3I4NH

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
137
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLETRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 21
structure length 137
sequence length 146
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nH00
3SGIA 3JAMi 3DLLA 2EIFA 4GOPA 3CCSA 3I4MG 3RN2A 1GO3E 1YHAA 4EQ5A 5FLMG 4BY1H 3HOWG 4J15A 1GVPA 3TS0A 1PH3A 2R92G 3H3VI 3HOYG 3NBHB 3HOUG 4L5TA 2D0OA 2K75A 1XMQQ 3KJPA 4LNQA 3I2ZA 2VZAA 3NELA 1JMCA 4C2MH 4LF6Q 3GTLH 2GVAA 1VQPA 3HOXH 2DGYA 4X64Q 1L1OA 4HJAA 4JV5Q 3BZCA 1TWGH 2IX0A 1N32L 5C4XH 1C7YA 1KC8C 1IXRA 5M3FH 4YY3L 2B63G 3KDFA 4A93G 5IYDH 4DAMA 4XIGS 3K7AH 1EIFA 1KIXA 1QUQB 1VCIA 1Y1VG 4DR2L 1XMOQ 4YCVA 2MNAA 2WB1E 3S16H 4OX9Q 5IT9c 4NXNQ 1J5EQ 2UXCL 2JA5G 4JI2L 4LW1A 5IY0A 4GKKQ 1IBKL 3J81j 1HZCA 1K8GA 1TWAH 2VQFL 3STBC 5M5YH 4X6AH 3PO3G 4A3GH 1S3OA 2WFWA 2EQSA 1EFWA 3FHWA 2QGQA 1PFSA 4QL5A 3ERSX 4BBRH 4BXXH 3PV0A 2E2IH 5M5WH 4DUZL 3G48A 3PIPA 1YJNA 3HOVH 1G6PA 5IYBH 1B70B 2LXKA 1VQIA 4C3IH 2WB1G 1JJ2A 2KHIA 3HOZG 4R4CA 4DR4Q 1CKMA 4KHPL 4YCWA 2ZJQA 3UDFA 3S2HH 1VQ4A 3E9HA 5H1SE 1B7YB 2E5LL 1X56A 2K52A 5JJIA 3S1NH 1VQHA 4HIDA 2F4VL 1CSPA 3S1MH 3J7ZC 4DR3Q 4YHHQ 3L0OA 1K0RA 1NJIC 4B3ML 4JYAQ 1NTGA 4NPSA 1EYGA 3I4MH 1Q1BA 3J81i 4A3BG 1HNXQ 5FLMH 3KF8B 4DV7Q 2R93H 4GLAC 3HFZB 3K7UC 3ER0A 2Q2UA 3PSIA 3S17H 3HOYH 3F2DA 4DV1L 1KHIA 4DV5L 3CD6A 3HOUH 3M85A 4BBSG 4XTCS 4AYBE 1XNQL 1H95A 3J7A5 4GOPB 1GD7A 1PH5A 1QZHA 3LGJA 2JA6H 3CMEA 5J3BA 3W5OA 3PCOB 4PZ8A 3CW2C 2HIVA 4NXMQ 2LXJA 1FGUA 2CCZA 4B3RQ 4X66Q 3NENA 4IFDJ 1E7ZA 4DV0Q 1UE5A 2MO0A 4JI8L 1IZ6A 4OWWB 2B63H 1SFOH 1QUQA 4RMFA 3K8AA 2NVYH 1Y1VH 2A19A 4PG3A 1VQ6A 1PYBA 3KF6A 1L1OB 1A8VA 4AYBG 4R4TA 2ZM6L 2K50A 4AQYQ 2UXDL 4JC0A 2ES2A 5C4XG 4JI0L 3GTMH 4POGA 5M3FG 2ASBA 2JQOA 1I5FA 2XTIA 3A5UA 4JI7L 1CUKA 4FDBA 4GKJQ 2UXBL 3KDFB 4DNIA 1OXSC 4B3SQ 4A3MG 4UY8C 1N33L 1FJGL 4JI6Q 4K0KQ 3M7NA 4QIWE 2MFIA 4IPDA 5JEAG 1NMFA 3PO3H 4EX5A 1J6QA 3CCVA 3CC4A 3U4ZA 4L5QA 2HHHL 4A3CH 3ULPA 2UUCQ 3RLOA 3PUYA 2D62A 1GKHA 3CP0A 4IOAA 3CCMA 1PH8A 3S1RH 3PF4A 5AJ3Q 2PI2A 4LFAL 1L2FA 4DV4Q 1KAWA 1A62A 5ELOA 4A3GG 4BXXG 1LUZA 1WFQA 2YTVA 3BZKA 4DR5Q 3GTQH 2KHJA 3CCQA 3HOVG 1XTDA 5IYBG 1YI2A 4IPCA 1W3SA 4X62Q 1Q81C 4KLKA 3VDYA 2HQLA 1KD1C 2XGTA 4X65L 2OCEA 2IT1A 4JBJA 3U4VA 3RLNA 1B8AA 4DAYB 3T1YL 3ULJA 4H02A 1NMGA 5LMUQ 1HNWL 4DPGA 4A3BH 1BBWA 2R6GA 5IP7G 4JI1Q 1OXTA 2K5NA 3UE1A 3S14H 4YWMA 4LF8L 2UU9Q 2AWNA 2YYZA 3GO5A 2QEXA 4JBKA 2UUAQ 4LFCQ 4BBSH 2CKZB 3CQZH 4P75A 2AMCB 4DK6C 5GAGC 1PV4A 3PUWA 1YHBA 4DV6L 3CCRA 3F2CA 2VQEL 2R93G 3TREA 1QVCA 1O7IA 2OTJA 3TRZA 4DR6Q 5GAEC 2A8VA 3H3VH 2MO1A 1L0WA 4JI5Q 3HKZE 4A4IA 3OTOQ 3G71A 1N34L 2KCTA 1X54A 3H15A 1HNZQ 1M90C 2Z6KC 1A0IA 3H0GG 3I4OA 1AE3A 4JI3L 1N36L 2BA1A 3CC7A 1VQCA 4DR1Q 1IBLQ 1VQ7A 3CC2A 2JK8A 3J80i 2N3SA 3GD7A 2AKWB 1Z9FA 1AH9A 1WYDA 3F1ZA 3CPFA 3T1HQ 1W2BA 5ELNA 2R7ZG 4A3DG 4HIKA 4L5RC 2NVTH 4A3MH 3I55A 2B29A 1OTCA 4UP9A 1UE1A 3HKZG 1UWVA 4TVAB 3KF6B 2VY3A 1Q7YC 1PA6A 1PH1A 4MNOA 4OO1G 1IYJB 1I94Q 3AEVA 3F2BA 5JJLA 3S2DH 1Q1EA 1VQKA 4LF9Q 1V9PA 1XMQL 2NVQH 4DR7Q 3MXNB 4QJFA 3GTJH 3GTOH 3M3YH 2NN6G 5LMNQ 4NB3A 1WCMH 3PGZA 1U5KA 3FP9A 3I56A 4X64L 1XJVA 1VQDA 4JV5L 4Y7NH 3D0FA 4A3CG 4APVA 1JT8A 5HY6A 2ATWA 1VS0A 3CCJA 1AE2A 2Z6KA 3GTPH 4DV2Q 3UDXA 4ME3A 2JJQA 4A3FH 1XMOL 3M4OH 2CFMA 2ID0A 1YIJA 4OX9L 4NXNL 1J5EL 2RHSB 3RZOH 1Q46A 2V1CC 4BA1I 4GNXC 4GKKL 5IP7H 3TS2A 3AQQA 1PH4A 5M3MH 1QZGA 1VQLA 4LFBQ 5C0XG 5IWAQ 4PZ7A 4WJ4A 2IHFA 3K81C 4YWKA 1N9WA 3AFQA 4A3EH 2GVBA 1MKHA 4DV3L 4C3HH 3CPWA 2JE6I 1P8LA 1RL2A 2ZTCA 4LF7Q 1NBWA 2RCNA 3RLFA 4IJLA 2I5LX 4JBWA 3W1BA 4R4QA 4LF4L 2R7DA 2PQAB 2UUBQ 4DR4L 1XNQQ 1SROA 2LSSA 4LF5Q 1XPRA 4L5SA 1Q86C 4QQBX 1V1QA 1C9OA 1CKNA 4TQUS 5GAHC 3H0GH 1KXLA 5C0XJ 1X9NA 1HR0Q 4GS3A 4LUZA 1WI5A 1V43A 2DUDA 1KL9A 1C0AA 1TWHH 1SLJA 4DR3L 4YHHL 4KHZA 4JI8Q 4A3KG 2R7ZH 2ZTDA 4OXPA 4BY7G 4A3DH 3RZDH 4JYAL 2N78A 4GLXA 3TQYA 2YTYA 3RR5A 4IOCA 2VUMH 2IY5B 4JOIC 4RG1A 4GNXA 1VQOA 4DV7L 1HNXL 5GROA 3KLWA 3WWVA 3IRBA 4GN3B 2I5HA 1S72A 1PH7A 1VQ9A 4B3TQ 1XNRQ 3GTKH 2EXDA 3CCLA 1IBMQ 5JJKA 1SMXA 1X55A 3HKSA 4JI4Q 3Q8DA 3I4NG 1OXXK 4HJ7A 2JA6G 1OXVA 1GM5A 5IYCH 3BU2A 4NXML 1I6HH 2PNHA 3TEHB 4B3RL 3ICEA 4X66L 1M1KC 3U50C 4DV0L 2VNUD 4DKAC 3KJOA 3PUVA 4UP8A 4HIOA 5BR8Q 1KRTA 1A63A 3STBD 1WCMG 2K5VA 2K5HA 2F3IA 4OWXB 2HT1A 1PH6A 3CAMA 4AQYL 3CMAA 3OW2A 5FJ8G 1E24A 1EQRA 2Y0SE 3UDIA 1K8AC 1JE5A 4GKJL 1G291 1K3RA 4JCVE 5JEAJ 4B3SL 3A5ZB 1Q8KA 4JOIA 4HJ5A 3B6YA 4A3FG 4WJ3M 1TWFH 1MJCA 4JI6L 1RIPA 4K0KL 3KYHC 1E3PA 3A74A 4A3LG 3CCEA 3E9IA 2OQ0A 3S1QH 1Q12A 1T9HA 3U58A 2NZOA 5M3MG 4DUYQ 2PQAA 1XPOA 4LWCA 4DK3C 1YNXA 2F52A 3PUZA 1OXUA 4A3EG 3DM3A 1CSQA 4DV4L 1TWCH 2C35B 2Y0SG 4ALPA 2OWOA 1I3QH 1UE6A 1E1OA 4DR5L 1FVIA 3S15H 4PMWA 4X62L 5C3EG 4O0AA 2CQOA 1JB7A 1EQQA 1Q82C 4A3KH 5LMUL 4BY7H 3M4PA 1CKNB 1EIYB 3M9BA 2K14A 4IFDI 3AFPA 1CKOA 3M4QA 2JA8H 2FXQA 1N32Q 4GLVB 2OTLA 1JJGA 2UU9L 4YY3Q 1BBUA 4LFCL 2UUAL 2BA0A 4JBMA 2MQHA 2VUMG 4DR2Q 5IE8A 1YJ9A 1TXYA 3W1GA 1MIUA 2OQKA 3I4NH 4GNXB 2NVXH 2YV5A 2L15A 1VQ8A 1U0LA 1BVSA 2PMZE 1Y1WG 2UXCQ 4JI2Q 3EIVA 4Y52H 2A1AA 3K0XA 1IBKQ 1PVOA 4JI5L 4YWLA 5EAYA 3OTOL 1HNZL 1VQJA 3EN2A 1IL2A 2RF4A 2K4KA 3RNUA 4DR6L 2VQFQ 5GADC 4DR1L 4LF6L 1IBLL 2R7FA 1E1TA 4P72A 4PZ6A 5IYCG 4IO9A 2AHOB 2WP8J 3ZJYC 3FKIH 1I50H 2PI2E 2VS1A 4P73A 3JAMc 3L2PA 4DUZQ 1VQNA 3E0EA 5FJ8H 3T1HL 1D8LA 4KHPQ 2E8GA 4MTNA 3GDEA 3EBEA 3CXCA 2ALYB 1SE8A 3I7FA 1X6OA 4A3JH 2Q2TA 1HZBA 2E5LQ 3PIOA 1UE7A 3L7ZC 1R9TH 2F4VQ 4GN4B 1SRUA 3CCUA 2GN5A 2JA7H 3PO2G 4LUOA 4A3LH 1I94L 1YEZA 2KENA 3D31A 1P16A 1EUJA 4LF9L 4DR7L 2I0QA 1VQFA 4P74A 1QVFA 4A76A 3J80c 1EWIA 3JC66 5LMNL 1KQSA 4B3MQ 2H5XA 4DV3Q 4QY7A 4OONA 4KI0A 4UP7A 1K73C 1X65A 3G6EA 3AYHB 1NY4A 4C3JH 2JA9A 3K80C 4LF4Q 4IJHA 4DV1Q 1X3GA 4DV5Q 5C3EH 4DV2L 1DGSA 5C44G 1YJWA 2Q2IA 2YTXA 5IP9H 1E22A 1K9MC 2KCMA 5K36G 3RN5A 1Z47A 3OYYA 4MZ9A 1LM0A 1PHJA 4R4OA 4UPAA 3UDGA 1YHQA 2I5MX 4LFBL 5IWAL 2ZTEA 3MEFA 4O2DA 1WOCA 4A3IG 3NEMA 1VQ5A 5HGQA 1LTLA 5LMNW 3PF5A 2JA8G 4LF7L 4IFDG 2UXDQ 1VQMA 3HOWH 2ZJRA 2ZM6Q 4GN5A 2R92H 3A0JA 1Y1WH 1HZ9A 1YBYA 4JI0Q 4JG2A 4JI7Q 2UUBL 2UXBQ 4LF5L 2VW9A 1Y14B 2NZHA 4R1JA 1SR3A 2RHQB 4BY1G 1FJGQ 1N33Q 4IPGA 4AH6A 3UE0A 5C4JH 1K83H 1VQBA 1YZ6A 1HR0L 2ZJPA 1LYLA 4R4IA 5GQOA 4LUVA 2HHHQ 5FLXc 2YU9H 1QVGA 4HJ8A 3J81c 4A93H 4LFAQ 3KOJA 3HOXG 4A75A 1HZAA 4BA2I 2N49A 1HH2P 1MJEA 2E2HH 3F8TA 3FKIG 1PH9A 1XNRL 4OO1I 4B3TL 2JA5H 3PO2H 2N8NA 5IYDG 1IBML 4IPHA 4X65Q 2QA4A 4JI4L 4YCUA 2NN6I 4A3JG 1ASZA 3T1YQ 2VL6A 3KFUA 3S24A 1HNWQ 1XPUA 4GOPC 1G51A 2WAQE 4AIMA 2JA7G 2AWOA 2CWAA 1PH2A 1HR0W 1YITA 1NE3A 1PYSB 2Q2HA 3CF5A 5M5XH 2JEBI 1UEBA 1WJJA 3G4SA 1BKBA 4LF8Q 2D0PA 2UUCL 1D7QA 5E7NA 2KBNA 3GTGH 3HOZH 1YVCA 1EOVA 2CWPA 4P71A 5BR8L 5C44H 3BJUA 5AJ3L 1S40A 1HJPA 4DV6Q 4QGUA 4HIMA 1ASYA 2IHEA 4BBRG 2VQEQ 3ULLA 2B3GA 2BH2A 2JEAI 2BH8A 5DLQE 1L1OC 5C0XI 1FL0A 3PUXA 1VQAA 2WAQG 1VQGA 1N34Q 2Z0SA 2E2JH 5IP9G 1SN8A 4OWTB 4JI3Q 1KRSA 1N36Q 1X3FA 1JJCB 4POFA 4A3IH 1VQEA 1N8RC 4HJ9A 2IX1A 4JI1L 1X3EA 4DUYL 2HIXA
chains in the Genus database with same CATH superfamily
3BVZA 4GOPA 2K03A 4X3TA 3CCSA 2NZ1D 4EQ5A 2XSCA 1SNCA 1NUCA 2OT2A 1PH3A 3H3VI 4L5TA 1QILA 4LNQA 3KJPA 1SNOA 1SFOB 3GTLH 1QOHA 3SEBA 2EYMA 1PLFA 4X64Q 1L1OA 3P20A 4JV5Q 1TWGH 5C4XH 3CU7A 4WORA 2SNSA 2B63G 4A93G 2FINB 1SNQA 3ND9A 4DR2L 2FJ2A 3S16H 1CQVA 2KEEA 2UXCL 4LW1A 5IY0A 4X3SA 4CBVA 5NUCA 1K8GA 1TWAH 2FHTA 4JK1C 3QIAA 1B4OA 1Y8OB 2VQFL 5JPNC 3STBC 2WACA 1S3OA 2WFWA 3NTIA 5KEEA 1FYCA 4QL5A 4BBRH 1E2ZA 2D5DA 5CV8A 5M5WH 3G48A 3RUZA 3HOVH 3BVMA 5IYBH 1B70B 4C3IH 4CJ1B 4ABNA 1JJ2A 2RQXA 5EGTA 3A54A 2K52A 4LAAA 5CC4A 3J7ZC 2PQEA 3SVMA 1STEA 2Z4HA 4YHHQ 1RTNA 3LWEA 4NPSA 1QWYA 2EYPA 2B8FA 3J81i 3IAYA 2R93H 1WVLA 2O5JC 2WINB 5IIFA 1EOTA 3K7UC 2Q2UA 5D65A 4RCOA 1BXTA 3KBXA 3M85A 4AYBE 1HUNA 2ZXRA 4CKCA 1EL0A 1AN8A 5J3BA 2B2WA 1O7ZA 3EVQA 5EQ0A 1ILQA 2HIVA 3A8KE 3TN2A 4NXMQ 3IFTA 4X66Q 1Q90A 3P75A 2PYKA 4CDFC 4OWWB 1SFOH 1ZYRC 3K8AA 3I4NB 1Y1VH 2A19A 3SE0A 3LX0A 1QJOA 4C1NK 1VQ6A 1PYBA 4EQPA 1A8VA 3R2IA 4JC0A 2XTIA 4JI7L 3K5LA 3S2DB 1ZKOA 3KDFB 5EJWA 4A3MG 4XQQA 1FJGL 1WCMB 4EGVA 3E3XA 4FP5D 4DXGA 4XQJA 1J6QA 3PUYA 2D62A 1GKHA 5HURA 4IOAA 4CDDC 3CCMA 4UHVA 5AJ3Q 4RH6A 4DV4Q 1KAWA 1EWCA 5ELOA 1CI3M 5BN4A 1KNAA 5FKAC 3RZOB 1LUZA 2YTVA 4DK0A 1XTDA 4IPCA 2F0PA 1CA6A 1AEXA 2HQLA 5M3MB 4X65L 2IT1A 5C0XH 2QCPX 1Z6HA 4DAYB 2RVLA 1NMGA 1TKWB 1HNWL 4RWSC 2SOBA 1EU3A 1WTWA 4JI1Q 3FPPA 1GUOA 3TDQA 4LF8L 2UU9Q 2AWNA 3MWYW 2F1MA 3BS1A 1YHBA 1B53A 2VQEL 2X69A 1ONLA 2OTJA 1SNDA 1RF2D 5I2YA 2A8VA 2NUCA 1MD2D 1YNJC 2KCTA 1X54A 3H15A 4XYOA 1M90C 3H0GG 3I4OA 4JI3L 1IBLQ 5FLXE 3CPFA 4ZRZA 3MVVA 3BDCA 3J81E 4L5RC 3I55A 1V1PB 4UP9A 3HKZG 1GHJA 3KF6B 1PA6A 3T53B 3OHXC 2DJFC 1I94Q 1I6HB 3S2DH 1Q1EA 4DR7Q 4QJFA 1LTTD 3ITPA 1V8QA 2PMZB 4H0LC 5LMNQ 5EKKA 4NB3A 1WCMH 5EPJA 1IW7D 4Y7NH 1E2WA 3D0FA 2NTTA 1JT8A 5HY6A 3CCJA 1SEBD 4DV2Q 1S5FD 4KN7C 4NXNL 1J5EL 3RZOH 1UUPA 1A15A 2RSNA 1Q46A 4KN4C 1AZQA 3S1QB 4OELB 5M3MH 5KGUA 5IWAQ 4K8JA 4YWKA 1I6VC 2GVBA 1KAAA 1MKHA 3CPWA 5E4WC 1P8LA 1NBWA 2RCNA 3S15B 1JOOA 2KHSA 1EZ8A 3PIP3 1RJTA 2LSSA 4LF5Q 1XPRA 3MTSA 3LNNA 1GOZA 3P1HA 2Q8RE 3HGBA 2B2TA 2L1BA 3W3AA 1V43A 2DUDA 4DNRB 2XN9C 1PYWD 3EQLC 4B9XA 3DM1A 1PZJD 1STNA 2ZTDA 4JYAL 1X3PA 5COYA 3KLWA 3KLRA 1XNRQ 1S72A 2EY2A 4QF4A 2CW0D 4K6DA 4OO1H 2EXDA 2RCFA 1IBMQ 5EBDA 3HKSA 4JI4Q 3C1FA 3Q8DA 5I4DA 1OXXK 4R8NA 5AFWA 2NN6H 1OO9B 1GM5A 3FKIB 1I6HH 3TEHB 2B8GA 4DKAC 4UP8A 3STBD 2K5DA 1D1KA 2GA4B 2JA7B 5FJ8G 1QG7A 5IGCA 5JEAJ 1AW7A 5DM63 1I4RA 1Q8KA 1RDPD 4HJ5A 3VA5A 3G7LA 1RIPA 1F9QA 2N55A 1H9SA 3VR6A 4KMUC 3VR2A 1A2TA 2MP1A 3S1QH 1Q12A 3A7LA 3U58A 4DUYQ 1O7YA 2PQAA 4DK3C 3I8ZA 3PUZA 4H44C 1OXUA 2C35B 4ALPA 2Z8LA 3OMGA 1S5ED 1I3QH 2A74C 3DEPA 2OWOA 3S1MB 5FOBB 1E1OA 1CZWA 3S15H 5J22A 4RAUC 3VR4A 3OMCA 3MXUA 4A3KH 4BY7H 1EIYB 3A8IE 3M4QA 1BUVT 4HEDA 1GHKA 1HXYD 1AP0A 4K8IA 1BBUA 5C4ZA 1ET9A 1ZYRD 3R2TA 2VUMG 5A2QE 4DR2Q 1YJ9A 1MIUA 2QW7A 4GNXB 2NVXH 2UXCQ 1PVOA 2B63B 4A93B 2VQFQ 2G9DA 4DR1L 5JJZA 2ZXPA 2AHOB 5EBCA 3FKIH 3OOCA 2F0DA 5C5LA 4E6IA 3E0EA 1D8LA 2ALYB 4ZK9B 5IOCA 1IYVA 3SK4A 3G6JB 1E2VA 4TSSA 2K1BA 2Q2TA 1ESRA 1UE7A 3KBGA 3BDOA 3GV6A 4F88A 3HZXA 2JA7H 2G5DA 1GUSA 1P16A 5FO7B 4LF9L 1JQYD 1LT3D 2H5XA 3W2DA 4DV3Q 4QY7A 4I65A 2JP1A 1CM9A 1NY4A 2JA9A 3A56A 4IJHA 1XWEA 1YJWA 1E22A 1SMYC 1K9MC 3RN5A 1Z47A 1PMRA 1LM0A 3NBIA 4UPAA 5DAUA 1YNJD 1EEID 3NTHA 1EYDA 1ESFA 3PF5A 2JA8G 2A5HA 4DU9A 5LL6S 1VQMA 2ZJRA 4DGZA 3BDLA 1Y1WH 1YBYA 3D4WA 3NK9A 5EPLA 4JI7Q 3T56B 2UUBL 1EFID 1EY7A 2RHQB 1FJGQ 3UE0A 2KECA 1CFMA 4R9WA 2G9HD 3OSOA 1LYLA 3VYRA 4A93H 2B2VA 4A3MB 3KOJA 3HOXG 1MJEA 1HH2P 1W6JA 4I7AA 1PZKD 1U4LA 2N8NA 5IYDG 1O80A 4X65Q 1MSHA 1SYDA 4A3JG 1HNWQ 1Y69U 4GOPC 2PZUA 2AQ2B 2FMMA 2AWOA 2QEJC 1LT6D 1PYSB 3G4SA 1V1OA 4LF8Q 1VF7A 2D0PA 1D7QA 5JOBA 3MFYA 4P71A 5ISRA 5C44H 5AJ3L 2L11A 1ASYA 2VQEQ 3S1NB 4KD3A 1TT2A 2B3GA 3FEWX 1L1OC 5CV9A 1PFNA 2KQ3A 1VQAA 2IW3A 2VB2X 2WAQG 1R4QB 2Z0SA 4JI3Q 4POFA 1N8RC 3HS0C 4IFDH 4OIKA 4HJ9A 2TSSA 4JI1L 4CKBA 1SBBB 3BG3A 5EPKA 2EDGA 1WTOA 1XYIA 3HOUB 2EIFA 3I4MG 3RN2A 3RD4A 3H0GB 1Q3LA 4PMBA 5FLMG 4BY1H 2EYOA 3HOWG 4J15A 1GVPA 3TS0A 4LJZC 2R92G 3HOYG 4KJNA 2D0OA 5KRUA 1HTPA 1GXDC 5LHY1 1JMCA 2GVAA 4K14A 1G2TA 2K04A 3X3MA 1WD1A 1LTGD 3HKZB 1ZXTA 4YY3L 3KDFA 1QUQB 4PNYA 4YCVA 2MNAA 4C56C 5T1GA 1HTLD 3I72A 2PNRC 4CDCC 1J5EQ 4NXNQ 3PO3B 4JI2L 4NMZA 5DEHA 1HZCA 2F0KA 3OWFA 1EFWA 1K8MA 2VB3X 5K5PA 1PTOH 3GTQB 1ENCA 2B2WC 3DEOA 4RFBA 1CKMA 4YCWA 2ZJQA 3UDFA 1TWFB 3E9HA 2E5LL 3S1NH 3TP8A 1TVXA 3TSSA 4HIDA 1CSPA 2D9UA 4CHTB 3S14B 2B2YA 1BCPC 4J6HA 1F9RA 1GJXA 4B3ML 2F4IA 4JYAQ 3NQTA 1NNXA 1QNKA 2XIWA 4A3BG 3AMUA 4Q0FA 4B9WA 1S4ZA 3HFZB 1TIID 3GP7A 4DV1L 1KHIA 3CD6A 3HOUH 4BBSG 3MEHA 1H95A 3J7A5 1STBA 2I07B 4PZ8A 1GUNA 3CW2C 1WTPA 1B9MA 1SAPA 1U4MA 1MGSA 2LXJA 1UEAB 1E7ZA 1UE5A 2MO0A 3T4AC 1IZ6A 1AFPA 3R8BA 4RMFA 2NVTB 1V1PA 5CV7A 3KF6A 4AYBG 4FF1A 5M3FG 3JAML 2JQOA 1I5FA 1DCZA 1U9RA 2PW5A 4UY8C 4IQZA 5I9OA 3M7NA 4IPDA 5JEAG 1NMFA 3PO3H 4EX5A 3CCVA 1I50B 3U4ZA 2HHHL 3ULPA 3MAQA 3PF4A 1QNUA 1LTSD 1R9TB 2RDHA 2XWJB 3GTQH 3IFDA 3CCQA 4YIJA 1W3SA 4Z9CB 4FXGC 4KLKA 1KD1C 1RCVD 2XGTA 5LL6X 2K01A 5D3IB 4DPGA 3DWAA 1SE2A 1BBWA 5IP7G 3S14H 4YWMA 2FFKB 2IX3A 2A6EC 3DMUA 4P75A 2AMCB 1PV4A 4DXFA 4ULLA 1FNVA 1SE3A 3H3VH 1TWHB 4WFN3 1N34L 5I2XA 4LMQD 4I7ZC 1A0IA 2JA6G 1AE3A 2BA1A 4DR1Q 1VQCA 2VUMB 1O78A 2JK8A 3SK8A 2N3SA 2OEOA 2AKWB 1Z9FA 3GD7A 1AH9A 3X3NA 1PTOC 4HTHA 2R7ZG 4A3DG 2NVTH 1HQRD 4L6TB 4TVAB 4QCLA 1PH1A 2F0SA 3K0YA 3K58A 5JJLA 4DFAA 4LF9Q 1VQKA 1V9PA 1XMQL 1KLUD 3GTOH 2EJFC 2F0TA 1ML0D 1CK1A 1EYAA 2ICIA 5BN5A 5BN3A 1VQDA 4APVA 2B2TC 1AE2A 2Z6KA 5M9OA 1Y8NB 1XMOL 3KLSX 1YIJA 2K5WA 1L0XB 1CT1D 1MSGA 4BA1I 4GKKL 1VQLA 4RGNA 4XYQA 4PZ7A 2IHFA 1W6KA 4ZKCB 1N9WA 4DV3L 4C3HH 1RL2A 2QILA 2I5LX 4F8MA 2X6GA 2JYOA 4RHRA 2UUBQ 4QQBX 3N52A 1C9OA 1PRTC 4TQUS 1HA6A 4HAEA 4JW0A 1B3AA 5C0XJ 2JA8B 4GS3A 2PO4A 4O42A 1U4RA 3DWQA 1KL9A 2MUYA 1TWHH 3VYUA 4DR3L 2RDGA 4KHZA 4OXPA 2DNCA 2N78A 4GLXA 2YTYA 4N9TA 2VUMH 2KCNA 4GNXA 5GROA 3WWVA 3Q24A 2IJ0A 3IRBA 1PH7A 2I5HA 3KUPA 2Z4IA 3VR5A 1X55A 2A68C 4OEMB 4ILWA 1CA5A 4C2MB 5CBAE 5ELEA 1XX8A 3OWEB 5KNBA 2PNHA 1HHVA 3U50C 4DV0L 4FF4A 2VNUD 3K7AB 3PUVA 4A3JB 4QUCA 3QR8A 1KRTA 4LK1C 3CAMA 4AQYL 1E24A 2Y0SE 2SNMA 1JE5A 4XT3B 1G291 1TS4A 4JCVE 4B3SL 4JOIA 3J7AF 3B6YA 5EKLA 4JI6L 3FVQA 3KYHC 3Q22A 5ELBA 1E3PA 3A55A 3A74A 4A3LG 2OQ0A 1T9HA 2L55A 1B3QA 3M7GA 3NUCA 4A3EG 1BR9A 5IGFA 1I4QA 1CQFA 1STGA 4PV1C 1FNWA 4HR7B 5C3EG 3EROA 1MI2A 3Q6SA 4N8FA 1LTRD 1EQQA 1KABA 4HN7A 1CKNB 3M9BA 3N6RA 2J0TD 2JA8H 3HOWB 2ENBA 2OTLA 1K3BC 2R92B 3HOYB 4L8JA 4YY3Q 4LFCL 2UUAL 2PPBC 3H6MA 1TXYA 3W1GA 3I4NH 1JICA 1L0YB 2L15A 4JI2Q 1NR2A 1BQQT 4Y52H 3K0XA 4JI5L 4YWLA 1HNZL 1VQJA 5KYLA 2H4OA 5J39A 4B08A 1PXUA 4DR6L 5GADC 3IKJA 4P72A 5IYCG 2E2HB 2EYJA 2WP8J 3JAMc 3SDZA 2WKCA 1EQTA 4HCEA 3E6ZX 4MTNA 1MBYA 3EBEA 3I7FA 2A69D 4A3JH 3C3LA 1SDFA 2K33A 1HZBA 3R3OA 2E5LQ 3L7ZC 2LS01 1M4VA 3CCUA 1SRUA 3VYTA 4X3UA 3PO2G 1VF5C 1EUJA 2F3VA 4CDEC 3S1RB 2I0QA 1QVFA 1KQSA 2EVBA 5KNCA 4CJ2C 3J80c 2F03A 1HA5A 4B3MQ 4OONA 4KI0A 2A6HD 1X65A 3AYHB 1DOMA 3K59A 1G6ZA 3K80C 4DV1Q 1X3GA 1F9PA 2F0NA 3DUZA 2IWHA 1EWHA 3Q23A 5K36G 2B2VC 4A3BB 2OF1A 1E0BA 1GUGA 1PHJA 3V2TA 2AQ3B 4PQXA 3UDGA 4LFBL 2I5MX 4BBSB 3MEFA 1VQ5A 4A3IG 1EIHA 4O1NA 4LF7L 3HOWH 2AUJD 4GN5A 2R92H 1K8OA 1HZ9A 2VW9A 1SR3A 1B44D 3AU7A 1HFNA 4IALA 1VQBA 2KA7A 2XRQD 1JOQA 4HSPA 2HHHQ 2LY7A 5M3FB 4WRDA 4G7HC 3FMCA 4A75A 4BA2I 1BCPF 2N49A 1BOSA 2E2HH 1BBXC 4OO1I 3ERQA 3HEJA 2F0HA 4IPHA 1JR0D 1RD9D 2NN6I 1SSOA 5M5YB 1LT5D 1G51A 3FDTA 2O2LD 1WTVA 2AQ1B 1YITA 3CF5A 2Q2HA 2E2IB 3NHHA 1UEBA 1WJJA 2J4XA 1BKBA 2D2CC 5J1ZA 5E7NA 3TP6A 1YVCA 5CGKA 1EOVA 1ENFA 5BR8L 4KY5A 3S2HB 1HJPA 1BO0A 4BBRG 2E76C 2SEBD 2BH2A 2JEAI 4H7BA 5CMDA 3PUXA 1N34Q 5IP9G 1PRTD 1SN8A 4XXEA 1X3FA 2XNAC 3TZDA 3F2UA 1VQEA 1SNMA 2K5QA 5CV5A 3TP7A 4CJ0B 2HIXA 2B2UC 4Q5VA 5HGTA 3SGIA 3JAMi 3DLLA 2DNEA 2JA6B 2LFNA 1SXTA 3AB9A 2A68D 4A3DB 1XMQQ 3I2ZA 1BNZA 4LF6Q 2NVYB 1VQPA 1TY0A 4HJAA 1N32L 3BZCA 3GTKB 1C7YA 1SJED 3TZUA 5M3FH 2IPKD 5C6AA 2B2YC 4XIGS 4DAMA 1KIXA 4F87A 1VCIA 1Y1VG 1XMOQ 2WB1E 5IT9c 4FXKC 1NSNS 2JA5G 1CZGA 4GKKQ 3VR3A 3J81j 4P2CB 1IL8A 5DM73 1DOLA 5M5YH 2QF7A 4X6AH 3FHWA 2QGQA 3WOEA 3ERSX 3PV0A 2E2IH 1G6PA 1B9NA 1VQIA 1TQOA 4HMIA 1LV9A 4RGOS 3S2HH 1B7YB 3GQBA 3NSWA 1JORA 1D2BA 2F4VL 3S1MH 2LMCB 4DR3Q 1G91A 3NPPA 1TWCB 2EY6A 4MN3A 3ER0A 5DNFA 4UAIA 2EE1A 4DV5L 3HRZC 1NCVA 2Z1CA 4JVZA 1PH5A 3MA2B 1QZHA 2JA6H 1HRJA 2HDMA 1HFGA 3PCOB 1HUMA 4N8X1 3WDNA 1FGUA 2CCZA 2M00A 3NENA 4IFDJ 1TS2A 3M4YA 5ELFA 4DV0Q 2B63H 3QOJA 2EYHA 2NVYH 2ZT9C 2SDFA 2F0WA 2UXDL 4AQYQ 2ZM6L 1LO5D 2BOSA 3JAME 3MFGA 4JI0L 4POGA 1D5MC 2QDBA 3WOFA 3A5UA 1CUKA 4EVOA 2UXBL 2NVQB 3KK7A 1F77A 1OXSC 4B3SQ 3M3YB 2E2DC 1N33L 4FVMA 4JI6Q 1BF4A 4QIWE 2MFIA 2X6LA 3CC4A 3TP5A 2UUCQ 1PRTF 4FF2A 3GTPB 3CP0A 3E0JA 3VYSA 1PH8A 3NWTA 2PI2A 3M4OB 1ZEQX 1A62A 4A3GG 1XXGA 4BXXG 1WFQA 3BZKA 2EY1A 1YI2A 1WTHA 4DK1A 4OIJA 2JN4A 2OCEA 4FYDA 1B8AA 3T1YL 1DJRD 3ULJA 4A3EB 4H02A 3TBIB 1CTMA 5FK9C 1OXTA 4G7ZC 2Q8IB 3UE1A 2YYZA 3GO5A 2QEXA 2UUAQ 4LFCQ 1A6XA 3PUWA 4BS9A 2M9VA 4ID6A 1IKLA 3CCRA 4DV6L 1FGBD 1QVCA 5TSSA 4OL7A 2NWGA 2K7VA 3TRZA 2O4XA 5GAEC 1L0WA 4JI5Q 1HNZQ 3CRLC 2Z6KC 3RZDB 1TY2A 4DR6Q 1N36L 5C3WA 5FO8B 2EPBA 1LACA 3OIPA 3CKIB 1B1ZA 1NR4A 1WYDA 1JB3A 3F1ZA 3NE5B 2N88A 2F0MA 4HIKA 4K6LA 5C4JB 4A3MH 2B29A 1K83B 1OTCA 1EY0A 2VY3A 1Q7YC 1EY9A 4MNOA 4OO1G 1Z7TA 2NVQH 1F2LA 3MXNB 4DA2A 3M3YH 2NN6G 1H9RA 1R4PB 1U5KA 1VDZA 2L5TA 3PO2B 4A3CG 5JPMC 2ATWA 1SE4A 2PZTA 1PRTB 4KY7A 4NDXA 3GTPH 5IODA 3UDXA 4DAYA 4ME3A 3C2PA 2JJQA 1FD7D 3M4OH 2ID0A 4OX9L 5E3FA 2RHSB 2RBMA 3PIO3 5M5XB 2V1CC 1LTBD 4GNXC 3TS2A 2H1EA 3AQQA 1PH4A 1ENAA 1QZGA 4LFBQ 1EYCA 3AFQA 4A3EH 2JE6I 3NQIA 4LF7Q 3NTKA 3RLFA 4M8AA 4JBWA 3W1BA 2RKSA 4DR4L 2PQAB 1XNQQ 1SROA 1V1QA 1CKNA 3SR1A 5GAHC 3H0GH 1KXLA 1FNUA 1X9NA 4ZUJA 1II3A 4TRDA 3MHBA 4L63B 4JI8Q 4A3KG 3E5SA 3MXPA 4BY7G 3EA6A 5C5MA 3RZDH 3TQYA 3RR5A 4NW2A 4JOIC 4RG1A 1VQOA 1HNXL 4DV7L 3I70A 4U68A 2F3WA 1BDOA 1VQ9A 4RA8A 1A3VA 2CQAA 5JJKA 1SMXA 4ZYSA 4HJ7A 4MTKA 1OXVA 1STAA 5IYCH 3NWSA 2BE5C 2CHBD 3BYTB 4B3RL 3I3CA 3Q0AA 1RODA 2MHVA 4WJWA 5BR8Q 1A63A 2K5VA 3J80L 2K5HA 2HDLA 2HT1A 1PH6A 2OXPA 3CMAA 3OW2A 1EQRA 5CYUA 1LTID 3IL8A 4GKJL 1K3RA 3A5ZB 3A8JE 4A3FG 2I46A 4WJ3M 1TWFH 1MJCA 3FPUB 4K0KL 1SMYD 1IW7C 2WV6D 2MGSA 1IHZA 4BBRB 5C3XA 3E9IA 3QO2A 1DD2A 1XPOA 1YNXA 3DM3A 1CSQA 2Y0SG 1RHPA 4JPBW 1UE6A 1D5ZC 4DR5L 1FVIA 4QUFA 4R8IA 4PMWA 4X62L 4O0AA 3VA7A 1JOKA 1JB7A 1LT4D 1Q82C 2FMCA 5LMUL 1LABA 5JAVA 1I4XA 5D14A 2K14A 5EKIA 1CKOA 2FXQA 1N32Q 4GLVB 2Z6BA 4KKUA 4K5VA 1DYQA 1JJGA 4JBMA 1C4QA 4CKEA 4K2LA 5I9PA 1K0SA 5IE8A 1U0LA 2PMZE 1Y1WG 3EIVA 2F0IA 4XDXA 3OTOL 3EN2A 2RF4A 3T16A 4QB4A 1SYEA 1Y1VB 4LF6L 2R7FA 4FNFA 3QWNA 3ZJYC 1I50H 4RGTA 2JA5B 3L2PA 2CW0C 1VQNA 5FJ8H 3T1HL 3L3OC 2E8GA 3GDEA 1SE8A 3OW7A 1X6OA 5T1IA 2BDOA 2NTSA 1C48A 2M2LA 1R9TH 2DJGC 2F4VQ 4GN4B 2KUMA 2GN5A 3LWUA 5CBEE 1YEZA 2KENA 1WD0A 1VQFA 4P74A 3V96A 4A76A 1EWIA 5KIXA 1G2SA 4UP7A 1K73C 2E74C 3G6EA 4QMGA 4C1NI 1PFBA 4LF4Q 4DV5Q 1DGSA 5C44G 2E2JB 2Q2IA 2YTXA 3U9SA 2RDFA 5IP9H 3OYYA 1QE6A 4R4OA 1YHQA 4X3KA 2ZTEA 3NEMA 1LTLA 3UI2A 1K28A 4IFDG 3MZ5A 3D6WA 4G4KA 2UXDQ 4KKSA 2ZM6Q 1T5EA 3A0JA 4RCNA 4JI0Q 4JG2A 4ODGA 3D4RA 2UXBQ 1N33Q 4BY1G 2EZVA 2KEDA 4IPGA 1HR0L 3HOXB 1YZ6A 3P7JA 5IT9L 2ZJPA 3EFXD 5GQOA 2AUKA 1H9JA 1QVGA 4RKLA 1Q8IA 1HZAA 2JXMB 3I73A 4K2KA 4V0BA 3F8TA 1PH9A 2P5ZX 4MHEA 4B3TL 2JA5H 2K05A 3H3VC 1KDBA 1RTOA 2RSOA 3SHLA 3D3RA 3T1YQ 1EEFD 3KFUA 3S24A 4GZYC 1XPUA 4A3GB 4AIMA 4IUVA 2CWAA 4PMCA 1HR0W 4Y7NB 5KNDA 2JEBI 1GUWA 1BCPD 2UUCL 3BVGA 4H13C 3HP3A 2CWPA 2WAQB 5F2DA 4IUQA 2WIIB 4DV6Q 4CGYB 3SK6A 1SYCA 2IHEA 3ULLA 4C3JG 5C0XI 2C9OA 1FL0A 3J7AV 2E2JH 5G3LD 4OWTB 3I4MB 1KRSA 1N36Q 2B39A 1X3EA 3S17B 2XVSA 2F0UA 3T13A 2J7ZA 4HMJA 1B50A 1GO3E 1YHAA 3H94A 3D8GA 2TMPA 1VMPA 2K32A 3DWPA 3NBHB 4RHSA 3HOUG 5IGEA 2K75A 2KOLA 1UAPA 2VZAA 3NELA 4C2MH 5JVH3 3HOXH 2DGYA 4NP5A 2HCIA 2BE5D 2L0CA 2IX0A 4KTAA 3ZYYX 1IXRA 1KC8C 3GTMB 2CVRA 5IYDH 1GUTA 3K7AH 1EIFA 1XTCD 2F0OA 4OX9Q 1A3TA 1A3UA 1IBKL 1EIGA 4N9PA 1JE4A 3QB3A 2HD3A 4ME5A 3PO3G 4A3GH 2EQSA 3KLSA 1I4GA 5CV4A 1KTKA 1PFSA 2DY8A 4BXXH 4DUZL 1YJNA 3PIPA 1DXMA 2LXKA 3HOZG 2WB1G 4DR4Q 2KHIA 4KHPL 4R4CA 1KDCA 1F2ZA 2A6ED 1JWSD 1VQ4A 5H1SE 1ILPA 1IKMA 1X56A 5JJIA 5CV6A 3CHBD 1VQHA 4HSVA 5L37A 4KKTA 1EU4A 3H91A 3URYA 5I6WA 3L0OA 1K0RA 3CQZB 1NJIC 1NTGA 1EYGA 3I4MH 1Q1BA 1I3QB 5ELDA 1HNXQ 5FLMH 3KF8B 4DV7Q 4GLAC 1SYGA 4OGQC 3PSIA 3S17H 3HOYH 1PTOD 3F2DA 4XTCS 1XNQL 4A3KB 4GOPB 1GD7A 3K5MA 1AZPA 4BY7B 3LGJA 3CMEA 3W5OA 4J1MA 3K57A 4AYBB 1PDQA 2RA4A 5A35A 1KLGD 4S3SA 4B3RQ 4JI8L 1QUQA 1SNPA 4PG3A 2NVXB 1L1OB 4DNTB 4R4TA 5E1FA 2K50A 3I4LA 5C4XG 2ES2A 3GTMH 2ASBA 4GKJQ 4FDBA 3MXNA 2QDLA 4DNIA 3GTJB 1HCZA 3R93A 1WTQA 1F2YA 1DONA 4K0KQ 2F0QA 1I4HA 2WKDA 4IUNA 1D1IA 4L5QA 4A3CH 5G3LF 5IGBA 3RLOA 3V05A 1NAPA 3S1RH 4LFAL 1JC7A 1L2FA 2L12A 4A3FB 3C46A 4DR5Q 2KHJA 3HOVG 5IYBG 4C3IG 4X62Q 1Q81C 3VDYA 4JBJA 3U4VA 3RLNA 3NP8A 5LMUQ 2Y0SB 2JSOA 2KCCA 4A3BH 2R6GA 2DN8A 4RKBA 2K5NA 3L9AX 1HQMC 2E75C 1DM0B 4JBKA 2PCFB 4K5XA 4BBSH 2CKZB 3CQZH 5GAGC 3PQIA 4DK6C 4C3HG 1S5BD 4FXDA 3F2CA 1O7LA 2R93G 2CH4A 3TREA 4V190 1O7IA 1PZID 2XRSD 3HG9A 1FR3A 1KNEA 2MO1A 3HKZE 3OIQA 3T51B 4A4IA 3OTOQ 3G71A 2R7ZB 2A73B 2R61A 5ELCA 3CC7A 1VQ7A 3CC2A 1VMCA 3J80i 1Y1WB 5D3DA 3T1HQ 1W2BA 5ELNA 5FLXL 3J81L 1UE1A 1BCPB 1UWVA 5JEAH 3GV3A 1IYJB 3AEVA 1EY5A 3F2BA 1WTRA 3GTJH 2LKVA 3ONAB 4ZLTF 1S5CD 2HUGA 3PGZA 1ICWA 1J8IA 3FP9A 4IUUA 3I56A 4F7XA 4X64L 1XJVA 4JV5L 5KYIA 2HCCA 1TS5A 1VS0A 2NYZD 1KDAA 2F0JA 4A3FH 1JWMD 4KD4A 2CFMA 4KHVA 1PTOF 1YNNC 2EJGC 2F0EA 5IP7H 4FF3A 5C0XG 2QKIC 1IYUA 4WJ4A 3DXJC 5C44B 3K81C 2ZTCA 5CR3A 4KJOA 1F9SA 4IJLA 2Q8TA 2KVMA 3I91A 1Y8PB 4R4QA 4LF4L 2R7DA 1LTAD 4L5SA 1Q86C 1HPCA 2O5IC 1DZ1A 1M8AA 1HR0Q 3C1EA 4LUZA 1WI5A 5C4HA 5IGGA 1C0AA 1SLJA 4DAVA 2L4NA 4YHHL 1ICFB 1D5XC 1H9MA 4XQNA 2R7ZH 4A3DH 2MJ8A 2IY5B 4BY1B 1EZ6A 4IOCA 2F0FA 4GN3B 4IN3A 3MXGA 4B3TQ 3S9WA 3GTKH 2ZXOA 3CCLA 2F0VA 4IURA 3I4NG 4NKLA 3BU2A 2R3ZA 4NXML 2IL8A 4X66L 1M1KC 1X3QA 3KJOA 4HIOA 3J80E 1WCMG 4U673 4OWXB 2F3IA 1LLRD 2KJXA 3K5NA 3UDIA 1K8AC 1D6EC 1PTOB 3CCEA 4C3JB 4UDUC 2EYFA 2NZOA 4KV6A 5M3MG 3D4DA 1PFMA 4LWCA 5C3EB 1EY6A 2F52A 4ZKBB 3J7YW 4DV4L 1TWCH 1CHPD 2PW7A 4EQOA 2EYLA 4K5WA 1G8ZD 4IUTA 3QJYA 4HCSA 2CQOA 2EOTA 3H09A 3M4PA 4IFDI 3AFPA 3CRKC 4G57A 2UU9L 2F0LA 2L9HA 2BA0A 4BWGB 1S5DD 2HQEA 2MQHA 2OQKA 5A2QL 2YV5A 3BYYB 1VQ8A 1BVSA 4XT1B 4DAPA 2A1AA 1IBKQ 1ET6A 2YU9B 1F2MA 5EAYA 3DHQA 4RGMA 1IL2A 1SJHD 2NBFA 2K4KA 3RNUA 5I6YA 2BDNA 2PZWA 1IBLL 1E1TA 4PZ6A 4IO9A 3O13A 4P73A 2PI2E 2VS1A 4DUZQ 1EY4A 3FRPB 4IZ8A 4KHPQ 1SYFA 3CXCA 2EXZA 5JVG3 3EJIA 1EY8A 3PIOA 1U4PA 2B2UA 3QG1A 4DF7A 4LUOA 4A3LH 1I94L 2MPMA 3D31A 3GTGB 3MC0B 3HOZB 2WB1B 4KY6A 4DR7L 1X32A 2EY5A 3JC66 5LMNL 2EJMA 1STHA 1H9SB 1STYA 3SXHA 2VXWA 4C3JH 2F0GA 3BZDB 1J9OA 1WTXA 2DY7A 5C3EH 4DV2L 1RKNA 2KCMA 1JWUD 1JCKB 2Z9HA 4A3IB 1C8CA 4MZ9A 3QOLA 4J8QA 5FO9B 2C5CA 2NB0A 1H9KA 3RMHA 2K6AA 5IWAL 3PMFA 4O2DA 1WOCA 5HGQA 5LMNW 1A2UA 1DOKA 4EQNA 4DN4M 3ND8A 4ZUIA 3D6CA 3NBHA 4FO2A 5CORA 4G7OC 4LF5L 1B2TA 2CH4W 1Y14B 2NZHA 4R1JA 3ICEA 3GTLB 4AH6A 2K28A 5C4JH 1K83H 5IT9E 5IGDA 3K5OA 1TWGB 4R4IA 5C4XB 4LUVA 1QCBD 1QB5D 5FLXc 2YU9H 2ICEC 1SYBA 4HJ8A 3J81c 4TKOB 2BCOA 4IUPA 4ZCKA 4LFAQ 4M1UB 3S16B 3K6OA 3FKIG 1XNRL 3U9OA 3PO2H 4ZAIA 1MHWC 3SK5A 3TMEA 1IBML 3OPOA 2QA4A 4JI4L 3NXWA 4YCUA 1TWAB 1ASZA 5E4XA 3GTOB 2VL6A 1TR5A 1TU2B 2WAQE 1YNND 2JA7G 1PH2A 1CHQD 1NE3A 2V4DA 5M5XH 5M5WB 3HOVB 4C3IB 2KBNA 3GTGH 3HOZH 4QIWB 2A69C 3BJUA 1S40A 4HIMA 4QGUA 1I4PA 1UNSA 5K36H 3A7AB 4ZQ3A 1EQVA 2BH8A 5DLQE 1TS3A 4KK7A 1VQGA 2XWBB 4OHJA 4C3HB 1JJCB 4A3IH 2A6HC 3KF8A 2R93B 1T5XD 3I90A 4MIUA 2IX1A 4DUYL
chains in the Genus database with same CATH topology
3SGIA 3JAMi 3DLLA 2EIFA 4GOPA 3CCSA 3I4MG 3RN2A 1GO3E 1YHAA 4EQ5A 5FLMG 4BY1H 3HOWG 4J15A 1GVPA 3TS0A 1PH3A 2R92G 3H3VI 3HOYG 3NBHB 3HOUG 4L5TA 2D0OA 2K75A 1XMQQ 3KJPA 4LNQA 3I2ZA 2VZAA 3NELA 1JMCA 4C2MH 4LF6Q 3GTLH 2GVAA 1VQPA 3HOXH 2DGYA 4X64Q 1L1OA 4HJAA 4JV5Q 3BZCA 1TWGH 2IX0A 1N32L 5C4XH 1C7YA 1KC8C 1IXRA 5M3FH 4YY3L 2B63G 3KDFA 4A93G 5IYDH 4DAMA 4XIGS 3K7AH 1EIFA 1KIXA 1QUQB 1VCIA 1Y1VG 4DR2L 1XMOQ 4YCVA 2MNAA 2WB1E 3S16H 4OX9Q 5IT9c 4NXNQ 1J5EQ 2UXCL 2JA5G 4JI2L 4LW1A 5IY0A 4GKKQ 1IBKL 3J81j 1HZCA 1K8GA 1TWAH 2VQFL 3STBC 5M5YH 4X6AH 3PO3G 4A3GH 1S3OA 2WFWA 2EQSA 1EFWA 3FHWA 2QGQA 1PFSA 4QL5A 3ERSX 4BBRH 4BXXH 3PV0A 2E2IH 5M5WH 4DUZL 3G48A 3PIPA 1YJNA 3HOVH 1G6PA 5IYBH 1B70B 2LXKA 1VQIA 4C3IH 2WB1G 1JJ2A 2KHIA 3HOZG 4R4CA 4DR4Q 1CKMA 4KHPL 4YCWA 2ZJQA 3UDFA 3S2HH 1VQ4A 3E9HA 5H1SE 1B7YB 2E5LL 1X56A 2K52A 5JJIA 3S1NH 1VQHA 4HIDA 2F4VL 1CSPA 3S1MH 3J7ZC 4DR3Q 4YHHQ 3L0OA 1K0RA 1NJIC 4B3ML 4JYAQ 1NTGA 4NPSA 1EYGA 3I4MH 1Q1BA 3J81i 4A3BG 1HNXQ 5FLMH 3KF8B 4DV7Q 2R93H 4GLAC 3HFZB 3K7UC 3ER0A 2Q2UA 3PSIA 3S17H 3HOYH 3F2DA 4DV1L 1KHIA 4DV5L 3CD6A 3HOUH 3M85A 4BBSG 4XTCS 4AYBE 1XNQL 1H95A 3J7A5 4GOPB 1GD7A 1PH5A 1QZHA 3LGJA 2JA6H 3CMEA 5J3BA 3W5OA 3PCOB 4PZ8A 3CW2C 2HIVA 4NXMQ 2LXJA 1FGUA 2CCZA 4B3RQ 4X66Q 3NENA 4IFDJ 1E7ZA 4DV0Q 1UE5A 2MO0A 4JI8L 1IZ6A 4OWWB 2B63H 1SFOH 1QUQA 4RMFA 3K8AA 2NVYH 1Y1VH 2A19A 4PG3A 1VQ6A 1PYBA 3KF6A 1L1OB 1A8VA 4AYBG 4R4TA 2ZM6L 2K50A 4AQYQ 2UXDL 4JC0A 2ES2A 5C4XG 4JI0L 3GTMH 4POGA 5M3FG 2ASBA 2JQOA 1I5FA 2XTIA 3A5UA 4JI7L 1CUKA 4FDBA 4GKJQ 2UXBL 3KDFB 4DNIA 1OXSC 4B3SQ 4A3MG 4UY8C 1N33L 1FJGL 4JI6Q 4K0KQ 3M7NA 4QIWE 2MFIA 4IPDA 5JEAG 1NMFA 3PO3H 4EX5A 1J6QA 3CCVA 3CC4A 3U4ZA 4L5QA 2HHHL 4A3CH 3ULPA 2UUCQ 3RLOA 3PUYA 2D62A 1GKHA 3CP0A 4IOAA 3CCMA 1PH8A 3S1RH 3PF4A 5AJ3Q 2PI2A 4LFAL 1L2FA 4DV4Q 1KAWA 1A62A 5ELOA 4A3GG 4BXXG 1LUZA 1WFQA 2YTVA 3BZKA 4DR5Q 3GTQH 2KHJA 3CCQA 3HOVG 1XTDA 5IYBG 1YI2A 4IPCA 1W3SA 4X62Q 1Q81C 4KLKA 3VDYA 2HQLA 1KD1C 2XGTA 4X65L 2OCEA 2IT1A 4JBJA 3U4VA 3RLNA 1B8AA 4DAYB 3T1YL 3ULJA 4H02A 1NMGA 5LMUQ 1HNWL 4DPGA 4A3BH 1BBWA 2R6GA 5IP7G 4JI1Q 1OXTA 2K5NA 3UE1A 3S14H 4YWMA 4LF8L 2UU9Q 2AWNA 2YYZA 3GO5A 2QEXA 4JBKA 2UUAQ 4LFCQ 4BBSH 2CKZB 3CQZH 4P75A 2AMCB 4DK6C 5GAGC 1PV4A 3PUWA 1YHBA 4DV6L 3CCRA 3F2CA 2VQEL 2R93G 3TREA 1QVCA 1O7IA 2OTJA 3TRZA 4DR6Q 5GAEC 2A8VA 3H3VH 2MO1A 1L0WA 4JI5Q 3HKZE 4A4IA 3OTOQ 3G71A 1N34L 2KCTA 1X54A 3H15A 1HNZQ 1M90C 2Z6KC 1A0IA 3H0GG 3I4OA 1AE3A 4JI3L 1N36L 2BA1A 3CC7A 1VQCA 4DR1Q 1IBLQ 1VQ7A 3CC2A 2JK8A 3J80i 2N3SA 3GD7A 2AKWB 1Z9FA 1AH9A 1WYDA 3F1ZA 3CPFA 3T1HQ 1W2BA 5ELNA 2R7ZG 4A3DG 4HIKA 4L5RC 2NVTH 4A3MH 3I55A 2B29A 1OTCA 4UP9A 1UE1A 3HKZG 1UWVA 4TVAB 3KF6B 2VY3A 1Q7YC 1PA6A 1PH1A 4MNOA 4OO1G 1IYJB 1I94Q 3AEVA 3F2BA 5JJLA 3S2DH 1Q1EA 1VQKA 4LF9Q 1V9PA 1XMQL 2NVQH 4DR7Q 3MXNB 4QJFA 3GTJH 3GTOH 3M3YH 2NN6G 5LMNQ 4NB3A 1WCMH 3PGZA 1U5KA 3FP9A 3I56A 4X64L 1XJVA 1VQDA 4JV5L 4Y7NH 3D0FA 4A3CG 4APVA 1JT8A 5HY6A 2ATWA 1VS0A 3CCJA 1AE2A 2Z6KA 3GTPH 4DV2Q 3UDXA 4ME3A 2JJQA 4A3FH 1XMOL 3M4OH 2CFMA 2ID0A 1YIJA 4OX9L 4NXNL 1J5EL 2RHSB 3RZOH 1Q46A 2V1CC 4BA1I 4GNXC 4GKKL 5IP7H 3TS2A 3AQQA 1PH4A 5M3MH 1QZGA 1VQLA 4LFBQ 5C0XG 5IWAQ 4PZ7A 4WJ4A 2IHFA 3K81C 4YWKA 1N9WA 3AFQA 4A3EH 2GVBA 1MKHA 4DV3L 4C3HH 3CPWA 2JE6I 1P8LA 1RL2A 2ZTCA 4LF7Q 1NBWA 2RCNA 3RLFA 4IJLA 2I5LX 4JBWA 3W1BA 4R4QA 4LF4L 2R7DA 2PQAB 2UUBQ 4DR4L 1XNQQ 1SROA 2LSSA 4LF5Q 1XPRA 4L5SA 1Q86C 4QQBX 1V1QA 1C9OA 1CKNA 4TQUS 5GAHC 3H0GH 1KXLA 5C0XJ 1X9NA 1HR0Q 4GS3A 4LUZA 1WI5A 1V43A 2DUDA 1KL9A 1C0AA 1TWHH 1SLJA 4DR3L 4YHHL 4KHZA 4JI8Q 4A3KG 2R7ZH 2ZTDA 4OXPA 4BY7G 4A3DH 3RZDH 4JYAL 2N78A 4GLXA 3TQYA 2YTYA 3RR5A 4IOCA 2VUMH 2IY5B 4JOIC 4RG1A 4GNXA 1VQOA 4DV7L 1HNXL 5GROA 3KLWA 3WWVA 3IRBA 4GN3B 2I5HA 1S72A 1PH7A 1VQ9A 4B3TQ 1XNRQ 3GTKH 2EXDA 3CCLA 1IBMQ 5JJKA 1SMXA 1X55A 3HKSA 4JI4Q 3Q8DA 3I4NG 1OXXK 4HJ7A 2JA6G 1OXVA 1GM5A 5IYCH 3BU2A 4NXML 1I6HH 2PNHA 3TEHB 4B3RL 3ICEA 4X66L 1M1KC 3U50C 4DV0L 2VNUD 4DKAC 3KJOA 3PUVA 4UP8A 4HIOA 5BR8Q 1KRTA 1A63A 3STBD 1WCMG 2K5VA 2K5HA 2F3IA 4OWXB 2HT1A 1PH6A 3CAMA 4AQYL 3CMAA 3OW2A 5FJ8G 1E24A 1EQRA 2Y0SE 3UDIA 1K8AC 1JE5A 4GKJL 1G291 1K3RA 4JCVE 5JEAJ 4B3SL 3A5ZB 1Q8KA 4JOIA 4HJ5A 3B6YA 4A3FG 4WJ3M 1TWFH 1MJCA 4JI6L 1RIPA 4K0KL 3KYHC 1E3PA 3A74A 4A3LG 3CCEA 3E9IA 2OQ0A 3S1QH 1Q12A 1T9HA 3U58A 2NZOA 5M3MG 4DUYQ 2PQAA 1XPOA 4LWCA 4DK3C 1YNXA 2F52A 3PUZA 1OXUA 4A3EG 3DM3A 1CSQA 4DV4L 1TWCH 2C35B 2Y0SG 4ALPA 2OWOA 1I3QH 1UE6A 1E1OA 4DR5L 1FVIA 3S15H 4PMWA 4X62L 5C3EG 4O0AA 2CQOA 1JB7A 1EQQA 1Q82C 4A3KH 5LMUL 4BY7H 3M4PA 1CKNB 1EIYB 3M9BA 2K14A 4IFDI 3AFPA 1CKOA 3M4QA 2JA8H 2FXQA 1N32Q 4GLVB 2OTLA 1JJGA 2UU9L 4YY3Q 1BBUA 4LFCL 2UUAL 2BA0A 4JBMA 2MQHA 2VUMG 4DR2Q 5IE8A 1YJ9A 1TXYA 3W1GA 1MIUA 2OQKA 3I4NH 4GNXB 2NVXH 2YV5A 2L15A 1VQ8A 1U0LA 1BVSA 2PMZE 1Y1WG 2UXCQ 4JI2Q 3EIVA 4Y52H 2A1AA 3K0XA 1IBKQ 1PVOA 4JI5L 4YWLA 5EAYA 3OTOL 1HNZL 1VQJA 3EN2A 1IL2A 2RF4A 2K4KA 3RNUA 4DR6L 2VQFQ 5GADC 4DR1L 4LF6L 1IBLL 2R7FA 1E1TA 4P72A 4PZ6A 5IYCG 4IO9A 2AHOB 2WP8J 3ZJYC 3FKIH 1I50H 2PI2E 2VS1A 4P73A 3JAMc 3L2PA 4DUZQ 1VQNA 3E0EA 5FJ8H 3T1HL 1D8LA 4KHPQ 2E8GA 4MTNA 3GDEA 3EBEA 3CXCA 2ALYB 1SE8A 3I7FA 1X6OA 4A3JH 2Q2TA 1HZBA 2E5LQ 3PIOA 1UE7A 3L7ZC 1R9TH 2F4VQ 4GN4B 1SRUA 3CCUA 2GN5A 2JA7H 3PO2G 4LUOA 4A3LH 1I94L 1YEZA 2KENA 3D31A 1P16A 1EUJA 4LF9L 4DR7L 2I0QA 1VQFA 4P74A 1QVFA 4A76A 3J80c 1EWIA 3JC66 5LMNL 1KQSA 4B3MQ 2H5XA 4DV3Q 4QY7A 4OONA 4KI0A 4UP7A 1K73C 1X65A 3G6EA 3AYHB 1NY4A 4C3JH 2JA9A 3K80C 4LF4Q 4IJHA 4DV1Q 1X3GA 4DV5Q 5C3EH 4DV2L 1DGSA 5C44G 1YJWA 2Q2IA 2YTXA 5IP9H 1E22A 1K9MC 2KCMA 5K36G 3RN5A 1Z47A 3OYYA 4MZ9A 1LM0A 1PHJA 4R4OA 4UPAA 3UDGA 1YHQA 2I5MX 4LFBL 5IWAL 2ZTEA 3MEFA 4O2DA 1WOCA 4A3IG 3NEMA 1VQ5A 5HGQA 1LTLA 5LMNW 3PF5A 2JA8G 4LF7L 4IFDG 2UXDQ 1VQMA 3HOWH 2ZJRA 2ZM6Q 4GN5A 2R92H 3A0JA 1Y1WH 1HZ9A 1YBYA 4JI0Q 4JG2A 4JI7Q 2UUBL 2UXBQ 4LF5L 2VW9A 1Y14B 2NZHA 4R1JA 1SR3A 2RHQB 4BY1G 1FJGQ 1N33Q 4IPGA 4AH6A 3UE0A 5C4JH 1K83H 1VQBA 1YZ6A 1HR0L 2ZJPA 1LYLA 4R4IA 5GQOA 4LUVA 2HHHQ 5FLXc 2YU9H 1QVGA 4HJ8A 3J81c 4A93H 4LFAQ 3KOJA 3HOXG 4A75A 1HZAA 4BA2I 2N49A 1HH2P 1MJEA 2E2HH 3F8TA 3FKIG 1PH9A 1XNRL 4OO1I 4B3TL 2JA5H 3PO2H 2N8NA 5IYDG 1IBML 4IPHA 4X65Q 2QA4A 4JI4L 4YCUA 2NN6I 4A3JG 1ASZA 3T1YQ 2VL6A 3KFUA 3S24A 1HNWQ 1XPUA 4GOPC 1G51A 2WAQE 4AIMA 2JA7G 2AWOA 2CWAA 1PH2A 1HR0W 1YITA 1NE3A 1PYSB 2Q2HA 3CF5A 5M5XH 2JEBI 1UEBA 1WJJA 3G4SA 1BKBA 4LF8Q 2D0PA 2UUCL 1D7QA 5E7NA 2KBNA 3GTGH 3HOZH 1YVCA 1EOVA 2CWPA 4P71A 5BR8L 5C44H 3BJUA 5AJ3L 1S40A 1HJPA 4DV6Q 4QGUA 4HIMA 1ASYA 2IHEA 4BBRG 2VQEQ 3ULLA 2B3GA 2BH2A 2JEAI 2BH8A 5DLQE 1L1OC 5C0XI 1FL0A 3PUXA 1VQAA 2WAQG 1VQGA 1N34Q 2Z0SA 2E2JH 5IP9G 1SN8A 4OWTB 4JI3Q 1KRSA 1N36Q 1X3FA 1JJCB 4POFA 4A3IH 1VQEA 1N8RC 4HJ9A 2IX1A 4JI1L 1X3EA 4DUYL 2HIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGI A;  3JAM i;  3DLL A;  2EIF A;  4GOP A;  3CCS A;  3I4M G;  3RN2 A;  1GO3 E;  1YHA A;  4EQ5 A;  5FLM G;  4BY1 H;  3HOW G;  4J15 A;  1GVP A;  3TS0 A;  1PH3 A;  2R92 G;  3H3V I;  3HOY G;  3NBH B;  3HOU G;  4L5T A;  2D0O A;  2K75 A;  1XMQ Q;  3KJP A;  4LNQ A;  3I2Z A;  2VZA A;  3NEL A;  1JMC A;  4C2M H;  4LF6 Q;  3GTL H;  2GVA A;  1VQP A;  3HOX H;  2DGY A;  4X64 Q;  1L1O A;  4HJA A;  4JV5 Q;  3BZC A;  1TWG H;  2IX0 A;  1N32 L;  5C4X H;  1C7Y A;  1KC8 C;  1IXR A;  5M3F H;  4YY3 L;  2B63 G;  3KDF A;  4A93 G;  5IYD H;  4DAM A;  4XIG S;  3K7A H;  1EIF A;  1KIX A;  1QUQ B;  1VCI A;  1Y1V G;  4DR2 L;  1XMO Q;  4YCV A;  2MNA A;  2WB1 E;  3S16 H;  4OX9 Q;  5IT9 c;  4NXN Q;  1J5E Q;  2UXC L;  2JA5 G;  4JI2 L;  4LW1 A;  5IY0 A;  4GKK Q;  1IBK L;  3J81 j;  1HZC A;  1K8G A;  1TWA H;  2VQF L;  3STB C;  5M5Y H;  4X6A H;  3PO3 G;  4A3G H;  1S3O A;  2WFW A;  2EQS A;  1EFW A;  3FHW A;  2QGQ A;  1PFS A;  4QL5 A;  3ERS X;  4BBR H;  4BXX H;  3PV0 A;  2E2I H;  5M5W H;  4DUZ L;  3G48 A;  3PIP A;  1YJN A;  3HOV H;  1G6P A;  5IYB H;  1B70 B;  2LXK A;  1VQI A;  4C3I H;  2WB1 G;  1JJ2 A;  2KHI A;  3HOZ G;  4R4C A;  4DR4 Q;  1CKM A;  4KHP L;  4YCW A;  2ZJQ A;  3UDF A;  3S2H H;  1VQ4 A;  3E9H A;  5H1S E;  1B7Y B;  2E5L L;  1X56 A;  2K52 A;  5JJI A;  3S1N H;  1VQH A;  4HID A;  2F4V L;  1CSP A;  3S1M H;  3J7Z C;  4DR3 Q;  4YHH Q;  3L0O A;  1K0R A;  1NJI C;  4B3M L;  4JYA Q;  1NTG A;  4NPS A;  1EYG A;  3I4M H;  1Q1B A;  3J81 i;  4A3B G;  1HNX Q;  5FLM H;  3KF8 B;  4DV7 Q;  2R93 H;  4GLA C;  3HFZ B;  3K7U C;  3ER0 A;  2Q2U A;  3PSI A;  3S17 H;  3HOY H;  3F2D A;  4DV1 L;  1KHI A;  4DV5 L;  3CD6 A;  3HOU H;  3M85 A;  4BBS G;  4XTC S;  4AYB E;  1XNQ L;  1H95 A;  3J7A 5;  4GOP B;  1GD7 A;  1PH5 A;  1QZH A;  3LGJ A;  2JA6 H;  3CME A;  5J3B A;  3W5O A;  3PCO B;  4PZ8 A;  3CW2 C;  2HIV A;  4NXM Q;  2LXJ A;  1FGU A;  2CCZ A;  4B3R Q;  4X66 Q;  3NEN A;  4IFD J;  1E7Z A;  4DV0 Q;  1UE5 A;  2MO0 A;  4JI8 L;  1IZ6 A;  4OWW B;  2B63 H;  1SFO H;  1QUQ A;  4RMF A;  3K8A A;  2NVY H;  1Y1V H;  2A19 A;  4PG3 A;  1VQ6 A;  1PYB A;  3KF6 A;  1L1O B;  1A8V A;  4AYB G;  4R4T A;  2ZM6 L;  2K50 A;  4AQY Q;  2UXD L;  4JC0 A;  2ES2 A;  5C4X G;  4JI0 L;  3GTM H;  4POG A;  5M3F G;  2ASB A;  2JQO A;  1I5F A;  2XTI A;  3A5U A;  4JI7 L;  1CUK A;  4FDB A;  4GKJ Q;  2UXB L;  3KDF B;  4DNI A;  1OXS C;  4B3S Q;  4A3M G;  4UY8 C;  1N33 L;  1FJG L;  4JI6 Q;  4K0K Q;  3M7N A;  4QIW E;  2MFI A;  4IPD A;  5JEA G;  1NMF A;  3PO3 H;  4EX5 A;  1J6Q A;  3CCV A;  3CC4 A;  3U4Z A;  4L5Q A;  2HHH L;  4A3C H;  3ULP A;  2UUC Q;  3RLO A;  3PUY A;  2D62 A;  1GKH A;  3CP0 A;  4IOA A;  3CCM A;  1PH8 A;  3S1R H;  3PF4 A;  5AJ3 Q;  2PI2 A;  4LFA L;  1L2F A;  4DV4 Q;  1KAW A;  1A62 A;  5ELO A;  4A3G G;  4BXX G;  1LUZ A;  1WFQ A;  2YTV A;  3BZK A;  4DR5 Q;  3GTQ H;  2KHJ A;  3CCQ A;  3HOV G;  1XTD A;  5IYB G;  1YI2 A;  4IPC A;  1W3S A;  4X62 Q;  1Q81 C;  4KLK A;  3VDY A;  2HQL A;  1KD1 C;  2XGT A;  4X65 L;  2OCE A;  2IT1 A;  4JBJ A;  3U4V A;  3RLN A;  1B8A A;  4DAY B;  3T1Y L;  3ULJ A;  4H02 A;  1NMG A;  5LMU Q;  1HNW L;  4DPG A;  4A3B H;  1BBW A;  2R6G A;  5IP7 G;  4JI1 Q;  1OXT A;  2K5N A;  3UE1 A;  3S14 H;  4YWM A;  4LF8 L;  2UU9 Q;  2AWN A;  2YYZ A;  3GO5 A;  2QEX A;  4JBK A;  2UUA Q;  4LFC Q;  4BBS H;  2CKZ B;  3CQZ H;  4P75 A;  2AMC B;  4DK6 C;  5GAG C;  1PV4 A;  3PUW A;  1YHB A;  4DV6 L;  3CCR A;  3F2C A;  2VQE L;  2R93 G;  3TRE A;  1QVC A;  1O7I A;  2OTJ A;  3TRZ A;  4DR6 Q;  5GAE C;  2A8V A;  3H3V H;  2MO1 A;  1L0W A;  4JI5 Q;  3HKZ E;  4A4I A;  3OTO Q;  3G71 A;  1N34 L;  2KCT A;  1X54 A;  3H15 A;  1HNZ Q;  1M90 C;  2Z6K C;  1A0I A;  3H0G G;  3I4O A;  1AE3 A;  4JI3 L;  1N36 L;  2BA1 A;  3CC7 A;  1VQC A;  4DR1 Q;  1IBL Q;  1VQ7 A;  3CC2 A;  2JK8 A;  3J80 i;  2N3S A;  3GD7 A;  2AKW B;  1Z9F A;  1AH9 A;  1WYD A;  3F1Z A;  3CPF A;  3T1H Q;  1W2B A;  5ELN A;  2R7Z G;  4A3D G;  4HIK A;  4L5R C;  2NVT H;  4A3M H;  3I55 A;  2B29 A;  1OTC A;  4UP9 A;  1UE1 A;  3HKZ G;  1UWV A;  4TVA B;  3KF6 B;  2VY3 A;  1Q7Y C;  1PA6 A;  1PH1 A;  4MNO A;  4OO1 G;  1IYJ B;  1I94 Q;  3AEV A;  3F2B A;  5JJL A;  3S2D H;  1Q1E A;  1VQK A;  4LF9 Q;  1V9P A;  1XMQ L;  2NVQ H;  4DR7 Q;  3MXN B;  4QJF A;  3GTJ H;  3GTO H;  3M3Y H;  2NN6 G;  5LMN Q;  4NB3 A;  1WCM H;  3PGZ A;  1U5K A;  3FP9 A;  3I56 A;  4X64 L;  1XJV A;  1VQD A;  4JV5 L;  4Y7N H;  3D0F A;  4A3C G;  4APV A;  1JT8 A;  5HY6 A;  2ATW A;  1VS0 A;  3CCJ A;  1AE2 A;  2Z6K A;  3GTP H;  4DV2 Q;  3UDX A;  4ME3 A;  2JJQ A;  4A3F H;  1XMO L;  3M4O H;  2CFM A;  2ID0 A;  1YIJ A;  4OX9 L;  4NXN L;  1J5E L;  2RHS B;  3RZO H;  1Q46 A;  2V1C C;  4BA1 I;  4GNX C;  4GKK L;  5IP7 H;  3TS2 A;  3AQQ A;  1PH4 A;  5M3M H;  1QZG A;  1VQL A;  4LFB Q;  5C0X G;  5IWA Q;  4PZ7 A;  4WJ4 A;  2IHF A;  3K81 C;  4YWK A;  1N9W A;  3AFQ A;  4A3E H;  2GVB A;  1MKH A;  4DV3 L;  4C3H H;  3CPW A;  2JE6 I;  1P8L A;  1RL2 A;  2ZTC A;  4LF7 Q;  1NBW A;  2RCN A;  3RLF A;  4IJL A;  2I5L X;  4JBW A;  3W1B A;  4R4Q A;  4LF4 L;  2R7D A;  2PQA B;  2UUB Q;  4DR4 L;  1XNQ Q;  1SRO A;  2LSS A;  4LF5 Q;  1XPR A;  4L5S A;  1Q86 C;  4QQB X;  1V1Q A;  1C9O A;  1CKN A;  4TQU S;  5GAH C;  3H0G H;  1KXL A;  5C0X J;  1X9N A;  1HR0 Q;  4GS3 A;  4LUZ A;  1WI5 A;  1V43 A;  2DUD A;  1KL9 A;  1C0A A;  1TWH H;  1SLJ A;  4DR3 L;  4YHH L;  4KHZ A;  4JI8 Q;  4A3K G;  2R7Z H;  2ZTD A;  4OXP A;  4BY7 G;  4A3D H;  3RZD H;  4JYA L;  2N78 A;  4GLX A;  3TQY A;  2YTY A;  3RR5 A;  4IOC A;  2VUM H;  2IY5 B;  4JOI C;  4RG1 A;  4GNX A;  1VQO A;  4DV7 L;  1HNX L;  5GRO A;  3KLW A;  3WWV A;  3IRB A;  4GN3 B;  2I5H A;  1S72 A;  1PH7 A;  1VQ9 A;  4B3T Q;  1XNR Q;  3GTK H;  2EXD A;  3CCL A;  1IBM Q;  5JJK A;  1SMX A;  1X55 A;  3HKS A;  4JI4 Q;  3Q8D A;  3I4N G;  1OXX K;  4HJ7 A;  2JA6 G;  1OXV A;  1GM5 A;  5IYC H;  3BU2 A;  4NXM L;  1I6H H;  2PNH A;  3TEH B;  4B3R L;  3ICE A;  4X66 L;  1M1K C;  3U50 C;  4DV0 L;  2VNU D;  4DKA C;  3KJO A;  3PUV A;  4UP8 A;  4HIO A;  5BR8 Q;  1KRT A;  1A63 A;  3STB D;  1WCM G;  2K5V A;  2K5H A;  2F3I A;  4OWX B;  2HT1 A;  1PH6 A;  3CAM A;  4AQY L;  3CMA A;  3OW2 A;  5FJ8 G;  1E24 A;  1EQR A;  2Y0S E;  3UDI A;  1K8A C;  1JE5 A;  4GKJ L;  1G29 1;  1K3R A;  4JCV E;  5JEA J;  4B3S L;  3A5Z B;  1Q8K A;  4JOI A;  4HJ5 A;  3B6Y A;  4A3F G;  4WJ3 M;  1TWF H;  1MJC A;  4JI6 L;  1RIP A;  4K0K L;  3KYH C;  1E3P A;  3A74 A;  4A3L G;  3CCE A;  3E9I A;  2OQ0 A;  3S1Q H;  1Q12 A;  1T9H A;  3U58 A;  2NZO A;  5M3M G;  4DUY Q;  2PQA A;  1XPO A;  4LWC A;  4DK3 C;  1YNX A;  2F52 A;  3PUZ A;  1OXU A;  4A3E G;  3DM3 A;  1CSQ A;  4DV4 L;  1TWC H;  2C35 B;  2Y0S G;  4ALP A;  2OWO A;  1I3Q H;  1UE6 A;  1E1O A;  4DR5 L;  1FVI A;  3S15 H;  4PMW A;  4X62 L;  5C3E G;  4O0A A;  2CQO A;  1JB7 A;  1EQQ A;  1Q82 C;  4A3K H;  5LMU L;  4BY7 H;  3M4P A;  1CKN B;  1EIY B;  3M9B A;  2K14 A;  4IFD I;  3AFP A;  1CKO A;  3M4Q A;  2JA8 H;  2FXQ A;  1N32 Q;  4GLV B;  2OTL A;  1JJG A;  2UU9 L;  4YY3 Q;  1BBU A;  4LFC L;  2UUA L;  2BA0 A;  4JBM A;  2MQH A;  2VUM G;  4DR2 Q;  5IE8 A;  1YJ9 A;  1TXY A;  3W1G A;  1MIU A;  2OQK A;  3I4N H;  4GNX B;  2NVX H;  2YV5 A;  2L15 A;  1VQ8 A;  1U0L A;  1BVS A;  2PMZ E;  1Y1W G;  2UXC Q;  4JI2 Q;  3EIV A;  4Y52 H;  2A1A A;  3K0X A;  1IBK Q;  1PVO A;  4JI5 L;  4YWL A;  5EAY A;  3OTO L;  1HNZ L;  1VQJ A;  3EN2 A;  1IL2 A;  2RF4 A;  2K4K A;  3RNU A;  4DR6 L;  2VQF Q;  5GAD C;  4DR1 L;  4LF6 L;  1IBL L;  2R7F A;  1E1T A;  4P72 A;  4PZ6 A;  5IYC G;  4IO9 A;  2AHO B;  2WP8 J;  3ZJY C;  3FKI H;  1I50 H;  2PI2 E;  2VS1 A;  4P73 A;  3JAM c;  3L2P A;  4DUZ Q;  1VQN A;  3E0E A;  5FJ8 H;  3T1H L;  1D8L A;  4KHP Q;  2E8G A;  4MTN A;  3GDE A;  3EBE A;  3CXC A;  2ALY B;  1SE8 A;  3I7F A;  1X6O A;  4A3J H;  2Q2T A;  1HZB A;  2E5L Q;  3PIO A;  1UE7 A;  3L7Z C;  1R9T H;  2F4V Q;  4GN4 B;  1SRU A;  3CCU A;  2GN5 A;  2JA7 H;  3PO2 G;  4LUO A;  4A3L H;  1I94 L;  1YEZ A;  2KEN A;  3D31 A;  1P16 A;  1EUJ A;  4LF9 L;  4DR7 L;  2I0Q A;  1VQF A;  4P74 A;  1QVF A;  4A76 A;  3J80 c;  1EWI A;  3JC6 6;  5LMN L;  1KQS A;  4B3M Q;  2H5X A;  4DV3 Q;  4QY7 A;  4OON A;  4KI0 A;  4UP7 A;  1K73 C;  1X65 A;  3G6E A;  3AYH B;  1NY4 A;  4C3J H;  2JA9 A;  3K80 C;  4LF4 Q;  4IJH A;  4DV1 Q;  1X3G A;  4DV5 Q;  5C3E H;  4DV2 L;  1DGS A;  5C44 G;  1YJW A;  2Q2I A;  2YTX A;  5IP9 H;  1E22 A;  1K9M C;  2KCM A;  5K36 G;  3RN5 A;  1Z47 A;  3OYY A;  4MZ9 A;  1LM0 A;  1PHJ A;  4R4O A;  4UPA A;  3UDG A;  1YHQ A;  2I5M X;  4LFB L;  5IWA L;  2ZTE A;  3MEF A;  4O2D A;  1WOC A;  4A3I G;  3NEM A;  1VQ5 A;  5HGQ A;  1LTL A;  5LMN W;  3PF5 A;  2JA8 G;  4LF7 L;  4IFD G;  2UXD Q;  1VQM A;  3HOW H;  2ZJR A;  2ZM6 Q;  4GN5 A;  2R92 H;  3A0J A;  1Y1W H;  1HZ9 A;  1YBY A;  4JI0 Q;  4JG2 A;  4JI7 Q;  2UUB L;  2UXB Q;  4LF5 L;  2VW9 A;  1Y14 B;  2NZH A;  4R1J A;  1SR3 A;  2RHQ B;  4BY1 G;  1FJG Q;  1N33 Q;  4IPG A;  4AH6 A;  3UE0 A;  5C4J H;  1K83 H;  1VQB A;  1YZ6 A;  1HR0 L;  2ZJP A;  1LYL A;  4R4I A;  5GQO A;  4LUV A;  2HHH Q;  5FLX c;  2YU9 H;  1QVG A;  4HJ8 A;  3J81 c;  4A93 H;  4LFA Q;  3KOJ A;  3HOX G;  4A75 A;  1HZA A;  4BA2 I;  2N49 A;  1HH2 P;  1MJE A;  2E2H H;  3F8T A;  3FKI G;  1PH9 A;  1XNR L;  4OO1 I;  4B3T L;  2JA5 H;  3PO2 H;  2N8N A;  5IYD G;  1IBM L;  4IPH A;  4X65 Q;  2QA4 A;  4JI4 L;  4YCU A;  2NN6 I;  4A3J G;  1ASZ A;  3T1Y Q;  2VL6 A;  3KFU A;  3S24 A;  1HNW Q;  1XPU A;  4GOP C;  1G51 A;  2WAQ E;  4AIM A;  2JA7 G;  2AWO A;  2CWA A;  1PH2 A;  1HR0 W;  1YIT A;  1NE3 A;  1PYS B;  2Q2H A;  3CF5 A;  5M5X H;  2JEB I;  1UEB A;  1WJJ A;  3G4S A;  1BKB A;  4LF8 Q;  2D0P A;  2UUC L;  1D7Q A;  5E7N A;  2KBN A;  3GTG H;  3HOZ H;  1YVC A;  1EOV A;  2CWP A;  4P71 A;  5BR8 L;  5C44 H;  3BJU A;  5AJ3 L;  1S40 A;  1HJP A;  4DV6 Q;  4QGU A;  4HIM A;  1ASY A;  2IHE A;  4BBR G;  2VQE Q;  3ULL A;  2B3G A;  2BH2 A;  2JEA I;  2BH8 A;  5DLQ E;  1L1O C;  5C0X I;  1FL0 A;  3PUX A;  1VQA A;  2WAQ G;  1VQG A;  1N34 Q;  2Z0S A;  2E2J H;  5IP9 G;  1SN8 A;  4OWT B;  4JI3 Q;  1KRS A;  1N36 Q;  1X3F A;  1JJC B;  4POF A;  4A3I H;  1VQE A;  1N8R C;  4HJ9 A;  2IX1 A;  4JI1 L;  1X3E A;  4DUY L;  2HIX A; 
#chains in the Genus database with same CATH topology
 3BVZ A;  4GOP A;  2K03 A;  4X3T A;  3CCS A;  2NZ1 D;  4EQ5 A;  2XSC A;  1SNC A;  1NUC A;  2OT2 A;  1PH3 A;  3H3V I;  4L5T A;  1QIL A;  4LNQ A;  3KJP A;  1SNO A;  1SFO B;  3GTL H;  1QOH A;  3SEB A;  2EYM A;  1PLF A;  4X64 Q;  1L1O A;  3P20 A;  4JV5 Q;  1TWG H;  5C4X H;  3CU7 A;  4WOR A;  2SNS A;  2B63 G;  4A93 G;  2FIN B;  1SNQ A;  3ND9 A;  4DR2 L;  2FJ2 A;  3S16 H;  1CQV A;  2KEE A;  2UXC L;  4LW1 A;  5IY0 A;  4X3S A;  4CBV A;  5NUC A;  1K8G A;  1TWA H;  2FHT A;  4JK1 C;  3QIA A;  1B4O A;  1Y8O B;  2VQF L;  5JPN C;  3STB C;  2WAC A;  1S3O A;  2WFW A;  3NTI A;  5KEE A;  1FYC A;  4QL5 A;  4BBR H;  1E2Z A;  2D5D A;  5CV8 A;  5M5W H;  3G48 A;  3RUZ A;  3HOV H;  3BVM A;  5IYB H;  1B70 B;  4C3I H;  4CJ1 B;  4ABN A;  1JJ2 A;  2RQX A;  5EGT A;  3A54 A;  2K52 A;  4LAA A;  5CC4 A;  3J7Z C;  2PQE A;  3SVM A;  1STE A;  2Z4H A;  4YHH Q;  1RTN A;  3LWE A;  4NPS A;  1QWY A;  2EYP A;  2B8F A;  3J81 i;  3IAY A;  2R93 H;  1WVL A;  2O5J C;  2WIN B;  5IIF A;  1EOT A;  3K7U C;  2Q2U A;  5D65 A;  4RCO A;  1BXT A;  3KBX A;  3M85 A;  4AYB E;  1HUN A;  2ZXR A;  4CKC A;  1EL0 A;  1AN8 A;  5J3B A;  2B2W A;  1O7Z A;  3EVQ A;  5EQ0 A;  1ILQ A;  2HIV A;  3A8K E;  3TN2 A;  4NXM Q;  3IFT A;  4X66 Q;  1Q90 A;  3P75 A;  2PYK A;  4CDF C;  4OWW B;  1SFO H;  1ZYR C;  3K8A A;  3I4N B;  1Y1V H;  2A19 A;  3SE0 A;  3LX0 A;  1QJO A;  4C1N K;  1VQ6 A;  1PYB A;  4EQP A;  1A8V A;  3R2I A;  4JC0 A;  2XTI A;  4JI7 L;  3K5L A;  3S2D B;  1ZKO A;  3KDF B;  5EJW A;  4A3M G;  4XQQ A;  1FJG L;  1WCM B;  4EGV A;  3E3X A;  4FP5 D;  4DXG A;  4XQJ A;  1J6Q A;  3PUY A;  2D62 A;  1GKH A;  5HUR A;  4IOA A;  4CDD C;  3CCM A;  4UHV A;  5AJ3 Q;  4RH6 A;  4DV4 Q;  1KAW A;  1EWC A;  5ELO A;  1CI3 M;  5BN4 A;  1KNA A;  5FKA C;  3RZO B;  1LUZ A;  2YTV A;  4DK0 A;  1XTD A;  4IPC A;  2F0P A;  1CA6 A;  1AEX A;  2HQL A;  5M3M B;  4X65 L;  2IT1 A;  5C0X H;  2QCP X;  1Z6H A;  4DAY B;  2RVL A;  1NMG A;  1TKW B;  1HNW L;  4RWS C;  2SOB A;  1EU3 A;  1WTW A;  4JI1 Q;  3FPP A;  1GUO A;  3TDQ A;  4LF8 L;  2UU9 Q;  2AWN A;  3MWY W;  2F1M A;  3BS1 A;  1YHB A;  1B53 A;  2VQE L;  2X69 A;  1ONL A;  2OTJ A;  1SND A;  1RF2 D;  5I2Y A;  2A8V A;  2NUC A;  1MD2 D;  1YNJ C;  2KCT A;  1X54 A;  3H15 A;  4XYO A;  1M90 C;  3H0G G;  3I4O A;  4JI3 L;  1IBL Q;  5FLX E;  3CPF A;  4ZRZ A;  3MVV A;  3BDC A;  3J81 E;  4L5R C;  3I55 A;  1V1P B;  4UP9 A;  3HKZ G;  1GHJ A;  3KF6 B;  1PA6 A;  3T53 B;  3OHX C;  2DJF C;  1I94 Q;  1I6H B;  3S2D H;  1Q1E A;  4DR7 Q;  4QJF A;  1LTT D;  3ITP A;  1V8Q A;  2PMZ B;  4H0L C;  5LMN Q;  5EKK A;  4NB3 A;  1WCM H;  5EPJ A;  1IW7 D;  4Y7N H;  1E2W A;  3D0F A;  2NTT A;  1JT8 A;  5HY6 A;  3CCJ A;  1SEB D;  4DV2 Q;  1S5F D;  4KN7 C;  4NXN L;  1J5E L;  3RZO H;  1UUP A;  1A15 A;  2RSN A;  1Q46 A;  4KN4 C;  1AZQ A;  3S1Q B;  4OEL B;  5M3M H;  5KGU A;  5IWA Q;  4K8J A;  4YWK A;  1I6V C;  2GVB A;  1KAA A;  1MKH A;  3CPW A;  5E4W C;  1P8L A;  1NBW A;  2RCN A;  3S15 B;  1JOO A;  2KHS A;  1EZ8 A;  3PIP 3;  1RJT A;  2LSS A;  4LF5 Q;  1XPR A;  3MTS A;  3LNN A;  1GOZ A;  3P1H A;  2Q8R E;  3HGB A;  2B2T A;  2L1B A;  3W3A A;  1V43 A;  2DUD A;  4DNR B;  2XN9 C;  1PYW D;  3EQL C;  4B9X A;  3DM1 A;  1PZJ D;  1STN A;  2ZTD A;  4JYA L;  1X3P A;  5COY A;  3KLW A;  3KLR A;  1XNR Q;  1S72 A;  2EY2 A;  4QF4 A;  2CW0 D;  4K6D A;  4OO1 H;  2EXD A;  2RCF A;  1IBM Q;  5EBD A;  3HKS A;  4JI4 Q;  3C1F A;  3Q8D A;  5I4D A;  1OXX K;  4R8N A;  5AFW A;  2NN6 H;  1OO9 B;  1GM5 A;  3FKI B;  1I6H H;  3TEH B;  2B8G A;  4DKA C;  4UP8 A;  3STB D;  2K5D A;  1D1K A;  2GA4 B;  2JA7 B;  5FJ8 G;  1QG7 A;  5IGC A;  5JEA J;  1AW7 A;  5DM6 3;  1I4R A;  1Q8K A;  1RDP D;  4HJ5 A;  3VA5 A;  3G7L A;  1RIP A;  1F9Q A;  2N55 A;  1H9S A;  3VR6 A;  4KMU C;  3VR2 A;  1A2T A;  2MP1 A;  3S1Q H;  1Q12 A;  3A7L A;  3U58 A;  4DUY Q;  1O7Y A;  2PQA A;  4DK3 C;  3I8Z A;  3PUZ A;  4H44 C;  1OXU A;  2C35 B;  4ALP A;  2Z8L A;  3OMG A;  1S5E D;  1I3Q H;  2A74 C;  3DEP A;  2OWO A;  3S1M B;  5FOB B;  1E1O A;  1CZW A;  3S15 H;  5J22 A;  4RAU C;  3VR4 A;  3OMC A;  3MXU A;  4A3K H;  4BY7 H;  1EIY B;  3A8I E;  3M4Q A;  1BUV T;  4HED A;  1GHK A;  1HXY D;  1AP0 A;  4K8I A;  1BBU A;  5C4Z A;  1ET9 A;  1ZYR D;  3R2T A;  2VUM G;  5A2Q E;  4DR2 Q;  1YJ9 A;  1MIU A;  2QW7 A;  4GNX B;  2NVX H;  2UXC Q;  1PVO A;  2B63 B;  4A93 B;  2VQF Q;  2G9D A;  4DR1 L;  5JJZ A;  2ZXP A;  2AHO B;  5EBC A;  3FKI H;  3OOC A;  2F0D A;  5C5L A;  4E6I A;  3E0E A;  1D8L A;  2ALY B;  4ZK9 B;  5IOC A;  1IYV A;  3SK4 A;  3G6J B;  1E2V A;  4TSS A;  2K1B A;  2Q2T A;  1ESR A;  1UE7 A;  3KBG A;  3BDO A;  3GV6 A;  4F88 A;  3HZX A;  2JA7 H;  2G5D A;  1GUS A;  1P16 A;  5FO7 B;  4LF9 L;  1JQY D;  1LT3 D;  2H5X A;  3W2D A;  4DV3 Q;  4QY7 A;  4I65 A;  2JP1 A;  1CM9 A;  1NY4 A;  2JA9 A;  3A56 A;  4IJH A;  1XWE A;  1YJW A;  1E22 A;  1SMY C;  1K9M C;  3RN5 A;  1Z47 A;  1PMR A;  1LM0 A;  3NBI A;  4UPA A;  5DAU A;  1YNJ D;  1EEI D;  3NTH A;  1EYD A;  1ESF A;  3PF5 A;  2JA8 G;  2A5H A;  4DU9 A;  5LL6 S;  1VQM A;  2ZJR A;  4DGZ A;  3BDL A;  1Y1W H;  1YBY A;  3D4W A;  3NK9 A;  5EPL A;  4JI7 Q;  3T56 B;  2UUB L;  1EFI D;  1EY7 A;  2RHQ B;  1FJG Q;  3UE0 A;  2KEC A;  1CFM A;  4R9W A;  2G9H D;  3OSO A;  1LYL A;  3VYR A;  4A93 H;  2B2V A;  4A3M B;  3KOJ A;  3HOX G;  1MJE A;  1HH2 P;  1W6J A;  4I7A A;  1PZK D;  1U4L A;  2N8N A;  5IYD G;  1O80 A;  4X65 Q;  1MSH A;  1SYD A;  4A3J G;  1HNW Q;  1Y69 U;  4GOP C;  2PZU A;  2AQ2 B;  2FMM A;  2AWO A;  2QEJ C;  1LT6 D;  1PYS B;  3G4S A;  1V1O A;  4LF8 Q;  1VF7 A;  2D0P A;  1D7Q A;  5JOB A;  3MFY A;  4P71 A;  5ISR A;  5C44 H;  5AJ3 L;  2L11 A;  1ASY A;  2VQE Q;  3S1N B;  4KD3 A;  1TT2 A;  2B3G A;  3FEW X;  1L1O C;  5CV9 A;  1PFN A;  2KQ3 A;  1VQA A;  2IW3 A;  2VB2 X;  2WAQ G;  1R4Q B;  2Z0S A;  4JI3 Q;  4POF A;  1N8R C;  3HS0 C;  4IFD H;  4OIK A;  4HJ9 A;  2TSS A;  4JI1 L;  4CKB A;  1SBB B;  3BG3 A;  5EPK A;  2EDG A;  1WTO A;  1XYI A;  3HOU B;  2EIF A;  3I4M G;  3RN2 A;  3RD4 A;  3H0G B;  1Q3L A;  4PMB A;  5FLM G;  4BY1 H;  2EYO A;  3HOW G;  4J15 A;  1GVP A;  3TS0 A;  4LJZ C;  2R92 G;  3HOY G;  4KJN A;  2D0O A;  5KRU A;  1HTP A;  1GXD C;  5LHY 1;  1JMC A;  2GVA A;  4K14 A;  1G2T A;  2K04 A;  3X3M A;  1WD1 A;  1LTG D;  3HKZ B;  1ZXT A;  4YY3 L;  3KDF A;  1QUQ B;  4PNY A;  4YCV A;  2MNA A;  4C56 C;  5T1G A;  1HTL D;  3I72 A;  2PNR C;  4CDC C;  1J5E Q;  4NXN Q;  3PO3 B;  4JI2 L;  4NMZ A;  5DEH A;  1HZC A;  2F0K A;  3OWF A;  1EFW A;  1K8M A;  2VB3 X;  5K5P A;  1PTO H;  3GTQ B;  1ENC A;  2B2W C;  3DEO A;  4RFB A;  1CKM A;  4YCW A;  2ZJQ A;  3UDF A;  1TWF B;  3E9H A;  2E5L L;  3S1N H;  3TP8 A;  1TVX A;  3TSS A;  4HID A;  1CSP A;  2D9U A;  4CHT B;  3S14 B;  2B2Y A;  1BCP C;  4J6H A;  1F9R A;  1GJX A;  4B3M L;  2F4I A;  4JYA Q;  3NQT A;  1NNX A;  1QNK A;  2XIW A;  4A3B G;  3AMU A;  4Q0F A;  4B9W A;  1S4Z A;  3HFZ B;  1TII D;  3GP7 A;  4DV1 L;  1KHI A;  3CD6 A;  3HOU H;  4BBS G;  3MEH A;  1H95 A;  3J7A 5;  1STB A;  2I07 B;  4PZ8 A;  1GUN A;  3CW2 C;  1WTP A;  1B9M A;  1SAP A;  1U4M A;  1MGS A;  2LXJ A;  1UEA B;  1E7Z A;  1UE5 A;  2MO0 A;  3T4A C;  1IZ6 A;  1AFP A;  3R8B A;  4RMF A;  2NVT B;  1V1P A;  5CV7 A;  3KF6 A;  4AYB G;  4FF1 A;  5M3F G;  3JAM L;  2JQO A;  1I5F A;  1DCZ A;  1U9R A;  2PW5 A;  4UY8 C;  4IQZ A;  5I9O A;  3M7N A;  4IPD A;  5JEA G;  1NMF A;  3PO3 H;  4EX5 A;  3CCV A;  1I50 B;  3U4Z A;  2HHH L;  3ULP A;  3MAQ A;  3PF4 A;  1QNU A;  1LTS D;  1R9T B;  2RDH A;  2XWJ B;  3GTQ H;  3IFD A;  3CCQ A;  4YIJ A;  1W3S A;  4Z9C B;  4FXG C;  4KLK A;  1KD1 C;  1RCV D;  2XGT A;  5LL6 X;  2K01 A;  5D3I B;  4DPG A;  3DWA A;  1SE2 A;  1BBW A;  5IP7 G;  3S14 H;  4YWM A;  2FFK B;  2IX3 A;  2A6E C;  3DMU A;  4P75 A;  2AMC B;  1PV4 A;  4DXF A;  4ULL A;  1FNV A;  1SE3 A;  3H3V H;  1TWH B;  4WFN 3;  1N34 L;  5I2X A;  4LMQ D;  4I7Z C;  1A0I A;  2JA6 G;  1AE3 A;  2BA1 A;  4DR1 Q;  1VQC A;  2VUM B;  1O78 A;  2JK8 A;  3SK8 A;  2N3S A;  2OEO A;  2AKW B;  1Z9F A;  3GD7 A;  1AH9 A;  3X3N A;  1PTO C;  4HTH A;  2R7Z G;  4A3D G;  2NVT H;  1HQR D;  4L6T B;  4TVA B;  4QCL A;  1PH1 A;  2F0S A;  3K0Y A;  3K58 A;  5JJL A;  4DFA A;  4LF9 Q;  1VQK A;  1V9P A;  1XMQ L;  1KLU D;  3GTO H;  2EJF C;  2F0T A;  1ML0 D;  1CK1 A;  1EYA A;  2ICI A;  5BN5 A;  5BN3 A;  1VQD A;  4APV A;  2B2T C;  1AE2 A;  2Z6K A;  5M9O A;  1Y8N B;  1XMO L;  3KLS X;  1YIJ A;  2K5W A;  1L0X B;  1CT1 D;  1MSG A;  4BA1 I;  4GKK L;  1VQL A;  4RGN A;  4XYQ A;  4PZ7 A;  2IHF A;  1W6K A;  4ZKC B;  1N9W A;  4DV3 L;  4C3H H;  1RL2 A;  2QIL A;  2I5L X;  4F8M A;  2X6G A;  2JYO A;  4RHR A;  2UUB Q;  4QQB X;  3N52 A;  1C9O A;  1PRT C;  4TQU S;  1HA6 A;  4HAE A;  4JW0 A;  1B3A A;  5C0X J;  2JA8 B;  4GS3 A;  2PO4 A;  4O42 A;  1U4R A;  3DWQ A;  1KL9 A;  2MUY A;  1TWH H;  3VYU A;  4DR3 L;  2RDG A;  4KHZ A;  4OXP A;  2DNC A;  2N78 A;  4GLX A;  2YTY A;  4N9T A;  2VUM H;  2KCN A;  4GNX A;  5GRO A;  3WWV A;  3Q24 A;  2IJ0 A;  3IRB A;  1PH7 A;  2I5H A;  3KUP A;  2Z4I A;  3VR5 A;  1X55 A;  2A68 C;  4OEM B;  4ILW A;  1CA5 A;  4C2M B;  5CBA E;  5ELE A;  1XX8 A;  3OWE B;  5KNB A;  2PNH A;  1HHV A;  3U50 C;  4DV0 L;  4FF4 A;  2VNU D;  3K7A B;  3PUV A;  4A3J B;  4QUC A;  3QR8 A;  1KRT A;  4LK1 C;  3CAM A;  4AQY L;  1E24 A;  2Y0S E;  2SNM A;  1JE5 A;  4XT3 B;  1G29 1;  1TS4 A;  4JCV E;  4B3S L;  4JOI A;  3J7A F;  3B6Y A;  5EKL A;  4JI6 L;  3FVQ A;  3KYH C;  3Q22 A;  5ELB A;  1E3P A;  3A55 A;  3A74 A;  4A3L G;  2OQ0 A;  1T9H A;  2L55 A;  1B3Q A;  3M7G A;  3NUC A;  4A3E G;  1BR9 A;  5IGF A;  1I4Q A;  1CQF A;  1STG A;  4PV1 C;  1FNW A;  4HR7 B;  5C3E G;  3ERO A;  1MI2 A;  3Q6S A;  4N8F A;  1LTR D;  1EQQ A;  1KAB A;  4HN7 A;  1CKN B;  3M9B A;  3N6R A;  2J0T D;  2JA8 H;  3HOW B;  2ENB A;  2OTL A;  1K3B C;  2R92 B;  3HOY B;  4L8J A;  4YY3 Q;  4LFC L;  2UUA L;  2PPB C;  3H6M A;  1TXY A;  3W1G A;  3I4N H;  1JIC A;  1L0Y B;  2L15 A;  4JI2 Q;  1NR2 A;  1BQQ T;  4Y52 H;  3K0X A;  4JI5 L;  4YWL A;  1HNZ L;  1VQJ A;  5KYL A;  2H4O A;  5J39 A;  4B08 A;  1PXU A;  4DR6 L;  5GAD C;  3IKJ A;  4P72 A;  5IYC G;  2E2H B;  2EYJ A;  2WP8 J;  3JAM c;  3SDZ A;  2WKC A;  1EQT A;  4HCE A;  3E6Z X;  4MTN A;  1MBY A;  3EBE A;  3I7F A;  2A69 D;  4A3J H;  3C3L A;  1SDF A;  2K33 A;  1HZB A;  3R3O A;  2E5L Q;  3L7Z C;  2LS0 1;  1M4V A;  3CCU A;  1SRU A;  3VYT A;  4X3U A;  3PO2 G;  1VF5 C;  1EUJ A;  2F3V A;  4CDE C;  3S1R B;  2I0Q A;  1QVF A;  1KQS A;  2EVB A;  5KNC A;  4CJ2 C;  3J80 c;  2F03 A;  1HA5 A;  4B3M Q;  4OON A;  4KI0 A;  2A6H D;  1X65 A;  3AYH B;  1DOM A;  3K59 A;  1G6Z A;  3K80 C;  4DV1 Q;  1X3G A;  1F9P A;  2F0N A;  3DUZ A;  2IWH A;  1EWH A;  3Q23 A;  5K36 G;  2B2V C;  4A3B B;  2OF1 A;  1E0B A;  1GUG A;  1PHJ A;  3V2T A;  2AQ3 B;  4PQX A;  3UDG A;  4LFB L;  2I5M X;  4BBS B;  3MEF A;  1VQ5 A;  4A3I G;  1EIH A;  4O1N A;  4LF7 L;  3HOW H;  2AUJ D;  4GN5 A;  2R92 H;  1K8O A;  1HZ9 A;  2VW9 A;  1SR3 A;  1B44 D;  3AU7 A;  1HFN A;  4IAL A;  1VQB A;  2KA7 A;  2XRQ D;  1JOQ A;  4HSP A;  2HHH Q;  2LY7 A;  5M3F B;  4WRD A;  4G7H C;  3FMC A;  4A75 A;  4BA2 I;  1BCP F;  2N49 A;  1BOS A;  2E2H H;  1BBX C;  4OO1 I;  3ERQ A;  3HEJ A;  2F0H A;  4IPH A;  1JR0 D;  1RD9 D;  2NN6 I;  1SSO A;  5M5Y B;  1LT5 D;  1G51 A;  3FDT A;  2O2L D;  1WTV A;  2AQ1 B;  1YIT A;  3CF5 A;  2Q2H A;  2E2I B;  3NHH A;  1UEB A;  1WJJ A;  2J4X A;  1BKB A;  2D2C C;  5J1Z A;  5E7N A;  3TP6 A;  1YVC A;  5CGK A;  1EOV A;  1ENF A;  5BR8 L;  4KY5 A;  3S2H B;  1HJP A;  1BO0 A;  4BBR G;  2E76 C;  2SEB D;  2BH2 A;  2JEA I;  4H7B A;  5CMD A;  3PUX A;  1N34 Q;  5IP9 G;  1PRT D;  1SN8 A;  4XXE A;  1X3F A;  2XNA C;  3TZD A;  3F2U A;  1VQE A;  1SNM A;  2K5Q A;  5CV5 A;  3TP7 A;  4CJ0 B;  2HIX A;  2B2U C;  4Q5V A;  5HGT A;  3SGI A;  3JAM i;  3DLL A;  2DNE A;  2JA6 B;  2LFN A;  1SXT A;  3AB9 A;  2A68 D;  4A3D B;  1XMQ Q;  3I2Z A;  1BNZ A;  4LF6 Q;  2NVY B;  1VQP A;  1TY0 A;  4HJA A;  1N32 L;  3BZC A;  3GTK B;  1C7Y A;  1SJE D;  3TZU A;  5M3F H;  2IPK D;  5C6A A;  2B2Y C;  4XIG S;  4DAM A;  1KIX A;  4F87 A;  1VCI A;  1Y1V G;  1XMO Q;  2WB1 E;  5IT9 c;  4FXK C;  1NSN S;  2JA5 G;  1CZG A;  4GKK Q;  3VR3 A;  3J81 j;  4P2C B;  1IL8 A;  5DM7 3;  1DOL A;  5M5Y H;  2QF7 A;  4X6A H;  3FHW A;  2QGQ A;  3WOE A;  3ERS X;  3PV0 A;  2E2I H;  1G6P A;  1B9N A;  1VQI A;  1TQO A;  4HMI A;  1LV9 A;  4RGO S;  3S2H H;  1B7Y B;  3GQB A;  3NSW A;  1JOR A;  1D2B A;  2F4V L;  3S1M H;  2LMC B;  4DR3 Q;  1G91 A;  3NPP A;  1TWC B;  2EY6 A;  4MN3 A;  3ER0 A;  5DNF A;  4UAI A;  2EE1 A;  4DV5 L;  3HRZ C;  1NCV A;  2Z1C A;  4JVZ A;  1PH5 A;  3MA2 B;  1QZH A;  2JA6 H;  1HRJ A;  2HDM A;  1HFG A;  3PCO B;  1HUM A;  4N8X 1;  3WDN A;  1FGU A;  2CCZ A;  2M00 A;  3NEN A;  4IFD J;  1TS2 A;  3M4Y A;  5ELF A;  4DV0 Q;  2B63 H;  3QOJ A;  2EYH A;  2NVY H;  2ZT9 C;  2SDF A;  2F0W A;  2UXD L;  4AQY Q;  2ZM6 L;  1LO5 D;  2BOS A;  3JAM E;  3MFG A;  4JI0 L;  4POG A;  1D5M C;  2QDB A;  3WOF A;  3A5U A;  1CUK A;  4EVO A;  2UXB L;  2NVQ B;  3KK7 A;  1F77 A;  1OXS C;  4B3S Q;  3M3Y B;  2E2D C;  1N33 L;  4FVM A;  4JI6 Q;  1BF4 A;  4QIW E;  2MFI A;  2X6L A;  3CC4 A;  3TP5 A;  2UUC Q;  1PRT F;  4FF2 A;  3GTP B;  3CP0 A;  3E0J A;  3VYS A;  1PH8 A;  3NWT A;  2PI2 A;  3M4O B;  1ZEQ X;  1A62 A;  4A3G G;  1XXG A;  4BXX G;  1WFQ A;  3BZK A;  2EY1 A;  1YI2 A;  1WTH A;  4DK1 A;  4OIJ A;  2JN4 A;  2OCE A;  4FYD A;  1B8A A;  3T1Y L;  1DJR D;  3ULJ A;  4A3E B;  4H02 A;  3TBI B;  1CTM A;  5FK9 C;  1OXT A;  4G7Z C;  2Q8I B;  3UE1 A;  2YYZ A;  3GO5 A;  2QEX A;  2UUA Q;  4LFC Q;  1A6X A;  3PUW A;  4BS9 A;  2M9V A;  4ID6 A;  1IKL A;  3CCR A;  4DV6 L;  1FGB D;  1QVC A;  5TSS A;  4OL7 A;  2NWG A;  2K7V A;  3TRZ A;  2O4X A;  5GAE C;  1L0W A;  4JI5 Q;  1HNZ Q;  3CRL C;  2Z6K C;  3RZD B;  1TY2 A;  4DR6 Q;  1N36 L;  5C3W A;  5FO8 B;  2EPB A;  1LAC A;  3OIP A;  3CKI B;  1B1Z A;  1NR4 A;  1WYD A;  1JB3 A;  3F1Z A;  3NE5 B;  2N88 A;  2F0M A;  4HIK A;  4K6L A;  5C4J B;  4A3M H;  2B29 A;  1K83 B;  1OTC A;  1EY0 A;  2VY3 A;  1Q7Y C;  1EY9 A;  4MNO A;  4OO1 G;  1Z7T A;  2NVQ H;  1F2L A;  3MXN B;  4DA2 A;  3M3Y H;  2NN6 G;  1H9R A;  1R4P B;  1U5K A;  1VDZ A;  2L5T A;  3PO2 B;  4A3C G;  5JPM C;  2ATW A;  1SE4 A;  2PZT A;  1PRT B;  4KY7 A;  4NDX A;  3GTP H;  5IOD A;  3UDX A;  4DAY A;  4ME3 A;  3C2P A;  2JJQ A;  1FD7 D;  3M4O H;  2ID0 A;  4OX9 L;  5E3F A;  2RHS B;  2RBM A;  3PIO 3;  5M5X B;  2V1C C;  1LTB D;  4GNX C;  3TS2 A;  2H1E A;  3AQQ A;  1PH4 A;  1ENA A;  1QZG A;  4LFB Q;  1EYC A;  3AFQ A;  4A3E H;  2JE6 I;  3NQI A;  4LF7 Q;  3NTK A;  3RLF A;  4M8A A;  4JBW A;  3W1B A;  2RKS A;  4DR4 L;  2PQA B;  1XNQ Q;  1SRO A;  1V1Q A;  1CKN A;  3SR1 A;  5GAH C;  3H0G H;  1KXL A;  1FNU A;  1X9N A;  4ZUJ A;  1II3 A;  4TRD A;  3MHB A;  4L63 B;  4JI8 Q;  4A3K G;  3E5S A;  3MXP A;  4BY7 G;  3EA6 A;  5C5M A;  3RZD H;  3TQY A;  3RR5 A;  4NW2 A;  4JOI C;  4RG1 A;  1VQO A;  1HNX L;  4DV7 L;  3I70 A;  4U68 A;  2F3W A;  1BDO A;  1VQ9 A;  4RA8 A;  1A3V A;  2CQA A;  5JJK A;  1SMX A;  4ZYS A;  4HJ7 A;  4MTK A;  1OXV A;  1STA A;  5IYC H;  3NWS A;  2BE5 C;  2CHB D;  3BYT B;  4B3R L;  3I3C A;  3Q0A A;  1ROD A;  2MHV A;  4WJW A;  5BR8 Q;  1A63 A;  2K5V A;  3J80 L;  2K5H A;  2HDL A;  2HT1 A;  1PH6 A;  2OXP A;  3CMA A;  3OW2 A;  1EQR A;  5CYU A;  1LTI D;  3IL8 A;  4GKJ L;  1K3R A;  3A5Z B;  3A8J E;  4A3F G;  2I46 A;  4WJ3 M;  1TWF H;  1MJC A;  3FPU B;  4K0K L;  1SMY D;  1IW7 C;  2WV6 D;  2MGS A;  1IHZ A;  4BBR B;  5C3X A;  3E9I A;  3QO2 A;  1DD2 A;  1XPO A;  1YNX A;  3DM3 A;  1CSQ A;  2Y0S G;  1RHP A;  4JPB W;  1UE6 A;  1D5Z C;  4DR5 L;  1FVI A;  4QUF A;  4R8I A;  4PMW A;  4X62 L;  4O0A A;  3VA7 A;  1JOK A;  1JB7 A;  1LT4 D;  1Q82 C;  2FMC A;  5LMU L;  1LAB A;  5JAV A;  1I4X A;  5D14 A;  2K14 A;  5EKI A;  1CKO A;  2FXQ A;  1N32 Q;  4GLV B;  2Z6B A;  4KKU A;  4K5V A;  1DYQ A;  1JJG A;  4JBM A;  1C4Q A;  4CKE A;  4K2L A;  5I9P A;  1K0S A;  5IE8 A;  1U0L A;  2PMZ E;  1Y1W G;  3EIV A;  2F0I A;  4XDX A;  3OTO L;  3EN2 A;  2RF4 A;  3T16 A;  4QB4 A;  1SYE A;  1Y1V B;  4LF6 L;  2R7F A;  4FNF A;  3QWN A;  3ZJY C;  1I50 H;  4RGT A;  2JA5 B;  3L2P A;  2CW0 C;  1VQN A;  5FJ8 H;  3T1H L;  3L3O C;  2E8G A;  3GDE A;  1SE8 A;  3OW7 A;  1X6O A;  5T1I A;  2BDO A;  2NTS A;  1C48 A;  2M2L A;  1R9T H;  2DJG C;  2F4V Q;  4GN4 B;  2KUM A;  2GN5 A;  3LWU A;  5CBE E;  1YEZ A;  2KEN A;  1WD0 A;  1VQF A;  4P74 A;  3V96 A;  4A76 A;  1EWI A;  5KIX A;  1G2S A;  4UP7 A;  1K73 C;  2E74 C;  3G6E A;  4QMG A;  4C1N I;  1PFB A;  4LF4 Q;  4DV5 Q;  1DGS A;  5C44 G;  2E2J B;  2Q2I A;  2YTX A;  3U9S A;  2RDF A;  5IP9 H;  3OYY A;  1QE6 A;  4R4O A;  1YHQ A;  4X3K A;  2ZTE A;  3NEM A;  1LTL A;  3UI2 A;  1K28 A;  4IFD G;  3MZ5 A;  3D6W A;  4G4K A;  2UXD Q;  4KKS A;  2ZM6 Q;  1T5E A;  3A0J A;  4RCN A;  4JI0 Q;  4JG2 A;  4ODG A;  3D4R A;  2UXB Q;  1N33 Q;  4BY1 G;  2EZV A;  2KED A;  4IPG A;  1HR0 L;  3HOX B;  1YZ6 A;  3P7J A;  5IT9 L;  2ZJP A;  3EFX D;  5GQO A;  2AUK A;  1H9J A;  1QVG A;  4RKL A;  1Q8I A;  1HZA A;  2JXM B;  3I73 A;  4K2K A;  4V0B A;  3F8T A;  1PH9 A;  2P5Z X;  4MHE A;  4B3T L;  2JA5 H;  2K05 A;  3H3V C;  1KDB A;  1RTO A;  2RSO A;  3SHL A;  3D3R A;  3T1Y Q;  1EEF D;  3KFU A;  3S24 A;  4GZY C;  1XPU A;  4A3G B;  4AIM A;  4IUV A;  2CWA A;  4PMC A;  1HR0 W;  4Y7N B;  5KND A;  2JEB I;  1GUW A;  1BCP D;  2UUC L;  3BVG A;  4H13 C;  3HP3 A;  2CWP A;  2WAQ B;  5F2D A;  4IUQ A;  2WII B;  4DV6 Q;  4CGY B;  3SK6 A;  1SYC A;  2IHE A;  3ULL A;  4C3J G;  5C0X I;  2C9O A;  1FL0 A;  3J7A V;  2E2J H;  5G3L D;  4OWT B;  3I4M B;  1KRS A;  1N36 Q;  2B39 A;  1X3E A;  3S17 B;  2XVS A;  2F0U A;  3T13 A;  2J7Z A;  4HMJ A;  1B50 A;  1GO3 E;  1YHA A;  3H94 A;  3D8G A;  2TMP A;  1VMP A;  2K32 A;  3DWP A;  3NBH B;  4RHS A;  3HOU G;  5IGE A;  2K75 A;  2KOL A;  1UAP A;  2VZA A;  3NEL A;  4C2M H;  5JVH 3;  3HOX H;  2DGY A;  4NP5 A;  2HCI A;  2BE5 D;  2L0C A;  2IX0 A;  4KTA A;  3ZYY X;  1IXR A;  1KC8 C;  3GTM B;  2CVR A;  5IYD H;  1GUT A;  3K7A H;  1EIF A;  1XTC D;  2F0O A;  4OX9 Q;  1A3T A;  1A3U A;  1IBK L;  1EIG A;  4N9P A;  1JE4 A;  3QB3 A;  2HD3 A;  4ME5 A;  3PO3 G;  4A3G H;  2EQS A;  3KLS A;  1I4G A;  5CV4 A;  1KTK A;  1PFS A;  2DY8 A;  4BXX H;  4DUZ L;  1YJN A;  3PIP A;  1DXM A;  2LXK A;  3HOZ G;  2WB1 G;  4DR4 Q;  2KHI A;  4KHP L;  4R4C A;  1KDC A;  1F2Z A;  2A6E D;  1JWS D;  1VQ4 A;  5H1S E;  1ILP A;  1IKM A;  1X56 A;  5JJI A;  5CV6 A;  3CHB D;  1VQH A;  4HSV A;  5L37 A;  4KKT A;  1EU4 A;  3H91 A;  3URY A;  5I6W A;  3L0O A;  1K0R A;  3CQZ B;  1NJI C;  1NTG A;  1EYG A;  3I4M H;  1Q1B A;  1I3Q B;  5ELD A;  1HNX Q;  5FLM H;  3KF8 B;  4DV7 Q;  4GLA C;  1SYG A;  4OGQ C;  3PSI A;  3S17 H;  3HOY H;  1PTO D;  3F2D A;  4XTC S;  1XNQ L;  4A3K B;  4GOP B;  1GD7 A;  3K5M A;  1AZP A;  4BY7 B;  3LGJ A;  3CME A;  3W5O A;  4J1M A;  3K57 A;  4AYB B;  1PDQ A;  2RA4 A;  5A35 A;  1KLG D;  4S3S A;  4B3R Q;  4JI8 L;  1QUQ A;  1SNP A;  4PG3 A;  2NVX B;  1L1O B;  4DNT B;  4R4T A;  5E1F A;  2K50 A;  3I4L A;  5C4X G;  2ES2 A;  3GTM H;  2ASB A;  4GKJ Q;  4FDB A;  3MXN A;  2QDL A;  4DNI A;  3GTJ B;  1HCZ A;  3R93 A;  1WTQ A;  1F2Y A;  1DON A;  4K0K Q;  2F0Q A;  1I4H A;  2WKD A;  4IUN A;  1D1I A;  4L5Q A;  4A3C H;  5G3L F;  5IGB A;  3RLO A;  3V05 A;  1NAP A;  3S1R H;  4LFA L;  1JC7 A;  1L2F A;  2L12 A;  4A3F B;  3C46 A;  4DR5 Q;  2KHJ A;  3HOV G;  5IYB G;  4C3I G;  4X62 Q;  1Q81 C;  3VDY A;  4JBJ A;  3U4V A;  3RLN A;  3NP8 A;  5LMU Q;  2Y0S B;  2JSO A;  2KCC A;  4A3B H;  2R6G A;  2DN8 A;  4RKB A;  2K5N A;  3L9A X;  1HQM C;  2E75 C;  1DM0 B;  4JBK A;  2PCF B;  4K5X A;  4BBS H;  2CKZ B;  3CQZ H;  5GAG C;  3PQI A;  4DK6 C;  4C3H G;  1S5B D;  4FXD A;  3F2C A;  1O7L A;  2R93 G;  2CH4 A;  3TRE A;  4V19 0;  1O7I A;  1PZI D;  2XRS D;  3HG9 A;  1FR3 A;  1KNE A;  2MO1 A;  3HKZ E;  3OIQ A;  3T51 B;  4A4I A;  3OTO Q;  3G71 A;  2R7Z B;  2A73 B;  2R61 A;  5ELC A;  3CC7 A;  1VQ7 A;  3CC2 A;  1VMC A;  3J80 i;  1Y1W B;  5D3D A;  3T1H Q;  1W2B A;  5ELN A;  5FLX L;  3J81 L;  1UE1 A;  1BCP B;  1UWV A;  5JEA H;  3GV3 A;  1IYJ B;  3AEV A;  1EY5 A;  3F2B A;  1WTR A;  3GTJ H;  2LKV A;  3ONA B;  4ZLT F;  1S5C D;  2HUG A;  3PGZ A;  1ICW A;  1J8I A;  3FP9 A;  4IUU A;  3I56 A;  4F7X A;  4X64 L;  1XJV A;  4JV5 L;  5KYI A;  2HCC A;  1TS5 A;  1VS0 A;  2NYZ D;  1KDA A;  2F0J A;  4A3F H;  1JWM D;  4KD4 A;  2CFM A;  4KHV A;  1PTO F;  1YNN C;  2EJG C;  2F0E A;  5IP7 H;  4FF3 A;  5C0X G;  2QKI C;  1IYU A;  4WJ4 A;  3DXJ C;  5C44 B;  3K81 C;  2ZTC A;  5CR3 A;  4KJO A;  1F9S A;  4IJL A;  2Q8T A;  2KVM A;  3I91 A;  1Y8P B;  4R4Q A;  4LF4 L;  2R7D A;  1LTA D;  4L5S A;  1Q86 C;  1HPC A;  2O5I C;  1DZ1 A;  1M8A A;  1HR0 Q;  3C1E A;  4LUZ A;  1WI5 A;  5C4H A;  5IGG A;  1C0A A;  1SLJ A;  4DAV A;  2L4N A;  4YHH L;  1ICF B;  1D5X C;  1H9M A;  4XQN A;  2R7Z H;  4A3D H;  2MJ8 A;  2IY5 B;  4BY1 B;  1EZ6 A;  4IOC A;  2F0F A;  4GN3 B;  4IN3 A;  3MXG A;  4B3T Q;  3S9W A;  3GTK H;  2ZXO A;  3CCL A;  2F0V A;  4IUR A;  3I4N G;  4NKL A;  3BU2 A;  2R3Z A;  4NXM L;  2IL8 A;  4X66 L;  1M1K C;  1X3Q A;  3KJO A;  4HIO A;  3J80 E;  1WCM G;  4U67 3;  4OWX B;  2F3I A;  1LLR D;  2KJX A;  3K5N A;  3UDI A;  1K8A C;  1D6E C;  1PTO B;  3CCE A;  4C3J B;  4UDU C;  2EYF A;  2NZO A;  4KV6 A;  5M3M G;  3D4D A;  1PFM A;  4LWC A;  5C3E B;  1EY6 A;  2F52 A;  4ZKB B;  3J7Y W;  4DV4 L;  1TWC H;  1CHP D;  2PW7 A;  4EQO A;  2EYL A;  4K5W A;  1G8Z D;  4IUT A;  3QJY A;  4HCS A;  2CQO A;  2EOT A;  3H09 A;  3M4P A;  4IFD I;  3AFP A;  3CRK C;  4G57 A;  2UU9 L;  2F0L A;  2L9H A;  2BA0 A;  4BWG B;  1S5D D;  2HQE A;  2MQH A;  2OQK A;  5A2Q L;  2YV5 A;  3BYY B;  1VQ8 A;  1BVS A;  4XT1 B;  4DAP A;  2A1A A;  1IBK Q;  1ET6 A;  2YU9 B;  1F2M A;  5EAY A;  3DHQ A;  4RGM A;  1IL2 A;  1SJH D;  2NBF A;  2K4K A;  3RNU A;  5I6Y A;  2BDN A;  2PZW A;  1IBL L;  1E1T A;  4PZ6 A;  4IO9 A;  3O13 A;  4P73 A;  2PI2 E;  2VS1 A;  4DUZ Q;  1EY4 A;  3FRP B;  4IZ8 A;  4KHP Q;  1SYF A;  3CXC A;  2EXZ A;  5JVG 3;  3EJI A;  1EY8 A;  3PIO A;  1U4P A;  2B2U A;  3QG1 A;  4DF7 A;  4LUO A;  4A3L H;  1I94 L;  2MPM A;  3D31 A;  3GTG B;  3MC0 B;  3HOZ B;  2WB1 B;  4KY6 A;  4DR7 L;  1X32 A;  2EY5 A;  3JC6 6;  5LMN L;  2EJM A;  1STH A;  1H9S B;  1STY A;  3SXH A;  2VXW A;  4C3J H;  2F0G A;  3BZD B;  1J9O A;  1WTX A;  2DY7 A;  5C3E H;  4DV2 L;  1RKN A;  2KCM A;  1JWU D;  1JCK B;  2Z9H A;  4A3I B;  1C8C A;  4MZ9 A;  3QOL A;  4J8Q A;  5FO9 B;  2C5C A;  2NB0 A;  1H9K A;  3RMH A;  2K6A A;  5IWA L;  3PMF A;  4O2D A;  1WOC A;  5HGQ A;  5LMN W;  1A2U A;  1DOK A;  4EQN A;  4DN4 M;  3ND8 A;  4ZUI A;  3D6C A;  3NBH A;  4FO2 A;  5COR A;  4G7O C;  4LF5 L;  1B2T A;  2CH4 W;  1Y14 B;  2NZH A;  4R1J A;  3ICE A;  3GTL B;  4AH6 A;  2K28 A;  5C4J H;  1K83 H;  5IT9 E;  5IGD A;  3K5O A;  1TWG B;  4R4I A;  5C4X B;  4LUV A;  1QCB D;  1QB5 D;  5FLX c;  2YU9 H;  2ICE C;  1SYB A;  4HJ8 A;  3J81 c;  4TKO B;  2BCO A;  4IUP A;  4ZCK A;  4LFA Q;  4M1U B;  3S16 B;  3K6O A;  3FKI G;  1XNR L;  3U9O A;  3PO2 H;  4ZAI A;  1MHW C;  3SK5 A;  3TME A;  1IBM L;  3OPO A;  2QA4 A;  4JI4 L;  3NXW A;  4YCU A;  1TWA B;  1ASZ A;  5E4X A;  3GTO B;  2VL6 A;  1TR5 A;  1TU2 B;  2WAQ E;  1YNN D;  2JA7 G;  1PH2 A;  1CHQ D;  1NE3 A;  2V4D A;  5M5X H;  5M5W B;  3HOV B;  4C3I B;  2KBN A;  3GTG H;  3HOZ H;  4QIW B;  2A69 C;  3BJU A;  1S40 A;  4HIM A;  4QGU A;  1I4P A;  1UNS A;  5K36 H;  3A7A B;  4ZQ3 A;  1EQV A;  2BH8 A;  5DLQ E;  1TS3 A;  4KK7 A;  1VQG A;  2XWB B;  4OHJ A;  4C3H B;  1JJC B;  4A3I H;  2A6H C;  3KF8 A;  2R93 B;  1T5X D;  3I90 A;  4MIU A;  2IX1 A;  4DUY L; 
#chains in the Genus database with same CATH homology
 3SGI A;  3JAM i;  3DLL A;  2EIF A;  4GOP A;  3CCS A;  3I4M G;  3RN2 A;  1GO3 E;  1YHA A;  4EQ5 A;  5FLM G;  4BY1 H;  3HOW G;  4J15 A;  1GVP A;  3TS0 A;  1PH3 A;  2R92 G;  3H3V I;  3HOY G;  3NBH B;  3HOU G;  4L5T A;  2D0O A;  2K75 A;  1XMQ Q;  3KJP A;  4LNQ A;  3I2Z A;  2VZA A;  3NEL A;  1JMC A;  4C2M H;  4LF6 Q;  3GTL H;  2GVA A;  1VQP A;  3HOX H;  2DGY A;  4X64 Q;  1L1O A;  4HJA A;  4JV5 Q;  3BZC A;  1TWG H;  2IX0 A;  1N32 L;  5C4X H;  1C7Y A;  1KC8 C;  1IXR A;  5M3F H;  4YY3 L;  2B63 G;  3KDF A;  4A93 G;  5IYD H;  4DAM A;  4XIG S;  3K7A H;  1EIF A;  1KIX A;  1QUQ B;  1VCI A;  1Y1V G;  4DR2 L;  1XMO Q;  4YCV A;  2MNA A;  2WB1 E;  3S16 H;  4OX9 Q;  5IT9 c;  4NXN Q;  1J5E Q;  2UXC L;  2JA5 G;  4JI2 L;  4LW1 A;  5IY0 A;  4GKK Q;  1IBK L;  3J81 j;  1HZC A;  1K8G A;  1TWA H;  2VQF L;  3STB C;  5M5Y H;  4X6A H;  3PO3 G;  4A3G H;  1S3O A;  2WFW A;  2EQS A;  1EFW A;  3FHW A;  2QGQ A;  1PFS A;  4QL5 A;  3ERS X;  4BBR H;  4BXX H;  3PV0 A;  2E2I H;  5M5W H;  4DUZ L;  3G48 A;  3PIP A;  1YJN A;  3HOV H;  1G6P A;  5IYB H;  1B70 B;  2LXK A;  1VQI A;  4C3I H;  2WB1 G;  1JJ2 A;  2KHI A;  3HOZ G;  4R4C A;  4DR4 Q;  1CKM A;  4KHP L;  4YCW A;  2ZJQ A;  3UDF A;  3S2H H;  1VQ4 A;  3E9H A;  5H1S E;  1B7Y B;  2E5L L;  1X56 A;  2K52 A;  5JJI A;  3S1N H;  1VQH A;  4HID A;  2F4V L;  1CSP A;  3S1M H;  3J7Z C;  4DR3 Q;  4YHH Q;  3L0O A;  1K0R A;  1NJI C;  4B3M L;  4JYA Q;  1NTG A;  4NPS A;  1EYG A;  3I4M H;  1Q1B A;  3J81 i;  4A3B G;  1HNX Q;  5FLM H;  3KF8 B;  4DV7 Q;  2R93 H;  4GLA C;  3HFZ B;  3K7U C;  3ER0 A;  2Q2U A;  3PSI A;  3S17 H;  3HOY H;  3F2D A;  4DV1 L;  1KHI A;  4DV5 L;  3CD6 A;  3HOU H;  3M85 A;  4BBS G;  4XTC S;  4AYB E;  1XNQ L;  1H95 A;  3J7A 5;  4GOP B;  1GD7 A;  1PH5 A;  1QZH A;  3LGJ A;  2JA6 H;  3CME A;  5J3B A;  3W5O A;  3PCO B;  4PZ8 A;  3CW2 C;  2HIV A;  4NXM Q;  2LXJ A;  1FGU A;  2CCZ A;  4B3R Q;  4X66 Q;  3NEN A;  4IFD J;  1E7Z A;  4DV0 Q;  1UE5 A;  2MO0 A;  4JI8 L;  1IZ6 A;  4OWW B;  2B63 H;  1SFO H;  1QUQ A;  4RMF A;  3K8A A;  2NVY H;  1Y1V H;  2A19 A;  4PG3 A;  1VQ6 A;  1PYB A;  3KF6 A;  1L1O B;  1A8V A;  4AYB G;  4R4T A;  2ZM6 L;  2K50 A;  4AQY Q;  2UXD L;  4JC0 A;  2ES2 A;  5C4X G;  4JI0 L;  3GTM H;  4POG A;  5M3F G;  2ASB A;  2JQO A;  1I5F A;  2XTI A;  3A5U A;  4JI7 L;  1CUK A;  4FDB A;  4GKJ Q;  2UXB L;  3KDF B;  4DNI A;  1OXS C;  4B3S Q;  4A3M G;  4UY8 C;  1N33 L;  1FJG L;  4JI6 Q;  4K0K Q;  3M7N A;  4QIW E;  2MFI A;  4IPD A;  5JEA G;  1NMF A;  3PO3 H;  4EX5 A;  1J6Q A;  3CCV A;  3CC4 A;  3U4Z A;  4L5Q A;  2HHH L;  4A3C H;  3ULP A;  2UUC Q;  3RLO A;  3PUY A;  2D62 A;  1GKH A;  3CP0 A;  4IOA A;  3CCM A;  1PH8 A;  3S1R H;  3PF4 A;  5AJ3 Q;  2PI2 A;  4LFA L;  1L2F A;  4DV4 Q;  1KAW A;  1A62 A;  5ELO A;  4A3G G;  4BXX G;  1LUZ A;  1WFQ A;  2YTV A;  3BZK A;  4DR5 Q;  3GTQ H;  2KHJ A;  3CCQ A;  3HOV G;  1XTD A;  5IYB G;  1YI2 A;  4IPC A;  1W3S A;  4X62 Q;  1Q81 C;  4KLK A;  3VDY A;  2HQL A;  1KD1 C;  2XGT A;  4X65 L;  2OCE A;  2IT1 A;  4JBJ A;  3U4V A;  3RLN A;  1B8A A;  4DAY B;  3T1Y L;  3ULJ A;  4H02 A;  1NMG A;  5LMU Q;  1HNW L;  4DPG A;  4A3B H;  1BBW A;  2R6G A;  5IP7 G;  4JI1 Q;  1OXT A;  2K5N A;  3UE1 A;  3S14 H;  4YWM A;  4LF8 L;  2UU9 Q;  2AWN A;  2YYZ A;  3GO5 A;  2QEX A;  4JBK A;  2UUA Q;  4LFC Q;  4BBS H;  2CKZ B;  3CQZ H;  4P75 A;  2AMC B;  4DK6 C;  5GAG C;  1PV4 A;  3PUW A;  1YHB A;  4DV6 L;  3CCR A;  3F2C A;  2VQE L;  2R93 G;  3TRE A;  1QVC A;  1O7I A;  2OTJ A;  3TRZ A;  4DR6 Q;  5GAE C;  2A8V A;  3H3V H;  2MO1 A;  1L0W A;  4JI5 Q;  3HKZ E;  4A4I A;  3OTO Q;  3G71 A;  1N34 L;  2KCT A;  1X54 A;  3H15 A;  1HNZ Q;  1M90 C;  2Z6K C;  1A0I A;  3H0G G;  3I4O A;  1AE3 A;  4JI3 L;  1N36 L;  2BA1 A;  3CC7 A;  1VQC A;  4DR1 Q;  1IBL Q;  1VQ7 A;  3CC2 A;  2JK8 A;  3J80 i;  2N3S A;  3GD7 A;  2AKW B;  1Z9F A;  1AH9 A;  1WYD A;  3F1Z A;  3CPF A;  3T1H Q;  1W2B A;  5ELN A;  2R7Z G;  4A3D G;  4HIK A;  4L5R C;  2NVT H;  4A3M H;  3I55 A;  2B29 A;  1OTC A;  4UP9 A;  1UE1 A;  3HKZ G;  1UWV A;  4TVA B;  3KF6 B;  2VY3 A;  1Q7Y C;  1PA6 A;  1PH1 A;  4MNO A;  4OO1 G;  1IYJ B;  1I94 Q;  3AEV A;  3F2B A;  5JJL A;  3S2D H;  1Q1E A;  1VQK A;  4LF9 Q;  1V9P A;  1XMQ L;  2NVQ H;  4DR7 Q;  3MXN B;  4QJF A;  3GTJ H;  3GTO H;  3M3Y H;  2NN6 G;  5LMN Q;  4NB3 A;  1WCM H;  3PGZ A;  1U5K A;  3FP9 A;  3I56 A;  4X64 L;  1XJV A;  1VQD A;  4JV5 L;  4Y7N H;  3D0F A;  4A3C G;  4APV A;  1JT8 A;  5HY6 A;  2ATW A;  1VS0 A;  3CCJ A;  1AE2 A;  2Z6K A;  3GTP H;  4DV2 Q;  3UDX A;  4ME3 A;  2JJQ A;  4A3F H;  1XMO L;  3M4O H;  2CFM A;  2ID0 A;  1YIJ A;  4OX9 L;  4NXN L;  1J5E L;  2RHS B;  3RZO H;  1Q46 A;  2V1C C;  4BA1 I;  4GNX C;  4GKK L;  5IP7 H;  3TS2 A;  3AQQ A;  1PH4 A;  5M3M H;  1QZG A;  1VQL A;  4LFB Q;  5C0X G;  5IWA Q;  4PZ7 A;  4WJ4 A;  2IHF A;  3K81 C;  4YWK A;  1N9W A;  3AFQ A;  4A3E H;  2GVB A;  1MKH A;  4DV3 L;  4C3H H;  3CPW A;  2JE6 I;  1P8L A;  1RL2 A;  2ZTC A;  4LF7 Q;  1NBW A;  2RCN A;  3RLF A;  4IJL A;  2I5L X;  4JBW A;  3W1B A;  4R4Q A;  4LF4 L;  2R7D A;  2PQA B;  2UUB Q;  4DR4 L;  1XNQ Q;  1SRO A;  2LSS A;  4LF5 Q;  1XPR A;  4L5S A;  1Q86 C;  4QQB X;  1V1Q A;  1C9O A;  1CKN A;  4TQU S;  5GAH C;  3H0G H;  1KXL A;  5C0X J;  1X9N A;  1HR0 Q;  4GS3 A;  4LUZ A;  1WI5 A;  1V43 A;  2DUD A;  1KL9 A;  1C0A A;  1TWH H;  1SLJ A;  4DR3 L;  4YHH L;  4KHZ A;  4JI8 Q;  4A3K G;  2R7Z H;  2ZTD A;  4OXP A;  4BY7 G;  4A3D H;  3RZD H;  4JYA L;  2N78 A;  4GLX A;  3TQY A;  2YTY A;  3RR5 A;  4IOC A;  2VUM H;  2IY5 B;  4JOI C;  4RG1 A;  4GNX A;  1VQO A;  4DV7 L;  1HNX L;  5GRO A;  3KLW A;  3WWV A;  3IRB A;  4GN3 B;  2I5H A;  1S72 A;  1PH7 A;  1VQ9 A;  4B3T Q;  1XNR Q;  3GTK H;  2EXD A;  3CCL A;  1IBM Q;  5JJK A;  1SMX A;  1X55 A;  3HKS A;  4JI4 Q;  3Q8D A;  3I4N G;  1OXX K;  4HJ7 A;  2JA6 G;  1OXV A;  1GM5 A;  5IYC H;  3BU2 A;  4NXM L;  1I6H H;  2PNH A;  3TEH B;  4B3R L;  3ICE A;  4X66 L;  1M1K C;  3U50 C;  4DV0 L;  2VNU D;  4DKA C;  3KJO A;  3PUV A;  4UP8 A;  4HIO A;  5BR8 Q;  1KRT A;  1A63 A;  3STB D;  1WCM G;  2K5V A;  2K5H A;  2F3I A;  4OWX B;  2HT1 A;  1PH6 A;  3CAM A;  4AQY L;  3CMA A;  3OW2 A;  5FJ8 G;  1E24 A;  1EQR A;  2Y0S E;  3UDI A;  1K8A C;  1JE5 A;  4GKJ L;  1G29 1;  1K3R A;  4JCV E;  5JEA J;  4B3S L;  3A5Z B;  1Q8K A;  4JOI A;  4HJ5 A;  3B6Y A;  4A3F G;  4WJ3 M;  1TWF H;  1MJC A;  4JI6 L;  1RIP A;  4K0K L;  3KYH C;  1E3P A;  3A74 A;  4A3L G;  3CCE A;  3E9I A;  2OQ0 A;  3S1Q H;  1Q12 A;  1T9H A;  3U58 A;  2NZO A;  5M3M G;  4DUY Q;  2PQA A;  1XPO A;  4LWC A;  4DK3 C;  1YNX A;  2F52 A;  3PUZ A;  1OXU A;  4A3E G;  3DM3 A;  1CSQ A;  4DV4 L;  1TWC H;  2C35 B;  2Y0S G;  4ALP A;  2OWO A;  1I3Q H;  1UE6 A;  1E1O A;  4DR5 L;  1FVI A;  3S15 H;  4PMW A;  4X62 L;  5C3E G;  4O0A A;  2CQO A;  1JB7 A;  1EQQ A;  1Q82 C;  4A3K H;  5LMU L;  4BY7 H;  3M4P A;  1CKN B;  1EIY B;  3M9B A;  2K14 A;  4IFD I;  3AFP A;  1CKO A;  3M4Q A;  2JA8 H;  2FXQ A;  1N32 Q;  4GLV B;  2OTL A;  1JJG A;  2UU9 L;  4YY3 Q;  1BBU A;  4LFC L;  2UUA L;  2BA0 A;  4JBM A;  2MQH A;  2VUM G;  4DR2 Q;  5IE8 A;  1YJ9 A;  1TXY A;  3W1G A;  1MIU A;  2OQK A;  3I4N H;  4GNX B;  2NVX H;  2YV5 A;  2L15 A;  1VQ8 A;  1U0L A;  1BVS A;  2PMZ E;  1Y1W G;  2UXC Q;  4JI2 Q;  3EIV A;  4Y52 H;  2A1A A;  3K0X A;  1IBK Q;  1PVO A;  4JI5 L;  4YWL A;  5EAY A;  3OTO L;  1HNZ L;  1VQJ A;  3EN2 A;  1IL2 A;  2RF4 A;  2K4K A;  3RNU A;  4DR6 L;  2VQF Q;  5GAD C;  4DR1 L;  4LF6 L;  1IBL L;  2R7F A;  1E1T A;  4P72 A;  4PZ6 A;  5IYC G;  4IO9 A;  2AHO B;  2WP8 J;  3ZJY C;  3FKI H;  1I50 H;  2PI2 E;  2VS1 A;  4P73 A;  3JAM c;  3L2P A;  4DUZ Q;  1VQN A;  3E0E A;  5FJ8 H;  3T1H L;  1D8L A;  4KHP Q;  2E8G A;  4MTN A;  3GDE A;  3EBE A;  3CXC A;  2ALY B;  1SE8 A;  3I7F A;  1X6O A;  4A3J H;  2Q2T A;  1HZB A;  2E5L Q;  3PIO A;  1UE7 A;  3L7Z C;  1R9T H;  2F4V Q;  4GN4 B;  1SRU A;  3CCU A;  2GN5 A;  2JA7 H;  3PO2 G;  4LUO A;  4A3L H;  1I94 L;  1YEZ A;  2KEN A;  3D31 A;  1P16 A;  1EUJ A;  4LF9 L;  4DR7 L;  2I0Q A;  1VQF A;  4P74 A;  1QVF A;  4A76 A;  3J80 c;  1EWI A;  3JC6 6;  5LMN L;  1KQS A;  4B3M Q;  2H5X A;  4DV3 Q;  4QY7 A;  4OON A;  4KI0 A;  4UP7 A;  1K73 C;  1X65 A;  3G6E A;  3AYH B;  1NY4 A;  4C3J H;  2JA9 A;  3K80 C;  4LF4 Q;  4IJH A;  4DV1 Q;  1X3G A;  4DV5 Q;  5C3E H;  4DV2 L;  1DGS A;  5C44 G;  1YJW A;  2Q2I A;  2YTX A;  5IP9 H;  1E22 A;  1K9M C;  2KCM A;  5K36 G;  3RN5 A;  1Z47 A;  3OYY A;  4MZ9 A;  1LM0 A;  1PHJ A;  4R4O A;  4UPA A;  3UDG A;  1YHQ A;  2I5M X;  4LFB L;  5IWA L;  2ZTE A;  3MEF A;  4O2D A;  1WOC A;  4A3I G;  3NEM A;  1VQ5 A;  5HGQ A;  1LTL A;  5LMN W;  3PF5 A;  2JA8 G;  4LF7 L;  4IFD G;  2UXD Q;  1VQM A;  3HOW H;  2ZJR A;  2ZM6 Q;  4GN5 A;  2R92 H;  3A0J A;  1Y1W H;  1HZ9 A;  1YBY A;  4JI0 Q;  4JG2 A;  4JI7 Q;  2UUB L;  2UXB Q;  4LF5 L;  2VW9 A;  1Y14 B;  2NZH A;  4R1J A;  1SR3 A;  2RHQ B;  4BY1 G;  1FJG Q;  1N33 Q;  4IPG A;  4AH6 A;  3UE0 A;  5C4J H;  1K83 H;  1VQB A;  1YZ6 A;  1HR0 L;  2ZJP A;  1LYL A;  4R4I A;  5GQO A;  4LUV A;  2HHH Q;  5FLX c;  2YU9 H;  1QVG A;  4HJ8 A;  3J81 c;  4A93 H;  4LFA Q;  3KOJ A;  3HOX G;  4A75 A;  1HZA A;  4BA2 I;  2N49 A;  1HH2 P;  1MJE A;  2E2H H;  3F8T A;  3FKI G;  1PH9 A;  1XNR L;  4OO1 I;  4B3T L;  2JA5 H;  3PO2 H;  2N8N A;  5IYD G;  1IBM L;  4IPH A;  4X65 Q;  2QA4 A;  4JI4 L;  4YCU A;  2NN6 I;  4A3J G;  1ASZ A;  3T1Y Q;  2VL6 A;  3KFU A;  3S24 A;  1HNW Q;  1XPU A;  4GOP C;  1G51 A;  2WAQ E;  4AIM A;  2JA7 G;  2AWO A;  2CWA A;  1PH2 A;  1HR0 W;  1YIT A;  1NE3 A;  1PYS B;  2Q2H A;  3CF5 A;  5M5X H;  2JEB I;  1UEB A;  1WJJ A;  3G4S A;  1BKB A;  4LF8 Q;  2D0P A;  2UUC L;  1D7Q A;  5E7N A;  2KBN A;  3GTG H;  3HOZ H;  1YVC A;  1EOV A;  2CWP A;  4P71 A;  5BR8 L;  5C44 H;  3BJU A;  5AJ3 L;  1S40 A;  1HJP A;  4DV6 Q;  4QGU A;  4HIM A;  1ASY A;  2IHE A;  4BBR G;  2VQE Q;  3ULL A;  2B3G A;  2BH2 A;  2JEA I;  2BH8 A;  5DLQ E;  1L1O C;  5C0X I;  1FL0 A;  3PUX A;  1VQA A;  2WAQ G;  1VQG A;  1N34 Q;  2Z0S A;  2E2J H;  5IP9 G;  1SN8 A;  4OWT B;  4JI3 Q;  1KRS A;  1N36 Q;  1X3F A;  1JJC B;  4POF A;  4A3I H;  1VQE A;  1N8R C;  4HJ9 A;  2IX1 A;  4JI1 L;  1X3E A;  4DUY L;  2HIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...