3RD4A

Crystal structure of propen_03304 from proteus penneri atcc 35198 northeast structural genomics consortium target id pvr55
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
76
Chain Sequence
APVKLYMVEVIDKKEIAANEITHYYQVTFRLTTDDRKDLVLNIDKSSYQNIEPEMKGRLFMQGSRFVQFETDVPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PROPEN_03304 from Proteus penneri ATCC 35198 Northeast Structural Genomics Consortium target id PvR55
rcsb
source organism Proteus penneri
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 11
structure length 76
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rd4A00
3RD4A 2L0CA
chains in the Genus database with same CATH superfamily
1SXTA 1KDBA 1SEBD 2F0VA 3D4RA 3E0EA 4XYOA 3MTSA 3CMAA 3KUPA 1EEID 3GO5A 1SNPA 3I4OA 1ENFA 1RHPA 4OGQC 1HNXQ 1Q82C 1Z9FA 2KHJA 1QJOA 4FDBA 2EPBA 4JI6L 5M5WB 1CI3M 5M3MH 1E1TA 4FF1A 3PUZA 4KTAA 2B2TA 3HOYH 4HJ9A 3I70A 2QEXA 4FF3A 1J8IA 1F2YA 3GTMB 3K8AA 1TWGH 5IT9c 1B9NA 1C9OA 2R7ZB 1L2FA 4B3MQ 2EY5A 1B70B 2RHSB 4QY7A 1PFSA 3PMFA 1RJTA 2E5LQ 1ASZA 1QZGA 3K5MA 2B2TC 2L0CA 2NN6I 4A3KG 5E1FA 3VR2A 3GTGH 2J4XA 2KQ3A 1KDCA 2EQSA 5JPNC 1LT6D 5HGTA 4A3EH 2G5DA 4BBRB 2E75C 3CRKC 3MAQA 2OEOA 3HP3A 4X62L 1PLFA 2WAQG 2K33A 5FLMG 3K5LA 2ZXRA 3SEBA 3U50C 1PYBA 5JEAJ 3GTJH 1QNUA 4LFAQ 2N78A 1CKNB 2JA6G 3R3OA 3HOXB 3MA2B 4ZUJA 1H9MA 5ISRA 3M7GA 1WCMB 4JBJA 5CV7A 3MWYW 4DFAA 4BS9A 1VMCA 4IO9A 1I6VC 4GKKL 4ZQ3A 3PO3G 4GLXA 1I4GA 1II3A 4NDXA 1ML0D 2MO1A 1OXVA 1PH4A 1AE3A 3OSOA 3KBXA 1PTOB 4K0KQ 2F0TA 1S72A 1HJPA 2Z6BA 2QCPX 2GN5A 1NAPA 3T1YL 5KRUA 5IYCG 1GVPA 4B3ML 4AQYL 1PTOD 1YNJD 2XNAC 4KD3A 1U4PA 3P20A 4MHEA 4XQJA 1SYGA 1VQOA 1HHVA 1B44D 4DXGA 2KHIA 2F0JA 1F9PA 1WD0A 4APVA 3MXGA 3F8TA 3GD7A 1MSGA 1WOCA 2O2LD 2RSOA 2JA5H 5KEEA 3KF8B 1K8MA 1I3QH 1SE8A 3PQIA 4QCLA 2R7ZH 3HRZC 1PZID 3I4LA 4XIGS 3UDIA 2JA8H 1CK1A 1SJED 4A3IG 1IKMA 5EAYA 1JT8A 4LFAL 3MVVA 3GTQH 5FKAC 4LF8L 3S1RH 2EZVA 5M5WH 2YU9H 1G291 4KK7A 3VYSA 3KJOA 2UUAQ 1ZEQX 4DAYB 4HIMA 1E1OA 4KMUC 5K5PA 4K5XA 1PZJD 3OWFA 1KQSA 2F0EA 2EVBA 5C0XH 3K57A 3RLFA 1ENAA 4JI1L 4A3MB 4X64Q 2JP1A 3E3XA 1AFPA 2V1CC 4FNFA 4DR6Q 2EJFC 3PIPA 2BA0A 4QIWB 5T1GA 2Y0SB 2YTXA 2K5QA 3CF5A 4A75A 5EJWA 2TSSA 1CUKA 4MTNA 4XTCS 3BZCA 1UE1A 3S1RB 3OTOL 1LV9A 1WTRA 2CVRA 2F0NA 4FF4A 3J81j 5CORA 3BYTB 3NXWA 1STEA 1TS3A 2XWBB 3K0XA 4B3SL 3N6RA 5FO8B 5IGGA 1IXRA 4RGNA 3IFTA 4GOPC 2RVLA 3HOXG 4BY7H 1A6XA 4GLAC 2AQ2B 3ERQA 1F2LA 2KEDA 1HRJA 1ICWA 1VF7A 3KDFA 1EY0A 1I3QB 3H91A 3IFDA 5IYDG 1HNWQ 2YV5A 3SK4A 2JA7G 2F0MA 2B8GA 1NUCA 1HZCA 1IL8A 4NP5A 1NMFA 1UE7A 1GOZA 1U4LA 3H6MA 1VMPA 2HUGA 4HJ7A 4B3TQ 4A3DB 4GS3A 1V43A 1PH3A 1I94Q 4MN3A 3SGIA 4DAVA 1EQTA 1V8QA 4A3GH 2M9VA 1MD2D 4RGMA 1Q12A 1BCPF 5C4XH 3J81E 3K0YA 4JI2Q 3HOWB 4E6IA 3PO2G 2KCTA 2VB2X 2R7FA 1TR5A 4EVOA 3O13A 3PIO3 3QIAA 2YTYA 2NWGA 1Q46A 2HCIA 2KBNA 1M4VA 4C2MH 3PGZA 4CGYB 3KJPA 4JOIA 2ICIA 3LGJA 3L9AX 4JK1C 2Z4HA 2OQ0A 1PTOH 4OO1G 1Y1VH 3M9BA 1B7YB 1WCMH 4R4CA 5NUCA 2A68D 3M4OB 1Q3LA 3A5ZB 1N8RC 4HTHA 2WACA 3UDFA 3ONAB 4JI4L 3HOVG 3OYYA 4P71A 1JCKB 4HSVA 3TDQA 4JYAQ 1K73C 3FVQA 1LTTD 2KVMA 1C4QA 4X3TA 1VQ4A 4BBRG 2EYMA 4A3GB 4LFCL 3CC4A 1B3AA 1TS2A 1PH2A 4AYBB 1HNWL 3KF8A 1S40A 3UE0A 4OHJA 1SYCA 1WVLA 4LFBQ 3CCEA 3S2HB 3CCJA 1CTMA 2F03A 1TWCH 2EDGA 1BCPD 4UDUC 2BA1A 2VXWA 1SROA 1KD1C 1KTKA 1STAA 1S5FD 1D6EC 3K7AH 1FD7D 3T4AC 4JI2L 1A15A 3RMHA 5C0XI 3J81i 5GAGC 3DMUA 1KRSA 2N55A 2CW0C 1YIJA 1S5CD 2K4KA 3S16H 2AKWB 1UEBA 4HSPA 4HR7B 3GTOH 1B1ZA 1OXUA 2ENBA 2B2VA 1CKOA 4BY1B 1EYGA 3HKZB 1BBXC 1PYSB 3SK5A 4OIKA 4NW2A 1CKNA 5CV5A 1RL2A 4JI4Q 3HOVH 3OMCA 3VR3A 2NTSA 4ALPA 4JYAL 2CH4A 4OIJA 3J7A5 5KNCA 4LF9Q 4LF4Q 1YHBA 5C3EG 3KOJA 1A3UA 3VR4A 2E2IB 2VZAA 1Y1VG 1Y1WG 2B63H 3IAYA 2JEBI 4NB3A 2E8GA 1VS0A 3NK9A 4LFCQ 3FHWA 4ZRZA 1DD2A 4KY6A 3CC7A 1EFID 1SFOH 1NMGA 4HJ5A 3QB3A 3BDOA 1WYDA 4HAEA 4JOIC 4N9TA 1PH8A 4LF5Q 3ERSX 1TWAB 3X3NA 1H95A 1SJHD 4XQNA 1YJWA 4H02A 2K5NA 2L55A 3WOFA 2RSNA 3MXUA 3CD6A 4PMCA 4A3GG 1VQIA 1UE6A 1DOLA 5HY6A 2HIVA 1N33Q 1KLUD 2JA7H 3CAMA 2R3ZA 3STBD 3DLLA 4MZ9A 4R8NA 1CZWA 3FKIH 5GAHC 1UEAB 1WI5A 1RODA 3UDXA 3CCVA 5C4JB 2ID0A 4G57A 4KKSA 1ENCA 4DV3Q 1BO0A 3CQZH 1E24A 3KK7A 3K7UC 4GOPA 1VQJA 4UP9A 3M4YA 2MPMA 5CBEE 1PTOF 2D9UA 5JOBA 1G51A 4LF9L 2DNEA 3I4NH 3E9HA 3T51B 1HPCA 1NTGA 2VL6A 4POFA 1RIPA 3WOEA 2Z1CA 2CQAA 2ZTEA 4X3KA 2F0PA 2Q2IA 2IY5B 3S1MH 1VQ9A 5EPLA 5CGKA 4TVAB 2JSOA 4L5RC 5EBDA 5TSSA 2R93B 4KKUA 4OXPA 2UU9Q 3PIOA 3GTJB 2F0KA 2A8VA 4R4TA 1AH9A 2VUMH 2ZM6Q 1DCZA 2LY7A 4I65A 1XPOA 4DK1A 1KAAA 2BE5C 5J3BA 2RCNA 3Q24A 2MJ8A 5FOBB 3MXPA 4FXGC 5G3LF 3GTKB 3H0GB 2VS1A 4KKTA 4DF7A 1OXSC 4DK3C 1VQEA 3J7YW 4WJ4A 2JQOA 3AQQA 1TWFH 4A3JH 2F3IA 2R92B 1MIUA 4G7OC 3A7LA 3L2PA 2JA5G 2PNHA 5C5LA 2A6HC 4A3CG 3R8BA 2JA8B 1A3VA 1PMRA 3B6YA 3S2DB 4DUZL 1B4OA 3Q6SA 4ZK9B 1SLJA 1CQVA 2A68C 2K28A 1A62A 2F1MA 1SR3A 3AMUA 1KL9A 3FDTA 2D0OA 3G71A 1B3QA 3DEPA 2HHHQ 2LFNA 3FKIG 5LL6S 3J80L 3PUWA 1GHKA 3PO2B 4LW1A 4CJ1B 2FHTA 3SVMA 4K2LA 3EIVA 1VCIA 3NBHB 5JJKA 2DNCA 2WB1G 2A6EC 2NYZD 3I4MB 3S15H 2QKIC 1T5XD 2VUMG 2JA7B 1PTOC 1YNJC 5ELDA 1D7QA 1O80A 2KECA 4A4IA 1S4ZA 4AH6A 1EY4A 1RKNA 2I5LX 2PW7A 1O7YA 1V9PA 5M5YH 4RG1A 2RDHA 3TZUA 1LTLA 3KLSA 1HFNA 1KC8C 3NTIA 4R4QA 2JA6H 1CKMA 2Q2UA 2I46A 3R2IA 5E4XA 2NZOA 3PO3B 4IUNA 2PQEA 4X6AH 4K14A 1LT3D 2KHSA 1Q7YC 2I5MX 1GHJA 1AEXA 1I5FA 2L12A 2L9HA 1AW7A 4IJLA 2VW9A 2JA6B 3T53B 2KUMA 4BY1G 2OF1A 5M3FG 2KEEA 4IUQA 1EZ6A 3AB9A 1LTAD 1JJ2A 4DUZQ 1ILPA 1N32Q 4JPBW 2E2HB 1UWVA 1AE2A 1QILA 3I90A 1PH9A 4GOPB 4WJ3M 3PUXA 1D2BA 2HHHL 4A3MG 3EBEA 3OMGA 4JI7L 4YWLA 1C48A 1TS4A 5EPJA 4DR7L 1W2BA 1GXDC 4IPHA 2K5VA 5M3MG 1NSNS 1OXXK 3DWAA 4RWSC 5M9OA 4AYBG 4PMBA 3LWUA 4FXDA 5EGTA 1JB3A 2K75A 2R92G 3OW2A 3G48A 5DM73 1Q81C 4EQ5A 3TP8A 4XT1B 1M8AA 2B2YA 1B53A 2XRQD 3K5NA 2UXBL 5KNBA 2BDNA 4CDDC 3NWSA 2A6ED 1GUNA 4JC0A 4GN3B 2HQEA 1CHQD 5I9OA 3A7AB 1F9RA 1EYAA 1JICA 2QF7A 4C3HG 3L0OA 3HOZH 3AFQA 4A93H 3H0GH 2WAQE 1LT4D 1EIYB 3TMEA 5A2QL 3UI2A 4O1NA 5HGQA 3GTPH 1KXLA 4NKLA 1X9NA 5IWAQ 3J7AF 2I07B 1KIXA 3NWTA 1T9HA 1F77A 2K03A 4TSSA 5CV6A 1SN8A 2LKVA 4KHZA 5C44B 3EA6A 4JI7Q 2O5IC 4DR1L 5KNDA 1HTLD 1PRTB 2P5ZX 4LUVA 3A0JA 5EBCA 1K8GA 2AHOB 4JCVE 3RN5A 1VQPA 1I4QA 1BQQT 4POGA 3SDZA 4JBMA 1JJGA 2YYZA 3RZOH 4L5TA 3PV0A 3W1BA 2CQOA 1U9RA 3NP8A 4FF2A 1CM9A 1PH5A 1Z47A 1XYIA 4ZLTF 4CDEC 1QCBD 1PA6A 2JE6I 3BZKA 3NPPA 4YCUA 3JAMi 4OEMB 1Q8IA 4DAYA 3J7AV 2GVBA 2UXBQ 4CDFC 4QJFA 3DWQA 3M4QA 5EKIA 3SR1A 1IHZA 4DV5Q 4A93G 1K0RA 1K3RA 4IQZA 4CJ0B 1N9WA 4H0LC 1L0YB 3M3YH 5M3FH 1Z6HA 3HZXA 4YIJA 3D8GA 1SBBB 2WB1E 1VQ6A 5ELOA 4KHPQ 2F0OA 5T1IA 4NXMQ 2B2WA 1QOHA 1STHA 4IALA 5JJIA 4RHRA 4YCVA 4HIDA 4QB4A 1DYQA 3ND8A 3AYHB 2PZWA 3S2DH 3TP5A 2PMZB 3UDGA 1XPRA 4RFBA 2OTLA 4JV5L 2R92H 1A8VA 5ELFA 2H4OA 2F0SA 3S1NB 4DV1L 4JI5Q 1IW7C 4C3HB 3M7NA 5LL6X 2C5CA 3ULJA 4FO2A 4JI3L 3Q0AA 4DR1Q 4LUZA 2JA9A 3DM1A 4IFDG 1PFNA 2MUYA 4OWXB 3J80E 1DONA 3H3VH 3I8ZA 3EFXD 4FP5D 3J80i 4B3RL 1U5KA 1STBA 5LMUQ 2UXCQ 3CP0A 3FP9A 4JI8Q 3S1NH 3NTHA 3GTLB 1LTGD 1HFGA 2OCEA 4DV5L 4BY1H 1VQ5A 3GP7A 1QVGA 1XMQL 3RNUA 3I2ZA 1LYLA 1NR2A 3OWEB 3ULPA 1MJEA 2UUCQ 2QDLA 1EIHA 3GTMH 2VQFL 4HMIA 5IGCA 4KHPL 5GQOA 3A55A 4NXML 1DXMA 5C44G 2SNMA 1D1IA 1FNVA 3GQBA 1E0BA 3BVMA 3NELA 4KHVA 3S17H 3NBHA 1KABA 1DOKA 4DR3L 2DJFC 1DJRD 1NY4A 2K32A 5KIXA 3NBIA 4QF4A 4IFDI 3FEWX 1IKLA 2XIWA 1VQLA 2ZJPA 1O7ZA 4JI5L 3J81L 4DV1Q 2DJGC 1XXGA 4JI6Q 4X3UA 1TVXA 3H09A 3CCLA 1SAPA 4GKJL 4J6HA 1VQAA 4M8AA 1XNQL 3HKZG 1WTQA 1BKBA 3KLSX 2UXDL 1PYWD 2LSSA 1XX8A 4NPSA 1PXUA 2EY1A 4DV0Q 4F7XA 1YNXA 3P75A 3SK8A 1K83H 3TS2A 1PFMA 5JJZA 1XMOL 4MIUA 2PI2A 3HS0C 3HEJA 4IOCA 5C44H 3KYHC 3I4NG 4IUTA 1G91A 1A3TA 2E74C 4IPDA 2MFIA 1S5BD 3OW7A 2L1BA 1AZQA 2AWOA 4X62Q 3MFYA 4DAMA 3C46A 4A3JG 4X66Q 5M5YB 1K9MC 4C2MB 2FINB 1VQHA 4C1NI 3G7LA 2KOLA 3C3LA 3I73A 4KV6A 5FK9C 1IBKL 4HCEA 4UPAA 2TMPA 1TIID 2EIFA 1DOMA 3BU2A 1X55A 4TKOB 3T1HL 4GKKQ 4U673 1CHPD 3A8JE 4TQUS 1TU2B 1EY7A 3GV3A 4H44C 1FNUA 3GTOB 2DGYA 3TQYA 1P16A 2K01A 1XNRL 2GA4B 2RF4A 4ZCKA 4K0KL 5K36H 4Z9CB 4DPGA 2NVQH 5CV4A 4I7ZC 1X3QA 4DR2L 1GUWA 1XNQQ 1HH2P 2N49A 3HOYB 2UXDQ 5C6AA 3Q8DA 4AQYQ 3TBIB 4DV0L 1NR4A 2F0FA 1IYUA 3K5OA 1LTID 3GDEA 4A3FB 3FPPA 4QL5A 1MHWC 4QUCA 1BVSA 2AUJD 5BN3A 4GNXA 3MEHA 3TS0A 4LF6Q 4HIKA 4YWMA 4ABNA 4A3EG 4OX9L 2DY8A 2NZ1D 1WTOA 4DV2Q 4A3LG 3V96A 1HZ9A 1K8AC 3S24A 2WB1B 1TY2A 1FVIA 3SXHA 5D65A 4OO1I 4X66L 1G8ZD 1QG7A 3I91A 3NUCA 1L1OA 1QUQA 5E7NA 2KCMA 1OTCA 3BVZA 1ZYRC 3A5UA 1Q1BA 4KI0A 3Q23A 3HOYG 1SMYC 2IT1A 2NUCA 3CPFA 4KLKA 4S3SA 1X6OA 5IGBA 3A54A 4NXNL 2PI2E 3EQLC 4JBWA 1XNRQ 5A35A 4JI1Q 1N36L 1FR3A 3KF6B 1Q1EA 2MNAA 1STNA 3I4NB 4CBVA 1JOQA 1IW7D 4DR2Q 4DR6L 5C4JH 3MFGA 4ILWA 1HQRD 1HNZL 2PYKA 2AWNA 1PRTD 2SEBD 4UAIA 2Z9HA 3JC66 4HJAA 4ZKCB 3CQZB 4DN4M 4WFN3 3OTOQ 4ID6A 1SNMA 3VDYA 3CC2A 1WTPA 4LF6L 4PZ7A 4K2KA 1EYDA 1PZKD 4M1UB 4DGZA 4CJ2C 1CSQA 1TY0A 5FO9B 3S17B 1L0WA 1EWIA 2XSCA 4IN3A 2RBMA 3U9OA 1FYCA 1IBMQ 2EXDA 4CHTB 1BR9A 3DHQA 2EE1A 3KDFB 1Y8PB 2VB3X 2F3WA 3L3OC 2NN6G 2M2LA 2FFKB 4B9WA 3V05A 2OT2A 1I6HH 5E3FA 1QUQB 1E7ZA 1I94L 2G9DA 1IL2A 1K3BC 4DR5L 1HZBA 5BR8L 4LK1C 2B3GA 2F0QA 2M00A 1SFOB 2BH2A 4NXNQ 3BZDB 1H9JA 1TS5A 2JYOA 5FLXc 1SYFA 3RD4A 3TEHB 2ATWA 4ME5A 3HKSA 2A69C 1HA6A 3V2TA 5LHY1 1Y14B 4A3BG 1JORA 4DXFA 1I4XA 4A3MH 4TRDA 1MKHA 1ESFA 2V4DA 4BBRH 1HNZQ 3EN2A 4IPCA 4GN5A 4AYBE 3H0GG 1YBYA 2WKDA 2R93H 3HOZG 4XXEA 1EY9A 2B8FA 4C3HH 1T5EA 1HQMC 4FXKC 4Q0FA 2E2DC 2IPKD 2K05A 3W3AA 4A3LH 1YJNA 1VQ7A 3K59A 2KENA 3J81c 3K58A 4YY3Q 4OWWB 3H3VC 2PZUA 3GTQB 3PUYA 1E3PA 4GNXC 1M1KC 3K6OA 4UY8C 1TWGB 3VYUA 1WCMG 2JA5B 3DXJC 1VQMA 1EWHA 5CR3A 1A0IA 1K0SA 3OIQA 2N3SA 4LAAA 3I55A 4LFBL 1JWUD 2HDLA 5C4ZA 4R8IA 1I50B 1JMCA 1KHIA 5K36G 3OPOA 2SNSA 2X6GA 1F9SA 1TKWB 3KLRA 4HCSA 4DV6Q 4DR5Q 3S2HH 2F0WA 1J5EQ 5BR8Q 5J39A 2QDBA 2A1AA 2Z6KA 5M5XH 1LO5D 3GV6A 2FMCA 2QEJC 4J8QA 2DUDA 1BF4A 5IYDH 3NEMA 2HIXA 3H15A 2C35B 2ZTCA 4N8FA 5GAEC 1D5ZC 4A3IH 3VA5A 3T16A 2AQ1B 3K80C 1N34L 3ER0A 5FLXL 5JPMC 3M4OH 3G4SA 1SSOA 1K8OA 4RCOA 2EYPA 5LMNQ 2B63B 2EYFA 1PVOA 2XGTA 1VQBA 4YY3L 4ODGA 5M5XB 4IZ8A 1C7YA 4LF4L 5GROA 2XVSA 3MC0B 2BDOA 4A3EB 1BCPC 2Q8RE 4LF7L 4BBSH 4EX5A 3URYA 4A93B 2KJXA 1J6QA 1I50H 3E9IA 3M85A 4Y7NH 4X65L 3ULLA 4K6LA 1HZAA 1AP0A 2E5LL 3W1GA 4G4KA 1G2TA 1RCVD 1U4RA 1H9SB 2Q2TA 2IWHA 3RN2A 4DK6C 2MO0A 4ZAIA 2B2UA 4U68A 4IUVA 4RGOS 1ET9A 3CXCA 4YHHL 5CV9A 4DV6L 1YVCA 5KYLA 1ESRA 1EFWA 1J5EL 1J9OA 3BS1A 3NQTA 1NCVA 3I7FA 1QB5D 1X3FA 1NBWA 1EQRA 5M3MB 4IURA 2VQEL 4GNXB 2NVQB 4K5WA 5IGEA 3H3VI 1O78A 3P7JA 3RZDH 1B9MA 1STGA 3ND9A 5I4DA 1GJXA 1XJVA 1YNND 4L6TB 2RA4A 1TWCB 4O0AA 1D8LA 4JW0A 2EYLA 1KNAA 2L11A 3OHXC 4A3CH 3EROA 3CRLC 2A6HD 4R1JA 5DNFA 2F0HA 4N9PA 3CW2C 1X56A 4F87A 1QVCA 3BDCA 1B50A 2MHVA 5LMNL 3GTKH 1HUNA 1BBUA 3CU7A 2WP8J 1OXTA 2D0PA 3E0JA 2DY7A 5IOCA 5H1SE 4LF7Q 2YTVA 3T1YQ 2R61A 3CCMA 5IYCH 2O4XA 1LTBD 2ICEC 1JE5A 1O7IA 2NVYB 4IJHA 4JVZA 5AJ3L 5ELBA 4X65Q 4KJNA 4MTKA 2HDMA 1I6HB 3FRPB 4YCWA 5C5MA 5COYA 3WDNA 4DV7L 4A76A 1VQNA 4IFDH 4JBKA 1KAWA 3CCUA 1BNZA 1ZYRD 2I5HA 4YHHQ 5IT9L 4CKBA 3JAMc 4PG3A 4OL7A 1UNSA 3I56A 2ASBA 1EQVA 4B9XA 3F2CA 2RDFA 3I4MG 1A2UA 2J7ZA 5E4WC 1EEFD 1XTDA 5EKLA 2VQEQ 3MXNB 4HIOA 3PSIA 2IW3A 3KBGA 4EQNA 4K8JA 2Z4IA 5IT9E 1LUZA 4LF8Q 3HGBA 3U58A 4EQOA 2F4VQ 3I4MH 3LX0A 3HG9A 4GZYC 3FKIB 1G6ZA 4QIWE 4QGUA 2UUAL 3KFUA 2C9OA 3H94A 3HOUB 1R4QB 1PRTF 3T13A 1GM5A 5EPKA 1SE2A 4X64L 5F2DA 1SE4A 1EU3A 3C2PA 2AQ3B 4DAPA 4G7ZC 4ULLA 1EOTA 3R93A 1NJIC 5AJ3Q 5FJ8G 3BDLA 4EQPA 3R2TA 1QZHA 1RD9D 1GUSA 1WTXA 2NVYH 5KGUA 1C0AA 4IUPA 4B3SQ 2L5TA 5I2YA 4DV7Q 2CW0D 2RKSA 1U4MA 1AN8A 3D3RA 3QJYA 4XYQA 1Y8NB 3GTGB 1R9TB 2IX0A 3HOUG 4QUFA 5HURA 4DV4Q 4B3TL 2LMCB 2F4VL 3RZDB 4BXXG 4C3JB 3ITPA 3G6EA 1WTHA 1CA5A 2A73B 2E2JB 3ZJYC 3LWEA 5IP9H 2ZJQA 3T56B 3S16B 4KY7A 3S14B 2LXKA 3J80c 5IIFA 1VQFA 2B2UC 3A56A 3K7AB 1WTWA 3CCRA 4A3DG 1WFQA 4A3KB 1DZ1A 4OO1H 2D5DA 1EIGA 4K8IA 1X3EA 4P73A 4P75A 1JB7A 4BBSG 2K1BA 1HR0Q 3M3YB 3I3CA 4DR7Q 1MJCA 4AIMA 1M90C 1TWHB 1HTPA 1SYEA 2OQKA 3QWNA 2F0DA 2IL8A 2JXMB 1VQ8A 2KCNA 1R9TH 4RH6A 2CH4W 2PW5A 5D14A 1PRTC 5C4XG 2OWOA 2K04A 3QOJA 4HJ8A 5IY0A 1KLGD 4LNQA 1WJJA 4K6DA 3A8KE 1ICFB 2WFWA 3D4WA 1B8AA 3D6CA 1JQYD 1E2ZA 1ET6A 5JEAG 2ES2A 2R6GA 4DNTB 2WV6D 3NTKA 5EQ0A 4ZKBB 1PH6A 4L5SA 5JEAH 4Y52H 1NE3A 2R7DA 1JC7A 4P74A 5A2QE 1K83B 4PQXA 1I4RA 3TP7A 4DV4L 4A3IB 1A2TA 1I4PA 2K5DA 3HOXH 1YEZA 2OXPA 2D2CC 2Z6KC 2ZT9C 1ILQA 2RCFA 3NSWA 4NMZA 4LUOA 1IBLL 4R9WA 1WD1A 2F0GA 1S5ED 5I6YA 2Z8LA 5IP7G 4WORA 5LMNW 5IGDA 3NQIA 1SNCA 4ME3A 1YHQA 1P8LA 5J22A 4RGTA 2F4IA 3VYTA 5C3XA 3QG1A 4C1NK 5FO7B 1XWEA 4L8JA 1CA6A 4A3DH 2CHBD 2VNUD 1HR0L 3S9WA 2JK8A 1KDAA 3PO2H 4XDXA 1QE6A 1Q90A 4DNIA 2MGSA 3BYYB 2XRSD 5C0XG 4L63B 1A63A 2K6AA 2WKCA 5IE8A 5J1ZA 3U4ZA 3P1HA 1W6JA 4PNYA 1Z7TA 1D5XC 4RA8A 5DLQE 4BXXH 4CKCA 1QWYA 1V1PA 2EJGC 2MP1A 3CPWA 2PMZE 2K5WA 1PHJA 1FJGQ 4DK0A 4C3JH 3VR5A 4CKEA 4A3BH 1BXTA 2Q8TA 3SHLA 4BY7G 2K5HA 1SRUA 2K52A 2NTTA 4LF5L 1TWFB 2H1EA 1W6KA 2LS01 1KNEA 5C3EB 1U0LA 2EJMA 4H13C 4X3SA 1IBLQ 3AFPA 5L37A 5JVH3 2IX3A 2QGQA 1X3PA 2JEAI 1DM0B 4C3IB 3JAML 3TN2A 2NVTB 2WINB 2E2HH 1E2WA 1LTSD 1EL0A 1N33L 1Q8KA 3TP6A 2BE5D 4JV5Q 2NN6H 5C3WA 1FGBD 1D1KA 1HA5A 1YITA 5CYUA 4DNRB 1GD7A 1D5MC 4DKAC 1CSPA 1OO9B 4R4OA 2YU9B 1EY5A 1JWSD 1H9RA 2OTJA 2BCOA 3VYRA 1RDPD 1Y1VB 1LACA 4JG2A 1SYBA 4DV3L 4WJWA 3PO3H 3UE1A 2IJ0A 3M4PA 4BWGB 1H9SA 2SOBA 5GADC 1X3GA 2KCCA 2PQAA 4IUUA 4LMQD 3RR5A 3DUZA 3VR6A 2RQXA 4V190 3S1QB 4B3RQ 3F2UA 4OONA 4UP8A 4JI8L 3NE5B 1B2TA 1GUTA 4RKBA 2CKZB 4DR4L 2BOSA 1FJGL 3CKIB 4C3IG 1V1OA 1FNWA 3TSSA 2IHEA 5DM63 1UE5A 2UU9L 2WAQB 1RTNA 2UUCL 2QW7A 5I6WA 3HFZB 2ZM6L 1PFBA 3OOCA 3CMEA 1RF2D 3N52A 4JI0Q 4XQQA 2X6LA 3KLWA 4BA1I 1VQDA 4EGVA 3RZOB 3S1QH 2L15A 1ASYA 1AZPA 1CFMA 2WIIB 1IYVA 4XT3B 4BA2I 2ZXPA 2QA4A 5I9PA 2PNRC 4PV1C 1L1OC 3EVQA 1PH7A 2EYJA 2RHQB 3TREA 4IOAA 4GKJQ 1YHAA 1E2VA 2E2IH 1EY8A 2K14A 4QQBX 1IZ6A 2SDFA 3D4DA 4RMFA 1VQCA 2GVAA 1EIFA 4C3IH 4V0BA 3VA7A 3ICEA 2CWPA 1E22A 5ELNA 4J1MA 1DGSA 3HOVB 1EY6A 1Y1WH 1XMOQ 2B63G 2XTIA 1FL0A 2NVXB 1GUOA 2FMMA 5C3EH 3CCSA 3F1ZA 4DR4Q 1EUJA 3OIPA 3E5SA 4A3FH 2FXQA 3U4VA 4O2DA 4MNOA 2AMCB 1YI2A 1SE3A 2PZTA 2CWAA 2F52A 2Z0SA 3C1FA 4A3KH 2LXJA 1MI2A 5FLXE 4K5VA 4JI0L 3L7ZC 3W2DA 2EY2A 5KYIA 2B2VC 3CCQA 3DEOA 4YWKA 1YZ6A 2O5JC 4KN4C 4C56C 1S3OA 4R4IA 1S5DD 3D6WA 1IBKQ 1EYCA 1XPUA 1JOKA 3GTLH 4DU9A 2K7VA 2VY3A 5BN4A 3MEFA 3NHHA 2XN9C 3T1HQ 1HR0W 4HMJA 4F88A 2B39A 3U9SA 3PF4A 2EY6A 1JJCB 1ONLA 1YNNC 1Q86C 3F2BA 3IKJA 2A19A 4IPGA 2H5XA 1JR0D 4DA2A 4B08A 1L1OB 4HN7A 1EWCA 2IHFA 3PUVA 1Y1WB 2NB0A 5JAVA 4PZ6A 4BBSB 2L4NA 3E6ZX 3SE0A 2EYOA 1GUGA 1EOVA 3HOWG 4ZUIA 3AEVA 1TQOA 1SNQA 1N32L 5JJLA 4GN4B 3DM3A 1LT5D 2UUBQ 5CV8A 1GO3E 1EU4A 1Y69U 4KJOA 1MGSA 1LTRD 2A69D 4RCNA 1R4PB 2HQLA 3BG3A 4PMWA 4OX9Q 1TT2A 1BDOA 4DV2L 1SNDA 1RTOA 2JN4A 1STYA 1HUMA 4KY5A 3WWVA 2QILA 3A74A 1ZKOA 3BJUA 2N88A 2ZTDA 4J15A 1LM0A 5IYBH 5EKKA 3IRBA 4KD4A 3G6JB 3S15B 3X3MA 2X69A 2EYHA 3ZYYX 2HT1A 1MBYA 1BBWA 5JVG3 1TWHH 1SNOA 2PPBC 1X65A 3TZDA 2IX1A 3FPUB 2HD3A 5CMDA 2A5HA 3FMCA 1ZXTA 1SYDA 3QR8A 1PH1A 1V1PB 2HCCA 1F2ZA 2E76C 1UUPA 5IP7H 2MQHA 4HEDA 2F0IA 4N8X1 4H7BA 5IGFA 5D3DA 3SK6A 3D0FA 3S14H 2FJ2A 1N36Q 4FYDA 2KA7A 1L0XB 1JE4A 4C3JG 1PDQA 1C8CA 1VQKA 2PCFB 1PV4A 4BY7B 1WTVA 3JAME 2R93G 1BOSA 2UUBL 5IWAL 1FGUA 4A3JB 3TRZA 2E2JH 5DAUA 1GKHA 3PF5A 2NVXH 3IL8A 2NVTH 3DWPA 2Y0SG 3MZ5A 1QVFA 3PCOB 4LJZC 4PZ8A 3HKZE 5G3LD 2NBFA 3BVGA 1F9QA 3HOZB 3MXNA 1IBML 3C1EA 1CQFA 3KF6A 5I2XA 3NENA 4DUYL 2ALYB 1LLRD 4P2CB 2VUMB 3MHBA 3EJIA 3QO2A 2CCZA 3RUZA 3W5OA 4A3BB 3LNNA 3I72A 4LWCA 1EZ8A 3S1MB 2JJQA 1IYJB 1SDFA 4ZYSA 3CHBD 5IYBG 2D62A 4WRDA 4UHVA 2J0TD 2B2WC 1V1QA 1BCPB 5IP9G 5CBAE 4L5QA 4RHSA 1X32A 5CC4A 4F8MA 4I7AA 1O7LA 1HXYD 3RLOA 1G2SA 5M3FB 1VF5C 2F3VA 1HCZA 2JA8G 1LABA 2B29A 2RDGA 3HOUH 2BH8A 2I0QA 2AUKA 2R7ZG 1X54A 3HOWH 5C4XB 2F0UA 1BUVT 5ELCA 1HNXL 2PO4A 1YJ9A 1W3SA 2XWJB 4OWTB 4Y7NB 3J7ZC 4JI3Q 4IFDJ 1SMYD 4RAUC 5D3IB 4G7HC 1F2MA 2CFMA 2Q2HA 1VDZA 3Q22A 1H9KA 1JWMD 4RKLA 2F0LA 3RLNA 1G6PA 5FJ8H 4DUYQ 1UAPA 2K50A 1QNKA 4KN7C 5LMUL 2UXCL 1KRTA 2PQAB 3QOLA 4P72A 4Q5VA 2Y0SE 2G9HD 4GLVB 5C4HA 1TWAH 2ZJRA 2NZHA 5BN5A 1K28A 2DN8A 1VQGA 4CDCC 1JOOA 4UP7A 1CZGA 3STBC 1XMQQ 1EQQA 1I4HA 2Q8IB 3GTPB 5IODA 2EOTA 3K81C 2VQFQ 4A3FG 3F2DA 1NNXA 2A74C 4QMGA 5C0XJ 1MSHA 1CT1D 4FVMA 3D31A 2N8NA 2EXZA 1TXYA 3PIP3 1XTCD 1Y8OB 4O42A 4DR3Q 2B2YC 4OELB 1SMXA 5AFWA 5FLMH 1N34Q 5ELEA 3AU7A 2ZXOA 3A8IE 5DEHA
chains in the Genus database with same CATH topology
1SXTA 1KDBA 1SEBD 2F0VA 3D4RA 4XYOA 3MTSA 3KUPA 1EEID 3GO5A 1SNPA 4OGQC 1ENFA 1RHPA 1QJOA 2EPBA 5M5WB 1CI3M 4FF1A 3PUZA 4KTAA 2B2TA 3I70A 4FF3A 1J8IA 1F2YA 3GTMB 1B9NA 2R7ZB 2EY5A 3PMFA 1RJTA 3K5MA 2B2TC 2L0CA 2NN6I 5E1FA 3VR2A 2J4XA 2KQ3A 1KDCA 5JPNC 1LT6D 5HGTA 4BBRB 2E75C 3CRKC 3MAQA 2OEOA 3HP3A 1PLFA 2K33A 3K5LA 2ZXRA 3SEBA 5JEAJ 1QNUA 3R3OA 3HOXB 4ZUJA 3MA2B 1H9MA 5ISRA 3M7GA 1WCMB 5CV7A 3MWYW 4DFAA 4BS9A 1VMCA 1I6VC 4ZQ3A 1I4GA 1II3A 4NDXA 1ML0D 1OXVA 3OSOA 3KBXA 1PTOB 2F0TA 2QCPX 1NAPA 5KRUA 1PTOD 1YNJD 2XNAC 4KD3A 1U4PA 3P20A 4MHEA 4XQJA 1SYGA 1HHVA 1B44D 4DXGA 2F0JA 1F9PA 1WD0A 3MXGA 3GD7A 1MSGA 2O2LD 2RSOA 5KEEA 1K8MA 4QCLA 3HRZC 1PZID 3I4LA 4XIGS 1CK1A 1SJED 1IKMA 3MVVA 5FKAC 2EZVA 1G291 4KK7A 3VYSA 1ZEQX 4KMUC 5K5PA 4K5XA 1PZJD 3OWFA 2F0EA 2EVBA 5C0XH 3K57A 3RLFA 1ENAA 4A3MB 2JP1A 1AFPA 4FNFA 2EJFC 2BA0A 4QIWB 5T1GA 2Y0SB 2K5QA 5EJWA 2TSSA 4XTCS 3S1RB 1LV9A 1WTRA 2CVRA 2F0NA 4FF4A 5CORA 3BYTB 1STEA 1TS3A 2XWBB 3NXWA 3N6RA 5FO8B 5IGGA 4RGNA 3IFTA 2RVLA 1A6XA 2AQ2B 3ERQA 1F2LA 2KEDA 1HRJA 1ICWA 1VF7A 1EY0A 1I3QB 3H91A 3IFDA 3SK4A 2F0MA 2B8GA 1NUCA 3H6MA 1IL8A 4NP5A 1GOZA 1U4LA 4A3DB 1VMPA 2HUGA 1V43A 4MN3A 4DAVA 1EQTA 1V8QA 2M9VA 1MD2D 4RGMA 1Q12A 1BCPF 3J81E 3K0YA 3HOWB 4E6IA 2VB2X 1TR5A 4EVOA 3O13A 3PIO3 3QIAA 2NWGA 2HCIA 1M4VA 4CGYB 2ICIA 3L9AX 4JK1C 2Z4HA 1PTOH 4OO1G 5NUCA 2A68D 3M4OB 1Q3LA 4HTHA 2WACA 3ONAB 1JCKB 4HSVA 3TDQA 3FVQA 1LTTD 2KVMA 1C4QA 4X3TA 2EYMA 4A3GB 1B3AA 1TS2A 4AYBB 3KF8A 4OHJA 1SYCA 1WVLA 3S2HB 1CTMA 2F03A 2EDGA 1BCPD 4UDUC 2BA1A 2VXWA 1KTKA 1STAA 1S5FD 1D6EC 1FD7D 3T4AC 1A15A 3RMHA 5C0XI 3DMUA 2N55A 2CW0C 1S5CD 4HSPA 4HR7B 1B1ZA 1OXUA 2ENBA 2B2VA 4BY1B 3HKZB 1BBXC 3SK5A 4OIKA 4NW2A 5CV5A 3OMCA 3VR3A 2NTSA 4OIJA 5KNCA 1A3UA 3VR4A 2E2IB 3IAYA 2JEBI 3NK9A 1DD2A 4ZRZA 4KY6A 1EFID 3QB3A 3BDOA 4HAEA 4N9TA 1TWAB 3X3NA 1SJHD 4XQNA 2L55A 3WOFA 2RSNA 3MXUA 4PMCA 1DOLA 1KLUD 2R3ZA 4R8NA 1CZWA 1UEAB 1RODA 5C4JB 2ID0A 4G57A 4KKSA 1ENCA 1BO0A 3KK7A 3M4YA 2MPMA 5CBEE 1PTOF 2D9UA 5JOBA 2DNEA 3T51B 1HPCA 3WOEA 2Z1CA 2CQAA 4X3KA 2F0PA 5EPLA 5CGKA 2JSOA 5EBDA 5TSSA 2R93B 4KKUA 3GTJB 2F0KA 1DCZA 2LY7A 4I65A 4DK1A 1KAAA 2BE5C 3Q24A 2MJ8A 5FOBB 3MXPA 4FXGC 5G3LF 3GTKB 3H0GB 4KKTA 4DF7A 1OXSC 3J7YW 2R92B 4G7OC 3A7LA 5C5LA 2A6HC 3R8BA 2JA8B 1A3VA 1PMRA 3S2DB 1B4OA 3Q6SA 4ZK9B 1CQVA 2A68C 2K28A 2F1MA 3AMUA 3FDTA 3DEPA 2LFNA 5LL6S 3J80L 3PUWA 1GHKA 3PO2B 4CJ1B 2FHTA 3SVMA 4K2LA 1VCIA 2DNCA 2A6EC 2NYZD 3I4MB 2QKIC 1T5XD 2JA7B 1PTOC 1YNJC 5ELDA 1O80A 2KECA 1S4ZA 1EY4A 1RKNA 2PW7A 1O7YA 2RDHA 3TZUA 1HFNA 3KLSA 3NTIA 2I46A 3R2IA 5E4XA 3PO3B 4IUNA 2PQEA 4K14A 1LT3D 2KHSA 1GHJA 1AEXA 2L12A 2L9HA 1AW7A 2JA6B 3T53B 2KUMA 2OF1A 2KEEA 4IUQA 1EZ6A 3AB9A 1LTAD 1ILPA 2E2HB 1QILA 3I90A 3PUXA 1D2BA 3OMGA 1C48A 1TS4A 5EPJA 1GXDC 1NSNS 1OXXK 3DWAA 4RWSC 5M9OA 4PMBA 3LWUA 4FXDA 5EGTA 1JB3A 5DM73 3TP8A 4XT1B 1M8AA 2B2YA 1B53A 2XRQD 3K5NA 5KNBA 2BDNA 3NWSA 2A6ED 1GUNA 2HQEA 1CHQD 5I9OA 3A7AB 1F9RA 1EYAA 1JICA 2QF7A 4C3HG 1LT4D 3TMEA 5A2QL 3UI2A 4O1NA 4NKLA 3J7AF 2I07B 3NWTA 1F77A 2K03A 4TSSA 5CV6A 2LKVA 4KHZA 5C44B 3EA6A 2O5IC 5KNDA 1HTLD 1PRTB 5EBCA 1I4QA 1BQQT 3SDZA 2YYZA 3PV0A 1U9RA 3NP8A 4FF2A 1CM9A 1Z47A 1XYIA 4ZLTF 1QCBD 2JE6I 3NPPA 1Q8IA 4DAYA 3J7AV 3SR1A 3DWQA 5EKIA 1IHZA 4IQZA 4CJ0B 4H0LC 1L0YB 1Z6HA 3HZXA 4YIJA 3D8GA 1SBBB 2F0OA 5T1IA 2B2WA 1QOHA 1STHA 4IALA 4RHRA 4QB4A 1DYQA 3ND8A 2PZWA 3TP5A 2PMZB 4RFBA 5ELFA 2H4OA 2F0SA 3S1NB 1IW7C 4C3HB 3M7NA 5LL6X 2C5CA 4FO2A 3Q0AA 3DM1A 4IFDG 1PFNA 2MUYA 3J80E 1DONA 3I8ZA 3EFXD 4FP5D 1STBA 3NTHA 3GTLB 1LTGD 1HFGA 3GP7A 1NR2A 3OWEB 1EIHA 4HMIA 5IGCA 3A55A 1DXMA 2SNMA 1D1IA 1FNVA 1E0BA 3BVMA 3GQBA 4KHVA 3NBHA 1KABA 1DOKA 1DJRD 2K32A 5KIXA 3NBIA 4QF4A 4IFDI 3FEWX 1IKLA 2XIWA 1O7ZA 3J81L 1XXGA 4X3UA 1TVXA 3H09A 1SAPA 4J6HA 4M8AA 1WTQA 3KLSX 1PYWD 1XX8A 1PXUA 2EY1A 4F7XA 3P75A 3SK8A 1PFMA 5JJZA 4MIUA 3HS0C 3HEJA 4IUTA 1G91A 1A3TA 2E74C 1S5BD 3OW7A 2L1BA 1AZQA 2AWOA 3MFYA 3C46A 5M5YB 4C2MB 2FINB 4C1NI 3G7LA 2KOLA 3C3LA 3I73A 4KV6A 5FK9C 4HCEA 2TMPA 1TIID 1DOMA 4TKOB 4U673 1CHPD 3A8JE 4TQUS 1TU2B 1EY7A 3GV3A 4H44C 1FNUA 3GTOB 2K01A 2GA4B 5K36H 4Z9CB 5CV4A 4I7ZC 1X3QA 1GUWA 3HOYB 5C6AA 3TBIB 1NR4A 2F0FA 1IYUA 1LTID 3K5OA 4A3FB 3FPPA 4QUCA 2AUJD 5BN3A 3MEHA 4ABNA 2DY8A 2NZ1D 1WTOA 3V96A 2WB1B 1TY2A 3SXHA 5D65A 4OO1I 1G8ZD 1QG7A 3I91A 3NUCA 3BVZA 1ZYRC 1Q1BA 4KI0A 3Q23A 1SMYC 2IT1A 2NUCA 4S3SA 5IGBA 3A54A 4JBWA 3EQLC 5A35A 1FR3A 1Q1EA 1STNA 3I4NB 4CBVA 1JOQA 1IW7D 3MFGA 4ILWA 1HQRD 2PYKA 2AWNA 1PRTD 2SEBD 4UAIA 4ZKCB 3CQZB 4DN4M 4WFN3 4ID6A 1SNMA 1WTPA 4K2KA 1EYDA 1PZKD 4M1UB 4DGZA 4CJ2C 1TY0A 5FO9B 3S17B 2XSCA 4IN3A 2RBMA 3U9OA 1FYCA 4CHTB 1BR9A 3DHQA 2EE1A 1Y8PB 2VB3X 2F3WA 2NN6G 3L3OC 2M2LA 2FFKB 4B9WA 3V05A 2OT2A 5E3FA 2G9DA 4LK1C 2F0QA 2M00A 1SFOB 3BZDB 1H9JA 1TS5A 2JYOA 1SYFA 3RD4A 4ME5A 2A69C 1HA6A 3V2TA 5LHY1 1JORA 4DXFA 1I4XA 4TRDA 1ESFA 2V4DA 2WKDA 4XXEA 1EY9A 2B8FA 1T5EA 1HQMC 4FXKC 4Q0FA 2E2DC 2IPKD 2K05A 3W3AA 3K59A 3K58A 3H3VC 2PZUA 3GTQB 3PUYA 3K6OA 1TWGB 3VYUA 2JA5B 3DXJC 1EWHA 5CR3A 3OIQA 4LAAA 1JWUD 2HDLA 5C4ZA 4R8IA 1I50B 5K36G 3OPOA 2SNSA 2X6GA 1F9SA 1TKWB 3KLRA 4HCSA 2F0WA 5J39A 2QDBA 1LO5D 3GV6A 2FMCA 2QEJC 4J8QA 1BF4A 1D5ZC 3VA5A 3T16A 2AQ1B 5FLXL 5JPMC 1SSOA 1K8OA 4RCOA 2EYPA 2B63B 2EYFA 4ODGA 5M5XB 4IZ8A 2XVSA 3MC0B 2BDOA 4A3EB 1BCPC 2Q8RE 3URYA 4A93B 2KJXA 3M85A 4K6LA 1AP0A 4G4KA 1G2TA 1RCVD 1U4RA 1H9SB 2IWHA 4ZAIA 2B2UA 4U68A 4IUVA 4RGOS 1ET9A 5CV9A 5KYLA 1ESRA 1J9OA 3BS1A 3NQTA 1NCVA 1QB5D 5M3MB 4IURA 2NVQB 4K5WA 5IGEA 1O78A 3P7JA 1B9MA 1STGA 3ND9A 5I4DA 1GJXA 1YNND 2RA4A 4L6TB 1TWCB 2EYLA 1KNAA 2L11A 3OHXC 3EROA 3CRLC 2A6HD 5DNFA 2F0HA 4N9PA 4F87A 3BDCA 1B50A 2MHVA 1HUNA 3CU7A 2WP8J 1OXTA 3E0JA 2DY7A 5IOCA 2R61A 2O4XA 1LTBD 2ICEC 2NVYB 5ELBA 4KJNA 2HDMA 1I6HB 3FRPB 5C5MA 5COYA 3WDNA 4IFDH 1BNZA 1ZYRD 5IT9L 4CKBA 4OL7A 1UNSA 1EQVA 4B9XA 2RDFA 1A2UA 2J7ZA 5E4WC 1EEFD 5EKLA 2IW3A 3KBGA 4EQNA 4K8JA 2Z4IA 5IT9E 3HGBA 4EQOA 3LX0A 3HG9A 4GZYC 3FKIB 1G6ZA 2C9OA 3H94A 3HOUB 1R4QB 1PRTF 3T13A 5EPKA 1SE2A 5F2DA 1SE4A 1EU3A 3C2PA 2AQ3B 4DAPA 4G7ZC 4ULLA 1EOTA 3R93A 3BDLA 4EQPA 3R2TA 1RD9D 1GUSA 1WTXA 5KGUA 4IUPA 2L5TA 5I2YA 2CW0D 2RKSA 1U4MA 1AN8A 3D3RA 3QJYA 4XYQA 1Y8NB 3GTGB 1R9TB 2IX0A 4QUFA 5HURA 2LMCB 3RZDB 4C3JB 3ITPA 1CA5A 2A73B 2E2JB 3LWEA 3T56B 3S16B 4KY7A 3S14B 5IIFA 2B2UC 3A56A 3K7AB 1WTWA 4A3KB 1DZ1A 4OO1H 2D5DA 1EIGA 4K8IA 2K1BA 3M3YB 3I3CA 1TWHB 1HTPA 1SYEA 3QWNA 2F0DA 2IL8A 2JXMB 2KCNA 4RH6A 2PW5A 5D14A 1PRTC 2K04A 3QOJA 1KLGD 4K6DA 3A8KE 3D4WA 3D6CA 1JQYD 1E2ZA 1ET6A 5JEAG 2R6GA 4DNTB 2WV6D 3NTKA 5EQ0A 4ZKBB 5JEAH 1JC7A 5A2QE 1K83B 4PQXA 1I4RA 3TP7A 4A3IB 1A2TA 1I4PA 2K5DA 2OXPA 2D2CC 2ZT9C 1ILQA 3NSWA 4NMZA 4R9WA 1WD1A 2F0GA 1S5ED 5I6YA 2Z8LA 4WORA 5IGDA 3NQIA 1SNCA 5J22A 4RGTA 2F4IA 3VYTA 5C3XA 4C1NK 3QG1A 5FO7B 1XWEA 4L8JA 1CA6A 2CHBD 2VNUD 3S9WA 1KDAA 4XDXA 1QE6A 1Q90A 2MGSA 3BYYB 2XRSD 5C0XG 4L63B 2K6AA 2WKCA 5J1ZA 3P1HA 1W6JA 4PNYA 1Z7TA 1D5XC 4RA8A 4CKCA 1QWYA 1V1PA 2EJGC 2MP1A 2K5WA 4DK0A 3VR5A 4CKEA 1BXTA 2Q8TA 3SHLA 2NTTA 1TWFB 2H1EA 1W6KA 2LS01 1KNEA 5C3EB 2EJMA 4H13C 4X3SA 5JVH3 2IX3A 1X3PA 2JEAI 1DM0B 4C3IB 3JAML 3TN2A 2NVTB 2WINB 1E2WA 1LTSD 1EL0A 3TP6A 2BE5D 2NN6H 5C3WA 1FGBD 1D1KA 1HA5A 5CYUA 4DNRB 1D5MC 1OO9B 2YU9B 1EY5A 1JWSD 1H9RA 2BCOA 3VYRA 1RDPD 1Y1VB 1LACA 1SYBA 4WJWA 2IJ0A 4BWGB 1H9SA 2SOBA 2KCCA 4IUUA 4LMQD 3DUZA 3VR6A 2RQXA 4V190 3S1QB 3F2UA 3NE5B 1B2TA 1GUTA 4RKBA 2BOSA 3CKIB 4C3IG 1V1OA 1FNWA 3TSSA 5DM63 2WAQB 1RTNA 5I6WA 1PFBA 3OOCA 1RF2D 3N52A 4XQQA 2X6LA 4BA1I 4EGVA 3RZOB 1AZPA 1CFMA 2WIIB 1IYVA 4XT3B 4BA2I 2ZXPA 5I9PA 2PNRC 4PV1C 3EVQA 2EYJA 1E2VA 1EY8A 2SDFA 3D4DA 4V0BA 3VA7A 4J1MA 3HOVB 1EY6A 2NVXB 1GUOA 2FMMA 3OIPA 3E5SA 1SE3A 2PZTA 3C1FA 1MI2A 5FLXE 4K5VA 3L7ZC 3W2DA 2EY2A 5KYIA 2B2VC 3DEOA 2O5JC 4KN4C 4C56C 1S5DD 3D6WA 1EYCA 1JOKA 4DU9A 2K7VA 5BN4A 3NHHA 2XN9C 4HMJA 4F88A 2B39A 3U9SA 2EY6A 1ONLA 1YNNC 3IKJA 1JR0D 4DA2A 4B08A 4HN7A 1EWCA 3PUVA 1Y1WB 2NB0A 5JAVA 4BBSB 2L4NA 3E6ZX 3SE0A 2EYOA 1GUGA 4ZUIA 1TQOA 1SNQA 1LT5D 5CV8A 1EU4A 1Y69U 4KJOA 1MGSA 1LTRD 2A69D 4RCNA 1R4PB 3BG3A 4PMWA 1TT2A 1BDOA 1SNDA 1RTOA 1STYA 1HUMA 4KY5A 2QILA 1ZKOA 2N88A 5EKKA 4KD4A 3G6JB 3S15B 3X3MA 2X69A 2EYHA 3ZYYX 1MBYA 2PPBC 5JVG3 1SNOA 3TZDA 2IX1A 3FPUB 5CMDA 2A5HA 3FMCA 1ZXTA 1SYDA 1V1PB 2HCCA 1F2ZA 2E76C 1UUPA 4HEDA 2F0IA 4H7BA 5IGFA 5D3DA 3SK6A 2FJ2A 4FYDA 2KA7A 1L0XB 1JE4A 4C3JG 1PDQA 1C8CA 2PCFB 4BY7B 1WTVA 3JAME 1BOSA 4A3JB 5DAUA 3IL8A 3DWPA 3MZ5A 4LJZC 5G3LD 2NBFA 3BVGA 1F9QA 3HOZB 3MXNA 3C1EA 1CQFA 5I2XA 1LLRD 4P2CB 2VUMB 3MHBA 3EJIA 3QO2A 3RUZA 4A3BB 3LNNA 3I72A 1EZ8A 3S1MB 1SDFA 4ZYSA 3CHBD 2D62A 4WRDA 2J0TD 2B2WC 1BCPB 5CBAE 4RHSA 1X32A 5CC4A 4F8MA 1O7LA 1HXYD 1G2SA 5M3FB 1VF5C 2F3VA 1HCZA 1LABA 2RDGA 2AUKA 5C4XB 2F0UA 1BUVT 5ELCA 2PO4A 2XWJB 4Y7NB 4IFDJ 1SMYD 4RAUC 5D3IB 4G7HC 1F2MA 1VDZA 3Q22A 1H9KA 1JWMD 4RKLA 2F0LA 1UAPA 1QNKA 4KN7C 3QOLA 4Q5VA 2G9HD 5C4HA 5BN5A 2DN8A 1JOOA 1CZGA 1I4HA 2Q8IB 3GTPB 5IODA 2EOTA 2A74C 4QMGA 5C0XJ 1MSHA 1CT1D 4FVMA 3D31A 2EXZA 3PIP3 1XTCD 1Y8OB 4O42A 2B2YC 5AFWA 5ELEA 3AU7A 2ZXOA 3A8IE 5DEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD4 A;  2L0C A; 
#chains in the Genus database with same CATH topology
 1SXT A;  1KDB A;  1SEB D;  2F0V A;  3D4R A;  3E0E A;  4XYO A;  3MTS A;  3CMA A;  3KUP A;  1EEI D;  3GO5 A;  1SNP A;  3I4O A;  1ENF A;  1RHP A;  4OGQ C;  1HNX Q;  1Q82 C;  1Z9F A;  2KHJ A;  1QJO A;  4FDB A;  2EPB A;  4JI6 L;  5M5W B;  1CI3 M;  5M3M H;  1E1T A;  4FF1 A;  3PUZ A;  4KTA A;  2B2T A;  3HOY H;  4HJ9 A;  3I70 A;  2QEX A;  4FF3 A;  1J8I A;  1F2Y A;  3GTM B;  3K8A A;  1TWG H;  5IT9 c;  1B9N A;  1C9O A;  2R7Z B;  1L2F A;  4B3M Q;  2EY5 A;  1B70 B;  2RHS B;  4QY7 A;  1PFS A;  3PMF A;  1RJT A;  2E5L Q;  1ASZ A;  1QZG A;  3K5M A;  2B2T C;  2L0C A;  2NN6 I;  4A3K G;  5E1F A;  3VR2 A;  3GTG H;  2J4X A;  2KQ3 A;  1KDC A;  2EQS A;  5JPN C;  1LT6 D;  5HGT A;  4A3E H;  2G5D A;  4BBR B;  2E75 C;  3CRK C;  3MAQ A;  2OEO A;  3HP3 A;  4X62 L;  1PLF A;  2WAQ G;  2K33 A;  5FLM G;  3K5L A;  2ZXR A;  3SEB A;  3U50 C;  1PYB A;  5JEA J;  3GTJ H;  1QNU A;  4LFA Q;  2N78 A;  1CKN B;  2JA6 G;  3R3O A;  3HOX B;  3MA2 B;  4ZUJ A;  1H9M A;  5ISR A;  3M7G A;  1WCM B;  4JBJ A;  5CV7 A;  3MWY W;  4DFA A;  4BS9 A;  1VMC A;  4IO9 A;  1I6V C;  4GKK L;  4ZQ3 A;  3PO3 G;  4GLX A;  1I4G A;  1II3 A;  4NDX A;  1ML0 D;  2MO1 A;  1OXV A;  1PH4 A;  1AE3 A;  3OSO A;  3KBX A;  1PTO B;  4K0K Q;  2F0T A;  1S72 A;  1HJP A;  2Z6B A;  2QCP X;  2GN5 A;  1NAP A;  3T1Y L;  5KRU A;  5IYC G;  1GVP A;  4B3M L;  4AQY L;  1PTO D;  1YNJ D;  2XNA C;  4KD3 A;  1U4P A;  3P20 A;  4MHE A;  4XQJ A;  1SYG A;  1VQO A;  1HHV A;  1B44 D;  4DXG A;  2KHI A;  2F0J A;  1F9P A;  1WD0 A;  4APV A;  3MXG A;  3F8T A;  3GD7 A;  1MSG A;  1WOC A;  2O2L D;  2RSO A;  2JA5 H;  5KEE A;  3KF8 B;  1K8M A;  1I3Q H;  1SE8 A;  3PQI A;  4QCL A;  2R7Z H;  3HRZ C;  1PZI D;  3I4L A;  4XIG S;  3UDI A;  2JA8 H;  1CK1 A;  1SJE D;  4A3I G;  1IKM A;  5EAY A;  1JT8 A;  4LFA L;  3MVV A;  3GTQ H;  5FKA C;  4LF8 L;  3S1R H;  2EZV A;  5M5W H;  2YU9 H;  1G29 1;  4KK7 A;  3VYS A;  3KJO A;  2UUA Q;  1ZEQ X;  4DAY B;  4HIM A;  1E1O A;  4KMU C;  5K5P A;  4K5X A;  1PZJ D;  3OWF A;  1KQS A;  2F0E A;  2EVB A;  5C0X H;  3K57 A;  3RLF A;  1ENA A;  4JI1 L;  4A3M B;  4X64 Q;  2JP1 A;  3E3X A;  1AFP A;  2V1C C;  4FNF A;  4DR6 Q;  2EJF C;  3PIP A;  2BA0 A;  4QIW B;  5T1G A;  2Y0S B;  2YTX A;  2K5Q A;  3CF5 A;  4A75 A;  5EJW A;  2TSS A;  1CUK A;  4MTN A;  4XTC S;  3BZC A;  1UE1 A;  3S1R B;  3OTO L;  1LV9 A;  1WTR A;  2CVR A;  2F0N A;  4FF4 A;  3J81 j;  5COR A;  3BYT B;  3NXW A;  1STE A;  1TS3 A;  2XWB B;  3K0X A;  4B3S L;  3N6R A;  5FO8 B;  5IGG A;  1IXR A;  4RGN A;  3IFT A;  4GOP C;  2RVL A;  3HOX G;  4BY7 H;  1A6X A;  4GLA C;  2AQ2 B;  3ERQ A;  1F2L A;  2KED A;  1HRJ A;  1ICW A;  1VF7 A;  3KDF A;  1EY0 A;  1I3Q B;  3H91 A;  3IFD A;  5IYD G;  1HNW Q;  2YV5 A;  3SK4 A;  2JA7 G;  2F0M A;  2B8G A;  1NUC A;  1HZC A;  1IL8 A;  4NP5 A;  1NMF A;  1UE7 A;  1GOZ A;  1U4L A;  3H6M A;  1VMP A;  2HUG A;  4HJ7 A;  4B3T Q;  4A3D B;  4GS3 A;  1V43 A;  1PH3 A;  1I94 Q;  4MN3 A;  3SGI A;  4DAV A;  1EQT A;  1V8Q A;  4A3G H;  2M9V A;  1MD2 D;  4RGM A;  1Q12 A;  1BCP F;  5C4X H;  3J81 E;  3K0Y A;  4JI2 Q;  3HOW B;  4E6I A;  3PO2 G;  2KCT A;  2VB2 X;  2R7F A;  1TR5 A;  4EVO A;  3O13 A;  3PIO 3;  3QIA A;  2YTY A;  2NWG A;  1Q46 A;  2HCI A;  2KBN A;  1M4V A;  4C2M H;  3PGZ A;  4CGY B;  3KJP A;  4JOI A;  2ICI A;  3LGJ A;  3L9A X;  4JK1 C;  2Z4H A;  2OQ0 A;  1PTO H;  4OO1 G;  1Y1V H;  3M9B A;  1B7Y B;  1WCM H;  4R4C A;  5NUC A;  2A68 D;  3M4O B;  1Q3L A;  3A5Z B;  1N8R C;  4HTH A;  2WAC A;  3UDF A;  3ONA B;  4JI4 L;  3HOV G;  3OYY A;  4P71 A;  1JCK B;  4HSV A;  3TDQ A;  4JYA Q;  1K73 C;  3FVQ A;  1LTT D;  2KVM A;  1C4Q A;  4X3T A;  1VQ4 A;  4BBR G;  2EYM A;  4A3G B;  4LFC L;  3CC4 A;  1B3A A;  1TS2 A;  1PH2 A;  4AYB B;  1HNW L;  3KF8 A;  1S40 A;  3UE0 A;  4OHJ A;  1SYC A;  1WVL A;  4LFB Q;  3CCE A;  3S2H B;  3CCJ A;  1CTM A;  2F03 A;  1TWC H;  2EDG A;  1BCP D;  4UDU C;  2BA1 A;  2VXW A;  1SRO A;  1KD1 C;  1KTK A;  1STA A;  1S5F D;  1D6E C;  3K7A H;  1FD7 D;  3T4A C;  4JI2 L;  1A15 A;  3RMH A;  5C0X I;  3J81 i;  5GAG C;  3DMU A;  1KRS A;  2N55 A;  2CW0 C;  1YIJ A;  1S5C D;  2K4K A;  3S16 H;  2AKW B;  1UEB A;  4HSP A;  4HR7 B;  3GTO H;  1B1Z A;  1OXU A;  2ENB A;  2B2V A;  1CKO A;  4BY1 B;  1EYG A;  3HKZ B;  1BBX C;  1PYS B;  3SK5 A;  4OIK A;  4NW2 A;  1CKN A;  5CV5 A;  1RL2 A;  4JI4 Q;  3HOV H;  3OMC A;  3VR3 A;  2NTS A;  4ALP A;  4JYA L;  2CH4 A;  4OIJ A;  3J7A 5;  5KNC A;  4LF9 Q;  4LF4 Q;  1YHB A;  5C3E G;  3KOJ A;  1A3U A;  3VR4 A;  2E2I B;  2VZA A;  1Y1V G;  1Y1W G;  2B63 H;  3IAY A;  2JEB I;  4NB3 A;  2E8G A;  1VS0 A;  3NK9 A;  4LFC Q;  3FHW A;  4ZRZ A;  1DD2 A;  4KY6 A;  3CC7 A;  1EFI D;  1SFO H;  1NMG A;  4HJ5 A;  3QB3 A;  3BDO A;  1WYD A;  4HAE A;  4JOI C;  4N9T A;  1PH8 A;  4LF5 Q;  3ERS X;  1TWA B;  3X3N A;  1H95 A;  1SJH D;  4XQN A;  1YJW A;  4H02 A;  2K5N A;  2L55 A;  3WOF A;  2RSN A;  3MXU A;  3CD6 A;  4PMC A;  4A3G G;  1VQI A;  1UE6 A;  1DOL A;  5HY6 A;  2HIV A;  1N33 Q;  1KLU D;  2JA7 H;  3CAM A;  2R3Z A;  3STB D;  3DLL A;  4MZ9 A;  4R8N A;  1CZW A;  3FKI H;  5GAH C;  1UEA B;  1WI5 A;  1ROD A;  3UDX A;  3CCV A;  5C4J B;  2ID0 A;  4G57 A;  4KKS A;  1ENC A;  4DV3 Q;  1BO0 A;  3CQZ H;  1E24 A;  3KK7 A;  3K7U C;  4GOP A;  1VQJ A;  4UP9 A;  3M4Y A;  2MPM A;  5CBE E;  1PTO F;  2D9U A;  5JOB A;  1G51 A;  4LF9 L;  2DNE A;  3I4N H;  3E9H A;  3T51 B;  1HPC A;  1NTG A;  2VL6 A;  4POF A;  1RIP A;  3WOE A;  2Z1C A;  2CQA A;  2ZTE A;  4X3K A;  2F0P A;  2Q2I A;  2IY5 B;  3S1M H;  1VQ9 A;  5EPL A;  5CGK A;  4TVA B;  2JSO A;  4L5R C;  5EBD A;  5TSS A;  2R93 B;  4KKU A;  4OXP A;  2UU9 Q;  3PIO A;  3GTJ B;  2F0K A;  2A8V A;  4R4T A;  1AH9 A;  2VUM H;  2ZM6 Q;  1DCZ A;  2LY7 A;  4I65 A;  1XPO A;  4DK1 A;  1KAA A;  2BE5 C;  5J3B A;  2RCN A;  3Q24 A;  2MJ8 A;  5FOB B;  3MXP A;  4FXG C;  5G3L F;  3GTK B;  3H0G B;  2VS1 A;  4KKT A;  4DF7 A;  1OXS C;  4DK3 C;  1VQE A;  3J7Y W;  4WJ4 A;  2JQO A;  3AQQ A;  1TWF H;  4A3J H;  2F3I A;  2R92 B;  1MIU A;  4G7O C;  3A7L A;  3L2P A;  2JA5 G;  2PNH A;  5C5L A;  2A6H C;  4A3C G;  3R8B A;  2JA8 B;  1A3V A;  1PMR A;  3B6Y A;  3S2D B;  4DUZ L;  1B4O A;  3Q6S A;  4ZK9 B;  1SLJ A;  1CQV A;  2A68 C;  2K28 A;  1A62 A;  2F1M A;  1SR3 A;  3AMU A;  1KL9 A;  3FDT A;  2D0O A;  3G71 A;  1B3Q A;  3DEP A;  2HHH Q;  2LFN A;  3FKI G;  5LL6 S;  3J80 L;  3PUW A;  1GHK A;  3PO2 B;  4LW1 A;  4CJ1 B;  2FHT A;  3SVM A;  4K2L A;  3EIV A;  1VCI A;  3NBH B;  5JJK A;  2DNC A;  2WB1 G;  2A6E C;  2NYZ D;  3I4M B;  3S15 H;  2QKI C;  1T5X D;  2VUM G;  2JA7 B;  1PTO C;  1YNJ C;  5ELD A;  1D7Q A;  1O80 A;  2KEC A;  4A4I A;  1S4Z A;  4AH6 A;  1EY4 A;  1RKN A;  2I5L X;  2PW7 A;  1O7Y A;  1V9P A;  5M5Y H;  4RG1 A;  2RDH A;  3TZU A;  1LTL A;  3KLS A;  1HFN A;  1KC8 C;  3NTI A;  4R4Q A;  2JA6 H;  1CKM A;  2Q2U A;  2I46 A;  3R2I A;  5E4X A;  2NZO A;  3PO3 B;  4IUN A;  2PQE A;  4X6A H;  4K14 A;  1LT3 D;  2KHS A;  1Q7Y C;  2I5M X;  1GHJ A;  1AEX A;  1I5F A;  2L12 A;  2L9H A;  1AW7 A;  4IJL A;  2VW9 A;  2JA6 B;  3T53 B;  2KUM A;  4BY1 G;  2OF1 A;  5M3F G;  2KEE A;  4IUQ A;  1EZ6 A;  3AB9 A;  1LTA D;  1JJ2 A;  4DUZ Q;  1ILP A;  1N32 Q;  4JPB W;  2E2H B;  1UWV A;  1AE2 A;  1QIL A;  3I90 A;  1PH9 A;  4GOP B;  4WJ3 M;  3PUX A;  1D2B A;  2HHH L;  4A3M G;  3EBE A;  3OMG A;  4JI7 L;  4YWL A;  1C48 A;  1TS4 A;  5EPJ A;  4DR7 L;  1W2B A;  1GXD C;  4IPH A;  2K5V A;  5M3M G;  1NSN S;  1OXX K;  3DWA A;  4RWS C;  5M9O A;  4AYB G;  4PMB A;  3LWU A;  4FXD A;  5EGT A;  1JB3 A;  2K75 A;  2R92 G;  3OW2 A;  3G48 A;  5DM7 3;  1Q81 C;  4EQ5 A;  3TP8 A;  4XT1 B;  1M8A A;  2B2Y A;  1B53 A;  2XRQ D;  3K5N A;  2UXB L;  5KNB A;  2BDN A;  4CDD C;  3NWS A;  2A6E D;  1GUN A;  4JC0 A;  4GN3 B;  2HQE A;  1CHQ D;  5I9O A;  3A7A B;  1F9R A;  1EYA A;  1JIC A;  2QF7 A;  4C3H G;  3L0O A;  3HOZ H;  3AFQ A;  4A93 H;  3H0G H;  2WAQ E;  1LT4 D;  1EIY B;  3TME A;  5A2Q L;  3UI2 A;  4O1N A;  5HGQ A;  3GTP H;  1KXL A;  4NKL A;  1X9N A;  5IWA Q;  3J7A F;  2I07 B;  1KIX A;  3NWT A;  1T9H A;  1F77 A;  2K03 A;  4TSS A;  5CV6 A;  1SN8 A;  2LKV A;  4KHZ A;  5C44 B;  3EA6 A;  4JI7 Q;  2O5I C;  4DR1 L;  5KND A;  1HTL D;  1PRT B;  2P5Z X;  4LUV A;  3A0J A;  5EBC A;  1K8G A;  2AHO B;  4JCV E;  3RN5 A;  1VQP A;  1I4Q A;  1BQQ T;  4POG A;  3SDZ A;  4JBM A;  1JJG A;  2YYZ A;  3RZO H;  4L5T A;  3PV0 A;  3W1B A;  2CQO A;  1U9R A;  3NP8 A;  4FF2 A;  1CM9 A;  1PH5 A;  1Z47 A;  1XYI A;  4ZLT F;  4CDE C;  1QCB D;  1PA6 A;  2JE6 I;  3BZK A;  3NPP A;  4YCU A;  3JAM i;  4OEM B;  1Q8I A;  4DAY A;  3J7A V;  2GVB A;  2UXB Q;  4CDF C;  4QJF A;  3DWQ A;  3M4Q A;  5EKI A;  3SR1 A;  1IHZ A;  4DV5 Q;  4A93 G;  1K0R A;  1K3R A;  4IQZ A;  4CJ0 B;  1N9W A;  4H0L C;  1L0Y B;  3M3Y H;  5M3F H;  1Z6H A;  3HZX A;  4YIJ A;  3D8G A;  1SBB B;  2WB1 E;  1VQ6 A;  5ELO A;  4KHP Q;  2F0O A;  5T1I A;  4NXM Q;  2B2W A;  1QOH A;  1STH A;  4IAL A;  5JJI A;  4RHR A;  4YCV A;  4HID A;  4QB4 A;  1DYQ A;  3ND8 A;  3AYH B;  2PZW A;  3S2D H;  3TP5 A;  2PMZ B;  3UDG A;  1XPR A;  4RFB A;  2OTL A;  4JV5 L;  2R92 H;  1A8V A;  5ELF A;  2H4O A;  2F0S A;  3S1N B;  4DV1 L;  4JI5 Q;  1IW7 C;  4C3H B;  3M7N A;  5LL6 X;  2C5C A;  3ULJ A;  4FO2 A;  4JI3 L;  3Q0A A;  4DR1 Q;  4LUZ A;  2JA9 A;  3DM1 A;  4IFD G;  1PFN A;  2MUY A;  4OWX B;  3J80 E;  1DON A;  3H3V H;  3I8Z A;  3EFX D;  4FP5 D;  3J80 i;  4B3R L;  1U5K A;  1STB A;  5LMU Q;  2UXC Q;  3CP0 A;  3FP9 A;  4JI8 Q;  3S1N H;  3NTH A;  3GTL B;  1LTG D;  1HFG A;  2OCE A;  4DV5 L;  4BY1 H;  1VQ5 A;  3GP7 A;  1QVG A;  1XMQ L;  3RNU A;  3I2Z A;  1LYL A;  1NR2 A;  3OWE B;  3ULP A;  1MJE A;  2UUC Q;  2QDL A;  1EIH A;  3GTM H;  2VQF L;  4HMI A;  5IGC A;  4KHP L;  5GQO A;  3A55 A;  4NXM L;  1DXM A;  5C44 G;  2SNM A;  1D1I A;  1FNV A;  3GQB A;  1E0B A;  3BVM A;  3NEL A;  4KHV A;  3S17 H;  3NBH A;  1KAB A;  1DOK A;  4DR3 L;  2DJF C;  1DJR D;  1NY4 A;  2K32 A;  5KIX A;  3NBI A;  4QF4 A;  4IFD I;  3FEW X;  1IKL A;  2XIW A;  1VQL A;  2ZJP A;  1O7Z A;  4JI5 L;  3J81 L;  4DV1 Q;  2DJG C;  1XXG A;  4JI6 Q;  4X3U A;  1TVX A;  3H09 A;  3CCL A;  1SAP A;  4GKJ L;  4J6H A;  1VQA A;  4M8A A;  1XNQ L;  3HKZ G;  1WTQ A;  1BKB A;  3KLS X;  2UXD L;  1PYW D;  2LSS A;  1XX8 A;  4NPS A;  1PXU A;  2EY1 A;  4DV0 Q;  4F7X A;  1YNX A;  3P75 A;  3SK8 A;  1K83 H;  3TS2 A;  1PFM A;  5JJZ A;  1XMO L;  4MIU A;  2PI2 A;  3HS0 C;  3HEJ A;  4IOC A;  5C44 H;  3KYH C;  3I4N G;  4IUT A;  1G91 A;  1A3T A;  2E74 C;  4IPD A;  2MFI A;  1S5B D;  3OW7 A;  2L1B A;  1AZQ A;  2AWO A;  4X62 Q;  3MFY A;  4DAM A;  3C46 A;  4A3J G;  4X66 Q;  5M5Y B;  1K9M C;  4C2M B;  2FIN B;  1VQH A;  4C1N I;  3G7L A;  2KOL A;  3C3L A;  3I73 A;  4KV6 A;  5FK9 C;  1IBK L;  4HCE A;  4UPA A;  2TMP A;  1TII D;  2EIF A;  1DOM A;  3BU2 A;  1X55 A;  4TKO B;  3T1H L;  4GKK Q;  4U67 3;  1CHP D;  3A8J E;  4TQU S;  1TU2 B;  1EY7 A;  3GV3 A;  4H44 C;  1FNU A;  3GTO B;  2DGY A;  3TQY A;  1P16 A;  2K01 A;  1XNR L;  2GA4 B;  2RF4 A;  4ZCK A;  4K0K L;  5K36 H;  4Z9C B;  4DPG A;  2NVQ H;  5CV4 A;  4I7Z C;  1X3Q A;  4DR2 L;  1GUW A;  1XNQ Q;  1HH2 P;  2N49 A;  3HOY B;  2UXD Q;  5C6A A;  3Q8D A;  4AQY Q;  3TBI B;  4DV0 L;  1NR4 A;  2F0F A;  1IYU A;  3K5O A;  1LTI D;  3GDE A;  4A3F B;  3FPP A;  4QL5 A;  1MHW C;  4QUC A;  1BVS A;  2AUJ D;  5BN3 A;  4GNX A;  3MEH A;  3TS0 A;  4LF6 Q;  4HIK A;  4YWM A;  4ABN A;  4A3E G;  4OX9 L;  2DY8 A;  2NZ1 D;  1WTO A;  4DV2 Q;  4A3L G;  3V96 A;  1HZ9 A;  1K8A C;  3S24 A;  2WB1 B;  1TY2 A;  1FVI A;  3SXH A;  5D65 A;  4OO1 I;  4X66 L;  1G8Z D;  1QG7 A;  3I91 A;  3NUC A;  1L1O A;  1QUQ A;  5E7N A;  2KCM A;  1OTC A;  3BVZ A;  1ZYR C;  3A5U A;  1Q1B A;  4KI0 A;  3Q23 A;  3HOY G;  1SMY C;  2IT1 A;  2NUC A;  3CPF A;  4KLK A;  4S3S A;  1X6O A;  5IGB A;  3A54 A;  4NXN L;  2PI2 E;  3EQL C;  4JBW A;  1XNR Q;  5A35 A;  4JI1 Q;  1N36 L;  1FR3 A;  3KF6 B;  1Q1E A;  2MNA A;  1STN A;  3I4N B;  4CBV A;  1JOQ A;  1IW7 D;  4DR2 Q;  4DR6 L;  5C4J H;  3MFG A;  4ILW A;  1HQR D;  1HNZ L;  2PYK A;  2AWN A;  1PRT D;  2SEB D;  4UAI A;  2Z9H A;  3JC6 6;  4HJA A;  4ZKC B;  3CQZ B;  4DN4 M;  4WFN 3;  3OTO Q;  4ID6 A;  1SNM A;  3VDY A;  3CC2 A;  1WTP A;  4LF6 L;  4PZ7 A;  4K2K A;  1EYD A;  1PZK D;  4M1U B;  4DGZ A;  4CJ2 C;  1CSQ A;  1TY0 A;  5FO9 B;  3S17 B;  1L0W A;  1EWI A;  2XSC A;  4IN3 A;  2RBM A;  3U9O A;  1FYC A;  1IBM Q;  2EXD A;  4CHT B;  1BR9 A;  3DHQ A;  2EE1 A;  3KDF B;  1Y8P B;  2VB3 X;  2F3W A;  3L3O C;  2NN6 G;  2M2L A;  2FFK B;  4B9W A;  3V05 A;  2OT2 A;  1I6H H;  5E3F A;  1QUQ B;  1E7Z A;  1I94 L;  2G9D A;  1IL2 A;  1K3B C;  4DR5 L;  1HZB A;  5BR8 L;  4LK1 C;  2B3G A;  2F0Q A;  2M00 A;  1SFO B;  2BH2 A;  4NXN Q;  3BZD B;  1H9J A;  1TS5 A;  2JYO A;  5FLX c;  1SYF A;  3RD4 A;  3TEH B;  2ATW A;  4ME5 A;  3HKS A;  2A69 C;  1HA6 A;  3V2T A;  5LHY 1;  1Y14 B;  4A3B G;  1JOR A;  4DXF A;  1I4X A;  4A3M H;  4TRD A;  1MKH A;  1ESF A;  2V4D A;  4BBR H;  1HNZ Q;  3EN2 A;  4IPC A;  4GN5 A;  4AYB E;  3H0G G;  1YBY A;  2WKD A;  2R93 H;  3HOZ G;  4XXE A;  1EY9 A;  2B8F A;  4C3H H;  1T5E A;  1HQM C;  4FXK C;  4Q0F A;  2E2D C;  2IPK D;  2K05 A;  3W3A A;  4A3L H;  1YJN A;  1VQ7 A;  3K59 A;  2KEN A;  3J81 c;  3K58 A;  4YY3 Q;  4OWW B;  3H3V C;  2PZU A;  3GTQ B;  3PUY A;  1E3P A;  4GNX C;  1M1K C;  3K6O A;  4UY8 C;  1TWG B;  3VYU A;  1WCM G;  2JA5 B;  3DXJ C;  1VQM A;  1EWH A;  5CR3 A;  1A0I A;  1K0S A;  3OIQ A;  2N3S A;  4LAA A;  3I55 A;  4LFB L;  1JWU D;  2HDL A;  5C4Z A;  4R8I A;  1I50 B;  1JMC A;  1KHI A;  5K36 G;  3OPO A;  2SNS A;  2X6G A;  1F9S A;  1TKW B;  3KLR A;  4HCS A;  4DV6 Q;  4DR5 Q;  3S2H H;  2F0W A;  1J5E Q;  5BR8 Q;  5J39 A;  2QDB A;  2A1A A;  2Z6K A;  5M5X H;  1LO5 D;  3GV6 A;  2FMC A;  2QEJ C;  4J8Q A;  2DUD A;  1BF4 A;  5IYD H;  3NEM A;  2HIX A;  3H15 A;  2C35 B;  2ZTC A;  4N8F A;  5GAE C;  1D5Z C;  4A3I H;  3VA5 A;  3T16 A;  2AQ1 B;  3K80 C;  1N34 L;  3ER0 A;  5FLX L;  5JPM C;  3M4O H;  3G4S A;  1SSO A;  1K8O A;  4RCO A;  2EYP A;  5LMN Q;  2B63 B;  2EYF A;  1PVO A;  2XGT A;  1VQB A;  4YY3 L;  4ODG A;  5M5X B;  4IZ8 A;  1C7Y A;  4LF4 L;  5GRO A;  2XVS A;  3MC0 B;  2BDO A;  4A3E B;  1BCP C;  2Q8R E;  4LF7 L;  4BBS H;  4EX5 A;  3URY A;  4A93 B;  2KJX A;  1J6Q A;  1I50 H;  3E9I A;  3M85 A;  4Y7N H;  4X65 L;  3ULL A;  4K6L A;  1HZA A;  1AP0 A;  2E5L L;  3W1G A;  4G4K A;  1G2T A;  1RCV D;  1U4R A;  1H9S B;  2Q2T A;  2IWH A;  3RN2 A;  4DK6 C;  2MO0 A;  4ZAI A;  2B2U A;  4U68 A;  4IUV A;  4RGO S;  1ET9 A;  3CXC A;  4YHH L;  5CV9 A;  4DV6 L;  1YVC A;  5KYL A;  1ESR A;  1EFW A;  1J5E L;  1J9O A;  3BS1 A;  3NQT A;  1NCV A;  3I7F A;  1QB5 D;  1X3F A;  1NBW A;  1EQR A;  5M3M B;  4IUR A;  2VQE L;  4GNX B;  2NVQ B;  4K5W A;  5IGE A;  3H3V I;  1O78 A;  3P7J A;  3RZD H;  1B9M A;  1STG A;  3ND9 A;  5I4D A;  1GJX A;  1XJV A;  1YNN D;  4L6T B;  2RA4 A;  1TWC B;  4O0A A;  1D8L A;  4JW0 A;  2EYL A;  1KNA A;  2L11 A;  3OHX C;  4A3C H;  3ERO A;  3CRL C;  2A6H D;  4R1J A;  5DNF A;  2F0H A;  4N9P A;  3CW2 C;  1X56 A;  4F87 A;  1QVC A;  3BDC A;  1B50 A;  2MHV A;  5LMN L;  3GTK H;  1HUN A;  1BBU A;  3CU7 A;  2WP8 J;  1OXT A;  2D0P A;  3E0J A;  2DY7 A;  5IOC A;  5H1S E;  4LF7 Q;  2YTV A;  3T1Y Q;  2R61 A;  3CCM A;  5IYC H;  2O4X A;  1LTB D;  2ICE C;  1JE5 A;  1O7I A;  2NVY B;  4IJH A;  4JVZ A;  5AJ3 L;  5ELB A;  4X65 Q;  4KJN A;  4MTK A;  2HDM A;  1I6H B;  3FRP B;  4YCW A;  5C5M A;  5COY A;  3WDN A;  4DV7 L;  4A76 A;  1VQN A;  4IFD H;  4JBK A;  1KAW A;  3CCU A;  1BNZ A;  1ZYR D;  2I5H A;  4YHH Q;  5IT9 L;  4CKB A;  3JAM c;  4PG3 A;  4OL7 A;  1UNS A;  3I56 A;  2ASB A;  1EQV A;  4B9X A;  3F2C A;  2RDF A;  3I4M G;  1A2U A;  2J7Z A;  5E4W C;  1EEF D;  1XTD A;  5EKL A;  2VQE Q;  3MXN B;  4HIO A;  3PSI A;  2IW3 A;  3KBG A;  4EQN A;  4K8J A;  2Z4I A;  5IT9 E;  1LUZ A;  4LF8 Q;  3HGB A;  3U58 A;  4EQO A;  2F4V Q;  3I4M H;  3LX0 A;  3HG9 A;  4GZY C;  3FKI B;  1G6Z A;  4QIW E;  4QGU A;  2UUA L;  3KFU A;  2C9O A;  3H94 A;  3HOU B;  1R4Q B;  1PRT F;  3T13 A;  1GM5 A;  5EPK A;  1SE2 A;  4X64 L;  5F2D A;  1SE4 A;  1EU3 A;  3C2P A;  2AQ3 B;  4DAP A;  4G7Z C;  4ULL A;  1EOT A;  3R93 A;  1NJI C;  5AJ3 Q;  5FJ8 G;  3BDL A;  4EQP A;  3R2T A;  1QZH A;  1RD9 D;  1GUS A;  1WTX A;  2NVY H;  5KGU A;  1C0A A;  4IUP A;  4B3S Q;  2L5T A;  5I2Y A;  4DV7 Q;  2CW0 D;  2RKS A;  1U4M A;  1AN8 A;  3D3R A;  3QJY A;  4XYQ A;  1Y8N B;  3GTG B;  1R9T B;  2IX0 A;  3HOU G;  4QUF A;  5HUR A;  4DV4 Q;  4B3T L;  2LMC B;  2F4V L;  3RZD B;  4BXX G;  4C3J B;  3ITP A;  3G6E A;  1WTH A;  1CA5 A;  2A73 B;  2E2J B;  3ZJY C;  3LWE A;  5IP9 H;  2ZJQ A;  3T56 B;  3S16 B;  4KY7 A;  3S14 B;  2LXK A;  3J80 c;  5IIF A;  1VQF A;  2B2U C;  3A56 A;  3K7A B;  1WTW A;  3CCR A;  4A3D G;  1WFQ A;  4A3K B;  1DZ1 A;  4OO1 H;  2D5D A;  1EIG A;  4K8I A;  1X3E A;  4P73 A;  4P75 A;  1JB7 A;  4BBS G;  2K1B A;  1HR0 Q;  3M3Y B;  3I3C A;  4DR7 Q;  1MJC A;  4AIM A;  1M90 C;  1TWH B;  1HTP A;  1SYE A;  2OQK A;  3QWN A;  2F0D A;  2IL8 A;  2JXM B;  1VQ8 A;  2KCN A;  1R9T H;  4RH6 A;  2CH4 W;  2PW5 A;  5D14 A;  1PRT C;  5C4X G;  2OWO A;  2K04 A;  3QOJ A;  4HJ8 A;  5IY0 A;  1KLG D;  4LNQ A;  1WJJ A;  4K6D A;  3A8K E;  1ICF B;  2WFW A;  3D4W A;  1B8A A;  3D6C A;  1JQY D;  1E2Z A;  1ET6 A;  5JEA G;  2ES2 A;  2R6G A;  4DNT B;  2WV6 D;  3NTK A;  5EQ0 A;  4ZKB B;  1PH6 A;  4L5S A;  5JEA H;  4Y52 H;  1NE3 A;  2R7D A;  1JC7 A;  4P74 A;  5A2Q E;  1K83 B;  4PQX A;  1I4R A;  3TP7 A;  4DV4 L;  4A3I B;  1A2T A;  1I4P A;  2K5D A;  3HOX H;  1YEZ A;  2OXP A;  2D2C C;  2Z6K C;  2ZT9 C;  1ILQ A;  2RCF A;  3NSW A;  4NMZ A;  4LUO A;  1IBL L;  4R9W A;  1WD1 A;  2F0G A;  1S5E D;  5I6Y A;  2Z8L A;  5IP7 G;  4WOR A;  5LMN W;  5IGD A;  3NQI A;  1SNC A;  4ME3 A;  1YHQ A;  1P8L A;  5J22 A;  4RGT A;  2F4I A;  3VYT A;  5C3X A;  3QG1 A;  4C1N K;  5FO7 B;  1XWE A;  4L8J A;  1CA6 A;  4A3D H;  2CHB D;  2VNU D;  1HR0 L;  3S9W A;  2JK8 A;  1KDA A;  3PO2 H;  4XDX A;  1QE6 A;  1Q90 A;  4DNI A;  2MGS A;  3BYY B;  2XRS D;  5C0X G;  4L63 B;  1A63 A;  2K6A A;  2WKC A;  5IE8 A;  5J1Z A;  3U4Z A;  3P1H A;  1W6J A;  4PNY A;  1Z7T A;  1D5X C;  4RA8 A;  5DLQ E;  4BXX H;  4CKC A;  1QWY A;  1V1P A;  2EJG C;  2MP1 A;  3CPW A;  2PMZ E;  2K5W A;  1PHJ A;  1FJG Q;  4DK0 A;  4C3J H;  3VR5 A;  4CKE A;  4A3B H;  1BXT A;  2Q8T A;  3SHL A;  4BY7 G;  2K5H A;  1SRU A;  2K52 A;  2NTT A;  4LF5 L;  1TWF B;  2H1E A;  1W6K A;  2LS0 1;  1KNE A;  5C3E B;  1U0L A;  2EJM A;  4H13 C;  4X3S A;  1IBL Q;  3AFP A;  5L37 A;  5JVH 3;  2IX3 A;  2QGQ A;  1X3P A;  2JEA I;  1DM0 B;  4C3I B;  3JAM L;  3TN2 A;  2NVT B;  2WIN B;  2E2H H;  1E2W A;  1LTS D;  1EL0 A;  1N33 L;  1Q8K A;  3TP6 A;  2BE5 D;  4JV5 Q;  2NN6 H;  5C3W A;  1FGB D;  1D1K A;  1HA5 A;  1YIT A;  5CYU A;  4DNR B;  1GD7 A;  1D5M C;  4DKA C;  1CSP A;  1OO9 B;  4R4O A;  2YU9 B;  1EY5 A;  1JWS D;  1H9R A;  2OTJ A;  2BCO A;  3VYR A;  1RDP D;  1Y1V B;  1LAC A;  4JG2 A;  1SYB A;  4DV3 L;  4WJW A;  3PO3 H;  3UE1 A;  2IJ0 A;  3M4P A;  4BWG B;  1H9S A;  2SOB A;  5GAD C;  1X3G A;  2KCC A;  2PQA A;  4IUU A;  4LMQ D;  3RR5 A;  3DUZ A;  3VR6 A;  2RQX A;  4V19 0;  3S1Q B;  4B3R Q;  3F2U A;  4OON A;  4UP8 A;  4JI8 L;  3NE5 B;  1B2T A;  1GUT A;  4RKB A;  2CKZ B;  4DR4 L;  2BOS A;  1FJG L;  3CKI B;  4C3I G;  1V1O A;  1FNW A;  3TSS A;  2IHE A;  5DM6 3;  1UE5 A;  2UU9 L;  2WAQ B;  1RTN A;  2UUC L;  2QW7 A;  5I6W A;  3HFZ B;  2ZM6 L;  1PFB A;  3OOC A;  3CME A;  1RF2 D;  3N52 A;  4JI0 Q;  4XQQ A;  2X6L A;  3KLW A;  4BA1 I;  1VQD A;  4EGV A;  3RZO B;  3S1Q H;  2L15 A;  1ASY A;  1AZP A;  1CFM A;  2WII B;  1IYV A;  4XT3 B;  4BA2 I;  2ZXP A;  2QA4 A;  5I9P A;  2PNR C;  4PV1 C;  1L1O C;  3EVQ A;  1PH7 A;  2EYJ A;  2RHQ B;  3TRE A;  4IOA A;  4GKJ Q;  1YHA A;  1E2V A;  2E2I H;  1EY8 A;  2K14 A;  4QQB X;  1IZ6 A;  2SDF A;  3D4D A;  4RMF A;  1VQC A;  2GVA A;  1EIF A;  4C3I H;  4V0B A;  3VA7 A;  3ICE A;  2CWP A;  1E22 A;  5ELN A;  4J1M A;  1DGS A;  3HOV B;  1EY6 A;  1Y1W H;  1XMO Q;  2B63 G;  2XTI A;  1FL0 A;  2NVX B;  1GUO A;  2FMM A;  5C3E H;  3CCS A;  3F1Z A;  4DR4 Q;  1EUJ A;  3OIP A;  3E5S A;  4A3F H;  2FXQ A;  3U4V A;  4O2D A;  4MNO A;  2AMC B;  1YI2 A;  1SE3 A;  2PZT A;  2CWA A;  2F52 A;  2Z0S A;  3C1F A;  4A3K H;  2LXJ A;  1MI2 A;  5FLX E;  4K5V A;  4JI0 L;  3L7Z C;  3W2D A;  2EY2 A;  5KYI A;  2B2V C;  3CCQ A;  3DEO A;  4YWK A;  1YZ6 A;  2O5J C;  4KN4 C;  4C56 C;  1S3O A;  4R4I A;  1S5D D;  3D6W A;  1IBK Q;  1EYC A;  1XPU A;  1JOK A;  3GTL H;  4DU9 A;  2K7V A;  2VY3 A;  5BN4 A;  3MEF A;  3NHH A;  2XN9 C;  3T1H Q;  1HR0 W;  4HMJ A;  4F88 A;  2B39 A;  3U9S A;  3PF4 A;  2EY6 A;  1JJC B;  1ONL A;  1YNN C;  1Q86 C;  3F2B A;  3IKJ A;  2A19 A;  4IPG A;  2H5X A;  1JR0 D;  4DA2 A;  4B08 A;  1L1O B;  4HN7 A;  1EWC A;  2IHF A;  3PUV A;  1Y1W B;  2NB0 A;  5JAV A;  4PZ6 A;  4BBS B;  2L4N A;  3E6Z X;  3SE0 A;  2EYO A;  1GUG A;  1EOV A;  3HOW G;  4ZUI A;  3AEV A;  1TQO A;  1SNQ A;  1N32 L;  5JJL A;  4GN4 B;  3DM3 A;  1LT5 D;  2UUB Q;  5CV8 A;  1GO3 E;  1EU4 A;  1Y69 U;  4KJO A;  1MGS A;  1LTR D;  2A69 D;  4RCN A;  1R4P B;  2HQL A;  3BG3 A;  4PMW A;  4OX9 Q;  1TT2 A;  1BDO A;  4DV2 L;  1SND A;  1RTO A;  2JN4 A;  1STY A;  1HUM A;  4KY5 A;  3WWV A;  2QIL A;  3A74 A;  1ZKO A;  3BJU A;  2N88 A;  2ZTD A;  4J15 A;  1LM0 A;  5IYB H;  5EKK A;  3IRB A;  4KD4 A;  3G6J B;  3S15 B;  3X3M A;  2X69 A;  2EYH A;  3ZYY X;  2HT1 A;  1MBY A;  1BBW A;  5JVG 3;  1TWH H;  1SNO A;  2PPB C;  1X65 A;  3TZD A;  2IX1 A;  3FPU B;  2HD3 A;  5CMD A;  2A5H A;  3FMC A;  1ZXT A;  1SYD A;  3QR8 A;  1PH1 A;  1V1P B;  2HCC A;  1F2Z A;  2E76 C;  1UUP A;  5IP7 H;  2MQH A;  4HED A;  2F0I A;  4N8X 1;  4H7B A;  5IGF A;  5D3D A;  3SK6 A;  3D0F A;  3S14 H;  2FJ2 A;  1N36 Q;  4FYD A;  2KA7 A;  1L0X B;  1JE4 A;  4C3J G;  1PDQ A;  1C8C A;  1VQK A;  2PCF B;  1PV4 A;  4BY7 B;  1WTV A;  3JAM E;  2R93 G;  1BOS A;  2UUB L;  5IWA L;  1FGU A;  4A3J B;  3TRZ A;  2E2J H;  5DAU A;  1GKH A;  3PF5 A;  2NVX H;  3IL8 A;  2NVT H;  3DWP A;  2Y0S G;  3MZ5 A;  1QVF A;  3PCO B;  4LJZ C;  4PZ8 A;  3HKZ E;  5G3L D;  2NBF A;  3BVG A;  1F9Q A;  3HOZ B;  3MXN A;  1IBM L;  3C1E A;  1CQF A;  3KF6 A;  5I2X A;  3NEN A;  4DUY L;  2ALY B;  1LLR D;  4P2C B;  2VUM B;  3MHB A;  3EJI A;  3QO2 A;  2CCZ A;  3RUZ A;  3W5O A;  4A3B B;  3LNN A;  3I72 A;  4LWC A;  1EZ8 A;  3S1M B;  2JJQ A;  1IYJ B;  1SDF A;  4ZYS A;  3CHB D;  5IYB G;  2D62 A;  4WRD A;  4UHV A;  2J0T D;  2B2W C;  1V1Q A;  1BCP B;  5IP9 G;  5CBA E;  4L5Q A;  4RHS A;  1X32 A;  5CC4 A;  4F8M A;  4I7A A;  1O7L A;  1HXY D;  3RLO A;  1G2S A;  5M3F B;  1VF5 C;  2F3V A;  1HCZ A;  2JA8 G;  1LAB A;  2B29 A;  2RDG A;  3HOU H;  2BH8 A;  2I0Q A;  2AUK A;  2R7Z G;  1X54 A;  3HOW H;  5C4X B;  2F0U A;  1BUV T;  5ELC A;  1HNX L;  2PO4 A;  1YJ9 A;  1W3S A;  2XWJ B;  4OWT B;  4Y7N B;  3J7Z C;  4JI3 Q;  4IFD J;  1SMY D;  4RAU C;  5D3I B;  4G7H C;  1F2M A;  2CFM A;  2Q2H A;  1VDZ A;  3Q22 A;  1H9K A;  1JWM D;  4RKL A;  2F0L A;  3RLN A;  1G6P A;  5FJ8 H;  4DUY Q;  1UAP A;  2K50 A;  1QNK A;  4KN7 C;  5LMU L;  2UXC L;  1KRT A;  2PQA B;  3QOL A;  4P72 A;  4Q5V A;  2Y0S E;  2G9H D;  4GLV B;  5C4H A;  1TWA H;  2ZJR A;  2NZH A;  5BN5 A;  1K28 A;  2DN8 A;  1VQG A;  4CDC C;  1JOO A;  4UP7 A;  1CZG A;  3STB C;  1XMQ Q;  1EQQ A;  1I4H A;  2Q8I B;  3GTP B;  5IOD A;  2EOT A;  3K81 C;  2VQF Q;  4A3F G;  3F2D A;  1NNX A;  2A74 C;  4QMG A;  5C0X J;  1MSH A;  1CT1 D;  4FVM A;  3D31 A;  2N8N A;  2EXZ A;  1TXY A;  3PIP 3;  1XTC D;  1Y8O B;  4O42 A;  4DR3 Q;  2B2Y C;  4OEL B;  1SMX A;  5AFW A;  5FLM H;  1N34 Q;  5ELE A;  3AU7 A;  2ZXO A;  3A8I E;  5DEH A; 
#chains in the Genus database with same CATH homology
 1SXT A;  1KDB A;  1SEB D;  2F0V A;  3D4R A;  4XYO A;  3MTS A;  3KUP A;  1EEI D;  3GO5 A;  1SNP A;  4OGQ C;  1ENF A;  1RHP A;  1QJO A;  2EPB A;  5M5W B;  1CI3 M;  4FF1 A;  3PUZ A;  4KTA A;  2B2T A;  3I70 A;  4FF3 A;  1J8I A;  1F2Y A;  3GTM B;  1B9N A;  2R7Z B;  2EY5 A;  3PMF A;  1RJT A;  3K5M A;  2B2T C;  2L0C A;  2NN6 I;  5E1F A;  3VR2 A;  2J4X A;  2KQ3 A;  1KDC A;  5JPN C;  1LT6 D;  5HGT A;  4BBR B;  2E75 C;  3CRK C;  3MAQ A;  2OEO A;  3HP3 A;  1PLF A;  2K33 A;  3K5L A;  2ZXR A;  3SEB A;  5JEA J;  1QNU A;  3R3O A;  3HOX B;  4ZUJ A;  3MA2 B;  1H9M A;  5ISR A;  3M7G A;  1WCM B;  5CV7 A;  3MWY W;  4DFA A;  4BS9 A;  1VMC A;  1I6V C;  4ZQ3 A;  1I4G A;  1II3 A;  4NDX A;  1ML0 D;  1OXV A;  3OSO A;  3KBX A;  1PTO B;  2F0T A;  2QCP X;  1NAP A;  5KRU A;  1PTO D;  1YNJ D;  2XNA C;  4KD3 A;  1U4P A;  3P20 A;  4MHE A;  4XQJ A;  1SYG A;  1HHV A;  1B44 D;  4DXG A;  2F0J A;  1F9P A;  1WD0 A;  3MXG A;  3GD7 A;  1MSG A;  2O2L D;  2RSO A;  5KEE A;  1K8M A;  4QCL A;  3HRZ C;  1PZI D;  3I4L A;  4XIG S;  1CK1 A;  1SJE D;  1IKM A;  3MVV A;  5FKA C;  2EZV A;  1G29 1;  4KK7 A;  3VYS A;  1ZEQ X;  4KMU C;  5K5P A;  4K5X A;  1PZJ D;  3OWF A;  2F0E A;  2EVB A;  5C0X H;  3K57 A;  3RLF A;  1ENA A;  4A3M B;  2JP1 A;  1AFP A;  4FNF A;  2EJF C;  2BA0 A;  4QIW B;  5T1G A;  2Y0S B;  2K5Q A;  5EJW A;  2TSS A;  4XTC S;  3S1R B;  1LV9 A;  1WTR A;  2CVR A;  2F0N A;  4FF4 A;  5COR A;  3BYT B;  1STE A;  1TS3 A;  2XWB B;  3NXW A;  3N6R A;  5FO8 B;  5IGG A;  4RGN A;  3IFT A;  2RVL A;  1A6X A;  2AQ2 B;  3ERQ A;  1F2L A;  2KED A;  1HRJ A;  1ICW A;  1VF7 A;  1EY0 A;  1I3Q B;  3H91 A;  3IFD A;  3SK4 A;  2F0M A;  2B8G A;  1NUC A;  3H6M A;  1IL8 A;  4NP5 A;  1GOZ A;  1U4L A;  4A3D B;  1VMP A;  2HUG A;  1V43 A;  4MN3 A;  4DAV A;  1EQT A;  1V8Q A;  2M9V A;  1MD2 D;  4RGM A;  1Q12 A;  1BCP F;  3J81 E;  3K0Y A;  3HOW B;  4E6I A;  2VB2 X;  1TR5 A;  4EVO A;  3O13 A;  3PIO 3;  3QIA A;  2NWG A;  2HCI A;  1M4V A;  4CGY B;  2ICI A;  3L9A X;  4JK1 C;  2Z4H A;  1PTO H;  4OO1 G;  5NUC A;  2A68 D;  3M4O B;  1Q3L A;  4HTH A;  2WAC A;  3ONA B;  1JCK B;  4HSV A;  3TDQ A;  3FVQ A;  1LTT D;  2KVM A;  1C4Q A;  4X3T A;  2EYM A;  4A3G B;  1B3A A;  1TS2 A;  4AYB B;  3KF8 A;  4OHJ A;  1SYC A;  1WVL A;  3S2H B;  1CTM A;  2F03 A;  2EDG A;  1BCP D;  4UDU C;  2BA1 A;  2VXW A;  1KTK A;  1STA A;  1S5F D;  1D6E C;  1FD7 D;  3T4A C;  1A15 A;  3RMH A;  5C0X I;  3DMU A;  2N55 A;  2CW0 C;  1S5C D;  4HSP A;  4HR7 B;  1B1Z A;  1OXU A;  2ENB A;  2B2V A;  4BY1 B;  3HKZ B;  1BBX C;  3SK5 A;  4OIK A;  4NW2 A;  5CV5 A;  3OMC A;  3VR3 A;  2NTS A;  4OIJ A;  5KNC A;  1A3U A;  3VR4 A;  2E2I B;  3IAY A;  2JEB I;  3NK9 A;  1DD2 A;  4ZRZ A;  4KY6 A;  1EFI D;  3QB3 A;  3BDO A;  4HAE A;  4N9T A;  1TWA B;  3X3N A;  1SJH D;  4XQN A;  2L55 A;  3WOF A;  2RSN A;  3MXU A;  4PMC A;  1DOL A;  1KLU D;  2R3Z A;  4R8N A;  1CZW A;  1UEA B;  1ROD A;  5C4J B;  2ID0 A;  4G57 A;  4KKS A;  1ENC A;  1BO0 A;  3KK7 A;  3M4Y A;  2MPM A;  5CBE E;  1PTO F;  2D9U A;  5JOB A;  2DNE A;  3T51 B;  1HPC A;  3WOE A;  2Z1C A;  2CQA A;  4X3K A;  2F0P A;  5EPL A;  5CGK A;  2JSO A;  5EBD A;  5TSS A;  2R93 B;  4KKU A;  3GTJ B;  2F0K A;  1DCZ A;  2LY7 A;  4I65 A;  4DK1 A;  1KAA A;  2BE5 C;  3Q24 A;  2MJ8 A;  5FOB B;  3MXP A;  4FXG C;  5G3L F;  3GTK B;  3H0G B;  4KKT A;  4DF7 A;  1OXS C;  3J7Y W;  2R92 B;  4G7O C;  3A7L A;  5C5L A;  2A6H C;  3R8B A;  2JA8 B;  1A3V A;  1PMR A;  3S2D B;  1B4O A;  3Q6S A;  4ZK9 B;  1CQV A;  2A68 C;  2K28 A;  2F1M A;  3AMU A;  3FDT A;  3DEP A;  2LFN A;  5LL6 S;  3J80 L;  3PUW A;  1GHK A;  3PO2 B;  4CJ1 B;  2FHT A;  3SVM A;  4K2L A;  1VCI A;  2DNC A;  2A6E C;  2NYZ D;  3I4M B;  2QKI C;  1T5X D;  2JA7 B;  1PTO C;  1YNJ C;  5ELD A;  1O80 A;  2KEC A;  1S4Z A;  1EY4 A;  1RKN A;  2PW7 A;  1O7Y A;  2RDH A;  3TZU A;  1HFN A;  3KLS A;  3NTI A;  2I46 A;  3R2I A;  5E4X A;  3PO3 B;  4IUN A;  2PQE A;  4K14 A;  1LT3 D;  2KHS A;  1GHJ A;  1AEX A;  2L12 A;  2L9H A;  1AW7 A;  2JA6 B;  3T53 B;  2KUM A;  2OF1 A;  2KEE A;  4IUQ A;  1EZ6 A;  3AB9 A;  1LTA D;  1ILP A;  2E2H B;  1QIL A;  3I90 A;  3PUX A;  1D2B A;  3OMG A;  1C48 A;  1TS4 A;  5EPJ A;  1GXD C;  1NSN S;  1OXX K;  3DWA A;  4RWS C;  5M9O A;  4PMB A;  3LWU A;  4FXD A;  5EGT A;  1JB3 A;  5DM7 3;  3TP8 A;  4XT1 B;  1M8A A;  2B2Y A;  1B53 A;  2XRQ D;  3K5N A;  5KNB A;  2BDN A;  3NWS A;  2A6E D;  1GUN A;  2HQE A;  1CHQ D;  5I9O A;  3A7A B;  1F9R A;  1EYA A;  1JIC A;  2QF7 A;  4C3H G;  1LT4 D;  3TME A;  5A2Q L;  3UI2 A;  4O1N A;  4NKL A;  3J7A F;  2I07 B;  3NWT A;  1F77 A;  2K03 A;  4TSS A;  5CV6 A;  2LKV A;  4KHZ A;  5C44 B;  3EA6 A;  2O5I C;  5KND A;  1HTL D;  1PRT B;  5EBC A;  1I4Q A;  1BQQ T;  3SDZ A;  2YYZ A;  3PV0 A;  1U9R A;  3NP8 A;  4FF2 A;  1CM9 A;  1Z47 A;  1XYI A;  4ZLT F;  1QCB D;  2JE6 I;  3NPP A;  1Q8I A;  4DAY A;  3J7A V;  3SR1 A;  3DWQ A;  5EKI A;  1IHZ A;  4IQZ A;  4CJ0 B;  4H0L C;  1L0Y B;  1Z6H A;  3HZX A;  4YIJ A;  3D8G A;  1SBB B;  2F0O A;  5T1I A;  2B2W A;  1QOH A;  1STH A;  4IAL A;  4RHR A;  4QB4 A;  1DYQ A;  3ND8 A;  2PZW A;  3TP5 A;  2PMZ B;  4RFB A;  5ELF A;  2H4O A;  2F0S A;  3S1N B;  1IW7 C;  4C3H B;  3M7N A;  5LL6 X;  2C5C A;  4FO2 A;  3Q0A A;  3DM1 A;  4IFD G;  1PFN A;  2MUY A;  3J80 E;  1DON A;  3I8Z A;  3EFX D;  4FP5 D;  1STB A;  3NTH A;  3GTL B;  1LTG D;  1HFG A;  3GP7 A;  1NR2 A;  3OWE B;  1EIH A;  4HMI A;  5IGC A;  3A55 A;  1DXM A;  2SNM A;  1D1I A;  1FNV A;  1E0B A;  3BVM A;  3GQB A;  4KHV A;  3NBH A;  1KAB A;  1DOK A;  1DJR D;  2K32 A;  5KIX A;  3NBI A;  4QF4 A;  4IFD I;  3FEW X;  1IKL A;  2XIW A;  1O7Z A;  3J81 L;  1XXG A;  4X3U A;  1TVX A;  3H09 A;  1SAP A;  4J6H A;  4M8A A;  1WTQ A;  3KLS X;  1PYW D;  1XX8 A;  1PXU A;  2EY1 A;  4F7X A;  3P75 A;  3SK8 A;  1PFM A;  5JJZ A;  4MIU A;  3HS0 C;  3HEJ A;  4IUT A;  1G91 A;  1A3T A;  2E74 C;  1S5B D;  3OW7 A;  2L1B A;  1AZQ A;  2AWO A;  3MFY A;  3C46 A;  5M5Y B;  4C2M B;  2FIN B;  4C1N I;  3G7L A;  2KOL A;  3C3L A;  3I73 A;  4KV6 A;  5FK9 C;  4HCE A;  2TMP A;  1TII D;  1DOM A;  4TKO B;  4U67 3;  1CHP D;  3A8J E;  4TQU S;  1TU2 B;  1EY7 A;  3GV3 A;  4H44 C;  1FNU A;  3GTO B;  2K01 A;  2GA4 B;  5K36 H;  4Z9C B;  5CV4 A;  4I7Z C;  1X3Q A;  1GUW A;  3HOY B;  5C6A A;  3TBI B;  1NR4 A;  2F0F A;  1IYU A;  1LTI D;  3K5O A;  4A3F B;  3FPP A;  4QUC A;  2AUJ D;  5BN3 A;  3MEH A;  4ABN A;  2DY8 A;  2NZ1 D;  1WTO A;  3V96 A;  2WB1 B;  1TY2 A;  3SXH A;  5D65 A;  4OO1 I;  1G8Z D;  1QG7 A;  3I91 A;  3NUC A;  3BVZ A;  1ZYR C;  1Q1B A;  4KI0 A;  3Q23 A;  1SMY C;  2IT1 A;  2NUC A;  4S3S A;  5IGB A;  3A54 A;  4JBW A;  3EQL C;  5A35 A;  1FR3 A;  1Q1E A;  1STN A;  3I4N B;  4CBV A;  1JOQ A;  1IW7 D;  3MFG A;  4ILW A;  1HQR D;  2PYK A;  2AWN A;  1PRT D;  2SEB D;  4UAI A;  4ZKC B;  3CQZ B;  4DN4 M;  4WFN 3;  4ID6 A;  1SNM A;  1WTP A;  4K2K A;  1EYD A;  1PZK D;  4M1U B;  4DGZ A;  4CJ2 C;  1TY0 A;  5FO9 B;  3S17 B;  2XSC A;  4IN3 A;  2RBM A;  3U9O A;  1FYC A;  4CHT B;  1BR9 A;  3DHQ A;  2EE1 A;  1Y8P B;  2VB3 X;  2F3W A;  2NN6 G;  3L3O C;  2M2L A;  2FFK B;  4B9W A;  3V05 A;  2OT2 A;  5E3F A;  2G9D A;  4LK1 C;  2F0Q A;  2M00 A;  1SFO B;  3BZD B;  1H9J A;  1TS5 A;  2JYO A;  1SYF A;  3RD4 A;  4ME5 A;  2A69 C;  1HA6 A;  3V2T A;  5LHY 1;  1JOR A;  4DXF A;  1I4X A;  4TRD A;  1ESF A;  2V4D A;  2WKD A;  4XXE A;  1EY9 A;  2B8F A;  1T5E A;  1HQM C;  4FXK C;  4Q0F A;  2E2D C;  2IPK D;  2K05 A;  3W3A A;  3K59 A;  3K58 A;  3H3V C;  2PZU A;  3GTQ B;  3PUY A;  3K6O A;  1TWG B;  3VYU A;  2JA5 B;  3DXJ C;  1EWH A;  5CR3 A;  3OIQ A;  4LAA A;  1JWU D;  2HDL A;  5C4Z A;  4R8I A;  1I50 B;  5K36 G;  3OPO A;  2SNS A;  2X6G A;  1F9S A;  1TKW B;  3KLR A;  4HCS A;  2F0W A;  5J39 A;  2QDB A;  1LO5 D;  3GV6 A;  2FMC A;  2QEJ C;  4J8Q A;  1BF4 A;  1D5Z C;  3VA5 A;  3T16 A;  2AQ1 B;  5FLX L;  5JPM C;  1SSO A;  1K8O A;  4RCO A;  2EYP A;  2B63 B;  2EYF A;  4ODG A;  5M5X B;  4IZ8 A;  2XVS A;  3MC0 B;  2BDO A;  4A3E B;  1BCP C;  2Q8R E;  3URY A;  4A93 B;  2KJX A;  3M85 A;  4K6L A;  1AP0 A;  4G4K A;  1G2T A;  1RCV D;  1U4R A;  1H9S B;  2IWH A;  4ZAI A;  2B2U A;  4U68 A;  4IUV A;  4RGO S;  1ET9 A;  5CV9 A;  5KYL A;  1ESR A;  1J9O A;  3BS1 A;  3NQT A;  1NCV A;  1QB5 D;  5M3M B;  4IUR A;  2NVQ B;  4K5W A;  5IGE A;  1O78 A;  3P7J A;  1B9M A;  1STG A;  3ND9 A;  5I4D A;  1GJX A;  1YNN D;  2RA4 A;  4L6T B;  1TWC B;  2EYL A;  1KNA A;  2L11 A;  3OHX C;  3ERO A;  3CRL C;  2A6H D;  5DNF A;  2F0H A;  4N9P A;  4F87 A;  3BDC A;  1B50 A;  2MHV A;  1HUN A;  3CU7 A;  2WP8 J;  1OXT A;  3E0J A;  2DY7 A;  5IOC A;  2R61 A;  2O4X A;  1LTB D;  2ICE C;  2NVY B;  5ELB A;  4KJN A;  2HDM A;  1I6H B;  3FRP B;  5C5M A;  5COY A;  3WDN A;  4IFD H;  1BNZ A;  1ZYR D;  5IT9 L;  4CKB A;  4OL7 A;  1UNS A;  1EQV A;  4B9X A;  2RDF A;  1A2U A;  2J7Z A;  5E4W C;  1EEF D;  5EKL A;  2IW3 A;  3KBG A;  4EQN A;  4K8J A;  2Z4I A;  5IT9 E;  3HGB A;  4EQO A;  3LX0 A;  3HG9 A;  4GZY C;  3FKI B;  1G6Z A;  2C9O A;  3H94 A;  3HOU B;  1R4Q B;  1PRT F;  3T13 A;  5EPK A;  1SE2 A;  5F2D A;  1SE4 A;  1EU3 A;  3C2P A;  2AQ3 B;  4DAP A;  4G7Z C;  4ULL A;  1EOT A;  3R93 A;  3BDL A;  4EQP A;  3R2T A;  1RD9 D;  1GUS A;  1WTX A;  5KGU A;  4IUP A;  2L5T A;  5I2Y A;  2CW0 D;  2RKS A;  1U4M A;  1AN8 A;  3D3R A;  3QJY A;  4XYQ A;  1Y8N B;  3GTG B;  1R9T B;  2IX0 A;  4QUF A;  5HUR A;  2LMC B;  3RZD B;  4C3J B;  3ITP A;  1CA5 A;  2A73 B;  2E2J B;  3LWE A;  3T56 B;  3S16 B;  4KY7 A;  3S14 B;  5IIF A;  2B2U C;  3A56 A;  3K7A B;  1WTW A;  4A3K B;  1DZ1 A;  4OO1 H;  2D5D A;  1EIG A;  4K8I A;  2K1B A;  3M3Y B;  3I3C A;  1TWH B;  1HTP A;  1SYE A;  3QWN A;  2F0D A;  2IL8 A;  2JXM B;  2KCN A;  4RH6 A;  2PW5 A;  5D14 A;  1PRT C;  2K04 A;  3QOJ A;  1KLG D;  4K6D A;  3A8K E;  3D4W A;  3D6C A;  1JQY D;  1E2Z A;  1ET6 A;  5JEA G;  2R6G A;  4DNT B;  2WV6 D;  3NTK A;  5EQ0 A;  4ZKB B;  5JEA H;  1JC7 A;  5A2Q E;  1K83 B;  4PQX A;  1I4R A;  3TP7 A;  4A3I B;  1A2T A;  1I4P A;  2K5D A;  2OXP A;  2D2C C;  2ZT9 C;  1ILQ A;  3NSW A;  4NMZ A;  4R9W A;  1WD1 A;  2F0G A;  1S5E D;  5I6Y A;  2Z8L A;  4WOR A;  5IGD A;  3NQI A;  1SNC A;  5J22 A;  4RGT A;  2F4I A;  3VYT A;  5C3X A;  4C1N K;  3QG1 A;  5FO7 B;  1XWE A;  4L8J A;  1CA6 A;  2CHB D;  2VNU D;  3S9W A;  1KDA A;  4XDX A;  1QE6 A;  1Q90 A;  2MGS A;  3BYY B;  2XRS D;  5C0X G;  4L63 B;  2K6A A;  2WKC A;  5J1Z A;  3P1H A;  1W6J A;  4PNY A;  1Z7T A;  1D5X C;  4RA8 A;  4CKC A;  1QWY A;  1V1P A;  2EJG C;  2MP1 A;  2K5W A;  4DK0 A;  3VR5 A;  4CKE A;  1BXT A;  2Q8T A;  3SHL A;  2NTT A;  1TWF B;  2H1E A;  1W6K A;  2LS0 1;  1KNE A;  5C3E B;  2EJM A;  4H13 C;  4X3S A;  5JVH 3;  2IX3 A;  1X3P A;  2JEA I;  1DM0 B;  4C3I B;  3JAM L;  3TN2 A;  2NVT B;  2WIN B;  1E2W A;  1LTS D;  1EL0 A;  3TP6 A;  2BE5 D;  2NN6 H;  5C3W A;  1FGB D;  1D1K A;  1HA5 A;  5CYU A;  4DNR B;  1D5M C;  1OO9 B;  2YU9 B;  1EY5 A;  1JWS D;  1H9R A;  2BCO A;  3VYR A;  1RDP D;  1Y1V B;  1LAC A;  1SYB A;  4WJW A;  2IJ0 A;  4BWG B;  1H9S A;  2SOB A;  2KCC A;  4IUU A;  4LMQ D;  3DUZ A;  3VR6 A;  2RQX A;  4V19 0;  3S1Q B;  3F2U A;  3NE5 B;  1B2T A;  1GUT A;  4RKB A;  2BOS A;  3CKI B;  4C3I G;  1V1O A;  1FNW A;  3TSS A;  5DM6 3;  2WAQ B;  1RTN A;  5I6W A;  1PFB A;  3OOC A;  1RF2 D;  3N52 A;  4XQQ A;  2X6L A;  4BA1 I;  4EGV A;  3RZO B;  1AZP A;  1CFM A;  2WII B;  1IYV A;  4XT3 B;  4BA2 I;  2ZXP A;  5I9P A;  2PNR C;  4PV1 C;  3EVQ A;  2EYJ A;  1E2V A;  1EY8 A;  2SDF A;  3D4D A;  4V0B A;  3VA7 A;  4J1M A;  3HOV B;  1EY6 A;  2NVX B;  1GUO A;  2FMM A;  3OIP A;  3E5S A;  1SE3 A;  2PZT A;  3C1F A;  1MI2 A;  5FLX E;  4K5V A;  3L7Z C;  3W2D A;  2EY2 A;  5KYI A;  2B2V C;  3DEO A;  2O5J C;  4KN4 C;  4C56 C;  1S5D D;  3D6W A;  1EYC A;  1JOK A;  4DU9 A;  2K7V A;  5BN4 A;  3NHH A;  2XN9 C;  4HMJ A;  4F88 A;  2B39 A;  3U9S A;  2EY6 A;  1ONL A;  1YNN C;  3IKJ A;  1JR0 D;  4DA2 A;  4B08 A;  4HN7 A;  1EWC A;  3PUV A;  1Y1W B;  2NB0 A;  5JAV A;  4BBS B;  2L4N A;  3E6Z X;  3SE0 A;  2EYO A;  1GUG A;  4ZUI A;  1TQO A;  1SNQ A;  1LT5 D;  5CV8 A;  1EU4 A;  1Y69 U;  4KJO A;  1MGS A;  1LTR D;  2A69 D;  4RCN A;  1R4P B;  3BG3 A;  4PMW A;  1TT2 A;  1BDO A;  1SND A;  1RTO A;  1STY A;  1HUM A;  4KY5 A;  2QIL A;  1ZKO A;  2N88 A;  5EKK A;  4KD4 A;  3G6J B;  3S15 B;  3X3M A;  2X69 A;  2EYH A;  3ZYY X;  1MBY A;  2PPB C;  5JVG 3;  1SNO A;  3TZD A;  2IX1 A;  3FPU B;  5CMD A;  2A5H A;  3FMC A;  1ZXT A;  1SYD A;  1V1P B;  2HCC A;  1F2Z A;  2E76 C;  1UUP A;  4HED A;  2F0I A;  4H7B A;  5IGF A;  5D3D A;  3SK6 A;  2FJ2 A;  4FYD A;  2KA7 A;  1L0X B;  1JE4 A;  4C3J G;  1PDQ A;  1C8C A;  2PCF B;  4BY7 B;  1WTV A;  3JAM E;  1BOS A;  4A3J B;  5DAU A;  3IL8 A;  3DWP A;  3MZ5 A;  4LJZ C;  5G3L D;  2NBF A;  3BVG A;  1F9Q A;  3HOZ B;  3MXN A;  3C1E A;  1CQF A;  5I2X A;  1LLR D;  4P2C B;  2VUM B;  3MHB A;  3EJI A;  3QO2 A;  3RUZ A;  4A3B B;  3LNN A;  3I72 A;  1EZ8 A;  3S1M B;  1SDF A;  4ZYS A;  3CHB D;  2D62 A;  4WRD A;  2J0T D;  2B2W C;  1BCP B;  5CBA E;  4RHS A;  1X32 A;  5CC4 A;  4F8M A;  1O7L A;  1HXY D;  1G2S A;  5M3F B;  1VF5 C;  2F3V A;  1HCZ A;  1LAB A;  2RDG A;  2AUK A;  5C4X B;  2F0U A;  1BUV T;  5ELC A;  2PO4 A;  2XWJ B;  4Y7N B;  4IFD J;  1SMY D;  4RAU C;  5D3I B;  4G7H C;  1F2M A;  1VDZ A;  3Q22 A;  1H9K A;  1JWM D;  4RKL A;  2F0L A;  1UAP A;  1QNK A;  4KN7 C;  3QOL A;  4Q5V A;  2G9H D;  5C4H A;  5BN5 A;  2DN8 A;  1JOO A;  1CZG A;  1I4H A;  2Q8I B;  3GTP B;  5IOD A;  2EOT A;  2A74 C;  4QMG A;  5C0X J;  1MSH A;  1CT1 D;  4FVM A;  3D31 A;  2EXZ A;  3PIP 3;  1XTC D;  1Y8O B;  4O42 A;  2B2Y C;  5AFW A;  5ELE A;  3AU7 A;  2ZXO A;  3A8I E;  5DEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...