3RD4A

Crystal structure of propen_03304 from proteus penneri atcc 35198 northeast structural genomics consortium target id pvr55
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
76
Chain Sequence
APVKLYMVEVIDKKEIAANEITHYYQVTFRLTTDDRKDLVLNIDKSSYQNIEPEMKGRLFMQGSRFVQFETDVPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of PROPEN_03304 from Proteus penneri ATCC 35198 Northeast Structural Genomics Consortium target id PvR55
rcsb
source organism Proteus penneri
total genus 11
structure length 76
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rd4A00
3RD4A 2L0CA
chains in the Genus database with same CATH superfamily
1TIID 2SDFA 4U673 1EYAA 4Y52H 2IWHA 4GNXC 4X64L 1G2TA 2D0PA 3KJOA 3F2CA 2I5MX 4G4KA 2Q8TA 2UXBQ 2IHFA 3B6YA 3SK4A 4DV3L 2ZXRA 3HRZC 2KCTA 1R9TH 4FF2A 2PNHA 1RCVD 5M3MH 4A3CH 4OO1I 4QQBX 3PO2H 2IPKD 2X6LA 4ALPA 1PFMA 4ZKCB 1N32L 4KJOA 1A3VA 1L0YB 5M3FB 2ATWA 3GTPB 1PDQA 2EYPA 3L9AX 1Z9FA 3GTLB 3OHXC 3NSWA 4PNYA 3TBIB 4OXPA 3VR6A 2N78A 3I56A 1JQYD 3MC0B 2A74C 3NXWA 1D7QA 4NPSA 1I6HB 1FNVA 2CW0D 1LTRD 5KYLA 4IFDG 1IZ6A 3EFXD 5AFWA 1CA6A 1L0XB 3QIAA 2XWJB 2ICEC 5DLQE 1W6JA 4PZ7A 3T1HQ 1I4GA 1VQCA 2JQOA 3D4DA 4DN4M 1FYCA 4PQXA 3VR3A 2UUBL 3S17H 1T5EA 3CP0A 4EX5A 2Z0SA 5M5YB 1YNNC 1YJWA 2B63G 4FXDA 5M5WB 1Y69U 2EXZA 1JJGA 1CKNB 2HQLA 2HQEA 1JOOA 1J5EL 1EQVA 2NVTH 4A93B 4LFBQ 4KTAA 2BH2A 5JOBA 3STBC 2D9UA 3K59A 1EIHA 2WFWA 1XMOL 3M9BA 4JI6Q 2RVLA 2LFNA 2VUMB 1U5KA 1SMXA 2PQEA 2F0SA 3I4MB 2Z8LA 2KQ3A 2E74C 1QB5D 3BG3A 4R8IA 5COYA 3JAME 3FPPA 4HJAA 4ZKBB 2B2WA 3SK8A 3OSOA 1ZXTA 2PZTA 3HOZB 4X65L 3QWNA 3L3OC 3P20A 3S2DB 4DF7A 5KNCA 3KLRA 5IP9H 4LFCQ 4KMUC 1PFBA 1LTSD 2VZAA 1FL0A 2K5WA 4RFBA 3S1NH 2B2UC 2KCNA 4A76A 3TP5A 2B8FA 4EGVA 1IL8A 3D6WA 3BS1A 3CD6A 4C56C 2V1CC 2Y0SE 3SXHA 4IJHA 3EJIA 4I65A 4DR6Q 4B08A 3H94A 2UXCQ 3VYTA 1EY4A 1JOQA 2EYLA 3M3YH 1XTCD 2EZVA 1TS5A 3S1MB 1KDBA 4DUZQ 3MAQA 5IYDH 1HCZA 1VQ4A 1YBYA 1LLRD 4P72A 2O4XA 4KV6A 1P16A 1UE5A 2CQAA 5C0XH 1SR3A 5ELCA 1F9QA 2PPBC 1H9SB 5JJKA 3ULLA 3UE0A 1YJ9A 1CK1A 1MI2A 1OO9B 1EIGA 1IXRA 3FDTA 5H1SE 3GTQH 4JCVE 2LSSA 5FLXL 4ULLA 2NN6G 4A3DH 4KKSA 3TN2A 2MP1A 3DXJC 3PV0A 1L1OB 2DGYA 1S5DD 1GUWA 1LV9A 1KRTA 1TWCB 3M85A 1CZGA 2YTXA 2JA5B 2F4VQ 1DOMA 2IJ0A 1JOKA 2MO1A 3NBIA 1Q90A 3BYYB 1EY5A 1QVGA 4X3UA 1I50B 1NTGA 4LF7Q 2DNCA 2YTVA 3G6JB 4WORA 2JA6B 3SE0A 2UUAL 1MSGA 1IW7C 5GAGC 1SNCA 4IPDA 3PUWA 4PZ8A 2M2LA 4TVAB 3V96A 5BR8L 4BY1H 2KVMA 4BBSG 4ZRZA 3GTKB 3EROA 2GN5A 2NWGA 1PYSB 3FKIB 1TR5A 1B9NA 3CCEA 1VCIA 1VF5C 2ZM6L 3PO3G 2RHSB 4ZUJA 4XXEA 4CKEA 3M7GA 3CQZB 4CDFC 5LHY1 3P75A 1DGSA 4XQJA 3H6MA 5HGQA 3J80c 4K0KQ 1EIFA 3X3MA 1AEXA 1K28A 2QCPX 4DV2Q 4KHVA 3HOVH 1GUNA 4HTHA 1PH6A 4RMFA 2MPMA 1Y1VB 5IP7G 2F0TA 5J1ZA 1O7IA 1HNWL 1XPOA 1Q7YC 1SFOH 2B2TC 4J1MA 1VQDA 2XWBB 1OXXK 4QUCA 4H44C 5M3FG 1DM0B 1JICA 2WKDA 1C48A 3PUXA 1MD2D 3SVMA 4KD3A 4YCWA 5LMNL 4AQYQ 2F0DA 1X32A 4DAMA 1VQPA 1STGA 1Z47A 2OEOA 3T1YQ 2PW7A 4BBRB 4CDDC 1WTRA 4EQNA 4X66L 2YU9H 5K5PA 1EY7A 2PQAB 1CKNA 1LTID 2NTSA 1O78A 3RZOB 1ZYRD 1YHBA 5IYCG 1Y1WB 4WJ3M 3I4NB 1ML0D 3E3XA 5F2DA 3H3VC 4IOCA 1VQNA 3IAYA 3ONAB 4RCNA 1A3TA 2ID0A 4QB4A 4DV6L 2XRQD 3M4YA 2JA7H 1ET9A 4DR7L 3IFTA 5FLXc 2FFKB 4HR7B 4KKTA 4DKAC 4B3MQ 1LTGD 1NR2A 2K4KA 4IFDJ 4UP7A 3RLOA 3GDEA 2EY5A 2VQEQ 4IALA 2XRSD 4A93G 1SYBA 3KLWA 3NE5B 4FF1A 2NN6I 1HFNA 4BY7B 2Z9HA 1FGBD 1MIUA 5J22A 2UXDL 4MTKA 2IX0A 3I8ZA 2JE6I 1ENCA 4IO9A 1BDOA 4M1UB 2VUMG 3T51B 3A56A 3WOFA 3H15A 3WDNA 1STEA 4BS9A 2A5HA 3I4MG 4OWWB 4IOAA 1C7YA 2JXMB 2PCFB 4UPAA 1STYA 4TSSA 3HGBA 4Y7NB 1VQFA 1BNZA 1VQLA 3HOZG 1DXMA 2M00A 4A3IH 4BA2I 1BCPF 2F0PA 2L1BA 1B53A 1QNKA 4XDXA 1TWAH 4GKJL 3K0YA 4NXNQ 4R4QA 1KRSA 1XTDA 1NMGA 2CW0C 1A6XA 5DEHA 1JJCB 1KABA 2WAQE 3J80E 4DV5Q 3PQIA 3Q6SA 3PUZA 4UDUC 4C3JB 3I70A 1I3QH 3T16A 2A6ED 4H7BA 3K5NA 1VQGA 1XNQQ 2IHEA 3S14H 2GA4B 3U9OA 1WJJA 4GZYC 3J7AF 4CHTB 1V1PB 3D4RA 1MKHA 4N9TA 1IBLL 1HZ9A 1AN8A 2HIXA 3J7A5 3Q24A 3G4SA 1PH9A 4QL5A 1STNA 1SE8A 4XIGS 2FJ2A 4DAYB 2JA9A 4DR4L 2R61A 1L1OA 2EE1A 1B8AA 3CCRA 3MXNB 4GOPC 5M3MB 4IN3A 3CRKC 4OX9L 3PO2B 5IGEA 5IT9E 1HNXL 1K0SA 4DAPA 1Y8PB 2QEJC 2VY3A 3S15B 3S2HH 3TQYA 1KIXA 3D8GA 4LW1A 4PG3A 2QKIC 3GD7A 1LTAD 4GLVB 2LXJA 1GO3E 4GN3B 5FJ8H 4N8FA 2JA5G 4JI7L 5IIFA 1AZQA 2MO0A 2R92G 2NTTA 1NNXA 2N49A 4ABNA 5FLXE 3UE1A 3DWQA 4FXKC 2QF7A 1IBMQ 5EGTA 4POGA 3K80C 4B3RL 3A55A 1IYJB 1RTNA 2HD3A 4A3LG 3HOWB 4ILWA 4OWXB 1KD1C 1TWFH 3S17B 3JC66 3R8BA 2F1MA 4NB3A 4F87A 4POFA 1F2LA 3QG1A 5I4DA 4A75A 4J6HA 2NVTB 4CGYB 1EY8A 4YIJA 2Y0SB 1XPRA 3FKIG 4DK6C 4JG2A 1B2TA 2E75C 2ALYB 3IFDA 2J7ZA 2R7ZH 1YI2A 1PVOA 4JV5L 1HA5A 4A3FB 1OXVA 2OWOA 4LFBL 2RSOA 3G71A 1SJHD 1DOLA 4C2MH 3A8IE 5JAVA 3I91A 4S3SA 2FINB 4G57A 4C3IB 1FJGL 1Y1VG 1CTMA 4IUTA 2DNEA 1H9KA 3SK5A 4HIDA 2E8GA 4JI4Q 5M9OA 4DR2L 1BBUA 4DNRB 4GS3A 1PTOH 1HR0W 2UUCQ 4YWMA 3K7AH 2DY7A 1SROA 3S1NB 5CBAE 2LY7A 4ZUIA 1HH2P 5AJ3L 1CI3M 1RODA 1P8LA 3NENA 4JW0A 4BBRG 3GP7A 3HS0C 2E2IB 4TKOB 3NBHB 1ILPA 2CVRA 3GV3A 3TSSA 2RF4A 1J8IA 1Y1WG 1ET6A 2VB3X 3M3YB 3I4NG 1E1OA 2EYOA 1RJTA 2LS01 3I55A 2YTYA 5TSSA 4AYBE 1Y8NB 2XVSA 1PH1A 1HHVA 3RLNA 5LL6X 2JYOA 2CWPA 4IUNA 1V8QA 4B9WA 1G8ZD 1RL2A 1XJVA 3HG9A 2R3ZA 5D3IB 3DUZA 4HJ8A 2GVBA 3SHLA 4FDBA 3U4ZA 4GLXA 1VDZA 2F0MA 1F9RA 1EEFD 3CMEA 4WRDA 2EYHA 2WP8J 2XSCA 2ENBA 4OO1H 4BY7G 1BCPB 1SNQA 2F3WA 1G2SA 5ELDA 1GUGA 1PMRA 3NQIA 1SAPA 1ILQA 3QR8A 3GTQB 2C9OA 4LF8L 1JWSD 1W3SA 2NZHA 2SOBA 3I4LA 4HN7A 4B3TL 4A3DB 1HR0L 2E2JH 2ICIA 4JOIC 1K3BC 3RMHA 1UUPA 3G48A 4LWCA 4EQPA 5C4HA 5JVH3 1Y14B 2B8GA 2K5NA 1X55A 4JI0L 2MQHA 1EYDA 5BN5A 1KXLA 4JVZA 1QILA 3HZXA 4R1JA 2OCEA 3W5OA 1CA5A 3I90A 2L4NA 3PUVA 5LMUQ 3C2PA 3PUYA 1B9MA 2F0WA 2CQOA 2E2DC 1CUKA 1V1PA 3AFPA 4QIWB 2AQ2B 4CJ1B 4P71A 5CV6A 2HUGA 5EPLA 3CF5A 1ZYRC 1VQEA 3KF6B 3C46A 1PTOD 1K8OA 4C3JG 4JI8Q 5KYIA 4DR1L 3SGIA 1ENFA 3MXNA 4V0BA 3IL8A 2FXQA 1M4VA 1AE3A 1X3PA 4A3JH 1RKNA 3G6EA 3VA7A 4A3KH 2AWOA 1VQIA 1EY6A 1F9PA 2GVAA 4IPGA 1YHAA 2WINB 2B2YC 5CV4A 5IWAL 4KN7C 3H3VI 2UU9Q 2ZTEA 3CPFA 4DV4Q 1WTOA 1QJOA 1B70B 5M3MG 2CKZB 3UDXA 1SFOB 4A3CG 4DFAA 3PO2G 3L0OA 4PMCA 2K5QA 3HOXH 1CZWA 1UE7A 1SE2A 2PZUA 3KF8B 4JI3Q 4A3BH 3FEWX 3PIPA 2NBFA 3OW2A 3CC2A 3GV6A 4ZQ3A 3MFYA 1ESFA 2YU9B 2NUCA 3J7YW 1QOHA 2PI2E 4AQYL 4RHRA 4QGUA 2A6HD 3K6OA 4XYQA 1WFQA 5G3LD 2JP1A 1EUJA 2K5HA 2IY5B 1N34L 4DU9A 5EBDA 2N55A 3OIPA 3EQLC 5GAEC 3HOWG 2K04A 1N33Q 1Y8OB 1U0LA 3KJPA 3F2UA 2A19A 1RHPA 2H1EA 2JA7B 2AQ3B 1RF2D 1E0BA 2A6EC 1CSPA 1VQ5A 1NBWA 1KAAA 2Y0SG 5CORA 2Q2UA 1QZGA 1W6KA 2EVBA 3I3CA 4DR5L 4IUQA 2E5LL 2Q2TA 1CM9A 3N6RA 5I6YA 1K83H 2JN4A 4P75A 5KRUA 3AYHB 4A3FG 1NUCA 2KA7A 2IW3A 2WB1G 4YY3L 1M1KC 1TY0A 4JI2Q 1LACA 1HPCA 2H4OA 3RNUA 1HRJA 4LF6L 2F3VA 3VYSA 2DY8A 4C3IG 2A68D 2FMCA 1Q8IA 2EYFA 4JPBW 1S5BD 3CMAA 4A3GH 3AB9A 2VXWA 2F0LA 3T53B 1PV4A 4A3IB 1YZ6A 4MNOA 4HIOA 1I94Q 5I9OA 4DXFA 2Q8RE 4JYAQ 3KLSA 1N9WA 5IP9G 3Q0AA 4JBJA 1ICWA 5ELFA 1HXYD 4JOIA 4RGOS 1TWAB 1K8GA 1LTBD 3K7UC 4HIMA 5KEEA 3RR5A 3J80L 1BO0A 2F0JA 5C4ZA 2BA1A 1KTKA 3NWSA 4HJ5A 3TRZA 5JEAJ 4X62Q 4LUVA 5C5LA 5FKAC 3HOUH 3TS2A 4AH6A 1XMQQ 1QG7A 1RIPA 2HHHQ 4AIMA 2B2VC 2AUJD 3GQBA 1NAPA 1TWHH 5C3EH 4LF9Q 2R6GA 4IQZA 4BWGB 3S14B 2F03A 4IPCA 1OTCA 3EA6A 4M8AA 1BR9A 5IYDG 2RDFA 4Q5VA 2K5DA 2RSNA 4CKBA 1G6ZA 2XGTA 5LL6S 3S16H 5EPJA 2O2LD 1WOCA 1JB3A 3URYA 1WD0A 4KHPL 3K5OA 3PCOB 5IT9L 5T1IA 2VB2X 2F0NA 1YEZA 2P5ZX 1V43A 5D3DA 2EYMA 3LWUA 3U50C 3S2HB 1JC7A 3TS0A 3P7JA 4A3DG 1QUQB 3PF4A 4UAIA 1SE4A 1KQSA 2CHBD 3BJUA 4GNXA 3NQTA 1TT2A 1ASYA 3Q8DA 4H02A 2F4IA 3KDFB 1EQRA 4DAVA 2AWNA 3DHQA 1BVSA 4IZ8A 3M4OH 4IFDI 1V9PA 4K5WA 1LUZA 3A8KE 4DK1A 1Q8KA 3HP3A 5JJIA 1EL0A 5LMNW 1TWFB 4PMBA 4R4CA 3BDCA 5C4XH 1VQAA 2NYZD 2ZTDA 5JPMC 2NN6H 4K6DA 1IYUA 2R7ZB 2IX1A 5HGTA 3C1FA 4LFAQ 3NELA 2VQFQ 4NXMQ 1STBA 2K5VA 2TSSA 1CKMA 1HNZL 1QVFA 4AYBB 4C2MB 1UE1A 1YVCA 1H95A 2OQKA 1CKOA 5J39A 1X6OA 1TXYA 4XQQA 2DUDA 3IRBA 5KNBA 1G291 4ZAIA 1GHJA 2VNUD 3DLLA 1K8MA 1NR4A 1QVCA 4XYOA 1EWIA 5CV9A 1AZPA 1PTOB 4XT1B 2DN8A 3K7AB 1F2ZA 4LF5Q 3OTOL 4E6IA 2F0QA 5E3FA 4LF4Q 1A2TA 1KLGD 3KBGA 1VF7A 2F3IA 5EPKA 4DV1L 2O5JC 4X64Q 2MUYA 3ULPA 3PO3H 3O13A 2QEXA 5FO8B 3K5MA 1C4QA 2EY6A 1A63A 1N36L 1XNRL 4DV3Q 3OIQA 5KIXA 5IT9c 1IBKL 1VQHA 1GD7A 3BVMA 2JA8H 4I7AA 1NCVA 1N32Q 4U68A 1PTOC 2JA7G 4BXXG 5HY6A 1STAA 2QDBA 2B2UA 1GM5A 2PZWA 1STHA 1IKLA 1JMCA 4F88A 1SE3A 4FYDA 3E9IA 3CCJA 4DV0L 4DV7L 2E2HH 5JJLA 2EJMA 1OXSC 3M4QA 3ZYYX 5C44H 2K05A 5EQ0A 2K1BA 4K5XA 5CBEE 2R93H 1CT1D 1K3RA 1UWVA 4LMQD 1AE2A 4O0AA 2VW9A 2F52A 2E2JB 1VQ9A 1D8LA 3PGZA 1KC8C 3R93A 1YNXA 1I4RA 4OHJA 4A3IG 1HZAA 1WCMH 2PO4A 5BN4A 3PIP3 3GTMH 1J5EQ 3CCLA 2DJFC 3HOYH 1F77A 3FPUB 4DK3C 2FMMA 2H5XA 1YIJA 3MWYW 4PZ6A 2EY1A 1TKWB 1H9RA 3Q22A 1XMOQ 2A6HC 3GTOH 3EN2A 5LMUL 3ERQA 1XYIA 1UEBA 1TS4A 4HJ7A 3K0XA 5C3WA 4DPGA 4NW2A 4YHHL 1CHPD 1MGSA 4GOPB 5A2QL 1LM0A 4A3JB 4JI1Q 4X65Q 4A3KB 3A7LA 1GKHA 2Q2IA 3D6CA 1WYDA 4JI8L 4DGZA 1GUTA 3ER0A 2NZOA 1H9SA 2F0HA 1X54A 4CJ2C 4YCVA 2NVXH 2OF1A 1GVPA 2KUMA 2DJGC 2F0KA 1FGUA 1SNMA 3DWPA 3LNNA 3MEHA 5K36H 4MN3A 2LXKA 4K6LA 1U4MA 4DXGA 2UU9L 3I4OA 1Q86C 4L5RC 1U4PA 1PH2A 3HOXB 2A68C 2NVQH 5C0XJ 4OGQC 1R9TB 4A3BB 3NTKA 3ICEA 3NEMA 2UXBL 3MA2B 4C3HH 1FD7D 2PMZE 3MEFA 1E2ZA 4GKKQ 2Z6BA 5CGKA 4H13C 4JI3L 5FJ8G 1VQ7A 1E24A 3MXPA 2K6AA 3NTIA 3SK6A 3J81j 1II3A 2F0GA 2A1AA 3U4VA 2R7DA 3AMUA 1DYQA 2RKSA 4A3EH 4RGNA 4N9PA 1PHJA 2B2TA 2D2CC 1B50A 2J4XA 3A54A 1NJIC 5EBCA 4HAEA 4KHZA 1HA6A 2HDLA 1MHWC 4Z9CB 2JEAI 1I6VC 1GHKA 1WTWA 2JA6G 4FP5D 3OPOA 2KEEA 4NDXA 1A62A 2MHVA 5M5XH 3N52A 3T1HL 2R7ZG 1K83B 1U4LA 3TP6A 1J9OA 1Z7TA 1VQJA 4C1NK 4AYBG 1TWCH 1JORA 1PYBA 3PSIA 2R92H 2F0EA 4TQUS 1GOZA 4KJNA 2A8VA 2UUAQ 4LUZA 4X6AH 4RKBA 4CBVA 5EKLA 1S72A 2F0OA 4A3GB 2KJXA 5BR8Q 1KLUD 4K14A 4RKLA 1VQKA 5ELOA 1JWMD 4DA2A 4JI6L 2VS1A 4C1NI 3E9HA 4V190 2PQAA 1U9RA 2CWAA 4X3TA 1LT3D 2AQ1B 2ZM6Q 2K32A 2SEBD 1KHIA 4KLKA 1L0WA 5JEAG 3W1GA 3GTKH 2HCCA 1WTXA 1IHZA 2K03A 1ASZA 1JB7A 1QNUA 1X3QA 1S5ED 4EVOA 3HOUB 3GTGH 1PRTD 4JK1C 4RH6A 4LFCL 1SDFA 2J0TD 1KNAA 1D2BA 1TWHB 5C3EB 1XMQL 1HNWQ 3S1QH 2BE5D 2OXPA 4KD4A 3BDOA 1PXUA 5GADC 4K5VA 1Y1VH 4LF9L 3S16B 4DR6L 1SXTA 4P2CB 2ZJQA 4OIKA 1PZKD 2UXCL 1EU4A 4WJWA 4ZLTF 3UDGA 1BOSA 4DUZL 2OTLA 3T4AC 5I6WA 2K14A 3L2PA 1SYDA 5BN3A 1EYCA 2F0IA 3TP7A 5CMDA 4DR3Q 1VQOA 2MJ8A 4QCLA 3NK9A 4K8IA 3KK7A 5GQOA 3A8JE 3NWTA 4UHVA 1B1ZA 3BZDB 1PA6A 5JPNC 4DV6Q 3I73A 1YNJD 2YYZA 4A3MH 4DR7Q 3E0EA 2A69D 2NVYH 3A74A 4RAUC 4APVA 4EQ5A 2RHQB 5D14A 2ZXPA 3D31A 4GOPA 3M4OB 1D1IA 2PNRC 2SNMA 2RCFA 2N8NA 4R8NA 1D6EC 2M9VA 2UXDQ 4OWTB 2L11A 2B2WC 5FOBB 1A3UA 1EYGA 2F4VL 4N8X1 5CR3A 5C4XB 3ZJYC 1FVIA 5IYBH 1UNSA 1PFNA 4EQOA 1Q12A 1I4PA 3CU7A 2K7VA 4X3KA 1YITA 1SYCA 4BY1B 4KN4C 5C4JH 4A3JG 4LF7L 2CH4A 2K01A 4A3KG 4OONA 3K81C 4DAYA 1I5FA 4H0LC 5FLMH 5DM73 1SJED 1PLFA 1SNDA 3CKIB 1EQTA 1VS0A 3H0GH 5E4WC 2L5TA 2YV5A 2KHJA 4NXML 4GKJQ 4GLAC 3PF5A 5A2QE 1KDAA 1SYEA 4FXGC 1X3EA 3J81i 1L2FA 1WTVA 1D1KA 4KK7A 3BVZA 1ZEQX 3OMGA 3HOVB 1CFMA 2D62A 3HOXG 4YCUA 2ZTCA 2QA4A 4K0KL 3RZDH 3S1RH 4A3BG 4J8QA 1PH3A 2D0OA 4DV2L 1K73C 4IPHA 2BOSA 3BZCA 2LMCB 5IGCA 4NKLA 4L63B 2B3GA 1IBLQ 1EEID 1HTLD 3HKZE 4LF4L 4KKUA 1LT5D 3PO3B 4BA1I 5IGDA 1QWYA 1X3FA 5L37A 3MFGA 4A4IA 3E6ZX 1A15A 4TRDA 3U58A 1DJRD 1X65A 4ODGA 4DR4Q 2KENA 1DZ1A 3QOJA 4IUPA 1WTPA 2BDOA 2EQSA 1PH4A 5IY0A 4OX9Q 1HQMC 3CCSA 3RN2A 2JA8B 2B29A 5CC4A 3T1YL 1HNXQ 1JR0D 2HDMA 1PTOF 3CRLC 1D5ZC 5J3BA 3OWFA 4KY7A 1PH7A 2BA0A 1HUNA 4LNQA 3S15H 3GTJH 1SN8A 1A0IA 2E2HB 4JI7Q 3OWEB 3EVQA 5NUCA 1G91A 3CC7A 5C3XA 4L5QA 2A73B 5C44B 1AW7A 2WAQB 4B3ML 1C0AA 2R93B 5FK9C 1EZ6A 2MNAA 4B3RQ 2ZT9C 4X3SA 1SNPA 1B4OA 3SDZA 4IJLA 2VQEL 3ERSX 2XN9C 1M90C 4NP5A 2K50A 4K2KA 3BYTB 3DM3A 2RDHA 1EQQA 4A3GG 1B3QA 2F0FA 4CJ0B 1WCMB 4L5TA 3HOWH 3GTMB 4R9WA 3HOYB 2EIFA 4IFDH 3A0JA 5DNFA 5KNDA 1FR3A 2C35B 1GUOA 3E0JA 3NBHA 3K8AA 2JEBI 1QCBD 1EWHA 3F2DA 4JV5Q 3UDFA 1M8AA 1WTQA 3SEBA 1NMFA 4MZ9A 3GTOB 3CCQA 1XPUA 1QE6A 2RCNA 3HOUG 3L7ZC 2B63H 5G3LF 5EKKA 2PMZB 3ITPA 4I7ZC 1OXUA 2Z1CA 3D4WA 1FJGQ 4A3FH 5ISRA 1XX8A 2KBNA 3HKSA 3J7ZC 3NTHA 3HFZB 5GAHC 5C3EG 4NXNL 3PIOA 4OL7A 2QDLA 3W3AA 4C3IH 4P73A 1SMYD 4DR2Q 3KFUA 1BKBA 3RUZA 1PH5A 1I3QB 4KY5A 3VYUA 1TY2A 4DV5L 2KHIA 4JI1L 1PFSA 2KCMA 3EBEA 2NVXB 3FRPB 2EPBA 2EYJA 5AJ3Q 5HURA 1XNQL 1F9SA 1Q1BA 1A8VA 2ZXOA 2K28A 3TP8A 5C0XG 1SLJA 3R2TA 4FF3A 3VA5A 1BF4A 2MGSA 1X56A 4JI5Q 1PRTB 2NVQB 2E2IH 2I0QA 1NSNS 1QZHA 4C3HB 1O80A 3DEPA 2JK8A 3CPWA 3F2BA 4DUYQ 2WB1E 2B2YA 1A2UA 3JAMi 4QUFA 4GKKL 4A3EB 4FVMA 2QW7A 2OTJA 3AU7A 3V05A 1LT4D 3FMCA 3KF6A 1KNEA 2KEDA 1BXTA 4RWSC 1VQMA 1S5FD 1W2BA 2RA4A 3NPPA 1EZ8A 4HJ9A 4O42A 1I4HA 1UEAB 1RDPD 2L15A 3QJYA 1PRTC 3D3RA 4HMJA 4LF8Q 1Q3LA 4B3TQ 1YJNA 2CFMA 1HR0Q 5C4XG 1BBWA 4QJFA 3D0FA 1IBML 4OELB 3TMEA 2F0VA 1MJEA 2BE5C 4IUVA 1TVXA 2Z4HA 4CKCA 4BY1G 5M5XB 4JI0Q 4XT3B 1YHQA 4IURA 3U9SA 5CV5A 5C5MA 1B3AA 4QY7A 3KUPA 3CCVA 1VQBA 1NY4A 1TU2B 4LAAA 2D5DA 2R92B 2K33A 4JBMA 3GO5A 1TWGH 2N3SA 3F1ZA 2Q2HA 1LO5D 3KF8A 4ID6A 1KL9A 2I07B 3H09A 1S5CD 1FNWA 3HOVG 1E2VA 2WV6D 3ND9A 4WJ4A 4B3SQ 2AUKA 4ZCKA 4DR1Q 2CCZA 3VYRA 1Q1EA 2Z4IA 1RD9D 2V4DA 1YNJC 4DNIA 3DEOA 2XNAC 1L1OC 1CHQD 2A69C 4G7HC 1JE4A 4JI4L 2NB0A 4BBSH 5IWAQ 3GTGB 4G7ZC 3CXCA 4RG1A 1SYFA 3MZ5A 3LWEA 1CSQA 2UUCL 1VQ6A 1DOKA 4MIUA 4MTNA 1Q81C 1Q82C 1S40A 3S1QB 4RCOA 2JA8G 4RA8A 1ONLA 3KLSX 4HIKA 1C9OA 3T56B 1N8RC 4WFN3 4Q0FA 3QB3A 3OOCA 2NZ1D 5C0XI 2F0UA 3MHBA 2BCOA 4QIWE 5IP7H 1G51A 1SNOA 3UI2A 5IGBA 2TMPA 3V2TA 1UAPA 3OW7A 5ELEA 2EXDA 3K57A 3M4PA 2B2VA 2L0CA 1ZKOA 5C44G 1E2WA 5ELBA 5M3FH 2WAQG 1BCPD 3DWAA 3VR2A 2ES2A 3A5ZB 2R93G 1H9JA 1N34Q 3GTPH 1OXTA 1IL2A 3GTLH 3HEJA 4FNFA 4JBWA 3S9WA 4F8MA 2HIVA 1R4QB 4DR3L 2QGQA 4QMGA 1PYWD 1DD2A 3TZUA 3WOEA 4XTCS 2EY2A 4A3MB 1S3OA 3RLFA 2EJFC 1WCMG 1BQQT 1TQOA 3I72A 3NHHA 4RGTA 3J81L 1I6HH 2NVYB 4G7OC 3MVVA 1WD1A 5IYCH 3HOYG 1LT6D 2UUBQ 4BXXH 1KAWA 3VR4A 4DR5Q 2KCCA 4DNTB 1V1QA 1Q46A 2E5LQ 3T13A 1TS2A 4LJZC 3CAMA 4OIJA 5E4XA 5A35A 3MTSA 4O2DA 3TEHB 4YY3Q 2OT2A 2E76C 4NMZA 2R7FA 5M5YH 4F7XA 4LF6Q 1PH8A 5M5WH 3H91A 1JJ2A 1HJPA 1EIYB 2G9HD 3HKZB 4A93H 2EDGA 1NE3A 1K9MC 5ELNA 3K5LA 5C4JB 1WVLA 1BUVT 2MFIA 3R2IA 4QF4A 4R4OA 1XWEA 4HMIA 5E7NA 2LKVA 2VUMH 3H0GB 1EOTA 2HT1A 3I4MH 2EOTA 1SRUA 1IYVA 2PYKA 3C1EA 4O1NA 1D5MC 3M7NA 3MXUA 1QUQA 3BDLA 3EIVA 5K36G 3HOZH 4ME3A 5EAYA 1O7LA 1WI5A 2B39A 3S2DH 3ULJA 1B44D 1JWUD 4L5SA 3RZDB 2KHSA 3S1RB 1AFPA 3UDIA 5KGUA 3FHWA 4IUUA 3KDFA 1HTPA 4C3HG 2CH4W 4JC0A 4LK1C 4DV4L 2I46A 5EKIA 4J15A 3FVQA 3CW2C 3AEVA 1CQFA 3A5UA 2ZJPA 4L8JA 1YNND 1GXDC 4A3EG 2L9HA 2AHOB 3I7FA 3S1MH 3AFQA 3QO2A 2EJGC 2N88A 4K8JA 3WWVA 4KHPQ 2PW5A 1E7ZA 1ESRA 2XIWA 1FNUA 4FF4A 3STBD 2ASBA 4HSVA 1CQVA 3RN5A 3S24A 1K8AC 4UY8C 3CCMA 1LTTD 2IL8A 4UP8A 3PIO3 1J6QA 1HUMA 2Z6KC 4YWKA 3KOJA 2FHTA 3GTJB 1WTHA 3J80i 1SMYC 1LYLA 1PZJD 1HFGA 2SNSA 1N33L 1EOVA 3DM1A 5I9PA 1TS3A 3J81c 4KI0A 4OEMB 1MBYA 1DONA 1ICFB 1O7YA 3W2DA 5DM63 1V1OA 5E1FA 3TZDA 3G7LA 2I5LX 3I2ZA 4L6TB 1DCZA 2KOLA 5IODA 4GN4B 1X3GA 3BZKA 3E5SA 4FO2A 2JA5H 5CV8A 1H9MA 3SR1A 4DK0A 2AMCB 3LX0A 3DMUA 1F2YA 2C5CA 4JI2L 4RHSA 4ZYSA 3IKJA 2AKWB 5IOCA 1JT8A 1Z6HA 1ENAA 1I50H 5GROA 4PMWA 2JA6H 4A3LH 5D65A 3CC4A 5JVG3 1JE5A 3VR5A 3BVGA 1HNZQ 1SSOA 2BDNA 1K0RA 2B63B 1I94L 4B9XA 1C8CA 2ZJRA 4JYAL 2WB1B 3LGJA 3FKIH 1IKMA 1O7ZA 1LTLA 3CHBD 3JAML 1HZCA 1U4RA 1HZBA 2XTIA 1LABA 3CQZH 2G9DA 4X62L 3FP9A 3NP8A 2HCIA 5JJZA 3OTOQ 1HQRD 1GUSA 1E22A 4KY6A 1D5XC 2HHHL 1UE6A 3RD4A 4RGMA 1I4QA 2JJQA 5DAUA 4K2LA 2KECA 4YWLA 1EWCA 4CDCC 3H3VH 4DV1Q 2L55A 3R3OA 3CCUA 4PV1C 5JEAH 5LMNQ 1SYGA 3F8TA 1G6PA 2RBMA 1N36Q 1XNRQ 1EU3A 1JCKB 4JBKA 4X66Q 4OO1G 3MXGA 1E3PA 1IBKQ 4JI5L 3C3LA 2VL6A 5IGGA 5IGFA 5T1GA 5C6AA 1I4XA 4BBRH 1PZID 4A3MG 1IW7D 5I2XA 2X6GA 5FO9B 3RZOH 4DUYL 2K52A 1Y1WH 4HSPA 2G5DA 1B7YB 3KYHC 3I4NH 3X3NA 1E1TA 4P74A 4DV0Q 4DV7Q 2X69A 2IX3A 1VQ8A 2BH8A 5I2YA 2L12A 3QOLA 3P1HA 4MHEA 2Q8IB 2PI2A 3NUCA 3J81E 1AH9A 1PRTF 3J7AV 1X9NA 5IYBG 4HEDA 3AQQA 1MSHA 2JSOA 3OMCA 3HKZG 4ZK9B 1EFWA 3TREA 1SBBB 5FO7B 1XXGA 4CDEC 1GJXA 4BY7H 1T5XD 1EFID 3TDQA 5FLMG 1SEBD 3KBXA 3H0GG 3K58A 1AP0A 4HCEA 3OYYA 2Z6KA 3W1BA 2QILA 1TWGB 2RDGA 2RQXA 4Y7NH 2I5HA 3A7AB 2WACA 4LFAL 1BCPC 2VQFL 1MJCA 3PMFA 3BU2A 5IE8A 4R4TA 5CV7A 1VMPA 4GNXB 1KDCA 4YHHQ 3ND8A 1S4ZA 2OQ0A 3JAMc 2K75A 2WKCA 1T9HA 4GN5A 4B3SL 4HCSA 5EJWA 1R4PB 1BBXC 1EY9A 2WIIB 3VDYA 4ME5A 2O5IC 1EY0A 3Q23A 5CYUA 4LUOA 4BBSB 4C3JH 2IT1A 4R4IA 4XQNA 4UP9A 4LF5L 1RTOA 1F2MA 1VMCA
chains in the Genus database with same CATH topology
1TIID 2SDFA 4U673 1EYAA 2IWHA 1G2TA 4G4KA 2Q8TA 3SK4A 2ZXRA 3HRZC 4FF2A 1RCVD 4OO1I 2IPKD 2X6LA 1PFMA 4ZKCB 4KJOA 1A3VA 1L0YB 5M3FB 3GTPB 1PDQA 2EYPA 3L9AX 3GTLB 3OHXC 3NSWA 4PNYA 3TBIB 3VR6A 1JQYD 3MC0B 2A74C 3NXWA 1I6HB 1FNVA 2CW0D 1LTRD 5KYLA 4IFDG 3EFXD 5AFWA 1CA6A 1L0XB 3QIAA 2XWJB 2ICEC 1W6JA 1I4GA 3D4DA 4DN4M 1FYCA 4PQXA 3VR3A 1T5EA 5M5YB 1YNNC 4FXDA 5M5WB 1Y69U 2EXZA 2HQEA 1JOOA 1EQVA 4A93B 4KTAA 5JOBA 2D9UA 3K59A 1EIHA 2RVLA 2LFNA 2VUMB 2PQEA 2F0SA 3I4MB 2Z8LA 2KQ3A 2E74C 1QB5D 3BG3A 4R8IA 5COYA 3JAME 3FPPA 4ZKBB 2B2WA 3SK8A 3OSOA 1ZXTA 2PZTA 3HOZB 3L3OC 3P20A 3QWNA 3S2DB 4DF7A 5KNCA 3KLRA 4KMUC 1PFBA 1LTSD 2K5WA 4RFBA 2B2UC 2KCNA 3TP5A 2B8FA 4EGVA 1IL8A 3D6WA 3BS1A 4C56C 3SXHA 3EJIA 4I65A 4B08A 3H94A 3VYTA 1EY4A 1JOQA 2EYLA 1XTCD 2EZVA 1TS5A 3S1MB 1KDBA 3MAQA 1HCZA 1LLRD 2O4XA 4KV6A 2CQAA 5C0XH 5ELCA 1F9QA 2PPBC 1H9SB 1CK1A 1MI2A 1OO9B 1EIGA 3FDTA 5FLXL 4ULLA 2NN6G 4KKSA 3TN2A 2MP1A 3DXJC 3PV0A 1S5DD 1GUWA 1LV9A 3M85A 1TWCB 1CZGA 2JA5B 1DOMA 2IJ0A 1JOKA 3NBIA 1Q90A 3BYYB 1EY5A 4X3UA 1I50B 2DNCA 3G6JB 4WORA 2JA6B 3SE0A 1MSGA 1IW7C 1SNCA 3PUWA 3V96A 2M2LA 2KVMA 4ZRZA 3GTKB 3EROA 2NWGA 3FKIB 1TR5A 1B9NA 1VCIA 1VF5C 4ZUJA 4XXEA 4CKEA 3M7GA 3CQZB 5LHY1 3P75A 4XQJA 3H6MA 3X3MA 1AEXA 2QCPX 4KHVA 1GUNA 4HTHA 2MPMA 1Y1VB 2F0TA 5J1ZA 2B2TC 4J1MA 2XWBB 1OXXK 4QUCA 4H44C 1DM0B 1JICA 1C48A 2WKDA 3PUXA 1MD2D 3SVMA 4KD3A 2F0DA 1X32A 1STGA 1Z47A 2OEOA 2PW7A 4BBRB 1WTRA 4EQNA 5K5PA 1EY7A 1LTID 2NTSA 1O78A 3RZOB 1ZYRD 1Y1WB 3I4NB 1ML0D 5F2DA 3H3VC 3IAYA 3ONAB 4RCNA 1A3TA 2ID0A 4QB4A 2XRQD 3M4YA 1ET9A 3IFTA 2FFKB 4HR7B 4KKTA 1LTGD 1NR2A 4IFDJ 2EY5A 4IALA 2XRSD 1SYBA 3NE5B 4FF1A 1HFNA 2NN6I 4BY7B 1FGBD 5J22A 2IX0A 3I8ZA 2JE6I 1ENCA 1BDOA 4M1UB 3T51B 3A56A 3WOFA 3WDNA 1STEA 4BS9A 2A5HA 2JXMB 2PCFB 1STYA 4TSSA 3HGBA 4Y7NB 1BNZA 1DXMA 2M00A 4BA2I 1BCPF 2F0PA 2L1BA 1B53A 1QNKA 4XDXA 3K0YA 2CW0C 1A6XA 5DEHA 1KABA 3J80E 3Q6SA 3PUZA 4UDUC 4C3JB 3I70A 3T16A 2A6ED 4H7BA 3K5NA 2GA4B 3U9OA 4GZYC 3J7AF 4CHTB 1V1PB 3D4RA 4N9TA 1AN8A 3Q24A 1STNA 4XIGS 2FJ2A 2R61A 2EE1A 5M3MB 4IN3A 3CRKC 3PO2B 5IGEA 5IT9E 4DAPA 1Y8PB 2QEJC 3S15B 3D8GA 2QKIC 3GD7A 1LTAD 5IIFA 1AZQA 2NTTA 4ABNA 5FLXE 3DWQA 4FXKC 2QF7A 5EGTA 3A55A 1RTNA 3HOWB 4ILWA 3S17B 3R8BA 2F1MA 4F87A 1F2LA 3QG1A 5I4DA 4J6HA 2NVTB 4CGYB 1EY8A 4YIJA 2Y0SB 1B2TA 2E75C 3IFDA 2J7ZA 1HA5A 4A3FB 1OXVA 2RSOA 1SJHD 1DOLA 3A8IE 5JAVA 3I91A 4S3SA 2FINB 4G57A 4C3IB 1CTMA 4IUTA 2DNEA 1H9KA 3SK5A 5M9OA 4DNRB 1PTOH 2DY7A 3S1NB 5CBAE 2LY7A 4ZUIA 1CI3M 1RODA 3GP7A 3HS0C 2E2IB 4TKOB 1ILPA 2CVRA 3GV3A 3TSSA 1J8IA 1ET6A 2VB3X 3M3YB 2EYOA 1RJTA 2LS01 5TSSA 1Y8NB 2XVSA 1HHVA 5LL6X 2JYOA 4IUNA 1V8QA 4B9WA 1G8ZD 3HG9A 2R3ZA 5D3IB 3DUZA 3SHLA 1VDZA 2F0MA 1F9RA 1EEFD 4WRDA 2EYHA 2WP8J 2XSCA 2ENBA 4OO1H 1BCPB 1SNQA 2F3WA 1G2SA 5ELDA 1GUGA 1PMRA 3NQIA 1SAPA 1ILQA 3GTQB 2C9OA 1JWSD 2SOBA 3I4LA 4HN7A 4A3DB 2ICIA 3RMHA 1UUPA 4EQPA 5C4HA 5JVH3 2B8GA 1EYDA 5BN5A 1QILA 3HZXA 1CA5A 3I90A 2L4NA 3PUVA 3C2PA 3PUYA 1B9MA 2F0WA 2E2DC 1V1PA 4QIWB 2AQ2B 4CJ1B 5CV6A 5EPLA 2HUGA 1ZYRC 3C46A 1PTOD 1K8OA 4C3JG 5KYIA 1ENFA 3MXNA 4V0BA 3IL8A 1M4VA 1X3PA 1RKNA 3VA7A 2AWOA 1EY6A 1F9PA 2WINB 2B2YC 5CV4A 4KN7C 1WTOA 1QJOA 1SFOB 4DFAA 4PMCA 2K5QA 1CZWA 1SE2A 2PZUA 3FEWX 2NBFA 3GV6A 4ZQ3A 3MFYA 1ESFA 2YU9B 2NUCA 3J7YW 1QOHA 4RHRA 2A6HD 3K6OA 4XYQA 5G3LD 2JP1A 4DU9A 5EBDA 2N55A 3OIPA 3EQLC 2K04A 1Y8OB 3F2UA 1RHPA 2H1EA 2JA7B 2AQ3B 1RF2D 1E0BA 2A6EC 1KAAA 5CORA 1W6KA 2EVBA 3I3CA 4IUQA 5KRUA 1CM9A 3N6RA 5I6YA 1NUCA 2KA7A 2IW3A 1TY0A 1LACA 1HPCA 2H4OA 1HRJA 2F3VA 3VYSA 2DY8A 4C3IG 2A68D 2FMCA 1Q8IA 2EYFA 1S5BD 3AB9A 2VXWA 2F0LA 3T53B 4A3IB 5I9OA 4DXFA 2Q8RE 3KLSA 3Q0AA 1ICWA 5ELFA 1HXYD 4RGOS 1TWAB 1LTBD 5KEEA 3J80L 1BO0A 2F0JA 5C4ZA 2BA1A 1KTKA 3NWSA 5JEAJ 5C5LA 5FKAC 1QG7A 2B2VC 2AUJD 3GQBA 1NAPA 2R6GA 4IQZA 4BWGB 3S14B 2F03A 3EA6A 4M8AA 1BR9A 2RDFA 4Q5VA 2K5DA 2RSNA 4CKBA 1G6ZA 5LL6S 5EPJA 2O2LD 1JB3A 3URYA 1WD0A 3K5OA 5IT9L 5T1IA 2VB2X 2F0NA 1V43A 5D3DA 2EYMA 3LWUA 3S2HB 1JC7A 3P7JA 4UAIA 1SE4A 2CHBD 3NQTA 1TT2A 2F4IA 4DAVA 2AWNA 3DHQA 4IZ8A 4IFDI 4K5WA 3A8KE 4DK1A 3HP3A 1EL0A 1TWFB 4PMBA 3BDCA 2NYZD 5JPMC 2NN6H 4K6DA 1IYUA 2R7ZB 2IX1A 5HGTA 3C1FA 1STBA 2TSSA 4AYBB 4C2MB 5J39A 4XQQA 5KNBA 1G291 4ZAIA 1GHJA 2VNUD 1K8MA 1NR4A 4XYOA 5CV9A 1AZPA 1PTOB 4XT1B 2DN8A 3K7AB 1F2ZA 4E6IA 2F0QA 5E3FA 1A2TA 1KLGD 3KBGA 1VF7A 5EPKA 2O5JC 2MUYA 3O13A 5FO8B 3K5MA 1C4QA 2EY6A 3OIQA 5KIXA 3BVMA 1NCVA 4U68A 1PTOC 1STAA 2QDBA 2B2UA 2PZWA 1STHA 1IKLA 4F88A 1SE3A 4FYDA 2EJMA 1OXSC 3ZYYX 2K05A 5EQ0A 2K1BA 4K5XA 5CBEE 1CT1D 2E2JB 4LMQD 3R93A 1I4RA 4OHJA 2PO4A 5BN4A 3PIP3 1F77A 3FPUB 2FMMA 3MWYW 2EY1A 1TKWB 1H9RA 3Q22A 2A6HC 3ERQA 1XYIA 1TS4A 5C3WA 4NW2A 1CHPD 1MGSA 5A2QL 4A3JB 4A3KB 3A7LA 3D6CA 4DGZA 1GUTA 1H9SA 2F0HA 4CJ2C 2OF1A 2KUMA 2F0KA 1SNMA 3DWPA 3LNNA 3MEHA 5K36H 4MN3A 4K6LA 1U4MA 4DXGA 1U4PA 3HOXB 2A68C 5C0XJ 4OGQC 1R9TB 4A3BB 3NTKA 3MA2B 1FD7D 1E2ZA 5CGKA 4H13C 3MXPA 2K6AA 3NTIA 3SK6A 1II3A 2F0GA 3AMUA 1DYQA 2RKSA 4RGNA 4N9PA 2B2TA 2D2CC 1B50A 2J4XA 3A54A 5EBCA 4HAEA 4KHZA 1HA6A 2HDLA 4Z9CB 2JEAI 1I6VC 1GHKA 1WTWA 4FP5D 3OPOA 2KEEA 4NDXA 2MHVA 3N52A 1K83B 1U4LA 3TP6A 1J9OA 1Z7TA 4C1NK 1JORA 2F0EA 4TQUS 1GOZA 4KJNA 4RKBA 4CBVA 5EKLA 4A3GB 2F0OA 2KJXA 1KLUD 4K14A 4RKLA 1JWMD 4DA2A 4C1NI 4V190 1U9RA 4X3TA 1LT3D 2AQ1B 2K32A 2SEBD 5JEAG 2HCCA 1WTXA 1IHZA 2K03A 1QNUA 1X3QA 1S5ED 4EVOA 3HOUB 1PRTD 4JK1C 4RH6A 1SDFA 2J0TD 1KNAA 1D2BA 1TWHB 5C3EB 2BE5D 2OXPA 4KD4A 3BDOA 1PXUA 4K5VA 3S16B 1SXTA 4P2CB 4OIKA 1PZKD 1EU4A 4WJWA 4ZLTF 1BOSA 3T4AC 5I6WA 1SYDA 5BN3A 1EYCA 2F0IA 3TP7A 5CMDA 2MJ8A 4QCLA 3NK9A 4K8IA 3KK7A 3A8JE 3NWTA 1B1ZA 3BZDB 5JPNC 3I73A 1YNJD 2YYZA 2A69D 4RAUC 5D14A 2ZXPA 3D31A 3M4OB 1D1IA 2PNRC 2SNMA 4R8NA 1D6EC 2M9VA 2L11A 2B2WC 5FOBB 1A3UA 5CR3A 5C4XB 1UNSA 1PFNA 4EQOA 1Q12A 1I4PA 3CU7A 2K7VA 4X3KA 1SYCA 4BY1B 4KN4C 2K01A 4DAYA 4H0LC 5DM73 1SJED 1PLFA 1SNDA 3CKIB 1EQTA 5E4WC 2L5TA 5A2QE 1KDAA 1SYEA 4FXGC 1WTVA 1D1KA 4KK7A 3BVZA 1ZEQX 3OMGA 3HOVB 1CFMA 2D62A 4J8QA 2BOSA 2LMCB 5IGCA 4NKLA 4L63B 1EEID 1HTLD 4KKUA 1LT5D 3PO3B 4BA1I 5IGDA 1QWYA 3MFGA 3E6ZX 1A15A 4TRDA 1DZ1A 1DJRD 4ODGA 3QOJA 4IUPA 1WTPA 2BDOA 1HQMC 2JA8B 5CC4A 1JR0D 2HDMA 1PTOF 3CRLC 1D5ZC 3OWFA 4KY7A 2BA0A 1HUNA 2E2HB 3OWEB 3EVQA 5NUCA 1G91A 5C3XA 2A73B 5C44B 1AW7A 2WAQB 2R93B 5FK9C 1EZ6A 2ZT9C 4X3SA 1SNPA 1B4OA 3SDZA 2XN9C 4NP5A 4K2KA 3BYTB 2RDHA 2F0FA 4CJ0B 1WCMB 3GTMB 4R9WA 3HOYB 4IFDH 5DNFA 5KNDA 1FR3A 1GUOA 3E0JA 3NBHA 2JEBI 1QCBD 1EWHA 1M8AA 1WTQA 3SEBA 3GTOB 1QE6A 3L7ZC 5G3LF 5EKKA 2PMZB 3ITPA 4I7ZC 1OXUA 2Z1CA 3D4WA 5ISRA 1XX8A 3NTHA 4OL7A 3W3AA 1SMYD 3RUZA 1I3QB 4KY5A 3VYUA 1TY2A 2NVXB 3FRPB 2EPBA 2EYJA 5HURA 1F9SA 1Q1BA 2ZXOA 2K28A 3TP8A 5C0XG 3R2TA 4FF3A 3VA5A 1BF4A 2MGSA 1PRTB 2NVQB 1NSNS 4C3HB 1O80A 3DEPA 2B2YA 1A2UA 4QUFA 4A3EB 4FVMA 3AU7A 3V05A 1LT4D 3FMCA 1KNEA 2KEDA 1BXTA 4RWSC 1S5FD 2RA4A 3NPPA 1EZ8A 4O42A 1I4HA 1UEAB 1RDPD 3QJYA 1PRTC 3D3RA 4HMJA 1Q3LA 3TMEA 2F0VA 2BE5C 4IUVA 1TVXA 2Z4HA 4CKCA 5M5XB 4XT3B 4IURA 3U9SA 5CV5A 5C5MA 1B3AA 3KUPA 4LAAA 1TU2B 2D5DA 2R92B 2K33A 3GO5A 1LO5D 3KF8A 4ID6A 2I07B 3H09A 1S5CD 1FNWA 1E2VA 2WV6D 3ND9A 2AUKA 3VYRA 1Q1EA 2Z4IA 1RD9D 2V4DA 1YNJC 3DEOA 2XNAC 1CHQD 2A69C 4G7HC 1JE4A 2NB0A 3GTGB 4G7ZC 1SYFA 3MZ5A 3LWEA 1DOKA 4MIUA 3S1QB 4RCOA 4RA8A 1ONLA 3KLSX 3T56B 4WFN3 4Q0FA 3QB3A 3OOCA 2NZ1D 5C0XI 2F0UA 3MHBA 2BCOA 1SNOA 5IGBA 3UI2A 2TMPA 3V2TA 1UAPA 3OW7A 5ELEA 3K57A 2B2VA 2L0CA 1ZKOA 1E2WA 5ELBA 1BCPD 3DWAA 3VR2A 1H9JA 1OXTA 3HEJA 4FNFA 4JBWA 3S9WA 4F8MA 1R4QB 4QMGA 1PYWD 1DD2A 3TZUA 3WOEA 4XTCS 2EY2A 4A3MB 3RLFA 2EJFC 3I72A 1BQQT 1TQOA 4RGTA 3NHHA 4G7OC 3J81L 2NVYB 3MVVA 1WD1A 1LT6D 3VR4A 2KCCA 4DNTB 3T13A 1TS2A 4LJZC 5E4XA 4OIJA 5A35A 3MTSA 2OT2A 2E76C 4NMZA 4F7XA 3H91A 2G9HD 3HKZB 2EDGA 3K5LA 5C4JB 1WVLA 1BUVT 3R2IA 4QF4A 1XWEA 4HMIA 2LKVA 3H0GB 1EOTA 2EOTA 1IYVA 2PYKA 3C1EA 4O1NA 1D5MC 3M7NA 3MXUA 3BDLA 5K36G 1O7LA 2B39A 1B44D 1JWUD 3RZDB 2KHSA 3S1RB 1AFPA 5KGUA 4IUUA 4C3HG 1HTPA 4LK1C 2I46A 5EKIA 3FVQA 1CQFA 4L8JA 1YNND 1GXDC 2L9HA 3QO2A 2EJGC 2N88A 4K8JA 2PW5A 1ESRA 2XIWA 1FNUA 4FF4A 4HSVA 1CQVA 1LTTD 2IL8A 3PIO3 1HUMA 2FHTA 3GTJB 1SMYC 1PZJD 1HFGA 2SNSA 3DM1A 5I9PA 1TS3A 4KI0A 1MBYA 1DONA 1O7YA 3W2DA 5DM63 1V1OA 5E1FA 3TZDA 3G7LA 4L6TB 1DCZA 2KOLA 5IODA 3E5SA 4FO2A 5CV8A 1H9MA 3SR1A 4DK0A 3LX0A 3DMUA 1F2YA 2C5CA 4RHSA 4ZYSA 3IKJA 5IOCA 1Z6HA 1ENAA 4PMWA 5D65A 5JVG3 3VR5A 3BVGA 1SSOA 2BDNA 2B63B 4B9XA 1C8CA 2WB1B 1IKMA 1O7ZA 3CHBD 3JAML 1U4RA 1LABA 2G9DA 3NP8A 2HCIA 5JJZA 1HQRD 1GUSA 4KY6A 1D5XC 3RD4A 4RGMA 1I4QA 5DAUA 4K2LA 2KECA 1EWCA 2L55A 3R3OA 4PV1C 5JEAH 1SYGA 2RBMA 1EU3A 1JCKB 4OO1G 3MXGA 3C3LA 5IGGA 5IGFA 5T1GA 5C6AA 1I4XA 1PZID 1IW7D 5I2XA 2X6GA 5FO9B 4HSPA 3X3NA 2X69A 2IX3A 5I2YA 2L12A 3QOLA 3P1HA 4MHEA 2Q8IB 3NUCA 3J81E 1PRTF 3J7AV 4HEDA 1MSHA 2JSOA 3OMCA 4ZK9B 1SBBB 5FO7B 1XXGA 1GJXA 1T5XD 1EFID 3TDQA 1SEBD 3KBXA 1AP0A 3K58A 4HCEA 2QILA 1TWGB 2RDGA 2RQXA 3A7AB 2WACA 1BCPC 3PMFA 5CV7A 1VMPA 1KDCA 3ND8A 1S4ZA 2WKCA 4HCSA 5EJWA 1R4PB 1BBXC 1EY9A 2WIIB 2O5IC 4ME5A 1EY0A 3Q23A 5CYUA 4BBSB 2IT1A 4XQNA 1RTOA 1F2MA 1VMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD4 A;  2L0C A; 
#chains in the Genus database with same CATH topology
 1TII D;  2SDF A;  4U67 3;  1EYA A;  4Y52 H;  2IWH A;  4GNX C;  4X64 L;  1G2T A;  2D0P A;  3KJO A;  3F2C A;  2I5M X;  4G4K A;  2Q8T A;  2UXB Q;  2IHF A;  3B6Y A;  3SK4 A;  4DV3 L;  2ZXR A;  3HRZ C;  2KCT A;  1R9T H;  4FF2 A;  2PNH A;  1RCV D;  5M3M H;  4A3C H;  4OO1 I;  4QQB X;  3PO2 H;  2IPK D;  2X6L A;  4ALP A;  1PFM A;  4ZKC B;  1N32 L;  4KJO A;  1A3V A;  1L0Y B;  5M3F B;  2ATW A;  3GTP B;  1PDQ A;  2EYP A;  3L9A X;  1Z9F A;  3GTL B;  3OHX C;  3NSW A;  4PNY A;  3TBI B;  4OXP A;  3VR6 A;  2N78 A;  3I56 A;  1JQY D;  3MC0 B;  2A74 C;  3NXW A;  1D7Q A;  4NPS A;  1I6H B;  1FNV A;  2CW0 D;  1LTR D;  5KYL A;  4IFD G;  1IZ6 A;  3EFX D;  5AFW A;  1CA6 A;  1L0X B;  3QIA A;  2XWJ B;  2ICE C;  5DLQ E;  1W6J A;  4PZ7 A;  3T1H Q;  1I4G A;  1VQC A;  2JQO A;  3D4D A;  4DN4 M;  1FYC A;  4PQX A;  3VR3 A;  2UUB L;  3S17 H;  1T5E A;  3CP0 A;  4EX5 A;  2Z0S A;  5M5Y B;  1YNN C;  1YJW A;  2B63 G;  4FXD A;  5M5W B;  1Y69 U;  2EXZ A;  1JJG A;  1CKN B;  2HQL A;  2HQE A;  1JOO A;  1J5E L;  1EQV A;  2NVT H;  4A93 B;  4LFB Q;  4KTA A;  2BH2 A;  5JOB A;  3STB C;  2D9U A;  3K59 A;  1EIH A;  2WFW A;  1XMO L;  3M9B A;  4JI6 Q;  2RVL A;  2LFN A;  2VUM B;  1U5K A;  1SMX A;  2PQE A;  2F0S A;  3I4M B;  2Z8L A;  2KQ3 A;  2E74 C;  1QB5 D;  3BG3 A;  4R8I A;  5COY A;  3JAM E;  3FPP A;  4HJA A;  4ZKB B;  2B2W A;  3SK8 A;  3OSO A;  1ZXT A;  2PZT A;  3HOZ B;  4X65 L;  3QWN A;  3L3O C;  3P20 A;  3S2D B;  4DF7 A;  5KNC A;  3KLR A;  5IP9 H;  4LFC Q;  4KMU C;  1PFB A;  1LTS D;  2VZA A;  1FL0 A;  2K5W A;  4RFB A;  3S1N H;  2B2U C;  2KCN A;  4A76 A;  3TP5 A;  2B8F A;  4EGV A;  1IL8 A;  3D6W A;  3BS1 A;  3CD6 A;  4C56 C;  2V1C C;  2Y0S E;  3SXH A;  4IJH A;  3EJI A;  4I65 A;  4DR6 Q;  4B08 A;  3H94 A;  2UXC Q;  3VYT A;  1EY4 A;  1JOQ A;  2EYL A;  3M3Y H;  1XTC D;  2EZV A;  1TS5 A;  3S1M B;  1KDB A;  4DUZ Q;  3MAQ A;  5IYD H;  1HCZ A;  1VQ4 A;  1YBY A;  1LLR D;  4P72 A;  2O4X A;  4KV6 A;  1P16 A;  1UE5 A;  2CQA A;  5C0X H;  1SR3 A;  5ELC A;  1F9Q A;  2PPB C;  1H9S B;  5JJK A;  3ULL A;  3UE0 A;  1YJ9 A;  1CK1 A;  1MI2 A;  1OO9 B;  1EIG A;  1IXR A;  3FDT A;  5H1S E;  3GTQ H;  4JCV E;  2LSS A;  5FLX L;  4ULL A;  2NN6 G;  4A3D H;  4KKS A;  3TN2 A;  2MP1 A;  3DXJ C;  3PV0 A;  1L1O B;  2DGY A;  1S5D D;  1GUW A;  1LV9 A;  1KRT A;  1TWC B;  3M85 A;  1CZG A;  2YTX A;  2JA5 B;  2F4V Q;  1DOM A;  2IJ0 A;  1JOK A;  2MO1 A;  3NBI A;  1Q90 A;  3BYY B;  1EY5 A;  1QVG A;  4X3U A;  1I50 B;  1NTG A;  4LF7 Q;  2DNC A;  2YTV A;  3G6J B;  4WOR A;  2JA6 B;  3SE0 A;  2UUA L;  1MSG A;  1IW7 C;  5GAG C;  1SNC A;  4IPD A;  3PUW A;  4PZ8 A;  2M2L A;  4TVA B;  3V96 A;  5BR8 L;  4BY1 H;  2KVM A;  4BBS G;  4ZRZ A;  3GTK B;  3ERO A;  2GN5 A;  2NWG A;  1PYS B;  3FKI B;  1TR5 A;  1B9N A;  3CCE A;  1VCI A;  1VF5 C;  2ZM6 L;  3PO3 G;  2RHS B;  4ZUJ A;  4XXE A;  4CKE A;  3M7G A;  3CQZ B;  4CDF C;  5LHY 1;  3P75 A;  1DGS A;  4XQJ A;  3H6M A;  5HGQ A;  3J80 c;  4K0K Q;  1EIF A;  3X3M A;  1AEX A;  1K28 A;  2QCP X;  4DV2 Q;  4KHV A;  3HOV H;  1GUN A;  4HTH A;  1PH6 A;  4RMF A;  2MPM A;  1Y1V B;  5IP7 G;  2F0T A;  5J1Z A;  1O7I A;  1HNW L;  1XPO A;  1Q7Y C;  1SFO H;  2B2T C;  4J1M A;  1VQD A;  2XWB B;  1OXX K;  4QUC A;  4H44 C;  5M3F G;  1DM0 B;  1JIC A;  2WKD A;  1C48 A;  3PUX A;  1MD2 D;  3SVM A;  4KD3 A;  4YCW A;  5LMN L;  4AQY Q;  2F0D A;  1X32 A;  4DAM A;  1VQP A;  1STG A;  1Z47 A;  2OEO A;  3T1Y Q;  2PW7 A;  4BBR B;  4CDD C;  1WTR A;  4EQN A;  4X66 L;  2YU9 H;  5K5P A;  1EY7 A;  2PQA B;  1CKN A;  1LTI D;  2NTS A;  1O78 A;  3RZO B;  1ZYR D;  1YHB A;  5IYC G;  1Y1W B;  4WJ3 M;  3I4N B;  1ML0 D;  3E3X A;  5F2D A;  3H3V C;  4IOC A;  1VQN A;  3IAY A;  3ONA B;  4RCN A;  1A3T A;  2ID0 A;  4QB4 A;  4DV6 L;  2XRQ D;  3M4Y A;  2JA7 H;  1ET9 A;  4DR7 L;  3IFT A;  5FLX c;  2FFK B;  4HR7 B;  4KKT A;  4DKA C;  4B3M Q;  1LTG D;  1NR2 A;  2K4K A;  4IFD J;  4UP7 A;  3RLO A;  3GDE A;  2EY5 A;  2VQE Q;  4IAL A;  2XRS D;  4A93 G;  1SYB A;  3KLW A;  3NE5 B;  4FF1 A;  2NN6 I;  1HFN A;  4BY7 B;  2Z9H A;  1FGB D;  1MIU A;  5J22 A;  2UXD L;  4MTK A;  2IX0 A;  3I8Z A;  2JE6 I;  1ENC A;  4IO9 A;  1BDO A;  4M1U B;  2VUM G;  3T51 B;  3A56 A;  3WOF A;  3H15 A;  3WDN A;  1STE A;  4BS9 A;  2A5H A;  3I4M G;  4OWW B;  4IOA A;  1C7Y A;  2JXM B;  2PCF B;  4UPA A;  1STY A;  4TSS A;  3HGB A;  4Y7N B;  1VQF A;  1BNZ A;  1VQL A;  3HOZ G;  1DXM A;  2M00 A;  4A3I H;  4BA2 I;  1BCP F;  2F0P A;  2L1B A;  1B53 A;  1QNK A;  4XDX A;  1TWA H;  4GKJ L;  3K0Y A;  4NXN Q;  4R4Q A;  1KRS A;  1XTD A;  1NMG A;  2CW0 C;  1A6X A;  5DEH A;  1JJC B;  1KAB A;  2WAQ E;  3J80 E;  4DV5 Q;  3PQI A;  3Q6S A;  3PUZ A;  4UDU C;  4C3J B;  3I70 A;  1I3Q H;  3T16 A;  2A6E D;  4H7B A;  3K5N A;  1VQG A;  1XNQ Q;  2IHE A;  3S14 H;  2GA4 B;  3U9O A;  1WJJ A;  4GZY C;  3J7A F;  4CHT B;  1V1P B;  3D4R A;  1MKH A;  4N9T A;  1IBL L;  1HZ9 A;  1AN8 A;  2HIX A;  3J7A 5;  3Q24 A;  3G4S A;  1PH9 A;  4QL5 A;  1STN A;  1SE8 A;  4XIG S;  2FJ2 A;  4DAY B;  2JA9 A;  4DR4 L;  2R61 A;  1L1O A;  2EE1 A;  1B8A A;  3CCR A;  3MXN B;  4GOP C;  5M3M B;  4IN3 A;  3CRK C;  4OX9 L;  3PO2 B;  5IGE A;  5IT9 E;  1HNX L;  1K0S A;  4DAP A;  1Y8P B;  2QEJ C;  2VY3 A;  3S15 B;  3S2H H;  3TQY A;  1KIX A;  3D8G A;  4LW1 A;  4PG3 A;  2QKI C;  3GD7 A;  1LTA D;  4GLV B;  2LXJ A;  1GO3 E;  4GN3 B;  5FJ8 H;  4N8F A;  2JA5 G;  4JI7 L;  5IIF A;  1AZQ A;  2MO0 A;  2R92 G;  2NTT A;  1NNX A;  2N49 A;  4ABN A;  5FLX E;  3UE1 A;  3DWQ A;  4FXK C;  2QF7 A;  1IBM Q;  5EGT A;  4POG A;  3K80 C;  4B3R L;  3A55 A;  1IYJ B;  1RTN A;  2HD3 A;  4A3L G;  3HOW B;  4ILW A;  4OWX B;  1KD1 C;  1TWF H;  3S17 B;  3JC6 6;  3R8B A;  2F1M A;  4NB3 A;  4F87 A;  4POF A;  1F2L A;  3QG1 A;  5I4D A;  4A75 A;  4J6H A;  2NVT B;  4CGY B;  1EY8 A;  4YIJ A;  2Y0S B;  1XPR A;  3FKI G;  4DK6 C;  4JG2 A;  1B2T A;  2E75 C;  2ALY B;  3IFD A;  2J7Z A;  2R7Z H;  1YI2 A;  1PVO A;  4JV5 L;  1HA5 A;  4A3F B;  1OXV A;  2OWO A;  4LFB L;  2RSO A;  3G71 A;  1SJH D;  1DOL A;  4C2M H;  3A8I E;  5JAV A;  3I91 A;  4S3S A;  2FIN B;  4G57 A;  4C3I B;  1FJG L;  1Y1V G;  1CTM A;  4IUT A;  2DNE A;  1H9K A;  3SK5 A;  4HID A;  2E8G A;  4JI4 Q;  5M9O A;  4DR2 L;  1BBU A;  4DNR B;  4GS3 A;  1PTO H;  1HR0 W;  2UUC Q;  4YWM A;  3K7A H;  2DY7 A;  1SRO A;  3S1N B;  5CBA E;  2LY7 A;  4ZUI A;  1HH2 P;  5AJ3 L;  1CI3 M;  1ROD A;  1P8L A;  3NEN A;  4JW0 A;  4BBR G;  3GP7 A;  3HS0 C;  2E2I B;  4TKO B;  3NBH B;  1ILP A;  2CVR A;  3GV3 A;  3TSS A;  2RF4 A;  1J8I A;  1Y1W G;  1ET6 A;  2VB3 X;  3M3Y B;  3I4N G;  1E1O A;  2EYO A;  1RJT A;  2LS0 1;  3I55 A;  2YTY A;  5TSS A;  4AYB E;  1Y8N B;  2XVS A;  1PH1 A;  1HHV A;  3RLN A;  5LL6 X;  2JYO A;  2CWP A;  4IUN A;  1V8Q A;  4B9W A;  1G8Z D;  1RL2 A;  1XJV A;  3HG9 A;  2R3Z A;  5D3I B;  3DUZ A;  4HJ8 A;  2GVB A;  3SHL A;  4FDB A;  3U4Z A;  4GLX A;  1VDZ A;  2F0M A;  1F9R A;  1EEF D;  3CME A;  4WRD A;  2EYH A;  2WP8 J;  2XSC A;  2ENB A;  4OO1 H;  4BY7 G;  1BCP B;  1SNQ A;  2F3W A;  1G2S A;  5ELD A;  1GUG A;  1PMR A;  3NQI A;  1SAP A;  1ILQ A;  3QR8 A;  3GTQ B;  2C9O A;  4LF8 L;  1JWS D;  1W3S A;  2NZH A;  2SOB A;  3I4L A;  4HN7 A;  4B3T L;  4A3D B;  1HR0 L;  2E2J H;  2ICI A;  4JOI C;  1K3B C;  3RMH A;  1UUP A;  3G48 A;  4LWC A;  4EQP A;  5C4H A;  5JVH 3;  1Y14 B;  2B8G A;  2K5N A;  1X55 A;  4JI0 L;  2MQH A;  1EYD A;  5BN5 A;  1KXL A;  4JVZ A;  1QIL A;  3HZX A;  4R1J A;  2OCE A;  3W5O A;  1CA5 A;  3I90 A;  2L4N A;  3PUV A;  5LMU Q;  3C2P A;  3PUY A;  1B9M A;  2F0W A;  2CQO A;  2E2D C;  1CUK A;  1V1P A;  3AFP A;  4QIW B;  2AQ2 B;  4CJ1 B;  4P71 A;  5CV6 A;  2HUG A;  5EPL A;  3CF5 A;  1ZYR C;  1VQE A;  3KF6 B;  3C46 A;  1PTO D;  1K8O A;  4C3J G;  4JI8 Q;  5KYI A;  4DR1 L;  3SGI A;  1ENF A;  3MXN A;  4V0B A;  3IL8 A;  2FXQ A;  1M4V A;  1AE3 A;  1X3P A;  4A3J H;  1RKN A;  3G6E A;  3VA7 A;  4A3K H;  2AWO A;  1VQI A;  1EY6 A;  1F9P A;  2GVA A;  4IPG A;  1YHA A;  2WIN B;  2B2Y C;  5CV4 A;  5IWA L;  4KN7 C;  3H3V I;  2UU9 Q;  2ZTE A;  3CPF A;  4DV4 Q;  1WTO A;  1QJO A;  1B70 B;  5M3M G;  2CKZ B;  3UDX A;  1SFO B;  4A3C G;  4DFA A;  3PO2 G;  3L0O A;  4PMC A;  2K5Q A;  3HOX H;  1CZW A;  1UE7 A;  1SE2 A;  2PZU A;  3KF8 B;  4JI3 Q;  4A3B H;  3FEW X;  3PIP A;  2NBF A;  3OW2 A;  3CC2 A;  3GV6 A;  4ZQ3 A;  3MFY A;  1ESF A;  2YU9 B;  2NUC A;  3J7Y W;  1QOH A;  2PI2 E;  4AQY L;  4RHR A;  4QGU A;  2A6H D;  3K6O A;  4XYQ A;  1WFQ A;  5G3L D;  2JP1 A;  1EUJ A;  2K5H A;  2IY5 B;  1N34 L;  4DU9 A;  5EBD A;  2N55 A;  3OIP A;  3EQL C;  5GAE C;  3HOW G;  2K04 A;  1N33 Q;  1Y8O B;  1U0L A;  3KJP A;  3F2U A;  2A19 A;  1RHP A;  2H1E A;  2JA7 B;  2AQ3 B;  1RF2 D;  1E0B A;  2A6E C;  1CSP A;  1VQ5 A;  1NBW A;  1KAA A;  2Y0S G;  5COR A;  2Q2U A;  1QZG A;  1W6K A;  2EVB A;  3I3C A;  4DR5 L;  4IUQ A;  2E5L L;  2Q2T A;  1CM9 A;  3N6R A;  5I6Y A;  1K83 H;  2JN4 A;  4P75 A;  5KRU A;  3AYH B;  4A3F G;  1NUC A;  2KA7 A;  2IW3 A;  2WB1 G;  4YY3 L;  1M1K C;  1TY0 A;  4JI2 Q;  1LAC A;  1HPC A;  2H4O A;  3RNU A;  1HRJ A;  4LF6 L;  2F3V A;  3VYS A;  2DY8 A;  4C3I G;  2A68 D;  2FMC A;  1Q8I A;  2EYF A;  4JPB W;  1S5B D;  3CMA A;  4A3G H;  3AB9 A;  2VXW A;  2F0L A;  3T53 B;  1PV4 A;  4A3I B;  1YZ6 A;  4MNO A;  4HIO A;  1I94 Q;  5I9O A;  4DXF A;  2Q8R E;  4JYA Q;  3KLS A;  1N9W A;  5IP9 G;  3Q0A A;  4JBJ A;  1ICW A;  5ELF A;  1HXY D;  4JOI A;  4RGO S;  1TWA B;  1K8G A;  1LTB D;  3K7U C;  4HIM A;  5KEE A;  3RR5 A;  3J80 L;  1BO0 A;  2F0J A;  5C4Z A;  2BA1 A;  1KTK A;  3NWS A;  4HJ5 A;  3TRZ A;  5JEA J;  4X62 Q;  4LUV A;  5C5L A;  5FKA C;  3HOU H;  3TS2 A;  4AH6 A;  1XMQ Q;  1QG7 A;  1RIP A;  2HHH Q;  4AIM A;  2B2V C;  2AUJ D;  3GQB A;  1NAP A;  1TWH H;  5C3E H;  4LF9 Q;  2R6G A;  4IQZ A;  4BWG B;  3S14 B;  2F03 A;  4IPC A;  1OTC A;  3EA6 A;  4M8A A;  1BR9 A;  5IYD G;  2RDF A;  4Q5V A;  2K5D A;  2RSN A;  4CKB A;  1G6Z A;  2XGT A;  5LL6 S;  3S16 H;  5EPJ A;  2O2L D;  1WOC A;  1JB3 A;  3URY A;  1WD0 A;  4KHP L;  3K5O A;  3PCO B;  5IT9 L;  5T1I A;  2VB2 X;  2F0N A;  1YEZ A;  2P5Z X;  1V43 A;  5D3D A;  2EYM A;  3LWU A;  3U50 C;  3S2H B;  1JC7 A;  3TS0 A;  3P7J A;  4A3D G;  1QUQ B;  3PF4 A;  4UAI A;  1SE4 A;  1KQS A;  2CHB D;  3BJU A;  4GNX A;  3NQT A;  1TT2 A;  1ASY A;  3Q8D A;  4H02 A;  2F4I A;  3KDF B;  1EQR A;  4DAV A;  2AWN A;  3DHQ A;  1BVS A;  4IZ8 A;  3M4O H;  4IFD I;  1V9P A;  4K5W A;  1LUZ A;  3A8K E;  4DK1 A;  1Q8K A;  3HP3 A;  5JJI A;  1EL0 A;  5LMN W;  1TWF B;  4PMB A;  4R4C A;  3BDC A;  5C4X H;  1VQA A;  2NYZ D;  2ZTD A;  5JPM C;  2NN6 H;  4K6D A;  1IYU A;  2R7Z B;  2IX1 A;  5HGT A;  3C1F A;  4LFA Q;  3NEL A;  2VQF Q;  4NXM Q;  1STB A;  2K5V A;  2TSS A;  1CKM A;  1HNZ L;  1QVF A;  4AYB B;  4C2M B;  1UE1 A;  1YVC A;  1H95 A;  2OQK A;  1CKO A;  5J39 A;  1X6O A;  1TXY A;  4XQQ A;  2DUD A;  3IRB A;  5KNB A;  1G29 1;  4ZAI A;  1GHJ A;  2VNU D;  3DLL A;  1K8M A;  1NR4 A;  1QVC A;  4XYO A;  1EWI A;  5CV9 A;  1AZP A;  1PTO B;  4XT1 B;  2DN8 A;  3K7A B;  1F2Z A;  4LF5 Q;  3OTO L;  4E6I A;  2F0Q A;  5E3F A;  4LF4 Q;  1A2T A;  1KLG D;  3KBG A;  1VF7 A;  2F3I A;  5EPK A;  4DV1 L;  2O5J C;  4X64 Q;  2MUY A;  3ULP A;  3PO3 H;  3O13 A;  2QEX A;  5FO8 B;  3K5M A;  1C4Q A;  2EY6 A;  1A63 A;  1N36 L;  1XNR L;  4DV3 Q;  3OIQ A;  5KIX A;  5IT9 c;  1IBK L;  1VQH A;  1GD7 A;  3BVM A;  2JA8 H;  4I7A A;  1NCV A;  1N32 Q;  4U68 A;  1PTO C;  2JA7 G;  4BXX G;  5HY6 A;  1STA A;  2QDB A;  2B2U A;  1GM5 A;  2PZW A;  1STH A;  1IKL A;  1JMC A;  4F88 A;  1SE3 A;  4FYD A;  3E9I A;  3CCJ A;  4DV0 L;  4DV7 L;  2E2H H;  5JJL A;  2EJM A;  1OXS C;  3M4Q A;  3ZYY X;  5C44 H;  2K05 A;  5EQ0 A;  2K1B A;  4K5X A;  5CBE E;  2R93 H;  1CT1 D;  1K3R A;  1UWV A;  4LMQ D;  1AE2 A;  4O0A A;  2VW9 A;  2F52 A;  2E2J B;  1VQ9 A;  1D8L A;  3PGZ A;  1KC8 C;  3R93 A;  1YNX A;  1I4R A;  4OHJ A;  4A3I G;  1HZA A;  1WCM H;  2PO4 A;  5BN4 A;  3PIP 3;  3GTM H;  1J5E Q;  3CCL A;  2DJF C;  3HOY H;  1F77 A;  3FPU B;  4DK3 C;  2FMM A;  2H5X A;  1YIJ A;  3MWY W;  4PZ6 A;  2EY1 A;  1TKW B;  1H9R A;  3Q22 A;  1XMO Q;  2A6H C;  3GTO H;  3EN2 A;  5LMU L;  3ERQ A;  1XYI A;  1UEB A;  1TS4 A;  4HJ7 A;  3K0X A;  5C3W A;  4DPG A;  4NW2 A;  4YHH L;  1CHP D;  1MGS A;  4GOP B;  5A2Q L;  1LM0 A;  4A3J B;  4JI1 Q;  4X65 Q;  4A3K B;  3A7L A;  1GKH A;  2Q2I A;  3D6C A;  1WYD A;  4JI8 L;  4DGZ A;  1GUT A;  3ER0 A;  2NZO A;  1H9S A;  2F0H A;  1X54 A;  4CJ2 C;  4YCV A;  2NVX H;  2OF1 A;  1GVP A;  2KUM A;  2DJG C;  2F0K A;  1FGU A;  1SNM A;  3DWP A;  3LNN A;  3MEH A;  5K36 H;  4MN3 A;  2LXK A;  4K6L A;  1U4M A;  4DXG A;  2UU9 L;  3I4O A;  1Q86 C;  4L5R C;  1U4P A;  1PH2 A;  3HOX B;  2A68 C;  2NVQ H;  5C0X J;  4OGQ C;  1R9T B;  4A3B B;  3NTK A;  3ICE A;  3NEM A;  2UXB L;  3MA2 B;  4C3H H;  1FD7 D;  2PMZ E;  3MEF A;  1E2Z A;  4GKK Q;  2Z6B A;  5CGK A;  4H13 C;  4JI3 L;  5FJ8 G;  1VQ7 A;  1E24 A;  3MXP A;  2K6A A;  3NTI A;  3SK6 A;  3J81 j;  1II3 A;  2F0G A;  2A1A A;  3U4V A;  2R7D A;  3AMU A;  1DYQ A;  2RKS A;  4A3E H;  4RGN A;  4N9P A;  1PHJ A;  2B2T A;  2D2C C;  1B50 A;  2J4X A;  3A54 A;  1NJI C;  5EBC A;  4HAE A;  4KHZ A;  1HA6 A;  2HDL A;  1MHW C;  4Z9C B;  2JEA I;  1I6V C;  1GHK A;  1WTW A;  2JA6 G;  4FP5 D;  3OPO A;  2KEE A;  4NDX A;  1A62 A;  2MHV A;  5M5X H;  3N52 A;  3T1H L;  2R7Z G;  1K83 B;  1U4L A;  3TP6 A;  1J9O A;  1Z7T A;  1VQJ A;  4C1N K;  4AYB G;  1TWC H;  1JOR A;  1PYB A;  3PSI A;  2R92 H;  2F0E A;  4TQU S;  1GOZ A;  4KJN A;  2A8V A;  2UUA Q;  4LUZ A;  4X6A H;  4RKB A;  4CBV A;  5EKL A;  1S72 A;  2F0O A;  4A3G B;  2KJX A;  5BR8 Q;  1KLU D;  4K14 A;  4RKL A;  1VQK A;  5ELO A;  1JWM D;  4DA2 A;  4JI6 L;  2VS1 A;  4C1N I;  3E9H A;  4V19 0;  2PQA A;  1U9R A;  2CWA A;  4X3T A;  1LT3 D;  2AQ1 B;  2ZM6 Q;  2K32 A;  2SEB D;  1KHI A;  4KLK A;  1L0W A;  5JEA G;  3W1G A;  3GTK H;  2HCC A;  1WTX A;  1IHZ A;  2K03 A;  1ASZ A;  1JB7 A;  1QNU A;  1X3Q A;  1S5E D;  4EVO A;  3HOU B;  3GTG H;  1PRT D;  4JK1 C;  4RH6 A;  4LFC L;  1SDF A;  2J0T D;  1KNA A;  1D2B A;  1TWH B;  5C3E B;  1XMQ L;  1HNW Q;  3S1Q H;  2BE5 D;  2OXP A;  4KD4 A;  3BDO A;  1PXU A;  5GAD C;  4K5V A;  1Y1V H;  4LF9 L;  3S16 B;  4DR6 L;  1SXT A;  4P2C B;  2ZJQ A;  4OIK A;  1PZK D;  2UXC L;  1EU4 A;  4WJW A;  4ZLT F;  3UDG A;  1BOS A;  4DUZ L;  2OTL A;  3T4A C;  5I6W A;  2K14 A;  3L2P A;  1SYD A;  5BN3 A;  1EYC A;  2F0I A;  3TP7 A;  5CMD A;  4DR3 Q;  1VQO A;  2MJ8 A;  4QCL A;  3NK9 A;  4K8I A;  3KK7 A;  5GQO A;  3A8J E;  3NWT A;  4UHV A;  1B1Z A;  3BZD B;  1PA6 A;  5JPN C;  4DV6 Q;  3I73 A;  1YNJ D;  2YYZ A;  4A3M H;  4DR7 Q;  3E0E A;  2A69 D;  2NVY H;  3A74 A;  4RAU C;  4APV A;  4EQ5 A;  2RHQ B;  5D14 A;  2ZXP A;  3D31 A;  4GOP A;  3M4O B;  1D1I A;  2PNR C;  2SNM A;  2RCF A;  2N8N A;  4R8N A;  1D6E C;  2M9V A;  2UXD Q;  4OWT B;  2L11 A;  2B2W C;  5FOB B;  1A3U A;  1EYG A;  2F4V L;  4N8X 1;  5CR3 A;  5C4X B;  3ZJY C;  1FVI A;  5IYB H;  1UNS A;  1PFN A;  4EQO A;  1Q12 A;  1I4P A;  3CU7 A;  2K7V A;  4X3K A;  1YIT A;  1SYC A;  4BY1 B;  4KN4 C;  5C4J H;  4A3J G;  4LF7 L;  2CH4 A;  2K01 A;  4A3K G;  4OON A;  3K81 C;  4DAY A;  1I5F A;  4H0L C;  5FLM H;  5DM7 3;  1SJE D;  1PLF A;  1SND A;  3CKI B;  1EQT A;  1VS0 A;  3H0G H;  5E4W C;  2L5T A;  2YV5 A;  2KHJ A;  4NXM L;  4GKJ Q;  4GLA C;  3PF5 A;  5A2Q E;  1KDA A;  1SYE A;  4FXG C;  1X3E A;  3J81 i;  1L2F A;  1WTV A;  1D1K A;  4KK7 A;  3BVZ A;  1ZEQ X;  3OMG A;  3HOV B;  1CFM A;  2D62 A;  3HOX G;  4YCU A;  2ZTC A;  2QA4 A;  4K0K L;  3RZD H;  3S1R H;  4A3B G;  4J8Q A;  1PH3 A;  2D0O A;  4DV2 L;  1K73 C;  4IPH A;  2BOS A;  3BZC A;  2LMC B;  5IGC A;  4NKL A;  4L63 B;  2B3G A;  1IBL Q;  1EEI D;  1HTL D;  3HKZ E;  4LF4 L;  4KKU A;  1LT5 D;  3PO3 B;  4BA1 I;  5IGD A;  1QWY A;  1X3F A;  5L37 A;  3MFG A;  4A4I A;  3E6Z X;  1A15 A;  4TRD A;  3U58 A;  1DJR D;  1X65 A;  4ODG A;  4DR4 Q;  2KEN A;  1DZ1 A;  3QOJ A;  4IUP A;  1WTP A;  2BDO A;  2EQS A;  1PH4 A;  5IY0 A;  4OX9 Q;  1HQM C;  3CCS A;  3RN2 A;  2JA8 B;  2B29 A;  5CC4 A;  3T1Y L;  1HNX Q;  1JR0 D;  2HDM A;  1PTO F;  3CRL C;  1D5Z C;  5J3B A;  3OWF A;  4KY7 A;  1PH7 A;  2BA0 A;  1HUN A;  4LNQ A;  3S15 H;  3GTJ H;  1SN8 A;  1A0I A;  2E2H B;  4JI7 Q;  3OWE B;  3EVQ A;  5NUC A;  1G91 A;  3CC7 A;  5C3X A;  4L5Q A;  2A73 B;  5C44 B;  1AW7 A;  2WAQ B;  4B3M L;  1C0A A;  2R93 B;  5FK9 C;  1EZ6 A;  2MNA A;  4B3R Q;  2ZT9 C;  4X3S A;  1SNP A;  1B4O A;  3SDZ A;  4IJL A;  2VQE L;  3ERS X;  2XN9 C;  1M90 C;  4NP5 A;  2K50 A;  4K2K A;  3BYT B;  3DM3 A;  2RDH A;  1EQQ A;  4A3G G;  1B3Q A;  2F0F A;  4CJ0 B;  1WCM B;  4L5T A;  3HOW H;  3GTM B;  4R9W A;  3HOY B;  2EIF A;  4IFD H;  3A0J A;  5DNF A;  5KND A;  1FR3 A;  2C35 B;  1GUO A;  3E0J A;  3NBH A;  3K8A A;  2JEB I;  1QCB D;  1EWH A;  3F2D A;  4JV5 Q;  3UDF A;  1M8A A;  1WTQ A;  3SEB A;  1NMF A;  4MZ9 A;  3GTO B;  3CCQ A;  1XPU A;  1QE6 A;  2RCN A;  3HOU G;  3L7Z C;  2B63 H;  5G3L F;  5EKK A;  2PMZ B;  3ITP A;  4I7Z C;  1OXU A;  2Z1C A;  3D4W A;  1FJG Q;  4A3F H;  5ISR A;  1XX8 A;  2KBN A;  3HKS A;  3J7Z C;  3NTH A;  3HFZ B;  5GAH C;  5C3E G;  4NXN L;  3PIO A;  4OL7 A;  2QDL A;  3W3A A;  4C3I H;  4P73 A;  1SMY D;  4DR2 Q;  3KFU A;  1BKB A;  3RUZ A;  1PH5 A;  1I3Q B;  4KY5 A;  3VYU A;  1TY2 A;  4DV5 L;  2KHI A;  4JI1 L;  1PFS A;  2KCM A;  3EBE A;  2NVX B;  3FRP B;  2EPB A;  2EYJ A;  5AJ3 Q;  5HUR A;  1XNQ L;  1F9S A;  1Q1B A;  1A8V A;  2ZXO A;  2K28 A;  3TP8 A;  5C0X G;  1SLJ A;  3R2T A;  4FF3 A;  3VA5 A;  1BF4 A;  2MGS A;  1X56 A;  4JI5 Q;  1PRT B;  2NVQ B;  2E2I H;  2I0Q A;  1NSN S;  1QZH A;  4C3H B;  1O80 A;  3DEP A;  2JK8 A;  3CPW A;  3F2B A;  4DUY Q;  2WB1 E;  2B2Y A;  1A2U A;  3JAM i;  4QUF A;  4GKK L;  4A3E B;  4FVM A;  2QW7 A;  2OTJ A;  3AU7 A;  3V05 A;  1LT4 D;  3FMC A;  3KF6 A;  1KNE A;  2KED A;  1BXT A;  4RWS C;  1VQM A;  1S5F D;  1W2B A;  2RA4 A;  3NPP A;  1EZ8 A;  4HJ9 A;  4O42 A;  1I4H A;  1UEA B;  1RDP D;  2L15 A;  3QJY A;  1PRT C;  3D3R A;  4HMJ A;  4LF8 Q;  1Q3L A;  4B3T Q;  1YJN A;  2CFM A;  1HR0 Q;  5C4X G;  1BBW A;  4QJF A;  3D0F A;  1IBM L;  4OEL B;  3TME A;  2F0V A;  1MJE A;  2BE5 C;  4IUV A;  1TVX A;  2Z4H A;  4CKC A;  4BY1 G;  5M5X B;  4JI0 Q;  4XT3 B;  1YHQ A;  4IUR A;  3U9S A;  5CV5 A;  5C5M A;  1B3A A;  4QY7 A;  3KUP A;  3CCV A;  1VQB A;  1NY4 A;  1TU2 B;  4LAA A;  2D5D A;  2R92 B;  2K33 A;  4JBM A;  3GO5 A;  1TWG H;  2N3S A;  3F1Z A;  2Q2H A;  1LO5 D;  3KF8 A;  4ID6 A;  1KL9 A;  2I07 B;  3H09 A;  1S5C D;  1FNW A;  3HOV G;  1E2V A;  2WV6 D;  3ND9 A;  4WJ4 A;  4B3S Q;  2AUK A;  4ZCK A;  4DR1 Q;  2CCZ A;  3VYR A;  1Q1E A;  2Z4I A;  1RD9 D;  2V4D A;  1YNJ C;  4DNI A;  3DEO A;  2XNA C;  1L1O C;  1CHQ D;  2A69 C;  4G7H C;  1JE4 A;  4JI4 L;  2NB0 A;  4BBS H;  5IWA Q;  3GTG B;  4G7Z C;  3CXC A;  4RG1 A;  1SYF A;  3MZ5 A;  3LWE A;  1CSQ A;  2UUC L;  1VQ6 A;  1DOK A;  4MIU A;  4MTN A;  1Q81 C;  1Q82 C;  1S40 A;  3S1Q B;  4RCO A;  2JA8 G;  4RA8 A;  1ONL A;  3KLS X;  4HIK A;  1C9O A;  3T56 B;  1N8R C;  4WFN 3;  4Q0F A;  3QB3 A;  3OOC A;  2NZ1 D;  5C0X I;  2F0U A;  3MHB A;  2BCO A;  4QIW E;  5IP7 H;  1G51 A;  1SNO A;  3UI2 A;  5IGB A;  2TMP A;  3V2T A;  1UAP A;  3OW7 A;  5ELE A;  2EXD A;  3K57 A;  3M4P A;  2B2V A;  2L0C A;  1ZKO A;  5C44 G;  1E2W A;  5ELB A;  5M3F H;  2WAQ G;  1BCP D;  3DWA A;  3VR2 A;  2ES2 A;  3A5Z B;  2R93 G;  1H9J A;  1N34 Q;  3GTP H;  1OXT A;  1IL2 A;  3GTL H;  3HEJ A;  4FNF A;  4JBW A;  3S9W A;  4F8M A;  2HIV A;  1R4Q B;  4DR3 L;  2QGQ A;  4QMG A;  1PYW D;  1DD2 A;  3TZU A;  3WOE A;  4XTC S;  2EY2 A;  4A3M B;  1S3O A;  3RLF A;  2EJF C;  1WCM G;  1BQQ T;  1TQO A;  3I72 A;  3NHH A;  4RGT A;  3J81 L;  1I6H H;  2NVY B;  4G7O C;  3MVV A;  1WD1 A;  5IYC H;  3HOY G;  1LT6 D;  2UUB Q;  4BXX H;  1KAW A;  3VR4 A;  4DR5 Q;  2KCC A;  4DNT B;  1V1Q A;  1Q46 A;  2E5L Q;  3T13 A;  1TS2 A;  4LJZ C;  3CAM A;  4OIJ A;  5E4X A;  5A35 A;  3MTS A;  4O2D A;  3TEH B;  4YY3 Q;  2OT2 A;  2E76 C;  4NMZ A;  2R7F A;  5M5Y H;  4F7X A;  4LF6 Q;  1PH8 A;  5M5W H;  3H91 A;  1JJ2 A;  1HJP A;  1EIY B;  2G9H D;  3HKZ B;  4A93 H;  2EDG A;  1NE3 A;  1K9M C;  5ELN A;  3K5L A;  5C4J B;  1WVL A;  1BUV T;  2MFI A;  3R2I A;  4QF4 A;  4R4O A;  1XWE A;  4HMI A;  5E7N A;  2LKV A;  2VUM H;  3H0G B;  1EOT A;  2HT1 A;  3I4M H;  2EOT A;  1SRU A;  1IYV A;  2PYK A;  3C1E A;  4O1N A;  1D5M C;  3M7N A;  3MXU A;  1QUQ A;  3BDL A;  3EIV A;  5K36 G;  3HOZ H;  4ME3 A;  5EAY A;  1O7L A;  1WI5 A;  2B39 A;  3S2D H;  3ULJ A;  1B44 D;  1JWU D;  4L5S A;  3RZD B;  2KHS A;  3S1R B;  1AFP A;  3UDI A;  5KGU A;  3FHW A;  4IUU A;  3KDF A;  1HTP A;  4C3H G;  2CH4 W;  4JC0 A;  4LK1 C;  4DV4 L;  2I46 A;  5EKI A;  4J15 A;  3FVQ A;  3CW2 C;  3AEV A;  1CQF A;  3A5U A;  2ZJP A;  4L8J A;  1YNN D;  1GXD C;  4A3E G;  2L9H A;  2AHO B;  3I7F A;  3S1M H;  3AFQ A;  3QO2 A;  2EJG C;  2N88 A;  4K8J A;  3WWV A;  4KHP Q;  2PW5 A;  1E7Z A;  1ESR A;  2XIW A;  1FNU A;  4FF4 A;  3STB D;  2ASB A;  4HSV A;  1CQV A;  3RN5 A;  3S24 A;  1K8A C;  4UY8 C;  3CCM A;  1LTT D;  2IL8 A;  4UP8 A;  3PIO 3;  1J6Q A;  1HUM A;  2Z6K C;  4YWK A;  3KOJ A;  2FHT A;  3GTJ B;  1WTH A;  3J80 i;  1SMY C;  1LYL A;  1PZJ D;  1HFG A;  2SNS A;  1N33 L;  1EOV A;  3DM1 A;  5I9P A;  1TS3 A;  3J81 c;  4KI0 A;  4OEM B;  1MBY A;  1DON A;  1ICF B;  1O7Y A;  3W2D A;  5DM6 3;  1V1O A;  5E1F A;  3TZD A;  3G7L A;  2I5L X;  3I2Z A;  4L6T B;  1DCZ A;  2KOL A;  5IOD A;  4GN4 B;  1X3G A;  3BZK A;  3E5S A;  4FO2 A;  2JA5 H;  5CV8 A;  1H9M A;  3SR1 A;  4DK0 A;  2AMC B;  3LX0 A;  3DMU A;  1F2Y A;  2C5C A;  4JI2 L;  4RHS A;  4ZYS A;  3IKJ A;  2AKW B;  5IOC A;  1JT8 A;  1Z6H A;  1ENA A;  1I50 H;  5GRO A;  4PMW A;  2JA6 H;  4A3L H;  5D65 A;  3CC4 A;  5JVG 3;  1JE5 A;  3VR5 A;  3BVG A;  1HNZ Q;  1SSO A;  2BDN A;  1K0R A;  2B63 B;  1I94 L;  4B9X A;  1C8C A;  2ZJR A;  4JYA L;  2WB1 B;  3LGJ A;  3FKI H;  1IKM A;  1O7Z A;  1LTL A;  3CHB D;  3JAM L;  1HZC A;  1U4R A;  1HZB A;  2XTI A;  1LAB A;  3CQZ H;  2G9D A;  4X62 L;  3FP9 A;  3NP8 A;  2HCI A;  5JJZ A;  3OTO Q;  1HQR D;  1GUS A;  1E22 A;  4KY6 A;  1D5X C;  2HHH L;  1UE6 A;  3RD4 A;  4RGM A;  1I4Q A;  2JJQ A;  5DAU A;  4K2L A;  2KEC A;  4YWL A;  1EWC A;  4CDC C;  3H3V H;  4DV1 Q;  2L55 A;  3R3O A;  3CCU A;  4PV1 C;  5JEA H;  5LMN Q;  1SYG A;  3F8T A;  1G6P A;  2RBM A;  1N36 Q;  1XNR Q;  1EU3 A;  1JCK B;  4JBK A;  4X66 Q;  4OO1 G;  3MXG A;  1E3P A;  1IBK Q;  4JI5 L;  3C3L A;  2VL6 A;  5IGG A;  5IGF A;  5T1G A;  5C6A A;  1I4X A;  4BBR H;  1PZI D;  4A3M G;  1IW7 D;  5I2X A;  2X6G A;  5FO9 B;  3RZO H;  4DUY L;  2K52 A;  1Y1W H;  4HSP A;  2G5D A;  1B7Y B;  3KYH C;  3I4N H;  3X3N A;  1E1T A;  4P74 A;  4DV0 Q;  4DV7 Q;  2X69 A;  2IX3 A;  1VQ8 A;  2BH8 A;  5I2Y A;  2L12 A;  3QOL A;  3P1H A;  4MHE A;  2Q8I B;  2PI2 A;  3NUC A;  3J81 E;  1AH9 A;  1PRT F;  3J7A V;  1X9N A;  5IYB G;  4HED A;  3AQQ A;  1MSH A;  2JSO A;  3OMC A;  3HKZ G;  4ZK9 B;  1EFW A;  3TRE A;  1SBB B;  5FO7 B;  1XXG A;  4CDE C;  1GJX A;  4BY7 H;  1T5X D;  1EFI D;  3TDQ A;  5FLM G;  1SEB D;  3KBX A;  3H0G G;  3K58 A;  1AP0 A;  4HCE A;  3OYY A;  2Z6K A;  3W1B A;  2QIL A;  1TWG B;  2RDG A;  2RQX A;  4Y7N H;  2I5H A;  3A7A B;  2WAC A;  4LFA L;  1BCP C;  2VQF L;  1MJC A;  3PMF A;  3BU2 A;  5IE8 A;  4R4T A;  5CV7 A;  1VMP A;  4GNX B;  1KDC A;  4YHH Q;  3ND8 A;  1S4Z A;  2OQ0 A;  3JAM c;  2K75 A;  2WKC A;  1T9H A;  4GN5 A;  4B3S L;  4HCS A;  5EJW A;  1R4P B;  1BBX C;  1EY9 A;  2WII B;  3VDY A;  4ME5 A;  2O5I C;  1EY0 A;  3Q23 A;  5CYU A;  4LUO A;  4BBS B;  4C3J H;  2IT1 A;  4R4I A;  4XQN A;  4UP9 A;  4LF5 L;  1RTO A;  1F2M A;  1VMC A; 
#chains in the Genus database with same CATH homology
 1TII D;  2SDF A;  4U67 3;  1EYA A;  2IWH A;  1G2T A;  4G4K A;  2Q8T A;  3SK4 A;  2ZXR A;  3HRZ C;  4FF2 A;  1RCV D;  4OO1 I;  2IPK D;  2X6L A;  1PFM A;  4ZKC B;  4KJO A;  1A3V A;  1L0Y B;  5M3F B;  3GTP B;  1PDQ A;  2EYP A;  3L9A X;  3GTL B;  3OHX C;  3NSW A;  4PNY A;  3TBI B;  3VR6 A;  1JQY D;  3MC0 B;  2A74 C;  3NXW A;  1I6H B;  1FNV A;  2CW0 D;  1LTR D;  5KYL A;  4IFD G;  3EFX D;  5AFW A;  1CA6 A;  1L0X B;  3QIA A;  2XWJ B;  2ICE C;  1W6J A;  1I4G A;  3D4D A;  4DN4 M;  1FYC A;  4PQX A;  3VR3 A;  1T5E A;  5M5Y B;  1YNN C;  4FXD A;  5M5W B;  1Y69 U;  2EXZ A;  2HQE A;  1JOO A;  1EQV A;  4A93 B;  4KTA A;  5JOB A;  2D9U A;  3K59 A;  1EIH A;  2RVL A;  2LFN A;  2VUM B;  2PQE A;  2F0S A;  3I4M B;  2Z8L A;  2KQ3 A;  2E74 C;  1QB5 D;  3BG3 A;  4R8I A;  5COY A;  3JAM E;  3FPP A;  4ZKB B;  2B2W A;  3SK8 A;  3OSO A;  1ZXT A;  2PZT A;  3HOZ B;  3L3O C;  3P20 A;  3QWN A;  3S2D B;  4DF7 A;  5KNC A;  3KLR A;  4KMU C;  1PFB A;  1LTS D;  2K5W A;  4RFB A;  2B2U C;  2KCN A;  3TP5 A;  2B8F A;  4EGV A;  1IL8 A;  3D6W A;  3BS1 A;  4C56 C;  3SXH A;  3EJI A;  4I65 A;  4B08 A;  3H94 A;  3VYT A;  1EY4 A;  1JOQ A;  2EYL A;  1XTC D;  2EZV A;  1TS5 A;  3S1M B;  1KDB A;  3MAQ A;  1HCZ A;  1LLR D;  2O4X A;  4KV6 A;  2CQA A;  5C0X H;  5ELC A;  1F9Q A;  2PPB C;  1H9S B;  1CK1 A;  1MI2 A;  1OO9 B;  1EIG A;  3FDT A;  5FLX L;  4ULL A;  2NN6 G;  4KKS A;  3TN2 A;  2MP1 A;  3DXJ C;  3PV0 A;  1S5D D;  1GUW A;  1LV9 A;  3M85 A;  1TWC B;  1CZG A;  2JA5 B;  1DOM A;  2IJ0 A;  1JOK A;  3NBI A;  1Q90 A;  3BYY B;  1EY5 A;  4X3U A;  1I50 B;  2DNC A;  3G6J B;  4WOR A;  2JA6 B;  3SE0 A;  1MSG A;  1IW7 C;  1SNC A;  3PUW A;  3V96 A;  2M2L A;  2KVM A;  4ZRZ A;  3GTK B;  3ERO A;  2NWG A;  3FKI B;  1TR5 A;  1B9N A;  1VCI A;  1VF5 C;  4ZUJ A;  4XXE A;  4CKE A;  3M7G A;  3CQZ B;  5LHY 1;  3P75 A;  4XQJ A;  3H6M A;  3X3M A;  1AEX A;  2QCP X;  4KHV A;  1GUN A;  4HTH A;  2MPM A;  1Y1V B;  2F0T A;  5J1Z A;  2B2T C;  4J1M A;  2XWB B;  1OXX K;  4QUC A;  4H44 C;  1DM0 B;  1JIC A;  1C48 A;  2WKD A;  3PUX A;  1MD2 D;  3SVM A;  4KD3 A;  2F0D A;  1X32 A;  1STG A;  1Z47 A;  2OEO A;  2PW7 A;  4BBR B;  1WTR A;  4EQN A;  5K5P A;  1EY7 A;  1LTI D;  2NTS A;  1O78 A;  3RZO B;  1ZYR D;  1Y1W B;  3I4N B;  1ML0 D;  5F2D A;  3H3V C;  3IAY A;  3ONA B;  4RCN A;  1A3T A;  2ID0 A;  4QB4 A;  2XRQ D;  3M4Y A;  1ET9 A;  3IFT A;  2FFK B;  4HR7 B;  4KKT A;  1LTG D;  1NR2 A;  4IFD J;  2EY5 A;  4IAL A;  2XRS D;  1SYB A;  3NE5 B;  4FF1 A;  1HFN A;  2NN6 I;  4BY7 B;  1FGB D;  5J22 A;  2IX0 A;  3I8Z A;  2JE6 I;  1ENC A;  1BDO A;  4M1U B;  3T51 B;  3A56 A;  3WOF A;  3WDN A;  1STE A;  4BS9 A;  2A5H A;  2JXM B;  2PCF B;  1STY A;  4TSS A;  3HGB A;  4Y7N B;  1BNZ A;  1DXM A;  2M00 A;  4BA2 I;  1BCP F;  2F0P A;  2L1B A;  1B53 A;  1QNK A;  4XDX A;  3K0Y A;  2CW0 C;  1A6X A;  5DEH A;  1KAB A;  3J80 E;  3Q6S A;  3PUZ A;  4UDU C;  4C3J B;  3I70 A;  3T16 A;  2A6E D;  4H7B A;  3K5N A;  2GA4 B;  3U9O A;  4GZY C;  3J7A F;  4CHT B;  1V1P B;  3D4R A;  4N9T A;  1AN8 A;  3Q24 A;  1STN A;  4XIG S;  2FJ2 A;  2R61 A;  2EE1 A;  5M3M B;  4IN3 A;  3CRK C;  3PO2 B;  5IGE A;  5IT9 E;  4DAP A;  1Y8P B;  2QEJ C;  3S15 B;  3D8G A;  2QKI C;  3GD7 A;  1LTA D;  5IIF A;  1AZQ A;  2NTT A;  4ABN A;  5FLX E;  3DWQ A;  4FXK C;  2QF7 A;  5EGT A;  3A55 A;  1RTN A;  3HOW B;  4ILW A;  3S17 B;  3R8B A;  2F1M A;  4F87 A;  1F2L A;  3QG1 A;  5I4D A;  4J6H A;  2NVT B;  4CGY B;  1EY8 A;  4YIJ A;  2Y0S B;  1B2T A;  2E75 C;  3IFD A;  2J7Z A;  1HA5 A;  4A3F B;  1OXV A;  2RSO A;  1SJH D;  1DOL A;  3A8I E;  5JAV A;  3I91 A;  4S3S A;  2FIN B;  4G57 A;  4C3I B;  1CTM A;  4IUT A;  2DNE A;  1H9K A;  3SK5 A;  5M9O A;  4DNR B;  1PTO H;  2DY7 A;  3S1N B;  5CBA E;  2LY7 A;  4ZUI A;  1CI3 M;  1ROD A;  3GP7 A;  3HS0 C;  2E2I B;  4TKO B;  1ILP A;  2CVR A;  3GV3 A;  3TSS A;  1J8I A;  1ET6 A;  2VB3 X;  3M3Y B;  2EYO A;  1RJT A;  2LS0 1;  5TSS A;  1Y8N B;  2XVS A;  1HHV A;  5LL6 X;  2JYO A;  4IUN A;  1V8Q A;  4B9W A;  1G8Z D;  3HG9 A;  2R3Z A;  5D3I B;  3DUZ A;  3SHL A;  1VDZ A;  2F0M A;  1F9R A;  1EEF D;  4WRD A;  2EYH A;  2WP8 J;  2XSC A;  2ENB A;  4OO1 H;  1BCP B;  1SNQ A;  2F3W A;  1G2S A;  5ELD A;  1GUG A;  1PMR A;  3NQI A;  1SAP A;  1ILQ A;  3GTQ B;  2C9O A;  1JWS D;  2SOB A;  3I4L A;  4HN7 A;  4A3D B;  2ICI A;  3RMH A;  1UUP A;  4EQP A;  5C4H A;  5JVH 3;  2B8G A;  1EYD A;  5BN5 A;  1QIL A;  3HZX A;  1CA5 A;  3I90 A;  2L4N A;  3PUV A;  3C2P A;  3PUY A;  1B9M A;  2F0W A;  2E2D C;  1V1P A;  4QIW B;  2AQ2 B;  4CJ1 B;  5CV6 A;  5EPL A;  2HUG A;  1ZYR C;  3C46 A;  1PTO D;  1K8O A;  4C3J G;  5KYI A;  1ENF A;  3MXN A;  4V0B A;  3IL8 A;  1M4V A;  1X3P A;  1RKN A;  3VA7 A;  2AWO A;  1EY6 A;  1F9P A;  2WIN B;  2B2Y C;  5CV4 A;  4KN7 C;  1WTO A;  1QJO A;  1SFO B;  4DFA A;  4PMC A;  2K5Q A;  1CZW A;  1SE2 A;  2PZU A;  3FEW X;  2NBF A;  3GV6 A;  4ZQ3 A;  3MFY A;  1ESF A;  2YU9 B;  2NUC A;  3J7Y W;  1QOH A;  4RHR A;  2A6H D;  3K6O A;  4XYQ A;  5G3L D;  2JP1 A;  4DU9 A;  5EBD A;  2N55 A;  3OIP A;  3EQL C;  2K04 A;  1Y8O B;  3F2U A;  1RHP A;  2H1E A;  2JA7 B;  2AQ3 B;  1RF2 D;  1E0B A;  2A6E C;  1KAA A;  5COR A;  1W6K A;  2EVB A;  3I3C A;  4IUQ A;  5KRU A;  1CM9 A;  3N6R A;  5I6Y A;  1NUC A;  2KA7 A;  2IW3 A;  1TY0 A;  1LAC A;  1HPC A;  2H4O A;  1HRJ A;  2F3V A;  3VYS A;  2DY8 A;  4C3I G;  2A68 D;  2FMC A;  1Q8I A;  2EYF A;  1S5B D;  3AB9 A;  2VXW A;  2F0L A;  3T53 B;  4A3I B;  5I9O A;  4DXF A;  2Q8R E;  3KLS A;  3Q0A A;  1ICW A;  5ELF A;  1HXY D;  4RGO S;  1TWA B;  1LTB D;  5KEE A;  3J80 L;  1BO0 A;  2F0J A;  5C4Z A;  2BA1 A;  1KTK A;  3NWS A;  5JEA J;  5C5L A;  5FKA C;  1QG7 A;  2B2V C;  2AUJ D;  3GQB A;  1NAP A;  2R6G A;  4IQZ A;  4BWG B;  3S14 B;  2F03 A;  3EA6 A;  4M8A A;  1BR9 A;  2RDF A;  4Q5V A;  2K5D A;  2RSN A;  4CKB A;  1G6Z A;  5LL6 S;  5EPJ A;  2O2L D;  1JB3 A;  3URY A;  1WD0 A;  3K5O A;  5IT9 L;  5T1I A;  2VB2 X;  2F0N A;  1V43 A;  5D3D A;  2EYM A;  3LWU A;  3S2H B;  1JC7 A;  3P7J A;  4UAI A;  1SE4 A;  2CHB D;  3NQT A;  1TT2 A;  2F4I A;  4DAV A;  2AWN A;  3DHQ A;  4IZ8 A;  4IFD I;  4K5W A;  3A8K E;  4DK1 A;  3HP3 A;  1EL0 A;  1TWF B;  4PMB A;  3BDC A;  2NYZ D;  5JPM C;  2NN6 H;  4K6D A;  1IYU A;  2R7Z B;  2IX1 A;  5HGT A;  3C1F A;  1STB A;  2TSS A;  4AYB B;  4C2M B;  5J39 A;  4XQQ A;  5KNB A;  1G29 1;  4ZAI A;  1GHJ A;  2VNU D;  1K8M A;  1NR4 A;  4XYO A;  5CV9 A;  1AZP A;  1PTO B;  4XT1 B;  2DN8 A;  3K7A B;  1F2Z A;  4E6I A;  2F0Q A;  5E3F A;  1A2T A;  1KLG D;  3KBG A;  1VF7 A;  5EPK A;  2O5J C;  2MUY A;  3O13 A;  5FO8 B;  3K5M A;  1C4Q A;  2EY6 A;  3OIQ A;  5KIX A;  3BVM A;  1NCV A;  4U68 A;  1PTO C;  1STA A;  2QDB A;  2B2U A;  2PZW A;  1STH A;  1IKL A;  4F88 A;  1SE3 A;  4FYD A;  2EJM A;  1OXS C;  3ZYY X;  2K05 A;  5EQ0 A;  2K1B A;  4K5X A;  5CBE E;  1CT1 D;  2E2J B;  4LMQ D;  3R93 A;  1I4R A;  4OHJ A;  2PO4 A;  5BN4 A;  3PIP 3;  1F77 A;  3FPU B;  2FMM A;  3MWY W;  2EY1 A;  1TKW B;  1H9R A;  3Q22 A;  2A6H C;  3ERQ A;  1XYI A;  1TS4 A;  5C3W A;  4NW2 A;  1CHP D;  1MGS A;  5A2Q L;  4A3J B;  4A3K B;  3A7L A;  3D6C A;  4DGZ A;  1GUT A;  1H9S A;  2F0H A;  4CJ2 C;  2OF1 A;  2KUM A;  2F0K A;  1SNM A;  3DWP A;  3LNN A;  3MEH A;  5K36 H;  4MN3 A;  4K6L A;  1U4M A;  4DXG A;  1U4P A;  3HOX B;  2A68 C;  5C0X J;  4OGQ C;  1R9T B;  4A3B B;  3NTK A;  3MA2 B;  1FD7 D;  1E2Z A;  5CGK A;  4H13 C;  3MXP A;  2K6A A;  3NTI A;  3SK6 A;  1II3 A;  2F0G A;  3AMU A;  1DYQ A;  2RKS A;  4RGN A;  4N9P A;  2B2T A;  2D2C C;  1B50 A;  2J4X A;  3A54 A;  5EBC A;  4HAE A;  4KHZ A;  1HA6 A;  2HDL A;  4Z9C B;  2JEA I;  1I6V C;  1GHK A;  1WTW A;  4FP5 D;  3OPO A;  2KEE A;  4NDX A;  2MHV A;  3N52 A;  1K83 B;  1U4L A;  3TP6 A;  1J9O A;  1Z7T A;  4C1N K;  1JOR A;  2F0E A;  4TQU S;  1GOZ A;  4KJN A;  4RKB A;  4CBV A;  5EKL A;  4A3G B;  2F0O A;  2KJX A;  1KLU D;  4K14 A;  4RKL A;  1JWM D;  4DA2 A;  4C1N I;  4V19 0;  1U9R A;  4X3T A;  1LT3 D;  2AQ1 B;  2K32 A;  2SEB D;  5JEA G;  2HCC A;  1WTX A;  1IHZ A;  2K03 A;  1QNU A;  1X3Q A;  1S5E D;  4EVO A;  3HOU B;  1PRT D;  4JK1 C;  4RH6 A;  1SDF A;  2J0T D;  1KNA A;  1D2B A;  1TWH B;  5C3E B;  2BE5 D;  2OXP A;  4KD4 A;  3BDO A;  1PXU A;  4K5V A;  3S16 B;  1SXT A;  4P2C B;  4OIK A;  1PZK D;  1EU4 A;  4WJW A;  4ZLT F;  1BOS A;  3T4A C;  5I6W A;  1SYD A;  5BN3 A;  1EYC A;  2F0I A;  3TP7 A;  5CMD A;  2MJ8 A;  4QCL A;  3NK9 A;  4K8I A;  3KK7 A;  3A8J E;  3NWT A;  1B1Z A;  3BZD B;  5JPN C;  3I73 A;  1YNJ D;  2YYZ A;  2A69 D;  4RAU C;  5D14 A;  2ZXP A;  3D31 A;  3M4O B;  1D1I A;  2PNR C;  2SNM A;  4R8N A;  1D6E C;  2M9V A;  2L11 A;  2B2W C;  5FOB B;  1A3U A;  5CR3 A;  5C4X B;  1UNS A;  1PFN A;  4EQO A;  1Q12 A;  1I4P A;  3CU7 A;  2K7V A;  4X3K A;  1SYC A;  4BY1 B;  4KN4 C;  2K01 A;  4DAY A;  4H0L C;  5DM7 3;  1SJE D;  1PLF A;  1SND A;  3CKI B;  1EQT A;  5E4W C;  2L5T A;  5A2Q E;  1KDA A;  1SYE A;  4FXG C;  1WTV A;  1D1K A;  4KK7 A;  3BVZ A;  1ZEQ X;  3OMG A;  3HOV B;  1CFM A;  2D62 A;  4J8Q A;  2BOS A;  2LMC B;  5IGC A;  4NKL A;  4L63 B;  1EEI D;  1HTL D;  4KKU A;  1LT5 D;  3PO3 B;  4BA1 I;  5IGD A;  1QWY A;  3MFG A;  3E6Z X;  1A15 A;  4TRD A;  1DZ1 A;  1DJR D;  4ODG A;  3QOJ A;  4IUP A;  1WTP A;  2BDO A;  1HQM C;  2JA8 B;  5CC4 A;  1JR0 D;  2HDM A;  1PTO F;  3CRL C;  1D5Z C;  3OWF A;  4KY7 A;  2BA0 A;  1HUN A;  2E2H B;  3OWE B;  3EVQ A;  5NUC A;  1G91 A;  5C3X A;  2A73 B;  5C44 B;  1AW7 A;  2WAQ B;  2R93 B;  5FK9 C;  1EZ6 A;  2ZT9 C;  4X3S A;  1SNP A;  1B4O A;  3SDZ A;  2XN9 C;  4NP5 A;  4K2K A;  3BYT B;  2RDH A;  2F0F A;  4CJ0 B;  1WCM B;  3GTM B;  4R9W A;  3HOY B;  4IFD H;  5DNF A;  5KND A;  1FR3 A;  1GUO A;  3E0J A;  3NBH A;  2JEB I;  1QCB D;  1EWH A;  1M8A A;  1WTQ A;  3SEB A;  3GTO B;  1QE6 A;  3L7Z C;  5G3L F;  5EKK A;  2PMZ B;  3ITP A;  4I7Z C;  1OXU A;  2Z1C A;  3D4W A;  5ISR A;  1XX8 A;  3NTH A;  4OL7 A;  3W3A A;  1SMY D;  3RUZ A;  1I3Q B;  4KY5 A;  3VYU A;  1TY2 A;  2NVX B;  3FRP B;  2EPB A;  2EYJ A;  5HUR A;  1F9S A;  1Q1B A;  2ZXO A;  2K28 A;  3TP8 A;  5C0X G;  3R2T A;  4FF3 A;  3VA5 A;  1BF4 A;  2MGS A;  1PRT B;  2NVQ B;  1NSN S;  4C3H B;  1O80 A;  3DEP A;  2B2Y A;  1A2U A;  4QUF A;  4A3E B;  4FVM A;  3AU7 A;  3V05 A;  1LT4 D;  3FMC A;  1KNE A;  2KED A;  1BXT A;  4RWS C;  1S5F D;  2RA4 A;  3NPP A;  1EZ8 A;  4O42 A;  1I4H A;  1UEA B;  1RDP D;  3QJY A;  1PRT C;  3D3R A;  4HMJ A;  1Q3L A;  3TME A;  2F0V A;  2BE5 C;  4IUV A;  1TVX A;  2Z4H A;  4CKC A;  5M5X B;  4XT3 B;  4IUR A;  3U9S A;  5CV5 A;  5C5M A;  1B3A A;  3KUP A;  4LAA A;  1TU2 B;  2D5D A;  2R92 B;  2K33 A;  3GO5 A;  1LO5 D;  3KF8 A;  4ID6 A;  2I07 B;  3H09 A;  1S5C D;  1FNW A;  1E2V A;  2WV6 D;  3ND9 A;  2AUK A;  3VYR A;  1Q1E A;  2Z4I A;  1RD9 D;  2V4D A;  1YNJ C;  3DEO A;  2XNA C;  1CHQ D;  2A69 C;  4G7H C;  1JE4 A;  2NB0 A;  3GTG B;  4G7Z C;  1SYF A;  3MZ5 A;  3LWE A;  1DOK A;  4MIU A;  3S1Q B;  4RCO A;  4RA8 A;  1ONL A;  3KLS X;  3T56 B;  4WFN 3;  4Q0F A;  3QB3 A;  3OOC A;  2NZ1 D;  5C0X I;  2F0U A;  3MHB A;  2BCO A;  1SNO A;  5IGB A;  3UI2 A;  2TMP A;  3V2T A;  1UAP A;  3OW7 A;  5ELE A;  3K57 A;  2B2V A;  2L0C A;  1ZKO A;  1E2W A;  5ELB A;  1BCP D;  3DWA A;  3VR2 A;  1H9J A;  1OXT A;  3HEJ A;  4FNF A;  4JBW A;  3S9W A;  4F8M A;  1R4Q B;  4QMG A;  1PYW D;  1DD2 A;  3TZU A;  3WOE A;  4XTC S;  2EY2 A;  4A3M B;  3RLF A;  2EJF C;  3I72 A;  1BQQ T;  1TQO A;  4RGT A;  3NHH A;  4G7O C;  3J81 L;  2NVY B;  3MVV A;  1WD1 A;  1LT6 D;  3VR4 A;  2KCC A;  4DNT B;  3T13 A;  1TS2 A;  4LJZ C;  5E4X A;  4OIJ A;  5A35 A;  3MTS A;  2OT2 A;  2E76 C;  4NMZ A;  4F7X A;  3H91 A;  2G9H D;  3HKZ B;  2EDG A;  3K5L A;  5C4J B;  1WVL A;  1BUV T;  3R2I A;  4QF4 A;  1XWE A;  4HMI A;  2LKV A;  3H0G B;  1EOT A;  2EOT A;  1IYV A;  2PYK A;  3C1E A;  4O1N A;  1D5M C;  3M7N A;  3MXU A;  3BDL A;  5K36 G;  1O7L A;  2B39 A;  1B44 D;  1JWU D;  3RZD B;  2KHS A;  3S1R B;  1AFP A;  5KGU A;  4IUU A;  4C3H G;  1HTP A;  4LK1 C;  2I46 A;  5EKI A;  3FVQ A;  1CQF A;  4L8J A;  1YNN D;  1GXD C;  2L9H A;  3QO2 A;  2EJG C;  2N88 A;  4K8J A;  2PW5 A;  1ESR A;  2XIW A;  1FNU A;  4FF4 A;  4HSV A;  1CQV A;  1LTT D;  2IL8 A;  3PIO 3;  1HUM A;  2FHT A;  3GTJ B;  1SMY C;  1PZJ D;  1HFG A;  2SNS A;  3DM1 A;  5I9P A;  1TS3 A;  4KI0 A;  1MBY A;  1DON A;  1O7Y A;  3W2D A;  5DM6 3;  1V1O A;  5E1F A;  3TZD A;  3G7L A;  4L6T B;  1DCZ A;  2KOL A;  5IOD A;  3E5S A;  4FO2 A;  5CV8 A;  1H9M A;  3SR1 A;  4DK0 A;  3LX0 A;  3DMU A;  1F2Y A;  2C5C A;  4RHS A;  4ZYS A;  3IKJ A;  5IOC A;  1Z6H A;  1ENA A;  4PMW A;  5D65 A;  5JVG 3;  3VR5 A;  3BVG A;  1SSO A;  2BDN A;  2B63 B;  4B9X A;  1C8C A;  2WB1 B;  1IKM A;  1O7Z A;  3CHB D;  3JAM L;  1U4R A;  1LAB A;  2G9D A;  3NP8 A;  2HCI A;  5JJZ A;  1HQR D;  1GUS A;  4KY6 A;  1D5X C;  3RD4 A;  4RGM A;  1I4Q A;  5DAU A;  4K2L A;  2KEC A;  1EWC A;  2L55 A;  3R3O A;  4PV1 C;  5JEA H;  1SYG A;  2RBM A;  1EU3 A;  1JCK B;  4OO1 G;  3MXG A;  3C3L A;  5IGG A;  5IGF A;  5T1G A;  5C6A A;  1I4X A;  1PZI D;  1IW7 D;  5I2X A;  2X6G A;  5FO9 B;  4HSP A;  3X3N A;  2X69 A;  2IX3 A;  5I2Y A;  2L12 A;  3QOL A;  3P1H A;  4MHE A;  2Q8I B;  3NUC A;  3J81 E;  1PRT F;  3J7A V;  4HED A;  1MSH A;  2JSO A;  3OMC A;  4ZK9 B;  1SBB B;  5FO7 B;  1XXG A;  1GJX A;  1T5X D;  1EFI D;  3TDQ A;  1SEB D;  3KBX A;  1AP0 A;  3K58 A;  4HCE A;  2QIL A;  1TWG B;  2RDG A;  2RQX A;  3A7A B;  2WAC A;  1BCP C;  3PMF A;  5CV7 A;  1VMP A;  1KDC A;  3ND8 A;  1S4Z A;  2WKC A;  4HCS A;  5EJW A;  1R4P B;  1BBX C;  1EY9 A;  2WII B;  2O5I C;  4ME5 A;  1EY0 A;  3Q23 A;  5CYU A;  4BBS B;  2IT1 A;  4XQN A;  1RTO A;  1F2M A;  1VMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...