3PMFA

Crystal structure of staphylococcal nuclease variant delta+phs v23a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pmfA00
2F0IA 4NP5A 2EY6A 4IUNA 5CR3A 4B9XA 5C3XA 1A2UA 4R8NA 2F0KA 3T16A 1F2YA 4KJOA 5M9OA 5KRUA 2F3WA 4PMBA 4NKLA 3VA5A 4DU9A 4K2KA 4MIUA 5C5MA 2F0LA 5IGEA 4HMIA 4KJNA 4OL7A 4ZUIA 5C4ZA 1EYCA 5C5LA 4ZQ3A 2OF1A 5IODA 1STYA 1U9RA 5CV8A 1EY0A 2PZTA 4NMZA 3D4DA 1A3VA 4J1MA 4DGZA 1EY4A 3MEHA 3SK5A 5JAVA 5IGGA 5KYIA 1EYAA 2F0EA 3NXWA 4PNYA 4EQNA 2KHSA 3OMCA 4PMCA 1EZ8A 3BDLA 3QOJA 1EY9A 2F0WA 4WORA 3SXHA 3T13A 4K8IA 1A3TA 5DAUA 2F0MA 4K5XA 4NDXA 5K5PA 5ISRA 5J22A 4K5VA 2WACA 1IHZA 3SK4A 1A2TA 4K8JA 1EYDA 4QF4A 4LAAA 1KDCA 1SNDA 2F0HA 1EY6A 2KQ3A 4KTAA 3EROA 1SYCA 4G57A 4K14A 3OMGA 2F0SA 2SNMA 2EYJA 4ID6A 2QDBA 4KY6A 5IOCA 1JORA 3NQTA 5DEHA 1SNOA 2F0OA 5IGBA 3MZ5A 5J1ZA 1STGA 2F0FA 5C6AA 5I6WA 5KIXA 2PYKA 1KAAA 3C1FA 5C4HA 3ITPA 2EYFA 1TR5A 3D8GA 3SR1A 1SNMA 3NK9A 1SYGA 3P75A 3TMEA 5CV4A 2O4XA 2M00A 3C1EA 3S9WA 1JOOA 2EYMA 1F2ZA 2PZUA 2F0DA 1SNQA 2PW5A 5EKKA 5NUCA 4K6DA 5KEEA 4RKBA 1ENCA 3MHBA 3D6CA 4KD4A 5I9OA 2PZWA 1KDAA 2EY2A 4KD3A 5KGUA 3MVVA 5HURA 3LX0A 4E6IA 1NSNS 4QMGA 5CV7A 2RKSA 2EYOA 3TP6A 2PW7A 5KYLA 1F2MA 2F0TA 1SYEA 5IGDA 3TP8A 1EY5A 3QB3A 4K5WA 3P1HA 2F0VA 4HMJA 1KABA 4KHVA 3SK6A 2OEOA 4KV6A 1RKNA 3NHHA 1NUCA 3PMFA 5E1FA 4F7XA 3H6MA 3ERQA 1SNPA 5EKLA 5JOBA 4EQOA 2OXPA 1STNA 1SYDA 3QOLA 2F3VA 4QB4A 3V2TA 5E3FA 5IIFA 2LKVA 5C3WA 2EYPA 2EXZA 4B9WA 5I6YA 1JOKA 3NP8A 3R3OA 2SOBA 2ENBA 4KY7A 4ODGA 4DF7A 2F0QA 4EVOA 5CGKA 5I9PA 2EYHA 2PQEA 3TP5A 4RKLA 2F0PA 3SK8A 4EQPA 5J39A 1ENAA 2RDFA 4KY5A 4N9TA 4I65A 5CV5A 4ZUJA 3RUZA 2RBMA 3HZXA 1KDBA 4K2LA 1AEXA 1EZ6A 4ME5A 1STBA 4IZ8A 5CV6A 4F8MA 1JOQA 1TT2A 5HGTA 5CC4A 1II3A 1STHA 3EVQA 1SYBA 2SNSA 4N9PA 2EY5A 3NUCA 3OWFA 4WRDA 1EY7A 1STAA 2EYLA 3DHQA 3OSOA 5F2DA 1SNCA 4TRDA 3EJIA 4J6HA 3SHLA 4DFAA 5IGFA 1EQVA 3D4WA 1A3UA 5EGTA 5IGCA 5CV9A 4HTHA 4IALA 3U9OA 2F0NA 2HQEA 2NUCA 3MXPA 4YIJA 3TP7A 2F0JA 4S3SA 4H7BA 3BDCA 3E5SA 1SYFA 2F0UA 1EY8A 3DMUA 1TQOA 2F0GA 2EY1A 3HEJA
chains in the Genus database with same CATH superfamily
1XXGA 4A3EG 4A3KH 2EY6A 2JA7G 1NNXA 4IJHA 3CU7A 3OIQA 3T16A 3CCRA 3K7AH 2ID0A 5IY0A 2HQLA 4K2KA 2FXQA 5IGEA 3KJPA 2CCZA 3G7LA 3I72A 1WD0A 1U0LA 3MFYA 3ICEA 5JAVA 3CC2A 3OMCA 1D7QA 2UUBQ 2E2HB 2DJFC 4DR6L 5IYBH 4A3CG 3KOJA 1CKNB 2D5DA 4CHTB 1ENFA 1PFSA 2XWBB 5EKIA 2B2UC 3CCQA 1F9PA 3NBIA 1ZYRC 2HDLA 1DZ1A 1TS5A 1K83B 5I6WA 1I4PA 4JI7L 3C1FA 3H3VH 1O7IA 1JE4A 3QG1A 3SR1A 3T1YQ 1SYGA 4XTCS 1A63A 3CHBD 5D3IB 3BVMA 2OT2A 3JAML 2PW5A 2UXBQ 1KNAA 3M7GA 2PI2E 1XPOA 2XTIA 3GTLB 4DV0L 4A3GH 4UAIA 4DV1Q 2YU9H 4G7OC 3ONAB 2BA1A 1SN8A 1YNJC 2OEOA 1F9QA 2JA7H 1MI2A 5DM63 1VQOA 2FMCA 1FNUA 4BY7B 1STNA 3PUVA 3OTOL 4FNFA 2VQFL 4QJFA 4X65Q 2MUYA 1YVCA 1NR4A 2ZM6Q 1HZAA 2F0PA 2BOSA 3HKSA 4F88A 2K32A 2QDLA 1YI2A 4DV4Q 4ZUJA 1B44D 2UXCQ 1I50B 4LF5Q 2B63B 1AEXA 1JQYD 4DR7Q 1JOQA 1TWAH 1N32L 3D0FA 2K50A 4A3CH 3TREA 2SNSA 3S1RH 3TZUA 5LMNL 1XNQQ 1STAA 3HOYB 3HG9A 3KDFA 3GTQB 1CHQD 1JMCA 3VDYA 2L0CA 1IBKL 1ASZA 1GOZA 4X62L 4HTHA 3M7NA 2XWJB 3IL8A 4OIKA 5FLXL 1VQPA 2I0QA 1I94Q 2F0GA 1Y1WB 1E3PA 1QB5D 2K75A 3PIPA 5CR3A 3BS1A 4IQZA 3N52A 2ICIA 1TS3A 1N8RC 4NXNL 2F0KA 1H9MA 1K0SA 4XT1B 3RN5A 1G6PA 2F3WA 3QIAA 3ZJYC 1HPCA 4DUYQ 4IUTA 5C5MA 3V96A 3CCUA 1O7LA 1O78A 3K0YA 1U4PA 5CV8A 4JI1L 2QCPX 1G2SA 2D0PA 2VNUD 2NVTB 3R93A 3ND8A 3I8ZA 1SFOB 2UU9Q 5K5PA 2LY7A 2IX3A 4A4IA 4K8JA 1CTMA 4QF4A 1KDCA 4JI4L 3MAQA 2M2LA 2NTTA 1ILPA 1JORA 1PRTF 5DEHA 3S2DH 1B4OA 2B2VA 1O7YA 2Q8TA 2MP1A 4DR3L 3MTSA 1MJEA 1SNMA 3NK9A 4Q5VA 1LTRD 2FJ2A 2BDOA 1MHWC 4DV2Q 4DR4Q 4BXXG 1K3BC 1E2ZA 4R4QA 3S9WA 4LF8Q 3PO2G 2AUKA 2R6GA 4GZYC 2BH8A 5M3MG 5I9OA 1I6HH 1YNNC 3KLWA 4X64Q 3CCVA 2WAQE 1KC8C 2ZXPA 2F4IA 4FYDA 1F2MA 1Z6HA 4A3IG 1HZCA 1NY4A 1Y69U 1EOVA 4ZKBB 5IP7H 5JVH3 3UDGA 1HJPA 4DV6L 4A3JB 1JT8A 4XYQA 4DAYB 2EOTA 1LLRD 4DR5Q 2EYHA 3PUWA 2PQEA 3UDIA 1E0BA 5J39A 2VW9A 2PCFB 2XVSA 4KY5A 2UUAL 4JI6L 1GUGA 4K2LA 1STBA 4A3MB 1GM5A 4QIWB 4JI7Q 3F1ZA 4LJZC 4BY1H 5IE8A 1WTOA 3RN2A 4CDFC 1AN8A 2HIVA 3HOUG 2MNAA 2I5LX 1GUOA 4R4OA 1PTOH 4V190 3M4YA 2EZVA 2AKWB 1YITA 4GN4B 4JV5L 4HIKA 3QJYA 2N3SA 2X69A 4BXXH 2R7ZB 4DAYA 4FDBA 1H9RA 4LW1A 4A3LH 5C4XG 1S5BD 1FNWA 5DLQE 5FLXE 5ELCA 2KCTA 1VQ8A 1Q81C 4AYBG 3K5LA 3I56A 2L1BA 2NVXB 5IWAQ 4DGZA 5ELEA 3KK7A 4JBWA 2NN6H 3I4MB 3S1QH 1WCMB 2Y0SG 4PMCA 3QOJA 1V1OA 1Y1VB 3UDFA 5KNBA 1WJJA 2JN4A 3GDEA 2F0HA 4G4KA 4C3HH 5LMNQ 4FF4A 2EYJA 1SAPA 4OX9L 1GUSA 2F0FA 2KEEA 3MFGA 5KIXA 3HOVG 4U68A 3EQLC 1GJXA 3AQQA 3SE0A 2VB3X 4IFDJ 2WKCA 3MHBA 1ILQA 3EFXD 5JEAG 3HOXG 4BBRH 1NSNS 4QMGA 3G6EA 3FPUB 4P73A 3H09A 4RAUC 3S1NB 4A3FH 1N34Q 4CDEC 3DWQA 5C4XH 1AZPA 4QGUA 4DNRB 5D65A 5JOBA 3A5ZB 2XIWA 4NW2A 1CA6A 5C4JH 3I4OA 2EXZA 5I6YA 4B9WA 3G6JB 3K59A 4KY7A 1VQHA 1QCBD 1GHJA 4HEDA 1E7ZA 1NJIC 3ERSX 1GUNA 1HHVA 3WDNA 3K81C 2EXDA 5BN3A 3RNUA 5T1IA 3D6WA 1Y8OB 2ZJPA 3BVZA 2IWHA 3PIP3 3PUZA 2B2VC 1DGSA 2IW3A 5IP9H 2L4NA 1AE3A 2ICEC 1BCPB 2NTSA 1E2VA 5I2YA 1DONA 4FXKC 3EIVA 1N36Q 3TSSA 2G5DA 3MWYW 4IFDH 1HTPA 1DOMA 1Q8KA 2J4XA 1K8AC 4IALA 3E3XA 2E8GA 3H0GB 3X3MA 4H7BA 4A3BG 2JXMB 1ICWA 3JC66 4IUNA 4B9XA 2JA5G 2Z8LA 4HSVA 1YHAA 2PMZB 4A75A 3M3YB 4X6AH 1DM0B 5M9OA 2ZTEA 1OXTA 2R7FA 4IJLA 4NKLA 3HOXH 5G3LF 2JEBI 1I3QH 4OXPA 2Q8IB 1CKMA 3FEWX 4GS3A 4B3ML 2SEBD 1UAPA 4WJ4A 2B63G 2D0OA 1F2LA 4BA2I 4GKJL 5ISRA 2IJ0A 3R2IA 1U4MA 1UEAB 2DY8A 1E2WA 3HOYG 1A8VA 4O2DA 2JA8B 2NN6I 3OMGA 4KY6A 4RFBA 5IOCA 2E2IB 5BR8Q 5IGBA 1D1IA 3SDZA 2A19A 2PYKA 5GAEC 1IBMQ 4V0BA 3J7A5 4C3IH 4HSPA 1Y1WG 1Q46A 1VQIA 3K6OA 3WOFA 4APVA 4C3JH 3Q8DA 2J7ZA 1EFWA 2D9UA 3PF5A 4A93B 3ND9A 2EYOA 1LTGD 2N78A 3J7AV 4A3BH 1F77A 1X3GA 3PF4A 3MEFA 4A3DH 2K5DA 2JA5H 4L5SA 2B39A 4LMQD 1IKLA 1DYQA 4B3RL 2GVBA 5E3FA 1QVGA 2M9VA 3C3LA 3SEBA 3CCSA 3PQIA 3S2HB 1LTAD 4B3SL 3RR5A 1XYIA 3CPFA 5LHY1 3F8TA 2KUMA 1STEA 1TT2A 4POFA 4JI8L 3I73A 2BA0A 5ELDA 1CT1D 4DK1A 4XQQA 5JPNC 3NENA 3MXNB 3HS0C 1KNEA 1J5EL 3PUYA 1QZGA 4LFBL 5IGFA 4HIOA 2VL6A 5CMDA 1JICA 3MXGA 5M5WH 3SVMA 3DXJC 1WTWA 4DUZL 4GKKQ 1BBUA 5C5LA 1R4PB 1N33L 1A2UA 3AB9A 2MJ8A 4PMWA 4IFDI 2TSSA 5FLMG 4DR2Q 4PQXA 3VA5A 1S5CD 2I5HA 3HFZB 1YBYA 5IODA 5M5XB 5CBAE 1X3FA 3FKIH 2HHHQ 1ET9A 4A3MG 5DAUA 1W6JA 4KMUC 3L7ZC 4PZ8A 3MC0B 2K1BA 1IHZA 1A2TA 5ELNA 1EYDA 3BVGA 4LFAQ 5C44G 1Q86C 3D4RA 4HJ7A 1EFID 2JE6I 1SMXA 3LWUA 3AMUA 5E7NA 4H02A 3G4SA 3AYHB 4FF1A 1IBLQ 2PI2A 2E5LL 3PGZA 3P75A 4UY8C 3TMEA 3KF6B 5M3FB 2R7ZG 5ELOA 1D8LA 2WB1B 3K57A 1HZBA 1Q1BA 1HFNA 2ZXRA 1B1ZA 1PH4A 3D6CA 1TWGB 2WINB 3RZDH 3FPPA 4OO1G 1BCPD 1N9WA 3ULPA 5J3BA 3HOZH 1B2TA 1NBWA 3E9IA 1RIPA 4HJ5A 1BNZA 1XNRQ 3AEVA 3FHWA 3HOWH 4AH6A 4KV6A 3S1MB 1WCMG 4B3MQ 4DR1Q 1RTOA 1Y1VG 3OW7A 5C3WA 2EYPA 4K0KL 3GQBA 1SR3A 1VQ4A 1SE2A 4AIMA 1PFMA 1BCPC 3J80c 5E4XA 1Z9FA 2ZTDA 4EQPA 1K8MA 5C0XH 2D2CC 5M5YH 3UI2A 3KF6A 3UE1A 2E76C 5CV5A 2VUMB 4C3HB 3RUZA 4DKAC 2LSSA 2JA6B 2VS1A 3GTPB 2D62A 4L5TA 2IL8A 3EBEA 5CYUA 1RODA 1G51A 2KHJA 1OTCA 1LABA 3OYYA 5C44H 2K28A 1Y8NB 4X3TA 3SHLA 1SNCA 1MBYA 2KA7A 2BCOA 4TQUS 4IOCA 3J80E 2EY1A 1CQVA 5BN5A 1PTOF 3C46A 3AU7A 2GVAA 3DUZA 3NE5B 1XPRA 5K36G 4JI2L 4GLXA 3CMAA 1BO0A 2Q2IA 4XYOA 3S14B 4YHHQ 1WTPA 5IGGA 3A5UA 2VQEL 4NDXA 1AH9A 1KIXA 1K8GA 1CK1A 3I70A 4KHPQ 1QUQB 4LF6Q 1Q90A 1TVXA 2K03A 2NBFA 2HCIA 4HN7A 1CUKA 4U673 1X3QA 1I4XA 2F52A 3K5OA 3J7YW 5AJ3L 1J5EQ 4LFBQ 2I46A 2O2LD 2CFMA 1ICFB 2NZHA 1G91A 1KAAA 4UP7A 2Z6BA 1ZYRD 3H0GG 3TEHB 1ZKOA 3GTMB 2K5NA 2NVQB 3NTKA 1CI3M 2C9OA 4LUOA 3TBIB 4P72A 2AQ2B 2H1EA 2WV6D 1VMCA 4FVMA 4IPCA 1EWIA 2TMPA 1W2BA 2F0TA 3K58A 1W6KA 1H95A 3O13A 4ZYSA 1QUQA 2OTJA 1H9KA 1PZID 5JJIA 2RF4A 1SBBB 2G9HD 1YNJD 1L2FA 4DV3L 2K7VA 4QL5A 5CGKA 1BDOA 1BVSA 4EVOA 1IL2A 5FJ8G 1WTHA 1G8ZD 1HCZA 2JA8G 4N8FA 1S3OA 4P2CB 4X66Q 1CM9A 2ZJRA 1YNXA 5GROA 3UE0A 3P20A 5EPLA 1HTLD 2L5TA 2LXJA 3MXUA 2XRQD 3F2UA 3KDFB 3PV0A 1DJRD 3J81c 1KAWA 2BE5D 2EY5A 4A3EH 5C0XI 4WRDA 1HZ9A 4J8QA 5F2DA 1QILA 2XN9C 4RGTA 1OXSC 1IXRA 1PRTB 2CWPA 1A3UA 2AWOA 3OOCA 4A93G 1PDQA 4LUVA 1FNVA 4YWMA 4H44C 2R93G 1KLUD 2AWNA 3E5SA 3PSIA 4LWCA 4OGQC 1HNWL 5IYCG 4XIGS 1S5DD 2VZAA 5A2QE 4JBKA 1X54A 5C3XA 3KFUA 5IYDG 4ZRZA 2H5XA 2Z4HA 1Y14B 2BE5C 3I91A 4KJOA 4TSSA 3S16H 5H1SE 2DUDA 1BQQT 3J81E 4K0KQ 5FO9B 5C4ZA 1QZHA 1J6QA 4ZCKA 2EDGA 3S15B 1QOHA 5EJWA 1I5FA 1MD2D 2VB2X 1VCIA 1EY9A 3NBHB 4LF4L 3SXHA 3DEPA 2IPKD 2B8FA 2NZ1D 1MSHA 4X3SA 4KKUA 4Z9CB 2KQ3A 5FJ8H 3WOEA 1SYCA 4FF3A 1FJGL 1PH8A 2DNCA 2KCMA 3GTKH 1K0RA 3A8IE 1IKMA 3M85A 4L5RC 2K05A 3L0OA 3ITPA 1BF4A 4LK1C 2CW0C 1ESRA 1ZEQX 2O4XA 3KLSA 2NB0A 1JOOA 5C3EG 1SXTA 4NXMQ 4XQJA 5KGUA 5LMUL 4DV7L 3LX0A 4QY7A 3VR6A 2E2JH 4X3UA 4JI2Q 3NBHA 1YNND 3VR3A 4ABNA 2R93H 1Y8PB 2DNEA 1LT6D 3EN2A 3R8BA 1M1KC 3V2TA 1C8CA 4RHRA 3J80i 1ESFA 2HCCA 3A7AB 2VQEQ 2EJMA 3W2DA 2Q8RE 1PYSB 1HA6A 2JSOA 2XRSD 3I3CA 5KNCA 4CJ2C 4RKLA 4C2MH 2UUCL 1JE5A 2A73B 1R9TB 3LWEA 4P71A 3H3VI 1D5ZC 3IRBA 1W3SA 1A6XA 4ME5A 3S17B 5ELBA 5FOBB 3PUXA 3HKZB 4BBSB 1QNKA 1II3A 3EVQA 2WB1G 4AYBE 3W5OA 2J0TD 2KCNA 1HNZL 3OSOA 1EY7A 1SE4A 2CKZB 4PZ6A 3Q6SA 4YCVA 3FVQA 2VY3A 3DWAA 4FF2A 4TVAB 3GTOB 3BJUA 5A35A 3VA7A 2Y0SE 2OQ0A 2Z0SA 4DR6Q 1TWCB 1EEFD 2F1MA 1EQQA 2ZTCA 3Q23A 4UDUC 3I4NB 2HIXA 1UUPA 2KEDA 2F0IA 4NP5A 1VMPA 5C3EH 1Q7YC 4PMBA 4PG3A 1VQEA 2A6ED 3CC7A 1Q82C 4HIDA 5HY6A 2R92B 1C0AA 4DNTB 1JB7A 5IT9c 2B2YA 3GTJH 2K5HA 4DV0Q 2JA6G 3CCJA 2MO1A 3PCOB 4CBVA 3PO2H 2F4VL 2G9DA 1XTDA 1PZKD 4HCEA 4K14A 5M3MH 2A6EC 4OEMB 1CA5A 1TWFB 2F0OA 5EPJA 2Q2HA 3MZ5A 3OTOQ 2VQFQ 4DK6C 1SRUA 3CW2C 1UEBA 4A3IH 1UE5A 1RDPD 1RL2A 1X55A 2M00A 4Y52H 1FR3A 2EE1A 2QILA 2PZUA 2ZXOA 1LACA 3K0XA 2AQ1B 5TSSA 2RSOA 1KDAA 3CXCA 3U4ZA 3MVVA 1N32Q 3CP0A 5CV7A 1PRTD 5T1GA 1TS2A 2GN5A 1X3EA 1XTCD 2DJGC 2LS01 1VQ7A 4HMJA 4JYAL 4IO9A 1RKNA 1VS0A 3PO3G 1IBKQ 3BYYB 4IURA 1XMOL 4EQOA 4X62Q 5IIFA 4N8X1 2LKVA 4OWWB 3NP8A 4ILWA 1MSGA 5I9PA 1VQNA 3HOUH 3P7JA 3PIOA 2X6LA 1YIJA 4CDCC 2LMCB 1PRTC 2Q2UA 4NXNQ 2AQ3B 4A3KB 4UHVA 3GTGH 3J81i 1I6VC 1X65A 1KDBA 4IZ8A 2RDHA 3L2PA 5HGTA 3M4OH 2KECA 4JI5L 3K7AB 4RGOS 1HR0W 3T1HL 2N88A 2OCEA 1QNUA 4JI1Q 3DHQA 4TRDA 2NVYH 4DNIA 4LFCL 5IGCA 1IW7D 2F0NA 1XPUA 3CQZH 1EYGA 4Y7NH 4JI4Q 4DK3C 1U4LA 1KXLA 3GV6A 1UE6A 1O80A 1SDFA 2K01A 4RG1A 1SEBD 2UXDL 2NWGA 4JI0L 1YHQA 3A74A 4DR3Q 1L1OA 4RMFA 1O7ZA 3VR2A 1KTKA 2OF1A 1LT4D 1U9RA 4UPAA 1IW7C 4WJWA 1NE3A 3KBGA 2KHSA 3PO3H 3RZOH 1PXUA 1RF2D 4HJ9A 2A68D 3HOVH 3G48A 4A3GB 4K5VA 1PH6A 3SK4A 2YU9B 3F2BA 4H13C 1G6ZA 3KF8A 4PV1C 2A74C 4LF7L 4BY7G 2FINB 3U58A 4GN5A 5JEAH 2JA7B 5I2XA 4DV6Q 1I4HA 5C6AA 1V9PA 1LTSD 3NTIA 2VXWA 5CV4A 2A68C 5GAGC 1B53A 4EGVA 3ZYYX 4UP8A 5EKKA 4GOPA 2UUAQ 4JI6Q 4JI3L 2E2HH 1CSQA 4JPBW 1TY2A 1TWAB 1UE1A 2H4OA 2SDFA 1H9JA 1J9OA 3TP8A 4FP5D 4K5WA 3SK6A 1PH1A 3S1RB 4FXDA 3PMFA 1I4RA 1K83H 4JV5Q 1GHKA 1WD1A 3MA2B 3STBC 2B2YC 1Q8IA 1SMYC 3RLFA 1DXMA 2R61A 4I7AA 1I4QA 1HA5A 4G7ZC 3Q0AA 4LF9L 3OHXC 3GTLH 1HNXL 2RBMA 4JOIA 4YY3L 1AZQA 1GKHA 2RHQB 4ME3A 5EAYA 3G71A 2MHVA 4B3TL 1LUZA 1AFPA 1XJVA 1EQTA 3RMHA 1F9SA 2MGSA 1CFMA 1MJCA 3BG3A 1LTLA 4BY7H 1LTTD 1WFQA 4AQYL 2GA4B 3CC4A 3I2ZA 1GO3E 3TP7A 4MTKA 4QIWE 1PYWD 3DMUA 1JWMD 1TQOA 5L37A 3DM1A 1CSPA 1S5ED 4DAMA 1I50H 3KUPA 2B63H 4OX9Q 4NPSA 5GQOA 3S2DB 1YJWA 2BH2A 2XGTA 1EYCA 1PYBA 1JR0D 2PQAB 1STYA 3HOYH 2PZTA 4DAPA 3GTQH 1EY4A 1NTGA 2F03A 1RHPA 3J80L 1BR9A 2HD3A 1JJGA 1FGBD 2MFIA 4DV5L 4K8IA 1I6HB 2R3ZA 1HXYD 2K5VA 1Y1WH 1I4GA 4HJAA 1S4ZA 4A3JG 2CH4W 1SNOA 3B6YA 3A55A 5CORA 5C4HA 1SJED 3KJOA 4R9WA 4DK0A 3CCLA 3I4NG 2K6AA 2NVTH 1EOTA 2KENA 1F9RA 3OPOA 1SNQA 4CKBA 2PQAA 1SFOH 1ENCA 4IOAA 2UUBL 1EUJA 2UXDQ 4F87A 1P16A 4JI0Q 1YJ9A 3H91A 5C0XJ 3OIPA 3TP6A 2WKDA 2PW7A 4IUUA 2R92G 2L12A 5IGDA 3TDQA 4BY1B 1EY5A 4DA2A 1L1OC 1XWEA 1X32A 1AE2A 2Z1CA 1EU3A 4F7XA 1EIFA 4OWTB 1PTOB 2YTXA 3CPWA 1FGUA 1SE8A 2KBNA 2L15A 1Q1EA 4KK7A 1VQLA 3R3OA 2A69D 4KN7C 4XQNA 3T1YL 4ULLA 4MTNA 2LXKA 2MO0A 5KNDA 4GNXB 2UXBL 4DV1L 1P8LA 5FK9C 3I4MG 2QGQA 1LTBD 4GLVB 3RLOA 4POGA 3GO5A 1VQJA 1QVFA 2A69C 3EJIA 5FLMH 4A3JH 3IAYA 3S1QB 3H3VC 4GKJQ 3CRKC 4GOPC 3RLNA 3NTHA 4JBJA 1LM0A 4YIJA 3URYA 1JWSD 4X65L 1EEID 5FO8B 1YJNA 1SYFA 1RCVD 2JA9A 1FL0A 4DXFA 2ZM6L 2IX1A 1QWYA 4WFN3 2HDMA 4DV4L 1FVIA 4A3MH 2QA4A 1VQ9A 2UXCL 1F2YA 2KCCA 4LF5L 1NR2A 2E75C 1TU2B 4DR7L 4GNXA 4MIUA 1CZGA 3LGJA 4ZUIA 2RCNA 4NMZA 1A3VA 1PVOA 3HRZC 1XNQL 4A3KG 3NXWA 4PZ7A 3E9HA 3T13A 4L6TB 5A2QL 1T5EA 2F0MA 2PMZE 4K5XA 4CDDC 4IPGA 3E0EA 2R7ZH 4Q0FA 2WACA 4BBRB 1G291 4UP9A 4JOIC 1V8QA 1EY6A 3J81L 1I94L 3EROA 1BBWA 4A3FB 2F0SA 4JC0A 4KI0A 2WAQB 4OO1H 1E22A 4M1UB 3CMEA 5C4XB 3VYSA 4B3RQ 1YHBA 4P75A 2NVXH 2I07B 5C4JB 4FO2A 3TS2A 5IYBG 2E74C 3TRZA 4MHEA 3I4MH 4B3SQ 2EYMA 1F2ZA 1WCMH 1VQ5A 1Y1VH 1ZXTA 2PZWA 4A76A 2UU9L 4JI8Q 1SSOA 1SYEA 2B2TA 4X3KA 3HGBA 2F0VA 3IFTA 1VQDA 3NHHA 3IKJA 1M4VA 2IHFA 3ERQA 3FMCA 2O5JC 1HFGA 1ET6A 4A3GG 3QWNA 4DUZQ 4DR4L 4DV2L 4IPHA 4LF8L 1N33Q 1M8AA 4N9TA 2X6GA 4I65A 3W1BA 1L0XB 1VF5C 3SK5A 4X64L 3Q24A 2QF7A 3S1NH 3HOXB 1PFNA 1I3QB 4N9PA 1VQFA 2EYLA 5E4WC 2K5WA 4DFAA 3A0JA 3A56A 2ATWA 1EQVA 5K36H 5EGTA 3KYHC 2NUCA 2L11A 1EWHA 3MXPA 1AP0A 3CCEA 4DR5L 1UNSA 3K8AA 4JVZA 1VQ6A 1A0IA 4DU9A 1VQGA 1PH9A 4HMIA 2E5LQ 1D2BA 2KJXA 1HR0L 1TKWB 3ULLA 1BBXC 1EY0A 1GUTA 4C3IB 3MEHA 1LT3D 1UWVA 4YCWA 1JJCB 3I90A 3BU2A 4WORA 1EZ8A 3QO2A 4C3JB 2KHIA 1IZ6A 3H0GH 2IY5B 1PTOD 3NELA 1LYLA 2C5CA 4A3BB 1KL9A 2SNMA 3I55A 3M3YH 4OONA 3NQTA 4A3DB 1L0YB 1CKNA 2Z4IA 2JA5B 1TR5A 2Z9HA 3KBXA 1WI5A 3C1EA 1AW7A 5IWAL 2A1AA 1X3PA 2CW0D 1PTOC 4K6DA 4OO1I 3AFPA 4P74A 5EPKA 3TN2A 4E6IA 1B8AA 2NYZD 2RKSA 3GP7A 1PHJA 1MGSA 2JA8H 5COYA 3NSWA 3OWEB 1XMQL 1KABA 1PFBA 4GNXC 1H9SB 2E2IH 2WB1E 2K5QA 1OXVA 1Q3LA 2V4DA 4YCUA 2I5MX 1SLJA 1B7YB 1SYDA 1NMGA 4QB4A 1T5XD 4YWLA 5IT9L 2L55A 1PH5A 2WFWA 3UDXA 4ODGA 5M5WB 2B2WA 3SK8A 2EPBA 5GAHC 2QEXA 4GN3B 2R7DA 4L5QA 2EJFC 1UE7A 1S5FD 3BYTB 3IFDA 4A93H 1EZ6A 5IP7G 4F8MA 5CV6A 2EIFA 5I4DA 2B3GA 2FFKB 1J8IA 2HUGA 2EJGC 5CC4A 3FDTA 3A54A 1SYBA 5IYCH 4OWXB 4C1NI 1EIYB 3NUCA 3W3AA 1N34L 1VQAA 5IYDH 3FKIB 2RSNA 2JQOA 1H9SA 4BA1I 4BWGB 1LO5D 3DLLA 3JAMc 4O1NA 2F0JA 3S2HH 1FYCA 3BDCA 4BY1G 2F0UA 1E1TA 1KRTA 3OW2A 2RVLA 2A5HA 2ES2A 1U4RA 2JK8A 5AJ3Q 2B2TC 1BXTA 1VQMA 2C35B 5M3FG 1WTRA 3E6ZX 2F0LA 3LNNA 3CRLC 1EL0A 2F3IA 1LTID 1VQBA 1D1KA 3WWVA 1X56A 2OTLA 4PNYA 4A3LG 2ZT9C 1N36L 4MN3A 2HT1A 3GD7A 1TXYA 1R4QB 1A3TA 3RZDB 3JAME 1KRSA 3E0JA 4LAAA 3HOZB 1SNDA 4DAVA 1L0WA 2CH4A 4JW0A 3HOWB 4MNOA 2NN6G 2JP1A 5DM73 1VQCA 2ALYB 3K5MA 3A8KE 4DV3Q 4BS9A 5M5XH 1VQKA 3HP3A 2BDNA 4JG2A 2VUMG 4C3HG 2K04A 2K33A 1PH2A 5M5YB 4RH6A 1EU4A 3W1GA 5EQ0A 2DN8A 5FLXc 2A6HD 3AFQA 2RHSB 1HR0Q 3FRPB 3KLSX 1WVLA 1U5KA 5C44B 1K9MC 2CVRA 2KOLA 2ASBA 3NWSA 5BR8L 1KD1C 2OXPA 1PH3A 2PO4A 5LL6X 2JEAI 5M3FH 4BBRG 1T9HA 3J7ZC 1JCKB 3GV3A 1IBML 2Q2TA 1HNWQ 4HJ8A 1IL8A 4A3FG 5IT9E 1TWGH 2WAQG 4IUQA 1HRJA 2A6HC 3HZXA 1VDZA 1B9NA 4DXGA 3M4QA 4ZLTF 2CWAA 2FHTA 4EX5A 1GUWA 1KLGD 3OWFA 3BDOA 3S1MH 2XSCA 3DWPA 4ZK9B 1S72A 4LF4Q 1QVCA 4RWSC 5CV9A 2PNHA 1GD7A 3BZCA 1DOKA 3K7UC 1YEZA 3NQIA 1EY8A 4DN4M 1FJGQ 1XMQQ 4CJ1B 2VUMH 1L1OB 5IP9G 1CKOA 2OQKA 2YTYA 4R8NA 2K52A 3CCMA 2RCFA 2JA6H 3I7FA 3GTPH 4IFDG 1E1OA 1TWHH 5AFWA 3QR8A 4KJNA 4ZQ3A 1D6EC 5JEAJ 1JWUD 2YTVA 2AMCB 2IT1A 3R2TA 4IUPA 1WTQA 2AHOB 1BUVT 5KYIA 4ALPA 1EYAA 2MQHA 3H94A 4HAEA 2O5IC 1TY0A 3VR5A 2B2WC 5LMUQ 4J15A 4DV7Q 4RGMA 1EWCA 4C56C 3D3RA 1B3QA 3KF8B 4H0LC 2PPBC 4GKKL 2DGYA 2QDBA 2N49A 2B8GA 2A8VA 2K14A 5J1ZA 4TKOB 1OO9B 4ZAIA 4DR2L 4WJ3M 4GOPB 4OHJA 1WTXA 2RDGA 4HR7B 3ULJA 3S14H 1V1PB 2HHHL 2UUCQ 4RCOA 1B3AA 4O0AA 4KD3A 2FMMA 2ZJQA 2JYOA 1OXXK 1VF7A 4R8IA 1PV4A 3VR4A 1HUNA 3NEMA 2QEJC 3A7LA 5GADC 3P1HA 1ML0D 2P5ZX 4C3IG 3ER0A 1HNZQ 4LFAL 3H15A 5LMNW 4A3EB 5E1FA 2Z6KA 3CAMA 3H6MA 4RHSA 4C3JG 4R4TA 3QOLA 1DCZA 4QUFA 1JOKA 5FO7B 1IBLL 2CQOA 3GTMH 2F0QA 2NVQH 1V43A 4G7HC 2N8NA 4IPDA 1IYVA 1ENAA 1K8OA 3STBD 4XXEA 1HQMC 4KKSA 4A3DG 1PMRA 1SMYD 1V1PA 3BZDB 1JJ2A 5JVG3 5EBDA 4CGYB 4JK1C 3DEOA 4RGNA 3S16B 1JC7A 3CF5A 1WYDA 4HIMA 1STHA 1KHIA 1HH2P 1CHPD 4L8JA 2QKIC 1XNRL 4B08A 1IYJB 1BKBA 5CBEE 3JAMi 3T51B 1WOCA 3D4WA 4DR1L 2WIIB 4L63B 4KN4C 3VYRA 1MKHA 3CD6A 2HQEA 2NZOA 2IHEA 1OXUA 2OWOA 4S3SA 2F4VQ 3HKZE 1DOLA 1NMFA 2CQAA 4DPGA 3GTKB 1NCVA 5KRUA 4ZKCB 1GXDC 3J7AF 3L3OC 3L9AX 4OL7A 4GLAC 3TS0A 1SE3A 2L9HA 3D4DA 2LFNA 4J1MA 1QJOA 2F0EA 4MZ9A 1S40A 3BDLA 2F0WA 1RTNA 2QW7A 4OELB 5J22A 2YYZA 2E2JB 1YZ6A 1QE6A 3U9SA 3K5NA 4JYAQ 2R93B 1BCPF 3FKIG 3BZKA 5FKAC 1XMOQ 2V1CC 4XT3B 1STGA 3I4LA 4R4IA 3V05A 1LT5D 2EYFA 2XNAC 3D8GA 4NB3A 3S15H 3DM3A 2K4KA 4I7ZC 2F0DA 3M9BA 4YHHL 1B50A 4C2MB 1FD7D 3VYTA 1BOSA 2EY2A 5HURA 3HKZG 5DNFA 4BBSG 3FP9A 4JI5Q 1HQRD 5G3LD 4KHPL 4LF6L 3T1HQ 1Q12A 1B9MA 5LL6S 2DY7A 4QQBX 4LFCQ 2E2DC 4EQ5A 1B70B 2SOBA 1CZWA 2MPMA 4DF7A 3HOZG 1QG7A 1DD2A 3TP5A 1SJHD 1CQFA 2RDFA 3HOWG 2B29A 1PZJD 1JB3A 3A8JE 4JBMA 1IYUA 5C3EB 3PIO3 5JJZA 2B2UA 4HCSA 3TQYA 2IX0A 2JJQA 1MIUA 1LV9A 1X6OA 2YV5A 1A62A 3M4PA 4J6HA 5C0XG 3F2DA 5D14A 1Z47A 3D31A 4LUZA 3MXNA 3U4VA 1PH7A 4FXGC 3GTJB 1C4QA 3K80C 1NAPA 1ONLA 1RD9D 4R1JA 3KLRA 3U9OA 4O42A 2CHBD 3T56B 3S24A 1D5XC 3HEJA 1RJTA 4OIJA 3T4AC 1HUMA 3PO2B 3NWTA 3SGIA 1R9TH 4LF7Q 3VYUA 4CJ0B 4X66L 3S17H 5M3MB 5JJLA 4XDXA 1K73C 1M90C 1TIID 1TS4A 1ASYA 1KQSA 4BBSH 1K28A 2Z6KC 3EA6A 1PA6A 4QUCA 3Q22A 4A3IB 3U50C 4QCLA 5JPMC 4JI3Q 3T53B 4KHZA 4EQNA 3RD4A 3GTOH 1TWCH 5EBCA 2RA4A 4KKTA 3NPPA 1PLFA 3J81j 1Z7TA 2AUJD 3I4NH 1EQRA 4KTAA 1C48A 4G57A 4CKEA 4ID6A 1K3RA 4IN3A 5D3DA 2R92H 4R4CA 1EIGA 3TZDA 3HOUB 1G2TA 3C2PA 1SROA 4LF9Q 5NUCA 5KEEA 4RKBA 4KD4A 1HNXQ 4YY3Q 2EVBA 4K6LA 3GTGB 3F2CA 5BN4A 4B3TQ 5KYLA 1XX8A 2PNRC 4JCVE 3M4OB 1TWHB 5JJKA 3QB3A 4KHVA 2N55A 1C7YA 1WTVA 4RCNA 1TWFH 1NUCA 1C9OA 4AQYQ 1SNPA 5EKLA 4C1NK 2NVYB 2F3VA 4DUYL 4AYBB 5ELFA 2ENBA 3X3NA 1E24A 1V1QA 3CQZB 2WP8J 4Y7NB 1GVPA 1X9NA 2Y0SB 4NXML 1A15A 4RA8A 4CKCA 4IUVA 4KLKA 3N6RA 4YWKA 1D5MC 4LNQA 4DV5Q 4M8AA 2KVMA 3PO3B 3RZOB 3HOVB 2RQXA 1EIHA 5HGQA 3CKIB 2EQSA
chains in the Genus database with same CATH topology
1XXGA 2EY6A 3CU7A 3OIQA 3T16A 2ID0A 4K2KA 5IGEA 3G7LA 3I72A 1WD0A 3MFYA 5JAVA 3OMCA 2E2HB 2D5DA 4CHTB 1ENFA 2XWBB 5EKIA 2B2UC 1F9PA 3NBIA 1ZYRC 2HDLA 1DZ1A 1TS5A 1K83B 5I6WA 1I4PA 3C1FA 1JE4A 3QG1A 3SR1A 1SYGA 4XTCS 3CHBD 5D3IB 3BVMA 2OT2A 3JAML 2PW5A 1KNAA 3M7GA 3GTLB 4UAIA 4G7OC 3ONAB 2BA1A 1YNJC 2OEOA 1F9QA 1MI2A 5DM63 2FMCA 1FNUA 4BY7B 1STNA 3PUVA 4FNFA 2MUYA 1NR4A 2F0PA 2BOSA 4F88A 2K32A 4ZUJA 1B44D 1I50B 2B63B 1AEXA 1JQYD 1JOQA 2SNSA 3TZUA 1STAA 3HOYB 3HG9A 3GTQB 1CHQD 2L0CA 1GOZA 4HTHA 3M7NA 2XWJB 3IL8A 4OIKA 5FLXL 2F0GA 1Y1WB 1QB5D 5CR3A 3BS1A 4IQZA 3N52A 2ICIA 1TS3A 2F0KA 1H9MA 4XT1B 2F3WA 3QIAA 1HPCA 4IUTA 5C5MA 3V96A 1O7LA 1O78A 3K0YA 1U4PA 5CV8A 2QCPX 1G2SA 2VNUD 2NVTB 3R93A 3ND8A 3I8ZA 1SFOB 5K5PA 2LY7A 2IX3A 4K8JA 1CTMA 4QF4A 1KDCA 3MAQA 2M2LA 2NTTA 1ILPA 1JORA 1PRTF 5DEHA 1B4OA 2B2VA 1O7YA 2Q8TA 2MP1A 3MTSA 1SNMA 3NK9A 4Q5VA 1LTRD 2FJ2A 2BDOA 1E2ZA 3S9WA 2AUKA 2R6GA 4GZYC 5I9OA 1YNNC 2ZXPA 2F4IA 4FYDA 1F2MA 1Z6HA 1Y69U 4ZKBB 5JVH3 4A3JB 4XYQA 2EOTA 1LLRD 2EYHA 3PUWA 2PQEA 1E0BA 5J39A 2PCFB 2XVSA 4KY5A 1GUGA 4K2LA 1STBA 4A3MB 4QIWB 4LJZC 1WTOA 1AN8A 1GUOA 1PTOH 4V190 3M4YA 2EZVA 3QJYA 2X69A 2R7ZB 4DAYA 1H9RA 1S5BD 1FNWA 5FLXE 5ELCA 3K5LA 2L1BA 2NVXB 4DGZA 5ELEA 3KK7A 4JBWA 2NN6H 3I4MB 1WCMB 4PMCA 3QOJA 1V1OA 1Y1VB 5KNBA 2F0HA 4G4KA 4FF4A 2EYJA 1SAPA 1GUSA 2F0FA 2KEEA 3MFGA 5KIXA 4U68A 3EQLC 1GJXA 3SE0A 2VB3X 4IFDJ 2WKCA 3MHBA 1ILQA 3EFXD 5JEAG 1NSNS 4QMGA 3FPUB 3H09A 4RAUC 3S1NB 3DWQA 1AZPA 4DNRB 5D65A 5JOBA 2XIWA 4NW2A 1CA6A 5I6YA 2EXZA 4B9WA 3G6JB 3K59A 4KY7A 1QCBD 1GHJA 4HEDA 1GUNA 1HHVA 3WDNA 5BN3A 5T1IA 3D6WA 1Y8OB 3BVZA 2IWHA 3PIP3 3PUZA 2B2VC 2IW3A 2L4NA 2ICEC 1BCPB 2NTSA 1E2VA 5I2YA 1DONA 4FXKC 3TSSA 3MWYW 4IFDH 1HTPA 1DOMA 2J4XA 4IALA 3H0GB 3X3MA 4H7BA 2JXMB 1ICWA 4IUNA 4B9XA 2Z8LA 4HSVA 2PMZB 3M3YB 1DM0B 5M9OA 1OXTA 4NKLA 5G3LF 2JEBI 2Q8IB 3FEWX 2SEBD 1UAPA 1F2LA 4BA2I 5ISRA 2IJ0A 3R2IA 1U4MA 1UEAB 2DY8A 1E2WA 2JA8B 2NN6I 3OMGA 4KY6A 4RFBA 5IOCA 2E2IB 5IGBA 1D1IA 3SDZA 2PYKA 4V0BA 4HSPA 3K6OA 3WOFA 2J7ZA 2D9UA 4A93B 3ND9A 2EYOA 1LTGD 3J7AV 1F77A 2K5DA 2B39A 4LMQD 1IKLA 1DYQA 5E3FA 2M9VA 3C3LA 3SEBA 3S2HB 1LTAD 1XYIA 5LHY1 2KUMA 1STEA 1TT2A 3I73A 2BA0A 5ELDA 5JPNC 1CT1D 4XQQA 4DK1A 3HS0C 1KNEA 3PUYA 5IGFA 5CMDA 1JICA 3MXGA 3SVMA 3DXJC 1WTWA 5C5LA 1R4PB 1A2UA 3AB9A 2MJ8A 4PMWA 4IFDI 2TSSA 4PQXA 3VA5A 1S5CD 5IODA 5M5XB 5CBAE 1ET9A 5DAUA 1W6JA 4KMUC 3L7ZC 3MC0B 2K1BA 1IHZA 1A2TA 1EYDA 3BVGA 3D4RA 1EFID 2JE6I 3LWUA 3AMUA 4FF1A 3P75A 3TMEA 5M3FB 2WB1B 3K57A 1Q1BA 1HFNA 2ZXRA 1B1ZA 3D6CA 1TWGB 2WINB 3FPPA 4OO1G 1BCPD 1B2TA 1BNZA 4KV6A 3S1MB 1RTOA 3OW7A 5C3WA 2EYPA 3GQBA 1SE2A 1PFMA 1BCPC 5E4XA 4EQPA 1K8MA 5C0XH 2D2CC 3UI2A 2E76C 5CV5A 2VUMB 4C3HB 3RUZA 2JA6B 3GTPB 2D62A 2IL8A 5CYUA 1RODA 1LABA 2K28A 1Y8NB 4X3TA 3SHLA 1SNCA 1MBYA 2KA7A 2BCOA 4TQUS 3J80E 2EY1A 1CQVA 5BN5A 1PTOF 3C46A 3AU7A 3DUZA 3NE5B 5K36G 1BO0A 4XYOA 3S14B 1WTPA 5IGGA 4NDXA 1CK1A 3I70A 1Q90A 1TVXA 2K03A 2NBFA 2HCIA 4HN7A 4U673 1X3QA 1I4XA 3K5OA 3J7YW 2I46A 2O2LD 1G91A 1KAAA 1ZYRD 1ZKOA 3GTMB 2NVQB 3NTKA 1CI3M 2C9OA 3TBIB 2AQ2B 2H1EA 2WV6D 1VMCA 4FVMA 2TMPA 2F0TA 3K58A 1W6KA 3O13A 4ZYSA 1H9KA 1PZID 1SBBB 2G9HD 1YNJD 2K7VA 5CGKA 1BDOA 4EVOA 1G8ZD 1HCZA 4P2CB 1CM9A 3P20A 5EPLA 1HTLD 2L5TA 3MXUA 3PV0A 2XRQD 3F2UA 1DJRD 2BE5D 2EY5A 5C0XI 4WRDA 4J8QA 5F2DA 1QILA 2XN9C 4RGTA 1OXSC 1PRTB 1A3UA 2AWOA 3OOCA 1PDQA 1FNVA 4H44C 1KLUD 2AWNA 3E5SA 4OGQC 4XIGS 1S5DD 5A2QE 5C3XA 4ZRZA 2Z4HA 2BE5C 3I91A 4KJOA 4TSSA 1BQQT 3J81E 5FO9B 5C4ZA 2EDGA 3S15B 1QOHA 5EJWA 1MD2D 2VB2X 1VCIA 1EY9A 3SXHA 3DEPA 2IPKD 2B8FA 2NZ1D 1MSHA 4X3SA 4KKUA 4Z9CB 2KQ3A 3WOEA 1SYCA 4FF3A 2DNCA 3A8IE 1IKMA 3M85A 2K05A 3ITPA 1BF4A 4LK1C 2CW0C 1ESRA 1ZEQX 2O4XA 3KLSA 2NB0A 1JOOA 1SXTA 4XQJA 5KGUA 3LX0A 3VR6A 4X3UA 3NBHA 1YNND 3VR3A 4ABNA 1Y8PB 2DNEA 1LT6D 3R8BA 1C8CA 3V2TA 4RHRA 1ESFA 2HCCA 3A7AB 2EJMA 3W2DA 2Q8RE 1HA6A 2JSOA 2XRSD 3I3CA 5KNCA 4CJ2C 4RKLA 2A73B 1R9TB 3LWEA 1D5ZC 1A6XA 4ME5A 3S17B 5ELBA 5FOBB 3PUXA 3HKZB 4BBSB 1QNKA 1II3A 3EVQA 2J0TD 2KCNA 1EY7A 3OSOA 1SE4A 3Q6SA 3FVQA 3DWAA 4FF2A 3GTOB 3VA7A 5A35A 1TWCB 1EEFD 2F1MA 3Q23A 4UDUC 3I4NB 1UUPA 2KEDA 2F0IA 4NP5A 1VMPA 4PMBA 2A6ED 2R92B 4DNTB 2B2YA 4CBVA 2G9DA 1PZKD 4HCEA 4K14A 2A6EC 1CA5A 1TWFB 2F0OA 5EPJA 3MZ5A 1RDPD 2M00A 1FR3A 2EE1A 2QILA 2PZUA 2ZXOA 1LACA 2AQ1B 5TSSA 2RSOA 1KDAA 3MVVA 5CV7A 1PRTD 5T1GA 1TS2A 1XTCD 2LS01 4HMJA 1RKNA 3BYYB 4IURA 4EQOA 5IIFA 2LKVA 3NP8A 4ILWA 1MSGA 5I9PA 3P7JA 2X6LA 2LMCB 1PRTC 2AQ3B 4A3KB 1I6VC 1KDBA 4IZ8A 2RDHA 5HGTA 2KECA 3K7AB 4RGOS 2N88A 1QNUA 3DHQA 4TRDA 5IGCA 1IW7D 2F0NA 1U4LA 3GV6A 1O80A 1SDFA 2K01A 1SEBD 2NWGA 1O7ZA 3VR2A 1KTKA 2OF1A 1LT4D 1U9RA 1IW7C 4WJWA 3KBGA 2KHSA 1PXUA 1RF2D 2A68D 4A3GB 4K5VA 3SK4A 2YU9B 4H13C 1G6ZA 3KF8A 4PV1C 2A74C 2FINB 5JEAH 2JA7B 5I2XA 1I4HA 5C6AA 1LTSD 3NTIA 2VXWA 5CV4A 2A68C 1B53A 4EGVA 3ZYYX 5EKKA 1TY2A 1TWAB 2H4OA 2SDFA 1H9JA 1J9OA 3TP8A 4FP5D 4K5WA 3SK6A 3S1RB 4FXDA 3PMFA 1I4RA 1GHKA 1WD1A 3MA2B 2B2YC 1Q8IA 1SMYC 3RLFA 1DXMA 2R61A 1I4QA 1HA5A 4G7ZC 3Q0AA 3OHXC 2RBMA 1AZQA 2MHVA 1AFPA 1EQTA 3RMHA 1F9SA 2MGSA 1CFMA 3BG3A 1LTTD 2GA4B 3TP7A 1PYWD 3DMUA 1JWMD 1TQOA 3DM1A 1S5ED 3KUPA 3S2DB 1EYCA 1JR0D 1STYA 2PZTA 4DAPA 1EY4A 2F03A 1RHPA 3J80L 1BR9A 1FGBD 4K8IA 1I6HB 2R3ZA 1HXYD 1I4GA 1S4ZA 1SNOA 3A55A 5CORA 5C4HA 1SJED 4R9WA 4DK0A 2K6AA 1EOTA 1F9RA 3OPOA 1SNQA 4CKBA 1ENCA 4F87A 3H91A 5C0XJ 3OIPA 3TP6A 2WKDA 2PW7A 4IUUA 2L12A 5IGDA 3TDQA 4BY1B 1EY5A 4DA2A 1XWEA 1X32A 2Z1CA 1EU3A 4F7XA 1PTOB 1Q1EA 4KK7A 3R3OA 2A69D 4KN7C 4XQNA 4ULLA 5KNDA 5FK9C 1LTBD 3GO5A 2A69C 3EJIA 3IAYA 3S1QB 3H3VC 3CRKC 3NTHA 3URYA 4YIJA 1JWSD 1EEID 5FO8B 1SYFA 1RCVD 4DXFA 2IX1A 1QWYA 4WFN3 2HDMA 1F2YA 2KCCA 1NR2A 2E75C 1TU2B 4MIUA 1CZGA 4ZUIA 4NMZA 1A3VA 3HRZC 3NXWA 3T13A 4L6TB 5A2QL 1T5EA 2F0MA 4K5XA 4Q0FA 2WACA 4BBRB 1G291 1V8QA 1EY6A 3J81L 3EROA 4A3FB 2F0SA 4KI0A 2WAQB 4OO1H 4M1UB 5C4XB 3VYSA 2I07B 5C4JB 4FO2A 2E74C 4MHEA 2EYMA 1F2ZA 1ZXTA 2PZWA 1SSOA 1SYEA 2B2TA 4X3KA 3HGBA 2F0VA 3IFTA 3NHHA 3IKJA 1M4VA 3ERQA 3FMCA 2O5JC 1HFGA 1ET6A 3QWNA 1M8AA 4N9TA 2X6GA 4I65A 1L0XB 1VF5C 3SK5A 3Q24A 2QF7A 3HOXB 1PFNA 1I3QB 4N9PA 2EYLA 5E4WC 2K5WA 4DFAA 3A56A 1EQVA 5K36H 5EGTA 2NUCA 2L11A 1EWHA 3MXPA 1AP0A 1UNSA 4DU9A 4HMIA 1D2BA 2KJXA 1TKWB 1BBXC 1EY0A 1GUTA 4C3IB 3MEHA 1LT3D 3I90A 4WORA 1EZ8A 3QO2A 4C3JB 1PTOD 2C5CA 4A3BB 2SNMA 3NQTA 4A3DB 1L0YB 2Z4IA 2JA5B 1TR5A 3KBXA 3C1EA 1AW7A 1X3PA 2CW0D 1PTOC 4K6DA 4OO1I 5EPKA 3TN2A 4E6IA 2NYZD 2RKSA 3GP7A 1MGSA 5COYA 3NSWA 3OWEB 1KABA 1PFBA 1H9SB 2K5QA 1OXVA 1Q3LA 2V4DA 1SYDA 4QB4A 1T5XD 5IT9L 2L55A 4ODGA 5M5WB 2B2WA 3SK8A 2EPBA 2EJFC 1S5FD 3BYTB 3IFDA 1EZ6A 4F8MA 5CV6A 5I4DA 2FFKB 1J8IA 2HUGA 5CC4A 2EJGC 3FDTA 3A54A 1SYBA 4C1NI 3NUCA 3W3AA 3FKIB 2RSNA 1H9SA 4BA1I 4BWGB 1LO5D 4O1NA 2F0JA 1FYCA 3BDCA 2F0UA 2RVLA 2A5HA 1U4RA 2B2TC 1BXTA 1WTRA 3E6ZX 2F0LA 3LNNA 3CRLC 1EL0A 1LTID 1D1KA 4PNYA 2ZT9C 4MN3A 3GD7A 1R4QB 1A3TA 3RZDB 3JAME 3E0JA 4LAAA 3HOZB 1SNDA 4DAVA 3HOWB 2NN6G 2JP1A 5DM73 3K5MA 3A8KE 4BS9A 3HP3A 2BDNA 4C3HG 2K04A 2K33A 5M5YB 4RH6A 1EU4A 5EQ0A 2DN8A 2A6HD 3FRPB 3KLSX 1WVLA 5C44B 2CVRA 2KOLA 3NWSA 2OXPA 2PO4A 5LL6X 2JEAI 1JCKB 3GV3A 1IL8A 5IT9E 4IUQA 1HRJA 2A6HC 3HZXA 1VDZA 1B9NA 4DXGA 4ZLTF 2FHTA 1GUWA 1KLGD 3OWFA 3BDOA 2XSCA 3DWPA 4ZK9B 4RWSC 5CV9A 1DOKA 3NQIA 1EY8A 4DN4M 4CJ1B 4R8NA 4IFDG 5AFWA 4KJNA 4ZQ3A 1D6EC 5JEAJ 1JWUD 3R2TA 2IT1A 4IUPA 1WTQA 1BUVT 5KYIA 1EYAA 3H94A 2O5IC 4HAEA 1TY0A 3VR5A 2B2WC 4RGMA 1EWCA 4C56C 3D3RA 4H0LC 2PPBC 2QDBA 2B8GA 5J1ZA 4TKOB 1OO9B 4ZAIA 4OHJA 1WTXA 2RDGA 4HR7B 1V1PB 4RCOA 1B3AA 4KD3A 2FMMA 2JYOA 1OXXK 1VF7A 4R8IA 3VR4A 1HUNA 2QEJC 3A7LA 3P1HA 1ML0D 4C3IG 4A3EB 5E1FA 3H6MA 4RHSA 4C3JG 3QOLA 1DCZA 4QUFA 1JOKA 5FO7B 2F0QA 1V43A 4G7HC 1IYVA 1ENAA 1K8OA 4XXEA 1HQMC 4KKSA 1PMRA 1SMYD 1V1PA 3BZDB 5JVG3 5EBDA 4CGYB 4JK1C 3DEOA 4RGNA 3S16B 1JC7A 1STHA 1CHPD 4L8JA 2QKIC 4B08A 5CBEE 3T51B 3D4WA 2WIIB 4L63B 4KN4C 3VYRA 2HQEA 1OXUA 4S3SA 1DOLA 2CQAA 3GTKB 1NCVA 5KRUA 4ZKCB 1GXDC 3L3OC 3L9AX 4OL7A 1SE3A 2L9HA 3D4DA 2LFNA 4J1MA 1QJOA 2F0EA 3BDLA 2F0WA 1RTNA 5J22A 2YYZA 2E2JB 3U9SA 1QE6A 3K5NA 2R93B 1BCPF 5FKAC 4XT3B 1STGA 3I4LA 3V05A 1LT5D 2EYFA 2XNAC 3D8GA 4I7ZC 2F0DA 1B50A 4C2MB 1FD7D 3VYTA 1BOSA 2EY2A 5HURA 5DNFA 1HQRD 5G3LD 1Q12A 1B9MA 5LL6S 2DY7A 2E2DC 2SOBA 1CZWA 2MPMA 4DF7A 1QG7A 1DD2A 3TP5A 1SJHD 1CQFA 2RDFA 1PZJD 1JB3A 3A8JE 1IYUA 5C3EB 3PIO3 5JJZA 2B2UA 4HCSA 2IX0A 1LV9A 5C0XG 4J6HA 5D14A 1Z47A 3D31A 3MXNA 4FXGC 3GTJB 1C4QA 3J7AF 1NAPA 1ONLA 1RD9D 3KLRA 3U9OA 4O42A 2CHBD 3T56B 1D5XC 3HEJA 1RJTA 4OIJA 3T4AC 1HUMA 3PO2B 3NWTA 3VYUA 4CJ0B 5M3MB 4XDXA 1TIID 1TS4A 3EA6A 4QUCA 3Q22A 4A3IB 4QCLA 5JPMC 3T53B 4KHZA 4EQNA 3RD4A 5EBCA 2RA4A 4KKTA 3NPPA 1PLFA 1Z7TA 2AUJD 4KTAA 1C48A 4G57A 4CKEA 4ID6A 4IN3A 5D3DA 1EIGA 3TZDA 3HOUB 1G2TA 3C2PA 5NUCA 5KEEA 4RKBA 4KD4A 2EVBA 4K6LA 3GTGB 5BN4A 5KYLA 1XX8A 2PNRC 3M4OB 1TWHB 3QB3A 4KHVA 2N55A 1WTVA 4RCNA 1NUCA 1SNPA 5EKLA 4C1NK 2NVYB 2F3VA 4AYBB 5ELFA 2ENBA 3X3NA 3CQZB 2WP8J 4Y7NB 2Y0SB 1A15A 4RA8A 4CKCA 4IUVA 3N6RA 1D5MC 4M8AA 2KVMA 3PO3B 3RZOB 3HOVB 2RQXA 1EIHA 3CKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0I A;  4NP5 A;  2EY6 A;  4IUN A;  5CR3 A;  4B9X A;  5C3X A;  1A2U A;  4R8N A;  2F0K A;  3T16 A;  1F2Y A;  4KJO A;  5M9O A;  5KRU A;  2F3W A;  4PMB A;  4NKL A;  3VA5 A;  4DU9 A;  4K2K A;  4MIU A;  5C5M A;  2F0L A;  5IGE A;  4HMI A;  4KJN A;  4OL7 A;  4ZUI A;  5C4Z A;  1EYC A;  5C5L A;  4ZQ3 A;  2OF1 A;  5IOD A;  1STY A;  1U9R A;  5CV8 A;  1EY0 A;  2PZT A;  4NMZ A;  3D4D A;  1A3V A;  4J1M A;  4DGZ A;  1EY4 A;  3MEH A;  3SK5 A;  5JAV A;  5IGG A;  5KYI A;  1EYA A;  2F0E A;  3NXW A;  4PNY A;  4EQN A;  2KHS A;  3OMC A;  4PMC A;  1EZ8 A;  3BDL A;  3QOJ A;  1EY9 A;  2F0W A;  4WOR A;  3SXH A;  3T13 A;  4K8I A;  1A3T A;  5DAU A;  2F0M A;  4K5X A;  4NDX A;  5K5P A;  5ISR A;  5J22 A;  4K5V A;  2WAC A;  1IHZ A;  3SK4 A;  1A2T A;  4K8J A;  1EYD A;  4QF4 A;  4LAA A;  1KDC A;  1SND A;  2F0H A;  1EY6 A;  2KQ3 A;  4KTA A;  3ERO A;  1SYC A;  4G57 A;  4K14 A;  3OMG A;  2F0S A;  2SNM A;  2EYJ A;  4ID6 A;  2QDB A;  4KY6 A;  5IOC A;  1JOR A;  3NQT A;  5DEH A;  1SNO A;  2F0O A;  5IGB A;  3MZ5 A;  5J1Z A;  1STG A;  2F0F A;  5C6A A;  5I6W A;  5KIX A;  2PYK A;  1KAA A;  3C1F A;  5C4H A;  3ITP A;  2EYF A;  1TR5 A;  3D8G A;  3SR1 A;  1SNM A;  3NK9 A;  1SYG A;  3P75 A;  3TME A;  5CV4 A;  2O4X A;  2M00 A;  3C1E A;  3S9W A;  1JOO A;  2EYM A;  1F2Z A;  2PZU A;  2F0D A;  1SNQ A;  2PW5 A;  5EKK A;  5NUC A;  4K6D A;  5KEE A;  4RKB A;  1ENC A;  3MHB A;  3D6C A;  4KD4 A;  5I9O A;  2PZW A;  1KDA A;  2EY2 A;  4KD3 A;  5KGU A;  3MVV A;  5HUR A;  3LX0 A;  4E6I A;  1NSN S;  4QMG A;  5CV7 A;  2RKS A;  2EYO A;  3TP6 A;  2PW7 A;  5KYL A;  1F2M A;  2F0T A;  1SYE A;  5IGD A;  3TP8 A;  1EY5 A;  3QB3 A;  4K5W A;  3P1H A;  2F0V A;  4HMJ A;  1KAB A;  4KHV A;  3SK6 A;  2OEO A;  4KV6 A;  1RKN A;  3NHH A;  1NUC A;  3PMF A;  5E1F A;  4F7X A;  3H6M A;  3ERQ A;  1SNP A;  5EKL A;  5JOB A;  4EQO A;  2OXP A;  1STN A;  1SYD A;  3QOL A;  2F3V A;  4QB4 A;  3V2T A;  5E3F A;  5IIF A;  2LKV A;  5C3W A;  2EYP A;  2EXZ A;  4B9W A;  5I6Y A;  1JOK A;  3NP8 A;  3R3O A;  2SOB A;  2ENB A;  4KY7 A;  4ODG A;  4DF7 A;  2F0Q A;  4EVO A;  5CGK A;  5I9P A;  2EYH A;  2PQE A;  3TP5 A;  4RKL A;  2F0P A;  3SK8 A;  4EQP A;  5J39 A;  1ENA A;  2RDF A;  4KY5 A;  4N9T A;  4I65 A;  5CV5 A;  4ZUJ A;  3RUZ A;  2RBM A;  3HZX A;  1KDB A;  4K2L A;  1AEX A;  1EZ6 A;  4ME5 A;  1STB A;  4IZ8 A;  5CV6 A;  4F8M A;  1JOQ A;  1TT2 A;  5HGT A;  5CC4 A;  1II3 A;  1STH A;  3EVQ A;  1SYB A;  2SNS A;  4N9P A;  2EY5 A;  3NUC A;  3OWF A;  4WRD A;  1EY7 A;  1STA A;  2EYL A;  3DHQ A;  3OSO A;  5F2D A;  1SNC A;  4TRD A;  3EJI A;  4J6H A;  3SHL A;  4DFA A;  5IGF A;  1EQV A;  3D4W A;  1A3U A;  5EGT A;  5IGC A;  5CV9 A;  4HTH A;  4IAL A;  3U9O A;  2F0N A;  2HQE A;  2NUC A;  3MXP A;  4YIJ A;  3TP7 A;  2F0J A;  4S3S A;  4H7B A;  3BDC A;  3E5S A;  1SYF A;  2F0U A;  1EY8 A;  3DMU A;  1TQO A;  2F0G A;  2EY1 A;  3HEJ A; 
#chains in the Genus database with same CATH topology
 1XXG A;  4A3E G;  4A3K H;  2EY6 A;  2JA7 G;  1NNX A;  4IJH A;  3CU7 A;  3OIQ A;  3T16 A;  3CCR A;  3K7A H;  2ID0 A;  5IY0 A;  2HQL A;  4K2K A;  2FXQ A;  5IGE A;  3KJP A;  2CCZ A;  3G7L A;  3I72 A;  1WD0 A;  1U0L A;  3MFY A;  3ICE A;  5JAV A;  3CC2 A;  3OMC A;  1D7Q A;  2UUB Q;  2E2H B;  2DJF C;  4DR6 L;  5IYB H;  4A3C G;  3KOJ A;  1CKN B;  2D5D A;  4CHT B;  1ENF A;  1PFS A;  2XWB B;  5EKI A;  2B2U C;  3CCQ A;  1F9P A;  3NBI A;  1ZYR C;  2HDL A;  1DZ1 A;  1TS5 A;  1K83 B;  5I6W A;  1I4P A;  4JI7 L;  3C1F A;  3H3V H;  1O7I A;  1JE4 A;  3QG1 A;  3SR1 A;  3T1Y Q;  1SYG A;  4XTC S;  1A63 A;  3CHB D;  5D3I B;  3BVM A;  2OT2 A;  3JAM L;  2PW5 A;  2UXB Q;  1KNA A;  3M7G A;  2PI2 E;  1XPO A;  2XTI A;  3GTL B;  4DV0 L;  4A3G H;  4UAI A;  4DV1 Q;  2YU9 H;  4G7O C;  3ONA B;  2BA1 A;  1SN8 A;  1YNJ C;  2OEO A;  1F9Q A;  2JA7 H;  1MI2 A;  5DM6 3;  1VQO A;  2FMC A;  1FNU A;  4BY7 B;  1STN A;  3PUV A;  3OTO L;  4FNF A;  2VQF L;  4QJF A;  4X65 Q;  2MUY A;  1YVC A;  1NR4 A;  2ZM6 Q;  1HZA A;  2F0P A;  2BOS A;  3HKS A;  4F88 A;  2K32 A;  2QDL A;  1YI2 A;  4DV4 Q;  4ZUJ A;  1B44 D;  2UXC Q;  1I50 B;  4LF5 Q;  2B63 B;  1AEX A;  1JQY D;  4DR7 Q;  1JOQ A;  1TWA H;  1N32 L;  3D0F A;  2K50 A;  4A3C H;  3TRE A;  2SNS A;  3S1R H;  3TZU A;  5LMN L;  1XNQ Q;  1STA A;  3HOY B;  3HG9 A;  3KDF A;  3GTQ B;  1CHQ D;  1JMC A;  3VDY A;  2L0C A;  1IBK L;  1ASZ A;  1GOZ A;  4X62 L;  4HTH A;  3M7N A;  2XWJ B;  3IL8 A;  4OIK A;  5FLX L;  1VQP A;  2I0Q A;  1I94 Q;  2F0G A;  1Y1W B;  1E3P A;  1QB5 D;  2K75 A;  3PIP A;  5CR3 A;  3BS1 A;  4IQZ A;  3N52 A;  2ICI A;  1TS3 A;  1N8R C;  4NXN L;  2F0K A;  1H9M A;  1K0S A;  4XT1 B;  3RN5 A;  1G6P A;  2F3W A;  3QIA A;  3ZJY C;  1HPC A;  4DUY Q;  4IUT A;  5C5M A;  3V96 A;  3CCU A;  1O7L A;  1O78 A;  3K0Y A;  1U4P A;  5CV8 A;  4JI1 L;  2QCP X;  1G2S A;  2D0P A;  2VNU D;  2NVT B;  3R93 A;  3ND8 A;  3I8Z A;  1SFO B;  2UU9 Q;  5K5P A;  2LY7 A;  2IX3 A;  4A4I A;  4K8J A;  1CTM A;  4QF4 A;  1KDC A;  4JI4 L;  3MAQ A;  2M2L A;  2NTT A;  1ILP A;  1JOR A;  1PRT F;  5DEH A;  3S2D H;  1B4O A;  2B2V A;  1O7Y A;  2Q8T A;  2MP1 A;  4DR3 L;  3MTS A;  1MJE A;  1SNM A;  3NK9 A;  4Q5V A;  1LTR D;  2FJ2 A;  2BDO A;  1MHW C;  4DV2 Q;  4DR4 Q;  4BXX G;  1K3B C;  1E2Z A;  4R4Q A;  3S9W A;  4LF8 Q;  3PO2 G;  2AUK A;  2R6G A;  4GZY C;  2BH8 A;  5M3M G;  5I9O A;  1I6H H;  1YNN C;  3KLW A;  4X64 Q;  3CCV A;  2WAQ E;  1KC8 C;  2ZXP A;  2F4I A;  4FYD A;  1F2M A;  1Z6H A;  4A3I G;  1HZC A;  1NY4 A;  1Y69 U;  1EOV A;  4ZKB B;  5IP7 H;  5JVH 3;  3UDG A;  1HJP A;  4DV6 L;  4A3J B;  1JT8 A;  4XYQ A;  4DAY B;  2EOT A;  1LLR D;  4DR5 Q;  2EYH A;  3PUW A;  2PQE A;  3UDI A;  1E0B A;  5J39 A;  2VW9 A;  2PCF B;  2XVS A;  4KY5 A;  2UUA L;  4JI6 L;  1GUG A;  4K2L A;  1STB A;  4A3M B;  1GM5 A;  4QIW B;  4JI7 Q;  3F1Z A;  4LJZ C;  4BY1 H;  5IE8 A;  1WTO A;  3RN2 A;  4CDF C;  1AN8 A;  2HIV A;  3HOU G;  2MNA A;  2I5L X;  1GUO A;  4R4O A;  1PTO H;  4V19 0;  3M4Y A;  2EZV A;  2AKW B;  1YIT A;  4GN4 B;  4JV5 L;  4HIK A;  3QJY A;  2N3S A;  2X69 A;  4BXX H;  2R7Z B;  4DAY A;  4FDB A;  1H9R A;  4LW1 A;  4A3L H;  5C4X G;  1S5B D;  1FNW A;  5DLQ E;  5FLX E;  5ELC A;  2KCT A;  1VQ8 A;  1Q81 C;  4AYB G;  3K5L A;  3I56 A;  2L1B A;  2NVX B;  5IWA Q;  4DGZ A;  5ELE A;  3KK7 A;  4JBW A;  2NN6 H;  3I4M B;  3S1Q H;  1WCM B;  2Y0S G;  4PMC A;  3QOJ A;  1V1O A;  1Y1V B;  3UDF A;  5KNB A;  1WJJ A;  2JN4 A;  3GDE A;  2F0H A;  4G4K A;  4C3H H;  5LMN Q;  4FF4 A;  2EYJ A;  1SAP A;  4OX9 L;  1GUS A;  2F0F A;  2KEE A;  3MFG A;  5KIX A;  3HOV G;  4U68 A;  3EQL C;  1GJX A;  3AQQ A;  3SE0 A;  2VB3 X;  4IFD J;  2WKC A;  3MHB A;  1ILQ A;  3EFX D;  5JEA G;  3HOX G;  4BBR H;  1NSN S;  4QMG A;  3G6E A;  3FPU B;  4P73 A;  3H09 A;  4RAU C;  3S1N B;  4A3F H;  1N34 Q;  4CDE C;  3DWQ A;  5C4X H;  1AZP A;  4QGU A;  4DNR B;  5D65 A;  5JOB A;  3A5Z B;  2XIW A;  4NW2 A;  1CA6 A;  5C4J H;  3I4O A;  2EXZ A;  5I6Y A;  4B9W A;  3G6J B;  3K59 A;  4KY7 A;  1VQH A;  1QCB D;  1GHJ A;  4HED A;  1E7Z A;  1NJI C;  3ERS X;  1GUN A;  1HHV A;  3WDN A;  3K81 C;  2EXD A;  5BN3 A;  3RNU A;  5T1I A;  3D6W A;  1Y8O B;  2ZJP A;  3BVZ A;  2IWH A;  3PIP 3;  3PUZ A;  2B2V C;  1DGS A;  2IW3 A;  5IP9 H;  2L4N A;  1AE3 A;  2ICE C;  1BCP B;  2NTS A;  1E2V A;  5I2Y A;  1DON A;  4FXK C;  3EIV A;  1N36 Q;  3TSS A;  2G5D A;  3MWY W;  4IFD H;  1HTP A;  1DOM A;  1Q8K A;  2J4X A;  1K8A C;  4IAL A;  3E3X A;  2E8G A;  3H0G B;  3X3M A;  4H7B A;  4A3B G;  2JXM B;  1ICW A;  3JC6 6;  4IUN A;  4B9X A;  2JA5 G;  2Z8L A;  4HSV A;  1YHA A;  2PMZ B;  4A75 A;  3M3Y B;  4X6A H;  1DM0 B;  5M9O A;  2ZTE A;  1OXT A;  2R7F A;  4IJL A;  4NKL A;  3HOX H;  5G3L F;  2JEB I;  1I3Q H;  4OXP A;  2Q8I B;  1CKM A;  3FEW X;  4GS3 A;  4B3M L;  2SEB D;  1UAP A;  4WJ4 A;  2B63 G;  2D0O A;  1F2L A;  4BA2 I;  4GKJ L;  5ISR A;  2IJ0 A;  3R2I A;  1U4M A;  1UEA B;  2DY8 A;  1E2W A;  3HOY G;  1A8V A;  4O2D A;  2JA8 B;  2NN6 I;  3OMG A;  4KY6 A;  4RFB A;  5IOC A;  2E2I B;  5BR8 Q;  5IGB A;  1D1I A;  3SDZ A;  2A19 A;  2PYK A;  5GAE C;  1IBM Q;  4V0B A;  3J7A 5;  4C3I H;  4HSP A;  1Y1W G;  1Q46 A;  1VQI A;  3K6O A;  3WOF A;  4APV A;  4C3J H;  3Q8D A;  2J7Z A;  1EFW A;  2D9U A;  3PF5 A;  4A93 B;  3ND9 A;  2EYO A;  1LTG D;  2N78 A;  3J7A V;  4A3B H;  1F77 A;  1X3G A;  3PF4 A;  3MEF A;  4A3D H;  2K5D A;  2JA5 H;  4L5S A;  2B39 A;  4LMQ D;  1IKL A;  1DYQ A;  4B3R L;  2GVB A;  5E3F A;  1QVG A;  2M9V A;  3C3L A;  3SEB A;  3CCS A;  3PQI A;  3S2H B;  1LTA D;  4B3S L;  3RR5 A;  1XYI A;  3CPF A;  5LHY 1;  3F8T A;  2KUM A;  1STE A;  1TT2 A;  4POF A;  4JI8 L;  3I73 A;  2BA0 A;  5ELD A;  1CT1 D;  4DK1 A;  4XQQ A;  5JPN C;  3NEN A;  3MXN B;  3HS0 C;  1KNE A;  1J5E L;  3PUY A;  1QZG A;  4LFB L;  5IGF A;  4HIO A;  2VL6 A;  5CMD A;  1JIC A;  3MXG A;  5M5W H;  3SVM A;  3DXJ C;  1WTW A;  4DUZ L;  4GKK Q;  1BBU A;  5C5L A;  1R4P B;  1N33 L;  1A2U A;  3AB9 A;  2MJ8 A;  4PMW A;  4IFD I;  2TSS A;  5FLM G;  4DR2 Q;  4PQX A;  3VA5 A;  1S5C D;  2I5H A;  3HFZ B;  1YBY A;  5IOD A;  5M5X B;  5CBA E;  1X3F A;  3FKI H;  2HHH Q;  1ET9 A;  4A3M G;  5DAU A;  1W6J A;  4KMU C;  3L7Z C;  4PZ8 A;  3MC0 B;  2K1B A;  1IHZ A;  1A2T A;  5ELN A;  1EYD A;  3BVG A;  4LFA Q;  5C44 G;  1Q86 C;  3D4R A;  4HJ7 A;  1EFI D;  2JE6 I;  1SMX A;  3LWU A;  3AMU A;  5E7N A;  4H02 A;  3G4S A;  3AYH B;  4FF1 A;  1IBL Q;  2PI2 A;  2E5L L;  3PGZ A;  3P75 A;  4UY8 C;  3TME A;  3KF6 B;  5M3F B;  2R7Z G;  5ELO A;  1D8L A;  2WB1 B;  3K57 A;  1HZB A;  1Q1B A;  1HFN A;  2ZXR A;  1B1Z A;  1PH4 A;  3D6C A;  1TWG B;  2WIN B;  3RZD H;  3FPP A;  4OO1 G;  1BCP D;  1N9W A;  3ULP A;  5J3B A;  3HOZ H;  1B2T A;  1NBW A;  3E9I A;  1RIP A;  4HJ5 A;  1BNZ A;  1XNR Q;  3AEV A;  3FHW A;  3HOW H;  4AH6 A;  4KV6 A;  3S1M B;  1WCM G;  4B3M Q;  4DR1 Q;  1RTO A;  1Y1V G;  3OW7 A;  5C3W A;  2EYP A;  4K0K L;  3GQB A;  1SR3 A;  1VQ4 A;  1SE2 A;  4AIM A;  1PFM A;  1BCP C;  3J80 c;  5E4X A;  1Z9F A;  2ZTD A;  4EQP A;  1K8M A;  5C0X H;  2D2C C;  5M5Y H;  3UI2 A;  3KF6 A;  3UE1 A;  2E76 C;  5CV5 A;  2VUM B;  4C3H B;  3RUZ A;  4DKA C;  2LSS A;  2JA6 B;  2VS1 A;  3GTP B;  2D62 A;  4L5T A;  2IL8 A;  3EBE A;  5CYU A;  1ROD A;  1G51 A;  2KHJ A;  1OTC A;  1LAB A;  3OYY A;  5C44 H;  2K28 A;  1Y8N B;  4X3T A;  3SHL A;  1SNC A;  1MBY A;  2KA7 A;  2BCO A;  4TQU S;  4IOC A;  3J80 E;  2EY1 A;  1CQV A;  5BN5 A;  1PTO F;  3C46 A;  3AU7 A;  2GVA A;  3DUZ A;  3NE5 B;  1XPR A;  5K36 G;  4JI2 L;  4GLX A;  3CMA A;  1BO0 A;  2Q2I A;  4XYO A;  3S14 B;  4YHH Q;  1WTP A;  5IGG A;  3A5U A;  2VQE L;  4NDX A;  1AH9 A;  1KIX A;  1K8G A;  1CK1 A;  3I70 A;  4KHP Q;  1QUQ B;  4LF6 Q;  1Q90 A;  1TVX A;  2K03 A;  2NBF A;  2HCI A;  4HN7 A;  1CUK A;  4U67 3;  1X3Q A;  1I4X A;  2F52 A;  3K5O A;  3J7Y W;  5AJ3 L;  1J5E Q;  4LFB Q;  2I46 A;  2O2L D;  2CFM A;  1ICF B;  2NZH A;  1G91 A;  1KAA A;  4UP7 A;  2Z6B A;  1ZYR D;  3H0G G;  3TEH B;  1ZKO A;  3GTM B;  2K5N A;  2NVQ B;  3NTK A;  1CI3 M;  2C9O A;  4LUO A;  3TBI B;  4P72 A;  2AQ2 B;  2H1E A;  2WV6 D;  1VMC A;  4FVM A;  4IPC A;  1EWI A;  2TMP A;  1W2B A;  2F0T A;  3K58 A;  1W6K A;  1H95 A;  3O13 A;  4ZYS A;  1QUQ A;  2OTJ A;  1H9K A;  1PZI D;  5JJI A;  2RF4 A;  1SBB B;  2G9H D;  1YNJ D;  1L2F A;  4DV3 L;  2K7V A;  4QL5 A;  5CGK A;  1BDO A;  1BVS A;  4EVO A;  1IL2 A;  5FJ8 G;  1WTH A;  1G8Z D;  1HCZ A;  2JA8 G;  4N8F A;  1S3O A;  4P2C B;  4X66 Q;  1CM9 A;  2ZJR A;  1YNX A;  5GRO A;  3UE0 A;  3P20 A;  5EPL A;  1HTL D;  2L5T A;  2LXJ A;  3MXU A;  2XRQ D;  3F2U A;  3KDF B;  3PV0 A;  1DJR D;  3J81 c;  1KAW A;  2BE5 D;  2EY5 A;  4A3E H;  5C0X I;  4WRD A;  1HZ9 A;  4J8Q A;  5F2D A;  1QIL A;  2XN9 C;  4RGT A;  1OXS C;  1IXR A;  1PRT B;  2CWP A;  1A3U A;  2AWO A;  3OOC A;  4A93 G;  1PDQ A;  4LUV A;  1FNV A;  4YWM A;  4H44 C;  2R93 G;  1KLU D;  2AWN A;  3E5S A;  3PSI A;  4LWC A;  4OGQ C;  1HNW L;  5IYC G;  4XIG S;  1S5D D;  2VZA A;  5A2Q E;  4JBK A;  1X54 A;  5C3X A;  3KFU A;  5IYD G;  4ZRZ A;  2H5X A;  2Z4H A;  1Y14 B;  2BE5 C;  3I91 A;  4KJO A;  4TSS A;  3S16 H;  5H1S E;  2DUD A;  1BQQ T;  3J81 E;  4K0K Q;  5FO9 B;  5C4Z A;  1QZH A;  1J6Q A;  4ZCK A;  2EDG A;  3S15 B;  1QOH A;  5EJW A;  1I5F A;  1MD2 D;  2VB2 X;  1VCI A;  1EY9 A;  3NBH B;  4LF4 L;  3SXH A;  3DEP A;  2IPK D;  2B8F A;  2NZ1 D;  1MSH A;  4X3S A;  4KKU A;  4Z9C B;  2KQ3 A;  5FJ8 H;  3WOE A;  1SYC A;  4FF3 A;  1FJG L;  1PH8 A;  2DNC A;  2KCM A;  3GTK H;  1K0R A;  3A8I E;  1IKM A;  3M85 A;  4L5R C;  2K05 A;  3L0O A;  3ITP A;  1BF4 A;  4LK1 C;  2CW0 C;  1ESR A;  1ZEQ X;  2O4X A;  3KLS A;  2NB0 A;  1JOO A;  5C3E G;  1SXT A;  4NXM Q;  4XQJ A;  5KGU A;  5LMU L;  4DV7 L;  3LX0 A;  4QY7 A;  3VR6 A;  2E2J H;  4X3U A;  4JI2 Q;  3NBH A;  1YNN D;  3VR3 A;  4ABN A;  2R93 H;  1Y8P B;  2DNE A;  1LT6 D;  3EN2 A;  3R8B A;  1M1K C;  3V2T A;  1C8C A;  4RHR A;  3J80 i;  1ESF A;  2HCC A;  3A7A B;  2VQE Q;  2EJM A;  3W2D A;  2Q8R E;  1PYS B;  1HA6 A;  2JSO A;  2XRS D;  3I3C A;  5KNC A;  4CJ2 C;  4RKL A;  4C2M H;  2UUC L;  1JE5 A;  2A73 B;  1R9T B;  3LWE A;  4P71 A;  3H3V I;  1D5Z C;  3IRB A;  1W3S A;  1A6X A;  4ME5 A;  3S17 B;  5ELB A;  5FOB B;  3PUX A;  3HKZ B;  4BBS B;  1QNK A;  1II3 A;  3EVQ A;  2WB1 G;  4AYB E;  3W5O A;  2J0T D;  2KCN A;  1HNZ L;  3OSO A;  1EY7 A;  1SE4 A;  2CKZ B;  4PZ6 A;  3Q6S A;  4YCV A;  3FVQ A;  2VY3 A;  3DWA A;  4FF2 A;  4TVA B;  3GTO B;  3BJU A;  5A35 A;  3VA7 A;  2Y0S E;  2OQ0 A;  2Z0S A;  4DR6 Q;  1TWC B;  1EEF D;  2F1M A;  1EQQ A;  2ZTC A;  3Q23 A;  4UDU C;  3I4N B;  2HIX A;  1UUP A;  2KED A;  2F0I A;  4NP5 A;  1VMP A;  5C3E H;  1Q7Y C;  4PMB A;  4PG3 A;  1VQE A;  2A6E D;  3CC7 A;  1Q82 C;  4HID A;  5HY6 A;  2R92 B;  1C0A A;  4DNT B;  1JB7 A;  5IT9 c;  2B2Y A;  3GTJ H;  2K5H A;  4DV0 Q;  2JA6 G;  3CCJ A;  2MO1 A;  3PCO B;  4CBV A;  3PO2 H;  2F4V L;  2G9D A;  1XTD A;  1PZK D;  4HCE A;  4K14 A;  5M3M H;  2A6E C;  4OEM B;  1CA5 A;  1TWF B;  2F0O A;  5EPJ A;  2Q2H A;  3MZ5 A;  3OTO Q;  2VQF Q;  4DK6 C;  1SRU A;  3CW2 C;  1UEB A;  4A3I H;  1UE5 A;  1RDP D;  1RL2 A;  1X55 A;  2M00 A;  4Y52 H;  1FR3 A;  2EE1 A;  2QIL A;  2PZU A;  2ZXO A;  1LAC A;  3K0X A;  2AQ1 B;  5TSS A;  2RSO A;  1KDA A;  3CXC A;  3U4Z A;  3MVV A;  1N32 Q;  3CP0 A;  5CV7 A;  1PRT D;  5T1G A;  1TS2 A;  2GN5 A;  1X3E A;  1XTC D;  2DJG C;  2LS0 1;  1VQ7 A;  4HMJ A;  4JYA L;  4IO9 A;  1RKN A;  1VS0 A;  3PO3 G;  1IBK Q;  3BYY B;  4IUR A;  1XMO L;  4EQO A;  4X62 Q;  5IIF A;  4N8X 1;  2LKV A;  4OWW B;  3NP8 A;  4ILW A;  1MSG A;  5I9P A;  1VQN A;  3HOU H;  3P7J A;  3PIO A;  2X6L A;  1YIJ A;  4CDC C;  2LMC B;  1PRT C;  2Q2U A;  4NXN Q;  2AQ3 B;  4A3K B;  4UHV A;  3GTG H;  3J81 i;  1I6V C;  1X65 A;  1KDB A;  4IZ8 A;  2RDH A;  3L2P A;  5HGT A;  3M4O H;  2KEC A;  4JI5 L;  3K7A B;  4RGO S;  1HR0 W;  3T1H L;  2N88 A;  2OCE A;  1QNU A;  4JI1 Q;  3DHQ A;  4TRD A;  2NVY H;  4DNI A;  4LFC L;  5IGC A;  1IW7 D;  2F0N A;  1XPU A;  3CQZ H;  1EYG A;  4Y7N H;  4JI4 Q;  4DK3 C;  1U4L A;  1KXL A;  3GV6 A;  1UE6 A;  1O80 A;  1SDF A;  2K01 A;  4RG1 A;  1SEB D;  2UXD L;  2NWG A;  4JI0 L;  1YHQ A;  3A74 A;  4DR3 Q;  1L1O A;  4RMF A;  1O7Z A;  3VR2 A;  1KTK A;  2OF1 A;  1LT4 D;  1U9R A;  4UPA A;  1IW7 C;  4WJW A;  1NE3 A;  3KBG A;  2KHS A;  3PO3 H;  3RZO H;  1PXU A;  1RF2 D;  4HJ9 A;  2A68 D;  3HOV H;  3G48 A;  4A3G B;  4K5V A;  1PH6 A;  3SK4 A;  2YU9 B;  3F2B A;  4H13 C;  1G6Z A;  3KF8 A;  4PV1 C;  2A74 C;  4LF7 L;  4BY7 G;  2FIN B;  3U58 A;  4GN5 A;  5JEA H;  2JA7 B;  5I2X A;  4DV6 Q;  1I4H A;  5C6A A;  1V9P A;  1LTS D;  3NTI A;  2VXW A;  5CV4 A;  2A68 C;  5GAG C;  1B53 A;  4EGV A;  3ZYY X;  4UP8 A;  5EKK A;  4GOP A;  2UUA Q;  4JI6 Q;  4JI3 L;  2E2H H;  1CSQ A;  4JPB W;  1TY2 A;  1TWA B;  1UE1 A;  2H4O A;  2SDF A;  1H9J A;  1J9O A;  3TP8 A;  4FP5 D;  4K5W A;  3SK6 A;  1PH1 A;  3S1R B;  4FXD A;  3PMF A;  1I4R A;  1K83 H;  4JV5 Q;  1GHK A;  1WD1 A;  3MA2 B;  3STB C;  2B2Y C;  1Q8I A;  1SMY C;  3RLF A;  1DXM A;  2R61 A;  4I7A A;  1I4Q A;  1HA5 A;  4G7Z C;  3Q0A A;  4LF9 L;  3OHX C;  3GTL H;  1HNX L;  2RBM A;  4JOI A;  4YY3 L;  1AZQ A;  1GKH A;  2RHQ B;  4ME3 A;  5EAY A;  3G71 A;  2MHV A;  4B3T L;  1LUZ A;  1AFP A;  1XJV A;  1EQT A;  3RMH A;  1F9S A;  2MGS A;  1CFM A;  1MJC A;  3BG3 A;  1LTL A;  4BY7 H;  1LTT D;  1WFQ A;  4AQY L;  2GA4 B;  3CC4 A;  3I2Z A;  1GO3 E;  3TP7 A;  4MTK A;  4QIW E;  1PYW D;  3DMU A;  1JWM D;  1TQO A;  5L37 A;  3DM1 A;  1CSP A;  1S5E D;  4DAM A;  1I50 H;  3KUP A;  2B63 H;  4OX9 Q;  4NPS A;  5GQO A;  3S2D B;  1YJW A;  2BH2 A;  2XGT A;  1EYC A;  1PYB A;  1JR0 D;  2PQA B;  1STY A;  3HOY H;  2PZT A;  4DAP A;  3GTQ H;  1EY4 A;  1NTG A;  2F03 A;  1RHP A;  3J80 L;  1BR9 A;  2HD3 A;  1JJG A;  1FGB D;  2MFI A;  4DV5 L;  4K8I A;  1I6H B;  2R3Z A;  1HXY D;  2K5V A;  1Y1W H;  1I4G A;  4HJA A;  1S4Z A;  4A3J G;  2CH4 W;  1SNO A;  3B6Y A;  3A55 A;  5COR A;  5C4H A;  1SJE D;  3KJO A;  4R9W A;  4DK0 A;  3CCL A;  3I4N G;  2K6A A;  2NVT H;  1EOT A;  2KEN A;  1F9R A;  3OPO A;  1SNQ A;  4CKB A;  2PQA A;  1SFO H;  1ENC A;  4IOA A;  2UUB L;  1EUJ A;  2UXD Q;  4F87 A;  1P16 A;  4JI0 Q;  1YJ9 A;  3H91 A;  5C0X J;  3OIP A;  3TP6 A;  2WKD A;  2PW7 A;  4IUU A;  2R92 G;  2L12 A;  5IGD A;  3TDQ A;  4BY1 B;  1EY5 A;  4DA2 A;  1L1O C;  1XWE A;  1X32 A;  1AE2 A;  2Z1C A;  1EU3 A;  4F7X A;  1EIF A;  4OWT B;  1PTO B;  2YTX A;  3CPW A;  1FGU A;  1SE8 A;  2KBN A;  2L15 A;  1Q1E A;  4KK7 A;  1VQL A;  3R3O A;  2A69 D;  4KN7 C;  4XQN A;  3T1Y L;  4ULL A;  4MTN A;  2LXK A;  2MO0 A;  5KND A;  4GNX B;  2UXB L;  4DV1 L;  1P8L A;  5FK9 C;  3I4M G;  2QGQ A;  1LTB D;  4GLV B;  3RLO A;  4POG A;  3GO5 A;  1VQJ A;  1QVF A;  2A69 C;  3EJI A;  5FLM H;  4A3J H;  3IAY A;  3S1Q B;  3H3V C;  4GKJ Q;  3CRK C;  4GOP C;  3RLN A;  3NTH A;  4JBJ A;  1LM0 A;  4YIJ A;  3URY A;  1JWS D;  4X65 L;  1EEI D;  5FO8 B;  1YJN A;  1SYF A;  1RCV D;  2JA9 A;  1FL0 A;  4DXF A;  2ZM6 L;  2IX1 A;  1QWY A;  4WFN 3;  2HDM A;  4DV4 L;  1FVI A;  4A3M H;  2QA4 A;  1VQ9 A;  2UXC L;  1F2Y A;  2KCC A;  4LF5 L;  1NR2 A;  2E75 C;  1TU2 B;  4DR7 L;  4GNX A;  4MIU A;  1CZG A;  3LGJ A;  4ZUI A;  2RCN A;  4NMZ A;  1A3V A;  1PVO A;  3HRZ C;  1XNQ L;  4A3K G;  3NXW A;  4PZ7 A;  3E9H A;  3T13 A;  4L6T B;  5A2Q L;  1T5E A;  2F0M A;  2PMZ E;  4K5X A;  4CDD C;  4IPG A;  3E0E A;  2R7Z H;  4Q0F A;  2WAC A;  4BBR B;  1G29 1;  4UP9 A;  4JOI C;  1V8Q A;  1EY6 A;  3J81 L;  1I94 L;  3ERO A;  1BBW A;  4A3F B;  2F0S A;  4JC0 A;  4KI0 A;  2WAQ B;  4OO1 H;  1E22 A;  4M1U B;  3CME A;  5C4X B;  3VYS A;  4B3R Q;  1YHB A;  4P75 A;  2NVX H;  2I07 B;  5C4J B;  4FO2 A;  3TS2 A;  5IYB G;  2E74 C;  3TRZ A;  4MHE A;  3I4M H;  4B3S Q;  2EYM A;  1F2Z A;  1WCM H;  1VQ5 A;  1Y1V H;  1ZXT A;  2PZW A;  4A76 A;  2UU9 L;  4JI8 Q;  1SSO A;  1SYE A;  2B2T A;  4X3K A;  3HGB A;  2F0V A;  3IFT A;  1VQD A;  3NHH A;  3IKJ A;  1M4V A;  2IHF A;  3ERQ A;  3FMC A;  2O5J C;  1HFG A;  1ET6 A;  4A3G G;  3QWN A;  4DUZ Q;  4DR4 L;  4DV2 L;  4IPH A;  4LF8 L;  1N33 Q;  1M8A A;  4N9T A;  2X6G A;  4I65 A;  3W1B A;  1L0X B;  1VF5 C;  3SK5 A;  4X64 L;  3Q24 A;  2QF7 A;  3S1N H;  3HOX B;  1PFN A;  1I3Q B;  4N9P A;  1VQF A;  2EYL A;  5E4W C;  2K5W A;  4DFA A;  3A0J A;  3A56 A;  2ATW A;  1EQV A;  5K36 H;  5EGT A;  3KYH C;  2NUC A;  2L11 A;  1EWH A;  3MXP A;  1AP0 A;  3CCE A;  4DR5 L;  1UNS A;  3K8A A;  4JVZ A;  1VQ6 A;  1A0I A;  4DU9 A;  1VQG A;  1PH9 A;  4HMI A;  2E5L Q;  1D2B A;  2KJX A;  1HR0 L;  1TKW B;  3ULL A;  1BBX C;  1EY0 A;  1GUT A;  4C3I B;  3MEH A;  1LT3 D;  1UWV A;  4YCW A;  1JJC B;  3I90 A;  3BU2 A;  4WOR A;  1EZ8 A;  3QO2 A;  4C3J B;  2KHI A;  1IZ6 A;  3H0G H;  2IY5 B;  1PTO D;  3NEL A;  1LYL A;  2C5C A;  4A3B B;  1KL9 A;  2SNM A;  3I55 A;  3M3Y H;  4OON A;  3NQT A;  4A3D B;  1L0Y B;  1CKN A;  2Z4I A;  2JA5 B;  1TR5 A;  2Z9H A;  3KBX A;  1WI5 A;  3C1E A;  1AW7 A;  5IWA L;  2A1A A;  1X3P A;  2CW0 D;  1PTO C;  4K6D A;  4OO1 I;  3AFP A;  4P74 A;  5EPK A;  3TN2 A;  4E6I A;  1B8A A;  2NYZ D;  2RKS A;  3GP7 A;  1PHJ A;  1MGS A;  2JA8 H;  5COY A;  3NSW A;  3OWE B;  1XMQ L;  1KAB A;  1PFB A;  4GNX C;  1H9S B;  2E2I H;  2WB1 E;  2K5Q A;  1OXV A;  1Q3L A;  2V4D A;  4YCU A;  2I5M X;  1SLJ A;  1B7Y B;  1SYD A;  1NMG A;  4QB4 A;  1T5X D;  4YWL A;  5IT9 L;  2L55 A;  1PH5 A;  2WFW A;  3UDX A;  4ODG A;  5M5W B;  2B2W A;  3SK8 A;  2EPB A;  5GAH C;  2QEX A;  4GN3 B;  2R7D A;  4L5Q A;  2EJF C;  1UE7 A;  1S5F D;  3BYT B;  3IFD A;  4A93 H;  1EZ6 A;  5IP7 G;  4F8M A;  5CV6 A;  2EIF A;  5I4D A;  2B3G A;  2FFK B;  1J8I A;  2HUG A;  2EJG C;  5CC4 A;  3FDT A;  3A54 A;  1SYB A;  5IYC H;  4OWX B;  4C1N I;  1EIY B;  3NUC A;  3W3A A;  1N34 L;  1VQA A;  5IYD H;  3FKI B;  2RSN A;  2JQO A;  1H9S A;  4BA1 I;  4BWG B;  1LO5 D;  3DLL A;  3JAM c;  4O1N A;  2F0J A;  3S2H H;  1FYC A;  3BDC A;  4BY1 G;  2F0U A;  1E1T A;  1KRT A;  3OW2 A;  2RVL A;  2A5H A;  2ES2 A;  1U4R A;  2JK8 A;  5AJ3 Q;  2B2T C;  1BXT A;  1VQM A;  2C35 B;  5M3F G;  1WTR A;  3E6Z X;  2F0L A;  3LNN A;  3CRL C;  1EL0 A;  2F3I A;  1LTI D;  1VQB A;  1D1K A;  3WWV A;  1X56 A;  2OTL A;  4PNY A;  4A3L G;  2ZT9 C;  1N36 L;  4MN3 A;  2HT1 A;  3GD7 A;  1TXY A;  1R4Q B;  1A3T A;  3RZD B;  3JAM E;  1KRS A;  3E0J A;  4LAA A;  3HOZ B;  1SND A;  4DAV A;  1L0W A;  2CH4 A;  4JW0 A;  3HOW B;  4MNO A;  2NN6 G;  2JP1 A;  5DM7 3;  1VQC A;  2ALY B;  3K5M A;  3A8K E;  4DV3 Q;  4BS9 A;  5M5X H;  1VQK A;  3HP3 A;  2BDN A;  4JG2 A;  2VUM G;  4C3H G;  2K04 A;  2K33 A;  1PH2 A;  5M5Y B;  4RH6 A;  1EU4 A;  3W1G A;  5EQ0 A;  2DN8 A;  5FLX c;  2A6H D;  3AFQ A;  2RHS B;  1HR0 Q;  3FRP B;  3KLS X;  1WVL A;  1U5K A;  5C44 B;  1K9M C;  2CVR A;  2KOL A;  2ASB A;  3NWS A;  5BR8 L;  1KD1 C;  2OXP A;  1PH3 A;  2PO4 A;  5LL6 X;  2JEA I;  5M3F H;  4BBR G;  1T9H A;  3J7Z C;  1JCK B;  3GV3 A;  1IBM L;  2Q2T A;  1HNW Q;  4HJ8 A;  1IL8 A;  4A3F G;  5IT9 E;  1TWG H;  2WAQ G;  4IUQ A;  1HRJ A;  2A6H C;  3HZX A;  1VDZ A;  1B9N A;  4DXG A;  3M4Q A;  4ZLT F;  2CWA A;  2FHT A;  4EX5 A;  1GUW A;  1KLG D;  3OWF A;  3BDO A;  3S1M H;  2XSC A;  3DWP A;  4ZK9 B;  1S72 A;  4LF4 Q;  1QVC A;  4RWS C;  5CV9 A;  2PNH A;  1GD7 A;  3BZC A;  1DOK A;  3K7U C;  1YEZ A;  3NQI A;  1EY8 A;  4DN4 M;  1FJG Q;  1XMQ Q;  4CJ1 B;  2VUM H;  1L1O B;  5IP9 G;  1CKO A;  2OQK A;  2YTY A;  4R8N A;  2K52 A;  3CCM A;  2RCF A;  2JA6 H;  3I7F A;  3GTP H;  4IFD G;  1E1O A;  1TWH H;  5AFW A;  3QR8 A;  4KJN A;  4ZQ3 A;  1D6E C;  5JEA J;  1JWU D;  2YTV A;  2AMC B;  2IT1 A;  3R2T A;  4IUP A;  1WTQ A;  2AHO B;  1BUV T;  5KYI A;  4ALP A;  1EYA A;  2MQH A;  3H94 A;  4HAE A;  2O5I C;  1TY0 A;  3VR5 A;  2B2W C;  5LMU Q;  4J15 A;  4DV7 Q;  4RGM A;  1EWC A;  4C56 C;  3D3R A;  1B3Q A;  3KF8 B;  4H0L C;  2PPB C;  4GKK L;  2DGY A;  2QDB A;  2N49 A;  2B8G A;  2A8V A;  2K14 A;  5J1Z A;  4TKO B;  1OO9 B;  4ZAI A;  4DR2 L;  4WJ3 M;  4GOP B;  4OHJ A;  1WTX A;  2RDG A;  4HR7 B;  3ULJ A;  3S14 H;  1V1P B;  2HHH L;  2UUC Q;  4RCO A;  1B3A A;  4O0A A;  4KD3 A;  2FMM A;  2ZJQ A;  2JYO A;  1OXX K;  1VF7 A;  4R8I A;  1PV4 A;  3VR4 A;  1HUN A;  3NEM A;  2QEJ C;  3A7L A;  5GAD C;  3P1H A;  1ML0 D;  2P5Z X;  4C3I G;  3ER0 A;  1HNZ Q;  4LFA L;  3H15 A;  5LMN W;  4A3E B;  5E1F A;  2Z6K A;  3CAM A;  3H6M A;  4RHS A;  4C3J G;  4R4T A;  3QOL A;  1DCZ A;  4QUF A;  1JOK A;  5FO7 B;  1IBL L;  2CQO A;  3GTM H;  2F0Q A;  2NVQ H;  1V43 A;  4G7H C;  2N8N A;  4IPD A;  1IYV A;  1ENA A;  1K8O A;  3STB D;  4XXE A;  1HQM C;  4KKS A;  4A3D G;  1PMR A;  1SMY D;  1V1P A;  3BZD B;  1JJ2 A;  5JVG 3;  5EBD A;  4CGY B;  4JK1 C;  3DEO A;  4RGN A;  3S16 B;  1JC7 A;  3CF5 A;  1WYD A;  4HIM A;  1STH A;  1KHI A;  1HH2 P;  1CHP D;  4L8J A;  2QKI C;  1XNR L;  4B08 A;  1IYJ B;  1BKB A;  5CBE E;  3JAM i;  3T51 B;  1WOC A;  3D4W A;  4DR1 L;  2WII B;  4L63 B;  4KN4 C;  3VYR A;  1MKH A;  3CD6 A;  2HQE A;  2NZO A;  2IHE A;  1OXU A;  2OWO A;  4S3S A;  2F4V Q;  3HKZ E;  1DOL A;  1NMF A;  2CQA A;  4DPG A;  3GTK B;  1NCV A;  5KRU A;  4ZKC B;  1GXD C;  3J7A F;  3L3O C;  3L9A X;  4OL7 A;  4GLA C;  3TS0 A;  1SE3 A;  2L9H A;  3D4D A;  2LFN A;  4J1M A;  1QJO A;  2F0E A;  4MZ9 A;  1S40 A;  3BDL A;  2F0W A;  1RTN A;  2QW7 A;  4OEL B;  5J22 A;  2YYZ A;  2E2J B;  1YZ6 A;  1QE6 A;  3U9S A;  3K5N A;  4JYA Q;  2R93 B;  1BCP F;  3FKI G;  3BZK A;  5FKA C;  1XMO Q;  2V1C C;  4XT3 B;  1STG A;  3I4L A;  4R4I A;  3V05 A;  1LT5 D;  2EYF A;  2XNA C;  3D8G A;  4NB3 A;  3S15 H;  3DM3 A;  2K4K A;  4I7Z C;  2F0D A;  3M9B A;  4YHH L;  1B50 A;  4C2M B;  1FD7 D;  3VYT A;  1BOS A;  2EY2 A;  5HUR A;  3HKZ G;  5DNF A;  4BBS G;  3FP9 A;  4JI5 Q;  1HQR D;  5G3L D;  4KHP L;  4LF6 L;  3T1H Q;  1Q12 A;  1B9M A;  5LL6 S;  2DY7 A;  4QQB X;  4LFC Q;  2E2D C;  4EQ5 A;  1B70 B;  2SOB A;  1CZW A;  2MPM A;  4DF7 A;  3HOZ G;  1QG7 A;  1DD2 A;  3TP5 A;  1SJH D;  1CQF A;  2RDF A;  3HOW G;  2B29 A;  1PZJ D;  1JB3 A;  3A8J E;  4JBM A;  1IYU A;  5C3E B;  3PIO 3;  5JJZ A;  2B2U A;  4HCS A;  3TQY A;  2IX0 A;  2JJQ A;  1MIU A;  1LV9 A;  1X6O A;  2YV5 A;  1A62 A;  3M4P A;  4J6H A;  5C0X G;  3F2D A;  5D14 A;  1Z47 A;  3D31 A;  4LUZ A;  3MXN A;  3U4V A;  1PH7 A;  4FXG C;  3GTJ B;  1C4Q A;  3K80 C;  1NAP A;  1ONL A;  1RD9 D;  4R1J A;  3KLR A;  3U9O A;  4O42 A;  2CHB D;  3T56 B;  3S24 A;  1D5X C;  3HEJ A;  1RJT A;  4OIJ A;  3T4A C;  1HUM A;  3PO2 B;  3NWT A;  3SGI A;  1R9T H;  4LF7 Q;  3VYU A;  4CJ0 B;  4X66 L;  3S17 H;  5M3M B;  5JJL A;  4XDX A;  1K73 C;  1M90 C;  1TII D;  1TS4 A;  1ASY A;  1KQS A;  4BBS H;  1K28 A;  2Z6K C;  3EA6 A;  1PA6 A;  4QUC A;  3Q22 A;  4A3I B;  3U50 C;  4QCL A;  5JPM C;  4JI3 Q;  3T53 B;  4KHZ A;  4EQN A;  3RD4 A;  3GTO H;  1TWC H;  5EBC A;  2RA4 A;  4KKT A;  3NPP A;  1PLF A;  3J81 j;  1Z7T A;  2AUJ D;  3I4N H;  1EQR A;  4KTA A;  1C48 A;  4G57 A;  4CKE A;  4ID6 A;  1K3R A;  4IN3 A;  5D3D A;  2R92 H;  4R4C A;  1EIG A;  3TZD A;  3HOU B;  1G2T A;  3C2P A;  1SRO A;  4LF9 Q;  5NUC A;  5KEE A;  4RKB A;  4KD4 A;  1HNX Q;  4YY3 Q;  2EVB A;  4K6L A;  3GTG B;  3F2C A;  5BN4 A;  4B3T Q;  5KYL A;  1XX8 A;  2PNR C;  4JCV E;  3M4O B;  1TWH B;  5JJK A;  3QB3 A;  4KHV A;  2N55 A;  1C7Y A;  1WTV A;  4RCN A;  1TWF H;  1NUC A;  1C9O A;  4AQY Q;  1SNP A;  5EKL A;  4C1N K;  2NVY B;  2F3V A;  4DUY L;  4AYB B;  5ELF A;  2ENB A;  3X3N A;  1E24 A;  1V1Q A;  3CQZ B;  2WP8 J;  4Y7N B;  1GVP A;  1X9N A;  2Y0S B;  4NXM L;  1A15 A;  4RA8 A;  4CKC A;  4IUV A;  4KLK A;  3N6R A;  4YWK A;  1D5M C;  4LNQ A;  4DV5 Q;  4M8A A;  2KVM A;  3PO3 B;  3RZO B;  3HOV B;  2RQX A;  1EIH A;  5HGQ A;  3CKI B;  2EQS A; 
#chains in the Genus database with same CATH homology
 1XXG A;  2EY6 A;  3CU7 A;  3OIQ A;  3T16 A;  2ID0 A;  4K2K A;  5IGE A;  3G7L A;  3I72 A;  1WD0 A;  3MFY A;  5JAV A;  3OMC A;  2E2H B;  2D5D A;  4CHT B;  1ENF A;  2XWB B;  5EKI A;  2B2U C;  1F9P A;  3NBI A;  1ZYR C;  2HDL A;  1DZ1 A;  1TS5 A;  1K83 B;  5I6W A;  1I4P A;  3C1F A;  1JE4 A;  3QG1 A;  3SR1 A;  1SYG A;  4XTC S;  3CHB D;  5D3I B;  3BVM A;  2OT2 A;  3JAM L;  2PW5 A;  1KNA A;  3M7G A;  3GTL B;  4UAI A;  4G7O C;  3ONA B;  2BA1 A;  1YNJ C;  2OEO A;  1F9Q A;  1MI2 A;  5DM6 3;  2FMC A;  1FNU A;  4BY7 B;  1STN A;  3PUV A;  4FNF A;  2MUY A;  1NR4 A;  2F0P A;  2BOS A;  4F88 A;  2K32 A;  4ZUJ A;  1B44 D;  1I50 B;  2B63 B;  1AEX A;  1JQY D;  1JOQ A;  2SNS A;  3TZU A;  1STA A;  3HOY B;  3HG9 A;  3GTQ B;  1CHQ D;  2L0C A;  1GOZ A;  4HTH A;  3M7N A;  2XWJ B;  3IL8 A;  4OIK A;  5FLX L;  2F0G A;  1Y1W B;  1QB5 D;  5CR3 A;  3BS1 A;  4IQZ A;  3N52 A;  2ICI A;  1TS3 A;  2F0K A;  1H9M A;  4XT1 B;  2F3W A;  3QIA A;  1HPC A;  4IUT A;  5C5M A;  3V96 A;  1O7L A;  1O78 A;  3K0Y A;  1U4P A;  5CV8 A;  2QCP X;  1G2S A;  2VNU D;  2NVT B;  3R93 A;  3ND8 A;  3I8Z A;  1SFO B;  5K5P A;  2LY7 A;  2IX3 A;  4K8J A;  1CTM A;  4QF4 A;  1KDC A;  3MAQ A;  2M2L A;  2NTT A;  1ILP A;  1JOR A;  1PRT F;  5DEH A;  1B4O A;  2B2V A;  1O7Y A;  2Q8T A;  2MP1 A;  3MTS A;  1SNM A;  3NK9 A;  4Q5V A;  1LTR D;  2FJ2 A;  2BDO A;  1E2Z A;  3S9W A;  2AUK A;  2R6G A;  4GZY C;  5I9O A;  1YNN C;  2ZXP A;  2F4I A;  4FYD A;  1F2M A;  1Z6H A;  1Y69 U;  4ZKB B;  5JVH 3;  4A3J B;  4XYQ A;  2EOT A;  1LLR D;  2EYH A;  3PUW A;  2PQE A;  1E0B A;  5J39 A;  2PCF B;  2XVS A;  4KY5 A;  1GUG A;  4K2L A;  1STB A;  4A3M B;  4QIW B;  4LJZ C;  1WTO A;  1AN8 A;  1GUO A;  1PTO H;  4V19 0;  3M4Y A;  2EZV A;  3QJY A;  2X69 A;  2R7Z B;  4DAY A;  1H9R A;  1S5B D;  1FNW A;  5FLX E;  5ELC A;  3K5L A;  2L1B A;  2NVX B;  4DGZ A;  5ELE A;  3KK7 A;  4JBW A;  2NN6 H;  3I4M B;  1WCM B;  4PMC A;  3QOJ A;  1V1O A;  1Y1V B;  5KNB A;  2F0H A;  4G4K A;  4FF4 A;  2EYJ A;  1SAP A;  1GUS A;  2F0F A;  2KEE A;  3MFG A;  5KIX A;  4U68 A;  3EQL C;  1GJX A;  3SE0 A;  2VB3 X;  4IFD J;  2WKC A;  3MHB A;  1ILQ A;  3EFX D;  5JEA G;  1NSN S;  4QMG A;  3FPU B;  3H09 A;  4RAU C;  3S1N B;  3DWQ A;  1AZP A;  4DNR B;  5D65 A;  5JOB A;  2XIW A;  4NW2 A;  1CA6 A;  5I6Y A;  2EXZ A;  4B9W A;  3G6J B;  3K59 A;  4KY7 A;  1QCB D;  1GHJ A;  4HED A;  1GUN A;  1HHV A;  3WDN A;  5BN3 A;  5T1I A;  3D6W A;  1Y8O B;  3BVZ A;  2IWH A;  3PIP 3;  3PUZ A;  2B2V C;  2IW3 A;  2L4N A;  2ICE C;  1BCP B;  2NTS A;  1E2V A;  5I2Y A;  1DON A;  4FXK C;  3TSS A;  3MWY W;  4IFD H;  1HTP A;  1DOM A;  2J4X A;  4IAL A;  3H0G B;  3X3M A;  4H7B A;  2JXM B;  1ICW A;  4IUN A;  4B9X A;  2Z8L A;  4HSV A;  2PMZ B;  3M3Y B;  1DM0 B;  5M9O A;  1OXT A;  4NKL A;  5G3L F;  2JEB I;  2Q8I B;  3FEW X;  2SEB D;  1UAP A;  1F2L A;  4BA2 I;  5ISR A;  2IJ0 A;  3R2I A;  1U4M A;  1UEA B;  2DY8 A;  1E2W A;  2JA8 B;  2NN6 I;  3OMG A;  4KY6 A;  4RFB A;  5IOC A;  2E2I B;  5IGB A;  1D1I A;  3SDZ A;  2PYK A;  4V0B A;  4HSP A;  3K6O A;  3WOF A;  2J7Z A;  2D9U A;  4A93 B;  3ND9 A;  2EYO A;  1LTG D;  3J7A V;  1F77 A;  2K5D A;  2B39 A;  4LMQ D;  1IKL A;  1DYQ A;  5E3F A;  2M9V A;  3C3L A;  3SEB A;  3S2H B;  1LTA D;  1XYI A;  5LHY 1;  2KUM A;  1STE A;  1TT2 A;  3I73 A;  2BA0 A;  5ELD A;  5JPN C;  1CT1 D;  4XQQ A;  4DK1 A;  3HS0 C;  1KNE A;  3PUY A;  5IGF A;  5CMD A;  1JIC A;  3MXG A;  3SVM A;  3DXJ C;  1WTW A;  5C5L A;  1R4P B;  1A2U A;  3AB9 A;  2MJ8 A;  4PMW A;  4IFD I;  2TSS A;  4PQX A;  3VA5 A;  1S5C D;  5IOD A;  5M5X B;  5CBA E;  1ET9 A;  5DAU A;  1W6J A;  4KMU C;  3L7Z C;  3MC0 B;  2K1B A;  1IHZ A;  1A2T A;  1EYD A;  3BVG A;  3D4R A;  1EFI D;  2JE6 I;  3LWU A;  3AMU A;  4FF1 A;  3P75 A;  3TME A;  5M3F B;  2WB1 B;  3K57 A;  1Q1B A;  1HFN A;  2ZXR A;  1B1Z A;  3D6C A;  1TWG B;  2WIN B;  3FPP A;  4OO1 G;  1BCP D;  1B2T A;  1BNZ A;  4KV6 A;  3S1M B;  1RTO A;  3OW7 A;  5C3W A;  2EYP A;  3GQB A;  1SE2 A;  1PFM A;  1BCP C;  5E4X A;  4EQP A;  1K8M A;  5C0X H;  2D2C C;  3UI2 A;  2E76 C;  5CV5 A;  2VUM B;  4C3H B;  3RUZ A;  2JA6 B;  3GTP B;  2D62 A;  2IL8 A;  5CYU A;  1ROD A;  1LAB A;  2K28 A;  1Y8N B;  4X3T A;  3SHL A;  1SNC A;  1MBY A;  2KA7 A;  2BCO A;  4TQU S;  3J80 E;  2EY1 A;  1CQV A;  5BN5 A;  1PTO F;  3C46 A;  3AU7 A;  3DUZ A;  3NE5 B;  5K36 G;  1BO0 A;  4XYO A;  3S14 B;  1WTP A;  5IGG A;  4NDX A;  1CK1 A;  3I70 A;  1Q90 A;  1TVX A;  2K03 A;  2NBF A;  2HCI A;  4HN7 A;  4U67 3;  1X3Q A;  1I4X A;  3K5O A;  3J7Y W;  2I46 A;  2O2L D;  1G91 A;  1KAA A;  1ZYR D;  1ZKO A;  3GTM B;  2NVQ B;  3NTK A;  1CI3 M;  2C9O A;  3TBI B;  2AQ2 B;  2H1E A;  2WV6 D;  1VMC A;  4FVM A;  2TMP A;  2F0T A;  3K58 A;  1W6K A;  3O13 A;  4ZYS A;  1H9K A;  1PZI D;  1SBB B;  2G9H D;  1YNJ D;  2K7V A;  5CGK A;  1BDO A;  4EVO A;  1G8Z D;  1HCZ A;  4P2C B;  1CM9 A;  3P20 A;  5EPL A;  1HTL D;  2L5T A;  3MXU A;  3PV0 A;  2XRQ D;  3F2U A;  1DJR D;  2BE5 D;  2EY5 A;  5C0X I;  4WRD A;  4J8Q A;  5F2D A;  1QIL A;  2XN9 C;  4RGT A;  1OXS C;  1PRT B;  1A3U A;  2AWO A;  3OOC A;  1PDQ A;  1FNV A;  4H44 C;  1KLU D;  2AWN A;  3E5S A;  4OGQ C;  4XIG S;  1S5D D;  5A2Q E;  5C3X A;  4ZRZ A;  2Z4H A;  2BE5 C;  3I91 A;  4KJO A;  4TSS A;  1BQQ T;  3J81 E;  5FO9 B;  5C4Z A;  2EDG A;  3S15 B;  1QOH A;  5EJW A;  1MD2 D;  2VB2 X;  1VCI A;  1EY9 A;  3SXH A;  3DEP A;  2IPK D;  2B8F A;  2NZ1 D;  1MSH A;  4X3S A;  4KKU A;  4Z9C B;  2KQ3 A;  3WOE A;  1SYC A;  4FF3 A;  2DNC A;  3A8I E;  1IKM A;  3M85 A;  2K05 A;  3ITP A;  1BF4 A;  4LK1 C;  2CW0 C;  1ESR A;  1ZEQ X;  2O4X A;  3KLS A;  2NB0 A;  1JOO A;  1SXT A;  4XQJ A;  5KGU A;  3LX0 A;  3VR6 A;  4X3U A;  3NBH A;  1YNN D;  3VR3 A;  4ABN A;  1Y8P B;  2DNE A;  1LT6 D;  3R8B A;  1C8C A;  3V2T A;  4RHR A;  1ESF A;  2HCC A;  3A7A B;  2EJM A;  3W2D A;  2Q8R E;  1HA6 A;  2JSO A;  2XRS D;  3I3C A;  5KNC A;  4CJ2 C;  4RKL A;  2A73 B;  1R9T B;  3LWE A;  1D5Z C;  1A6X A;  4ME5 A;  3S17 B;  5ELB A;  5FOB B;  3PUX A;  3HKZ B;  4BBS B;  1QNK A;  1II3 A;  3EVQ A;  2J0T D;  2KCN A;  1EY7 A;  3OSO A;  1SE4 A;  3Q6S A;  3FVQ A;  3DWA A;  4FF2 A;  3GTO B;  3VA7 A;  5A35 A;  1TWC B;  1EEF D;  2F1M A;  3Q23 A;  4UDU C;  3I4N B;  1UUP A;  2KED A;  2F0I A;  4NP5 A;  1VMP A;  4PMB A;  2A6E D;  2R92 B;  4DNT B;  2B2Y A;  4CBV A;  2G9D A;  1PZK D;  4HCE A;  4K14 A;  2A6E C;  1CA5 A;  1TWF B;  2F0O A;  5EPJ A;  3MZ5 A;  1RDP D;  2M00 A;  1FR3 A;  2EE1 A;  2QIL A;  2PZU A;  2ZXO A;  1LAC A;  2AQ1 B;  5TSS A;  2RSO A;  1KDA A;  3MVV A;  5CV7 A;  1PRT D;  5T1G A;  1TS2 A;  1XTC D;  2LS0 1;  4HMJ A;  1RKN A;  3BYY B;  4IUR A;  4EQO A;  5IIF A;  2LKV A;  3NP8 A;  4ILW A;  1MSG A;  5I9P A;  3P7J A;  2X6L A;  2LMC B;  1PRT C;  2AQ3 B;  4A3K B;  1I6V C;  1KDB A;  4IZ8 A;  2RDH A;  5HGT A;  2KEC A;  3K7A B;  4RGO S;  2N88 A;  1QNU A;  3DHQ A;  4TRD A;  5IGC A;  1IW7 D;  2F0N A;  1U4L A;  3GV6 A;  1O80 A;  1SDF A;  2K01 A;  1SEB D;  2NWG A;  1O7Z A;  3VR2 A;  1KTK A;  2OF1 A;  1LT4 D;  1U9R A;  1IW7 C;  4WJW A;  3KBG A;  2KHS A;  1PXU A;  1RF2 D;  2A68 D;  4A3G B;  4K5V A;  3SK4 A;  2YU9 B;  4H13 C;  1G6Z A;  3KF8 A;  4PV1 C;  2A74 C;  2FIN B;  5JEA H;  2JA7 B;  5I2X A;  1I4H A;  5C6A A;  1LTS D;  3NTI A;  2VXW A;  5CV4 A;  2A68 C;  1B53 A;  4EGV A;  3ZYY X;  5EKK A;  1TY2 A;  1TWA B;  2H4O A;  2SDF A;  1H9J A;  1J9O A;  3TP8 A;  4FP5 D;  4K5W A;  3SK6 A;  3S1R B;  4FXD A;  3PMF A;  1I4R A;  1GHK A;  1WD1 A;  3MA2 B;  2B2Y C;  1Q8I A;  1SMY C;  3RLF A;  1DXM A;  2R61 A;  1I4Q A;  1HA5 A;  4G7Z C;  3Q0A A;  3OHX C;  2RBM A;  1AZQ A;  2MHV A;  1AFP A;  1EQT A;  3RMH A;  1F9S A;  2MGS A;  1CFM A;  3BG3 A;  1LTT D;  2GA4 B;  3TP7 A;  1PYW D;  3DMU A;  1JWM D;  1TQO A;  3DM1 A;  1S5E D;  3KUP A;  3S2D B;  1EYC A;  1JR0 D;  1STY A;  2PZT A;  4DAP A;  1EY4 A;  2F03 A;  1RHP A;  3J80 L;  1BR9 A;  1FGB D;  4K8I A;  1I6H B;  2R3Z A;  1HXY D;  1I4G A;  1S4Z A;  1SNO A;  3A55 A;  5COR A;  5C4H A;  1SJE D;  4R9W A;  4DK0 A;  2K6A A;  1EOT A;  1F9R A;  3OPO A;  1SNQ A;  4CKB A;  1ENC A;  4F87 A;  3H91 A;  5C0X J;  3OIP A;  3TP6 A;  2WKD A;  2PW7 A;  4IUU A;  2L12 A;  5IGD A;  3TDQ A;  4BY1 B;  1EY5 A;  4DA2 A;  1XWE A;  1X32 A;  2Z1C A;  1EU3 A;  4F7X A;  1PTO B;  1Q1E A;  4KK7 A;  3R3O A;  2A69 D;  4KN7 C;  4XQN A;  4ULL A;  5KND A;  5FK9 C;  1LTB D;  3GO5 A;  2A69 C;  3EJI A;  3IAY A;  3S1Q B;  3H3V C;  3CRK C;  3NTH A;  3URY A;  4YIJ A;  1JWS D;  1EEI D;  5FO8 B;  1SYF A;  1RCV D;  4DXF A;  2IX1 A;  1QWY A;  4WFN 3;  2HDM A;  1F2Y A;  2KCC A;  1NR2 A;  2E75 C;  1TU2 B;  4MIU A;  1CZG A;  4ZUI A;  4NMZ A;  1A3V A;  3HRZ C;  3NXW A;  3T13 A;  4L6T B;  5A2Q L;  1T5E A;  2F0M A;  4K5X A;  4Q0F A;  2WAC A;  4BBR B;  1G29 1;  1V8Q A;  1EY6 A;  3J81 L;  3ERO A;  4A3F B;  2F0S A;  4KI0 A;  2WAQ B;  4OO1 H;  4M1U B;  5C4X B;  3VYS A;  2I07 B;  5C4J B;  4FO2 A;  2E74 C;  4MHE A;  2EYM A;  1F2Z A;  1ZXT A;  2PZW A;  1SSO A;  1SYE A;  2B2T A;  4X3K A;  3HGB A;  2F0V A;  3IFT A;  3NHH A;  3IKJ A;  1M4V A;  3ERQ A;  3FMC A;  2O5J C;  1HFG A;  1ET6 A;  3QWN A;  1M8A A;  4N9T A;  2X6G A;  4I65 A;  1L0X B;  1VF5 C;  3SK5 A;  3Q24 A;  2QF7 A;  3HOX B;  1PFN A;  1I3Q B;  4N9P A;  2EYL A;  5E4W C;  2K5W A;  4DFA A;  3A56 A;  1EQV A;  5K36 H;  5EGT A;  2NUC A;  2L11 A;  1EWH A;  3MXP A;  1AP0 A;  1UNS A;  4DU9 A;  4HMI A;  1D2B A;  2KJX A;  1TKW B;  1BBX C;  1EY0 A;  1GUT A;  4C3I B;  3MEH A;  1LT3 D;  3I90 A;  4WOR A;  1EZ8 A;  3QO2 A;  4C3J B;  1PTO D;  2C5C A;  4A3B B;  2SNM A;  3NQT A;  4A3D B;  1L0Y B;  2Z4I A;  2JA5 B;  1TR5 A;  3KBX A;  3C1E A;  1AW7 A;  1X3P A;  2CW0 D;  1PTO C;  4K6D A;  4OO1 I;  5EPK A;  3TN2 A;  4E6I A;  2NYZ D;  2RKS A;  3GP7 A;  1MGS A;  5COY A;  3NSW A;  3OWE B;  1KAB A;  1PFB A;  1H9S B;  2K5Q A;  1OXV A;  1Q3L A;  2V4D A;  1SYD A;  4QB4 A;  1T5X D;  5IT9 L;  2L55 A;  4ODG A;  5M5W B;  2B2W A;  3SK8 A;  2EPB A;  2EJF C;  1S5F D;  3BYT B;  3IFD A;  1EZ6 A;  4F8M A;  5CV6 A;  5I4D A;  2FFK B;  1J8I A;  2HUG A;  5CC4 A;  2EJG C;  3FDT A;  3A54 A;  1SYB A;  4C1N I;  3NUC A;  3W3A A;  3FKI B;  2RSN A;  1H9S A;  4BA1 I;  4BWG B;  1LO5 D;  4O1N A;  2F0J A;  1FYC A;  3BDC A;  2F0U A;  2RVL A;  2A5H A;  1U4R A;  2B2T C;  1BXT A;  1WTR A;  3E6Z X;  2F0L A;  3LNN A;  3CRL C;  1EL0 A;  1LTI D;  1D1K A;  4PNY A;  2ZT9 C;  4MN3 A;  3GD7 A;  1R4Q B;  1A3T A;  3RZD B;  3JAM E;  3E0J A;  4LAA A;  3HOZ B;  1SND A;  4DAV A;  3HOW B;  2NN6 G;  2JP1 A;  5DM7 3;  3K5M A;  3A8K E;  4BS9 A;  3HP3 A;  2BDN A;  4C3H G;  2K04 A;  2K33 A;  5M5Y B;  4RH6 A;  1EU4 A;  5EQ0 A;  2DN8 A;  2A6H D;  3FRP B;  3KLS X;  1WVL A;  5C44 B;  2CVR A;  2KOL A;  3NWS A;  2OXP A;  2PO4 A;  5LL6 X;  2JEA I;  1JCK B;  3GV3 A;  1IL8 A;  5IT9 E;  4IUQ A;  1HRJ A;  2A6H C;  3HZX A;  1VDZ A;  1B9N A;  4DXG A;  4ZLT F;  2FHT A;  1GUW A;  1KLG D;  3OWF A;  3BDO A;  2XSC A;  3DWP A;  4ZK9 B;  4RWS C;  5CV9 A;  1DOK A;  3NQI A;  1EY8 A;  4DN4 M;  4CJ1 B;  4R8N A;  4IFD G;  5AFW A;  4KJN A;  4ZQ3 A;  1D6E C;  5JEA J;  1JWU D;  3R2T A;  2IT1 A;  4IUP A;  1WTQ A;  1BUV T;  5KYI A;  1EYA A;  3H94 A;  2O5I C;  4HAE A;  1TY0 A;  3VR5 A;  2B2W C;  4RGM A;  1EWC A;  4C56 C;  3D3R A;  4H0L C;  2PPB C;  2QDB A;  2B8G A;  5J1Z A;  4TKO B;  1OO9 B;  4ZAI A;  4OHJ A;  1WTX A;  2RDG A;  4HR7 B;  1V1P B;  4RCO A;  1B3A A;  4KD3 A;  2FMM A;  2JYO A;  1OXX K;  1VF7 A;  4R8I A;  3VR4 A;  1HUN A;  2QEJ C;  3A7L A;  3P1H A;  1ML0 D;  4C3I G;  4A3E B;  5E1F A;  3H6M A;  4RHS A;  4C3J G;  3QOL A;  1DCZ A;  4QUF A;  1JOK A;  5FO7 B;  2F0Q A;  1V43 A;  4G7H C;  1IYV A;  1ENA A;  1K8O A;  4XXE A;  1HQM C;  4KKS A;  1PMR A;  1SMY D;  1V1P A;  3BZD B;  5JVG 3;  5EBD A;  4CGY B;  4JK1 C;  3DEO A;  4RGN A;  3S16 B;  1JC7 A;  1STH A;  1CHP D;  4L8J A;  2QKI C;  4B08 A;  5CBE E;  3T51 B;  3D4W A;  2WII B;  4L63 B;  4KN4 C;  3VYR A;  2HQE A;  1OXU A;  4S3S A;  1DOL A;  2CQA A;  3GTK B;  1NCV A;  5KRU A;  4ZKC B;  1GXD C;  3L3O C;  3L9A X;  4OL7 A;  1SE3 A;  2L9H A;  3D4D A;  2LFN A;  4J1M A;  1QJO A;  2F0E A;  3BDL A;  2F0W A;  1RTN A;  5J22 A;  2YYZ A;  2E2J B;  3U9S A;  1QE6 A;  3K5N A;  2R93 B;  1BCP F;  5FKA C;  4XT3 B;  1STG A;  3I4L A;  3V05 A;  1LT5 D;  2EYF A;  2XNA C;  3D8G A;  4I7Z C;  2F0D A;  1B50 A;  4C2M B;  1FD7 D;  3VYT A;  1BOS A;  2EY2 A;  5HUR A;  5DNF A;  1HQR D;  5G3L D;  1Q12 A;  1B9M A;  5LL6 S;  2DY7 A;  2E2D C;  2SOB A;  1CZW A;  2MPM A;  4DF7 A;  1QG7 A;  1DD2 A;  3TP5 A;  1SJH D;  1CQF A;  2RDF A;  1PZJ D;  1JB3 A;  3A8J E;  1IYU A;  5C3E B;  3PIO 3;  5JJZ A;  2B2U A;  4HCS A;  2IX0 A;  1LV9 A;  5C0X G;  4J6H A;  5D14 A;  1Z47 A;  3D31 A;  3MXN A;  4FXG C;  3GTJ B;  1C4Q A;  3J7A F;  1NAP A;  1ONL A;  1RD9 D;  3KLR A;  3U9O A;  4O42 A;  2CHB D;  3T56 B;  1D5X C;  3HEJ A;  1RJT A;  4OIJ A;  3T4A C;  1HUM A;  3PO2 B;  3NWT A;  3VYU A;  4CJ0 B;  5M3M B;  4XDX A;  1TII D;  1TS4 A;  3EA6 A;  4QUC A;  3Q22 A;  4A3I B;  4QCL A;  5JPM C;  3T53 B;  4KHZ A;  4EQN A;  3RD4 A;  5EBC A;  2RA4 A;  4KKT A;  3NPP A;  1PLF A;  1Z7T A;  2AUJ D;  4KTA A;  1C48 A;  4G57 A;  4CKE A;  4ID6 A;  4IN3 A;  5D3D A;  1EIG A;  3TZD A;  3HOU B;  1G2T A;  3C2P A;  5NUC A;  5KEE A;  4RKB A;  4KD4 A;  2EVB A;  4K6L A;  3GTG B;  5BN4 A;  5KYL A;  1XX8 A;  2PNR C;  3M4O B;  1TWH B;  3QB3 A;  4KHV A;  2N55 A;  1WTV A;  4RCN A;  1NUC A;  1SNP A;  5EKL A;  4C1N K;  2NVY B;  2F3V A;  4AYB B;  5ELF A;  2ENB A;  3X3N A;  3CQZ B;  2WP8 J;  4Y7N B;  2Y0S B;  1A15 A;  4RA8 A;  4CKC A;  4IUV A;  3N6R A;  1D5M C;  4M8A A;  2KVM A;  3PO3 B;  3RZO B;  3HOV B;  2RQX A;  1EIH A;  3CKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...