3I4NH

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
137
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLETRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 21
structure length 137
sequence length 146
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nH00
4HJAA 1UWVA 3CCSA 1WCMG 1EFWA 3S1MH 1CSQA 1N32L 4A3MH 2B63H 3PO3G 4DR7Q 3JAMc 2K4KA 1XMOQ 4OO1I 1VQHA 4A3JH 4DV5Q 1XMQQ 1XPUA 1BBWA 1Y14B 3CCMA 4K0KQ 4GN3B 4DR3Q 4YY3Q 1X3EA 5IE8A 1J5EL 3EBEA 1KHIA 3PUVA 4DK6C 1I6HH 1PH8A 2EIFA 5M3MH 2A8VA 1LYLA 4JI1L 3KLWA 1HNZL 1N34L 1OTCA 1TWCH 4GLAC 2F3IA 4AYBE 2WP8J 1N32Q 4NB3A 2B29A 5IYBG 2YTVA 4JCVE 2E2HH 1YITA 3HOWH 2RF4A 2QGQA 1IYJB 1U0LA 1J5EQ 4A76A 3K80C 5EAYA 3I55A 5C3EG 3G48A 5ELOA 1K3RA 1VQAA 4GN4B 1W2BA 2PMZE 2HT1A 2CWPA 3A5UA 1IBKL 4EX5A 1HNZQ 1YI2A 1N34Q 2KHIA 4IPGA 3G6EA 3S1RH 2UU9L 3I4OA 2PI2A 3J7A5 3GTKH 4A3GG 4JV5Q 2VNUD 3AEVA 3BU2A 1K8AC 2AMCB 1D8LA 1G291 4LF4L 2UXCL 5FJ8G 2JQOA 4JI5L 3L2PA 3M4OH 5JEAJ 3J81i 5C0XJ 4YWMA 3RZOH 1K0RA 4X65L 4IJHA 1GVPA 4B3RL 3E9HA 1OXTA 3HOXG 1SR3A 5M5WH 1IBKQ 4BXXH 1N9WA 4JBKA 2OWOA 4DV0Q 4A3KG 3H0GH 2UU9Q 2RCNA 1HZCA 4A3EH 1OXVA 3CW2C 4JI6L 4IPHA 1L2FA 4LF8L 2H5XA 3DM3A 1X3GA 3S1NH 3NEMA 3GTQH 3FKIG 4R4CA 3A0JA 2UXCQ 4JI5Q 1R9TH 2D62A 3G4SA 1B8AA 2LXKA 4LF5L 4WJ4A 1MJEA 2LSSA 1YEZA 4KHPL 1HR0L 5FLMH 2IX1A 4X65Q 4B3RQ 1IZ6A 5J3BA 3STBD 1JB7A 2WAQG 3PUXA 5IWAL 3J80i 3DLLA 1NE3A 1TXYA 5LMNL 4JI3L 1FJGQ 4LF9Q 2Y0SG 3CMEA 1U5KA 4JI2L 3OTOQ 1I3QH 1SROA 3HOUG 1E7ZA 4DV6L 1UE5A 4JI0Q 1VQ8A 4LF5Q 1P8LA 3GTPH 3HOZH 3CCQA 1YJWA 1HR0Q 4IFDJ 1NMGA 4DV2Q 1X54A 4LUOA 1XPRA 2MFIA 5BR8L 3PO2G 4R4TA 4MNOA 2Q2TA 3J7ZC 1X6OA 2RHSB 5IWAQ 4RMFA 4JI3Q 4R4OA 4DPGA 4O2DA 2PQAB 5M3FG 1AE2A 1L1OA 4JI4Q 4LFAL 4KLKA 1YHAA 2Q2UA 3GO5A 3KDFB 3L0OA 3GTGH 5GQOA 5C44G 1KAWA 1CKOA 1Q82C 1UE6A 1YJNA 2IHEA 1P16A 1YBYA 4APVA 1SMXA 3HOYG 4XIGS 2LXJA 4R4QA 1HZAA 1SE8A 4PZ6A 1A62A 4BY1G 2VY3A 2JA6H 2EQSA 4A3FG 2KENA 4LFAQ 1I94L 3IRBA 5C4XH 2IY5B 1EWIA 1VQIA 3HKZE 3KOJA 4HJ7A 2NN6I 2JE6I 4P73A 1M1KC 2N3SA 3F2DA 3CCRA 3UDGA 3T1HL 2VUMH 4IO9A 4H02A 4LW1A 1IBLL 4HIDA 2R93G 1A63A 3LGJA 4JBJA 4BA1I 2NVXH 2JA8G 4L5QA 2ES2A 2DGYA 1WOCA 1EIFA 3G71A 1VQ9A 2K50A 1RL2A 4B3SL 3TEHB 2UUAL 1I94Q 4NXNQ 1MJCA 3HOVH 5AJ3L 3JAMi 1VQJA 3M9BA 1HNXL 1XJVA 4AH6A 2R7ZH 2PI2E 2VL6A 4LWCA 4YCUA 4LFCL 1VQGA 2YV5A 5IYDG 1PH5A 3T1HQ 2XGTA 2ALYB 2UUBQ 3S1QH 1IBLQ 1HNWQ 1X56A 4LUVA 1EYGA 5GADC 4XTCS 2UUCL 4X6AH 4PG3A 3U50C 3GD7A 2KBNA 1Q86C 3E9IA 2RHQB 2UUAQ 1GKHA 4HJ5A 5E7NA 1CUKA 3CCUA 2IX0A 1V1QA 1JJCB 3I2ZA 4X64L 1JE5A 5IP7G 3RN5A 3RN2A 1N8RC 4A3BG 1Q46A 3F2CA 4GKJL 4PMWA 1VQKA 1L1OC 1VQFA 1VQDA 5GAGC 1PV4A 1PH1A 1VQCA 2UXBL 4DUZL 3M4PA 1KQSA 4A3LG 1PHJA 2UUCQ 2OQKA 5JEAG 5C0XG 4A93H 1VQBA 3AFQA 2MO0A 1KRSA 1Q81C 1VQ7A 3I4NG 4A3DH 3CAMA 3F2BA 3STBC 1LTLA 1QVGA 4BBSH 3RLOA 5IP9H 3CPWA 4EQ5A 2NZHA 2YTYA 1HH2P 4GKJQ 3GTOH 3A74A 4UP7A 3UE1A 4JI1Q 2R6GA 1EQQA 4L5SA 2JA5H 2UXBQ 4DUZQ 1GO3E 3ZJYC 4QIWE 3K7UC 2QEXA 4R1JA 1KRTA 1WCMH 2BA1A 1IL2A 2ID0A 3PO3H 3RR5A 1NTGA 1Z47A 3K7AH 1PH6A 1VQEA 1UE7A 1Y1VG 4POFA 5JJLA 3OYYA 2N8NA 3ULLA 4QQBX 3A5ZB 4LNQA 3K8AA 2JA7G 4BA2I 4A3CG 3PCOB 3Q8DA 3I4MG 2ZTCA 2EXDA 1LM0A 4AQYL 2E5LL 4KI0A 3EN2A 1AE3A 4KHZA 2JA9A 3VDYA 2Q2HA 3CMAA 1M90C 1JJ2A 3D0FA 4NXML 1CKNA 2B3GA 2K75A 3F8TA 4LF4Q 3KJOA 4IFDG 5IYBH 4PZ7A 1HJPA 1J6QA 2NVYH 3M85A 1IBML 4JYAL 2NVQH 1OXSC 4C3JH 2D0PA 4NPSA 5M5XH 4LF6L 2F4VL 4FDBA 3S24A 1XNQL 5C3EH 2ZTDA 2E5LQ 1XTDA 1YHBA 1TWFH 3TRZA 4JI6Q 1A0IA 3CPFA 1FL0A 4LF8Q 4NXMQ 1KL9A 4A75A 3S15H 3CXCA 1VQ5A 1CKNB 1XNRL 1G6PA 4A3IG 3MXNB 3UE0A 1E1OA 2HQLA 4P75A 3UDXA 4AIMA 4A3GH 2VQEL 2I0QA 1VS0A 1IBMQ 4JOIA 5FJ8H 4JC0A 5IY0A 4QGUA 1SN8A 1SLJA 4KHPQ 5JJIA 1I5FA 4LF6Q 4BY7G 2Z6KC 3K0XA 4POGA 3TS0A 1XNQQ 4DR6L 5LMNQ 2C35B 1B7YB 3ULJA 1T9HA 5HGQA 3HOXH 3GTLH 2WAQE 5HY6A 2VS1A 2Q2IA 2Y0SE 4JI2Q 1XNRQ 4A3KH 1QVCA 4DV6Q 2VQEQ 3I56A 1IXRA 1PFSA 3FKIH 1Y1WG 3CCJA 1KD1C 1PA6A 1VQ6A 3RLNA 3CP0A 3ER0A 3S17H 4IOAA 5BR8Q 1CKMA 1KC8C 1N33L 4DR6Q 4GOPC 4DAYB 3KF6A 3UDFA 2ZJPA 1NY4A 2CCZA 2R92G 1WI5A 3S2HH 4DNIA 1LUZA 1L1OB 1WJJA 2BH8A 3BZCA 3TREA 2K5HA 1YIJA 4JI7L 5DLQE 4LF7L 4IPDA 2AKWB 4RG1A 3CF5A 4JBMA 1C0AA 4OO1G 1X9NA 4ME3A 1K73C 3HOUH 2PNHA 1V43A 4B3ML 2IHFA 4DV4L 4DUYL 4OONA 4BBRG 2KCTA 2VQFL 2YYZA 3L7ZC 3HKSA 1N33Q 4P71A 1AH9A 1PH9A 2K14A 3PO2H 4A3MG 2B63G 1TWHH 2WB1G 4A3JG 4OWWB 2E2IH 3TQYA 1SRUA 3BJUA 4LF7Q 1EQRA 5M3FH 1WYDA 4QY7A 4UP9A 1QVFA 4GKKL 3PSIA 4B3MQ 3H3VH 1E24A 5M3MG 2I5HA 5C44H 1K9MC 1PYSB 2K5VA 3ULPA 1PH7A 1YHQA 1HR0W 1O7IA 4GNXA 1YNXA 5IT9c 2ZTEA 3I7FA 3HOYH 4L5RC 1EUJA 4JOIC 4B3SQ 1UEBA 4IPCA 3HOWG 3W1BA 4BY1H 1FGUA 4UP8A 5AJ3Q 3H3VI 4A3FH 2OCEA 1HNXQ 3CQZH 1XMQL 4C3IH 3PF4A 2BA0A 4B3TL 4YY3L 5M5YH 4HIMA 4DR2L 2VZAA 4ALPA 4LFCQ 3H15A 2AWNA 2ATWA 3KYHC 2GVAA 1PH2A 4JG2A 2OTLA 4YWLA 3U4VA 3KJPA 3AQQA 1JJGA 4AYBG 1A8VA 1Q12A 2R93H 1N36L 2JA8H 2Z6KA 5GAEC 3NELA 1EIYB 3PIOA 4Y52H 1BBUA 3AYHB 3PV0A 4X64Q 3CC7A 3CD6A 3GDEA 4B3TQ 4GLXA 4DR2Q 1OXUA 3J81j 2K5NA 3SGIA 2ZM6L 4BXXG 5IYDH 3W5OA 4IJLA 3T1YL 1S3OA 4A4IA 3M3YH 3H0GG 5C4JH 4A3EG 1X55A 3TS2A 1C9OA 1N36Q 3ERSX 2D0OA 4DR1L 1Q1EA 1YJ9A 1TWAH 4X66L 1YVCA 2GVBA 4DV1L 4HJ9A 4GOPA 3RZDH 3AFPA 1GM5A 1Q1BA 4JV5L 1XPOA 3S2DH 1S40A 3U4ZA 5FLMG 3BZKA 3KFUA 2HHHL 2NVTH 5IP7H 2E2JH 1Z9FA 2ZM6Q 4A3BH 2CQOA 5K36G 2QA4A 2YTXA 3T1YQ 3NENA 1QZHA 3EIVA 2K52A 3FP9A 4QL5A 3PUYA 2MNAA 1BKBA 5IYCG 2JEBI 4DV0L 1QZGA 4A3LH 1S72A 4GLVB 5GAHC 4DR1Q 3FHWA 2CFMA 3WWVA 4X62L 4X66Q 4DV1Q 4GNXC 4GOPB 5GROA 5LMUL 4L5TA 3OW2A 2KCMA 1KIXA 2OQ0A 3I4NH 3HOZG 2Z0SA 1Q8KA 3K81C 2I5MX 2DUDA 1SFOH 2HHHQ 4DR4L 3U58A 4AQYQ 2ZJQA 2N78A 2VW9A 2JEAI 2F52A 2A1AA 1ASYA 5C0XI 1FJGL 4OWXB 4YCWA 4UY8C 4LF9L 2E8GA 1VQNA 4HIKA 3CCLA 2BH2A 3E0EA 1JMCA 4YCVA 1G51A 4X62Q 3J81c 2CKZB 3OTOL 2IT1A 1RIPA 1YZ6A 1DGSA 3PGZA 5ELNA 5LMUQ 1ASZA 3M7NA 3S14H 4JYAQ 1VQPA 1Y1VH 4JI0L 1K83H 5H1SE 2F4VQ 2NN6G 1E22A 4DR4Q 1V9PA 3KF8B 3M4QA 4A3CH 1UE1A 2JA7H 3I4MH 4DV2L 2N49A 1K8GA 2JA6G 2UXDL 2GN5A 1VCIA 2A19A 2FXQA 1X3FA 2PQAA 4DAMA 1VQ4A 5C4XG 4DK3C 3S16H 4JI4L 3D31A 3NBHB 5IYCH 4OXPA 3KDFA 4DV7Q 4P72A 4QJFA 4OWTB 2HIVA 3RNUA 4OX9L 2VUMG 4YWKA 1NMFA 2V1CC 4DR5L 1MKHA 2JK8A 1FVIA 2ZJRA 3J80c 3PUZA 3UDIA 4DV3L 5JJKA 4IOCA 1TWGH 4MTNA 1PH3A 1PYBA 4HJ8A 2UXDQ 4GN5A 3GTJH 3CCVA 3CC2A 4IFDI 1E1TA 3HOVG 4UPAA 2R7ZG 3HKZG 4YHHL 4P74A 3RLFA 1H95A 4A3IH 2YU9H 2HIXA 3HFZB 4OX9Q 1HZ9A 3F1ZA 4DR5Q 4O0AA 2ASBA 1VQMA 3PUWA 1B70B 4DV3Q 4DV7L 1W3SA 4GS3A 4BY7H 3KF6B 2JJQA 3MEFA 4JI8L 3B6YA 4LFBL 5FLXc 1L0WA 4JBWA 2L15A 4JI7Q 1VQOA 1GD7A 1PVOA 2MO1A 1QUQA 1PH4A 4NXNL 4YHHQ 3CC4A 2MQHA 4TQUS 1BVSA 4Y7NH 4DV4Q 3W1GA 2XTIA 1CSPA 4DUYQ 4WJ3M 4TVAB 2AHOB 4J15A 2VQFQ 3PIPA 2WFWA 2UUBL 1Y1WH 4C3HH 4LUZA 4R4IA 3GTMH 2OTJA 1HNWL 3JC66 1E3PA 5LMNW 3PF5A 1JT8A 4JI8Q 4A93G 4LFBQ 1MIUA 1X65A 1OXXK 2NZOA 2KHJA 2WB1E 1WFQA 4DKAC 4DR7L 4A3DG 1XMOL 2R92H 1HZBA 4DV5L 1NJIC 4K0KL 4BBSG 1QUQB 5IP9G 4DR3L 1VQLA 4HIOA 4GKKQ 4C2MH 1NBWA 1EOVA 4PZ8A 4MZ9A 1D7QA 1KXLA 1Q7YC 2I5LX 2JA5G 1I50H 2AWOA 3ICEA 2R7FA 3CCEA 4GNXB 4BBRH 1C7YA 2R7DA 2CWAA
chains in the Genus database with same CATH superfamily
3T53B 3CCSA 4A3MH 3GTGB 4DR7Q 5EPJA 2K4KA 4DV5Q 1EWCA 1Y14B 2A6HC 3M7GA 3BDOA 1KHIA 3PUVA 4DK6C 4Z9CB 4HSPA 1PH8A 1B4OA 3OMGA 4H44C 1AEXA 1LABA 2QILA 1QNKA 2JA6B 1T5EA 4J1MA 5TSSA 1HNZL 1N34L 1H9MA 2F3IA 4AYBE 5K5PA 3MAQA 4NB3A 1N32Q 2YTVA 4IUVA 2RF4A 1O7LA 1IYJB 1LV9A 2B39A 1J5EQ 3K80C 2F0SA 2A6EC 1Y8OB 5ELOA 1VQAA 2R92B 1IBKL 1B9NA 1NSNS 2MJ8A 2KHIA 2UU9L 2JSOA 2E76C 3SHLA 4JV5Q 1IKLA 1D8LA 2AMCB 2UXCL 2F0GA 2JQOA 4JI5L 2CW0D 3M4OH 5F2DA 4HMJA 5FKAC 3K59A 4RHRA 1STNA 1OXTA 2E75C 4G7ZC 1GJXA 5M5WH 4BXXH 1ENCA 2BE5D 1SEBD 5LL6X 4A3KG 2O2LD 4RKBA 4A3EH 3CW2C 4IPHA 1EQVA 3S1NH 3GTQH 2LKVA 2D62A 1G6ZA 5E1FA 2NTSA 1YEZA 5FLMH 5J3BA 1IYUA 3TSSA 3PUXA 5LMNL 1NUCA 4LF9Q 1I4HA 4OIKA 1RJTA 3CMEA 4ME5A 3TMEA 4JI2L 3OTOQ 2PZWA 1E7ZA 3GTOB 3GTPH 3HOZH 1NMGA 1ENAA 3PO2G 4QUCA 3D6CA 2Q2TA 2F0HA 3J7ZC 3CKIB 3K5OA 1CTMA 4KJOA 4DPGA 1STGA 2PQAB 4O2DA 1A6XA 1G2TA 2EY5A 2Z8LA 3NTIA 2PQEA 3KDFB 3L0OA 3GTGH 2PMZB 1BCPD 1KAWA 1TS3A 3E6ZX 1YBYA 3HOYG 4RGNA 2LS01 5HURA 5IODA 2PYKA 2CHBD 4QB4A 1EY8A 1YNNC 4BY1G 1B2TA 3FMCA 2JA6H 2EQSA 3NSWA 4S3SA 1I94L 3IRBA 1WTWA 1JOKA 1A2TA 1SYCA 3MXGA 4QF4A 1I4GA 5CBAE 4KD3A 1M1KC 1IBLL 4KY6A 3R93A 1A63A 4UDUC 4JBJA 4L5QA 2FFKB 2DGYA 1KAAA 3TEHB 4H0LC 5BN4A 5AJ3L 1HNXL 3NWSA 1MHWC 1O7ZA 1ILPA 2YV5A 3T1HQ 3A8JE 1JB3A 1LTRD 2IPKD 4A3KB 2X69A 2WIIB 4PG3A 1BO0A 3CHBD 2RHQB 1HTLD 1GKHA 3CCUA 2PZTA 4CDFC 4X64L 1JE5A 5COYA 5IP7G 4NW2A 1FNVA 3RN5A 1Q46A 1L1OC 1VQDA 1VQCA 4PQXA 1VF7A 3M4PA 1SXTA 4ZYSA 1PTOF 2K28A 1PHJA 5JEAG 4K6LA 1BNZA 1VQBA 1DZ1A 2MO0A 3KUPA 4EQ5A 1IL8A 3GTOH 3A74A 4UP7A 1L0XB 4L5SA 2UXBQ 4DUZQ 1KRTA 3UI2A 3J81E 1TS2A 3H91A 1NTGA 1Y1VG 4POFA 3OYYA 3ULLA 4K2KA 4LNQA 2QDBA 3IL8A 4A3CG 3PCOB 5BN5A 1KNAA 1QILA 2EXDA 3HOYB 1ET9A 1RD9D 3KBGA 3CMAA 1TT2A 1SYBA 1SE2A 2WINB 4IFDG 4PZ7A 1HJPA 2X6LA 2D0PA 4L8JA 5IGFA 4X3UA 1WTHA 4FDBA 3A7LA 3QG1A 1S4ZA 1BR9A 4EQNA 1PRTC 4NXMQ 4EQPA 5CV9A 1CKNB 1G6PA 4A3IG 2F0VA 2G9DA 2I0QA 4JOIA 5IY0A 3M3YB 5A35A 5JJIA 1I5FA 1NAPA 5LMNQ 3ULJA 1T9HA 5HGQA 5HY6A 5CGKA 2Y0SE 4JI2Q 1XNRQ 4A3KH 3F2UA 2MGSA 2M00A 5ELCA 3MEHA 4IURA 2K1BA 3RLNA 1CKMA 4DAYB 3UDFA 1XWEA 2KCNA 3MZ5A 1WI5A 3QB3A 5IOCA 3J7AV 2H4OA 4JBMA 1HXYD 2N88A 1V1PB 4DUYL 2VQFL 3L7ZC 1N33Q 1EY6A 2A74C 2K14A 3PO2H 1SYGA 3V05A 2B63G 3D4DA 4JK1C 3S14B 4R8NA 2QKIC 3TQYA 4LF7Q 1QJOA 1WTVA 4B08A 2L1BA 1C8CA 4GKKL 4XYOA 4KV6A 4B3MQ 3H3VH 1K9MC 4CDEC 2K5VA 2FINB 1HR0W 1CHPD 1A3UA 1SJHD 1AFPA 1QE6A 2JXMB 3HOYH 3HOWG 4BY1H 5AJ3Q 1HNXQ 5ELBA 1XMQL 1GUTA 4HCEA 5M5YH 2M2LA 3S2HB 2DJFC 1HQMC 3GTJB 1LO5D 3R3OA 3U4VA 1Q12A 2SDFA 2Z6KA 3BDCA 3NELA 1EIYB 1PTOB 4X64Q 3CD6A 5LHY1 3GDEA 3OOCA 4IUUA 3URYA 4DR2Q 4RCOA 5FLXL 4FXGC 3GQBA 1KDAA 4IJLA 4A4IA 2XRQD 3M3YH 4CJ0B 5C3XA 1N36Q 2F0PA 2D0OA 3MFYA 1YJ9A 1A15A 3ZYYX 4DV1L 5CV4A 3AFPA 1DOLA 2KHSA 5IP7H 1A3TA 4FXDA 2QA4A 1EY7A 3PUYA 1BKBA 1QZGA 5JEAH 4DR1Q 5CR3A 4GNXC 3OW2A 1I50B 2KCMA 4ILWA 1I4QA 2EXZA 3TP5A 2R93B 2G9HD 2ICIA 3VR3A 1JE4A 2A1AA 4F8MA 3SE0A 1RF2D 2EE1A 1FJGL 1STEA 4UY8C 1VQNA 2BH2A 1ZXTA 3E0EA 1PLFA 1HFGA 2IT1A 3S14H 3ITPA 1ASZA 1Y1VH 3DHQA 1QB5D 3D3RA 5G3LF 3KF8B 3I72A 3OSOA 4A3CH 2LY7A 1EY5A 2E2HB 3HOWB 1VCIA 2FXQA 2AQ2B 4CGYB 1V8QA 4JI4L 1FYCA 3DEPA 4A3BB 4OXPA 4IFDH 5KYLA 2V1CC 4HAEA 1F9RA 2XRSD 4ODGA 4IOCA 1FNUA 4PNYA 4HJ8A 2UXDQ 4Q0FA 1S5DD 3GTJH 3CCVA 3HOVG 3HKZG 1HCZA 4P74A 2ZXRA 3NTHA 4A3IH 3NQTA 2QEJC 2HCCA 3FPPA 5C6AA 1PTOH 2F3VA 3NHHA 4DR5Q 2ASBA 3A56A 1B70B 3LX0A 4HSVA 3J81L 2JJQA 3K6OA 1AZPA 5FLXc 3SK8A 2L15A 1PZJD 1R9TB 4TKOB 4NXNL 4YHHQ 3W1GA 4DUYQ 4WJ3M 2DNCA 4TVAB 2VQFQ 4U673 1IHZA 2UUBL 2JP1A 3S16B 1JT8A 4JI8Q 4LFBQ 5FO9B 1I3QB 1MIUA 5CYUA 4DR7L 1OO9B 1HZBA 4DV5L 1XXGA 4BBSG 2KQ3A 1EY0A 1QUQB 3RMHA 1VQLA 3BDLA 2L55A 4GKKQ 2X6GA 3N6RA 3AMUA 1FD7D 1I50H 3HRZC 2R7FA 3OPOA 2QCPX 1C7YA 2R7DA 2CWAA 4HJAA 1VF5C 1N32L 1EU3A 2B63H 2PW7A 5I4DA 4L63B 3V2TA 1D1KA 2K04A 1XMQQ 2ZXPA 2EYMA 2J7ZA 4DR3Q 2XIWA 1B53A 1J5EL 3EBEA 4HTHA 1ZYRD 2BE5C 1HUNA 1LYLA 1OTCA 3J7YW 4GLAC 5M9OA 5IYBG 4JCVE 2E2HH 3HOWH 3SK5A 2F0TA 2D9UA 5JOBA 4CDDC 1U0LA 4A76A 4FVMA 3I55A 5C3EG 2EY1A 4GN4B 1W2BA 2PMZE 2HT1A 2CWPA 1JICA 1YI2A 4I7ZC 3HOVB 3HKZB 4ZUIA 1YNJC 2WKDA 3VYRA 3BU2A 1K8AC 3S1QB 4OEMB 5FJ8G 5JPMC 3J81i 5C0XJ 4ZUJA 1K0RA 2EYHA 3E9HA 2F0KA 1N9WA 2O5JC 2OWOA 1S5ED 2RCNA 4JI6L 1L2FA 1RCVD 1B3AA 3DM3A 1D1IA 3NP8A 4HEDA 3FKIG 4R4CA 3WOFA 1O78A 1R9TH 1CHQD 4NP5A 1D5ZC 1LTID 3CU7A 4WJ4A 1MJEA 2B8FA 4B3RQ 1IZ6A 4OIJA 1JB7A 1U4LA 2WAQG 1FJGQ 4MTKA 4N9PA 1GOZA 1TXYA 3QWNA 3W3AA 1I3QH 4M8AA 1UE5A 1SYFA 4LF5Q 1DM0B 1X54A 2TSSA 3H3VC 2MFIA 5BR8L 3T56B 4DA2A 5IWAQ 3P20A 4JI3Q 5CV8A 1L1OA 4JI4Q 3I91A 5GQOA 2OT2A 1WD0A 2QW7A 4QIWB 2IHEA 1P16A 4APVA 3E5SA 4DNRB 2LXJA 2NYZD 1HZAA 1SE8A 4ZRZA 3DEOA 3S1NB 3GTQB 1BDOA 4LFAQ 4C3IG 2E2DC 1EWIA 3KOJA 3A8IE 2NN6I 5C3EB 2EZVA 2N3SA 4L6TB 5L37A 3T1HL 4H02A 2EDGA 4CKBA 4ABNA 1JORA 2SNMA 4FYDA 2NVXH 2JA8G 2SNSA 5DNFA 3MFGA 1EIFA 2M9VA 4TSSA 1VQ9A 1KABA 4B3SL 1FNWA 4NXNQ 3HOVH 1EY4A 1DYQA 3KK7A 3DXJC 4ZQ3A 1F2YA 2ZXOA 3Q23A 2JN4A 4LWCA 2B2TA 2EY2A 4LFCL 1R4PB 1VQGA 5KIXA 5BN3A 2UUBQ 3S1QH 1HA6A 1X56A 4LUVA 3DWQA 4P2CB 4DN4M 1LTGD 2KBNA 1BCPF 1Q86C 1F2ZA 1Y69U 3FKIB 4HJ5A 4FF3A 1JOQA 1CUKA 3DM1A 1JQYD 4I65A 1JJCB 5C5LA 1N8RC 3F2CA 1VQKA 1VQFA 1PV4A 2UXBL 2WAQB 4DUZL 4A3LG 2KECA 3P75A 3BYTB 3OHXC 3OIPA 3AFQA 5JPNC 1KRSA 4O1NA 5EBCA 3STBC 1LTLA 4BBSH 3D6WA 3CPWA 4HN7A 5KNBA 5A2QE 5KNCA 3MHBA 1GO3E 2QEXA 4R1JA 4PMBA 5KNDA 1IL2A 3ND9A 1PH6A 1VQEA 1UE7A 3A5ZB 4BS9A 2JA7G 2I07B 3KLRA 2ZTCA 1LM0A 2WKCA 2Q2HA 2WACA 1M90C 3D0FA 4NXML 4C3IB 1L0YB 3FPUB 1V1OA 3F8TA 4KKUA 1STBA 3KJOA 2MP1A 5IYBH 5KGUA 3D4WA 4JYAL 1SNQA 5T1GA 1OXSC 4NPSA 5M5XH 4G7HC 2JA8B 5C3EH 3H09A 1PTOC 2ZTDA 2SEBD 1YHBA 1WTPA 3A7AB 3VR5A 3LWEA 5I9OA 2BOSA 1A0IA 4JI6Q 1FL0A 3HG9A 1KL9A 3CXCA 1VQ5A 1XNRL 3UE0A 3TBIB 1X3PA 3UDXA 1IBMQ 1UNSA 5FJ8H 4H13C 4KKSA 4LF6Q 3K0XA 4F7XA 1XNQQ 5FLXE 4FF1A 1B7YB 2F0MA 3RZDB 1ICFB 5C4ZA 2Q2IA 3J7AF 1CI3M 3SK4A 3U9OA 2NVTB 2E2JB 1IXRA 3FKIH 4XT3B 1Y1WG 4C3HG 3CCJA 2A68D 1DD2A 1PA6A 3CRLC 4IOAA 5BR8Q 1N33L 2EYFA 4JPBW 5FK9C 2MPMA 2NWGA 4V190 4DNIA 1LUZA 1WJJA 2BH8A 4LF7L 1C0AA 1SFOB 2Z9HA 3C3LA 1V43A 4B3ML 3I90A 1SMYC 4BBRG 2B2UC 4KN7C 4IUQA 4P71A 5CV6A 3R2IA 1ENFA 4A3JG 4ID6A 2E2IH 1SNDA 1EQRA 1S5FD 1K83B 1JWUD 1WYDA 4QY7A 2JA7B 4KTAA 2NUCA 2FMMA 1PYSB 4ULLA 3ULPA 4GNXA 1YNXA 3VA7A 3I7FA 4C1NK 5CV5A 4B3SQ 4IPCA 3L9AX 4WJWA 2OCEA 2KA7A 4I7AA 4C3IH 4CHTB 4YY3L 1BCPB 4HIMA 4DR2L 4ALPA 2BDOA 4LFCQ 3BG3A 2ATWA 3HP3A 3KYHC 2GVAA 1ONLA 4JG2A 2OTLA 4YWLA 3KJPA 4AYBG 1A8VA 1O80A 3OWFA 4U68A 1N36L 2JA8H 4GZYC 1EYDA 4H7BA 5I2YA 3PIOA 1BBUA 3AYHB 3EQLC 3ONAB 3PO2B 2D2CC 2K5NA 1LT4D 5HGTA 1IKMA 4FXKC 3H0GG 1X55A 4PMCA 4N8X1 3ERSX 4DR1L 4C1NI 4GOPA 3RZDH 4F87A 2HUGA 1Y1WB 3QJYA 4C3HB 2RVLA 3EROA 5KRUA 2NVTH 4RGMA 1CA5A 2E2JH 5K36G 2QF7A 4BY1B 2EY6A 1QZHA 2K52A 2MNAA 5M5YB 4DV0L 4A3LH 1EIHA 1S72A 5JVG3 4GLVB 2RDFA 4X66Q 4QQBX 3BZDB 1KIXA 1EZ6A 5GROA 2RDGA 2A5HA 4KKTA 1Q8KA 4BBRB 1SFOH 2HHHQ 4LK1C 3U58A 2N78A 1E0BA 3X3MA 2VW9A 2JEAI 1TS4A 2F0JA 4A3JB 2E8GA 4HIKA 4BWGB 3CCLA 4UAIA 3VA5A 5ELNA 5LMUQ 4JYAQ 1G8ZD 2RCFA 5NUCA 1K83H 1AW7A 2NN6G 3BYYB 4QMGA 4DNTB 1HQRD 4QUFA 4DR4Q 1EL0A 1TWCB 1UE1A 3GV3A 5CMDA 2JA7H 2R61A 2G5DA 4KY7A 2VB2X 2UXDL 2A19A 2PQAA 5C4XG 1R4QB 3OIQA 3FRPB 1WD1A 4IUNA 5IYCH 3KDFA 4DV7Q 3RNUA 2HIVA 4DR5L 2FMCA 1ILQA 2MHVA 3J80c 4AYBB 3GTKB 4G4KA 4MTNA 3R2TA 3NXWA 3NE5B 3NTKA 2F0OA 2R7ZG 4YHHL 5LL6S 3RLFA 5A2QL 1H95A 3A55A 2YU9H 3HFZB 1IW7C 4OX9Q 1HZ9A 4CBVA 5J39A 4RWSC 2L11A 4CJ2C 1CQFA 1W3SA 3NPPA 3KF6B 3MEFA 4YIJA 4JI8L 3B6YA 4LFBL 4NDXA 1L0WA 5FOBB 4QCLA 4CDCC 1Y1VB 2EVBA 3Q24A 2B2YA 4V0BA 1I6VC 3HEJA 3IAYA 1GHJA 2XTIA 1CSPA 1RDPD 2AHOB 2KUMA 1K8MA 3MA2B 5I9PA 3PIPA 1Y1WH 4C3HH 2OTJA 4IUPA 4OHJA 3JC66 3ND8A 4A93G 2HD3A 3MTSA 2XNAC 1X65A 2WB1E 4A3DG 1STAA 2PCFB 5IP9G 4DR3L 3EFXD 4HIOA 1EOVA 4MZ9A 1TKWB 1KXLA 1W6KA 2JA5G 3CCEA 4BBRH 1STHA 3NUCA 1HPCA 1J9OA 1UWVA 1WCMG 4A3IB 3PO3G 1ML0D 3JAMc 3T51B 2XN9C 4A3JH 4DGZA 1XPUA 5J22A 4YY3Q 5IE8A 1YNND 4ZKCB 1SNCA 2EIFA 1O7YA 4DXFA 1CA6A 4JI1L 5C4XB 1TWCH 3Q6SA 2WP8J 1WTXA 2DY7A 2B29A 4HR7B 4O42A 1TQOA 1YITA 1NR2A 3BVMA 2C5CA 5EAYA 2RBMA 2NTTA 1K3RA 3A5UA 1DOMA 4EX5A 1KNEA 1II3A 3DMUA 3I8ZA 3G6EA 4IPGA 5FO7B 2R7ZB 3GTKH 3D8GA 3NK9A 4IALA 4NMZA 4LF4L 5JEAJ 1U4RA 4NKLA 4TRDA 1SYDA 1GVPA 1KLUD 2B63B 4B3RL 3HOXG 1SR3A 4OELB 3KBXA 4JBKA 4DV0Q 3VYTA 3H0GH 2N55A 4CKCA 1HZCA 1OXVA 3TZUA 2H5XA 1X3GA 3NEMA 3A0JA 3G4SA 5CV7A 1B8AA 2LXKA 4LF5L 4XQQA 3VR4A 4K14A 4X65Q 1CM9A 5K36H 4A93B 1H9SB 1PFBA 5IWAL 3DLLA 2B2VC 1NE3A 4JI3L 4A3DB 2A69C 2Y0SG 5D3IB 1U5KA 1HHVA 1EEFD 1X32A 4DV6L 2B8GA 3HGBA 4R9WA 1Z7TA 1VQ8A 4DAPA 2JA5B 1P8LA 3MC0B 1YJWA 1HR0Q 4IFDJ 4LUOA 3H94A 4R4TA 4DAYA 5DM63 2O4XA 3PO3B 4RMFA 2F0NA 5M3FG 1AE2A 4LFAL 4KLKA 2LFNA 3FVQA 2Q2UA 3GO5A 1V1PA 1SJED 1UE6A 3MWYW 1YJNA 1SMXA 2NN6H 2V4DA 4XIGS 3WDNA 1MSHA 4IUTA 2VY3A 2NVYB 4A3FG 3NQIA 5C4XH 2IY5B 3FDTA 2B2WC 4HJ7A 1PRTD 3F2DA 4G57A 3CCRA 3UDGA 4LW1A 2NZ1D 1B9MA 1HRJA 4HIDA 3LGJA 2EYLA 4BA1I 4JVZA 2Q8TA 1QWYA 5ELEA 2ES2A 1CFMA 3K5MA 2F0DA 2K50A 4DFAA 3OMCA 5DM73 1F77A 1VQJA 2R7ZH 2CH4A 1XJVA 2PI2E 1WVLA 1NNXA 4YCUA 5DEHA 2XVSA 3NBIA 3OW7A 2XGTA 2ALYB 3HOXB 3GTLB 1EYGA 4MHEA 5GADC 2CW0C 4XTCS 4X6AH 1PDQA 5J1ZA 3E9IA 2UUAQ 1S5BD 5EKLA 5E7NA 2Z4HA 1V1QA 2K32A 3I2ZA 5ISRA 4PMWA 5GAGC 5JVH3 2AUKA 4RFBA 4N9TA 3TDQA 1KQSA 2Y0SB 2UUCQ 3D4RA 4A93H 1Q81C 2DJGC 3VYSA 1G2SA 4A3DH 2J0TD 3CAMA 2F4IA 2Z6BA 1UEAB 3MVVA 3RLOA 5IP9H 2NZHA 2NVXB 2KOLA 2YTYA 2CQAA 4GKJQ 1KTKA 5EKIA 4B9XA 1EQTA 2EYOA 4JI1Q 3UE1A 2JA5H 3K7UC 1ZKOA 1AP0A 1B3QA 1WCMH 1PZKD 3PO3H 2IL8A 1LT5D 3BVGA 2RQXA 5IT9L 3K8AA 4AQYL 2PO4A 2MUYA 4KI0A 3EN2A 3L3OC 2RSNA 2JA9A 4A3FB 2IJ0A 1BCPC 1JJ2A 3MXNA 2B2UA 2HDLA 4LF4Q 2PPBC 1K8OA 1J6QA 2NVYH 1F9SA 4J8QA 4DU9A 3M85A 1IBML 4RKLA 2ZT9C 2K5QA 3J80E 4LF6L 1EZ8A 3S24A 1XNQL 1H9KA 2E5LQ 2OEOA 1TWFH 1JC7A 1ESFA 1SE3A 2L12A 4BBSB 3CPFA 4A75A 1RODA 1BF4A 1MSGA 1E1OA 4P75A 1F9PA 2P5ZX 4AIMA 1VS0A 1M4VA 3VYUA 4JC0A 4QGUA 1VDZA 4IN3A 4BY7G 2Z6KC 4G7OC 3KLSX 4POGA 1RTNA 3AU7A 2C35B 1TWAB 2FJ2A 3HOXH 3GTLH 1GHKA 1SNPA 5IGEA 3WOEA 5C5MA 4ZCKA 4DV6Q 1JOOA 2VQEQ 3I56A 1KDCA 1PFSA 2RKSA 1VQ6A 3S17H 3CP0A 1KC8C 4DR6Q 1I4RA 1NY4A 2Q8IB 2CCZA 2R92G 3K58A 3TREA 4JI7L 2K5HA 5DLQE 5M5XB 4IPDA 2JYOA 1MBYA 1K73C 1SBBB 2PNHA 4N8FA 2F0FA 5EJWA 3HKSA 1PYWD 1KLGD 4X3TA 5I6WA 3JAME 1ET6A 4IZ8A 1SRUA 5M3FH 1Q90A 4UP9A 5I2XA 3PSIA 5M3MG 1PH7A 1O7IA 3TZDA 5IT9c 3CRKC 1EUJA 4ZKBB 5IGBA 3GP7A 2K6AA 3SK6A 4A3FH 3CQZH 3I73A 4CJ1B 2VZAA 3H15A 1PXUA 1QOHA 1STYA 1JJGA 1XX8A 3IKJA 4DAVA 5GAEC 5D3DA 4Y52H 3P7JA 3CC7A 5ELFA 4B3TQ 4GLXA 4BY7B 1E2ZA 1OXUA 3SGIA 2E2IB 1S3OA 3GV6A 2Q8RE 4KJNA 4OGQC 3RUZA 1XTCD 3TS2A 2L5TA 3PQIA 1GUGA 3T16A 4Y7NB 1MI2A 1Q1EA 1TWAH 4X66L 1YVCA 2GVBA 1GUSA 4HJ9A 1GM5A 1Q1BA 2IWHA 1XPOA 3S2DH 4C56C 1S40A 3KFUA 4RAUC 2HHHL 1W6JA 1H9JA 1Z9FA 2ZM6Q 2CQOA 3T1YQ 3NENA 1BOSA 4EQOA 1D5MC 1FGBD 2EOTA 2JEBI 3A54A 5EGTA 4C2MB 5IYCG 3FHWA 2CFMA 3WWVA 4GOPB 3J7A5 5LMUL 1TVXA 4KK7A 2Z0SA 2F0LA 3K81C 4DR4L 2ZJQA 4AQYQ 3S1MB 2QDLA 3TP8A 2F52A 1TIID 5CC4A 4RCNA 5C0XI 3Q0AA 4OWXB 5JAVA 3NBHA 5E3FA 1JMCA 1I6HB 4X62Q 4DV7L 2CKZB 2XWJB 5M3MB 4JI0L 1E22A 4XXEA 2KJXA 4DV2L 1H9RA 2N49A 2AQ1B 2GN5A 1QCBD 1RTOA 1CK1A 1X3FA 1G91A 4DK3C 1Y8NB 3C46A 2RSOA 4QJFA 4OX9L 2VUMG 1QG7A 1EWHA 1MKHA 5IGCA 1F2LA 1M8AA 1NCVA 1YNJD 2F0EA 3S1RB 3UDIA 5JJKA 4K2LA 1TWGH 1EFID 4PV1C 3DWPA 4DXGA 4HCSA 2C9OA 3QOJA 1X3QA 1EU4A 2K03A 4K5XA 4WRDA 3RZOB 2XSCA 3G7LA 4DF7A 3TP6A 3V96A 3F1ZA 1VQMA 4DV3Q 4BY7H 2FHTA 4JI7Q 2R3ZA 1VQOA 2MO1A 2J4XA 3BVZA 4XDXA 1PH4A 3CC4A 4K5WA 1EYCA 3T4AC 4Y7NH 4J15A 2KVMA 4LUZA 1SE4A 1HNWL 2ENBA 5LMNW 1NR4A 2NZOA 1WFQA 1TY2A 2R92H 1BQQT 1GUNA 1HTPA 1VMCA 1VMPA 3J80L 1K3BC 4C2MH 1NBWA 4MIUA 5IIFA 5EKKA 4E6IA 1Q7YC 2I5LX 3ICEA 4K8IA 1DOKA 1EFWA 1PFMA 1CSQA 2YU9B 3S1MH 3QIAA 1U4MA 1XMOQ 4OO1I 1VQHA 2K01A 1BBWA 2BDNA 5DAUA 3CCMA 4GN3B 4K0KQ 1X3EA 2B2VA 1I6HH 5M3MH 2A8VA 3KLWA 2O5IC 3R8BA 2EJMA 1AN8A 2Z1CA 3X3NA 2QGQA 2VUMB 4C3JG 4LJZC 2HCIA 3QO2A 3C2PA 3G48A 5CORA 3LWUA 1T5XD 2A73B 2TMPA 1HNZQ 4LAAA 1N34Q 3S1RH 1F9QA 3I4OA 2PI2A 1DJRD 2DNEA 3BS1A 1BBXC 4A3GG 3AEVA 2VNUD 1G291 1UAPA 3L2PA 4FNFA 4YWMA 3RZOH 1LACA 4X65L 1F2MA 4IJHA 3JAML 2A6HD 2B2WA 1IBKQ 2EYJA 2F0WA 1I4XA 2UU9Q 2E74C 4LF8L 2B2TC 3DWAA 4XYQA 2UXCQ 4JI5Q 3I70A 4RGOS 2LSSA 4KHPL 4RH6A 1HR0L 2IX1A 1LTAD 4MN3A 3STBD 3J80i 2A6ED 1PMRA 1TY0A 1DXMA 1SROA 3HOUG 1HFNA 1C48A 4JI0Q 1E2WA 3CCQA 1E2VA 4ZK9B 4DK0A 2RDHA 4X3SA 4DV2Q 1XPRA 4KHVA 4MNOA 1JWSD 2L4NA 1X6OA 2RHSB 3K7AB 4XQNA 4R4OA 4WFN3 2HDMA 3K5LA 1JWMD 3Q22A 4RA8A 1D5XC 1YHAA 2K5WA 2L9HA 2K7VA 5C44G 5KEEA 3KLSA 2PW5A 1PFNA 1CKOA 2F0IA 1Q82C 3SR1A 3H0GB 5IT9E 3VR6A 4R4QA 4PZ6A 1A62A 1BUVT 4IQZA 1ZYRC 1AZQA 2KENA 2BCOA 2NVQB 4C3JB 1PTOD 1VQIA 3HKZE 2JE6I 4P73A 2PZUA 2VUMH 4IO9A 4WORA 1LTSD 2R93G 3S15B 2Z4IA 1DONA 1SDFA 1WOCA 3G71A 4A3GB 1RL2A 2UUAL 1I94Q 1LTBD 1MJCA 3JAMi 3M9BA 4AH6A 2VL6A 3SDZA 5IYDG 1PH5A 4XQJA 1IBLQ 1HNWQ 5C4HA 1CZWA 5IGDA 5T1IA 2UUCL 3K57A 3MXPA 5EPKA 3U50C 3GD7A 2PNRC 4K8JA 1A3VA 1Q8IA 2IX0A 1LTTD 2I46A 2RA4A 3RN2A 4A3BG 2DN8A 4GKJL 3AB9A 4K6DA 1PH1A 1D2BA 3RD4A 3E3XA 3S9WA 3EVQA 2OQKA 5C0XG 1PRTF 2DY8A 4OL7A 1SMYD 3PIO3 3HOUB 3I4NG 1VQ7A 1TR5A 3EA6A 3F2BA 1EEID 1QVGA 1ZEQX 1HH2P 3PMFA 1TWHB 1EQQA 2R6GA 1FR3A 4JW0A 3ZJYC 4QIWE 2F3WA 2OF1A 2BA1A 2ID0A 3RR5A 3K7AH 1Z47A 3FEWX 5C44B 5JJLA 2N8NA 4BA2I 3Q8DA 5IGGA 3I4MG 2E5LL 1LLRD 1AE3A 2F0UA 4KHZA 5C3WA 5I6YA 3VDYA 1Y8PB 1CKNA 2B3GA 2K75A 4DK1A 1B44D 4LMQD 3VR2A 3DUZA 2NVQH 4C3JH 1U9RA 2F4VL 4ZAIA 3P1HA 1XTDA 3TRZA 3U9SA 4LF8Q 3E0JA 3S15H 3MXNB 3ERQA 2HQLA 3LNNA 2VQEL 4A3GH 4UHVA 4R8IA 3IFTA 3C1FA 3TN2A 2CH4W 4KHPQ 1SN8A 1SLJA 5C4JB 1SAPA 1TS5A 3SXHA 4FO2A 1RKNA 1WCMB 3TS0A 4DR6L 1QNUA 4F88A 2WAQE 2VS1A 1IYVA 4X3KA 1EOTA 1QVCA 3K5NA 1KD1C 2EJGC 3ER0A 1D6EC 4GOPC 3KF6A 2ZJPA 1I4PA 2WV6D 2CVRA 3S2HH 4CKEA 5E4XA 1YIJA 1L1OB 3I4NB 3BZCA 1RHPA 2AKWB 4RG1A 3CF5A 4OO1G 1X9NA 4ME3A 3HOUH 1TWFB 2IHFA 2KEEA 2F1MA 4DV4L 2AUJD 4OONA 2KCTA 2YYZA 1SNOA 1AH9A 1PH9A 4A3MG 1TWHH 2WB1G 2K33A 4OWWB 2D5DA 3BJUA 4XT1B 1QVFA 3I4MB 3PIP3 1E24A 5C44H 2I5HA 4J6HA 1K0SA 1YHQA 1CT1D 2ZTEA 4L5RC 4JOIC 1UEBA 3W1BA 1FGUA 4UP8A 3H3VI 3S17B 3PF4A 2BA0A 4EGVA 4B3TL 1LT6D 3H6MA 5EPLA 1K28A 2AWNA 1Q3LA 2K5DA 1PH2A 2F0QA 3AQQA 2R93H 1IW7D 1EIGA 2IX3A 1MGSA 4KN4C 4FP5D 3PV0A 1ICWA 4RGTA 1PRTB 1CQVA 3HS0C 5ELDA 3TP7A 3J81j 2ZM6L 4BXXG 5IYDH 3W5OA 3G6JB 3T1YL 2EJFC 2ICEC 5M3FB 5C4JH 2H1EA 5G3LD 4A3EG 1C9OA 2NBFA 1GUWA 1JR0D 4ZLTF 4JV5L 2K05A 3N52A 4Q5VA 1J8IA 3SVMA 3GTMB 3U4ZA 3EJIA 3BZKA 5FLMG 3HZXA 4K5VA 4A3BH 2SOBA 2YTXA 2B2YC 2HQEA 3CQZB 5D65A 1GUOA 3EIVA 3FP9A 3QOLA 4QL5A 2A68C 5CBEE 4KD4A 3C1EA 5GAHC 1XYIA 4DV1Q 4X62L 5C0XH 3M4YA 4L5TA 2OQ0A 3I4NH 3HOZG 3K0YA 3OWEB 1UUPA 3KF8A 2I5MX 2DUDA 1MD2D 2L0CA 1C4QA 4A3MB 1JCKB 1H9SA 2WB1B 1ASYA 1PZID 1CZGA 5E4WC 4YCWA 4LF9L 1SYEA 1B1ZA 3QR8A 2OXPA 4YCVA 1G51A 3J81c 3OTOL 1RIPA 1YZ6A 1DGSA 3PGZA 3M7NA 1VQPA 5H1SE 2F4VQ 1BXTA 2EYPA 3M4QA 1V9PA 1LT3D 2LMCB 3I4MH 1A2UA 1K8GA 2JA6G 1WTOA 3NWTA 3S2DB 2EPBA 4DAMA 1VQ4A 2KCCA 1KDBA 3T13A 3S16H 2GA4B 1SNMA 3D31A 1ESRA 3NBHB 4P72A 4OWTB 3O13A 3I3CA 4YWKA 1NMFA 1Z6HA 4RHSA 2JK8A 1FVIA 1WTQA 2ZJRA 1B50A 3PUZA 4DV3L 1PH3A 1PYBA 3MXUA 5AFWA 4GN5A 1SSOA 2IW3A 4KY5A 3CC2A 1E1TA 4IFDI 1DCZA 4UPAA 3M4OB 4FF2A 3IFDA 2HIXA 5EQ0A 2XWBB 5D14A 2AQ3B 3A8KE 5EBDA 5M5WB 4O0AA 3PUWA 4A3EB 4GS3A 3W2DA 1TU2B 4HMIA 4JBWA 1GD7A 1PVOA 1QUQA 1WTRA 1GXDC 4M1UB 2MQHA 4TQUS 1BVSA 2VXWA 4DV4Q 2KEDA 2A69D 1HA5A 2WFWA 3GTMH 1EYAA 4R4IA 1EY9A 5KYIA 1HUMA 1E3PA 3PF5A 5JJZA 1OXXK 2KHJA 4DKAC 5FO8B 1XMOL 2VB3X 2NB0A 1NJIC 1S5CD 4K0KL 3GTPB 3HOZB 4KMUC 3SEBA 4PZ8A 4OO1H 1TWGB 4B9WA 1D7QA 2AWOA 3I4LA 4GNXB 1U4PA 2F03A 4FF4A 4EVOA
chains in the Genus database with same CATH topology
4HJAA 1UWVA 3CCSA 1WCMG 1EFWA 3S1MH 1CSQA 1N32L 4A3MH 2B63H 3PO3G 4DR7Q 3JAMc 2K4KA 1XMOQ 4OO1I 1VQHA 4A3JH 4DV5Q 1XMQQ 1XPUA 1BBWA 1Y14B 3CCMA 4K0KQ 4GN3B 4DR3Q 4YY3Q 1X3EA 5IE8A 1J5EL 3EBEA 1KHIA 3PUVA 4DK6C 1I6HH 1PH8A 2EIFA 5M3MH 2A8VA 1LYLA 4JI1L 3KLWA 1HNZL 1N34L 1OTCA 1TWCH 4GLAC 2F3IA 4AYBE 2WP8J 1N32Q 4NB3A 2B29A 5IYBG 2YTVA 4JCVE 2E2HH 1YITA 3HOWH 2RF4A 2QGQA 1IYJB 1U0LA 1J5EQ 4A76A 3K80C 5EAYA 3I55A 5C3EG 3G48A 5ELOA 1K3RA 1VQAA 4GN4B 1W2BA 2PMZE 2HT1A 2CWPA 3A5UA 1IBKL 4EX5A 1HNZQ 1YI2A 1N34Q 2KHIA 4IPGA 3G6EA 3S1RH 2UU9L 3I4OA 2PI2A 3J7A5 3GTKH 4A3GG 4JV5Q 2VNUD 3AEVA 3BU2A 1K8AC 2AMCB 1D8LA 1G291 4LF4L 2UXCL 5FJ8G 2JQOA 4JI5L 3L2PA 3M4OH 5JEAJ 3J81i 5C0XJ 4YWMA 3RZOH 1K0RA 4X65L 4IJHA 1GVPA 4B3RL 3E9HA 1OXTA 3HOXG 1SR3A 5M5WH 1IBKQ 4BXXH 1N9WA 4JBKA 2OWOA 4DV0Q 4A3KG 3H0GH 2UU9Q 2RCNA 1HZCA 4A3EH 1OXVA 3CW2C 4JI6L 4IPHA 1L2FA 4LF8L 2H5XA 3DM3A 1X3GA 3S1NH 3NEMA 3GTQH 3FKIG 4R4CA 3A0JA 2UXCQ 4JI5Q 1R9TH 2D62A 3G4SA 1B8AA 2LXKA 4LF5L 4WJ4A 1MJEA 2LSSA 1YEZA 4KHPL 1HR0L 5FLMH 2IX1A 4X65Q 4B3RQ 1IZ6A 5J3BA 3STBD 1JB7A 2WAQG 3PUXA 5IWAL 3J80i 3DLLA 1NE3A 1TXYA 5LMNL 4JI3L 1FJGQ 4LF9Q 2Y0SG 3CMEA 1U5KA 4JI2L 3OTOQ 1I3QH 1SROA 3HOUG 1E7ZA 4DV6L 1UE5A 4JI0Q 1VQ8A 4LF5Q 1P8LA 3GTPH 3HOZH 3CCQA 1YJWA 1HR0Q 4IFDJ 1NMGA 4DV2Q 1X54A 4LUOA 1XPRA 2MFIA 5BR8L 3PO2G 4R4TA 4MNOA 2Q2TA 3J7ZC 1X6OA 2RHSB 5IWAQ 4RMFA 4JI3Q 4R4OA 4DPGA 4O2DA 2PQAB 5M3FG 1AE2A 1L1OA 4JI4Q 4LFAL 4KLKA 1YHAA 2Q2UA 3GO5A 3KDFB 3L0OA 3GTGH 5GQOA 5C44G 1KAWA 1CKOA 1Q82C 1UE6A 1YJNA 2IHEA 1P16A 1YBYA 4APVA 1SMXA 3HOYG 4XIGS 2LXJA 4R4QA 1HZAA 1SE8A 4PZ6A 1A62A 4BY1G 2VY3A 2JA6H 2EQSA 4A3FG 2KENA 4LFAQ 1I94L 3IRBA 5C4XH 2IY5B 1EWIA 1VQIA 3HKZE 3KOJA 4HJ7A 2NN6I 2JE6I 4P73A 1M1KC 2N3SA 3F2DA 3CCRA 3UDGA 3T1HL 2VUMH 4IO9A 4H02A 4LW1A 1IBLL 4HIDA 2R93G 1A63A 3LGJA 4JBJA 4BA1I 2NVXH 2JA8G 4L5QA 2ES2A 2DGYA 1WOCA 1EIFA 3G71A 1VQ9A 2K50A 1RL2A 4B3SL 3TEHB 2UUAL 1I94Q 4NXNQ 1MJCA 3HOVH 5AJ3L 3JAMi 1VQJA 3M9BA 1HNXL 1XJVA 4AH6A 2R7ZH 2PI2E 2VL6A 4LWCA 4YCUA 4LFCL 1VQGA 2YV5A 5IYDG 1PH5A 3T1HQ 2XGTA 2ALYB 2UUBQ 3S1QH 1IBLQ 1HNWQ 1X56A 4LUVA 1EYGA 5GADC 4XTCS 2UUCL 4X6AH 4PG3A 3U50C 3GD7A 2KBNA 1Q86C 3E9IA 2RHQB 2UUAQ 1GKHA 4HJ5A 5E7NA 1CUKA 3CCUA 2IX0A 1V1QA 1JJCB 3I2ZA 4X64L 1JE5A 5IP7G 3RN5A 3RN2A 1N8RC 4A3BG 1Q46A 3F2CA 4GKJL 4PMWA 1VQKA 1L1OC 1VQFA 1VQDA 5GAGC 1PV4A 1PH1A 1VQCA 2UXBL 4DUZL 3M4PA 1KQSA 4A3LG 1PHJA 2UUCQ 2OQKA 5JEAG 5C0XG 4A93H 1VQBA 3AFQA 2MO0A 1KRSA 1Q81C 1VQ7A 3I4NG 4A3DH 3CAMA 3F2BA 3STBC 1LTLA 1QVGA 4BBSH 3RLOA 5IP9H 3CPWA 4EQ5A 2NZHA 2YTYA 1HH2P 4GKJQ 3GTOH 3A74A 4UP7A 3UE1A 4JI1Q 2R6GA 1EQQA 4L5SA 2JA5H 2UXBQ 4DUZQ 1GO3E 3ZJYC 4QIWE 3K7UC 2QEXA 4R1JA 1KRTA 1WCMH 2BA1A 1IL2A 2ID0A 3PO3H 3RR5A 1NTGA 1Z47A 3K7AH 1PH6A 1VQEA 1UE7A 1Y1VG 4POFA 5JJLA 3OYYA 2N8NA 3ULLA 4QQBX 3A5ZB 4LNQA 3K8AA 2JA7G 4BA2I 4A3CG 3PCOB 3Q8DA 3I4MG 2ZTCA 2EXDA 1LM0A 4AQYL 2E5LL 4KI0A 3EN2A 1AE3A 4KHZA 2JA9A 3VDYA 2Q2HA 3CMAA 1M90C 1JJ2A 3D0FA 4NXML 1CKNA 2B3GA 2K75A 3F8TA 4LF4Q 3KJOA 4IFDG 5IYBH 4PZ7A 1HJPA 1J6QA 2NVYH 3M85A 1IBML 4JYAL 2NVQH 1OXSC 4C3JH 2D0PA 4NPSA 5M5XH 4LF6L 2F4VL 4FDBA 3S24A 1XNQL 5C3EH 2ZTDA 2E5LQ 1XTDA 1YHBA 1TWFH 3TRZA 4JI6Q 1A0IA 3CPFA 1FL0A 4LF8Q 4NXMQ 1KL9A 4A75A 3S15H 3CXCA 1VQ5A 1CKNB 1XNRL 1G6PA 4A3IG 3MXNB 3UE0A 1E1OA 2HQLA 4P75A 3UDXA 4AIMA 4A3GH 2VQEL 2I0QA 1VS0A 1IBMQ 4JOIA 5FJ8H 4JC0A 5IY0A 4QGUA 1SN8A 1SLJA 4KHPQ 5JJIA 1I5FA 4LF6Q 4BY7G 2Z6KC 3K0XA 4POGA 3TS0A 1XNQQ 4DR6L 5LMNQ 2C35B 1B7YB 3ULJA 1T9HA 5HGQA 3HOXH 3GTLH 2WAQE 5HY6A 2VS1A 2Q2IA 2Y0SE 4JI2Q 1XNRQ 4A3KH 1QVCA 4DV6Q 2VQEQ 3I56A 1IXRA 1PFSA 3FKIH 1Y1WG 3CCJA 1KD1C 1PA6A 1VQ6A 3RLNA 3CP0A 3ER0A 3S17H 4IOAA 5BR8Q 1CKMA 1KC8C 1N33L 4DR6Q 4GOPC 4DAYB 3KF6A 3UDFA 2ZJPA 1NY4A 2CCZA 2R92G 1WI5A 3S2HH 4DNIA 1LUZA 1L1OB 1WJJA 2BH8A 3BZCA 3TREA 2K5HA 1YIJA 4JI7L 5DLQE 4LF7L 4IPDA 2AKWB 4RG1A 3CF5A 4JBMA 1C0AA 4OO1G 1X9NA 4ME3A 1K73C 3HOUH 2PNHA 1V43A 4B3ML 2IHFA 4DV4L 4DUYL 4OONA 4BBRG 2KCTA 2VQFL 2YYZA 3L7ZC 3HKSA 1N33Q 4P71A 1AH9A 1PH9A 2K14A 3PO2H 4A3MG 2B63G 1TWHH 2WB1G 4A3JG 4OWWB 2E2IH 3TQYA 1SRUA 3BJUA 4LF7Q 1EQRA 5M3FH 1WYDA 4QY7A 4UP9A 1QVFA 4GKKL 3PSIA 4B3MQ 3H3VH 1E24A 5M3MG 2I5HA 5C44H 1K9MC 1PYSB 2K5VA 3ULPA 1PH7A 1YHQA 1HR0W 1O7IA 4GNXA 1YNXA 5IT9c 2ZTEA 3I7FA 3HOYH 4L5RC 1EUJA 4JOIC 4B3SQ 1UEBA 4IPCA 3HOWG 3W1BA 4BY1H 1FGUA 4UP8A 5AJ3Q 3H3VI 4A3FH 2OCEA 1HNXQ 3CQZH 1XMQL 4C3IH 3PF4A 2BA0A 4B3TL 4YY3L 5M5YH 4HIMA 4DR2L 2VZAA 4ALPA 4LFCQ 3H15A 2AWNA 2ATWA 3KYHC 2GVAA 1PH2A 4JG2A 2OTLA 4YWLA 3U4VA 3KJPA 3AQQA 1JJGA 4AYBG 1A8VA 1Q12A 2R93H 1N36L 2JA8H 2Z6KA 5GAEC 3NELA 1EIYB 3PIOA 4Y52H 1BBUA 3AYHB 3PV0A 4X64Q 3CC7A 3CD6A 3GDEA 4B3TQ 4GLXA 4DR2Q 1OXUA 3J81j 2K5NA 3SGIA 2ZM6L 4BXXG 5IYDH 3W5OA 4IJLA 3T1YL 1S3OA 4A4IA 3M3YH 3H0GG 5C4JH 4A3EG 1X55A 3TS2A 1C9OA 1N36Q 3ERSX 2D0OA 4DR1L 1Q1EA 1YJ9A 1TWAH 4X66L 1YVCA 2GVBA 4DV1L 4HJ9A 4GOPA 3RZDH 3AFPA 1GM5A 1Q1BA 4JV5L 1XPOA 3S2DH 1S40A 3U4ZA 5FLMG 3BZKA 3KFUA 2HHHL 2NVTH 5IP7H 2E2JH 1Z9FA 2ZM6Q 4A3BH 2CQOA 5K36G 2QA4A 2YTXA 3T1YQ 3NENA 1QZHA 3EIVA 2K52A 3FP9A 4QL5A 3PUYA 2MNAA 1BKBA 5IYCG 2JEBI 4DV0L 1QZGA 4A3LH 1S72A 4GLVB 5GAHC 4DR1Q 3FHWA 2CFMA 3WWVA 4X62L 4X66Q 4DV1Q 4GNXC 4GOPB 5GROA 5LMUL 4L5TA 3OW2A 2KCMA 1KIXA 2OQ0A 3I4NH 3HOZG 2Z0SA 1Q8KA 3K81C 2I5MX 2DUDA 1SFOH 2HHHQ 4DR4L 3U58A 4AQYQ 2ZJQA 2N78A 2VW9A 2JEAI 2F52A 2A1AA 1ASYA 5C0XI 1FJGL 4OWXB 4YCWA 4UY8C 4LF9L 2E8GA 1VQNA 4HIKA 3CCLA 2BH2A 3E0EA 1JMCA 4YCVA 1G51A 4X62Q 3J81c 2CKZB 3OTOL 2IT1A 1RIPA 1YZ6A 1DGSA 3PGZA 5ELNA 5LMUQ 1ASZA 3M7NA 3S14H 4JYAQ 1VQPA 1Y1VH 4JI0L 1K83H 5H1SE 2F4VQ 2NN6G 1E22A 4DR4Q 1V9PA 3KF8B 3M4QA 4A3CH 1UE1A 2JA7H 3I4MH 4DV2L 2N49A 1K8GA 2JA6G 2UXDL 2GN5A 1VCIA 2A19A 2FXQA 1X3FA 2PQAA 4DAMA 1VQ4A 5C4XG 4DK3C 3S16H 4JI4L 3D31A 3NBHB 5IYCH 4OXPA 3KDFA 4DV7Q 4P72A 4QJFA 4OWTB 2HIVA 3RNUA 4OX9L 2VUMG 4YWKA 1NMFA 2V1CC 4DR5L 1MKHA 2JK8A 1FVIA 2ZJRA 3J80c 3PUZA 3UDIA 4DV3L 5JJKA 4IOCA 1TWGH 4MTNA 1PH3A 1PYBA 4HJ8A 2UXDQ 4GN5A 3GTJH 3CCVA 3CC2A 4IFDI 1E1TA 3HOVG 4UPAA 2R7ZG 3HKZG 4YHHL 4P74A 3RLFA 1H95A 4A3IH 2YU9H 2HIXA 3HFZB 4OX9Q 1HZ9A 3F1ZA 4DR5Q 4O0AA 2ASBA 1VQMA 3PUWA 1B70B 4DV3Q 4DV7L 1W3SA 4GS3A 4BY7H 3KF6B 2JJQA 3MEFA 4JI8L 3B6YA 4LFBL 5FLXc 1L0WA 4JBWA 2L15A 4JI7Q 1VQOA 1GD7A 1PVOA 2MO1A 1QUQA 1PH4A 4NXNL 4YHHQ 3CC4A 2MQHA 4TQUS 1BVSA 4Y7NH 4DV4Q 3W1GA 2XTIA 1CSPA 4DUYQ 4WJ3M 4TVAB 2AHOB 4J15A 2VQFQ 3PIPA 2WFWA 2UUBL 1Y1WH 4C3HH 4LUZA 4R4IA 3GTMH 2OTJA 1HNWL 3JC66 1E3PA 5LMNW 3PF5A 1JT8A 4JI8Q 4A93G 4LFBQ 1MIUA 1X65A 1OXXK 2NZOA 2KHJA 2WB1E 1WFQA 4DKAC 4DR7L 4A3DG 1XMOL 2R92H 1HZBA 4DV5L 1NJIC 4K0KL 4BBSG 1QUQB 5IP9G 4DR3L 1VQLA 4HIOA 4GKKQ 4C2MH 1NBWA 1EOVA 4PZ8A 4MZ9A 1D7QA 1KXLA 1Q7YC 2I5LX 2JA5G 1I50H 2AWOA 3ICEA 2R7FA 3CCEA 4GNXB 4BBRH 1C7YA 2R7DA 2CWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJA A;  1UWV A;  3CCS A;  1WCM G;  1EFW A;  3S1M H;  1CSQ A;  1N32 L;  4A3M H;  2B63 H;  3PO3 G;  4DR7 Q;  3JAM c;  2K4K A;  1XMO Q;  4OO1 I;  1VQH A;  4A3J H;  4DV5 Q;  1XMQ Q;  1XPU A;  1BBW A;  1Y14 B;  3CCM A;  4K0K Q;  4GN3 B;  4DR3 Q;  4YY3 Q;  1X3E A;  5IE8 A;  1J5E L;  3EBE A;  1KHI A;  3PUV A;  4DK6 C;  1I6H H;  1PH8 A;  2EIF A;  5M3M H;  2A8V A;  1LYL A;  4JI1 L;  3KLW A;  1HNZ L;  1N34 L;  1OTC A;  1TWC H;  4GLA C;  2F3I A;  4AYB E;  2WP8 J;  1N32 Q;  4NB3 A;  2B29 A;  5IYB G;  2YTV A;  4JCV E;  2E2H H;  1YIT A;  3HOW H;  2RF4 A;  2QGQ A;  1IYJ B;  1U0L A;  1J5E Q;  4A76 A;  3K80 C;  5EAY A;  3I55 A;  5C3E G;  3G48 A;  5ELO A;  1K3R A;  1VQA A;  4GN4 B;  1W2B A;  2PMZ E;  2HT1 A;  2CWP A;  3A5U A;  1IBK L;  4EX5 A;  1HNZ Q;  1YI2 A;  1N34 Q;  2KHI A;  4IPG A;  3G6E A;  3S1R H;  2UU9 L;  3I4O A;  2PI2 A;  3J7A 5;  3GTK H;  4A3G G;  4JV5 Q;  2VNU D;  3AEV A;  3BU2 A;  1K8A C;  2AMC B;  1D8L A;  1G29 1;  4LF4 L;  2UXC L;  5FJ8 G;  2JQO A;  4JI5 L;  3L2P A;  3M4O H;  5JEA J;  3J81 i;  5C0X J;  4YWM A;  3RZO H;  1K0R A;  4X65 L;  4IJH A;  1GVP A;  4B3R L;  3E9H A;  1OXT A;  3HOX G;  1SR3 A;  5M5W H;  1IBK Q;  4BXX H;  1N9W A;  4JBK A;  2OWO A;  4DV0 Q;  4A3K G;  3H0G H;  2UU9 Q;  2RCN A;  1HZC A;  4A3E H;  1OXV A;  3CW2 C;  4JI6 L;  4IPH A;  1L2F A;  4LF8 L;  2H5X A;  3DM3 A;  1X3G A;  3S1N H;  3NEM A;  3GTQ H;  3FKI G;  4R4C A;  3A0J A;  2UXC Q;  4JI5 Q;  1R9T H;  2D62 A;  3G4S A;  1B8A A;  2LXK A;  4LF5 L;  4WJ4 A;  1MJE A;  2LSS A;  1YEZ A;  4KHP L;  1HR0 L;  5FLM H;  2IX1 A;  4X65 Q;  4B3R Q;  1IZ6 A;  5J3B A;  3STB D;  1JB7 A;  2WAQ G;  3PUX A;  5IWA L;  3J80 i;  3DLL A;  1NE3 A;  1TXY A;  5LMN L;  4JI3 L;  1FJG Q;  4LF9 Q;  2Y0S G;  3CME A;  1U5K A;  4JI2 L;  3OTO Q;  1I3Q H;  1SRO A;  3HOU G;  1E7Z A;  4DV6 L;  1UE5 A;  4JI0 Q;  1VQ8 A;  4LF5 Q;  1P8L A;  3GTP H;  3HOZ H;  3CCQ A;  1YJW A;  1HR0 Q;  4IFD J;  1NMG A;  4DV2 Q;  1X54 A;  4LUO A;  1XPR A;  2MFI A;  5BR8 L;  3PO2 G;  4R4T A;  4MNO A;  2Q2T A;  3J7Z C;  1X6O A;  2RHS B;  5IWA Q;  4RMF A;  4JI3 Q;  4R4O A;  4DPG A;  4O2D A;  2PQA B;  5M3F G;  1AE2 A;  1L1O A;  4JI4 Q;  4LFA L;  4KLK A;  1YHA A;  2Q2U A;  3GO5 A;  3KDF B;  3L0O A;  3GTG H;  5GQO A;  5C44 G;  1KAW A;  1CKO A;  1Q82 C;  1UE6 A;  1YJN A;  2IHE A;  1P16 A;  1YBY A;  4APV A;  1SMX A;  3HOY G;  4XIG S;  2LXJ A;  4R4Q A;  1HZA A;  1SE8 A;  4PZ6 A;  1A62 A;  4BY1 G;  2VY3 A;  2JA6 H;  2EQS A;  4A3F G;  2KEN A;  4LFA Q;  1I94 L;  3IRB A;  5C4X H;  2IY5 B;  1EWI A;  1VQI A;  3HKZ E;  3KOJ A;  4HJ7 A;  2NN6 I;  2JE6 I;  4P73 A;  1M1K C;  2N3S A;  3F2D A;  3CCR A;  3UDG A;  3T1H L;  2VUM H;  4IO9 A;  4H02 A;  4LW1 A;  1IBL L;  4HID A;  2R93 G;  1A63 A;  3LGJ A;  4JBJ A;  4BA1 I;  2NVX H;  2JA8 G;  4L5Q A;  2ES2 A;  2DGY A;  1WOC A;  1EIF A;  3G71 A;  1VQ9 A;  2K50 A;  1RL2 A;  4B3S L;  3TEH B;  2UUA L;  1I94 Q;  4NXN Q;  1MJC A;  3HOV H;  5AJ3 L;  3JAM i;  1VQJ A;  3M9B A;  1HNX L;  1XJV A;  4AH6 A;  2R7Z H;  2PI2 E;  2VL6 A;  4LWC A;  4YCU A;  4LFC L;  1VQG A;  2YV5 A;  5IYD G;  1PH5 A;  3T1H Q;  2XGT A;  2ALY B;  2UUB Q;  3S1Q H;  1IBL Q;  1HNW Q;  1X56 A;  4LUV A;  1EYG A;  5GAD C;  4XTC S;  2UUC L;  4X6A H;  4PG3 A;  3U50 C;  3GD7 A;  2KBN A;  1Q86 C;  3E9I A;  2RHQ B;  2UUA Q;  1GKH A;  4HJ5 A;  5E7N A;  1CUK A;  3CCU A;  2IX0 A;  1V1Q A;  1JJC B;  3I2Z A;  4X64 L;  1JE5 A;  5IP7 G;  3RN5 A;  3RN2 A;  1N8R C;  4A3B G;  1Q46 A;  3F2C A;  4GKJ L;  4PMW A;  1VQK A;  1L1O C;  1VQF A;  1VQD A;  5GAG C;  1PV4 A;  1PH1 A;  1VQC A;  2UXB L;  4DUZ L;  3M4P A;  1KQS A;  4A3L G;  1PHJ A;  2UUC Q;  2OQK A;  5JEA G;  5C0X G;  4A93 H;  1VQB A;  3AFQ A;  2MO0 A;  1KRS A;  1Q81 C;  1VQ7 A;  3I4N G;  4A3D H;  3CAM A;  3F2B A;  3STB C;  1LTL A;  1QVG A;  4BBS H;  3RLO A;  5IP9 H;  3CPW A;  4EQ5 A;  2NZH A;  2YTY A;  1HH2 P;  4GKJ Q;  3GTO H;  3A74 A;  4UP7 A;  3UE1 A;  4JI1 Q;  2R6G A;  1EQQ A;  4L5S A;  2JA5 H;  2UXB Q;  4DUZ Q;  1GO3 E;  3ZJY C;  4QIW E;  3K7U C;  2QEX A;  4R1J A;  1KRT A;  1WCM H;  2BA1 A;  1IL2 A;  2ID0 A;  3PO3 H;  3RR5 A;  1NTG A;  1Z47 A;  3K7A H;  1PH6 A;  1VQE A;  1UE7 A;  1Y1V G;  4POF A;  5JJL A;  3OYY A;  2N8N A;  3ULL A;  4QQB X;  3A5Z B;  4LNQ A;  3K8A A;  2JA7 G;  4BA2 I;  4A3C G;  3PCO B;  3Q8D A;  3I4M G;  2ZTC A;  2EXD A;  1LM0 A;  4AQY L;  2E5L L;  4KI0 A;  3EN2 A;  1AE3 A;  4KHZ A;  2JA9 A;  3VDY A;  2Q2H A;  3CMA A;  1M90 C;  1JJ2 A;  3D0F A;  4NXM L;  1CKN A;  2B3G A;  2K75 A;  3F8T A;  4LF4 Q;  3KJO A;  4IFD G;  5IYB H;  4PZ7 A;  1HJP A;  1J6Q A;  2NVY H;  3M85 A;  1IBM L;  4JYA L;  2NVQ H;  1OXS C;  4C3J H;  2D0P A;  4NPS A;  5M5X H;  4LF6 L;  2F4V L;  4FDB A;  3S24 A;  1XNQ L;  5C3E H;  2ZTD A;  2E5L Q;  1XTD A;  1YHB A;  1TWF H;  3TRZ A;  4JI6 Q;  1A0I A;  3CPF A;  1FL0 A;  4LF8 Q;  4NXM Q;  1KL9 A;  4A75 A;  3S15 H;  3CXC A;  1VQ5 A;  1CKN B;  1XNR L;  1G6P A;  4A3I G;  3MXN B;  3UE0 A;  1E1O A;  2HQL A;  4P75 A;  3UDX A;  4AIM A;  4A3G H;  2VQE L;  2I0Q A;  1VS0 A;  1IBM Q;  4JOI A;  5FJ8 H;  4JC0 A;  5IY0 A;  4QGU A;  1SN8 A;  1SLJ A;  4KHP Q;  5JJI A;  1I5F A;  4LF6 Q;  4BY7 G;  2Z6K C;  3K0X A;  4POG A;  3TS0 A;  1XNQ Q;  4DR6 L;  5LMN Q;  2C35 B;  1B7Y B;  3ULJ A;  1T9H A;  5HGQ A;  3HOX H;  3GTL H;  2WAQ E;  5HY6 A;  2VS1 A;  2Q2I A;  2Y0S E;  4JI2 Q;  1XNR Q;  4A3K H;  1QVC A;  4DV6 Q;  2VQE Q;  3I56 A;  1IXR A;  1PFS A;  3FKI H;  1Y1W G;  3CCJ A;  1KD1 C;  1PA6 A;  1VQ6 A;  3RLN A;  3CP0 A;  3ER0 A;  3S17 H;  4IOA A;  5BR8 Q;  1CKM A;  1KC8 C;  1N33 L;  4DR6 Q;  4GOP C;  4DAY B;  3KF6 A;  3UDF A;  2ZJP A;  1NY4 A;  2CCZ A;  2R92 G;  1WI5 A;  3S2H H;  4DNI A;  1LUZ A;  1L1O B;  1WJJ A;  2BH8 A;  3BZC A;  3TRE A;  2K5H A;  1YIJ A;  4JI7 L;  5DLQ E;  4LF7 L;  4IPD A;  2AKW B;  4RG1 A;  3CF5 A;  4JBM A;  1C0A A;  4OO1 G;  1X9N A;  4ME3 A;  1K73 C;  3HOU H;  2PNH A;  1V43 A;  4B3M L;  2IHF A;  4DV4 L;  4DUY L;  4OON A;  4BBR G;  2KCT A;  2VQF L;  2YYZ A;  3L7Z C;  3HKS A;  1N33 Q;  4P71 A;  1AH9 A;  1PH9 A;  2K14 A;  3PO2 H;  4A3M G;  2B63 G;  1TWH H;  2WB1 G;  4A3J G;  4OWW B;  2E2I H;  3TQY A;  1SRU A;  3BJU A;  4LF7 Q;  1EQR A;  5M3F H;  1WYD A;  4QY7 A;  4UP9 A;  1QVF A;  4GKK L;  3PSI A;  4B3M Q;  3H3V H;  1E24 A;  5M3M G;  2I5H A;  5C44 H;  1K9M C;  1PYS B;  2K5V A;  3ULP A;  1PH7 A;  1YHQ A;  1HR0 W;  1O7I A;  4GNX A;  1YNX A;  5IT9 c;  2ZTE A;  3I7F A;  3HOY H;  4L5R C;  1EUJ A;  4JOI C;  4B3S Q;  1UEB A;  4IPC A;  3HOW G;  3W1B A;  4BY1 H;  1FGU A;  4UP8 A;  5AJ3 Q;  3H3V I;  4A3F H;  2OCE A;  1HNX Q;  3CQZ H;  1XMQ L;  4C3I H;  3PF4 A;  2BA0 A;  4B3T L;  4YY3 L;  5M5Y H;  4HIM A;  4DR2 L;  2VZA A;  4ALP A;  4LFC Q;  3H15 A;  2AWN A;  2ATW A;  3KYH C;  2GVA A;  1PH2 A;  4JG2 A;  2OTL A;  4YWL A;  3U4V A;  3KJP A;  3AQQ A;  1JJG A;  4AYB G;  1A8V A;  1Q12 A;  2R93 H;  1N36 L;  2JA8 H;  2Z6K A;  5GAE C;  3NEL A;  1EIY B;  3PIO A;  4Y52 H;  1BBU A;  3AYH B;  3PV0 A;  4X64 Q;  3CC7 A;  3CD6 A;  3GDE A;  4B3T Q;  4GLX A;  4DR2 Q;  1OXU A;  3J81 j;  2K5N A;  3SGI A;  2ZM6 L;  4BXX G;  5IYD H;  3W5O A;  4IJL A;  3T1Y L;  1S3O A;  4A4I A;  3M3Y H;  3H0G G;  5C4J H;  4A3E G;  1X55 A;  3TS2 A;  1C9O A;  1N36 Q;  3ERS X;  2D0O A;  4DR1 L;  1Q1E A;  1YJ9 A;  1TWA H;  4X66 L;  1YVC A;  2GVB A;  4DV1 L;  4HJ9 A;  4GOP A;  3RZD H;  3AFP A;  1GM5 A;  1Q1B A;  4JV5 L;  1XPO A;  3S2D H;  1S40 A;  3U4Z A;  5FLM G;  3BZK A;  3KFU A;  2HHH L;  2NVT H;  5IP7 H;  2E2J H;  1Z9F A;  2ZM6 Q;  4A3B H;  2CQO A;  5K36 G;  2QA4 A;  2YTX A;  3T1Y Q;  3NEN A;  1QZH A;  3EIV A;  2K52 A;  3FP9 A;  4QL5 A;  3PUY A;  2MNA A;  1BKB A;  5IYC G;  2JEB I;  4DV0 L;  1QZG A;  4A3L H;  1S72 A;  4GLV B;  5GAH C;  4DR1 Q;  3FHW A;  2CFM A;  3WWV A;  4X62 L;  4X66 Q;  4DV1 Q;  4GNX C;  4GOP B;  5GRO A;  5LMU L;  4L5T A;  3OW2 A;  2KCM A;  1KIX A;  2OQ0 A;  3I4N H;  3HOZ G;  2Z0S A;  1Q8K A;  3K81 C;  2I5M X;  2DUD A;  1SFO H;  2HHH Q;  4DR4 L;  3U58 A;  4AQY Q;  2ZJQ A;  2N78 A;  2VW9 A;  2JEA I;  2F52 A;  2A1A A;  1ASY A;  5C0X I;  1FJG L;  4OWX B;  4YCW A;  4UY8 C;  4LF9 L;  2E8G A;  1VQN A;  4HIK A;  3CCL A;  2BH2 A;  3E0E A;  1JMC A;  4YCV A;  1G51 A;  4X62 Q;  3J81 c;  2CKZ B;  3OTO L;  2IT1 A;  1RIP A;  1YZ6 A;  1DGS A;  3PGZ A;  5ELN A;  5LMU Q;  1ASZ A;  3M7N A;  3S14 H;  4JYA Q;  1VQP A;  1Y1V H;  4JI0 L;  1K83 H;  5H1S E;  2F4V Q;  2NN6 G;  1E22 A;  4DR4 Q;  1V9P A;  3KF8 B;  3M4Q A;  4A3C H;  1UE1 A;  2JA7 H;  3I4M H;  4DV2 L;  2N49 A;  1K8G A;  2JA6 G;  2UXD L;  2GN5 A;  1VCI A;  2A19 A;  2FXQ A;  1X3F A;  2PQA A;  4DAM A;  1VQ4 A;  5C4X G;  4DK3 C;  3S16 H;  4JI4 L;  3D31 A;  3NBH B;  5IYC H;  4OXP A;  3KDF A;  4DV7 Q;  4P72 A;  4QJF A;  4OWT B;  2HIV A;  3RNU A;  4OX9 L;  2VUM G;  4YWK A;  1NMF A;  2V1C C;  4DR5 L;  1MKH A;  2JK8 A;  1FVI A;  2ZJR A;  3J80 c;  3PUZ A;  3UDI A;  4DV3 L;  5JJK A;  4IOC A;  1TWG H;  4MTN A;  1PH3 A;  1PYB A;  4HJ8 A;  2UXD Q;  4GN5 A;  3GTJ H;  3CCV A;  3CC2 A;  4IFD I;  1E1T A;  3HOV G;  4UPA A;  2R7Z G;  3HKZ G;  4YHH L;  4P74 A;  3RLF A;  1H95 A;  4A3I H;  2YU9 H;  2HIX A;  3HFZ B;  4OX9 Q;  1HZ9 A;  3F1Z A;  4DR5 Q;  4O0A A;  2ASB A;  1VQM A;  3PUW A;  1B70 B;  4DV3 Q;  4DV7 L;  1W3S A;  4GS3 A;  4BY7 H;  3KF6 B;  2JJQ A;  3MEF A;  4JI8 L;  3B6Y A;  4LFB L;  5FLX c;  1L0W A;  4JBW A;  2L15 A;  4JI7 Q;  1VQO A;  1GD7 A;  1PVO A;  2MO1 A;  1QUQ A;  1PH4 A;  4NXN L;  4YHH Q;  3CC4 A;  2MQH A;  4TQU S;  1BVS A;  4Y7N H;  4DV4 Q;  3W1G A;  2XTI A;  1CSP A;  4DUY Q;  4WJ3 M;  4TVA B;  2AHO B;  4J15 A;  2VQF Q;  3PIP A;  2WFW A;  2UUB L;  1Y1W H;  4C3H H;  4LUZ A;  4R4I A;  3GTM H;  2OTJ A;  1HNW L;  3JC6 6;  1E3P A;  5LMN W;  3PF5 A;  1JT8 A;  4JI8 Q;  4A93 G;  4LFB Q;  1MIU A;  1X65 A;  1OXX K;  2NZO A;  2KHJ A;  2WB1 E;  1WFQ A;  4DKA C;  4DR7 L;  4A3D G;  1XMO L;  2R92 H;  1HZB A;  4DV5 L;  1NJI C;  4K0K L;  4BBS G;  1QUQ B;  5IP9 G;  4DR3 L;  1VQL A;  4HIO A;  4GKK Q;  4C2M H;  1NBW A;  1EOV A;  4PZ8 A;  4MZ9 A;  1D7Q A;  1KXL A;  1Q7Y C;  2I5L X;  2JA5 G;  1I50 H;  2AWO A;  3ICE A;  2R7F A;  3CCE A;  4GNX B;  4BBR H;  1C7Y A;  2R7D A;  2CWA A; 
#chains in the Genus database with same CATH topology
 3T53 B;  3CCS A;  4A3M H;  3GTG B;  4DR7 Q;  5EPJ A;  2K4K A;  4DV5 Q;  1EWC A;  1Y14 B;  2A6H C;  3M7G A;  3BDO A;  1KHI A;  3PUV A;  4DK6 C;  4Z9C B;  4HSP A;  1PH8 A;  1B4O A;  3OMG A;  4H44 C;  1AEX A;  1LAB A;  2QIL A;  1QNK A;  2JA6 B;  1T5E A;  4J1M A;  5TSS A;  1HNZ L;  1N34 L;  1H9M A;  2F3I A;  4AYB E;  5K5P A;  3MAQ A;  4NB3 A;  1N32 Q;  2YTV A;  4IUV A;  2RF4 A;  1O7L A;  1IYJ B;  1LV9 A;  2B39 A;  1J5E Q;  3K80 C;  2F0S A;  2A6E C;  1Y8O B;  5ELO A;  1VQA A;  2R92 B;  1IBK L;  1B9N A;  1NSN S;  2MJ8 A;  2KHI A;  2UU9 L;  2JSO A;  2E76 C;  3SHL A;  4JV5 Q;  1IKL A;  1D8L A;  2AMC B;  2UXC L;  2F0G A;  2JQO A;  4JI5 L;  2CW0 D;  3M4O H;  5F2D A;  4HMJ A;  5FKA C;  3K59 A;  4RHR A;  1STN A;  1OXT A;  2E75 C;  4G7Z C;  1GJX A;  5M5W H;  4BXX H;  1ENC A;  2BE5 D;  1SEB D;  5LL6 X;  4A3K G;  2O2L D;  4RKB A;  4A3E H;  3CW2 C;  4IPH A;  1EQV A;  3S1N H;  3GTQ H;  2LKV A;  2D62 A;  1G6Z A;  5E1F A;  2NTS A;  1YEZ A;  5FLM H;  5J3B A;  1IYU A;  3TSS A;  3PUX A;  5LMN L;  1NUC A;  4LF9 Q;  1I4H A;  4OIK A;  1RJT A;  3CME A;  4ME5 A;  3TME A;  4JI2 L;  3OTO Q;  2PZW A;  1E7Z A;  3GTO B;  3GTP H;  3HOZ H;  1NMG A;  1ENA A;  3PO2 G;  4QUC A;  3D6C A;  2Q2T A;  2F0H A;  3J7Z C;  3CKI B;  3K5O A;  1CTM A;  4KJO A;  4DPG A;  1STG A;  2PQA B;  4O2D A;  1A6X A;  1G2T A;  2EY5 A;  2Z8L A;  3NTI A;  2PQE A;  3KDF B;  3L0O A;  3GTG H;  2PMZ B;  1BCP D;  1KAW A;  1TS3 A;  3E6Z X;  1YBY A;  3HOY G;  4RGN A;  2LS0 1;  5HUR A;  5IOD A;  2PYK A;  2CHB D;  4QB4 A;  1EY8 A;  1YNN C;  4BY1 G;  1B2T A;  3FMC A;  2JA6 H;  2EQS A;  3NSW A;  4S3S A;  1I94 L;  3IRB A;  1WTW A;  1JOK A;  1A2T A;  1SYC A;  3MXG A;  4QF4 A;  1I4G A;  5CBA E;  4KD3 A;  1M1K C;  1IBL L;  4KY6 A;  3R93 A;  1A63 A;  4UDU C;  4JBJ A;  4L5Q A;  2FFK B;  2DGY A;  1KAA A;  3TEH B;  4H0L C;  5BN4 A;  5AJ3 L;  1HNX L;  3NWS A;  1MHW C;  1O7Z A;  1ILP A;  2YV5 A;  3T1H Q;  3A8J E;  1JB3 A;  1LTR D;  2IPK D;  4A3K B;  2X69 A;  2WII B;  4PG3 A;  1BO0 A;  3CHB D;  2RHQ B;  1HTL D;  1GKH A;  3CCU A;  2PZT A;  4CDF C;  4X64 L;  1JE5 A;  5COY A;  5IP7 G;  4NW2 A;  1FNV A;  3RN5 A;  1Q46 A;  1L1O C;  1VQD A;  1VQC A;  4PQX A;  1VF7 A;  3M4P A;  1SXT A;  4ZYS A;  1PTO F;  2K28 A;  1PHJ A;  5JEA G;  4K6L A;  1BNZ A;  1VQB A;  1DZ1 A;  2MO0 A;  3KUP A;  4EQ5 A;  1IL8 A;  3GTO H;  3A74 A;  4UP7 A;  1L0X B;  4L5S A;  2UXB Q;  4DUZ Q;  1KRT A;  3UI2 A;  3J81 E;  1TS2 A;  3H91 A;  1NTG A;  1Y1V G;  4POF A;  3OYY A;  3ULL A;  4K2K A;  4LNQ A;  2QDB A;  3IL8 A;  4A3C G;  3PCO B;  5BN5 A;  1KNA A;  1QIL A;  2EXD A;  3HOY B;  1ET9 A;  1RD9 D;  3KBG A;  3CMA A;  1TT2 A;  1SYB A;  1SE2 A;  2WIN B;  4IFD G;  4PZ7 A;  1HJP A;  2X6L A;  2D0P A;  4L8J A;  5IGF A;  4X3U A;  1WTH A;  4FDB A;  3A7L A;  3QG1 A;  1S4Z A;  1BR9 A;  4EQN A;  1PRT C;  4NXM Q;  4EQP A;  5CV9 A;  1CKN B;  1G6P A;  4A3I G;  2F0V A;  2G9D A;  2I0Q A;  4JOI A;  5IY0 A;  3M3Y B;  5A35 A;  5JJI A;  1I5F A;  1NAP A;  5LMN Q;  3ULJ A;  1T9H A;  5HGQ A;  5HY6 A;  5CGK A;  2Y0S E;  4JI2 Q;  1XNR Q;  4A3K H;  3F2U A;  2MGS A;  2M00 A;  5ELC A;  3MEH A;  4IUR A;  2K1B A;  3RLN A;  1CKM A;  4DAY B;  3UDF A;  1XWE A;  2KCN A;  3MZ5 A;  1WI5 A;  3QB3 A;  5IOC A;  3J7A V;  2H4O A;  4JBM A;  1HXY D;  2N88 A;  1V1P B;  4DUY L;  2VQF L;  3L7Z C;  1N33 Q;  1EY6 A;  2A74 C;  2K14 A;  3PO2 H;  1SYG A;  3V05 A;  2B63 G;  3D4D A;  4JK1 C;  3S14 B;  4R8N A;  2QKI C;  3TQY A;  4LF7 Q;  1QJO A;  1WTV A;  4B08 A;  2L1B A;  1C8C A;  4GKK L;  4XYO A;  4KV6 A;  4B3M Q;  3H3V H;  1K9M C;  4CDE C;  2K5V A;  2FIN B;  1HR0 W;  1CHP D;  1A3U A;  1SJH D;  1AFP A;  1QE6 A;  2JXM B;  3HOY H;  3HOW G;  4BY1 H;  5AJ3 Q;  1HNX Q;  5ELB A;  1XMQ L;  1GUT A;  4HCE A;  5M5Y H;  2M2L A;  3S2H B;  2DJF C;  1HQM C;  3GTJ B;  1LO5 D;  3R3O A;  3U4V A;  1Q12 A;  2SDF A;  2Z6K A;  3BDC A;  3NEL A;  1EIY B;  1PTO B;  4X64 Q;  3CD6 A;  5LHY 1;  3GDE A;  3OOC A;  4IUU A;  3URY A;  4DR2 Q;  4RCO A;  5FLX L;  4FXG C;  3GQB A;  1KDA A;  4IJL A;  4A4I A;  2XRQ D;  3M3Y H;  4CJ0 B;  5C3X A;  1N36 Q;  2F0P A;  2D0O A;  3MFY A;  1YJ9 A;  1A15 A;  3ZYY X;  4DV1 L;  5CV4 A;  3AFP A;  1DOL A;  2KHS A;  5IP7 H;  1A3T A;  4FXD A;  2QA4 A;  1EY7 A;  3PUY A;  1BKB A;  1QZG A;  5JEA H;  4DR1 Q;  5CR3 A;  4GNX C;  3OW2 A;  1I50 B;  2KCM A;  4ILW A;  1I4Q A;  2EXZ A;  3TP5 A;  2R93 B;  2G9H D;  2ICI A;  3VR3 A;  1JE4 A;  2A1A A;  4F8M A;  3SE0 A;  1RF2 D;  2EE1 A;  1FJG L;  1STE A;  4UY8 C;  1VQN A;  2BH2 A;  1ZXT A;  3E0E A;  1PLF A;  1HFG A;  2IT1 A;  3S14 H;  3ITP A;  1ASZ A;  1Y1V H;  3DHQ A;  1QB5 D;  3D3R A;  5G3L F;  3KF8 B;  3I72 A;  3OSO A;  4A3C H;  2LY7 A;  1EY5 A;  2E2H B;  3HOW B;  1VCI A;  2FXQ A;  2AQ2 B;  4CGY B;  1V8Q A;  4JI4 L;  1FYC A;  3DEP A;  4A3B B;  4OXP A;  4IFD H;  5KYL A;  2V1C C;  4HAE A;  1F9R A;  2XRS D;  4ODG A;  4IOC A;  1FNU A;  4PNY A;  4HJ8 A;  2UXD Q;  4Q0F A;  1S5D D;  3GTJ H;  3CCV A;  3HOV G;  3HKZ G;  1HCZ A;  4P74 A;  2ZXR A;  3NTH A;  4A3I H;  3NQT A;  2QEJ C;  2HCC A;  3FPP A;  5C6A A;  1PTO H;  2F3V A;  3NHH A;  4DR5 Q;  2ASB A;  3A56 A;  1B70 B;  3LX0 A;  4HSV A;  3J81 L;  2JJQ A;  3K6O A;  1AZP A;  5FLX c;  3SK8 A;  2L15 A;  1PZJ D;  1R9T B;  4TKO B;  4NXN L;  4YHH Q;  3W1G A;  4DUY Q;  4WJ3 M;  2DNC A;  4TVA B;  2VQF Q;  4U67 3;  1IHZ A;  2UUB L;  2JP1 A;  3S16 B;  1JT8 A;  4JI8 Q;  4LFB Q;  5FO9 B;  1I3Q B;  1MIU A;  5CYU A;  4DR7 L;  1OO9 B;  1HZB A;  4DV5 L;  1XXG A;  4BBS G;  2KQ3 A;  1EY0 A;  1QUQ B;  3RMH A;  1VQL A;  3BDL A;  2L55 A;  4GKK Q;  2X6G A;  3N6R A;  3AMU A;  1FD7 D;  1I50 H;  3HRZ C;  2R7F A;  3OPO A;  2QCP X;  1C7Y A;  2R7D A;  2CWA A;  4HJA A;  1VF5 C;  1N32 L;  1EU3 A;  2B63 H;  2PW7 A;  5I4D A;  4L63 B;  3V2T A;  1D1K A;  2K04 A;  1XMQ Q;  2ZXP A;  2EYM A;  2J7Z A;  4DR3 Q;  2XIW A;  1B53 A;  1J5E L;  3EBE A;  4HTH A;  1ZYR D;  2BE5 C;  1HUN A;  1LYL A;  1OTC A;  3J7Y W;  4GLA C;  5M9O A;  5IYB G;  4JCV E;  2E2H H;  3HOW H;  3SK5 A;  2F0T A;  2D9U A;  5JOB A;  4CDD C;  1U0L A;  4A76 A;  4FVM A;  3I55 A;  5C3E G;  2EY1 A;  4GN4 B;  1W2B A;  2PMZ E;  2HT1 A;  2CWP A;  1JIC A;  1YI2 A;  4I7Z C;  3HOV B;  3HKZ B;  4ZUI A;  1YNJ C;  2WKD A;  3VYR A;  3BU2 A;  1K8A C;  3S1Q B;  4OEM B;  5FJ8 G;  5JPM C;  3J81 i;  5C0X J;  4ZUJ A;  1K0R A;  2EYH A;  3E9H A;  2F0K A;  1N9W A;  2O5J C;  2OWO A;  1S5E D;  2RCN A;  4JI6 L;  1L2F A;  1RCV D;  1B3A A;  3DM3 A;  1D1I A;  3NP8 A;  4HED A;  3FKI G;  4R4C A;  3WOF A;  1O78 A;  1R9T H;  1CHQ D;  4NP5 A;  1D5Z C;  1LTI D;  3CU7 A;  4WJ4 A;  1MJE A;  2B8F A;  4B3R Q;  1IZ6 A;  4OIJ A;  1JB7 A;  1U4L A;  2WAQ G;  1FJG Q;  4MTK A;  4N9P A;  1GOZ A;  1TXY A;  3QWN A;  3W3A A;  1I3Q H;  4M8A A;  1UE5 A;  1SYF A;  4LF5 Q;  1DM0 B;  1X54 A;  2TSS A;  3H3V C;  2MFI A;  5BR8 L;  3T56 B;  4DA2 A;  5IWA Q;  3P20 A;  4JI3 Q;  5CV8 A;  1L1O A;  4JI4 Q;  3I91 A;  5GQO A;  2OT2 A;  1WD0 A;  2QW7 A;  4QIW B;  2IHE A;  1P16 A;  4APV A;  3E5S A;  4DNR B;  2LXJ A;  2NYZ D;  1HZA A;  1SE8 A;  4ZRZ A;  3DEO A;  3S1N B;  3GTQ B;  1BDO A;  4LFA Q;  4C3I G;  2E2D C;  1EWI A;  3KOJ A;  3A8I E;  2NN6 I;  5C3E B;  2EZV A;  2N3S A;  4L6T B;  5L37 A;  3T1H L;  4H02 A;  2EDG A;  4CKB A;  4ABN A;  1JOR A;  2SNM A;  4FYD A;  2NVX H;  2JA8 G;  2SNS A;  5DNF A;  3MFG A;  1EIF A;  2M9V A;  4TSS A;  1VQ9 A;  1KAB A;  4B3S L;  1FNW A;  4NXN Q;  3HOV H;  1EY4 A;  1DYQ A;  3KK7 A;  3DXJ C;  4ZQ3 A;  1F2Y A;  2ZXO A;  3Q23 A;  2JN4 A;  4LWC A;  2B2T A;  2EY2 A;  4LFC L;  1R4P B;  1VQG A;  5KIX A;  5BN3 A;  2UUB Q;  3S1Q H;  1HA6 A;  1X56 A;  4LUV A;  3DWQ A;  4P2C B;  4DN4 M;  1LTG D;  2KBN A;  1BCP F;  1Q86 C;  1F2Z A;  1Y69 U;  3FKI B;  4HJ5 A;  4FF3 A;  1JOQ A;  1CUK A;  3DM1 A;  1JQY D;  4I65 A;  1JJC B;  5C5L A;  1N8R C;  3F2C A;  1VQK A;  1VQF A;  1PV4 A;  2UXB L;  2WAQ B;  4DUZ L;  4A3L G;  2KEC A;  3P75 A;  3BYT B;  3OHX C;  3OIP A;  3AFQ A;  5JPN C;  1KRS A;  4O1N A;  5EBC A;  3STB C;  1LTL A;  4BBS H;  3D6W A;  3CPW A;  4HN7 A;  5KNB A;  5A2Q E;  5KNC A;  3MHB A;  1GO3 E;  2QEX A;  4R1J A;  4PMB A;  5KND A;  1IL2 A;  3ND9 A;  1PH6 A;  1VQE A;  1UE7 A;  3A5Z B;  4BS9 A;  2JA7 G;  2I07 B;  3KLR A;  2ZTC A;  1LM0 A;  2WKC A;  2Q2H A;  2WAC A;  1M90 C;  3D0F A;  4NXM L;  4C3I B;  1L0Y B;  3FPU B;  1V1O A;  3F8T A;  4KKU A;  1STB A;  3KJO A;  2MP1 A;  5IYB H;  5KGU A;  3D4W A;  4JYA L;  1SNQ A;  5T1G A;  1OXS C;  4NPS A;  5M5X H;  4G7H C;  2JA8 B;  5C3E H;  3H09 A;  1PTO C;  2ZTD A;  2SEB D;  1YHB A;  1WTP A;  3A7A B;  3VR5 A;  3LWE A;  5I9O A;  2BOS A;  1A0I A;  4JI6 Q;  1FL0 A;  3HG9 A;  1KL9 A;  3CXC A;  1VQ5 A;  1XNR L;  3UE0 A;  3TBI B;  1X3P A;  3UDX A;  1IBM Q;  1UNS A;  5FJ8 H;  4H13 C;  4KKS A;  4LF6 Q;  3K0X A;  4F7X A;  1XNQ Q;  5FLX E;  4FF1 A;  1B7Y B;  2F0M A;  3RZD B;  1ICF B;  5C4Z A;  2Q2I A;  3J7A F;  1CI3 M;  3SK4 A;  3U9O A;  2NVT B;  2E2J B;  1IXR A;  3FKI H;  4XT3 B;  1Y1W G;  4C3H G;  3CCJ A;  2A68 D;  1DD2 A;  1PA6 A;  3CRL C;  4IOA A;  5BR8 Q;  1N33 L;  2EYF A;  4JPB W;  5FK9 C;  2MPM A;  2NWG A;  4V19 0;  4DNI A;  1LUZ A;  1WJJ A;  2BH8 A;  4LF7 L;  1C0A A;  1SFO B;  2Z9H A;  3C3L A;  1V43 A;  4B3M L;  3I90 A;  1SMY C;  4BBR G;  2B2U C;  4KN7 C;  4IUQ A;  4P71 A;  5CV6 A;  3R2I A;  1ENF A;  4A3J G;  4ID6 A;  2E2I H;  1SND A;  1EQR A;  1S5F D;  1K83 B;  1JWU D;  1WYD A;  4QY7 A;  2JA7 B;  4KTA A;  2NUC A;  2FMM A;  1PYS B;  4ULL A;  3ULP A;  4GNX A;  1YNX A;  3VA7 A;  3I7F A;  4C1N K;  5CV5 A;  4B3S Q;  4IPC A;  3L9A X;  4WJW A;  2OCE A;  2KA7 A;  4I7A A;  4C3I H;  4CHT B;  4YY3 L;  1BCP B;  4HIM A;  4DR2 L;  4ALP A;  2BDO A;  4LFC Q;  3BG3 A;  2ATW A;  3HP3 A;  3KYH C;  2GVA A;  1ONL A;  4JG2 A;  2OTL A;  4YWL A;  3KJP A;  4AYB G;  1A8V A;  1O80 A;  3OWF A;  4U68 A;  1N36 L;  2JA8 H;  4GZY C;  1EYD A;  4H7B A;  5I2Y A;  3PIO A;  1BBU A;  3AYH B;  3EQL C;  3ONA B;  3PO2 B;  2D2C C;  2K5N A;  1LT4 D;  5HGT A;  1IKM A;  4FXK C;  3H0G G;  1X55 A;  4PMC A;  4N8X 1;  3ERS X;  4DR1 L;  4C1N I;  4GOP A;  3RZD H;  4F87 A;  2HUG A;  1Y1W B;  3QJY A;  4C3H B;  2RVL A;  3ERO A;  5KRU A;  2NVT H;  4RGM A;  1CA5 A;  2E2J H;  5K36 G;  2QF7 A;  4BY1 B;  2EY6 A;  1QZH A;  2K52 A;  2MNA A;  5M5Y B;  4DV0 L;  4A3L H;  1EIH A;  1S72 A;  5JVG 3;  4GLV B;  2RDF A;  4X66 Q;  4QQB X;  3BZD B;  1KIX A;  1EZ6 A;  5GRO A;  2RDG A;  2A5H A;  4KKT A;  1Q8K A;  4BBR B;  1SFO H;  2HHH Q;  4LK1 C;  3U58 A;  2N78 A;  1E0B A;  3X3M A;  2VW9 A;  2JEA I;  1TS4 A;  2F0J A;  4A3J B;  2E8G A;  4HIK A;  4BWG B;  3CCL A;  4UAI A;  3VA5 A;  5ELN A;  5LMU Q;  4JYA Q;  1G8Z D;  2RCF A;  5NUC A;  1K83 H;  1AW7 A;  2NN6 G;  3BYY B;  4QMG A;  4DNT B;  1HQR D;  4QUF A;  4DR4 Q;  1EL0 A;  1TWC B;  1UE1 A;  3GV3 A;  5CMD A;  2JA7 H;  2R61 A;  2G5D A;  4KY7 A;  2VB2 X;  2UXD L;  2A19 A;  2PQA A;  5C4X G;  1R4Q B;  3OIQ A;  3FRP B;  1WD1 A;  4IUN A;  5IYC H;  3KDF A;  4DV7 Q;  3RNU A;  2HIV A;  4DR5 L;  2FMC A;  1ILQ A;  2MHV A;  3J80 c;  4AYB B;  3GTK B;  4G4K A;  4MTN A;  3R2T A;  3NXW A;  3NE5 B;  3NTK A;  2F0O A;  2R7Z G;  4YHH L;  5LL6 S;  3RLF A;  5A2Q L;  1H95 A;  3A55 A;  2YU9 H;  3HFZ B;  1IW7 C;  4OX9 Q;  1HZ9 A;  4CBV A;  5J39 A;  4RWS C;  2L11 A;  4CJ2 C;  1CQF A;  1W3S A;  3NPP A;  3KF6 B;  3MEF A;  4YIJ A;  4JI8 L;  3B6Y A;  4LFB L;  4NDX A;  1L0W A;  5FOB B;  4QCL A;  4CDC C;  1Y1V B;  2EVB A;  3Q24 A;  2B2Y A;  4V0B A;  1I6V C;  3HEJ A;  3IAY A;  1GHJ A;  2XTI A;  1CSP A;  1RDP D;  2AHO B;  2KUM A;  1K8M A;  3MA2 B;  5I9P A;  3PIP A;  1Y1W H;  4C3H H;  2OTJ A;  4IUP A;  4OHJ A;  3JC6 6;  3ND8 A;  4A93 G;  2HD3 A;  3MTS A;  2XNA C;  1X65 A;  2WB1 E;  4A3D G;  1STA A;  2PCF B;  5IP9 G;  4DR3 L;  3EFX D;  4HIO A;  1EOV A;  4MZ9 A;  1TKW B;  1KXL A;  1W6K A;  2JA5 G;  3CCE A;  4BBR H;  1STH A;  3NUC A;  1HPC A;  1J9O A;  1UWV A;  1WCM G;  4A3I B;  3PO3 G;  1ML0 D;  3JAM c;  3T51 B;  2XN9 C;  4A3J H;  4DGZ A;  1XPU A;  5J22 A;  4YY3 Q;  5IE8 A;  1YNN D;  4ZKC B;  1SNC A;  2EIF A;  1O7Y A;  4DXF A;  1CA6 A;  4JI1 L;  5C4X B;  1TWC H;  3Q6S A;  2WP8 J;  1WTX A;  2DY7 A;  2B29 A;  4HR7 B;  4O42 A;  1TQO A;  1YIT A;  1NR2 A;  3BVM A;  2C5C A;  5EAY A;  2RBM A;  2NTT A;  1K3R A;  3A5U A;  1DOM A;  4EX5 A;  1KNE A;  1II3 A;  3DMU A;  3I8Z A;  3G6E A;  4IPG A;  5FO7 B;  2R7Z B;  3GTK H;  3D8G A;  3NK9 A;  4IAL A;  4NMZ A;  4LF4 L;  5JEA J;  1U4R A;  4NKL A;  4TRD A;  1SYD A;  1GVP A;  1KLU D;  2B63 B;  4B3R L;  3HOX G;  1SR3 A;  4OEL B;  3KBX A;  4JBK A;  4DV0 Q;  3VYT A;  3H0G H;  2N55 A;  4CKC A;  1HZC A;  1OXV A;  3TZU A;  2H5X A;  1X3G A;  3NEM A;  3A0J A;  3G4S A;  5CV7 A;  1B8A A;  2LXK A;  4LF5 L;  4XQQ A;  3VR4 A;  4K14 A;  4X65 Q;  1CM9 A;  5K36 H;  4A93 B;  1H9S B;  1PFB A;  5IWA L;  3DLL A;  2B2V C;  1NE3 A;  4JI3 L;  4A3D B;  2A69 C;  2Y0S G;  5D3I B;  1U5K A;  1HHV A;  1EEF D;  1X32 A;  4DV6 L;  2B8G A;  3HGB A;  4R9W A;  1Z7T A;  1VQ8 A;  4DAP A;  2JA5 B;  1P8L A;  3MC0 B;  1YJW A;  1HR0 Q;  4IFD J;  4LUO A;  3H94 A;  4R4T A;  4DAY A;  5DM6 3;  2O4X A;  3PO3 B;  4RMF A;  2F0N A;  5M3F G;  1AE2 A;  4LFA L;  4KLK A;  2LFN A;  3FVQ A;  2Q2U A;  3GO5 A;  1V1P A;  1SJE D;  1UE6 A;  3MWY W;  1YJN A;  1SMX A;  2NN6 H;  2V4D A;  4XIG S;  3WDN A;  1MSH A;  4IUT A;  2VY3 A;  2NVY B;  4A3F G;  3NQI A;  5C4X H;  2IY5 B;  3FDT A;  2B2W C;  4HJ7 A;  1PRT D;  3F2D A;  4G57 A;  3CCR A;  3UDG A;  4LW1 A;  2NZ1 D;  1B9M A;  1HRJ A;  4HID A;  3LGJ A;  2EYL A;  4BA1 I;  4JVZ A;  2Q8T A;  1QWY A;  5ELE A;  2ES2 A;  1CFM A;  3K5M A;  2F0D A;  2K50 A;  4DFA A;  3OMC A;  5DM7 3;  1F77 A;  1VQJ A;  2R7Z H;  2CH4 A;  1XJV A;  2PI2 E;  1WVL A;  1NNX A;  4YCU A;  5DEH A;  2XVS A;  3NBI A;  3OW7 A;  2XGT A;  2ALY B;  3HOX B;  3GTL B;  1EYG A;  4MHE A;  5GAD C;  2CW0 C;  4XTC S;  4X6A H;  1PDQ A;  5J1Z A;  3E9I A;  2UUA Q;  1S5B D;  5EKL A;  5E7N A;  2Z4H A;  1V1Q A;  2K32 A;  3I2Z A;  5ISR A;  4PMW A;  5GAG C;  5JVH 3;  2AUK A;  4RFB A;  4N9T A;  3TDQ A;  1KQS A;  2Y0S B;  2UUC Q;  3D4R A;  4A93 H;  1Q81 C;  2DJG C;  3VYS A;  1G2S A;  4A3D H;  2J0T D;  3CAM A;  2F4I A;  2Z6B A;  1UEA B;  3MVV A;  3RLO A;  5IP9 H;  2NZH A;  2NVX B;  2KOL A;  2YTY A;  2CQA A;  4GKJ Q;  1KTK A;  5EKI A;  4B9X A;  1EQT A;  2EYO A;  4JI1 Q;  3UE1 A;  2JA5 H;  3K7U C;  1ZKO A;  1AP0 A;  1B3Q A;  1WCM H;  1PZK D;  3PO3 H;  2IL8 A;  1LT5 D;  3BVG A;  2RQX A;  5IT9 L;  3K8A A;  4AQY L;  2PO4 A;  2MUY A;  4KI0 A;  3EN2 A;  3L3O C;  2RSN A;  2JA9 A;  4A3F B;  2IJ0 A;  1BCP C;  1JJ2 A;  3MXN A;  2B2U A;  2HDL A;  4LF4 Q;  2PPB C;  1K8O A;  1J6Q A;  2NVY H;  1F9S A;  4J8Q A;  4DU9 A;  3M85 A;  1IBM L;  4RKL A;  2ZT9 C;  2K5Q A;  3J80 E;  4LF6 L;  1EZ8 A;  3S24 A;  1XNQ L;  1H9K A;  2E5L Q;  2OEO A;  1TWF H;  1JC7 A;  1ESF A;  1SE3 A;  2L12 A;  4BBS B;  3CPF A;  4A75 A;  1ROD A;  1BF4 A;  1MSG A;  1E1O A;  4P75 A;  1F9P A;  2P5Z X;  4AIM A;  1VS0 A;  1M4V A;  3VYU A;  4JC0 A;  4QGU A;  1VDZ A;  4IN3 A;  4BY7 G;  2Z6K C;  4G7O C;  3KLS X;  4POG A;  1RTN A;  3AU7 A;  2C35 B;  1TWA B;  2FJ2 A;  3HOX H;  3GTL H;  1GHK A;  1SNP A;  5IGE A;  3WOE A;  5C5M A;  4ZCK A;  4DV6 Q;  1JOO A;  2VQE Q;  3I56 A;  1KDC A;  1PFS A;  2RKS A;  1VQ6 A;  3S17 H;  3CP0 A;  1KC8 C;  4DR6 Q;  1I4R A;  1NY4 A;  2Q8I B;  2CCZ A;  2R92 G;  3K58 A;  3TRE A;  4JI7 L;  2K5H A;  5DLQ E;  5M5X B;  4IPD A;  2JYO A;  1MBY A;  1K73 C;  1SBB B;  2PNH A;  4N8F A;  2F0F A;  5EJW A;  3HKS A;  1PYW D;  1KLG D;  4X3T A;  5I6W A;  3JAM E;  1ET6 A;  4IZ8 A;  1SRU A;  5M3F H;  1Q90 A;  4UP9 A;  5I2X A;  3PSI A;  5M3M G;  1PH7 A;  1O7I A;  3TZD A;  5IT9 c;  3CRK C;  1EUJ A;  4ZKB B;  5IGB A;  3GP7 A;  2K6A A;  3SK6 A;  4A3F H;  3CQZ H;  3I73 A;  4CJ1 B;  2VZA A;  3H15 A;  1PXU A;  1QOH A;  1STY A;  1JJG A;  1XX8 A;  3IKJ A;  4DAV A;  5GAE C;  5D3D A;  4Y52 H;  3P7J A;  3CC7 A;  5ELF A;  4B3T Q;  4GLX A;  4BY7 B;  1E2Z A;  1OXU A;  3SGI A;  2E2I B;  1S3O A;  3GV6 A;  2Q8R E;  4KJN A;  4OGQ C;  3RUZ A;  1XTC D;  3TS2 A;  2L5T A;  3PQI A;  1GUG A;  3T16 A;  4Y7N B;  1MI2 A;  1Q1E A;  1TWA H;  4X66 L;  1YVC A;  2GVB A;  1GUS A;  4HJ9 A;  1GM5 A;  1Q1B A;  2IWH A;  1XPO A;  3S2D H;  4C56 C;  1S40 A;  3KFU A;  4RAU C;  2HHH L;  1W6J A;  1H9J A;  1Z9F A;  2ZM6 Q;  2CQO A;  3T1Y Q;  3NEN A;  1BOS A;  4EQO A;  1D5M C;  1FGB D;  2EOT A;  2JEB I;  3A54 A;  5EGT A;  4C2M B;  5IYC G;  3FHW A;  2CFM A;  3WWV A;  4GOP B;  3J7A 5;  5LMU L;  1TVX A;  4KK7 A;  2Z0S A;  2F0L A;  3K81 C;  4DR4 L;  2ZJQ A;  4AQY Q;  3S1M B;  2QDL A;  3TP8 A;  2F52 A;  1TII D;  5CC4 A;  4RCN A;  5C0X I;  3Q0A A;  4OWX B;  5JAV A;  3NBH A;  5E3F A;  1JMC A;  1I6H B;  4X62 Q;  4DV7 L;  2CKZ B;  2XWJ B;  5M3M B;  4JI0 L;  1E22 A;  4XXE A;  2KJX A;  4DV2 L;  1H9R A;  2N49 A;  2AQ1 B;  2GN5 A;  1QCB D;  1RTO A;  1CK1 A;  1X3F A;  1G91 A;  4DK3 C;  1Y8N B;  3C46 A;  2RSO A;  4QJF A;  4OX9 L;  2VUM G;  1QG7 A;  1EWH A;  1MKH A;  5IGC A;  1F2L A;  1M8A A;  1NCV A;  1YNJ D;  2F0E A;  3S1R B;  3UDI A;  5JJK A;  4K2L A;  1TWG H;  1EFI D;  4PV1 C;  3DWP A;  4DXG A;  4HCS A;  2C9O A;  3QOJ A;  1X3Q A;  1EU4 A;  2K03 A;  4K5X A;  4WRD A;  3RZO B;  2XSC A;  3G7L A;  4DF7 A;  3TP6 A;  3V96 A;  3F1Z A;  1VQM A;  4DV3 Q;  4BY7 H;  2FHT A;  4JI7 Q;  2R3Z A;  1VQO A;  2MO1 A;  2J4X A;  3BVZ A;  4XDX A;  1PH4 A;  3CC4 A;  4K5W A;  1EYC A;  3T4A C;  4Y7N H;  4J15 A;  2KVM A;  4LUZ A;  1SE4 A;  1HNW L;  2ENB A;  5LMN W;  1NR4 A;  2NZO A;  1WFQ A;  1TY2 A;  2R92 H;  1BQQ T;  1GUN A;  1HTP A;  1VMC A;  1VMP A;  3J80 L;  1K3B C;  4C2M H;  1NBW A;  4MIU A;  5IIF A;  5EKK A;  4E6I A;  1Q7Y C;  2I5L X;  3ICE A;  4K8I A;  1DOK A;  1EFW A;  1PFM A;  1CSQ A;  2YU9 B;  3S1M H;  3QIA A;  1U4M A;  1XMO Q;  4OO1 I;  1VQH A;  2K01 A;  1BBW A;  2BDN A;  5DAU A;  3CCM A;  4GN3 B;  4K0K Q;  1X3E A;  2B2V A;  1I6H H;  5M3M H;  2A8V A;  3KLW A;  2O5I C;  3R8B A;  2EJM A;  1AN8 A;  2Z1C A;  3X3N A;  2QGQ A;  2VUM B;  4C3J G;  4LJZ C;  2HCI A;  3QO2 A;  3C2P A;  3G48 A;  5COR A;  3LWU A;  1T5X D;  2A73 B;  2TMP A;  1HNZ Q;  4LAA A;  1N34 Q;  3S1R H;  1F9Q A;  3I4O A;  2PI2 A;  1DJR D;  2DNE A;  3BS1 A;  1BBX C;  4A3G G;  3AEV A;  2VNU D;  1G29 1;  1UAP A;  3L2P A;  4FNF A;  4YWM A;  3RZO H;  1LAC A;  4X65 L;  1F2M A;  4IJH A;  3JAM L;  2A6H D;  2B2W A;  1IBK Q;  2EYJ A;  2F0W A;  1I4X A;  2UU9 Q;  2E74 C;  4LF8 L;  2B2T C;  3DWA A;  4XYQ A;  2UXC Q;  4JI5 Q;  3I70 A;  4RGO S;  2LSS A;  4KHP L;  4RH6 A;  1HR0 L;  2IX1 A;  1LTA D;  4MN3 A;  3STB D;  3J80 i;  2A6E D;  1PMR A;  1TY0 A;  1DXM A;  1SRO A;  3HOU G;  1HFN A;  1C48 A;  4JI0 Q;  1E2W A;  3CCQ A;  1E2V A;  4ZK9 B;  4DK0 A;  2RDH A;  4X3S A;  4DV2 Q;  1XPR A;  4KHV A;  4MNO A;  1JWS D;  2L4N A;  1X6O A;  2RHS B;  3K7A B;  4XQN A;  4R4O A;  4WFN 3;  2HDM A;  3K5L A;  1JWM D;  3Q22 A;  4RA8 A;  1D5X C;  1YHA A;  2K5W A;  2L9H A;  2K7V A;  5C44 G;  5KEE A;  3KLS A;  2PW5 A;  1PFN A;  1CKO A;  2F0I A;  1Q82 C;  3SR1 A;  3H0G B;  5IT9 E;  3VR6 A;  4R4Q A;  4PZ6 A;  1A62 A;  1BUV T;  4IQZ A;  1ZYR C;  1AZQ A;  2KEN A;  2BCO A;  2NVQ B;  4C3J B;  1PTO D;  1VQI A;  3HKZ E;  2JE6 I;  4P73 A;  2PZU A;  2VUM H;  4IO9 A;  4WOR A;  1LTS D;  2R93 G;  3S15 B;  2Z4I A;  1DON A;  1SDF A;  1WOC A;  3G71 A;  4A3G B;  1RL2 A;  2UUA L;  1I94 Q;  1LTB D;  1MJC A;  3JAM i;  3M9B A;  4AH6 A;  2VL6 A;  3SDZ A;  5IYD G;  1PH5 A;  4XQJ A;  1IBL Q;  1HNW Q;  5C4H A;  1CZW A;  5IGD A;  5T1I A;  2UUC L;  3K57 A;  3MXP A;  5EPK A;  3U50 C;  3GD7 A;  2PNR C;  4K8J A;  1A3V A;  1Q8I A;  2IX0 A;  1LTT D;  2I46 A;  2RA4 A;  3RN2 A;  4A3B G;  2DN8 A;  4GKJ L;  3AB9 A;  4K6D A;  1PH1 A;  1D2B A;  3RD4 A;  3E3X A;  3S9W A;  3EVQ A;  2OQK A;  5C0X G;  1PRT F;  2DY8 A;  4OL7 A;  1SMY D;  3PIO 3;  3HOU B;  3I4N G;  1VQ7 A;  1TR5 A;  3EA6 A;  3F2B A;  1EEI D;  1QVG A;  1ZEQ X;  1HH2 P;  3PMF A;  1TWH B;  1EQQ A;  2R6G A;  1FR3 A;  4JW0 A;  3ZJY C;  4QIW E;  2F3W A;  2OF1 A;  2BA1 A;  2ID0 A;  3RR5 A;  3K7A H;  1Z47 A;  3FEW X;  5C44 B;  5JJL A;  2N8N A;  4BA2 I;  3Q8D A;  5IGG A;  3I4M G;  2E5L L;  1LLR D;  1AE3 A;  2F0U A;  4KHZ A;  5C3W A;  5I6Y A;  3VDY A;  1Y8P B;  1CKN A;  2B3G A;  2K75 A;  4DK1 A;  1B44 D;  4LMQ D;  3VR2 A;  3DUZ A;  2NVQ H;  4C3J H;  1U9R A;  2F4V L;  4ZAI A;  3P1H A;  1XTD A;  3TRZ A;  3U9S A;  4LF8 Q;  3E0J A;  3S15 H;  3MXN B;  3ERQ A;  2HQL A;  3LNN A;  2VQE L;  4A3G H;  4UHV A;  4R8I A;  3IFT A;  3C1F A;  3TN2 A;  2CH4 W;  4KHP Q;  1SN8 A;  1SLJ A;  5C4J B;  1SAP A;  1TS5 A;  3SXH A;  4FO2 A;  1RKN A;  1WCM B;  3TS0 A;  4DR6 L;  1QNU A;  4F88 A;  2WAQ E;  2VS1 A;  1IYV A;  4X3K A;  1EOT A;  1QVC A;  3K5N A;  1KD1 C;  2EJG C;  3ER0 A;  1D6E C;  4GOP C;  3KF6 A;  2ZJP A;  1I4P A;  2WV6 D;  2CVR A;  3S2H H;  4CKE A;  5E4X A;  1YIJ A;  1L1O B;  3I4N B;  3BZC A;  1RHP A;  2AKW B;  4RG1 A;  3CF5 A;  4OO1 G;  1X9N A;  4ME3 A;  3HOU H;  1TWF B;  2IHF A;  2KEE A;  2F1M A;  4DV4 L;  2AUJ D;  4OON A;  2KCT A;  2YYZ A;  1SNO A;  1AH9 A;  1PH9 A;  4A3M G;  1TWH H;  2WB1 G;  2K33 A;  4OWW B;  2D5D A;  3BJU A;  4XT1 B;  1QVF A;  3I4M B;  3PIP 3;  1E24 A;  5C44 H;  2I5H A;  4J6H A;  1K0S A;  1YHQ A;  1CT1 D;  2ZTE A;  4L5R C;  4JOI C;  1UEB A;  3W1B A;  1FGU A;  4UP8 A;  3H3V I;  3S17 B;  3PF4 A;  2BA0 A;  4EGV A;  4B3T L;  1LT6 D;  3H6M A;  5EPL A;  1K28 A;  2AWN A;  1Q3L A;  2K5D A;  1PH2 A;  2F0Q A;  3AQQ A;  2R93 H;  1IW7 D;  1EIG A;  2IX3 A;  1MGS A;  4KN4 C;  4FP5 D;  3PV0 A;  1ICW A;  4RGT A;  1PRT B;  1CQV A;  3HS0 C;  5ELD A;  3TP7 A;  3J81 j;  2ZM6 L;  4BXX G;  5IYD H;  3W5O A;  3G6J B;  3T1Y L;  2EJF C;  2ICE C;  5M3F B;  5C4J H;  2H1E A;  5G3L D;  4A3E G;  1C9O A;  2NBF A;  1GUW A;  1JR0 D;  4ZLT F;  4JV5 L;  2K05 A;  3N52 A;  4Q5V A;  1J8I A;  3SVM A;  3GTM B;  3U4Z A;  3EJI A;  3BZK A;  5FLM G;  3HZX A;  4K5V A;  4A3B H;  2SOB A;  2YTX A;  2B2Y C;  2HQE A;  3CQZ B;  5D65 A;  1GUO A;  3EIV A;  3FP9 A;  3QOL A;  4QL5 A;  2A68 C;  5CBE E;  4KD4 A;  3C1E A;  5GAH C;  1XYI A;  4DV1 Q;  4X62 L;  5C0X H;  3M4Y A;  4L5T A;  2OQ0 A;  3I4N H;  3HOZ G;  3K0Y A;  3OWE B;  1UUP A;  3KF8 A;  2I5M X;  2DUD A;  1MD2 D;  2L0C A;  1C4Q A;  4A3M B;  1JCK B;  1H9S A;  2WB1 B;  1ASY A;  1PZI D;  1CZG A;  5E4W C;  4YCW A;  4LF9 L;  1SYE A;  1B1Z A;  3QR8 A;  2OXP A;  4YCV A;  1G51 A;  3J81 c;  3OTO L;  1RIP A;  1YZ6 A;  1DGS A;  3PGZ A;  3M7N A;  1VQP A;  5H1S E;  2F4V Q;  1BXT A;  2EYP A;  3M4Q A;  1V9P A;  1LT3 D;  2LMC B;  3I4M H;  1A2U A;  1K8G A;  2JA6 G;  1WTO A;  3NWT A;  3S2D B;  2EPB A;  4DAM A;  1VQ4 A;  2KCC A;  1KDB A;  3T13 A;  3S16 H;  2GA4 B;  1SNM A;  3D31 A;  1ESR A;  3NBH B;  4P72 A;  4OWT B;  3O13 A;  3I3C A;  4YWK A;  1NMF A;  1Z6H A;  4RHS A;  2JK8 A;  1FVI A;  1WTQ A;  2ZJR A;  1B50 A;  3PUZ A;  4DV3 L;  1PH3 A;  1PYB A;  3MXU A;  5AFW A;  4GN5 A;  1SSO A;  2IW3 A;  4KY5 A;  3CC2 A;  1E1T A;  4IFD I;  1DCZ A;  4UPA A;  3M4O B;  4FF2 A;  3IFD A;  2HIX A;  5EQ0 A;  2XWB B;  5D14 A;  2AQ3 B;  3A8K E;  5EBD A;  5M5W B;  4O0A A;  3PUW A;  4A3E B;  4GS3 A;  3W2D A;  1TU2 B;  4HMI A;  4JBW A;  1GD7 A;  1PVO A;  1QUQ A;  1WTR A;  1GXD C;  4M1U B;  2MQH A;  4TQU S;  1BVS A;  2VXW A;  4DV4 Q;  2KED A;  2A69 D;  1HA5 A;  2WFW A;  3GTM H;  1EYA A;  4R4I A;  1EY9 A;  5KYI A;  1HUM A;  1E3P A;  3PF5 A;  5JJZ A;  1OXX K;  2KHJ A;  4DKA C;  5FO8 B;  1XMO L;  2VB3 X;  2NB0 A;  1NJI C;  1S5C D;  4K0K L;  3GTP B;  3HOZ B;  4KMU C;  3SEB A;  4PZ8 A;  4OO1 H;  1TWG B;  4B9W A;  1D7Q A;  2AWO A;  3I4L A;  4GNX B;  1U4P A;  2F03 A;  4FF4 A;  4EVO A; 
#chains in the Genus database with same CATH homology
 4HJA A;  1UWV A;  3CCS A;  1WCM G;  1EFW A;  3S1M H;  1CSQ A;  1N32 L;  4A3M H;  2B63 H;  3PO3 G;  4DR7 Q;  3JAM c;  2K4K A;  1XMO Q;  4OO1 I;  1VQH A;  4A3J H;  4DV5 Q;  1XMQ Q;  1XPU A;  1BBW A;  1Y14 B;  3CCM A;  4K0K Q;  4GN3 B;  4DR3 Q;  4YY3 Q;  1X3E A;  5IE8 A;  1J5E L;  3EBE A;  1KHI A;  3PUV A;  4DK6 C;  1I6H H;  1PH8 A;  2EIF A;  5M3M H;  2A8V A;  1LYL A;  4JI1 L;  3KLW A;  1HNZ L;  1N34 L;  1OTC A;  1TWC H;  4GLA C;  2F3I A;  4AYB E;  2WP8 J;  1N32 Q;  4NB3 A;  2B29 A;  5IYB G;  2YTV A;  4JCV E;  2E2H H;  1YIT A;  3HOW H;  2RF4 A;  2QGQ A;  1IYJ B;  1U0L A;  1J5E Q;  4A76 A;  3K80 C;  5EAY A;  3I55 A;  5C3E G;  3G48 A;  5ELO A;  1K3R A;  1VQA A;  4GN4 B;  1W2B A;  2PMZ E;  2HT1 A;  2CWP A;  3A5U A;  1IBK L;  4EX5 A;  1HNZ Q;  1YI2 A;  1N34 Q;  2KHI A;  4IPG A;  3G6E A;  3S1R H;  2UU9 L;  3I4O A;  2PI2 A;  3J7A 5;  3GTK H;  4A3G G;  4JV5 Q;  2VNU D;  3AEV A;  3BU2 A;  1K8A C;  2AMC B;  1D8L A;  1G29 1;  4LF4 L;  2UXC L;  5FJ8 G;  2JQO A;  4JI5 L;  3L2P A;  3M4O H;  5JEA J;  3J81 i;  5C0X J;  4YWM A;  3RZO H;  1K0R A;  4X65 L;  4IJH A;  1GVP A;  4B3R L;  3E9H A;  1OXT A;  3HOX G;  1SR3 A;  5M5W H;  1IBK Q;  4BXX H;  1N9W A;  4JBK A;  2OWO A;  4DV0 Q;  4A3K G;  3H0G H;  2UU9 Q;  2RCN A;  1HZC A;  4A3E H;  1OXV A;  3CW2 C;  4JI6 L;  4IPH A;  1L2F A;  4LF8 L;  2H5X A;  3DM3 A;  1X3G A;  3S1N H;  3NEM A;  3GTQ H;  3FKI G;  4R4C A;  3A0J A;  2UXC Q;  4JI5 Q;  1R9T H;  2D62 A;  3G4S A;  1B8A A;  2LXK A;  4LF5 L;  4WJ4 A;  1MJE A;  2LSS A;  1YEZ A;  4KHP L;  1HR0 L;  5FLM H;  2IX1 A;  4X65 Q;  4B3R Q;  1IZ6 A;  5J3B A;  3STB D;  1JB7 A;  2WAQ G;  3PUX A;  5IWA L;  3J80 i;  3DLL A;  1NE3 A;  1TXY A;  5LMN L;  4JI3 L;  1FJG Q;  4LF9 Q;  2Y0S G;  3CME A;  1U5K A;  4JI2 L;  3OTO Q;  1I3Q H;  1SRO A;  3HOU G;  1E7Z A;  4DV6 L;  1UE5 A;  4JI0 Q;  1VQ8 A;  4LF5 Q;  1P8L A;  3GTP H;  3HOZ H;  3CCQ A;  1YJW A;  1HR0 Q;  4IFD J;  1NMG A;  4DV2 Q;  1X54 A;  4LUO A;  1XPR A;  2MFI A;  5BR8 L;  3PO2 G;  4R4T A;  4MNO A;  2Q2T A;  3J7Z C;  1X6O A;  2RHS B;  5IWA Q;  4RMF A;  4JI3 Q;  4R4O A;  4DPG A;  4O2D A;  2PQA B;  5M3F G;  1AE2 A;  1L1O A;  4JI4 Q;  4LFA L;  4KLK A;  1YHA A;  2Q2U A;  3GO5 A;  3KDF B;  3L0O A;  3GTG H;  5GQO A;  5C44 G;  1KAW A;  1CKO A;  1Q82 C;  1UE6 A;  1YJN A;  2IHE A;  1P16 A;  1YBY A;  4APV A;  1SMX A;  3HOY G;  4XIG S;  2LXJ A;  4R4Q A;  1HZA A;  1SE8 A;  4PZ6 A;  1A62 A;  4BY1 G;  2VY3 A;  2JA6 H;  2EQS A;  4A3F G;  2KEN A;  4LFA Q;  1I94 L;  3IRB A;  5C4X H;  2IY5 B;  1EWI A;  1VQI A;  3HKZ E;  3KOJ A;  4HJ7 A;  2NN6 I;  2JE6 I;  4P73 A;  1M1K C;  2N3S A;  3F2D A;  3CCR A;  3UDG A;  3T1H L;  2VUM H;  4IO9 A;  4H02 A;  4LW1 A;  1IBL L;  4HID A;  2R93 G;  1A63 A;  3LGJ A;  4JBJ A;  4BA1 I;  2NVX H;  2JA8 G;  4L5Q A;  2ES2 A;  2DGY A;  1WOC A;  1EIF A;  3G71 A;  1VQ9 A;  2K50 A;  1RL2 A;  4B3S L;  3TEH B;  2UUA L;  1I94 Q;  4NXN Q;  1MJC A;  3HOV H;  5AJ3 L;  3JAM i;  1VQJ A;  3M9B A;  1HNX L;  1XJV A;  4AH6 A;  2R7Z H;  2PI2 E;  2VL6 A;  4LWC A;  4YCU A;  4LFC L;  1VQG A;  2YV5 A;  5IYD G;  1PH5 A;  3T1H Q;  2XGT A;  2ALY B;  2UUB Q;  3S1Q H;  1IBL Q;  1HNW Q;  1X56 A;  4LUV A;  1EYG A;  5GAD C;  4XTC S;  2UUC L;  4X6A H;  4PG3 A;  3U50 C;  3GD7 A;  2KBN A;  1Q86 C;  3E9I A;  2RHQ B;  2UUA Q;  1GKH A;  4HJ5 A;  5E7N A;  1CUK A;  3CCU A;  2IX0 A;  1V1Q A;  1JJC B;  3I2Z A;  4X64 L;  1JE5 A;  5IP7 G;  3RN5 A;  3RN2 A;  1N8R C;  4A3B G;  1Q46 A;  3F2C A;  4GKJ L;  4PMW A;  1VQK A;  1L1O C;  1VQF A;  1VQD A;  5GAG C;  1PV4 A;  1PH1 A;  1VQC A;  2UXB L;  4DUZ L;  3M4P A;  1KQS A;  4A3L G;  1PHJ A;  2UUC Q;  2OQK A;  5JEA G;  5C0X G;  4A93 H;  1VQB A;  3AFQ A;  2MO0 A;  1KRS A;  1Q81 C;  1VQ7 A;  3I4N G;  4A3D H;  3CAM A;  3F2B A;  3STB C;  1LTL A;  1QVG A;  4BBS H;  3RLO A;  5IP9 H;  3CPW A;  4EQ5 A;  2NZH A;  2YTY A;  1HH2 P;  4GKJ Q;  3GTO H;  3A74 A;  4UP7 A;  3UE1 A;  4JI1 Q;  2R6G A;  1EQQ A;  4L5S A;  2JA5 H;  2UXB Q;  4DUZ Q;  1GO3 E;  3ZJY C;  4QIW E;  3K7U C;  2QEX A;  4R1J A;  1KRT A;  1WCM H;  2BA1 A;  1IL2 A;  2ID0 A;  3PO3 H;  3RR5 A;  1NTG A;  1Z47 A;  3K7A H;  1PH6 A;  1VQE A;  1UE7 A;  1Y1V G;  4POF A;  5JJL A;  3OYY A;  2N8N A;  3ULL A;  4QQB X;  3A5Z B;  4LNQ A;  3K8A A;  2JA7 G;  4BA2 I;  4A3C G;  3PCO B;  3Q8D A;  3I4M G;  2ZTC A;  2EXD A;  1LM0 A;  4AQY L;  2E5L L;  4KI0 A;  3EN2 A;  1AE3 A;  4KHZ A;  2JA9 A;  3VDY A;  2Q2H A;  3CMA A;  1M90 C;  1JJ2 A;  3D0F A;  4NXM L;  1CKN A;  2B3G A;  2K75 A;  3F8T A;  4LF4 Q;  3KJO A;  4IFD G;  5IYB H;  4PZ7 A;  1HJP A;  1J6Q A;  2NVY H;  3M85 A;  1IBM L;  4JYA L;  2NVQ H;  1OXS C;  4C3J H;  2D0P A;  4NPS A;  5M5X H;  4LF6 L;  2F4V L;  4FDB A;  3S24 A;  1XNQ L;  5C3E H;  2ZTD A;  2E5L Q;  1XTD A;  1YHB A;  1TWF H;  3TRZ A;  4JI6 Q;  1A0I A;  3CPF A;  1FL0 A;  4LF8 Q;  4NXM Q;  1KL9 A;  4A75 A;  3S15 H;  3CXC A;  1VQ5 A;  1CKN B;  1XNR L;  1G6P A;  4A3I G;  3MXN B;  3UE0 A;  1E1O A;  2HQL A;  4P75 A;  3UDX A;  4AIM A;  4A3G H;  2VQE L;  2I0Q A;  1VS0 A;  1IBM Q;  4JOI A;  5FJ8 H;  4JC0 A;  5IY0 A;  4QGU A;  1SN8 A;  1SLJ A;  4KHP Q;  5JJI A;  1I5F A;  4LF6 Q;  4BY7 G;  2Z6K C;  3K0X A;  4POG A;  3TS0 A;  1XNQ Q;  4DR6 L;  5LMN Q;  2C35 B;  1B7Y B;  3ULJ A;  1T9H A;  5HGQ A;  3HOX H;  3GTL H;  2WAQ E;  5HY6 A;  2VS1 A;  2Q2I A;  2Y0S E;  4JI2 Q;  1XNR Q;  4A3K H;  1QVC A;  4DV6 Q;  2VQE Q;  3I56 A;  1IXR A;  1PFS A;  3FKI H;  1Y1W G;  3CCJ A;  1KD1 C;  1PA6 A;  1VQ6 A;  3RLN A;  3CP0 A;  3ER0 A;  3S17 H;  4IOA A;  5BR8 Q;  1CKM A;  1KC8 C;  1N33 L;  4DR6 Q;  4GOP C;  4DAY B;  3KF6 A;  3UDF A;  2ZJP A;  1NY4 A;  2CCZ A;  2R92 G;  1WI5 A;  3S2H H;  4DNI A;  1LUZ A;  1L1O B;  1WJJ A;  2BH8 A;  3BZC A;  3TRE A;  2K5H A;  1YIJ A;  4JI7 L;  5DLQ E;  4LF7 L;  4IPD A;  2AKW B;  4RG1 A;  3CF5 A;  4JBM A;  1C0A A;  4OO1 G;  1X9N A;  4ME3 A;  1K73 C;  3HOU H;  2PNH A;  1V43 A;  4B3M L;  2IHF A;  4DV4 L;  4DUY L;  4OON A;  4BBR G;  2KCT A;  2VQF L;  2YYZ A;  3L7Z C;  3HKS A;  1N33 Q;  4P71 A;  1AH9 A;  1PH9 A;  2K14 A;  3PO2 H;  4A3M G;  2B63 G;  1TWH H;  2WB1 G;  4A3J G;  4OWW B;  2E2I H;  3TQY A;  1SRU A;  3BJU A;  4LF7 Q;  1EQR A;  5M3F H;  1WYD A;  4QY7 A;  4UP9 A;  1QVF A;  4GKK L;  3PSI A;  4B3M Q;  3H3V H;  1E24 A;  5M3M G;  2I5H A;  5C44 H;  1K9M C;  1PYS B;  2K5V A;  3ULP A;  1PH7 A;  1YHQ A;  1HR0 W;  1O7I A;  4GNX A;  1YNX A;  5IT9 c;  2ZTE A;  3I7F A;  3HOY H;  4L5R C;  1EUJ A;  4JOI C;  4B3S Q;  1UEB A;  4IPC A;  3HOW G;  3W1B A;  4BY1 H;  1FGU A;  4UP8 A;  5AJ3 Q;  3H3V I;  4A3F H;  2OCE A;  1HNX Q;  3CQZ H;  1XMQ L;  4C3I H;  3PF4 A;  2BA0 A;  4B3T L;  4YY3 L;  5M5Y H;  4HIM A;  4DR2 L;  2VZA A;  4ALP A;  4LFC Q;  3H15 A;  2AWN A;  2ATW A;  3KYH C;  2GVA A;  1PH2 A;  4JG2 A;  2OTL A;  4YWL A;  3U4V A;  3KJP A;  3AQQ A;  1JJG A;  4AYB G;  1A8V A;  1Q12 A;  2R93 H;  1N36 L;  2JA8 H;  2Z6K A;  5GAE C;  3NEL A;  1EIY B;  3PIO A;  4Y52 H;  1BBU A;  3AYH B;  3PV0 A;  4X64 Q;  3CC7 A;  3CD6 A;  3GDE A;  4B3T Q;  4GLX A;  4DR2 Q;  1OXU A;  3J81 j;  2K5N A;  3SGI A;  2ZM6 L;  4BXX G;  5IYD H;  3W5O A;  4IJL A;  3T1Y L;  1S3O A;  4A4I A;  3M3Y H;  3H0G G;  5C4J H;  4A3E G;  1X55 A;  3TS2 A;  1C9O A;  1N36 Q;  3ERS X;  2D0O A;  4DR1 L;  1Q1E A;  1YJ9 A;  1TWA H;  4X66 L;  1YVC A;  2GVB A;  4DV1 L;  4HJ9 A;  4GOP A;  3RZD H;  3AFP A;  1GM5 A;  1Q1B A;  4JV5 L;  1XPO A;  3S2D H;  1S40 A;  3U4Z A;  5FLM G;  3BZK A;  3KFU A;  2HHH L;  2NVT H;  5IP7 H;  2E2J H;  1Z9F A;  2ZM6 Q;  4A3B H;  2CQO A;  5K36 G;  2QA4 A;  2YTX A;  3T1Y Q;  3NEN A;  1QZH A;  3EIV A;  2K52 A;  3FP9 A;  4QL5 A;  3PUY A;  2MNA A;  1BKB A;  5IYC G;  2JEB I;  4DV0 L;  1QZG A;  4A3L H;  1S72 A;  4GLV B;  5GAH C;  4DR1 Q;  3FHW A;  2CFM A;  3WWV A;  4X62 L;  4X66 Q;  4DV1 Q;  4GNX C;  4GOP B;  5GRO A;  5LMU L;  4L5T A;  3OW2 A;  2KCM A;  1KIX A;  2OQ0 A;  3I4N H;  3HOZ G;  2Z0S A;  1Q8K A;  3K81 C;  2I5M X;  2DUD A;  1SFO H;  2HHH Q;  4DR4 L;  3U58 A;  4AQY Q;  2ZJQ A;  2N78 A;  2VW9 A;  2JEA I;  2F52 A;  2A1A A;  1ASY A;  5C0X I;  1FJG L;  4OWX B;  4YCW A;  4UY8 C;  4LF9 L;  2E8G A;  1VQN A;  4HIK A;  3CCL A;  2BH2 A;  3E0E A;  1JMC A;  4YCV A;  1G51 A;  4X62 Q;  3J81 c;  2CKZ B;  3OTO L;  2IT1 A;  1RIP A;  1YZ6 A;  1DGS A;  3PGZ A;  5ELN A;  5LMU Q;  1ASZ A;  3M7N A;  3S14 H;  4JYA Q;  1VQP A;  1Y1V H;  4JI0 L;  1K83 H;  5H1S E;  2F4V Q;  2NN6 G;  1E22 A;  4DR4 Q;  1V9P A;  3KF8 B;  3M4Q A;  4A3C H;  1UE1 A;  2JA7 H;  3I4M H;  4DV2 L;  2N49 A;  1K8G A;  2JA6 G;  2UXD L;  2GN5 A;  1VCI A;  2A19 A;  2FXQ A;  1X3F A;  2PQA A;  4DAM A;  1VQ4 A;  5C4X G;  4DK3 C;  3S16 H;  4JI4 L;  3D31 A;  3NBH B;  5IYC H;  4OXP A;  3KDF A;  4DV7 Q;  4P72 A;  4QJF A;  4OWT B;  2HIV A;  3RNU A;  4OX9 L;  2VUM G;  4YWK A;  1NMF A;  2V1C C;  4DR5 L;  1MKH A;  2JK8 A;  1FVI A;  2ZJR A;  3J80 c;  3PUZ A;  3UDI A;  4DV3 L;  5JJK A;  4IOC A;  1TWG H;  4MTN A;  1PH3 A;  1PYB A;  4HJ8 A;  2UXD Q;  4GN5 A;  3GTJ H;  3CCV A;  3CC2 A;  4IFD I;  1E1T A;  3HOV G;  4UPA A;  2R7Z G;  3HKZ G;  4YHH L;  4P74 A;  3RLF A;  1H95 A;  4A3I H;  2YU9 H;  2HIX A;  3HFZ B;  4OX9 Q;  1HZ9 A;  3F1Z A;  4DR5 Q;  4O0A A;  2ASB A;  1VQM A;  3PUW A;  1B70 B;  4DV3 Q;  4DV7 L;  1W3S A;  4GS3 A;  4BY7 H;  3KF6 B;  2JJQ A;  3MEF A;  4JI8 L;  3B6Y A;  4LFB L;  5FLX c;  1L0W A;  4JBW A;  2L15 A;  4JI7 Q;  1VQO A;  1GD7 A;  1PVO A;  2MO1 A;  1QUQ A;  1PH4 A;  4NXN L;  4YHH Q;  3CC4 A;  2MQH A;  4TQU S;  1BVS A;  4Y7N H;  4DV4 Q;  3W1G A;  2XTI A;  1CSP A;  4DUY Q;  4WJ3 M;  4TVA B;  2AHO B;  4J15 A;  2VQF Q;  3PIP A;  2WFW A;  2UUB L;  1Y1W H;  4C3H H;  4LUZ A;  4R4I A;  3GTM H;  2OTJ A;  1HNW L;  3JC6 6;  1E3P A;  5LMN W;  3PF5 A;  1JT8 A;  4JI8 Q;  4A93 G;  4LFB Q;  1MIU A;  1X65 A;  1OXX K;  2NZO A;  2KHJ A;  2WB1 E;  1WFQ A;  4DKA C;  4DR7 L;  4A3D G;  1XMO L;  2R92 H;  1HZB A;  4DV5 L;  1NJI C;  4K0K L;  4BBS G;  1QUQ B;  5IP9 G;  4DR3 L;  1VQL A;  4HIO A;  4GKK Q;  4C2M H;  1NBW A;  1EOV A;  4PZ8 A;  4MZ9 A;  1D7Q A;  1KXL A;  1Q7Y C;  2I5L X;  2JA5 G;  1I50 H;  2AWO A;  3ICE A;  2R7F A;  3CCE A;  4GNX B;  4BBR H;  1C7Y A;  2R7D A;  2CWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...