3GTMH

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtmH00
3I4NG 1E24A 2ZTDA 4UP9A 3U58A 5IP9G 4JI3L 2OWOA 3BZKA 1HR0W 1Z9FA 3CCEA 5ELNA 3GTKH 2UXDQ 4IPGA 4DV4Q 3BU2A 1VCIA 3CF5A 4QL5A 1PA6A 3J81c 1YITA 3W1BA 2ASBA 4X66L 3FP9A 4JBKA 2YTVA 1PH8A 3ULPA 2BA1A 3UDIA 1NJIC 2HIXA 5AJ3L 4GNXB 1GM5A 1MJCA 3PO2H 1JT8A 1JJCB 2BH8A 1I6HH 5C0XI 1JJ2A 1Q8KA 1EFWA 2R7FA 3M9BA 3RZOH 3A0JA 1Y14B 1SFOH 1N32L 1TWFH 3GTPH 4X65L 3A5UA 1MIUA 4OXPA 4DV4L 3T1HQ 1YZ6A 4JBJA 1VQOA 4A3BG 1E7ZA 1N34Q 2F4VL 1BBUA 3RLNA 2PNHA 3M4PA 2PI2A 1LYLA 3U4VA 4IFDJ 5IYDG 3RLFA 3SGIA 1VQGA 5IYCG 2K14A 3UDFA 4DV0Q 2OQKA 1YNXA 1PH9A 2R7DA 5IP9H 5IT9c 1YHAA 5FLMH 4JI5Q 1VQ7A 1WOCA 3NEMA 3VDYA 1SMXA 1GD7A 5H1SE 4GNXC 2IHEA 4A3EG 3K0XA 3H3VH 1C0AA 3WWVA 1E1OA 1FL0A 4LF4L 2K52A 1X56A 1L1OB 2YTYA 4JI7Q 3S1RH 4A3IG 3HOUH 4R4CA 1VQ9A 2JE6I 1EYGA 1XNRL 5C0XJ 3F1ZA 4C2MH 3JAMc 4R4QA 1XJVA 1X54A 2CCZA 4A3CH 1W2BA 4JI5L 4NB3A 2JA6G 1HNWQ 5C4JH 1I50H 1UE6A 4BY1G 2KENA 1WJJA 1IBMQ 5GROA 3JC66 3AYHB 2AMCB 2N78A 3GTOH 1X65A 3G71A 1HNXQ 2VL6A 4JI7L 1YVCA 3S24A 4K0KQ 1N9WA 3I4OA 2JEAI 3K81C 3HOXG 4XIGS 4LF8Q 3CXCA 2CFMA 1N33Q 4A3JH 3KDFB 2R93H 1T9HA 4BBRH 2OTJA 4DR3Q 1VQPA 4LF9Q 4OONA 3S1QH 1L0WA 2HIVA 1KD1C 1BBWA 2VZAA 3CC2A 3E9HA 2UU9L 4LWCA 2JA5G 4LF7Q 3JAMi 4OX9L 4PMWA 4YWKA 5LMNL 1WYDA 4GN5A 2UUBQ 1IBLQ 1UE7A 2PQAA 4DUZQ 4A3IH 1Z47A 2ZM6L 1C7YA 3HOUG 4B3RL 4GOPC 4JG2A 4A3KH 4EQ5A 3ZJYC 4L5SA 2DUDA 5JEAG 4QGUA 2NN6G 2E2IH 1B8AA 4LUOA 3HOWH 4DV7L 4GKJQ 2Q2IA 1IBKL 3HOXH 1NBWA 2UXDL 1PH7A 4OO1G 1C9OA 3MEFA 2AWNA 5M3MG 1S3OA 1KQSA 1G291 1OTCA 4R4IA 4JI1L 3STBD 1MJEA 4BBSG 1QVGA 3BJUA 3F8TA 2ES2A 1BVSA 1CKMA 2MQHA 1LM0A 3HOYG 4P72A 1IBKQ 3J7A5 4JI2Q 4ME3A 3TEHB 4DKAC 3GTJH 3T1HL 4PG3A 1KL9A 1XMOL 1SR3A 3NBHB 1RL2A 1J6QA 1XPOA 2I5MX 1HZCA 4KHPQ 2OTLA 3ULLA 5JJLA 4DR5L 1EQRA 4YY3L 4L5QA 3RN2A 4JC0A 3HOVH 1XNQQ 3I7FA 2XTIA 4JV5L 1FJGQ 4OWXB 3CW2C 4A3DG 2R92H 1WFQA 4DR4L 3ERSX 1G51A 3HOWG 3S16H 2I5HA 3F2BA 1NMFA 1QUQB 2ZJPA 1KXLA 3CAMA 1I5FA 3E0EA 3PUWA 5GAGC 2UUCQ 4BA2I 3RZDH 1A8VA 2EIFA 4BBSH 1LTLA 3S15H 3A74A 3PUZA 4A3EH 1YHBA 4A3JG 1Y1VG 3HKSA 1XTDA 3D31A 1PYBA 1Q82C 1YJ9A 3L7ZC 3T1YL 2LXJA 4H02A 2Q2UA 1ASZA 3HOYH 1OXXK 1K73C 5FJ8G 1PV4A 4JI4L 2VY3A 4BY7H 5JJKA 4JI6Q 3KLWA 1PH4A 3TS0A 2OQ0A 1PHJA 5GQOA 4B3SQ 4LF8L 1Q12A 4KHZA 1N33L 1V43A 4DV2L 3UDXA 3CCLA 3PUVA 4NXMQ 1WCMH 3TQYA 4A3GH 4JBWA 4Y52H 1AH9A 1SROA 1PH5A 4UP7A 3CP0A 2KCMA 3T1YQ 1PH3A 1D7QA 3CCJA 4JYAQ 2I0QA 3PO3G 1CSPA 2KHJA 2UXCL 2PMZE 2VQFQ 3I4MH 1X9NA 3ER0A 3H0GH 1GKHA 2R92G 3S14H 1AE3A 5M3FH 4B3SL 1I94L 1U0LA 4C3IH 3M3YH 2R93G 4X6AH 4DUYQ 4DR7L 1V1QA 3KF6B 1IYJB 1B70B 2ZM6Q 2JA8G 2C35B 1XPRA 4MTNA 2RHSB 1EOVA 5LMUQ 3EBEA 3U50C 2VUMG 4IJHA 4PZ8A 3OTOL 4FDBA 4BY7G 4AQYQ 2MNAA 1DGSA 3I2ZA 4OWTB 4GKJL 2VUMH 2ZTCA 5IY0A 1VQ4A 4JBMA 4HJ9A 1Q86C 3PUYA 2MFIA 5FJ8H 1VQ5A 3OYYA 4LUZA 2A1AA 2Z6KA 1UEBA 2JK8A 5C44G 3CCVA 1VQHA 4KI0A 5C3EH 4LFBL 4A4IA 3K8AA 4GS3A 4HJAA 2N8NA 4HJ8A 4P73A 5BR8L 1N36Q 5GADC 1N8RC 1VQMA 4YWMA 3DLLA 2ZJQA 3UE1A 4A3BH 4APVA 4A3GG 3W5OA 2YV5A 3TREA 1J5EQ 3EIVA 4X64Q 1AE2A 1VQFA 4AYBE 1NTGA 1XMOQ 3M4QA 1E3PA 4LF4Q 5DLQE 3L0OA 1OXVA 2NZHA 4NPSA 4R1JA 1QVCA 2N3SA 5IE8A 1HR0L 4P75A 4JI0L 4GKKL 1KC8C 5FLMG 5JJIA 5C4XG 1N36L 3CPFA 2K5HA 4DR5Q 1XNRQ 2KBNA 3U4ZA 2KHIA 1A62A 2HQLA 2AWOA 1FVIA 3OW2A 4KLKA 1PH6A 4LFCQ 2E5LQ 2IT1A 2UXBQ 4LNQA 3F2CA 3CCRA 4DR4Q 2PI2E 3KF6A 1EWIA 1R9TH 3IRBA 1SRUA 2ALYB 2NVXH 4X62L 3UE0A 4LF5L 1CKNB 2WB1E 4YWLA 3STBC 1OXUA 1K3RA 1A0IA 4GN4B 2JA9A 1CUKA 5IP7H 4IFDI 2UXBL 1WCMG 2IHFA 2JEBI 4LF9L 3PUXA 1Q1EA 1ASYA 4B3TQ 1UWVA 2JQOA 4DV1Q 5J3BA 1HNZL 4X62Q 2D0OA 3KDFA 3UDGA 2NVQH 3PIOA 1PH1A 1HH2P 2A19A 2MO0A 4LUVA 4DK3C 3KOJA 3S2DH 3K80C 4RG1A 4PZ7A 1D8LA 3HKZE 2JJQA 4AYBG 4DUZL 2DGYA 2HT1A 1M90C 3ICEA 4B3RQ 2QGQA 1IBML 2LXKA 1K0RA 3F2DA 2ZJRA 4DV5Q 4DR2L 3CD6A 4YHHQ 1KAWA 4DR1Q 2VQEQ 3GTLH 4DV7Q 4A75A 2F52A 4L5RC 2AHOB 3EN2A 3GDEA 4ALPA 3RN5A 2CWPA 4AIMA 1L1OA 2BH2A 3GTMH 1A63A 4GOPA 4QY7A 1S40A 3D0FA 1SLJA 3KYHC 2BA0A 4HJ5A 3PO3H 1Q1BA 3E9IA 4DK6C 1HZAA 2VQEL 1Y1WG 3HOVG 1EQQA 1JJGA 4BY1H 2RF4A 4LF7L 5M3FG 4OX9Q 1XMQQ 2K5NA 1PH2A 5IYCH 1TWHH 3HKZG 4EX5A 3MXNB 1XPUA 5FLXc 3RLOA 5AJ3Q 3L2PA 1GO3E 2ID0A 2IX1A 5GAHC 4GLXA 4B3ML 3CCSA 5BR8Q 4DAYB 2NN6I 4A3FG 3PGZA 3J7ZC 4A93G 2I5LX 5M5YH 4X65Q 4A3FH 1YEZA 1SN8A 4JCVE 1J5EL 4X64L 5C44H 3LGJA 2GVBA 4OO1I 1P16A 4MNOA 2K75A 4A3MH 1CKOA 3G48A 1QZGA 4UPAA 1YJNA 2E2HH 4JI0Q 4MZ9A 3J80c 2A8VA 4YCVA 2F3IA 4A3LH 4DV0L 1WI5A 4P71A 2CWAA 4YCUA 4A3LG 4IJLA 2GN5A 4QJFA 2NZOA 2MO1A 2Z0SA 2E5LL 4IO9A 2Q2HA 3A5ZB 4POGA 2R7ZH 4R4TA 4X66Q 1GVPA 4NXNL 4DPGA 2N49A 2K5VA 3AQQA 4GN3B 1QVFA 3I4MG 4JI6L 4LF5Q 4DAMA 3I56A 2Q2TA 4YY3Q 1N32Q 1FGUA 1JE5A 1VQ6A 3S2HH 1V9PA 3NENA 1PYSB 1PVOA 2OCEA 4JOIA 4C3JH 1IXRA 4IPCA 5JEAJ 2KCTA 2JA5H 2F4VQ 2K4KA 4B3TL 1LUZA 1UE1A 4HIKA 4A3MG 1HNZQ 2VQFL 1KRSA 2B3GA 1OXTA 4K0KL 2WAQE 2WP8J 2AKWB 2UUAL 1NE3A 4GOPB 1B7YB 4A3KG 4P74A 1VQCA 1VQAA 5IP7G 5IWAL 2QA4A 4DUYL 2H5XA 4YCWA 3S1MH 4DR3L 1VQJA 3ULJA 4A3CG 3CMAA 4QIWE 2HHHL 4QQBX 4YHHL 2JA6H 2B29A 4GLVB 3H15A 2V1CC 4AQYL 5IYDH 3M7NA 2NVYH 5IYBH 2UU9Q 2YU9H 2R7ZG 1QUQA 3I55A 1SE8A 3K7UC 3J80i 5GAEC 3CC4A 4NXML 4O0AA 2E2JH 1X55A 2EXDA 2RCNA 3KF8B 2QEXA 2WFWA 4IPDA 3W1GA 2HHHQ 4JI8Q 2IX0A 3RNUA 1QZHA 5C4XH 3GTGH 1PFSA 4HIMA 4C3HH 1TWCH 3B6YA 3K7AH 4RMFA 2VW9A 3CPWA 1JB7A 2K50A 2WAQG 3G6EA 4HJ7A 1YI2A 3CCUA 1KIXA 3TS2A 1TWAH 2PQAB 1CSQA 3CQZH 1XMQL 3TRZA 5C3EG 4DR7Q 2WB1G 1E22A 4TVAB 2GVAA 2IY5B 3CC7A 5EAYA 1G6PA 4JI8L 1YHQA 1HR0Q 5LMUL 4B3MQ 2CQOA 4TQUS 1OXSC 4GLAC 3OTOQ 1Y1WH 3HFZB 3CMEA 1Q7YC 1L1OC 4WJ3M 2Z6KC 2L15A 4LW1A 1YJWA 4IOAA 1P8LA 1O7IA 3AFPA 3RR5A 4IOCA 1BKBA 1JMCA 1VQKA 2B63H 3CCMA 1YBYA 3M4OH 2LSSA 3S17H 3H3VI 1NY4A 1VQ8A 4GKKQ 4IFDG 4BBRG 1VQDA 5IYBG 2XGTA 3KJOA 3I4NH 3DM3A 3CCQA 4KHPL 1TXYA 2D62A 5M3MH 3AFQA 3PF5A 1L2FA 1W3SA 4J15A 3FHWA 1EUJA 1U5KA 4O2DA 1H95A 3PIPA 2JA8H 4A76A 1RIPA 3PCOB 1VQLA 4POFA 1FJGL 1KHIA 4BXXH 1N34L 1VS0A 5HGQA 4NXNQ 1VQIA 1UE5A 4HIDA 1IL2A 1CKNA 3NELA 4DR6Q 1I3QH 4Y7NH 1X3GA 5ELOA 4DV1L 1XNQL 4JI1Q 1Q46A 3J81j 3GD7A 3S1NH 1TWGH 4DNIA 3GO5A 1VQNA 2R6GA 1KRTA 1HZ9A 2VS1A 1NMGA 4LFCL 4BA1I 4JI2L 4LF6L 2VNUD 2ZTEA 4DV5L 4DR6L 4DR1L 2Y0SE 3J81i 4A3DH 5K36G 2YTXA 4XTCS 1VQBA 4JOIC 1E1TA 3G4SA 4DV3Q 3FKIH 4DV6L 4PZ6A 2UUAQ 2JA7G 5M5XH 5IWAQ 1HZBA 4DV2Q 2JA7H 4UP8A 4JV5Q 3PV0A 1HNWL 5HY6A 4LF6Q 2E8GA 4AH6A 1MKHA 2Y0SG 3PSIA 4BXXG 1VQEA 4JYAL 1Y1VH 4OWWB 2UXCQ 4UY8C 5E7NA 1HNXL 3M85A 2UUCL 3GTQH 4A93H 1EIYB 1HJPA 4DV3L 4DV6Q 3PO2G 4GNXA 3KFUA 1I94Q 4IPHA 2NVTH 4HIOA 1K8AC 5C0XG 3KJPA 4LFAQ 2EQSA 1EIFA 1K83H 3Q8DA 3BZCA 1X3EA 4L5TA 4DR2Q 1S72A 2CKZB 1YIJA 2FXQA 1IZ6A 4JI4Q 1K9MC 4JI3Q 3HOZH 2YYZA 2RHQB 3FKIG 5LMNQ 2D0PA 3HOZG 4WJ4A 3H0GG 2UUBL 2ATWA 2B63G 1K8GA 5LMNW 1IBLL 3AEVA 5M5WH 3PF4A 1X6OA 4LFAL 4R4OA 1X3FA 1M1KC 4LFBQ 1Q81C
chains in the Genus database with same CATH superfamily
1E24A 1IYVA 4UP9A 5C3EB 4U68A 2OWOA 3URYA 3CCEA 5ELNA 4DV4Q 1W6JA 1BCPD 3BU2A 3CF5A 3FP9A 3ULPA 2BA1A 5AJ3L 1GUGA 1I6HH 1Q8KA 1SNQA 4C3IB 4G7HC 4N8FA 4KKSA 5KGUA 1Y14B 3GTJB 2DNCA 4F8MA 4X65L 3A55A 3MA2B 2A6ED 4DV4L 4Z9CB 4JBJA 1SNCA 3O13A 3C46A 3N6RA 1LYLA 4IFDJ 5IYDG 3TMEA 3SEBA 2OQKA 1PH9A 2R7DA 5IP9H 3E0JA 3VDYA 1SMXA 1GD7A 2KVMA 5IGCA 1QNKA 2K52A 1JOKA 1G2SA 1X56A 2Z8LA 2M2LA 3IKJA 4A3IG 2KJXA 4R4CA 1CFMA 1EYGA 3VR5A 5C0XJ 1XJVA 3JAMc 5EBCA 4BY1G 1KNEA 3OW7A 3I4NB 3AYHB 1O78A 2JA7B 1X65A 1GUNA 2X6GA 4K0KQ 2JEAI 3HOXG 4XIGS 2CFMA 2MP1A 2R93H 2K6AA 1OO9B 4DR3Q 4LF9Q 1U4RA 1S5DD 1L0WA 4CDFC 3IFTA 2NZ1D 2VZAA 1EIGA 2JA5G 2LS01 1WYDA 2M9VA 3X3NA 2DNEA 1ILQA 4RGNA 1UE7A 2PQAA 4DUZQ 3T53B 2ZM6L 1C7YA 2FJ2A 1PTOD 4JG2A 4EQ5A 2E76C 2F0KA 2EJMA 2NN6G 4F87A 1B8AA 3HOWH 3AU7A 4OHJA 2B2YA 4IN3A 1NBWA 4TKOB 3P20A 1PFNA 1HFGA 1QILA 3FEWX 1G291 1PZKD 1BDOA 2XVSA 4BBSG 5IGFA 4C3JB 3BJUA 1CKMA 1HUMA 1Y8PB 1XYIA 3G6JB 1YNJD 3NTKA 3GTJH 1EQVA 4RKBA 1PRTF 2FHTA 1RL2A 1O7ZA 1HZCA 1XTCD 5T1GA 3J80L 1EQRA 4DR5L 4L5QA 3LX0A 5D14A 2XTIA 1FJGQ 5JEAH 3CW2C 1WFQA 1VF7A 1B3QA 1SYFA 2EVBA 3RZDH 4BBSH 2EIFA 4XXEA 2B2UC 4A3EH 1Y1VG 3HKSA 3NTHA 1NNXA 3IL8A 4JI4L 3NPPA 2PMZB 2VY3A 1TIID 3RMHA 3T56B 3V2TA 5JVH3 4UAIA 2OQ0A 3TS0A 4RGTA 1Q12A 1JR0D 4KHZA 1EZ8A 2K5QA 3TQYA 4A3GH 4Y52H 2KCMA 3D6CA 2UXCL 2VQFQ 2ZXPA 1GKHA 1AE3A 4B3SL 1U0LA 4C3IH 4DN4M 2R93G 1V1QA 3KF6B 4YIJA 2E74C 2XWBB 1IYJB 1B70B 1LLRD 2JA8G 3CKIB 4IJHA 2JP1A 1O80A 4BY7G 2K33A 2VUMH 1CHPD 1V8QA 3AMUA 1Q86C 2A1AA 3A8IE 5C44G 1VQHA 4ZLTF 4NDXA 2X6LA 3TP5A 2J4XA 5BR8L 3BS1A 5GADC 3S2DB 4FF2A 4BWGB 4UHVA 5C4JB 2YV5A 2QF7A 2DJFC 4B08A 1VQFA 1NTGA 1DXMA 3SK6A 5A35A 1SJHD 2NZHA 4CDDC 5IE8A 1XNQQ 1QVCA 1HR0L 5C4XG 2HCIA 3U4ZA 3MWYW 4J8QA 1D5MC 2IT1A 2J7ZA 2EXZA 2BOSA 1B4OA 1EWIA 1V1PA 1HPCA 2NVXH 1R4QB 1YNNC 4X62L 4QUCA 2A6HD 3U9SA 1K3RA 4IFDI 3L3OC 1TWFB 4LF9L 3PUXA 1Q1EA 1IYUA 5IGGA 4B3TQ 3SXHA 4DV1Q 5J3BA 1HNZL 3A54A 3KDFA 2NVQH 1PH1A 2Q8TA 2EZVA 2MO0A 1RJTA 1MHWC 4HTHA 4RAUC 3EVQA 1D8LA 2JJQA 3E6ZX 4DUZL 1M90C 1IBML 4DR2L 1K0RA 3MTSA 3F2DA 2ZJRA 5HURA 4HCEA 3A7AB 3CD6A 4DR1Q 3GTLH 3E5SA 2F52A 4ALPA 2I07B 2K32A 1CZGA 1A63A 1H9RA 4F7XA 4DK0A 3A8KE 1ILPA 1S5FD 4DNTB 2K01A 2VQEL 3QO2A 2B63B 2PW5A 1Y1WG 1EQQA 4BY1H 2RF4A 1TQOA 5C6AA 5KYLA 4N8X1 1DCZA 2AUKA 2VUMB 3SK8A 3RLOA 2MHVA 5AJ3Q 2K5WA 3VYSA 1GO3E 2ID0A 4B3ML 4ODGA 3CCSA 1PTOC 2NN6I 3PGZA 3J7ZC 4X65Q 3MC0B 1SN8A 4JCVE 2R61A 4X64L 1J5EL 2JSOA 3LGJA 2GVBA 3U9OA 4OO1I 1P16A 1KDCA 5IODA 3SDZA 5IIFA 4KK7A 4MZ9A 5DM63 1WI5A 1S5ED 4YCUA 4FXGC 1E0BA 2E5LL 2L11A 3CQZB 2QDBA 2NTSA 2R7ZH 1TY2A 2R92B 1SNMA 1Y8OB 3AQQA 2K5VA 1QVFA 2O5JC 3S1MB 3HOYB 2ZXRA 2B2VA 5I2YA 4LF5Q 2F0GA 4YY3Q 1FGUA 3H3VC 3S2HH 3NENA 1W6KA 3VR2A 1IXRA 5JEAJ 3HOXB 3BDOA 2KCTA 2F4VQ 1U4LA 2MUYA 1UE1A 2O4XA 3NXWA 2VQFL 1OXTA 4O42A 1NE3A 1RTNA 2GA4B 5F2DA 5IP7G 4G7ZC 5C4ZA 5K5PA 4YCWA 1CM9A 1IHZA 4ZAIA 1D6EC 4DR3L 5D3DA 3UI2A 2CW0D 3ULJA 4A3CG 1X3QA 2JA6H 1LT4D 5K36H 2DY7A 2EY1A 5IYDH 3S1QB 2EYHA 4RCOA 1QUQA 3K7UC 3QIAA 4NXML 3EROA 2RCNA 3P75A 4ZUJA 2R93B 4C3HH 1FNWA 3B6YA 3K7AH 3D6WA 3G6EA 2IPKD 3VYTA 3GP7A 3CQZH 3TBIB 4XT1B 3ND8A 2CH4A 1HR0Q 1TWHB 3C2PA 2CQOA 2MJ8A 1Y1WH 2NYZD 4M8AA 4TSSA 4LW1A 4ZKCB 4MTKA 3AFPA 3RR5A 4FNFA 4IOCA 1BKBA 4Q5VA 1VQ8A 4GKKQ 2DJGC 2SDFA 1HTLD 1VQDA 2J0TD 1SFOB 1EY7A 5M3MH 3QWNA 1EWHA 1STBA 2B2VC 3Q23A 1XX8A 3PCOB 1FJGL 4BXXH 1IL2A 4NXNQ 4HIDA 4QB4A 2XRSD 1I3QH 1NUCA 5JPMC 4R9WA 3WOFA 3S1NH 3DXJC 4HR7B 3PMFA 1UUPA 4BA1I 2VS1A 4LFCL 2WIIB 2NVXB 2LFNA 2ZTEA 3VA5A 2QEJC 1CTMA 3RD4A 1CI3M 1E1TA 4DV3Q 1LTSD 3TDQA 4EQNA 4PZ6A 4EQOA 2UUAQ 3NSWA 2F0UA 1HZBA 4KD3A 4UP8A 5EJWA 2E8GA 4BXXG 4JYAL 4OWWB 4UY8C 3M85A 3K5LA 1PXUA 2EJFC 3NWSA 4DV3L 2K03A 3M7GA 3J81E 4HIOA 1K8OA 4KV6A 3GV6A 1EIFA 1K83H 1X3EA 1HRJA 1S72A 1EZ6A 4FXKC 4JI4Q 4JI3Q 1ZXTA 1VF5C 2D0PA 3SK4A 2RQXA 5EKKA 2UUBL 2B63G 4LFAL 1CHQD 1TR5A 3R8BA 3I4NG 1AFPA 3U58A 5IP9G 4JI3L 4M1UB 2F0VA 3BZKA 1Z9FA 2UXDQ 4IPGA 4DFAA 1VCIA 4QL5A 4ME5A 3J81c 2VNUD 3W1BA 3BVGA 4JBKA 1GM5A 2A74C 2HIXA 2Z1CA 2NVYB 5C0XI 3RZOH 1GJXA 1STHA 1SFOH 3GTPH 3J81L 1MIUA 3I4MB 1EOTA 3T1HQ 1H9SA 2B2YC 2NVTB 5ELEA 5M3FB 1RF2D 3RUZA 1BBUA 3CRKC 1N34Q 1JWMD 2F4VL 3SGIA 1YNXA 1SE2A 1UEAB 2C9OA 5FLMH 3PIP3 4L8JA 1VQ7A 4JI5Q 2XIWA 3NEMA 2E75C 3H3VH 3K0XA 5KNCA 1FL0A 4C3HG 1GHKA 2YTYA 3S1RH 3DMUA 2C5CA 2QDLA 1LV9A 2CCZA 1X32A 3MFGA 4JI5L 1XWEA 1HNWQ 1UE6A 5GROA 3JC66 2AMCB 5JPNC 3PIO3 2F0NA 2N78A 2Q8RE 5I6WA 1CQFA 1GUOA 1HNXQ 1YVCA 4S3SA 1TKWB 3K81C 4ZRZA 4OO1H 2TMPA 1Y1WB 4QIWB 4IFDH 1I4PA 2Z4IA 1T9HA 4OL7A 4NP5A 5CV8A 1PRTC 3FMCA 1IKLA 3S1QH 1HXYD 1F2LA 1KD1C 3D3RA 2A6EC 2UU9L 1BXTA 4LWCA 1DJRD 1DOKA 4YWKA 4ZYSA 1IBLQ 3Q0AA 3C1EA 3HOVB 4A3IH 3CU7A 5C5MA 4L5SA 1STNA 4FVMA 1RDPD 2E2IH 3SK5A 4CKCA 4GKJQ 1GXDC 2Q2IA 4OO1G 3A8JE 1IKMA 2F0IA 4P2CB 5J22A 1KQSA 1TU2B 1D2BA 3STBD 2WINB 3S1RB 5CV4A 2ES2A 2RDFA 1EY4A 2MQHA 1LM0A 1ZYRC 3HOYG 2XSCA 3NUCA 3J7A5 3ERQA 1NR4A 2WAQB 3T13A 4TRDA 1J6QA 2I5MX 1IW7D 1HQMC 3K5OA 3RN2A 4K8JA 3NK9A 1QNUA 4OWXB 2R92H 1STYA 3ERSX 1G51A 3HOWG 1BCPC 4N9PA 2R7ZB 1WTHA 3CAMA 3E0EA 3PUWA 5GAGC 3H91A 1ONLA 1Y8NB 4HN7A 3A74A 3PUZA 2E2DC 4A3JG 1XTDA 3D31A 4DGZA 1EL0A 3GTKB 1GUTA 1YJ9A 2LXJA 4H02A 4PMCA 1WTWA 1K73C 1PV4A 2CHBD 3NTIA 1AZPA 2D5DA 5E3FA 1PHJA 1JWUD 4CHTB 4B3SQ 1NAPA 4DV2L 3DHQA 4NXMQ 3MXGA 3HEJA 4UP7A 3T1YQ 2KHJA 3R2IA 1X9NA 4HMIA 1I4GA 3S14H 4I7ZC 1I94L 3NQTA 3M3YH 3KLSX 2H4OA 5FLXL 5EGTA 2VB2X 4PZ8A 4U673 1I6HB 4AQYQ 1R9TB 2B8FA 5HGTA 1PTOH 5FO9B 2VB3X 3T4AC 2MFIA 3TZDA 3D4WA 5FJ8H 2Z6KA 1UEBA 2HCCA 1RCVD 3CCVA 4LFBL 2N8NA 4P73A 4B9XA 5KNDA 1BBXC 4KTAA 2B39A 4YWMA 4A3GG 1C48A 5FO8B 1B9NA 4L6TB 4WRDA 3M4QA 5TSSA 1XMOQ 5DLQE 1IW7C 3L0OA 4R1JA 2N3SA 4MHEA 1VMPA 2BE5D 4NW2A 4UDUC 5I4DA 2AQ1B 1I3QB 2KBNA 2KHIA 2O5IC 1WTXA 4CKBA 1LTTD 4HAEA 3KF6A 2F0MA 1SRUA 2ALYB 3FRPB 2F0LA 2G9DA 1QB5D 3K5NA 3UE0A 1CKNB 4KY5A 1SYCA 4HEDA 1L0XB 3T16A 1S5BD 2IHFA 3RZOB 5LL6X 4HCSA 1DONA 2D0OA 2AUJD 1Q3LA 3PIOA 3S2DH 3KOJA 1QCBD 4RG1A 1F9QA 4BBSB 2B8GA 4YHHQ 1KAWA 1F77A 1Z7TA 4KN7C 2VQEQ 3K5MA 4A75A 1X3PA 3RN5A 2CWPA 2BH2A 4GOPA 1S40A 2FMCA 2PZTA 3QOJA 2BA0A 1V1OA 4HJ5A 1R4PB 1HZAA 2SEBD 4Y7NB 3HOVG 2I46A 1JJGA 2PPBC 2KCCA 1WTQA 1PH2A 5IYCH 5EPLA 3HKZG 1XPUA 4GLXA 1LTRD 3V96A 4A3FG 5CBAE 2ICIA 2I5LX 5M5YH 3HOWB 3Q24A 5C44H 3FKIB 1BO0A 4MNOA 1I4XA 2KA7A 5E1FA 3J7AV 4DXFA 2F0PA 1A3VA 4UPAA 3FDTA 4JI0Q 3BVZA 4P71A 4RA8A 2CWAA 1B1ZA 4RGOS 2NZOA 1GOZA 4Q0FA 2EYLA 3NHHA 4DPGA 4GN3B 4JI6L 5COYA 2Q2TA 4EGVA 4IUNA 4IPCA 3NWTA 3W2DA 4FF1A 5AFWA 4B3TL 1Z6HA 1LACA 1PDQA 1KRSA 2B3GA 1HNZQ 3I4LA 4K0KL 2WP8J 2AKWB 3S2HB 1B7YB 4A3KG 4P74A 1VQAA 2QA4A 1K8MA 1XXGA 5KYIA 2H5XA 1Q8IA 4QQBX 1NR2A 2ENBA 3NBIA 2IL8A 4AQYL 3F2UA 1IL8A 3GTOB 5IYBH 2UU9Q 2YU9H 1K3BC 1YNND 1PTOF 5M5YB 1FD7D 2A6HC 3J80i 4RWSC 2NVQB 4O0AA 1X55A 4KN4C 2WFWA 2HHHQ 1QZHA 3MXPA 3KF8A 1AW7A 3P1HA 4HIMA 1TWCH 2VW9A 1SMYD 3CPWA 1JB7A 1EFID 2K50A 3CCUA 1KIXA 1MD2D 2PQAB 1CSQA 3ND9A 1XMQL 1GHJA 4KY6A 5C3EG 1SJED 4RHSA 2WB1G 1E22A 2GVAA 2IY5B 1G6PA 4GZYC 4JI8L 2E2IB 3JAME 5EPJA 4B3MQ 2JA6B 4TQUS 1OXSC 1I6VC 2PW7A 3OTOQ 3C3LA 2L15A 1VQKA 3SVMA 3M4OH 2B63H 3CCMA 1A2UA 3VR4A 4IFDG 1HTPA 3I4NH 3CCQA 1EU3A 3PF5A 3AFQA 1L2FA 4LJZC 2EYPA 1QOHA 4I7AA 2JA8H 1FYCA 4A76A 4JW0A 3Q22A 1SNPA 4JK1C 5M9OA 1VQIA 1CKNA 1X3GA 2WKDA 1MI2A 3GD7A 2Z4HA 2NTTA 2ZXOA 1RD9D 3GO5A 1KTKA 4IUUA 1ZKOA 3BZDB 1D5ZC 5EBDA 1RKNA 4DR6L 4A3DH 1HA5A 4ZKBB 4AYBB 4K8IA 2SNSA 4ZK9B 2JA7G 3G4SA 3MVVA 1JORA 1TVXA 5IWAQ 2H1EA 3PV0A 5T1IA 5HY6A 4DAYA 5L37A 2Y0SG 2DN8A 1Y1VH 2UXCQ 2EYOA 1Y1VB 1EIYB 1HJPA 3C1FA 3PO2G 1HFNA 1WD1A 1ENFA 1I94Q 1NSNS 1DOMA 1K8AC 4LFAQ 3HG9A 4L5TA 3Q8DA 3DWPA 3BZCA 4RH6A 2CKZB 1YIJA 2FXQA 1F9SA 4A3DB 1SYBA 2RDHA 3HOZH 2YYZA 3EA6A 3NP8A 2RHQB 3FKIG 5LMNQ 2OXPA 1ICFB 4WJ4A 4A3GB 3H0GG 3OSOA 3PF4A 5M5WH 4R8NA 1SXTA 1M4VA 5IT9E 1X3FA 1M1KC 4LFBQ 1Q81C 4XQJA 4H7BA 2ZTDA 3LWEA 3QR8A 3DWAA 1QJOA 1HR0W 2NWGA 4K6DA 1ESRA 1PA6A 3W3AA 1YITA 5CYUA 1PH8A 1NJIC 1JT8A 4C1NK 4GNXB 1MJCA 2BH8A 2B2WA 1EFWA 3NE5B 3H09A 1N32L 1TWFH 3TZUA 1M8AA 3A5UA 1G2TA 1HCZA 3M3YB 4A3BG 1E7ZA 1PFMA 4NMZA 2PNHA 4IQZA 2PI2A 4G7OC 3ONAB 2E2JB 1VQGA 5IYCG 1EYAA 3UDFA 1ML0D 4XQQA 3TSSA 4GNXC 1E1OA 3HOUH 1VMCA 1VQ9A 1XNRL 3BG3A 3F1ZA 4C2MH 3RZDB 3SHLA 4NB3A 1CT1D 5C4JH 1DM0B 2KENA 4FO2A 4JVZA 1IBMQ 3IFDA 5I6YA 5BN3A 3GTOH 3G71A 2VL6A 3S24A 5DNFA 4LF8Q 1J9OA 2F0DA 3CXCA 3AB9A 1D1IA 1N33Q 4A3JH 1JICA 3VYUA 1VQPA 2L9HA 4PMBA 1S4ZA 3E9HA 2B2TA 3HP3A 1E2WA 4GN5A 2UUBQ 4XYQA 1B44D 5C3WA 3WDNA 4A3KH 3ZJYC 2DUDA 5C44B 1TS4A 4LUOA 4DV7L 2YU9B 2UXDL 1PH7A 2XN9C 1C9OA 3MHBA 1S3OA 1U4PA 4K6LA 1MJEA 1QVGA 4WORA 3F8TA 1BVSA 4P72A 4E6IA 3TEHB 4ME3A 3T1HL 4PG3A 1TS2A 1KL9A 1CA6A 3NBHB 2K5DA 2OTLA 3ULLA 2B2UA 4YY3L 3HOVH 4KHVA 1STGA 3I7FA 3VYRA 4BBRB 4JV5L 4DR4L 2KEDA 1EYCA 3T51B 1KXLA 3QJYA 2K05A 4BA2I 1AN8A 1A8VA 2A68D 4IUPA 3S15H 1LTBD 1A6XA 5IT9L 3HOUB 4X3SA 1YHBA 4N9TA 5KNBA 1Q82C 4A3IB 3L7ZC 3T1YL 2XNAC 3HOYH 2O2LD 5JJKA 4JI6Q 2OEOA 1B3AA 4RCNA 1JCKB 5GQOA 4BY1B 3CCLA 4JBWA 1AH9A 1SROA 3PO2B 1D7QA 3CCJA 2I0QA 2F3VA 3PO3G 3HOZB 2PMZE 3ER0A 3R2TA 4A3MB 2MPMA 2EY6A 5M3FH 4XDXA 4KJOA 4X6AH 3OIPA 2BCOA 4ILWA 2ZM6Q 1BOSA 2C35B 1WD0A 4XT3B 2RHSB 3EBEA 1CA5A 2XWJB 2VUMG 1MGSA 3OPOA 3OTOL 1LABA 1DGSA 4MIUA 4K2KA 4OWTB 4GKJL 1RHPA 1D5XC 4A3BB 4JBMA 1SSOA 1EY5A 3QOLA 1VQ5A 4LUZA 3D8GA 1F9RA 4RKLA 1B9MA 4KD4A 3CRLC 4A4IA 1ZEQX 3K8AA 4GS3A 4HJ8A 1H9SB 4K2LA 1KAAA 1N36Q 1N8RC 2ZJQA 3DLLA 2L0CA 3W5OA 5NUCA 3EIVA 4X64Q 1J8IA 4AYBE 1STEA 1ENCA 1OXVA 2FMMA 2KOLA 4P75A 5FLMG 1N36L 3CPFA 3EJIA 4DR5Q 1XNRQ 2AWOA 2HQLA 1FVIA 3OW2A 4LFCQ 2UXBQ 4KY7A 3F2CA 3CCRA 2PI2E 1R9TH 2NBFA 1PFBA 2WB1E 4YWLA 3QG1A 5I2XA 1OXUA 2CQAA 4CJ0B 2L4NA 2JA9A 1CUKA 1PZID 3HRZC 2UXBL 3KK7A 5I9OA 1WCMG 1AZQA 4OIKA 4RGMA 2LMCB 1UWVA 2A69C 1B53A 3UDGA 1UNSA 1HH2P 2A19A 4DK3C 2F0WA 3K6OA 1QG7A 3HKZE 5G3LD 1SYEA 4FP5D 2HT1A 1BQQT 3ICEA 4H13C 2QGQA 3H0GB 4DV7Q 3GTGB 5CV5A 4FXDA 2AHOB 3EN2A 1FNVA 2BDOA 2AQ3B 2QILA 1L1OA 1A15A 5IGDA 1BCPB 4QY7A 1JWSD 1T5XD 3S1NB 1LT3D 1DOLA 1Q1BA 4DK6C 5A2QE 5C4HA 5CR3A 1JB3A 1DYQA 5CMDA 4KMUC 4LF7L 4CBVA 4B9WA 4OX9Q 3G7LA 2K5NA 3K7AB 5D65A 3MXNB 1PZJD 3L2PA 2R3ZA 4BS9A 2IX1A 1ET9A 5BR8Q 4CGYB 3MEHA 4R8IA 1A3TA 4A3FH 2L55A 2D9UA 1H9JA 2FFKB 1U9RA 2K75A 4A3MH 1CKOA 1QZGA 1A3UA 5CV7A 1YJNA 1QWYA 3J80c 4A3LH 2F3IA 4V0BA 3VR3A 1HHVA 4FYDA 5M3MB 4QJFA 2MO1A 4POGA 4X66Q 1GVPA 1Q90A 2N49A 5ELFA 3I4MG 5EQ0A 2ICEC 2A73B 3OMCA 5J39A 3MXNA 4DAMA 1QE6A 1N32Q 1JE5A 1VQ6A 1V9PA 2SOBA 1PVOA 3BYYB 4C3JH 3PO3B 2JA5B 4F88A 4HIKA 4A3MG 1AEXA 3WOEA 2UUAL 1VQCA 1NCVA 2B2WC 1KLGD 2L1BA 4J1MA 1VQJA 3K59A 1EY8A 1A2TA 3CMAA 4QIWE 2HHHL 2B29A 2FINB 4GLVB 4RHRA 3H15A 3FPPA 1EEFD 3LWUA 2R7ZG 3I55A 1BUVT 1MSGA 2XRQD 4C3JG 2EXDA 2F0TA 5ELCA 4IPDA 4JI8Q 3RNUA 1PFSA 1FNUA 4RMFA 2RKSA 1SBBB 2IW3A 2WACA 3TRZA 1EQTA 4DR7Q 5A2QL 3CC7A 5EAYA 4EQPA 5LMUL 4QCLA 4IUVA 3HFZB 3CMEA 2KECA 1Q7YC 1LTAD 2JN4A 4HMJA 5JOBA 1YJWA 1P8LA 1O7IA 4NKLA 1YBYA 2NUCA 2LSSA 3S17H 1FR3A 3OOCA 2Q8IB 2EJGC 1WTRA 4BBRG 4G57A 5E4WC 2XGTA 2RSNA 1AP0A 1W3SA 3HGBA 1H95A 4O2DA 4X3KA 1RIPA 4OIJA 5BN5A 4POFA 3N52A 5HGQA 4DR6Q 1UE5A 4CKEA 5ELOA 3VA7A 3SE0A 4IUQA 3J81j 4ABNA 4DNIA 1VQNA 2MGSA 2R6GA 1KRTA 2RA4A 5EKIA 4C1NI 2V4DA 4LF6L 4K5VA 1F2ZA 3J81i 4X3TA 2EYMA 3A56A 2YTXA 4XTCS 3HZXA 2F0OA 3FKIH 2F0FA 2DY8A 4DV2Q 1DZ1A 2JA7H 4JV5Q 2HUGA 1ET6A 4LF6Q 1KDBA 1MKHA 1VQEA 2N88A 2UUCL 3FPUB 3GTQH 2F03A 4KJNA 2A69D 3I90A 1WTOA 3KFUA 4IPHA 3J7AF 3J80E 5C0XG 3IAYA 3KLSA 2EQSA 4DR2Q 4DU9A 5IOCA 2AQ2B 5KRUA 1K9MC 5C5LA 4DXGA 1SDFA 1IBLL 3AEVA 4DAPA 2CH4W 3BDCA 1K83B 2KCNA 4R4OA 1CZWA 1G8ZD 1G91A 2F0EA 2CW0C 4I65A 1STAA 3GTKH 2KUMA 1CQVA 2PZWA 4GKKL 3OIQA 3I3CA 2ASBA 4X66L 1MBYA 2YTVA 5C0XH 3UDIA 3KBGA 2F0JA 3PO2H 1JJCB 2Z9HA 1JJ2A 1ESFA 2R7FA 3M9BA 3OHXC 3A0JA 1SNOA 3NQIA 4OXPA 2EE1A 3E3XA 1F2MA 1YZ6A 2D2CC 1VQOA 2NB0A 3RLNA 5M5WB 3M4PA 2KHSA 2OF1A 4XYOA 3U4VA 4A93B 3RLFA 1WCMB 2WV6D 4PNYA 2K14A 2QKIC 2JA8B 4DV0Q 1SE3A 2BDNA 5IT9c 3EFXD 1Y69U 4ZQ3A 1YHAA 4X3UA 1WOCA 3R93A 5H1SE 1C0AA 5ELDA 2IHEA 4A3EG 3WWVA 4RFBA 4LF4L 3HS0C 2G5DA 1GUWA 1L1OB 3QB3A 4JI7Q 1F9PA 1TS3A 5LHY1 3M4OB 3MFYA 2JE6I 2EY5A 4R4QA 1X54A 4A3CH 1W2BA 3MXUA 2JA6G 1I50H 1WJJA 3S16B 5C3XA 4PQXA 2IX3A 4JI7L 1N9WA 2PYKA 3I4OA 5FK9C 3I73A 4H44C 1PTOB 2EYFA 3KDFB 5C4XB 4BBRH 3TN2A 2OTJA 4OONA 2HIVA 5CV6A 1BBWA 4BY7H 3CC2A 4LF7Q 2F3WA 2EPBA 4OX9L 4ULLA 5KEEA 3JAMi 4PMWA 3P7JA 4WJWA 5LMNL 5BN4A 2TSSA 1HQRD 1BR9A 1UAPA 3HOUG 4A3KB 1O7LA 1Z47A 4B3RL 4ZUIA 2BE5C 1HA6A 4GOPC 1L0YB 5JEAG 4QGUA 4ZCKA 1IBKL 4C56C 3HOXH 1K0SA 1C4QA 3M4YA 3MEFA 2AWNA 5M3MG 4LAAA 1OTCA 4CDEC 5IGEA 4R4IA 1EYDA 4JI1L 4ID6A 5CV9A 1SYGA 2EDGA 2VXWA 4IURA 1IBKQ 4JI2Q 4DKAC 5ELBA 4A3FB 1E2VA 1XMOL 1I4QA 1SR3A 1JC7A 2N55A 1LO5D 5CGKA 3K58A 1XPOA 5J1ZA 4KHPQ 1SEBD 2PZUA 2KQ3A 5JJLA 5DEHA 1WTPA 4EVOA 1WTVA 4JC0A 2LY7A 1PRTD 4K14A 4A3DG 4XQNA 3S16H 3EQLC 2I5HA 5EKLA 1NMFA 1PYWD 1QUQB 5IGBA 3F2BA 2ZJPA 2UUCQ 1I5FA 1LTLA 4CDCC 4KKUA 2CVRA 5EPKA 1PYBA 3ITPA 2Q2UA 1ASZA 1OXXK 5FJ8G 3CHBD 3KLWA 4DA2A 1K28A 1PH4A 4LF8L 4H0LC 1N33L 1JOOA 1V43A 3UDXA 3PUVA 1WCMH 2OT2A 2K1BA 1PH5A 1RTOA 3CP0A 1PH3A 2M00A 4JYAQ 3GQBA 1CSPA 4DK1A 4HSPA 1H9MA 3I4MH 3H0GH 4OGQC 3D4DA 2R92G 5DAUA 4DUYQ 4DR7L 3OWEB 5E4XA 3DEOA 1XPRA 4MTNA 1EOVA 3MAQA 5LMUQ 3U50C 4FDBA 1H9KA 2MNAA 2F0SA 3I2ZA 4CJ1B 3VR6A 1RODA 2ZTCA 5IY0A 1VQ4A 1I4HA 4HJ9A 3PUYA 3L9AX 3OYYA 3KLRA 2KEEA 2JK8A 4HSVA 4KKTA 4KI0A 5C3EH 2A68C 4HJAA 2RVLA 3K0YA 1VQMA 2HDMA 2QCPX 3UE1A 4A3BH 4APVA 1SNDA 3TREA 3GTMB 1J5EQ 3H6MA 1WVLA 5G3LF 1AE2A 1LTID 5JJZA 3OWFA 4FF3A 5CBEE 1E3PA 4LF4Q 1TT2A 4NPSA 2ATWA 2EOTA 3TP8A 5LL6S 4JI0L 1KC8C 5JJIA 2K5HA 1A62A 4KLKA 1PH6A 3GTQB 2E5LQ 3D4RA 1PRTB 4LNQA 3S9WA 4DR4Q 3X3MA 3IRBA 2L5TA 4LF5L 1T5EA 5CC4A 1JOQA 3STBC 5JVG3 2EY2A 1A0IA 1TWGB 4GN4B 5IP7H 1ZYRD 3GTPB 5M5XB 2K28A 2JEBI 3DUZA 1EY9A 1ASYA 2JQOA 2ZT9C 4X62Q 1TS5A 3TP6A 1FGBD 4OEMB 4LUVA 2F1MA 4K5XA 2JXMB 3K80C 4PZ7A 5FLXE 1HUNA 4AYBG 2DGYA 4B3RQ 2LXKA 3PQIA 4DV5Q 3I70A 4IALA 4L5RC 5FOBB 3GDEA 1V1PB 2EYJA 1SAPA 4AIMA 3GTMH 1KNAA 3D0FA 1SLJA 3KYHC 1B2TA 3S15B 2G9HD 3PO3H 3E9IA 2WB1B 4CJ2C 5M3FG 3TP7A 1XMQQ 4J6HA 1TWHH 1O7YA 4EX5A 1LTGD 1VDZA 5DM73 5FLXc 5GAHC 4DAYB 4L63B 4A93G 2F0HA 2HD3A 1S5CD 1YEZA 4C3HB 1JE4A 3J7YW 3G48A 1SE4A 4A3EB 2E2HH 3BYTB 2IJ0A 2A8VA 4YCVA 4DV0L 4LK1C 1EY6A 3I72A 4LMQD 4A3LG 4IJLA 2GN5A 2QW7A 2WKCA 1I50B 2Z0SA 1TWAB 1G6ZA 5KIXA 2Q2HA 3A5ZB 4IO9A 3MZ5A 4R4TA 2IWHA 4NXNL 4G4KA 1TWCB 4A3JB 3S14B 3I56A 2PQEA 4O1NA 3R3OA 4C3IG 1PYSB 2PNRC 2OCEA 4JOIA 5CORA 1PMRA 1ENAA 2JA5H 5I9PA 2K4KA 1I4RA 1LUZA 1U4MA 2WAQE 2Y0SB 2K04A 4QF4A 3NBHA 4GOPB 1CK1A 5IWAL 1EY0A 4DUYL 3ZYYX 3S1MH 5JAVA 3DWQA 2L12A 1KDAA 4YHHL 2V1CC 3M7NA 2NVYH 2F4IA 1SE8A 3OMGA 5GAEC 3CC4A 2E2JH 4DF7A 3KF8B 2QEXA 1EU4A 1II3A 3W1GA 2IX0A 3FVQA 5C4XH 2LKVA 2X69A 3GTGH 1KLUD 2E2HB 2JYOA 2WAQG 4HJ7A 2P5ZX 1YI2A 4FF4A 3TS2A 1TWAH 1E2ZA 2RSOA 4TVAB 4C2MB 4IZ8A 1YHQA 5FKAC 1TY0A 1EEID 4GLAC 1YNJC 1L1OC 4WJ3M 2Z6KC 1F2YA 4QMGA 2HDLA 4IOAA 4JPBW 1JMCA 1GUSA 5FO7B 1NY4A 3H3VI 2RCFA 1LT6D 1ICWA 3KJOA 5IYBG 4BY7B 3H94A 3BDLA 3DM3A 2RBMA 3JAML 4KHPL 1EWCA 1TXYA 2D62A 3KBXA 5D3IB 1D1KA 4J15A 3FHWA 1EUJA 1U5KA 3PIPA 1C8CA 3GTLB 1SYDA 1VQLA 3K57A 1KHIA 1LT5D 3GV3A 1N34L 1VS0A 3SR1A 3NELA 2F0QA 4Y7NH 2Z6BA 1XNQL 4DV1L 1DD2A 2A5HA 4JI1Q 1Q46A 4K5WA 1KABA 4QUFA 1TWGH 1PLFA 1JQYD 1BF4A 3I91A 4WFN3 1HZ9A 1NMGA 4JI2L 3DEPA 4IUTA 4DAVA 4DV5L 1SMYC 4DR1L 3BVMA 2Y0SE 5K36G 3DM1A 1VQBA 4JOIC 2SNMA 4DV6L 4MN3A 5M5XH 4V190 5ISRA 1HNWL 4AH6A 3PSIA 2RDGA 2B2TC 1EIHA 5E7NA 1HNXL 4A93H 1B50A 4DV6Q 4GNXA 3KUPA 2NVTH 3A7LA 3KJPA 3S17B 1BCPF 3Q6SA 3V05A 1MSHA 1IZ6A 4DNRB 2NN6H 3HKZB 3I8ZA 4OELB 2K7VA 2HQEA 4PV1C 3HOZG 1K8GA 5LMNW 3LNNA 1BNZA 2PCFB 1X6OA 2PO4A
chains in the Genus database with same CATH topology
3I4NG 1E24A 2ZTDA 4UP9A 3U58A 5IP9G 4JI3L 2OWOA 3BZKA 1HR0W 1Z9FA 3CCEA 5ELNA 3GTKH 2UXDQ 4IPGA 4DV4Q 3BU2A 1VCIA 3CF5A 4QL5A 1PA6A 3J81c 1YITA 3W1BA 2ASBA 4X66L 3FP9A 4JBKA 2YTVA 1PH8A 3ULPA 2BA1A 3UDIA 1NJIC 2HIXA 5AJ3L 4GNXB 1GM5A 1MJCA 3PO2H 1JT8A 1JJCB 2BH8A 1I6HH 5C0XI 1JJ2A 1Q8KA 1EFWA 2R7FA 3M9BA 3RZOH 3A0JA 1Y14B 1SFOH 1N32L 1TWFH 3GTPH 4X65L 3A5UA 1MIUA 4OXPA 4DV4L 3T1HQ 1YZ6A 4JBJA 1VQOA 4A3BG 1E7ZA 1N34Q 2F4VL 1BBUA 3RLNA 2PNHA 3M4PA 2PI2A 1LYLA 3U4VA 4IFDJ 5IYDG 3RLFA 3SGIA 1VQGA 5IYCG 2K14A 3UDFA 4DV0Q 2OQKA 1YNXA 1PH9A 2R7DA 5IP9H 5IT9c 1YHAA 5FLMH 4JI5Q 1VQ7A 1WOCA 3NEMA 3VDYA 1SMXA 1GD7A 5H1SE 4GNXC 2IHEA 4A3EG 3K0XA 3H3VH 1C0AA 3WWVA 1E1OA 1FL0A 4LF4L 2K52A 1X56A 1L1OB 2YTYA 4JI7Q 3S1RH 4A3IG 3HOUH 4R4CA 1VQ9A 2JE6I 1EYGA 1XNRL 5C0XJ 3F1ZA 4C2MH 3JAMc 4R4QA 1XJVA 1X54A 2CCZA 4A3CH 1W2BA 4JI5L 4NB3A 2JA6G 1HNWQ 5C4JH 1I50H 1UE6A 4BY1G 2KENA 1WJJA 1IBMQ 5GROA 3JC66 3AYHB 2AMCB 2N78A 3GTOH 1X65A 3G71A 1HNXQ 2VL6A 4JI7L 1YVCA 3S24A 4K0KQ 1N9WA 3I4OA 2JEAI 3K81C 3HOXG 4XIGS 4LF8Q 3CXCA 2CFMA 1N33Q 4A3JH 3KDFB 2R93H 1T9HA 4BBRH 2OTJA 4DR3Q 1VQPA 4LF9Q 4OONA 3S1QH 1L0WA 2HIVA 1KD1C 1BBWA 2VZAA 3CC2A 3E9HA 2UU9L 4LWCA 2JA5G 4LF7Q 3JAMi 4OX9L 4PMWA 4YWKA 5LMNL 1WYDA 4GN5A 2UUBQ 1IBLQ 1UE7A 2PQAA 4DUZQ 4A3IH 1Z47A 2ZM6L 1C7YA 3HOUG 4B3RL 4GOPC 4JG2A 4A3KH 4EQ5A 3ZJYC 4L5SA 2DUDA 5JEAG 4QGUA 2NN6G 2E2IH 1B8AA 4LUOA 3HOWH 4DV7L 4GKJQ 2Q2IA 1IBKL 3HOXH 1NBWA 2UXDL 1PH7A 4OO1G 1C9OA 3MEFA 2AWNA 5M3MG 1S3OA 1KQSA 1G291 1OTCA 4R4IA 4JI1L 3STBD 1MJEA 4BBSG 1QVGA 3BJUA 3F8TA 2ES2A 1BVSA 1CKMA 2MQHA 1LM0A 3HOYG 4P72A 1IBKQ 3J7A5 4JI2Q 4ME3A 3TEHB 4DKAC 3GTJH 3T1HL 4PG3A 1KL9A 1XMOL 1SR3A 3NBHB 1RL2A 1J6QA 1XPOA 2I5MX 1HZCA 4KHPQ 2OTLA 3ULLA 5JJLA 4DR5L 1EQRA 4YY3L 4L5QA 3RN2A 4JC0A 3HOVH 1XNQQ 3I7FA 2XTIA 4JV5L 1FJGQ 4OWXB 3CW2C 4A3DG 2R92H 1WFQA 4DR4L 3ERSX 1G51A 3HOWG 3S16H 2I5HA 3F2BA 1NMFA 1QUQB 2ZJPA 1KXLA 3CAMA 1I5FA 3E0EA 3PUWA 5GAGC 2UUCQ 4BA2I 3RZDH 1A8VA 2EIFA 4BBSH 1LTLA 3S15H 3A74A 3PUZA 4A3EH 1YHBA 4A3JG 1Y1VG 3HKSA 1XTDA 3D31A 1PYBA 1Q82C 1YJ9A 3L7ZC 3T1YL 2LXJA 4H02A 2Q2UA 1ASZA 3HOYH 1OXXK 1K73C 5FJ8G 1PV4A 4JI4L 2VY3A 4BY7H 5JJKA 4JI6Q 3KLWA 1PH4A 3TS0A 2OQ0A 1PHJA 5GQOA 4B3SQ 4LF8L 1Q12A 4KHZA 1N33L 1V43A 4DV2L 3UDXA 3CCLA 3PUVA 4NXMQ 1WCMH 3TQYA 4A3GH 4JBWA 4Y52H 1AH9A 1SROA 1PH5A 4UP7A 3CP0A 2KCMA 3T1YQ 1PH3A 1D7QA 3CCJA 4JYAQ 2I0QA 3PO3G 1CSPA 2KHJA 2UXCL 2PMZE 2VQFQ 3I4MH 1X9NA 3ER0A 3H0GH 1GKHA 2R92G 3S14H 1AE3A 5M3FH 4B3SL 1I94L 1U0LA 4C3IH 3M3YH 2R93G 4X6AH 4DUYQ 4DR7L 1V1QA 3KF6B 1IYJB 1B70B 2ZM6Q 2JA8G 2C35B 1XPRA 4MTNA 2RHSB 1EOVA 5LMUQ 3EBEA 3U50C 2VUMG 4IJHA 4PZ8A 3OTOL 4FDBA 4BY7G 4AQYQ 2MNAA 1DGSA 3I2ZA 4OWTB 4GKJL 2VUMH 2ZTCA 5IY0A 1VQ4A 4JBMA 4HJ9A 1Q86C 3PUYA 2MFIA 5FJ8H 1VQ5A 3OYYA 4LUZA 2A1AA 2Z6KA 1UEBA 2JK8A 5C44G 3CCVA 1VQHA 4KI0A 5C3EH 4LFBL 4A4IA 3K8AA 4GS3A 4HJAA 2N8NA 4HJ8A 4P73A 5BR8L 1N36Q 5GADC 1N8RC 1VQMA 4YWMA 3DLLA 2ZJQA 3UE1A 4A3BH 4APVA 4A3GG 3W5OA 2YV5A 3TREA 1J5EQ 3EIVA 4X64Q 1AE2A 1VQFA 4AYBE 1NTGA 1XMOQ 3M4QA 1E3PA 4LF4Q 5DLQE 3L0OA 1OXVA 2NZHA 4NPSA 4R1JA 1QVCA 2N3SA 5IE8A 1HR0L 4P75A 4JI0L 4GKKL 1KC8C 5FLMG 5JJIA 5C4XG 1N36L 3CPFA 2K5HA 4DR5Q 1XNRQ 2KBNA 3U4ZA 2KHIA 1A62A 2HQLA 2AWOA 1FVIA 3OW2A 4KLKA 1PH6A 4LFCQ 2E5LQ 2IT1A 2UXBQ 4LNQA 3F2CA 3CCRA 4DR4Q 2PI2E 3KF6A 1EWIA 1R9TH 3IRBA 1SRUA 2ALYB 2NVXH 4X62L 3UE0A 4LF5L 1CKNB 2WB1E 4YWLA 3STBC 1OXUA 1K3RA 1A0IA 4GN4B 2JA9A 1CUKA 5IP7H 4IFDI 2UXBL 1WCMG 2IHFA 2JEBI 4LF9L 3PUXA 1Q1EA 1ASYA 4B3TQ 1UWVA 2JQOA 4DV1Q 5J3BA 1HNZL 4X62Q 2D0OA 3KDFA 3UDGA 2NVQH 3PIOA 1PH1A 1HH2P 2A19A 2MO0A 4LUVA 4DK3C 3KOJA 3S2DH 3K80C 4RG1A 4PZ7A 1D8LA 3HKZE 2JJQA 4AYBG 4DUZL 2DGYA 2HT1A 1M90C 3ICEA 4B3RQ 2QGQA 1IBML 2LXKA 1K0RA 3F2DA 2ZJRA 4DV5Q 4DR2L 3CD6A 4YHHQ 1KAWA 4DR1Q 2VQEQ 3GTLH 4DV7Q 4A75A 2F52A 4L5RC 2AHOB 3EN2A 3GDEA 4ALPA 3RN5A 2CWPA 4AIMA 1L1OA 2BH2A 3GTMH 1A63A 4GOPA 4QY7A 1S40A 3D0FA 1SLJA 3KYHC 2BA0A 4HJ5A 3PO3H 1Q1BA 3E9IA 4DK6C 1HZAA 2VQEL 1Y1WG 3HOVG 1EQQA 1JJGA 4BY1H 2RF4A 4LF7L 5M3FG 4OX9Q 1XMQQ 2K5NA 1PH2A 5IYCH 1TWHH 3HKZG 4EX5A 3MXNB 1XPUA 5FLXc 3RLOA 5AJ3Q 3L2PA 1GO3E 2ID0A 2IX1A 5GAHC 4GLXA 4B3ML 3CCSA 5BR8Q 4DAYB 2NN6I 4A3FG 3PGZA 3J7ZC 4A93G 2I5LX 5M5YH 4X65Q 4A3FH 1YEZA 1SN8A 4JCVE 1J5EL 4X64L 5C44H 3LGJA 2GVBA 4OO1I 1P16A 4MNOA 2K75A 4A3MH 1CKOA 3G48A 1QZGA 4UPAA 1YJNA 2E2HH 4JI0Q 4MZ9A 3J80c 2A8VA 4YCVA 2F3IA 4A3LH 4DV0L 1WI5A 4P71A 2CWAA 4YCUA 4A3LG 4IJLA 2GN5A 4QJFA 2NZOA 2MO1A 2Z0SA 2E5LL 4IO9A 2Q2HA 3A5ZB 4POGA 2R7ZH 4R4TA 4X66Q 1GVPA 4NXNL 4DPGA 2N49A 2K5VA 3AQQA 4GN3B 1QVFA 3I4MG 4JI6L 4LF5Q 4DAMA 3I56A 2Q2TA 4YY3Q 1N32Q 1FGUA 1JE5A 1VQ6A 3S2HH 1V9PA 3NENA 1PYSB 1PVOA 2OCEA 4JOIA 4C3JH 1IXRA 4IPCA 5JEAJ 2KCTA 2JA5H 2F4VQ 2K4KA 4B3TL 1LUZA 1UE1A 4HIKA 4A3MG 1HNZQ 2VQFL 1KRSA 2B3GA 1OXTA 4K0KL 2WAQE 2WP8J 2AKWB 2UUAL 1NE3A 4GOPB 1B7YB 4A3KG 4P74A 1VQCA 1VQAA 5IP7G 5IWAL 2QA4A 4DUYL 2H5XA 4YCWA 3S1MH 4DR3L 1VQJA 3ULJA 4A3CG 3CMAA 4QIWE 2HHHL 4QQBX 4YHHL 2JA6H 2B29A 4GLVB 3H15A 2V1CC 4AQYL 5IYDH 3M7NA 2NVYH 5IYBH 2UU9Q 2YU9H 2R7ZG 1QUQA 3I55A 1SE8A 3K7UC 3J80i 5GAEC 3CC4A 4NXML 4O0AA 2E2JH 1X55A 2EXDA 2RCNA 3KF8B 2QEXA 2WFWA 4IPDA 3W1GA 2HHHQ 4JI8Q 2IX0A 3RNUA 1QZHA 5C4XH 3GTGH 1PFSA 4HIMA 4C3HH 1TWCH 3B6YA 3K7AH 4RMFA 2VW9A 3CPWA 1JB7A 2K50A 2WAQG 3G6EA 4HJ7A 1YI2A 3CCUA 1KIXA 3TS2A 1TWAH 2PQAB 1CSQA 3CQZH 1XMQL 3TRZA 5C3EG 4DR7Q 2WB1G 1E22A 4TVAB 2GVAA 2IY5B 3CC7A 5EAYA 1G6PA 4JI8L 1YHQA 1HR0Q 5LMUL 4B3MQ 2CQOA 4TQUS 1OXSC 4GLAC 3OTOQ 1Y1WH 3HFZB 3CMEA 1Q7YC 1L1OC 4WJ3M 2Z6KC 2L15A 4LW1A 1YJWA 4IOAA 1P8LA 1O7IA 3AFPA 3RR5A 4IOCA 1BKBA 1JMCA 1VQKA 2B63H 3CCMA 1YBYA 3M4OH 2LSSA 3S17H 3H3VI 1NY4A 1VQ8A 4GKKQ 4IFDG 4BBRG 1VQDA 5IYBG 2XGTA 3KJOA 3I4NH 3DM3A 3CCQA 4KHPL 1TXYA 2D62A 5M3MH 3AFQA 3PF5A 1L2FA 1W3SA 4J15A 3FHWA 1EUJA 1U5KA 4O2DA 1H95A 3PIPA 2JA8H 4A76A 1RIPA 3PCOB 1VQLA 4POFA 1FJGL 1KHIA 4BXXH 1N34L 1VS0A 5HGQA 4NXNQ 1VQIA 1UE5A 4HIDA 1IL2A 1CKNA 3NELA 4DR6Q 1I3QH 4Y7NH 1X3GA 5ELOA 4DV1L 1XNQL 4JI1Q 1Q46A 3J81j 3GD7A 3S1NH 1TWGH 4DNIA 3GO5A 1VQNA 2R6GA 1KRTA 1HZ9A 2VS1A 1NMGA 4LFCL 4BA1I 4JI2L 4LF6L 2VNUD 2ZTEA 4DV5L 4DR6L 4DR1L 2Y0SE 3J81i 4A3DH 5K36G 2YTXA 4XTCS 1VQBA 4JOIC 1E1TA 3G4SA 4DV3Q 3FKIH 4DV6L 4PZ6A 2UUAQ 2JA7G 5M5XH 5IWAQ 1HZBA 4DV2Q 2JA7H 4UP8A 4JV5Q 3PV0A 1HNWL 5HY6A 4LF6Q 2E8GA 4AH6A 1MKHA 2Y0SG 3PSIA 4BXXG 1VQEA 4JYAL 1Y1VH 4OWWB 2UXCQ 4UY8C 5E7NA 1HNXL 3M85A 2UUCL 3GTQH 4A93H 1EIYB 1HJPA 4DV3L 4DV6Q 3PO2G 4GNXA 3KFUA 1I94Q 4IPHA 2NVTH 4HIOA 1K8AC 5C0XG 3KJPA 4LFAQ 2EQSA 1EIFA 1K83H 3Q8DA 3BZCA 1X3EA 4L5TA 4DR2Q 1S72A 2CKZB 1YIJA 2FXQA 1IZ6A 4JI4Q 1K9MC 4JI3Q 3HOZH 2YYZA 2RHQB 3FKIG 5LMNQ 2D0PA 3HOZG 4WJ4A 3H0GG 2UUBL 2ATWA 2B63G 1K8GA 5LMNW 1IBLL 3AEVA 5M5WH 3PF4A 1X6OA 4LFAL 4R4OA 1X3FA 1M1KC 4LFBQ 1Q81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N G;  1E24 A;  2ZTD A;  4UP9 A;  3U58 A;  5IP9 G;  4JI3 L;  2OWO A;  3BZK A;  1HR0 W;  1Z9F A;  3CCE A;  5ELN A;  3GTK H;  2UXD Q;  4IPG A;  4DV4 Q;  3BU2 A;  1VCI A;  3CF5 A;  4QL5 A;  1PA6 A;  3J81 c;  1YIT A;  3W1B A;  2ASB A;  4X66 L;  3FP9 A;  4JBK A;  2YTV A;  1PH8 A;  3ULP A;  2BA1 A;  3UDI A;  1NJI C;  2HIX A;  5AJ3 L;  4GNX B;  1GM5 A;  1MJC A;  3PO2 H;  1JT8 A;  1JJC B;  2BH8 A;  1I6H H;  5C0X I;  1JJ2 A;  1Q8K A;  1EFW A;  2R7F A;  3M9B A;  3RZO H;  3A0J A;  1Y14 B;  1SFO H;  1N32 L;  1TWF H;  3GTP H;  4X65 L;  3A5U A;  1MIU A;  4OXP A;  4DV4 L;  3T1H Q;  1YZ6 A;  4JBJ A;  1VQO A;  4A3B G;  1E7Z A;  1N34 Q;  2F4V L;  1BBU A;  3RLN A;  2PNH A;  3M4P A;  2PI2 A;  1LYL A;  3U4V A;  4IFD J;  5IYD G;  3RLF A;  3SGI A;  1VQG A;  5IYC G;  2K14 A;  3UDF A;  4DV0 Q;  2OQK A;  1YNX A;  1PH9 A;  2R7D A;  5IP9 H;  5IT9 c;  1YHA A;  5FLM H;  4JI5 Q;  1VQ7 A;  1WOC A;  3NEM A;  3VDY A;  1SMX A;  1GD7 A;  5H1S E;  4GNX C;  2IHE A;  4A3E G;  3K0X A;  3H3V H;  1C0A A;  3WWV A;  1E1O A;  1FL0 A;  4LF4 L;  2K52 A;  1X56 A;  1L1O B;  2YTY A;  4JI7 Q;  3S1R H;  4A3I G;  3HOU H;  4R4C A;  1VQ9 A;  2JE6 I;  1EYG A;  1XNR L;  5C0X J;  3F1Z A;  4C2M H;  3JAM c;  4R4Q A;  1XJV A;  1X54 A;  2CCZ A;  4A3C H;  1W2B A;  4JI5 L;  4NB3 A;  2JA6 G;  1HNW Q;  5C4J H;  1I50 H;  1UE6 A;  4BY1 G;  2KEN A;  1WJJ A;  1IBM Q;  5GRO A;  3JC6 6;  3AYH B;  2AMC B;  2N78 A;  3GTO H;  1X65 A;  3G71 A;  1HNX Q;  2VL6 A;  4JI7 L;  1YVC A;  3S24 A;  4K0K Q;  1N9W A;  3I4O A;  2JEA I;  3K81 C;  3HOX G;  4XIG S;  4LF8 Q;  3CXC A;  2CFM A;  1N33 Q;  4A3J H;  3KDF B;  2R93 H;  1T9H A;  4BBR H;  2OTJ A;  4DR3 Q;  1VQP A;  4LF9 Q;  4OON A;  3S1Q H;  1L0W A;  2HIV A;  1KD1 C;  1BBW A;  2VZA A;  3CC2 A;  3E9H A;  2UU9 L;  4LWC A;  2JA5 G;  4LF7 Q;  3JAM i;  4OX9 L;  4PMW A;  4YWK A;  5LMN L;  1WYD A;  4GN5 A;  2UUB Q;  1IBL Q;  1UE7 A;  2PQA A;  4DUZ Q;  4A3I H;  1Z47 A;  2ZM6 L;  1C7Y A;  3HOU G;  4B3R L;  4GOP C;  4JG2 A;  4A3K H;  4EQ5 A;  3ZJY C;  4L5S A;  2DUD A;  5JEA G;  4QGU A;  2NN6 G;  2E2I H;  1B8A A;  4LUO A;  3HOW H;  4DV7 L;  4GKJ Q;  2Q2I A;  1IBK L;  3HOX H;  1NBW A;  2UXD L;  1PH7 A;  4OO1 G;  1C9O A;  3MEF A;  2AWN A;  5M3M G;  1S3O A;  1KQS A;  1G29 1;  1OTC A;  4R4I A;  4JI1 L;  3STB D;  1MJE A;  4BBS G;  1QVG A;  3BJU A;  3F8T A;  2ES2 A;  1BVS A;  1CKM A;  2MQH A;  1LM0 A;  3HOY G;  4P72 A;  1IBK Q;  3J7A 5;  4JI2 Q;  4ME3 A;  3TEH B;  4DKA C;  3GTJ H;  3T1H L;  4PG3 A;  1KL9 A;  1XMO L;  1SR3 A;  3NBH B;  1RL2 A;  1J6Q A;  1XPO A;  2I5M X;  1HZC A;  4KHP Q;  2OTL A;  3ULL A;  5JJL A;  4DR5 L;  1EQR A;  4YY3 L;  4L5Q A;  3RN2 A;  4JC0 A;  3HOV H;  1XNQ Q;  3I7F A;  2XTI A;  4JV5 L;  1FJG Q;  4OWX B;  3CW2 C;  4A3D G;  2R92 H;  1WFQ A;  4DR4 L;  3ERS X;  1G51 A;  3HOW G;  3S16 H;  2I5H A;  3F2B A;  1NMF A;  1QUQ B;  2ZJP A;  1KXL A;  3CAM A;  1I5F A;  3E0E A;  3PUW A;  5GAG C;  2UUC Q;  4BA2 I;  3RZD H;  1A8V A;  2EIF A;  4BBS H;  1LTL A;  3S15 H;  3A74 A;  3PUZ A;  4A3E H;  1YHB A;  4A3J G;  1Y1V G;  3HKS A;  1XTD A;  3D31 A;  1PYB A;  1Q82 C;  1YJ9 A;  3L7Z C;  3T1Y L;  2LXJ A;  4H02 A;  2Q2U A;  1ASZ A;  3HOY H;  1OXX K;  1K73 C;  5FJ8 G;  1PV4 A;  4JI4 L;  2VY3 A;  4BY7 H;  5JJK A;  4JI6 Q;  3KLW A;  1PH4 A;  3TS0 A;  2OQ0 A;  1PHJ A;  5GQO A;  4B3S Q;  4LF8 L;  1Q12 A;  4KHZ A;  1N33 L;  1V43 A;  4DV2 L;  3UDX A;  3CCL A;  3PUV A;  4NXM Q;  1WCM H;  3TQY A;  4A3G H;  4JBW A;  4Y52 H;  1AH9 A;  1SRO A;  1PH5 A;  4UP7 A;  3CP0 A;  2KCM A;  3T1Y Q;  1PH3 A;  1D7Q A;  3CCJ A;  4JYA Q;  2I0Q A;  3PO3 G;  1CSP A;  2KHJ A;  2UXC L;  2PMZ E;  2VQF Q;  3I4M H;  1X9N A;  3ER0 A;  3H0G H;  1GKH A;  2R92 G;  3S14 H;  1AE3 A;  5M3F H;  4B3S L;  1I94 L;  1U0L A;  4C3I H;  3M3Y H;  2R93 G;  4X6A H;  4DUY Q;  4DR7 L;  1V1Q A;  3KF6 B;  1IYJ B;  1B70 B;  2ZM6 Q;  2JA8 G;  2C35 B;  1XPR A;  4MTN A;  2RHS B;  1EOV A;  5LMU Q;  3EBE A;  3U50 C;  2VUM G;  4IJH A;  4PZ8 A;  3OTO L;  4FDB A;  4BY7 G;  4AQY Q;  2MNA A;  1DGS A;  3I2Z A;  4OWT B;  4GKJ L;  2VUM H;  2ZTC A;  5IY0 A;  1VQ4 A;  4JBM A;  4HJ9 A;  1Q86 C;  3PUY A;  2MFI A;  5FJ8 H;  1VQ5 A;  3OYY A;  4LUZ A;  2A1A A;  2Z6K A;  1UEB A;  2JK8 A;  5C44 G;  3CCV A;  1VQH A;  4KI0 A;  5C3E H;  4LFB L;  4A4I A;  3K8A A;  4GS3 A;  4HJA A;  2N8N A;  4HJ8 A;  4P73 A;  5BR8 L;  1N36 Q;  5GAD C;  1N8R C;  1VQM A;  4YWM A;  3DLL A;  2ZJQ A;  3UE1 A;  4A3B H;  4APV A;  4A3G G;  3W5O A;  2YV5 A;  3TRE A;  1J5E Q;  3EIV A;  4X64 Q;  1AE2 A;  1VQF A;  4AYB E;  1NTG A;  1XMO Q;  3M4Q A;  1E3P A;  4LF4 Q;  5DLQ E;  3L0O A;  1OXV A;  2NZH A;  4NPS A;  4R1J A;  1QVC A;  2N3S A;  5IE8 A;  1HR0 L;  4P75 A;  4JI0 L;  4GKK L;  1KC8 C;  5FLM G;  5JJI A;  5C4X G;  1N36 L;  3CPF A;  2K5H A;  4DR5 Q;  1XNR Q;  2KBN A;  3U4Z A;  2KHI A;  1A62 A;  2HQL A;  2AWO A;  1FVI A;  3OW2 A;  4KLK A;  1PH6 A;  4LFC Q;  2E5L Q;  2IT1 A;  2UXB Q;  4LNQ A;  3F2C A;  3CCR A;  4DR4 Q;  2PI2 E;  3KF6 A;  1EWI A;  1R9T H;  3IRB A;  1SRU A;  2ALY B;  2NVX H;  4X62 L;  3UE0 A;  4LF5 L;  1CKN B;  2WB1 E;  4YWL A;  3STB C;  1OXU A;  1K3R A;  1A0I A;  4GN4 B;  2JA9 A;  1CUK A;  5IP7 H;  4IFD I;  2UXB L;  1WCM G;  2IHF A;  2JEB I;  4LF9 L;  3PUX A;  1Q1E A;  1ASY A;  4B3T Q;  1UWV A;  2JQO A;  4DV1 Q;  5J3B A;  1HNZ L;  4X62 Q;  2D0O A;  3KDF A;  3UDG A;  2NVQ H;  3PIO A;  1PH1 A;  1HH2 P;  2A19 A;  2MO0 A;  4LUV A;  4DK3 C;  3KOJ A;  3S2D H;  3K80 C;  4RG1 A;  4PZ7 A;  1D8L A;  3HKZ E;  2JJQ A;  4AYB G;  4DUZ L;  2DGY A;  2HT1 A;  1M90 C;  3ICE A;  4B3R Q;  2QGQ A;  1IBM L;  2LXK A;  1K0R A;  3F2D A;  2ZJR A;  4DV5 Q;  4DR2 L;  3CD6 A;  4YHH Q;  1KAW A;  4DR1 Q;  2VQE Q;  3GTL H;  4DV7 Q;  4A75 A;  2F52 A;  4L5R C;  2AHO B;  3EN2 A;  3GDE A;  4ALP A;  3RN5 A;  2CWP A;  4AIM A;  1L1O A;  2BH2 A;  3GTM H;  1A63 A;  4GOP A;  4QY7 A;  1S40 A;  3D0F A;  1SLJ A;  3KYH C;  2BA0 A;  4HJ5 A;  3PO3 H;  1Q1B A;  3E9I A;  4DK6 C;  1HZA A;  2VQE L;  1Y1W G;  3HOV G;  1EQQ A;  1JJG A;  4BY1 H;  2RF4 A;  4LF7 L;  5M3F G;  4OX9 Q;  1XMQ Q;  2K5N A;  1PH2 A;  5IYC H;  1TWH H;  3HKZ G;  4EX5 A;  3MXN B;  1XPU A;  5FLX c;  3RLO A;  5AJ3 Q;  3L2P A;  1GO3 E;  2ID0 A;  2IX1 A;  5GAH C;  4GLX A;  4B3M L;  3CCS A;  5BR8 Q;  4DAY B;  2NN6 I;  4A3F G;  3PGZ A;  3J7Z C;  4A93 G;  2I5L X;  5M5Y H;  4X65 Q;  4A3F H;  1YEZ A;  1SN8 A;  4JCV E;  1J5E L;  4X64 L;  5C44 H;  3LGJ A;  2GVB A;  4OO1 I;  1P16 A;  4MNO A;  2K75 A;  4A3M H;  1CKO A;  3G48 A;  1QZG A;  4UPA A;  1YJN A;  2E2H H;  4JI0 Q;  4MZ9 A;  3J80 c;  2A8V A;  4YCV A;  2F3I A;  4A3L H;  4DV0 L;  1WI5 A;  4P71 A;  2CWA A;  4YCU A;  4A3L G;  4IJL A;  2GN5 A;  4QJF A;  2NZO A;  2MO1 A;  2Z0S A;  2E5L L;  4IO9 A;  2Q2H A;  3A5Z B;  4POG A;  2R7Z H;  4R4T A;  4X66 Q;  1GVP A;  4NXN L;  4DPG A;  2N49 A;  2K5V A;  3AQQ A;  4GN3 B;  1QVF A;  3I4M G;  4JI6 L;  4LF5 Q;  4DAM A;  3I56 A;  2Q2T A;  4YY3 Q;  1N32 Q;  1FGU A;  1JE5 A;  1VQ6 A;  3S2H H;  1V9P A;  3NEN A;  1PYS B;  1PVO A;  2OCE A;  4JOI A;  4C3J H;  1IXR A;  4IPC A;  5JEA J;  2KCT A;  2JA5 H;  2F4V Q;  2K4K A;  4B3T L;  1LUZ A;  1UE1 A;  4HIK A;  4A3M G;  1HNZ Q;  2VQF L;  1KRS A;  2B3G A;  1OXT A;  4K0K L;  2WAQ E;  2WP8 J;  2AKW B;  2UUA L;  1NE3 A;  4GOP B;  1B7Y B;  4A3K G;  4P74 A;  1VQC A;  1VQA A;  5IP7 G;  5IWA L;  2QA4 A;  4DUY L;  2H5X A;  4YCW A;  3S1M H;  4DR3 L;  1VQJ A;  3ULJ A;  4A3C G;  3CMA A;  4QIW E;  2HHH L;  4QQB X;  4YHH L;  2JA6 H;  2B29 A;  4GLV B;  3H15 A;  2V1C C;  4AQY L;  5IYD H;  3M7N A;  2NVY H;  5IYB H;  2UU9 Q;  2YU9 H;  2R7Z G;  1QUQ A;  3I55 A;  1SE8 A;  3K7U C;  3J80 i;  5GAE C;  3CC4 A;  4NXM L;  4O0A A;  2E2J H;  1X55 A;  2EXD A;  2RCN A;  3KF8 B;  2QEX A;  2WFW A;  4IPD A;  3W1G A;  2HHH Q;  4JI8 Q;  2IX0 A;  3RNU A;  1QZH A;  5C4X H;  3GTG H;  1PFS A;  4HIM A;  4C3H H;  1TWC H;  3B6Y A;  3K7A H;  4RMF A;  2VW9 A;  3CPW A;  1JB7 A;  2K50 A;  2WAQ G;  3G6E A;  4HJ7 A;  1YI2 A;  3CCU A;  1KIX A;  3TS2 A;  1TWA H;  2PQA B;  1CSQ A;  3CQZ H;  1XMQ L;  3TRZ A;  5C3E G;  4DR7 Q;  2WB1 G;  1E22 A;  4TVA B;  2GVA A;  2IY5 B;  3CC7 A;  5EAY A;  1G6P A;  4JI8 L;  1YHQ A;  1HR0 Q;  5LMU L;  4B3M Q;  2CQO A;  4TQU S;  1OXS C;  4GLA C;  3OTO Q;  1Y1W H;  3HFZ B;  3CME A;  1Q7Y C;  1L1O C;  4WJ3 M;  2Z6K C;  2L15 A;  4LW1 A;  1YJW A;  4IOA A;  1P8L A;  1O7I A;  3AFP A;  3RR5 A;  4IOC A;  1BKB A;  1JMC A;  1VQK A;  2B63 H;  3CCM A;  1YBY A;  3M4O H;  2LSS A;  3S17 H;  3H3V I;  1NY4 A;  1VQ8 A;  4GKK Q;  4IFD G;  4BBR G;  1VQD A;  5IYB G;  2XGT A;  3KJO A;  3I4N H;  3DM3 A;  3CCQ A;  4KHP L;  1TXY A;  2D62 A;  5M3M H;  3AFQ A;  3PF5 A;  1L2F A;  1W3S A;  4J15 A;  3FHW A;  1EUJ A;  1U5K A;  4O2D A;  1H95 A;  3PIP A;  2JA8 H;  4A76 A;  1RIP A;  3PCO B;  1VQL A;  4POF A;  1FJG L;  1KHI A;  4BXX H;  1N34 L;  1VS0 A;  5HGQ A;  4NXN Q;  1VQI A;  1UE5 A;  4HID A;  1IL2 A;  1CKN A;  3NEL A;  4DR6 Q;  1I3Q H;  4Y7N H;  1X3G A;  5ELO A;  4DV1 L;  1XNQ L;  4JI1 Q;  1Q46 A;  3J81 j;  3GD7 A;  3S1N H;  1TWG H;  4DNI A;  3GO5 A;  1VQN A;  2R6G A;  1KRT A;  1HZ9 A;  2VS1 A;  1NMG A;  4LFC L;  4BA1 I;  4JI2 L;  4LF6 L;  2VNU D;  2ZTE A;  4DV5 L;  4DR6 L;  4DR1 L;  2Y0S E;  3J81 i;  4A3D H;  5K36 G;  2YTX A;  4XTC S;  1VQB A;  4JOI C;  1E1T A;  3G4S A;  4DV3 Q;  3FKI H;  4DV6 L;  4PZ6 A;  2UUA Q;  2JA7 G;  5M5X H;  5IWA Q;  1HZB A;  4DV2 Q;  2JA7 H;  4UP8 A;  4JV5 Q;  3PV0 A;  1HNW L;  5HY6 A;  4LF6 Q;  2E8G A;  4AH6 A;  1MKH A;  2Y0S G;  3PSI A;  4BXX G;  1VQE A;  4JYA L;  1Y1V H;  4OWW B;  2UXC Q;  4UY8 C;  5E7N A;  1HNX L;  3M85 A;  2UUC L;  3GTQ H;  4A93 H;  1EIY B;  1HJP A;  4DV3 L;  4DV6 Q;  3PO2 G;  4GNX A;  3KFU A;  1I94 Q;  4IPH A;  2NVT H;  4HIO A;  1K8A C;  5C0X G;  3KJP A;  4LFA Q;  2EQS A;  1EIF A;  1K83 H;  3Q8D A;  3BZC A;  1X3E A;  4L5T A;  4DR2 Q;  1S72 A;  2CKZ B;  1YIJ A;  2FXQ A;  1IZ6 A;  4JI4 Q;  1K9M C;  4JI3 Q;  3HOZ H;  2YYZ A;  2RHQ B;  3FKI G;  5LMN Q;  2D0P A;  3HOZ G;  4WJ4 A;  3H0G G;  2UUB L;  2ATW A;  2B63 G;  1K8G A;  5LMN W;  1IBL L;  3AEV A;  5M5W H;  3PF4 A;  1X6O A;  4LFA L;  4R4O A;  1X3F A;  1M1K C;  4LFB Q;  1Q81 C; 
#chains in the Genus database with same CATH topology
 1E24 A;  1IYV A;  4UP9 A;  5C3E B;  4U68 A;  2OWO A;  3URY A;  3CCE A;  5ELN A;  4DV4 Q;  1W6J A;  1BCP D;  3BU2 A;  3CF5 A;  3FP9 A;  3ULP A;  2BA1 A;  5AJ3 L;  1GUG A;  1I6H H;  1Q8K A;  1SNQ A;  4C3I B;  4G7H C;  4N8F A;  4KKS A;  5KGU A;  1Y14 B;  3GTJ B;  2DNC A;  4F8M A;  4X65 L;  3A55 A;  3MA2 B;  2A6E D;  4DV4 L;  4Z9C B;  4JBJ A;  1SNC A;  3O13 A;  3C46 A;  3N6R A;  1LYL A;  4IFD J;  5IYD G;  3TME A;  3SEB A;  2OQK A;  1PH9 A;  2R7D A;  5IP9 H;  3E0J A;  3VDY A;  1SMX A;  1GD7 A;  2KVM A;  5IGC A;  1QNK A;  2K52 A;  1JOK A;  1G2S A;  1X56 A;  2Z8L A;  2M2L A;  3IKJ A;  4A3I G;  2KJX A;  4R4C A;  1CFM A;  1EYG A;  3VR5 A;  5C0X J;  1XJV A;  3JAM c;  5EBC A;  4BY1 G;  1KNE A;  3OW7 A;  3I4N B;  3AYH B;  1O78 A;  2JA7 B;  1X65 A;  1GUN A;  2X6G A;  4K0K Q;  2JEA I;  3HOX G;  4XIG S;  2CFM A;  2MP1 A;  2R93 H;  2K6A A;  1OO9 B;  4DR3 Q;  4LF9 Q;  1U4R A;  1S5D D;  1L0W A;  4CDF C;  3IFT A;  2NZ1 D;  2VZA A;  1EIG A;  2JA5 G;  2LS0 1;  1WYD A;  2M9V A;  3X3N A;  2DNE A;  1ILQ A;  4RGN A;  1UE7 A;  2PQA A;  4DUZ Q;  3T53 B;  2ZM6 L;  1C7Y A;  2FJ2 A;  1PTO D;  4JG2 A;  4EQ5 A;  2E76 C;  2F0K A;  2EJM A;  2NN6 G;  4F87 A;  1B8A A;  3HOW H;  3AU7 A;  4OHJ A;  2B2Y A;  4IN3 A;  1NBW A;  4TKO B;  3P20 A;  1PFN A;  1HFG A;  1QIL A;  3FEW X;  1G29 1;  1PZK D;  1BDO A;  2XVS A;  4BBS G;  5IGF A;  4C3J B;  3BJU A;  1CKM A;  1HUM A;  1Y8P B;  1XYI A;  3G6J B;  1YNJ D;  3NTK A;  3GTJ H;  1EQV A;  4RKB A;  1PRT F;  2FHT A;  1RL2 A;  1O7Z A;  1HZC A;  1XTC D;  5T1G A;  3J80 L;  1EQR A;  4DR5 L;  4L5Q A;  3LX0 A;  5D14 A;  2XTI A;  1FJG Q;  5JEA H;  3CW2 C;  1WFQ A;  1VF7 A;  1B3Q A;  1SYF A;  2EVB A;  3RZD H;  4BBS H;  2EIF A;  4XXE A;  2B2U C;  4A3E H;  1Y1V G;  3HKS A;  3NTH A;  1NNX A;  3IL8 A;  4JI4 L;  3NPP A;  2PMZ B;  2VY3 A;  1TII D;  3RMH A;  3T56 B;  3V2T A;  5JVH 3;  4UAI A;  2OQ0 A;  3TS0 A;  4RGT A;  1Q12 A;  1JR0 D;  4KHZ A;  1EZ8 A;  2K5Q A;  3TQY A;  4A3G H;  4Y52 H;  2KCM A;  3D6C A;  2UXC L;  2VQF Q;  2ZXP A;  1GKH A;  1AE3 A;  4B3S L;  1U0L A;  4C3I H;  4DN4 M;  2R93 G;  1V1Q A;  3KF6 B;  4YIJ A;  2E74 C;  2XWB B;  1IYJ B;  1B70 B;  1LLR D;  2JA8 G;  3CKI B;  4IJH A;  2JP1 A;  1O80 A;  4BY7 G;  2K33 A;  2VUM H;  1CHP D;  1V8Q A;  3AMU A;  1Q86 C;  2A1A A;  3A8I E;  5C44 G;  1VQH A;  4ZLT F;  4NDX A;  2X6L A;  3TP5 A;  2J4X A;  5BR8 L;  3BS1 A;  5GAD C;  3S2D B;  4FF2 A;  4BWG B;  4UHV A;  5C4J B;  2YV5 A;  2QF7 A;  2DJF C;  4B08 A;  1VQF A;  1NTG A;  1DXM A;  3SK6 A;  5A35 A;  1SJH D;  2NZH A;  4CDD C;  5IE8 A;  1XNQ Q;  1QVC A;  1HR0 L;  5C4X G;  2HCI A;  3U4Z A;  3MWY W;  4J8Q A;  1D5M C;  2IT1 A;  2J7Z A;  2EXZ A;  2BOS A;  1B4O A;  1EWI A;  1V1P A;  1HPC A;  2NVX H;  1R4Q B;  1YNN C;  4X62 L;  4QUC A;  2A6H D;  3U9S A;  1K3R A;  4IFD I;  3L3O C;  1TWF B;  4LF9 L;  3PUX A;  1Q1E A;  1IYU A;  5IGG A;  4B3T Q;  3SXH A;  4DV1 Q;  5J3B A;  1HNZ L;  3A54 A;  3KDF A;  2NVQ H;  1PH1 A;  2Q8T A;  2EZV A;  2MO0 A;  1RJT A;  1MHW C;  4HTH A;  4RAU C;  3EVQ A;  1D8L A;  2JJQ A;  3E6Z X;  4DUZ L;  1M90 C;  1IBM L;  4DR2 L;  1K0R A;  3MTS A;  3F2D A;  2ZJR A;  5HUR A;  4HCE A;  3A7A B;  3CD6 A;  4DR1 Q;  3GTL H;  3E5S A;  2F52 A;  4ALP A;  2I07 B;  2K32 A;  1CZG A;  1A63 A;  1H9R A;  4F7X A;  4DK0 A;  3A8K E;  1ILP A;  1S5F D;  4DNT B;  2K01 A;  2VQE L;  3QO2 A;  2B63 B;  2PW5 A;  1Y1W G;  1EQQ A;  4BY1 H;  2RF4 A;  1TQO A;  5C6A A;  5KYL A;  4N8X 1;  1DCZ A;  2AUK A;  2VUM B;  3SK8 A;  3RLO A;  2MHV A;  5AJ3 Q;  2K5W A;  3VYS A;  1GO3 E;  2ID0 A;  4B3M L;  4ODG A;  3CCS A;  1PTO C;  2NN6 I;  3PGZ A;  3J7Z C;  4X65 Q;  3MC0 B;  1SN8 A;  4JCV E;  2R61 A;  4X64 L;  1J5E L;  2JSO A;  3LGJ A;  2GVB A;  3U9O A;  4OO1 I;  1P16 A;  1KDC A;  5IOD A;  3SDZ A;  5IIF A;  4KK7 A;  4MZ9 A;  5DM6 3;  1WI5 A;  1S5E D;  4YCU A;  4FXG C;  1E0B A;  2E5L L;  2L11 A;  3CQZ B;  2QDB A;  2NTS A;  2R7Z H;  1TY2 A;  2R92 B;  1SNM A;  1Y8O B;  3AQQ A;  2K5V A;  1QVF A;  2O5J C;  3S1M B;  3HOY B;  2ZXR A;  2B2V A;  5I2Y A;  4LF5 Q;  2F0G A;  4YY3 Q;  1FGU A;  3H3V C;  3S2H H;  3NEN A;  1W6K A;  3VR2 A;  1IXR A;  5JEA J;  3HOX B;  3BDO A;  2KCT A;  2F4V Q;  1U4L A;  2MUY A;  1UE1 A;  2O4X A;  3NXW A;  2VQF L;  1OXT A;  4O42 A;  1NE3 A;  1RTN A;  2GA4 B;  5F2D A;  5IP7 G;  4G7Z C;  5C4Z A;  5K5P A;  4YCW A;  1CM9 A;  1IHZ A;  4ZAI A;  1D6E C;  4DR3 L;  5D3D A;  3UI2 A;  2CW0 D;  3ULJ A;  4A3C G;  1X3Q A;  2JA6 H;  1LT4 D;  5K36 H;  2DY7 A;  2EY1 A;  5IYD H;  3S1Q B;  2EYH A;  4RCO A;  1QUQ A;  3K7U C;  3QIA A;  4NXM L;  3ERO A;  2RCN A;  3P75 A;  4ZUJ A;  2R93 B;  4C3H H;  1FNW A;  3B6Y A;  3K7A H;  3D6W A;  3G6E A;  2IPK D;  3VYT A;  3GP7 A;  3CQZ H;  3TBI B;  4XT1 B;  3ND8 A;  2CH4 A;  1HR0 Q;  1TWH B;  3C2P A;  2CQO A;  2MJ8 A;  1Y1W H;  2NYZ D;  4M8A A;  4TSS A;  4LW1 A;  4ZKC B;  4MTK A;  3AFP A;  3RR5 A;  4FNF A;  4IOC A;  1BKB A;  4Q5V A;  1VQ8 A;  4GKK Q;  2DJG C;  2SDF A;  1HTL D;  1VQD A;  2J0T D;  1SFO B;  1EY7 A;  5M3M H;  3QWN A;  1EWH A;  1STB A;  2B2V C;  3Q23 A;  1XX8 A;  3PCO B;  1FJG L;  4BXX H;  1IL2 A;  4NXN Q;  4HID A;  4QB4 A;  2XRS D;  1I3Q H;  1NUC A;  5JPM C;  4R9W A;  3WOF A;  3S1N H;  3DXJ C;  4HR7 B;  3PMF A;  1UUP A;  4BA1 I;  2VS1 A;  4LFC L;  2WII B;  2NVX B;  2LFN A;  2ZTE A;  3VA5 A;  2QEJ C;  1CTM A;  3RD4 A;  1CI3 M;  1E1T A;  4DV3 Q;  1LTS D;  3TDQ A;  4EQN A;  4PZ6 A;  4EQO A;  2UUA Q;  3NSW A;  2F0U A;  1HZB A;  4KD3 A;  4UP8 A;  5EJW A;  2E8G A;  4BXX G;  4JYA L;  4OWW B;  4UY8 C;  3M85 A;  3K5L A;  1PXU A;  2EJF C;  3NWS A;  4DV3 L;  2K03 A;  3M7G A;  3J81 E;  4HIO A;  1K8O A;  4KV6 A;  3GV6 A;  1EIF A;  1K83 H;  1X3E A;  1HRJ A;  1S72 A;  1EZ6 A;  4FXK C;  4JI4 Q;  4JI3 Q;  1ZXT A;  1VF5 C;  2D0P A;  3SK4 A;  2RQX A;  5EKK A;  2UUB L;  2B63 G;  4LFA L;  1CHQ D;  1TR5 A;  3R8B A;  3I4N G;  1AFP A;  3U58 A;  5IP9 G;  4JI3 L;  4M1U B;  2F0V A;  3BZK A;  1Z9F A;  2UXD Q;  4IPG A;  4DFA A;  1VCI A;  4QL5 A;  4ME5 A;  3J81 c;  2VNU D;  3W1B A;  3BVG A;  4JBK A;  1GM5 A;  2A74 C;  2HIX A;  2Z1C A;  2NVY B;  5C0X I;  3RZO H;  1GJX A;  1STH A;  1SFO H;  3GTP H;  3J81 L;  1MIU A;  3I4M B;  1EOT A;  3T1H Q;  1H9S A;  2B2Y C;  2NVT B;  5ELE A;  5M3F B;  1RF2 D;  3RUZ A;  1BBU A;  3CRK C;  1N34 Q;  1JWM D;  2F4V L;  3SGI A;  1YNX A;  1SE2 A;  1UEA B;  2C9O A;  5FLM H;  3PIP 3;  4L8J A;  1VQ7 A;  4JI5 Q;  2XIW A;  3NEM A;  2E75 C;  3H3V H;  3K0X A;  5KNC A;  1FL0 A;  4C3H G;  1GHK A;  2YTY A;  3S1R H;  3DMU A;  2C5C A;  2QDL A;  1LV9 A;  2CCZ A;  1X32 A;  3MFG A;  4JI5 L;  1XWE A;  1HNW Q;  1UE6 A;  5GRO A;  3JC6 6;  2AMC B;  5JPN C;  3PIO 3;  2F0N A;  2N78 A;  2Q8R E;  5I6W A;  1CQF A;  1GUO A;  1HNX Q;  1YVC A;  4S3S A;  1TKW B;  3K81 C;  4ZRZ A;  4OO1 H;  2TMP A;  1Y1W B;  4QIW B;  4IFD H;  1I4P A;  2Z4I A;  1T9H A;  4OL7 A;  4NP5 A;  5CV8 A;  1PRT C;  3FMC A;  1IKL A;  3S1Q H;  1HXY D;  1F2L A;  1KD1 C;  3D3R A;  2A6E C;  2UU9 L;  1BXT A;  4LWC A;  1DJR D;  1DOK A;  4YWK A;  4ZYS A;  1IBL Q;  3Q0A A;  3C1E A;  3HOV B;  4A3I H;  3CU7 A;  5C5M A;  4L5S A;  1STN A;  4FVM A;  1RDP D;  2E2I H;  3SK5 A;  4CKC A;  4GKJ Q;  1GXD C;  2Q2I A;  4OO1 G;  3A8J E;  1IKM A;  2F0I A;  4P2C B;  5J22 A;  1KQS A;  1TU2 B;  1D2B A;  3STB D;  2WIN B;  3S1R B;  5CV4 A;  2ES2 A;  2RDF A;  1EY4 A;  2MQH A;  1LM0 A;  1ZYR C;  3HOY G;  2XSC A;  3NUC A;  3J7A 5;  3ERQ A;  1NR4 A;  2WAQ B;  3T13 A;  4TRD A;  1J6Q A;  2I5M X;  1IW7 D;  1HQM C;  3K5O A;  3RN2 A;  4K8J A;  3NK9 A;  1QNU A;  4OWX B;  2R92 H;  1STY A;  3ERS X;  1G51 A;  3HOW G;  1BCP C;  4N9P A;  2R7Z B;  1WTH A;  3CAM A;  3E0E A;  3PUW A;  5GAG C;  3H91 A;  1ONL A;  1Y8N B;  4HN7 A;  3A74 A;  3PUZ A;  2E2D C;  4A3J G;  1XTD A;  3D31 A;  4DGZ A;  1EL0 A;  3GTK B;  1GUT A;  1YJ9 A;  2LXJ A;  4H02 A;  4PMC A;  1WTW A;  1K73 C;  1PV4 A;  2CHB D;  3NTI A;  1AZP A;  2D5D A;  5E3F A;  1PHJ A;  1JWU D;  4CHT B;  4B3S Q;  1NAP A;  4DV2 L;  3DHQ A;  4NXM Q;  3MXG A;  3HEJ A;  4UP7 A;  3T1Y Q;  2KHJ A;  3R2I A;  1X9N A;  4HMI A;  1I4G A;  3S14 H;  4I7Z C;  1I94 L;  3NQT A;  3M3Y H;  3KLS X;  2H4O A;  5FLX L;  5EGT A;  2VB2 X;  4PZ8 A;  4U67 3;  1I6H B;  4AQY Q;  1R9T B;  2B8F A;  5HGT A;  1PTO H;  5FO9 B;  2VB3 X;  3T4A C;  2MFI A;  3TZD A;  3D4W A;  5FJ8 H;  2Z6K A;  1UEB A;  2HCC A;  1RCV D;  3CCV A;  4LFB L;  2N8N A;  4P73 A;  4B9X A;  5KND A;  1BBX C;  4KTA A;  2B39 A;  4YWM A;  4A3G G;  1C48 A;  5FO8 B;  1B9N A;  4L6T B;  4WRD A;  3M4Q A;  5TSS A;  1XMO Q;  5DLQ E;  1IW7 C;  3L0O A;  4R1J A;  2N3S A;  4MHE A;  1VMP A;  2BE5 D;  4NW2 A;  4UDU C;  5I4D A;  2AQ1 B;  1I3Q B;  2KBN A;  2KHI A;  2O5I C;  1WTX A;  4CKB A;  1LTT D;  4HAE A;  3KF6 A;  2F0M A;  1SRU A;  2ALY B;  3FRP B;  2F0L A;  2G9D A;  1QB5 D;  3K5N A;  3UE0 A;  1CKN B;  4KY5 A;  1SYC A;  4HED A;  1L0X B;  3T16 A;  1S5B D;  2IHF A;  3RZO B;  5LL6 X;  4HCS A;  1DON A;  2D0O A;  2AUJ D;  1Q3L A;  3PIO A;  3S2D H;  3KOJ A;  1QCB D;  4RG1 A;  1F9Q A;  4BBS B;  2B8G A;  4YHH Q;  1KAW A;  1F77 A;  1Z7T A;  4KN7 C;  2VQE Q;  3K5M A;  4A75 A;  1X3P A;  3RN5 A;  2CWP A;  2BH2 A;  4GOP A;  1S40 A;  2FMC A;  2PZT A;  3QOJ A;  2BA0 A;  1V1O A;  4HJ5 A;  1R4P B;  1HZA A;  2SEB D;  4Y7N B;  3HOV G;  2I46 A;  1JJG A;  2PPB C;  2KCC A;  1WTQ A;  1PH2 A;  5IYC H;  5EPL A;  3HKZ G;  1XPU A;  4GLX A;  1LTR D;  3V96 A;  4A3F G;  5CBA E;  2ICI A;  2I5L X;  5M5Y H;  3HOW B;  3Q24 A;  5C44 H;  3FKI B;  1BO0 A;  4MNO A;  1I4X A;  2KA7 A;  5E1F A;  3J7A V;  4DXF A;  2F0P A;  1A3V A;  4UPA A;  3FDT A;  4JI0 Q;  3BVZ A;  4P71 A;  4RA8 A;  2CWA A;  1B1Z A;  4RGO S;  2NZO A;  1GOZ A;  4Q0F A;  2EYL A;  3NHH A;  4DPG A;  4GN3 B;  4JI6 L;  5COY A;  2Q2T A;  4EGV A;  4IUN A;  4IPC A;  3NWT A;  3W2D A;  4FF1 A;  5AFW A;  4B3T L;  1Z6H A;  1LAC A;  1PDQ A;  1KRS A;  2B3G A;  1HNZ Q;  3I4L A;  4K0K L;  2WP8 J;  2AKW B;  3S2H B;  1B7Y B;  4A3K G;  4P74 A;  1VQA A;  2QA4 A;  1K8M A;  1XXG A;  5KYI A;  2H5X A;  1Q8I A;  4QQB X;  1NR2 A;  2ENB A;  3NBI A;  2IL8 A;  4AQY L;  3F2U A;  1IL8 A;  3GTO B;  5IYB H;  2UU9 Q;  2YU9 H;  1K3B C;  1YNN D;  1PTO F;  5M5Y B;  1FD7 D;  2A6H C;  3J80 i;  4RWS C;  2NVQ B;  4O0A A;  1X55 A;  4KN4 C;  2WFW A;  2HHH Q;  1QZH A;  3MXP A;  3KF8 A;  1AW7 A;  3P1H A;  4HIM A;  1TWC H;  2VW9 A;  1SMY D;  3CPW A;  1JB7 A;  1EFI D;  2K50 A;  3CCU A;  1KIX A;  1MD2 D;  2PQA B;  1CSQ A;  3ND9 A;  1XMQ L;  1GHJ A;  4KY6 A;  5C3E G;  1SJE D;  4RHS A;  2WB1 G;  1E22 A;  2GVA A;  2IY5 B;  1G6P A;  4GZY C;  4JI8 L;  2E2I B;  3JAM E;  5EPJ A;  4B3M Q;  2JA6 B;  4TQU S;  1OXS C;  1I6V C;  2PW7 A;  3OTO Q;  3C3L A;  2L15 A;  1VQK A;  3SVM A;  3M4O H;  2B63 H;  3CCM A;  1A2U A;  3VR4 A;  4IFD G;  1HTP A;  3I4N H;  3CCQ A;  1EU3 A;  3PF5 A;  3AFQ A;  1L2F A;  4LJZ C;  2EYP A;  1QOH A;  4I7A A;  2JA8 H;  1FYC A;  4A76 A;  4JW0 A;  3Q22 A;  1SNP A;  4JK1 C;  5M9O A;  1VQI A;  1CKN A;  1X3G A;  2WKD A;  1MI2 A;  3GD7 A;  2Z4H A;  2NTT A;  2ZXO A;  1RD9 D;  3GO5 A;  1KTK A;  4IUU A;  1ZKO A;  3BZD B;  1D5Z C;  5EBD A;  1RKN A;  4DR6 L;  4A3D H;  1HA5 A;  4ZKB B;  4AYB B;  4K8I A;  2SNS A;  4ZK9 B;  2JA7 G;  3G4S A;  3MVV A;  1JOR A;  1TVX A;  5IWA Q;  2H1E A;  3PV0 A;  5T1I A;  5HY6 A;  4DAY A;  5L37 A;  2Y0S G;  2DN8 A;  1Y1V H;  2UXC Q;  2EYO A;  1Y1V B;  1EIY B;  1HJP A;  3C1F A;  3PO2 G;  1HFN A;  1WD1 A;  1ENF A;  1I94 Q;  1NSN S;  1DOM A;  1K8A C;  4LFA Q;  3HG9 A;  4L5T A;  3Q8D A;  3DWP A;  3BZC A;  4RH6 A;  2CKZ B;  1YIJ A;  2FXQ A;  1F9S A;  4A3D B;  1SYB A;  2RDH A;  3HOZ H;  2YYZ A;  3EA6 A;  3NP8 A;  2RHQ B;  3FKI G;  5LMN Q;  2OXP A;  1ICF B;  4WJ4 A;  4A3G B;  3H0G G;  3OSO A;  3PF4 A;  5M5W H;  4R8N A;  1SXT A;  1M4V A;  5IT9 E;  1X3F A;  1M1K C;  4LFB Q;  1Q81 C;  4XQJ A;  4H7B A;  2ZTD A;  3LWE A;  3QR8 A;  3DWA A;  1QJO A;  1HR0 W;  2NWG A;  4K6D A;  1ESR A;  1PA6 A;  3W3A A;  1YIT A;  5CYU A;  1PH8 A;  1NJI C;  1JT8 A;  4C1N K;  4GNX B;  1MJC A;  2BH8 A;  2B2W A;  1EFW A;  3NE5 B;  3H09 A;  1N32 L;  1TWF H;  3TZU A;  1M8A A;  3A5U A;  1G2T A;  1HCZ A;  3M3Y B;  4A3B G;  1E7Z A;  1PFM A;  4NMZ A;  2PNH A;  4IQZ A;  2PI2 A;  4G7O C;  3ONA B;  2E2J B;  1VQG A;  5IYC G;  1EYA A;  3UDF A;  1ML0 D;  4XQQ A;  3TSS A;  4GNX C;  1E1O A;  3HOU H;  1VMC A;  1VQ9 A;  1XNR L;  3BG3 A;  3F1Z A;  4C2M H;  3RZD B;  3SHL A;  4NB3 A;  1CT1 D;  5C4J H;  1DM0 B;  2KEN A;  4FO2 A;  4JVZ A;  1IBM Q;  3IFD A;  5I6Y A;  5BN3 A;  3GTO H;  3G71 A;  2VL6 A;  3S24 A;  5DNF A;  4LF8 Q;  1J9O A;  2F0D A;  3CXC A;  3AB9 A;  1D1I A;  1N33 Q;  4A3J H;  1JIC A;  3VYU A;  1VQP A;  2L9H A;  4PMB A;  1S4Z A;  3E9H A;  2B2T A;  3HP3 A;  1E2W A;  4GN5 A;  2UUB Q;  4XYQ A;  1B44 D;  5C3W A;  3WDN A;  4A3K H;  3ZJY C;  2DUD A;  5C44 B;  1TS4 A;  4LUO A;  4DV7 L;  2YU9 B;  2UXD L;  1PH7 A;  2XN9 C;  1C9O A;  3MHB A;  1S3O A;  1U4P A;  4K6L A;  1MJE A;  1QVG A;  4WOR A;  3F8T A;  1BVS A;  4P72 A;  4E6I A;  3TEH B;  4ME3 A;  3T1H L;  4PG3 A;  1TS2 A;  1KL9 A;  1CA6 A;  3NBH B;  2K5D A;  2OTL A;  3ULL A;  2B2U A;  4YY3 L;  3HOV H;  4KHV A;  1STG A;  3I7F A;  3VYR A;  4BBR B;  4JV5 L;  4DR4 L;  2KED A;  1EYC A;  3T51 B;  1KXL A;  3QJY A;  2K05 A;  4BA2 I;  1AN8 A;  1A8V A;  2A68 D;  4IUP A;  3S15 H;  1LTB D;  1A6X A;  5IT9 L;  3HOU B;  4X3S A;  1YHB A;  4N9T A;  5KNB A;  1Q82 C;  4A3I B;  3L7Z C;  3T1Y L;  2XNA C;  3HOY H;  2O2L D;  5JJK A;  4JI6 Q;  2OEO A;  1B3A A;  4RCN A;  1JCK B;  5GQO A;  4BY1 B;  3CCL A;  4JBW A;  1AH9 A;  1SRO A;  3PO2 B;  1D7Q A;  3CCJ A;  2I0Q A;  2F3V A;  3PO3 G;  3HOZ B;  2PMZ E;  3ER0 A;  3R2T A;  4A3M B;  2MPM A;  2EY6 A;  5M3F H;  4XDX A;  4KJO A;  4X6A H;  3OIP A;  2BCO A;  4ILW A;  2ZM6 Q;  1BOS A;  2C35 B;  1WD0 A;  4XT3 B;  2RHS B;  3EBE A;  1CA5 A;  2XWJ B;  2VUM G;  1MGS A;  3OPO A;  3OTO L;  1LAB A;  1DGS A;  4MIU A;  4K2K A;  4OWT B;  4GKJ L;  1RHP A;  1D5X C;  4A3B B;  4JBM A;  1SSO A;  1EY5 A;  3QOL A;  1VQ5 A;  4LUZ A;  3D8G A;  1F9R A;  4RKL A;  1B9M A;  4KD4 A;  3CRL C;  4A4I A;  1ZEQ X;  3K8A A;  4GS3 A;  4HJ8 A;  1H9S B;  4K2L A;  1KAA A;  1N36 Q;  1N8R C;  2ZJQ A;  3DLL A;  2L0C A;  3W5O A;  5NUC A;  3EIV A;  4X64 Q;  1J8I A;  4AYB E;  1STE A;  1ENC A;  1OXV A;  2FMM A;  2KOL A;  4P75 A;  5FLM G;  1N36 L;  3CPF A;  3EJI A;  4DR5 Q;  1XNR Q;  2AWO A;  2HQL A;  1FVI A;  3OW2 A;  4LFC Q;  2UXB Q;  4KY7 A;  3F2C A;  3CCR A;  2PI2 E;  1R9T H;  2NBF A;  1PFB A;  2WB1 E;  4YWL A;  3QG1 A;  5I2X A;  1OXU A;  2CQA A;  4CJ0 B;  2L4N A;  2JA9 A;  1CUK A;  1PZI D;  3HRZ C;  2UXB L;  3KK7 A;  5I9O A;  1WCM G;  1AZQ A;  4OIK A;  4RGM A;  2LMC B;  1UWV A;  2A69 C;  1B53 A;  3UDG A;  1UNS A;  1HH2 P;  2A19 A;  4DK3 C;  2F0W A;  3K6O A;  1QG7 A;  3HKZ E;  5G3L D;  1SYE A;  4FP5 D;  2HT1 A;  1BQQ T;  3ICE A;  4H13 C;  2QGQ A;  3H0G B;  4DV7 Q;  3GTG B;  5CV5 A;  4FXD A;  2AHO B;  3EN2 A;  1FNV A;  2BDO A;  2AQ3 B;  2QIL A;  1L1O A;  1A15 A;  5IGD A;  1BCP B;  4QY7 A;  1JWS D;  1T5X D;  3S1N B;  1LT3 D;  1DOL A;  1Q1B A;  4DK6 C;  5A2Q E;  5C4H A;  5CR3 A;  1JB3 A;  1DYQ A;  5CMD A;  4KMU C;  4LF7 L;  4CBV A;  4B9W A;  4OX9 Q;  3G7L A;  2K5N A;  3K7A B;  5D65 A;  3MXN B;  1PZJ D;  3L2P A;  2R3Z A;  4BS9 A;  2IX1 A;  1ET9 A;  5BR8 Q;  4CGY B;  3MEH A;  4R8I A;  1A3T A;  4A3F H;  2L55 A;  2D9U A;  1H9J A;  2FFK B;  1U9R A;  2K75 A;  4A3M H;  1CKO A;  1QZG A;  1A3U A;  5CV7 A;  1YJN A;  1QWY A;  3J80 c;  4A3L H;  2F3I A;  4V0B A;  3VR3 A;  1HHV A;  4FYD A;  5M3M B;  4QJF A;  2MO1 A;  4POG A;  4X66 Q;  1GVP A;  1Q90 A;  2N49 A;  5ELF A;  3I4M G;  5EQ0 A;  2ICE C;  2A73 B;  3OMC A;  5J39 A;  3MXN A;  4DAM A;  1QE6 A;  1N32 Q;  1JE5 A;  1VQ6 A;  1V9P A;  2SOB A;  1PVO A;  3BYY B;  4C3J H;  3PO3 B;  2JA5 B;  4F88 A;  4HIK A;  4A3M G;  1AEX A;  3WOE A;  2UUA L;  1VQC A;  1NCV A;  2B2W C;  1KLG D;  2L1B A;  4J1M A;  1VQJ A;  3K59 A;  1EY8 A;  1A2T A;  3CMA A;  4QIW E;  2HHH L;  2B29 A;  2FIN B;  4GLV B;  4RHR A;  3H15 A;  3FPP A;  1EEF D;  3LWU A;  2R7Z G;  3I55 A;  1BUV T;  1MSG A;  2XRQ D;  4C3J G;  2EXD A;  2F0T A;  5ELC A;  4IPD A;  4JI8 Q;  3RNU A;  1PFS A;  1FNU A;  4RMF A;  2RKS A;  1SBB B;  2IW3 A;  2WAC A;  3TRZ A;  1EQT A;  4DR7 Q;  5A2Q L;  3CC7 A;  5EAY A;  4EQP A;  5LMU L;  4QCL A;  4IUV A;  3HFZ B;  3CME A;  2KEC A;  1Q7Y C;  1LTA D;  2JN4 A;  4HMJ A;  5JOB A;  1YJW A;  1P8L A;  1O7I A;  4NKL A;  1YBY A;  2NUC A;  2LSS A;  3S17 H;  1FR3 A;  3OOC A;  2Q8I B;  2EJG C;  1WTR A;  4BBR G;  4G57 A;  5E4W C;  2XGT A;  2RSN A;  1AP0 A;  1W3S A;  3HGB A;  1H95 A;  4O2D A;  4X3K A;  1RIP A;  4OIJ A;  5BN5 A;  4POF A;  3N52 A;  5HGQ A;  4DR6 Q;  1UE5 A;  4CKE A;  5ELO A;  3VA7 A;  3SE0 A;  4IUQ A;  3J81 j;  4ABN A;  4DNI A;  1VQN A;  2MGS A;  2R6G A;  1KRT A;  2RA4 A;  5EKI A;  4C1N I;  2V4D A;  4LF6 L;  4K5V A;  1F2Z A;  3J81 i;  4X3T A;  2EYM A;  3A56 A;  2YTX A;  4XTC S;  3HZX A;  2F0O A;  3FKI H;  2F0F A;  2DY8 A;  4DV2 Q;  1DZ1 A;  2JA7 H;  4JV5 Q;  2HUG A;  1ET6 A;  4LF6 Q;  1KDB A;  1MKH A;  1VQE A;  2N88 A;  2UUC L;  3FPU B;  3GTQ H;  2F03 A;  4KJN A;  2A69 D;  3I90 A;  1WTO A;  3KFU A;  4IPH A;  3J7A F;  3J80 E;  5C0X G;  3IAY A;  3KLS A;  2EQS A;  4DR2 Q;  4DU9 A;  5IOC A;  2AQ2 B;  5KRU A;  1K9M C;  5C5L A;  4DXG A;  1SDF A;  1IBL L;  3AEV A;  4DAP A;  2CH4 W;  3BDC A;  1K83 B;  2KCN A;  4R4O A;  1CZW A;  1G8Z D;  1G91 A;  2F0E A;  2CW0 C;  4I65 A;  1STA A;  3GTK H;  2KUM A;  1CQV A;  2PZW A;  4GKK L;  3OIQ A;  3I3C A;  2ASB A;  4X66 L;  1MBY A;  2YTV A;  5C0X H;  3UDI A;  3KBG A;  2F0J A;  3PO2 H;  1JJC B;  2Z9H A;  1JJ2 A;  1ESF A;  2R7F A;  3M9B A;  3OHX C;  3A0J A;  1SNO A;  3NQI A;  4OXP A;  2EE1 A;  3E3X A;  1F2M A;  1YZ6 A;  2D2C C;  1VQO A;  2NB0 A;  3RLN A;  5M5W B;  3M4P A;  2KHS A;  2OF1 A;  4XYO A;  3U4V A;  4A93 B;  3RLF A;  1WCM B;  2WV6 D;  4PNY A;  2K14 A;  2QKI C;  2JA8 B;  4DV0 Q;  1SE3 A;  2BDN A;  5IT9 c;  3EFX D;  1Y69 U;  4ZQ3 A;  1YHA A;  4X3U A;  1WOC A;  3R93 A;  5H1S E;  1C0A A;  5ELD A;  2IHE A;  4A3E G;  3WWV A;  4RFB A;  4LF4 L;  3HS0 C;  2G5D A;  1GUW A;  1L1O B;  3QB3 A;  4JI7 Q;  1F9P A;  1TS3 A;  5LHY 1;  3M4O B;  3MFY A;  2JE6 I;  2EY5 A;  4R4Q A;  1X54 A;  4A3C H;  1W2B A;  3MXU A;  2JA6 G;  1I50 H;  1WJJ A;  3S16 B;  5C3X A;  4PQX A;  2IX3 A;  4JI7 L;  1N9W A;  2PYK A;  3I4O A;  5FK9 C;  3I73 A;  4H44 C;  1PTO B;  2EYF A;  3KDF B;  5C4X B;  4BBR H;  3TN2 A;  2OTJ A;  4OON A;  2HIV A;  5CV6 A;  1BBW A;  4BY7 H;  3CC2 A;  4LF7 Q;  2F3W A;  2EPB A;  4OX9 L;  4ULL A;  5KEE A;  3JAM i;  4PMW A;  3P7J A;  4WJW A;  5LMN L;  5BN4 A;  2TSS A;  1HQR D;  1BR9 A;  1UAP A;  3HOU G;  4A3K B;  1O7L A;  1Z47 A;  4B3R L;  4ZUI A;  2BE5 C;  1HA6 A;  4GOP C;  1L0Y B;  5JEA G;  4QGU A;  4ZCK A;  1IBK L;  4C56 C;  3HOX H;  1K0S A;  1C4Q A;  3M4Y A;  3MEF A;  2AWN A;  5M3M G;  4LAA A;  1OTC A;  4CDE C;  5IGE A;  4R4I A;  1EYD A;  4JI1 L;  4ID6 A;  5CV9 A;  1SYG A;  2EDG A;  2VXW A;  4IUR A;  1IBK Q;  4JI2 Q;  4DKA C;  5ELB A;  4A3F B;  1E2V A;  1XMO L;  1I4Q A;  1SR3 A;  1JC7 A;  2N55 A;  1LO5 D;  5CGK A;  3K58 A;  1XPO A;  5J1Z A;  4KHP Q;  1SEB D;  2PZU A;  2KQ3 A;  5JJL A;  5DEH A;  1WTP A;  4EVO A;  1WTV A;  4JC0 A;  2LY7 A;  1PRT D;  4K14 A;  4A3D G;  4XQN A;  3S16 H;  3EQL C;  2I5H A;  5EKL A;  1NMF A;  1PYW D;  1QUQ B;  5IGB A;  3F2B A;  2ZJP A;  2UUC Q;  1I5F A;  1LTL A;  4CDC C;  4KKU A;  2CVR A;  5EPK A;  1PYB A;  3ITP A;  2Q2U A;  1ASZ A;  1OXX K;  5FJ8 G;  3CHB D;  3KLW A;  4DA2 A;  1K28 A;  1PH4 A;  4LF8 L;  4H0L C;  1N33 L;  1JOO A;  1V43 A;  3UDX A;  3PUV A;  1WCM H;  2OT2 A;  2K1B A;  1PH5 A;  1RTO A;  3CP0 A;  1PH3 A;  2M00 A;  4JYA Q;  3GQB A;  1CSP A;  4DK1 A;  4HSP A;  1H9M A;  3I4M H;  3H0G H;  4OGQ C;  3D4D A;  2R92 G;  5DAU A;  4DUY Q;  4DR7 L;  3OWE B;  5E4X A;  3DEO A;  1XPR A;  4MTN A;  1EOV A;  3MAQ A;  5LMU Q;  3U50 C;  4FDB A;  1H9K A;  2MNA A;  2F0S A;  3I2Z A;  4CJ1 B;  3VR6 A;  1ROD A;  2ZTC A;  5IY0 A;  1VQ4 A;  1I4H A;  4HJ9 A;  3PUY A;  3L9A X;  3OYY A;  3KLR A;  2KEE A;  2JK8 A;  4HSV A;  4KKT A;  4KI0 A;  5C3E H;  2A68 C;  4HJA A;  2RVL A;  3K0Y A;  1VQM A;  2HDM A;  2QCP X;  3UE1 A;  4A3B H;  4APV A;  1SND A;  3TRE A;  3GTM B;  1J5E Q;  3H6M A;  1WVL A;  5G3L F;  1AE2 A;  1LTI D;  5JJZ A;  3OWF A;  4FF3 A;  5CBE E;  1E3P A;  4LF4 Q;  1TT2 A;  4NPS A;  2ATW A;  2EOT A;  3TP8 A;  5LL6 S;  4JI0 L;  1KC8 C;  5JJI A;  2K5H A;  1A62 A;  4KLK A;  1PH6 A;  3GTQ B;  2E5L Q;  3D4R A;  1PRT B;  4LNQ A;  3S9W A;  4DR4 Q;  3X3M A;  3IRB A;  2L5T A;  4LF5 L;  1T5E A;  5CC4 A;  1JOQ A;  3STB C;  5JVG 3;  2EY2 A;  1A0I A;  1TWG B;  4GN4 B;  5IP7 H;  1ZYR D;  3GTP B;  5M5X B;  2K28 A;  2JEB I;  3DUZ A;  1EY9 A;  1ASY A;  2JQO A;  2ZT9 C;  4X62 Q;  1TS5 A;  3TP6 A;  1FGB D;  4OEM B;  4LUV A;  2F1M A;  4K5X A;  2JXM B;  3K80 C;  4PZ7 A;  5FLX E;  1HUN A;  4AYB G;  2DGY A;  4B3R Q;  2LXK A;  3PQI A;  4DV5 Q;  3I70 A;  4IAL A;  4L5R C;  5FOB B;  3GDE A;  1V1P B;  2EYJ A;  1SAP A;  4AIM A;  3GTM H;  1KNA A;  3D0F A;  1SLJ A;  3KYH C;  1B2T A;  3S15 B;  2G9H D;  3PO3 H;  3E9I A;  2WB1 B;  4CJ2 C;  5M3F G;  3TP7 A;  1XMQ Q;  4J6H A;  1TWH H;  1O7Y A;  4EX5 A;  1LTG D;  1VDZ A;  5DM7 3;  5FLX c;  5GAH C;  4DAY B;  4L63 B;  4A93 G;  2F0H A;  2HD3 A;  1S5C D;  1YEZ A;  4C3H B;  1JE4 A;  3J7Y W;  3G48 A;  1SE4 A;  4A3E B;  2E2H H;  3BYT B;  2IJ0 A;  2A8V A;  4YCV A;  4DV0 L;  4LK1 C;  1EY6 A;  3I72 A;  4LMQ D;  4A3L G;  4IJL A;  2GN5 A;  2QW7 A;  2WKC A;  1I50 B;  2Z0S A;  1TWA B;  1G6Z A;  5KIX A;  2Q2H A;  3A5Z B;  4IO9 A;  3MZ5 A;  4R4T A;  2IWH A;  4NXN L;  4G4K A;  1TWC B;  4A3J B;  3S14 B;  3I56 A;  2PQE A;  4O1N A;  3R3O A;  4C3I G;  1PYS B;  2PNR C;  2OCE A;  4JOI A;  5COR A;  1PMR A;  1ENA A;  2JA5 H;  5I9P A;  2K4K A;  1I4R A;  1LUZ A;  1U4M A;  2WAQ E;  2Y0S B;  2K04 A;  4QF4 A;  3NBH A;  4GOP B;  1CK1 A;  5IWA L;  1EY0 A;  4DUY L;  3ZYY X;  3S1M H;  5JAV A;  3DWQ A;  2L12 A;  1KDA A;  4YHH L;  2V1C C;  3M7N A;  2NVY H;  2F4I A;  1SE8 A;  3OMG A;  5GAE C;  3CC4 A;  2E2J H;  4DF7 A;  3KF8 B;  2QEX A;  1EU4 A;  1II3 A;  3W1G A;  2IX0 A;  3FVQ A;  5C4X H;  2LKV A;  2X69 A;  3GTG H;  1KLU D;  2E2H B;  2JYO A;  2WAQ G;  4HJ7 A;  2P5Z X;  1YI2 A;  4FF4 A;  3TS2 A;  1TWA H;  1E2Z A;  2RSO A;  4TVA B;  4C2M B;  4IZ8 A;  1YHQ A;  5FKA C;  1TY0 A;  1EEI D;  4GLA C;  1YNJ C;  1L1O C;  4WJ3 M;  2Z6K C;  1F2Y A;  4QMG A;  2HDL A;  4IOA A;  4JPB W;  1JMC A;  1GUS A;  5FO7 B;  1NY4 A;  3H3V I;  2RCF A;  1LT6 D;  1ICW A;  3KJO A;  5IYB G;  4BY7 B;  3H94 A;  3BDL A;  3DM3 A;  2RBM A;  3JAM L;  4KHP L;  1EWC A;  1TXY A;  2D62 A;  3KBX A;  5D3I B;  1D1K A;  4J15 A;  3FHW A;  1EUJ A;  1U5K A;  3PIP A;  1C8C A;  3GTL B;  1SYD A;  1VQL A;  3K57 A;  1KHI A;  1LT5 D;  3GV3 A;  1N34 L;  1VS0 A;  3SR1 A;  3NEL A;  2F0Q A;  4Y7N H;  2Z6B A;  1XNQ L;  4DV1 L;  1DD2 A;  2A5H A;  4JI1 Q;  1Q46 A;  4K5W A;  1KAB A;  4QUF A;  1TWG H;  1PLF A;  1JQY D;  1BF4 A;  3I91 A;  4WFN 3;  1HZ9 A;  1NMG A;  4JI2 L;  3DEP A;  4IUT A;  4DAV A;  4DV5 L;  1SMY C;  4DR1 L;  3BVM A;  2Y0S E;  5K36 G;  3DM1 A;  1VQB A;  4JOI C;  2SNM A;  4DV6 L;  4MN3 A;  5M5X H;  4V19 0;  5ISR A;  1HNW L;  4AH6 A;  3PSI A;  2RDG A;  2B2T C;  1EIH A;  5E7N A;  1HNX L;  4A93 H;  1B50 A;  4DV6 Q;  4GNX A;  3KUP A;  2NVT H;  3A7L A;  3KJP A;  3S17 B;  1BCP F;  3Q6S A;  3V05 A;  1MSH A;  1IZ6 A;  4DNR B;  2NN6 H;  3HKZ B;  3I8Z A;  4OEL B;  2K7V A;  2HQE A;  4PV1 C;  3HOZ G;  1K8G A;  5LMN W;  3LNN A;  1BNZ A;  2PCF B;  1X6O A;  2PO4 A; 
#chains in the Genus database with same CATH homology
 3I4N G;  1E24 A;  2ZTD A;  4UP9 A;  3U58 A;  5IP9 G;  4JI3 L;  2OWO A;  3BZK A;  1HR0 W;  1Z9F A;  3CCE A;  5ELN A;  3GTK H;  2UXD Q;  4IPG A;  4DV4 Q;  3BU2 A;  1VCI A;  3CF5 A;  4QL5 A;  1PA6 A;  3J81 c;  1YIT A;  3W1B A;  2ASB A;  4X66 L;  3FP9 A;  4JBK A;  2YTV A;  1PH8 A;  3ULP A;  2BA1 A;  3UDI A;  1NJI C;  2HIX A;  5AJ3 L;  4GNX B;  1GM5 A;  1MJC A;  3PO2 H;  1JT8 A;  1JJC B;  2BH8 A;  1I6H H;  5C0X I;  1JJ2 A;  1Q8K A;  1EFW A;  2R7F A;  3M9B A;  3RZO H;  3A0J A;  1Y14 B;  1SFO H;  1N32 L;  1TWF H;  3GTP H;  4X65 L;  3A5U A;  1MIU A;  4OXP A;  4DV4 L;  3T1H Q;  1YZ6 A;  4JBJ A;  1VQO A;  4A3B G;  1E7Z A;  1N34 Q;  2F4V L;  1BBU A;  3RLN A;  2PNH A;  3M4P A;  2PI2 A;  1LYL A;  3U4V A;  4IFD J;  5IYD G;  3RLF A;  3SGI A;  1VQG A;  5IYC G;  2K14 A;  3UDF A;  4DV0 Q;  2OQK A;  1YNX A;  1PH9 A;  2R7D A;  5IP9 H;  5IT9 c;  1YHA A;  5FLM H;  4JI5 Q;  1VQ7 A;  1WOC A;  3NEM A;  3VDY A;  1SMX A;  1GD7 A;  5H1S E;  4GNX C;  2IHE A;  4A3E G;  3K0X A;  3H3V H;  1C0A A;  3WWV A;  1E1O A;  1FL0 A;  4LF4 L;  2K52 A;  1X56 A;  1L1O B;  2YTY A;  4JI7 Q;  3S1R H;  4A3I G;  3HOU H;  4R4C A;  1VQ9 A;  2JE6 I;  1EYG A;  1XNR L;  5C0X J;  3F1Z A;  4C2M H;  3JAM c;  4R4Q A;  1XJV A;  1X54 A;  2CCZ A;  4A3C H;  1W2B A;  4JI5 L;  4NB3 A;  2JA6 G;  1HNW Q;  5C4J H;  1I50 H;  1UE6 A;  4BY1 G;  2KEN A;  1WJJ A;  1IBM Q;  5GRO A;  3JC6 6;  3AYH B;  2AMC B;  2N78 A;  3GTO H;  1X65 A;  3G71 A;  1HNX Q;  2VL6 A;  4JI7 L;  1YVC A;  3S24 A;  4K0K Q;  1N9W A;  3I4O A;  2JEA I;  3K81 C;  3HOX G;  4XIG S;  4LF8 Q;  3CXC A;  2CFM A;  1N33 Q;  4A3J H;  3KDF B;  2R93 H;  1T9H A;  4BBR H;  2OTJ A;  4DR3 Q;  1VQP A;  4LF9 Q;  4OON A;  3S1Q H;  1L0W A;  2HIV A;  1KD1 C;  1BBW A;  2VZA A;  3CC2 A;  3E9H A;  2UU9 L;  4LWC A;  2JA5 G;  4LF7 Q;  3JAM i;  4OX9 L;  4PMW A;  4YWK A;  5LMN L;  1WYD A;  4GN5 A;  2UUB Q;  1IBL Q;  1UE7 A;  2PQA A;  4DUZ Q;  4A3I H;  1Z47 A;  2ZM6 L;  1C7Y A;  3HOU G;  4B3R L;  4GOP C;  4JG2 A;  4A3K H;  4EQ5 A;  3ZJY C;  4L5S A;  2DUD A;  5JEA G;  4QGU A;  2NN6 G;  2E2I H;  1B8A A;  4LUO A;  3HOW H;  4DV7 L;  4GKJ Q;  2Q2I A;  1IBK L;  3HOX H;  1NBW A;  2UXD L;  1PH7 A;  4OO1 G;  1C9O A;  3MEF A;  2AWN A;  5M3M G;  1S3O A;  1KQS A;  1G29 1;  1OTC A;  4R4I A;  4JI1 L;  3STB D;  1MJE A;  4BBS G;  1QVG A;  3BJU A;  3F8T A;  2ES2 A;  1BVS A;  1CKM A;  2MQH A;  1LM0 A;  3HOY G;  4P72 A;  1IBK Q;  3J7A 5;  4JI2 Q;  4ME3 A;  3TEH B;  4DKA C;  3GTJ H;  3T1H L;  4PG3 A;  1KL9 A;  1XMO L;  1SR3 A;  3NBH B;  1RL2 A;  1J6Q A;  1XPO A;  2I5M X;  1HZC A;  4KHP Q;  2OTL A;  3ULL A;  5JJL A;  4DR5 L;  1EQR A;  4YY3 L;  4L5Q A;  3RN2 A;  4JC0 A;  3HOV H;  1XNQ Q;  3I7F A;  2XTI A;  4JV5 L;  1FJG Q;  4OWX B;  3CW2 C;  4A3D G;  2R92 H;  1WFQ A;  4DR4 L;  3ERS X;  1G51 A;  3HOW G;  3S16 H;  2I5H A;  3F2B A;  1NMF A;  1QUQ B;  2ZJP A;  1KXL A;  3CAM A;  1I5F A;  3E0E A;  3PUW A;  5GAG C;  2UUC Q;  4BA2 I;  3RZD H;  1A8V A;  2EIF A;  4BBS H;  1LTL A;  3S15 H;  3A74 A;  3PUZ A;  4A3E H;  1YHB A;  4A3J G;  1Y1V G;  3HKS A;  1XTD A;  3D31 A;  1PYB A;  1Q82 C;  1YJ9 A;  3L7Z C;  3T1Y L;  2LXJ A;  4H02 A;  2Q2U A;  1ASZ A;  3HOY H;  1OXX K;  1K73 C;  5FJ8 G;  1PV4 A;  4JI4 L;  2VY3 A;  4BY7 H;  5JJK A;  4JI6 Q;  3KLW A;  1PH4 A;  3TS0 A;  2OQ0 A;  1PHJ A;  5GQO A;  4B3S Q;  4LF8 L;  1Q12 A;  4KHZ A;  1N33 L;  1V43 A;  4DV2 L;  3UDX A;  3CCL A;  3PUV A;  4NXM Q;  1WCM H;  3TQY A;  4A3G H;  4JBW A;  4Y52 H;  1AH9 A;  1SRO A;  1PH5 A;  4UP7 A;  3CP0 A;  2KCM A;  3T1Y Q;  1PH3 A;  1D7Q A;  3CCJ A;  4JYA Q;  2I0Q A;  3PO3 G;  1CSP A;  2KHJ A;  2UXC L;  2PMZ E;  2VQF Q;  3I4M H;  1X9N A;  3ER0 A;  3H0G H;  1GKH A;  2R92 G;  3S14 H;  1AE3 A;  5M3F H;  4B3S L;  1I94 L;  1U0L A;  4C3I H;  3M3Y H;  2R93 G;  4X6A H;  4DUY Q;  4DR7 L;  1V1Q A;  3KF6 B;  1IYJ B;  1B70 B;  2ZM6 Q;  2JA8 G;  2C35 B;  1XPR A;  4MTN A;  2RHS B;  1EOV A;  5LMU Q;  3EBE A;  3U50 C;  2VUM G;  4IJH A;  4PZ8 A;  3OTO L;  4FDB A;  4BY7 G;  4AQY Q;  2MNA A;  1DGS A;  3I2Z A;  4OWT B;  4GKJ L;  2VUM H;  2ZTC A;  5IY0 A;  1VQ4 A;  4JBM A;  4HJ9 A;  1Q86 C;  3PUY A;  2MFI A;  5FJ8 H;  1VQ5 A;  3OYY A;  4LUZ A;  2A1A A;  2Z6K A;  1UEB A;  2JK8 A;  5C44 G;  3CCV A;  1VQH A;  4KI0 A;  5C3E H;  4LFB L;  4A4I A;  3K8A A;  4GS3 A;  4HJA A;  2N8N A;  4HJ8 A;  4P73 A;  5BR8 L;  1N36 Q;  5GAD C;  1N8R C;  1VQM A;  4YWM A;  3DLL A;  2ZJQ A;  3UE1 A;  4A3B H;  4APV A;  4A3G G;  3W5O A;  2YV5 A;  3TRE A;  1J5E Q;  3EIV A;  4X64 Q;  1AE2 A;  1VQF A;  4AYB E;  1NTG A;  1XMO Q;  3M4Q A;  1E3P A;  4LF4 Q;  5DLQ E;  3L0O A;  1OXV A;  2NZH A;  4NPS A;  4R1J A;  1QVC A;  2N3S A;  5IE8 A;  1HR0 L;  4P75 A;  4JI0 L;  4GKK L;  1KC8 C;  5FLM G;  5JJI A;  5C4X G;  1N36 L;  3CPF A;  2K5H A;  4DR5 Q;  1XNR Q;  2KBN A;  3U4Z A;  2KHI A;  1A62 A;  2HQL A;  2AWO A;  1FVI A;  3OW2 A;  4KLK A;  1PH6 A;  4LFC Q;  2E5L Q;  2IT1 A;  2UXB Q;  4LNQ A;  3F2C A;  3CCR A;  4DR4 Q;  2PI2 E;  3KF6 A;  1EWI A;  1R9T H;  3IRB A;  1SRU A;  2ALY B;  2NVX H;  4X62 L;  3UE0 A;  4LF5 L;  1CKN B;  2WB1 E;  4YWL A;  3STB C;  1OXU A;  1K3R A;  1A0I A;  4GN4 B;  2JA9 A;  1CUK A;  5IP7 H;  4IFD I;  2UXB L;  1WCM G;  2IHF A;  2JEB I;  4LF9 L;  3PUX A;  1Q1E A;  1ASY A;  4B3T Q;  1UWV A;  2JQO A;  4DV1 Q;  5J3B A;  1HNZ L;  4X62 Q;  2D0O A;  3KDF A;  3UDG A;  2NVQ H;  3PIO A;  1PH1 A;  1HH2 P;  2A19 A;  2MO0 A;  4LUV A;  4DK3 C;  3KOJ A;  3S2D H;  3K80 C;  4RG1 A;  4PZ7 A;  1D8L A;  3HKZ E;  2JJQ A;  4AYB G;  4DUZ L;  2DGY A;  2HT1 A;  1M90 C;  3ICE A;  4B3R Q;  2QGQ A;  1IBM L;  2LXK A;  1K0R A;  3F2D A;  2ZJR A;  4DV5 Q;  4DR2 L;  3CD6 A;  4YHH Q;  1KAW A;  4DR1 Q;  2VQE Q;  3GTL H;  4DV7 Q;  4A75 A;  2F52 A;  4L5R C;  2AHO B;  3EN2 A;  3GDE A;  4ALP A;  3RN5 A;  2CWP A;  4AIM A;  1L1O A;  2BH2 A;  3GTM H;  1A63 A;  4GOP A;  4QY7 A;  1S40 A;  3D0F A;  1SLJ A;  3KYH C;  2BA0 A;  4HJ5 A;  3PO3 H;  1Q1B A;  3E9I A;  4DK6 C;  1HZA A;  2VQE L;  1Y1W G;  3HOV G;  1EQQ A;  1JJG A;  4BY1 H;  2RF4 A;  4LF7 L;  5M3F G;  4OX9 Q;  1XMQ Q;  2K5N A;  1PH2 A;  5IYC H;  1TWH H;  3HKZ G;  4EX5 A;  3MXN B;  1XPU A;  5FLX c;  3RLO A;  5AJ3 Q;  3L2P A;  1GO3 E;  2ID0 A;  2IX1 A;  5GAH C;  4GLX A;  4B3M L;  3CCS A;  5BR8 Q;  4DAY B;  2NN6 I;  4A3F G;  3PGZ A;  3J7Z C;  4A93 G;  2I5L X;  5M5Y H;  4X65 Q;  4A3F H;  1YEZ A;  1SN8 A;  4JCV E;  1J5E L;  4X64 L;  5C44 H;  3LGJ A;  2GVB A;  4OO1 I;  1P16 A;  4MNO A;  2K75 A;  4A3M H;  1CKO A;  3G48 A;  1QZG A;  4UPA A;  1YJN A;  2E2H H;  4JI0 Q;  4MZ9 A;  3J80 c;  2A8V A;  4YCV A;  2F3I A;  4A3L H;  4DV0 L;  1WI5 A;  4P71 A;  2CWA A;  4YCU A;  4A3L G;  4IJL A;  2GN5 A;  4QJF A;  2NZO A;  2MO1 A;  2Z0S A;  2E5L L;  4IO9 A;  2Q2H A;  3A5Z B;  4POG A;  2R7Z H;  4R4T A;  4X66 Q;  1GVP A;  4NXN L;  4DPG A;  2N49 A;  2K5V A;  3AQQ A;  4GN3 B;  1QVF A;  3I4M G;  4JI6 L;  4LF5 Q;  4DAM A;  3I56 A;  2Q2T A;  4YY3 Q;  1N32 Q;  1FGU A;  1JE5 A;  1VQ6 A;  3S2H H;  1V9P A;  3NEN A;  1PYS B;  1PVO A;  2OCE A;  4JOI A;  4C3J H;  1IXR A;  4IPC A;  5JEA J;  2KCT A;  2JA5 H;  2F4V Q;  2K4K A;  4B3T L;  1LUZ A;  1UE1 A;  4HIK A;  4A3M G;  1HNZ Q;  2VQF L;  1KRS A;  2B3G A;  1OXT A;  4K0K L;  2WAQ E;  2WP8 J;  2AKW B;  2UUA L;  1NE3 A;  4GOP B;  1B7Y B;  4A3K G;  4P74 A;  1VQC A;  1VQA A;  5IP7 G;  5IWA L;  2QA4 A;  4DUY L;  2H5X A;  4YCW A;  3S1M H;  4DR3 L;  1VQJ A;  3ULJ A;  4A3C G;  3CMA A;  4QIW E;  2HHH L;  4QQB X;  4YHH L;  2JA6 H;  2B29 A;  4GLV B;  3H15 A;  2V1C C;  4AQY L;  5IYD H;  3M7N A;  2NVY H;  5IYB H;  2UU9 Q;  2YU9 H;  2R7Z G;  1QUQ A;  3I55 A;  1SE8 A;  3K7U C;  3J80 i;  5GAE C;  3CC4 A;  4NXM L;  4O0A A;  2E2J H;  1X55 A;  2EXD A;  2RCN A;  3KF8 B;  2QEX A;  2WFW A;  4IPD A;  3W1G A;  2HHH Q;  4JI8 Q;  2IX0 A;  3RNU A;  1QZH A;  5C4X H;  3GTG H;  1PFS A;  4HIM A;  4C3H H;  1TWC H;  3B6Y A;  3K7A H;  4RMF A;  2VW9 A;  3CPW A;  1JB7 A;  2K50 A;  2WAQ G;  3G6E A;  4HJ7 A;  1YI2 A;  3CCU A;  1KIX A;  3TS2 A;  1TWA H;  2PQA B;  1CSQ A;  3CQZ H;  1XMQ L;  3TRZ A;  5C3E G;  4DR7 Q;  2WB1 G;  1E22 A;  4TVA B;  2GVA A;  2IY5 B;  3CC7 A;  5EAY A;  1G6P A;  4JI8 L;  1YHQ A;  1HR0 Q;  5LMU L;  4B3M Q;  2CQO A;  4TQU S;  1OXS C;  4GLA C;  3OTO Q;  1Y1W H;  3HFZ B;  3CME A;  1Q7Y C;  1L1O C;  4WJ3 M;  2Z6K C;  2L15 A;  4LW1 A;  1YJW A;  4IOA A;  1P8L A;  1O7I A;  3AFP A;  3RR5 A;  4IOC A;  1BKB A;  1JMC A;  1VQK A;  2B63 H;  3CCM A;  1YBY A;  3M4O H;  2LSS A;  3S17 H;  3H3V I;  1NY4 A;  1VQ8 A;  4GKK Q;  4IFD G;  4BBR G;  1VQD A;  5IYB G;  2XGT A;  3KJO A;  3I4N H;  3DM3 A;  3CCQ A;  4KHP L;  1TXY A;  2D62 A;  5M3M H;  3AFQ A;  3PF5 A;  1L2F A;  1W3S A;  4J15 A;  3FHW A;  1EUJ A;  1U5K A;  4O2D A;  1H95 A;  3PIP A;  2JA8 H;  4A76 A;  1RIP A;  3PCO B;  1VQL A;  4POF A;  1FJG L;  1KHI A;  4BXX H;  1N34 L;  1VS0 A;  5HGQ A;  4NXN Q;  1VQI A;  1UE5 A;  4HID A;  1IL2 A;  1CKN A;  3NEL A;  4DR6 Q;  1I3Q H;  4Y7N H;  1X3G A;  5ELO A;  4DV1 L;  1XNQ L;  4JI1 Q;  1Q46 A;  3J81 j;  3GD7 A;  3S1N H;  1TWG H;  4DNI A;  3GO5 A;  1VQN A;  2R6G A;  1KRT A;  1HZ9 A;  2VS1 A;  1NMG A;  4LFC L;  4BA1 I;  4JI2 L;  4LF6 L;  2VNU D;  2ZTE A;  4DV5 L;  4DR6 L;  4DR1 L;  2Y0S E;  3J81 i;  4A3D H;  5K36 G;  2YTX A;  4XTC S;  1VQB A;  4JOI C;  1E1T A;  3G4S A;  4DV3 Q;  3FKI H;  4DV6 L;  4PZ6 A;  2UUA Q;  2JA7 G;  5M5X H;  5IWA Q;  1HZB A;  4DV2 Q;  2JA7 H;  4UP8 A;  4JV5 Q;  3PV0 A;  1HNW L;  5HY6 A;  4LF6 Q;  2E8G A;  4AH6 A;  1MKH A;  2Y0S G;  3PSI A;  4BXX G;  1VQE A;  4JYA L;  1Y1V H;  4OWW B;  2UXC Q;  4UY8 C;  5E7N A;  1HNX L;  3M85 A;  2UUC L;  3GTQ H;  4A93 H;  1EIY B;  1HJP A;  4DV3 L;  4DV6 Q;  3PO2 G;  4GNX A;  3KFU A;  1I94 Q;  4IPH A;  2NVT H;  4HIO A;  1K8A C;  5C0X G;  3KJP A;  4LFA Q;  2EQS A;  1EIF A;  1K83 H;  3Q8D A;  3BZC A;  1X3E A;  4L5T A;  4DR2 Q;  1S72 A;  2CKZ B;  1YIJ A;  2FXQ A;  1IZ6 A;  4JI4 Q;  1K9M C;  4JI3 Q;  3HOZ H;  2YYZ A;  2RHQ B;  3FKI G;  5LMN Q;  2D0P A;  3HOZ G;  4WJ4 A;  3H0G G;  2UUB L;  2ATW A;  2B63 G;  1K8G A;  5LMN W;  1IBL L;  3AEV A;  5M5W H;  3PF4 A;  1X6O A;  4LFA L;  4R4O A;  1X3F A;  1M1K C;  4LFB Q;  1Q81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...