4N9PA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/l25a/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4n9pA00
4WORA 1NUCA 3H6MA 3MVVA 2F0OA 3BDCA 3QOJA 3TP6A 2OF1A 1SNQA 4RKLA 1JOQA 1EY7A 2EYHA 3PMFA 1TQOA 2F0GA 4KJNA 3SR1A 1F2YA 2F0WA 4K5VA 2PW7A 5CV6A 3SK5A 5I6WA 3HEJA 1SNDA 4HMJA 1A2UA 1EY0A 5NUCA 5IGEA 2M00A 3TP5A 3OSOA 2F0FA 3MZ5A 3NQTA 5KIXA 5ISRA 4MIUA 1SYGA 1F2ZA 4DGZA 5IGBA 4EQNA 3MHBA 5J1ZA 5KEEA 4KY5A 5EKKA 2SNSA 3D4WA 5F2DA 2F0EA 1EY8A 1SNOA 5CV4A 1A3VA 2O4XA 5IGGA 3DMUA 4K5XA 3P75A 4OL7A 2F0HA 5KYIA 1JOKA 4G57A 2EY6A 2EY1A 5C4HA 4QMGA 2LKVA 2RKSA 1U9RA 4PMBA 4QB4A 3SHLA 1STAA 4K2LA 5K5PA 2EY5A 3U9OA 1EZ6A 2SOBA 2EYFA 2F0SA 2F0LA 1SYDA 3E5SA 3ITPA 4J6HA 3EVQA 3D8GA 4TRDA 1A3TA 5CV7A 4YIJA 2SNMA 3TP7A 5KGUA 1KDBA 2F0PA 2EYMA 1II3A 5CR3A 4I65A 1EY9A 5CV9A 3T13A 1KDCA 2PYKA 5CV5A 5C5MA 3ERQA 4ZQ3A 1TT2A 5HGTA 2F0QA 4KV6A 2EYOA 3NUCA 3NXWA 4B9XA 4F7XA 3OMGA 4ME5A 3V2TA 4K2KA 4ODGA 1KABA 3OMCA 4R8NA 3SK4A 2EYPA 3SK6A 5CC4A 2F3WA 3DHQA 4NKLA 3T16A 1ENAA 1SYBA 2PQEA 5I9PA 3BDLA 5IGCA 4IALA 1A2TA 4J1MA 3C1EA 5C6AA 2PW5A 2F0NA 1EY6A 2PZUA 4RKBA 5I9OA 1EYDA 5M9OA 4EQPA 3P1HA 1IHZA 2EYJA 4KHVA 3TMEA 5KRUA 5J39A 1EYCA 2EYLA 4HTHA 4ID6A 4KTAA 1SYCA 3NHHA 4K8JA 4K5WA 4ZUIA 4N9TA 3VA5A 4E6IA 5IODA 4N9PA 4DU9A 3C1FA 1JORA 2F0TA 2F0MA 4KY7A 5I6YA 2EXZA 3D6CA 3EJIA 1EZ8A 3SXHA 1KAAA 2EY2A 3NK9A 5C4ZA 3HZXA 5IGFA 2F0KA 2OXPA 1KDAA 3S9WA 4PNYA 5E3FA 3EROA 4S3SA 2F0VA 4ZUJA 5J22A 1F2MA 1JOOA 1SNMA 2PZWA 4K14A 3SK8A 3MXPA 1TR5A 1SNCA 4IZ8A 4NMZA 5JAVA 2F0IA 2KQ3A 5HURA 3QB3A 4NP5A 5EGTA 5IIFA 4NDXA 5C3WA 4KD4A 4KD3A 1EQVA 2F3VA 1STBA 1EY5A 2F0JA 4KJOA 4LAAA 4PMCA 4EQOA 4EVOA 3R3OA 1EY4A 1STHA 5IGDA 5IOCA 2RBMA 1NSNS 4QF4A 4K8IA 1STGA 4KY6A 5DEHA 3TP8A 4HMIA 2F0DA 4B9WA 1STNA 5KYLA 4K6DA 1SNPA 2WACA 1EYAA 1RKNA 2RDFA 5C5LA 3D4DA 3MEHA 3NP8A 1ENCA 1A3UA 2OEOA 4IUNA 5JOBA 4DFAA 4F8MA 2KHSA 4WRDA 5EKLA 3RUZA 5C3XA 3QOLA 3OWFA 2QDBA 2F0UA 5CV8A 5CGKA 1SYFA 2ENBA 2PZTA 5DAUA 1STYA 2HQEA 3LX0A 5E1FA 1SYEA 1AEXA 4H7BA 2NUCA 4DF7A
chains in the Genus database with same CATH superfamily
1JQYD 3MVVA 4C3JH 1JOQA 5JVH3 2PO4A 3GTGB 4L6TB 2YYZA 2QA4A 1HUNA 1EFWA 1PTOD 3I72A 4X3UA 2PQAA 1N8RC 1O78A 1A2UA 3KF6A 4OO1G 5K36H 3L2PA 1FGUA 3MHBA 5LMNQ 1G6PA 2O4XA 4G57A 3SDZA 2EY1A 2G9HD 5C4HA 1XNRL 2YTYA 4A3GG 1I4RA 1IBML 1FJGL 1AH9A 1F9PA 4K2LA 1X3GA 4JI6L 2EY5A 1D7QA 3ICEA 1A0IA 5KGUA 2JP1A 1B9MA 4JBKA 4L63B 3CCRA 1G8ZD 2I0QA 1V1PA 3NELA 1S4ZA 4BBSG 3OMGA 1VS0A 1HJPA 4ODGA 4NXML 1DONA 1HR0Q 2IX3A 4IFDG 1UNSA 2JYOA 1ENAA 2PQEA 2MJ8A 1Q3LA 1EY6A 5M9OA 5C4XG 4LF5Q 2LFNA 1BO0A 2ZJQA 4HEDA 1PFSA 2A6HD 4E6IA 5ELBA 3VA5A 2UUCQ 3RZOH 4ME3A 1CHQD 1F77A 2LS01 3SVMA 3OTOQ 2KHIA 3QG1A 3S9WA 5IP7G 1F2LA 1BR9A 2BDOA 2F3IA 4ZUJA 3WOEA 5C3EH 2HHHQ 2VQFQ 3FRPB 4KJOA 2UUAQ 1ILPA 4TKOB 4K8IA 1STGA 4KY6A 4DV7Q 3FP9A 3S16B 2VY3A 3GQBA 5JJLA 2PI2E 4B3RL 1S5BD 2O2LD 4LJZC 5BR8Q 1IYJB 4PZ7A 2AMCB 4GNXA 3T53B 3S2HH 4JBJA 4ZKBB 4DV0Q 3W5OA 3HOUH 5C4JB 3K5NA 1PTOC 1HNXL 2K5DA 1VQMA 3S1RB 3PMFA 2BH2A 3W1BA 1NY4A 2WAQB 1HQRD 3U9SA 2Z4HA 2QCPX 1WYDA 3NBHB 3ND9A 2K5HA 3A74A 4IOAA 2NVYB 2Q2UA 2NVTH 2HQLA 4R4CA 4BY7H 5GAHC 3M3YH 4IPGA 5IGBA 2FINB 2PCFB 3CKIB 3KDFB 4LUOA 3SGIA 4KHZA 5KYIA 4HJ8A 1IBKQ 1STAA 1Y1VB 1KAWA 4CGYB 3WOFA 1NTGA 1A3TA 1BBXC 3ZYYX 4A93G 2B29A 4QUFA 2H5XA 3X3NA 1AZPA 1G2TA 5CV5A 5C5MA 3BYTB 1PVOA 4BY1H 4GN5A 3KUPA 3BVZA 2WB1G 3NXWA 4C3HB 4X65Q 1T5EA 4K2KA 3OMCA 4FYDA 4L5TA 1SBBB 2KECA 2EYPA 4DKAC 3IKJA 3J80i 3S1NH 5LMNL 1E2VA 3KF8A 1JT8A 3HKZG 1PFMA 4NXNQ 2XTIA 1CSPA 2A6HC 2EJFC 2AQ1B 4K8JA 2XVSA 2J4XA 3C1FA 2F0TA 1SE8A 2EXZA 5FO9B 4XT1B 3S24A 1PRTC 3I4NH 2OXPA 1D5XC 3CQZH 3GTLB 1M8AA 3MXPA 1SNCA 2RCNA 3RLFA 3TS2A 1HR0L 1PH9A 4LFCQ 1IW7D 1K28A 2GN5A 4JOIC 5JJKA 1GJXA 5KNBA 3J7YW 1N36L 1KNEA 4PG3A 1A6XA 4IUNA 4LF4Q 2UUCL 1UUPA 3OWFA 4QQBX 2R93G 3OIQA 2MFIA 1KIXA 4YWMA 1IKMA 3AU7A 1C0AA 3OTOL 1AEXA 1EWHA 1RHPA 2AUKA 4H7BA 4DF7A 4DNTB 1C4QA 4O1NA 1TS4A 1I5FA 2L1BA 4ZK9B 2EYHA 1FNWA 2VQFL 1LLRD 5IT9E 2NN6I 5JEAH 1N33Q 1L0WA 2F0WA 1Y1WG 2D9UA 3PSIA 1TWHB 5IT9c 3H0GG 5GROA 1KTKA 1VQGA 3TP5A 1JE4A 4DV7L 4HAEA 3OSOA 2L0CA 2K5VA 1ZXTA 4OEMB 1EFID 5KNCA 4A3DB 4GN4B 4EGVA 5F2DA 5IYCH 2XIWA 3QO2A 4HR7B 5CV4A 1HQMC 5ELOA 1DOKA 3K6OA 5BR8L 2EY6A 1G2SA 3G6JB 1CKNA 1PZID 4R4QA 4DV0L 2EYFA 2JA6B 1H9RA 3OW7A 3RLOA 3T13A 4JI7L 2LMCB 1DYQA 4CDCC 3T1YQ 1N32L 1LYLA 2B2YC 1S5DD 2AQ2B 3H09A 4F7XA 4POFA 2VXWA 4R8NA 4WJWA 4F88A 1SYBA 1WI5A 2NB0A 3RD4A 5IGCA 4IALA 4G7ZC 3HOXB 2DN8A 3CMAA 1UEBA 4RKBA 1B1ZA 2IW3A 3BU2A 5KRUA 1I50B 4IJLA 1R4PB 2Z6KA 2BH8A 4X64Q 4C56C 2RQXA 1V8QA 4O42A 4HN7A 3VR3A 3DM3A 3HS0C 4AYBG 3H91A 4ZKCB 3KJOA 3S17B 1JWSD 2QILA 3HGBA 3AB9A 4IUUA 2H4OA 5LL6X 5M5YH 1NE3A 1VQBA 2EQSA 3V96A 4R4TA 3O13A 5IP7H 1CUKA 1EOVA 4IZ8A 4X65L 1IW7C 5D65A 1VQCA 2Q2HA 3J80L 1HNZL 4EQOA 4APVA 4HJ9A 3TP8A 1PH8A 1W2BA 1D1KA 1MHWC 2Q2TA 1ZYRD 3E0JA 5JPMC 2WACA 4GOPC 1LV9A 3D4DA 3NP8A 2WP8J 4LF9Q 3GTQH 4A3FB 4BXXH 1IYVA 3NBHA 3RR5A 2LY7A 3SE0A 1PTOH 3J81L 1FGBD 1WTHA 4H02A 1PHJA 1VQLA 1KXLA 1U4LA 4Q5VA 1D2BA 3EQLC 1Z6HA 1V1QA 4DR5Q 2JA7H 3G7LA 3KDFA 1AE2A 1SE4A 2L4NA 3Q0AA 5ELNA 1E1OA 1EIGA 3UDXA 1XTDA 4F87A 4HMJA 4A3MG 1F9RA 2M00A 2CH4W 2I5LX 4A3EB 3ERSX 1OXSC 2Q8RE 1T9HA 2B8GA 4LF4L 4CKCA 3T4AC 4DA2A 4A3IG 3DMUA 1EU3A 5EKIA 2JA5B 3CCEA 3KLRA 4CBVA 2ALYB 1KRSA 4QMGA 2DY8A 2B63B 3A54A 2RA4A 3D8GA 4YIJA 2K52A 1K9MC 1RIPA 3NQIA 2FJ2A 2CH4A 3N52A 1GM5A 1T5XD 3ERQA 1PH2A 2R7ZG 3JAME 1KC8C 2JA8H 3AYHB 1VQOA 2QF7A 5FO8B 5LL6S 3JAMc 4C3JB 1VMCA 4P2CB 1O7IA 4J1MA 2PQAB 1CM9A 1YEZA 5I9OA 1HNWL 3QIAA 3KF6B 4FXGC 1HA6A 1MSGA 3L7ZC 1MSHA 1LO5D 3PQIA 3I4MG 4N9PA 1W6KA 2F0MA 3EIVA 2GVBA 1WTVA 2VS1A 2J0TD 1EZ8A 4IOCA 1ICFB 4DV4Q 4V190 1H9SA 1M90C 4OGQC 5C4ZA 2F0KA 1ZKOA 1D1IA 3L3OC 3T1YL 2FMCA 3A8JE 1JOOA 1XMOL 3WDNA 2JQOA 3BG3A 4YCUA 1WCMH 3MFYA 5IIFA 2R92H 2WKCA 4DV5Q 2FXQA 4G4KA 1ZYRC 1LT5D 3BVGA 3BZKA 4HMIA 2F0DA 1XMQQ 4B9WA 1PMRA 1B7YB 2RCFA 2Z4IA 3MFGA 4X64L 1H95A 1B4OA 1HUMA 4R4IA 1IBLL 2ZJRA 2Q8IB 2FMMA 4MZ9A 3AMUA 2KEDA 4A3JH 2KUMA 5AFWA 1HFNA 4C3IH 3VR4A 1HHVA 2ENBA 3D0FA 2R93H 1WTOA 4FNFA 4XDXA 4BBRH 2B2WA 3GTMH 1VQAA 2K7VA 2JEBI 3TBIB 4DV3Q 1CA6A 2Z0SA 3H3VH 2K28A 2MHVA 3RZOB 2MO1A 4K5VA 2I5MX 5KNDA 1XPRA 2ZTDA 1Y1WH 2F03A 4HIKA 2ZM6L 1B3AA 1L1OB 3E9HA 3GO5A 4DGZA 4EQNA 4HJ5A 1H9MA 5EKKA 4LF9L 4DV6Q 5C3EB 1HTLD 5JVG3 1SNOA 3CRKC 1LABA 3HP3A 1IBMQ 2F0HA 5L37A 1U0LA 4X3KA 2LKVA 2NN6G 3K80C 2HD3A 3I91A 3UDFA 3TEHB 3E5SA 4DR5L 2F0LA 3TP7A 1PFBA 4RCNA 3GP7A 1II3A 1DGSA 1PH4A 2MQHA 2A73B 4A3KH 4J15A 3CCMA 3GTKH 4GNXB 2MP1A 1NMGA 5M3FH 5I2YA 4C1NK 1CQVA 1GHJA 5EPKA 4QUCA 3HOVG 3S2HB 4NKLA 3KOJA 3HOUB 2NWGA 1KRTA 2B2UC 5IY0A 1A2TA 2F4IA 3I73A 3FVQA 4POGA 1YNXA 1K73C 2PPBC 2B2TC 4LK1C 2BDNA 4A76A 3CW2C 1W6JA 2NVTB 3HRZC 4BY7B 4B3ML 3M3YB 1VQ6A 1KDAA 1I6HH 5CBAE 4A75A 3S1QH 2K03A 5JAVA 1TR5A 5M3MH 1Q12A 4CJ1B 1BOSA 1OXVA 1EQTA 3M4OH 2L5TA 4GZYC 3CP0A 4N8FA 2NZ1D 4X62L 1X32A 1RKNA 4B3RQ 4BY1B 1FNVA 1SJED 1Z7TA 2QDBA 3U58A 5EQ0A 1C7YA 2PZTA 4DV4L 5DAUA 5LMUL 1RJTA 4DAMA 3S1NB 4OWWB 2DNCA 1SNQA 4IUVA 1Q1BA 2FHTA 3NBIA 2YTVA 3NE5B 3CCLA 1X55A 3FKIH 5M5XH 3SK5A 2QW7A 1SNDA 3QWNA 4KLKA 3G6EA 3I4NB 1JB7A 4FF1A 1SYGA 1LTBD 2A6ED 4A3BH 5DNFA 3LWEA 4KY5A 1VQPA 1S5CD 4CJ2C 2AQ3B 2SEBD 3HOWH 1U9RA 3URYA 1EWCA 1B9NA 1EZ6A 2SOBA 3EA6A 3K5OA 5CV7A 4DV3L 1TS3A 4JC0A 4CKBA 1ONLA 2IHFA 3MWYW 4JBMA 4U68A 1K83B 1HFGA 3DUZA 2NZOA 2AWNA 2UUBL 3A5ZB 1DZ1A 5GQOA 1I94L 2OCEA 4JI8Q 4FXDA 3DHQA 1EEID 2HDLA 3VYSA 3HOZH 3BDLA 4DV6L 2WKDA 4TQUS 3M4QA 1BCPB 4EQPA 3PO2H 3ZJYC 1XYIA 2EYLA 1BF4A 5DLQE 4TSSA 2A68C 3I4MH 1RD9D 2BA0A 4ULLA 3NK9A 1X3EA 5IGFA 1QNKA 4PNYA 1ET9A 1RF2D 2L55A 3A8KE 4CJ0B 1CKNB 4PZ6A 4XQNA 1Q81C 2L9HA 4NP5A 1Q86C 1NBWA 4X66Q 3K57A 2YU9H 4QF4A 1N36Q 5IWAL 1PZJD 1BVSA 4CHTB 2E2JH 1EYAA 2XNAC 4OHJA 4GLXA 2KCMA 1GO3E 1VQJA 1ENFA 1DOLA 2K04A 2A8VA 3LWUA 5IYDG 1TY0A 3TDQA 2B39A 1PRTD 1L1OA 3BS1A 1Y69U 3QOJA 4B3TL 2OF1A 1SRUA 1OTCA 2JE6I 3JC66 1ML0D 1MIUA 1XPOA 1PTOF 2A6EC 1PZKD 5COYA 2F4VL 1ASZA 5M5YB 4YCWA 1QZHA 4L5SA 4HJAA 3FEWX 1VQEA 3VYRA 1VQIA 4ZLTF 5IP9G 1C9OA 1LTSD 3DXJC 3F8TA 3SEBA 2Z9HA 3VYUA 2N3SA 2UXCQ 3I4OA 3KLWA 5K5PA 1SXTA 1BQQT 2WAQG 3AEVA 1B3QA 1H9KA 1ZEQX 4UPAA 4CKEA 3I55A 1CZGA 4JI7Q 3S14H 1GKHA 3W2DA 1N32Q 3GTQB 2JEAI 4ZQ3A 3S15H 3I3CA 1YNJD 2HCCA 3D6WA 4YWKA 2VQEQ 1Q8IA 1NNXA 4P72A 2ZXRA 1TIID 2JA7B 2EIFA 1WD0A 1Y1VG 2NTTA 3M9BA 2E2HH 2I46A 4XT3B 1GOZA 3GDEA 3HKSA 1STEA 1EYCA 1PXUA 4ID6A 3GV6A 4K5WA 4LF8Q 4DUYQ 1G291 3HFZB 3I8ZA 4JK1C 3HOYG 3NWSA 2B2VC 2X6GA 4C3HG 1I3QH 2C9OA 1JJ2A 4JI2Q 2XRQD 1S40A 3CCUA 3K7AH 4K14A 2K33A 1HNZQ 3MXGA 1JJCB 1M4VA 4JI8L 1PRTF 2F3VA 2MO0A 1VQKA 1GUOA 4PMCA 4EVOA 3A5UA 2DJGC 1QVCA 1YBYA 4DR2Q 2RBMA 3C46A 3J7ZC 4R4OA 1LTTD 1QCBD 1FL0A 3TN2A 4NW2A 2Z8LA 2TSSA 1NR4A 4RMFA 3G71A 3QOLA 2JA8B 1QE6A 2ZJPA 1WTWA 1HZBA 2QGQA 4JCVE 3F1ZA 5EJWA 2NVQH 4DK0A 3KK7A 4P71A 2ZT9C 2HCIA 4EX5A 1JWMD 3H6MA 5C44H 5ELEA 3T56B 1E2ZA 4KHPQ 1NR2A 1S5ED 2MUYA 1PYBA 1YJ9A 2KVMA 4LFBQ 4JG2A 4X66L 5I4DA 5CV6A 3PO3G 1H9SB 5AJ3Q 1CKOA 2H1EA 4XYOA 3JAMi 5EPJA 2KENA 3M4YA 1NAPA 4I7ZC 1EY8A 3J7AF 3RNUA 2VUMG 1WCMB 2LSSA 3K7UC 2R92B 3NTHA 3FHWA 4PMBA 3CCJA 1SAPA 1W3SA 1TVXA 4FF3A 5CR3A 2CQOA 4GS3A 1QZGA 3PUZA 4MHEA 5FO7B 5G3LD 1YNJC 2WINB 1TU2B 4A3JB 4C3IB 1PFNA 2EYOA 2K50A 4M1UB 4B9XA 4A3DG 4OO1H 2R93B 4JI1Q 4U673 1BBWA 1JJGA 2XN9C 4BBRB 2VNUD 1G6ZA 5CC4A 3GTMB 3GTOH 1HNWQ 5HGQA 4L8JA 1UWVA 2JA6G 1PH7A 3AFPA 1CSQA 4A3GH 2UXCL 1I4GA 4Y7NH 1JORA 3OPOA 4DU9A 1IL2A 2CVRA 5D3DA 2JK8A 3PF4A 3D6CA 4RGTA 4RHSA 4GKKL 3HZXA 2KHJA 4JI5Q 1E7ZA 1XMOQ 4S3SA 1VMPA 2G5DA 4BBSH 2P5ZX 1SMYD 3EBEA 3HOXG 3CC2A 4BA1I 2C5CA 2I5HA 3L9AX 2VQEL 1IL8A 5FJ8G 4HSVA 4JI0Q 4KD4A 2IL8A 2F0JA 4IFDH 1TS2A 1NSNS 1GUNA 5C4XH 3PIPA 1Z47A 1BXTA 1RL2A 1IBLQ 4DAYB 4R8IA 3I56A 4A3KB 2O5JC 5M3FB 4LF8L 4DUYL 2KBNA 4BA2I 1V1OA 4BS9A 1JR0D 4ZYSA 2ZXPA 1Q8KA 2HQEA 3WWVA 4JI2L 3GD7A 4JPBW 5FKAC 2NUCA 3RN2A 3A55A 4WORA 4WJ4A 2CW0D 5JJIA 1GUTA 4LMQD 5T1IA 1BUVT 1S5FD 3TQYA 3HEJA 2ZM6Q 4DR2L 1WTQA 1E0BA 3IFDA 3NWTA 4A3FG 5A35A 3CU7A 3GTJH 1Q7YC 3FPUB 4IUPA 2F0FA 3PIOA 3M85A 5G3LF 3C3LA 2QDLA 1I6HB 2PNHA 3S1QB 5EPLA 4GKJQ 1OXUA 4UHVA 2F0EA 5M3MB 2AKWB 5T1GA 3OW2A 1JOKA 4FO2A 4GOPB 3SHLA 5IP9H 2TMPA 1UE1A 2XRSD 4J6HA 3GTPH 4A3LG 2SNMA 3M4PA 4QL5A 3RZDH 3TZDA 4KHPL 2XWJB 2DY7A 2L11A 4P74A 4LFBL 2CKZB 2PYKA 5AJ3L 5DM73 2N88A 4DR4Q 3OYYA 4I7AA 2BCOA 5IE8A 2JA5G 5HY6A 1RCVD 3CF5A 3NTKA 3DEPA 3PCOB 2MPMA 3K5MA 1J6QA 2KCCA 2B63G 1B8AA 1Y1VH 3FKIB 5M5XB 4OIJA 3R93A 1P16A 4PZ8A 1EIYB 4B3MQ 3CCVA 4KY7A 2N8NA 4A93H 5I6YA 2ZTEA 2D5DA 4PQXA 3HOYH 4A3BB 3P7JA 3UE0A 2A5HA 4JV5Q 1SMYC 4C3HH 3J81E 2F0VA 3I70A 5J22A 1B70B 3J81c 4JI1L 3HOWB 1MD2D 1EQVA 2JA9A 3R3OA 1STHA 4X62Q 2UXBQ 2KJXA 3S1MH 4AIMA 3N6RA 1L0XB 1CHPD 5EBDA 2O5IC 1VDZA 5KYLA 1BDOA 1SNPA 5K36G 1YIJA 3NSWA 3G48A 4DFAA 4F8MA 5EKLA 4A3CG 4ALPA 1UE6A 3J81j 2A19A 2F0UA 5LMUQ 1YITA 1E2WA 2E5LL 3LNNA 1OXTA 2CW0C 1X6OA 3LX0A 4JI5L 1K8MA 5JPNC 3HOZB 3TRZA 4JOIA 4UY8C 3PO2B 1EIFA 1TQOA 2UXDQ 4JI0L 2D2CC 1CA5A 3PUWA 3CRLC 2PW7A 1CZWA 4O0AA 5NUCA 3PO3H 2KCTA 1WJJA 5JEAJ 4DPGA 1N9WA 2IWHA 2EOTA 1S72A 1G91A 4X3TA 1F2ZA 5FLXL 2DGYA 1D5ZC 4JI4Q 5IGGA 2E2DC 1D6EC 1NJIC 2PMZB 2L12A 2Z1CA 2CWAA 2VUMH 2QEXA 2F1MA 2E8GA 1QUQB 2YU9B 2IT1A 4QGUA 1LUZA 2EPBA 3F2DA 3CD6A 1YHAA 4DV1Q 4ILWA 1Y8OB 3EVQA 3KBGA 2E2JB 1EQQA 2M9VA 2UUBQ 3L0OA 3V05A 3H0GH 4IURA 4KN4C 4MTNA 1I94Q 3NUCA 2BE5D 4CDFC 3OOCA 2CCZA 2ES2A 2F3WA 3T16A 4G7OC 4GKJL 1JICA 4AH6A 3KLSA 2PW5A 2F0NA 4FXKC 4IO9A 3BJUA 1UE7A 1IKLA 1LTAD 1AE3A 5J3BA 5C0XI 1O80A 2Z6BA 4WFN3 4OWXB 3VR2A 4DN4M 1KLGD 3KJPA 2KA7A 4OONA 3Q23A 5H1SE 4DAYA 1EUJA 4IPDA 3HOUG 3I4LA 4DV2L 4DR4L 2E75C 4GNXC 2KQ3A 2ASBA 4FP5D 2EXDA 4LAAA 5IWAQ 1PA6A 2Y0SB 4DR1L 1DOMA 1E24A 1I50H 5DEHA 1VQ9A 3NPPA 4RAUC 4P73A 4DK3C 4DR3Q 2PMZE 4BY7G 1X3QA 1IXRA 3K0XA 3S15B 1RODA 3DLLA 2ICEC 1IZ6A 2A68D 1XX8A 3MAQA 4B3TQ 1RDPD 4JV5L 1TKWB 4LUZA 5CBEE 4OX9L 2K32A 1Q1EA 3QR8A 2F0OA 1I4XA 2E2HB 4RKLA 1XXGA 2EE1A 3CHBD 2K5QA 5M5WH 1MKHA 3ER0A 2RDGA 4GOPA 2K5WA 2NVXH 1ESFA 2UXBL 1TY2A 1LACA 4BY1G 1TWFH 2F4VQ 1SR3A 4PV1C 1I3QB 1PDQA 5ISRA 5A2QL 5C0XJ 3HG9A 4FVMA 5J1ZA 3K7AB 3LGJA 5BN5A 2SNSA 1A3VA 2NZHA 1M1KC 3J7AV 4OL7A 1SJHD 3TS0A 4RG1A 4WJ3M 3G4SA 3TREA 5GADC 4Q0FA 3ITPA 3IRBA 4DR6Q 1BKBA 2HT1A 3R8BA 4IQZA 4I65A 4A3LH 1LM0A 2UXDL 1O7YA 2OT2A 4A4IA 1KLUD 2BE5C 3MXNB 1NCVA 4A3MH 1TT2A 1MI2A 2Y0SE 3CQZB 2NVQB 1TWAH 1E22A 1UEAB 3M7NA 2K05A 2IJ0A 5IYBG 1B50A 5C44B 4JI4L 4A3IH 2PZUA 1SSOA 5J39A 4KI0A 4RCOA 3H3VI 2K01A 1XPUA 1XWEA 1WFQA 4YCVA 4ZUIA 1SN8A 4N9TA 3CC4A 2XGTA 3K0YA 3ND8A 4DV1L 3PUVA 1PH5A 1AP0A 1VQDA 1B2TA 3PUYA 1KAAA 3C2PA 1TWGH 3K58A 1K3RA 1OO9B 1HCZA 1ICWA 2RF4A 5E4XA 1KD1C 2R7ZH 1HZ9A 2LXJA 5C3WA 2DUDA 1HPCA 5JEAG 3IL8A 4J8QA 4LWCA 2OWOA 1STNA 2EJGC 3UI2A 4KKUA 1BCPC 3CMEA 1JE5A 2OEOA 1AFPA 4LUVA 4O2DA 5IYCG 1VCIA 5CV8A 5D14A 2GA4B 4QJFA 4A3CH 1STYA 5E1FA 3GTOB 2VL6A 4KK7A 4RGOS 3QJYA 1NUCA 3Q22A 3TP6A 4YHHQ 4A3GB 4Y7NB 2F0GA 3CCQA 1JWUD 1X56A 1F2YA 1CQFA 2E76C 1A62A 3BYYB 1QUQA 3PUXA 3KFUA 1QOHA 2VB2X 2VZAA 3KBXA 4DXFA 4JI3Q 3A0JA 3AQQA 4DR3L 1A63A 4MN3A 4H0LC 2EVBA 1VF5C 2UU9L 2D62A 2ATWA 4BBSB 2IPKD 1N34Q 1YNND 2YTXA 4V0BA 1JCKB 1Q46A 4R1JA 4UP8A 2WFWA 1A8VA 3DM1A 1MJCA 1TXYA 2IX1A 5C4XB 4LNQA 2HIVA 1LTLA 2OQKA 1YJNA 2Z6KC 4IPHA 2Q8TA 1DCZA 1KDCA 4XXEA 1GXDC 4JBWA 5CYUA 2F0QA 1EWIA 1LTGD 4ME5A 2CQAA 4ZAIA 3ULLA 1PH3A 4FF2A 1WD1A 3SK4A 4JW0A 4ZCKA 2B3GA 4DR7Q 5I2XA 4JVZA 2K14A 2E2IH 4KHVA 2NN6H 1K8GA 3D3RA 2HUGA 1VF7A 4HTHA 1SLJA 1WOCA 1CT1D 1SYCA 3KYHC 2RHQB 4BXXG 5TSSA 1HTPA 3GTJB 4GKKQ 2HDMA 4DR6L 4GLVB 1HH2P 3OHXC 3BVMA 1JB3A 3R2IA 1J8IA 1PTOB 5E3FA 3EROA 3FPPA 1TWCH 2K4KA 2JA7G 2B2UA 5EAYA 1I4HA 3QB3A 3HOVH 2PNRC 4HCSA 4KD3A 1PLFA 1RTNA 3I7FA 4KKSA 3TSSA 5C0XG 3GTPB 1Y8PB 1EYGA 1J5EQ 4OWTB 3RZDB 2B2TA 4G7HC 1R4QB 1XJVA 4H44C 4DK1A 5JJZA 1X9NA 1HZCA 4HCEA 5JOBA 4CDDC 5C3XA 2V1CC 5GAEC 1O7LA 3T51B 4IUQA 1V9PA 3KLSX 1SFOH 1QWYA 2QEJC 3ULPA 2KOLA 1WVLA 1QVFA 2K1BA 3SR1A 1I4QA 2CHBD 1D5MC 4Z9CB 1PH6A 3H94A 4A93B 1EY0A 2GVAA 3BZDB 3VR5A 3RN5A 3HOYB 1R9TH 2OTLA 3CAMA 1D8LA 2JA8G 3NQTA 4X6AH 4MIUA 1B44D 1Q90A 1X65A 2QKIC 1YNNC 3FMCA 5KEEA 3VYTA 2WB1B 3D4WA 1J9OA 3MXNA 4K5XA 1SMXA 2KCNA 1X54A 1K8AC 2RKSA 1GUSA 2CFMA 1KQSA 1VQNA 3S1MB 1YVCA 3DWAA 3S2DH 1Y14B 2F0SA 3HKZB 4TRDA 1SYDA 2XWBB 5IT9L 3P20A 3PIP3 1XNQQ 4JYAQ 1PRTB 4UP9A 4YHHL 1KDBA 4YWLA 4RGMA 1CTMA 4DAVA 1EY9A 5CV9A 1CI3M 4IJHA 4DUZQ 1HZAA 4C2MH 4DK6C 2RSNA 3J81i 3EN2A 2WAQE 4JI3L 1LT3D 1WCMG 2BOSA 2R92G 1GD7A 2KEEA 5DM63 3CPFA 1C8CA 4BWGB 5IYBH 3IAYA 1AN8A 1N34L 2EYJA 3GTGH 1VQ8A 1JMCA 2DNEA 2WV6D 4LF5L 3NHHA 3T1HQ 3U4ZA 3PO3B 1VQHA 1TS5A 3E9IA 2A69D 3PIO3 4A3JG 3UDIA 4C3IG 1K83H 2EY2A 2E74C 1WTPA 2OQ0A 1ET6A 4BBRG 2X69A 3J7A5 2PZWA 3F2CA 1DJRD 1DXMA 3I90A 2VUMB 1YI2A 5EGTA 4NDXA 2B2WC 2HHHL 5IGDA 1EY4A 3OIPA 2K6AA 4DR7L 1Z9FA 3BZCA 1SDFA 2UUAL 2WB1E 1PYWD 2PI2A 1Y1WB 4TVAB 2NBFA 3H0GB 3K8AA 3H3VC 1HA5A 1A3UA 2N49A 3IFTA 4KKTA 5HGTA 2KHSA 3RUZA 2E5LQ 3HKZE 5CGKA 1SYFA 2J7ZA 1DD2A 4MTKA 3D31A 3BDCA 4RA8A 4ABNA 1LTRD 1GUGA 4B3SQ 3M7GA 3H15A 1K0SA 2L15A 1WTXA 3MC0B 4M8AA 4A3KG 1QB5D 3R2TA 5I6WA 5LHY1 5M3FG 5IGEA 1J5EL 2ID0A 3OWEB 4LF6Q 3GTKB 3PF5A 4OELB 2EJMA 4RH6A 1EU4A 2D0PA 2V4DA 3F2UA 1HXYD 1X3PA 3RLNA 3Q24A 4QIWB 4HIDA 4XYQA 5IYDH 2F52A 1C48A 2K75A 3U4VA 1IBKL 1F9SA 1BNZA 4YY3Q 1SE3A 1QNUA 5ELDA 3A56A 3U50C 1EIHA 3E3XA 1U4RA 3S16H 4AYBB 4HIOA 2HIXA 3A8IE 4XQQA 4RWSC 2AHOB 4IPCA 3V2TA 5M3MG 4LW1A 2ZTCA 5EBCA 2EZVA 5LMNW 4IN3A 1EEFD 3UDGA 4RFBA 2JJQA 5C4JH 3M4OB 1FYCA 3DWQA 5M5WB 1FNUA 1U4PA 4UAIA 3S1RH 2A69C 4QCLA 4NXNL 4KTAA 2NVXB 1F9QA 1TWFB 5GAGC 3E6ZX 1VQ5A 4KMUC 1XNQL 4JYAL 2X6LA 4A3EG 2R61A 1ESRA 3SXHA 1YHBA 2NVYH 3TZUA 3JAML 4P75A 4DV2Q 4DUZL 5FLMG 1KNAA 3VA7A 1HR0W 1PH1A 4DR1Q 3J80E 3VDYA 1EY5A 3FKIG 3PGZA 4NB3A 3J80c 4QIWE 4LFCL 5C0XH 4CDEC 2AWOA 4K6DA 1EQRA 2B2VA 3UE1A 2RDFA 4L5QA 2B8FA 3MTSA 3T1HL 4A3MB 4A3BG 1MBYA 2JXMB 1E3PA 2K5NA 4FF4A 1G51A 1I4PA 2R7FA 3Q6SA 4WRDA 4DAPA 4C1NI 3NENA 4OO1I 1TWAB 1CFMA 3A7AB 3EFXD 1K3BC 5CORA 2IY5B 2M2LA 3VR6A 4OX9Q 1BBUA 3HOWG 3CPWA 1SYEA 3W3AA 4C3JG 2CWPA 1A15A 4NPSA 4A3IB 3ULJA 4AYBE 4EQ5A 1EY7A 4N8X1 5E7NA 3FDTA 2FFKB 2A1AA 1UAPA 1FVIA 1EOTA 4K0KQ 2RHSB 4DNIA 1N33L 2OTJA 1TWGB 1VQ4A 3BDOA 1GHKA 2R7ZB 2R7DA 3X3MA 3HOZG 3DEOA 2YV5A 3GTLH 4GLAC 1X3FA 3PO2G 4ZRZA 3STBD 4QB4A 1VQ7A 1MGSA 1CK1A 4LF7Q 4IFDI 3U9OA 2A74C 3K81C 2F0PA 3AFQA 2BA1A 4B3SL 4L5RC 1PYSB 2ZXOA 3I4MB 1CKMA 3W1GA 4DXGA 4IUTA 4KV6A 1SROA 2RDHA 1AZQA 4LF6L 1KL9A 1LT4D 3C1EA 4XQJA 1H9JA 1PV4A 3P1HA 1IHZA 2Q2IA 1V1PB 1KHIA 1QJOA 4LFAQ 5IODA 1IYUA 4YY3L 1TWHH 2JSOA 2D0OA 4K6LA 2N78A 3EJIA 3MA2B 4B08A 4AQYQ 1QILA 2IX0A 5CMDA 2LXKA 5C3EG 3D4RA 4HIMA 2NTSA 4MNOA 4XTCS 4A3DH 1EL0A 1F2MA 4NMZA 2WIIB 2F0IA 1V43A 3ONAB 1GVPA 1DM0B 1L1OC 5IOCA 3Q8DA 4OIKA 2JA6H 3K5LA 4IFDJ 1LT6D 1K0RA 2EDGA 1VQFA 3MEHA 1K8OA 4HJ7A 2B2YA 5FLXE 5FOBB 1XNRQ 5FLXc 1MJEA 1FJGQ 4JI6Q 1XTCD 2DJFC 1FR3A 4UP7A 2Y0SG 2E2IB 3HOXH 2C35B 1YJWA 4RHRA 5FJ8H 4KJNA 2AUJD 3S14B 1UE5A 1YHQA 1Y8NB 1B53A 1S3OA 3DWPA 3MZ5A 5KIXA 2UU9Q 4NXMQ 4X3SA 3CCSA 3S17H 1BCPD 2R3ZA 1SE2A 1TWCB 4PMWA 3NEMA 4H13C 3STBC 4QY7A 3I2ZA 3HOVB 3P75A 1QG7A 3MEFA 1L2FA 2SDFA 1I6VC 3B6YA 2RVLA 1U5KA 4FDBA 1FD7D 1SEBD 2EYMA 2G9DA 1O7ZA 1L0YB 4GN3B 4K0KL 2XSCA 4HSPA 3K59A 1WTRA 4A3FH 4UDUC 3CXCA 1U4MA 2N55A 1KABA 1SFOB 3SK6A 5I9PA 1JC7A 3NTIA 1EYDA 2NYZD 3TMEA 1LTID 4LF7L 1RTOA 1R9TB 3I4NG 5ELFA 1ASYA 2MNAA 4A3EH 2MGSA 1HRJA 4Y52H 3KF8B 1ILQA 4OXPA 4DNRB 5C44G 3SK8A 1SNMA 1HNXQ 2IHEA 5FLMH 5FK9C 2VB3X 5HURA 2JA5H 3GV3A 4R9WA 5D3IB 1STBA 3S2DB 2RSOA 2ICIA 1QVGA 2R6GA 2B63H 1P8LA 2VW9A 3CC7A 4XIGS 4DV5L 3E0EA 3A7LA 1YZ6A 3MXUA 3F2BA 1GUWA 5C5LA 1XMQL 1NMFA 5E4WC 1AW7A 1ENCA 4C2MB 5A2QE 5C6AA 1E1TA 2JN4A 5ELCA 1Q82C 1OXXK 5BN3A 4LFAL 4RGNA 5BN4A 4KN7C 3RMHA 2I07B 3PV0A 4AQYL 1BCPF
chains in the Genus database with same CATH topology
1JQYD 3MVVA 1JOQA 5JVH3 2PO4A 3GTGB 4L6TB 2YYZA 1HUNA 1PTOD 3I72A 4X3UA 1O78A 1A2UA 4OO1G 5K36H 3MHBA 2O4XA 4G57A 3SDZA 2EY1A 2G9HD 5C4HA 1I4RA 1F9PA 4K2LA 2EY5A 5KGUA 2JP1A 1B9MA 4L63B 1G8ZD 1V1PA 1S4ZA 3OMGA 4ODGA 1DONA 2IX3A 4IFDG 1UNSA 2JYOA 1ENAA 2PQEA 2MJ8A 1Q3LA 1EY6A 5M9OA 2LFNA 1BO0A 4HEDA 2A6HD 4E6IA 5ELBA 3VA5A 1CHQD 1F77A 2LS01 3SVMA 3QG1A 3S9WA 1F2LA 1BR9A 2BDOA 4ZUJA 3WOEA 3FRPB 4KJOA 1ILPA 4TKOB 4K8IA 1STGA 4KY6A 3S16B 3GQBA 1S5BD 2O2LD 4LJZC 3T53B 4ZKBB 5C4JB 3K5NA 1PTOC 2K5DA 3S1RB 3PMFA 2WAQB 1HQRD 3U9SA 2Z4HA 2QCPX 3ND9A 2NVYB 5IGBA 2FINB 2PCFB 3CKIB 4KHZA 5KYIA 1STAA 1Y1VB 4CGYB 3WOFA 1A3TA 1BBXC 3ZYYX 4QUFA 3X3NA 1AZPA 1G2TA 5CV5A 5C5MA 3BYTB 3KUPA 3BVZA 3NXWA 4C3HB 1T5EA 4K2KA 3OMCA 4FYDA 1SBBB 2KECA 2EYPA 3IKJA 1E2VA 3KF8A 1PFMA 2A6HC 2EJFC 2AQ1B 4K8JA 2XVSA 2J4XA 3C1FA 2F0TA 2EXZA 5FO9B 4XT1B 1PRTC 2OXPA 1D5XC 3GTLB 1M8AA 3MXPA 1SNCA 3RLFA 1IW7D 1GJXA 5KNBA 3J7YW 1KNEA 1A6XA 4IUNA 1UUPA 3OWFA 3OIQA 1IKMA 3AU7A 1AEXA 1EWHA 1RHPA 2AUKA 4H7BA 4DF7A 4DNTB 1C4QA 4O1NA 1TS4A 2L1BA 4ZK9B 2EYHA 1FNWA 1LLRD 5IT9E 2NN6I 5JEAH 2F0WA 2D9UA 1TWHB 1KTKA 3TP5A 1JE4A 4HAEA 3OSOA 2L0CA 1ZXTA 1EFID 5KNCA 4A3DB 4EGVA 5F2DA 2XIWA 3QO2A 4HR7B 5CV4A 1HQMC 1DOKA 3K6OA 2EY6A 1G2SA 3G6JB 1PZID 2EYFA 2JA6B 1H9RA 3OW7A 3T13A 2LMCB 1DYQA 2B2YC 1S5DD 2AQ2B 3H09A 4F7XA 2VXWA 4R8NA 4WJWA 4F88A 1SYBA 2NB0A 3RD4A 5IGCA 4IALA 4G7ZC 3HOXB 2DN8A 4RKBA 1B1ZA 2IW3A 5KRUA 1I50B 1R4PB 4C56C 2RQXA 1V8QA 4O42A 4HN7A 3VR3A 3HS0C 3H91A 4ZKCB 3S17B 1JWSD 2QILA 3HGBA 3AB9A 4IUUA 2H4OA 5LL6X 3V96A 3O13A 4IZ8A 1IW7C 5D65A 3J80L 4EQOA 3TP8A 1D1KA 1ZYRD 3E0JA 5JPMC 2WACA 1LV9A 3D4DA 3NP8A 2WP8J 1IYVA 4A3FB 3NBHA 2LY7A 3SE0A 1PTOH 3J81L 1FGBD 1U4LA 4Q5VA 1D2BA 3EQLC 1Z6HA 3G7LA 1SE4A 2L4NA 3Q0AA 1EIGA 4F87A 4HMJA 1F9RA 2M00A 4A3EB 1OXSC 2Q8RE 2B8GA 4CKCA 3T4AC 4DA2A 3DMUA 1EU3A 5EKIA 2JA5B 3KLRA 4CBVA 4QMGA 2DY8A 2B63B 3A54A 2RA4A 3D8GA 4YIJA 3NQIA 2FJ2A 3N52A 1T5XD 3ERQA 3JAME 2QF7A 5FO8B 5LL6S 4C3JB 1VMCA 4P2CB 4J1MA 1CM9A 5I9OA 3QIAA 4FXGC 1HA6A 1MSGA 3L7ZC 1MSHA 1LO5D 4N9PA 1W6KA 2F0MA 1WTVA 2J0TD 1EZ8A 4V190 1H9SA 4OGQC 5C4ZA 2F0KA 1ZKOA 1D1IA 3L3OC 2FMCA 3A8JE 1JOOA 3WDNA 3BG3A 5IIFA 3MFYA 2WKCA 4G4KA 1ZYRC 1LT5D 3BVGA 4HMIA 2F0DA 4B9WA 1PMRA 2Z4IA 3MFGA 1B4OA 1HUMA 2Q8IB 2FMMA 3AMUA 2KEDA 2KUMA 5AFWA 1HFNA 1HHVA 3VR4A 2ENBA 1WTOA 4FNFA 4XDXA 2B2WA 2K7VA 2JEBI 3TBIB 1CA6A 2K28A 2MHVA 3RZOB 4K5VA 5KNDA 2F03A 1B3AA 3GO5A 4DGZA 4EQNA 1H9MA 5EKKA 5C3EB 1HTLD 5JVG3 1SNOA 3CRKC 1LABA 3HP3A 2F0HA 4X3KA 2LKVA 2NN6G 3I91A 3E5SA 2F0LA 3TP7A 1PFBA 4RCNA 3GP7A 1II3A 2A73B 2MP1A 5I2YA 4C1NK 1CQVA 1GHJA 5EPKA 4QUCA 3S2HB 4NKLA 3HOUB 2NWGA 2B2UC 1A2TA 2F4IA 3I73A 3FVQA 2PPBC 2B2TC 4LK1C 2BDNA 1W6JA 2NVTB 3HRZC 4BY7B 3M3YB 1KDAA 5CBAE 2K03A 5JAVA 1TR5A 1Q12A 4CJ1B 1BOSA 1OXVA 1EQTA 2L5TA 4GZYC 2NZ1D 1X32A 1RKNA 4BY1B 1FNVA 1SJED 1Z7TA 2QDBA 5EQ0A 2PZTA 5DAUA 1RJTA 3S1NB 2DNCA 1SNQA 4IUVA 1Q1BA 2FHTA 3NBIA 3NE5B 3SK5A 1SNDA 3QWNA 3I4NB 4FF1A 1SYGA 1LTBD 2A6ED 5DNFA 3LWEA 4KY5A 1S5CD 4CJ2C 2AQ3B 2SEBD 1U9RA 3URYA 1EWCA 1B9NA 1EZ6A 2SOBA 3EA6A 3K5OA 5CV7A 1TS3A 4CKBA 1ONLA 3MWYW 4U68A 1K83B 1HFGA 3DUZA 2AWNA 1DZ1A 4FXDA 3DHQA 1EEID 2HDLA 3VYSA 3BDLA 2WKDA 4TQUS 1BCPB 4EQPA 1XYIA 2EYLA 1BF4A 4TSSA 2A68C 1RD9D 2BA0A 4ULLA 3NK9A 5IGFA 1QNKA 4PNYA 1ET9A 1RF2D 2L55A 3A8KE 4CJ0B 4XQNA 2L9HA 4NP5A 3K57A 4QF4A 1PZJD 4CHTB 1EYAA 2XNAC 4OHJA 1ENFA 1DOLA 2K04A 3LWUA 1TY0A 3TDQA 2B39A 1PRTD 3BS1A 1Y69U 3QOJA 2OF1A 2JE6I 1ML0D 1PTOF 2A6EC 1PZKD 5COYA 5M5YB 3FEWX 3VYRA 4ZLTF 1LTSD 3DXJC 3SEBA 3VYUA 5K5PA 1SXTA 1BQQT 1H9KA 1ZEQX 4CKEA 1CZGA 3W2DA 3GTQB 2JEAI 4ZQ3A 3I3CA 1YNJD 2HCCA 3D6WA 1Q8IA 2ZXRA 1TIID 2JA7B 1WD0A 2NTTA 2I46A 4XT3B 1GOZA 1STEA 1EYCA 1PXUA 4ID6A 3GV6A 4K5WA 1G291 3I8ZA 4JK1C 3NWSA 2B2VC 2X6GA 4C3HG 2C9OA 2XRQD 4K14A 2K33A 3MXGA 1M4VA 1PRTF 2F3VA 1GUOA 4PMCA 4EVOA 2RBMA 3C46A 1LTTD 1QCBD 3TN2A 4NW2A 2Z8LA 2TSSA 1NR4A 3QOLA 2JA8B 1QE6A 1WTWA 5EJWA 4DK0A 3KK7A 2ZT9C 2HCIA 1JWMD 3H6MA 5ELEA 3T56B 1E2ZA 1NR2A 1S5ED 2MUYA 2KVMA 5I4DA 5CV6A 1H9SB 2H1EA 4XYOA 5EPJA 3M4YA 1NAPA 4I7ZC 1EY8A 3J7AF 1WCMB 2R92B 3NTHA 4PMBA 1SAPA 1TVXA 4FF3A 5CR3A 3PUZA 4MHEA 5G3LD 5FO7B 1YNJC 2WINB 1TU2B 4A3JB 4C3IB 1PFNA 2EYOA 4M1UB 4OO1H 4B9XA 2R93B 4U673 2XN9C 4BBRB 2VNUD 1G6ZA 5CC4A 3GTMB 4L8JA 1I4GA 1JORA 3OPOA 4DU9A 2CVRA 5D3DA 3D6CA 4RGTA 4RHSA 3HZXA 4S3SA 1VMPA 1SMYD 4BA1I 2C5CA 3L9AX 1IL8A 4HSVA 4KD4A 2IL8A 2F0JA 4IFDH 1TS2A 1NSNS 1GUNA 1Z47A 1BXTA 4A3KB 4R8IA 2O5JC 5M3FB 4BA2I 1V1OA 4BS9A 1JR0D 2ZXPA 2HQEA 3GD7A 5FKAC 2NUCA 3A55A 4WORA 2CW0D 1GUTA 4LMQD 5T1IA 1BUVT 1S5FD 3HEJA 1WTQA 1E0BA 3IFDA 3NWTA 5A35A 3CU7A 3FPUB 4IUPA 2F0FA 3M85A 5G3LF 3C3LA 1I6HB 3S1QB 5EPLA 1OXUA 2F0EA 5M3MB 5T1GA 1JOKA 4FO2A 3SHLA 2TMPA 2XRSD 4J6HA 2SNMA 3TZDA 2XWJB 2DY7A 2L11A 2PYKA 5DM73 2N88A 2BCOA 1RCVD 3NTKA 3DEPA 3K5MA 2MPMA 2KCCA 3FKIB 5M5XB 4OIJA 3R93A 4KY7A 5I6YA 2D5DA 4PQXA 4A3BB 3P7JA 2A5HA 1SMYC 3J81E 2F0VA 3I70A 5J22A 3HOWB 1MD2D 1EQVA 3R3OA 1STHA 2KJXA 3N6RA 1L0XB 1CHPD 5EBDA 2O5IC 1VDZA 5KYLA 1BDOA 1SNPA 5K36G 3NSWA 4DFAA 4F8MA 5EKLA 2F0UA 1E2WA 3LNNA 1OXTA 2CW0C 3LX0A 1K8MA 5JPNC 3HOZB 3PO2B 1TQOA 2D2CC 1CA5A 3PUWA 3CRLC 2PW7A 1CZWA 5NUCA 5JEAJ 2IWHA 2EOTA 1G91A 4X3TA 1F2ZA 5FLXL 1D5ZC 5IGGA 2E2DC 1D6EC 2PMZB 2L12A 2Z1CA 2F1MA 2YU9B 2IT1A 2EPBA 4ILWA 1Y8OB 3EVQA 3KBGA 2E2JB 2M9VA 3V05A 4IURA 4KN4C 3NUCA 2BE5D 3OOCA 2F3WA 3T16A 4G7OC 1JICA 3KLSA 2PW5A 2F0NA 4FXKC 1IKLA 1LTAD 5C0XI 1O80A 4WFN3 3VR2A 4DN4M 1KLGD 2KA7A 3Q23A 4DAYA 3I4LA 2E75C 2KQ3A 4FP5D 4LAAA 2Y0SB 1DOMA 5DEHA 3NPPA 4RAUC 1X3QA 3S15B 1RODA 2ICEC 2A68D 1XX8A 3MAQA 1RDPD 1TKWB 5CBEE 2K32A 1Q1EA 2F0OA 1I4XA 2E2HB 4RKLA 1XXGA 2EE1A 3CHBD 2K5QA 2RDGA 2K5WA 1ESFA 1TY2A 1LACA 4PV1C 1I3QB 1PDQA 5ISRA 5A2QL 5C0XJ 3HG9A 4FVMA 5J1ZA 3K7AB 5BN5A 2SNSA 1A3VA 3J7AV 4OL7A 1SJHD 4Q0FA 3ITPA 3R8BA 4IQZA 4I65A 1O7YA 2OT2A 1KLUD 2BE5C 1NCVA 1TT2A 1MI2A 3CQZB 2NVQB 1BCPF 1UEAB 3M7NA 2K05A 2IJ0A 1B50A 5C44B 2PZUA 1SSOA 5J39A 4KI0A 4RCOA 2K01A 1XWEA 4ZUIA 4N9TA 3ND8A 3K0YA 3PUVA 1AP0A 1B2TA 3PUYA 1KAAA 3C2PA 3K58A 1OO9B 1HCZA 1ICWA 5E4XA 5C3WA 1HPCA 5JEAG 3IL8A 4J8QA 1STNA 2EJGC 3UI2A 4KKUA 1BCPC 2OEOA 1AFPA 1VCIA 5CV8A 5D14A 2GA4B 1STYA 5E1FA 3GTOB 4KK7A 4RGOS 3QJYA 1NUCA 3Q22A 3TP6A 4A3GB 4Y7NB 2F0GA 1JWUD 1F2YA 1CQFA 2E76C 3BYYB 3PUXA 1QOHA 2VB2X 3KBXA 4DXFA 4MN3A 4H0LC 2EVBA 1VF5C 2D62A 4BBSB 2IPKD 1YNND 4V0BA 1JCKB 3DM1A 2IX1A 5C4XB 2Q8TA 1DCZA 1KDCA 4XXEA 1GXDC 4JBWA 5CYUA 2F0QA 1LTGD 4ME5A 2CQAA 4ZAIA 4FF2A 1WD1A 3SK4A 5I2XA 4KHVA 2NN6H 3D3RA 2HUGA 1VF7A 4HTHA 1CT1D 1SYCA 5TSSA 1HTPA 3GTJB 2HDMA 3OHXC 3BVMA 1JB3A 3R2IA 1J8IA 1PTOB 5E3FA 3EROA 3FPPA 2B2UA 1I4HA 3QB3A 2PNRC 4HCSA 4KD3A 1PLFA 1RTNA 4KKSA 3TSSA 5C0XG 3GTPB 1Y8PB 3RZDB 2B2TA 4G7HC 1R4QB 4H44C 4DK1A 5JJZA 4HCEA 5JOBA 5C3XA 1O7LA 3T51B 4IUQA 3KLSX 1QWYA 2QEJC 2KOLA 1WVLA 2K1BA 3SR1A 1I4QA 2CHBD 1D5MC 4Z9CB 3H94A 4A93B 1EY0A 3BZDB 3VR5A 3HOYB 3NQTA 4MIUA 1B44D 1Q90A 2QKIC 1YNNC 3FMCA 5KEEA 3VYTA 2WB1B 3D4WA 1J9OA 3MXNA 4K5XA 2KCNA 2RKSA 1GUSA 3S1MB 3DWAA 2F0SA 3HKZB 4TRDA 1SYDA 2XWBB 5IT9L 3P20A 3PIP3 1PRTB 1KDBA 4RGMA 1CTMA 4DAVA 1EY9A 5CV9A 1CI3M 2RSNA 1LT3D 2BOSA 2KEEA 5DM63 1C8CA 4BWGB 3IAYA 1AN8A 2EYJA 2DNEA 2WV6D 3NHHA 3PO3B 1TS5A 2A69D 3PIO3 4C3IG 2EY2A 2E74C 1WTPA 1ET6A 2X69A 2PZWA 1DXMA 1DJRD 3I90A 2VUMB 5EGTA 4NDXA 2B2WC 5IGDA 1EY4A 3OIPA 2K6AA 1SDFA 1PYWD 1Y1WB 2NBFA 3H0GB 3H3VC 1HA5A 1A3UA 3IFTA 4KKTA 5HGTA 2KHSA 3RUZA 5CGKA 1SYFA 2J7ZA 1DD2A 3D31A 3BDCA 4RA8A 4ABNA 1LTRD 1GUGA 3M7GA 1WTXA 3MC0B 4M8AA 1QB5D 3R2TA 5I6WA 5LHY1 5IGEA 2ID0A 3OWEB 3GTKB 2EJMA 4RH6A 1EU4A 2V4DA 3F2UA 1HXYD 1X3PA 3Q24A 4QIWB 4XYQA 1C48A 1BNZA 1F9SA 1SE3A 1QNUA 5ELDA 3A56A 1EIHA 1U4RA 4AYBB 3A8IE 4XQQA 4RWSC 3V2TA 5EBCA 2EZVA 4IN3A 1EEFD 4RFBA 3M4OB 1FYCA 3DWQA 5M5WB 1FNUA 1U4PA 4UAIA 4QCLA 2A69C 2NVXB 4KTAA 1F9QA 1TWFB 3E6ZX 4KMUC 2X6LA 2R61A 1ESRA 3SXHA 3TZUA 3JAML 1KNAA 3VA7A 3J80E 1EY5A 5C0XH 2AWOA 4K6DA 2B2VA 2RDFA 2B8FA 3MTSA 4A3MB 1MBYA 2JXMB 4FF4A 1I4PA 4WRDA 3Q6SA 4DAPA 4C1NI 4OO1I 1TWAB 1CFMA 3A7AB 3EFXD 5CORA 2M2LA 3VR6A 1SYEA 3W3AA 4C3JG 1A15A 4A3IB 1EY7A 3FDTA 2FFKB 1UAPA 1EOTA 1TWGB 3BDOA 1GHKA 2R7ZB 3X3MA 3DEOA 4ZRZA 4QB4A 1MGSA 1CK1A 4IFDI 3U9OA 2A74C 2F0PA 2BA1A 2ZXOA 3I4MB 4DXGA 4IUTA 4KV6A 2RDHA 1AZQA 1LT4D 3C1EA 4XQJA 1H9JA 3P1HA 1IHZA 1V1PB 1QJOA 5IODA 1IYUA 2JSOA 4K6LA 3EJIA 3MA2B 4B08A 1QILA 2IX0A 5CMDA 3D4RA 2NTSA 4XTCS 1EL0A 1F2MA 4NMZA 2WIIB 2F0IA 1V43A 3ONAB 1DM0B 5IOCA 4OIKA 3K5LA 4IFDJ 1LT6D 2EDGA 3MEHA 1K8OA 2B2YA 5FLXE 5FOBB 1XTCD 1FR3A 2E2IB 4RHRA 4KJNA 2AUJD 3S14B 1Y8NB 1B53A 3DWPA 3MZ5A 5KIXA 4X3SA 1BCPD 2R3ZA 1SE2A 1TWCB 4PMWA 4H13C 3HOVB 3P75A 1QG7A 2SDFA 1I6VC 2RVLA 1FD7D 1SEBD 2EYMA 2G9DA 1O7ZA 1L0YB 2XSCA 4HSPA 3K59A 1WTRA 4UDUC 1U4MA 2N55A 1KABA 1SFOB 3SK6A 5I9PA 1JC7A 3NTIA 1EYDA 2NYZD 3TMEA 1LTID 1RTOA 1R9TB 5ELFA 2MGSA 1HRJA 1ILQA 4DNRB 3SK8A 1SNMA 5FK9C 2VB3X 5HURA 3GV3A 4R9WA 5D3IB 1STBA 3S2DB 2RSOA 2ICIA 2R6GA 4XIGS 3A7LA 3MXUA 1GUWA 5C5LA 5E4WC 1AW7A 1ENCA 4C2MB 5A2QE 5C6AA 5ELCA 1OXXK 5BN3A 4RGNA 5BN4A 4KN7C 3RMHA 2I07B 3PV0A 4ZYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WOR A;  1NUC A;  3H6M A;  3MVV A;  2F0O A;  3BDC A;  3QOJ A;  3TP6 A;  2OF1 A;  1SNQ A;  4RKL A;  1JOQ A;  1EY7 A;  2EYH A;  3PMF A;  1TQO A;  2F0G A;  4KJN A;  3SR1 A;  1F2Y A;  2F0W A;  4K5V A;  2PW7 A;  5CV6 A;  3SK5 A;  5I6W A;  3HEJ A;  1SND A;  4HMJ A;  1A2U A;  1EY0 A;  5NUC A;  5IGE A;  2M00 A;  3TP5 A;  3OSO A;  2F0F A;  3MZ5 A;  3NQT A;  5KIX A;  5ISR A;  4MIU A;  1SYG A;  1F2Z A;  4DGZ A;  5IGB A;  4EQN A;  3MHB A;  5J1Z A;  5KEE A;  4KY5 A;  5EKK A;  2SNS A;  3D4W A;  5F2D A;  2F0E A;  1EY8 A;  1SNO A;  5CV4 A;  1A3V A;  2O4X A;  5IGG A;  3DMU A;  4K5X A;  3P75 A;  4OL7 A;  2F0H A;  5KYI A;  1JOK A;  4G57 A;  2EY6 A;  2EY1 A;  5C4H A;  4QMG A;  2LKV A;  2RKS A;  1U9R A;  4PMB A;  4QB4 A;  3SHL A;  1STA A;  4K2L A;  5K5P A;  2EY5 A;  3U9O A;  1EZ6 A;  2SOB A;  2EYF A;  2F0S A;  2F0L A;  1SYD A;  3E5S A;  3ITP A;  4J6H A;  3EVQ A;  3D8G A;  4TRD A;  1A3T A;  5CV7 A;  4YIJ A;  2SNM A;  3TP7 A;  5KGU A;  1KDB A;  2F0P A;  2EYM A;  1II3 A;  5CR3 A;  4I65 A;  1EY9 A;  5CV9 A;  3T13 A;  1KDC A;  2PYK A;  5CV5 A;  5C5M A;  3ERQ A;  4ZQ3 A;  1TT2 A;  5HGT A;  2F0Q A;  4KV6 A;  2EYO A;  3NUC A;  3NXW A;  4B9X A;  4F7X A;  3OMG A;  4ME5 A;  3V2T A;  4K2K A;  4ODG A;  1KAB A;  3OMC A;  4R8N A;  3SK4 A;  2EYP A;  3SK6 A;  5CC4 A;  2F3W A;  3DHQ A;  4NKL A;  3T16 A;  1ENA A;  1SYB A;  2PQE A;  5I9P A;  3BDL A;  5IGC A;  4IAL A;  1A2T A;  4J1M A;  3C1E A;  5C6A A;  2PW5 A;  2F0N A;  1EY6 A;  2PZU A;  4RKB A;  5I9O A;  1EYD A;  5M9O A;  4EQP A;  3P1H A;  1IHZ A;  2EYJ A;  4KHV A;  3TME A;  5KRU A;  5J39 A;  1EYC A;  2EYL A;  4HTH A;  4ID6 A;  4KTA A;  1SYC A;  3NHH A;  4K8J A;  4K5W A;  4ZUI A;  4N9T A;  3VA5 A;  4E6I A;  5IOD A;  4N9P A;  4DU9 A;  3C1F A;  1JOR A;  2F0T A;  2F0M A;  4KY7 A;  5I6Y A;  2EXZ A;  3D6C A;  3EJI A;  1EZ8 A;  3SXH A;  1KAA A;  2EY2 A;  3NK9 A;  5C4Z A;  3HZX A;  5IGF A;  2F0K A;  2OXP A;  1KDA A;  3S9W A;  4PNY A;  5E3F A;  3ERO A;  4S3S A;  2F0V A;  4ZUJ A;  5J22 A;  1F2M A;  1JOO A;  1SNM A;  2PZW A;  4K14 A;  3SK8 A;  3MXP A;  1TR5 A;  1SNC A;  4IZ8 A;  4NMZ A;  5JAV A;  2F0I A;  2KQ3 A;  5HUR A;  3QB3 A;  4NP5 A;  5EGT A;  5IIF A;  4NDX A;  5C3W A;  4KD4 A;  4KD3 A;  1EQV A;  2F3V A;  1STB A;  1EY5 A;  2F0J A;  4KJO A;  4LAA A;  4PMC A;  4EQO A;  4EVO A;  3R3O A;  1EY4 A;  1STH A;  5IGD A;  5IOC A;  2RBM A;  1NSN S;  4QF4 A;  4K8I A;  1STG A;  4KY6 A;  5DEH A;  3TP8 A;  4HMI A;  2F0D A;  4B9W A;  1STN A;  5KYL A;  4K6D A;  1SNP A;  2WAC A;  1EYA A;  1RKN A;  2RDF A;  5C5L A;  3D4D A;  3MEH A;  3NP8 A;  1ENC A;  1A3U A;  2OEO A;  4IUN A;  5JOB A;  4DFA A;  4F8M A;  2KHS A;  4WRD A;  5EKL A;  3RUZ A;  5C3X A;  3QOL A;  3OWF A;  2QDB A;  2F0U A;  5CV8 A;  5CGK A;  1SYF A;  2ENB A;  2PZT A;  5DAU A;  1STY A;  2HQE A;  3LX0 A;  5E1F A;  1SYE A;  1AEX A;  4H7B A;  2NUC A;  4DF7 A; 
#chains in the Genus database with same CATH topology
 1JQY D;  3MVV A;  4C3J H;  1JOQ A;  5JVH 3;  2PO4 A;  3GTG B;  4L6T B;  2YYZ A;  2QA4 A;  1HUN A;  1EFW A;  1PTO D;  3I72 A;  4X3U A;  2PQA A;  1N8R C;  1O78 A;  1A2U A;  3KF6 A;  4OO1 G;  5K36 H;  3L2P A;  1FGU A;  3MHB A;  5LMN Q;  1G6P A;  2O4X A;  4G57 A;  3SDZ A;  2EY1 A;  2G9H D;  5C4H A;  1XNR L;  2YTY A;  4A3G G;  1I4R A;  1IBM L;  1FJG L;  1AH9 A;  1F9P A;  4K2L A;  1X3G A;  4JI6 L;  2EY5 A;  1D7Q A;  3ICE A;  1A0I A;  5KGU A;  2JP1 A;  1B9M A;  4JBK A;  4L63 B;  3CCR A;  1G8Z D;  2I0Q A;  1V1P A;  3NEL A;  1S4Z A;  4BBS G;  3OMG A;  1VS0 A;  1HJP A;  4ODG A;  4NXM L;  1DON A;  1HR0 Q;  2IX3 A;  4IFD G;  1UNS A;  2JYO A;  1ENA A;  2PQE A;  2MJ8 A;  1Q3L A;  1EY6 A;  5M9O A;  5C4X G;  4LF5 Q;  2LFN A;  1BO0 A;  2ZJQ A;  4HED A;  1PFS A;  2A6H D;  4E6I A;  5ELB A;  3VA5 A;  2UUC Q;  3RZO H;  4ME3 A;  1CHQ D;  1F77 A;  2LS0 1;  3SVM A;  3OTO Q;  2KHI A;  3QG1 A;  3S9W A;  5IP7 G;  1F2L A;  1BR9 A;  2BDO A;  2F3I A;  4ZUJ A;  3WOE A;  5C3E H;  2HHH Q;  2VQF Q;  3FRP B;  4KJO A;  2UUA Q;  1ILP A;  4TKO B;  4K8I A;  1STG A;  4KY6 A;  4DV7 Q;  3FP9 A;  3S16 B;  2VY3 A;  3GQB A;  5JJL A;  2PI2 E;  4B3R L;  1S5B D;  2O2L D;  4LJZ C;  5BR8 Q;  1IYJ B;  4PZ7 A;  2AMC B;  4GNX A;  3T53 B;  3S2H H;  4JBJ A;  4ZKB B;  4DV0 Q;  3W5O A;  3HOU H;  5C4J B;  3K5N A;  1PTO C;  1HNX L;  2K5D A;  1VQM A;  3S1R B;  3PMF A;  2BH2 A;  3W1B A;  1NY4 A;  2WAQ B;  1HQR D;  3U9S A;  2Z4H A;  2QCP X;  1WYD A;  3NBH B;  3ND9 A;  2K5H A;  3A74 A;  4IOA A;  2NVY B;  2Q2U A;  2NVT H;  2HQL A;  4R4C A;  4BY7 H;  5GAH C;  3M3Y H;  4IPG A;  5IGB A;  2FIN B;  2PCF B;  3CKI B;  3KDF B;  4LUO A;  3SGI A;  4KHZ A;  5KYI A;  4HJ8 A;  1IBK Q;  1STA A;  1Y1V B;  1KAW A;  4CGY B;  3WOF A;  1NTG A;  1A3T A;  1BBX C;  3ZYY X;  4A93 G;  2B29 A;  4QUF A;  2H5X A;  3X3N A;  1AZP A;  1G2T A;  5CV5 A;  5C5M A;  3BYT B;  1PVO A;  4BY1 H;  4GN5 A;  3KUP A;  3BVZ A;  2WB1 G;  3NXW A;  4C3H B;  4X65 Q;  1T5E A;  4K2K A;  3OMC A;  4FYD A;  4L5T A;  1SBB B;  2KEC A;  2EYP A;  4DKA C;  3IKJ A;  3J80 i;  3S1N H;  5LMN L;  1E2V A;  3KF8 A;  1JT8 A;  3HKZ G;  1PFM A;  4NXN Q;  2XTI A;  1CSP A;  2A6H C;  2EJF C;  2AQ1 B;  4K8J A;  2XVS A;  2J4X A;  3C1F A;  2F0T A;  1SE8 A;  2EXZ A;  5FO9 B;  4XT1 B;  3S24 A;  1PRT C;  3I4N H;  2OXP A;  1D5X C;  3CQZ H;  3GTL B;  1M8A A;  3MXP A;  1SNC A;  2RCN A;  3RLF A;  3TS2 A;  1HR0 L;  1PH9 A;  4LFC Q;  1IW7 D;  1K28 A;  2GN5 A;  4JOI C;  5JJK A;  1GJX A;  5KNB A;  3J7Y W;  1N36 L;  1KNE A;  4PG3 A;  1A6X A;  4IUN A;  4LF4 Q;  2UUC L;  1UUP A;  3OWF A;  4QQB X;  2R93 G;  3OIQ A;  2MFI A;  1KIX A;  4YWM A;  1IKM A;  3AU7 A;  1C0A A;  3OTO L;  1AEX A;  1EWH A;  1RHP A;  2AUK A;  4H7B A;  4DF7 A;  4DNT B;  1C4Q A;  4O1N A;  1TS4 A;  1I5F A;  2L1B A;  4ZK9 B;  2EYH A;  1FNW A;  2VQF L;  1LLR D;  5IT9 E;  2NN6 I;  5JEA H;  1N33 Q;  1L0W A;  2F0W A;  1Y1W G;  2D9U A;  3PSI A;  1TWH B;  5IT9 c;  3H0G G;  5GRO A;  1KTK A;  1VQG A;  3TP5 A;  1JE4 A;  4DV7 L;  4HAE A;  3OSO A;  2L0C A;  2K5V A;  1ZXT A;  4OEM B;  1EFI D;  5KNC A;  4A3D B;  4GN4 B;  4EGV A;  5F2D A;  5IYC H;  2XIW A;  3QO2 A;  4HR7 B;  5CV4 A;  1HQM C;  5ELO A;  1DOK A;  3K6O A;  5BR8 L;  2EY6 A;  1G2S A;  3G6J B;  1CKN A;  1PZI D;  4R4Q A;  4DV0 L;  2EYF A;  2JA6 B;  1H9R A;  3OW7 A;  3RLO A;  3T13 A;  4JI7 L;  2LMC B;  1DYQ A;  4CDC C;  3T1Y Q;  1N32 L;  1LYL A;  2B2Y C;  1S5D D;  2AQ2 B;  3H09 A;  4F7X A;  4POF A;  2VXW A;  4R8N A;  4WJW A;  4F88 A;  1SYB A;  1WI5 A;  2NB0 A;  3RD4 A;  5IGC A;  4IAL A;  4G7Z C;  3HOX B;  2DN8 A;  3CMA A;  1UEB A;  4RKB A;  1B1Z A;  2IW3 A;  3BU2 A;  5KRU A;  1I50 B;  4IJL A;  1R4P B;  2Z6K A;  2BH8 A;  4X64 Q;  4C56 C;  2RQX A;  1V8Q A;  4O42 A;  4HN7 A;  3VR3 A;  3DM3 A;  3HS0 C;  4AYB G;  3H91 A;  4ZKC B;  3KJO A;  3S17 B;  1JWS D;  2QIL A;  3HGB A;  3AB9 A;  4IUU A;  2H4O A;  5LL6 X;  5M5Y H;  1NE3 A;  1VQB A;  2EQS A;  3V96 A;  4R4T A;  3O13 A;  5IP7 H;  1CUK A;  1EOV A;  4IZ8 A;  4X65 L;  1IW7 C;  5D65 A;  1VQC A;  2Q2H A;  3J80 L;  1HNZ L;  4EQO A;  4APV A;  4HJ9 A;  3TP8 A;  1PH8 A;  1W2B A;  1D1K A;  1MHW C;  2Q2T A;  1ZYR D;  3E0J A;  5JPM C;  2WAC A;  4GOP C;  1LV9 A;  3D4D A;  3NP8 A;  2WP8 J;  4LF9 Q;  3GTQ H;  4A3F B;  4BXX H;  1IYV A;  3NBH A;  3RR5 A;  2LY7 A;  3SE0 A;  1PTO H;  3J81 L;  1FGB D;  1WTH A;  4H02 A;  1PHJ A;  1VQL A;  1KXL A;  1U4L A;  4Q5V A;  1D2B A;  3EQL C;  1Z6H A;  1V1Q A;  4DR5 Q;  2JA7 H;  3G7L A;  3KDF A;  1AE2 A;  1SE4 A;  2L4N A;  3Q0A A;  5ELN A;  1E1O A;  1EIG A;  3UDX A;  1XTD A;  4F87 A;  4HMJ A;  4A3M G;  1F9R A;  2M00 A;  2CH4 W;  2I5L X;  4A3E B;  3ERS X;  1OXS C;  2Q8R E;  1T9H A;  2B8G A;  4LF4 L;  4CKC A;  3T4A C;  4DA2 A;  4A3I G;  3DMU A;  1EU3 A;  5EKI A;  2JA5 B;  3CCE A;  3KLR A;  4CBV A;  2ALY B;  1KRS A;  4QMG A;  2DY8 A;  2B63 B;  3A54 A;  2RA4 A;  3D8G A;  4YIJ A;  2K52 A;  1K9M C;  1RIP A;  3NQI A;  2FJ2 A;  2CH4 A;  3N52 A;  1GM5 A;  1T5X D;  3ERQ A;  1PH2 A;  2R7Z G;  3JAM E;  1KC8 C;  2JA8 H;  3AYH B;  1VQO A;  2QF7 A;  5FO8 B;  5LL6 S;  3JAM c;  4C3J B;  1VMC A;  4P2C B;  1O7I A;  4J1M A;  2PQA B;  1CM9 A;  1YEZ A;  5I9O A;  1HNW L;  3QIA A;  3KF6 B;  4FXG C;  1HA6 A;  1MSG A;  3L7Z C;  1MSH A;  1LO5 D;  3PQI A;  3I4M G;  4N9P A;  1W6K A;  2F0M A;  3EIV A;  2GVB A;  1WTV A;  2VS1 A;  2J0T D;  1EZ8 A;  4IOC A;  1ICF B;  4DV4 Q;  4V19 0;  1H9S A;  1M90 C;  4OGQ C;  5C4Z A;  2F0K A;  1ZKO A;  1D1I A;  3L3O C;  3T1Y L;  2FMC A;  3A8J E;  1JOO A;  1XMO L;  3WDN A;  2JQO A;  3BG3 A;  4YCU A;  1WCM H;  3MFY A;  5IIF A;  2R92 H;  2WKC A;  4DV5 Q;  2FXQ A;  4G4K A;  1ZYR C;  1LT5 D;  3BVG A;  3BZK A;  4HMI A;  2F0D A;  1XMQ Q;  4B9W A;  1PMR A;  1B7Y B;  2RCF A;  2Z4I A;  3MFG A;  4X64 L;  1H95 A;  1B4O A;  1HUM A;  4R4I A;  1IBL L;  2ZJR A;  2Q8I B;  2FMM A;  4MZ9 A;  3AMU A;  2KED A;  4A3J H;  2KUM A;  5AFW A;  1HFN A;  4C3I H;  3VR4 A;  1HHV A;  2ENB A;  3D0F A;  2R93 H;  1WTO A;  4FNF A;  4XDX A;  4BBR H;  2B2W A;  3GTM H;  1VQA A;  2K7V A;  2JEB I;  3TBI B;  4DV3 Q;  1CA6 A;  2Z0S A;  3H3V H;  2K28 A;  2MHV A;  3RZO B;  2MO1 A;  4K5V A;  2I5M X;  5KND A;  1XPR A;  2ZTD A;  1Y1W H;  2F03 A;  4HIK A;  2ZM6 L;  1B3A A;  1L1O B;  3E9H A;  3GO5 A;  4DGZ A;  4EQN A;  4HJ5 A;  1H9M A;  5EKK A;  4LF9 L;  4DV6 Q;  5C3E B;  1HTL D;  5JVG 3;  1SNO A;  3CRK C;  1LAB A;  3HP3 A;  1IBM Q;  2F0H A;  5L37 A;  1U0L A;  4X3K A;  2LKV A;  2NN6 G;  3K80 C;  2HD3 A;  3I91 A;  3UDF A;  3TEH B;  3E5S A;  4DR5 L;  2F0L A;  3TP7 A;  1PFB A;  4RCN A;  3GP7 A;  1II3 A;  1DGS A;  1PH4 A;  2MQH A;  2A73 B;  4A3K H;  4J15 A;  3CCM A;  3GTK H;  4GNX B;  2MP1 A;  1NMG A;  5M3F H;  5I2Y A;  4C1N K;  1CQV A;  1GHJ A;  5EPK A;  4QUC A;  3HOV G;  3S2H B;  4NKL A;  3KOJ A;  3HOU B;  2NWG A;  1KRT A;  2B2U C;  5IY0 A;  1A2T A;  2F4I A;  3I73 A;  3FVQ A;  4POG A;  1YNX A;  1K73 C;  2PPB C;  2B2T C;  4LK1 C;  2BDN A;  4A76 A;  3CW2 C;  1W6J A;  2NVT B;  3HRZ C;  4BY7 B;  4B3M L;  3M3Y B;  1VQ6 A;  1KDA A;  1I6H H;  5CBA E;  4A75 A;  3S1Q H;  2K03 A;  5JAV A;  1TR5 A;  5M3M H;  1Q12 A;  4CJ1 B;  1BOS A;  1OXV A;  1EQT A;  3M4O H;  2L5T A;  4GZY C;  3CP0 A;  4N8F A;  2NZ1 D;  4X62 L;  1X32 A;  1RKN A;  4B3R Q;  4BY1 B;  1FNV A;  1SJE D;  1Z7T A;  2QDB A;  3U58 A;  5EQ0 A;  1C7Y A;  2PZT A;  4DV4 L;  5DAU A;  5LMU L;  1RJT A;  4DAM A;  3S1N B;  4OWW B;  2DNC A;  1SNQ A;  4IUV A;  1Q1B A;  2FHT A;  3NBI A;  2YTV A;  3NE5 B;  3CCL A;  1X55 A;  3FKI H;  5M5X H;  3SK5 A;  2QW7 A;  1SND A;  3QWN A;  4KLK A;  3G6E A;  3I4N B;  1JB7 A;  4FF1 A;  1SYG A;  1LTB D;  2A6E D;  4A3B H;  5DNF A;  3LWE A;  4KY5 A;  1VQP A;  1S5C D;  4CJ2 C;  2AQ3 B;  2SEB D;  3HOW H;  1U9R A;  3URY A;  1EWC A;  1B9N A;  1EZ6 A;  2SOB A;  3EA6 A;  3K5O A;  5CV7 A;  4DV3 L;  1TS3 A;  4JC0 A;  4CKB A;  1ONL A;  2IHF A;  3MWY W;  4JBM A;  4U68 A;  1K83 B;  1HFG A;  3DUZ A;  2NZO A;  2AWN A;  2UUB L;  3A5Z B;  1DZ1 A;  5GQO A;  1I94 L;  2OCE A;  4JI8 Q;  4FXD A;  3DHQ A;  1EEI D;  2HDL A;  3VYS A;  3HOZ H;  3BDL A;  4DV6 L;  2WKD A;  4TQU S;  3M4Q A;  1BCP B;  4EQP A;  3PO2 H;  3ZJY C;  1XYI A;  2EYL A;  1BF4 A;  5DLQ E;  4TSS A;  2A68 C;  3I4M H;  1RD9 D;  2BA0 A;  4ULL A;  3NK9 A;  1X3E A;  5IGF A;  1QNK A;  4PNY A;  1ET9 A;  1RF2 D;  2L55 A;  3A8K E;  4CJ0 B;  1CKN B;  4PZ6 A;  4XQN A;  1Q81 C;  2L9H A;  4NP5 A;  1Q86 C;  1NBW A;  4X66 Q;  3K57 A;  2YU9 H;  4QF4 A;  1N36 Q;  5IWA L;  1PZJ D;  1BVS A;  4CHT B;  2E2J H;  1EYA A;  2XNA C;  4OHJ A;  4GLX A;  2KCM A;  1GO3 E;  1VQJ A;  1ENF A;  1DOL A;  2K04 A;  2A8V A;  3LWU A;  5IYD G;  1TY0 A;  3TDQ A;  2B39 A;  1PRT D;  1L1O A;  3BS1 A;  1Y69 U;  3QOJ A;  4B3T L;  2OF1 A;  1SRU A;  1OTC A;  2JE6 I;  3JC6 6;  1ML0 D;  1MIU A;  1XPO A;  1PTO F;  2A6E C;  1PZK D;  5COY A;  2F4V L;  1ASZ A;  5M5Y B;  4YCW A;  1QZH A;  4L5S A;  4HJA A;  3FEW X;  1VQE A;  3VYR A;  1VQI A;  4ZLT F;  5IP9 G;  1C9O A;  1LTS D;  3DXJ C;  3F8T A;  3SEB A;  2Z9H A;  3VYU A;  2N3S A;  2UXC Q;  3I4O A;  3KLW A;  5K5P A;  1SXT A;  1BQQ T;  2WAQ G;  3AEV A;  1B3Q A;  1H9K A;  1ZEQ X;  4UPA A;  4CKE A;  3I55 A;  1CZG A;  4JI7 Q;  3S14 H;  1GKH A;  3W2D A;  1N32 Q;  3GTQ B;  2JEA I;  4ZQ3 A;  3S15 H;  3I3C A;  1YNJ D;  2HCC A;  3D6W A;  4YWK A;  2VQE Q;  1Q8I A;  1NNX A;  4P72 A;  2ZXR A;  1TII D;  2JA7 B;  2EIF A;  1WD0 A;  1Y1V G;  2NTT A;  3M9B A;  2E2H H;  2I46 A;  4XT3 B;  1GOZ A;  3GDE A;  3HKS A;  1STE A;  1EYC A;  1PXU A;  4ID6 A;  3GV6 A;  4K5W A;  4LF8 Q;  4DUY Q;  1G29 1;  3HFZ B;  3I8Z A;  4JK1 C;  3HOY G;  3NWS A;  2B2V C;  2X6G A;  4C3H G;  1I3Q H;  2C9O A;  1JJ2 A;  4JI2 Q;  2XRQ D;  1S40 A;  3CCU A;  3K7A H;  4K14 A;  2K33 A;  1HNZ Q;  3MXG A;  1JJC B;  1M4V A;  4JI8 L;  1PRT F;  2F3V A;  2MO0 A;  1VQK A;  1GUO A;  4PMC A;  4EVO A;  3A5U A;  2DJG C;  1QVC A;  1YBY A;  4DR2 Q;  2RBM A;  3C46 A;  3J7Z C;  4R4O A;  1LTT D;  1QCB D;  1FL0 A;  3TN2 A;  4NW2 A;  2Z8L A;  2TSS A;  1NR4 A;  4RMF A;  3G71 A;  3QOL A;  2JA8 B;  1QE6 A;  2ZJP A;  1WTW A;  1HZB A;  2QGQ A;  4JCV E;  3F1Z A;  5EJW A;  2NVQ H;  4DK0 A;  3KK7 A;  4P71 A;  2ZT9 C;  2HCI A;  4EX5 A;  1JWM D;  3H6M A;  5C44 H;  5ELE A;  3T56 B;  1E2Z A;  4KHP Q;  1NR2 A;  1S5E D;  2MUY A;  1PYB A;  1YJ9 A;  2KVM A;  4LFB Q;  4JG2 A;  4X66 L;  5I4D A;  5CV6 A;  3PO3 G;  1H9S B;  5AJ3 Q;  1CKO A;  2H1E A;  4XYO A;  3JAM i;  5EPJ A;  2KEN A;  3M4Y A;  1NAP A;  4I7Z C;  1EY8 A;  3J7A F;  3RNU A;  2VUM G;  1WCM B;  2LSS A;  3K7U C;  2R92 B;  3NTH A;  3FHW A;  4PMB A;  3CCJ A;  1SAP A;  1W3S A;  1TVX A;  4FF3 A;  5CR3 A;  2CQO A;  4GS3 A;  1QZG A;  3PUZ A;  4MHE A;  5FO7 B;  5G3L D;  1YNJ C;  2WIN B;  1TU2 B;  4A3J B;  4C3I B;  1PFN A;  2EYO A;  2K50 A;  4M1U B;  4B9X A;  4A3D G;  4OO1 H;  2R93 B;  4JI1 Q;  4U67 3;  1BBW A;  1JJG A;  2XN9 C;  4BBR B;  2VNU D;  1G6Z A;  5CC4 A;  3GTM B;  3GTO H;  1HNW Q;  5HGQ A;  4L8J A;  1UWV A;  2JA6 G;  1PH7 A;  3AFP A;  1CSQ A;  4A3G H;  2UXC L;  1I4G A;  4Y7N H;  1JOR A;  3OPO A;  4DU9 A;  1IL2 A;  2CVR A;  5D3D A;  2JK8 A;  3PF4 A;  3D6C A;  4RGT A;  4RHS A;  4GKK L;  3HZX A;  2KHJ A;  4JI5 Q;  1E7Z A;  1XMO Q;  4S3S A;  1VMP A;  2G5D A;  4BBS H;  2P5Z X;  1SMY D;  3EBE A;  3HOX G;  3CC2 A;  4BA1 I;  2C5C A;  2I5H A;  3L9A X;  2VQE L;  1IL8 A;  5FJ8 G;  4HSV A;  4JI0 Q;  4KD4 A;  2IL8 A;  2F0J A;  4IFD H;  1TS2 A;  1NSN S;  1GUN A;  5C4X H;  3PIP A;  1Z47 A;  1BXT A;  1RL2 A;  1IBL Q;  4DAY B;  4R8I A;  3I56 A;  4A3K B;  2O5J C;  5M3F B;  4LF8 L;  4DUY L;  2KBN A;  4BA2 I;  1V1O A;  4BS9 A;  1JR0 D;  4ZYS A;  2ZXP A;  1Q8K A;  2HQE A;  3WWV A;  4JI2 L;  3GD7 A;  4JPB W;  5FKA C;  2NUC A;  3RN2 A;  3A55 A;  4WOR A;  4WJ4 A;  2CW0 D;  5JJI A;  1GUT A;  4LMQ D;  5T1I A;  1BUV T;  1S5F D;  3TQY A;  3HEJ A;  2ZM6 Q;  4DR2 L;  1WTQ A;  1E0B A;  3IFD A;  3NWT A;  4A3F G;  5A35 A;  3CU7 A;  3GTJ H;  1Q7Y C;  3FPU B;  4IUP A;  2F0F A;  3PIO A;  3M85 A;  5G3L F;  3C3L A;  2QDL A;  1I6H B;  2PNH A;  3S1Q B;  5EPL A;  4GKJ Q;  1OXU A;  4UHV A;  2F0E A;  5M3M B;  2AKW B;  5T1G A;  3OW2 A;  1JOK A;  4FO2 A;  4GOP B;  3SHL A;  5IP9 H;  2TMP A;  1UE1 A;  2XRS D;  4J6H A;  3GTP H;  4A3L G;  2SNM A;  3M4P A;  4QL5 A;  3RZD H;  3TZD A;  4KHP L;  2XWJ B;  2DY7 A;  2L11 A;  4P74 A;  4LFB L;  2CKZ B;  2PYK A;  5AJ3 L;  5DM7 3;  2N88 A;  4DR4 Q;  3OYY A;  4I7A A;  2BCO A;  5IE8 A;  2JA5 G;  5HY6 A;  1RCV D;  3CF5 A;  3NTK A;  3DEP A;  3PCO B;  2MPM A;  3K5M A;  1J6Q A;  2KCC A;  2B63 G;  1B8A A;  1Y1V H;  3FKI B;  5M5X B;  4OIJ A;  3R93 A;  1P16 A;  4PZ8 A;  1EIY B;  4B3M Q;  3CCV A;  4KY7 A;  2N8N A;  4A93 H;  5I6Y A;  2ZTE A;  2D5D A;  4PQX A;  3HOY H;  4A3B B;  3P7J A;  3UE0 A;  2A5H A;  4JV5 Q;  1SMY C;  4C3H H;  3J81 E;  2F0V A;  3I70 A;  5J22 A;  1B70 B;  3J81 c;  4JI1 L;  3HOW B;  1MD2 D;  1EQV A;  2JA9 A;  3R3O A;  1STH A;  4X62 Q;  2UXB Q;  2KJX A;  3S1M H;  4AIM A;  3N6R A;  1L0X B;  1CHP D;  5EBD A;  2O5I C;  1VDZ A;  5KYL A;  1BDO A;  1SNP A;  5K36 G;  1YIJ A;  3NSW A;  3G48 A;  4DFA A;  4F8M A;  5EKL A;  4A3C G;  4ALP A;  1UE6 A;  3J81 j;  2A19 A;  2F0U A;  5LMU Q;  1YIT A;  1E2W A;  2E5L L;  3LNN A;  1OXT A;  2CW0 C;  1X6O A;  3LX0 A;  4JI5 L;  1K8M A;  5JPN C;  3HOZ B;  3TRZ A;  4JOI A;  4UY8 C;  3PO2 B;  1EIF A;  1TQO A;  2UXD Q;  4JI0 L;  2D2C C;  1CA5 A;  3PUW A;  3CRL C;  2PW7 A;  1CZW A;  4O0A A;  5NUC A;  3PO3 H;  2KCT A;  1WJJ A;  5JEA J;  4DPG A;  1N9W A;  2IWH A;  2EOT A;  1S72 A;  1G91 A;  4X3T A;  1F2Z A;  5FLX L;  2DGY A;  1D5Z C;  4JI4 Q;  5IGG A;  2E2D C;  1D6E C;  1NJI C;  2PMZ B;  2L12 A;  2Z1C A;  2CWA A;  2VUM H;  2QEX A;  2F1M A;  2E8G A;  1QUQ B;  2YU9 B;  2IT1 A;  4QGU A;  1LUZ A;  2EPB A;  3F2D A;  3CD6 A;  1YHA A;  4DV1 Q;  4ILW A;  1Y8O B;  3EVQ A;  3KBG A;  2E2J B;  1EQQ A;  2M9V A;  2UUB Q;  3L0O A;  3V05 A;  3H0G H;  4IUR A;  4KN4 C;  4MTN A;  1I94 Q;  3NUC A;  2BE5 D;  4CDF C;  3OOC A;  2CCZ A;  2ES2 A;  2F3W A;  3T16 A;  4G7O C;  4GKJ L;  1JIC A;  4AH6 A;  3KLS A;  2PW5 A;  2F0N A;  4FXK C;  4IO9 A;  3BJU A;  1UE7 A;  1IKL A;  1LTA D;  1AE3 A;  5J3B A;  5C0X I;  1O80 A;  2Z6B A;  4WFN 3;  4OWX B;  3VR2 A;  4DN4 M;  1KLG D;  3KJP A;  2KA7 A;  4OON A;  3Q23 A;  5H1S E;  4DAY A;  1EUJ A;  4IPD A;  3HOU G;  3I4L A;  4DV2 L;  4DR4 L;  2E75 C;  4GNX C;  2KQ3 A;  2ASB A;  4FP5 D;  2EXD A;  4LAA A;  5IWA Q;  1PA6 A;  2Y0S B;  4DR1 L;  1DOM A;  1E24 A;  1I50 H;  5DEH A;  1VQ9 A;  3NPP A;  4RAU C;  4P73 A;  4DK3 C;  4DR3 Q;  2PMZ E;  4BY7 G;  1X3Q A;  1IXR A;  3K0X A;  3S15 B;  1ROD A;  3DLL A;  2ICE C;  1IZ6 A;  2A68 D;  1XX8 A;  3MAQ A;  4B3T Q;  1RDP D;  4JV5 L;  1TKW B;  4LUZ A;  5CBE E;  4OX9 L;  2K32 A;  1Q1E A;  3QR8 A;  2F0O A;  1I4X A;  2E2H B;  4RKL A;  1XXG A;  2EE1 A;  3CHB D;  2K5Q A;  5M5W H;  1MKH A;  3ER0 A;  2RDG A;  4GOP A;  2K5W A;  2NVX H;  1ESF A;  2UXB L;  1TY2 A;  1LAC A;  4BY1 G;  1TWF H;  2F4V Q;  1SR3 A;  4PV1 C;  1I3Q B;  1PDQ A;  5ISR A;  5A2Q L;  5C0X J;  3HG9 A;  4FVM A;  5J1Z A;  3K7A B;  3LGJ A;  5BN5 A;  2SNS A;  1A3V A;  2NZH A;  1M1K C;  3J7A V;  4OL7 A;  1SJH D;  3TS0 A;  4RG1 A;  4WJ3 M;  3G4S A;  3TRE A;  5GAD C;  4Q0F A;  3ITP A;  3IRB A;  4DR6 Q;  1BKB A;  2HT1 A;  3R8B A;  4IQZ A;  4I65 A;  4A3L H;  1LM0 A;  2UXD L;  1O7Y A;  2OT2 A;  4A4I A;  1KLU D;  2BE5 C;  3MXN B;  1NCV A;  4A3M H;  1TT2 A;  1MI2 A;  2Y0S E;  3CQZ B;  2NVQ B;  1TWA H;  1E22 A;  1UEA B;  3M7N A;  2K05 A;  2IJ0 A;  5IYB G;  1B50 A;  5C44 B;  4JI4 L;  4A3I H;  2PZU A;  1SSO A;  5J39 A;  4KI0 A;  4RCO A;  3H3V I;  2K01 A;  1XPU A;  1XWE A;  1WFQ A;  4YCV A;  4ZUI A;  1SN8 A;  4N9T A;  3CC4 A;  2XGT A;  3K0Y A;  3ND8 A;  4DV1 L;  3PUV A;  1PH5 A;  1AP0 A;  1VQD A;  1B2T A;  3PUY A;  1KAA A;  3C2P A;  1TWG H;  3K58 A;  1K3R A;  1OO9 B;  1HCZ A;  1ICW A;  2RF4 A;  5E4X A;  1KD1 C;  2R7Z H;  1HZ9 A;  2LXJ A;  5C3W A;  2DUD A;  1HPC A;  5JEA G;  3IL8 A;  4J8Q A;  4LWC A;  2OWO A;  1STN A;  2EJG C;  3UI2 A;  4KKU A;  1BCP C;  3CME A;  1JE5 A;  2OEO A;  1AFP A;  4LUV A;  4O2D A;  5IYC G;  1VCI A;  5CV8 A;  5D14 A;  2GA4 B;  4QJF A;  4A3C H;  1STY A;  5E1F A;  3GTO B;  2VL6 A;  4KK7 A;  4RGO S;  3QJY A;  1NUC A;  3Q22 A;  3TP6 A;  4YHH Q;  4A3G B;  4Y7N B;  2F0G A;  3CCQ A;  1JWU D;  1X56 A;  1F2Y A;  1CQF A;  2E76 C;  1A62 A;  3BYY B;  1QUQ A;  3PUX A;  3KFU A;  1QOH A;  2VB2 X;  2VZA A;  3KBX A;  4DXF A;  4JI3 Q;  3A0J A;  3AQQ A;  4DR3 L;  1A63 A;  4MN3 A;  4H0L C;  2EVB A;  1VF5 C;  2UU9 L;  2D62 A;  2ATW A;  4BBS B;  2IPK D;  1N34 Q;  1YNN D;  2YTX A;  4V0B A;  1JCK B;  1Q46 A;  4R1J A;  4UP8 A;  2WFW A;  1A8V A;  3DM1 A;  1MJC A;  1TXY A;  2IX1 A;  5C4X B;  4LNQ A;  2HIV A;  1LTL A;  2OQK A;  1YJN A;  2Z6K C;  4IPH A;  2Q8T A;  1DCZ A;  1KDC A;  4XXE A;  1GXD C;  4JBW A;  5CYU A;  2F0Q A;  1EWI A;  1LTG D;  4ME5 A;  2CQA A;  4ZAI A;  3ULL A;  1PH3 A;  4FF2 A;  1WD1 A;  3SK4 A;  4JW0 A;  4ZCK A;  2B3G A;  4DR7 Q;  5I2X A;  4JVZ A;  2K14 A;  2E2I H;  4KHV A;  2NN6 H;  1K8G A;  3D3R A;  2HUG A;  1VF7 A;  4HTH A;  1SLJ A;  1WOC A;  1CT1 D;  1SYC A;  3KYH C;  2RHQ B;  4BXX G;  5TSS A;  1HTP A;  3GTJ B;  4GKK Q;  2HDM A;  4DR6 L;  4GLV B;  1HH2 P;  3OHX C;  3BVM A;  1JB3 A;  3R2I A;  1J8I A;  1PTO B;  5E3F A;  3ERO A;  3FPP A;  1TWC H;  2K4K A;  2JA7 G;  2B2U A;  5EAY A;  1I4H A;  3QB3 A;  3HOV H;  2PNR C;  4HCS A;  4KD3 A;  1PLF A;  1RTN A;  3I7F A;  4KKS A;  3TSS A;  5C0X G;  3GTP B;  1Y8P B;  1EYG A;  1J5E Q;  4OWT B;  3RZD B;  2B2T A;  4G7H C;  1R4Q B;  1XJV A;  4H44 C;  4DK1 A;  5JJZ A;  1X9N A;  1HZC A;  4HCE A;  5JOB A;  4CDD C;  5C3X A;  2V1C C;  5GAE C;  1O7L A;  3T51 B;  4IUQ A;  1V9P A;  3KLS X;  1SFO H;  1QWY A;  2QEJ C;  3ULP A;  2KOL A;  1WVL A;  1QVF A;  2K1B A;  3SR1 A;  1I4Q A;  2CHB D;  1D5M C;  4Z9C B;  1PH6 A;  3H94 A;  4A93 B;  1EY0 A;  2GVA A;  3BZD B;  3VR5 A;  3RN5 A;  3HOY B;  1R9T H;  2OTL A;  3CAM A;  1D8L A;  2JA8 G;  3NQT A;  4X6A H;  4MIU A;  1B44 D;  1Q90 A;  1X65 A;  2QKI C;  1YNN C;  3FMC A;  5KEE A;  3VYT A;  2WB1 B;  3D4W A;  1J9O A;  3MXN A;  4K5X A;  1SMX A;  2KCN A;  1X54 A;  1K8A C;  2RKS A;  1GUS A;  2CFM A;  1KQS A;  1VQN A;  3S1M B;  1YVC A;  3DWA A;  3S2D H;  1Y14 B;  2F0S A;  3HKZ B;  4TRD A;  1SYD A;  2XWB B;  5IT9 L;  3P20 A;  3PIP 3;  1XNQ Q;  4JYA Q;  1PRT B;  4UP9 A;  4YHH L;  1KDB A;  4YWL A;  4RGM A;  1CTM A;  4DAV A;  1EY9 A;  5CV9 A;  1CI3 M;  4IJH A;  4DUZ Q;  1HZA A;  4C2M H;  4DK6 C;  2RSN A;  3J81 i;  3EN2 A;  2WAQ E;  4JI3 L;  1LT3 D;  1WCM G;  2BOS A;  2R92 G;  1GD7 A;  2KEE A;  5DM6 3;  3CPF A;  1C8C A;  4BWG B;  5IYB H;  3IAY A;  1AN8 A;  1N34 L;  2EYJ A;  3GTG H;  1VQ8 A;  1JMC A;  2DNE A;  2WV6 D;  4LF5 L;  3NHH A;  3T1H Q;  3U4Z A;  3PO3 B;  1VQH A;  1TS5 A;  3E9I A;  2A69 D;  3PIO 3;  4A3J G;  3UDI A;  4C3I G;  1K83 H;  2EY2 A;  2E74 C;  1WTP A;  2OQ0 A;  1ET6 A;  4BBR G;  2X69 A;  3J7A 5;  2PZW A;  3F2C A;  1DJR D;  1DXM A;  3I90 A;  2VUM B;  1YI2 A;  5EGT A;  4NDX A;  2B2W C;  2HHH L;  5IGD A;  1EY4 A;  3OIP A;  2K6A A;  4DR7 L;  1Z9F A;  3BZC A;  1SDF A;  2UUA L;  2WB1 E;  1PYW D;  2PI2 A;  1Y1W B;  4TVA B;  2NBF A;  3H0G B;  3K8A A;  3H3V C;  1HA5 A;  1A3U A;  2N49 A;  3IFT A;  4KKT A;  5HGT A;  2KHS A;  3RUZ A;  2E5L Q;  3HKZ E;  5CGK A;  1SYF A;  2J7Z A;  1DD2 A;  4MTK A;  3D31 A;  3BDC A;  4RA8 A;  4ABN A;  1LTR D;  1GUG A;  4B3S Q;  3M7G A;  3H15 A;  1K0S A;  2L15 A;  1WTX A;  3MC0 B;  4M8A A;  4A3K G;  1QB5 D;  3R2T A;  5I6W A;  5LHY 1;  5M3F G;  5IGE A;  1J5E L;  2ID0 A;  3OWE B;  4LF6 Q;  3GTK B;  3PF5 A;  4OEL B;  2EJM A;  4RH6 A;  1EU4 A;  2D0P A;  2V4D A;  3F2U A;  1HXY D;  1X3P A;  3RLN A;  3Q24 A;  4QIW B;  4HID A;  4XYQ A;  5IYD H;  2F52 A;  1C48 A;  2K75 A;  3U4V A;  1IBK L;  1F9S A;  1BNZ A;  4YY3 Q;  1SE3 A;  1QNU A;  5ELD A;  3A56 A;  3U50 C;  1EIH A;  3E3X A;  1U4R A;  3S16 H;  4AYB B;  4HIO A;  2HIX A;  3A8I E;  4XQQ A;  4RWS C;  2AHO B;  4IPC A;  3V2T A;  5M3M G;  4LW1 A;  2ZTC A;  5EBC A;  2EZV A;  5LMN W;  4IN3 A;  1EEF D;  3UDG A;  4RFB A;  2JJQ A;  5C4J H;  3M4O B;  1FYC A;  3DWQ A;  5M5W B;  1FNU A;  1U4P A;  4UAI A;  3S1R H;  2A69 C;  4QCL A;  4NXN L;  4KTA A;  2NVX B;  1F9Q A;  1TWF B;  5GAG C;  3E6Z X;  1VQ5 A;  4KMU C;  1XNQ L;  4JYA L;  2X6L A;  4A3E G;  2R61 A;  1ESR A;  3SXH A;  1YHB A;  2NVY H;  3TZU A;  3JAM L;  4P75 A;  4DV2 Q;  4DUZ L;  5FLM G;  1KNA A;  3VA7 A;  1HR0 W;  1PH1 A;  4DR1 Q;  3J80 E;  3VDY A;  1EY5 A;  3FKI G;  3PGZ A;  4NB3 A;  3J80 c;  4QIW E;  4LFC L;  5C0X H;  4CDE C;  2AWO A;  4K6D A;  1EQR A;  2B2V A;  3UE1 A;  2RDF A;  4L5Q A;  2B8F A;  3MTS A;  3T1H L;  4A3M B;  4A3B G;  1MBY A;  2JXM B;  1E3P A;  2K5N A;  4FF4 A;  1G51 A;  1I4P A;  2R7F A;  3Q6S A;  4WRD A;  4DAP A;  4C1N I;  3NEN A;  4OO1 I;  1TWA B;  1CFM A;  3A7A B;  3EFX D;  1K3B C;  5COR A;  2IY5 B;  2M2L A;  3VR6 A;  4OX9 Q;  1BBU A;  3HOW G;  3CPW A;  1SYE A;  3W3A A;  4C3J G;  2CWP A;  1A15 A;  4NPS A;  4A3I B;  3ULJ A;  4AYB E;  4EQ5 A;  1EY7 A;  4N8X 1;  5E7N A;  3FDT A;  2FFK B;  2A1A A;  1UAP A;  1FVI A;  1EOT A;  4K0K Q;  2RHS B;  4DNI A;  1N33 L;  2OTJ A;  1TWG B;  1VQ4 A;  3BDO A;  1GHK A;  2R7Z B;  2R7D A;  3X3M A;  3HOZ G;  3DEO A;  2YV5 A;  3GTL H;  4GLA C;  1X3F A;  3PO2 G;  4ZRZ A;  3STB D;  4QB4 A;  1VQ7 A;  1MGS A;  1CK1 A;  4LF7 Q;  4IFD I;  3U9O A;  2A74 C;  3K81 C;  2F0P A;  3AFQ A;  2BA1 A;  4B3S L;  4L5R C;  1PYS B;  2ZXO A;  3I4M B;  1CKM A;  3W1G A;  4DXG A;  4IUT A;  4KV6 A;  1SRO A;  2RDH A;  1AZQ A;  4LF6 L;  1KL9 A;  1LT4 D;  3C1E A;  4XQJ A;  1H9J A;  1PV4 A;  3P1H A;  1IHZ A;  2Q2I A;  1V1P B;  1KHI A;  1QJO A;  4LFA Q;  5IOD A;  1IYU A;  4YY3 L;  1TWH H;  2JSO A;  2D0O A;  4K6L A;  2N78 A;  3EJI A;  3MA2 B;  4B08 A;  4AQY Q;  1QIL A;  2IX0 A;  5CMD A;  2LXK A;  5C3E G;  3D4R A;  4HIM A;  2NTS A;  4MNO A;  4XTC S;  4A3D H;  1EL0 A;  1F2M A;  4NMZ A;  2WII B;  2F0I A;  1V43 A;  3ONA B;  1GVP A;  1DM0 B;  1L1O C;  5IOC A;  3Q8D A;  4OIK A;  2JA6 H;  3K5L A;  4IFD J;  1LT6 D;  1K0R A;  2EDG A;  1VQF A;  3MEH A;  1K8O A;  4HJ7 A;  2B2Y A;  5FLX E;  5FOB B;  1XNR Q;  5FLX c;  1MJE A;  1FJG Q;  4JI6 Q;  1XTC D;  2DJF C;  1FR3 A;  4UP7 A;  2Y0S G;  2E2I B;  3HOX H;  2C35 B;  1YJW A;  4RHR A;  5FJ8 H;  4KJN A;  2AUJ D;  3S14 B;  1UE5 A;  1YHQ A;  1Y8N B;  1B53 A;  1S3O A;  3DWP A;  3MZ5 A;  5KIX A;  2UU9 Q;  4NXM Q;  4X3S A;  3CCS A;  3S17 H;  1BCP D;  2R3Z A;  1SE2 A;  1TWC B;  4PMW A;  3NEM A;  4H13 C;  3STB C;  4QY7 A;  3I2Z A;  3HOV B;  3P75 A;  1QG7 A;  3MEF A;  1L2F A;  2SDF A;  1I6V C;  3B6Y A;  2RVL A;  1U5K A;  4FDB A;  1FD7 D;  1SEB D;  2EYM A;  2G9D A;  1O7Z A;  1L0Y B;  4GN3 B;  4K0K L;  2XSC A;  4HSP A;  3K59 A;  1WTR A;  4A3F H;  4UDU C;  3CXC A;  1U4M A;  2N55 A;  1KAB A;  1SFO B;  3SK6 A;  5I9P A;  1JC7 A;  3NTI A;  1EYD A;  2NYZ D;  3TME A;  1LTI D;  4LF7 L;  1RTO A;  1R9T B;  3I4N G;  5ELF A;  1ASY A;  2MNA A;  4A3E H;  2MGS A;  1HRJ A;  4Y52 H;  3KF8 B;  1ILQ A;  4OXP A;  4DNR B;  5C44 G;  3SK8 A;  1SNM A;  1HNX Q;  2IHE A;  5FLM H;  5FK9 C;  2VB3 X;  5HUR A;  2JA5 H;  3GV3 A;  4R9W A;  5D3I B;  1STB A;  3S2D B;  2RSO A;  2ICI A;  1QVG A;  2R6G A;  2B63 H;  1P8L A;  2VW9 A;  3CC7 A;  4XIG S;  4DV5 L;  3E0E A;  3A7L A;  1YZ6 A;  3MXU A;  3F2B A;  1GUW A;  5C5L A;  1XMQ L;  1NMF A;  5E4W C;  1AW7 A;  1ENC A;  4C2M B;  5A2Q E;  5C6A A;  1E1T A;  2JN4 A;  5ELC A;  1Q82 C;  1OXX K;  5BN3 A;  4LFA L;  4RGN A;  5BN4 A;  4KN7 C;  3RMH A;  2I07 B;  3PV0 A;  4AQY L;  1BCP F; 
#chains in the Genus database with same CATH homology
 1JQY D;  3MVV A;  1JOQ A;  5JVH 3;  2PO4 A;  3GTG B;  4L6T B;  2YYZ A;  1HUN A;  1PTO D;  3I72 A;  4X3U A;  1O78 A;  1A2U A;  4OO1 G;  5K36 H;  3MHB A;  2O4X A;  4G57 A;  3SDZ A;  2EY1 A;  2G9H D;  5C4H A;  1I4R A;  1F9P A;  4K2L A;  2EY5 A;  5KGU A;  2JP1 A;  1B9M A;  4L63 B;  1G8Z D;  1V1P A;  1S4Z A;  3OMG A;  4ODG A;  1DON A;  2IX3 A;  4IFD G;  1UNS A;  2JYO A;  1ENA A;  2PQE A;  2MJ8 A;  1Q3L A;  1EY6 A;  5M9O A;  2LFN A;  1BO0 A;  4HED A;  2A6H D;  4E6I A;  5ELB A;  3VA5 A;  1CHQ D;  1F77 A;  2LS0 1;  3SVM A;  3QG1 A;  3S9W A;  1F2L A;  1BR9 A;  2BDO A;  4ZUJ A;  3WOE A;  3FRP B;  4KJO A;  1ILP A;  4TKO B;  4K8I A;  1STG A;  4KY6 A;  3S16 B;  3GQB A;  1S5B D;  2O2L D;  4LJZ C;  3T53 B;  4ZKB B;  5C4J B;  3K5N A;  1PTO C;  2K5D A;  3S1R B;  3PMF A;  2WAQ B;  1HQR D;  3U9S A;  2Z4H A;  2QCP X;  3ND9 A;  2NVY B;  5IGB A;  2FIN B;  2PCF B;  3CKI B;  4KHZ A;  5KYI A;  1STA A;  1Y1V B;  4CGY B;  3WOF A;  1A3T A;  1BBX C;  3ZYY X;  4QUF A;  3X3N A;  1AZP A;  1G2T A;  5CV5 A;  5C5M A;  3BYT B;  3KUP A;  3BVZ A;  3NXW A;  4C3H B;  1T5E A;  4K2K A;  3OMC A;  4FYD A;  1SBB B;  2KEC A;  2EYP A;  3IKJ A;  1E2V A;  3KF8 A;  1PFM A;  2A6H C;  2EJF C;  2AQ1 B;  4K8J A;  2XVS A;  2J4X A;  3C1F A;  2F0T A;  2EXZ A;  5FO9 B;  4XT1 B;  1PRT C;  2OXP A;  1D5X C;  3GTL B;  1M8A A;  3MXP A;  1SNC A;  3RLF A;  1IW7 D;  1GJX A;  5KNB A;  3J7Y W;  1KNE A;  1A6X A;  4IUN A;  1UUP A;  3OWF A;  3OIQ A;  1IKM A;  3AU7 A;  1AEX A;  1EWH A;  1RHP A;  2AUK A;  4H7B A;  4DF7 A;  4DNT B;  1C4Q A;  4O1N A;  1TS4 A;  2L1B A;  4ZK9 B;  2EYH A;  1FNW A;  1LLR D;  5IT9 E;  2NN6 I;  5JEA H;  2F0W A;  2D9U A;  1TWH B;  1KTK A;  3TP5 A;  1JE4 A;  4HAE A;  3OSO A;  2L0C A;  1ZXT A;  1EFI D;  5KNC A;  4A3D B;  4EGV A;  5F2D A;  2XIW A;  3QO2 A;  4HR7 B;  5CV4 A;  1HQM C;  1DOK A;  3K6O A;  2EY6 A;  1G2S A;  3G6J B;  1PZI D;  2EYF A;  2JA6 B;  1H9R A;  3OW7 A;  3T13 A;  2LMC B;  1DYQ A;  2B2Y C;  1S5D D;  2AQ2 B;  3H09 A;  4F7X A;  2VXW A;  4R8N A;  4WJW A;  4F88 A;  1SYB A;  2NB0 A;  3RD4 A;  5IGC A;  4IAL A;  4G7Z C;  3HOX B;  2DN8 A;  4RKB A;  1B1Z A;  2IW3 A;  5KRU A;  1I50 B;  1R4P B;  4C56 C;  2RQX A;  1V8Q A;  4O42 A;  4HN7 A;  3VR3 A;  3HS0 C;  3H91 A;  4ZKC B;  3S17 B;  1JWS D;  2QIL A;  3HGB A;  3AB9 A;  4IUU A;  2H4O A;  5LL6 X;  3V96 A;  3O13 A;  4IZ8 A;  1IW7 C;  5D65 A;  3J80 L;  4EQO A;  3TP8 A;  1D1K A;  1ZYR D;  3E0J A;  5JPM C;  2WAC A;  1LV9 A;  3D4D A;  3NP8 A;  2WP8 J;  1IYV A;  4A3F B;  3NBH A;  2LY7 A;  3SE0 A;  1PTO H;  3J81 L;  1FGB D;  1U4L A;  4Q5V A;  1D2B A;  3EQL C;  1Z6H A;  3G7L A;  1SE4 A;  2L4N A;  3Q0A A;  1EIG A;  4F87 A;  4HMJ A;  1F9R A;  2M00 A;  4A3E B;  1OXS C;  2Q8R E;  2B8G A;  4CKC A;  3T4A C;  4DA2 A;  3DMU A;  1EU3 A;  5EKI A;  2JA5 B;  3KLR A;  4CBV A;  4QMG A;  2DY8 A;  2B63 B;  3A54 A;  2RA4 A;  3D8G A;  4YIJ A;  3NQI A;  2FJ2 A;  3N52 A;  1T5X D;  3ERQ A;  3JAM E;  2QF7 A;  5FO8 B;  5LL6 S;  4C3J B;  1VMC A;  4P2C B;  4J1M A;  1CM9 A;  5I9O A;  3QIA A;  4FXG C;  1HA6 A;  1MSG A;  3L7Z C;  1MSH A;  1LO5 D;  4N9P A;  1W6K A;  2F0M A;  1WTV A;  2J0T D;  1EZ8 A;  4V19 0;  1H9S A;  4OGQ C;  5C4Z A;  2F0K A;  1ZKO A;  1D1I A;  3L3O C;  2FMC A;  3A8J E;  1JOO A;  3WDN A;  3BG3 A;  5IIF A;  3MFY A;  2WKC A;  4G4K A;  1ZYR C;  1LT5 D;  3BVG A;  4HMI A;  2F0D A;  4B9W A;  1PMR A;  2Z4I A;  3MFG A;  1B4O A;  1HUM A;  2Q8I B;  2FMM A;  3AMU A;  2KED A;  2KUM A;  5AFW A;  1HFN A;  1HHV A;  3VR4 A;  2ENB A;  1WTO A;  4FNF A;  4XDX A;  2B2W A;  2K7V A;  2JEB I;  3TBI B;  1CA6 A;  2K28 A;  2MHV A;  3RZO B;  4K5V A;  5KND A;  2F03 A;  1B3A A;  3GO5 A;  4DGZ A;  4EQN A;  1H9M A;  5EKK A;  5C3E B;  1HTL D;  5JVG 3;  1SNO A;  3CRK C;  1LAB A;  3HP3 A;  2F0H A;  4X3K A;  2LKV A;  2NN6 G;  3I91 A;  3E5S A;  2F0L A;  3TP7 A;  1PFB A;  4RCN A;  3GP7 A;  1II3 A;  2A73 B;  2MP1 A;  5I2Y A;  4C1N K;  1CQV A;  1GHJ A;  5EPK A;  4QUC A;  3S2H B;  4NKL A;  3HOU B;  2NWG A;  2B2U C;  1A2T A;  2F4I A;  3I73 A;  3FVQ A;  2PPB C;  2B2T C;  4LK1 C;  2BDN A;  1W6J A;  2NVT B;  3HRZ C;  4BY7 B;  3M3Y B;  1KDA A;  5CBA E;  2K03 A;  5JAV A;  1TR5 A;  1Q12 A;  4CJ1 B;  1BOS A;  1OXV A;  1EQT A;  2L5T A;  4GZY C;  2NZ1 D;  1X32 A;  1RKN A;  4BY1 B;  1FNV A;  1SJE D;  1Z7T A;  2QDB A;  5EQ0 A;  2PZT A;  5DAU A;  1RJT A;  3S1N B;  2DNC A;  1SNQ A;  4IUV A;  1Q1B A;  2FHT A;  3NBI A;  3NE5 B;  3SK5 A;  1SND A;  3QWN A;  3I4N B;  4FF1 A;  1SYG A;  1LTB D;  2A6E D;  5DNF A;  3LWE A;  4KY5 A;  1S5C D;  4CJ2 C;  2AQ3 B;  2SEB D;  1U9R A;  3URY A;  1EWC A;  1B9N A;  1EZ6 A;  2SOB A;  3EA6 A;  3K5O A;  5CV7 A;  1TS3 A;  4CKB A;  1ONL A;  3MWY W;  4U68 A;  1K83 B;  1HFG A;  3DUZ A;  2AWN A;  1DZ1 A;  4FXD A;  3DHQ A;  1EEI D;  2HDL A;  3VYS A;  3BDL A;  2WKD A;  4TQU S;  1BCP B;  4EQP A;  1XYI A;  2EYL A;  1BF4 A;  4TSS A;  2A68 C;  1RD9 D;  2BA0 A;  4ULL A;  3NK9 A;  5IGF A;  1QNK A;  4PNY A;  1ET9 A;  1RF2 D;  2L55 A;  3A8K E;  4CJ0 B;  4XQN A;  2L9H A;  4NP5 A;  3K57 A;  4QF4 A;  1PZJ D;  4CHT B;  1EYA A;  2XNA C;  4OHJ A;  1ENF A;  1DOL A;  2K04 A;  3LWU A;  1TY0 A;  3TDQ A;  2B39 A;  1PRT D;  3BS1 A;  1Y69 U;  3QOJ A;  2OF1 A;  2JE6 I;  1ML0 D;  1PTO F;  2A6E C;  1PZK D;  5COY A;  5M5Y B;  3FEW X;  3VYR A;  4ZLT F;  1LTS D;  3DXJ C;  3SEB A;  3VYU A;  5K5P A;  1SXT A;  1BQQ T;  1H9K A;  1ZEQ X;  4CKE A;  1CZG A;  3W2D A;  3GTQ B;  2JEA I;  4ZQ3 A;  3I3C A;  1YNJ D;  2HCC A;  3D6W A;  1Q8I A;  2ZXR A;  1TII D;  2JA7 B;  1WD0 A;  2NTT A;  2I46 A;  4XT3 B;  1GOZ A;  1STE A;  1EYC A;  1PXU A;  4ID6 A;  3GV6 A;  4K5W A;  1G29 1;  3I8Z A;  4JK1 C;  3NWS A;  2B2V C;  2X6G A;  4C3H G;  2C9O A;  2XRQ D;  4K14 A;  2K33 A;  3MXG A;  1M4V A;  1PRT F;  2F3V A;  1GUO A;  4PMC A;  4EVO A;  2RBM A;  3C46 A;  1LTT D;  1QCB D;  3TN2 A;  4NW2 A;  2Z8L A;  2TSS A;  1NR4 A;  3QOL A;  2JA8 B;  1QE6 A;  1WTW A;  5EJW A;  4DK0 A;  3KK7 A;  2ZT9 C;  2HCI A;  1JWM D;  3H6M A;  5ELE A;  3T56 B;  1E2Z A;  1NR2 A;  1S5E D;  2MUY A;  2KVM A;  5I4D A;  5CV6 A;  1H9S B;  2H1E A;  4XYO A;  5EPJ A;  3M4Y A;  1NAP A;  4I7Z C;  1EY8 A;  3J7A F;  1WCM B;  2R92 B;  3NTH A;  4PMB A;  1SAP A;  1TVX A;  4FF3 A;  5CR3 A;  3PUZ A;  4MHE A;  5G3L D;  5FO7 B;  1YNJ C;  2WIN B;  1TU2 B;  4A3J B;  4C3I B;  1PFN A;  2EYO A;  4M1U B;  4OO1 H;  4B9X A;  2R93 B;  4U67 3;  2XN9 C;  4BBR B;  2VNU D;  1G6Z A;  5CC4 A;  3GTM B;  4L8J A;  1I4G A;  1JOR A;  3OPO A;  4DU9 A;  2CVR A;  5D3D A;  3D6C A;  4RGT A;  4RHS A;  3HZX A;  4S3S A;  1VMP A;  1SMY D;  4BA1 I;  2C5C A;  3L9A X;  1IL8 A;  4HSV A;  4KD4 A;  2IL8 A;  2F0J A;  4IFD H;  1TS2 A;  1NSN S;  1GUN A;  1Z47 A;  1BXT A;  4A3K B;  4R8I A;  2O5J C;  5M3F B;  4BA2 I;  1V1O A;  4BS9 A;  1JR0 D;  2ZXP A;  2HQE A;  3GD7 A;  5FKA C;  2NUC A;  3A55 A;  4WOR A;  2CW0 D;  1GUT A;  4LMQ D;  5T1I A;  1BUV T;  1S5F D;  3HEJ A;  1WTQ A;  1E0B A;  3IFD A;  3NWT A;  5A35 A;  3CU7 A;  3FPU B;  4IUP A;  2F0F A;  3M85 A;  5G3L F;  3C3L A;  1I6H B;  3S1Q B;  5EPL A;  1OXU A;  2F0E A;  5M3M B;  5T1G A;  1JOK A;  4FO2 A;  3SHL A;  2TMP A;  2XRS D;  4J6H A;  2SNM A;  3TZD A;  2XWJ B;  2DY7 A;  2L11 A;  2PYK A;  5DM7 3;  2N88 A;  2BCO A;  1RCV D;  3NTK A;  3DEP A;  3K5M A;  2MPM A;  2KCC A;  3FKI B;  5M5X B;  4OIJ A;  3R93 A;  4KY7 A;  5I6Y A;  2D5D A;  4PQX A;  4A3B B;  3P7J A;  2A5H A;  1SMY C;  3J81 E;  2F0V A;  3I70 A;  5J22 A;  3HOW B;  1MD2 D;  1EQV A;  3R3O A;  1STH A;  2KJX A;  3N6R A;  1L0X B;  1CHP D;  5EBD A;  2O5I C;  1VDZ A;  5KYL A;  1BDO A;  1SNP A;  5K36 G;  3NSW A;  4DFA A;  4F8M A;  5EKL A;  2F0U A;  1E2W A;  3LNN A;  1OXT A;  2CW0 C;  3LX0 A;  1K8M A;  5JPN C;  3HOZ B;  3PO2 B;  1TQO A;  2D2C C;  1CA5 A;  3PUW A;  3CRL C;  2PW7 A;  1CZW A;  5NUC A;  5JEA J;  2IWH A;  2EOT A;  1G91 A;  4X3T A;  1F2Z A;  5FLX L;  1D5Z C;  5IGG A;  2E2D C;  1D6E C;  2PMZ B;  2L12 A;  2Z1C A;  2F1M A;  2YU9 B;  2IT1 A;  2EPB A;  4ILW A;  1Y8O B;  3EVQ A;  3KBG A;  2E2J B;  2M9V A;  3V05 A;  4IUR A;  4KN4 C;  3NUC A;  2BE5 D;  3OOC A;  2F3W A;  3T16 A;  4G7O C;  1JIC A;  3KLS A;  2PW5 A;  2F0N A;  4FXK C;  1IKL A;  1LTA D;  5C0X I;  1O80 A;  4WFN 3;  3VR2 A;  4DN4 M;  1KLG D;  2KA7 A;  3Q23 A;  4DAY A;  3I4L A;  2E75 C;  2KQ3 A;  4FP5 D;  4LAA A;  2Y0S B;  1DOM A;  5DEH A;  3NPP A;  4RAU C;  1X3Q A;  3S15 B;  1ROD A;  2ICE C;  2A68 D;  1XX8 A;  3MAQ A;  1RDP D;  1TKW B;  5CBE E;  2K32 A;  1Q1E A;  2F0O A;  1I4X A;  2E2H B;  4RKL A;  1XXG A;  2EE1 A;  3CHB D;  2K5Q A;  2RDG A;  2K5W A;  1ESF A;  1TY2 A;  1LAC A;  4PV1 C;  1I3Q B;  1PDQ A;  5ISR A;  5A2Q L;  5C0X J;  3HG9 A;  4FVM A;  5J1Z A;  3K7A B;  5BN5 A;  2SNS A;  1A3V A;  3J7A V;  4OL7 A;  1SJH D;  4Q0F A;  3ITP A;  3R8B A;  4IQZ A;  4I65 A;  1O7Y A;  2OT2 A;  1KLU D;  2BE5 C;  1NCV A;  1TT2 A;  1MI2 A;  3CQZ B;  2NVQ B;  1BCP F;  1UEA B;  3M7N A;  2K05 A;  2IJ0 A;  1B50 A;  5C44 B;  2PZU A;  1SSO A;  5J39 A;  4KI0 A;  4RCO A;  2K01 A;  1XWE A;  4ZUI A;  4N9T A;  3ND8 A;  3K0Y A;  3PUV A;  1AP0 A;  1B2T A;  3PUY A;  1KAA A;  3C2P A;  3K58 A;  1OO9 B;  1HCZ A;  1ICW A;  5E4X A;  5C3W A;  1HPC A;  5JEA G;  3IL8 A;  4J8Q A;  1STN A;  2EJG C;  3UI2 A;  4KKU A;  1BCP C;  2OEO A;  1AFP A;  1VCI A;  5CV8 A;  5D14 A;  2GA4 B;  1STY A;  5E1F A;  3GTO B;  4KK7 A;  4RGO S;  3QJY A;  1NUC A;  3Q22 A;  3TP6 A;  4A3G B;  4Y7N B;  2F0G A;  1JWU D;  1F2Y A;  1CQF A;  2E76 C;  3BYY B;  3PUX A;  1QOH A;  2VB2 X;  3KBX A;  4DXF A;  4MN3 A;  4H0L C;  2EVB A;  1VF5 C;  2D62 A;  4BBS B;  2IPK D;  1YNN D;  4V0B A;  1JCK B;  3DM1 A;  2IX1 A;  5C4X B;  2Q8T A;  1DCZ A;  1KDC A;  4XXE A;  1GXD C;  4JBW A;  5CYU A;  2F0Q A;  1LTG D;  4ME5 A;  2CQA A;  4ZAI A;  4FF2 A;  1WD1 A;  3SK4 A;  5I2X A;  4KHV A;  2NN6 H;  3D3R A;  2HUG A;  1VF7 A;  4HTH A;  1CT1 D;  1SYC A;  5TSS A;  1HTP A;  3GTJ B;  2HDM A;  3OHX C;  3BVM A;  1JB3 A;  3R2I A;  1J8I A;  1PTO B;  5E3F A;  3ERO A;  3FPP A;  2B2U A;  1I4H A;  3QB3 A;  2PNR C;  4HCS A;  4KD3 A;  1PLF A;  1RTN A;  4KKS A;  3TSS A;  5C0X G;  3GTP B;  1Y8P B;  3RZD B;  2B2T A;  4G7H C;  1R4Q B;  4H44 C;  4DK1 A;  5JJZ A;  4HCE A;  5JOB A;  5C3X A;  1O7L A;  3T51 B;  4IUQ A;  3KLS X;  1QWY A;  2QEJ C;  2KOL A;  1WVL A;  2K1B A;  3SR1 A;  1I4Q A;  2CHB D;  1D5M C;  4Z9C B;  3H94 A;  4A93 B;  1EY0 A;  3BZD B;  3VR5 A;  3HOY B;  3NQT A;  4MIU A;  1B44 D;  1Q90 A;  2QKI C;  1YNN C;  3FMC A;  5KEE A;  3VYT A;  2WB1 B;  3D4W A;  1J9O A;  3MXN A;  4K5X A;  2KCN A;  2RKS A;  1GUS A;  3S1M B;  3DWA A;  2F0S A;  3HKZ B;  4TRD A;  1SYD A;  2XWB B;  5IT9 L;  3P20 A;  3PIP 3;  1PRT B;  1KDB A;  4RGM A;  1CTM A;  4DAV A;  1EY9 A;  5CV9 A;  1CI3 M;  2RSN A;  1LT3 D;  2BOS A;  2KEE A;  5DM6 3;  1C8C A;  4BWG B;  3IAY A;  1AN8 A;  2EYJ A;  2DNE A;  2WV6 D;  3NHH A;  3PO3 B;  1TS5 A;  2A69 D;  3PIO 3;  4C3I G;  2EY2 A;  2E74 C;  1WTP A;  1ET6 A;  2X69 A;  2PZW A;  1DXM A;  1DJR D;  3I90 A;  2VUM B;  5EGT A;  4NDX A;  2B2W C;  5IGD A;  1EY4 A;  3OIP A;  2K6A A;  1SDF A;  1PYW D;  1Y1W B;  2NBF A;  3H0G B;  3H3V C;  1HA5 A;  1A3U A;  3IFT A;  4KKT A;  5HGT A;  2KHS A;  3RUZ A;  5CGK A;  1SYF A;  2J7Z A;  1DD2 A;  3D31 A;  3BDC A;  4RA8 A;  4ABN A;  1LTR D;  1GUG A;  3M7G A;  1WTX A;  3MC0 B;  4M8A A;  1QB5 D;  3R2T A;  5I6W A;  5LHY 1;  5IGE A;  2ID0 A;  3OWE B;  3GTK B;  2EJM A;  4RH6 A;  1EU4 A;  2V4D A;  3F2U A;  1HXY D;  1X3P A;  3Q24 A;  4QIW B;  4XYQ A;  1C48 A;  1BNZ A;  1F9S A;  1SE3 A;  1QNU A;  5ELD A;  3A56 A;  1EIH A;  1U4R A;  4AYB B;  3A8I E;  4XQQ A;  4RWS C;  3V2T A;  5EBC A;  2EZV A;  4IN3 A;  1EEF D;  4RFB A;  3M4O B;  1FYC A;  3DWQ A;  5M5W B;  1FNU A;  1U4P A;  4UAI A;  4QCL A;  2A69 C;  2NVX B;  4KTA A;  1F9Q A;  1TWF B;  3E6Z X;  4KMU C;  2X6L A;  2R61 A;  1ESR A;  3SXH A;  3TZU A;  3JAM L;  1KNA A;  3VA7 A;  3J80 E;  1EY5 A;  5C0X H;  2AWO A;  4K6D A;  2B2V A;  2RDF A;  2B8F A;  3MTS A;  4A3M B;  1MBY A;  2JXM B;  4FF4 A;  1I4P A;  4WRD A;  3Q6S A;  4DAP A;  4C1N I;  4OO1 I;  1TWA B;  1CFM A;  3A7A B;  3EFX D;  5COR A;  2M2L A;  3VR6 A;  1SYE A;  3W3A A;  4C3J G;  1A15 A;  4A3I B;  1EY7 A;  3FDT A;  2FFK B;  1UAP A;  1EOT A;  1TWG B;  3BDO A;  1GHK A;  2R7Z B;  3X3M A;  3DEO A;  4ZRZ A;  4QB4 A;  1MGS A;  1CK1 A;  4IFD I;  3U9O A;  2A74 C;  2F0P A;  2BA1 A;  2ZXO A;  3I4M B;  4DXG A;  4IUT A;  4KV6 A;  2RDH A;  1AZQ A;  1LT4 D;  3C1E A;  4XQJ A;  1H9J A;  3P1H A;  1IHZ A;  1V1P B;  1QJO A;  5IOD A;  1IYU A;  2JSO A;  4K6L A;  3EJI A;  3MA2 B;  4B08 A;  1QIL A;  2IX0 A;  5CMD A;  3D4R A;  2NTS A;  4XTC S;  1EL0 A;  1F2M A;  4NMZ A;  2WII B;  2F0I A;  1V43 A;  3ONA B;  1DM0 B;  5IOC A;  4OIK A;  3K5L A;  4IFD J;  1LT6 D;  2EDG A;  3MEH A;  1K8O A;  2B2Y A;  5FLX E;  5FOB B;  1XTC D;  1FR3 A;  2E2I B;  4RHR A;  4KJN A;  2AUJ D;  3S14 B;  1Y8N B;  1B53 A;  3DWP A;  3MZ5 A;  5KIX A;  4X3S A;  1BCP D;  2R3Z A;  1SE2 A;  1TWC B;  4PMW A;  4H13 C;  3HOV B;  3P75 A;  1QG7 A;  2SDF A;  1I6V C;  2RVL A;  1FD7 D;  1SEB D;  2EYM A;  2G9D A;  1O7Z A;  1L0Y B;  2XSC A;  4HSP A;  3K59 A;  1WTR A;  4UDU C;  1U4M A;  2N55 A;  1KAB A;  1SFO B;  3SK6 A;  5I9P A;  1JC7 A;  3NTI A;  1EYD A;  2NYZ D;  3TME A;  1LTI D;  1RTO A;  1R9T B;  5ELF A;  2MGS A;  1HRJ A;  1ILQ A;  4DNR B;  3SK8 A;  1SNM A;  5FK9 C;  2VB3 X;  5HUR A;  3GV3 A;  4R9W A;  5D3I B;  1STB A;  3S2D B;  2RSO A;  2ICI A;  2R6G A;  4XIG S;  3A7L A;  3MXU A;  1GUW A;  5C5L A;  5E4W C;  1AW7 A;  1ENC A;  4C2M B;  5A2Q E;  5C6A A;  5ELC A;  1OXX K;  5BN3 A;  4RGN A;  5BN4 A;  4KN7 C;  3RMH A;  2I07 B;  3PV0 A;  4ZYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...