5G3LD

Escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAAAVLSGMRVNMCASPASSPNVIWAIELEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN IIB, B CHAIN
publication title Biochemical and Structural Characterization of the Novel Sialic Acid-Binding Site of Escherichia Coli Heat-Labile Enterotoxin Lt-Iib.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 23
structure length 98
sequence length 99
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5g3lD00
4FNFA 4FO2A 5G3LF 5G3LD 4FP5D 1QCBD 1TIID 1QB5D
chains in the Genus database with same CATH superfamily
4TKOB 3HFZB 3S1RB 3D6WA 4RCOA 4OWTB 5C44B 1B44D 2B2TA 2X6GA 1A2UA 4FXKC 1DONA 5EPKA 4GLAC 1NMFA 1PXUA 5K5PA 1HXYD 1RD9D 2P5ZX 2Q2IA 1JOKA 5KYIA 2UUAQ 2EJGC 1VMCA 1G8ZD 4HIKA 1WI5A 4A3JB 1GUNA 1YVCA 1F2LA 5KNBA 4WFN3 5E1FA 3NBHB 5I6YA 1JC7A 1LM0A 1L2FA 2VZAA 4DNTB 1I4GA 1TS5A 5C3EG 1YIJA 2A6HC 1KHIA 3H6MA 2XN9C 4IPHA 4TRDA 3GTMB 4LUOA 2F0HA 1HNWQ 5JJZA 5FO7B 2BCOA 3CW2C 3QB3A 4O2DA 5HGQA 3U4ZA 3PUXA 3NTIA 2ZXOA 4XYQA 5C0XG 2A1AA 1QVGA 1GHKA 4DV1Q 3LX0A 4ALPA 4X66L 2K5DA 5FO8B 2H4OA 2F0IA 4PMCA 4JOIA 4LFBL 1S5DD 1SYFA 3A56A 2MNAA 4FDBA 4WJWA 3QOJA 3RLNA 1UWVA 2R93B 2GVBA 4P71A 3K59A 4QUCA 1IHZA 1B3QA 1MKHA 3EIVA 3GO5A 3UDGA 1PMRA 2CWAA 1WTXA 1HZAA 1XXGA 3MXNB 4RGNA 1TWFB 4IUQA 2QEXA 1TS3A 1GM5A 2D2CC 5IT9c 1TR5A 1K0RA 3BZDB 3OHXC 1A6XA 1XTDA 1IXRA 5M5WH 5FLMH 4IO9A 4B3MQ 1WCMB 4IJLA 1WTOA 1NBWA 5KEEA 4A93H 1CHPD 3R2TA 3CF5A 4PMBA 1SE2A 2F0MA 3PSIA 2WV6D 2I0QA 3NBIA 2EY6A 5IYBG 1I6VC 1JICA 3HOZH 2HDLA 1CSPA 1UE5A 1BCPB 4GLVB 2F4VL 4CKBA 2RDFA 1V9PA 1S3OA 3L0OA 3LNNA 5CYUA 2CQAA 3KLSA 3G48A 1C0AA 1BUVT 4C2MB 2NN6G 2K1BA 1LT6D 3NHHA 1BBXC 1RJTA 1TS4A 4B3SL 3H15A 4NDXA 2JYOA 3RZOB 1AH9A 1LTID 3MEFA 2R7ZG 3I4NB 4JI0L 1UE7A 1Q90A 1L0WA 4GZYC 2J4XA 4CKCA 1RF2D 3KFUA 3J81L 3S1MH 1STYA 2I5HA 4PZ8A 1UE1A 1B9MA 5CBAE 4A3FH 3IL8A 2Z6BA 3PO2G 1CKOA 1A63A 2BH2A 4A3MG 1Q1EA 1D2BA 4L63B 1RTOA 4C3JB 1XNRL 4LWCA 3M9BA 4CJ1B 4DR4L 1HZCA 1D5MC 2XRSD 3K6OA 4KKTA 3T51B 4OWWB 3NP8A 4HJ5A 3GTKB 1PRTB 4GS3A 3S1RH 1J6QA 3OYYA 1UUPA 4X66Q 3LWEA 1WTWA 3CC2A 4BY1G 4ME5A 2K28A 3A7LA 4LFBQ 3STBC 1DXMA 1RODA 1E1OA 1KDAA 3DWPA 3KF6B 1TWGB 4KJNA 1PH7A 2D0OA 5LMNW 4DR1L 1DJRD 3C1EA 4B9XA 2VY3A 2QA4A 1KTKA 3HKZE 4GN4B 1LV9A 4XDXA 4A3EG 2SOBA 5C4ZA 4A3LH 2N78A 2OTLA 5IP7H 4R8IA 2F0KA 3BU2A 1MJCA 3T53B 4GN3B 2JA8H 1LO5D 2KENA 3K58A 2XTIA 3HOVB 3AYHB 2O5IC 3GTMH 2K32A 1LTTD 5M3MB 2QDBA 2L11A 5D3IB 1VQ4A 4DK6C 1PH3A 3MZ5A 3MFYA 4ME3A 1SYEA 2FMCA 2NVYB 5CV9A 5I9PA 1ICWA 3UDFA 3JC66 1PTOC 3HOXG 1LLRD 3P1HA 4KHVA 4IUVA 2F4VQ 3S9WA 3M4QA 2C35B 3MXPA 4MIUA 2K5HA 2XWBB 3CMEA 4NP5A 1A15A 1M4VA 2JJQA 1D1IA 4QUFA 1UEAB 1FNUA 2F0WA 5I9OA 2EXZA 4C3HB 4B3SQ 4HJ7A 3GTPB 2B8FA 2EYOA 2PQAA 5ELCA 3T56B 4KN7C 3VR5A 4JI0Q 1TWFH 2F52A 4LF5L 3BJUA 3FKIG 4TSSA 4TQUS 4BXXH 1D1KA 1EU4A 2GN5A 3K0YA 1Y14B 4JPBW 2Z4IA 3I72A 4NXNL 5CR3A 1DZ1A 1H9SA 1WCMH 2N88A 4DK1A 1XNRQ 3J81i 1PTOF 3N52A 4DPGA 5JJIA 1M90C 2HCIA 3J81c 4DR4Q 1D7QA 3G7LA 5C4XG 4A75A 1XPRA 1TXYA 3NWTA 2AUKA 5M9OA 5FO9B 1JORA 4UP9A 2FXQA 3R2IA 1I6HB 4DN4M 2K14A 3I70A 1ENFA 2AMCB 1PZID 5M3FB 1G2TA 3AEVA 1D8LA 2ENBA 3SDZA 4K8JA 1KAWA 1KL9A 1WTRA 1G291 5DM63 2PNRC 1EY9A 5BN3A 4CHTB 4XXEA 3RZOH 1QZHA 2G9DA 4POGA 2X6LA 2RQXA 1HR0L 1Y1VB 3FP9A 3NWSA 1V1OA 2E2HB 4IUTA 3I2ZA 1Y8PB 1E7ZA 1Y8OB 4H0LC 3HZXA 3D31A 1BCPC 2NZ1D 3X3MA 3CXCA 1SE3A 1N36L 1TWCB 1N33L 2CHBD 4IUUA 2BDNA 1GUWA 4XQJA 3CCMA 1F9SA 4F7XA 1H9MA 3U9OA 3I4OA 5J3BA 1G6PA 4A3GG 1QCBD 1B2TA 4LF8L 4A3IG 4CGYB 1EOVA 3I4MG 2JXMB 4DAYA 4F87A 5FJ8G 5IYCG 4X3SA 4KY6A 4EX5A 4QGUA 5T1IA 1EU3A 1WOCA 3ERSX 4HN7A 4TVAB 3V96A 5IP9H 2MO0A 1YNND 1D5ZC 1T9HA 1YEZA 2PI2A 1VQ6A 5EKKA 3C3LA 1EY7A 4IALA 4L5QA 4JV5L 3W1BA 2NVTB 3Q0AA 1AEXA 1TY0A 1VQIA 3OPOA 4RKBA 4X3TA 2WACA 3OMCA 2ICIA 1EWCA 1AZQA 1Q12A 5JOBA 4LF5Q 1TVXA 1Y1WH 1EYGA 1CKNA 2JQOA 1Q46A 1BCPF 1E24A 1QG7A 1Z6HA 1SNDA 2H1EA 1OXTA 4G7ZC 3H09A 2TSSA 1PRTC 3HOVH 2B2TC 3CCVA 5IE8A 3DEPA 3DHQA 5M3MH 1FNWA 5ELEA 5EAYA 3AQQA 3GTGH 1K0SA 1I3QB 1SYCA 1U9RA 1B50A 3S15B 2NVYH 2PMZE 1F9QA 4KKUA 4BBRH 2DY7A 1STBA 1IL2A 4C3IB 2E74C 2VS1A 2VQEL 4LMQD 1LTGD 2PW7A 2DJGC 5ISRA 1YJWA 5JEAG 1STEA 4AYBB 4R1JA 1KXLA 1Q7YC 4JI1Q 4HTHA 3BDCA 1K83H 1VMPA 2DNCA 3S2DH 1MJEA 1EFID 3GD7A 1CFMA 5IGGA 2YTXA 2NUCA 2PQAB 3TSSA 1SN8A 4IFDJ 3GTPH 3I91A 4FP5D 3GP7A 1ESRA 1XNQL 4BY7G 1S72A 1CA6A 4DF7A 1HR0Q 5GADC 3HOYG 2B2WA 1VQDA 4WORA 1PRTF 4RGTA 4L6TB 5HURA 2K50A 4Y7NB 2F0OA 3HEJA 5T1GA 1MBYA 4F88A 3CQZB 5EBCA 3HRZC 4JBWA 4JOIC 3QIAA 5EPJA 5GAHC 1N33Q 2KJXA 1E2VA 1PYWD 5K36H 1NTGA 3J80L 3L2PA 5C5MA 3FPPA 2K5VA 3FDTA 3OMGA 1PV4A 3OIQA 2A68C 1E22A 1HFNA 4O1NA 2IHFA 3HG9A 5E4WC 4DUYQ 3I4LA 1STHA 1LTLA 2E76C 2JA5G 2QEJC 3CU7A 4LF8Q 2KCTA 3J7A5 1EYAA 3ZJYC 2Y0SB 1I6HH 1STNA 2HDMA 1EIYB 2IX1A 2UXCL 3VYUA 1EQVA 5M3FH 1A2TA 4FF4A 2ASBA 1JWSD 4HJ8A 2OXPA 5ELDA 4JV5Q 1IL8A 2I5MX 1Q3LA 1VQEA 1H9RA 2BA0A 3HKZG 4B08A 1T5XD 1MSHA 1Y1VH 1MIUA 1CZWA 1IYUA 1SDFA 4KY5A 4EQPA 2CH4A 1MGSA 3AB9A 4DR3Q 1HTPA 2E2HH 2VUMH 2MGSA 1VQMA 2A8VA 1RIPA 4DV6L 3DWQA 4JI4L 5M5XB 2SNMA 1HTLD 4HR7B 5IY0A 3IKJA 1HUNA 4MZ9A 3OWEB 2V4DA 2Q8IB 1TT2A 3A7AB 4J1MA 2WFWA 3S17H 2HT1A 1X9NA 1II3A 1S5CD 4P74A 4GKJL 3URYA 5FK9C 4DAYB 1A3TA 1IYJB 4MN3A 3J7AV 2MFIA 3L7ZC 3MXGA 3H3VH 5KNCA 1DGSA 3VYSA 1XJVA 4ID6A 4YHHL 2B39A 5I4DA 4IJHA 5ELOA 3CRKC 1VQGA 1SFOB 2Q8TA 3HOZB 3TP7A 3ND9A 3KJOA 2BA1A 2WKCA 1IKLA 2VNUD 3S16B 1JR0D 4JYAL 2EY5A 1XNQQ 2AWNA 5C3EB 2QW7A 3IAYA 1WYDA 2MPMA 3GTLH 2CW0C 1KLGD 5G3LF 4M8AA 1KRTA 2SNSA 2KA7A 3A8JE 4OHJA 2WAQE 4EGVA 1VQJA 1SMYD 1DOLA 4DK0A 4OO1I 2DY8A 2F0LA 4KLKA 1PH2A 3TP8A 4C3IH 2F0JA 3BG3A 4PZ6A 5LMUL 3EBEA 5D65A 5A2QE 2Z8LA 3J80i 4G7OC 3C1FA 1ZKOA 1EEFD 1Q86C 2DUDA 3E9IA 4RFBA 5HGTA 2YV5A 1LYLA 4JI3L 2UXCQ 4RHRA 2E8GA 3MEHA 4K8IA 3OSOA 4FXDA 1EEID 2B63B 1GJXA 3TBIB 4XT3B 3D4RA 3LWUA 3C46A 1BBUA 3MHBA 2SDFA 4DFAA 1IKMA 4A3DB 3SK6A 5JJLA 3BDLA 4Y7NH 3CQZH 2WIIB 4DR5L 3KF6A 4DV6Q 4DNIA 2K03A 3R3OA 4YWLA 4XQNA 1J5EL 4A76A 4KI0A 4CDCC 2LFNA 2Q2UA 3SR1A 1U5KA 3L9AX 2F1MA 4LUVA 2JN4A 2R92H 1MHWC 2QF7A 4WJ4A 1F9PA 3PIO3 5KGUA 3J7AF 4GKJQ 5HY6A 2JA8B 2RSNA 1M8AA 2QDLA 1DOMA 3EN2A 4RH6A 5IOCA 4LNQA 1CQVA 4A93G 4RGMA 4UP7A 4RHSA 3K5OA 3T1HL 4YHHQ 2RHQB 2EDGA 4K5XA 1ENCA 3FEWX 3HOWG 4FO2A 1AFPA 1YJNA 2R7ZB 3OTOL 3CCUA 3NQIA 1K8GA 1SNOA 1K8OA 2A6HD 2JEAI 1CI3M 1JWMD 2ZTDA 3DM1A 3NXWA 4CDEC 4JYAQ 1LT4D 1SEBD 2MQHA 3TRZA 1EQRA 1XPUA 2JP1A 1N9WA 3HOUG 3FHWA 4JC0A 1GUOA 2LSSA 1SR3A 4IFDI 2HIVA 5M5XH 4EQ5A 1QZGA 4DAPA 2ATWA 1HA6A 3ULLA 1RTNA 2F3IA 3K81C 5C6AA 3S1QB 1VCIA 1TWAB 4R8NA 1ZYRC 3A0JA 3BZCA 3PV0A 2CH4W 1S5FD 1KAAA 2AKWB 2L55A 2R7FA 2WB1B 4X62Q 3F1ZA 5LMUQ 1PH1A 4WRDA 3E0JA 4FF3A 1JJGA 5DEHA 2EY2A 4JI3Q 1PYBA 2IHEA 1NJIC 4R4CA 4LAAA 1SFOH 2G5DA 2RDGA 2ZJPA 4A3EB 1UEBA 1CT1D 2KHSA 5C44G 1G51A 5JVG3 1XWEA 3S16H 5KIXA 2R61A 1N8RC 3W1GA 4GLXA 3N6RA 4P72A 5C3EH 1TWHB 2GA4B 1ILQA 2K5NA 4DAVA 1NY4A 2JA7B 2F0EA 1F77A 1ENAA 5C3WA 1SBBB 1PZJD 4P75A 1SRUA 2QILA 4A3JG 1CSQA 3AU7A 4QF4A 3UDXA 4AIMA 4BA1I 4A3CG 4ZKCB 4HSPA 4A3LG 5C0XH 3HOXB 1BOSA 1IW7C 3U58A 5EGTA 1I94L 2F0NA 1EQTA 1EY5A 2Z9HA 1Q82C 2OTJA 1X65A 3VR2A 1HZBA 3ULPA 4JBMA 4HAEA 3PIOA 4N8FA 5KRUA 2NB0A 1HRJA 3K5MA 2Q2HA 3T1HQ 2CCZA 4L5TA 4V0BA 1HHVA 3BS1A 3OTOQ 1HFGA 2M9VA 1V1QA 3PUWA 4HMJA 4IN3A 2B63H 2EOTA 4L8JA 3FKIB 1MD2D 5BN4A 1QNUA 3K7UC 1OXUA 3RLOA 3U4VA 1ONLA 1WD0A 1K73C 2R93G 5EKIA 4A3DH 4LF7L 4DR2L 3QR8A 2EPBA 3WOEA 1WTQA 2EIFA 1VQCA 4XTCS 5DNFA 1LTSD 4O42A 5A35A 3P7JA 3J80E 5C0XJ 3MAQA 1LT5D 1C8CA 2ZT9C 4NKLA 4OO1G 1GXDC 5JVH3 4L5RC 4HMIA 1Y1WB 5C4HA 3ICEA 4RG1A 1KIXA 1ASYA 1MI2A 4JI6L 1N32L 2HIXA 1E2ZA 4GOPA 2K7VA 1ET6A 3E3XA 1IBKL 2F0GA 4OL7A 2B2WC 1PH6A 3GTGB 1SNQA 2LS01 3TN2A 1VQ9A 2B2UC 4RGOS 2R7ZH 3NUCA 4BBRB 3SGIA 5IYDG 2LMCB 1Q1BA 5EKLA 4QJFA 5KNDA 2R7DA 3ND8A 4QMGA 4HSVA 1PVOA 4AYBE 5A2QL 1CHQD 1L1OB 3U9SA 3W5OA 5LMNL 2UUBL 2LKVA 1K83B 2RSOA 3S2DB 3I7FA 1EZ8A 3DEOA 2WAQG 3I4NG 2C5CA 3RUZA 1PTOD 3KF8A 3PF4A 3G71A 2M2LA 4LUZA 5ELNA 1V8QA 1EOTA 1Y8NB 1I94Q 1I50B 3S1QH 1VQ8A 2L15A 1TWAH 4A3IB 2F0TA 3HGBA 2ZXPA 3DMUA 4C3JG 1GVPA 1C9OA 4KV6A 5LHY1 2DN8A 5E3FA 1KABA 2XRQD 5GAEC 3FPUB 3U50C 1U4PA 1XTCD 1V1PB 3OWFA 4A3EH 2K5QA 4R9WA 4M1UB 4EVOA 3TQYA 2EYPA 1EUJA 2HCCA 3VYTA 1TWHH 3C2PA 2PO4A 4DR2Q 1YBYA 1I4RA 3BVGA 2JA7H 1E2WA 1Y69U 1WJJA 1HA5A 4X6AH 3VR4A 5IWAL 1VS0A 3T13A 2VB3X 4DR1Q 4IFDG 1EFWA 3M85A 1KDCA 4LK1C 3M3YH 1EY8A 3RN5A 1GUSA 3HOXH 4FF2A 1HPCA 2UU9L 2ZTCA 4NW2A 1VDZA 1BKBA 1X6OA 5IGEA 2VUMB 3HOVG 2KVMA 2HQLA 4YIJA 4JI6Q 4YCUA 1RCVD 1N32Q 2RBMA 3W2DA 1OXSC 3TZUA 2ZM6L 1YNJD 4OWXB 4HJAA 3RR5A 1UNSA 3M4PA 1HJPA 4S3SA 4DV3L 2AQ1B 4G7HC 3TP6A 2L0CA 1QILA 2EYLA 3CKIB 4A3BB 3S17B 4DV2L 3A54A 3S14B 1PFNA 2AQ3B 4DR6L 2M00A 3FKIH 2B8GA 2KHJA 3D0FA 3HOYB 2LXJA 3HS0C 1LACA 2IX3A 5C5LA 4X65L 4J15A 2PI2E 1I5FA 1H9KA 3DLLA 5LMNQ 1QOHA 3D4DA 5I2XA 2UUBQ 1T5EA 4C3HG 4QCLA 5CGKA 1YNNC 1FL0A 1L0XB 3K7AH 5CC4A 2JA6G 4QY7A 1NCVA 2OCEA 2E2JB 1NNXA 5FLXE 2E2IB 1AW7A 1GUGA 1KNAA 2RCFA 1WTVA 2R3ZA 1F2ZA 3MWYW 2XNAC 5D3DA 3GTLB 2HHHL 3I73A 4DA2A 4YY3L 4BWGB 4X64L 2GVAA 2A69C 1VQLA 4OX9L 3DM3A 1CKMA 4U673 4GNXB 4GOPB 1SAPA 4NXNQ 5LL6S 1VQOA 5COYA 4P2CB 3VYRA 1VQ7A 2N49A 1STGA 1TIID 3H0GB 1QUQB 4FF1A 2MJ8A 1Q8IA 1LT3D 3J7YW 4DU9A 4JI2L 2VQFL 3SVMA 3NTKA 5J1ZA 5I6WA 1IYVA 1JB3A 4K6DA 4DV5L 3LGJA 3E0EA 2KEDA 4A3KG 3CAMA 3EROA 1RL2A 4BBSG 1SE8A 5IWAQ 2XVSA 1SYGA 3KF8B 1O7IA 1EL0A 1XMOL 2XGTA 2XWJB 2IT1A 1X3PA 1BNZA 3V05A 5EJWA 3CCLA 3PO3G 2UXDL 1SMXA 3UI2A 3GV6A 3PGZA 2UU9Q 1I50H 5CV4A 4AH6A 4A3IH 3S1NB 2N55A 4HEDA 3I4MH 1QB5D 5IYCH 5DAUA 1Z47A 4DKAC 2B2UA 1EYCA 2ZM6Q 1N36Q 5C0XI 4DV3Q 1FVIA 3D6CA 2KHIA 1JJCB 2R92B 5FOBB 2MO1A 3NSWA 2HQEA 4DV2Q 1BVSA 2IPKD 2PCFB 1O78A 2K75A 4PV1C 1VQPA 4UP8A 3SE0A 1Q81C 4X65Q 1ET9A 1XPOA 3T16A 4PNYA 4A4IA 4IOAA 4ULLA 2PZUA 4GN5A 2ZXRA 2JK8A 3ZYYX 1VF5C 1I4QA 2BE5C 2A68D 4C56C 1B8AA 2XIWA 3A74A 1F2YA 2QKIC 3RD4A 4XQQA 4AQYL 3CRLC 4YY3Q 4DAMA 3CCRA 5NUCA 4X64Q 2E5LL 1ML0D 1EIHA 4OX9Q 4F8MA 3VA5A 5LL6X 3CCSA 1GUTA 1FGBD 4JVZA 4JK1C 1JMCA 1X32A 1M1KC 3DXJC 4IURA 5JPMC 4KKSA 4A3BH 4DV4L 2PQEA 5JPNC 1DYQA 1F2MA 1TS2A 2L9HA 3S14H 4YWKA 2VQFQ 2VXWA 2NYZD 2EZVA 3HOYH 3S2HB 4CJ2C 3J81j 1SSOA 2VQEQ 4DV5Q 1W6JA 1X3FA 4AYBG 1PH9A 3K0XA 2EYHA 3I90A 2F03A 4I65A 3KLSX 4KD3A 1F9RA 5ELBA 3G4SA 1IBLL 1KRSA 4ZAIA 1R4QB 3FVQA 1PHJA 2F0SA 2A73B 2F0VA 2E2JH 2L5TA 3D3RA 1XMOQ 2VL6A 2E2IH 1YZ6A 2KUMA 3TMEA 3RZDB 1HNXL 4LF4L 4EQOA 1EYDA 3NTHA 3A5UA 2IJ0A 1R4PB 2BDOA 4ZKBB 2JA5H 1PFSA 2A6ED 1B7YB 1K8AC 4OIKA 1RKNA 5AJ3L 2UXBL 2PPBC 3HOWB 1PDQA 2MP1A 3H3VC 1WD1A 1VF7A 1SMYC 1AZPA 4LFCL 2IWHA 4KJOA 1NUCA 1X56A 3H0GH 1U0LA 2WP8J 3PCOB 5EQ0A 3WWVA 1EY6A 2KBNA 4CBVA 2EE1A 1VQHA 5IT9L 3EVQA 4JG2A 3ONAB 3H94A 4PZ7A 3J80c 1GHJA 2I07B 3CPWA 4CDFC 2JE6I 3KYHC 2RF4A 1DM0B 1K9MC 3JAMi 2KEEA 1E3PA 3T1YL 4MTKA 4GOPC 3NEMA 3M4OB 4KHZA 2B2VA 4KY7A 5M5YH 2PMZB 2EQSA 3CPFA 3M7GA 2D0PA 4IZ8A 4K0KL 1VQKA 1EWIA 4BA2I 4AQYQ 2FJ2A 2I46A 3S1NH 1MSGA 4RKLA 2E5LQ 4G4KA 1KD1C 2B2YA 5BN5A 4JI4Q 3GTQH 3WOFA 4K5VA 3K5LA 5E4XA 3A8KE 3PF5A 1W3SA 5FLXL 4UY8C 5C3XA 4DV4Q 2OF1A 4Q0FA 3F2DA 3ERQA 2AQ2B 2F3VA 1K3BC 3BVMA 4ZCKA 1VQ5A 2IX0A 3VA7A 1U4MA 2F0UA 3FRPB 5FLMG 4NXML 1LUZA 1SNPA 1J8IA 5BR8L 5GROA 1PTOB 2NWGA 1S40A 2F0FA 1QVFA 4QIWB 1CQFA 4PG3A 3KLRA 2V1CC 3SK4A 3HOZG 4MHEA 1IBLQ 1PYSB 3CCQA 4V190 1KQSA 4MNOA 4KK7A 3CD6A 3TS0A 1JCKB 1NMGA 3A8IE 1JOQA 1NE3A 4Q5VA 1HNXQ 4LF4Q 4B3RL 1FGUA 5CORA 1L1OA 1D6EC 2NVXH 1UAPA 3PO2B 2A19A 4OONA 1FD7D 1BBWA 4KMUC 4A3MB 1X54A 4B3TL 4XT1B 3OW7A 5AJ3Q 2UXBQ 1X55A 2E2DC 1PH4A 1STAA 1AE2A 3ULJA 2OT2A 3SEBA 2PW5A 1AN8A 2JA9A 1C4QA 2J7ZA 3PUYA 4LFCQ 1R9TH 2L4NA 1WVLA 3PIPA 5C4JB 4BY1B 4R4OA 4R4TA 4A3FG 3S2HH 1JOOA 3IFDA 4Y52H 5IGBA 4YCWA 3SK8A 1U4RA 2B3GA 1SLJA 3HP3A 5DLQE 2B63G 3TDQA 3A55A 2A74C 4HIOA 3T1YQ 1ZYRD 3GTOB 2NTTA 2Z6KA 1V1PA 3RZDH 4XIGS 3CC7A 2OWOA 4R4IA 4A3DG 1C7YA 4K0KQ 1CZGA 3ER0A 3IRBA 4IUPA 1TQOA 4FYDA 3QWNA 1PH5A 2K05A 3Q8DA 4I7ZC 2BH8A 4FXGC 2KQ3A 2N3SA 2WKDA 2WINB 4ILWA 4GKKL 4DR5Q 4IUNA 1SXTA 1QNKA 4K2LA 1B53A 3KBGA 1J5EQ 3BVZA 3HOWH 3M3YB 3QG1A 1W2BA 4CDDC 5IP7G 2F0PA 2A5HA 4K5WA 5J39A 1VQBA 2JA8G 2LXKA 3FMCA 1D5XC 1UE6A 1CA5A 3NENA 3KDFA 1RDPD 3P20A 4HIMA 4NXMQ 4P73A 3HOUH 5BR8Q 4NB3A 5FLXc 3GQBA 1G91A 3TREA 2EJFC 1O80A 1VQFA 2WAQB 1G2SA 2K04A 2KOLA 1IW7D 4RA8A 1QWYA 4KHPL 5IGCA 4NPSA 3M4OH 5EPLA 3CMAA 4J6HA 3R93A 4C1NI 3I55A 3KJPA 2ALYB 2NVQH 4B3RQ 3G6JB 1O7LA 4DV0L 3W3AA 2KCMA 3OOCA 2EY1A 1W6KA 1LTBD 1S5ED 2EYFA 2O4XA 2YTYA 1E0BA 4RAUC 3Q6SA 4B3TQ 3K7AB 1X3GA 2YTVA 3Q22A 5IODA 1GO3E 4ODGA 3CC4A 1CUKA 5IYBH 4BXXG 5C4XB 4JBJA 5C44H 1TU2B 2DNEA 3JAME 2WB1G 4LJZC 5IGDA 3UE0A 1NSNS 1V43A 1LTRD 1A3UA 4YCVA 3STBD 2X69A 3MTSA 1WCMG 4GNXA 2FMMA 2NN6H 3E5SA 1PTOH 3QJYA 1LTAD 2Z1CA 3I3CA 4A3JH 4A3CH 4IPGA 1YHQA 1I4XA 2K33A 2F0QA 1QUQA 1YHAA 1B4OA 4PMWA 2L12A 4IPCA 4H44C 2KCNA 4RCNA 3H3VI 1B3AA 4ZUIA 4HJ9A 5CV7A 2OQ0A 2JA7G 4R4QA 5FKAC 1C48A 3BYTB 2QGQA 4X3KA 1EY4A 3V2TA 1JQYD 1WTPA 1EQQA 3PO2H 2RHSB 5TSSA 1Q8KA 1HNZL 3OW2A 3S24A 4JI7L 4GKKQ 4A3MH 2D62A 1A0IA 1AP0A 3KBXA 1XX8A 2D9UA 4N9PA 3GTJB 5CMDA 2FHTA 1Z7TA 3SK5A 2Z0SA 4LF6L 4A3GB 3T4AC 2NBFA 4IQZA 1SROA 2SEBD 1DD2A 2IL8A 3I4MB 5C4JH 4OELB 4BY1H 3RMHA 2R93H 1YHBA 2PZWA 3K5NA 2UUCL 1SE4A 3MA2B 1YJ9A 2NZHA 4E6IA 1BF4A 1OXVA 3MVVA 3K80C 1JE5A 1Z9FA 4RWSC 3F8TA 2JA6B 2G9HD 4HCEA 3ITPA 3D8GA 5CBEE 4DXFA 4C1NK 4H02A 4KHPQ 1SNCA 1B70B 4KTAA 3MXUA 4ZQ3A 4OO1H 4LW1A 3GTOH 2Q2TA 5ELFA 1HR0W 3NE5B 2Y0SE 1CK1A 1B9NA 4DV0Q 1PH8A 5IP9G 1JE4A 1JT8A 4LF7Q 1P8LA 3K8AA 4ZRZA 2K01A 4DNRB 4JI8L 5J22A 1ILPA 1OTCA 1LABA 1P16A 3E6ZX 3RLFA 4K6LA 1DOKA 3AFPA 3VDYA 1Y1WG 5IYDH 1PFMA 1AE3A 1SYBA 4DR7L 4FNFA 5L37A 5IT9E 1KNEA 3Q24A 4A3KB 3KDFB 4JI1L 4C2MH 1I4HA 3G6EA 5M3MG 3UE1A 4BS9A 2PZTA 1ASZA 4BBSB 5EBDA 1YNJC 1IBKQ 3PUZA 1XMQL 1O7YA 2QCPX 4JBKA 3IFTA 4RMFA 4POFA 4DV7L 2YU9B 3HKSA 2ID0A 2MUYA 2CWPA 1VQAA 3I4NH 3CCJA 4BBRG 1NR4A 4LF9L 3Q23A 3PO3B 3KLWA 2DJFC 1BR9A 4BY7B 2CKZB 2RVLA 1K28A 3NQTA 1BCPD 4N9TA 4JI5L 3D4WA 3RNUA 1JB7A 3E9HA 4G57A 2AHOB 2RDHA 4X3UA 3KOJA 4C3JH 1HNZQ 4JI7Q 3F2BA 4IPDA 4HIDA 4OGQC 1EY0A 2EJMA 3KUPA 4IOCA 2RA4A 4DUYL 2KCCA 2PYKA 1DCZA 3GTKH 5C4XH 2TMPA 1IBML 1NR2A 1E1TA 4LF6Q 2EVBA 1G6ZA 2JA5B 1CM9A 2BOSA 2O5JC 3R8BA 2DGYA 2K5WA 1PA6A 1N34L 3I8ZA 4APVA 3O13A 2B2VC 3K57A 2UUCQ 1H95A 1TWGH 1FR3A 1S5BD 1ZXTA 4DGZA 1PLFA 5K36G 2K52A 4IFDH 3DUZA 4OXPA 2B2YC 2C9OA 3CP0A 2AUJD 3HKZB 2XSCA 2K6AA 4I7AA 4UPAA 5AFWA 4DR3L 2A69D 2ZJQA 1EIFA 1VQNA 3SXHA 1QJOA 1PRTD 1K8MA 3TP5A 3TS2A 2EYMA 3WDNA 3BZKA 5H1SE 5M3FG 2Q8RE 3NPPA 2CFMA 4DUZL 1ICFB 1WFQA 1GKHA 3H91A 2ES2A 4JI8Q 1SJHD 3AFQA 3GTJH 5M5YB 3BDOA 1ESFA 1Y1VG 2E75C 2J0TD 4KD4A 1RHPA 1OO9B 3J7ZC 2HUGA 4J8QA 1FNVA 2F4IA 4A3GH 4DR7Q 1TKWB 2VUMG 2ZTEA 2NTSA 2AWOA 4N8X1 4L5SA 5FJ8H 5IIFA 4K14A 4UDUC 2JSOA 3GTQB 3OIPA 2RCNA 4C3HH 4A3BG 1XMQQ 3B6YA 1L1OC 4DV7Q 2JA6H 3I56A 3MFGA 2HD3A 4XYOA 1B1ZA 4LF9Q 1HQRD 3TZDA 3A5ZB 4UHVA 4DR6Q 1BXTA 1S4ZA 3JAML 4MTNA 3BYYB 4FVMA 3EQLC 2Z4HA 4ZK9B 5CV8A 2YYZA 4QIWE 4LFAL 2VW9A 3DWAA 2D5DA 1X3EA 2K4KA 4JI5Q 2H5XA 1FJGL 1H9SB 5KYLA 5CV6A 1IZ6A 4NMZA 1KC8C 3NBHA 2IY5B 1EIGA 4OIJA 3VR3A 4O0AA 3QO2A 2O2LD 1IBMQ 1GOZA 4ZUJA 2HHHQ 2RKSA 3X3NA 3PUVA 2NVXB 1U4LA 4B9WA 2Z6KC 1O7ZA 3CHBD 4A3KH 1N34Q 1X3QA 4JW0A 1PFBA 5JEAH 4BBSH 2VB2X 2BE5D 2CQOA 4QL5A 3GDEA 3NK9A 5CV5A 3H0GG 2YU9H 1KLUD 2OEOA 1A3VA 2KECA 1R9TB 5E7NA 2CVRA 3UDIA 3AMUA 2L1BA 3PO3H 2WB1E 1SJED 2IW3A 4CKEA 4C3IG 4BY7H 3J81E 4JI2Q 4H13C 4QQBX 1HUMA 2NN6I 4WJ3M 3P75A 3EJIA 3PMFA 5G3LD 2UUAL 1ZEQX 4K2KA 1J9OA 1NAPA 1TWCH 2OQKA 3QOLA 1FYCA 1QE6A 4DUZQ 4JCVE 4PQXA 1HCZA 3MXNA 5F2DA 5IGFA 4YWMA 1BO0A 4ZLTF 3M4YA 1I4PA 3EA6A 4EQNA 2UXDQ 2LY7A 1BDOA 5M5WB 1SNMA 1XYIA 1KDBA 1YITA 2ICEC 1HNWL 4DXGA 1YNXA 1BQQT 2A6EC 4A93B 5JEAJ 3RN2A 3KK7A 3VR6A 4H7BA 2N8NA 1TY2A 2NVTH 1HH2P 4ZYSA 5JAVA 2R92G 2I5LX 4DV1L 3TEHB 3PIP3 1WTHA 2PNHA 1JWUD 2EYJA 2MHVA 1QVCA 2CW0D 1CKNB 4DK3C 1HZ9A 1H9JA 1SYDA 2F3WA 3F2UA 5I2YA 1GD7A 4UAIA 3MC0B 2Y0SG 3HOUB 3GV3A 4LFAQ 1FJGQ 5D14A 4Z9CB 2NZOA 3SHLA 1A8VA 4OEMB 1EWHA 2R6GA 1CTMA 1I3QH 3JAMc 3S15H 2B29A 1L0YB 1EZ6A 4GNXC 3CCEA 2FFKB 2EXDA 2JEBI 5GQOA 3S1MB 3M7NA 4HCSA 4X62L 2NVQB 3L3OC 4ABNA 5DM73 1YI2A 4A3FB 1PZKD 2ZJRA 4B3ML 1HQMC 1OXXK 4U68A 1K3RA 1JJ2A 4QB4A 4KN4C 2FINB 3NELA 1A62A 5JJKA 3PQIA 4CJ0B 3F2CA 5GAGC 2F0DA 3EFXD
chains in the Genus database with same CATH topology
4TKOB 3S1RB 3D6WA 4RCOA 5C44B 1B44D 2B2TA 2X6GA 1A2UA 4FXKC 1DONA 5EPKA 1PXUA 5K5PA 1HXYD 1RD9D 1JOKA 5KYIA 2EJGC 1VMCA 1G8ZD 4A3JB 1GUNA 1F2LA 5KNBA 4WFN3 5E1FA 5I6YA 1JC7A 4DNTB 1I4GA 1TS5A 2A6HC 3H6MA 2XN9C 4TRDA 3GTMB 2F0HA 5JJZA 5FO7B 2BCOA 3QB3A 3PUXA 3NTIA 2ZXOA 4XYQA 5C0XG 1GHKA 3LX0A 2K5DA 5FO8B 2H4OA 2F0IA 4PMCA 1S5DD 1SYFA 3A56A 4WJWA 3QOJA 2R93B 3K59A 4QUCA 1IHZA 3GO5A 1PMRA 1WTXA 1XXGA 4RGNA 1TWFB 4IUQA 1TS3A 2D2CC 1TR5A 3BZDB 3OHXC 1A6XA 1WCMB 1WTOA 5KEEA 1CHPD 3R2TA 4PMBA 1SE2A 2F0MA 2WV6D 3NBIA 2EY6A 1I6VC 1JICA 2HDLA 1BCPB 4CKBA 2RDFA 3LNNA 5CYUA 2CQAA 3KLSA 1BUVT 4C2MB 2NN6G 2K1BA 1LT6D 3NHHA 1BBXC 1RJTA 1TS4A 4NDXA 2JYOA 3RZOB 1LTID 3I4NB 1Q90A 4GZYC 2J4XA 4CKCA 1RF2D 3J81L 1STYA 1B9MA 5CBAE 3IL8A 1Q1EA 1D2BA 4L63B 1RTOA 4C3JB 4CJ1B 1D5MC 2XRSD 3K6OA 4KKTA 3T51B 3NP8A 3GTKB 1PRTB 1UUPA 1WTWA 3LWEA 4ME5A 2K28A 3A7LA 1DXMA 1RODA 1KDAA 3DWPA 1TWGB 4KJNA 1DJRD 3C1EA 4B9XA 1KTKA 1LV9A 4XDXA 2SOBA 5C4ZA 4R8IA 2F0KA 3T53B 1LO5D 3K58A 3HOVB 2O5IC 2K32A 1LTTD 5M3MB 2QDBA 2L11A 5D3IB 3MZ5A 3MFYA 1SYEA 2FMCA 2NVYB 5CV9A 5I9PA 1ICWA 1PTOC 1LLRD 3P1HA 4KHVA 4IUVA 3S9WA 3MXPA 4MIUA 2XWBB 4NP5A 1A15A 1M4VA 1D1IA 4QUFA 1UEAB 1FNUA 2F0WA 5I9OA 2EXZA 4C3HB 3GTPB 2B8FA 2EYOA 5ELCA 3T56B 4KN7C 3VR5A 4TSSA 4TQUS 1D1KA 1EU4A 3K0YA 2Z4IA 3I72A 5CR3A 1DZ1A 1H9SA 2N88A 4DK1A 1PTOF 3N52A 2HCIA 3G7LA 3NWTA 2AUKA 5M9OA 5FO9B 1JORA 3R2IA 1I6HB 4DN4M 3I70A 1ENFA 5M3FB 1PZID 1G2TA 2ENBA 3SDZA 4K8JA 1WTRA 1G291 5DM63 2PNRC 1EY9A 5BN3A 4CHTB 4XXEA 2G9DA 2X6LA 2RQXA 1Y1VB 3NWSA 1V1OA 2E2HB 4IUTA 1Y8PB 1Y8OB 4H0LC 3HZXA 3D31A 1BCPC 2NZ1D 3X3MA 1SE3A 1TWCB 2CHBD 4IUUA 2BDNA 1GUWA 4XQJA 1F9SA 4F7XA 1H9MA 3U9OA 1QCBD 1B2TA 4CGYB 2JXMB 4DAYA 4F87A 4X3SA 4KY6A 5T1IA 1EU3A 4HN7A 3V96A 1YNND 1D5ZC 5EKKA 3C3LA 1EY7A 4IALA 2NVTB 3Q0AA 1AEXA 1TY0A 3OPOA 4RKBA 4X3TA 2WACA 3OMCA 2ICIA 1EWCA 1AZQA 1Q12A 5JOBA 1TVXA 1BCPF 1QG7A 1Z6HA 1SNDA 2H1EA 1OXTA 4G7ZC 3H09A 2TSSA 1PRTC 2B2TC 3DEPA 3DHQA 1FNWA 5ELEA 1I3QB 1SYCA 1U9RA 1B50A 3S15B 1F9QA 4KKUA 2DY7A 1STBA 4C3IB 2E74C 4LMQD 1LTGD 2PW7A 5ISRA 5JEAG 1STEA 4AYBB 4HTHA 3BDCA 2DNCA 1VMPA 1EFID 1CFMA 3GD7A 5IGGA 2NUCA 3TSSA 4IFDJ 3I91A 4FP5D 3GP7A 1ESRA 1CA6A 4DF7A 2B2WA 4WORA 1PRTF 4RGTA 4L6TB 5HURA 4Y7NB 2F0OA 3HEJA 5T1GA 1MBYA 4F88A 3CQZB 5EBCA 3HRZC 4JBWA 3QIAA 5EPJA 2KJXA 1E2VA 1PYWD 5K36H 3J80L 5C5MA 3FPPA 3FDTA 3OMGA 3OIQA 2A68C 1HFNA 4O1NA 3HG9A 5E4WC 3I4LA 1STHA 2E76C 2QEJC 3CU7A 1EYAA 2Y0SB 1STNA 2HDMA 2IX1A 3VYUA 1EQVA 1A2TA 4FF4A 1JWSD 2OXPA 5ELDA 1IL8A 1Q3LA 1H9RA 2BA0A 4B08A 1T5XD 1MSHA 1CZWA 1IYUA 1SDFA 4KY5A 4EQPA 1MGSA 3AB9A 1HTPA 2MGSA 3DWQA 5M5XB 2SNMA 1HTLD 4HR7B 3IKJA 1HUNA 3OWEB 2V4DA 2Q8IB 1TT2A 3A7AB 4J1MA 1II3A 1S5CD 3URYA 5FK9C 1A3TA 4MN3A 3J7AV 3L7ZC 3MXGA 5KNCA 3VYSA 4ID6A 2B39A 5I4DA 3CRKC 1SFOB 2Q8TA 3HOZB 3TP7A 3ND9A 2BA1A 2WKCA 1IKLA 2VNUD 3S16B 1JR0D 2EY5A 2AWNA 5C3EB 3IAYA 2MPMA 2CW0C 1KLGD 5G3LF 4M8AA 2SNSA 2KA7A 3A8JE 4OHJA 4EGVA 1SMYD 1DOLA 4DK0A 4OO1I 2DY8A 2F0LA 3TP8A 2F0JA 3BG3A 5A2QE 5D65A 2Z8LA 4G7OC 3C1FA 1ZKOA 1EEFD 4RFBA 5HGTA 4RHRA 3MEHA 4K8IA 3OSOA 4FXDA 1EEID 2B63B 1GJXA 3TBIB 4XT3B 3D4RA 3LWUA 3C46A 3MHBA 2SDFA 4DFAA 1IKMA 4A3DB 3SK6A 3BDLA 2WIIB 2K03A 3R3OA 4XQNA 4KI0A 2LFNA 3SR1A 3L9AX 2F1MA 2QF7A 1F9PA 3PIO3 5KGUA 3J7AF 2JA8B 2RSNA 1M8AA 1DOMA 4RH6A 5IOCA 1CQVA 4RGMA 4RHSA 3K5OA 2EDGA 4K5XA 1ENCA 3FEWX 4FO2A 1AFPA 2R7ZB 3NQIA 1SNOA 1K8OA 2A6HD 2JEAI 1CI3M 1JWMD 3DM1A 3NXWA 1LT4D 1SEBD 2JP1A 1GUOA 4IFDI 4DAPA 1HA6A 1RTNA 5C6AA 3S1QB 1VCIA 1TWAB 4R8NA 1ZYRC 3PV0A 2WB1B 1S5FD 1KAAA 2L55A 4WRDA 3E0JA 4FF3A 5DEHA 2EY2A 4LAAA 2RDGA 4A3EB 1CT1D 2KHSA 5JVG3 1XWEA 5KIXA 2R61A 3N6RA 1TWHB 2GA4B 1ILQA 4DAVA 2JA7B 2F0EA 1F77A 1ENAA 5C3WA 1SBBB 1PZJD 2QILA 3AU7A 4QF4A 4BA1I 4ZKCB 4HSPA 5C0XH 3HOXB 1BOSA 1IW7C 5EGTA 2F0NA 1EQTA 1EY5A 3VR2A 4HAEA 5KRUA 2NB0A 1HRJA 3K5MA 4V0BA 1HHVA 3BS1A 1HFGA 2M9VA 3PUWA 4HMJA 4IN3A 2EOTA 4L8JA 3FKIB 1MD2D 5BN4A 1QNUA 1OXUA 1ONLA 1WD0A 5EKIA 2EPBA 3WOEA 1WTQA 4XTCS 5DNFA 1LTSD 4O42A 5A35A 3P7JA 3J80E 5C0XJ 3MAQA 1LT5D 1C8CA 2ZT9C 4NKLA 4OO1G 1GXDC 5JVH3 4HMIA 1Y1WB 5C4HA 1MI2A 1E2ZA 2K7VA 1ET6A 2F0GA 4OL7A 2B2WC 3GTGB 1SNQA 2LS01 3TN2A 2B2UC 4RGOS 3NUCA 4BBRB 2LMCB 1Q1BA 5EKLA 5KNDA 3ND8A 4QMGA 4HSVA 5A2QL 1CHQD 3U9SA 2LKVA 1K83B 2RSOA 3S2DB 1EZ8A 3DEOA 2C5CA 3RUZA 1PTOD 3KF8A 2M2LA 1V8QA 1EOTA 1Y8NB 1I50B 4A3IB 2F0TA 3HGBA 2ZXPA 3DMUA 4C3JG 4KV6A 5LHY1 2DN8A 5E3FA 1KABA 2XRQD 3FPUB 1U4PA 1XTCD 1V1PB 3OWFA 2K5QA 4R9WA 4M1UB 4EVOA 2EYPA 3VYTA 2HCCA 3C2PA 2PO4A 1I4RA 3BVGA 1E2WA 1Y69U 1HA5A 3VR4A 3T13A 2VB3X 4IFDG 3M85A 1KDCA 4LK1C 1EY8A 1GUSA 4FF2A 1HPCA 4NW2A 1VDZA 5IGEA 2VUMB 2KVMA 4YIJA 1RCVD 2RBMA 3W2DA 1OXSC 3TZUA 1YNJD 1UNSA 4S3SA 2AQ1B 4G7HC 3TP6A 2L0CA 1QILA 2EYLA 3CKIB 4A3BB 3S17B 3A54A 3S14B 1PFNA 2AQ3B 2M00A 2B8GA 3HOYB 3HS0C 1LACA 2IX3A 5C5LA 1H9KA 1QOHA 3D4DA 5I2XA 1T5EA 4C3HG 4QCLA 5CGKA 1YNNC 1L0XB 5CC4A 2E2JB 1NCVA 5FLXE 2E2IB 1AW7A 1GUGA 1KNAA 1WTVA 2R3ZA 1F2ZA 3MWYW 2XNAC 5D3DA 3GTLB 3I73A 4DA2A 4BWGB 2A69C 4U673 1SAPA 5LL6S 5COYA 4P2CB 3VYRA 1STGA 1TIID 3H0GB 4FF1A 2MJ8A 1Q8IA 1LT3D 3J7YW 4DU9A 3SVMA 3NTKA 5J1ZA 5I6WA 1IYVA 1JB3A 4K6DA 2KEDA 3EROA 2XVSA 1SYGA 1EL0A 2XWJB 2IT1A 1X3PA 1BNZA 3V05A 5EJWA 3UI2A 3GV6A 5CV4A 3S1NB 2N55A 4HEDA 1QB5D 5DAUA 1Z47A 2B2UA 1EYCA 5C0XI 3D6CA 2R92B 5FOBB 3NSWA 2HQEA 2IPKD 2PCFB 1O78A 4PV1C 3SE0A 1ET9A 3T16A 4PNYA 4ULLA 2PZUA 2ZXRA 3ZYYX 1VF5C 1I4QA 2BE5C 2A68D 4C56C 2XIWA 1F2YA 2QKIC 3RD4A 4XQQA 3CRLC 5NUCA 1ML0D 1EIHA 4F8MA 3VA5A 5LL6X 1GUTA 1FGBD 4JK1C 1X32A 3DXJC 4IURA 5JPMC 4KKSA 2PQEA 5JPNC 1DYQA 1F2MA 1TS2A 2L9HA 2VXWA 2NYZD 2EZVA 3S2HB 4CJ2C 1SSOA 1W6JA 2EYHA 3I90A 2F03A 4I65A 3KLSX 4KD3A 1F9RA 5ELBA 4ZAIA 1R4QB 3FVQA 2F0SA 2A73B 2F0VA 2L5TA 3D3RA 2KUMA 3TMEA 3RZDB 4EQOA 1EYDA 3NTHA 2IJ0A 1R4PB 2BDOA 4ZKBB 2A6ED 4OIKA 1RKNA 2PPBC 3HOWB 1PDQA 2MP1A 3H3VC 1WD1A 1VF7A 1SMYC 1AZPA 2IWHA 4KJOA 1NUCA 2WP8J 5EQ0A 1EY6A 4CBVA 2EE1A 5IT9L 3EVQA 3ONAB 3H94A 1GHJA 2I07B 2JE6I 1DM0B 2KEEA 3EFXD 3M4OB 4KHZA 2B2VA 4KY7A 2PMZB 3M7GA 4IZ8A 4BA2I 2FJ2A 2I46A 1MSGA 4RKLA 4G4KA 2B2YA 5BN5A 3WOFA 4K5VA 3K5LA 5E4XA 3A8KE 5FLXL 5C3XA 4Q0FA 2OF1A 3ERQA 2AQ2B 2F3VA 3BVMA 2IX0A 3VA7A 1U4MA 2F0UA 3FRPB 1SNPA 1J8IA 1PTOB 2NWGA 2F0FA 4QIWB 1CQFA 3KLRA 3SK4A 4MHEA 4V190 4KK7A 1JCKB 3A8IE 1JOQA 4Q5VA 5CORA 1D6EC 1UAPA 3PO2B 1FD7D 4KMUC 4A3MB 4XT1B 3OW7A 2E2DC 1STAA 2OT2A 3SEBA 2PW5A 1AN8A 1C4QA 2J7ZA 3PUYA 2L4NA 1WVLA 5C4JB 4BY1B 1JOOA 3IFDA 5IGBA 3SK8A 1U4RA 3HP3A 3TDQA 3A55A 2A74C 1ZYRD 3GTOB 2NTTA 1V1PA 4XIGS 1CZGA 4IUPA 1TQOA 4FYDA 3QWNA 2K05A 4I7ZC 4FXGC 2KQ3A 2WINB 2WKDA 4ILWA 4IUNA 1SXTA 1QNKA 4K2LA 1B53A 3KBGA 3BVZA 3M3YB 3QG1A 2F0PA 2A5HA 4K5WA 5J39A 3FMCA 1D5XC 1CA5A 1RDPD 3P20A 3GQBA 1G91A 2EJFC 1O80A 2WAQB 1G2SA 2K04A 2KOLA 1IW7D 4RA8A 1QWYA 5IGCA 5EPLA 4J6HA 3R93A 4C1NI 3G6JB 1O7LA 3W3AA 3OOCA 2EY1A 1W6KA 1LTBD 1S5ED 2EYFA 2O4XA 1E0BA 4RAUC 3Q6SA 3K7AB 3Q22A 5IODA 4ODGA 5C4XB 1TU2B 2DNEA 3JAME 4LJZC 5IGDA 1NSNS 1V43A 1LTRD 1A3UA 2X69A 3MTSA 2FMMA 2NN6H 3E5SA 1PTOH 3QJYA 1LTAD 2Z1CA 3I3CA 1I4XA 2K33A 2F0QA 1B4OA 4PMWA 2L12A 4H44C 2KCNA 4RCNA 1B3AA 4ZUIA 5CV7A 5FKAC 1C48A 3BYTB 4X3KA 1EY4A 3V2TA 1JQYD 1WTPA 5TSSA 1AP0A 2D62A 3KBXA 1XX8A 2D9UA 4N9PA 3GTJB 5CMDA 2FHTA 1Z7TA 3SK5A 4A3GB 3T4AC 2NBFA 4IQZA 2SEBD 1DD2A 2IL8A 3I4MB 3RMHA 2PZWA 3K5NA 1SE4A 3MA2B 4E6IA 1BF4A 1OXVA 3MVVA 4RWSC 2JA6B 2G9HD 4HCEA 3ITPA 3D8GA 5CBEE 4DXFA 4C1NK 1SNCA 4KTAA 3MXUA 4ZQ3A 4OO1H 5ELFA 3NE5B 1CK1A 1B9NA 1JE4A 4ZRZA 2K01A 4DNRB 5J22A 1ILPA 1LABA 3E6ZX 3RLFA 4K6LA 1DOKA 1PFMA 1SYBA 4FNFA 5IT9E 1KNEA 3Q24A 4A3KB 1I4HA 4BS9A 2PZTA 4BBSB 5EBDA 1YNJC 3PUZA 1O7YA 2QCPX 3IFTA 2YU9B 2ID0A 2MUYA 1NR4A 3Q23A 3PO3B 1BR9A 4BY7B 2RVLA 3NQTA 1BCPD 4N9TA 3D4WA 4G57A 2RDHA 4X3UA 4OGQC 1EY0A 2EJMA 3KUPA 2RA4A 2KCCA 2PYKA 1DCZA 2TMPA 1NR2A 2EVBA 1G6ZA 2JA5B 1CM9A 2BOSA 2O5JC 3R8BA 2K5WA 3I8ZA 3O13A 2B2VC 3K57A 1FR3A 1S5BD 1ZXTA 4DGZA 1PLFA 5K36G 4IFDH 3DUZA 2B2YC 2C9OA 2AUJD 3HKZB 2XSCA 2K6AA 5AFWA 2A69D 3SXHA 1QJOA 1PRTD 1K8MA 3TP5A 2EYMA 3WDNA 2Q8RE 3NPPA 3H91A 1SJHD 5M5YB 3BDOA 1ESFA 2E75C 2J0TD 4KD4A 1RHPA 1OO9B 2HUGA 4J8QA 1FNVA 2F4IA 1TKWB 2NTSA 2AWOA 5IIFA 4K14A 4UDUC 2JSOA 3GTQB 3OIPA 3MFGA 4XYOA 1B1ZA 1HQRD 3TZDA 1BXTA 1S4ZA 3JAML 3BYYB 4FVMA 3EQLC 2Z4HA 4ZK9B 5CV8A 2YYZA 3DWAA 2D5DA 1H9SB 5KYLA 5CV6A 4NMZA 3NBHA 1EIGA 4OIJA 3VR3A 3QO2A 2O2LD 1GOZA 4ZUJA 2RKSA 3X3NA 3PUVA 2NVXB 1U4LA 4B9WA 1O7ZA 3CHBD 1X3QA 5JEAH 1PFBA 2VB2X 2BE5D 3NK9A 5CV5A 1KLUD 2OEOA 1A3VA 2KECA 1R9TB 3AMUA 2CVRA 2L1BA 1SJED 2IW3A 4CKEA 4C3IG 3J81E 4H13C 1HUMA 2NN6I 3P75A 3EJIA 3PMFA 5G3LD 1ZEQX 4K2KA 1J9OA 1NAPA 3QOLA 1FYCA 1QE6A 4PQXA 1HCZA 5F2DA 3MXNA 5IGFA 1BO0A 4ZLTF 3M4YA 1I4PA 3EA6A 4EQNA 2LY7A 1BDOA 5M5WB 1SNMA 1XYIA 1KDBA 2ICEC 4DXGA 1BQQT 2A6EC 4A93B 5JEAJ 3KK7A 3VR6A 1TY2A 4ZYSA 5JAVA 3PIP3 1JWUD 2EYJA 2MHVA 2CW0D 1H9JA 1SYDA 2F3WA 3F2UA 5I2YA 4UAIA 3MC0B 3HOUB 3GV3A 5D14A 4Z9CB 3SHLA 1EWHA 2R6GA 1CTMA 1L0YB 1EZ6A 2FFKB 2JEBI 3S1MB 3M7NA 4HCSA 2NVQB 3L3OC 4ABNA 5DM73 4A3FB 1PZKD 1HQMC 1OXXK 4U68A 4QB4A 4KN4C 2FINB 4CJ0B 2F0DA 4H7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FNF A;  4FO2 A;  5G3L F;  5G3L D;  4FP5 D;  1QCB D;  1TII D;  1QB5 D; 
#chains in the Genus database with same CATH topology
 4TKO B;  3HFZ B;  3S1R B;  3D6W A;  4RCO A;  4OWT B;  5C44 B;  1B44 D;  2B2T A;  2X6G A;  1A2U A;  4FXK C;  1DON A;  5EPK A;  4GLA C;  1NMF A;  1PXU A;  5K5P A;  1HXY D;  1RD9 D;  2P5Z X;  2Q2I A;  1JOK A;  5KYI A;  2UUA Q;  2EJG C;  1VMC A;  1G8Z D;  4HIK A;  1WI5 A;  4A3J B;  1GUN A;  1YVC A;  1F2L A;  5KNB A;  4WFN 3;  5E1F A;  3NBH B;  5I6Y A;  1JC7 A;  1LM0 A;  1L2F A;  2VZA A;  4DNT B;  1I4G A;  1TS5 A;  5C3E G;  1YIJ A;  2A6H C;  1KHI A;  3H6M A;  2XN9 C;  4IPH A;  4TRD A;  3GTM B;  4LUO A;  2F0H A;  1HNW Q;  5JJZ A;  5FO7 B;  2BCO A;  3CW2 C;  3QB3 A;  4O2D A;  5HGQ A;  3U4Z A;  3PUX A;  3NTI A;  2ZXO A;  4XYQ A;  5C0X G;  2A1A A;  1QVG A;  1GHK A;  4DV1 Q;  3LX0 A;  4ALP A;  4X66 L;  2K5D A;  5FO8 B;  2H4O A;  2F0I A;  4PMC A;  4JOI A;  4LFB L;  1S5D D;  1SYF A;  3A56 A;  2MNA A;  4FDB A;  4WJW A;  3QOJ A;  3RLN A;  1UWV A;  2R93 B;  2GVB A;  4P71 A;  3K59 A;  4QUC A;  1IHZ A;  1B3Q A;  1MKH A;  3EIV A;  3GO5 A;  3UDG A;  1PMR A;  2CWA A;  1WTX A;  1HZA A;  1XXG A;  3MXN B;  4RGN A;  1TWF B;  4IUQ A;  2QEX A;  1TS3 A;  1GM5 A;  2D2C C;  5IT9 c;  1TR5 A;  1K0R A;  3BZD B;  3OHX C;  1A6X A;  1XTD A;  1IXR A;  5M5W H;  5FLM H;  4IO9 A;  4B3M Q;  1WCM B;  4IJL A;  1WTO A;  1NBW A;  5KEE A;  4A93 H;  1CHP D;  3R2T A;  3CF5 A;  4PMB A;  1SE2 A;  2F0M A;  3PSI A;  2WV6 D;  2I0Q A;  3NBI A;  2EY6 A;  5IYB G;  1I6V C;  1JIC A;  3HOZ H;  2HDL A;  1CSP A;  1UE5 A;  1BCP B;  4GLV B;  2F4V L;  4CKB A;  2RDF A;  1V9P A;  1S3O A;  3L0O A;  3LNN A;  5CYU A;  2CQA A;  3KLS A;  3G48 A;  1C0A A;  1BUV T;  4C2M B;  2NN6 G;  2K1B A;  1LT6 D;  3NHH A;  1BBX C;  1RJT A;  1TS4 A;  4B3S L;  3H15 A;  4NDX A;  2JYO A;  3RZO B;  1AH9 A;  1LTI D;  3MEF A;  2R7Z G;  3I4N B;  4JI0 L;  1UE7 A;  1Q90 A;  1L0W A;  4GZY C;  2J4X A;  4CKC A;  1RF2 D;  3KFU A;  3J81 L;  3S1M H;  1STY A;  2I5H A;  4PZ8 A;  1UE1 A;  1B9M A;  5CBA E;  4A3F H;  3IL8 A;  2Z6B A;  3PO2 G;  1CKO A;  1A63 A;  2BH2 A;  4A3M G;  1Q1E A;  1D2B A;  4L63 B;  1RTO A;  4C3J B;  1XNR L;  4LWC A;  3M9B A;  4CJ1 B;  4DR4 L;  1HZC A;  1D5M C;  2XRS D;  3K6O A;  4KKT A;  3T51 B;  4OWW B;  3NP8 A;  4HJ5 A;  3GTK B;  1PRT B;  4GS3 A;  3S1R H;  1J6Q A;  3OYY A;  1UUP A;  4X66 Q;  3LWE A;  1WTW A;  3CC2 A;  4BY1 G;  4ME5 A;  2K28 A;  3A7L A;  4LFB Q;  3STB C;  1DXM A;  1ROD A;  1E1O A;  1KDA A;  3DWP A;  3KF6 B;  1TWG B;  4KJN A;  1PH7 A;  2D0O A;  5LMN W;  4DR1 L;  1DJR D;  3C1E A;  4B9X A;  2VY3 A;  2QA4 A;  1KTK A;  3HKZ E;  4GN4 B;  1LV9 A;  4XDX A;  4A3E G;  2SOB A;  5C4Z A;  4A3L H;  2N78 A;  2OTL A;  5IP7 H;  4R8I A;  2F0K A;  3BU2 A;  1MJC A;  3T53 B;  4GN3 B;  2JA8 H;  1LO5 D;  2KEN A;  3K58 A;  2XTI A;  3HOV B;  3AYH B;  2O5I C;  3GTM H;  2K32 A;  1LTT D;  5M3M B;  2QDB A;  2L11 A;  5D3I B;  1VQ4 A;  4DK6 C;  1PH3 A;  3MZ5 A;  3MFY A;  4ME3 A;  1SYE A;  2FMC A;  2NVY B;  5CV9 A;  5I9P A;  1ICW A;  3UDF A;  3JC6 6;  1PTO C;  3HOX G;  1LLR D;  3P1H A;  4KHV A;  4IUV A;  2F4V Q;  3S9W A;  3M4Q A;  2C35 B;  3MXP A;  4MIU A;  2K5H A;  2XWB B;  3CME A;  4NP5 A;  1A15 A;  1M4V A;  2JJQ A;  1D1I A;  4QUF A;  1UEA B;  1FNU A;  2F0W A;  5I9O A;  2EXZ A;  4C3H B;  4B3S Q;  4HJ7 A;  3GTP B;  2B8F A;  2EYO A;  2PQA A;  5ELC A;  3T56 B;  4KN7 C;  3VR5 A;  4JI0 Q;  1TWF H;  2F52 A;  4LF5 L;  3BJU A;  3FKI G;  4TSS A;  4TQU S;  4BXX H;  1D1K A;  1EU4 A;  2GN5 A;  3K0Y A;  1Y14 B;  4JPB W;  2Z4I A;  3I72 A;  4NXN L;  5CR3 A;  1DZ1 A;  1H9S A;  1WCM H;  2N88 A;  4DK1 A;  1XNR Q;  3J81 i;  1PTO F;  3N52 A;  4DPG A;  5JJI A;  1M90 C;  2HCI A;  3J81 c;  4DR4 Q;  1D7Q A;  3G7L A;  5C4X G;  4A75 A;  1XPR A;  1TXY A;  3NWT A;  2AUK A;  5M9O A;  5FO9 B;  1JOR A;  4UP9 A;  2FXQ A;  3R2I A;  1I6H B;  4DN4 M;  2K14 A;  3I70 A;  1ENF A;  2AMC B;  1PZI D;  5M3F B;  1G2T A;  3AEV A;  1D8L A;  2ENB A;  3SDZ A;  4K8J A;  1KAW A;  1KL9 A;  1WTR A;  1G29 1;  5DM6 3;  2PNR C;  1EY9 A;  5BN3 A;  4CHT B;  4XXE A;  3RZO H;  1QZH A;  2G9D A;  4POG A;  2X6L A;  2RQX A;  1HR0 L;  1Y1V B;  3FP9 A;  3NWS A;  1V1O A;  2E2H B;  4IUT A;  3I2Z A;  1Y8P B;  1E7Z A;  1Y8O B;  4H0L C;  3HZX A;  3D31 A;  1BCP C;  2NZ1 D;  3X3M A;  3CXC A;  1SE3 A;  1N36 L;  1TWC B;  1N33 L;  2CHB D;  4IUU A;  2BDN A;  1GUW A;  4XQJ A;  3CCM A;  1F9S A;  4F7X A;  1H9M A;  3U9O A;  3I4O A;  5J3B A;  1G6P A;  4A3G G;  1QCB D;  1B2T A;  4LF8 L;  4A3I G;  4CGY B;  1EOV A;  3I4M G;  2JXM B;  4DAY A;  4F87 A;  5FJ8 G;  5IYC G;  4X3S A;  4KY6 A;  4EX5 A;  4QGU A;  5T1I A;  1EU3 A;  1WOC A;  3ERS X;  4HN7 A;  4TVA B;  3V96 A;  5IP9 H;  2MO0 A;  1YNN D;  1D5Z C;  1T9H A;  1YEZ A;  2PI2 A;  1VQ6 A;  5EKK A;  3C3L A;  1EY7 A;  4IAL A;  4L5Q A;  4JV5 L;  3W1B A;  2NVT B;  3Q0A A;  1AEX A;  1TY0 A;  1VQI A;  3OPO A;  4RKB A;  4X3T A;  2WAC A;  3OMC A;  2ICI A;  1EWC A;  1AZQ A;  1Q12 A;  5JOB A;  4LF5 Q;  1TVX A;  1Y1W H;  1EYG A;  1CKN A;  2JQO A;  1Q46 A;  1BCP F;  1E24 A;  1QG7 A;  1Z6H A;  1SND A;  2H1E A;  1OXT A;  4G7Z C;  3H09 A;  2TSS A;  1PRT C;  3HOV H;  2B2T C;  3CCV A;  5IE8 A;  3DEP A;  3DHQ A;  5M3M H;  1FNW A;  5ELE A;  5EAY A;  3AQQ A;  3GTG H;  1K0S A;  1I3Q B;  1SYC A;  1U9R A;  1B50 A;  3S15 B;  2NVY H;  2PMZ E;  1F9Q A;  4KKU A;  4BBR H;  2DY7 A;  1STB A;  1IL2 A;  4C3I B;  2E74 C;  2VS1 A;  2VQE L;  4LMQ D;  1LTG D;  2PW7 A;  2DJG C;  5ISR A;  1YJW A;  5JEA G;  1STE A;  4AYB B;  4R1J A;  1KXL A;  1Q7Y C;  4JI1 Q;  4HTH A;  3BDC A;  1K83 H;  1VMP A;  2DNC A;  3S2D H;  1MJE A;  1EFI D;  3GD7 A;  1CFM A;  5IGG A;  2YTX A;  2NUC A;  2PQA B;  3TSS A;  1SN8 A;  4IFD J;  3GTP H;  3I91 A;  4FP5 D;  3GP7 A;  1ESR A;  1XNQ L;  4BY7 G;  1S72 A;  1CA6 A;  4DF7 A;  1HR0 Q;  5GAD C;  3HOY G;  2B2W A;  1VQD A;  4WOR A;  1PRT F;  4RGT A;  4L6T B;  5HUR A;  2K50 A;  4Y7N B;  2F0O A;  3HEJ A;  5T1G A;  1MBY A;  4F88 A;  3CQZ B;  5EBC A;  3HRZ C;  4JBW A;  4JOI C;  3QIA A;  5EPJ A;  5GAH C;  1N33 Q;  2KJX A;  1E2V A;  1PYW D;  5K36 H;  1NTG A;  3J80 L;  3L2P A;  5C5M A;  3FPP A;  2K5V A;  3FDT A;  3OMG A;  1PV4 A;  3OIQ A;  2A68 C;  1E22 A;  1HFN A;  4O1N A;  2IHF A;  3HG9 A;  5E4W C;  4DUY Q;  3I4L A;  1STH A;  1LTL A;  2E76 C;  2JA5 G;  2QEJ C;  3CU7 A;  4LF8 Q;  2KCT A;  3J7A 5;  1EYA A;  3ZJY C;  2Y0S B;  1I6H H;  1STN A;  2HDM A;  1EIY B;  2IX1 A;  2UXC L;  3VYU A;  1EQV A;  5M3F H;  1A2T A;  4FF4 A;  2ASB A;  1JWS D;  4HJ8 A;  2OXP A;  5ELD A;  4JV5 Q;  1IL8 A;  2I5M X;  1Q3L A;  1VQE A;  1H9R A;  2BA0 A;  3HKZ G;  4B08 A;  1T5X D;  1MSH A;  1Y1V H;  1MIU A;  1CZW A;  1IYU A;  1SDF A;  4KY5 A;  4EQP A;  2CH4 A;  1MGS A;  3AB9 A;  4DR3 Q;  1HTP A;  2E2H H;  2VUM H;  2MGS A;  1VQM A;  2A8V A;  1RIP A;  4DV6 L;  3DWQ A;  4JI4 L;  5M5X B;  2SNM A;  1HTL D;  4HR7 B;  5IY0 A;  3IKJ A;  1HUN A;  4MZ9 A;  3OWE B;  2V4D A;  2Q8I B;  1TT2 A;  3A7A B;  4J1M A;  2WFW A;  3S17 H;  2HT1 A;  1X9N A;  1II3 A;  1S5C D;  4P74 A;  4GKJ L;  3URY A;  5FK9 C;  4DAY B;  1A3T A;  1IYJ B;  4MN3 A;  3J7A V;  2MFI A;  3L7Z C;  3MXG A;  3H3V H;  5KNC A;  1DGS A;  3VYS A;  1XJV A;  4ID6 A;  4YHH L;  2B39 A;  5I4D A;  4IJH A;  5ELO A;  3CRK C;  1VQG A;  1SFO B;  2Q8T A;  3HOZ B;  3TP7 A;  3ND9 A;  3KJO A;  2BA1 A;  2WKC A;  1IKL A;  2VNU D;  3S16 B;  1JR0 D;  4JYA L;  2EY5 A;  1XNQ Q;  2AWN A;  5C3E B;  2QW7 A;  3IAY A;  1WYD A;  2MPM A;  3GTL H;  2CW0 C;  1KLG D;  5G3L F;  4M8A A;  1KRT A;  2SNS A;  2KA7 A;  3A8J E;  4OHJ A;  2WAQ E;  4EGV A;  1VQJ A;  1SMY D;  1DOL A;  4DK0 A;  4OO1 I;  2DY8 A;  2F0L A;  4KLK A;  1PH2 A;  3TP8 A;  4C3I H;  2F0J A;  3BG3 A;  4PZ6 A;  5LMU L;  3EBE A;  5D65 A;  5A2Q E;  2Z8L A;  3J80 i;  4G7O C;  3C1F A;  1ZKO A;  1EEF D;  1Q86 C;  2DUD A;  3E9I A;  4RFB A;  5HGT A;  2YV5 A;  1LYL A;  4JI3 L;  2UXC Q;  4RHR A;  2E8G A;  3MEH A;  4K8I A;  3OSO A;  4FXD A;  1EEI D;  2B63 B;  1GJX A;  3TBI B;  4XT3 B;  3D4R A;  3LWU A;  3C46 A;  1BBU A;  3MHB A;  2SDF A;  4DFA A;  1IKM A;  4A3D B;  3SK6 A;  5JJL A;  3BDL A;  4Y7N H;  3CQZ H;  2WII B;  4DR5 L;  3KF6 A;  4DV6 Q;  4DNI A;  2K03 A;  3R3O A;  4YWL A;  4XQN A;  1J5E L;  4A76 A;  4KI0 A;  4CDC C;  2LFN A;  2Q2U A;  3SR1 A;  1U5K A;  3L9A X;  2F1M A;  4LUV A;  2JN4 A;  2R92 H;  1MHW C;  2QF7 A;  4WJ4 A;  1F9P A;  3PIO 3;  5KGU A;  3J7A F;  4GKJ Q;  5HY6 A;  2JA8 B;  2RSN A;  1M8A A;  2QDL A;  1DOM A;  3EN2 A;  4RH6 A;  5IOC A;  4LNQ A;  1CQV A;  4A93 G;  4RGM A;  4UP7 A;  4RHS A;  3K5O A;  3T1H L;  4YHH Q;  2RHQ B;  2EDG A;  4K5X A;  1ENC A;  3FEW X;  3HOW G;  4FO2 A;  1AFP A;  1YJN A;  2R7Z B;  3OTO L;  3CCU A;  3NQI A;  1K8G A;  1SNO A;  1K8O A;  2A6H D;  2JEA I;  1CI3 M;  1JWM D;  2ZTD A;  3DM1 A;  3NXW A;  4CDE C;  4JYA Q;  1LT4 D;  1SEB D;  2MQH A;  3TRZ A;  1EQR A;  1XPU A;  2JP1 A;  1N9W A;  3HOU G;  3FHW A;  4JC0 A;  1GUO A;  2LSS A;  1SR3 A;  4IFD I;  2HIV A;  5M5X H;  4EQ5 A;  1QZG A;  4DAP A;  2ATW A;  1HA6 A;  3ULL A;  1RTN A;  2F3I A;  3K81 C;  5C6A A;  3S1Q B;  1VCI A;  1TWA B;  4R8N A;  1ZYR C;  3A0J A;  3BZC A;  3PV0 A;  2CH4 W;  1S5F D;  1KAA A;  2AKW B;  2L55 A;  2R7F A;  2WB1 B;  4X62 Q;  3F1Z A;  5LMU Q;  1PH1 A;  4WRD A;  3E0J A;  4FF3 A;  1JJG A;  5DEH A;  2EY2 A;  4JI3 Q;  1PYB A;  2IHE A;  1NJI C;  4R4C A;  4LAA A;  1SFO H;  2G5D A;  2RDG A;  2ZJP A;  4A3E B;  1UEB A;  1CT1 D;  2KHS A;  5C44 G;  1G51 A;  5JVG 3;  1XWE A;  3S16 H;  5KIX A;  2R61 A;  1N8R C;  3W1G A;  4GLX A;  3N6R A;  4P72 A;  5C3E H;  1TWH B;  2GA4 B;  1ILQ A;  2K5N A;  4DAV A;  1NY4 A;  2JA7 B;  2F0E A;  1F77 A;  1ENA A;  5C3W A;  1SBB B;  1PZJ D;  4P75 A;  1SRU A;  2QIL A;  4A3J G;  1CSQ A;  3AU7 A;  4QF4 A;  3UDX A;  4AIM A;  4BA1 I;  4A3C G;  4ZKC B;  4HSP A;  4A3L G;  5C0X H;  3HOX B;  1BOS A;  1IW7 C;  3U58 A;  5EGT A;  1I94 L;  2F0N A;  1EQT A;  1EY5 A;  2Z9H A;  1Q82 C;  2OTJ A;  1X65 A;  3VR2 A;  1HZB A;  3ULP A;  4JBM A;  4HAE A;  3PIO A;  4N8F A;  5KRU A;  2NB0 A;  1HRJ A;  3K5M A;  2Q2H A;  3T1H Q;  2CCZ A;  4L5T A;  4V0B A;  1HHV A;  3BS1 A;  3OTO Q;  1HFG A;  2M9V A;  1V1Q A;  3PUW A;  4HMJ A;  4IN3 A;  2B63 H;  2EOT A;  4L8J A;  3FKI B;  1MD2 D;  5BN4 A;  1QNU A;  3K7U C;  1OXU A;  3RLO A;  3U4V A;  1ONL A;  1WD0 A;  1K73 C;  2R93 G;  5EKI A;  4A3D H;  4LF7 L;  4DR2 L;  3QR8 A;  2EPB A;  3WOE A;  1WTQ A;  2EIF A;  1VQC A;  4XTC S;  5DNF A;  1LTS D;  4O42 A;  5A35 A;  3P7J A;  3J80 E;  5C0X J;  3MAQ A;  1LT5 D;  1C8C A;  2ZT9 C;  4NKL A;  4OO1 G;  1GXD C;  5JVH 3;  4L5R C;  4HMI A;  1Y1W B;  5C4H A;  3ICE A;  4RG1 A;  1KIX A;  1ASY A;  1MI2 A;  4JI6 L;  1N32 L;  2HIX A;  1E2Z A;  4GOP A;  2K7V A;  1ET6 A;  3E3X A;  1IBK L;  2F0G A;  4OL7 A;  2B2W C;  1PH6 A;  3GTG B;  1SNQ A;  2LS0 1;  3TN2 A;  1VQ9 A;  2B2U C;  4RGO S;  2R7Z H;  3NUC A;  4BBR B;  3SGI A;  5IYD G;  2LMC B;  1Q1B A;  5EKL A;  4QJF A;  5KND A;  2R7D A;  3ND8 A;  4QMG A;  4HSV A;  1PVO A;  4AYB E;  5A2Q L;  1CHQ D;  1L1O B;  3U9S A;  3W5O A;  5LMN L;  2UUB L;  2LKV A;  1K83 B;  2RSO A;  3S2D B;  3I7F A;  1EZ8 A;  3DEO A;  2WAQ G;  3I4N G;  2C5C A;  3RUZ A;  1PTO D;  3KF8 A;  3PF4 A;  3G71 A;  2M2L A;  4LUZ A;  5ELN A;  1V8Q A;  1EOT A;  1Y8N B;  1I94 Q;  1I50 B;  3S1Q H;  1VQ8 A;  2L15 A;  1TWA H;  4A3I B;  2F0T A;  3HGB A;  2ZXP A;  3DMU A;  4C3J G;  1GVP A;  1C9O A;  4KV6 A;  5LHY 1;  2DN8 A;  5E3F A;  1KAB A;  2XRQ D;  5GAE C;  3FPU B;  3U50 C;  1U4P A;  1XTC D;  1V1P B;  3OWF A;  4A3E H;  2K5Q A;  4R9W A;  4M1U B;  4EVO A;  3TQY A;  2EYP A;  1EUJ A;  2HCC A;  3VYT A;  1TWH H;  3C2P A;  2PO4 A;  4DR2 Q;  1YBY A;  1I4R A;  3BVG A;  2JA7 H;  1E2W A;  1Y69 U;  1WJJ A;  1HA5 A;  4X6A H;  3VR4 A;  5IWA L;  1VS0 A;  3T13 A;  2VB3 X;  4DR1 Q;  4IFD G;  1EFW A;  3M85 A;  1KDC A;  4LK1 C;  3M3Y H;  1EY8 A;  3RN5 A;  1GUS A;  3HOX H;  4FF2 A;  1HPC A;  2UU9 L;  2ZTC A;  4NW2 A;  1VDZ A;  1BKB A;  1X6O A;  5IGE A;  2VUM B;  3HOV G;  2KVM A;  2HQL A;  4YIJ A;  4JI6 Q;  4YCU A;  1RCV D;  1N32 Q;  2RBM A;  3W2D A;  1OXS C;  3TZU A;  2ZM6 L;  1YNJ D;  4OWX B;  4HJA A;  3RR5 A;  1UNS A;  3M4P A;  1HJP A;  4S3S A;  4DV3 L;  2AQ1 B;  4G7H C;  3TP6 A;  2L0C A;  1QIL A;  2EYL A;  3CKI B;  4A3B B;  3S17 B;  4DV2 L;  3A54 A;  3S14 B;  1PFN A;  2AQ3 B;  4DR6 L;  2M00 A;  3FKI H;  2B8G A;  2KHJ A;  3D0F A;  3HOY B;  2LXJ A;  3HS0 C;  1LAC A;  2IX3 A;  5C5L A;  4X65 L;  4J15 A;  2PI2 E;  1I5F A;  1H9K A;  3DLL A;  5LMN Q;  1QOH A;  3D4D A;  5I2X A;  2UUB Q;  1T5E A;  4C3H G;  4QCL A;  5CGK A;  1YNN C;  1FL0 A;  1L0X B;  3K7A H;  5CC4 A;  2JA6 G;  4QY7 A;  1NCV A;  2OCE A;  2E2J B;  1NNX A;  5FLX E;  2E2I B;  1AW7 A;  1GUG A;  1KNA A;  2RCF A;  1WTV A;  2R3Z A;  1F2Z A;  3MWY W;  2XNA C;  5D3D A;  3GTL B;  2HHH L;  3I73 A;  4DA2 A;  4YY3 L;  4BWG B;  4X64 L;  2GVA A;  2A69 C;  1VQL A;  4OX9 L;  3DM3 A;  1CKM A;  4U67 3;  4GNX B;  4GOP B;  1SAP A;  4NXN Q;  5LL6 S;  1VQO A;  5COY A;  4P2C B;  3VYR A;  1VQ7 A;  2N49 A;  1STG A;  1TII D;  3H0G B;  1QUQ B;  4FF1 A;  2MJ8 A;  1Q8I A;  1LT3 D;  3J7Y W;  4DU9 A;  4JI2 L;  2VQF L;  3SVM A;  3NTK A;  5J1Z A;  5I6W A;  1IYV A;  1JB3 A;  4K6D A;  4DV5 L;  3LGJ A;  3E0E A;  2KED A;  4A3K G;  3CAM A;  3ERO A;  1RL2 A;  4BBS G;  1SE8 A;  5IWA Q;  2XVS A;  1SYG A;  3KF8 B;  1O7I A;  1EL0 A;  1XMO L;  2XGT A;  2XWJ B;  2IT1 A;  1X3P A;  1BNZ A;  3V05 A;  5EJW A;  3CCL A;  3PO3 G;  2UXD L;  1SMX A;  3UI2 A;  3GV6 A;  3PGZ A;  2UU9 Q;  1I50 H;  5CV4 A;  4AH6 A;  4A3I H;  3S1N B;  2N55 A;  4HED A;  3I4M H;  1QB5 D;  5IYC H;  5DAU A;  1Z47 A;  4DKA C;  2B2U A;  1EYC A;  2ZM6 Q;  1N36 Q;  5C0X I;  4DV3 Q;  1FVI A;  3D6C A;  2KHI A;  1JJC B;  2R92 B;  5FOB B;  2MO1 A;  3NSW A;  2HQE A;  4DV2 Q;  1BVS A;  2IPK D;  2PCF B;  1O78 A;  2K75 A;  4PV1 C;  1VQP A;  4UP8 A;  3SE0 A;  1Q81 C;  4X65 Q;  1ET9 A;  1XPO A;  3T16 A;  4PNY A;  4A4I A;  4IOA A;  4ULL A;  2PZU A;  4GN5 A;  2ZXR A;  2JK8 A;  3ZYY X;  1VF5 C;  1I4Q A;  2BE5 C;  2A68 D;  4C56 C;  1B8A A;  2XIW A;  3A74 A;  1F2Y A;  2QKI C;  3RD4 A;  4XQQ A;  4AQY L;  3CRL C;  4YY3 Q;  4DAM A;  3CCR A;  5NUC A;  4X64 Q;  2E5L L;  1ML0 D;  1EIH A;  4OX9 Q;  4F8M A;  3VA5 A;  5LL6 X;  3CCS A;  1GUT A;  1FGB D;  4JVZ A;  4JK1 C;  1JMC A;  1X32 A;  1M1K C;  3DXJ C;  4IUR A;  5JPM C;  4KKS A;  4A3B H;  4DV4 L;  2PQE A;  5JPN C;  1DYQ A;  1F2M A;  1TS2 A;  2L9H A;  3S14 H;  4YWK A;  2VQF Q;  2VXW A;  2NYZ D;  2EZV A;  3HOY H;  3S2H B;  4CJ2 C;  3J81 j;  1SSO A;  2VQE Q;  4DV5 Q;  1W6J A;  1X3F A;  4AYB G;  1PH9 A;  3K0X A;  2EYH A;  3I90 A;  2F03 A;  4I65 A;  3KLS X;  4KD3 A;  1F9R A;  5ELB A;  3G4S A;  1IBL L;  1KRS A;  4ZAI A;  1R4Q B;  3FVQ A;  1PHJ A;  2F0S A;  2A73 B;  2F0V A;  2E2J H;  2L5T A;  3D3R A;  1XMO Q;  2VL6 A;  2E2I H;  1YZ6 A;  2KUM A;  3TME A;  3RZD B;  1HNX L;  4LF4 L;  4EQO A;  1EYD A;  3NTH A;  3A5U A;  2IJ0 A;  1R4P B;  2BDO A;  4ZKB B;  2JA5 H;  1PFS A;  2A6E D;  1B7Y B;  1K8A C;  4OIK A;  1RKN A;  5AJ3 L;  2UXB L;  2PPB C;  3HOW B;  1PDQ A;  2MP1 A;  3H3V C;  1WD1 A;  1VF7 A;  1SMY C;  1AZP A;  4LFC L;  2IWH A;  4KJO A;  1NUC A;  1X56 A;  3H0G H;  1U0L A;  2WP8 J;  3PCO B;  5EQ0 A;  3WWV A;  1EY6 A;  2KBN A;  4CBV A;  2EE1 A;  1VQH A;  5IT9 L;  3EVQ A;  4JG2 A;  3ONA B;  3H94 A;  4PZ7 A;  3J80 c;  1GHJ A;  2I07 B;  3CPW A;  4CDF C;  2JE6 I;  3KYH C;  2RF4 A;  1DM0 B;  1K9M C;  3JAM i;  2KEE A;  1E3P A;  3T1Y L;  4MTK A;  4GOP C;  3NEM A;  3M4O B;  4KHZ A;  2B2V A;  4KY7 A;  5M5Y H;  2PMZ B;  2EQS A;  3CPF A;  3M7G A;  2D0P A;  4IZ8 A;  4K0K L;  1VQK A;  1EWI A;  4BA2 I;  4AQY Q;  2FJ2 A;  2I46 A;  3S1N H;  1MSG A;  4RKL A;  2E5L Q;  4G4K A;  1KD1 C;  2B2Y A;  5BN5 A;  4JI4 Q;  3GTQ H;  3WOF A;  4K5V A;  3K5L A;  5E4X A;  3A8K E;  3PF5 A;  1W3S A;  5FLX L;  4UY8 C;  5C3X A;  4DV4 Q;  2OF1 A;  4Q0F A;  3F2D A;  3ERQ A;  2AQ2 B;  2F3V A;  1K3B C;  3BVM A;  4ZCK A;  1VQ5 A;  2IX0 A;  3VA7 A;  1U4M A;  2F0U A;  3FRP B;  5FLM G;  4NXM L;  1LUZ A;  1SNP A;  1J8I A;  5BR8 L;  5GRO A;  1PTO B;  2NWG A;  1S40 A;  2F0F A;  1QVF A;  4QIW B;  1CQF A;  4PG3 A;  3KLR A;  2V1C C;  3SK4 A;  3HOZ G;  4MHE A;  1IBL Q;  1PYS B;  3CCQ A;  4V19 0;  1KQS A;  4MNO A;  4KK7 A;  3CD6 A;  3TS0 A;  1JCK B;  1NMG A;  3A8I E;  1JOQ A;  1NE3 A;  4Q5V A;  1HNX Q;  4LF4 Q;  4B3R L;  1FGU A;  5COR A;  1L1O A;  1D6E C;  2NVX H;  1UAP A;  3PO2 B;  2A19 A;  4OON A;  1FD7 D;  1BBW A;  4KMU C;  4A3M B;  1X54 A;  4B3T L;  4XT1 B;  3OW7 A;  5AJ3 Q;  2UXB Q;  1X55 A;  2E2D C;  1PH4 A;  1STA A;  1AE2 A;  3ULJ A;  2OT2 A;  3SEB A;  2PW5 A;  1AN8 A;  2JA9 A;  1C4Q A;  2J7Z A;  3PUY A;  4LFC Q;  1R9T H;  2L4N A;  1WVL A;  3PIP A;  5C4J B;  4BY1 B;  4R4O A;  4R4T A;  4A3F G;  3S2H H;  1JOO A;  3IFD A;  4Y52 H;  5IGB A;  4YCW A;  3SK8 A;  1U4R A;  2B3G A;  1SLJ A;  3HP3 A;  5DLQ E;  2B63 G;  3TDQ A;  3A55 A;  2A74 C;  4HIO A;  3T1Y Q;  1ZYR D;  3GTO B;  2NTT A;  2Z6K A;  1V1P A;  3RZD H;  4XIG S;  3CC7 A;  2OWO A;  4R4I A;  4A3D G;  1C7Y A;  4K0K Q;  1CZG A;  3ER0 A;  3IRB A;  4IUP A;  1TQO A;  4FYD A;  3QWN A;  1PH5 A;  2K05 A;  3Q8D A;  4I7Z C;  2BH8 A;  4FXG C;  2KQ3 A;  2N3S A;  2WKD A;  2WIN B;  4ILW A;  4GKK L;  4DR5 Q;  4IUN A;  1SXT A;  1QNK A;  4K2L A;  1B53 A;  3KBG A;  1J5E Q;  3BVZ A;  3HOW H;  3M3Y B;  3QG1 A;  1W2B A;  4CDD C;  5IP7 G;  2F0P A;  2A5H A;  4K5W A;  5J39 A;  1VQB A;  2JA8 G;  2LXK A;  3FMC A;  1D5X C;  1UE6 A;  1CA5 A;  3NEN A;  3KDF A;  1RDP D;  3P20 A;  4HIM A;  4NXM Q;  4P73 A;  3HOU H;  5BR8 Q;  4NB3 A;  5FLX c;  3GQB A;  1G91 A;  3TRE A;  2EJF C;  1O80 A;  1VQF A;  2WAQ B;  1G2S A;  2K04 A;  2KOL A;  1IW7 D;  4RA8 A;  1QWY A;  4KHP L;  5IGC A;  4NPS A;  3M4O H;  5EPL A;  3CMA A;  4J6H A;  3R93 A;  4C1N I;  3I55 A;  3KJP A;  2ALY B;  2NVQ H;  4B3R Q;  3G6J B;  1O7L A;  4DV0 L;  3W3A A;  2KCM A;  3OOC A;  2EY1 A;  1W6K A;  1LTB D;  1S5E D;  2EYF A;  2O4X A;  2YTY A;  1E0B A;  4RAU C;  3Q6S A;  4B3T Q;  3K7A B;  1X3G A;  2YTV A;  3Q22 A;  5IOD A;  1GO3 E;  4ODG A;  3CC4 A;  1CUK A;  5IYB H;  4BXX G;  5C4X B;  4JBJ A;  5C44 H;  1TU2 B;  2DNE A;  3JAM E;  2WB1 G;  4LJZ C;  5IGD A;  3UE0 A;  1NSN S;  1V43 A;  1LTR D;  1A3U A;  4YCV A;  3STB D;  2X69 A;  3MTS A;  1WCM G;  4GNX A;  2FMM A;  2NN6 H;  3E5S A;  1PTO H;  3QJY A;  1LTA D;  2Z1C A;  3I3C A;  4A3J H;  4A3C H;  4IPG A;  1YHQ A;  1I4X A;  2K33 A;  2F0Q A;  1QUQ A;  1YHA A;  1B4O A;  4PMW A;  2L12 A;  4IPC A;  4H44 C;  2KCN A;  4RCN A;  3H3V I;  1B3A A;  4ZUI A;  4HJ9 A;  5CV7 A;  2OQ0 A;  2JA7 G;  4R4Q A;  5FKA C;  1C48 A;  3BYT B;  2QGQ A;  4X3K A;  1EY4 A;  3V2T A;  1JQY D;  1WTP A;  1EQQ A;  3PO2 H;  2RHS B;  5TSS A;  1Q8K A;  1HNZ L;  3OW2 A;  3S24 A;  4JI7 L;  4GKK Q;  4A3M H;  2D62 A;  1A0I A;  1AP0 A;  3KBX A;  1XX8 A;  2D9U A;  4N9P A;  3GTJ B;  5CMD A;  2FHT A;  1Z7T A;  3SK5 A;  2Z0S A;  4LF6 L;  4A3G B;  3T4A C;  2NBF A;  4IQZ A;  1SRO A;  2SEB D;  1DD2 A;  2IL8 A;  3I4M B;  5C4J H;  4OEL B;  4BY1 H;  3RMH A;  2R93 H;  1YHB A;  2PZW A;  3K5N A;  2UUC L;  1SE4 A;  3MA2 B;  1YJ9 A;  2NZH A;  4E6I A;  1BF4 A;  1OXV A;  3MVV A;  3K80 C;  1JE5 A;  1Z9F A;  4RWS C;  3F8T A;  2JA6 B;  2G9H D;  4HCE A;  3ITP A;  3D8G A;  5CBE E;  4DXF A;  4C1N K;  4H02 A;  4KHP Q;  1SNC A;  1B70 B;  4KTA A;  3MXU A;  4ZQ3 A;  4OO1 H;  4LW1 A;  3GTO H;  2Q2T A;  5ELF A;  1HR0 W;  3NE5 B;  2Y0S E;  1CK1 A;  1B9N A;  4DV0 Q;  1PH8 A;  5IP9 G;  1JE4 A;  1JT8 A;  4LF7 Q;  1P8L A;  3K8A A;  4ZRZ A;  2K01 A;  4DNR B;  4JI8 L;  5J22 A;  1ILP A;  1OTC A;  1LAB A;  1P16 A;  3E6Z X;  3RLF A;  4K6L A;  1DOK A;  3AFP A;  3VDY A;  1Y1W G;  5IYD H;  1PFM A;  1AE3 A;  1SYB A;  4DR7 L;  4FNF A;  5L37 A;  5IT9 E;  1KNE A;  3Q24 A;  4A3K B;  3KDF B;  4JI1 L;  4C2M H;  1I4H A;  3G6E A;  5M3M G;  3UE1 A;  4BS9 A;  2PZT A;  1ASZ A;  4BBS B;  5EBD A;  1YNJ C;  1IBK Q;  3PUZ A;  1XMQ L;  1O7Y A;  2QCP X;  4JBK A;  3IFT A;  4RMF A;  4POF A;  4DV7 L;  2YU9 B;  3HKS A;  2ID0 A;  2MUY A;  2CWP A;  1VQA A;  3I4N H;  3CCJ A;  4BBR G;  1NR4 A;  4LF9 L;  3Q23 A;  3PO3 B;  3KLW A;  2DJF C;  1BR9 A;  4BY7 B;  2CKZ B;  2RVL A;  1K28 A;  3NQT A;  1BCP D;  4N9T A;  4JI5 L;  3D4W A;  3RNU A;  1JB7 A;  3E9H A;  4G57 A;  2AHO B;  2RDH A;  4X3U A;  3KOJ A;  4C3J H;  1HNZ Q;  4JI7 Q;  3F2B A;  4IPD A;  4HID A;  4OGQ C;  1EY0 A;  2EJM A;  3KUP A;  4IOC A;  2RA4 A;  4DUY L;  2KCC A;  2PYK A;  1DCZ A;  3GTK H;  5C4X H;  2TMP A;  1IBM L;  1NR2 A;  1E1T A;  4LF6 Q;  2EVB A;  1G6Z A;  2JA5 B;  1CM9 A;  2BOS A;  2O5J C;  3R8B A;  2DGY A;  2K5W A;  1PA6 A;  1N34 L;  3I8Z A;  4APV A;  3O13 A;  2B2V C;  3K57 A;  2UUC Q;  1H95 A;  1TWG H;  1FR3 A;  1S5B D;  1ZXT A;  4DGZ A;  1PLF A;  5K36 G;  2K52 A;  4IFD H;  3DUZ A;  4OXP A;  2B2Y C;  2C9O A;  3CP0 A;  2AUJ D;  3HKZ B;  2XSC A;  2K6A A;  4I7A A;  4UPA A;  5AFW A;  4DR3 L;  2A69 D;  2ZJQ A;  1EIF A;  1VQN A;  3SXH A;  1QJO A;  1PRT D;  1K8M A;  3TP5 A;  3TS2 A;  2EYM A;  3WDN A;  3BZK A;  5H1S E;  5M3F G;  2Q8R E;  3NPP A;  2CFM A;  4DUZ L;  1ICF B;  1WFQ A;  1GKH A;  3H91 A;  2ES2 A;  4JI8 Q;  1SJH D;  3AFQ A;  3GTJ H;  5M5Y B;  3BDO A;  1ESF A;  1Y1V G;  2E75 C;  2J0T D;  4KD4 A;  1RHP A;  1OO9 B;  3J7Z C;  2HUG A;  4J8Q A;  1FNV A;  2F4I A;  4A3G H;  4DR7 Q;  1TKW B;  2VUM G;  2ZTE A;  2NTS A;  2AWO A;  4N8X 1;  4L5S A;  5FJ8 H;  5IIF A;  4K14 A;  4UDU C;  2JSO A;  3GTQ B;  3OIP A;  2RCN A;  4C3H H;  4A3B G;  1XMQ Q;  3B6Y A;  1L1O C;  4DV7 Q;  2JA6 H;  3I56 A;  3MFG A;  2HD3 A;  4XYO A;  1B1Z A;  4LF9 Q;  1HQR D;  3TZD A;  3A5Z B;  4UHV A;  4DR6 Q;  1BXT A;  1S4Z A;  3JAM L;  4MTN A;  3BYY B;  4FVM A;  3EQL C;  2Z4H A;  4ZK9 B;  5CV8 A;  2YYZ A;  4QIW E;  4LFA L;  2VW9 A;  3DWA A;  2D5D A;  1X3E A;  2K4K A;  4JI5 Q;  2H5X A;  1FJG L;  1H9S B;  5KYL A;  5CV6 A;  1IZ6 A;  4NMZ A;  1KC8 C;  3NBH A;  2IY5 B;  1EIG A;  4OIJ A;  3VR3 A;  4O0A A;  3QO2 A;  2O2L D;  1IBM Q;  1GOZ A;  4ZUJ A;  2HHH Q;  2RKS A;  3X3N A;  3PUV A;  2NVX B;  1U4L A;  4B9W A;  2Z6K C;  1O7Z A;  3CHB D;  4A3K H;  1N34 Q;  1X3Q A;  4JW0 A;  1PFB A;  5JEA H;  4BBS H;  2VB2 X;  2BE5 D;  2CQO A;  4QL5 A;  3GDE A;  3NK9 A;  5CV5 A;  3H0G G;  2YU9 H;  1KLU D;  2OEO A;  1A3V A;  2KEC A;  1R9T B;  5E7N A;  2CVR A;  3UDI A;  3AMU A;  2L1B A;  3PO3 H;  2WB1 E;  1SJE D;  2IW3 A;  4CKE A;  4C3I G;  4BY7 H;  3J81 E;  4JI2 Q;  4H13 C;  4QQB X;  1HUM A;  2NN6 I;  4WJ3 M;  3P75 A;  3EJI A;  3PMF A;  5G3L D;  2UUA L;  1ZEQ X;  4K2K A;  1J9O A;  1NAP A;  1TWC H;  2OQK A;  3QOL A;  1FYC A;  1QE6 A;  4DUZ Q;  4JCV E;  4PQX A;  1HCZ A;  3MXN A;  5F2D A;  5IGF A;  4YWM A;  1BO0 A;  4ZLT F;  3M4Y A;  1I4P A;  3EA6 A;  4EQN A;  2UXD Q;  2LY7 A;  1BDO A;  5M5W B;  1SNM A;  1XYI A;  1KDB A;  1YIT A;  2ICE C;  1HNW L;  4DXG A;  1YNX A;  1BQQ T;  2A6E C;  4A93 B;  5JEA J;  3RN2 A;  3KK7 A;  3VR6 A;  4H7B A;  2N8N A;  1TY2 A;  2NVT H;  1HH2 P;  4ZYS A;  5JAV A;  2R92 G;  2I5L X;  4DV1 L;  3TEH B;  3PIP 3;  1WTH A;  2PNH A;  1JWU D;  2EYJ A;  2MHV A;  1QVC A;  2CW0 D;  1CKN B;  4DK3 C;  1HZ9 A;  1H9J A;  1SYD A;  2F3W A;  3F2U A;  5I2Y A;  1GD7 A;  4UAI A;  3MC0 B;  2Y0S G;  3HOU B;  3GV3 A;  4LFA Q;  1FJG Q;  5D14 A;  4Z9C B;  2NZO A;  3SHL A;  1A8V A;  4OEM B;  1EWH A;  2R6G A;  1CTM A;  1I3Q H;  3JAM c;  3S15 H;  2B29 A;  1L0Y B;  1EZ6 A;  4GNX C;  3CCE A;  2FFK B;  2EXD A;  2JEB I;  5GQO A;  3S1M B;  3M7N A;  4HCS A;  4X62 L;  2NVQ B;  3L3O C;  4ABN A;  5DM7 3;  1YI2 A;  4A3F B;  1PZK D;  2ZJR A;  4B3M L;  1HQM C;  1OXX K;  4U68 A;  1K3R A;  1JJ2 A;  4QB4 A;  4KN4 C;  2FIN B;  3NEL A;  1A62 A;  5JJK A;  3PQI A;  4CJ0 B;  3F2C A;  5GAG C;  2F0D A;  3EFX D; 
#chains in the Genus database with same CATH homology
 4TKO B;  3S1R B;  3D6W A;  4RCO A;  5C44 B;  1B44 D;  2B2T A;  2X6G A;  1A2U A;  4FXK C;  1DON A;  5EPK A;  1PXU A;  5K5P A;  1HXY D;  1RD9 D;  1JOK A;  5KYI A;  2EJG C;  1VMC A;  1G8Z D;  4A3J B;  1GUN A;  1F2L A;  5KNB A;  4WFN 3;  5E1F A;  5I6Y A;  1JC7 A;  4DNT B;  1I4G A;  1TS5 A;  2A6H C;  3H6M A;  2XN9 C;  4TRD A;  3GTM B;  2F0H A;  5JJZ A;  5FO7 B;  2BCO A;  3QB3 A;  3PUX A;  3NTI A;  2ZXO A;  4XYQ A;  5C0X G;  1GHK A;  3LX0 A;  2K5D A;  5FO8 B;  2H4O A;  2F0I A;  4PMC A;  1S5D D;  1SYF A;  3A56 A;  4WJW A;  3QOJ A;  2R93 B;  3K59 A;  4QUC A;  1IHZ A;  3GO5 A;  1PMR A;  1WTX A;  1XXG A;  4RGN A;  1TWF B;  4IUQ A;  1TS3 A;  2D2C C;  1TR5 A;  3BZD B;  3OHX C;  1A6X A;  1WCM B;  1WTO A;  5KEE A;  1CHP D;  3R2T A;  4PMB A;  1SE2 A;  2F0M A;  2WV6 D;  3NBI A;  2EY6 A;  1I6V C;  1JIC A;  2HDL A;  1BCP B;  4CKB A;  2RDF A;  3LNN A;  5CYU A;  2CQA A;  3KLS A;  1BUV T;  4C2M B;  2NN6 G;  2K1B A;  1LT6 D;  3NHH A;  1BBX C;  1RJT A;  1TS4 A;  4NDX A;  2JYO A;  3RZO B;  1LTI D;  3I4N B;  1Q90 A;  4GZY C;  2J4X A;  4CKC A;  1RF2 D;  3J81 L;  1STY A;  1B9M A;  5CBA E;  3IL8 A;  1Q1E A;  1D2B A;  4L63 B;  1RTO A;  4C3J B;  4CJ1 B;  1D5M C;  2XRS D;  3K6O A;  4KKT A;  3T51 B;  3NP8 A;  3GTK B;  1PRT B;  1UUP A;  1WTW A;  3LWE A;  4ME5 A;  2K28 A;  3A7L A;  1DXM A;  1ROD A;  1KDA A;  3DWP A;  1TWG B;  4KJN A;  1DJR D;  3C1E A;  4B9X A;  1KTK A;  1LV9 A;  4XDX A;  2SOB A;  5C4Z A;  4R8I A;  2F0K A;  3T53 B;  1LO5 D;  3K58 A;  3HOV B;  2O5I C;  2K32 A;  1LTT D;  5M3M B;  2QDB A;  2L11 A;  5D3I B;  3MZ5 A;  3MFY A;  1SYE A;  2FMC A;  2NVY B;  5CV9 A;  5I9P A;  1ICW A;  1PTO C;  1LLR D;  3P1H A;  4KHV A;  4IUV A;  3S9W A;  3MXP A;  4MIU A;  2XWB B;  4NP5 A;  1A15 A;  1M4V A;  1D1I A;  4QUF A;  1UEA B;  1FNU A;  2F0W A;  5I9O A;  2EXZ A;  4C3H B;  3GTP B;  2B8F A;  2EYO A;  5ELC A;  3T56 B;  4KN7 C;  3VR5 A;  4TSS A;  4TQU S;  1D1K A;  1EU4 A;  3K0Y A;  2Z4I A;  3I72 A;  5CR3 A;  1DZ1 A;  1H9S A;  2N88 A;  4DK1 A;  1PTO F;  3N52 A;  2HCI A;  3G7L A;  3NWT A;  2AUK A;  5M9O A;  5FO9 B;  1JOR A;  3R2I A;  1I6H B;  4DN4 M;  3I70 A;  1ENF A;  5M3F B;  1PZI D;  1G2T A;  2ENB A;  3SDZ A;  4K8J A;  1WTR A;  1G29 1;  5DM6 3;  2PNR C;  1EY9 A;  5BN3 A;  4CHT B;  4XXE A;  2G9D A;  2X6L A;  2RQX A;  1Y1V B;  3NWS A;  1V1O A;  2E2H B;  4IUT A;  1Y8P B;  1Y8O B;  4H0L C;  3HZX A;  3D31 A;  1BCP C;  2NZ1 D;  3X3M A;  1SE3 A;  1TWC B;  2CHB D;  4IUU A;  2BDN A;  1GUW A;  4XQJ A;  1F9S A;  4F7X A;  1H9M A;  3U9O A;  1QCB D;  1B2T A;  4CGY B;  2JXM B;  4DAY A;  4F87 A;  4X3S A;  4KY6 A;  5T1I A;  1EU3 A;  4HN7 A;  3V96 A;  1YNN D;  1D5Z C;  5EKK A;  3C3L A;  1EY7 A;  4IAL A;  2NVT B;  3Q0A A;  1AEX A;  1TY0 A;  3OPO A;  4RKB A;  4X3T A;  2WAC A;  3OMC A;  2ICI A;  1EWC A;  1AZQ A;  1Q12 A;  5JOB A;  1TVX A;  1BCP F;  1QG7 A;  1Z6H A;  1SND A;  2H1E A;  1OXT A;  4G7Z C;  3H09 A;  2TSS A;  1PRT C;  2B2T C;  3DEP A;  3DHQ A;  1FNW A;  5ELE A;  1I3Q B;  1SYC A;  1U9R A;  1B50 A;  3S15 B;  1F9Q A;  4KKU A;  2DY7 A;  1STB A;  4C3I B;  2E74 C;  4LMQ D;  1LTG D;  2PW7 A;  5ISR A;  5JEA G;  1STE A;  4AYB B;  4HTH A;  3BDC A;  2DNC A;  1VMP A;  1EFI D;  1CFM A;  3GD7 A;  5IGG A;  2NUC A;  3TSS A;  4IFD J;  3I91 A;  4FP5 D;  3GP7 A;  1ESR A;  1CA6 A;  4DF7 A;  2B2W A;  4WOR A;  1PRT F;  4RGT A;  4L6T B;  5HUR A;  4Y7N B;  2F0O A;  3HEJ A;  5T1G A;  1MBY A;  4F88 A;  3CQZ B;  5EBC A;  3HRZ C;  4JBW A;  3QIA A;  5EPJ A;  2KJX A;  1E2V A;  1PYW D;  5K36 H;  3J80 L;  5C5M A;  3FPP A;  3FDT A;  3OMG A;  3OIQ A;  2A68 C;  1HFN A;  4O1N A;  3HG9 A;  5E4W C;  3I4L A;  1STH A;  2E76 C;  2QEJ C;  3CU7 A;  1EYA A;  2Y0S B;  1STN A;  2HDM A;  2IX1 A;  3VYU A;  1EQV A;  1A2T A;  4FF4 A;  1JWS D;  2OXP A;  5ELD A;  1IL8 A;  1Q3L A;  1H9R A;  2BA0 A;  4B08 A;  1T5X D;  1MSH A;  1CZW A;  1IYU A;  1SDF A;  4KY5 A;  4EQP A;  1MGS A;  3AB9 A;  1HTP A;  2MGS A;  3DWQ A;  5M5X B;  2SNM A;  1HTL D;  4HR7 B;  3IKJ A;  1HUN A;  3OWE B;  2V4D A;  2Q8I B;  1TT2 A;  3A7A B;  4J1M A;  1II3 A;  1S5C D;  3URY A;  5FK9 C;  1A3T A;  4MN3 A;  3J7A V;  3L7Z C;  3MXG A;  5KNC A;  3VYS A;  4ID6 A;  2B39 A;  5I4D A;  3CRK C;  1SFO B;  2Q8T A;  3HOZ B;  3TP7 A;  3ND9 A;  2BA1 A;  2WKC A;  1IKL A;  2VNU D;  3S16 B;  1JR0 D;  2EY5 A;  2AWN A;  5C3E B;  3IAY A;  2MPM A;  2CW0 C;  1KLG D;  5G3L F;  4M8A A;  2SNS A;  2KA7 A;  3A8J E;  4OHJ A;  4EGV A;  1SMY D;  1DOL A;  4DK0 A;  4OO1 I;  2DY8 A;  2F0L A;  3TP8 A;  2F0J A;  3BG3 A;  5A2Q E;  5D65 A;  2Z8L A;  4G7O C;  3C1F A;  1ZKO A;  1EEF D;  4RFB A;  5HGT A;  4RHR A;  3MEH A;  4K8I A;  3OSO A;  4FXD A;  1EEI D;  2B63 B;  1GJX A;  3TBI B;  4XT3 B;  3D4R A;  3LWU A;  3C46 A;  3MHB A;  2SDF A;  4DFA A;  1IKM A;  4A3D B;  3SK6 A;  3BDL A;  2WII B;  2K03 A;  3R3O A;  4XQN A;  4KI0 A;  2LFN A;  3SR1 A;  3L9A X;  2F1M A;  2QF7 A;  1F9P A;  3PIO 3;  5KGU A;  3J7A F;  2JA8 B;  2RSN A;  1M8A A;  1DOM A;  4RH6 A;  5IOC A;  1CQV A;  4RGM A;  4RHS A;  3K5O A;  2EDG A;  4K5X A;  1ENC A;  3FEW X;  4FO2 A;  1AFP A;  2R7Z B;  3NQI A;  1SNO A;  1K8O A;  2A6H D;  2JEA I;  1CI3 M;  1JWM D;  3DM1 A;  3NXW A;  1LT4 D;  1SEB D;  2JP1 A;  1GUO A;  4IFD I;  4DAP A;  1HA6 A;  1RTN A;  5C6A A;  3S1Q B;  1VCI A;  1TWA B;  4R8N A;  1ZYR C;  3PV0 A;  2WB1 B;  1S5F D;  1KAA A;  2L55 A;  4WRD A;  3E0J A;  4FF3 A;  5DEH A;  2EY2 A;  4LAA A;  2RDG A;  4A3E B;  1CT1 D;  2KHS A;  5JVG 3;  1XWE A;  5KIX A;  2R61 A;  3N6R A;  1TWH B;  2GA4 B;  1ILQ A;  4DAV A;  2JA7 B;  2F0E A;  1F77 A;  1ENA A;  5C3W A;  1SBB B;  1PZJ D;  2QIL A;  3AU7 A;  4QF4 A;  4BA1 I;  4ZKC B;  4HSP A;  5C0X H;  3HOX B;  1BOS A;  1IW7 C;  5EGT A;  2F0N A;  1EQT A;  1EY5 A;  3VR2 A;  4HAE A;  5KRU A;  2NB0 A;  1HRJ A;  3K5M A;  4V0B A;  1HHV A;  3BS1 A;  1HFG A;  2M9V A;  3PUW A;  4HMJ A;  4IN3 A;  2EOT A;  4L8J A;  3FKI B;  1MD2 D;  5BN4 A;  1QNU A;  1OXU A;  1ONL A;  1WD0 A;  5EKI A;  2EPB A;  3WOE A;  1WTQ A;  4XTC S;  5DNF A;  1LTS D;  4O42 A;  5A35 A;  3P7J A;  3J80 E;  5C0X J;  3MAQ A;  1LT5 D;  1C8C A;  2ZT9 C;  4NKL A;  4OO1 G;  1GXD C;  5JVH 3;  4HMI A;  1Y1W B;  5C4H A;  1MI2 A;  1E2Z A;  2K7V A;  1ET6 A;  2F0G A;  4OL7 A;  2B2W C;  3GTG B;  1SNQ A;  2LS0 1;  3TN2 A;  2B2U C;  4RGO S;  3NUC A;  4BBR B;  2LMC B;  1Q1B A;  5EKL A;  5KND A;  3ND8 A;  4QMG A;  4HSV A;  5A2Q L;  1CHQ D;  3U9S A;  2LKV A;  1K83 B;  2RSO A;  3S2D B;  1EZ8 A;  3DEO A;  2C5C A;  3RUZ A;  1PTO D;  3KF8 A;  2M2L A;  1V8Q A;  1EOT A;  1Y8N B;  1I50 B;  4A3I B;  2F0T A;  3HGB A;  2ZXP A;  3DMU A;  4C3J G;  4KV6 A;  5LHY 1;  2DN8 A;  5E3F A;  1KAB A;  2XRQ D;  3FPU B;  1U4P A;  1XTC D;  1V1P B;  3OWF A;  2K5Q A;  4R9W A;  4M1U B;  4EVO A;  2EYP A;  3VYT A;  2HCC A;  3C2P A;  2PO4 A;  1I4R A;  3BVG A;  1E2W A;  1Y69 U;  1HA5 A;  3VR4 A;  3T13 A;  2VB3 X;  4IFD G;  3M85 A;  1KDC A;  4LK1 C;  1EY8 A;  1GUS A;  4FF2 A;  1HPC A;  4NW2 A;  1VDZ A;  5IGE A;  2VUM B;  2KVM A;  4YIJ A;  1RCV D;  2RBM A;  3W2D A;  1OXS C;  3TZU A;  1YNJ D;  1UNS A;  4S3S A;  2AQ1 B;  4G7H C;  3TP6 A;  2L0C A;  1QIL A;  2EYL A;  3CKI B;  4A3B B;  3S17 B;  3A54 A;  3S14 B;  1PFN A;  2AQ3 B;  2M00 A;  2B8G A;  3HOY B;  3HS0 C;  1LAC A;  2IX3 A;  5C5L A;  1H9K A;  1QOH A;  3D4D A;  5I2X A;  1T5E A;  4C3H G;  4QCL A;  5CGK A;  1YNN C;  1L0X B;  5CC4 A;  2E2J B;  1NCV A;  5FLX E;  2E2I B;  1AW7 A;  1GUG A;  1KNA A;  1WTV A;  2R3Z A;  1F2Z A;  3MWY W;  2XNA C;  5D3D A;  3GTL B;  3I73 A;  4DA2 A;  4BWG B;  2A69 C;  4U67 3;  1SAP A;  5LL6 S;  5COY A;  4P2C B;  3VYR A;  1STG A;  1TII D;  3H0G B;  4FF1 A;  2MJ8 A;  1Q8I A;  1LT3 D;  3J7Y W;  4DU9 A;  3SVM A;  3NTK A;  5J1Z A;  5I6W A;  1IYV A;  1JB3 A;  4K6D A;  2KED A;  3ERO A;  2XVS A;  1SYG A;  1EL0 A;  2XWJ B;  2IT1 A;  1X3P A;  1BNZ A;  3V05 A;  5EJW A;  3UI2 A;  3GV6 A;  5CV4 A;  3S1N B;  2N55 A;  4HED A;  1QB5 D;  5DAU A;  1Z47 A;  2B2U A;  1EYC A;  5C0X I;  3D6C A;  2R92 B;  5FOB B;  3NSW A;  2HQE A;  2IPK D;  2PCF B;  1O78 A;  4PV1 C;  3SE0 A;  1ET9 A;  3T16 A;  4PNY A;  4ULL A;  2PZU A;  2ZXR A;  3ZYY X;  1VF5 C;  1I4Q A;  2BE5 C;  2A68 D;  4C56 C;  2XIW A;  1F2Y A;  2QKI C;  3RD4 A;  4XQQ A;  3CRL C;  5NUC A;  1ML0 D;  1EIH A;  4F8M A;  3VA5 A;  5LL6 X;  1GUT A;  1FGB D;  4JK1 C;  1X32 A;  3DXJ C;  4IUR A;  5JPM C;  4KKS A;  2PQE A;  5JPN C;  1DYQ A;  1F2M A;  1TS2 A;  2L9H A;  2VXW A;  2NYZ D;  2EZV A;  3S2H B;  4CJ2 C;  1SSO A;  1W6J A;  2EYH A;  3I90 A;  2F03 A;  4I65 A;  3KLS X;  4KD3 A;  1F9R A;  5ELB A;  4ZAI A;  1R4Q B;  3FVQ A;  2F0S A;  2A73 B;  2F0V A;  2L5T A;  3D3R A;  2KUM A;  3TME A;  3RZD B;  4EQO A;  1EYD A;  3NTH A;  2IJ0 A;  1R4P B;  2BDO A;  4ZKB B;  2A6E D;  4OIK A;  1RKN A;  2PPB C;  3HOW B;  1PDQ A;  2MP1 A;  3H3V C;  1WD1 A;  1VF7 A;  1SMY C;  1AZP A;  2IWH A;  4KJO A;  1NUC A;  2WP8 J;  5EQ0 A;  1EY6 A;  4CBV A;  2EE1 A;  5IT9 L;  3EVQ A;  3ONA B;  3H94 A;  1GHJ A;  2I07 B;  2JE6 I;  1DM0 B;  2KEE A;  3EFX D;  3M4O B;  4KHZ A;  2B2V A;  4KY7 A;  2PMZ B;  3M7G A;  4IZ8 A;  4BA2 I;  2FJ2 A;  2I46 A;  1MSG A;  4RKL A;  4G4K A;  2B2Y A;  5BN5 A;  3WOF A;  4K5V A;  3K5L A;  5E4X A;  3A8K E;  5FLX L;  5C3X A;  4Q0F A;  2OF1 A;  3ERQ A;  2AQ2 B;  2F3V A;  3BVM A;  2IX0 A;  3VA7 A;  1U4M A;  2F0U A;  3FRP B;  1SNP A;  1J8I A;  1PTO B;  2NWG A;  2F0F A;  4QIW B;  1CQF A;  3KLR A;  3SK4 A;  4MHE A;  4V19 0;  4KK7 A;  1JCK B;  3A8I E;  1JOQ A;  4Q5V A;  5COR A;  1D6E C;  1UAP A;  3PO2 B;  1FD7 D;  4KMU C;  4A3M B;  4XT1 B;  3OW7 A;  2E2D C;  1STA A;  2OT2 A;  3SEB A;  2PW5 A;  1AN8 A;  1C4Q A;  2J7Z A;  3PUY A;  2L4N A;  1WVL A;  5C4J B;  4BY1 B;  1JOO A;  3IFD A;  5IGB A;  3SK8 A;  1U4R A;  3HP3 A;  3TDQ A;  3A55 A;  2A74 C;  1ZYR D;  3GTO B;  2NTT A;  1V1P A;  4XIG S;  1CZG A;  4IUP A;  1TQO A;  4FYD A;  3QWN A;  2K05 A;  4I7Z C;  4FXG C;  2KQ3 A;  2WIN B;  2WKD A;  4ILW A;  4IUN A;  1SXT A;  1QNK A;  4K2L A;  1B53 A;  3KBG A;  3BVZ A;  3M3Y B;  3QG1 A;  2F0P A;  2A5H A;  4K5W A;  5J39 A;  3FMC A;  1D5X C;  1CA5 A;  1RDP D;  3P20 A;  3GQB A;  1G91 A;  2EJF C;  1O80 A;  2WAQ B;  1G2S A;  2K04 A;  2KOL A;  1IW7 D;  4RA8 A;  1QWY A;  5IGC A;  5EPL A;  4J6H A;  3R93 A;  4C1N I;  3G6J B;  1O7L A;  3W3A A;  3OOC A;  2EY1 A;  1W6K A;  1LTB D;  1S5E D;  2EYF A;  2O4X A;  1E0B A;  4RAU C;  3Q6S A;  3K7A B;  3Q22 A;  5IOD A;  4ODG A;  5C4X B;  1TU2 B;  2DNE A;  3JAM E;  4LJZ C;  5IGD A;  1NSN S;  1V43 A;  1LTR D;  1A3U A;  2X69 A;  3MTS A;  2FMM A;  2NN6 H;  3E5S A;  1PTO H;  3QJY A;  1LTA D;  2Z1C A;  3I3C A;  1I4X A;  2K33 A;  2F0Q A;  1B4O A;  4PMW A;  2L12 A;  4H44 C;  2KCN A;  4RCN A;  1B3A A;  4ZUI A;  5CV7 A;  5FKA C;  1C48 A;  3BYT B;  4X3K A;  1EY4 A;  3V2T A;  1JQY D;  1WTP A;  5TSS A;  1AP0 A;  2D62 A;  3KBX A;  1XX8 A;  2D9U A;  4N9P A;  3GTJ B;  5CMD A;  2FHT A;  1Z7T A;  3SK5 A;  4A3G B;  3T4A C;  2NBF A;  4IQZ A;  2SEB D;  1DD2 A;  2IL8 A;  3I4M B;  3RMH A;  2PZW A;  3K5N A;  1SE4 A;  3MA2 B;  4E6I A;  1BF4 A;  1OXV A;  3MVV A;  4RWS C;  2JA6 B;  2G9H D;  4HCE A;  3ITP A;  3D8G A;  5CBE E;  4DXF A;  4C1N K;  1SNC A;  4KTA A;  3MXU A;  4ZQ3 A;  4OO1 H;  5ELF A;  3NE5 B;  1CK1 A;  1B9N A;  1JE4 A;  4ZRZ A;  2K01 A;  4DNR B;  5J22 A;  1ILP A;  1LAB A;  3E6Z X;  3RLF A;  4K6L A;  1DOK A;  1PFM A;  1SYB A;  4FNF A;  5IT9 E;  1KNE A;  3Q24 A;  4A3K B;  1I4H A;  4BS9 A;  2PZT A;  4BBS B;  5EBD A;  1YNJ C;  3PUZ A;  1O7Y A;  2QCP X;  3IFT A;  2YU9 B;  2ID0 A;  2MUY A;  1NR4 A;  3Q23 A;  3PO3 B;  1BR9 A;  4BY7 B;  2RVL A;  3NQT A;  1BCP D;  4N9T A;  3D4W A;  4G57 A;  2RDH A;  4X3U A;  4OGQ C;  1EY0 A;  2EJM A;  3KUP A;  2RA4 A;  2KCC A;  2PYK A;  1DCZ A;  2TMP A;  1NR2 A;  2EVB A;  1G6Z A;  2JA5 B;  1CM9 A;  2BOS A;  2O5J C;  3R8B A;  2K5W A;  3I8Z A;  3O13 A;  2B2V C;  3K57 A;  1FR3 A;  1S5B D;  1ZXT A;  4DGZ A;  1PLF A;  5K36 G;  4IFD H;  3DUZ A;  2B2Y C;  2C9O A;  2AUJ D;  3HKZ B;  2XSC A;  2K6A A;  5AFW A;  2A69 D;  3SXH A;  1QJO A;  1PRT D;  1K8M A;  3TP5 A;  2EYM A;  3WDN A;  2Q8R E;  3NPP A;  3H91 A;  1SJH D;  5M5Y B;  3BDO A;  1ESF A;  2E75 C;  2J0T D;  4KD4 A;  1RHP A;  1OO9 B;  2HUG A;  4J8Q A;  1FNV A;  2F4I A;  1TKW B;  2NTS A;  2AWO A;  5IIF A;  4K14 A;  4UDU C;  2JSO A;  3GTQ B;  3OIP A;  3MFG A;  4XYO A;  1B1Z A;  1HQR D;  3TZD A;  1BXT A;  1S4Z A;  3JAM L;  3BYY B;  4FVM A;  3EQL C;  2Z4H A;  4ZK9 B;  5CV8 A;  2YYZ A;  3DWA A;  2D5D A;  1H9S B;  5KYL A;  5CV6 A;  4NMZ A;  3NBH A;  1EIG A;  4OIJ A;  3VR3 A;  3QO2 A;  2O2L D;  1GOZ A;  4ZUJ A;  2RKS A;  3X3N A;  3PUV A;  2NVX B;  1U4L A;  4B9W A;  1O7Z A;  3CHB D;  1X3Q A;  5JEA H;  1PFB A;  2VB2 X;  2BE5 D;  3NK9 A;  5CV5 A;  1KLU D;  2OEO A;  1A3V A;  2KEC A;  1R9T B;  3AMU A;  2CVR A;  2L1B A;  1SJE D;  2IW3 A;  4CKE A;  4C3I G;  3J81 E;  4H13 C;  1HUM A;  2NN6 I;  3P75 A;  3EJI A;  3PMF A;  5G3L D;  1ZEQ X;  4K2K A;  1J9O A;  1NAP A;  3QOL A;  1FYC A;  1QE6 A;  4PQX A;  1HCZ A;  5F2D A;  3MXN A;  5IGF A;  1BO0 A;  4ZLT F;  3M4Y A;  1I4P A;  3EA6 A;  4EQN A;  2LY7 A;  1BDO A;  5M5W B;  1SNM A;  1XYI A;  1KDB A;  2ICE C;  4DXG A;  1BQQ T;  2A6E C;  4A93 B;  5JEA J;  3KK7 A;  3VR6 A;  1TY2 A;  4ZYS A;  5JAV A;  3PIP 3;  1JWU D;  2EYJ A;  2MHV A;  2CW0 D;  1H9J A;  1SYD A;  2F3W A;  3F2U A;  5I2Y A;  4UAI A;  3MC0 B;  3HOU B;  3GV3 A;  5D14 A;  4Z9C B;  3SHL A;  1EWH A;  2R6G A;  1CTM A;  1L0Y B;  1EZ6 A;  2FFK B;  2JEB I;  3S1M B;  3M7N A;  4HCS A;  2NVQ B;  3L3O C;  4ABN A;  5DM7 3;  4A3F B;  1PZK D;  1HQM C;  1OXX K;  4U68 A;  4QB4 A;  4KN4 C;  2FIN B;  4CJ0 B;  2F0D A;  4H7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...