5G3LD

Escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
98
Chain Sequence
b'GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAAAVLSGMRVNMCASPASSPNVIWAIELEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN IIB, B CHAIN
publication title Biochemical and Structural Characterization of the Novel Sialic Acid-Binding Site of Escherichia Coli Heat-Labile Enterotoxin Lt-Iib.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 23
structure length 98
sequence length 99
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5g3lD00
1QCBD 5G3LD 1TIID 5G3LF 4FO2A 4FNFA 4FP5D 1QB5D
chains in the Genus database with same CATH superfamily
1K83B 1VQDA 5C4XG 2KCMA 4B9WA 4DR6L 3R2IA 5A35A 1O7IA 4KHVA 2ZTEA 1G6ZA 3PUWA 1K28A 1Q3LA 4H02A 4YCWA 1GJXA 1U9RA 5M3MG 5IT9E 5C4XB 1TWCB 4X62L 1IL8A 3GQBA 2QKIC 1STGA 1U5KA 3I3CA 2Z8LA 1GUGA 3T4AC 2K32A 3S17H 3M85A 3D4RA 5M3MB 3GTJH 4K6LA 3A8KE 1PFBA 1J8IA 1EWCA 1RTOA 1SYGA 3J81c 4A3MG 3M3YB 3K7UC 1SLJA 3JAME 3LWEA 2CKZB 3SEBA 2BA1A 2IWHA 2RDFA 4CJ1B 3CP0A 4DR1Q 2IW3A 2NWGA 1X3EA 2V1CC 1Q1BA 5K5PA 3H0GG 4A3MB 4B3RQ 3ULPA 2ICIA 2K75A 1EUJA 1HQMC 5GQOA 3PO2H 2VXWA 1QOHA 2WP8J 1EQVA 2VUMG 3I4NH 1VQEA 5C5MA 4A75A 3H0GB 5EPKA 3S2HH 1PLFA 4PZ7A 2KECA 1VQGA 4JI4Q 1HQRD 3ZJYC 3TP8A 1CA6A 3F2CA 3T53B 4A3LH 3K5LA 1E2ZA 1W6JA 2E2JB 3TDQA 4RG1A 2VUMB 1E3PA 1TY0A 1FGBD 1STBA 1SMXA 1HNWQ 3BDCA 5HY6A 4A93H 3SDZA 1KLGD 1EYCA 3DWQA 2B63H 2G9HD 1EY4A 2CH4W 2IJ0A 5C4HA 4AQYQ 4IPDA 1FL0A 3HOWH 1IKLA 1N8RC 5M3FH 5E3FA 1BCPD 1HUMA 3NUCA 4HJ7A 1TVXA 4P73A 1L0WA 3FKIG 3CAMA 1UWVA 3NXWA 4R9WA 3CMAA 1X54A 4HN7A 2JA8G 1JJGA 1LV9A 1EY0A 3KF6B 2AMCB 3FKIB 4A3DG 3H3VH 2NYZD 2UUBQ 3VR2A 2DN8A 1MJCA 1N36Q 2NVQB 1WTRA 5FJ8G 1F2LA 2H5XA 2JA8B 1AEXA 3VDYA 5GADC 4IUUA 4A3DB 5JVG3 3BYTB 1FNUA 2KHIA 4IQZA 2F0GA 4A3GH 2B2YA 1X32A 5IIFA 5IGBA 3L0OA 4HJAA 5JJIA 2B8GA 1BDOA 1Q82C 2DGYA 3GTMB 1D5ZC 1K0RA 3K8AA 2WKCA 2R7ZH 4LF7L 2OF1A 2DY8A 5FOBB 4BBSH 1JC7A 2IHFA 4Q0FA 4DV0Q 2A69C 4L5SA 2CQAA 2KHSA 2JN4A 4A3BH 1JOOA 3DWAA 3HGBA 1H9MA 3E9IA 3VA7A 2XWJB 1DOMA 2Z4IA 1TXYA 1HR0Q 1VQ7A 1S5DD 5G3LF 2R92G 3GTGB 1IYUA 4X65L 5L37A 3HZXA 4U673 3HKSA 1XMOL 2NTSA 4RA8A 2I46A 2F0HA 4DKAC 2YTXA 1PRTB 2GN5A 4JBMA 1VQ4A 2UU9L 4LUZA 3QOJA 2R92B 3CRLC 4DV1Q 1MIUA 1MGSA 5IOCA 2QW7A 1YJ9A 1XPUA 2CW0C 4EGVA 4DR5L 2RVLA 1Z9FA 1X3QA 4N8X1 4JI3Q 2RCNA 3DEOA 1MD2D 2BCOA 4CJ0B 1X3PA 3W2DA 3HOYH 1J9OA 4ZCKA 2UXDL 5KIXA 1EFID 3RLFA 5CV8A 2N55A 1Q12A 4UP9A 3TQYA 5LHY1 1EY7A 1KDCA 1VQAA 5FO7B 3X3NA 2DY7A 2Q2IA 1HFGA 3ND9A 2MJ8A 3J7A5 4GNXB 3AMUA 3C46A 1MSHA 3AB9A 3P20A 4JBWA 5ELNA 4ODGA 1CKNA 1CA5A 3ICEA 4JI0Q 1VS0A 3NENA 4ZLTF 4HSPA 4K2LA 3U9OA 2M00A 5GAEC 5IP7G 1HFNA 4GN3B 1TWGB 1NMFA 5EPJA 1OXXK 3D6CA 3OWFA 4KN4C 4LK1C 3NTIA 2WAQG 3HOVG 2CH4A 1IL2A 2HDMA 4A3JB 3FEWX 4DNTB 3T1YQ 1STYA 2WAQB 3MZ5A 1GXDC 3HOVB 1NSNS 2JA6H 2F0LA 1E24A 4LFCQ 1E0BA 1PV4A 4DV7Q 2A6ED 1PH9A 1YZ6A 5LMUL 1B3AA 1EY5A 3PQIA 1WCMH 3UDGA 3NBHB 2F03A 5BN3A 4B3TL 3GTOH 3I91A 3J7YW 2F0DA 3PSIA 4RGOS 4GKKL 3PCOB 1SYDA 1I50H 4DV4Q 1Q81C 1N33L 3KOJA 5TSSA 1G8ZD 3PUVA 4JI6Q 1UAPA 3BDLA 3CQZB 5KNDA 3A5UA 4OL7A 4WJ4A 3TS0A 4XT1B 4HSVA 1FD7D 4IPCA 2JEAI 1FJGQ 4M8AA 2PW5A 2A68D 1ESFA 3TS2A 1ZYRD 3A56A 4LUVA 4JI5L 5DNFA 1YNND 2JA9A 3A7LA 3F2BA 3QWNA 4DV5Q 1LTID 3L3OC 2NN6I 4KD3A 4B3SL 1EWIA 1RJTA 3MXNA 3K59A 1CQVA 1CTMA 2F3IA 2OT2A 3I72A 2F0IA 2DUDA 2EY2A 5COYA 1DJRD 1I6HH 3OSOA 3FVQA 4JC0A 2MPMA 2F4VL 2F0TA 1JWMD 2ZTDA 1WTXA 4FNFA 1A6XA 1II3A 1BXTA 4J8QA 3KJPA 1CKMA 4CBVA 1GKHA 1T5EA 2SNMA 5JJLA 4L6TB 4OGQC 3M4OB 2NVXH 2E2HB 3ULLA 2RF4A 4JI1L 5I6YA 1PRTF 3BVGA 5LL6S 1Y1WG 3A5ZB 3E0EA 3HOUG 4LMQD 1G2SA 3PV0A 1IBML 5JEAH 1RTNA 5T1GA 4JV5Q 2F3VA 1B1ZA 3S15H 1Y1WB 1R9TH 1S3OA 1AN8A 3CPWA 3HOUB 4PNYA 1HA5A 2R93H 5C44H 2JA5G 2MFIA 3MEHA 3NWTA 3OOCA 1TWAB 3S1MH 1IBLL 4OEMB 3G6JB 2BDNA 3DLLA 1BBXC 3U9SA 3B6YA 2JA5B 1E22A 3GV3A 4R8NA 2EVBA 2IT1A 1SYBA 3UDIA 4O42A 1WD0A 5CC4A 3OMCA 4KY5A 3H15A 3K7AH 2M9VA 2K01A 2JXMB 4WJWA 2KVMA 1YNXA 3FP9A 3TP7A 1KRSA 2WB1G 5CBAE 1EU3A 1AH9A 4JYAQ 5IT9L 5BR8L 4C3IG 4XDXA 3S16B 1SE2A 1ILQA 3LNNA 4Q5VA 3G71A 2F0JA 4NPSA 4G7OC 1Y8PB 2RHQB 2IX3A 2VQEL 2SEBD 2KCTA 1E2WA 1S5CD 3C1EA 3E5SA 4HMIA 1PZID 5IGCA 2AQ1B 4C3IB 3WOEA 3I2ZA 2YU9B 3E0JA 4A3KH 3NTHA 4C3JB 4DFAA 1C9OA 2RDGA 2NN6G 5JJKA 1J6QA 5KNCA 3JAML 2HHHQ 2SDFA 1TS4A 1G91A 1EIFA 4GOPB 1E1OA 3V96A 2N88A 4OO1H 2Z0SA 3VR4A 2K05A 1Q90A 3CU7A 3NELA 2Q2UA 1VQMA 1I4RA 5HURA 4DV3Q 2ZXOA 5ELBA 3R2TA 3C2PA 2SOBA 1Y69U 5J39A 1B53A 1ZEQX 2CCZA 4GLAC 4KK7A 1HTPA 1BBUA 3KLSA 4OXPA 1O7LA 1YJWA 1F9QA 4YY3L 5J1ZA 4LF6L 3I4LA 2HCIA 4I7AA 1SYFA 2Q8IB 1WOCA 3L7ZC 4KHPQ 1BUVT 5I9OA 2BDOA 1F2MA 3D8GA 1K9MC 1SNQA 1VQ5A 4NXNQ 3EVQA 2JA7H 1EOVA 1E1TA 4A3MH 3M4YA 2L0CA 2MHVA 4GLVB 2RKSA 3K57A 1BQQT 2PW7A 5JPMC 2CWPA 1WD1A 3DEPA 2JYOA 4OHJA 1Z47A 4GKJQ 5M5XH 5E4XA 3K0YA 2HD3A 4MZ9A 1B50A 1XTDA 2F0UA 3NSWA 2EOTA 4CGYB 2E2JH 1PH2A 4X6AH 1M8AA 2A1AA 4A3IH 3OW2A 3CCRA 2KA7A 1A8VA 2HDLA 1VQHA 1GD7A 4V0BA 4FXKC 4CDFC 1PTOB 3PIP3 3S2DB 1X3FA 2R7FA 4A3KB 1VQ8A 1N34L 5KRUA 3DMUA 1X56A 4FXGC 3K6OA 4K8JA 1SJED 2EY5A 1D1IA 1TWFB 2WACA 4HIMA 2NVTB 4R4OA 1XNRL 2UXBQ 5C3XA 2X6LA 3FKIH 4HR7B 2CQOA 3HG9A 3OPOA 2L4NA 1DOLA 1JE4A 3K5OA 4LF4L 4ALPA 2EQSA 3J7AV 3ZYYX 2E5LL 3NBIA 4A3DH 1H9RA 2Q8RE 5IWAL 4DR3L 1K3RA 1PFNA 2QF7A 2AWNA 2CFMA 2E2IB 5FJ8H 3J80i 4DK1A 1WYDA 1JE5A 1H9SA 1L1OA 1GOZA 3GTMH 2E75C 1VQ6A 2Z9HA 1BCPC 3OW7A 4UP7A 5IT9c 1PYBA 3K81C 5CGKA 3K5MA 1JR0D 2K14A 2Z6KA 4NKLA 3U4VA 3PIO3 1S40A 3Q24A 1U4PA 1W3SA 2PI2E 1SBBB 5HGQA 5FO9B 2QILA 4JW0A 1UNSA 4X3SA 2IX0A 1T9HA 3T51B 4DR2L 4IFDI 2C5CA 4KY6A 5IYBG 4CJ2C 4HIKA 2IL8A 4YIJA 4C2MH 3T1HQ 1BBWA 3DUZA 3PIPA 3W5OA 4H13C 2R92H 2XN9C 3OMGA 4BA1I 4X3KA 5GROA 1SFOB 3GTLB 1HNXL 5K36G 2QA4A 4OX9L 4QGUA 2GVBA 5EKIA 2EY1A 5FLXE 2EY6A 5I9PA 3K5NA 2RCFA 2RHSB 4AIMA 1IYJB 4F8MA 1JORA 4DV2Q 1VF7A 3KF8B 3VA5A 1QUQB 4BWGB 3BVZA 3HFZB 3NQIA 1HH2P 5I2YA 3I4MG 3S1NB 2J0TD 2QCPX 4OIJA 1HZ9A 3ERQA 1F77A 3MXPA 5IY0A 4YWMA 1OXTA 2RA4A 3I4MB 3CD6A 1N32Q 2LMCB 5DEHA 4K0KL 4BY7G 2XWBB 4BXXG 2OCEA 4MN3A 3CC2A 1VQNA 4A3FB 1EFWA 2Z1CA 3G4SA 3PIOA 1B2TA 1V8QA 1F9SA 2A6HD 4BY7B 1DXMA 5DM63 4JOIC 2A74C 2VB3X 1PTOD 3HOXB 1X55A 5M5YH 5IP7H 2K03A 4JPBW 3NE5B 4UDUC 1LT3D 3QG1A 2GA4B 2XNAC 4X3UA 3EQLC 1STAA 2EJMA 3PF5A 1EYDA 4CDDC 3M7GA 1PTOF 2ZXRA 1ZKOA 2B2WC 3AU7A 3IFTA 3I4OA 1I94L 3DM3A 4JOIA 4LFBQ 1ET6A 3M4PA 2F0QA 1XNQQ 2UXCQ 3J7ZC 4A4IA 4HCEA 1V43A 3OTOQ 1S5BD 4JI2L 1KRTA 1D2BA 1YBYA 4RWSC 1YIJA 2L12A 4FYDA 4DV6Q 2PCFB 3ITPA 4H0LC 1YI2A 1B3QA 4BBRG 1ENFA 2HIVA 1ONLA 1YVCA 2F0KA 1YJNA 4LNQA 1PH5A 4DR6Q 4HJ9A 4WRDA 4TVAB 1QG7A 1PH3A 4FF3A 1KTKA 3CQZH 1Y8OB 1O78A 2B2WA 3NWSA 2ZJPA 2B2YC 4BBRB 3CPFA 3NQTA 3GTKB 1SNCA 4E6IA 4X62Q 3E6ZX 2FMCA 2BE5D 5C0XH 5I2XA 1D8LA 1EIGA 3Q8DA 5CV6A 1B9MA 4APVA 3J80E 3C3LA 3W3AA 4IURA 1PH4A 4L5RC 4XT3B 4LFAL 2ID0A 4DK6C 1TWHH 2A6EC 1KDAA 1YHAA 5I6WA 2Y0SE 3BZDB 2K5NA 4C56C 3C1FA 3FPUB 1KQSA 3F1ZA 2ZTCA 5IYDG 2D2CC 5ELEA 4Y7NB 2JK8A 1VCIA 1P16A 4KHZA 2DNEA 4KY7A 5G3LD 4DNIA 2OTJA 3KF6A 2F0EA 1NR4A 5JPNC 4XXEA 2WKDA 3MC0B 4UHVA 3M4OH 1JB7A 1C7YA 1N9WA 2A68C 3P1HA 5M5WB 1ZYRC 2RSNA 5DM73 1IZ6A 2X6GA 3M9BA 4RCNA 2EYPA 1YNNC 1Z7TA 4QIWB 3U4ZA 4YWLA 2KHJA 1Z6HA 3DHQA 5AJ3L 5FKAC 3HOUH 3FDTA 2VZAA 2I5LX 1TU2B 2A73B 3OIQA 1TWAH 3BU2A 2KENA 3S14B 2MO1A 1B70B 1PA6A 1I3QB 3SK6A 4PMCA 1HUNA 4L5TA 2MNAA 2DJFC 4DUZL 3H3VI 4ABNA 4POGA 4CKBA 4FO2A 3VR5A 4IALA 1CFMA 1DZ1A 4LF8L 3KDFB 2ATWA 3VYSA 1SNMA 5J3BA 4OIKA 5A2QE 3S16H 5EKKA 1AP0A 4IN3A 1VQIA 1GVPA 3A55A 3UDXA 2I5MX 2VQFL 4A3CH 1UE6A 2MQHA 5D3IB 4B3ML 4LF7Q 5KEEA 4KJNA 3EBEA 4I7ZC 1KHIA 3HKZE 2UUAL 1QJOA 1UE7A 3FPPA 4JI8L 4DUYL 1O80A 4A3JG 4LF5L 3I8ZA 1QILA 3RZDB 2XTIA 5CYUA 4F88A 2JSOA 4DR7L 2PNRC 3KDFA 1NAPA 4YHHL 1GUSA 4XTCS 4X65Q 4RFBA 4GNXA 2PZWA 1JB3A 4C3HG 2ZT9C 4ME5A 1BVSA 3WWVA 2MO0A 3AEVA 1XMOQ 1CHQD 1A63A 1IBKL 1CQFA 3R8BA 3PO2G 3GTPB 2JJQA 3I4NG 2EYOA 2UU9Q 1EZ6A 3HOZG 2A19A 4DAPA 1C4QA 2B8FA 4C3HB 1CZGA 4A3LG 1UEAB 3GP7A 1JJCB 2K5HA 3PO2B 1BF4A 4DR5Q 4OONA 3I4NB 3S2HB 2B3GA 4KI0A 4HEDA 3HOZB 2Z6BA 1VQLA 4P75A 1RKNA 3I73A 1SAPA 2PZTA 3MVVA 2EIFA 2A8VA 3PO3G 2UXDQ 4K14A 2EYLA 2KUMA 2VY3A 5M3FG 5D14A 4EQNA 3AFPA 3SVMA 4DK0A 3PO3B 1AE3A 5D65A 1PDQA 3BG3A 1Q86C 1DOKA 4O2DA 5M3FB 4ZKBB 4CDCC 3MFYA 1IXRA 3GD7A 3NBHA 4HJ8A 4DA2A 4HMJA 3KBGA 2NVYH 3BZKA 1JICA 4R4QA 4C1NK 2DJGC 1X6OA 1IHZA 1VF5C 3NP8A 1LT6D 3S2DH 3TSSA 3PF4A 4N9TA 1G2TA 1PRTD 1B8AA 2MGSA 2BH2A 1T5XD 1TWFH 4IUTA 4PG3A 1JCKB 3D31A 2VB2X 2NZOA 1YNJD 1WJJA 3Q23A 5IGFA 3GTQH 5LMNW 1GUTA 4QUCA 4MIUA 2K50A 4DAVA 1S5ED 2IPKD 2NBFA 1AW7A 1S5FD 1VQCA 4R8IA 3EFXD 2LSSA 3RZOB 1TKWB 5LMUQ 4G7ZC 4B3TQ 3VYRA 1MSGA 1MKHA 3I70A 3SK5A 1CSQA 2F52A 2XSCA 1FVIA 5ELFA 2OEOA 5C3EH 2FHTA 4GKKQ 4POFA 2EYFA 4S3SA 1N33Q 1RCVD 4CKCA 1YHBA 4IFDJ 1FNVA 2EJFC 1XMQL 1Q8KA 1LTSD 2AWOA 1UE1A 2C35B 1TR5A 3ONAB 3RN2A 1OO9B 1EIHA 3K80C 5FLXL 2L1BA 1JMCA 4MHEA 1PZKD 1UE5A 2E8GA 1CKOA 1PH1A 5JVH3 4JI5Q 4UPAA 1V1PB 2AQ2B 1EEID 2RBMA 2WV6D 1HTLD 4B3SQ 2E2DC 4RKLA 5ELCA 3RLOA 1AE2A 1STHA 3SHLA 4C3JG 2Q2HA 3HOYB 4QMGA 1OXSC 4L5QA 4XIGS 1JT8A 4J15A 1D1KA 1H95A 2IY5B 3GTLH 3G6EA 5EBCA 4NMZA 2F4VQ 4DAYB 4DK3C 5BN5A 1RD9D 1ASZA 2VNUD 1LTAD 1K83H 3KFUA 1EOTA 4X66L 4LF9L 2Y0SG 1I4HA 5K36H 4ZKCB 4ILWA 1AFPA 4JI1Q 2KCNA 3S1RB 5C4XH 1TWCH 4HTHA 1C0AA 2EYJA 3A54A 1LT4D 2VS1A 5H1SE 2Y0SB 4GOPC 5FLMG 3TBIB 1XJVA 1IBMQ 2LFNA 2ZM6L 5M3MH 1LTBD 1Y1VG 4IPGA 1HNZL 2PZUA 1D5MC 2EZVA 3G7LA 4U68A 2EYHA 3MHBA 4BA2I 3M3YH 1LO5D 4F7XA 4Z9CB 1Y1VB 1H9KA 2AHOB 1SSOA 1IBLQ 2JA6G 4P74A 4GS3A 4GOPA 3IL8A 2O2LD 1S4ZA 1W6KA 1K0SA 3A7AB 3FHWA 1U4MA 4RGNA 4X64L 1E7ZA 4N9PA 2JA6B 4CHTB 2SNSA 1BR9A 2JE6I 3FMCA 1Y14B 1IKMA 1F2ZA 4K6DA 1JJ2A 1SROA 3GTOB 3H0GH 2YV5A 4JBJA 4HJ5A 3S24A 4NXML 1RF2D 4UP8A 2KBNA 5BR8Q 1ASYA 2K04A 1YITA 1J5EL 3OHXC 1I50B 3SK4A 3VYUA 1A62A 2D0OA 4DU9A 2VQEQ 4IJLA 2TMPA 2VUMH 2Z4HA 2CVRA 1LACA 3J80L 4FDBA 3SK8A 2PQAB 4DPGA 1MJEA 1WTHA 3I56A 4OELB 2WIIB 2LY7A 3L2PA 3R93A 1WTOA 2N78A 1PYSB 1IYVA 2OQ0A 4IOAA 1HR0W 1KNEA 2JP1A 4M1UB 5JOBA 1D7QA 2A6HC 4IUNA 1EU4A 1A2TA 2HIXA 3HRZC 1B9NA 4OO1I 1PTOC 4IZ8A 2EYMA 4P71A 3IKJA 3NTKA 1A3VA 1D5XC 2LKVA 4Y52H 1F2YA 4DF7A 1L1OC 2PYKA 4MTKA 4A3EG 1EY8A 1V1OA 1IW7D 4RCOA 2WINB 1I6HB 1F9PA 4DR4L 5GAHC 4LUOA 2NVQH 4KMUC 4HAEA 2F0NA 2JA8H 2HCCA 5LMNL 1CT1D 2Z6KC 4A3EB 4HIOA 4FF1A 1L0XB 3H09A 4YY3Q 4XQJA 4LF6Q 1TT2A 2QGQA 5C4JB 5FLXc 3RNUA 1HHVA 3STBD 4DN4M 3RUZA 4Y7NH 3J81i 1L0YB 2B2VA 4GZYC 1QVGA 2K28A 2JQOA 5KGUA 3T16A 2K5VA 1YEZA 3PUZA 1R9TB 1EYAA 2BE5C 4PZ8A 3KK7A 3H94A 2KCCA 1NR2A 4GLXA 3V05A 3GTGH 4FF2A 3ULJA 3H6MA 2ZXPA 2B2UC 4PV1C 1M4VA 1CSPA 3QIAA 2EDGA 5C0XJ 2F0PA 4DR1L 2M2LA 1PXUA 2F0MA 3P7JA 2XGTA 5A2QL 4A76A 1SYEA 4B3RL 3G48A 3N6RA 3I90A 1N34Q 3RD4A 5IGDA 1O7ZA 1M1KC 4ZYSA 3S14H 4K8IA 1PHJA 1VQFA 3D3RA 4JI4L 1I3QH 2B2UA 2O4XA 4TRDA 5KYIA 2RDHA 1XNRQ 1EQRA 1WFQA 1ENCA 1PH8A 1X3GA 2L11A 1HNWL 3CKIB 4LF4Q 4IO9A 1OTCA 2PO4A 3VR3A 3S1QB 3SE0A 2E5LQ 2VW9A 1SRUA 4RGTA 4AQYL 2K7VA 3WOFA 1K8AC 3M4QA 4OO1G 5IWAQ 4DR3Q 4A3FG 3AYHB 1ILPA 4H7BA 2EXZA 5C5LA 4RHRA 1LABA 2WFWA 1HPCA 3E3XA 1KDBA 4GN5A 1CI3M 1LM0A 4LW1A 2NTTA 3HOXG 3SGIA 3U58A 5FK9C 3KF8A 2UUBL 1P8LA 1QUQA 5EBDA 1ESRA 5F2DA 1TWGH 1TS2A 2D62A 1WTVA 1N36L 3JC66 2BOSA 5EJWA 3J80c 1KABA 3F2DA 1G6PA 3RZDH 4EVOA 3QO2A 2C9OA 1LTGD 2JA7G 1A15A 4A3JH 3TP6A 4DNRB 1VMPA 4KKUA 4DR2Q 4B08A 3TP5A 4KKSA 1GHKA 2Q2TA 4OWWB 4F87A 3RR5A 4R4IA 5HGTA 4J6HA 2JA7B 3MTSA 2L55A 3GTPH 3HOVH 1CHPD 1KL9A 5EPLA 1S72A 3CCVA 2CWAA 3MXUA 3T56B 5NUCA 4C3HH 4DV0L 1QNUA 1HNXQ 2J4XA 1DCZA 1BO0A 2F0VA 4IFDG 4OX9Q 5M5XB 1XX8A 5IYCG 4A3IG 3HOZH 2R3ZA 3PMFA 3ERSX 4O1NA 2NB0A 1I4PA 2XVSA 5C6AA 1HR0L 1LTRD 3BDOA 1QVCA 2B39A 1SMYD 2EPBA 2E76C 4A3IB 4WJ3M 3NPPA 3RLNA 3QOLA 1RIPA 1I4XA 1RDPD 4IUQA 1QB5D 5C3WA 2ENBA 4XYQA 3PO3H 2RSOA 4DV1L 3WDNA 1SR3A 3BYYB 2PMZE 2O5JC 4B9XA 2WB1E 1JOQA 4K0KQ 1NNXA 3J81E 4KJOA 1HXYD 1SNDA 1NMGA 4JI3L 1M90C 1CK1A 1SE8A 1HJPA 2IHEA 5AFWA 3CXCA 1W2BA 1DM0B 1BCPF 4JI7L 4QCLA 4AYBE 4XQQA 3CRKC 2YYZA 2PPBC 1SJHD 1ML0D 4FVMA 3QB3A 1K8GA 2KEEA 4BY1G 3BS1A 2OTLA 2HQEA 4I65A 4PMBA 1EQQA 1STEA 2N8NA 5ELDA 3HP3A 3E9HA 4RHSA 2E2HH 3GDEA 2ASBA 4BY1B 1UEBA 1DD2A 5E1FA 1I5FA 2VL6A 3I7FA 4JI0L 1I94Q 2H1EA 2JEBI 4QL5A 1XYIA 3RZOH 5CORA 1Y8NB 5EKLA 4IOCA 4P2CB 3EA6A 1SNPA 2E74C 4JI2Q 4DXGA 1Y1WH 4V190 4RH6A 1LT5D 2QEXA 2F3WA 4YCVA 1VDZA 1QZGA 1KD1C 1PVOA 2Q8TA 3W1GA 3V2TA 1NBWA 1HRJA 1K73C 2R6GA 3TN2A 5ISRA 1SDFA 1PRTC 1AZQA 1QZHA 2N3SA 1SNOA 4IJHA 3T1YL 2JA5H 4C2MB 4HCSA 1MI2A 1R4PB 5C0XI 5IP9G 2B2TC 1X65A 3LGJA 4LFCL 1QVFA 3BVMA 1YNJC 4XQNA 3CCJA 4DV7L 1ET9A 1U0LA 2FXQA 4LFAQ 1CKNB 4XYOA 1KIXA 1GUOA 4DV4L 4YWKA 1KAAA 1G291 3MFGA 4K5VA 2PNHA 4JCVE 4JI6L 3IRBA 2B2TA 2H4OA 2R7DA 1WI5A 4C3IH 3URYA 3KBXA 4JI7Q 4AH6A 3EROA 4CKEA 1RL2A 2QDBA 2FFKB 2YU9H 5JEAJ 3CCUA 3H91A 4OWXB 5DLQE 4GNXC 4NB3A 1FJGL 4C3JH 2K1BA 2KJXA 2ZJRA 1EIYB 4LWCA 2XRQD 2K5QA 1WTQA 3S17B 1PMRA 4WORA 1VQBA 3GTJB 3ND8A 1MBYA 1TS3A 5M9OA 2F4IA 1HZCA 2ES2A 4QQBX 1I6VC 3N52A 3UDFA 4DV5L 2NUCA 4PZ6A 3S1RH 2NN6H 3EJIA 3O13A 3A0JA 3CMEA 2MUYA 4MNOA 4LAAA 3NHHA 4P72A 5EAYA 3MA2B 4KV6A 5AJ3Q 4RMFA 1SN8A 1VQJA 1NUCA 5DAUA 1E2VA 5FLMH 3CW2C 3BZCA 4DAMA 5M5YB 2F0OA 5T1IA 2FINB 1FGUA 1Y1VH 4X3TA 3HS0C 3K0XA 1ENAA 3KLSX 1V1QA 4KN7C 4JBKA 3MWYW 5JAVA 4G7HC 1B7YB 4A93G 1MHWC 3BJUA 2B63G 3A8JE 3F2UA 3A74A 4DUZQ 5EGTA 1I4QA 3S9WA 3HOWG 4TSSA 4JV5L 2EE1A 2K33A 4A93B 2N49A 3OWEB 4JK1C 2KQ3A 3RMHA 3SR1A 2B63B 5KYLA 3MXNB 4LF8Q 2I07B 3HOWB 4L8JA 4MTNA 4R4CA 4G4KA 4R4TA 4UY8C 3QR8A 1RODA 2F0SA 3PGZA 5C0XG 1GUWA 2L5TA 3EIVA 2A69D 3OIPA 1B4OA 4ZUJA 3VYTA 2VQFQ 1WTWA 2ZJQA 4QF4A 3U50C 4B3MQ 2ALYB 5I4DA 1O7YA 5IE8A 2PI2A 1PTOH 1DYQA 3KYHC 3T13A 4JVZA 1LTTD 1OXVA 2UUAQ 4JI8Q 3TZUA 3UE1A 4DUYQ 1G51A 4A3GG 4LF5Q 3SXHA 2AQ3B 3DM1A 1EY9A 1TS5A 1PH6A 4JYAL 1HZAA 3W1BA 1DGSA 2NVTH 1TWHB 3H3VC 4DR7Q 4UAIA 2OQKA 1STNA 4WFN3 3AFQA 3Q22A 2R7ZG 4YHHQ 4A3GB 3Q0AA 4TQUS 4BBSG 3P75A 4RGMA 1VQKA 1SEBD 1IBKQ 1HCZA 2LS01 2CW0D 2V4DA 2R7ZB 4A3BG 4A3EH 3IAYA 1GUNA 1K3BC 4BBSB 2QEJC 1NTGA 3KLWA 2LXKA 3EN2A 5C4JH 2HHHL 3KLRA 4PMWA 4DXFA 4TKOB 2E2IH 2O5IC 4A3BB 2X69A 1EEFD 3CCLA 1PFSA 4FF4A 1BNZA 1DONA 4DGZA 3CF5A 3IFDA 4DV3L 5BN4A 2CHBD 4K2KA 1QCBD 2K5DA 1UUPA 5CMDA 4RKBA 3A8IE 5ELOA 1VQPA 1IW7C 4K5XA 5CV5A 3MEFA 4KHPL 3HOYG 1R4QB 2F1MA 2OWOA 3TEHB 3TMEA 4NXNL 3VR6A 2D5DA 1TIID 1JWSD 1BOSA 4QUFA 4PQXA 4ULLA 2L15A 5IYBH 2TSSA 3STBC 3TREA 1TQOA 5CR3A 1SFOH 4GKJL 2L9HA 1JQYD 1EQTA 5E4WC 2G5DA 1CUKA 2F0FA 1EZ8A 4ZQ3A 2AKWB 4EX5A 4KKTA 4A3CG 3LWUA 1F9RA 1XXGA 2PMZB 1NE3A 5CBEE 1SE3A 3CCSA 4GN4B 1A3TA 1I4GA 2EXDA 3CCMA 2WB1B 1V1PA 2K5WA 1PZJD 3S1NH 1WVLA 4AYBG 2J7ZA 2OXPA 3J81j 3S1QH 2NZHA 2AUJD 4JG2A 3DWPA 4NDXA 5EQ0A 1NCVA 1NY4A 2YTVA 4EQPA 2BA0A 2K4KA 4O0AA 1JWUD 5IGEA 2BH8A 3I4MH 3AQQA 3L9AX 4AYBB 1RHPA 1GO3E 2QDLA 4DAYA 3R3OA 3ER0A 3D0FA 4A3FH 1C48A 4R1JA 1XMQQ 4CDEC 1Q7YC 1ZXTA 2UXBL 5FO8B 1HZBA 4KLKA 1EL0A 4BY7H 1B44D 4BXXH 1WCMG 2IX1A 3F8TA 3GV6A 1GM5A 5JJZA 2I0QA 2MP1A 1AZPA 4G57A 3HOXH 3NEMA 1SE4A 1U4RA 2B29A 2HUGA 4FP5D 3CHBD 1WCMB 4ZRZA 4ZAIA 1KXLA 1LLRD 2FJ2A 3TZDA 5C4ZA 3OYYA 1QE6A 4QIWE 1X9NA 2UUCL 1LYLA 4EQOA 4QJFA 1QNKA 2XIWA 4ZUIA 4IUPA 1XWEA 3D6WA 3JAMi 3RN5A 3PUYA 4NW2A 5GAGC 3J81L 1KLUD 2I5HA 1VQ9A 3QJYA 1LTLA 3UI2A 3I55A 1BKBA 1VMCA 3X3MA 5CV7A 4RAUC 4X66Q 4LF9Q 1LUZA 5LL6X 5IGGA 1VQOA 1C8CA 4IFDH 2DNCA 4LJZC 3D4DA 5IYCH 4BBRH 4ZK9B 3GTKH 2D9UA 3T1HL 1KC8C 2NVYB 1NJIC 1OXUA 3M7NA 3HKZG 2NZ1D 2KEDA 5IODA 1GHJA 2ZM6Q 5CV4A 1V9PA 1FYCA 4H44C 1H9SB 2B2VC 2ICEC 4EQ5A 1L1OB 1HNZQ 2PQAA 1KAWA 2RQXA 3DXJC 1CZWA 1Q46A 1ICFB 3CCQA 3HKZB 1A2UA 4IUVA 2P5ZX 4K5WA 3LX0A 2AUKA 1A0IA 4C1NI 4DV2L 3HEJA 3CCEA 3J7AF 1XPRA 4YCUA 5JEAG 3GTQB 2NVXB 1SXTA 5CV9A 3GO5A 3PUXA 2KOLA 3Q6SA 4X64Q 1QWYA 1SYCA 5KNBA 3KJOA 5C3EG 3K58A 4N8FA 1XPOA 4HIDA 1H9JA 1Q1EA 1SMYC 2FMMA 2R93G 4ME3A 4J1MA 5C44G 3D4WA 1K8MA 1HA6A 5IYDH 1KNAA 1EYGA 1BCPB 2XRSD 2K6AA 1FR3A 1TY2A 1EWHA 3S15B 4NXMQ 1N32L 5J22A 3CC7A 5C3EB 1CM9A 2D0PA 1Q8IA 5M5WH 2UUCQ 1J5EQ 1FNWA 4BY1H 2R93B 2F0WA 1PYWD 5C44B 1L2FA 2WAQE 4QB4A 4ID6A 3S1MB 2GVAA 2A5HA 3MXGA 2G9DA 3FRPB 4IPHA 4KTAA 3TRZA 2EJGC 3KUPA 1PH7A 1JOKA 1ICWA 2YTYA 4OWTB 4NP5A 3K7AB 2R61A 1K8OA 1U4LA 4FXDA 1PFMA 2PQEA 4L63B 1D6EC 2HT1A 2HQLA 1YHQA 3JAMc 1A3UA 1WTPA 2LXJA 4A3KG 4LFBL 4QY7A 1XNQL 4BS9A 3MAQA 4DR4Q 2UXCL 3NK9A 5LMNQ 3OTOL 3CC4A 5D3DA 5E7NA 5IP9H 2K52A 4DV6L 3UE0A 4KD4A 1EY6A 1XTCD
chains in the Genus database with same CATH topology
1K83B 4B9WA 3R2IA 5A35A 4KHVA 1G6ZA 3PUWA 1Q3LA 1GJXA 1U9RA 5IT9E 5C4XB 1TWCB 1IL8A 3GQBA 2QKIC 1STGA 3I3CA 2Z8LA 1GUGA 3T4AC 2K32A 3M85A 3D4RA 5M3MB 4K6LA 3A8KE 1PFBA 1J8IA 1EWCA 1RTOA 1SYGA 3M3YB 3JAME 3LWEA 3SEBA 2BA1A 2IWHA 2RDFA 4CJ1B 2IW3A 2NWGA 1Q1BA 5K5PA 4A3MB 2ICIA 1HQMC 2VXWA 1QOHA 2WP8J 1EQVA 5C5MA 3H0GB 5EPKA 1PLFA 2KECA 1HQRD 3TP8A 1CA6A 3T53B 3K5LA 1E2ZA 1W6JA 2E2JB 3TDQA 2VUMB 1TY0A 1FGBD 1STBA 3BDCA 3SDZA 1KLGD 1EYCA 3DWQA 2G9HD 1EY4A 2IJ0A 5C4HA 1IKLA 5E3FA 1BCPD 1HUMA 3NUCA 1TVXA 3NXWA 4R9WA 4HN7A 1LV9A 1EY0A 3FKIB 2NYZD 3VR2A 2DN8A 2NVQB 1WTRA 1F2LA 2JA8B 1AEXA 4IUUA 4A3DB 5JVG3 3BYTB 1FNUA 4IQZA 2F0GA 2B2YA 1X32A 5IIFA 5IGBA 2B8GA 1BDOA 3GTMB 1D5ZC 2WKCA 2OF1A 2DY8A 5FOBB 1JC7A 4Q0FA 2A69C 2CQAA 2KHSA 1JOOA 3DWAA 3HGBA 1H9MA 3VA7A 2XWJB 1DOMA 2Z4IA 3GTGB 1S5DD 5G3LF 1IYUA 3HZXA 4U673 2NTSA 4RA8A 2I46A 2F0HA 1PRTB 3QOJA 2R92B 3CRLC 1MGSA 5IOCA 2CW0C 4EGVA 2RVLA 1X3QA 3DEOA 1MD2D 2BCOA 4CJ0B 1X3PA 3W2DA 1J9OA 5KIXA 1EFID 3RLFA 5CV8A 2N55A 1Q12A 5LHY1 1EY7A 1KDCA 5FO7B 3X3NA 2DY7A 3ND9A 1HFGA 2MJ8A 3AMUA 3C46A 1MSHA 3AB9A 3P20A 4JBWA 4ODGA 1CA5A 4ZLTF 4HSPA 4K2LA 3U9OA 2M00A 1HFNA 1TWGB 5EPJA 1OXXK 3D6CA 3OWFA 4KN4C 4LK1C 3NTIA 2HDMA 4A3JB 3FEWX 4DNTB 1STYA 2WAQB 3MZ5A 1GXDC 3HOVB 1NSNS 2F0LA 1E0BA 2A6ED 1B3AA 1EY5A 2F03A 5BN3A 3I91A 3J7YW 2F0DA 4RGOS 1SYDA 5TSSA 1G8ZD 3PUVA 1UAPA 3BDLA 3CQZB 5KNDA 4OL7A 4XT1B 4HSVA 1FD7D 2JEAI 4M8AA 2PW5A 2A68D 1ESFA 1ZYRD 3A56A 5DNFA 1YNND 3A7LA 3QWNA 1LTID 3L3OC 2NN6I 4KD3A 1RJTA 3MXNA 3K59A 1CQVA 1CTMA 2OT2A 3I72A 2F0IA 2EY2A 5COYA 1DJRD 3OSOA 3FVQA 2MPMA 2F0TA 1JWMD 1WTXA 4FNFA 1A6XA 1II3A 1BXTA 4J8QA 4CBVA 1T5EA 2SNMA 4L6TB 4OGQC 3M4OB 2E2HB 5I6YA 1PRTF 3BVGA 5LL6S 4LMQD 1G2SA 3PV0A 5JEAH 1RTNA 5T1GA 2F3VA 1B1ZA 1Y1WB 1AN8A 3HOUB 4PNYA 1HA5A 3MEHA 3NWTA 3OOCA 1TWAB 3G6JB 2BDNA 1BBXC 3U9SA 2JA5B 3GV3A 4R8NA 2EVBA 2IT1A 1SYBA 4O42A 1WD0A 5CC4A 3OMCA 4KY5A 2M9VA 2K01A 2JXMB 4WJWA 2KVMA 3TP7A 5CBAE 1EU3A 5IT9L 4C3IG 4XDXA 3S16B 1SE2A 1ILQA 3LNNA 4Q5VA 2F0JA 4G7OC 1Y8PB 2IX3A 2SEBD 1E2WA 1S5CD 3C1EA 3E5SA 4HMIA 1PZID 5IGCA 2AQ1B 4C3IB 3WOEA 2YU9B 3E0JA 3NTHA 4C3JB 4DFAA 2RDGA 2NN6G 5KNCA 3JAML 2SDFA 1TS4A 1G91A 3V96A 2N88A 4OO1H 3VR4A 2K05A 1Q90A 3CU7A 1I4RA 5HURA 2ZXOA 5ELBA 3R2TA 3C2PA 2SOBA 1Y69U 5J39A 1B53A 1ZEQX 4KK7A 1HTPA 3KLSA 1O7LA 1F9QA 5J1ZA 3I4LA 2HCIA 1SYFA 2Q8IB 3L7ZC 1BUVT 5I9OA 2BDOA 1F2MA 3D8GA 1SNQA 3EVQA 3M4YA 2L0CA 2MHVA 2RKSA 3K57A 1BQQT 2PW7A 5JPMC 1WD1A 3DEPA 2JYOA 4OHJA 1Z47A 5E4XA 3K0YA 1B50A 2F0UA 3NSWA 2EOTA 4CGYB 1M8AA 2KA7A 2HDLA 4V0BA 4FXKC 1PTOB 3PIP3 3S2DB 5KRUA 3DMUA 4FXGC 3K6OA 4K8JA 1SJED 2EY5A 1D1IA 1TWFB 2WACA 2NVTB 5C3XA 2X6LA 4HR7B 3HG9A 3OPOA 2L4NA 1DOLA 1JE4A 3K5OA 3J7AV 3ZYYX 3NBIA 1H9RA 2Q8RE 1PFNA 2QF7A 2AWNA 2E2IB 4DK1A 1H9SA 1GOZA 2E75C 1BCPC 3OW7A 5CGKA 3K5MA 1JR0D 4NKLA 3PIO3 3Q24A 1U4PA 1SBBB 5FO9B 2QILA 1UNSA 4X3SA 2IX0A 3T51B 4IFDI 2C5CA 4KY6A 4CJ2C 2IL8A 4YIJA 3DUZA 4H13C 2XN9C 3OMGA 4BA1I 4X3KA 1SFOB 3GTLB 5K36G 5EKIA 2EY1A 5FLXE 2EY6A 5I9PA 3K5NA 4F8MA 1JORA 1VF7A 3VA5A 4BWGB 3BVZA 3NQIA 5I2YA 3S1NB 2J0TD 2QCPX 4OIJA 3ERQA 1F77A 3MXPA 1OXTA 2RA4A 3I4MB 2LMCB 5DEHA 2XWBB 4MN3A 4A3FB 2Z1CA 1B2TA 1V8QA 1F9SA 2A6HD 4BY7B 1DXMA 5DM63 2A74C 2VB3X 1PTOD 3HOXB 2K03A 3NE5B 4UDUC 1LT3D 3QG1A 2GA4B 4X3UA 2XNAC 3EQLC 1STAA 2EJMA 1EYDA 3M7GA 1PTOF 2ZXRA 1ZKOA 2B2WC 3AU7A 3IFTA 1ET6A 2F0QA 1D2BA 4HCEA 1V43A 1S5BD 4RWSC 2L12A 4FYDA 2PCFB 3ITPA 4H0LC 1ENFA 1ONLA 2F0KA 4WRDA 1QG7A 4FF3A 1KTKA 1Y8OB 1O78A 2B2WA 3NWSA 2B2YC 4BBRB 3NQTA 3GTKB 1SNCA 4E6IA 3E6ZX 2FMCA 2BE5D 5C0XH 5I2XA 1EIGA 5CV6A 1B9MA 3J80E 3C3LA 3W3AA 4IURA 4XT3B 2ID0A 2A6EC 1KDAA 5I6WA 3BZDB 4C56C 3C1FA 3FPUB 2D2CC 5ELEA 4Y7NB 1VCIA 4KHZA 2DNEA 4KY7A 5G3LD 2F0EA 1NR4A 5JPNC 4XXEA 2WKDA 3MC0B 2A68C 3P1HA 5M5WB 1ZYRC 2RSNA 5DM73 2X6GA 4RCNA 2EYPA 1YNNC 1Z7TA 4QIWB 1Z6HA 3DHQA 5FKAC 3FDTA 1TU2B 2A73B 3OIQA 3S14B 1I3QB 3SK6A 4PMCA 1HUNA 4ABNA 4CKBA 4FO2A 3VR5A 4IALA 1CFMA 1DZ1A 3VYSA 1SNMA 4OIKA 5A2QE 5EKKA 1AP0A 4IN3A 3A55A 5D3IB 5KEEA 4KJNA 4I7ZC 1QJOA 3FPPA 1O80A 3I8ZA 1QILA 3RZDB 5CYUA 4F88A 2JSOA 2PNRC 1NAPA 1GUSA 4XTCS 4RFBA 2PZWA 1JB3A 4C3HG 2ZT9C 4ME5A 1CHQD 1CQFA 3R8BA 3GTPB 2EYOA 1EZ6A 4DAPA 1C4QA 2B8FA 4C3HB 1CZGA 1UEAB 3GP7A 3PO2B 1BF4A 3I4NB 3S2HB 4KI0A 4HEDA 3HOZB 1RKNA 3I73A 1SAPA 2PZTA 3MVVA 4K14A 2EYLA 2KUMA 5D14A 4EQNA 3SVMA 4DK0A 3PO3B 5D65A 1PDQA 3BG3A 1DOKA 5M3FB 4ZKBB 3MFYA 3GD7A 3NBHA 4DA2A 4HMJA 3KBGA 1JICA 4C1NK 1IHZA 1VF5C 3NP8A 1LT6D 3TSSA 4N9TA 1G2TA 1PRTD 2MGSA 1T5XD 4IUTA 1JCKB 3D31A 2VB2X 1YNJD 3Q23A 5IGFA 1GUTA 4QUCA 4MIUA 4DAVA 1S5ED 2IPKD 2NBFA 1AW7A 1S5FD 4R8IA 3EFXD 3RZOB 1TKWB 4G7ZC 3VYRA 1MSGA 3I70A 3SK5A 2XSCA 5ELFA 2OEOA 2FHTA 2EYFA 4S3SA 4IFDJ 1RCVD 4CKCA 1FNVA 2EJFC 1LTSD 2AWOA 1TR5A 3ONAB 1OO9B 1EIHA 5FLXL 2L1BA 4MHEA 1PZKD 5JVH3 1V1PB 2AQ2B 1EEID 2RBMA 2WV6D 1HTLD 2E2DC 4RKLA 5ELCA 1STHA 3SHLA 4C3JG 3HOYB 4QMGA 1OXSC 4XIGS 1D1KA 5EBCA 4NMZA 5BN5A 1RD9D 2VNUD 1LTAD 1EOTA 1I4HA 5K36H 4ZKCB 4ILWA 1AFPA 2KCNA 3S1RB 4HTHA 2EYJA 3A54A 1LT4D 2Y0SB 3TBIB 2LFNA 1LTBD 2PZUA 1D5MC 2EZVA 3G7LA 4U68A 2EYHA 3MHBA 4BA2I 1LO5D 4F7XA 4Z9CB 1Y1VB 1H9KA 1SSOA 3IL8A 2O2LD 1S4ZA 1W6KA 3A7AB 1U4MA 4RGNA 4N9PA 2JA6B 4CHTB 2SNSA 1BR9A 2JE6I 3FMCA 1IKMA 1F2ZA 4K6DA 3GTOB 1RF2D 2K04A 3OHXC 1I50B 3SK4A 3VYUA 4DU9A 2TMPA 2Z4HA 2CVRA 1LACA 3J80L 3SK8A 2WIIB 2LY7A 3R93A 1WTOA 1IYVA 1KNEA 2JP1A 4M1UB 5JOBA 2A6HC 4IUNA 1EU4A 1A2TA 3HRZC 1B9NA 4OO1I 1PTOC 4IZ8A 2EYMA 3IKJA 3NTKA 1A3VA 1D5XC 2LKVA 1F2YA 4DF7A 2PYKA 1EY8A 1V1OA 1IW7D 4RCOA 2WINB 1I6HB 1F9PA 4KMUC 4HAEA 2F0NA 2HCCA 1CT1D 4A3EB 4FF1A 1L0XB 3H09A 4XQJA 1TT2A 5C4JB 1HHVA 4DN4M 3RUZA 1L0YB 2B2VA 4GZYC 2K28A 5KGUA 3T16A 3PUZA 1R9TB 1EYAA 2BE5C 3KK7A 3H94A 2KCCA 1NR2A 3V05A 4FF2A 3H6MA 2ZXPA 2B2UC 4PV1C 1M4VA 3QIAA 2EDGA 5C0XJ 2F0PA 2M2LA 1PXUA 2F0MA 3P7JA 5A2QL 1SYEA 3N6RA 3I90A 3RD4A 5IGDA 1O7ZA 4ZYSA 4K8IA 3D3RA 2O4XA 2B2UA 4TRDA 5KYIA 2RDHA 1ENCA 2L11A 3CKIB 2PO4A 3VR3A 3S1QB 3SE0A 4RGTA 2K7VA 3WOFA 4OO1G 1ILPA 4H7BA 2EXZA 5C5LA 4RHRA 1LABA 1HPCA 1KDBA 1CI3M 2NTTA 5FK9C 3KF8A 5EBDA 1ESRA 5F2DA 1WTVA 1TS2A 2D62A 2BOSA 5EJWA 1KABA 4EVOA 3QO2A 2C9OA 1LTGD 1A15A 3TP6A 4DNRB 1VMPA 4KKUA 4B08A 3TP5A 4KKSA 1GHKA 4F87A 5HGTA 4J6HA 2JA7B 3MTSA 2L55A 1CHPD 5EPLA 3MXUA 3T56B 5NUCA 1QNUA 2J4XA 1DCZA 1BO0A 2F0VA 4IFDG 5M5XB 1XX8A 2R3ZA 3PMFA 4O1NA 2NB0A 1I4PA 2XVSA 5C6AA 1LTRD 3BDOA 2B39A 1SMYD 2EPBA 2E76C 4A3IB 3NPPA 3QOLA 1I4XA 1RDPD 4IUQA 1QB5D 5C3WA 2ENBA 4XYQA 2RSOA 3WDNA 3BYYB 2O5JC 4B9XA 1JOQA 3J81E 4KJOA 1HXYD 1SNDA 1CK1A 5AFWA 1DM0B 1BCPF 4QCLA 4XQQA 3CRKC 2YYZA 2PPBC 1SJHD 1ML0D 4FVMA 3QB3A 2KEEA 3BS1A 2HQEA 4I65A 4PMBA 1STEA 5ELDA 3HP3A 4RHSA 4BY1B 1DD2A 5E1FA 2H1EA 2JEBI 1XYIA 5CORA 1Y8NB 5EKLA 4P2CB 3EA6A 1SNPA 2E74C 4DXGA 4V190 4RH6A 1LT5D 2F3WA 1VDZA 2Q8TA 3V2TA 1HRJA 2R6GA 3TN2A 5ISRA 1SDFA 1PRTC 1AZQA 1SNOA 4C2MB 4HCSA 1MI2A 1R4PB 5C0XI 2B2TC 3BVMA 1YNJC 4XQNA 1ET9A 4XYOA 1GUOA 1KAAA 1G291 3MFGA 4K5VA 2B2TA 2H4OA 3URYA 3KBXA 3EROA 4CKEA 2QDBA 2FFKB 5JEAJ 3H91A 2K1BA 2KJXA 2XRQD 2K5QA 1WTQA 3S17B 1PMRA 4WORA 3GTJB 3ND8A 1MBYA 1TS3A 5M9OA 2F4IA 1I6VC 3N52A 2NUCA 2NN6H 3EJIA 3O13A 2MUYA 4LAAA 3NHHA 3MA2B 4KV6A 1NUCA 5DAUA 1E2VA 5M5YB 2F0OA 5T1IA 2FINB 4X3TA 3HS0C 3KLSX 1ENAA 4KN7C 3MWYW 5JAVA 4G7HC 3A8JE 3F2UA 5EGTA 1I4QA 3S9WA 4TSSA 2EE1A 2K33A 4A93B 3OWEB 4JK1C 2KQ3A 3RMHA 3SR1A 2B63B 5KYLA 2I07B 3HOWB 4L8JA 4G4KA 1RODA 2F0SA 5C0XG 1GUWA 2L5TA 2A69D 3OIPA 1B4OA 4ZUJA 3VYTA 1WTWA 4QF4A 5I4DA 1O7YA 1PTOH 1DYQA 3T13A 1LTTD 1OXVA 3TZUA 3SXHA 2AQ3B 3DM1A 1EY9A 1TS5A 1TWHB 3H3VC 4UAIA 1STNA 4WFN3 3Q22A 4A3GB 3Q0AA 4TQUS 3P75A 4RGMA 1SEBD 1HCZA 2LS01 2CW0D 2V4DA 2R7ZB 3IAYA 1GUNA 4BBSB 2QEJC 3KLRA 4PMWA 4DXFA 4TKOB 2O5IC 4A3BB 2X69A 1EEFD 4FF4A 1BNZA 1DONA 4DGZA 3IFDA 5BN4A 2CHBD 4K2KA 1QCBD 2K5DA 1UUPA 5CMDA 4RKBA 3A8IE 1IW7C 4K5XA 5CV5A 1R4QB 2F1MA 3TMEA 3VR6A 2D5DA 1TIID 1JWSD 1BOSA 4QUFA 4PQXA 4ULLA 2TSSA 1TQOA 5CR3A 2L9HA 1JQYD 1EQTA 5E4WC 2F0FA 1EZ8A 4ZQ3A 4KKTA 3LWUA 1F9RA 1XXGA 2PMZB 5CBEE 1SE3A 1A3TA 1I4GA 2WB1B 1V1PA 2K5WA 1PZJD 1WVLA 2J7ZA 2OXPA 2AUJD 3DWPA 4NDXA 5EQ0A 1NCVA 4EQPA 2BA0A 1JWUD 5IGEA 3L9AX 4AYBB 1RHPA 4DAYA 3R3OA 1C48A 1ZXTA 5FO8B 1EL0A 1B44D 2IX1A 3GV6A 5JJZA 2MP1A 1AZPA 4G57A 1SE4A 1U4RA 2HUGA 4FP5D 3CHBD 1WCMB 4ZRZA 4ZAIA 1LLRD 2FJ2A 3TZDA 5C4ZA 1QE6A 4EQOA 1QNKA 2XIWA 4ZUIA 4IUPA 1XWEA 3D6WA 3PUYA 4NW2A 3J81L 1KLUD 3QJYA 3UI2A 1VMCA 3X3MA 5CV7A 4RAUC 5LL6X 5IGGA 1C8CA 4IFDH 2DNCA 4LJZC 3D4DA 4ZK9B 2D9UA 2NVYB 1OXUA 3M7NA 2NZ1D 2KEDA 5IODA 1GHJA 5CV4A 1FYCA 4H44C 1H9SB 2B2VC 2ICEC 2RQXA 3DXJC 1CZWA 3HKZB 1A2UA 4IUVA 4K5WA 3LX0A 2AUKA 4C1NI 3HEJA 3J7AF 5JEAG 3GTQB 2NVXB 1SXTA 5CV9A 3GO5A 3PUXA 2KOLA 3Q6SA 1QWYA 1SYCA 5KNBA 3K58A 1H9JA 1Q1EA 1SMYC 2FMMA 4J1MA 3D4WA 1K8MA 1HA6A 1KNAA 1BCPB 2XRSD 2K6AA 1FR3A 1TY2A 1EWHA 3S15B 5J22A 5C3EB 1CM9A 1Q8IA 1FNWA 2R93B 2F0WA 1PYWD 5C44B 4QB4A 4ID6A 3S1MB 2A5HA 3MXGA 2G9DA 3FRPB 4KTAA 2EJGC 3KUPA 1JOKA 1ICWA 4NP5A 3K7AB 2R61A 1K8OA 1U4LA 4FXDA 1PFMA 2PQEA 4L63B 1D6EC 1A3UA 1WTPA 4BS9A 3MAQA 3NK9A 5D3DA 4A3KB 4KD4A 1EY6A 1XTCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCB D;  5G3L D;  1TII D;  5G3L F;  4FO2 A;  4FNF A;  4FP5 D;  1QB5 D; 
#chains in the Genus database with same CATH topology
 1K83 B;  1VQD A;  5C4X G;  2KCM A;  4B9W A;  4DR6 L;  3R2I A;  5A35 A;  1O7I A;  4KHV A;  2ZTE A;  1G6Z A;  3PUW A;  1K28 A;  1Q3L A;  4H02 A;  4YCW A;  1GJX A;  1U9R A;  5M3M G;  5IT9 E;  5C4X B;  1TWC B;  4X62 L;  1IL8 A;  3GQB A;  2QKI C;  1STG A;  1U5K A;  3I3C A;  2Z8L A;  1GUG A;  3T4A C;  2K32 A;  3S17 H;  3M85 A;  3D4R A;  5M3M B;  3GTJ H;  4K6L A;  3A8K E;  1PFB A;  1J8I A;  1EWC A;  1RTO A;  1SYG A;  3J81 c;  4A3M G;  3M3Y B;  3K7U C;  1SLJ A;  3JAM E;  3LWE A;  2CKZ B;  3SEB A;  2BA1 A;  2IWH A;  2RDF A;  4CJ1 B;  3CP0 A;  4DR1 Q;  2IW3 A;  2NWG A;  1X3E A;  2V1C C;  1Q1B A;  5K5P A;  3H0G G;  4A3M B;  4B3R Q;  3ULP A;  2ICI A;  2K75 A;  1EUJ A;  1HQM C;  5GQO A;  3PO2 H;  2VXW A;  1QOH A;  2WP8 J;  1EQV A;  2VUM G;  3I4N H;  1VQE A;  5C5M A;  4A75 A;  3H0G B;  5EPK A;  3S2H H;  1PLF A;  4PZ7 A;  2KEC A;  1VQG A;  4JI4 Q;  1HQR D;  3ZJY C;  3TP8 A;  1CA6 A;  3F2C A;  3T53 B;  4A3L H;  3K5L A;  1E2Z A;  1W6J A;  2E2J B;  3TDQ A;  4RG1 A;  2VUM B;  1E3P A;  1TY0 A;  1FGB D;  1STB A;  1SMX A;  1HNW Q;  3BDC A;  5HY6 A;  4A93 H;  3SDZ A;  1KLG D;  1EYC A;  3DWQ A;  2B63 H;  2G9H D;  1EY4 A;  2CH4 W;  2IJ0 A;  5C4H A;  4AQY Q;  4IPD A;  1FL0 A;  3HOW H;  1IKL A;  1N8R C;  5M3F H;  5E3F A;  1BCP D;  1HUM A;  3NUC A;  4HJ7 A;  1TVX A;  4P73 A;  1L0W A;  3FKI G;  3CAM A;  1UWV A;  3NXW A;  4R9W A;  3CMA A;  1X54 A;  4HN7 A;  2JA8 G;  1JJG A;  1LV9 A;  1EY0 A;  3KF6 B;  2AMC B;  3FKI B;  4A3D G;  3H3V H;  2NYZ D;  2UUB Q;  3VR2 A;  2DN8 A;  1MJC A;  1N36 Q;  2NVQ B;  1WTR A;  5FJ8 G;  1F2L A;  2H5X A;  2JA8 B;  1AEX A;  3VDY A;  5GAD C;  4IUU A;  4A3D B;  5JVG 3;  3BYT B;  1FNU A;  2KHI A;  4IQZ A;  2F0G A;  4A3G H;  2B2Y A;  1X32 A;  5IIF A;  5IGB A;  3L0O A;  4HJA A;  5JJI A;  2B8G A;  1BDO A;  1Q82 C;  2DGY A;  3GTM B;  1D5Z C;  1K0R A;  3K8A A;  2WKC A;  2R7Z H;  4LF7 L;  2OF1 A;  2DY8 A;  5FOB B;  4BBS H;  1JC7 A;  2IHF A;  4Q0F A;  4DV0 Q;  2A69 C;  4L5S A;  2CQA A;  2KHS A;  2JN4 A;  4A3B H;  1JOO A;  3DWA A;  3HGB A;  1H9M A;  3E9I A;  3VA7 A;  2XWJ B;  1DOM A;  2Z4I A;  1TXY A;  1HR0 Q;  1VQ7 A;  1S5D D;  5G3L F;  2R92 G;  3GTG B;  1IYU A;  4X65 L;  5L37 A;  3HZX A;  4U67 3;  3HKS A;  1XMO L;  2NTS A;  4RA8 A;  2I46 A;  2F0H A;  4DKA C;  2YTX A;  1PRT B;  2GN5 A;  4JBM A;  1VQ4 A;  2UU9 L;  4LUZ A;  3QOJ A;  2R92 B;  3CRL C;  4DV1 Q;  1MIU A;  1MGS A;  5IOC A;  2QW7 A;  1YJ9 A;  1XPU A;  2CW0 C;  4EGV A;  4DR5 L;  2RVL A;  1Z9F A;  1X3Q A;  4N8X 1;  4JI3 Q;  2RCN A;  3DEO A;  1MD2 D;  2BCO A;  4CJ0 B;  1X3P A;  3W2D A;  3HOY H;  1J9O A;  4ZCK A;  2UXD L;  5KIX A;  1EFI D;  3RLF A;  5CV8 A;  2N55 A;  1Q12 A;  4UP9 A;  3TQY A;  5LHY 1;  1EY7 A;  1KDC A;  1VQA A;  5FO7 B;  3X3N A;  2DY7 A;  2Q2I A;  1HFG A;  3ND9 A;  2MJ8 A;  3J7A 5;  4GNX B;  3AMU A;  3C46 A;  1MSH A;  3AB9 A;  3P20 A;  4JBW A;  5ELN A;  4ODG A;  1CKN A;  1CA5 A;  3ICE A;  4JI0 Q;  1VS0 A;  3NEN A;  4ZLT F;  4HSP A;  4K2L A;  3U9O A;  2M00 A;  5GAE C;  5IP7 G;  1HFN A;  4GN3 B;  1TWG B;  1NMF A;  5EPJ A;  1OXX K;  3D6C A;  3OWF A;  4KN4 C;  4LK1 C;  3NTI A;  2WAQ G;  3HOV G;  2CH4 A;  1IL2 A;  2HDM A;  4A3J B;  3FEW X;  4DNT B;  3T1Y Q;  1STY A;  2WAQ B;  3MZ5 A;  1GXD C;  3HOV B;  1NSN S;  2JA6 H;  2F0L A;  1E24 A;  4LFC Q;  1E0B A;  1PV4 A;  4DV7 Q;  2A6E D;  1PH9 A;  1YZ6 A;  5LMU L;  1B3A A;  1EY5 A;  3PQI A;  1WCM H;  3UDG A;  3NBH B;  2F03 A;  5BN3 A;  4B3T L;  3GTO H;  3I91 A;  3J7Y W;  2F0D A;  3PSI A;  4RGO S;  4GKK L;  3PCO B;  1SYD A;  1I50 H;  4DV4 Q;  1Q81 C;  1N33 L;  3KOJ A;  5TSS A;  1G8Z D;  3PUV A;  4JI6 Q;  1UAP A;  3BDL A;  3CQZ B;  5KND A;  3A5U A;  4OL7 A;  4WJ4 A;  3TS0 A;  4XT1 B;  4HSV A;  1FD7 D;  4IPC A;  2JEA I;  1FJG Q;  4M8A A;  2PW5 A;  2A68 D;  1ESF A;  3TS2 A;  1ZYR D;  3A56 A;  4LUV A;  4JI5 L;  5DNF A;  1YNN D;  2JA9 A;  3A7L A;  3F2B A;  3QWN A;  4DV5 Q;  1LTI D;  3L3O C;  2NN6 I;  4KD3 A;  4B3S L;  1EWI A;  1RJT A;  3MXN A;  3K59 A;  1CQV A;  1CTM A;  2F3I A;  2OT2 A;  3I72 A;  2F0I A;  2DUD A;  2EY2 A;  5COY A;  1DJR D;  1I6H H;  3OSO A;  3FVQ A;  4JC0 A;  2MPM A;  2F4V L;  2F0T A;  1JWM D;  2ZTD A;  1WTX A;  4FNF A;  1A6X A;  1II3 A;  1BXT A;  4J8Q A;  3KJP A;  1CKM A;  4CBV A;  1GKH A;  1T5E A;  2SNM A;  5JJL A;  4L6T B;  4OGQ C;  3M4O B;  2NVX H;  2E2H B;  3ULL A;  2RF4 A;  4JI1 L;  5I6Y A;  1PRT F;  3BVG A;  5LL6 S;  1Y1W G;  3A5Z B;  3E0E A;  3HOU G;  4LMQ D;  1G2S A;  3PV0 A;  1IBM L;  5JEA H;  1RTN A;  5T1G A;  4JV5 Q;  2F3V A;  1B1Z A;  3S15 H;  1Y1W B;  1R9T H;  1S3O A;  1AN8 A;  3CPW A;  3HOU B;  4PNY A;  1HA5 A;  2R93 H;  5C44 H;  2JA5 G;  2MFI A;  3MEH A;  3NWT A;  3OOC A;  1TWA B;  3S1M H;  1IBL L;  4OEM B;  3G6J B;  2BDN A;  3DLL A;  1BBX C;  3U9S A;  3B6Y A;  2JA5 B;  1E22 A;  3GV3 A;  4R8N A;  2EVB A;  2IT1 A;  1SYB A;  3UDI A;  4O42 A;  1WD0 A;  5CC4 A;  3OMC A;  4KY5 A;  3H15 A;  3K7A H;  2M9V A;  2K01 A;  2JXM B;  4WJW A;  2KVM A;  1YNX A;  3FP9 A;  3TP7 A;  1KRS A;  2WB1 G;  5CBA E;  1EU3 A;  1AH9 A;  4JYA Q;  5IT9 L;  5BR8 L;  4C3I G;  4XDX A;  3S16 B;  1SE2 A;  1ILQ A;  3LNN A;  4Q5V A;  3G71 A;  2F0J A;  4NPS A;  4G7O C;  1Y8P B;  2RHQ B;  2IX3 A;  2VQE L;  2SEB D;  2KCT A;  1E2W A;  1S5C D;  3C1E A;  3E5S A;  4HMI A;  1PZI D;  5IGC A;  2AQ1 B;  4C3I B;  3WOE A;  3I2Z A;  2YU9 B;  3E0J A;  4A3K H;  3NTH A;  4C3J B;  4DFA A;  1C9O A;  2RDG A;  2NN6 G;  5JJK A;  1J6Q A;  5KNC A;  3JAM L;  2HHH Q;  2SDF A;  1TS4 A;  1G91 A;  1EIF A;  4GOP B;  1E1O A;  3V96 A;  2N88 A;  4OO1 H;  2Z0S A;  3VR4 A;  2K05 A;  1Q90 A;  3CU7 A;  3NEL A;  2Q2U A;  1VQM A;  1I4R A;  5HUR A;  4DV3 Q;  2ZXO A;  5ELB A;  3R2T A;  3C2P A;  2SOB A;  1Y69 U;  5J39 A;  1B53 A;  1ZEQ X;  2CCZ A;  4GLA C;  4KK7 A;  1HTP A;  1BBU A;  3KLS A;  4OXP A;  1O7L A;  1YJW A;  1F9Q A;  4YY3 L;  5J1Z A;  4LF6 L;  3I4L A;  2HCI A;  4I7A A;  1SYF A;  2Q8I B;  1WOC A;  3L7Z C;  4KHP Q;  1BUV T;  5I9O A;  2BDO A;  1F2M A;  3D8G A;  1K9M C;  1SNQ A;  1VQ5 A;  4NXN Q;  3EVQ A;  2JA7 H;  1EOV A;  1E1T A;  4A3M H;  3M4Y A;  2L0C A;  2MHV A;  4GLV B;  2RKS A;  3K57 A;  1BQQ T;  2PW7 A;  5JPM C;  2CWP A;  1WD1 A;  3DEP A;  2JYO A;  4OHJ A;  1Z47 A;  4GKJ Q;  5M5X H;  5E4X A;  3K0Y A;  2HD3 A;  4MZ9 A;  1B50 A;  1XTD A;  2F0U A;  3NSW A;  2EOT A;  4CGY B;  2E2J H;  1PH2 A;  4X6A H;  1M8A A;  2A1A A;  4A3I H;  3OW2 A;  3CCR A;  2KA7 A;  1A8V A;  2HDL A;  1VQH A;  1GD7 A;  4V0B A;  4FXK C;  4CDF C;  1PTO B;  3PIP 3;  3S2D B;  1X3F A;  2R7F A;  4A3K B;  1VQ8 A;  1N34 L;  5KRU A;  3DMU A;  1X56 A;  4FXG C;  3K6O A;  4K8J A;  1SJE D;  2EY5 A;  1D1I A;  1TWF B;  2WAC A;  4HIM A;  2NVT B;  4R4O A;  1XNR L;  2UXB Q;  5C3X A;  2X6L A;  3FKI H;  4HR7 B;  2CQO A;  3HG9 A;  3OPO A;  2L4N A;  1DOL A;  1JE4 A;  3K5O A;  4LF4 L;  4ALP A;  2EQS A;  3J7A V;  3ZYY X;  2E5L L;  3NBI A;  4A3D H;  1H9R A;  2Q8R E;  5IWA L;  4DR3 L;  1K3R A;  1PFN A;  2QF7 A;  2AWN A;  2CFM A;  2E2I B;  5FJ8 H;  3J80 i;  4DK1 A;  1WYD A;  1JE5 A;  1H9S A;  1L1O A;  1GOZ A;  3GTM H;  2E75 C;  1VQ6 A;  2Z9H A;  1BCP C;  3OW7 A;  4UP7 A;  5IT9 c;  1PYB A;  3K81 C;  5CGK A;  3K5M A;  1JR0 D;  2K14 A;  2Z6K A;  4NKL A;  3U4V A;  3PIO 3;  1S40 A;  3Q24 A;  1U4P A;  1W3S A;  2PI2 E;  1SBB B;  5HGQ A;  5FO9 B;  2QIL A;  4JW0 A;  1UNS A;  4X3S A;  2IX0 A;  1T9H A;  3T51 B;  4DR2 L;  4IFD I;  2C5C A;  4KY6 A;  5IYB G;  4CJ2 C;  4HIK A;  2IL8 A;  4YIJ A;  4C2M H;  3T1H Q;  1BBW A;  3DUZ A;  3PIP A;  3W5O A;  4H13 C;  2R92 H;  2XN9 C;  3OMG A;  4BA1 I;  4X3K A;  5GRO A;  1SFO B;  3GTL B;  1HNX L;  5K36 G;  2QA4 A;  4OX9 L;  4QGU A;  2GVB A;  5EKI A;  2EY1 A;  5FLX E;  2EY6 A;  5I9P A;  3K5N A;  2RCF A;  2RHS B;  4AIM A;  1IYJ B;  4F8M A;  1JOR A;  4DV2 Q;  1VF7 A;  3KF8 B;  3VA5 A;  1QUQ B;  4BWG B;  3BVZ A;  3HFZ B;  3NQI A;  1HH2 P;  5I2Y A;  3I4M G;  3S1N B;  2J0T D;  2QCP X;  4OIJ A;  1HZ9 A;  3ERQ A;  1F77 A;  3MXP A;  5IY0 A;  4YWM A;  1OXT A;  2RA4 A;  3I4M B;  3CD6 A;  1N32 Q;  2LMC B;  5DEH A;  4K0K L;  4BY7 G;  2XWB B;  4BXX G;  2OCE A;  4MN3 A;  3CC2 A;  1VQN A;  4A3F B;  1EFW A;  2Z1C A;  3G4S A;  3PIO A;  1B2T A;  1V8Q A;  1F9S A;  2A6H D;  4BY7 B;  1DXM A;  5DM6 3;  4JOI C;  2A74 C;  2VB3 X;  1PTO D;  3HOX B;  1X55 A;  5M5Y H;  5IP7 H;  2K03 A;  4JPB W;  3NE5 B;  4UDU C;  1LT3 D;  3QG1 A;  2GA4 B;  2XNA C;  4X3U A;  3EQL C;  1STA A;  2EJM A;  3PF5 A;  1EYD A;  4CDD C;  3M7G A;  1PTO F;  2ZXR A;  1ZKO A;  2B2W C;  3AU7 A;  3IFT A;  3I4O A;  1I94 L;  3DM3 A;  4JOI A;  4LFB Q;  1ET6 A;  3M4P A;  2F0Q A;  1XNQ Q;  2UXC Q;  3J7Z C;  4A4I A;  4HCE A;  1V43 A;  3OTO Q;  1S5B D;  4JI2 L;  1KRT A;  1D2B A;  1YBY A;  4RWS C;  1YIJ A;  2L12 A;  4FYD A;  4DV6 Q;  2PCF B;  3ITP A;  4H0L C;  1YI2 A;  1B3Q A;  4BBR G;  1ENF A;  2HIV A;  1ONL A;  1YVC A;  2F0K A;  1YJN A;  4LNQ A;  1PH5 A;  4DR6 Q;  4HJ9 A;  4WRD A;  4TVA B;  1QG7 A;  1PH3 A;  4FF3 A;  1KTK A;  3CQZ H;  1Y8O B;  1O78 A;  2B2W A;  3NWS A;  2ZJP A;  2B2Y C;  4BBR B;  3CPF A;  3NQT A;  3GTK B;  1SNC A;  4E6I A;  4X62 Q;  3E6Z X;  2FMC A;  2BE5 D;  5C0X H;  5I2X A;  1D8L A;  1EIG A;  3Q8D A;  5CV6 A;  1B9M A;  4APV A;  3J80 E;  3C3L A;  3W3A A;  4IUR A;  1PH4 A;  4L5R C;  4XT3 B;  4LFA L;  2ID0 A;  4DK6 C;  1TWH H;  2A6E C;  1KDA A;  1YHA A;  5I6W A;  2Y0S E;  3BZD B;  2K5N A;  4C56 C;  3C1F A;  3FPU B;  1KQS A;  3F1Z A;  2ZTC A;  5IYD G;  2D2C C;  5ELE A;  4Y7N B;  2JK8 A;  1VCI A;  1P16 A;  4KHZ A;  2DNE A;  4KY7 A;  5G3L D;  4DNI A;  2OTJ A;  3KF6 A;  2F0E A;  1NR4 A;  5JPN C;  4XXE A;  2WKD A;  3MC0 B;  4UHV A;  3M4O H;  1JB7 A;  1C7Y A;  1N9W A;  2A68 C;  3P1H A;  5M5W B;  1ZYR C;  2RSN A;  5DM7 3;  1IZ6 A;  2X6G A;  3M9B A;  4RCN A;  2EYP A;  1YNN C;  1Z7T A;  4QIW B;  3U4Z A;  4YWL A;  2KHJ A;  1Z6H A;  3DHQ A;  5AJ3 L;  5FKA C;  3HOU H;  3FDT A;  2VZA A;  2I5L X;  1TU2 B;  2A73 B;  3OIQ A;  1TWA H;  3BU2 A;  2KEN A;  3S14 B;  2MO1 A;  1B70 B;  1PA6 A;  1I3Q B;  3SK6 A;  4PMC A;  1HUN A;  4L5T A;  2MNA A;  2DJF C;  4DUZ L;  3H3V I;  4ABN A;  4POG A;  4CKB A;  4FO2 A;  3VR5 A;  4IAL A;  1CFM A;  1DZ1 A;  4LF8 L;  3KDF B;  2ATW A;  3VYS A;  1SNM A;  5J3B A;  4OIK A;  5A2Q E;  3S16 H;  5EKK A;  1AP0 A;  4IN3 A;  1VQI A;  1GVP A;  3A55 A;  3UDX A;  2I5M X;  2VQF L;  4A3C H;  1UE6 A;  2MQH A;  5D3I B;  4B3M L;  4LF7 Q;  5KEE A;  4KJN A;  3EBE A;  4I7Z C;  1KHI A;  3HKZ E;  2UUA L;  1QJO A;  1UE7 A;  3FPP A;  4JI8 L;  4DUY L;  1O80 A;  4A3J G;  4LF5 L;  3I8Z A;  1QIL A;  3RZD B;  2XTI A;  5CYU A;  4F88 A;  2JSO A;  4DR7 L;  2PNR C;  3KDF A;  1NAP A;  4YHH L;  1GUS A;  4XTC S;  4X65 Q;  4RFB A;  4GNX A;  2PZW A;  1JB3 A;  4C3H G;  2ZT9 C;  4ME5 A;  1BVS A;  3WWV A;  2MO0 A;  3AEV A;  1XMO Q;  1CHQ D;  1A63 A;  1IBK L;  1CQF A;  3R8B A;  3PO2 G;  3GTP B;  2JJQ A;  3I4N G;  2EYO A;  2UU9 Q;  1EZ6 A;  3HOZ G;  2A19 A;  4DAP A;  1C4Q A;  2B8F A;  4C3H B;  1CZG A;  4A3L G;  1UEA B;  3GP7 A;  1JJC B;  2K5H A;  3PO2 B;  1BF4 A;  4DR5 Q;  4OON A;  3I4N B;  3S2H B;  2B3G A;  4KI0 A;  4HED A;  3HOZ B;  2Z6B A;  1VQL A;  4P75 A;  1RKN A;  3I73 A;  1SAP A;  2PZT A;  3MVV A;  2EIF A;  2A8V A;  3PO3 G;  2UXD Q;  4K14 A;  2EYL A;  2KUM A;  2VY3 A;  5M3F G;  5D14 A;  4EQN A;  3AFP A;  3SVM A;  4DK0 A;  3PO3 B;  1AE3 A;  5D65 A;  1PDQ A;  3BG3 A;  1Q86 C;  1DOK A;  4O2D A;  5M3F B;  4ZKB B;  4CDC C;  3MFY A;  1IXR A;  3GD7 A;  3NBH A;  4HJ8 A;  4DA2 A;  4HMJ A;  3KBG A;  2NVY H;  3BZK A;  1JIC A;  4R4Q A;  4C1N K;  2DJG C;  1X6O A;  1IHZ A;  1VF5 C;  3NP8 A;  1LT6 D;  3S2D H;  3TSS A;  3PF4 A;  4N9T A;  1G2T A;  1PRT D;  1B8A A;  2MGS A;  2BH2 A;  1T5X D;  1TWF H;  4IUT A;  4PG3 A;  1JCK B;  3D31 A;  2VB2 X;  2NZO A;  1YNJ D;  1WJJ A;  3Q23 A;  5IGF A;  3GTQ H;  5LMN W;  1GUT A;  4QUC A;  4MIU A;  2K50 A;  4DAV A;  1S5E D;  2IPK D;  2NBF A;  1AW7 A;  1S5F D;  1VQC A;  4R8I A;  3EFX D;  2LSS A;  3RZO B;  1TKW B;  5LMU Q;  4G7Z C;  4B3T Q;  3VYR A;  1MSG A;  1MKH A;  3I70 A;  3SK5 A;  1CSQ A;  2F52 A;  2XSC A;  1FVI A;  5ELF A;  2OEO A;  5C3E H;  2FHT A;  4GKK Q;  4POF A;  2EYF A;  4S3S A;  1N33 Q;  1RCV D;  4CKC A;  1YHB A;  4IFD J;  1FNV A;  2EJF C;  1XMQ L;  1Q8K A;  1LTS D;  2AWO A;  1UE1 A;  2C35 B;  1TR5 A;  3ONA B;  3RN2 A;  1OO9 B;  1EIH A;  3K80 C;  5FLX L;  2L1B A;  1JMC A;  4MHE A;  1PZK D;  1UE5 A;  2E8G A;  1CKO A;  1PH1 A;  5JVH 3;  4JI5 Q;  4UPA A;  1V1P B;  2AQ2 B;  1EEI D;  2RBM A;  2WV6 D;  1HTL D;  4B3S Q;  2E2D C;  4RKL A;  5ELC A;  3RLO A;  1AE2 A;  1STH A;  3SHL A;  4C3J G;  2Q2H A;  3HOY B;  4QMG A;  1OXS C;  4L5Q A;  4XIG S;  1JT8 A;  4J15 A;  1D1K A;  1H95 A;  2IY5 B;  3GTL H;  3G6E A;  5EBC A;  4NMZ A;  2F4V Q;  4DAY B;  4DK3 C;  5BN5 A;  1RD9 D;  1ASZ A;  2VNU D;  1LTA D;  1K83 H;  3KFU A;  1EOT A;  4X66 L;  4LF9 L;  2Y0S G;  1I4H A;  5K36 H;  4ZKC B;  4ILW A;  1AFP A;  4JI1 Q;  2KCN A;  3S1R B;  5C4X H;  1TWC H;  4HTH A;  1C0A A;  2EYJ A;  3A54 A;  1LT4 D;  2VS1 A;  5H1S E;  2Y0S B;  4GOP C;  5FLM G;  3TBI B;  1XJV A;  1IBM Q;  2LFN A;  2ZM6 L;  5M3M H;  1LTB D;  1Y1V G;  4IPG A;  1HNZ L;  2PZU A;  1D5M C;  2EZV A;  3G7L A;  4U68 A;  2EYH A;  3MHB A;  4BA2 I;  3M3Y H;  1LO5 D;  4F7X A;  4Z9C B;  1Y1V B;  1H9K A;  2AHO B;  1SSO A;  1IBL Q;  2JA6 G;  4P74 A;  4GS3 A;  4GOP A;  3IL8 A;  2O2L D;  1S4Z A;  1W6K A;  1K0S A;  3A7A B;  3FHW A;  1U4M A;  4RGN A;  4X64 L;  1E7Z A;  4N9P A;  2JA6 B;  4CHT B;  2SNS A;  1BR9 A;  2JE6 I;  3FMC A;  1Y14 B;  1IKM A;  1F2Z A;  4K6D A;  1JJ2 A;  1SRO A;  3GTO B;  3H0G H;  2YV5 A;  4JBJ A;  4HJ5 A;  3S24 A;  4NXM L;  1RF2 D;  4UP8 A;  2KBN A;  5BR8 Q;  1ASY A;  2K04 A;  1YIT A;  1J5E L;  3OHX C;  1I50 B;  3SK4 A;  3VYU A;  1A62 A;  2D0O A;  4DU9 A;  2VQE Q;  4IJL A;  2TMP A;  2VUM H;  2Z4H A;  2CVR A;  1LAC A;  3J80 L;  4FDB A;  3SK8 A;  2PQA B;  4DPG A;  1MJE A;  1WTH A;  3I56 A;  4OEL B;  2WII B;  2LY7 A;  3L2P A;  3R93 A;  1WTO A;  2N78 A;  1PYS B;  1IYV A;  2OQ0 A;  4IOA A;  1HR0 W;  1KNE A;  2JP1 A;  4M1U B;  5JOB A;  1D7Q A;  2A6H C;  4IUN A;  1EU4 A;  1A2T A;  2HIX A;  3HRZ C;  1B9N A;  4OO1 I;  1PTO C;  4IZ8 A;  2EYM A;  4P71 A;  3IKJ A;  3NTK A;  1A3V A;  1D5X C;  2LKV A;  4Y52 H;  1F2Y A;  4DF7 A;  1L1O C;  2PYK A;  4MTK A;  4A3E G;  1EY8 A;  1V1O A;  1IW7 D;  4RCO A;  2WIN B;  1I6H B;  1F9P A;  4DR4 L;  5GAH C;  4LUO A;  2NVQ H;  4KMU C;  4HAE A;  2F0N A;  2JA8 H;  2HCC A;  5LMN L;  1CT1 D;  2Z6K C;  4A3E B;  4HIO A;  4FF1 A;  1L0X B;  3H09 A;  4YY3 Q;  4XQJ A;  4LF6 Q;  1TT2 A;  2QGQ A;  5C4J B;  5FLX c;  3RNU A;  1HHV A;  3STB D;  4DN4 M;  3RUZ A;  4Y7N H;  3J81 i;  1L0Y B;  2B2V A;  4GZY C;  1QVG A;  2K28 A;  2JQO A;  5KGU A;  3T16 A;  2K5V A;  1YEZ A;  3PUZ A;  1R9T B;  1EYA A;  2BE5 C;  4PZ8 A;  3KK7 A;  3H94 A;  2KCC A;  1NR2 A;  4GLX A;  3V05 A;  3GTG H;  4FF2 A;  3ULJ A;  3H6M A;  2ZXP A;  2B2U C;  4PV1 C;  1M4V A;  1CSP A;  3QIA A;  2EDG A;  5C0X J;  2F0P A;  4DR1 L;  2M2L A;  1PXU A;  2F0M A;  3P7J A;  2XGT A;  5A2Q L;  4A76 A;  1SYE A;  4B3R L;  3G48 A;  3N6R A;  3I90 A;  1N34 Q;  3RD4 A;  5IGD A;  1O7Z A;  1M1K C;  4ZYS A;  3S14 H;  4K8I A;  1PHJ A;  1VQF A;  3D3R A;  4JI4 L;  1I3Q H;  2B2U A;  2O4X A;  4TRD A;  5KYI A;  2RDH A;  1XNR Q;  1EQR A;  1WFQ A;  1ENC A;  1PH8 A;  1X3G A;  2L11 A;  1HNW L;  3CKI B;  4LF4 Q;  4IO9 A;  1OTC A;  2PO4 A;  3VR3 A;  3S1Q B;  3SE0 A;  2E5L Q;  2VW9 A;  1SRU A;  4RGT A;  4AQY L;  2K7V A;  3WOF A;  1K8A C;  3M4Q A;  4OO1 G;  5IWA Q;  4DR3 Q;  4A3F G;  3AYH B;  1ILP A;  4H7B A;  2EXZ A;  5C5L A;  4RHR A;  1LAB A;  2WFW A;  1HPC A;  3E3X A;  1KDB A;  4GN5 A;  1CI3 M;  1LM0 A;  4LW1 A;  2NTT A;  3HOX G;  3SGI A;  3U58 A;  5FK9 C;  3KF8 A;  2UUB L;  1P8L A;  1QUQ A;  5EBD A;  1ESR A;  5F2D A;  1TWG H;  1TS2 A;  2D62 A;  1WTV A;  1N36 L;  3JC6 6;  2BOS A;  5EJW A;  3J80 c;  1KAB A;  3F2D A;  1G6P A;  3RZD H;  4EVO A;  3QO2 A;  2C9O A;  1LTG D;  2JA7 G;  1A15 A;  4A3J H;  3TP6 A;  4DNR B;  1VMP A;  4KKU A;  4DR2 Q;  4B08 A;  3TP5 A;  4KKS A;  1GHK A;  2Q2T A;  4OWW B;  4F87 A;  3RR5 A;  4R4I A;  5HGT A;  4J6H A;  2JA7 B;  3MTS A;  2L55 A;  3GTP H;  3HOV H;  1CHP D;  1KL9 A;  5EPL A;  1S72 A;  3CCV A;  2CWA A;  3MXU A;  3T56 B;  5NUC A;  4C3H H;  4DV0 L;  1QNU A;  1HNX Q;  2J4X A;  1DCZ A;  1BO0 A;  2F0V A;  4IFD G;  4OX9 Q;  5M5X B;  1XX8 A;  5IYC G;  4A3I G;  3HOZ H;  2R3Z A;  3PMF A;  3ERS X;  4O1N A;  2NB0 A;  1I4P A;  2XVS A;  5C6A A;  1HR0 L;  1LTR D;  3BDO A;  1QVC A;  2B39 A;  1SMY D;  2EPB A;  2E76 C;  4A3I B;  4WJ3 M;  3NPP A;  3RLN A;  3QOL A;  1RIP A;  1I4X A;  1RDP D;  4IUQ A;  1QB5 D;  5C3W A;  2ENB A;  4XYQ A;  3PO3 H;  2RSO A;  4DV1 L;  3WDN A;  1SR3 A;  3BYY B;  2PMZ E;  2O5J C;  4B9X A;  2WB1 E;  1JOQ A;  4K0K Q;  1NNX A;  3J81 E;  4KJO A;  1HXY D;  1SND A;  1NMG A;  4JI3 L;  1M90 C;  1CK1 A;  1SE8 A;  1HJP A;  2IHE A;  5AFW A;  3CXC A;  1W2B A;  1DM0 B;  1BCP F;  4JI7 L;  4QCL A;  4AYB E;  4XQQ A;  3CRK C;  2YYZ A;  2PPB C;  1SJH D;  1ML0 D;  4FVM A;  3QB3 A;  1K8G A;  2KEE A;  4BY1 G;  3BS1 A;  2OTL A;  2HQE A;  4I65 A;  4PMB A;  1EQQ A;  1STE A;  2N8N A;  5ELD A;  3HP3 A;  3E9H A;  4RHS A;  2E2H H;  3GDE A;  2ASB A;  4BY1 B;  1UEB A;  1DD2 A;  5E1F A;  1I5F A;  2VL6 A;  3I7F A;  4JI0 L;  1I94 Q;  2H1E A;  2JEB I;  4QL5 A;  1XYI A;  3RZO H;  5COR A;  1Y8N B;  5EKL A;  4IOC A;  4P2C B;  3EA6 A;  1SNP A;  2E74 C;  4JI2 Q;  4DXG A;  1Y1W H;  4V19 0;  4RH6 A;  1LT5 D;  2QEX A;  2F3W A;  4YCV A;  1VDZ A;  1QZG A;  1KD1 C;  1PVO A;  2Q8T A;  3W1G A;  3V2T A;  1NBW A;  1HRJ A;  1K73 C;  2R6G A;  3TN2 A;  5ISR A;  1SDF A;  1PRT C;  1AZQ A;  1QZH A;  2N3S A;  1SNO A;  4IJH A;  3T1Y L;  2JA5 H;  4C2M B;  4HCS A;  1MI2 A;  1R4P B;  5C0X I;  5IP9 G;  2B2T C;  1X65 A;  3LGJ A;  4LFC L;  1QVF A;  3BVM A;  1YNJ C;  4XQN A;  3CCJ A;  4DV7 L;  1ET9 A;  1U0L A;  2FXQ A;  4LFA Q;  1CKN B;  4XYO A;  1KIX A;  1GUO A;  4DV4 L;  4YWK A;  1KAA A;  1G29 1;  3MFG A;  4K5V A;  2PNH A;  4JCV E;  4JI6 L;  3IRB A;  2B2T A;  2H4O A;  2R7D A;  1WI5 A;  4C3I H;  3URY A;  3KBX A;  4JI7 Q;  4AH6 A;  3ERO A;  4CKE A;  1RL2 A;  2QDB A;  2FFK B;  2YU9 H;  5JEA J;  3CCU A;  3H91 A;  4OWX B;  5DLQ E;  4GNX C;  4NB3 A;  1FJG L;  4C3J H;  2K1B A;  2KJX A;  2ZJR A;  1EIY B;  4LWC A;  2XRQ D;  2K5Q A;  1WTQ A;  3S17 B;  1PMR A;  4WOR A;  1VQB A;  3GTJ B;  3ND8 A;  1MBY A;  1TS3 A;  5M9O A;  2F4I A;  1HZC A;  2ES2 A;  4QQB X;  1I6V C;  3N52 A;  3UDF A;  4DV5 L;  2NUC A;  4PZ6 A;  3S1R H;  2NN6 H;  3EJI A;  3O13 A;  3A0J A;  3CME A;  2MUY A;  4MNO A;  4LAA A;  3NHH A;  4P72 A;  5EAY A;  3MA2 B;  4KV6 A;  5AJ3 Q;  4RMF A;  1SN8 A;  1VQJ A;  1NUC A;  5DAU A;  1E2V A;  5FLM H;  3CW2 C;  3BZC A;  4DAM A;  5M5Y B;  2F0O A;  5T1I A;  2FIN B;  1FGU A;  1Y1V H;  4X3T A;  3HS0 C;  3K0X A;  1ENA A;  3KLS X;  1V1Q A;  4KN7 C;  4JBK A;  3MWY W;  5JAV A;  4G7H C;  1B7Y B;  4A93 G;  1MHW C;  3BJU A;  2B63 G;  3A8J E;  3F2U A;  3A74 A;  4DUZ Q;  5EGT A;  1I4Q A;  3S9W A;  3HOW G;  4TSS A;  4JV5 L;  2EE1 A;  2K33 A;  4A93 B;  2N49 A;  3OWE B;  4JK1 C;  2KQ3 A;  3RMH A;  3SR1 A;  2B63 B;  5KYL A;  3MXN B;  4LF8 Q;  2I07 B;  3HOW B;  4L8J A;  4MTN A;  4R4C A;  4G4K A;  4R4T A;  4UY8 C;  3QR8 A;  1ROD A;  2F0S A;  3PGZ A;  5C0X G;  1GUW A;  2L5T A;  3EIV A;  2A69 D;  3OIP A;  1B4O A;  4ZUJ A;  3VYT A;  2VQF Q;  1WTW A;  2ZJQ A;  4QF4 A;  3U50 C;  4B3M Q;  2ALY B;  5I4D A;  1O7Y A;  5IE8 A;  2PI2 A;  1PTO H;  1DYQ A;  3KYH C;  3T13 A;  4JVZ A;  1LTT D;  1OXV A;  2UUA Q;  4JI8 Q;  3TZU A;  3UE1 A;  4DUY Q;  1G51 A;  4A3G G;  4LF5 Q;  3SXH A;  2AQ3 B;  3DM1 A;  1EY9 A;  1TS5 A;  1PH6 A;  4JYA L;  1HZA A;  3W1B A;  1DGS A;  2NVT H;  1TWH B;  3H3V C;  4DR7 Q;  4UAI A;  2OQK A;  1STN A;  4WFN 3;  3AFQ A;  3Q22 A;  2R7Z G;  4YHH Q;  4A3G B;  3Q0A A;  4TQU S;  4BBS G;  3P75 A;  4RGM A;  1VQK A;  1SEB D;  1IBK Q;  1HCZ A;  2LS0 1;  2CW0 D;  2V4D A;  2R7Z B;  4A3B G;  4A3E H;  3IAY A;  1GUN A;  1K3B C;  4BBS B;  2QEJ C;  1NTG A;  3KLW A;  2LXK A;  3EN2 A;  5C4J H;  2HHH L;  3KLR A;  4PMW A;  4DXF A;  4TKO B;  2E2I H;  2O5I C;  4A3B B;  2X69 A;  1EEF D;  3CCL A;  1PFS A;  4FF4 A;  1BNZ A;  1DON A;  4DGZ A;  3CF5 A;  3IFD A;  4DV3 L;  5BN4 A;  2CHB D;  4K2K A;  1QCB D;  2K5D A;  1UUP A;  5CMD A;  4RKB A;  3A8I E;  5ELO A;  1VQP A;  1IW7 C;  4K5X A;  5CV5 A;  3MEF A;  4KHP L;  3HOY G;  1R4Q B;  2F1M A;  2OWO A;  3TEH B;  3TME A;  4NXN L;  3VR6 A;  2D5D A;  1TII D;  1JWS D;  1BOS A;  4QUF A;  4PQX A;  4ULL A;  2L15 A;  5IYB H;  2TSS A;  3STB C;  3TRE A;  1TQO A;  5CR3 A;  1SFO H;  4GKJ L;  2L9H A;  1JQY D;  1EQT A;  5E4W C;  2G5D A;  1CUK A;  2F0F A;  1EZ8 A;  4ZQ3 A;  2AKW B;  4EX5 A;  4KKT A;  4A3C G;  3LWU A;  1F9R A;  1XXG A;  2PMZ B;  1NE3 A;  5CBE E;  1SE3 A;  3CCS A;  4GN4 B;  1A3T A;  1I4G A;  2EXD A;  3CCM A;  2WB1 B;  1V1P A;  2K5W A;  1PZJ D;  3S1N H;  1WVL A;  4AYB G;  2J7Z A;  2OXP A;  3J81 j;  3S1Q H;  2NZH A;  2AUJ D;  4JG2 A;  3DWP A;  4NDX A;  5EQ0 A;  1NCV A;  1NY4 A;  2YTV A;  4EQP A;  2BA0 A;  2K4K A;  4O0A A;  1JWU D;  5IGE A;  2BH8 A;  3I4M H;  3AQQ A;  3L9A X;  4AYB B;  1RHP A;  1GO3 E;  2QDL A;  4DAY A;  3R3O A;  3ER0 A;  3D0F A;  4A3F H;  1C48 A;  4R1J A;  1XMQ Q;  4CDE C;  1Q7Y C;  1ZXT A;  2UXB L;  5FO8 B;  1HZB A;  4KLK A;  1EL0 A;  4BY7 H;  1B44 D;  4BXX H;  1WCM G;  2IX1 A;  3F8T A;  3GV6 A;  1GM5 A;  5JJZ A;  2I0Q A;  2MP1 A;  1AZP A;  4G57 A;  3HOX H;  3NEM A;  1SE4 A;  1U4R A;  2B29 A;  2HUG A;  4FP5 D;  3CHB D;  1WCM B;  4ZRZ A;  4ZAI A;  1KXL A;  1LLR D;  2FJ2 A;  3TZD A;  5C4Z A;  3OYY A;  1QE6 A;  4QIW E;  1X9N A;  2UUC L;  1LYL A;  4EQO A;  4QJF A;  1QNK A;  2XIW A;  4ZUI A;  4IUP A;  1XWE A;  3D6W A;  3JAM i;  3RN5 A;  3PUY A;  4NW2 A;  5GAG C;  3J81 L;  1KLU D;  2I5H A;  1VQ9 A;  3QJY A;  1LTL A;  3UI2 A;  3I55 A;  1BKB A;  1VMC A;  3X3M A;  5CV7 A;  4RAU C;  4X66 Q;  4LF9 Q;  1LUZ A;  5LL6 X;  5IGG A;  1VQO A;  1C8C A;  4IFD H;  2DNC A;  4LJZ C;  3D4D A;  5IYC H;  4BBR H;  4ZK9 B;  3GTK H;  2D9U A;  3T1H L;  1KC8 C;  2NVY B;  1NJI C;  1OXU A;  3M7N A;  3HKZ G;  2NZ1 D;  2KED A;  5IOD A;  1GHJ A;  2ZM6 Q;  5CV4 A;  1V9P A;  1FYC A;  4H44 C;  1H9S B;  2B2V C;  2ICE C;  4EQ5 A;  1L1O B;  1HNZ Q;  2PQA A;  1KAW A;  2RQX A;  3DXJ C;  1CZW A;  1Q46 A;  1ICF B;  3CCQ A;  3HKZ B;  1A2U A;  4IUV A;  2P5Z X;  4K5W A;  3LX0 A;  2AUK A;  1A0I A;  4C1N I;  4DV2 L;  3HEJ A;  3CCE A;  3J7A F;  1XPR A;  4YCU A;  5JEA G;  3GTQ B;  2NVX B;  1SXT A;  5CV9 A;  3GO5 A;  3PUX A;  2KOL A;  3Q6S A;  4X64 Q;  1QWY A;  1SYC A;  5KNB A;  3KJO A;  5C3E G;  3K58 A;  4N8F A;  1XPO A;  4HID A;  1H9J A;  1Q1E A;  1SMY C;  2FMM A;  2R93 G;  4ME3 A;  4J1M A;  5C44 G;  3D4W A;  1K8M A;  1HA6 A;  5IYD H;  1KNA A;  1EYG A;  1BCP B;  2XRS D;  2K6A A;  1FR3 A;  1TY2 A;  1EWH A;  3S15 B;  4NXM Q;  1N32 L;  5J22 A;  3CC7 A;  5C3E B;  1CM9 A;  2D0P A;  1Q8I A;  5M5W H;  2UUC Q;  1J5E Q;  1FNW A;  4BY1 H;  2R93 B;  2F0W A;  1PYW D;  5C44 B;  1L2F A;  2WAQ E;  4QB4 A;  4ID6 A;  3S1M B;  2GVA A;  2A5H A;  3MXG A;  2G9D A;  3FRP B;  4IPH A;  4KTA A;  3TRZ A;  2EJG C;  3KUP A;  1PH7 A;  1JOK A;  1ICW A;  2YTY A;  4OWT B;  4NP5 A;  3K7A B;  2R61 A;  1K8O A;  1U4L A;  4FXD A;  1PFM A;  2PQE A;  4L63 B;  1D6E C;  2HT1 A;  2HQL A;  1YHQ A;  3JAM c;  1A3U A;  1WTP A;  2LXJ A;  4A3K G;  4LFB L;  4QY7 A;  1XNQ L;  4BS9 A;  3MAQ A;  4DR4 Q;  2UXC L;  3NK9 A;  5LMN Q;  3OTO L;  3CC4 A;  5D3D A;  5E7N A;  5IP9 H;  2K52 A;  4DV6 L;  3UE0 A;  4KD4 A;  1EY6 A;  1XTC D; 
#chains in the Genus database with same CATH homology
 1K83 B;  4B9W A;  3R2I A;  5A35 A;  4KHV A;  1G6Z A;  3PUW A;  1Q3L A;  1GJX A;  1U9R A;  5IT9 E;  5C4X B;  1TWC B;  1IL8 A;  3GQB A;  2QKI C;  1STG A;  3I3C A;  2Z8L A;  1GUG A;  3T4A C;  2K32 A;  3M85 A;  3D4R A;  5M3M B;  4K6L A;  3A8K E;  1PFB A;  1J8I A;  1EWC A;  1RTO A;  1SYG A;  3M3Y B;  3JAM E;  3LWE A;  3SEB A;  2BA1 A;  2IWH A;  2RDF A;  4CJ1 B;  2IW3 A;  2NWG A;  1Q1B A;  5K5P A;  4A3M B;  2ICI A;  1HQM C;  2VXW A;  1QOH A;  2WP8 J;  1EQV A;  5C5M A;  3H0G B;  5EPK A;  1PLF A;  2KEC A;  1HQR D;  3TP8 A;  1CA6 A;  3T53 B;  3K5L A;  1E2Z A;  1W6J A;  2E2J B;  3TDQ A;  2VUM B;  1TY0 A;  1FGB D;  1STB A;  3BDC A;  3SDZ A;  1KLG D;  1EYC A;  3DWQ A;  2G9H D;  1EY4 A;  2IJ0 A;  5C4H A;  1IKL A;  5E3F A;  1BCP D;  1HUM A;  3NUC A;  1TVX A;  3NXW A;  4R9W A;  4HN7 A;  1LV9 A;  1EY0 A;  3FKI B;  2NYZ D;  3VR2 A;  2DN8 A;  2NVQ B;  1WTR A;  1F2L A;  2JA8 B;  1AEX A;  4IUU A;  4A3D B;  5JVG 3;  3BYT B;  1FNU A;  4IQZ A;  2F0G A;  2B2Y A;  1X32 A;  5IIF A;  5IGB A;  2B8G A;  1BDO A;  3GTM B;  1D5Z C;  2WKC A;  2OF1 A;  2DY8 A;  5FOB B;  1JC7 A;  4Q0F A;  2A69 C;  2CQA A;  2KHS A;  1JOO A;  3DWA A;  3HGB A;  1H9M A;  3VA7 A;  2XWJ B;  1DOM A;  2Z4I A;  3GTG B;  1S5D D;  5G3L F;  1IYU A;  3HZX A;  4U67 3;  2NTS A;  4RA8 A;  2I46 A;  2F0H A;  1PRT B;  3QOJ A;  2R92 B;  3CRL C;  1MGS A;  5IOC A;  2CW0 C;  4EGV A;  2RVL A;  1X3Q A;  3DEO A;  1MD2 D;  2BCO A;  4CJ0 B;  1X3P A;  3W2D A;  1J9O A;  5KIX A;  1EFI D;  3RLF A;  5CV8 A;  2N55 A;  1Q12 A;  5LHY 1;  1EY7 A;  1KDC A;  5FO7 B;  3X3N A;  2DY7 A;  3ND9 A;  1HFG A;  2MJ8 A;  3AMU A;  3C46 A;  1MSH A;  3AB9 A;  3P20 A;  4JBW A;  4ODG A;  1CA5 A;  4ZLT F;  4HSP A;  4K2L A;  3U9O A;  2M00 A;  1HFN A;  1TWG B;  5EPJ A;  1OXX K;  3D6C A;  3OWF A;  4KN4 C;  4LK1 C;  3NTI A;  2HDM A;  4A3J B;  3FEW X;  4DNT B;  1STY A;  2WAQ B;  3MZ5 A;  1GXD C;  3HOV B;  1NSN S;  2F0L A;  1E0B A;  2A6E D;  1B3A A;  1EY5 A;  2F03 A;  5BN3 A;  3I91 A;  3J7Y W;  2F0D A;  4RGO S;  1SYD A;  5TSS A;  1G8Z D;  3PUV A;  1UAP A;  3BDL A;  3CQZ B;  5KND A;  4OL7 A;  4XT1 B;  4HSV A;  1FD7 D;  2JEA I;  4M8A A;  2PW5 A;  2A68 D;  1ESF A;  1ZYR D;  3A56 A;  5DNF A;  1YNN D;  3A7L A;  3QWN A;  1LTI D;  3L3O C;  2NN6 I;  4KD3 A;  1RJT A;  3MXN A;  3K59 A;  1CQV A;  1CTM A;  2OT2 A;  3I72 A;  2F0I A;  2EY2 A;  5COY A;  1DJR D;  3OSO A;  3FVQ A;  2MPM A;  2F0T A;  1JWM D;  1WTX A;  4FNF A;  1A6X A;  1II3 A;  1BXT A;  4J8Q A;  4CBV A;  1T5E A;  2SNM A;  4L6T B;  4OGQ C;  3M4O B;  2E2H B;  5I6Y A;  1PRT F;  3BVG A;  5LL6 S;  4LMQ D;  1G2S A;  3PV0 A;  5JEA H;  1RTN A;  5T1G A;  2F3V A;  1B1Z A;  1Y1W B;  1AN8 A;  3HOU B;  4PNY A;  1HA5 A;  3MEH A;  3NWT A;  3OOC A;  1TWA B;  3G6J B;  2BDN A;  1BBX C;  3U9S A;  2JA5 B;  3GV3 A;  4R8N A;  2EVB A;  2IT1 A;  1SYB A;  4O42 A;  1WD0 A;  5CC4 A;  3OMC A;  4KY5 A;  2M9V A;  2K01 A;  2JXM B;  4WJW A;  2KVM A;  3TP7 A;  5CBA E;  1EU3 A;  5IT9 L;  4C3I G;  4XDX A;  3S16 B;  1SE2 A;  1ILQ A;  3LNN A;  4Q5V A;  2F0J A;  4G7O C;  1Y8P B;  2IX3 A;  2SEB D;  1E2W A;  1S5C D;  3C1E A;  3E5S A;  4HMI A;  1PZI D;  5IGC A;  2AQ1 B;  4C3I B;  3WOE A;  2YU9 B;  3E0J A;  3NTH A;  4C3J B;  4DFA A;  2RDG A;  2NN6 G;  5KNC A;  3JAM L;  2SDF A;  1TS4 A;  1G91 A;  3V96 A;  2N88 A;  4OO1 H;  3VR4 A;  2K05 A;  1Q90 A;  3CU7 A;  1I4R A;  5HUR A;  2ZXO A;  5ELB A;  3R2T A;  3C2P A;  2SOB A;  1Y69 U;  5J39 A;  1B53 A;  1ZEQ X;  4KK7 A;  1HTP A;  3KLS A;  1O7L A;  1F9Q A;  5J1Z A;  3I4L A;  2HCI A;  1SYF A;  2Q8I B;  3L7Z C;  1BUV T;  5I9O A;  2BDO A;  1F2M A;  3D8G A;  1SNQ A;  3EVQ A;  3M4Y A;  2L0C A;  2MHV A;  2RKS A;  3K57 A;  1BQQ T;  2PW7 A;  5JPM C;  1WD1 A;  3DEP A;  2JYO A;  4OHJ A;  1Z47 A;  5E4X A;  3K0Y A;  1B50 A;  2F0U A;  3NSW A;  2EOT A;  4CGY B;  1M8A A;  2KA7 A;  2HDL A;  4V0B A;  4FXK C;  1PTO B;  3PIP 3;  3S2D B;  5KRU A;  3DMU A;  4FXG C;  3K6O A;  4K8J A;  1SJE D;  2EY5 A;  1D1I A;  1TWF B;  2WAC A;  2NVT B;  5C3X A;  2X6L A;  4HR7 B;  3HG9 A;  3OPO A;  2L4N A;  1DOL A;  1JE4 A;  3K5O A;  3J7A V;  3ZYY X;  3NBI A;  1H9R A;  2Q8R E;  1PFN A;  2QF7 A;  2AWN A;  2E2I B;  4DK1 A;  1H9S A;  1GOZ A;  2E75 C;  1BCP C;  3OW7 A;  5CGK A;  3K5M A;  1JR0 D;  4NKL A;  3PIO 3;  3Q24 A;  1U4P A;  1SBB B;  5FO9 B;  2QIL A;  1UNS A;  4X3S A;  2IX0 A;  3T51 B;  4IFD I;  2C5C A;  4KY6 A;  4CJ2 C;  2IL8 A;  4YIJ A;  3DUZ A;  4H13 C;  2XN9 C;  3OMG A;  4BA1 I;  4X3K A;  1SFO B;  3GTL B;  5K36 G;  5EKI A;  2EY1 A;  5FLX E;  2EY6 A;  5I9P A;  3K5N A;  4F8M A;  1JOR A;  1VF7 A;  3VA5 A;  4BWG B;  3BVZ A;  3NQI A;  5I2Y A;  3S1N B;  2J0T D;  2QCP X;  4OIJ A;  3ERQ A;  1F77 A;  3MXP A;  1OXT A;  2RA4 A;  3I4M B;  2LMC B;  5DEH A;  2XWB B;  4MN3 A;  4A3F B;  2Z1C A;  1B2T A;  1V8Q A;  1F9S A;  2A6H D;  4BY7 B;  1DXM A;  5DM6 3;  2A74 C;  2VB3 X;  1PTO D;  3HOX B;  2K03 A;  3NE5 B;  4UDU C;  1LT3 D;  3QG1 A;  2GA4 B;  4X3U A;  2XNA C;  3EQL C;  1STA A;  2EJM A;  1EYD A;  3M7G A;  1PTO F;  2ZXR A;  1ZKO A;  2B2W C;  3AU7 A;  3IFT A;  1ET6 A;  2F0Q A;  1D2B A;  4HCE A;  1V43 A;  1S5B D;  4RWS C;  2L12 A;  4FYD A;  2PCF B;  3ITP A;  4H0L C;  1ENF A;  1ONL A;  2F0K A;  4WRD A;  1QG7 A;  4FF3 A;  1KTK A;  1Y8O B;  1O78 A;  2B2W A;  3NWS A;  2B2Y C;  4BBR B;  3NQT A;  3GTK B;  1SNC A;  4E6I A;  3E6Z X;  2FMC A;  2BE5 D;  5C0X H;  5I2X A;  1EIG A;  5CV6 A;  1B9M A;  3J80 E;  3C3L A;  3W3A A;  4IUR A;  4XT3 B;  2ID0 A;  2A6E C;  1KDA A;  5I6W A;  3BZD B;  4C56 C;  3C1F A;  3FPU B;  2D2C C;  5ELE A;  4Y7N B;  1VCI A;  4KHZ A;  2DNE A;  4KY7 A;  5G3L D;  2F0E A;  1NR4 A;  5JPN C;  4XXE A;  2WKD A;  3MC0 B;  2A68 C;  3P1H A;  5M5W B;  1ZYR C;  2RSN A;  5DM7 3;  2X6G A;  4RCN A;  2EYP A;  1YNN C;  1Z7T A;  4QIW B;  1Z6H A;  3DHQ A;  5FKA C;  3FDT A;  1TU2 B;  2A73 B;  3OIQ A;  3S14 B;  1I3Q B;  3SK6 A;  4PMC A;  1HUN A;  4ABN A;  4CKB A;  4FO2 A;  3VR5 A;  4IAL A;  1CFM A;  1DZ1 A;  3VYS A;  1SNM A;  4OIK A;  5A2Q E;  5EKK A;  1AP0 A;  4IN3 A;  3A55 A;  5D3I B;  5KEE A;  4KJN A;  4I7Z C;  1QJO A;  3FPP A;  1O80 A;  3I8Z A;  1QIL A;  3RZD B;  5CYU A;  4F88 A;  2JSO A;  2PNR C;  1NAP A;  1GUS A;  4XTC S;  4RFB A;  2PZW A;  1JB3 A;  4C3H G;  2ZT9 C;  4ME5 A;  1CHQ D;  1CQF A;  3R8B A;  3GTP B;  2EYO A;  1EZ6 A;  4DAP A;  1C4Q A;  2B8F A;  4C3H B;  1CZG A;  1UEA B;  3GP7 A;  3PO2 B;  1BF4 A;  3I4N B;  3S2H B;  4KI0 A;  4HED A;  3HOZ B;  1RKN A;  3I73 A;  1SAP A;  2PZT A;  3MVV A;  4K14 A;  2EYL A;  2KUM A;  5D14 A;  4EQN A;  3SVM A;  4DK0 A;  3PO3 B;  5D65 A;  1PDQ A;  3BG3 A;  1DOK A;  5M3F B;  4ZKB B;  3MFY A;  3GD7 A;  3NBH A;  4DA2 A;  4HMJ A;  3KBG A;  1JIC A;  4C1N K;  1IHZ A;  1VF5 C;  3NP8 A;  1LT6 D;  3TSS A;  4N9T A;  1G2T A;  1PRT D;  2MGS A;  1T5X D;  4IUT A;  1JCK B;  3D31 A;  2VB2 X;  1YNJ D;  3Q23 A;  5IGF A;  1GUT A;  4QUC A;  4MIU A;  4DAV A;  1S5E D;  2IPK D;  2NBF A;  1AW7 A;  1S5F D;  4R8I A;  3EFX D;  3RZO B;  1TKW B;  4G7Z C;  3VYR A;  1MSG A;  3I70 A;  3SK5 A;  2XSC A;  5ELF A;  2OEO A;  2FHT A;  2EYF A;  4S3S A;  4IFD J;  1RCV D;  4CKC A;  1FNV A;  2EJF C;  1LTS D;  2AWO A;  1TR5 A;  3ONA B;  1OO9 B;  1EIH A;  5FLX L;  2L1B A;  4MHE A;  1PZK D;  5JVH 3;  1V1P B;  2AQ2 B;  1EEI D;  2RBM A;  2WV6 D;  1HTL D;  2E2D C;  4RKL A;  5ELC A;  1STH A;  3SHL A;  4C3J G;  3HOY B;  4QMG A;  1OXS C;  4XIG S;  1D1K A;  5EBC A;  4NMZ A;  5BN5 A;  1RD9 D;  2VNU D;  1LTA D;  1EOT A;  1I4H A;  5K36 H;  4ZKC B;  4ILW A;  1AFP A;  2KCN A;  3S1R B;  4HTH A;  2EYJ A;  3A54 A;  1LT4 D;  2Y0S B;  3TBI B;  2LFN A;  1LTB D;  2PZU A;  1D5M C;  2EZV A;  3G7L A;  4U68 A;  2EYH A;  3MHB A;  4BA2 I;  1LO5 D;  4F7X A;  4Z9C B;  1Y1V B;  1H9K A;  1SSO A;  3IL8 A;  2O2L D;  1S4Z A;  1W6K A;  3A7A B;  1U4M A;  4RGN A;  4N9P A;  2JA6 B;  4CHT B;  2SNS A;  1BR9 A;  2JE6 I;  3FMC A;  1IKM A;  1F2Z A;  4K6D A;  3GTO B;  1RF2 D;  2K04 A;  3OHX C;  1I50 B;  3SK4 A;  3VYU A;  4DU9 A;  2TMP A;  2Z4H A;  2CVR A;  1LAC A;  3J80 L;  3SK8 A;  2WII B;  2LY7 A;  3R93 A;  1WTO A;  1IYV A;  1KNE A;  2JP1 A;  4M1U B;  5JOB A;  2A6H C;  4IUN A;  1EU4 A;  1A2T A;  3HRZ C;  1B9N A;  4OO1 I;  1PTO C;  4IZ8 A;  2EYM A;  3IKJ A;  3NTK A;  1A3V A;  1D5X C;  2LKV A;  1F2Y A;  4DF7 A;  2PYK A;  1EY8 A;  1V1O A;  1IW7 D;  4RCO A;  2WIN B;  1I6H B;  1F9P A;  4KMU C;  4HAE A;  2F0N A;  2HCC A;  1CT1 D;  4A3E B;  4FF1 A;  1L0X B;  3H09 A;  4XQJ A;  1TT2 A;  5C4J B;  1HHV A;  4DN4 M;  3RUZ A;  1L0Y B;  2B2V A;  4GZY C;  2K28 A;  5KGU A;  3T16 A;  3PUZ A;  1R9T B;  1EYA A;  2BE5 C;  3KK7 A;  3H94 A;  2KCC A;  1NR2 A;  3V05 A;  4FF2 A;  3H6M A;  2ZXP A;  2B2U C;  4PV1 C;  1M4V A;  3QIA A;  2EDG A;  5C0X J;  2F0P A;  2M2L A;  1PXU A;  2F0M A;  3P7J A;  5A2Q L;  1SYE A;  3N6R A;  3I90 A;  3RD4 A;  5IGD A;  1O7Z A;  4ZYS A;  4K8I A;  3D3R A;  2O4X A;  2B2U A;  4TRD A;  5KYI A;  2RDH A;  1ENC A;  2L11 A;  3CKI B;  2PO4 A;  3VR3 A;  3S1Q B;  3SE0 A;  4RGT A;  2K7V A;  3WOF A;  4OO1 G;  1ILP A;  4H7B A;  2EXZ A;  5C5L A;  4RHR A;  1LAB A;  1HPC A;  1KDB A;  1CI3 M;  2NTT A;  5FK9 C;  3KF8 A;  5EBD A;  1ESR A;  5F2D A;  1WTV A;  1TS2 A;  2D62 A;  2BOS A;  5EJW A;  1KAB A;  4EVO A;  3QO2 A;  2C9O A;  1LTG D;  1A15 A;  3TP6 A;  4DNR B;  1VMP A;  4KKU A;  4B08 A;  3TP5 A;  4KKS A;  1GHK A;  4F87 A;  5HGT A;  4J6H A;  2JA7 B;  3MTS A;  2L55 A;  1CHP D;  5EPL A;  3MXU A;  3T56 B;  5NUC A;  1QNU A;  2J4X A;  1DCZ A;  1BO0 A;  2F0V A;  4IFD G;  5M5X B;  1XX8 A;  2R3Z A;  3PMF A;  4O1N A;  2NB0 A;  1I4P A;  2XVS A;  5C6A A;  1LTR D;  3BDO A;  2B39 A;  1SMY D;  2EPB A;  2E76 C;  4A3I B;  3NPP A;  3QOL A;  1I4X A;  1RDP D;  4IUQ A;  1QB5 D;  5C3W A;  2ENB A;  4XYQ A;  2RSO A;  3WDN A;  3BYY B;  2O5J C;  4B9X A;  1JOQ A;  3J81 E;  4KJO A;  1HXY D;  1SND A;  1CK1 A;  5AFW A;  1DM0 B;  1BCP F;  4QCL A;  4XQQ A;  3CRK C;  2YYZ A;  2PPB C;  1SJH D;  1ML0 D;  4FVM A;  3QB3 A;  2KEE A;  3BS1 A;  2HQE A;  4I65 A;  4PMB A;  1STE A;  5ELD A;  3HP3 A;  4RHS A;  4BY1 B;  1DD2 A;  5E1F A;  2H1E A;  2JEB I;  1XYI A;  5COR A;  1Y8N B;  5EKL A;  4P2C B;  3EA6 A;  1SNP A;  2E74 C;  4DXG A;  4V19 0;  4RH6 A;  1LT5 D;  2F3W A;  1VDZ A;  2Q8T A;  3V2T A;  1HRJ A;  2R6G A;  3TN2 A;  5ISR A;  1SDF A;  1PRT C;  1AZQ A;  1SNO A;  4C2M B;  4HCS A;  1MI2 A;  1R4P B;  5C0X I;  2B2T C;  3BVM A;  1YNJ C;  4XQN A;  1ET9 A;  4XYO A;  1GUO A;  1KAA A;  1G29 1;  3MFG A;  4K5V A;  2B2T A;  2H4O A;  3URY A;  3KBX A;  3ERO A;  4CKE A;  2QDB A;  2FFK B;  5JEA J;  3H91 A;  2K1B A;  2KJX A;  2XRQ D;  2K5Q A;  1WTQ A;  3S17 B;  1PMR A;  4WOR A;  3GTJ B;  3ND8 A;  1MBY A;  1TS3 A;  5M9O A;  2F4I A;  1I6V C;  3N52 A;  2NUC A;  2NN6 H;  3EJI A;  3O13 A;  2MUY A;  4LAA A;  3NHH A;  3MA2 B;  4KV6 A;  1NUC A;  5DAU A;  1E2V A;  5M5Y B;  2F0O A;  5T1I A;  2FIN B;  4X3T A;  3HS0 C;  3KLS X;  1ENA A;  4KN7 C;  3MWY W;  5JAV A;  4G7H C;  3A8J E;  3F2U A;  5EGT A;  1I4Q A;  3S9W A;  4TSS A;  2EE1 A;  2K33 A;  4A93 B;  3OWE B;  4JK1 C;  2KQ3 A;  3RMH A;  3SR1 A;  2B63 B;  5KYL A;  2I07 B;  3HOW B;  4L8J A;  4G4K A;  1ROD A;  2F0S A;  5C0X G;  1GUW A;  2L5T A;  2A69 D;  3OIP A;  1B4O A;  4ZUJ A;  3VYT A;  1WTW A;  4QF4 A;  5I4D A;  1O7Y A;  1PTO H;  1DYQ A;  3T13 A;  1LTT D;  1OXV A;  3TZU A;  3SXH A;  2AQ3 B;  3DM1 A;  1EY9 A;  1TS5 A;  1TWH B;  3H3V C;  4UAI A;  1STN A;  4WFN 3;  3Q22 A;  4A3G B;  3Q0A A;  4TQU S;  3P75 A;  4RGM A;  1SEB D;  1HCZ A;  2LS0 1;  2CW0 D;  2V4D A;  2R7Z B;  3IAY A;  1GUN A;  4BBS B;  2QEJ C;  3KLR A;  4PMW A;  4DXF A;  4TKO B;  2O5I C;  4A3B B;  2X69 A;  1EEF D;  4FF4 A;  1BNZ A;  1DON A;  4DGZ A;  3IFD A;  5BN4 A;  2CHB D;  4K2K A;  1QCB D;  2K5D A;  1UUP A;  5CMD A;  4RKB A;  3A8I E;  1IW7 C;  4K5X A;  5CV5 A;  1R4Q B;  2F1M A;  3TME A;  3VR6 A;  2D5D A;  1TII D;  1JWS D;  1BOS A;  4QUF A;  4PQX A;  4ULL A;  2TSS A;  1TQO A;  5CR3 A;  2L9H A;  1JQY D;  1EQT A;  5E4W C;  2F0F A;  1EZ8 A;  4ZQ3 A;  4KKT A;  3LWU A;  1F9R A;  1XXG A;  2PMZ B;  5CBE E;  1SE3 A;  1A3T A;  1I4G A;  2WB1 B;  1V1P A;  2K5W A;  1PZJ D;  1WVL A;  2J7Z A;  2OXP A;  2AUJ D;  3DWP A;  4NDX A;  5EQ0 A;  1NCV A;  4EQP A;  2BA0 A;  1JWU D;  5IGE A;  3L9A X;  4AYB B;  1RHP A;  4DAY A;  3R3O A;  1C48 A;  1ZXT A;  5FO8 B;  1EL0 A;  1B44 D;  2IX1 A;  3GV6 A;  5JJZ A;  2MP1 A;  1AZP A;  4G57 A;  1SE4 A;  1U4R A;  2HUG A;  4FP5 D;  3CHB D;  1WCM B;  4ZRZ A;  4ZAI A;  1LLR D;  2FJ2 A;  3TZD A;  5C4Z A;  1QE6 A;  4EQO A;  1QNK A;  2XIW A;  4ZUI A;  4IUP A;  1XWE A;  3D6W A;  3PUY A;  4NW2 A;  3J81 L;  1KLU D;  3QJY A;  3UI2 A;  1VMC A;  3X3M A;  5CV7 A;  4RAU C;  5LL6 X;  5IGG A;  1C8C A;  4IFD H;  2DNC A;  4LJZ C;  3D4D A;  4ZK9 B;  2D9U A;  2NVY B;  1OXU A;  3M7N A;  2NZ1 D;  2KED A;  5IOD A;  1GHJ A;  5CV4 A;  1FYC A;  4H44 C;  1H9S B;  2B2V C;  2ICE C;  2RQX A;  3DXJ C;  1CZW A;  3HKZ B;  1A2U A;  4IUV A;  4K5W A;  3LX0 A;  2AUK A;  4C1N I;  3HEJ A;  3J7A F;  5JEA G;  3GTQ B;  2NVX B;  1SXT A;  5CV9 A;  3GO5 A;  3PUX A;  2KOL A;  3Q6S A;  1QWY A;  1SYC A;  5KNB A;  3K58 A;  1H9J A;  1Q1E A;  1SMY C;  2FMM A;  4J1M A;  3D4W A;  1K8M A;  1HA6 A;  1KNA A;  1BCP B;  2XRS D;  2K6A A;  1FR3 A;  1TY2 A;  1EWH A;  3S15 B;  5J22 A;  5C3E B;  1CM9 A;  1Q8I A;  1FNW A;  2R93 B;  2F0W A;  1PYW D;  5C44 B;  4QB4 A;  4ID6 A;  3S1M B;  2A5H A;  3MXG A;  2G9D A;  3FRP B;  4KTA A;  2EJG C;  3KUP A;  1JOK A;  1ICW A;  4NP5 A;  3K7A B;  2R61 A;  1K8O A;  1U4L A;  4FXD A;  1PFM A;  2PQE A;  4L63 B;  1D6E C;  1A3U A;  1WTP A;  4BS9 A;  3MAQ A;  3NK9 A;  5D3D A;  4A3K B;  4KD4 A;  1EY6 A;  1XTC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...