3I4NH

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
146
structure length
137
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLETRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 21
structure length 137
sequence length 146
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nH00
2VZAA 2NVQH 1XNRQ 4DR7L 4A3GH 3KYHC 1N36L 4HIMA 4LWCA 2WAQG 3NBHB 4JYAQ 2K52A 4ALPA 3W1GA 2K5HA 4X64L 3ULJA 1CSPA 3LGJA 2VY3A 4JI8L 2MNAA 3CCEA 1JJCB 4POFA 2GN5A 2JA8H 4HJ5A 3CXCA 2JA6H 1L0WA 1T9HA 4R4CA 4B3SL 3GDEA 3L0OA 2WB1G 1Q46A 5IWAL 3HOXG 4GKKQ 1XMOQ 1M1KC 1P16A 3K7AH 4L5QA 4H02A 5DLQE 2UUAQ 4BY1H 2F4VL 3GTKH 2F52A 3BZCA 3B6YA 4L5RC 1Q12A 2ZJRA 2A19A 1N8RC 1PHJA 1PH4A 1E3PA 1X3EA 3UE1A 4A3BG 4B3TQ 2ZM6L 4A4IA 2VL6A 1VQNA 4QY7A 1A8VA 4DK6C 1VCIA 3PIPA 3HOZH 3UDXA 4JI6Q 1J5EL 4A76A 4JI0Q 3CF5A 3NELA 4DV1Q 1XPOA 1Q86C 1L2FA 2VUMG 4JOIA 1PH5A 3KJOA 2UUCL 4X65L 3J80c 3MEFA 3OYYA 2ZJQA 3GTLH 4O0AA 4BXXG 5LMNQ 4LUOA 1LM0A 1K8GA 4LF7Q 1CKNA 4DV5L 1YBYA 2EXDA 1KHIA 2QEXA 4AQYL 5IYCG 4MZ9A 2E5LQ 3KF6A 3HOUG 4WJ3M 5ELNA 3AFPA 2HIVA 4HIKA 5AJ3Q 4DV7L 4JBMA 1PVOA 2XGTA 1WYDA 3RR5A 5IE8A 1NJIC 1FL0A 4DV3L 1Q81C 1SLJA 4QQBX 1OXTA 1QVCA 1TWHH 2MO0A 5GAEC 3S2HH 3PUWA 4HJ8A 3T1HQ 1PH3A 3J7A5 4JI2L 3HOXH 1N34Q 2CQOA 4QIWE 2NZOA 2KCTA 4PZ7A 1I94Q 2N8NA 3PSIA 1IBMQ 2UU9Q 4LUZA 1K3RA 4LF9Q 3RNUA 4LF8Q 1YHAA 3ULLA 1W3SA 3A74A 2Q2TA 2VQFQ 2OWOA 4BY7G 4FDBA 3S17H 1JJ2A 2UXDL 3BZKA 4X66Q 1XMQL 2VQEQ 4A3BH 4DK3C 4QGUA 1WFQA 1XNQL 1GVPA 4GNXA 1X9NA 2PI2E 4C3HH 4A3JG 1CKNB 1A63A 1VQJA 2R6GA 5JJLA 1ASZA 2BA0A 2JK8A 5IY0A 2VUMH 3KF6B 3JAMc 4DV0Q 4KHPL 3NENA 2E8GA 2NN6G 5IP9G 4BXXH 5C0XI 4POGA 1TXYA 1WOCA 2ID0A 3HOYG 2R93G 1KQSA 1U0LA 1Q1BA 5M5WH 3AQQA 5IYCH 3CC7A 4YY3L 4A3MG 3HOUH 1C0AA 2B29A 4EQ5A 4DV2L 1MJCA 5LMNW 4IFDG 4JI7Q 1UE1A 4JV5Q 1SROA 3M4PA 4L5SA 1KC8C 1TWAH 1PYSB 5J3BA 3G71A 1HR0Q 1FJGL 1OXVA 2YTVA 3E9HA 4IJLA 3KF8B 2UUBL 1S40A 2UXCL 4YWLA 2AMCB 2CKZB 2H5XA 2GVAA 4YCUA 3EBEA 4JBWA 3CCSA 4LFCL 4R1JA 2YTYA 5GADC 4GNXB 4NXML 2WAQE 4DV4L 3D0FA 3KDFA 1PH8A 1M90C 4BY7H 1I50H 3T1YL 1FVIA 4DAYB 1VQMA 3KLWA 4X64Q 3GTOH 3CD6A 4DR3L 4OXPA 1OXXK 1UE7A 1V43A 1Z9FA 3CW2C 3F2BA 4A3JH 2VNUD 1JT8A 2PI2A 2K75A 4A93G 4B3SQ 1KRSA 4JI5L 2E2JH 1L1OA 5IP9H 5IWAQ 4GN3B 2PQAB 2KCMA 1LYLA 2WB1E 2FXQA 2F4VQ 3HOYH 2R93H 3K81C 1VQ4A 1HH2P 4A3MH 1SRUA 3CPWA 2HQLA 3TS2A 2JJQA 1NMGA 4Y7NH 2I0QA 2I5LX 1X65A 4DR6L 4APVA 3J81c 4AIMA 1KD1C 1VQHA 1J5EQ 3BJUA 1A62A 2CCZA 4IFDI 4HJ9A 5BR8L 1VQKA 3NEMA 4OX9Q 2BA1A 2MO1A 2ZTEA 3KDFB 1N33L 2UUCQ 1HR0W 2GVBA 4MNOA 2Y0SE 4X65Q 2KBNA 4JI4L 4PZ6A 1VQ9A 1B70B 3CQZH 4DV5Q 3PF5A 2N3SA 3RLOA 2NVXH 3S1NH 3M4OH 1X3FA 2ATWA 4UPAA 4DV7Q 1CKMA 2R7DA 2E2IH 3OTOL 1N32L 4LF6L 1L1OB 3KFUA 4A3DG 3I2ZA 1XTDA 5GQOA 4DV3Q 4R4TA 4KLKA 4OWTB 3I56A 4A93H 2Q2HA 4C2MH 1JMCA 3CCQA 4DUZQ 1EYGA 4IO9A 3I4NG 1AH9A 1S72A 1EFWA 1WI5A 4A3CG 4IPGA 2R7ZG 3PUZA 1D7QA 4NPSA 1YVCA 1YHBA 2Y0SG 1CUKA 1VQDA 4JI1L 5C44G 2HT1A 1N9WA 1SR3A 2D0PA 1K73C 3F2DA 1PH6A 1NBWA 4GOPC 3HOVG 4LF5L 1CKOA 5FLMG 3S16H 4XTCS 4UP9A 2EQSA 3S24A 4DPGA 1W2BA 1XNRL 3UDGA 1D8LA 2IT1A 4GN5A 1B8AA 1VQBA 1XNQQ 5C4XG 4GKJL 1G291 2RHSB 4UP8A 1Y1WG 3GTPH 5C4JH 3PIOA 3CCMA 1QUQB 1Q82C 4P73A 4RG1A 1NMFA 4YWMA 3PO2G 1PH2A 1A0IA 3J80i 5LMUQ 5IYBG 1G6PA 4LF4Q 1VQ7A 1PYBA 2XTIA 1X54A 4YY3Q 1YI2A 4DV2Q 1JE5A 4O2DA 4B3ML 4DKAC 3GTJH 2LXJA 4P72A 3UE0A 3S15H 2K5VA 4UP7A 3ZJYC 1UE6A 2MQHA 2IHEA 3FP9A 1XMOL 2JQOA 1VQ6A 4A3DH 3PV0A 2K14A 1FJGQ 1Y14B 4DAMA 1IBLL 2Z6KC 1QVGA 1LTLA 1UEBA 4K0KQ 1MKHA 2V1CC 4XIGS 2UUBQ 1HJPA 3I4NH 4A3CH 1I6HH 3L7ZC 3DM3A 2R7ZH 4RMFA 1S3OA 5IYDG 1VQ8A 3GTMH 5C44H 4LFCQ 4LNQA 4UY8C 2JE6I 4JI6L 3HOVH 1AE2A 4NXMQ 4DV4Q 4YHHL 5M3MG 5FLMH 3PF4A 2LSSA 5GROA 3T1YQ 4DV1L 3GTGH 4EX5A 1Q7YC 3ERSX 3U58A 1R9TH 4LFAQ 1KRTA 4BA2I 2AWOA 5C4XH 1YNXA 4LF7L 2PQAA 1X6OA 4X62L 3CMAA 5IP7G 1WJJA 4GOPA 1Y1WH 3E9IA 3A5ZB 3PUXA 2D0OA 5HY6A 4A3FG 1B7YB 1TWGH 2E5LL 4OO1I 1JJGA 4DR5L 2PMZE 2JA5G 2ES2A 4JI5Q 3CPFA 3PO2H 3JAMi 1IYJB 4P71A 1PA6A 4B3RL 1HZBA 3DLLA 5IYBH 1HZ9A 2K5NA 5C0XJ 2JA7G 1SE8A 1NTGA 1C7YA 4DR7Q 3IRBA 3VDYA 1N36Q 5GAGC 1K83H 2NN6I 3S2DH 1Z47A 1VQPA 5JJIA 1PH7A 1N34L 2CWAA 5JEAJ 5FJ8G 4JCVE 2KHJA 4HIDA 1I94L 2HHHL 4LFBL 4YCWA 3PCOB 4IPHA 1QZHA 3GO5A 2KENA 1Q8KA 1WCMG 4JI8Q 4DR2L 2YU9H 2IX1A 5M5YH 1DGSA 2ZTCA 4X66L 4AYBE 1SMXA 4JI4Q 3S1MH 5IYDH 2B3GA 1YJNA 4IPDA 2Q2IA 1OXSC 1E24A 2A1AA 1HNWL 3PUYA 4R4IA 4HJAA 5EAYA 1K9MC 5M3MH 4KI0A 3F2CA 4GOPB 4DR4L 1U5KA 2CFMA 1PV4A 3OTOQ 2WFWA 3RZDH 1N32Q 4LF6Q 1ASYA 4A3LG 4GS3A 3J81j 2HIXA 3CC4A 3HOWG 3J7ZC 1SFOH 5IP7H 3CAMA 2ZM6Q 4NB3A 1YEZA 4QJFA 2PNHA 4LUVA 4A3FH 2IX0A 3G4SA 3PO3G 4ME3A 2YTXA 2JA5H 3EIVA 1V1QA 4JOIC 4JI7L 4BBSG 5JJKA 3STBC 2B63G 4DUYL 1MIUA 2K50A 4YCVA 4NXNL 4AYBG 3WWVA 1E22A 2JA7H 2NVTH 3TRZA 1HZAA 3F8TA 1KXLA 3A0JA 1HNZL 4AQYQ 3M3YH 1UWVA 3CCUA 1Q1EA 2OTJA 1QUQA 5FJ8H 3H3VH 2BH2A 3RN5A 4JI3L 1VQCA 1BBUA 2MFIA 4GKJQ 3CC2A 1BKBA 3J81i 3CCJA 1WCMH 4P75A 3M85A 3CP0A 1I5FA 3M4QA 3CCVA 2VW9A 5K36G 3KJPA 1IBKL 2C35B 1XPRA 1Y1VG 5FLXc 1YJ9A 4R4QA 4PMWA 3G6EA 3I4OA 2QGQA 2ZTDA 1NE3A 1OXUA 4JI2Q 2K4KA 2ZJPA 4DV6L 2UXBL 2LXKA 4PG3A 1EUJA 2D62A 4B3MQ 3TREA 3EN2A 3RZOH 4IPCA 1YJWA 3PUVA 4IOCA 5M3FG 4DR1L 1KIXA 1EIFA 2JEAI 1UE5A 3W1BA 2RHQB 2IHFA 4IJHA 4HIOA 1HNXL 5ELOA 4A3LH 4Y52H 3HOWH 2UXDQ 4C3IH 1YIJA 1XMQQ 2YV5A 4A3IG 3A5UA 4A3KG 4GNXC 1IBLQ 4TVAB 3K7UC 3L2PA 4BBRG 2NVYH 3PO3H 3UDIA 1GO3E 1I3QH 1VQAA 3M9BA 4GN4B 2JA9A 1YHQA 3U4ZA 3W5OA 2OTLA 2B63H 1RIPA 2R92G 4BBSH 4GLVB 4OWXB 3K0XA 4JBJA 4KHPQ 4QL5A 3H0GG 2AHOB 4AH6A 4JYAL 1RL2A 4LW1A 4YHHQ 4OX9L 1XJVA 3AFQA 4J15A 3HFZB 4JG2A 3SGIA 3ULPA 2QA4A 1VQGA 4X62Q 4GKKL 2ALYB 2RF4A 4A3EG 2UUAL 2Z0SA 3CCRA 4DR5Q 1AE3A 1EQQA 2EIFA 3H15A 3RLFA 1Y1VH 1YZ6A 4OWWB 1EQRA 2WP8J 4B3RQ 2E2HH 1NY4A 4GLXA 4OONA 2UXCQ 3F1ZA 2A8VA 4B3TL 5C3EG 5C0XG 4P74A 2OQKA 4DUZL 5M3FH 2RCNA 4JI0L 1BVSA 3U4VA 3I4MG 4GLAC 3U50C 1TWCH 1QZGA 1J6QA 3HKSA 2HHHQ 4A3IH 4LFBQ 2I5HA 2OQ0A 4A3KH 4L5TA 2AKWB 2N49A 5JEAG 1FGUA 1IZ6A 1TWFH 3GD7A 4KHZA 1VS0A 2AWNA 3RLNA 2L15A 4BBRH 5LMNL 4DR3Q 4DR2Q 3BU2A 4OO1G 2R92H 1JB7A 1C9OA 1EOVA 1K0RA 1L1OC 1X55A 2DUDA 3GTQH 1PH1A 3M7NA 4X6AH 1E1TA 1VQEA 3H0GH 2F3IA 5H1SE 5AJ3L 1HNWQ 1GKHA 4C3JH 1H95A 4A75A 4DR4Q 4DNIA 1K8AC 1BBWA 2I5MX 1GD7A 3FKIG 3I55A 4HJ7A 4JC0A 1P8LA 3JC66 2JEBI 3TEHB 3HKZE 2N78A 4R4OA 5LMUL 1VQOA 3CCLA 3T1HL 1VQIA 4LF4L 3UDFA 1MJEA 1IL2A 3Q8DA 4IOAA 4A3EH 4A3GG 2YYZA 3OW2A 3AYHB 3D31A 1SN8A 1KAWA 3RN2A 1IBML 2UU9L 4DR6Q 5E7NA 4LF9L 1VQ5A 1X56A 3CMEA 5BR8Q 1HZCA 3K80C 4DUYQ 1GM5A 4LF8L 4NXNQ 2VQFL 3AEVA 1VQLA 1KL9A 1N33Q 5GAHC 2VQEL 1XPUA 5C3EH 1O7IA 2DGYA 3MXNB 1PH9A 4K0KL 4PZ8A 3S1QH 1HNZQ 2Z6KA 1LUZA 2BH8A 2JA8G 3I4MH 3K8AA 1PFSA 3TS0A 3STBD 2JA6G 2CWPA 4BA1I 5HGQA 2VS1A 4DV0L 2IY5B 4JI3Q 1OTCA 2OCEA 3ER0A 2R7FA 3FHWA 3HKZG 3KOJA 4MTNA 4BY1G 3ICEA 3G48A 4YWKA 4JBKA 1IBKQ 1X3GA 4IFDJ 3H3VI 4LFAL 1EWIA 4WJ4A 1V9PA 1E7ZA 4JV5L 3PGZA 1QVFA 4DV6Q 3TQYA 1G51A 2UXBQ 4TQUS 3S14H 1E1OA 2Q2UA 1HR0L 2ASBA 4JI1Q 5IT9c 3FKIH 5M5XH 1VQFA 4DR1Q 3HOZG 3E0EA 3S1RH 1HNXQ 4LF5Q 2NZHA 3I7FA 1EIYB 1IXRA 2KHIA 1CSQA 1YITA
chains in the Genus database with same CATH superfamily
3BDCA 1JOQA 1XNRQ 4A3GH 2B2YC 5EKLA 2M2LA 4QCLA 2WAQG 4EQPA 4CDDC 4FXDA 1JWUD 1RHPA 1M4VA 3NBHB 4ALPA 4X64L 2NVQB 1CSPA 2VY3A 3QOLA 2MNAA 1JCKB 2XRSD 2E74C 4HJ5A 1HUMA 2FMCA 4B3SL 3GDEA 3SK5A 4HEDA 3HOXG 1XMOQ 4L5QA 2UUAQ 1JWSD 2F52A 4FP5D 3B6YA 2BDNA 5C4HA 4L5RC 1Q12A 3EJIA 1UAPA 4I7AA 2Z4HA 1X3EA 2H1EA 4K14A 1C48A 3EA6A 4KK7A 4WORA 3K7AB 4DK6C 4BY1B 4JI6Q 3CF5A 1AEXA 1H9KA 4DV1Q 3KJOA 3OYYA 1O78A 2HDMA 1K8GA 2XVSA 1YBYA 5I2YA 1KHIA 4RFBA 4AQYL 4MZ9A 3HOUG 3C1EA 5ELNA 3G6JB 5DAUA 3T13A 4HIKA 2A6ED 1Y8NB 2XGTA 5IE8A 1WTVA 2EDGA 4WJWA 5HURA 2WAQB 3PMFA 2AQ2B 2Q8TA 3PUWA 4HJ8A 2IW3A 1I4GA 3T1HQ 3J7A5 1PXUA 3NWTA 2CQOA 1CQVA 4ME5A 2NZOA 2KCTA 2L9HA 2CQAA 3FVQA 3A55A 5KNCA 3Q24A 3KF8A 2UU9Q 4LF8Q 1CI3M 4N9PA 3A74A 1I4XA 2OWOA 1JOOA 2UXDL 4DFAA 4CKBA 2VQEQ 4V0BA 3I70A 1FYCA 3EFXD 3HOXB 1STYA 1NR2A 1XNQL 4JK1C 2MPMA 2PI2E 4C3HH 1GXDC 1VQJA 5JJLA 2D2CC 1ASZA 2HDLA 2JK8A 3KF6B 1PFMA 4RA8A 1JR0D 3R2IA 2B2UC 5IP9G 4KKSA 2ID0A 2R93G 1C0AA 3MVVA 4DV2L 4EQ5A 3FPPA 5LMNW 2DJGC 3M4PA 4L5SA 2O4XA 1PYSB 1FJGL 2YTVA 5I4DA 3FPUB 3PIP3 5M5WB 3HOUB 2UUBL 1S40A 5CBEE 4YWLA 2AMCB 3DM1A 4KD3A 4YCUA 1B2TA 4DF7A 1EIGA 3IFTA 1MSGA 5GADC 1NNXA 4NXML 2WAQE 3KDFA 1PH8A 4DK1A 1PRTD 1XX8A 1SXTA 2CW0D 4BS9A 3CD6A 2IJ0A 4OXPA 1UE7A 1V43A 5D14A 1HTLD 1KRSA 2MP1A 5FO7B 4CBVA 1I50B 2A68C 3A8JE 1L1OA 3N6RA 5E4WC 3GTOB 3QIAA 3K81C 4XYOA 2GA4B 3ZYYX 4OGQC 2JJQA 4IFDH 1BBXC 4DR6L 4APVA 2R93B 2CCZA 1J5EQ 1ILPA 4O1NA 1DCZA 5BR8L 1TKWB 4XQJA 4OELB 2UUCQ 4Y7NB 2B2VC 3E3XA 3SHLA 5IIFA 4DV5Q 3CHBD 2R7DA 3KBGA 2E2IH 1N32L 3RD4A 5GQOA 1U4RA 2Q2HA 3NQIA 5I9PA 4DNRB 4DUZQ 3M4OB 3I4NG 4IO9A 1QNKA 1S72A 4RGMA 5CGKA 5BN4A 5C44G 3F2DA 3HOVG 1PTOC 3FDTA 4M8AA 5FLMG 2RQXA 4C2MB 1CHPD 2EJMA 3HP3A 4I65A 5C4XG 1ENCA 1Y1WG 3CCMA 3DWAA 1NMFA 4PQXA 2NYZD 4DU9A 5IYBG 5JOBA 3BVZA 4YY3Q 1YI2A 1DD2A 2ICIA 1JE5A 2K28A 4KJOA 4N8FA 3SK8A 3GTJH 2LXJA 3I73A 4P72A 1S4ZA 3UE0A 1IW7C 3ZJYC 3QO2A 2JQOA 4A3DH 2XSCA 1IBLL 1QVGA 5ELEA 1CQFA 2P5ZX 3DM3A 4RMFA 1CT1D 1DONA 1PRTB 1SNMA 4LNQA 2JE6I 2EXZA 4S3SA 3NWSA 3MAQA 4K6LA 3I4NB 1B50A 3ERSX 1H9MA 3KLRA 1K0SA 2B2WC 1CK1A 4LFAQ 1X6OA 4X62L 5C44B 2F0QA 3PUXA 1LT3D 3HOVB 4H7BA 1GUSA 5CR3A 4IURA 4JI5Q 2ES2A 3PO2H 1IYJB 3KBXA 1PA6A 3DLLA 3LWEA 2K5NA 5C4XB 1FNUA 1C7YA 4HSPA 1Y1WB 2PZTA 4FXGC 1TWGB 2NN6I 1XTCD 5JJIA 1PFBA 2KOLA 2B2TA 3NPPA 1I94L 4LFBL 3NXWA 3PCOB 5CV4A 2PQEA 1QZHA 1TS3A 2KENA 1SNOA 2NTSA 3PIO3 4DAVA 4H13C 4JI4Q 3S2DB 2Q2IA 2A1AA 4R4IA 4KI0A 1U5KA 1JC7A 2WINB 3DHQA 3E0JA 3S9WA 1YEZA 2EVBA 1WTOA 5EBDA 2JA5H 4BBSG 4DUYL 1MIUA 4NXNL 4AYBG 3RZDB 1AFPA 2CH4W 3BS1A 2JA7H 1YNNC 4TRDA 3NUCA 1L0XB 1HZAA 3F8TA 1KXLA 1HNZL 2WACA 3TP6A 4AQYQ 3M3YH 4LMQD 1Q1EA 5G3LF 1VQCA 2L55A 5IGCA 4HCEA 3I4OA 2JP1A 5EGTA 4DV6L 2UXBL 5IGFA 3EN2A 1YJWA 1LABA 1KIXA 4DR1L 4IJHA 4Y52H 5ELOA 3HOWH 2UXDQ 2RDFA 3Q0AA 2F0KA 3A5UA 4GNXC 1BCPF 3CKIB 1KDCA 4ZLTF 1GO3E 1I3QH 1VQAA 2F0TA 4GN4B 1YHQA 2OTLA 1WTQA 1BOSA 1RIPA 2B63H 4GLVB 2F0UA 4KTAA 4AH6A 4IQZA 2OT2A 3U9OA 1XJVA 1KABA 3AFQA 4BBSB 3ULPA 3SGIA 4AYBB 5KNDA 2QA4A 4QUCA 4OHJA 5DM63 2UUAL 4HMIA 4CJ1B 2Z0SA 5K36H 4PV1C 1CZGA 3MHBA 1EQQA 1Y1VH 4B3RQ 3OW7A 2E2HH 4GLXA 4OONA 3MEHA 4P74A 1TIID 3MZ5A 4NP5A 1QZGA 1DYQA 4A3KH 5KNBA 4HAEA 1TWFH 3GD7A 4KHZA 1VS0A 2AWNA 4BBRH 1H9RA 4KY7A 4DR2Q 4OO1G 1BCPC 1EOVA 1K0RA 1WD1A 1HNWQ 1GKHA 1IKMA 4C3JH 3SEBA 1H95A 2F3WA 1S5ED 1D5XC 3FKIG 4HJ7A 3TEHB 4CHTB 1PYWD 2JEBI 4R4OA 1VQOA 3CCLA 3GTQB 3T1HL 2F0WA 1IL2A 2IL8A 4JVZA 4A3EH 2EYLA 1VMCA 2YYZA 4DR6Q 3D31A 2UU9L 5ELCA 3ND9A 1F2YA 1VQ5A 1GM5A 3CMEA 5BR8Q 4LF8L 2VNUD 1A2TA 1KL9A 1EFID 5GAHC 1FR3A 3DWQA 3HEJA 2VQEL 5C3EH 1DZ1A 4K0KL 2Z6KA 3I4MH 1D1IA 1PFSA 3NBHA 2JA6G 2CWPA 4BA1I 2VS1A 2G9DA 1I4RA 2IY5B 5JEAH 4TKOB 4MTNA 3ICEA 2B8GA 3S1QB 4IFDJ 1EWIA 1V9PA 4LK1C 3K5MA 5IT9c 1WTRA 3KLSX 2PW5A 1EIYB 3DMUA 2M00A 1CSQA 1YITA 2NVQH 3FKIB 4OIKA 3BVMA 3S1RB 3L3OC 1MD2D 1SAPA 4JYAQ 4ZAIA 2F0VA 1B9MA 3VR6A 2K5HA 1PLFA 1STBA 2TSSA 4C56C 4POFA 5C5LA 1A6XA 2Z9HA 3CXCA 1L0WA 4Q0FA 1T9HA 5D65A 5T1GA 4RHSA 1D5MC 1Q46A 2NB0A 4NW2A 4GKKQ 3K7AH 5DLQE 4H02A 4BY1H 3QG1A 1F2MA 3RUZA 1BCPB 5D3IB 1EY6A 4Q5VA 3I8ZA 4RKBA 2JA6B 3IL8A 3K5OA 2Z8LA 2FJ2A 4WRDA 4A3BG 1KDBA 2ZM6L 2VL6A 2ICEC 2KQ3A 3GTKB 4NDXA 2A69D 1MI2A 1J5EL 3D4RA 2K5DA 3NELA 4DGZA 2UUCL 1PH5A 3J80c 3MEFA 4XXEA 1KTKA 1B4OA 3ND8A 4DV5L 2F0NA 3MFGA 5J22A 5IYCG 1SYGA 3KF6A 2RBMA 2DNEA 5KRUA 1WYDA 1GUWA 4FNFA 3GTLB 2I07B 4KMUC 2LKVA 5GAEC 3HOXH 4K8JA 2H4OA 1I94Q 1IBMQ 4LUZA 3HZXA 4N9TA 4LF9Q 1YHAA 1W3SA 3TP7A 2Q2TA 4BY7G 4FDBA 3NHHA 3BZKA 1TWHB 3R3OA 4LJZC 1XMQL 3S2HB 3SVMA 1WTWA 1YNJD 4QGUA 1H9SB 4FF2A 4RH6A 4A3JG 1A63A 5IY0A 3H3VC 3JAMc 2V4DA 3NENA 3S17B 2NN6G 3OMGA 4KJNA 4A3BB 5C0XI 1TXYA 3D4DA 1U0LA 5M5WH 3AQQA 3HOUH 3CC7A 4YY3L 2F0PA 1MJCA 4XDXA 2L5TA 1UE1A 1J9OA 3UI2A 1KC8C 5J3BA 3G71A 1HR0Q 3QOJA 2EYJA 3X3NA 1F9RA 5CORA 1KNAA 2UXCL 1A3UA 3M7GA 2H5XA 2CKZB 3NP8A 1TWAB 1UEAB 4IUVA 1M90C 4G4KA 1I50H 4IN3A 3KLWA 3GTOH 2KEEA 3VR3A 5E1FA 4MIUA 2FHTA 2K75A 4BY7B 4JI5L 1HFNA 5IP9H 4GN3B 5LL6X 2PQAB 2FXQA 2R93H 1D1KA 1VQ4A 1R4PB 4A3JB 2HQLA 4Y7NH 2E2JB 3P1HA 2I0QA 4IUTA 4IUQA 3J81c 1KD1C 1VQHA 3MXGA 4HJ9A 2BA1A 2MO1A 1WTXA 1N33L 2Y0SE 4JI4L 1PZID 5C3WA 1IL8A 2N3SA 5IODA 2BCOA 3RLOA 3Q23A 3M4OH 2PO4A 1CKMA 2F4IA 4PMBA 4YIJA 5DNFA 4DV3Q 3CQZB 1QG7A 4KLKA 4R4TA 3I56A 4LAAA 4C2MH 2NVXB 1SE2A 3A8KE 3CCQA 2BE5C 4FF1A 1EYGA 4A3CG 2MUYA 2KHSA 1YHBA 2MHVA 3VA5A 1N9WA 4ZKCB 5IGEA 4KV6A 1K73C 5A35A 3SDZA 4LF5L 1CKOA 5IOCA 3O13A 3V05A 4DPGA 1W2BA 3FRPB 3UDGA 1GUNA 2F0JA 1QUQB 5IGDA 1Q82C 1G2SA 3J80i 1ICFB 1ZYRC 4PNYA 3Q22A 3MXUA 1X54A 4Z9CB 4O2DA 3GTPB 5C4JB 1STAA 3OMCA 3PV0A 1Y14B 1UEBA 4K0KQ 1MKHA 2V1CC 4XIGS 5EKKA 3TDQA 3I4NH 2F0HA 2SDFA 3S15B 3R93A 5IYDG 5C44H 4LFCQ 3HOVH 1KNEA 1ET6A 5M3MG 5FLMH 3T1YQ 5GROA 3DEOA 2QKIC 4EX5A 4IUUA 1KRTA 5C4XH 5DEHA 4LF7L 3GTMB 1Y69U 5IP7G 1Y1WH 3D4WA 3E9IA 2D0OA 4OO1I 2RCFA 1TWGH 1JJGA 4XYQA 5IGGA 3CPFA 3GTGB 3JAMi 5IT9L 4B3RL 2B8FA 5IYBH 1HZ9A 2XRQD 3KUPA 3WOEA 2K04A 1NTGA 3IRBA 3VDYA 5GAGC 4CGYB 3S2DH 2A68D 1PH7A 1N34L 5JEAJ 4JCVE 4IPHA 1Q8KA 1CTMA 1WCMG 4DR2L 4X66L 1YJNA 2BOSA 1E24A 2J4XA 1HNWL 2K03A 3H6MA 4K6DA 2DN8A 3TMEA 4HTHA 3F2CA 1PTOF 5F2DA 2CFMA 2EOTA 1PV4A 3RZDH 4LF6Q 4A3LG 3J81j 3CC4A 5ISRA 3J7ZC 1JE4A 1SNDA 2ZM6Q 4NB3A 4QJFA 2LS01 4LUVA 4HMJA 3G4SA 5M3MB 3PO3G 4ME3A 1V1QA 1TU2B 2K50A 2L11A 3WWVA 1E22A 1DM0B 1E2ZA 4FXKC 3SR1A 3J80L 2EZVA 4M1UB 1A2UA 2A6HC 2OTJA 1EL0A 3GQBA 3RN5A 1BBUA 2MFIA 1BKBA 3J81i 1PTOD 2NVTB 2SEBD 4L63B 1NAPA 2VW9A 2C35B 2R61A 4KY6A 5FLXc 1YJ9A 2QGQA 1NE3A 1II3A 5D3DA 4DXFA 2LXKA 1CA5A 1EUJA 2CVRA 2D62A 2AUKA 4IPCA 1WCMB 5M3FG 1EIFA 2JEAI 4HIOA 2IHFA 2SNMA 1YIJA 1XMQQ 3CU7A 4TVAB 3RMHA 3QWNA 1EYAA 1O7LA 3RZOB 1AZQA 2JA9A 4BBSH 3W5OA 1PZKD 1IW7D 1TVXA 1G2TA 3FMCA 2AHOB 4JYAL 3JAML 4YHHQ 4OX9L 2NVYB 3PO3B 4J15A 2O5JC 3HFZB 4JPBW 1VQGA 4QB4A 3V2TA 2NBFA 4GKKL 1HXYD 4ZYSA 1I4HA 4DR5Q 1GOZA 2EIFA 1S5DD 1YZ6A 1NY4A 2UXCQ 4KHVA 1LO5D 1Q3LA 3F1ZA 3T56B 2A8VA 2N55A 5C0XG 2EYOA 1RCVD 1J6QA 1U4MA 3BG3A 1LLRD 2C9OA 2OQ0A 4L5TA 4X3SA 2N49A 3RLNA 5IT9E 1X55A 5M3FB 1L1OC 3I72A 3GTQH 1TWCB 1VQEA 2F3IA 2TMPA 4DR4Q 1K8AC 1BBWA 4B9WA 1GD7A 3I55A 1WTHA 1XXGA 3HKZE 2ZT9C 1MJEA 3Q8DA 1SYEA 2PZWA 1TS5A 2KEDA 3AYHB 1RTNA 5I6YA 1IBML 1WTPA 4LF9L 1X56A 5CMDA 3J81L 1N33Q 3AMUA 3OPOA 5CC4A 4MHEA 1LT4D 3CRKC 1F9SA 1O7IA 3N52A 5EQ0A 3G7LA 4PZ8A 3S1QH 2BH8A 2JA8G 3K8AA 1FD7D 1PTOB 5HGQA 1H9JA 2OCEA 4DK0A 1OTCA 2JSOA 2F0IA 1YNND 5HGTA 2AQ3B 4OO1H 4YWKA 4JBKA 1IBKQ 1A15A 1A3TA 3H3VI 3SE0A 1E7ZA 4EQOA 1G51A 5EPLA 4F87A 2Q2UA 1ONLA 1HR0L 2ASBA 3FKIH 3HOZG 3S1RH 1HUNA 1BUVT 4LF5Q 1EU3A 1UUPA 3OOCA 1IXRA 4N8X1 1TY0A 2RA4A 3TSSA 1VDZA 3KYHC 4HIMA 1ENFA 3BDLA 3H09A 1I6VC 3I3CA 4IZ8A 4H0LC 4G7ZC 2K52A 1DOMA 3ULJA 3LGJA 1G91A 4JI8L 1Q90A 5EPKA 2GN5A 1GUGA 2G5DA 2JA6H 5IGBA 4R4CA 3ONAB 3VYRA 4DNTB 3P20A 1M1KC 3GTKH 3BZCA 3VR4A 4DAPA 3MWYW 2ZJRA 2JA8B 1N8RC 1PHJA 1E3PA 3UE1A 4B3TQ 4A4IA 3TN2A 2QW7A 1HHVA 1UNSA 5G3LD 1VQNA 4QY7A 1A8VA 1VCIA 2WKCA 3PIPA 2NUCA 1X3PA 4JI0Q 1ESRA 2SNSA 3C3LA 3EQLC 2VUMG 4ZRZA 2KCCA 1L2FA 1XPOA 4JOIA 4HR7B 2K32A 3OWEB 3GTLH 4O0AA 4BXXG 1KDAA 1H9SA 5CYUA 5LMNQ 4LF7Q 4QUFA 3MFYA 3VYSA 1O80A 2QEXA 3HOZB 1J8IA 5KYIA 3A7LA 3A8IE 2HIVA 3T51B 5CV8A 2K05A 4F7XA 1NJIC 3WDNA 1CFMA 2AQ1B 1B1ZA 4DV3L 1Z7TA 5E4XA 2JXMB 4DN4M 1Q81C 1BCPD 1SLJA 4QQBX 2B2TC 4UAIA 1OXTA 2MO0A 1TWHH 3S2HH 4JI2L 4RKLA 1N34Q 4QIWE 2M9VA 2I46A 4PZ7A 4XQNA 3M4YA 3ULLA 2XNAC 4UHVA 2VQFQ 1KLGD 3S17H 1JJ2A 1EZ6A 4X66Q 4A3BH 4DK3C 2E2DC 3OIQA 1X9NA 1CKNB 2R6GA 2BA0A 4KHPL 1IKLA 1GUTA 1VF5C 1ILQA 1NUCA 3HOYG 2SOBA 5IYCH 4A3MG 1EQVA 2VUMB 1MGSA 5C5MA 4L8JA 4JV5Q 1TWAH 3E9HA 2LMCB 4J1MA 5JAVA 2GVAA 3EBEA 4JBWA 1RKNA 3CCSA 1EYDA 4LFCL 1SNCA 4UDUC 4GNXB 5COYA 3D3RA 4BY7H 1JQYD 4IUPA 3TBIB 1CHQD 1EEFD 3T1YL 4DAYB 5KEEA 2JN4A 4RGOS 1OXXK 3A56A 5FLXL 1Z9FA 3CW2C 4A3JH 1JT8A 1K8OA 2IWHA 2PI2A 2L4NA 4A93G 3WOFA 1GHJA 4K2LA 2K5QA 2E2JH 5IWAQ 2NN6H 1RJTA 1LYLA 2F4VQ 2DY7A 2OEOA 3CPWA 2F0MA 1NMGA 2I5LX 1SMYC 3HOYB 3NTIA 3QR8A 4AIMA 2KCNA 3BJUA 1SSOA 1VQKA 4OX9Q 4A3MB 1BNZA 4X65Q 2KBNA 2XIWA 4KKTA 1VQ9A 4C1NI 2X6GA 3CQZH 1V1PB 4KN7C 3PF5A 4DXGA 2PCFB 2NVXH 1X3FA 2K01A 2VB3X 2ATWA 4DV7Q 4RHRA 1C4QA 2ZXPA 4ZKBB 1LT5D 4LF6L 3KFUA 3I2ZA 5A2QL 1DOKA 4J6HA 2DY8A 3E6ZX 5I9OA 1JMCA 3S1NB 1NCVA 1AH9A 1D2BA 4IPGA 2R7ZG 3PUZA 4NPSA 2Y0SG 5CV6A 2K6AA 1SR3A 1DJRD 1NBWA 4GOPC 1PH6A 4FYDA 1F77A 4A93B 1IYUA 1G6ZA 2IT1A 4GN5A 1B8AA 1G291 2RHSB 4UP8A 2CHBD 3GTPH 5C4JH 3PIOA 5JJZA 2B2YA 3S16B 2EJGC 4P73A 4RG1A 1K3BC 5M9OA 1G6PA 2XTIA 1BDOA 4DKAC 3S15H 2K5VA 2L12A 1UE6A 2MQHA 3FP9A 5JVG3 5J39A 1T5EA 3H94A 2K14A 1NSNS 2Z6KC 5EKIA 1LTLA 4R8NA 4E6IA 1STHA 4A3CH 3NTKA 3L7ZC 1FGBD 1I4PA 1VQ8A 3GTMH 1PZJD 2Q8RE 4DV4Q 1HFGA 3R2TA 4YHHL 1QNUA 1RDPD 2HQEA 3NE5B 3GTGH 1Q7YC 1I6HB 1IYVA 2R7ZB 2AWOA 2Y0SB 1YNXA 1E0BA 1WJJA 2E5LL 4A3FG 1B7YB 4DR5L 2PMZE 2K5WA 3ERQA 2R3ZA 2Q8IB 2OF1A 1HZBA 1QE6A 4K5XA 4CDCC 1R9TB 1SE8A 1VMPA 2NTTA 5CV9A 5KYLA 4HSVA 2RKSA 2A73B 1Z47A 1VQPA 5FJ8G 1TS2A 4HIDA 4BWGB 2HD3A 4YCWA 3GO5A 2IX1A 4JI8Q 2QF7A 4IFDI 1DGSA 1SMXA 4CKEA 1K83B 1F9PA 5IYDH 1EY7A 1OXSC 3HRZC 1OO9B 3PUYA 4TSSA 5EAYA 5M3MH 4GOPB 3IFDA 4DR4L 4J8QA 2YU9B 3OTOQ 2WFWA 5M5YB 1EY4A 4V190 3S1MB 2HIXA 2IX3A 1ESFA 4C3IG 2B2UA 5IP7H 1U4PA 3LX0A 2YTXA 1HRJA 4JI7L 3STBC 5E3FA 2NZ1D 5EBCA 1EEID 1SFOB 1C8CA 2NVTH 4A3FB 3TRZA 1FNWA 3A0JA 2BE5D 1Y8PB 1UWVA 4CDEC 3CCUA 2BH2A 4IALA 1HQMC 1EWHA 5CBAE 1XYIA 4GKJQ 3CCJA 1WCMH 4P75A 3M85A 3CP0A 1I5FA 3M4QA 2PW7A 2A74C 2EYMA 1IBKL 4C1NK 4R4QA 4PMWA 4X3UA 2ZTDA 1JICA 4JI2Q 4PG3A 3RZOH 4B3MQ 1BXTA 1RF2D 3TREA 3PUVA 4IOCA 1EY8A 3W1BA 4A3LH 2DNCA 4A3IG 1BQQT 1ZYRD 4JW0A 3L2PA 1MSHA 2NVYH 3PO3H 2BDOA 3GV6A 1MHWC 3AU7A 2R92G 2EYPA 4MTKA 2PZUA 1QOHA 3K0XA 4KHPQ 4QL5A 1WVLA 3H0GG 4RCNA 4C3IB 1RL2A 1HQRD 5FO9B 3K5LA 2F0LA 4JG2A 2ALYB 4B08A 2B2VA 2RSNA 3NSWA 1AE3A 3RLFA 1EQRA 4G57A 2EY6A 4G7HC 1RD9D 2DJFC 4B3TL 1HCZA 1U9RA 1TR5A 3FEWX 2OQKA 5M3FH 2RCNA 5FO8B 1BVSA 5C6AA 3U4VA 1QCBD 2F0SA 4GLAC 3U50C 1TWCH 5BN5A 2A6EC 3C1FA 2RDHA 1ENAA 2O2LD 2HHHQ 2AKWB 2F0GA 1FGUA 3DWPA 2L15A 5LMNL 4G7OC 3BU2A 1C9OA 3AB9A 4X6AH 1EIHA 2EYHA 5H1SE 5ELFA 1RODA 4A3IB 2QDBA 4HCSA 3K57A 1PRTF 2I5MX 1SNQA 2R92B 3JC66 5BN3A 2N78A 4K5VA 5LMUL 2E76C 4LF4L 3H0GB 3UDFA 1E2VA 2JYOA 4FF4A 1LTRD 4RWSC 4A3GG 3OW2A 1X3QA 2C5CA 3RN2A 1SN8A 1KAWA 3D6CA 5E7NA 1PTOH 2K33A 2X69A 3BDOA 2VQFL 1WD0A 1VQLA 2DGYA 3LWUA 3MXNB 5C0XH 1EQTA 3GV3A 1JORA 1D6EC 3TS0A 2J7ZA 4JI3Q 3HKZG 4R9WA 1TY2A 4K5WA 1X3GA 2A6HD 3DEPA 1AW7A 1F2LA 2FMMA 1LTAD 4JV5L 2B2WA 1M8AA 1E1OA 2QEJC 3BYYB 2RDGA 2RSOA 3E0EA 1HNXQ 1PRTC 3I7FA 2NZHA 2CW0C 1DOLA 2VZAA 4DR7L 1N36L 2FINB 2CH4A 3S14B 4LWCA 4FVMA 5M5XB 1F9QA 2L1BA 1B3AA 5LL6S 1ICWA 4DA2A 1R4QB 1O7ZA 3W1GA 4A3GB 3CCEA 1JJCB 2JA8H 1JWMD 3L0OA 2WB1G 1VF7A 5IWAL 1P16A 1CA6A 2F4VL 1Y8OB 2A19A 4OL7A 1PH4A 2EY5A 3HS0C 1K8MA 1BF4A 2EY2A 4EVOA 3HKZB 2KA7A 3HOZH 3UDXA 4OIJA 4C3HG 4A76A 2F03A 1XWEA 4ABNA 2D9UA 4WFN3 1Q86C 1CZWA 3VR2A 4X65L 2ZJQA 2MJ8A 4LUOA 1LM0A 3A54A 4L6TB 4IUNA 1CKNA 2EXDA 4XT1B 2E5LQ 4KKUA 4WJ3M 1SE3A 3AFPA 5AJ3Q 4DV7L 4JBMA 1PVOA 3RR5A 1FL0A 4PMCA 1BO0A 5C3XA 1EWCA 1QVCA 2X6LA 3MA2B 1PH3A 1EY9A 4H44C 1X32A 2FFKB 3PSIA 2N8NA 2QILA 1K3RA 3R8BA 3GP7A 3RNUA 2EY1A 4EQNA 3X3MA 3EROA 3E5SA 2ENBA 2WB1B 3OSOA 5EPJA 1STNA 1WFQA 3TP5A 3C2PA 3VYTA 1GVPA 4P2CB 4GNXA 5I6WA 3OHXC 4DAYA 2VUMH 4DV0Q 2E8GA 4BXXH 4POGA 2Z1CA 1WOCA 4R8IA 1LACA 1KQSA 1Q1BA 5CV5A 1A3VA 4C3HB 2B29A 1HTPA 5I2XA 4RCOA 4IFDG 3PQIA 4JI7Q 1SROA 1PFNA 4MN3A 2XN9C 1OXVA 4F8MA 4IJLA 3KF8B 4XQQA 3VA7A 1TS4A 2LY7A 4K8IA 2AUJD 1ZXTA 1FNVA 1EZ8A 2EPBA 1SYFA 3IKJA 3SK6A 4R1JA 1W6JA 2YTYA 4DV4L 3D0FA 1STEA 3ITPA 1FVIA 1VQMA 2HCIA 2NWGA 4X64Q 1LTSD 1V1PA 4DR3L 4ZUIA 3J80E 4CJ2C 3H91A 3F2BA 1STGA 2KVMA 4B3SQ 3D8GA 3T4AC 2KCMA 2WB1E 1V8QA 2IPKD 4B9XA 4FF3A 3HOYH 3NK9A 3J7AV 2G9HD 1HH2P 3K6OA 5T1IA 5JVH3 1SRUA 4A3MH 3TS2A 4CKCA 5C4ZA 2WV6D 3D6WA 2F3VA 1LTBD 2WKDA 1X65A 3J7YW 4FO2A 4QIWB 1A62A 4ZK9B 3NEMA 3K0YA 2O5IC 2ZTEA 3KDFB 4ID6A 2GVBA 4MNOA 1HR0W 4PZ6A 1LT6D 1B70B 3T16A 3S1NH 2B39A 3NTHA 4UPAA 1IHZA 3IAYA 1BR9A 3OTOL 3JAME 1L1OB 1B3QA 3A7AB 4A3DG 5KGUA 1XTDA 4ZQ3A 1Z6HA 4OWTB 4A93H 2F0OA 1EFWA 1WI5A 1LTGD 1D7QA 3BVGA 2E2IB 1YVCA 1CUKA 1VQDA 4JI1L 2HT1A 2D0PA 3NBIA 5L37A 3S16H 4XTCS 4UP9A 4OEMB 2EQSA 2A5HA 3S24A 1K28A 3T53B 3VYUA 1V1OA 1I4QA 1XNRL 1D8LA 3Q6SA 3TP8A 1VQBA 1XNQQ 4NKLA 2WIIB 4GKJL 1RTOA 2Z4IA 4YWMA 3PO2G 1PH2A 1A0IA 1U4LA 5FK9C 5LMUQ 1T5XD 4LF4Q 5FKAC 1VQ7A 1PYBA 3P7JA 4DV2Q 4B3ML 4UP7A 3I91A 1XMOL 1QB5D 2IHEA 1VQ6A 1FJGQ 4I7ZC 5FOBB 4DAMA 2UUBQ 1ZKOA 1S5FD 2EE1A 1HJPA 4K2KA 3GTJB 4ULLA 5EJWA 1I6HH 2R7ZH 2ZXRA 1S3OA 4QF4A 2ZXOA 2K7VA 1QWYA 4A3DB 4UY8C 4JI6L 1B53A 1QJOA 4JI0L 1AE2A 4NXMQ 3U9SA 3J81E 3PF4A 2LSSA 4DV1L 1SEBD 3U58A 2E75C 1R9TH 4BA2I 2VXWA 1D5ZC 4ZCKA 2PQAA 3CMAA 2QCPX 4GOPA 3A5ZB 5HY6A 3V96A 1G8ZD 2JA5G 4P71A 2XWJB 1JB3A 1ML0D 4KY5A 5C0XJ 4X3KA 2JA7G 3CRLC 2J0TD 1PMRA 4DR7Q 3BYTB 1N36Q 3I90A 1K83H 2EJFC 2CWAA 3K59A 3PO2B 4ZUJA 2KHJA 2HHHL 1GUOA 4CJ0B 4F88A 2YU9H 1JOKA 5M5YH 2ZTCA 4AYBE 3SK4A 3S1MH 2B3GA 4IPDA 2HCCA 1SMYD 4KN4C 4HJAA 1K9MC 1AN8A 5ELDA 2L0CA 4O42A 2VB2X 1N32Q 3W3AA 2EYFA 1ASYA 1TQOA 4GS3A 3C46A 3HOWG 2PYKA 4RAUC 1SFOH 1SJED 3CAMA 5DM73 2PNHA 4A3FH 2IX0A 1O7YA 1EU4A 1EY0A 3EIVA 3DXJC 4JOIC 5JJKA 2B63G 4YCVA 3QJYA 2HUGA 3P75A 1CM9A 3L9AX 1DXMA 3K5NA 3KK7A 2Z6BA 2JA5B 2F0FA 1QUQA 1NR4A 5FJ8H 3H3VH 3QB3A 2XWBB 3HG9A 4JI3L 3F2UA 3CC2A 1EY5A 5AFWA 2JA7B 3CCVA 1KAAA 5K36G 3KJPA 2QDLA 1XPRA 1Y1VG 2RVLA 3G6EA 3HGBA 3M3YB 1SYDA 1OXUA 1B9NA 2K4KA 4X3TA 3VR5A 2ZJPA 2PNRC 1SBBB 1UE5A 2RHQB 1HNXL 2PMZB 1PDQA 4XT3B 4C3IH 1HPCA 1W6KA 2YV5A 4U68A 4A3KG 1IBLQ 3K7UC 1MBYA 4BBRG 3UDIA 3M9BA 1SYCA 3U4ZA 4OWXB 2F0DA 4JBJA 3HOWB 3URYA 1E2WA 5KIXA 4LW1A 1TT2A 4C3JG 3DUZA 2N88A 1I3QB 4QMGA 5K5PA 2B63B 3TZUA 3OIPA 3SXHA 2KJXA 3BZDB 2D5DA 2F0EA 4ILWA 4X62Q 1F2ZA 1AP0A 1LV9A 2RF4A 5CV7A 4A3EG 2A69C 3MTSA 3CCRA 3H15A 1L0YB 1SNPA 1AZPA 4OWWB 2WP8J 1GJXA 1S5CD 3MC0B 2K1BA 5C3EG 5TSSA 5JPNC 4DUZL 3MXPA 3I4MG 1Y1VB 4RGNA 3HKSA 1Q8IA 2E2HB 3NQTA 4A3IH 2I5HA 4LFBQ 4NMZA 5JEAG 3MXNA 1IZ6A 4DR3Q 2LFNA 5ELBA 3TZDA 1JB7A 4U673 2R92H 2DUDA 1PH1A 3M7NA 1E1TA 3H0GH 5AJ3L 1SDFA 1GHKA 4A3KB 1S5BD 4CDFC 4A75A 1TWFB 4DNIA 1ZEQX 4RGTA 1SE4A 4BBRB 1KLUD 3KLSA 4EGVA 1HA6A 4JC0A 4ODGA 1P8LA 3I4LA 1VQIA 5FLXE 1SJHD 1YNJC 4IOAA 3EVQA 4C3JB 1LTID 2PPBC 3LNNA 4DUYQ 1HZCA 3K80C 4NXNQ 3AEVA 4HN7A 5J1ZA 1XPUA 1PH9A 4A3EB 1HNZQ 5JPMC 5LHY1 1LUZA 3STBD 1ET9A 4DV0L 3W2DA 1EYCA 3ER0A 2OXPA 2R7FA 3FHWA 3KOJA 5NUCA 2KUMA 1B44D 4BY1G 5C3EB 3G48A 3J7AF 2KECA 1QILA 1EOTA 3K58A 3I4MB 4LFAL 4WJ4A 1HA5A 4GZYC 1LTTD 3PGZA 1QVFA 4DV6Q 3TQYA 2UXBQ 4TQUS 3S14H 2MGSA 4JI1Q 5M5XH 1VQFA 4KD4A 3OWFA 2F1MA 4DR1Q 1SYBA 2KHIA 5A2QE
chains in the Genus database with same CATH topology
2VZAA 2NVQH 1XNRQ 4DR7L 4A3GH 3KYHC 1N36L 4HIMA 4LWCA 2WAQG 3NBHB 4JYAQ 2K52A 4ALPA 3W1GA 2K5HA 4X64L 3ULJA 1CSPA 3LGJA 2VY3A 4JI8L 2MNAA 3CCEA 1JJCB 4POFA 2GN5A 2JA8H 4HJ5A 3CXCA 2JA6H 1L0WA 1T9HA 4R4CA 4B3SL 3GDEA 3L0OA 2WB1G 1Q46A 5IWAL 3HOXG 4GKKQ 1XMOQ 1M1KC 1P16A 3K7AH 4L5QA 4H02A 5DLQE 2UUAQ 4BY1H 2F4VL 3GTKH 2F52A 3BZCA 3B6YA 4L5RC 1Q12A 2ZJRA 2A19A 1N8RC 1PHJA 1PH4A 1E3PA 1X3EA 3UE1A 4A3BG 4B3TQ 2ZM6L 4A4IA 2VL6A 1VQNA 4QY7A 1A8VA 4DK6C 1VCIA 3PIPA 3HOZH 3UDXA 4JI6Q 1J5EL 4A76A 4JI0Q 3CF5A 3NELA 4DV1Q 1XPOA 1Q86C 1L2FA 2VUMG 4JOIA 1PH5A 3KJOA 2UUCL 4X65L 3J80c 3MEFA 3OYYA 2ZJQA 3GTLH 4O0AA 4BXXG 5LMNQ 4LUOA 1LM0A 1K8GA 4LF7Q 1CKNA 4DV5L 1YBYA 2EXDA 1KHIA 2QEXA 4AQYL 5IYCG 4MZ9A 2E5LQ 3KF6A 3HOUG 4WJ3M 5ELNA 3AFPA 2HIVA 4HIKA 5AJ3Q 4DV7L 4JBMA 1PVOA 2XGTA 1WYDA 3RR5A 5IE8A 1NJIC 1FL0A 4DV3L 1Q81C 1SLJA 4QQBX 1OXTA 1QVCA 1TWHH 2MO0A 5GAEC 3S2HH 3PUWA 4HJ8A 3T1HQ 1PH3A 3J7A5 4JI2L 3HOXH 1N34Q 2CQOA 4QIWE 2NZOA 2KCTA 4PZ7A 1I94Q 2N8NA 3PSIA 1IBMQ 2UU9Q 4LUZA 1K3RA 4LF9Q 3RNUA 4LF8Q 1YHAA 3ULLA 1W3SA 3A74A 2Q2TA 2VQFQ 2OWOA 4BY7G 4FDBA 3S17H 1JJ2A 2UXDL 3BZKA 4X66Q 1XMQL 2VQEQ 4A3BH 4DK3C 4QGUA 1WFQA 1XNQL 1GVPA 4GNXA 1X9NA 2PI2E 4C3HH 4A3JG 1CKNB 1A63A 1VQJA 2R6GA 5JJLA 1ASZA 2BA0A 2JK8A 5IY0A 2VUMH 3KF6B 3JAMc 4DV0Q 4KHPL 3NENA 2E8GA 2NN6G 5IP9G 4BXXH 5C0XI 4POGA 1TXYA 1WOCA 2ID0A 3HOYG 2R93G 1KQSA 1U0LA 1Q1BA 5M5WH 3AQQA 5IYCH 3CC7A 4YY3L 4A3MG 3HOUH 1C0AA 2B29A 4EQ5A 4DV2L 1MJCA 5LMNW 4IFDG 4JI7Q 1UE1A 4JV5Q 1SROA 3M4PA 4L5SA 1KC8C 1TWAH 1PYSB 5J3BA 3G71A 1HR0Q 1FJGL 1OXVA 2YTVA 3E9HA 4IJLA 3KF8B 2UUBL 1S40A 2UXCL 4YWLA 2AMCB 2CKZB 2H5XA 2GVAA 4YCUA 3EBEA 4JBWA 3CCSA 4LFCL 4R1JA 2YTYA 5GADC 4GNXB 4NXML 2WAQE 4DV4L 3D0FA 3KDFA 1PH8A 1M90C 4BY7H 1I50H 3T1YL 1FVIA 4DAYB 1VQMA 3KLWA 4X64Q 3GTOH 3CD6A 4DR3L 4OXPA 1OXXK 1UE7A 1V43A 1Z9FA 3CW2C 3F2BA 4A3JH 2VNUD 1JT8A 2PI2A 2K75A 4A93G 4B3SQ 1KRSA 4JI5L 2E2JH 1L1OA 5IP9H 5IWAQ 4GN3B 2PQAB 2KCMA 1LYLA 2WB1E 2FXQA 2F4VQ 3HOYH 2R93H 3K81C 1VQ4A 1HH2P 4A3MH 1SRUA 3CPWA 2HQLA 3TS2A 2JJQA 1NMGA 4Y7NH 2I0QA 2I5LX 1X65A 4DR6L 4APVA 3J81c 4AIMA 1KD1C 1VQHA 1J5EQ 3BJUA 1A62A 2CCZA 4IFDI 4HJ9A 5BR8L 1VQKA 3NEMA 4OX9Q 2BA1A 2MO1A 2ZTEA 3KDFB 1N33L 2UUCQ 1HR0W 2GVBA 4MNOA 2Y0SE 4X65Q 2KBNA 4JI4L 4PZ6A 1VQ9A 1B70B 3CQZH 4DV5Q 3PF5A 2N3SA 3RLOA 2NVXH 3S1NH 3M4OH 1X3FA 2ATWA 4UPAA 4DV7Q 1CKMA 2R7DA 2E2IH 3OTOL 1N32L 4LF6L 1L1OB 3KFUA 4A3DG 3I2ZA 1XTDA 5GQOA 4DV3Q 4R4TA 4KLKA 4OWTB 3I56A 4A93H 2Q2HA 4C2MH 1JMCA 3CCQA 4DUZQ 1EYGA 4IO9A 3I4NG 1AH9A 1S72A 1EFWA 1WI5A 4A3CG 4IPGA 2R7ZG 3PUZA 1D7QA 4NPSA 1YVCA 1YHBA 2Y0SG 1CUKA 1VQDA 4JI1L 5C44G 2HT1A 1N9WA 1SR3A 2D0PA 1K73C 3F2DA 1PH6A 1NBWA 4GOPC 3HOVG 4LF5L 1CKOA 5FLMG 3S16H 4XTCS 4UP9A 2EQSA 3S24A 4DPGA 1W2BA 1XNRL 3UDGA 1D8LA 2IT1A 4GN5A 1B8AA 1VQBA 1XNQQ 5C4XG 4GKJL 1G291 2RHSB 4UP8A 1Y1WG 3GTPH 5C4JH 3PIOA 3CCMA 1QUQB 1Q82C 4P73A 4RG1A 1NMFA 4YWMA 3PO2G 1PH2A 1A0IA 3J80i 5LMUQ 5IYBG 1G6PA 4LF4Q 1VQ7A 1PYBA 2XTIA 1X54A 4YY3Q 1YI2A 4DV2Q 1JE5A 4O2DA 4B3ML 4DKAC 3GTJH 2LXJA 4P72A 3UE0A 3S15H 2K5VA 4UP7A 3ZJYC 1UE6A 2MQHA 2IHEA 3FP9A 1XMOL 2JQOA 1VQ6A 4A3DH 3PV0A 2K14A 1FJGQ 1Y14B 4DAMA 1IBLL 2Z6KC 1QVGA 1LTLA 1UEBA 4K0KQ 1MKHA 2V1CC 4XIGS 2UUBQ 1HJPA 3I4NH 4A3CH 1I6HH 3L7ZC 3DM3A 2R7ZH 4RMFA 1S3OA 5IYDG 1VQ8A 3GTMH 5C44H 4LFCQ 4LNQA 4UY8C 2JE6I 4JI6L 3HOVH 1AE2A 4NXMQ 4DV4Q 4YHHL 5M3MG 5FLMH 3PF4A 2LSSA 5GROA 3T1YQ 4DV1L 3GTGH 4EX5A 1Q7YC 3ERSX 3U58A 1R9TH 4LFAQ 1KRTA 4BA2I 2AWOA 5C4XH 1YNXA 4LF7L 2PQAA 1X6OA 4X62L 3CMAA 5IP7G 1WJJA 4GOPA 1Y1WH 3E9IA 3A5ZB 3PUXA 2D0OA 5HY6A 4A3FG 1B7YB 1TWGH 2E5LL 4OO1I 1JJGA 4DR5L 2PMZE 2JA5G 2ES2A 4JI5Q 3CPFA 3PO2H 3JAMi 1IYJB 4P71A 1PA6A 4B3RL 1HZBA 3DLLA 5IYBH 1HZ9A 2K5NA 5C0XJ 2JA7G 1SE8A 1NTGA 1C7YA 4DR7Q 3IRBA 3VDYA 1N36Q 5GAGC 1K83H 2NN6I 3S2DH 1Z47A 1VQPA 5JJIA 1PH7A 1N34L 2CWAA 5JEAJ 5FJ8G 4JCVE 2KHJA 4HIDA 1I94L 2HHHL 4LFBL 4YCWA 3PCOB 4IPHA 1QZHA 3GO5A 2KENA 1Q8KA 1WCMG 4JI8Q 4DR2L 2YU9H 2IX1A 5M5YH 1DGSA 2ZTCA 4X66L 4AYBE 1SMXA 4JI4Q 3S1MH 5IYDH 2B3GA 1YJNA 4IPDA 2Q2IA 1OXSC 1E24A 2A1AA 1HNWL 3PUYA 4R4IA 4HJAA 5EAYA 1K9MC 5M3MH 4KI0A 3F2CA 4GOPB 4DR4L 1U5KA 2CFMA 1PV4A 3OTOQ 2WFWA 3RZDH 1N32Q 4LF6Q 1ASYA 4A3LG 4GS3A 3J81j 2HIXA 3CC4A 3HOWG 3J7ZC 1SFOH 5IP7H 3CAMA 2ZM6Q 4NB3A 1YEZA 4QJFA 2PNHA 4LUVA 4A3FH 2IX0A 3G4SA 3PO3G 4ME3A 2YTXA 2JA5H 3EIVA 1V1QA 4JOIC 4JI7L 4BBSG 5JJKA 3STBC 2B63G 4DUYL 1MIUA 2K50A 4YCVA 4NXNL 4AYBG 3WWVA 1E22A 2JA7H 2NVTH 3TRZA 1HZAA 3F8TA 1KXLA 3A0JA 1HNZL 4AQYQ 3M3YH 1UWVA 3CCUA 1Q1EA 2OTJA 1QUQA 5FJ8H 3H3VH 2BH2A 3RN5A 4JI3L 1VQCA 1BBUA 2MFIA 4GKJQ 3CC2A 1BKBA 3J81i 3CCJA 1WCMH 4P75A 3M85A 3CP0A 1I5FA 3M4QA 3CCVA 2VW9A 5K36G 3KJPA 1IBKL 2C35B 1XPRA 1Y1VG 5FLXc 1YJ9A 4R4QA 4PMWA 3G6EA 3I4OA 2QGQA 2ZTDA 1NE3A 1OXUA 4JI2Q 2K4KA 2ZJPA 4DV6L 2UXBL 2LXKA 4PG3A 1EUJA 2D62A 4B3MQ 3TREA 3EN2A 3RZOH 4IPCA 1YJWA 3PUVA 4IOCA 5M3FG 4DR1L 1KIXA 1EIFA 2JEAI 1UE5A 3W1BA 2RHQB 2IHFA 4IJHA 4HIOA 1HNXL 5ELOA 4A3LH 4Y52H 3HOWH 2UXDQ 4C3IH 1YIJA 1XMQQ 2YV5A 4A3IG 3A5UA 4A3KG 4GNXC 1IBLQ 4TVAB 3K7UC 3L2PA 4BBRG 2NVYH 3PO3H 3UDIA 1GO3E 1I3QH 1VQAA 3M9BA 4GN4B 2JA9A 1YHQA 3U4ZA 3W5OA 2OTLA 2B63H 1RIPA 2R92G 4BBSH 4GLVB 4OWXB 3K0XA 4JBJA 4KHPQ 4QL5A 3H0GG 2AHOB 4AH6A 4JYAL 1RL2A 4LW1A 4YHHQ 4OX9L 1XJVA 3AFQA 4J15A 3HFZB 4JG2A 3SGIA 3ULPA 2QA4A 1VQGA 4X62Q 4GKKL 2ALYB 2RF4A 4A3EG 2UUAL 2Z0SA 3CCRA 4DR5Q 1AE3A 1EQQA 2EIFA 3H15A 3RLFA 1Y1VH 1YZ6A 4OWWB 1EQRA 2WP8J 4B3RQ 2E2HH 1NY4A 4GLXA 4OONA 2UXCQ 3F1ZA 2A8VA 4B3TL 5C3EG 5C0XG 4P74A 2OQKA 4DUZL 5M3FH 2RCNA 4JI0L 1BVSA 3U4VA 3I4MG 4GLAC 3U50C 1TWCH 1QZGA 1J6QA 3HKSA 2HHHQ 4A3IH 4LFBQ 2I5HA 2OQ0A 4A3KH 4L5TA 2AKWB 2N49A 5JEAG 1FGUA 1IZ6A 1TWFH 3GD7A 4KHZA 1VS0A 2AWNA 3RLNA 2L15A 4BBRH 5LMNL 4DR3Q 4DR2Q 3BU2A 4OO1G 2R92H 1JB7A 1C9OA 1EOVA 1K0RA 1L1OC 1X55A 2DUDA 3GTQH 1PH1A 3M7NA 4X6AH 1E1TA 1VQEA 3H0GH 2F3IA 5H1SE 5AJ3L 1HNWQ 1GKHA 4C3JH 1H95A 4A75A 4DR4Q 4DNIA 1K8AC 1BBWA 2I5MX 1GD7A 3FKIG 3I55A 4HJ7A 4JC0A 1P8LA 3JC66 2JEBI 3TEHB 3HKZE 2N78A 4R4OA 5LMUL 1VQOA 3CCLA 3T1HL 1VQIA 4LF4L 3UDFA 1MJEA 1IL2A 3Q8DA 4IOAA 4A3EH 4A3GG 2YYZA 3OW2A 3AYHB 3D31A 1SN8A 1KAWA 3RN2A 1IBML 2UU9L 4DR6Q 5E7NA 4LF9L 1VQ5A 1X56A 3CMEA 5BR8Q 1HZCA 3K80C 4DUYQ 1GM5A 4LF8L 4NXNQ 2VQFL 3AEVA 1VQLA 1KL9A 1N33Q 5GAHC 2VQEL 1XPUA 5C3EH 1O7IA 2DGYA 3MXNB 1PH9A 4K0KL 4PZ8A 3S1QH 1HNZQ 2Z6KA 1LUZA 2BH8A 2JA8G 3I4MH 3K8AA 1PFSA 3TS0A 3STBD 2JA6G 2CWPA 4BA1I 5HGQA 2VS1A 4DV0L 2IY5B 4JI3Q 1OTCA 2OCEA 3ER0A 2R7FA 3FHWA 3HKZG 3KOJA 4MTNA 4BY1G 3ICEA 3G48A 4YWKA 4JBKA 1IBKQ 1X3GA 4IFDJ 3H3VI 4LFAL 1EWIA 4WJ4A 1V9PA 1E7ZA 4JV5L 3PGZA 1QVFA 4DV6Q 3TQYA 1G51A 2UXBQ 4TQUS 3S14H 1E1OA 2Q2UA 1HR0L 2ASBA 4JI1Q 5IT9c 3FKIH 5M5XH 1VQFA 4DR1Q 3HOZG 3E0EA 3S1RH 1HNXQ 4LF5Q 2NZHA 3I7FA 1EIYB 1IXRA 2KHIA 1CSQA 1YITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZA A;  2NVQ H;  1XNR Q;  4DR7 L;  4A3G H;  3KYH C;  1N36 L;  4HIM A;  4LWC A;  2WAQ G;  3NBH B;  4JYA Q;  2K52 A;  4ALP A;  3W1G A;  2K5H A;  4X64 L;  3ULJ A;  1CSP A;  3LGJ A;  2VY3 A;  4JI8 L;  2MNA A;  3CCE A;  1JJC B;  4POF A;  2GN5 A;  2JA8 H;  4HJ5 A;  3CXC A;  2JA6 H;  1L0W A;  1T9H A;  4R4C A;  4B3S L;  3GDE A;  3L0O A;  2WB1 G;  1Q46 A;  5IWA L;  3HOX G;  4GKK Q;  1XMO Q;  1M1K C;  1P16 A;  3K7A H;  4L5Q A;  4H02 A;  5DLQ E;  2UUA Q;  4BY1 H;  2F4V L;  3GTK H;  2F52 A;  3BZC A;  3B6Y A;  4L5R C;  1Q12 A;  2ZJR A;  2A19 A;  1N8R C;  1PHJ A;  1PH4 A;  1E3P A;  1X3E A;  3UE1 A;  4A3B G;  4B3T Q;  2ZM6 L;  4A4I A;  2VL6 A;  1VQN A;  4QY7 A;  1A8V A;  4DK6 C;  1VCI A;  3PIP A;  3HOZ H;  3UDX A;  4JI6 Q;  1J5E L;  4A76 A;  4JI0 Q;  3CF5 A;  3NEL A;  4DV1 Q;  1XPO A;  1Q86 C;  1L2F A;  2VUM G;  4JOI A;  1PH5 A;  3KJO A;  2UUC L;  4X65 L;  3J80 c;  3MEF A;  3OYY A;  2ZJQ A;  3GTL H;  4O0A A;  4BXX G;  5LMN Q;  4LUO A;  1LM0 A;  1K8G A;  4LF7 Q;  1CKN A;  4DV5 L;  1YBY A;  2EXD A;  1KHI A;  2QEX A;  4AQY L;  5IYC G;  4MZ9 A;  2E5L Q;  3KF6 A;  3HOU G;  4WJ3 M;  5ELN A;  3AFP A;  2HIV A;  4HIK A;  5AJ3 Q;  4DV7 L;  4JBM A;  1PVO A;  2XGT A;  1WYD A;  3RR5 A;  5IE8 A;  1NJI C;  1FL0 A;  4DV3 L;  1Q81 C;  1SLJ A;  4QQB X;  1OXT A;  1QVC A;  1TWH H;  2MO0 A;  5GAE C;  3S2H H;  3PUW A;  4HJ8 A;  3T1H Q;  1PH3 A;  3J7A 5;  4JI2 L;  3HOX H;  1N34 Q;  2CQO A;  4QIW E;  2NZO A;  2KCT A;  4PZ7 A;  1I94 Q;  2N8N A;  3PSI A;  1IBM Q;  2UU9 Q;  4LUZ A;  1K3R A;  4LF9 Q;  3RNU A;  4LF8 Q;  1YHA A;  3ULL A;  1W3S A;  3A74 A;  2Q2T A;  2VQF Q;  2OWO A;  4BY7 G;  4FDB A;  3S17 H;  1JJ2 A;  2UXD L;  3BZK A;  4X66 Q;  1XMQ L;  2VQE Q;  4A3B H;  4DK3 C;  4QGU A;  1WFQ A;  1XNQ L;  1GVP A;  4GNX A;  1X9N A;  2PI2 E;  4C3H H;  4A3J G;  1CKN B;  1A63 A;  1VQJ A;  2R6G A;  5JJL A;  1ASZ A;  2BA0 A;  2JK8 A;  5IY0 A;  2VUM H;  3KF6 B;  3JAM c;  4DV0 Q;  4KHP L;  3NEN A;  2E8G A;  2NN6 G;  5IP9 G;  4BXX H;  5C0X I;  4POG A;  1TXY A;  1WOC A;  2ID0 A;  3HOY G;  2R93 G;  1KQS A;  1U0L A;  1Q1B A;  5M5W H;  3AQQ A;  5IYC H;  3CC7 A;  4YY3 L;  4A3M G;  3HOU H;  1C0A A;  2B29 A;  4EQ5 A;  4DV2 L;  1MJC A;  5LMN W;  4IFD G;  4JI7 Q;  1UE1 A;  4JV5 Q;  1SRO A;  3M4P A;  4L5S A;  1KC8 C;  1TWA H;  1PYS B;  5J3B A;  3G71 A;  1HR0 Q;  1FJG L;  1OXV A;  2YTV A;  3E9H A;  4IJL A;  3KF8 B;  2UUB L;  1S40 A;  2UXC L;  4YWL A;  2AMC B;  2CKZ B;  2H5X A;  2GVA A;  4YCU A;  3EBE A;  4JBW A;  3CCS A;  4LFC L;  4R1J A;  2YTY A;  5GAD C;  4GNX B;  4NXM L;  2WAQ E;  4DV4 L;  3D0F A;  3KDF A;  1PH8 A;  1M90 C;  4BY7 H;  1I50 H;  3T1Y L;  1FVI A;  4DAY B;  1VQM A;  3KLW A;  4X64 Q;  3GTO H;  3CD6 A;  4DR3 L;  4OXP A;  1OXX K;  1UE7 A;  1V43 A;  1Z9F A;  3CW2 C;  3F2B A;  4A3J H;  2VNU D;  1JT8 A;  2PI2 A;  2K75 A;  4A93 G;  4B3S Q;  1KRS A;  4JI5 L;  2E2J H;  1L1O A;  5IP9 H;  5IWA Q;  4GN3 B;  2PQA B;  2KCM A;  1LYL A;  2WB1 E;  2FXQ A;  2F4V Q;  3HOY H;  2R93 H;  3K81 C;  1VQ4 A;  1HH2 P;  4A3M H;  1SRU A;  3CPW A;  2HQL A;  3TS2 A;  2JJQ A;  1NMG A;  4Y7N H;  2I0Q A;  2I5L X;  1X65 A;  4DR6 L;  4APV A;  3J81 c;  4AIM A;  1KD1 C;  1VQH A;  1J5E Q;  3BJU A;  1A62 A;  2CCZ A;  4IFD I;  4HJ9 A;  5BR8 L;  1VQK A;  3NEM A;  4OX9 Q;  2BA1 A;  2MO1 A;  2ZTE A;  3KDF B;  1N33 L;  2UUC Q;  1HR0 W;  2GVB A;  4MNO A;  2Y0S E;  4X65 Q;  2KBN A;  4JI4 L;  4PZ6 A;  1VQ9 A;  1B70 B;  3CQZ H;  4DV5 Q;  3PF5 A;  2N3S A;  3RLO A;  2NVX H;  3S1N H;  3M4O H;  1X3F A;  2ATW A;  4UPA A;  4DV7 Q;  1CKM A;  2R7D A;  2E2I H;  3OTO L;  1N32 L;  4LF6 L;  1L1O B;  3KFU A;  4A3D G;  3I2Z A;  1XTD A;  5GQO A;  4DV3 Q;  4R4T A;  4KLK A;  4OWT B;  3I56 A;  4A93 H;  2Q2H A;  4C2M H;  1JMC A;  3CCQ A;  4DUZ Q;  1EYG A;  4IO9 A;  3I4N G;  1AH9 A;  1S72 A;  1EFW A;  1WI5 A;  4A3C G;  4IPG A;  2R7Z G;  3PUZ A;  1D7Q A;  4NPS A;  1YVC A;  1YHB A;  2Y0S G;  1CUK A;  1VQD A;  4JI1 L;  5C44 G;  2HT1 A;  1N9W A;  1SR3 A;  2D0P A;  1K73 C;  3F2D A;  1PH6 A;  1NBW A;  4GOP C;  3HOV G;  4LF5 L;  1CKO A;  5FLM G;  3S16 H;  4XTC S;  4UP9 A;  2EQS A;  3S24 A;  4DPG A;  1W2B A;  1XNR L;  3UDG A;  1D8L A;  2IT1 A;  4GN5 A;  1B8A A;  1VQB A;  1XNQ Q;  5C4X G;  4GKJ L;  1G29 1;  2RHS B;  4UP8 A;  1Y1W G;  3GTP H;  5C4J H;  3PIO A;  3CCM A;  1QUQ B;  1Q82 C;  4P73 A;  4RG1 A;  1NMF A;  4YWM A;  3PO2 G;  1PH2 A;  1A0I A;  3J80 i;  5LMU Q;  5IYB G;  1G6P A;  4LF4 Q;  1VQ7 A;  1PYB A;  2XTI A;  1X54 A;  4YY3 Q;  1YI2 A;  4DV2 Q;  1JE5 A;  4O2D A;  4B3M L;  4DKA C;  3GTJ H;  2LXJ A;  4P72 A;  3UE0 A;  3S15 H;  2K5V A;  4UP7 A;  3ZJY C;  1UE6 A;  2MQH A;  2IHE A;  3FP9 A;  1XMO L;  2JQO A;  1VQ6 A;  4A3D H;  3PV0 A;  2K14 A;  1FJG Q;  1Y14 B;  4DAM A;  1IBL L;  2Z6K C;  1QVG A;  1LTL A;  1UEB A;  4K0K Q;  1MKH A;  2V1C C;  4XIG S;  2UUB Q;  1HJP A;  3I4N H;  4A3C H;  1I6H H;  3L7Z C;  3DM3 A;  2R7Z H;  4RMF A;  1S3O A;  5IYD G;  1VQ8 A;  3GTM H;  5C44 H;  4LFC Q;  4LNQ A;  4UY8 C;  2JE6 I;  4JI6 L;  3HOV H;  1AE2 A;  4NXM Q;  4DV4 Q;  4YHH L;  5M3M G;  5FLM H;  3PF4 A;  2LSS A;  5GRO A;  3T1Y Q;  4DV1 L;  3GTG H;  4EX5 A;  1Q7Y C;  3ERS X;  3U58 A;  1R9T H;  4LFA Q;  1KRT A;  4BA2 I;  2AWO A;  5C4X H;  1YNX A;  4LF7 L;  2PQA A;  1X6O A;  4X62 L;  3CMA A;  5IP7 G;  1WJJ A;  4GOP A;  1Y1W H;  3E9I A;  3A5Z B;  3PUX A;  2D0O A;  5HY6 A;  4A3F G;  1B7Y B;  1TWG H;  2E5L L;  4OO1 I;  1JJG A;  4DR5 L;  2PMZ E;  2JA5 G;  2ES2 A;  4JI5 Q;  3CPF A;  3PO2 H;  3JAM i;  1IYJ B;  4P71 A;  1PA6 A;  4B3R L;  1HZB A;  3DLL A;  5IYB H;  1HZ9 A;  2K5N A;  5C0X J;  2JA7 G;  1SE8 A;  1NTG A;  1C7Y A;  4DR7 Q;  3IRB A;  3VDY A;  1N36 Q;  5GAG C;  1K83 H;  2NN6 I;  3S2D H;  1Z47 A;  1VQP A;  5JJI A;  1PH7 A;  1N34 L;  2CWA A;  5JEA J;  5FJ8 G;  4JCV E;  2KHJ A;  4HID A;  1I94 L;  2HHH L;  4LFB L;  4YCW A;  3PCO B;  4IPH A;  1QZH A;  3GO5 A;  2KEN A;  1Q8K A;  1WCM G;  4JI8 Q;  4DR2 L;  2YU9 H;  2IX1 A;  5M5Y H;  1DGS A;  2ZTC A;  4X66 L;  4AYB E;  1SMX A;  4JI4 Q;  3S1M H;  5IYD H;  2B3G A;  1YJN A;  4IPD A;  2Q2I A;  1OXS C;  1E24 A;  2A1A A;  1HNW L;  3PUY A;  4R4I A;  4HJA A;  5EAY A;  1K9M C;  5M3M H;  4KI0 A;  3F2C A;  4GOP B;  4DR4 L;  1U5K A;  2CFM A;  1PV4 A;  3OTO Q;  2WFW A;  3RZD H;  1N32 Q;  4LF6 Q;  1ASY A;  4A3L G;  4GS3 A;  3J81 j;  2HIX A;  3CC4 A;  3HOW G;  3J7Z C;  1SFO H;  5IP7 H;  3CAM A;  2ZM6 Q;  4NB3 A;  1YEZ A;  4QJF A;  2PNH A;  4LUV A;  4A3F H;  2IX0 A;  3G4S A;  3PO3 G;  4ME3 A;  2YTX A;  2JA5 H;  3EIV A;  1V1Q A;  4JOI C;  4JI7 L;  4BBS G;  5JJK A;  3STB C;  2B63 G;  4DUY L;  1MIU A;  2K50 A;  4YCV A;  4NXN L;  4AYB G;  3WWV A;  1E22 A;  2JA7 H;  2NVT H;  3TRZ A;  1HZA A;  3F8T A;  1KXL A;  3A0J A;  1HNZ L;  4AQY Q;  3M3Y H;  1UWV A;  3CCU A;  1Q1E A;  2OTJ A;  1QUQ A;  5FJ8 H;  3H3V H;  2BH2 A;  3RN5 A;  4JI3 L;  1VQC A;  1BBU A;  2MFI A;  4GKJ Q;  3CC2 A;  1BKB A;  3J81 i;  3CCJ A;  1WCM H;  4P75 A;  3M85 A;  3CP0 A;  1I5F A;  3M4Q A;  3CCV A;  2VW9 A;  5K36 G;  3KJP A;  1IBK L;  2C35 B;  1XPR A;  1Y1V G;  5FLX c;  1YJ9 A;  4R4Q A;  4PMW A;  3G6E A;  3I4O A;  2QGQ A;  2ZTD A;  1NE3 A;  1OXU A;  4JI2 Q;  2K4K A;  2ZJP A;  4DV6 L;  2UXB L;  2LXK A;  4PG3 A;  1EUJ A;  2D62 A;  4B3M Q;  3TRE A;  3EN2 A;  3RZO H;  4IPC A;  1YJW A;  3PUV A;  4IOC A;  5M3F G;  4DR1 L;  1KIX A;  1EIF A;  2JEA I;  1UE5 A;  3W1B A;  2RHQ B;  2IHF A;  4IJH A;  4HIO A;  1HNX L;  5ELO A;  4A3L H;  4Y52 H;  3HOW H;  2UXD Q;  4C3I H;  1YIJ A;  1XMQ Q;  2YV5 A;  4A3I G;  3A5U A;  4A3K G;  4GNX C;  1IBL Q;  4TVA B;  3K7U C;  3L2P A;  4BBR G;  2NVY H;  3PO3 H;  3UDI A;  1GO3 E;  1I3Q H;  1VQA A;  3M9B A;  4GN4 B;  2JA9 A;  1YHQ A;  3U4Z A;  3W5O A;  2OTL A;  2B63 H;  1RIP A;  2R92 G;  4BBS H;  4GLV B;  4OWX B;  3K0X A;  4JBJ A;  4KHP Q;  4QL5 A;  3H0G G;  2AHO B;  4AH6 A;  4JYA L;  1RL2 A;  4LW1 A;  4YHH Q;  4OX9 L;  1XJV A;  3AFQ A;  4J15 A;  3HFZ B;  4JG2 A;  3SGI A;  3ULP A;  2QA4 A;  1VQG A;  4X62 Q;  4GKK L;  2ALY B;  2RF4 A;  4A3E G;  2UUA L;  2Z0S A;  3CCR A;  4DR5 Q;  1AE3 A;  1EQQ A;  2EIF A;  3H15 A;  3RLF A;  1Y1V H;  1YZ6 A;  4OWW B;  1EQR A;  2WP8 J;  4B3R Q;  2E2H H;  1NY4 A;  4GLX A;  4OON A;  2UXC Q;  3F1Z A;  2A8V A;  4B3T L;  5C3E G;  5C0X G;  4P74 A;  2OQK A;  4DUZ L;  5M3F H;  2RCN A;  4JI0 L;  1BVS A;  3U4V A;  3I4M G;  4GLA C;  3U50 C;  1TWC H;  1QZG A;  1J6Q A;  3HKS A;  2HHH Q;  4A3I H;  4LFB Q;  2I5H A;  2OQ0 A;  4A3K H;  4L5T A;  2AKW B;  2N49 A;  5JEA G;  1FGU A;  1IZ6 A;  1TWF H;  3GD7 A;  4KHZ A;  1VS0 A;  2AWN A;  3RLN A;  2L15 A;  4BBR H;  5LMN L;  4DR3 Q;  4DR2 Q;  3BU2 A;  4OO1 G;  2R92 H;  1JB7 A;  1C9O A;  1EOV A;  1K0R A;  1L1O C;  1X55 A;  2DUD A;  3GTQ H;  1PH1 A;  3M7N A;  4X6A H;  1E1T A;  1VQE A;  3H0G H;  2F3I A;  5H1S E;  5AJ3 L;  1HNW Q;  1GKH A;  4C3J H;  1H95 A;  4A75 A;  4DR4 Q;  4DNI A;  1K8A C;  1BBW A;  2I5M X;  1GD7 A;  3FKI G;  3I55 A;  4HJ7 A;  4JC0 A;  1P8L A;  3JC6 6;  2JEB I;  3TEH B;  3HKZ E;  2N78 A;  4R4O A;  5LMU L;  1VQO A;  3CCL A;  3T1H L;  1VQI A;  4LF4 L;  3UDF A;  1MJE A;  1IL2 A;  3Q8D A;  4IOA A;  4A3E H;  4A3G G;  2YYZ A;  3OW2 A;  3AYH B;  3D31 A;  1SN8 A;  1KAW A;  3RN2 A;  1IBM L;  2UU9 L;  4DR6 Q;  5E7N A;  4LF9 L;  1VQ5 A;  1X56 A;  3CME A;  5BR8 Q;  1HZC A;  3K80 C;  4DUY Q;  1GM5 A;  4LF8 L;  4NXN Q;  2VQF L;  3AEV A;  1VQL A;  1KL9 A;  1N33 Q;  5GAH C;  2VQE L;  1XPU A;  5C3E H;  1O7I A;  2DGY A;  3MXN B;  1PH9 A;  4K0K L;  4PZ8 A;  3S1Q H;  1HNZ Q;  2Z6K A;  1LUZ A;  2BH8 A;  2JA8 G;  3I4M H;  3K8A A;  1PFS A;  3TS0 A;  3STB D;  2JA6 G;  2CWP A;  4BA1 I;  5HGQ A;  2VS1 A;  4DV0 L;  2IY5 B;  4JI3 Q;  1OTC A;  2OCE A;  3ER0 A;  2R7F A;  3FHW A;  3HKZ G;  3KOJ A;  4MTN A;  4BY1 G;  3ICE A;  3G48 A;  4YWK A;  4JBK A;  1IBK Q;  1X3G A;  4IFD J;  3H3V I;  4LFA L;  1EWI A;  4WJ4 A;  1V9P A;  1E7Z A;  4JV5 L;  3PGZ A;  1QVF A;  4DV6 Q;  3TQY A;  1G51 A;  2UXB Q;  4TQU S;  3S14 H;  1E1O A;  2Q2U A;  1HR0 L;  2ASB A;  4JI1 Q;  5IT9 c;  3FKI H;  5M5X H;  1VQF A;  4DR1 Q;  3HOZ G;  3E0E A;  3S1R H;  1HNX Q;  4LF5 Q;  2NZH A;  3I7F A;  1EIY B;  1IXR A;  2KHI A;  1CSQ A;  1YIT A; 
#chains in the Genus database with same CATH topology
 3BDC A;  1JOQ A;  1XNR Q;  4A3G H;  2B2Y C;  5EKL A;  2M2L A;  4QCL A;  2WAQ G;  4EQP A;  4CDD C;  4FXD A;  1JWU D;  1RHP A;  1M4V A;  3NBH B;  4ALP A;  4X64 L;  2NVQ B;  1CSP A;  2VY3 A;  3QOL A;  2MNA A;  1JCK B;  2XRS D;  2E74 C;  4HJ5 A;  1HUM A;  2FMC A;  4B3S L;  3GDE A;  3SK5 A;  4HED A;  3HOX G;  1XMO Q;  4L5Q A;  2UUA Q;  1JWS D;  2F52 A;  4FP5 D;  3B6Y A;  2BDN A;  5C4H A;  4L5R C;  1Q12 A;  3EJI A;  1UAP A;  4I7A A;  2Z4H A;  1X3E A;  2H1E A;  4K14 A;  1C48 A;  3EA6 A;  4KK7 A;  4WOR A;  3K7A B;  4DK6 C;  4BY1 B;  4JI6 Q;  3CF5 A;  1AEX A;  1H9K A;  4DV1 Q;  3KJO A;  3OYY A;  1O78 A;  2HDM A;  1K8G A;  2XVS A;  1YBY A;  5I2Y A;  1KHI A;  4RFB A;  4AQY L;  4MZ9 A;  3HOU G;  3C1E A;  5ELN A;  3G6J B;  5DAU A;  3T13 A;  4HIK A;  2A6E D;  1Y8N B;  2XGT A;  5IE8 A;  1WTV A;  2EDG A;  4WJW A;  5HUR A;  2WAQ B;  3PMF A;  2AQ2 B;  2Q8T A;  3PUW A;  4HJ8 A;  2IW3 A;  1I4G A;  3T1H Q;  3J7A 5;  1PXU A;  3NWT A;  2CQO A;  1CQV A;  4ME5 A;  2NZO A;  2KCT A;  2L9H A;  2CQA A;  3FVQ A;  3A55 A;  5KNC A;  3Q24 A;  3KF8 A;  2UU9 Q;  4LF8 Q;  1CI3 M;  4N9P A;  3A74 A;  1I4X A;  2OWO A;  1JOO A;  2UXD L;  4DFA A;  4CKB A;  2VQE Q;  4V0B A;  3I70 A;  1FYC A;  3EFX D;  3HOX B;  1STY A;  1NR2 A;  1XNQ L;  4JK1 C;  2MPM A;  2PI2 E;  4C3H H;  1GXD C;  1VQJ A;  5JJL A;  2D2C C;  1ASZ A;  2HDL A;  2JK8 A;  3KF6 B;  1PFM A;  4RA8 A;  1JR0 D;  3R2I A;  2B2U C;  5IP9 G;  4KKS A;  2ID0 A;  2R93 G;  1C0A A;  3MVV A;  4DV2 L;  4EQ5 A;  3FPP A;  5LMN W;  2DJG C;  3M4P A;  4L5S A;  2O4X A;  1PYS B;  1FJG L;  2YTV A;  5I4D A;  3FPU B;  3PIP 3;  5M5W B;  3HOU B;  2UUB L;  1S40 A;  5CBE E;  4YWL A;  2AMC B;  3DM1 A;  4KD3 A;  4YCU A;  1B2T A;  4DF7 A;  1EIG A;  3IFT A;  1MSG A;  5GAD C;  1NNX A;  4NXM L;  2WAQ E;  3KDF A;  1PH8 A;  4DK1 A;  1PRT D;  1XX8 A;  1SXT A;  2CW0 D;  4BS9 A;  3CD6 A;  2IJ0 A;  4OXP A;  1UE7 A;  1V43 A;  5D14 A;  1HTL D;  1KRS A;  2MP1 A;  5FO7 B;  4CBV A;  1I50 B;  2A68 C;  3A8J E;  1L1O A;  3N6R A;  5E4W C;  3GTO B;  3QIA A;  3K81 C;  4XYO A;  2GA4 B;  3ZYY X;  4OGQ C;  2JJQ A;  4IFD H;  1BBX C;  4DR6 L;  4APV A;  2R93 B;  2CCZ A;  1J5E Q;  1ILP A;  4O1N A;  1DCZ A;  5BR8 L;  1TKW B;  4XQJ A;  4OEL B;  2UUC Q;  4Y7N B;  2B2V C;  3E3X A;  3SHL A;  5IIF A;  4DV5 Q;  3CHB D;  2R7D A;  3KBG A;  2E2I H;  1N32 L;  3RD4 A;  5GQO A;  1U4R A;  2Q2H A;  3NQI A;  5I9P A;  4DNR B;  4DUZ Q;  3M4O B;  3I4N G;  4IO9 A;  1QNK A;  1S72 A;  4RGM A;  5CGK A;  5BN4 A;  5C44 G;  3F2D A;  3HOV G;  1PTO C;  3FDT A;  4M8A A;  5FLM G;  2RQX A;  4C2M B;  1CHP D;  2EJM A;  3HP3 A;  4I65 A;  5C4X G;  1ENC A;  1Y1W G;  3CCM A;  3DWA A;  1NMF A;  4PQX A;  2NYZ D;  4DU9 A;  5IYB G;  5JOB A;  3BVZ A;  4YY3 Q;  1YI2 A;  1DD2 A;  2ICI A;  1JE5 A;  2K28 A;  4KJO A;  4N8F A;  3SK8 A;  3GTJ H;  2LXJ A;  3I73 A;  4P72 A;  1S4Z A;  3UE0 A;  1IW7 C;  3ZJY C;  3QO2 A;  2JQO A;  4A3D H;  2XSC A;  1IBL L;  1QVG A;  5ELE A;  1CQF A;  2P5Z X;  3DM3 A;  4RMF A;  1CT1 D;  1DON A;  1PRT B;  1SNM A;  4LNQ A;  2JE6 I;  2EXZ A;  4S3S A;  3NWS A;  3MAQ A;  4K6L A;  3I4N B;  1B50 A;  3ERS X;  1H9M A;  3KLR A;  1K0S A;  2B2W C;  1CK1 A;  4LFA Q;  1X6O A;  4X62 L;  5C44 B;  2F0Q A;  3PUX A;  1LT3 D;  3HOV B;  4H7B A;  1GUS A;  5CR3 A;  4IUR A;  4JI5 Q;  2ES2 A;  3PO2 H;  1IYJ B;  3KBX A;  1PA6 A;  3DLL A;  3LWE A;  2K5N A;  5C4X B;  1FNU A;  1C7Y A;  4HSP A;  1Y1W B;  2PZT A;  4FXG C;  1TWG B;  2NN6 I;  1XTC D;  5JJI A;  1PFB A;  2KOL A;  2B2T A;  3NPP A;  1I94 L;  4LFB L;  3NXW A;  3PCO B;  5CV4 A;  2PQE A;  1QZH A;  1TS3 A;  2KEN A;  1SNO A;  2NTS A;  3PIO 3;  4DAV A;  4H13 C;  4JI4 Q;  3S2D B;  2Q2I A;  2A1A A;  4R4I A;  4KI0 A;  1U5K A;  1JC7 A;  2WIN B;  3DHQ A;  3E0J A;  3S9W A;  1YEZ A;  2EVB A;  1WTO A;  5EBD A;  2JA5 H;  4BBS G;  4DUY L;  1MIU A;  4NXN L;  4AYB G;  3RZD B;  1AFP A;  2CH4 W;  3BS1 A;  2JA7 H;  1YNN C;  4TRD A;  3NUC A;  1L0X B;  1HZA A;  3F8T A;  1KXL A;  1HNZ L;  2WAC A;  3TP6 A;  4AQY Q;  3M3Y H;  4LMQ D;  1Q1E A;  5G3L F;  1VQC A;  2L55 A;  5IGC A;  4HCE A;  3I4O A;  2JP1 A;  5EGT A;  4DV6 L;  2UXB L;  5IGF A;  3EN2 A;  1YJW A;  1LAB A;  1KIX A;  4DR1 L;  4IJH A;  4Y52 H;  5ELO A;  3HOW H;  2UXD Q;  2RDF A;  3Q0A A;  2F0K A;  3A5U A;  4GNX C;  1BCP F;  3CKI B;  1KDC A;  4ZLT F;  1GO3 E;  1I3Q H;  1VQA A;  2F0T A;  4GN4 B;  1YHQ A;  2OTL A;  1WTQ A;  1BOS A;  1RIP A;  2B63 H;  4GLV B;  2F0U A;  4KTA A;  4AH6 A;  4IQZ A;  2OT2 A;  3U9O A;  1XJV A;  1KAB A;  3AFQ A;  4BBS B;  3ULP A;  3SGI A;  4AYB B;  5KND A;  2QA4 A;  4QUC A;  4OHJ A;  5DM6 3;  2UUA L;  4HMI A;  4CJ1 B;  2Z0S A;  5K36 H;  4PV1 C;  1CZG A;  3MHB A;  1EQQ A;  1Y1V H;  4B3R Q;  3OW7 A;  2E2H H;  4GLX A;  4OON A;  3MEH A;  4P74 A;  1TII D;  3MZ5 A;  4NP5 A;  1QZG A;  1DYQ A;  4A3K H;  5KNB A;  4HAE A;  1TWF H;  3GD7 A;  4KHZ A;  1VS0 A;  2AWN A;  4BBR H;  1H9R A;  4KY7 A;  4DR2 Q;  4OO1 G;  1BCP C;  1EOV A;  1K0R A;  1WD1 A;  1HNW Q;  1GKH A;  1IKM A;  4C3J H;  3SEB A;  1H95 A;  2F3W A;  1S5E D;  1D5X C;  3FKI G;  4HJ7 A;  3TEH B;  4CHT B;  1PYW D;  2JEB I;  4R4O A;  1VQO A;  3CCL A;  3GTQ B;  3T1H L;  2F0W A;  1IL2 A;  2IL8 A;  4JVZ A;  4A3E H;  2EYL A;  1VMC A;  2YYZ A;  4DR6 Q;  3D31 A;  2UU9 L;  5ELC A;  3ND9 A;  1F2Y A;  1VQ5 A;  1GM5 A;  3CME A;  5BR8 Q;  4LF8 L;  2VNU D;  1A2T A;  1KL9 A;  1EFI D;  5GAH C;  1FR3 A;  3DWQ A;  3HEJ A;  2VQE L;  5C3E H;  1DZ1 A;  4K0K L;  2Z6K A;  3I4M H;  1D1I A;  1PFS A;  3NBH A;  2JA6 G;  2CWP A;  4BA1 I;  2VS1 A;  2G9D A;  1I4R A;  2IY5 B;  5JEA H;  4TKO B;  4MTN A;  3ICE A;  2B8G A;  3S1Q B;  4IFD J;  1EWI A;  1V9P A;  4LK1 C;  3K5M A;  5IT9 c;  1WTR A;  3KLS X;  2PW5 A;  1EIY B;  3DMU A;  2M00 A;  1CSQ A;  1YIT A;  2NVQ H;  3FKI B;  4OIK A;  3BVM A;  3S1R B;  3L3O C;  1MD2 D;  1SAP A;  4JYA Q;  4ZAI A;  2F0V A;  1B9M A;  3VR6 A;  2K5H A;  1PLF A;  1STB A;  2TSS A;  4C56 C;  4POF A;  5C5L A;  1A6X A;  2Z9H A;  3CXC A;  1L0W A;  4Q0F A;  1T9H A;  5D65 A;  5T1G A;  4RHS A;  1D5M C;  1Q46 A;  2NB0 A;  4NW2 A;  4GKK Q;  3K7A H;  5DLQ E;  4H02 A;  4BY1 H;  3QG1 A;  1F2M A;  3RUZ A;  1BCP B;  5D3I B;  1EY6 A;  4Q5V A;  3I8Z A;  4RKB A;  2JA6 B;  3IL8 A;  3K5O A;  2Z8L A;  2FJ2 A;  4WRD A;  4A3B G;  1KDB A;  2ZM6 L;  2VL6 A;  2ICE C;  2KQ3 A;  3GTK B;  4NDX A;  2A69 D;  1MI2 A;  1J5E L;  3D4R A;  2K5D A;  3NEL A;  4DGZ A;  2UUC L;  1PH5 A;  3J80 c;  3MEF A;  4XXE A;  1KTK A;  1B4O A;  3ND8 A;  4DV5 L;  2F0N A;  3MFG A;  5J22 A;  5IYC G;  1SYG A;  3KF6 A;  2RBM A;  2DNE A;  5KRU A;  1WYD A;  1GUW A;  4FNF A;  3GTL B;  2I07 B;  4KMU C;  2LKV A;  5GAE C;  3HOX H;  4K8J A;  2H4O A;  1I94 Q;  1IBM Q;  4LUZ A;  3HZX A;  4N9T A;  4LF9 Q;  1YHA A;  1W3S A;  3TP7 A;  2Q2T A;  4BY7 G;  4FDB A;  3NHH A;  3BZK A;  1TWH B;  3R3O A;  4LJZ C;  1XMQ L;  3S2H B;  3SVM A;  1WTW A;  1YNJ D;  4QGU A;  1H9S B;  4FF2 A;  4RH6 A;  4A3J G;  1A63 A;  5IY0 A;  3H3V C;  3JAM c;  2V4D A;  3NEN A;  3S17 B;  2NN6 G;  3OMG A;  4KJN A;  4A3B B;  5C0X I;  1TXY A;  3D4D A;  1U0L A;  5M5W H;  3AQQ A;  3HOU H;  3CC7 A;  4YY3 L;  2F0P A;  1MJC A;  4XDX A;  2L5T A;  1UE1 A;  1J9O A;  3UI2 A;  1KC8 C;  5J3B A;  3G71 A;  1HR0 Q;  3QOJ A;  2EYJ A;  3X3N A;  1F9R A;  5COR A;  1KNA A;  2UXC L;  1A3U A;  3M7G A;  2H5X A;  2CKZ B;  3NP8 A;  1TWA B;  1UEA B;  4IUV A;  1M90 C;  4G4K A;  1I50 H;  4IN3 A;  3KLW A;  3GTO H;  2KEE A;  3VR3 A;  5E1F A;  4MIU A;  2FHT A;  2K75 A;  4BY7 B;  4JI5 L;  1HFN A;  5IP9 H;  4GN3 B;  5LL6 X;  2PQA B;  2FXQ A;  2R93 H;  1D1K A;  1VQ4 A;  1R4P B;  4A3J B;  2HQL A;  4Y7N H;  2E2J B;  3P1H A;  2I0Q A;  4IUT A;  4IUQ A;  3J81 c;  1KD1 C;  1VQH A;  3MXG A;  4HJ9 A;  2BA1 A;  2MO1 A;  1WTX A;  1N33 L;  2Y0S E;  4JI4 L;  1PZI D;  5C3W A;  1IL8 A;  2N3S A;  5IOD A;  2BCO A;  3RLO A;  3Q23 A;  3M4O H;  2PO4 A;  1CKM A;  2F4I A;  4PMB A;  4YIJ A;  5DNF A;  4DV3 Q;  3CQZ B;  1QG7 A;  4KLK A;  4R4T A;  3I56 A;  4LAA A;  4C2M H;  2NVX B;  1SE2 A;  3A8K E;  3CCQ A;  2BE5 C;  4FF1 A;  1EYG A;  4A3C G;  2MUY A;  2KHS A;  1YHB A;  2MHV A;  3VA5 A;  1N9W A;  4ZKC B;  5IGE A;  4KV6 A;  1K73 C;  5A35 A;  3SDZ A;  4LF5 L;  1CKO A;  5IOC A;  3O13 A;  3V05 A;  4DPG A;  1W2B A;  3FRP B;  3UDG A;  1GUN A;  2F0J A;  1QUQ B;  5IGD A;  1Q82 C;  1G2S A;  3J80 i;  1ICF B;  1ZYR C;  4PNY A;  3Q22 A;  3MXU A;  1X54 A;  4Z9C B;  4O2D A;  3GTP B;  5C4J B;  1STA A;  3OMC A;  3PV0 A;  1Y14 B;  1UEB A;  4K0K Q;  1MKH A;  2V1C C;  4XIG S;  5EKK A;  3TDQ A;  3I4N H;  2F0H A;  2SDF A;  3S15 B;  3R93 A;  5IYD G;  5C44 H;  4LFC Q;  3HOV H;  1KNE A;  1ET6 A;  5M3M G;  5FLM H;  3T1Y Q;  5GRO A;  3DEO A;  2QKI C;  4EX5 A;  4IUU A;  1KRT A;  5C4X H;  5DEH A;  4LF7 L;  3GTM B;  1Y69 U;  5IP7 G;  1Y1W H;  3D4W A;  3E9I A;  2D0O A;  4OO1 I;  2RCF A;  1TWG H;  1JJG A;  4XYQ A;  5IGG A;  3CPF A;  3GTG B;  3JAM i;  5IT9 L;  4B3R L;  2B8F A;  5IYB H;  1HZ9 A;  2XRQ D;  3KUP A;  3WOE A;  2K04 A;  1NTG A;  3IRB A;  3VDY A;  5GAG C;  4CGY B;  3S2D H;  2A68 D;  1PH7 A;  1N34 L;  5JEA J;  4JCV E;  4IPH A;  1Q8K A;  1CTM A;  1WCM G;  4DR2 L;  4X66 L;  1YJN A;  2BOS A;  1E24 A;  2J4X A;  1HNW L;  2K03 A;  3H6M A;  4K6D A;  2DN8 A;  3TME A;  4HTH A;  3F2C A;  1PTO F;  5F2D A;  2CFM A;  2EOT A;  1PV4 A;  3RZD H;  4LF6 Q;  4A3L G;  3J81 j;  3CC4 A;  5ISR A;  3J7Z C;  1JE4 A;  1SND A;  2ZM6 Q;  4NB3 A;  4QJF A;  2LS0 1;  4LUV A;  4HMJ A;  3G4S A;  5M3M B;  3PO3 G;  4ME3 A;  1V1Q A;  1TU2 B;  2K50 A;  2L11 A;  3WWV A;  1E22 A;  1DM0 B;  1E2Z A;  4FXK C;  3SR1 A;  3J80 L;  2EZV A;  4M1U B;  1A2U A;  2A6H C;  2OTJ A;  1EL0 A;  3GQB A;  3RN5 A;  1BBU A;  2MFI A;  1BKB A;  3J81 i;  1PTO D;  2NVT B;  2SEB D;  4L63 B;  1NAP A;  2VW9 A;  2C35 B;  2R61 A;  4KY6 A;  5FLX c;  1YJ9 A;  2QGQ A;  1NE3 A;  1II3 A;  5D3D A;  4DXF A;  2LXK A;  1CA5 A;  1EUJ A;  2CVR A;  2D62 A;  2AUK A;  4IPC A;  1WCM B;  5M3F G;  1EIF A;  2JEA I;  4HIO A;  2IHF A;  2SNM A;  1YIJ A;  1XMQ Q;  3CU7 A;  4TVA B;  3RMH A;  3QWN A;  1EYA A;  1O7L A;  3RZO B;  1AZQ A;  2JA9 A;  4BBS H;  3W5O A;  1PZK D;  1IW7 D;  1TVX A;  1G2T A;  3FMC A;  2AHO B;  4JYA L;  3JAM L;  4YHH Q;  4OX9 L;  2NVY B;  3PO3 B;  4J15 A;  2O5J C;  3HFZ B;  4JPB W;  1VQG A;  4QB4 A;  3V2T A;  2NBF A;  4GKK L;  1HXY D;  4ZYS A;  1I4H A;  4DR5 Q;  1GOZ A;  2EIF A;  1S5D D;  1YZ6 A;  1NY4 A;  2UXC Q;  4KHV A;  1LO5 D;  1Q3L A;  3F1Z A;  3T56 B;  2A8V A;  2N55 A;  5C0X G;  2EYO A;  1RCV D;  1J6Q A;  1U4M A;  3BG3 A;  1LLR D;  2C9O A;  2OQ0 A;  4L5T A;  4X3S A;  2N49 A;  3RLN A;  5IT9 E;  1X55 A;  5M3F B;  1L1O C;  3I72 A;  3GTQ H;  1TWC B;  1VQE A;  2F3I A;  2TMP A;  4DR4 Q;  1K8A C;  1BBW A;  4B9W A;  1GD7 A;  3I55 A;  1WTH A;  1XXG A;  3HKZ E;  2ZT9 C;  1MJE A;  3Q8D A;  1SYE A;  2PZW A;  1TS5 A;  2KED A;  3AYH B;  1RTN A;  5I6Y A;  1IBM L;  1WTP A;  4LF9 L;  1X56 A;  5CMD A;  3J81 L;  1N33 Q;  3AMU A;  3OPO A;  5CC4 A;  4MHE A;  1LT4 D;  3CRK C;  1F9S A;  1O7I A;  3N52 A;  5EQ0 A;  3G7L A;  4PZ8 A;  3S1Q H;  2BH8 A;  2JA8 G;  3K8A A;  1FD7 D;  1PTO B;  5HGQ A;  1H9J A;  2OCE A;  4DK0 A;  1OTC A;  2JSO A;  2F0I A;  1YNN D;  5HGT A;  2AQ3 B;  4OO1 H;  4YWK A;  4JBK A;  1IBK Q;  1A15 A;  1A3T A;  3H3V I;  3SE0 A;  1E7Z A;  4EQO A;  1G51 A;  5EPL A;  4F87 A;  2Q2U A;  1ONL A;  1HR0 L;  2ASB A;  3FKI H;  3HOZ G;  3S1R H;  1HUN A;  1BUV T;  4LF5 Q;  1EU3 A;  1UUP A;  3OOC A;  1IXR A;  4N8X 1;  1TY0 A;  2RA4 A;  3TSS A;  1VDZ A;  3KYH C;  4HIM A;  1ENF A;  3BDL A;  3H09 A;  1I6V C;  3I3C A;  4IZ8 A;  4H0L C;  4G7Z C;  2K52 A;  1DOM A;  3ULJ A;  3LGJ A;  1G91 A;  4JI8 L;  1Q90 A;  5EPK A;  2GN5 A;  1GUG A;  2G5D A;  2JA6 H;  5IGB A;  4R4C A;  3ONA B;  3VYR A;  4DNT B;  3P20 A;  1M1K C;  3GTK H;  3BZC A;  3VR4 A;  4DAP A;  3MWY W;  2ZJR A;  2JA8 B;  1N8R C;  1PHJ A;  1E3P A;  3UE1 A;  4B3T Q;  4A4I A;  3TN2 A;  2QW7 A;  1HHV A;  1UNS A;  5G3L D;  1VQN A;  4QY7 A;  1A8V A;  1VCI A;  2WKC A;  3PIP A;  2NUC A;  1X3P A;  4JI0 Q;  1ESR A;  2SNS A;  3C3L A;  3EQL C;  2VUM G;  4ZRZ A;  2KCC A;  1L2F A;  1XPO A;  4JOI A;  4HR7 B;  2K32 A;  3OWE B;  3GTL H;  4O0A A;  4BXX G;  1KDA A;  1H9S A;  5CYU A;  5LMN Q;  4LF7 Q;  4QUF A;  3MFY A;  3VYS A;  1O80 A;  2QEX A;  3HOZ B;  1J8I A;  5KYI A;  3A7L A;  3A8I E;  2HIV A;  3T51 B;  5CV8 A;  2K05 A;  4F7X A;  1NJI C;  3WDN A;  1CFM A;  2AQ1 B;  1B1Z A;  4DV3 L;  1Z7T A;  5E4X A;  2JXM B;  4DN4 M;  1Q81 C;  1BCP D;  1SLJ A;  4QQB X;  2B2T C;  4UAI A;  1OXT A;  2MO0 A;  1TWH H;  3S2H H;  4JI2 L;  4RKL A;  1N34 Q;  4QIW E;  2M9V A;  2I46 A;  4PZ7 A;  4XQN A;  3M4Y A;  3ULL A;  2XNA C;  4UHV A;  2VQF Q;  1KLG D;  3S17 H;  1JJ2 A;  1EZ6 A;  4X66 Q;  4A3B H;  4DK3 C;  2E2D C;  3OIQ A;  1X9N A;  1CKN B;  2R6G A;  2BA0 A;  4KHP L;  1IKL A;  1GUT A;  1VF5 C;  1ILQ A;  1NUC A;  3HOY G;  2SOB A;  5IYC H;  4A3M G;  1EQV A;  2VUM B;  1MGS A;  5C5M A;  4L8J A;  4JV5 Q;  1TWA H;  3E9H A;  2LMC B;  4J1M A;  5JAV A;  2GVA A;  3EBE A;  4JBW A;  1RKN A;  3CCS A;  1EYD A;  4LFC L;  1SNC A;  4UDU C;  4GNX B;  5COY A;  3D3R A;  4BY7 H;  1JQY D;  4IUP A;  3TBI B;  1CHQ D;  1EEF D;  3T1Y L;  4DAY B;  5KEE A;  2JN4 A;  4RGO S;  1OXX K;  3A56 A;  5FLX L;  1Z9F A;  3CW2 C;  4A3J H;  1JT8 A;  1K8O A;  2IWH A;  2PI2 A;  2L4N A;  4A93 G;  3WOF A;  1GHJ A;  4K2L A;  2K5Q A;  2E2J H;  5IWA Q;  2NN6 H;  1RJT A;  1LYL A;  2F4V Q;  2DY7 A;  2OEO A;  3CPW A;  2F0M A;  1NMG A;  2I5L X;  1SMY C;  3HOY B;  3NTI A;  3QR8 A;  4AIM A;  2KCN A;  3BJU A;  1SSO A;  1VQK A;  4OX9 Q;  4A3M B;  1BNZ A;  4X65 Q;  2KBN A;  2XIW A;  4KKT A;  1VQ9 A;  4C1N I;  2X6G A;  3CQZ H;  1V1P B;  4KN7 C;  3PF5 A;  4DXG A;  2PCF B;  2NVX H;  1X3F A;  2K01 A;  2VB3 X;  2ATW A;  4DV7 Q;  4RHR A;  1C4Q A;  2ZXP A;  4ZKB B;  1LT5 D;  4LF6 L;  3KFU A;  3I2Z A;  5A2Q L;  1DOK A;  4J6H A;  2DY8 A;  3E6Z X;  5I9O A;  1JMC A;  3S1N B;  1NCV A;  1AH9 A;  1D2B A;  4IPG A;  2R7Z G;  3PUZ A;  4NPS A;  2Y0S G;  5CV6 A;  2K6A A;  1SR3 A;  1DJR D;  1NBW A;  4GOP C;  1PH6 A;  4FYD A;  1F77 A;  4A93 B;  1IYU A;  1G6Z A;  2IT1 A;  4GN5 A;  1B8A A;  1G29 1;  2RHS B;  4UP8 A;  2CHB D;  3GTP H;  5C4J H;  3PIO A;  5JJZ A;  2B2Y A;  3S16 B;  2EJG C;  4P73 A;  4RG1 A;  1K3B C;  5M9O A;  1G6P A;  2XTI A;  1BDO A;  4DKA C;  3S15 H;  2K5V A;  2L12 A;  1UE6 A;  2MQH A;  3FP9 A;  5JVG 3;  5J39 A;  1T5E A;  3H94 A;  2K14 A;  1NSN S;  2Z6K C;  5EKI A;  1LTL A;  4R8N A;  4E6I A;  1STH A;  4A3C H;  3NTK A;  3L7Z C;  1FGB D;  1I4P A;  1VQ8 A;  3GTM H;  1PZJ D;  2Q8R E;  4DV4 Q;  1HFG A;  3R2T A;  4YHH L;  1QNU A;  1RDP D;  2HQE A;  3NE5 B;  3GTG H;  1Q7Y C;  1I6H B;  1IYV A;  2R7Z B;  2AWO A;  2Y0S B;  1YNX A;  1E0B A;  1WJJ A;  2E5L L;  4A3F G;  1B7Y B;  4DR5 L;  2PMZ E;  2K5W A;  3ERQ A;  2R3Z A;  2Q8I B;  2OF1 A;  1HZB A;  1QE6 A;  4K5X A;  4CDC C;  1R9T B;  1SE8 A;  1VMP A;  2NTT A;  5CV9 A;  5KYL A;  4HSV A;  2RKS A;  2A73 B;  1Z47 A;  1VQP A;  5FJ8 G;  1TS2 A;  4HID A;  4BWG B;  2HD3 A;  4YCW A;  3GO5 A;  2IX1 A;  4JI8 Q;  2QF7 A;  4IFD I;  1DGS A;  1SMX A;  4CKE A;  1K83 B;  1F9P A;  5IYD H;  1EY7 A;  1OXS C;  3HRZ C;  1OO9 B;  3PUY A;  4TSS A;  5EAY A;  5M3M H;  4GOP B;  3IFD A;  4DR4 L;  4J8Q A;  2YU9 B;  3OTO Q;  2WFW A;  5M5Y B;  1EY4 A;  4V19 0;  3S1M B;  2HIX A;  2IX3 A;  1ESF A;  4C3I G;  2B2U A;  5IP7 H;  1U4P A;  3LX0 A;  2YTX A;  1HRJ A;  4JI7 L;  3STB C;  5E3F A;  2NZ1 D;  5EBC A;  1EEI D;  1SFO B;  1C8C A;  2NVT H;  4A3F B;  3TRZ A;  1FNW A;  3A0J A;  2BE5 D;  1Y8P B;  1UWV A;  4CDE C;  3CCU A;  2BH2 A;  4IAL A;  1HQM C;  1EWH A;  5CBA E;  1XYI A;  4GKJ Q;  3CCJ A;  1WCM H;  4P75 A;  3M85 A;  3CP0 A;  1I5F A;  3M4Q A;  2PW7 A;  2A74 C;  2EYM A;  1IBK L;  4C1N K;  4R4Q A;  4PMW A;  4X3U A;  2ZTD A;  1JIC A;  4JI2 Q;  4PG3 A;  3RZO H;  4B3M Q;  1BXT A;  1RF2 D;  3TRE A;  3PUV A;  4IOC A;  1EY8 A;  3W1B A;  4A3L H;  2DNC A;  4A3I G;  1BQQ T;  1ZYR D;  4JW0 A;  3L2P A;  1MSH A;  2NVY H;  3PO3 H;  2BDO A;  3GV6 A;  1MHW C;  3AU7 A;  2R92 G;  2EYP A;  4MTK A;  2PZU A;  1QOH A;  3K0X A;  4KHP Q;  4QL5 A;  1WVL A;  3H0G G;  4RCN A;  4C3I B;  1RL2 A;  1HQR D;  5FO9 B;  3K5L A;  2F0L A;  4JG2 A;  2ALY B;  4B08 A;  2B2V A;  2RSN A;  3NSW A;  1AE3 A;  3RLF A;  1EQR A;  4G57 A;  2EY6 A;  4G7H C;  1RD9 D;  2DJF C;  4B3T L;  1HCZ A;  1U9R A;  1TR5 A;  3FEW X;  2OQK A;  5M3F H;  2RCN A;  5FO8 B;  1BVS A;  5C6A A;  3U4V A;  1QCB D;  2F0S A;  4GLA C;  3U50 C;  1TWC H;  5BN5 A;  2A6E C;  3C1F A;  2RDH A;  1ENA A;  2O2L D;  2HHH Q;  2AKW B;  2F0G A;  1FGU A;  3DWP A;  2L15 A;  5LMN L;  4G7O C;  3BU2 A;  1C9O A;  3AB9 A;  4X6A H;  1EIH A;  2EYH A;  5H1S E;  5ELF A;  1ROD A;  4A3I B;  2QDB A;  4HCS A;  3K57 A;  1PRT F;  2I5M X;  1SNQ A;  2R92 B;  3JC6 6;  5BN3 A;  2N78 A;  4K5V A;  5LMU L;  2E76 C;  4LF4 L;  3H0G B;  3UDF A;  1E2V A;  2JYO A;  4FF4 A;  1LTR D;  4RWS C;  4A3G G;  3OW2 A;  1X3Q A;  2C5C A;  3RN2 A;  1SN8 A;  1KAW A;  3D6C A;  5E7N A;  1PTO H;  2K33 A;  2X69 A;  3BDO A;  2VQF L;  1WD0 A;  1VQL A;  2DGY A;  3LWU A;  3MXN B;  5C0X H;  1EQT A;  3GV3 A;  1JOR A;  1D6E C;  3TS0 A;  2J7Z A;  4JI3 Q;  3HKZ G;  4R9W A;  1TY2 A;  4K5W A;  1X3G A;  2A6H D;  3DEP A;  1AW7 A;  1F2L A;  2FMM A;  1LTA D;  4JV5 L;  2B2W A;  1M8A A;  1E1O A;  2QEJ C;  3BYY B;  2RDG A;  2RSO A;  3E0E A;  1HNX Q;  1PRT C;  3I7F A;  2NZH A;  2CW0 C;  1DOL A;  2VZA A;  4DR7 L;  1N36 L;  2FIN B;  2CH4 A;  3S14 B;  4LWC A;  4FVM A;  5M5X B;  1F9Q A;  2L1B A;  1B3A A;  5LL6 S;  1ICW A;  4DA2 A;  1R4Q B;  1O7Z A;  3W1G A;  4A3G B;  3CCE A;  1JJC B;  2JA8 H;  1JWM D;  3L0O A;  2WB1 G;  1VF7 A;  5IWA L;  1P16 A;  1CA6 A;  2F4V L;  1Y8O B;  2A19 A;  4OL7 A;  1PH4 A;  2EY5 A;  3HS0 C;  1K8M A;  1BF4 A;  2EY2 A;  4EVO A;  3HKZ B;  2KA7 A;  3HOZ H;  3UDX A;  4OIJ A;  4C3H G;  4A76 A;  2F03 A;  1XWE A;  4ABN A;  2D9U A;  4WFN 3;  1Q86 C;  1CZW A;  3VR2 A;  4X65 L;  2ZJQ A;  2MJ8 A;  4LUO A;  1LM0 A;  3A54 A;  4L6T B;  4IUN A;  1CKN A;  2EXD A;  4XT1 B;  2E5L Q;  4KKU A;  4WJ3 M;  1SE3 A;  3AFP A;  5AJ3 Q;  4DV7 L;  4JBM A;  1PVO A;  3RR5 A;  1FL0 A;  4PMC A;  1BO0 A;  5C3X A;  1EWC A;  1QVC A;  2X6L A;  3MA2 B;  1PH3 A;  1EY9 A;  4H44 C;  1X32 A;  2FFK B;  3PSI A;  2N8N A;  2QIL A;  1K3R A;  3R8B A;  3GP7 A;  3RNU A;  2EY1 A;  4EQN A;  3X3M A;  3ERO A;  3E5S A;  2ENB A;  2WB1 B;  3OSO A;  5EPJ A;  1STN A;  1WFQ A;  3TP5 A;  3C2P A;  3VYT A;  1GVP A;  4P2C B;  4GNX A;  5I6W A;  3OHX C;  4DAY A;  2VUM H;  4DV0 Q;  2E8G A;  4BXX H;  4POG A;  2Z1C A;  1WOC A;  4R8I A;  1LAC A;  1KQS A;  1Q1B A;  5CV5 A;  1A3V A;  4C3H B;  2B29 A;  1HTP A;  5I2X A;  4RCO A;  4IFD G;  3PQI A;  4JI7 Q;  1SRO A;  1PFN A;  4MN3 A;  2XN9 C;  1OXV A;  4F8M A;  4IJL A;  3KF8 B;  4XQQ A;  3VA7 A;  1TS4 A;  2LY7 A;  4K8I A;  2AUJ D;  1ZXT A;  1FNV A;  1EZ8 A;  2EPB A;  1SYF A;  3IKJ A;  3SK6 A;  4R1J A;  1W6J A;  2YTY A;  4DV4 L;  3D0F A;  1STE A;  3ITP A;  1FVI A;  1VQM A;  2HCI A;  2NWG A;  4X64 Q;  1LTS D;  1V1P A;  4DR3 L;  4ZUI A;  3J80 E;  4CJ2 C;  3H91 A;  3F2B A;  1STG A;  2KVM A;  4B3S Q;  3D8G A;  3T4A C;  2KCM A;  2WB1 E;  1V8Q A;  2IPK D;  4B9X A;  4FF3 A;  3HOY H;  3NK9 A;  3J7A V;  2G9H D;  1HH2 P;  3K6O A;  5T1I A;  5JVH 3;  1SRU A;  4A3M H;  3TS2 A;  4CKC A;  5C4Z A;  2WV6 D;  3D6W A;  2F3V A;  1LTB D;  2WKD A;  1X65 A;  3J7Y W;  4FO2 A;  4QIW B;  1A62 A;  4ZK9 B;  3NEM A;  3K0Y A;  2O5I C;  2ZTE A;  3KDF B;  4ID6 A;  2GVB A;  4MNO A;  1HR0 W;  4PZ6 A;  1LT6 D;  1B70 B;  3T16 A;  3S1N H;  2B39 A;  3NTH A;  4UPA A;  1IHZ A;  3IAY A;  1BR9 A;  3OTO L;  3JAM E;  1L1O B;  1B3Q A;  3A7A B;  4A3D G;  5KGU A;  1XTD A;  4ZQ3 A;  1Z6H A;  4OWT B;  4A93 H;  2F0O A;  1EFW A;  1WI5 A;  1LTG D;  1D7Q A;  3BVG A;  2E2I B;  1YVC A;  1CUK A;  1VQD A;  4JI1 L;  2HT1 A;  2D0P A;  3NBI A;  5L37 A;  3S16 H;  4XTC S;  4UP9 A;  4OEM B;  2EQS A;  2A5H A;  3S24 A;  1K28 A;  3T53 B;  3VYU A;  1V1O A;  1I4Q A;  1XNR L;  1D8L A;  3Q6S A;  3TP8 A;  1VQB A;  1XNQ Q;  4NKL A;  2WII B;  4GKJ L;  1RTO A;  2Z4I A;  4YWM A;  3PO2 G;  1PH2 A;  1A0I A;  1U4L A;  5FK9 C;  5LMU Q;  1T5X D;  4LF4 Q;  5FKA C;  1VQ7 A;  1PYB A;  3P7J A;  4DV2 Q;  4B3M L;  4UP7 A;  3I91 A;  1XMO L;  1QB5 D;  2IHE A;  1VQ6 A;  1FJG Q;  4I7Z C;  5FOB B;  4DAM A;  2UUB Q;  1ZKO A;  1S5F D;  2EE1 A;  1HJP A;  4K2K A;  3GTJ B;  4ULL A;  5EJW A;  1I6H H;  2R7Z H;  2ZXR A;  1S3O A;  4QF4 A;  2ZXO A;  2K7V A;  1QWY A;  4A3D B;  4UY8 C;  4JI6 L;  1B53 A;  1QJO A;  4JI0 L;  1AE2 A;  4NXM Q;  3U9S A;  3J81 E;  3PF4 A;  2LSS A;  4DV1 L;  1SEB D;  3U58 A;  2E75 C;  1R9T H;  4BA2 I;  2VXW A;  1D5Z C;  4ZCK A;  2PQA A;  3CMA A;  2QCP X;  4GOP A;  3A5Z B;  5HY6 A;  3V96 A;  1G8Z D;  2JA5 G;  4P71 A;  2XWJ B;  1JB3 A;  1ML0 D;  4KY5 A;  5C0X J;  4X3K A;  2JA7 G;  3CRL C;  2J0T D;  1PMR A;  4DR7 Q;  3BYT B;  1N36 Q;  3I90 A;  1K83 H;  2EJF C;  2CWA A;  3K59 A;  3PO2 B;  4ZUJ A;  2KHJ A;  2HHH L;  1GUO A;  4CJ0 B;  4F88 A;  2YU9 H;  1JOK A;  5M5Y H;  2ZTC A;  4AYB E;  3SK4 A;  3S1M H;  2B3G A;  4IPD A;  2HCC A;  1SMY D;  4KN4 C;  4HJA A;  1K9M C;  1AN8 A;  5ELD A;  2L0C A;  4O42 A;  2VB2 X;  1N32 Q;  3W3A A;  2EYF A;  1ASY A;  1TQO A;  4GS3 A;  3C46 A;  3HOW G;  2PYK A;  4RAU C;  1SFO H;  1SJE D;  3CAM A;  5DM7 3;  2PNH A;  4A3F H;  2IX0 A;  1O7Y A;  1EU4 A;  1EY0 A;  3EIV A;  3DXJ C;  4JOI C;  5JJK A;  2B63 G;  4YCV A;  3QJY A;  2HUG A;  3P75 A;  1CM9 A;  3L9A X;  1DXM A;  3K5N A;  3KK7 A;  2Z6B A;  2JA5 B;  2F0F A;  1QUQ A;  1NR4 A;  5FJ8 H;  3H3V H;  3QB3 A;  2XWB B;  3HG9 A;  4JI3 L;  3F2U A;  3CC2 A;  1EY5 A;  5AFW A;  2JA7 B;  3CCV A;  1KAA A;  5K36 G;  3KJP A;  2QDL A;  1XPR A;  1Y1V G;  2RVL A;  3G6E A;  3HGB A;  3M3Y B;  1SYD A;  1OXU A;  1B9N A;  2K4K A;  4X3T A;  3VR5 A;  2ZJP A;  2PNR C;  1SBB B;  1UE5 A;  2RHQ B;  1HNX L;  2PMZ B;  1PDQ A;  4XT3 B;  4C3I H;  1HPC A;  1W6K A;  2YV5 A;  4U68 A;  4A3K G;  1IBL Q;  3K7U C;  1MBY A;  4BBR G;  3UDI A;  3M9B A;  1SYC A;  3U4Z A;  4OWX B;  2F0D A;  4JBJ A;  3HOW B;  3URY A;  1E2W A;  5KIX A;  4LW1 A;  1TT2 A;  4C3J G;  3DUZ A;  2N88 A;  1I3Q B;  4QMG A;  5K5P A;  2B63 B;  3TZU A;  3OIP A;  3SXH A;  2KJX A;  3BZD B;  2D5D A;  2F0E A;  4ILW A;  4X62 Q;  1F2Z A;  1AP0 A;  1LV9 A;  2RF4 A;  5CV7 A;  4A3E G;  2A69 C;  3MTS A;  3CCR A;  3H15 A;  1L0Y B;  1SNP A;  1AZP A;  4OWW B;  2WP8 J;  1GJX A;  1S5C D;  3MC0 B;  2K1B A;  5C3E G;  5TSS A;  5JPN C;  4DUZ L;  3MXP A;  3I4M G;  1Y1V B;  4RGN A;  3HKS A;  1Q8I A;  2E2H B;  3NQT A;  4A3I H;  2I5H A;  4LFB Q;  4NMZ A;  5JEA G;  3MXN A;  1IZ6 A;  4DR3 Q;  2LFN A;  5ELB A;  3TZD A;  1JB7 A;  4U67 3;  2R92 H;  2DUD A;  1PH1 A;  3M7N A;  1E1T A;  3H0G H;  5AJ3 L;  1SDF A;  1GHK A;  4A3K B;  1S5B D;  4CDF C;  4A75 A;  1TWF B;  4DNI A;  1ZEQ X;  4RGT A;  1SE4 A;  4BBR B;  1KLU D;  3KLS A;  4EGV A;  1HA6 A;  4JC0 A;  4ODG A;  1P8L A;  3I4L A;  1VQI A;  5FLX E;  1SJH D;  1YNJ C;  4IOA A;  3EVQ A;  4C3J B;  1LTI D;  2PPB C;  3LNN A;  4DUY Q;  1HZC A;  3K80 C;  4NXN Q;  3AEV A;  4HN7 A;  5J1Z A;  1XPU A;  1PH9 A;  4A3E B;  1HNZ Q;  5JPM C;  5LHY 1;  1LUZ A;  3STB D;  1ET9 A;  4DV0 L;  3W2D A;  1EYC A;  3ER0 A;  2OXP A;  2R7F A;  3FHW A;  3KOJ A;  5NUC A;  2KUM A;  1B44 D;  4BY1 G;  5C3E B;  3G48 A;  3J7A F;  2KEC A;  1QIL A;  1EOT A;  3K58 A;  3I4M B;  4LFA L;  4WJ4 A;  1HA5 A;  4GZY C;  1LTT D;  3PGZ A;  1QVF A;  4DV6 Q;  3TQY A;  2UXB Q;  4TQU S;  3S14 H;  2MGS A;  4JI1 Q;  5M5X H;  1VQF A;  4KD4 A;  3OWF A;  2F1M A;  4DR1 Q;  1SYB A;  2KHI A;  5A2Q E; 
#chains in the Genus database with same CATH homology
 2VZA A;  2NVQ H;  1XNR Q;  4DR7 L;  4A3G H;  3KYH C;  1N36 L;  4HIM A;  4LWC A;  2WAQ G;  3NBH B;  4JYA Q;  2K52 A;  4ALP A;  3W1G A;  2K5H A;  4X64 L;  3ULJ A;  1CSP A;  3LGJ A;  2VY3 A;  4JI8 L;  2MNA A;  3CCE A;  1JJC B;  4POF A;  2GN5 A;  2JA8 H;  4HJ5 A;  3CXC A;  2JA6 H;  1L0W A;  1T9H A;  4R4C A;  4B3S L;  3GDE A;  3L0O A;  2WB1 G;  1Q46 A;  5IWA L;  3HOX G;  4GKK Q;  1XMO Q;  1M1K C;  1P16 A;  3K7A H;  4L5Q A;  4H02 A;  5DLQ E;  2UUA Q;  4BY1 H;  2F4V L;  3GTK H;  2F52 A;  3BZC A;  3B6Y A;  4L5R C;  1Q12 A;  2ZJR A;  2A19 A;  1N8R C;  1PHJ A;  1PH4 A;  1E3P A;  1X3E A;  3UE1 A;  4A3B G;  4B3T Q;  2ZM6 L;  4A4I A;  2VL6 A;  1VQN A;  4QY7 A;  1A8V A;  4DK6 C;  1VCI A;  3PIP A;  3HOZ H;  3UDX A;  4JI6 Q;  1J5E L;  4A76 A;  4JI0 Q;  3CF5 A;  3NEL A;  4DV1 Q;  1XPO A;  1Q86 C;  1L2F A;  2VUM G;  4JOI A;  1PH5 A;  3KJO A;  2UUC L;  4X65 L;  3J80 c;  3MEF A;  3OYY A;  2ZJQ A;  3GTL H;  4O0A A;  4BXX G;  5LMN Q;  4LUO A;  1LM0 A;  1K8G A;  4LF7 Q;  1CKN A;  4DV5 L;  1YBY A;  2EXD A;  1KHI A;  2QEX A;  4AQY L;  5IYC G;  4MZ9 A;  2E5L Q;  3KF6 A;  3HOU G;  4WJ3 M;  5ELN A;  3AFP A;  2HIV A;  4HIK A;  5AJ3 Q;  4DV7 L;  4JBM A;  1PVO A;  2XGT A;  1WYD A;  3RR5 A;  5IE8 A;  1NJI C;  1FL0 A;  4DV3 L;  1Q81 C;  1SLJ A;  4QQB X;  1OXT A;  1QVC A;  1TWH H;  2MO0 A;  5GAE C;  3S2H H;  3PUW A;  4HJ8 A;  3T1H Q;  1PH3 A;  3J7A 5;  4JI2 L;  3HOX H;  1N34 Q;  2CQO A;  4QIW E;  2NZO A;  2KCT A;  4PZ7 A;  1I94 Q;  2N8N A;  3PSI A;  1IBM Q;  2UU9 Q;  4LUZ A;  1K3R A;  4LF9 Q;  3RNU A;  4LF8 Q;  1YHA A;  3ULL A;  1W3S A;  3A74 A;  2Q2T A;  2VQF Q;  2OWO A;  4BY7 G;  4FDB A;  3S17 H;  1JJ2 A;  2UXD L;  3BZK A;  4X66 Q;  1XMQ L;  2VQE Q;  4A3B H;  4DK3 C;  4QGU A;  1WFQ A;  1XNQ L;  1GVP A;  4GNX A;  1X9N A;  2PI2 E;  4C3H H;  4A3J G;  1CKN B;  1A63 A;  1VQJ A;  2R6G A;  5JJL A;  1ASZ A;  2BA0 A;  2JK8 A;  5IY0 A;  2VUM H;  3KF6 B;  3JAM c;  4DV0 Q;  4KHP L;  3NEN A;  2E8G A;  2NN6 G;  5IP9 G;  4BXX H;  5C0X I;  4POG A;  1TXY A;  1WOC A;  2ID0 A;  3HOY G;  2R93 G;  1KQS A;  1U0L A;  1Q1B A;  5M5W H;  3AQQ A;  5IYC H;  3CC7 A;  4YY3 L;  4A3M G;  3HOU H;  1C0A A;  2B29 A;  4EQ5 A;  4DV2 L;  1MJC A;  5LMN W;  4IFD G;  4JI7 Q;  1UE1 A;  4JV5 Q;  1SRO A;  3M4P A;  4L5S A;  1KC8 C;  1TWA H;  1PYS B;  5J3B A;  3G71 A;  1HR0 Q;  1FJG L;  1OXV A;  2YTV A;  3E9H A;  4IJL A;  3KF8 B;  2UUB L;  1S40 A;  2UXC L;  4YWL A;  2AMC B;  2CKZ B;  2H5X A;  2GVA A;  4YCU A;  3EBE A;  4JBW A;  3CCS A;  4LFC L;  4R1J A;  2YTY A;  5GAD C;  4GNX B;  4NXM L;  2WAQ E;  4DV4 L;  3D0F A;  3KDF A;  1PH8 A;  1M90 C;  4BY7 H;  1I50 H;  3T1Y L;  1FVI A;  4DAY B;  1VQM A;  3KLW A;  4X64 Q;  3GTO H;  3CD6 A;  4DR3 L;  4OXP A;  1OXX K;  1UE7 A;  1V43 A;  1Z9F A;  3CW2 C;  3F2B A;  4A3J H;  2VNU D;  1JT8 A;  2PI2 A;  2K75 A;  4A93 G;  4B3S Q;  1KRS A;  4JI5 L;  2E2J H;  1L1O A;  5IP9 H;  5IWA Q;  4GN3 B;  2PQA B;  2KCM A;  1LYL A;  2WB1 E;  2FXQ A;  2F4V Q;  3HOY H;  2R93 H;  3K81 C;  1VQ4 A;  1HH2 P;  4A3M H;  1SRU A;  3CPW A;  2HQL A;  3TS2 A;  2JJQ A;  1NMG A;  4Y7N H;  2I0Q A;  2I5L X;  1X65 A;  4DR6 L;  4APV A;  3J81 c;  4AIM A;  1KD1 C;  1VQH A;  1J5E Q;  3BJU A;  1A62 A;  2CCZ A;  4IFD I;  4HJ9 A;  5BR8 L;  1VQK A;  3NEM A;  4OX9 Q;  2BA1 A;  2MO1 A;  2ZTE A;  3KDF B;  1N33 L;  2UUC Q;  1HR0 W;  2GVB A;  4MNO A;  2Y0S E;  4X65 Q;  2KBN A;  4JI4 L;  4PZ6 A;  1VQ9 A;  1B70 B;  3CQZ H;  4DV5 Q;  3PF5 A;  2N3S A;  3RLO A;  2NVX H;  3S1N H;  3M4O H;  1X3F A;  2ATW A;  4UPA A;  4DV7 Q;  1CKM A;  2R7D A;  2E2I H;  3OTO L;  1N32 L;  4LF6 L;  1L1O B;  3KFU A;  4A3D G;  3I2Z A;  1XTD A;  5GQO A;  4DV3 Q;  4R4T A;  4KLK A;  4OWT B;  3I56 A;  4A93 H;  2Q2H A;  4C2M H;  1JMC A;  3CCQ A;  4DUZ Q;  1EYG A;  4IO9 A;  3I4N G;  1AH9 A;  1S72 A;  1EFW A;  1WI5 A;  4A3C G;  4IPG A;  2R7Z G;  3PUZ A;  1D7Q A;  4NPS A;  1YVC A;  1YHB A;  2Y0S G;  1CUK A;  1VQD A;  4JI1 L;  5C44 G;  2HT1 A;  1N9W A;  1SR3 A;  2D0P A;  1K73 C;  3F2D A;  1PH6 A;  1NBW A;  4GOP C;  3HOV G;  4LF5 L;  1CKO A;  5FLM G;  3S16 H;  4XTC S;  4UP9 A;  2EQS A;  3S24 A;  4DPG A;  1W2B A;  1XNR L;  3UDG A;  1D8L A;  2IT1 A;  4GN5 A;  1B8A A;  1VQB A;  1XNQ Q;  5C4X G;  4GKJ L;  1G29 1;  2RHS B;  4UP8 A;  1Y1W G;  3GTP H;  5C4J H;  3PIO A;  3CCM A;  1QUQ B;  1Q82 C;  4P73 A;  4RG1 A;  1NMF A;  4YWM A;  3PO2 G;  1PH2 A;  1A0I A;  3J80 i;  5LMU Q;  5IYB G;  1G6P A;  4LF4 Q;  1VQ7 A;  1PYB A;  2XTI A;  1X54 A;  4YY3 Q;  1YI2 A;  4DV2 Q;  1JE5 A;  4O2D A;  4B3M L;  4DKA C;  3GTJ H;  2LXJ A;  4P72 A;  3UE0 A;  3S15 H;  2K5V A;  4UP7 A;  3ZJY C;  1UE6 A;  2MQH A;  2IHE A;  3FP9 A;  1XMO L;  2JQO A;  1VQ6 A;  4A3D H;  3PV0 A;  2K14 A;  1FJG Q;  1Y14 B;  4DAM A;  1IBL L;  2Z6K C;  1QVG A;  1LTL A;  1UEB A;  4K0K Q;  1MKH A;  2V1C C;  4XIG S;  2UUB Q;  1HJP A;  3I4N H;  4A3C H;  1I6H H;  3L7Z C;  3DM3 A;  2R7Z H;  4RMF A;  1S3O A;  5IYD G;  1VQ8 A;  3GTM H;  5C44 H;  4LFC Q;  4LNQ A;  4UY8 C;  2JE6 I;  4JI6 L;  3HOV H;  1AE2 A;  4NXM Q;  4DV4 Q;  4YHH L;  5M3M G;  5FLM H;  3PF4 A;  2LSS A;  5GRO A;  3T1Y Q;  4DV1 L;  3GTG H;  4EX5 A;  1Q7Y C;  3ERS X;  3U58 A;  1R9T H;  4LFA Q;  1KRT A;  4BA2 I;  2AWO A;  5C4X H;  1YNX A;  4LF7 L;  2PQA A;  1X6O A;  4X62 L;  3CMA A;  5IP7 G;  1WJJ A;  4GOP A;  1Y1W H;  3E9I A;  3A5Z B;  3PUX A;  2D0O A;  5HY6 A;  4A3F G;  1B7Y B;  1TWG H;  2E5L L;  4OO1 I;  1JJG A;  4DR5 L;  2PMZ E;  2JA5 G;  2ES2 A;  4JI5 Q;  3CPF A;  3PO2 H;  3JAM i;  1IYJ B;  4P71 A;  1PA6 A;  4B3R L;  1HZB A;  3DLL A;  5IYB H;  1HZ9 A;  2K5N A;  5C0X J;  2JA7 G;  1SE8 A;  1NTG A;  1C7Y A;  4DR7 Q;  3IRB A;  3VDY A;  1N36 Q;  5GAG C;  1K83 H;  2NN6 I;  3S2D H;  1Z47 A;  1VQP A;  5JJI A;  1PH7 A;  1N34 L;  2CWA A;  5JEA J;  5FJ8 G;  4JCV E;  2KHJ A;  4HID A;  1I94 L;  2HHH L;  4LFB L;  4YCW A;  3PCO B;  4IPH A;  1QZH A;  3GO5 A;  2KEN A;  1Q8K A;  1WCM G;  4JI8 Q;  4DR2 L;  2YU9 H;  2IX1 A;  5M5Y H;  1DGS A;  2ZTC A;  4X66 L;  4AYB E;  1SMX A;  4JI4 Q;  3S1M H;  5IYD H;  2B3G A;  1YJN A;  4IPD A;  2Q2I A;  1OXS C;  1E24 A;  2A1A A;  1HNW L;  3PUY A;  4R4I A;  4HJA A;  5EAY A;  1K9M C;  5M3M H;  4KI0 A;  3F2C A;  4GOP B;  4DR4 L;  1U5K A;  2CFM A;  1PV4 A;  3OTO Q;  2WFW A;  3RZD H;  1N32 Q;  4LF6 Q;  1ASY A;  4A3L G;  4GS3 A;  3J81 j;  2HIX A;  3CC4 A;  3HOW G;  3J7Z C;  1SFO H;  5IP7 H;  3CAM A;  2ZM6 Q;  4NB3 A;  1YEZ A;  4QJF A;  2PNH A;  4LUV A;  4A3F H;  2IX0 A;  3G4S A;  3PO3 G;  4ME3 A;  2YTX A;  2JA5 H;  3EIV A;  1V1Q A;  4JOI C;  4JI7 L;  4BBS G;  5JJK A;  3STB C;  2B63 G;  4DUY L;  1MIU A;  2K50 A;  4YCV A;  4NXN L;  4AYB G;  3WWV A;  1E22 A;  2JA7 H;  2NVT H;  3TRZ A;  1HZA A;  3F8T A;  1KXL A;  3A0J A;  1HNZ L;  4AQY Q;  3M3Y H;  1UWV A;  3CCU A;  1Q1E A;  2OTJ A;  1QUQ A;  5FJ8 H;  3H3V H;  2BH2 A;  3RN5 A;  4JI3 L;  1VQC A;  1BBU A;  2MFI A;  4GKJ Q;  3CC2 A;  1BKB A;  3J81 i;  3CCJ A;  1WCM H;  4P75 A;  3M85 A;  3CP0 A;  1I5F A;  3M4Q A;  3CCV A;  2VW9 A;  5K36 G;  3KJP A;  1IBK L;  2C35 B;  1XPR A;  1Y1V G;  5FLX c;  1YJ9 A;  4R4Q A;  4PMW A;  3G6E A;  3I4O A;  2QGQ A;  2ZTD A;  1NE3 A;  1OXU A;  4JI2 Q;  2K4K A;  2ZJP A;  4DV6 L;  2UXB L;  2LXK A;  4PG3 A;  1EUJ A;  2D62 A;  4B3M Q;  3TRE A;  3EN2 A;  3RZO H;  4IPC A;  1YJW A;  3PUV A;  4IOC A;  5M3F G;  4DR1 L;  1KIX A;  1EIF A;  2JEA I;  1UE5 A;  3W1B A;  2RHQ B;  2IHF A;  4IJH A;  4HIO A;  1HNX L;  5ELO A;  4A3L H;  4Y52 H;  3HOW H;  2UXD Q;  4C3I H;  1YIJ A;  1XMQ Q;  2YV5 A;  4A3I G;  3A5U A;  4A3K G;  4GNX C;  1IBL Q;  4TVA B;  3K7U C;  3L2P A;  4BBR G;  2NVY H;  3PO3 H;  3UDI A;  1GO3 E;  1I3Q H;  1VQA A;  3M9B A;  4GN4 B;  2JA9 A;  1YHQ A;  3U4Z A;  3W5O A;  2OTL A;  2B63 H;  1RIP A;  2R92 G;  4BBS H;  4GLV B;  4OWX B;  3K0X A;  4JBJ A;  4KHP Q;  4QL5 A;  3H0G G;  2AHO B;  4AH6 A;  4JYA L;  1RL2 A;  4LW1 A;  4YHH Q;  4OX9 L;  1XJV A;  3AFQ A;  4J15 A;  3HFZ B;  4JG2 A;  3SGI A;  3ULP A;  2QA4 A;  1VQG A;  4X62 Q;  4GKK L;  2ALY B;  2RF4 A;  4A3E G;  2UUA L;  2Z0S A;  3CCR A;  4DR5 Q;  1AE3 A;  1EQQ A;  2EIF A;  3H15 A;  3RLF A;  1Y1V H;  1YZ6 A;  4OWW B;  1EQR A;  2WP8 J;  4B3R Q;  2E2H H;  1NY4 A;  4GLX A;  4OON A;  2UXC Q;  3F1Z A;  2A8V A;  4B3T L;  5C3E G;  5C0X G;  4P74 A;  2OQK A;  4DUZ L;  5M3F H;  2RCN A;  4JI0 L;  1BVS A;  3U4V A;  3I4M G;  4GLA C;  3U50 C;  1TWC H;  1QZG A;  1J6Q A;  3HKS A;  2HHH Q;  4A3I H;  4LFB Q;  2I5H A;  2OQ0 A;  4A3K H;  4L5T A;  2AKW B;  2N49 A;  5JEA G;  1FGU A;  1IZ6 A;  1TWF H;  3GD7 A;  4KHZ A;  1VS0 A;  2AWN A;  3RLN A;  2L15 A;  4BBR H;  5LMN L;  4DR3 Q;  4DR2 Q;  3BU2 A;  4OO1 G;  2R92 H;  1JB7 A;  1C9O A;  1EOV A;  1K0R A;  1L1O C;  1X55 A;  2DUD A;  3GTQ H;  1PH1 A;  3M7N A;  4X6A H;  1E1T A;  1VQE A;  3H0G H;  2F3I A;  5H1S E;  5AJ3 L;  1HNW Q;  1GKH A;  4C3J H;  1H95 A;  4A75 A;  4DR4 Q;  4DNI A;  1K8A C;  1BBW A;  2I5M X;  1GD7 A;  3FKI G;  3I55 A;  4HJ7 A;  4JC0 A;  1P8L A;  3JC6 6;  2JEB I;  3TEH B;  3HKZ E;  2N78 A;  4R4O A;  5LMU L;  1VQO A;  3CCL A;  3T1H L;  1VQI A;  4LF4 L;  3UDF A;  1MJE A;  1IL2 A;  3Q8D A;  4IOA A;  4A3E H;  4A3G G;  2YYZ A;  3OW2 A;  3AYH B;  3D31 A;  1SN8 A;  1KAW A;  3RN2 A;  1IBM L;  2UU9 L;  4DR6 Q;  5E7N A;  4LF9 L;  1VQ5 A;  1X56 A;  3CME A;  5BR8 Q;  1HZC A;  3K80 C;  4DUY Q;  1GM5 A;  4LF8 L;  4NXN Q;  2VQF L;  3AEV A;  1VQL A;  1KL9 A;  1N33 Q;  5GAH C;  2VQE L;  1XPU A;  5C3E H;  1O7I A;  2DGY A;  3MXN B;  1PH9 A;  4K0K L;  4PZ8 A;  3S1Q H;  1HNZ Q;  2Z6K A;  1LUZ A;  2BH8 A;  2JA8 G;  3I4M H;  3K8A A;  1PFS A;  3TS0 A;  3STB D;  2JA6 G;  2CWP A;  4BA1 I;  5HGQ A;  2VS1 A;  4DV0 L;  2IY5 B;  4JI3 Q;  1OTC A;  2OCE A;  3ER0 A;  2R7F A;  3FHW A;  3HKZ G;  3KOJ A;  4MTN A;  4BY1 G;  3ICE A;  3G48 A;  4YWK A;  4JBK A;  1IBK Q;  1X3G A;  4IFD J;  3H3V I;  4LFA L;  1EWI A;  4WJ4 A;  1V9P A;  1E7Z A;  4JV5 L;  3PGZ A;  1QVF A;  4DV6 Q;  3TQY A;  1G51 A;  2UXB Q;  4TQU S;  3S14 H;  1E1O A;  2Q2U A;  1HR0 L;  2ASB A;  4JI1 Q;  5IT9 c;  3FKI H;  5M5X H;  1VQF A;  4DR1 Q;  3HOZ G;  3E0E A;  3S1R H;  1HNX Q;  4LF5 Q;  2NZH A;  3I7F A;  1EIY B;  1IXR A;  2KHI A;  1CSQ A;  1YIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...