3RD4A

Crystal structure of propen_03304 from proteus penneri atcc 35198 northeast structural genomics consortium target id pvr55
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
76
Chain Sequence
APVKLYMVEVIDKKEIAANEITHYYQVTFRLTTDDRKDLVLNIDKSSYQNIEPEMKGRLFMQGSRFVQFETDVPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of PROPEN_03304 from Proteus penneri ATCC 35198 Northeast Structural Genomics Consortium target id PvR55
rcsb
source organism Proteus penneri
molecule tags Structural genomics, unknown function
total genus 11
structure length 76
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rd4A00
2L0CA 3RD4A
chains in the Genus database with same CATH superfamily
2NYZD 5KNDA 2NVYH 2EVBA 2KEDA 1LABA 4DNTB 1PV4A 3Q22A 1B44D 1ENAA 4JK1C 1ILPA 4GLXA 5I6YA 3D31A 4QF4A 2CWPA 1O7IA 3MXNB 2DGYA 5I2YA 1LLRD 1D1IA 2MO1A 4UP9A 4B08A 3H91A 5M5YH 2UXDL 1HUMA 2AUKA 3Q23A 1KAAA 4N8X1 2VZAA 4IFDI 1PFNA 1L2FA 1BCPC 4BBRG 2HQLA 4TQUS 4RKLA 3A55A 2Z0SA 4IFDG 2NTSA 2E2JH 1DCZA 3HOXG 2F0MA 3FPUB 1AE2A 5FKAC 4K6LA 4X66Q 3F2CA 4GS3A 2O5IC 4FO2A 1CI3M 2B63H 4R4OA 1VQ6A 1N33Q 2R6GA 2B3GA 2ZTEA 1WI5A 3J7A5 3P1HA 4QL5A 1PH6A 3OPOA 1BCPD 3BDOA 4OELB 3VYSA 1SROA 1GHKA 2IWHA 2KHSA 2F0LA 4WFN3 3GTOB 1CHQD 1N9WA 1X3PA 4IUNA 2M9VA 4CDCC 1LT4D 3RZOH 2YV5A 3OW7A 5ELFA 3CQZH 4X66L 1K8AC 2EQSA 2AQ2B 2DUDA 1T5XD 5IWAQ 1N33L 3OSOA 2A1AA 4BXXH 3S1MH 3VDYA 1AZPA 2VUMG 4DR6Q 1K8MA 4OO1H 1SJED 4DU9A 4ZLTF 1A2TA 2Z1CA 3KUPA 5FJ8G 3MXNA 5HY6A 3TEHB 5CV9A 2DJFC 1HQMC 3H3VI 4AYBE 3OHXC 2BE5C 4HCEA 5JVH3 1TWGH 1JJGA 4JPBW 4RA8A 5FLMH 2XRQD 5IODA 5IWAL 5CV8A 1Z9FA 5K36G 1TWAH 2K5DA 1JWUD 3RZDH 1X3EA 4DR6L 1I4PA 3CRKC 4G4KA 1GO3E 4JOIA 1EQRA 1VMPA 2NVYB 1LV9A 2EPBA 2IPKD 2BE5D 3SHLA 5M5WB 1STNA 1NMFA 4HJ9A 2F4VQ 1R4PB 4K6DA 1YIJA 2F0WA 1SE2A 1PZJD 4K14A 4DR7Q 1V1PA 1F2ZA 4NB3A 3RR5A 3PO3G 3QWNA 3PIO3 2YTVA 4A3JG 3D4DA 5M5YB 5M3MG 5ELOA 1I4GA 1HTLD 4BBRB 4M1UB 2LFNA 3MXUA 4GN5A 4XT1B 4KN7C 5D3IB 5IYBH 2E2JB 3IFDA 2F4VL 4A3KH 1CT1D 3MEHA 4DR7L 1M90C 3CF5A 3VR4A 1N32Q 3VR6A 2B63B 2K5VA 1D2BA 1EY9A 3FP9A 2R7FA 4KY5A 1TWFH 3S15B 1B4OA 5LHY1 3QO2A 1H9SB 2K5QA 2OTJA 1XJVA 4KY6A 2I07B 4HN7A 1UE6A 1C9OA 3RZOB 3JAME 1TU2B 5C4JH 3ZYYX 2XNAC 4DK3C 1N32L 4JBMA 5JVG3 2VQEQ 5IYCH 2NB0A 2BH2A 5GAHC 2JE6I 3S1MB 1SYDA 3OW2A 1PDQA 1J8IA 1CSQA 1KL9A 4CJ0B 1E3PA 4DV3Q 1DJRD 1V1OA 2LXJA 5C44H 4J8QA 1JE5A 1QB5D 2WAQG 1RF2D 4C3HG 5C4XH 4RHSA 1ASZA 1TWGB 1TWCH 3Q6SA 1VQ4A 3PQIA 4KKSA 1BNZA 1BKBA 3PUYA 3CU7A 4I65A 3R93A 4S3SA 1W2BA 2VQEL 1GHJA 4IUPA 4LJZC 1YJWA 2MFIA 1AP0A 1E22A 4JOIC 3RZDB 4RGNA 1UWVA 2M2LA 2B39A 4DV3L 5EJWA 2OQKA 3BG3A 5D65A 1PXUA 3AU7A 1H9SA 4MHEA 3A0JA 3FEWX 2Z6BA 1HRJA 5DLQE 3A7AB 2FINB 3PO3B 2K4KA 4EQNA 2N8NA 3S1NB 5ELBA 5J22A 1JT8A 4PG3A 4A3JB 2L0CA 2Z8LA 3K8AA 2AQ1B 4DAYB 3J81L 4IOCA 5M3MB 1QG7A 1JWMD 4DAMA 2F3IA 1V8QA 2K28A 3V96A 4LFAQ 2ASBA 2G5DA 4DUYQ 3W1BA 4A3KB 2CVRA 5IYDH 3QJYA 3K5LA 1KQSA 3WOFA 5GAGC 4KTAA 3KF8A 1EOTA 1TWFB 4ZKBB 2K7VA 3KF6A 4HMIA 3I3CA 1VDZA 3GDEA 2D9UA 1VF7A 2MJ8A 3J80L 2RDHA 1WTHA 1E7ZA 1GUOA 3BVZA 3RLOA 2XIWA 3C1FA 3EBEA 1ICFB 1R4QB 4A76A 4KN4C 3HOWG 3ER0A 2O4XA 2WB1G 4K8JA 3MA2B 1NSNS 4DUYL 1LYLA 3A5UA 1NTGA 1QZHA 4JG2A 5C4JB 1X3FA 3MHBA 1SNDA 1Q8KA 3NTKA 2D0PA 3OTOQ 2YU9H 3UE0A 1TS2A 3I4MH 3W2DA 1DONA 4F87A 3MAQA 5KEEA 3TP6A 1SYCA 1GVPA 3FHWA 5C44B 4DAYA 2B2UA 1M4VA 1YNJC 4JI5L 2VY3A 4B3MQ 1E2WA 5C4XB 3C3LA 4QJFA 5CV6A 2I5LX 3STBC 4KHZA 2KJXA 1TWCB 4A3FG 1NJIC 5JEAG 3KOJA 2TMPA 1GOZA 1Q82C 2SEBD 3OTOL 4R4CA 5GROA 2AKWB 4GLAC 4FNFA 1NR4A 1STEA 2DY7A 2RCNA 1GUGA 4ZYSA 1WTWA 3W3AA 3TS0A 2RDGA 1YNJD 2RHSB 1CQVA 4QGUA 3STBD 1Q8IA 4B3ML 1AH9A 3J81E 2EYLA 5CGKA 1HZ9A 2ZT9C 1QOHA 3MXPA 4XIGS 4HEDA 5M5XH 3GTGH 1SMYC 4GLVB 5JOBA 4QUFA 4U68A 4A93H 1PTOC 5C6AA 1Z47A 2KCMA 2EZVA 3S2HH 1XX8A 3NENA 3I4LA 2VW9A 5JAVA 2O2LD 3D6WA 2WKCA 1XMQQ 3BZDB 4POGA 3KLWA 1EYDA 1XXGA 4DV5Q 1UEAB 4DPGA 3R2TA 2JA8G 1S5CD 2C9OA 1D8LA 1SMYD 3NWSA 3J80E 3ULLA 5IP9H 1PTOD 3GV3A 5I9PA 2D62A 1R9TH 3K5OA 3K57A 1FJGQ 3HOYG 1K83H 3CAMA 1QUQB 2HUGA 1ONLA 1XMQL 2J0TD 2F0PA 5J39A 3D0FA 2L9HA 4EVOA 1U4MA 2PNRC 4DV5L 5FK9C 2VNUD 2ES2A 2NWGA 5LL6X 2PYKA 4L63B 1SEBD 1VQ8A 4IOAA 1GKHA 4GKJQ 4IURA 1CUKA 4KHPQ 5AJ3Q 4A3EG 1XNQQ 1M8AA 3PO2H 2A73B 2D0OA 1W6KA 4RAUC 3I4MB 4J6HA 2HT1A 3P75A 5IGGA 4IALA 1FJGL 1ILQA 4JVZA 4DXFA 4Z9CB 2BDOA 3CHBD 4CHTB 1LTTD 1HZCA 1EY5A 2CQAA 2JJQA 1Y1VH 3ND9A 3J7ZC 1SNMA 1NR2A 1K8GA 1BBXC 2EJMA 2ID0A 4JBWA 3P7JA 1VQPA 5ELCA 4KHPL 4G7OC 1XNQL 4R4IA 4IPDA 2D2CC 3I4NH 1AZQA 3M4PA 5DM73 5C0XI 1JMCA 4A3GH 5JEAJ 5C4HA 3E9IA 4A4IA 2LKVA 3RN2A 5C0XG 1W3SA 2EY2A 5CR3A 3D8GA 1BCPB 4B3SQ 4A3CH 1A8VA 4A3BG 2RSNA 4FXKC 3CCSA 1LACA 5M5XB 3GTGB 4HIKA 2QA4A 1KNAA 4K8IA 3S2HB 1EWCA 5ELDA 3NHHA 5I6WA 1XMOQ 3PV0A 1NUCA 2CW0C 3JAMc 4K2LA 4EGVA 3KBGA 2AHOB 1I4RA 2WIIB 3MFGA 1EOVA 4HIDA 1JJ2A 4LUVA 1JCKB 4HTHA 1WCMG 1HR0W 1LTLA 2KA7A 4B3SL 1CZGA 4C3JH 2WAQE 4Q5VA 5EBDA 2JA8B 1GD7A 3M4OB 2E2HH 4LF5Q 1GUWA 4BWGB 2RQXA 5G3LD 1B70B 4F7XA 1R9TB 3A7LA 1K9MC 1IL2A 3L9AX 4MZ9A 3I72A 3CKIB 4ID6A 1KIXA 2CW0D 3HOYB 1II3A 1XMOL 1GUTA 1U9RA 1FGBD 2G9HD 1ESRA 1Q1BA 1O7YA 4JI6Q 4QUCA 1KHIA 1XPUA 1CSPA 2ZM6Q 4UPAA 5BR8Q 3HS0C 4O42A 4LF5L 1IBLQ 1I3QH 1QCBD 1BVSA 4H0LC 1EY7A 3ITPA 1WTQA 5LMNW 5JJZA 3HGBA 2LS01 3DMUA 5E4WC 3GTMH 1Y1VB 3PUWA 1AN8A 1I50H 4JI6L 3OMCA 2WKDA 5EBCA 2ZM6L 3DEPA 1G2TA 1HZBA 1H9KA 1F77A 1TT2A 2L12A 1VQOA 1NY4A 5KGUA 1FR3A 2V1CC 5IGFA 3I4NB 3R8BA 4ALPA 1PZID 3VYTA 3EVQA 2R61A 4A3GB 3S14H 4YY3L 3BS1A 4LF7Q 4WJWA 2D5DA 4KHVA 4A3MH 2B2VC 1L0WA 1ICWA 3AFPA 2QILA 2HHHQ 1RHPA 1B7YB 2F0NA 2WB1E 2RSOA 2E2DC 2R92H 1YNNC 1GUSA 1EIHA 4P74A 2EJGC 4XTCS 3W5OA 1A3VA 2KOLA 5IP7H 3I4OA 1LTBD 4C56C 3UDGA 1SYFA 4KK7A 1OTCA 3A8JE 4LF7L 1N34Q 1G2SA 2UXDQ 4DNRB 2DN8A 1UEBA 4C3JB 2K14A 2HHHL 1BXTA 1PH7A 2E2HB 1FL0A 1CK1A 4KKTA 2F03A 3M4YA 1SRUA 1EEFD 3TS2A 3J7YW 4HIMA 3U58A 2JA6H 2FFKB 4K5XA 4HJ7A 1KNEA 4DFAA 2NN6H 1N34L 3BYYB 4ABNA 3F2DA 3RLNA 2KENA 3TQYA 1VQ5A 1QNUA 4YWLA 1STAA 2AMCB 1H9RA 3E6ZX 3OWEB 2K05A 4PNYA 4RCOA 3SK8A 3CCRA 2L15A 2NZ1D 2B63G 1K0RA 1VQGA 4DKAC 2PI2E 4O0AA 1F9PA 3KLSX 3J81c 1DM0B 2JA5H 4KD4A 3V2TA 1HTPA 2E2IH 3K0YA 4LFCQ 2EXDA 4YCVA 4DR2Q 1PFMA 4EX5A 1PLFA 3K5MA 2N49A 2BA1A 1V1PB 1A2UA 2F1MA 2HCCA 2Y0SG 4IFDH 1OXSC 1WD1A 2EYMA 4YCWA 3GTKH 1KLUD 4XYQA 4GZYC 4EQOA 1TY0A 4NKLA 5C3EH 3H09A 2MGSA 1PTOH 3DXJC 1G91A 2BH8A 3BZCA 4H44C 3I90A 4BXXG 4OO1I 3RLFA 3J80c 4LFCL 4OIKA 1L1OC 1PFSA 4DR2L 3JAML 4OO1G 4JI7L 3ONAB 2SNMA 4DK1A 1KXLA 1CA5A 2R92B 3J81j 3K80C 5I2XA 3BDLA 1SYBA 1EY8A 3HKZB 4DA2A 4PMWA 2XTIA 3JAMi 2YTXA 4KD3A 1Y8PB 4RGOS 2R7ZH 4LF9Q 5FLMG 1SR3A 1E0BA 3HRZC 2NVXB 2IX0A 3GTQH 3E0EA 5EGTA 1YJ9A 2UUAQ 2ZJQA 1PH2A 4R8NA 3M3YH 4L8JA 3IRBA 3K7UC 1WTOA 3T53B 3I56A 2MHVA 1XPOA 1Z7TA 2CFMA 4N9PA 5GADC 4BY7H 2MPMA 5T1GA 3CPFA 1XWEA 1VF5C 3KDFA 1PRTC 3G48A 1CA6A 4LF9L 4QMGA 1K73C 1KRSA 3A8IE 2VS1A 3K7AH 2Q2TA 1PYSB 2F3WA 2KCNA 2SNSA 2UUAL 1FGUA 2F0HA 3EIVA 1MKHA 2KEEA 2F4IA 4NPSA 4P75A 4RHRA 1WTVA 3I73A 3MVVA 3HOUH 3VR3A 2L4NA 2TSSA 1QWYA 3IAYA 4QIWE 1JC7A 1HJPA 4A3KG 4KV6A 1PRTD 4C3IH 2EYOA 4LF8Q 1EQQA 3A74A 1Q86C 4TSSA 1F9RA 2K5HA 2VB2X 4DK0A 4IJHA 1WTXA 4OX9Q 1BBWA 4XXEA 2JA5B 2E2IB 1DOKA 3T16A 3LX0A 3C2PA 2ALYB 2JYOA 1BUVT 1Q81C 1D7QA 4NMZA 1IYJB 2OEOA 3CCUA 1JJCB 2Y0SB 1VQCA 4V0BA 3I8ZA 4OL7A 1WTRA 1N8RC 3GTKB 3ND8A 4PZ7A 3GQBA 5M9OA 1HFGA 1RJTA 3AYHB 3I2ZA 2FHTA 1IBML 4C2MH 2FXQA 4LF8L 5C3EB 3CQZB 2PW7A 1PTOB 4UY8C 5IYCG 4RKBA 1B8AA 1V43A 4OX9L 1LTID 4P73A 3H0GH 3K6OA 4FVMA 1U0LA 4NDXA 3QG1A 3SXHA 2VQFL 2JN4A 4YCUA 4DV4Q 2UXBQ 4X62Q 1X3QA 5C44G 1EIFA 3CMEA 1JE4A 1CZWA 3PIPA 5JJIA 2GVBA 3KF8B 5EKKA 4EQPA 5C4XG 4DR4L 1FNWA 3KF6B 4B3RL 3IL8A 3EROA 2R7ZB 1DXMA 2I5HA 4NP5A 5BN5A 4IN3A 5E3FA 1JB7A 3GTQB 1TWAB 4JI4Q 2O5JC 3C1EA 2RA4A 1S5DD 3M3YB 4DV4L 2UXBL 3CCQA 3EFXD 4X62L 4ZK9B 4LMQD 2JA7H 1UUPA 2X69A 4XQJA 4CKEA 1CKOA 4GNXC 4ME5A 4BY7B 5EPKA 3X3NA 4IUVA 3KFUA 2PQAA 4A75A 3K7AB 2B2WC 5IT9c 5CBAE 2Q2UA 5LMUQ 1EL0A 4LAAA 4JI4L 3BZKA 3FKIH 1LM0A 1F9SA 1AFPA 2KHIA 3FDTA 4A3DH 1OXTA 3HOUB 2UUCQ 3J81i 2JEBI 1J5EL 4C3IB 5IYDG 2VXWA 5KIXA 4JCVE 5IGDA 4BBSH 2WACA 2QGQA 1RDPD 3V05A 1KAWA 4P2CB 4CJ1B 4PQXA 3G71A 5HGTA 5LMUL 3URYA 3GTPH 3U9SA 3E3XA 2C5CA 5IE8A 2K50A 2H4OA 4H13C 1W6JA 4KY7A 5C5LA 5IGEA 5FOBB 5E7NA 5ELEA 3HZXA 4JI5Q 1Y1WH 4Y7NH 4APVA 2A8VA 2UUCL 1KDAA 2CH4W 3MZ5A 2F0UA 2B2YC 4C1NK 4C2MB 3QB3A 3J80i 2XSCA 2EXZA 4LK1C 3IFTA 1OXXK 3H0GB 1TS5A 4UHVA 4B3TQ 3I4MG 4JI2Q 3I91A 1RKNA 1EY4A 1JOQA 1S5FD 1SMXA 5EKIA 1PH8A 4L5RC 2XN9C 2UUBQ 4GN4B 3DM1A 2F0QA 2ZTCA 4X65Q 3PF4A 4JI0L 4PZ6A 1VQAA 2CH4A 2IJ0A 3HOZH 4JW0A 1SYGA 4FF1A 2A68C 1B53A 3SK4A 3GTJH 1HHVA 1KDCA 1XPRA 4B3TL 3BJUA 4JI2L 5L37A 1G51A 3AQQA 1B3QA 1S5BD 2G9DA 1UE1A 2JEAI 1I4QA 4FDBA 3SR1A 2Y0SE 2JA7B 4DAVA 2UUBL 2QW7A 2H1EA 4X65L 3AMUA 5KNCA 3EQLC 3AFQA 1YHBA 2A68D 4BA2I 1HA5A 1SE4A 1VQEA 3JC66 4ZRZA 4BY1H 4C1NI 1B2TA 3Q0AA 4A93G 3G7LA 1BCPF 1PH3A 3N6RA 3TZDA 1QZGA 3FKIB 2PZWA 2ZXRA 2KHJA 1B50A 2MNAA 3PGZA 1LUZA 1K28A 1V9PA 3T1YQ 4A3DB 4A3LH 3QOLA 4J15A 3S1QH 1A15A 1RIPA 5T1IA 4RCNA 4OGQC 1WFQA 5JPNC 3E0JA 3T4AC 5IP9G 3S9WA 1JOOA 4BBSB 4Q0FA 2OT2A 2FMCA 3B6YA 1TS3A 3RD4A 4OWWB 3LWEA 5I9OA 1Q12A 1IBKQ 2P5ZX 4HR7B 1EY6A 2KVMA 3T1YL 1D5ZC 4YIJA 2R93H 4DXGA 4ODGA 5FO7B 4H7BA 3M85A 1K3BC 4Y7NB 5CMDA 1KLGD 1A63A 1FNUA 3CD6A 1TWHH 2AUJD 1VMCA 3PIOA 1BBUA 1SDFA 1TQOA 3H3VC 2F0FA 3VYRA 3N52A 5DNFA 1VQJA 1O80A 2KCTA 4IJLA 2IY5B 4AH6A 1YNXA 4L5QA 2YU9B 3RUZA 4FF2A 3DLLA 1JQYD 2QDLA 3K58A 4E6IA 2AWNA 1ZKOA 2H5XA 1IBKL 3KJPA 3TSSA 1MI2A 3CRLC 1O7ZA 1Y1VG 5M3FH 3KLRA 3CXCA 1YHQA 1P8LA 4ZUIA 2KBNA 4AYBG 1A3TA 3A56A 3NSWA 4HIOA 1JR0D 3TRZA 1VQFA 1B9NA 1G6ZA 2KUMA 3A54A 3NXWA 1VQLA 3T1HL 3I4NG 4QQBX 2HIXA 4F8MA 3CMAA 1SAPA 4HMJA 5IT9L 5JJKA 2EY1A 3K81C 3CPWA 4A3GG 4IO9A 1VQDA 1MSGA 3L0OA 3SEBA 1SN8A 2QKIC 1VQMA 4CKBA 4CBVA 4LW1A 1KABA 4A3CG 2B2VA 2K6AA 3EN2A 4UP8A 5FO9B 1HNZQ 4BY1B 3NBIA 1PH9A 4A93B 3PUXA 2PZTA 4GKKQ 1KRTA 4PMCA 5DEHA 1D5MC 3U4ZA 2E5LQ 3ICEA 4O1NA 1X55A 5C3XA 4RFBA 1K3RA 3QR8A 1U5KA 4KJOA 3CCMA 1LO5D 3FVQA 3HFZB 4C3JG 2K03A 2V4DA 3TN2A 3PUZA 4G57A 4A3IH 5CV4A 1HQRD 4RGMA 2CQOA 1EEID 1U4LA 1HNZL 1KDBA 3G6EA 2K1BA 3RNUA 2UU9Q 5EKLA 2Z6KC 1STYA 2LSSA 1HZAA 1WYDA 3S1RH 4GKKL 2NVTB 2F0VA 4HJ5A 1K83B 4PMBA 4X3SA 1PFBA 2E5LL 1AEXA 4ULLA 1B1ZA 2YTYA 3PSIA 1BO0A 1F9QA 5I4DA 1SSOA 3FRPB 2N55A 4JI3L 1K8OA 2F0EA 1TWHB 3I7FA 5CV5A 2K33A 5D14A 2QDBA 1SBBB 1SNOA 1QNKA 3PO2B 3F2UA 1Z6HA 1SXTA 2UU9L 4O2DA 3F2BA 4AQYL 1CQFA 5FLXE 3CC2A 2BA0A 4YY3Q 4JV5Q 1EQTA 3A8KE 1I5FA 5M3FB 1PYWD 1EFWA 1EZ6A 4AYBB 3DM3A 3GTLH 1STGA 5IT9E 3MC0B 5EPLA 3MFYA 1NCVA 5KYLA 2BCOA 3OMGA 3WOEA 1S4ZA 4AIMA 2OXPA 4X3TA 4MTKA 1VQKA 4XT3B 3GO5A 4RH6A 2CWAA 4JV5L 2DNEA 4ME3A 4A3MG 2I5MX 3UDFA 1I6HH 1IYUA 2EY5A 3SK6A 1ZYRC 2R3ZA 5CYUA 2R92G 4LUZA 1L1OA 3S2DH 1HA6A 3HKZG 3ERQA 4QY7A 3X3MA 4HSVA 2J7ZA 3C46A 1RL2A 4CDDC 4GOPA 3NE5B 5IP7G 2N88A 4TRDA 1HPCA 4OEMB 3DWAA 3CW2C 1RTNA 2OTLA 1VQIA 1EYAA 1ZYRD 3FPPA 2NVQH 4LWCA 5C5MA 2E75C 1MBYA 1V1QA 2JP1A 2RHQB 3MEFA 1VS0A 4A3IB 1LTSD 4I7ZC 2EYPA 3I55A 2XRSD 4JI1Q 5KRUA 3S17H 4LF6Q 2NZHA 3HOVH 4H02A 1S5ED 1E2ZA 2VL6A 1Q3LA 2CKZB 2JA6G 2NN6I 1YHAA 3S1RB 2RVLA 2JK8A 1M1KC 4LF4L 2B2TA 1Q90A 2NN6G 1ET9A 2F0JA 1JORA 1Q7YC 4IUUA 3DEOA 1QILA 4GN3B 2GVAA 5M5WH 4X3KA 5DAUA 3ULPA 1HXYD 1NMGA 3U9OA 2B8FA 1MHWC 5D3DA 1I3QB 4DNIA 2EJFC 1HNWQ 3LGJA 1RCVD 2XWJB 3NP8A 4JI1L 1GJXA 4LF6L 2IL8A 3L3OC 4YWKA 5HURA 2MP1A 2WP8J 1A3UA 2K01A 2M00A 2JA5G 4KJNA 4QCLA 3BDCA 1VQNA 1C48A 2MO0A 3GTMB 1PVOA 1I50B 3P20A 4IUQA 4JI7Q 3S24A 5EPJA 4BBRH 1Y8NB 4TVAB 3GTLB 4IPHA 5COYA 3NWTA 3GV6A 2CHBD 3KDFB 4B9WA 1HNXQ 2PZUA 3HOXH 2IT1A 2Q8RE 4GNXB 4DR3Q 3NTIA 3HEJA 1HNWL 1P16A 2F0KA 1KC8C 5C3EG 2A74C 3TP7A 3NEMA 4FF4A 4JYAQ 2NVTH 3S14B 1DOMA 2F0GA 2RKSA 4R1JA 3S15H 3EJIA 1X9NA 4A3MB 3HG9A 1U4RA 2K5WA 1GM5A 1I6HB 4IUTA 3CC4A 1PTOF 1LTGD 1YITA 3L7ZC 1DOLA 3NBHA 1O7LA 4QB4A 4GOPC 1HNXL 3S2DB 1LTRD 1SJHD 1D1KA 1IXRA 3EA6A 4DR3L 2ZXPA 1HH2P 1TS4A 4FXGC 4XYOA 4IPCA 5ISRA 3T51B 4HAEA 2R7ZG 1T5EA 3Q24A 4JYAL 1JB3A 2UXCQ 1MIUA 2VUMH 3TDQA 2BDNA 2EYFA 4NW2A 3PCOB 4DV2Q 2F52A 5ELNA 4OWXB 2NVQB 5FJ8H 1JWSD 2HCIA 1E1TA 2EE1A 2F3VA 1F2LA 3H15A 1UE7A 2Q8TA 1X3GA 2VB3X 4WJ3M 1LT3D 2IX3A 3K5NA 3S17B 1TKWB 3H3VH 4XQQA 3H6MA 3HOVB 4BY7G 2B2TC 3AB9A 3F8TA 2R7DA 5F2DA 5IGBA 2JA6B 2ICIA 2OCEA 1BR9A 4K5VA 5CC4A 4GNXA 4MTNA 5K36H 2SOBA 4DUZQ 2UXCL 2EDGA 1U4PA 3OWFA 3E5SA 3NTHA 3NELA 1EIYB 1LT5D 2F0IA 2DY8A 4B9XA 2B2WA 4DV2L 2XVSA 3QOJA 5NUCA 3VA7A 3HOUG 1XTDA 1D6EC 3I70A 4R9WA 4CGYB 5IYBG 2PW5A 5C4ZA 1IKLA 4C3IG 1IBMQ 2NBFA 4HJ8A 3PO3H 2EYJA 2RBMA 1SE8A 4IPGA 1YJNA 3S1NH 1VQ9A 3KK7A 4A3JH 3K59A 4DUZL 5A35A 1S3OA 3WDNA 5M3MH 2IHFA 1WOCA 1J6QA 2WFWA 1C0AA 2Z4HA 5J3BA 3CP0A 5E4XA 3HOXB 1PH4A 2PQAB 1ET6A 1OO9B 4DR4Q 1X32A 4OIJA 4B3RQ 3SK5A 2FJ2A 1PH1A 2F0TA 5CV7A 1X65A 5DM63 2YYZA 4IFDJ 5CORA 1Y69U 1BQQT 2B29A 2B2YA 3T13A 1L0XB 2WINB 2HD3A 1LTAD 3ZJYC 3BYTB 3H0GG 5J1ZA 5IGCA 1IW7C 4M8AA 1TY2A 2OQ0A 3CCEA 1H95A 1ASYA 5G3LF 4POFA 4KMUC 3M4QA 4HJAA 2ZJPA 1K0SA 2F0OA 2HDLA 4R4QA 2I46A 3DUZA 1E24A 1EZ8A 3OIQA 2IW3A 4KKUA 1C8CA 2VUMB 1EFID 2A19A 1IW7D 3GD7A 4FXDA 1VQHA 4G7HC 3OIPA 5FLXc 3TP8A 2JA7G 4C3HH 3AEVA 1IYVA 1B3AA 1J5EQ 3WWVA 1TVXA 4MN3A 1SLJA 4L5SA 2QEJC 1PZKD 5JPMC 3FKIG 2Z4IA 3SDZA 4DGZA 2HDMA 1E1OA 4EQ5A 4DV6Q 4A3DG 3H94A 1EYCA 1EY0A 4P72A 4CDEC 2LMCB 3K0XA 2FMMA 1FNVA 1NAPA 4IQZA 3HKZE 3R3OA 2PQEA 4ZAIA 1IKMA 2L55A 4BBSG 4ZQ3A 3CCJA 3UDIA 3NUCA 1J9OA 1I94Q 4G7ZC 1H9JA 1WD0A 3MXGA 5E1FA 2K32A 4UP7A 1PYBA 4TKOB 3KBXA 4DV6L 2F0SA 1ENFA 1EU4A 5EAYA 1Y1WG 2PMZB 1YBYA 1YI2A 4JI0Q 1HFNA 5IY0A 1T9HA 1VQBA 4CKCA 1S40A 3M7GA 3G4SA 2QCPX 4N8FA 3S16H 2GA4B 4LFBQ 4JBKA 3NQTA 1I94L 1VCIA 4BS9A 2ZTDA 2SDFA 4LFAL 2AQ3B 2ATWA 3HOWH 1WVLA 2PNHA 1SE3A 3U4VA 4DAPA 4R4TA 3DHQA 1TR5A 2Q2IA 4DN4M 1X54A 3HOZG 2RF4A 1EUJA 4X6AH 1MSHA 1Q46A 3G6JB 2NTTA 1EU3A 4FP5D 4RMFA 3A5ZB 4LFBL 2GN5A 1QJOA 2OWOA 1QE6A 1WJJA 1EWIA 2PO4A 5H1SE 3OYYA 1H9MA 3F1ZA 1XYIA 2WAQB 3ERSX 3DWPA 1I6VC 2QEXA 3NPPA 4C3HB 3TP5A 2K52A 5HGQA 4A3FH 5JEAH 4I7AA 5K5PA 4BY1G 4ZCKA 1UAPA 1UE5A 1STHA 4J1MA 3NK9A 4IZ8A 1PMRA 4A3LG 1YZ6A 2EOTA 2KQ3A 2IHEA 1CHPD 4X3UA 4ZUJA 1PHJA 4P71A 1HUNA 2RCFA 1CKNB 1KD1C 2ICEC 4ZKCB 2A5HA 3LNNA 4DR1Q 1WTPA 2C35B 2QF7A 4K2KA 3GTPB 3SVMA 2L1BA 1RODA 2L11A 1PA6A 3PF5A 2E76C 1MJEA 2NUCA 2Q8IB 2ZJRA 1ENCA 2Z6KA 1DYQA 1X6OA 1IL8A 1X56A 2R93G 1CM9A 1RTOA 1Y1WB 3MWYW 2JA8H 3M4OH 1OXVA 1Y8OB 1OXUA 5GQOA 1G291 4YHHQ 4NXNQ 2K75A 4DR1L 3T1HQ 3PO2G 2DNCA 1N36Q 3S16B 4MIUA 1C7YA 3HOYH 4OWTB 1KTKA 1I4XA 1Q1EA 1YEZA 2X6LA 1JICA 3HOWB 1CKMA 1I4HA 2WB1B 3D4RA 2XGTA 5M3FG 5FLXL 2KCCA 4KI0A 1GXDC 3J7AF 3NQIA 2X6GA 4RG1A 4LUOA 3TREA 4DK6C 5GAEC 1DGSA 4CDFC 2RDFA 4A3EH 3HP3A 3M7NA 3HOZB 4NXNL 4YHHL 2IX1A 4PZ8A 3GTJB 1N36L 3L2PA 1SYEA 2HQEA 2B2UC 1BF4A 2CCZA 1CKNA 3TZUA 1SNQA 3T56B 3RN5A 1HCZA 5CBEE 2N3SA 2Z9HA 2A6EC 4XQNA 4PV1C 1PRTF 2MUYA 3UDXA 1QVGA 2JXMB 3BVGA 1A62A 1SNPA 4A3FB 1ESFA 2PMZE 4GKJL 1RD9D 4K0KQ 5AJ3L 1E2VA 3KYHC 3M9BA 3KLSA 3VR2A 5TSSA 4LNQA 2MQHA 4CJ2C 1SFOH 1O78A 1AW7A 2A6ED 2JA9A 1ZEQX 4JBJA 2XWBB 1MJCA 5C0XH 4RGTA 3QIAA 4UAIA 5KNBA 4DR5Q 5BN4A 1NNXA 1MGSA 4JI3Q 2F0DA 4A3BH 3S1QB 1TIID 1QUQA 4ILWA 1G6PA 3FMCA 4BA1I 5FO8B 5IOCA 4A3IG 2JQOA 3D6CA 4L5TA 4K0KL 5IIFA 1HR0Q 3CC7A 3GP7A 1XTCD 3HKSA 1EYGA 1IZ6A 2OF1A 1L0YB 2PCFB 5AFWA 4AQYQ 3OOCA 1S72A 4FYDA 4DV1Q 3VYUA 3W1GA 2EY6A 2HIVA 4WORA 3UI2A 1XNRQ 1L1OB 2J4XA 1YVCA 4MNOA 5LL6S 3LWUA 1WCMH 1ML0D 2R93B 2Q2HA 2L5TA 4DR5L 4WRDA 2AWOA 4YWMA 5A2QL 4DV7Q 3PMFA 4GOPB 1DZ1A 4V190 1HR0L 5JJLA 2JSOA 4F88A 4DV0Q 1EWHA 2I0QA 2DJGC 2E74C 3Q8DA 1LT6D 2KECA 3KJOA 4DV1L 4Y52H 3IKJA 3VA5A 1FVIA 1BOSA 1XNRL 2A6HC 4N9TA 4JC0A 5LMNQ 3O13A 2PPBC 2LXKA 3PUVA 4DV7L 4HCSA 1C4QA 3BU2A 1STBA 4X64Q 4A3EB 1F2YA 3MTSA 1MD2D 3TBIB 3PIP3 1SNCA 1PRTB 4DV0L 1EQVA 3J7AV 2K04A 1QVFA 3ULJA 2A6HD 1G8ZD 4OXPA 1ZXTA 1Y14B 5KYIA 2PI2A 3U50C 3RMHA 3R2IA 3SGIA 3BVMA 4UDUC 2ZXOA 1UNSA 5LMNL 1DD2A 1NBWA 4JI8Q 4U673 3TMEA 5BR8L 1F2MA 4NXMQ 3UE1A 1IHZA 3GTOH 3VR5A 1IBLL 2N78A 1EIGA 4X64L 1D5XC 2NZOA 4HSPA 4OHJA 3D4WA 2EIFA 2E8GA 1QVCA 4R8IA 1GUNA 2B8GA 1A0IA 4LF4Q 1FYCA 2WV6D 1SFOB 3DWQA 5EQ0A 3SE0A 3D3RA 4DF7A 2VQFQ 1BDOA 5C3WA 4WJ4A 4A3BB 3CCLA 5BN3A 2A69C 2LY7A 4JI8L 1B9MA 4QIWB 4NXML 4FF3A 2BOSA 1TXYA 5C0XJ 4K5WA 3CCVA 1A6XA 3E9HA 2ENBA 3HOVG 2K5NA 1VQ7A 2NVXH 1NE3A 1CTMA 5A2QE 4KLKA 1AE3A 4L6TB 4RWSC 4OONA 4XDXA 1JOKA 1FD7D 1PH5A 3NBHB 2EYHA 1WCMB 2A69D 1YNND 1CFMA
chains in the Genus database with same CATH topology
2NYZD 5KNDA 2EVBA 2KEDA 1LABA 4DNTB 3Q22A 1B44D 1ENAA 4JK1C 1ILPA 5I6YA 3D31A 4QF4A 5I2YA 1LLRD 1D1IA 4B08A 3H91A 1HUMA 2AUKA 3Q23A 1KAAA 4IFDI 1PFNA 1BCPC 4TQUS 4RKLA 3A55A 4IFDG 2NTSA 1DCZA 2F0MA 3FPUB 5FKAC 4K6LA 2O5IC 4FO2A 1CI3M 2R6GA 3P1HA 3OPOA 1BCPD 3BDOA 3VYSA 1GHKA 2IWHA 2KHSA 2F0LA 4WFN3 3GTOB 1CHQD 1X3PA 4IUNA 2M9VA 1LT4D 3OW7A 5ELFA 2AQ2B 1T5XD 3OSOA 1AZPA 1K8MA 4OO1H 4DU9A 4ZLTF 1SJED 1A2TA 2Z1CA 3KUPA 3MXNA 5CV9A 1HQMC 3OHXC 2BE5C 4HCEA 5JVH3 4RA8A 2XRQD 5IODA 5CV8A 5K36G 2K5DA 1JWUD 1I4PA 3CRKC 4G4KA 1VMPA 2NVYB 1LV9A 2EPBA 2IPKD 2BE5D 3SHLA 5M5WB 1STNA 1R4PB 4K6DA 2F0WA 1SE2A 1PZJD 4K14A 1V1PA 1F2ZA 3QWNA 3PIO3 3D4DA 5M5YB 1I4GA 1HTLD 4BBRB 4M1UB 2LFNA 3MXUA 4XT1B 4KN7C 5D3IB 2E2JB 3IFDA 1CT1D 3MEHA 3VR4A 3VR6A 2B63B 1D2BA 1EY9A 4KY5A 3S15B 1B4OA 5LHY1 3QO2A 1H9SB 2K5QA 4KY6A 2I07B 4HN7A 3RZOB 3JAME 1TU2B 3ZYYX 2XNAC 5JVG3 2NB0A 2JE6I 3S1MB 1SYDA 1PDQA 1J8IA 4CJ0B 1DJRD 1V1OA 4J8QA 1QB5D 1RF2D 4C3HG 4RHSA 1TWGB 3Q6SA 4KKSA 1BNZA 3PUYA 3CU7A 4I65A 3R93A 4S3SA 1GHJA 4IUPA 4LJZC 1AP0A 3RZDB 4RGNA 2M2LA 1YNND 2B39A 5EJWA 3BG3A 5D65A 1PXUA 3AU7A 1H9SA 4MHEA 3FEWX 1HRJA 3A7AB 2FINB 3PO3B 4EQNA 3S1NB 5ELBA 5J22A 4A3JB 2L0CA 2Z8LA 2AQ1B 3J81L 5M3MB 1QG7A 1JWMD 1V8QA 2K28A 3V96A 4A3KB 2CVRA 3QJYA 3K5LA 3WOFA 4KTAA 3KF8A 1EOTA 1TWFB 4ZKBB 2K7VA 4HMIA 3I3CA 1VDZA 2D9UA 1VF7A 2MJ8A 3J80L 2RDHA 1GUOA 3BVZA 2XIWA 3C1FA 1R4QB 4KN4C 2O4XA 4K8JA 3MA2B 1NSNS 5C4JB 3MHBA 1SNDA 3NTKA 1TS2A 3W2DA 1DONA 4F87A 3MAQA 5KEEA 3TP6A 1SYCA 5C44B 4DAYA 2B2UA 1M4VA 1YNJC 1E2WA 5C4XB 3C3LA 5CV6A 4KHZA 2KJXA 1TWCB 5JEAG 2TMPA 1GOZA 2SEBD 4FNFA 1NR4A 1STEA 2DY7A 4ZYSA 1GUGA 1WTWA 3W3AA 2RDGA 1YNJD 1CQVA 1Q8IA 3J81E 2EYLA 5CGKA 2ZT9C 1QOHA 3MXPA 4XIGS 4HEDA 1SMYC 5JOBA 4QUFA 4U68A 1PTOC 5C6AA 1Z47A 2EZVA 1XX8A 3I4LA 5JAVA 2O2LD 3D6WA 2WKCA 3BZDB 1EYDA 1XXGA 1UEAB 3R2TA 1S5CD 2C9OA 1SMYD 3NWSA 3J80E 1PTOD 3GV3A 5I9PA 2D62A 3K5OA 3K57A 2HUGA 1ONLA 2J0TD 2F0PA 5J39A 2L9HA 4EVOA 1U4MA 2PNRC 5FK9C 2VNUD 2NWGA 5LL6X 2PYKA 4L63B 1SEBD 4IURA 1M8AA 2A73B 1W6KA 4RAUC 3I4MB 4J6HA 3P75A 5IGGA 4IALA 1ILQA 4DXFA 4Z9CB 2BDOA 3CHBD 4CHTB 1LTTD 1EY5A 2CQAA 3ND9A 1SNMA 1NR2A 1BBXC 2EJMA 2ID0A 4JBWA 3P7JA 5ELCA 4G7OC 2D2CC 1AZQA 5DM73 5C0XI 5JEAJ 2LKVA 5C0XG 2EY2A 5CR3A 3D8GA 1BCPB 2RSNA 4FXKC 1LACA 5M5XB 3GTGB 1KNAA 4K8IA 3S2HB 1EWCA 5ELDA 3NHHA 5I6WA 3PV0A 1NUCA 2CW0C 4K2LA 4EGVA 3KBGA 2WIIB 1I4RA 3MFGA 1JCKB 4HTHA 2KA7A 1CZGA 4Q5VA 5EBDA 2JA8B 3M4OB 1GUWA 4BWGB 2RQXA 5G3LD 4F7XA 1R9TB 3A7LA 3L9AX 3I72A 3CKIB 4ID6A 2CW0D 3HOYB 1II3A 1GUTA 1U9RA 1FGBD 2G9HD 1ESRA 1Q1BA 1O7YA 4QUCA 3HS0C 4O42A 1QCBD 4H0LC 1EY7A 3ITPA 1WTQA 5JJZA 3HGBA 2LS01 3DMUA 5E4WC 1Y1VB 3PUWA 1AN8A 3OMCA 2WKDA 5EBCA 3DEPA 1G2TA 1H9KA 1F77A 1TT2A 2L12A 5KGUA 1FR3A 5IGFA 3I4NB 3R8BA 1PZID 3VYTA 3EVQA 2R61A 4A3GB 3BS1A 4WJWA 2D5DA 4KHVA 2B2VC 1ICWA 2QILA 1RHPA 2F0NA 2RSOA 2E2DC 1YNNC 1GUSA 1EIHA 2EJGC 4XTCS 1A3VA 2KOLA 1LTBD 4C56C 1SYFA 4KK7A 3A8JE 1G2SA 4DNRB 2DN8A 4C3JB 1BXTA 2E2HB 1CK1A 4KKTA 2F03A 3M4YA 1EEFD 3J7YW 2FFKB 4K5XA 1KNEA 4DFAA 2NN6H 3BYYB 4ABNA 1QNUA 1STAA 1H9RA 3E6ZX 3OWEB 2K05A 4PNYA 4RCOA 3SK8A 2NZ1D 1F9PA 3KLSX 1DM0B 4KD4A 3V2TA 1HTPA 3K0YA 1PFMA 1PLFA 3K5MA 2BA1A 1V1PB 1A2UA 2F1MA 2HCCA 4IFDH 1OXSC 1WD1A 2EYMA 1KLUD 4XYQA 4GZYC 4EQOA 1TY0A 4NKLA 3H09A 2MGSA 1PTOH 3DXJC 1G91A 4H44C 3I90A 4OO1I 3RLFA 4OIKA 3JAML 4OO1G 3ONAB 2SNMA 4DK1A 1CA5A 2R92B 5I2XA 3BDLA 1SYBA 1EY8A 3HKZB 4DA2A 4PMWA 4KD3A 1Y8PB 4RGOS 1E0BA 3HRZC 2NVXB 2IX0A 5EGTA 4R8NA 4L8JA 1WTOA 3T53B 2MHVA 1Z7TA 4N9PA 2MPMA 5T1GA 1XWEA 1VF5C 1PRTC 1CA6A 4QMGA 3A8IE 2F3WA 2KCNA 2SNSA 2F0HA 2KEEA 2F4IA 4RHRA 1WTVA 3I73A 3MVVA 3VR3A 2L4NA 2TSSA 1QWYA 3IAYA 1JC7A 4KV6A 1PRTD 2EYOA 4TSSA 1F9RA 2VB2X 1WTXA 4DK0A 4XXEA 2JA5B 2E2IB 1DOKA 3T16A 3LX0A 3C2PA 2JYOA 1BUVT 4NMZA 2OEOA 2Y0SB 4V0BA 3I8ZA 4OL7A 1WTRA 3GTKB 3ND8A 3GQBA 5M9OA 1HFGA 1RJTA 2FHTA 5C3EB 3CQZB 2PW7A 1PTOB 4RKBA 1V43A 1LTID 3K6OA 4FVMA 4NDXA 3QG1A 3SXHA 1X3QA 1JE4A 1CZWA 5EKKA 4EQPA 1FNWA 3IL8A 3EROA 2R7ZB 1DXMA 4NP5A 5BN5A 4IN3A 5E3FA 3GTQB 1TWAB 2O5JC 3C1EA 2RA4A 1S5DD 3M3YB 3EFXD 4ZK9B 4LMQD 1UUPA 2X69A 4XQJA 4CKEA 4ME5A 4BY7B 5EPKA 3X3NA 4IUVA 3K7AB 2B2WC 5CBAE 1EL0A 4LAAA 1F9SA 1AFPA 3FDTA 1OXTA 3HOUB 2JEBI 4C3IB 2VXWA 5KIXA 5IGDA 2WACA 1RDPD 3V05A 4CJ1B 4P2CB 4PQXA 5HGTA 3URYA 3U9SA 2C5CA 5IGEA 2H4OA 4H13C 1W6JA 4KY7A 5C5LA 5FOBB 5ELEA 3HZXA 1KDAA 3MZ5A 2F0UA 2B2YC 4C1NK 4C2MB 3QB3A 2XSCA 2EXZA 4LK1C 3IFTA 1OXXK 3H0GB 1TS5A 3I91A 1RKNA 1EY4A 1JOQA 1S5FD 5EKIA 2XN9C 3DM1A 2F0QA 2IJ0A 1SYGA 4FF1A 2A68C 1B53A 3SK4A 1HHVA 1KDCA 1S5BD 2G9DA 2JEAI 1I4QA 3SR1A 2JA7B 4DAVA 2H1EA 3AMUA 5KNCA 3EQLC 2A68D 4BA2I 1HA5A 1SE4A 4ZRZA 4C1NI 1B2TA 3Q0AA 3G7LA 1BCPF 3N6RA 3TZDA 3FKIB 2PZWA 2ZXRA 1B50A 4A3DB 3QOLA 1A15A 5T1IA 4RCNA 4OGQC 5JPNC 3E0JA 3T4AC 3S9WA 1JOOA 4BBSB 4Q0FA 2OT2A 2FMCA 1TS3A 3RD4A 3LWEA 5I9OA 1Q12A 4HR7B 1EY6A 2KVMA 1D5ZC 4YIJA 4DXGA 4ODGA 5FO7B 4H7BA 3M85A 4Y7NB 5CMDA 1KLGD 1FNUA 2AUJD 1VMCA 1SDFA 1TQOA 3H3VC 2F0FA 3VYRA 3N52A 5DNFA 1O80A 2YU9B 3RUZA 4FF2A 1JQYD 3K58A 4E6IA 2AWNA 1ZKOA 3TSSA 1MI2A 3CRLC 1O7ZA 3KLRA 4ZUIA 1A3TA 3A56A 3NSWA 1JR0D 1B9NA 1G6ZA 2KUMA 3A54A 3NXWA 4F8MA 1SAPA 4HMJA 5IT9L 2EY1A 1MSGA 3SEBA 2QKIC 4CKBA 4CBVA 1KABA 2B2VA 2K6AA 5FO9B 4BY1B 3NBIA 4A93B 3PUXA 2PZTA 4PMCA 5DEHA 1D5MC 4O1NA 5C3XA 4RFBA 4KJOA 1LO5D 3FVQA 4C3JG 2K03A 2V4DA 3TN2A 3PUZA 4G57A 5CV4A 1HQRD 4RGMA 1EEID 1U4LA 1KDBA 2K1BA 5EKLA 1STYA 2F0VA 1K83B 4PMBA 4X3SA 1PFBA 1AEXA 4ULLA 1B1ZA 1BO0A 1F9QA 5I4DA 1SSOA 3FRPB 2N55A 1K8OA 2F0EA 1TWHB 5CV5A 2K33A 5D14A 2QDBA 1SBBB 1SNOA 1QNKA 3PO2B 3F2UA 1Z6HA 1SXTA 1CQFA 5FLXE 2BA0A 1EQTA 3A8KE 5M3FB 1PYWD 1EZ6A 4AYBB 1STGA 5IT9E 3MC0B 5EPLA 3MFYA 1NCVA 5KYLA 2BCOA 3OMGA 3WOEA 1S4ZA 2OXPA 4X3TA 4XT3B 3GO5A 4RH6A 2DNEA 1IYUA 2EY5A 3SK6A 1ZYRC 2R3ZA 5CYUA 1HA6A 3ERQA 3X3MA 4HSVA 2J7ZA 3C46A 3NE5B 2N88A 4TRDA 1HPCA 3DWAA 1RTNA 1EYAA 1ZYRD 3FPPA 5C5MA 2E75C 1MBYA 2JP1A 4A3IB 1LTSD 4I7ZC 2EYPA 2XRSD 5KRUA 1S5ED 1E2ZA 1Q3LA 2NN6I 3S1RB 2RVLA 2B2TA 1Q90A 2NN6G 1ET9A 2F0JA 1JORA 4IUUA 3DEOA 1QILA 4X3KA 5DAUA 1HXYD 3U9OA 2B8FA 5D3DA 1I3QB 2EJFC 1GJXA 1RCVD 3NP8A 2XWJB 2IL8A 3L3OC 5HURA 2MP1A 2WP8J 1A3UA 2K01A 2M00A 4KJNA 4QCLA 3BDCA 1C48A 3GTMB 1I50B 3P20A 4IUQA 5EPJA 1Y8NB 3GTLB 5COYA 3NWTA 3GV6A 2CHBD 4B9WA 2PZUA 2IT1A 2Q8RE 3NTIA 3HEJA 2F0KA 2A74C 3TP7A 4FF4A 3S14B 1DOMA 2F0GA 2RKSA 3EJIA 4A3MB 3HG9A 1U4RA 2K5WA 1I6HB 4IUTA 1PTOF 1LTGD 3L7ZC 1DOLA 3NBHA 1O7LA 4QB4A 3S2DB 1LTRD 1SJHD 1D1KA 3EA6A 2ZXPA 1TS4A 4FXGC 4XYOA 5ISRA 3T51B 4HAEA 1T5EA 3Q24A 1JB3A 3TDQA 2BDNA 2EYFA 4NW2A 2NVQB 1JWSD 2HCIA 2EE1A 2F3VA 1F2LA 2Q8TA 2VB3X 1LT3D 2IX3A 3K5NA 3S17B 1TKWB 4XQQA 3H6MA 3HOVB 2B2TC 3AB9A 5F2DA 5IGBA 2JA6B 2ICIA 5CC4A 1BR9A 4K5VA 5K36H 2SOBA 2EDGA 1U4PA 3OWFA 3E5SA 3NTHA 1LT5D 2F0IA 2DY8A 4B9XA 2B2WA 2XVSA 3QOJA 5NUCA 3VA7A 1D6EC 3I70A 4R9WA 4CGYB 2PW5A 5C4ZA 1IKLA 4C3IG 2NBFA 2EYJA 2RBMA 3KK7A 3K59A 5A35A 3WDNA 2Z4HA 5E4XA 3HOXB 1ET6A 1OO9B 1X32A 4OIJA 3SK5A 2FJ2A 2F0TA 5CV7A 5DM63 4IFDJ 2YYZA 5CORA 1Y69U 1BQQT 2B2YA 3T13A 2NVTB 1L0XB 2WINB 1LTAD 3BYTB 5J1ZA 5IGCA 1IW7C 4M8AA 1TY2A 5G3LF 4KMUC 2F0OA 2HDLA 2I46A 3DUZA 1EZ8A 3OIQA 2IW3A 4KKUA 1C8CA 2VUMB 1EFID 1IW7D 3GD7A 4FXDA 4G7HC 3OIPA 3TP8A 1IYVA 1B3AA 1TVXA 4MN3A 2QEJC 1PZKD 5JPMC 2Z4IA 3SDZA 4DGZA 2HDMA 3H94A 1EYCA 1EY0A 2LMCB 2FMMA 1FNVA 1NAPA 4IQZA 3R3OA 2PQEA 4ZAIA 1IKMA 2L55A 4ZQ3A 3NUCA 1J9OA 4G7ZC 1H9JA 1WD0A 3MXGA 5E1FA 2K32A 4TKOB 3KBXA 2F0SA 1ENFA 1EU4A 2PMZB 1HFNA 4CKCA 3M7GA 2QCPX 2GA4B 3NQTA 1VCIA 4BS9A 2SDFA 2AQ3B 1WVLA 1SE3A 4DAPA 3DHQA 1TR5A 4DN4M 1MSHA 3G6JB 2NTTA 1EU3A 4FP5D 1QJOA 1QE6A 2PO4A 1H9MA 1XYIA 2WAQB 3DWPA 1I6VC 3NPPA 4C3HB 3TP5A 5JEAH 5K5PA 1UAPA 1STHA 4J1MA 3NK9A 4IZ8A 1PMRA 2EOTA 2KQ3A 1CHPD 4X3UA 4ZUJA 1HUNA 2ICEC 4ZKCB 2A5HA 3LNNA 1WTPA 2QF7A 4K2KA 3GTPB 3SVMA 2L1BA 1RODA 2L11A 2E76C 2NUCA 2Q8IB 1ENCA 1DYQA 1IL8A 1CM9A 1RTOA 1Y1WB 3MWYW 1OXVA 1Y8OB 1OXUA 1G291 2DNCA 3S16B 4MIUA 1KTKA 1I4XA 1Q1EA 2X6LA 1JICA 3HOWB 1I4HA 2WB1B 3D4RA 5FLXL 2KCCA 4KI0A 1GXDC 3J7AF 3NQIA 2X6GA 2RDFA 3HP3A 3M7NA 3HOZB 2IX1A 3GTJB 1SYEA 2HQEA 2B2UC 1BF4A 3TZUA 1SNQA 3T56B 1HCZA 5CBEE 4XQNA 2A6EC 4PV1C 1PRTF 2MUYA 2JXMB 3BVGA 1SNPA 4A3FB 1ESFA 1RD9D 1E2VA 3KLSA 3VR2A 5TSSA 4CJ2C 1O78A 1AW7A 2A6ED 1ZEQX 2XWBB 5C0XH 4RGTA 3QIAA 4UAIA 5KNBA 5BN4A 1MGSA 2F0DA 3S1QB 1TIID 4ILWA 3FMCA 4BA1I 5FO8B 5IOCA 3D6CA 5IIFA 3GP7A 1XTCD 2OF1A 1L0YB 2PCFB 5AFWA 3OOCA 4FYDA 3VYUA 2EY6A 4WORA 3UI2A 2J4XA 5LL6S 3LWUA 1ML0D 2R93B 2L5TA 4WRDA 2AWOA 5A2QL 3PMFA 1DZ1A 4V190 2JSOA 4F88A 1EWHA 2E74C 1LT6D 2KECA 3IKJA 3VA5A 1BOSA 2A6HC 4N9TA 3O13A 2PPBC 3PUVA 4HCSA 1C4QA 1STBA 4A3EB 1F2YA 3MTSA 1MD2D 3TBIB 3PIP3 1SNCA 1PRTB 1EQVA 3J7AV 2K04A 2A6HD 1G8ZD 1ZXTA 5KYIA 3RMHA 3R2IA 4UDUC 3BVMA 2ZXOA 1UNSA 1DD2A 4U673 3TMEA 1F2MA 1IHZA 3VR5A 1EIGA 1D5XC 4HSPA 4OHJA 3D4WA 4R8IA 1GUNA 2B8GA 1FYCA 2WV6D 1SFOB 3DWQA 5EQ0A 3SE0A 3D3RA 4DF7A 1BDOA 5C3WA 4A3BB 5BN3A 2A69C 2LY7A 1B9MA 4QIWB 4FF3A 2BOSA 5C0XJ 4K5WA 1A6XA 2ENBA 1CTMA 5A2QE 4L6TB 4RWSC 4XDXA 1JOKA 1FD7D 2EYHA 1WCMB 2A69D 5C4HA 1CFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0C A;  3RD4 A; 
#chains in the Genus database with same CATH topology
 2NYZ D;  5KND A;  2NVY H;  2EVB A;  2KED A;  1LAB A;  4DNT B;  1PV4 A;  3Q22 A;  1B44 D;  1ENA A;  4JK1 C;  1ILP A;  4GLX A;  5I6Y A;  3D31 A;  4QF4 A;  2CWP A;  1O7I A;  3MXN B;  2DGY A;  5I2Y A;  1LLR D;  1D1I A;  2MO1 A;  4UP9 A;  4B08 A;  3H91 A;  5M5Y H;  2UXD L;  1HUM A;  2AUK A;  3Q23 A;  1KAA A;  4N8X 1;  2VZA A;  4IFD I;  1PFN A;  1L2F A;  1BCP C;  4BBR G;  2HQL A;  4TQU S;  4RKL A;  3A55 A;  2Z0S A;  4IFD G;  2NTS A;  2E2J H;  1DCZ A;  3HOX G;  2F0M A;  3FPU B;  1AE2 A;  5FKA C;  4K6L A;  4X66 Q;  3F2C A;  4GS3 A;  2O5I C;  4FO2 A;  1CI3 M;  2B63 H;  4R4O A;  1VQ6 A;  1N33 Q;  2R6G A;  2B3G A;  2ZTE A;  1WI5 A;  3J7A 5;  3P1H A;  4QL5 A;  1PH6 A;  3OPO A;  1BCP D;  3BDO A;  4OEL B;  3VYS A;  1SRO A;  1GHK A;  2IWH A;  2KHS A;  2F0L A;  4WFN 3;  3GTO B;  1CHQ D;  1N9W A;  1X3P A;  4IUN A;  2M9V A;  4CDC C;  1LT4 D;  3RZO H;  2YV5 A;  3OW7 A;  5ELF A;  3CQZ H;  4X66 L;  1K8A C;  2EQS A;  2AQ2 B;  2DUD A;  1T5X D;  5IWA Q;  1N33 L;  3OSO A;  2A1A A;  4BXX H;  3S1M H;  3VDY A;  1AZP A;  2VUM G;  4DR6 Q;  1K8M A;  4OO1 H;  1SJE D;  4DU9 A;  4ZLT F;  1A2T A;  2Z1C A;  3KUP A;  5FJ8 G;  3MXN A;  5HY6 A;  3TEH B;  5CV9 A;  2DJF C;  1HQM C;  3H3V I;  4AYB E;  3OHX C;  2BE5 C;  4HCE A;  5JVH 3;  1TWG H;  1JJG A;  4JPB W;  4RA8 A;  5FLM H;  2XRQ D;  5IOD A;  5IWA L;  5CV8 A;  1Z9F A;  5K36 G;  1TWA H;  2K5D A;  1JWU D;  3RZD H;  1X3E A;  4DR6 L;  1I4P A;  3CRK C;  4G4K A;  1GO3 E;  4JOI A;  1EQR A;  1VMP A;  2NVY B;  1LV9 A;  2EPB A;  2IPK D;  2BE5 D;  3SHL A;  5M5W B;  1STN A;  1NMF A;  4HJ9 A;  2F4V Q;  1R4P B;  4K6D A;  1YIJ A;  2F0W A;  1SE2 A;  1PZJ D;  4K14 A;  4DR7 Q;  1V1P A;  1F2Z A;  4NB3 A;  3RR5 A;  3PO3 G;  3QWN A;  3PIO 3;  2YTV A;  4A3J G;  3D4D A;  5M5Y B;  5M3M G;  5ELO A;  1I4G A;  1HTL D;  4BBR B;  4M1U B;  2LFN A;  3MXU A;  4GN5 A;  4XT1 B;  4KN7 C;  5D3I B;  5IYB H;  2E2J B;  3IFD A;  2F4V L;  4A3K H;  1CT1 D;  3MEH A;  4DR7 L;  1M90 C;  3CF5 A;  3VR4 A;  1N32 Q;  3VR6 A;  2B63 B;  2K5V A;  1D2B A;  1EY9 A;  3FP9 A;  2R7F A;  4KY5 A;  1TWF H;  3S15 B;  1B4O A;  5LHY 1;  3QO2 A;  1H9S B;  2K5Q A;  2OTJ A;  1XJV A;  4KY6 A;  2I07 B;  4HN7 A;  1UE6 A;  1C9O A;  3RZO B;  3JAM E;  1TU2 B;  5C4J H;  3ZYY X;  2XNA C;  4DK3 C;  1N32 L;  4JBM A;  5JVG 3;  2VQE Q;  5IYC H;  2NB0 A;  2BH2 A;  5GAH C;  2JE6 I;  3S1M B;  1SYD A;  3OW2 A;  1PDQ A;  1J8I A;  1CSQ A;  1KL9 A;  4CJ0 B;  1E3P A;  4DV3 Q;  1DJR D;  1V1O A;  2LXJ A;  5C44 H;  4J8Q A;  1JE5 A;  1QB5 D;  2WAQ G;  1RF2 D;  4C3H G;  5C4X H;  4RHS A;  1ASZ A;  1TWG B;  1TWC H;  3Q6S A;  1VQ4 A;  3PQI A;  4KKS A;  1BNZ A;  1BKB A;  3PUY A;  3CU7 A;  4I65 A;  3R93 A;  4S3S A;  1W2B A;  2VQE L;  1GHJ A;  4IUP A;  4LJZ C;  1YJW A;  2MFI A;  1AP0 A;  1E22 A;  4JOI C;  3RZD B;  4RGN A;  1UWV A;  2M2L A;  2B39 A;  4DV3 L;  5EJW A;  2OQK A;  3BG3 A;  5D65 A;  1PXU A;  3AU7 A;  1H9S A;  4MHE A;  3A0J A;  3FEW X;  2Z6B A;  1HRJ A;  5DLQ E;  3A7A B;  2FIN B;  3PO3 B;  2K4K A;  4EQN A;  2N8N A;  3S1N B;  5ELB A;  5J22 A;  1JT8 A;  4PG3 A;  4A3J B;  2L0C A;  2Z8L A;  3K8A A;  2AQ1 B;  4DAY B;  3J81 L;  4IOC A;  5M3M B;  1QG7 A;  1JWM D;  4DAM A;  2F3I A;  1V8Q A;  2K28 A;  3V96 A;  4LFA Q;  2ASB A;  2G5D A;  4DUY Q;  3W1B A;  4A3K B;  2CVR A;  5IYD H;  3QJY A;  3K5L A;  1KQS A;  3WOF A;  5GAG C;  4KTA A;  3KF8 A;  1EOT A;  1TWF B;  4ZKB B;  2K7V A;  3KF6 A;  4HMI A;  3I3C A;  1VDZ A;  3GDE A;  2D9U A;  1VF7 A;  2MJ8 A;  3J80 L;  2RDH A;  1WTH A;  1E7Z A;  1GUO A;  3BVZ A;  3RLO A;  2XIW A;  3C1F A;  3EBE A;  1ICF B;  1R4Q B;  4A76 A;  4KN4 C;  3HOW G;  3ER0 A;  2O4X A;  2WB1 G;  4K8J A;  3MA2 B;  1NSN S;  4DUY L;  1LYL A;  3A5U A;  1NTG A;  1QZH A;  4JG2 A;  5C4J B;  1X3F A;  3MHB A;  1SND A;  1Q8K A;  3NTK A;  2D0P A;  3OTO Q;  2YU9 H;  3UE0 A;  1TS2 A;  3I4M H;  3W2D A;  1DON A;  4F87 A;  3MAQ A;  5KEE A;  3TP6 A;  1SYC A;  1GVP A;  3FHW A;  5C44 B;  4DAY A;  2B2U A;  1M4V A;  1YNJ C;  4JI5 L;  2VY3 A;  4B3M Q;  1E2W A;  5C4X B;  3C3L A;  4QJF A;  5CV6 A;  2I5L X;  3STB C;  4KHZ A;  2KJX A;  1TWC B;  4A3F G;  1NJI C;  5JEA G;  3KOJ A;  2TMP A;  1GOZ A;  1Q82 C;  2SEB D;  3OTO L;  4R4C A;  5GRO A;  2AKW B;  4GLA C;  4FNF A;  1NR4 A;  1STE A;  2DY7 A;  2RCN A;  1GUG A;  4ZYS A;  1WTW A;  3W3A A;  3TS0 A;  2RDG A;  1YNJ D;  2RHS B;  1CQV A;  4QGU A;  3STB D;  1Q8I A;  4B3M L;  1AH9 A;  3J81 E;  2EYL A;  5CGK A;  1HZ9 A;  2ZT9 C;  1QOH A;  3MXP A;  4XIG S;  4HED A;  5M5X H;  3GTG H;  1SMY C;  4GLV B;  5JOB A;  4QUF A;  4U68 A;  4A93 H;  1PTO C;  5C6A A;  1Z47 A;  2KCM A;  2EZV A;  3S2H H;  1XX8 A;  3NEN A;  3I4L A;  2VW9 A;  5JAV A;  2O2L D;  3D6W A;  2WKC A;  1XMQ Q;  3BZD B;  4POG A;  3KLW A;  1EYD A;  1XXG A;  4DV5 Q;  1UEA B;  4DPG A;  3R2T A;  2JA8 G;  1S5C D;  2C9O A;  1D8L A;  1SMY D;  3NWS A;  3J80 E;  3ULL A;  5IP9 H;  1PTO D;  3GV3 A;  5I9P A;  2D62 A;  1R9T H;  3K5O A;  3K57 A;  1FJG Q;  3HOY G;  1K83 H;  3CAM A;  1QUQ B;  2HUG A;  1ONL A;  1XMQ L;  2J0T D;  2F0P A;  5J39 A;  3D0F A;  2L9H A;  4EVO A;  1U4M A;  2PNR C;  4DV5 L;  5FK9 C;  2VNU D;  2ES2 A;  2NWG A;  5LL6 X;  2PYK A;  4L63 B;  1SEB D;  1VQ8 A;  4IOA A;  1GKH A;  4GKJ Q;  4IUR A;  1CUK A;  4KHP Q;  5AJ3 Q;  4A3E G;  1XNQ Q;  1M8A A;  3PO2 H;  2A73 B;  2D0O A;  1W6K A;  4RAU C;  3I4M B;  4J6H A;  2HT1 A;  3P75 A;  5IGG A;  4IAL A;  1FJG L;  1ILQ A;  4JVZ A;  4DXF A;  4Z9C B;  2BDO A;  3CHB D;  4CHT B;  1LTT D;  1HZC A;  1EY5 A;  2CQA A;  2JJQ A;  1Y1V H;  3ND9 A;  3J7Z C;  1SNM A;  1NR2 A;  1K8G A;  1BBX C;  2EJM A;  2ID0 A;  4JBW A;  3P7J A;  1VQP A;  5ELC A;  4KHP L;  4G7O C;  1XNQ L;  4R4I A;  4IPD A;  2D2C C;  3I4N H;  1AZQ A;  3M4P A;  5DM7 3;  5C0X I;  1JMC A;  4A3G H;  5JEA J;  5C4H A;  3E9I A;  4A4I A;  2LKV A;  3RN2 A;  5C0X G;  1W3S A;  2EY2 A;  5CR3 A;  3D8G A;  1BCP B;  4B3S Q;  4A3C H;  1A8V A;  4A3B G;  2RSN A;  4FXK C;  3CCS A;  1LAC A;  5M5X B;  3GTG B;  4HIK A;  2QA4 A;  1KNA A;  4K8I A;  3S2H B;  1EWC A;  5ELD A;  3NHH A;  5I6W A;  1XMO Q;  3PV0 A;  1NUC A;  2CW0 C;  3JAM c;  4K2L A;  4EGV A;  3KBG A;  2AHO B;  1I4R A;  2WII B;  3MFG A;  1EOV A;  4HID A;  1JJ2 A;  4LUV A;  1JCK B;  4HTH A;  1WCM G;  1HR0 W;  1LTL A;  2KA7 A;  4B3S L;  1CZG A;  4C3J H;  2WAQ E;  4Q5V A;  5EBD A;  2JA8 B;  1GD7 A;  3M4O B;  2E2H H;  4LF5 Q;  1GUW A;  4BWG B;  2RQX A;  5G3L D;  1B70 B;  4F7X A;  1R9T B;  3A7L A;  1K9M C;  1IL2 A;  3L9A X;  4MZ9 A;  3I72 A;  3CKI B;  4ID6 A;  1KIX A;  2CW0 D;  3HOY B;  1II3 A;  1XMO L;  1GUT A;  1U9R A;  1FGB D;  2G9H D;  1ESR A;  1Q1B A;  1O7Y A;  4JI6 Q;  4QUC A;  1KHI A;  1XPU A;  1CSP A;  2ZM6 Q;  4UPA A;  5BR8 Q;  3HS0 C;  4O42 A;  4LF5 L;  1IBL Q;  1I3Q H;  1QCB D;  1BVS A;  4H0L C;  1EY7 A;  3ITP A;  1WTQ A;  5LMN W;  5JJZ A;  3HGB A;  2LS0 1;  3DMU A;  5E4W C;  3GTM H;  1Y1V B;  3PUW A;  1AN8 A;  1I50 H;  4JI6 L;  3OMC A;  2WKD A;  5EBC A;  2ZM6 L;  3DEP A;  1G2T A;  1HZB A;  1H9K A;  1F77 A;  1TT2 A;  2L12 A;  1VQO A;  1NY4 A;  5KGU A;  1FR3 A;  2V1C C;  5IGF A;  3I4N B;  3R8B A;  4ALP A;  1PZI D;  3VYT A;  3EVQ A;  2R61 A;  4A3G B;  3S14 H;  4YY3 L;  3BS1 A;  4LF7 Q;  4WJW A;  2D5D A;  4KHV A;  4A3M H;  2B2V C;  1L0W A;  1ICW A;  3AFP A;  2QIL A;  2HHH Q;  1RHP A;  1B7Y B;  2F0N A;  2WB1 E;  2RSO A;  2E2D C;  2R92 H;  1YNN C;  1GUS A;  1EIH A;  4P74 A;  2EJG C;  4XTC S;  3W5O A;  1A3V A;  2KOL A;  5IP7 H;  3I4O A;  1LTB D;  4C56 C;  3UDG A;  1SYF A;  4KK7 A;  1OTC A;  3A8J E;  4LF7 L;  1N34 Q;  1G2S A;  2UXD Q;  4DNR B;  2DN8 A;  1UEB A;  4C3J B;  2K14 A;  2HHH L;  1BXT A;  1PH7 A;  2E2H B;  1FL0 A;  1CK1 A;  4KKT A;  2F03 A;  3M4Y A;  1SRU A;  1EEF D;  3TS2 A;  3J7Y W;  4HIM A;  3U58 A;  2JA6 H;  2FFK B;  4K5X A;  4HJ7 A;  1KNE A;  4DFA A;  2NN6 H;  1N34 L;  3BYY B;  4ABN A;  3F2D A;  3RLN A;  2KEN A;  3TQY A;  1VQ5 A;  1QNU A;  4YWL A;  1STA A;  2AMC B;  1H9R A;  3E6Z X;  3OWE B;  2K05 A;  4PNY A;  4RCO A;  3SK8 A;  3CCR A;  2L15 A;  2NZ1 D;  2B63 G;  1K0R A;  1VQG A;  4DKA C;  2PI2 E;  4O0A A;  1F9P A;  3KLS X;  3J81 c;  1DM0 B;  2JA5 H;  4KD4 A;  3V2T A;  1HTP A;  2E2I H;  3K0Y A;  4LFC Q;  2EXD A;  4YCV A;  4DR2 Q;  1PFM A;  4EX5 A;  1PLF A;  3K5M A;  2N49 A;  2BA1 A;  1V1P B;  1A2U A;  2F1M A;  2HCC A;  2Y0S G;  4IFD H;  1OXS C;  1WD1 A;  2EYM A;  4YCW A;  3GTK H;  1KLU D;  4XYQ A;  4GZY C;  4EQO A;  1TY0 A;  4NKL A;  5C3E H;  3H09 A;  2MGS A;  1PTO H;  3DXJ C;  1G91 A;  2BH8 A;  3BZC A;  4H44 C;  3I90 A;  4BXX G;  4OO1 I;  3RLF A;  3J80 c;  4LFC L;  4OIK A;  1L1O C;  1PFS A;  4DR2 L;  3JAM L;  4OO1 G;  4JI7 L;  3ONA B;  2SNM A;  4DK1 A;  1KXL A;  1CA5 A;  2R92 B;  3J81 j;  3K80 C;  5I2X A;  3BDL A;  1SYB A;  1EY8 A;  3HKZ B;  4DA2 A;  4PMW A;  2XTI A;  3JAM i;  2YTX A;  4KD3 A;  1Y8P B;  4RGO S;  2R7Z H;  4LF9 Q;  5FLM G;  1SR3 A;  1E0B A;  3HRZ C;  2NVX B;  2IX0 A;  3GTQ H;  3E0E A;  5EGT A;  1YJ9 A;  2UUA Q;  2ZJQ A;  1PH2 A;  4R8N A;  3M3Y H;  4L8J A;  3IRB A;  3K7U C;  1WTO A;  3T53 B;  3I56 A;  2MHV A;  1XPO A;  1Z7T A;  2CFM A;  4N9P A;  5GAD C;  4BY7 H;  2MPM A;  5T1G A;  3CPF A;  1XWE A;  1VF5 C;  3KDF A;  1PRT C;  3G48 A;  1CA6 A;  4LF9 L;  4QMG A;  1K73 C;  1KRS A;  3A8I E;  2VS1 A;  3K7A H;  2Q2T A;  1PYS B;  2F3W A;  2KCN A;  2SNS A;  2UUA L;  1FGU A;  2F0H A;  3EIV A;  1MKH A;  2KEE A;  2F4I A;  4NPS A;  4P75 A;  4RHR A;  1WTV A;  3I73 A;  3MVV A;  3HOU H;  3VR3 A;  2L4N A;  2TSS A;  1QWY A;  3IAY A;  4QIW E;  1JC7 A;  1HJP A;  4A3K G;  4KV6 A;  1PRT D;  4C3I H;  2EYO A;  4LF8 Q;  1EQQ A;  3A74 A;  1Q86 C;  4TSS A;  1F9R A;  2K5H A;  2VB2 X;  4DK0 A;  4IJH A;  1WTX A;  4OX9 Q;  1BBW A;  4XXE A;  2JA5 B;  2E2I B;  1DOK A;  3T16 A;  3LX0 A;  3C2P A;  2ALY B;  2JYO A;  1BUV T;  1Q81 C;  1D7Q A;  4NMZ A;  1IYJ B;  2OEO A;  3CCU A;  1JJC B;  2Y0S B;  1VQC A;  4V0B A;  3I8Z A;  4OL7 A;  1WTR A;  1N8R C;  3GTK B;  3ND8 A;  4PZ7 A;  3GQB A;  5M9O A;  1HFG A;  1RJT A;  3AYH B;  3I2Z A;  2FHT A;  1IBM L;  4C2M H;  2FXQ A;  4LF8 L;  5C3E B;  3CQZ B;  2PW7 A;  1PTO B;  4UY8 C;  5IYC G;  4RKB A;  1B8A A;  1V43 A;  4OX9 L;  1LTI D;  4P73 A;  3H0G H;  3K6O A;  4FVM A;  1U0L A;  4NDX A;  3QG1 A;  3SXH A;  2VQF L;  2JN4 A;  4YCU A;  4DV4 Q;  2UXB Q;  4X62 Q;  1X3Q A;  5C44 G;  1EIF A;  3CME A;  1JE4 A;  1CZW A;  3PIP A;  5JJI A;  2GVB A;  3KF8 B;  5EKK A;  4EQP A;  5C4X G;  4DR4 L;  1FNW A;  3KF6 B;  4B3R L;  3IL8 A;  3ERO A;  2R7Z B;  1DXM A;  2I5H A;  4NP5 A;  5BN5 A;  4IN3 A;  5E3F A;  1JB7 A;  3GTQ B;  1TWA B;  4JI4 Q;  2O5J C;  3C1E A;  2RA4 A;  1S5D D;  3M3Y B;  4DV4 L;  2UXB L;  3CCQ A;  3EFX D;  4X62 L;  4ZK9 B;  4LMQ D;  2JA7 H;  1UUP A;  2X69 A;  4XQJ A;  4CKE A;  1CKO A;  4GNX C;  4ME5 A;  4BY7 B;  5EPK A;  3X3N A;  4IUV A;  3KFU A;  2PQA A;  4A75 A;  3K7A B;  2B2W C;  5IT9 c;  5CBA E;  2Q2U A;  5LMU Q;  1EL0 A;  4LAA A;  4JI4 L;  3BZK A;  3FKI H;  1LM0 A;  1F9S A;  1AFP A;  2KHI A;  3FDT A;  4A3D H;  1OXT A;  3HOU B;  2UUC Q;  3J81 i;  2JEB I;  1J5E L;  4C3I B;  5IYD G;  2VXW A;  5KIX A;  4JCV E;  5IGD A;  4BBS H;  2WAC A;  2QGQ A;  1RDP D;  3V05 A;  1KAW A;  4P2C B;  4CJ1 B;  4PQX A;  3G71 A;  5HGT A;  5LMU L;  3URY A;  3GTP H;  3U9S A;  3E3X A;  2C5C A;  5IE8 A;  2K50 A;  2H4O A;  4H13 C;  1W6J A;  4KY7 A;  5C5L A;  5IGE A;  5FOB B;  5E7N A;  5ELE A;  3HZX A;  4JI5 Q;  1Y1W H;  4Y7N H;  4APV A;  2A8V A;  2UUC L;  1KDA A;  2CH4 W;  3MZ5 A;  2F0U A;  2B2Y C;  4C1N K;  4C2M B;  3QB3 A;  3J80 i;  2XSC A;  2EXZ A;  4LK1 C;  3IFT A;  1OXX K;  3H0G B;  1TS5 A;  4UHV A;  4B3T Q;  3I4M G;  4JI2 Q;  3I91 A;  1RKN A;  1EY4 A;  1JOQ A;  1S5F D;  1SMX A;  5EKI A;  1PH8 A;  4L5R C;  2XN9 C;  2UUB Q;  4GN4 B;  3DM1 A;  2F0Q A;  2ZTC A;  4X65 Q;  3PF4 A;  4JI0 L;  4PZ6 A;  1VQA A;  2CH4 A;  2IJ0 A;  3HOZ H;  4JW0 A;  1SYG A;  4FF1 A;  2A68 C;  1B53 A;  3SK4 A;  3GTJ H;  1HHV A;  1KDC A;  1XPR A;  4B3T L;  3BJU A;  4JI2 L;  5L37 A;  1G51 A;  3AQQ A;  1B3Q A;  1S5B D;  2G9D A;  1UE1 A;  2JEA I;  1I4Q A;  4FDB A;  3SR1 A;  2Y0S E;  2JA7 B;  4DAV A;  2UUB L;  2QW7 A;  2H1E A;  4X65 L;  3AMU A;  5KNC A;  3EQL C;  3AFQ A;  1YHB A;  2A68 D;  4BA2 I;  1HA5 A;  1SE4 A;  1VQE A;  3JC6 6;  4ZRZ A;  4BY1 H;  4C1N I;  1B2T A;  3Q0A A;  4A93 G;  3G7L A;  1BCP F;  1PH3 A;  3N6R A;  3TZD A;  1QZG A;  3FKI B;  2PZW A;  2ZXR A;  2KHJ A;  1B50 A;  2MNA A;  3PGZ A;  1LUZ A;  1K28 A;  1V9P A;  3T1Y Q;  4A3D B;  4A3L H;  3QOL A;  4J15 A;  3S1Q H;  1A15 A;  1RIP A;  5T1I A;  4RCN A;  4OGQ C;  1WFQ A;  5JPN C;  3E0J A;  3T4A C;  5IP9 G;  3S9W A;  1JOO A;  4BBS B;  4Q0F A;  2OT2 A;  2FMC A;  3B6Y A;  1TS3 A;  3RD4 A;  4OWW B;  3LWE A;  5I9O A;  1Q12 A;  1IBK Q;  2P5Z X;  4HR7 B;  1EY6 A;  2KVM A;  3T1Y L;  1D5Z C;  4YIJ A;  2R93 H;  4DXG A;  4ODG A;  5FO7 B;  4H7B A;  3M85 A;  1K3B C;  4Y7N B;  5CMD A;  1KLG D;  1A63 A;  1FNU A;  3CD6 A;  1TWH H;  2AUJ D;  1VMC A;  3PIO A;  1BBU A;  1SDF A;  1TQO A;  3H3V C;  2F0F A;  3VYR A;  3N52 A;  5DNF A;  1VQJ A;  1O80 A;  2KCT A;  4IJL A;  2IY5 B;  4AH6 A;  1YNX A;  4L5Q A;  2YU9 B;  3RUZ A;  4FF2 A;  3DLL A;  1JQY D;  2QDL A;  3K58 A;  4E6I A;  2AWN A;  1ZKO A;  2H5X A;  1IBK L;  3KJP A;  3TSS A;  1MI2 A;  3CRL C;  1O7Z A;  1Y1V G;  5M3F H;  3KLR A;  3CXC A;  1YHQ A;  1P8L A;  4ZUI A;  2KBN A;  4AYB G;  1A3T A;  3A56 A;  3NSW A;  4HIO A;  1JR0 D;  3TRZ A;  1VQF A;  1B9N A;  1G6Z A;  2KUM A;  3A54 A;  3NXW A;  1VQL A;  3T1H L;  3I4N G;  4QQB X;  2HIX A;  4F8M A;  3CMA A;  1SAP A;  4HMJ A;  5IT9 L;  5JJK A;  2EY1 A;  3K81 C;  3CPW A;  4A3G G;  4IO9 A;  1VQD A;  1MSG A;  3L0O A;  3SEB A;  1SN8 A;  2QKI C;  1VQM A;  4CKB A;  4CBV A;  4LW1 A;  1KAB A;  4A3C G;  2B2V A;  2K6A A;  3EN2 A;  4UP8 A;  5FO9 B;  1HNZ Q;  4BY1 B;  3NBI A;  1PH9 A;  4A93 B;  3PUX A;  2PZT A;  4GKK Q;  1KRT A;  4PMC A;  5DEH A;  1D5M C;  3U4Z A;  2E5L Q;  3ICE A;  4O1N A;  1X55 A;  5C3X A;  4RFB A;  1K3R A;  3QR8 A;  1U5K A;  4KJO A;  3CCM A;  1LO5 D;  3FVQ A;  3HFZ B;  4C3J G;  2K03 A;  2V4D A;  3TN2 A;  3PUZ A;  4G57 A;  4A3I H;  5CV4 A;  1HQR D;  4RGM A;  2CQO A;  1EEI D;  1U4L A;  1HNZ L;  1KDB A;  3G6E A;  2K1B A;  3RNU A;  2UU9 Q;  5EKL A;  2Z6K C;  1STY A;  2LSS A;  1HZA A;  1WYD A;  3S1R H;  4GKK L;  2NVT B;  2F0V A;  4HJ5 A;  1K83 B;  4PMB A;  4X3S A;  1PFB A;  2E5L L;  1AEX A;  4ULL A;  1B1Z A;  2YTY A;  3PSI A;  1BO0 A;  1F9Q A;  5I4D A;  1SSO A;  3FRP B;  2N55 A;  4JI3 L;  1K8O A;  2F0E A;  1TWH B;  3I7F A;  5CV5 A;  2K33 A;  5D14 A;  2QDB A;  1SBB B;  1SNO A;  1QNK A;  3PO2 B;  3F2U A;  1Z6H A;  1SXT A;  2UU9 L;  4O2D A;  3F2B A;  4AQY L;  1CQF A;  5FLX E;  3CC2 A;  2BA0 A;  4YY3 Q;  4JV5 Q;  1EQT A;  3A8K E;  1I5F A;  5M3F B;  1PYW D;  1EFW A;  1EZ6 A;  4AYB B;  3DM3 A;  3GTL H;  1STG A;  5IT9 E;  3MC0 B;  5EPL A;  3MFY A;  1NCV A;  5KYL A;  2BCO A;  3OMG A;  3WOE A;  1S4Z A;  4AIM A;  2OXP A;  4X3T A;  4MTK A;  1VQK A;  4XT3 B;  3GO5 A;  4RH6 A;  2CWA A;  4JV5 L;  2DNE A;  4ME3 A;  4A3M G;  2I5M X;  3UDF A;  1I6H H;  1IYU A;  2EY5 A;  3SK6 A;  1ZYR C;  2R3Z A;  5CYU A;  2R92 G;  4LUZ A;  1L1O A;  3S2D H;  1HA6 A;  3HKZ G;  3ERQ A;  4QY7 A;  3X3M A;  4HSV A;  2J7Z A;  3C46 A;  1RL2 A;  4CDD C;  4GOP A;  3NE5 B;  5IP7 G;  2N88 A;  4TRD A;  1HPC A;  4OEM B;  3DWA A;  3CW2 C;  1RTN A;  2OTL A;  1VQI A;  1EYA A;  1ZYR D;  3FPP A;  2NVQ H;  4LWC A;  5C5M A;  2E75 C;  1MBY A;  1V1Q A;  2JP1 A;  2RHQ B;  3MEF A;  1VS0 A;  4A3I B;  1LTS D;  4I7Z C;  2EYP A;  3I55 A;  2XRS D;  4JI1 Q;  5KRU A;  3S17 H;  4LF6 Q;  2NZH A;  3HOV H;  4H02 A;  1S5E D;  1E2Z A;  2VL6 A;  1Q3L A;  2CKZ B;  2JA6 G;  2NN6 I;  1YHA A;  3S1R B;  2RVL A;  2JK8 A;  1M1K C;  4LF4 L;  2B2T A;  1Q90 A;  2NN6 G;  1ET9 A;  2F0J A;  1JOR A;  1Q7Y C;  4IUU A;  3DEO A;  1QIL A;  4GN3 B;  2GVA A;  5M5W H;  4X3K A;  5DAU A;  3ULP A;  1HXY D;  1NMG A;  3U9O A;  2B8F A;  1MHW C;  5D3D A;  1I3Q B;  4DNI A;  2EJF C;  1HNW Q;  3LGJ A;  1RCV D;  2XWJ B;  3NP8 A;  4JI1 L;  1GJX A;  4LF6 L;  2IL8 A;  3L3O C;  4YWK A;  5HUR A;  2MP1 A;  2WP8 J;  1A3U A;  2K01 A;  2M00 A;  2JA5 G;  4KJN A;  4QCL A;  3BDC A;  1VQN A;  1C48 A;  2MO0 A;  3GTM B;  1PVO A;  1I50 B;  3P20 A;  4IUQ A;  4JI7 Q;  3S24 A;  5EPJ A;  4BBR H;  1Y8N B;  4TVA B;  3GTL B;  4IPH A;  5COY A;  3NWT A;  3GV6 A;  2CHB D;  3KDF B;  4B9W A;  1HNX Q;  2PZU A;  3HOX H;  2IT1 A;  2Q8R E;  4GNX B;  4DR3 Q;  3NTI A;  3HEJ A;  1HNW L;  1P16 A;  2F0K A;  1KC8 C;  5C3E G;  2A74 C;  3TP7 A;  3NEM A;  4FF4 A;  4JYA Q;  2NVT H;  3S14 B;  1DOM A;  2F0G A;  2RKS A;  4R1J A;  3S15 H;  3EJI A;  1X9N A;  4A3M B;  3HG9 A;  1U4R A;  2K5W A;  1GM5 A;  1I6H B;  4IUT A;  3CC4 A;  1PTO F;  1LTG D;  1YIT A;  3L7Z C;  1DOL A;  3NBH A;  1O7L A;  4QB4 A;  4GOP C;  1HNX L;  3S2D B;  1LTR D;  1SJH D;  1D1K A;  1IXR A;  3EA6 A;  4DR3 L;  2ZXP A;  1HH2 P;  1TS4 A;  4FXG C;  4XYO A;  4IPC A;  5ISR A;  3T51 B;  4HAE A;  2R7Z G;  1T5E A;  3Q24 A;  4JYA L;  1JB3 A;  2UXC Q;  1MIU A;  2VUM H;  3TDQ A;  2BDN A;  2EYF A;  4NW2 A;  3PCO B;  4DV2 Q;  2F52 A;  5ELN A;  4OWX B;  2NVQ B;  5FJ8 H;  1JWS D;  2HCI A;  1E1T A;  2EE1 A;  2F3V A;  1F2L A;  3H15 A;  1UE7 A;  2Q8T A;  1X3G A;  2VB3 X;  4WJ3 M;  1LT3 D;  2IX3 A;  3K5N A;  3S17 B;  1TKW B;  3H3V H;  4XQQ A;  3H6M A;  3HOV B;  4BY7 G;  2B2T C;  3AB9 A;  3F8T A;  2R7D A;  5F2D A;  5IGB A;  2JA6 B;  2ICI A;  2OCE A;  1BR9 A;  4K5V A;  5CC4 A;  4GNX A;  4MTN A;  5K36 H;  2SOB A;  4DUZ Q;  2UXC L;  2EDG A;  1U4P A;  3OWF A;  3E5S A;  3NTH A;  3NEL A;  1EIY B;  1LT5 D;  2F0I A;  2DY8 A;  4B9X A;  2B2W A;  4DV2 L;  2XVS A;  3QOJ A;  5NUC A;  3VA7 A;  3HOU G;  1XTD A;  1D6E C;  3I70 A;  4R9W A;  4CGY B;  5IYB G;  2PW5 A;  5C4Z A;  1IKL A;  4C3I G;  1IBM Q;  2NBF A;  4HJ8 A;  3PO3 H;  2EYJ A;  2RBM A;  1SE8 A;  4IPG A;  1YJN A;  3S1N H;  1VQ9 A;  3KK7 A;  4A3J H;  3K59 A;  4DUZ L;  5A35 A;  1S3O A;  3WDN A;  5M3M H;  2IHF A;  1WOC A;  1J6Q A;  2WFW A;  1C0A A;  2Z4H A;  5J3B A;  3CP0 A;  5E4X A;  3HOX B;  1PH4 A;  2PQA B;  1ET6 A;  1OO9 B;  4DR4 Q;  1X32 A;  4OIJ A;  4B3R Q;  3SK5 A;  2FJ2 A;  1PH1 A;  2F0T A;  5CV7 A;  1X65 A;  5DM6 3;  2YYZ A;  4IFD J;  5COR A;  1Y69 U;  1BQQ T;  2B29 A;  2B2Y A;  3T13 A;  1L0X B;  2WIN B;  2HD3 A;  1LTA D;  3ZJY C;  3BYT B;  3H0G G;  5J1Z A;  5IGC A;  1IW7 C;  4M8A A;  1TY2 A;  2OQ0 A;  3CCE A;  1H95 A;  1ASY A;  5G3L F;  4POF A;  4KMU C;  3M4Q A;  4HJA A;  2ZJP A;  1K0S A;  2F0O A;  2HDL A;  4R4Q A;  2I46 A;  3DUZ A;  1E24 A;  1EZ8 A;  3OIQ A;  2IW3 A;  4KKU A;  1C8C A;  2VUM B;  1EFI D;  2A19 A;  1IW7 D;  3GD7 A;  4FXD A;  1VQH A;  4G7H C;  3OIP A;  5FLX c;  3TP8 A;  2JA7 G;  4C3H H;  3AEV A;  1IYV A;  1B3A A;  1J5E Q;  3WWV A;  1TVX A;  4MN3 A;  1SLJ A;  4L5S A;  2QEJ C;  1PZK D;  5JPM C;  3FKI G;  2Z4I A;  3SDZ A;  4DGZ A;  2HDM A;  1E1O A;  4EQ5 A;  4DV6 Q;  4A3D G;  3H94 A;  1EYC A;  1EY0 A;  4P72 A;  4CDE C;  2LMC B;  3K0X A;  2FMM A;  1FNV A;  1NAP A;  4IQZ A;  3HKZ E;  3R3O A;  2PQE A;  4ZAI A;  1IKM A;  2L55 A;  4BBS G;  4ZQ3 A;  3CCJ A;  3UDI A;  3NUC A;  1J9O A;  1I94 Q;  4G7Z C;  1H9J A;  1WD0 A;  3MXG A;  5E1F A;  2K32 A;  4UP7 A;  1PYB A;  4TKO B;  3KBX A;  4DV6 L;  2F0S A;  1ENF A;  1EU4 A;  5EAY A;  1Y1W G;  2PMZ B;  1YBY A;  1YI2 A;  4JI0 Q;  1HFN A;  5IY0 A;  1T9H A;  1VQB A;  4CKC A;  1S40 A;  3M7G A;  3G4S A;  2QCP X;  4N8F A;  3S16 H;  2GA4 B;  4LFB Q;  4JBK A;  3NQT A;  1I94 L;  1VCI A;  4BS9 A;  2ZTD A;  2SDF A;  4LFA L;  2AQ3 B;  2ATW A;  3HOW H;  1WVL A;  2PNH A;  1SE3 A;  3U4V A;  4DAP A;  4R4T A;  3DHQ A;  1TR5 A;  2Q2I A;  4DN4 M;  1X54 A;  3HOZ G;  2RF4 A;  1EUJ A;  4X6A H;  1MSH A;  1Q46 A;  3G6J B;  2NTT A;  1EU3 A;  4FP5 D;  4RMF A;  3A5Z B;  4LFB L;  2GN5 A;  1QJO A;  2OWO A;  1QE6 A;  1WJJ A;  1EWI A;  2PO4 A;  5H1S E;  3OYY A;  1H9M A;  3F1Z A;  1XYI A;  2WAQ B;  3ERS X;  3DWP A;  1I6V C;  2QEX A;  3NPP A;  4C3H B;  3TP5 A;  2K52 A;  5HGQ A;  4A3F H;  5JEA H;  4I7A A;  5K5P A;  4BY1 G;  4ZCK A;  1UAP A;  1UE5 A;  1STH A;  4J1M A;  3NK9 A;  4IZ8 A;  1PMR A;  4A3L G;  1YZ6 A;  2EOT A;  2KQ3 A;  2IHE A;  1CHP D;  4X3U A;  4ZUJ A;  1PHJ A;  4P71 A;  1HUN A;  2RCF A;  1CKN B;  1KD1 C;  2ICE C;  4ZKC B;  2A5H A;  3LNN A;  4DR1 Q;  1WTP A;  2C35 B;  2QF7 A;  4K2K A;  3GTP B;  3SVM A;  2L1B A;  1ROD A;  2L11 A;  1PA6 A;  3PF5 A;  2E76 C;  1MJE A;  2NUC A;  2Q8I B;  2ZJR A;  1ENC A;  2Z6K A;  1DYQ A;  1X6O A;  1IL8 A;  1X56 A;  2R93 G;  1CM9 A;  1RTO A;  1Y1W B;  3MWY W;  2JA8 H;  3M4O H;  1OXV A;  1Y8O B;  1OXU A;  5GQO A;  1G29 1;  4YHH Q;  4NXN Q;  2K75 A;  4DR1 L;  3T1H Q;  3PO2 G;  2DNC A;  1N36 Q;  3S16 B;  4MIU A;  1C7Y A;  3HOY H;  4OWT B;  1KTK A;  1I4X A;  1Q1E A;  1YEZ A;  2X6L A;  1JIC A;  3HOW B;  1CKM A;  1I4H A;  2WB1 B;  3D4R A;  2XGT A;  5M3F G;  5FLX L;  2KCC A;  4KI0 A;  1GXD C;  3J7A F;  3NQI A;  2X6G A;  4RG1 A;  4LUO A;  3TRE A;  4DK6 C;  5GAE C;  1DGS A;  4CDF C;  2RDF A;  4A3E H;  3HP3 A;  3M7N A;  3HOZ B;  4NXN L;  4YHH L;  2IX1 A;  4PZ8 A;  3GTJ B;  1N36 L;  3L2P A;  1SYE A;  2HQE A;  2B2U C;  1BF4 A;  2CCZ A;  1CKN A;  3TZU A;  1SNQ A;  3T56 B;  3RN5 A;  1HCZ A;  5CBE E;  2N3S A;  2Z9H A;  2A6E C;  4XQN A;  4PV1 C;  1PRT F;  2MUY A;  3UDX A;  1QVG A;  2JXM B;  3BVG A;  1A62 A;  1SNP A;  4A3F B;  1ESF A;  2PMZ E;  4GKJ L;  1RD9 D;  4K0K Q;  5AJ3 L;  1E2V A;  3KYH C;  3M9B A;  3KLS A;  3VR2 A;  5TSS A;  4LNQ A;  2MQH A;  4CJ2 C;  1SFO H;  1O78 A;  1AW7 A;  2A6E D;  2JA9 A;  1ZEQ X;  4JBJ A;  2XWB B;  1MJC A;  5C0X H;  4RGT A;  3QIA A;  4UAI A;  5KNB A;  4DR5 Q;  5BN4 A;  1NNX A;  1MGS A;  4JI3 Q;  2F0D A;  4A3B H;  3S1Q B;  1TII D;  1QUQ A;  4ILW A;  1G6P A;  3FMC A;  4BA1 I;  5FO8 B;  5IOC A;  4A3I G;  2JQO A;  3D6C A;  4L5T A;  4K0K L;  5IIF A;  1HR0 Q;  3CC7 A;  3GP7 A;  1XTC D;  3HKS A;  1EYG A;  1IZ6 A;  2OF1 A;  1L0Y B;  2PCF B;  5AFW A;  4AQY Q;  3OOC A;  1S72 A;  4FYD A;  4DV1 Q;  3VYU A;  3W1G A;  2EY6 A;  2HIV A;  4WOR A;  3UI2 A;  1XNR Q;  1L1O B;  2J4X A;  1YVC A;  4MNO A;  5LL6 S;  3LWU A;  1WCM H;  1ML0 D;  2R93 B;  2Q2H A;  2L5T A;  4DR5 L;  4WRD A;  2AWO A;  4YWM A;  5A2Q L;  4DV7 Q;  3PMF A;  4GOP B;  1DZ1 A;  4V19 0;  1HR0 L;  5JJL A;  2JSO A;  4F88 A;  4DV0 Q;  1EWH A;  2I0Q A;  2DJG C;  2E74 C;  3Q8D A;  1LT6 D;  2KEC A;  3KJO A;  4DV1 L;  4Y52 H;  3IKJ A;  3VA5 A;  1FVI A;  1BOS A;  1XNR L;  2A6H C;  4N9T A;  4JC0 A;  5LMN Q;  3O13 A;  2PPB C;  2LXK A;  3PUV A;  4DV7 L;  4HCS A;  1C4Q A;  3BU2 A;  1STB A;  4X64 Q;  4A3E B;  1F2Y A;  3MTS A;  1MD2 D;  3TBI B;  3PIP 3;  1SNC A;  1PRT B;  4DV0 L;  1EQV A;  3J7A V;  2K04 A;  1QVF A;  3ULJ A;  2A6H D;  1G8Z D;  4OXP A;  1ZXT A;  1Y14 B;  5KYI A;  2PI2 A;  3U50 C;  3RMH A;  3R2I A;  3SGI A;  3BVM A;  4UDU C;  2ZXO A;  1UNS A;  5LMN L;  1DD2 A;  1NBW A;  4JI8 Q;  4U67 3;  3TME A;  5BR8 L;  1F2M A;  4NXM Q;  3UE1 A;  1IHZ A;  3GTO H;  3VR5 A;  1IBL L;  2N78 A;  1EIG A;  4X64 L;  1D5X C;  2NZO A;  4HSP A;  4OHJ A;  3D4W A;  2EIF A;  2E8G A;  1QVC A;  4R8I A;  1GUN A;  2B8G A;  1A0I A;  4LF4 Q;  1FYC A;  2WV6 D;  1SFO B;  3DWQ A;  5EQ0 A;  3SE0 A;  3D3R A;  4DF7 A;  2VQF Q;  1BDO A;  5C3W A;  4WJ4 A;  4A3B B;  3CCL A;  5BN3 A;  2A69 C;  2LY7 A;  4JI8 L;  1B9M A;  4QIW B;  4NXM L;  4FF3 A;  2BOS A;  1TXY A;  5C0X J;  4K5W A;  3CCV A;  1A6X A;  3E9H A;  2ENB A;  3HOV G;  2K5N A;  1VQ7 A;  2NVX H;  1NE3 A;  1CTM A;  5A2Q E;  4KLK A;  1AE3 A;  4L6T B;  4RWS C;  4OON A;  4XDX A;  1JOK A;  1FD7 D;  1PH5 A;  3NBH B;  2EYH A;  1WCM B;  2A69 D;  1YNN D;  1CFM A; 
#chains in the Genus database with same CATH homology
 2NYZ D;  5KND A;  2EVB A;  2KED A;  1LAB A;  4DNT B;  3Q22 A;  1B44 D;  1ENA A;  4JK1 C;  1ILP A;  5I6Y A;  3D31 A;  4QF4 A;  5I2Y A;  1LLR D;  1D1I A;  4B08 A;  3H91 A;  1HUM A;  2AUK A;  3Q23 A;  1KAA A;  4IFD I;  1PFN A;  1BCP C;  4TQU S;  4RKL A;  3A55 A;  4IFD G;  2NTS A;  1DCZ A;  2F0M A;  3FPU B;  5FKA C;  4K6L A;  2O5I C;  4FO2 A;  1CI3 M;  2R6G A;  3P1H A;  3OPO A;  1BCP D;  3BDO A;  3VYS A;  1GHK A;  2IWH A;  2KHS A;  2F0L A;  4WFN 3;  3GTO B;  1CHQ D;  1X3P A;  4IUN A;  2M9V A;  1LT4 D;  3OW7 A;  5ELF A;  2AQ2 B;  1T5X D;  3OSO A;  1AZP A;  1K8M A;  4OO1 H;  4DU9 A;  4ZLT F;  1SJE D;  1A2T A;  2Z1C A;  3KUP A;  3MXN A;  5CV9 A;  1HQM C;  3OHX C;  2BE5 C;  4HCE A;  5JVH 3;  4RA8 A;  2XRQ D;  5IOD A;  5CV8 A;  5K36 G;  2K5D A;  1JWU D;  1I4P A;  3CRK C;  4G4K A;  1VMP A;  2NVY B;  1LV9 A;  2EPB A;  2IPK D;  2BE5 D;  3SHL A;  5M5W B;  1STN A;  1R4P B;  4K6D A;  2F0W A;  1SE2 A;  1PZJ D;  4K14 A;  1V1P A;  1F2Z A;  3QWN A;  3PIO 3;  3D4D A;  5M5Y B;  1I4G A;  1HTL D;  4BBR B;  4M1U B;  2LFN A;  3MXU A;  4XT1 B;  4KN7 C;  5D3I B;  2E2J B;  3IFD A;  1CT1 D;  3MEH A;  3VR4 A;  3VR6 A;  2B63 B;  1D2B A;  1EY9 A;  4KY5 A;  3S15 B;  1B4O A;  5LHY 1;  3QO2 A;  1H9S B;  2K5Q A;  4KY6 A;  2I07 B;  4HN7 A;  3RZO B;  3JAM E;  1TU2 B;  3ZYY X;  2XNA C;  5JVG 3;  2NB0 A;  2JE6 I;  3S1M B;  1SYD A;  1PDQ A;  1J8I A;  4CJ0 B;  1DJR D;  1V1O A;  4J8Q A;  1QB5 D;  1RF2 D;  4C3H G;  4RHS A;  1TWG B;  3Q6S A;  4KKS A;  1BNZ A;  3PUY A;  3CU7 A;  4I65 A;  3R93 A;  4S3S A;  1GHJ A;  4IUP A;  4LJZ C;  1AP0 A;  3RZD B;  4RGN A;  2M2L A;  1YNN D;  2B39 A;  5EJW A;  3BG3 A;  5D65 A;  1PXU A;  3AU7 A;  1H9S A;  4MHE A;  3FEW X;  1HRJ A;  3A7A B;  2FIN B;  3PO3 B;  4EQN A;  3S1N B;  5ELB A;  5J22 A;  4A3J B;  2L0C A;  2Z8L A;  2AQ1 B;  3J81 L;  5M3M B;  1QG7 A;  1JWM D;  1V8Q A;  2K28 A;  3V96 A;  4A3K B;  2CVR A;  3QJY A;  3K5L A;  3WOF A;  4KTA A;  3KF8 A;  1EOT A;  1TWF B;  4ZKB B;  2K7V A;  4HMI A;  3I3C A;  1VDZ A;  2D9U A;  1VF7 A;  2MJ8 A;  3J80 L;  2RDH A;  1GUO A;  3BVZ A;  2XIW A;  3C1F A;  1R4Q B;  4KN4 C;  2O4X A;  4K8J A;  3MA2 B;  1NSN S;  5C4J B;  3MHB A;  1SND A;  3NTK A;  1TS2 A;  3W2D A;  1DON A;  4F87 A;  3MAQ A;  5KEE A;  3TP6 A;  1SYC A;  5C44 B;  4DAY A;  2B2U A;  1M4V A;  1YNJ C;  1E2W A;  5C4X B;  3C3L A;  5CV6 A;  4KHZ A;  2KJX A;  1TWC B;  5JEA G;  2TMP A;  1GOZ A;  2SEB D;  4FNF A;  1NR4 A;  1STE A;  2DY7 A;  4ZYS A;  1GUG A;  1WTW A;  3W3A A;  2RDG A;  1YNJ D;  1CQV A;  1Q8I A;  3J81 E;  2EYL A;  5CGK A;  2ZT9 C;  1QOH A;  3MXP A;  4XIG S;  4HED A;  1SMY C;  5JOB A;  4QUF A;  4U68 A;  1PTO C;  5C6A A;  1Z47 A;  2EZV A;  1XX8 A;  3I4L A;  5JAV A;  2O2L D;  3D6W A;  2WKC A;  3BZD B;  1EYD A;  1XXG A;  1UEA B;  3R2T A;  1S5C D;  2C9O A;  1SMY D;  3NWS A;  3J80 E;  1PTO D;  3GV3 A;  5I9P A;  2D62 A;  3K5O A;  3K57 A;  2HUG A;  1ONL A;  2J0T D;  2F0P A;  5J39 A;  2L9H A;  4EVO A;  1U4M A;  2PNR C;  5FK9 C;  2VNU D;  2NWG A;  5LL6 X;  2PYK A;  4L63 B;  1SEB D;  4IUR A;  1M8A A;  2A73 B;  1W6K A;  4RAU C;  3I4M B;  4J6H A;  3P75 A;  5IGG A;  4IAL A;  1ILQ A;  4DXF A;  4Z9C B;  2BDO A;  3CHB D;  4CHT B;  1LTT D;  1EY5 A;  2CQA A;  3ND9 A;  1SNM A;  1NR2 A;  1BBX C;  2EJM A;  2ID0 A;  4JBW A;  3P7J A;  5ELC A;  4G7O C;  2D2C C;  1AZQ A;  5DM7 3;  5C0X I;  5JEA J;  2LKV A;  5C0X G;  2EY2 A;  5CR3 A;  3D8G A;  1BCP B;  2RSN A;  4FXK C;  1LAC A;  5M5X B;  3GTG B;  1KNA A;  4K8I A;  3S2H B;  1EWC A;  5ELD A;  3NHH A;  5I6W A;  3PV0 A;  1NUC A;  2CW0 C;  4K2L A;  4EGV A;  3KBG A;  2WII B;  1I4R A;  3MFG A;  1JCK B;  4HTH A;  2KA7 A;  1CZG A;  4Q5V A;  5EBD A;  2JA8 B;  3M4O B;  1GUW A;  4BWG B;  2RQX A;  5G3L D;  4F7X A;  1R9T B;  3A7L A;  3L9A X;  3I72 A;  3CKI B;  4ID6 A;  2CW0 D;  3HOY B;  1II3 A;  1GUT A;  1U9R A;  1FGB D;  2G9H D;  1ESR A;  1Q1B A;  1O7Y A;  4QUC A;  3HS0 C;  4O42 A;  1QCB D;  4H0L C;  1EY7 A;  3ITP A;  1WTQ A;  5JJZ A;  3HGB A;  2LS0 1;  3DMU A;  5E4W C;  1Y1V B;  3PUW A;  1AN8 A;  3OMC A;  2WKD A;  5EBC A;  3DEP A;  1G2T A;  1H9K A;  1F77 A;  1TT2 A;  2L12 A;  5KGU A;  1FR3 A;  5IGF A;  3I4N B;  3R8B A;  1PZI D;  3VYT A;  3EVQ A;  2R61 A;  4A3G B;  3BS1 A;  4WJW A;  2D5D A;  4KHV A;  2B2V C;  1ICW A;  2QIL A;  1RHP A;  2F0N A;  2RSO A;  2E2D C;  1YNN C;  1GUS A;  1EIH A;  2EJG C;  4XTC S;  1A3V A;  2KOL A;  1LTB D;  4C56 C;  1SYF A;  4KK7 A;  3A8J E;  1G2S A;  4DNR B;  2DN8 A;  4C3J B;  1BXT A;  2E2H B;  1CK1 A;  4KKT A;  2F03 A;  3M4Y A;  1EEF D;  3J7Y W;  2FFK B;  4K5X A;  1KNE A;  4DFA A;  2NN6 H;  3BYY B;  4ABN A;  1QNU A;  1STA A;  1H9R A;  3E6Z X;  3OWE B;  2K05 A;  4PNY A;  4RCO A;  3SK8 A;  2NZ1 D;  1F9P A;  3KLS X;  1DM0 B;  4KD4 A;  3V2T A;  1HTP A;  3K0Y A;  1PFM A;  1PLF A;  3K5M A;  2BA1 A;  1V1P B;  1A2U A;  2F1M A;  2HCC A;  4IFD H;  1OXS C;  1WD1 A;  2EYM A;  1KLU D;  4XYQ A;  4GZY C;  4EQO A;  1TY0 A;  4NKL A;  3H09 A;  2MGS A;  1PTO H;  3DXJ C;  1G91 A;  4H44 C;  3I90 A;  4OO1 I;  3RLF A;  4OIK A;  3JAM L;  4OO1 G;  3ONA B;  2SNM A;  4DK1 A;  1CA5 A;  2R92 B;  5I2X A;  3BDL A;  1SYB A;  1EY8 A;  3HKZ B;  4DA2 A;  4PMW A;  4KD3 A;  1Y8P B;  4RGO S;  1E0B A;  3HRZ C;  2NVX B;  2IX0 A;  5EGT A;  4R8N A;  4L8J A;  1WTO A;  3T53 B;  2MHV A;  1Z7T A;  4N9P A;  2MPM A;  5T1G A;  1XWE A;  1VF5 C;  1PRT C;  1CA6 A;  4QMG A;  3A8I E;  2F3W A;  2KCN A;  2SNS A;  2F0H A;  2KEE A;  2F4I A;  4RHR A;  1WTV A;  3I73 A;  3MVV A;  3VR3 A;  2L4N A;  2TSS A;  1QWY A;  3IAY A;  1JC7 A;  4KV6 A;  1PRT D;  2EYO A;  4TSS A;  1F9R A;  2VB2 X;  1WTX A;  4DK0 A;  4XXE A;  2JA5 B;  2E2I B;  1DOK A;  3T16 A;  3LX0 A;  3C2P A;  2JYO A;  1BUV T;  4NMZ A;  2OEO A;  2Y0S B;  4V0B A;  3I8Z A;  4OL7 A;  1WTR A;  3GTK B;  3ND8 A;  3GQB A;  5M9O A;  1HFG A;  1RJT A;  2FHT A;  5C3E B;  3CQZ B;  2PW7 A;  1PTO B;  4RKB A;  1V43 A;  1LTI D;  3K6O A;  4FVM A;  4NDX A;  3QG1 A;  3SXH A;  1X3Q A;  1JE4 A;  1CZW A;  5EKK A;  4EQP A;  1FNW A;  3IL8 A;  3ERO A;  2R7Z B;  1DXM A;  4NP5 A;  5BN5 A;  4IN3 A;  5E3F A;  3GTQ B;  1TWA B;  2O5J C;  3C1E A;  2RA4 A;  1S5D D;  3M3Y B;  3EFX D;  4ZK9 B;  4LMQ D;  1UUP A;  2X69 A;  4XQJ A;  4CKE A;  4ME5 A;  4BY7 B;  5EPK A;  3X3N A;  4IUV A;  3K7A B;  2B2W C;  5CBA E;  1EL0 A;  4LAA A;  1F9S A;  1AFP A;  3FDT A;  1OXT A;  3HOU B;  2JEB I;  4C3I B;  2VXW A;  5KIX A;  5IGD A;  2WAC A;  1RDP D;  3V05 A;  4CJ1 B;  4P2C B;  4PQX A;  5HGT A;  3URY A;  3U9S A;  2C5C A;  5IGE A;  2H4O A;  4H13 C;  1W6J A;  4KY7 A;  5C5L A;  5FOB B;  5ELE A;  3HZX A;  1KDA A;  3MZ5 A;  2F0U A;  2B2Y C;  4C1N K;  4C2M B;  3QB3 A;  2XSC A;  2EXZ A;  4LK1 C;  3IFT A;  1OXX K;  3H0G B;  1TS5 A;  3I91 A;  1RKN A;  1EY4 A;  1JOQ A;  1S5F D;  5EKI A;  2XN9 C;  3DM1 A;  2F0Q A;  2IJ0 A;  1SYG A;  4FF1 A;  2A68 C;  1B53 A;  3SK4 A;  1HHV A;  1KDC A;  1S5B D;  2G9D A;  2JEA I;  1I4Q A;  3SR1 A;  2JA7 B;  4DAV A;  2H1E A;  3AMU A;  5KNC A;  3EQL C;  2A68 D;  4BA2 I;  1HA5 A;  1SE4 A;  4ZRZ A;  4C1N I;  1B2T A;  3Q0A A;  3G7L A;  1BCP F;  3N6R A;  3TZD A;  3FKI B;  2PZW A;  2ZXR A;  1B50 A;  4A3D B;  3QOL A;  1A15 A;  5T1I A;  4RCN A;  4OGQ C;  5JPN C;  3E0J A;  3T4A C;  3S9W A;  1JOO A;  4BBS B;  4Q0F A;  2OT2 A;  2FMC A;  1TS3 A;  3RD4 A;  3LWE A;  5I9O A;  1Q12 A;  4HR7 B;  1EY6 A;  2KVM A;  1D5Z C;  4YIJ A;  4DXG A;  4ODG A;  5FO7 B;  4H7B A;  3M85 A;  4Y7N B;  5CMD A;  1KLG D;  1FNU A;  2AUJ D;  1VMC A;  1SDF A;  1TQO A;  3H3V C;  2F0F A;  3VYR A;  3N52 A;  5DNF A;  1O80 A;  2YU9 B;  3RUZ A;  4FF2 A;  1JQY D;  3K58 A;  4E6I A;  2AWN A;  1ZKO A;  3TSS A;  1MI2 A;  3CRL C;  1O7Z A;  3KLR A;  4ZUI A;  1A3T A;  3A56 A;  3NSW A;  1JR0 D;  1B9N A;  1G6Z A;  2KUM A;  3A54 A;  3NXW A;  4F8M A;  1SAP A;  4HMJ A;  5IT9 L;  2EY1 A;  1MSG A;  3SEB A;  2QKI C;  4CKB A;  4CBV A;  1KAB A;  2B2V A;  2K6A A;  5FO9 B;  4BY1 B;  3NBI A;  4A93 B;  3PUX A;  2PZT A;  4PMC A;  5DEH A;  1D5M C;  4O1N A;  5C3X A;  4RFB A;  4KJO A;  1LO5 D;  3FVQ A;  4C3J G;  2K03 A;  2V4D A;  3TN2 A;  3PUZ A;  4G57 A;  5CV4 A;  1HQR D;  4RGM A;  1EEI D;  1U4L A;  1KDB A;  2K1B A;  5EKL A;  1STY A;  2F0V A;  1K83 B;  4PMB A;  4X3S A;  1PFB A;  1AEX A;  4ULL A;  1B1Z A;  1BO0 A;  1F9Q A;  5I4D A;  1SSO A;  3FRP B;  2N55 A;  1K8O A;  2F0E A;  1TWH B;  5CV5 A;  2K33 A;  5D14 A;  2QDB A;  1SBB B;  1SNO A;  1QNK A;  3PO2 B;  3F2U A;  1Z6H A;  1SXT A;  1CQF A;  5FLX E;  2BA0 A;  1EQT A;  3A8K E;  5M3F B;  1PYW D;  1EZ6 A;  4AYB B;  1STG A;  5IT9 E;  3MC0 B;  5EPL A;  3MFY A;  1NCV A;  5KYL A;  2BCO A;  3OMG A;  3WOE A;  1S4Z A;  2OXP A;  4X3T A;  4XT3 B;  3GO5 A;  4RH6 A;  2DNE A;  1IYU A;  2EY5 A;  3SK6 A;  1ZYR C;  2R3Z A;  5CYU A;  1HA6 A;  3ERQ A;  3X3M A;  4HSV A;  2J7Z A;  3C46 A;  3NE5 B;  2N88 A;  4TRD A;  1HPC A;  3DWA A;  1RTN A;  1EYA A;  1ZYR D;  3FPP A;  5C5M A;  2E75 C;  1MBY A;  2JP1 A;  4A3I B;  1LTS D;  4I7Z C;  2EYP A;  2XRS D;  5KRU A;  1S5E D;  1E2Z A;  1Q3L A;  2NN6 I;  3S1R B;  2RVL A;  2B2T A;  1Q90 A;  2NN6 G;  1ET9 A;  2F0J A;  1JOR A;  4IUU A;  3DEO A;  1QIL A;  4X3K A;  5DAU A;  1HXY D;  3U9O A;  2B8F A;  5D3D A;  1I3Q B;  2EJF C;  1GJX A;  1RCV D;  3NP8 A;  2XWJ B;  2IL8 A;  3L3O C;  5HUR A;  2MP1 A;  2WP8 J;  1A3U A;  2K01 A;  2M00 A;  4KJN A;  4QCL A;  3BDC A;  1C48 A;  3GTM B;  1I50 B;  3P20 A;  4IUQ A;  5EPJ A;  1Y8N B;  3GTL B;  5COY A;  3NWT A;  3GV6 A;  2CHB D;  4B9W A;  2PZU A;  2IT1 A;  2Q8R E;  3NTI A;  3HEJ A;  2F0K A;  2A74 C;  3TP7 A;  4FF4 A;  3S14 B;  1DOM A;  2F0G A;  2RKS A;  3EJI A;  4A3M B;  3HG9 A;  1U4R A;  2K5W A;  1I6H B;  4IUT A;  1PTO F;  1LTG D;  3L7Z C;  1DOL A;  3NBH A;  1O7L A;  4QB4 A;  3S2D B;  1LTR D;  1SJH D;  1D1K A;  3EA6 A;  2ZXP A;  1TS4 A;  4FXG C;  4XYO A;  5ISR A;  3T51 B;  4HAE A;  1T5E A;  3Q24 A;  1JB3 A;  3TDQ A;  2BDN A;  2EYF A;  4NW2 A;  2NVQ B;  1JWS D;  2HCI A;  2EE1 A;  2F3V A;  1F2L A;  2Q8T A;  2VB3 X;  1LT3 D;  2IX3 A;  3K5N A;  3S17 B;  1TKW B;  4XQQ A;  3H6M A;  3HOV B;  2B2T C;  3AB9 A;  5F2D A;  5IGB A;  2JA6 B;  2ICI A;  5CC4 A;  1BR9 A;  4K5V A;  5K36 H;  2SOB A;  2EDG A;  1U4P A;  3OWF A;  3E5S A;  3NTH A;  1LT5 D;  2F0I A;  2DY8 A;  4B9X A;  2B2W A;  2XVS A;  3QOJ A;  5NUC A;  3VA7 A;  1D6E C;  3I70 A;  4R9W A;  4CGY B;  2PW5 A;  5C4Z A;  1IKL A;  4C3I G;  2NBF A;  2EYJ A;  2RBM A;  3KK7 A;  3K59 A;  5A35 A;  3WDN A;  2Z4H A;  5E4X A;  3HOX B;  1ET6 A;  1OO9 B;  1X32 A;  4OIJ A;  3SK5 A;  2FJ2 A;  2F0T A;  5CV7 A;  5DM6 3;  4IFD J;  2YYZ A;  5COR A;  1Y69 U;  1BQQ T;  2B2Y A;  3T13 A;  2NVT B;  1L0X B;  2WIN B;  1LTA D;  3BYT B;  5J1Z A;  5IGC A;  1IW7 C;  4M8A A;  1TY2 A;  5G3L F;  4KMU C;  2F0O A;  2HDL A;  2I46 A;  3DUZ A;  1EZ8 A;  3OIQ A;  2IW3 A;  4KKU A;  1C8C A;  2VUM B;  1EFI D;  1IW7 D;  3GD7 A;  4FXD A;  4G7H C;  3OIP A;  3TP8 A;  1IYV A;  1B3A A;  1TVX A;  4MN3 A;  2QEJ C;  1PZK D;  5JPM C;  2Z4I A;  3SDZ A;  4DGZ A;  2HDM A;  3H94 A;  1EYC A;  1EY0 A;  2LMC B;  2FMM A;  1FNV A;  1NAP A;  4IQZ A;  3R3O A;  2PQE A;  4ZAI A;  1IKM A;  2L55 A;  4ZQ3 A;  3NUC A;  1J9O A;  4G7Z C;  1H9J A;  1WD0 A;  3MXG A;  5E1F A;  2K32 A;  4TKO B;  3KBX A;  2F0S A;  1ENF A;  1EU4 A;  2PMZ B;  1HFN A;  4CKC A;  3M7G A;  2QCP X;  2GA4 B;  3NQT A;  1VCI A;  4BS9 A;  2SDF A;  2AQ3 B;  1WVL A;  1SE3 A;  4DAP A;  3DHQ A;  1TR5 A;  4DN4 M;  1MSH A;  3G6J B;  2NTT A;  1EU3 A;  4FP5 D;  1QJO A;  1QE6 A;  2PO4 A;  1H9M A;  1XYI A;  2WAQ B;  3DWP A;  1I6V C;  3NPP A;  4C3H B;  3TP5 A;  5JEA H;  5K5P A;  1UAP A;  1STH A;  4J1M A;  3NK9 A;  4IZ8 A;  1PMR A;  2EOT A;  2KQ3 A;  1CHP D;  4X3U A;  4ZUJ A;  1HUN A;  2ICE C;  4ZKC B;  2A5H A;  3LNN A;  1WTP A;  2QF7 A;  4K2K A;  3GTP B;  3SVM A;  2L1B A;  1ROD A;  2L11 A;  2E76 C;  2NUC A;  2Q8I B;  1ENC A;  1DYQ A;  1IL8 A;  1CM9 A;  1RTO A;  1Y1W B;  3MWY W;  1OXV A;  1Y8O B;  1OXU A;  1G29 1;  2DNC A;  3S16 B;  4MIU A;  1KTK A;  1I4X A;  1Q1E A;  2X6L A;  1JIC A;  3HOW B;  1I4H A;  2WB1 B;  3D4R A;  5FLX L;  2KCC A;  4KI0 A;  1GXD C;  3J7A F;  3NQI A;  2X6G A;  2RDF A;  3HP3 A;  3M7N A;  3HOZ B;  2IX1 A;  3GTJ B;  1SYE A;  2HQE A;  2B2U C;  1BF4 A;  3TZU A;  1SNQ A;  3T56 B;  1HCZ A;  5CBE E;  4XQN A;  2A6E C;  4PV1 C;  1PRT F;  2MUY A;  2JXM B;  3BVG A;  1SNP A;  4A3F B;  1ESF A;  1RD9 D;  1E2V A;  3KLS A;  3VR2 A;  5TSS A;  4CJ2 C;  1O78 A;  1AW7 A;  2A6E D;  1ZEQ X;  2XWB B;  5C0X H;  4RGT A;  3QIA A;  4UAI A;  5KNB A;  5BN4 A;  1MGS A;  2F0D A;  3S1Q B;  1TII D;  4ILW A;  3FMC A;  4BA1 I;  5FO8 B;  5IOC A;  3D6C A;  5IIF A;  3GP7 A;  1XTC D;  2OF1 A;  1L0Y B;  2PCF B;  5AFW A;  3OOC A;  4FYD A;  3VYU A;  2EY6 A;  4WOR A;  3UI2 A;  2J4X A;  5LL6 S;  3LWU A;  1ML0 D;  2R93 B;  2L5T A;  4WRD A;  2AWO A;  5A2Q L;  3PMF A;  1DZ1 A;  4V19 0;  2JSO A;  4F88 A;  1EWH A;  2E74 C;  1LT6 D;  2KEC A;  3IKJ A;  3VA5 A;  1BOS A;  2A6H C;  4N9T A;  3O13 A;  2PPB C;  3PUV A;  4HCS A;  1C4Q A;  1STB A;  4A3E B;  1F2Y A;  3MTS A;  1MD2 D;  3TBI B;  3PIP 3;  1SNC A;  1PRT B;  1EQV A;  3J7A V;  2K04 A;  2A6H D;  1G8Z D;  1ZXT A;  5KYI A;  3RMH A;  3R2I A;  4UDU C;  3BVM A;  2ZXO A;  1UNS A;  1DD2 A;  4U67 3;  3TME A;  1F2M A;  1IHZ A;  3VR5 A;  1EIG A;  1D5X C;  4HSP A;  4OHJ A;  3D4W A;  4R8I A;  1GUN A;  2B8G A;  1FYC A;  2WV6 D;  1SFO B;  3DWQ A;  5EQ0 A;  3SE0 A;  3D3R A;  4DF7 A;  1BDO A;  5C3W A;  4A3B B;  5BN3 A;  2A69 C;  2LY7 A;  1B9M A;  4QIW B;  4FF3 A;  2BOS A;  5C0X J;  4K5W A;  1A6X A;  2ENB A;  1CTM A;  5A2Q E;  4L6T B;  4RWS C;  4XDX A;  1JOK A;  1FD7 D;  2EYH A;  1WCM B;  2A69 D;  5C4H A;  1CFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...