3GTMH

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtmH00
2IX0A 3AQQA 4A75A 3OW2A 2K50A 3S1MH 2OQ0A 3T1YQ 1HR0Q 4NPSA 3KF6A 5LMUL 1Q86C 1PYBA 4C3HH 5IYBG 4LW1A 1IL2A 4DUYL 2JA5G 4JI4L 2JEBI 1EWIA 3E9HA 3UDIA 1KL9A 2CFMA 1EUJA 4K0KQ 1QZHA 1TWAH 3IRBA 3PSIA 2UUAQ 5H1SE 4KLKA 4LF4L 2AWOA 2E2HH 2R93G 4JV5Q 4LF8L 1VQJA 3HOYH 3HOZG 4LF9L 5IP7H 2BH2A 1PYSB 4BY1G 1QVGA 2B63H 2L15A 3KOJA 5EAYA 5BR8L 1H95A 1HNXL 5ELOA 4GS3A 3GDEA 3FKIH 3PIPA 4HIMA 2NN6I 4B3RQ 3PUVA 4R4TA 3U4VA 2WAQG 4A3KH 1V1QA 4DR2Q 3I7FA 4IFDI 1VQDA 1X3EA 3CXCA 3G6EA 2QEXA 4QY7A 1FJGQ 4UP8A 4DV0Q 3KF8B 1L1OA 1CKNB 4A3JH 1YJWA 1XPUA 4A3CG 3J81i 5M5YH 4HJAA 1Q82C 2YTXA 4NXNL 4JI2L 5JJIA 2QA4A 3CCLA 2LXJA 4JBWA 4JYAL 4BA2I 3GTKH 1X3GA 3S24A 4JI0L 2JE6I 2I5MX 1NMFA 1K9MC 4OONA 4X66Q 4DV6L 3RN5A 3I4MG 4DR1L 1JJGA 1IBKQ 3J7A5 1TWGH 2VW9A 2IX1A 4RG1A 4XTCS 2R92H 3CCMA 1Z47A 4IOAA 1GO3E 4TQUS 1FGUA 4X62L 4DV7L 1IBLQ 3HOWG 4FDBA 4A3MH 4JI3Q 3NEMA 4GKKL 4B3MQ 4GOPA 1N36L 4APVA 2UUCL 1I50H 4IPGA 4L5SA 3GTOH 2PMZE 1ASYA 2LXKA 1AH9A 2PI2E 1YI2A 4R4CA 3DLLA 2JQOA 1LYLA 1UE1A 1XTDA 5IE8A 4DV2L 3RNUA 1OTCA 2E5LL 3HOVH 4A3BG 1E7ZA 2MNAA 1YVCA 3I4OA 3GTMH 1LM0A 1X65A 2JJQA 1SN8A 4EQ5A 5IYBH 5C0XI 3PIOA 1YIJA 1NJIC 4NXMQ 4OO1G 2WB1G 1HJPA 5HGQA 1K8AC 1MJEA 3M4OH 2OTJA 4DR3L 1UE5A 4DR4L 2K52A 4IPDA 3K8AA 5GADC 1EQRA 3H3VH 1KRSA 4QQBX 3ULPA 1WJJA 1L2FA 3CMEA 1PH5A 4DV3Q 3WWVA 4HJ7A 1S72A 1PH9A 4LF7Q 2IHEA 2WFWA 3UE0A 1PH6A 1J5EQ 3W5OA 1M1KC 3HOZH 3K80C 4BY1H 1V43A 2PQAA 2YYZA 4LF5L 1YZ6A 1EIFA 3S1QH 4C3JH 1VQPA 3W1BA 3EIVA 1SMXA 2KCTA 1WFQA 1Q12A 4X65Q 1VQ9A 4GLAC 3HOYG 4DK3C 4OX9Q 5IP7G 2UXCQ 3S14H 4PMWA 2B63G 4JI1Q 4IOCA 2R6GA 3D31A 2WAQE 4IJLA 3FKIG 3KJPA 1QZGA 4R4OA 3T1HQ 4JC0A 4A3KG 1B70B 2RHQB 4L5RC 2R7FA 1KAWA 1K8GA 4DR6L 1VQBA 3UE1A 2ZJRA 1Y1WH 1C0AA 1PFSA 3MEFA 2NVXH 4A3JG 3H0GH 1E1TA 3I4MH 4JI7Q 4LFBL 4PG3A 1YJ9A 4JI4Q 4A3DH 3S1NH 2ALYB 1VQ8A 3CCQA 1N33L 3PF5A 1D7QA 1X9NA 1TWCH 1J6QA 2H5XA 3KDFB 1SR3A 1VQOA 4DAMA 3NELA 5LMNQ 2VQEQ 3RN2A 3ULJA 2JA8H 3CC7A 5GAHC 1CSQA 2QGQA 3CF5A 4LF8Q 1N9WA 2R92G 4YWLA 1I6HH 5JEAJ 4DR7Q 4DV1L 1WCMH 3LGJA 4A4IA 1ASZA 5HY6A 3S1RH 5M3MG 5GAEC 4A3MG 1HNXQ 3AFQA 2ZM6L 2ZJPA 4A3EG 3EBEA 3MXNB 3NBHB 1GM5A 2D0PA 4Y7NH 4YY3L 3F2BA 3CC4A 1XPOA 3AYHB 4AQYL 4IJHA 2Z0SA 2UU9Q 3HOVG 3RLOA 2OCEA 2WP8J 1UE6A 3K81C 1VQ5A 4A3LG 4JG2A 4NXNQ 4KI0A 3S16H 3FP9A 1BKBA 4AYBG 2HHHL 1V9PA 3M4PA 3E9IA 3PUZA 4LF6L 2I0QA 1PH7A 1E3PA 4JYAQ 1HNWL 5IWAL 4R1JA 1YHQA 1PH4A 1HNZL 4JBKA 1E22A 2FXQA 4DR1Q 2UXDQ 3FHWA 1OXXK 3RLNA 3ZJYC 2VQFL 3K7UC 4P74A 3RZOH 1QUQB 3CD6A 1SRUA 3PUWA 3J80i 1KRTA 1CKNA 1LUZA 3M4QA 5FJ8G 3ERSX 4DKAC 2A8VA 1N36Q 2UXBL 2UUCQ 1VQNA 3PGZA 1I5FA 1D8LA 4JI6L 1TWHH 3UDXA 1W2BA 1BBWA 3GTQH 3KYHC 1PA6A 4GKJL 2HIXA 3NENA 4DV2Q 5JJLA 4UPAA 5M5XH 3PF4A 1N32Q 3H15A 1IZ6A 1PH3A 1XNRQ 3GTPH 2DGYA 4DV4L 3S15H 1WYDA 1PVOA 1Q1BA 4R4IA 4UP7A 4HIOA 4YWKA 2A19A 4DR3Q 1JB7A 3CCSA 1Y1WG 2ID0A 3K7AH 2PI2A 1XMOL 1SLJA 4MZ9A 2KCMA 3PV0A 1YNXA 4WJ3M 1NBWA 3H0GG 3DM3A 3KF6B 3UDGA 4A3DG 3J81j 3CCUA 3I2ZA 3M9BA 1UE7A 1TXYA 1KQSA 2F52A 4GLXA 2LSSA 2N78A 1UEBA 1VQEA 1FVIA 3CCRA 1HH2P 1YHAA 4PZ6A 3J7ZC 1EFWA 4DV5Q 2NVYH 5M3MH 1HZCA 3PO2G 4DUZQ 3BZCA 4LNQA 3OTOQ 2JA8G 1M90C 4A3EH 3L2PA 5FLXc 1VQ7A 5AJ3Q 1K73C 2MFIA 3T1YL 1WCMG 3SGIA 3UDFA 3L7ZC 5C4XH 3HKZG 3RZDH 1VQCA 4A3LH 1S40A 4LFCQ 5C44G 3CPWA 2K75A 2VNUD 3CPFA 2E8GA 4DR6Q 1EIYB 4QIWE 1IBMQ 2UUBL 4IFDG 3HKSA 1OXTA 4OWTB 1Q8KA 4O0AA 1EQQA 5M5WH 3AEVA 3A5ZB 4AYBE 5E7NA 1JMCA 3TQYA 4JI8Q 1XMQQ 3TRZA 2AKWB 2AHOB 4P73A 4UP9A 3ICEA 3TS2A 1AE3A 5FJ8H 3S2HH 3B6YA 3CCEA 2F4VL 3M7NA 4JOIA 4JI5Q 4DV1Q 2I5HA 4GNXC 1Y1VH 5JEAG 4LFAL 3PUYA 2EXDA 3GTGH 1MKHA 2ZJQA 1I94Q 4O2DA 1Q81C 3KDFA 1RL2A 1HZAA 4H02A 4AQYQ 4IFDJ 4MNOA 1E1OA 1OXVA 4TVAB 1IBKL 3CP0A 4YHHL 4JBJA 2VY3A 2HHHQ 1G291 1N8RC 4RMFA 4LF6Q 2Z6KA 2JA9A 4GN3B 1BBUA 5LMUQ 5M3FH 1HNWQ 2K14A 4AIMA 4DUYQ 1E24A 3BJUA 3RLFA 3HOXH 4OXPA 1HNZQ 1IBLL 4JI3L 1CUKA 4POFA 4B3ML 1VQLA 4J15A 2OTLA 2DUDA 3HOUH 4BBSH 4OWWB 4UY8C 1SROA 3PO2H 4LF4Q 3STBD 1PH8A 3J81c 4GNXB 3F1ZA 4HIKA 4LF9Q 2VUMH 1N34L 4X64L 2E2JH 3JC66 2D0OA 2PQAB 3D0FA 5BR8Q 3CC2A 4JI6Q 3KFUA 4HJ5A 1KIXA 4GN4B 1Q1EA 4ME3A 3A5UA 3KJOA 5C44H 1OXSC 5IYDH 1JJCB 1IYJB 2JK8A 5J3BA 1YBYA 1I3QH 3HKZE 1X56A 1PH2A 4B3SL 2VZAA 4DV3L 3KLWA 3PCOB 2YTVA 1B7YB 1GVPA 5C4XG 2D62A 2KHJA 4L5QA 4JI2Q 1JT8A 1J5EL 2BA1A 2WB1E 1NE3A 5C0XJ 4AH6A 3A74A 4HIDA 2GVAA 4JI0Q 4P72A 2CQOA 2Q2HA 1O7IA 2ZTCA 4QGUA 5GAGC 5C4JH 4DV6Q 2B29A 3PO3H 4KHPL 2AMCB 5FLMH 4OX9L 1G51A 1C9OA 2N8NA 3L0OA 3JAMc 1PHJA 2MO1A 4C2MH 4X62Q 2A1AA 4DV7Q 1VQ4A 4WJ4A 2EIFA 3CCJA 5DLQE 1YHBA 4GKKQ 2R7ZH 2CCZA 1WI5A 2YTYA 2B3GA 2BA0A 4EX5A 2IHFA 1QVFA 3G4SA 2HIVA 2MQHA 1XNQL 1U5KA 1Y1VG 4DR5L 4A3IG 2E5LQ 4JI7L 2JA6H 4BY7H 4XIGS 4B3TL 2HT1A 4A3GH 3F2CA 5IYCH 1PH1A 2ZTEA 3AFPA 3PUXA 3I55A 2Q2UA 2UUBQ 4OWXB 4MTNA 1X55A 5LMNL 2VQEL 4DR4Q 1CKOA 1A8VA 2HQLA 1VS0A 2VL6A 1L1OC 3CMAA 3TREA 3M3YH 4DR7L 2ZTDA 5M3FG 4DK6C 1JJ2A 4LUZA 4A3FH 1CKMA 2Y0SG 1NMGA 2MO0A 3HOXG 4A93G 2CWPA 2N3SA 3BU2A 3EN2A 1U0LA 3CW2C 3W1GA 1R9TH 2F4VQ 2RF4A 5IP9G 4LF5Q 2K5VA 4OO1I 4BBSG 4BBRH 3BZKA 3HOUG 4POGA 3OYYA 1G6PA 3G48A 2UU9L 2OWOA 2RHSB 3GD7A 1K3RA 4LFAQ 5C3EG 4HJ9A 2ASBA 5LMNW 2VUMG 1B8AA 3VDYA 1HR0L 1X54A 1W3SA 2NZHA 1EYGA 4JCVE 1YITA 4X6AH 3GO5A 1GD7A 4GOPC 1C7YA 5IY0A 4BXXH 3U4ZA 5IYDG 2NN6G 3CAMA 2XGTA 2KENA 4YCUA 2K4KA 3U50C 2JA7H 4K0KL 2UXDL 4YHHQ 4Y52H 2UUAL 4P71A 1QVCA 1VQHA 4IO9A 1HZBA 3CQZH 1L1OB 4JV5L 4LFBQ 2R7DA 3Q8DA 2AWNA 1PV4A 1N33Q 2NVTH 3TS0A 4IPCA 3GTJH 3I56A 2IT1A 2YU9H 4JBMA 3CCVA 5GQOA 2CWAA 2PNHA 3RR5A 1HR0W 3I4NH 1S3OA 5K36G 4B3RL 3A0JA 3PO3G 2CKZB 4QL5A 2IY5B 5JJKA 4DR2L 1VCIA 5FLMG 4PZ7A 1N32L 1IXRA 3JAMi 1FJGL 1KD1C 3G71A 1KHIA 2OQKA 3STBC 4X64Q 4DV0L 1N34Q 1HZ9A 4C3IH 4ALPA 1XNRL 3S17H 4A3IH 1DGSA 1KXLA 4LUVA 2V1CC 2R7ZG 2ZM6Q 2NZOA 2N49A 5ELNA 5GROA 2JA5H 3S2DH 4JOIC 4GOPB 1VQIA 4YY3Q 1A0IA 2EQSA 1TWFH 1JE5A 1RIPA 4X66L 3U58A 1Y14B 3J80c 4B3SQ 1CSPA 2JA6G 4BY7G 2R93H 3K0XA 4GNXA 4A3GG 2C35B 3TEHB 5IYCG 1VQMA 4DNIA 4PZ8A 1LTLA 4YWMA 1SFOH 1BVSA 5IWAQ 5C0XG 2K5HA 1T9HA 1P16A 4DV5L 4A93H 1YEZA 4DUZL 1K83H 2GVBA 1P8LA 1X6OA 4KHZA 3OTOL 1VQAA 5IP9H 2VQFQ 4KHPQ 2K5NA 2Z6KC 1VQGA 4DPGA 2Y0SE 5AJ3L 4LWCA 1XJVA 2GN5A 4A3FG 1NY4A 3F2DA 2I5LX 2YV5A 4A3CH 1VQ6A 4A76A 5C3EH 4LFCL 3M85A 4NB3A 1KC8C 2XTIA 2Q2IA 2UXBQ 1VQKA 5IT9c 3GTLH 4BBRG 4NXML 1AE2A 3ULLA 1IBML 1A63A 2RCNA 1OXUA 1XNQQ 1Q46A 1MJCA 4LUOA 2ES2A 2Q2TA 1XPRA 2ATWA 3H3VI 4GKJQ 1GKHA 4DR5Q 2VS1A 1EOVA 3E0EA 4YCVA 1NTGA 1QUQA 1VQFA 4B3TQ 4JI8L 1XMQL 1K0RA 1Z9FA 1X3FA 4L5TA 4LF7L 4DV4Q 4DAYB 1Q7YC 4BA1I 1MIUA 3ER0A 1FL0A 3HOWH 4BXXG 1A62A 1SE8A 2JA7G 2BH8A 4YCWA 4GN5A 1XMOQ 4GLVB 4JI5L 4P75A 4R4QA 4X65L 4HJ8A 1WOCA 4IPHA 2JEAI 4A3BH 3F8TA 2NVQH 2KHIA 2UXCL 2F3IA 1UWVA 4JI1L 1L0WA 1I94L 3HFZB 2KBNA 1YJNA 4QJFA 2E2IH 3I4NG 3T1HL
chains in the Genus database with same CATH superfamily
3AQQA 3OW2A 2WB1B 4V0BA 1IL2A 2EYFA 3S1MB 3S16B 2L4NA 1QWYA 2DY8A 1ENAA 1KL9A 3E9HA 5JAVA 3NSWA 1TWAH 3IRBA 1YNJD 4RHSA 2Z6BA 4F8MA 4KLKA 4JV5Q 2N55A 1O7LA 4LF8L 1HUNA 3OHXC 1PFMA 5IP7H 2BH2A 1PYSB 4BY1G 5JJZA 4IURA 5BR8L 5J22A 5ELOA 5KIXA 3FKIH 2A5HA 4LK1C 3T53B 4CKBA 3T51B 1I6VC 3I7FA 1VQDA 2F0LA 2F0QA 3X3MA 3MAQA 4A3CG 1ZYRD 5M5YH 4JI2L 4NXNL 5JJIA 3QJYA 4XT1B 2FJ2A 3H94A 1LLRD 5E1FA 2JE6I 4RGTA 1U4PA 4X66Q 1IBKQ 1DZ1A 3HZXA 2MUYA 1Z47A 3VR2A 3NPPA 1FGUA 4X62L 3HOWG 4FDBA 2R92B 4NMZA 4JI3Q 4GKKL 1ZEQX 4GOPA 4L5SA 4IPGA 1A15A 1ASYA 3QIAA 1NNXA 4A3MB 3DLLA 1XTDA 5IE8A 3HOVH 2K33A 2A6ED 2L11A 5IGEA 1WTQA 3J7AV 1PZKD 1UNSA 3I4OA 2IL8A 4EQ5A 1B1ZA 1B3QA 4X3UA 4DR3L 1VF5C 4IPDA 1EQRA 4J6HA 3ULPA 1WJJA 2QCPX 1PH9A 4HJ7A 1S72A 1SXTA 2F0JA 1GOZA 3UE0A 1J5EQ 4BY1H 1EEFD 5I9OA 3EJIA 1JICA 5FLXE 4QUCA 1VQPA 1EWCA 3EIVA 4OEMB 2KCTA 1WFQA 4GLAC 5D14A 3A8IE 2A69C 2WACA 4JI1Q 4IOCA 3VA7A 2L0CA 2K6AA 2PZTA 4DAVA 3KJPA 1NR4A 5CORA 1EYCA 1LTBD 4RFBA 2RHQB 1KAWA 2X6GA 1VQBA 2AQ1B 1HXYD 3MEFA 5JPNC 4A3JG 1U4MA 3H0GH 1E1TA 2NVXH 1EU4A 1BCPD 1Y1WB 5CV6A 4LFBL 3LX0A 4A3DH 4JI4Q 2F0DA 1VQ8A 2ZT9C 1X9NA 1JCKB 3HOXB 2RDFA 3HS0C 3KDFB 5LMNQ 5CYUA 1K0SA 2VQEQ 2EJFC 1YNJC 3DHQA 5JEAJ 4F7XA 4DR7Q 4X3TA 4A4IA 1KDBA 5BN5A 1HNXQ 2ZM6L 1WCMB 4G4KA 1JORA 2SDFA 3NBHB 1GUOA 3S1RB 4YY3L 5C44B 1XPOA 4AQYL 4A3LG 2OCEA 1UE6A 5EKLA 4ZYSA 4AYBG 2HHHL 1ZYRC 5CV7A 2VB3X 1HNWL 1WTOA 4ULLA 4HN7A 5EKIA 3CU7A 1EU3A 5FO7B 3FHWA 3RZOH 3CD6A 1KRTA 4C1NI 3MXUA 5JEAH 3M4YA 2A8VA 1B53A 3PGZA 1QB5D 4JI6L 3NWSA 1W2BA 5IGCA 3OMGA 2RVLA 3KYHC 1W6KA 4GKJL 2L12A 5CV5A 3PF4A 2OF1A 3H15A 1EZ8A 2A6EC 1K8OA 1Q1BA 3FDTA 1FNVA 4A3GB 4HIOA 1MSGA 4YWKA 2A19A 3CCSA 3K7AH 1XMOL 4RAUC 1FGBD 1A6XA 2BE5D 4MZ9A 4WJ3M 3DM3A 3KF6B 3J81j 3CCUA 1UE7A 1TXYA 5C5LA 2SNMA 3IFTA 4GLXA 4H0LC 4DNRB 1FVIA 3CCRA 3J7ZC 1YHAA 4PZ6A 4DV5Q 4DNTB 3PO2G 4DUZQ 2JA8G 1M90C 5FLXc 4IALA 3A8KE 1PTOH 1EOTA 3L7ZC 3HKZG 4A3LH 4LFCQ 4GZYC 3CPWA 2VNUD 2K75A 4QIWE 5KRUA 1M4VA 5C4XB 2EOTA 1SNQA 3C1FA 4OWTB 4O0AA 1AEXA 4AYBE 3K59A 1D5ZC 4JI8Q 1XWEA 1BCPC 1RD9D 1S5ED 1ZKOA 1HQMC 2K7VA 2O4XA 4KTAA 4CGYB 1H9JA 3B6YA 3CCEA 2F4VL 1KTKA 1LTTD 2I5HA 1Y1VH 3PUYA 1CHPD 4C3IB 2ZJQA 1JOKA 4O1NA 1DYQA 3R8BA 1E1OA 1IBKL 4O42A 1GUSA 4M8AA 1A3VA 2VY3A 1SBBB 1TWFB 2EYPA 1BBUA 3DEPA 2IPKD 2K14A 3W3AA 4OXPA 1HNZQ 4JI3L 2L55A 2L9HA 1RHPA 4WJWA 3D3RA 4BBSH 3HOUH 4UY8C 3PO2H 1TS3A 1PH8A 3SK8A 3F1ZA 4LF9Q 2VUMH 5KNBA 3JC66 3KFUA 4HJ5A 1Q1EA 2NUCA 2PZWA 3HKZE 4I7ZC 3MEHA 3KLWA 2YTVA 1GVPA 3RMHA 1JT8A 1EY5A 1J5EL 1A3UA 1SYFA 2BA1A 2DNEA 2XSCA 4ZCKA 4HIDA 2CQOA 1Q8IA 4Q5VA 3HOWB 4XXEA 2ZTCA 4DV6Q 2B29A 2BE5C 2AMCB 4L8JA 3MTSA 3TBIB 1G51A 1QILA 2BCOA 5E4WC 3JAMc 1PHJA 3NP8A 2MO1A 4C2MH 4NDXA 5IT9E 3IKJA 1VQ4A 4WJ4A 2EIFA 2R7ZH 4EVOA 4RCOA 5G3LD 2K28A 4K5VA 2C9OA 1XNQL 3R93A 4N8X1 5IGBA 1HA5A 2FINB 4J8QA 1IHZA 2JA6H 4BY7H 4B3TL 1PH1A 1H9SB 3AFPA 3PUXA 1SNDA 1VF7A 5DAUA 5E4XA 1X55A 5LMNL 2VQEL 4B08A 2HQLA 5I2XA 2VL6A 3MFYA 4DR7L 5M3FG 2M00A 1O80A 4A93G 1O7ZA 3EN2A 3CW2C 4CJ1B 2RF4A 1GUTA 3BZKA 3P75A 4ZAIA 2RHSB 3GD7A 4BBRB 4HJ9A 4RWSC 1DOLA 3VDYA 1YITA 4K5XA 4GOPC 4HR7B 2Q8IB 4BXXH 2F0WA 2XGTA 2JA7H 4XDXA 2K4KA 4F88A 2JP1A 1PRTD 1VQHA 2CH4A 1TWGB 2LMCB 4LJZC 4DU9A 3GTJH 2YU9H 3CCVA 2CWAA 1E0BA 4OIKA 1SJED 5K36G 2NVTB 4B3RL 1O78A 3A0JA 3QO2A 3PO3G 3GTOB 1SNPA 1IXRA 4TSSA 3JAMi 1FJGL 1N34Q 2OQKA 3S17H 2HQEA 1AFPA 2V1CC 2JA5H 1LO5D 1LTGD 5AFWA 1VQIA 3J81L 4FP5D 3U58A 5IGFA 2FHTA 4C3HG 3C1EA 4GNXA 1OO9B 2C35B 3L9AX 1HTPA 2IX3A 3KBXA 1SFOH 4YWMA 1PFNA 5IWAQ 5C0XG 2K5HA 1ET9A 4DV5L 4A93H 2KUMA 4DUZL 1P8LA 1U4RA 1VQAA 2VQFQ 4KHPQ 4DGZA 4LWCA 1XJVA 1NY4A 3F2DA 2YV5A 4A76A 4G7HC 1KABA 4LFCL 1KC8C 3BS1A 3AMUA 3DWQA 5IT9c 3D4WA 1AE2A 2IWHA 1OXUA 1Q46A 3TSSA 5CC4A 1TVXA 3E0EA 4YCVA 2HDLA 4JVZA 1VQFA 4JI8L 4ZUJA 4L5TA 4H44C 4DV4Q 3NXWA 1Q7YC 3I70A 2BH8A 4YCWA 5CMDA 4K6LA 2C5CA 5EKKA 3MVVA 3NTKA 4WORA 2XN9C 1I6HB 2LS01 3OWEB 2F3IA 2IJ0A 3MHBA 2KBNA 4A3BB 3HKZB 1YJNA 1A2TA 2IX0A 4Y7NB 4A75A 3S1MH 2OQ0A 3T1YQ 4NPSA 1ENFA 1Q86C 4C3HH 5COYA 5EPJA 4ZK9B 1VMCA 3MA2B 1EUJA 3BZDB 3DWAA 5LL6X 3PSIA 3X3NA 2UUAQ 2MHVA 2R93G 4LMQD 4L6TB 3HRZC 1PRTC 1VQJA 3HOZG 4LF9L 1LT5D 3N6RA 2B63H 2L15A 4C3JG 1Q3LA 1HA6A 3HOYB 2EY6A 3I4LA 1BNZA 3PUVA 3U4VA 3SXHA 4IFDI 1TWHB 1EYAA 2ZXOA 1X3EA 4RA8A 3GTQB 3KF8B 4A3KB 1XPUA 3J81i 5KYIA 5M5XB 2YTXA 2KCNA 2QA4A 3CCLA 4JBWA 1C4QA 3GTPB 4BA2I 3GTKH 1X3GA 4OONA 4DV6L 5CV4A 4DR1L 3FVQA 3LWEA 3D8GA 4XTCS 2R92H 1KDCA 2F0PA 1HFGA 4CJ0B 2PNRC 3CCMA 4IOAA 4A3MH 3PMFA 5KEEA 4B3MQ 1EQTA 1N36L 1V1OA 1S5DD 1T5EA 4CDDC 1AH9A 1X3QA 2PI2E 1YNND 4R4CA 2JQOA 1I50B 1LYLA 4A3EB 1OTCA 3ITPA 1IKLA 1PTOD 3VR4A 1E7ZA 2MNAA 1ILQA 5ELCA 4F87A 3RZDB 1SN8A 1CHQD 1Y8OB 3DM1A 4XYQA 1STGA 1UE5A 2K52A 3Q22A 4QQBX 1C8CA 1BXTA 4CKEA 3CMEA 1ML0D 3WWVA 4EQNA 1PH6A 2G9HD 3BDOA 3HOZH 1V8QA 2PQAA 3S1QH 1ET6A 4C3JH 1STNA 5IODA 3S2HB 1Q12A 4X65Q 1F9QA 1HPCA 5D3IB 4DK3C 2UXCQ 5IP7G 3S14H 4PMWA 2R6GA 3D31A 1RJTA 2E74C 3FKIG 3T1HQ 5DM73 1SYCA 3GTGB 1B70B 3I8ZA 2R7FA 1Y1WH 1PFSA 4JI7Q 4PG3A 3D6CA 3PF5A 1LT3D 4XQNA 1J6QA 3H09A 5F2DA 3GV3A 3NE5B 4HCEA 5I9PA 3ONAB 1F2MA 4BWGB 3RN2A 3L3OC 3SVMA 1CSQA 4DV1L 1WCMH 3LGJA 2FFKB 1ASZA 3S1RH 5M3MG 1LT4D 2EYLA 2MP1A 3MXNB 2D0PA 3F2BA 3CC4A 2TSSA 3HOVG 2Z0SA 5NUCA 2WP8J 1VQ5A 4CDEC 4JG2A 4NP5A 1I3QB 1WTHA 3VR3A 3FP9A 1BKBA 4LF6L 4JYAQ 2I0QA 4DN4M 1PZJD 1NUCA 1SYBA 4R1JA 5IWAL 4UHVA 4JBKA 1E22A 2FXQA 3ZJYC 2VQFL 5I6YA 1QUQB 2A74C 5C4HA 5KNDA 5E3FA 2EYJA 2F0KA 4FXGC 4ID6A 3ERSX 1TU2B 4DKAC 2Z4HA 2PQEA 3TP8A 2UUCQ 3SEBA 1LTID 1BBWA 5JVH3 5J39A 4IUQA 1PA6A 1BUVT 2HIXA 4DV2Q 5JJLA 4UPAA 1YNNC 4WRDA 4H13C 1N32Q 2V4DA 1KAAA 1PTOC 2DGYA 4DV4L 1QOHA 3S15H 2PPBC 3C2PA 4FXDA 1JB7A 1CQFA 5ELFA 2PI2A 5EPLA 5CGKA 1SLJA 1Y8NB 1YNXA 1Q90A 3H0GG 4PMCA 4A3DG 2EYHA 3M9BA 2H1EA 1KQSA 2LSSA 5M3MH 1HZCA 1R9TB 1GHJA 3OTOQ 3L2PA 1K73C 2MFIA 2NVYB 3U9OA 3T1YL 3UDFA 4KKUA 1CI3M 5C4XH 1VQCA 4U68A 1S40A 4DR6Q 2BDOA 3S9WA 4KY6A 1IBMQ 2UUBL 4IFDG 3HKSA 1OXTA 4KJNA 2WKCA 1HTLD 2RA4A 3V2TA 5M5WH 3SHLA 1MD2D 1XMQQ 1JWSD 5M9OA 2AHOB 2EPBA 2PO4A 3DEOA 3I90A 2NTTA 2R3ZA 1TS2A 1L0YB 4NW2A 1EFID 4GNXC 5C3XA 5JEAG 3CRLC 2EXDA 3E3XA 3I91A 3TDQA 4DAYA 4A3IB 4O2DA 4QCLA 3KDFA 3S2DB 4IFDJ 1OXVA 1IYVA 4FVMA 1D5MC 3NTHA 2L5TA 5IGGA 1G291 1ESFA 3R2TA 4RMFA 5LMUQ 4OL7A 2R93B 3BJUA 4B3ML 1VMPA 4J15A 3T13A 1KDAA 1BO0A 1EEID 2KEDA 1WTWA 1GHKA 4HIKA 4FXKC 4KKTA 1V1PA 2HCCA 4X64L 3TP7A 3CC2A 4TRDA 1KIXA 5C3EB 1S5BD 1IYUA 3A5UA 3KJOA 1OXSC 5FO8B 5IYDH 3BVGA 5HGTA 4MIUA 3J80E 2JK8A 5J3BA 1YBYA 4IFDH 3PCOB 1B7YB 4L5QA 3LWUA 1SE2A 1NE3A 1A3TA 4IZ8A 4AH6A 4JI0Q 3T4AC 2Q2HA 4QGUA 3AU7A 5C4JH 2NBFA 5FLMH 2XRQD 3CCJA 3J7AF 4KV6A 4DF7A 4TKOB 2CCZA 2YTYA 2B3GA 3HP3A 4EX5A 2IHFA 3G4SA 2HIVA 1U5KA 1Y1VG 3BG3A 4DR5L 4JI7L 1U9RA 1TS4A 1QG7A 5IYCH 1G2SA 3A7AB 2MPMA 2NYZD 5FLXL 1E2WA 4OWXB 4MTNA 2B8FA 2XRSD 3NWTA 1SNOA 3DUZA 1A8VA 2IW3A 2RSNA 1TWAB 4OHJA 3TREA 3M3YH 2Y0SG 5DNFA 3BU2A 4K8IA 5ELDA 4LF5Q 5IP9G 4A3FB 1EY8A 4BBSG 4BBRH 3HOUG 2L1BA 2F0MA 3OYYA 1G6PA 3FPPA 1D6EC 2J0TD 1K3RA 4LFAQ 1Z6HA 2ASBA 3K5NA 3W2DA 2VUMG 1B8AA 2F0UA 1EYGA 5J1ZA 4X3SA 5L37A 2F0OA 1C7YA 4ZRZA 3CAMA 4YCUA 2PCFB 4YHHQ 2JXMB 4P71A 1HZBA 1L1OB 4JV5L 3K5MA 1MHWC 2NVTH 3CQZB 1II3A 4IUNA 4QMGA 4JBMA 2PNHA 2B2YC 2CKZB 4QL5A 2IY5B 5JJKA 3I4NB 1N32L 1KHIA 2QKIC 2HUGA 4U673 4LUVA 1XX8A 2R7ZG 5GROA 2B2VA 2EE1A 1AP0A 1BDOA 1RIPA 4X66L 4B3SQ 1Y14B 1PMRA 3J80c 1CSPA 1KLUD 2JA6G 4BY7G 3TEHB 1VQMA 4PZ8A 1LTLA 1LACA 1K83H 4KN7C 4BY1B 3OTOL 1X6OA 5IP9H 2Z6KC 4K8JA 4B9WA 2Y0SE 3QOJA 3EROA 4MHEA 3Q6SA 2OXPA 1EY6A 2UXBQ 1I4PA 2A6HD 1IBML 3TP6A 2RCNA 1A63A 2EXZA 1G91A 1RCVD 1C48A 2ATWA 3JAML 1GKHA 3GTLB 2VS1A 1XMQL 1QCBD 1Z9FA 3H0GB 1BBXC 1MIUA 4BXXG 1A62A 1SE8A 1SYGA 2JA7G 2ENBA 4GLVB 4DXFA 4P75A 4R4QA 3WOFA 4HJ8A 4QB4A 1WOCA 4A3BH 2NVQH 2KHIA 4JI1L 3KUPA 1L0WA 2M2LA 2E2IH 2F0SA 2SOBA 3C3LA 2EYMA 4ZLTF 2K50A 3NBIA 3MXPA 1FNWA 2NB0A 1HR0Q 5LMUL 1PYBA 5IYBG 2XWJB 3K57A 2JA5G 4JI4L 4C56C 4K0KQ 1QZHA 4KY5A 5H1SE 4KY7A 5FK9C 2SEBD 3OIPA 1E2ZA 3RZOB 3HOYH 4IN3A 1QVGA 2E2HB 2N88A 1H95A 3M7GA 4R9WA 1HNXL 5D65A 3GDEA 3T16A 4B9XA 2NN6I 3N52A 2D2CC 1GXDC 2WAQG 3BYYB 1V1QA 3KBGA 4DR2Q 4A3KH 2O2LD 3CXCA 1GUGA 3G6EA 2QEXA 4QY7A 4DV0Q 1XXGA 1CKNB 1YJWA 4HJAA 3CKIB 1SYEA 5ELBA 4A3JB 1STBA 4JI0L 1NMFA 1CZGA 1K9MC 3LNNA 3RN5A 3I4MG 2JYOA 2EY5A 3J7A5 2VW9A 2IX1A 1STEA 1GO3E 4L63B 4BS9A 3ND8A 5EBCA 1NR2A 1PXUA 1DD2A 1I50H 2LXKA 2EYOA 3G7LA 1UE1A 5KNCA 4FF3A 4QIWB 3BYTB 1QE6A 1LM0A 2JJQA 4IUTA 5IIFA 5IYBH 3PIOA 1YIJA 4NXMQ 1NJIC 1ICWA 2WB1G 5HGQA 1MJEA 1K28A 4AYBB 3GTMB 3A55A 5GADC 3H3VH 1CA5A 1KRSA 3E0JA 2FMCA 4FNFA 1D1IA 3M4OB 5KYLA 4LF7Q 4UDUC 5IT9L 1F77A 1D5XC 4HSPA 2WFWA 1MSHA 3W5OA 1F9RA 1JC7A 4LF5L 2DJFC 4RKLA 3E5SA 2K03A 2NWGA 1SMXA 2AUJD 3NTIA 1VQ9A 3KLSX 4OX9Q 1DXMA 1B9NA 2B63G 1Y1VB 1ENCA 2WAQE 4FO2A 4IJLA 1QZGA 4R4OA 4JC0A 1B2TA 5CBEE 4KD3A 1K8GA 2JN4A 1C0AA 3I4MH 1F9SA 1YJ9A 3MZ5A 3S1NH 2ALYB 2WV6D 2K5WA 4JW0A 3NQTA 2H5XA 1SR3A 1VQOA 2AUKA 4DAMA 1EIHA 1PLFA 1JWMD 1TWCB 1RKNA 1RODA 1SE4A 2QGQA 1N9WA 3CF5A 4LF8Q 4YWLA 2R92G 3HOUB 5CV8A 2EY1A 3PO2B 2JA8B 4KKSA 2RDHA 5HY6A 5GAEC 4A3MG 4XT3B 2WIIB 3FPUB 2K01A 5CR3A 1GM5A 4IUUA 2F0GA 2XIWA 2UU9Q 4IJHA 4NXNQ 3S16H 1UUPA 2QEJC 1V9PA 1PH7A 2KVMA 1YHQA 3WDNA 2B2UA 1Y8PB 1HNZL 1GJXA 4DXGA 3H6MA 2UXDQ 1OXXK 1STAA 1HFNA 3K7UC 4P74A 4IQZA 1ZXTA 1SYDA 1PZID 5A2QE 2KHSA 4RH6A 2UXBL 2B39A 4HMJA 4C2MB 1HQRD 1VQNA 1I5FA 1SNCA 3UDXA 3VR6A 1BF4A 2X6LA 4KK7A 3BVZA 1IZ6A 1PH3A 2DY7A 1PVOA 4BY7B 4UP7A 3BVMA 2LY7A 1W6JA 4DR3Q 1Y1WG 2CH4W 2KCMA 3PV0A 2KECA 2O5IC 3MFGA 1X32A 3K6OA 2EZVA 4QF4A 1BCPF 1S5FD 2F52A 3EA6A 2E76C 2N78A 4N9PA 1HH2P 3P7JA 1EFWA 2NVYH 3BZCA 1VQ7A 5AJ3Q 1WCMG 3D4DA 5C44G 5TSSA 2F0VA 2RDGA 2E8GA 2WKDA 2BOSA 1EQQA 4RGNA 3A5ZB 5E7NA 4CKCA 1BR9A 3GV6A 1JMCA 1ILPA 5CBAE 2B2YA 1EYDA 2AKWB 2SNSA 3ICEA 3TS2A 1AE3A 4CJ2C 1RDPD 1F2YA 2B2VC 5IGDA 3M7NA 3GTJB 3ND9A 2YU9B 2K32A 4JI5Q 2RSOA 1JB3A 2CW0D 3TZDA 1HUMA 1I94Q 1DONA 3D4RA 1RL2A 4H02A 1FD7D 2WINB 4AQYQ 4MNOA 4TVAB 1S5CD 2X69A 5KGUA 1FR3A 4JBJA 2HHHQ 1D7QA 2Z6KA 4GN3B 4DK0A 1HNWQ 4DUYQ 1E24A 3HOXH 1BCPB 1B9MA 5BN4A 2F03A 1CUKA 4POFA 1SFOB 4ZUIA 3TP5A 5M3FB 1VQLA 4KMUC 4ODGA 5LL6S 4A93B 4OWWB 4LF4Q 1STYA 3BDCA 4RGMA 3IFDA 1EY4A 1N34L 1S4ZA 2PQAB 4JI6Q 1QNUA 2AQ2B 4ME3A 2QDLA 1AZQA 4YIJA 1LTAD 5C44H 2E2JB 1JJCB 2NN6H 1IYJB 3G6JB 2ZXRA 1X56A 2I46A 5K5PA 5C4XG 2D62A 2KHJA 3AB9A 3I72A 1M8AA 3A74A 3MC0B 3DWPA 2A73B 5T1GA 5FKAC 5GAGC 2P5ZX 4KHPL 1X3PA 4DA2A 5ISRA 4OX9L 4HMIA 2ICIA 3PO3B 3A8JE 4DV7Q 1QNKA 1WD0A 1YHBA 5I2YA 1AW7A 1H9RA 2Z1CA 4Z9CB 2BA0A 3D6WA 1EQVA 4C3IG 1F2LA 2E5LQ 1SSOA 3K58A 1A2UA 4A3GH 2RKSA 1B50A 2ZTEA 4C3HB 2Q2UA 2EY2A 1AZPA 3K5OA 2F3VA 5C3WA 4DR4Q 1CKOA 5EGTA 3KLSA 4K14A 2XWBB 1JJ2A 4LUZA 4A3FH 1NMGA 1R4PB 2FMMA 2MO0A 2CWPA 2N3SA 1E2VA 1CA6A 3W1GA 1U0LA 2F4VQ 2B63B 1TY2A 4OO1I 4POGA 5EBDA 3G48A 2UU9L 2OWOA 2GA4B 2OT2A 1WTPA 2DNCA 2CW0C 1W3SA 4ZKCB 1GD7A 1MBYA 5IY0A 1KNEA 5IYDG 3U50C 3FRPB 3GTKB 2UXDL 2XNAC 2UUAL 1SDFA 4CDCC 4PMBA 1QVCA 2E75C 4IO9A 3CQZH 4RGOS 2Z8LA 1SAPA 1N33Q 1TIID 2BDNA 1TT2A 3TS0A 4IPCA 3I56A 2B2WA 2EDGA 3RR5A 1EY0A 1HR0W 2D9UA 1S3OA 3I4NH 2G5DA 1CQVA 3MXGA 1VCIA 2B2TC 5FLMG 4PZ7A 1NCVA 3FEWX 3VYUA 2NZ1D 1HZ9A 4C3IH 4ALPA 2KQ3A 1DGSA 5EJWA 3TMEA 2DJGC 2F0IA 2NZOA 2N49A 1WTRA 4JOIC 4GOPB 4DAPA 1TWFH 1JE5A 5G3LF 1EY9A 5JPMC 4WFN3 2G9DA 5IYCG 1BVSA 1T9HA 1P16A 2RCFA 4OIJA 1YEZA 4DK1A 3HOZB 2GVBA 4KJOA 3NBHA 2K1BA 3S1QB 2K5NA 4CDFC 5AJ3L 1VQGA 4DPGA 4C3JB 1EL0A 2ZXPA 2GN5A 2KA7A 4A3CH 4I7AA 3V05A 1VQ6A 3S14B 4NB3A 4KN4C 2Q2IA 3VR5A 3GTLH 4BBRG 3P20A 5C5MA 1XNQQ 2F0NA 1MJCA 2ICEC 2Q2TA 3H3VI 2HDMA 3OW7A 5LHY1 5FO9B 1NTGA 4B3TQ 1JWUD 4K2KA 1IW7D 5CV9A 2VB2X 4DAYB 2K04A 1I4XA 3ER0A 1L0XB 1FL0A 4BA1I 3HOWH 2K05A 3K5LA 2I07B 1KNAA 2DN8A 4JI5L 4X65L 2JEAI 1PRTF 3F8TA 2UXCL 1B4OA 2B2UC 1TQOA 1I94L 1WVLA 4QJFA 3GP7A 3T1HL 5I4DA 1HCZA 1D2BA 3KF6A 1V1PB 1JE4A 1O7YA 4LW1A 4DUYL 2Q8TA 4J1MA 2JEBI 1EWIA 3UDIA 2CFMA 4K2LA 5C6AA 1TS5A 4LF4L 2AWOA 2E2HH 3NUCA 1B44D 3HG9A 1FYCA 3KOJA 5EAYA 3ZYYX 4GS3A 3PIPA 4HIMA 4B3RQ 4R4TA 3PIO3 3FKIB 1FJGQ 2E2DC 4UP8A 4G57A 2B8GA 1L1OA 4A3JH 2F0EA 1Q82C 5JOBA 1I4RA 4G7ZC 2LXJA 1T5XD 5EPKA 4E6IA 4JYAL 3S15B 3S24A 4EGVA 5M5YB 2I5MX 4I65A 2QILA 3T56B 1JJGA 3JAME 3OWFA 1TWGH 4C1NK 4RG1A 3H3VC 5HURA 2RQXA 2O5JC 4TQUS 1PRTB 1D1KA 4DV7L 1IBLQ 2QDBA 3WOEA 3NEMA 4APVA 2UUCL 3GTOH 2PMZE 3J80L 2LFNA 5M3MB 2HCIA 1YI2A 4KD4A 3SK6A 4DV2L 3RNUA 2E5LL 4A3BG 4X3KA 4ABNA 1YVCA 4FF1A 3GTMH 3HOVB 1X65A 5C0XI 1LTRD 1FNUA 1SJHD 4OO1G 1HJPA 4UAIA 4HCSA 1K8AC 3M4OH 2OTJA 3F2UA 4DR4L 3H91A 3K8AA 1CFMA 1L2FA 1I4HA 5T1IA 5M5WB 1PH5A 3OSOA 4DV3Q 4FYDA 2IHEA 1IW7C 1M1KC 3QOLA 1PDQA 3K80C 1V43A 2YYZA 4NKLA 1YZ6A 1EIFA 4XQQA 3W1BA 4IUPA 1XTCD 3HOYG 3RD4A 4JK1C 4XQJA 3P1HA 1G6ZA 4A3KG 4L5RC 4DR6L 3DMUA 1TY0A 2NTSA 4P2CB 3URYA 1K8MA 3UE1A 2ZJRA 2KOLA 2QW7A 1RTNA 3PQIA 1I4QA 2F3WA 4G7OC 3A7LA 1SE3A 2J4XA 3CCQA 1N33L 2NVXB 1TWCH 4A3DB 3U9SA 3EVQA 3NELA 3NQIA 3A56A 1IL8A 3ULJA 2JA8H 2TMPA 5GAHC 3CC7A 1I6HH 3QB3A 3AFQA 2ZJPA 1H9SA 3CHBD 3NHHA 3EBEA 4A3EG 1CTMA 1TKWB 4K6DA 4Y7NH 4OO1H 1TR5A 3AYHB 5FOBB 3DXJC 3RLOA 3K81C 1RF2D 4KI0A 3M4PA 3E9IA 1PYWD 3PUZA 1PTOF 1E3PA 5C4ZA 1PH4A 4DR1Q 3RLNA 5D3DA 1SRUA 3PUWA 3J80i 3J81E 5C4JB 1CKNA 1LUZA 3M4QA 5FJ8G 3MWYW 3OOCA 3K0YA 5EQ0A 1N36Q 1D8LA 1K3BC 1TWHH 2EJGC 1Y69U 1GUNA 3GTQH 5I6WA 2K5QA 2F0HA 1QJOA 3NENA 2LKVA 5A35A 3Q23A 1BQQT 2KEEA 5M5XH 1I4GA 1EWHA 1XNRQ 3GTPH 5ELEA 1CZWA 2MJ8A 1WYDA 3VYSA 4R4IA 2J7ZA 2QF7A 2Z9HA 2ID0A 1F2ZA 4HSVA 1NBWA 1JOQA 2D5DA 1WD1A 3K7AB 3UDGA 2AQ3B 3I2ZA 3M3YB 2F0FA 1UEBA 1VQEA 1R4QB 3C46A 4PNYA 3EQLC 1LV9A 1SMYD 4LNQA 1JR0D 4CHTB 4A3EH 3SGIA 3O13A 1SNMA 2F1MA 5JVG3 3RZDH 1DJRD 3OPOA 1MGSA 1PTOB 2B2WC 2A68D 3CPFA 1EIYB 1SEBD 4ZQ3A 1Q8KA 2A6HC 3AEVA 3Q24A 1LABA 3TQYA 3R2IA 4N9TA 3TRZA 2B2TA 4HAEA 2PMZB 4P73A 4UP9A 3QG1A 5FJ8H 4LAAA 3S2HH 3RUZA 1DOMA 3CRKC 2MGSA 4JOIA 3QR8A 3R3OA 4DV1Q 4H7BA 4LFAL 4HTHA 3SDZA 3GTGH 1MKHA 2PW5A 1Q81C 4FF2A 1HZAA 1UAPA 1JOOA 4S3SA 3CP0A 3OIQA 4YHHL 4N8FA 1N8RC 4LF6Q 2XVSA 2JA9A 5M3FH 2PYKA 1PFBA 1IBLL 4AIMA 3RLFA 1H9MA 1BOSA 3SK5A 2Q8RE 3J7YW 2Y0SB 2OTLA 2DUDA 4HEDA 4V190 3BDLA 1SROA 1K83B 3STBD 3GQBA 4BBSB 3J81c 4GNXB 1NAPA 2E2JH 1Z7TA 2HD3A 3E6ZX 2D0OA 3D0FA 5BR8Q 3EFXD 4ILWA 4GN4B 4K5WA 2VUMB 4ZKBB 1NSNS 2M9VA 1U4LA 1I3QH 3ERQA 1PH2A 2CHBD 2VZAA 4DV3L 4B3SL 1H9KA 1J9OA 2OEOA 4M1UB 4JI2Q 2F0TA 2WB1E 5C0XJ 1KLGD 2GVAA 4P72A 1F9PA 5K36H 1MI2A 1O7IA 1EY7A 4MTKA 1EZ6A 3PO3H 4PQXA 4R8IA 2N8NA 1C9OA 3L0OA 3KF8A 5BN3A 1UEAB 4X62Q 2A1AA 4R8NA 2NVQB 3IL8A 5DLQE 4GKKQ 1WTVA 1WI5A 5DM63 2E2IB 1QVFA 1SMYC 2MQHA 2R7ZB 4A3IG 4RKBA 4XIGS 2HT1A 3F2CA 1VDZA 2EJMA 3I55A 2UUBQ 3Q0AA 2JA6B 2A68C 5C0XH 1CM9A 3SK4A 1VS0A 1L1OC 3CMAA 1ICFB 2ZTDA 4DK6C 1CKMA 4EQOA 3HOXG 4RHRA 3VYTA 4DFAA 2Z4IA 1R9TH 2K5VA 1STHA 3TN2A 5DEHA 1WTXA 5C3EG 3UI2A 3SR1A 4ME5A 5LMNW 1AN8A 1HR0L 1X54A 2NZHA 3V96A 4JCVE 4X6AH 3GO5A 3IAYA 3SE0A 2PZUA 3U4ZA 2R61A 2NN6G 4K0KL 2VXWA 2KENA 3NK9A 4Y52H 2JA7B 2RBMA 1HHVA 3VYRA 4LFBQ 2JSOA 2R7DA 3Q8DA 1ONLA 3QWNA 2AWNA 1PV4A 4QUFA 2IT1A 5GQOA 2CVRA 2H4OA 2KJXA 3KK7A 4OELB 4DR2L 4FF4A 3TZUA 4KHVA 1RTOA 1JQYD 1KD1C 3G71A 3STBC 4X64Q 4DV0L 1XNRL 4A3IH 1KXLA 2ZM6Q 1DM0B 4JPBW 5ELNA 3S17B 3S2DH 1G8ZD 4YY3Q 2JA5B 1A0IA 3A54A 2EQSA 4EQPA 5A2QL 2R93H 3I3CA 1IKMA 3K0XA 1CT1D 4A3GG 4DNIA 3HGBA 4PV1C 1XYIA 1LT6D 3MXNA 4KHZA 3I73A 4CBVA 4A3FG 2WAQB 2I5LX 5C3EH 3M85A 2KCCA 1J8IA 2XTIA 4RCNA 1VQKA 1LTSD 4MN3A 4NXML 1G2TA 3ULLA 5IOCA 2ES2A 4LUOA 1ESRA 1XPRA 3KLRA 4GKJQ 4DR5Q 1EOVA 4OGQC 1QUQA 1GUWA 1HRJA 1B3AA 1K0RA 4Q0FA 1X3FA 4LF7L 3I4MB 3HEJA 1DOKA 3S1NB 3OMCA 2PW7A 2CQAA 4GN5A 3FMCA 1XMOQ 2K5DA 2A69D 3VA5A 3PIP3 4IPHA 1CK1A 1UWVA 4IUVA 1EIGA 4XYOA 3HFZB 2F4IA 3I4NG 1DCZA 2EVBA
chains in the Genus database with same CATH topology
2IX0A 3AQQA 4A75A 3OW2A 2K50A 3S1MH 2OQ0A 3T1YQ 1HR0Q 4NPSA 3KF6A 5LMUL 1Q86C 1PYBA 4C3HH 5IYBG 4LW1A 1IL2A 4DUYL 2JA5G 4JI4L 2JEBI 1EWIA 3E9HA 3UDIA 1KL9A 2CFMA 1EUJA 4K0KQ 1QZHA 1TWAH 3IRBA 3PSIA 2UUAQ 5H1SE 4KLKA 4LF4L 2AWOA 2E2HH 2R93G 4JV5Q 4LF8L 1VQJA 3HOYH 3HOZG 4LF9L 5IP7H 2BH2A 1PYSB 4BY1G 1QVGA 2B63H 2L15A 3KOJA 5EAYA 5BR8L 1H95A 1HNXL 5ELOA 4GS3A 3GDEA 3FKIH 3PIPA 4HIMA 2NN6I 4B3RQ 3PUVA 4R4TA 3U4VA 2WAQG 4A3KH 1V1QA 4DR2Q 3I7FA 4IFDI 1VQDA 1X3EA 3CXCA 3G6EA 2QEXA 4QY7A 1FJGQ 4UP8A 4DV0Q 3KF8B 1L1OA 1CKNB 4A3JH 1YJWA 1XPUA 4A3CG 3J81i 5M5YH 4HJAA 1Q82C 2YTXA 4NXNL 4JI2L 5JJIA 2QA4A 3CCLA 2LXJA 4JBWA 4JYAL 4BA2I 3GTKH 1X3GA 3S24A 4JI0L 2JE6I 2I5MX 1NMFA 1K9MC 4OONA 4X66Q 4DV6L 3RN5A 3I4MG 4DR1L 1JJGA 1IBKQ 3J7A5 1TWGH 2VW9A 2IX1A 4RG1A 4XTCS 2R92H 3CCMA 1Z47A 4IOAA 1GO3E 4TQUS 1FGUA 4X62L 4DV7L 1IBLQ 3HOWG 4FDBA 4A3MH 4JI3Q 3NEMA 4GKKL 4B3MQ 4GOPA 1N36L 4APVA 2UUCL 1I50H 4IPGA 4L5SA 3GTOH 2PMZE 1ASYA 2LXKA 1AH9A 2PI2E 1YI2A 4R4CA 3DLLA 2JQOA 1LYLA 1UE1A 1XTDA 5IE8A 4DV2L 3RNUA 1OTCA 2E5LL 3HOVH 4A3BG 1E7ZA 2MNAA 1YVCA 3I4OA 3GTMH 1LM0A 1X65A 2JJQA 1SN8A 4EQ5A 5IYBH 5C0XI 3PIOA 1YIJA 1NJIC 4NXMQ 4OO1G 2WB1G 1HJPA 5HGQA 1K8AC 1MJEA 3M4OH 2OTJA 4DR3L 1UE5A 4DR4L 2K52A 4IPDA 3K8AA 5GADC 1EQRA 3H3VH 1KRSA 4QQBX 3ULPA 1WJJA 1L2FA 3CMEA 1PH5A 4DV3Q 3WWVA 4HJ7A 1S72A 1PH9A 4LF7Q 2IHEA 2WFWA 3UE0A 1PH6A 1J5EQ 3W5OA 1M1KC 3HOZH 3K80C 4BY1H 1V43A 2PQAA 2YYZA 4LF5L 1YZ6A 1EIFA 3S1QH 4C3JH 1VQPA 3W1BA 3EIVA 1SMXA 2KCTA 1WFQA 1Q12A 4X65Q 1VQ9A 4GLAC 3HOYG 4DK3C 4OX9Q 5IP7G 2UXCQ 3S14H 4PMWA 2B63G 4JI1Q 4IOCA 2R6GA 3D31A 2WAQE 4IJLA 3FKIG 3KJPA 1QZGA 4R4OA 3T1HQ 4JC0A 4A3KG 1B70B 2RHQB 4L5RC 2R7FA 1KAWA 1K8GA 4DR6L 1VQBA 3UE1A 2ZJRA 1Y1WH 1C0AA 1PFSA 3MEFA 2NVXH 4A3JG 3H0GH 1E1TA 3I4MH 4JI7Q 4LFBL 4PG3A 1YJ9A 4JI4Q 4A3DH 3S1NH 2ALYB 1VQ8A 3CCQA 1N33L 3PF5A 1D7QA 1X9NA 1TWCH 1J6QA 2H5XA 3KDFB 1SR3A 1VQOA 4DAMA 3NELA 5LMNQ 2VQEQ 3RN2A 3ULJA 2JA8H 3CC7A 5GAHC 1CSQA 2QGQA 3CF5A 4LF8Q 1N9WA 2R92G 4YWLA 1I6HH 5JEAJ 4DR7Q 4DV1L 1WCMH 3LGJA 4A4IA 1ASZA 5HY6A 3S1RH 5M3MG 5GAEC 4A3MG 1HNXQ 3AFQA 2ZM6L 2ZJPA 4A3EG 3EBEA 3MXNB 3NBHB 1GM5A 2D0PA 4Y7NH 4YY3L 3F2BA 3CC4A 1XPOA 3AYHB 4AQYL 4IJHA 2Z0SA 2UU9Q 3HOVG 3RLOA 2OCEA 2WP8J 1UE6A 3K81C 1VQ5A 4A3LG 4JG2A 4NXNQ 4KI0A 3S16H 3FP9A 1BKBA 4AYBG 2HHHL 1V9PA 3M4PA 3E9IA 3PUZA 4LF6L 2I0QA 1PH7A 1E3PA 4JYAQ 1HNWL 5IWAL 4R1JA 1YHQA 1PH4A 1HNZL 4JBKA 1E22A 2FXQA 4DR1Q 2UXDQ 3FHWA 1OXXK 3RLNA 3ZJYC 2VQFL 3K7UC 4P74A 3RZOH 1QUQB 3CD6A 1SRUA 3PUWA 3J80i 1KRTA 1CKNA 1LUZA 3M4QA 5FJ8G 3ERSX 4DKAC 2A8VA 1N36Q 2UXBL 2UUCQ 1VQNA 3PGZA 1I5FA 1D8LA 4JI6L 1TWHH 3UDXA 1W2BA 1BBWA 3GTQH 3KYHC 1PA6A 4GKJL 2HIXA 3NENA 4DV2Q 5JJLA 4UPAA 5M5XH 3PF4A 1N32Q 3H15A 1IZ6A 1PH3A 1XNRQ 3GTPH 2DGYA 4DV4L 3S15H 1WYDA 1PVOA 1Q1BA 4R4IA 4UP7A 4HIOA 4YWKA 2A19A 4DR3Q 1JB7A 3CCSA 1Y1WG 2ID0A 3K7AH 2PI2A 1XMOL 1SLJA 4MZ9A 2KCMA 3PV0A 1YNXA 4WJ3M 1NBWA 3H0GG 3DM3A 3KF6B 3UDGA 4A3DG 3J81j 3CCUA 3I2ZA 3M9BA 1UE7A 1TXYA 1KQSA 2F52A 4GLXA 2LSSA 2N78A 1UEBA 1VQEA 1FVIA 3CCRA 1HH2P 1YHAA 4PZ6A 3J7ZC 1EFWA 4DV5Q 2NVYH 5M3MH 1HZCA 3PO2G 4DUZQ 3BZCA 4LNQA 3OTOQ 2JA8G 1M90C 4A3EH 3L2PA 5FLXc 1VQ7A 5AJ3Q 1K73C 2MFIA 3T1YL 1WCMG 3SGIA 3UDFA 3L7ZC 5C4XH 3HKZG 3RZDH 1VQCA 4A3LH 1S40A 4LFCQ 5C44G 3CPWA 2K75A 2VNUD 3CPFA 2E8GA 4DR6Q 1EIYB 4QIWE 1IBMQ 2UUBL 4IFDG 3HKSA 1OXTA 4OWTB 1Q8KA 4O0AA 1EQQA 5M5WH 3AEVA 3A5ZB 4AYBE 5E7NA 1JMCA 3TQYA 4JI8Q 1XMQQ 3TRZA 2AKWB 2AHOB 4P73A 4UP9A 3ICEA 3TS2A 1AE3A 5FJ8H 3S2HH 3B6YA 3CCEA 2F4VL 3M7NA 4JOIA 4JI5Q 4DV1Q 2I5HA 4GNXC 1Y1VH 5JEAG 4LFAL 3PUYA 2EXDA 3GTGH 1MKHA 2ZJQA 1I94Q 4O2DA 1Q81C 3KDFA 1RL2A 1HZAA 4H02A 4AQYQ 4IFDJ 4MNOA 1E1OA 1OXVA 4TVAB 1IBKL 3CP0A 4YHHL 4JBJA 2VY3A 2HHHQ 1G291 1N8RC 4RMFA 4LF6Q 2Z6KA 2JA9A 4GN3B 1BBUA 5LMUQ 5M3FH 1HNWQ 2K14A 4AIMA 4DUYQ 1E24A 3BJUA 3RLFA 3HOXH 4OXPA 1HNZQ 1IBLL 4JI3L 1CUKA 4POFA 4B3ML 1VQLA 4J15A 2OTLA 2DUDA 3HOUH 4BBSH 4OWWB 4UY8C 1SROA 3PO2H 4LF4Q 3STBD 1PH8A 3J81c 4GNXB 3F1ZA 4HIKA 4LF9Q 2VUMH 1N34L 4X64L 2E2JH 3JC66 2D0OA 2PQAB 3D0FA 5BR8Q 3CC2A 4JI6Q 3KFUA 4HJ5A 1KIXA 4GN4B 1Q1EA 4ME3A 3A5UA 3KJOA 5C44H 1OXSC 5IYDH 1JJCB 1IYJB 2JK8A 5J3BA 1YBYA 1I3QH 3HKZE 1X56A 1PH2A 4B3SL 2VZAA 4DV3L 3KLWA 3PCOB 2YTVA 1B7YB 1GVPA 5C4XG 2D62A 2KHJA 4L5QA 4JI2Q 1JT8A 1J5EL 2BA1A 2WB1E 1NE3A 5C0XJ 4AH6A 3A74A 4HIDA 2GVAA 4JI0Q 4P72A 2CQOA 2Q2HA 1O7IA 2ZTCA 4QGUA 5GAGC 5C4JH 4DV6Q 2B29A 3PO3H 4KHPL 2AMCB 5FLMH 4OX9L 1G51A 1C9OA 2N8NA 3L0OA 3JAMc 1PHJA 2MO1A 4C2MH 4X62Q 2A1AA 4DV7Q 1VQ4A 4WJ4A 2EIFA 3CCJA 5DLQE 1YHBA 4GKKQ 2R7ZH 2CCZA 1WI5A 2YTYA 2B3GA 2BA0A 4EX5A 2IHFA 1QVFA 3G4SA 2HIVA 2MQHA 1XNQL 1U5KA 1Y1VG 4DR5L 4A3IG 2E5LQ 4JI7L 2JA6H 4BY7H 4XIGS 4B3TL 2HT1A 4A3GH 3F2CA 5IYCH 1PH1A 2ZTEA 3AFPA 3PUXA 3I55A 2Q2UA 2UUBQ 4OWXB 4MTNA 1X55A 5LMNL 2VQEL 4DR4Q 1CKOA 1A8VA 2HQLA 1VS0A 2VL6A 1L1OC 3CMAA 3TREA 3M3YH 4DR7L 2ZTDA 5M3FG 4DK6C 1JJ2A 4LUZA 4A3FH 1CKMA 2Y0SG 1NMGA 2MO0A 3HOXG 4A93G 2CWPA 2N3SA 3BU2A 3EN2A 1U0LA 3CW2C 3W1GA 1R9TH 2F4VQ 2RF4A 5IP9G 4LF5Q 2K5VA 4OO1I 4BBSG 4BBRH 3BZKA 3HOUG 4POGA 3OYYA 1G6PA 3G48A 2UU9L 2OWOA 2RHSB 3GD7A 1K3RA 4LFAQ 5C3EG 4HJ9A 2ASBA 5LMNW 2VUMG 1B8AA 3VDYA 1HR0L 1X54A 1W3SA 2NZHA 1EYGA 4JCVE 1YITA 4X6AH 3GO5A 1GD7A 4GOPC 1C7YA 5IY0A 4BXXH 3U4ZA 5IYDG 2NN6G 3CAMA 2XGTA 2KENA 4YCUA 2K4KA 3U50C 2JA7H 4K0KL 2UXDL 4YHHQ 4Y52H 2UUAL 4P71A 1QVCA 1VQHA 4IO9A 1HZBA 3CQZH 1L1OB 4JV5L 4LFBQ 2R7DA 3Q8DA 2AWNA 1PV4A 1N33Q 2NVTH 3TS0A 4IPCA 3GTJH 3I56A 2IT1A 2YU9H 4JBMA 3CCVA 5GQOA 2CWAA 2PNHA 3RR5A 1HR0W 3I4NH 1S3OA 5K36G 4B3RL 3A0JA 3PO3G 2CKZB 4QL5A 2IY5B 5JJKA 4DR2L 1VCIA 5FLMG 4PZ7A 1N32L 1IXRA 3JAMi 1FJGL 1KD1C 3G71A 1KHIA 2OQKA 3STBC 4X64Q 4DV0L 1N34Q 1HZ9A 4C3IH 4ALPA 1XNRL 3S17H 4A3IH 1DGSA 1KXLA 4LUVA 2V1CC 2R7ZG 2ZM6Q 2NZOA 2N49A 5ELNA 5GROA 2JA5H 3S2DH 4JOIC 4GOPB 1VQIA 4YY3Q 1A0IA 2EQSA 1TWFH 1JE5A 1RIPA 4X66L 3U58A 1Y14B 3J80c 4B3SQ 1CSPA 2JA6G 4BY7G 2R93H 3K0XA 4GNXA 4A3GG 2C35B 3TEHB 5IYCG 1VQMA 4DNIA 4PZ8A 1LTLA 4YWMA 1SFOH 1BVSA 5IWAQ 5C0XG 2K5HA 1T9HA 1P16A 4DV5L 4A93H 1YEZA 4DUZL 1K83H 2GVBA 1P8LA 1X6OA 4KHZA 3OTOL 1VQAA 5IP9H 2VQFQ 4KHPQ 2K5NA 2Z6KC 1VQGA 4DPGA 2Y0SE 5AJ3L 4LWCA 1XJVA 2GN5A 4A3FG 1NY4A 3F2DA 2I5LX 2YV5A 4A3CH 1VQ6A 4A76A 5C3EH 4LFCL 3M85A 4NB3A 1KC8C 2XTIA 2Q2IA 2UXBQ 1VQKA 5IT9c 3GTLH 4BBRG 4NXML 1AE2A 3ULLA 1IBML 1A63A 2RCNA 1OXUA 1XNQQ 1Q46A 1MJCA 4LUOA 2ES2A 2Q2TA 1XPRA 2ATWA 3H3VI 4GKJQ 1GKHA 4DR5Q 2VS1A 1EOVA 3E0EA 4YCVA 1NTGA 1QUQA 1VQFA 4B3TQ 4JI8L 1XMQL 1K0RA 1Z9FA 1X3FA 4L5TA 4LF7L 4DV4Q 4DAYB 1Q7YC 4BA1I 1MIUA 3ER0A 1FL0A 3HOWH 4BXXG 1A62A 1SE8A 2JA7G 2BH8A 4YCWA 4GN5A 1XMOQ 4GLVB 4JI5L 4P75A 4R4QA 4X65L 4HJ8A 1WOCA 4IPHA 2JEAI 4A3BH 3F8TA 2NVQH 2KHIA 2UXCL 2F3IA 1UWVA 4JI1L 1L0WA 1I94L 3HFZB 2KBNA 1YJNA 4QJFA 2E2IH 3I4NG 3T1HL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IX0 A;  3AQQ A;  4A75 A;  3OW2 A;  2K50 A;  3S1M H;  2OQ0 A;  3T1Y Q;  1HR0 Q;  4NPS A;  3KF6 A;  5LMU L;  1Q86 C;  1PYB A;  4C3H H;  5IYB G;  4LW1 A;  1IL2 A;  4DUY L;  2JA5 G;  4JI4 L;  2JEB I;  1EWI A;  3E9H A;  3UDI A;  1KL9 A;  2CFM A;  1EUJ A;  4K0K Q;  1QZH A;  1TWA H;  3IRB A;  3PSI A;  2UUA Q;  5H1S E;  4KLK A;  4LF4 L;  2AWO A;  2E2H H;  2R93 G;  4JV5 Q;  4LF8 L;  1VQJ A;  3HOY H;  3HOZ G;  4LF9 L;  5IP7 H;  2BH2 A;  1PYS B;  4BY1 G;  1QVG A;  2B63 H;  2L15 A;  3KOJ A;  5EAY A;  5BR8 L;  1H95 A;  1HNX L;  5ELO A;  4GS3 A;  3GDE A;  3FKI H;  3PIP A;  4HIM A;  2NN6 I;  4B3R Q;  3PUV A;  4R4T A;  3U4V A;  2WAQ G;  4A3K H;  1V1Q A;  4DR2 Q;  3I7F A;  4IFD I;  1VQD A;  1X3E A;  3CXC A;  3G6E A;  2QEX A;  4QY7 A;  1FJG Q;  4UP8 A;  4DV0 Q;  3KF8 B;  1L1O A;  1CKN B;  4A3J H;  1YJW A;  1XPU A;  4A3C G;  3J81 i;  5M5Y H;  4HJA A;  1Q82 C;  2YTX A;  4NXN L;  4JI2 L;  5JJI A;  2QA4 A;  3CCL A;  2LXJ A;  4JBW A;  4JYA L;  4BA2 I;  3GTK H;  1X3G A;  3S24 A;  4JI0 L;  2JE6 I;  2I5M X;  1NMF A;  1K9M C;  4OON A;  4X66 Q;  4DV6 L;  3RN5 A;  3I4M G;  4DR1 L;  1JJG A;  1IBK Q;  3J7A 5;  1TWG H;  2VW9 A;  2IX1 A;  4RG1 A;  4XTC S;  2R92 H;  3CCM A;  1Z47 A;  4IOA A;  1GO3 E;  4TQU S;  1FGU A;  4X62 L;  4DV7 L;  1IBL Q;  3HOW G;  4FDB A;  4A3M H;  4JI3 Q;  3NEM A;  4GKK L;  4B3M Q;  4GOP A;  1N36 L;  4APV A;  2UUC L;  1I50 H;  4IPG A;  4L5S A;  3GTO H;  2PMZ E;  1ASY A;  2LXK A;  1AH9 A;  2PI2 E;  1YI2 A;  4R4C A;  3DLL A;  2JQO A;  1LYL A;  1UE1 A;  1XTD A;  5IE8 A;  4DV2 L;  3RNU A;  1OTC A;  2E5L L;  3HOV H;  4A3B G;  1E7Z A;  2MNA A;  1YVC A;  3I4O A;  3GTM H;  1LM0 A;  1X65 A;  2JJQ A;  1SN8 A;  4EQ5 A;  5IYB H;  5C0X I;  3PIO A;  1YIJ A;  1NJI C;  4NXM Q;  4OO1 G;  2WB1 G;  1HJP A;  5HGQ A;  1K8A C;  1MJE A;  3M4O H;  2OTJ A;  4DR3 L;  1UE5 A;  4DR4 L;  2K52 A;  4IPD A;  3K8A A;  5GAD C;  1EQR A;  3H3V H;  1KRS A;  4QQB X;  3ULP A;  1WJJ A;  1L2F A;  3CME A;  1PH5 A;  4DV3 Q;  3WWV A;  4HJ7 A;  1S72 A;  1PH9 A;  4LF7 Q;  2IHE A;  2WFW A;  3UE0 A;  1PH6 A;  1J5E Q;  3W5O A;  1M1K C;  3HOZ H;  3K80 C;  4BY1 H;  1V43 A;  2PQA A;  2YYZ A;  4LF5 L;  1YZ6 A;  1EIF A;  3S1Q H;  4C3J H;  1VQP A;  3W1B A;  3EIV A;  1SMX A;  2KCT A;  1WFQ A;  1Q12 A;  4X65 Q;  1VQ9 A;  4GLA C;  3HOY G;  4DK3 C;  4OX9 Q;  5IP7 G;  2UXC Q;  3S14 H;  4PMW A;  2B63 G;  4JI1 Q;  4IOC A;  2R6G A;  3D31 A;  2WAQ E;  4IJL A;  3FKI G;  3KJP A;  1QZG A;  4R4O A;  3T1H Q;  4JC0 A;  4A3K G;  1B70 B;  2RHQ B;  4L5R C;  2R7F A;  1KAW A;  1K8G A;  4DR6 L;  1VQB A;  3UE1 A;  2ZJR A;  1Y1W H;  1C0A A;  1PFS A;  3MEF A;  2NVX H;  4A3J G;  3H0G H;  1E1T A;  3I4M H;  4JI7 Q;  4LFB L;  4PG3 A;  1YJ9 A;  4JI4 Q;  4A3D H;  3S1N H;  2ALY B;  1VQ8 A;  3CCQ A;  1N33 L;  3PF5 A;  1D7Q A;  1X9N A;  1TWC H;  1J6Q A;  2H5X A;  3KDF B;  1SR3 A;  1VQO A;  4DAM A;  3NEL A;  5LMN Q;  2VQE Q;  3RN2 A;  3ULJ A;  2JA8 H;  3CC7 A;  5GAH C;  1CSQ A;  2QGQ A;  3CF5 A;  4LF8 Q;  1N9W A;  2R92 G;  4YWL A;  1I6H H;  5JEA J;  4DR7 Q;  4DV1 L;  1WCM H;  3LGJ A;  4A4I A;  1ASZ A;  5HY6 A;  3S1R H;  5M3M G;  5GAE C;  4A3M G;  1HNX Q;  3AFQ A;  2ZM6 L;  2ZJP A;  4A3E G;  3EBE A;  3MXN B;  3NBH B;  1GM5 A;  2D0P A;  4Y7N H;  4YY3 L;  3F2B A;  3CC4 A;  1XPO A;  3AYH B;  4AQY L;  4IJH A;  2Z0S A;  2UU9 Q;  3HOV G;  3RLO A;  2OCE A;  2WP8 J;  1UE6 A;  3K81 C;  1VQ5 A;  4A3L G;  4JG2 A;  4NXN Q;  4KI0 A;  3S16 H;  3FP9 A;  1BKB A;  4AYB G;  2HHH L;  1V9P A;  3M4P A;  3E9I A;  3PUZ A;  4LF6 L;  2I0Q A;  1PH7 A;  1E3P A;  4JYA Q;  1HNW L;  5IWA L;  4R1J A;  1YHQ A;  1PH4 A;  1HNZ L;  4JBK A;  1E22 A;  2FXQ A;  4DR1 Q;  2UXD Q;  3FHW A;  1OXX K;  3RLN A;  3ZJY C;  2VQF L;  3K7U C;  4P74 A;  3RZO H;  1QUQ B;  3CD6 A;  1SRU A;  3PUW A;  3J80 i;  1KRT A;  1CKN A;  1LUZ A;  3M4Q A;  5FJ8 G;  3ERS X;  4DKA C;  2A8V A;  1N36 Q;  2UXB L;  2UUC Q;  1VQN A;  3PGZ A;  1I5F A;  1D8L A;  4JI6 L;  1TWH H;  3UDX A;  1W2B A;  1BBW A;  3GTQ H;  3KYH C;  1PA6 A;  4GKJ L;  2HIX A;  3NEN A;  4DV2 Q;  5JJL A;  4UPA A;  5M5X H;  3PF4 A;  1N32 Q;  3H15 A;  1IZ6 A;  1PH3 A;  1XNR Q;  3GTP H;  2DGY A;  4DV4 L;  3S15 H;  1WYD A;  1PVO A;  1Q1B A;  4R4I A;  4UP7 A;  4HIO A;  4YWK A;  2A19 A;  4DR3 Q;  1JB7 A;  3CCS A;  1Y1W G;  2ID0 A;  3K7A H;  2PI2 A;  1XMO L;  1SLJ A;  4MZ9 A;  2KCM A;  3PV0 A;  1YNX A;  4WJ3 M;  1NBW A;  3H0G G;  3DM3 A;  3KF6 B;  3UDG A;  4A3D G;  3J81 j;  3CCU A;  3I2Z A;  3M9B A;  1UE7 A;  1TXY A;  1KQS A;  2F52 A;  4GLX A;  2LSS A;  2N78 A;  1UEB A;  1VQE A;  1FVI A;  3CCR A;  1HH2 P;  1YHA A;  4PZ6 A;  3J7Z C;  1EFW A;  4DV5 Q;  2NVY H;  5M3M H;  1HZC A;  3PO2 G;  4DUZ Q;  3BZC A;  4LNQ A;  3OTO Q;  2JA8 G;  1M90 C;  4A3E H;  3L2P A;  5FLX c;  1VQ7 A;  5AJ3 Q;  1K73 C;  2MFI A;  3T1Y L;  1WCM G;  3SGI A;  3UDF A;  3L7Z C;  5C4X H;  3HKZ G;  3RZD H;  1VQC A;  4A3L H;  1S40 A;  4LFC Q;  5C44 G;  3CPW A;  2K75 A;  2VNU D;  3CPF A;  2E8G A;  4DR6 Q;  1EIY B;  4QIW E;  1IBM Q;  2UUB L;  4IFD G;  3HKS A;  1OXT A;  4OWT B;  1Q8K A;  4O0A A;  1EQQ A;  5M5W H;  3AEV A;  3A5Z B;  4AYB E;  5E7N A;  1JMC A;  3TQY A;  4JI8 Q;  1XMQ Q;  3TRZ A;  2AKW B;  2AHO B;  4P73 A;  4UP9 A;  3ICE A;  3TS2 A;  1AE3 A;  5FJ8 H;  3S2H H;  3B6Y A;  3CCE A;  2F4V L;  3M7N A;  4JOI A;  4JI5 Q;  4DV1 Q;  2I5H A;  4GNX C;  1Y1V H;  5JEA G;  4LFA L;  3PUY A;  2EXD A;  3GTG H;  1MKH A;  2ZJQ A;  1I94 Q;  4O2D A;  1Q81 C;  3KDF A;  1RL2 A;  1HZA A;  4H02 A;  4AQY Q;  4IFD J;  4MNO A;  1E1O A;  1OXV A;  4TVA B;  1IBK L;  3CP0 A;  4YHH L;  4JBJ A;  2VY3 A;  2HHH Q;  1G29 1;  1N8R C;  4RMF A;  4LF6 Q;  2Z6K A;  2JA9 A;  4GN3 B;  1BBU A;  5LMU Q;  5M3F H;  1HNW Q;  2K14 A;  4AIM A;  4DUY Q;  1E24 A;  3BJU A;  3RLF A;  3HOX H;  4OXP A;  1HNZ Q;  1IBL L;  4JI3 L;  1CUK A;  4POF A;  4B3M L;  1VQL A;  4J15 A;  2OTL A;  2DUD A;  3HOU H;  4BBS H;  4OWW B;  4UY8 C;  1SRO A;  3PO2 H;  4LF4 Q;  3STB D;  1PH8 A;  3J81 c;  4GNX B;  3F1Z A;  4HIK A;  4LF9 Q;  2VUM H;  1N34 L;  4X64 L;  2E2J H;  3JC6 6;  2D0O A;  2PQA B;  3D0F A;  5BR8 Q;  3CC2 A;  4JI6 Q;  3KFU A;  4HJ5 A;  1KIX A;  4GN4 B;  1Q1E A;  4ME3 A;  3A5U A;  3KJO A;  5C44 H;  1OXS C;  5IYD H;  1JJC B;  1IYJ B;  2JK8 A;  5J3B A;  1YBY A;  1I3Q H;  3HKZ E;  1X56 A;  1PH2 A;  4B3S L;  2VZA A;  4DV3 L;  3KLW A;  3PCO B;  2YTV A;  1B7Y B;  1GVP A;  5C4X G;  2D62 A;  2KHJ A;  4L5Q A;  4JI2 Q;  1JT8 A;  1J5E L;  2BA1 A;  2WB1 E;  1NE3 A;  5C0X J;  4AH6 A;  3A74 A;  4HID A;  2GVA A;  4JI0 Q;  4P72 A;  2CQO A;  2Q2H A;  1O7I A;  2ZTC A;  4QGU A;  5GAG C;  5C4J H;  4DV6 Q;  2B29 A;  3PO3 H;  4KHP L;  2AMC B;  5FLM H;  4OX9 L;  1G51 A;  1C9O A;  2N8N A;  3L0O A;  3JAM c;  1PHJ A;  2MO1 A;  4C2M H;  4X62 Q;  2A1A A;  4DV7 Q;  1VQ4 A;  4WJ4 A;  2EIF A;  3CCJ A;  5DLQ E;  1YHB A;  4GKK Q;  2R7Z H;  2CCZ A;  1WI5 A;  2YTY A;  2B3G A;  2BA0 A;  4EX5 A;  2IHF A;  1QVF A;  3G4S A;  2HIV A;  2MQH A;  1XNQ L;  1U5K A;  1Y1V G;  4DR5 L;  4A3I G;  2E5L Q;  4JI7 L;  2JA6 H;  4BY7 H;  4XIG S;  4B3T L;  2HT1 A;  4A3G H;  3F2C A;  5IYC H;  1PH1 A;  2ZTE A;  3AFP A;  3PUX A;  3I55 A;  2Q2U A;  2UUB Q;  4OWX B;  4MTN A;  1X55 A;  5LMN L;  2VQE L;  4DR4 Q;  1CKO A;  1A8V A;  2HQL A;  1VS0 A;  2VL6 A;  1L1O C;  3CMA A;  3TRE A;  3M3Y H;  4DR7 L;  2ZTD A;  5M3F G;  4DK6 C;  1JJ2 A;  4LUZ A;  4A3F H;  1CKM A;  2Y0S G;  1NMG A;  2MO0 A;  3HOX G;  4A93 G;  2CWP A;  2N3S A;  3BU2 A;  3EN2 A;  1U0L A;  3CW2 C;  3W1G A;  1R9T H;  2F4V Q;  2RF4 A;  5IP9 G;  4LF5 Q;  2K5V A;  4OO1 I;  4BBS G;  4BBR H;  3BZK A;  3HOU G;  4POG A;  3OYY A;  1G6P A;  3G48 A;  2UU9 L;  2OWO A;  2RHS B;  3GD7 A;  1K3R A;  4LFA Q;  5C3E G;  4HJ9 A;  2ASB A;  5LMN W;  2VUM G;  1B8A A;  3VDY A;  1HR0 L;  1X54 A;  1W3S A;  2NZH A;  1EYG A;  4JCV E;  1YIT A;  4X6A H;  3GO5 A;  1GD7 A;  4GOP C;  1C7Y A;  5IY0 A;  4BXX H;  3U4Z A;  5IYD G;  2NN6 G;  3CAM A;  2XGT A;  2KEN A;  4YCU A;  2K4K A;  3U50 C;  2JA7 H;  4K0K L;  2UXD L;  4YHH Q;  4Y52 H;  2UUA L;  4P71 A;  1QVC A;  1VQH A;  4IO9 A;  1HZB A;  3CQZ H;  1L1O B;  4JV5 L;  4LFB Q;  2R7D A;  3Q8D A;  2AWN A;  1PV4 A;  1N33 Q;  2NVT H;  3TS0 A;  4IPC A;  3GTJ H;  3I56 A;  2IT1 A;  2YU9 H;  4JBM A;  3CCV A;  5GQO A;  2CWA A;  2PNH A;  3RR5 A;  1HR0 W;  3I4N H;  1S3O A;  5K36 G;  4B3R L;  3A0J A;  3PO3 G;  2CKZ B;  4QL5 A;  2IY5 B;  5JJK A;  4DR2 L;  1VCI A;  5FLM G;  4PZ7 A;  1N32 L;  1IXR A;  3JAM i;  1FJG L;  1KD1 C;  3G71 A;  1KHI A;  2OQK A;  3STB C;  4X64 Q;  4DV0 L;  1N34 Q;  1HZ9 A;  4C3I H;  4ALP A;  1XNR L;  3S17 H;  4A3I H;  1DGS A;  1KXL A;  4LUV A;  2V1C C;  2R7Z G;  2ZM6 Q;  2NZO A;  2N49 A;  5ELN A;  5GRO A;  2JA5 H;  3S2D H;  4JOI C;  4GOP B;  1VQI A;  4YY3 Q;  1A0I A;  2EQS A;  1TWF H;  1JE5 A;  1RIP A;  4X66 L;  3U58 A;  1Y14 B;  3J80 c;  4B3S Q;  1CSP A;  2JA6 G;  4BY7 G;  2R93 H;  3K0X A;  4GNX A;  4A3G G;  2C35 B;  3TEH B;  5IYC G;  1VQM A;  4DNI A;  4PZ8 A;  1LTL A;  4YWM A;  1SFO H;  1BVS A;  5IWA Q;  5C0X G;  2K5H A;  1T9H A;  1P16 A;  4DV5 L;  4A93 H;  1YEZ A;  4DUZ L;  1K83 H;  2GVB A;  1P8L A;  1X6O A;  4KHZ A;  3OTO L;  1VQA A;  5IP9 H;  2VQF Q;  4KHP Q;  2K5N A;  2Z6K C;  1VQG A;  4DPG A;  2Y0S E;  5AJ3 L;  4LWC A;  1XJV A;  2GN5 A;  4A3F G;  1NY4 A;  3F2D A;  2I5L X;  2YV5 A;  4A3C H;  1VQ6 A;  4A76 A;  5C3E H;  4LFC L;  3M85 A;  4NB3 A;  1KC8 C;  2XTI A;  2Q2I A;  2UXB Q;  1VQK A;  5IT9 c;  3GTL H;  4BBR G;  4NXM L;  1AE2 A;  3ULL A;  1IBM L;  1A63 A;  2RCN A;  1OXU A;  1XNQ Q;  1Q46 A;  1MJC A;  4LUO A;  2ES2 A;  2Q2T A;  1XPR A;  2ATW A;  3H3V I;  4GKJ Q;  1GKH A;  4DR5 Q;  2VS1 A;  1EOV A;  3E0E A;  4YCV A;  1NTG A;  1QUQ A;  1VQF A;  4B3T Q;  4JI8 L;  1XMQ L;  1K0R A;  1Z9F A;  1X3F A;  4L5T A;  4LF7 L;  4DV4 Q;  4DAY B;  1Q7Y C;  4BA1 I;  1MIU A;  3ER0 A;  1FL0 A;  3HOW H;  4BXX G;  1A62 A;  1SE8 A;  2JA7 G;  2BH8 A;  4YCW A;  4GN5 A;  1XMO Q;  4GLV B;  4JI5 L;  4P75 A;  4R4Q A;  4X65 L;  4HJ8 A;  1WOC A;  4IPH A;  2JEA I;  4A3B H;  3F8T A;  2NVQ H;  2KHI A;  2UXC L;  2F3I A;  1UWV A;  4JI1 L;  1L0W A;  1I94 L;  3HFZ B;  2KBN A;  1YJN A;  4QJF A;  2E2I H;  3I4N G;  3T1H L; 
#chains in the Genus database with same CATH topology
 3AQQ A;  3OW2 A;  2WB1 B;  4V0B A;  1IL2 A;  2EYF A;  3S1M B;  3S16 B;  2L4N A;  1QWY A;  2DY8 A;  1ENA A;  1KL9 A;  3E9H A;  5JAV A;  3NSW A;  1TWA H;  3IRB A;  1YNJ D;  4RHS A;  2Z6B A;  4F8M A;  4KLK A;  4JV5 Q;  2N55 A;  1O7L A;  4LF8 L;  1HUN A;  3OHX C;  1PFM A;  5IP7 H;  2BH2 A;  1PYS B;  4BY1 G;  5JJZ A;  4IUR A;  5BR8 L;  5J22 A;  5ELO A;  5KIX A;  3FKI H;  2A5H A;  4LK1 C;  3T53 B;  4CKB A;  3T51 B;  1I6V C;  3I7F A;  1VQD A;  2F0L A;  2F0Q A;  3X3M A;  3MAQ A;  4A3C G;  1ZYR D;  5M5Y H;  4JI2 L;  4NXN L;  5JJI A;  3QJY A;  4XT1 B;  2FJ2 A;  3H94 A;  1LLR D;  5E1F A;  2JE6 I;  4RGT A;  1U4P A;  4X66 Q;  1IBK Q;  1DZ1 A;  3HZX A;  2MUY A;  1Z47 A;  3VR2 A;  3NPP A;  1FGU A;  4X62 L;  3HOW G;  4FDB A;  2R92 B;  4NMZ A;  4JI3 Q;  4GKK L;  1ZEQ X;  4GOP A;  4L5S A;  4IPG A;  1A15 A;  1ASY A;  3QIA A;  1NNX A;  4A3M B;  3DLL A;  1XTD A;  5IE8 A;  3HOV H;  2K33 A;  2A6E D;  2L11 A;  5IGE A;  1WTQ A;  3J7A V;  1PZK D;  1UNS A;  3I4O A;  2IL8 A;  4EQ5 A;  1B1Z A;  1B3Q A;  4X3U A;  4DR3 L;  1VF5 C;  4IPD A;  1EQR A;  4J6H A;  3ULP A;  1WJJ A;  2QCP X;  1PH9 A;  4HJ7 A;  1S72 A;  1SXT A;  2F0J A;  1GOZ A;  3UE0 A;  1J5E Q;  4BY1 H;  1EEF D;  5I9O A;  3EJI A;  1JIC A;  5FLX E;  4QUC A;  1VQP A;  1EWC A;  3EIV A;  4OEM B;  2KCT A;  1WFQ A;  4GLA C;  5D14 A;  3A8I E;  2A69 C;  2WAC A;  4JI1 Q;  4IOC A;  3VA7 A;  2L0C A;  2K6A A;  2PZT A;  4DAV A;  3KJP A;  1NR4 A;  5COR A;  1EYC A;  1LTB D;  4RFB A;  2RHQ B;  1KAW A;  2X6G A;  1VQB A;  2AQ1 B;  1HXY D;  3MEF A;  5JPN C;  4A3J G;  1U4M A;  3H0G H;  1E1T A;  2NVX H;  1EU4 A;  1BCP D;  1Y1W B;  5CV6 A;  4LFB L;  3LX0 A;  4A3D H;  4JI4 Q;  2F0D A;  1VQ8 A;  2ZT9 C;  1X9N A;  1JCK B;  3HOX B;  2RDF A;  3HS0 C;  3KDF B;  5LMN Q;  5CYU A;  1K0S A;  2VQE Q;  2EJF C;  1YNJ C;  3DHQ A;  5JEA J;  4F7X A;  4DR7 Q;  4X3T A;  4A4I A;  1KDB A;  5BN5 A;  1HNX Q;  2ZM6 L;  1WCM B;  4G4K A;  1JOR A;  2SDF A;  3NBH B;  1GUO A;  3S1R B;  4YY3 L;  5C44 B;  1XPO A;  4AQY L;  4A3L G;  2OCE A;  1UE6 A;  5EKL A;  4ZYS A;  4AYB G;  2HHH L;  1ZYR C;  5CV7 A;  2VB3 X;  1HNW L;  1WTO A;  4ULL A;  4HN7 A;  5EKI A;  3CU7 A;  1EU3 A;  5FO7 B;  3FHW A;  3RZO H;  3CD6 A;  1KRT A;  4C1N I;  3MXU A;  5JEA H;  3M4Y A;  2A8V A;  1B53 A;  3PGZ A;  1QB5 D;  4JI6 L;  3NWS A;  1W2B A;  5IGC A;  3OMG A;  2RVL A;  3KYH C;  1W6K A;  4GKJ L;  2L12 A;  5CV5 A;  3PF4 A;  2OF1 A;  3H15 A;  1EZ8 A;  2A6E C;  1K8O A;  1Q1B A;  3FDT A;  1FNV A;  4A3G B;  4HIO A;  1MSG A;  4YWK A;  2A19 A;  3CCS A;  3K7A H;  1XMO L;  4RAU C;  1FGB D;  1A6X A;  2BE5 D;  4MZ9 A;  4WJ3 M;  3DM3 A;  3KF6 B;  3J81 j;  3CCU A;  1UE7 A;  1TXY A;  5C5L A;  2SNM A;  3IFT A;  4GLX A;  4H0L C;  4DNR B;  1FVI A;  3CCR A;  3J7Z C;  1YHA A;  4PZ6 A;  4DV5 Q;  4DNT B;  3PO2 G;  4DUZ Q;  2JA8 G;  1M90 C;  5FLX c;  4IAL A;  3A8K E;  1PTO H;  1EOT A;  3L7Z C;  3HKZ G;  4A3L H;  4LFC Q;  4GZY C;  3CPW A;  2VNU D;  2K75 A;  4QIW E;  5KRU A;  1M4V A;  5C4X B;  2EOT A;  1SNQ A;  3C1F A;  4OWT B;  4O0A A;  1AEX A;  4AYB E;  3K59 A;  1D5Z C;  4JI8 Q;  1XWE A;  1BCP C;  1RD9 D;  1S5E D;  1ZKO A;  1HQM C;  2K7V A;  2O4X A;  4KTA A;  4CGY B;  1H9J A;  3B6Y A;  3CCE A;  2F4V L;  1KTK A;  1LTT D;  2I5H A;  1Y1V H;  3PUY A;  1CHP D;  4C3I B;  2ZJQ A;  1JOK A;  4O1N A;  1DYQ A;  3R8B A;  1E1O A;  1IBK L;  4O42 A;  1GUS A;  4M8A A;  1A3V A;  2VY3 A;  1SBB B;  1TWF B;  2EYP A;  1BBU A;  3DEP A;  2IPK D;  2K14 A;  3W3A A;  4OXP A;  1HNZ Q;  4JI3 L;  2L55 A;  2L9H A;  1RHP A;  4WJW A;  3D3R A;  4BBS H;  3HOU H;  4UY8 C;  3PO2 H;  1TS3 A;  1PH8 A;  3SK8 A;  3F1Z A;  4LF9 Q;  2VUM H;  5KNB A;  3JC6 6;  3KFU A;  4HJ5 A;  1Q1E A;  2NUC A;  2PZW A;  3HKZ E;  4I7Z C;  3MEH A;  3KLW A;  2YTV A;  1GVP A;  3RMH A;  1JT8 A;  1EY5 A;  1J5E L;  1A3U A;  1SYF A;  2BA1 A;  2DNE A;  2XSC A;  4ZCK A;  4HID A;  2CQO A;  1Q8I A;  4Q5V A;  3HOW B;  4XXE A;  2ZTC A;  4DV6 Q;  2B29 A;  2BE5 C;  2AMC B;  4L8J A;  3MTS A;  3TBI B;  1G51 A;  1QIL A;  2BCO A;  5E4W C;  3JAM c;  1PHJ A;  3NP8 A;  2MO1 A;  4C2M H;  4NDX A;  5IT9 E;  3IKJ A;  1VQ4 A;  4WJ4 A;  2EIF A;  2R7Z H;  4EVO A;  4RCO A;  5G3L D;  2K28 A;  4K5V A;  2C9O A;  1XNQ L;  3R93 A;  4N8X 1;  5IGB A;  1HA5 A;  2FIN B;  4J8Q A;  1IHZ A;  2JA6 H;  4BY7 H;  4B3T L;  1PH1 A;  1H9S B;  3AFP A;  3PUX A;  1SND A;  1VF7 A;  5DAU A;  5E4X A;  1X55 A;  5LMN L;  2VQE L;  4B08 A;  2HQL A;  5I2X A;  2VL6 A;  3MFY A;  4DR7 L;  5M3F G;  2M00 A;  1O80 A;  4A93 G;  1O7Z A;  3EN2 A;  3CW2 C;  4CJ1 B;  2RF4 A;  1GUT A;  3BZK A;  3P75 A;  4ZAI A;  2RHS B;  3GD7 A;  4BBR B;  4HJ9 A;  4RWS C;  1DOL A;  3VDY A;  1YIT A;  4K5X A;  4GOP C;  4HR7 B;  2Q8I B;  4BXX H;  2F0W A;  2XGT A;  2JA7 H;  4XDX A;  2K4K A;  4F88 A;  2JP1 A;  1PRT D;  1VQH A;  2CH4 A;  1TWG B;  2LMC B;  4LJZ C;  4DU9 A;  3GTJ H;  2YU9 H;  3CCV A;  2CWA A;  1E0B A;  4OIK A;  1SJE D;  5K36 G;  2NVT B;  4B3R L;  1O78 A;  3A0J A;  3QO2 A;  3PO3 G;  3GTO B;  1SNP A;  1IXR A;  4TSS A;  3JAM i;  1FJG L;  1N34 Q;  2OQK A;  3S17 H;  2HQE A;  1AFP A;  2V1C C;  2JA5 H;  1LO5 D;  1LTG D;  5AFW A;  1VQI A;  3J81 L;  4FP5 D;  3U58 A;  5IGF A;  2FHT A;  4C3H G;  3C1E A;  4GNX A;  1OO9 B;  2C35 B;  3L9A X;  1HTP A;  2IX3 A;  3KBX A;  1SFO H;  4YWM A;  1PFN A;  5IWA Q;  5C0X G;  2K5H A;  1ET9 A;  4DV5 L;  4A93 H;  2KUM A;  4DUZ L;  1P8L A;  1U4R A;  1VQA A;  2VQF Q;  4KHP Q;  4DGZ A;  4LWC A;  1XJV A;  1NY4 A;  3F2D A;  2YV5 A;  4A76 A;  4G7H C;  1KAB A;  4LFC L;  1KC8 C;  3BS1 A;  3AMU A;  3DWQ A;  5IT9 c;  3D4W A;  1AE2 A;  2IWH A;  1OXU A;  1Q46 A;  3TSS A;  5CC4 A;  1TVX A;  3E0E A;  4YCV A;  2HDL A;  4JVZ A;  1VQF A;  4JI8 L;  4ZUJ A;  4L5T A;  4H44 C;  4DV4 Q;  3NXW A;  1Q7Y C;  3I70 A;  2BH8 A;  4YCW A;  5CMD A;  4K6L A;  2C5C A;  5EKK A;  3MVV A;  3NTK A;  4WOR A;  2XN9 C;  1I6H B;  2LS0 1;  3OWE B;  2F3I A;  2IJ0 A;  3MHB A;  2KBN A;  4A3B B;  3HKZ B;  1YJN A;  1A2T A;  2IX0 A;  4Y7N B;  4A75 A;  3S1M H;  2OQ0 A;  3T1Y Q;  4NPS A;  1ENF A;  1Q86 C;  4C3H H;  5COY A;  5EPJ A;  4ZK9 B;  1VMC A;  3MA2 B;  1EUJ A;  3BZD B;  3DWA A;  5LL6 X;  3PSI A;  3X3N A;  2UUA Q;  2MHV A;  2R93 G;  4LMQ D;  4L6T B;  3HRZ C;  1PRT C;  1VQJ A;  3HOZ G;  4LF9 L;  1LT5 D;  3N6R A;  2B63 H;  2L15 A;  4C3J G;  1Q3L A;  1HA6 A;  3HOY B;  2EY6 A;  3I4L A;  1BNZ A;  3PUV A;  3U4V A;  3SXH A;  4IFD I;  1TWH B;  1EYA A;  2ZXO A;  1X3E A;  4RA8 A;  3GTQ B;  3KF8 B;  4A3K B;  1XPU A;  3J81 i;  5KYI A;  5M5X B;  2YTX A;  2KCN A;  2QA4 A;  3CCL A;  4JBW A;  1C4Q A;  3GTP B;  4BA2 I;  3GTK H;  1X3G A;  4OON A;  4DV6 L;  5CV4 A;  4DR1 L;  3FVQ A;  3LWE A;  3D8G A;  4XTC S;  2R92 H;  1KDC A;  2F0P A;  1HFG A;  4CJ0 B;  2PNR C;  3CCM A;  4IOA A;  4A3M H;  3PMF A;  5KEE A;  4B3M Q;  1EQT A;  1N36 L;  1V1O A;  1S5D D;  1T5E A;  4CDD C;  1AH9 A;  1X3Q A;  2PI2 E;  1YNN D;  4R4C A;  2JQO A;  1I50 B;  1LYL A;  4A3E B;  1OTC A;  3ITP A;  1IKL A;  1PTO D;  3VR4 A;  1E7Z A;  2MNA A;  1ILQ A;  5ELC A;  4F87 A;  3RZD B;  1SN8 A;  1CHQ D;  1Y8O B;  3DM1 A;  4XYQ A;  1STG A;  1UE5 A;  2K52 A;  3Q22 A;  4QQB X;  1C8C A;  1BXT A;  4CKE A;  3CME A;  1ML0 D;  3WWV A;  4EQN A;  1PH6 A;  2G9H D;  3BDO A;  3HOZ H;  1V8Q A;  2PQA A;  3S1Q H;  1ET6 A;  4C3J H;  1STN A;  5IOD A;  3S2H B;  1Q12 A;  4X65 Q;  1F9Q A;  1HPC A;  5D3I B;  4DK3 C;  2UXC Q;  5IP7 G;  3S14 H;  4PMW A;  2R6G A;  3D31 A;  1RJT A;  2E74 C;  3FKI G;  3T1H Q;  5DM7 3;  1SYC A;  3GTG B;  1B70 B;  3I8Z A;  2R7F A;  1Y1W H;  1PFS A;  4JI7 Q;  4PG3 A;  3D6C A;  3PF5 A;  1LT3 D;  4XQN A;  1J6Q A;  3H09 A;  5F2D A;  3GV3 A;  3NE5 B;  4HCE A;  5I9P A;  3ONA B;  1F2M A;  4BWG B;  3RN2 A;  3L3O C;  3SVM A;  1CSQ A;  4DV1 L;  1WCM H;  3LGJ A;  2FFK B;  1ASZ A;  3S1R H;  5M3M G;  1LT4 D;  2EYL A;  2MP1 A;  3MXN B;  2D0P A;  3F2B A;  3CC4 A;  2TSS A;  3HOV G;  2Z0S A;  5NUC A;  2WP8 J;  1VQ5 A;  4CDE C;  4JG2 A;  4NP5 A;  1I3Q B;  1WTH A;  3VR3 A;  3FP9 A;  1BKB A;  4LF6 L;  4JYA Q;  2I0Q A;  4DN4 M;  1PZJ D;  1NUC A;  1SYB A;  4R1J A;  5IWA L;  4UHV A;  4JBK A;  1E22 A;  2FXQ A;  3ZJY C;  2VQF L;  5I6Y A;  1QUQ B;  2A74 C;  5C4H A;  5KND A;  5E3F A;  2EYJ A;  2F0K A;  4FXG C;  4ID6 A;  3ERS X;  1TU2 B;  4DKA C;  2Z4H A;  2PQE A;  3TP8 A;  2UUC Q;  3SEB A;  1LTI D;  1BBW A;  5JVH 3;  5J39 A;  4IUQ A;  1PA6 A;  1BUV T;  2HIX A;  4DV2 Q;  5JJL A;  4UPA A;  1YNN C;  4WRD A;  4H13 C;  1N32 Q;  2V4D A;  1KAA A;  1PTO C;  2DGY A;  4DV4 L;  1QOH A;  3S15 H;  2PPB C;  3C2P A;  4FXD A;  1JB7 A;  1CQF A;  5ELF A;  2PI2 A;  5EPL A;  5CGK A;  1SLJ A;  1Y8N B;  1YNX A;  1Q90 A;  3H0G G;  4PMC A;  4A3D G;  2EYH A;  3M9B A;  2H1E A;  1KQS A;  2LSS A;  5M3M H;  1HZC A;  1R9T B;  1GHJ A;  3OTO Q;  3L2P A;  1K73 C;  2MFI A;  2NVY B;  3U9O A;  3T1Y L;  3UDF A;  4KKU A;  1CI3 M;  5C4X H;  1VQC A;  4U68 A;  1S40 A;  4DR6 Q;  2BDO A;  3S9W A;  4KY6 A;  1IBM Q;  2UUB L;  4IFD G;  3HKS A;  1OXT A;  4KJN A;  2WKC A;  1HTL D;  2RA4 A;  3V2T A;  5M5W H;  3SHL A;  1MD2 D;  1XMQ Q;  1JWS D;  5M9O A;  2AHO B;  2EPB A;  2PO4 A;  3DEO A;  3I90 A;  2NTT A;  2R3Z A;  1TS2 A;  1L0Y B;  4NW2 A;  1EFI D;  4GNX C;  5C3X A;  5JEA G;  3CRL C;  2EXD A;  3E3X A;  3I91 A;  3TDQ A;  4DAY A;  4A3I B;  4O2D A;  4QCL A;  3KDF A;  3S2D B;  4IFD J;  1OXV A;  1IYV A;  4FVM A;  1D5M C;  3NTH A;  2L5T A;  5IGG A;  1G29 1;  1ESF A;  3R2T A;  4RMF A;  5LMU Q;  4OL7 A;  2R93 B;  3BJU A;  4B3M L;  1VMP A;  4J15 A;  3T13 A;  1KDA A;  1BO0 A;  1EEI D;  2KED A;  1WTW A;  1GHK A;  4HIK A;  4FXK C;  4KKT A;  1V1P A;  2HCC A;  4X64 L;  3TP7 A;  3CC2 A;  4TRD A;  1KIX A;  5C3E B;  1S5B D;  1IYU A;  3A5U A;  3KJO A;  1OXS C;  5FO8 B;  5IYD H;  3BVG A;  5HGT A;  4MIU A;  3J80 E;  2JK8 A;  5J3B A;  1YBY A;  4IFD H;  3PCO B;  1B7Y B;  4L5Q A;  3LWU A;  1SE2 A;  1NE3 A;  1A3T A;  4IZ8 A;  4AH6 A;  4JI0 Q;  3T4A C;  2Q2H A;  4QGU A;  3AU7 A;  5C4J H;  2NBF A;  5FLM H;  2XRQ D;  3CCJ A;  3J7A F;  4KV6 A;  4DF7 A;  4TKO B;  2CCZ A;  2YTY A;  2B3G A;  3HP3 A;  4EX5 A;  2IHF A;  3G4S A;  2HIV A;  1U5K A;  1Y1V G;  3BG3 A;  4DR5 L;  4JI7 L;  1U9R A;  1TS4 A;  1QG7 A;  5IYC H;  1G2S A;  3A7A B;  2MPM A;  2NYZ D;  5FLX L;  1E2W A;  4OWX B;  4MTN A;  2B8F A;  2XRS D;  3NWT A;  1SNO A;  3DUZ A;  1A8V A;  2IW3 A;  2RSN A;  1TWA B;  4OHJ A;  3TRE A;  3M3Y H;  2Y0S G;  5DNF A;  3BU2 A;  4K8I A;  5ELD A;  4LF5 Q;  5IP9 G;  4A3F B;  1EY8 A;  4BBS G;  4BBR H;  3HOU G;  2L1B A;  2F0M A;  3OYY A;  1G6P A;  3FPP A;  1D6E C;  2J0T D;  1K3R A;  4LFA Q;  1Z6H A;  2ASB A;  3K5N A;  3W2D A;  2VUM G;  1B8A A;  2F0U A;  1EYG A;  5J1Z A;  4X3S A;  5L37 A;  2F0O A;  1C7Y A;  4ZRZ A;  3CAM A;  4YCU A;  2PCF B;  4YHH Q;  2JXM B;  4P71 A;  1HZB A;  1L1O B;  4JV5 L;  3K5M A;  1MHW C;  2NVT H;  3CQZ B;  1II3 A;  4IUN A;  4QMG A;  4JBM A;  2PNH A;  2B2Y C;  2CKZ B;  4QL5 A;  2IY5 B;  5JJK A;  3I4N B;  1N32 L;  1KHI A;  2QKI C;  2HUG A;  4U67 3;  4LUV A;  1XX8 A;  2R7Z G;  5GRO A;  2B2V A;  2EE1 A;  1AP0 A;  1BDO A;  1RIP A;  4X66 L;  4B3S Q;  1Y14 B;  1PMR A;  3J80 c;  1CSP A;  1KLU D;  2JA6 G;  4BY7 G;  3TEH B;  1VQM A;  4PZ8 A;  1LTL A;  1LAC A;  1K83 H;  4KN7 C;  4BY1 B;  3OTO L;  1X6O A;  5IP9 H;  2Z6K C;  4K8J A;  4B9W A;  2Y0S E;  3QOJ A;  3ERO A;  4MHE A;  3Q6S A;  2OXP A;  1EY6 A;  2UXB Q;  1I4P A;  2A6H D;  1IBM L;  3TP6 A;  2RCN A;  1A63 A;  2EXZ A;  1G91 A;  1RCV D;  1C48 A;  2ATW A;  3JAM L;  1GKH A;  3GTL B;  2VS1 A;  1XMQ L;  1QCB D;  1Z9F A;  3H0G B;  1BBX C;  1MIU A;  4BXX G;  1A62 A;  1SE8 A;  1SYG A;  2JA7 G;  2ENB A;  4GLV B;  4DXF A;  4P75 A;  4R4Q A;  3WOF A;  4HJ8 A;  4QB4 A;  1WOC A;  4A3B H;  2NVQ H;  2KHI A;  4JI1 L;  3KUP A;  1L0W A;  2M2L A;  2E2I H;  2F0S A;  2SOB A;  3C3L A;  2EYM A;  4ZLT F;  2K50 A;  3NBI A;  3MXP A;  1FNW A;  2NB0 A;  1HR0 Q;  5LMU L;  1PYB A;  5IYB G;  2XWJ B;  3K57 A;  2JA5 G;  4JI4 L;  4C56 C;  4K0K Q;  1QZH A;  4KY5 A;  5H1S E;  4KY7 A;  5FK9 C;  2SEB D;  3OIP A;  1E2Z A;  3RZO B;  3HOY H;  4IN3 A;  1QVG A;  2E2H B;  2N88 A;  1H95 A;  3M7G A;  4R9W A;  1HNX L;  5D65 A;  3GDE A;  3T16 A;  4B9X A;  2NN6 I;  3N52 A;  2D2C C;  1GXD C;  2WAQ G;  3BYY B;  1V1Q A;  3KBG A;  4DR2 Q;  4A3K H;  2O2L D;  3CXC A;  1GUG A;  3G6E A;  2QEX A;  4QY7 A;  4DV0 Q;  1XXG A;  1CKN B;  1YJW A;  4HJA A;  3CKI B;  1SYE A;  5ELB A;  4A3J B;  1STB A;  4JI0 L;  1NMF A;  1CZG A;  1K9M C;  3LNN A;  3RN5 A;  3I4M G;  2JYO A;  2EY5 A;  3J7A 5;  2VW9 A;  2IX1 A;  1STE A;  1GO3 E;  4L63 B;  4BS9 A;  3ND8 A;  5EBC A;  1NR2 A;  1PXU A;  1DD2 A;  1I50 H;  2LXK A;  2EYO A;  3G7L A;  1UE1 A;  5KNC A;  4FF3 A;  4QIW B;  3BYT B;  1QE6 A;  1LM0 A;  2JJQ A;  4IUT A;  5IIF A;  5IYB H;  3PIO A;  1YIJ A;  4NXM Q;  1NJI C;  1ICW A;  2WB1 G;  5HGQ A;  1MJE A;  1K28 A;  4AYB B;  3GTM B;  3A55 A;  5GAD C;  3H3V H;  1CA5 A;  1KRS A;  3E0J A;  2FMC A;  4FNF A;  1D1I A;  3M4O B;  5KYL A;  4LF7 Q;  4UDU C;  5IT9 L;  1F77 A;  1D5X C;  4HSP A;  2WFW A;  1MSH A;  3W5O A;  1F9R A;  1JC7 A;  4LF5 L;  2DJF C;  4RKL A;  3E5S A;  2K03 A;  2NWG A;  1SMX A;  2AUJ D;  3NTI A;  1VQ9 A;  3KLS X;  4OX9 Q;  1DXM A;  1B9N A;  2B63 G;  1Y1V B;  1ENC A;  2WAQ E;  4FO2 A;  4IJL A;  1QZG A;  4R4O A;  4JC0 A;  1B2T A;  5CBE E;  4KD3 A;  1K8G A;  2JN4 A;  1C0A A;  3I4M H;  1F9S A;  1YJ9 A;  3MZ5 A;  3S1N H;  2ALY B;  2WV6 D;  2K5W A;  4JW0 A;  3NQT A;  2H5X A;  1SR3 A;  1VQO A;  2AUK A;  4DAM A;  1EIH A;  1PLF A;  1JWM D;  1TWC B;  1RKN A;  1ROD A;  1SE4 A;  2QGQ A;  1N9W A;  3CF5 A;  4LF8 Q;  4YWL A;  2R92 G;  3HOU B;  5CV8 A;  2EY1 A;  3PO2 B;  2JA8 B;  4KKS A;  2RDH A;  5HY6 A;  5GAE C;  4A3M G;  4XT3 B;  2WII B;  3FPU B;  2K01 A;  5CR3 A;  1GM5 A;  4IUU A;  2F0G A;  2XIW A;  2UU9 Q;  4IJH A;  4NXN Q;  3S16 H;  1UUP A;  2QEJ C;  1V9P A;  1PH7 A;  2KVM A;  1YHQ A;  3WDN A;  2B2U A;  1Y8P B;  1HNZ L;  1GJX A;  4DXG A;  3H6M A;  2UXD Q;  1OXX K;  1STA A;  1HFN A;  3K7U C;  4P74 A;  4IQZ A;  1ZXT A;  1SYD A;  1PZI D;  5A2Q E;  2KHS A;  4RH6 A;  2UXB L;  2B39 A;  4HMJ A;  4C2M B;  1HQR D;  1VQN A;  1I5F A;  1SNC A;  3UDX A;  3VR6 A;  1BF4 A;  2X6L A;  4KK7 A;  3BVZ A;  1IZ6 A;  1PH3 A;  2DY7 A;  1PVO A;  4BY7 B;  4UP7 A;  3BVM A;  2LY7 A;  1W6J A;  4DR3 Q;  1Y1W G;  2CH4 W;  2KCM A;  3PV0 A;  2KEC A;  2O5I C;  3MFG A;  1X32 A;  3K6O A;  2EZV A;  4QF4 A;  1BCP F;  1S5F D;  2F52 A;  3EA6 A;  2E76 C;  2N78 A;  4N9P A;  1HH2 P;  3P7J A;  1EFW A;  2NVY H;  3BZC A;  1VQ7 A;  5AJ3 Q;  1WCM G;  3D4D A;  5C44 G;  5TSS A;  2F0V A;  2RDG A;  2E8G A;  2WKD A;  2BOS A;  1EQQ A;  4RGN A;  3A5Z B;  5E7N A;  4CKC A;  1BR9 A;  3GV6 A;  1JMC A;  1ILP A;  5CBA E;  2B2Y A;  1EYD A;  2AKW B;  2SNS A;  3ICE A;  3TS2 A;  1AE3 A;  4CJ2 C;  1RDP D;  1F2Y A;  2B2V C;  5IGD A;  3M7N A;  3GTJ B;  3ND9 A;  2YU9 B;  2K32 A;  4JI5 Q;  2RSO A;  1JB3 A;  2CW0 D;  3TZD A;  1HUM A;  1I94 Q;  1DON A;  3D4R A;  1RL2 A;  4H02 A;  1FD7 D;  2WIN B;  4AQY Q;  4MNO A;  4TVA B;  1S5C D;  2X69 A;  5KGU A;  1FR3 A;  4JBJ A;  2HHH Q;  1D7Q A;  2Z6K A;  4GN3 B;  4DK0 A;  1HNW Q;  4DUY Q;  1E24 A;  3HOX H;  1BCP B;  1B9M A;  5BN4 A;  2F03 A;  1CUK A;  4POF A;  1SFO B;  4ZUI A;  3TP5 A;  5M3F B;  1VQL A;  4KMU C;  4ODG A;  5LL6 S;  4A93 B;  4OWW B;  4LF4 Q;  1STY A;  3BDC A;  4RGM A;  3IFD A;  1EY4 A;  1N34 L;  1S4Z A;  2PQA B;  4JI6 Q;  1QNU A;  2AQ2 B;  4ME3 A;  2QDL A;  1AZQ A;  4YIJ A;  1LTA D;  5C44 H;  2E2J B;  1JJC B;  2NN6 H;  1IYJ B;  3G6J B;  2ZXR A;  1X56 A;  2I46 A;  5K5P A;  5C4X G;  2D62 A;  2KHJ A;  3AB9 A;  3I72 A;  1M8A A;  3A74 A;  3MC0 B;  3DWP A;  2A73 B;  5T1G A;  5FKA C;  5GAG C;  2P5Z X;  4KHP L;  1X3P A;  4DA2 A;  5ISR A;  4OX9 L;  4HMI A;  2ICI A;  3PO3 B;  3A8J E;  4DV7 Q;  1QNK A;  1WD0 A;  1YHB A;  5I2Y A;  1AW7 A;  1H9R A;  2Z1C A;  4Z9C B;  2BA0 A;  3D6W A;  1EQV A;  4C3I G;  1F2L A;  2E5L Q;  1SSO A;  3K58 A;  1A2U A;  4A3G H;  2RKS A;  1B50 A;  2ZTE A;  4C3H B;  2Q2U A;  2EY2 A;  1AZP A;  3K5O A;  2F3V A;  5C3W A;  4DR4 Q;  1CKO A;  5EGT A;  3KLS A;  4K14 A;  2XWB B;  1JJ2 A;  4LUZ A;  4A3F H;  1NMG A;  1R4P B;  2FMM A;  2MO0 A;  2CWP A;  2N3S A;  1E2V A;  1CA6 A;  3W1G A;  1U0L A;  2F4V Q;  2B63 B;  1TY2 A;  4OO1 I;  4POG A;  5EBD A;  3G48 A;  2UU9 L;  2OWO A;  2GA4 B;  2OT2 A;  1WTP A;  2DNC A;  2CW0 C;  1W3S A;  4ZKC B;  1GD7 A;  1MBY A;  5IY0 A;  1KNE A;  5IYD G;  3U50 C;  3FRP B;  3GTK B;  2UXD L;  2XNA C;  2UUA L;  1SDF A;  4CDC C;  4PMB A;  1QVC A;  2E75 C;  4IO9 A;  3CQZ H;  4RGO S;  2Z8L A;  1SAP A;  1N33 Q;  1TII D;  2BDN A;  1TT2 A;  3TS0 A;  4IPC A;  3I56 A;  2B2W A;  2EDG A;  3RR5 A;  1EY0 A;  1HR0 W;  2D9U A;  1S3O A;  3I4N H;  2G5D A;  1CQV A;  3MXG A;  1VCI A;  2B2T C;  5FLM G;  4PZ7 A;  1NCV A;  3FEW X;  3VYU A;  2NZ1 D;  1HZ9 A;  4C3I H;  4ALP A;  2KQ3 A;  1DGS A;  5EJW A;  3TME A;  2DJG C;  2F0I A;  2NZO A;  2N49 A;  1WTR A;  4JOI C;  4GOP B;  4DAP A;  1TWF H;  1JE5 A;  5G3L F;  1EY9 A;  5JPM C;  4WFN 3;  2G9D A;  5IYC G;  1BVS A;  1T9H A;  1P16 A;  2RCF A;  4OIJ A;  1YEZ A;  4DK1 A;  3HOZ B;  2GVB A;  4KJO A;  3NBH A;  2K1B A;  3S1Q B;  2K5N A;  4CDF C;  5AJ3 L;  1VQG A;  4DPG A;  4C3J B;  1EL0 A;  2ZXP A;  2GN5 A;  2KA7 A;  4A3C H;  4I7A A;  3V05 A;  1VQ6 A;  3S14 B;  4NB3 A;  4KN4 C;  2Q2I A;  3VR5 A;  3GTL H;  4BBR G;  3P20 A;  5C5M A;  1XNQ Q;  2F0N A;  1MJC A;  2ICE C;  2Q2T A;  3H3V I;  2HDM A;  3OW7 A;  5LHY 1;  5FO9 B;  1NTG A;  4B3T Q;  1JWU D;  4K2K A;  1IW7 D;  5CV9 A;  2VB2 X;  4DAY B;  2K04 A;  1I4X A;  3ER0 A;  1L0X B;  1FL0 A;  4BA1 I;  3HOW H;  2K05 A;  3K5L A;  2I07 B;  1KNA A;  2DN8 A;  4JI5 L;  4X65 L;  2JEA I;  1PRT F;  3F8T A;  2UXC L;  1B4O A;  2B2U C;  1TQO A;  1I94 L;  1WVL A;  4QJF A;  3GP7 A;  3T1H L;  5I4D A;  1HCZ A;  1D2B A;  3KF6 A;  1V1P B;  1JE4 A;  1O7Y A;  4LW1 A;  4DUY L;  2Q8T A;  4J1M A;  2JEB I;  1EWI A;  3UDI A;  2CFM A;  4K2L A;  5C6A A;  1TS5 A;  4LF4 L;  2AWO A;  2E2H H;  3NUC A;  1B44 D;  3HG9 A;  1FYC A;  3KOJ A;  5EAY A;  3ZYY X;  4GS3 A;  3PIP A;  4HIM A;  4B3R Q;  4R4T A;  3PIO 3;  3FKI B;  1FJG Q;  2E2D C;  4UP8 A;  4G57 A;  2B8G A;  1L1O A;  4A3J H;  2F0E A;  1Q82 C;  5JOB A;  1I4R A;  4G7Z C;  2LXJ A;  1T5X D;  5EPK A;  4E6I A;  4JYA L;  3S15 B;  3S24 A;  4EGV A;  5M5Y B;  2I5M X;  4I65 A;  2QIL A;  3T56 B;  1JJG A;  3JAM E;  3OWF A;  1TWG H;  4C1N K;  4RG1 A;  3H3V C;  5HUR A;  2RQX A;  2O5J C;  4TQU S;  1PRT B;  1D1K A;  4DV7 L;  1IBL Q;  2QDB A;  3WOE A;  3NEM A;  4APV A;  2UUC L;  3GTO H;  2PMZ E;  3J80 L;  2LFN A;  5M3M B;  2HCI A;  1YI2 A;  4KD4 A;  3SK6 A;  4DV2 L;  3RNU A;  2E5L L;  4A3B G;  4X3K A;  4ABN A;  1YVC A;  4FF1 A;  3GTM H;  3HOV B;  1X65 A;  5C0X I;  1LTR D;  1FNU A;  1SJH D;  4OO1 G;  1HJP A;  4UAI A;  4HCS A;  1K8A C;  3M4O H;  2OTJ A;  3F2U A;  4DR4 L;  3H91 A;  3K8A A;  1CFM A;  1L2F A;  1I4H A;  5T1I A;  5M5W B;  1PH5 A;  3OSO A;  4DV3 Q;  4FYD A;  2IHE A;  1IW7 C;  1M1K C;  3QOL A;  1PDQ A;  3K80 C;  1V43 A;  2YYZ A;  4NKL A;  1YZ6 A;  1EIF A;  4XQQ A;  3W1B A;  4IUP A;  1XTC D;  3HOY G;  3RD4 A;  4JK1 C;  4XQJ A;  3P1H A;  1G6Z A;  4A3K G;  4L5R C;  4DR6 L;  3DMU A;  1TY0 A;  2NTS A;  4P2C B;  3URY A;  1K8M A;  3UE1 A;  2ZJR A;  2KOL A;  2QW7 A;  1RTN A;  3PQI A;  1I4Q A;  2F3W A;  4G7O C;  3A7L A;  1SE3 A;  2J4X A;  3CCQ A;  1N33 L;  2NVX B;  1TWC H;  4A3D B;  3U9S A;  3EVQ A;  3NEL A;  3NQI A;  3A56 A;  1IL8 A;  3ULJ A;  2JA8 H;  2TMP A;  5GAH C;  3CC7 A;  1I6H H;  3QB3 A;  3AFQ A;  2ZJP A;  1H9S A;  3CHB D;  3NHH A;  3EBE A;  4A3E G;  1CTM A;  1TKW B;  4K6D A;  4Y7N H;  4OO1 H;  1TR5 A;  3AYH B;  5FOB B;  3DXJ C;  3RLO A;  3K81 C;  1RF2 D;  4KI0 A;  3M4P A;  3E9I A;  1PYW D;  3PUZ A;  1PTO F;  1E3P A;  5C4Z A;  1PH4 A;  4DR1 Q;  3RLN A;  5D3D A;  1SRU A;  3PUW A;  3J80 i;  3J81 E;  5C4J B;  1CKN A;  1LUZ A;  3M4Q A;  5FJ8 G;  3MWY W;  3OOC A;  3K0Y A;  5EQ0 A;  1N36 Q;  1D8L A;  1K3B C;  1TWH H;  2EJG C;  1Y69 U;  1GUN A;  3GTQ H;  5I6W A;  2K5Q A;  2F0H A;  1QJO A;  3NEN A;  2LKV A;  5A35 A;  3Q23 A;  1BQQ T;  2KEE A;  5M5X H;  1I4G A;  1EWH A;  1XNR Q;  3GTP H;  5ELE A;  1CZW A;  2MJ8 A;  1WYD A;  3VYS A;  4R4I A;  2J7Z A;  2QF7 A;  2Z9H A;  2ID0 A;  1F2Z A;  4HSV A;  1NBW A;  1JOQ A;  2D5D A;  1WD1 A;  3K7A B;  3UDG A;  2AQ3 B;  3I2Z A;  3M3Y B;  2F0F A;  1UEB A;  1VQE A;  1R4Q B;  3C46 A;  4PNY A;  3EQL C;  1LV9 A;  1SMY D;  4LNQ A;  1JR0 D;  4CHT B;  4A3E H;  3SGI A;  3O13 A;  1SNM A;  2F1M A;  5JVG 3;  3RZD H;  1DJR D;  3OPO A;  1MGS A;  1PTO B;  2B2W C;  2A68 D;  3CPF A;  1EIY B;  1SEB D;  4ZQ3 A;  1Q8K A;  2A6H C;  3AEV A;  3Q24 A;  1LAB A;  3TQY A;  3R2I A;  4N9T A;  3TRZ A;  2B2T A;  4HAE A;  2PMZ B;  4P73 A;  4UP9 A;  3QG1 A;  5FJ8 H;  4LAA A;  3S2H H;  3RUZ A;  1DOM A;  3CRK C;  2MGS A;  4JOI A;  3QR8 A;  3R3O A;  4DV1 Q;  4H7B A;  4LFA L;  4HTH A;  3SDZ A;  3GTG H;  1MKH A;  2PW5 A;  1Q81 C;  4FF2 A;  1HZA A;  1UAP A;  1JOO A;  4S3S A;  3CP0 A;  3OIQ A;  4YHH L;  4N8F A;  1N8R C;  4LF6 Q;  2XVS A;  2JA9 A;  5M3F H;  2PYK A;  1PFB A;  1IBL L;  4AIM A;  3RLF A;  1H9M A;  1BOS A;  3SK5 A;  2Q8R E;  3J7Y W;  2Y0S B;  2OTL A;  2DUD A;  4HED A;  4V19 0;  3BDL A;  1SRO A;  1K83 B;  3STB D;  3GQB A;  4BBS B;  3J81 c;  4GNX B;  1NAP A;  2E2J H;  1Z7T A;  2HD3 A;  3E6Z X;  2D0O A;  3D0F A;  5BR8 Q;  3EFX D;  4ILW A;  4GN4 B;  4K5W A;  2VUM B;  4ZKB B;  1NSN S;  2M9V A;  1U4L A;  1I3Q H;  3ERQ A;  1PH2 A;  2CHB D;  2VZA A;  4DV3 L;  4B3S L;  1H9K A;  1J9O A;  2OEO A;  4M1U B;  4JI2 Q;  2F0T A;  2WB1 E;  5C0X J;  1KLG D;  2GVA A;  4P72 A;  1F9P A;  5K36 H;  1MI2 A;  1O7I A;  1EY7 A;  4MTK A;  1EZ6 A;  3PO3 H;  4PQX A;  4R8I A;  2N8N A;  1C9O A;  3L0O A;  3KF8 A;  5BN3 A;  1UEA B;  4X62 Q;  2A1A A;  4R8N A;  2NVQ B;  3IL8 A;  5DLQ E;  4GKK Q;  1WTV A;  1WI5 A;  5DM6 3;  2E2I B;  1QVF A;  1SMY C;  2MQH A;  2R7Z B;  4A3I G;  4RKB A;  4XIG S;  2HT1 A;  3F2C A;  1VDZ A;  2EJM A;  3I55 A;  2UUB Q;  3Q0A A;  2JA6 B;  2A68 C;  5C0X H;  1CM9 A;  3SK4 A;  1VS0 A;  1L1O C;  3CMA A;  1ICF B;  2ZTD A;  4DK6 C;  1CKM A;  4EQO A;  3HOX G;  4RHR A;  3VYT A;  4DFA A;  2Z4I A;  1R9T H;  2K5V A;  1STH A;  3TN2 A;  5DEH A;  1WTX A;  5C3E G;  3UI2 A;  3SR1 A;  4ME5 A;  5LMN W;  1AN8 A;  1HR0 L;  1X54 A;  2NZH A;  3V96 A;  4JCV E;  4X6A H;  3GO5 A;  3IAY A;  3SE0 A;  2PZU A;  3U4Z A;  2R61 A;  2NN6 G;  4K0K L;  2VXW A;  2KEN A;  3NK9 A;  4Y52 H;  2JA7 B;  2RBM A;  1HHV A;  3VYR A;  4LFB Q;  2JSO A;  2R7D A;  3Q8D A;  1ONL A;  3QWN A;  2AWN A;  1PV4 A;  4QUF A;  2IT1 A;  5GQO A;  2CVR A;  2H4O A;  2KJX A;  3KK7 A;  4OEL B;  4DR2 L;  4FF4 A;  3TZU A;  4KHV A;  1RTO A;  1JQY D;  1KD1 C;  3G71 A;  3STB C;  4X64 Q;  4DV0 L;  1XNR L;  4A3I H;  1KXL A;  2ZM6 Q;  1DM0 B;  4JPB W;  5ELN A;  3S17 B;  3S2D H;  1G8Z D;  4YY3 Q;  2JA5 B;  1A0I A;  3A54 A;  2EQS A;  4EQP A;  5A2Q L;  2R93 H;  3I3C A;  1IKM A;  3K0X A;  1CT1 D;  4A3G G;  4DNI A;  3HGB A;  4PV1 C;  1XYI A;  1LT6 D;  3MXN A;  4KHZ A;  3I73 A;  4CBV A;  4A3F G;  2WAQ B;  2I5L X;  5C3E H;  3M85 A;  2KCC A;  1J8I A;  2XTI A;  4RCN A;  1VQK A;  1LTS D;  4MN3 A;  4NXM L;  1G2T A;  3ULL A;  5IOC A;  2ES2 A;  4LUO A;  1ESR A;  1XPR A;  3KLR A;  4GKJ Q;  4DR5 Q;  1EOV A;  4OGQ C;  1QUQ A;  1GUW A;  1HRJ A;  1B3A A;  1K0R A;  4Q0F A;  1X3F A;  4LF7 L;  3I4M B;  3HEJ A;  1DOK A;  3S1N B;  3OMC A;  2PW7 A;  2CQA A;  4GN5 A;  3FMC A;  1XMO Q;  2K5D A;  2A69 D;  3VA5 A;  3PIP 3;  4IPH A;  1CK1 A;  1UWV A;  4IUV A;  1EIG A;  4XYO A;  3HFZ B;  2F4I A;  3I4N G;  1DCZ A;  2EVB A; 
#chains in the Genus database with same CATH homology
 2IX0 A;  3AQQ A;  4A75 A;  3OW2 A;  2K50 A;  3S1M H;  2OQ0 A;  3T1Y Q;  1HR0 Q;  4NPS A;  3KF6 A;  5LMU L;  1Q86 C;  1PYB A;  4C3H H;  5IYB G;  4LW1 A;  1IL2 A;  4DUY L;  2JA5 G;  4JI4 L;  2JEB I;  1EWI A;  3E9H A;  3UDI A;  1KL9 A;  2CFM A;  1EUJ A;  4K0K Q;  1QZH A;  1TWA H;  3IRB A;  3PSI A;  2UUA Q;  5H1S E;  4KLK A;  4LF4 L;  2AWO A;  2E2H H;  2R93 G;  4JV5 Q;  4LF8 L;  1VQJ A;  3HOY H;  3HOZ G;  4LF9 L;  5IP7 H;  2BH2 A;  1PYS B;  4BY1 G;  1QVG A;  2B63 H;  2L15 A;  3KOJ A;  5EAY A;  5BR8 L;  1H95 A;  1HNX L;  5ELO A;  4GS3 A;  3GDE A;  3FKI H;  3PIP A;  4HIM A;  2NN6 I;  4B3R Q;  3PUV A;  4R4T A;  3U4V A;  2WAQ G;  4A3K H;  1V1Q A;  4DR2 Q;  3I7F A;  4IFD I;  1VQD A;  1X3E A;  3CXC A;  3G6E A;  2QEX A;  4QY7 A;  1FJG Q;  4UP8 A;  4DV0 Q;  3KF8 B;  1L1O A;  1CKN B;  4A3J H;  1YJW A;  1XPU A;  4A3C G;  3J81 i;  5M5Y H;  4HJA A;  1Q82 C;  2YTX A;  4NXN L;  4JI2 L;  5JJI A;  2QA4 A;  3CCL A;  2LXJ A;  4JBW A;  4JYA L;  4BA2 I;  3GTK H;  1X3G A;  3S24 A;  4JI0 L;  2JE6 I;  2I5M X;  1NMF A;  1K9M C;  4OON A;  4X66 Q;  4DV6 L;  3RN5 A;  3I4M G;  4DR1 L;  1JJG A;  1IBK Q;  3J7A 5;  1TWG H;  2VW9 A;  2IX1 A;  4RG1 A;  4XTC S;  2R92 H;  3CCM A;  1Z47 A;  4IOA A;  1GO3 E;  4TQU S;  1FGU A;  4X62 L;  4DV7 L;  1IBL Q;  3HOW G;  4FDB A;  4A3M H;  4JI3 Q;  3NEM A;  4GKK L;  4B3M Q;  4GOP A;  1N36 L;  4APV A;  2UUC L;  1I50 H;  4IPG A;  4L5S A;  3GTO H;  2PMZ E;  1ASY A;  2LXK A;  1AH9 A;  2PI2 E;  1YI2 A;  4R4C A;  3DLL A;  2JQO A;  1LYL A;  1UE1 A;  1XTD A;  5IE8 A;  4DV2 L;  3RNU A;  1OTC A;  2E5L L;  3HOV H;  4A3B G;  1E7Z A;  2MNA A;  1YVC A;  3I4O A;  3GTM H;  1LM0 A;  1X65 A;  2JJQ A;  1SN8 A;  4EQ5 A;  5IYB H;  5C0X I;  3PIO A;  1YIJ A;  1NJI C;  4NXM Q;  4OO1 G;  2WB1 G;  1HJP A;  5HGQ A;  1K8A C;  1MJE A;  3M4O H;  2OTJ A;  4DR3 L;  1UE5 A;  4DR4 L;  2K52 A;  4IPD A;  3K8A A;  5GAD C;  1EQR A;  3H3V H;  1KRS A;  4QQB X;  3ULP A;  1WJJ A;  1L2F A;  3CME A;  1PH5 A;  4DV3 Q;  3WWV A;  4HJ7 A;  1S72 A;  1PH9 A;  4LF7 Q;  2IHE A;  2WFW A;  3UE0 A;  1PH6 A;  1J5E Q;  3W5O A;  1M1K C;  3HOZ H;  3K80 C;  4BY1 H;  1V43 A;  2PQA A;  2YYZ A;  4LF5 L;  1YZ6 A;  1EIF A;  3S1Q H;  4C3J H;  1VQP A;  3W1B A;  3EIV A;  1SMX A;  2KCT A;  1WFQ A;  1Q12 A;  4X65 Q;  1VQ9 A;  4GLA C;  3HOY G;  4DK3 C;  4OX9 Q;  5IP7 G;  2UXC Q;  3S14 H;  4PMW A;  2B63 G;  4JI1 Q;  4IOC A;  2R6G A;  3D31 A;  2WAQ E;  4IJL A;  3FKI G;  3KJP A;  1QZG A;  4R4O A;  3T1H Q;  4JC0 A;  4A3K G;  1B70 B;  2RHQ B;  4L5R C;  2R7F A;  1KAW A;  1K8G A;  4DR6 L;  1VQB A;  3UE1 A;  2ZJR A;  1Y1W H;  1C0A A;  1PFS A;  3MEF A;  2NVX H;  4A3J G;  3H0G H;  1E1T A;  3I4M H;  4JI7 Q;  4LFB L;  4PG3 A;  1YJ9 A;  4JI4 Q;  4A3D H;  3S1N H;  2ALY B;  1VQ8 A;  3CCQ A;  1N33 L;  3PF5 A;  1D7Q A;  1X9N A;  1TWC H;  1J6Q A;  2H5X A;  3KDF B;  1SR3 A;  1VQO A;  4DAM A;  3NEL A;  5LMN Q;  2VQE Q;  3RN2 A;  3ULJ A;  2JA8 H;  3CC7 A;  5GAH C;  1CSQ A;  2QGQ A;  3CF5 A;  4LF8 Q;  1N9W A;  2R92 G;  4YWL A;  1I6H H;  5JEA J;  4DR7 Q;  4DV1 L;  1WCM H;  3LGJ A;  4A4I A;  1ASZ A;  5HY6 A;  3S1R H;  5M3M G;  5GAE C;  4A3M G;  1HNX Q;  3AFQ A;  2ZM6 L;  2ZJP A;  4A3E G;  3EBE A;  3MXN B;  3NBH B;  1GM5 A;  2D0P A;  4Y7N H;  4YY3 L;  3F2B A;  3CC4 A;  1XPO A;  3AYH B;  4AQY L;  4IJH A;  2Z0S A;  2UU9 Q;  3HOV G;  3RLO A;  2OCE A;  2WP8 J;  1UE6 A;  3K81 C;  1VQ5 A;  4A3L G;  4JG2 A;  4NXN Q;  4KI0 A;  3S16 H;  3FP9 A;  1BKB A;  4AYB G;  2HHH L;  1V9P A;  3M4P A;  3E9I A;  3PUZ A;  4LF6 L;  2I0Q A;  1PH7 A;  1E3P A;  4JYA Q;  1HNW L;  5IWA L;  4R1J A;  1YHQ A;  1PH4 A;  1HNZ L;  4JBK A;  1E22 A;  2FXQ A;  4DR1 Q;  2UXD Q;  3FHW A;  1OXX K;  3RLN A;  3ZJY C;  2VQF L;  3K7U C;  4P74 A;  3RZO H;  1QUQ B;  3CD6 A;  1SRU A;  3PUW A;  3J80 i;  1KRT A;  1CKN A;  1LUZ A;  3M4Q A;  5FJ8 G;  3ERS X;  4DKA C;  2A8V A;  1N36 Q;  2UXB L;  2UUC Q;  1VQN A;  3PGZ A;  1I5F A;  1D8L A;  4JI6 L;  1TWH H;  3UDX A;  1W2B A;  1BBW A;  3GTQ H;  3KYH C;  1PA6 A;  4GKJ L;  2HIX A;  3NEN A;  4DV2 Q;  5JJL A;  4UPA A;  5M5X H;  3PF4 A;  1N32 Q;  3H15 A;  1IZ6 A;  1PH3 A;  1XNR Q;  3GTP H;  2DGY A;  4DV4 L;  3S15 H;  1WYD A;  1PVO A;  1Q1B A;  4R4I A;  4UP7 A;  4HIO A;  4YWK A;  2A19 A;  4DR3 Q;  1JB7 A;  3CCS A;  1Y1W G;  2ID0 A;  3K7A H;  2PI2 A;  1XMO L;  1SLJ A;  4MZ9 A;  2KCM A;  3PV0 A;  1YNX A;  4WJ3 M;  1NBW A;  3H0G G;  3DM3 A;  3KF6 B;  3UDG A;  4A3D G;  3J81 j;  3CCU A;  3I2Z A;  3M9B A;  1UE7 A;  1TXY A;  1KQS A;  2F52 A;  4GLX A;  2LSS A;  2N78 A;  1UEB A;  1VQE A;  1FVI A;  3CCR A;  1HH2 P;  1YHA A;  4PZ6 A;  3J7Z C;  1EFW A;  4DV5 Q;  2NVY H;  5M3M H;  1HZC A;  3PO2 G;  4DUZ Q;  3BZC A;  4LNQ A;  3OTO Q;  2JA8 G;  1M90 C;  4A3E H;  3L2P A;  5FLX c;  1VQ7 A;  5AJ3 Q;  1K73 C;  2MFI A;  3T1Y L;  1WCM G;  3SGI A;  3UDF A;  3L7Z C;  5C4X H;  3HKZ G;  3RZD H;  1VQC A;  4A3L H;  1S40 A;  4LFC Q;  5C44 G;  3CPW A;  2K75 A;  2VNU D;  3CPF A;  2E8G A;  4DR6 Q;  1EIY B;  4QIW E;  1IBM Q;  2UUB L;  4IFD G;  3HKS A;  1OXT A;  4OWT B;  1Q8K A;  4O0A A;  1EQQ A;  5M5W H;  3AEV A;  3A5Z B;  4AYB E;  5E7N A;  1JMC A;  3TQY A;  4JI8 Q;  1XMQ Q;  3TRZ A;  2AKW B;  2AHO B;  4P73 A;  4UP9 A;  3ICE A;  3TS2 A;  1AE3 A;  5FJ8 H;  3S2H H;  3B6Y A;  3CCE A;  2F4V L;  3M7N A;  4JOI A;  4JI5 Q;  4DV1 Q;  2I5H A;  4GNX C;  1Y1V H;  5JEA G;  4LFA L;  3PUY A;  2EXD A;  3GTG H;  1MKH A;  2ZJQ A;  1I94 Q;  4O2D A;  1Q81 C;  3KDF A;  1RL2 A;  1HZA A;  4H02 A;  4AQY Q;  4IFD J;  4MNO A;  1E1O A;  1OXV A;  4TVA B;  1IBK L;  3CP0 A;  4YHH L;  4JBJ A;  2VY3 A;  2HHH Q;  1G29 1;  1N8R C;  4RMF A;  4LF6 Q;  2Z6K A;  2JA9 A;  4GN3 B;  1BBU A;  5LMU Q;  5M3F H;  1HNW Q;  2K14 A;  4AIM A;  4DUY Q;  1E24 A;  3BJU A;  3RLF A;  3HOX H;  4OXP A;  1HNZ Q;  1IBL L;  4JI3 L;  1CUK A;  4POF A;  4B3M L;  1VQL A;  4J15 A;  2OTL A;  2DUD A;  3HOU H;  4BBS H;  4OWW B;  4UY8 C;  1SRO A;  3PO2 H;  4LF4 Q;  3STB D;  1PH8 A;  3J81 c;  4GNX B;  3F1Z A;  4HIK A;  4LF9 Q;  2VUM H;  1N34 L;  4X64 L;  2E2J H;  3JC6 6;  2D0O A;  2PQA B;  3D0F A;  5BR8 Q;  3CC2 A;  4JI6 Q;  3KFU A;  4HJ5 A;  1KIX A;  4GN4 B;  1Q1E A;  4ME3 A;  3A5U A;  3KJO A;  5C44 H;  1OXS C;  5IYD H;  1JJC B;  1IYJ B;  2JK8 A;  5J3B A;  1YBY A;  1I3Q H;  3HKZ E;  1X56 A;  1PH2 A;  4B3S L;  2VZA A;  4DV3 L;  3KLW A;  3PCO B;  2YTV A;  1B7Y B;  1GVP A;  5C4X G;  2D62 A;  2KHJ A;  4L5Q A;  4JI2 Q;  1JT8 A;  1J5E L;  2BA1 A;  2WB1 E;  1NE3 A;  5C0X J;  4AH6 A;  3A74 A;  4HID A;  2GVA A;  4JI0 Q;  4P72 A;  2CQO A;  2Q2H A;  1O7I A;  2ZTC A;  4QGU A;  5GAG C;  5C4J H;  4DV6 Q;  2B29 A;  3PO3 H;  4KHP L;  2AMC B;  5FLM H;  4OX9 L;  1G51 A;  1C9O A;  2N8N A;  3L0O A;  3JAM c;  1PHJ A;  2MO1 A;  4C2M H;  4X62 Q;  2A1A A;  4DV7 Q;  1VQ4 A;  4WJ4 A;  2EIF A;  3CCJ A;  5DLQ E;  1YHB A;  4GKK Q;  2R7Z H;  2CCZ A;  1WI5 A;  2YTY A;  2B3G A;  2BA0 A;  4EX5 A;  2IHF A;  1QVF A;  3G4S A;  2HIV A;  2MQH A;  1XNQ L;  1U5K A;  1Y1V G;  4DR5 L;  4A3I G;  2E5L Q;  4JI7 L;  2JA6 H;  4BY7 H;  4XIG S;  4B3T L;  2HT1 A;  4A3G H;  3F2C A;  5IYC H;  1PH1 A;  2ZTE A;  3AFP A;  3PUX A;  3I55 A;  2Q2U A;  2UUB Q;  4OWX B;  4MTN A;  1X55 A;  5LMN L;  2VQE L;  4DR4 Q;  1CKO A;  1A8V A;  2HQL A;  1VS0 A;  2VL6 A;  1L1O C;  3CMA A;  3TRE A;  3M3Y H;  4DR7 L;  2ZTD A;  5M3F G;  4DK6 C;  1JJ2 A;  4LUZ A;  4A3F H;  1CKM A;  2Y0S G;  1NMG A;  2MO0 A;  3HOX G;  4A93 G;  2CWP A;  2N3S A;  3BU2 A;  3EN2 A;  1U0L A;  3CW2 C;  3W1G A;  1R9T H;  2F4V Q;  2RF4 A;  5IP9 G;  4LF5 Q;  2K5V A;  4OO1 I;  4BBS G;  4BBR H;  3BZK A;  3HOU G;  4POG A;  3OYY A;  1G6P A;  3G48 A;  2UU9 L;  2OWO A;  2RHS B;  3GD7 A;  1K3R A;  4LFA Q;  5C3E G;  4HJ9 A;  2ASB A;  5LMN W;  2VUM G;  1B8A A;  3VDY A;  1HR0 L;  1X54 A;  1W3S A;  2NZH A;  1EYG A;  4JCV E;  1YIT A;  4X6A H;  3GO5 A;  1GD7 A;  4GOP C;  1C7Y A;  5IY0 A;  4BXX H;  3U4Z A;  5IYD G;  2NN6 G;  3CAM A;  2XGT A;  2KEN A;  4YCU A;  2K4K A;  3U50 C;  2JA7 H;  4K0K L;  2UXD L;  4YHH Q;  4Y52 H;  2UUA L;  4P71 A;  1QVC A;  1VQH A;  4IO9 A;  1HZB A;  3CQZ H;  1L1O B;  4JV5 L;  4LFB Q;  2R7D A;  3Q8D A;  2AWN A;  1PV4 A;  1N33 Q;  2NVT H;  3TS0 A;  4IPC A;  3GTJ H;  3I56 A;  2IT1 A;  2YU9 H;  4JBM A;  3CCV A;  5GQO A;  2CWA A;  2PNH A;  3RR5 A;  1HR0 W;  3I4N H;  1S3O A;  5K36 G;  4B3R L;  3A0J A;  3PO3 G;  2CKZ B;  4QL5 A;  2IY5 B;  5JJK A;  4DR2 L;  1VCI A;  5FLM G;  4PZ7 A;  1N32 L;  1IXR A;  3JAM i;  1FJG L;  1KD1 C;  3G71 A;  1KHI A;  2OQK A;  3STB C;  4X64 Q;  4DV0 L;  1N34 Q;  1HZ9 A;  4C3I H;  4ALP A;  1XNR L;  3S17 H;  4A3I H;  1DGS A;  1KXL A;  4LUV A;  2V1C C;  2R7Z G;  2ZM6 Q;  2NZO A;  2N49 A;  5ELN A;  5GRO A;  2JA5 H;  3S2D H;  4JOI C;  4GOP B;  1VQI A;  4YY3 Q;  1A0I A;  2EQS A;  1TWF H;  1JE5 A;  1RIP A;  4X66 L;  3U58 A;  1Y14 B;  3J80 c;  4B3S Q;  1CSP A;  2JA6 G;  4BY7 G;  2R93 H;  3K0X A;  4GNX A;  4A3G G;  2C35 B;  3TEH B;  5IYC G;  1VQM A;  4DNI A;  4PZ8 A;  1LTL A;  4YWM A;  1SFO H;  1BVS A;  5IWA Q;  5C0X G;  2K5H A;  1T9H A;  1P16 A;  4DV5 L;  4A93 H;  1YEZ A;  4DUZ L;  1K83 H;  2GVB A;  1P8L A;  1X6O A;  4KHZ A;  3OTO L;  1VQA A;  5IP9 H;  2VQF Q;  4KHP Q;  2K5N A;  2Z6K C;  1VQG A;  4DPG A;  2Y0S E;  5AJ3 L;  4LWC A;  1XJV A;  2GN5 A;  4A3F G;  1NY4 A;  3F2D A;  2I5L X;  2YV5 A;  4A3C H;  1VQ6 A;  4A76 A;  5C3E H;  4LFC L;  3M85 A;  4NB3 A;  1KC8 C;  2XTI A;  2Q2I A;  2UXB Q;  1VQK A;  5IT9 c;  3GTL H;  4BBR G;  4NXM L;  1AE2 A;  3ULL A;  1IBM L;  1A63 A;  2RCN A;  1OXU A;  1XNQ Q;  1Q46 A;  1MJC A;  4LUO A;  2ES2 A;  2Q2T A;  1XPR A;  2ATW A;  3H3V I;  4GKJ Q;  1GKH A;  4DR5 Q;  2VS1 A;  1EOV A;  3E0E A;  4YCV A;  1NTG A;  1QUQ A;  1VQF A;  4B3T Q;  4JI8 L;  1XMQ L;  1K0R A;  1Z9F A;  1X3F A;  4L5T A;  4LF7 L;  4DV4 Q;  4DAY B;  1Q7Y C;  4BA1 I;  1MIU A;  3ER0 A;  1FL0 A;  3HOW H;  4BXX G;  1A62 A;  1SE8 A;  2JA7 G;  2BH8 A;  4YCW A;  4GN5 A;  1XMO Q;  4GLV B;  4JI5 L;  4P75 A;  4R4Q A;  4X65 L;  4HJ8 A;  1WOC A;  4IPH A;  2JEA I;  4A3B H;  3F8T A;  2NVQ H;  2KHI A;  2UXC L;  2F3I A;  1UWV A;  4JI1 L;  1L0W A;  1I94 L;  3HFZ B;  2KBN A;  1YJN A;  4QJF A;  2E2I H;  3I4N G;  3T1H L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...