3PMFA

Crystal structure of staphylococcal nuclease variant delta+phs v23a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pmfA00
3ITPA 3SK5A 5IGFA 5C3WA 3EVQA 5DEHA 4IUNA 5NUCA 1KDAA 3NK9A 5I6YA 3DHQA 2PQEA 3S9WA 5IGCA 3LX0A 3HZXA 3P75A 5C4ZA 4K14A 3D4WA 5CV9A 4H7BA 3OMGA 4PMBA 3NHHA 3T13A 2EYLA 2EYHA 5HURA 2EY5A 5C5MA 3R3OA 4RKLA 1F2YA 2EYPA 3MXPA 5EGTA 2EYMA 2RBMA 2F0EA 4J1MA 5IODA 3ERQA 1IHZA 4IZ8A 4B9XA 1JORA 3MHBA 4HTHA 2F0QA 5HGTA 1A3UA 4QF4A 4R8NA 3SXHA 5CGKA 5M9OA 1AEXA 1A2UA 1RKNA 2OEOA 4NP5A 3TP7A 2WACA 1SYGA 5CV4A 1EY5A 2F0PA 2OF1A 4YIJA 3NUCA 3TP8A 5J39A 2PZUA 4QB4A 4ZUJA 1KAAA 4K8IA 4K2KA 3SK8A 4IALA 3D8GA 3D6CA 1EYCA 1KDCA 4S3SA 5IGDA 4HMJA 2F0JA 2OXPA 3VA5A 4I65A 3V2TA 1A3VA 5K5PA 4KD3A 2F0KA 4MIUA 2EYFA 4OL7A 5CC4A 1EYDA 5C6AA 5IIFA 1EY9A 2RDFA 4N9TA 5IOCA 2F0MA 4DGZA 5KEEA 5KRUA 2EYJA 5F2DA 1ENCA 5C4HA 3DMUA 2F0TA 1STAA 4K5XA 4KD4A 1F2ZA 1SYBA 4PNYA 1JOOA 3MZ5A 4KTAA 3TP5A 5IGGA 1NSNS 3P1HA 4F8MA 1SNMA 4EQOA 3C1FA 1SYCA 1EQVA 2NUCA 3OWFA 4ZQ3A 2LKVA 5EKKA 2F0WA 5C5LA 4F7XA 4J6HA 1SNDA 3H6MA 5JAVA 4G57A 2M00A 4DU9A 3RUZA 1SNPA 1TT2A 1SNOA 4TRDA 2F0UA 1EY4A 2KQ3A 1EY8A 4KHVA 2QDBA 5KYLA 4DF7A 1SNQA 4ID6A 5E1FA 2EY2A 1SYDA 4LAAA 5CV5A 5I9OA 5IGEA 2HQEA 3NXWA 2F0NA 1TR5A 2SNSA 4ME5A 2ENBA 4KJNA 4NDXA 5DAUA 5C3XA 2PYKA 4ZUIA 2PW5A 1STGA 3TP6A 5EKLA 4KY5A 1EY7A 4K5WA 4K8JA 1ENAA 2F0LA 3BDLA 4KV6A 3MEHA 4WORA 4KY7A 1TQOA 1EYAA 1KDBA 3D4DA 4RKBA 1A2TA 1SYFA 1STBA 2O4XA 3OSOA 4ODGA 4PMCA 1F2MA 1II3A 3QOLA 5CV6A 2F0HA 4K2LA 2EYOA 4WRDA 2PZWA 1STNA 2EY1A 3BDCA 4NKLA 5KGUA 2PZTA 3PMFA 3QB3A 5E3FA 3QOJA 3MVVA 4DFAA 2SNMA 1SNCA 1STHA 1NUCA 4K5VA 4KJOA 3TMEA 2SOBA 3U9OA 4EQNA 5I6WA 4B9WA 2F0DA 5KYIA 3HEJA 1SYEA 5ISRA 3EROA 5JOBA 2F3WA 2PW7A 2RKSA 4E6IA 2F0VA 3EJIA 2F0IA 4EVOA 3C1EA 1EZ8A 3NP8A 3T16A 4HMIA 5KIXA 5I9PA 1STYA 2F0OA 3SHLA 4KY6A 3SK4A 1U9RA 2EXZA 3OMCA 4NMZA 2KHSA 2F0SA 2F0GA 2EY6A 3SR1A 1EY6A 5CV7A 1A3TA 3NQTA 5J22A 5CV8A 3E5SA 1JOQA 4N9PA 4K6DA 1JOKA 4EQPA 4QMGA 5CR3A 3SK6A 2F0FA 5J1ZA 1EZ6A 2F3VA 1EY0A 1KABA 5IGBA
chains in the Genus database with same CATH superfamily
3ITPA 1Q3LA 1WTRA 4ABNA 1KNAA 4JI4L 4GKKL 3N6RA 3EVQA 2KECA 1D5MC 1SDFA 2L5TA 3LX0A 3CCJA 3X3MA 2AQ2B 4K14A 3S17H 2DY8A 1GKHA 2HHHL 2A6HC 1SLJA 3MXPA 1RTOA 1M4VA 4P72A 3PCOB 4DR3L 5HGTA 2NN6H 1HNWL 1QCBD 1YHBA 3U50C 4H44C 3G6EA 2WACA 1YZ6A 2IY5B 1EY5A 3OTOQ 4UDUC 2B29A 4K8IA 4B3TL 4DPGA 1IZ6A 3VA5A 4I65A 2Z0SA 2XN9C 1VQ6A 5DM73 5C4HA 3J80i 5COYA 1ASZA 3DMUA 2VB2X 2NTTA 2G5DA 2VY3A 1VDZA 1ML0D 3AU7A 3HOWG 1DM0B 1DGSA 3D3RA 3PUXA 2CFMA 4RMFA 1SRUA 1TXYA 1KLUD 4BA1I 1OXXK 4PMWA 4RGNA 1J5EL 4FF3A 4C3JB 3OIQA 5I9OA 1EQTA 2O5JC 2F0NA 1MKHA 3I4LA 1FGBD 1PHJA 1C4QA 4KY5A 1NBWA 1AE3A 2K5HA 1A2TA 1CFMA 4A3JH 2UXDQ 2LSSA 3NWSA 1HFGA 2Z9HA 1KIXA 1PTOD 1U0LA 3AFPA 1ESRA 5JPMC 3UDIA 1SNCA 1HUMA 4K5VA 1VQ7A 1G6PA 2AQ1B 1VQOA 1W2BA 5FO9B 3FP9A 4HJAA 1R9TB 2JA6G 2PW7A 4E6IA 2UUCQ 2F0VA 4DUYQ 2F0GA 4ZKBB 2G9DA 1TWAB 3E5SA 1UWVA 3C2PA 1SMYD 4IUUA 1EWCA 5H1SE 1KD1C 1BO0A 3RN2A 5FLXL 1N8RC 2NVXH 1FGUA 3J80L 4JV5L 1RTNA 2DNCA 3SK5A 1UAPA 5FOBB 2VUMG 1PTOF 4KHPL 3PUWA 5ELFA 2K4KA 3KBXA 3I73A 2KCCA 1VQIA 1AFPA 4B3MQ 3NQIA 1RIPA 1PMRA 2F4IA 3H0GG 3GTKB 5JJIA 1IXRA 4GS3A 1S5CD 2XWJB 3BVMA 4DAPA 2MPMA 2QEXA 4V190 1PYSB 1JE4A 1XNRQ 2XWBB 4A3DB 3J7YW 1EQRA 2MO1A 1I6VC 2QCPX 1GD7A 1GVPA 2PI2E 2UU9L 4GOPB 3ERSX 1QJOA 5EJWA 1N36L 1EY9A 1ENCA 3I2ZA 1IBKQ 2NZ1D 5TSSA 1CT1D 4R1JA 2XNAC 4KTAA 4A3IB 1SE4A 2EVBA 2DN8A 2B39A 1TS5A 4KLKA 2KCNA 3UDXA 1JICA 3CPFA 1GUTA 1DONA 4TRDA 3A5UA 4GOPA 4KHVA 5LL6S 5E1FA 3FVQA 4FVMA 2IWHA 5CV5A 4QL5A 4CKCA 1KLGD 3K5MA 2K5VA 2R92H 1TR5A 1WD1A 1B7YB 1A6XA 3VDYA 2PYKA 1MIUA 4MTKA 3K8AA 1V1OA 1LTLA 4ULLA 1ENAA 2A74C 1QVCA 1TVXA 1N33L 5C0XJ 1ZKOA 3E0JA 1PYWD 3VR6A 1J8IA 2XGTA 1SJHD 1VQLA 2PI2A 4ZCKA 3JAMc 1U4MA 5KGUA 4K0KQ 4QUFA 4OO1H 3I4OA 1TS2A 3B6YA 1XX8A 3HOXH 4DUZL 2JA5H 5AJ3Q 4H13C 1FNUA 4RH6A 5BN4A 1T5XD 1EUJA 4C3JG 2F0IA 1XPUA 2B63B 4HMIA 5LMNW 3H3VH 1LV9A 3S16B 4LUOA 2L9HA 4JOIC 3J7AV 4XQJA 1I5FA 5J22A 4YY3Q 3MXUA 3CCMA 1JOQA 1PRTD 1QUQB 4DAYB 5LHY1 3HFZB 1HPCA 1YNNC 5L37A 3CF5A 2D0PA 4ZYSA 3A74A 5K36G 1NTGA 1KDAA 2EJFC 3HOVB 3S1MB 1WTVA 4ZKCB 1I4PA 1PH9A 1EWHA 4DR7L 2PPBC 3BZDB 4CDFC 3G6JB 4RKLA 2K04A 3I4NG 4X3TA 1UEBA 4HJ5A 4DV2Q 1PTOC 3S17B 1QUQA 4DAYA 3DXJC 3RLFA 1BCPF 1Y8OB 2K52A 1QOHA 2KCTA 1EOVA 3GTQB 4YIJA 2MO0A 4DV1L 3NUCA 2OCEA 2PZUA 2K14A 3GTGH 1B3AA 4JI6Q 1T5EA 1BVSA 4A4IA 2BA1A 3M9BA 4JI0L 5LMUQ 1F9RA 3AQQA 2F0JA 3KJOA 5C0XG 3HOUG 1OO9B 3UE1A 2FXQA 5CBAE 2RDFA 3HOWH 1CKOA 4DGZA 2ZM6Q 4G7HC 3T56B 2MQHA 2LXJA 4OEMB 4DKAC 1ILPA 2VS1A 5IGGA 1GXDC 2FINB 2K5QA 2FFKB 1H95A 3HGBA 4MHEA 1QG7A 1EIFA 1JCKB 3GTOB 2DJFC 1NCVA 3QIAA 3Q24A 5C4JH 4GZYC 1PH1A 1SMXA 3T53B 4IJHA 2NVQH 1Z9FA 3NBIA 2L0CA 1KC8C 1EY7A 1PYBA 1RF2D 2B8GA 1TQOA 1EYAA 1AN8A 2XVSA 3ULJA 2HQLA 3STBC 3R2IA 3DWPA 1K3RA 2FHTA 3HOYB 4AH6A 3RN5A 2PQAB 2JA6H 3QB3A 2KHJA 1DCZA 2ZTDA 1Q46A 5IWAQ 1QNUA 1SE2A 1X3PA 1BNZA 1D6EC 4OXPA 2HCIA 3I91A 1KTKA 3L7ZC 3M3YH 1X54A 3Q22A 1K9MC 1MSGA 2B8FA 1F9QA 2E2DC 3DWQA 4IFDJ 1P16A 2JQOA 5KNDA 1WTHA 2WAQE 4U68A 1ET9A 2VUMH 2JA8B 2PQAA 2CCZA 1O7LA 3NENA 5DLQE 5J1ZA 1N32L 1PVOA 5M5YB 2A19A 2ICEC 4IUNA 1ASYA 3H0GH 3A7AB 2NVTB 5IGCA 2NVXB 1K28A 2VQFL 1PZJD 3OWEB 1BXTA 2XRQD 1CQFA 3ERQA 3PGZA 4Y7NB 1L0YB 2WAQB 1ZYRD 1GOZA 2GA4B 2B63G 1D1IA 2SEBD 2F4VL 1WTPA 2F0PA 2EQSA 1BCPC 2KOLA 1PZKD 3EA6A 1S40A 1IKLA 1C7YA 2CH4W 1F77A 3U4VA 3PIPA 3H15A 4DV6L 1I6HH 4KN7C 3HOVG 2TSSA 3PO2B 4FDBA 2EYJA 4L5RC 1XNQQ 4DV0L 1ET6A 4FF2A 2R7FA 4RGMA 1FJGL 3M4OH 4ZLTF 2NUCA 1EQVA 3N52A 4A3KG 3AFQA 4DA2A 1G2SA 2R93G 1R4PB 1VMCA 3UDGA 1EY4A 1AP0A 1HHVA 3UE0A 3TS2A 4DR2L 2JE6I 3DWAA 4IFDG 3NPPA 4LF4Q 5C4XB 4ME5A 4KJNA 4LF7Q 3KFUA 4V0BA 2D62A 4DV5L 1O7IA 1HNXL 1H9MA 4K5WA 3CRLC 3IRBA 2B2VC 2RQXA 3BYYB 4O0AA 4R4TA 5EPLA 3M7GA 4WORA 2R92B 1SYFA 2B2WA 5LMNL 3OSOA 1DOLA 1QWYA 2F0HA 1PFSA 1QE6A 3QJYA 4C3JH 4HAEA 5BN5A 2SOBA 4U673 1YHQA 1SYEA 4X3KA 2HIXA 2JA5B 2Z6KC 1SAPA 1Y1VG 1TY0A 3J80E 3OMCA 4BY1G 3O13A 2X6LA 5A2QL 1TWCB 1VQCA 1XMOL 2WV6D 5K36H 1HXYD 4QIWE 5IYCG 4OHJA 2L55A 5GAEC 1LTAD 2WB1E 1XXGA 4YHHQ 3NTIA 3HOYG 3I4NH 2KEEA 2QGQA 1X3GA 3D4WA 3MFYA 4H7BA 3J81j 2VQEQ 4A3LG 2Z4HA 4GN3B 1FL0A 1Q81C 3VYRA 4GN5A 4QIWB 3U9SA 4DAMA 1GUSA 3NBHB 2WB1B 4FXDA 3CCRA 4HN7A 1AEXA 5C0XH 2YTXA 1TIID 3HOUH 1CSQA 1V1QA 1X55A 4ZUJA 2K28A 4L63B 4I7AA 2JA8G 1K83H 4WJWA 3GTJH 1IBLQ 4BY7G 3ER0A 1VQMA 3GTGB 1WI5A 2I5LX 3VR4A 4KD3A 4OONA 3DEPA 5J3BA 3G48A 1I4QA 3CXCA 1VQGA 3GTKH 5F2DA 2BH2A 4X65L 1Q1EA 5G3LD 2FMMA 3Q8DA 1SNMA 1LTSD 4DV3Q 1EFWA 4LFCQ 2M00A 3D4RA 2QEJC 3RUZA 3OW7A 2EDGA 4DK6C 4WJ4A 1D1KA 4DXGA 2CWAA 4JI8Q 2NTSA 4H02A 1SNQA 1E1TA 2LY7A 3SVMA 1HZ9A 1SYDA 2EE1A 2HQEA 5C4JB 3NTKA 4POGA 3KF8B 2AWNA 4NXNL 3R93A 1YJWA 1PH8A 2HT1A 2K01A 3PO2G 3A8JE 4DAVA 1BQQT 4F87A 2RVLA 1Y69U 3VYUA 4A3MG 5IT9c 4P75A 4QCLA 3UDFA 1STHA 1CZWA 3D0FA 1SN8A 1S5ED 3WOEA 1EU3A 1KQSA 1PDQA 3T1HL 1W6JA 2RKSA 1A63A 5M5XB 1EZ8A 4MTNA 5C4XG 3SHLA 3A5ZB 4HJ7A 1U9RA 4NXMQ 1IBML 2KJXA 2F0SA 1BDOA 2C9OA 3GD7A 5CV7A 1A3TA 1EQQA 4OWTB 1JOKA 3K5OA 3UI2A 2YV5A 1X65A 4LF8L 3K0XA 3KLRA 4LF5L 2VUMB 4A93G 2NN6I 1EIHA 3P75A 1BUVT 4A75A 2B63H 2RCNA 3BVGA 1YNXA 5CV9A 2UXCQ 2ZJRA 2GVAA 4LUZA 4QUCA 4DR1Q 3H0GB 1HZCA 5JVH3 4IZ8A 1CSPA 2I07B 1K0SA 5D3IB 1GM5A 3J81i 2J0TD 2OF1A 1SBBB 3HOVH 3S1MH 4JVZA 4QGUA 5IGDA 3CCEA 2MJ8A 3SE0A 1F2LA 1GUOA 5KRUA 4A3KH 2Q2HA 1IL2A 4DR5L 2R93H 1I6HB 1CZGA 4IOCA 4XTCS 3TP5A 3GTQH 3TZUA 2CVRA 2JN4A 3S1RB 2TMPA 4JBJA 4IFDH 2E75C 1SROA 3E9IA 2WB1G 3QG1A 4A3FG 3M4OB 1TT2A 3J7ZC 1B50A 1TS3A 2E76C 2ICIA 3R8BA 4AQYQ 1WFQA 3SEBA 1HQMC 3MWYW 1C8CA 4IN3A 3K58A 5EKLA 2LMCB 3MEHA 3GTOH 3RZOB 4Y52H 1V43A 3ONAB 5EPKA 4HJ9A 1HZBA 5FJ8G 3J7AF 5FLXc 1B9MA 4R4OA 3J80c 3ZYYX 3MVVA 1Y1VH 1BR9A 2SNMA 4L6TB 4GKKQ 3I7FA 1TWHH 2HUGA 4BY1H 3NEMA 3F2DA 1LACA 3VR2A 4YCWA 3J81L 5IYCH 3G7LA 2UUCL 2HHHQ 2CWPA 4AYBE 4EVOA 1YNND 3NP8A 3PUZA 2E74C 1CKNB 2KHSA 4DR3Q 1YIJA 1HNWQ 3HOYH 1MSHA 1E1OA 1LT4D 2JJQA 4FXGC 4IPDA 4KKSA 1BBXC 3HOZB 1EZ6A 4A3LH 5CMDA 1WTQA 1HA5A 1B1ZA 3GTMH 1S5DD 1IYJB 1KHIA 1OXVA 2LXKA 3DHQA 1OTCA 2Q8RE 3DLLA 3TS0A 4C3IB 4RFBA 5C4ZA 1NJIC 3ND8A 4AYBB 2E2JB 3I4NB 2ASBA 1CKNA 1S72A 1DZ1A 3RR5A 4MN3A 2UUAQ 1PRTB 2PNRC 4B9XA 1O78A 2JA8H 4A3EB 4BY7H 4NP5A 1A2UA 2PNHA 5M5YH 1D8LA 3K57A 2PMZE 3RZDH 3V96A 2IX3A 4C3HB 2NVTH 3CRKC 3HOUB 2JXMB 3W5OA 1J5EQ 1HNZL 1IYUA 1JT8A 4PG3A 1Q90A 4BWGB 1K83B 4Y7NH 5EPJA 3GTJB 2PCFB 4P74A 4NB3A 2JP1A 4BA2I 1JMCA 1SYBA 2BH8A 2JEBI 2JK8A 4G7ZC 4OELB 4EQOA 3A8KE 2PMZB 4JI7L 1X3EA 3TEHB 3WWVA 3LGJA 2CHBD 4QY7A 5ELEA 1EY8A 4GNXB 3KK7A 3NELA 1E0BA 3PO2H 2XIWA 4LAAA 1EOTA 1AW7A 3STBD 2J7ZA 4DK3C 5C44G 5C3XA 4DV4L 4A3GG 4RAUC 1IW7D 5JJZA 4A3MH 2A73B 4XYQA 5IP9G 4OO1I 1K0RA 2HIVA 1X3FA 4JG2A 4DR6L 1TS4A 4N8FA 1EEFD 1I50B 4GNXA 3CU7A 4JV5Q 2XSCA 4OWWB 4OGQC 3WDNA 4LFAL 5C4XH 2EZVA 3TMEA 5A2QE 4KHPQ 3CC2A 1K8GA 1OXUA 4RGOS 2Q2IA 1B4OA 3AMUA 1LABA 1PFNA 1MD2D 2Q8TA 4JYAL 4JK1C 4A93H 1R4QB 1HA6A 2IPKD 2NB0A 3S1QB 1DJRD 5ELNA 1TWGB 3KLSA 4JI1L 2FMCA 1HJPA 2K5WA 1G6ZA 5C3WA 1BBUA 5NUCA 3OOCA 4X66L 2UU9Q 2PQEA 2OTLA 2R61A 4X62L 3CCVA 3CAMA 4NW2A 3JAMi 1N36Q 1PH5A 1TWCH 2H4OA 2AHOB 2I5MX 2L12A 1WTXA 1BCPD 5JJKA 3W3AA 2OEOA 2VB3X 4IO9A 4R8IA 3TP8A 2JA7B 1KAAA 4PZ7A 3SDZA 1GUGA 4FF1A 3SK8A 1I3QH 3HOZG 1L0XB 1XYIA 3MAQA 1KDCA 2QW7A 4FYDA 1YVCA 1L1OC 3K7UC 4LJZC 2EYFA 5C6AA 2B2UA 5KEEA 1VQ5A 1QVFA 4C3IG 3RNUA 4A3BB 1UE6A 4AYBG 4A3FH 2P5ZX 4XQQA 5I4DA 3EFXD 3BU2A 2AUJD 4LW1A 1N33Q 1EU4A 2B3GA 2RHSB 4A3KB 1DOKA 2R93B 3EBEA 1SYCA 4F7XA 2N55A 4HCSA 4A3EG 1JE5A 4R4CA 1HFNA 4G57A 4DU9A 1K8AC 3HS0C 2B2YC 2F0UA 1S4ZA 1VS0A 4PZ6A 2KQ3A 4DUZQ 4C3HG 4ID6A 2B2TC 4FP5D 1AZQA 1SE8A 1YITA 3AEVA 4F88A 3ZJYC 4RHRA 1LTBD 4ZUIA 1DOMA 4LK1C 1NY4A 5FJ8H 3CCQA 1PV4A 1VMPA 4K8JA 5IYDG 1I4GA 4L8JA 3G4SA 4PMCA 2XTIA 2IX0A 2A6EC 1E3PA 2DGYA 1G51A 5ELDA 2K75A 2O5IC 4DFAA 3BS1A 1QNKA 1FVIA 3F1ZA 4L5TA 1V1PB 1JB7A 2Y0SE 3F8TA 1Y1VB 4DR7Q 1TWHB 2NYZD 4BY1B 3C1EA 2JEAI 1UNSA 1SXTA 1LTGD 1HRJA 2VNUD 1EY6A 3MA2B 5CR3A 5D65A 3SK6A 4DV1Q 3H91A 1Q12A 2E5LL 1IW7C 1V8QA 1V1PA 2V1CC 3OYYA 4CKBA 1N34L 1A62A 4JI0Q 4GLAC 2E8GA 2Y0SB 3NK9A 3PF5A 5M5XH 2N49A 4JI3L 5IP7G 3GTMB 2F03A 2EYLA 2HD3A 3FEWX 4EGVA 3KJPA 3MXNB 1Z7TA 1F2YA 1A0IA 1I4HA 2RCFA 1PH4A 4X3UA 4Z9CB 2UXBL 1TWFB 1PTOH 3FRPB 5BR8L 3ICEA 3H94A 1VCIA 4CDCC 5AFWA 1IKMA 2K7VA 5CV4A 5GADC 3S15H 3I4MG 1VQHA 4QB4A 5GROA 4BY7B 1YJ9A 3HKSA 2DNEA 1W3SA 3PIP3 3RZDB 3V2TA 1A3VA 5K5PA 3MXNA 1FNVA 1HR0W 5DM63 4J8QA 1VQFA 3DUZA 3FHWA 3KLSX 3T1YL 1MJCA 1U4PA 1SFOH 5M5WB 4MZ9A 4BS9A 2CH4A 4ZQ3A 5C5LA 1LTRD 1JR0D 5C44H 4A3GH 1MJEA 1SNOA 1UE5A 3L9AX 5IP9H 2JA7G 1KXLA 3K81C 4BBSB 2KBNA 3PQIA 4LF7L 1LO5D 4HIOA 3S1NB 2PW5A 3S2HB 5ELOA 3ND9A 3S1RH 2F0LA 3K5NA 4A3BG 3L2PA 1KL9A 1H9KA 2R6GA 2UUBL 4A3MB 1DYQA 1WCMG 1LLRD 1ZXTA 2KHIA 4DV7L 4LF9L 3J81E 1N32Q 3G71A 1XMQL 1B53A 5T1GA 3PIOA 1E22A 4DK0A 1RJTA 1AE2A 1LUZA 1ZEQX 3Q6SA 4KJOA 3T4AC 1Q8IA 4C2MH 2F0DA 2IX1A 4FO2A 2WKCA 3RZOH 4OWXB 3IFDA 2VQFQ 4I7ZC 3NWTA 1KRTA 3SK4A 2QILA 5HGQA 3I55A 4DR4L 2R7DA 2QA4A 3KDFB 1V9PA 4M8AA 1XPOA 1JC7A 2F4VQ 3K6OA 2IJ0A 2F3VA 3A0JA 2WIIB 3PO3B 4LUVA 4A93B 1WTOA 3HRZC 3P20A 5FLMG 1VQKA 2K5DA 2N78A 5C0XI 4DV6Q 1K8MA 1VF7A 3NHHA 1HZAA 3FKIB 1L2FA 2L4NA 3KDFA 1ENFA 5IODA 1E24A 4DV0Q 2BOSA 1IHZA 2GN5A 2KUMA 4CDEC 1JORA 3HOZH 1FJGQ 4QF4A 5CGKA 1JWMD 5JJLA 3FMCA 1DXMA 2OQ0A 2A69C 5J39A 4IUTA 4XXEA 4X64L 1G8ZD 4GOPC 3X3NA 3KLWA 1QILA 4C3IH 4RCOA 1EYCA 2E2JH 4DR2Q 4HMJA 2F3IA 2BE5D 2F0KA 4O42A 2ALYB 4OL7A 3S14H 2Y0SG 1GHJA 1I3QB 5IYBG 3GTPB 4A3EH 4DV5Q 3HKZG 1HNXQ 2A1AA 1H9JA 1S5BD 3TDQA 1A15A 1FD7D 3P1HA 1ESFA 5EKKA 4C3HH 5LMNQ 4A3FB 1CUKA 4LFBL 3H6MA 5JEAJ 2CW0D 5KNBA 3MTSA 3KUPA 4HCEA 1E2VA 5IYDH 1OXTA 2OWOA 1EL0A 5IGEA 2NZOA 1WD0A 4JPBW 1SSOA 2H1EA 3CW2C 1I94L 4NDXA 1QZGA 2K03A 3VYSA 1HUNA 3L0OA 2WINB 5M3FB 4IUQA 5E4XA 3K5LA 1XMOQ 4ODGA 4P2CB 4LF6L 3QOLA 1II3A 2A68C 1FYCA 2IHFA 3CHBD 1PLFA 2XRSD 4NKLA 4OX9L 2DJGC 1EYGA 5E3FA 1C0AA 1D2BA 2WP8J 3RD4A 4JI2L 4IURA 1J9OA 2O2LD 2SDFA 1X9NA 1CQVA 1Z6HA 4BBSG 5JOBA 5EQ0A 4K6LA 3EJIA 3MEFA 4JBWA 5T1IA 2A8VA 3M4YA 1Q82C 1XPRA 1Y14B 1Q1BA 1RL2A 4GLXA 1I50H 4B3SL 5IP7H 1PXUA 3D8GA 3M4PA 4TKOB 2OTJA 5ELBA 5IY0A 4GN4B 2UXCL 1X6OA 3CMAA 1STEA 4TSSA 1D5ZC 1NE3A 4HIKA 4XYOA 3OMGA 3AYHB 1Y1WG 5JEAG 2YTVA 4X65Q 1HR0L 4JI5Q 3I4MH 3S1QH 3WOFA 1AH9A 4KHZA 1TWGH 1TKWB 3K7AH 3CCUA 3BJUA 4JOIA 3IKJA 3W1BA 1UE1A 1PTOB 3NE5B 1RCVD 1GO3E 1LT3D 2K33A 3D6CA 3KF6B 3NSWA 4UP8A 4DNIA 5I2YA 3Q0AA 3PO3G 3S15B 2YU9B 4WJ3M 1O7YA 4UHVA 3PUVA 4IFDI 2MNAA 3HG9A 4IOAA 4CJ2C 4XT1B 2KCMA 1EEID 1NNXA 1X56A 3CC4A 3FKIG 4APVA 1ONLA 2JA7H 2NVYB 4RGTA 1C48A 2LKVA 1XTCD 1OXSC 3OTOL 4KKUA 4LWCA 3KF6A 1SFOB 2AMCB 1WTWA 4B3RQ 4IPCA 2Z8LA 2QDBA 1CA6A 2N3SA 2E2HB 4UY8C 1GUWA 4A3BH 5C44B 4POFA 4A3GB 4GKJQ 4G4KA 4LMQD 3I90A 4KN4C 3J81c 3T1HQ 1WCMH 5DAUA 1BKBA 1YNJC 4BBRB 2RDGA 3K59A 4RA8A 1B44D 1IBMQ 1IYVA 1XJVA 1RD9D 1STBA 2BE5C 1F2MA 4N8X1 5IT9L 4K2LA 3KYHC 4LF8Q 4LF5Q 3PMFA 4DNRB 1O7ZA 3BZCA 3PV0A 2VZAA 1B9NA 4OIKA 4NPSA 3EROA 2ZXRA 2F3WA 2I46A 3J7A5 4C2MB 2CW0C 2F0OA 4HSVA 5LL6X 1EIYB 2C35B 4HR7B 3CQZH 5FLMH 5JVG3 1AZPA 5A35A 1CTMA 4EQ5A 1ICWA 2ZXPA 5M3FG 2NWGA 2UXDL 1KRSA 3MC0B 2MFIA 4FNFA 2ZT9C 1VQ8A 2HDMA 4JI4Q 2D5DA 4L5QA 3MXGA 5M3MB 3HZXA 3CMEA 3FPUB 3KBGA 3BVZA 4UAIA 2A5HA 2WFWA 1PH3A 2UUAL 4DR5Q 4XDXA 1MBYA 4DUYL 4RWSC 3E0EA 4JBKA 4JW0A 1QZHA 3M85A 5C3EG 1E2ZA 4P71A 1A3UA 2CQAA 1CK1A 1RKNA 2VW9A 3LWEA 3QWNA 2MP1A 5IYBH 4IQZA 3BZKA 4B3TQ 3S24A 5ELCA 2IT1A 2EJGC 3S2DH 4BXXG 1GUNA 4IJLA 1K73C 1BCPB 1TWFH 4IUPA 5E4WC 2D0OA 2K6AA 3M4QA 5D14A 1WYDA 4B3ML 3TZDA 3S14B 1K3BC 3I56A 1B70B 2B2WC 4A3CG 1JJ2A 1VQDA 3OHXC 1RHPA 1GJXA 5D3DA 3W2DA 3A7LA 2RHQB 1XNRL 2AKWB 3BG3A 1WVLA 4ILWA 4CBVA 3R2TA 2RDHA 3NXWA 4ZRZA 1HH2P 2A6ED 2AWOA 2ENBA 3W1GA 1IBKL 3GQBA 1STGA 5M5WH 1MGSA 2R7ZB 2J4XA 4UPAA 5CBEE 2G9HD 3VR5A 4HEDA 1U4LA 4BBSH 2EY1A 3BDCA 3QO2A 3QR8A 3GTLB 4ME3A 3QOJA 1PH2A 1I4XA 1DD2A 1NUCA 1UEAB 3S1NH 3S2HH 5KNCA 3M7NA 1WJJA 3H3VC 3MFGA 3K80C 2EY6A 3SR1A 4BBRG 2B2VA 2YYZA 5FO7B 4N9PA 4K6DA 1H9SB 1Q86C 3Q23A 4K0KL 2MHVA 1Y1WH 2MUYA 5JEAH 4C1NI 3H3VI 5DEHA 5AJ3L 4KMUC 4IUVA 1E7ZA 1RDPD 1HNZQ 5EBDA 4PMBA 3T13A 1N9WA 2BDOA 2EYPA 4PQXA 2Z6KA 4J1MA 2N8NA 4QQBX 4HIDA 1S3OA 2F0QA 1VQJA 4RG1A 4YY3L 3A56A 3PO3H 1H9SA 3TP7A 3SGIA 3I4MB 4JI7Q 3K7AB 4L5SA 1B2TA 3BDOA 1SR3A 1JWUD 4S3SA 3FKIH 5CC4A 5IIFA 4DNTB 1EYDA 4DV4Q 2F0MA 5M3MG 1STAA 3I72A 4K5XA 1F2ZA 4DV2L 1PZID 3CD6A 1NAPA 4DR6Q 2F0WA 1B3QA 5FO8B 1Y8PB 1BOSA 3KOJA 3P7JA 4JI6L 4X3SA 4LFAQ 2ZTCA 1UUPA 2M9VA 5IE8A 5LMUL 1BF4A 3GTPH 1CI3M 1PFMA 2VL6A 2LFNA 4IPGA 2SNSA 1Q7YC 2ZM6L 4ALPA 2K5NA 1F9SA 1K8OA 4YWMA 3TP6A 1VQEA 1VQBA 4JYAQ 2K05A 3BYTB 5GAGC 1WCMB 1KDBA 4H0LC 3F2CA 3TSSA 3H09A 4HIMA 1PH6A 2DUDA 4O1NA 5CV6A 1CA5A 5GAHC 1JQYD 5E7NA 4JI1Q 2EYOA 4WRDA 2PZWA 4KI0A 4P73A 3LNNA 4KKTA 1YJNA 3ULPA 2EJMA 4X66Q 4DXFA 2JYOA 2WKDA 4X62Q 3A8IE 5M3FH 4C1NK 4HSPA 1BBWA 3RLNA 2ZJQA 1STYA 4YCVA 2EXZA 3DM1A 4X6AH 1VF5C 2OQKA 3IFTA 5JPNC 3NQTA 3CP0A 2R7ZG 1FNWA 2V4DA 4EQPA 1LTTD 1PRTF 3CQZB 3JAML 1EY0A 2QF7A 3PF4A 5IWAL 1VQPA 2E2IH 4UP7A 2Q2TA 5C3EH 3S9WA 2L1BA 3A55A 5EAYA 1NMFA 1SMYC 2EOTA 2F1MA 2A69D 2EYHA 2EY5A 1QB5D 3HKZE 5EGTA 1UE7A 1EWIA 3TBIB 5M9OA 2ATWA 3GO5A 4BXXH 1D5XC 1JB3A 1SYGA 3K0YA 1NR2A 1U5KA 2CQOA 2K1BA 3TRZA 4A3DG 3CC7A 4G7OC 3IAYA 2FJ2A 4A3CH 5KYLA 1KNEA 3HKZB 3S2DB 1XTDA 2X6GA 1YHAA 1JOOA 3MZ5A 4F8MA 2RF4A 3OWFA 4A3IG 2ID0A 2ZXOA 4J6HA 1YI2A 4O2DA 2YU9H 2EPBA 1SNPA 4B08A 2NZHA 4A3JB 1H9RA 4DF7A 4Q0FA 3OIPA 4YWKA 2EY2A 4XQNA 2IL8A 3T51B 4UP9A 2A68D 3C3LA 5IT9E 3VR3A 1CKMA 2NVYH 1XNQL 1M8AA 2Q8IB 3BDLA 3U4ZA 4ZAIA 2L11A 4KY7A 3D4DA 2O4XA 3CKIB 4QJFA 3I3CA 4CJ1B 4CJ0B 3PIO3 2E5LQ 2E2HH 2I0QA 3ULLA 1F9PA 2HCCA 1LT5D 2Z4IA 1N34Q 2JA9A 3E6ZX 5KYIA 4BBRH 3HEJA 4JI3Q 4LF4L 1B8AA 2YTYA 3V05A 3C46A 3IL8A 3T16A 1VQ4A 1ICFB 2LS01 4KY6A 1J6QA 2UXBQ 3OW2A 3EQLC 5BR8Q 4YWLA 3DM3A 2F52A 2N88A 4XIGS 2JSOA 1JJCB 4OIJA 3LWUA 1LYLA 4NMZA 4MNOA 4PV1C 2I5HA 1CHPD 4R4QA 1Y1WB 1PRTC 3TN2A 2EIFA 2ES2A 5C5MA 2EYMA 2F0EA 4M1UB 3NTHA 3MHBA 4HTHA 3T1YQ 3EN2A 1HTPA 4GLVB 4R8NA 2BCOA 1YBYA 1PFBA 1QVGA 1D7QA 5HY6A 3D31A 3EIVA 4A76A 5EBCA 4YHHL 5M3MH 3DEOA 2NBFA 2NN6G 4CDDC 2GVBA 2L15A 2RSOA 1G91A 3GP7A 3URYA 1M90C 4AIMA 2VQEL 4N9TA 5IOCA 1XWEA 2R3ZA 2F0TA 2EXDA 4KD4A 1X32A 4PNYA 3FDTA 3VYTA 2KVMA 5I2XA 3HP3A 2UUBQ 3C1FA 2VXWA 2KEDA 2M2LA 4DV7Q 4GNXC 4LF9Q 4FXKC 5JAVA 1YNJD 1JJGA 1XMQQ 2QKIC 1IBLL 4FF4A 1YEZA 2DY7A 3I8ZA 3HOXB 2OT2A 4DK1A 2Q2UA 1Q8KA 1FR3A 5FLXE 5GQOA 3TQYA 2D2CC 2QDLA 2BDNA 4KV6A 2HDLA 4DR4Q 3TREA 2KENA 4RKBA 1GHKA 4DV3L 1PH7A 3CCLA 3E3XA 2A6HD 3PUYA 4LFCL 1SJED 1E2WA 2D9UA 4CGYB 1M1KC 2PZTA 3F2UA 1VQAA 1R9TH 2K32A 4JI8L 5FK9C 5I6WA 4A3JG 4EX5A 4B9WA 2KA7A 2PO4A 1LM0A 1TY2A 2R7ZH 1TWAH 4RHSA 5CORA 1TU2B 5I9PA 3OPOA 1C9OA 4LNQA 1X3QA 3GTLH 1VQNA 1ILQA 2IW3A 4X64Q 1G2TA 1KABA 2RA4A 5IGBA 2Z1CA 1IL8A 5IGFA 2IHEA 3VA7A 5I6YA 1Z47A 2B2UC 1P8LA 3U58A 2E2IB 5HURA 4R9WA 3R3OA 4JI5L 3NBHA 5C3EB 2RBMA 2C5CA 4NXML 3HOWB 3CPWA 3F2BA 5BN3A 1LT6D 3SXHA 4A3DH 2WAQG 4IPHA 1NMGA 1U4RA 1RODA 2X69A 1A8VA 4ZK9B 4LFBQ 3RMHA 4JC0A 1G291 1LTID 4K2KA 4IALA 1I4RA 1ZYRC 2ZTEA 2OXPA 4JCVE 3GDEA 4MIUA 4TQUS 4TVAB 1I94Q 4A3IH 4DR1L 2NVQB 1L1OB 4CHTB 5DNFA 1SE3A 2K50A 1NSNS 1EIGA 4Q5VA 5CYUA 1HQRD 3GV3A 5G3LF 4LF6Q 4DN4M 1MHWC 5FKAC 1SNDA 4B3RL 4OX9Q 3A54A 1Y8NB 4JBMA 2AUKA 1SEBD 3KF8A 4JI2Q 1HCZA 2Z6BA 1PA6A 2JA6B 4GKJL 1MI2A 1L1OA 3L3OC 2BA0A 1HTLD 1O80A 3M3YB 4NXNQ 1KAWA 4R4IA 1L0WA 2R92G 3GV6A 4YCUA 2AQ3B 1JWSD 3JC66 4B3SQ 3I70A 1STNA 4RCNA 3D6WA 3CCSA 4J15A 1CHQD 4PZ8A 2ZJPA 1WOCA 1T9HA 2B2YA 3RLOA 3U9OA 4EQNA 1EFID 4AQYL 2CKZB 2MGSA 5EKIA 5ISRA 2B2TA 3S16H 3FPPA 1NR4A 3AB9A 4OO1G 1S5FD 5KIXA 3E9HA 4WFN3 4C56C 3JAME 3HOXG 3PSIA 1HR0Q 2JA5G 1VQ9A 1W6KA 4HJ8A 4XT3B 4KK7A 5CV8A 1CM9A 4QMGA 2H5XA 4CKEA 2F0FA 2RSNA
chains in the Genus database with same CATH topology
3ITPA 1Q3LA 1WTRA 4ABNA 1KNAA 3N6RA 3EVQA 2KECA 1D5MC 1SDFA 2L5TA 3LX0A 3X3MA 2AQ2B 4K14A 2DY8A 2A6HC 3MXPA 1RTOA 1M4VA 5HGTA 2NN6H 1QCBD 4H44C 2WACA 1EY5A 4UDUC 4K8IA 3VA5A 4I65A 2XN9C 5DM73 5C4HA 5COYA 3DMUA 2VB2X 2NTTA 1VDZA 1ML0D 3AU7A 1DM0B 3D3RA 3PUXA 4BA1I 1KLUD 1OXXK 4PMWA 4RGNA 4FF3A 4C3JB 3OIQA 5I9OA 1EQTA 2O5JC 2F0NA 3I4LA 1FGBD 1C4QA 4KY5A 1A2TA 1CFMA 3NWSA 1HFGA 1PTOD 5JPMC 1ESRA 1SNCA 1HUMA 4K5VA 2AQ1B 5FO9B 1R9TB 2PW7A 4E6IA 2F0VA 2F0GA 4ZKBB 2G9DA 1TWAB 3E5SA 3C2PA 1SMYD 4IUUA 1EWCA 1BO0A 5FLXL 3J80L 1RTNA 2DNCA 3SK5A 1UAPA 5FOBB 1PTOF 3PUWA 5ELFA 3KBXA 3I73A 2KCCA 1AFPA 3NQIA 1PMRA 2F4IA 3GTKB 1S5CD 2XWJB 3BVMA 4DAPA 2MPMA 4V190 1JE4A 2XWBB 4A3DB 3J7YW 1I6VC 2QCPX 1QJOA 5EJWA 1EY9A 1ENCA 2NZ1D 5TSSA 1CT1D 2XNAC 4KTAA 4A3IB 1SE4A 2EVBA 2DN8A 2B39A 1TS5A 2KCNA 1JICA 1GUTA 1DONA 4TRDA 4KHVA 5LL6S 5E1FA 3FVQA 4FVMA 2IWHA 5CV5A 4CKCA 1KLGD 3K5MA 1TR5A 1WD1A 1A6XA 2PYKA 1V1OA 4ULLA 1ENAA 2A74C 1TVXA 5C0XJ 1ZKOA 3E0JA 1PYWD 3VR6A 1J8IA 1SJHD 1U4MA 5KGUA 4QUFA 4OO1H 1TS2A 1XX8A 4H13C 1FNUA 4RH6A 5BN4A 1T5XD 4C3JG 2F0IA 2B63B 4HMIA 1LV9A 3S16B 2L9HA 3J7AV 4XQJA 5J22A 3MXUA 1JOQA 1PRTD 5LHY1 1HPCA 1YNNC 4ZYSA 5K36G 1KDAA 2EJFC 3HOVB 3S1MB 1WTVA 4ZKCB 1I4PA 1EWHA 2PPBC 3BZDB 3G6JB 4RKLA 2K04A 4X3TA 1PTOC 3S17B 4DAYA 3DXJC 3RLFA 1BCPF 1Y8OB 1QOHA 3GTQB 4YIJA 3NUCA 2PZUA 1B3AA 1T5EA 2BA1A 1F9RA 2F0JA 5C0XG 1OO9B 5CBAE 2RDFA 4DGZA 4G7HC 3T56B 1ILPA 5IGGA 1GXDC 2FINB 2K5QA 2FFKB 3HGBA 4MHEA 1QG7A 1JCKB 3GTOB 1NCVA 3QIAA 3Q24A 4GZYC 3T53B 3NBIA 2L0CA 1EY7A 1RF2D 2B8GA 1TQOA 1EYAA 1AN8A 2XVSA 3R2IA 3DWPA 2FHTA 3HOYB 3QB3A 1DCZA 1QNUA 1SE2A 1X3PA 1BNZA 1D6EC 2HCIA 3I91A 1KTKA 3L7ZC 3Q22A 1MSGA 2B8FA 1F9QA 2E2DC 3DWQA 4IFDJ 5KNDA 4U68A 1ET9A 2JA8B 1O7LA 5J1ZA 5M5YB 2ICEC 4IUNA 3A7AB 2NVTB 5IGCA 2NVXB 1PZJD 3OWEB 1BXTA 2XRQD 1CQFA 3ERQA 4Y7NB 1L0YB 2WAQB 1ZYRD 1GOZA 2GA4B 1D1IA 2SEBD 1WTPA 2F0PA 1BCPC 2KOLA 1PZKD 3EA6A 1IKLA 1F77A 4KN7C 2TSSA 3PO2B 2EYJA 1ET6A 4FF2A 4RGMA 4ZLTF 2NUCA 1EQVA 3N52A 4DA2A 1G2SA 1R4PB 1VMCA 1EY4A 1AP0A 1HHVA 2JE6I 3DWAA 4IFDG 3NPPA 5C4XB 4ME5A 4KJNA 4V0BA 2D62A 1H9MA 4K5WA 3CRLC 2B2VC 2RQXA 3BYYB 2R92B 5EPLA 3M7GA 4WORA 1SYFA 2B2WA 3OSOA 1DOLA 1QWYA 2F0HA 1QE6A 3QJYA 4HAEA 5BN5A 2SOBA 4U673 1SYEA 4X3KA 2JA5B 1SAPA 1TY0A 3J80E 3OMCA 3O13A 2X6LA 5A2QL 1TWCB 2WV6D 5K36H 1HXYD 4OHJA 2L55A 1LTAD 1XXGA 3NTIA 2KEEA 3D4WA 3MFYA 4H7BA 2Z4HA 3VYRA 4QIWB 3U9SA 1GUSA 2WB1B 4FXDA 4HN7A 1AEXA 5C0XH 1TIID 4ZUJA 2K28A 4L63B 4WJWA 3GTGB 3VR4A 4KD3A 3DEPA 1I4QA 5F2DA 1Q1EA 5G3LD 2FMMA 1SNMA 1LTSD 2M00A 3D4RA 2QEJC 3RUZA 3OW7A 2EDGA 1D1KA 4DXGA 2NTSA 1SNQA 2LY7A 3SVMA 2EE1A 1SYDA 2HQEA 5C4JB 3NTKA 2AWNA 3R93A 2K01A 3A8JE 4DAVA 1BQQT 4F87A 2RVLA 1Y69U 3VYUA 4QCLA 1STHA 1CZWA 1S5ED 3WOEA 1EU3A 1PDQA 1W6JA 2RKSA 5M5XB 1EZ8A 3SHLA 1U9RA 2KJXA 2F0SA 1BDOA 2C9OA 3GD7A 5CV7A 1A3TA 2RSNA 1JOKA 3K5OA 3UI2A 3KLRA 2VUMB 2NN6I 1EIHA 3P75A 1BUVT 3BVGA 5CV9A 4QUCA 3H0GB 5JVH3 4IZ8A 2I07B 5D3IB 2J0TD 2OF1A 1SBBB 5IGDA 2MJ8A 3SE0A 1F2LA 1GUOA 5KRUA 1I6HB 1CZGA 4XTCS 3TP5A 3TZUA 2CVRA 3S1RB 2TMPA 4IFDH 2E75C 3QG1A 3M4OB 1TT2A 1B50A 1TS3A 2E76C 2ICIA 3R8BA 3SEBA 1HQMC 3MWYW 1C8CA 4IN3A 3K58A 5EKLA 2LMCB 3MEHA 3RZOB 1V43A 3ONAB 5EPKA 3J7AF 1B9MA 3ZYYX 3MVVA 2SNMA 1BR9A 4L6TB 2HUGA 1LACA 3VR2A 3J81L 3G7LA 4EVOA 1YNND 3NP8A 3PUZA 2E74C 2KHSA 1MSHA 1LT4D 4FXGC 4KKSA 1BBXC 3HOZB 1EZ6A 5CMDA 1WTQA 1HA5A 1B1ZA 1S5DD 1OXVA 3DHQA 2Q8RE 4C3IB 4RFBA 5C4ZA 3ND8A 4AYBB 2E2JB 3I4NB 1DZ1A 4MN3A 1PRTB 2PNRC 4B9XA 1O78A 4A3EB 4NP5A 1A2UA 3K57A 3V96A 2IX3A 4C3HB 3CRKC 3HOUB 2JXMB 1IYUA 1Q90A 4BWGB 1K83B 5EPJA 3GTJB 2PCFB 2JP1A 4BA2I 1SYBA 2JEBI 4G7ZC 4EQOA 3A8KE 2PMZB 2CHBD 5ELEA 1EY8A 3KK7A 1E0BA 2XIWA 4LAAA 1EOTA 1AW7A 2J7ZA 5C3XA 4RAUC 1IW7D 5JJZA 2A73B 4XYQA 4OO1I 1TS4A 1EEFD 1I50B 3CU7A 2XSCA 4OGQC 3WDNA 2EZVA 3TMEA 5A2QE 1OXUA 4RGOS 1B4OA 3AMUA 1LABA 1PFNA 1MD2D 2Q8TA 4JK1C 1R4QB 1HA6A 2IPKD 2NB0A 3S1QB 1DJRD 1TWGB 3KLSA 2FMCA 2K5WA 1G6ZA 5C3WA 5NUCA 3OOCA 2PQEA 2R61A 4NW2A 2H4OA 2L12A 1WTXA 1BCPD 3W3AA 2OEOA 2VB3X 4R8IA 3TP8A 2JA7B 1KAAA 3SDZA 1GUGA 4FF1A 3SK8A 1L0XB 1XYIA 3MAQA 1KDCA 4FYDA 4LJZC 2EYFA 5C6AA 2B2UA 5KEEA 4C3IG 4A3BB 4XQQA 5I4DA 3EFXD 2AUJD 1EU4A 4A3KB 1DOKA 2R93B 1SYCA 4F7XA 2N55A 4HCSA 1HFNA 4G57A 4DU9A 3HS0C 2B2YC 2F0UA 1S4ZA 2KQ3A 4C3HG 4ID6A 2B2TC 4FP5D 1AZQA 4F88A 4RHRA 1LTBD 4ZUIA 1DOMA 4LK1C 1VMPA 4K8JA 1I4GA 4L8JA 4PMCA 2IX0A 2A6EC 5ELDA 2O5IC 4DFAA 3BS1A 1QNKA 1V1PB 1Y1VB 1TWHB 2NYZD 4BY1B 3C1EA 2JEAI 1UNSA 1SXTA 1LTGD 1HRJA 2VNUD 1EY6A 3MA2B 5CR3A 5D65A 3SK6A 3H91A 1Q12A 1IW7C 1V8QA 1V1PA 4CKBA 2Y0SB 3NK9A 3GTMB 2F03A 2EYLA 3FEWX 4EGVA 1Z7TA 1F2YA 1I4HA 4X3UA 4Z9CB 1TWFB 1PTOH 3FRPB 3H94A 1VCIA 5AFWA 1IKMA 2K7VA 5CV4A 4QB4A 4BY7B 2DNEA 3PIP3 3RZDB 3V2TA 1A3VA 5K5PA 3MXNA 1FNVA 5DM63 4J8QA 3DUZA 3KLSX 1U4PA 5M5WB 4BS9A 4ZQ3A 1LTRD 1JR0D 1SNOA 3L9AX 4BBSB 1LO5D 3S1NB 2PW5A 3S2HB 3ND9A 2F0LA 3K5NA 1H9KA 2R6GA 4A3MB 1DYQA 1LLRD 1ZXTA 3J81E 1B53A 5T1GA 4DK0A 1RJTA 1ZEQX 3Q6SA 4KJOA 3T4AC 1Q8IA 2F0DA 2IX1A 4FO2A 2WKCA 3IFDA 4I7ZC 3NWTA 3SK4A 2QILA 4M8AA 1JC7A 3K6OA 2IJ0A 2F3VA 3PO3B 2WIIB 4A93B 1WTOA 3HRZC 3P20A 2K5DA 5C0XI 1K8MA 1VF7A 3NHHA 3FKIB 2L4NA 1ENFA 5IODA 2BOSA 1IHZA 1JORA 2KUMA 4QF4A 5CGKA 1JWMD 3FMCA 1DXMA 2A69C 5J39A 4IUTA 4XXEA 1G8ZD 3X3NA 1QILA 4RCOA 1EYCA 4HMJA 2BE5D 2F0KA 4O42A 4OL7A 1GHJA 1I3QB 3GTPB 1H9JA 1S5BD 3TDQA 1A15A 1FD7D 3P1HA 1ESFA 5EKKA 4A3FB 3H6MA 5JEAJ 2CW0D 5KNBA 3MTSA 3KUPA 4HCEA 1E2VA 1OXTA 1EL0A 5IGEA 1WD0A 1SSOA 2H1EA 4NDXA 2K03A 3VYSA 1HUNA 2WINB 5M3FB 4IUQA 5E4XA 3K5LA 4ODGA 4P2CB 3QOLA 1II3A 2A68C 1FYCA 3CHBD 1PLFA 2XRSD 4NKLA 5E3FA 1D2BA 2WP8J 3RD4A 4IURA 1J9OA 2O2LD 2SDFA 1CQVA 1Z6HA 5JOBA 5EQ0A 4K6LA 3EJIA 4JBWA 5T1IA 3M4YA 1Q1BA 1PXUA 3D8GA 4TKOB 5ELBA 1STEA 4TSSA 1D5ZC 4XYOA 3OMGA 5JEAG 3WOFA 4KHZA 1TKWB 3IKJA 1PTOB 3NE5B 1RCVD 1LT3D 2K33A 3D6CA 3NSWA 5I2YA 3Q0AA 3S15B 2YU9B 1O7YA 3PUVA 4IFDI 3HG9A 4CJ2C 4XT1B 1EEID 1ONLA 2NVYB 4RGTA 1C48A 2LKVA 1XTCD 1OXSC 4KKUA 1SFOB 1WTWA 2Z8LA 2QDBA 1CA6A 2E2HB 1GUWA 5C44B 4A3GB 4G4KA 4LMQD 3I90A 4KN4C 5DAUA 1YNJC 4BBRB 2RDGA 3K59A 4RA8A 1B44D 1IYVA 1RD9D 1STBA 2BE5C 1F2MA 5IT9L 4K2LA 3PMFA 4DNRB 1O7ZA 3PV0A 1B9NA 4OIKA 3EROA 2ZXRA 2F3WA 2I46A 4C2MB 2CW0C 2F0OA 4HSVA 5LL6X 4HR7B 5JVG3 1AZPA 5A35A 1CTMA 1ICWA 2ZXPA 2NWGA 3MC0B 4FNFA 2ZT9C 2HDMA 2D5DA 3MXGA 5M3MB 3HZXA 3FPUB 3KBGA 3BVZA 4UAIA 2A5HA 4XDXA 1MBYA 4RWSC 3M85A 1E2ZA 1A3UA 2CQAA 1CK1A 1RKNA 3LWEA 3QWNA 2MP1A 4IQZA 5ELCA 2IT1A 2EJGC 1GUNA 1BCPB 5E4WC 4IUPA 2K6AA 5D14A 3TZDA 3S14B 2B2WC 3OHXC 1RHPA 1GJXA 5D3DA 3W2DA 3A7LA 3BG3A 1WVLA 4ILWA 4CBVA 3R2TA 2RDHA 3NXWA 4ZRZA 2A6ED 2AWOA 2ENBA 3GQBA 1STGA 1MGSA 2R7ZB 2J4XA 5CBEE 2G9HD 3VR5A 4HEDA 1U4LA 2EY1A 3BDCA 3QO2A 3GTLB 3QOJA 1I4XA 1DD2A 1NUCA 1UEAB 5KNCA 3M7NA 3H3VC 3MFGA 2EY6A 3SR1A 2B2VA 2YYZA 5FO7B 4N9PA 4K6DA 1H9SB 3Q23A 2MHVA 2MUYA 5JEAH 4C1NI 5DEHA 4KMUC 4IUVA 1RDPD 5EBDA 4PMBA 3T13A 2BDOA 2EYPA 4PQXA 4J1MA 2F0QA 3A56A 1H9SA 3TP7A 3I4MB 3K7AB 1B2TA 3BDOA 1JWUD 4S3SA 5CC4A 5IIFA 4DNTB 1EYDA 2F0MA 1STAA 3I72A 4K5XA 1F2ZA 1PZID 1NAPA 2F0WA 5FO8B 1Y8PB 1BOSA 3P7JA 4X3SA 1UUPA 2M9VA 1BF4A 1CI3M 1PFMA 2LFNA 2SNSA 1F9SA 1K8OA 3TP6A 2K05A 3BYTB 1WCMB 1KDBA 4H0LC 3TSSA 3H09A 4O1NA 5CV6A 1CA5A 1JQYD 2EYOA 4WRDA 2PZWA 4KI0A 3LNNA 4KKTA 2EJMA 4DXFA 2JYOA 2WKDA 3A8IE 4C1NK 4HSPA 1STYA 2EXZA 3DM1A 1VF5C 3IFTA 5JPNC 3NQTA 1FNWA 2V4DA 4EQPA 1LTTD 1PRTF 3CQZB 3JAML 1EY0A 2QF7A 3S9WA 2L1BA 3A55A 2EOTA 1SMYC 2F1MA 2A69D 2EYHA 2EY5A 1QB5D 5EGTA 3TBIB 5M9OA 3GO5A 1D5XC 1JB3A 1SYGA 3K0YA 1NR2A 2K1BA 4G7OC 3IAYA 2FJ2A 5KYLA 1KNEA 3HKZB 3S2DB 2X6GA 1JOOA 3MZ5A 4F8MA 3OWFA 2ID0A 2ZXOA 4J6HA 2EPBA 1SNPA 4B08A 4A3JB 1H9RA 4DF7A 4Q0FA 3OIPA 4XQNA 2EY2A 2IL8A 3T51B 2A68D 3C3LA 5IT9E 3VR3A 1M8AA 2Q8IB 3BDLA 4ZAIA 2L11A 4KY7A 3D4DA 2O4XA 3CKIB 3I3CA 4CJ1B 4CJ0B 3PIO3 1F9PA 2HCCA 1LT5D 2Z4IA 3E6ZX 5KYIA 3HEJA 3V05A 3C46A 3IL8A 3T16A 2LS01 4KY6A 3EQLC 2N88A 4XIGS 2JSOA 4OIJA 3LWUA 4NMZA 4PV1C 1CHPD 1Y1WB 1PRTC 3TN2A 5C5MA 2EYMA 2F0EA 4M1UB 3NTHA 3MHBA 4HTHA 1HTPA 4R8NA 2BCOA 1PFBA 3D31A 5EBCA 3DEOA 2NBFA 2NN6G 2RSOA 1G91A 3GP7A 3URYA 4N9TA 5IOCA 1XWEA 2R3ZA 2F0TA 4KD4A 1X32A 4PNYA 3FDTA 3VYTA 2KVMA 5I2XA 3HP3A 3C1FA 2VXWA 2KEDA 2M2LA 4FXKC 5JAVA 1YNJD 2QKIC 4FF4A 2DY7A 3I8ZA 3HOXB 2OT2A 4DK1A 1FR3A 5FLXE 2D2CC 2BDNA 4KV6A 2HDLA 4RKBA 1GHKA 2A6HD 3PUYA 1SJED 1E2WA 2D9UA 4CGYB 2PZTA 3F2UA 2K32A 5FK9C 5I6WA 4B9WA 2KA7A 2PO4A 1TY2A 4RHSA 5CORA 1TU2B 5I9PA 3OPOA 1X3QA 1ILQA 2IW3A 1G2TA 1KABA 2RA4A 5IGBA 2Z1CA 1IL8A 5IGFA 3VA7A 5I6YA 1Z47A 2B2UC 2E2IB 5HURA 4R9WA 3R3OA 3NBHA 5C3EB 2RBMA 2C5CA 3HOWB 5BN3A 1LT6D 3SXHA 1U4RA 1RODA 2X69A 4ZK9B 3RMHA 1G291 1LTID 4K2KA 4IALA 1I4RA 1ZYRC 2OXPA 4MIUA 4TQUS 2NVQB 4CHTB 5DNFA 1SE3A 1NSNS 1EIGA 4Q5VA 5CYUA 1HQRD 3GV3A 5G3LF 4DN4M 5FKAC 1SNDA 3A54A 1Y8NB 2AUKA 1SEBD 3KF8A 2JA6B 1HCZA 1MI2A 3L3OC 2BA0A 1HTLD 1O80A 3M3YB 3GV6A 2AQ3B 1JWSD 3I70A 1STNA 4RCNA 3D6WA 1CHQD 2B2YA 3U9OA 4EQNA 1EFID 2MGSA 5EKIA 5ISRA 2B2TA 3FPPA 1NR4A 3AB9A 4OO1G 1S5FD 5KIXA 4WFN3 4C56C 3JAME 1W6KA 4XT3B 4KK7A 5CV8A 1CM9A 4QMGA 4CKEA 2F0FA 5C5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITP A;  3SK5 A;  5IGF A;  5C3W A;  3EVQ A;  5DEH A;  4IUN A;  5NUC A;  1KDA A;  3NK9 A;  5I6Y A;  3DHQ A;  2PQE A;  3S9W A;  5IGC A;  3LX0 A;  3HZX A;  3P75 A;  5C4Z A;  4K14 A;  3D4W A;  5CV9 A;  4H7B A;  3OMG A;  4PMB A;  3NHH A;  3T13 A;  2EYL A;  2EYH A;  5HUR A;  2EY5 A;  5C5M A;  3R3O A;  4RKL A;  1F2Y A;  2EYP A;  3MXP A;  5EGT A;  2EYM A;  2RBM A;  2F0E A;  4J1M A;  5IOD A;  3ERQ A;  1IHZ A;  4IZ8 A;  4B9X A;  1JOR A;  3MHB A;  4HTH A;  2F0Q A;  5HGT A;  1A3U A;  4QF4 A;  4R8N A;  3SXH A;  5CGK A;  5M9O A;  1AEX A;  1A2U A;  1RKN A;  2OEO A;  4NP5 A;  3TP7 A;  2WAC A;  1SYG A;  5CV4 A;  1EY5 A;  2F0P A;  2OF1 A;  4YIJ A;  3NUC A;  3TP8 A;  5J39 A;  2PZU A;  4QB4 A;  4ZUJ A;  1KAA A;  4K8I A;  4K2K A;  3SK8 A;  4IAL A;  3D8G A;  3D6C A;  1EYC A;  1KDC A;  4S3S A;  5IGD A;  4HMJ A;  2F0J A;  2OXP A;  3VA5 A;  4I65 A;  3V2T A;  1A3V A;  5K5P A;  4KD3 A;  2F0K A;  4MIU A;  2EYF A;  4OL7 A;  5CC4 A;  1EYD A;  5C6A A;  5IIF A;  1EY9 A;  2RDF A;  4N9T A;  5IOC A;  2F0M A;  4DGZ A;  5KEE A;  5KRU A;  2EYJ A;  5F2D A;  1ENC A;  5C4H A;  3DMU A;  2F0T A;  1STA A;  4K5X A;  4KD4 A;  1F2Z A;  1SYB A;  4PNY A;  1JOO A;  3MZ5 A;  4KTA A;  3TP5 A;  5IGG A;  1NSN S;  3P1H A;  4F8M A;  1SNM A;  4EQO A;  3C1F A;  1SYC A;  1EQV A;  2NUC A;  3OWF A;  4ZQ3 A;  2LKV A;  5EKK A;  2F0W A;  5C5L A;  4F7X A;  4J6H A;  1SND A;  3H6M A;  5JAV A;  4G57 A;  2M00 A;  4DU9 A;  3RUZ A;  1SNP A;  1TT2 A;  1SNO A;  4TRD A;  2F0U A;  1EY4 A;  2KQ3 A;  1EY8 A;  4KHV A;  2QDB A;  5KYL A;  4DF7 A;  1SNQ A;  4ID6 A;  5E1F A;  2EY2 A;  1SYD A;  4LAA A;  5CV5 A;  5I9O A;  5IGE A;  2HQE A;  3NXW A;  2F0N A;  1TR5 A;  2SNS A;  4ME5 A;  2ENB A;  4KJN A;  4NDX A;  5DAU A;  5C3X A;  2PYK A;  4ZUI A;  2PW5 A;  1STG A;  3TP6 A;  5EKL A;  4KY5 A;  1EY7 A;  4K5W A;  4K8J A;  1ENA A;  2F0L A;  3BDL A;  4KV6 A;  3MEH A;  4WOR A;  4KY7 A;  1TQO A;  1EYA A;  1KDB A;  3D4D A;  4RKB A;  1A2T A;  1SYF A;  1STB A;  2O4X A;  3OSO A;  4ODG A;  4PMC A;  1F2M A;  1II3 A;  3QOL A;  5CV6 A;  2F0H A;  4K2L A;  2EYO A;  4WRD A;  2PZW A;  1STN A;  2EY1 A;  3BDC A;  4NKL A;  5KGU A;  2PZT A;  3PMF A;  3QB3 A;  5E3F A;  3QOJ A;  3MVV A;  4DFA A;  2SNM A;  1SNC A;  1STH A;  1NUC A;  4K5V A;  4KJO A;  3TME A;  2SOB A;  3U9O A;  4EQN A;  5I6W A;  4B9W A;  2F0D A;  5KYI A;  3HEJ A;  1SYE A;  5ISR A;  3ERO A;  5JOB A;  2F3W A;  2PW7 A;  2RKS A;  4E6I A;  2F0V A;  3EJI A;  2F0I A;  4EVO A;  3C1E A;  1EZ8 A;  3NP8 A;  3T16 A;  4HMI A;  5KIX A;  5I9P A;  1STY A;  2F0O A;  3SHL A;  4KY6 A;  3SK4 A;  1U9R A;  2EXZ A;  3OMC A;  4NMZ A;  2KHS A;  2F0S A;  2F0G A;  2EY6 A;  3SR1 A;  1EY6 A;  5CV7 A;  1A3T A;  3NQT A;  5J22 A;  5CV8 A;  3E5S A;  1JOQ A;  4N9P A;  4K6D A;  1JOK A;  4EQP A;  4QMG A;  5CR3 A;  3SK6 A;  2F0F A;  5J1Z A;  1EZ6 A;  2F3V A;  1EY0 A;  1KAB A;  5IGB A; 
#chains in the Genus database with same CATH topology
 3ITP A;  1Q3L A;  1WTR A;  4ABN A;  1KNA A;  4JI4 L;  4GKK L;  3N6R A;  3EVQ A;  2KEC A;  1D5M C;  1SDF A;  2L5T A;  3LX0 A;  3CCJ A;  3X3M A;  2AQ2 B;  4K14 A;  3S17 H;  2DY8 A;  1GKH A;  2HHH L;  2A6H C;  1SLJ A;  3MXP A;  1RTO A;  1M4V A;  4P72 A;  3PCO B;  4DR3 L;  5HGT A;  2NN6 H;  1HNW L;  1QCB D;  1YHB A;  3U50 C;  4H44 C;  3G6E A;  2WAC A;  1YZ6 A;  2IY5 B;  1EY5 A;  3OTO Q;  4UDU C;  2B29 A;  4K8I A;  4B3T L;  4DPG A;  1IZ6 A;  3VA5 A;  4I65 A;  2Z0S A;  2XN9 C;  1VQ6 A;  5DM7 3;  5C4H A;  3J80 i;  5COY A;  1ASZ A;  3DMU A;  2VB2 X;  2NTT A;  2G5D A;  2VY3 A;  1VDZ A;  1ML0 D;  3AU7 A;  3HOW G;  1DM0 B;  1DGS A;  3D3R A;  3PUX A;  2CFM A;  4RMF A;  1SRU A;  1TXY A;  1KLU D;  4BA1 I;  1OXX K;  4PMW A;  4RGN A;  1J5E L;  4FF3 A;  4C3J B;  3OIQ A;  5I9O A;  1EQT A;  2O5J C;  2F0N A;  1MKH A;  3I4L A;  1FGB D;  1PHJ A;  1C4Q A;  4KY5 A;  1NBW A;  1AE3 A;  2K5H A;  1A2T A;  1CFM A;  4A3J H;  2UXD Q;  2LSS A;  3NWS A;  1HFG A;  2Z9H A;  1KIX A;  1PTO D;  1U0L A;  3AFP A;  1ESR A;  5JPM C;  3UDI A;  1SNC A;  1HUM A;  4K5V A;  1VQ7 A;  1G6P A;  2AQ1 B;  1VQO A;  1W2B A;  5FO9 B;  3FP9 A;  4HJA A;  1R9T B;  2JA6 G;  2PW7 A;  4E6I A;  2UUC Q;  2F0V A;  4DUY Q;  2F0G A;  4ZKB B;  2G9D A;  1TWA B;  3E5S A;  1UWV A;  3C2P A;  1SMY D;  4IUU A;  1EWC A;  5H1S E;  1KD1 C;  1BO0 A;  3RN2 A;  5FLX L;  1N8R C;  2NVX H;  1FGU A;  3J80 L;  4JV5 L;  1RTN A;  2DNC A;  3SK5 A;  1UAP A;  5FOB B;  2VUM G;  1PTO F;  4KHP L;  3PUW A;  5ELF A;  2K4K A;  3KBX A;  3I73 A;  2KCC A;  1VQI A;  1AFP A;  4B3M Q;  3NQI A;  1RIP A;  1PMR A;  2F4I A;  3H0G G;  3GTK B;  5JJI A;  1IXR A;  4GS3 A;  1S5C D;  2XWJ B;  3BVM A;  4DAP A;  2MPM A;  2QEX A;  4V19 0;  1PYS B;  1JE4 A;  1XNR Q;  2XWB B;  4A3D B;  3J7Y W;  1EQR A;  2MO1 A;  1I6V C;  2QCP X;  1GD7 A;  1GVP A;  2PI2 E;  2UU9 L;  4GOP B;  3ERS X;  1QJO A;  5EJW A;  1N36 L;  1EY9 A;  1ENC A;  3I2Z A;  1IBK Q;  2NZ1 D;  5TSS A;  1CT1 D;  4R1J A;  2XNA C;  4KTA A;  4A3I B;  1SE4 A;  2EVB A;  2DN8 A;  2B39 A;  1TS5 A;  4KLK A;  2KCN A;  3UDX A;  1JIC A;  3CPF A;  1GUT A;  1DON A;  4TRD A;  3A5U A;  4GOP A;  4KHV A;  5LL6 S;  5E1F A;  3FVQ A;  4FVM A;  2IWH A;  5CV5 A;  4QL5 A;  4CKC A;  1KLG D;  3K5M A;  2K5V A;  2R92 H;  1TR5 A;  1WD1 A;  1B7Y B;  1A6X A;  3VDY A;  2PYK A;  1MIU A;  4MTK A;  3K8A A;  1V1O A;  1LTL A;  4ULL A;  1ENA A;  2A74 C;  1QVC A;  1TVX A;  1N33 L;  5C0X J;  1ZKO A;  3E0J A;  1PYW D;  3VR6 A;  1J8I A;  2XGT A;  1SJH D;  1VQL A;  2PI2 A;  4ZCK A;  3JAM c;  1U4M A;  5KGU A;  4K0K Q;  4QUF A;  4OO1 H;  3I4O A;  1TS2 A;  3B6Y A;  1XX8 A;  3HOX H;  4DUZ L;  2JA5 H;  5AJ3 Q;  4H13 C;  1FNU A;  4RH6 A;  5BN4 A;  1T5X D;  1EUJ A;  4C3J G;  2F0I A;  1XPU A;  2B63 B;  4HMI A;  5LMN W;  3H3V H;  1LV9 A;  3S16 B;  4LUO A;  2L9H A;  4JOI C;  3J7A V;  4XQJ A;  1I5F A;  5J22 A;  4YY3 Q;  3MXU A;  3CCM A;  1JOQ A;  1PRT D;  1QUQ B;  4DAY B;  5LHY 1;  3HFZ B;  1HPC A;  1YNN C;  5L37 A;  3CF5 A;  2D0P A;  4ZYS A;  3A74 A;  5K36 G;  1NTG A;  1KDA A;  2EJF C;  3HOV B;  3S1M B;  1WTV A;  4ZKC B;  1I4P A;  1PH9 A;  1EWH A;  4DR7 L;  2PPB C;  3BZD B;  4CDF C;  3G6J B;  4RKL A;  2K04 A;  3I4N G;  4X3T A;  1UEB A;  4HJ5 A;  4DV2 Q;  1PTO C;  3S17 B;  1QUQ A;  4DAY A;  3DXJ C;  3RLF A;  1BCP F;  1Y8O B;  2K52 A;  1QOH A;  2KCT A;  1EOV A;  3GTQ B;  4YIJ A;  2MO0 A;  4DV1 L;  3NUC A;  2OCE A;  2PZU A;  2K14 A;  3GTG H;  1B3A A;  4JI6 Q;  1T5E A;  1BVS A;  4A4I A;  2BA1 A;  3M9B A;  4JI0 L;  5LMU Q;  1F9R A;  3AQQ A;  2F0J A;  3KJO A;  5C0X G;  3HOU G;  1OO9 B;  3UE1 A;  2FXQ A;  5CBA E;  2RDF A;  3HOW H;  1CKO A;  4DGZ A;  2ZM6 Q;  4G7H C;  3T56 B;  2MQH A;  2LXJ A;  4OEM B;  4DKA C;  1ILP A;  2VS1 A;  5IGG A;  1GXD C;  2FIN B;  2K5Q A;  2FFK B;  1H95 A;  3HGB A;  4MHE A;  1QG7 A;  1EIF A;  1JCK B;  3GTO B;  2DJF C;  1NCV A;  3QIA A;  3Q24 A;  5C4J H;  4GZY C;  1PH1 A;  1SMX A;  3T53 B;  4IJH A;  2NVQ H;  1Z9F A;  3NBI A;  2L0C A;  1KC8 C;  1EY7 A;  1PYB A;  1RF2 D;  2B8G A;  1TQO A;  1EYA A;  1AN8 A;  2XVS A;  3ULJ A;  2HQL A;  3STB C;  3R2I A;  3DWP A;  1K3R A;  2FHT A;  3HOY B;  4AH6 A;  3RN5 A;  2PQA B;  2JA6 H;  3QB3 A;  2KHJ A;  1DCZ A;  2ZTD A;  1Q46 A;  5IWA Q;  1QNU A;  1SE2 A;  1X3P A;  1BNZ A;  1D6E C;  4OXP A;  2HCI A;  3I91 A;  1KTK A;  3L7Z C;  3M3Y H;  1X54 A;  3Q22 A;  1K9M C;  1MSG A;  2B8F A;  1F9Q A;  2E2D C;  3DWQ A;  4IFD J;  1P16 A;  2JQO A;  5KND A;  1WTH A;  2WAQ E;  4U68 A;  1ET9 A;  2VUM H;  2JA8 B;  2PQA A;  2CCZ A;  1O7L A;  3NEN A;  5DLQ E;  5J1Z A;  1N32 L;  1PVO A;  5M5Y B;  2A19 A;  2ICE C;  4IUN A;  1ASY A;  3H0G H;  3A7A B;  2NVT B;  5IGC A;  2NVX B;  1K28 A;  2VQF L;  1PZJ D;  3OWE B;  1BXT A;  2XRQ D;  1CQF A;  3ERQ A;  3PGZ A;  4Y7N B;  1L0Y B;  2WAQ B;  1ZYR D;  1GOZ A;  2GA4 B;  2B63 G;  1D1I A;  2SEB D;  2F4V L;  1WTP A;  2F0P A;  2EQS A;  1BCP C;  2KOL A;  1PZK D;  3EA6 A;  1S40 A;  1IKL A;  1C7Y A;  2CH4 W;  1F77 A;  3U4V A;  3PIP A;  3H15 A;  4DV6 L;  1I6H H;  4KN7 C;  3HOV G;  2TSS A;  3PO2 B;  4FDB A;  2EYJ A;  4L5R C;  1XNQ Q;  4DV0 L;  1ET6 A;  4FF2 A;  2R7F A;  4RGM A;  1FJG L;  3M4O H;  4ZLT F;  2NUC A;  1EQV A;  3N52 A;  4A3K G;  3AFQ A;  4DA2 A;  1G2S A;  2R93 G;  1R4P B;  1VMC A;  3UDG A;  1EY4 A;  1AP0 A;  1HHV A;  3UE0 A;  3TS2 A;  4DR2 L;  2JE6 I;  3DWA A;  4IFD G;  3NPP A;  4LF4 Q;  5C4X B;  4ME5 A;  4KJN A;  4LF7 Q;  3KFU A;  4V0B A;  2D62 A;  4DV5 L;  1O7I A;  1HNX L;  1H9M A;  4K5W A;  3CRL C;  3IRB A;  2B2V C;  2RQX A;  3BYY B;  4O0A A;  4R4T A;  5EPL A;  3M7G A;  4WOR A;  2R92 B;  1SYF A;  2B2W A;  5LMN L;  3OSO A;  1DOL A;  1QWY A;  2F0H A;  1PFS A;  1QE6 A;  3QJY A;  4C3J H;  4HAE A;  5BN5 A;  2SOB A;  4U67 3;  1YHQ A;  1SYE A;  4X3K A;  2HIX A;  2JA5 B;  2Z6K C;  1SAP A;  1Y1V G;  1TY0 A;  3J80 E;  3OMC A;  4BY1 G;  3O13 A;  2X6L A;  5A2Q L;  1TWC B;  1VQC A;  1XMO L;  2WV6 D;  5K36 H;  1HXY D;  4QIW E;  5IYC G;  4OHJ A;  2L55 A;  5GAE C;  1LTA D;  2WB1 E;  1XXG A;  4YHH Q;  3NTI A;  3HOY G;  3I4N H;  2KEE A;  2QGQ A;  1X3G A;  3D4W A;  3MFY A;  4H7B A;  3J81 j;  2VQE Q;  4A3L G;  2Z4H A;  4GN3 B;  1FL0 A;  1Q81 C;  3VYR A;  4GN5 A;  4QIW B;  3U9S A;  4DAM A;  1GUS A;  3NBH B;  2WB1 B;  4FXD A;  3CCR A;  4HN7 A;  1AEX A;  5C0X H;  2YTX A;  1TII D;  3HOU H;  1CSQ A;  1V1Q A;  1X55 A;  4ZUJ A;  2K28 A;  4L63 B;  4I7A A;  2JA8 G;  1K83 H;  4WJW A;  3GTJ H;  1IBL Q;  4BY7 G;  3ER0 A;  1VQM A;  3GTG B;  1WI5 A;  2I5L X;  3VR4 A;  4KD3 A;  4OON A;  3DEP A;  5J3B A;  3G48 A;  1I4Q A;  3CXC A;  1VQG A;  3GTK H;  5F2D A;  2BH2 A;  4X65 L;  1Q1E A;  5G3L D;  2FMM A;  3Q8D A;  1SNM A;  1LTS D;  4DV3 Q;  1EFW A;  4LFC Q;  2M00 A;  3D4R A;  2QEJ C;  3RUZ A;  3OW7 A;  2EDG A;  4DK6 C;  4WJ4 A;  1D1K A;  4DXG A;  2CWA A;  4JI8 Q;  2NTS A;  4H02 A;  1SNQ A;  1E1T A;  2LY7 A;  3SVM A;  1HZ9 A;  1SYD A;  2EE1 A;  2HQE A;  5C4J B;  3NTK A;  4POG A;  3KF8 B;  2AWN A;  4NXN L;  3R93 A;  1YJW A;  1PH8 A;  2HT1 A;  2K01 A;  3PO2 G;  3A8J E;  4DAV A;  1BQQ T;  4F87 A;  2RVL A;  1Y69 U;  3VYU A;  4A3M G;  5IT9 c;  4P75 A;  4QCL A;  3UDF A;  1STH A;  1CZW A;  3D0F A;  1SN8 A;  1S5E D;  3WOE A;  1EU3 A;  1KQS A;  1PDQ A;  3T1H L;  1W6J A;  2RKS A;  1A63 A;  5M5X B;  1EZ8 A;  4MTN A;  5C4X G;  3SHL A;  3A5Z B;  4HJ7 A;  1U9R A;  4NXM Q;  1IBM L;  2KJX A;  2F0S A;  1BDO A;  2C9O A;  3GD7 A;  5CV7 A;  1A3T A;  1EQQ A;  4OWT B;  1JOK A;  3K5O A;  3UI2 A;  2YV5 A;  1X65 A;  4LF8 L;  3K0X A;  3KLR A;  4LF5 L;  2VUM B;  4A93 G;  2NN6 I;  1EIH A;  3P75 A;  1BUV T;  4A75 A;  2B63 H;  2RCN A;  3BVG A;  1YNX A;  5CV9 A;  2UXC Q;  2ZJR A;  2GVA A;  4LUZ A;  4QUC A;  4DR1 Q;  3H0G B;  1HZC A;  5JVH 3;  4IZ8 A;  1CSP A;  2I07 B;  1K0S A;  5D3I B;  1GM5 A;  3J81 i;  2J0T D;  2OF1 A;  1SBB B;  3HOV H;  3S1M H;  4JVZ A;  4QGU A;  5IGD A;  3CCE A;  2MJ8 A;  3SE0 A;  1F2L A;  1GUO A;  5KRU A;  4A3K H;  2Q2H A;  1IL2 A;  4DR5 L;  2R93 H;  1I6H B;  1CZG A;  4IOC A;  4XTC S;  3TP5 A;  3GTQ H;  3TZU A;  2CVR A;  2JN4 A;  3S1R B;  2TMP A;  4JBJ A;  4IFD H;  2E75 C;  1SRO A;  3E9I A;  2WB1 G;  3QG1 A;  4A3F G;  3M4O B;  1TT2 A;  3J7Z C;  1B50 A;  1TS3 A;  2E76 C;  2ICI A;  3R8B A;  4AQY Q;  1WFQ A;  3SEB A;  1HQM C;  3MWY W;  1C8C A;  4IN3 A;  3K58 A;  5EKL A;  2LMC B;  3MEH A;  3GTO H;  3RZO B;  4Y52 H;  1V43 A;  3ONA B;  5EPK A;  4HJ9 A;  1HZB A;  5FJ8 G;  3J7A F;  5FLX c;  1B9M A;  4R4O A;  3J80 c;  3ZYY X;  3MVV A;  1Y1V H;  1BR9 A;  2SNM A;  4L6T B;  4GKK Q;  3I7F A;  1TWH H;  2HUG A;  4BY1 H;  3NEM A;  3F2D A;  1LAC A;  3VR2 A;  4YCW A;  3J81 L;  5IYC H;  3G7L A;  2UUC L;  2HHH Q;  2CWP A;  4AYB E;  4EVO A;  1YNN D;  3NP8 A;  3PUZ A;  2E74 C;  1CKN B;  2KHS A;  4DR3 Q;  1YIJ A;  1HNW Q;  3HOY H;  1MSH A;  1E1O A;  1LT4 D;  2JJQ A;  4FXG C;  4IPD A;  4KKS A;  1BBX C;  3HOZ B;  1EZ6 A;  4A3L H;  5CMD A;  1WTQ A;  1HA5 A;  1B1Z A;  3GTM H;  1S5D D;  1IYJ B;  1KHI A;  1OXV A;  2LXK A;  3DHQ A;  1OTC A;  2Q8R E;  3DLL A;  3TS0 A;  4C3I B;  4RFB A;  5C4Z A;  1NJI C;  3ND8 A;  4AYB B;  2E2J B;  3I4N B;  2ASB A;  1CKN A;  1S72 A;  1DZ1 A;  3RR5 A;  4MN3 A;  2UUA Q;  1PRT B;  2PNR C;  4B9X A;  1O78 A;  2JA8 H;  4A3E B;  4BY7 H;  4NP5 A;  1A2U A;  2PNH A;  5M5Y H;  1D8L A;  3K57 A;  2PMZ E;  3RZD H;  3V96 A;  2IX3 A;  4C3H B;  2NVT H;  3CRK C;  3HOU B;  2JXM B;  3W5O A;  1J5E Q;  1HNZ L;  1IYU A;  1JT8 A;  4PG3 A;  1Q90 A;  4BWG B;  1K83 B;  4Y7N H;  5EPJ A;  3GTJ B;  2PCF B;  4P74 A;  4NB3 A;  2JP1 A;  4BA2 I;  1JMC A;  1SYB A;  2BH8 A;  2JEB I;  2JK8 A;  4G7Z C;  4OEL B;  4EQO A;  3A8K E;  2PMZ B;  4JI7 L;  1X3E A;  3TEH B;  3WWV A;  3LGJ A;  2CHB D;  4QY7 A;  5ELE A;  1EY8 A;  4GNX B;  3KK7 A;  3NEL A;  1E0B A;  3PO2 H;  2XIW A;  4LAA A;  1EOT A;  1AW7 A;  3STB D;  2J7Z A;  4DK3 C;  5C44 G;  5C3X A;  4DV4 L;  4A3G G;  4RAU C;  1IW7 D;  5JJZ A;  4A3M H;  2A73 B;  4XYQ A;  5IP9 G;  4OO1 I;  1K0R A;  2HIV A;  1X3F A;  4JG2 A;  4DR6 L;  1TS4 A;  4N8F A;  1EEF D;  1I50 B;  4GNX A;  3CU7 A;  4JV5 Q;  2XSC A;  4OWW B;  4OGQ C;  3WDN A;  4LFA L;  5C4X H;  2EZV A;  3TME A;  5A2Q E;  4KHP Q;  3CC2 A;  1K8G A;  1OXU A;  4RGO S;  2Q2I A;  1B4O A;  3AMU A;  1LAB A;  1PFN A;  1MD2 D;  2Q8T A;  4JYA L;  4JK1 C;  4A93 H;  1R4Q B;  1HA6 A;  2IPK D;  2NB0 A;  3S1Q B;  1DJR D;  5ELN A;  1TWG B;  3KLS A;  4JI1 L;  2FMC A;  1HJP A;  2K5W A;  1G6Z A;  5C3W A;  1BBU A;  5NUC A;  3OOC A;  4X66 L;  2UU9 Q;  2PQE A;  2OTL A;  2R61 A;  4X62 L;  3CCV A;  3CAM A;  4NW2 A;  3JAM i;  1N36 Q;  1PH5 A;  1TWC H;  2H4O A;  2AHO B;  2I5M X;  2L12 A;  1WTX A;  1BCP D;  5JJK A;  3W3A A;  2OEO A;  2VB3 X;  4IO9 A;  4R8I A;  3TP8 A;  2JA7 B;  1KAA A;  4PZ7 A;  3SDZ A;  1GUG A;  4FF1 A;  3SK8 A;  1I3Q H;  3HOZ G;  1L0X B;  1XYI A;  3MAQ A;  1KDC A;  2QW7 A;  4FYD A;  1YVC A;  1L1O C;  3K7U C;  4LJZ C;  2EYF A;  5C6A A;  2B2U A;  5KEE A;  1VQ5 A;  1QVF A;  4C3I G;  3RNU A;  4A3B B;  1UE6 A;  4AYB G;  4A3F H;  2P5Z X;  4XQQ A;  5I4D A;  3EFX D;  3BU2 A;  2AUJ D;  4LW1 A;  1N33 Q;  1EU4 A;  2B3G A;  2RHS B;  4A3K B;  1DOK A;  2R93 B;  3EBE A;  1SYC A;  4F7X A;  2N55 A;  4HCS A;  4A3E G;  1JE5 A;  4R4C A;  1HFN A;  4G57 A;  4DU9 A;  1K8A C;  3HS0 C;  2B2Y C;  2F0U A;  1S4Z A;  1VS0 A;  4PZ6 A;  2KQ3 A;  4DUZ Q;  4C3H G;  4ID6 A;  2B2T C;  4FP5 D;  1AZQ A;  1SE8 A;  1YIT A;  3AEV A;  4F88 A;  3ZJY C;  4RHR A;  1LTB D;  4ZUI A;  1DOM A;  4LK1 C;  1NY4 A;  5FJ8 H;  3CCQ A;  1PV4 A;  1VMP A;  4K8J A;  5IYD G;  1I4G A;  4L8J A;  3G4S A;  4PMC A;  2XTI A;  2IX0 A;  2A6E C;  1E3P A;  2DGY A;  1G51 A;  5ELD A;  2K75 A;  2O5I C;  4DFA A;  3BS1 A;  1QNK A;  1FVI A;  3F1Z A;  4L5T A;  1V1P B;  1JB7 A;  2Y0S E;  3F8T A;  1Y1V B;  4DR7 Q;  1TWH B;  2NYZ D;  4BY1 B;  3C1E A;  2JEA I;  1UNS A;  1SXT A;  1LTG D;  1HRJ A;  2VNU D;  1EY6 A;  3MA2 B;  5CR3 A;  5D65 A;  3SK6 A;  4DV1 Q;  3H91 A;  1Q12 A;  2E5L L;  1IW7 C;  1V8Q A;  1V1P A;  2V1C C;  3OYY A;  4CKB A;  1N34 L;  1A62 A;  4JI0 Q;  4GLA C;  2E8G A;  2Y0S B;  3NK9 A;  3PF5 A;  5M5X H;  2N49 A;  4JI3 L;  5IP7 G;  3GTM B;  2F03 A;  2EYL A;  2HD3 A;  3FEW X;  4EGV A;  3KJP A;  3MXN B;  1Z7T A;  1F2Y A;  1A0I A;  1I4H A;  2RCF A;  1PH4 A;  4X3U A;  4Z9C B;  2UXB L;  1TWF B;  1PTO H;  3FRP B;  5BR8 L;  3ICE A;  3H94 A;  1VCI A;  4CDC C;  5AFW A;  1IKM A;  2K7V A;  5CV4 A;  5GAD C;  3S15 H;  3I4M G;  1VQH A;  4QB4 A;  5GRO A;  4BY7 B;  1YJ9 A;  3HKS A;  2DNE A;  1W3S A;  3PIP 3;  3RZD B;  3V2T A;  1A3V A;  5K5P A;  3MXN A;  1FNV A;  1HR0 W;  5DM6 3;  4J8Q A;  1VQF A;  3DUZ A;  3FHW A;  3KLS X;  3T1Y L;  1MJC A;  1U4P A;  1SFO H;  5M5W B;  4MZ9 A;  4BS9 A;  2CH4 A;  4ZQ3 A;  5C5L A;  1LTR D;  1JR0 D;  5C44 H;  4A3G H;  1MJE A;  1SNO A;  1UE5 A;  3L9A X;  5IP9 H;  2JA7 G;  1KXL A;  3K81 C;  4BBS B;  2KBN A;  3PQI A;  4LF7 L;  1LO5 D;  4HIO A;  3S1N B;  2PW5 A;  3S2H B;  5ELO A;  3ND9 A;  3S1R H;  2F0L A;  3K5N A;  4A3B G;  3L2P A;  1KL9 A;  1H9K A;  2R6G A;  2UUB L;  4A3M B;  1DYQ A;  1WCM G;  1LLR D;  1ZXT A;  2KHI A;  4DV7 L;  4LF9 L;  3J81 E;  1N32 Q;  3G71 A;  1XMQ L;  1B53 A;  5T1G A;  3PIO A;  1E22 A;  4DK0 A;  1RJT A;  1AE2 A;  1LUZ A;  1ZEQ X;  3Q6S A;  4KJO A;  3T4A C;  1Q8I A;  4C2M H;  2F0D A;  2IX1 A;  4FO2 A;  2WKC A;  3RZO H;  4OWX B;  3IFD A;  2VQF Q;  4I7Z C;  3NWT A;  1KRT A;  3SK4 A;  2QIL A;  5HGQ A;  3I55 A;  4DR4 L;  2R7D A;  2QA4 A;  3KDF B;  1V9P A;  4M8A A;  1XPO A;  1JC7 A;  2F4V Q;  3K6O A;  2IJ0 A;  2F3V A;  3A0J A;  2WII B;  3PO3 B;  4LUV A;  4A93 B;  1WTO A;  3HRZ C;  3P20 A;  5FLM G;  1VQK A;  2K5D A;  2N78 A;  5C0X I;  4DV6 Q;  1K8M A;  1VF7 A;  3NHH A;  1HZA A;  3FKI B;  1L2F A;  2L4N A;  3KDF A;  1ENF A;  5IOD A;  1E24 A;  4DV0 Q;  2BOS A;  1IHZ A;  2GN5 A;  2KUM A;  4CDE C;  1JOR A;  3HOZ H;  1FJG Q;  4QF4 A;  5CGK A;  1JWM D;  5JJL A;  3FMC A;  1DXM A;  2OQ0 A;  2A69 C;  5J39 A;  4IUT A;  4XXE A;  4X64 L;  1G8Z D;  4GOP C;  3X3N A;  3KLW A;  1QIL A;  4C3I H;  4RCO A;  1EYC A;  2E2J H;  4DR2 Q;  4HMJ A;  2F3I A;  2BE5 D;  2F0K A;  4O42 A;  2ALY B;  4OL7 A;  3S14 H;  2Y0S G;  1GHJ A;  1I3Q B;  5IYB G;  3GTP B;  4A3E H;  4DV5 Q;  3HKZ G;  1HNX Q;  2A1A A;  1H9J A;  1S5B D;  3TDQ A;  1A15 A;  1FD7 D;  3P1H A;  1ESF A;  5EKK A;  4C3H H;  5LMN Q;  4A3F B;  1CUK A;  4LFB L;  3H6M A;  5JEA J;  2CW0 D;  5KNB A;  3MTS A;  3KUP A;  4HCE A;  1E2V A;  5IYD H;  1OXT A;  2OWO A;  1EL0 A;  5IGE A;  2NZO A;  1WD0 A;  4JPB W;  1SSO A;  2H1E A;  3CW2 C;  1I94 L;  4NDX A;  1QZG A;  2K03 A;  3VYS A;  1HUN A;  3L0O A;  2WIN B;  5M3F B;  4IUQ A;  5E4X A;  3K5L A;  1XMO Q;  4ODG A;  4P2C B;  4LF6 L;  3QOL A;  1II3 A;  2A68 C;  1FYC A;  2IHF A;  3CHB D;  1PLF A;  2XRS D;  4NKL A;  4OX9 L;  2DJG C;  1EYG A;  5E3F A;  1C0A A;  1D2B A;  2WP8 J;  3RD4 A;  4JI2 L;  4IUR A;  1J9O A;  2O2L D;  2SDF A;  1X9N A;  1CQV A;  1Z6H A;  4BBS G;  5JOB A;  5EQ0 A;  4K6L A;  3EJI A;  3MEF A;  4JBW A;  5T1I A;  2A8V A;  3M4Y A;  1Q82 C;  1XPR A;  1Y14 B;  1Q1B A;  1RL2 A;  4GLX A;  1I50 H;  4B3S L;  5IP7 H;  1PXU A;  3D8G A;  3M4P A;  4TKO B;  2OTJ A;  5ELB A;  5IY0 A;  4GN4 B;  2UXC L;  1X6O A;  3CMA A;  1STE A;  4TSS A;  1D5Z C;  1NE3 A;  4HIK A;  4XYO A;  3OMG A;  3AYH B;  1Y1W G;  5JEA G;  2YTV A;  4X65 Q;  1HR0 L;  4JI5 Q;  3I4M H;  3S1Q H;  3WOF A;  1AH9 A;  4KHZ A;  1TWG H;  1TKW B;  3K7A H;  3CCU A;  3BJU A;  4JOI A;  3IKJ A;  3W1B A;  1UE1 A;  1PTO B;  3NE5 B;  1RCV D;  1GO3 E;  1LT3 D;  2K33 A;  3D6C A;  3KF6 B;  3NSW A;  4UP8 A;  4DNI A;  5I2Y A;  3Q0A A;  3PO3 G;  3S15 B;  2YU9 B;  4WJ3 M;  1O7Y A;  4UHV A;  3PUV A;  4IFD I;  2MNA A;  3HG9 A;  4IOA A;  4CJ2 C;  4XT1 B;  2KCM A;  1EEI D;  1NNX A;  1X56 A;  3CC4 A;  3FKI G;  4APV A;  1ONL A;  2JA7 H;  2NVY B;  4RGT A;  1C48 A;  2LKV A;  1XTC D;  1OXS C;  3OTO L;  4KKU A;  4LWC A;  3KF6 A;  1SFO B;  2AMC B;  1WTW A;  4B3R Q;  4IPC A;  2Z8L A;  2QDB A;  1CA6 A;  2N3S A;  2E2H B;  4UY8 C;  1GUW A;  4A3B H;  5C44 B;  4POF A;  4A3G B;  4GKJ Q;  4G4K A;  4LMQ D;  3I90 A;  4KN4 C;  3J81 c;  3T1H Q;  1WCM H;  5DAU A;  1BKB A;  1YNJ C;  4BBR B;  2RDG A;  3K59 A;  4RA8 A;  1B44 D;  1IBM Q;  1IYV A;  1XJV A;  1RD9 D;  1STB A;  2BE5 C;  1F2M A;  4N8X 1;  5IT9 L;  4K2L A;  3KYH C;  4LF8 Q;  4LF5 Q;  3PMF A;  4DNR B;  1O7Z A;  3BZC A;  3PV0 A;  2VZA A;  1B9N A;  4OIK A;  4NPS A;  3ERO A;  2ZXR A;  2F3W A;  2I46 A;  3J7A 5;  4C2M B;  2CW0 C;  2F0O A;  4HSV A;  5LL6 X;  1EIY B;  2C35 B;  4HR7 B;  3CQZ H;  5FLM H;  5JVG 3;  1AZP A;  5A35 A;  1CTM A;  4EQ5 A;  1ICW A;  2ZXP A;  5M3F G;  2NWG A;  2UXD L;  1KRS A;  3MC0 B;  2MFI A;  4FNF A;  2ZT9 C;  1VQ8 A;  2HDM A;  4JI4 Q;  2D5D A;  4L5Q A;  3MXG A;  5M3M B;  3HZX A;  3CME A;  3FPU B;  3KBG A;  3BVZ A;  4UAI A;  2A5H A;  2WFW A;  1PH3 A;  2UUA L;  4DR5 Q;  4XDX A;  1MBY A;  4DUY L;  4RWS C;  3E0E A;  4JBK A;  4JW0 A;  1QZH A;  3M85 A;  5C3E G;  1E2Z A;  4P71 A;  1A3U A;  2CQA A;  1CK1 A;  1RKN A;  2VW9 A;  3LWE A;  3QWN A;  2MP1 A;  5IYB H;  4IQZ A;  3BZK A;  4B3T Q;  3S24 A;  5ELC A;  2IT1 A;  2EJG C;  3S2D H;  4BXX G;  1GUN A;  4IJL A;  1K73 C;  1BCP B;  1TWF H;  4IUP A;  5E4W C;  2D0O A;  2K6A A;  3M4Q A;  5D14 A;  1WYD A;  4B3M L;  3TZD A;  3S14 B;  1K3B C;  3I56 A;  1B70 B;  2B2W C;  4A3C G;  1JJ2 A;  1VQD A;  3OHX C;  1RHP A;  1GJX A;  5D3D A;  3W2D A;  3A7L A;  2RHQ B;  1XNR L;  2AKW B;  3BG3 A;  1WVL A;  4ILW A;  4CBV A;  3R2T A;  2RDH A;  3NXW A;  4ZRZ A;  1HH2 P;  2A6E D;  2AWO A;  2ENB A;  3W1G A;  1IBK L;  3GQB A;  1STG A;  5M5W H;  1MGS A;  2R7Z B;  2J4X A;  4UPA A;  5CBE E;  2G9H D;  3VR5 A;  4HED A;  1U4L A;  4BBS H;  2EY1 A;  3BDC A;  3QO2 A;  3QR8 A;  3GTL B;  4ME3 A;  3QOJ A;  1PH2 A;  1I4X A;  1DD2 A;  1NUC A;  1UEA B;  3S1N H;  3S2H H;  5KNC A;  3M7N A;  1WJJ A;  3H3V C;  3MFG A;  3K80 C;  2EY6 A;  3SR1 A;  4BBR G;  2B2V A;  2YYZ A;  5FO7 B;  4N9P A;  4K6D A;  1H9S B;  1Q86 C;  3Q23 A;  4K0K L;  2MHV A;  1Y1W H;  2MUY A;  5JEA H;  4C1N I;  3H3V I;  5DEH A;  5AJ3 L;  4KMU C;  4IUV A;  1E7Z A;  1RDP D;  1HNZ Q;  5EBD A;  4PMB A;  3T13 A;  1N9W A;  2BDO A;  2EYP A;  4PQX A;  2Z6K A;  4J1M A;  2N8N A;  4QQB X;  4HID A;  1S3O A;  2F0Q A;  1VQJ A;  4RG1 A;  4YY3 L;  3A56 A;  3PO3 H;  1H9S A;  3TP7 A;  3SGI A;  3I4M B;  4JI7 Q;  3K7A B;  4L5S A;  1B2T A;  3BDO A;  1SR3 A;  1JWU D;  4S3S A;  3FKI H;  5CC4 A;  5IIF A;  4DNT B;  1EYD A;  4DV4 Q;  2F0M A;  5M3M G;  1STA A;  3I72 A;  4K5X A;  1F2Z A;  4DV2 L;  1PZI D;  3CD6 A;  1NAP A;  4DR6 Q;  2F0W A;  1B3Q A;  5FO8 B;  1Y8P B;  1BOS A;  3KOJ A;  3P7J A;  4JI6 L;  4X3S A;  4LFA Q;  2ZTC A;  1UUP A;  2M9V A;  5IE8 A;  5LMU L;  1BF4 A;  3GTP H;  1CI3 M;  1PFM A;  2VL6 A;  2LFN A;  4IPG A;  2SNS A;  1Q7Y C;  2ZM6 L;  4ALP A;  2K5N A;  1F9S A;  1K8O A;  4YWM A;  3TP6 A;  1VQE A;  1VQB A;  4JYA Q;  2K05 A;  3BYT B;  5GAG C;  1WCM B;  1KDB A;  4H0L C;  3F2C A;  3TSS A;  3H09 A;  4HIM A;  1PH6 A;  2DUD A;  4O1N A;  5CV6 A;  1CA5 A;  5GAH C;  1JQY D;  5E7N A;  4JI1 Q;  2EYO A;  4WRD A;  2PZW A;  4KI0 A;  4P73 A;  3LNN A;  4KKT A;  1YJN A;  3ULP A;  2EJM A;  4X66 Q;  4DXF A;  2JYO A;  2WKD A;  4X62 Q;  3A8I E;  5M3F H;  4C1N K;  4HSP A;  1BBW A;  3RLN A;  2ZJQ A;  1STY A;  4YCV A;  2EXZ A;  3DM1 A;  4X6A H;  1VF5 C;  2OQK A;  3IFT A;  5JPN C;  3NQT A;  3CP0 A;  2R7Z G;  1FNW A;  2V4D A;  4EQP A;  1LTT D;  1PRT F;  3CQZ B;  3JAM L;  1EY0 A;  2QF7 A;  3PF4 A;  5IWA L;  1VQP A;  2E2I H;  4UP7 A;  2Q2T A;  5C3E H;  3S9W A;  2L1B A;  3A55 A;  5EAY A;  1NMF A;  1SMY C;  2EOT A;  2F1M A;  2A69 D;  2EYH A;  2EY5 A;  1QB5 D;  3HKZ E;  5EGT A;  1UE7 A;  1EWI A;  3TBI B;  5M9O A;  2ATW A;  3GO5 A;  4BXX H;  1D5X C;  1JB3 A;  1SYG A;  3K0Y A;  1NR2 A;  1U5K A;  2CQO A;  2K1B A;  3TRZ A;  4A3D G;  3CC7 A;  4G7O C;  3IAY A;  2FJ2 A;  4A3C H;  5KYL A;  1KNE A;  3HKZ B;  3S2D B;  1XTD A;  2X6G A;  1YHA A;  1JOO A;  3MZ5 A;  4F8M A;  2RF4 A;  3OWF A;  4A3I G;  2ID0 A;  2ZXO A;  4J6H A;  1YI2 A;  4O2D A;  2YU9 H;  2EPB A;  1SNP A;  4B08 A;  2NZH A;  4A3J B;  1H9R A;  4DF7 A;  4Q0F A;  3OIP A;  4YWK A;  2EY2 A;  4XQN A;  2IL8 A;  3T51 B;  4UP9 A;  2A68 D;  3C3L A;  5IT9 E;  3VR3 A;  1CKM A;  2NVY H;  1XNQ L;  1M8A A;  2Q8I B;  3BDL A;  3U4Z A;  4ZAI A;  2L11 A;  4KY7 A;  3D4D A;  2O4X A;  3CKI B;  4QJF A;  3I3C A;  4CJ1 B;  4CJ0 B;  3PIO 3;  2E5L Q;  2E2H H;  2I0Q A;  3ULL A;  1F9P A;  2HCC A;  1LT5 D;  2Z4I A;  1N34 Q;  2JA9 A;  3E6Z X;  5KYI A;  4BBR H;  3HEJ A;  4JI3 Q;  4LF4 L;  1B8A A;  2YTY A;  3V05 A;  3C46 A;  3IL8 A;  3T16 A;  1VQ4 A;  1ICF B;  2LS0 1;  4KY6 A;  1J6Q A;  2UXB Q;  3OW2 A;  3EQL C;  5BR8 Q;  4YWL A;  3DM3 A;  2F52 A;  2N88 A;  4XIG S;  2JSO A;  1JJC B;  4OIJ A;  3LWU A;  1LYL A;  4NMZ A;  4MNO A;  4PV1 C;  2I5H A;  1CHP D;  4R4Q A;  1Y1W B;  1PRT C;  3TN2 A;  2EIF A;  2ES2 A;  5C5M A;  2EYM A;  2F0E A;  4M1U B;  3NTH A;  3MHB A;  4HTH A;  3T1Y Q;  3EN2 A;  1HTP A;  4GLV B;  4R8N A;  2BCO A;  1YBY A;  1PFB A;  1QVG A;  1D7Q A;  5HY6 A;  3D31 A;  3EIV A;  4A76 A;  5EBC A;  4YHH L;  5M3M H;  3DEO A;  2NBF A;  2NN6 G;  4CDD C;  2GVB A;  2L15 A;  2RSO A;  1G91 A;  3GP7 A;  3URY A;  1M90 C;  4AIM A;  2VQE L;  4N9T A;  5IOC A;  1XWE A;  2R3Z A;  2F0T A;  2EXD A;  4KD4 A;  1X32 A;  4PNY A;  3FDT A;  3VYT A;  2KVM A;  5I2X A;  3HP3 A;  2UUB Q;  3C1F A;  2VXW A;  2KED A;  2M2L A;  4DV7 Q;  4GNX C;  4LF9 Q;  4FXK C;  5JAV A;  1YNJ D;  1JJG A;  1XMQ Q;  2QKI C;  1IBL L;  4FF4 A;  1YEZ A;  2DY7 A;  3I8Z A;  3HOX B;  2OT2 A;  4DK1 A;  2Q2U A;  1Q8K A;  1FR3 A;  5FLX E;  5GQO A;  3TQY A;  2D2C C;  2QDL A;  2BDN A;  4KV6 A;  2HDL A;  4DR4 Q;  3TRE A;  2KEN A;  4RKB A;  1GHK A;  4DV3 L;  1PH7 A;  3CCL A;  3E3X A;  2A6H D;  3PUY A;  4LFC L;  1SJE D;  1E2W A;  2D9U A;  4CGY B;  1M1K C;  2PZT A;  3F2U A;  1VQA A;  1R9T H;  2K32 A;  4JI8 L;  5FK9 C;  5I6W A;  4A3J G;  4EX5 A;  4B9W A;  2KA7 A;  2PO4 A;  1LM0 A;  1TY2 A;  2R7Z H;  1TWA H;  4RHS A;  5COR A;  1TU2 B;  5I9P A;  3OPO A;  1C9O A;  4LNQ A;  1X3Q A;  3GTL H;  1VQN A;  1ILQ A;  2IW3 A;  4X64 Q;  1G2T A;  1KAB A;  2RA4 A;  5IGB A;  2Z1C A;  1IL8 A;  5IGF A;  2IHE A;  3VA7 A;  5I6Y A;  1Z47 A;  2B2U C;  1P8L A;  3U58 A;  2E2I B;  5HUR A;  4R9W A;  3R3O A;  4JI5 L;  3NBH A;  5C3E B;  2RBM A;  2C5C A;  4NXM L;  3HOW B;  3CPW A;  3F2B A;  5BN3 A;  1LT6 D;  3SXH A;  4A3D H;  2WAQ G;  4IPH A;  1NMG A;  1U4R A;  1ROD A;  2X69 A;  1A8V A;  4ZK9 B;  4LFB Q;  3RMH A;  4JC0 A;  1G29 1;  1LTI D;  4K2K A;  4IAL A;  1I4R A;  1ZYR C;  2ZTE A;  2OXP A;  4JCV E;  3GDE A;  4MIU A;  4TQU S;  4TVA B;  1I94 Q;  4A3I H;  4DR1 L;  2NVQ B;  1L1O B;  4CHT B;  5DNF A;  1SE3 A;  2K50 A;  1NSN S;  1EIG A;  4Q5V A;  5CYU A;  1HQR D;  3GV3 A;  5G3L F;  4LF6 Q;  4DN4 M;  1MHW C;  5FKA C;  1SND A;  4B3R L;  4OX9 Q;  3A54 A;  1Y8N B;  4JBM A;  2AUK A;  1SEB D;  3KF8 A;  4JI2 Q;  1HCZ A;  2Z6B A;  1PA6 A;  2JA6 B;  4GKJ L;  1MI2 A;  1L1O A;  3L3O C;  2BA0 A;  1HTL D;  1O80 A;  3M3Y B;  4NXN Q;  1KAW A;  4R4I A;  1L0W A;  2R92 G;  3GV6 A;  4YCU A;  2AQ3 B;  1JWS D;  3JC6 6;  4B3S Q;  3I70 A;  1STN A;  4RCN A;  3D6W A;  3CCS A;  4J15 A;  1CHQ D;  4PZ8 A;  2ZJP A;  1WOC A;  1T9H A;  2B2Y A;  3RLO A;  3U9O A;  4EQN A;  1EFI D;  4AQY L;  2CKZ B;  2MGS A;  5EKI A;  5ISR A;  2B2T A;  3S16 H;  3FPP A;  1NR4 A;  3AB9 A;  4OO1 G;  1S5F D;  5KIX A;  3E9H A;  4WFN 3;  4C56 C;  3JAM E;  3HOX G;  3PSI A;  1HR0 Q;  2JA5 G;  1VQ9 A;  1W6K A;  4HJ8 A;  4XT3 B;  4KK7 A;  5CV8 A;  1CM9 A;  4QMG A;  2H5X A;  4CKE A;  2F0F A;  2RSN A; 
#chains in the Genus database with same CATH homology
 3ITP A;  1Q3L A;  1WTR A;  4ABN A;  1KNA A;  3N6R A;  3EVQ A;  2KEC A;  1D5M C;  1SDF A;  2L5T A;  3LX0 A;  3X3M A;  2AQ2 B;  4K14 A;  2DY8 A;  2A6H C;  3MXP A;  1RTO A;  1M4V A;  5HGT A;  2NN6 H;  1QCB D;  4H44 C;  2WAC A;  1EY5 A;  4UDU C;  4K8I A;  3VA5 A;  4I65 A;  2XN9 C;  5DM7 3;  5C4H A;  5COY A;  3DMU A;  2VB2 X;  2NTT A;  1VDZ A;  1ML0 D;  3AU7 A;  1DM0 B;  3D3R A;  3PUX A;  4BA1 I;  1KLU D;  1OXX K;  4PMW A;  4RGN A;  4FF3 A;  4C3J B;  3OIQ A;  5I9O A;  1EQT A;  2O5J C;  2F0N A;  3I4L A;  1FGB D;  1C4Q A;  4KY5 A;  1A2T A;  1CFM A;  3NWS A;  1HFG A;  1PTO D;  5JPM C;  1ESR A;  1SNC A;  1HUM A;  4K5V A;  2AQ1 B;  5FO9 B;  1R9T B;  2PW7 A;  4E6I A;  2F0V A;  2F0G A;  4ZKB B;  2G9D A;  1TWA B;  3E5S A;  3C2P A;  1SMY D;  4IUU A;  1EWC A;  1BO0 A;  5FLX L;  3J80 L;  1RTN A;  2DNC A;  3SK5 A;  1UAP A;  5FOB B;  1PTO F;  3PUW A;  5ELF A;  3KBX A;  3I73 A;  2KCC A;  1AFP A;  3NQI A;  1PMR A;  2F4I A;  3GTK B;  1S5C D;  2XWJ B;  3BVM A;  4DAP A;  2MPM A;  4V19 0;  1JE4 A;  2XWB B;  4A3D B;  3J7Y W;  1I6V C;  2QCP X;  1QJO A;  5EJW A;  1EY9 A;  1ENC A;  2NZ1 D;  5TSS A;  1CT1 D;  2XNA C;  4KTA A;  4A3I B;  1SE4 A;  2EVB A;  2DN8 A;  2B39 A;  1TS5 A;  2KCN A;  1JIC A;  1GUT A;  1DON A;  4TRD A;  4KHV A;  5LL6 S;  5E1F A;  3FVQ A;  4FVM A;  2IWH A;  5CV5 A;  4CKC A;  1KLG D;  3K5M A;  1TR5 A;  1WD1 A;  1A6X A;  2PYK A;  1V1O A;  4ULL A;  1ENA A;  2A74 C;  1TVX A;  5C0X J;  1ZKO A;  3E0J A;  1PYW D;  3VR6 A;  1J8I A;  1SJH D;  1U4M A;  5KGU A;  4QUF A;  4OO1 H;  1TS2 A;  1XX8 A;  4H13 C;  1FNU A;  4RH6 A;  5BN4 A;  1T5X D;  4C3J G;  2F0I A;  2B63 B;  4HMI A;  1LV9 A;  3S16 B;  2L9H A;  3J7A V;  4XQJ A;  5J22 A;  3MXU A;  1JOQ A;  1PRT D;  5LHY 1;  1HPC A;  1YNN C;  4ZYS A;  5K36 G;  1KDA A;  2EJF C;  3HOV B;  3S1M B;  1WTV A;  4ZKC B;  1I4P A;  1EWH A;  2PPB C;  3BZD B;  3G6J B;  4RKL A;  2K04 A;  4X3T A;  1PTO C;  3S17 B;  4DAY A;  3DXJ C;  3RLF A;  1BCP F;  1Y8O B;  1QOH A;  3GTQ B;  4YIJ A;  3NUC A;  2PZU A;  1B3A A;  1T5E A;  2BA1 A;  1F9R A;  2F0J A;  5C0X G;  1OO9 B;  5CBA E;  2RDF A;  4DGZ A;  4G7H C;  3T56 B;  1ILP A;  5IGG A;  1GXD C;  2FIN B;  2K5Q A;  2FFK B;  3HGB A;  4MHE A;  1QG7 A;  1JCK B;  3GTO B;  1NCV A;  3QIA A;  3Q24 A;  4GZY C;  3T53 B;  3NBI A;  2L0C A;  1EY7 A;  1RF2 D;  2B8G A;  1TQO A;  1EYA A;  1AN8 A;  2XVS A;  3R2I A;  3DWP A;  2FHT A;  3HOY B;  3QB3 A;  1DCZ A;  1QNU A;  1SE2 A;  1X3P A;  1BNZ A;  1D6E C;  2HCI A;  3I91 A;  1KTK A;  3L7Z C;  3Q22 A;  1MSG A;  2B8F A;  1F9Q A;  2E2D C;  3DWQ A;  4IFD J;  5KND A;  4U68 A;  1ET9 A;  2JA8 B;  1O7L A;  5J1Z A;  5M5Y B;  2ICE C;  4IUN A;  3A7A B;  2NVT B;  5IGC A;  2NVX B;  1PZJ D;  3OWE B;  1BXT A;  2XRQ D;  1CQF A;  3ERQ A;  4Y7N B;  1L0Y B;  2WAQ B;  1ZYR D;  1GOZ A;  2GA4 B;  1D1I A;  2SEB D;  1WTP A;  2F0P A;  1BCP C;  2KOL A;  1PZK D;  3EA6 A;  1IKL A;  1F77 A;  4KN7 C;  2TSS A;  3PO2 B;  2EYJ A;  1ET6 A;  4FF2 A;  4RGM A;  4ZLT F;  2NUC A;  1EQV A;  3N52 A;  4DA2 A;  1G2S A;  1R4P B;  1VMC A;  1EY4 A;  1AP0 A;  1HHV A;  2JE6 I;  3DWA A;  4IFD G;  3NPP A;  5C4X B;  4ME5 A;  4KJN A;  4V0B A;  2D62 A;  1H9M A;  4K5W A;  3CRL C;  2B2V C;  2RQX A;  3BYY B;  2R92 B;  5EPL A;  3M7G A;  4WOR A;  1SYF A;  2B2W A;  3OSO A;  1DOL A;  1QWY A;  2F0H A;  1QE6 A;  3QJY A;  4HAE A;  5BN5 A;  2SOB A;  4U67 3;  1SYE A;  4X3K A;  2JA5 B;  1SAP A;  1TY0 A;  3J80 E;  3OMC A;  3O13 A;  2X6L A;  5A2Q L;  1TWC B;  2WV6 D;  5K36 H;  1HXY D;  4OHJ A;  2L55 A;  1LTA D;  1XXG A;  3NTI A;  2KEE A;  3D4W A;  3MFY A;  4H7B A;  2Z4H A;  3VYR A;  4QIW B;  3U9S A;  1GUS A;  2WB1 B;  4FXD A;  4HN7 A;  1AEX A;  5C0X H;  1TII D;  4ZUJ A;  2K28 A;  4L63 B;  4WJW A;  3GTG B;  3VR4 A;  4KD3 A;  3DEP A;  1I4Q A;  5F2D A;  1Q1E A;  5G3L D;  2FMM A;  1SNM A;  1LTS D;  2M00 A;  3D4R A;  2QEJ C;  3RUZ A;  3OW7 A;  2EDG A;  1D1K A;  4DXG A;  2NTS A;  1SNQ A;  2LY7 A;  3SVM A;  2EE1 A;  1SYD A;  2HQE A;  5C4J B;  3NTK A;  2AWN A;  3R93 A;  2K01 A;  3A8J E;  4DAV A;  1BQQ T;  4F87 A;  2RVL A;  1Y69 U;  3VYU A;  4QCL A;  1STH A;  1CZW A;  1S5E D;  3WOE A;  1EU3 A;  1PDQ A;  1W6J A;  2RKS A;  5M5X B;  1EZ8 A;  3SHL A;  1U9R A;  2KJX A;  2F0S A;  1BDO A;  2C9O A;  3GD7 A;  5CV7 A;  1A3T A;  2RSN A;  1JOK A;  3K5O A;  3UI2 A;  3KLR A;  2VUM B;  2NN6 I;  1EIH A;  3P75 A;  1BUV T;  3BVG A;  5CV9 A;  4QUC A;  3H0G B;  5JVH 3;  4IZ8 A;  2I07 B;  5D3I B;  2J0T D;  2OF1 A;  1SBB B;  5IGD A;  2MJ8 A;  3SE0 A;  1F2L A;  1GUO A;  5KRU A;  1I6H B;  1CZG A;  4XTC S;  3TP5 A;  3TZU A;  2CVR A;  3S1R B;  2TMP A;  4IFD H;  2E75 C;  3QG1 A;  3M4O B;  1TT2 A;  1B50 A;  1TS3 A;  2E76 C;  2ICI A;  3R8B A;  3SEB A;  1HQM C;  3MWY W;  1C8C A;  4IN3 A;  3K58 A;  5EKL A;  2LMC B;  3MEH A;  3RZO B;  1V43 A;  3ONA B;  5EPK A;  3J7A F;  1B9M A;  3ZYY X;  3MVV A;  2SNM A;  1BR9 A;  4L6T B;  2HUG A;  1LAC A;  3VR2 A;  3J81 L;  3G7L A;  4EVO A;  1YNN D;  3NP8 A;  3PUZ A;  2E74 C;  2KHS A;  1MSH A;  1LT4 D;  4FXG C;  4KKS A;  1BBX C;  3HOZ B;  1EZ6 A;  5CMD A;  1WTQ A;  1HA5 A;  1B1Z A;  1S5D D;  1OXV A;  3DHQ A;  2Q8R E;  4C3I B;  4RFB A;  5C4Z A;  3ND8 A;  4AYB B;  2E2J B;  3I4N B;  1DZ1 A;  4MN3 A;  1PRT B;  2PNR C;  4B9X A;  1O78 A;  4A3E B;  4NP5 A;  1A2U A;  3K57 A;  3V96 A;  2IX3 A;  4C3H B;  3CRK C;  3HOU B;  2JXM B;  1IYU A;  1Q90 A;  4BWG B;  1K83 B;  5EPJ A;  3GTJ B;  2PCF B;  2JP1 A;  4BA2 I;  1SYB A;  2JEB I;  4G7Z C;  4EQO A;  3A8K E;  2PMZ B;  2CHB D;  5ELE A;  1EY8 A;  3KK7 A;  1E0B A;  2XIW A;  4LAA A;  1EOT A;  1AW7 A;  2J7Z A;  5C3X A;  4RAU C;  1IW7 D;  5JJZ A;  2A73 B;  4XYQ A;  4OO1 I;  1TS4 A;  1EEF D;  1I50 B;  3CU7 A;  2XSC A;  4OGQ C;  3WDN A;  2EZV A;  3TME A;  5A2Q E;  1OXU A;  4RGO S;  1B4O A;  3AMU A;  1LAB A;  1PFN A;  1MD2 D;  2Q8T A;  4JK1 C;  1R4Q B;  1HA6 A;  2IPK D;  2NB0 A;  3S1Q B;  1DJR D;  1TWG B;  3KLS A;  2FMC A;  2K5W A;  1G6Z A;  5C3W A;  5NUC A;  3OOC A;  2PQE A;  2R61 A;  4NW2 A;  2H4O A;  2L12 A;  1WTX A;  1BCP D;  3W3A A;  2OEO A;  2VB3 X;  4R8I A;  3TP8 A;  2JA7 B;  1KAA A;  3SDZ A;  1GUG A;  4FF1 A;  3SK8 A;  1L0X B;  1XYI A;  3MAQ A;  1KDC A;  4FYD A;  4LJZ C;  2EYF A;  5C6A A;  2B2U A;  5KEE A;  4C3I G;  4A3B B;  4XQQ A;  5I4D A;  3EFX D;  2AUJ D;  1EU4 A;  4A3K B;  1DOK A;  2R93 B;  1SYC A;  4F7X A;  2N55 A;  4HCS A;  1HFN A;  4G57 A;  4DU9 A;  3HS0 C;  2B2Y C;  2F0U A;  1S4Z A;  2KQ3 A;  4C3H G;  4ID6 A;  2B2T C;  4FP5 D;  1AZQ A;  4F88 A;  4RHR A;  1LTB D;  4ZUI A;  1DOM A;  4LK1 C;  1VMP A;  4K8J A;  1I4G A;  4L8J A;  4PMC A;  2IX0 A;  2A6E C;  5ELD A;  2O5I C;  4DFA A;  3BS1 A;  1QNK A;  1V1P B;  1Y1V B;  1TWH B;  2NYZ D;  4BY1 B;  3C1E A;  2JEA I;  1UNS A;  1SXT A;  1LTG D;  1HRJ A;  2VNU D;  1EY6 A;  3MA2 B;  5CR3 A;  5D65 A;  3SK6 A;  3H91 A;  1Q12 A;  1IW7 C;  1V8Q A;  1V1P A;  4CKB A;  2Y0S B;  3NK9 A;  3GTM B;  2F03 A;  2EYL A;  3FEW X;  4EGV A;  1Z7T A;  1F2Y A;  1I4H A;  4X3U A;  4Z9C B;  1TWF B;  1PTO H;  3FRP B;  3H94 A;  1VCI A;  5AFW A;  1IKM A;  2K7V A;  5CV4 A;  4QB4 A;  4BY7 B;  2DNE A;  3PIP 3;  3RZD B;  3V2T A;  1A3V A;  5K5P A;  3MXN A;  1FNV A;  5DM6 3;  4J8Q A;  3DUZ A;  3KLS X;  1U4P A;  5M5W B;  4BS9 A;  4ZQ3 A;  1LTR D;  1JR0 D;  1SNO A;  3L9A X;  4BBS B;  1LO5 D;  3S1N B;  2PW5 A;  3S2H B;  3ND9 A;  2F0L A;  3K5N A;  1H9K A;  2R6G A;  4A3M B;  1DYQ A;  1LLR D;  1ZXT A;  3J81 E;  1B53 A;  5T1G A;  4DK0 A;  1RJT A;  1ZEQ X;  3Q6S A;  4KJO A;  3T4A C;  1Q8I A;  2F0D A;  2IX1 A;  4FO2 A;  2WKC A;  3IFD A;  4I7Z C;  3NWT A;  3SK4 A;  2QIL A;  4M8A A;  1JC7 A;  3K6O A;  2IJ0 A;  2F3V A;  3PO3 B;  2WII B;  4A93 B;  1WTO A;  3HRZ C;  3P20 A;  2K5D A;  5C0X I;  1K8M A;  1VF7 A;  3NHH A;  3FKI B;  2L4N A;  1ENF A;  5IOD A;  2BOS A;  1IHZ A;  1JOR A;  2KUM A;  4QF4 A;  5CGK A;  1JWM D;  3FMC A;  1DXM A;  2A69 C;  5J39 A;  4IUT A;  4XXE A;  1G8Z D;  3X3N A;  1QIL A;  4RCO A;  1EYC A;  4HMJ A;  2BE5 D;  2F0K A;  4O42 A;  4OL7 A;  1GHJ A;  1I3Q B;  3GTP B;  1H9J A;  1S5B D;  3TDQ A;  1A15 A;  1FD7 D;  3P1H A;  1ESF A;  5EKK A;  4A3F B;  3H6M A;  5JEA J;  2CW0 D;  5KNB A;  3MTS A;  3KUP A;  4HCE A;  1E2V A;  1OXT A;  1EL0 A;  5IGE A;  1WD0 A;  1SSO A;  2H1E A;  4NDX A;  2K03 A;  3VYS A;  1HUN A;  2WIN B;  5M3F B;  4IUQ A;  5E4X A;  3K5L A;  4ODG A;  4P2C B;  3QOL A;  1II3 A;  2A68 C;  1FYC A;  3CHB D;  1PLF A;  2XRS D;  4NKL A;  5E3F A;  1D2B A;  2WP8 J;  3RD4 A;  4IUR A;  1J9O A;  2O2L D;  2SDF A;  1CQV A;  1Z6H A;  5JOB A;  5EQ0 A;  4K6L A;  3EJI A;  4JBW A;  5T1I A;  3M4Y A;  1Q1B A;  1PXU A;  3D8G A;  4TKO B;  5ELB A;  1STE A;  4TSS A;  1D5Z C;  4XYO A;  3OMG A;  5JEA G;  3WOF A;  4KHZ A;  1TKW B;  3IKJ A;  1PTO B;  3NE5 B;  1RCV D;  1LT3 D;  2K33 A;  3D6C A;  3NSW A;  5I2Y A;  3Q0A A;  3S15 B;  2YU9 B;  1O7Y A;  3PUV A;  4IFD I;  3HG9 A;  4CJ2 C;  4XT1 B;  1EEI D;  1ONL A;  2NVY B;  4RGT A;  1C48 A;  2LKV A;  1XTC D;  1OXS C;  4KKU A;  1SFO B;  1WTW A;  2Z8L A;  2QDB A;  1CA6 A;  2E2H B;  1GUW A;  5C44 B;  4A3G B;  4G4K A;  4LMQ D;  3I90 A;  4KN4 C;  5DAU A;  1YNJ C;  4BBR B;  2RDG A;  3K59 A;  4RA8 A;  1B44 D;  1IYV A;  1RD9 D;  1STB A;  2BE5 C;  1F2M A;  5IT9 L;  4K2L A;  3PMF A;  4DNR B;  1O7Z A;  3PV0 A;  1B9N A;  4OIK A;  3ERO A;  2ZXR A;  2F3W A;  2I46 A;  4C2M B;  2CW0 C;  2F0O A;  4HSV A;  5LL6 X;  4HR7 B;  5JVG 3;  1AZP A;  5A35 A;  1CTM A;  1ICW A;  2ZXP A;  2NWG A;  3MC0 B;  4FNF A;  2ZT9 C;  2HDM A;  2D5D A;  3MXG A;  5M3M B;  3HZX A;  3FPU B;  3KBG A;  3BVZ A;  4UAI A;  2A5H A;  4XDX A;  1MBY A;  4RWS C;  3M85 A;  1E2Z A;  1A3U A;  2CQA A;  1CK1 A;  1RKN A;  3LWE A;  3QWN A;  2MP1 A;  4IQZ A;  5ELC A;  2IT1 A;  2EJG C;  1GUN A;  1BCP B;  5E4W C;  4IUP A;  2K6A A;  5D14 A;  3TZD A;  3S14 B;  2B2W C;  3OHX C;  1RHP A;  1GJX A;  5D3D A;  3W2D A;  3A7L A;  3BG3 A;  1WVL A;  4ILW A;  4CBV A;  3R2T A;  2RDH A;  3NXW A;  4ZRZ A;  2A6E D;  2AWO A;  2ENB A;  3GQB A;  1STG A;  1MGS A;  2R7Z B;  2J4X A;  5CBE E;  2G9H D;  3VR5 A;  4HED A;  1U4L A;  2EY1 A;  3BDC A;  3QO2 A;  3GTL B;  3QOJ A;  1I4X A;  1DD2 A;  1NUC A;  1UEA B;  5KNC A;  3M7N A;  3H3V C;  3MFG A;  2EY6 A;  3SR1 A;  2B2V A;  2YYZ A;  5FO7 B;  4N9P A;  4K6D A;  1H9S B;  3Q23 A;  2MHV A;  2MUY A;  5JEA H;  4C1N I;  5DEH A;  4KMU C;  4IUV A;  1RDP D;  5EBD A;  4PMB A;  3T13 A;  2BDO A;  2EYP A;  4PQX A;  4J1M A;  2F0Q A;  3A56 A;  1H9S A;  3TP7 A;  3I4M B;  3K7A B;  1B2T A;  3BDO A;  1JWU D;  4S3S A;  5CC4 A;  5IIF A;  4DNT B;  1EYD A;  2F0M A;  1STA A;  3I72 A;  4K5X A;  1F2Z A;  1PZI D;  1NAP A;  2F0W A;  5FO8 B;  1Y8P B;  1BOS A;  3P7J A;  4X3S A;  1UUP A;  2M9V A;  1BF4 A;  1CI3 M;  1PFM A;  2LFN A;  2SNS A;  1F9S A;  1K8O A;  3TP6 A;  2K05 A;  3BYT B;  1WCM B;  1KDB A;  4H0L C;  3TSS A;  3H09 A;  4O1N A;  5CV6 A;  1CA5 A;  1JQY D;  2EYO A;  4WRD A;  2PZW A;  4KI0 A;  3LNN A;  4KKT A;  2EJM A;  4DXF A;  2JYO A;  2WKD A;  3A8I E;  4C1N K;  4HSP A;  1STY A;  2EXZ A;  3DM1 A;  1VF5 C;  3IFT A;  5JPN C;  3NQT A;  1FNW A;  2V4D A;  4EQP A;  1LTT D;  1PRT F;  3CQZ B;  3JAM L;  1EY0 A;  2QF7 A;  3S9W A;  2L1B A;  3A55 A;  2EOT A;  1SMY C;  2F1M A;  2A69 D;  2EYH A;  2EY5 A;  1QB5 D;  5EGT A;  3TBI B;  5M9O A;  3GO5 A;  1D5X C;  1JB3 A;  1SYG A;  3K0Y A;  1NR2 A;  2K1B A;  4G7O C;  3IAY A;  2FJ2 A;  5KYL A;  1KNE A;  3HKZ B;  3S2D B;  2X6G A;  1JOO A;  3MZ5 A;  4F8M A;  3OWF A;  2ID0 A;  2ZXO A;  4J6H A;  2EPB A;  1SNP A;  4B08 A;  4A3J B;  1H9R A;  4DF7 A;  4Q0F A;  3OIP A;  4XQN A;  2EY2 A;  2IL8 A;  3T51 B;  2A68 D;  3C3L A;  5IT9 E;  3VR3 A;  1M8A A;  2Q8I B;  3BDL A;  4ZAI A;  2L11 A;  4KY7 A;  3D4D A;  2O4X A;  3CKI B;  3I3C A;  4CJ1 B;  4CJ0 B;  3PIO 3;  1F9P A;  2HCC A;  1LT5 D;  2Z4I A;  3E6Z X;  5KYI A;  3HEJ A;  3V05 A;  3C46 A;  3IL8 A;  3T16 A;  2LS0 1;  4KY6 A;  3EQL C;  2N88 A;  4XIG S;  2JSO A;  4OIJ A;  3LWU A;  4NMZ A;  4PV1 C;  1CHP D;  1Y1W B;  1PRT C;  3TN2 A;  5C5M A;  2EYM A;  2F0E A;  4M1U B;  3NTH A;  3MHB A;  4HTH A;  1HTP A;  4R8N A;  2BCO A;  1PFB A;  3D31 A;  5EBC A;  3DEO A;  2NBF A;  2NN6 G;  2RSO A;  1G91 A;  3GP7 A;  3URY A;  4N9T A;  5IOC A;  1XWE A;  2R3Z A;  2F0T A;  4KD4 A;  1X32 A;  4PNY A;  3FDT A;  3VYT A;  2KVM A;  5I2X A;  3HP3 A;  3C1F A;  2VXW A;  2KED A;  2M2L A;  4FXK C;  5JAV A;  1YNJ D;  2QKI C;  4FF4 A;  2DY7 A;  3I8Z A;  3HOX B;  2OT2 A;  4DK1 A;  1FR3 A;  5FLX E;  2D2C C;  2BDN A;  4KV6 A;  2HDL A;  4RKB A;  1GHK A;  2A6H D;  3PUY A;  1SJE D;  1E2W A;  2D9U A;  4CGY B;  2PZT A;  3F2U A;  2K32 A;  5FK9 C;  5I6W A;  4B9W A;  2KA7 A;  2PO4 A;  1TY2 A;  4RHS A;  5COR A;  1TU2 B;  5I9P A;  3OPO A;  1X3Q A;  1ILQ A;  2IW3 A;  1G2T A;  1KAB A;  2RA4 A;  5IGB A;  2Z1C A;  1IL8 A;  5IGF A;  3VA7 A;  5I6Y A;  1Z47 A;  2B2U C;  2E2I B;  5HUR A;  4R9W A;  3R3O A;  3NBH A;  5C3E B;  2RBM A;  2C5C A;  3HOW B;  5BN3 A;  1LT6 D;  3SXH A;  1U4R A;  1ROD A;  2X69 A;  4ZK9 B;  3RMH A;  1G29 1;  1LTI D;  4K2K A;  4IAL A;  1I4R A;  1ZYR C;  2OXP A;  4MIU A;  4TQU S;  2NVQ B;  4CHT B;  5DNF A;  1SE3 A;  1NSN S;  1EIG A;  4Q5V A;  5CYU A;  1HQR D;  3GV3 A;  5G3L F;  4DN4 M;  5FKA C;  1SND A;  3A54 A;  1Y8N B;  2AUK A;  1SEB D;  3KF8 A;  2JA6 B;  1HCZ A;  1MI2 A;  3L3O C;  2BA0 A;  1HTL D;  1O80 A;  3M3Y B;  3GV6 A;  2AQ3 B;  1JWS D;  3I70 A;  1STN A;  4RCN A;  3D6W A;  1CHQ D;  2B2Y A;  3U9O A;  4EQN A;  1EFI D;  2MGS A;  5EKI A;  5ISR A;  2B2T A;  3FPP A;  1NR4 A;  3AB9 A;  4OO1 G;  1S5F D;  5KIX A;  4WFN 3;  4C56 C;  3JAM E;  1W6K A;  4XT3 B;  4KK7 A;  5CV8 A;  1CM9 A;  4QMG A;  4CKE A;  2F0F A;  5C5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...