5G3LD

Escherichia coli heat labile enterotoxin type iib b-pentamer complexed with sialylated sugar
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAAAVLSGMRVNMCASPASSPNVIWAIELEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN IIB, B CHAIN
publication title Biochemical and Structural Characterization of the Novel Sialic Acid-Binding Site of Escherichia Coli Heat-Labile Enterotoxin Lt-Iib.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 98
sequence length 99
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2016-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5g3lD00
4FP5D 5G3LF 4FO2A 5G3LD 4FNFA 1QB5D 1QCBD 1TIID
chains in the Genus database with same CATH superfamily
2A6HD 1VQOA 1J5EL 5EBDA 1ILQA 2F4VQ 3VYRA 3N6RA 5D3IB 5EAYA 3H94A 3N52A 4JI1Q 3IAYA 5J39A 1PDQA 1Q90A 2TMPA 4K6LA 2E2JH 5M5XB 3KDFA 3V05A 1VQIA 4JI5L 1VQCA 1ICWA 2N49A 3BU2A 1FNWA 2HUGA 1IBLQ 4R4CA 2H1EA 1MGSA 2MGSA 4AYBB 1HNZL 3ER0A 2JA8H 4KY6A 1V1OA 1EEFD 3PIP3 1I6HB 1A3TA 5F2DA 2CW0D 4JC0A 3SDZA 3V96A 5C4XH 3VR4A 3H0GH 5LL6S 1V1QA 3KUPA 4C2MH 4LWCA 2KCNA 1WI5A 2C9OA 1JOQA 2QEXA 1PMRA 4ULLA 4FYDA 3U9OA 1HQRD 2RSOA 2N3SA 2AUKA 1GUWA 1FD7D 2MJ8A 5KNDA 4CDCC 1DOMA 4JYAL 2PNRC 4DV0L 4N9TA 4IUVA 2IY5B 1B1ZA 3GTQB 3OW2A 3S14H 1JB3A 2EQSA 4RHRA 3GTPB 3CPWA 3SXHA 5IT9c 2B2YA 1NAPA 2L55A 2A6EC 1S5FD 1UNSA 4PQXA 2RCNA 3ZYYX 4HIKA 2UXCL 2SOBA 4GN5A 4LF9Q 5ELFA 1A0IA 2PW7A 1JE5A 3BG3A 2GVAA 1Z9FA 2WV6D 3GTMB 2Q2IA 3A5UA 4OWWB 4KHPL 4GN3B 1N33Q 1QZHA 4C3IG 1QNUA 3L2PA 3J7A5 2PZWA 5KYIA 5KGUA 1SE8A 3KLRA 5C3XA 1R9TB 1K3RA 2Z1CA 1OXSC 2F0TA 1QCBD 3MXUA 2K01A 2KA7A 4HAEA 4KK7A 1UEAB 3ULPA 3CC2A 1TY0A 4F7XA 2B2WC 5FO7B 1GUNA 1II3A 5DEHA 1D7QA 3PIPA 1HR0W 1LTRD 1QE6A 1ESFA 3EA6A 2NZ1D 3D0FA 1I6HH 1FNVA 4AH6A 5IWAQ 2BDNA 2QILA 5I6YA 3J7AF 1G6PA 3I4OA 3K8AA 1BBXC 1PRTD 1NCVA 2R7ZG 1RIPA 1SFOB 1X3PA 1MKHA 1Y1VG 4N9PA 3HOYB 4X62L 1HXYD 3M85A 3V2TA 5CV8A 2FMMA 5IGBA 1JWUD 5AFWA 1KNEA 1K83H 4JOIA 3OOCA 5FJ8G 1CK1A 1VQ5A 4NXNL 5JEAH 1X3FA 1ENFA 1Q8IA 4KTAA 3OWFA 4TKOB 4X64L 2HDMA 1KQSA 3HOZH 1SYCA 1LV9A 1M90C 1RKNA 2F3WA 1A8VA 2MUYA 5JVH3 1GOZA 1K28A 4JBWA 3AMUA 2R92G 1X9NA 4HIMA 2LXJA 4I7AA 2DJFC 2MO1A 4LF8Q 4Q5VA 3S2HH 4DR1L 1TS3A 1HHVA 3D8GA 3NE5B 3NP8A 3J80L 3Q8DA 4BBSG 3QJYA 2RCFA 1FGUA 1PFNA 3CKIB 3UDIA 3KJOA 3Q24A 1A2UA 2XTIA 1SNMA 1J9OA 2O5JC 1G8ZD 4X66L 1R9TH 3G48A 1Z6HA 2DNCA 1QWYA 2R6GA 3URYA 5GADC 1KC8C 2HCIA 2WP8J 2JYOA 2NWGA 1BNZA 5C3WA 1CT1D 3HKSA 5C44H 2NZOA 3OTOQ 2WB1B 1KRTA 3R3OA 4A3GG 3PIO3 3MVVA 5I6WA 2ZTDA 4YCVA 2B63B 1V9PA 1I50B 4KMUC 2BH2A 4L5QA 4DAYA 1DZ1A 1SAPA 4K8JA 5KEEA 4FNFA 2UUCQ 2K7VA 1SFOH 1K0SA 1BCPD 2A68D 3NUCA 3CCMA 1RODA 1XMOL 4KHVA 4DU9A 2ZXRA 1TWHB 3I4LA 1WFQA 2VUMG 1LTGD 2ZTEA 1CUKA 4XDXA 2HHHL 1GO3E 4JV5L 5C0XG 1LTBD 2EYOA 1KXLA 5E1FA 4DR5L 3VA7A 2F0GA 1IYJB 1SDFA 4GLAC 1K3BC 1VQHA 4DR3Q 3CCQA 3PF5A 1X3GA 3J80E 3HOUG 5JEAJ 1Q86C 3CCEA 1JICA 1IBMQ 1RDPD 1AE3A 1JCKB 3OMCA 5EJWA 1WTXA 1BQQT 3TP6A 4H13C 4DNRB 3VR6A 1PXUA 3R2IA 2MHVA 5CORA 5EKIA 3C1EA 1IHZA 4LUZA 1Q46A 1H9MA 1XMQQ 3NWTA 3W1BA 5IYBG 1K9MC 1O7ZA 2Z0SA 3PIOA 4XYOA 5LMUQ 4M8AA 2IX0A 2VB3X 3CCVA 2A6ED 1Q82C 3HFZB 2MPMA 4L8JA 4KN4C 1TU2B 4B3SL 3KOJA 4J8QA 1K8OA 3RN5A 4MTKA 4A3BG 1SNOA 4DF7A 1VQ4A 2H5XA 2C35B 4HJ9A 2KUMA 1YNXA 5M5WH 1IZ6A 1TWCH 3GTJB 3MHBA 2B8GA 3GTOH 1GVPA 3HS0C 1Q3LA 4P72A 4DV2Q 2B2WA 1TWAH 4GZYC 3CRKC 3JAML 4OL7A 4PG3A 4DUZQ 3ND8A 1JJGA 2K75A 3CQZH 3CCLA 1HTPA 4GKKL 1BBUA 4OO1G 2EYLA 4F87A 2YU9B 4LFAQ 3EQLC 4CKEA 2JEAI 4DV6Q 5HGQA 1QUQB 4YWMA 5GROA 2JN4A 4A3JB 2PI2A 4X3SA 1HA6A 4QUCA 2IHFA 4UDUC 1QG7A 1QNKA 4BY7G 4A3MB 3TQYA 4X3UA 3WWVA 2JSOA 4H44C 1Q12A 3A56A 3D4WA 1PFBA 1H9KA 2KHIA 2XIWA 2SNMA 4YY3L 4GLXA 1PYBA 3M3YH 1A3VA 3L3OC 4GLVB 4JI2Q 3C46A 1HR0L 3H3VC 2ZM6Q 4HCEA 3HOWG 4DR6Q 4A3EG 2HDLA 2UUBL 2KCTA 2K5VA 2WKDA 3PMFA 1PH3A 4JI8Q 4FXKC 3A8JE 4ZYSA 3R2TA 4YHHQ 1Y1WG 2EYPA 3K7AB 4GN4B 3I3CA 1PVOA 3A54A 3SK5A 4RGMA 1SMYC 1WJJA 5J22A 2K52A 2UXDL 3TMEA 3S2DH 4IJLA 3GTJH 1BXTA 2D0PA 2R3ZA 4L63B 2A69C 3T53B 3BVGA 1D5MC 2A8VA 1YEZA 4G57A 4X6AH 4A93B 3JAME 1TS5A 2FFKB 1MHWC 3BYYB 2L11A 1KD1C 1WD0A 3SK8A 2YTYA 4IUQA 2IJ0A 5JPMC 4R1JA 2R93H 2QF7A 3TP5A 4LUOA 4HJAA 2PZUA 3TN2A 4A3JH 1WTOA 1JWSD 1OTCA 5D65A 2QA4A 4A3CH 4JI6Q 5CBAE 4A3MH 2P5ZX 4APVA 2LKVA 3HOXH 1EY5A 2QW7A 3PUYA 2EOTA 4UAIA 2KHJA 5FK9C 1HUMA 1GUTA 2F0IA 1EYDA 4JG2A 1V8QA 3M4OB 1MJEA 5C6AA 4QQBX 3OPOA 1EZ6A 4BY1B 3NWSA 5ELCA 2OWOA 1V43A 5CV6A 3IRBA 4FF3A 1F77A 3S17H 5IYDG 2Q2HA 3NBHA 1XNRQ 5FLMG 3K7AH 1K8GA 5LMNL 4WRDA 5K36H 3LX0A 2EJFC 1DCZA 1SE2A 3S16H 3T4AC 1VMPA 1KDAA 3P7JA 4RG1A 4JI6L 1PTOC 3RMHA 5FLXc 4LF4L 1D1KA 3TS2A 2JA7B 3QOJA 1TWGB 4XXEA 3ND9A 4HIOA 3FKIB 2OXPA 4U673 1I4QA 1LTSD 1CSPA 3HG9A 5I2XA 4A3DB 1CSQA 3H15A 4BA2I 1EU3A 4S3SA 1KTKA 1BKBA 1TKWB 2JXMB 2K5QA 3GD7A 1SJHD 1AW7A 2F0EA 1QOHA 5M3FB 3BS1A 4FXDA 2AHOB 4HMIA 2FINB 2AQ2B 2NVQB 5DM73 4FO2A 5EPJA 4H0LC 1QVGA 2OQKA 5DNFA 3TZDA 5KNBA 2VB2X 4LW1A 1TWFH 3QG1A 1WTVA 1EWCA 1YHQA 3VDYA 1Q7YC 1Q81C 3I56A 1X3QA 1YBYA 1X65A 3PUZA 3I4MH 3W3AA 3M4QA 2RHQB 4BWGB 4CHTB 5CMDA 3UI2A 1BUVT 2G5DA 3AFQA 3DWAA 4TVAB 3H6MA 1DXMA 4C3HG 2WAQB 2L15A 1EIYB 4ILWA 4CJ0B 4HEDA 2F0LA 1A15A 1E2ZA 1SJED 5HURA 5CV5A 4DK0A 2E2HH 1N32L 1UE5A 4IALA 3FMCA 4MTNA 4DAPA 4Y52H 1PZID 2JA5G 5JJIA 1NR4A 1E7ZA 1LO5D 2FJ2A 1TS2A 4KLKA 5BR8L 2JA7H 3PO2G 1TWGH 1CQVA 3CMAA 4PMWA 3TREA 3I4NB 3SE0A 2E5LQ 1AP0A 1FJGQ 4BBRG 5CV9A 1IXRA 4FF1A 3OMGA 5IGGA 1PFSA 4F88A 4A3DH 4JI0L 3DM1A 3DM3A 1AH9A 2WACA 3H0GB 2ZJQA 3NTKA 5IT9L 1IKMA 4AQYL 4FF2A 2Y0SG 1D8LA 4A3KG 1B9MA 1SMYD 3IFDA 1V1PA 3E0JA 2SDFA 3CMEA 4IPCA 3DMUA 1WTPA 5DLQE 5J1ZA 4HIDA 3LNNA 4IUNA 3X3MA 5I9OA 3BDLA 4JI5Q 2A69D 2JA6G 1AZPA 3NBIA 3FPUB 1BOSA 1VQ6A 3ERQA 4XYQA 3NENA 2D5DA 3BVMA 1HNZQ 4KJOA 5I9PA 3J7AV 1ICFB 1HA5A 1HH2P 1SNDA 4JI4L 4IFDH 5L37A 4CDFC 2HIXA 5M9OA 2NN6I 3CPFA 2NVXH 2CWAA 1U4PA 4EQOA 3A5ZB 5C4XG 1YIJA 3RR5A 2EPBA 4QL5A 5IGFA 1PFMA 1CFMA 1MSHA 2GA4B 1BCPC 3PUXA 3KYHC 4K8IA 4KD4A 2RDFA 3ITPA 4RHSA 3F2CA 3L0OA 1FL0A 1KDCA 1EWIA 2VQFL 2PCFB 4JYAQ 4DV0Q 1HFNA 3I4NH 2Q2UA 2X6GA 3J81L 1M8AA 1PH6A 4A75A 5EKLA 5M5YH 3FPPA 2F03A 1PTOF 4JBKA 2UXCQ 2KVMA 1Z7TA 1F2MA 2M9VA 1PH2A 3O13A 4C3JG 2I5LX 3E9IA 1SEBD 1L2FA 5IT9E 3DXJC 2DGYA 4KHPQ 2Q8RE 1W6JA 3DEPA 2KCCA 3KDFB 2L1BA 2A74C 3H3VH 1K83B 1YITA 1PTOD 4RMFA 2J4XA 1YJWA 4POFA 3RZOB 3MA2B 3OHXC 3QOLA 4CJ2C 4IOAA 4ID6A 3HOZB 3P75A 4DK1A 1PYSB 4DA2A 3PSIA 1LT4D 4R4QA 1KL9A 3K5LA 1KABA 1MJCA 1NBWA 1EFWA 1JC7A 4AYBG 5KRUA 1KLGD 4YWKA 5E7NA 3S2HB 1A62A 2F0HA 2F0QA 2FHTA 1PTOB 4LNQA 1N34L 2K03A 1SSOA 1JMCA 5ELNA 1ESRA 1PYWD 1Y8PB 1JB7A 4LF5L 5FKAC 1K0RA 4X62Q 2RQXA 4YCWA 4HCSA 3K0XA 1EIFA 4RKLA 4PMCA 4IFDJ 1G6ZA 4NXNQ 3Q6SA 2LY7A 5CV7A 1PH1A 1NMGA 4X64Q 1VQ9A 1Y69U 1B70B 1PRTF 3J81E 5C44B 3S1MB 2VY3A 3QWNA 3GTKH 2MNAA 2PMZE 2B39A 4O0AA 2VZAA 5D14A 1WTRA 1HJPA 3STBC 4OIJA 2EYJA 3GO5A 4F8MA 1CHQD 4XT3B 2OTLA 1STEA 4DR1Q 1ASYA 1DGSA 2D2CC 4DV4L 4DV3Q 4J6HA 2J7ZA 3J81j 3NPPA 4DK3C 4AYBE 4HJ7A 4X3KA 1F9PA 5C5LA 3F2BA 4WJ3M 1Y8NB 3DWQA 4JBJA 3PF4A 4X66Q 3A8KE 4QY7A 4V0BA 4C56C 3RZOH 2QCPX 1JJCB 1MSGA 2RDGA 1Y14B 4KKTA 2M00A 4K5VA 1TQOA 2NZHA 1LTLA 2E2DC 2F0DA 4FDBA 2F0UA 4DXFA 4ALPA 4C3IH 1PRTB 2F0KA 4BS9A 4DV3L 1PTOH 1WCMG 1CKNA 3M9BA 4DV5L 2MFIA 2JK8A 2XN9C 3TP7A 1ZEQX 3LGJA 3CU7A 1A3UA 4KN7C 2EY5A 2OF1A 5KYLA 3HOYG 3OIQA 1XMOQ 3RZDH 3PQIA 4GKJQ 1VQBA 5HGTA 1BF4A 3A8IE 4PNYA 3T1YL 1STBA 4QB4A 2HHHQ 4JV5Q 3JC66 1I3QB 1UE7A 3E3XA 3G6JB 1U4LA 3S1MH 1BCPF 4DR5Q 1G291 3OYYA 1CKNB 1NY4A 5FJ8H 2VUMB 3ERSX 1RHPA 2DJGC 5CGKA 1LT5D 2F0OA 1LT6D 3W2DA 3C2PA 4QIWE 1D5ZC 3WDNA 5IP7G 1STYA 5M5WB 1TWCB 3IKJA 2R92H 4ZCKA 3TBIB 3ULJA 3KF8A 1SYGA 1PH8A 3KBXA 4GKJL 1N8RC 1VMCA 4V190 3GTOB 3TSSA 3S1QH 2CQOA 5IYCG 2K5HA 4WJ4A 1GXDC 1PLFA 4TRDA 4A3LH 4BBSH 1KDBA 1I4RA 1TWAB 2PZTA 5GAHC 2AMCB 5BN3A 4GS3A 3CQZB 3TP8A 2A5HA 4DAYB 1M4VA 2IX3A 2WB1G 3VA5A 5C4JB 1BCPB 3MXGA 1SE3A 3CC7A 1FR3A 2B63G 4WJWA 3D6WA 4WORA 4DNIA 1EYCA 4B3SQ 4E6IA 1EOVA 1Q1EA 3KF8B 1RTOA 2JP1A 3R93A 2B8FA 2F4IA 4A3GH 1U9RA 1XXGA 3QO2A 4ZUIA 4BXXG 4RGNA 1TXYA 4CJ1B 3G6EA 5C3EB 3M3YB 3PGZA 4I65A 2PPBC 2K14A 1T5XD 1I3QH 3TEHB 1G2SA 4Q0FA 4RAUC 4RCOA 1BDOA 2Z4IA 3GDEA 1KRSA 2HQLA 2F0MA 3UE0A 3TS0A 4GKKQ 1PH7A 2JQOA 4ME5A 3RLFA 4L6TB 4LUVA 1S3OA 2Q8IB 2VUMH 5EBCA 5IE8A 1I5FA 2G9DA 2Z9HA 1STAA 2EDGA 1X56A 5C0XH 5CC4A 3S2DB 4B08A 2IWHA 1XNQL 2PNHA 1E1TA 4B9WA 4B3RL 5IY0A 1LTTD 3OW7A 4ODGA 1E0BA 4DUYL 1WVLA 3BJUA 2CWPA 4YY3Q 1HQMC 4OEMB 4P73A 2YYZA 1KHIA 4B3ML 4JBMA 3ONAB 2QDLA 1HR0Q 1EQTA 4X65L 1X6OA 5GAEC 4O1NA 2UUBQ 1IBKL 5C0XI 1L1OA 1AFPA 5C4JH 1SROA 2WINB 2R93B 5EPLA 3STBD 3KLSA 3NHHA 3LWUA 5ELEA 5FO8B 1TY2A 3E9HA 1ET9A 1VQGA 5IYBH 3K80C 1EQRA 1EOTA 5C4HA 2UXDQ 3EVQA 1VQNA 3I7FA 1SNCA 3FDTA 2OCEA 3HOXB 4JI3L 3QB3A 5A2QL 1MIUA 3W1GA 2F0PA 3GV6A 3D3RA 1QB5D 2ZTCA 3RNUA 2LFNA 3UDXA 5C3EH 1NJIC 1SN8A 3J7ZC 3RD4A 1VQAA 1HNXL 4A3BH 2F0JA 5FLXL 5DAUA 2B2TC 2VS1A 1ZXTA 4YWLA 1NUCA 1T9HA 2YTVA 1FVIA 1X55A 1JORA 4RA8A 2UXBL 3S17B 4C1NK 2PQAA 3K6OA 4UY8C 1XTDA 3HOVB 2BA0A 4KV6A 1K8AC 2IW3A 1XTCD 2K5NA 1S72A 1W3SA 3HEJA 5K5PA 3S16B 3F1ZA 5H1SE 2UU9Q 2K05A 2N78A 4A3IB 1E2WA 2RHSB 1VQLA 4A3CG 5G3LD 4A3MG 2EYFA 1D2BA 1VQFA 4CKBA 2XRQD 1UE6A 4U68A 4HJ5A 2BE5D 5HY6A 5CYUA 3CRLC 1ILPA 1TIID 1E3PA 3PUWA 4K6DA 4IPGA 4JVZA 5C0XJ 1M1KC 2K4KA 4N8FA 1N36L 3UDGA 1H9JA 1GUOA 3HKZG 4NKLA 1VS0A 1U5KA 1IYVA 1KAAA 1WD1A 1NNXA 1VDZA 3SK4A 2D0OA 4K5WA 4H7BA 5LMNQ 2IT1A 2NTTA 2UU9L 1RD9D 3DLLA 1SXTA 2A73B 1HNWQ 2KJXA 3HOWH 2F3IA 4A3EH 4DR4L 2B2UA 1TWFB 4LF4Q 1PH5A 3WOEA 4R9WA 2RBMA 2ASBA 3GV3A 4OONA 5A2QE 1K73C 4FXGC 2X69A 3NSWA 3F2UA 1CZWA 3I4MB 2L4NA 2VW9A 3H91A 2I5HA 2ENBA 5FLXE 4HN7A 1AZQA 4A93G 3EROA 2NVTH 1ENAA 2LSSA 4ZLTF 2RSNA 3G7LA 3JAMc 5ELDA 1I4GA 4OX9L 3HOVH 3M4YA 3D31A 1LACA 1VQ8A 5D3DA 2E2HB 1HNWL 5IP9G 3K57A 3BZDB 2PQEA 3SEBA 2ZXPA 4A3IH 3I91A 1EYGA 3LWEA 2BCOA 3HKZE 3EBEA 2K6AA 2SEBD 1HTLD 1EZ8A 4PZ6A 2DY8A 3KK7A 1IL2A 2G9HD 3I2ZA 1Q1BA 2E76C 3GP7A 4QUFA 1PZJD 1C48A 2EXDA 3NBHB 3U9SA 2JEBI 5IODA 2B2VC 2F52A 4MN3A 3NTIA 1LM0A 4BY1G 1HCZA 2XWJB 4RH6A 4FVMA 2JA9A 2HQEA 4L5RC 1CKMA 4R4IA 2EYHA 1YNJC 2PYKA 1MBYA 4NB3A 2J0TD 1UWVA 4NP5A 1N32Q 2F0SA 3TRZA 1HUNA 4DV1L 3S24A 1EEID 2ICEC 3EN2A 1I4XA 5AJ3L 3AB9A 1SYDA 2IHEA 1H95A 2F0NA 1CKOA 1S40A 1HFGA 1S5BD 1UEBA 2IL8A 4G4KA 5FLMH 5BR8Q 3Q23A 2EZVA 1JE4A 4OWTB 2QGQA 2JA7G 1CQFA 2EY6A 4PZ7A 1B53A 1S4ZA 4K2LA 3FKIG 5KNCA 1EFID 2B3GA 3T1HL 1F2LA 1LLRD 1VQMA 1DJRD 2YTXA 2MO0A 1YNNC 4JI0Q 4XQJA 1R4PB 2NVXB 1JWMD 3R8BA 3PO3B 3B6YA 4XQNA 5M3MB 1I4PA 4PZ8A 5M3FG 4XTCS 2A19A 1IYUA 2L12A 3AFPA 1JR0D 4OHJA 1AEXA 4AQYQ 1FGBD 3S15B 1QJOA 4R4OA 2NN6G 1NMFA 3EFXD 1WYDA 4J15A 4DAMA 3KFUA 5IIFA 1F2ZA 1GKHA 4DK6C 5IGCA 3I8ZA 4JI7L 1L0WA 2Z4HA 3I70A 1C4QA 2B2TA 2OT2A 3S1RB 3VYTA 3I72A 4IUUA 2CKZB 4RKBA 2K50A 3I73A 3M7NA 5M5YB 4JI4Q 1RF2D 4JW0A 4X3TA 2WAQG 4DFAA 1OO9B 4DXGA 1C0AA 2FXQA 1X54A 3DWPA 4TSSA 1I94L 2KOLA 2UUAL 4A3FB 3T13A 4DR7L 4RCNA 3KBGA 1HZBA 1X3EA 3GQBA 4IUTA 4ABNA 2EJGC 2K04A 4C3HH 1ZYRD 3CCRA 3BDCA 1H9SA 3U4VA 4FF4A 2VQFQ 3MAQA 3AQQA 3J80i 2KECA 2RKSA 3I4NG 1G51A 1GJXA 1L0XB 1SYBA 1WTQA 3G71A 1LUZA 2LMCB 3GTLH 2JA5H 4DR2L 1UE1A 5E4XA 2MQHA 2JA8G 4LF6L 5IGEA 3AU7A 4TQUS 3CCUA 3PO3H 1XYIA 5M3MH 1STNA 1V1PB 2E75C 3H0GG 2EIFA 3BDOA 4BBRH 1H9SB 3S15H 4ZUJA 3VR5A 1EY6A 1HZAA 2EY1A 4DV7L 4IUPA 3HRZC 4IFDI 2HIVA 4EQPA 1PHJA 5EQ0A 1R4QB 2M2LA 4C3JB 2Y0SE 2D62A 1STHA 3S1RH 2K1BA 2Z6KC 5EGTA 4RGTA 3GTKB 4P2CB 4A3KH 3E0EA 2KEEA 3PCOB 1HZCA 1P16A 2PMZB 4DGZA 1YJ9A 3AYHB 5CBEE 3CHBD 1XJVA 4NXMQ 2BOSA 1VQPA 3RUZA 1N34Q 2JA6H 2KEDA 1O78A 2ALYB 4A3FH 1P8LA 4QF4A 2OEOA 2KBNA 1B2TA 2C5CA 4LF5Q 3MFYA 2NB0A 3J7YW 3VYUA 4ZQ3A 5JJLA 3CCSA 1HZ9A 2I46A 1YHBA 1Z47A 1MD2D 4I7ZC 2R61A 5ELOA 4N8X1 5FO9B 1BVSA 3GTGB 1B3QA 4ZAIA 1D1IA 2B2VA 4C3IB 3S1NH 1SNQA 4J1MA 2F4VL 3I90A 4JI1L 4ZKCB 4NXML 3KJPA 2ZT9C 3H3VI 4DV4Q 2SNSA 2TSSA 4CDDC 1IL8A 1A63A 2L9HA 3CAMA 1YNJD 4CGYB 2EYMA 2VQEQ 3D4RA 1RCVD 2N8NA 3RLNA 1DYQA 4IOCA 4IPHA 2IX1A 2I5MX 4L5SA 4G7ZC 1IBLL 3VR2A 1RJTA 3RZDB 4LFCQ 2X6LA 3NTHA 2VXWA 4NDXA 2DY7A 5JPNC 1EWHA 5JEAG 4GNXC 4C3JH 4Y7NH 4HSVA 1GHKA 4MNOA 3HOZG 2OTJA 1JOOA 2R7ZB 4EGVA 4UP8A 1XPRA 2NBFA 4ME3A 2AQ1B 1Y1VB 2DNEA 4ZRZA 4EVOA 3OWEB 1F2YA 4G7OC 3WOFA 1L1OC 4IN3A 1YNND 5DM63 1IKLA 4WFN3 2XNAC 5KIXA 2XGTA 1YHAA 5M5XH 1CHPD 1BBWA 4EX5A 2VQEL 3JAMi 4DV5Q 1FNUA 2PO4A 3CXCA 4GOPC 4QIWB 2O2LD 2R92B 3NXWA 1O7YA 4OGQC 4CDEC 3HZXA 4LFCL 3S1QB 4P75A 4XQQA 4DNTB 1U4RA 5TSSA 4LF9L 1O7LA 4BBSB 1WCMB 3SK6A 3QR8A 3T1YQ 1CA5A 4FP5D 3Q0AA 3GTGH 2O4XA 3UDFA 2O5IC 5IOCA 5C44G 1N33L 1ZKOA 4KI0A 1C7YA 3J81c 4BA1I 1A6XA 2YV5A 3A74A 1J8IA 4JK1C 1NE3A 5CR3A 4OXPA 3W5OA 4LFBQ 1O80A 3GTQH 4A3GB 1QVCA 4R8NA 4K0KQ 3GTPH 1I6VC 2BE5C 2DUDA 2E74C 1EQQA 2VNUD 2XVSA 5ELBA 4LAAA 5IWAL 4DAVA 2HT1A 4A3LG 2R7ZH 1Y1VH 1AN8A 3M7GA 3GTMH 4HR7B 2LS01 3BZKA 5C4ZA 3UE1A 1YVCA 4KY5A 1JOKA 2HD3A 1VQ7A 2GVBA 1ML0D 3OSOA 3SHLA 2FMCA 3BVZA 4LFBL 1EQVA 1LYLA 2IPKD 2NVYB 5BN4A 4K0KL 2B2UC 2JJQA 1SNPA 1GUSA 2QEJC 1C8CA 2RVLA 3K81C 1EL0A 1G91A 4JCVE 4LF8L 1YI2A 1YZ6A 4OELB 4RWSC 3HOUB 3MC0B 5JAVA 1WCMH 1B9NA 4MHEA 5GQOA 3TDQA 2Z6KA 3NQIA 2ES2A 1SE4A 3HOYH 4KHZA 1LT3D 5LMNW 5E3FA 2BH8A 1PV4A 1D6EC 3KF6A 4LK1C 1F9QA 4XIGS 2EXZA 3IFTA 5NUCA 2D9UA 1AE2A 2XSCA 2EJMA 1Q8KA 3H09A 3NK9A 3OTOL 4NPSA 1XNQQ 2K28A 2CFMA 1SYFA 2E2IB 4K2KA 4B3RQ 4L5TA 2CVRA 3T51B 4DUYQ 4IZ8A 1FYCA 1VQEA 4B3MQ 2K33A 4A3BB 4X65Q 3K58A 3HP3A 1MI2A 5IP7H 2QKIC 1O7IA 2UUCL 3KF6B 1CTMA 1DM0B 1H9RA 4A4IA 1VF5C 1IBKQ 3AEVA 2Q8TA 4A76A 5IYCH 4B3TQ 3L9AX 2F3VA 4XT1B 2V4DA 4EQNA 2WB1E 4DN4M 4KKSA 2NVYH 1EU4A 1T5EA 5GAGC 4QCLA 3J80c 3K5MA 5JVG3 1SYEA 5T1IA 5FOBB 1RTNA 3PUVA 2ID0A 4UPAA 2ICIA 2AWOA 4JI3Q 2AQ3B 4GNXA 2B63H 1I50H 1NR2A 2E8GA 3MZ5A 1PH9A 1GD7A 2LXKA 2R7FA 4UP7A 2I0QA 3HOUH 5C3EG 4DR3L 1HNXQ 3CF5A 5T1GA 4BY7B 1IBML 2F1MA 2QDBA 3S9WA 1GUGA 1N9WA 1QUQA 3X3NA 2UXBQ 1HPCA 1KIXA 1PA6A 4BXXH 4LMQD 4B3TL 1VCIA 1SLJA 1IW7C 1TWHH 4G7HC 2XRSD 4KD3A 2EVBA 1LTID 3MXPA 3HOWB 1XMQL 4GOPA 4A3EB 1JJ2A 3MEHA 4GNXB 4UHVA 4CKCA 5LMUL 1W2BA 2N88A 4NMZA 2E2IH 3CCJA 3QIAA 1Y1WB 4CBVA 3G4SA 1GHJA 2KCMA 4LF7Q 1SRUA 1L1OB 4R8IA 4ZK9B 1CA6A 1F9SA 1C9OA 1Y8OB 2NVTB 1KLUD 3A7LA 3F8TA 5G3LF 4DKAC 3RN2A 4HMJA 1N36Q 1EY9A 1CI3M 4P71A 1HRJA 4GOPB 2CH4W 2F0VA 4HSPA 2R93G 4DV2L 1ZYRC 2WFWA 4A3JG 2R7DA 3A55A 4DUZL 1OXVA 2VL6A 4DR4Q 1STGA 1NTGA 1TS4A 4MZ9A 4OO1H 1JQYD 2BDOA 3E6ZX 3HKZB 5CV4A 1UAPA 3HOXG 3FRPB 4LFAL 1VQJA 3D4DA 1XWEA 5JOBA 4DV6L 1S5CD 4LF7L 3CP0A 4RFBA 1ASZA 3CC4A 2PQAB 4R4TA 1LTAD 4BY7H 3Q22A 3ICEA 1SR3A 1TVXA 4QJFA 1UUPA 1XPUA 4OX9Q 1EUJA 5COYA 1J6QA 3HOVG 4OO1I 3D6CA 1B4OA 3FHWA 4KJNA 3C1FA 4NW2A 4JI2L 5K36G 2ZM6L 2ATWA 3L7ZC 3MXNA 4DR6L 1B50A 4A3IG 1B44D 1KAWA 3NEMA 4JI8L 1QZGA 5LHY1 1ET6A 1TR5A 1Y1WH 2NUCA 2YU9H 2ZXOA 4B9XA 4YHHL 2Q2TA 4KY7A 1D5XC 2N55A 1DONA 2A6HC 1A2TA 4HTHA 3CW2C 3K5OA 5J3BA 3MEFA 1F9RA 4OIKA 2K32A 2CCZA 1PH4A 3MFGA 4Z9CB 3MXNB 4OWXB 2KHSA 1ONLA 3SGIA 1OXXK 2KQ3A 1VQDA 1NSNS 5EPKA 4EQ5A 1XPOA 3J81i 4DV1Q 2AKWB 5AJ3Q 3K59A 1E1OA 2WKCA 1EY8A 2NYZD 4IQZA 3F2DA 2PI2E 2CW0C 2KENA 3TZUA 4PMBA 3SVMA 5BN5A 4POGA 1RL2A 2BA1A 1TT2A 3I4MG 1OXUA 2ZJPA 5LL6X 3E5SA 2ZJRA 4YCUA 1L0YB 4ZKBB 3T1HQ 2I07B 1DOLA 2RF4A 3FVQA 1VQKA 1E2VA 1B8AA 4O2DA 1W6KA 1JT8A 2XWBB 4K14A 3BYTB 4C3HB 1U0LA 2B29A 4K5XA 2PW5A 4P74A 4A93H 2A1AA 1EIHA 2GN5A 1VF7A 1U4MA 5IYDH 2B2YC 3NELA 4YIJA 1XNRL 1E24A 3U4ZA 1WTWA 4JI7Q 1G2TA 3KLSX 2EE1A 1I4HA 5IP9H 1ENCA 2CHBD 3GTLB 3MWYW 2JA5B 2L0CA 2RA4A 4A3DG 3I55A 1K8MA 3FP9A 4UP9A 2HCCA 3PO2B 1SBBB 4IPDA 1WTHA 1I94Q 1QILA 3MTSA 2UUAQ 3RLOA 2EY2A 1IW7D 4BBRB 3EJIA 4O42A 4DR7Q 4M1UB 3DHQA 3DEOA 3SR1A 3M4OH 3K7UC 5I4DA 4IO9A 2AUJD 3BZCA 3ZJYC 2RDHA 1B3AA 4BY1H 2NTSA 1X32A 1XX8A 1EY7A 3ULLA 2DN8A 1PRTC 3OIPA 4MIUA 5JJKA 4DPGA 5A35A 2Y0SB 4A3KB 4PV1C 1EY0A 2AWNA 2L5TA 4IFDG 2Z8LA 4DR2Q 1EIGA 4LF6Q 2H4OA 1E22A 4JPBW 3U58A 2E2JB 4JOIC 2CQAA 2JA6B 3PO3G 5M3MG 3A7AB 3C3LA 5ISRA 3FKIH 2CH4A 3K0YA 2F0WA 1QVFA 2Z6BA 3PV0A 1EYAA 3EIVA 2MP1A 4QGUA 2JA8B 4DV7Q 1PZKD 3T56B 1SMXA 3P20A 1OXTA 1DD2A 1CM9A 5IGDA 4AIMA 5C4XB 2JE6I 3M4PA 5M3FH 1LABA 2WIIB 2K5DA 4C2MB 1KNAA 1WOCA 2K5WA 3S1NB 4KKUA 5EKKA 1GM5A 2NVQH 4LJZC 2NN6H 3HGBA 1J5EQ 3IL8A 3KLWA 3A0JA 5C5MA 5I2YA 3VR3A 1BO0A 4C1NI 1S5ED 5JJZA 3PO2H 3K5NA 3CD6A 4RGOS 3FEWX 4A3FG 2E5LL 1YJNA 1FJGL 3S14B 4IJHA 3P1HA 3U50C 2WAQE 4HJ8A 3DUZA 3T16A 4IURA 1DOKA 1CZGA 1S5DD 2OQ0A 1B7YB 4H02A 4QMGA 2V1CC 4Y7NB 3VYSA 1EY4A 2F0FA 3NQTA 2A68C 1BR9A 5E4WC
chains in the Genus database with same CATH topology
2A6HD 5EBDA 1ILQA 3VYRA 3N6RA 5D3IB 3H94A 3N52A 3IAYA 5J39A 1PDQA 1Q90A 2TMPA 4K6LA 5M5XB 3V05A 1ICWA 1FNWA 2HUGA 2H1EA 1MGSA 2MGSA 4AYBB 4KY6A 1V1OA 1EEFD 3PIP3 1I6HB 3SDZA 1A3TA 2CW0D 5F2DA 3V96A 3VR4A 5LL6S 3KUPA 2KCNA 2C9OA 1JOQA 1PMRA 4ULLA 4FYDA 3U9OA 1HQRD 2RSOA 2AUKA 1GUWA 1FD7D 2MJ8A 5KNDA 1DOMA 2PNRC 4N9TA 4IUVA 1B1ZA 3GTQB 1JB3A 4RHRA 3GTPB 3SXHA 2B2YA 1NAPA 2L55A 2A6EC 1S5FD 1UNSA 4PQXA 3ZYYX 2SOBA 5ELFA 2PW7A 3BG3A 2WV6D 3GTMB 4C3IG 1QNUA 2PZWA 5KYIA 5KGUA 3KLRA 5C3XA 1R9TB 2Z1CA 1OXSC 2F0TA 1QCBD 3MXUA 2K01A 2KA7A 4HAEA 4KK7A 1UEAB 1TY0A 4F7XA 2B2WC 5FO7B 1GUNA 1II3A 5DEHA 1LTRD 1QE6A 1ESFA 3EA6A 2NZ1D 1FNVA 2BDNA 2QILA 5I6YA 3J7AF 1BBXC 1PRTD 1NCVA 1SFOB 1X3PA 4N9PA 3HOYB 1HXYD 3M85A 3V2TA 5CV8A 2FMMA 5IGBA 1JWUD 5AFWA 1KNEA 3OOCA 1CK1A 5JEAH 1ENFA 1Q8IA 4KTAA 3OWFA 4TKOB 2HDMA 1SYCA 1LV9A 1RKNA 2F3WA 2MUYA 5JVH3 1GOZA 4JBWA 3AMUA 4Q5VA 1TS3A 1HHVA 3D8GA 3NE5B 3NP8A 3J80L 3QJYA 1PFNA 3CKIB 3Q24A 1A2UA 1SNMA 1J9OA 2O5JC 1G8ZD 1Z6HA 2DNCA 1QWYA 2R6GA 3URYA 2HCIA 2WP8J 2JYOA 2NWGA 1BNZA 5C3WA 1CT1D 2WB1B 3R3OA 3PIO3 3MVVA 5I6WA 2B63B 1I50B 4KMUC 4DAYA 1DZ1A 1SAPA 4K8JA 5KEEA 4FNFA 2K7VA 1BCPD 2A68D 3NUCA 1RODA 4KHVA 4DU9A 2ZXRA 1TWHB 3I4LA 1LTGD 4XDXA 5C0XG 1LTBD 2EYOA 5E1FA 3VA7A 2F0GA 1SDFA 3J80E 5JEAJ 1JICA 1RDPD 1JCKB 3OMCA 5EJWA 1WTXA 1BQQT 3TP6A 4H13C 4DNRB 3VR6A 1PXUA 3R2IA 2MHVA 5CORA 5EKIA 3C1EA 1IHZA 1H9MA 3NWTA 1O7ZA 4XYOA 4M8AA 2IX0A 2VB3X 2A6ED 2MPMA 4L8JA 4KN4C 1TU2B 4J8QA 1K8OA 1SNOA 4DF7A 2KUMA 3GTJB 3MHBA 2B8GA 3HS0C 1Q3LA 2B2WA 4GZYC 3CRKC 3JAML 4OL7A 3ND8A 1HTPA 4OO1G 2EYLA 4F87A 2YU9B 3EQLC 4CKEA 2JEAI 4A3JB 1HA6A 4X3SA 4QUCA 4UDUC 1QG7A 1QNKA 4A3MB 4X3UA 2JSOA 4H44C 1Q12A 3A56A 3D4WA 1PFBA 1H9KA 2XIWA 2SNMA 1A3VA 3L3OC 3C46A 3H3VC 4HCEA 2HDLA 2WKDA 3PMFA 4FXKC 3A8JE 4ZYSA 3R2TA 2EYPA 3K7AB 3I3CA 3A54A 3SK5A 4RGMA 1SMYC 5J22A 3TMEA 1BXTA 2R3ZA 4L63B 2A69C 3T53B 3BVGA 1D5MC 4G57A 4A93B 3JAME 1TS5A 2FFKB 3BYYB 2L11A 1WD0A 3SK8A 4IUQA 2IJ0A 5JPMC 2QF7A 3TP5A 2PZUA 3TN2A 1WTOA 1JWSD 5D65A 5CBAE 2LKVA 1EY5A 3PUYA 2EOTA 4UAIA 5FK9C 1HUMA 1GUTA 2F0IA 1EYDA 1V8QA 3M4OB 5C6AA 3OPOA 1EZ6A 4BY1B 3NWSA 5ELCA 1V43A 5CV6A 4FF3A 1F77A 3NBHA 4WRDA 5K36H 3LX0A 2EJFC 1DCZA 1SE2A 3T4AC 1VMPA 1KDAA 3P7JA 1PTOC 3RMHA 1D1KA 2JA7B 3QOJA 1TWGB 4XXEA 3ND9A 3FKIB 2OXPA 4U673 1I4QA 1LTSD 3HG9A 5I2XA 4A3DB 4BA2I 1EU3A 4S3SA 1KTKA 1TKWB 2JXMB 2K5QA 3GD7A 1SJHD 1AW7A 2F0EA 1QOHA 5M3FB 3BS1A 4FXDA 4HMIA 2FINB 2AQ2B 2NVQB 5DM73 4FO2A 5EPJA 4H0LC 5DNFA 5KNBA 3TZDA 2VB2X 3QG1A 1WTVA 1EWCA 1X3QA 3PUZA 3W3AA 4BWGB 4CHTB 5CMDA 3UI2A 1BUVT 3DWAA 3H6MA 1DXMA 4C3HG 2WAQB 4ILWA 4CJ0B 4HEDA 2F0LA 1A15A 1E2ZA 1SJED 5HURA 5CV5A 4DK0A 4IALA 3FMCA 4DAPA 1PZID 1NR4A 1LO5D 2FJ2A 1TS2A 1CQVA 4PMWA 3I4NB 3SE0A 1AP0A 5CV9A 4FF1A 3OMGA 5IGGA 4F88A 3DM1A 2WACA 3H0GB 3NTKA 5IT9L 1IKMA 4FF2A 1B9MA 1SMYD 3IFDA 1V1PA 3E0JA 2SDFA 3DMUA 1WTPA 5J1ZA 3LNNA 4IUNA 3X3MA 5I9OA 3BDLA 2A69D 1AZPA 3NBIA 3FPUB 1BOSA 3ERQA 4XYQA 2D5DA 3BVMA 4KJOA 5I9PA 3J7AV 4IFDH 1HA5A 1SNDA 5M9OA 2NN6I 1U4PA 4EQOA 2EPBA 5IGFA 1PFMA 1CFMA 1MSHA 2GA4B 1BCPC 3PUXA 4K8IA 4KD4A 2RDFA 3ITPA 4RHSA 1KDCA 2PCFB 1HFNA 2X6GA 3J81L 1M8AA 5EKLA 3FPPA 2F03A 1PTOF 2KVMA 1Z7TA 1F2MA 2M9VA 3O13A 4C3JG 1SEBD 5IT9E 3DXJC 2Q8RE 1W6JA 3DEPA 2KCCA 2L1BA 2A74C 1K83B 1PTOD 2J4XA 3RZOB 3MA2B 3OHXC 3QOLA 4CJ2C 4ID6A 3HOZB 3P75A 4DK1A 4DA2A 1LT4D 3K5LA 1KABA 1JC7A 5KRUA 1KLGD 3S2HB 2F0HA 2F0QA 2FHTA 1PTOB 2K03A 1SSOA 1ESRA 1PYWD 1Y8PB 5FKAC 2RQXA 4HCSA 4RKLA 1G6ZA 4PMCA 4IFDJ 3Q6SA 2LY7A 5CV7A 1Y69U 1PRTF 3J81E 5C44B 3S1MB 3QWNA 2B39A 1WTRA 5D14A 4OIJA 2EYJA 3GO5A 4F8MA 1CHQD 4XT3B 1STEA 2D2CC 4J6HA 2J7ZA 3NPPA 4X3KA 1F9PA 5C5LA 1Y8NB 3DWQA 3A8KE 4V0BA 4C56C 2QCPX 1MSGA 2RDGA 4KKTA 2M00A 4K5VA 1TQOA 2E2DC 2F0DA 2F0UA 4DXFA 1PRTB 2F0KA 4BS9A 1PTOH 2XN9C 3TP7A 1ZEQX 3CU7A 1A3UA 4KN7C 2EY5A 2OF1A 5KYLA 3OIQA 5HGTA 1BF4A 3A8IE 4PNYA 1STBA 4QB4A 1I3QB 3G6JB 1U4LA 1BCPF 1G291 2VUMB 1RHPA 5CGKA 1LT5D 2F0OA 1LT6D 3W2DA 3C2PA 1D5ZC 3WDNA 1STYA 5M5WB 1TWCB 3IKJA 3TBIB 3KF8A 1SYGA 3KBXA 1VMCA 4V190 3GTOB 3TSSA 1GXDC 1PLFA 4TRDA 1KDBA 1I4RA 1TWAB 2PZTA 5BN3A 3CQZB 3TP8A 2A5HA 1M4VA 2IX3A 3VA5A 5C4JB 1BCPB 3MXGA 1SE3A 1FR3A 4WJWA 3D6WA 4WORA 1EYCA 4E6IA 1Q1EA 1RTOA 2JP1A 3R93A 2B8FA 2F4IA 1U9RA 1XXGA 3QO2A 4ZUIA 4RGNA 4CJ1B 5C3EB 3M3YB 4I65A 2PPBC 1T5XD 1G2SA 4Q0FA 4RAUC 4RCOA 1BDOA 2Z4IA 2F0MA 4ME5A 3RLFA 4L6TB 2Q8IB 5EBCA 2G9DA 1STAA 2EDGA 5C0XH 5CC4A 3S2DB 4B08A 2IWHA 4B9WA 1LTTD 3OW7A 4ODGA 1E0BA 1WVLA 1HQMC 2YYZA 3ONAB 1EQTA 4O1NA 5C0XI 1AFPA 2WINB 2R93B 5EPLA 3KLSA 3NHHA 3LWUA 5ELEA 5FO8B 1TY2A 1ET9A 1EOTA 5C4HA 3EVQA 1SNCA 3FDTA 3HOXB 5A2QL 3QB3A 2F0PA 3D3RA 3GV6A 1QB5D 2LFNA 3RD4A 2F0JA 5FLXL 5DAUA 2B2TC 1ZXTA 1NUCA 1JORA 4RA8A 3S17B 4C1NK 3K6OA 3HOVB 2BA0A 4KV6A 2IW3A 1XTCD 3HEJA 5K5PA 3S16B 2K05A 4A3IB 1E2WA 5G3LD 2EYFA 1D2BA 4CKBA 2XRQD 4U68A 2BE5D 5CYUA 3CRLC 1ILPA 1TIID 3PUWA 4K6DA 5C0XJ 1H9JA 1GUOA 4NKLA 1IYVA 1KAAA 1WD1A 1VDZA 3SK4A 4K5WA 4H7BA 2IT1A 2NTTA 1RD9D 1SXTA 2A73B 2KJXA 2B2UA 1TWFB 3WOEA 4R9WA 2RBMA 3GV3A 5A2QE 4FXGC 2X69A 3NSWA 3F2UA 1CZWA 3I4MB 2L4NA 3H91A 2ENBA 5FLXE 4HN7A 1AZQA 3EROA 1ENAA 4ZLTF 2RSNA 3G7LA 5ELDA 1I4GA 3M4YA 3D31A 1LACA 5D3DA 2E2HB 3K57A 3BZDB 2PQEA 3SEBA 2ZXPA 3I91A 3LWEA 2BCOA 2K6AA 2SEBD 1HTLD 1EZ8A 2DY8A 3KK7A 2G9HD 1Q1BA 2E76C 3GP7A 4QUFA 1PZJD 1C48A 3U9SA 2JEBI 5IODA 2B2VC 4MN3A 3NTIA 1HCZA 2XWJB 4RH6A 4FVMA 2HQEA 2EYHA 1YNJC 2PYKA 1MBYA 2J0TD 4NP5A 1HUNA 2F0SA 1EEID 2ICEC 1I4XA 3AB9A 1SYDA 2F0NA 1HFGA 1S5BD 2IL8A 4G4KA 3Q23A 2EZVA 1JE4A 1CQFA 2EY6A 1B53A 1S4ZA 4K2LA 5KNCA 1EFID 1F2LA 1LLRD 1DJRD 1YNNC 4XQJA 1R4PB 2NVXB 1JWMD 3R8BA 3PO3B 4XQNA 5M3MB 1I4PA 4XTCS 1IYUA 2L12A 1JR0D 4OHJA 1AEXA 3S15B 1FGBD 1QJOA 2NN6G 3EFXD 5IIFA 1F2ZA 5IGCA 3I8ZA 2Z4HA 3I70A 1C4QA 2B2TA 2OT2A 3S1RB 3VYTA 3I72A 4IUUA 4RKBA 3M7NA 3I73A 5M5YB 1RF2D 4X3TA 4DFAA 1OO9B 4DXGA 3DWPA 4TSSA 2KOLA 4A3FB 3T13A 4RCNA 3KBGA 4IUTA 3GQBA 4ABNA 2EJGC 2K04A 1ZYRD 3BDCA 1H9SA 4FF4A 3MAQA 2KECA 2RKSA 1GJXA 1L0XB 1SYBA 1WTQA 2LMCB 5E4XA 5IGEA 3AU7A 4TQUS 1XYIA 1STNA 1V1PB 2E75C 3BDOA 1H9SB 4ZUJA 3VR5A 1EY6A 2EY1A 4IUPA 3HRZC 4IFDI 4EQPA 5EQ0A 1R4QB 2M2LA 4C3JB 2D62A 1STHA 3GTKB 2K1BA 5EGTA 4RGTA 4P2CB 2KEEA 2PMZB 4DGZA 5CBEE 3CHBD 2BOSA 3RUZA 2KEDA 1O78A 4QF4A 2OEOA 1B2TA 2C5CA 3MFYA 2NB0A 3J7YW 3VYUA 4ZQ3A 2I46A 4I7ZC 1Z47A 1MD2D 2R61A 5FO9B 3GTGB 4ZAIA 1D1IA 2B2VA 4C3IB 1SNQA 4J1MA 3I90A 4ZKCB 2ZT9C 2SNSA 2TSSA 1IL8A 2L9HA 1YNJD 4CGYB 2EYMA 3D4RA 1RCVD 1DYQA 2IX1A 4G7ZC 3VR2A 1RJTA 3RZDB 2X6LA 3NTHA 2VXWA 4NDXA 2DY7A 5JPNC 1EWHA 5JEAG 4HSVA 1GHKA 1JOOA 2R7ZB 4EGVA 2NBFA 2AQ1B 1Y1VB 2DNEA 4ZRZA 4EVOA 3OWEB 1F2YA 4G7OC 3WOFA 4IN3A 1YNND 5DM63 1IKLA 4WFN3 2XNAC 5KIXA 1CHPD 1FNUA 2PO4A 4QIWB 2O2LD 2R92B 3NXWA 1O7YA 4OGQC 3HZXA 3S1QB 4XQQA 4DNTB 1U4RA 5TSSA 1O7LA 4BBSB 1WCMB 3SK6A 1CA5A 4FP5D 3Q0AA 2O4XA 2O5IC 5IOCA 1ZKOA 4KI0A 1A6XA 4BA1I 1J8IA 4JK1C 5CR3A 1O80A 4A3GB 4R8NA 1I6VC 2BE5C 2E74C 2VNUD 2XVSA 5ELBA 4LAAA 4DAVA 3M7GA 1AN8A 4HR7B 2LS01 5C4ZA 4KY5A 1JOKA 1ML0D 3OSOA 3SHLA 2FMCA 3BVZA 1EQVA 2IPKD 2NVYB 5BN4A 2B2UC 2QEJC 1SNPA 1GUSA 1C8CA 1EL0A 2RVLA 1G91A 4RWSC 3HOUB 3MC0B 5JAVA 4MHEA 1B9NA 3TDQA 3NQIA 1SE4A 4KHZA 1LT3D 5E3FA 1D6EC 4LK1C 1F9QA 4XIGS 2EXZA 3IFTA 5NUCA 2D9UA 2XSCA 2EJMA 3H09A 3NK9A 2K28A 1SYFA 2E2IB 4K2KA 2CVRA 3T51B 4IZ8A 1FYCA 2K33A 4A3BB 3K58A 3HP3A 1MI2A 2QKIC 1CTMA 1DM0B 1H9RA 1VF5C 2Q8TA 3L9AX 2F3VA 4XT1B 2V4DA 4EQNA 4DN4M 4KKSA 1EU4A 1T5EA 4QCLA 3K5MA 5JVG3 1SYEA 5T1IA 5FOBB 1RTNA 3PUVA 2ID0A 2ICIA 2AWOA 2AQ3B 1NR2A 3MZ5A 5T1GA 4BY7B 2F1MA 2QDBA 3S9WA 1GUGA 3X3NA 1HPCA 4LMQD 1VCIA 1IW7C 4G7HC 2XRSD 4KD3A 2EVBA 1LTID 3MXPA 3HOWB 4A3EB 3MEHA 4CKCA 2N88A 4NMZA 3QIAA 1Y1WB 4CBVA 1GHJA 4R8IA 4ZK9B 1CA6A 1F9SA 1Y8OB 2NVTB 1KLUD 3A7LA 5G3LF 4HMJA 1EY9A 1CI3M 1HRJA 2F0VA 4HSPA 1ZYRC 3A55A 1OXVA 1STGA 1TS4A 4OO1H 1JQYD 2BDOA 3E6ZX 3HKZB 5CV4A 1UAPA 3FRPB 3D4DA 1XWEA 5JOBA 1S5CD 4RFBA 1LTAD 3Q22A 1TVXA 1UUPA 5COYA 4OO1I 3D6CA 1B4OA 4KJNA 3C1FA 4NW2A 5K36G 3L7ZC 3MXNA 1B50A 1B44D 5LHY1 1ET6A 1TR5A 2NUCA 2ZXOA 4B9XA 4KY7A 1D5XC 2N55A 1DONA 2A6HC 1A2TA 4HTHA 3K5OA 1F9RA 4OIKA 2K32A 3MFGA 4Z9CB 2KHSA 1ONLA 1OXXK 2KQ3A 5EPKA 1NSNS 3K59A 2WKCA 1EY8A 2NYZD 4IQZA 2CW0C 3TZUA 4PMBA 3SVMA 5BN5A 2BA1A 1TT2A 1OXUA 5LL6X 3E5SA 1L0YB 4ZKBB 2I07B 1DOLA 3FVQA 1E2VA 1W6KA 2XWBB 4K14A 3BYTB 4C3HB 4K5XA 2PW5A 1EIHA 1VF7A 1U4MA 2B2YC 4YIJA 1WTWA 1G2TA 3KLSX 2EE1A 1I4HA 1ENCA 2CHBD 3GTLB 3MWYW 2JA5B 2L0CA 2RA4A 1K8MA 2HCCA 3PO2B 1SBBB 1QILA 3MTSA 4BBRB 2EY2A 1IW7D 3EJIA 4O42A 4M1UB 3DHQA 3DEOA 3SR1A 5I4DA 2AUJD 2RDHA 1B3AA 2NTSA 1X32A 1XX8A 1EY7A 2DN8A 1PRTC 3OIPA 4MIUA 5A35A 2Y0SB 4A3KB 4PV1C 1EY0A 2AWNA 2L5TA 4IFDG 2Z8LA 1EIGA 2H4OA 2E2JB 2CQAA 2JA6B 3A7AB 3C3LA 5ISRA 3K0YA 2F0WA 3PV0A 1EYAA 2MP1A 2JA8B 1PZKD 3T56B 3P20A 1OXTA 1DD2A 1CM9A 5IGDA 5C4XB 2JE6I 1LABA 2WIIB 2K5DA 4C2MB 1KNAA 2K5WA 3S1NB 4KKUA 5EKKA 4LJZC 2NN6H 3HGBA 3IL8A 5C5MA 5I2YA 3VR3A 1BO0A 4C1NI 1S5ED 5JJZA 3K5NA 4RGOS 3FEWX 3S14B 3P1HA 3DUZA 3T16A 4IURA 1DOKA 1CZGA 1S5DD 4QMGA 4Y7NB 3VYSA 1EY4A 2F0FA 3NQTA 2A68C 1BR9A 5E4WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FP5 D;  5G3L F;  4FO2 A;  5G3L D;  4FNF A;  1QB5 D;  1QCB D;  1TII D; 
#chains in the Genus database with same CATH topology
 2A6H D;  1VQO A;  1J5E L;  5EBD A;  1ILQ A;  2F4V Q;  3VYR A;  3N6R A;  5D3I B;  5EAY A;  3H94 A;  3N52 A;  4JI1 Q;  3IAY A;  5J39 A;  1PDQ A;  1Q90 A;  2TMP A;  4K6L A;  2E2J H;  5M5X B;  3KDF A;  3V05 A;  1VQI A;  4JI5 L;  1VQC A;  1ICW A;  2N49 A;  3BU2 A;  1FNW A;  2HUG A;  1IBL Q;  4R4C A;  2H1E A;  1MGS A;  2MGS A;  4AYB B;  1HNZ L;  3ER0 A;  2JA8 H;  4KY6 A;  1V1O A;  1EEF D;  3PIP 3;  1I6H B;  1A3T A;  5F2D A;  2CW0 D;  4JC0 A;  3SDZ A;  3V96 A;  5C4X H;  3VR4 A;  3H0G H;  5LL6 S;  1V1Q A;  3KUP A;  4C2M H;  4LWC A;  2KCN A;  1WI5 A;  2C9O A;  1JOQ A;  2QEX A;  1PMR A;  4ULL A;  4FYD A;  3U9O A;  1HQR D;  2RSO A;  2N3S A;  2AUK A;  1GUW A;  1FD7 D;  2MJ8 A;  5KND A;  4CDC C;  1DOM A;  4JYA L;  2PNR C;  4DV0 L;  4N9T A;  4IUV A;  2IY5 B;  1B1Z A;  3GTQ B;  3OW2 A;  3S14 H;  1JB3 A;  2EQS A;  4RHR A;  3GTP B;  3CPW A;  3SXH A;  5IT9 c;  2B2Y A;  1NAP A;  2L55 A;  2A6E C;  1S5F D;  1UNS A;  4PQX A;  2RCN A;  3ZYY X;  4HIK A;  2UXC L;  2SOB A;  4GN5 A;  4LF9 Q;  5ELF A;  1A0I A;  2PW7 A;  1JE5 A;  3BG3 A;  2GVA A;  1Z9F A;  2WV6 D;  3GTM B;  2Q2I A;  3A5U A;  4OWW B;  4KHP L;  4GN3 B;  1N33 Q;  1QZH A;  4C3I G;  1QNU A;  3L2P A;  3J7A 5;  2PZW A;  5KYI A;  5KGU A;  1SE8 A;  3KLR A;  5C3X A;  1R9T B;  1K3R A;  2Z1C A;  1OXS C;  2F0T A;  1QCB D;  3MXU A;  2K01 A;  2KA7 A;  4HAE A;  4KK7 A;  1UEA B;  3ULP A;  3CC2 A;  1TY0 A;  4F7X A;  2B2W C;  5FO7 B;  1GUN A;  1II3 A;  5DEH A;  1D7Q A;  3PIP A;  1HR0 W;  1LTR D;  1QE6 A;  1ESF A;  3EA6 A;  2NZ1 D;  3D0F A;  1I6H H;  1FNV A;  4AH6 A;  5IWA Q;  2BDN A;  2QIL A;  5I6Y A;  3J7A F;  1G6P A;  3I4O A;  3K8A A;  1BBX C;  1PRT D;  1NCV A;  2R7Z G;  1RIP A;  1SFO B;  1X3P A;  1MKH A;  1Y1V G;  4N9P A;  3HOY B;  4X62 L;  1HXY D;  3M85 A;  3V2T A;  5CV8 A;  2FMM A;  5IGB A;  1JWU D;  5AFW A;  1KNE A;  1K83 H;  4JOI A;  3OOC A;  5FJ8 G;  1CK1 A;  1VQ5 A;  4NXN L;  5JEA H;  1X3F A;  1ENF A;  1Q8I A;  4KTA A;  3OWF A;  4TKO B;  4X64 L;  2HDM A;  1KQS A;  3HOZ H;  1SYC A;  1LV9 A;  1M90 C;  1RKN A;  2F3W A;  1A8V A;  2MUY A;  5JVH 3;  1GOZ A;  1K28 A;  4JBW A;  3AMU A;  2R92 G;  1X9N A;  4HIM A;  2LXJ A;  4I7A A;  2DJF C;  2MO1 A;  4LF8 Q;  4Q5V A;  3S2H H;  4DR1 L;  1TS3 A;  1HHV A;  3D8G A;  3NE5 B;  3NP8 A;  3J80 L;  3Q8D A;  4BBS G;  3QJY A;  2RCF A;  1FGU A;  1PFN A;  3CKI B;  3UDI A;  3KJO A;  3Q24 A;  1A2U A;  2XTI A;  1SNM A;  1J9O A;  2O5J C;  1G8Z D;  4X66 L;  1R9T H;  3G48 A;  1Z6H A;  2DNC A;  1QWY A;  2R6G A;  3URY A;  5GAD C;  1KC8 C;  2HCI A;  2WP8 J;  2JYO A;  2NWG A;  1BNZ A;  5C3W A;  1CT1 D;  3HKS A;  5C44 H;  2NZO A;  3OTO Q;  2WB1 B;  1KRT A;  3R3O A;  4A3G G;  3PIO 3;  3MVV A;  5I6W A;  2ZTD A;  4YCV A;  2B63 B;  1V9P A;  1I50 B;  4KMU C;  2BH2 A;  4L5Q A;  4DAY A;  1DZ1 A;  1SAP A;  4K8J A;  5KEE A;  4FNF A;  2UUC Q;  2K7V A;  1SFO H;  1K0S A;  1BCP D;  2A68 D;  3NUC A;  3CCM A;  1ROD A;  1XMO L;  4KHV A;  4DU9 A;  2ZXR A;  1TWH B;  3I4L A;  1WFQ A;  2VUM G;  1LTG D;  2ZTE A;  1CUK A;  4XDX A;  2HHH L;  1GO3 E;  4JV5 L;  5C0X G;  1LTB D;  2EYO A;  1KXL A;  5E1F A;  4DR5 L;  3VA7 A;  2F0G A;  1IYJ B;  1SDF A;  4GLA C;  1K3B C;  1VQH A;  4DR3 Q;  3CCQ A;  3PF5 A;  1X3G A;  3J80 E;  3HOU G;  5JEA J;  1Q86 C;  3CCE A;  1JIC A;  1IBM Q;  1RDP D;  1AE3 A;  1JCK B;  3OMC A;  5EJW A;  1WTX A;  1BQQ T;  3TP6 A;  4H13 C;  4DNR B;  3VR6 A;  1PXU A;  3R2I A;  2MHV A;  5COR A;  5EKI A;  3C1E A;  1IHZ A;  4LUZ A;  1Q46 A;  1H9M A;  1XMQ Q;  3NWT A;  3W1B A;  5IYB G;  1K9M C;  1O7Z A;  2Z0S A;  3PIO A;  4XYO A;  5LMU Q;  4M8A A;  2IX0 A;  2VB3 X;  3CCV A;  2A6E D;  1Q82 C;  3HFZ B;  2MPM A;  4L8J A;  4KN4 C;  1TU2 B;  4B3S L;  3KOJ A;  4J8Q A;  1K8O A;  3RN5 A;  4MTK A;  4A3B G;  1SNO A;  4DF7 A;  1VQ4 A;  2H5X A;  2C35 B;  4HJ9 A;  2KUM A;  1YNX A;  5M5W H;  1IZ6 A;  1TWC H;  3GTJ B;  3MHB A;  2B8G A;  3GTO H;  1GVP A;  3HS0 C;  1Q3L A;  4P72 A;  4DV2 Q;  2B2W A;  1TWA H;  4GZY C;  3CRK C;  3JAM L;  4OL7 A;  4PG3 A;  4DUZ Q;  3ND8 A;  1JJG A;  2K75 A;  3CQZ H;  3CCL A;  1HTP A;  4GKK L;  1BBU A;  4OO1 G;  2EYL A;  4F87 A;  2YU9 B;  4LFA Q;  3EQL C;  4CKE A;  2JEA I;  4DV6 Q;  5HGQ A;  1QUQ B;  4YWM A;  5GRO A;  2JN4 A;  4A3J B;  2PI2 A;  4X3S A;  1HA6 A;  4QUC A;  2IHF A;  4UDU C;  1QG7 A;  1QNK A;  4BY7 G;  4A3M B;  3TQY A;  4X3U A;  3WWV A;  2JSO A;  4H44 C;  1Q12 A;  3A56 A;  3D4W A;  1PFB A;  1H9K A;  2KHI A;  2XIW A;  2SNM A;  4YY3 L;  4GLX A;  1PYB A;  3M3Y H;  1A3V A;  3L3O C;  4GLV B;  4JI2 Q;  3C46 A;  1HR0 L;  3H3V C;  2ZM6 Q;  4HCE A;  3HOW G;  4DR6 Q;  4A3E G;  2HDL A;  2UUB L;  2KCT A;  2K5V A;  2WKD A;  3PMF A;  1PH3 A;  4JI8 Q;  4FXK C;  3A8J E;  4ZYS A;  3R2T A;  4YHH Q;  1Y1W G;  2EYP A;  3K7A B;  4GN4 B;  3I3C A;  1PVO A;  3A54 A;  3SK5 A;  4RGM A;  1SMY C;  1WJJ A;  5J22 A;  2K52 A;  2UXD L;  3TME A;  3S2D H;  4IJL A;  3GTJ H;  1BXT A;  2D0P A;  2R3Z A;  4L63 B;  2A69 C;  3T53 B;  3BVG A;  1D5M C;  2A8V A;  1YEZ A;  4G57 A;  4X6A H;  4A93 B;  3JAM E;  1TS5 A;  2FFK B;  1MHW C;  3BYY B;  2L11 A;  1KD1 C;  1WD0 A;  3SK8 A;  2YTY A;  4IUQ A;  2IJ0 A;  5JPM C;  4R1J A;  2R93 H;  2QF7 A;  3TP5 A;  4LUO A;  4HJA A;  2PZU A;  3TN2 A;  4A3J H;  1WTO A;  1JWS D;  1OTC A;  5D65 A;  2QA4 A;  4A3C H;  4JI6 Q;  5CBA E;  4A3M H;  2P5Z X;  4APV A;  2LKV A;  3HOX H;  1EY5 A;  2QW7 A;  3PUY A;  2EOT A;  4UAI A;  2KHJ A;  5FK9 C;  1HUM A;  1GUT A;  2F0I A;  1EYD A;  4JG2 A;  1V8Q A;  3M4O B;  1MJE A;  5C6A A;  4QQB X;  3OPO A;  1EZ6 A;  4BY1 B;  3NWS A;  5ELC A;  2OWO A;  1V43 A;  5CV6 A;  3IRB A;  4FF3 A;  1F77 A;  3S17 H;  5IYD G;  2Q2H A;  3NBH A;  1XNR Q;  5FLM G;  3K7A H;  1K8G A;  5LMN L;  4WRD A;  5K36 H;  3LX0 A;  2EJF C;  1DCZ A;  1SE2 A;  3S16 H;  3T4A C;  1VMP A;  1KDA A;  3P7J A;  4RG1 A;  4JI6 L;  1PTO C;  3RMH A;  5FLX c;  4LF4 L;  1D1K A;  3TS2 A;  2JA7 B;  3QOJ A;  1TWG B;  4XXE A;  3ND9 A;  4HIO A;  3FKI B;  2OXP A;  4U67 3;  1I4Q A;  1LTS D;  1CSP A;  3HG9 A;  5I2X A;  4A3D B;  1CSQ A;  3H15 A;  4BA2 I;  1EU3 A;  4S3S A;  1KTK A;  1BKB A;  1TKW B;  2JXM B;  2K5Q A;  3GD7 A;  1SJH D;  1AW7 A;  2F0E A;  1QOH A;  5M3F B;  3BS1 A;  4FXD A;  2AHO B;  4HMI A;  2FIN B;  2AQ2 B;  2NVQ B;  5DM7 3;  4FO2 A;  5EPJ A;  4H0L C;  1QVG A;  2OQK A;  5DNF A;  3TZD A;  5KNB A;  2VB2 X;  4LW1 A;  1TWF H;  3QG1 A;  1WTV A;  1EWC A;  1YHQ A;  3VDY A;  1Q7Y C;  1Q81 C;  3I56 A;  1X3Q A;  1YBY A;  1X65 A;  3PUZ A;  3I4M H;  3W3A A;  3M4Q A;  2RHQ B;  4BWG B;  4CHT B;  5CMD A;  3UI2 A;  1BUV T;  2G5D A;  3AFQ A;  3DWA A;  4TVA B;  3H6M A;  1DXM A;  4C3H G;  2WAQ B;  2L15 A;  1EIY B;  4ILW A;  4CJ0 B;  4HED A;  2F0L A;  1A15 A;  1E2Z A;  1SJE D;  5HUR A;  5CV5 A;  4DK0 A;  2E2H H;  1N32 L;  1UE5 A;  4IAL A;  3FMC A;  4MTN A;  4DAP A;  4Y52 H;  1PZI D;  2JA5 G;  5JJI A;  1NR4 A;  1E7Z A;  1LO5 D;  2FJ2 A;  1TS2 A;  4KLK A;  5BR8 L;  2JA7 H;  3PO2 G;  1TWG H;  1CQV A;  3CMA A;  4PMW A;  3TRE A;  3I4N B;  3SE0 A;  2E5L Q;  1AP0 A;  1FJG Q;  4BBR G;  5CV9 A;  1IXR A;  4FF1 A;  3OMG A;  5IGG A;  1PFS A;  4F88 A;  4A3D H;  4JI0 L;  3DM1 A;  3DM3 A;  1AH9 A;  2WAC A;  3H0G B;  2ZJQ A;  3NTK A;  5IT9 L;  1IKM A;  4AQY L;  4FF2 A;  2Y0S G;  1D8L A;  4A3K G;  1B9M A;  1SMY D;  3IFD A;  1V1P A;  3E0J A;  2SDF A;  3CME A;  4IPC A;  3DMU A;  1WTP A;  5DLQ E;  5J1Z A;  4HID A;  3LNN A;  4IUN A;  3X3M A;  5I9O A;  3BDL A;  4JI5 Q;  2A69 D;  2JA6 G;  1AZP A;  3NBI A;  3FPU B;  1BOS A;  1VQ6 A;  3ERQ A;  4XYQ A;  3NEN A;  2D5D A;  3BVM A;  1HNZ Q;  4KJO A;  5I9P A;  3J7A V;  1ICF B;  1HA5 A;  1HH2 P;  1SND A;  4JI4 L;  4IFD H;  5L37 A;  4CDF C;  2HIX A;  5M9O A;  2NN6 I;  3CPF A;  2NVX H;  2CWA A;  1U4P A;  4EQO A;  3A5Z B;  5C4X G;  1YIJ A;  3RR5 A;  2EPB A;  4QL5 A;  5IGF A;  1PFM A;  1CFM A;  1MSH A;  2GA4 B;  1BCP C;  3PUX A;  3KYH C;  4K8I A;  4KD4 A;  2RDF A;  3ITP A;  4RHS A;  3F2C A;  3L0O A;  1FL0 A;  1KDC A;  1EWI A;  2VQF L;  2PCF B;  4JYA Q;  4DV0 Q;  1HFN A;  3I4N H;  2Q2U A;  2X6G A;  3J81 L;  1M8A A;  1PH6 A;  4A75 A;  5EKL A;  5M5Y H;  3FPP A;  2F03 A;  1PTO F;  4JBK A;  2UXC Q;  2KVM A;  1Z7T A;  1F2M A;  2M9V A;  1PH2 A;  3O13 A;  4C3J G;  2I5L X;  3E9I A;  1SEB D;  1L2F A;  5IT9 E;  3DXJ C;  2DGY A;  4KHP Q;  2Q8R E;  1W6J A;  3DEP A;  2KCC A;  3KDF B;  2L1B A;  2A74 C;  3H3V H;  1K83 B;  1YIT A;  1PTO D;  4RMF A;  2J4X A;  1YJW A;  4POF A;  3RZO B;  3MA2 B;  3OHX C;  3QOL A;  4CJ2 C;  4IOA A;  4ID6 A;  3HOZ B;  3P75 A;  4DK1 A;  1PYS B;  4DA2 A;  3PSI A;  1LT4 D;  4R4Q A;  1KL9 A;  3K5L A;  1KAB A;  1MJC A;  1NBW A;  1EFW A;  1JC7 A;  4AYB G;  5KRU A;  1KLG D;  4YWK A;  5E7N A;  3S2H B;  1A62 A;  2F0H A;  2F0Q A;  2FHT A;  1PTO B;  4LNQ A;  1N34 L;  2K03 A;  1SSO A;  1JMC A;  5ELN A;  1ESR A;  1PYW D;  1Y8P B;  1JB7 A;  4LF5 L;  5FKA C;  1K0R A;  4X62 Q;  2RQX A;  4YCW A;  4HCS A;  3K0X A;  1EIF A;  4RKL A;  4PMC A;  4IFD J;  1G6Z A;  4NXN Q;  3Q6S A;  2LY7 A;  5CV7 A;  1PH1 A;  1NMG A;  4X64 Q;  1VQ9 A;  1Y69 U;  1B70 B;  1PRT F;  3J81 E;  5C44 B;  3S1M B;  2VY3 A;  3QWN A;  3GTK H;  2MNA A;  2PMZ E;  2B39 A;  4O0A A;  2VZA A;  5D14 A;  1WTR A;  1HJP A;  3STB C;  4OIJ A;  2EYJ A;  3GO5 A;  4F8M A;  1CHQ D;  4XT3 B;  2OTL A;  1STE A;  4DR1 Q;  1ASY A;  1DGS A;  2D2C C;  4DV4 L;  4DV3 Q;  4J6H A;  2J7Z A;  3J81 j;  3NPP A;  4DK3 C;  4AYB E;  4HJ7 A;  4X3K A;  1F9P A;  5C5L A;  3F2B A;  4WJ3 M;  1Y8N B;  3DWQ A;  4JBJ A;  3PF4 A;  4X66 Q;  3A8K E;  4QY7 A;  4V0B A;  4C56 C;  3RZO H;  2QCP X;  1JJC B;  1MSG A;  2RDG A;  1Y14 B;  4KKT A;  2M00 A;  4K5V A;  1TQO A;  2NZH A;  1LTL A;  2E2D C;  2F0D A;  4FDB A;  2F0U A;  4DXF A;  4ALP A;  4C3I H;  1PRT B;  2F0K A;  4BS9 A;  4DV3 L;  1PTO H;  1WCM G;  1CKN A;  3M9B A;  4DV5 L;  2MFI A;  2JK8 A;  2XN9 C;  3TP7 A;  1ZEQ X;  3LGJ A;  3CU7 A;  1A3U A;  4KN7 C;  2EY5 A;  2OF1 A;  5KYL A;  3HOY G;  3OIQ A;  1XMO Q;  3RZD H;  3PQI A;  4GKJ Q;  1VQB A;  5HGT A;  1BF4 A;  3A8I E;  4PNY A;  3T1Y L;  1STB A;  4QB4 A;  2HHH Q;  4JV5 Q;  3JC6 6;  1I3Q B;  1UE7 A;  3E3X A;  3G6J B;  1U4L A;  3S1M H;  1BCP F;  4DR5 Q;  1G29 1;  3OYY A;  1CKN B;  1NY4 A;  5FJ8 H;  2VUM B;  3ERS X;  1RHP A;  2DJG C;  5CGK A;  1LT5 D;  2F0O A;  1LT6 D;  3W2D A;  3C2P A;  4QIW E;  1D5Z C;  3WDN A;  5IP7 G;  1STY A;  5M5W B;  1TWC B;  3IKJ A;  2R92 H;  4ZCK A;  3TBI B;  3ULJ A;  3KF8 A;  1SYG A;  1PH8 A;  3KBX A;  4GKJ L;  1N8R C;  1VMC A;  4V19 0;  3GTO B;  3TSS A;  3S1Q H;  2CQO A;  5IYC G;  2K5H A;  4WJ4 A;  1GXD C;  1PLF A;  4TRD A;  4A3L H;  4BBS H;  1KDB A;  1I4R A;  1TWA B;  2PZT A;  5GAH C;  2AMC B;  5BN3 A;  4GS3 A;  3CQZ B;  3TP8 A;  2A5H A;  4DAY B;  1M4V A;  2IX3 A;  2WB1 G;  3VA5 A;  5C4J B;  1BCP B;  3MXG A;  1SE3 A;  3CC7 A;  1FR3 A;  2B63 G;  4WJW A;  3D6W A;  4WOR A;  4DNI A;  1EYC A;  4B3S Q;  4E6I A;  1EOV A;  1Q1E A;  3KF8 B;  1RTO A;  2JP1 A;  3R93 A;  2B8F A;  2F4I A;  4A3G H;  1U9R A;  1XXG A;  3QO2 A;  4ZUI A;  4BXX G;  4RGN A;  1TXY A;  4CJ1 B;  3G6E A;  5C3E B;  3M3Y B;  3PGZ A;  4I65 A;  2PPB C;  2K14 A;  1T5X D;  1I3Q H;  3TEH B;  1G2S A;  4Q0F A;  4RAU C;  4RCO A;  1BDO A;  2Z4I A;  3GDE A;  1KRS A;  2HQL A;  2F0M A;  3UE0 A;  3TS0 A;  4GKK Q;  1PH7 A;  2JQO A;  4ME5 A;  3RLF A;  4L6T B;  4LUV A;  1S3O A;  2Q8I B;  2VUM H;  5EBC A;  5IE8 A;  1I5F A;  2G9D A;  2Z9H A;  1STA A;  2EDG A;  1X56 A;  5C0X H;  5CC4 A;  3S2D B;  4B08 A;  2IWH A;  1XNQ L;  2PNH A;  1E1T A;  4B9W A;  4B3R L;  5IY0 A;  1LTT D;  3OW7 A;  4ODG A;  1E0B A;  4DUY L;  1WVL A;  3BJU A;  2CWP A;  4YY3 Q;  1HQM C;  4OEM B;  4P73 A;  2YYZ A;  1KHI A;  4B3M L;  4JBM A;  3ONA B;  2QDL A;  1HR0 Q;  1EQT A;  4X65 L;  1X6O A;  5GAE C;  4O1N A;  2UUB Q;  1IBK L;  5C0X I;  1L1O A;  1AFP A;  5C4J H;  1SRO A;  2WIN B;  2R93 B;  5EPL A;  3STB D;  3KLS A;  3NHH A;  3LWU A;  5ELE A;  5FO8 B;  1TY2 A;  3E9H A;  1ET9 A;  1VQG A;  5IYB H;  3K80 C;  1EQR A;  1EOT A;  5C4H A;  2UXD Q;  3EVQ A;  1VQN A;  3I7F A;  1SNC A;  3FDT A;  2OCE A;  3HOX B;  4JI3 L;  3QB3 A;  5A2Q L;  1MIU A;  3W1G A;  2F0P A;  3GV6 A;  3D3R A;  1QB5 D;  2ZTC A;  3RNU A;  2LFN A;  3UDX A;  5C3E H;  1NJI C;  1SN8 A;  3J7Z C;  3RD4 A;  1VQA A;  1HNX L;  4A3B H;  2F0J A;  5FLX L;  5DAU A;  2B2T C;  2VS1 A;  1ZXT A;  4YWL A;  1NUC A;  1T9H A;  2YTV A;  1FVI A;  1X55 A;  1JOR A;  4RA8 A;  2UXB L;  3S17 B;  4C1N K;  2PQA A;  3K6O A;  4UY8 C;  1XTD A;  3HOV B;  2BA0 A;  4KV6 A;  1K8A C;  2IW3 A;  1XTC D;  2K5N A;  1S72 A;  1W3S A;  3HEJ A;  5K5P A;  3S16 B;  3F1Z A;  5H1S E;  2UU9 Q;  2K05 A;  2N78 A;  4A3I B;  1E2W A;  2RHS B;  1VQL A;  4A3C G;  5G3L D;  4A3M G;  2EYF A;  1D2B A;  1VQF A;  4CKB A;  2XRQ D;  1UE6 A;  4U68 A;  4HJ5 A;  2BE5 D;  5HY6 A;  5CYU A;  3CRL C;  1ILP A;  1TII D;  1E3P A;  3PUW A;  4K6D A;  4IPG A;  4JVZ A;  5C0X J;  1M1K C;  2K4K A;  4N8F A;  1N36 L;  3UDG A;  1H9J A;  1GUO A;  3HKZ G;  4NKL A;  1VS0 A;  1U5K A;  1IYV A;  1KAA A;  1WD1 A;  1NNX A;  1VDZ A;  3SK4 A;  2D0O A;  4K5W A;  4H7B A;  5LMN Q;  2IT1 A;  2NTT A;  2UU9 L;  1RD9 D;  3DLL A;  1SXT A;  2A73 B;  1HNW Q;  2KJX A;  3HOW H;  2F3I A;  4A3E H;  4DR4 L;  2B2U A;  1TWF B;  4LF4 Q;  1PH5 A;  3WOE A;  4R9W A;  2RBM A;  2ASB A;  3GV3 A;  4OON A;  5A2Q E;  1K73 C;  4FXG C;  2X69 A;  3NSW A;  3F2U A;  1CZW A;  3I4M B;  2L4N A;  2VW9 A;  3H91 A;  2I5H A;  2ENB A;  5FLX E;  4HN7 A;  1AZQ A;  4A93 G;  3ERO A;  2NVT H;  1ENA A;  2LSS A;  4ZLT F;  2RSN A;  3G7L A;  3JAM c;  5ELD A;  1I4G A;  4OX9 L;  3HOV H;  3M4Y A;  3D31 A;  1LAC A;  1VQ8 A;  5D3D A;  2E2H B;  1HNW L;  5IP9 G;  3K57 A;  3BZD B;  2PQE A;  3SEB A;  2ZXP A;  4A3I H;  3I91 A;  1EYG A;  3LWE A;  2BCO A;  3HKZ E;  3EBE A;  2K6A A;  2SEB D;  1HTL D;  1EZ8 A;  4PZ6 A;  2DY8 A;  3KK7 A;  1IL2 A;  2G9H D;  3I2Z A;  1Q1B A;  2E76 C;  3GP7 A;  4QUF A;  1PZJ D;  1C48 A;  2EXD A;  3NBH B;  3U9S A;  2JEB I;  5IOD A;  2B2V C;  2F52 A;  4MN3 A;  3NTI A;  1LM0 A;  4BY1 G;  1HCZ A;  2XWJ B;  4RH6 A;  4FVM A;  2JA9 A;  2HQE A;  4L5R C;  1CKM A;  4R4I A;  2EYH A;  1YNJ C;  2PYK A;  1MBY A;  4NB3 A;  2J0T D;  1UWV A;  4NP5 A;  1N32 Q;  2F0S A;  3TRZ A;  1HUN A;  4DV1 L;  3S24 A;  1EEI D;  2ICE C;  3EN2 A;  1I4X A;  5AJ3 L;  3AB9 A;  1SYD A;  2IHE A;  1H95 A;  2F0N A;  1CKO A;  1S40 A;  1HFG A;  1S5B D;  1UEB A;  2IL8 A;  4G4K A;  5FLM H;  5BR8 Q;  3Q23 A;  2EZV A;  1JE4 A;  4OWT B;  2QGQ A;  2JA7 G;  1CQF A;  2EY6 A;  4PZ7 A;  1B53 A;  1S4Z A;  4K2L A;  3FKI G;  5KNC A;  1EFI D;  2B3G A;  3T1H L;  1F2L A;  1LLR D;  1VQM A;  1DJR D;  2YTX A;  2MO0 A;  1YNN C;  4JI0 Q;  4XQJ A;  1R4P B;  2NVX B;  1JWM D;  3R8B A;  3PO3 B;  3B6Y A;  4XQN A;  5M3M B;  1I4P A;  4PZ8 A;  5M3F G;  4XTC S;  2A19 A;  1IYU A;  2L12 A;  3AFP A;  1JR0 D;  4OHJ A;  1AEX A;  4AQY Q;  1FGB D;  3S15 B;  1QJO A;  4R4O A;  2NN6 G;  1NMF A;  3EFX D;  1WYD A;  4J15 A;  4DAM A;  3KFU A;  5IIF A;  1F2Z A;  1GKH A;  4DK6 C;  5IGC A;  3I8Z A;  4JI7 L;  1L0W A;  2Z4H A;  3I70 A;  1C4Q A;  2B2T A;  2OT2 A;  3S1R B;  3VYT A;  3I72 A;  4IUU A;  2CKZ B;  4RKB A;  2K50 A;  3I73 A;  3M7N A;  5M5Y B;  4JI4 Q;  1RF2 D;  4JW0 A;  4X3T A;  2WAQ G;  4DFA A;  1OO9 B;  4DXG A;  1C0A A;  2FXQ A;  1X54 A;  3DWP A;  4TSS A;  1I94 L;  2KOL A;  2UUA L;  4A3F B;  3T13 A;  4DR7 L;  4RCN A;  3KBG A;  1HZB A;  1X3E A;  3GQB A;  4IUT A;  4ABN A;  2EJG C;  2K04 A;  4C3H H;  1ZYR D;  3CCR A;  3BDC A;  1H9S A;  3U4V A;  4FF4 A;  2VQF Q;  3MAQ A;  3AQQ A;  3J80 i;  2KEC A;  2RKS A;  3I4N G;  1G51 A;  1GJX A;  1L0X B;  1SYB A;  1WTQ A;  3G71 A;  1LUZ A;  2LMC B;  3GTL H;  2JA5 H;  4DR2 L;  1UE1 A;  5E4X A;  2MQH A;  2JA8 G;  4LF6 L;  5IGE A;  3AU7 A;  4TQU S;  3CCU A;  3PO3 H;  1XYI A;  5M3M H;  1STN A;  1V1P B;  2E75 C;  3H0G G;  2EIF A;  3BDO A;  4BBR H;  1H9S B;  3S15 H;  4ZUJ A;  3VR5 A;  1EY6 A;  1HZA A;  2EY1 A;  4DV7 L;  4IUP A;  3HRZ C;  4IFD I;  2HIV A;  4EQP A;  1PHJ A;  5EQ0 A;  1R4Q B;  2M2L A;  4C3J B;  2Y0S E;  2D62 A;  1STH A;  3S1R H;  2K1B A;  2Z6K C;  5EGT A;  4RGT A;  3GTK B;  4P2C B;  4A3K H;  3E0E A;  2KEE A;  3PCO B;  1HZC A;  1P16 A;  2PMZ B;  4DGZ A;  1YJ9 A;  3AYH B;  5CBE E;  3CHB D;  1XJV A;  4NXM Q;  2BOS A;  1VQP A;  3RUZ A;  1N34 Q;  2JA6 H;  2KED A;  1O78 A;  2ALY B;  4A3F H;  1P8L A;  4QF4 A;  2OEO A;  2KBN A;  1B2T A;  2C5C A;  4LF5 Q;  3MFY A;  2NB0 A;  3J7Y W;  3VYU A;  4ZQ3 A;  5JJL A;  3CCS A;  1HZ9 A;  2I46 A;  1YHB A;  1Z47 A;  1MD2 D;  4I7Z C;  2R61 A;  5ELO A;  4N8X 1;  5FO9 B;  1BVS A;  3GTG B;  1B3Q A;  4ZAI A;  1D1I A;  2B2V A;  4C3I B;  3S1N H;  1SNQ A;  4J1M A;  2F4V L;  3I90 A;  4JI1 L;  4ZKC B;  4NXM L;  3KJP A;  2ZT9 C;  3H3V I;  4DV4 Q;  2SNS A;  2TSS A;  4CDD C;  1IL8 A;  1A63 A;  2L9H A;  3CAM A;  1YNJ D;  4CGY B;  2EYM A;  2VQE Q;  3D4R A;  1RCV D;  2N8N A;  3RLN A;  1DYQ A;  4IOC A;  4IPH A;  2IX1 A;  2I5M X;  4L5S A;  4G7Z C;  1IBL L;  3VR2 A;  1RJT A;  3RZD B;  4LFC Q;  2X6L A;  3NTH A;  2VXW A;  4NDX A;  2DY7 A;  5JPN C;  1EWH A;  5JEA G;  4GNX C;  4C3J H;  4Y7N H;  4HSV A;  1GHK A;  4MNO A;  3HOZ G;  2OTJ A;  1JOO A;  2R7Z B;  4EGV A;  4UP8 A;  1XPR A;  2NBF A;  4ME3 A;  2AQ1 B;  1Y1V B;  2DNE A;  4ZRZ A;  4EVO A;  3OWE B;  1F2Y A;  4G7O C;  3WOF A;  1L1O C;  4IN3 A;  1YNN D;  5DM6 3;  1IKL A;  4WFN 3;  2XNA C;  5KIX A;  2XGT A;  1YHA A;  5M5X H;  1CHP D;  1BBW A;  4EX5 A;  2VQE L;  3JAM i;  4DV5 Q;  1FNU A;  2PO4 A;  3CXC A;  4GOP C;  4QIW B;  2O2L D;  2R92 B;  3NXW A;  1O7Y A;  4OGQ C;  4CDE C;  3HZX A;  4LFC L;  3S1Q B;  4P75 A;  4XQQ A;  4DNT B;  1U4R A;  5TSS A;  4LF9 L;  1O7L A;  4BBS B;  1WCM B;  3SK6 A;  3QR8 A;  3T1Y Q;  1CA5 A;  4FP5 D;  3Q0A A;  3GTG H;  2O4X A;  3UDF A;  2O5I C;  5IOC A;  5C44 G;  1N33 L;  1ZKO A;  4KI0 A;  1C7Y A;  3J81 c;  4BA1 I;  1A6X A;  2YV5 A;  3A74 A;  1J8I A;  4JK1 C;  1NE3 A;  5CR3 A;  4OXP A;  3W5O A;  4LFB Q;  1O80 A;  3GTQ H;  4A3G B;  1QVC A;  4R8N A;  4K0K Q;  3GTP H;  1I6V C;  2BE5 C;  2DUD A;  2E74 C;  1EQQ A;  2VNU D;  2XVS A;  5ELB A;  4LAA A;  5IWA L;  4DAV A;  2HT1 A;  4A3L G;  2R7Z H;  1Y1V H;  1AN8 A;  3M7G A;  3GTM H;  4HR7 B;  2LS0 1;  3BZK A;  5C4Z A;  3UE1 A;  1YVC A;  4KY5 A;  1JOK A;  2HD3 A;  1VQ7 A;  2GVB A;  1ML0 D;  3OSO A;  3SHL A;  2FMC A;  3BVZ A;  4LFB L;  1EQV A;  1LYL A;  2IPK D;  2NVY B;  5BN4 A;  4K0K L;  2B2U C;  2JJQ A;  1SNP A;  1GUS A;  2QEJ C;  1C8C A;  2RVL A;  3K81 C;  1EL0 A;  1G91 A;  4JCV E;  4LF8 L;  1YI2 A;  1YZ6 A;  4OEL B;  4RWS C;  3HOU B;  3MC0 B;  5JAV A;  1WCM H;  1B9N A;  4MHE A;  5GQO A;  3TDQ A;  2Z6K A;  3NQI A;  2ES2 A;  1SE4 A;  3HOY H;  4KHZ A;  1LT3 D;  5LMN W;  5E3F A;  2BH8 A;  1PV4 A;  1D6E C;  3KF6 A;  4LK1 C;  1F9Q A;  4XIG S;  2EXZ A;  3IFT A;  5NUC A;  2D9U A;  1AE2 A;  2XSC A;  2EJM A;  1Q8K A;  3H09 A;  3NK9 A;  3OTO L;  4NPS A;  1XNQ Q;  2K28 A;  2CFM A;  1SYF A;  2E2I B;  4K2K A;  4B3R Q;  4L5T A;  2CVR A;  3T51 B;  4DUY Q;  4IZ8 A;  1FYC A;  1VQE A;  4B3M Q;  2K33 A;  4A3B B;  4X65 Q;  3K58 A;  3HP3 A;  1MI2 A;  5IP7 H;  2QKI C;  1O7I A;  2UUC L;  3KF6 B;  1CTM A;  1DM0 B;  1H9R A;  4A4I A;  1VF5 C;  1IBK Q;  3AEV A;  2Q8T A;  4A76 A;  5IYC H;  4B3T Q;  3L9A X;  2F3V A;  4XT1 B;  2V4D A;  4EQN A;  2WB1 E;  4DN4 M;  4KKS A;  2NVY H;  1EU4 A;  1T5E A;  5GAG C;  4QCL A;  3J80 c;  3K5M A;  5JVG 3;  1SYE A;  5T1I A;  5FOB B;  1RTN A;  3PUV A;  2ID0 A;  4UPA A;  2ICI A;  2AWO A;  4JI3 Q;  2AQ3 B;  4GNX A;  2B63 H;  1I50 H;  1NR2 A;  2E8G A;  3MZ5 A;  1PH9 A;  1GD7 A;  2LXK A;  2R7F A;  4UP7 A;  2I0Q A;  3HOU H;  5C3E G;  4DR3 L;  1HNX Q;  3CF5 A;  5T1G A;  4BY7 B;  1IBM L;  2F1M A;  2QDB A;  3S9W A;  1GUG A;  1N9W A;  1QUQ A;  3X3N A;  2UXB Q;  1HPC A;  1KIX A;  1PA6 A;  4BXX H;  4LMQ D;  4B3T L;  1VCI A;  1SLJ A;  1IW7 C;  1TWH H;  4G7H C;  2XRS D;  4KD3 A;  2EVB A;  1LTI D;  3MXP A;  3HOW B;  1XMQ L;  4GOP A;  4A3E B;  1JJ2 A;  3MEH A;  4GNX B;  4UHV A;  4CKC A;  5LMU L;  1W2B A;  2N88 A;  4NMZ A;  2E2I H;  3CCJ A;  3QIA A;  1Y1W B;  4CBV A;  3G4S A;  1GHJ A;  2KCM A;  4LF7 Q;  1SRU A;  1L1O B;  4R8I A;  4ZK9 B;  1CA6 A;  1F9S A;  1C9O A;  1Y8O B;  2NVT B;  1KLU D;  3A7L A;  3F8T A;  5G3L F;  4DKA C;  3RN2 A;  4HMJ A;  1N36 Q;  1EY9 A;  1CI3 M;  4P71 A;  1HRJ A;  4GOP B;  2CH4 W;  2F0V A;  4HSP A;  2R93 G;  4DV2 L;  1ZYR C;  2WFW A;  4A3J G;  2R7D A;  3A55 A;  4DUZ L;  1OXV A;  2VL6 A;  4DR4 Q;  1STG A;  1NTG A;  1TS4 A;  4MZ9 A;  4OO1 H;  1JQY D;  2BDO A;  3E6Z X;  3HKZ B;  5CV4 A;  1UAP A;  3HOX G;  3FRP B;  4LFA L;  1VQJ A;  3D4D A;  1XWE A;  5JOB A;  4DV6 L;  1S5C D;  4LF7 L;  3CP0 A;  4RFB A;  1ASZ A;  3CC4 A;  2PQA B;  4R4T A;  1LTA D;  4BY7 H;  3Q22 A;  3ICE A;  1SR3 A;  1TVX A;  4QJF A;  1UUP A;  1XPU A;  4OX9 Q;  1EUJ A;  5COY A;  1J6Q A;  3HOV G;  4OO1 I;  3D6C A;  1B4O A;  3FHW A;  4KJN A;  3C1F A;  4NW2 A;  4JI2 L;  5K36 G;  2ZM6 L;  2ATW A;  3L7Z C;  3MXN A;  4DR6 L;  1B50 A;  4A3I G;  1B44 D;  1KAW A;  3NEM A;  4JI8 L;  1QZG A;  5LHY 1;  1ET6 A;  1TR5 A;  1Y1W H;  2NUC A;  2YU9 H;  2ZXO A;  4B9X A;  4YHH L;  2Q2T A;  4KY7 A;  1D5X C;  2N55 A;  1DON A;  2A6H C;  1A2T A;  4HTH A;  3CW2 C;  3K5O A;  5J3B A;  3MEF A;  1F9R A;  4OIK A;  2K32 A;  2CCZ A;  1PH4 A;  3MFG A;  4Z9C B;  3MXN B;  4OWX B;  2KHS A;  1ONL A;  3SGI A;  1OXX K;  2KQ3 A;  1VQD A;  1NSN S;  5EPK A;  4EQ5 A;  1XPO A;  3J81 i;  4DV1 Q;  2AKW B;  5AJ3 Q;  3K59 A;  1E1O A;  2WKC A;  1EY8 A;  2NYZ D;  4IQZ A;  3F2D A;  2PI2 E;  2CW0 C;  2KEN A;  3TZU A;  4PMB A;  3SVM A;  5BN5 A;  4POG A;  1RL2 A;  2BA1 A;  1TT2 A;  3I4M G;  1OXU A;  2ZJP A;  5LL6 X;  3E5S A;  2ZJR A;  4YCU A;  1L0Y B;  4ZKB B;  3T1H Q;  2I07 B;  1DOL A;  2RF4 A;  3FVQ A;  1VQK A;  1E2V A;  1B8A A;  4O2D A;  1W6K A;  1JT8 A;  2XWB B;  4K14 A;  3BYT B;  4C3H B;  1U0L A;  2B29 A;  4K5X A;  2PW5 A;  4P74 A;  4A93 H;  2A1A A;  1EIH A;  2GN5 A;  1VF7 A;  1U4M A;  5IYD H;  2B2Y C;  3NEL A;  4YIJ A;  1XNR L;  1E24 A;  3U4Z A;  1WTW A;  4JI7 Q;  1G2T A;  3KLS X;  2EE1 A;  1I4H A;  5IP9 H;  1ENC A;  2CHB D;  3GTL B;  3MWY W;  2JA5 B;  2L0C A;  2RA4 A;  4A3D G;  3I55 A;  1K8M A;  3FP9 A;  4UP9 A;  2HCC A;  3PO2 B;  1SBB B;  4IPD A;  1WTH A;  1I94 Q;  1QIL A;  3MTS A;  2UUA Q;  3RLO A;  2EY2 A;  1IW7 D;  4BBR B;  3EJI A;  4O42 A;  4DR7 Q;  4M1U B;  3DHQ A;  3DEO A;  3SR1 A;  3M4O H;  3K7U C;  5I4D A;  4IO9 A;  2AUJ D;  3BZC A;  3ZJY C;  2RDH A;  1B3A A;  4BY1 H;  2NTS A;  1X32 A;  1XX8 A;  1EY7 A;  3ULL A;  2DN8 A;  1PRT C;  3OIP A;  4MIU A;  5JJK A;  4DPG A;  5A35 A;  2Y0S B;  4A3K B;  4PV1 C;  1EY0 A;  2AWN A;  2L5T A;  4IFD G;  2Z8L A;  4DR2 Q;  1EIG A;  4LF6 Q;  2H4O A;  1E22 A;  4JPB W;  3U58 A;  2E2J B;  4JOI C;  2CQA A;  2JA6 B;  3PO3 G;  5M3M G;  3A7A B;  3C3L A;  5ISR A;  3FKI H;  2CH4 A;  3K0Y A;  2F0W A;  1QVF A;  2Z6B A;  3PV0 A;  1EYA A;  3EIV A;  2MP1 A;  4QGU A;  2JA8 B;  4DV7 Q;  1PZK D;  3T56 B;  1SMX A;  3P20 A;  1OXT A;  1DD2 A;  1CM9 A;  5IGD A;  4AIM A;  5C4X B;  2JE6 I;  3M4P A;  5M3F H;  1LAB A;  2WII B;  2K5D A;  4C2M B;  1KNA A;  1WOC A;  2K5W A;  3S1N B;  4KKU A;  5EKK A;  1GM5 A;  2NVQ H;  4LJZ C;  2NN6 H;  3HGB A;  1J5E Q;  3IL8 A;  3KLW A;  3A0J A;  5C5M A;  5I2Y A;  3VR3 A;  1BO0 A;  4C1N I;  1S5E D;  5JJZ A;  3PO2 H;  3K5N A;  3CD6 A;  4RGO S;  3FEW X;  4A3F G;  2E5L L;  1YJN A;  1FJG L;  3S14 B;  4IJH A;  3P1H A;  3U50 C;  2WAQ E;  4HJ8 A;  3DUZ A;  3T16 A;  4IUR A;  1DOK A;  1CZG A;  1S5D D;  2OQ0 A;  1B7Y B;  4H02 A;  4QMG A;  2V1C C;  4Y7N B;  3VYS A;  1EY4 A;  2F0F A;  3NQT A;  2A68 C;  1BR9 A;  5E4W C; 
#chains in the Genus database with same CATH homology
 2A6H D;  5EBD A;  1ILQ A;  3VYR A;  3N6R A;  5D3I B;  3H94 A;  3N52 A;  3IAY A;  5J39 A;  1PDQ A;  1Q90 A;  2TMP A;  4K6L A;  5M5X B;  3V05 A;  1ICW A;  1FNW A;  2HUG A;  2H1E A;  1MGS A;  2MGS A;  4AYB B;  4KY6 A;  1V1O A;  1EEF D;  3PIP 3;  1I6H B;  3SDZ A;  1A3T A;  2CW0 D;  5F2D A;  3V96 A;  3VR4 A;  5LL6 S;  3KUP A;  2KCN A;  2C9O A;  1JOQ A;  1PMR A;  4ULL A;  4FYD A;  3U9O A;  1HQR D;  2RSO A;  2AUK A;  1GUW A;  1FD7 D;  2MJ8 A;  5KND A;  1DOM A;  2PNR C;  4N9T A;  4IUV A;  1B1Z A;  3GTQ B;  1JB3 A;  4RHR A;  3GTP B;  3SXH A;  2B2Y A;  1NAP A;  2L55 A;  2A6E C;  1S5F D;  1UNS A;  4PQX A;  3ZYY X;  2SOB A;  5ELF A;  2PW7 A;  3BG3 A;  2WV6 D;  3GTM B;  4C3I G;  1QNU A;  2PZW A;  5KYI A;  5KGU A;  3KLR A;  5C3X A;  1R9T B;  2Z1C A;  1OXS C;  2F0T A;  1QCB D;  3MXU A;  2K01 A;  2KA7 A;  4HAE A;  4KK7 A;  1UEA B;  1TY0 A;  4F7X A;  2B2W C;  5FO7 B;  1GUN A;  1II3 A;  5DEH A;  1LTR D;  1QE6 A;  1ESF A;  3EA6 A;  2NZ1 D;  1FNV A;  2BDN A;  2QIL A;  5I6Y A;  3J7A F;  1BBX C;  1PRT D;  1NCV A;  1SFO B;  1X3P A;  4N9P A;  3HOY B;  1HXY D;  3M85 A;  3V2T A;  5CV8 A;  2FMM A;  5IGB A;  1JWU D;  5AFW A;  1KNE A;  3OOC A;  1CK1 A;  5JEA H;  1ENF A;  1Q8I A;  4KTA A;  3OWF A;  4TKO B;  2HDM A;  1SYC A;  1LV9 A;  1RKN A;  2F3W A;  2MUY A;  5JVH 3;  1GOZ A;  4JBW A;  3AMU A;  4Q5V A;  1TS3 A;  1HHV A;  3D8G A;  3NE5 B;  3NP8 A;  3J80 L;  3QJY A;  1PFN A;  3CKI B;  3Q24 A;  1A2U A;  1SNM A;  1J9O A;  2O5J C;  1G8Z D;  1Z6H A;  2DNC A;  1QWY A;  2R6G A;  3URY A;  2HCI A;  2WP8 J;  2JYO A;  2NWG A;  1BNZ A;  5C3W A;  1CT1 D;  2WB1 B;  3R3O A;  3PIO 3;  3MVV A;  5I6W A;  2B63 B;  1I50 B;  4KMU C;  4DAY A;  1DZ1 A;  1SAP A;  4K8J A;  5KEE A;  4FNF A;  2K7V A;  1BCP D;  2A68 D;  3NUC A;  1ROD A;  4KHV A;  4DU9 A;  2ZXR A;  1TWH B;  3I4L A;  1LTG D;  4XDX A;  5C0X G;  1LTB D;  2EYO A;  5E1F A;  3VA7 A;  2F0G A;  1SDF A;  3J80 E;  5JEA J;  1JIC A;  1RDP D;  1JCK B;  3OMC A;  5EJW A;  1WTX A;  1BQQ T;  3TP6 A;  4H13 C;  4DNR B;  3VR6 A;  1PXU A;  3R2I A;  2MHV A;  5COR A;  5EKI A;  3C1E A;  1IHZ A;  1H9M A;  3NWT A;  1O7Z A;  4XYO A;  4M8A A;  2IX0 A;  2VB3 X;  2A6E D;  2MPM A;  4L8J A;  4KN4 C;  1TU2 B;  4J8Q A;  1K8O A;  1SNO A;  4DF7 A;  2KUM A;  3GTJ B;  3MHB A;  2B8G A;  3HS0 C;  1Q3L A;  2B2W A;  4GZY C;  3CRK C;  3JAM L;  4OL7 A;  3ND8 A;  1HTP A;  4OO1 G;  2EYL A;  4F87 A;  2YU9 B;  3EQL C;  4CKE A;  2JEA I;  4A3J B;  1HA6 A;  4X3S A;  4QUC A;  4UDU C;  1QG7 A;  1QNK A;  4A3M B;  4X3U A;  2JSO A;  4H44 C;  1Q12 A;  3A56 A;  3D4W A;  1PFB A;  1H9K A;  2XIW A;  2SNM A;  1A3V A;  3L3O C;  3C46 A;  3H3V C;  4HCE A;  2HDL A;  2WKD A;  3PMF A;  4FXK C;  3A8J E;  4ZYS A;  3R2T A;  2EYP A;  3K7A B;  3I3C A;  3A54 A;  3SK5 A;  4RGM A;  1SMY C;  5J22 A;  3TME A;  1BXT A;  2R3Z A;  4L63 B;  2A69 C;  3T53 B;  3BVG A;  1D5M C;  4G57 A;  4A93 B;  3JAM E;  1TS5 A;  2FFK B;  3BYY B;  2L11 A;  1WD0 A;  3SK8 A;  4IUQ A;  2IJ0 A;  5JPM C;  2QF7 A;  3TP5 A;  2PZU A;  3TN2 A;  1WTO A;  1JWS D;  5D65 A;  5CBA E;  2LKV A;  1EY5 A;  3PUY A;  2EOT A;  4UAI A;  5FK9 C;  1HUM A;  1GUT A;  2F0I A;  1EYD A;  1V8Q A;  3M4O B;  5C6A A;  3OPO A;  1EZ6 A;  4BY1 B;  3NWS A;  5ELC A;  1V43 A;  5CV6 A;  4FF3 A;  1F77 A;  3NBH A;  4WRD A;  5K36 H;  3LX0 A;  2EJF C;  1DCZ A;  1SE2 A;  3T4A C;  1VMP A;  1KDA A;  3P7J A;  1PTO C;  3RMH A;  1D1K A;  2JA7 B;  3QOJ A;  1TWG B;  4XXE A;  3ND9 A;  3FKI B;  2OXP A;  4U67 3;  1I4Q A;  1LTS D;  3HG9 A;  5I2X A;  4A3D B;  4BA2 I;  1EU3 A;  4S3S A;  1KTK A;  1TKW B;  2JXM B;  2K5Q A;  3GD7 A;  1SJH D;  1AW7 A;  2F0E A;  1QOH A;  5M3F B;  3BS1 A;  4FXD A;  4HMI A;  2FIN B;  2AQ2 B;  2NVQ B;  5DM7 3;  4FO2 A;  5EPJ A;  4H0L C;  5DNF A;  5KNB A;  3TZD A;  2VB2 X;  3QG1 A;  1WTV A;  1EWC A;  1X3Q A;  3PUZ A;  3W3A A;  4BWG B;  4CHT B;  5CMD A;  3UI2 A;  1BUV T;  3DWA A;  3H6M A;  1DXM A;  4C3H G;  2WAQ B;  4ILW A;  4CJ0 B;  4HED A;  2F0L A;  1A15 A;  1E2Z A;  1SJE D;  5HUR A;  5CV5 A;  4DK0 A;  4IAL A;  3FMC A;  4DAP A;  1PZI D;  1NR4 A;  1LO5 D;  2FJ2 A;  1TS2 A;  1CQV A;  4PMW A;  3I4N B;  3SE0 A;  1AP0 A;  5CV9 A;  4FF1 A;  3OMG A;  5IGG A;  4F88 A;  3DM1 A;  2WAC A;  3H0G B;  3NTK A;  5IT9 L;  1IKM A;  4FF2 A;  1B9M A;  1SMY D;  3IFD A;  1V1P A;  3E0J A;  2SDF A;  3DMU A;  1WTP A;  5J1Z A;  3LNN A;  4IUN A;  3X3M A;  5I9O A;  3BDL A;  2A69 D;  1AZP A;  3NBI A;  3FPU B;  1BOS A;  3ERQ A;  4XYQ A;  2D5D A;  3BVM A;  4KJO A;  5I9P A;  3J7A V;  4IFD H;  1HA5 A;  1SND A;  5M9O A;  2NN6 I;  1U4P A;  4EQO A;  2EPB A;  5IGF A;  1PFM A;  1CFM A;  1MSH A;  2GA4 B;  1BCP C;  3PUX A;  4K8I A;  4KD4 A;  2RDF A;  3ITP A;  4RHS A;  1KDC A;  2PCF B;  1HFN A;  2X6G A;  3J81 L;  1M8A A;  5EKL A;  3FPP A;  2F03 A;  1PTO F;  2KVM A;  1Z7T A;  1F2M A;  2M9V A;  3O13 A;  4C3J G;  1SEB D;  5IT9 E;  3DXJ C;  2Q8R E;  1W6J A;  3DEP A;  2KCC A;  2L1B A;  2A74 C;  1K83 B;  1PTO D;  2J4X A;  3RZO B;  3MA2 B;  3OHX C;  3QOL A;  4CJ2 C;  4ID6 A;  3HOZ B;  3P75 A;  4DK1 A;  4DA2 A;  1LT4 D;  3K5L A;  1KAB A;  1JC7 A;  5KRU A;  1KLG D;  3S2H B;  2F0H A;  2F0Q A;  2FHT A;  1PTO B;  2K03 A;  1SSO A;  1ESR A;  1PYW D;  1Y8P B;  5FKA C;  2RQX A;  4HCS A;  4RKL A;  1G6Z A;  4PMC A;  4IFD J;  3Q6S A;  2LY7 A;  5CV7 A;  1Y69 U;  1PRT F;  3J81 E;  5C44 B;  3S1M B;  3QWN A;  2B39 A;  1WTR A;  5D14 A;  4OIJ A;  2EYJ A;  3GO5 A;  4F8M A;  1CHQ D;  4XT3 B;  1STE A;  2D2C C;  4J6H A;  2J7Z A;  3NPP A;  4X3K A;  1F9P A;  5C5L A;  1Y8N B;  3DWQ A;  3A8K E;  4V0B A;  4C56 C;  2QCP X;  1MSG A;  2RDG A;  4KKT A;  2M00 A;  4K5V A;  1TQO A;  2E2D C;  2F0D A;  2F0U A;  4DXF A;  1PRT B;  2F0K A;  4BS9 A;  1PTO H;  2XN9 C;  3TP7 A;  1ZEQ X;  3CU7 A;  1A3U A;  4KN7 C;  2EY5 A;  2OF1 A;  5KYL A;  3OIQ A;  5HGT A;  1BF4 A;  3A8I E;  4PNY A;  1STB A;  4QB4 A;  1I3Q B;  3G6J B;  1U4L A;  1BCP F;  1G29 1;  2VUM B;  1RHP A;  5CGK A;  1LT5 D;  2F0O A;  1LT6 D;  3W2D A;  3C2P A;  1D5Z C;  3WDN A;  1STY A;  5M5W B;  1TWC B;  3IKJ A;  3TBI B;  3KF8 A;  1SYG A;  3KBX A;  1VMC A;  4V19 0;  3GTO B;  3TSS A;  1GXD C;  1PLF A;  4TRD A;  1KDB A;  1I4R A;  1TWA B;  2PZT A;  5BN3 A;  3CQZ B;  3TP8 A;  2A5H A;  1M4V A;  2IX3 A;  3VA5 A;  5C4J B;  1BCP B;  3MXG A;  1SE3 A;  1FR3 A;  4WJW A;  3D6W A;  4WOR A;  1EYC A;  4E6I A;  1Q1E A;  1RTO A;  2JP1 A;  3R93 A;  2B8F A;  2F4I A;  1U9R A;  1XXG A;  3QO2 A;  4ZUI A;  4RGN A;  4CJ1 B;  5C3E B;  3M3Y B;  4I65 A;  2PPB C;  1T5X D;  1G2S A;  4Q0F A;  4RAU C;  4RCO A;  1BDO A;  2Z4I A;  2F0M A;  4ME5 A;  3RLF A;  4L6T B;  2Q8I B;  5EBC A;  2G9D A;  1STA A;  2EDG A;  5C0X H;  5CC4 A;  3S2D B;  4B08 A;  2IWH A;  4B9W A;  1LTT D;  3OW7 A;  4ODG A;  1E0B A;  1WVL A;  1HQM C;  2YYZ A;  3ONA B;  1EQT A;  4O1N A;  5C0X I;  1AFP A;  2WIN B;  2R93 B;  5EPL A;  3KLS A;  3NHH A;  3LWU A;  5ELE A;  5FO8 B;  1TY2 A;  1ET9 A;  1EOT A;  5C4H A;  3EVQ A;  1SNC A;  3FDT A;  3HOX B;  5A2Q L;  3QB3 A;  2F0P A;  3D3R A;  3GV6 A;  1QB5 D;  2LFN A;  3RD4 A;  2F0J A;  5FLX L;  5DAU A;  2B2T C;  1ZXT A;  1NUC A;  1JOR A;  4RA8 A;  3S17 B;  4C1N K;  3K6O A;  3HOV B;  2BA0 A;  4KV6 A;  2IW3 A;  1XTC D;  3HEJ A;  5K5P A;  3S16 B;  2K05 A;  4A3I B;  1E2W A;  5G3L D;  2EYF A;  1D2B A;  4CKB A;  2XRQ D;  4U68 A;  2BE5 D;  5CYU A;  3CRL C;  1ILP A;  1TII D;  3PUW A;  4K6D A;  5C0X J;  1H9J A;  1GUO A;  4NKL A;  1IYV A;  1KAA A;  1WD1 A;  1VDZ A;  3SK4 A;  4K5W A;  4H7B A;  2IT1 A;  2NTT A;  1RD9 D;  1SXT A;  2A73 B;  2KJX A;  2B2U A;  1TWF B;  3WOE A;  4R9W A;  2RBM A;  3GV3 A;  5A2Q E;  4FXG C;  2X69 A;  3NSW A;  3F2U A;  1CZW A;  3I4M B;  2L4N A;  3H91 A;  2ENB A;  5FLX E;  4HN7 A;  1AZQ A;  3ERO A;  1ENA A;  4ZLT F;  2RSN A;  3G7L A;  5ELD A;  1I4G A;  3M4Y A;  3D31 A;  1LAC A;  5D3D A;  2E2H B;  3K57 A;  3BZD B;  2PQE A;  3SEB A;  2ZXP A;  3I91 A;  3LWE A;  2BCO A;  2K6A A;  2SEB D;  1HTL D;  1EZ8 A;  2DY8 A;  3KK7 A;  2G9H D;  1Q1B A;  2E76 C;  3GP7 A;  4QUF A;  1PZJ D;  1C48 A;  3U9S A;  2JEB I;  5IOD A;  2B2V C;  4MN3 A;  3NTI A;  1HCZ A;  2XWJ B;  4RH6 A;  4FVM A;  2HQE A;  2EYH A;  1YNJ C;  2PYK A;  1MBY A;  2J0T D;  4NP5 A;  1HUN A;  2F0S A;  1EEI D;  2ICE C;  1I4X A;  3AB9 A;  1SYD A;  2F0N A;  1HFG A;  1S5B D;  2IL8 A;  4G4K A;  3Q23 A;  2EZV A;  1JE4 A;  1CQF A;  2EY6 A;  1B53 A;  1S4Z A;  4K2L A;  5KNC A;  1EFI D;  1F2L A;  1LLR D;  1DJR D;  1YNN C;  4XQJ A;  1R4P B;  2NVX B;  1JWM D;  3R8B A;  3PO3 B;  4XQN A;  5M3M B;  1I4P A;  4XTC S;  1IYU A;  2L12 A;  1JR0 D;  4OHJ A;  1AEX A;  3S15 B;  1FGB D;  1QJO A;  2NN6 G;  3EFX D;  5IIF A;  1F2Z A;  5IGC A;  3I8Z A;  2Z4H A;  3I70 A;  1C4Q A;  2B2T A;  2OT2 A;  3S1R B;  3VYT A;  3I72 A;  4IUU A;  4RKB A;  3M7N A;  3I73 A;  5M5Y B;  1RF2 D;  4X3T A;  4DFA A;  1OO9 B;  4DXG A;  3DWP A;  4TSS A;  2KOL A;  4A3F B;  3T13 A;  4RCN A;  3KBG A;  4IUT A;  3GQB A;  4ABN A;  2EJG C;  2K04 A;  1ZYR D;  3BDC A;  1H9S A;  4FF4 A;  3MAQ A;  2KEC A;  2RKS A;  1GJX A;  1L0X B;  1SYB A;  1WTQ A;  2LMC B;  5E4X A;  5IGE A;  3AU7 A;  4TQU S;  1XYI A;  1STN A;  1V1P B;  2E75 C;  3BDO A;  1H9S B;  4ZUJ A;  3VR5 A;  1EY6 A;  2EY1 A;  4IUP A;  3HRZ C;  4IFD I;  4EQP A;  5EQ0 A;  1R4Q B;  2M2L A;  4C3J B;  2D62 A;  1STH A;  3GTK B;  2K1B A;  5EGT A;  4RGT A;  4P2C B;  2KEE A;  2PMZ B;  4DGZ A;  5CBE E;  3CHB D;  2BOS A;  3RUZ A;  2KED A;  1O78 A;  4QF4 A;  2OEO A;  1B2T A;  2C5C A;  3MFY A;  2NB0 A;  3J7Y W;  3VYU A;  4ZQ3 A;  2I46 A;  4I7Z C;  1Z47 A;  1MD2 D;  2R61 A;  5FO9 B;  3GTG B;  4ZAI A;  1D1I A;  2B2V A;  4C3I B;  1SNQ A;  4J1M A;  3I90 A;  4ZKC B;  2ZT9 C;  2SNS A;  2TSS A;  1IL8 A;  2L9H A;  1YNJ D;  4CGY B;  2EYM A;  3D4R A;  1RCV D;  1DYQ A;  2IX1 A;  4G7Z C;  3VR2 A;  1RJT A;  3RZD B;  2X6L A;  3NTH A;  2VXW A;  4NDX A;  2DY7 A;  5JPN C;  1EWH A;  5JEA G;  4HSV A;  1GHK A;  1JOO A;  2R7Z B;  4EGV A;  2NBF A;  2AQ1 B;  1Y1V B;  2DNE A;  4ZRZ A;  4EVO A;  3OWE B;  1F2Y A;  4G7O C;  3WOF A;  4IN3 A;  1YNN D;  5DM6 3;  1IKL A;  4WFN 3;  2XNA C;  5KIX A;  1CHP D;  1FNU A;  2PO4 A;  4QIW B;  2O2L D;  2R92 B;  3NXW A;  1O7Y A;  4OGQ C;  3HZX A;  3S1Q B;  4XQQ A;  4DNT B;  1U4R A;  5TSS A;  1O7L A;  4BBS B;  1WCM B;  3SK6 A;  1CA5 A;  4FP5 D;  3Q0A A;  2O4X A;  2O5I C;  5IOC A;  1ZKO A;  4KI0 A;  1A6X A;  4BA1 I;  1J8I A;  4JK1 C;  5CR3 A;  1O80 A;  4A3G B;  4R8N A;  1I6V C;  2BE5 C;  2E74 C;  2VNU D;  2XVS A;  5ELB A;  4LAA A;  4DAV A;  3M7G A;  1AN8 A;  4HR7 B;  2LS0 1;  5C4Z A;  4KY5 A;  1JOK A;  1ML0 D;  3OSO A;  3SHL A;  2FMC A;  3BVZ A;  1EQV A;  2IPK D;  2NVY B;  5BN4 A;  2B2U C;  2QEJ C;  1SNP A;  1GUS A;  1C8C A;  1EL0 A;  2RVL A;  1G91 A;  4RWS C;  3HOU B;  3MC0 B;  5JAV A;  4MHE A;  1B9N A;  3TDQ A;  3NQI A;  1SE4 A;  4KHZ A;  1LT3 D;  5E3F A;  1D6E C;  4LK1 C;  1F9Q A;  4XIG S;  2EXZ A;  3IFT A;  5NUC A;  2D9U A;  2XSC A;  2EJM A;  3H09 A;  3NK9 A;  2K28 A;  1SYF A;  2E2I B;  4K2K A;  2CVR A;  3T51 B;  4IZ8 A;  1FYC A;  2K33 A;  4A3B B;  3K58 A;  3HP3 A;  1MI2 A;  2QKI C;  1CTM A;  1DM0 B;  1H9R A;  1VF5 C;  2Q8T A;  3L9A X;  2F3V A;  4XT1 B;  2V4D A;  4EQN A;  4DN4 M;  4KKS A;  1EU4 A;  1T5E A;  4QCL A;  3K5M A;  5JVG 3;  1SYE A;  5T1I A;  5FOB B;  1RTN A;  3PUV A;  2ID0 A;  2ICI A;  2AWO A;  2AQ3 B;  1NR2 A;  3MZ5 A;  5T1G A;  4BY7 B;  2F1M A;  2QDB A;  3S9W A;  1GUG A;  3X3N A;  1HPC A;  4LMQ D;  1VCI A;  1IW7 C;  4G7H C;  2XRS D;  4KD3 A;  2EVB A;  1LTI D;  3MXP A;  3HOW B;  4A3E B;  3MEH A;  4CKC A;  2N88 A;  4NMZ A;  3QIA A;  1Y1W B;  4CBV A;  1GHJ A;  4R8I A;  4ZK9 B;  1CA6 A;  1F9S A;  1Y8O B;  2NVT B;  1KLU D;  3A7L A;  5G3L F;  4HMJ A;  1EY9 A;  1CI3 M;  1HRJ A;  2F0V A;  4HSP A;  1ZYR C;  3A55 A;  1OXV A;  1STG A;  1TS4 A;  4OO1 H;  1JQY D;  2BDO A;  3E6Z X;  3HKZ B;  5CV4 A;  1UAP A;  3FRP B;  3D4D A;  1XWE A;  5JOB A;  1S5C D;  4RFB A;  1LTA D;  3Q22 A;  1TVX A;  1UUP A;  5COY A;  4OO1 I;  3D6C A;  1B4O A;  4KJN A;  3C1F A;  4NW2 A;  5K36 G;  3L7Z C;  3MXN A;  1B50 A;  1B44 D;  5LHY 1;  1ET6 A;  1TR5 A;  2NUC A;  2ZXO A;  4B9X A;  4KY7 A;  1D5X C;  2N55 A;  1DON A;  2A6H C;  1A2T A;  4HTH A;  3K5O A;  1F9R A;  4OIK A;  2K32 A;  3MFG A;  4Z9C B;  2KHS A;  1ONL A;  1OXX K;  2KQ3 A;  5EPK A;  1NSN S;  3K59 A;  2WKC A;  1EY8 A;  2NYZ D;  4IQZ A;  2CW0 C;  3TZU A;  4PMB A;  3SVM A;  5BN5 A;  2BA1 A;  1TT2 A;  1OXU A;  5LL6 X;  3E5S A;  1L0Y B;  4ZKB B;  2I07 B;  1DOL A;  3FVQ A;  1E2V A;  1W6K A;  2XWB B;  4K14 A;  3BYT B;  4C3H B;  4K5X A;  2PW5 A;  1EIH A;  1VF7 A;  1U4M A;  2B2Y C;  4YIJ A;  1WTW A;  1G2T A;  3KLS X;  2EE1 A;  1I4H A;  1ENC A;  2CHB D;  3GTL B;  3MWY W;  2JA5 B;  2L0C A;  2RA4 A;  1K8M A;  2HCC A;  3PO2 B;  1SBB B;  1QIL A;  3MTS A;  4BBR B;  2EY2 A;  1IW7 D;  3EJI A;  4O42 A;  4M1U B;  3DHQ A;  3DEO A;  3SR1 A;  5I4D A;  2AUJ D;  2RDH A;  1B3A A;  2NTS A;  1X32 A;  1XX8 A;  1EY7 A;  2DN8 A;  1PRT C;  3OIP A;  4MIU A;  5A35 A;  2Y0S B;  4A3K B;  4PV1 C;  1EY0 A;  2AWN A;  2L5T A;  4IFD G;  2Z8L A;  1EIG A;  2H4O A;  2E2J B;  2CQA A;  2JA6 B;  3A7A B;  3C3L A;  5ISR A;  3K0Y A;  2F0W A;  3PV0 A;  1EYA A;  2MP1 A;  2JA8 B;  1PZK D;  3T56 B;  3P20 A;  1OXT A;  1DD2 A;  1CM9 A;  5IGD A;  5C4X B;  2JE6 I;  1LAB A;  2WII B;  2K5D A;  4C2M B;  1KNA A;  2K5W A;  3S1N B;  4KKU A;  5EKK A;  4LJZ C;  2NN6 H;  3HGB A;  3IL8 A;  5C5M A;  5I2Y A;  3VR3 A;  1BO0 A;  4C1N I;  1S5E D;  5JJZ A;  3K5N A;  4RGO S;  3FEW X;  3S14 B;  3P1H A;  3DUZ A;  3T16 A;  4IUR A;  1DOK A;  1CZG A;  1S5D D;  4QMG A;  4Y7N B;  3VYS A;  1EY4 A;  2F0F A;  3NQT A;  2A68 C;  1BR9 A;  5E4W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...