5EGTA

Crystal structure of staphylococcal nuclease variant delta+phs v66e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5egtA00
4DU9A 3TP8A 5J22A 2PQEA 2F0GA 1RKNA 3SK8A 5C5LA 2F0EA 4K6DA 3MVVA 1JOOA 5DAUA 5C4ZA 5CGKA 3EVQA 4IALA 4EQNA 5KGUA 1A3UA 5JOBA 3LX0A 2QDBA 1EY6A 3MXPA 1NUCA 4NP5A 1EY4A 3C1FA 1SNOA 4ODGA 1EY7A 3NHHA 1SNCA 3P75A 1EQVA 4K5VA 4RKLA 3ERQA 5HGTA 2F3VA 3TP5A 3OWFA 3NQTA 4KJNA 4QMGA 2NUCA 5C6AA 5M9OA 1A3VA 4ZUIA 5EKKA 4K8IA 1EY9A 2F0TA 4N9PA 5I6WA 5CV4A 2OF1A 2F0FA 3E5SA 1STGA 2F0JA 2HQEA 4I65A 1JORA 1A3TA 1STAA 3SK5A 4N9TA 4K5WA 5JAVA 3QB3A 2EYOA 4B9XA 5IGDA 5IIFA 3EROA 1TQOA 1KDCA 4KY7A 1SYEA 1ENAA 4IUNA 1EYCA 5F2DA 2SNMA 4QB4A 2RKSA 2EYJA 3TP6A 2F0VA 2WACA 4HMIA 4B9WA 4HTHA 3D6CA 5IGBA 3P1HA 1TT2A 4E6IA 5IOCA 2EY1A 5KIXA 4KY6A 2OXPA 1U9RA 5IGGA 4PMBA 1EY8A 3OSOA 5C4HA 3DMUA 4KHVA 5CC4A 1A2UA 3NP8A 5E3FA 2F0OA 4LAAA 4NDXA 3ITPA 5C3XA 5C5MA 3TP7A 1SYGA 4K5XA 3EJIA 4EVOA 5I6YA 4G57A 3BDCA 4YIJA 3SK6A 5KYLA 1EYDA 2KHSA 2M00A 4R8NA 5CV8A 5KEEA 1NSNS 3MHBA 1EZ6A 3NK9A 5CV7A 1IHZA 5KRUA 3S9WA 2EYLA 2RBMA 4KTAA 3T13A 1JOQA 3QOJA 3OMCA 4ME5A 1JOKA 2PZWA 3MEHA 3T16A 4DF7A 4J6HA 2SOBA 2PZTA 4TRDA 4MIUA 2RDFA 3HEJA 5EKLA 1SYBA 2PYKA 3V2TA 2F0NA 1F2ZA 3SR1A 4K8JA 4WRDA 3QOLA 3TMEA 4RKBA 5DEHA 2F0MA 4J1MA 1SNDA 2PZUA 4S3SA 3BDLA 5CV5A 3NUCA 4ZUJA 3D4DA 4KV6A 4OL7A 4PMCA 1F2MA 4HMJA 1SYDA 4EQPA 2EYFA 5J1ZA 3SHLA 3HZXA 1F2YA 1KDBA 1KAAA 2EY2A 2PW5A 2F0DA 2F0HA 3MZ5A 5I9OA 5IODA 5K5PA 2F0QA 1SYFA 1STYA 2F0SA 1STHA 3PMFA 4ID6A 3H6MA 2EYHA 2OEOA 3D8GA 3NXWA 4NKLA 3RUZA 3VA5A 1SNQA 5IGCA 2O4XA 4H7BA 4K2KA 4F8MA 2EY5A 2F0IA 5CR3A 2PW7A 5E1FA 3DHQA 3SK4A 3C1EA 4IZ8A 1SYCA 3OMGA 1EZ8A 2EYPA 2EY6A 3D4WA 4EQOA 2F0WA 1SNPA 5NUCA 2EXZA 3SXHA 2F3WA 4KD3A 4KD4A 2F0PA 4ZQ3A 3R3OA 1STNA 1TR5A 4QF4A 2F0LA 1AEXA 2SNSA 1SNMA 4K14A 4KY5A 5IGEA 2LKVA 5IGFA 5J39A 4K2LA 4PNYA 1A2TA 2F0UA 2F0KA 4F7XA 1KABA 1EY0A 2EYMA 5CV9A 4WORA 4DFAA 5I9PA 5ISRA 4KJOA 1EY5A 3U9OA 1II3A 2KQ3A 5HURA 1EYAA 1KDAA 4DGZA 5C3WA 1ENCA 4NMZA 1STBA 5EGTA 2ENBA 5CV6A 5KYIA
chains in the Genus database with same CATH superfamily
4O1NA 3TP8A 1PTOB 2P5ZX 3J80E 3IAYA 1JOOA 3VYRA 2QEXA 5ELNA 1C8CA 3H94A 3BYYB 1G91A 1PTOC 2MHVA 3I8ZA 3IL8A 2R92H 4X62Q 2Q2UA 4IUVA 2CVRA 1VS0A 1R9TH 5KNDA 1VCIA 4K5VA 1B3AA 5BR8L 2F3VA 3O13A 3FHWA 3GTPH 1VQ9A 1S4ZA 3L9AX 2KHIA 3AFPA 3QIAA 2VY3A 2VQFQ 4ULLA 1IYJB 1SR3A 2EDGA 4V0BA 4DA2A 4A3IB 4IUNA 1ENAA 1DD2A 4A3JG 1GUGA 4DXGA 2A69C 2WB1B 1X32A 1GHJA 2RDHA 1G8ZD 2RSNA 2XSCA 2WP8J 4DV1L 3MXNA 3Q22A 1TXYA 1YEZA 2OT2A 3VYSA 3KFUA 1F77A 3TZUA 1LT6D 1IW7C 1FGBD 1I4GA 1O80A 3GTGB 4JI3L 1PTOH 3T13A 4FF1A 1TS2A 1QCBD 1B9MA 2EJFC 1ZEQX 2N88A 4OIKA 3ND9A 4K8JA 1HA5A 1C9OA 2GN5A 1N32L 1FJGQ 1AN8A 3D4DA 4R4TA 4HMJA 4FF3A 1HR0W 1EIFA 3U58A 1EIHA 3SHLA 2OQKA 1TWHH 4IPCA 5D3DA 5K5PA 3CPWA 1FVIA 4LF5Q 1STYA 3HP3A 1D8LA 3M4PA 2OWOA 3H91A 1ICFB 2C5CA 4LMQD 4UAIA 3N52A 4JI1Q 4IPDA 3SXHA 1IXRA 4YHHQ 3KJPA 4UPAA 3FP9A 3K7UC 3T1HL 3KF8A 3H0GB 1N33Q 3CKIB 2A74C 4LFCQ 2JA6G 5I9PA 1E2VA 3RNUA 2ZM6L 1EY5A 3GTGH 4FP5D 4X65Q 1B3QA 1ENCA 5EGTA 1Q81C 1X3QA 1Z6HA 1HTPA 1VMCA 4EVOA 3I56A 4R4QA 1D1IA 1LT3D 2M2LA 3HOVH 2MGSA 3S1RH 4GLVB 1K8OA 2FINB 4PZ7A 5GADC 1M4VA 3HS0C 4TQUS 1UAPA 3FPUB 1O7LA 3W3AA 1NE3A 3VYUA 1QG7A 4XXEA 4GOPB 3GP7A 1A3VA 1L2FA 5CBAE 4N9PA 1GUWA 4GOPC 4DR6Q 1H9KA 1LM0A 3CCMA 4LF7Q 4G7HC 4B9XA 5A2QL 2PNHA 3GTLH 4KY7A 1HCZA 4QB4A 1MGSA 3FKIG 3T4AC 4LFBL 4A3BG 2FJ2A 4LF9L 4JBJA 1QOHA 3Q24A 3CPFA 1VQPA 2GA4B 3K81C 2HUGA 3L3OC 3Q6SA 2H5XA 2XWJB 2B2VC 4GLAC 3G71A 4NW2A 5LMUL 4FNFA 2HCIA 2XNAC 4XQQA 1O78A 4B3SQ 3HEJA 3TDQA 3SR1A 5J3BA 4A3EG 1ICWA 1B8AA 2HIXA 1F2MA 1SN8A 2R93B 1SYDA 2NVQB 2BOSA 2AQ2B 1QE6A 1V1QA 1KAAA 2EY2A 3STBD 1H9SA 2AMCB 3X3NA 4DR4Q 2OEOA 1EOVA 3SDZA 1G6ZA 1SJED 2A6EC 4IOCA 4NXMQ 1UEAB 1LT5D 2F0WA 4X66Q 3PIP3 3CCQA 3DM1A 1Y1WG 4QUCA 4R1JA 1ONLA 5FK9C 4IPGA 4MTKA 3KLSX 2HT1A 2EJMA 2F0UA 4F7XA 2VW9A 1Y69U 4GZYC 1VF7A 3OTOL 1PH7A 4LF6Q 3AEVA 3RZDH 5M5YB 1D2BA 2Z9HA 3AFQA 4C3IG 1UE7A 3NPPA 1KNAA 3KF6A 4C3IH 4IUUA 1EWHA 1K8GA 3PCOB 1EU4A 5DAUA 2PNRC 3LGJA 4DK1A 2OTLA 3HOUG 5L37A 3A8KE 3DWQA 3T51B 4DKAC 2R93H 1CQFA 3HOWB 2NVQH 1L0YB 4BBSB 1E2WA 1VQ5A 1MD2D 1YHAA 5M9OA 1U4MA 3RLFA 5JVH3 1TKWB 1KL9A 1SXTA 2KECA 4OWXB 2VQEL 2WAQB 4JG2A 1CSPA 3J7ZC 2EJGC 4RA8A 4DR1Q 4DR5Q 1T5EA 2JEBI 5JJZA 1NAPA 2Y0SG 4X64L 4HTHA 3E0JA 2R61A 2VQFL 1X56A 3HKZG 1X3FA 2NN6G 5CYUA 3NP8A 1C48A 5M5YH 5I6YA 3J81E 4UDUC 2CH4A 2E2IH 3RR5A 3M7GA 1DM0B 1NSNS 2IX0A 2IX1A 3I55A 2RBMA 3QOJA 2JP1A 4KHZA 2JSOA 5IP7H 2IX3A 2Q8TA 3RZOH 3DXJC 4MIUA 3GQBA 1XNRL 2F0NA 3PGZA 3S2DH 2BDOA 2K33A 2V1CC 1A8VA 2JEAI 1WTXA 1C7YA 3PO3G 1Q1EA 4EQ5A 2K04A 1U4PA 1XNQQ 3PO3H 5IODA 1V8QA 1LLRD 3UDXA 1CA6A 3GO5A 5A35A 4DNIA 2E2JB 4NKLA 1FJGL 4OEMB 1SMYD 1PZID 2BA0A 2F0IA 4NXNQ 1LTSD 5C0XH 3KK7A 1A0IA 3D4WA 4DAPA 3OIQA 1AFPA 3TREA 4EQOA 2AUKA 2KHJA 5JVG3 4LWCA 2XVSA 4LF5L 2NYZD 3PQIA 1Q90A 5EBDA 4OIJA 1VQLA 3QO2A 4C3HB 2SNSA 2RVLA 4HSPA 4DR3Q 3I2ZA 1Y8NB 3CHBD 3A5UA 1WTRA 1K3RA 2UXCL 4YHHL 1WI5A 2I5HA 4OO1G 2PQEA 2BH8A 4AH6A 3FEWX 2DGYA 2KJXA 1Y1VB 1CT1D 4LFCL 1SFOH 1A3UA 1EL0A 5JOBA 4LUOA 1NR4A 4Q0FA 3C1FA 1L0WA 2A1AA 1EY7A 4X65L 4GNXB 1JB7A 5LL6X 5M5XB 4ZK9B 3F8TA 2JA7H 4X3UA 1ASYA 2A73B 4ZUIA 2LFNA 1JCKB 3KLWA 1BVSA 2K4KA 4X3KA 2IT1A 1IBLQ 2YYZA 1WVLA 1CUKA 5BR8Q 4JI2Q 1VQGA 4ZYSA 3S2HB 4DXFA 1EYGA 1NMGA 1KDCA 5AFWA 3MTSA 4GN4B 1EYCA 4QIWB 1HHVA 1PFNA 1WD0A 4C3HH 1MJCA 1TT2A 4ZCKA 4KY6A 3CCVA 4LF7L 2DY8A 3G7LA 1HNZL 1EWCA 2VNUD 1U4RA 3JC66 3KJOA 4CJ2C 2ZTCA 3EA6A 2HDLA 5H1SE 1E2ZA 4IOAA 1ILQA 1VQIA 1YNXA 1TS5A 3MHBA 1GHKA 4DV1Q 1EFID 3PIO3 1X6OA 1KHIA 3PO2B 1CZWA 1Y1VH 5EKLA 4A3FH 1FYCA 2HCCA 5I4DA 1F2ZA 2K03A 5M3MH 2Q2TA 4A3DB 4JK1C 4J1MA 1SNDA 3MFYA 4JI3Q 5IE8A 3A7AB 2BA1A 2EYFA 4DAVA 2D0PA 2KUMA 3K0XA 1SYFA 1KQSA 2ZXRA 4ID6A 1N32Q 1HFNA 2EPBA 4H7BA 3EIVA 4F88A 1D6EC 3CAMA 1WCMH 3RMHA 1PVOA 3C1EA 3F2CA 3OW2A 4KK7A 1Q1BA 3JAMi 1HZ9A 1D1KA 4QCLA 1TR5A 1G291 4KMUC 1BOSA 2UUBL 4DR4L 4R8IA 4UP9A 2B39A 4QY7A 3Q8DA 1EIGA 2X69A 1GUSA 2MUYA 5M3FH 4JBWA 4A3CG 4NXML 4JPBW 5A2QE 4YWKA 5C3EH 4RG1A 5C4JH 5T1GA 1L1OB 3J7AV 1GUOA 3GTJB 2C9OA 2KBNA 3SK8A 1L1OC 4XDXA 2WAQE 4DK3C 4IJHA 4P71A 4CGYB 1GO3E 2ZM6Q 4A3DH 2DJGC 2QDBA 1NUCA 1CQVA 1EY4A 4IJLA 3NTKA 4LF6L 2KEEA 4G7ZC 1FNUA 1ESFA 5C0XI 4GKJL 1AE2A 5JEAG 1BCPB 3DWPA 1ZXTA 1CKNA 4EGVA 1STGA 4AYBE 2BCOA 4C3JB 5ELEA 2Z1CA 5AJ3L 3S1QB 4J8QA 4LUVA 5ELFA 3BJUA 4FXKC 3FRPB 1MIUA 3BVZA 5C0XJ 5CORA 2JN4A 2FFKB 5IGBA 1NMFA 3AQQA 1IZ6A 1WTHA 2FMCA 1GJXA 3QR8A 5IP9H 3OSOA 1E1TA 2CKZB 3ITPA 5C5MA 1HA6A 3TN2A 4DR1L 4DNRB 1SAPA 3GTJH 4DR5L 4HCSA 4LF9Q 1PH6A 2CHBD 1PRTF 3NK9A 3PUVA 1VQKA 5JJKA 1XTDA 1EQRA 3VA7A 3J7YW 2RDFA 2PYKA 1X55A 2UUAL 4IUQA 3CC2A 1VQFA 1Y8OB 2LS01 5LMUQ 3DEOA 2Q2HA 2F4VL 1HUMA 1CKOA 1E22A 1VQEA 2IHEA 1CK1A 1KTKA 3I91A 2WV6D 2DNEA 2QA4A 1P16A 3K59A 4Y7NH 3S1QH 2PQAA 4A3GG 2Z0SA 3MA2B 5K36G 5KNCA 2EVBA 3J7AF 5DM73 1RHPA 1RTOA 1WFQA 4CDCC 5FJ8H 3NSWA 3MC0B 2B8GA 5IT9c 3SVMA 1YNND 4R4CA 4KY5A 2R92B 4DFAA 1SJHD 3HFZB 2PMZE 3GTPB 2A68D 2IL8A 3K57A 5IYDH 3QWNA 5EBCA 2MO0A 1UE1A 4MNOA 2HIVA 3ZYYX 3G6JB 4DR3L 1PHJA 1K0RA 3VR5A 3F2UA 3OTOQ 3UDGA 1ESRA 1XYIA 3NWSA 2JQOA 1EQTA 1O7ZA 2VB2X 2E5LL 4HN7A 4V190 1BF4A 1KRSA 4QIWE 3TP5A 1IBMQ 4CKCA 1P8LA 2JA9A 1V43A 1VMPA 5EKKA 1G2TA 3DUZA 1BDOA 1I6VC 3FPPA 1PA6A 1STAA 3AU7A 1OTCA 4QUFA 1LTBD 2RA4A 1AE3A 3KBGA 4LFAL 2VUMG 1A15A 1J8IA 2VQEQ 3J80i 1SEBD 2EY1A 1RL2A 2IWHA 1IBLL 2XTIA 1SE8A 1MI2A 1ZYRC 2V4DA 5CC4A 1BQQT 4JI2L 4LAAA 1UUPA 1TWAB 4H0LC 5C3XA 4Q5VA 1X9NA 1TWHB 4X64Q 2IJ0A 3PF4A 2J4XA 4L5QA 1SMYC 4DN4M 4ME5A 2B63G 3D0FA 3M4QA 3C46A 3QOLA 3TMEA 3NEMA 4WJWA 4S3SA 3A8JE 4PMWA 2EIFA 3D31A 3M4YA 4A3JH 4BA2I 1KDBA 2I5MX 3NE5B 5FO9B 1XNRQ 1GXDC 2WINB 1HZBA 4F8MA 1TU2B 2SDFA 4YWLA 5E4WC 2BE5D 3DHQA 2EXDA 3SK4A 1EZ8A 1Q82C 3HOVB 4IN3A 3S1RB 3BZDB 4ZQ3A 1RD9D 4HJ7A 1STNA 5JJLA 1AZPA 1PMRA 5GROA 1HNWL 1TWAH 5LMNL 4H02A 3I72A 4WORA 3IRBA 1II3A 3C3LA 2WFWA 5C3WA 1O7IA 1QUQA 5KYIA 1Q7YC 3J81j 3S1NB 5E4XA 2F0GA 1RKNA 3TBIB 1JICA 5IYCG 2CW0C 3MVVA 5C4ZA 1V1OA 2UXCQ 3GTLB 4LJZC 1PXUA 1LTGD 2OCEA 1SNOA 1SE2A 2D0OA 2NTSA 3V96A 3FKIB 3CP0A 3S16H 4HIMA 4A3BB 4KN7C 4K8IA 1E3PA 5CV4A 2WKCA 2JYOA 4GN3B 4A3IG 1I3QH 3E5SA 4RGOS 2JA6H 2WB1G 4RH6A 1D5XC 1YBYA 3A55A 3CD6A 1V9PA 1SYEA 1QJOA 1QVCA 3M3YB 1C4QA 1KLGD 3QJYA 4P75A 4JI8L 1OXSC 1I5FA 1VQDA 3R93A 2KHSA 3S1NH 2OTJA 4R8NA 1IHZA 1HQRD 1K28A 1HNZQ 1TWFB 2E8GA 3RN5A 2KOLA 5D14A 2NVYB 4WRDA 5DEHA 4HIKA 2B3GA 4OL7A 1PZKD 3FKIH 5KNBA 1QNUA 3LWEA 4A3BH 3S1MH 4ABNA 4WFN3 1Y1WB 1RF2D 4MZ9A 4OWTB 2XIWA 1S72A 2EY5A 2QGQA 4A93G 3RZDB 3ICEA 1DOKA 1SYCA 3M3YH 1SE4A 2EY6A 2ES2A 4C3IB 1B1ZA 4K0KL 1B7YB 4KD3A 1PDQA 2VZAA 1S5FD 2WIIB 1YJNA 3I4NG 3UE1A 4CJ1B 4RGNA 3I4NH 1AEXA 1V1PB 5CBEE 1OXVA 5J39A 3HOUB 4A3EH 4DNTB 1HH2P 2B2YC 2NZOA 1PH3A 3CCJA 1BCPD 1S5CD 4BY1G 5EPLA 2UUBQ 4N8FA 5C44G 1BR9A 4B3RQ 2DUDA 2AWOA 1TWFH 2F03A 4KHPL 5C44H 5FO7B 3A74A 4K6DA 3D4RA 2NVYH 1BBUA 1TY2A 3E9IA 4P72A 1SNCA 2EOTA 5HGTA 1Y1WH 3GDEA 3NQIA 4QMGA 2Y0SB 1KIXA 1YNJD 3BZKA 4M1UB 5I6WA 5HGQA 3HGBA 4JI0L 4HEDA 4PG3A 4IO9A 4GKJQ 4N9TA 2E2IB 3EBEA 1HUNA 3HOZG 4APVA 1IBML 1VQ6A 3RZOB 3D6CA 3PUWA 3P7JA 5AJ3Q 2K01A 3HOUH 3S2DB 3KLSA 3GTQH 5FLMG 1EY8A 1SRUA 2RDGA 1A6XA 4KHVA 2IHFA 5LL6S 1JQYD 1UE6A 4G57A 3PO3B 4YWMA 2ZT9C 1PH1A 5KEEA 1HXYD 5CV7A 4GOPA 2IPKD 4PQXA 4OXPA 1PV4A 1HTLD 2VS1A 1B4OA 1JOKA 1PZJD 1PRTD 4NPSA 4RAUC 3BYTB 1QNKA 2E2HH 2G9HD 1GOZA 3AYHB 2AHOB 4L5SA 1VQHA 1BBXC 4JOIC 4GN5A 2KEDA 4G7OC 3IFTA 3QG1A 2QW7A 3VYTA 4A3MG 2UU9L 2F0DA 1XX8A 4AYBB 2F0QA 3GV3A 1I94Q 2NN6H 2UUAQ 1E1OA 1NNXA 1KNEA 2K52A 2F4VQ 2B2VA 1AZQA 1K83B 3J81i 4BXXG 1EQQA 1BKBA 2EYPA 3Q23A 1H9RA 1SNPA 4JBKA 1VF5C 1KD1C 1H95A 2H4OA 4FDBA 1SFOB 1F9RA 2F0LA 3CRLC 1RDPD 2DY7A 3CF5A 3F2DA 1JWUD 4JI6L 3CCSA 4O42A 4A4IA 2A6HC 1CA5A 1U0LA 2JA7B 3U9OA 1Z7TA 4C2MB 4DGZA 5CMDA 4NMZA 4JV5L 5EPKA 4HJ9A 5GAHC 4DV5L 1ET6A 4BBSG 1I4HA 5C5LA 3K5NA 1J5EQ 5CGKA 1JR0D 2QCPX 1PTOD 2EQSA 5KGUA 4JCVE 4JI5L 1TS3A 1CM9A 2LY7A 4L5TA 4DR7L 2B2WC 4X3TA 4B3TL 2CFMA 2N8NA 4N8X1 1HNXL 1CTMA 4LK1C 4RKLA 3OWFA 2NUCA 3BS1A 1PFMA 2MPMA 4WJ3M 1LTLA 3OWEB 2E5LQ 2R7ZG 2B2UC 2F0JA 4ZRZA 1K83H 1GUTA 4B3MQ 1GM5A 2R7ZH 2EYOA 1SMXA 5IGDA 3S15B 5D65A 3DWAA 1QWYA 1XPUA 3U9SA 2A69D 3F2BA 4OO1H 2WACA 4HMIA 1EIYB 4A3FB 1Q3LA 3P1HA 4DV0Q 1JMCA 3PIPA 1GD7A 1MHWC 4PZ8A 5M3MB 1UE5A 5C4HA 5FKAC 1WTPA 2PMZB 1OXUA 4POFA 1MSHA 4JVZA 1QB5D 3GTKH 2ZJRA 3PUYA 4LFAQ 4C2MH 4K5XA 1IYVA 1U4LA 1LV9A 3BDOA 3K7AH 2NBFA 5CV8A 1IYUA 1Q8IA 4TVAB 2X6GA 1JOQA 4EX5A 3FVQA 2PZWA 4B08A 2PZTA 4DK6C 1WCMB 4IURA 4ZUJA 4HSVA 3GD7A 1OXTA 3HG9A 3ULJA 2K1BA 3SE0A 4HJ5A 5M3FB 1YITA 2CQAA 1PFSA 4G4KA 1PFBA 5ELCA 4J15A 4R4IA 1KRTA 2EYHA 4X3SA 1CFMA 5C3EB 4HIOA 1XPOA 3S15H 5C4JB 4YCUA 3L0OA 4BY7G 1DOMA 2F1MA 5IWAQ 3J80c 2I0QA 4RHRA 1RIPA 1EUJA 3I4MG 1VQNA 4M8AA 5ISRA 4F87A 1JB3A 2K6AA 3M85A 2FXQA 3KDFB 2Y0SE 3H3VC 2E76C 4RFBA 1HNWQ 4XYQA 2UXBQ 2NVTB 1BBWA 5LMNQ 2F0EA 4L8JA 2DN8A 3S24A 3HKZE 2NN6I 1G2SA 3EVQA 4EQNA 3LX0A 3TQYA 1EY6A 3KLRA 3NBHB 4OELB 4ZAIA 1LTRD 3ER0A 2JXMB 2UXDQ 1TWCH 4B3RL 1BCPF 1LT4D 4POGA 4RGMA 3OOCA 3T1YQ 3TS0A 2OF1A 1WD1A 1S40A 2PO4A 1JORA 2CWAA 3E9HA 4A3CH 2VL6A 2KCTA 4A75A 5EJWA 5C4XG 3A5ZB 1JT8A 1RJTA 4QL5A 4CKEA 1DGSA 1Z9FA 2IW3A 1DCZA 1KAWA 1MBYA 2Z6KA 3PV0A 1NTGA 1QZGA 1WTQA 1QVFA 3KBXA 4H44C 2CWPA 4O2DA 1J9OA 2ZJQA 1U9RA 3H3VH 2JA8G 4Y52H 3DMUA 5E7NA 4HIDA 3OHXC 3WDNA 1JJ2A 3A56A 3BDCA 5IT9L 4DK0A 5JEAH 5COYA 1EYDA 1Z47A 1B70B 3HKSA 3L7ZC 4GNXA 2NVTH 3OPOA 3S9WA 2EYLA 4Y7NB 4JI8Q 2XN9C 1DJRD 3ERSX 5DLQE 3MEHA 4XTCS 2G9DA 3BZCA 4HCEA 4UHVA 4A3GB 1K8AC 3HOXG 5IYBG 1LUZA 2RQXA 5D3IB 4ZLTF 3KUPA 1HRJA 1T9HA 5J1ZA 2ALYB 4A3LG 1F2LA 5GAEC 4OO1I 5BN5A 4A3LH 2F0SA 4R9WA 3STBC 3CCRA 1N36L 3NXWA 1XWEA 2A6ED 1K9MC 5BN3A 1AH9A 2J0TD 1SROA 2ZTEA 4JI7L 2BDNA 2JK8A 1I94L 4QGUA 3DEPA 2XWBB 1XMOL 1SNMA 5IGEA 1I6HB 3Q0AA 1PYWD 4K0KQ 2GVAA 5M5WH 2EE1A 1X3GA 5LMNW 1JJCB 3A54A 3CC4A 4U68A 2I5LX 1UNSA 1JWSD 3MXNB 5J22A 3S17B 4TKOB 2F52A 4A3GH 3PIOA 5FO8B 4K6LA 4IALA 5K36H 2PI2A 3KDFA 3OIPA 4CDEC 1HZCA 4L5RC 5FLXL 1KLUD 1EWIA 2RHSB 4KHPQ 2LMCB 4C3JG 4CHTB 3I70A 2PCFB 1CI3M 4KKUA 4ALPA 1J5EL 3W5OA 2F0TA 3C2PA 1FNWA 4KN4C 3HOYG 3M7NA 4I65A 3IFDA 3VR6A 3SK5A 1PTOF 2B2TA 4IFDG 3EROA 1TQOA 4KI0A 1OO9B 2AQ3B 4HJAA 3ZJYC 1PRTC 2Q8IB 1YIJA 4JI0Q 2MNAA 1L1OA 2JA5G 5KIXA 1I6HH 2B63B 2E75C 5HY6A 4B3ML 3MWYW 5TSSA 1EEID 4UP7A 1WTVA 2HD3A 1A2UA 4JI4L 1D5ZC 4A3JB 1E0BA 1PH8A 2B8FA 2ID0A 2C35B 1B44D 4YY3L 4A3KG 3U50C 1LACA 3KF8B 4DV0L 3S17H 3PSIA 5I2YA 4A3KH 3OMCA 1VQMA 4LF4L 3BVGA 3VR4A 2QF7A 4FF2A 1SYBA 2LXKA 4JYAL 1AP0A 2K50A 2N55A 3BDLA 2L0CA 2VUMH 4EQPA 1RTNA 2Z4HA 2PW5A 1CHQD 2OQ0A 3MEFA 4BBRG 5BN4A 2RHQB 2YTVA 1JJGA 3FMCA 3H15A 3H3VI 1D7QA 3J7A5 1HFGA 4P74A 4AQYL 4RCOA 5FLXc 2PI2E 4A76A 2UU9Q 2L15A 1TWGB 3NBIA 1WJJA 3G48A 2R92G 1VQ4A 2ATWA 1Q46A 2B63H 2K28A 4UP8A 4DV4L 1STEA 3CMAA 2EYMA 3CXCA 2L55A 2D62A 5IWAL 5DM63 3S16B 2MFIA 1S5ED 3GTOB 5JEAJ 1GUNA 5CV6A 4DUZL 1I3QB 3PUZA 4DU9A 1FL0A 4DAMA 2A8VA 1PYBA 2JA6B 1TIID 4JI6Q 3W2DA 3E3XA 2N3SA 2LXJA 2TMPA 1KC8C 1G6PA 1HPCA 3KOJA 1YHBA 4JV5Q 1CHPD 3AMUA 3P75A 1EQVA 4DV5Q 4C1NI 4RCNA 3E6ZX 3TEHB 2DNCA 1W6KA 3VR2A 2YU9H 5GAGC 2CQOA 2K5HA 1RODA 2UXBL 2GVBA 1YZ6A 4LNQA 4JI5Q 3J81c 4DR7Q 4B3TQ 2RCFA 4O0AA 3CCUA 1HNXQ 3K0YA 4K5WA 3M4OB 2N78A 2UXDL 1TWGH 5IIFA 3A0JA 1R4PB 2SNMA 4RMFA 1H9SB 3T1YL 2R7FA 5IYCH 2UUCL 3SEBA 3LNNA 4MTNA 2OXPA 1YJWA 2QKIC 2L12A 3OYYA 3S1MB 4TSSA 2R6GA 5EKIA 2ZXOA 4YIJA 2DJFC 3GTOH 3SK6A 2E74C 1I4RA 2HQLA 1VQOA 4IQZA 2I46A 4A3IH 2E2DC 2JE6I 1N9WA 3K6OA 2X6LA 2Z6BA 1BXTA 4DV7L 4A93B 1NJIC 4KV6A 2BH2A 3KF6B 1N34L 3HZXA 4IFDI 3I4NB 4FO2A 2D2CC 4A3EB 4L63B 4BS9A 3HOVG 3VR3A 4OONA 3RUZA 3WOEA 1S5DD 3M4OH 5IGCA 4K2KA 3I4OA 5JPMC 3VDYA 3KYHC 1QILA 1W3SA 3P20A 4XT3B 2HHHQ 1XTCD 3L2PA 4BY1B 3W1BA 3NENA 3K5LA 5C44B 3E0EA 2F0PA 1JWMD 3R3OA 4DV2L 4IFDJ 2NVXB 3JAML 4QF4A 4DUYQ 4BA1I 2A19A 2LKVA 1EEFD 5IGFA 1PH2A 1SSOA 4PNYA 4C1NK 2SEBD 1XMQL 1JC7A 2KCNA 2XGTA 4GKKQ 5HURA 4PZ6A 2IY5B 1GVPA 4QJFA 1Q86C 5EAYA 1ML0D 4L6TB 5T1IA 1QVGA 1IL8A 3H0GG 3X3MA 2Z4IA 3NELA 4A93H 2TSSA 3H0GH 2R3ZA 1X65A 2FHTA 5IT9E 2VXWA 4FXGC 3HOZB 3ERQA 1E24A 3NQTA 3I90A 1LTTD 2YTYA 3GTQB 2HDMA 1FR3A 4DV6Q 3AB9A 3GV6A 2ZJPA 5ELDA 1U5KA 5GQOA 4OX9L 1HJPA 4BY1H 3T53B 4XQJA 1EU3A 1VQBA 4DV3Q 1YI2A 4JBMA 2L5TA 4RGTA 2NVXH 5F2DA 3EN2A 3G4SA 4B9WA 1PH5A 3H09A 2E2HB 1ZKOA 5IGGA 2H1EA 4UY8C 1PYSB 3N6RA 2R7DA 3K8AA 1A62A 4NDXA 4FF4A 1JE4A 1E7ZA 3EJIA 4HAEA 4GLXA 3TRZA 3RLOA 1SDFA 4A3MB 3HKZB 1EZ6A 2CCZA 1W2BA 5KRUA 1XJVA 3JAMc 4OWWB 2L9HA 2ICEC 3V2TA 2N49A 1HR0L 2PPBC 3HOZH 2F0MA 2MQHA 3MFGA 4Z9CB 1L0XB 3BU2A 1F2YA 1YHQA 2F0HA 1G51A 3D3RA 1I4PA 1Y8PB 1DXMA 4LF8Q 5FLMH 1STHA 1B53A 3S14B 3H6MA 3U4ZA 2Q8RE 3D8GA 3VA5A 2YV5A 4R4OA 1VQAA 4PV1C 5FLXE 4DAYB 3UDFA 1SLJA 3CU7A 4FXDA 3BVMA 2KCMA 2R93G 1LO5D 4KD4A 2KA7A 1N36Q 4DR2L 1RCVD 4KKTA 5EQ0A 1I50B 4JW0A 3RD4A 2WB1E 3PF5A 1BO0A 1YNNC 1A2TA 3DM3A 1EY0A 1A63A 1VQCA 5I2XA 4KJOA 4JI7Q 4XQNA 4A3MH 3NWTA 2QEJC 1STBA 1X3PA 2MP1A 3PUXA 4X62L 2A68C 1WTWA 1XMOQ 4RWSC 3WOFA 2RSOA 3LWUA 2R7ZB 3DLLA 4BXXH 3R8BA 1K73C 1GKHA 4ODGA 3A7LA 3CQZB 4JC0A 4KJNA 1W6JA 3S14H 1F9PA 1EOTA 1B2TA 3EFXD 3GTKB 3CMEA 2B2YA 1IBKQ 1K3BC 4FVMA 5IP7G 1M90C 1MSGA 1V1PA 3K7AB 4ILWA 5JAVA 3QB3A 1M1KC 5DNFA 3R2IA 2ICIA 3HOWG 1CSQA 4CDFC 2XRQD 3HOWH 1ENFA 2RKSA 4BBSH 3R2TA 2K7VA 3TP6A 4FYDA 4BWGB 1I50H 1ZYRD 4E6IA 5IOCA 2LSSA 2ASBA 4AIMA 4PMBA 3J80L 2WAQG 2NZHA 1SYGA 1WTOA 2XRSD 1H9JA 1BUVT 2D9UA 5KYLA 5C0XG 1H9MA 1LTAD 4KKSA 2L4NA 3K58A 1VQJA 4KTAA 1LTID 2O2LD 3NTIA 4RHSA 4JI4Q 4DF7A 1OXXK 1TVXA 3EQLC 1DZ1A 3OW7A 4AYBG 4YY3Q 4QQBX 2K5WA 3HRZC 4RKBA 1VQ8A 3MAQA 3CQZH 3M9BA 1WYDA 4BY7B 1FGUA 1SBBB 5IY0A 4LF4Q 2O5JC 5I9OA 1TY0A 2J7ZA 4JI1L 4CBVA 4JYAQ 3I3CA 1IW7D 3NTHA 3K80C 1SE3A 1LYLA 1JE5A 1SNQA 2D5DA 3TZDA 2O4XA 2Z6KC 2KCCA 4XIGS 5CR3A 1N33L 3I4MB 2ZXPA 5G3LD 4IZ8A 2QDLA 2BE5C 3D6WA 2EXZA 1CKNB 2F3WA 1DOLA 4ZKBB 2JA7G 1K8MA 4DAYA 4AQYQ 2K14A 3CRKC 3SGIA 1VDZA 4K2LA 1FD7D 3A8IE 1TWCB 4JOIA 5CV9A 4GNXC 2HHHL 2E2JH 3UE0A 1ASZA 2AKWB 2KQ3A 1J6QA 1ILPA 2NWGA 3F1ZA 2ENBA 4DUYL 4DV4Q 1NY4A 2CW0D 3URYA 1IKMA 4C3HG 3RLNA 1MJEA 1VQ7A 5C4XB 2EZVA 3MXPA 4GKKL 4NP5A 4BY7H 4DR6L 4DUZQ 4HR7B 5LHY1 3CCLA 1S5BD 2AWNA 2MJ8A 5ELBA 4U673 1EY9A 1HQMC 3ULLA 1NBWA 2JA8B 1Y1VG 3I4MH 4A3FG 5M3MG 3FDTA 3K5MA 1Y14B 1YVCA 1X3EA 1Q12A 4NB3A 2F0VA 1XXGA 4GS3A 5JPNC 4DV6L 3GTMB 5M5XH 4OGQC 2PQAB 3ONAB 3CC7A 1C0AA 2B2WA 5E3FA 4DV3L 3HOXB 1X54A 1O7YA 4B3SL 1QZHA 4CJ0B 4WJ4A 1I4QA 1Q8KA 3MXGA 2UUCQ 1WCMG 3WWVA 3TSSA 4HJ8A 2K75A 1BNZA 3S2HH 3JAME 2B2UA 4OHJA 3T16A 5C4XH 4J6HA 4TRDA 5M3FG 3NUCA 4PMCA 1KXLA 2O5IC 5C3EG 1DYQA 3MZ5A 2NB0A 4X66L 3PO2G 2JA8H 3PMFA 2B2TC 4DV7Q 3T1HQ 5M5WB 2KVMA 3PO2H 1N34Q 2ZTDA 4A3DG 2PW7A 1NR2A 3CW2C 1DONA 5NUCA 2MO1A 3GTMH 4P73A 1UEBA 4LF8L 3CCEA 5EPJA 2NTTA 2L1BA 1D5MC 3HOXH 5IYBH 2F0KA 3K5OA 4YCVA 3MXUA 2AUJD 4I7AA 4YCWA 4DV2Q 1ET9A 1KDAA 1N8RC 1BCPC 3ULPA 4LW1A 2M9VA 2NZ1D 1PH4A 3HOYB 1XMQQ 5IP9G 3BG3A 4CKBA 1K0SA 4H13C 1LABA 1YJ9A 3NHHA 2AQ1B 4ZKCB 4LUZA 4X6AH 5C6AA 2F3IA 4MHEA 4I7ZC 2JA5B 3B6YA 4LFBQ 1YNJC 2F0FA 2HQEA 2WKDA 1A3TA 3RN2A 2Z8LA 3IKJA 1T5XD 3U4VA 1F9SA 1B50A 4A3KB 2FMMA 1WOCA 1F9QA 4IUPA 2CH4W 2K5VA 2EYJA 4ME3A 1B9NA 2L11A 2VB3X 3I4LA 4IUTA 1IBKL 4OX9Q 4IPHA 1NCVA 4MN3A 2K5QA 3UDIA 2VUMB 2F0OA 1TS4A 1HZAA 3I7FA 4C3JH 1M8AA 3ND8A 3NBHA 2QILA 2M00A 4DPGA 1PH9A 2K5DA 1IL2A 1PRTB 2Q2IA 4BBRB 4P2CB 3HOYH 5FJ8G 1XNQL 2SOBA 4IFDH 3TP7A 5JJIA 5CV5A 2PZUA 1CKMA 2YTXA 5ELOA 2F4IA 1QUQB 1FNVA 4NXNL 1R9TB 3W1GA 1XPRA 2JA5H 2K5NA 5IYDG 1HR0Q 1UWVA 4XT1B 1R4QB 3T56B 1PLFA 1MKHA 3TS2A 2A5HA 2G5DA 2K32A 5FOBB 1S3OA 4C56C 2B29A 2RCNA 3V05A 1EFWA 3G6EA 5E1FA 4KLKA 2I07B 3OMGA 1CZGA 3J81L 2KENA 3UI2A 1IKLA 2RF4A 1AW7A 4K14A 3I73A 4CDDC 2A6HD 1KABA 2YU9B 1EYAA 4DR2Q 4XYOA 4BBRH 2JJQA 1I4XA 5G3LF 2K05A
chains in the Genus database with same CATH topology
4O1NA 3TP8A 1PTOB 3J80E 3IAYA 1JOOA 3VYRA 1C8CA 3H94A 3BYYB 1G91A 1PTOC 2MHVA 3I8ZA 3IL8A 4IUVA 2CVRA 5KNDA 1VCIA 4K5VA 1B3AA 2F3VA 3O13A 1S4ZA 3L9AX 3QIAA 4ULLA 2EDGA 4V0BA 4DA2A 4A3IB 4IUNA 1ENAA 1DD2A 4DXGA 1GUGA 2A69C 2WB1B 1X32A 1GHJA 2RDHA 1G8ZD 2RSNA 2XSCA 2WP8J 3MXNA 3Q22A 2OT2A 3VYSA 1F77A 3TZUA 1LT6D 1IW7C 1FGBD 1I4GA 1O80A 3GTGB 1PTOH 3T13A 4FF1A 1TS2A 1QCBD 1B9MA 2EJFC 1ZEQX 2N88A 4OIKA 3ND9A 4K8JA 1HA5A 1AN8A 3D4DA 4HMJA 4FF3A 1EIHA 3SHLA 5D3DA 5K5PA 1STYA 3HP3A 3H91A 2C5CA 4LMQD 4UAIA 3N52A 3SXHA 3KF8A 3H0GB 3CKIB 2A74C 5I9PA 1E2VA 1EY5A 4FP5D 1ENCA 5EGTA 1X3QA 1Z6HA 1HTPA 1VMCA 4EVOA 1D1IA 1LT3D 2M2LA 2MGSA 1K8OA 2FINB 1M4VA 3HS0C 4TQUS 1UAPA 3FPUB 1O7LA 3W3AA 3VYUA 1QG7A 4XXEA 3GP7A 1A3VA 5CBAE 4N9PA 1GUWA 1H9KA 4G7HC 4B9XA 5A2QL 4KY7A 1HCZA 4QB4A 1MGSA 3T4AC 2FJ2A 1QOHA 3Q24A 2GA4B 2HUGA 3L3OC 3Q6SA 2XWJB 2B2VC 4NW2A 4FNFA 2HCIA 2XNAC 4XQQA 1O78A 3HEJA 3TDQA 3SR1A 1ICWA 1F2MA 2R93B 1SYDA 2NVQB 2BOSA 2AQ2B 1QE6A 1KAAA 2EY2A 1H9SA 3X3NA 2OEOA 3SDZA 1G6ZA 1SJED 2A6EC 1UEAB 1LT5D 2F0WA 3PIP3 3DM1A 4QUCA 1ONLA 5FK9C 3KLSX 2EJMA 2F0UA 4F7XA 4GZYC 1Y69U 1VF7A 5M5YB 1D2BA 4C3IG 3NPPA 1KNAA 4IUUA 1EWHA 4DK1A 1EU4A 5DAUA 2PNRC 3A8KE 3DWQA 3T51B 1CQFA 3HOWB 1L0YB 4BBSB 1E2WA 1MD2D 5M9OA 1U4MA 3RLFA 5JVH3 1TKWB 1SXTA 2KECA 2WAQB 2EJGC 4RA8A 1T5EA 2JEBI 5JJZA 1NAPA 4HTHA 3E0JA 2R61A 2NN6G 5CYUA 3NP8A 1C48A 5I6YA 3J81E 4UDUC 3M7GA 1DM0B 1NSNS 2IX0A 2IX1A 2RBMA 3QOJA 2JP1A 4KHZA 2JSOA 2IX3A 2Q8TA 3DXJC 4MIUA 3GQBA 2F0NA 2BDOA 2K33A 2JEAI 1WTXA 1Q1EA 2K04A 1U4PA 5IODA 1V8QA 1LLRD 1CA6A 3GO5A 5A35A 2E2JB 4NKLA 1SMYD 1PZID 2BA0A 2F0IA 1LTSD 5C0XH 3KK7A 4DAPA 3D4WA 3OIQA 1AFPA 4EQOA 2AUKA 5JVG3 2XVSA 2NYZD 1Q90A 5EBDA 4OIJA 3QO2A 4C3HB 2SNSA 2RVLA 4HSPA 1Y8NB 3CHBD 1WTRA 4OO1G 2PQEA 3FEWX 2KJXA 1Y1VB 1CT1D 1A3UA 1EL0A 5JOBA 1NR4A 4Q0FA 3C1FA 1EY7A 5LL6X 5M5XB 4ZK9B 4X3UA 2A73B 4ZUIA 2LFNA 1JCKB 4X3KA 2IT1A 2YYZA 1WVLA 4ZYSA 3S2HB 4DXFA 1KDCA 5AFWA 3MTSA 1EYCA 4QIWB 1HHVA 1PFNA 1WD0A 1TT2A 4KY6A 2DY8A 3G7LA 1EWCA 2VNUD 1U4RA 4CJ2C 3EA6A 2HDLA 1E2ZA 1ILQA 1TS5A 3MHBA 1GHKA 1EFID 3PIO3 3PO2B 1CZWA 5EKLA 1FYCA 2HCCA 5I4DA 1F2ZA 2K03A 4A3DB 4JK1C 4J1MA 1SNDA 3MFYA 3A7AB 2BA1A 2EYFA 4DAVA 2KUMA 1SYFA 2ZXRA 4ID6A 1HFNA 2EPBA 4H7BA 4F88A 1D6EC 3RMHA 3C1EA 4KK7A 1Q1BA 1D1KA 4QCLA 1TR5A 1G291 4KMUC 1BOSA 4R8IA 2B39A 1EIGA 2X69A 1GUSA 2MUYA 4JBWA 5A2QE 5T1GA 3J7AV 1GUOA 3GTJB 2C9OA 3SK8A 4XDXA 4CGYB 2QDBA 1NUCA 1CQVA 1EY4A 3NTKA 2KEEA 4G7ZC 1FNUA 1ESFA 5C0XI 5JEAG 1BCPB 3DWPA 1ZXTA 4EGVA 1STGA 2BCOA 4C3JB 5ELEA 2Z1CA 3S1QB 4J8QA 5ELFA 4FXKC 3FRPB 3BVZA 5C0XJ 5CORA 2FFKB 5IGBA 2FMCA 1GJXA 3OSOA 3ITPA 5C5MA 1HA6A 3TN2A 4DNRB 1SAPA 4HCSA 2CHBD 1PRTF 3NK9A 3PUVA 3VA7A 3J7YW 2RDFA 2PYKA 4IUQA 1Y8OB 2LS01 3DEOA 1HUMA 1CK1A 1KTKA 3I91A 2WV6D 2DNEA 3K59A 3MA2B 5K36G 5KNCA 2EVBA 3J7AF 5DM73 1RHPA 1RTOA 3NSWA 3MC0B 2B8GA 3SVMA 1YNND 4KY5A 2R92B 4DFAA 1SJHD 3GTPB 2A68D 2IL8A 3K57A 3QWNA 5EBCA 3ZYYX 3G6JB 3VR5A 3F2UA 1ESRA 1XYIA 3NWSA 1EQTA 1O7ZA 2VB2X 4V190 4HN7A 1BF4A 3TP5A 4CKCA 1V43A 1VMPA 5EKKA 1G2TA 3DUZA 1BDOA 1I6VC 3FPPA 1STAA 3AU7A 4QUFA 1LTBD 2RA4A 3KBGA 1A15A 1J8IA 1SEBD 2EY1A 2IWHA 1MI2A 1ZYRC 2V4DA 5CC4A 1BQQT 4LAAA 1UUPA 1TWAB 4H0LC 5C3XA 4Q5VA 1TWHB 2IJ0A 2J4XA 1SMYC 4DN4M 4ME5A 3C46A 3QOLA 3TMEA 4WJWA 4S3SA 3A8JE 4PMWA 3D31A 3M4YA 4BA2I 1KDBA 3NE5B 5FO9B 1GXDC 2WINB 4F8MA 1TU2B 2SDFA 5E4WC 2BE5D 3DHQA 3SK4A 1EZ8A 3HOVB 4IN3A 3S1RB 3BZDB 4ZQ3A 1RD9D 1STNA 1AZPA 1PMRA 3I72A 4WORA 1II3A 3C3LA 5C3WA 5KYIA 3S1NB 5E4XA 2F0GA 1RKNA 3TBIB 1JICA 2CW0C 3MVVA 5C4ZA 1V1OA 3GTLB 4LJZC 1PXUA 1LTGD 1SNOA 1SE2A 2NTSA 3V96A 3FKIB 4A3BB 4KN7C 4K8IA 5CV4A 2WKCA 2JYOA 3E5SA 4RGOS 4RH6A 1D5XC 3A55A 1SYEA 1QJOA 3M3YB 1C4QA 1KLGD 3QJYA 1OXSC 3R93A 2KHSA 4R8NA 1IHZA 1HQRD 1TWFB 2KOLA 5D14A 2NVYB 4WRDA 5DEHA 4OL7A 1PZKD 5KNBA 1QNUA 3LWEA 4ABNA 4WFN3 1Y1WB 1RF2D 2XIWA 2EY5A 3RZDB 1DOKA 1SYCA 1SE4A 2EY6A 4C3IB 1B1ZA 4KD3A 1PDQA 2WIIB 1S5FD 4CJ1B 4RGNA 1AEXA 1V1PB 5CBEE 1OXVA 5J39A 3HOUB 4DNTB 2B2YC 1BCPD 1S5CD 5EPLA 1BR9A 2AWOA 2F03A 5FO7B 4K6DA 3D4RA 1TY2A 1SNCA 2EOTA 5HGTA 3NQIA 4QMGA 2Y0SB 1YNJD 4M1UB 5I6WA 3HGBA 4HEDA 4N9TA 2E2IB 1HUNA 3RZOB 3D6CA 3PUWA 3P7JA 2K01A 3S2DB 3KLSA 1EY8A 2RDGA 1A6XA 4KHVA 5LL6S 1JQYD 4G57A 3PO3B 2ZT9C 5KEEA 1HXYD 5CV7A 2IPKD 4PQXA 1HTLD 1B4OA 1JOKA 1PZJD 1PRTD 4RAUC 3BYTB 1QNKA 2G9HD 1GOZA 1BBXC 4G7OC 2KEDA 3IFTA 3QG1A 3VYTA 2F0DA 1XX8A 4AYBB 2F0QA 3GV3A 2NN6H 1KNEA 2B2VA 1AZQA 1K83B 2EYPA 3Q23A 1H9RA 1SNPA 1VF5C 2H4OA 1SFOB 1F9RA 2F0LA 3CRLC 1RDPD 2DY7A 1JWUD 4O42A 2A6HC 1CA5A 2JA7B 3U9OA 1Z7TA 4C2MB 4DGZA 5CMDA 4NMZA 5EPKA 1ET6A 1I4HA 5C5LA 3K5NA 5CGKA 1JR0D 2QCPX 1PTOD 5KGUA 1TS3A 1CM9A 2LY7A 2B2WC 4X3TA 1CTMA 4LK1C 4RKLA 3OWFA 2NUCA 3BS1A 1PFMA 2MPMA 3OWEB 2B2UC 2F0JA 4ZRZA 1GUTA 2EYOA 5IGDA 3S15B 5D65A 3DWAA 1QWYA 3U9SA 2A69D 4OO1H 2WACA 4HMIA 4A3FB 1Q3LA 3P1HA 5M3MB 5C4HA 5FKAC 1WTPA 2PMZB 1OXUA 1MSHA 1QB5D 3PUYA 4K5XA 1IYVA 1U4LA 1LV9A 3BDOA 2NBFA 5CV8A 1IYUA 1Q8IA 2X6GA 1JOQA 3FVQA 2PZWA 4B08A 2PZTA 1WCMB 4IURA 4ZUJA 4HSVA 3GD7A 1OXTA 3HG9A 2K1BA 3SE0A 5M3FB 2CQAA 4G4KA 1PFBA 5ELCA 2EYHA 4X3SA 1CFMA 5C3EB 5C4JB 1DOMA 2F1MA 4RHRA 4M8AA 5ISRA 4F87A 1JB3A 2K6AA 3M85A 3H3VC 2E76C 4RFBA 4XYQA 2NVTB 2F0EA 4L8JA 2DN8A 2NN6I 1G2SA 3EVQA 4EQNA 3LX0A 1EY6A 3KLRA 4ZAIA 1LTRD 2JXMB 1BCPF 1LT4D 4RGMA 3OOCA 2OF1A 1WD1A 2PO4A 1JORA 5EJWA 1RJTA 4CKEA 2IW3A 1DCZA 3PV0A 1MBYA 1WTQA 3KBXA 4H44C 1J9OA 1U9RA 3DMUA 3OHXC 3WDNA 3A56A 3BDCA 5IT9L 4DK0A 5JEAH 5COYA 1EYDA 1Z47A 3L7ZC 3OPOA 3S9WA 2EYLA 4Y7NB 2XN9C 1DJRD 3MEHA 4XTCS 2G9DA 4HCEA 4A3GB 2RQXA 5D3IB 4ZLTF 3KUPA 1HRJA 5J1ZA 1F2LA 4OO1I 5BN5A 2F0SA 4R9WA 3NXWA 1XWEA 2A6ED 5BN3A 2J0TD 2BDNA 3DEPA 2XWBB 1SNMA 5IGEA 1I6HB 3Q0AA 1PYWD 2EE1A 3A54A 4U68A 1UNSA 1JWSD 5J22A 3S17B 4TKOB 5FO8B 4K6LA 4IALA 5K36H 3OIPA 5FLXL 1KLUD 2LMCB 4C3JG 4CHTB 3I70A 2PCFB 1CI3M 4KKUA 2F0TA 3C2PA 1FNWA 4KN4C 3M7NA 4I65A 3IFDA 3VR6A 3SK5A 1PTOF 2B2TA 4IFDG 3EROA 1TQOA 4KI0A 1OO9B 2AQ3B 1PRTC 2Q8IB 5KIXA 2B63B 2E75C 3MWYW 5TSSA 1EEID 1WTVA 1A2UA 1D5ZC 4A3JB 1E0BA 2B8FA 2ID0A 1B44D 1LACA 5I2YA 3OMCA 3BVGA 3VR4A 2QF7A 4FF2A 1SYBA 1AP0A 2N55A 3BDLA 2L0CA 4EQPA 1RTNA 2Z4HA 2PW5A 1CHQD 5BN4A 3FMCA 1HFGA 4RCOA 1TWGB 3NBIA 2K28A 1STEA 2EYMA 2L55A 2D62A 5DM63 3S16B 1S5ED 3GTOB 5JEAJ 1GUNA 5CV6A 1I3QB 3PUZA 4DU9A 2JA6B 1TIID 3W2DA 2TMPA 1HPCA 1CHPD 3AMUA 3P75A 1EQVA 4C1NI 4RCNA 3E6ZX 2DNCA 1W6KA 3VR2A 1RODA 3K0YA 4K5WA 3M4OB 5IIFA 1R4PB 2SNMA 1H9SB 3SEBA 3LNNA 2OXPA 2QKIC 2L12A 3S1MB 4TSSA 2R6GA 5EKIA 2ZXOA 4YIJA 3SK6A 2E74C 1I4RA 4IQZA 2I46A 2E2DC 2JE6I 3K6OA 2X6LA 1BXTA 4A93B 4KV6A 3HZXA 4IFDI 3I4NB 4FO2A 2D2CC 4A3EB 4L63B 4BS9A 3VR3A 3WOEA 3RUZA 1S5DD 5IGCA 4K2KA 5JPMC 1QILA 3P20A 4XT3B 1XTCD 4BY1B 3K5LA 5C44B 2F0PA 1JWMD 3R3OA 4IFDJ 2NVXB 3JAML 4QF4A 4BA1I 2LKVA 1EEFD 5IGFA 1SSOA 4PNYA 4C1NK 2SEBD 1JC7A 2KCNA 5HURA 1ML0D 4L6TB 5T1IA 1IL8A 3X3MA 2Z4IA 2TSSA 2R3ZA 2FHTA 5IT9E 2VXWA 4FXGC 3HOZB 3ERQA 3NQTA 3I90A 1LTTD 3GTQB 2HDMA 1FR3A 3AB9A 3GV6A 5ELDA 3T53B 4XQJA 1EU3A 2L5TA 4RGTA 5F2DA 4B9WA 3H09A 2E2HB 1ZKOA 5IGGA 2H1EA 3N6RA 4NDXA 4FF4A 1JE4A 3EJIA 4HAEA 1SDFA 4A3MB 3HKZB 1EZ6A 5KRUA 2L9HA 2ICEC 3V2TA 2PPBC 2F0MA 3MFGA 4Z9CB 1L0XB 1F2YA 2F0HA 3D3RA 1I4PA 1Y8PB 1DXMA 1STHA 1B53A 3S14B 3H6MA 2Q8RE 3D8GA 3VA5A 4PV1C 5FLXE 3CU7A 4FXDA 3BVMA 1LO5D 4KD4A 2KA7A 1RCVD 4KKTA 5EQ0A 1I50B 3RD4A 1BO0A 1YNNC 1A2TA 1EY0A 5I2XA 4KJOA 4XQNA 3NWTA 2QEJC 1STBA 1X3PA 2MP1A 3PUXA 2A68C 1WTWA 4RWSC 3WOFA 2RSOA 3LWUA 2R7ZB 3R8BA 4ODGA 3A7LA 3CQZB 4KJNA 1W6JA 1F9PA 1EOTA 1B2TA 3EFXD 3GTKB 2B2YA 4FVMA 1MSGA 1V1PA 3K7AB 4ILWA 5JAVA 3QB3A 5DNFA 3R2IA 2ICIA 2XRQD 1ENFA 2RKSA 4FYDA 3R2TA 2K7VA 3TP6A 4BWGB 1ZYRD 4E6IA 5IOCA 4PMBA 3J80L 1SYGA 1WTOA 2XRSD 1H9JA 1BUVT 2D9UA 5KYLA 5C0XG 1H9MA 1LTAD 4KKSA 2L4NA 3K58A 4KTAA 1LTID 2O2LD 3NTIA 4RHSA 4DF7A 1OXXK 1TVXA 3EQLC 1DZ1A 3OW7A 2K5WA 3HRZC 4RKBA 3MAQA 4BY7B 1SBBB 2O5JC 5I9OA 1TY0A 2J7ZA 4CBVA 3I3CA 1IW7D 3NTHA 1SE3A 2D5DA 1SNQA 3TZDA 2O4XA 4XIGS 2KCCA 5CR3A 3I4MB 2ZXPA 5G3LD 4IZ8A 2BE5C 3D6WA 2EXZA 2F3WA 1DOLA 4ZKBB 1K8MA 4DAYA 3CRKC 1VDZA 4K2LA 1FD7D 3A8IE 1TWCB 5CV9A 2KQ3A 1ILPA 2NWGA 2ENBA 2CW0D 3URYA 1IKMA 4C3HG 5C4XB 2EZVA 3MXPA 4NP5A 4HR7B 5LHY1 1S5BD 2AWNA 2MJ8A 5ELBA 4U673 1EY9A 1HQMC 2JA8B 3FDTA 3K5MA 1Q12A 2F0VA 1XXGA 5JPNC 3GTMB 4OGQC 3ONAB 2B2WA 5E3FA 3HOXB 1O7YA 4CJ0B 1I4QA 3MXGA 3TSSA 1BNZA 3JAME 2B2UA 4OHJA 3T16A 4J6HA 4TRDA 3NUCA 4PMCA 2O5IC 1DYQA 3MZ5A 2NB0A 3PMFA 2B2TC 5M5WB 2KVMA 2PW7A 1NR2A 1DONA 5NUCA 5EPJA 2NTTA 2L1BA 1D5MC 2F0KA 3K5OA 3MXUA 2AUJD 1ET9A 1KDAA 1BCPC 2M9VA 2NZ1D 3HOYB 3BG3A 4CKBA 4H13C 1LABA 3NHHA 2AQ1B 4ZKCB 5C6AA 4MHEA 4I7ZC 2JA5B 1YNJC 2F0FA 2HQEA 2WKDA 1A3TA 2Z8LA 3IKJA 1T5XD 1F9SA 1B50A 4A3KB 2FMMA 1F9QA 4IUPA 2EYJA 1B9NA 2L11A 2VB3X 3I4LA 4IUTA 1NCVA 4MN3A 2K5QA 2VUMB 2F0OA 1TS4A 1M8AA 3ND8A 3NBHA 2QILA 2M00A 2K5DA 1PRTB 4BBRB 4P2CB 2SOBA 4IFDH 3TP7A 5CV5A 2PZUA 2F4IA 1FNVA 1R9TB 4XT1B 1R4QB 3T56B 1PLFA 2A5HA 2K32A 5FOBB 4C56C 3V05A 5E1FA 2I07B 3OMGA 1CZGA 3J81L 3UI2A 1IKLA 1AW7A 4K14A 3I73A 2A6HD 1KABA 2YU9B 1EYAA 4XYOA 1I4XA 5G3LF 2K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DU9 A;  3TP8 A;  5J22 A;  2PQE A;  2F0G A;  1RKN A;  3SK8 A;  5C5L A;  2F0E A;  4K6D A;  3MVV A;  1JOO A;  5DAU A;  5C4Z A;  5CGK A;  3EVQ A;  4IAL A;  4EQN A;  5KGU A;  1A3U A;  5JOB A;  3LX0 A;  2QDB A;  1EY6 A;  3MXP A;  1NUC A;  4NP5 A;  1EY4 A;  3C1F A;  1SNO A;  4ODG A;  1EY7 A;  3NHH A;  1SNC A;  3P75 A;  1EQV A;  4K5V A;  4RKL A;  3ERQ A;  5HGT A;  2F3V A;  3TP5 A;  3OWF A;  3NQT A;  4KJN A;  4QMG A;  2NUC A;  5C6A A;  5M9O A;  1A3V A;  4ZUI A;  5EKK A;  4K8I A;  1EY9 A;  2F0T A;  4N9P A;  5I6W A;  5CV4 A;  2OF1 A;  2F0F A;  3E5S A;  1STG A;  2F0J A;  2HQE A;  4I65 A;  1JOR A;  1A3T A;  1STA A;  3SK5 A;  4N9T A;  4K5W A;  5JAV A;  3QB3 A;  2EYO A;  4B9X A;  5IGD A;  5IIF A;  3ERO A;  1TQO A;  1KDC A;  4KY7 A;  1SYE A;  1ENA A;  4IUN A;  1EYC A;  5F2D A;  2SNM A;  4QB4 A;  2RKS A;  2EYJ A;  3TP6 A;  2F0V A;  2WAC A;  4HMI A;  4B9W A;  4HTH A;  3D6C A;  5IGB A;  3P1H A;  1TT2 A;  4E6I A;  5IOC A;  2EY1 A;  5KIX A;  4KY6 A;  2OXP A;  1U9R A;  5IGG A;  4PMB A;  1EY8 A;  3OSO A;  5C4H A;  3DMU A;  4KHV A;  5CC4 A;  1A2U A;  3NP8 A;  5E3F A;  2F0O A;  4LAA A;  4NDX A;  3ITP A;  5C3X A;  5C5M A;  3TP7 A;  1SYG A;  4K5X A;  3EJI A;  4EVO A;  5I6Y A;  4G57 A;  3BDC A;  4YIJ A;  3SK6 A;  5KYL A;  1EYD A;  2KHS A;  2M00 A;  4R8N A;  5CV8 A;  5KEE A;  1NSN S;  3MHB A;  1EZ6 A;  3NK9 A;  5CV7 A;  1IHZ A;  5KRU A;  3S9W A;  2EYL A;  2RBM A;  4KTA A;  3T13 A;  1JOQ A;  3QOJ A;  3OMC A;  4ME5 A;  1JOK A;  2PZW A;  3MEH A;  3T16 A;  4DF7 A;  4J6H A;  2SOB A;  2PZT A;  4TRD A;  4MIU A;  2RDF A;  3HEJ A;  5EKL A;  1SYB A;  2PYK A;  3V2T A;  2F0N A;  1F2Z A;  3SR1 A;  4K8J A;  4WRD A;  3QOL A;  3TME A;  4RKB A;  5DEH A;  2F0M A;  4J1M A;  1SND A;  2PZU A;  4S3S A;  3BDL A;  5CV5 A;  3NUC A;  4ZUJ A;  3D4D A;  4KV6 A;  4OL7 A;  4PMC A;  1F2M A;  4HMJ A;  1SYD A;  4EQP A;  2EYF A;  5J1Z A;  3SHL A;  3HZX A;  1F2Y A;  1KDB A;  1KAA A;  2EY2 A;  2PW5 A;  2F0D A;  2F0H A;  3MZ5 A;  5I9O A;  5IOD A;  5K5P A;  2F0Q A;  1SYF A;  1STY A;  2F0S A;  1STH A;  3PMF A;  4ID6 A;  3H6M A;  2EYH A;  2OEO A;  3D8G A;  3NXW A;  4NKL A;  3RUZ A;  3VA5 A;  1SNQ A;  5IGC A;  2O4X A;  4H7B A;  4K2K A;  4F8M A;  2EY5 A;  2F0I A;  5CR3 A;  2PW7 A;  5E1F A;  3DHQ A;  3SK4 A;  3C1E A;  4IZ8 A;  1SYC A;  3OMG A;  1EZ8 A;  2EYP A;  2EY6 A;  3D4W A;  4EQO A;  2F0W A;  1SNP A;  5NUC A;  2EXZ A;  3SXH A;  2F3W A;  4KD3 A;  4KD4 A;  2F0P A;  4ZQ3 A;  3R3O A;  1STN A;  1TR5 A;  4QF4 A;  2F0L A;  1AEX A;  2SNS A;  1SNM A;  4K14 A;  4KY5 A;  5IGE A;  2LKV A;  5IGF A;  5J39 A;  4K2L A;  4PNY A;  1A2T A;  2F0U A;  2F0K A;  4F7X A;  1KAB A;  1EY0 A;  2EYM A;  5CV9 A;  4WOR A;  4DFA A;  5I9P A;  5ISR A;  4KJO A;  1EY5 A;  3U9O A;  1II3 A;  2KQ3 A;  5HUR A;  1EYA A;  1KDA A;  4DGZ A;  5C3W A;  1ENC A;  4NMZ A;  1STB A;  5EGT A;  2ENB A;  5CV6 A;  5KYI A; 
#chains in the Genus database with same CATH topology
 4O1N A;  3TP8 A;  1PTO B;  2P5Z X;  3J80 E;  3IAY A;  1JOO A;  3VYR A;  2QEX A;  5ELN A;  1C8C A;  3H94 A;  3BYY B;  1G91 A;  1PTO C;  2MHV A;  3I8Z A;  3IL8 A;  2R92 H;  4X62 Q;  2Q2U A;  4IUV A;  2CVR A;  1VS0 A;  1R9T H;  5KND A;  1VCI A;  4K5V A;  1B3A A;  5BR8 L;  2F3V A;  3O13 A;  3FHW A;  3GTP H;  1VQ9 A;  1S4Z A;  3L9A X;  2KHI A;  3AFP A;  3QIA A;  2VY3 A;  2VQF Q;  4ULL A;  1IYJ B;  1SR3 A;  2EDG A;  4V0B A;  4DA2 A;  4A3I B;  4IUN A;  1ENA A;  1DD2 A;  4A3J G;  1GUG A;  4DXG A;  2A69 C;  2WB1 B;  1X32 A;  1GHJ A;  2RDH A;  1G8Z D;  2RSN A;  2XSC A;  2WP8 J;  4DV1 L;  3MXN A;  3Q22 A;  1TXY A;  1YEZ A;  2OT2 A;  3VYS A;  3KFU A;  1F77 A;  3TZU A;  1LT6 D;  1IW7 C;  1FGB D;  1I4G A;  1O80 A;  3GTG B;  4JI3 L;  1PTO H;  3T13 A;  4FF1 A;  1TS2 A;  1QCB D;  1B9M A;  2EJF C;  1ZEQ X;  2N88 A;  4OIK A;  3ND9 A;  4K8J A;  1HA5 A;  1C9O A;  2GN5 A;  1N32 L;  1FJG Q;  1AN8 A;  3D4D A;  4R4T A;  4HMJ A;  4FF3 A;  1HR0 W;  1EIF A;  3U58 A;  1EIH A;  3SHL A;  2OQK A;  1TWH H;  4IPC A;  5D3D A;  5K5P A;  3CPW A;  1FVI A;  4LF5 Q;  1STY A;  3HP3 A;  1D8L A;  3M4P A;  2OWO A;  3H91 A;  1ICF B;  2C5C A;  4LMQ D;  4UAI A;  3N52 A;  4JI1 Q;  4IPD A;  3SXH A;  1IXR A;  4YHH Q;  3KJP A;  4UPA A;  3FP9 A;  3K7U C;  3T1H L;  3KF8 A;  3H0G B;  1N33 Q;  3CKI B;  2A74 C;  4LFC Q;  2JA6 G;  5I9P A;  1E2V A;  3RNU A;  2ZM6 L;  1EY5 A;  3GTG H;  4FP5 D;  4X65 Q;  1B3Q A;  1ENC A;  5EGT A;  1Q81 C;  1X3Q A;  1Z6H A;  1HTP A;  1VMC A;  4EVO A;  3I56 A;  4R4Q A;  1D1I A;  1LT3 D;  2M2L A;  3HOV H;  2MGS A;  3S1R H;  4GLV B;  1K8O A;  2FIN B;  4PZ7 A;  5GAD C;  1M4V A;  3HS0 C;  4TQU S;  1UAP A;  3FPU B;  1O7L A;  3W3A A;  1NE3 A;  3VYU A;  1QG7 A;  4XXE A;  4GOP B;  3GP7 A;  1A3V A;  1L2F A;  5CBA E;  4N9P A;  1GUW A;  4GOP C;  4DR6 Q;  1H9K A;  1LM0 A;  3CCM A;  4LF7 Q;  4G7H C;  4B9X A;  5A2Q L;  2PNH A;  3GTL H;  4KY7 A;  1HCZ A;  4QB4 A;  1MGS A;  3FKI G;  3T4A C;  4LFB L;  4A3B G;  2FJ2 A;  4LF9 L;  4JBJ A;  1QOH A;  3Q24 A;  3CPF A;  1VQP A;  2GA4 B;  3K81 C;  2HUG A;  3L3O C;  3Q6S A;  2H5X A;  2XWJ B;  2B2V C;  4GLA C;  3G71 A;  4NW2 A;  5LMU L;  4FNF A;  2HCI A;  2XNA C;  4XQQ A;  1O78 A;  4B3S Q;  3HEJ A;  3TDQ A;  3SR1 A;  5J3B A;  4A3E G;  1ICW A;  1B8A A;  2HIX A;  1F2M A;  1SN8 A;  2R93 B;  1SYD A;  2NVQ B;  2BOS A;  2AQ2 B;  1QE6 A;  1V1Q A;  1KAA A;  2EY2 A;  3STB D;  1H9S A;  2AMC B;  3X3N A;  4DR4 Q;  2OEO A;  1EOV A;  3SDZ A;  1G6Z A;  1SJE D;  2A6E C;  4IOC A;  4NXM Q;  1UEA B;  1LT5 D;  2F0W A;  4X66 Q;  3PIP 3;  3CCQ A;  3DM1 A;  1Y1W G;  4QUC A;  4R1J A;  1ONL A;  5FK9 C;  4IPG A;  4MTK A;  3KLS X;  2HT1 A;  2EJM A;  2F0U A;  4F7X A;  2VW9 A;  1Y69 U;  4GZY C;  1VF7 A;  3OTO L;  1PH7 A;  4LF6 Q;  3AEV A;  3RZD H;  5M5Y B;  1D2B A;  2Z9H A;  3AFQ A;  4C3I G;  1UE7 A;  3NPP A;  1KNA A;  3KF6 A;  4C3I H;  4IUU A;  1EWH A;  1K8G A;  3PCO B;  1EU4 A;  5DAU A;  2PNR C;  3LGJ A;  4DK1 A;  2OTL A;  3HOU G;  5L37 A;  3A8K E;  3DWQ A;  3T51 B;  4DKA C;  2R93 H;  1CQF A;  3HOW B;  2NVQ H;  1L0Y B;  4BBS B;  1E2W A;  1VQ5 A;  1MD2 D;  1YHA A;  5M9O A;  1U4M A;  3RLF A;  5JVH 3;  1TKW B;  1KL9 A;  1SXT A;  2KEC A;  4OWX B;  2VQE L;  2WAQ B;  4JG2 A;  1CSP A;  3J7Z C;  2EJG C;  4RA8 A;  4DR1 Q;  4DR5 Q;  1T5E A;  2JEB I;  5JJZ A;  1NAP A;  2Y0S G;  4X64 L;  4HTH A;  3E0J A;  2R61 A;  2VQF L;  1X56 A;  3HKZ G;  1X3F A;  2NN6 G;  5CYU A;  3NP8 A;  1C48 A;  5M5Y H;  5I6Y A;  3J81 E;  4UDU C;  2CH4 A;  2E2I H;  3RR5 A;  3M7G A;  1DM0 B;  1NSN S;  2IX0 A;  2IX1 A;  3I55 A;  2RBM A;  3QOJ A;  2JP1 A;  4KHZ A;  2JSO A;  5IP7 H;  2IX3 A;  2Q8T A;  3RZO H;  3DXJ C;  4MIU A;  3GQB A;  1XNR L;  2F0N A;  3PGZ A;  3S2D H;  2BDO A;  2K33 A;  2V1C C;  1A8V A;  2JEA I;  1WTX A;  1C7Y A;  3PO3 G;  1Q1E A;  4EQ5 A;  2K04 A;  1U4P A;  1XNQ Q;  3PO3 H;  5IOD A;  1V8Q A;  1LLR D;  3UDX A;  1CA6 A;  3GO5 A;  5A35 A;  4DNI A;  2E2J B;  4NKL A;  1FJG L;  4OEM B;  1SMY D;  1PZI D;  2BA0 A;  2F0I A;  4NXN Q;  1LTS D;  5C0X H;  3KK7 A;  1A0I A;  3D4W A;  4DAP A;  3OIQ A;  1AFP A;  3TRE A;  4EQO A;  2AUK A;  2KHJ A;  5JVG 3;  4LWC A;  2XVS A;  4LF5 L;  2NYZ D;  3PQI A;  1Q90 A;  5EBD A;  4OIJ A;  1VQL A;  3QO2 A;  4C3H B;  2SNS A;  2RVL A;  4HSP A;  4DR3 Q;  3I2Z A;  1Y8N B;  3CHB D;  3A5U A;  1WTR A;  1K3R A;  2UXC L;  4YHH L;  1WI5 A;  2I5H A;  4OO1 G;  2PQE A;  2BH8 A;  4AH6 A;  3FEW X;  2DGY A;  2KJX A;  1Y1V B;  1CT1 D;  4LFC L;  1SFO H;  1A3U A;  1EL0 A;  5JOB A;  4LUO A;  1NR4 A;  4Q0F A;  3C1F A;  1L0W A;  2A1A A;  1EY7 A;  4X65 L;  4GNX B;  1JB7 A;  5LL6 X;  5M5X B;  4ZK9 B;  3F8T A;  2JA7 H;  4X3U A;  1ASY A;  2A73 B;  4ZUI A;  2LFN A;  1JCK B;  3KLW A;  1BVS A;  2K4K A;  4X3K A;  2IT1 A;  1IBL Q;  2YYZ A;  1WVL A;  1CUK A;  5BR8 Q;  4JI2 Q;  1VQG A;  4ZYS A;  3S2H B;  4DXF A;  1EYG A;  1NMG A;  1KDC A;  5AFW A;  3MTS A;  4GN4 B;  1EYC A;  4QIW B;  1HHV A;  1PFN A;  1WD0 A;  4C3H H;  1MJC A;  1TT2 A;  4ZCK A;  4KY6 A;  3CCV A;  4LF7 L;  2DY8 A;  3G7L A;  1HNZ L;  1EWC A;  2VNU D;  1U4R A;  3JC6 6;  3KJO A;  4CJ2 C;  2ZTC A;  3EA6 A;  2HDL A;  5H1S E;  1E2Z A;  4IOA A;  1ILQ A;  1VQI A;  1YNX A;  1TS5 A;  3MHB A;  1GHK A;  4DV1 Q;  1EFI D;  3PIO 3;  1X6O A;  1KHI A;  3PO2 B;  1CZW A;  1Y1V H;  5EKL A;  4A3F H;  1FYC A;  2HCC A;  5I4D A;  1F2Z A;  2K03 A;  5M3M H;  2Q2T A;  4A3D B;  4JK1 C;  4J1M A;  1SND A;  3MFY A;  4JI3 Q;  5IE8 A;  3A7A B;  2BA1 A;  2EYF A;  4DAV A;  2D0P A;  2KUM A;  3K0X A;  1SYF A;  1KQS A;  2ZXR A;  4ID6 A;  1N32 Q;  1HFN A;  2EPB A;  4H7B A;  3EIV A;  4F88 A;  1D6E C;  3CAM A;  1WCM H;  3RMH A;  1PVO A;  3C1E A;  3F2C A;  3OW2 A;  4KK7 A;  1Q1B A;  3JAM i;  1HZ9 A;  1D1K A;  4QCL A;  1TR5 A;  1G29 1;  4KMU C;  1BOS A;  2UUB L;  4DR4 L;  4R8I A;  4UP9 A;  2B39 A;  4QY7 A;  3Q8D A;  1EIG A;  2X69 A;  1GUS A;  2MUY A;  5M3F H;  4JBW A;  4A3C G;  4NXM L;  4JPB W;  5A2Q E;  4YWK A;  5C3E H;  4RG1 A;  5C4J H;  5T1G A;  1L1O B;  3J7A V;  1GUO A;  3GTJ B;  2C9O A;  2KBN A;  3SK8 A;  1L1O C;  4XDX A;  2WAQ E;  4DK3 C;  4IJH A;  4P71 A;  4CGY B;  1GO3 E;  2ZM6 Q;  4A3D H;  2DJG C;  2QDB A;  1NUC A;  1CQV A;  1EY4 A;  4IJL A;  3NTK A;  4LF6 L;  2KEE A;  4G7Z C;  1FNU A;  1ESF A;  5C0X I;  4GKJ L;  1AE2 A;  5JEA G;  1BCP B;  3DWP A;  1ZXT A;  1CKN A;  4EGV A;  1STG A;  4AYB E;  2BCO A;  4C3J B;  5ELE A;  2Z1C A;  5AJ3 L;  3S1Q B;  4J8Q A;  4LUV A;  5ELF A;  3BJU A;  4FXK C;  3FRP B;  1MIU A;  3BVZ A;  5C0X J;  5COR A;  2JN4 A;  2FFK B;  5IGB A;  1NMF A;  3AQQ A;  1IZ6 A;  1WTH A;  2FMC A;  1GJX A;  3QR8 A;  5IP9 H;  3OSO A;  1E1T A;  2CKZ B;  3ITP A;  5C5M A;  1HA6 A;  3TN2 A;  4DR1 L;  4DNR B;  1SAP A;  3GTJ H;  4DR5 L;  4HCS A;  4LF9 Q;  1PH6 A;  2CHB D;  1PRT F;  3NK9 A;  3PUV A;  1VQK A;  5JJK A;  1XTD A;  1EQR A;  3VA7 A;  3J7Y W;  2RDF A;  2PYK A;  1X55 A;  2UUA L;  4IUQ A;  3CC2 A;  1VQF A;  1Y8O B;  2LS0 1;  5LMU Q;  3DEO A;  2Q2H A;  2F4V L;  1HUM A;  1CKO A;  1E22 A;  1VQE A;  2IHE A;  1CK1 A;  1KTK A;  3I91 A;  2WV6 D;  2DNE A;  2QA4 A;  1P16 A;  3K59 A;  4Y7N H;  3S1Q H;  2PQA A;  4A3G G;  2Z0S A;  3MA2 B;  5K36 G;  5KNC A;  2EVB A;  3J7A F;  5DM7 3;  1RHP A;  1RTO A;  1WFQ A;  4CDC C;  5FJ8 H;  3NSW A;  3MC0 B;  2B8G A;  5IT9 c;  3SVM A;  1YNN D;  4R4C A;  4KY5 A;  2R92 B;  4DFA A;  1SJH D;  3HFZ B;  2PMZ E;  3GTP B;  2A68 D;  2IL8 A;  3K57 A;  5IYD H;  3QWN A;  5EBC A;  2MO0 A;  1UE1 A;  4MNO A;  2HIV A;  3ZYY X;  3G6J B;  4DR3 L;  1PHJ A;  1K0R A;  3VR5 A;  3F2U A;  3OTO Q;  3UDG A;  1ESR A;  1XYI A;  3NWS A;  2JQO A;  1EQT A;  1O7Z A;  2VB2 X;  2E5L L;  4HN7 A;  4V19 0;  1BF4 A;  1KRS A;  4QIW E;  3TP5 A;  1IBM Q;  4CKC A;  1P8L A;  2JA9 A;  1V43 A;  1VMP A;  5EKK A;  1G2T A;  3DUZ A;  1BDO A;  1I6V C;  3FPP A;  1PA6 A;  1STA A;  3AU7 A;  1OTC A;  4QUF A;  1LTB D;  2RA4 A;  1AE3 A;  3KBG A;  4LFA L;  2VUM G;  1A15 A;  1J8I A;  2VQE Q;  3J80 i;  1SEB D;  2EY1 A;  1RL2 A;  2IWH A;  1IBL L;  2XTI A;  1SE8 A;  1MI2 A;  1ZYR C;  2V4D A;  5CC4 A;  1BQQ T;  4JI2 L;  4LAA A;  1UUP A;  1TWA B;  4H0L C;  5C3X A;  4Q5V A;  1X9N A;  1TWH B;  4X64 Q;  2IJ0 A;  3PF4 A;  2J4X A;  4L5Q A;  1SMY C;  4DN4 M;  4ME5 A;  2B63 G;  3D0F A;  3M4Q A;  3C46 A;  3QOL A;  3TME A;  3NEM A;  4WJW A;  4S3S A;  3A8J E;  4PMW A;  2EIF A;  3D31 A;  3M4Y A;  4A3J H;  4BA2 I;  1KDB A;  2I5M X;  3NE5 B;  5FO9 B;  1XNR Q;  1GXD C;  2WIN B;  1HZB A;  4F8M A;  1TU2 B;  2SDF A;  4YWL A;  5E4W C;  2BE5 D;  3DHQ A;  2EXD A;  3SK4 A;  1EZ8 A;  1Q82 C;  3HOV B;  4IN3 A;  3S1R B;  3BZD B;  4ZQ3 A;  1RD9 D;  4HJ7 A;  1STN A;  5JJL A;  1AZP A;  1PMR A;  5GRO A;  1HNW L;  1TWA H;  5LMN L;  4H02 A;  3I72 A;  4WOR A;  3IRB A;  1II3 A;  3C3L A;  2WFW A;  5C3W A;  1O7I A;  1QUQ A;  5KYI A;  1Q7Y C;  3J81 j;  3S1N B;  5E4X A;  2F0G A;  1RKN A;  3TBI B;  1JIC A;  5IYC G;  2CW0 C;  3MVV A;  5C4Z A;  1V1O A;  2UXC Q;  3GTL B;  4LJZ C;  1PXU A;  1LTG D;  2OCE A;  1SNO A;  1SE2 A;  2D0O A;  2NTS A;  3V96 A;  3FKI B;  3CP0 A;  3S16 H;  4HIM A;  4A3B B;  4KN7 C;  4K8I A;  1E3P A;  5CV4 A;  2WKC A;  2JYO A;  4GN3 B;  4A3I G;  1I3Q H;  3E5S A;  4RGO S;  2JA6 H;  2WB1 G;  4RH6 A;  1D5X C;  1YBY A;  3A55 A;  3CD6 A;  1V9P A;  1SYE A;  1QJO A;  1QVC A;  3M3Y B;  1C4Q A;  1KLG D;  3QJY A;  4P75 A;  4JI8 L;  1OXS C;  1I5F A;  1VQD A;  3R93 A;  2KHS A;  3S1N H;  2OTJ A;  4R8N A;  1IHZ A;  1HQR D;  1K28 A;  1HNZ Q;  1TWF B;  2E8G A;  3RN5 A;  2KOL A;  5D14 A;  2NVY B;  4WRD A;  5DEH A;  4HIK A;  2B3G A;  4OL7 A;  1PZK D;  3FKI H;  5KNB A;  1QNU A;  3LWE A;  4A3B H;  3S1M H;  4ABN A;  4WFN 3;  1Y1W B;  1RF2 D;  4MZ9 A;  4OWT B;  2XIW A;  1S72 A;  2EY5 A;  2QGQ A;  4A93 G;  3RZD B;  3ICE A;  1DOK A;  1SYC A;  3M3Y H;  1SE4 A;  2EY6 A;  2ES2 A;  4C3I B;  1B1Z A;  4K0K L;  1B7Y B;  4KD3 A;  1PDQ A;  2VZA A;  1S5F D;  2WII B;  1YJN A;  3I4N G;  3UE1 A;  4CJ1 B;  4RGN A;  3I4N H;  1AEX A;  1V1P B;  5CBE E;  1OXV A;  5J39 A;  3HOU B;  4A3E H;  4DNT B;  1HH2 P;  2B2Y C;  2NZO A;  1PH3 A;  3CCJ A;  1BCP D;  1S5C D;  4BY1 G;  5EPL A;  2UUB Q;  4N8F A;  5C44 G;  1BR9 A;  4B3R Q;  2DUD A;  2AWO A;  1TWF H;  2F03 A;  4KHP L;  5C44 H;  5FO7 B;  3A74 A;  4K6D A;  3D4R A;  2NVY H;  1BBU A;  1TY2 A;  3E9I A;  4P72 A;  1SNC A;  2EOT A;  5HGT A;  1Y1W H;  3GDE A;  3NQI A;  4QMG A;  2Y0S B;  1KIX A;  1YNJ D;  3BZK A;  4M1U B;  5I6W A;  5HGQ A;  3HGB A;  4JI0 L;  4HED A;  4PG3 A;  4IO9 A;  4GKJ Q;  4N9T A;  2E2I B;  3EBE A;  1HUN A;  3HOZ G;  4APV A;  1IBM L;  1VQ6 A;  3RZO B;  3D6C A;  3PUW A;  3P7J A;  5AJ3 Q;  2K01 A;  3HOU H;  3S2D B;  3KLS A;  3GTQ H;  5FLM G;  1EY8 A;  1SRU A;  2RDG A;  1A6X A;  4KHV A;  2IHF A;  5LL6 S;  1JQY D;  1UE6 A;  4G57 A;  3PO3 B;  4YWM A;  2ZT9 C;  1PH1 A;  5KEE A;  1HXY D;  5CV7 A;  4GOP A;  2IPK D;  4PQX A;  4OXP A;  1PV4 A;  1HTL D;  2VS1 A;  1B4O A;  1JOK A;  1PZJ D;  1PRT D;  4NPS A;  4RAU C;  3BYT B;  1QNK A;  2E2H H;  2G9H D;  1GOZ A;  3AYH B;  2AHO B;  4L5S A;  1VQH A;  1BBX C;  4JOI C;  4GN5 A;  2KED A;  4G7O C;  3IFT A;  3QG1 A;  2QW7 A;  3VYT A;  4A3M G;  2UU9 L;  2F0D A;  1XX8 A;  4AYB B;  2F0Q A;  3GV3 A;  1I94 Q;  2NN6 H;  2UUA Q;  1E1O A;  1NNX A;  1KNE A;  2K52 A;  2F4V Q;  2B2V A;  1AZQ A;  1K83 B;  3J81 i;  4BXX G;  1EQQ A;  1BKB A;  2EYP A;  3Q23 A;  1H9R A;  1SNP A;  4JBK A;  1VF5 C;  1KD1 C;  1H95 A;  2H4O A;  4FDB A;  1SFO B;  1F9R A;  2F0L A;  3CRL C;  1RDP D;  2DY7 A;  3CF5 A;  3F2D A;  1JWU D;  4JI6 L;  3CCS A;  4O42 A;  4A4I A;  2A6H C;  1CA5 A;  1U0L A;  2JA7 B;  3U9O A;  1Z7T A;  4C2M B;  4DGZ A;  5CMD A;  4NMZ A;  4JV5 L;  5EPK A;  4HJ9 A;  5GAH C;  4DV5 L;  1ET6 A;  4BBS G;  1I4H A;  5C5L A;  3K5N A;  1J5E Q;  5CGK A;  1JR0 D;  2QCP X;  1PTO D;  2EQS A;  5KGU A;  4JCV E;  4JI5 L;  1TS3 A;  1CM9 A;  2LY7 A;  4L5T A;  4DR7 L;  2B2W C;  4X3T A;  4B3T L;  2CFM A;  2N8N A;  4N8X 1;  1HNX L;  1CTM A;  4LK1 C;  4RKL A;  3OWF A;  2NUC A;  3BS1 A;  1PFM A;  2MPM A;  4WJ3 M;  1LTL A;  3OWE B;  2E5L Q;  2R7Z G;  2B2U C;  2F0J A;  4ZRZ A;  1K83 H;  1GUT A;  4B3M Q;  1GM5 A;  2R7Z H;  2EYO A;  1SMX A;  5IGD A;  3S15 B;  5D65 A;  3DWA A;  1QWY A;  1XPU A;  3U9S A;  2A69 D;  3F2B A;  4OO1 H;  2WAC A;  4HMI A;  1EIY B;  4A3F B;  1Q3L A;  3P1H A;  4DV0 Q;  1JMC A;  3PIP A;  1GD7 A;  1MHW C;  4PZ8 A;  5M3M B;  1UE5 A;  5C4H A;  5FKA C;  1WTP A;  2PMZ B;  1OXU A;  4POF A;  1MSH A;  4JVZ A;  1QB5 D;  3GTK H;  2ZJR A;  3PUY A;  4LFA Q;  4C2M H;  4K5X A;  1IYV A;  1U4L A;  1LV9 A;  3BDO A;  3K7A H;  2NBF A;  5CV8 A;  1IYU A;  1Q8I A;  4TVA B;  2X6G A;  1JOQ A;  4EX5 A;  3FVQ A;  2PZW A;  4B08 A;  2PZT A;  4DK6 C;  1WCM B;  4IUR A;  4ZUJ A;  4HSV A;  3GD7 A;  1OXT A;  3HG9 A;  3ULJ A;  2K1B A;  3SE0 A;  4HJ5 A;  5M3F B;  1YIT A;  2CQA A;  1PFS A;  4G4K A;  1PFB A;  5ELC A;  4J15 A;  4R4I A;  1KRT A;  2EYH A;  4X3S A;  1CFM A;  5C3E B;  4HIO A;  1XPO A;  3S15 H;  5C4J B;  4YCU A;  3L0O A;  4BY7 G;  1DOM A;  2F1M A;  5IWA Q;  3J80 c;  2I0Q A;  4RHR A;  1RIP A;  1EUJ A;  3I4M G;  1VQN A;  4M8A A;  5ISR A;  4F87 A;  1JB3 A;  2K6A A;  3M85 A;  2FXQ A;  3KDF B;  2Y0S E;  3H3V C;  2E76 C;  4RFB A;  1HNW Q;  4XYQ A;  2UXB Q;  2NVT B;  1BBW A;  5LMN Q;  2F0E A;  4L8J A;  2DN8 A;  3S24 A;  3HKZ E;  2NN6 I;  1G2S A;  3EVQ A;  4EQN A;  3LX0 A;  3TQY A;  1EY6 A;  3KLR A;  3NBH B;  4OEL B;  4ZAI A;  1LTR D;  3ER0 A;  2JXM B;  2UXD Q;  1TWC H;  4B3R L;  1BCP F;  1LT4 D;  4POG A;  4RGM A;  3OOC A;  3T1Y Q;  3TS0 A;  2OF1 A;  1WD1 A;  1S40 A;  2PO4 A;  1JOR A;  2CWA A;  3E9H A;  4A3C H;  2VL6 A;  2KCT A;  4A75 A;  5EJW A;  5C4X G;  3A5Z B;  1JT8 A;  1RJT A;  4QL5 A;  4CKE A;  1DGS A;  1Z9F A;  2IW3 A;  1DCZ A;  1KAW A;  1MBY A;  2Z6K A;  3PV0 A;  1NTG A;  1QZG A;  1WTQ A;  1QVF A;  3KBX A;  4H44 C;  2CWP A;  4O2D A;  1J9O A;  2ZJQ A;  1U9R A;  3H3V H;  2JA8 G;  4Y52 H;  3DMU A;  5E7N A;  4HID A;  3OHX C;  3WDN A;  1JJ2 A;  3A56 A;  3BDC A;  5IT9 L;  4DK0 A;  5JEA H;  5COY A;  1EYD A;  1Z47 A;  1B70 B;  3HKS A;  3L7Z C;  4GNX A;  2NVT H;  3OPO A;  3S9W A;  2EYL A;  4Y7N B;  4JI8 Q;  2XN9 C;  1DJR D;  3ERS X;  5DLQ E;  3MEH A;  4XTC S;  2G9D A;  3BZC A;  4HCE A;  4UHV A;  4A3G B;  1K8A C;  3HOX G;  5IYB G;  1LUZ A;  2RQX A;  5D3I B;  4ZLT F;  3KUP A;  1HRJ A;  1T9H A;  5J1Z A;  2ALY B;  4A3L G;  1F2L A;  5GAE C;  4OO1 I;  5BN5 A;  4A3L H;  2F0S A;  4R9W A;  3STB C;  3CCR A;  1N36 L;  3NXW A;  1XWE A;  2A6E D;  1K9M C;  5BN3 A;  1AH9 A;  2J0T D;  1SRO A;  2ZTE A;  4JI7 L;  2BDN A;  2JK8 A;  1I94 L;  4QGU A;  3DEP A;  2XWB B;  1XMO L;  1SNM A;  5IGE A;  1I6H B;  3Q0A A;  1PYW D;  4K0K Q;  2GVA A;  5M5W H;  2EE1 A;  1X3G A;  5LMN W;  1JJC B;  3A54 A;  3CC4 A;  4U68 A;  2I5L X;  1UNS A;  1JWS D;  3MXN B;  5J22 A;  3S17 B;  4TKO B;  2F52 A;  4A3G H;  3PIO A;  5FO8 B;  4K6L A;  4IAL A;  5K36 H;  2PI2 A;  3KDF A;  3OIP A;  4CDE C;  1HZC A;  4L5R C;  5FLX L;  1KLU D;  1EWI A;  2RHS B;  4KHP Q;  2LMC B;  4C3J G;  4CHT B;  3I70 A;  2PCF B;  1CI3 M;  4KKU A;  4ALP A;  1J5E L;  3W5O A;  2F0T A;  3C2P A;  1FNW A;  4KN4 C;  3HOY G;  3M7N A;  4I65 A;  3IFD A;  3VR6 A;  3SK5 A;  1PTO F;  2B2T A;  4IFD G;  3ERO A;  1TQO A;  4KI0 A;  1OO9 B;  2AQ3 B;  4HJA A;  3ZJY C;  1PRT C;  2Q8I B;  1YIJ A;  4JI0 Q;  2MNA A;  1L1O A;  2JA5 G;  5KIX A;  1I6H H;  2B63 B;  2E75 C;  5HY6 A;  4B3M L;  3MWY W;  5TSS A;  1EEI D;  4UP7 A;  1WTV A;  2HD3 A;  1A2U A;  4JI4 L;  1D5Z C;  4A3J B;  1E0B A;  1PH8 A;  2B8F A;  2ID0 A;  2C35 B;  1B44 D;  4YY3 L;  4A3K G;  3U50 C;  1LAC A;  3KF8 B;  4DV0 L;  3S17 H;  3PSI A;  5I2Y A;  4A3K H;  3OMC A;  1VQM A;  4LF4 L;  3BVG A;  3VR4 A;  2QF7 A;  4FF2 A;  1SYB A;  2LXK A;  4JYA L;  1AP0 A;  2K50 A;  2N55 A;  3BDL A;  2L0C A;  2VUM H;  4EQP A;  1RTN A;  2Z4H A;  2PW5 A;  1CHQ D;  2OQ0 A;  3MEF A;  4BBR G;  5BN4 A;  2RHQ B;  2YTV A;  1JJG A;  3FMC A;  3H15 A;  3H3V I;  1D7Q A;  3J7A 5;  1HFG A;  4P74 A;  4AQY L;  4RCO A;  5FLX c;  2PI2 E;  4A76 A;  2UU9 Q;  2L15 A;  1TWG B;  3NBI A;  1WJJ A;  3G48 A;  2R92 G;  1VQ4 A;  2ATW A;  1Q46 A;  2B63 H;  2K28 A;  4UP8 A;  4DV4 L;  1STE A;  3CMA A;  2EYM A;  3CXC A;  2L55 A;  2D62 A;  5IWA L;  5DM6 3;  3S16 B;  2MFI A;  1S5E D;  3GTO B;  5JEA J;  1GUN A;  5CV6 A;  4DUZ L;  1I3Q B;  3PUZ A;  4DU9 A;  1FL0 A;  4DAM A;  2A8V A;  1PYB A;  2JA6 B;  1TII D;  4JI6 Q;  3W2D A;  3E3X A;  2N3S A;  2LXJ A;  2TMP A;  1KC8 C;  1G6P A;  1HPC A;  3KOJ A;  1YHB A;  4JV5 Q;  1CHP D;  3AMU A;  3P75 A;  1EQV A;  4DV5 Q;  4C1N I;  4RCN A;  3E6Z X;  3TEH B;  2DNC A;  1W6K A;  3VR2 A;  2YU9 H;  5GAG C;  2CQO A;  2K5H A;  1ROD A;  2UXB L;  2GVB A;  1YZ6 A;  4LNQ A;  4JI5 Q;  3J81 c;  4DR7 Q;  4B3T Q;  2RCF A;  4O0A A;  3CCU A;  1HNX Q;  3K0Y A;  4K5W A;  3M4O B;  2N78 A;  2UXD L;  1TWG H;  5IIF A;  3A0J A;  1R4P B;  2SNM A;  4RMF A;  1H9S B;  3T1Y L;  2R7F A;  5IYC H;  2UUC L;  3SEB A;  3LNN A;  4MTN A;  2OXP A;  1YJW A;  2QKI C;  2L12 A;  3OYY A;  3S1M B;  4TSS A;  2R6G A;  5EKI A;  2ZXO A;  4YIJ A;  2DJF C;  3GTO H;  3SK6 A;  2E74 C;  1I4R A;  2HQL A;  1VQO A;  4IQZ A;  2I46 A;  4A3I H;  2E2D C;  2JE6 I;  1N9W A;  3K6O A;  2X6L A;  2Z6B A;  1BXT A;  4DV7 L;  4A93 B;  1NJI C;  4KV6 A;  2BH2 A;  3KF6 B;  1N34 L;  3HZX A;  4IFD I;  3I4N B;  4FO2 A;  2D2C C;  4A3E B;  4L63 B;  4BS9 A;  3HOV G;  3VR3 A;  4OON A;  3RUZ A;  3WOE A;  1S5D D;  3M4O H;  5IGC A;  4K2K A;  3I4O A;  5JPM C;  3VDY A;  3KYH C;  1QIL A;  1W3S A;  3P20 A;  4XT3 B;  2HHH Q;  1XTC D;  3L2P A;  4BY1 B;  3W1B A;  3NEN A;  3K5L A;  5C44 B;  3E0E A;  2F0P A;  1JWM D;  3R3O A;  4DV2 L;  4IFD J;  2NVX B;  3JAM L;  4QF4 A;  4DUY Q;  4BA1 I;  2A19 A;  2LKV A;  1EEF D;  5IGF A;  1PH2 A;  1SSO A;  4PNY A;  4C1N K;  2SEB D;  1XMQ L;  1JC7 A;  2KCN A;  2XGT A;  4GKK Q;  5HUR A;  4PZ6 A;  2IY5 B;  1GVP A;  4QJF A;  1Q86 C;  5EAY A;  1ML0 D;  4L6T B;  5T1I A;  1QVG A;  1IL8 A;  3H0G G;  3X3M A;  2Z4I A;  3NEL A;  4A93 H;  2TSS A;  3H0G H;  2R3Z A;  1X65 A;  2FHT A;  5IT9 E;  2VXW A;  4FXG C;  3HOZ B;  3ERQ A;  1E24 A;  3NQT A;  3I90 A;  1LTT D;  2YTY A;  3GTQ B;  2HDM A;  1FR3 A;  4DV6 Q;  3AB9 A;  3GV6 A;  2ZJP A;  5ELD A;  1U5K A;  5GQO A;  4OX9 L;  1HJP A;  4BY1 H;  3T53 B;  4XQJ A;  1EU3 A;  1VQB A;  4DV3 Q;  1YI2 A;  4JBM A;  2L5T A;  4RGT A;  2NVX H;  5F2D A;  3EN2 A;  3G4S A;  4B9W A;  1PH5 A;  3H09 A;  2E2H B;  1ZKO A;  5IGG A;  2H1E A;  4UY8 C;  1PYS B;  3N6R A;  2R7D A;  3K8A A;  1A62 A;  4NDX A;  4FF4 A;  1JE4 A;  1E7Z A;  3EJI A;  4HAE A;  4GLX A;  3TRZ A;  3RLO A;  1SDF A;  4A3M B;  3HKZ B;  1EZ6 A;  2CCZ A;  1W2B A;  5KRU A;  1XJV A;  3JAM c;  4OWW B;  2L9H A;  2ICE C;  3V2T A;  2N49 A;  1HR0 L;  2PPB C;  3HOZ H;  2F0M A;  2MQH A;  3MFG A;  4Z9C B;  1L0X B;  3BU2 A;  1F2Y A;  1YHQ A;  2F0H A;  1G51 A;  3D3R A;  1I4P A;  1Y8P B;  1DXM A;  4LF8 Q;  5FLM H;  1STH A;  1B53 A;  3S14 B;  3H6M A;  3U4Z A;  2Q8R E;  3D8G A;  3VA5 A;  2YV5 A;  4R4O A;  1VQA A;  4PV1 C;  5FLX E;  4DAY B;  3UDF A;  1SLJ A;  3CU7 A;  4FXD A;  3BVM A;  2KCM A;  2R93 G;  1LO5 D;  4KD4 A;  2KA7 A;  1N36 Q;  4DR2 L;  1RCV D;  4KKT A;  5EQ0 A;  1I50 B;  4JW0 A;  3RD4 A;  2WB1 E;  3PF5 A;  1BO0 A;  1YNN C;  1A2T A;  3DM3 A;  1EY0 A;  1A63 A;  1VQC A;  5I2X A;  4KJO A;  4JI7 Q;  4XQN A;  4A3M H;  3NWT A;  2QEJ C;  1STB A;  1X3P A;  2MP1 A;  3PUX A;  4X62 L;  2A68 C;  1WTW A;  1XMO Q;  4RWS C;  3WOF A;  2RSO A;  3LWU A;  2R7Z B;  3DLL A;  4BXX H;  3R8B A;  1K73 C;  1GKH A;  4ODG A;  3A7L A;  3CQZ B;  4JC0 A;  4KJN A;  1W6J A;  3S14 H;  1F9P A;  1EOT A;  1B2T A;  3EFX D;  3GTK B;  3CME A;  2B2Y A;  1IBK Q;  1K3B C;  4FVM A;  5IP7 G;  1M90 C;  1MSG A;  1V1P A;  3K7A B;  4ILW A;  5JAV A;  3QB3 A;  1M1K C;  5DNF A;  3R2I A;  2ICI A;  3HOW G;  1CSQ A;  4CDF C;  2XRQ D;  3HOW H;  1ENF A;  2RKS A;  4BBS H;  3R2T A;  2K7V A;  3TP6 A;  4FYD A;  4BWG B;  1I50 H;  1ZYR D;  4E6I A;  5IOC A;  2LSS A;  2ASB A;  4AIM A;  4PMB A;  3J80 L;  2WAQ G;  2NZH A;  1SYG A;  1WTO A;  2XRS D;  1H9J A;  1BUV T;  2D9U A;  5KYL A;  5C0X G;  1H9M A;  1LTA D;  4KKS A;  2L4N A;  3K58 A;  1VQJ A;  4KTA A;  1LTI D;  2O2L D;  3NTI A;  4RHS A;  4JI4 Q;  4DF7 A;  1OXX K;  1TVX A;  3EQL C;  1DZ1 A;  3OW7 A;  4AYB G;  4YY3 Q;  4QQB X;  2K5W A;  3HRZ C;  4RKB A;  1VQ8 A;  3MAQ A;  3CQZ H;  3M9B A;  1WYD A;  4BY7 B;  1FGU A;  1SBB B;  5IY0 A;  4LF4 Q;  2O5J C;  5I9O A;  1TY0 A;  2J7Z A;  4JI1 L;  4CBV A;  4JYA Q;  3I3C A;  1IW7 D;  3NTH A;  3K80 C;  1SE3 A;  1LYL A;  1JE5 A;  1SNQ A;  2D5D A;  3TZD A;  2O4X A;  2Z6K C;  2KCC A;  4XIG S;  5CR3 A;  1N33 L;  3I4M B;  2ZXP A;  5G3L D;  4IZ8 A;  2QDL A;  2BE5 C;  3D6W A;  2EXZ A;  1CKN B;  2F3W A;  1DOL A;  4ZKB B;  2JA7 G;  1K8M A;  4DAY A;  4AQY Q;  2K14 A;  3CRK C;  3SGI A;  1VDZ A;  4K2L A;  1FD7 D;  3A8I E;  1TWC B;  4JOI A;  5CV9 A;  4GNX C;  2HHH L;  2E2J H;  3UE0 A;  1ASZ A;  2AKW B;  2KQ3 A;  1J6Q A;  1ILP A;  2NWG A;  3F1Z A;  2ENB A;  4DUY L;  4DV4 Q;  1NY4 A;  2CW0 D;  3URY A;  1IKM A;  4C3H G;  3RLN A;  1MJE A;  1VQ7 A;  5C4X B;  2EZV A;  3MXP A;  4GKK L;  4NP5 A;  4BY7 H;  4DR6 L;  4DUZ Q;  4HR7 B;  5LHY 1;  3CCL A;  1S5B D;  2AWN A;  2MJ8 A;  5ELB A;  4U67 3;  1EY9 A;  1HQM C;  3ULL A;  1NBW A;  2JA8 B;  1Y1V G;  3I4M H;  4A3F G;  5M3M G;  3FDT A;  3K5M A;  1Y14 B;  1YVC A;  1X3E A;  1Q12 A;  4NB3 A;  2F0V A;  1XXG A;  4GS3 A;  5JPN C;  4DV6 L;  3GTM B;  5M5X H;  4OGQ C;  2PQA B;  3ONA B;  3CC7 A;  1C0A A;  2B2W A;  5E3F A;  4DV3 L;  3HOX B;  1X54 A;  1O7Y A;  4B3S L;  1QZH A;  4CJ0 B;  4WJ4 A;  1I4Q A;  1Q8K A;  3MXG A;  2UUC Q;  1WCM G;  3WWV A;  3TSS A;  4HJ8 A;  2K75 A;  1BNZ A;  3S2H H;  3JAM E;  2B2U A;  4OHJ A;  3T16 A;  5C4X H;  4J6H A;  4TRD A;  5M3F G;  3NUC A;  4PMC A;  1KXL A;  2O5I C;  5C3E G;  1DYQ A;  3MZ5 A;  2NB0 A;  4X66 L;  3PO2 G;  2JA8 H;  3PMF A;  2B2T C;  4DV7 Q;  3T1H Q;  5M5W B;  2KVM A;  3PO2 H;  1N34 Q;  2ZTD A;  4A3D G;  2PW7 A;  1NR2 A;  3CW2 C;  1DON A;  5NUC A;  2MO1 A;  3GTM H;  4P73 A;  1UEB A;  4LF8 L;  3CCE A;  5EPJ A;  2NTT A;  2L1B A;  1D5M C;  3HOX H;  5IYB H;  2F0K A;  3K5O A;  4YCV A;  3MXU A;  2AUJ D;  4I7A A;  4YCW A;  4DV2 Q;  1ET9 A;  1KDA A;  1N8R C;  1BCP C;  3ULP A;  4LW1 A;  2M9V A;  2NZ1 D;  1PH4 A;  3HOY B;  1XMQ Q;  5IP9 G;  3BG3 A;  4CKB A;  1K0S A;  4H13 C;  1LAB A;  1YJ9 A;  3NHH A;  2AQ1 B;  4ZKC B;  4LUZ A;  4X6A H;  5C6A A;  2F3I A;  4MHE A;  4I7Z C;  2JA5 B;  3B6Y A;  4LFB Q;  1YNJ C;  2F0F A;  2HQE A;  2WKD A;  1A3T A;  3RN2 A;  2Z8L A;  3IKJ A;  1T5X D;  3U4V A;  1F9S A;  1B50 A;  4A3K B;  2FMM A;  1WOC A;  1F9Q A;  4IUP A;  2CH4 W;  2K5V A;  2EYJ A;  4ME3 A;  1B9N A;  2L11 A;  2VB3 X;  3I4L A;  4IUT A;  1IBK L;  4OX9 Q;  4IPH A;  1NCV A;  4MN3 A;  2K5Q A;  3UDI A;  2VUM B;  2F0O A;  1TS4 A;  1HZA A;  3I7F A;  4C3J H;  1M8A A;  3ND8 A;  3NBH A;  2QIL A;  2M00 A;  4DPG A;  1PH9 A;  2K5D A;  1IL2 A;  1PRT B;  2Q2I A;  4BBR B;  4P2C B;  3HOY H;  5FJ8 G;  1XNQ L;  2SOB A;  4IFD H;  3TP7 A;  5JJI A;  5CV5 A;  2PZU A;  1CKM A;  2YTX A;  5ELO A;  2F4I A;  1QUQ B;  1FNV A;  4NXN L;  1R9T B;  3W1G A;  1XPR A;  2JA5 H;  2K5N A;  5IYD G;  1HR0 Q;  1UWV A;  4XT1 B;  1R4Q B;  3T56 B;  1PLF A;  1MKH A;  3TS2 A;  2A5H A;  2G5D A;  2K32 A;  5FOB B;  1S3O A;  4C56 C;  2B29 A;  2RCN A;  3V05 A;  1EFW A;  3G6E A;  5E1F A;  4KLK A;  2I07 B;  3OMG A;  1CZG A;  3J81 L;  2KEN A;  3UI2 A;  1IKL A;  2RF4 A;  1AW7 A;  4K14 A;  3I73 A;  4CDD C;  2A6H D;  1KAB A;  2YU9 B;  1EYA A;  4DR2 Q;  4XYO A;  4BBR H;  2JJQ A;  1I4X A;  5G3L F;  2K05 A; 
#chains in the Genus database with same CATH homology
 4O1N A;  3TP8 A;  1PTO B;  3J80 E;  3IAY A;  1JOO A;  3VYR A;  1C8C A;  3H94 A;  3BYY B;  1G91 A;  1PTO C;  2MHV A;  3I8Z A;  3IL8 A;  4IUV A;  2CVR A;  5KND A;  1VCI A;  4K5V A;  1B3A A;  2F3V A;  3O13 A;  1S4Z A;  3L9A X;  3QIA A;  4ULL A;  2EDG A;  4V0B A;  4DA2 A;  4A3I B;  4IUN A;  1ENA A;  1DD2 A;  4DXG A;  1GUG A;  2A69 C;  2WB1 B;  1X32 A;  1GHJ A;  2RDH A;  1G8Z D;  2RSN A;  2XSC A;  2WP8 J;  3MXN A;  3Q22 A;  2OT2 A;  3VYS A;  1F77 A;  3TZU A;  1LT6 D;  1IW7 C;  1FGB D;  1I4G A;  1O80 A;  3GTG B;  1PTO H;  3T13 A;  4FF1 A;  1TS2 A;  1QCB D;  1B9M A;  2EJF C;  1ZEQ X;  2N88 A;  4OIK A;  3ND9 A;  4K8J A;  1HA5 A;  1AN8 A;  3D4D A;  4HMJ A;  4FF3 A;  1EIH A;  3SHL A;  5D3D A;  5K5P A;  1STY A;  3HP3 A;  3H91 A;  2C5C A;  4LMQ D;  4UAI A;  3N52 A;  3SXH A;  3KF8 A;  3H0G B;  3CKI B;  2A74 C;  5I9P A;  1E2V A;  1EY5 A;  4FP5 D;  1ENC A;  5EGT A;  1X3Q A;  1Z6H A;  1HTP A;  1VMC A;  4EVO A;  1D1I A;  1LT3 D;  2M2L A;  2MGS A;  1K8O A;  2FIN B;  1M4V A;  3HS0 C;  4TQU S;  1UAP A;  3FPU B;  1O7L A;  3W3A A;  3VYU A;  1QG7 A;  4XXE A;  3GP7 A;  1A3V A;  5CBA E;  4N9P A;  1GUW A;  1H9K A;  4G7H C;  4B9X A;  5A2Q L;  4KY7 A;  1HCZ A;  4QB4 A;  1MGS A;  3T4A C;  2FJ2 A;  1QOH A;  3Q24 A;  2GA4 B;  2HUG A;  3L3O C;  3Q6S A;  2XWJ B;  2B2V C;  4NW2 A;  4FNF A;  2HCI A;  2XNA C;  4XQQ A;  1O78 A;  3HEJ A;  3TDQ A;  3SR1 A;  1ICW A;  1F2M A;  2R93 B;  1SYD A;  2NVQ B;  2BOS A;  2AQ2 B;  1QE6 A;  1KAA A;  2EY2 A;  1H9S A;  3X3N A;  2OEO A;  3SDZ A;  1G6Z A;  1SJE D;  2A6E C;  1UEA B;  1LT5 D;  2F0W A;  3PIP 3;  3DM1 A;  4QUC A;  1ONL A;  5FK9 C;  3KLS X;  2EJM A;  2F0U A;  4F7X A;  4GZY C;  1Y69 U;  1VF7 A;  5M5Y B;  1D2B A;  4C3I G;  3NPP A;  1KNA A;  4IUU A;  1EWH A;  4DK1 A;  1EU4 A;  5DAU A;  2PNR C;  3A8K E;  3DWQ A;  3T51 B;  1CQF A;  3HOW B;  1L0Y B;  4BBS B;  1E2W A;  1MD2 D;  5M9O A;  1U4M A;  3RLF A;  5JVH 3;  1TKW B;  1SXT A;  2KEC A;  2WAQ B;  2EJG C;  4RA8 A;  1T5E A;  2JEB I;  5JJZ A;  1NAP A;  4HTH A;  3E0J A;  2R61 A;  2NN6 G;  5CYU A;  3NP8 A;  1C48 A;  5I6Y A;  3J81 E;  4UDU C;  3M7G A;  1DM0 B;  1NSN S;  2IX0 A;  2IX1 A;  2RBM A;  3QOJ A;  2JP1 A;  4KHZ A;  2JSO A;  2IX3 A;  2Q8T A;  3DXJ C;  4MIU A;  3GQB A;  2F0N A;  2BDO A;  2K33 A;  2JEA I;  1WTX A;  1Q1E A;  2K04 A;  1U4P A;  5IOD A;  1V8Q A;  1LLR D;  1CA6 A;  3GO5 A;  5A35 A;  2E2J B;  4NKL A;  1SMY D;  1PZI D;  2BA0 A;  2F0I A;  1LTS D;  5C0X H;  3KK7 A;  4DAP A;  3D4W A;  3OIQ A;  1AFP A;  4EQO A;  2AUK A;  5JVG 3;  2XVS A;  2NYZ D;  1Q90 A;  5EBD A;  4OIJ A;  3QO2 A;  4C3H B;  2SNS A;  2RVL A;  4HSP A;  1Y8N B;  3CHB D;  1WTR A;  4OO1 G;  2PQE A;  3FEW X;  2KJX A;  1Y1V B;  1CT1 D;  1A3U A;  1EL0 A;  5JOB A;  1NR4 A;  4Q0F A;  3C1F A;  1EY7 A;  5LL6 X;  5M5X B;  4ZK9 B;  4X3U A;  2A73 B;  4ZUI A;  2LFN A;  1JCK B;  4X3K A;  2IT1 A;  2YYZ A;  1WVL A;  4ZYS A;  3S2H B;  4DXF A;  1KDC A;  5AFW A;  3MTS A;  1EYC A;  4QIW B;  1HHV A;  1PFN A;  1WD0 A;  1TT2 A;  4KY6 A;  2DY8 A;  3G7L A;  1EWC A;  2VNU D;  1U4R A;  4CJ2 C;  3EA6 A;  2HDL A;  1E2Z A;  1ILQ A;  1TS5 A;  3MHB A;  1GHK A;  1EFI D;  3PIO 3;  3PO2 B;  1CZW A;  5EKL A;  1FYC A;  2HCC A;  5I4D A;  1F2Z A;  2K03 A;  4A3D B;  4JK1 C;  4J1M A;  1SND A;  3MFY A;  3A7A B;  2BA1 A;  2EYF A;  4DAV A;  2KUM A;  1SYF A;  2ZXR A;  4ID6 A;  1HFN A;  2EPB A;  4H7B A;  4F88 A;  1D6E C;  3RMH A;  3C1E A;  4KK7 A;  1Q1B A;  1D1K A;  4QCL A;  1TR5 A;  1G29 1;  4KMU C;  1BOS A;  4R8I A;  2B39 A;  1EIG A;  2X69 A;  1GUS A;  2MUY A;  4JBW A;  5A2Q E;  5T1G A;  3J7A V;  1GUO A;  3GTJ B;  2C9O A;  3SK8 A;  4XDX A;  4CGY B;  2QDB A;  1NUC A;  1CQV A;  1EY4 A;  3NTK A;  2KEE A;  4G7Z C;  1FNU A;  1ESF A;  5C0X I;  5JEA G;  1BCP B;  3DWP A;  1ZXT A;  4EGV A;  1STG A;  2BCO A;  4C3J B;  5ELE A;  2Z1C A;  3S1Q B;  4J8Q A;  5ELF A;  4FXK C;  3FRP B;  3BVZ A;  5C0X J;  5COR A;  2FFK B;  5IGB A;  2FMC A;  1GJX A;  3OSO A;  3ITP A;  5C5M A;  1HA6 A;  3TN2 A;  4DNR B;  1SAP A;  4HCS A;  2CHB D;  1PRT F;  3NK9 A;  3PUV A;  3VA7 A;  3J7Y W;  2RDF A;  2PYK A;  4IUQ A;  1Y8O B;  2LS0 1;  3DEO A;  1HUM A;  1CK1 A;  1KTK A;  3I91 A;  2WV6 D;  2DNE A;  3K59 A;  3MA2 B;  5K36 G;  5KNC A;  2EVB A;  3J7A F;  5DM7 3;  1RHP A;  1RTO A;  3NSW A;  3MC0 B;  2B8G A;  3SVM A;  1YNN D;  4KY5 A;  2R92 B;  4DFA A;  1SJH D;  3GTP B;  2A68 D;  2IL8 A;  3K57 A;  3QWN A;  5EBC A;  3ZYY X;  3G6J B;  3VR5 A;  3F2U A;  1ESR A;  1XYI A;  3NWS A;  1EQT A;  1O7Z A;  2VB2 X;  4V19 0;  4HN7 A;  1BF4 A;  3TP5 A;  4CKC A;  1V43 A;  1VMP A;  5EKK A;  1G2T A;  3DUZ A;  1BDO A;  1I6V C;  3FPP A;  1STA A;  3AU7 A;  4QUF A;  1LTB D;  2RA4 A;  3KBG A;  1A15 A;  1J8I A;  1SEB D;  2EY1 A;  2IWH A;  1MI2 A;  1ZYR C;  2V4D A;  5CC4 A;  1BQQ T;  4LAA A;  1UUP A;  1TWA B;  4H0L C;  5C3X A;  4Q5V A;  1TWH B;  2IJ0 A;  2J4X A;  1SMY C;  4DN4 M;  4ME5 A;  3C46 A;  3QOL A;  3TME A;  4WJW A;  4S3S A;  3A8J E;  4PMW A;  3D31 A;  3M4Y A;  4BA2 I;  1KDB A;  3NE5 B;  5FO9 B;  1GXD C;  2WIN B;  4F8M A;  1TU2 B;  2SDF A;  5E4W C;  2BE5 D;  3DHQ A;  3SK4 A;  1EZ8 A;  3HOV B;  4IN3 A;  3S1R B;  3BZD B;  4ZQ3 A;  1RD9 D;  1STN A;  1AZP A;  1PMR A;  3I72 A;  4WOR A;  1II3 A;  3C3L A;  5C3W A;  5KYI A;  3S1N B;  5E4X A;  2F0G A;  1RKN A;  3TBI B;  1JIC A;  2CW0 C;  3MVV A;  5C4Z A;  1V1O A;  3GTL B;  4LJZ C;  1PXU A;  1LTG D;  1SNO A;  1SE2 A;  2NTS A;  3V96 A;  3FKI B;  4A3B B;  4KN7 C;  4K8I A;  5CV4 A;  2WKC A;  2JYO A;  3E5S A;  4RGO S;  4RH6 A;  1D5X C;  3A55 A;  1SYE A;  1QJO A;  3M3Y B;  1C4Q A;  1KLG D;  3QJY A;  1OXS C;  3R93 A;  2KHS A;  4R8N A;  1IHZ A;  1HQR D;  1TWF B;  2KOL A;  5D14 A;  2NVY B;  4WRD A;  5DEH A;  4OL7 A;  1PZK D;  5KNB A;  1QNU A;  3LWE A;  4ABN A;  4WFN 3;  1Y1W B;  1RF2 D;  2XIW A;  2EY5 A;  3RZD B;  1DOK A;  1SYC A;  1SE4 A;  2EY6 A;  4C3I B;  1B1Z A;  4KD3 A;  1PDQ A;  2WII B;  1S5F D;  4CJ1 B;  4RGN A;  1AEX A;  1V1P B;  5CBE E;  1OXV A;  5J39 A;  3HOU B;  4DNT B;  2B2Y C;  1BCP D;  1S5C D;  5EPL A;  1BR9 A;  2AWO A;  2F03 A;  5FO7 B;  4K6D A;  3D4R A;  1TY2 A;  1SNC A;  2EOT A;  5HGT A;  3NQI A;  4QMG A;  2Y0S B;  1YNJ D;  4M1U B;  5I6W A;  3HGB A;  4HED A;  4N9T A;  2E2I B;  1HUN A;  3RZO B;  3D6C A;  3PUW A;  3P7J A;  2K01 A;  3S2D B;  3KLS A;  1EY8 A;  2RDG A;  1A6X A;  4KHV A;  5LL6 S;  1JQY D;  4G57 A;  3PO3 B;  2ZT9 C;  5KEE A;  1HXY D;  5CV7 A;  2IPK D;  4PQX A;  1HTL D;  1B4O A;  1JOK A;  1PZJ D;  1PRT D;  4RAU C;  3BYT B;  1QNK A;  2G9H D;  1GOZ A;  1BBX C;  4G7O C;  2KED A;  3IFT A;  3QG1 A;  3VYT A;  2F0D A;  1XX8 A;  4AYB B;  2F0Q A;  3GV3 A;  2NN6 H;  1KNE A;  2B2V A;  1AZQ A;  1K83 B;  2EYP A;  3Q23 A;  1H9R A;  1SNP A;  1VF5 C;  2H4O A;  1SFO B;  1F9R A;  2F0L A;  3CRL C;  1RDP D;  2DY7 A;  1JWU D;  4O42 A;  2A6H C;  1CA5 A;  2JA7 B;  3U9O A;  1Z7T A;  4C2M B;  4DGZ A;  5CMD A;  4NMZ A;  5EPK A;  1ET6 A;  1I4H A;  5C5L A;  3K5N A;  5CGK A;  1JR0 D;  2QCP X;  1PTO D;  5KGU A;  1TS3 A;  1CM9 A;  2LY7 A;  2B2W C;  4X3T A;  1CTM A;  4LK1 C;  4RKL A;  3OWF A;  2NUC A;  3BS1 A;  1PFM A;  2MPM A;  3OWE B;  2B2U C;  2F0J A;  4ZRZ A;  1GUT A;  2EYO A;  5IGD A;  3S15 B;  5D65 A;  3DWA A;  1QWY A;  3U9S A;  2A69 D;  4OO1 H;  2WAC A;  4HMI A;  4A3F B;  1Q3L A;  3P1H A;  5M3M B;  5C4H A;  5FKA C;  1WTP A;  2PMZ B;  1OXU A;  1MSH A;  1QB5 D;  3PUY A;  4K5X A;  1IYV A;  1U4L A;  1LV9 A;  3BDO A;  2NBF A;  5CV8 A;  1IYU A;  1Q8I A;  2X6G A;  1JOQ A;  3FVQ A;  2PZW A;  4B08 A;  2PZT A;  1WCM B;  4IUR A;  4ZUJ A;  4HSV A;  3GD7 A;  1OXT A;  3HG9 A;  2K1B A;  3SE0 A;  5M3F B;  2CQA A;  4G4K A;  1PFB A;  5ELC A;  2EYH A;  4X3S A;  1CFM A;  5C3E B;  5C4J B;  1DOM A;  2F1M A;  4RHR A;  4M8A A;  5ISR A;  4F87 A;  1JB3 A;  2K6A A;  3M85 A;  3H3V C;  2E76 C;  4RFB A;  4XYQ A;  2NVT B;  2F0E A;  4L8J A;  2DN8 A;  2NN6 I;  1G2S A;  3EVQ A;  4EQN A;  3LX0 A;  1EY6 A;  3KLR A;  4ZAI A;  1LTR D;  2JXM B;  1BCP F;  1LT4 D;  4RGM A;  3OOC A;  2OF1 A;  1WD1 A;  2PO4 A;  1JOR A;  5EJW A;  1RJT A;  4CKE A;  2IW3 A;  1DCZ A;  3PV0 A;  1MBY A;  1WTQ A;  3KBX A;  4H44 C;  1J9O A;  1U9R A;  3DMU A;  3OHX C;  3WDN A;  3A56 A;  3BDC A;  5IT9 L;  4DK0 A;  5JEA H;  5COY A;  1EYD A;  1Z47 A;  3L7Z C;  3OPO A;  3S9W A;  2EYL A;  4Y7N B;  2XN9 C;  1DJR D;  3MEH A;  4XTC S;  2G9D A;  4HCE A;  4A3G B;  2RQX A;  5D3I B;  4ZLT F;  3KUP A;  1HRJ A;  5J1Z A;  1F2L A;  4OO1 I;  5BN5 A;  2F0S A;  4R9W A;  3NXW A;  1XWE A;  2A6E D;  5BN3 A;  2J0T D;  2BDN A;  3DEP A;  2XWB B;  1SNM A;  5IGE A;  1I6H B;  3Q0A A;  1PYW D;  2EE1 A;  3A54 A;  4U68 A;  1UNS A;  1JWS D;  5J22 A;  3S17 B;  4TKO B;  5FO8 B;  4K6L A;  4IAL A;  5K36 H;  3OIP A;  5FLX L;  1KLU D;  2LMC B;  4C3J G;  4CHT B;  3I70 A;  2PCF B;  1CI3 M;  4KKU A;  2F0T A;  3C2P A;  1FNW A;  4KN4 C;  3M7N A;  4I65 A;  3IFD A;  3VR6 A;  3SK5 A;  1PTO F;  2B2T A;  4IFD G;  3ERO A;  1TQO A;  4KI0 A;  1OO9 B;  2AQ3 B;  1PRT C;  2Q8I B;  5KIX A;  2B63 B;  2E75 C;  3MWY W;  5TSS A;  1EEI D;  1WTV A;  1A2U A;  1D5Z C;  4A3J B;  1E0B A;  2B8F A;  2ID0 A;  1B44 D;  1LAC A;  5I2Y A;  3OMC A;  3BVG A;  3VR4 A;  2QF7 A;  4FF2 A;  1SYB A;  1AP0 A;  2N55 A;  3BDL A;  2L0C A;  4EQP A;  1RTN A;  2Z4H A;  2PW5 A;  1CHQ D;  5BN4 A;  3FMC A;  1HFG A;  4RCO A;  1TWG B;  3NBI A;  2K28 A;  1STE A;  2EYM A;  2L55 A;  2D62 A;  5DM6 3;  3S16 B;  1S5E D;  3GTO B;  5JEA J;  1GUN A;  5CV6 A;  1I3Q B;  3PUZ A;  4DU9 A;  2JA6 B;  1TII D;  3W2D A;  2TMP A;  1HPC A;  1CHP D;  3AMU A;  3P75 A;  1EQV A;  4C1N I;  4RCN A;  3E6Z X;  2DNC A;  1W6K A;  3VR2 A;  1ROD A;  3K0Y A;  4K5W A;  3M4O B;  5IIF A;  1R4P B;  2SNM A;  1H9S B;  3SEB A;  3LNN A;  2OXP A;  2QKI C;  2L12 A;  3S1M B;  4TSS A;  2R6G A;  5EKI A;  2ZXO A;  4YIJ A;  3SK6 A;  2E74 C;  1I4R A;  4IQZ A;  2I46 A;  2E2D C;  2JE6 I;  3K6O A;  2X6L A;  1BXT A;  4A93 B;  4KV6 A;  3HZX A;  4IFD I;  3I4N B;  4FO2 A;  2D2C C;  4A3E B;  4L63 B;  4BS9 A;  3VR3 A;  3WOE A;  3RUZ A;  1S5D D;  5IGC A;  4K2K A;  5JPM C;  1QIL A;  3P20 A;  4XT3 B;  1XTC D;  4BY1 B;  3K5L A;  5C44 B;  2F0P A;  1JWM D;  3R3O A;  4IFD J;  2NVX B;  3JAM L;  4QF4 A;  4BA1 I;  2LKV A;  1EEF D;  5IGF A;  1SSO A;  4PNY A;  4C1N K;  2SEB D;  1JC7 A;  2KCN A;  5HUR A;  1ML0 D;  4L6T B;  5T1I A;  1IL8 A;  3X3M A;  2Z4I A;  2TSS A;  2R3Z A;  2FHT A;  5IT9 E;  2VXW A;  4FXG C;  3HOZ B;  3ERQ A;  3NQT A;  3I90 A;  1LTT D;  3GTQ B;  2HDM A;  1FR3 A;  3AB9 A;  3GV6 A;  5ELD A;  3T53 B;  4XQJ A;  1EU3 A;  2L5T A;  4RGT A;  5F2D A;  4B9W A;  3H09 A;  2E2H B;  1ZKO A;  5IGG A;  2H1E A;  3N6R A;  4NDX A;  4FF4 A;  1JE4 A;  3EJI A;  4HAE A;  1SDF A;  4A3M B;  3HKZ B;  1EZ6 A;  5KRU A;  2L9H A;  2ICE C;  3V2T A;  2PPB C;  2F0M A;  3MFG A;  4Z9C B;  1L0X B;  1F2Y A;  2F0H A;  3D3R A;  1I4P A;  1Y8P B;  1DXM A;  1STH A;  1B53 A;  3S14 B;  3H6M A;  2Q8R E;  3D8G A;  3VA5 A;  4PV1 C;  5FLX E;  3CU7 A;  4FXD A;  3BVM A;  1LO5 D;  4KD4 A;  2KA7 A;  1RCV D;  4KKT A;  5EQ0 A;  1I50 B;  3RD4 A;  1BO0 A;  1YNN C;  1A2T A;  1EY0 A;  5I2X A;  4KJO A;  4XQN A;  3NWT A;  2QEJ C;  1STB A;  1X3P A;  2MP1 A;  3PUX A;  2A68 C;  1WTW A;  4RWS C;  3WOF A;  2RSO A;  3LWU A;  2R7Z B;  3R8B A;  4ODG A;  3A7L A;  3CQZ B;  4KJN A;  1W6J A;  1F9P A;  1EOT A;  1B2T A;  3EFX D;  3GTK B;  2B2Y A;  4FVM A;  1MSG A;  1V1P A;  3K7A B;  4ILW A;  5JAV A;  3QB3 A;  5DNF A;  3R2I A;  2ICI A;  2XRQ D;  1ENF A;  2RKS A;  4FYD A;  3R2T A;  2K7V A;  3TP6 A;  4BWG B;  1ZYR D;  4E6I A;  5IOC A;  4PMB A;  3J80 L;  1SYG A;  1WTO A;  2XRS D;  1H9J A;  1BUV T;  2D9U A;  5KYL A;  5C0X G;  1H9M A;  1LTA D;  4KKS A;  2L4N A;  3K58 A;  4KTA A;  1LTI D;  2O2L D;  3NTI A;  4RHS A;  4DF7 A;  1OXX K;  1TVX A;  3EQL C;  1DZ1 A;  3OW7 A;  2K5W A;  3HRZ C;  4RKB A;  3MAQ A;  4BY7 B;  1SBB B;  2O5J C;  5I9O A;  1TY0 A;  2J7Z A;  4CBV A;  3I3C A;  1IW7 D;  3NTH A;  1SE3 A;  2D5D A;  1SNQ A;  3TZD A;  2O4X A;  4XIG S;  2KCC A;  5CR3 A;  3I4M B;  2ZXP A;  5G3L D;  4IZ8 A;  2BE5 C;  3D6W A;  2EXZ A;  2F3W A;  1DOL A;  4ZKB B;  1K8M A;  4DAY A;  3CRK C;  1VDZ A;  4K2L A;  1FD7 D;  3A8I E;  1TWC B;  5CV9 A;  2KQ3 A;  1ILP A;  2NWG A;  2ENB A;  2CW0 D;  3URY A;  1IKM A;  4C3H G;  5C4X B;  2EZV A;  3MXP A;  4NP5 A;  4HR7 B;  5LHY 1;  1S5B D;  2AWN A;  2MJ8 A;  5ELB A;  4U67 3;  1EY9 A;  1HQM C;  2JA8 B;  3FDT A;  3K5M A;  1Q12 A;  2F0V A;  1XXG A;  5JPN C;  3GTM B;  4OGQ C;  3ONA B;  2B2W A;  5E3F A;  3HOX B;  1O7Y A;  4CJ0 B;  1I4Q A;  3MXG A;  3TSS A;  1BNZ A;  3JAM E;  2B2U A;  4OHJ A;  3T16 A;  4J6H A;  4TRD A;  3NUC A;  4PMC A;  2O5I C;  1DYQ A;  3MZ5 A;  2NB0 A;  3PMF A;  2B2T C;  5M5W B;  2KVM A;  2PW7 A;  1NR2 A;  1DON A;  5NUC A;  5EPJ A;  2NTT A;  2L1B A;  1D5M C;  2F0K A;  3K5O A;  3MXU A;  2AUJ D;  1ET9 A;  1KDA A;  1BCP C;  2M9V A;  2NZ1 D;  3HOY B;  3BG3 A;  4CKB A;  4H13 C;  1LAB A;  3NHH A;  2AQ1 B;  4ZKC B;  5C6A A;  4MHE A;  4I7Z C;  2JA5 B;  1YNJ C;  2F0F A;  2HQE A;  2WKD A;  1A3T A;  2Z8L A;  3IKJ A;  1T5X D;  1F9S A;  1B50 A;  4A3K B;  2FMM A;  1F9Q A;  4IUP A;  2EYJ A;  1B9N A;  2L11 A;  2VB3 X;  3I4L A;  4IUT A;  1NCV A;  4MN3 A;  2K5Q A;  2VUM B;  2F0O A;  1TS4 A;  1M8A A;  3ND8 A;  3NBH A;  2QIL A;  2M00 A;  2K5D A;  1PRT B;  4BBR B;  4P2C B;  2SOB A;  4IFD H;  3TP7 A;  5CV5 A;  2PZU A;  2F4I A;  1FNV A;  1R9T B;  4XT1 B;  1R4Q B;  3T56 B;  1PLF A;  2A5H A;  2K32 A;  5FOB B;  4C56 C;  3V05 A;  5E1F A;  2I07 B;  3OMG A;  1CZG A;  3J81 L;  3UI2 A;  1IKL A;  1AW7 A;  4K14 A;  3I73 A;  2A6H D;  1KAB A;  2YU9 B;  1EYA A;  4XYO A;  1I4X A;  5G3L F;  2K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...