3RD4A

Crystal structure of propen_03304 from proteus penneri atcc 35198 northeast structural genomics consortium target id pvr55
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
76
Chain Sequence
APVKLYMVEVIDKKEIAANEITHYYQVTFRLTTDDRKDLVLNIDKSSYQNIEPEMKGRLFMQGSRFVQFETDVPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of PROPEN_03304 from Proteus penneri ATCC 35198 Northeast Structural Genomics Consortium target id PvR55
rcsb
source organism Proteus penneri
molecule tags Structural genomics, unknown function
total genus 11
structure length 76
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rd4A00
3RD4A 2L0CA
chains in the Genus database with same CATH superfamily
1CKMA 1V9PA 5FLXc 3I91A 3BVMA 3BZCA 4DAMA 4HCSA 4GOPB 2NTTA 1WCMH 4GLVB 3WDNA 4NXNQ 2DJGC 2UXCL 1PFBA 1DGSA 2Q8TA 4XQNA 1STAA 1EY6A 4KN4C 4C3JB 2FFKB 4DV5Q 1SNMA 2LS01 5JOBA 1LTGD 4C3JG 5LHY1 3PO2B 1U4PA 4RGNA 4DN4M 4DU9A 3PO2G 4DR7Q 5ELEA 3RR5A 4X62Q 2LSSA 1FNUA 2DN8A 5I6WA 2MJ8A 2JA5H 1LT3D 1O78A 1IYJB 2L5TA 4GOPC 4F88A 2B63B 4TRDA 1VQCA 2CKZB 4K8JA 5C3WA 3DWQA 2NN6H 2B63G 2EYOA 1NBWA 4R4CA 3S1QH 3CU7A 4JPBW 4KJNA 1YNJC 1TKWB 1T9HA 2L12A 4ZKBB 3ERQA 2NVQB 1QOHA 2EJFC 3D4RA 2C9OA 1CHQD 1ZXTA 5LMNW 3M7GA 2YTYA 4X3UA 1V1OA 3EJIA 4GLAC 1KD1C 2EYMA 3BZDB 2PNRC 3D4DA 4DAVA 3CKIB 4JVZA 3TSSA 4DV4L 4PNYA 2CQAA 4GNXB 1KQSA 4A3IH 2UUAQ 2DNEA 1E0BA 5IE8A 2RSNA 1XMQL 4E6IA 1GOZA 3T53B 4KMUC 1D5MC 1TY0A 1YEZA 2JQOA 3KJOA 3I7FA 3PQIA 3J7ZC 2NVTB 5CYUA 4HCEA 1GUWA 1N34L 3G7LA 2CH4A 1TWGB 3RZOB 2A6EC 4F87A 4DXFA 4IFDJ 1SNQA 1N33Q 1AZPA 1VQBA 1SRUA 4XQJA 2ID0A 3DM1A 1J6QA 3L3OC 4GNXC 3S24A 1G51A 1GXDC 3NQTA 4OO1G 4JYAQ 5AJ3L 4DUZL 1L1OB 2HIXA 4RGMA 4CDEC 1EYDA 1Q7YC 1CI3M 2VB3X 3TQYA 5E4XA 3K5NA 1A3UA 1FL0A 4H44C 1X3EA 4WJWA 3R3OA 2OTLA 4DF7A 3J81L 3J7AF 3QG1A 4QQBX 2BH8A 2WINB 2EXZA 4PV1C 3W5OA 3FPPA 1TWCB 2HHHL 4PZ8A 4P74A 4C3JH 3DEPA 1PFSA 3PIO3 3PO2H 3HOZB 2I5HA 1J9OA 1JB7A 1I4PA 1EY0A 3HOZG 4X64Q 1IYUA 4J1MA 4N9TA 3CRLC 3ULPA 5KIXA 2NBFA 2TSSA 2RBMA 2B63H 4A3FB 2IPKD 4IPDA 3HZXA 4A3FG 2B2YA 3PGZA 4ME5A 4I7ZC 5FKAC 2F4VL 4MTNA 5JJIA 3JAML 2FMCA 1BO0A 1R4QB 3FHWA 2FJ2A 2PW7A 1UEBA 1SNPA 5GQOA 3Q24A 2EIFA 4KKTA 1U4MA 4K6DA 2UXCQ 2F0GA 2ZTCA 2D2CC 2L1BA 1LACA 1A62A 2EOTA 2O5JC 1SEBD 1VDZA 2KHJA 2K14A 1D5XC 1KAAA 1JJ2A 2E2HB 4DAYA 2K04A 4IJHA 4ULLA 1YI2A 3VDYA 1MHWC 3R2IA 2JA8B 4A3LG 4XTCS 4U673 1IBKL 2NVTH 2JA6B 2CQOA 2JA8G 2E2IB 4YCVA 1TWGH 1UE5A 3RZOH 2Z6KC 1GUSA 2JA6G 2IW3A 2RQXA 3CCMA 3QB3A 2KCCA 4GOPA 1XJVA 1STHA 4OO1H 3CPFA 4HJ8A 1JMCA 3GTKB 2CCZA 1PH5A 1QCBD 4KY5A 1AW7A 2F0TA 1S5FD 1S5DD 2AUJD 5E7NA 1OXUA 1QZGA 4C3HB 1JE4A 1AEXA 1I5FA 3I73A 3CCJA 3C3LA 1BBWA 4K5XA 4ABNA 1MI2A 2XIWA 4C3HG 3CCUA 4DV4Q 4MTKA 3C2PA 2OT2A 2XTIA 4JW0A 1ZEQX 1G2TA 2F0PA 1U4RA 2KVMA 4EQNA 1GUTA 1JOOA 4JC0A 1XMQQ 4KTAA 2PO4A 5M5WB 3QOJA 1S5BD 1BBXC 1TWCH 4LFCL 1GJXA 3J7YW 2O5IC 3TRZA 2IWHA 1KDCA 1N34Q 2FINB 5HURA 2L9HA 1E22A 3HOZH 4A76A 3R93A 3PUZA 2M2LA 1KDAA 1PH2A 1DD2A 1YZ6A 1QE6A 2EYPA 2L0CA 2PZWA 5I9OA 4GNXA 3HOYB 4A3FH 5AJ3Q 4DUZQ 2F03A 3HOYG 2E8GA 2F0WA 1X3FA 1V43A 4Y52H 1JT8A 2ZJQA 1EYCA 3CHBD 3G6JB 4DR4L 2OQKA 4JI0L 2EZVA 2H5XA 4MNOA 2F0NA 4H13C 3M4QA 3KDFB 5JAVA 4B3RQ 4FYDA 2WKCA 2E76C 1LT5D 4HJ7A 5E4WC 1B1ZA 4LF9L 2EY6A 2HHHQ 4FXDA 3GO5A 3TP6A 4HSVA 1SXTA 2E2HH 1L1OA 5CV6A 2OCEA 1TS5A 4A3LH 4HSPA 1SYGA 1K83B 1JB3A 5IY0A 2JA8H 1GVPA 1DONA 2B2VA 2PI2A 1PYSB 3G48A 4LF6Q 2JA6H 2ATWA 2E2IH 3TBIB 2E75C 3BG3A 1GUNA 1SMXA 5EAYA 4JK1C 1U9RA 2HUGA 3F8TA 3J81c 2LFNA 2G5DA 1RIPA 3MXGA 4RAUC 2F4VQ 1AFPA 3IL8A 1O7LA 5J1ZA 4DV7L 3GTKH 2OTJA 1CUKA 2B39A 5KEEA 4DK6C 1Q1EA 1QZHA 1Q90A 3TMEA 4HIOA 1EWCA 3WOFA 4C3HH 2ASBA 3AYHB 2IHEA 5IGFA 1KLUD 1FNWA 4QMGA 1K8AC 4IJLA 1NAPA 1IBLL 2J4XA 2PPBC 5ELNA 1HNWL 5HY6A 2PQAA 1A63A 4FO2A 1MJCA 1X65A 3GTLB 5KGUA 4H0LC 4U68A 1CM9A 5M5WH 1SJHD 5JEAJ 1WFQA 1VMPA 2BA0A 3TP8A 1IBKQ 5DNFA 4RHRA 4JI3Q 1EY4A 1IZ6A 4GKJL 4KHPL 1D2BA 2KEDA 2F0FA 3J80c 4ALPA 2Z6KA 1XYIA 5EJWA 1PRTC 5FLXL 1J8IA 1NTGA 1OXTA 4OWXB 1DZ1A 3E5SA 1G2SA 3HOYH 5IWAL 1SAPA 1EYGA 1RDPD 1EY8A 2J0TD 2SDFA 1SDFA 5DLQE 1F2ZA 1BQQT 3OWFA 4HIDA 2IHFA 1LT6D 1A15A 4CKCA 5JJKA 3SDZA 4J15A 4IPHA 2JN4A 5CBAE 2D5DA 2F0QA 4CJ2C 5CR3A 3E0EA 1K28A 1XWEA 3NWTA 3KF6B 3A54A 1BKBA 3K58A 2F0JA 2JEBI 4GN4B 4L63B 2K5HA 4UP9A 5ELDA 2L4NA 4EQOA 1LT4D 3OPOA 4C3IB 1I6HB 1K83H 5F2DA 2WACA 3H6MA 4V190 1PYWD 3K81C 3K5OA 4JG2A 2Q2UA 3BDOA 4C3IG 1VQNA 5HGTA 4HN7A 3A8JE 3RZDB 4AQYL 1B9NA 1XTDA 1ASYA 5KNBA 1K0SA 4YIJA 2LXKA 2HQLA 1IL2A 4C1NK 2R3ZA 4YWLA 5COYA 1VQIA 1TS2A 4M8AA 4DR4Q 4GZYC 1HJPA 4C1NI 1P8LA 2JSOA 1KC8C 2AHOB 2KOLA 1FVIA 4POFA 4JBJA 3CC4A 1PTOB 4IPCA 1CT1D 3A7AB 2F0DA 2RF4A 3MTSA 2YYZA 4LF9Q 3D6CA 3DM3A 1H9MA 1VQJA 2HD3A 2HDMA 4K6LA 1Q86C 4J6HA 1O7YA 3GTLH 4LFBL 3R2TA 2V4DA 1SYCA 1I4QA 1VQFA 1W6JA 1HUNA 3HOWB 3W1GA 5CGKA 1CTMA 1LABA 2MFIA 5GAEC 1JOQA 1I94L 3GTPB 3HOWG 4K5WA 5KYLA 1KTKA 1IYVA 1NE3A 2Y0SE 3P75A 1L0XB 1YJNA 1A3TA 3KDFA 3CCSA 2KENA 1IBML 3F2DA 1EOVA 4R9WA 1TR5A 1F2MA 4B3SL 1QVGA 3A0JA 1H9RA 4DV7Q 1LYLA 1PHJA 3GTJB 1KNAA 2JEAI 5BR8L 3VA5A 2K1BA 3PMFA 4DR2L 1J5EL 4FNFA 1JC7A 2OEOA 3STBC 1QILA 1LTBD 2L55A 3IFTA 5GADC 4UHVA 2BDNA 5A2QE 1WYDA 3T1HL 1IBLQ 5G3LD 1U4LA 1HNWQ 3RN5A 1YHAA 4KY7A 3MA2B 1PDQA 3BVZA 4DFAA 4N9PA 2AMCB 3J7AV 5ELFA 2MO1A 3AFQA 5G3LF 4DV1L 1I4XA 1RD9D 2E2DC 1FYCA 3CRKC 2ZJRA 4GKJQ 4KHPQ 1BXTA 4RHSA 1H9SB 1HTLD 3I90A 4DXGA 2K28A 4C3IH 1I6HH 2VQEL 4OL7A 3P20A 1HNXL 2A74C 2RDHA 1VQGA 5C4ZA 5H1SE 3T51B 3RZDH 4YWMA 5IWAQ 1MD2D 1C9OA 1LTID 2EPBA 3D4WA 3FP9A 3PCOB 3VYSA 4J8QA 1A6XA 3AFPA 2Y0SB 4TSSA 2OQ0A 3Q0AA 2SNSA 2K05A 1YNXA 3GDEA 2Y0SG 1G6PA 2ZTDA 2NVXB 2EQSA 4BXXG 4N8X1 1HZAA 1SBBB 3MVVA 4NP5A 4OWTB 4DV0L 1PTOH 2N88A 3K0YA 5C3XA 4G7ZC 1GKHA 1XPRA 1EFWA 5C0XI 3HP3A 4NB3A 4DNRB 1DJRD 3CP0A 1CZGA 2Z4HA 5D14A 2A6HD 4CDFC 1W2BA 4OWWB 3BDLA 3RD4A 1HH2P 4ZK9B 1BNZA 4IUTA 3KOJA 1RCVD 3HOWH 2RHSB 1SNCA 2RCNA 4DUYL 2NTSA 4JI4L 2XRSD 3GTPH 1TU2B 1CFMA 1SYBA 1CK1A 4AQYQ 1A2TA 2RDFA 4HJ5A 2UXBL 1B7YB 3PIPA 4R8NA 2K01A 2UUCL 3KF6A 1TT2A 1YNJD 5M3FB 3GTJH 4NDXA 5M3FG 4DK0A 1NJIC 3TEHB 2PI2E 2F1MA 1HZBA 5LL6X 1I6VC 4KN7C 5IYCG 3HOVB 4CBVA 5T1GA 1EFID 1OTCA 3HOVG 1TWAB 3FPUB 3TREA 1C8CA 4L5TA 1CQFA 3UI2A 4RG1A 3PUWA 1U0LA 1I94Q 2QDLA 1NY4A 3C1FA 4P75A 2Q2TA 3BYTB 1E24A 3IFDA 2JP1A 2CWPA 2M9VA 1K3RA 2QCPX 2BCOA 1L0YB 4ME3A 2DGYA 1IBMQ 3I2ZA 1WTOA 5IODA 5NUCA 3ERSX 4OEMB 2DUDA 2NN6I 2QDBA 3NP8A 4B3SQ 3GTGB 3BJUA 3KLRA 3KLWA 3BZKA 1BCPD 3NPPA 2O4XA 1HR0W 2IX0A 3TP7A 4DR2Q 1J5EQ 2AQ1B 4LF4L 1EY5A 1JICA 1TY2A 3I4MB 4HMJA 1H9JA 3E0JA 4BXXH 3M85A 3I4MG 1BCPF 1I3QB 2NVXH 1M8AA 3SR1A 4ILWA 1NMGA 4DV3L 1C7YA 2PW5A 3NTIA 2B8GA 3AB9A 2GN5A 1Y8OB 4I7AA 1WTVA 2FXQA 2B3GA 2Z6BA 3W3AA 3F2CA 4DV1Q 1LLRD 1U5KA 3OWEB 2F0VA 2A19A 4LF7L 2KEEA 1B4OA 3SK6A 4JI2Q 4FDBA 2D9UA 1SNDA 2VQEQ 2F0EA 3MXNB 4EGVA 5J22A 2VQFQ 2SOBA 1HNXQ 1JOKA 1L1OC 4O1NA 4RGOS 2DNCA 2F0MA 3VR6A 5JJLA 1WOCA 1Q81C 4XT1B 3ZYYX 2B2VC 2BDOA 1RL2A 1WTHA 2B29A 1RJTA 1RODA 5EKIA 4KKUA 1DOMA 1B44D 4NKLA 3WOEA 4OIKA 4A3DB 5M3FH 1QJOA 4AH6A 1Q46A 2A8VA 3P1HA 3TN2A 4A3DG 1S5ED 2CHBD 4YCUA 5IYCH 4DV0Q 3BS1A 1LTLA 5FO9B 4I65A 4MZ9A 1ICWA 1YHBA 5CMDA 3HOVH 1MIUA 1XX8A 4OGQC 1KDBA 2VUMB 1CKNB 2N78A 2VUMG 1TWAH 4PG3A 1Z47A 3J80L 2DY8A 3MXUA 2CFMA 4RH6A 3U50C 4IFDG 1PH6A 3PO3B 5IT9E 1G6ZA 3CCLA 3H91A 1B2TA 3K57A 3NELA 3PO3G 4DUYQ 4JI4Q 1UE6A 1MSGA 1QUQB 2XRQD 3BVGA 2OXPA 1Y69U 1X32A 4ZQ3A 1Z6HA 3DXJC 4X3TA 3QO2A 2UXBQ 3OIQA 2UUCQ 3OTOL 3M3YB 2YTVA 3GTGH 4UY8C 1Q3LA 2RCFA 5EPKA 3L0OA 5GROA 2A68D 4O0AA 3UE0A 3GQBA 1G291 3PF5A 3ICEA 1YITA 2SNMA 5LMUL 4RKLA 5IP7G 1JR0D 1MGSA 1X56A 1S40A 5C3EB 2X6LA 3I4MH 1PH8A 3QJYA 5C3EG 4R8IA 4GS3A 1I3QH 1JQYD 3EQLC 4NPSA 4N8FA 3TS2A 3K7UC 3VR3A 1BOSA 1RHPA 1Q8KA 2AQ2B 3AEVA 2CW0C 1Z7TA 1I4GA 3SXHA 3AMUA 5IYBG 2F0HA 3FMCA 2MPMA 3J81i 3MAQA 1ZKOA 3F2UA 1SYDA 1VQMA 4NXML 1K73C 3M4PA 2TMPA 3NBIA 1SN8A 1CA6A 3I3CA 2F0KA 5C4XG 1ZYRD 4OO1I 3L9AX 5I6YA 3KFUA 4G4KA 2EE1A 2C35B 1JJGA 1EWHA 3I55A 4DAPA 1C48A 2X69A 2WV6D 2G9DA 4A3DH 5EKKA 3I8ZA 1JWMD 3RUZA 3A7LA 2K4KA 3RLNA 3EA6A 1F9PA 1M90C 2HDLA 4DV3Q 3DHQA 2MUYA 3LNNA 3X3MA 1S4ZA 1BR9A 4LUZA 3CMEA 1KABA 3OIPA 1R4PB 2VUMH 2A69D 1B3QA 3I4OA 3JAMi 4A3CG 3E3XA 2KBNA 5D3DA 4IFDH 4Q0FA 4LF7Q 1SMYD 2JA9A 4PZ6A 4YHHL 3PO3H 4IUUA 2E5LL 3BU2A 4PMCA 1UUPA 4JI8L 3L2PA 4ODGA 1O80A 2PZTA 2HCCA 2AUKA 4JOIA 2WKDA 2BE5D 4YCWA 4H7BA 3GTQB 4L6TB 4FVMA 4LAAA 3H0GB 2EY5A 5GAHC 2YTXA 4XYQA 5EBDA 4Q5VA 3M3YH 3QWNA 3S1NB 2JA7B 4KD3A 1T5XD 3H0GG 2NVYB 1EIYB 3MFGA 3K80C 4A3JB 2JA7G 1Q1BA 3NEMA 5IP7H 5CBEE 1N8RC 4KKSA 3IKJA 1EU3A 2WFWA 4A3JG 1WTQA 1Z9FA 3CCQA 2MGSA 5C3EH 1VQ8A 3V2TA 2LKVA 3MXNA 2K50A 1HCZA 2Q2IA 3A55A 1NMFA 1XNQL 3V05A 1I50B 3U4ZA 4LFAL 4IUVA 5EQ0A 4MN3A 4P71A 5LL6S 4FF2A 5IYBH 2EYFA 1SYEA 5FOBB 1G91A 3MWYW 3S2HB 2Z0SA 3GP7A 3ND9A 2XGTA 2N49A 3VR4A 5DEHA 5E1FA 1KHIA 4LW1A 5BN4A 2EY1A 4R4IA 5C0XJ 1UEAB 4P72A 5IT9L 5I2XA 5IOCA 1EY7A 3OTOQ 1CKNA 3CW2C 1F9QA 2ICIA 4ZLTF 3S1MB 4MIUA 5IGGA 4C2MB 5M3MB 2R92B 2K52A 1V1PB 3TZUA 5M3MG 5C6AA 5LMUQ 4FF4A 2R92G 1TXYA 5C4HA 1LV9A 1EQVA 1HXYD 4FXKC 4DKAC 1VQ5A 3Q23A 1X6OA 1PRTF 4KV6A 1QUQA 3DEOA 4CHTB 4NW2A 1DOKA 4AYBE 1PH4A 4KHZA 4P73A 1SJED 3T56B 4IN3A 4LF5L 1SE2A 5D3IB 1KNEA 4A3CH 4HIMA 1JWSD 3C1EA 1YJWA 4IOAA 4WFN3 3D6WA 4JI5L 4BBRB 3CD6A 2B8FA 4NXMQ 4BBRG 2YU9B 2VW9A 4A4IA 3M4YA 4DGZA 3OW7A 4LFCQ 1HUMA 1STEA 5I2YA 5DAUA 4QGUA 2VXWA 1VQ9A 3C46A 2HT1A 1JORA 4X65L 1DM0B 2K5VA 4LF8L 3GTOB 3E9IA 3GTQH 1N36L 3H0GH 2J7ZA 2F0IA 2JA7H 1NR4A 3S1NH 1D7QA 1BF4A 1HZ9A 2NVYH 4A3JH 3FKIB 4JBWA 2UU9L 1HQRD 3FKIG 1EYAA 1ET6A 1NSNS 1TIID 1PZID 3SEBA 2MHVA 4QY7A 5JEAG 4JI0Q 5C0XG 1PH7A 4RFBA 1N32L 1I50H 4UPAA 3Q8DA 2K7VA 2A73B 1B70B 3U9SA 4JBMA 3UDXA 3V96A 1DCZA 4YHHQ 2ZJPA 3R8BA 1G8ZD 2PMZE 1L2FA 3S2HH 4AYBB 1JJCB 3OYYA 1NCVA 5C5MA 5IGEA 4AYBG 1Y1VB 2LXJA 3HOUB 1OXXK 3PUXA 4PMWA 2AKWB 3T1YL 1Y1VG 3HOUG 2F3WA 4PQXA 1PH3A 1YBYA 1X3GA 4FXGC 1PTOC 3ND8A 3K8AA 3AQQA 2PZUA 1KIXA 3S1MH 5M3MH 4C2MH 2R92H 4DPGA 1KAWA 4A93B 1X3QA 1GHKA 4IUPA 4A93G 2LY7A 1WJJA 3HEJA 4TQUS 1QVFA 1S5CD 3VR2A 1E1TA 2IL8A 1XNQQ 4IURA 1FD7D 4A3KB 4K0KL 3HGBA 1EQRA 4LFAQ 4A3KG 1TVXA 4DR3L 4DK1A 4KD4A 3RLFA 1YNND 1D5ZC 2Z4IA 2EYHA 1EZ6A 2IJ0A 4QUFA 1E2ZA 4BBRH 2M00A 2RHQB 3NHHA 4BWGB 1JWUD 1W6KA 2BOSA 2EYJA 2YU9H 1F9SA 1LUZA 5C5LA 4WJ3M 1N33L 1VQKA 1BVSA 4IOCA 1HQMC 4B9WA 3SVMA 3B6YA 3BDCA 2AWNA 4OELB 2ENBA 5CC4A 3KBXA 1PXUA 4ZAIA 3U9OA 3J81E 4BA2I 4JCVE 4DR6L 1UWVA 1EQTA 3GV6A 2PMZB 1GO3E 2DJFC 3GTOH 2R61A 3QR8A 3LGJA 1PZJD 1BBUA 2I0QA 1B3AA 1AP0A 3LWUA 3KYHC 1GUGA 2KCNA 3GTMB 3H3VH 5CV5A 3ULLA 1STBA 3FKIH 3HRZC 1MKHA 2HQEA 1D1KA 4B08A 4F8MA 1K3BC 3DUZA 5JEAH 5C0XH 3PSIA 4FF1A 4LF5Q 2QEJC 1KRTA 4R1JA 3RNUA 3KLSX 4QIWE 3M4OB 3A74A 1PA6A 5IT9c 2L11A 1V1PA 4EQPA 2UUBL 2EJGC 4BBSB 1KLGD 3G71A 4O2DA 4JI6L 4BBSG 5FLMG 2VB2X 4TKOB 4X64L 1Q12A 1HNZL 4RGTA 3JAME 4ZRZA 3S16B 1Y1VH 3VYTA 3HOUH 4L5QA 2BH2A 2K5WA 5IYDG 4LF8Q 2ZXOA 3RN2A 1TWHB 2N8NA 3I70A 1N36Q 2NYZD 3HKZE 1DYQA 4JV5L 2NZOA 5C4JB 1F2YA 3FVQA 2PQEA 3EVQA 1LTSD 3OMCA 5JVH3 1GM5A 1V8QA 2KUMA 4A93H 3CF5A 2R6GA 2UU9Q 1A0IA 4GN5A 3CCRA 3OMGA 2HCIA 3KF8B 1QG7A 5AFWA 2A1AA 2MNAA 1OXSC 1S3OA 1PH1A 1WTPA 1MJEA 1STGA 1IW7C 4YY3L 4A3KH 1N32Q 2A6HC 3CAMA 3NBHB 2B2WC 5IP9G 1VF7A 2WIIB 4CKBA 1AH9A 1F77A 2HIVA 2V1CC 3U58A 3VYUA 2EVBA 1MSHA 4G7HC 2KCMA 5JPNC 2N55A 3CQZB 4BY7B 3K0XA 3H09A 3EN2A 3S2DB 1YHQA 2RA4A 4OIJA 5EBCA 3H15A 4BY7G 1HPCA 4LFBQ 4QIWB 3T1YQ 1JE5A 1I4RA 2F3IA 2O2LD 1B50A 4XYOA 3SE0A 2RDGA 4OONA 3F2BA 2E2JB 4QB4A 1E3PA 4K2LA 1BUVT 2VY3A 3CXCA 4DV6L 2A6ED 1VQ7A 1Y14B 2MQHA 4WRDA 2IX3A 2K5QA 5GAGC 5HGQA 3OOCA 4LNQA 3GTMH 3S9WA 4K0KQ 3UE1A 3ITPA 5BR8Q 3HKZB 1ILQA 3D8GA 4A3MB 3PIOA 4DR3Q 4QUCA 1NUCA 3HKZG 4KY6A 3PIP3 1BCPB 1E1OA 2GA4B 4A3MG 2XWJB 1Q8IA 1W3SA 4APVA 3HFZB 3M4OH 2F0SA 3T1HQ 4KLKA 1XPUA 1EUJA 2B2UC 4JBKA 3Q6SA 2EY2A 2NUCA 4LUOA 2K33A 1SFOB 1SSOA 4BBSH 5EPJA 5FLMH 4X6AH 1CKOA 2JYOA 2YV5A 2UXDL 5ISRA 4QF4A 1OXVA 2OWOA 1KL9A 5A2QL 2RSOA 1VQHA 3S16H 1BCPC 5IYDH 4DR6Q 3U4VA 2IT1A 4L5RC 2KQ3A 1TWHH 4IUQA 2IY5B 4JOIC 4LUVA 2ES2A 1RTOA 5C4JH 1YJ9A 1VQLA 4BY1B 4UP8A 3I72A 4BY1G 4RCOA 4ZYSA 4HTHA 2F52A 4L5SA 1VQ6A 1VCIA 4UP7A 4EVOA 5L37A 1SLJA 3M7NA 4B3RL 2RKSA 2IX1A 1WTXA 1ASZA 1ESFA 2VS1A 1FGBD 4HR7B 4CDCC 1EY9A 2PCFB 1PH9A 4OHJA 4XT3B 5IP9H 3OSOA 1SNOA 2G9HD 2K5DA 1GHJA 1DXMA 2KHIA 4X3SA 1H9SA 4HJ9A 1UE1A 4DNTB 2UUBQ 2QA4A 4FF3A 3PUYA 1VS0A 5IGDA 1HHVA 4JI6Q 1SE3A 2CVRA 1AE3A 3RLOA 1HNZQ 4B3TL 1QWYA 3CQZH 3TS0A 4BY7H 2DY7A 2Z1CA 3S2DH 1XPOA 2JJQA 4LF6L 4CGYB 1SR3A 4G7OC 5I4DA 1FJGL 2L15A 1K0RA 2PQAB 5FJ8G 2ICEC 2I5LX 3S15B 3EROA 3KUPA 1VQPA 4JV5Q 1HFNA 2E2JH 1CHPD 2K75A 2P5ZX 5JPMC 2NVQH 5M9OA 5C44B 3DMUA 5C44G 3K7AB 4CKEA 1VF5C 3HS0C 2B2TA 1KXLA 2WB1E 1B8AA 3QIAA 2MP1A 3VR5A 1HTPA 1H95A 4YY3Q 1R9TB 1E2WA 3GD7A 5KYIA 1GUOA 3G4SA 3SK5A 4A3MH 3E9HA 3SHLA 1STNA 3HG9A 2F3VA 1PYBA 5J3BA 1OO9B 2H1EA 3A8KE 4H02A 5FO8B 1AN8A 2B2WA 4DNIA 2CW0D 1A8VA 1CSPA 3SK8A 1XMOL 3CCVA 4IUNA 5FLXE 2A5HA 1AE2A 2EDGA 2F0UA 3NUCA 3L7ZC 4V0BA 3LWEA 1N9WA 2XVSA 1ML0D 4JI3L 2ZM6L 1SFOH 1UNSA 2X6GA 2EYLA 3KF8A 1Y1WB 1EQQA 3NK9A 3I4NB 1ONLA 1X9NA 1Y1WG 1STYA 5LMNL 4K5VA 2A68C 3I4NG 4NMZA 4GLXA 4XDXA 2D0PA 3NBHA 5FK9C 4GKKL 4DV6Q 1PV4A 3PF4A 4Z9CB 5E3FA 5C4XB 4LWCA 1LTTD 3TZDA 3UDIA 1GD7A 4BY1H 1CQVA 5J39A 1PFNA 1NR2A 1ENAA 2JXMB 5BN5A 1XNRL 1PVOA 3TDQA 3T4AC 2VNUD 2NZ1D 4LF4Q 2WP8J 4B3ML 2ZT9C 4OXPA 3URYA 3D0FA 1V1QA 2BA1A 3VYRA 4LJZC 3H94A 3NTKA 1HR0L 4EX5A 2WB1B 2F4IA 2JK8A 2NWGA 4G57A 4ZKCB 2WB1G 2B2UA 4FP5D 4S3SA 1QB5D 2UXDQ 1I4HA 4X3KA 2NB0A 3MFYA 1ZYRC 3D31A 4BS9A 5ELBA 5FJ8H 1A3VA 2GVBA 2ZXRA 1JCKB 1MBYA 3J80i 4LMQD 5ELOA 5M5XB 3S15H 1B53A 3OW2A 4C56C 2N3SA 4QL5A 5CORA 5K36G 1D8LA 1XTCD 1UE7A 1P16A 3EBEA 1SYFA 1EU4A 3W1BA 1YIJA 5C44H 1PFMA 4ZUJA 4QJFA 1NNXA 4A3EB 4IZ8A 2F0OA 2KA7A 1VQ4A 5I9PA 3NE5B 3K7AH 5DM73 1O7ZA 4OX9L 4A3EG 1EIFA 3N52A 2A69C 3GV3A 1VQDA 4IQZA 1O7IA 1R9TH 3A56A 2H4OA 3K6OA 1LO5D 3FDTA 1LTRD 1SMYC 1EZ8A 2XWBB 3T16A 4JI7L 1HZCA 4WORA 3D3RA 4IFDI 1HRJA 5DM63 1QVCA 1PMRA 1T5EA 4IPGA 4B3TQ 3HOXB 2NZHA 4F7XA 3HOXG 2BE5C 1FNVA 2I46A 4RA8A 3IRBA 1FJGQ 5M5YB 3WWVA 1EIGA 1DOLA 1X55A 4X66L 3NENA 1Y1WH 3A5UA 4DR1L 5KNCA 3NTHA 4IALA 3I4NH 1KRSA 1F2LA 1SE8A 1PLFA 5ELCA 4HIKA 2K5NA 4A3BB 5FO7B 4AIMA 5C4XH 4A3BG 3Q22A 2PNHA 2JE6I 4R4OA 5CV4A 3FEWX 5D65A 1PRTD 1VMCA 3QOLA 3EFXD 4LK1C 1LM0A 4M1UB 3MHBA 2FHTA 1PRTB 1SE4A 4B9XA 2D62A 1XMOQ 2PYKA 3DWPA 1ESRA 4QCLA 2ZM6Q 4A3GB 2R7DA 4POGA 4IO9A 3MZ5A 5A35A 3JAMc 4A3GG 1IHZA 5EKLA 2R93B 1IKMA 4Y7NB 3OHXC 5LMNQ 2R93G 3F1ZA 3I4LA 4GKKQ 1WTWA 3NXWA 1E7ZA 4DR5L 5M5XH 5K36H 1WI5A 1EL0A 1C0AA 2CH4W 3CMAA 4DV2L 5IIFA 1X54A 1EIHA 2AQ3B 4A3EH 2FMMA 1E2VA 1XNRQ 2WAQE 4RWSC 5IGCA 2QEXA 2QGQA 3M9BA 4B3MQ 4ZCKA 1VQEA 4JI1L 3BYYB 1M1KC 1WTRA 3LX0A 1EEID 4RCNA 2ZXPA 1ICFB 1TQOA 1HR0Q 1RTNA 3KK7A 4K14A 5KNDA 2R7ZB 4NXNL 3DLLA 1IKLA 1TWFB 2XSCA 3CPWA 3K5LA 2R7ZG 3O13A 3NWSA 3HOXH 3DWAA 4DV5L 3J7A5 1ILPA 4BA1I 2KCTA 2RVLA 2E74C 4PMBA 4PZ7A 5M5YH 1F9RA 1WD1A 1K8MA 2E5LQ 2EXDA 4TVAB 3H3VC 3S17B 1EEFD 1ENFA 3T13A 4JI8Q 3CC7A 4ID6A 4DR7L 5BN3A 2AWOA 4X62L 3S14B 4KJOA 2OF1A 3KJPA 5TSSA 5EPLA 4HAEA 3S1RB 1VQAA 1AZQA 1II3A 4RKBA 5CV9A 3A5ZB 1PTOD 3N6RA 4A3BH 5KRUA 3MXPA 3UDGA 3ZJYC 5JVG3 2Z9HA 2SEBD 4OX9Q 4EQ5A 3J81j 2LMCB 1UAPA 2R7FA 4XQQA 3G6EA 2QILA 3A8IE 4RMFA 5T1IA 1C4QA 1TS3A 1PTOF 1FR3A 2KHSA 1BDOA 1RF2D 2Q8RE 1QNUA 2C5CA 5IGBA 3SGIA 5K5PA 2MO0A 2QKIC 4JI7Q 4CJ0B 3CC2A 1D1IA 1WCMB 3AU7A 4WJ4A 2CWAA 1WCMG 2WAQB 3STBD 2F0LA 3I56A 4DA2A 3W2DA 4A75A 2WAQG 3CCEA 2GVAA 1HA6A 2UUAL 4A3GH 4CDDC 4X66Q 4XIGS 4DR1Q 1Y8PB 2R93H 4Y7NH 3EIVA 2EJMA 1VQOA 4HEDA 2JA5B 3K59A 4KHVA 3P7JA 3X3NA 3MC0B 3NQIA 2JA5G 2KECA 3IAYA 3MEHA 1D6EC 3S1QB 1L0WA 3E6ZX 2NN6G 4K2KA 2ZTEA 2I07B 2Q2HA 3PUVA 1EWIA 1IXRA 4MHEA 4JYAL 1S72A 1ET9A 3KLSA 4P2CB 1YNNC 3MEFA 2XN9C 2KJXA 2ALYB 1A2UA 1LTAD 2I5MX 4HJAA 2VL6A 4O42A 2VZAA 4CJ1B 4A3IB 1H9KA 3ER0A 1K8GA 1HA5A 1EOTA 4L8JA 4A3IG 2R7ZH 4JI2L 1FGUA 3UDFA 1TWFH 3KBGA 4HMIA 5CV7A 2D0OA 4UAIA 5JJZA 1X3PA 2VQFL 2K6AA 3RMHA 1QNKA 3SK4A 3NSWA 1CSQA 1ENCA 3VA7A 1WD0A 4UDUC 3HKSA 4JI5Q 4ZUIA 1M4VA 2Z8LA 4XXEA 4DR5Q 3S17H 3ULJA 4R4QA 1CZWA 3K5MA 1TS4A 2QF7A 4YWKA 1YVCA 1Q82C 3S14H 5EGTA 3S1RH 3JC66 5CV8A 2Q8IB 4DV2Q 4KK7A 4DK3C 4X65Q 4K8IA 2QW7A 2XNAC 1IL8A 3J80E 2B2YC 1HFGA 2K03A 4GN3B 1XXGA 3ONAB 3H3VI 4DAYB 3FRPB 1SROA 1CA5A 1WVLA 1K8OA 1B9MA 1RKNA 3TP5A 4JI1Q 2K32A 3PV0A 1K9MC 1PZKD 4KI0A 2B2TC 1IW7D 1Y8NB 4R4TA
chains in the Genus database with same CATH topology
3I91A 3BVMA 4HCSA 2NTTA 3WDNA 1PFBA 2Q8TA 4XQNA 1STAA 1EY6A 4KN4C 4C3JB 2FFKB 1SNMA 2LS01 5JOBA 1LTGD 4C3JG 5LHY1 3PO2B 1U4PA 4RGNA 4DN4M 4DU9A 5ELEA 1FNUA 2DN8A 5I6WA 2MJ8A 1LT3D 1O78A 2L5TA 4F88A 2B63B 4TRDA 4K8JA 5C3WA 3DWQA 2NN6H 2EYOA 3CU7A 4KJNA 1YNJC 1TKWB 2L12A 4ZKBB 3ERQA 2NVQB 1QOHA 2EJFC 3D4RA 2C9OA 1CHQD 1ZXTA 3M7GA 4X3UA 1V1OA 3EJIA 2EYMA 3BZDB 2PNRC 3D4DA 4DAVA 3CKIB 3TSSA 4PNYA 2CQAA 2DNEA 1E0BA 2RSNA 4E6IA 1GOZA 3T53B 4KMUC 1D5MC 1TY0A 2NVTB 5CYUA 4HCEA 1GUWA 3G7LA 1TWGB 3RZOB 2A6EC 4F87A 4DXFA 4IFDJ 1SNQA 1AZPA 4XQJA 2ID0A 3DM1A 3L3OC 1GXDC 3NQTA 4OO1G 4RGMA 1EYDA 1CI3M 2VB3X 5E4XA 3K5NA 1A3UA 4H44C 4WJWA 3R3OA 4DF7A 3J81L 3J7AF 3QG1A 2WINB 2EXZA 4PV1C 3FPPA 1TWCB 3DEPA 3PIO3 3HOZB 1J9OA 1I4PA 1EY0A 1IYUA 4J1MA 4N9TA 3CRLC 5KIXA 2NBFA 2TSSA 2RBMA 4A3FB 2IPKD 3HZXA 2B2YA 4ME5A 4I7ZC 5FKAC 3JAML 2FMCA 1BO0A 1R4QB 2FJ2A 2PW7A 1SNPA 3Q24A 4KKTA 1U4MA 4K6DA 2F0GA 2D2CC 2L1BA 1LACA 2EOTA 2O5JC 1SEBD 1VDZA 1D5XC 1KAAA 2E2HB 4DAYA 2K04A 4ULLA 3R2IA 2JA8B 4XTCS 4U673 2JA6B 2E2IB 1GUSA 2IW3A 2RQXA 3QB3A 2KCCA 1STHA 4OO1H 3GTKB 1QCBD 4KY5A 1AW7A 2F0TA 1S5FD 1S5DD 2AUJD 1OXUA 4C3HB 1JE4A 1AEXA 3I73A 3C3LA 4K5XA 4ABNA 1MI2A 2XIWA 4C3HG 3C2PA 2OT2A 1ZEQX 1G2TA 2F0PA 1U4RA 2KVMA 4EQNA 1GUTA 1JOOA 4KTAA 2PO4A 5M5WB 3QOJA 1S5BD 1BBXC 1GJXA 3J7YW 2O5IC 2IWHA 1KDCA 2FINB 5HURA 2L9HA 3R93A 3PUZA 2M2LA 1KDAA 1DD2A 1QE6A 2EYPA 2L0CA 2PZWA 5I9OA 3HOYB 2F03A 2F0WA 1V43A 1EYCA 3CHBD 3G6JB 2EZVA 2F0NA 4H13C 5JAVA 4FYDA 2WKCA 2E76C 1LT5D 5E4WC 1B1ZA 2EY6A 4FXDA 3GO5A 3TP6A 4HSVA 1SXTA 5CV6A 1TS5A 4HSPA 1SYGA 1K83B 1JB3A 1DONA 2B2VA 3TBIB 2E75C 3BG3A 1GUNA 4JK1C 1U9RA 2HUGA 2LFNA 3MXGA 4RAUC 1AFPA 3IL8A 1O7LA 5J1ZA 2B39A 5KEEA 1Q1EA 1Q90A 3TMEA 1EWCA 3WOFA 5IGFA 1KLUD 1FNWA 4QMGA 1NAPA 2J4XA 2PPBC 4FO2A 3GTLB 5KGUA 4H0LC 4U68A 1CM9A 1SJHD 5JEAJ 1VMPA 2BA0A 3TP8A 5DNFA 4RHRA 1EY4A 1D2BA 2KEDA 2F0FA 1XYIA 5EJWA 1PRTC 5FLXL 1J8IA 1OXTA 1DZ1A 3E5SA 1G2SA 1SAPA 1RDPD 1EY8A 2J0TD 2SDFA 1SDFA 1F2ZA 1BQQT 3OWFA 1LT6D 1A15A 4CKCA 3SDZA 5CBAE 2D5DA 4CJ2C 2F0QA 5CR3A 1XWEA 3NWTA 3A54A 3K58A 2F0JA 2JEBI 4L63B 5ELDA 2L4NA 4EQOA 1LT4D 3OPOA 4C3IB 1I6HB 5F2DA 2WACA 3H6MA 4V190 1PYWD 3K5OA 3BDOA 4C3IG 5HGTA 4HN7A 3A8JE 3RZDB 1B9NA 5KNBA 4YIJA 4C1NK 2R3ZA 5COYA 4M8AA 1TS2A 4GZYC 4C1NI 2JSOA 2KOLA 1PTOB 1CT1D 3A7AB 2F0DA 3MTSA 2YYZA 3D6CA 1H9MA 2HDMA 4K6LA 4J6HA 1O7YA 3R2TA 2V4DA 1SYCA 1I4QA 1W6JA 1HUNA 3HOWB 5CGKA 1CTMA 1LABA 1JOQA 3GTPB 4K5WA 5KYLA 1KTKA 1IYVA 3P75A 1L0XB 1A3TA 4R9WA 1TR5A 1F2MA 1H9RA 3GTJB 1KNAA 2JEAI 3VA5A 2K1BA 3PMFA 4FNFA 1JC7A 2OEOA 1QILA 1LTBD 2L55A 3IFTA 2BDNA 5A2QE 5G3LD 1U4LA 4KY7A 3MA2B 1PDQA 3BVZA 4DFAA 4N9PA 3J7AV 5ELFA 5G3LF 1I4XA 1RD9D 2E2DC 1FYCA 3CRKC 1BXTA 4RHSA 1H9SB 1HTLD 3I90A 4DXGA 2K28A 4OL7A 3P20A 2A74C 2RDHA 5C4ZA 3T51B 1MD2D 1LTID 2EPBA 3D4WA 3VYSA 4J8QA 1A6XA 2Y0SB 4TSSA 3Q0AA 2SNSA 2K05A 2NVXB 1SBBB 3MVVA 4NP5A 1PTOH 2N88A 3K0YA 5C3XA 4G7ZC 5C0XI 3HP3A 4DNRB 1DJRD 5D14A 1CZGA 2Z4HA 2A6HD 3BDLA 3RD4A 4ZK9B 1BNZA 4IUTA 1RCVD 1SNCA 2NTSA 2XRSD 1TU2B 1CFMA 1SYBA 1CK1A 1A2TA 2RDFA 4R8NA 2K01A 1TT2A 1YNJD 5M3FB 4NDXA 4DK0A 2F1MA 5LL6X 1I6VC 4KN7C 3HOVB 4CBVA 5T1GA 1EFID 1TWAB 3FPUB 1C8CA 1CQFA 3UI2A 3PUWA 3C1FA 3BYTB 2JP1A 3IFDA 2M9VA 2QCPX 2BCOA 1L0YB 1WTOA 5IODA 5NUCA 2NN6I 2QDBA 3NP8A 3GTGB 3KLRA 1BCPD 3NPPA 2O4XA 2IX0A 3TP7A 2AQ1B 1EY5A 1JICA 1TY2A 3I4MB 4HMJA 1H9JA 3E0JA 3M85A 1BCPF 1I3QB 1M8AA 3SR1A 4ILWA 2PW5A 3NTIA 2B8GA 3AB9A 1Y8OB 1WTVA 3W3AA 1LLRD 3OWEB 2F0VA 2KEEA 1B4OA 3SK6A 2D9UA 1SNDA 2F0EA 4EGVA 5J22A 2SOBA 1JOKA 4O1NA 4RGOS 2DNCA 2F0MA 3VR6A 4XT1B 3ZYYX 2B2VC 2BDOA 1RJTA 1RODA 5EKIA 4KKUA 1DOMA 1B44D 4NKLA 3WOEA 4OIKA 4A3DB 1QJOA 3P1HA 3TN2A 1S5ED 2CHBD 3BS1A 5FO9B 4I65A 1ICWA 5CMDA 1XX8A 4OGQC 1KDBA 2VUMB 1Z47A 3J80L 2DY8A 3MXUA 4RH6A 4IFDG 3PO3B 5IT9E 1G6ZA 3H91A 1B2TA 3K57A 1MSGA 2XRQD 3BVGA 2OXPA 1Y69U 1X32A 4ZQ3A 1Z6HA 3DXJC 4X3TA 3QO2A 3OIQA 3M3YB 1Q3LA 5EPKA 2A68D 3GQBA 1G291 2SNMA 4RKLA 1JR0D 1MGSA 5C3EB 2X6LA 3QJYA 4R8IA 1JQYD 3EQLC 3VR3A 1BOSA 1RHPA 2AQ2B 2CW0C 1Z7TA 1I4GA 3SXHA 3AMUA 2F0HA 3FMCA 2MPMA 3MAQA 1ZKOA 3F2UA 1SYDA 2TMPA 3NBIA 1CA6A 3I3CA 2F0KA 1ZYRD 4OO1I 3L9AX 5I6YA 4G4KA 2EE1A 1EWHA 4DAPA 1C48A 2X69A 2WV6D 2G9DA 5EKKA 3I8ZA 1JWMD 3RUZA 3A7LA 3EA6A 1F9PA 2HDLA 3DHQA 2MUYA 3LNNA 3X3MA 1S4ZA 1BR9A 1KABA 3OIPA 1R4PB 2A69D 5D3DA 4IFDH 4Q0FA 1SMYD 4IUUA 4PMCA 1UUPA 4ODGA 1O80A 2PZTA 2HCCA 2AUKA 2WKDA 2BE5D 4H7BA 3GTQB 4L6TB 4FVMA 4LAAA 3H0GB 2EY5A 4XYQA 5EBDA 4Q5VA 2JA7B 3QWNA 3S1NB 4KD3A 1T5XD 2NVYB 3MFGA 4A3JB 1Q1BA 5CBEE 4KKSA 3IKJA 1EU3A 1WTQA 2MGSA 3V2TA 2LKVA 3MXNA 1HCZA 3A55A 3V05A 1I50B 4IUVA 5EQ0A 4MN3A 5LL6S 4FF2A 2EYFA 1SYEA 5FOBB 1G91A 3MWYW 3S2HB 3GP7A 3ND9A 3VR4A 5DEHA 5E1FA 5BN4A 2EY1A 5C0XJ 1UEAB 5IT9L 5I2XA 5IOCA 1EY7A 1F9QA 2ICIA 4ZLTF 3S1MB 4MIUA 5IGGA 4C2MB 5M3MB 2R92B 1V1PB 3TZUA 5C6AA 4FF4A 5C4HA 1LV9A 1EQVA 1HXYD 4FXKC 3Q23A 4KV6A 1PRTF 3DEOA 4CHTB 4NW2A 1DOKA 4KHZA 1SJED 3T56B 4IN3A 1SE2A 5D3IB 1KNEA 1JWSD 3C1EA 4WFN3 3D6WA 4BBRB 2B8FA 2YU9B 3M4YA 4DGZA 3OW7A 1HUMA 1STEA 5I2YA 5DAUA 2VXWA 3C46A 1JORA 1DM0B 3GTOB 2J7ZA 2F0IA 1NR4A 1BF4A 3FKIB 4JBWA 1HQRD 1EYAA 1ET6A 1NSNS 1TIID 1PZID 3SEBA 2MHVA 5JEAG 5C0XG 4RFBA 2K7VA 2A73B 3U9SA 3V96A 1DCZA 3R8BA 1G8ZD 4AYBB 5C5MA 1NCVA 5IGEA 1Y1VB 3HOUB 1OXXK 3PUXA 4PMWA 2F3WA 4PQXA 4FXGC 1PTOC 3ND8A 2PZUA 4A93B 1X3QA 1GHKA 4IUPA 2LY7A 3HEJA 4TQUS 1S5CD 3VR2A 2IL8A 4IURA 1FD7D 4A3KB 3HGBA 1TVXA 4DK1A 4KD4A 3RLFA 1YNND 1D5ZC 2Z4IA 2EYHA 1EZ6A 2IJ0A 4QUFA 1E2ZA 4BWGB 2M00A 3NHHA 1JWUD 1W6KA 2BOSA 2EYJA 1F9SA 5C5LA 1HQMC 4B9WA 3SVMA 3BDCA 2AWNA 2ENBA 5CC4A 3KBXA 1PXUA 4ZAIA 3U9OA 3J81E 4BA2I 1EQTA 3GV6A 2PMZB 2R61A 1PZJD 1B3AA 1AP0A 3LWUA 1GUGA 2KCNA 3GTMB 5CV5A 1STBA 3HRZC 2HQEA 1D1KA 4B08A 4F8MA 3DUZA 5JEAH 5C0XH 4FF1A 2QEJC 3KLSX 3M4OB 2L11A 1V1PA 4EQPA 2EJGC 4BBSB 1KLGD 2VB2X 4TKOB 1Q12A 4RGTA 3JAME 4ZRZA 3S16B 3VYTA 2K5WA 2ZXOA 1TWHB 3I70A 2NYZD 1DYQA 5C4JB 1F2YA 3FVQA 2PQEA 3EVQA 1LTSD 3OMCA 5JVH3 1V8QA 2KUMA 2R6GA 3OMGA 2HCIA 1QG7A 5AFWA 1OXSC 1WTPA 1STGA 1IW7C 2A6HC 2B2WC 1VF7A 2WIIB 4CKBA 1F77A 3VYUA 2EVBA 1MSHA 4G7HC 5JPNC 2N55A 3CQZB 4BY7B 3H09A 3S2DB 2RA4A 4OIJA 5EBCA 1HPCA 4QIWB 1I4RA 2O2LD 1B50A 4XYOA 3SE0A 2RDGA 2E2JB 4QB4A 4K2LA 1BUVT 2A6ED 2IX3A 4WRDA 2K5QA 3OOCA 3S9WA 3ITPA 3HKZB 1ILQA 3D8GA 4A3MB 4QUCA 1NUCA 4KY6A 3PIP3 1BCPB 2GA4B 2XWJB 1Q8IA 2F0SA 2B2UC 3Q6SA 2EY2A 2NUCA 2K33A 1SFOB 1SSOA 5EPJA 2JYOA 5ISRA 4QF4A 1OXVA 5A2QL 2RSOA 1BCPC 2IT1A 2KQ3A 4IUQA 1RTOA 4BY1B 3I72A 4RCOA 4ZYSA 4HTHA 1VCIA 4EVOA 3M7NA 2RKSA 2IX1A 1WTXA 1ESFA 1FGBD 4HR7B 1EY9A 2PCFB 4OHJA 4XT3B 3OSOA 1SNOA 2G9HD 2K5DA 1GHJA 1DXMA 4X3SA 1H9SA 4DNTB 4FF3A 3PUYA 5IGDA 1HHVA 1SE3A 2CVRA 1QWYA 2DY7A 2Z1CA 4CGYB 4G7OC 5I4DA 2ICEC 3S15B 3EROA 3KUPA 1HFNA 1CHPD 5JPMC 5M9OA 5C44B 3DMUA 3K7AB 4CKEA 1VF5C 3HS0C 2B2TA 3QIAA 2MP1A 3VR5A 1HTPA 1R9TB 1E2WA 3GD7A 5KYIA 1GUOA 3SK5A 3SHLA 1STNA 3HG9A 2F3VA 1OO9B 2H1EA 3A8KE 5FO8B 1AN8A 2B2WA 2CW0D 3SK8A 4IUNA 5FLXE 2A5HA 2EDGA 2F0UA 3NUCA 3L7ZC 4V0BA 3LWEA 2XVSA 1ML0D 1UNSA 2X6GA 2EYLA 3KF8A 1Y1WB 3NK9A 3I4NB 1ONLA 1STYA 4K5VA 2A68C 4NMZA 4XDXA 3NBHA 5FK9C 4Z9CB 5E3FA 5C4XB 3TZDA 1LTTD 1CQVA 5J39A 1PFNA 1NR2A 1ENAA 2JXMB 5BN5A 3TDQA 3T4AC 2VNUD 2NZ1D 2WP8J 2ZT9C 3URYA 2BA1A 3VYRA 4LJZC 3H94A 3NTKA 2WB1B 2F4IA 2NWGA 4G57A 4ZKCB 2B2UA 4FP5D 4S3SA 1QB5D 1I4HA 4X3KA 2NB0A 3MFYA 1ZYRC 3D31A 4BS9A 5ELBA 1A3VA 2ZXRA 1JCKB 1MBYA 4LMQD 5M5XB 1B53A 4C56C 5CORA 5K36G 1XTCD 1SYFA 1EU4A 1PFMA 4ZUJA 4A3EB 4IZ8A 2F0OA 2KA7A 5I9PA 3NE5B 5DM73 1O7ZA 3N52A 2A69C 3GV3A 4IQZA 3A56A 2H4OA 3K6OA 1LO5D 3FDTA 1LTRD 1SMYC 1EZ8A 2XWBB 3T16A 4WORA 3D3RA 4IFDI 1HRJA 5DM63 1PMRA 1T5EA 3HOXB 4F7XA 2BE5C 1FNVA 2I46A 4RA8A 5M5YB 1EIGA 1DOLA 5KNCA 3NTHA 4IALA 1F2LA 1PLFA 5ELCA 4A3BB 5FO7B 3Q22A 2JE6I 5CV4A 3FEWX 5D65A 1PRTD 1VMCA 3QOLA 3EFXD 4LK1C 4M1UB 3MHBA 2FHTA 1PRTB 1SE4A 4B9XA 2D62A 2PYKA 3DWPA 1ESRA 4QCLA 4A3GB 3MZ5A 5A35A 1IHZA 5EKLA 2R93B 1IKMA 4Y7NB 3OHXC 3I4LA 1WTWA 3NXWA 5K36H 1EL0A 5IIFA 1EIHA 2AQ3B 2FMMA 1E2VA 4RWSC 5IGCA 3BYYB 1WTRA 3LX0A 1EEID 4RCNA 2ZXPA 1TQOA 1RTNA 3KK7A 4K14A 5KNDA 2R7ZB 1IKLA 1TWFB 2XSCA 3K5LA 3O13A 3NWSA 3DWAA 1ILPA 4BA1I 2RVLA 2E74C 4PMBA 1F9RA 1WD1A 1K8MA 3H3VC 3S17B 1EEFD 1ENFA 3T13A 4ID6A 5BN3A 2AWOA 3S14B 4KJOA 2OF1A 5TSSA 5EPLA 4HAEA 3S1RB 1AZQA 1II3A 4RKBA 5CV9A 1PTOD 3N6RA 5KRUA 3MXPA 5JVG3 2SEBD 2LMCB 1UAPA 4XQQA 2QILA 3A8IE 5T1IA 1C4QA 1TS3A 1PTOF 1FR3A 2KHSA 1BDOA 1RF2D 2Q8RE 1QNUA 2C5CA 5IGBA 5K5PA 2QKIC 4CJ0B 1D1IA 1WCMB 3AU7A 2WAQB 2F0LA 4DA2A 3W2DA 1HA6A 4XIGS 1Y8PB 2EJMA 2JA5B 4HEDA 3K59A 4KHVA 3P7JA 3X3NA 3MC0B 3NQIA 2KECA 3IAYA 3MEHA 1D6EC 3S1QB 3E6ZX 2NN6G 4K2KA 2I07B 3PUVA 4MHEA 1ET9A 3KLSA 4P2CB 1YNNC 2XN9C 2KJXA 1A2UA 1LTAD 4O42A 4CJ1B 4A3IB 1H9KA 1HA5A 1EOTA 4L8JA 3KBGA 4HMIA 5CV7A 4UAIA 5JJZA 1X3PA 2K6AA 3RMHA 1QNKA 3SK4A 1ENCA 3NSWA 3VA7A 1WD0A 4UDUC 4ZUIA 1M4VA 2Z8LA 4XXEA 1CZWA 3K5MA 1TS4A 2QF7A 5EGTA 5CV8A 2Q8IB 4KK7A 4K8IA 2XNAC 1IL8A 3J80E 2B2YC 1HFGA 2K03A 1XXGA 3ONAB 3FRPB 1CA5A 1WVLA 1K8OA 1B9MA 1RKNA 3TP5A 2K32A 3PV0A 1PZKD 4KI0A 2B2TC 1IW7D 1Y8NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD4 A;  2L0C A; 
#chains in the Genus database with same CATH topology
 1CKM A;  1V9P A;  5FLX c;  3I91 A;  3BVM A;  3BZC A;  4DAM A;  4HCS A;  4GOP B;  2NTT A;  1WCM H;  4GLV B;  3WDN A;  4NXN Q;  2DJG C;  2UXC L;  1PFB A;  1DGS A;  2Q8T A;  4XQN A;  1STA A;  1EY6 A;  4KN4 C;  4C3J B;  2FFK B;  4DV5 Q;  1SNM A;  2LS0 1;  5JOB A;  1LTG D;  4C3J G;  5LHY 1;  3PO2 B;  1U4P A;  4RGN A;  4DN4 M;  4DU9 A;  3PO2 G;  4DR7 Q;  5ELE A;  3RR5 A;  4X62 Q;  2LSS A;  1FNU A;  2DN8 A;  5I6W A;  2MJ8 A;  2JA5 H;  1LT3 D;  1O78 A;  1IYJ B;  2L5T A;  4GOP C;  4F88 A;  2B63 B;  4TRD A;  1VQC A;  2CKZ B;  4K8J A;  5C3W A;  3DWQ A;  2NN6 H;  2B63 G;  2EYO A;  1NBW A;  4R4C A;  3S1Q H;  3CU7 A;  4JPB W;  4KJN A;  1YNJ C;  1TKW B;  1T9H A;  2L12 A;  4ZKB B;  3ERQ A;  2NVQ B;  1QOH A;  2EJF C;  3D4R A;  2C9O A;  1CHQ D;  1ZXT A;  5LMN W;  3M7G A;  2YTY A;  4X3U A;  1V1O A;  3EJI A;  4GLA C;  1KD1 C;  2EYM A;  3BZD B;  2PNR C;  3D4D A;  4DAV A;  3CKI B;  4JVZ A;  3TSS A;  4DV4 L;  4PNY A;  2CQA A;  4GNX B;  1KQS A;  4A3I H;  2UUA Q;  2DNE A;  1E0B A;  5IE8 A;  2RSN A;  1XMQ L;  4E6I A;  1GOZ A;  3T53 B;  4KMU C;  1D5M C;  1TY0 A;  1YEZ A;  2JQO A;  3KJO A;  3I7F A;  3PQI A;  3J7Z C;  2NVT B;  5CYU A;  4HCE A;  1GUW A;  1N34 L;  3G7L A;  2CH4 A;  1TWG B;  3RZO B;  2A6E C;  4F87 A;  4DXF A;  4IFD J;  1SNQ A;  1N33 Q;  1AZP A;  1VQB A;  1SRU A;  4XQJ A;  2ID0 A;  3DM1 A;  1J6Q A;  3L3O C;  4GNX C;  3S24 A;  1G51 A;  1GXD C;  3NQT A;  4OO1 G;  4JYA Q;  5AJ3 L;  4DUZ L;  1L1O B;  2HIX A;  4RGM A;  4CDE C;  1EYD A;  1Q7Y C;  1CI3 M;  2VB3 X;  3TQY A;  5E4X A;  3K5N A;  1A3U A;  1FL0 A;  4H44 C;  1X3E A;  4WJW A;  3R3O A;  2OTL A;  4DF7 A;  3J81 L;  3J7A F;  3QG1 A;  4QQB X;  2BH8 A;  2WIN B;  2EXZ A;  4PV1 C;  3W5O A;  3FPP A;  1TWC B;  2HHH L;  4PZ8 A;  4P74 A;  4C3J H;  3DEP A;  1PFS A;  3PIO 3;  3PO2 H;  3HOZ B;  2I5H A;  1J9O A;  1JB7 A;  1I4P A;  1EY0 A;  3HOZ G;  4X64 Q;  1IYU A;  4J1M A;  4N9T A;  3CRL C;  3ULP A;  5KIX A;  2NBF A;  2TSS A;  2RBM A;  2B63 H;  4A3F B;  2IPK D;  4IPD A;  3HZX A;  4A3F G;  2B2Y A;  3PGZ A;  4ME5 A;  4I7Z C;  5FKA C;  2F4V L;  4MTN A;  5JJI A;  3JAM L;  2FMC A;  1BO0 A;  1R4Q B;  3FHW A;  2FJ2 A;  2PW7 A;  1UEB A;  1SNP A;  5GQO A;  3Q24 A;  2EIF A;  4KKT A;  1U4M A;  4K6D A;  2UXC Q;  2F0G A;  2ZTC A;  2D2C C;  2L1B A;  1LAC A;  1A62 A;  2EOT A;  2O5J C;  1SEB D;  1VDZ A;  2KHJ A;  2K14 A;  1D5X C;  1KAA A;  1JJ2 A;  2E2H B;  4DAY A;  2K04 A;  4IJH A;  4ULL A;  1YI2 A;  3VDY A;  1MHW C;  3R2I A;  2JA8 B;  4A3L G;  4XTC S;  4U67 3;  1IBK L;  2NVT H;  2JA6 B;  2CQO A;  2JA8 G;  2E2I B;  4YCV A;  1TWG H;  1UE5 A;  3RZO H;  2Z6K C;  1GUS A;  2JA6 G;  2IW3 A;  2RQX A;  3CCM A;  3QB3 A;  2KCC A;  4GOP A;  1XJV A;  1STH A;  4OO1 H;  3CPF A;  4HJ8 A;  1JMC A;  3GTK B;  2CCZ A;  1PH5 A;  1QCB D;  4KY5 A;  1AW7 A;  2F0T A;  1S5F D;  1S5D D;  2AUJ D;  5E7N A;  1OXU A;  1QZG A;  4C3H B;  1JE4 A;  1AEX A;  1I5F A;  3I73 A;  3CCJ A;  3C3L A;  1BBW A;  4K5X A;  4ABN A;  1MI2 A;  2XIW A;  4C3H G;  3CCU A;  4DV4 Q;  4MTK A;  3C2P A;  2OT2 A;  2XTI A;  4JW0 A;  1ZEQ X;  1G2T A;  2F0P A;  1U4R A;  2KVM A;  4EQN A;  1GUT A;  1JOO A;  4JC0 A;  1XMQ Q;  4KTA A;  2PO4 A;  5M5W B;  3QOJ A;  1S5B D;  1BBX C;  1TWC H;  4LFC L;  1GJX A;  3J7Y W;  2O5I C;  3TRZ A;  2IWH A;  1KDC A;  1N34 Q;  2FIN B;  5HUR A;  2L9H A;  1E22 A;  3HOZ H;  4A76 A;  3R93 A;  3PUZ A;  2M2L A;  1KDA A;  1PH2 A;  1DD2 A;  1YZ6 A;  1QE6 A;  2EYP A;  2L0C A;  2PZW A;  5I9O A;  4GNX A;  3HOY B;  4A3F H;  5AJ3 Q;  4DUZ Q;  2F03 A;  3HOY G;  2E8G A;  2F0W A;  1X3F A;  1V43 A;  4Y52 H;  1JT8 A;  2ZJQ A;  1EYC A;  3CHB D;  3G6J B;  4DR4 L;  2OQK A;  4JI0 L;  2EZV A;  2H5X A;  4MNO A;  2F0N A;  4H13 C;  3M4Q A;  3KDF B;  5JAV A;  4B3R Q;  4FYD A;  2WKC A;  2E76 C;  1LT5 D;  4HJ7 A;  5E4W C;  1B1Z A;  4LF9 L;  2EY6 A;  2HHH Q;  4FXD A;  3GO5 A;  3TP6 A;  4HSV A;  1SXT A;  2E2H H;  1L1O A;  5CV6 A;  2OCE A;  1TS5 A;  4A3L H;  4HSP A;  1SYG A;  1K83 B;  1JB3 A;  5IY0 A;  2JA8 H;  1GVP A;  1DON A;  2B2V A;  2PI2 A;  1PYS B;  3G48 A;  4LF6 Q;  2JA6 H;  2ATW A;  2E2I H;  3TBI B;  2E75 C;  3BG3 A;  1GUN A;  1SMX A;  5EAY A;  4JK1 C;  1U9R A;  2HUG A;  3F8T A;  3J81 c;  2LFN A;  2G5D A;  1RIP A;  3MXG A;  4RAU C;  2F4V Q;  1AFP A;  3IL8 A;  1O7L A;  5J1Z A;  4DV7 L;  3GTK H;  2OTJ A;  1CUK A;  2B39 A;  5KEE A;  4DK6 C;  1Q1E A;  1QZH A;  1Q90 A;  3TME A;  4HIO A;  1EWC A;  3WOF A;  4C3H H;  2ASB A;  3AYH B;  2IHE A;  5IGF A;  1KLU D;  1FNW A;  4QMG A;  1K8A C;  4IJL A;  1NAP A;  1IBL L;  2J4X A;  2PPB C;  5ELN A;  1HNW L;  5HY6 A;  2PQA A;  1A63 A;  4FO2 A;  1MJC A;  1X65 A;  3GTL B;  5KGU A;  4H0L C;  4U68 A;  1CM9 A;  5M5W H;  1SJH D;  5JEA J;  1WFQ A;  1VMP A;  2BA0 A;  3TP8 A;  1IBK Q;  5DNF A;  4RHR A;  4JI3 Q;  1EY4 A;  1IZ6 A;  4GKJ L;  4KHP L;  1D2B A;  2KED A;  2F0F A;  3J80 c;  4ALP A;  2Z6K A;  1XYI A;  5EJW A;  1PRT C;  5FLX L;  1J8I A;  1NTG A;  1OXT A;  4OWX B;  1DZ1 A;  3E5S A;  1G2S A;  3HOY H;  5IWA L;  1SAP A;  1EYG A;  1RDP D;  1EY8 A;  2J0T D;  2SDF A;  1SDF A;  5DLQ E;  1F2Z A;  1BQQ T;  3OWF A;  4HID A;  2IHF A;  1LT6 D;  1A15 A;  4CKC A;  5JJK A;  3SDZ A;  4J15 A;  4IPH A;  2JN4 A;  5CBA E;  2D5D A;  2F0Q A;  4CJ2 C;  5CR3 A;  3E0E A;  1K28 A;  1XWE A;  3NWT A;  3KF6 B;  3A54 A;  1BKB A;  3K58 A;  2F0J A;  2JEB I;  4GN4 B;  4L63 B;  2K5H A;  4UP9 A;  5ELD A;  2L4N A;  4EQO A;  1LT4 D;  3OPO A;  4C3I B;  1I6H B;  1K83 H;  5F2D A;  2WAC A;  3H6M A;  4V19 0;  1PYW D;  3K81 C;  3K5O A;  4JG2 A;  2Q2U A;  3BDO A;  4C3I G;  1VQN A;  5HGT A;  4HN7 A;  3A8J E;  3RZD B;  4AQY L;  1B9N A;  1XTD A;  1ASY A;  5KNB A;  1K0S A;  4YIJ A;  2LXK A;  2HQL A;  1IL2 A;  4C1N K;  2R3Z A;  4YWL A;  5COY A;  1VQI A;  1TS2 A;  4M8A A;  4DR4 Q;  4GZY C;  1HJP A;  4C1N I;  1P8L A;  2JSO A;  1KC8 C;  2AHO B;  2KOL A;  1FVI A;  4POF A;  4JBJ A;  3CC4 A;  1PTO B;  4IPC A;  1CT1 D;  3A7A B;  2F0D A;  2RF4 A;  3MTS A;  2YYZ A;  4LF9 Q;  3D6C A;  3DM3 A;  1H9M A;  1VQJ A;  2HD3 A;  2HDM A;  4K6L A;  1Q86 C;  4J6H A;  1O7Y A;  3GTL H;  4LFB L;  3R2T A;  2V4D A;  1SYC A;  1I4Q A;  1VQF A;  1W6J A;  1HUN A;  3HOW B;  3W1G A;  5CGK A;  1CTM A;  1LAB A;  2MFI A;  5GAE C;  1JOQ A;  1I94 L;  3GTP B;  3HOW G;  4K5W A;  5KYL A;  1KTK A;  1IYV A;  1NE3 A;  2Y0S E;  3P75 A;  1L0X B;  1YJN A;  1A3T A;  3KDF A;  3CCS A;  2KEN A;  1IBM L;  3F2D A;  1EOV A;  4R9W A;  1TR5 A;  1F2M A;  4B3S L;  1QVG A;  3A0J A;  1H9R A;  4DV7 Q;  1LYL A;  1PHJ A;  3GTJ B;  1KNA A;  2JEA I;  5BR8 L;  3VA5 A;  2K1B A;  3PMF A;  4DR2 L;  1J5E L;  4FNF A;  1JC7 A;  2OEO A;  3STB C;  1QIL A;  1LTB D;  2L55 A;  3IFT A;  5GAD C;  4UHV A;  2BDN A;  5A2Q E;  1WYD A;  3T1H L;  1IBL Q;  5G3L D;  1U4L A;  1HNW Q;  3RN5 A;  1YHA A;  4KY7 A;  3MA2 B;  1PDQ A;  3BVZ A;  4DFA A;  4N9P A;  2AMC B;  3J7A V;  5ELF A;  2MO1 A;  3AFQ A;  5G3L F;  4DV1 L;  1I4X A;  1RD9 D;  2E2D C;  1FYC A;  3CRK C;  2ZJR A;  4GKJ Q;  4KHP Q;  1BXT A;  4RHS A;  1H9S B;  1HTL D;  3I90 A;  4DXG A;  2K28 A;  4C3I H;  1I6H H;  2VQE L;  4OL7 A;  3P20 A;  1HNX L;  2A74 C;  2RDH A;  1VQG A;  5C4Z A;  5H1S E;  3T51 B;  3RZD H;  4YWM A;  5IWA Q;  1MD2 D;  1C9O A;  1LTI D;  2EPB A;  3D4W A;  3FP9 A;  3PCO B;  3VYS A;  4J8Q A;  1A6X A;  3AFP A;  2Y0S B;  4TSS A;  2OQ0 A;  3Q0A A;  2SNS A;  2K05 A;  1YNX A;  3GDE A;  2Y0S G;  1G6P A;  2ZTD A;  2NVX B;  2EQS A;  4BXX G;  4N8X 1;  1HZA A;  1SBB B;  3MVV A;  4NP5 A;  4OWT B;  4DV0 L;  1PTO H;  2N88 A;  3K0Y A;  5C3X A;  4G7Z C;  1GKH A;  1XPR A;  1EFW A;  5C0X I;  3HP3 A;  4NB3 A;  4DNR B;  1DJR D;  3CP0 A;  1CZG A;  2Z4H A;  5D14 A;  2A6H D;  4CDF C;  1W2B A;  4OWW B;  3BDL A;  3RD4 A;  1HH2 P;  4ZK9 B;  1BNZ A;  4IUT A;  3KOJ A;  1RCV D;  3HOW H;  2RHS B;  1SNC A;  2RCN A;  4DUY L;  2NTS A;  4JI4 L;  2XRS D;  3GTP H;  1TU2 B;  1CFM A;  1SYB A;  1CK1 A;  4AQY Q;  1A2T A;  2RDF A;  4HJ5 A;  2UXB L;  1B7Y B;  3PIP A;  4R8N A;  2K01 A;  2UUC L;  3KF6 A;  1TT2 A;  1YNJ D;  5M3F B;  3GTJ H;  4NDX A;  5M3F G;  4DK0 A;  1NJI C;  3TEH B;  2PI2 E;  2F1M A;  1HZB A;  5LL6 X;  1I6V C;  4KN7 C;  5IYC G;  3HOV B;  4CBV A;  5T1G A;  1EFI D;  1OTC A;  3HOV G;  1TWA B;  3FPU B;  3TRE A;  1C8C A;  4L5T A;  1CQF A;  3UI2 A;  4RG1 A;  3PUW A;  1U0L A;  1I94 Q;  2QDL A;  1NY4 A;  3C1F A;  4P75 A;  2Q2T A;  3BYT B;  1E24 A;  3IFD A;  2JP1 A;  2CWP A;  2M9V A;  1K3R A;  2QCP X;  2BCO A;  1L0Y B;  4ME3 A;  2DGY A;  1IBM Q;  3I2Z A;  1WTO A;  5IOD A;  5NUC A;  3ERS X;  4OEM B;  2DUD A;  2NN6 I;  2QDB A;  3NP8 A;  4B3S Q;  3GTG B;  3BJU A;  3KLR A;  3KLW A;  3BZK A;  1BCP D;  3NPP A;  2O4X A;  1HR0 W;  2IX0 A;  3TP7 A;  4DR2 Q;  1J5E Q;  2AQ1 B;  4LF4 L;  1EY5 A;  1JIC A;  1TY2 A;  3I4M B;  4HMJ A;  1H9J A;  3E0J A;  4BXX H;  3M85 A;  3I4M G;  1BCP F;  1I3Q B;  2NVX H;  1M8A A;  3SR1 A;  4ILW A;  1NMG A;  4DV3 L;  1C7Y A;  2PW5 A;  3NTI A;  2B8G A;  3AB9 A;  2GN5 A;  1Y8O B;  4I7A A;  1WTV A;  2FXQ A;  2B3G A;  2Z6B A;  3W3A A;  3F2C A;  4DV1 Q;  1LLR D;  1U5K A;  3OWE B;  2F0V A;  2A19 A;  4LF7 L;  2KEE A;  1B4O A;  3SK6 A;  4JI2 Q;  4FDB A;  2D9U A;  1SND A;  2VQE Q;  2F0E A;  3MXN B;  4EGV A;  5J22 A;  2VQF Q;  2SOB A;  1HNX Q;  1JOK A;  1L1O C;  4O1N A;  4RGO S;  2DNC A;  2F0M A;  3VR6 A;  5JJL A;  1WOC A;  1Q81 C;  4XT1 B;  3ZYY X;  2B2V C;  2BDO A;  1RL2 A;  1WTH A;  2B29 A;  1RJT A;  1ROD A;  5EKI A;  4KKU A;  1DOM A;  1B44 D;  4NKL A;  3WOE A;  4OIK A;  4A3D B;  5M3F H;  1QJO A;  4AH6 A;  1Q46 A;  2A8V A;  3P1H A;  3TN2 A;  4A3D G;  1S5E D;  2CHB D;  4YCU A;  5IYC H;  4DV0 Q;  3BS1 A;  1LTL A;  5FO9 B;  4I65 A;  4MZ9 A;  1ICW A;  1YHB A;  5CMD A;  3HOV H;  1MIU A;  1XX8 A;  4OGQ C;  1KDB A;  2VUM B;  1CKN B;  2N78 A;  2VUM G;  1TWA H;  4PG3 A;  1Z47 A;  3J80 L;  2DY8 A;  3MXU A;  2CFM A;  4RH6 A;  3U50 C;  4IFD G;  1PH6 A;  3PO3 B;  5IT9 E;  1G6Z A;  3CCL A;  3H91 A;  1B2T A;  3K57 A;  3NEL A;  3PO3 G;  4DUY Q;  4JI4 Q;  1UE6 A;  1MSG A;  1QUQ B;  2XRQ D;  3BVG A;  2OXP A;  1Y69 U;  1X32 A;  4ZQ3 A;  1Z6H A;  3DXJ C;  4X3T A;  3QO2 A;  2UXB Q;  3OIQ A;  2UUC Q;  3OTO L;  3M3Y B;  2YTV A;  3GTG H;  4UY8 C;  1Q3L A;  2RCF A;  5EPK A;  3L0O A;  5GRO A;  2A68 D;  4O0A A;  3UE0 A;  3GQB A;  1G29 1;  3PF5 A;  3ICE A;  1YIT A;  2SNM A;  5LMU L;  4RKL A;  5IP7 G;  1JR0 D;  1MGS A;  1X56 A;  1S40 A;  5C3E B;  2X6L A;  3I4M H;  1PH8 A;  3QJY A;  5C3E G;  4R8I A;  4GS3 A;  1I3Q H;  1JQY D;  3EQL C;  4NPS A;  4N8F A;  3TS2 A;  3K7U C;  3VR3 A;  1BOS A;  1RHP A;  1Q8K A;  2AQ2 B;  3AEV A;  2CW0 C;  1Z7T A;  1I4G A;  3SXH A;  3AMU A;  5IYB G;  2F0H A;  3FMC A;  2MPM A;  3J81 i;  3MAQ A;  1ZKO A;  3F2U A;  1SYD A;  1VQM A;  4NXM L;  1K73 C;  3M4P A;  2TMP A;  3NBI A;  1SN8 A;  1CA6 A;  3I3C A;  2F0K A;  5C4X G;  1ZYR D;  4OO1 I;  3L9A X;  5I6Y A;  3KFU A;  4G4K A;  2EE1 A;  2C35 B;  1JJG A;  1EWH A;  3I55 A;  4DAP A;  1C48 A;  2X69 A;  2WV6 D;  2G9D A;  4A3D H;  5EKK A;  3I8Z A;  1JWM D;  3RUZ A;  3A7L A;  2K4K A;  3RLN A;  3EA6 A;  1F9P A;  1M90 C;  2HDL A;  4DV3 Q;  3DHQ A;  2MUY A;  3LNN A;  3X3M A;  1S4Z A;  1BR9 A;  4LUZ A;  3CME A;  1KAB A;  3OIP A;  1R4P B;  2VUM H;  2A69 D;  1B3Q A;  3I4O A;  3JAM i;  4A3C G;  3E3X A;  2KBN A;  5D3D A;  4IFD H;  4Q0F A;  4LF7 Q;  1SMY D;  2JA9 A;  4PZ6 A;  4YHH L;  3PO3 H;  4IUU A;  2E5L L;  3BU2 A;  4PMC A;  1UUP A;  4JI8 L;  3L2P A;  4ODG A;  1O80 A;  2PZT A;  2HCC A;  2AUK A;  4JOI A;  2WKD A;  2BE5 D;  4YCW A;  4H7B A;  3GTQ B;  4L6T B;  4FVM A;  4LAA A;  3H0G B;  2EY5 A;  5GAH C;  2YTX A;  4XYQ A;  5EBD A;  4Q5V A;  3M3Y H;  3QWN A;  3S1N B;  2JA7 B;  4KD3 A;  1T5X D;  3H0G G;  2NVY B;  1EIY B;  3MFG A;  3K80 C;  4A3J B;  2JA7 G;  1Q1B A;  3NEM A;  5IP7 H;  5CBE E;  1N8R C;  4KKS A;  3IKJ A;  1EU3 A;  2WFW A;  4A3J G;  1WTQ A;  1Z9F A;  3CCQ A;  2MGS A;  5C3E H;  1VQ8 A;  3V2T A;  2LKV A;  3MXN A;  2K50 A;  1HCZ A;  2Q2I A;  3A55 A;  1NMF A;  1XNQ L;  3V05 A;  1I50 B;  3U4Z A;  4LFA L;  4IUV A;  5EQ0 A;  4MN3 A;  4P71 A;  5LL6 S;  4FF2 A;  5IYB H;  2EYF A;  1SYE A;  5FOB B;  1G91 A;  3MWY W;  3S2H B;  2Z0S A;  3GP7 A;  3ND9 A;  2XGT A;  2N49 A;  3VR4 A;  5DEH A;  5E1F A;  1KHI A;  4LW1 A;  5BN4 A;  2EY1 A;  4R4I A;  5C0X J;  1UEA B;  4P72 A;  5IT9 L;  5I2X A;  5IOC A;  1EY7 A;  3OTO Q;  1CKN A;  3CW2 C;  1F9Q A;  2ICI A;  4ZLT F;  3S1M B;  4MIU A;  5IGG A;  4C2M B;  5M3M B;  2R92 B;  2K52 A;  1V1P B;  3TZU A;  5M3M G;  5C6A A;  5LMU Q;  4FF4 A;  2R92 G;  1TXY A;  5C4H A;  1LV9 A;  1EQV A;  1HXY D;  4FXK C;  4DKA C;  1VQ5 A;  3Q23 A;  1X6O A;  1PRT F;  4KV6 A;  1QUQ A;  3DEO A;  4CHT B;  4NW2 A;  1DOK A;  4AYB E;  1PH4 A;  4KHZ A;  4P73 A;  1SJE D;  3T56 B;  4IN3 A;  4LF5 L;  1SE2 A;  5D3I B;  1KNE A;  4A3C H;  4HIM A;  1JWS D;  3C1E A;  1YJW A;  4IOA A;  4WFN 3;  3D6W A;  4JI5 L;  4BBR B;  3CD6 A;  2B8F A;  4NXM Q;  4BBR G;  2YU9 B;  2VW9 A;  4A4I A;  3M4Y A;  4DGZ A;  3OW7 A;  4LFC Q;  1HUM A;  1STE A;  5I2Y A;  5DAU A;  4QGU A;  2VXW A;  1VQ9 A;  3C46 A;  2HT1 A;  1JOR A;  4X65 L;  1DM0 B;  2K5V A;  4LF8 L;  3GTO B;  3E9I A;  3GTQ H;  1N36 L;  3H0G H;  2J7Z A;  2F0I A;  2JA7 H;  1NR4 A;  3S1N H;  1D7Q A;  1BF4 A;  1HZ9 A;  2NVY H;  4A3J H;  3FKI B;  4JBW A;  2UU9 L;  1HQR D;  3FKI G;  1EYA A;  1ET6 A;  1NSN S;  1TII D;  1PZI D;  3SEB A;  2MHV A;  4QY7 A;  5JEA G;  4JI0 Q;  5C0X G;  1PH7 A;  4RFB A;  1N32 L;  1I50 H;  4UPA A;  3Q8D A;  2K7V A;  2A73 B;  1B70 B;  3U9S A;  4JBM A;  3UDX A;  3V96 A;  1DCZ A;  4YHH Q;  2ZJP A;  3R8B A;  1G8Z D;  2PMZ E;  1L2F A;  3S2H H;  4AYB B;  1JJC B;  3OYY A;  1NCV A;  5C5M A;  5IGE A;  4AYB G;  1Y1V B;  2LXJ A;  3HOU B;  1OXX K;  3PUX A;  4PMW A;  2AKW B;  3T1Y L;  1Y1V G;  3HOU G;  2F3W A;  4PQX A;  1PH3 A;  1YBY A;  1X3G A;  4FXG C;  1PTO C;  3ND8 A;  3K8A A;  3AQQ A;  2PZU A;  1KIX A;  3S1M H;  5M3M H;  4C2M H;  2R92 H;  4DPG A;  1KAW A;  4A93 B;  1X3Q A;  1GHK A;  4IUP A;  4A93 G;  2LY7 A;  1WJJ A;  3HEJ A;  4TQU S;  1QVF A;  1S5C D;  3VR2 A;  1E1T A;  2IL8 A;  1XNQ Q;  4IUR A;  1FD7 D;  4A3K B;  4K0K L;  3HGB A;  1EQR A;  4LFA Q;  4A3K G;  1TVX A;  4DR3 L;  4DK1 A;  4KD4 A;  3RLF A;  1YNN D;  1D5Z C;  2Z4I A;  2EYH A;  1EZ6 A;  2IJ0 A;  4QUF A;  1E2Z A;  4BBR H;  2M00 A;  2RHQ B;  3NHH A;  4BWG B;  1JWU D;  1W6K A;  2BOS A;  2EYJ A;  2YU9 H;  1F9S A;  1LUZ A;  5C5L A;  4WJ3 M;  1N33 L;  1VQK A;  1BVS A;  4IOC A;  1HQM C;  4B9W A;  3SVM A;  3B6Y A;  3BDC A;  2AWN A;  4OEL B;  2ENB A;  5CC4 A;  3KBX A;  1PXU A;  4ZAI A;  3U9O A;  3J81 E;  4BA2 I;  4JCV E;  4DR6 L;  1UWV A;  1EQT A;  3GV6 A;  2PMZ B;  1GO3 E;  2DJF C;  3GTO H;  2R61 A;  3QR8 A;  3LGJ A;  1PZJ D;  1BBU A;  2I0Q A;  1B3A A;  1AP0 A;  3LWU A;  3KYH C;  1GUG A;  2KCN A;  3GTM B;  3H3V H;  5CV5 A;  3ULL A;  1STB A;  3FKI H;  3HRZ C;  1MKH A;  2HQE A;  1D1K A;  4B08 A;  4F8M A;  1K3B C;  3DUZ A;  5JEA H;  5C0X H;  3PSI A;  4FF1 A;  4LF5 Q;  2QEJ C;  1KRT A;  4R1J A;  3RNU A;  3KLS X;  4QIW E;  3M4O B;  3A74 A;  1PA6 A;  5IT9 c;  2L11 A;  1V1P A;  4EQP A;  2UUB L;  2EJG C;  4BBS B;  1KLG D;  3G71 A;  4O2D A;  4JI6 L;  4BBS G;  5FLM G;  2VB2 X;  4TKO B;  4X64 L;  1Q12 A;  1HNZ L;  4RGT A;  3JAM E;  4ZRZ A;  3S16 B;  1Y1V H;  3VYT A;  3HOU H;  4L5Q A;  2BH2 A;  2K5W A;  5IYD G;  4LF8 Q;  2ZXO A;  3RN2 A;  1TWH B;  2N8N A;  3I70 A;  1N36 Q;  2NYZ D;  3HKZ E;  1DYQ A;  4JV5 L;  2NZO A;  5C4J B;  1F2Y A;  3FVQ A;  2PQE A;  3EVQ A;  1LTS D;  3OMC A;  5JVH 3;  1GM5 A;  1V8Q A;  2KUM A;  4A93 H;  3CF5 A;  2R6G A;  2UU9 Q;  1A0I A;  4GN5 A;  3CCR A;  3OMG A;  2HCI A;  3KF8 B;  1QG7 A;  5AFW A;  2A1A A;  2MNA A;  1OXS C;  1S3O A;  1PH1 A;  1WTP A;  1MJE A;  1STG A;  1IW7 C;  4YY3 L;  4A3K H;  1N32 Q;  2A6H C;  3CAM A;  3NBH B;  2B2W C;  5IP9 G;  1VF7 A;  2WII B;  4CKB A;  1AH9 A;  1F77 A;  2HIV A;  2V1C C;  3U58 A;  3VYU A;  2EVB A;  1MSH A;  4G7H C;  2KCM A;  5JPN C;  2N55 A;  3CQZ B;  4BY7 B;  3K0X A;  3H09 A;  3EN2 A;  3S2D B;  1YHQ A;  2RA4 A;  4OIJ A;  5EBC A;  3H15 A;  4BY7 G;  1HPC A;  4LFB Q;  4QIW B;  3T1Y Q;  1JE5 A;  1I4R A;  2F3I A;  2O2L D;  1B50 A;  4XYO A;  3SE0 A;  2RDG A;  4OON A;  3F2B A;  2E2J B;  4QB4 A;  1E3P A;  4K2L A;  1BUV T;  2VY3 A;  3CXC A;  4DV6 L;  2A6E D;  1VQ7 A;  1Y14 B;  2MQH A;  4WRD A;  2IX3 A;  2K5Q A;  5GAG C;  5HGQ A;  3OOC A;  4LNQ A;  3GTM H;  3S9W A;  4K0K Q;  3UE1 A;  3ITP A;  5BR8 Q;  3HKZ B;  1ILQ A;  3D8G A;  4A3M B;  3PIO A;  4DR3 Q;  4QUC A;  1NUC A;  3HKZ G;  4KY6 A;  3PIP 3;  1BCP B;  1E1O A;  2GA4 B;  4A3M G;  2XWJ B;  1Q8I A;  1W3S A;  4APV A;  3HFZ B;  3M4O H;  2F0S A;  3T1H Q;  4KLK A;  1XPU A;  1EUJ A;  2B2U C;  4JBK A;  3Q6S A;  2EY2 A;  2NUC A;  4LUO A;  2K33 A;  1SFO B;  1SSO A;  4BBS H;  5EPJ A;  5FLM H;  4X6A H;  1CKO A;  2JYO A;  2YV5 A;  2UXD L;  5ISR A;  4QF4 A;  1OXV A;  2OWO A;  1KL9 A;  5A2Q L;  2RSO A;  1VQH A;  3S16 H;  1BCP C;  5IYD H;  4DR6 Q;  3U4V A;  2IT1 A;  4L5R C;  2KQ3 A;  1TWH H;  4IUQ A;  2IY5 B;  4JOI C;  4LUV A;  2ES2 A;  1RTO A;  5C4J H;  1YJ9 A;  1VQL A;  4BY1 B;  4UP8 A;  3I72 A;  4BY1 G;  4RCO A;  4ZYS A;  4HTH A;  2F52 A;  4L5S A;  1VQ6 A;  1VCI A;  4UP7 A;  4EVO A;  5L37 A;  1SLJ A;  3M7N A;  4B3R L;  2RKS A;  2IX1 A;  1WTX A;  1ASZ A;  1ESF A;  2VS1 A;  1FGB D;  4HR7 B;  4CDC C;  1EY9 A;  2PCF B;  1PH9 A;  4OHJ A;  4XT3 B;  5IP9 H;  3OSO A;  1SNO A;  2G9H D;  2K5D A;  1GHJ A;  1DXM A;  2KHI A;  4X3S A;  1H9S A;  4HJ9 A;  1UE1 A;  4DNT B;  2UUB Q;  2QA4 A;  4FF3 A;  3PUY A;  1VS0 A;  5IGD A;  1HHV A;  4JI6 Q;  1SE3 A;  2CVR A;  1AE3 A;  3RLO A;  1HNZ Q;  4B3T L;  1QWY A;  3CQZ H;  3TS0 A;  4BY7 H;  2DY7 A;  2Z1C A;  3S2D H;  1XPO A;  2JJQ A;  4LF6 L;  4CGY B;  1SR3 A;  4G7O C;  5I4D A;  1FJG L;  2L15 A;  1K0R A;  2PQA B;  5FJ8 G;  2ICE C;  2I5L X;  3S15 B;  3ERO A;  3KUP A;  1VQP A;  4JV5 Q;  1HFN A;  2E2J H;  1CHP D;  2K75 A;  2P5Z X;  5JPM C;  2NVQ H;  5M9O A;  5C44 B;  3DMU A;  5C44 G;  3K7A B;  4CKE A;  1VF5 C;  3HS0 C;  2B2T A;  1KXL A;  2WB1 E;  1B8A A;  3QIA A;  2MP1 A;  3VR5 A;  1HTP A;  1H95 A;  4YY3 Q;  1R9T B;  1E2W A;  3GD7 A;  5KYI A;  1GUO A;  3G4S A;  3SK5 A;  4A3M H;  3E9H A;  3SHL A;  1STN A;  3HG9 A;  2F3V A;  1PYB A;  5J3B A;  1OO9 B;  2H1E A;  3A8K E;  4H02 A;  5FO8 B;  1AN8 A;  2B2W A;  4DNI A;  2CW0 D;  1A8V A;  1CSP A;  3SK8 A;  1XMO L;  3CCV A;  4IUN A;  5FLX E;  2A5H A;  1AE2 A;  2EDG A;  2F0U A;  3NUC A;  3L7Z C;  4V0B A;  3LWE A;  1N9W A;  2XVS A;  1ML0 D;  4JI3 L;  2ZM6 L;  1SFO H;  1UNS A;  2X6G A;  2EYL A;  3KF8 A;  1Y1W B;  1EQQ A;  3NK9 A;  3I4N B;  1ONL A;  1X9N A;  1Y1W G;  1STY A;  5LMN L;  4K5V A;  2A68 C;  3I4N G;  4NMZ A;  4GLX A;  4XDX A;  2D0P A;  3NBH A;  5FK9 C;  4GKK L;  4DV6 Q;  1PV4 A;  3PF4 A;  4Z9C B;  5E3F A;  5C4X B;  4LWC A;  1LTT D;  3TZD A;  3UDI A;  1GD7 A;  4BY1 H;  1CQV A;  5J39 A;  1PFN A;  1NR2 A;  1ENA A;  2JXM B;  5BN5 A;  1XNR L;  1PVO A;  3TDQ A;  3T4A C;  2VNU D;  2NZ1 D;  4LF4 Q;  2WP8 J;  4B3M L;  2ZT9 C;  4OXP A;  3URY A;  3D0F A;  1V1Q A;  2BA1 A;  3VYR A;  4LJZ C;  3H94 A;  3NTK A;  1HR0 L;  4EX5 A;  2WB1 B;  2F4I A;  2JK8 A;  2NWG A;  4G57 A;  4ZKC B;  2WB1 G;  2B2U A;  4FP5 D;  4S3S A;  1QB5 D;  2UXD Q;  1I4H A;  4X3K A;  2NB0 A;  3MFY A;  1ZYR C;  3D31 A;  4BS9 A;  5ELB A;  5FJ8 H;  1A3V A;  2GVB A;  2ZXR A;  1JCK B;  1MBY A;  3J80 i;  4LMQ D;  5ELO A;  5M5X B;  3S15 H;  1B53 A;  3OW2 A;  4C56 C;  2N3S A;  4QL5 A;  5COR A;  5K36 G;  1D8L A;  1XTC D;  1UE7 A;  1P16 A;  3EBE A;  1SYF A;  1EU4 A;  3W1B A;  1YIJ A;  5C44 H;  1PFM A;  4ZUJ A;  4QJF A;  1NNX A;  4A3E B;  4IZ8 A;  2F0O A;  2KA7 A;  1VQ4 A;  5I9P A;  3NE5 B;  3K7A H;  5DM7 3;  1O7Z A;  4OX9 L;  4A3E G;  1EIF A;  3N52 A;  2A69 C;  3GV3 A;  1VQD A;  4IQZ A;  1O7I A;  1R9T H;  3A56 A;  2H4O A;  3K6O A;  1LO5 D;  3FDT A;  1LTR D;  1SMY C;  1EZ8 A;  2XWB B;  3T16 A;  4JI7 L;  1HZC A;  4WOR A;  3D3R A;  4IFD I;  1HRJ A;  5DM6 3;  1QVC A;  1PMR A;  1T5E A;  4IPG A;  4B3T Q;  3HOX B;  2NZH A;  4F7X A;  3HOX G;  2BE5 C;  1FNV A;  2I46 A;  4RA8 A;  3IRB A;  1FJG Q;  5M5Y B;  3WWV A;  1EIG A;  1DOL A;  1X55 A;  4X66 L;  3NEN A;  1Y1W H;  3A5U A;  4DR1 L;  5KNC A;  3NTH A;  4IAL A;  3I4N H;  1KRS A;  1F2L A;  1SE8 A;  1PLF A;  5ELC A;  4HIK A;  2K5N A;  4A3B B;  5FO7 B;  4AIM A;  5C4X H;  4A3B G;  3Q22 A;  2PNH A;  2JE6 I;  4R4O A;  5CV4 A;  3FEW X;  5D65 A;  1PRT D;  1VMC A;  3QOL A;  3EFX D;  4LK1 C;  1LM0 A;  4M1U B;  3MHB A;  2FHT A;  1PRT B;  1SE4 A;  4B9X A;  2D62 A;  1XMO Q;  2PYK A;  3DWP A;  1ESR A;  4QCL A;  2ZM6 Q;  4A3G B;  2R7D A;  4POG A;  4IO9 A;  3MZ5 A;  5A35 A;  3JAM c;  4A3G G;  1IHZ A;  5EKL A;  2R93 B;  1IKM A;  4Y7N B;  3OHX C;  5LMN Q;  2R93 G;  3F1Z A;  3I4L A;  4GKK Q;  1WTW A;  3NXW A;  1E7Z A;  4DR5 L;  5M5X H;  5K36 H;  1WI5 A;  1EL0 A;  1C0A A;  2CH4 W;  3CMA A;  4DV2 L;  5IIF A;  1X54 A;  1EIH A;  2AQ3 B;  4A3E H;  2FMM A;  1E2V A;  1XNR Q;  2WAQ E;  4RWS C;  5IGC A;  2QEX A;  2QGQ A;  3M9B A;  4B3M Q;  4ZCK A;  1VQE A;  4JI1 L;  3BYY B;  1M1K C;  1WTR A;  3LX0 A;  1EEI D;  4RCN A;  2ZXP A;  1ICF B;  1TQO A;  1HR0 Q;  1RTN A;  3KK7 A;  4K14 A;  5KND A;  2R7Z B;  4NXN L;  3DLL A;  1IKL A;  1TWF B;  2XSC A;  3CPW A;  3K5L A;  2R7Z G;  3O13 A;  3NWS A;  3HOX H;  3DWA A;  4DV5 L;  3J7A 5;  1ILP A;  4BA1 I;  2KCT A;  2RVL A;  2E74 C;  4PMB A;  4PZ7 A;  5M5Y H;  1F9R A;  1WD1 A;  1K8M A;  2E5L Q;  2EXD A;  4TVA B;  3H3V C;  3S17 B;  1EEF D;  1ENF A;  3T13 A;  4JI8 Q;  3CC7 A;  4ID6 A;  4DR7 L;  5BN3 A;  2AWO A;  4X62 L;  3S14 B;  4KJO A;  2OF1 A;  3KJP A;  5TSS A;  5EPL A;  4HAE A;  3S1R B;  1VQA A;  1AZQ A;  1II3 A;  4RKB A;  5CV9 A;  3A5Z B;  1PTO D;  3N6R A;  4A3B H;  5KRU A;  3MXP A;  3UDG A;  3ZJY C;  5JVG 3;  2Z9H A;  2SEB D;  4OX9 Q;  4EQ5 A;  3J81 j;  2LMC B;  1UAP A;  2R7F A;  4XQQ A;  3G6E A;  2QIL A;  3A8I E;  4RMF A;  5T1I A;  1C4Q A;  1TS3 A;  1PTO F;  1FR3 A;  2KHS A;  1BDO A;  1RF2 D;  2Q8R E;  1QNU A;  2C5C A;  5IGB A;  3SGI A;  5K5P A;  2MO0 A;  2QKI C;  4JI7 Q;  4CJ0 B;  3CC2 A;  1D1I A;  1WCM B;  3AU7 A;  4WJ4 A;  2CWA A;  1WCM G;  2WAQ B;  3STB D;  2F0L A;  3I56 A;  4DA2 A;  3W2D A;  4A75 A;  2WAQ G;  3CCE A;  2GVA A;  1HA6 A;  2UUA L;  4A3G H;  4CDD C;  4X66 Q;  4XIG S;  4DR1 Q;  1Y8P B;  2R93 H;  4Y7N H;  3EIV A;  2EJM A;  1VQO A;  4HED A;  2JA5 B;  3K59 A;  4KHV A;  3P7J A;  3X3N A;  3MC0 B;  3NQI A;  2JA5 G;  2KEC A;  3IAY A;  3MEH A;  1D6E C;  3S1Q B;  1L0W A;  3E6Z X;  2NN6 G;  4K2K A;  2ZTE A;  2I07 B;  2Q2H A;  3PUV A;  1EWI A;  1IXR A;  4MHE A;  4JYA L;  1S72 A;  1ET9 A;  3KLS A;  4P2C B;  1YNN C;  3MEF A;  2XN9 C;  2KJX A;  2ALY B;  1A2U A;  1LTA D;  2I5M X;  4HJA A;  2VL6 A;  4O42 A;  2VZA A;  4CJ1 B;  4A3I B;  1H9K A;  3ER0 A;  1K8G A;  1HA5 A;  1EOT A;  4L8J A;  4A3I G;  2R7Z H;  4JI2 L;  1FGU A;  3UDF A;  1TWF H;  3KBG A;  4HMI A;  5CV7 A;  2D0O A;  4UAI A;  5JJZ A;  1X3P A;  2VQF L;  2K6A A;  3RMH A;  1QNK A;  3SK4 A;  3NSW A;  1CSQ A;  1ENC A;  3VA7 A;  1WD0 A;  4UDU C;  3HKS A;  4JI5 Q;  4ZUI A;  1M4V A;  2Z8L A;  4XXE A;  4DR5 Q;  3S17 H;  3ULJ A;  4R4Q A;  1CZW A;  3K5M A;  1TS4 A;  2QF7 A;  4YWK A;  1YVC A;  1Q82 C;  3S14 H;  5EGT A;  3S1R H;  3JC6 6;  5CV8 A;  2Q8I B;  4DV2 Q;  4KK7 A;  4DK3 C;  4X65 Q;  4K8I A;  2QW7 A;  2XNA C;  1IL8 A;  3J80 E;  2B2Y C;  1HFG A;  2K03 A;  4GN3 B;  1XXG A;  3ONA B;  3H3V I;  4DAY B;  3FRP B;  1SRO A;  1CA5 A;  1WVL A;  1K8O A;  1B9M A;  1RKN A;  3TP5 A;  4JI1 Q;  2K32 A;  3PV0 A;  1K9M C;  1PZK D;  4KI0 A;  2B2T C;  1IW7 D;  1Y8N B;  4R4T A; 
#chains in the Genus database with same CATH homology
 3I91 A;  3BVM A;  4HCS A;  2NTT A;  3WDN A;  1PFB A;  2Q8T A;  4XQN A;  1STA A;  1EY6 A;  4KN4 C;  4C3J B;  2FFK B;  1SNM A;  2LS0 1;  5JOB A;  1LTG D;  4C3J G;  5LHY 1;  3PO2 B;  1U4P A;  4RGN A;  4DN4 M;  4DU9 A;  5ELE A;  1FNU A;  2DN8 A;  5I6W A;  2MJ8 A;  1LT3 D;  1O78 A;  2L5T A;  4F88 A;  2B63 B;  4TRD A;  4K8J A;  5C3W A;  3DWQ A;  2NN6 H;  2EYO A;  3CU7 A;  4KJN A;  1YNJ C;  1TKW B;  2L12 A;  4ZKB B;  3ERQ A;  2NVQ B;  1QOH A;  2EJF C;  3D4R A;  2C9O A;  1CHQ D;  1ZXT A;  3M7G A;  4X3U A;  1V1O A;  3EJI A;  2EYM A;  3BZD B;  2PNR C;  3D4D A;  4DAV A;  3CKI B;  3TSS A;  4PNY A;  2CQA A;  2DNE A;  1E0B A;  2RSN A;  4E6I A;  1GOZ A;  3T53 B;  4KMU C;  1D5M C;  1TY0 A;  2NVT B;  5CYU A;  4HCE A;  1GUW A;  3G7L A;  1TWG B;  3RZO B;  2A6E C;  4F87 A;  4DXF A;  4IFD J;  1SNQ A;  1AZP A;  4XQJ A;  2ID0 A;  3DM1 A;  3L3O C;  1GXD C;  3NQT A;  4OO1 G;  4RGM A;  1EYD A;  1CI3 M;  2VB3 X;  5E4X A;  3K5N A;  1A3U A;  4H44 C;  4WJW A;  3R3O A;  4DF7 A;  3J81 L;  3J7A F;  3QG1 A;  2WIN B;  2EXZ A;  4PV1 C;  3FPP A;  1TWC B;  3DEP A;  3PIO 3;  3HOZ B;  1J9O A;  1I4P A;  1EY0 A;  1IYU A;  4J1M A;  4N9T A;  3CRL C;  5KIX A;  2NBF A;  2TSS A;  2RBM A;  4A3F B;  2IPK D;  3HZX A;  2B2Y A;  4ME5 A;  4I7Z C;  5FKA C;  3JAM L;  2FMC A;  1BO0 A;  1R4Q B;  2FJ2 A;  2PW7 A;  1SNP A;  3Q24 A;  4KKT A;  1U4M A;  4K6D A;  2F0G A;  2D2C C;  2L1B A;  1LAC A;  2EOT A;  2O5J C;  1SEB D;  1VDZ A;  1D5X C;  1KAA A;  2E2H B;  4DAY A;  2K04 A;  4ULL A;  3R2I A;  2JA8 B;  4XTC S;  4U67 3;  2JA6 B;  2E2I B;  1GUS A;  2IW3 A;  2RQX A;  3QB3 A;  2KCC A;  1STH A;  4OO1 H;  3GTK B;  1QCB D;  4KY5 A;  1AW7 A;  2F0T A;  1S5F D;  1S5D D;  2AUJ D;  1OXU A;  4C3H B;  1JE4 A;  1AEX A;  3I73 A;  3C3L A;  4K5X A;  4ABN A;  1MI2 A;  2XIW A;  4C3H G;  3C2P A;  2OT2 A;  1ZEQ X;  1G2T A;  2F0P A;  1U4R A;  2KVM A;  4EQN A;  1GUT A;  1JOO A;  4KTA A;  2PO4 A;  5M5W B;  3QOJ A;  1S5B D;  1BBX C;  1GJX A;  3J7Y W;  2O5I C;  2IWH A;  1KDC A;  2FIN B;  5HUR A;  2L9H A;  3R93 A;  3PUZ A;  2M2L A;  1KDA A;  1DD2 A;  1QE6 A;  2EYP A;  2L0C A;  2PZW A;  5I9O A;  3HOY B;  2F03 A;  2F0W A;  1V43 A;  1EYC A;  3CHB D;  3G6J B;  2EZV A;  2F0N A;  4H13 C;  5JAV A;  4FYD A;  2WKC A;  2E76 C;  1LT5 D;  5E4W C;  1B1Z A;  2EY6 A;  4FXD A;  3GO5 A;  3TP6 A;  4HSV A;  1SXT A;  5CV6 A;  1TS5 A;  4HSP A;  1SYG A;  1K83 B;  1JB3 A;  1DON A;  2B2V A;  3TBI B;  2E75 C;  3BG3 A;  1GUN A;  4JK1 C;  1U9R A;  2HUG A;  2LFN A;  3MXG A;  4RAU C;  1AFP A;  3IL8 A;  1O7L A;  5J1Z A;  2B39 A;  5KEE A;  1Q1E A;  1Q90 A;  3TME A;  1EWC A;  3WOF A;  5IGF A;  1KLU D;  1FNW A;  4QMG A;  1NAP A;  2J4X A;  2PPB C;  4FO2 A;  3GTL B;  5KGU A;  4H0L C;  4U68 A;  1CM9 A;  1SJH D;  5JEA J;  1VMP A;  2BA0 A;  3TP8 A;  5DNF A;  4RHR A;  1EY4 A;  1D2B A;  2KED A;  2F0F A;  1XYI A;  5EJW A;  1PRT C;  5FLX L;  1J8I A;  1OXT A;  1DZ1 A;  3E5S A;  1G2S A;  1SAP A;  1RDP D;  1EY8 A;  2J0T D;  2SDF A;  1SDF A;  1F2Z A;  1BQQ T;  3OWF A;  1LT6 D;  1A15 A;  4CKC A;  3SDZ A;  5CBA E;  2D5D A;  4CJ2 C;  2F0Q A;  5CR3 A;  1XWE A;  3NWT A;  3A54 A;  3K58 A;  2F0J A;  2JEB I;  4L63 B;  5ELD A;  2L4N A;  4EQO A;  1LT4 D;  3OPO A;  4C3I B;  1I6H B;  5F2D A;  2WAC A;  3H6M A;  4V19 0;  1PYW D;  3K5O A;  3BDO A;  4C3I G;  5HGT A;  4HN7 A;  3A8J E;  3RZD B;  1B9N A;  5KNB A;  4YIJ A;  4C1N K;  2R3Z A;  5COY A;  4M8A A;  1TS2 A;  4GZY C;  4C1N I;  2JSO A;  2KOL A;  1PTO B;  1CT1 D;  3A7A B;  2F0D A;  3MTS A;  2YYZ A;  3D6C A;  1H9M A;  2HDM A;  4K6L A;  4J6H A;  1O7Y A;  3R2T A;  2V4D A;  1SYC A;  1I4Q A;  1W6J A;  1HUN A;  3HOW B;  5CGK A;  1CTM A;  1LAB A;  1JOQ A;  3GTP B;  4K5W A;  5KYL A;  1KTK A;  1IYV A;  3P75 A;  1L0X B;  1A3T A;  4R9W A;  1TR5 A;  1F2M A;  1H9R A;  3GTJ B;  1KNA A;  2JEA I;  3VA5 A;  2K1B A;  3PMF A;  4FNF A;  1JC7 A;  2OEO A;  1QIL A;  1LTB D;  2L55 A;  3IFT A;  2BDN A;  5A2Q E;  5G3L D;  1U4L A;  4KY7 A;  3MA2 B;  1PDQ A;  3BVZ A;  4DFA A;  4N9P A;  3J7A V;  5ELF A;  5G3L F;  1I4X A;  1RD9 D;  2E2D C;  1FYC A;  3CRK C;  1BXT A;  4RHS A;  1H9S B;  1HTL D;  3I90 A;  4DXG A;  2K28 A;  4OL7 A;  3P20 A;  2A74 C;  2RDH A;  5C4Z A;  3T51 B;  1MD2 D;  1LTI D;  2EPB A;  3D4W A;  3VYS A;  4J8Q A;  1A6X A;  2Y0S B;  4TSS A;  3Q0A A;  2SNS A;  2K05 A;  2NVX B;  1SBB B;  3MVV A;  4NP5 A;  1PTO H;  2N88 A;  3K0Y A;  5C3X A;  4G7Z C;  5C0X I;  3HP3 A;  4DNR B;  1DJR D;  5D14 A;  1CZG A;  2Z4H A;  2A6H D;  3BDL A;  3RD4 A;  4ZK9 B;  1BNZ A;  4IUT A;  1RCV D;  1SNC A;  2NTS A;  2XRS D;  1TU2 B;  1CFM A;  1SYB A;  1CK1 A;  1A2T A;  2RDF A;  4R8N A;  2K01 A;  1TT2 A;  1YNJ D;  5M3F B;  4NDX A;  4DK0 A;  2F1M A;  5LL6 X;  1I6V C;  4KN7 C;  3HOV B;  4CBV A;  5T1G A;  1EFI D;  1TWA B;  3FPU B;  1C8C A;  1CQF A;  3UI2 A;  3PUW A;  3C1F A;  3BYT B;  2JP1 A;  3IFD A;  2M9V A;  2QCP X;  2BCO A;  1L0Y B;  1WTO A;  5IOD A;  5NUC A;  2NN6 I;  2QDB A;  3NP8 A;  3GTG B;  3KLR A;  1BCP D;  3NPP A;  2O4X A;  2IX0 A;  3TP7 A;  2AQ1 B;  1EY5 A;  1JIC A;  1TY2 A;  3I4M B;  4HMJ A;  1H9J A;  3E0J A;  3M85 A;  1BCP F;  1I3Q B;  1M8A A;  3SR1 A;  4ILW A;  2PW5 A;  3NTI A;  2B8G A;  3AB9 A;  1Y8O B;  1WTV A;  3W3A A;  1LLR D;  3OWE B;  2F0V A;  2KEE A;  1B4O A;  3SK6 A;  2D9U A;  1SND A;  2F0E A;  4EGV A;  5J22 A;  2SOB A;  1JOK A;  4O1N A;  4RGO S;  2DNC A;  2F0M A;  3VR6 A;  4XT1 B;  3ZYY X;  2B2V C;  2BDO A;  1RJT A;  1ROD A;  5EKI A;  4KKU A;  1DOM A;  1B44 D;  4NKL A;  3WOE A;  4OIK A;  4A3D B;  1QJO A;  3P1H A;  3TN2 A;  1S5E D;  2CHB D;  3BS1 A;  5FO9 B;  4I65 A;  1ICW A;  5CMD A;  1XX8 A;  4OGQ C;  1KDB A;  2VUM B;  1Z47 A;  3J80 L;  2DY8 A;  3MXU A;  4RH6 A;  4IFD G;  3PO3 B;  5IT9 E;  1G6Z A;  3H91 A;  1B2T A;  3K57 A;  1MSG A;  2XRQ D;  3BVG A;  2OXP A;  1Y69 U;  1X32 A;  4ZQ3 A;  1Z6H A;  3DXJ C;  4X3T A;  3QO2 A;  3OIQ A;  3M3Y B;  1Q3L A;  5EPK A;  2A68 D;  3GQB A;  1G29 1;  2SNM A;  4RKL A;  1JR0 D;  1MGS A;  5C3E B;  2X6L A;  3QJY A;  4R8I A;  1JQY D;  3EQL C;  3VR3 A;  1BOS A;  1RHP A;  2AQ2 B;  2CW0 C;  1Z7T A;  1I4G A;  3SXH A;  3AMU A;  2F0H A;  3FMC A;  2MPM A;  3MAQ A;  1ZKO A;  3F2U A;  1SYD A;  2TMP A;  3NBI A;  1CA6 A;  3I3C A;  2F0K A;  1ZYR D;  4OO1 I;  3L9A X;  5I6Y A;  4G4K A;  2EE1 A;  1EWH A;  4DAP A;  1C48 A;  2X69 A;  2WV6 D;  2G9D A;  5EKK A;  3I8Z A;  1JWM D;  3RUZ A;  3A7L A;  3EA6 A;  1F9P A;  2HDL A;  3DHQ A;  2MUY A;  3LNN A;  3X3M A;  1S4Z A;  1BR9 A;  1KAB A;  3OIP A;  1R4P B;  2A69 D;  5D3D A;  4IFD H;  4Q0F A;  1SMY D;  4IUU A;  4PMC A;  1UUP A;  4ODG A;  1O80 A;  2PZT A;  2HCC A;  2AUK A;  2WKD A;  2BE5 D;  4H7B A;  3GTQ B;  4L6T B;  4FVM A;  4LAA A;  3H0G B;  2EY5 A;  4XYQ A;  5EBD A;  4Q5V A;  2JA7 B;  3QWN A;  3S1N B;  4KD3 A;  1T5X D;  2NVY B;  3MFG A;  4A3J B;  1Q1B A;  5CBE E;  4KKS A;  3IKJ A;  1EU3 A;  1WTQ A;  2MGS A;  3V2T A;  2LKV A;  3MXN A;  1HCZ A;  3A55 A;  3V05 A;  1I50 B;  4IUV A;  5EQ0 A;  4MN3 A;  5LL6 S;  4FF2 A;  2EYF A;  1SYE A;  5FOB B;  1G91 A;  3MWY W;  3S2H B;  3GP7 A;  3ND9 A;  3VR4 A;  5DEH A;  5E1F A;  5BN4 A;  2EY1 A;  5C0X J;  1UEA B;  5IT9 L;  5I2X A;  5IOC A;  1EY7 A;  1F9Q A;  2ICI A;  4ZLT F;  3S1M B;  4MIU A;  5IGG A;  4C2M B;  5M3M B;  2R92 B;  1V1P B;  3TZU A;  5C6A A;  4FF4 A;  5C4H A;  1LV9 A;  1EQV A;  1HXY D;  4FXK C;  3Q23 A;  4KV6 A;  1PRT F;  3DEO A;  4CHT B;  4NW2 A;  1DOK A;  4KHZ A;  1SJE D;  3T56 B;  4IN3 A;  1SE2 A;  5D3I B;  1KNE A;  1JWS D;  3C1E A;  4WFN 3;  3D6W A;  4BBR B;  2B8F A;  2YU9 B;  3M4Y A;  4DGZ A;  3OW7 A;  1HUM A;  1STE A;  5I2Y A;  5DAU A;  2VXW A;  3C46 A;  1JOR A;  1DM0 B;  3GTO B;  2J7Z A;  2F0I A;  1NR4 A;  1BF4 A;  3FKI B;  4JBW A;  1HQR D;  1EYA A;  1ET6 A;  1NSN S;  1TII D;  1PZI D;  3SEB A;  2MHV A;  5JEA G;  5C0X G;  4RFB A;  2K7V A;  2A73 B;  3U9S A;  3V96 A;  1DCZ A;  3R8B A;  1G8Z D;  4AYB B;  5C5M A;  1NCV A;  5IGE A;  1Y1V B;  3HOU B;  1OXX K;  3PUX A;  4PMW A;  2F3W A;  4PQX A;  4FXG C;  1PTO C;  3ND8 A;  2PZU A;  4A93 B;  1X3Q A;  1GHK A;  4IUP A;  2LY7 A;  3HEJ A;  4TQU S;  1S5C D;  3VR2 A;  2IL8 A;  4IUR A;  1FD7 D;  4A3K B;  3HGB A;  1TVX A;  4DK1 A;  4KD4 A;  3RLF A;  1YNN D;  1D5Z C;  2Z4I A;  2EYH A;  1EZ6 A;  2IJ0 A;  4QUF A;  1E2Z A;  4BWG B;  2M00 A;  3NHH A;  1JWU D;  1W6K A;  2BOS A;  2EYJ A;  1F9S A;  5C5L A;  1HQM C;  4B9W A;  3SVM A;  3BDC A;  2AWN A;  2ENB A;  5CC4 A;  3KBX A;  1PXU A;  4ZAI A;  3U9O A;  3J81 E;  4BA2 I;  1EQT A;  3GV6 A;  2PMZ B;  2R61 A;  1PZJ D;  1B3A A;  1AP0 A;  3LWU A;  1GUG A;  2KCN A;  3GTM B;  5CV5 A;  1STB A;  3HRZ C;  2HQE A;  1D1K A;  4B08 A;  4F8M A;  3DUZ A;  5JEA H;  5C0X H;  4FF1 A;  2QEJ C;  3KLS X;  3M4O B;  2L11 A;  1V1P A;  4EQP A;  2EJG C;  4BBS B;  1KLG D;  2VB2 X;  4TKO B;  1Q12 A;  4RGT A;  3JAM E;  4ZRZ A;  3S16 B;  3VYT A;  2K5W A;  2ZXO A;  1TWH B;  3I70 A;  2NYZ D;  1DYQ A;  5C4J B;  1F2Y A;  3FVQ A;  2PQE A;  3EVQ A;  1LTS D;  3OMC A;  5JVH 3;  1V8Q A;  2KUM A;  2R6G A;  3OMG A;  2HCI A;  1QG7 A;  5AFW A;  1OXS C;  1WTP A;  1STG A;  1IW7 C;  2A6H C;  2B2W C;  1VF7 A;  2WII B;  4CKB A;  1F77 A;  3VYU A;  2EVB A;  1MSH A;  4G7H C;  5JPN C;  2N55 A;  3CQZ B;  4BY7 B;  3H09 A;  3S2D B;  2RA4 A;  4OIJ A;  5EBC A;  1HPC A;  4QIW B;  1I4R A;  2O2L D;  1B50 A;  4XYO A;  3SE0 A;  2RDG A;  2E2J B;  4QB4 A;  4K2L A;  1BUV T;  2A6E D;  2IX3 A;  4WRD A;  2K5Q A;  3OOC A;  3S9W A;  3ITP A;  3HKZ B;  1ILQ A;  3D8G A;  4A3M B;  4QUC A;  1NUC A;  4KY6 A;  3PIP 3;  1BCP B;  2GA4 B;  2XWJ B;  1Q8I A;  2F0S A;  2B2U C;  3Q6S A;  2EY2 A;  2NUC A;  2K33 A;  1SFO B;  1SSO A;  5EPJ A;  2JYO A;  5ISR A;  4QF4 A;  1OXV A;  5A2Q L;  2RSO A;  1BCP C;  2IT1 A;  2KQ3 A;  4IUQ A;  1RTO A;  4BY1 B;  3I72 A;  4RCO A;  4ZYS A;  4HTH A;  1VCI A;  4EVO A;  3M7N A;  2RKS A;  2IX1 A;  1WTX A;  1ESF A;  1FGB D;  4HR7 B;  1EY9 A;  2PCF B;  4OHJ A;  4XT3 B;  3OSO A;  1SNO A;  2G9H D;  2K5D A;  1GHJ A;  1DXM A;  4X3S A;  1H9S A;  4DNT B;  4FF3 A;  3PUY A;  5IGD A;  1HHV A;  1SE3 A;  2CVR A;  1QWY A;  2DY7 A;  2Z1C A;  4CGY B;  4G7O C;  5I4D A;  2ICE C;  3S15 B;  3ERO A;  3KUP A;  1HFN A;  1CHP D;  5JPM C;  5M9O A;  5C44 B;  3DMU A;  3K7A B;  4CKE A;  1VF5 C;  3HS0 C;  2B2T A;  3QIA A;  2MP1 A;  3VR5 A;  1HTP A;  1R9T B;  1E2W A;  3GD7 A;  5KYI A;  1GUO A;  3SK5 A;  3SHL A;  1STN A;  3HG9 A;  2F3V A;  1OO9 B;  2H1E A;  3A8K E;  5FO8 B;  1AN8 A;  2B2W A;  2CW0 D;  3SK8 A;  4IUN A;  5FLX E;  2A5H A;  2EDG A;  2F0U A;  3NUC A;  3L7Z C;  4V0B A;  3LWE A;  2XVS A;  1ML0 D;  1UNS A;  2X6G A;  2EYL A;  3KF8 A;  1Y1W B;  3NK9 A;  3I4N B;  1ONL A;  1STY A;  4K5V A;  2A68 C;  4NMZ A;  4XDX A;  3NBH A;  5FK9 C;  4Z9C B;  5E3F A;  5C4X B;  3TZD A;  1LTT D;  1CQV A;  5J39 A;  1PFN A;  1NR2 A;  1ENA A;  2JXM B;  5BN5 A;  3TDQ A;  3T4A C;  2VNU D;  2NZ1 D;  2WP8 J;  2ZT9 C;  3URY A;  2BA1 A;  3VYR A;  4LJZ C;  3H94 A;  3NTK A;  2WB1 B;  2F4I A;  2NWG A;  4G57 A;  4ZKC B;  2B2U A;  4FP5 D;  4S3S A;  1QB5 D;  1I4H A;  4X3K A;  2NB0 A;  3MFY A;  1ZYR C;  3D31 A;  4BS9 A;  5ELB A;  1A3V A;  2ZXR A;  1JCK B;  1MBY A;  4LMQ D;  5M5X B;  1B53 A;  4C56 C;  5COR A;  5K36 G;  1XTC D;  1SYF A;  1EU4 A;  1PFM A;  4ZUJ A;  4A3E B;  4IZ8 A;  2F0O A;  2KA7 A;  5I9P A;  3NE5 B;  5DM7 3;  1O7Z A;  3N52 A;  2A69 C;  3GV3 A;  4IQZ A;  3A56 A;  2H4O A;  3K6O A;  1LO5 D;  3FDT A;  1LTR D;  1SMY C;  1EZ8 A;  2XWB B;  3T16 A;  4WOR A;  3D3R A;  4IFD I;  1HRJ A;  5DM6 3;  1PMR A;  1T5E A;  3HOX B;  4F7X A;  2BE5 C;  1FNV A;  2I46 A;  4RA8 A;  5M5Y B;  1EIG A;  1DOL A;  5KNC A;  3NTH A;  4IAL A;  1F2L A;  1PLF A;  5ELC A;  4A3B B;  5FO7 B;  3Q22 A;  2JE6 I;  5CV4 A;  3FEW X;  5D65 A;  1PRT D;  1VMC A;  3QOL A;  3EFX D;  4LK1 C;  4M1U B;  3MHB A;  2FHT A;  1PRT B;  1SE4 A;  4B9X A;  2D62 A;  2PYK A;  3DWP A;  1ESR A;  4QCL A;  4A3G B;  3MZ5 A;  5A35 A;  1IHZ A;  5EKL A;  2R93 B;  1IKM A;  4Y7N B;  3OHX C;  3I4L A;  1WTW A;  3NXW A;  5K36 H;  1EL0 A;  5IIF A;  1EIH A;  2AQ3 B;  2FMM A;  1E2V A;  4RWS C;  5IGC A;  3BYY B;  1WTR A;  3LX0 A;  1EEI D;  4RCN A;  2ZXP A;  1TQO A;  1RTN A;  3KK7 A;  4K14 A;  5KND A;  2R7Z B;  1IKL A;  1TWF B;  2XSC A;  3K5L A;  3O13 A;  3NWS A;  3DWA A;  1ILP A;  4BA1 I;  2RVL A;  2E74 C;  4PMB A;  1F9R A;  1WD1 A;  1K8M A;  3H3V C;  3S17 B;  1EEF D;  1ENF A;  3T13 A;  4ID6 A;  5BN3 A;  2AWO A;  3S14 B;  4KJO A;  2OF1 A;  5TSS A;  5EPL A;  4HAE A;  3S1R B;  1AZQ A;  1II3 A;  4RKB A;  5CV9 A;  1PTO D;  3N6R A;  5KRU A;  3MXP A;  5JVG 3;  2SEB D;  2LMC B;  1UAP A;  4XQQ A;  2QIL A;  3A8I E;  5T1I A;  1C4Q A;  1TS3 A;  1PTO F;  1FR3 A;  2KHS A;  1BDO A;  1RF2 D;  2Q8R E;  1QNU A;  2C5C A;  5IGB A;  5K5P A;  2QKI C;  4CJ0 B;  1D1I A;  1WCM B;  3AU7 A;  2WAQ B;  2F0L A;  4DA2 A;  3W2D A;  1HA6 A;  4XIG S;  1Y8P B;  2EJM A;  2JA5 B;  4HED A;  3K59 A;  4KHV A;  3P7J A;  3X3N A;  3MC0 B;  3NQI A;  2KEC A;  3IAY A;  3MEH A;  1D6E C;  3S1Q B;  3E6Z X;  2NN6 G;  4K2K A;  2I07 B;  3PUV A;  4MHE A;  1ET9 A;  3KLS A;  4P2C B;  1YNN C;  2XN9 C;  2KJX A;  1A2U A;  1LTA D;  4O42 A;  4CJ1 B;  4A3I B;  1H9K A;  1HA5 A;  1EOT A;  4L8J A;  3KBG A;  4HMI A;  5CV7 A;  4UAI A;  5JJZ A;  1X3P A;  2K6A A;  3RMH A;  1QNK A;  3SK4 A;  1ENC A;  3NSW A;  3VA7 A;  1WD0 A;  4UDU C;  4ZUI A;  1M4V A;  2Z8L A;  4XXE A;  1CZW A;  3K5M A;  1TS4 A;  2QF7 A;  5EGT A;  5CV8 A;  2Q8I B;  4KK7 A;  4K8I A;  2XNA C;  1IL8 A;  3J80 E;  2B2Y C;  1HFG A;  2K03 A;  1XXG A;  3ONA B;  3FRP B;  1CA5 A;  1WVL A;  1K8O A;  1B9M A;  1RKN A;  3TP5 A;  2K32 A;  3PV0 A;  1PZK D;  4KI0 A;  2B2T C;  1IW7 D;  1Y8N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...