2AWOA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
372
structure length
372
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 91
structure length 372
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awoA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awoA01
1PLKA 4QBGB 1T9HA 4A3DH 2ZSEA 4ALPA 2GNOA 5DYIA 2DNCA 4MDEA 3GJ8A 2QNRA 2PX3A 1H9KA 1ZJ6A 3U5ZB 2IEZA 2CHVA 1TXYA 4PZ6A 4TYQA 3TUZC 4C2TA 2HQLA 3GTMH 1ETUA 4B3TQ 3X1ZA 1EFUA 2HJGA 4F4JA 4JI2L 1HPCA 5JJKA 4XWAA 3TAUA 4AYXA 3MRSA 4KHZA 4R4IA 4IPHA 1H8HD 3EZ9A 3QF4B 2IX3A 1WMSA 2A30A 4Q4AA 2JA7H 3KKNA 2RGDA 4IRUB 3OTOL 2Q21A 4FXPA 3ZZUA 3ND8A 5IT9c 5C0XJ 1GIAA 1GP2A 2YTYA 1YZGA 2YKGA 2ZVQX 1M7BA 4C0KA 1Z0JA 3SU8A 3EN2A 3D31A 3AVVA 1DVRA 4YQFA 4OO1H 2B6HA 1W2HA 1YZQA 3K9LA 3Q8XB 2RGNC 2ZI6A 2ZI5A 3AP3A 4OK5A 2Q3HA 1N6RA 4TLDA 3STBD 1XNRQ 1Q7YC 1GUNA 1DPFA 4JI8Q 5HGQA 2PNRC 2CHQA 2Z5FA 3HOZG 1D5CA 4JLVA 4LBWA 1N33Q 1OW3B 1S9HA 4X65Q 4N0DA 4YY3L 4RG1A 1XPOA 1E69A 4QXAA 3ADDA 4JLNA 4Q4AB 1KQSA 1RPZA 1T5IA 1Z9FA 1Z6YA 2NZJA 2PBRA 5CDFE 1P73A 1F2TA 2QM7A 1Q1QA 1RE0A 3EIHA 4P75A 2IX1A 1E96A 4QGFA 4V0OA 1MR3F 2JAQA 1X3GA 3CCSA 3QF7A 1O3YA 2HCJB 2Z0MA 2CHGA 2QORA 3TK1A 4IXMA 4Q21A 2VQFQ 1FNMA 1VYUA 2ASBA 5DSZA 5EP4A 1S96A 2IUUA 2GK6A 3WYFA 4M1WA 1P2UA 3VNVA 1EXMA 3IRBA 5BR8L 4R4OA 4Q00A 3BBPA 1SR3A 5C4XG 4I1OA 2D7DA 3K9NA 4C3ZA 4URUR 1W49A 1XD9A 1W0KD 2J9RA 1IONA 4LNQA 2CCGA 4LDJA 4A0HA 1FR3A 1MKHA 2PZEA 4NCIA 1Q1ZA 1YR9A 2WIAA 2A6HC 4NYJR 2R7ZH 4HDQB 4TYWA 1XB2A 1E2WA 3AUXA 5HY6A 3HU1A 2BDTA 1RIFA 4RZUA 5FPSA 1NLYA 4MNOA 1Q1BA 1F2TB 1W48A 2RGEA 1JR3D 3O8DA 3M4PA 1EG7A 2WZQA 4DUYQ 1OFIA 4LJZC 4GLAC 2V7QA 4RZ3A 1FFHA 4LJ7A 2QAJA 1Q3TA 3TSWA 3U58A 4K81B 4MUBA 3QKSA 4JYAL 1E9BA 1VKJA 4ZI2A 1J5EQ 2BBWA 4MRPA 4GOPA 2V9PA 3AP1A 4IPCA 4AD8A 3RWOA 3U6BA 4DK1A 2XTZA 2W58A 2ZU0C 3ZQ6A 3GFTA 1G3RA 3S17H 4JIMA 1C9OA 5IP7G 4X66Q 1T8UA 2WM9B 4KSBA 1H65A 1W4RA 5EXSA 3PEYA 2UKDA 2J7PA 5KPDA 2F1HA 5IT5A 2NG1A 5LB4A 1R10A 4FI3C 1E2MA 5FOTA 2BM0A 1F2UA 3BFKA 4KO8A 4QGHA 2EYUA 4DKXA 2GXAA 3CZQA 1R9TH 1ZUIA 3UE0A 4IOJA 1P2TA 2R65A 1W36D 1WDTA 3VTKA 3F1ZA 3SJAA 5IF9A 2VYFA 4OK3A 2GTPA 2OSBA 4LYFA 5JHHB 3U7FB 1KIXA 1MOZA 2HHHL 1JE5A 4HDOB 3KDFB 2XTMA 5H70A 4E22A 2F9LA 1JEDA 1T8TA 4O2RA 4R2HA 5FUXA 2HT1A 1CLUA 3TR5A 1I94Q 4JSTA 2B21A 1XU4A 1Y8OB 3CNNA 1IXRC 1Y8PB 2EDGA 2CE2X 3LO5A 2RGGA 4LUVA 3I4MG 4MGIR 4WZ6A 1GKYA 3RWMB 3T1YQ 1DADA 1OYYA 2QP3A 4ON9A 3SJCA 4LF6Q 1F2UB 5DHFA 3I1FA 3LX8A 3M9BA 4FW9A 2IL1A 2OFWA 4GOXA 4B3SL 3EQLC 4A3GH 1ZRHA 1ZD1A 4D6PA 2YVUA 2KENA 3IKJA 2CLSA 5IYDG 3BRWD 1KKMA 2EFDB 2FF7A 5CJPA 1NBME 3UDGA 3KL4A 4JT2A 4BZPA 2AUJD 1U0LA 2JA6H 1YIJA 1SULA 3MJRA 5UKDA 3GFOA 4OHZA 4PSAA 2Q3FA 3CXCA 2OESA 5EE1A 5KSPA 4NL4H 2XOKD 4JLDA 1Y1WH 4AYBG 2YZ2A 5KSYA 2FOLA 2OXCA 1CJKC 4JBYA 3Q7PA 1VG0B 5JBQA 1P62B 1IJFA 3TSZA 1IW7D 1NJFA 2YC4C 4DT1A 1N6OA 3B6YA 2ZJ8A 4GFDA 4LYAA 4DB2A 1HQYE 1E1RD 2K52A 3TRZA 2QMOA 2WBLC 4G1UC 4TL8A 5EZ6B 1C1YA 2BA1A 1HT1E 4BFTA 3CO5A 2DFNA 1GUGA 1Z07A 1FMLA 4BQSA 1GNQA 4HLUC 2JA8G 3I3SR 2IYSA 1X8KA 1KTVA 3UG7A 1UDWA 2OQ0A 4ILEA 2UU9Q 1W3SA 3CRW1 2IWHA 2EJFC 1SMXA 2NVXH 3IEUA 2AXNA 3OE7D 1MO3A 1D8LA 1GL7A 1MO4A 2JA1A 2ZRPA 3QG5A 5K36G 4JV5Q 1TQDA 5EE3A 4GN3B 4HYYA 1UADA 2R7DA 4PPNA 3U2QA 1CKNA 1H9JA 4DV5Q 4HAYA 1GNPA 1ZW6A 5J4LA 4DT1B 1II9A 1VF5C 4FMBB 4M22A 2B8GA 3I92A 4D4MA 3W3AA 3U6KA 3LY5A 4II7A 2AD1A 3FHOA 3GEEA 3BJIC 1UWVA 3ZVRA 1EGAA 2C78A 4JI4L 1NMYA 4BASA 1FUKA 1L2TA 3HKZG 1ASZA 1N9WA 2J87A 5FL7D 3S2DH 2O8DA 5FLMG 4U00A 5M3MG 4HDCA 4HB3A 4TTPA 1CEEA 1KMQA 2REOA 3VU9A 621PA 4E07A 1VQIA 4TL9A 1CKNB 1NL3A 2W00A 3EC2A 4MKGA 2JLYA 1NNEA 4B3MQ 2IYYA 1ZC4A 2FN4A 2YWEA 2N46A 3IPXA 4PAQA 3UIEA 1L4UA 3ZVNA 3GP8A 4A0FA 3EWAA 5G40A 1GAJA 1IYJB 2WMOB 1Z22A 2R2AA 1G41A 3PF4A 1SQ5A 2ZUDA 3EZ7A 2ASEA 2K50A 2DY1A 5FL7A 2N78A 1UBGA 3JZAA 1CULC 1MRNA 4IOKA 4YHHQ 4QKQA 1I6VC 1TU2B 5AUOB 3N5CA 1X1SA 3A36A 1XJVA 4Q02A 1IXRA 5B30A 4ME3A 2JA5H 4H13C 2DFTA 4BFYA 2WKRA 4TL7A 4ACBA 1E98A 2A2ZA 2UXDL 1N8RC 2KBEA 2VQSA 4P4SA 4YLGA 1XD2A 4F38A 2VIIA 3NIBA 1M1KC 2H5EA 2QRNA 2VRWA 3AF1A 5HE9A 3KJOA 4PO8A 1NJGA 5CK5A 1R4AA 4WVFA 3T12A 1GHKA 3LDAA 5EQTA 2CJWA 4PZLA 3DKVA 4DR1Q 4Z8XA 4MYHA 3T15A 3X2SA 4UY8C 1VIYA 4NH0A 5FBLB 1UKZA 4HB4A 3OZXA 5GJWC 2NZHA 2E5LL 3A5ZB 1HUQA 2GILA 2KSQA 4A15A 1NG9A 4AI6A 3DDCA 2O0JA 3TVDA 2NN6I 3AKDA 2WV9A 3AYHB 3FGNA 2ERXA 4X62L 5CLQA 3K0XA 1ZYRC 2OBLA 3QOFA 5FI1B 3FKIH 3UANA 3ND9A 4LYJA 4TLEA 1EFRD 4OO1I 1P61B 4NP6A 1Q46A 5LMUQ 1XD2B 2Y0SG 2IYZA 1M34E 1E2LA 2VHQA 2ZE7A 4GI7A 3CCUA 4HUQA 3C41J 1E3MA 2AN9A 5JEEA 1E7ZA 1ZU4A 4HAWA 1X54A 4LI0A 1HZAA 5CITA 4Q01A 1KK1A 1KO8A 3AVUA 2K5NA 2CJWB 4R4QA 4JL8A 4Q47A 3NDPA 3A6PC 3HOYG 1UDXA 2PEZA 4AG6A 1G3IA 1MH1A 2A5FA 1OE0A 1EX7A 1XEWY 3CF0A 4B47A 3RSOA 4NYJQ 1PH3A 4GKKL 1RVDA 3I2ZA 3I7FA 1GFIA 3IGFA 1CXZA 2E8GA 4JI7L 1EFRA 2XJ9A 4QBFA 4S35A 2ZU6A 3FOZA 1RYHA 1K5GA 2UXBL 3SBDA 4UNRA 4U7DA 1XXHE 3LNCA 4R98A 1QHSA 5JSZA 3RANA 1IN8A 4Q19A 4JS0A 4BPBA 3VR6A 4B3GA 4RD2A 1NG1A 3DM9B 2ZUBA 4HUQB 1B7YB 4OQFA 1S8FA 4DDWA 2ODWA 2VF8A 4IFBA 3QKUA 2B63H 1OJLA 1OXXK 1V1QA 4IFDI 4JVNA 3RRYA 4ASUD 5HCIA 1OXTA 2WWXA 2ZRLA 3GJ3A 4A3EH 4JI0L 4XVUA 4Q5IA 3U4ZA 3CCVA 1YRAA 1E94E 2K5UA 2WTUA 3DHWC 5C0XG 3C5HA 4IFDG 1QF9A 5B2ZA 3U7HB 2ZRDA 1GKIA 4JLBA 4PX9A 2GCPA 5DIFA 1U90A 1YHBA 1AKEA 5JSZB 2RGBA 4D4LA 3GLGE 4JJZA 2H57A 1TWGH 4HJ8A 1VDZA 1KY2A 3TE6A 4JVMA 4UJ5A 4ESHA 3JVUA 1K8RA 5GQOA 2IYQA 4XVQA 4KI0A 3CMAA 1CU1A 2ZYVX 4LPKA 2K14A 2CFMA 3PJRA 2JLWA 3C4JA 1XWIA 1BH2A 3C7KA 1S0UA 2ZRFA 2RHQB 2BHRA 2FZLA 2ZRKA 5F98A 2V8OA 4TTQA 2YNMA 1FQKA 2ZS7A 2GZHA 2CWPA 5IY0A 3BOSA 4JSYA 4PC2A 5DE3A 4B71A 5C4JH 3W1BA 4A3KG 2R93H 5IWAL 1OT3A 2CBZA 2W2VA 3VKGA 4JLMA 4A8JC 2Z6KA 3U4QA 2GVDC 4Q03A 3WXMA 1YVCA 1DG1G 4RZXA 2FZ4A 5BW8A 1NLZA 4EX5A 3AFPA 3P20A 2J45A 5KDLA 4EQ5A 2EWVA 3EBEA 1YR6A 1OF1A 2N42A 4I99A 1TL7C 4AYWA 5BXQC 1N6KA 3TW8B 1NBMA 1KGDA 3W5IA 1JNYA 4JMPA 3AFQA 4DV1Q 3CIOA 4Q4HB 1E0KA 4DIDA 4DLSA 5K8IA 3VNUA 4Z8YA 1KXLA 4X8MA 1HE1C 4QHTA 1XMOQ 3W3ZB 1N36L 4P0TA 4ZV4A 1VQBA 4RCYA 3GPLA 2NZ8A 1HJPA 2JJQA 3PEVA 1OHHD 3OYYA 5JS8A 2ZPTX 2HDNB 1SGWA 2ZROA 4DLTA 1VQ5A 1VS0A 5JEAH 4QBHA 3WRXC 2K32A 1OIXA 4QC2A 4LW1A 4RSGA 3WWVA 4AURA 2OE2A 3F8TA 3CX7A 4P73A 1NIJA 2O0HA 1SRUA 4A3JH 2NO1A 1G5TA 3F3YA 2DUDA 1LS6A 2K33A 4DR2L 1NY5A 4XSHA 1KOFA 4X8OA 1UBFA 5JMTA 3VR4A 2KB0A 3I4NG 4DK6C 4KHPQ 2H17A 4RJLA 3SFVA 4LF8L 1WP9A 3MWKA 3QIAA 4TYPA 2ZXUA 1YR7A 4B3RQ 5L3QA 4IQZA 2QENA 4LJAA 3VX3A 4BLOA 3QXHA 1GNRA 3SC3A 4QM7A 4QJ5A 1DE0A 3NBFA 1Z6XA 4NPSA 5CK4A 1EWHA 2KHIA 1Z2AA 5FTJA 4OBEA 2V54A 4NU0A 1KSHA 2I5LX 3NEMA 1F6BA 2GEVA 2GWHA 2W6JA 4AIMA 2YU9H 1QZXA 2DHRA 4G5SA 3O8BA 4PZ7A 3SBEA 3CF6R 3QXJA 4G7HC 1UEBA 4O2LA 1NN0A 4UQOA 1P2VA 4KKUA 3DPUA 4DV0Q 1Z0FA 3CKLA 1ZINA 4BEJA 3W9YA 4KU4A 3A37A 2WFWA 3RNLA 4LSGA 3EPLA 4OI1A 4TQAA 3IO5A 3T34A 2KCTA 3ICEA 1SLJA 2IUSA 4DAYB 3VR1A 1KIMA 2EJMA 1X6OA 1J8YF 3T53B 2VSOA 2YOFA 1ZM9A 2F7SA 4Q7JB 5DN6D 1HT2E 2LMCB 3QBTA 1R7RA 1VQ7A 2HUPA 3R9WA 2MO0A 4PR0A 3LW7A 5TVKA 2XZPA 2F1JA 1DEKA 2ODEA 1PYSB 2KBNA 4JI2Q 1E22A 1XMQL 4CEJA 3IIJA 2PZGA 2QAGC 1GILA 5KHOC 1YJ9A 1ZU5A 4ZCIA 4NONA 3NHBA 1GD7A 4JYCA 1X3EA 2AL7A 2TMKA 2KCMA 1G20E 1MO6A 4D80A 1XMJA 4IKEA 1GUAA 3RYTC 4JBJA 3IHLA 3L7ZC 3CCQA 2V6IA 1GL9B 4F7WA 1RC8A 3A1TA 3RS5A 3TZUA 2D2FA 2ZR7A 2HCBA 4A8JA 4G5RA 1SHKA 4GZYC 2BH8A 3U3RA 4A2PA 4CEIA 1G7RA 1XPUA 4G3XA 1A1VA 4ZPXA 2J1LA 2RB4A 4TVAB 2ZRBA 2E1RA 3HOXG 1CJUC 3K0AA 3Q7QA 2ZJZA 4DR3L 3CLVA 3MCAA 4PZZA 4TQ9A 4CEJB 2JLVA 2CL0X 4LJ8A 4DV7L 2FH5B 5CJ2A 3J81i 3T5GA 1R5BA 1HYQA 4LHVA 1E9DA 4NYIQ 4HLDA 4EDHA 3GLHE 3F5FA 2V6JA 3VFDA 2OAP1 2GZAA 4RVCA 5TDHA 4LFBQ 1UEJA 2QBYA 3R9IA 2Z6VA 2CLCX 5FLXc 2DR3A 1N6IA 5K8LA 1WFQA 3UE1A 2A68D 1SKQA 1OH6A 4L8GA 2FEMA 2Q2IA 4HZIA 5M04A 4M1YA 4B76A 2X2EA 5GJCA 1VYVA 3CH4B 2J0UB 3CRRA 1MJEA 4HAVA 2IS4A 1TF7A 1KSFX 3K0AB 5E7MA 2B8WA 4GNXB 2DN8A 3GTLH 2GEDA 2VP2A 1AJEA 2QE7A 1E0JA 1CSQA 4C3JH 2N1BA 4YMTA 1R5NA 2P65A 3U60B 2Q8IB 2GA8A 4CYMA 3IIKA 3K09C 3THYA 3AVQA 4DAMA 5IP7H 1IJEA 2W2XA 2QA4A 1E2IA 1E2ZA 4IOMA 3LGJA 4Q1DA 4D25A 2RF4A 2B7CA 5HR5A 4A3BH 4KBFA 5CB8A 2QBYB 3B1YA 2RHSB 4RFVA 1NMXA 3ZIAA 3L0OA 1M7GA 5C1BA 3H0GH 4DSOA 4G5QA 4J0QA 3T1OA 3EASA 2WPDD 4TSFD 1TKWB 2QY9A 1Z3IX 2VHJA 1CR1A 4JYAQ 2VHUA 1UKYA 1DGSA 3CUEF 3BORA 4M9QA 3B60A 3BS4A 1UKVY 1CJVC 1BYIA 1NMZA 3B9PA 5SZHB 2G0NA 4PHHA 3IEVA 2O8BA 3HR7A 2KWIA 1X6VA 1TPZA 4A3LH 2G0TA 3B7GA 2RHDA 1T5EA 4LPSA 3THYB 4AY2A 3WDNA 3PIOA 2EVWX 4GL2A 2YYZA 4QG7A 4DUZL 1AE3A 4BA2I 4HEJA 2NO6A 2OILA 2FMXA 4NBSA 1U94A 4IVPA 5AJXA 2QEXA 4JI6Q 1GITA 1FGUA 3AF2A 3GLGA 3AVYA 2O52A 3TQCA 4QY7A 3L2PA 3KFXA 4POGA 2DWPA 4LGMA 1PV4A 2FFAA 4N0EA 5CIQA 1VG8A 3KKPA 2LKDA 1LACA 3VX4A 5IYDH 3UXMA 2CK3D 4UP7A 1HH2P 2UUBQ 3L8YA 4IDHA 5JLJA 3RLFA 2WWYA 1JAIA 2ONJA 4FWIB 2D2EA 1QBKC 1TQ2A 3KX2A 3J7A5 3Q85A 2O8BB 4HZUA 3PCOB 2J46A 1SVKA 3EIQA 3KTAA 4NE2A 3T1QA 1JPNA 1FW6A 2QRZA 3V4RA 3UDIA 3OESA 2WB1G 3VR3A 3NH6A 1QHHA 3KB2A 3KXKA 5EJEA 5E7JA 3U4VA 5JCPA 2BMFA 4C2MH 4X64L 3HOVH 4LHZA 3IHWA 3GLGB 2V4DA 2A6ED 3ZJYC 4EPRA 1K0RA 1J6QA 4F93B 3X1DA 1E79D 4DR7L 4A0GA 3AQQA 4JI5Q 1DAFA 2O5VA 3IIMA 3OFND 4Z1MA 3TRFA 5GVSA 1X86B 3GEIA 5A0FA 2ZM6L 4DR5L 1COWA 1LTQA 2J0SA 1TWFH 1QDEA 1XJ0A 4BBRH 1T91A 2AFHE 2G1JA 2IWRA 5FPKA 1XNQL 3I8SA 3L2OB 3H2YA 2FFQA 4AQYQ 1FNNA 3OAAD 4LHYA 3GLFA 3VHXA 4LF5L 5K36H 3KTAB 4KKTA 2MMGA 4DKAC 3T1HL 2Q2HA 1EOVA 1QHHB 4CZ2A 1KL9A 1NE3A 4OONA 2ZUCA 5M3FG 2A5GA 1E79A 4DDTA 1GM5A 5CM9C 3ADBA 1E9SA 3ADKA 5HKKA 3AVPA 3UMFA 3P4YA 2UZIR 1FX0A 2FV8A 1EFWA 2GAAA 2WJJA 2ZRNA 2J0QA 5KDDA 1PFSA 3STBC 2A78A 3C15C 3RS4A 4E09A 1R6BX 1YZNA 1J70A 2MSEB 3C16C 2PZFA 3RLOA 2HF8A 4JZKA 4QFMA 3K9HA 4Q4JA 3K80C 1NSFA 4BBSH 4WXRA 3SE0A 1P8LA 1RJ9A 1XF9A 1ZAKA 2ZYWX 1HR0L 3GLFB 3CONA 1M1YE 3ER0A 1T5LA 2G88A 3CZPA 4A3FG 3TAHA 1HE8B 1XMSA 1QVAA 2FGJA 3E9HA 4BFXA 3B1ZA 1FJGL 1KY3A 1Y69U 2HLDA 3L43A 2A8VA 1UF9A 1OIVA 4LJ5A 3GEHA 1ZM2A 1E2EA 3F2CA 4LF9L 1FX0B 4LY6A 5FPHA 4MUAA 3W90A 4Q9KA 3A74A 4JI4Q 2ANBA 1M6NA 4EJSC 3MAAC 5TXGA 3H86A 3R7WA 2K5VA 1OV4A 3BK7A 3M4YA 1A0IA 4LC0A 4Q4JB 3W6PA 1VQ9A 1TUEA 1E9AA 2DYKA 4QOSA 1X8JA 1QUQB 1XTKA 3FMFA 1FQJA 2QTHA 1HTWA 2WSMA 4Z51A 4G5OA 3LVQE 1TU3A 2JJ2A 3PO3G 2XB4A 4DJTA 3CPEA 4LF4Q 5BYKA 2QP4A 3DOEA 2OCYC 4DSNA 3AVOA 1A8VA 3EIVA 1G16A 5EUQB 1ZUNB 5JS7A 3KUDA 1VQCA 5D3MA 4IFDJ 2WWGA 4O0AA 1YI2A 3AQ4A 4KFRA 4M2LA 1KKLA 1ZM4A 1I50H 1BIFA 2XSZA 2F43A 2HF9A 4IW3B 1I6HH 5LD2C 3PV0A 3HPRA 3R7WB 1WCV1 2BE5C 2JLSA 1IQPA 4MRRA 2F4VL 4H1VA 2PCJA 4LWCA 2JLQA 1FYCA 4HIKA 2IW3A 3EZFA 4LJYA 3H94A 1B9NA 4JT4A 5CIWA 2NPFA 3A5UA 2P67A 2E74C 4P3YA 5SZKB 3WHKA 3BH6A 3ERSX 1EWQA 3CC2A 4E5UA 4KFTA 5GROA 1Q0UA 1JAHA 2VP6A 4QHYA 4AC9A 3E9IA 2JLXA 4ZDWA 1W36C 2BVNA 3EC1A 4Q9IA 4OKSA 4YCUA 2XJ4A 1HZ9A 4M1KA 1ANKA 2VH5R 5A35A 4C0SA 4DV3Q 3HOYH 1GUSA 3G6EA 3AKCA 1NJIC 4PHGA 4Q66C 3GJ4A 3GLHA 3TUJC 1XP8A 2E5LQ 1UE7A 3PGZA 4ITRC 4IEIA 3D0FA 1Z06A 3SGIA 2V4ZA 4YWMA 2V7QD 5BN3A 1L8QA 4DK0A 2G1KA 4IFEA 3VKWA 5LPNA 3T1TA 4I1UA 5CYOA 2AR7A 3AEVA 2F3IA 3CB4A 3G0HA 4TZ0A 3TEHB 3HR8A 1VPLA 2JE6I 1AKYA 2G77B 3F2BA 1TUIA 3L82B 4OI2A 4A4IA 4YWKA 1VCOA 5FFMA 3LAWA 3AB9A 1KI8A 3OHMA 3FHTA 2BBTA 4UXJA 5EXPA 4TL6A 2FDCA 3FP9A 3LWNA 1A62A 5LMNL 2H1LA 4GDFA 1YVDA 2UUAL 1XTJA 2ZR9A 2C9YA 2I3BA 4ZO4A 3TSOA 4V0ME 4ZCLA 2QA5A 5DLQC 4NXML 2L15A 2J7PD 1WCMG 1JJVA 2GJAA 2MMCA 4EQ6A 2VPPA 1H95A 2PJZA 1E1TA 3EW9A 1V8QA 2A9KA 3RC3A 3GLHB 1N5LA 121PA 1TF5A 4QNMA 2QGNA 4EPTA 1VQ6A 4GKKQ 1AS2A 3KQLA 3ZDQA 2ATWA 3M6AA 4JK1C 1N0WA 1EFCA 4LWZA 1OTCA 5C3EG 3CRLC 1IW7C 3ULPA 2Q2TA 4HR7B 1G3QA 1I4DD 2GAOA 2F1IA 2KBFA 2QZ4A 3HFZB 1HA3A 2X19A 2ZI4A 3CPHA 5AUQA 5KYKA 4WXPA 1U5KA 1ZNXA 2Q3MA 1PH4A 2WWIA 4JOIC 4PV1C 1OFHA 3KDSE 4US2R 1V9PA 1XNJA 1F3OA 1QVFA 3HYRA 1GUTA 4EQ6B 4L5SA 3KXLA 8OHMA 1NLFA 4F91B 2NTYC 3KJIA 3CCJA 4K0KQ 3AF3A 2BA0A 4HIDA 3CX6A 1HNZL 1FPMA 1TWAH 3NENA 2PT5A 3B5JA 3QKSB 5F9HA 4PPGA 1N34L 4OHYA 4JI0Q 1VQEA 3D7MA 4A3KH 4LK1C 1XZPA 4PZYA 4DLWA 4GOPB 4C0QC 3IPYA 1YHQA 1PLLA 1BMFA 2QMUA 4POFA 1HV8A 4BZQA 3CWZA 3CCEA 1O7IA 4BY1G 3CCRA 1S40A 3R8CA 3HOWG 1PMRA 4A6XA 1XEXA 5M5WH 4KXFB 1SN8A 1XCMA 1UKEA 1IN7A 1I2DA 1QHIA 4MYTA 1LW7A 2B3GA 3J81k 1WBDA 1VHLA 3DMDA 1W5SA 4DCTA 2ATXA 5FUWA 3GTJH 2ZRGA 3B9QA 1Q86C 1IBLL 1JPJA 2VO1A 2P6UA 2ZJRA 4IJMA 4BXXG 4HUTA 2Z43A 1R8QA 1KK3A 1EESA 3H15A 1UEIA 1XTRA 2W6IA 3KUCA 1ZCAA 5AUNB 2RGNA 4BWYA 1AE2A 3CNOA 4TKOB 2K7VA 5GAHC 3CAMA 2EQBA 1DAGA 3P32A 3QNUA 4L5QA 3GLIE 1HNXQ 4TYYA 2IYLD 2QU8A 3M85A 4IDQA 4DRZA 1OPXA 1SKYE 4CVNA 1SVMA 1XEXB 2SHKA 3B85A 1KC8C 3DEFA 3FFAA 4TT3A 4DCSA 1YHAA 4MRSA 4QHSA 1WOCA 1TEVA 2K4KA 4P4UA 3PO2G 4XWOA 1N0UA 2MNAA 2A3RA 1XZQA 3MLEA 1HH4A 1G1MA 1QG4A 3E70C 5LBIA 3I4NH 2UUCL 2PMKA 1N36Q 3CRQA 5EAYA 4PHTA 2A69C 1EQQA 2NGRA 1KO5A 1XFAA 3RAPR 1SFOH 3ZLJA 3BH0A 4DCUA 2HXYA 2YOHA 2ZSDA 2ZREA 4DHEA 4KSCA 1IM2A 4Q7LA 4B2LA 1PUJA 1H9RA 3EX7C 4Q1AA 2V1XA 4LFCQ 1E2NA 2GN5A 4A93H 2GBLC 2L0XA 2QQEA 2NIPA 5BYJA 1OSNA 2GJSA 4O3MA 3PUXA 2Q9AA 2VSFA 3T5DA 4L15A 1HZBA 4D82A 2BEKA 5J4HA 4OX9L 1ZBDA 4LF8Q 4OWWB 3BERA 3MG9A 4RD1A 4DV4Q 4N3NA 1ZIOA 3WHLA 3B1WA 4GKJL 4RFSA 2V3CC 1FZQA 4KLKA 3RRNA 2FWRA 1D9XA 1CI3M 2OEPA 3BC1A 4GBMA 4JJKA 2WAQE 4JL5A 3PF5A 3W5OA 1NVVR 1OFTA 3QPVA 2PCFB 3O8RA 4DUGA 1BDOA 2E2JH 3HYTA 5C4MA 2QT1A 4YCWA 1N6LA 3VAAA 4L16A 4WZAE 1GDDA 5ELXA 3LW8A 1XEWX 1E2GA 1GRQA 4GPTA 4MKHA 2EFEB 3HOUG 2PMZE 4RCNA 1NMFA 2FPLA 4LJ4A 3QG1A 5IDVA 1US8A 1Z08A 4LRWA 2OTJA 1FOEB 2YWGA 2PEYA 3RN5A 2VEDA 4QGGA 1YQTA 5FTLA 3EZ6A 2DNEA 1P72A 1PHJA 3FMOB 1RRCA 2RH5A 4FWTA 2AUKA 3DXJC 5CM8B 4A6PA 3K1JA 1U8YA 3O47A 2ZS8A 1A6XA 2O8DB 3CBQA 3LXXA 2CE7A 4GRAA 4A3MG 4A36A 2VSXA 4HB2A 5DGXA 5AR1A 3HOXH 5GJBA 5IP9H 5DI3A 3VU9B 3E2IA 1NF3A 3KLWA 5HZKA 1YEZA 1ONBA 1T6NA 3FTQA 3HP1A 4KV9A 2A5JA 1VF7A 2ZT9C 3GJ6A 2WMNB 1CKEA 1GVPA 4A3DG 4R7ZA 3ZD7A 2ZE6A 1AM4D 1GJXA 3SS8A 3A0JA 1K8GA 2GZDA 3I5XA 1US8B 1W5TA 2W0MA 3CWQA 4HSEA 1LF0A 4IVRA 2OQKA 1RIPA 4PPFA 1JQLB 2XNSA 5JJIA 3D8BA 3KJGA 2GETA 4DNRB 3PENA 3PQCA 5C4GB 3DM5A 1ODFA 3WP1B 3K9GA 1JXMA 1P9NA 4QBIA 4TMTA 4Y0AA 2DCUA 4QIWE 4LFAQ 3EPHA 2YINC 3VR2A 4IXNA 1G291 4PG3A 3U3MA 3WRYC 4LHXA 3QI2A 2MO1A 2C8VA 3QEOA 3U9SA 2JA7G 2WVJA 4LBVA 3ZS9A 4M8NE 5DI3B 5FBVB 1B8AA 4DV7Q 3P4XA 4P4SB 2F3RA 1Q57A 1JJ2A 3MD0A 1UAAA 1QG2A 2OFOA 5FPTA 2NN6G 2OCPA 1Z28A 1VG1A 1AQUA 1KO4A 3A7LA 1DARA 2YV5A 2EXDA 2C03A 3NE5B 4OO1G 4FN5A 3EA0A 4PZ8A 4HLUA 4HATA 2KCCA 3CW2C 2N8NA 1JBKA 2QGQA 4G7OC 4I1VA 2QF7A 3DKPA 1GHJA 3RHFA 1WF3A 5EE0A 4V0MA 2GBLA 1Q1EA 4Q1CA 4B3BA 2BMDA 5FUYA 5E95A 1J8MF 1VMAA 3PUVA 3MXUA 1K6MA 3AGPA 4A4DA 4LBZA 2RAPA 4OQNA 2G9NA 5DNYB 3DVLA 1KI9A 4R9UC 4A3CH 2O8CA 3I56A 1OYWA 2OHFA 1N0VC 3SYNA 3AB3A 1NVUQ 1JJCB 2REXB 1Z7TA 2ZYUX 3CRMA 1Q81C 5KPJA 1E3PA 4PFSA 3W6OA 4P72A 2XAUA 3OOCA 4DPGA 1SXJC 4P4TA 4AKIA 2JQOA 1P7CA 2QM8A 2IUTA 3NEJA 2IS6A 1W46A 4EPYA 1UJ2A 2QQ0A 3ULJA 3OIWA 2ZYTX 4JVLA 3S15H 1YR8A 2PMDA 4EIWA 5KNBA 2ANCA 2G6BA 5IRCD 2IT1A 2ERYA 5C44H 4Q48A 4DV6L 3CM0A 4U5XA 2R7ZG 1H8EA 4LUZA 4X66L 3AKEA 3THWA 5HCNA 1E4VA 1FMJA 1Z6TA 4AWXA 3WBJA 1X9NA 4BECA 2O8CB 2P3SA 3VA7A 1KSJA 2ZQ5A 3FYHA 4DUZQ 1TX4B 1KYIA 2GJ9A 2ODNA 1NBMD 1PLJA 1SE8A 2BBSA 3FDIA 5C2JB 1K3RA 3I61A 3CR7A 1U8ZA 5KUTA 4C2UA 1Z47A 4GLXA 1KK0A 1ZM3A 3ZZTA 4Q1FA 4WZBE 1G21E 5KTYA 1JJGA 4FD2A 4IPGA 1A7JA 4LK2A 1M7HA 1GOTA 3EPKA 4BFUA 2GVAA 1PVOA 3TUIC 2C95A 3VMFA 2FPMA 4OYHA 4US1R 2Q9CA 5EP2A 4L5BA 5DISB 3THWB 4PAOA 3J81c 3LV8A 4OGQC 4MGKR 3T1YL 4B3CA 4M1OA 4ZIRA 5L3VA 5IYCG 1X8LA 5JWOA 3GLIA 2VA8A 2DFKB 5F3WB 2ODBA 1VCMA 2OO7A 2EJGC 2HIXA 2NOAA 2ZR0A 4B3FX 1D2MA 4AKHA 1W2GA 3WBKA 4BY7G 1JALA 3G4SA 4X64Q 4QJFA 4BLRA 1QRAA 4P31A 3J81j 4IO9A 5DYGA 3GLFE 1VQ8A 4DR7Q 2I0QA 3RZOH 1FP7A 4NMMA 5K8UA 3U4QB 1ZD8A 2ZM6Q 2IX0A 2ALYB 5FJ8H 1HZCA 4DR5Q 1S1MA 2EU8A 1G8YA 4G0NA 1FP6A 4LUOA 1UBEA 1P9RA 3KKOA 4M53A 4TLCA 5IK2A 3KQHA 2QPAA 1XNQQ 5DI9A 2BCJQ 3OIYA 1W4CA 3SDZA 2JA9A 1Z63A 3DM3A 2MSDB 4LJ9A 4RY2A 1IYUA 4LF5Q 3U50C 2W6JD 2JJ1A 3I4OA 4ZIRB 4V0KA 4MQBA 3CPJB 1NVWQ 4Q9HA 3GLIB 3T1HQ 1XEFA 1N5JA 1KAGA 4G01B 1EX6A 1SMYC 3EAQA 1YRBA 3IILA 4W5HA 4B33A 3CW2A 1SKYB 1KAWA 2AKYA 4OJKA 1S72A 1HURA 3I8XA 4DBLC 3K70C 5LDDC 2UU9L 4PAMA 1Q12A 1JR6A 4JI3L 2XB2A 1XJQA 1CKMA 2X2FA 3PUZA 1CUKA 3B82A 4JI1Q 5JWRA 3NC0C 1L1OC 3KJPA 2IF2A 1GSIA 2OCEA 3M3YH 4FMDB 4FCTA 1P3JA 4UP8A 3AVXA 4LV6A 3K7AH 2J5XA 2QGZA 1FTSA 2IXEA 3RVBA 3B6EA 2EIFA 1HCZA 3CP0A 1ESNA 3GFPA 3Q3JB 5E3HA 1SXJA 2YTXA 2A68C 5FTMA 2F3TA 4M1SA 3VKHA 4AKGA 1YNJC 3O8CA 5L3QB 2YJTD 3Q5DA 3OEHA 2GVZC 2ZAMA 2MFIA 3BB4A 4C0HA 4LF9Q 2NO9A 3T51B 1DO2A 5H1SE 2IXGA 3MWJA 3EIEA 5FBRB 4EPVA 1X3SA 3CNLA 1NN1A 2QSZA 4APVA 3KLRA 5KDOA 2YHSA 4JLOA 1VCIA 3T06B 4KN7C 1D8TA 1UE1A 1PH8A 3RLNA 1S4QA 3HWSA 4MGYR 4Q7KA 1NP6A 3RS0A 4BRWA 2DPXA 5CB6A 3TS0A 1XTSA 2QEQA 3HOZH 1GRRA 4DDUA 2GJKA 4FMCB 4AH6A 2BV3A 2JEBI 4XSGA 1YJWA 3WP0A 4AK9A 4GS3A 1YHNA 2JK8A 2ONKA 3NBYC 3OTOQ 5KU1A 4BGDA 2ZJQA 3M4QA 2CVHA 1WJJA 1M74A 3QKRA 4OJQA 4YDSA 2A1AA 3BZKA 2XNDD 2YWHA 4FCWA 1FUUA 3E1SA 2IS2A 1SHZA 3L0SA 1WI5A 1VQKA 1GG2A 2ZSFA 1G64A 1IY0A 4UKDA 3IDQA 2QG6A 4LYHA 4AYTA 3IBYA 2B8FA 3AVWA 2R62A 3OEEA 3UDXA 2GF9A 1RYFA 2X1VA 4NCHA 1R0WA 3EZ2A 2F4VQ 2HEIA 2PX0A 2YWFA 4HAUA 1X56A 1BO6A 2G83A 2DBYA 3KB1A 5C4XH 1VQPA 3BWDD 3GD7A 3R8FA 2UXCL 5AJ3L 3FPAA 1A2KC 4LF7L 4MKIA 4YY3Q 5FBWB 4DNTB 2XNDA 1UFQA 2QE7D 3LBNA 1KZ7B 3BIFA 4NB3A 4NXNL 1A5TA 1EIYB 4DR1L 3S1NH 3QKTA 4L9SA 2IHYA 3C8UA 1E2JA 4Q9LA 1XD8A 2GF0A 4CEHA 3KF8B 4XD7A 3QKRB 4E03A 3FKQA 3LFUA 3SNHA 4QQBX 2AD5A 1EWRA 2QL6A 3QXCA 1N5IA 3UMSA 4A8JB 4IDNA 5DHAA 1H9SA 4IJHA 2RCNA 1Z5ZA 3PG5A 1G3UA 4Z54A 3SQWA 4OWTB 2ZE5A 2WWWA 2GXUA 2I5MX 4FCVA 3ZIAD 4MKFA 2O8FA 1TAGA 1KJYA 4CEIB 2WSSA 4TMWA 4CGZA 3J80i 4CT4B 1W0JA 4PC1A 5BR8Q 3NWJA 5D3QA 5LMUL 1CIPA 3LQRA 1X55A 2ZTEA 3MFYA 3LD9A 3NC1C 4ZDKA 1OXUA 1PJRA 4P33A 3WNCA 4B2IA 3LNNA 5C3EH 2OUKA 2R6DA 2V1UA 3GCGA 3W1GA 3G71A 1GKUB 2C04A 4D4KA 2XTIA 3ZZ0A 2A6EC 2OTLA 5AJZA 1D7QA 4HJ7A 3UK6A 1E32A 1M8PA 1CR2A 3BGWA 2UUAQ 4DEYA 2JASA 1TQ4A 1Y1VG 2C9CA 2QSYA 4AKEA 4KN4C 2N49A 1S2MA 2VQEL 1TADA 1Z83A 1H9SB 2WAXA 1G6PA 3MMPA 1JI0A 2PJRA 1R0ZA 1SVSA 3REGA 421PA 2O8FB 1SVOA 1Q44A 4V02A 2O5JC 3IBGA 1EQRA 2AX4A 4EFMA 1Z6AA 3R9XA 2EYQA 2DGYA 1G17A 5J5CA 5DO9A 2ZM5A 2FGKA 1HNWL 4JBWA 4JKYA 3TW4A 1W44A 2CVFA 1DD2A 3TLXA 3K81C 4IHQA 3TGPA 2AWNA 4XIGS 1QZGA 2IF0A 1D2EA 2HYDA 3HPQA 4WAUA 1JQJC 5F2EA 1WBBA 3CPWA 5JZVA 3I4MH 1KO7A 1NN5A 4GP6A 3FHWA 1X1RA 2A5YB 3I5YA 1OB2A 4UXHA 2HV8A 4B75A 1N5KA 1NY6A 1FL0A 2CL6X 2H18A 2J41A 2QT0A 2R6AA 3X1XA 5KO2A 5SZIA 1MKYA 4BXXH 2IHBA 1JR3E 3N70A 2WAYA 5H8WA 5GADl 3DMNA 2E75C 1HNZQ 2GKSA 1VTKA 1DG3A 1N34Q 2F1RA 4ZKDA 2ZRIA 4FDBA 2WICA 2QAGA 2HHHQ 1C0AA 1DBSA 1AIPA 2IYVA 4Z1MD 4M1TA 2R92G 3DZDA 4B34A 2XTNA 4C3IH 3P1JA 4F92B 1COWD 4PXAA 3I32A 1YE8A 2RGXA 4AIIA 1BBUA 3OIUA 4QJ4A 5BN5A 2WWFA 2RGCA 3C14C 5E4FA 2C5LA 2BJVA 1XTDA 1PA6A 3TQFA 3UKDA 4DSTA 2BKEA 2XEXA 1T4GA 4GMXA 3AGQA 1BKDR 4PTLA 2QMEA 3PO2H 1X3FA 1LNZA 3MWYW 4B3SQ 2E2HH 2ZETA 1J7KA 1L7VC 5FPYA 3S1AA 3T35A 3W5JA 2ID0A 4ZI3A 1IBRA 2WKPA 3QPWA 5HKKD 5J4KA 5E7NA 1FTNA 2JEOA 2JA8H 1E9CA 2QAGB 4H1UA 4C30A 1DAKA 1Q82C 1K8MA 3A4MA 2FNAA 1IBML 3SEAA 3NBZC 1CF4A 1BVSA 1LUZA 1CJTC 3PCRB 4JBKA 1L2FA 1IOZA 4HZUB 1UE6A 3LBIA 4PC6A 4WJ3M 2E87A 1S3SA 1AK2A 3QJYA 1E99A 1P75A 1ZUHA 1LS1A 3ICQB 3W34A 2NO0A 4P71A 2WP8J 3M1IA 2E76C 3U3JA 2R93G 1LF5A 4I4LA 2OV2A 3F0TA 3PIRA 3EWSA 4BFWA 2HXSA 2UUCQ 3CC4A 3SJBA 2HLDD 3KQNA 3S1AB 2VY3A 1XBTA 1PZNA 1K8AC 3TH5A 4D0NA 2F9MA 5L3RA 4KFUA 3K0FA 1NIPA 2B8TA 3THOA 3RC8A 4V0NA 4YMVA 2ZIAA 4DEXA 5FLMH 2NVQH 5M3MH 1IBKL 3K09A 2FEOA 1OKKA 4TWZA 1VQHA 521PA 1HTPA 1LV7A 4KHPL 3QXSA 2QMHA 3BU2A 2D06A 1KJZA 4D2IA 2JIZA 2W2TA 4DLRA 1GWNA 4B3RL 3JZMA 4KVAA 1WYDA 4ZDJA 3AEZA 3HOUH 3JAMc 2PLRA 2XGTA 2JJ2D 3B1VA 3PVSA 4N1AA 4OX9Q 1Z0DA 4A76A 2R6GA 3MGCA 4GZLA 5AJWA 2ZEJA 3SR0A 2Z83A 2ECKA 4C7OA 2B29A 1WXQA 3BD9A 1I2MA 3PFIA 2CEAA 1G8PA 1XCPA 1WRBA 1VQAA 3K0FB 5F9FA 4KKSA 2OCBA 1VQOA 1YJNA 1G18A 2RGAA 4A3JG 2XSZD 2V55B 4TMVA 3RDPA 1RJ9B 3EXAA 1VHTA 3RS2A 2WJHA 3VHLB 2F55A 4DLUA 4A3MH 1Z8FA 1NI3A 2ATVA 3B13B 2GEUA 5IHPA 3LX5A 1NSTA 2VHCA 1IN5A 1B9MA 4YMSA 3GJ0A 2F1MA 1YJ5A 3PUWA 1Y63A 1ZYUA 4URWR 1WQ1R 1G5RA 4Q1BA 4TN1A 2NMVA 4C7OB 2J7KA 2QUZA 4LCBA 1A82A 4I1SA 1UBCA 3C5CA 5FOXA 4BLQA 1KI3A 3I55A 1U9IC 3QBVA 2D0PA 2ZSBA 4QL3A 4W7SA 2FX3A 3A1VA 4R71A 4OI0A 5JI2E 1E1QA 3KQKA 4DCVA 1J90A 1GTVA 2VP5A 5ELOA 1TU4A 1ZIPA 2OZEA 3SJZA 3JC66 4LV8B 5HE8A 2UXDQ 1MO5A 1JECA 2D3WA 3A4NA 4GSYA 1VQJA 4LOAA 4A1FA 4GZMA 2LSSA 1NVXQ 1GL6A 4DSUA 4NKRA 2NN6H 4KYIB 5K8TA 1ZNZA 3ZJYA 5HPYB 4IDPA 3CRVA 1BYUA 1VQFA 3KOJA 1G5PA 5D3MB 1Q90A 1PUIA 4CT5A 1KI7A 3G48A 3RN2A 1P9WA 2N3SA 2I1VB 4HAXA 1NMGA 2QTVB 2W0SA 4OQXA 4GOJA 4ABYA 2F43B 5FR1A 1CR0A 4B74A 1H8HA 1Z0AA 4TLBA 4C0JA 1GVNB 1QZHA 4H9GA 3MWLA 2IC5A 3G82C 1VG9B 4W5JA 4X62Q 4D0LB 5B58C 4P32A 1ESMA 2WJVA 1LYLA 4LC1A 2IXFA 2ZSAA 1VQGA 4PPQA 4O0MA 5JCZA 4RKFA 3CCMA 5G53C 4LFBL 5FOSA 4DR6L 2BOVA 4B48A 2AK2A 1LFDB 5EUMA 2VZAA 2AXPA 2LKCA 5GAEC 1K5DA 2WOOA 3KFVA 3Q72A 3FPPA 2X77A 1OB5A 2FSFA 2JJ8A 4GLVB 3S1QH 4URXR 2VL7A 1T0JB 2IK8A 4CF7A 2H5XA 4JI7Q 3S1RH 1DOAA 2JDID 5FL3A 3S24A 3EARA 4IOLA 4TMKA 3RS3A 3WMGA 3GDEA 4B6EA 5C0XH 2OAQ1 2ZE8A 2UXBQ 4IFDH 4QGAA 4KLNA 2UZ3A 1GO3E 3AP2A 2XZOA 2IEYA 3IUYA 3TR0A 1BMFD 1NKSA 1WE2A 3GJ5A 4IOCA 5EE9A 1LB1B 2AHOA 1TWCH 4P74A 3RR5A 5IYBG 4JLPA 1AH9A 3E0EA 4K8OA 3ETLA 5GJVC 3IFTA 4DNIA 2H7VA 5JECA 2AK3A 4DB4A 2ZANA 1A4RA 5B57C 3JAMi 3J7ZC 3ONWA 4GT1A 1XCGB 3L0IB 3TKLA 3I4LA 1MT0A 1Y14B 1QHGA 4EJSA 3ZQJA 2JDIA 1CSPA 1Z0IA 5FBQB 3SHFA 3A7AB 1KDRA 1W0KA 1Z29A 2CL7X 3KDFA 2K5HA 3S14H 1RKBA 2CDNA 2W6ID 3DO6A 5J40A 5J4YA 3FB4A 1Z6HA 1PH6A 2P2LA 2ZJOA 3Q5EA 1N2CE 2BE5D 4C0AC 3SHWA 4DV6Q 1LVGA 3KKMA 4QRHA 1JR3A 2KI5A 4WA7A 1S3GA 3WYGA 3W6NA 2HJVA 4PO9A 3A1UA 2KHJA 4PSKA 4A3BG 1E2DA 2AHOB 4LZZA 5AJYA 1B70B 2OBMA 3MSXA 3TBKA 1P4SA 1P16A 4JI6L 4LV5B 1MABA 5AK0A 1RFLA 2JCSA 3H0GG 5IYCH 1AZTA 4TT3D 4V0LA 1VQLA 5TARA 2R7FA 2VP0A 4RCZA 4EFLA 3SYLA 1A63A 3BFVA 1U9IA 1IL2A 3UWOA 1T3LA 2P6RA 4BY7H 1YKSA 4EJSB 2OWOA 4Q7MB 4R1JA 3GO5A 2VUMG 2GCNA 1QVRA 2UUBL 3EG5A 3THXA 2VL6A 5IWAQ 1U81A 2QPOA 3LA6A 1DCZA 4UPAA 4LJ6A 4PHFA 4NHOA 2CCJA 1AS0A 1BBWA 4A3LG 3NXSA 4AYBE 2P5TB 2CXXA 4UNSA 3PXGA 4UXIA 1R2QA 2OXRA 2RHMA 1W1WA 2ZJ2A 5JRZA 1G9XA 1E2HA 2ORVA 2X8AA 4EUNA 3FMPB 3A58B 3CCLA 1D6JA 1P6XA 4TMXA 2A6HD 1MABB 4XH9B 4H44C 4MTNA 2EW1A 4A92A 1YBYA 4JI5L 2XGJA 1ZNYA 4DV2L 2PNHA 2VNUD 1N32L 4NYMR 5LD2B 3MUFA 1G8HA 2A7QA 1SVLA 4A3IG 2IYUA 3A1WA 3VR5A 1YZUA 4L5RC 1A2BA 3BFXA 2REBA 2GRJA 4YMWA 4URYR 5G3ZA 5AWFC 1CRPA 5FUVA 4B32A 2WOJA 4NCKA 4AQYL 3RSLA 1D2NA 3NTUA 1KDOA 3A8IE 1OLOA 1E2PA 3U3KA 4GMDA 4C0BA 3QE0A 4B43A 1NRJB 3M0EA 4M0LA 2BWJA 1QHXA 3B2EA 4HIMA 1I4LD 4DUGD 4EPXA 3TJZA 3M7NA 3K8AA 4DR2Q 3HOVG 3FHCB 4KAXA 1XX6A 2ZRHA 4UNPA 3AUYA 3V4FA 2GDJA 1SVIA 1W36B 1TNDA 1VECA 4KBGA 4MYUA 2JEAI 2WIBA 4HLQB 4PANA 2BC9A 4DR4L 1CKOA 4FMDF 3FE2A 3CF5A 4PQFA 4BFVA 4OQMA 5J4VA 4BBRG 5FTKA 4YONB 1Y8NB 2KA7A 3HKZE 2XOKA 4QNRA 3PEWA 3DLLA 4RMFA 1KDTA 3N2IA 3BDOA 2J59A 4JI3Q 5TY0A 3VDYA 1PH9A 3GTKH 1E9RA 3LQQA 3LXRA 3P26A 3R20A 5BQ5A 4YMUA 1SXJE 2V1CC 5FH9A 2A19A 4TLAA 1XJCA 2BEJA 3H0KA 1E1RA 3PR1A 2VF7A 4MRVA 3AH8A 3A8JE 3RNUA 2ORWA 1QHNA 1EWIA 4JOIA 1G8FA 1HY3A 1PH2A 1YZTA 2GJ8A 1K8OA 4G5GA 4J15A 4F4CA 3CPFA 3A8KE 1DELA 1P60A 3TNFA 1JT8A 1CJMA 4B35A 3HDTA 1LTLA 4B2PA 1XDBA 1Q22A 2Z4RA 4Y7NH 3HGBA 1F5NA 3NHAA 1Z0KA 1SZPA 3OE7A 4RFSB 821PA 1YU9A 1C4OA 3WNBA 1AGPA 3THXB 5GADC 1CS4C 1G6HA 3TQYA 4B3TL 1HQMC 2JXMB 4FMCF 1JJ7A 4BBSG 3D6TB 3FMCA 3A8TA 4JYBA 2GK7A 2WAQG 3I73A 2ZRMA 4A2WA 3BB3A 3GQBA 3GTOH 5KNDA 2D62A 1ASYA 2GHIA 4M4SA 3A1SA 1XMQQ 3N2EA 1QVGA 4LF4L 2C77A 3H3VH 1BS1A 4O25A 4URZR 1ZC3A 4DLYA 1C9KA 2LXJA 1VQMA 1UM8A 4PSVA 5A4JA 3VQTA 4L4UA 3H1TA 3T56B 1LABA 2WWHA 2ZRJA 1U2RA 1J99A 3F2DA 2O5IC 1ZMXA 1IN4A 2ZS9A 4M9SA 2VLIA 5EXTA 2RKOA 3CR8A 1O78A 1U98A 2H92A 2PPBC 1IYVA 3S16H 2A69D 3GJ7A 2PL3A 3FMIA 4F4IA 3T1VA 5JI3E 3CRKC 2IS1A 5JEDA 3I72A 1XNRL 2Z6KC 4JI8L 3DZ8A 4OHVA 3WY9A 2ZTDA 4B73A 1NBWA 1N33L 4X65L 5FOVA 5LB2A 1IXSB 1KRSA 2Y0SE 4DR3Q 1CBUA 3ZS8A 4DLZA 5KSOA 2WKQA 1T3HA 4PO1A 2UXCQ 2HIVA 5AJ3Q 1Z6GA 2FPKA 2VP4A 4KFSA 3H4MA 2XXAA 4C3HH 4LF7Q 4JBXA 2AWOA 1Q8KA 4YXWD 4Q9JA 1TF2A 2E9SA 1T0HB 1Q21A 3HKSA 4NXNQ 2IYXA 3SFZA 1W47A 4DV3L 1S1CA 1JEEA 1AGRA 2VQFL 1ZVQA 4NYIR 2CWAA 3SZRA 4DC9A 2PH1A 4OWXB 1Y1VH 4WBSA 3DL0A 1PYBA 4IEEA 5CDFA 4A82A 4CIDA 2H16A 4DIEA 3W8NA 1DS6A 1SROA 3WYAA 3ZGXA 4YXWA 1FVIA 4ESVA 5KNCA 4RD3A 2AFIE 3PIPA 5L8VA 2D74A 1RL2A 1KAOA 1NKTA 2BKUA 4X6AH 2ZI3A 4BE7B 2XXAB 4WJ4A 2CCZA 1H8ED 1L4YA 1WA5A 1AN0A 1R0YA 2P0EA 4C4PA 3LRPA 4DUYL 1AQYA 1EFHA 4OQLA 3SQXA 2BBOA 2ZRCA 4QJ3A 4GN5A 2D7CA 4M1MA 2ZJAA 2HT6A 1Q20A 1KI1A 2DWOA 4HJ9A 1J5EL 3BJUA 1B0UA 3B8HA 5BWMA 2VQEQ 3GMTA 3QSYA 2GESA 4C0LA 1KK2A 3ZD6A 1YZ6A 1G4AE 3KFUA 2AMCB 3QQ5A 3T61A 1RW4A 3D3QA 3BZCA 4JLAA 4JG2A 2MSCB 4DVGA 1HNWQ 2R92H 1R0XA 5FI0B 2L5TA 4H0LC 1N6NA 2J0VA 3V00A 1I4TD 4BLSA 1ZP6A 4YC7A 3SYKA 2BMJA 5JEAJ 1U8AA 4CW7A 1ZNWA 2AKAB 3KJEA 4B44A 4LHWA 5P21A 5C0XI 4HI0E 2XZLA 2O8EA 4K0KL 1KO1A 4BA1I 1IHUA 4NZYA 1RZ3A 1KRTA 4XVRA 3K0SA 3QENA 4NCNA 2OM2A 1W2BA 2MQHA 1W4AA 4R2IA 2NQ2C 1I94L 1VIAA 1E4YA 3CX8A 2H8KA 4W5WA 4DZZA 3B1XA 3UPUA 4KCGA 4GN4B 4XOIA 2BIFA 2EQSA 3K7UC 3BE4A 1CTMA 3U7EB 2R44A 4HLCA 6Q21A 1X65A 1M90C 5EP3A 5IK2D 4Q4HA 4ASUA 2ZRAA 4EFNA 5SZJA 1E0SA 4LF6L 2CNWD 2OG2A 1XRJA 4KODA 3WNDA 4PQRA 3FVQA 2E2IH 1KSGA 2R8RA 2O8EB 2Q2UA 1NN3A 2JJ1D 5M3FH 3FWYA 3WMEA 2NZOA 1KHTA 1P5ZB 4HJ5A 1PH7A 3AKYA 3RRMA 5L3SA 1N25A 4X8HA 3I62A 2IYTA 1J2JA 1HNXL 3IQXA 4KLZA 1E6CA 2CLDX 2Q9BA 4UNNA 5ANRB 1LM0A 2ZTCA 2ZI9A 3J80c 4KYUA 2QP9X 1K9MC 2I4IA 2ZTSA 3QXXA 1U0HC 3ECCA 3LLMA 1N6PA 4GNXC 1IBMQ 3M4OH 1DAHA 2CNWA 3A4LA 721PA 5JWHA 4A9AA 4BZXA 4BEBA 5C46F 3UG6A 4NYMQ 1WB9A 1VYTA 2FU5C 1T3SA 2GXSA 1V43A 3D4RA 4S2EA 1GKHA 2Q0HA 1O87A 1AA9A 1R5OA 3KZ1E 1YNNC 4A3FH 4A3GG 3GTQH 3N6RA 3KF6A 4JC0A 2ZJPA 3GTGH 1E9EA 2FA9A 2WJGA 1NY4A 4YDHB 3G5UA 1GZSA 1GUOA 4Q4LA 4DK3C 2R6CA 3ADCA 1TEXA 4MRNA 4WIAA 3PUYA 5L3SB 1SXJD 4KJZA 1E24A 4YCVA 1ZKOA 2JA6G 5G41A 1HR0W 1M2OB 2OLJA 3ZYCA 3OPOA 3OEHD 1V5WA 2CCKA 3SI7A 5G3YA 4LFCL 1N3BA 1Y1WG 1IXZA 4JV5L 2BJWA 3E5HA 3NKVA 1IY2A 2C99A 3IQWA 3GTPH 1JXOA 1B23P 1P2SA 2ZJYA 5JJLA 3QVUA 2P5SA 3AM1A 4DV5L 2C96A 1OXVA 1HR0Q 1IBKQ 1EFTA 4XJXA 1DAIA 2PI2E 3BH7A 2LWIA 5H68A 4D4JA 2PQAA 1DO0A 3QPUA 4L9WA 1OHHA 4G7ZC 3PO3H 2B92A 3KF6B 3PSIA 1FJGQ 5JFGA 4XTRA 1NVVQ 4DV4L 3K0CC 5KOYA 1XMVA 2EWWA 2ZJ5A 3QUSA 2R6FA 5KSZA 1C7YA 1YNXA 4WOPA 1G6OA 1XTQA 4MDFA 4MITA 4M9XA 1QHYA 2BCGY 2WJYA 2VHTA 1NTGA 1W7AA 3SN6A 3IO3A 2CKZB 3CMEA 2D2CC 1CP2A 5B64A 3HU3A 3NELA 4OXPA 2IHFA 4A93G 3ASZA 3H84A 1JB7A 4HAZA 2QI9C 3TMKA 4KVGA 4OHWA 3B78A 1F48A 4DLVA 1II0A 2OT3B 3BG3A 4X8LA 3SOPA 3OEED 4B3ML 1L0WA 3UDFA 4H02A 5FOWA 1KI4A 4HJAA 3BXZA 5EXXA 4A0RA 1RRPA 3REFA 2PQAB 1KD1C 2JLUA 1E0AA 4V03A 3RS7A 1E2VA 4LX0A 3FKSD 5AJVB 1II8A 1SXJB 2NPIA 3QVVA 3UATA 3L0PA 3S1MH 2AKWB 3LBHA 3RABA 2JATA 4RZ2A 5CYPA 4DXAA 3V9PA 4LUCA 4YHHL 2VTKA 5H1YA 5E7IA 1OIWA 2I5HA 2IA5A 3CH5A 4JLKA 4XD7D 1KZGB 3K8YA 3UWKA 5FR2A 1KDPA 2FE4A 2DFLA 1YZKA 3ZH9B 5TMPA 2WJIA 1VQNA 1TQ6A 1KNQA 3CC7A 221PA 2VP9A 4NDZA 4NTZA 1JB1A 4GOKA 4UJ3A 2WSSD 3RRZA 3FKSA 4ZKEA 4PMWA 1W0JD 1E2QA 1OH5A 5JHGB 1CTQA 4QM6A 4DCNA 3QY0A 4MGZR 4US0R 1F60A 5DN6A 3ULLA 4YWLA 1II8B 3NG1A 1D9ZA 4B3XA 1OXSC 3MEFA 4NPHA 4ERNA 2ZJBA 3H3VI 4AG5A 4BLTA 4HIOA 3OIVA 3EA5A 1AZSC 2C9OA 3AF0A 1WCMH 5FTNA 4IJLA 1MIUA 4LFAL 2FSIA 1G7SA 2J0UA 4D81A 2ORIA 3K53A 2JA5G 3K70D 4Y0VA 2IBMA 1BOFA 2YC2C 2Z4SA 4KITB 5IP9G 4GNXA 1GRNA 2C35B 4IPDA 4MH0R 3U3OA 1TTTA 2CQOA 1YITA 5LMNW 3TVTA 1MV5A 2WHXA 1KI6A 4XWKA 5TB5A 1ELOA 2IYWA 4CDGA 1ZCBA 4PQYA 4ZDIA 4DR6Q 1R8SA 3KJHA 2EFGA 5IYBH 2XX3A 1IAQA 4CEHB 5LMNQ 3TIFA 2OCAA 5GVRA 3HU2A 2BMEA 5GAGC 2F52A 2FJUA 4NXMQ 4HB0A 4MA4A 2HYIC 2PLFA 4BRUA 1W4BA 3NH9A 4WW0A 4DLXA 4M9ZA 5C18A 5J3BA 4UNQA 3WMFA 2P6NA 2BM1A 1G7CA 1CFMA 1SVWA 2EFCB 3FKIG 1L1OA 4TQUS 2GCOA 2FSHA 2OLKA 3MXNB 4I81A 4I7ZC 3U61B 1BKBA 1MJCA 2FSGA 2EFHB 2D4HA 1KMHA 3DOFA 4FIDA 4RD6A 2YTVA 5M5XH 2PCLA 2NVTH 4BY1H 1ZM7A 2QN6A 2YOGA 5EP1A 3BB1A 3HOWH 2IY5B 1KI6B 4EAQA 4KMUC 4UP9A 1I5FA 1XMIA 2JLRA 4K46A 4DWJA 3K0CA 4IDOA 3MJHA 5M5YH 1FL9A 1XXHA 4MYCA 2ES2A 4PC7A 1LY1A 1KI2A 1RRFA 2O0KA 3NBHB 1S9DA 5CLLA 2G3YA 1VQDA 2K75A 3TS2A 3K70B 2IHEA 2I1QA 3K0EA 3NVAA 4FINA 4M21A 5BN4A 4TTRA 4EKDA 4B3DA 3CF2A 3L8ZA 3X1YA 4W9MC 1HQCA 3RZDH 1KJWA 3OW2A 5EE5B 2B7BA 2VUMH 4JVSB 3FFBA 1L1OB 1JMCA 2GCOB 4BUJA 1OFUX 4CRWB 4JL6A 5IE8A 1KNXA 1KMHB 1RRGA 2LCFA 1G8GA 5DH9A 4BFZA 4D0GA 5HZHA 1XTIA 4A3CG 3AF4A 4TMZA 3PEUA 4GNKA 2KE5A 4GP7A 3UMRA 4RD4A 2WB1E 2FFHA 2B63G 3KKQA 4QGUA 5ELNA 3KXIA 2WPDA 4TSFA 1XXHB 4A75A 2ZITA 4OK6A 3NEYA 1G19A 3EPJA 3U44A 2J3EA 1IBLQ 2FXQA 4A3EG 1PH1A 4DDVA 1CRQA 1YZLA 5AUPB 4L5TA 1EUJA 4C9BA 3U7GA 2CMKA 5C44G 2OFXA 2W83A 1OH7A 4JCVE 4XTCS 1DXMA 1KHIA 2ZI7A 4A3IH 3LVRE 4PC3A 1G7TA 2PT7A 4Q1EA 1DTSA 3ASYA 3KQUA 1G51A 4O2DA 2F6RA 2QPTA 2OBNA 1EIFA 4ARZA 1K83H 4D26A 1N6HA 2XITA 1TWHH 2JGNA 2QROA 3AVTA 1IN6A 4DV1L 2KJQA 3GJXC 3QEJA 4OL0A 4JBMA 4RKEA 5A5GA 4B6FA 4U02A 1S3OA 3AV0B 4LBYA 1XMOL 2D5DA 3TREA 2C2HA 4TYNA 1IZ6A 1UPTA 4Y52H 1OKKD 4BFSA 5HTKA 3U44B 1ZD9A 3NDBB 1OH8A 1CR4A 1HEIA 1U99A 1G3MA 2CK3A 1QJOA 2BDOA 3CD6A 2JIZD 4DV2Q 2Z0SA 3KYHC 2CW0C 1N32Q 4URVR 3Q8DA 5FOUA 3Q9LA 3CQZH 4ZCMA 4IOAA 2NO7A 5DLQE 1VCNA 2IYRA 1UE5A 3S2HH 2QTFA 2ZAOA 1TMKA 3ZVMA 4IVQA 4ACAA 4ARZB 1E9FA 5TV2A 1IY1A 2FFBA 3PITA 3ZVLA 4OHXA 1E1OA 2VBCA 1I3QH 1H9MA 1PH5A 1O7LA 2R9VA 2EVBA 4OI4A 2Q6TA 1K73C 2VS1A 1MRSA 3HJNA 4RD0A 3OFNA 2GVBA 5J47A 1Q3HA 2JLZA 3LH5A 3NBXX 4L8JA 4R4CA 1E2FA 4DR4Q 5JRJA 1G4UR 2A5DA 4R4TA 1VQ4A 1AS3A 1DAMA 2DWQA 3JVVA 4A2QA 5JEAG 5FJ8G 1Z2CA 1XPRA 2PI2A 4GKJQ 4EPWA 3OAAA 4Q18A 3X1WA 2BH2A 2NVYH 4JI1L 2C98A 3BAFA 4JLJA 1QVCA 2RMKA 2Y8EA 2D0OA 2LXKA 4GOPC 1QUQA 2ZVPX 5EZ5A 1Y3AA 2FG5A 2UVQA 2DB3A 3LLUA 3P27A 4JKIA 3W8RA 1EYGA 1DAEA 4QL5A 3LWUA 2GXQA 3QF4A 1E1QD 4TZ6A 3OW7A 4DV0L 1E2KA 1ONLA 4BLPA 1EK0A 4NCJA 1U0JA 4POAA 2VW9A 3OF5A 4MZ9A
chains in the Genus database with same CATH superfamily
1NVKA 5BV7A 1D6MA 2PX3A 2QNRA 4V1CA 3NNDA 4H2DA 3ZE8A 4D97A 2ZT6A 1P0PA 3ENZA 1EFUA 4FZ5A 1T4CB 3Q12A 1MVNA 3EEBA 3GTKB 3QF4B 5AM2A 2VJAA 2Q21A 4RZQA 4JBHA 5NUCA 3JQ7B 4XT1B 5IT9c 2JGAA 3JALA 2B6HA 2IUEA 3OMLA 1B44D 1XNRQ 1KZHA 1L5ZA 1N33Q 3ZJUA 1E64A 4UHEA 3FCYA 1G2TA 2RDHA 1MR3F 4BNMA 4MGHA 2QORA 4MDHA 5C4HA 3EFOB 4HAOA 3DXZA 4URUR 2OB1A 4A0HA 2FK7A 3FRIA 1U4PA 1CY1A 3RYIB 1LJUA 5IJ0A 3TOSA 4K81B 4MUBA 4ZI2A 5LLSA 4NU6A 3ZV7A 1PTOD 3G8YA 2J7ZA 1Q6YA 3DFKA 4X66Q 4K9QA 1QF7A 3MRTA 1O94C 4LGVA 1RJFA 3HCRA 5EXEA 1PR3A 1WDTA 3ZZ1A 2W8ZA 1VC2A 3AB7A 5JHHB 1NW9B 2HHHL 1D1QA 1JA1A 5KVQA 2F9LA 2IOHA 3M9LA 2HOQA 4ZAFA 5IBQA 3RWMB 4KTVE 4BCCA 4F8YA 5FQNA 4U2CA 3VJRA 1KKMA 3V1UA 2ZYGA 1SULA 4EGJA 5CDTA 5HF9A 4WH0A 4IDFA 1Y1WH 5IBPA 1SH7A 1RHJA 1NJFA 4KXVA 2WBLC 2CXPA 2MYPA 1Z07A 4NBNA 1EQ2A 4IGKA 1YGPA 2P9CA 4R31A 1JLSA 3FTCA 3RK4A 2NVXH 1MO3A 1FJXA 1L5OA 2QD5A 4DV5B 3LQ4A 4R9SA 4HAYA 1GNPA 4FMBB 4NECA 4L8WB 1XHEA 5C5DA 3L79A 4CTJA 1ASZA 2JFBA 4GX2A 2V9ZA 4JNCA 2M1XA 1Y3BE 3IJEB 5G40A 1L7QA 3N86A 1MB9A 4N5HX 1YE5A 1EB9A 3JZAA 1M67A 5AUOB 1X1SA 1Z5NA 2CGEA 1FNSA 5B30A 3ZUPA 5BVHA 4ACBA 1RXYA 1WW3A 2ZQZA 2IV2X 3AEXA 2HRCA 5TGTA 3AHJA 4M36A 5HS4A 3T15A 2VZ0A 3A5ZB 2HBYA 3GWGA 5H9VA 4BLWA 3WGHA 3TVDA 3AYHB 3ZXYA 4YDRA 5F12A 2TMYA 3WFIA 4YRAA 1PJCA 1PK7A 3P9QA 3PPIA 4HDMA 2FAXA 3LBYA 4RS3A 2A5FA 1N3IA 4IUBS 3N7UA 4JI7L 4JC4A 2XJ9A 3FOZA 1GAWA 2EATA 1UOPA 4MVWA 2YN0A 2DKNA 4PXYA 3P0HA 2HSDA 1FJHA 1Q1NA 4L6AA 5IKXA 1EX9A 1I7SB 3DV0B 2ZRLA 1Y6ZA 3VC1A 3PR2B 2B2YA 2V4MA 1AKEA 3IR6A 4JJZA 4MVJH 3Q9UA 3FN4A 2PW5A 3G2OA 3V1KA 2ZRFA 2YFKA 4KNVA 3ENVA 1OT3A 3VZDA 2Z6KA 4MV6A 1EIHA 2VNJA 4RJJA 1NLZA 1JWUD 1OZHA 2H08A 2YJ3A 3A25A 1TUGA 5CFNA 1U3DA 3ZCSA 3O7WA 4FHDA 2HUNA 1VQBA 2X6GA 3L4EA 2NWQA 4AY4A 2D9UA 1IH8A 3OQMA 2K32A 4AJNA 2B2UA 5E9JA 2IHVA 1BCSA 5LBTA 2A9RA 4L4RA 3CGWA 1WP9A 1KBQA 1JHYA 5FDFA 4HH4A 3DTVD 2QGFA 4R8SA 1AO3A 1QZXA 4G5SA 2V74B 3QXJA 3K9FC 5GZ3A 2AYZA 4YUXA 2HW8A 2QTCA 1NXPA 1JH8A 4YYEA 2EJMA 2XT6A 3QBTA 1VQ7A 5CFOA 2HV9A 2F1JA 4CODB 1Q3KA 4IXDA 1GPJA 1CUUA 2X5XA 3N8GA 3B36A 5HUHA 1LKZA 1U0SY 4AECA 1H2EA 1RC1A 1WCWA 3B53X 2PRKA 4XDZA 3Q7QA 4TXJA 4GYYA 3Q3CA 1P7VA 3N52A 1E9DA 3MCVA 3OD5A 5I7AA 2CLCX 1E61A 2QWXA 5FXMA 2GBIA 4ZKBB 4LSZA 3AKZA 5TPZA 4MUNA 1NP7A 3OWHA 4B6SA 4TKZA 4R1NA 2AQ1B 4PGMA 1EXDA 2H29A 5B58T 2L42A 2RF4A 2VT7A 4N5MA 5LZ2A 2WF5A 3AIIA 3V7FA 1GU1A 1T5TA 1RHUA 2E4XA 1LLFA 3BS4A 1Q1AA 3M2TA 1PR1A 1NCVA 2PWBA 2IU0A 3OE1A 1NVDA 3PL5A 1VSBA 2I80A 1ORTA 1U94A 4IVPA 1T1RA 3AX6A 3H1EA 1Z0ZA 2VPIA 1VPEA 2WWYA 5LQSA 1VE7A 3OESA 3I12A 3ORFA 3U4VA 1UBLS 3EXEB 2XGSA 4A0GA 4U0KA 3TRFA 5HSGA 4MVJF 1X86B 5IJ9A 1QNFA 1K68A 1ZGCA 3BZUA 2QDBA 4DIOA 1XAIA 5AHOA 3VHXA 1LTBD 2J9YB 5TQ2A 3UUFA 1O0CA 2WU1A 4GVPA 1N7GA 4RJKA 2CXOA 5CM9C 1E2UA 5HBRA 3T1NA 2A78A 1J70A 3E22B 1X3PA 2HF8A 2UV8A 3K80C 5FK9C 3CONA 4FS8A 1ZOSA 1SY7A 3CUUA 3B1ZA 2V7UA 4KI7A 1SB8A 5KYGA 1O95D 1OIVA 4Y98A 1E2EA 4Z7OB 3ZDRA 4LY6A 1FE8A 2QW1A 1E1YA 4IFIA 1U3WA 3BK7A 4LC0A 2TSYB 1G42A 4LSWA 2FB9A 3U9LA 2B30A 3AJ9A 1RKNA 2OCYC 2GLXA 3ET4A 1BIFA 2F43A 2VJMA 3PXEA 2FHSA 2JLQA 4D4HA 1VPVA 3EZFA 1EGVB 1SOUA 1B9NA 1BS9A 1IK6A 3DTTA 4YCUA 2YBEA 4RKBA 5IJWA 1PVVA 1EFPA 3AKCA 3RB8A 3NHYA 2VG8A 3W7VA 3YASA 1L8QA 4DK0A 3AOEC 1TUIA 4UFNA 1Z56C 3KUPA 4PV7A 3LWNA 5LMNL 2H1LA 3IBFA 2X4LA 3DLIA 2YXEA 4QFDA 1WPXA 5A9SB 1N5LA 3MELA 3NSWA 2BM9A 1GZ4A 3MFQA 4KVZA 5LU9A 3QX7A 1ZNXA 2Q3MA 2ZB4A 2BA0A 1TQOA 1V9LA 2QEJC 2DGDA 3QFHA 4OJNA 3ETEA 2B3GA 3BE6A 2ATXA 3B9QA 2H4XA 2R1TA 4BXXG 2B4QA 4W5RA 3MZ5A 3WB9A 2M1ZA 3T7CA 1F12A 2HIMA 1XEXB 1JORA 3AEQB 4L5JA 2R7KA 2JRLA 5J2TF 2AOUA 4PHTA 4FM9A 1BX1A 1XFAA 2ZREA 4DHEA 1Y7HA 3E61A 1A96A 4CKCB 3AB8A 2O6HA 5CA0A 4U7GA 4CHGA 1ZBDA 5CD9A 1ZIOA 4QTTB 1CI3M 1WETA 2BI4A 5EPLA 3E7WA 3L4BA 1GRQA 1IAVA 3PDJA 5IDVA 2HIHA 4BNZA 1YA8A 2Q1XA 2CFCA 1KARA 4AMYA 2PANA 1E62A 4IWYA 5IS2A 2OXEA 1J23A 3JAKA 4ZHQF 2ZP1A 1GJXA 5JY6A 3WNVA 1USIA 3JQ6A 4TTVA 3EPHA 1L4KA 3QI2A 4FKZA 4P4SB 1UAAA 2K05A 2NN6G 1VZ2A 1AQUA 3L1UA 3N2ZB 5T64A 3E0JA 3NE5B 3KWMA 2Q0XA 4I1VA 3RHFA 3P2MA 2LD4A 1D1IA 1VMAA 4WBNF 4OQNA 1JYEA 4OMCA 5CAEB 2PAAA 4UZSA 3ZVKA 1TFRA 3N75A 1EFVA 2PMWB 1JHDA 1XZHA 1GPUA 1YR8A 2YNMD 4U7PB 5IRCD 1PW7A 2G5GX 1C41A 2M2LA 4BO6A 2V7VA 4FMPA 2EOTA 5I7FA 3VA7A 2F67A 2WIGA 2Z5VA 2FX2A 1NBMD 4GKAA 1FYFA 1U2DA 1CY4A 2WKCA 1QFSA 1JMYA 4OGQC 2DE0X 3WL3A 2DFKB 2EKBA 1TZCA 3LVFO 3KAKA 2J9FB 3VYSA 3NX4A 4XARA 3G4SA 1RR6A 2IKSA 4TLCA 3KWLA 3SDZA 1IYUA 4MTKA 2B39A 3AFMA 1I1HA 1M5TA 1MA0A 1T1EA 5BSRA 4WUVA 1GPBA 1HURA 2CV0A 1PL6A 4PAMA 4JI3L 3JASB 4XM0A 4BGEA 1U0RA 2IF2A 4TV8B 4D99A 4WK2B 2J5XA 5K0EA 2BGJA 2O7RA 3ITEA 4M1SA 1OU4A 3VVLA 4IWXA 2JGJA 4E12A 4YT8A 4B3IA 5LQKA 5ETJA 2PYIA 1KJNA 1WUIS 2ICIA 4JR2A 2YHSA 1CDDA 3RS0A 2DPXA 2X0NA 2HK9A 5I9LA 2Y6UA 3OTOB 4PTYA 2B2CA 4I14A 3LUDA 4PZPA 3D2CA 1GZ3A 3E1SA 3VH3A 3FOEC 1GG2A 2OBYA 1AFPA 2JCBA 5EYPA 2ZZNA 4D44A 4QQFA 4Q3DA 3OEEA 4XUCA 3QM1A 3QTLA 4CG3A 2IUFA 4YY3B 1A2KC 3FDZB 3OG9A 1G2OA 4K8RB 1N5IA 4Z4QA 2OXIA 3M3DA 1KJYA 5CLFA 4PC1A 2YIJA 1T8SA 1PJRA 1IJKA 2JPDA 3R5FA 3LC0A 5E6UA 1D7QA 2UUAQ 1LT3D 2HWKA 1JI0A 4MQEA 1Q44A 4XFJA 4HWSA 1W44A 1LI5A 3C3BA 3KHTA 4PLZA 1GPMA 2DBZA 4C78A 1N5KA 4BNDA 4AJLA 2G9HD 3N70A 4EK9A 2GKSA 2WSYB 2C4TA 2PGOA 2L69A 4Y2SA 1HRJA 1JDBC 4QZVA 5CV5A 1QYCA 2A9PA 1XQ9A 1BO0A 3AJRA 3BEOA 4ZI3A 5CFMA 3OD1A 4O42A 3W5JA 1LLQA 1H0HA 1T10A 1CF4A 1IBML 1HM5A 4E5DA 1T9ZA 5FA6A 2I6GA 3ICQB 4YO7A 1WIWA 1SFRA 3W5CA 3S1AB 1SEBD 4AM8A 2P8SA 4L6IA 2ZIAA 3K09A 4KHPL 4AY3A 1WKCA 2XA9A 4B6JA 3MGCA 2O3UA 1XCOA 1WXQA 1T2UA 3PFIA 3LDFA 4OLJA 3KBOA 1FC0A 4IZOA 1A9XA 1NLUA 1K8QA 3A2MA 3FYUC 4G85A 5A4IS 3RTBA 3TSYA 1XVVA 1B73A 1YJ5A 4M83A 4CUKA 5KVVA 1WQ1R 3MXPA 5FWYA 1Q11A 3WGKA 2D0PA 2CW0D 2UUOA 1U3UA 1C3LA 2E21A 2PRSA 5IC5A 5DNWA 4HNAB 1N1MA 1MGPA 3N8DA 3DEKA 2P2ZA 2XGGA 3S7TA 1CR0A 5REQB 5LR6A 4XGKA 3RTEA 3DXXA 1I33A 5CDUA 4IDBA 3TEFA 5G53C 3HOXB 2BOVA 1KP3A 3B1KA 2BEWA 2QUIA 4IIXA 1IOLA 4URXR 1O58A 1VIDA 4YRSA 4F6CA 1FIUA 3JAML 4JLPA 1CV2A 1YZFA 5L6LB 2H0AA 1QHGA 1Y14B 2Y0DA 2DHDA 4E3ZA 2HGSA 1KGSA 3FB4A 3P9CA 2EKZA 4DV6Q 4Q39A 1Z75A 3WYGA 3UUEA 1K6IA 3SK5A 3MERA 1YONA 1QGZA 2OWOA 1C0LA 1Q7RA 4UPAA 4YH1A 1CUCA 3X44A 5A5DA 1O4WA 2YMQA 2VQ6A 2GBFA 1E7WA 1O96A 3IAEA 2VJPA 4ZT7A 4MTNA 1A9YA 1SVLA 1U8XX 3THXB 2REBA 3UHAA 2QLMA 4I55B 1KDOA 1QQ6A 1AHHA 1XEAA 3JATB 3LY8A 4UNPA 3A0RB 2E4VA 4ZRDA 1ZXTA 3ZLTA 4PR3A 3VDYA 3P26A 2A19A 4M7WA 3O9VA 5TE9A 1EINA 2JCXA 4ZOLB 1PH2A 4J15A 1YHZA 1CJBA 1JT8A 1XDBA 4OJMX 1F5NA 3OE7A 3OLYA 4FK8A 4LJSA 2HO5A 1L4FA 2AJTA 1JWAB 4PSVA 1FY2A 2YZ7A 5MFPA 3HNRA 2YDYA 3T56B 2RHHA 3G5LA 4JNKA 1ZL2A 3AIMA 2VDNB 2VYNA 2WIDA 4RETA 3S68A 1FLNA 2FUG1 3R3XA 3QEAZ 2DJIA 2P7HA 4DR3B 4BLUA 4GLOA 2IEAA 5AJ3Q 4DMKA 3H4MA 3VZSA 3B3QA 2NXNA 5I7UA 4YP1A 3ZN2A 1IJBA 2OVBA 5KNCA 4OGKA 1SJHD 2BBOA 4XCXA 2QN3A 2BGLA 2ZSIA 2F0SA 3UJDA 1YZ6A 4RK5A 3JWPA 3BIJA 1TYDE 4DPLA 2W8BB 1N6NA 2NZWA 4RORA 1U6IA 4LNHA 2HXGA 4ALIA 2EIHA 1T5XD 4AJ2A 3W9UA 2GM3A 2WQ6A 2AEMA 3U4GA 4BATA 2AOTA 3EIFA 4GN4B 3WNZA 1CTMA 4HLCA 1JYFA 3JU3A 4EQNA 4MIKA 1XRJA 2BFBA 5H3LA 1N4DA 3CV3A 5BQ3A 3OJXA 5DASA 3GUUA 1HSOA 2YXNA 4Z4IA 3GGGA 1KMIY 2QJRA 3KQSA 1D0SA 2CNWA 2H3EA 4NYMQ 1Z13A 2Q0HA 3U39A 1Y4SA 1TTQB 3WX0A 1Q5PA 1KBZA 2QR2A 4YRNA 4N7RA 1SXJD 4KJZA 3RFFA 2ZPUA 2E2HB 3SI7A 3E5HA 2QL9A 3I9NA 3AM1A 4HGZA 3DEHA 2LWIA 1STBA 2PR2A 1BRTA 2IE8A 1G6OA 1XTQA 4D5EA 1FLDA 2P2CA 2OAEA 3EQ7A 2ZJ1A 3TCKA 3HU3A 3IVGA 2QAIA 2EHJA 3BG3A 1QS0B 4RXTA 1VI2A 4QLAA 4C5CA 2PQAB 1QUEA 1E7MA 2JATA 3AR4A 1SUIA 3CH5A 3HKCA 4DM7A 3UGJA 1IB6A 221PA 1JB1A 1SM4A 3KJNA 4RIFA 3EVGA 5JHGB 1KEKA 4QM6A 2WPNA 1TVEA 4F88A 2G9ZA 3E5SA 2ZJBA 2IXAA 1E77A 4EARA 3K53A 4J94A 4MP6A 2NUAB 1W6KA 1XLVA 3V2UA 1MV5A 4X0EA 4MV9A 4R1MA 2F62A 2F0UA 1MJ5A 4EUKA 4UNQA 2WMYA 3UF0A 2H52A 1AE1A 4X3OA 3IP5A 4YNBA 5C32A 5BV8A 4XWGA 4EAQA 1X77A 2JLRA 5BSKA 3WWOA 2O0KA 1HYHA 4D45A 1H3FA 1P7ZA 3FWKA 5FWXA 1K3UB 2NZYA 2F3QA 1KNXA 2LCFA 4GZ6A 1JMVA 3PEUA 4YTEA 4RD4A 5LZ7A 1DUVG 1G19A 1IPHA 2R7AA 3I4CA 4A3EG 2GI4A 3UW1A 4WWHA 4JP2A 2HK8A 4XDXA 1LLDA 1TWHH 1IN6A 1Y9EA 4OG2A 4JBMA 1G8KA 5EZYA 1IZ6A 4P5DA 2Q8NA 5AJUA 2X23A 2E7ZA 2UUCB 3K9WA 3L41A 2Z0SA 1D2AA 3Q8DA 5G0TA 1SXQA 2Y0PA 2RBGA 3RBZA 3CYFA 4AULA 2IZ0A 2O19A 1IY1A 2BGUA 2PWAA 1CM9A 1LPSA 1P1RA 4OD0A 2C92A 5J47A 1BZYA 4R4CA 3ZDCA 2BH2A 2NVYH 3FF1A 4BNFA 5A3VA 1MJGA 3ZWXA 3U7QB 4EUHA 2PQEA 1N9GA 1XF1A 5CC4A 1H9KA 2RG1A 4LHSA 2PZUA 3JD3A 4PEVA 5IGDA 2QX8A 4IINA 4AYXA 2B2NA 3S2FA 2QN9A 3MN1A 4HGRA 3PC7A 1VI6A 2OXFA 1XUOA 4FXPA 4MQUA 3EN2A 2DETA 1JDBB 1PEAA 4QXAA 1G98A 3ADDA 2NZJA 5BSGA 4WBXC 2QM7A 4P75A 4TM7A 3DLHA 2HCJB 4HAEA 3FDXA 1KQOA 4CJXA 1NFQA 1PXUA 4I1OA 3D4IA 2X8WA 2D7DA 2V7EA 1W0KD 3WICA 3HJTA 1C2TA 4HR7A 1WLYA 1FLVA 3KOWA 4MNOA 3FRHA 3M3PA 1A72A 1R4ZA 5BP7A 1JH9A 1EG7A 3GAMA 2QAJA 3GEMA 2FWAA 5BNZA 4DK1A 3BYZA 4FVTA 1W4RA 4LQ4A 3P7MA 3NGLA 2EGGA 4QGHA 5T6MA 1KJ8A 4D1YA 3WHPA 3F1ZA 1X1DA 1KIXA 2V6BA 4B7CA 1QDLB 1R50A 2VDPB 3FYUB 1I94Q 3C8HA 2PRZA 1KEEA 5BV1A 3EUWA 3R75A 3UPTA 4PLVA 4Y7CA 2JBAA 1S2IA 2FPGA 1VKHA 3MHPA 1UKCA 3EQLC 5IDXA 4CDMA 2OUIA 1J49A 5KSPA 3DDZX 5JBQA 4JQSA 4DT1A 3COPA 2QUAA 4OP3A 3OTIA 4OSPA 1W3SA 1HDOA 4PE5B 1GL7A 3DFUA 2ZR8A 4GN3B 4HYYA 5EMKA 4A23A 1W5EA 5TQ0A 1KMCA 4YRBA 4II7A 5K3DA 2OR3A 2C78A 1NYLA 2O23A 4BASA 2YWDA 2QYSA 4NDAA 3ZU4A 1BXTA 3O13A 4NV1A 4U00A 4EW2A 3BIWA 1HL7A 3T41A 1VQIA 1CKNB 2VRCD 1PTJC 5I2YA 2W2LD 1V8PA 1PE0A 3BMNA 2Q62A 1B76A 1I3LA 1Z22A 3HSSA 1SQ5A 2ZUDA 3WQRA 3J80A 3WC4A 1Q15A 2D5CA 3P9KA 5JH7A 4EYGA 5HE9A 4PO8A 4O2AB 1MEEA 5EC8A 1QFMA 3T12A 3X2SA 2I4LA 5FBLB 1FDUA 1DQRA 4GQBA 3EF0A 1O97C 2ZSJA 1P61B 3SSNA 1I3CA 1E7ZA 1KK1A 2YFHA 4FO2A 1EX7A 2DH6A 5A03A 4J1TA 2EL9A 4UNRA 4L51A 1NURA 2VPTA 1IN8A 4JS0A 1VMEA 5SYMA 2PQ0A 1D2HA 1FFWA 3PEEA 1CVRA 1GR1A 2QVLA 3DNMA 4K87A 3UJ9A 3IAAA 3LTEA 3IMFA 1JXQA 3JQPA 5K3OA 1X42A 5DE3A 1UXIA 3U7RA 5ADHA 1GGVA 3R5SA 4DA6A 2J45A 4O4HB 2EWVA 3EBEA 3ZDFA 4PNHA 3AFQA 5KJ1A 4DIDA