  3JC6 6;  2R7F A;  4IPD A;  5M5W H;  4YY3 L;  4LF4 Q;  1LUZ A;  2L15 A;  4JI4 L;  1VQ9 A;  4PG3 A;  4DV2 Q;  3Q8D A;  1YI2 A;  1QVG A;  1IBL L;  1KXL A;  4NXN L;  1Y1V H;  5C0X G;  2HIX A;  2OQK A;  1OXX K;  4MZ9 A;  2ZM6 Q;  4GLX A;  1ASZ A;  2K4K A;  4B3T Q;  3RLF A;  3CQZ H;  4JI5 Q;  4JBK A;  3BZC A;  3H3V H;  3PO2 G;  2NVQ H;  4JOI A;  4PMW A;  3CC4 A;  3UDG A;  5K36 G;  1VQO A;  1J6Q A;  1E1T A;  3BJU A;  2MQH A;  3D31 A;  1WOC A;  3T1Y L;  4JI0 L;  4DR4 L;  2RCN A;  4JV5 Q;  2AMC B;  1Y1W H;  2D0P A;  1JB7 A;  4OXP A;  2ATW A;  4OO1 G;  3PV0 A;  1L2F A;  4DK3 C;  1A0I A;  1VQN A;  1PH9 A;  3G4S A;  4L5R C;  3ICE A;  1QZG A;  4B3S Q;  2UU9 L;  4UY8 C;  1SLJ A;  3OTO L;  1B7Y B;  4P72 A;  2VQE Q;  2NVT H;  4GS3 A;  4LF4 L;  3CCU A;  4DUZ Q;  4LWC A;  5FLM H;  1BKB A;  3KF8 B;  4X65 Q;  2OQ0 A;  1UEB A;  3RLO A;  1XNQ Q;  3I4N H;  4A3E G;  4DR3 L;  4A3D G;  2ZM6 L;  5EAY A;  3RN2 A;  3CC2 A;  4PZ7 A;  1NJI C;  3HOZ G;  4HJA A;  4JI5 L;  2UUB Q;  4A3F G;  1JMC A;  4B3T L;  4LF5 Q;  5LMU L;  3CD6 A;  3KYH C;  2B29 A;  4R4T A;  4UP7 A;  4JG2 A;  3HOX G;  2N49 A;  3L0O A;  1KL9 A;  4A4I A;  2JA8 H;  3HOV H;  1N34 Q;  3HKZ G;  1KQS A;  3S14 H;  1TWG H;  3STB D;  2VUM H;  3CCR A;  4TVA B;  3FKI G;  1UE6 A;  3MEF A;  4NXM Q;  3PGZ A;  3PUW A;  2VL6 A;  4A3I G;  1QZH A;  1HH2 P;  4A3K H;  2VQE L;  2ZTC A;  3A5Z B;  1E24 A;  2N3S A;  1UE5 A;  2RHQ B;  2V1C C;  3KDF B;  4NPS A;  4LFA Q;  3JAM c;  3CF5 A;  1VQ5 A;  1VQ7 A;  4GLV B;  2VS1 A;  4DR5 Q;  3RZO H;  1GVP A;  3KJP A;  4DV1 L;  1YJ9 A;  3AYH B;  4C2M H;  1G6P A;  2JA5 G;  3HFZ B;  2UUB L;  1VCI A;  4R4C A;  4DAM A;  1EWI A;  4HJ9 A;  4YWK A;  4A93 H;  4DR1 Q;  4DNI A;  1PH4 A;  1VQB A;  1N36 L;  1N34 L;  2NN6 I;  1TWC H;  1Q1B A;  4A75 A;  1VS0 A;  3KDF A;  4X64 L;  2H5X A;  4GLA C;  4NXM L;  4LFB Q;  3S16 H;  3BU2 A;  2KCT A;  3E9H A;  1VQG A;  1K8G A;  5IP7 G;  1Q81 C;  3J81 j;  2E8G A;  3K81 C;  4HJ7 A;  2B3G A;  2MFI A;  1YIT A;  2GN5 A;  3WWV A;  1TWF H;  2VQF Q;  4DR6 Q;  1KC8 C;  4P71 A;  4MTN A;  1BBW A;  3I2Z A;  4C3J H;  2EQS A;  2Q2U A;  1X6O A;  4C3H H;  1YJW A;  3L7Z C;  1E7Z A;  4GKJ Q;  5C4X G;  1FVI A;  1K3R A;  4DR1 L;  1Y1V G;  4MNO A;  5M3M G;  3CC7 A;  1IXR A;  2JA7 G;  3ER0 A;  1G29 1;  2AHO B;  1V43 A;  4A3D H;  2WFW A;  4JI3 L;  4A3F H;  1HNZ Q;  4LFB L;  4BY1 G;  4YCW A;  4R4Q A;  3HOX H;  1YIJ A;  5AJ3 Q;  1GD7 A;  3S1N H;  3F1Z A;  1VQ4 A;  2VQF L;  2CQO A;  4DV7 Q;  1PYB A;  3S17 H;  3CCQ A;  4X66 Q;  5FLM G;  4A3I H;  3GTQ H;  2K52 A;  1A8V A;  1VQH A;  4OON A;  4A3M G;  4DUY Q;  4DV4 Q;  3I4M G;  4A3B H;  1JJ2 A;  4GKJ L;  3CME A;  2BH8 A;  1R9T H;  1P8L A;  1L1O B;  5C3E G;  4IO9 A;  3CCS A;  1DGS A;  2JA5 H;  2OCE A;  2E2I H;  2CKZ B;  3NEM A;  4NB3 A;  1HNZ L;  2UUC Q;  2JQO A;  2KHJ A;  1XJV A;  2JA8 G;  3HOV G;  1IBL Q;  1O7I A;  2Z0S A;  3KOJ A;  4NXN Q;  2HQL A;  5AJ3 L;  1OTC A;  4J15 A;  4QQB X;  2VUM G;  3TS2 A;  1D8L A;  4BA2 I;  2UXC Q;  5GAD C;  1PH8 A;  3D0F A;  1N33 Q;  1NMF A;  4DV7 L;  1C0A A;  4A3K G;  4JI0 Q;  4X66 L;  1QUQ B;  1Q8K A;  4JYA Q;  1A62 A;  2PMZ E;  3UDF A;  1YJN A;  4PZ6 A;  2UUA Q;  1IYJ B;  5IP7 H;  4DUY L;  4DV4 L;  5IT9 c;  4XIG S;  3I56 A;  3BZK A;  3A74 A;  3G48 A;  1VQI A;  3S15 H;  1WCM G;  1M1K C;  1I3Q H;  4JBW A;  1CKM A;  4JOI C;  3K80 C;  2XGT A;  4KLK A;  1JE5 A;  1UE1 A;  1N8R C;  1K83 H;  4A93 G;  3ULP A;  2UUC L;  1TWH H;  3OYY A;  1V1Q A;  4AQY Q;  3J80 c;  4JI2 L;  2A19 A;  5C4X H;  1KD1 C;  4DR3 Q;  1QUQ A;  2YTX A;  5E7N A;  3U4V A;  5M3M H;  2JA7 H;  4AIM A;  3PUY A;  2UXC L;  3M85 A;  5LMU Q;  3CPW A;  3CCE A;  5LMN W;  2KCM A;  1N33 L;  2UXB L;  2E2H H;  1E1O A;  2IX0 A;  3NBH B;  4IOC A;  1OXS C;  1Q1E A;  5IYD G;  1X65 A;  4JBJ A;  2YU9 H;  4BY1 H;  2IX1 A;  1PH5 A;  2HHH Q;  1YZ6 A;  3S1Q H;  3OW2 A;  2UUA L;  5H1S E;  1VQF A;  3J81 i;  3GO5 A;  2NVX H;  1UE7 A;  1U0L A;  2MO1 A;  1K73 C;  1SRO A;  2VY3 A;  3PUX A;  1I94 Q;  3GTO H;  5DLQ E;  4DK6 C;  1NTG A;  3IRB A;  4IPG A;  1K8A C;  1J5E Q;  1OXV A;  4K0K Q;  4JI7 Q;  1UWV A;  1CUK A;  2F52 A;  2WB1 E;  3U4Z A;  2I0Q A;  4AQY L;  3GTM H;  3S1M H;  4GNX A;  4A3M H;  3I4M H;  1N32 L;  4QJF A;  2E2J H;  4DV1 Q;  1OXU A;  2WB1 G;  2OTL A;  5IYC G;  5IY0 A;  3I7F A;  1I50 H;  3AQQ A;  3FP9 A;  2BA1 A;  5C3E H;  1XPO A;  1B8A A;  4FDB A;  4JI8 Q;  3HKZ E;  1PH7 A;  1YHA A;  1Q12 A;  2R7D A;  3PF5 A;  3RNU A;  3M9B A;  1N36 Q;  2HHH L;  4GN5 A;  3HOY H;  2K5V A;  1C7Y A;  3GTP H;  2NN6 G;  2VW9 A;  4YHH L;  3VDY A;  4RG1 A;  4BBR H;  4X64 Q;  1I94 L;  3K0X A;  1KRT A;  3ZJY C;  2OWO A;  4DV5 Q;  1FL0 A;  2F3I A;  4P75 A;  1J5E L;  4A3B G;  4K0K L;  3T1H Q;  4JI7 L;  2WAQ G;  3W5O A;  2D0O A;  2NZO A;  4GKK Q;  4IPH A;  1X56 A;  5HY6 A;  5IWA L;  1S40 A;  1EYG A;  3F2D A;  2JE6 I;  1EFW A;  1WCM H;  2QEX A;  4JBM A;  3DLL A;  2JA6 G;  2IY5 B;  3K8A A;  4JI8 L;  4GOP A;  2CCZ A;  3CCL A;  2ASB A;  5M3F H;  1VQK A;  3K7A H;  1U5K A;  4B3R Q;  2ZJP A;  2C35 B;  2K5H A;  1SRU A;  4R4I A;  2AKW B;  4A3L G;  1PYS B;  5GAE C;  5HGQ A;  1Q86 C;  1EIY B;  2R7Z G;  1OXT A;  4JI3 Q;  2I5L X;  2LXK A;  3PSI A;  1NY4 A;  4IOA A;  1HNX Q;  4DV5 L;  3M4O H;  1YEZ A;  1NBW A;  4UP8 A;  1YVC A;  4LNQ A;  3UDI A;  3T1H L;  5IYD H;  1A63 A;  3HKS A;  1T9H A;  4GKK L;  1XPU A;  1E22 A;  4O0A A;  5M5Y H;  1SFO H;  5GAG C;  3TRZ A;  3CP0 A;  4LF8 Q;  1VQ8 A;  1VQ6 A;  2Z6K A;  2YTY A;  4B3R L;  1HJP A;  3HOW H;  4OWT B;  1IBK L;  4IFD J;  1HZB A;  5IYC H;  4LUZ A;  3PIP A;  4X6A H;  2E5L Q;  2N78 A;  4OX9 Q;  2B63 H;  2R92 H;  1X3G A;  3RR5 A;  1CSP A;  1PH6 A;  1HNX L;  1FJG Q;  2OTJ A;  2I5H A;  2K75 A;  2ZTD A;  1FGU A;  2Y0S G;  2CFM A;  1AE3 A;  5M5X H;  3GTL H;  5GQO A;  4X62 Q;  3RZD H;  1CKN B;  2KHI A;  3CAM A;  4LF8 L;  1NMG A;  2HIV A;  1JT8 A;  4DKA C;  3W1B A;  1VQD A;  2VZA A;  2Q2H A;  5JJK A;  3RN5 A;  1Q82 C;  5JJL A;  2JJQ A;  1CKO A;  1H95 A;  1XNR L;  3GTJ H;  2JK8 A;  3CCV A;  3HOU G;  1TWA H;  2E5L L;  1L1O C;  4JI2 Q;  2JA6 H;  4OX9 L;  1VQM A;  1CKN A;  1FJG L;  4IFD G;  4DR7 L;  1KRS A;  2EIF A;  2JA9 A;  4POF A;  4EX5 A;  3HOY G;  1PFS A;  1D7Q A;  1X54 A;  3KLW A;  3F2B A;  4BBR G;  3CCM A;  4HJ8 A;  4A3L H;  2BH2 A;  1K9M C;  4OWW B;  2UXB Q;  4OWX B;  1V9P A;  1KHI A;  1QVC A;  4X62 L;  4HIO A;  2R7Z H;  4KHP Q;  4BXX G;  4HIK A;  4JC0 A;  2LXJ A;  4JI1 Q;  2YTV A;  3H15 A;  1X3F A;  4HIM A;  3CMA A;  3H3V I;  1C9O A;  4XTC S;  2YYZ A;  3K7U C;  1HR0 W;  1NE3 A;  4A3G G;  1VQJ A;  3PUV A;  2Q2T A;  4WJ4 A;  1P16 A;  5JJI A;  5IP9 H;  4YWL A;  2PQA A;  4C3I H;  4BY7 H;  1YHQ A;  1PA6 A;  5M3F G;  4IFD I;  1N32 Q;  1LM0 A;  1EOV A;  4P73 A;  5JEA J;  4A3J G;  1XMQ L;  1W2B A;  2I5M X;  3A0J A;  1HZ9 A;  4B3M Q;  1X3E A;  1MIU A;  1S3O A;  1WJJ A;  1TXY A;  1XTD A;  4QL5 A;  4GNX B;  3SGI A;  3ULL A;  1X9N A;  2ES2 A;  4KHP L;  1Q46 A;  4LF6 Q;  4JI1 L;  4GNX C;  1AE2 A;  4AYB G;  2ALY B;  4HID A;  3NEL A;  1PVO A;  3EIV A;  2D62 A;  4QIW E;  5FLX c;  4YHH Q;  4ALP A;  1VQC A;  3PUZ A;  2K50 A;  4R1J A;  3EN2 A;  3TQY A;  4YCV A;  2PNH A;  5IWA Q;  3HOW G;  2YV5 A;  4H02 A;  3I4O A;  3ULJ A;  3G71 A;  3A5U A;  5JEA G;  4B3M L;  2IHE A;  4QGU A;  2R92 G;  4DV0 L;  2B63 G;  3HOU H;  3M7N A;  1MKH A;  4RMF A;  1RIP A;  2Q2I A;  3M4Q A;  2KEN A;  4LF6 L;  1CSQ A;  4UP9 A;  4ME3 A;  1I5F A;  4GOP B; 
#chains in the Genus database with same CATH topology
 1MJC A;  1ZKO A;  1Y8O B;  4LUV A;  2RKS A;  4CKC A;  4LF9 Q;  2WAQ E;  4FNF A;  4L5Q A;  1D5M C;  1PYW D;  4GOP C;  2VNU D;  2B2W C;  4GN4 B;  4A3C G;  5BR8 Q;  4DAY B;  4BXX H;  2A8V A;  1WYD A;  1Z9F A;  4DV2 L;  4I7Z C;  2HT1 A;  1L0Y B;  4DR2 Q;  1VQP A;  1GXD C;  1F9R A;  3UDX A;  4KKS A;  3F2U A;  2Q8T A;  4OO1 I;  4K2K A;  3KF8 A;  3DM1 A;  4LFC Q;  5IT9 E;  2FMC A;  5FOB B;  2AWO A;  4LF9 L;  1JJC B;  3E0E A;  2WP8 J;  4DUZ L;  3CXC A;  2B2V C;  4UPA A;  5BR8 L;  3DWP A;  4BY7 B;  4V19 0;  1VQL A;  1HUN A;  3ERQ A;  3EBE A;  4RGM A;  4DR2 L;  4LF5 L;  4BY7 G;  4K8I A;  3VYT A;  1CZW A;  4LFC L;  1EY8 A;  1NNX A;  4LUO A;  2Y0S E;  1TS4 A;  3ERS X;  2F4V Q;  2K5D A;  3S2D H;  1HR0 Q;  1EY0 A;  4OO1 H;  4DR5 L;  5EPK A;  1W3S A;  2F0P A;  3SXH A;  2PZT A;  3AMU A;  2EYM A;  3IFD A;  3MFG A;  4A3C H;  5IIF A;  3I8Z A;  1Y14 B;  4APV A;  5LMN Q;  3SDZ A;  5ELN A;  4YCU A;  1QVF A;  4UHV A;  1XMQ Q;  3I55 A;  2EE1 A;  4QUC A;  2F4V L;  2JEB I;  2B8F A;  1HR0 L;  1SMX A;  4IZ8 A;  5CV4 A;  2GVA A;  1LTL A;  3PO3 B;  1O78 A;  3DWQ A;  2CWP A;  4POG A;  3MZ5 A;  4DGZ A;  1HUM A;  1IW7 C;  3B6Y A;  3PO3 G;  2DN8 A;  2KBN A;  5LMN L;  1XYI A;  1K3B C;  2EY1 A;  5C44 B;  1UUP A;  1VQE A;  3MWY W;  3A8I E;  4IAL A;  1MJE A;  2B2Y A;  1I6H H;  5C44 G;  3PCO B;  2KVM A;  1B53 A;  1YNJ C;  2PMZ B;  5GRO A;  3RLN A;  4IUN A;  1FYC A;  1SXT A;  3GTK H;  5FJ8 G;  4K6D A;  2IHF A;  4G7Z C;  1G51 A;  3OTO Q;  4IPD A;  2A68 D;  1KXL A;  4XDX A;  1NSN S;  2HIX A;  4F88 A;  4GLX A;  1ASZ A;  3H3V H;  3RLF A;  4F8M A;  2CQA A;  1I4R A;  1WTP A;  3UDG A;  4JI0 L;  1E1T A;  1QNU A;  2AMC B;  4OXP A;  2ATW A;  3PV0 A;  4L5R C;  1R4Q B;  1QZG A;  1UAP A;  4UY8 C;  3OTO L;  3J80 L;  2F0J A;  2EPB A;  4OL7 A;  4A3D G;  3RN2 A;  2EY2 A;  4PZ7 A;  5LMU L;  3CD6 A;  2B29 A;  2RQX A;  4UP7 A;  2NVY B;  1I4P A;  3L0O A;  3FKI B;  4A4I A;  2JA8 H;  1MHW C;  3EA6 A;  1N34 Q;  1KQS A;  1WD0 A;  3GTQ B;  3CCR A;  1FR3 A;  3FKI G;  1UE6 A;  1PTO H;  1BOS A;  1HH2 P;  1G8Z D;  4FF2 A;  2EXZ A;  2ZTC A;  3S9W A;  3AYH B;  3MTS A;  1EWI A;  4ME5 A;  4DR1 Q;  2K7V A;  1N36 L;  1N34 L;  1MSH A;  3BG3 A;  2PNR C;  2HD3 A;  5C4H A;  1ILP A;  5ELB A;  1VF7 A;  4N8X 1;  2PQE A;  1SNC A;  5M5W B;  1D5X C;  1ZYR D;  3J81 j;  3K81 C;  1EZ6 A;  4CDE C;  2B3G A;  1YIT A;  1IL8 A;  4P71 A;  4MTN A;  5JAV A;  2Q2U A;  1X6O A;  3Q23 A;  1VDZ A;  4C3H H;  4GKJ Q;  4DR1 L;  4MNO A;  5E4W C;  2JA7 G;  1G29 1;  4A3D H;  4JI3 L;  3UI2 A;  4B9W A;  1WTV A;  1IKM A;  1PRT D;  5AJ3 Q;  3BDO A;  3IL8 A;  4L63 B;  3RMH A;  3F1Z A;  4DV7 Q;  2EJF C;  2XSC A;  5FLM G;  1IKL A;  3ND9 A;  2EY6 A;  3GTQ H;  1VQH A;  4GKJ L;  2L4N A;  2IJ0 A;  1PLF A;  4MIU A;  2J0T D;  5FK9 C;  3GQB A;  1R9T H;  2QDL A;  3HOV B;  3CCS A;  5I4D A;  1TWG B;  3NEM A;  1F2Y A;  1XXG A;  3TDQ A;  5M9O A;  3HOV G;  1Q8I A;  5AJ3 L;  4FVM A;  4J15 A;  4QQB X;  1D8L A;  3EVQ A;  3AB9 A;  3RZO B;  4DV7 L;  5JVG 3;  1AZQ A;  4C2M B;  1B50 A;  3T51 B;  2TMP A;  2BCO A;  1VQI A;  3Q0A A;  3N6R A;  3CRK C;  1N8R C;  2NTS A;  3ULP A;  4LK1 C;  3BYY B;  4DR3 Q;  1QUQ A;  3U4V A;  2JA7 H;  2KCM A;  1E1O A;  3NBH B;  1SMY D;  3MEH A;  2H4O A;  4YIJ A;  1G6Z A;  3S1Q H;  3FVQ A;  2YU9 H;  2CH4 A;  2DY7 A;  1LV9 A;  4IUU A;  3J81 i;  1ICW A;  3NQT A;  4P2C B;  4C1N K;  4IN3 A;  5D65 A;  4DK6 C;  3IRB A;  4IPG A;  5EJW A;  1J5E Q;  4K0K Q;  3W2D A;  2WB1 E;  3HEJ A;  4A3F B;  1C8C A;  5EQ0 A;  3AQQ A;  2BA1 A;  3NXW A;  1YHA A;  3S17 B;  1Q12 A;  3RNU A;  1CZG A;  3HOY H;  1E2V A;  2K28 A;  2ZT9 C;  2NN6 G;  4A3B B;  2C5C A;  1SMY C;  2SNS A;  2A6E D;  4DV5 Q;  2RSN A;  4HED A;  4ZUI A;  4A3B G;  1J5E L;  4K0K L;  3T1H Q;  2E2I B;  2WAQ G;  3P75 A;  2NZO A;  1KNE A;  1S40 A;  2WII B;  1SSO A;  1SJE D;  2IY5 B;  1BUV T;  5M3F H;  1VQK A;  3MAQ A;  2WKD A;  2K5H A;  3T53 B;  4A3L G;  5GAE C;  5KNC A;  1BCP D;  3MXG A;  1L0X B;  2R7Z G;  1X3Q A;  2R3Z A;  3S15 B;  4DV5 L;  3M4O H;  2LFN A;  2BOS A;  5CMD A;  3T1H L;  4LNQ A;  1TWH B;  3TZD A;  4CDC C;  5C4X B;  2PW5 A;  5M3M B;  1PXU A;  1DCZ A;  3C2P A;  1EY6 A;  1VQ6 A;  2RCF A;  1IYV A;  4I65 A;  1IBK L;  2C9O A;  3I73 A;  4X6A H;  2Y0S B;  2E5L Q;  2R92 H;  2B63 H;  1DXM A;  2KEC A;  1CSP A;  2OTJ A;  1JR0 D;  1FGU A;  2Y0S G;  3NE5 B;  5T1I A;  5M5X H;  3GTL H;  4A3M B;  2NN6 H;  1CKN B;  4X3T A;  4QF4 A;  1EIG A;  2HIV A;  5C3E B;  3W1B A;  5JJL A;  4IUQ A;  4KV6 A;  3GTJ H;  1XNR L;  4J1M A;  3IFT A;  1TWA H;  2E5L L;  1ESR A;  1L1O C;  4DN4 M;  4BBR B;  4POF A;  1S4Z A;  3JAM E;  2AQ2 B;  2IPK D;  3BYT B;  2CH4 W;  3F2B A;  2RBM A;  4BBR G;  1MD2 D;  4A3L H;  1STA A;  2UXB Q;  3A56 A;  4HIO A;  4RKL A;  2R7Z H;  4KHP Q;  1SEB D;  4JPB W;  1QCB D;  4HSP A;  1C9O A;  2YYZ A;  5JJI A;  3MFY A;  2PQA A;  1SYD A;  3QO2 A;  1LM0 A;  1EOV A;  4XT1 B;  2I5M X;  1QE6 A;  2JSO A;  3NK9 A;  1HPC A;  1TXY A;  1XTD A;  2JXM B;  3SGI A;  4HCE A;  5ELD A;  3SR1 A;  5T1G A;  3E6Z X;  1LTS D;  4KHP L;  4HID A;  3QG1 A;  2NWG A;  3V2T A;  2F0U A;  4QIW E;  5FLX c;  4YHH Q;  2EJG C;  1K8O A;  3A54 A;  4CKB A;  4DF7 A;  3EN2 A;  1CHQ D;  4YCV A;  2B2T C;  4H02 A;  1B2T A;  1ONL A;  5LHY 1;  2D9U A;  5FLX L;  4UP9 A;  3DEO A;  3V05 A;  1STG A;  4Y52 H;  2B2U A;  1RF2 D;  1LT4 D;  1BNZ A;  5C0X I;  2JA6 B;  4GZY C;  2UXD L;  1J9O A;  1ML0 D;  1ET9 A;  4ID6 A;  4JV5 L;  4DAP A;  1MSG A;  1Z47 A;  3FEW X;  2DUD A;  2ZJQ A;  4WJ3 M;  1SN8 A;  3G7L A;  2NZH A;  2AWN A;  1K28 A;  2F3V A;  4X65 L;  3H0G G;  5EKK A;  4NMZ A;  1XNQ L;  1EEF D;  2Z6B A;  3NEN A;  1D1I A;  4KJO A;  1Q3L A;  1X55 A;  4P74 A;  5I9P A;  4KTA A;  1CTM A;  2CWA A;  1PH1 A;  1BBU A;  2SNM A;  2RHS B;  3S1R H;  5KEE A;  5C0X H;  4HJ5 A;  5KIX A;  1Q90 A;  3PO2 H;  5GAH C;  4MHE A;  3J7Z C;  5IOC A;  1FNW A;  3QB3 A;  4BBS H;  5I6W A;  4DR7 Q;  3DUZ A;  1GO3 E;  4LFA L;  4Y7N H;  4S3S A;  1VF5 C;  1SND A;  2XNA C;  1U9R A;  1LTB D;  1W6J A;  4ABN A;  2K14 A;  4KD4 A;  2X69 A;  1KNA A;  3M4P A;  1XTC D;  4IJH A;  3FPP A;  3LGJ A;  1EL0 A;  1SE8 A;  4CGY B;  5EBD A;  4A3E H;  1PH2 A;  1G91 A;  1JC7 A;  3MA2 B;  1Y1W B;  5IE8 A;  3J7A 5;  3E5S A;  1CM9 A;  4L5T A;  5ELO A;  3TP8 A;  4BBS B;  2J4X A;  4LF7 Q;  2K05 A;  1Y1W G;  3SEB A;  2ID0 A;  5IGB A;  4BBS G;  1LYL A;  4RKB A;  3GDE A;  2QA4 A;  3I4N B;  3W1G A;  1XPR A;  3MXP A;  1JWM D;  2A73 B;  4DNR B;  3I4N G;  3H0G H;  5FO7 B;  3GV3 A;  1PHJ A;  2DNC A;  1ENF A;  4RGT A;  1EQV A;  4JI4 Q;  1W6K A;  3TEH B;  1GOZ A;  1FGB D;  2ZTE A;  4F87 A;  5A2Q E;  1IL2 A;  4LF7 L;  4OIJ A;  1S5B D;  1LTA D;  2CW0 C;  3G6J B;  1PH3 A;  3SVM A;  5J3B A;  1TQO A;  4KKT A;  4AYB E;  4UDU C;  3KJO A;  1L1O A;  1GM5 A;  2BA0 A;  2FXQ A;  1KLU D;  2N8N A;  2CVR A;  2WV6 D;  2UU9 Q;  3S24 A;  1LUZ A;  4JI4 L;  1VQ9 A;  1B9M A;  1OO9 B;  4DV2 Q;  2K1B A;  2EYH A;  1Y1V H;  1T5E A;  4JBK A;  3KLS A;  4B3T Q;  5KRU A;  3CQZ H;  4DU9 A;  3S2D B;  1BXT A;  5IT9 L;  1VQO A;  3D31 A;  1SNM A;  4RCN A;  1WOC A;  2EY5 A;  2RCN A;  1Y1W H;  2D0P A;  1A2T A;  4OO1 G;  3ICE A;  3OMC A;  2F0T A;  4HSV A;  4ZAI A;  1KAB A;  2QCP X;  4FP5 D;  2UU9 L;  1TKW B;  2NVT H;  4GS3 A;  4KY7 A;  3CCU A;  4DUZ Q;  5L37 A;  4HN7 A;  3I4N H;  3A7L A;  3LWE A;  4HJA A;  4B3T L;  2PPB C;  4LF5 Q;  1NR4 A;  4R4T A;  1GUN A;  1KL9 A;  1TY0 A;  1JOO A;  1STY A;  2F0K A;  2VUM H;  2AQ3 B;  4PMC A;  1PRT F;  4TVA B;  3PGZ A;  2RA4 A;  2A6H C;  2GA4 B;  4A3K H;  5LL6 S;  2JA5 B;  1E24 A;  2N3S A;  3CF5 A;  1VQ5 A;  5I9O A;  4GLV B;  3QJY A;  4XT3 B;  4DR5 Q;  2LMC B;  1GVP A;  1WTH A;  4DV1 L;  1YJ9 A;  2JA5 G;  4E6I A;  1I6H B;  4HJ9 A;  4R4C A;  4YWK A;  4A93 H;  2O2L D;  5HUR A;  5FO8 B;  1TWC H;  2L11 A;  1SBB B;  1EY5 A;  4A75 A;  3GTK B;  4FXD A;  4RFB A;  4WFN 3;  3PIP 3;  3NWT A;  4GLA C;  3S16 H;  3E9H A;  4HAE A;  5IP7 G;  3WWV A;  1KC8 C;  4K5V A;  2SDF A;  1IW7 D;  4LJZ C;  3J7Y W;  3BDC A;  4U68 A;  3LX0 A;  1FVI A;  3H3V C;  1IXR A;  2AHO B;  4K5X A;  1FNV A;  5C3X A;  1O80 A;  2I07 B;  1CK1 A;  1HNZ Q;  1YNJ D;  4R4Q A;  3TP7 A;  1GD7 A;  3I91 A;  1HTL D;  5EBC A;  3S1M B;  2WIN B;  3Q24 A;  5CV7 A;  1JWU D;  2K52 A;  1KTK A;  4DUY Q;  4Z9C B;  1JJ2 A;  2BH8 A;  2JA8 B;  2F0F A;  4IO9 A;  2JA5 H;  3GTP B;  1HNZ L;  1HHV A;  2JQO A;  2JA8 G;  1PTO B;  4HR7 B;  4NDX A;  4OGQ C;  2O5I C;  1HFG A;  1O7I A;  2Z0S A;  1CA6 A;  1OTC A;  1PTO C;  3TS2 A;  4BA2 I;  4EVO A;  1SDF A;  2NUC A;  1PH8 A;  3J7A V;  2K03 A;  2UXC Q;  4R8N A;  1C0A A;  5EKI A;  4F7X A;  4JI0 Q;  1ET6 A;  1QUQ B;  1Q8K A;  3UDF A;  4I7A A;  4H44 C;  1EWH A;  2UUA Q;  5IP7 H;  4G7O C;  4DUY L;  4EGV A;  1S5D D;  3I56 A;  5D3I B;  4O1N A;  3RD4 A;  1SJH D;  2E74 C;  1I3Q H;  4JBW A;  4JOI C;  3K80 C;  5CYU A;  1M8A A;  5E3F A;  2M2L A;  3J80 c;  4JI2 L;  1SE3 A;  2DY8 A;  2KQ3 A;  2L9H A;  1I4Q A;  2RDG A;  1S5F D;  4DA2 A;  4AIM A;  2UXC L;  3M85 A;  5LMU Q;  5LMN W;  2G9D A;  2HQE A;  3ITP A;  2A5H A;  4IOC A;  4NW2 A;  1BCP F;  5IYD G;  2IX1 A;  2HHH Q;  1YZ6 A;  4C3H B;  3OW2 A;  4QIW B;  3VR6 A;  2UUA L;  2MO1 A;  1U0L A;  1SRO A;  5DLQ E;  4C3H G;  2NYZ D;  4A3D B;  4IUT A;  4JI7 Q;  3S1M H;  1I4H A;  4PV1 C;  5IY0 A;  3R2I A;  2PYK A;  1I50 H;  1JOK A;  1M4V A;  1XPO A;  2ICI A;  2BE5 C;  4FDB A;  4XYO A;  4JI8 Q;  3HKZ E;  1TS3 A;  4IUP A;  1N36 Q;  2HHH L;  2OF1 A;  3IAY A;  3GTP H;  2VW9 A;  3M4Y A;  4KN7 C;  3ZJY C;  1KRT A;  1TR5 A;  1R9T B;  1FL0 A;  4P75 A;  2XIW A;  4JI7 L;  1ENA A;  5DAU A;  4GKK Q;  1X56 A;  5HY6 A;  5IWA L;  1EU3 A;  1EYG A;  4DAV A;  4B08 A;  4EQN A;  1CT1 D;  1EFW A;  4JBM A;  3LWU A;  4JI8 L;  4GOP A;  3CCL A;  2B2W A;  2ASB A;  5A35 A;  3K7A H;  3VYR A;  2A74 C;  2ZJP A;  4B3R Q;  2AKW B;  4DAY A;  1I6V C;  4U67 3;  1RHP A;  2CHB D;  1DZ1 A;  1Q86 C;  4JI3 Q;  2I5L X;  3T4A C;  2F0N A;  4LMQ D;  3PSI A;  1GUW A;  1NY4 A;  1SYC A;  5KND A;  3E3X A;  5F2D A;  1YEZ A;  1H9M A;  1NBW A;  5IYD H;  3UDI A;  3TP5 A;  2F0S A;  4C3I B;  3J80 E;  3HKS A;  1T9H A;  1SYE A;  4GKK L;  1DJR D;  5D14 A;  1SFO H;  4C3I G;  3TRZ A;  2JA7 B;  2F0O A;  2L0C A;  5ISR A;  4LF8 Q;  1VQ8 A;  2TSS A;  3K57 A;  5ELC A;  2F0G A;  2B2V A;  3NWS A;  2YTY A;  1AEX A;  4B3R L;  4ZQ3 A;  3S1Q B;  2YU9 B;  1LTT D;  4LUZ A;  1PFN A;  2IWH A;  3TME A;  4FO2 A;  1X3G A;  3R2T A;  5KNB A;  1WTO A;  4H0L C;  1D6E C;  1PZK D;  3RZD H;  2PZU A;  2KHI A;  3HGB A;  1SYG A;  1DOL A;  4LF8 L;  3J81 L;  4DKA C;  3HOU B;  5JJK A;  2Q2H A;  3NUC A;  2JJQ A;  2OXP A;  1H9S A;  1CKO A;  1FNU A;  3EJI A;  4DFA A;  3HOU G;  3CCV A;  3HOY B;  4EQP A;  2O5J C;  1I4G A;  1VQM A;  3HOY G;  4O42 A;  1SNP A;  3CCM A;  1V9P A;  1JOQ A;  3D8G A;  4CJ2 C;  1EWC A;  4HIK A;  2LXJ A;  3H15 A;  4N8F A;  1X3F A;  4HIM A;  2BDN A;  5G3L D;  3K5L A;  3DWA A;  3K7U C;  3VYS A;  1NE3 A;  1PFB A;  3PIO 3;  5M3F B;  4A3G G;  4WJ4 A;  1P16 A;  3OWE B;  5IP9 H;  4A3J B;  3L9A X;  4C3I H;  5M3F G;  1FD7 D;  1PDQ A;  3AU7 A;  4P73 A;  4A3J G;  1LO5 D;  1O7L A;  2KCC A;  3A0J A;  4ULL A;  3M4O B;  1EZ8 A;  1HZ9 A;  3ONA B;  1S5E D;  1WJJ A;  1KLG D;  4GNX B;  4XQJ A;  1DOM A;  5I2Y A;  4GNX C;  4AYB G;  1UNS A;  2ALY B;  2MGS A;  2AUJ D;  1VQC A;  3PUZ A;  2D2C C;  4FXK C;  2DJF C;  4R1J A;  1HA5 A;  2R92 B;  2B63 B;  2YV5 A;  3G71 A;  3A5U A;  1NCV A;  2IHE A;  4QGU A;  5M5X B;  4DV0 L;  1XWE A;  2B63 G;  2R92 G;  3HOU H;  4RCO A;  1LAB A;  3GTL B;  1RIP A;  2P5Z X;  3OHX C;  1QOH A;  2WAQ B;  4IPC A;  2R93 G;  1EOT A;  2F0W A;  1EIF A;  3GTJ B;  1BF4 A;  5JVH 3;  1TWA B;  4A3G H;  4JVZ A;  1J8I A;  4CJ0 B;  5CBA E;  4V0B A;  2R7Z B;  2F0V A;  1QNK A;  4A3J H;  1LTR D;  1IBK Q;  3E0J A;  3TS0 A;  4B3S L;  4GN3 B;  5BN3 A;  4LW1 A;  3GD7 A;  2GVB A;  2Z6K C;  3HZX A;  3M3Y H;  2E2D C;  1F77 A;  1AH9 A;  3DM3 A;  2XWB B;  1QB5 D;  1SE2 A;  3C3L A;  1IBM Q;  5CGK A;  3NHH A;  2VXW A;  1CA5 A;  1RL2 A;  2JEA I;  1U4L A;  1Z6H A;  1XNR Q;  4JI6 Q;  4DV3 Q;  4DXF A;  3K5M A;  1F2M A;  1B70 B;  4BS9 A;  1HZA A;  5J22 A;  3GP7 A;  2X6G A;  2IT1 A;  3STB C;  1YHB A;  1XMO Q;  4FF4 A;  3F2C A;  3WOE A;  2F0M A;  3S2H H;  2PI2 E;  1YNX A;  1IBM L;  1C48 A;  1GKH A;  5JOB A;  2R93 H;  4IJL A;  4RWS C;  2E75 C;  4TRD A;  1HNW Q;  4JI6 L;  3HOZ H;  3GTG H;  2QGQ A;  4UAI A;  4DV3 L;  1BCP B;  1EFI D;  1WTR A;  1ASY A;  1IHZ A;  4CDF C;  1ROD A;  1YNN C;  4DR6 L;  1XMO L;  4AH6 A;  1DYQ A;  3KBX A;  2K01 A;  1KIX A;  4OHJ A;  3G6E A;  1PV4 A;  2XTI A;  1PMR A;  2ZJR A;  4DK1 A;  1B9N A;  1PZJ D;  1IZ6 A;  1JWS D;  4NP5 A;  1B3A A;  1N9W A;  1V1P A;  2A69 C;  5C4Z A;  1K0R A;  1HNW L;  4R4O A;  4KMU C;  5C0X J;  3QIA A;  2F0H A;  3VA7 A;  2QDB A;  5JPN C;  3JAM i;  3QR8 A;  1RTO A;  4TQU S;  2IX3 A;  2MO0 A;  1TY2 A;  2LSS A;  4HCS A;  5DM6 3;  5C4J H;  3T1Y Q;  4DR4 Q;  4L5S A;  3TP6 A;  5IGC A;  4QY7 A;  3UE0 A;  3U58 A;  3KF6 A;  3MXN A;  1WFQ A;  2A1A A;  3I72 A;  1O7Z A;  4ODG A;  1LTI D;  3JC6 6;  5IGG A;  2R7F A;  3S1R B;  2WAC A;  4LF4 Q;  4KK7 A;  1HCZ A;  3V96 A;  3CHB D;  1HFN A;  3X3N A;  2F1M A;  3PO2 B;  3Q8D A;  3C1E A;  1YI2 A;  1QVG A;  1IBL L;  4NXN L;  3HRZ C;  5C0X G;  2OQK A;  1OXX K;  4MZ9 A;  2UXD Q;  5K5P A;  1VMP A;  4JI5 Q;  4ZKB B;  2ICE C;  3BZC A;  4XQN A;  1HQR D;  3PO2 G;  2NVQ H;  4Y7N B;  3CC4 A;  3BJU A;  3ZYY X;  2MQH A;  3T1Y L;  3T13 A;  4DR4 L;  4JV5 Q;  2EOT A;  1L2F A;  2ZXO A;  4X3U A;  3NBI A;  1PH9 A;  4C3J G;  1O7Y A;  1SLJ A;  1B7Y B;  4KJN A;  4LF4 L;  4A3E B;  3NPP A;  3KF8 B;  5C3W A;  4X65 Q;  1UEB A;  1XNQ Q;  4A3E G;  3HOX B;  4R8I A;  1XX8 A;  3Q6S A;  4JI5 L;  3HS0 C;  3S1N B;  3HOX G;  2N49 A;  3HKZ G;  3K59 A;  3S14 H;  5JJZ A;  3BVG A;  4NXM Q;  3H0G B;  2MHV A;  2VL6 A;  4CBV A;  1UE5 A;  4NPS A;  4LFA Q;  2VS1 A;  2XVS A;  4ZCK A;  1WD1 A;  1G6P A;  1VCI A;  4DAM A;  1A3T A;  2QW7 A;  4DNI A;  1VQB A;  1VS0 A;  3KDF A;  5FLX E;  4X64 L;  4NXM L;  3BU2 A;  1E2Z A;  1EEI D;  1VQG A;  2Z1C A;  2JP1 A;  3WDN A;  1K8G A;  2E8G A;  3VR4 A;  2GN5 A;  1TWF H;  2L55 A;  3I90 A;  4C3J H;  4K2L A;  1TS2 A;  2EQS A;  1Y1V B;  2XRQ D;  4G7H C;  3CQZ B;  3L7Z C;  1K3R A;  1Y1V G;  3DMU A;  3P1H A;  1RJT A;  3ER0 A;  2XN9 C;  2CW0 D;  2WFW A;  2R61 A;  1A2U A;  2EYJ A;  3K5O A;  3HOX H;  1GHK A;  1YIJ A;  4ZK9 B;  4N9T A;  2NVT B;  3S1N H;  3BVZ A;  1VQ4 A;  1DM0 B;  1PYB A;  4WJW A;  2N55 A;  4C56 C;  2F0L A;  4OON A;  3I4M G;  2B2Y C;  1LT6 D;  1P8L A;  2QKI C;  4JW0 A;  1DGS A;  5IGD A;  4OEL B;  4MN3 A;  2CKZ B;  1ZXT A;  4CDD C;  1ESF A;  2VUM B;  3KOJ A;  4A3K B;  2HQL A;  4DXG A;  2G5D A;  1NUC A;  2VUM G;  4M8A A;  2AQ1 B;  5GAD C;  1N33 Q;  3D0F A;  1RD9 D;  1F2L A;  4A3K G;  2K04 A;  4JYA Q;  1DD2 A;  1EYC A;  2EVB A;  1YJN A;  4PZ6 A;  3CU7 A;  1SE4 A;  2IL8 A;  5IT9 c;  3BZK A;  3A74 A;  3L3O C;  3G48 A;  4A93 B;  2EDG A;  1WCM G;  1TWC B;  1JE5 A;  4RA8 A;  4Q5V A;  1K83 H;  4A93 G;  3OYY A;  1V1Q A;  4AQY Q;  1MGS A;  2PCF B;  3DEP A;  1WTX A;  1KD1 C;  3S16 B;  5E7N A;  3PUY A;  3SK8 A;  3CPW A;  1N33 L;  3EQL C;  3OMG A;  2E2H H;  3WOF A;  2IX0 A;  3I4L A;  4JYA L;  1Q1E A;  2A6H D;  2KA7 A;  4JBJ A;  5H1S E;  1EY4 A;  4OIK A;  1K73 C;  3GTO H;  2VY3 A;  3PUX A;  4IQZ A;  3ERO A;  2WB1 B;  1UWV A;  4HMI A;  1N32 L;  4AQY L;  3GTM H;  2VB3 X;  3I4M H;  2E2J H;  4DV1 Q;  1U4R A;  2WB1 G;  3KLR A;  3I7F A;  2RVL A;  3N52 A;  1BDO A;  1Y69 U;  2OT2 A;  2RDF A;  1PH7 A;  2R7D A;  3PF5 A;  1JOR A;  3R8B A;  1U4M A;  3M9B A;  4GN5 A;  2B2T A;  1C7Y A;  1ICF B;  3CKI B;  4RGO S;  3VDY A;  3K0X A;  1SAP A;  1D5Z C;  1NAP A;  4K8J A;  3W5O A;  2D0O A;  2XRS D;  3F2D A;  1WTQ A;  2L12 A;  1WCM H;  1KDA A;  2ZXP A;  5D3D A;  4QCL A;  2CCZ A;  5EGT A;  1V8Q A;  5COR A;  2Q8I B;  1AP0 A;  1MI2 A;  2OEO A;  3M7G A;  4R4I A;  5KYL A;  2IW3 A;  5CC4 A;  1PYS B;  4IUR A;  1OXT A;  1F9S A;  4IOA A;  4N9P A;  1I3Q B;  4NKL A;  4UP8 A;  5I6Y A;  1LLR D;  2FMM A;  3OWF A;  1LTG D;  1E22 A;  4O0A A;  5M5Y H;  4KY5 A;  1A3V A;  5G3L F;  4MTK A;  5C5M A;  1TII D;  2PZW A;  3HOW H;  1G2T A;  1HZB A;  1PTO D;  3PIP A;  4LAA A;  1A15 A;  5JEA H;  1WTW A;  1TVX A;  1H9S B;  4KHV A;  3RR5 A;  1PH6 A;  1FJG Q;  5CV9 A;  3U9O A;  2CFM A;  1AE3 A;  2JN4 A;  2EYL A;  2Z8L A;  4X62 Q;  3CAM A;  4G57 A;  1QIL A;  2VB2 X;  1I50 B;  3PMF A;  2VZA A;  3RN5 A;  5IOD A;  3T16 A;  4XXE A;  2QIL A;  5TSS A;  1H95 A;  1JCK B;  5DEH A;  4JI2 Q;  1FJG L;  2EIF A;  3K5N A;  1HRJ A;  1PFS A;  1D7Q A;  4HJ8 A;  3KLW A;  2KHS A;  2BH2 A;  1K9M C;  1KHI A;  1QVC A;  4X62 L;  1LT3 D;  2M9V A;  4B9X A;  4JI1 Q;  2YTV A;  3TN2 A;  2F0I A;  2EJM A;  3H3V I;  4XTC S;  2RDH A;  1HR0 W;  2Q8R E;  1VQJ A;  3PUV A;  3K7A B;  2Q2T A;  4YWL A;  3BDL A;  4BY7 H;  1YHQ A;  2EYF A;  1PA6 A;  2BE5 D;  2H1E A;  4RGN A;  1LAC A;  1W2B A;  1XMQ L;  2LS0 1;  5EPJ A;  4FXG C;  3NP8 A;  1X3E A;  3P20 A;  1STE A;  1STH A;  4QL5 A;  1B4O A;  3ULL A;  1X9N A;  1SFO B;  4JI1 L;  1AE2 A;  4M1U B;  2G9H D;  3KLS X;  3NEL A;  5C5L A;  2D62 A;  2BDO A;  3VR2 A;  2F4I A;  2K50 A;  3H09 A;  3VYU A;  3TSS A;  3VR3 A;  2PNH A;  5IWA Q;  4WRD A;  3ULJ A;  3I4O A;  3VA5 A;  4ZYS A;  2KED A;  3OPO A;  1JE4 A;  1MKH A;  3LNN A;  3RZD B;  2Q2I A;  2KEN A;  1GUG A;  1CSQ A;  4ME3 A;  5J1Z A;  3OOC A;  1TT2 A;  4JCV E;  1B44 D;  5E4X A;  2NBF A;  5IGE A;  1IYU A;  3UE1 A;  4KHZ A;  3TRE A;  3MC0 B;  1JJG A;  1II3 A;  2R6G A;  3D3R A;  5DNF A;  1GJX A;  2DGY A;  5E1F A;  2QEJ C;  3PO3 H;  4L8J A;  1WI5 A;  2A68 C;  1RCV D;  4KY6 A;  2F3W A;  2MP1 A;  5DM7 3;  2K6A A;  1RDP D;  1SR3 A;  1GHJ A;  2KEE A;  2HCI A;  1KAW A;  5C44 H;  2K5N A;  3SK5 A;  1Y8N B;  4KI0 A;  3FDT A;  5IYB G;  5FJ8 H;  1NR2 A;  1EIH A;  4J8Q A;  3AEV A;  5IP9 G;  4A76 A;  3CPF A;  4PZ8 A;  2V4D A;  3D6W A;  1VQA A;  2K32 A;  5EPL A;  4QB4 A;  3J81 c;  1BR9 A;  2L1B A;  3HP3 A;  4BA1 I;  2DJG C;  4J6H A;  3J80 i;  3SK4 A;  3SE0 A;  2WKC A;  2L5T A;  4PNY A;  4XYQ A;  3D4D A;  3L2P A;  3AFP A;  1H9R A;  4R9W A;  1HZC A;  3QOL A;  1E3P A;  1EQR A;  3F8T A;  1Z7T A;  2I46 A;  4O2D A;  1S72 A;  1QJO A;  3CRL C;  2N88 A;  3OW7 A;  4FYD A;  4HTH A;  1SNQ A;  1R4P B;  3T56 B;  1GUS A;  2HCC A;  1UEA B;  1EQQ A;  2F0Q A;  1EUJ A;  1M90 C;  1V1P B;  2PI2 A;  4DV6 Q;  3NTK A;  1ENC A;  1Q7Y C;  2PQA B;  5NUC A;  1A3U A;  1CHP D;  2NVY H;  3FKI H;  2F03 A;  4A3G B;  3H94 A;  1ZYR C;  5IYB H;  3U50 C;  4DNT B;  1F2Z A;  3E9I A;  5CBE E;  4RHR A;  4YY3 Q;  1Y8P B;  4RHS A;  3H91 A;  4EQ5 A;  3KF6 B;  3MXN B;  2EXD A;  4DV6 L;  3PQI A;  3CCJ A;  4DPG A;  1BVS A;  1YBY A;  4X3K A;  3PF4 A;  3M3Y B;  1PRT B;  3NQI A;  3P7J A;  4AYB B;  1SNO A;  1L0W A;  5IGF A;  4DV0 Q;  2MNA A;  2F0D A;  1JIC A;  3CW2 C;  1AFP A;  1PRT C;  3AFQ A;  1HXY D;  4YWM A;  2RF4 A;  3FHW A;  3PIO A;  3J81 E;  3KFU A;  2XWJ B;  3C46 A;  5M5W H;  4YY3 L;  1H9J A;  2L15 A;  4PG3 A;  2K33 A;  1HTP A;  4ILW A;  2NB0 A;  4TSS A;  3MVV A;  2ZM6 Q;  3NSW A;  2K5W A;  2K4K A;  4EQO A;  4JOI A;  2B2U C;  4PMW A;  5K36 G;  5CV8 A;  1J6Q A;  3S2H B;  1GUO A;  1JB7 A;  2R93 B;  3MXU A;  4DK3 C;  1VQN A;  1A0I A;  3G4S A;  1BO0 A;  2SEB D;  4B3S Q;  2EYO A;  1EQT A;  3R3O A;  4P72 A;  2VQE Q;  4JK1 C;  4IUV A;  4LWC A;  5FLM H;  1BKB A;  3BVM A;  3HOZ B;  3GTG B;  2OQ0 A;  4K5W A;  3RLO A;  4G4K A;  4DR3 L;  2EZV A;  2E76 C;  5EAY A;  2ZM6 L;  3CC2 A;  1U4P A;  1NJI C;  3HOZ G;  2UUB Q;  4A3F G;  1JMC A;  1X32 A;  3KYH C;  4JG2 A;  1D2B A;  3TZU A;  3HOV H;  4A3I B;  1TWG H;  4PQX A;  3STB D;  3TBI B;  3MEF A;  3H6M A;  3PUW A;  2PO4 A;  4A3I G;  1QZH A;  2VQE L;  4FF1 A;  1K0S A;  3A5Z B;  3KDF B;  2RHQ B;  2V1C C;  3JAM c;  1VQ7 A;  3RZO H;  3NTH A;  1EY7 A;  3KJP A;  4C2M H;  2KJX A;  3HFZ B;  2UUB L;  2Z4H A;  1QG7 A;  1EU4 A;  1D1K A;  3ND8 A;  1PH4 A;  5C4J B;  3K0Y A;  1V1O A;  3O13 A;  2NN6 I;  3J7A F;  1Q1B A;  1A6X A;  5FO9 B;  1YNN D;  1SYF A;  5CV6 A;  1VMC A;  2H5X A;  4ZRZ A;  4LFB Q;  3JAM L;  2KCT A;  5K36 H;  1Q81 C;  4HJ7 A;  2MFI A;  1JB3 A;  4DR6 Q;  2VQF Q;  2QF7 A;  1BBW A;  3I2Z A;  2A6E C;  2A69 D;  2DNE A;  1F9P A;  3OIP A;  1YJW A;  1E7Z A;  4XQQ A;  5C4X G;  2NVQ B;  1EYA A;  3BS1 A;  5M3M G;  3CC7 A;  3RUZ A;  1LT5 D;  1STN A;  4BY1 B;  1CQV A;  3DXJ C;  1V43 A;  1QWY A;  1AZP A;  1RTN A;  2FIN B;  4A3F H;  4LFB L;  4BY1 G;  2NVX B;  4YCW A;  3KBG A;  1BCP C;  2VQF L;  2CQO A;  3S17 H;  2O4X A;  5BN4 A;  3CCQ A;  2EYP A;  3A8K E;  4X66 Q;  4A3I H;  1AN8 A;  2ZXR A;  5CV5 A;  2B39 A;  4A3M G;  1A8V A;  4A3B H;  4DV4 Q;  1H9K A;  2F0E A;  4QUF A;  1SYB A;  3FRP B;  1S5C D;  3CME A;  1CQF A;  4KN4 C;  1L1O B;  1PZI D;  5C3E G;  2OCE A;  2E2I H;  3S14 B;  4NB3 A;  2UUC Q;  5JPM C;  1XJV A;  2KHJ A;  1IBL Q;  4NXN Q;  2ENB A;  2AUK A;  3A55 A;  1B3Q A;  1NMF A;  2RSO A;  3HG9 A;  2D5D A;  4L6T B;  4X66 L;  4H7B A;  1BQQ T;  1A62 A;  2PMZ E;  3K6O A;  1IYJ B;  4WOR A;  4DV4 L;  4XIG S;  2PW7 A;  3I3C A;  3S15 H;  1M1K C;  1CKM A;  1EYD A;  2XGT A;  3GV6 A;  4KLK A;  1UE1 A;  2UUC L;  1TWH H;  2A19 A;  5C4X H;  4H13 C;  2YTX A;  5M3M H;  3QOJ A;  4Q0F A;  3BZD B;  2UXB L;  3CCE A;  1TWF B;  5BN5 A;  2KOL A;  4CJ1 B;  1OXS C;  4C3J B;  4BY1 H;  1X65 A;  1ILQ A;  1PH5 A;  1VQF A;  3GO5 A;  4QMG A;  3SK6 A;  4C1N I;  2NVX H;  1UE7 A;  1I94 Q;  1NTG A;  3SHL A;  1K8A C;  1OXV A;  4OEM B;  3K58 A;  1CUK A;  2F52 A;  3U4Z A;  2I0Q A;  4GNX A;  1JQY D;  4A3M H;  4QJF A;  3NBH A;  1OXU A;  2OTL A;  2HDL A;  5ELF A;  2NZ1 D;  5IYC G;  5LL6 X;  3FPU B;  1MBY A;  3FP9 A;  2Z4I A;  2FFK B;  5C3E H;  3HKZ B;  1B8A A;  1HA6 A;  1DON A;  3OIQ A;  1BBX C;  1PTO F;  5FKA C;  5I2X A;  5J39 A;  2K5V A;  4X3S A;  4YHH L;  4RAU C;  4RG1 A;  4TKO B;  4BBR H;  4X64 Q;  3A7A B;  1I94 L;  2OWO A;  1HQM C;  2F3I A;  3U9S A;  1GUT A;  3NTI A;  3W3A A;  4IPH A;  4K6L A;  2JE6 I;  4RH6 A;  3VR5 A;  2QEX A;  3DLL A;  2LY7 A;  2JA6 G;  4HMJ A;  1DOK A;  3K8A A;  1C4Q A;  3URY A;  3R93 A;  1U5K A;  2C35 B;  1SRU A;  3D4R A;  2LKV A;  5HGQ A;  1EIY B;  3KUP A;  2LXK A;  2MUY A;  1HNX Q;  3I70 A;  3D6C A;  1YVC A;  1A63 A;  1K83 B;  5COY A;  2M00 A;  2HDM A;  1XPU A;  3Q22 A;  5GAG C;  1KDB A;  1TS5 A;  1E0B A;  1KDC A;  3CP0 A;  2JYO A;  3X3M A;  2Z6K A;  2E2H B;  1HJP A;  1STB A;  4OWT B;  5A2Q L;  4IFD J;  5IYC H;  2J7Z A;  3FMC A;  2X6L A;  2N78 A;  1TU2 B;  1E2W A;  4OX9 Q;  3GTO B;  1HNX L;  2I5H A;  2K75 A;  2ZTD A;  2KUM A;  2KCN A;  3GTM B;  3I4M B;  5GQO A;  2E2J B;  1I4X A;  1T5X D;  3C1F A;  1NMG A;  2FJ2 A;  1JT8 A;  1VQD A;  4ZLT F;  1Q82 C;  3IKJ A;  3EFX D;  2Z9H A;  2JK8 A;  5AFW A;  2NTT A;  1ZEQ X;  4ZKC B;  5HGT A;  2JA6 H;  4OX9 L;  1CKN A;  4IFD G;  4DR7 L;  1KRS A;  2JA9 A;  4EX5 A;  1G2S A;  1X54 A;  4CKE A;  1B1Z A;  5KGU A;  4OWW B;  4OWX B;  3A8J E;  3KK7 A;  1X3P A;  1RKN A;  4BXX G;  4JC0 A;  1WCM B;  4FF3 A;  3CMA A;  4KD3 A;  2SOB A;  4K14 A;  4IFD I;  1N32 Q;  2B8G A;  1EY9 A;  5JEA J;  1PFM A;  5KYI A;  5C6A A;  4BWG B;  1CI3 M;  1F9Q A;  4CHT B;  4B3M Q;  1MIU A;  1S3O A;  1WVL A;  5M5Y B;  2ES2 A;  5ELE A;  1Q46 A;  1KAA A;  4LF6 Q;  1PVO A;  3MHB A;  3EIV A;  4ALP A;  2K5Q A;  5EKL A;  3DHQ A;  3HOW B;  1K8M A;  3OSO A;  4PMB A;  5CR3 A;  4ZUJ A;  2MJ8 A;  3TQY A;  4KKU A;  2HUG A;  2MPM A;  3HOW G;  3QWN A;  2FHT A;  5JEA G;  4B3M L;  1AW7 A;  3M7N A;  4RMF A;  4DK0 A;  1CFM A;  3M4Q A;  4LF6 L;  4IFD H;  1I5F A;  4GOP B;  3D4W A; 
#chains in the Genus database with same CATH homology
 1MJC A;  4JCV E;  4Y52 H;  4IPC A;  4LUV A;  4LF9 Q;  2R93 G;  2WAQ E;  4L5Q A;  3UE1 A;  2VNU D;  4KHZ A;  4GOP C;  1EIF A;  4GN4 B;  3TRE A;  4A3C G;  5BR8 Q;  4DAY B;  4BXX H;  1JJG A;  2R6G A;  2A8V A;  1WYD A;  1Z9F A;  5C0X I;  4DV2 L;  2HT1 A;  2DGY A;  4DR2 Q;  1VQP A;  2UXD L;  4A3G H;  3PO3 H;  1WI5 A;  3UDX A;  4JYA L;  4OO1 I;  4JV5 L;  4A3J H;  1SR3 A;  4LFC Q;  1IBK Q;  1KAW A;  1Z47 A;  2DUD A;  5C44 H;  3TS0 A;  2K5N A;  4B3S L;  4GN3 B;  2ZJQ A;  4WJ3 M;  1SN8 A;  2AWO A;  3GD7 A;  1JJC B;  2GVB A;  4KI0 A;  3E0E A;  2WP8 J;  2NZH A;  2AWN A;  4LW1 A;  5IYB G;  3CXC A;  4DUZ L;  4X65 L;  4UPA A;  2Z6K C;  5BR8 L;  3H0G G;  3M3Y H;  5FJ8 H;  1XNQ L;  1AH9 A;  1VQL A;  3DM3 A;  3AEV A;  3EBE A;  5IP9 G;  4DR2 L;  3NEN A;  4LF5 L;  4BY7 G;  4A76 A;  3CPF A;  1X55 A;  4PZ8 A;  1IBM Q;  4P74 A;  1VQA A;  2CWA A;  1PH1 A;  1BBU A;  1RL2 A;  2RHS B;  3S1R H;  3J81 c;  2JEA I;  4HJ5 A;  1XNR Q;  4LFC L;  4JI6 Q;  3PO2 H;  4DV3 Q;  4BA1 I;  4LUO A;  5GAH C;  3J7Z C;  2Y0S E;  4BBS H;  3J80 i;  4DR7 Q;  1B70 B;  3ERS X;  1HZA A;  1GO3 E;  2F4V Q;  4LFA L;  3S2D H;  1HR0 Q;  2IT1 A;  3L2P A;  3STB C;  1YHB A;  4Y7N H;  4DR5 L;  1XMO Q;  3F2C A;  3AFP A;  1W3S A;  1HZC A;  3S2H H;  1E3P A;  1EQR A;  2PI2 E;  1YNX A;  3F8T A;  1IBM L;  2R93 H;  1GKH A;  2K14 A;  4O2D A;  3M4P A;  1S72 A;  4IJL A;  4IJH A;  4A3C H;  3LGJ A;  1SE8 A;  1Y14 B;  4APV A;  4A3E H;  1PH2 A;  1HNW Q;  4JI6 L;  5IE8 A;  5LMN Q;  3HOZ H;  3GTG H;  3J7A 5;  2QGQ A;  4L5T A;  5ELO A;  5ELN A;  4YCU A;  4DV3 L;  1EQQ A;  1EUJ A;  1M90 C;  1QVF A;  4LF7 Q;  2PI2 A;  4DV6 Q;  1Y1W G;  1XMQ Q;  2ID0 A;  3I55 A;  1ASY A;  4LF9 L;  2F4V L;  2JEB I;  1Q7Y C;  1HR0 L;  2PQA B;  4BBS G;  1LYL A;  1XMO L;  4DR6 L;  4AH6 A;  1SMX A;  2NVY H;  3GDE A;  2QA4 A;  3W1G A;  1XPR A;  1KIX A;  3G6E A;  3FKI H;  1PV4 A;  2XTI A;  2GVA A;  1LTL A;  4POG A;  2CWP A;  2ZJR A;  3I4N G;  5IYB H;  1IZ6 A;  3U50 C;  3H0G H;  1N9W A;  3B6Y A;  3E9I A;  3PO3 G;  1PHJ A;  1K0R A;  4YY3 Q;  1HNW L;  2KBN A;  4R4O A;  5LMN L;  4JI4 Q;  5C0X J;  3TEH B;  4EQ5 A;  3KF6 B;  3MXN B;  2ZTE A;  1VQE A;  2EXD A;  1IL2 A;  3JAM i;  4LF7 L;  4DV6 L;  4TQU S;  1MJE A;  3CCJ A;  4DPG A;  1BVS A;  5C44 G;  1I6H H;  1YBY A;  3PF4 A;  2MO0 A;  3PCO B;  2LSS A;  1PH3 A;  1L0W A;  4DV0 Q;  5J3B A;  4AYB E;  5C4J H;  2MNA A;  3T1Y Q;  3CW2 C;  3KJO A;  1L1O A;  3AFQ A;  5GRO A;  3RLN A;  2BA0 A;  1GM5 A;  4L5S A;  4DR4 Q;  3GTK H;  2UXD Q;  2FXQ A;  2N8N A;  5FJ8 G;  4QY7 A;  3UE0 A;  3U58 A;  3KF6 A;  2IHF A;  2RF4 A;  4YWM A;  1WFQ A;  2A1A A;  3FHW A;  3PIO A;  2UU9 Q;  1G51 A;  3S24 A;  3KFU A;  3OTO Q;  3JC6 6;  2R7F A;  4IPD A;  5M5W H;  4YY3 L;  4LF4 Q;  1LUZ A;  2L15 A;  4JI4 L;  1VQ9 A;  4PG3 A;  4DV2 Q;  3Q8D A;  1YI2 A;  1QVG A;  1IBL L;  1KXL A;  4NXN L;  1Y1V H;  5C0X G;  2HIX A;  2OQK A;  1OXX K;  4MZ9 A;  2ZM6 Q;  4GLX A;  1ASZ A;  2K4K A;  4B3T Q;  3RLF A;  3CQZ H;  4JI5 Q;  4JBK A;  3BZC A;  3H3V H;  3PO2 G;  2NVQ H;  4JOI A;  4PMW A;  3CC4 A;  3UDG A;  5K36 G;  1VQO A;  1J6Q A;  1E1T A;  3BJU A;  2MQH A;  3D31 A;  1WOC A;  3T1Y L;  4JI0 L;  4DR4 L;  2RCN A;  4JV5 Q;  2AMC B;  1Y1W H;  2D0P A;  1JB7 A;  4OXP A;  2ATW A;  4OO1 G;  3PV0 A;  1L2F A;  4DK3 C;  1A0I A;  1VQN A;  1PH9 A;  3G4S A;  4L5R C;  3ICE A;  1QZG A;  4B3S Q;  2UU9 L;  4UY8 C;  1SLJ A;  3OTO L;  1B7Y B;  4P72 A;  2VQE Q;  2NVT H;  4GS3 A;  4LF4 L;  3CCU A;  4DUZ Q;  4LWC A;  5FLM H;  1BKB A;  3KF8 B;  4X65 Q;  2OQ0 A;  1UEB A;  3RLO A;  1XNQ Q;  3I4N H;  4A3E G;  4DR3 L;  4A3D G;  2ZM6 L;  5EAY A;  3RN2 A;  3CC2 A;  4PZ7 A;  1NJI C;  3HOZ G;  4HJA A;  4JI5 L;  2UUB Q;  4A3F G;  1JMC A;  4B3T L;  4LF5 Q;  5LMU L;  3CD6 A;  3KYH C;  2B29 A;  4R4T A;  4UP7 A;  4JG2 A;  3HOX G;  2N49 A;  3L0O A;  1KL9 A;  4A4I A;  2JA8 H;  3HOV H;  1N34 Q;  3HKZ G;  1KQS A;  3S14 H;  1TWG H;  3STB D;  2VUM H;  3CCR A;  4TVA B;  3FKI G;  1UE6 A;  3MEF A;  4NXM Q;  3PGZ A;  3PUW A;  2VL6 A;  4A3I G;  1QZH A;  1HH2 P;  4A3K H;  2VQE L;  2ZTC A;  3A5Z B;  1E24 A;  2N3S A;  1UE5 A;  2RHQ B;  2V1C C;  3KDF B;  4NPS A;  4LFA Q;  3JAM c;  3CF5 A;  1VQ5 A;  1VQ7 A;  4GLV B;  2VS1 A;  4DR5 Q;  3RZO H;  1GVP A;  3KJP A;  4DV1 L;  1YJ9 A;  3AYH B;  4C2M H;  1G6P A;  2JA5 G;  3HFZ B;  2UUB L;  1VCI A;  4R4C A;  4DAM A;  1EWI A;  4HJ9 A;  4YWK A;  4A93 H;  4DR1 Q;  4DNI A;  1PH4 A;  1VQB A;  1N36 L;  1N34 L;  2NN6 I;  1TWC H;  1Q1B A;  4A75 A;  1VS0 A;  3KDF A;  4X64 L;  2H5X A;  4GLA C;  4NXM L;  4LFB Q;  3S16 H;  3BU2 A;  2KCT A;  3E9H A;  1VQG A;  1K8G A;  5IP7 G;  1Q81 C;  3J81 j;  2E8G A;  3K81 C;  4HJ7 A;  2B3G A;  2MFI A;  1YIT A;  2GN5 A;  3WWV A;  1TWF H;  2VQF Q;  4DR6 Q;  1KC8 C;  4P71 A;  4MTN A;  1BBW A;  3I2Z A;  4C3J H;  2EQS A;  2Q2U A;  1X6O A;  4C3H H;  1YJW A;  3L7Z C;  1E7Z A;  4GKJ Q;  5C4X G;  1FVI A;  1K3R A;  4DR1 L;  1Y1V G;  4MNO A;  5M3M G;  3CC7 A;  1IXR A;  2JA7 G;  3ER0 A;  1G29 1;  2AHO B;  1V43 A;  4A3D H;  2WFW A;  4JI3 L;  4A3F H;  1HNZ Q;  4LFB L;  4BY1 G;  4YCW A;  4R4Q A;  3HOX H;  1YIJ A;  5AJ3 Q;  1GD7 A;  3S1N H;  3F1Z A;  1VQ4 A;  2VQF L;  2CQO A;  4DV7 Q;  1PYB A;  3S17 H;  3CCQ A;  4X66 Q;  5FLM G;  4A3I H;  3GTQ H;  2K52 A;  1A8V A;  1VQH A;  4OON A;  4A3M G;  4DUY Q;  4DV4 Q;  3I4M G;  4A3B H;  1JJ2 A;  4GKJ L;  3CME A;  2BH8 A;  1R9T H;  1P8L A;  1L1O B;  5C3E G;  4IO9 A;  3CCS A;  1DGS A;  2JA5 H;  2OCE A;  2E2I H;  2CKZ B;  3NEM A;  4NB3 A;  1HNZ L;  2UUC Q;  2JQO A;  2KHJ A;  1XJV A;  2JA8 G;  3HOV G;  1IBL Q;  1O7I A;  2Z0S A;  3KOJ A;  4NXN Q;  2HQL A;  5AJ3 L;  1OTC A;  4J15 A;  4QQB X;  2VUM G;  3TS2 A;  1D8L A;  4BA2 I;  2UXC Q;  5GAD C;  1PH8 A;  3D0F A;  1N33 Q;  1NMF A;  4DV7 L;  1C0A A;  4A3K G;  4JI0 Q;  4X66 L;  1QUQ B;  1Q8K A;  4JYA Q;  1A62 A;  2PMZ E;  3UDF A;  1YJN A;  4PZ6 A;  2UUA Q;  1IYJ B;  5IP7 H;  4DUY L;  4DV4 L;  5IT9 c;  4XIG S;  3I56 A;  3BZK A;  3A74 A;  3G48 A;  1VQI A;  3S15 H;  1WCM G;  1M1K C;  1I3Q H;  4JBW A;  1CKM A;  4JOI C;  3K80 C;  2XGT A;  4KLK A;  1JE5 A;  1UE1 A;  1N8R C;  1K83 H;  4A93 G;  3ULP A;  2UUC L;  1TWH H;  3OYY A;  1V1Q A;  4AQY Q;  3J80 c;  4JI2 L;  2A19 A;  5C4X H;  1KD1 C;  4DR3 Q;  1QUQ A;  2YTX A;  5E7N A;  3U4V A;  5M3M H;  2JA7 H;  4AIM A;  3PUY A;  2UXC L;  3M85 A;  5LMU Q;  3CPW A;  3CCE A;  5LMN W;  2KCM A;  1N33 L;  2UXB L;  2E2H H;  1E1O A;  2IX0 A;  3NBH B;  4IOC A;  1OXS C;  1Q1E A;  5IYD G;  1X65 A;  4JBJ A;  2YU9 H;  4BY1 H;  2IX1 A;  1PH5 A;  2HHH Q;  1YZ6 A;  3S1Q H;  3OW2 A;  2UUA L;  5H1S E;  1VQF A;  3J81 i;  3GO5 A;  2NVX H;  1UE7 A;  1U0L A;  2MO1 A;  1K73 C;  1SRO A;  2VY3 A;  3PUX A;  1I94 Q;  3GTO H;  5DLQ E;  4DK6 C;  1NTG A;  3IRB A;  4IPG A;  1K8A C;  1J5E Q;  1OXV A;  4K0K Q;  4JI7 Q;  1UWV A;  1CUK A;  2F52 A;  2WB1 E;  3U4Z A;  2I0Q A;  4AQY L;  3GTM H;  3S1M H;  4GNX A;  4A3M H;  3I4M H;  1N32 L;  4QJF A;  2E2J H;  4DV1 Q;  1OXU A;  2WB1 G;  2OTL A;  5IYC G;  5IY0 A;  3I7F A;  1I50 H;  3AQQ A;  3FP9 A;  2BA1 A;  5C3E H;  1XPO A;  1B8A A;  4FDB A;  4JI8 Q;  3HKZ E;  1PH7 A;  1YHA A;  1Q12 A;  2R7D A;  3PF5 A;  3RNU A;  3M9B A;  1N36 Q;  2HHH L;  4GN5 A;  3HOY H;  2K5V A;  1C7Y A;  3GTP H;  2NN6 G;  2VW9 A;  4YHH L;  3VDY A;  4RG1 A;  4BBR H;  4X64 Q;  1I94 L;  3K0X A;  1KRT A;  3ZJY C;  2OWO A;  4DV5 Q;  1FL0 A;  2F3I A;  4P75 A;  1J5E L;  4A3B G;  4K0K L;  3T1H Q;  4JI7 L;  2WAQ G;  3W5O A;  2D0O A;  2NZO A;  4GKK Q;  4IPH A;  1X56 A;  5HY6 A;  5IWA L;  1S40 A;  1EYG A;  3F2D A;  2JE6 I;  1EFW A;  1WCM H;  2QEX A;  4JBM A;  3DLL A;  2JA6 G;  2IY5 B;  3K8A A;  4JI8 L;  4GOP A;  2CCZ A;  3CCL A;  2ASB A;  5M3F H;  1VQK A;  3K7A H;  1U5K A;  4B3R Q;  2ZJP A;  2C35 B;  2K5H A;  1SRU A;  4R4I A;  2AKW B;  4A3L G;  1PYS B;  5GAE C;  5HGQ A;  1Q86 C;  1EIY B;  2R7Z G;  1OXT A;  4JI3 Q;  2I5L X;  2LXK A;  3PSI A;  1NY4 A;  4IOA A;  1HNX Q;  4DV5 L;  3M4O H;  1YEZ A;  1NBW A;  4UP8 A;  1YVC A;  4LNQ A;  3UDI A;  3T1H L;  5IYD H;  1A63 A;  3HKS A;  1T9H A;  4GKK L;  1XPU A;  1E22 A;  4O0A A;  5M5Y H;  1SFO H;  5GAG C;  3TRZ A;  3CP0 A;  4LF8 Q;  1VQ8 A;  1VQ6 A;  2Z6K A;  2YTY A;  4B3R L;  1HJP A;  3HOW H;  4OWT B;  1IBK L;  4IFD J;  1HZB A;  5IYC H;  4LUZ A;  3PIP A;  4X6A H;  2E5L Q;  2N78 A;  4OX9 Q;  2B63 H;  2R92 H;  1X3G A;  3RR5 A;  1CSP A;  1PH6 A;  1HNX L;  1FJG Q;  2OTJ A;  2I5H A;  2K75 A;  2ZTD A;  1FGU A;  2Y0S G;  2CFM A;  1AE3 A;  5M5X H;  3GTL H;  5GQO A;  4X62 Q;  3RZD H;  1CKN B;  2KHI A;  3CAM A;  4LF8 L;  1NMG A;  2HIV A;  1JT8 A;  4DKA C;  3W1B A;  1VQD A;  2VZA A;  2Q2H A;  5JJK A;  3RN5 A;  1Q82 C;  5JJL A;  2JJQ A;  1CKO A;  1H95 A;  1XNR L;  3GTJ H;  2JK8 A;  3CCV A;  3HOU G;  1TWA H;  2E5L L;  1L1O C;  4JI2 Q;  2JA6 H;  4OX9 L;  1VQM A;  1CKN A;  1FJG L;  4IFD G;  4DR7 L;  1KRS A;  2EIF A;  2JA9 A;  4POF A;  4EX5 A;  3HOY G;  1PFS A;  1D7Q A;  1X54 A;  3KLW A;  3F2B A;  4BBR G;  3CCM A;  4HJ8 A;  4A3L H;  2BH2 A;  1K9M C;  4OWW B;  2UXB Q;  4OWX B;  1V9P A;  1KHI A;  1QVC A;  4X62 L;  4HIO A;  2R7Z H;  4KHP Q;  4BXX G;  4HIK A;  4JC0 A;  2LXJ A;  4JI1 Q;  2YTV A;  3H15 A;  1X3F A;  4HIM A;  3CMA A;  3H3V I;  1C9O A;  4XTC S;  2YYZ A;  3K7U C;  1HR0 W;  1NE3 A;  4A3G G;  1VQJ A;  3PUV A;  2Q2T A;  4WJ4 A;  1P16 A;  5JJI A;  5IP9 H;  4YWL A;  2PQA A;  4C3I H;  4BY7 H;  1YHQ A;  1PA6 A;  5M3F G;  4IFD I;  1N32 Q;  1LM0 A;  1EOV A;  4P73 A;  5JEA J;  4A3J G;  1XMQ L;  1W2B A;  2I5M X;  3A0J A;  1HZ9 A;  4B3M Q;  1X3E A;  1MIU A;  1S3O A;  1WJJ A;  1TXY A;  1XTD A;  4QL5 A;  4GNX B;  3SGI A;  3ULL A;  1X9N A;  2ES2 A;  4KHP L;  1Q46 A;  4LF6 Q;  4JI1 L;  4GNX C;  1AE2 A;  4AYB G;  2ALY B;  4HID A;  3NEL A;  1PVO A;  3EIV A;  2D62 A;  4QIW E;  5FLX c;  4YHH Q;  4ALP A;  1VQC A;  3PUZ A;  2K50 A;  4R1J A;  3EN2 A;  3TQY A;  4YCV A;  2PNH A;  5IWA Q;  3HOW G;  2YV5 A;  4H02 A;  3I4O A;  3ULJ A;  3G71 A;  3A5U A;  5JEA G;  4B3M L;  2IHE A;  4QGU A;  2R92 G;  4DV0 L;  2B63 G;  3HOU H;  3M7N A;  1MKH A;  4RMF A;  1RIP A;  2Q2I A;  3M4Q A;  2KEN A;  4LF6 L;  1CSQ A;  4UP9 A;  4ME3 A;  1I5F A;  4GOP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...