2AWOA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
372
structure length
372
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 372
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awoA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awoA01
2OBLA 1J90A 1W36B 3R20A 1OHHD 3KJOA 1K3RA 3CD6A 3KDSE 4Y0VA 4CIDA 2F43B 1QUQB 4TYWA 5EE1A 4C4PA 4RSGA 2ODBA 4V0KA 821PA 1KQSA 1XTJA 3N70A 2NN6G 2ZXUA 4L5BA 4FD2A 4ON9A 4CVNA 5IP7H 1MV5A 4RFSB 3WNDA 4TQUS 1XEWY 3WMEA 1Y8OB 3S1MH 3EZ6A 1U9IC 1E7ZA 2D2EA 4JJZA 4LHXA 4UNSA 4B75A 3OTOL 3I7FA 1PUIA 3SBDA 2OCYC 2PNHA 1OB5A 4A3CH 1OFIA 3KKQA 2ZJ8A 5C44H 1U2RA 4Q5IA 4OX9Q 1G3UA 4LF4Q 1VKJA 1SVLA 4DEXA 4EJSC 2ZUDA 4Z54A 4CGZA 3REFA 2VQEL 1YRBA 3P32A 1FMLA 2Y0SG 1KIXA 1WFQA 1E0JA 3B9PA 2Z4SA 5M3MH 1OFUX 3EX7C 3LGJA 2R92G 4FWIB 4JKYA 1XMQL 2ATVA 4JBJA 1IXRC 2VYFA 3L43A 4G1UC 4OO1I 2HJGA 2IHEA 1IW7C 4NKRA 3T1OA 2YV5A 3MEFA 1T8UA 1B70B 1Y14B 4QY7A 2QI9C 1U94A 3OEHA 1EQRA 2UU9L 4P71A 3D8BA 4MA4A 2ZSEA 5GJCA 1EFCA 3B1YA 3BBPA 3ZD7A 4V0NA 1MKHA 3RR5A 3LVRE 3VR1A 2DYKA 4RD2A 1XTDA 4PZ8A 4GOXA 1EFTA 3QXHA 3NDBB 3F3YA 4LK2A 4B6FA 1E1QA 2IBMA 2RGBA 5DN6A 2Q8IB 1ZUNB 1S1MA 5FOSA 1HT1E 3K80C 4XVQA 1UBGA 4D4LA 5KSZA 1I50H 1ESNA 1FQJA 5HCIA 4A6XA 3EZ9A 2PMZE 2GDJA 1XDBA 5C18A 2J7KA 1VQKA 1G41A 5H68A 2B92A 2QA4A 2C98A 1W46A 2IHFA 2ID0A 1X1SA 4ESHA 1RC8A 1JQJC 2KBFA 2IEYA 5M5WH 4G7OC 4N1AA 3T12A 5K36H 4LF6L 2NZHA 4GZYC 2N3SA 3GEEA 2WSSA 3SYLA 4ZCIA 3EPLA 4L5RC 3RC3A 2EU8A 1V1QA 3QXXA 3UANA 4UXHA 4JBWA 5KNDA 4P75A 3BZKA 1GG2A 3B1WA 3LQRA 4C0BA 2PBRA 1P2SA 1SMXA 1WYDA 1K8RA 2CE2X 4MGKR 2ZTDA 3CRLC 4DUGD 2A6EC 5GAGC 4A3GH 4FIDA 3MGCA 3IQWA 3TIFA 2CVFA 2FWRA 1IM2A 1ZD1A 5C3EH 4TKOB 1MIUA 2DWQA 4HAYA 4D4KA 4JYAL 1VMAA 3QXCA 1KO7A 4IFEA 4O2RA 2EW1A 1JJGA 5L3QA 2NO1A 2HCJB 1KKMA 1U0HC 4DXAA 1D9XA 4QBFA 1G3QA 1WP9A 2YOFA 2D62A 4WW0A 3ZQJA 4HIMA 1TUIA 3G5UA 3CRMA 4NP6A 1NI3A 4OQFA 4QG7A 4BFYA 2JLXA 1KKLA 1OYYA 4AURA 1IBKL 1NMFA 5FUVA 4KHZA 2K75A 1DAMA 4L15A 1XNRL 2F43A 5J4HA 4FWTA 1QUQA 1D9ZA 1I2DA 2VP9A 4GN3B 1O7IA 2K50A 1DS6A 5E7IA 4B47A 5EXTA 4OKSA 1EOVA 2XNDD 4ZI3A 4NH0A 4RFSA 2QGNA 4LJYA 3AGQA 4QNRA 5EE3A 3LY5A 2BHRA 1Z8FA 3WHLA 4AQYQ 1UKVY 4KFUA 3U4QB 1ZBDA 1LACA 4C2TA 2ZUCA 2QEXA 3M1IA 2AL7A 2IHYA 3P26A 3AKEA 1CP2A 2R6FA 2AUJD 4B3TQ 4KYUA 5FLMH 2J5XA 2VNUD 1AE3A 3DDCA 5E7NA 2RHMA 4LJ5A 4P4SB 5FPTA 5JCZA 2IS4A 4GP7A 1WXQA 2ZE7A 4TL9A 3K70B 1JR6A 5IP7G 3QKRB 1R0YA 2VL7A 3FDIA 1BMFA 1FGUA 4QHTA 1IBMQ 4B3BA 4LF5L 4DDTA 2ONKA 1KL9A 3C15C 1QBKC 1J6QA 3B2EA 2NVTH 4RG1A 4POFA 4X64L 1G1MA 1OV4A 5CYOA 2Z4RA 5C44G 3KL4A 3PG5A 2VQFQ 2PCFB 2BVNA 2E75C 3NBFA 1TQ2A 5CJ2A 4BQSA 3RSLA 3SYNA 1TF2A 1EFHA 2HLDA 1IOZA 4Q4AB 2GVZC 3M4QA 2I4IA 1WB9A 5M3MG 2JA6H 1VQOA 4DV1Q 4LJAA 1XCGB 4Q4HB 2DN8A 4AH6A 1VG0B 4PTLA 1VQCA 3AVUA 1XTIA 5DHFA 3O8DA 4CT4B 2ZRHA 2A8VA 4OI4A 5J4LA 2MMCA 4DV4Q 2BIFA 1FTSA 1I4DD 1NY5A 5JRJA 1G5TA 3V4RA 4JI6L 1T5LA 4HI0E 2O8EA 1Z7TA 3CCRA 3VAAA 2AKYA 3UATA 1G6HA 1RYHA 4BFZA 2Z0SA 4P73A 4M9SA 2PMKA 1AM4D 3DEFA 3E9IA 4FINA 1UE1A 2FA9A 2ZJQA 2QE7D 3HR7A 4XWOA 3IPYA 5SZKB 5LMUL 3TEHB 1Q86C 1NMGA 2K33A 2I1VB 4Y0AA 1ZNYA 4DV0L 4A3LH 2A5GA 1ZM9A 1KO4A 2MSCB 4IW3B 5HPYB 1E1QD 2EQBA 4IDPA 4R2IA 4PZYA 2EQSA 4PO9A 1CRPA 2AX4A 4HATA 3DVLA 4W7SA 4DLZA 3HOWG 5FJ8G 1Q3TA 4BASA 5K36G 3E5HA 2IUSA 4DK3C 3A1SA 4AYBG 4N0EA 3I62A 3U60B 1EFWA 2OBNA 3VU9B 3U7FB 2IUUA 2XZOA 1CR2A 1VQ4A 2QA5A 4GLAC 3QF7A 4TYQA 4ESVA 1RYFA 1S3SA 4DV2L 2MSEB 4BRWA 3K7AH 3FPAA 4C0SA 2QMUA 2X2FA 3FFBA 3EW9A 3MD0A 1CI3M 5C3EG 4NCKA 4RZ2A 3RHFA 1ZNZA 2ZJRA 4S35A 1GITA 5AUOB 4GZLA 3FKIH 3OW2A 2OE2A 2NVXH 1M7HA 2VSXA 4FN5A 2PEZA 1T3SA 1B7YB 3GTJH 3CF6R 3F5FA 4TL7A 4V0OA 3RS4A 1ETUA 1EX7A 1CIPA 2YTYA 3U4QA 5FPHA 1V5WA 3M7NA 3A74A 2IYWA 3ETLA 3B7GA 1WJJA 4P74A 4OHYA 2H57A 1P2TA 5HZHA 1Z6AA 4P4SA 1HY3A 3JZAA 3K81C 3SFZA 3FHTA 3EBEA 3E0EA 2UUAQ 1CKNB 1G4AE 1N5JA 1W0JD 2QL6A 2X8AA 3NH9A 2D06A 3QKRA 4MRPA 4A76A 3ZGXA 2A6HC 3J7A5 2FFHA 2IX3A 2J0SA 2EFDB 1IYUA 2DY1A 3VFDA 4JLOA 3W1BA 1L2TA 2OG2A 3EASA 1N6NA 3R7WA 1C7YA 3BAFA 5FLXc 1D6JA 4JIMA 2C78A 1KAGA 2AKWB 3BU2A 3HYRA 3J81k 5CK5A 2HT1A 3K8YA 3KDFB 4ERNA 3EC2A 3CP0A 4Q4HA 4IFDH 3KYHC 3I8XA 3PXGA 4G5RA 4DNTB 1KD1C 3BD9A 3WY9A 1E2MA 1EX6A 1P73A 4BEJA 4JI2L 2FG5A 1IN5A 1GD7A 4W5WA 2F55A 1KDRA 1MT0A 2OAQ1 1DAKA 3W6PA 5C2JB 2JAQA 1BMFD 2KI5A 3NBXX 3SI7A 2PX0A 3KKMA 5H1YA 2JA6G 1YJ5A 4JBMA 1L8QA 3AFPA 4X8LA 4JI4Q 2WBLC 5JEEA 2DPXA 4DEYA 2UXBL 3AP2A 5SZJA 2WOJA 3CNNA 3CF0A 4UKDA 4OWWB 4UY8C 1JEEA 1P4SA 1A2KC 2V4DA 4DV6L 1KDOA 1XU4A 2IYYA 4ASUD 4D0GA 1HZ9A 1PH2A 1HE1C 4IQZA 2I5MX 1HQYE 1W47A 1XZPA 3EZ2A 4A3FH 3FGNA 1OW3B 4H9GA 3WYAA 1CJMA 5B58C 4BPBA 5CB6A 2ODNA 2QN6A 4MKGA 5AJ3Q 2GJKA 3GTQH 1G18A 5C0XH 2IYSA 2AUKA 1HR0W 4QXAA 2B29A 4B6EA 4DLVA 2AFIE 1E2EA 2WWWA 3VU9A 4D26A 2B8TA 1CFMA 2BM0A 2GCOB 2BDOA 1E22A 2C2HA 4LJ4A 2D5DA 4A3LG 2NIPA 3ZZTA 1A63A 4C0LA 4KMUC 1US8B 2ZJPA 3CIOA 5FTKA 4H44C 3T1YL 1Q1BA 1IAQA 2EVWX 4BLRA 2ZRDA 1FJGQ 3L82B 1LNZA 3E9HA 3CCUA 1HTWA 5M5XH 1JJCB 2GRJA 3BK7A 1UBEA 1E2HA 5IWAL 3HU2A 2F1JA 2WJYA 5JI3E 4YMVA 4A4DA 1KK0A 1NLYA 3WYFA 1YNXA 1R0ZA 1V43A 2TMKA 5AK0A 4BY1H 2VQSA 1JJ7A 3AP3A 4DCNA 3DPUA 4Y7NH 1VQIA 3GJ4A 2ZRKA 1OFHA 3FKIG 3LXRA 1BH2A 4QM6A 4UPAA 5JHGB 1CKNA 4JLKA 4BFVA 3VQTA 1II9A 3T1TA 2WICA 4XD7A 1G7SA 4CRWB 1QVGA 4CYMA 1PH7A 4KSBA 1BDOA 5L3SB 2D0OA 4W9MC 1H8EA 2ZSDA 4J15A 1U5KA 1DO0A 1KAOA 3X1DA 4E22A 1EYGA 4LPSA 2HDNB 3WBKA 2QT0A 5JCPA 1XEFA 3LNNA 1L7VC 1KXLA 2IK8A 1AJEA 1R10A 2IS6A 4AIMA 1U99A 4US1R 4HR7B 1E1TA 1E2QA 3NG1A 3KDFA 1B8AA 5FTMA 2C96A 1UKZA 1HNZQ 3UMSA 1VDZA 2B8GA 4JI5Q 3K8AA 1CJTC 1KK1A 4TSFA 3MWLA 1UEBA 4KO8A 1SQ5A 2J0VA 4TN1A 3KUCA 4KLZA 4ZDKA 4BXXH 2BMJA 4A0GA 2QPTA 4PQFA 3QVVA 5KUTA 2PMDA 1HR0Q 3FWYA 2QUZA 3U3OA 3B60A 3W1GA 4NYIR 2GXAA 1DO2A 4Q1DA 3F2BA 4LF9Q 2QP3A 1R4AA 2EDGA 4PZZA 4PPQA 4I99A 2XJ4A 3C14C 1EFRD 1TU2B 1II8B 2NO0A 3EAQA 4M9ZA 4AIIA 1D2MA 1JBKA 3VA7A 2JLWA 5EXSA 3TS2A 1YZ6A 2ZJ5A 3QUSA 1GSIA 4HB4A 1X54A 1RJ9B 4X62Q 1P75A 4IO9A 1XXHA 5J5CA 4KN4C 4KU4A 1KI2A 4DCVA 1FFHA 2JJQA 4NYJQ 1IYJB 3C16C 2R7DA 5IP9H 3QJYA 1SGWA 1NJIC 5BN4A 4ZO4A 5DIFA 4A3EH 2BC9A 2RGXA 4LBWA 3T56B 4LBYA 4NB3A 3A8KE 2ZRPA 2LWIA 2GCOA 1E4YA 1TL7C 5GVSA 1M1KC 2WOOA 4HDQB 4R4IA 4DBLC 2Z6VA 1US8A 2UUBL 1DG1G 3EZ7A 1NE3A 5GROA 4A3FG 1YBYA 5EAYA 1N32L 2C9OA 4KBGA 4F38A 4DLXA 3C5HA 3OFNA 3I56A 4JI1L 4MYCA 1JJ2A 3U3JA 4IDNA 5B57C 1A5TA 2GILA 3C4JA 2RCNA 2ZSAA 4POAA 1R0WA 4R7ZA 5C0XG 4GT1A 4B43A 1HT2E 4HZUB 4LYFA 3X1ZA 3PJRA 3TR5A 2HIVA 2PQAB 1S8FA 1XCPA 4BFSA 3KJIA 5FL3A 4WBSA 4KN7C 1JR3E 3ULLA 4BFTA 3U6BA 3B6YA 4PHTA 5G3YA 2KJQA 3GLGB 3T1HL 1U0LA 3PIOA 1E79A 3BFVA 2JATA 1TNDA 2N8NA 4A3JH 2GHIA 2REOA 1IONA 3GLHA 3SHWA 4A36A 1QF9A 1W48A 4EQ5A 1ZNWA 3GLFE 2QU8A 4DDVA 1YZLA 3U5ZB 3GJ5A 4AWXA 3G6EA 3SDZA 3AF1A 1W4CA 2O0KA 3SOPA 5JJIA 2A9KA 4QHYA 3KZ1E 4S2EA 3W5IA 5L3SA 2Q0HA 3ULJA 4LUCA 2YTXA 1K6MA 2ZRMA 4K0KL 3BS4A 2BE5C 2BWJA 2CFMA 4JLVA 5CYPA 4EQ6B 3PUYA 4YWLA 3UDIA 1R8SA 4LYJA 4LJ6A 5IYCH 2JLSA 1Y8PB 4DV5Q 4DLUA 3FVQA 2WVJA 2IS1A 1VQPA 3K9LA 3QXJA 4O3MA 4Q9HA 2PEYA 2NMVA 1MO4A 1XEXB 4TMKA 4GKKL 1SVKA 4BY7H 1F48A 1W2BA 2JA1A 2CHVA 2Y8EA 2AWNA 3A37A 3TNFA 3LWUA 5EZ6B 3ZIAA 521PA 5KPDA 3KJPA 4H0LC 4LX0A 3WBJA 2MNAA 2GJAA 2XTNA 3OE7D 2OFOA 4E03A 4JI3Q 2W0MA 3L0SA 4EFMA 1KHTA 1G6PA 1VHTA 4GPTA 3FMIA 4NYJR 1GKIA 2YWHA 2K52A 2Q9CA 3SEAA 4Q03A 3MLEA 4Y52H 1VQEA 5CB8A 4ALPA 1R5NA 4PSAA 3SC3A 2VTKA 4DR5Q 2V6JA 2XAUA 4TVAB 4YLGA 5FOUA 5AWFC 4Z51A 1II8A 4JI0Q 2Q3HA 2QPOA 4F4IA 3QY0A 1GIAA 5FBQB 1KOFA 3HJNA 3PUXA 5DE3A 5KO2A 4OONA 1G7TA 1RJ9A 4O0MA 4MDEA 3NEMA 4YCWA 1OKKD 5EZ5A 1C0AA 1YR6A 1XD2B 1H9RA 2J3EA 3BGWA 3GJ0A 3CZQA 1L1OB 1E9CA 2ZRIA 2RHSB 4ABYA 3B78A 5FBRB 1WI5A 3H2YA 2D2CC 1KC8C 2ZS7A 1VCIA 3U2QA 4B3SL 1VQHA 3U7EB 2CKZB 1WBDA 1O3YA 2EXDA 4LK1C 4Q1FA 3EWSA 2R6CA 2NPFA 4FMCF 2A69C 1NN5A 1XMSA 1YZNA 3VDYA 4TT3A 1TWHH 2EWWA 3PO2H 1E9DA 1N0UA 1YHAA 2J0UB 4PO8A 4R1JA 4A3MH 5IP9G 3OIWA 4DPGA 1T9HA 4Q7JB 2UKDA 2OCAA 2PQAA 4A3EG 1LS6A 1UPTA 2Q6TA 4JLNA 3QG5A 4OI2A 4TQAA 1KZ7B 4A82A 4BLTA 1D5CA 1JJVA 4AYXA 3OPOA 1VECA 5DNYB 4EUNA 5LDDC 2K5NA 3FMCA 2EFCB 3IDQA 2FXQA 3GTMH 2EJGC 1IN4A 2V4ZA 1C9OA 1QZGA 1PH5A 2KWIA 2ZITA 3Q5EA 3SZRA 3TKLA 3A8IE 5LMNL 2VF8A 4Q1CA 2GTPA 1N6IA 1TXYA 4MZ9A 4DV3L 4YHHL 2Z6KC 2FFAA 1COWA 2HYDA 2PZGA 3CR8A 3TE6A 1TAGA 2NOAA 2B8FA 2ZVPX 2AD1A 2IYXA 4M53A 4Q47A 5FFMA 3OEED 5JWHA 2JXMB 2V1UA 2IT1A 2K4KA 1YIJA 4KI0A 1CKEA 2G88A 1LF5A 2QNRA 5KTYA 3NBHB 2ZJOA 1E94E 2ZIAA 5CM8B 2OILA 5DISB 3KXKA 4GI7A 5FUYA 3TUZC 2JJ8A 4B3MQ 1VHLA 1X8KA 4EQ6A 1FR3A 1XEWX 4R4CA 3CXCA 1ELOA 1OSNA 2OHFA 1W4BA 3N2IA 4A3JG 3IIMA 5P21A 3RSOA 4CDGA 1T6NA 4M2LA 2FV8A 3TREA 1Z63A 3WXMA 2GXQA 5JJKA 3SHFA 4OK6A 2FSGA 4QFMA 1N33Q 3WNBA 4UJ5A 3RWMB 2WJIA 1U9IA 3K0FB 2BM1A 2ZETA 3UKDA 4BFXA 3VKWA 1K8MA 1IYVA 1QZHA 2QAGB 4MRSA 5BXQC 5A35A 1YR9A 1RW4A 4PPFA 3CPJB 2B63H 3P4XA 4EJSA 1NMYA 1KSHA 1W0KA 2HHHL 5CLLA 2NZ8A 1W44A 4LV5B 4KBFA 4BLQA 5GVRA 4NXNQ 2QT1A 1TWCH 1J5EL 1VQ5A 2R92H 3EXAA 3DM9B 4UJ3A 1E9RA 3LX8A 4LF8L 3WMGA 5BYKA 2F1HA 3S14H 3LX5A 2D0PA 3WRYC 1M8PA 5CJPA 1YZTA 4BY7G 4O2LA 1E3PA 2GNOA 2QP9X 4PAOA 2A1AA 3W3ZB 2DGYA 3HKZE 2F4VL 1MRNA 2OESA 4HIKA 1T0HB 4B3TL 1NMXA 4RZ3A 4TMXA 2E76C 1DTSA 1GWNA 1SZPA 4NCIA 5JWRA 3D7MA 2UXCL 1H8HA 4DIDA 1SXJD 3B1XA 3TAHA 4FCVA 1L1OA 2OCEA 1E4VA 2ATXA 4K8OA 3ADBA 3PF4A 1NN0A 3U3MA 1GUOA 4H13C 2EFHB 3K9NA 5DLQE 5E7JA 1G5RA 3PEUA 4HLUA 3T35A 5E3HA 3S1QH 1OXSC 1F6BA 4JV5L 3T51B 1R8QA 2YINC 3HKZG 1CKOA 1L4UA 4YCUA 2YZ2A 1D2NA 2O52A 1OT3A 2R62A 3ZD6A 4EPTA 4YXWA 3RN5A 1PVOA 1Q7YC 3AYHB 4LFBQ 5H8WA 3I32A 3LRPA 2J0UA 3ZZ0A 4C3HH 4GOPB 1ZU4A 3A5ZB 1JQLB 3HPRA 3CC7A 2K5VA 1KSFX 2IYTA 4DZZA 4X8HA 3PUVA 3TAUA 1HNWQ 2AR7A 1E9EA 1E9BA 1YI2A 1KJZA 2UUCQ 2W6JA 2ZRJA 3K9HA 1X9NA 3O47A 2ZYTX 4I1OA 4Q4JB 2FGJA 2Z83A 3FB4A 4OWXB 1E2NA 4UNQA 1X65A 3FHCB 2BH8A 3WP0A 2WFWA 2XTZA 4XSGA 1UBCA 4A3MG 1SULA 1TUEA 5C4XH 4EX5A 3TW8B 3CCMA 2OXCA 3LXXA 1M90C 4Z1MD 4R4QA 3QEJA 3X1XA 4C3JH 4MRNA 4AKGA 4URZR 4FMCB 3A1TA 3NBYC 1NBMD 3SFVA 1O78A 4O2DA 5EP4A 4CF7A 1Z28A 4B74A 4MGYR 2EYUA 5CIQA 4V03A 1E6CA 3RLOA 4LI0A 1FUUA 2OCPA 3MXNB 2Q3FA 2WB1G 5AJVB 4EPYA 5BW8A 2WZQA 3K0FA 4LC1A 4DR4Q 3LW8A 4JOIC 2ZSFA 4OJQA 2IC5A 5SZIA 1B23P 1LM0A 3GP8A 2JA8G 2WPDD 3IBGA 2A68C 2D7CA 4QGHA 1UE5A 1Z22A 1OH6A 1N0VC 1T91A 1YU9A 2DFLA 1I6VC 2RGCA 2FN4A 1T0JB 4TYYA 1BKBA 4X8OA 2PT7A 2GBLA 2H7VA 1XMVA 5C4GB 4M9XA 1W2HA 3NKVA 4DVGA 1QVFA 3KB1A 1D7QA 1E2VA 1GRQA 4G7ZC 1AE2A 4NPSA 4QIWE 1MR3F 3ADKA 3BH0A 3H84A 5B64A 1SR3A 4DLTA 1KK2A 1K73C 4Q7KA 2JIZA 3NELA 2W00A 4X65L 2FSIA 2B63G 3TVTA 1EIFA 2JLRA 5ELXA 2G6BA 1ZC4A 3S15H 5TARA 3ZVLA 1VQAA 3KXLA 1PLJA 2CNWD 2UZIR 2Z5FA 3AVVA 4QBGB 1PYSB 4RD0A 1F2UB 2OM2A 4Z8YA 3T34A 2JLVA 3H15A 1Q57A 2GJ8A 4JLMA 3OOCA 4DV7Q 3CB4A 3FMFA 1HQMC 3LDAA 3N5CA 2ZRLA 1Q20A 4P3YA 3TLXA 1B9NA 1ZMXA 2QMEA 2OZEA 4BZPA 2YKGA 3KJHA 5JFGA 3CWQA 2JA7G 3Q8XB 4M21A 2MO0A 1TWFH 1N34L 1ANKA 3TRFA 1L1OC 5C4JH 3U61B 3N2EA 5CIWA 1P60A 4GOPA 5G53C 2K14A 1N36Q 4DB2A 2E2HH 3IILA 2N46A 4OL0A 1N5IA 4HLUC 2GKSA 4URWR 1G16A 2VEDA 4KKSA 1PYBA 1X8JA 3EA0A 4OQLA 3AVPA 1FL9A 5C46F 4APVA 2XOKA 3OIVA 1W4RA 4CEIB 2MQHA 2FZ4A 1NY4A 2QMOA 4NMMA 4DSNA 2V6IA 1HNXQ 1HURA 3HOWH 5FJ8H 3GFPA 3GTKH 2OFXA 3Q3JB 3M0EA 2FJUA 4YY3L 2ZT9C 2QROA 3BOSA 1DBSA 2PPBC 2JJ1D 3A1UA 1PH3A 4A0FA 5GAHC 2RKOA 1TQ6A 3GLGE 3LO5A 4JI7Q 4JSYA 3BH6A 1YJNA 3ERSX 3HP1A 2W58A 1MJEA 5EE5B 4PHFA 1KAWA 4JL5A 3CRRA 1YRAA 5CM9C 3GJ6A 2VP0A 2CJWA 3WRXC 4F4JA 5HE8A 4DNIA 3WNCA 2ORIA 2F3TA 2QSYA 2IW3A 4POGA 3HOYH 2VHQA 2VL6A 5LB2A 1HPCA 1G5PA 5C4XG 3CMEA 2WIAA 3PEWA 1HZCA 2IXFA 1PJRA 4Q9KA 2GZAA 4LJ8A 3TH5A 3L0OA 1YKSA 3Q7QA 4L9WA 2O5JC 1LUZA 1MO5A 3P4YA 3DLLA 4OO1H 1G21E 1UKYA 3VR5A 4QL5A 4A4IA 2EJMA 1H95A 3HKSA 1YEZA 1VG1A 2QTHA 2V3CC 1P16A 1ZINA 2QRZA 3HOZH 2CCGA 3AVTA 3DXJC 2QAGC 3GTGH 1GDDA 2FE4A 3DOFA 3GLFB 1HZAA 1IBLL 2OWOA 1VIAA 3FKSD 3ZVRA 4X66Q 3LA6A 2AMCB 3PCRB 4CEHB 2GBLC 4GNXC 3S1RH 1Z6XA 2WJJA 4LFAL 1CKMA 5IT5A 1QHIA 1XBTA 3BB3A 4BFUA 2MO1A 3RS2A 2F1RA 1XD8A 1ZM3A 1Z07A 3KQHA 4D81A 3CRW1 1VQGA 1FX0B 1Z47A 3HOVG 2F6RA 4JT2A 3G71A 2IXEA 1CUKA 1Z08A 2BKEA 4DT1B 4BZXA 2KHJA 1GTVA 3DMNA 4QJ4A 1EUJA 1AQYA 1OIVA 4QGGA 3CX6A 4LY6A 1Q82C 1GL7A 2AK2A 2KSQA 3DKPA 4P33A 4YC7A 3MCAA 2JEOA 5D3QA 4F7WA 3STBC 3I73A 2GXUA 4AYWA 5C4MA 1OLOA 1G51A 3I92A 3LH5A 1MO6A 1AGRA 2IYUA 1IBRA 1P9RA 2Q21A 5EE9A 2CQOA 4U7DA 5LD2C 3NEJA 2NO9A 3AKCA 3FHWA 2ATWA 5CDFE 3R8FA 2N78A 1OTCA 3BORA 3RABA 1FW6A 2A30A 2YC4C 2P5SA 2OQ0A 3K0AB 1W1WA 1P5ZB 1OH7A 4TYPA 5B2ZA 4WZBE 3OEHD 3K0CC 5IYDH 3CLVA 4GOPC 1G8HA 2OCBA 3QPUA 3S2DH 1HEIA 2KHIA 1K8GA 2F7SA 2G83A 3CNOA 5FR2A 2X77A 1EWHA 3S2HH 3CH4B 3X1YA 4MNOA 1U8AA 2K32A 3AQ4A 1CU1A 2G0TA 3KKOA 4LC0A 4RD1A 5AUNB 4LF7Q 2W6IA 1PZNA 4EIWA 2VLIA 4GKJL 2F3RA 3CKLA 2V54A 2R6GA 2CL6X 4Q02A 4DWJA 5DN6D 5GAEC 2DWPA 3QXSA 1XP8A 2REXB 4DLSA 3EIVA 1Z3IX 1SKYE 4HLCA 1M2OB 3L0PA 3CZPA 3AVYA 4JMPA 5DH9A 4QOSA 1RFLA 3I55A 2UXDQ 4DR1L 4KHPL 3VTKA 2JLUA 4IFDI 3Q7PA 3UE1A 4WAUA 4JCVE 1G7RA 4ZIRB 2IHBA 3W6NA 3I1FA 4D2IA 1VQDA 4MQBA 2WSSD 3DMDA 3EWAA 1I6HH 1ZD8A 1QG2A 4QRHA 1M34E 4BUJA 1Z06A 4MGIR 2AHOB 1JR3A 4R9UC 4L16A 3HOYG 2XTMA 3RZOH 1VTKA 2EVBA 5D3MB 2A5YB 3ADDA 1QVCA 1IN8A 4NE2A 1VS0A 4A2PA 4RFVA 3VR3A 4GN5A 5BR8Q 2LKCA 2EWVA 5DI3B 1YE8A 3GLFA 4DUYL 4MH0R 3F2CA 1K8OA 5L3VA 4CEHA 1WCV1 1RRFA 2KE5A 2HQLA 3OHMA 4EPRA 4ZDJA 1NNEA 2PCJA 2PJRA 4L4UA 5HZKA 2GAAA 3GLIB 1XNJA 4OO1G 4G5GA 2ZI4A 2Q2TA 4US0R 5JECA 1XF9A 4MRVA 3DHWC 1TPZA 1W36D 1DD2A 2WP8J 1E98A 3I5YA 2RHDA 5FUWA 2GESA 5J4YA 3PCOB 4URYR 3HOZG 2XITA 2H5EA 3QNUA 4LFCL 1FX0A 4MGZR 2ZM5A 1YHQA 2V8OA 3OTOQ 4R71A 3ZS8A 4QGAA 4BECA 1J2JA 3H3VI 2E2IH 3FMPB 5F98A 1D2EA 2EFEB 4B3RL 3A5UA 4FMBB 3GDEA 4PFSA 3NENA 3L2PA 1ASYA 2FEMA 3CR7A 4HB0A 5E7MA 1ZJ6A 4Q4AA 3VNUA 2VQEQ 1G17A 1A82A 3OIUA 2A6HD 4C0JA 3W3AA 1PHJA 4LWCA 1G3MA 4M1SA 1XB2A 2ZR0A 2ZRNA 3FPPA 2JJ2A 4B3XA 4C9BA 4DR3L 3CC2A 4D4MA 4B3CA 3SQWA 1VF5C 4JG2A 1NN1A 2BMDA 1XMQQ 4LGMA 1J8YF 2BEKA 1PH6A 3RRMA 1ZU5A 2RB4A 3QEOA 3AH8A 3CCEA 4HAVA 4IDQA 5FOTA 4CEJB 1DAFA 3SGIA 1C1YA 1XPRA 4KLKA 2YVUA 2JA9A 2UU9Q 3E1SA 3G82C 3K0AA 2QG6A 3QBVA 2QM8A 3S16H 3GJXC 3MUFA 4NXML 4JVLA 4DDUA 4HAWA 4RCZA 4XVUA 2GVAA 4KJZA 1LYLA 4WXRA 1E9SA 3FP9A 2NVYH 1S2MA 1P2UA 4QJFA 1E2WA 1UWVA 3PVSA 5EQTA 2FFBA 3IIKA 2QRNA 2EFGA 3F0TA 4NBSA 2LCFA 3VMFA 3HOXH 4HJAA 3JZMA 3EQLC 2HLDD 1T4GA 2E87A 4XVRA 3UXMA 1F5NA 1NSFA 421PA 1EXMA 3EIEA 3AEVA 4MKHA 1M74A 1DEKA 2AXPA 5KHOC 2P6NA 5IYDG 1RIFA 3GJ7A 4TLCA 4NCJA 4QGUA 4DR2L 1XJVA 2CCZA 2JQOA 2VF7A 3B8HA 5J4KA 4LF6Q 1DXMA 2QSZA 4P4TA 1P9WA 721PA 1SLJA 1QG4A 4NL4H 2LXKA 4F91B 1N6KA 1CULC 2D3WA 2ZE6A 2JE6I 1FVIA 2I5LX 1CR4A 1NJFA 5IK2A 4IOMA 3U9SA 3NDPA 1E69A 3PQCA 4B73A 5KDDA 2XXAB 1E0AA 4G01B 4B44A 4DSUA 1OXVA 4A8JB 3U4ZA 2XZLA 1YR7A 4F93B 2AHOA 2LSSA 2CMKA 4DLYA 3CX7A 3VHXA 4PPNA 4JYAQ 3SR0A 2BJVA 5D3MA 3TSWA 5HKKA 1E24A 1QVRA 2ERYA 1X3SA 4B35A 2BMFA 1L0WA 5DI3A 4K81B 1LS1A 1RVDA 1Z0KA 3NIBA 2MMGA 4OHXA 5H70A 4O0AA 1GUNA 3NTUA 3A58B 4UXIA 4YONB 2GF0A 1IBKQ 1DAGA 2HXSA 1Z0DA 3BRWD 3GLIA 1XNRQ 2JA5H 2SHKA 2ZM6L 1X56A 5G3ZA 3OAAA 1Q81C 2YC2C 2DUDA 4JK1C 4WZAE 4JVMA 3IFTA 1Y3AA 1FP7A 1G8GA 1H9MA 2IYVA 3DM5A 4M1WA 3KQLA 4A1FA 1GKHA 5JS7A 3ER0A 3EG5A 2KA7A 2RF4A 4NCNA 4PAMA 1OB2A 1J7KA 4XIGS 2FH5B 2EJFC 4H02A 2ONJA 3EPKA 1KRSA 2XB2A 4AG6A 5K8UA 3I4OA 4GS3A 1MRSA 2V9PA 2PT5A 1VQLA 2E5LL 1S9HA 1YR8A 3ZH9B 5KSYA 4WVFA 4DUZL 4OQXA 4PHGA 3WP1B 2FPMA 4Q7LA 4LF5Q 3UK6A 2FFQA 3ZLJA 4CEJA 1IJEA 1GZSA 2V7QA 3K70D 4GOKA 2VHCA 3NC0C 1VIYA 2CLCX 4X64Q 1E32A 2DBYA 1SRUA 4QC2A 4QQBX 1T5EA 2P5TB 3T5GA 2A5JA 3A1WA 2G9NA 4BE7B 3RNLA 3UPUA 4M9QA 1U8YA 3IEUA 3H1TA 4A3DG 1N5KA 3P1JA 4LV8B 4CZ2A 4JKIA 1Z5ZA 1ZCBA 1E0SA 3O8BA 4HB3A 2H1LA 3A36A 1G291 5G40A 3RRZA 3SJBA 2NVQH 2K7VA 2Q2IA 3PEYA 1CJVC 1K0RA 3B6EA 5HR5A 2CEAA 2XSZA 3TZUA 1XMOL 1AH9A 4Q1AA 4TLAA 4RZXA 1I94L 3CWZA 3L8YA 4AD8A 1FP6A 3U4VA 1G7CA 1GFIA 1SXJB 1XNQL 1PLLA 3BB4A 4DDWA 3U44B 4JI6Q 3HPQA 3J81i 2JCSA 2VSOA 3K1JA 4I1VA 4JT4A 2WTUA 2A2ZA 4EKDA 1NN3A 3W90A 2FNAA 3AF4A 5DYIA 2ZPTX 3LWNA 5JEAJ 2GCPA 2HUPA 5A4JA 2ES2A 2WAQE 3HOXG 2L5TA 1YITA 1UM8A 2AXNA 3UE0A 2VHUA 3O8CA 1Z0IA 3DZDA 4DKXA 1XPOA 3GFTA 1ZCAA 5LMUQ 4CT5A 1AZTA 1CR0A 2XXAA 1GKUB 4DV0Q 2QGZA 3CM0A 2ZJBA 1JALA 4L8JA 2QQ0A 4FXPA 2ANBA 3KUDA 4A8JA 4B48A 1UE6A 4KYIB 2XEXA 4DR7L 4GBMA 2IF2A 3BDOA 1KY3A 4LFBL 1OXXK 3BERA 4IXNA 1DE0A 5EE0A 2RGAA 2Z6KA 3L2OB 3HU1A 3TSZA 3G0HA 1EK0A 4MUAA 4DLWA 3B85A 2YU9H 2WAQG 4DR6L 2V1XA 4A3BH 2UUCL 4L5SA 3Q85A 3QG1A 4OHWA 2KENA 2OFWA 4JBYA 5GADl 4M1OA 2VA8A 4DV2Q 1KI3A 3AKDA 3AEZA 2FF7A 2P3SA 3RVBA 2ZRGA 1UAAA 2GEUA 2BKUA 2FMXA 2Z0MA 4R2HA 3TS0A 1E0KA 1YZGA 2C77A 1DELA 2ZRBA 1QHXA 3F8TA 4MKFA 2VO1A 3SJAA 5A0FA 1GNRA 3KQKA 3THYB 2ZTSA 2JDIA 3U58A 3QENA 5J3BA 4G5QA 3CBQA 4C2MH 2EYQA 4IOJA 4MYTA 2JA5G 1E2FA 1BYIA 2VP5A 3IGFA 3QPWA 2R8RA 4JLDA 1FYCA 1NKSA 1T3HA 4OI1A 4JBKA 1TU4A 3WYGA 2HT6A 2NZJA 2YWGA 4HDOB 4IPDA 3PIPA 1E99A 2JEBI 1KI4A 4HLDA 1E1RA 1Q46A 4HIOA 5IF9A 2FSHA 2FEOA 4BLOA 2NG1A 1G8PA 1PV4A 2PCLA 3ND8A 3CCQA 1VQ7A 1S3OA 1IN6A 2Z43A 3QE0A 4Q1EA 4XD7D 3IHWA 4C2UA 3J81c 1LV7A 2ZJZA 2LKDA 5DI9A 1H8ED 2YWEA 3AP1A 4RZUA 4EPVA 3N6RA 3CAMA 3I61A 4TQ9A 1AKEA 2GZDA 1TEVA 4PXAA 4URXR 1CSPA 2WMOB 3CONA 1FOEB 3B82A 3AVWA 3TUJC 1YZKA 4OX9L 4JI2Q 4LF4L 1BVSA 3GTOH 3D31A 1NKTA 1GUAA 2NO7A 1AK2A 4LOAA 4MRRA 3W8RA 4LJ9A 2XNSA 2GVBA 3C5CA 3OZXA 4DRZA 3MWYW 3C41J 2JLQA 2HF8A 3KJGA 1AS2A 3EARA 1S40A 4Q1BA 4TSFD 3U44A 3JVUA 4A3IG 2WAYA 4RVCA 4PAQA 1X86B 3QOFA 3CO5A 3W8NA 1CXZA 1BYUA 2CK3A 2CXXA 3H4MA 1J70A 3RAPR 2NN6I 1Y69U 3PO3H 4IPGA 2RGDA 4A6PA 2H5XA 2UXBQ 2IX0A 4IPCA 2GCNA 3A1VA 5ANRB 3J81j 4HDCA 4BWYA 3RC8A 1HTPA 2O5VA 4JL6A 2VS1A 1B9MA 1KO1A 4K46A 5DLQC 5FTJA 4DV6Q 1A1VA 1VG9B 4UNNA 4H1VA 5TB5A 3ZVNA 3LBHA 2H92A 3Q72A 4MYUA 5JI2E 2Q3MA 4AKHA 3W5OA 3MSXA 4LHWA 3J7ZC 3TMKA 4RY2A 1KI6B 1VCNA 4KFTA 4MKIA 1XD9A 2VIIA 4HZUA 2WJVA 1N36L 1G6OA 2WKQA 2VY3A 3EIHA 4IKEA 1VYTA 1YQTA 2J41A 1KYIA 2A69D 2WWHA 1BBWA 1W3SA 1GL9B 2BCJQ 1AIPA 2IYQA 2ZU6A 4PZLA 1XFAA 5AUQA 4KSCA 4B2IA 1QHSA 4IOAA 4L5TA 2WWXA 4A8JC 4ZDIA 3GLGA 1CEEA 4ZCLA 2QY9A 1KIMA 4QJ3A 2GVDC 2C8VA 1DGSA 2HV8A 1RZ3A 2IYZA 2ZAMA 4QBIA 4KKTA 4B3FX 4MUBA 4OK5A 2H17A 5FOVA 2ANCA 4LW1A 1SKYB 3UWKA 4J0QA 5IYBG 4LBZA 1Q12A 5IWAQ 1C9KA 3OFND 4TTPA 3THYA 3S17H 2JA8H 4BBSH 4JOIA 4A3BG 4YDSA 1Y1VH 1SROA 2YTVA 2OV2A 4B32A 4KVGA 4C7OB 4XTRA 2Q2HA 1CS4C 2I0QA 3AVQA 1PMRA 3I3SR 4D82A 2J87A 3I72A 1XEXA 4F92B 3FKQA 1OHHA 3QPVA 5EUMA 2QTVB 1R5BA 2FZLA 1KI9A 1E79D 1HUQA 2N1BA 3BXZA 4PHHA 3RANA 2DWOA 1B0UA 3QI2A 1CF4A 5JEDA 1DARA 3JC66 4CEIA 3AQQA 4KITB 1T3LA 1P2VA 4GMXA 4GNXB 1FQKA 2J9RA 1S72A 1GJXA 4HZIA 1EWIA 2XTIA 3I5XA 3THWB 3IRBA 4M4SA 1Z6HA 2DNCA 3D0FA 1DAIA 1KZGB 4LHZA 3FYHA 5TMPA 4C0KA 4AQYL 3MJRA 1PH1A 1CJUC 4RMFA 3G48A 4UP7A 4PSVA 1NLZA 1Q22A 3CNLA 4RKEA 1HZBA 3G4SA 1GNQA 2E2JH 1NJGA 1FNNA 2L0XA 2O8FB 1QHYA 4NHOA 3RNUA 2JA7H 2BBSA 3RZDH 4TMWA 5G41A 2LXJA 1E1RD 1XD2A 3ZIAD 8OHMA 4HJ8A 1XJ0A 1IBML 3MWKA 1U81A 4A75A 3TJZA 1MABB 1VF7A 1ZYUA 4QKQA 1E2LA 5LD2B 1A6XA 5FBVB 1SE8A 4P31A 2BCGY 3GMTA 2VQFL 4HJ7A 1ESMA 3WHKA 5F3WB 1SXJC 4JI8Q 2I5HA 2VSFA 5EXXA 5LBIA 4LRWA 3CMAA 1ZRHA 1NSTA 1Z2CA 1EFUA 2QQEA 3T53B 5CDFA 1AN0A 1N6RA 1GL6A 3UG6A 4JS0A 2ZTEA 4TL8A 5FOXA 1WCMH 4DV1L 4P4UA 2DCUA 2PZEA 1KI6A 2O5IC 2ZI7A 1GRNA 3U50C 4BZQA 1G20E 2KCMA 5ELOA 3PO3G 2DFNA 2OEPA 2MFIA 2Q9AA 1D8LA 5JWOA 3UDGA 1G64A 4DV4L 1WE2A 3I8SA 3W6OA 5J4VA 2F9MA 2DFKB 3S1AB 2CVHA 1JXMA 3BE4A 3UWOA 4DCSA 4YMTA 2UUBQ 2B7BA 2VHTA 1C4OA 1TQ4A 2YNMA 2H18A 3BIFA 1N32Q 5AJWA 1WBBA 5HGQA 2NTYC 4M0LA 1MKYA 2E9SA 5HE9A 1P8LA 4JI1Q 1BBUA 2CL7X 2YJTD 4TL6A 4DUGA 1DCZA 5BWMA 1M1YE 4BGDA 3DL0A 4TT3D 4V0ME 1KI7A 2HCBA 3RS0A 2BDTA 2GWHA 4Q9LA 2OTJA 5GJWC 3KLWA 3FFAA 1KNXA 1Q1ZA 2PX3A 4DLRA 1DAEA 4C7OA 1M7BA 1UEJA 3EPJA 1IHUA 1OH8A 3R8CA 2ZROA 5IRCD 2AWOA 2P6RA 2V55B 4EPWA 4TZ6A 3T1HQ 3IPXA 4YQFA 3PV0A 4GLXA 1E2DA 3PENA 4LDJA 3H86A 3P27A 2PI2E 4XOIA 4A2QA 3IQXA 2ZAOA 4W5JA 2ZJ2A 2BMEA 2KB0A 1N9WA 3W34A 4DK6C 1JPNA 2ORVA 1A4RA 2WJGA 4BBSG 2QAGA 4ZKEA 1X8LA 1Y1VG 2RMKA 621PA 1RRCA 2C35B 1COWD 2BEJA 4K0KQ 1L2FA 4I1UA 4KAXA 2WKRA 1TEXA 3AUYA 2KCCA 4GNXA 1NP6A 1ZM7A 1ZP6A 2RH5A 3KJEA 2YOHA 3GJ3A 3LV8A 3THWA 5KDOA 4D25A 4MDFA 1Z9FA 2P67A 5GJBA 4Z8XA 2QBYB 4EFNA 3HOVH 2VRWA 2A68D 3CCJA 2CW0C 4JSTA 4GKKQ 2ZR9A 2V1CC 5LMNW 2ZI9A 1P72A 1G9XA 1TF5A 2X1VA 1GUSA 3RWOA 3GLIE 3K0EA 1YZQA 4DK1A 1Y1WG 2ZR7A 1LF0A 4WIAA 2O8FA 3TQFA 2Y0SE 1NIPA 3VKGA 1MOZA 4X8MA 2X2EA 4Q7MB 2DR3A 1UBFA 3CCVA 2A7QA 2UUAL 1NMZA 3NBZC 1FTNA 3RYTC 3OYYA 3HR8A 1N2CE 3BH7A 4RCYA 2QZ4A 3ICEA 4C0AC 2NZOA 4I7ZC 1MABA 1SXJE 1W0KD 2YHSA 2CHGA 1SHZA 3H0KA 4NDZA 4TTQA 4Q18A 1R5OA 4NZYA 1II0A 4BRUA 4UP8A 2ZE8A 3ZDQA 5KSPA 3HWSA 3TBKA 1XJQA 2C5LA 1A8VA 3GO5A 3DOEA 1KGDA 4XWAA 1TWGH 2GZHA 2RGNC 1IW7D 1P6XA 2YWFA 1CBUA 2ZI3A 3QF4B 1UADA 4JVSB 2BOVA 1QZXA 2F1IA 1XWIA 2FX3A 2IEZA 2A5FA 3K0CA 4Q9JA 1E96A 5B30A 4ZPXA 1R0XA 3B9QA 3A6PC 3PITA 2NGRA 1FMJA 2YYZA 1OXUA 1XCMA 5IT9c 1KDTA 4B3SQ 4JVNA 1HJPA 1H8HD 3EZFA 2RHQB 3LBIA 4I1SA 2VUMG 4Q4JA 3LBNA 3S1AA 1NG9A 3MG9A 3TR0A 1CR1A 1S1CA 4A9AA 4U02A 1SVMA 5FBWB 4QL3A 3L0IB 1WCMG 1DVRA 2IXGA 3IKJA 2QE7A 2W83A 4JI4L 3K7UC 3FTQA 1NVUQ 3ZJYC 4HYYA 1NVWQ 2R6AA 1WRBA 3MXUA 3B13B 4NYMR 5L8VA 4JL8A 2AFHE 1DAHA 2ZYVX 2WHXA 1UEIA 1K5GA 1SVOA 3RS7A 4RD4A 2WWFA 3BWDD 5FH9A 2REBA 4YXWD 3T1VA 1P3JA 2P65A 4HSEA 5KOYA 1P9NA 1UDWA 4WA7A 4OGQC 3E2IA 4F4CA 1ASZA 1WDTA 3U3KA 2BH2A 2O8EB 1XTKA 5AJ3L 3H0GG 2IX1A 2W6JD 4AI6A 2CCJA 3HGBA 1NBME 1A0IA 5LMNQ 3K0XA 1Z6GA 3MRSA 4M1TA 4M22A 5UKDA 2O8DB 4DV3Q 3LW7A 4YHHQ 3MWJA 5FUXA 2A6ED 5L3RA 3VX4A 3AVXA 1E9AA 4FMDF 4AKIA 4KCGA 1GVPA 4ITRC 3R9XA 3ZVMA 3B1ZA 3B1VA 5JS8A 3A7AB 2B6HA 2JGNA 2ERXA 1KMQA 3FE2A 4A15A 1W5SA 4HAUA 4UP9A 1FJGL 4R4TA 3QKSB 4GLVB 4IOLA 3CPEA 4PSKA 1LTQA 4NU0A 1JMCA 3BG3A 4B76A 1Q90A 1SMYC 4LYHA 2ZJAA 5FTLA 2QBYA 5ELNA 4DNRB 2GA8A 2OT3B 3V9PA 3QSYA 1NLFA 5KNBA 1S0UA 2CLSA 2Q9BA 3U3RA 1DPFA 1W0JA 2CCKA 3K9GA 1VCOA 2RAPA 1X6VA 3TW4A 3MFYA 1JEDA 5TXGA 2B3GA 2CHQA 121PA 5KNCA 2HHHQ 2J7PA 3RDPA 4BLSA 1T8TA 4FW9A 1F2UA 1MH1A 3SJCA 1J5EQ 4TLDA 1GVNB 1NF3A 4LF8Q 2P2LA 4II7A 2FU5C 4JLJA 2PZFA 2NO6A 3JVVA 4PZ7A 4BBRG 1HQCA 1XZQA 2C03A 3KKNA 1LFDB 2XX3A 4GMDA 4HB2A 5CK4A 2W2VA 5DHAA 1H9JA 4XTCS 1JB7A 2F4VQ 2QGQA 1RRPA 1XJCA 1HH2P 1PLKA 2QMHA 3CRQA 3NC1C 4YMSA 2E8GA 4V02A 2FDCA 3X2SA 1SHKA 3QF4A 1YJWA 3TQCA 1S9DA 5HCNA 2N49A 3F1ZA 2CE7A 2JIZD 2R2AA 3CPWA 1HNZL 2QEQA 2UXCQ 4Q01A 5BQ5A 5FOWA 4B34A 1JPJA 2N42A 4JI5L 3ASZA 3TVDA 3K0SA 3ND9A 1KO5A 4ME3A 2E1RA 2ORWA 3PSIA 2ZI6A 2O8BB 3S1NH 1KJYA 5FI1B 3SS8A 1CRQA 4A3CG 3M4OH 1KRTA 1H9KA 3ZQ6A 3AFQA 3STBD 4B2PA 2YOGA 3R7WB 2GAOA 3VKHA 1YHNA 4JV5Q 1HR0L 1XRJA 1V8QA 1ZW6A 4M8NE 3D6TB 4ASUA 1E1OA 4LF9L 4E07A 4PC3A 1A7JA 4MYHA 4EFLA 4XSHA 4JLPA 2FGKA 2O0HA 2A78A 3TGPA 2R7FA 3I4MH 1XTSA 5JRZA 3CX8A 2VP4A 1JAHA 1ZYRC 3GD7A 3IO5A 1BKDR 1EQQA 2IWRA 1EIYB 4KFSA 3S24A 1Z29A 2C9YA 4FDBA 4X62L 1NG1A 3ASYA 3CPHA 5M04A 1SVSA 2OTLA 3LNCA 2F9LA 1HCZA 4AYBE 2O8DA 2XOKD 1UFQA 5AR1A 4U00A 1TKWB 2FPKA 2PL3A 1BIFA 2I1QA 2WWGA 2O8CB 1X3EA 3EA5A 1RL2A 1N5LA 1XMJA 1Z0JA 3V4FA 1N8RC 2W2XA 1IXSB 1K8AC 2P6UA 1IY2A 3QKSA 2WAXA 4HUQB 2DNEA 3W9YA 4A93H 4I81A 2Q2UA 2D4HA 2VP2A 1FUKA 1LB1B 3GJ8A 4DK0A 1LW7A 4IJHA 1OXTA 2VBCA 3LAWA 4G5OA 4N0DA 5BYJA 4WOPA 1ZUHA 4IOCA 2ZREA 4AKEA 1T5IA 3ICQB 4IHQA 3AGPA 2ZQ5A 1CJKC 3B5JA 1EWRA 4TMZA 3M9BA 4Q19A 4PR0A 1KDPA 1YHBA 3NXSA 3A8TA 4PQYA 3MAAC 2H8KA 4BA2I 4GFDA 1EESA 4A3GG 4U5XA 2R93H 2UVQA 1V9PA 2ASEA 3W5JA 5BN5A 1E2GA 3AUXA 1E2PA 3KXIA 4E09A 1AGPA 5DO9A 1RPZA 1M7GA 3TUIC 4DT1A 4IVQA 4FMDB 4PZ6A 3R9IA 4R4OA 4QHSA 5C0XI 1A62A 1I4LD 1W36C 3NE5B 1EGAA 4PC7A 5EJEA 4DCUA 6Q21A 3M85A 4G7HC 4X65Q 2ZSBA 3EPHA 1KJWA 1HA3A 3KF6B 4DCTA 4AG5A 3A4MA 4LNQA 1KHIA 1JXOA 4IXMA 4A3DH 4DV5L 5FTNA 2XGJA 4LYAA 2IYLD 4TLEA 1P62B 4HJ9A 4LBVA 4D0LB 4DIEA 1WMSA 2G77B 3PGZA 1AKYA 2O8BA 1YNNC 4GNKA 4LCBA 4C30A 1N6HA 1NTGA 1ONLA 2J7PD 5HTKA 4QBHA 4JI3L 1P61B 1KTVA 2OLKA 4JLAA 3PFIA 5FLMG 3SN6A 4P72A 1YZUA 1EFRA 3NWJA 4M1YA 1A2BA 1N34Q 2PLRA 4O25A 1Q44A 2GEDA 4GZMA 2F52A 1LTLA 4DR5L 5EP3A 4NCHA 5GJVC 2QF7A 2WMNB 2DHRA 4IEIA 4JI0L 5FPKA 5SZHB 4MITA 5K8TA 5KDLA 1OYWA 3WMFA 1PH9A 5C1BA 1PFSA 4IVRA 1QJOA 4DAMA 1ZIOA 4B2LA 5LPNA 5JEAH 3HFZB 3J80i 2J46A 4KLNA 1OIXA 3L7ZC 2R9VA 4YWMA 1NVXQ 1JE5A 3A7LA 3NH6A 1Y8NB 2E74C 3BJIC 3CC4A 1F60A 4L8GA 1UDXA 3PIRA 4NPHA 4JLBA 1TF7A 2WV9A 3RLNA 4YY3Q 3OF5A 1H65A 2IS2A 3F2DA 4ZIRA 4EPXA 1D8TA 1TX4B 2O8CA 2B8WA 3I4MG 3IIJA 4LSGA 1E2JA 1GUGA 2QM7A 2HXYA 5TVKA 3DM3A 5J47A 3THOA 3U6KA 1Z0AA 3OESA 1GAJA 4HUQA 3BC1A 3BZCA 3R9WA 2B21A 4DKAC 2OO7A 2W2TA 2W6ID 3GQBA 1XXHB 2ZVQX 4WJ4A 2WJHA 4JYBA 5LB4A 4YMUA 4OI0A 2WWYA 3Q5DA 4LUVA 4BLPA 5FPSA 1Z83A 1IXZA 1OJLA 3H3VH 3CW2A 3CPFA 5JMTA 3IUYA 2JLZA 4LJ7A 4AK9A 1EWQA 3CCLA 1Q0UA 1TMKA 2G1JA 4PC1A 1VQNA 3FMOB 5EP1A 3IEVA 3DO6A 3AB9A 4PX9A 5A5GA 1ODFA 1E2KA 4TWZA 1VYVA 5F2EA 2I3BA 4A93G 1JAIA 1DADA 2ODWA 1OF1A 2G0NA 2W0SA 4ACAA 4IRUB 2BA0A 1K9MC 3Q8DA 2G3YA 2IY5B 4OBEA 4B3GA 2CWPA 2H16A 2ASBA 2ZUBA 3D3QA 1AA9A 3CCSA 5JBQA 1N0WA 1JR3D 3EC1A 4TMVA 2GN5A 3I2ZA 1VQ6A 1VPLA 4A92A 4C3ZA 4B3ML 1IBLQ 5KU1A 5CLQA 5DYGA 3GTPH 2GK7A 3KF6A 2QENA 1RIPA 3KF8B 5KPJA 1HYQA 3RLFA 2R93G 1F2TB 2UZ3A 4RD6A 4LFAQ 3AVOA 4LZZA 2CL0X 1QHHB 3GLHB 2ZS8A 2ZYWX 5TV2A 3HOUH 1N33L 1R2QA 3OE7A 2A19A 1MO3A 4ARZB 4E5UA 5J40A 1JNYA 2C95A 1FNMA 2FOLA 2WWIA 4NONA 4UNPA 3REGA 1HV8A 1KMHB 1S3GA 1ZVQA 4AYTA 5JLJA 4MTNA 1K83H 1QRAA 2R65A 1NRJB 4W5HA 3H94A 1E2IA 3J80c 3ONWA 1ZIPA 3JAMi 4LHVA 1I2MA 3THXB 1EG7A 4NXNL 4A3IH 2J59A 1XMIA 3K70C 1YVCA 4IDHA 1TWAH 3KQNA 1ZM4A 3PR1A 3SE0A 2BBOA 3X1WA 1IY1A 1IY0A 2G1KA 4L9SA 5AJYA 4A3KH 3U7GA 4HIDA 2JEAI 4D4JA 2ALYB 3AF3A 1OKKA 4KVAA 4BEBA 4ZKDA 4IFDJ 2HEIA 2JJ2D 4URVR 3BB1A 3VX3A 2OBMA 4JBXA 4D0NA 3M3YH 1H9SB 4OHVA 4WJ3M 1ZUIA 4PQRA 3IBYA 3VR6A 1LABA 3LLMA 3QQ5A 4FCTA 4C3IH 4OWTB 4LUOA 1IN7A 4AY2A 4IFDG 3TSOA 1JB1A 1E3MA 2VHJA 2P0EA 1M6NA 1ZKOA 2IA5A 5M5YH 1R9TH 5E4FA 5FPYA 4JI8L 3RRYA 3KKPA 3AM1A 5JEAG 2WM9B 1GP2A 4ZDWA 4GKJQ 1UJ2A 2ZEJA 5F9HA 4HAZA 3MMPA 2ZYUX 1N6PA 5EP2A 2EIFA 3D4RA 4GL2A 2K5UA 1GILA 3C8UA 3VR4A 5AUPB 4PMWA 1LY1A 3KTAB 2VW9A 5H1SE 1SVIA 5K8IA 5IYBH 4Q48A 1HNWL 2ODEA 1W2GA 4LWZA 4G0NA 4DR1Q 4KHPQ 1GUTA 1Q8KA 3CQZH 1VQ8A 1G4UR 1KSJA 2OLJA 1RRGA 3QVUA 3ADCA 1NBWA 1L4YA 5C0XJ 4V0MA 2IL1A 1E9FA 2BBWA 4RKFA 1SFOH 5F9FA 3SYKA 3OEEA 2J0QA 3KFXA 1OFTA 5IK2D 3KOJA 1HH4A 1R6BX 4WZ6A 2HYIC 3CW2C 1JT8A 4OYHA 4PV1C 4X6AH 3UIEA 1NVVQ 2FPLA 2PI2A 1NL3A 1GM5A 4KKUA 1TQDA 3A4LA 4A0HA 4DHEA 4GRAA 4YCVA 1Z6TA 4R98A 1GRRA 4DUYQ 1QVAA 2LMCB 5HKKD 3JAMc 2BA1A 4KODA 2CWAA 2GXSA 4HJ5A 4XJXA 3SU8A 1F2TA 3CF5A 4PANA 4OJKA 2A5DA 1QHHA 1TU3A 3LQQA 3FHOA 1X3GA 3ZS9A 2BE5D 3PEVA 4ARZA 1I4TD 3L8ZA 1RKBA 3KLRA 4JYCA 4DR4L 4G5SA 3RN2A 4Q66C 3SNHA 1JECA 2AN9A 4GSYA 4OQNA 4LFCQ 3NEYA 2RGGA 3OAAD 5E95A 1KMHA 4C0QC 4DJTA 1GO3E 1S96A 1UKEA 3GCGA 2R7ZH 4UXJA 3RS5A 2QAJA 1Z2AA 3C7KA 3DZ8A 4BY1G 5M3FH 1PH8A 1DOAA 3GEIA 4RJLA 4B3RQ 5TY0A 1N3BA 4NTZA 3THXA 1G8YA 1X1RA 1XTQA 2IF0A 3SBEA 3HOUG 1BOFA 2ZRAA 3KFUA 1CTMA 2ECKA 5KYKA 4TZ0A 3UDFA 4TMTA 1PH4A 4DR3Q 4TTRA 3ZYCA 5FL7A 4V0LA 2BV3A 2J45A 2FSFA 3ECCA 4GP6A 1VCMA 1SXJA 3TK1A 4YWKA 2NPIA 3DKVA 4D80A 1N6LA 2HJVA 3U7HB 3BFXA 3OW7A 1IZ6A 1X6OA 1J8MF 4EJSB 1H9SA 4NXMQ 1PA6A 2C9CA 2V7QD 1XPUA 1OPXA 5JJLA 5JSZB 4IOKA 4M1MA 5JZVA 4TYNA 2AK3A 2CLDX 3AKYA 5EUQB 2B7CA 1FZQA 1WQ1R 4IJLA 2PH1A 2PJZA 4AC9A 3KQUA 4DV7L 4A3KG 1XX6A 4LHYA 2OUKA 4NYIQ 5K8LA 2OSBA 2KBNA 3UMFA 3HU3A 3TRZA 3NHAA 1ZM2A 2KBEA 5GQOA 4DC9A 1QDEA 4RCNA 4XH9B 2GJ9A 4BXXG 1J99A 1ZNXA 1U90A 1CTQA 2O0JA 2ZTCA 4P0TA 4LJZC 4GN4B 3KB2A 1KI1A 1NY6A 1O87A 1NVVR 2OAP1 2OXRA 2XSZD 1QHNA 4PO1A 1Z0FA 1K5DA 2GEVA 2HIXA 3T15A 4DR2Q 1NIJA 3AF2A 3IHLA 2QTFA 2XZPA 2XGTA 1PUJA 1AQUA 3GEHA 3KTAA 3UMRA 3E70C 1I5FA 2WKPA 3WDNA 1P7CA 3QBTA 4QNMA 1YVDA 2IYRA 3A8JE 1W7AA 1JI0A 4Q00A 2K5HA 2C99A 2PNRC 2DFTA 1Q1QA 3M4YA 5DGXA 4WXPA 4XWKA 3T1YQ 2J1LA 1HNXL 4A2WA 3CUEF 1U98A 4QGFA 4Z1MA 3GTLH 3I4NH 3T5DA 1F3OA 1Q21A 1AS3A 3QKTA 4H1UA 4HUTA 4UNRA 4JI7L 1BO6A 2ZI5A 4GOJA 4QJ5A 1G19A 1NBMA 5FI0B 5AJZA 2ZANA 4IFBA 1Q3HA 4ZV4A 3ZZUA 1W5TA 1O7LA 4ILEA 1VQMA 4JZKA 4GDFA 4KV9A 1UF9A 4ZI2A 1VQ9A 2ZRFA 1FPMA 1MJCA 1AS0A 2GF9A 4URUR 2ZM6Q 3AB3A 1I3QH 3NHBA 2WPDA 4OQMA 3P20A 5FR1A 5HY6A 1W49A 2DB3A 1LVGA 1KO8A 4IJMA 5DSZA 3LD9A 3KX2A 2CBZA 1SN8A 1ZD9A 4DB4A 3K09A 5IHPA 1Y1WH 1OIWA 3AV0B 4DSTA 4IPHA 1YJ9A 1HE8B 1GHJA 4ZCMA 5IE8A 4B3DA 4IDOA 4LUZA 2AKAB 2JDID 2WSMA 5TDHA 2NN6H 4UQOA 1RE0A 1IL2A 1X55A 1VQFA 2E5LQ 3GFOA 3HDTA 4P32A 5EXPA 5KSOA 4DUZQ 4N3NA 3GPLA 4BA1I 4X66L 1SKQA 2CNWA 1VQJA 5IDVA 2R7ZG 2BJWA 2BBTA 4OXPA 2QPAA 4HEJA 2X19A 1U0JA 3OIYA 5M3FG 4RD3A 3T06B 1GHKA 3M4PA 3CRVA 2MSDB 2RGNA 1KI8A 4FCWA 5JSZA 4PG3A 3O8RA 3ULPA 1TADA 5IYCG 2VPPA 5AJXA 3FOZA 1KY2A 221PA 3T61A 1E2ZA 2ZRCA 4I4LA 2VH5R 1Q1EA 5BN3A 2R44A 4OHZA 1KK3A 1S4QA 1IXRA 4IEEA 4Q9IA 1DG3A 1ONBA 2D74A 2VUMH 3I4LA 1X3FA 5CITA 3M6AA 4Q21A 1QHGA 1XMOQ 4LV6A 1I94Q 4HAXA 4JC0A 4QM7A 2JASA 2D7DA 1XNQQ 1G3RA 3A4NA 3IO3A 2OQKA 4KXFB 5FL7D 4EAQA 4JJKA 3PUWA 1GOTA 3ZJYA 1VYUA 4DSOA 1Z6YA 1TTTA 3QIAA 5IY0A 1WOCA 2XB4A 1KNQA 4YMWA 3CH5A 4EDHA 3KFVA 2ZS9A 2QORA 1BS1A 4L5QA 1XXHE 2CK3D 1UE7A 2JK8A 2JJ1A 3HYTA 4Q4LA 4TLBA 1CLUA 3Q9LA 2VZAA 4PPGA 4LPKA 2ZE5A 2QP4A 3H0GH 4D6PA 1OE0A 1W4AA 3PUZA 2F3IA 1IJFA 1VG8A 4DR7Q 2PLFA 4DAYB 2GETA 1OH5A 2GK6A 2AD5A 4ACBA 3MJHA 3NVAA 4B71A 4YDHB 1YNJC 2L15A 4LF7L 1CSQA 2CDNA 4FI3C 4KFRA 3TQYA 4CW7A 1XTRA 3SJZA 4IVPA 4BFWA 4DR6Q 2XJ9A 2NQ2C 3RRNA 1AZSC 1ZAKA 2ZU0C 4G3XA 2WIBA 2JLYA 4OK3A 5FBLB 3WWVA 1WF3A 3EN2A 1Y63A 3VHLB 2F1MA 2D2FA 3LVQE 3PO2G 3LLUA 3QKUA 4US2R 2A3RA 3I4NG 2IWHA 5JHHB 3LFUA 4A0RA 3UG7A 2WB1E 4M1KA 2UXDL 3T1QA 2HF9A 2VP6A 1WA5A 1N6OA 1N25A 2IUTA 3V00A 4B33A 4NYMQ 1FL0A 1G3IA 2XNDA 4C0HA 2C04A 4HLQB 3GLHE 3CRKC 3CF2A 1G8FA 2RGEA 4PC2A 1R7RA 1ZC3A 3BJUA 3BFKA 3UDXA 3A0JA 5GADC 2CJWB 1GKYA 3EIQA 1IQPA 1GNPA 3SQXA 2KCTA 3FKSA 3PF5A 5L3QB 3VNVA 1VQBA 3AF0A 1SVWA 3K53A 1KSGA 5BR8L 3VR2A 2ZJYA 3K09C 4PC6A 2R6DA 2GJSA 4BBRH 3RS3A 1U8ZA
chains in the Genus database with same CATH superfamily
4JGGA 3GFRA 3ILHA 3ZBTA 2QDXA 1EJBA 2ZXUA 3WL8A 2LIPA 4TQUS 3S1MH 2XWSA 2ZJ8A 1C81A 3P32A 4IFIA 2SBTA 4HGRA 4M8AA 1X7XA 3TL6A 5LU8A 2NPOA 1NVKA 1Q7RA 1TJ3A 1IXRC 1WXFA 1QK4A 4EA6A 2QI9C 1U94A 3D8BA 3C6QA 5AXBA 1DRKA 3T95A 3C85A 3QXHA 2CKDA 5EJ2A 2HA0A 3DWFA 3UWDA 3GLRA 4I9UA 2AHRA 4Y2YA 2J7KA 2W93A 2HCTA 2R7NA 3L1JA 2NZHA 3TTUA 1YQUA 5JFTA 5KNDA 3M9XA 2PBRA 2NTVA 4YRDA 4O42A 1MIUA 1EQUA 1KO7A 1KKMA 3N3BC 4QBFA 3K16A 2Z6BA 4O4JA 4YYZA 3FRPB 3QX8A 5J4HA 4BY1B 3O1LA 3G17A 5H82A 1JSLA 5I7WA 2MUYA 3BVPA 3S0JA 1JKJB 1A3UA 1AE3A 2Y2VA 1REQB 4P4SB 4QHTA 1KL9A 4F71A 1QBKC 2NVTH 3GJTA 4NHEA 4WD3A 2PCFB 1NMSA 1TQ2A 1V25A 4NABA 4BB5A 1IEWA 1RRMA 1MJGA 4Q4AB 4TQGA 2DN8A 1E1NA 4ZOLB 5KYNA 3UMMA 2BD0A 1RYYA 2YVLA 4JBLA 5JRJA 4Q7EA 1GT6A 1YB1A 2CMDA 3VAAA 1RYHA 3FCYA 4E5DA 1Z2PX 1JG7A 4XWOA 4TTAA 1PNTA 2ORED 3SFTA 2EQBA 4KPUB 2I3ZA 4RTQA 1FFWA 5HGJA 5CD1A 2IUSA 2BM8A 5GOTA 2GUGA 3TG2A 3WYDA 2XZOA 3U7FB 4ESVA 4WESA 3V4VB 4TTVA 4RZ2A 4YY3B 3QVLA 1D2AA 2OORC 1Q2UA 4YRIA 1V5WA 1I1OA 4OHYA 5E4JA 3E0EA 3S27A 4U7JA 3TP7A 1E5LA 1EB8A 1RQ2A 1U1EA 3NOVA 4MVJM 2WLTA 2V9ZA 3SXUA 2KLHA 1YQ9A 1M2KA 3VO2A 1K9SA 1E2MA 4JI2L 1VOTA 1IN5A 3K73O 3DYVA 3IRUA 2PH7A 2HMUA 2MSNA 5IJ0B 4JBMA 3RTAA 1Q5PA 4G85A 5HZGA 1CW2B 3WE7A 4DV6L 3EZ2A 4WKOA 3R6WA 2NVBA 4IIJF 4JIGA 3QJGA 2MP1A 5HIAA 2J3DA 2D5DA 3PNLA 1A63A 3A6JA 2ZJPA 1FDSA 3PX3A 3P2EA 3GTMB 5IVKA 5COQA 5M5XH 1CP3A 3GLSA 1W93A 2TMKA 3PYLA 3KR0A 5JHGB 3CSSA 4QTYA 1T8YA 2IOQA 2IK8A 3LNNA 3KZOA 4PZPA 2CB9A 2BTQB 3EMVA 1SQ5A 1YK0A 1GNLA 3ABZA 2BMJA 5FULA 3C43A 5K8VA 2QTMA 5JH7F 3JSXA 3VH3A 3R2TA 4N18A 2WZDA 2AF4C 2ZJ5A 2ECQA 1JEAA 3OLYA 1P4GA 3HABA 4KJXA 2JJQA 4BVGA 1TZCA 4Q3EA 4RF3A 2V6BA 2YVQA 3SAJA 5GVSA 4OELB 4PAWA 4POAA 1PRTD 3TSYA 3NWSA 1RWPA 3TR5A 2NXCA 3MC0B 4E5VA 2AFRA 2IIBA 2PR2A 4M98A 4XYOA 4PSCA 3DGEC 2VZ9A 3ZW7A 1C1XB 2KVMA 3SEFA 3W5UA 1PP4A 1X8XA 4W6QA 1Q1AA 3RUAA 2IS1A 2BY4A 1VQPA 4C4OA 1T8SA 5JXHA 1SVKA 1F48A 2N47A 2Y8EA 3A37A 3ZIAA 3GWGA 3KJPA 3WBJA 2MNAA 2ZM6B 4NYJR 5FAKA 1EZ1A 7REQB 5CP8A 5C8YA 5CB8A 3G02A 5KINB 4H4CA 4DR5Q 1WXGA 5FOUA 4KIUA 5BMVA 1QG7A 4EKYA 1XTCD 5TF4A 4FT2A 2GR9A 4MDEA 4Z0TA 4KGXA 3O03A 3B1FA 2ZRIA 2VNSA 16PKA 1IUOA 1NXVA 4BL5A 4EBBA 3JTEA 2HMVA 2EXDA 1M2NA 3E22A 1IKLA 1VCHA 2WKCA 5IKOA 3P97A 1CHQD 1PTOC 4EQNA 3AR9A 4LIPD 3U81A 1XNQB 1D5CA 2JRCA 4XM2A 3G5MA 2J48A 3A8IE 1N6IA 2HYDA 1RJWA 2XUKA 3HOYB 1ODKA 4EJ6A 1CKEA 2QTGA 1RBZA 3TUZC 1IKMA 3PFWO 4K9NA 1OSNA 3HV0A 2OHFA 3RSOA 4KZKA 3IIMA 3ML1A 2I03A 4ZMBA 4BFXA 2F8SA 3ZXUB 4HFNA 3TWOA 3S1RB 4UJ3A 3NAGA 3AG5A 3LX8A 4WRDA 3HBLA 1DQYA 4HH0A 5AXDA 2GNOA 3R1IA 4R0VA 5U4XA 2E76C 1L5GB 2AQ2B 4DIDA 5L3ZA 4XT1B 1I2BA 2XVXA 3NHRA 1R8QA 3PR3A 4J3JA 1NVAA 3LRPA 4LF4B 2IYTA 4ZYSA 3C3JA 4M87A 2O2GA 1X9NA 5FA6A 1N77A 2Z83A 2ATCA 3STWA 1E2NA 3UJBA 1H2RS 3O1JC 3TW8B 5C4XH 4PHCA 2C2WA 1M90C 4B7UA 4TRNA 4R4QA 4FMCB 1ET9A 3DLBA 2I62A 4UDOA 5EP4A 4EPYA 4S1OA 1JB3A 2FZWA 1C4XA 3KOOA 2H7VA 5C31A 3DFIA 3NKVA 3ND6A 1E2VA 1NF2A 3PKJA 2M2LA 3FNRA 4X65L 1PT9A 1RRVA 2XE8A 4QBGB 1NNUA 4NBNA 4YJFA 1ZMXA 2ESRA 1E3IA 2FFKB 4IP0A 2C5CA 3TRFA 3D2BA 4HRYA 4LGVA 4DB2A 1CYDA 2VEDA 4B80A 4QLOA 3DS8A 1W4RA 2VDJA 4NLLA 2RI1A 1HURA 1ZBQA 3SXJA 2DUMA 1BRMA 5A7HA 3E9EA 3LUAA 2W2LD 4PS1A 3UC9A 2AJ8A 5EE5B 4KXYA 2QYTA 2QLLA 3LT1A 1ECLA 3RIYA 4TUYB 5CHEA 3Q7QA 2QRUA 5F64A 2JA5B 4FUQA 4O2AB 2V3CC 1ZZGA 2QAGC 1QLWA 1SIUA 5LZ2A 2DQYA 3QEMA 4JOBA 1QWOA 5JCJA 4RTLA 1FX1A 4JT2A 4HFRA 2F9FA 2UZ1A 1MO6A 4OP2A 3ORRA 2F0VA 1BEUB 4RVGA 2M2IA 4MKZA 1IEQA 1RI2A 4FYPA 3K0CC 4KXXA 3UBMA 5IYDH 2WNSA 4BP3A 1G8HA 3PNVA 1NOJA 4MMYB 4RD1A 5AUNB 2MIIA 1XP8A 2REXB 1Z3IX 1SNCA 4DQLA 3BG5A 4ZU1X 2OC4A 1GPWB 5DYTA 4JCVE 4BUJA 3DCNA 3KVVA 2CC2A 1VTKA 2EOAA 4MJ7A 3NK9A 4DCGA 1N3LA 1U1DA 5F76A 3WGUA 1YE8A 5MN6A 4CEHA 1E66A 4JFAA 4UDUC 2C7QA 3GI1A 4CMEC 1XF9A 2H4FA 4MGZR 3OQPA 5DDIP 4RLQA 3PDIA 1NXOA 3G88A 1YAHA 2FEMA 2JEZA 4URFA 4PLGA 4H2DA 1H4TA 1SNMA 1PH6A 3EC7A 4CLDA 4DA8A 1DOHA 4WTOA 3K0AA 4FZVA 2Q49A 4Q3AA 2PO7A 2BSXA 1LYLA 3NAQA 3NHYA 4LYGA 3O8QB 1DKPA 4NBSA 3W5SA 4LXXA 2F8TA 2BDEA 2JGDB 1F5NA 4DCPA 1NURA 3EIEA 1BFDA 3ZNOA 1M74A 4DR2L 2CCZA 4Z7JA 2M6SA 2P41A 2POCA 3O82A 1EP1B 2ZE6A 3DDZX 1HR0B 4MTLA 3HCWA 4G01B 1SIOA 3OA0A 1QB7A 2ZJ0A 5EJ8A 1PYDA 1DUVG 4CMKA 4W8OA 5DI3A 2C2KA 2TS1A 5G3ZA 5DXFA 4PYQA 2H2HA 2V6GA 4QA9A 2BGUA 1DT3A 4K6LA 4HDKA 1Z16A 2RK4A 4FGJA 3DBHB 1EMDA 3J80L 3E5SA 1T5BA 3WLSA 3A1WA 2G9NA 3NHUA 3RJMA 2E2JB 3IEUA 3P1JA 1K75A 4K2AA 2Q2IA 1MD9A 2NXNA 4FSXA 4UEOA 3DT9A 4OGFA 1GFIA 2HPAA 3KYJB 1JE4A 1NN3A 1L5HA 4GXNA 5JZSA 4JI3B 1SCJA 2AXNA 3UE0A 1LDYA 8ADHA 3V7YA 3H1BA 3I04A 1M76A 3BERA 1MD2D 3GHHA 1SQSA 4NFHA 1RTTA 1YQWA 4A3BH 3UXHA 3NTLA 4G67A 3N53A 3R40A 3SJAA 3WLLA 5E1DA 5DNCA 3CBQA 3P9CA 4KIWA 3H1AA 5C4ZA 1LI4A 4I3GA 4S12A 1G21B 3EXEA 3IAFA 1S3OA 2XZDA 1K8ZB 4MEBA 1V1PB 2E6UX 3AWDA 3ZWPA 4JI2Q 3C97A 4QARA 5BSMA 2RGDA 3JQAB 4GLLA 2C5BA 2Q9UA 2VS1A 1QORA 5FTJA 1A1VA 4DV6Q 3R0JA 5TB5A 3MSXA 3DAYA 2PX2A 1EY4A 1BBWA 5F5NA 2HXGA 5AUQA 4ZV7A 4YASA 1ID8A 4BNZA 2BKAA 4RM3A 3UWKA 3QTBA 4IIVA 4F45A 5A9RA 1NVFA 1L0BA 1WTPA 2XUPA 2J87A 3DBRA 3FKQA 4NPAA 1Z74A 2AG6A 1RLMA 5L40A 1N2GA 3VHRA 3BE6A 1S72A 1MU0A 5BURA 4UPEA 5JYEA 1RXVA 2XUFA 3G4SA 1FNNA 2OGZA 4NHOA 2JA7H 1HUMA 2HI0A 5F2OA 2XUQA 1N1MA 5AIAA 1NJSA 1ESMA 1SXJC 2I5HA 2VEOA 4LRWA 1X13A 5CDFA 1XKLA 1L4BA 1G20E 2KCMA 2MFIA 4JH0A 1RMYA 1JXMA 5ICMA 4CIBA 1UWLA 4H08A 1L8OA 2J6CA 5HGQA 1MKYA 1HE5A 3DL0A 3RS0A 4IJWA 4ZP1A 4MQFA 5BYBA 5DGCA 3Q7EA 3ED5A 4XOIA 5THXA 4N12A 4MSUA 5H80A 2ZJ2A 2BMEA 1WDMA 2FYTA 5ERGB 1F3LA 2R8EA 3AFGA 1L2FA 1PGQA 2VK1A 5TQ2B 3CEPB 2I99A 4F06A 1IM5A 4ID6A 2R11A 1NU6A 1YQXA 1TC2A 2DR3A 1WTXA 3DC7A 1UBFA 3ZV6A 3CCVA 5ILGA 1SXJE 1DZ3A 3KR1A 3FPSA 1ZVVA 4ZOLF 5HFAA 2RGNC 4MHTA 1P6XA 4ZPXA 3A6PC 3RRXA 5IT9c 1YR2A 3PDJA 2DJ5A 3WIUA 5FBWB 1NRWA 2PUAA 1Z25A 4MTKA 1WB6A 2XRYA 3AUKA 2BW0A 2P5ZX 2J9FB 3FSRA 1XQXA 4BX2A 4L6CA 3AJRA 4QDTA 1WDTA 4D9JA 1PJ3A 3HGBA 3MRSA 2O8DB 5UKDA 3LUDA 1GVPA 3ZVMA 3B1ZA 2XIQA 3SD7A 4J2HA 1EUYA 3DFKA 1KMIY 2I9PA 4P22A 4WZAA 3UJDA 1W0JA 2ISSD 1EXWA 2BFEB 4QQ8A 1TIKA 1JEDA 2V65A 3L7JA 1F0PA 4JLJA 4PZ7A 4HB2A 1H9JA 5CDUA 4HQKA 2FDCA 3TQCA 3S8YA 4LMBA 2JA2A 4AJ4A 5KYYB 4MV0A 1KH3A 1TWAB 5J2UB 3HWWA 5GZ6A 1CJBA 5CA1A 1JKMA 5K3FA 1E1OA 4YIHA 3HLKA 1EX9A 5CFZA 3CX8A 2VP4A 3SC4A 1BKDR 4IMPA 1GU0A 1F6DA 3S70A 4PGAA 3UAZA 4X1YB 2O7NA 4RPLA 4U7FA 4KLCA 4CTMA 3F9RA 1JJBA 1GARA 4G56A 1QLJA 1SFOB 3GJ8A 2VBCA 2QR5A 3EH1A 3NX4A 1UC5B 4IHQA 1MJ5A 3W78A 5AW1A 1TEHA 2BEUA 5DSTA 4ZRMA 2VYVA 3FSGD 4FPXA 4R4OA 3VR5D 3LX0A 4EZEA 4X65Q 1KHIA 1IHPA 1E7MA 1SCUB 3TLKA 3COVA 2JHGA 4L6TB 1UC8A 2LUOA 2Z04A 3KTOA 3JS5A 4JLAA 5FLMG 4UFNA 3HJCA 2F52A 5IBPA 4ENQA 4JI0L 3R74A 1YZ3A 1IL8A 1K7SN 3KLNA 4L8GA 1JE5A 5E38A 4JLBA 1FEZA 2D1FA 3L6RA 4ARSA 2GD2A 5HJ2A 4FZ5A 4EG6A 3BCHA 2WJHA 1L5WA 4NJMA 1B16A 4BDTA 2G63A 4LXHA 1M1YB 5EZYB 1ODFA 3OZEA 4LAAA 4C07A 2IY5B 2PX5A 2ARKA 2NAFA 4XX0A 1QWSA 1N0WA 1G6ZA 2AH5A 2A0UA 3VSAA 4EQOA 1N8SA 2HZ7A 1EA7A 3H9QA 5I7FA 3DBLB 3F67A 2PMEA 5LQJA 4LCEA 2AN5A 2B6NA 1I2MA 1QUEA 4DLKA 2R61A 3PR1A 4KI7A 3U7GA 1XTZA 2ALYB 3AF3A 2HEIA 1ZGJA 2ZB7A 5L7WA 2H9IA 3GJQA 4ZT4A 4KQ1A 4U0KA 4ZRZA 2VHJA 1R9TH 4FYXA 1VDMA 3AM1A 1QE3A 4ZDWA 1NR5A 3BL6A 2K5UA 3IPLA 1A2OA 2H8GA 4HKTA 4KK7A 1SVIA 3KT8A 5C0XJ 3JR7A 5LR6A 3ZBUA 1X7HA 3TLBA 2V45A 3QLEA 3ETJA 4OYHA 1R9JA 1NVVQ 4KH1A 1QU3A 1CY8A 4DHEA 2OA0A 2SEBD 4P8RA 3OQ1A 4MV8A 2GXSA 2A5DA 2O3RA 1HC7A 4PQGA 3PEVA 3D6JA 2G09A 2E18A 4XM0A 1M2WA 2WSYB 3UB2A 1L7OA 4UXJA 3GEIA 2ZXFA 3L7AA 2IF0A 2F59A 3NHKA 3MLAA 4XCQA 1TM2A 3PNMA 3G68A 1H9SA 4M1MA 2AK3A 1FZQA 5G3LD 5JNRA 3S7ZA 1B3QA 2ZB2A 1V3UA 1QDEA 3R3ZA 2ES4A 3GAFA 4GN4B 4F5EA 2LP4Y 3T15A 3C3DA 4DR2Q 2WM3A 3E58A 3QBTA 3ZIDA 1PTOD 2OBYA 3AV3A 4LGYA 4FE7A 3N2GA 1F3OA 4H1UA 3TTXA 3K9CA 4CFSA 4JI7L 1U4OA 4MPJA 4DG9A 1O94D 4KV9A 4URUR 4A3GB 2L0CA 3O75A 3OZRA 3PYXA 3B2NA 4D8VA 1EDOA 1N32B 3R5TA 1MW8X 1EHCA 4IDOA 4KTTE 1IH8A 3RFFA 1RYEA 2NN6H 4IQ4A 4OXQA 5I8ZA 4KXMA 2QUAA 2WQ7A 3MINA 2PZLA 3T06B 1H4QA 4DSZA 3L0DA 4IQGA 1UFRA 5AJXA 3K1TA 2UV8A 1SBQA 3ZTYA 1MTZA 2VH5R 5BT9A 4XFKA 2J32A 1DG3A 2NAPA 4LTDA 3I90A 1WPQA 2M6KA 1GXSB 2JA6B 3CKKA 1X3LA 4HP8A 4F8MA 3KFVA 1XVTA 1UE7A 4ES6A 1L3IA 2QL9A 1IVNA 3PUZA 2PLFA 3Q6SA 3U48A 2L15A 4LF7L 4OJTA 1XTRA 4TUYF 4OHFA 4RA9B 2YY5A 4EL5A 3QKUA 5EHNA 4NFYA 4O2AF 3TLJA 3G0DA 4BLWA 1EYZA 3A0JA 2O7QA 1CY7A 1W1IA 3V8EA 3VNVA 2MSWA 5LQAA 3Q3HA 2NVXB 3ZGZA 1PNQA 1PYGA 2OBLA 3AEQB 5EE1A 4C4PA 2G9HD 1QX4A 1KE2A 4RFSB 2I4LA 3L1UA 3JQPA 4P38A 1E2BA 1EK5A 3HO6A 5C32A 3KKQA 3GEBA 4JZYA 1I1HA 1JKIA 2CKMA 2VJKA 3QWFA 3PXUA 4NKRA 1FLVA 3B1YA 2ZGVA 1J5EB 2FP4B 3LJKA 4WWHA 1R0BA 1ISSA 4RXTA 3WLIA 1I50H 1HFEL 1G41A 2IEYA 4A3FB 1Z6ZA 1QCYA 3EPLA 2WU0A 3SHVA 3E7WA 3I30X 1U5BB 3E05A 3NIGB 1IM2A 2XNJA 3LSTA 4IFEA 5EMHA 1XVAA 4Y7CA 3QI7A 4AURA 3G8DA 2F43A 3IR6A 4S3SA 1ZXLA 1W88A 1O7IA 1DS6A 1SA0B 3A7EA 1CF9A 4RXUA 1GZDA 4R3NA 3D0QA 3P0HA 1THMA 3C7TA 3ZY5A 3OT5A 2IHYA 5CLJA 3FHTA 3AKEA 1FSSA 3AEKB 3OWHA 2ZE7A 1I4QA 3UAXA 5MF6A 4DC0A 3AIOA 4BCCA 1STBA 2AG1A 2X14A 2Z4RA 4IHAA 1H4VB 3KQPA 4AUEA 5M3MG 1XCGB 4UFOA 3H9CA 3ZPXA 3B3JA 3RJZA 3ONVA 5IWCA 4XB6B 4Y9DA 1Z7TA 4N8DA 1X7WB 3E9IA 2E7ZA 2ZJQA 1DO8A 2P7HA 3WQRA 2K33A 3Q11A 1E1QD 3CKYA 1XEAA 5EYPA 2YWXA 3KJXA 5A62A 2XCIA 1D1QA 1EFWA 1NRXA 1XKXA 2P0AA 1XQWA 1RYFA 2H1WA 3RHFA 3MD0A 2N75A 3KZMA 1GITA 2HHLA 2PEZA 3PEEA 4TL7A 2YV1A 4V0OA 2VPTA 1EIWA 3A74A 2LD4A 3AM4A 4XDHA 2FN3A 3O90A 3ELYA 1AK1A 2I71A 4B09A 1WSDA 1HORA 3R7WA 1DCMA 3J81k 4MWSA 2PRKA 1K4MA 4L27A 3H5RA 1GD7A 1NQVA 3TZDA 3KKMA 2FXVA 3FHJA 4XDZA 1XZPA 4IQZA 1HQYE 1NZJA 4BPBA 1BE0A 3JWEA 2EP5A 1U7UA 4B6EA 2WJPA 2BDOA 4UHHA 3L8HA 1JJCB 3CWCA 1D4AA 3GFFA 1HXYD 3WYFA 2HA4A 2AXEA 2O3UA 3WB0A 1UDAA 2SKCA 3T3HA 1GPDG 1HG0A 2AZXA 1XGKA 2P9JA 4F0JA 4EHNA 4BVEA 2B8GA 2D4AA 4YJHA 4TSFA 3NT4A 3Q6NA 4QICA 4Y6RA 2BHNA 1YVUA 3H5OA 3BF8A 1A15A 3D59A 1EFRD 1BAPA 2C57A 5MFZA 1YZ6A 2QE6A 2OXIA 3WK8A 4M0KA 1T2UA 4IO9A 2OGWA 2I78A 4KU4A