2AWOA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
372
structure length
372
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 91
structure length 372
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awoA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awoA01
4M9XA 4W5JA 4P75A 3PUVA 3VX3A 2WKRA 1EWHA 1W1WA 5JLJA 3S1MH 3T1TA 1QG4A 2UUBQ 5GVSA 1OXXK 3N6RA 4R2HA 4CZ2A 1LFDB 3UG7A 4B6FA 1D2NA 1TADA 3TQYA 2FOLA 2RHDA 1KI6A 1TF7A 1Z29A 4B2LA 4ARZA 2FE4A 2K5HA 2NO0A 2EFHB 1SULA 4PC2A 2IXGA 4TWZA 3JAMi 3OOCA 3WWVA 5HTKA 1C7YA 3AFPA 1P60A 3FHOA 2D62A 1YEZA 2KE5A 2CWAA 1OFUX 4D2IA 4EFLA 5GJVC 3W6PA 2QMHA 3WBJA 1GKUB 2VF8A 3J81k 1XCMA 1IN5A 2ZREA 3LQRA 4QBHA 3WMGA 3W3AA 1E2IA 5H70A 4PO9A 1ZM2A 2WWIA 2IUSA 3TIFA 2YVUA 3DLLA 3RRYA 1BDOA 3CRKC 1P2VA 2CMKA 2B8WA 1RW4A 4PPFA 5D3QA 3TNFA 3WYAA 4PPGA 3K7AH 3TSZA 1KK2A 4IXNA 1KHTA 3RS2A 4Q9KA 4CEHB 2QZ4A 1O78A 4ZDIA 4C2TA 2EJFC 2YU9H 2GZHA 3S1AA 1FZQA 1Z7TA 2VP6A 4BXXH 5FBVB 1C9KA 1GUAA 1ZD8A 221PA 4O2RA 5SZKB 1B9MA 4TQUS 2ZYVX 4M1WA 4V03A 1XD9A 4OHWA 4MUAA 3LX5A 4DRZA 2J7KA 2QPOA 4LHZA 1KI3A 4GMDA 1X1SA 2KI5A 1HZCA 1PH9A 1DE0A 2NPIA 6Q21A 4P31A 3V00A 2JIZD 3GTGH 1GNRA 3CH4B 2WJVA 1JE5A 5FLXc 2IYSA 4RD3A 2VYFA 1C9OA 4JLOA 1N5LA 3LXXA 4PZZA 5K8TA 1W0KA 1U8ZA 3JC66 4RD2A 3GLIA 1TEVA 1PH5A 1HNXQ 4HB4A 2JATA 2PCJA 4PR0A 3TLXA 2RH5A 4DR4Q 1Z06A 3AFQA 1NY5A 4TYNA 2WJJA 3RVBA 5A35A 1L8QA 1JNYA 4YCWA 4GOXA 2AFIE 1YU9A 5KTYA 1KDOA 5IK2D 1AKEA 2OTLA 3B6YA 3BC1A 4FINA 1ZJ6A 5KNCA 3OE7A 1Y3AA 1P73A 1WCV1 1I4DD 2C78A 2J3EA 3CPJB 3KB2A 1XTJA 3GEIA 1R7RA 1GUGA 4DSTA 4C0HA 5L3SB 5CM8B 2Z4SA 3U3OA 4KMUC 4KITB 3LNCA 1AZTA 4AY2A 2DFNA 2HHHL 3EIHA 3HR7A 3QXXA 4URZR 2K5NA 3WHLA 3U4QB 4UNQA 2FNAA 2HF8A 4IO9A 1R2QA 2NVYH 5HKKD 4BZQA 3HWSA 1EOVA 4Q4HA 1H8ED 1Z0AA 3OEHA 2R6GA 1Q81C 3QJYA 3CCLA 4L5BA 4I4LA 1YVDA 2ORVA 2QUZA 4BA2I 1A0IA 4BWYA 1IM2A 4YXWA 1R0WA 2QP4A 4PZ7A 2VBCA 1KMQA 4O25A 5C0XJ 4UP7A 1KK3A 1T5IA 3EG5A 1SMYC 2I5MX 4PXAA 5LBIA 3QG5A 5A4JA 2BMFA 2ZI9A 3M7NA 2UUBL 1G3UA 4FD2A 3CQZH 1PMRA 1EGAA 4LC0A 4A9AA 5C4MA 5FJ8H 3O8BA 1VG9B 4L4UA 2TMKA 1Y8OB 1VMAA 3QOFA 3SC3A 4BY1G 1E9CA 2JE6I 4LZZA 2GEUA 3EARA 4IRUB 1NY4A 3SI7A 1KI6B 2XNSA 3GFPA 1Z0DA 3SOPA 1XTDA 1S40A 1YR6A 3GMTA 3NC1C 4X64L 3PENA 3REGA 3SYKA 3NH6A 1U81A 4TKOB 1N8RC 4A3BH 2PLRA 4GN5A 2DYKA 2RF4A 4XWKA 3AVPA 1DAHA 1E2NA 4HLUA 4OBEA 5JCZA 2O8DB 1Q1BA 3KOJA 4KSBA 1QUQA 3THWB 4TLCA 3BZKA 1C0AA 2CL6X 1RL2A 3B8HA 3GJ7A 1ZM3A 3MGCA 4Q7JB 2HJVA 2HT6A 3PSIA 4DLXA 3KDFA 2EFCB 2HT1A 1Z47A 4L5RC 4B33A 1E3MA 4KODA 3U7GA 1CI3M 3T1HQ 3CIOA 2AWNA 4JLAA 2D06A 1A5TA 3M4OH 3BH6A 5FUVA 2O0JA 3MD0A 4QGGA 2PI2A 3NH9A 3H0GG 4DNIA 4OHXA 4ESHA 4Q18A 2BDTA 4HB0A 3SHWA 2KWIA 4MRPA 3J80c 3GJ4A 3X1ZA 3EQLC 1WBDA 3ICQB 3CRMA 1R5OA 1II9A 2ZRGA 2DPXA 3K1JA 4LW1A 2ZUBA 4KV9A 2HHHQ 1GKIA 3U4VA 4TYWA 1UKEA 4AURA 2VPPA 2NMVA 5DN6A 4A3EH 4GZLA 5CYOA 3QE0A 3HOUG 3NTUA 2Q8IB 2ZM6Q 1I3QH 2R7ZH 5KSYA 2HUPA 4IPHA 4A3EG 3VKHA 2Q21A 2GF0A 4LYFA 3THYA 4TL7A 2PCFB 2R7ZG 3MMPA 2N49A 2R9VA 4EKDA 2O8BB 4LFAL 5TXGA 1U0LA 1XXHE 1NJIC 2AMCB 1VCOA 4V0LA 4B48A 5KU1A 4NE2A 3T1YQ 1E1QA 4AG6A 2BKEA 1HEIA 3MXUA 1VDZA 1AN0A 4GP7A 2GF9A 1RIPA 4AIMA 4BY7H 1ODFA 1LTLA 3IBGA 4Q1AA 2FFHA 4IFDJ 3K0AB 4Q02A 1RKBA 3W90A 4DBLC 4P0TA 4FCVA 4PZYA 1DADA 1ZINA 2ZJZA 5FBRB 3EPJA 4M1OA 4HDQB 3CF2A 2IEYA 3BE4A 3FMPB 4ERNA 1UKVY 2GXQA 1XNJA 4BFVA 2VNUD 3LDAA 3IKJA 5FOUA 3OW2A 5JEAJ 2EWWA 3VMFA 3T1QA 4JSYA 1F5NA 2JEOA 1E1QD 2ODBA 4KJZA 4EQ6A 5J4VA 5G41A 3R9IA 1BKBA 2L5TA 4Q1DA 5F3WB 5ANRB 4JOIA 1QUQB 4C0SA 1N32L 2EJMA 2MFIA 3NBXX 4JL5A 3H84A 4LF9Q 1Y8PB 2VL6A 1F2UB 2BC9A 1RC8A 3ZD6A 1HCZA 3CP0A 1G8HA 3GTOH 1ANKA 1HNWQ 1ZRHA 3BB3A 3IGFA 1JR3D 3A1UA 4PC1A 3UMRA 4HIKA 1N6KA 4GOKA 5K8IA 1HT1E 4G1UC 4Q7LA 1G6OA 2QAJA 3BU2A 1P62B 1ELOA 1T6NA 3OIUA 3B1ZA 3U7HB 3E1SA 2Q2TA 1XD8A 4Y7NH 4QGAA 5FOWA 4PANA 2ERXA 2JEAI 5AJWA 3FMOB 4D4JA 2QP9X 1MO3A 3FPPA 4RFSA 1DAFA 2F9MA 3IUYA 3IO5A 4Q4AB 4BFTA 3B6EA 4XWOA 4UP9A 1E0SA 4H1UA 5HY6A 5M3FG 2CL7X 4X62L 1G7CA 2LKDA 3VR2A 1KNQA 3RWMB 4DSOA 4DDUA 4QIWE 4PZLA 3GQBA 3FMFA 1IL2A 4OHVA 1QHYA 3M1IA 5K8UA 1PLLA 4IEIA 2GAOA 1TU4A 4Q01A 1V43A 3ZJYA 3NVAA 2C99A 1VQ9A 2QEQA 4CYMA 4KFSA 3AQQA 2QA5A 1DXMA 4A3IH 1S0UA 5FOSA 5LB4A 2IHFA 3TK1A 1MV5A 3CZPA 4B34A 1FTNA 2FA9A 1JECA 3AVYA 4C4PA 5FOTA 4A3IG 2AUJD 1VQGA 3PEUA 5J3BA 1IY0A 1MO6A 3I92A 3O8CA 1W36B 3EWAA 4P71A 3CD6A 5H8WA 2L15A 4FI3C 1DEKA 1ZNYA 1QVAA 2QBYB 2OXCA 1W5SA 2IT1A 3FKIH 2FG5A 3CCEA 1A7JA 3Q85A 2ORWA 1WCMG 5IY0A 3A8KE 4RSGA 5FTNA 2NVXH 1YZUA 2YJTD 4DZZA 1PYBA 1T91A 4XTRA 4NCJA 3W8NA 4D0GA 3SYNA 3A4MA 1A6XA 2UU9Q 1KK1A 4PHHA 2B8TA 4LUCA 3VR1A 4DPGA 2NZJA 2A2ZA 4RCYA 4WVFA 4JLPA 2O8BA 1OXSC 4PSKA 1OHHA 3DM5A 1O3YA 1U0HC 3NBFA 1JB7A 1XPOA 2VZAA 1DVRA 4TVAB 3S1RH 1TU2B 2QORA 3FMIA 4Q9JA 2RAPA 3R9XA 1LVGA 2WSSD 5FFMA 3QPUA 4RZ3A 2IYUA 3CXCA 1BMFD 1IW7D 4LHXA 4D82A 1X3EA 3AVWA 3T34A 2C96A 5JS7A 5LPNA 4Q4JB 2UXCL 4X66Q 1CXZA 2HIVA 5DIFA 1X3GA 5IRCD 5FH9A 4BLOA 1IXRA 4BFWA 3AM1A 2QTVB 5SZIA 3LXRA 2G77B 3I7FA 2NVQH 2ZRKA 4DV0L 1G1MA 3KFXA 1FMLA 2A30A 3CMAA 1OFHA 2W6IA 4XH9B 1M7GA 4KHZA 4IOAA 2ASBA 1BOFA 1VG0B 5A5GA 3UDGA 4JJKA 1DD2A 2HLDD 1N6LA 1E2WA 2K5UA 3GLHE 4HDOB 4JI8L 5C0XG 1QHXA 2KHIA 3AKDA 4BA1I 2WVJA 4BLRA 4DR6Q 2H7VA 2OBNA 5M3MH 2A78A 4N0EA 1N6IA 1NMZA 4OKSA 1D8TA 3KJGA 1PHJA 1II8B 5EQTA 121PA 1R5BA 3WP1B 3ZDQA 4JYAQ 4LF4L 2GXUA 3WHKA 1HQMC 5EE9A 1JB1A 3PIRA 1YJ5A 4FW9A 1EWQA 3SBDA 5C44G 4GNKA 3KUCA 3AGPA 1KD1C 1N6RA 1VIAA 3DZDA 1NY6A 1NMXA 2JJ2D 2ZJQA 2SHKA 2QGQA 5KSOA 1DAEA 1ZM4A 4LNQA 1S8FA 1W4BA 3RS0A 4K0KL 4HIDA 4RZUA 4WJ4A 1Z8FA 2HLDA 2PZEA 3SDZA 1PH2A 2O0HA 3AF1A 1WMSA 3AEZA 1IN6A 1WFQA 2XZOA 4A3DG 5AJ3Q 1NN0A 2ZU6A 3AP1A 3ECCA 3VR4A 2BH2A 4NCHA 2ZXUA 3ULJA 2WICA 4M9QA 3ZVNA 4A3DH 3Q8XB 2XSZA 2PZGA 4HUQB 3AV0B 2QP3A 3KZ1E 4DR5Q 1J5EQ 4BBRG 2NG1A 1YHQA 2OSBA 3GCGA 2F55A 5E7IA 2HF9A 1A4RA 3FVQA 4YWLA 3KX2A 3VNUA 1NE3A 5JRZA 5DHAA 1H9JA 4JC0A 3FKSA 3KXKA 2CJWB 4LJ8A 4Q03A 3R9WA 2GBLA 4B3SQ 4Z54A 1SFOH 5GAHC 1NMGA 1X8KA 2FSHA 3MXNB 2ZPTX 3HR8A 5TB5A 4HI0E 3LV8A 5IYDH 1B9NA 5CYPA 1XFAA 1QZHA 1UPTA 4HLCA 2J7PA 2GXSA 4KKUA 4TLDA 3KQLA 5ELXA 2GAAA 5EXXA 1OB2A 3TZUA 1E2EA 2QENA 2NN6I 2IK8A 1MABB 2WJGA 2R6CA 4NDZA 2YHSA 3ZH9B 3UWOA 1OW3B 3KF8B 1AE3A 2AD5A 1HQCA 2V7QA 4C3ZA 1CJKC 5AR1A 4X8MA 4B3DA 5KNBA 3FHTA 5TARA 1HE1C 3DHWC 5IT5A 4DLRA 4UPAA 1U5KA 3CCQA 2YNMA 1OYYA 4KFRA 4Q5IA 4EPWA 2XGJA 1K5DA 2JIZA 3FFAA 5EZ6B 2WMOB 3CCMA 4AIIA 5J47A 2F1MA 1VQ5A 2D7DA 3MAAC 3HDTA 4OL0A 4DXAA 3CRQA 1N32Q 4MZ9A 3AKEA 4LF6L 4EQ6B 1GM5A 3TJZA 1E1TA 2PCLA 1P2UA 1W49A 2YZ2A 3W5JA 1KOFA 2NZHA 1IY1A 2VP9A 4JV5L 4M53A 4B47A 4II7A 1ONBA 4DWJA 3GFOA 4JKYA 2O5VA 4C0KA 2JLXA 4P4TA 2V3CC 4ZCMA 4H13C 2FEOA 2OILA 2WPDA 2EFDB 4QM7A 4A3GH 2J87A 5JEAG 3LLMA 4LJ6A 5CDFE 4D26A 5EZ5A 2NTYC 4LUOA 4DV0Q 2J1LA 1YRAA 5EP3A 3I55A 1E6CA 1SXJC 2G1JA 2PL3A 1OXUA 1W44A 4US0R 3GLFA 4MA4A 2NO9A 2WJIA 4FXPA 2B63H 3F2DA 3GTKH 1UEIA 1R8SA 2F1HA 4GZMA 1GUNA 1LACA 4UP8A 1PA6A 1GL9B 2D4HA 4Q7KA 4WXRA 5C2JB 2J0QA 1NN3A 4ITRC 5LD2C 2AKAB 1N0UA 2ODWA 3KTAB 1KDTA 4UNPA 4UXIA 4BEBA 3W5OA 1SVKA 4OQFA 3MRSA 4DR6L 1HJPA 2MO1A 2UXBQ 2IHBA 4CW7A 3RLFA 2ORIA 3NELA 4DKAC 4G5OA 2WPDD 1B0UA 4C0JA 3R7WB 3GP8A 1E2VA 4HZUB 1CKEA 2ZSFA 1HUQA 1Q20A 3SS8A 1JPNA 4LHWA 4A3BG 4OJKA 4TSFD 2YOHA 1X6OA 3A7AB 5ELOA 4DV2L 1E94E 1XZQA 1Z0FA 4JSTA 4LFCQ 1Q3HA 2XNDD 1CUKA 3QBVA 1GVNB 4G3XA 3AH8A 1VTKA 2ZI7A 2ZRHA 1BVSA 1OFIA 5LDDC 3A74A 2ZAMA 4DB4A 2V1UA 1Z3IX 3BZCA 1TPZA 1G7RA 1GSIA 4LYJA 4ON9A 2CVFA 2A5GA 3I8XA 5G3YA 2ZE6A 1PUIA 2G0TA 2OAQ1 3BS4A 2ZS7A 4IJLA 2QEXA 4NH0A 2PMZE 4HAYA 1UE6A 4HAUA 4IW3B 2P6UA 2WSMA 1J5EL 3RC3A 3H0GH 2AX4A 4F7WA 521PA 1J99A 4XD7D 2IWRA 3W6NA 1S3OA 3CRVA 2OCYC 4MYCA 5JS8A 5L3VA 2XNDA 1VQJA 4AK9A 4HB2A 3SGIA 4OHZA 4ZV4A 3CCVA 2ANBA 2A3RA 1LS1A 2F3IA 4EFMA 2IBMA 1NKSA 3I4NG 1FOEB 2YWFA 1KXLA 2OG2A 1E2KA 2O8FB 8OHMA 1GD7A 3D0FA 2JA8G 2C9CA 3RYTC 3U44A 4YDHB 3J81j 4BRUA 3OFNA 3PUXA 1KI8A 1OE0A 2IX3A 1XP8A 3W5IA 2JXMB 4URXR 1Q44A 3H86A 3A1SA 2F1RA 3CPFA 1IBML 1CIPA 1FFHA 2ZRMA 4PHFA 3M4YA 5AJXA 2QN6A 1HY3A 1X1RA 4LV6A 3A6PC 4RCZA 1XNRQ 2CLSA 1R8QA 4DAYB 5HGQA 2QF7A 1E0KA 1XU4A 3ZS9A 1KRSA 2GETA 3T61A 1XRJA 3CLVA 3DM3A 3QKSA 2WMNB 5AWFC 3KKNA 4XJXA 5LD2B 1L0WA 1ZCBA 1IXZA 4MGYR 3GJ8A 4PG3A 2UUCQ 2RGXA 2WWXA 2J59A 3ONWA 2B21A 2OM2A 5KPDA 4CVNA 3AB3A 1J6QA 4LFBL 3M85A 1E9RA 4DV3L 4LF4Q 2MNAA 1W47A 4HLDA 3OFND 5DGXA 2AHOB 1YIJA 2ZI6A 3VHLB 3J81i 5JFGA 2E76C 5H1YA 3WNDA 2JA1A 2QTFA 3G5UA 3UXMA 1NRJB 5C4XG 4P72A 4LF5L 2KENA 3KLRA 5CLQA 1I4TD 4RFVA 4ZI3A 1KMHA 1KI4A 3KB1A 1LW7A 5C4JH 4HIMA 1QF9A 2A9KA 3KF6A 2IF2A 3U6KA 2BCGY 1JBKA 4UJ3A 3PCOB 1YZKA 4NL4H 3TR0A 3WYFA 1VYUA 2ZRPA 4DLWA 2P65A 5JEAH 2OFWA 1DOAA 2YOFA 2ZRCA 1QHHB 4BECA 2PEZA 4L8JA 1GKYA 2H92A 4L9WA 4DIEA 2A5DA 2NOAA 2V54A 3F3YA 5AUPB 3BDOA 4G7OC 1N9WA 4DAMA 3S17H 1V8QA 1CR1A 3NXSA 4KSCA 5B30A 1W4RA 1JT8A 3HOXG 4BLTA 4LBZA 1HZBA 2KHJA 1S2MA 2C04A 1VKJA 2Q3FA 2ZR0A 3AP2A 5DISB 3W6OA 3E9HA 1FJGQ 1Z2CA 1Z6XA 3GJXC 3QVVA 3Q3JB 4JMPA 4DV2Q 5AJZA 2YYZA 4LFCL 2FFAA 3L82B 4O0AA 3VU9A 1CSQA 1IBKQ 1ZC4A 2BBOA 2R62A 4GLVB 1MOZA 1JJ7A 2XTMA 3PIPA 2VSXA 4JI3L 1NSTA 4LJYA 3RS5A 3WRYC 3Q8DA 3B2EA 1AJEA 4XVRA 4OK3A 4O3MA 2ODNA 1CEEA 1MIUA 1PUJA 1ZYUA 1Q46A 1P9WA 1ZBDA 1SKYB 2OZEA 2ZE8A 1U8YA 4HJ7A 5H1SE 4YHHQ 3F5FA 1N2CE 1NVWQ 2JLZA 2ERYA 1G5TA 5IP9G 3PO2H 2AL7A 1HT2E 3SJZA 1VHTA 1YE8A 1QVCA 1CS4C 1VG8A 3IHWA 1Z6AA 3UDXA 2GHIA 1KO4A 5HCIA 2ES2A 2ZYUX 4TMKA 4LRWA 1GILA 3WNBA 3ND8A 2X2EA 2J45A 1HZAA 2D0PA 2IHEA 5FLMG 1UE7A 3LW8A 4BASA 1SVWA 1RVDA 3CM0A 1N0WA 2YWEA 3GLHA 3UMFA 1W0JA 1X54A 3RLOA 1KQSA 2AD1A 3IO3A 4V0MA 1M7BA 1SR3A 3EBEA 4LF6Q 4JT4A 5CK4A 3CZQA 4DV3Q 3CC7A 4TYQA 4EIWA 2DWPA 2ZR7A 3SU8A 5L8VA 1TWGH 1CLUA 4IFBA 3PIOA 4HJAA 1K8AC 4TMVA 2H17A 2RGBA 4LF5Q 5C46F 2O8CA 1Y1VH 3BG3A 1LS6A 3D3QA 3FTQA 1GZSA 4JJZA 2UZIR 1E98A 2C5LA 2OFOA 3DKVA 4TLBA 1OIXA 3CX7A 1KJWA 1J8YF 2QAGB 1TMKA 1ZNZA 3HJNA 2Z6KA 1XF9A 3KKPA 4PQYA 4NCIA 4CEIB 1A62A 3TSWA 1N33L 1NLYA 1VQBA 2Q9BA 1KO8A 1W0JD 2NO7A 1LM0A 2OAP1 4G5QA 3RRNA 1T0HB 1MO5A 3K09A 2F43B 2ZR9A 4YMWA 4B3MQ 5FI1B 3FOZA 4JI1L 4G5SA 4C7OA 5M04A 2AR7A 4A4IA 1VQMA 2UUCL 1FX0B 1P2TA 3SJCA 1KHIA 5KSPA 4LF8L 1UEBA 2NPFA 4B43A 4A6PA 1FJGL 4IFDI 1YRBA 3AVQA 1D9ZA 1UF9A 3BXZA 3S1NH 2DHRA 1WF3A 2EFEB 3WYGA 4B3CA 3Q5EA 4DEXA 2G1KA 4JLBA 2WKPA 1X6VA 2JA7H 1U90A 2FJUA 4MKHA 2WM9B 4US1R 2IXEA 2ZUDA 1G7SA 2P2LA 1EWIA 2NGRA 3NEYA 4PPNA 1ZD9A 3A8JE 5EE5B 3TSOA 4XVUA 2FGKA 1ZIOA 4DUZQ 3RS7A 2GVBA 2FPMA 3D31A 3ETLA 1IJFA 4GMXA 5BN3A 4GZYC 1W4CA 2K75A 2G3YA 2ZRJA 4JL8A 4A36A 1KTVA 1I50H 4DR3Q 3KF6B 4YHHL 1G20E 3QXCA 5JWOA 4PO8A 2GEVA 1U98A 4QHYA 4V0NA 4JK1C 4WZ6A 2I5LX 2Q0HA 1XTIA 1E2ZA 4NYJR 2J0UB 4X8LA 1KSGA 2R92H 4Q1FA 4HAWA 3CO5A 2A6HD 2I1QA 3HKZE 1JXOA 2WWFA 1TWHH 4YWKA 1E3PA 4QHTA 5HR5A 3GTPH 3K53A 5EE3A 4W9MC 4NB3A 3U61B 3E70C 4X66L 2HEIA 1KY2A 3SFVA 2ZTDA 4IPCA 2OCBA 3NHAA 4N3NA 3GPLA 3B78A 3Q7PA 1NG1A 4ZCLA 1K5GA 2B7CA 3VFDA 4OI0A 1XEWY 3A4NA 3P27A 1BKDR 1MO4A 3AYHB 1JEDA 3NBZC 5BXQC 2QM7A 1I94Q 2YTVA 4F4CA 2JLWA 5DLQE 5M3FH 4LSGA 4NCNA 3CB4A 4Q66C 4D81A 1S1MA 4DCTA 5CDFA 4BZPA 5KNDA 2AFHE 5L3RA 5JI2E 1US8A 3X2SA 1CKNB 1YJWA 4DSNA 4Q19A 4BBSH 3LFUA 4M21A 2BMEA 1D5CA 3CWQA 4JVNA 3HOYG 1E9SA 1EK0A 4DLVA 3QI2A 2IYZA 3U7FB 2CL0X 1UEJA 4A0FA 1G7TA 3FFBA 4MTNA 2XSZD 4X62Q 5DYIA 3TGPA 3PFIA 4JLKA 3EZ6A 1XWIA 721PA 2O5IC 1W5TA 1SVIA 1HNXL 5J5CA 1NG9A 4LF8Q 4I99A 4DK1A 5KHOC 1WA5A 3GEEA 2QMUA 2PNRC 2OCEA 3GLHB 5IP9H 3OIYA 1BYUA 3P26A 4WAUA 5SZJA 5B57C 2F52A 5CB8A 1RJ9B 4MGIR 1OH7A 2WSSA 1K0RA 3Q72A 4JI2Q 3TVTA 4FN5A 1EIYB 2VUMH 2C2HA 2DWQA 5B2ZA 2XB2A 5JJKA 1S9DA 3P20A 4URYR 3E0EA 2W6JD 4H1VA 4MGZR 4O0MA 4OWXB 3ULPA 1G4AE 5E7JA 3LH5A 2OLJA 4DUZL 3TRFA 1XTKA 2N46A 3G71A 4B3BA 4R2IA 1P8LA 1UBFA 3MCAA 1K8RA 3BERA 3C14C 3I4MG 2IF0A 4N0DA 2Q6TA 4X8OA 3UMSA 2OT3B 2WZQA 2A5FA 4YMUA 2W6ID 3IRBA 2V7QD 3BFVA 1E79A 4PFSA 4DK3C 3R7WA 2MSEB 4PZ8A 4DR5L 1YITA 1XB2A 1ZC3A 2C98A 2X8AA 4BE7B 4A8JB 3ZGXA 3E9IA 3EIVA 2QRNA 4CEJA 1P16A 4PQFA 2QQEA 4DLTA 3PXGA 3RR5A 2EDGA 2FN4A 2VL7A 2ZYTX 4DC9A 2LCFA 4LUVA 3ZZTA 1B70B 2R7DA 4WIAA 2PMDA 3K8YA 5H68A 3N5CA 421PA 1TQ4A 2X19A 4AKEA 3SEAA 4IJMA 2BA0A 1O7IA 2UXCQ 3K9LA 2EU8A 3ADBA 2JJ8A 5E7NA 2JJ2A 2BJVA 2VA8A 2BWJA 1E79D 1IOZA 5M5XH 1H8HD 3E2IA 1MRNA 1P4SA 5JHGB 2HJGA 4KU4A 3OAAD 4UNSA 3TVDA 3EAQA 1XMOL 1CR2A 2X77A 4QM6A 2NO6A 1KI2A 3KLWA 3AP3A 2VEDA 4LK1C 5LMNL 1DAIA 3KJIA 3ULLA 1R9TH 3BD9A 3MG9A 2AUKA 2B3GA 4WXPA 5ELNA 2WV9A 1MT0A 3K70D 3ER0A 2A8VA 5FPHA 1CR4A 5C44H 4A3LG 3H2YA 2BV3A 4DVGA 3SQXA 2XZPA 4AH6A 3TAUA 1XMQL 2EVWX 3LQQA 4CIDA 1JAHA 1JR6A 4ILEA 2QE7D 1A8VA 4X65L 1NVXQ 1Z83A 3EZ9A 3GTJH 3EIQA 4Z51A 2QPTA 3KFUA 1N5KA 3IEUA 4JYAL 1L2TA 2IL1A 3OAAA 2B6HA 1E9AA 1PZNA 3GLIB 2ZQ5A 3AUYA 4LC1A 1WRBA 2CWPA 3IEVA 1GWNA 1NP6A 2OO7A 5M5WH 3CCRA 2F1IA 2P67A 1XEFA 3G82C 4NTZA 4PAOA 3T06B 4B2IA 4ZI2A 2GILA 1EX6A 4K0KQ 4LV8B 3IIKA 1EUJA 2WHXA 3PEWA 1YNXA 2QPAA 5K36G 4DV5L 2XJ9A 3G0HA 4LPKA 1S96A 2LSSA 4P4UA 2N8NA 4QRHA 1MABA 1IZ6A 4CRWB 4NYIQ 4P74A 3I4NH 3OIVA 3AGQA 4BGDA 2G0NA 5KPJA 4BXXG 4L16A 2QE7A 2QT0A 1II8A 1PH1A 1P61B 3B85A 1D2MA 3VKGA 5TDHA 1P5ZB 3TEHB 1G16A 2BBTA 4UXHA 1G8PA 1N6HA 3U3JA 1E9DA 1T5LA 1YZQA 1RJ9A 3L0PA 1FL9A 1QVGA 1E24A 4QBGB 2V1XA 3K81C 3AKYA 2Q9AA 3N70A 4JI2L 1YHAA 4B3RQ 3KJOA 1NMYA 621PA 3BWDD 5BW8A 4UY8C 3K9HA 3AF4A 3K0SA 3RSOA 1JAIA 1SVMA 2UZ3A 3MWKA 4URWR 2DBYA 2J46A 4G7ZC 5FTMA 2GZAA 1ZUNB 4ZIRB 3I32A 2QM8A 5EE0A 1GHJA 3K9GA 1D9XA 1SQ5A 4BUJA 2JLVA 2QMEA 4IVPA 3U7EB 3F0TA 2DCUA 4Q47A 3LW7A 2JA9A 2FPKA 1W0KD 2BM0A 1DGSA 1H9RA 5C4XH 1R0ZA 2PNHA 2IYQA 4CF7A 1X65A 1L4YA 5BYKA 3BB4A 4J15A 3ZJYC 4A8JA 4NKRA 3TKLA 4IOCA 1DG1G 3LRPA 3THYB 1KDRA 3FB4A 2FFBA 2PT5A 3ZIAD 1E4VA 4CT5A 4JLMA 4IKEA 2BKUA 4E03A 2ZTEA 2YTYA 4FIDA 4A4DA 4JI7Q 1T3HA 1JJCB 2KBNA 1YZLA 2YINC 1VQLA 2JA6H 1N36L 1SRUA 1VQHA 1T9HA 2XTIA 1JALA 1F2TA 1NVUQ 1U9IC 2F6RA 2WWGA 2R65A 1CRQA 2XOKA 3DL0A 3KJEA 2JJQA 2VSOA 4J0QA 4M1SA 5JECA 3I73A 3EA5A 4P4SB 5AUOB 2A6HC 2LMCB 2VW9A 1N0VC 2Q3HA 1IW7C 1F6BA 1YJNA 1HA3A 4C3JH 1M8PA 2ZJ2A 3B13B 2OESA 5LMNQ 1IBMQ 1ONLA 1XTRA 4DR2Q 3G4SA 1FUKA 3BH7A 1QHGA 4PSAA 4W5HA 5DI3B 1V5WA 4GN3B 1HR0L 1J90A 1GJXA 4JLNA 4PSVA 2DN8A 1CJVC 3C15C 3K70C 3UPUA 1WDTA 1M90C 1SZPA 3QVUA 3TQCA 4TTQA 3S1QH 2W0SA 5DE3A 1QJOA 2BMJA 4LDJA 4S2EA 3TQFA 1EFTA 2RHMA 1L4UA 2D5DA 3TS0A 5UKDA 1AQUA 1KAOA 3BIFA 1C4OA 1QHSA 3MUFA 1SE8A 1PH6A 4MYHA 5GADl 2K14A 2YWGA 1Y1WG 4KI0A 4D6PA 2ZUCA 2MQHA 3M9BA 2ODEA 4NPHA 3I1FA 4AG5A 4A2WA 4KKTA 2ZETA 4L5SA 3RZOH 3T1HL 1NSFA 3I4LA 2DFTA 2Z0SA 1M74A 1UBGA 2NQ2C 2ATVA 4OI1A 2VRWA 2A68C 1CU1A 1E69A 1G3IA 4POGA 4H0LC 1VS0A 1MKYA 5DHFA 5BR8Q 3GJ0A 3SYLA 3H4MA 3QKUA 1W48A 3QPVA 4EUNA 2D2EA 2ZSEA 1YHNA 3FHCB 2VLIA 4GLAC 3FE2A 3TW4A 2UU9L 3DZ8A 1XEXA 1VQFA 1E9FA 3HYRA 4OONA 1RRGA 4TLAA 4ACBA 3GLFB 4Z8YA 5KDOA 1PH3A 1FX0A 1Z07A 3PEVA 4B3GA 4BFZA 2NO1A 5EAYA 4L5TA 1VQ6A 1S72A 1FUUA 3FKQA 1ZD1A 3O47A 1X55A 1VHLA 3QY0A 4LFAQ 2KJQA 1VIYA 3ZZUA 4BPBA 5AUNB 5C4GB 4L5QA 1E99A 5E3HA 2H16A 2ZI5A 1H9SB 2O8EB 1EX7A 1NIJA 4RKEA 4WBSA 3ZD7A 3QF7A 1KYIA 1LUZA 1HURA 1NBME 1UDWA 1YI2A 1NN5A 3QEJA 5FL3A 2BE5D 5FOVA 4CEHA 2W00A 5JZVA 4DLZA 2ZU0C 4DSUA 3UDIA 3JAMc 2W2XA 4YCVA 1JI0A 2WWHA 2AKWB 5DN6D 3T12A 1OTCA 4PAMA 2Z4RA 2ZYWX 4AKIA 2ZITA 2J0SA 4OHYA 2RMKA 1B23P 1FPMA 2E2HH 2YC2C 1XCPA 1DAMA 4QFMA 2FDCA 2C35B 2DNCA 3H94A 4TL6A 3K0FB 2GJ9A 1YNNC 3NC0C 1S3SA 5KDDA 1A1VA 1HZ9A 1A2KC 3WRXC 1GITA 4R1JA 1XMQQ 3FHWA 4DV7L 1CKOA 4JI7L 4US2R 2H1LA 4LF9L 1N36Q 1CTQA 2VP4A 4OQMA 1FNNA 1G64A 1FNMA 4MKFA 3HOWG 2QY9A 3B1WA 3THXA 4LFBQ 3ADKA 3U9SA 2QGZA 1L1OB 3CAMA 2JLYA 2FXQA 3I8SA 3PCRB 4KN4C 1W36D 4R4QA 1HH2P 3HOWH 4I81A 4LHVA 2H57A 4D25A 3FDIA 1YQTA 3LWUA 3GLIE 1AH9A 3GD7A 3SN6A 4CT4B 3H3VH 1E2MA 1G6PA 4A93H 2BVNA 1IN8A 3MWYW 5C1BA 1UM8A 1G51A 4M1KA 2YWHA 4AYBG 1ZUHA 2R6DA 4TLEA 3U5ZB 4JBJA 1Q8KA 3AVUA 1JEEA 4KFTA 4JG2A 2GCOA 2VIIA 4C7OB 3BJIC 2MSCB 4LJ5A 4RD0A 4Q9IA 4R4TA 4MGKR 2ZJ5A 1IBLL 1R6BX 2UKDA 2I1VB 3EX7C 4IFDH 3IIJA 1JR3A 4EJSA 1N6NA 1FVIA 4GKJQ 1G4UR 3MWJA 3UKDA 2R93H 1NBMD 1HTPA 2O5JC 1H9MA 4X6AH 1HTWA 2ZSDA 4Q1CA 4P32A 5GVRA 4DDTA 1NLFA 1SKYE 1PVOA 3HPQA 2RGNC 2D2FA 3GJ3A 1YBYA 3DXJC 4NXNL 3NE5B 5EUMA 3QIAA 3ZQ6A 1XX6A 3L43A 1MKHA 1SGWA 4GKKL 4DR3L 1LTQA 3CUEF 3OESA 3CCUA 4KKSA 2WJHA 4IFEA 1EFWA 2MMGA 4LJZC 4DV1L 2RGCA 1WXQA 2VUMG 4A6XA 1R4AA 1DBSA 2G83A 3K0FA 4CEIA 1TF2A 1ZNXA 2NZ8A 3VQTA 1T3SA 3QUSA 2KCTA 1EFRD 3ZYCA 1WQ1R 1XD2A 2K7VA 4ALPA 4XSHA 3CMEA 1FYCA 3LBHA 3KKQA 5JJLA 4JI4Q 3IHLA 1Q22A 2X1VA 4JVMA 4IEEA 4HR7B 1EFUA 1F3OA 3AQ4A 1Y1VG 1KK0A 5D3MB 4BFXA 4DNRB 4B75A 1SXJD 1W7AA 4TTPA 4CDGA 3K0XA 2OHFA 2XXAA 2J0VA 1YNJC 1AS3A 2JCSA 1YZTA 3PUWA 4NPSA 2P5SA 2CE2X 4POAA 3CRW1 1Q12A 5KUTA 4WW0A 4DV6L 4LYAA 1KI7A 5BN4A 1NN1A 3U3MA 1PJRA 3HP1A 3NEJA 3DKPA 1BO6A 2N3SA 1AZSC 2CFMA 2HCBA 3EXAA 1OXVA 4PC6A 4DR2L 2O0KA 4PC7A 3T51B 1GAJA 2A5JA 3GEHA 1Z0JA 1IQPA 1CP2A 5AUQA 1N33Q 4NZYA 3ERSX 4HB3A 1ETUA 2PMKA 1TUIA 4OXPA 1K6MA 4O2LA 4AYXA 2CCZA 4C0QC 4IPGA 4B3ML 2J0UA 3DEFA 1XMJA 3T5GA 1LY1A 4NYMQ 4HATA 1E2GA 4PC3A 4XTCS 5FUXA 4M9ZA 4POFA 1F2UA 4R4OA 2K32A 4TMWA 1ZAKA 3TUIC 4A8JC 4A3CH 2K33A 1VQNA 2ZRBA 4LJ9A 1G17A 5C0XH 4DR4L 4OO1G 2MO0A 3J7ZC 1Z6YA 2OLKA 4G5RA 2PPBC 4A3CG 1GHKA 4LI0A 4TQ9A 4NYIR 4OO1H 1W3SA 2V1CC 2JA5H 4I1OA 2QAGA 4P33A 4Q1EA 3T1OA 3WDNA 4C0AC 1CR0A 1KZ7B 1KSJA 4D80A 1O7LA 5CITA 3QSYA 4A3KH 2G88A 2C03A 5FTKA 2OUKA 1I6VC 4GKKQ 1DTSA 3BFKA 3QG1A 5IF9A 4P73A 2PEYA 1GRRA 4A3KG 2BEJA 4HAVA 3C8UA 3Q7QA 2JGNA 1Q57A 2REXB 2FSGA 3LX8A 3P1JA 3HPRA 3VKWA 2LXKA 4NXML 2FZLA 3CKLA 1KO5A 5JJIA 1I2MA 2CDNA 1E2DA 1TEXA 3DM9B 3CX8A 1NIPA 3DMNA 4FMBB 5GJCA 2W0MA 4G5GA 3TMKA 4RD6A 1BS1A 3OTOL 1T3LA 4JI4L 5F9HA 1VQKA 1E32A 3O8RA 4KFUA 3NWJA 1UJ2A 4AQYQ 3T1YL 1K83H 2XGTA 2OBLA 1OSNA 3KTAA 3GDEA 2E2IH 1ZM7A 4TMXA 3AEVA 4R4IA 1I5FA 3CPWA 5JMTA 5JSZA 3S24A 1G41A 1YR9A 1GKHA 3THWA 1QHNA 1RYFA 1ZU5A 4DDVA 3CRLC 2Q2IA 3KQNA 4GI7A 4WOPA 1JR3E 2OEPA 5DNYB 4YY3Q 2VQFL 2V55B 4JS0A 4R9UC 3B1VA 3OF5A 1GUSA 2VHUA 2R93G 4HJ8A 2I4IA 3FWYA 4B3FX 4C30A 1XNQQ 1WBBA 3EN2A 3L2PA 4MRVA 3K8AA 4WZAE 4ESVA 2IS1A 2D3WA 3RN5A 3CBQA 1K8OA 1XNRL 2IYVA 1PFSA 2QI9C 3JVVA 3HFZB 3B9PA 2B8FA 2WOJA 1IXSB 1RE0A 2MSDB 3FKIG 2PQAB 5GROA 1IBRA 5FI0B 3ADDA 3UWKA 1KL9A 2HQLA 4TMZA 2CHQA 1VYTA 2VTKA 5CIWA 2IY5B 1A2BA 1E96A 2GJ8A 3R8FA 1XJQA 3PITA 2OCAA 5FLMH 3TRZA 3CPEA 4YLGA 3W34A 821PA 3KQUA 1OB5A 1GG2A 3BRWD 1E7ZA 4GOPA 4JBYA 4P4SA 1XPUA 5C18A 5CIQA 4ASUA 3I72A 1QBKC 4L8GA 3PGZA 4IDPA 3A1VA 4DV6Q 1F60A 5B64A 1WI5A 1KO7A 2Z6VA 3TUZC 3ZVRA 4NMMA 3P32A 1FGUA 4DUGA 3V9PA 5L3QB 1DELA 1IAQA 4QJFA 2ATWA 2XITA 4QXAA 1YJ9A 1OYWA 2C8VA 1AS0A 4DV5Q 2ZRFA 3HU3A 3LBIA 4PHGA 2GTPA 5JEEA 1TNDA 2VHCA 5TVKA 3X1YA 5AJYA 4Y0AA 4D0NA 1TX4B 4FMCF 3PF5A 4IJHA 1OIWA 2ID0A 1UWVA 3B1XA 2QTHA 3RLNA 4RG1A 5IP7G 1US8B 3RS4A 1RPZA 2ZM6L 5JEDA 2B63G 1VQIA 5KSZA 3IPYA 1EXMA 1BBUA 1Q82C 4ZCIA 3I3SR 3REFA 3NENA 1CJTC 1VF5C 3QKSB 4E07A 3K0CC 3K9NA 1LV7A 5IHPA 3ZIAA 1COWD 1Z6TA 4DHEA 2IX0A 4JVSB 4A3JG 1W2HA 2A19A 2FWRA 4IQZA 1R5NA 4IVRA 4LJ7A 4UKDA 2HIXA 4JOIC 1G9XA 4JBXA 1TAGA 1LF5A 1TWFH 2JDID 4Q4LA 4D0LB 4EJSB 4ME3A 2JA7G 2Z83A 2DR3A 4DDWA 2JASA 1T0JB 4NU0A 3U44B 2R8RA 1XJVA 2ZJ8A 4WA7A 4R7ZA 1XTSA 2GK6A 4A3LH 3ICEA 1NMFA 1I6HH 1Q0UA 4IDQA 5C3EG 3S1AB 4QBFA 1XMOQ 2ZRIA 3OYYA 1KKMA 4PX9A 1PLKA 2KA7A 1XZPA 1KMHB 4PMWA 1GVPA 4KLZA 1NL3A 3H15A 1EFCA 3THOA 4FMDB 2IX1A 3JZAA 3NIBA 3RRMA 4YXWD 3EPKA 3K70B 2ZJBA 4Q4AA 4AQYL 5FTLA 4HUQA 4TSFA 4HJ5A 2GVDC 2JDIA 5EXSA 2WAQG 1DO2A 1HNZQ 1GDDA 1Z08A 4TZ6A 2R92G 4QKQA 1ZM9A 1DPFA 1M7HA 4KVGA 3B1YA 1M1YE 1ZYRC 3UG6A 3CRRA 5J40A 2ZAOA 3HOUH 2PJZA 4BBRH 1QG2A 1Z0KA 1K9MC 1BBWA 2FEMA 3B60A 3KDSE 5EP4A 2RHQB 2PLFA 5IK2A 1L1OC 1Z5ZA 2L0XA 3A7LA 3C5CA 4A3FG 4A3MG 4EX5A 4JBWA 1KIXA 1GFIA 5CM9C 1OH8A 1EG7A 2CHVA 2PJRA 3NEMA 4ZIRA 2JA8H 3U4ZA 4G01B 1VQ8A 4XIGS 4LJAA 1X86B 5EE1A 2BMDA 5G53C 4H44C 4XD7A 1XTQA 2CKZB 4JI8Q 4BY7G 3IFTA 3HOYH 4M1TA 2EXDA 1YR8A 2IS2A 3DDCA 2EQSA 4JT2A 4WZBE 4ACAA 1XJ0A 1CSPA 2K50A 1TXYA 5HKKA 1VQDA 4U7DA 1H8EA 1E1RA 5GJBA 3THXB 4D4LA 4GLXA 5GQOA 1T4GA 3RSLA 3OZXA 1FW6A 4B3RL 3K0AA 3A1TA 2Z0MA 2I0QA 3QBTA 2O8FA 3GTQH 3G48A 3ZVLA 2GCNA 2BJWA 3UATA 2C9OA 2XOKD 1YKSA 2UXDL 3TH5A 2DB3A 2K5VA 3FP9A 1JJGA 3TR5A 2N78A 3U3RA 4GP6A 4JLJA 4RFSB 2ANCA 3A4LA 4NBSA 4TTRA 1KKLA 2XZLA 1KAGA 3A5UA 4M2LA 3X1XA 1WP9A 1VYVA 2EVBA 1M34E 4Q9LA 4JLDA 4F93B 3D6TB 4XOIA 3DMDA 5E7MA 1Z9FA 4A3GG 4HIOA 2ATXA 2Q3MA 3IQXA 3SE0A 3LLUA 3BORA 5JWRA 3ZQJA 3W1GA 1GUTA 2IYTA 1Q21A 3T15A 3L2OB 5B58C 5FPKA 1TQ6A 3KJPA 3GLFE 2REBA 1PH4A 2G9NA 1TU3A 3KXIA 3LD9A 2WBLC 3QF4B 2IUTA 3EC1A 2E8GA 3T5DA 1XMVA 4M22A 2IYWA 4JBMA 4AKGA 4GL2A 2AXPA 3GLGA 3B5JA 1PH7A 4MRSA 2QBYA 1FP6A 1IBKL 1SXJB 4OK6A 3R8CA 1KGDA 2FFQA 3ADCA 1J70A 4KHPQ 1GNPA 3VDYA 2Y8EA 2W2VA 4IXMA 1FQJA 1BYIA 1G291 1E22A 3RDPA 1N34Q 4YY3L 2VQFQ 2UUAQ 2F4VQ 1N6OA 5IYBH 1HQYE 3LY5A 3ZS8A 4GRAA 3UDFA 2JJ1A 3D8BA 3BOSA 4EDHA 4XSGA 2P6RA 2WKQA 2I3BA 1Q86C 4URUR 2ZTCA 1QHHA 2ZVQX 4AYBE 4TL8A 1E2PA 5HE8A 4EPVA 1SMXA 3L8YA 2RGGA 2GBLC 2FPLA 3T35A 1TTTA 1S1CA 1D8LA 4DV4Q 3VR5A 1J7KA 3D4RA 1T8UA 5GAEC 1ZNWA 2ZEJA 4QY7A 4A2PA 5HZKA 2AN9A 1CBUA 4F91B 4A76A 4QQBX 4DR1Q 1KNXA 4Q4JA 1WCMH 4IDNA 4BFUA 5KO2A 3VNVA 3ASYA 3QXSA 1AM4D 1X9NA 2KCCA 2J9RA 4YCUA 1AE2A 1TUEA 1N5IA 2JJ1D 2CVHA 2RB4A 2JAQA 4IPDA 3CCSA 3GTMH 2JLUA 2BA1A 1MR3F 3CH5A 4KAXA 3AF0A 4YONB 2C9YA 2GA8A 1RRCA 4QBIA 2WFWA 5L3QA 1S3GA 1VQ7A 4DR7L 2A7QA 4MQBA 5J4LA 1EIFA 2C95A 4Q7MB 4FCTA 2ZJOA 5EP1A 2F3RA 2ZRLA 2FSFA 3BB1A 4Q4HB 4EFNA 1PLJA 4JLVA 4QC2A 1NNEA 2EWVA 4EPXA 4PZ6A 1NKTA 4OQXA 1D7QA 2WAQE 2VQSA 2H5XA 3K80C 2GVAA 2CCKA 1I4LD 4XVQA 3PR1A 4TQAA 3KDFB 1ZCAA 3B9QA 5A0FA 4DK0A 5LMUL 1KJYA 4DLUA 4LY6A 1HH4A 1EYGA 1Y8NB 3NBHB 1SXJA 3I4OA 3EWSA 4M0LA 1H9KA 5EJEA 4BFSA 2GNOA 2Z5FA 3CR7A 4GOPC 4KO8A 1I2DA 4KHPL 2OQ0A 1E0AA 4GNXC 3NBYC 4HUTA 4HZIA 1N34L 2UUAL 4QOSA 1DG3A 3QKTA 4LWCA 2IXFA 4TT3A 3PO3H 1GRNA 4E22A 4F38A 3CNOA 4DV1Q 1IN7A 2REOA 3CCJA 3HOVG 5P21A 2ONKA 3I2ZA 1G3RA 3V4FA 1ZUIA 5FTJA 3ZLJA 3KJHA 3QENA 2QL6A 2W2TA 3S2HH 3OHMA 5FOXA 3J81c 2GCOB 3F1ZA 1PH8A 1KO1A 3EIEA 3IQWA 2EJGC 2A69D 2KBFA 2QNRA 3DPUA 5IDVA 2O8EA 4MITA 1NVVR 2PT7A 2DGYA 2CLDX 3L0IB 1OKKA 4DUYQ 4GT1A 4TN1A 4QJ3A 3UANA 4TT3D 4B3XA 1JQLB 4FMDF 4JI5L 1YHBA 4QHSA 1UADA 2EW1A 4HZUA 1FR3A 5K36H 2CCJA 1CF4A 4Z1MA 1QVRA 3QKRB 2H5EA 2DWOA 1CULC 3L0SA 1CKNA 5BWMA 1HYQA 3GLGE 3HOZH 4BRWA 4F4IA 1DO0A 2PH1A 5L3SA 2PQAA 4IFDG 3TE6A 4QL5A 2V6IA 4OJQA 1JQJC 3LVRE 1CTMA 1DCZA 3TS2A 3OEEA 3SQWA 2IC5A 1AIPA 4DV4L 4MUBA 3EW9A 2WP8J 1RZ3A 1GNQA 5DSZA 4RY2A 1SVOA 2VY3A 1GOTA 1EFRA 4B3TL 1W4AA 4S35A 4W5WA 1OXTA 2BM1A 3PUZA 3EZ7A 3TBKA 4D4MA 4DCVA 2XAUA 2VP0A 4DCUA 3T56B 1L2FA 2IWHA 5FUWA 5TY0A 3I5XA 5JHHB 4DT1A 3U2QA 4HEJA 2BEKA 2ZRNA 4TYPA 1Y1WH 4OK5A 4Y0VA 1GL6A 2P3SA 2OXRA 1HE8B 1DAGA 1IN4A 2V9PA 2CNWD 2ZTSA 3RHFA 3VU9B 1D6JA 3A0JA 2ZANA 2UXDQ 3NDPA 2R7FA 3KYHC 3LAWA 1DAKA 3VTKA 3OEED 4AI6A 4Q9HA 2QQ0A 1UBCA 1IYVA 4NXNQ 1CJUC 2F3TA 4IVQA 2YTXA 1FMJA 3L0OA 3MJHA 1GO3E 2AWOA 3W1BA 4OWWB 2R6AA 4FCWA 1MRSA 4PO1A 5E95A 2BHRA 3AB9A 1T5EA 2FX3A 2K52A 1E1OA 4LBVA 3L8ZA 4DIDA 3S2DH 1NI3A 3J80i 1M6NA 4DB2A 2G6BA 4RJLA 1XDBA 4M8NE 1CRPA 4HLUC 2WB1G 2JA6G 5LMUQ 2EFGA 5F2EA 5TMPA 5FR2A 4AYTA 4B32A 5J4KA 1GRQA 2GDJA 3MLEA 1K8MA 1QDEA 3OIWA 1BIFA 1Y63A 4Q21A 2AXNA 2GRJA 3KQKA 1P75A 1T8TA 2IUUA 2JEBI 1UDXA 2WIBA 4IDHA 4JI5Q 4M9SA 5FJ8G 1WJJA 3M4QA 3K0EA 4F4JA 2ZJYA 4MYUA 1NLZA 2ZS9A 3LA6A 2WWWA 3AUXA 5FR1A 4DUGD 1SXJE 3P4XA 4JYBA 1G3MA 3HU1A 4GN4B 1Q1EA 1KRTA 1KDPA 3FMCA 1V1QA 2NIPA 5CJ2A 3I61A 2FZ4A 2ZJAA 4OO1I 5F9FA 1QVFA 4C3IH 1HR0Q 2XEXA 2HYDA 4B35A 2WTUA 4CEJB 3S15H 2KB0A 2HV8A 3PF4A 2QSYA 1J2JA 1KIMA 3CONA 1RFLA 3A37A 1ZIPA 4NYMR 4PTLA 2P0EA 4G7HC 2ZRAA 5CB6A 3CNLA 4K8OA 2F43A 4M1MA 3CW2A 4YMTA 2A68D 1N25A 2WJYA 2B7BA 2ZRDA 3C4JA 2ZE7A 3BJUA 2JLQA 4X65Q 4C0LA 4R98A 3PJRA 1COWA 2GZDA 5FPSA 2ZM5A 2GJSA 2CJWA 1VCMA 3QNUA 2ASEA 4JL6A 4R4CA 1H8HA 1P9NA 3WMEA 4JI6L 4IOMA 1AS2A 1VPLA 3GLGB 4I1SA 1E9BA 3QKRA 2LWIA 2VP5A 5IT9c 1E0JA 2RCNA 3JVUA 5K8LA 3L7ZC 1YZGA 1Z6GA 5FUYA 5HPYB 4EQ5A 2ZI3A 3WY9A 4EPYA 3VR3A 1W36C 1SN8A 5SZHB 4D4KA 3A5ZB 2E9SA 2QGNA 2DUDA 2ZVPX 3H1TA 4QL3A 1U8AA 4K46A 3QXHA 1WOCA 1U99A 2V6JA 4PAQA 1ESNA 4OGQC 1YZ6A 3S14H 1HR0W 4RMFA 3HOZG 4RCNA 2CHGA 2DFKB 4EAQA 1CJMA 1K73C 1E9EA 2Q2UA 4A3MH 1F48A 4GDFA 5FL7A 1ZP6A 1OLOA 2J41A 1EWRA 1C1YA 1H95A 2VH5R 4DT1B 5J4HA 5HE9A 2Z6KC 2V8OA 3RN2A 4OI4A 2RGEA 4HLQB 1R0YA 2QSZA 4R71A 4ZKDA 1L7VC 2B92A 2CK3A 4PHTA 1U2RA 2CE7A 3ZZ0A 3AF2A 4NHOA 2E5LQ 4E5UA 3B7GA 2ZJRA 4Z8XA 1GUOA 2VO1A 3MFYA 1FTSA 2OCPA 2ZI4A 4GSYA 4KLNA 1QRAA 4GOJA 3WXMA 2E75C 1AGRA 1XNQL 1XXHB 2OE2A 1LABA 2QMOA 4PV1C 4U00A 1XMIA 5FL7D 2A69C 4L9SA 3VAAA 1GIAA 2NN6H 2FF7A 2IYLD 5BQ5A 1W46A 2R44A 2V4ZA 4EJSC 3MEFA 1CFMA 2RHSB 5EXTA 1Z0IA 1NJFA 3ASZA 3I4MH 3QF4A 1SVLA 3TW8B 1QZGA 2FSIA 2O8DA 2X2FA 1E1RD 4GS3A 4RVCA 1TWCH 4JV5Q 3Q9LA 3HKSA 1KI9A 3AF3A 4OX9L 3K09C 4OQLA 2GXAA 2HYIC 2IS6A 1VECA 3QPWA 4B74A 2RGNA 3CR8A 4B44A 4A93G 1RIFA 3IIMA 1I94L 3P4YA 3OE7D 1OT3A 3BK7A 4O2DA 1KZGB 4FWTA 1Q3TA 2JLRA 4UQOA 1PYSB 5EXPA 2NVTH 5IP7H 1G3QA 1M2OB 3HOXH 3NG1A 4GNXA 2ZT9C 2IYYA 3AVTA 2IHYA 1ASZA 2F7SA 1H65A 2EYQA 4X64Q 1OPXA 3LNNA 4RZXA 4C3HH 2QG6A 4KYIB 3C7KA 1MJCA 3CF0A 1A82A 5IWAL 4B76A 4EPTA 3PEYA 1Q90A 3MSXA 4LUZA 3SBEA 4A3JH 5KDLA 2BDOA 1II0A 1XCGB 2LKCA 3OEHD 4JZKA 1IBLQ 2HXSA 3RRZA 4ZDWA 4JI1Q 4Y52H 3PVSA 4B3TQ 3DOFA 2BH8A 1GL7A 3BGWA 3GJ6A 5JWHA 5D3MA 2D7CA 2GJAA 2N42A 2OWOA 1P3JA 1P7CA 1G5PA 1X8JA 4NCKA 3LWNA 3I62A 5LB2A 2Q9CA 1HPCA 3PV0A 2DFLA 3IPXA 5DYGA 3SHFA 4JI6Q 3M0EA 3HKZG 1P2SA 5DI3A 2CLCX 2D0OA 4QGUA 2ZJPA 1EFHA 3H3VI 3EA0A 1ZKOA 3UK6A 3EASA 5JBQA 1VF7A 4KN7C 3UE1A 2IA5A 1Q7YC 1IXRC 4LCBA 4A75A 1ZMXA 2IEZA 2C77A 2PZFA 4B2PA 1M1KC 3AKCA 3WP0A 1NBWA 3CW2C 1AA9A 3RANA 3LBNA 1Y14B 2MMCA 3TUJC 4ARZB 1ZU4A 4MKIA 4HYYA 2WIAA 3FYHA 4MRNA 4ZO4A 3ZVMA 4M1YA 3A8TA 1UAAA 4QNRA 3R20A 3T53B 1B8AA 1FQKA 1X3SA 2JK8A 3C5HA 4N1AA 3FGNA 2LXJA 4FWIB 5E4FA 1EQQA 3KFVA 3RS3A 4KBFA 3CNNA 4YMSA 2N1BA 1KSFX 3RABA 1JXMA 3SZRA 1XPRA 3CF6R 3SJBA 4OX9Q 5JSZB 1P72A 1G21E 3E5HA 3NKVA 1G19A 3NHBA 2QAGC 3CWZA 4QNMA 4BLSA 4V0OA 5HCNA 4LF7Q 4B71A 1E2FA 2VQEQ 1Q1QA 2GKSA 2IW3A 3F8TA 1X56A 2E87A 3C41J 3CX6A 4V0ME 1S9HA 5JRJA 2FH5B 4QG7A 3GO5A 3H0KA 4OQNA 2ECKA 4V02A 1TF5A 4F92B 1OV4A 5JCPA 3UIEA 4EPRA 3A8IE 3S16H 3LO5A 4ZDJA 4A0RA 1UKYA 2EYUA 5CLLA 5IWAQ 3M4PA 3RC8A 1AGPA 1KAWA 2KCMA 3TREA 4GPTA 1XBTA 4U5XA 1TQDA 2YC4C 3STBD 4LGMA 4DKXA 5M3MG 5EP2A 2WB1E 3PO3G 2P5TB 3AVVA 3SNHA 1VQ4A 4A0HA 3PUYA 4GOPB 4DR1L 1G5RA 3F2BA 1HV8A 1HNWL 2AK3A 3GFTA 3M3YH 2VP2A 2NN6G 4DK6C 3MWLA 1DS6A 3U3KA 3VA7A 5DI9A 5C0XI 4MH0R 4Q48A 3W8RA 1JJVA 4HJ9A 1N5JA 4RZ2A 1OH5A 2CW0C 3OW7A 1F2TB 1AKYA 2PBRA 4ABYA 4LPSA 4TMTA 4AC9A 3MJRA 1NF3A 1KI1A 1LYLA 3N2IA 4UNRA 3ND9A 1YR7A 2E74C 1KSHA 3CPHA 4AD8A 3B82A 1ASYA 2VS1A 2GEDA 3DVLA 1KC8C 1Z22A 3IBYA 2OBMA 2A6ED 1DARA 2ZSAA 3IILA 4B73A 4DEYA 4TYYA 2BOVA 4KLKA 4DCNA 3IDQA 4OWTB 1R0XA 1V9PA 5LMNW 2CEAA 2EQBA 3OTOQ 1JJ2A 2RGDA 4LYHA 4BQSA 3F2CA 4JI0L 1SROA 1QHIA 5FBLB 1AQYA 4I1UA 3OPOA 1XMSA 3KUDA 3KKMA 1ESMA 3VHXA 2Y0SE 4I7ZC 4BY1H 3HGBA 4YWMA 1K8GA 2ONJA 3AVXA 1KJZA 1Z28A 3K7UC 2GJKA 2GWHA 3JZMA 4KBGA 3EZ2A 1OKKD 5IYBG 3UE0A 1TL7C 4BBSG 1W2BA 1E2JA 2WAXA 1FP7A 2CXXA 3I5YA 4HAZA 2CBZA 5KYKA 2XTNA 2ZROA 1JPJA 5DLQC 1CKMA 1IJEA 4IHQA 4QGFA 3W3ZB 4AYWA 4Z1MD 2J5XA 1IYUA 5FBWB 1A63A 2WWYA 2E5LL 2F4VL 3V4RA 2R2AA 4LHYA 2O52A 3QQ5A 4BEJA 4OI2A 3WNCA 1FL0A 1Z2AA 1OF1A 2IYXA 2W58A 1XEXB 5C3EH 1SLJA 2RKOA 1XD2B 4MRRA 4DCSA 4Q00A 2WAYA 1WB9A 2JQOA 3D7MA 3A1WA 1EESA 4YC7A 5M5YH 4WJ3M 3BBPA 3CC4A 3K0CA 3LVQE 1XXHA 3TAHA 4MKGA 2ZS8A 2AHOA 3GTLH 4FDBA 3A36A 4IDOA 1LNZA 1NBMA 2CCGA 3AVOA 4JVLA 1ZW6A 1S4QA 1Y69U 4RD1A 2EIFA 4H9GA 1OH6A 3X1DA 3KKOA 4HAXA 4NP6A 1VCIA 5HZHA 2QROA 1IY2A 1VCNA 1P6XA 2GK7A 4MNOA 2VHTA 1SHZA 4K81B 2O8CB 1NVVQ 4LWZA 5G3ZA 1XJCA 3U50C 1VQCA 5G40A 1OFTA 1W2GA 1Q1ZA 4JYCA 1NJGA 1G8YA 3RWOA 2NZOA 4A1FA 4A15A 1G8GA 4A3FH 2DNEA 4DR7Q 3EC2A 5BYJA 3T1VA 2OTJA 2YV5A 3GJ5A 4DLSA 4ZPXA 4X8HA 2H8KA 1OHHD 4JI0Q 2ZIAA 1TKWB 2A1AA 3RZDH 1UBEA 1U9IA 2OQKA 2GN5A 3C16C 4JBKA 3N2EA 4AWXA 2XXAB 2XTZA 2KSQA 4MDEA 4OYHA 2UVQA 5F98A 5DO9A 2PX3A 2VF7A 5JI3E 1U0JA 1TQ2A 1BMFA 1IHUA 4KCGA 4G0NA 4LK2A 1D2EA 1Z6HA 4TL9A 1H9SA 4C0BA 3J7A5 2W83A 1G18A 1JMCA 2PI2E 2E1RA 1NTGA 2D2CC 2CQOA 2QRZA 1MH1A 2VHQA 4IOKA 1LB1B 4LJ4A 3QEOA 4BLQA 2E2JH 3O8DA 3HOVH 3RNLA 1E4YA 1QZXA 2FMXA 1L1OA 3HU2A 4PPQA 2HDNB 3EPLA 1GTVA 3DO6A 4C2UA 4I1VA 3SFZA 4AKHA 4C9BA 2JA5G 4A2QA 2A6EC 1KY3A 5DH9A 4HDCA 1SHKA 4GNXB 2HCJB 4BLPA 5FPTA 4NXMQ 3HYTA 3KL4A 4L15A 4M4SA 3X1WA 4BFYA 4HSEA 4LBWA 4QJ5A 1J8MF 4NONA 1RRFA 5IE8A 3WBKA 1R10A 2VHJA 4YQFA 2ZSBA 4W7SA 4H02A 1HNZL 4JCVE 5GADC 2F9LA 1G6HA 2JLSA 2RGAA 1TWAH 4RD4A 3SJAA 4B3SL 2XJ4A 1N6PA 1OIVA 2GCPA 4DNTB 2P6NA 4KYUA 4DUYL 4UJ5A 1N3BA 3BH0A 2WOOA 4C2MH 1E2LA 4LV5B 1UKZA 3RNUA 2BE5C 1SKQA 4LF7L 1VQPA 2Z43A 2V4DA 1RRPA 3VR6A 2VQEL 4LOAA 4JI3Q 4A92A 4ZDKA 5FPYA 1O87A 2CNWA 2QU8A 1Z63A 1MJEA 2W6JA 1AK2A 2B29A 3WMFA 4UNNA 1P9RA 4P3YA 3Q5DA 4YDSA 2DY1A 5CJPA 1IONA 1IYJB 4GBMA 3STBC 5IYDG 4A0GA 1X3FA 1EQRA 1UE5A 1X8LA 2VSFA 1LF0A 3RAPR 3LGJA 3U60B 2PX0A 4TZ0A 4ZKEA 5FBQB 1VG1A 3BAFA 1VQOA 1OJLA 4MYTA 2YOGA 1U94A 1WE2A 4IOLA 4YMVA 2AKYA 3U6BA 2BBSA 1K3RA 5GJWC 3PO2G 4A82A 4DV7Q 5BN5A 3KXLA 3G6EA 1BH2A 2GVZC 3FKSD 1GP2A 3FPAA 4LBYA 4E09A 2QT1A 1VQAA 4LX0A 1XEWX 4DLYA 5EUQB 2BIFA 2OV2A 4B6EA 2AK2A 2OFXA 4MDFA 4IOJA 1VQEA 1UE1A 3CC2A 1ZVQA 1G8FA 2BCJQ 4GFDA 3CF5A 1B7YB 3BFXA 4CGZA 4Q1BA 4BZXA 4JKIA 2J7PD 4FMCB 2Y0SG 2ALYB 5CK5A 2I5HA 2XX3A 2H18A 3PQCA 2CK3D 2A5YB 1YVCA 2QA4A 5AJVB 4DJTA 1SVSA 3KQHA 2Q2HA 1E2QA 2R6FA 3M6AA 2YKGA 2KBEA 5BR8L 2D74A 4KVAA 3PG5A 1WYDA 2FGJA 5AK0A 5KOYA 2FU5C 4KXFB 2IS4A 5AJ3L 2FV8A 3DOEA 4QGHA 4XWAA 3I56A 3VX4A 3EPHA 5TV2A 5J4YA 4U02A 2UXBL 2XB4A 3U4QA 5GAGC 2IYRA 2K4KA 2ZE5A 5IYCG 4RKFA 4URVR 1UFQA 4NYJQ 2F1JA 3NDBB 2HXYA 2GESA 4JIMA 1YZNA 2BBWA 3EZFA 5IYCH 1E2HA 4ASUD 4GKJL 2B8GA 1PV4A 4QJ4A 4V0KA 4PQRA 3A58B 4UXJA 3W9YA 4APVA 3SR0A 1RYHA 3U58A 3QXJA
chains in the Genus database with same CATH superfamily
1YK0A 3VX3A 1T36A 4C4YA 1P7PA 3DD5A 3ZDYB 2EJTA 4DMMA 3TLGB 4Y9RA 3S1MH 1OLUA 1VHWA 3M6MD 1OXXK 5GM2A 3MOIA 2ZJ0A 3VXKA 3ZWWA 4H3VA 1XZKA 3LJKA 4HXGA 4Y6GB 1VLHA 5I7SA 3D02A 2HH9A 4J1NA 3GDFA 4C1NA 4EDFA 2AFVA 3ENWA 3PDWA 3O38A 4BBZA 4P5PA 5A9RA 1OBOA 2DQZA 4MLZA 1Q95A 1OY1A 3OOCA 4YMGA 3EJIA 4KV7A 1C7YA 1ZUWA 4NXMB 4XASA 1ISJA 2XADA 1JZTA 3FLMA 1OFUX 1Y6QA 3W8FA 4EFLA 2QMHA 4KGZA 3WBJA 3VR4H 1XCMA 3H99A 4R8LA 1IN5A 3IAUA 4HQRA 4K7JA 5FYQA 3WMGA 4AZWA 2ID9A 3FPEA 3OKFA 4RQUA 5CURA 4BGVA 2ENWA 1BXTA 3NBUA 4TV8B 2B1RA 2YVUA 3LCCA 4LWOA 3CRKC 3WYAA 1RW4A 1OB2A 1KMMA 4BDTA 3S3TA 4PLCA 1V3QE 4HH1A 3PE3A 1FFXB 3SIRA 2NBFA 1QO7A 3TL3A 1KHTA 4UUMA 4KP7A 4Q9KA 5FBVB 3EE6A 3CG4A 1WTVA 1KJ8A 2CZQA 1K06A 221PA 2OHJA 4O2RA 4D9MA 3TQTA 1B9MA 1XLWA 1YJ8A 4RTOA 2D1YA 3N7TA 2J7KA 2HF7A 4DJJA 4GMDA 2K5DA 1X1SA 4HBZA 4YA6A 1PH9A 3JR3A 1NI5A 3VDRA 4R1NA 3MJVA 2AN5A 3WLSA 1N5LA 3K6OA 3LXXA 3LDUA 5CLIA 1Q14A 1W0KA 2YIVX 4V190 1U8ZA 3AM3A 1B15A 4GHWA 4P3PA 4RD2A 4YRNA 2QTNA 2JATA 3VO8A 1GGVA 3S8YA 2RH5A 4QYSA 1XG5A 3AFQA 2VNAA 2J08A 2WJJA 3RVBA 3CQZB 1MFPA 1ZUD1 4IHAA 4YCWA 3WSVA 2EBUA 2CHUA 2W2KB 5AVVA 5LP6F 5IK2D 5IIFA 1C3OB 1AMOA 2UXDB 2PJDA 4FINA 1YQDA 2QDBA 1J1IA 3H1GA 2AYZA 3K1ZA 1USKA 5ELEA 4KWIA 4U8GA 2JIRA 1WCV1 2KYRA 3HQ4O 4A3BB 1XTJA 3UB4A 1YQXA 4BLWA 4Z1OA 5L3SB 2QAIA 2NVOA 5JPMC 5KWEA 1AZTA 4ZQBA 3WGVA 3VYVA 5HNKA 3EIHA 4URZR 1SYFA 4AY2A 2E4YA 3JQ9C 3OLQA 1GGJA 3WHLA 4MULA 2CZCA 4UNQA 4DE5A 2BEVB 2FNAA 4QWWA 5HQ3B 1IPEA 4FZ3A 2NVYH 4F56A 4GGOA 3PNOA 1EOVA 4P83A 1YZHA 5KS2A 1XTVA 2BFCA 4MIYA 3QJYA 3USZA 3NTQA 4F5DA 2NUAA 2QUZA 4OO3A 4YXWA 2QP4A 4PZ7A 5IEJA 3D7LA 5IKXA 4WCDA 4EUEA 1RZVA 1T5IA 2Y4OA 1HDZA 2OFPA 4IIEA 3G0OA 5AKXA 4FLFA 3IUQA 3M7NA 1G3UA 2HCRA 4FD2A 5EJMA 3CQZH 1PMRA 5C4MA 4A9AA 1EE1A 4L4UA 5ALGA 1Y8OB 2Z56A 2AOWA 1SDFA 4HN9A 5FHQA 2JE6I 5C4ZA 1I1OA 4YYEA 2KOLA 1TT2A 2C2WA 3UBTA 2Q41A 2DG2A 3GFPA 3H2ZA 1Z0DA 3NT4A 4NV0A 1L5FA 3NC1C 3ZE1B 3A70A 3PENA 1XV5A 3REGA 5JVG3 1U81A 3F90A 3IDOA 2PLRA 2EJVA 2OO5A 1QAQA 4GN5A 3O94A 2VZ0A 4G56A 1ZESA 4I8DA 4J03A 4QTUB 2O8DB 4XWKA 3EA4A 3WLMA 1HNXB 4XIYA 4WOBA 3MTGA 3KOJA 1FTYA 1KEKA 2EF0A 1M1NB 3D6FA 1C0AA 3II6X 3JTMA 4UPEA 1RAIA 3Q24A 1WCXA 1TCVA 1AGNA 2B1GA 1Q2UA 1RCUA 2WYVA 3WJ2A 4JB0A 3PSIA 3IAM1 4G37A 1L4NA 2Y0PA 4WK2B 1XKXA 2QR3A 4Y98A 1TS5A 4F5EA 4ENSA 5I7UA 1W73A 3FTPA 1Z47A 5DT2A 5KVQA 3U7GA 1GCUA 1U8TA 4JLAA 4GU5A 5AW6A 1A5TA 1JDPA 2PR7A 3M4OH 3BH6A 5TPWB 3EDMA 1I2AA 4KAJA 4RGMA 4A5OA 4Q18A 5IJ9A 3QWNA 2BDTA 1HSZA 2YVKA 2YZNA 1DV2A 4V24A 3SHWA 2PD3A 4OQEA 3X1ZA 5CDHA 2OTCA 3K5LA 5JNSA 2ZRGA 4LAAA 1PFNA 2OPBA 4LW1A 2LTAA 2ZUBA 3BSFA 2V6BA 3U4VA 3HN2A 3I42A 5HIMA 1HDEA 3ZOZA 1U1EA 4M1QA 5F51A 2WTXA 2QL5A 3JD1A 3NONA 2FRVA 4N40A 5BWLA 3HOUG 1T3TA 3ETJA 2Q8IB 4NS1A 3T38A 4R0MA 3A14A 3WRVA 2HUPA 3VKHA 3RKRA 4LYFA 3THYA 3NFRA 1X3PA 4CKZA 2WF9A 4XQ9A 1EQAA 4LFAL 2G72A 1U0LA 2EZ4A 4UHCA 3AL0C 1PFKA 4D56A 3T1YQ 4AG6A 6GPBA 1EY4A 3G8AA 3A31A 4YP1A 1U4LA 2ZBPA 4ZYXA 4CKXA 3FZGA 1HDIA 2QDXA 1SSOA 2F4NA 2H51A 4W99A 2PGAA 3IBGA 3NRJA 5BUZA 5CYFA 4DDWA 3EMBA 4DBLC 2IYOA 2VQ3A 4P0TA 2AJTA 4IZ8A 1PI3A 3PZRA 5FBRB 4ALLA 3I45A 3OJOA 5IEBA 4CM9A 3NC4A 5CDTA 3CF2A 5IYZF 5C4IA 2IEYA 3MW8A 3AHHA 3FMPB 5B58T 1UKVY 1J8VA 4C5CA 1C2YA 1LX7A 3TF5A 5LA6F 3OW2A 2Z58A 3L8DA 1OZ0A 5CM2Z 4QPPA 3KC2A 5DXJA 2YWJA 3WVNA 3CKKA 3S2SA 2JP1A 4OLHA 2ODBA 4EQ6A 5LYJB 1PJSA 2I2WA 4XXHA 4AQYB 2X13A 2HADA 4I5IA 3RVKA 2ZB2A 1P7ZA 5KVVA 3L6BA 2ZJ3A 1VA4A 4M8KA 3E81A 2F8SA 3IQGX 2WYUA 2MFIA 1XDGA 3H84A 4KXXA 5BQPA 4RDXA 2BC9A 2VK8A 3HOUB 3U7IA 1H9BA 3PGKA 1G8HA 1T15A 2HR1A 3RUDA 2QIOA 1U7DA 1JWSD 1C30B 3FKIB 2BGRA 4K6MA 3E35A 3ZDEA 4MEBA 4BO8A 4FYPA 4Q7LA 1G6OA 3BU2A 4J0EA 1JQDA 1T6NA 3PPVA 4G9EA 3U7HB 1XD8A 4QPCA 1RYNA 4I1PA 1USIA 1TQHA 5F73A 3MINB 5D85A 3V4SA 2ERXA 2XYQA 2X3FA 1VKRA 3D6NB 2J6HA 4MWZA 2GDZA 3ZTTA 5HOEA 3FPPA 2FRDA 1L5MA 1DAFA 2OWEA 5CNKA 4Q4AB 3KJFA 5DHRA 3VNRA 3V4ZA 4UP9A 5DBIA 4C88A 4M8AA 1E0SA 2WHRA 4YT5A 1FDIA 5M3FG 2LKDA 4X62L 5ALQA 1XX8A 2PX4A 4PZLA 4XGKA 4OHVA 3RVQA 3E15A 1U0OC 3M1IA 4WLVA 2ZSJA 3ELWA 3IP6A 3E23A 3J80E 2W8ZA 4F9TA 1TU4A 1DBWA 3LHIA 1V43A 1RLUA 3NVAA 4Q01A 4NFHA 4QYXA 2SECE 3TTSA 2WIKA 3S2UA 1HG1A 2DXIA 4ZRZA 1X19A 3IP5A 1S0UA 5BWNA 2O4UX 3JQPA 1FTNA 4EG5A 1JECA 3E84A 4C4PA 4CF5A 1VQGA 2BDEA 2PSJA 5J3BA 3KNZA 4TMFA 3EWAA 4P71A 3CD6A 2HJ9A 1VL0A 4MQUA 1I3LA 4QFDA 4LTNA 3OZAA 4M0EA 2OXCA 4BNLA 1YTLA 4X7RA 3LCJA 3L84A 2WABA 3CCEA 1TRKA 4MOWA 3Q85A 3TRKA 1WCMG 1V1MB 4FM9A 3A8KE 3CVWA 4Y0NA 9MHTA 1KQFA 1E6EA 1TFRA 3W8NA 2AE1A 3KT8A 4D0GA 3I9OA 3A4MA 1KK1A 3TKAA 4Q93A 2CNOA 2AA3A 3JV7A 4MPPA 2A2ZA 3JAML 1KZ4A 3MVVA 2PFGA 4JLPA 4MUEA 4MXDA 1T9KA 1OHHA 4PSKA 5CA1F 3DM5A 3DWQA 3NBFA 3P7JA 1DP4A 3KEQA 4KK3A 1SCUB 4L75A 2OBXA 3VSCA 5A5VA 3I6IA 1NT4A 1U6IA 3FMIA 4RY0A 3UCFA 1RKQA 2WSSD 4REQA 1JU3A 1OJ7A 4CBVA 5LL6S 4C6HA 1IW7D 3VZSA 1ZIYA 3RTDA 5J2UA 1ESZA 1WP4A 5JS7A 5EFOA 5LPNA 1EIGA 4E70A 4L4SA 1OLUB 4A91A 3ZXXA 1HC7A 1QGED 1EKXA 1QUFA 3A26A 3IP9A 4MO2A 5DHTA 1KJ9A 4R0VA 5FH9A 5I7HA 2P5YA 3NBKA 4KHVA 1T5OA 2DZDA 3HB4X 1D2GA 2E21A 5GONF 3LXRA 3M1AA 5HK9A 3WGOA 1NC3A 4DV0L 1L4MA 4N9WA 3ZD9A 3RU7A 1OX4B 2PIAA 5LQUA 1KAEA 3DFFA 4MCAA 4ZYZA 5H3HA 1UNSA 4IOAA 1BOFA 2CWDA 3L6OO 4QTXA 3NR2A 4RF5A 5COQA 1E5QA 1PD1A 4JC5A 4UOQA 3TECE 1N6LA 2VOEA 2Q6IA 5TPWA 3RAGA 1RMTA 3WLLA 4IJ5A 5EZYF 1GNVA 3AKDA 3QNMA 2H7VA 1CUIA 2OBNA 5LYYA 3FGZA 2IH5A 4N0EA 1N6IA 1T1IA 4TV8A 3KJGA 4QF4A 1W9HA 1II8B 3I3OA 121PA 2WD9A 3IUSA 1MC1A 2DM6A 2IV7A 4JYAQ 4LF4L 1E89A 1J8DA 4LRTB 4ZOLA 5DNWA 1JB1A 4RZSA 3W9SA 3TI9A 3V42A 1BW9B 2OK7A 2FWIA 2IYAA 1HNWB 1BGXT 1KD1C 1AV7A 1VIAA 1I7QB 1NY6A 2KQ3A 2JJ2D 4RU1A 3GELA 1QSGA 1ZM4A 4LNQA 4QVKA 3I09A 1SKAA 5DXFA 3A32A 3GVIA 4QTTB 5DZSA 1A4UA 4CR7A 3B6JA 2PZEA 3I6QA 1A5AB 1UEAB 1PH2A 4M1UB 1WMSA 1Z4NA 3Q40A 2Q46A 1Z7BA 4F45A 1PXUA 1EFID 3VO2A 4BVHA 2B2CA 5ELLA 1GPNA 1FYWA 2XDQB 1FBTA 3GGOA 1FTGA 2WICA 4TS4A 4BCBA 1UJ4A 3FM9A 3Q8XB 1DBVO 3R3ZA 5DNDA 1MA0A 2BFCB 4XQQA 4XDXA 3KZ1E 2XBLA 1I3OA 1NUQA 4DR5Q 1J5EQ 4GEGA 1STAA 4M60A 4D96A 5E7IA 2HF9A 3PUJA 5E6UA 3ZV5A 2TMPA 3FVQA 1DB3A 2Y76A 4Y2JA 5JRZA 5JCJA 1H9JA 4FC6A 3FKSA 3KXKA 4JT8A 4Q03A 5CBEE 3DR5A 4PLYA 1GNTA 4Z54A 1X8KA 5AKZA 3WSWA 3O1LA 3KJQA 4ZCRA 3HR8A 2FN3A 2D1FA 3NUGA 3NYQA 4GE3A 4NS4A 3LYHA 3QVJA 1XFAA 1QZHA 4HLCA 2J7PA 3GP5A 1PR2A 2P1ZA 2JFVA 2P2SA 3CF4G 4OFWA 3FFWA 3KT0A 3VZDA 2QXTA 4WZBA 3TZUA 4Y2HA 2H8GA 2QENA 2WJGA 1HFJA 4CUKA 5DGTA 5REQA 3Q7RA 1YXMA 5C0OE 5TRTA 5E2IA 4RHTA 3WL4A 3HBLA 2AZMA 3J7TA 4BAZA 5JG7A 2BEVA 4AN1A 4C3ZA 2V7QA 4GI1A 3CN7A 3FX2A 5C7YA 3K9WA 1MJFA 4ONEA 3E61A 1HE1C 3DHWC 4URUR 5TR9A 4UPAA 2GPSA 1OYYA 4Q5IA 2XGJA 2W2OA 5DPMA 3VM6A 5BUQA 3CCMA 1EUCA 2JHAA 2FUG1 1DKMA 1F9QA 2BELA 3RT9A 1XA3A 3HDTA 4JJEA 4MWDA 4BO0A 4XM0A 4EYOA 1N32Q 3S1SA 2UYQA 4LF6L 3AKEA 3KWLA 5DRYA 5F2KA 1E1TA 3W5JA 3G7LA 1IY1A 1FRVA 2VP9A 1YQ9A 4WCFA 1BXKA 4C05A 3JY6A 4G6ZA 3N9IA 2QX6A 4NBKA 1TAHA 5CMLA 4AJKA 2WKDA 1H3FA 2O7NA 1M34A 2BZSA 1NJSA 3DVRX 4F86A 5AD1A 5C1PA 2OILA 5C46F 4GL4A 2EFDB 2OAGA 5D3KA 5JEAG 1JN0A 4BS9A 4MR9B 4LUOA 1CQWA 4DV0Q 1H1DA 4L8WB 4DIMA 2J1LA 3E3AA 1YRAA 4U7TB 1SXJC 2PBLA 2QLFA 2ZIXB 4HD8A 4HWKA 1OXUA 3GTMB 2JFYA 5GGYA 3RHTA 3GLFA 2NO9A 2WJIA 2VLBA 1HR0B 2ZB3A 3SJUA 3P9KA 3GTKH 4FXPA 1H2WA 1W75A 5K5EA 2JFUA 4GX1A 4BDSA 4DQ0A 3EXEB 5LD2C 2AKAB 2ODWA 1U4NA 3KTAB 4R54A 2D7JA 4F4DA 1D5ZC 3RCBA 3WOVA 1X38A 2FHTA 4DR6L 2MO1A 2KCNA 4QRDA 3S7TA 4DLBA 3F71A 1K7FB 2UZ4A 4QPJC 4O2AB 1XZIA 4CG0A 2FY8A 1RAFA 4CGYA 4DKAC 4C0JA 3M89A 2H2FA 1E2VA 2VK2A 1CKEA 3EOAI 3G2LA 4GMFA 4HZUB 4LNUB 2DUMA 3CVUA 3AIIA 4A3BG 1C7ZA 1U5BB 1X70A 2X7JA 3A05A 3E1GA 3OBBA 4Y6QA 1Z0FA 4CM8B 1AF7A 4LFCQ 3KPVA 3G2NA 4FFNA 5CH5A 1D04A 3ZE0B 2GYUA 3PICA 4GC5A 4HAIA 4J2OA 2HRRA 2WA2A 1L7NA 3AH8A 1A9PA 1OFIA 1G20B 1UC9A 5B6IA 3U9LA 4BB9A 2V1UA 4IUNA 1SD5A 5THKA 3A11A 1OFGA 3I8XA 1XUOA 1OGIA 2GFHA 4JQYA 4K2HA 4BX2A 5AVZA 2ZE6A 3O31A 5BNWA 2JGJA 3O4RA 3KF8A 4O1IA 2CGEA 2CXQA 3LTEA 1UE6A 1MC5A 1XMXA 4HAUA 4YO7A 1RABA 5GGXA 1RLMA 5C1DA 2OF1A 4N3BA 3NORA 2XRFA 4JU8A 1X7ZA 3MRVA 4QZVA 1LU9A 1C8LA 1Z6PA 5ITWA 2FWNA 1RXVA 1E3SA 4RHSA 3FSGD 1PZEA 1EYZA 4HMPA 4RSRA 5KYTA 2ID4A 2VPYA 2POQX 4C06A 1PJ8A 2SNMA 3L02A 1V7CA 5E2BA 4LXGA 1GEGA 4RNDB 3SVMA 2HU8A 2JZNA 1MAWA 1V95A 1P0PA 2O6HA 4H7FA 1P0IA 4MRMB 5FWDA 3WYEA 2I2DA 3BQNB 1N2SA 1GD7A 1XAHA 4H6WA 5EKTA 2HHJA 4YDHB 5IUKC 2ZZMA 2WHPB 4HNUA 4DANA 2OZLA 3C1TA 3T3OA 1UT6A 1XP8A 3IJPA 2JXMB 5ALVA 4URXR 3C70A 3EVFA 4PHFA 5B1EA 5AJXA 3MTSA 2R3ZA 5JW6A 3EXFA 4QUEA 1XNRQ 1KAAA 1KVRA 5HGQA 1E0KA 5FX2A 4JBGA 5JSFA 1FXWA 5T1GA 2ZQYA 4RPGA 3V9AA 3WFIA 3CLVA 5AWFC 2Q8QA 3UYKA 3ZPXA 5HIAA 1U9JA 4CM7A 2DTEA 4E5MA 4AFNA 1XGKA 5LD2B 4I0WB 4H6XA 3QY9A 4DMKA 1WEKA 2IZZA 2WVGA 4EGVA 4J6EA 2P4QA 2RGXA 2WWXA 3C6KA 4FS3A 2OM2A 2QQ5A 3MYRA 2QILA 2Q29A 3AB3A 4LFBL 4WOJA 4BNKA 2O5CA 1E9RA 1EWKA 4LF4Q 2MNAA 1FDRA 4QEZA 4RJ2A 2OMEA 3HL4A 1MXFA 4Y1EA 1RAAA 3VHLB 3VHRA 2AE2A 3LF1A 2O0LA 1ZG3A 3EW7A 4RK6A 5C4XG 1KFKB 3IQEA 4P72A 2IU3A 2KENA 1FIUA 4RFVA 3W6UA 2Q1WA 4DW8A 1LW7A 2X3YA 3GV0A 4L22A 2XH8A 1GZ7A 3PO2B 1QF9A 1XTZA 2CEKA 4HH4A 1R16A 4XDHA 3RFXA 3ROMA 4KSYA 3KF6A 2IF2A 3ZI7A 1UFRA 4NL4H 4L5AA 2ZRPA 4QLBA 2P65A 2Z8LA 1OREA 4BECA 2YOFA 3A3PA 4L8JA 4L9WA 2NOAA 3IP8A 4LZPA 3GN2A 4DAMA 1Y1QA 1B3RA 2AF4C 3HFGA 4G8BA 3UZUA 1WD1A 1IYZA 1YB2A 3MEQA 4M0DA 3ZXYA 4BLTA 1KOGA 1O96A 5EJFA 1R9MA 4CMCA 4HQNA 1N2XA 3NWPA 3OC6A 5DISB 3QX3A 3W6OA 3B36A 1WQ3A 1Z2CA 1Z6XA 1K5HA 1P5RA 3GJXC 2GPJA 1YONA 1H66A 2G82A 3UJ6A 4CLOB 1ZC4A 1IBKQ 2BBOA 1ZO8A 1MOZA 1ZOOA 5AICA 3UAOA 1PRTD 4BMDA 5HQJA 1WG8A 3IYLW 5FNZA 3U4CA 2F3SA 1G9TA 1M2WA 3WRYC 4EUHA 1AJEA 1KYZA 3OSUA 2OYCA 2WT8A 1MIUA 4TT8A 1CEEA 1Q46A 3PVZA 1P9WA 2OZEA 2PLAA 1PZMA 3HUUA 5DP2A 2WUVA 1KS2A 1ZMRA 4RFLA 3VSBA 1CR6A 3ACCA 4YHHQ 3R7SA 1EDBA 1N2CE 1R5JA 4RK0A 2QZSA 5EKSA 4ARUA 4L8LA 4MV9A 4Y7DA 1HT2E 2B1JA 4HNSA 1QVCA 4Q16A 3NTHA 3DF7A 2GHIA 1W88A 4EG4A 2AG8A 1NUUA 4Z9AA 1D2AA 5ADHA 1GILA 3FHLA 2L11A