2AWOA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
372
structure length
372
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 91
structure length 372
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awoA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awoA01
3UKDA 2JA9A 1YR7A 3FFBA 2WKQA 2HCJB 1FNMA 2FFHA 1P9RA 1AK2A 4LF8L 4JI7Q 2D74A 3MSXA 4I81A 1B23P 4LY6A 1SVMA 4NYMQ 3CRMA 4YMUA 3AEVA 2CVFA 4Z1MD 2JA8H 2YWGA 1G21E 3B1ZA 4ACAA 4IVRA 5C3EG 4WA7A 3RHFA 1I6HH 3UG7A 4PHFA 2ZTSA 2BCGY 1R8QA 4JI3L 3QKUA 4YY3Q 1U98A 3C16C 2JJ2A 3CAMA 3BFVA 3BC1A 3NHBA 4DV2L 3QPWA 5SZIA 2B8GA 3EN2A 2XB4A 4JLVA 3THWB 2R92G 3T56B 4Z8YA 2A30A 3FHCB 3PUZA 4OGQC 3TZUA 2CLCX 1U8AA 2JA7G 1WQ1R 2GAOA 2K7VA 3LFUA 2Q2UA 4TVAB 4TYWA 3J80i 2C04A 3FMOB 4Z51A 4LF5L 2NTYC 3MUFA 4B3RQ 3QI2A 4JK1C 1SXJD 4QJFA 4GKKQ 3FPPA 1SVKA 3GEEA 4MA4A 4KXFB 2DHRA 2IYYA 4L5QA 4DR2Q 3H2YA 3NG1A 1LABA 4LFAQ 4DLYA 2H16A 3W6OA 4DCVA 1NG9A 1B9MA 3S14H 1ETUA 1Y63A 3BWDD 3EIHA 4MQBA 4DDWA 1JE5A 1EK0A 2AWOA 1NN5A 2W0SA 4Q1CA 1S4QA 1R5BA 2A69D 1UAAA 1PYBA 3P20A 1O87A 3SC3A 3AVYA 2LKCA 2ZSDA 3M4QA 2CL7X 1KHIA 2RGNC 2IS6A 2GK7A 1E9AA 3GFOA 1SVLA 4CIDA 5FOSA 4DR4L 2CQOA 2WVJA 2V3CC 5EE1A 2QGZA 1NMZA 4LYFA 3EXAA 2VSOA 2XGTA 5C0XI 1G7RA 1GL9B 2CE2X 3WNDA 1G7TA 3OPOA 1X54A 1P73A 3B1WA 4FCWA 1G3MA 1XTRA 3NDPA 121PA 5FPHA 2A6HD 4QRHA 1IQPA 1RKBA 1ZC4A 5EZ6B 4DJTA 4YMTA 5GVSA 1XEXB 2DFLA 2DY1A 3E70C 4D2IA 4B3BA 4IKEA 3QXJA 4GI7A 2NVXH 1KXLA 2UXDQ 2J9RA 4YXWD 4PX9A 2GILA 3M6AA 2FV8A 1VG0B 5E7IA 1SMXA 2JA6H 2KWIA 4JC0A 1LTQA 2DYKA 2VY3A 1P72A 3GEIA 2D7CA 4ZIRB 1NIJA 3MEFA 3KJEA 3NEJA 5KSYA 5C4MA 2O52A 2B63H 4DB2A 4LUOA 3LD9A 4LBYA 5KYKA 1I3QH 3KF6B 5AJVB 4GN3B 1L2FA 2WB1E 4FD2A 4GOKA 1TNDA 2UZIR 3K0CA 4D0GA 3M85A 4D80A 4OHXA 1AS3A 3RWOA 3KJPA 4NBSA 5FFMA 5JJKA 2BMDA 1N6OA 1Z22A 1Z6GA 3STBD 1CJKC 2P6NA 3ADKA 3LAWA 4XH9B 2ZSEA 4B33A 3AP2A 4B76A 1MRSA 2VHJA 4Z8XA 4MYTA 3EZ9A 1YBYA 4WJ3M 4QHYA 3PUXA 2UZ3A 2WKRA 3GCGA 3TW8B 1G20E 1L2TA 3PEVA 2QBYB 1ZCAA 1DVRA 2RGDA 2NPFA 1NNEA 1IN4A 1VQKA 1NVUQ 1UE6A 4DLVA 3L8YA 2WWFA 4AYTA 3UE1A 4A3KG 2QF7A 3HOYG 2F43B 4NYJQ 3WYAA 2F52A 4M1OA 3RANA 4LFCL 1YU9A 2WWWA 4C0SA 1PH8A 4X8HA 1VQHA 4JZKA 4D4MA 521PA 2WAXA 2AUJD 4QOSA 1U8ZA 2ODNA 4LOAA 2ZJBA 4PMWA 2ZRKA 3P4YA 3RWMB 2E8GA 1ZRHA 3AGPA 4K8OA 4ZDIA 4ZCMA 4JI8Q 1SVWA 4JBXA 1HZ9A 3IFTA 1Z9FA 1HQMC 3KOJA 4ZDJA 2B7BA 1WCV1 2F9LA 4QM6A 2XX3A 3BZCA 2E75C 3VNUA 5FPSA 1U99A 2QE7A 1NMGA 4IDQA 4QY7A 4U5XA 2VIIA 1ZM3A 4XWKA 4YHHL 1TWFH 3QXSA 2PCLA 3FKIG 2CCKA 1O7LA 3AEZA 1YVDA 3A8JE 3N70A 3NBFA 1Y69U 5EE3A 2CCZA 2BC9A 1NJIC 2FOLA 4KFUA 2NPIA 1ZNZA 4GFDA 3W1GA 3SBDA 4A92A 1NMYA 1LFDB 3LXRA 4QGFA 4IDPA 4OHYA 4QIWE 2DFTA 4MUBA 4Q9HA 3EIVA 4HUQB 2WSMA 4Q48A 5F2EA 1R2QA 2N1BA 3QKTA 3L2PA 3U7FB 4NH0A 2W2VA 1OH6A 5KNDA 3H4MA 3A36A 1N6PA 4WZBE 1PLLA 3TAUA 4EPVA 3I62A 1QZGA 1LS6A 1M8PA 5DYGA 3SYLA 4GLAC 4A4IA 3RZDH 1L4YA 1ZNYA 3NH9A 3WDNA 1K73C 3PUWA 4IDHA 2DB3A 4GP6A 4DCNA 3PO2G 1LV7A 4OHWA 1J8MF 5HZKA 1Y14B 3CCSA 2JJ2D 3SFVA 5IP7H 2AKWB 3RZOH 1R8SA 2AXPA 4PC7A 1QUQA 4ZKDA 3K8AA 2X2EA 5BN5A 4DK6C 4I1UA 2JEBI 1Z47A 2ZJ2A 4XJXA 5EP2A 1NI3A 2EJGC 5GJCA 1TQ2A 1DAFA 4A82A 3UDIA 3LH5A 1GUTA 1EFRA 2PLFA 3WP0A 5K36G 5CLQA 2AFIE 1SKYB 4DLXA 1NY5A 3ZQ6A 2FN4A 5JBQA 4AYXA 4WJ4A 1DAGA 3O47A 2DNEA 3AKEA 1P16A 1IN7A 1JQLB 4D26A 4IPGA 4O0AA 5BW8A 3VAAA 2BKEA 1E4VA 2FPKA 4DR5L 1Z2AA 3CH5A 4O2DA 5DGXA 4RD0A 4B71A 4RFVA 2A78A 3RS2A 1EIFA 4LWZA 3KQUA 4HEJA 1GKHA 4JS0A 2BKUA 3CP0A 2O5JC 3RLNA 1GKUB 2C9OA 5JS7A 3K70D 2ZT9C 2VQEQ 1IYVA 1PHJA 4BRUA 1J5EL 2EFEB 2NO0A 3EWSA 2NG1A 4AG6A 2ZJOA 4LZZA 4JG2A 4JVLA 4AH6A 2AD5A 2IBMA 3TUJC 2PNRC 1A6XA 2UUAQ 2C96A 3Q5EA 2V1XA 1E2PA 4NPSA 1DBSA 4HLDA 4A3GG 4Q01A 3T34A 3WMFA 1N0WA 1P2VA 3A8IE 3DDCA 5HR5A 3PEWA 4P75A 2XXAA 4OONA 1UFQA 4HDQB 5CYOA 2IYVA 1XWIA 4NZYA 5DHAA 5IYBH 1H9MA 1WXQA 1EWIA 2FNAA 2QI9C 4N0DA 5H8WA 4PTLA 4C3ZA 5KTYA 1H9JA 3CNLA 1SXJB 1W2GA 2ORWA 1M1KC 4XOIA 1U0HC 1LM0A 3E9IA 2ATXA 3CBQA 1IBRA 5LB4A 3K0FB 3H94A 2BWJA 1PVOA 1RIFA 2J46A 3T5GA 1MKYA 2O0KA 1JAHA 3CX7A 1Q3HA 2E87A 4LJ9A 4A3CG 2JLXA 3S1AA 1BKBA 4EFNA 4N3NA 1U94A 4IO9A 3LQRA 2REXB 4DSNA 1I4TD 2BIFA 4P31A 1AKEA 3BAFA 3R8CA 1ZW6A 1LNZA 2G0NA 4XVRA 3NBYC 2HYDA 4A3IH 4Q9IA 3Q8DA 4M1YA 1N5LA 2VTKA 4B6EA 2QSZA 2ZXUA 4BA1I 2F4VQ 5FLMG 3ZLJA 4DV3L 5EXPA 1YJ5A 4LV6A 2ZVQX 4DV6L 2ZSFA 1YHAA 3B13B 4QBFA 5ELXA 1YNJC 1E2JA 1KIMA 2IA5A 3V9PA 3GLIB 1LF5A 1XNRQ 2G3YA 5SZJA 3TVTA 4NP6A 1OXUA 1VQ5A 1D5CA 1G17A 4OQMA 4DUYL 3R20A 3UDGA 4AKEA 4MZ9A 2RHMA 1TWGH 3HYTA 4LGMA 2KSQA 5FH9A 1EWHA 3T1QA 1DEKA 2BE5C 2QL6A 2ZS7A 3VR4A 4JCVE 1E2KA 3VKWA 1V43A 4X62L 3H86A 4KFRA 2BA0A 4A3LG 1ZM7A 3AF3A 3CWZA 1PH4A 3SJCA 4TMKA 4HB3A 1KSGA 2UVQA 1U2RA 1SKYE 1NSTA 3E9HA 1RVDA 4JJKA 1UDWA 2KBNA 3BJIC 4C7OB 1YR9A 4DPGA 3H3VI 3CRLC 2QE7D 3D6TB 4QC2A 4TYNA 4QM7A 4TMWA 1VQFA 1E0KA 3J7ZC 5F3WB 1A63A 3CR7A 3UIEA 1VHTA 2WSSA 1IW7C 4DV4Q 2F1HA 1OFHA 1H9RA 1UADA 2ZI6A 3UDXA 2JLZA 3U61B 2ZAMA 4P74A 3O8DA 4U02A 3SR0A 2XEXA 3KJHA 5GJVC 4Q03A 1UEJA 4CEHA 1Q1EA 1BVSA 4JI6Q 2HUPA 2PMDA 2F1JA 3LWNA 3ULLA 3VQTA 3HOZG 3AV0B 1D9XA 4OI2A 4GN5A 2EJMA 4RCYA 3H15A 2UXCQ 3OFNA 1UEBA 1E79A 3H0GH 1UM8A 1Q82C 3AKCA 2HXSA 4V0MA 4JI7L 3N6RA 3GP8A 4A3FG 1GRRA 4A3MH 3RN2A 5FUWA 3VKGA 2PLRA 2WWYA 3IPXA 2JDIA 3Q3JB 4OO1H 4D81A 4DUGA 4ZI2A 5HTKA 5HKKA 1ONBA 2ZI9A 4UJ3A 1UE5A 2PI2E 1N5KA 4YDHB 5KSPA 2O8DB 3TMKA 1M1YE 1DXMA 2QROA 1II9A 5EAYA 3TUZC 4DAYB 2VLIA 3FYHA 4JL5A 2IYLD 4YY3L 4UKDA 5JJLA 3EZ7A 4NXNL 1VIYA 2BM1A 1EFRD 3UE0A 3G4SA 3D0FA 4YWMA 1E2MA 2OO7A 4URUR 4A0HA 3FMIA 4Q47A 2NN6H 4P33A 2D06A 3E2IA 1SULA 2GEDA 4HJ7A 2C03A 1G6PA 4Q21A 4A93H 1Z8FA 4B3RL 1EGAA 4GKKL 2FA9A 4G5RA 5JCZA 1Q1BA 3SDZA 1E2QA 1WP9A 4DR2L 3I4OA 4EPYA 4M1WA 4LFAL 5DO9A 1C0AA 5JJIA 3ONWA 2J41A 3IBGA 1YEZA 4HZIA 4RZ3A 5ELNA 2FMXA 3QY0A 2G9NA 1G19A 3JZAA 4IRUB 4EIWA 2PX0A 2WPDA 1E4YA 2C95A 3TRFA 2EQSA 2OBMA 3ZZ0A 1SXJC 3TGPA 3GLIE 4JOIC 5BN4A 2O8CA 3PITA 5EXTA 4P4SA 3GFPA 3AVQA 2XTZA 2WAYA 1W47A 3EIQA 3CCEA 1GWNA 2IEZA 1K0RA 3OIVA 2FZ4A 4KSBA 4TT3A 4Q7MB 3OIYA 4UNNA 4CRWB 2ODBA 3F2CA 2ZJPA 2ZJQA 1R5NA 1N6LA 2ZRMA 2A69C 4JLJA 3TR5A 3W34A 4DK3C 2OFWA 1SROA 3TLXA 4JI4L 4RCZA 5KHOC 4QJ4A 2EXDA 3CNOA 3KFUA 1GVNB 3QKSA 4PPNA 5IYDH 1ZUIA 1S8FA 1KI3A 3BOSA 2UXDL 1GHKA 3GTGH 5AJ3Q 1UEIA 2OQKA 3PFIA 2QBYA 3FVQA 4C2TA 3M3YH 4Q7JB 1J2JA 4BXXG 1EX6A 3B2EA 3OW2A 3LA6A 1OIWA 5JFGA 5LMNW 2GN5A 1FUKA 1G5TA 1VG9B 2QT1A 2A6HC 3BS4A 4K0KQ 3QXCA 4A3BG 2VP0A 5LPNA 3K70B 2AX4A 1RRCA 1CF4A 2ZRHA 1UF9A 3CC2A 3RRZA 1GHJA 4LF6Q 1N6KA 2DWQA 5FPKA 4R4QA 5M5XH 1GITA 1QDEA 5C18A 1BBWA 1HE8B 1LVGA 1W49A 4FCTA 3O8CA 1N6NA 1OH7A 4QKQA 2LXJA 3KL4A 4X8OA 1GM5A 2RGGA 3RS0A 4AKIA 1ZYRC 3U4ZA 3V00A 5EE9A 2HJGA 4V03A 4YMVA 2FJUA 4JSYA 3A4NA 3FMCA 5JEAH 1OYYA 1P2UA 1D2NA 4BY1G 2PL3A 2ZSBA 4A0RA 2VUMH 5KNCA 4A9AA 4LUZA 3F2DA 1X1RA 2CW0C 1PMRA 2XTMA 2R44A 1VTKA 1XD9A 3QBTA 5GROA 2ZRJA 3RAPR 5FPYA 3STBC 3W5OA 1G4AE 1E2IA 4Q00A 5FTJA 2OAQ1 2ZTDA 1T5EA 1E6CA 1V1QA 5HGQA 2JLRA 4OKSA 4TTQA 2AR7A 4TTRA 1DAIA 2J59A 2VHTA 1CIPA 1J7KA 2DCUA 4PC2A 2FFBA 4ITRC 4ZCLA 3KKPA 3MLEA 1RW4A 3QF7A 2OILA 1CJTC 4L5BA 5DYIA 3I3SR 4LF7Q 5GAHC 4M1TA 4JI8L 2WTUA 1KI8A 2QY9A 1XF9A 3CB4A 4Q7LA 2LXKA 2BA1A 3AM1A 5FR1A 3B6YA 1OW3B 1X8JA 2CL0X 3CRQA 3OZXA 5JCPA 1IJFA 2ZVPX 3KKMA 1UDXA 3HDTA 4TYQA 4TWZA 1UPTA 4W5JA 4ARZA 4W5HA 4O0MA 1NMXA 1SE8A 1ONLA 1IBKQ 1IONA 2D2FA 2AHOA 1E69A 1L7VC 1P62B 2QTFA 4GZMA 4S35A 3W8RA 4A0GA 4OL0A 1RFLA 1XMQQ 3FDIA 4DNIA 4OQNA 1YQTA 1LYLA 1KAWA 1Z0FA 1E0AA 1DAHA 3TSWA 4Q9JA 5JI3E 1OHHA 3OFND 1OB2A 4CZ2A 1WOCA 1E79D 3NHAA 4D4JA 3MGCA 3AVVA 3KFVA 4P73A 3REGA 4JVNA 4TL6A 3VHXA 1KSHA 2ZITA 2VHQA 4PSAA 3K0XA 4TMVA 2RCNA 5HKKD 4Y7NH 2X8AA 1Z6TA 1TXYA 2IYRA 2ZSAA 1ZIPA 4Q5IA 1VCOA 1U5KA 2C8VA 1IM2A 1C4OA 4BPBA 3U3RA 4ACBA 1ZUHA 3ETLA 2VZAA 2A1AA 1XMOQ 3CZPA 3WRYC 1DS6A 3B85A 4PAOA 2QA5A 5IT9c 1IBLQ 1G8YA 2X77A 4LYHA 4P32A 4OHZA 4KKUA 1E0SA 2IYSA 5E7NA 3S1NH 2DN8A 3PV0A 1CR0A 1D6JA 4R4CA 4Q9KA 5DE3A 2ZTEA 1DO2A 1OXXK 2WJIA 4DEXA 4DV1Q 3DXJC 3S1RH 4C9BA 4AKGA 4GRAA 1KI4A 3AQ4A 1JJCB 4DKAC 4BFYA 2A5GA 1BKDR 2E2JH 3QNUA 421PA 2XGJA 3AVOA 1GJXA 4JYAQ 1JBKA 3K9NA 3LV8A 1Z7TA 2ZE8A 4MUAA 2PI2A 2JLSA 4MRVA 4UNPA 2EFHB 3CF0A 4US0R 2ZM5A 4LJAA 2VSFA 2C9YA 2HLDA 4IJMA 3O8RA 2WPDD 1FL9A 2MO1A 2QG6A 3R9WA 3K1JA 1Z07A 1RL2A 3KX2A 4A75A 1QUQB 2K50A 1R10A 1W0JD 2XTIA 1DG3A 3R8FA 1Q8KA 1P2SA 4NKRA 2IF0A 3IQXA 4TLEA 2ZJ8A 5G3YA 1YITA 1W4RA 2UUAL 2WOJA 4Q1EA 4RSGA 1FOEB 4TT3D 4F92B 2G0TA 2A68D 2IT1A 1GKYA 4LHXA 2RGEA 2C9CA 3NBZC 3DLLA 1E2NA 1PH7A 3K70C 4PZLA 3AGQA 6Q21A 2W6JA 1S3OA 1OH8A 2JLQA 4GZYC 1NJGA 2J45A 4G5SA 4JLBA 5FOWA 4YQFA 3TE6A 3DM3A 3MFYA 3QG1A 5JWHA 2I0QA 1KDTA 2HF8A 2EVBA 3NVAA 3L0IB 3P27A 1VQGA 1KNXA 5E7JA 4Z54A 3AYHB 2ZRGA 2OCEA 1HZAA 3CO5A 1QHYA 1L1OA 1WCMH 1Y1VG 1G3UA 3DEFA 2ZJRA 5C44G 3AVWA 5IP7G 1OKKA 3LNNA 5EUQB 4TZ0A 5M3FH 2IYWA 1BMFA 4C2MH 2HDNB 2IYQA 2WJHA 4BE7B 3RS7A 2WFWA 1PV4A 3A1UA 3PSIA 1KO4A 2Q3HA 1PH3A 2EIFA 1UE1A 1HNWQ 1WRBA 3NXSA 3CMAA 1O78A 5JHGB 2XXAB 4D82A 3IPYA 3ZDQA 2GA8A 4ESHA 4BGDA 2C98A 2IUUA 1N5IA 3K0CC 1EUJA 2R6CA 5KPJA 4BLSA 2F4VL 1ZUNB 3BZKA 1UKYA 3E5HA 1VQ6A 4WW0A 1WMSA 2CKZB 2ODEA 3K0SA 4DR3Q 1XNRL 2NVTH 3OEHA 1OB5A 3PIPA 4POGA 2A5JA 3ADBA 1A62A 5AJWA 4BFXA 2O8FA 3OOCA 3FWYA 1UKEA 3ASZA 3P4XA 2TMKA 4KLNA 2A9KA 1KAGA 2NOAA 2DPXA 2EYUA 4J0QA 4JSTA 5FLXc 4G5GA 2XTNA 1PLKA 1UKZA 1Z29A 2QPOA 3EPLA 4LV8B 2YZ2A 4S2EA 2JEOA 1IXSB 3TREA 3L2OB 4F4JA 5KU1A 2CWAA 3L43A 1A4RA 4TSFA 2IYTA 5DIFA 3X1DA 2OHFA 5BXQC 4HJAA 1W1WA 2V55B 2PNHA 1VQIA 1E2GA 2OXCA 3GJ7A 5TV2A 4DT1A 4ZI3A 2XNDA 4WZ6A 3KUDA 1XRJA 2O8DA 2XSZD 4IJLA 2J5XA 3MJRA 4DV4L 2DGYA 5GJBA 2JLYA 2R93H 1ZM4A 2WOOA 2E2HH 2CCGA 2DBYA 3SEAA 1CKNB 3IRBA 3QIAA 2QZ4A 5FOTA 2B8TA 1Z0AA 1OHHD 5JRJA 4JI6L 4PC1A 1WBBA 5B2ZA 1E9SA 3KKNA 3RLFA 1Z0DA 1VQOA 5G53C 1BDOA 3SHWA 2UXCL 5CITA 2F3RA 1VQ9A 1P9NA 4EQ6A 2ID0A 1MKHA 4LRWA 4I4LA 1VCNA 1QVAA 4JBKA 3BH7A 5FR2A 1HR0Q 4A3IG 1XJQA 3IQWA 2Z4SA 3GLGE 3ZVNA 5TDHA 2IL1A 1S96A 4G7HC 5KDLA 5CK4A 1TQ6A 3S2DH 4O2LA 4OK3A 1X9NA 4F7WA 4B34A 1DO0A 1VCIA 2QTVB 4G5OA 8OHMA 1V8QA 1N6RA 4A8JA 4A4DA 2ZRBA 5H70A 4CDGA 2E76C 3CCUA 4E22A 1ZCBA 3MXNB 4CEHB 2AMCB 4PPQA 2A7QA 2ECKA 1FPMA 1ZINA 3QXHA 3NE5B 3J81c 1JT8A 2GAAA 4ZKEA 2Q3MA 1WYDA 3IGFA 5C4XH 2Y8EA 4JMPA 2GWHA 4UXJA 4BEBA 3DOEA 5TY0A 4M9SA 1JJ2A 4KN7C 2WKPA 1F6BA 1HTWA 721PA 2QEQA 1HH4A 5JEAJ 4GOPA 2G83A 4AIIA 2FU5C 4HSEA 5HZHA 1XTSA 2QA4A 2WV9A 4Q4HA 2HLDD 2R9VA 2WJVA 2OUKA 4YONB 2JE6I 4JLOA 1TEVA 4OXPA 4QBIA 4IOMA 3R7WA 4BEJA 1W3SA 1DCZA 2R6AA 3FMFA 3UDFA 1L0WA 3PUVA 2JATA 2D2EA 4R7ZA 1IYUA 5J4VA 4AURA 2PEZA 1RRGA 3AH8A 1S72A 4PHGA 1IZ6A 3GDEA 2J1LA 2YINC 4JLKA 1EOVA 5SZKB 3B5JA 1NN1A 3QENA 1BYIA 1NE3A 1G1MA 4URYR 2Q9AA 3KJGA 2W6JD 3MD0A 1ODFA 1HQCA 3THXA 3B1VA 4RCNA 4NL4H 4A15A 3I4MH 2OQ0A 5IE8A 4TKOB 4A3MG 2CHQA 5K8LA 2R7ZH 3W6PA 4OO1G 1GO3E 1AZTA 1KNQA 1V5WA 5AJ3L 2ZROA 1WDTA 4LX0A 2VP2A 2IEYA 3UMSA 4QQBX 2GCNA 2B29A 4GLVB 1GTVA 1OKKD 1TQ4A 1QHNA 4QGGA 3RSLA 4ZDKA 2VP4A 2ZJ5A 4K0KL 2J87A 1BMFD 2MO0A 1Z08A 5F9HA 2O8CB 3HOWH 4P4SB 1IN5A 1ZIOA 4OI1A 2GJ9A 4LF6L 2K5UA 3A5ZB 2NO9A 4R98A 5JZVA 3CCJA 3SU8A 1N36Q 2HQLA 2UUBQ 1JPJA 4W9MC 1HA3A 1W4CA 1B8AA 4XSHA 1I4DD 1DTSA 2YWEA 4B2PA 1G8HA 4AYBG 1TWCH 4BFZA 1X3FA 3H0KA 2RF4A 5LMUQ 2D0PA 2BDTA 1OJLA 1OXVA 4A93G 2FDCA 1G7CA 3QKSB 3D8BA 1C7YA 3WHKA 3GMTA 3C5HA 3FOZA 1A2BA 2ZM6Q 3BE4A 2ZE5A 1CJMA 3CIOA 3EWAA 1S1CA 3F8TA 4BFWA 3G48A 4GKJQ 2HJVA 2FG5A 3OEHD 4E07A 2JXMB 2FFAA 1ZKOA 4C2UA 4DKXA 4CW7A 4DR6Q 3X1ZA 1N33L 2ZRIA 4LI0A 1AA9A 5K8TA 2P6UA 4JI0Q 3ER0A 5FTMA 2F3IA 1ZNWA 2Q6TA 3NC0C 1RYFA 3X1WA 4BASA 3AB3A 3TVDA 5FI0B 2Z4RA 3VR3A 4MDEA 5LB2A 4AWXA 3T53B 1C1YA 4IVPA 4PO1A 5FUVA 3IKJA 1YRAA 3EBEA 3FTQA 3TJZA 3UMRA 3EPKA 4RKFA 1E99A 2EQBA 2ZRFA 4GMDA 1QBKC 4XSGA 4LF7L 3U2QA 3GTQH 3HOVH 1L4UA 1Z6YA 2V54A 2FF7A 4PANA 4TSFD 4V0ME 5IYCG 4YWKA 1W4AA 3AF0A 1T0JB 5FBLB 3ZYCA 4V0OA 1X86B 2O8BA 1U9IA 2XNDD 2ZE6A 2QRZA 4LK1C 4DB4A 1DG1G 4CF7A 5JECA 3IEVA 4R2HA 2IHFA 3IIKA 1IBKL 2R6DA 3W8NA 3EQLC 2WAQG 1TQDA 1FX0A 5AR1A 2X1VA 2GJKA 1XEFA 3K9HA 4KBGA 4MGIR 2R62A 1E9DA 4B3DA 1XMQL 4H9GA 1KO5A 3KXLA 2VYFA 2QQ0A 2IC5A 2FSIA 3KTAB 2QMOA 3TK1A 5D3QA 4LHZA 4D4LA 1WBDA 4KN4C 4XIGS 3MWKA 2Q8IB 5CB8A 4DZZA 2KB0A 1UBEA 1KI1A 2YTVA 1AIPA 221PA 5KDOA 2VQFQ 4QGUA 2SHKA 1Q21A 5DI3A 4DWJA 1GUNA 1F2TA 2GXSA 2CFMA 1GNRA 2KHIA 4MITA 4D0NA 1OT3A 1XMIA 2X19A 1SLJA 1YJWA 1LS1A 1JXOA 4X8MA 3RRYA 5JMTA 3GLFE 4HIDA 1RRFA 5IHPA 2CHGA 1W2HA 2FSHA 2VH5R 2CVHA 2W83A 2ZI3A 1P61B 5JEAG 1UBFA 3NC1C 1QG2A 1K8AC 4KYUA 4ARZB 3S15H 3K0AB 1HR0W 3TIFA 5GAEC 3BD9A 4A2QA 2AHOB 1XMOL 5J40A 5CM8B 2EW1A 1IBLL 3QKRA 3JVVA 5EUMA 3AVUA 1GNQA 3D4RA 3VU9A 2OESA 4OX9Q 2VQSA 1FMJA 1K8MA 1HNZQ 1HY3A 1XTIA 4DV1L 1EFHA 3CRRA 3S24A 5LDDC 1H65A 3LXXA 4FWTA 4LNQA 1TU3A 3V4FA 3J81i 2QT0A 3WMGA 4RD2A 5KOYA 3KB1A 2N78A 3ULPA 3EASA 1YVCA 5FBVB 3EPHA 2R7FA 1SQ5A 4IPCA 3DZ8A 4NXMQ 4JYAL 1J99A 1Q1ZA 1QHGA 2BBSA 2B21A 2VBCA 2ZPTX 5DSZA 3GLGA 3ADDA 4HAZA 4L5RC 3CPEA 4B3SQ 1T91A 1CS4C 1KI2A 2BDOA 1PA6A 1R6BX 2GK6A 2QNRA 2GZAA 2V6JA 4A2WA 1ZD8A 2GCOB 5BN3A 2FPMA 2GVDC 4DIDA 1U0JA 2KCCA 1FUUA 4X8LA 1SGWA 4KKSA 2GDJA 4FW9A 3H1TA 4EX5A 4AC9A 1IJEA 3TQCA 2ZU6A 2IX0A 4KCGA 3I61A 3EIEA 2XZLA 3G71A 5IWAQ 3S17H 3ASYA 4LHVA 5CLLA 2F1RA 4V0NA 4TZ6A 4HJ8A 3W5IA 5HE9A 4B48A 1TU2B 1OLOA 4NMMA 1MABA 2CL6X 3QG5A 1E94E 1EFWA 4HLQB 4C0HA 4HAUA 2I5MX 4YWLA 1VQBA 2XB2A 4DUZQ 4BZQA 2GESA 2GBLA 3KFXA 3KQLA 1VIAA 4A3EH 4L16A 1QVCA 5FPTA 2A68C 5LMNQ 3ZS8A 1G9XA 4I1SA 5IDVA 3LQQA 3HOUH 2PT7A 5HPYB 3L82B 2QAGA 4TMTA 3CF6R 1D2EA 1F2UB 2Q21A 3J7A5 3GJ8A 4A6XA 4HJ9A 1I2DA 1N25A 1NKTA 2F6RA 1ZC3A 4OQLA 4IQZA 3CD6A 4KJZA 1M2OB 1X1SA 5AWFC 3WP1B 2Q2HA 3QEJA 2H92A 1L8QA 4DHEA 1N3BA 4XD7A 5M04A 2FPLA 1D8TA 3VA7A 1MIUA 2IK8A 3U60B 4F93B 1BO6A 4B2IA 2YC2C 1F60A 1E2LA 1IL2A 2YJTD 2GCPA 1I50H 3TKLA 5J3BA 2QM8A 821PA 1X6VA 4DDTA 3OIUA 3U3OA 1XCGB 1H9KA 1X56A 3RC3A 1QG4A 1E24A 3AF2A 4P4UA 4TTPA 4F38A 3KLRA 3CC7A 2N46A 3PIRA 3ZS9A 4OJKA 4HUTA 3A5UA 4DSUA 2VP9A 2HV8A 2WHXA 2BHRA 5TVKA 4DR3L 2IY5B 1J8YF 1L1OB 2C77A 1AS0A 2IXFA 4M1MA 4QGHA 5CJ2A 1XCMA 5J4LA 4YCUA 1CKNA 2JJQA 3RABA 3WYFA 2WMOB 2W6IA 4FCVA 4W7SA 2JGNA 2WJGA 2ZQ5A 2HIXA 5M5WH 3AUYA 1C9KA 3P26A 2C5LA 2MFIA 4NYIR 3B9PA 4HZUA 4TL9A 2PZGA 4RMFA 5D3MB 3U7HB 4LJ5A 2CDNA 3CH4B 4NCKA 1KJWA 2IWHA 1NTGA 4DV7Q 4O2RA 1I2MA 4LBVA 5C3EH 2VRWA 3KJIA 5J47A 5JWRA 2IXGA 1KZGB 4F4CA 1A2KC 3P1JA 4PHHA 4MNOA 3T12A 3NWJA 5CYPA 3BB1A 1W36D 1GDDA 1YHQA 1EFTA 2I4IA 3WXMA 3M4YA 4DDVA 3DKPA 1WCMG 2UU9Q 2QORA 4ME3A 3EARA 2BEJA 1GRNA 3NIBA 1HNXQ 1SR3A 1JECA 4A6PA 4JBYA 4QNMA 2O8FB 5IT5A 1P3JA 4H1UA 3WY9A 4EPTA 1KGDA 2PCFB 3AQQA 2BVNA 2P65A 2YOHA 5A35A 1E32A 3G82C 4TLDA 4V02A 2F7SA 2NO7A 5CIQA 5G40A 1YZ6A 4JL8A 4RVCA 5UKDA 3W90A 3BGWA 1HZCA 5E3HA 4KU4A 2IYXA 2D2CC 3FHWA 2ZS9A 4G7OC 4I1VA 1H8HA 1HR0L 2MSDB 5EE5B 4GZLA 1E96A 2R7DA 3J81j 3U4QA 4ZPXA 1W44A 2WBLC 3JVUA 1VECA 4DT1B 3UPUA 3ZVMA 2GJSA 4F4IA 2BBTA 1JALA 2V7QA 4JL6A 2GVAA 2FEMA 4MRPA 3EC1A 3FFAA 3IHWA 4MRNA 4JI5Q 4QNRA 3REFA 3UWOA 3ZD7A 3H3VH 4MTNA 1YZNA 1W7AA 4PV1C 1CR4A 3MWYW 3I73A 5IP9G 3IBYA 1ANKA 5DNYB 1CTMA 4NTZA 1JR3A 1S0UA 2ZUBA 1NY6A 3QQ5A 2ZE7A 4ILEA 1LF0A 1XP8A 3T1HQ 1DE0A 1YR6A 1FGUA 4MYUA 5G3ZA 1KO1A 1A1VA 2GVBA 3HU1A 4JKYA 4MKFA 5GADC 4W5WA 1GVPA 4M53A 4EQ6B 2HXYA 1E1QA 4QJ5A 2ZAOA 3JAMc 1W2BA 3KYHC 4BZXA 2BBWA 2W2XA 1RE0A 3B1XA 5EE0A 4BECA 3GLFA 2PQAA 5F9FA 3GTOH 2EJFC 2VW9A 2J7KA 2RGBA 1E2ZA 4TL7A 1OV4A 1AGRA 3CONA 5FJ8G 3GJXC 1TTTA 5L3VA 1H95A 1F5NA 1S9DA 2XAUA 4N0EA 1CP2A 1AE2A 4Q4JA 1E22A 1Z06A 4DR7Q 4GL2A 1K8OA 1NG1A 4TYYA 2J0QA 2XITA 3LLMA 4QHTA 4A8JB 1G291 4EDHA 1G3QA 5AUOB 1QHHA 1GUAA 3NENA 1HT2E 1ZAKA 1AE3A 4PZ6A 3S1QH 2R65A 1G8PA 1E98A 1K5GA 1W0JA 4LJZC 2CHVA 5M3MH 2NVYH 1DAKA 1YZUA 2IF2A 3A1VA 3IEUA 2JCSA 4B3MQ 4RD3A 2MQHA 2X2FA 4MKIA 2HIVA 2K33A 5CK5A 4IPHA 3FPAA 1ZU5A 4Q18A 1I4LD 2J0UA 2QMUA 4BLTA 3UXMA 4GBMA 2NZHA 4TMXA 4GOPB 3IHLA 1VQJA 3GLHE 3CRKC 3LVQE 1M74A 2WMNB 1E9EA 4QFMA 3CF2A 4TQ9A 4B3XA 3A4MA 4Q4HB 2RHSB 4L9SA 3CPJB 1PUJA 4FMDF 3WRXC 4NCHA 2A6ED 3CPFA 1QVFA 4L8GA 3TEHB 2JA8G 2GZHA 2OFOA 3R7WB 1W5SA 1K83H 1QHSA 3IILA 1PH9A 4A3KH 4X64Q 3K09A 4PSKA 1I94Q 4HJ5A 2CCJA 2XNSA 5E95A 4KHPQ 1E3MA 3MXUA 4KMUC 4QL5A 2QPTA 4M2LA 1N34Q 4PXAA 3LX8A 2D0OA 2OTJA 4XVUA 2GZDA 4LSGA 3GTMH 1NVWQ 2RH5A 2H18A 4NCJA 1L1OC 4P72A 1N36L 2CXXA 2UUBL 4XD7D 3KF8B 2LKDA 4URWR 5C4XG 4WXPA 3LBHA 3GTLH 2WWIA 3FKSA 2E1RA 1IBMQ 1E3PA 1YZGA 1GL6A 2ORIA 3THXB 2C35B 4AK9A 5J4KA 1AQYA 5LMUL 1GUSA 3QOFA 2DR3A 3PCRB 1N6HA 4HB0A 2ZM6L 3EX7C 4L9WA 3FKIH 3C7KA 2XOKA 4NHOA 3T35A 4GNKA 3T5DA 4Q9LA 4GKJL 1NLZA 5TXGA 2E74C 3W6NA 4KVAA 3ND9A 4M21A 2PZFA 4CEIA 1GNPA 4DR6L 1QRAA 2W6ID 4H1VA 2FGKA 4JI0L 4C0LA 1XNJA 3GJ4A 3KTAA 2EVWX 2ANCA 5FBQB 5L8VA 2GXQA 4P4TA 1PFSA 4HAVA 2KCMA 3A7LA 1YE8A 5FTLA 2GXUA 1X8LA 5A4JA 2O5IC 3TSZA 3CX8A 5FUXA 5BYKA 5H1SE 1AKYA 3PENA 1IAQA 2FXQA 2BJWA 3LY5A 4DNRB 1PUIA 4Q1AA 4A2PA 4C4PA 4CVNA 3B82A 4EPRA 1DGSA 2P3SA 4B35A 2R7ZG 4FMCF 3O8BA 2EU8A 2KJQA 5H68A 2IHYA 3LO5A 1RJ9A 1U81A 4DK1A 3K0AA 1SRUA 1E2HA 1G7SA 3G0HA 4NDZA 3KXIA 3VFDA 2Q0HA 1CU1A 2KENA 1SVOA 2JA6G 2XSZA 1HYQA 2AXNA 2V8OA 3T1OA 3AKYA 4GT1A 3UATA 1SHKA 2XZPA 1S40A 2EWVA 1NN3A 5JS8A 1GUGA 4G7ZC 1SMYC 3RN5A 4RZ2A 3A7AB 1Z6HA 5K36H 1FMLA 1R5OA 2NIPA 3HOWG 3B60A 3DL0A 1HH2P 2B63G 1XPUA 1F48A 4LV5B 2G1KA 5P21A 2P0EA 2VF7A 4AG5A 3T1YQ 1D8LA 2VQFL 3PEYA 1OTCA 1KK3A 1BBUA 1H8HD 1U90A 2ZEJA 2NZJA 2MMCA 3S16H 2PMKA 3GJ5A 3PCOB 1E9CA 2JIZA 1JPNA 2AKYA 3KDSE 2HHHQ 1SKQA 3LNCA 1M7GA 1W4BA 2PCJA 2O8BB 2ERXA 2V7QD 3JC66 1E1RD 1HTPA 4LCBA 1Q20A 3W9YA 1XBTA 2GCOA 3A58B 5DH9A 1II8A 3FE2A 2ZI4A 1FX0B 2PEYA 4LF9Q 1TPZA 1Z6XA 2FGJA 1W36B 4RD6A 4J15A 1JR3D 4PQRA 4QG7A 4DCUA 4L5TA 3NEMA 4OX9L 1GKIA 1KMQA 2DFKB 3DO6A 5LBIA 3MMPA 4KBFA 3PUYA 1HNZL 2WJJA 2GF0A 2OAP1 4IXMA 4DBLC 2AUKA 4H0LC 1AH9A 1KTVA 4PO9A 4EPWA 1GD7A 1P7CA 1UKVY 4A8JC 1E1QD 3F2BA 4HB2A 5JI2E 1ESMA 4NONA 4KKTA 5DI3B 4JBMA 1LB1B 1F2TB 4NXML 3HOVG 3UWKA 4IFDH 5DLQE 1P2TA 3SJZA 1G8FA 3EA5A 4B3CA 2PJRA 4B3SL 1EFCA 2K5HA 1QHXA 2H7VA 1CTQA 3BRWD 2OCBA 3LDAA 4CYMA 5FBRB 2UKDA 4LJ6A 2P6RA 1XZQA 4GOPC 3B78A 1JEEA 3ULJA 4X66Q 1N0VC 2ONJA 4BY7H 3VKHA 2VQEL 1F2UA 3QKRB 3TR0A 4G1UC 2JAQA 2ZJYA 3VU9B 4FWIB 2UUCQ 5IWAL 1KKLA 3VNVA 1ZU4A 2N42A 5B64A 5F98A 3OHMA 3J80c 1X55A 3EC2A 3M1IA 4LBZA 4ASUA 1VQ7A 2GEUA 4B32A 3BB3A 2BMEA 4Q1DA 5JHHB 4MYHA 1XJCA 2FFQA 3B1YA 4ZDWA 2K4KA 2D4HA 1XZPA 3EZ6A 4MH0R 2DWPA 2ORVA 1OFIA 2QSYA 4DUZL 4I99A 2JLUA 5FLMH 1I5FA 4Q66C 3GLGB 3WWVA 4A1FA 4IVQA 3ZQJA 4CT4B 5C2JB 1RZ3A 3K7UC 1Y8PB 4I7ZC 5GQOA 3RR5A 4YC7A 4D0LB 5LMNL 2Q2IA 2FWRA 1JQJC 1W0KA 1CFMA 3KB2A 3EA0A 3A74A 1DOAA 5DLQC 1JEDA 3THOA 2QMEA 5AJZA 2ZRDA 3TAHA 1MH1A 4K46A 1VYTA 2MMGA 5DN6A 4ZV4A 3I72A 1MRNA 1XDBA 1EX7A 2B92A 2OWOA 3DKVA 5KSOA 1E0JA 1E9FA 1OFTA 1Q3TA 3LW7A 4A3LH 4QJ3A 1Z0KA 2FEOA 5TB5A 4C0AC 2XZOA 5C4GB 3FKSD 3LGJA 3I56A 2RHDA 4UJ5A 5D3MA 3PIOA 1ZMXA 1G5PA 1MABB 2Z5FA 1GG2A 3A6PC 2IW3A 3BORA 1R9TH 1ZD1A 2YKGA 3GLHA 3A1WA 3LX5A 4V0KA 1CR1A 4BFTA 3OE7A 4II7A 1NLFA 1GILA 1T3LA 4M1KA 1EFUA 4HIKA 2XOKD 2YHSA 3BU2A 3C5CA 1NRJB 1JAIA 2W0MA 3SFZA 3U3JA 4POFA 4DV5Q 1P60A 3H84A 3VX4A 4U7DA 4NYIQ 1ELOA 4YCVA 2QAGB 3BFXA 5B57C 1IYJB 1MO4A 1RC8A 3OYYA 1P9WA 1MR3F 3PGZA 2CE7A 4M8NE 3HKSA 4B6FA 3HOZH 2EWWA 4TYPA 5KSZA 1N0UA 5AJXA 2CK3A 3DOFA 3OTOQ 4QL3A 5IRCD 2CWPA 1JXMA 1KKMA 1TF7A 3D3QA 4MRRA 3VTKA 4JV5Q 3X2SA 3PO3H 4DUGD 4NCIA 4H44C 1NY4A 1VQEA 2F3TA 3RNLA 4DV7L 3VMFA 2ZU0C 2EYQA 4EFLA 3UK6A 5JSZA 2QRNA 1Q12A 2ZYTX 1A5TA 1V9PA 5IYBG 3UMFA 2NQ2C 3CUEF 4HB4A 4XWAA 4AIMA 4DLWA 4GSYA 2JASA 2Z6KA 3FKQA 1TKWB 2QM7A 4G3XA 4HYYA 2N49A 4EJSA 2I1QA 3HOUG 3CNNA 2AN9A 1Z0IA 1EXMA 2G77B 1U9IC 1US8B 3PEUA 2UU9L 4JLPA 2RGCA 3U3KA 3WHLA 4BLOA 1OH5A 1HNXL 1HUQA 3NELA 3GJ3A 4YMWA 3RVBA 2OZEA 3CC4A 3HU2A 5EXXA 5JRZA 2YTXA 2IYUA 2ZR7A 3KZ1E 1IY0A 4RFSA 3AVPA 1G3IA 4HZUB 4Q4LA 5CM9C 2JA5H 1UBCA 1W36C 4KLKA 3Q5DA 1EWRA 2BH2A 4ON9A 2A5DA 2B7CA 2LWIA 1M7BA 1LW7A 2JIZD 3CWQA 2WWXA 4EAQA 4BQSA 3W1BA 3TS2A 5E7MA 2NMVA 3QXXA 5DI9A 2C99A 3TBKA 3HOXH 2ZRNA 3BFKA 3ZVLA 1P5ZB 2GVZC 2K14A 3RC8A 1KDRA 2JEAI 1QVRA 4JI5L 3EPJA 3A0JA 3CXCA 5KPDA 1AQUA 4AY2A 1MO3A 2ZETA 1XD2A 3SJAA 3FGNA 1XNQQ 4LJ4A 3N2IA 1EWQA 1T0HB 4FDBA 4JLDA 3T1HL 3TSOA 1DELA 4OWWB 3D7MA 1R0WA 3RRMA 2F55A 3PF5A 2BV3A 2NO1A 5FOXA 4US2R 4C3JH 3VHLB 2PPBC 3RS5A 5JEDA 2H5XA 3I32A 3U6KA 1UJ2A 2O0JA 3WBKA 3N2EA 3EAQA 1KMHA 3K81C 4UNSA 2NO6A 3ZJYA 3U4QB 2XJ4A 2B6HA 3HU3A 5JEEA 4LHWA 4BXXH 3CPHA 3TRZA 1QZHA 1MT0A 2F1IA 2ZANA 4A3BH 1NP6A 4NXNQ 4DR7L 1J90A 3K7AH 3TUIC 2Q9CA 3QJYA 3ECCA 1Q1QA 2IUTA 3CKLA 2KA7A 1U0LA 2ZS8A 2B8WA 3J81k 1XMSA 5FL7D 4ASUD 1WFQA 1FJGQ 2J3EA 1IY2A 1KDPA 4MRSA 2QN6A 4B3ML 4JLAA 2ZJAA 4D4KA 1KSFX 4LJYA 4PHTA 1G3RA 4Q1BA 3OEEA 4BA2I 3H0GG 1XB2A 4BY1H 3AFPA 2A5FA 2GJ8A 2I1VB 3CM0A 1OSNA 3WMEA 5CDFE 3GLFB 2PQAB 1QVGA 2IHEA 2YWHA 2LMCB 1K8RA 3CQZH 1AGPA 4HDOB 1W0KD 3Q9LA 1K6MA 1OF1A 4X65Q 2MSCB 2ODWA 3Q7QA 2O8EA 3T51B 1B7YB 1EESA 2PT5A 2HYIC 5J5CA 1HPCA 4PO8A 4TN1A 1BIFA 4X64L 2ZI7A 1E7ZA 4APVA 1I94L 4Q4JB 5IK2A 4BRWA 2FZLA 2GBLC 2CJWA 2O5VA 5DN6D 1CLUA 2NZOA 1N9WA 4KHPL 1A7JA 1AJEA 4L8JA 1FL0A 1QHHB 3U6BA 1N34L 1YHNA 2Q9BA 1PJRA 4C3IH 1N2CE 2RKOA 1UWVA 4OK5A 3Q72A 2A6EC 4YMSA 3E1SA 2OM2A 3X1YA 2ZTCA 1J6QA 1KHTA 1R4AA 1XTKA 2QAGC 4HLUA 5C46F 1KI7A 3RDPA 2NN6G 4A3DH 4A3JH 1W46A 3KLWA 4LBWA 4A0FA 1IBML 1KK1A 2OCAA 3HFZB 4JI4Q 3B7GA 2PBRA 3F0TA 2A5YB 2J0UB 3GEHA 2YNMA 3KXKA 3OE7D 4X6AH 4DR1Q 4FINA 1P6XA 2QEXA 2JA1A 2HT1A 4WIAA 3T61A 1PYSB 3AVTA 3BIFA 3M7NA 2OCYC 5L3QB 4GNXA 1E1TA 3NKVA 1W5TA 5C0XH 4DC9A 4LDJA 1VYVA 3ICEA 1GOTA 3CMEA 1YZQA 5IF9A 3HP1A 2J0SA 5LD2B 2VP5A 3ND8A 2CK3D 2ZREA 2B3GA 3DHWC 4OHVA 4AI6A 2BOVA 4DRZA 4B3TQ 2OFXA 3VR2A 3K8YA 1IXRA 5M3MG 1VQNA 1F3OA 1XXHB 1J70A 4RJLA 2FX3A 4JKIA 2UXBQ 1KI6A 4LYJA 4ESVA 3T06B 3U7EB 2YYZA 4JI2Q 2P5SA 5CIWA 4YDSA 4DK0A 1CRPA 4WOPA 4AQYQ 4IFDJ 1X8KA 1KI9A 1G64A 3THYA 3HPQA 2L15A 3HGBA 1VQ8A 2ZR9A 4WZAE 3WBJA 4LPKA 3X1XA 4PZZA 3NBXX 4PPFA 5BYJA 4KFSA 4PAMA 1QF9A 1Q44A 1TAGA 3W3ZB 1SVSA 5IYDG 3ZZUA 2V9PA 1U8YA 3MG9A 4M22A 1CRQA 1CSPA 3IO3A 4M9XA 4CEIB 2CMKA 3HR8A 2K32A 2RGAA 4AYWA 1M90C 1R7RA 1YIJA 4PR0A 2VF8A 4WVFA 2OCPA 5HE8A 1KO7A 3ZVRA 4UP8A 4JYBA 1FP6A 5EJEA 3BDOA 1JR3E 1Y1WH 3PR1A 2A3RA 3CR8A 1P75A 1E9BA 2E5LQ 4V0LA 3C41J 4R4OA 4YCWA 3T1YL 1G6HA 4H02A 4PAQA 1KIXA 1NF3A 3FHOA 4XVQA 3F5FA 2ZUDA 1H9SA 1SVIA 4L5SA 2K75A 4K81B 2ALYB 2WIBA 2F9MA 2NVQH 1HQYE 4TL8A 2IUSA 1O7IA 3CW2A 2HHHL 2JJ8A 4LC1A 1YHBA 1KC8C 3I1FA 2IX3A 2H5EA 1XU4A 1ZYUA 2OBLA 4LUVA 2QP9X 1T3HA 4TMZA 1PZNA 1JMCA 3N5CA 4TLAA 1NN0A 1N8RC 2VUMG 1RJ9B 2RHQB 3MCAA 5L3SA 1VQDA 2RGXA 3F1ZA 1JJ7A 4LF9L 5HY6A 4BBRH 4M1SA 4O25A 5C1BA 1B9NA 1HEIA 3VX3A 1NBME 2WWGA 4US1R 1W48A 2GEVA 1GZSA 1HT1E 3ADCA 2GJAA 4GLXA 3I4LA 1KRTA 2OTLA 1KK0A 1T3SA 1TF5A 1XTJA 3HJNA 4FMBB 4Q4AB 2D62A 1YZTA 1Q86C 3I8XA 1CUKA 2DNCA 2V4ZA 2MNAA 3NDBB 2DUDA 3C15C 1CEEA 1GRQA 1K3RA 3I4NH 4PC6A 5TARA 2Y0SG 3L8ZA 4C0BA 2JLWA 1ZNXA 1NVVR 4G0NA 1XTDA 1VQCA 3QUSA 1E2DA 2K5NA 1OE0A 2GTPA 4OK6A 1Y1VH 5GVRA 5C44H 2CLDX 2QENA 1BOFA 5FI1B 4BUJA 3LBNA 1II8B 4LPSA 2KE5A 4DXAA 4X66L 2YU9H 1CBUA 3ZH9B 2Z43A 2Q3FA 3A4LA 2ZI5A 4PZYA 2L0XA 1E9RA 4RZUA 2UUCL 1CKMA 2RMKA 5A0FA 4DLTA 1D9ZA 2GHIA 4KVGA 4GDFA 1Q90A 4JI1Q 4DV0Q 3ZZTA 3PF4A 1VF5C 3E0EA 1BS1A 3CRW1 3OEED 2CNWA 1K9MC 4C0KA 1XXHE 1IY1A 4GP7A 4TQUS 3U44A 4RD4A 1KQSA 4HATA 5FUYA 1TMKA 1YKSA 2H1LA 3QF4A 4Y0VA 4BFVA 2NZ8A 4E09A 2AK2A 2XJ9A 4KAXA 1TUEA 4JVSB 4R71A 1R0ZA 5C4JH 2QMHA 2RGNA 3L0OA 4KLZA 5FTNA 3AFQA 2YV5A 1XMJA 5IK2D 3SQXA 4KO8A 1Z5ZA 1YZLA 4NPHA 1S2MA 1UBGA 2A19A 2AK3A 2OBNA 1FQKA 1Q46A 1P8LA 5TMPA 4QGAA 2GETA 1N32Q 1Z28A 3BH0A 2VS1A 1E2FA 3KUCA 3KQHA 2JLVA 1NVXQ 4DLRA 3I5XA 2WJYA 4CEJB 5DISB 1WJJA 2ES2A 3K09C 4KFTA 4M9ZA 4R4IA 4BLQA 4LFBQ 1CR2A 1OFUX 1VQPA 1GIAA 5LD2C 2O0HA 2YOFA 1A0IA 1YR8A 4GOJA 3VR6A 1HNWL 4BBSH 3BXZA 5CDFA 3S1MH 3U7GA 1VMAA 3BK7A 2QP4A 2AWNA 2FH5B 1KK2A 4JT2A 4IFDG 3NBHB 3PJRA 2PH1A 4B2LA 1D7QA 4DV5L 2VNUD 1KO8A 3C4JA 1XEWY 1MJEA 3DMDA 4B74A 1CSQA 1CJVC 4L4UA 2I5HA 4LF4Q 1KZ7B 2Z83A 3IDQA 3W3AA 4P3YA 2W00A 3BB4A 1TWHH 1OXTA 1HZBA 1US8A 1VQ4A 3QPVA 3QSYA 1VS0A 4BY7G 4D6PA 1ZJ6A 3FB4A 3TNFA 4F91B 3FHTA 4DSOA 4HI0E 4QXAA 2GRJA 3OTOL 4UQOA 3VDYA 3OW7A 3TQYA 4UY8C 1HURA 3MAAC 5BR8Q 3KDFA 4JLNA 3AVXA 1HCZA 3LW8A 1PH6A 4DCTA 1MV5A 1NL3A 4JV5L 1T5LA 4N1AA 3R9IA 3UANA 5B30A 2A2ZA 2BM0A 5J4HA 4JYCA 3DM5A 2CBZA 2WM9B 2WIAA 3GLHB 1TWAH 1VPLA 1OIXA 4TLCA 4TQAA 4WAUA 4EKDA 3U50C 3BG3A 1KY2A 2GNOA 3SGIA 5L3RA 3SNHA 4IXNA 1JB1A 3A8TA 1EYGA 2AFHE 2ZYVX 1Q57A 2IS4A 3WYGA 1Q81C 4DLSA 3GJ0A 5HCIA 2ZYUX 2VEDA 4A76A 1T9HA 2G1JA 2VL7A 5E4FA 1FFHA 4QHSA 3TQFA 1OYWA 4FI3C 4C0QC 2WWHA 3EZFA 2HEIA 2N3SA 2HF9A 2R92H 4CT5A 2JA7H 4OO1I 3GTKH 4GN4B 3WNBA 5M3FG 4R2IA 3CX6A 5EXSA 4ABYA 3TS0A 2PX3A 1R0YA 4DCSA 1GL7A 2ZR0A 2REBA 1DAEA 3GQBA 3CLVA 1MO6A 2EFCB 3MWJA 3HKZG 4MYCA 4DEYA 1R0XA 3Q85A 4XTRA 4IDOA 5JSZB 4UP9A 4URZR 3GD7A 3U9SA 1PH2A 4AYBE 4IDNA 3JZMA 3G6EA 2D3WA 2IYZA 2ONKA 2NN6I 1X65A 3KJOA 4HIMA 1E2EA 1XD8A 3CCLA 3AP1A 4NU0A 4EJSB 1E1RA 4OI4A 3ZIAA 3KQNA 4URXR 2H8KA 3AP3A 2EFDB 1XNQL 1IXZA 2FSFA 4E03A 1BH2A 1ZD9A 4P0TA 3THWA 5EZ5A 4OWXB 3FMPB 1PH5A 3Q8XB 4WXRA 1IHUA 1HV8A 3RLOA 4RFSB 4Y0AA 2IWRA 2RAPA 1T8TA 4LJ7A 1IN6A 2OT3B 5JLJA 2ZRCA 4LF8Q 1TUIA 1AM4D 3PO3G 1NIPA 3F3YA 5AUQA 4BZPA 4DAMA 1D2MA 4L15A 1Z0JA 4FN5A 3RYTC 2KBFA 1TU4A 2DFNA 5C0XJ 1KAOA 1SXJE 3PG5A 3BERA 4OQFA 4NYMR 4PQYA 1TL7C 4PQFA 1X3EA 4LJ8A 1ZVQA 1YRBA 5B58C 1NLYA 4KITB 2OXRA 3LVRE 4JI3Q 1M6NA 1RPZA 3KKOA 1PH1A 4NCNA 1NBMA 2KHJA 3GPLA 3A8KE 3Q7PA 4G5QA 3M4PA 2GXAA 2R6GA 1XD2B 4DV2Q 2WAQE 3GTJH 2R93G 1IN8A 2REOA 2LSSA 3LLUA 3K80C 3HWSA 1FJGL 4B47A 2OG2A 1T5IA 3U5ZB 2CNWD 1Y3AA 4U00A 4OBEA 2PJZA 5BQ5A 3T1VA 3SE0A 2JA5G 3B8HA 2IX1A 4OQXA 5FL3A 1CJUC 3M9BA 2JJ1A 5AK0A 3ZGXA 4B44A 4B75A 1FYCA 4LF5Q 2ATWA 2VP6A 4YLGA 3CCVA 1YJ9A 3PXGA 1XEXA 1KMHB 2E9SA 3EW9A 3AF4A 4MGKR 4ALPA 4X65L 4UNRA 1LY1A 1GAJA 2AKAB 3HOXG 3S2HH 5L3QA 1AN0A 5EP1A 4C0JA 4ZIRA 3I2ZA 4AKHA 2P5TB 4NB3A 1FTNA 1G18A 3ERSX 2ANBA 1SN8A 2OLKA 3HOYH 1VDZA 5BWMA 1XJ0A 4GS3A 3KF6A 3EZ2A 5EQTA 3IO5A 3P32A 4DR4Q 4B3FX 1ZP6A 1NSFA 4LUCA 4ERNA 4JBJA 2BMJA 3RS3A 5EP3A 1XXHA 3V4RA 2FE4A 3CCQA 4LK2A 1QJOA 1G41A 2D5DA 5IYCH 4GMXA 4LC0A 3PQCA 1H8EA 2VO1A 4DR1L 3OAAA 4OJQA 1PLJA 1WF3A 1EIYB 1GSIA 3FP9A 1OIVA 3NTUA 1COWA 1XPOA 1RRPA 2J7PA 5AUPB 1A82A 2Y0SE 1KDOA 4B43A 5AUNB 2O8EB 3UG6A 2C78A 5G41A 1GFIA 2Z0MA 1KRSA 3AUXA 3HPRA 1CKOA 4P71A 4NE2A 3SBEA 5JWOA 2CJWB 4Q19A 4EUNA 2WZQA 1MOZA 3C8UA 2WP8J 2ASBA 1KJZA 2F43A 1TADA 4DIEA 2L5TA 2KI5A 1DARA 3QE0A 2BMFA 4KYIB 4B3TL 4IOKA 3WNCA 2Z0SA 2IS1A 4JBWA 4IFBA 2BEKA 1UE7A 2HCBA 4FIDA 2JQOA 2BBOA 2UXBL 2A8VA 4GPTA 4JI2L 3TW4A 4IW3B 4RKEA 3LWUA 1JB7A 3B6EA 4AQYL 4QBGB 3KQKA 2EDGA 1II0A 3B9QA 3I92A 4MKGA 2KCTA 3SHFA 1VQAA 3I4MG 4TLBA 3SOPA 1DPFA 4IJHA 3PO2H 1B70B 1DAMA 1ZM9A 2F1MA 1SHZA 3A37A 3NEYA 4LHYA 5CB6A 4GNXB 5ELOA 5A5GA 2YOGA 1KOFA 2G6BA 2YC4C 4MGZR 3GO5A 1G16A 2BJVA 2VPPA 3M4OH 2Z6VA 4UP7A 3DZDA 1NKSA 1N33Q 2MSEB 3K0EA 4IPDA 1TX4B 5FOVA 3AF1A 1YJNA 2B8FA 2BH8A 1G6OA 3I8SA 4M9QA 2Z6KC 1VYUA 4HR7B 1ZBDA 3ZD6A 4LFCQ 4JJZA 4MDFA 1I6VC 4EJSC 1IOZA 1LACA 2E5LL 4PSVA 1KL9A 4HUQA 4Q4AA 1LTLA 1E1OA 1KI6B 1ASYA 4KODA 4NYJR 2VL6A 5HCNA 4A3DG 4A3JG 1NJFA 4DNTB 1VG8A 3G5UA 4HIOA 3THYB 3SYKA 1FVIA 2ASEA 5FBWB 3AKDA 2WSSD 4G01B 4IEEA 3U3MA 1BYUA 4IOJA 4PPGA 3CRVA 1G5RA 1S1MA 1KJYA 4MGYR 1Y8OB 1X6OA 4YHHQ 3KKQA 2VHUA 3ZIAD 4BLPA 1Z3IX 4Q02A 5C0XG 4DVGA 1Q7YC 3T15A 2QU8A 1SZPA 621PA 3QVVA 1K5DA 1CKEA 4IFDI 1VQMA 5KO2A 1HJPA 2G88A 4FMDB 3VR1A 4CGZA 4KI0A 1VG1A 4A3GH 1T4GA 4EFMA 1S3SA 1B0UA 1EQQA 4R9UC 2N8NA 1NVVQ 2JDID 1GP2A 1KYIA 1H9SB 2ATVA 3CZQA 2QAJA 4I1OA 4JVMA 1XEWX 2IS2A 4GOXA 5DHFA 1XJVA 3JAMi 2RB4A 4DLUA 4Z1MA 4PZ7A 2P67A 4DLZA 4JT4A 2WICA 1GUOA 4URVR 5H1YA 2KBEA 1NBMD 2VSXA 1WB9A 1MJCA 5L3SB 2DWOA 4OYHA 3GTPH 1G51A 3ZJYC 4EPXA 4M0LA 4A3CH 5KDDA 2WB1G 1M7HA 2V4DA 1S3GA 1WA5A 2VA8A 1TF2A 4JI1L 4DV0L 4IOCA 1YI2A 2H57A 1KSJA 3SS8A 3PVSA 5KUTA 4CEJA 1Y1WG 4QBHA 2JJ1D 2W58A 4HDCA 3K53A 5FL7A 1XTQA 1CI3M 2V1UA 1N5JA 1Q0UA 1N6IA 2LCFA 3I7FA 2IXEA 1M34E 2ZYWX 3K9GA 5FTKA 4DR5Q 1S9HA 3OESA 3SJBA 1FQJA 3TH5A 2W2TA 4RD1A 3HKZE 1SXJA 1XMVA 4JOIA 4B3GA 4Q1FA 4RG1A 1SFOH 1JNYA 1YNXA 1MO5A 4WBSA 4IOLA 1OXSC 4OWTB 1ZM2A 3K0FA 2QGNA 3L0PA 1X3SA 4Q7KA 5AJYA 3T1TA 1NBWA 4D25A 2VHCA 1X3GA 1CXZA 3EG5A 4A36A 1HE1C 1FR3A 1J5EQ 1E2WA 2CLSA 4BBRG 3U58A 2QUZA 3VR5A 5J4YA 4MKHA 1Z2CA 5GJWC 1N32L 4EQ5A 2YTYA 1DADA 4UXHA 1VQLA 4PZ8A 3DMNA 5M5YH 2R8RA 2V6IA 4FMCB 4BWYA 2HT6A 1OPXA 2AD1A 4IHQA 2QP3A 2K5VA 3CF5A 1T6NA 1WE2A 2PMZE 5IY0A 4LFBL 2BCJQ 3DM9B 3GFTA 4RZXA 4E5UA 1DD2A 4DDUA 2IHBA 1H8ED 4RY2A 2ZIAA 4M4SA 3OAAD 3U44B 3R9XA 3DPUA 3ICQB 3MRSA 3I55A 4Y52H 3CCRA 3QF4B 4KSCA 5SZHB 4ZCIA 4H13C 1JI0A 4KV9A 4DSTA 5FOUA 1COWD 2J7PD 4HLUC 4IOAA 2ERYA 2FSGA 3I4NG 3HYRA 4O3MA 3L7ZC 3CCMA 3U4VA 2YVUA 3IIJA 1ASZA 1AZSC 3QVUA 4YXWA 3SZRA 4LF4L 5EP4A 3GLIA 1Z63A 1VKJA 1FW6A 5GAGC 3RNUA 1JJGA 2YWFA 1XPRA 1FP7A 2OV2A 4XTCS 3D31A 1RYHA 4GNXC 2P2LA 1Z6AA 4HLCA 5GADl 4HAXA 5KNBA 3OF5A 5BR8L 1CULC 1EQRA 4KHZA 3QBVA 1RIPA 4IFEA 3QEOA 1XX6A 4A3FH 1YNNC 1G8GA 2ZJZA 1FZQA 3L0SA 3W5JA 2C2HA 1VF7A 4POAA 4C7OA 4ZO4A 2Q2TA 3MJHA 1XFAA 1O3YA 3C14C 1VCMA 2ZUCA 3IIMA 3GJ6A 2ZRPA 1E2VA 1IXRC 3K9LA 3HR7A 2D7DA 1C9OA 3A1SA 1YZKA 2H17A 1KY3A 2BE5D 4DV3Q 2OEPA 1FNNA 3QPUA 2E2IH 4XWOA 4A3EG 2K52A 1KD1C 4DV6Q 3SI7A 3BJUA 5IP9H 4LYAA 2QTHA 4R1JA 1FTSA 4PFSA 1JJVA 2PZEA 3LBIA 1LUZA 4R4TA 2QQEA 1EG7A 4UXIA 2CEAA 2ZRAA 4DUYQ 2JK8A 2GF9A 3S1AB 5K8UA 1QZXA 4JIMA 5CJPA 1JR6A 2I3BA 2GKSA 2I5LX 4B73A 3SQWA 4X62Q 1QHIA 2R2AA 1A8VA 3KDFB 3CPWA 1K8GA 3DVLA 3M0EA 3NH6A 1AS2A 2J0VA 1XCPA 2OLJA 1IW7D 3LRPA 2AL7A 4FXPA 4HAYA 2NGRA 4BFUA 4PC3A 2ZRLA 4IEIA 1Z83A 4C30A 1ESNA 4BBSG 2V1CC 4UPAA 1WI5A 1G4UR 5FJ8H 4LWCA 1TEXA 2OSBA 2R6FA 1T8UA 4BFSA 4PG3A 5ANRB 3RS4A 4JLMA 3BH6A 2QPAA 3BBPA 4HAWA 1P4SA 3SYNA 4AD8A 4BLRA 1NMFA 3AB9A 3I5YA 3OIWA 3SN6A 1VHLA 3MWLA 5K8IA 1Y8NB 3CW2C 2EFGA 4UNQA 4LW1A 1Q22A 3IUYA 3A1TA 4OI0A 2QGQA 2OE2A 3RSOA 3RRNA 4C3HH
chains in the Genus database with same CATH superfamily
2PX6A 2Q46A 3WRYA 4EJ0A 4XIYA 4XB6B 1NJ1A 5REQA 5FWAA 1IBKB 3EN2A 3KNZA 4Z8YA 2C04A 4Z51A 3TSAA 4M1ZA 2R25B 1U1DA 1DUSA 3EIHA 3EBOA 1R5BA 1PYBA 3WK9A 4LOJA 2GK7A 4LWOA 3WGGA 1XMOB 2IHUA 1VL6A 4QQKA 4RTNA 1G7TA 4XCQA 1JDSA 2VUUA 1PAUA 5JR3A 3W2EA 1PR1A 4OHRA 5E7IA 1SMXA 2CHEA 2ZJFA 3LKDA 1NIJA 2WZCA 1TRHA 4DB2A 4LUOA 5KNBD 1I3QH 1S5PA 1YF3A 1QGDA 1UOPA 4ZAZA 1QIDA 3TR6A 4F85A 1BSVA 3D6FA 5FFMA 1RKQA 5BV8A 1CJKC 2ZSEA 1L7OA 1NF8A 3PJEA 3OO0A 3HOYG 2WSBA 3COYA 1MTZA 4ENWA 2WAXA 1U8ZA 2GLTA 1ZRHA 3WK6A 2QD4A 3I70A 1UXIA 3A8JE 5EE3A 2JFOA 1WD5A 1J00A 4ZA2A 1DJOA 4CLRB 1XGKA 1OH6A 4R16A 4I9UA 1PLLA 5ALJA 5DRYA 3NH9A 1DLJA 4LMQD 4GP6A 3DLPX 2JJ2D 1GTJ1 5JYCA 2H2HA 4D43A 4RY8A 3TDNA 3F67A 3SCZA 2PAFA 4IPGA 2BKEA 5ALZA 1EIFA 4JS0A 2NUAB 5AJHA 2ZTLA 2VB3X 3EWSA 2FR0A 1NURA 2XDQA 5JD5A 2HA4A 4UE6A 2PM8A 1WXQA 5G4KA 1VC2A 4KR6A 3PDIB 5L4LA 3C2PA 2VK1A 2E87A 4LJ9A 1EVEA 3K1TA 4A0QA 1JHMA 3BDVA 5IT4A 2BIFA 2DERA 1TB4A 2WHRA 5EPJA 1YBMA 4EGQA 3B3QA 3GK3A 3KC2A 3DDOA 4C4XA 4DV6L 3D8HA 3V9PA 1XNRQ 4X6UA 4N9WA 4MHOA 1SCDA 4RIHA 1SXIA 1ZGGA 4K9DA 2PWAA 1X13A 2KBNA 4DPGA 4EAAA 2UUBB 1NXPA 3NAMA 4OA8A 5IXJA 2WSSA 5EVCA 3CEPB 3SR0A 4X90A 4IQ4A 4JHXA 3KZVA 3DTVB 2HXSA 3N6RA 1GRRA 4OV6B 4FFVA 2JDIA 5LUAA 2R8YA 2ARKA 5ALQA 2PV7A 3T16A 4KUGA 4AF7A 5LZ7A 3FYHA 2CXRA 5JJLA 4QUHA 4K26A 1U9ZA 4FF1A 4A0HA 4W99A 1SVUA 2HDMA 2H29A 1Z8FA 1EGAA 5HZGA 3SDZA 5ES4B 2XAAA 1W35A 2Y66A 3G2LA 4FOSA 3WRWA 3JZAA 4UUPA 2B2CA 2K05A 4QFCA 5KJEA 1X1DA 2ZJPA 2FE1A 1DRVA 1V41E 4G23A 3TTVA 2PKWA 4NXMB 1Y6ZA 3HBNA 2Z56A 3ENVA 2K5QA 4A3BG 4GP9A 5AW9A 4D9HA 4B80A 1OH7A 3NBAA 2LXJA 3KL4A 2VJNA 4E5SA 2C3MA 5E9QA 4ZRNA 2X1LA 2ZSBA 3HM2A 2D1SA 4M9CA 1K7CA 3ROTA 3W5OA 1E2IA 3MYRA 1JLRA 3FA2A 1CR6A 2YVQA 2DCUA 4U9UA 1T9GR 3KKPA 1RW4A 3HOZB 1U6KA 4RBNA 1IWBB 4DJJA 4U2GA 3CRQA 1J97A 4TWZA 4HSVA 4Q34A 1K7XB 4Z7JA 1QJ4A 4YALA 3NV7A 2RIRA 4D41A 3A6FA 2QW0X 4I3HA 4PSAA 1P1HA 1PX2A 2O9JA 2WINB 1JHUA 3IUNA 3CRZA 1ZJ5A 4ACBA 3AFOA 4LYHA 2ZR8A 4ZTBA 1D6JA 1SCUA 3WMWA 4Q9KA 2ZTEA 1LPNA 2OCLA 4C9BA 2EBUA 4LDAA 4AJ1A 4JYAQ 4MUAA 2J0EA 3VH1A 2QR5A 2C9YA 3TJRA 4MSUA 3O8RA 2J3JA 5IGDA 3KQQA 5HNKA 1R10A 1PS0A 5FQNA 2J7ZA 3FWZA 4ZZ2A 4TLEA 4WHMA 2HA3A 1DZ1A 4RSGA 4F92B 4YMIA 2G0TA 4I1YA 3JYNA 3G6KA 5IGFA 3NGXA 2HF8A 2H65A 1RBQA 3ITNA 3NHJA 1OKKA 1L0XB 4JI3B 1TVKA 3ETHA 1B44D 2XDQB 2VJMA 3WWDA 4D98A 4C3IB 3GFRA 1MCZA 5CA0F 5JARA 5G4KB 1N5IA 1TUGA 4BLSA 2HBRA 2CNBA 3ROFA 4HEDA 4MLDA 2NVTH 4KX3A 1QIEA 4WLVA 1T9GS 4KE6A 5DM1A 3I9NA 3N2KA 1FP2A 3PR2B 4HC4A 4HV4A 2CWAA 1T1JA 1MAAA 5TV2A 1MLDA 1XRJA 2PT6A 5FXMA 3JQRA 4P5DA 4HVCA 1W59A 3FTCA 2BF7A 1VQOA 1YSCA 4C76A 1VCNA 4K9LA 3S5JA 1AHIA 5CGQB 4KQ9A 2BOSA 1Z9BA 5KDLA 1QHFA 8MHTA 1TQ6A 4C3VA 5BT8A 1V8QA 1P0CA 4YPFA 1QNFA 4A8JA 2ZRBA 3DDWA 3I0MA 2DLCX 4ZKEA 4F8EA 4G1CA 1QAOA 1RABA 3HVUA 2G83A 5B55A 3DDHA 3BCRA 5HKBA 3UDFA 2CNOA 3U1TA 5J39A 3AH8A 4PM4A 3KUXA 3H2SA 1DEXA 2HHLA 2W6JD 1T8WA 3BE8A 3WLSA 3O2SB 3O13A 1M2JA 1DEHA 5LCXA 4QQBX 1VL1A 2B29A 5C4JB 4F56A 2MO0A 1W5FA 2I22A 2DE0X 1JOQA 1Q2XA 3ICVA 4XUEA 5JSQA 1T36A 4AN0A 4A93G 3OFJA 1IL8A 2KEDA 1A2BA 2ZM6Q 3KJFA 1SUFA 2QDBA 1GYRA 3BGSA 1QRTA 4JI0Q 3ER0A 3X1WA 4RJTA 1C1YA 3IKJA 3EBEA 4PSCA 3EVQA 4XSGA 1OWPA 1RP1A 2DWUA 3MAJA 4WSOA 3VAYA 1NFRA 4YAWA 1EBBA 2Q6OA 1Q0TA 4PYMA 3W7VA 3NTKA 1JWBB 3TPFA 2QMOA 1XWFA 1JFSA 2Q8IB 5CB8A 5JE8A 2KB0A 5KDOA 3L5OA 4EX6A 2G71A 1FRVA 4A10A 2PUWA 1JXOA 1PL7A 3D2BA 4HNTA 3TIFA 4AU1A 5J40A 2AXEA 5EUMA 1FMJA 3TQOA 3CLTC 3K9QO 1F4LA 3ZCSA 3ULPA 2O14A 4ZK6A 4J75A 2GERA 1GPJA 1AN8A 2JFUA 3TYXA 5ESXA 2Z6QA 2J31A 3FJOA 1SCUB 2P8SA 3AHJA 1EDEA 1R00A 1VSTA 1EFWA 1VJ0A 4YWLA 4WNYA 4ZEWA 2FN7A 2C3PA 1G9XA 3F1KA 3IELA 2AGVA 3C3XA 2F0SA 3DLTA 4GDMA 3DQZA 2R8EA 1TMGE 1AHNA 3EEBA 1MIUA 3MEQA 3N75A 4FEGA 3J7AF 2QM8A 3ANMA 3U3OA 1E24A 4DQVA 1L5RA 3DMHA 2IXFA 2JF0A 2GFIA 2WNHA 2F3PA 2WMOB 4BO5A 5AVYA 2C5LA 2VJMB 1O77A 4NCKA 4GOLD 1NTGA 3C3AA 4LBVA 5J47A 2HUNA 4NULA 3P1JA 1U2EA 1NJ5A 3Q7IA 1U0OC 4Q82A 4ME3A 1GPH1 3OSOA 4V190 2BEJA 3MOGA 3QX9A 2A67A 1PT5A 4ITVA 5LIPA 2IITA 1YZ6A 1HZCA 1FNSA 4B3TB 3VC2A 3PIP3 2X6GA 2R7DA 4FR2A 1W44A 2ZRQA 2BBTA 4ZN6A 1JALA 2GVAA 1IY8A 2FEMA 1Y1LA 4BE9A 1B76A 4ZCPA 4XYOA 4NTZA 3DNPA 2ZUBA 4ILEA 3LUKA 2QKYA 2FK7A 3UO8B 4A3GB 4BZXA 4BECA 3B1XA 5J3JA 1XDZA 1OV4A 3OQ1A 3MVVA 1E22A 1Z06A 3LLMA 4A8JB 1G291 4EDHA 3OHXC 2JG3A 4XVRA 1MTOA 1FUIA 4KO4S 1FRQA 2DSTA 1ZU5A 2H2FA 5DRTA 4QRIA 3A70A 4FMDF 4LMBA 3PE6A 5DNFA 2XWSA 2XNSA 2NACA 4PXAA 2GZDA 4LSGA 1OXBB 2AEJA 2RH5A 2RC5A 4RKLA 2E1RA 3QJ5A 5H82A 1KE1A 3Q0IA 5JNSA 1FY2A 2MP1A 3C7KA 1ZGZA 2GT1A 4KVAA 4M21A 4CEIA 2CVPA 3DLHA 3KTAA 3OLCX 4KG7A 5IAGA 4HAVA 1T36B 3TQIA 4BNZA 2BM8A 5JTUA 4C4PA 1KGSA 3P0EA 1LC3A 4ER7A 2IHYA 4RSMA 1QUEA 1V8BA 1OFUA 5JOQA 1T5OA 3ACDA 4LV5B 2B63G 4NG4A 3TB4A 3ESRA 1CY8A 3WJAA 3PEYA 1BBUA 4JOQA 4PMCA 4KAFA 2FP4A 4FNOA 3PCOB 4PYIA 1HTPA 4ZRDA 3Q15C 5DH9A 2E4WA 3I9KA 1A1SA 1BKYA 1QPZA 4L5TA 4NAHA 1P7CA 4KV6A 2FMIA 4NONA 5IX8A 2LV8A 3TIXB 2XUGA 1NQVA 1QUFA 1QHXA 3X2EA 3HKCA 2HPZA 2OCBA 3IYLW 4P5EA 2JSOA 4G1UC 4IX9A 5ECGC 4FWIB 1DJNA 5IWAL 2XF8A 5EERA 1GGMA 2PU7A 3EC2A 1MHWC 2WU8A 4MYHA 4XVCA 1I5FA 1QWYA 4ZOAA 5F1YA 2E82A 1DEOA 3CQZB 4K14A 2XUHA 5CLFA 1Z0KA 3T5TA 1THTA 1GRVA 1V3TA 2R5WA 4YRTA 2XOKD 4LF5B 4DV5Q 4JJ6A 2P41A 1TE2A 4QBKA 3URYA 3HOZH 2JCGA 2CWPA 3NM6B 3DMPA 4DR4B 4DV7L 1WY5A 3VMFA 2ZWMA 4II2A 5IYBG 3W8EA 1VMIA 1NLMA 4XX0A 2F0TA 3ILHA 3LUPA 3O4HA 1HSZA 3K1YA 4Q4LA 3KAPA 4KLKA 3ETCA 3I5AA 2JIZD 2XOXA 3GT3A 3TBKA 4QARA 3PB3A 5K4GA 3SX2A 1KU6A 4ARBA 1XNQQ 1BN7A 1EWQA 3D7MA 1THZA 5AXBA 4LXYA 4Y2JA 5AK6A 1EFAA 4LHWA 3TRZA 5LJLA 2ZANA 4LGVA 5AVXA 2OWEA 3RB8A 3QJYA 4M1UB 1COZA 3J81k 3O94A 3EGWA 1WFQA 3FUXA 4FNAA 4JLAA 3F4LA 2ZJAA 2WU0A 1NXSA 2XE4A 1D7OA 1WNTA 5C32A 2QDLA 2DQYA 3Q7QA 4LXGA 2Q3JA 3PQEA 4L8JA 1FL0A 5JS6A 4C3IH 2XVZA 4U8GA 3MF4A 4HLUA 2CXQA 4Z3DA 1PYSB 5L3QB 1W5TA 4WINA 1K1EA 2DPHA 3HP1A 2OVFA 2P4QA 4OHVA 2FPIA 4DRZA 5M3MG 2PIDA 4LYJA 1X19A 2VQ6A 4IFDJ 2X41A 1GZ5A 4BNLA 2GEBA 2QTNA 1RQLA 2O07A 4E30A 1EQUA 4HQ0A 2FSUA 4CEIB 5D86A 2H4HA 3G2HA 3ZVRA 5EJEA 3WSVA 1GPMA 3CHYA 3CR8A 2QTRA 3V46A 1NF3A 1HYGA 3A6GA 4K81B 2WIBA 5F2KA 1BCPB 1BMDA 2PGDA 5ALXA 1PZNA 1GEEA 1CY1A 4MVXA 3F1ZA 4IYJA 3O83A 5J2TA 2GJAA 2XUPA 2L2QA 4LYYA 1U4MA 2FP4B 4ZREA 1YQQA 1PTOH 3Q98A 3RK1A 4B87A 2J9YB 4EG0A 3DCJA 2ZI5A 1GY8A 4CI9A 4DV0Q 1A96A 3DHEA 1QB5D 3CRW1 4G9GA 4F11A 4N6GA 1ZAYA 4WY2A 1G21A 3ZWKA 1YXMA 5C4JH 3HKCB 4YCDA 1EB9A 1T3ZA 3AWIA 1E1CA 1LFAA 1T3GA 4KFTA 4R4IA 4BLQA 4D6XA 4GOJA 3VR6A 3ZQKA 2DTXA 4B74A 4OSPA 3TD6A 4K9MA 1YNND 1BVUA 1H66A 3TNFA 4YNBA 4DCTA 2WUWE 3R9XB 4AUNA 1VPLA 3TNYA 3NGMA 4XLLA 4IXNA 5HCIA 5E4FA 2HQOA 2D0DA 4QXOA 4AUKA 3RLIA 3IDOA 3HUDA 3IFSA 3Q85A 2C57A 1SZCA 1GKKA 2CLHB 5JQWA 4XX0B 2OORA 1YTUA 4E08A 3O5AA 3VRHA 1HV8A 2I3DA 3F7NA 2F0QA 3BHIA 3TZLA 2ZRCA 4FW8A 1GPBA 5COAA 3K5HA 3HS3A 3DGFC 2VJQA 1T2NA 1WPGA 2X0RA 4IHJF 4R31A 1DJQA 2EHJA 3QXGA 2GSDA 1T5IA 2JVIA 1U0EA 4OQXA 4OLAA 3E15A 1WO8A 3KUUA 4TXNA 4DAVA 3ZK9A 3C8HA 2DHQA 3VH2A 4H1WA 5BWMA 3E58A 2HL6A 1KP3A 3BDIA 1K8QA 1JMYA 4YAFA 5I7OA 5AMXA 3FOFC 1JWMD 5E4WC 1PLJA 2F4IA 4GM0A 1A82A 2Y0SE 1KDOA 3F98A 1P4AA 4M87A 3EUEA 4I4TA 1GGKA 2B69A 4FOTA 2WZQA 1RC1A 1TADA 4YLYA 2VPQA 2V0CA 2CJYA 5JSKA 4URHA 1N4DA 3LY7A 4JI2L 4KR9A 4R7GA 3PNQA 3VJMA 1WNFA 1DAMA 5DXFA 2V45A 1YO6A 3AF1A 2FPIB 4XGIA 3H9GA 4PVCA 3ND5A 4HIOA 5A4MS 4EECA 3ZIAD 3T15A 4GBJA 2XGGA 5IKPA 2EKQA 3I2YX 4G9BA 4A3GH 1XNRB 3MQFA 3GGPA 3J7AC 3B38A 2ATVA 3PC2A 4W7IA 2OYRA 1HHVA 2GA4B 1JI3A 1N2JA 2OLEA 4DC0A 3TTSA 3TTYA 3I5MA 5J2TB 1HRDA 1BU5A 4AZWA 2BI7A 4OGLA 4BV9A 3PVSA 1NFQA 1SEBD 1FTQA 1N6IA 2ZYWX 4DR5Q 3O1HB 4U2BA 4RTMA 1MAHA 4HD8A 1PFWA 3B6IA 3RC9A 4A36A 1FR3A 3T8YA 2V6IA 2X13A 1WVLA 5JNUA 5LVAA 4ZCIA 5SZHB 1G21B 5AI0A 3WS7A 2FSGA 4AF8A 4CV1A 3EA6A 3L7ZC 4FR5A 4OP3A 1TIID 1KH2A 3D31A 1EYZA 1E1CB 4HAXA 3U3XA 3JAKA 2Y1KA 1GN9A 2UYGA 2A0YA 2EYHA 5INTA 4IMJB 1JJVA 5D51S 5IBCA 3ZX4A 2V98A 4UREA 4FGWA 3DL2A 4IFTA 3ZBPA 4PC3A 3GLUA 1G9TA 1WI5A 5IT9E 4BB5A 3V2UA 3WLMA 3D3JA 1BEEA 2BEVB 5D3DA 2WD7B 2HY7A 4HNRA 4LW1A 4KDEA 3RYCA 4OI0A 1D0VA 1YQ9A 1K3TA 4MW0A 5D7BA 5CV9A 1MZVA 1C3JA 1SVMA 2NU9A 2JA8H 5C3EG 3WGJA 2KHZA 4BRSA 2ZTSA 1R8QA 3QKUA 3C16C 5LL6P 4Y9SA 5CFLA 1STOA 3BVGA 4XQJA 1PZJD 1P0PA 2FPWA 3C3MA 1LABA 3T7EA 4BYGA 4EA9A 2WWVD 1KLGD 2XGOA 2LKCA 1QMGA 3Q9NA 1GL9B 1WDLA 4JKOA 2PO7A 1RPAA 2Y99A 4NS1A 4ML3A 3UA3A 4DJTA 1HDEA 3HL4A 4YXWD 3QVJA 4LXXA 4JYAB 4NK5A 5AKHA 1XVAA 1QOQB 1T9ZA 4BNMA 4LBYA 3CG0A 2IYNA 3AB7A 1L2FA 2IOFA 3EWIA 4B76A 4EA7A 5IYZA 4IZIA 2A59A 4D5EA 4KPFC 2IP1A 1BHQ1 3IMFA 4P80A 5E4XA 1FRFS 4PGHA 4I4TB 3L8YA 4OEHA 2XT9A 4BC1A 3RANA 4QOFA 4RKYA 3NBKA 4ZDIA 4R1LA 5EHGA 1E3QA 1HZ9A 4V24A 1Z9FA 1A98A 3BZCA 4EEKA 2QE7A 5IJWA 2HXGA 2PKQP 3K2BA 1RWXA 4HCEA 3FKIG 1V5EA 2CCZA 2EQ5A 3SBDA 3PGKA 3I8OA 2ZBRA 4IDPA 4MQEA 4QIWE 5F2EA 3U7FB 4NH0A 2C7VA 1TAQA 3BWBA 1J8MF 4XRRA 1QRRA 5IP7H 4HYEA 3H5WA 2X2EA 2PD4A 4IDDA 4H60A 3IT0A 4WLUA 1BE6A 3AKEA 2FPKA 3WL6A 3U13A 3P2EA 1JYSA 1I14A 1NXWA 3UMVA 5D5QA 1FU7A 1NUTA 2E3JA 5DEOA 4HLDA 5FFFA 3QKWA 3BSYA 3GAZA 2IYVA 1H9MA 5KTYA 3E9IA 4XYEA 1MKYA 4UEWA 1GPNA 1DQRA 2G0NA 1JEQA 5HQ3A 4HN9A 2X58A 4MS3B 3TRKA 2JCYA 1D6MA 5HXAA 2O19A 1RJFA 3WL7A 2ZVQX 1W5EA 1KIMA 2IA5A 1JDNA 1XZHA 4ND3A 2KSQA 4BMVA 4X62L 3CWZA 3JAKB 4LY0A 2BE7A 4FGKA 2BJHA 1QRSA 1VQFA 2X40A 4N8EA 3UIEA 3JQBA 3TBFA 1INLA 2I55A 1AGNA 1MX3A 2EX1A 3KV3O 5CB4F 2W2MA 4JI0B 3D6MA 1ADCA 2ACWA 4YDHB 1PQWA 1PT8A 1RJDA 4QUDA 5HIJA 4RH0A 3UE0A 3RYCB 2MSWA 4J0JA 1U1GA 1KP2A 4YBRA 4AZ0A 1YT5A 5JCZA 2NU9B 4RXMA 2E2JB 5JFTA 5BR1A 3BDLA 2V58A 4IDAA 4BMNA 4BY7B 4F71A 2Y71A 3DEYX 4C3HG 2QXUA 4JFAA 4I5EA 3NHPA 4JLJA 2XQGA 2P9JA 2B4QA 4QB4A 3QKSA 3TXXA 3BOSA 3AR2A 2OQKA 4BN5A 3WJ7A 3OECA 4GWKA 3ZVKA 1FUKA 2ZVJA 3IB3A 3D59A 3PICA 2VDQB 1HE8B 3QEBZ 2W7TA 2AI1A 3E8SA 1ZYRC 1NGSA 2FJUA 3IUPA 2JLAA 3EDMA 1J49A 2XTMA 4BCDA 3STBC 4J9VA 2OAQ1 1R12A 3CF4A 5HGQA 3MTDA 1CDDA 1GQQA 1AC5A 1WXFA 1E64A 1YCGA 1EWVA