2AWOA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
372
structure length
372
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 91
structure length 372
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awoA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awoA01
3Q5DA 4DB4A 2O0KA 3UK6A 1L2TA 1QHGA 2BMDA 2QY9A 4L15A 3TS2A 5LMNL 3LVQE 1XJ0A 4OQXA 5CM8B 4IFDH 1VQLA 3SE0A 1HT2E 2ATWA 1VYVA 4EX5A 1HZBA 1U9IC 1Z5ZA 2VHJA 4HLCA 3HYTA 4Q4LA 1XEFA 3PXGA 3FKIH 2ZUDA 3EIVA 2X2EA 3F5FA 4A6XA 4LDJA 1QVCA 1FVIA 1R5NA 3K9GA 3EWSA 2H5XA 1ZM4A 3LV8A 3SU8A 4CYMA 2K52A 2JLZA 3HOYG 2DFTA 3MG9A 4ACBA 1GDDA 3QF4B 2F4VL 4GMDA 2R7FA 2C99A 1ZNXA 2FE4A 2KSQA 2PX3A 3BERA 1MR3F 3V4RA 3AVWA 2N1BA 4RVCA 3HOWG 1W36D 5EXPA 1KSJA 4B3RQ 1VQ8A 2HIXA 2WICA 1KL9A 3NHBA 4B6FA 2JLXA 4KHPL 1E9FA 1M1KC 2ZI6A 4UY8C 4M22A 1IBMQ 1KI8A 2W6ID 4RZ3A 2ZJZA 3ICQB 5JMTA 3W34A 2I1QA 1XXHE 1GILA 3KJEA 3CNOA 1YR6A 4W5HA 1IXRA 4X64L 2G0TA 1B8AA 3L0PA 5ANRB 3LD9A 1OFUX 2YTVA 5J3BA 4DR1L 1E2WA 4DR4Q 1WRBA 5E4FA 3GLHB 1Z3IX 2VUMH 4OBEA 4EAQA 2Q0HA 2BDTA 3CW2C 2IUTA 2V6IA 1GWNA 2BMFA 1C7YA 1CTQA 1QUQA 2CXXA 3NBFA 4DLUA 5FPSA 4KSBA 1HT1E 2HHHQ 3VR4A 1SE8A 1CP2A 1X8KA 2ZVQX 5FBQB 2RGXA 2EIFA 2X19A 3BE4A 3EIQA 3HU1A 5JLJA 3J81k 4O0AA 1JJ2A 2GA8A 5HY6A 3P27A 4AYWA 1YVCA 1W2HA 5CIQA 2PI2E 1CJKC 1M1YE 2PT7A 3CWQA 2R6GA 3S1NH 5M5WH 1YJWA 4DVGA 1MO6A 1XP8A 3RSLA 4QM6A 2CK3A 4BEBA 1IXZA 2J0UB 4LFCL 4B3SQ 3AKEA 1TXYA 3B13B 4PXAA 4ESVA 2HYIC 4Q21A 3LXRA 3RWMB 2WTUA 4B3ML 3AEZA 4NZYA 4HIOA 4A3BH 3AP3A 4LSGA 3I92A 5K8UA 5DO9A 3THXA 4HJ7A 5KNBA 1M74A 2JDIA 1XMIA 3PIRA 4NYMR 4Q1DA 3SHFA 3TRFA 2B8WA 3GTLH 4A3GH 1U8AA 1HPCA 4TT3D 4UNSA 2F3TA 3J81i 4XVRA 1Z0IA 4DLTA 1P9WA 2VTKA 2PNHA 4D81A 4H44C 1LV7A 2IW3A 5IY0A 1SXJC 2P2LA 4OWTB 2W2VA 1VHTA 3NKVA 1G3MA 5AR1A 3TQFA 3VAAA 2E8GA 4YMVA 1HY3A 4C9BA 5KDOA 5L8VA 2EWVA 1FMLA 2SHKA 3A1VA 2DN8A 1Y1WG 3B2EA 3B9QA 4M1WA 4BY7H 4NYJQ 3VFDA 1JMCA 1XTDA 3J81j 3D7MA 3SFZA 121PA 4XWOA 3IBGA 5M3FH 4B3XA 3PITA 3EXAA 1O7LA 3RYTC 4L5SA 3AVQA 3RS0A 3QG1A 1S8FA 2HXSA 1EESA 5BR8Q 2Q9AA 2O8FA 4A3MG 2ZSBA 2IX0A 3I4NH 4A8JC 4US2R 4WW0A 1WCMG 5JSZA 2E5LQ 4D82A 4L5TA 2CLSA 4LF7Q 4RCZA 5J4YA 1C4OA 3RHFA 3FP9A 4M2LA 4C4PA 1UDWA 2QA5A 3EASA 4DDVA 1J90A 1PMRA 3TK1A 3FMOB 1N6HA 4BY1G 2ZR7A 3H3VI 2UU9Q 3V9PA 1UFQA 1UEIA 1UEJA 2J9RA 4HYYA 3K7AH 4GNXA 2J3EA 3RVBA 5FLMH 3CMAA 3HOZG 2GEVA 2ECKA 2NO7A 1Z0JA 2AWNA 2IHBA 1ZNWA 4DLYA 2YNMA 2D2FA 2OHFA 1DVRA 2ZRPA 4HAWA 4G5SA 3VNVA 5BYJA 3KJOA 3GO5A 4BXXG 1KJYA 2YV5A 2ZAOA 4DLWA 2ZE5A 1ZMXA 2YTYA 4P3YA 3R9XA 1QZGA 1YNJC 4B3RL 1F60A 2Z6VA 1C1YA 1II8A 4P4SB 1Q44A 1ELOA 3CF2A 2RGCA 3HYRA 3PQCA 4LV6A 2ZUCA 4LF8Q 4NMMA 2HUPA 4A15A 3WY9A 3QG5A 1IBML 1BS1A 1CR1A 1P2VA 3HKZE 2XSZA 2Z4RA 1WOCA 3U4ZA 4DAYB 1ZIOA 3ZH9B 4DDWA 4C30A 5EXTA 1K6MA 4C2UA 1Y1VG 4H0LC 2J59A 2W2TA 3NH9A 4PMWA 4XIGS 3C7KA 3HKSA 2DHRA 4MRRA 4NBSA 2ZUBA 3OF5A 3T15A 1U8ZA 4MKGA 3AUXA 5GVRA 5B57C 4GP7A 3CD6A 4QOSA 1XEXB 1NLFA 1PJRA 4B34A 1FNMA 1SHKA 1SVSA 1UJ2A 2O0JA 1YHNA 2GEUA 4A93G 4Z54A 3T1HQ 3GTOH 2HDNB 5CDFE 1U0JA 1JE5A 3SDZA 2QA4A 3VKGA 1TQ4A 1YJ5A 2Z43A 3TREA 4PPNA 3E9IA 2CLDX 4PQRA 3TAUA 2ZI5A 2GBLC 5J4KA 2OM2A 2I5MX 2IWRA 1D9ZA 4HB3A 2R2AA 1T5LA 4A3KH 2AD5A 2IXFA 2QORA 4LUZA 1IYJB 1C9KA 2RGAA 5GAEC 2Y0SE 1G5PA 4Q4AB 2IYVA 1Q3HA 1UBFA 1XMOQ 3BB3A 1KAOA 1ZNZA 1LYLA 3A5ZB 1G3UA 2OXCA 2ZROA 3IHLA 4JI5Q 3QENA 1G18A 3IPYA 4B3SL 4KCGA 3WRYC 4AG5A 2P0EA 1X9NA 1NMZA 3K9LA 1RIPA 1TU2B 1L4YA 2NZ8A 2JCSA 3A4LA 1LUZA 4B6EA 2D06A 2VNUD 1OTCA 1UKYA 3UPUA 1NNEA 3C8UA 4OK6A 2XNDA 3PUWA 4EDHA 4H13C 5M3MH 2ZYWX 2CL7X 4IXMA 1RRCA 2PLFA 3WMGA 2BEJA 2RGNC 3S1QH 1XCPA 1ZCAA 1H95A 1XTQA 1QHSA 1PLKA 4M0LA 3KXIA 2W2XA 5FBRB 4C0JA 3S1AA 5FTMA 3TUJC 4MTNA 2CDNA 1N36Q 3CPWA 3CCUA 1NKSA 2X8AA 3BGWA 1CS4C 2WFWA 2XEXA 3KFUA 3N5CA 5FOWA 721PA 1ZC3A 1MV5A 2C9YA 4QJ4A 5DHFA 4GRAA 2A8VA 1G6HA 5B2ZA 1P4SA 4B33A 3OTOL 1WB9A 3W3AA 5C0XI 3I3SR 1R9TH 4S35A 1GFIA 4F4JA 1W46A 2YU9H 5BR8L 4DNRB 1SULA 3FHCB 3K0CA 3A5UA 4A3FH 1DAKA 2D74A 3WNDA 3FHWA 4WZ6A 2IYZA 5K36H 1IBLL 3C5HA 1H9MA 1VQNA 3A36A 1KY2A 2RMKA 2E5LL 1FX0B 1OIXA 2H8KA 4TQ9A 2QAGA 4LF7L 2ZI9A 4HJ9A 1VQPA 1PH1A 4H1VA 4GLAC 1NSFA 3DM5A 2JA5G 3T53B 1G64A 1VQBA 3CO5A 1P3JA 2VY3A 2ATVA 2HV8A 1P9NA 5CJ2A 4Q9LA 4V02A 1CSPA 4B32A 1NVVQ 3LBIA 1VQ7A 1AA9A 3DZDA 4A75A 1KNQA 3QI2A 3D8BA 4L8GA 4RKFA 3UATA 4KITB 1JQJC 2PJZA 1IBRA 2IYLD 5E95A 3RAPR 4IPHA 2OQ0A 4X65Q 2P67A 2GWHA 3EZ9A 5FUXA 1GP2A 3EA0A 2HEIA 2JEAI 3H0GG 4TZ0A 5FUWA 1K3RA 2RHDA 1E0KA 2BH2A 3KJPA 2CLCX 4V0MA 3BB1A 1MRSA 1DPFA 1G51A 1ODFA 4PZLA 1HQMC 2IEYA 1NVWQ 1W3SA 3J7A5 1S0UA 4LF8L 3CZPA 3TS0A 5JEEA 3KQKA 2RKOA 3K0FB 3MGCA 4DR2Q 3LWNA 3FKSA 2JDID 2BDOA 1IN7A 1IYVA 4JCVE 4FMCF 3W5JA 3K70D 1E9RA 1E9BA 3BS4A 4IJLA 4LK2A 4RY2A 4DR7Q 1F3OA 3CZQA 3B8HA 3RLNA 2CEAA 4AG6A 2ODNA 1Y14B 2B8TA 2ZT9C 5AJ3L 2ZYUX 4KFSA 1NJGA 1JJGA 2IK8A 3PVSA 4PAOA 4GSYA 2HLDA 1AS0A 2QNRA 4WZAE 2QL6A 1P2UA 2DYKA 2ZSDA 3OPOA 3E5HA 3T1HL 3H3VH 4QNRA 1ONLA 5GJWC 4BPBA 1X6OA 2BWJA 4EFLA 2Y8EA 3QF7A 4RD3A 3MXUA 2NG1A 2J0VA 4B35A 3WBJA 3LH5A 4JI4L 3U6KA 4MUBA 5JECA 2IY5B 1Y63A 5KO2A 3NC1C 1GHJA 4DV5Q 2VSXA 3DZ8A 2W6JA 2WJVA 4M9XA 4PHTA 1VYTA 1XMOL 2C35B 3PF5A 1PHJA 1KDRA 2R8RA 5HE8A 2D7DA 4D6PA 3M4PA 4DDUA 2ZRKA 4X66Q 3I62A 3RWOA 2O8DB 1TUEA 3X1WA 1PZNA 3FOZA 4QJFA 4HLUC 2BVNA 1SXJB 1TL7C 4GOKA 3CX7A 1KSFX 1S4QA 2MFIA 1Q22A 5JEAG 4LPSA 1HQYE 3F1ZA 4NYJR 4CZ2A 4FMBB 4IDOA 3CRQA 3N70A 2N49A 5CLQA 1XD2B 4IJMA 4NU0A 1FFHA 2OO7A 2PH1A 3TMKA 1SVIA 1TAGA 3MJRA 4Q01A 2RB4A 1CBUA 1IHUA 1NRJB 2H5EA 3D6TB 4UP8A 3BFVA 2VP2A 3S14H 1S1CA 4LZZA 4US1R 3NTUA 3ZS8A 2IHFA 1Q46A 4RZ2A 3HR8A 1N36L 5J47A 1E0AA 3NH6A 1JECA 4A3LG 4TL9A 4HAXA 1N5KA 4UQOA 4A8JB 4EQ6A 3KKPA 2XZPA 3ICEA 1VG0B 2AXNA 3MEFA 4D4JA 3OEHD 1DARA 2WIBA 3K09A 1QVGA 3NBXX 3BJUA 1UE1A 1KOFA 4A6PA 1KDPA 3CBQA 2XZOA 3Q3JB 3ULLA 3OYYA 4NPSA 4URZR 4W5WA 1I5FA 4P75A 1Z28A 2AFHE 4LBYA 4M9QA 2XSZD 1ZYRC 1KDOA 4PZZA 4LW1A 1CJUC 1R7RA 3KUDA 1O7IA 4DV0L 2QZ4A 4QBGB 4Z8YA 4A0GA 4F93B 1G4UR 2JLWA 1T5IA 1P16A 4R1JA 1OFTA 3HOXG 4BLPA 4MYCA 4JJZA 1COWD 3BJIC 4PO1A 3OE7A 3ZVRA 4V0OA 1G3QA 2QEQA 4IPGA 5FUYA 3GLFA 2QPOA 5JHGB 5TDHA 2QTHA 3N2EA 4FD2A 4IFBA 1JJVA 1YHBA 3T1YL 4ASUA 4BLOA 1WJJA 2Z6KA 3KXLA 4Q7MB 4MDEA 3HP1A 1OT3A 4G3XA 1DAIA 2W83A 1CJVC 4PFSA 1Z63A 3NE5B 3NDBB 1I94L 3A8JE 2WVJA 4BGDA 4JBJA 3GDEA 3P26A 4JYBA 1EIFA 4PAQA 4UXJA 1HCZA 3B9PA 4QGGA 2K7VA 1W49A 2C5LA 1Q57A 4HZIA 2NGRA 4UNRA 5IK2A 3M85A 4BBSH 2FV8A 4KKUA 1SZPA 2P6NA 4RZXA 3U3JA 3ZDQA 1JI0A 2FSGA 1U98A 4M9SA 3CC2A 1E2IA 1A8VA 3BH6A 3SYNA 4AK9A 1N6IA 5C0XH 2GZAA 4Q9HA 3KYHC 2FEOA 2P65A 3CCEA 3HOXH 4A4DA 2ODEA 3TW4A 4GOPA 1N5IA 1XXHA 1T8TA 3HPQA 1UBCA 4L5BA 3A7LA 4DK3C 4OI1A 3VU9A 3ZJYA 3ZQJA 1VCOA 2C96A 1U90A 2AK2A 4DR7L 4ZDWA 2JA9A 4B3CA 2ZRNA 3AKYA 2B3GA 1VG1A 4JIMA 3QJYA 1GRNA 4UP9A 2QTFA 4URWR 4TTRA 1FPMA 4ACAA 1BO6A 4LK1C 2ANCA 2GJ8A 2AUJD 2IS6A 3QIAA 4JI3Q 2IS2A 3A1SA 4NTZA 4ARZA 3OIVA 2HCJB 1XJQA 3TKLA 5JWOA 4MNOA 2B7CA 4KXFB 2ONJA 4P33A 3JC66 1GTVA 1HR0Q 2QROA 2QBYA 3GJ6A 3CKLA 4BFUA 2F43A 4D2IA 1E2ZA 8OHMA 1VQGA 4DV5L 3SBEA 1YJ9A 2QGQA 4IFDI 3MSXA 2B92A 1XNRQ 2DR3A 4RFSA 2ZI3A 4DSOA 1OYWA 3AFQA 1XTJA 4KBFA 4DIEA 5BN5A 5IT5A 4YWKA 2ZRBA 1X8JA 4TL8A 5IWAL 4E5UA 4L9SA 2A5DA 5FR2A 3WBKA 3KB1A 1VQ5A 5EUQB 1TPZA 3MMPA 1KK2A 3BFKA 3IIMA 4I7ZC 1TF7A 2RGGA 2NZOA 4LUVA 1SHZA 2KCTA 1AKYA 3LQQA 5H70A 1VQCA 3OW2A 2RH5A 1MABA 4IRUB 4MRVA 4R71A 3C15C 2A19A 2PZFA 3H4MA 5TMPA 3I4MG 1AE3A 2ZJ5A 2ZSFA 4MRPA 3UWOA 4C7OB 2J46A 2WJJA 4UJ5A 5IP9G 1AGPA 2IYUA 4TSFA 3SYKA 4EPTA 1DE0A 5JCPA 4V0NA 4XH9B 5LB2A 4PHHA 4DKXA 3AVXA 2J41A 4P31A 1XNQQ 1ZD1A 2YINC 2YVUA 3A8IE 3GTMH 2N3SA 3BBPA 2WJIA 3DMNA 4A3DH 1TWGH 3DXJC 4MGZR 1IYUA 4YDHB 4R4QA 2C78A 4NCKA 1L2FA 4PC2A 1LM0A 1R0WA 3RS3A 4EJSA 3THOA 3SJBA 4D4MA 4LF9Q 3T51B 4E22A 1J7KA 3QF4A 5EP1A 4B48A 1JEEA 1J5EL 2QT0A 4CRWB 1QZXA 4YY3Q 1G7CA 1YR9A 2UVQA 3RS5A 3GLIB 2GXAA 4TT3A 5A35A 1S3GA 3HOVH 1LB1B 2QPTA 4JV5Q 2OEPA 4JVMA 4YHHL 1DAFA 3N6RA 3DPUA 2A68C 1A4RA 2FH5B 3U9SA 1Z9FA 1X3EA 2VQEQ 1T8UA 3B6EA 4DCNA 4JMPA 2OWOA 2ZSEA 4M1SA 2WSSD 1IZ6A 3VR5A 1W2BA 3CF6R 3O8CA 1H9RA 3HPRA 4A76A 1SGWA 4JKIA 4M53A 2UZIR 3QKSA 2DCUA 4UXHA 2EVBA 4V0ME 3VX4A 2E2HH 3GLHA 2R93G 1F5NA 3FHOA 3HDTA 3QBVA 4FW9A 2UUCQ 1G6PA 1XDBA 3AB3A 5FI0B 5AUQA 5H8WA 2A3RA 1CI3M 1XJVA 2H17A 1Q12A 4POAA 2G1JA 1OYYA 1VQAA 3THYB 1UAAA 3W8RA 1EFHA 3IO3A 2VH5R 3G4SA 4GBMA 2MO0A 3Q85A 4XTRA 4NHOA 2JLRA 1AIPA 4QGUA 3B78A 4FINA 3QVUA 4P74A 4NPHA 4DAMA 1NP6A 2QAJA 1D7QA 4BA1I 2QGNA 3LRPA 4PC6A 4Q1BA 5L3VA 2B8GA 1NG1A 3DEFA 5KHOC 2WJYA 2JA7G 3C41J 2NVYH 1GNRA 3L2PA 3ETLA 3KTAB 3PENA 4IVQA 4OQLA 4URVR 3ADCA 2F55A 2VHQA 4ALPA 1KAGA 2OESA 2JA1A 1AS3A 1N2CE 1Z0FA 4PANA 2GF0A 3QKTA 3TE6A 2ANBA 1A0IA 4RG1A 4OXPA 4G0NA 4PZ6A 1GRRA 3NBZC 3UG7A 2MMCA 4QFMA 1TMKA 2OG2A 1J6QA 1CR0A 1RZ3A 1XEWY 1EQQA 3QXXA 3GD7A 1NE3A 3U58A 2FF7A 4LYJA 4DR5Q 5K8TA 4JI3L 3MWYW 4FDBA 1OV4A 2GILA 3J7ZC 2PBRA 3T1QA 4BUJA 3UKDA 3UIEA 1G9XA 2KENA 3EWAA 1FYCA 3FTQA 1C9OA 4GN4B 3GJ4A 4DV7Q 3QXCA 4M8NE 3SR0A 1HR0L 1VTKA 4JSTA 4BFVA 3KJIA 5GADl 3NG1A 1J99A 3NHAA 1LF5A 4F91B 2IC5A 5LMUQ 2Q3HA 2ZJ2A 1OE0A 1P2TA 3CX6A 4RCYA 2BMJA 2ZTSA 4E07A 3A6PC 1CKNB 1SVOA 1LNZA 2WV9A 3KDSE 1WF3A 4QHTA 3STBC 5JWRA 3EPJA 2QU8A 4G5RA 3GEHA 3KF6B 3LBNA 1KQSA 2R6FA 3LXXA 1FTSA 4JVSB 2BH8A 4KHZA 5DYGA 4HLDA 2GCOB 3EIHA 5EUMA 5E7MA 4IFDG 2CW0C 1QZHA 2ASBA 2OTLA 3OE7D 1EFUA 5J4LA 1GKHA 4LPKA 3RN5A 2KI5A 5DLQC 1LVGA 3RRZA 3WP0A 4EPWA 4X8MA 2OCAA 2ZU6A 4JT4A 4Q18A 1P72A 3QOFA 1N5JA 3A0JA 2J87A 3CIOA 5LMNW 2N8NA 3ZVLA 3GQBA 4JKYA 4AKIA 3ZGXA 1SRUA 2F7SA 1GVPA 1G7RA 3S1MH 4I1OA 4DWJA 2R44A 1DCZA 1I50H 1Z0KA 3T1TA 3ADDA 3IKJA 2QRNA 5C2JB 2ZM6L 3P32A 3QEOA 4BLTA 3FGNA 1XTRA 1LS6A 3CCMA 1N9WA 2A6EC 4LWCA 2WWYA 2EJMA 1HV8A 5TB5A 1W4CA 2GEDA 3EBEA 2IYRA 2XGJA 1JQLB 4OK3A 1CR2A 1SVLA 4IDPA 1B9MA 2REXB 4KBGA 4LF9L 2JLUA 2IX1A 4MZ9A 1PUJA 2AKWB 2OSBA 2VHUA 4QG7A 4O2RA 3H15A 4YQFA 1TEVA 4TMTA 4YY3L 1VKJA 4NP6A 1IN5A 3GLFE 3L8YA 4OJQA 1IL2A 1UKVY 1SLJA 2XNSA 2CE7A 4P4SA 2UZ3A 3AF4A 2FWRA 4JV5L 5IP7G 4B44A 2FPMA 3BRWD 4DNTB 3IFTA 3UE0A 3KJHA 1C0AA 5CIWA 4JBYA 3NWJA 2IS4A 2VUMG 1JXOA 2VQEL 2AL7A 3G82C 4FMCB 3EN2A 4OI0A 2OLJA 2I4IA 4P32A 5HZHA 3FMCA 2VSOA 4EFNA 1E0SA 1JJ7A 1E2FA 4Q4JB 4B2IA 1OKKD 2BM1A 1D2EA 3E70C 4HLQB 4L9WA 5L3QB 1EIYB 1DAHA 1ZYUA 4EIWA 3EC1A 5EXSA 4ABYA 1DBSA 5FOSA 1KMHB 1E2KA 3UANA 2UUCL 4OO1I 5JS7A 4N0DA 4JI7Q 2EW1A 1IAQA 1U2RA 1KI6B 3H0KA 3OESA 4DC9A 1Z2CA 4KN4C 2GDJA 1E3MA 2KHIA 1GKUB 5HPYB 2CCKA 5IT9c 4YMUA 5HTKA 1Z06A 2EVWX 4AKHA 1L7VC 4Q19A 1LF0A 3AFPA 4GOJA 5IP7H 4X8HA 5EE5B 4JOIC 3H1TA 4U5XA 3HOUH 2IHYA 4IPDA 3LLMA 4IDNA 4A3BG 5H68A 2B63H 4GN3B 2ZJAA 3SYLA 1QHNA 1WBDA 4JBWA 1YJNA 2A6HC 1E22A 3PUYA 3KKMA 1M7GA 2EFGA 1K73C 4A3GG 1N6KA 4BZPA 2A69D 1Q7YC 1IY0A 1VECA 3BH7A 4LYHA 4AKEA 3T06B 1KAWA 1YEZA 3LAWA 1G6OA 1ZRHA 1K8GA 3LLUA 1Z7TA 2WKPA 3RZDH 2R7DA 3LW8A 1R8QA 4R9UC 4HSEA 3SJAA 1W5TA 4HUQB 3BFXA 4D80A 5DN6A 1N0WA 4RJLA 1SKYE 1GKYA 1A2BA 4B43A 3VQTA 2WMNB 2VW9A 2UXCQ 3I73A 1FUKA 1PYBA 1E9CA 4BY7G 1JR3D 4H1UA 1MRNA 1U0HC 4ZCLA 3O47A 4CVNA 5M3FG 5FOTA 1CJTC 2AXPA 4NCJA 3ADBA 1YI2A 3R8FA 3CCJA 4K8OA 4DV7L 4B2PA 4AY2A 1S3OA 2MO1A 3HU2A 3VKHA 4KV9A 3UDGA 3K0XA 3JVUA 1Z2AA 2BJWA 1P62B 4DV1Q 4AKGA 4Q47A 1XZPA 1TQ2A 4FI3C 4F92B 3I4NG 4AI6A 4OONA 4A3EH 4WZBE 3AEVA 1G16A 4ZV4A 3TH5A 1U99A 4M1YA 2XXAB 1MJCA 1ZU4A 2VSFA 5EE9A 1GAJA 4C0QC 3T1OA 2EFDB 4IJHA 1VQIA 5D3MB 4XTCS 5GROA 1JAHA 1E24A 1SQ5A 4DR3L 4JI1L 4A3IG 2DFKB 2ONKA 5DH9A 1BVSA 1H9SB 2YOFA 3KDFB 4FMDF 2OAQ1 1H9JA 1FX0A 2VPPA 1U9IA 4MRNA 3U4QB 1E1TA 1A5TA 1SVMA 5FR1A 1KO5A 2W0MA 2ZJOA 1OH5A 5FLMG 2BBSA 4JBXA 3ZZTA 5TXGA 4JI0Q 2ZITA 3GJXC 1E99A 2A5YB 1K83H 3BXZA 1QBKC 4QL5A 1XPOA 3T1VA 4AQYQ 1KI2A 2GESA 3A4MA 4Q4HB 1P60A 1V1QA 2K4KA 2AHOA 2K14A 4BZQA 3SS8A 3OOCA 4OX9Q 3KB2A 2BE5D 4LYAA 3UMRA 5JJLA 3DHWC 1NY5A 1ZD8A 3LW7A 2H57A 3W3ZB 4Y52H 1I4LD 2UUBQ 4JSYA 1H8HD 1OB2A 2ALYB 2IS1A 4KVGA 5CK4A 2ZS7A 2PNRC 3CM0A 4A3IH 1FP7A 2G3YA 4BFWA 2L5TA 5KYKA 1W7AA 4IOJA 3S2DH 4I1UA 1S9DA 5CYPA 3HWSA 1UKZA 3AQ4A 3FB4A 3GEEA 3K0FA 4KMUC 1KI4A 2FSFA 2Q2IA 2GVZC 3GLHE 5LB4A 1GUGA 4TYWA 3RNUA 4HEJA 2ZJBA 3I2ZA 2Q9BA 2B29A 2KBFA 2V4DA 3J81c 4R4IA 5DIFA 5JRZA 2CHQA 3SI7A 2GJSA 4AYXA 1KRSA 4J0QA 3GP8A 1U5KA 1Z6XA 2PMKA 1L1OC 2DUDA 3OEHA 4P4UA 3WHLA 1BYUA 1TADA 4LGMA 3I32A 3SHWA 3VTKA 4A3KG 3CF0A 3R20A 4DBLC 4LNQA 4JI7L 1P75A 1BDOA 3PO2G 3MRSA 5ELOA 1HE8B 2Z4SA 2MSCB 4X8LA 4RKEA 3TW8B 3U7EB 1KK1A 2F3RA 4F4IA 1VQ9A 1YZLA 2XTZA 1DS6A 3ND8A 3W1GA 5JEAJ 2IYTA 4MKFA 2YTXA 4JI8Q 5IYBH 3K0CC 4HAVA 4PZ8A 1AZSC 1JAIA 1LY1A 3GMTA 1COWA 2JA8H 1US8B 4DPGA 4DR4L 5CB8A 4CEHB 4GDFA 1NMFA 1HURA 5M3MG 2JASA 2OFXA 2QAGC 1OSNA 3MUFA 3S2HH 1W48A 2VP0A 3QXJA 4JLDA 4B3FX 621PA 4DK0A 1KJWA 3NDPA 1WI5A 1KGDA 3QNUA 2WB1G 1FGUA 2HHHL 1Z0AA 1F2UB 3IBYA 1K5GA 3CNLA 4OL0A 4UNNA 1YZKA 2MNAA 3EARA 4BRUA 4DLVA 3U4VA 2OBNA 1SXJA 4H9GA 2JIZA 2ZRMA 2F1JA 4LHXA 2UXCL 1JPNA 1Z22A 421PA 3Q8XB 1XD2A 3PO2H 4A9AA 2F9MA 2BIFA 3CPFA 3Q72A 4RD2A 2FGKA 5DNYB 2D62A 2O8CB 4R4OA 1NMYA 3EPKA 2GJKA 3QKRA 1II0A 2NO9A 3A4NA 4TN1A 2PCJA 2ERYA 5C4MA 4CEIB 2O8EB 2GVAA 1IY2A 1VHLA 1NJFA 2VP5A 3GPLA 2QQEA 4JLOA 4DV1L 2ZJ8A 4OO1H 3VDYA 1VIAA 4YXWD 5G3ZA 4A3FG 4LFBQ 3TIFA 5CB6A 3U44A 1E98A 3AM1A 1GVNB 5K36G 2VEDA 2BKEA 2ZVPX 3LDAA 3A8KE 3S1RH 2C95A 1XBTA 4MGYR 2VHTA 5CK5A 4A8JA 2GHIA 3REFA 3E9HA 4HB4A 2H92A 5G40A 3QXHA 4IQZA 1LACA 1E0JA 1X55A 3TUZC 1MO5A 1E9AA 1OW3B 1BYIA 4HIKA 2ORIA 2ZRAA 2PL3A 3PJRA 2VZAA 2QUZA 1CUKA 4ZCIA 3Q5EA 5AJWA 2NPFA 2GXSA 4UNQA 4TYNA 4X62Q 1D9XA 4MYUA 1A62A 3EPHA 1N25A 4MKHA 4WIAA 3WRXC 2V9PA 4JI0L 3B1VA 1EFRA 3SNHA 3I56A 4JL6A 2G88A 3IQWA 5GJVC 2O5IC 5DI3A 3AVTA 2GN5A 1AKEA 1E96A 2D7CA 3AVPA 3ZD6A 3AUYA 3BC1A 1MKHA 4ZKDA 3PCOB 1GO3E 1XTKA 2C04A 3FDIA 2LXKA 2E2IH 4AQYL 1JEDA 1ZM3A 3OAAA 4YMSA 4LC0A 2WM9B 4I1SA 3RRMA 2WWGA 4HZUA 1DGSA 2GXUA 2NPIA 4JS0A 1OIWA 4OX9L 1NKTA 3QPUA 1OH6A 5KOYA 1IW7C 2YOHA 3ZIAD 3PUZA 3BZKA 3MJHA 2DGYA 2WAXA 4DCSA 5L3SB 1NN3A 4JYCA 2UUBL 1IXSB 2BHRA 4OK5A 1U8YA 3LGJA 1S9HA 4C2TA 3AVVA 3CRW1 1IJFA 1GUSA 3CF5A 2UU9L 1TKWB 1NN1A 4GZMA 221PA 3BDOA 4GMXA 1Q1QA 1W47A 3TR5A 3OEED 3JAMi 2ZR0A 2IUSA 5EP2A 2CFMA 2R65A 4TLEA 3KQHA 4Q5IA 4HDOB 3VR3A 2C9CA 4LWZA 1CSQA 4DB2A 4BA2I 5JCZA 1ZKOA 3U50C 1ZUNB 5DN6D 3BZCA 521PA 3DLLA 3A1WA 5FOVA 4DV2Q 3UMFA 6Q21A 3PUVA 4II7A 1FZQA 2IX3A 2W00A 2EFCB 2R92H 1RJ9B 4JYAQ 2IYXA 4B3TQ 2LCFA 1HZ9A 4PQYA 5BXQC 4R4TA 5GJBA 3KQNA 1JJCB 5C4XH 1VCNA 2R6DA 2ZTDA 1K8RA 1VCIA 3L0IB 4IEEA 4TMZA 3WYAA 2GBLA 1GKIA 2QP4A 2RHMA 3VHLB 1D2MA 2ZRJA 3TRZA 1T3HA 2I5LX 4CT5A 2O8BB 3PR1A 3NEYA 2BOVA 4B76A 2CHGA 4G5OA 3KF8B 1O87A 5SZJA 3L2OB 3W9YA 1GJXA 3SGIA 1W4RA 3R8CA 2L15A 2GNOA 4JI8L 2C9OA 2VA8A 3ZZUA 4HJAA 1GM5A 2WHXA 1W4BA 4LJ9A 4A4IA 2BC9A 1NF3A 1GSIA 2WSSA 1X1RA 1VYUA 5J40A 1LTLA 4DLSA 2NTYC 4PHFA 4GNXB 1DOAA 3KQUA 2WWWA 4JI6Q 3I72A 4IO9A 3DOFA 3RR5A 3VMFA 4GS3A 5JSZB 2J7KA 1TEXA 2RGNA 1J2JA 3GLGB 1YZTA 1CU1A 1ZINA 3LA6A 4PSKA 4BFTA 1LFDB 3RN2A 2Z0MA 1IJEA 4LUCA 3ULJA 4KYIB 4LJZC 4TL6A 4MYTA 2YJTD 3X1YA 1MKYA 1X1SA 1EFTA 1XTIA 1SN8A 1IQPA 1GG2A 2PPBC 4JC0A 2Y0SG 1NLYA 1P61B 2FZ4A 2GK6A 4CW7A 4C7OA 1KHTA 4JI5L 1II8B 4JT2A 2VL6A 5GAGC 2YOGA 1N5LA 4DEXA 1EUJA 4WJ3M 1ZC4A 4DSNA 1WE2A 1XFAA 1Q1ZA 4LJ8A 4JLVA 4ZKEA 1I4TD 4AYBE 2O0HA 2HT1A 3FMFA 1R0XA 1XF9A 2A1AA 4LFBL 4W5JA 1RRFA 5EQTA 2LKCA 1WMSA 3K0EA 4U00A 5AUNB 4Q1EA 3CAMA 4Q1CA 4WOPA 3NVAA 1X8LA 1CULC 4GKJQ 3FPPA 2KBNA 4B75A 3C14C 2Q6TA 5GVSA 3FE2A 2P5TB 1ETUA 3M0EA 1K0RA 4HATA 3VX3A 3I8XA 4QBFA 1FQJA 2JA6G 1Z6AA 3PSIA 2OBLA 3EG5A 2FA9A 5HKKA 3I4LA 2ZRDA 4I1VA 3GLIA 4YCUA 4G1UC 1EWRA 2B8FA 2E1RA 2GAOA 1P2SA 2GZDA 3ASZA 1G1MA 4LHZA 2G6BA 2QM8A 3K9HA 3ZQ6A 4X62L 2CL6X 4LJ5A 3W6NA 2WKRA 1F2TB 2R6CA 4Y7NH 3CMEA 4LV5B 2WPDA 4ZPXA 4D4LA 2HF9A 4IVPA 1E2DA 3UDXA 2JEBI 1G17A 1QRAA 4YCWA 2CCZA 4IOAA 1W36C 1YBYA 1XJCA 5TY0A 1DD2A 2DPXA 4LJ4A 4DNIA 3MWKA 3WNBA 3CPHA 1BKBA 4BBSG 2R62A 4MGIR 1E69A 1I6HH 3FMIA 2G77B 2ZRLA 5C0XG 1V8QA 2FJUA 4QRHA 2OTJA 3RRNA 4PTLA 2KBEA 3RSOA 3PG5A 2AX4A 3FWYA 2JA6H 4KLZA 4EPVA 4KI0A 3THYA 1A1VA 1U0LA 3TJZA 4DT1B 3P4YA 4OQMA 1AJEA 2FNAA 4TVAB 2UUAQ 3PIOA 1D5CA 1TF5A 3GJ3A 1KSHA 2C2HA 4MUAA 5AJZA 1GL6A 3CCSA 1Z08A 1ZNYA 1KXLA 2GJAA 2QI9C 4RD4A 1QVAA 1U81A 3S1AB 3AKDA 2RCNA 1PH5A 1R8SA 2Q9CA 2F52A 3S15H 4O2LA 1SXJD 3PEWA 2PQAB 2JIZD 1Q3TA 1L1OB 1XMQQ 2EJFC 1K8MA 1VQHA 4ON9A 4A0FA 4X65L 3KTAA 1EQRA 2OQKA 1BBWA 1H8EA 1KKMA 2I3BA 4GZYC 4OYHA 3B7GA 4ZDIA 4A3JG 1HEIA 2AK3A 1X86B 1E2MA 3IPXA 5ELNA 4JYAL 1AQYA 1E2LA 4B3TL 1E4VA 2K50A 2QQ0A 3GTJH 2R7ZH 2EDGA 1KHIA 3BORA 4M1TA 2FX3A 3VKWA 3I5YA 2AKYA 3AGPA 2XJ4A 1YNXA 4R4CA 1QJOA 1R0YA 2BKUA 4YDSA 2B7BA 3RDPA 1XX6A 4ERNA 1OXVA 2BBOA 1I4DD 2PEZA 3C4JA 4TTPA 4DR2L 3PFIA 2ZRIA 3U7HB 4M1OA 2XTIA 4OHVA 2NN6H 5FI1B 1E1RD 4EJSC 2ZJQA 2QAGB 4S2EA 2YC4C 3NENA 2ZE7A 4NYIQ 3NEJA 4IFDJ 5BWMA 4I99A 4XWAA 4XVQA 2RF4A 3V00A 5JS8A 2IXEA 4M1KA 4P4TA 4POFA 4HLUA 4BLSA 4EKDA 3UDIA 1SXJE 1CKNA 4Q7KA 4BASA 5JI3E 4M21A 5M04A 2IYYA 3HGBA 1SVWA 4OI4A 1OKKA 3X1XA 4JI6L 4MGKR 3U3MA 3KF6A 4A3JH 3LY5A 4QXAA 4G7ZC 2DNEA 1UWVA 3K1JA 4NB3A 3A1TA 2VLIA 1EFRD 4DJTA 4FMDB 3TSZA 5UKDA 3K80C 1HQCA 4WXRA 2GVBA 4P71A 5DHAA 2P6RA 2Z0SA 1PLJA 1G19A 2HYDA 1Y8OB 3R7WB 1CKEA 1CIPA 1Q90A 1XEWX 3OAAD 4BFXA 5KSZA 4A3DG 3ZS9A 4X66L 5FPYA 1M7HA 3AGQA 5P21A 4BWYA 2PCLA 4B47A 3DM3A 4DSUA 2CJWB 4BBRH 2VO1A 4DDTA 1NTGA 5CJPA 3P4XA 2RHQB 4QL3A 2QEXA 3T34A 1N0VC 5GADC 1NBMA 2P5SA 1E2EA 1E79D 1S3SA 3JZAA 5KPDA 2IUUA 2ZS9A 2B6HA 2R9VA 3HOVG 4GKJL 4HAYA 3ZYCA 4TZ6A 1VQ6A 1DTSA 5C4GB 3WHKA 1E32A 4N1AA 1FMJA 1X6VA 1YRBA 2AKAB 5KSOA 4LC1A 4A3CH 4GP6A 5TVKA 2X2FA 1JR3A 4TQUS 3WP1B 5G3YA 1XCGB 3KFXA 1EOVA 1DAMA 3DDCA 2ODWA 1BBUA 4G01B 1E9DA 3NC0C 3FKQA 5JBQA 5TARA 3KJGA 2FXQA 4JZKA 2BCJQ 2E75C 1E1QA 2GRJA 4WBSA 1KY3A 4PC1A 4QNMA 4BLRA 4P73A 5KDDA 1T0JB 4DR6Q 3REGA 2ZTEA 5F9FA 4NYMQ 1G8PA 1KTVA 3Q8DA 4L16A 1UF9A 4JLKA 1N6NA 3SJZA 5IYDH 1OPXA 4Q4JA 5H1SE 4A0RA 1KMQA 1ESMA 2YHSA 1HYQA 1CXZA 1NVVR 2V6JA 4MKIA 1HNWQ 5FTKA 4LFAQ 3TVTA 2IWHA 4BE7B 3X1DA 1RFLA 4QY7A 2WWHA 1OIVA 1T3SA 4AURA 1KI6A 3H86A 4Y0VA 3F2DA 2IEZA 1ASYA 4XSHA 1FP6A 3GFTA 5AUOB 1RE0A 2BM0A 3FYHA 2NZHA 4MQBA 4N0EA 4KO8A 4YWLA 1MH1A 2UUAL 2EYQA 2C77A 2NOAA 2XGTA 2Z83A 1G4AE 1P6XA 1Z07A 3B1ZA 4QGHA 4JI2Q 5DSZA 2CQOA 3ONWA 3QQ5A 4KVAA 1NN5A 2W58A 3KKQA 1CR4A 2GETA 3LVRE 1PH9A 1LS1A 5A4JA 1FW6A 5SZKB 2WIAA 2ZE8A 3CB4A 5DE3A 4A1FA 1E2VA 1VQEA 4YWMA 2ODBA 3B85A 4TMVA 4XOIA 3RS2A 3GCGA 1SVKA 1UBEA 2GCNA 3EZ6A 3FFAA 3H84A 3Q9LA 4CEIA 2V3CC 1OXTA 4JK1C 2JQOA 2OILA 4XD7A 1KD1C 3J80i 1XMJA 1H8HA 5KTYA 3IEVA 2ZEJA 1N33Q 2PZEA 3QPVA 1FJGQ 5HCIA 1DAEA 3L0OA 4IEIA 1RYHA 4AH6A 1HR0W 2BBWA 2XJ9A 4OHXA 5EE1A 2J0UA 2LMCB 4MITA 4MYHA 1G5TA 1A2KC 1E2NA 5HE9A 1JNYA 3VR2A 1GD7A 3PV0A 2FN4A 3GTKH 1E4YA 3TVDA 4W9MC 1IW7D 3GLFB 1TU4A 4G5QA 1NN0A 1SMXA 1CLUA 3CH5A 5HKKD 3K0SA 2D0PA 2JLSA 2CVFA 2XXAA 3F0TA 3PF4A 1TNDA 1N6LA 5IRCD 1TWFH 1V43A 2PMZE 2QM7A 4L8JA 4LBZA 3GTQH 5FJ8H 4DR1Q 2CWAA 4PAMA 1YQTA 4CF7A 4DLXA 5D3MA 2WPDD 3NEMA 3DO6A 4Q1AA 2XX3A 2E2JH 4BFSA 1H9SA 3D4RA 3KDFA 4DUGA 4G7OC 2QT1A 1T0HB 3DKPA 2PJRA 1EWQA 3L43A 2R6AA 5KUTA 3U4QA 1XNRL 4JLMA 3B1XA 5F2EA 1P73A 3G0HA 3RLOA 2CKZB 3QY0A 4JLPA 4HJ5A 4YCVA 1WDTA 4AYTA 2OT3B 4C0KA 2XB2A 1S2MA 1YE8A 1LW7A 3AYHB 1DADA 3F3YA 1XXHB 1N34Q 4Q1FA 3HFZB 1DG1G 3BAFA 4TTQA 4RFVA 3CC4A 4PR0A 3U60B 2ZQ5A 4HDQB 2BA1A 4O0MA 4LFCQ 4OWXB 3GTGH 1IXRC 1FNNA 2YZ2A 4Q4HA 1G7TA 5EP3A 3GLIE 4IOLA 3CPJB 1P7CA 4TQAA 1XPRA 1Z6GA 2H1LA 1QG2A 2V1XA 3KZ1E 4NL4H 1UEBA 2VF7A 3W5OA 4XSGA 5FLXc 4C3ZA 1R10A 1ZBDA 2WBLC 4JVNA 3TQCA 2ZRFA 3D3QA 4OWWB 1G3RA 3RNLA 1I6VC 1UBGA 2E9SA 2J7PD 4IDQA 1A7JA 1XNQL 5SZHB 3W6PA 2A5GA 3IGFA 1H8ED 1W36B 2JE6I 3VR6A 4DK1A 2K5UA 1OXSC 5FL7A 2GKSA 4QKQA 1ZCBA 2QBYB 4JG2A 4DR6L 1IN6A 2FFBA 4R2HA 3U7GA 1TQ6A 2Q21A 4NONA 3I61A 1QDEA 2WWXA 4YXWA 2K5NA 3LX8A 1VQKA 1CRPA 3G48A 2Q3FA 3AKCA 1H9KA 4KJZA 1HTWA 1KO4A 1AE2A 1N8RC 4R2IA 1H65A 1HNWL 2A7QA 1OFIA 2OV2A 3KXKA 3ZVNA 2D3WA 3HOUG 4D25A 3D31A 1TF2A 2ZREA 2B63G 1UE7A 1E2JA 1QHHB 1W0KD 5C3EH 4KYUA 3NBYC 3K70C 5AUPB 3ZVMA 4WA7A 2P6UA 2ASEA 3W8NA 1MABB 5E7JA 1WQ1R 1Q20A 1ZP6A 4ZIRB 4NCIA 3QBTA 1KKLA 4M1MA 1I3QH 2WAQG 1GIAA 3KFVA 1B9NA 5FOUA 5K8LA 3FFBA 4JI2L 5F3WB 5GJCA 4PV1C 1US8A 2QE7D 3PO3G 1J8MF 4Q02A 4CEHA 3LX5A 1XEXA 2JGNA 5C44H 3DVLA 3SEAA 3K8YA 2ERXA 2O52A 4QIWE 3KLWA 3AV0B 2PZGA 3K0AB 4BFZA 4ME3A 1F2UA 5C18A 2OBMA 5B64A 2MSDB 4FIDA 2DWOA 4LF6Q 4NYIR 2FSHA 4EJSB 2NO6A 3BH0A 3PEVA 3ZIAA 2VQSA 5LDDC 1V5WA 4HR7B 1YKSA 4N3NA 2LXJA 2YWFA 4DRZA 2A5FA 4LJYA 4Q4AA 2F1MA 3CH4B 1N33L 2LSSA 2RHSB 2ZTCA 4A3EG 1FJGL 2ORVA 3RANA 3VHXA 1ZM7A 4OHYA 1NBMD 2IF2A 2O8CA 1E6CA 1ANKA 4PC7A 3K53A 4KLNA 5EE3A 2O8EA 3OEEA 3M3YH 1KDTA 5J4HA 1JR6A 1DO0A 4IOMA 4B73A 3PO3H 2EFHB 4PSAA 1D8TA 4R98A 4EPXA 1QF9A 3K8AA 2NIPA 4GNXC 4HJ8A 4LF5Q 4DR5L 2FFQA 2VRWA 3CRVA 3GJ5A 1ZM2A 4GPTA 4RD0A 1JPJA 1CEEA 3QKSB 1G8GA 2V7QA 2AUKA 4LOAA 4F38A 1E1QD 4NXNQ 1HH4A 2JJ1A 3B82A 1E2GA 3M1IA 3CC7A 5AJYA 2YWEA 3P20A 4B3GA 2QMUA 2XITA 2CBZA 3HOYH 1HTPA 2WB1E 3CXCA 2UXBQ 1DO2A 2I1VB 4HAZA 4I81A 5LMUL 4QGFA 4YONB 3WYGA 3QPWA 3T5DA 3MWJA 2MMGA 1IY1A 5LD2C 3HOWH 2JJ2A 2RGBA 3TQYA 1NBME 2P3SA 2DWPA 1DELA 4LBWA 4LY6A 4X6AH 1IN4A 3I1FA 4IW3B 3A1UA 4A82A 1N6OA 2ID0A 2GK7A 5HGQA 3QE0A 3JZMA 5E3HA 3O8DA 4Q03A 1N34L 3CP0A 1XPUA 2VIIA 3THWB 2OLKA 4G5GA 1JR3E 4C0BA 4OHWA 1TQDA 4LX0A 2JAQA 2YYZA 1GL7A 1T5EA 4QGAA 3RS7A 2N42A 5FTNA 1OHHD 2QP3A 3IEUA 2GAAA 3OFNA 2ZIAA 2ZJYA 4OHZA 4D0NA 5BW8A 1NMXA 2EXDA 3EAQA 3RC3A 4B3BA 5L3SA 3A8TA 1A63A 4TYYA 4LUOA 1RRGA 5BN3A 2F1RA 3CPEA 4ZDKA 2AWOA 5H1YA 4PZ7A 1QVFA 3WMFA 5C46F 3N2IA 4D26A 1VQDA 3OZXA 2V54A 4U02A 4BFYA 4B74A 1P8LA 3A74A 1PH2A 2YWHA 3LWUA 1JALA 1GZSA 1M6NA 2C03A 2EYUA 2ZAMA 1OFHA 4Q66C 1V9PA 2QTVB 2NMVA 4EUNA 1HNZQ 4IVRA 5B58C 3U3KA 1R5OA 5G53C 2F1HA 1WBBA 1WA5A 4XD7D 1KZ7B 1XMSA 1TWHH 2QRZA 3CCVA 1KO1A 5HZKA 1VG8A 2G1KA 2AR7A 3KL4A 1RJ9A 5FBLB 1OJLA 4CT4B 3AVYA 2NVQH 1WP9A 3S24A 1EFCA 2G0NA 4OGQC 2ZYVX 3OIYA 3OTOQ 3M9BA 4E03A 1OH8A 3DOEA 3TAHA 5GAHC 1O3YA 1ZM9A 4GNKA 5IYBG 1NY4A 1JT8A 1BIFA 1KI1A 3BIFA 2JA8G 3S17H 4JOIA 3DMDA 4TSFD 2KCMA 1XB2A 3U61B 3TZUA 4GLVB 1IBLQ 3AH8A 3QXSA 2O8BA 1BOFA 4QBHA 4DV6Q 4R7ZA 1W44A 3CW2A 4JLJA 4PPQA 3K7UC 3LNCA 1IN8A 2DB3A 3GJ0A 4MH0R 2BMEA 2JK8A 2H7VA 2K5HA 1BMFD 2F9LA 3SN6A 2WWIA 3B5JA 1SFOH 4Y0AA 1MT0A 1RL2A 4DIDA 4DXAA 2CE2X 4GKKQ 3EPLA 3T5GA 1Y1WH 1YHAA 1VPLA 3B60A 4JL5A 4DUGD 3FHTA 2IL1A 4F4CA 1AZTA 4BQSA 4CDGA 4NE2A 5K8IA 3HU3A 3QUSA 3R9IA 3BG3A 4A0HA 3GLGA 1E9EA 4LF6L 2GXQA 4FWTA 5F98A 3OW7A 1E9SA 4P72A 1NIJA 1JB1A 1RW4A 5IE8A 5D3QA 4A3MH 4OO1G 4ITRC 1A82A 1S96A 5AJVB 1M34E 4FXPA 1WCMH 1G21E 2ZETA 2O8DA 4APVA 1D6JA 1N0UA 4C3HH 3T35A 1DXMA 3FPAA 5M5YH 5FL3A 2VS1A 3NBHB 4D0LB 2DBYA 5B30A 1AH9A 3W1BA 3IIKA 2A68D 3KX2A 1GNQA 5FTJA 3CCLA 5AJXA 4BY1H 3GJ7A 2VF8A 1WYDA 4DUYQ 2DY1A 4V03A 4LF5L 2CHVA 2L0XA 5A0FA 1GUNA 2FPKA 1KC8C 4LYFA 2D2CC 2HIVA 2ZPTX 4PZYA 3L8ZA 1HH2P 1I2MA 1Y8NB 4KKTA 3GJ8A 3WXMA 1S72A 2EQSA 3HOZH 2OE2A 5HR5A 3CR8A 5AJ3Q 4NXNL 1CRQA 4LHWA 5FL7D 3SFVA 4HB0A 4DV3Q 2G83A 1PYSB 5FH9A 4J15A 1HNXQ 2UXBL 1LTQA 1XNJA 1NY6A 4RSGA 1TU3A 3L0SA 3UWKA 3I5XA 4URUR 4CEJA 3TUIC 1L0WA 2HT6A 3OIWA 4BXXH 3PEUA 5C0XJ 1E1RA 4TMKA 4TL7A 4D4KA 1EX7A 1ZVQA 1VQOA 1F2TA 1W5SA 3CQZH 1CFMA 3K9NA 4JI4Q 1E2PA 2ZSAA 4LBVA 2RGDA 4YMWA 1Z6HA 1Z8FA 4OQNA 3AF0A 4G7HC 3EZ2A 4UXIA 4A2WA 4C0SA 4ZI2A 3WWVA 1QUQB 4IPCA 4RCNA 2ZI7A 1IBKQ 1Y1VH 3ND9A 5FPTA 2YKGA 1E94E 4TMWA 3U7FB 4QBIA 4GN5A 1X56A 4O2DA 1X54A 3ASYA 1Y8PB 2H18A 2QMOA 4KSCA 4L4UA 4DHEA 2OCEA 3O8RA 2OCBA 3PCRB 1E2HA 4DT1A 3AP1A 4PG3A 2HQLA 1Q8KA 4A93H 1ESNA 4OJKA 3TNFA 3TSWA 4CIDA 1OB5A 2R92G 2NN6I 3MD0A 3SOPA 3CLVA 2ZRCA 1GRQA 4B2LA 3I55A 5C4XG 2V55B 2VHCA 3RS4A 2OZEA 3DL0A 1RIFA 1HNZL 2NVTH 4TWZA 2PQAA 3UXMA 1L1OA 3RABA 3W90A 5L3RA 3THXB 3VNUA 3IO5A 1F6BA 4DEYA 2OCPA 1RKBA 2I0QA 1FR3A 2PEYA 3ADKA 2CL0X 1E79A 3K70B 4UKDA 3SQWA 1XU4A 3RRYA 3RLFA 1RVDA 3M4YA 1W4AA 1YZUA 2CCJA 2OAP1 4FCWA 2IYSA 2EQBA 3STBD 2AD1A 2JLQA 2LWIA 3BOSA 4GZLA 2IF0A 3AB9A 2GCPA 4Q7LA 3X2SA 2DNCA 1SKQA 4FCVA 4GLXA 1YZQA 2ZS8A 4DV6L 2ZYTX 1AQUA 4DV0Q 2MQHA 2QMEA 4LCBA 1M90C 1EWIA 4KODA 4P0TA 1NLZA 1HZCA 1QG4A 4QQBX 3E2IA 1UADA 1GUAA 1T91A 4EFMA 2GJ9A 2V7QD 3TBKA 1L4UA 5LPNA 2F3IA 4EPYA 2V1CC 1B7YB 2WOJA 3B6YA 1R0ZA 2JJ1D 4GKKL 3B1WA 4DCVA 1FOEB 3PUXA 3T1YQ 2E87A 5BN4A 5CLLA 5KU1A 4PPGA 2O8FB 5IHPA 1D8LA 4AIMA 2FMXA 3OHMA 5E7NA 2KE5A 2AHOB 2YC2C 3KLRA 1Q21A 3RZOH 2UXDQ 3IILA 4HDCA 2WJHA 2WP8J 1MIUA 2JJ2D 3HKZG 2VQFQ 3DM9B 4OI2A 3FMPB 1I94Q 1MO3A 3C16C 3K09C 3VR1A 2IHEA 1G8YA 4W7SA 2WMOB 2A6ED 1E3PA 1N3BA 1DEKA 4UJ3A 1W0JA 1EX6A 2PLRA 4HI0E 1Z47A 1XTSA 1N6PA 5CITA 3IHWA 3R7WA 4NH0A 4WJ4A 3W5IA 4Z1MA 4NCHA 4C3IH 2CK3D 5JEDA 4DZZA 4V0LA 4ZDJA 5DLQE 2IYQA 1XMVA 2CNWA 2PX0A 2CJWA 2JA5H 2D5DA 1G5RA 3I8SA 3OFND 3QVVA 3EZ7A 3AF3A 5AK0A 5EZ6B 1VQFA 1YZGA 1JXMA 5DYIA 1Q82C 4WAUA 3CRKC 2J45A 3G71A 2Z6KC 2WJGA 4DUYL 3TSOA 4LF4Q 2QENA 2OFOA 2VP6A 2VP4A 3W6OA 3WYFA 2EJGC 3Q7PA 3JAMc 1YZNA 2K32A 3F2BA 1FQKA 1ONBA 4LJ6A 3G6EA 4AWXA 2AFIE 4DV4Q 1WXQA 3EW9A 4OQFA 5LD2B 1PUIA 4HUTA 1SROA 1ZD9A 1ZJ6A 4YC7A 4DV3L 4LHYA 5FTLA 1Q0UA 1YITA 1HNXL 2DFNA 2JXMB 4JLNA 3WMEA 2JLVA 3TR0A 3H0GH 1KNXA 3IIJA 3LQRA 5LBIA 2F1IA 4C0AC 2WZQA 1EFWA 4B71A 4NDZA 2FOLA 2ZE6A 5EAYA 2XTNA 2I5HA 3U3RA 1EXMA 3I4OA 1OF1A 1NSTA 4KLKA 3A58B 1SR3A 4HB2A 1NVUQ 5KNDA 4DSTA 4KKSA 4GOPC 4BECA 2DWQA 2VBCA 4QHYA 4RZUA 3H2YA 3ZJYC 2O5VA 1HUQA 1EGAA 2QF7A 3HJNA 2HF8A 1CKOA 1B70B 1K9MC 1AK2A 3EC2A 4XJXA 2A6HD 3T12A 1IBKL 1KK0A 5IWAQ 1BKDR 1J8YF 3ECCA 5FBWB 3TGPA 1PH8A 1EK0A 1GL9B 1R5BA 2C98A 3L7ZC 1HZAA 1J70A 2IXGA 3I7FA 1R2QA 2FEMA 2FSIA 1NMGA 4IDHA 4AD8A 5HCNA 5J5CA 2JEOA 1PV4A 5JZVA 3UMSA 1T3LA 3OIUA 4MA4A 1YHQA 3QKRB 1PFSA 2R7ZG 5KNCA 1IOZA 4IOKA 3LFUA 3PEYA 2D0OA 5E7IA 4DLRA 4Z51A 2HCBA 1JB7A 3U44B 2XB4A 5C1BA 3U5ZB 2NVXH 3CNNA 2NN6G 1XD8A 1PH4A 2PT5A 1RC8A 3AVUA 2XOKA 2KHJA 1JBKA 1GHKA 2G9NA 1E7ZA 1GUTA 4KFTA 1KIMA 4BRWA 4WVFA 1Q1EA 5EXXA 1NL3A 2N46A 2QGZA 3F2CA 5CM9C 4DK6C 3GFPA 1FL9A 1KZGB 2J0SA 3GFOA 1S40A 3F8TA 3CX8A 4QHSA 1J5EQ 4U7DA 2A69C 5JEAH 3LBHA 4LRWA 4GFDA 1OXXK 5J4VA 2J7PA 2EWWA 4LI0A 3IRBA 4DV2L 2EFEB 1NG9A 3MCAA 2NO0A 4YHHQ 2WAYA 2JJQA 1ZUIA 4GI7A 4LJAA 4KAXA 4URYR 3SZRA 1TWCH 2A30A 1EWHA 3M7NA 2QP9X 4BEJA 2X1VA 1QHIA 5DI3B 2K33A 5FOXA 4F7WA 3GLGE 2MSEB 1VF5C 3MLEA 1VCMA 4KFUA 3B1YA 4HIMA 2FGJA 2WOOA 3SJCA 4XWKA 5KPJA 3ZD7A 1P9RA 4K81B 1XWIA 2NO1A 2IBMA 3WDNA 4A3LH 1UM8A 4Q9IA 4HZUB 2D4HA 2E74C 1KRTA 2UXDL 1SMYC 4I4LA 2VQFL 4FWIB 4TYPA 4US0R 4YMTA 3U6BA 3QSYA 4FCTA 5JJIA 2FDCA 3UE1A 3BD9A 2OXRA 2D2EA 4BBRG 4JLBA 4RD1A 1K8AC 1FUUA 1W0KA 1B23P 4DUZQ 3S16H 3BU2A 1PA6A 1G8FA 1KK3A 2Q2UA 1U94A 2X77A 4OKSA 2GF9A 2JJ8A 1B0UA 4GL2A 1NI3A 1UDXA 4HAUA 2V8OA 3CR7A 3U2QA 4JBKA 1R4AA 4KU4A 1QVRA 2QE7A 5FFMA 1KJZA 2J1LA 5CYOA 2BV3A 1A6XA 2A78A 4A3CG 2FFHA 1Z6YA 4PHGA 5G41A 3E0EA 2GCOA 2XNDD 4PPFA 4Q7JB 1PH6A 3CONA 1HA3A 1AGRA 5DISB 2N78A 4LF4L 1T6NA 2V4ZA 3LO5A 3Q7QA 2QMHA 4ESHA 5KSYA 2BA0A 2HJGA 1EYGA 1G291 4GT1A 4HIDA 1KSGA 4E09A 4DV4L 2WKQA 1N32Q 3IUYA 1XCMA 3GTPH 1RYFA 1Z29A 3MXNB 3SC3A 2VYFA 4L5RC 4POGA 2QSZA 2AN9A 3O8BA 3CRLC 1G8HA 1AN0A 5IYDG 1KIXA 1CJMA 4AYBG 2BE5C 4QC2A 1O78A 1E2QA 5F9HA 2PI2A 4PC3A 1ZUHA 4IFEA 3KQLA 2JLYA 4PX9A 2E76C 2K75A 2ZXUA 2VP9A 2W6IA 1YNNC 1MO4A 2HJVA 4TKOB 3R9WA 3AF1A 1S1MA 2OCYC 1GOTA 1G20E 1ZAKA 2Q3MA 3MAAC 5EP4A 4UNPA 1L8QA 5JFGA 2QSYA 4TYQA 3U3OA 2BBTA 2FU5C 1NVXQ 4QJ3A 2KA7A 2IT1A 2FG5A 1ZU5A 3BK7A 2GZHA 1KI9A 3KKNA 2PMDA 5ELXA 3CUEF 2Q2TA 1FTNA 2PCFB 1QHHA 4O25A 3AVOA 5FPHA 3KOJA 1N6RA 4BZXA 5FPKA 3KKOA 1CTMA 3CRRA 1VS0A 1WFQA 1Y3AA 5KSPA 4ZIRA 4A36A 4Q00A 4UPAA 3K81C 5FUVA 1TTTA 5KDLA 4K0KQ 2VL7A 1XD9A 3EIEA 5L3QA 1VMAA 3TEHB 4TMXA 4NXMQ 1G3IA 4PO8A 4FN5A 4MRSA 2KCCA 1T9HA 1KMHA 5JJKA 5JI2E 4H02A 2XTMA 3PGZA 2ZM6Q 1W0JD 2FPLA 3CWZA 3K0AA 4QJ5A 4XVUA 5IF9A 3V4FA 2A9KA 3G5UA 1X65A 2REBA 3QEJA 4A2PA 4UP7A 4C2MH 1GITA 4Z1MD 3M4OH 4LJ7A 2KB0A 1OHHA 1YU9A 2ORWA 3CCQA 2REOA 2ZM5A 2WWFA 4IHQA 2GTPA 2CNWD 1AS2A 2HXYA 3AF2A 5LMNQ 3E1SA 3FKSD 5M5XH 1MJEA 4URXR 1YRAA 1XMQL 1TX4B 4PO9A 3IQXA 4IXNA 3KUCA 4Q9KA 1Z6TA 1XZQA 5GQOA 2O5JC 3I4MH 5FJ8G 1Q86C 1YR8A 4L5QA 1M7BA 4M4SA 4NCNA 2DFLA 4O3MA 5IP9H 4EQ6B 1QHXA 1X3GA 1VQMA 4HUQA 4PQFA 1LABA 1PH3A 2WAQE 1KI7A 3IDQA 1FL0A 5IDVA 2HLDD 2ZRHA 3H94A 2F4VQ 1BH2A 2ZRGA 3A37A 2C8VA 4YLGA 2CCGA 3EZFA 1Q1BA 3EX7C 1IONA 1Q81C 1P5ZB 2Q8IB 4TLDA 2FZLA 2AMCB 1TUIA 1YVDA 2Q2HA 3BB4A 4V0KA 4KHPQ 2ZJRA 4M9ZA 1X3SA 1G41A 4TLBA 4Q9JA 1R6BX 4DUZL 3GEIA 3LNNA 4IKEA 2W0SA 4Z8XA 2W6JD 3MWLA 1VF7A 1HJPA 1OLOA 1KO8A 2ATXA 1VIYA 4DKAC 3A7AB 4NKRA 3RC8A 1CF4A 2NZJA 2XAUA 5BQ5A 2ES2A 4RD6A 3TLXA 4DLZA 4ZI3A 4X64Q 2J0QA 2OFWA 5BYKA 1BMFA 1VDZA 1EG7A 4TLAA 1NBWA 3DKVA 4DCUA 2ZR9A 3THWA 5AWFC 2RGEA 2TMKA 4ZCMA 5JHHB 5IYCG 1PVOA 4CGZA 3NIBA 4B3DA 3T56B 5DGXA 1UKEA 4WXPA 1E1OA 5EZ5A 5EE0A 4A2QA 4CEJB 5SZIA 2JATA 4EPRA 4QM7A 1N32L 3AP2A 3ER0A 2R93H 3WNCA 4AC9A 1W1WA 4DCTA 2A2ZA 3EQLC 1PH7A 4JVLA 1UPTA 2KJQA 1Y69U 5CDFA 3MFYA 4GOPB 5FBVB 4C0HA 2EU8A 3BWDD 4RMFA 4TLCA 3M4QA 3VU9B 1KO7A 4C0LA 2OUKA 2Z5FA 2YWGA 5DI9A 4GOXA 1AM4D 2XOKD 2CVHA 2H16A 3UG6A 1K5DA 3C5CA 2BCGY 4C3JH 1HE1C 4ILEA 3SBDA 4B3MQ 2CWPA 1DG3A 1YZ6A 1ZW6A 1NJIC 2GVDC 3J80c 4JJKA 1VQJA 5C3EG 1DAGA 1ZIPA 4JLAA 4KN7C 1CKMA 3EA5A 1OH7A 2JA7H 5C4JH 1OXUA 1VG9B 2QN6A 1K8OA 5IYCH 1RRPA 2ZI4A 1QHYA 1KI3A 1M8PA 1D2NA 4LV8B 4ARZB 1NIPA 5A5GA 4ZO4A 1F48A 5TV2A 821PA 2IYWA 1GNPA 2J5XA 3HR7A 3P1JA 3CRMA 1GUOA 1SKYB 2RAPA 2KWIA 1Z0DA 3ERSX 4DR3Q 1UE6A 1UE5A 4JI1Q 1PLLA 1YR7A 2BEKA 2F6RA 2K5VA 3PIPA 3CCRA 1T4GA 1II9A 2UKDA 3UDFA 5C44G 1VQ4A 2F43B 4BLQA 5EJEA 4IOCA 4X8OA 1RPZA 3AQQA 3FKIG 4PSVA 4Q48A 3NELA 4K46A 4ASUD 2FFAA 2LKDA 4RFSB 1XRJA 5JWHA 3VA7A 4K0KL 2CMKA 2A5JA 1I2DA 1MOZA 3D0FA 4EQ5A 1TWAH 2BJVA 4NXML 2IA5A 4LHVA 5JRJA 2WSMA 2V1UA 3SQXA 1KYIA 2QPAA 4LFAL 2ZJPA 3QKUA 1ASZA 3ULPA 4KFRA 4AIIA 3ZLJA 4MDFA 2QG6A 1WCV1 3T61A 2B21A 3L82B 3ZZ0A 4JL8A 1G7SA 1Z83A 3X1ZA 5IK2D 1IM2A 2ZU0C 3FVQA 4JBMA 3NXSA 4D0GA 2NQ2C 1W2GA 1YIJA 3JVVA 2XZLA 1X3FA 1M2OB 3M6AA 2ZANA 4A92A
chains in the Genus database with same CATH superfamily
3Q5DA 1L2TA 2BMDA 3PQDA 4IFDH 4LSZA 1ENCA 4HLCA 1U2SA 1UDAA 3CNHA 2AYZA 2JHFA 5AKLA 2ZAIA 1HDIA 2X6QA 2H4JA 1T6ZA 3SG0A 1DXYA 1UWKA 1TJNA 3GGOA 3D8GA 4Z7QB 3NHBA 4EENA 1XXHE 1YIDA 5FUMA 1WRBA 4GXQA 2VUMH 2XCLA 2Q0HA 2IUTA 2YCLA 3HB7A 2WZBA 3TMAA 1AD2A 3JWEA 1EUDA 3S1NH 4RMJA 2YWCA 2IRWA 5IT4A 4BB6A 4Q21A 4B3ML 1IE3A 5KNBA 3F6PA 1PNVA 1A9PA 1XMIA 1CUEA 2OHVA 1U8AA 1PJ3A 3J81i 4D81A 5HF5A 5IY0A 2NYAA 3A1VA 1KPIA 4PONA 1AURA 4TV8F 4O4LB 5K20A 121PA 3TL3A 4ZRNA 1IPEA 3EXAA 3QG1A 6ADHA 1VZ3A 2ZJ4A 4D82A 3H16A 4AP6A 4N5NA 3AEQA 1J90A 4QUKA 3H3VI 1UFQA 4ZZIA 3RNOA 3V97A 3U5TA 4RDHA 4G5SA 1M0WA 4UUMA 1CDDA 1QZGA 3F1KA 4WT7A 4P4SB 1V9CA 3AC0A 4EHFA 1TEZA 2VPIA 1WOCA 4DDWA 3VYUB 4D3XA 5G3LD 2J0EA 4EVRA 1NLFA 1SVSA 2GUWA 1R4MA 1RBZA 1Y6RA 4J1QA 2VUIB 3AL0C 1TQ4A 4NKLA 3TREA 4GI3A 2C3PA 1XROA 4LUZA 1DLJA 1YFZA 4PG6A 5ALSA 5DBFA 1K3FA 1R5JA 3C0KA 1C48A 4JP1A 3VV3A 3VSBA 2XNDA 5M3MH 1RVV1 5JAPA 2R68A 2BCOA 3WMGA 3ZWQA 2VTVA 3AW8A 3GAFA 1ZCAA 2ICAA 4CQLA 1ESFA 1YS2X 3JYHA 1N36Q 3OF2A 4X6XA 5L7WA 1C7QA 1N8SA 1M33A 4X3TA 2XWPA 4HTHA 3HP4A 3MCTA 4F72A 2QAGA 1PH1A 2C61A 1HFJA 1P3JA 4OB7A 1FGBD 5BSMA 2EIXA 2BSXA 2QXYA 1PVDA 3H3XA 3D8BA 3RRFA 3EZNA 1Z4JA 1TK3A 3I4MB 3I04M 3EA0A 2JEAI 1K3RA 4N47A 2DTDA 2TECE 2PMBA 4L8YA 5JY6A 2RSOA 5C8DA 4BO2A 1M83A 2HR1A 2Z9CA 3DW3X 2QJWA 2B8TA 4OLAA 3J81L 2GERA 3G6KA 2QNRA 4K9MA 2ROQA 1RWKA 3ANMA 3PIIA 4EFLA 3WGVA 2J0VA 4N7JA 3FUTA 1XZ8A 4EP1A 2VZEA 2PH7A 2C35B 3W7VA 3I62A 3EOBI 5TVGA 2V5UA 1PZNA 2XE6A 4AXBA 1XKLA 2JFBA 1S4QA 4CZ2A 3SAJA 1XD2B 1HNWB 3MJRA 4DUPA 3DB1A 4I2NA 3QVLA 3Q24A 3CLSC 3O0TA 3QOLA 1DWPA 4OH7A 1UBKS 4Y9TA 1JDBB 2WUVA 1FUEA 5AVTA 5A3RA 1KDPA 3L8MA 4P75A 3O4FA 4M9QA 1CJUC 4IGKA 1IVYA 4YT8A 2QTHA 3UA4A 4GLFA 2W83A 3NE5B 1L7BA 3E9EA 2PVSA 4GM0A 2NGRA 5FT9A 4ISBA 3CCEA 3TW4A 4B3CA 3AKYA 4OAQA 1ICWA 2IH2A 2WHRA 4YJHB 2IY9A 3KL2A 4ACAA 5REQB 2HMAA 1LBTA 2QD2A 1NONA 2JLAA 3S44A 4MA0A 4RF3A 1BXGB 1YJ9A 2PAFA 4RFSA 4RDXA 5JH7F 4TL8A 2A5DA 3MMPA 3JYOA 2IVFA 5JY1A 4A3BB 3KYCB 2RH5A 4MRVA 4IRUB 3C15C 4C7OB 2ZJ5A 3TQSA 3F3MA 1GPUA 5C6AA 3P9KA 3DMNA 4MGZR 4PC2A 2J9FA 3NFYA 1J5EL 2QT0A 2UVQA 1LLDA 2QPTA 1ZH8A 2RQXA 3C7AA 2QVXX 3TQTA 2OWOA 4YRDA 2ZBVA 2B4AA 1E20A 2V59A 2Q5QA 2EBFX 3RFTA 3SIWA 2UZ0A 4URFA 3VPDA 1PW7A 3W8RA 3R7LA 3G4SA 1AZLA 1I36A 3Q85A 5H3HA 4UOEA 1B93A 3JWIA 1T8SA 4OXPA 3SY8A 2HO5A 4YQEA 3NBZC 2ACVA 2Y0DA 2Z57A 3J7ZC 1RPNA 3HKEB 4UFOA 5BRNA 3PDCA 1JHPA 4I6GA 3MXOA 1VTKA 1Y42X 3K35A 2M00A 2Q3HA 4LVOA 4A3KB 1F4LA 2B78A 3NUCA 3GEHA 5EKXA 2VDPB 4KHZA 3GPBA 5CURA 5E7QA 2ASBA 1UH5A 4OFXA 2O2YA 2ZU6A 1P72A 4GWGA 5DNVA 1E92A 2BFPA 2C83A 3UWDA 3VYWA 4U68A 3QA3E 1G2TA 2W6NA 2REXB 3H15A 3TDMA 2Q3EA 3L8YA 4JV5L 4YAOA 3TTVA 5LNK1 2QMZA 3NEAA 2I4IA 4HG2A 4FGSA 5C8ZA 3FTFA 3E70C 3F8SA 3FPKA 1TT5B 2WILA 2EW1A 4DC9A 4OUKX 3IBFA 2B63H 4M0FA 1YJNA 3IP3A 1DJOA 3BH7A 1HHVA 4F3YA 3F6SA 4WNAA 1W5TA 2K2QB 4MTLA 1BNCA 4FJ1A 3URMA 2AG8A 4FZ5A 3PRYA 2I6SA 1JAZA 1U0HC 3IJPA 1DONA 1CJTC 1SZJG 4F2DA 1Z2AA 4R5MA 1TQ2A 2J5QA 3M6WA 1BCPC 3AEVA 4PLYA 5DCLA 4O2BB 1AEXA 1HWYA 1Q95A 3AXSA 4BFCA 5DH9A 1BVSA 3OUTA 3KDFB 5FXMA 5CLHA 3U4QB 4DAOA 5FLMG 4JBXA 5IKPA 2QB5A 3N39C 1Q14A 2ZFUA 1RWPA 1P60A 4BZQA 2C9MA 1Y8QB 2WUDA 2JIQA 5CK4A 3C3WA 2L5TA 2D1FA 3AHCA 3EDYA 5CDTA 5KYIA 3U31A 3IQIX 4A27A 3AQ4A 2ZJBA 3CUVA 1FDOA 2KBFA 1I01A 2RG1A 4U2KA 2RCYA 4MZXA 3WO0A 1A88A 2NVWA 1WIWA 3SHWA 4F4IA 4WFJA 1DS6A 4OHPA 2AX3A 4HAVA 2JA8H 2E49A 4PIVA 1ID1A 2DH6A 2MNAA 3EARA 3WWEA 3BMNB 4AZWA 4TKVA 3IQFA 1JPNA 2I91A 4C7MA 1MQ8B 3VR6D 5EJFA 3LUAA 4TN1A 1RAAA 3JAWA 4IUNA 3L7JA 5G3ZA 3AM1A 3ZG6A 2HREA 3OQJA 3UT6A 2Y6UA 4A8JA 4E70A 1R8XA 5G40A 2G9VA 3TRJA 1MO5A 1PTOB 4HIKA 1XALA 1VPTA 2OBXA 1XYYA 4TGLA 3UBMA 4S1PA 3V3KA 3ZD6A 4YHHB 3ZVKA 4FNAA 4O4JF 5JLAA 1N77A 4JENA 2WAXA 3H9QA 1M67A 1QG0A 3DAHA 1G9SA 3W2TA 4W9NC 1RXYA 3V7NA 3BDOA 1C4KA 3D0KA 4DB2A 5ITVA 3A1WA 2W00A 2KHZA 3PIO3 4DNQA 4ND6A 2GBLA 4NMWA 2E2HB 2XQVA 4CT5A 1JH8A 1BX1A 2A1UA 4S1TA 4EF4A 2L15A 1FDRA 2HCIA 1QAMA 4R9VA 1CF2O 4GNXB 3AHDA 4ICIA 5K4AA 1J2JA 4FPXA 3NOXA 1YZTA 1JLSA 4MS3B 5FNZA 3HUUA 4MYTA 1N5LA 5IWCA 3K6RA 4P58A 4JLVA 5IH3A 5CFOA 4P83A 2UAGA 5M2QA 2HB6A 2XYVA 4Q1CA 4BN0A 3OFVA 2O8NA 2GA4B 4HQ6A 5I7AA 3K7EA 3VSAA 3ZQ6A 2GZDA 2B1QA 2G6BA 1KMIY 2J3IA 1U4RA 4Y7NH 2VOJA 3GUCA 4HYTA 1ZGAA 5EL0A 1YVPA 1PWEA 1TO2E 1Y7TA 3C70A 2C5GA 3GFQA 3PG5A 3ICCA 1EYZA 5JXIA 4DT1B 2I1LA 1TF5A 3PIOA 1QRTA 1I33A 2QI9C 4RD4A 2OR3A 3ZHVA 4YV1A 2CUTA 4MQMA 2P77A 1EE2A 4OYHA 3RODA 1EWTA 3KSAC 1E2MA 3FHLA 5JXJA 2BGMA 3BORA 4KSYA 3NP9A 2ECPA 1E1RD 2X5NA 2Q2QA 1DC8A 3NRJA 4JI6L 5FP0A 4QXAA 4NB3A 5AW3A 3TIVA 3RZDB 2GVBA 2YJ3A 3PHLA 2RAVA 4M0KA 1QIFA 4R1NA 3KD3A 3A6JA 5B7PA 3M3HA 2HU5A 2IUUA 1WV1A 3DDCA 4OXRA 4WKCA 1MFPA 5KNBH 3KT8A 5KDDA 2IE0A 1XRPA 3Q0EA 4Z5XA 3HYSA 1ZGZA 3AWIA 3GA7A 3TO5A 1WNTA 1Z7BA 5FTKA 2QCPX 2GJ4A 3HDVA 4Y0VA 3F2DA 3E9RA 1ASYA 3GFTA 2RVLA 2NQ8A 2NZHA 4N0EA 2QV7A 5H59A 4UPVA 4QGHA 4WN9B 3INRA 3G23A 2B8NA 2V6FA 3PXXA 4KFCA 4J1SA 1CD5A 3V6LA 3ZYYX 4HXEB 4DR4B 1HRJA 4BO5A 2O2SA 3L06A 3VA5A 1KD1C 4YYEA 2HHHB 3VDXA 3MQFA 1NKVA 1GNLA 2E6UX 5LL6X 2XJ9A 4OHXA 1GSHA 4EY3A 1JHAA 3UN1A 3GTKH 1CEQA 1EK1A 2PT6A 5FJ8H 2D2IA 4DLXA 4DUGA 2D0DA 2R96A 4TKUB 5ALRA 5CT6A 4HJ5A 2UZ1A 3IKTA 1G6KA 1XXHB 2GFIA 3BAFA 4WLFA 2FX2A 2ONJA 4LFCQ 2YZ2A 1LPBB 4TQAA 4XEUA 1QG2A 3VVCA 4OWWB 1YV9A 2K5UA 1RTOA 4EGVA 4PGMA 2QBYB 4L5IA 2EDCA 2PTGA 1XVTA 1H0RA 2WWXA 3LX8A 1E2BA 2E2IB 2A7QA 3NGXA 1OFIA 1DFGA 3NBYC 3VM6A 5AUPB 3PKZA 1EY6A 1YBHA 2JGJA 3D64A 4EG4A 1KYTA 2QR5A 4RHTA 2H52A 1GUDA 1LLRD 2CVPA 4WFIA 1Y6QA 4KJOA 4ME3A 1F2UA 1WHSA 1GFZA 2D1SA 3PEVA 1MAAA 3OX1A 5HP4A 3KDPA 5KWIA 3CH4B 3GRRA 4ZVVA 5DT2A 1Q8IA 1D8TA 1LW6E 2F0OA 1SD1A 2NIPA 2PZLA 4DR5L 4RD0A 2FEXA 3EOAI 4DGZA 3BRQA 5AJYA 3UGJA 2UXBQ 3FJYA 1W8DA 1QTQA 3ZDZB 2H00A 1IY1A 2RGBA 1WMEA 1I4GA 1M73E 5KQPA 4KY7A 5U9CA 5E3HA 3THWB 2OLKA 5TPWB 3KKEA 3FB1A 3BRCA 3CPEA 4U02A 4GBJA 4DCGA 1R27A 5AMXA 1WBBA 4ES6A 1KO1A 4D97A 1YR3A 2D00A 1OJLA 4ONEA 2G0NA 5CW2A 2WNHA 1ZM9A 4Q9DA 1TVKA 3VR2D 1RRKA 1IBLQ 4R7ZA 1RLJA 4OHOA 4OM8A 2W90A 2F9LA 1WZUA 3EPLA 1H6AA 1O0BA 5T4EA 5E4WC 3BG3A 4XQEA 1NRIA 1NIJA 4WRRA 1QFSA 3ZJUA 2NXWA 1U4NA 4JODA 2D2XA 5EHZA 5EHXA 4DCMA 1S4MA 2C2BA 5BSHA 4B3JA 2FMUA 2VJBA 4IEFB 4Q4DA 2Q4TA 1KC8C 1Y8NB 3GJ8A 5LYJF 3NBAA 4FKZA 2GFQA 2BFCA 3ISVA 5CCDA 4DV3Q 1FDTA 3GAZA 4TL7A 2YDYA 1VQOA 1CFMA 4JI4Q 1E2PA 3S81A 1JPVA 2HPHA 2J3LA 2BTOA 4NH4A 1BVUA 2A88A 5D8DA 4YUYA 1N0HA 1S3FA 3IT0A 1E6UA 1PRYA 4J2OA 2Z6AA 4ZK2A 4A93H 4BNGA 3T5PA 3VI3B 5AP9A 2VHCA 2K5QA 4OXYA 5ELCA 4EVIA 1LBEA 4TWJA 2I0QA 1FR3A 1ZJZA 4J90A 2DUNA 3V48A 3IPCA 2C2KA 3E5SA 1ZXTA 2NUTB 4KNYA 4QIHA 4LCBA 3X3MA 4M83A 5ICGA 5DOVA 2V7QD 3H11B 1GYQA 2LS01 3OMGA 1PTOD 1F38A 2C7RA 3PUXA 2O5EA 2WF6A 2PUHA 2L11A 5ESRA 1GFWA 4JB0A 2YC2C 1SUEA 3FMPB 4F12A 3K31A 1RXCA 2I6FA 5TR9A 1W0JA 3ILHA 4NH0A 3LKZA 1L5KA 5JEDA 5DLQE 1UDBA 2PX0A 1D5MC 2O59A 1Q82C 2WJGA 1VCHA 1NJ5A 3TTWA 3KT6A 3AXTA 3G6EA 4OQFA 3RF6A 3K0KA 1QE6A 4AX8A 1RC0A 2FOLA 3N6XA 2ZWVA 3OKCA 1OF1A 3LCCA 5FYQA 5K3OA 3QOXA 2O2ZA 1YS6A 5K0FA 3KEMA 5JVG3 4YX9A 1I32A 1JILA 4AN0A 1JEAA 2IYFA 2WIGA 3ZWAA 2FEMA 2FCAA 5HCNA 1V9SA 2OCLA 2R7ZG 3QO2A 1RRMA 4YALA 2NUPA 2D0OA 2RH9B 2JFWA 1XD8A 1WPGA 4GMFA 2I4NA 2UUCB 3GFPA 1WQ3A 3SKXA 4XQJA 2JBAA 1BXKA 4EA9A 2RK4A 4GI7A 1ZUIA 4ZT2A 1XZHA 1BO0A 5FV7A 3NVKI 2HBQA 3IV9A 3GLGE 3CH7A 3BMOA 5HBRA 3MRTA 3UE1A 4KV7A 4UASA 5F33A 3S16H 3D6HA 1QSGA 3E7FA 4OKSA 2CEKA 4GL2A 3U2QA 3VPHA 1NVAA 5J59A 3QMMA 4KWIA 3JQFA 3A26A 5DISB 4RK7A 3VBEA 4CMGA 1K6XA 3I9MA 5KSYA 2HMVA 1V1MB 4HIDA 1X14A 3GTPH 1I14A 1D5XC 3HB0A 2B2XA 2FZEA 4PS0A 1E2QA 2PI2A 1SE2A 1E4OA 4UZFA 3N3AC 2E76C 4MKXA 2JP1A 2OCYC 5EXEA 1OXMA 1XQ1A 2QSYA 1NVXQ 4OHBA 2KA7A 1ZD2P 3NM4A 4AS3A 4F6RB 5JC8A 3T9BA 5LQJA 2YXNA 4CM4A 1DKPA 2WU0A 3VYTA 3O6VA 1IHDA 3G5UA 1X65A 3GFVA 2RC5A 4EUHA 2ORWA 2CNWD 2B2WC 2R1TA 4Y0NA 1AGXA 4GU5A 4UC0A 1EP1B 2O5JC 4MULA 1EGHA 4L5QA 3GLKA 4Q3KA 3OEYA 1PXUA 1V8BA 4G8JA 1WSBA 4XDZA 3SSOA 3KXPA 4LIPD 2AMCB 1QJCA 1QV9A 10MHA 2WE8A 3U81A 3TQQA 2H9AA 4DVJA 3RC8A 2ES2A 3R7SA 1QIMA 3JYQA 5DCWA 1NBWA 4F8YA 3SX2A 3QUTA 1LUAA 3FTNA 5IABA 3K6OA 3GUYA 5JSFA 4C0LA 3OCZA 2Z5FA 2A0UA 3ZQ4A 2BCGY 4C3JH 1GY8A 5LA6F 2HDWA 821PA 3HR7A 5A6SB 1T5DX 1D1KA 4HX2A 5AJTA 2LKDA 1DQNA 3BFJA 3UJ8A 1CZGA 1IUPA 3KPUA 3D3NA 1MOZA 3D0FA 1B3AA 2ZJPA 2V0GA 1WCV1 5AM0A 4RGBA 4D0GA 5EUBA 3TW8A 3IOCA 1H69A 4HT3B 3EPRA 3DO5A 4RHCA 5LMNL 2JI9A 3I2YX 3DAYA 1VYVA 3AEUA 4QLOA 1CT1D 4JI8B 2LDBA 4K05A 3F5FA 3IL2A 1J0CA 1HDRA 1J2RA 1OBFO 1YXMA 3LV8A 4RKYA 4ACBA 3MG9A 1ZNXA 4H3VA 2FOXA 4TSKA 2HIXA 1ZVMA 3S40A 1KL9A 3D6WA 3KAPA 1E9FA 3IVMA 1M1KC 4Y9RA 2GBIA 3RRXA 3JR3A 4YS6A 3LUBA 3MWDB 2MOKA 1RQXA 4MR8A 5LZ8A 2B98A 1B8AA 3MA0A 4OBEA 4J1TC 3ROZA 1ZLXA 2HDMA 4B7AA 5FPSA 4QLAA 1UBNA 1HT1E 3QYFA 4AYWA 3DTVB 1MO6A 4KXVA 5DNAA 1TZCA 5LMZA 1CK4A 1VM6A 1UMKA 3L8DA 4QULA 5DO9A 1N0IA 2DQYA 1A9QA 3ZJ5A 2CMHA 5K99A 2Q7XA 4OWTB 1MX1A 5CV8A 2PL5A 3VAAA 2DBZA 5L8VA 4EHDA 1Y1WG 1EMDA 4BY7H 3C3CA 2IHVA 2WTXA 2OT2A 3PNOA 4U2CA 4DIBA 3HU5A 3PITA 1O7LA 1XXGA 5KRUA 3AVQA 1S8FA 1R0RE 2XYHA 3BE6A 1JDBC 1BF4A 3W06A 1LTRD 2NAFA 3VJRA 3RMHA 1S2LA 4HEDA 2XQJA 2ECKA 3GYGA 1KAEA 1EP9A 4P3YA 1ELOA 1J06A 1M0SA 5TQVA 4MJLA 1KH3A 1XU7A 3HKSA 2ZUBA 3DOOA 1VHJA 3DWAA 4QOSA 4TVKA 1NPTO 4FEAA 1UJ5A 2B8EA 2GEUA 1BFKA 4D44A 4HJXA 3PQ7A 3FSGD 1IYJB 3ANTA 2OPHA 2Y0SE 5ELBA 4RTSA 3VHXB 1DIOB 3RBAA 4BASA 3BB3A 1QGED 1X9NA 1L4YA 2NZ8A 1PT8A 2MUYA 1V8OA 3S7ZA 5I9IA 3WMWA 4EDHA 4R1QA 2ZWMA 5JMWA 4QD3A 3UH1A 1XRSB 2CLEB 1TYEB 4B33A 1MJFA 5EHQA 1WB9A 4ZHQA 4JCOA 1OGYA 3LTNC 4HCEA 2ZJ3A 2QLNA 4XPIA 1OIXA 3L5OA 4UM7A 2WUGA 4R1MA 4JLSA 4HWRA 2QRVB 3ZWXA 1XZLA 4PXYA 1ADYA 3LBIA 4HN4B 5EJ6A 5FQNA 2Z5GA 5TS3A 4KITB 2D8MA 5E95A 5BT8A 1KEKA 4L0QA 5AOCA 1W5BA 3QZUA 2H63A 4DR2Q 3PXAA 4LK2A 3UXYA 2HWYA 4CMJA 2JFQA 2IFTA 5J2TB 1JWUD 4EY5A 1C8VB 1I4WA 4BPBA 2FMFA 2O2XA 1XELA 5HM8A 5H9WA 4MHEA 4B35A 3GBPA 3NTOA 3HCOA 1CY1A 2W6JA 1PHJA 1SXTA 2Y1GA 3GAMA