1DJRD

Heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl-alpha-d-galactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structure of m-carboxyphenyl-alpha-D-galactopyranoside complexed to heat-labile enterotoxin at 1.3 A resolution: surprising variations in ligand-binding modes.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1djrD00
3R2TA 3O13A 4Z9CB 1FD7D 1AN8A 1JWUD 3DWPA 4RGTA 5TSSA 1I4QA 1M4VA 2CHBD 3BVMA 2AQ2B 2SEBD 2O2LD 2WV6D 1L0YB 5FKAC 4RHRA 1PTOF 1B44D 1L0XB 1PZKD 2Z8LA 3TSSA 1LT6D 1EU4A 1I4RA 1V1PA 5D3IB 1EEFD 1CT1D 5ELBA 1BCPD 1ENFA 3BVZA 2XNAC 4L63B 1HQRD 1B1ZA 3URYA 1SJHD 1KTKA 4RGOS 1EU3A 2NTTA 2XRQD 1RF2D 1TS2A 2G9HD 1ET6A 1SE2A 1LT4D 1KLGD 1JWMD 1S5DD 1S5CD 3DWQA 4RGNA 5D3DA 4BWGB 1T5XD 2XRSD 4L6TB 1EEID 1KLUD 2IJ0A 1F77A 3EFXD 4K6LA 2QEJC 3MC0B 1PZID 1LTBD 1LTID 4C56C 1LT3D 1PRTC 4O1NA 1PRTB 1HXYD 3OWEB 1JCKB 1LTRD 1BCPC 1CK1A 1PYWD 1BCPB 1G8ZD 1JQYD 1LLRD 4ZYSA 3DWAA 3BYYB 1HTLD 1TS5A 1CQVA 1AW7A 1EFID 1RD9D 5ELFA 3R2IA 2AQ1B 2ICIA 1JWSD 1LO5D 3GP7A 3V05A 1I4HA 1LTAD 4UDUC 5FK9C 2TSSA 1D5ZC 1FNUA 4DXFA 3KLSX 1TY2A 1ET9A 2QILA 1UNSA 1LT5D 5ELCA 1SJED 1DJRD 4RGMA 1PTOH 1SE4A 2RDGA 1S5FD 4OHJA 1TY0A 4RCOA 1MD2D 3MFGA 1I4PA 1PTOD 1TS3A 1PRTF 1D5XC 3W2DA 3SEBA 1BCPF 2NTSA 1D6EC 5ELDA 1FNWA 1FGBD 1RCVD 1RDPD 1EWCA 1SBBB 2R61A 3BVGA 1LTSD 4RHSA 3R8BA 1S5BD 1SXTA 1XXGA 4RFBA 1I4XA 1LTTD 2XN9C 1STEA 2J4XA 1GOZA 3CHBD 3BZDB 4RH6A 4DXGA 2AQ3B 1ESFA 2IPKD 1SEBD 1UUPA 1FNVA 1S5ED 1CHPD 1JR0D 1PTOC 3BYTB 1HA5A 1PRTD 5I4DA 1DYQA 1PTOB 4TSSA 1TS4A 5ELEA 1BXTA 3EA6A 1CHQD 2RDHA 1V1OA 1QILA 1SE3A 1LTGD 1XTCD 1D5MC 1I4GA 1V1PB 1PZJD
chains in the Genus database with same CATH superfamily
1SNMA 2JA6H 3U58A 4U68A 1K3BC 1KAAA 5FLMG 4A76A 1SROA 4KKUA 4WRDA 1CI3M 1K0RA 4RCNA 3V2TA 4A3EB 3DEOA 2K5WA 5I9PA 1GD7A 5GAGC 4RHRA 2H1EA 3GTOB 1LT6D 4A4IA 4QCLA 3WOFA 2F0JA 2AKWB 2R7ZG 3ND9A 1SE2A 3SXHA 4LF5Q 1KLGD 3GDEA 1G2TA 4N8FA 3D3RA 4X65L 2Z9HA 4A75A 1EY5A 3J7AF 2EDGA 3JAML 5JEAH 1ASYA 1ZXTA 3GQBA 3DMUA 4A3JB 5FJ8G 1GUGA 4JV5L 2FJ2A 1C8CA 4ZYSA 5I2XA 2NWGA 4DA2A 1YJNA 2Q8RE 3GTMH 4GLVB 5AJ3L 2JA7G 1CQFA 5BN5A 5I2YA 4CJ2C 1NE3A 3T1HQ 4KKSA 1EWHA 1Y1VH 5IWAL 3U4ZA 5HGTA 1PA6A 2ENBA 4PZ7A 1ET9A 1Y14B 2JJQA 1SE4A 2HUGA 1S5FD 2B2WA 4AQYL 4DNTB 4CHTB 3S2HH 2CFMA 3AFQA 3K58A 4JC0A 3GV3A 2OF1A 4YHHQ 1HR0L 2EYHA 2MO0A 4BY1G 1VQPA 1HRJA 2AWOA 4CJ1B 2Q2UA 5K36G 5JJZA 2UXCQ 1RCVD 1RTOA 2B3GA 1JJGA 1SXTA 4CDFC 3S1MB 1TWGB 3KBXA 2K32A 1YNXA 1PH9A 5COYA 1DXMA 3I7FA 3ITPA 1NMGA 4A3EH 1Q7YC 2SNMA 1KD1C 1N33Q 4L5QA 2D0OA 1S5ED 2KOLA 2PO4A 3GTOH 4DR7L 1XNQL 4EVOA 3L0OA 3I4NG 1HA5A 2CQAA 3UE1A 2K5VA 1WVLA 5M3MG 1Y1WB 1W6KA 4PV1C 1LACA 4PG3A 4BA1I 2EJFC 3SK6A 1S40A 2RHSB 2NVTB 4PZ8A 4ILWA 3H91A 1XPUA 4JI8Q 3T53B 4C3IG 4O2DA 1K73C 4DV2L 4A3JH 3H6MA 1MI2A 3TQYA 4LK1C 3P75A 2AQ2B 5LMNL 4YWMA 3R3OA 5FKAC 1NSNS 3TMEA 2JEAI 5IP9H 3NBHB 1RL2A 1CZGA 4LNQA 1AE2A 4DR3L 1AZQA 4M8AA 2F0LA 2G9HD 1ET6A 3FVQA 2IWHA 2KCNA 4R1JA 3S16B 1JWMD 5D3DA 4WORA 1Q8IA 2HCCA 1HPCA 5BN3A 2F0TA 4Q5VA 3I72A 1WD1A 4IUUA 3SR1A 4H02A 4TQUS 3HOVG 3E9IA 3CCLA 3BZKA 4K2KA 4YY3Q 1XNRQ 5J3BA 2NVQB 2KJXA 1A0IA 1PH6A 4RAUC 1QB5D 1Q8KA 2K75A 3S1MH 1RTNA 3DWAA 1TWGH 1EYDA 2NN6G 1UWVA 1EZ8A 3KJPA 4DGZA 2K5NA 3WDNA 4XT1B 4DXFA 2Z6KC 1DZ1A 5CORA 4DAYA 4C3HB 3H3VC 2B2UA 1Y8PB 3KBGA 1Y1WH 4F88A 1KDAA 4DKAC 1STNA 2VB2X 1TR5A 2NVTH 1EUJA 1F9SA 3OWFA 4PMBA 1CKNB 5JOBA 5DEHA 3S1NB 1SN8A 1EYGA 1LTSD 4XYOA 3A8KE 3BDOA 4X65Q 5KNDA 4DPGA 1A15A 1OO9B 4YWLA 1HFGA 2Z4HA 1OXVA 1IKLA 2JP1A 3AB9A 4OL7A 1BKBA 1YITA 3VDYA 1TWCB 2I0QA 1QVFA 4JV5Q 4ZRZA 1H9JA 3A5ZB 4P71A 3F2CA 2E75C 2B2TC 5AJ3Q 1R4QB 5C44B 3BU2A 3K5OA 3VYUA 3S16H 5IWAQ 4H0LC 2F0EA 5GROA 4EQOA 3H0GG 1AH9A 3QWNA 1D5MC 5EKLA 1NBWA 3JAMc 5C4ZA 5LMUL 1VQFA 2WAQB 4DR4L 1OXSC 1QVGA 4JI4L 4AQYQ 2EPBA 4RWSC 2EYOA 3I56A 1TU2B 2EYPA 2Z4IA 1B2TA 2TMPA 4K14A 1HR0Q 2NVQH 2SEBD 4A3BB 3HOUG 4PZ6A 5K5PA 4JI5L 2J0TD 4DV3L 4DAYB 4BBSB 2KENA 1ILQA 2N49A 2EJGC 1SJHD 2AWNA 4A3CG 4ME3A 3CCSA 1PH4A 2K33A 1B3AA 2RSNA 4GLXA 2PQAA 4C3HH 5GAEC 2F0PA 3U50C 1XNQQ 2EYJA 3K0XA 1PH5A 4JCVE 3LX0A 1U0LA 3ULPA 5FLXL 3AU7A 1CSQA 4BXXG 1BDOA 3ICEA 5JVG3 3ND8A 3S1NH 5IODA 1LTRD 1QZGA 5JAVA 4LUVA 3HZXA 3DEPA 1VDZA 1WTPA 1WCMG 1DOMA 4DV2Q 3UDGA 4MTKA 5IGEA 1JORA 3NXWA 2AQ1B 2ICIA 2J7ZA 1LO5D 1X54A 1TWCH 2B2YC 5LMNQ 2KHSA 4B9WA 3RLFA 2E8GA 4J8QA 4UAIA 1Q86C 1SJED 1U4PA 4A3KB 2FFKB 1GUSA 4GLAC 2WACA 3L3OC 5C5LA 5C44H 2MJ8A 4DR3Q 4LUOA 1TS3A 1PRTF 4X66L 2X6LA 1EWIA 3MXNB 2CH4A 2SOBA 1FGBD 4FXGC 2C9OA 1PLFA 3LWEA 4JI7L 4KY7A 2A73B 2UUAL 1Q1EA 4KN4C 2K7VA 3W5OA 3J7AV 1SNQA 2ASBA 4A3BH 5C4XB 2WINB 3L7ZC 3C2PA 1DONA 3HFZB 2B2VC 2H4OA 3M9BA 1UUPA 1A6XA 4BBSH 1PTOC 4QUCA 3U4VA 2R7DA 3U9OA 1TS4A 3BDLA 5HGQA 2KEEA 1QILA 1U5KA 3J7ZC 2XSCA 3H94A 4NP5A 3NTKA 2F0IA 1V1PB 5IGFA 2B8FA 3I55A 2UUCQ 3CCMA 2OTJA 1YIJA 3LNNA 2M9VA 3VR3A 3PIPA 2IX1A 2XVSA 4O42A 3HGBA 1SYFA 4EQ5A 4MHEA 3BG3A 3M7GA 3CCRA 5D3IB 3BVZA 1EIYB 3TP5A 1S4ZA 2LXJA 4RGOS 2CW0D 2PI2A 1TS2A 2BE5D 4JW0A 4ABNA 2JE6I 5IYBG 1WD0A 2PW7A 4A3KH 2N78A 2PYKA 3TN2A 4HN7A 1HQMC 1A2UA 3HRZC 4JYAL 4A3LG 4YIJA 2A19A 1BCPC 3MXGA 1GVPA 3NTIA 5LMUQ 4DR4Q 4JI4Q 3E3XA 2OT2A 2BCOA 4K8JA 1TS5A 1GO3E 4LF4L 5C4XH 2IT1A 4OWWB 2BH8A 4JI5Q 1GUNA 2GN5A 4DV3Q 1HFNA 2B63B 4A3DB 4JBKA 2HDLA 1AP0A 1A3UA 2VW9A 3FPPA 3F1ZA 4C2MB 1Q1BA 2Z6BA 1HCZA 4NXNL 4DN4M 1OXTA 2CWAA 3I4LA 3X3NA 1J9OA 1D1KA 3AEVA 2Z6KA 3HOZG 4UP8A 4B9XA 2SDFA 3VR2A 3T1YL 1WTXA 3NE5B 4BS9A 1EQTA 2DJFC 4HR7B 4RH6A 1C4QA 5IGBA 1QCBD 4OO1H 4DV1L 1I6HB 1SFOB 3K6OA 1Q12A 2FINB 1Q82C 2RF4A 3A56A 1ICFB 2UUBL 2HHHL 4ZLTF 1HNZL 3EA6A 4WFN3 2LY7A 4XQNA 2JA5B 1SYBA 4LJZC 2PMZE 1E24A 2F0UA 1WTOA 3J7YW 2VS1A 5FLXc 4OXPA 4MNOA 1M90C 2K6AA 4X3TA 1I5FA 4UHVA 2NVYB 1TWFB 3AQQA 4HIOA 1D7QA 2OXPA 4I7ZC 2B2TA 4RGTA 3HOYH 3A8IE 2NBFA 3I4MG 3JAMi 2K5HA 3H15A 2JEBI 4ID6A 4X6AH 4N8X1 1NAPA 4JI7Q 1EEFD 1S3OA 2UUAQ 4OGQC 4HJ9A 4BY7H 5GQOA 4B3SL 2K50A 5AFWA 3KK7A 2EXDA 1SMYC 4DR2L 2B63H 4KY6A 5DAUA 5FLXE 1CA5A 1UE7A 2LS01 4IN3A 3MC0B 1PZID 2ALYB 3KDFB 2F4IA 4C2MH 3C1EA 5JVH3 4O1NA 4S3SA 5LHY1 5M5YB 5LMNW 1XYIA 3QR8A 4HJ8A 4OWTB 2LKVA 1JQYD 1QUQA 1OTCA 2WKCA 1RHPA 3KUPA 3I3CA 4A93B 1JOOA 1YZ6A 1IYVA 2NN6I 4IOCA 3QB3A 1BOSA 4ALPA 1I6HH 3KLSX 1SFOH 3M4OB 5C6AA 1LT5D 4XTCS 2JSOA 1DJRD 3MHBA 4OELB 2QDLA 1ESRA 4HJ7A 2E2JB 4HMJA 2JA5H 4XIGS 2VNUD 1VF5C 1VQBA 4LWCA 1VQLA 4MIUA 3CP0A 5G3LD 1T5EA 2JQOA 4NDXA 5KYLA 1D6EC 3OMGA 2RKSA 2LMCB 1WTQA 4DFAA 5FO7B 2Q2IA 4J15A 4C3JB 5KGUA 2DY7A 2NVYH 1TWFH 4WJWA 1I4XA 3QOJA 4BA2I 1N32L 3OTOL 4A3FG 3IL8A 3PIOA 2EY5A 4JYAQ 3CC2A 1DOKA 2ZXOA 1L0WA 4DK6C 2A1AA 3CAMA 1Y69U 2OQ0A 2E5LL 5BN4A 4WJ3M 3QIAA 4AYBG 1RIPA 1A2TA 2VY3A 4LF4Q 1G91A 4L5SA 3OSOA 4MTNA 4BY1B 1SSOA 1B50A 3DM1A 4A3IG 1QUQB 2RSOA 3K59A 2ATWA 5EGTA 3FEWX 1GXDC 4NXNQ 3P20A 5L37A 5M5YH 1K8MA 1E0BA 3PCOB 2OWOA 3G7LA 3TSSA 1E7ZA 5CC4A 2Z8LA 3OYYA 4B3RL 4WJ4A 2K5QA 3D6CA 3Q8DA 3K5NA 3T1YQ 2XNAC 3I4NB 3TRZA 3KF8A 3F8TA 2RCNA 4A93H 2KHIA 1YNND 1EOVA 1MSGA 3M4OH 1J8IA 1X3PA 4RGNA 4DV1Q 1JE5A 1K28A 4QF4A 1EEID 4OIKA 2UUBQ 1EQVA 1O7LA 3RD4A 2E2JH 2EZVA 1HNWL 3FHWA 2HHHQ 1HNZQ 3DUZA 1B8AA 3J81i 5IYDG 1PRTB 2F3WA 1N36L 3TP7A 5FJ8H 1YHQA 1K9MC 4IPGA 4LUZA 2F0FA 4C3JH 4DNRB 1EY8A 4FF4A 1QNUA 4R4QA 1UE6A 1AW7A 1EFID 4J1MA 1IW7D 3X3MA 2MQHA 2WB1G 4JBWA 4XYQA 5LL6S 3S24A 2JA8B 1KNAA 3N6RA 3H09A 3C46A 1L1OA 2KQ3A 4B3SQ 1VQMA 4DK1A 3NP8A 3HOVB 4BY1H 3M3YB 4JI0L 2D9UA 1W6JA 3SK8A 3CMAA 4NW2A 2R61A 3GTGB 1TQOA 4KV6A 1STEA 2J4XA 2JA6G 1GOZA 3OMCA 3PUVA 1R4PB 2PI2E 2BOSA 1J6QA 1CHPD 2CKZB 2YTVA 1JR0D 3GTLB 3EROA 3I4NH 1KAWA 2ZM6L 5ELEA 2UXDL 4G7OC 4IPCA 4XQJA 3CXCA 4DK0A 2Y0SE 1S72A 4AYBE 2QW7A 4G57A 5KIXA 1JJ2A 3GD7A 5CV9A 3OHXC 2AHOB 1HNXL 2CCZA 3GTKB 1X9NA 1A62A 4N9TA 5IYCH 2VQEL 1M4VA 1GUOA 3CCVA 1K3RA 4X3UA 2OQKA 5FO8B 4R4CA 1H9KA 4P72A 1B4OA 5I6WA 3D4WA 4DUZL 1L1OB 3OTOQ 3I90A 2NTTA 3I4OA 1WTRA 2QCPX 1S5DD 1JOKA 2F1MA 3A7AB 5CGKA 1G291 3PQIA 2JA8H 1D8LA 1CM9A 3STBC 1UE5A 2E5LQ 1BR9A 3MEHA 4CGYB 3MAQA 1EY4A 5T1IA 1LTID 3HOVH 4V190 1W2BA 2DN8A 1VCIA 3ULJA 3PO2G 3QO2A 3M3YH 1KABA 1VQ9A 5I9OA 4N9PA 2MNAA 2R3ZA 1ILPA 3UDFA 4JVZA 1FVIA 3GTGH 4KD3A 2LFNA 5KYIA 4GOPC 1JC7A 3FMCA 1F9RA 2NN6H 3HOXG 3E5SA 4P2CB 1F2LA 1MSHA 3GP7A 1LTAD 3CCQA 1SMXA 5FK9C 4A3EG 2JA9A 1D5ZC 4CKEA 4KY5A 3GTLH 2WB1E 4RCOA 1XMOL 1QJOA 1YVCA 3A54A 3D0FA 2CH4W 4FF2A 4CKCA 2PZTA 4F87A 1YBYA 1HZ9A 1WTVA 3Q6SA 3FKIB 4IFDI 4KHPL 4GNXC 3Q22A 3GTKH 1HNWQ 2XIWA 1GUTA 4RFBA 5CV7A 1LTTD 5KNBA 4ZK9B 4FDBA 4A3JG 3EJIA 5IGGA 1N36Q 4LF9L 1SEBD 2V4DA 4CBVA 3PF5A 1NJIC 5C0XI 3NQTA 3S1RB 3NQIA 3M4QA 5IP9G 4V0BA 2PZWA 3J81L 1G51A 2PZUA 4EX5A 3ER0A 3PO3B 1D1IA 1KQSA 4Y52H 4BBRG 1L2FA 4L5RC 1XTCD 1Y8NB 2B29A 2Q2TA 2X69A 3LGJA 1K8AC 2HT1A 4LF7L 2V1CC 3BJUA 4UP9A 3W1BA 4ULLA 1JWUD 2E74C 1PH1A 1VQIA 3HKSA 4X64L 4HAEA 5C3EG 1KDBA 5JJKA 2KECA 1CFMA 2MFIA 4JI0Q 4OO1I 2I46A 1WI5A 2MGSA 1Z9FA 1I50B 1PVOA 1I3QB 2PMZB 4A3CH 4K5WA 5I6YA 1VQ7A 3P7JA 3CF5A 1LT4D 4OIJA 5JPMC 3RLNA 3ZJYC 1YJ9A 2C35B 1KLUD 1N34L 1LM0A 1RKNA 2R93B 2ZM6Q 3S9WA 2UXDQ 4HMIA 1UEBA 2R92B 1FL0A 1TT2A 1V43A 3QOLA 1F2YA 3FKIH 1VQ8A 1G8ZD 2KHJA 1IHZA 3G6EA 2OEOA 1HNXQ 1Z47A 2VQEQ 1B9MA 4DAPA 4CKBA 1IZ6A 1I4HA 1N8RC 4DR7Q 3S1RH 5IY0A 2MO1A 3JAME 3PUXA 1OXXK 3IAYA 1ENAA 4DUZQ 4JI1L 1NMFA 1NR2A 3KJOA 1HTPA 1EIGA 4HIKA 3T16A 1NUCA 3UE0A 3PO3H 2K4KA 1EIFA 2F3VA 1M8AA 1CUKA 1NR4A 4H44C 3K80C 4K0KL 1I6VC 2FHTA 3A74A 5ELOA 3VA5A 1TIID 1YNJC 1IBKL 3CHBD 3BZDB 1PXUA 3STBD 1X56A 2F0QA 2KEDA 4QMGA 5IIFA 1SYEA 3EBEA 3PF4A 4B3ML 1I50H 4RKLA 3KF6A 3F2BA 2L15A 2VUMB 1I3QH 4IJLA 1BXTA 4JBMA 1FJGL 2VZAA 1SR3A 2KCMA 1SYCA 2Z0SA 4RA8A 3A8JE 5DNFA 3W3AA 4KHVA 1VQCA 3RLOA 3E9HA 1FD7D 1IYJB 2EY1A 1XMOQ 3HOZB 1AFPA 4GN5A 4DR5L 2R92H 3DWPA 2ZJQA 1WFQA 5E3FA 1VQ4A 2EXZA 2PQAB 1E3PA 3NBIA 5FOBB 1L0YB 3MXPA 4KHPQ 1PTOF 1B44D 4IO9A 3NENA 3T56B 4LFAL 5M5WB 1CT1D 1T9HA 2RVLA 1G2SA 4L63B 4A3MB 4L8JA 5EKKA 2HIVA 1EU3A 5JJIA 1H9SA 2PNRC 3J80i 3K0YA 3HEJA 2YU9B 1CTMA 1Q3LA 4LF9Q 4BWGB 1BUVT 2E76C 3EFXD 2A6EC 3EVQA 3H3VI 5ISRA 4NXML 5C44G 1I94L 3GTJB 1LT3D 4DK3C 2VL6A 3HKZG 4GN4B 5EAYA 4A3LH 3I4MB 3PUZA 2IW3A 4C1NK 1MHWC 4FYDA 4ZUJA 5G3LF 1LLRD 2WAQG 1STBA 3BYYB 3TEHB 4LF7Q 2F3IA 1QWYA 1HTLD 4K5VA 4CJ0B 4IPDA 2Q8IB 3TBIB 4IOAA 1WYDA 2PCFB 4X64Q 3AYHB 3V05A 3L2PA 1HUNA 3J81c 4A3GB 2QKIC 4RGMA 4BBSG 2L9HA 2VUMH 1X3EA 3A55A 2K04A 3TDQA 2EE1A 2EY6A 3I8ZA 3HOYB 4OONA 4GOPA 4R8IA 4QGUA 3IRBA 3ONAB 3W2DA 3SEBA 1KC8C 1IBML 4H7BA 5EPJA 3K57A 1BCPF 3VA7A 4IFDH 1E22A 1KXLA 1EWCA 4UY8C 1N34Q 3HOZH 1PFNA 2L55A 3SDZA 3RUZA 3ERQA 1X55A 2PNHA 4BY7B 2HIXA 3TZUA 3K5MA 3MZ5A 4KJOA 1X32A 3RZOB 4E6IA 5C0XH 2HDMA 4HJAA 2RQXA 2YTXA 1BVSA 1G6PA 3J81E 2DUDA 1F9PA 5M5WH 1E1TA 4Y7NB 3I91A 1KDCA 1LTLA 4A3MH 1LUZA 4GNXA 3GTPB 1KNEA 2RDHA 1EIHA 1V1OA 2MUYA 5IGDA 1BO0A 2YU9H 2G9DA 1VQGA 2A6HC 1IL2A 2XWBB 1LV9A 2VQFL 1ML0D 4JI1Q 3F2DA 2QGQA 2UXBL 2RBMA 3GTJH 1TVXA 3I4MH 2NZHA 3Q23A 2BA0A 3RR5A 2PQEA 4K0KQ 3NUCA 1UEAB 1MBYA 5EPLA 2Y0SB 4AYBB 1HR0W 1IBKQ 4JI2L 2N55A 2JYOA 5C4XG 3HOWB 4A3GH 4OX9L 3MFYA 3R93A 3VYTA 4B3MQ 2IJ0A 4DAVA 4K6LA 3UDIA 1O7ZA 1FJGQ 4X66Q 4FXKC 1YHAA 2L0CA 1WTHA 5H1SE 3MVVA 3HKZE 3D6WA 3V96A 4TVAB 1GJXA 4DR5Q 1CQVA 3CCUA 3R2IA 4JI3L 4G4KA 3RZOH 1JOQA 3MTSA 3S2DB 5A2QL 1FNUA 3OIQA 1STHA 1UNSA 4KN7C 3GO5A 4LFAQ 4Y7NH 2K28A 2L5TA 1Z6HA 3EN2A 3NWTA 3SK4A 1EYAA 3GTPH 1PTOD 1WTWA 5C3XA 2R6GA 1PMRA 4FP5D 5EKIA 1BBXC 1XJVA 4HCSA 4GKJL 1FNWA 2EVBA 4XXEA 4YCVA 4APVA 5DLQE 3J80L 4MN3A 4NXMQ 4DV5L 1ENCA 2XTIA 1I94Q 2R7ZB 2D62A 2CWPA 1HJPA 1RODA 2A6ED 5HY6A 2BA1A 4KKTA 1FNVA 2WB1B 1EY6A 4ZCKA 5M3FG 5C5MA 1AZPA 1E2VA 5I4DA 3PSIA 1DYQA 1HA6A 1K8GA 1HUMA 4K5XA 2EQSA 2SNSA 4DU9A 4EGVA 4DR1L 3C3LA 3HOWH 2NYZD 1QVCA 2AUJD 1A8VA 3QG1A 3KLWA 1EFWA 2B2YA 1E2ZA 3KOJA 4DV6L 3D4DA 1EY9A 2B63G 4X62L 4A3DG 1B70B 5IGCA 3M4YA 1AN8A 2JA7B 3EIVA 4EQNA 2RA4A 4FF1A 5TSSA 3KLRA 4AIMA 1HZCA 1IBMQ 3SVMA 5M5XB 1PH8A 5JEAJ 3WOEA 3K8AA 3CKIB 1BCPD 4RMFA 2N88A 1KTKA 1EY0A 4DR6L 3S2DH 1BBUA 2YV5A 1RJTA 1YHBA 4K8IA 2B2VA 3H3VH 1BBWA 3NELA 5J39A 4HSPA 4DF7A 5FLMH 4JK1C 2KBNA 4HJ5A 1EY7A 4PMCA 3MEFA 5IYDH 1YEZA 2VB3X 2IY5B 4QQBX 2WIIB 3NTHA 4JBJA 3TP8A 2IX0A 5DM73 2F0HA 2QF7A 2VQFQ 4I7AA 1B7YB 5M3MB 3TZDA 4I65A 2UXBQ 2R7ZH 3Q24A 2K5DA 3CU7A 5EBDA 5IP7G 3B6YA 1TY2A 4UPAA 1V9PA 1Q90A 2RDGA 4XQQA 3PGZA 1TY0A 2A74C 4R4OA 4C3IB 3PIP3 1MKHA 4JI2Q 5EJWA 3RN5A 3BZCA 3UDXA 1NNXA 4X3SA 4OX9Q 4RKBA 2JN4A 2A68C 2KUMA 3G6JB 2FMMA 4IUPA 2JA7H 1E1OA 3SE0A 3D31A 2O5JC 3E0EA 2ZTDA 5M5XH 3HOXB 2AQ3B 2IPKD 5KRUA 1C7YA 2L1BA 4NB3A 1IXRA 1SNPA 2LSSA 3BYTB 1PTOB 3T13A 4A93G 4JI3Q 1SNOA 3TS0A 3M7NA 4NPSA 4DR2Q 4LW1A 5K36H 1PH7A 3SHLA 3G4SA 1GKHA 3KF8B 1SMYD 3I70A 4POFA 1JMCA 5CR3A 3BVMA 3CPWA 3NHHA 2F0NA 4GKJQ 2M00A 2DY8A 3PV0A 2N3SA 4XT3B 4QIWE 4C3JG 1EU4A 2DJGC 5EQ0A 5M3MH 1ZKOA 4DV5Q 1R9TB 3NEMA 2BDNA 4L5TA 2JXMB 2YTYA 3CQZB 4FVMA 1A3TA 1S5CD 5IT9L 4C1NI 4BBRB 1T5XD 5D14A 2DNEA 1WJJA 4KLKA 3VYRA 4R4TA 4C3IH 4ZQ3A 4DV0L 1KRSA 2HD3A 1CZWA 4R8NA 3NBHA 1B3QA 5JEAG 2I07B 4DR1Q 1PV4A 3PO2H 1OXUA 3J80c 5C3EB 4X3KA 2IX3A 4KHZA 4DV6Q 5C4JB 1PYWD 2PW5A 1BCPB 1ONLA 4PMWA 4X62Q 1XTDA 2ZJPA 1N32Q 1STGA 5E7NA 1XMQL 2H5XA 5A2QE 1Y1VG 3E0JA 3HOXH 2MP1A 1NY4A 1SNCA 3H0GB 2BDOA 1O7YA 2QILA 4LF6L 1CKMA 3S15B 1VQNA 5GAHC 2EOTA 1PTOH 1QG7A 3AMUA 2HQLA 1CSPA 1EYCA 1I4PA 2EYMA 4DR6Q 2LXKA 4IALA 3HOUB 4TRDA 4F8MA 4IPHA 3K7AB 3BS1A 1RDPD 3J80E 3R8BA 2Q2HA 1D2BA 2K03A 3A5UA 3CPFA 2O5IC 2DGYA 3TREA 2XGTA 5IYCG 3ULLA 3IKJA 4YWKA 3DXJC 2ZTCA 1CKNA 4B3RQ 1A63A 3CCEA 4P74A 2KCTA 5J22A 1R9TH 4HIMA 5JPNC 3CQZH 4BBRH 1LTGD 1VS0A 3RN2A 2I5LX 1X65A 1I4GA 1GUWA 1PZJD 4AH6A 2JA8G 2NVXB 3R2TA 3O13A 4Z9CB 4JOIC 3I73A 1O80A 1WCMB 3S17B 3OPOA 2VXWA 3NSWA 2QEXA 5C3EH 3CC4A 5C4JH 2EY2A 1KRTA 1TXYA 3JC66 3M4PA 2F03A 1X6OA 4P73A 2A68D 1TWHB 2QDBA 4LMQD 4IUTA 3H0GH 3DWQA 3C1FA 1PYSB 3J81j 3S15H 3VR5A 5GADC 4L6TB 3S1QB 1YJWA 5E4WC 2UUCL 3PIO3 4LF8L 2EYFA 3HOUH 5IOCA 3CW2C 3K7AH 1SYGA 1U9RA 2WFWA 2CW0C 4NKLA 2BE5C 2ZJRA 5BR8L 2ICEC 5DM63 1IYUA 3E6ZX 1X3FA 1KHIA 3A0JA 1RD9D 1ICWA 1MJCA 1EZ6A 3KFUA 1X3GA 1UAPA 5KEEA 1J5EL 1Y1WG 1YI2A 1VMPA 4POGA 2Q8TA 1D5XC 4BXXH 4KD4A 4QY7A 3VR4A 4B3TL 3HKZB 2D0PA 3ERSX 4IUNA 2IL8A 2NVXH 4ZKCB 1FR3A 3SK5A 4DV0Q 1VQ6A 1WCMH 4OWXB 3N52A 3S17H 4IQZA 3F2UA 5J1ZA 2ES2A 2E2DC 2UU9L 4LFCL 2F0VA 3MXNA 3BDCA 1VQJA 2WP8J 2K01A 5IT9c 2A5HA 2F0WA 1TWHH 1XMQQ 2NB0A 1SLJA 4GS3A 4DAMA 1SE3A 1QZHA 4DNIA 3RZDB 1HZAA 4LF6Q 1VQEA 3NWSA 3VYSA 4NMZA 3S1QH 1HZBA 4GKKL 3D8GA 1VMCA 4QL5A 2C5CA 1B53A 5IE8A 1M1KC 4R9WA 3PMFA 2CQOA 1PFBA 2FMCA 3FKIG 4KJNA 1L0XB 1PZKD 2F0OA 3G71A 5ELBA 1I4RA 1V1PA 4DV7L 1ENFA 3U9SA 1MIUA 1HQRD 4IFDJ 5IT9E 4FXDA 2AMCB 2XRQD 1MJEA 1PH3A 4EQPA 3T51B 4ZKBB 1TKWB 2EJMA 4C3HG 2XRSD 2Z1CA 1JE4A 5C3WA 5C0XJ 4DUYL 2KCCA 1JT8A 2F0KA 1PRTC 3PO3G 2IHEA 3OWEB 4ZAIA 2GVBA 2X6GA 4QJFA 4FF3A 1U4RA 4HEDA 4JG2A 1P8LA 5EPKA 4M1UB 5D65A 5M9OA 2I5MX 1V1QA 1JB7A 2F4VL 5JJLA 3AFPA 5ELFA 2KA7A 5IYBH 5NUCA 3DLLA 3CC7A 1PHJA 2EIFA 2A8VA 1K8OA 1VQAA 1K0SA 1F2ZA 3DHQA 1QE6A 1BNZA 1F9QA 2FXQA 3RZDH 1O78A 5T1GA 1IBLL 5ELDA 3BVGA 3KF6B 3DM3A 3HP3A 1DCZA 4K6DA 3OOCA 4KI0A 1BQQT 3W1GA 2R93G 4YCUA 2ZT9C 4LF8Q 2XN9C 4UP7A 2R92G 4A3BG 5ELNA 5A35A 1SE8A 4IUVA 3FP9A 4OEMB 3HS0C 5BR8Q 1XPRA 4KMUC 2G5DA 2R7FA 5E4XA 1ZYRC 1JICA 1VF7A 4LFBL 2ZXPA 2DNCA 5CBEE 1AEXA 1SNDA 5C4HA 3T4AC 2K1BA 4B08A 1J5EQ 2B39A 1SDFA 1EQQA 1Z7TA 2E2HB 4HTHA 2XWJB 2A69C 1H9RA 1XX8A 1LABA 1H9SB 1ZEQX 1I4QA 3FPUB 2F0SA 4B3TQ 1NCVA 5F2DA 4P75A 2O2LD 2WV6D 2O4XA 4PNYA 3L9AX 1DOLA 2K52A 1ASZA 4GZYC 5M3FB 1L1OC 4DV4L 3URYA 4CDEC 4ODGA 2OCEA 3NPPA 4JOIA 3KLSA 3K5LA 4HCEA 2L12A 2UU9Q 5E1FA 4LFCQ 2GA4B 1SRUA 4A3KG 1PFMA 1F77A 1PYBA 1WOCA 2IHFA 4LAAA 2VUMG 2QEJC 4RG1A 2MPMA 4TKOB 5HURA 4JI6L 3CCJA 4A3FB 2ID0A 4O0AA 2QA4A 1HH2P 2HCIA 4QIWB 4H13C 1KL9A 1CK1A 3QJYA 2B2WC 4IFDG 2D2CC 4IZ8A 4GKKQ 1YNNC 3M85A 1PH2A 1UE1A 3MWYW 1SYDA 2D5DA 4GOPB 1XWEA 4XDXA 1K83B 4ZUIA 3KDFA 1JWSD 3EQLC 1VQHA 4UDUC 4FNFA 1YNJD 3MXUA 5C0XG 2MHVA 3IFTA 3S14B 2RDFA 3RMHA 4A3IB 3A7LA 3IFDA 4DV7Q 1PDQA 3CRKC 4A3MG 3MFGA 3NK9A 1H95A 1C9OA 4CDDC 1DD2A 2NTSA 1N9WA 4U673 1A3VA 4QB4A 1SBBB 1GHKA 2E2HH 4GNXB 1IW7C 3OIPA 4DUYQ 1E2WA 2WAQE 1CKOA 3OW7A 4K2LA 3VR6A 1JJCB 4DXGA 4LF5L 4OO1G 4YCWA 1EQRA 1F2MA 1NTGA 4HSVA 1U4LA 5M3FH 1PRTD 1DGSA 2CVRA 4Q0FA 5CV6A 2F4VQ 3K7UC 4IJHA 4HIDA 1Q81C 1TWAB 3GTQB 4IUQA 4MZ9A 1VQ5A 4GN3B 4A3GG 1B9NA 2AUKA 2GVAA 4KK7A 4A3DH 2F0GA 3J7A5 5KNCA 1O7IA 4IURA 4A3FH 3CD6A 3HOYG 3T1HL 2N8NA 2CHBD 1VQKA 3TS2A 2RCFA 1IBLQ 1Q46A 2NZ1D 3SGIA 3KYHC 3HG9A 2L11A 2NZOA 2F52A 3GV6A 2E2IB 2BH2A 2I5HA 4BY7G 1B1ZA 1W3SA 2K14A 1K83H 1Y8OB 4F7XA 2PPBC 1EL0A 4YHHL 3WWVA 2NUCA 1FGUA 1RF2D 3MA2B 1P16A 1FYCA 3S14H 4JPBW 3RNUA 4A3IH 1VQDA 2UXCL 1II3A 1GHJA 2K05A 5FO9B 4PQXA 1V8QA 3I2ZA 1HHVA 1G6ZA 1U4MA 5CV4A 2JA6B 1LTBD 1SAPA 4C56C 4G7ZC 2OTLA 2HQEA 5CYUA 1JB3A 4LFBQ 1HXYD 2B2UC 1JCKB 4QUFA 4FO2A 5CV8A 5LL6X 1N33L 2L4NA 2KVMA 2YYZA 1ZYRD 3K81C 1C0AA 2P5ZX 3FRPB 3LWUA 1STAA 3P1HA 2TSSA 4J6HA 2A69D 1STYA 5IP7H 5ELCA 3TP6A 1DM0B 4OHJA 4R4IA 3OW2A 1BF4A 4JI8L 2M2LA 1KIXA 1C48A 4DV4Q 2Y0SG 2JA5G 1MD2D 2EYLA 1TWAH 3GTQH 3HOWG 2ZXRA 5CV5A 3ZYYX 3Q0AA 1XPOA 1LYLA 1EOTA 1GM5A 4RHSA 4CDCC 1S5BD 1PFSA 5EBCA 1XXGA 2A6HD 4G7HC 1AE3A 3GTMB 1X3QA 1QNKA 1VQOA 4JI6Q 2RHQB 1Y1VB 4KTAA 2R93H 1ESFA 2F0MA 3G48A 4ME5A 1IKMA 1QOHA 2B8GA 2WKDA 2E2IH 2F0DA 5CMDA 1IL8A 3PUYA 2ZTEA 4TSSA 3CMEA 3S2HB 1CHQD 1MGSA 3D4RA 2JK8A 5CBAE 3PO2B 4YY3L 1XNRL 3CRLC 1CA6A 3PUWA 1H9MA 3FDTA 3UI2A
chains in the Genus database with same CATH topology
1SNMA 4U68A 1KAAA 4KKUA 4WRDA 1CI3M 4RCNA 3V2TA 4A3EB 3DEOA 2K5WA 5I9PA 4RHRA 2H1EA 3GTOB 1LT6D 4QCLA 3WOFA 2F0JA 3ND9A 1SE2A 3SXHA 1KLGD 1G2TA 3D3RA 1EY5A 3J7AF 2EDGA 3JAML 5JEAH 1ZXTA 3GQBA 3DMUA 4A3JB 1GUGA 2FJ2A 1C8CA 4ZYSA 5I2XA 2NWGA 4DA2A 2Q8RE 1CQFA 5BN5A 5I2YA 4CJ2C 4KKSA 1EWHA 5HGTA 2ENBA 1ET9A 1SE4A 2HUGA 1S5FD 2B2WA 4DNTB 4CHTB 3K58A 3GV3A 2OF1A 2EYHA 1HRJA 2AWOA 4CJ1B 5K36G 5JJZA 1RCVD 1RTOA 1SXTA 3S1MB 1TWGB 3KBXA 2K32A 5COYA 1DXMA 3ITPA 2SNMA 1S5ED 2KOLA 2PO4A 4EVOA 1HA5A 2CQAA 1WVLA 1Y1WB 1W6KA 4PV1C 1LACA 4BA1I 2EJFC 3SK6A 2NVTB 4ILWA 3H91A 3T53B 4C3IG 3H6MA 1MI2A 4LK1C 3P75A 2AQ2B 3R3OA 5FKAC 1NSNS 3TMEA 2JEAI 1CZGA 1AZQA 4M8AA 2F0LA 2G9HD 1ET6A 3FVQA 2IWHA 2KCNA 3S16B 1JWMD 5D3DA 4WORA 1Q8IA 2HCCA 1HPCA 5BN3A 2F0TA 4Q5VA 3I72A 1WD1A 4IUUA 3SR1A 4TQUS 4K2KA 2NVQB 2KJXA 4RAUC 1QB5D 1RTNA 3DWAA 1EYDA 2NN6G 1EZ8A 4DGZA 3WDNA 4XT1B 4DXFA 1DZ1A 5CORA 4DAYA 4C3HB 3H3VC 2B2UA 1Y8PB 3KBGA 4F88A 1KDAA 1STNA 2VB2X 1TR5A 1F9SA 3OWFA 4PMBA 5JOBA 5DEHA 3S1NB 1LTSD 4XYOA 3A8KE 3BDOA 5KNDA 1A15A 1OO9B 1HFGA 2Z4HA 1OXVA 1IKLA 2JP1A 3AB9A 4OL7A 1TWCB 4ZRZA 1H9JA 2E75C 2B2TC 1R4QB 5C44B 3K5OA 3VYUA 4H0LC 2F0EA 4EQOA 3QWNA 1D5MC 5EKLA 5C4ZA 2WAQB 1OXSC 2EPBA 4RWSC 2EYOA 1TU2B 2EYPA 2Z4IA 1B2TA 2TMPA 4K14A 2SEBD 4A3BB 5K5PA 2J0TD 4BBSB 1ILQA 2EJGC 1SJHD 2AWNA 2K33A 1B3AA 2RSNA 2F0PA 2EYJA 3LX0A 5FLXL 3AU7A 1BDOA 5JVG3 3ND8A 5IODA 1LTRD 5JAVA 3HZXA 3DEPA 1VDZA 1WTPA 1DOMA 5IGEA 1JORA 2AQ1B 3NXWA 2ICIA 2J7ZA 1LO5D 2B2YC 2KHSA 4B9WA 3RLFA 4J8QA 4UAIA 1SJED 1U4PA 4A3KB 2FFKB 1GUSA 5C5LA 2WACA 3L3OC 2MJ8A 1TS3A 1PRTF 2X6LA 2SOBA 1FGBD 4FXGC 2C9OA 1PLFA 3LWEA 4KY7A 2A73B 1Q1EA 4KN4C 2K7VA 3J7AV 1SNQA 5C4XB 2WINB 3L7ZC 3C2PA 1DONA 2B2VC 2H4OA 1UUPA 1A6XA 1PTOC 4QUCA 3U9OA 1TS4A 3BDLA 2KEEA 1QILA 2XSCA 3H94A 4NP5A 3NTKA 2F0IA 1V1PB 5IGFA 2B8FA 3LNNA 2M9VA 3VR3A 2IX1A 2XVSA 4O42A 3HGBA 1SYFA 4MHEA 3BG3A 3M7GA 5D3IB 3BVZA 3TP5A 1S4ZA 4RGOS 2CW0D 4ABNA 1TS2A 2BE5D 2JE6I 1WD0A 2PW7A 2PYKA 3TN2A 4HN7A 1HQMC 1A2UA 3HRZC 4YIJA 1BCPC 3MXGA 3NTIA 2OT2A 2BCOA 4K8JA 1TS5A 2IT1A 1GUNA 1HFNA 2B63B 4A3DB 2HDLA 1AP0A 1A3UA 3FPPA 4C2MB 1Q1BA 1HCZA 4DN4M 1OXTA 3I4LA 3X3NA 1J9OA 1D1KA 4B9XA 2SDFA 3VR2A 1WTXA 3NE5B 4BS9A 1EQTA 4HR7B 4RH6A 1C4QA 5IGBA 1QCBD 4OO1H 1I6HB 1SFOB 3K6OA 1Q12A 2FINB 3A56A 4ZLTF 3EA6A 4WFN3 2LY7A 4XQNA 2JA5B 1SYBA 4LJZC 2F0UA 1WTOA 3J7YW 2K6AA 4X3TA 2NVYB 1TWFB 2OXPA 4I7ZC 2B2TA 4RGTA 3A8IE 2NBFA 2JEBI 4ID6A 1NAPA 1EEFD 4OGQC 5AFWA 3KK7A 1SMYC 4KY6A 5DAUA 5FLXE 1CA5A 2LS01 4IN3A 3MC0B 1PZID 2F4IA 3C1EA 5JVH3 4O1NA 4S3SA 5LHY1 5M5YB 1XYIA 2LKVA 1JQYD 2WKCA 1RHPA 3KUPA 3I3CA 4A93B 1JOOA 1IYVA 2NN6I 3QB3A 1BOSA 3KLSX 3M4OB 5C6AA 1LT5D 4XTCS 2JSOA 1DJRD 3MHBA 1ESRA 2E2JB 4HMJA 4XIGS 2VNUD 1VF5C 4MIUA 5G3LD 1T5EA 4NDXA 5KYLA 1D6EC 3OMGA 2RKSA 2LMCB 1WTQA 4DFAA 5FO7B 4C3JB 5KGUA 2DY7A 4WJWA 1I4XA 3QOJA 4BA2I 3IL8A 2EY5A 1DOKA 2ZXOA 1Y69U 5BN4A 3QIAA 1A2TA 1G91A 3OSOA 4BY1B 1SSOA 1B50A 3DM1A 2RSOA 3K59A 5EGTA 3FEWX 1GXDC 3P20A 1K8MA 1E0BA 3G7LA 3TSSA 5CC4A 2Z8LA 2K5QA 3D6CA 3K5NA 2XNAC 3I4NB 3KF8A 1YNND 1MSGA 1J8IA 1X3PA 4RGNA 4QF4A 1EEID 4OIKA 1EQVA 1O7LA 3RD4A 2EZVA 3DUZA 1PRTB 2F3WA 3TP7A 4DNRB 2F0FA 1EY8A 4FF4A 1QNUA 1AW7A 1EFID 4J1MA 1IW7D 3X3MA 4JBWA 4XYQA 5LL6S 2JA8B 1KNAA 3N6RA 3H09A 3C46A 2KQ3A 4DK1A 3NP8A 3HOVB 3M3YB 2D9UA 1W6JA 3SK8A 4NW2A 2R61A 3GTGB 1TQOA 4KV6A 1STEA 2J4XA 1GOZA 3OMCA 3PUVA 1R4PB 2BOSA 1CHPD 1JR0D 3GTLB 3EROA 5ELEA 4G7OC 4XQJA 4DK0A 4G57A 5KIXA 3GD7A 5CV9A 3OHXC 3GTKB 4N9TA 1M4VA 1GUOA 4X3UA 5FO8B 1H9KA 1B4OA 5I6WA 3D4WA 3I90A 2NTTA 1WTRA 2QCPX 1S5DD 1JOKA 2F1MA 3A7AB 5CGKA 1G291 1CM9A 1BR9A 3MEHA 4CGYB 3MAQA 1EY4A 5T1IA 1LTID 4V190 2DN8A 1VCIA 3QO2A 1KABA 5I9OA 4N9PA 1ILPA 2R3ZA 4KD3A 2LFNA 5KYIA 1JC7A 3FMCA 1F9RA 2NN6H 3E5SA 4P2CB 1F2LA 1MSHA 3GP7A 1LTAD 5FK9C 1D5ZC 4CKEA 4KY5A 4RCOA 1QJOA 3A54A 4FF2A 4CKCA 2PZTA 4F87A 1WTVA 3Q6SA 3FKIB 4IFDI 3Q22A 2XIWA 1GUTA 4RFBA 5CV7A 1LTTD 5KNBA 4ZK9B 3EJIA 5IGGA 1SEBD 2V4DA 4CBVA 5C0XI 3NQTA 3S1RB 3NQIA 4V0BA 2PZWA 3J81L 2PZUA 3PO3B 1D1IA 1XTCD 1Y8NB 2X69A 4ULLA 1JWUD 2E74C 4HAEA 1KDBA 2KECA 1CFMA 4OO1I 2I46A 2MGSA 1I50B 1I3QB 2PMZB 4K5WA 5I6YA 3P7JA 1LT4D 4OIJA 5JPMC 1KLUD 1RKNA 2R93B 3S9WA 4HMIA 2R92B 1TT2A 1V43A 3QOLA 1F2YA 1G8ZD 1IHZA 2OEOA 1Z47A 1B9MA 4DAPA 4CKBA 1I4HA 3JAME 3PUXA 1OXXK 3IAYA 1ENAA 1NR2A 1HTPA 1EIGA 3T16A 1NUCA 2F3VA 1M8AA 1NR4A 4H44C 1I6VC 2FHTA 3VA5A 1TIID 1YNJC 3CHBD 3BZDB 1PXUA 2F0QA 2KEDA 4QMGA 5IIFA 1SYEA 4RKLA 2VUMB 1BXTA 1SYCA 4RA8A 3A8JE 5DNFA 3W3AA 4KHVA 1AFPA 3HOZB 1FD7D 2EY1A 3DWPA 5E3FA 2EXZA 3NBIA 5FOBB 1L0YB 3MXPA 1PTOF 1B44D 3T56B 5M5WB 1CT1D 4L63B 2RVLA 1G2SA 4A3MB 4L8JA 5EKKA 1EU3A 1H9SA 2PNRC 3K0YA 3HEJA 2YU9B 1CTMA 1Q3LA 4BWGB 1BUVT 2E76C 3EFXD 2A6EC 3EVQA 5ISRA 3GTJB 1LT3D 3I4MB 3PUZA 2IW3A 4C1NK 4FYDA 4ZUJA 5G3LF 1LLRD 1STBA 3BYYB 1QWYA 1HTLD 4K5VA 4CJ0B 2Q8IB 3TBIB 2PCFB 3V05A 1HUNA 4A3GB 2QKIC 4RGMA 2L9HA 3A55A 2K04A 3TDQA 2EE1A 2EY6A 3I8ZA 3HOYB 4R8IA 3ONAB 3W2DA 3SEBA 4H7BA 5EPJA 3K57A 1BCPF 3VA7A 4IFDH 1EWCA 1PFNA 2L55A 3SDZA 3RUZA 3ERQA 4BY7B 3TZUA 3K5MA 3MZ5A 4KJOA 1X32A 3RZOB 4E6IA 5C0XH 2HDMA 2RQXA 3J81E 1F9PA 4Y7NB 3I91A 1KDCA 3GTPB 1KNEA 2RDHA 1EIHA 1V1OA 2MUYA 5IGDA 1BO0A 2G9DA 2A6HC 2XWBB 1LV9A 1ML0D 2RBMA 1TVXA 3Q23A 2BA0A 2PQEA 3NUCA 1UEAB 1MBYA 5EPLA 2Y0SB 4AYBB 2N55A 2JYOA 3HOWB 3MFYA 3R93A 3VYTA 2IJ0A 4DAVA 4K6LA 1O7ZA 4FXKC 2L0CA 3MVVA 3D6WA 3V96A 1GJXA 1CQVA 3R2IA 4G4KA 1JOQA 3MTSA 3S2DB 5A2QL 1FNUA 3OIQA 1STHA 1UNSA 4KN7C 3GO5A 2K28A 2L5TA 1Z6HA 3NWTA 3SK4A 1EYAA 1PTOD 1WTWA 5C3XA 2R6GA 1PMRA 4FP5D 5EKIA 1BBXC 4HCSA 1FNWA 2EVBA 4XXEA 3J80L 4MN3A 1ENCA 2R7ZB 2D62A 1RODA 2A6ED 2BA1A 4KKTA 1FNVA 2WB1B 1EY6A 5C5MA 1AZPA 1E2VA 5I4DA 1DYQA 1HA6A 1HUMA 4K5XA 2SNSA 4DU9A 4EGVA 3C3LA 2NYZD 3QG1A 2AUJD 2B2YA 1E2ZA 3D4DA 1EY9A 5IGCA 3M4YA 1AN8A 2JA7B 4EQNA 2RA4A 4FF1A 5TSSA 3KLRA 3SVMA 5M5XB 5JEAJ 3WOEA 3CKIB 1BCPD 2N88A 1KTKA 1EY0A 1RJTA 4K8IA 2B2VA 5J39A 4HSPA 4DF7A 4JK1C 1EY7A 4PMCA 2VB3X 2WIIB 3NTHA 3TP8A 2IX0A 5DM73 2F0HA 2QF7A 5M3MB 3TZDA 4I65A 3Q24A 2K5DA 3CU7A 5EBDA 1TY2A 1Q90A 2RDGA 4XQQA 1TY0A 2A74C 4C3IB 3PIP3 5EJWA 4X3SA 4RKBA 2A68C 2KUMA 3G6JB 2FMMA 4IUPA 3SE0A 3D31A 2O5JC 3HOXB 2AQ3B 2IPKD 5KRUA 2L1BA 1SNPA 3BYTB 1PTOB 3T13A 1SNOA 3M7NA 5K36H 3SHLA 1SMYD 3I70A 5CR3A 3BVMA 3NHHA 2F0NA 2M00A 2DY8A 3PV0A 4XT3B 4C3JG 1EU4A 5EQ0A 1ZKOA 1R9TB 2BDNA 2JXMB 3CQZB 4FVMA 1A3TA 1S5CD 5IT9L 4C1NI 4BBRB 1T5XD 5D14A 2DNEA 3VYRA 4ZQ3A 1CZWA 4R8NA 3NBHA 5JEAG 2I07B 1OXUA 5C3EB 4X3KA 2IX3A 4KHZA 5C4JB 1PYWD 2PW5A 1BCPB 1ONLA 4PMWA 1STGA 5A2QE 3E0JA 2MP1A 1SNCA 3H0GB 2BDOA 1O7YA 2QILA 3S15B 2EOTA 1PTOH 1QG7A 3AMUA 1EYCA 1I4PA 2EYMA 4IALA 3HOUB 4TRDA 4F8MA 3K7AB 3BS1A 1RDPD 3J80E 3R8BA 1D2BA 2K03A 2O5IC 3IKJA 3DXJC 5J22A 5JPNC 1LTGD 1GUWA 1I4GA 1PZJD 2NVXB 3R2TA 3O13A 4Z9CB 3I73A 1O80A 1WCMB 3S17B 3OPOA 2VXWA 3NSWA 2EY2A 2F03A 2A68D 1TWHB 2QDBA 4LMQD 4IUTA 3DWQA 3C1FA 3VR5A 4L6TB 3S1QB 5E4WC 3PIO3 2EYFA 5IOCA 1SYGA 1U9RA 2CW0C 4NKLA 2BE5C 2ICEC 5DM63 1IYUA 3E6ZX 1RD9D 1ICWA 1EZ6A 1UAPA 5KEEA 1VMPA 2Q8TA 1D5XC 4KD4A 3VR4A 3HKZB 4IUNA 2IL8A 4ZKCB 1FR3A 3SK5A 3N52A 4IQZA 3F2UA 5J1ZA 2E2DC 2F0VA 3MXNA 3BDCA 2WP8J 2K01A 2A5HA 2F0WA 2NB0A 1SE3A 3RZDB 3NWSA 3VYSA 4NMZA 3D8GA 1VMCA 2C5CA 1B53A 4R9WA 3PMFA 1PFBA 2FMCA 4KJNA 1L0XB 1PZKD 2F0OA 5ELBA 1I4RA 1V1PA 1ENFA 3U9SA 1HQRD 4IFDJ 5IT9E 4FXDA 2XRQD 4EQPA 3T51B 4ZKBB 1TKWB 2EJMA 4C3HG 2XRSD 2Z1CA 1JE4A 5C3WA 5C0XJ 2KCCA 2F0KA 1PRTC 3OWEB 4ZAIA 2X6GA 4FF3A 1U4RA 4HEDA 5EPKA 4M1UB 5D65A 5M9OA 5ELFA 2KA7A 5NUCA 1K8OA 1F2ZA 3DHQA 1QE6A 1BNZA 1F9QA 1O78A 5T1GA 5ELDA 3BVGA 4K6DA 3HP3A 1DCZA 4KI0A 3OOCA 1BQQT 2ZT9C 2XN9C 5A35A 4IUVA 3HS0C 4KMUC 5E4XA 1ZYRC 1JICA 1VF7A 2ZXPA 2DNCA 5CBEE 1AEXA 1SNDA 5C4HA 3T4AC 2K1BA 4B08A 2B39A 1SDFA 1Z7TA 2E2HB 4HTHA 2XWJB 2A69C 1H9RA 1XX8A 1LABA 1H9SB 1ZEQX 1I4QA 3FPUB 2F0SA 1NCVA 5F2DA 2O2LD 2WV6D 2O4XA 4PNYA 3L9AX 1DOLA 4GZYC 5M3FB 3URYA 4ODGA 3NPPA 3KLSA 3K5LA 4HCEA 2L12A 5E1FA 2GA4B 1PFMA 1F77A 4LAAA 2QEJC 2MPMA 4TKOB 5HURA 4A3FB 2ID0A 2HCIA 4QIWB 4H13C 1CK1A 3QJYA 2B2WC 4IFDG 2D2CC 4IZ8A 1YNNC 3M85A 3MWYW 1SYDA 2D5DA 1XWEA 4XDXA 1K83B 4ZUIA 1JWSD 3EQLC 4UDUC 4FNFA 1YNJD 3MXUA 5C0XG 2MHVA 3IFTA 3S14B 2RDFA 3RMHA 4A3IB 3A7LA 3IFDA 1PDQA 3CRKC 3MFGA 3NK9A 1DD2A 2NTSA 4U673 4QB4A 1A3VA 1SBBB 1GHKA 1IW7C 3OIPA 1E2WA 3OW7A 4K2LA 3VR6A 4DXGA 4OO1G 1F2MA 4HSVA 1U4LA 1PRTD 2CVRA 4Q0FA 5CV6A 1TWAB 3GTQB 4IUQA 1B9NA 2AUKA 4KK7A 2F0GA 5KNCA 4IURA 2CHBD 2NZ1D 3HG9A 2L11A 3GV6A 2E2IB 1B1ZA 4F7XA 2PPBC 1Y8OB 1EL0A 2NUCA 1RF2D 3MA2B 1FYCA 1II3A 1GHJA 2K05A 5FO9B 4PQXA 1V8QA 1HHVA 1G6ZA 1U4MA 5CV4A 2JA6B 1LTBD 1SAPA 4C56C 4G7ZC 2HQEA 5CYUA 1JB3A 1HXYD 2B2UC 1JCKB 4QUFA 4FO2A 5CV8A 5LL6X 2L4NA 2KVMA 2YYZA 1ZYRD 3FRPB 3LWUA 1STAA 3P1HA 2TSSA 4J6HA 2A69D 1STYA 5ELCA 3TP6A 1DM0B 4OHJA 1BF4A 2M2LA 1C48A 1MD2D 2EYLA 2ZXRA 5CV5A 3ZYYX 3Q0AA 1EOTA 4RHSA 1S5BD 5EBCA 1XXGA 2A6HD 4G7HC 3GTMB 1X3QA 1QNKA 1Y1VB 4KTAA 1ESFA 2F0MA 4ME5A 1IKMA 1QOHA 2B8GA 2WKDA 2F0DA 5CMDA 1IL8A 3PUYA 4TSSA 3S2HB 1CHQD 1MGSA 3D4RA 5CBAE 3PO2B 3CRLC 1CA6A 3PUWA 1H9MA 3FDTA 3UI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2T A;  3O13 A;  4Z9C B;  1FD7 D;  1AN8 A;  1JWU D;  3DWP A;  4RGT A;  5TSS A;  1I4Q A;  1M4V A;  2CHB D;  3BVM A;  2AQ2 B;  2SEB D;  2O2L D;  2WV6 D;  1L0Y B;  5FKA C;  4RHR A;  1PTO F;  1B44 D;  1L0X B;  1PZK D;  2Z8L A;  3TSS A;  1LT6 D;  1EU4 A;  1I4R A;  1V1P A;  5D3I B;  1EEF D;  1CT1 D;  5ELB A;  1BCP D;  1ENF A;  3BVZ A;  2XNA C;  4L63 B;  1HQR D;  1B1Z A;  3URY A;  1SJH D;  1KTK A;  4RGO S;  1EU3 A;  2NTT A;  2XRQ D;  1RF2 D;  1TS2 A;  2G9H D;  1ET6 A;  1SE2 A;  1LT4 D;  1KLG D;  1JWM D;  1S5D D;  1S5C D;  3DWQ A;  4RGN A;  5D3D A;  4BWG B;  1T5X D;  2XRS D;  4L6T B;  1EEI D;  1KLU D;  2IJ0 A;  1F77 A;  3EFX D;  4K6L A;  2QEJ C;  3MC0 B;  1PZI D;  1LTB D;  1LTI D;  4C56 C;  1LT3 D;  1PRT C;  4O1N A;  1PRT B;  1HXY D;  3OWE B;  1JCK B;  1LTR D;  1BCP C;  1CK1 A;  1PYW D;  1BCP B;  1G8Z D;  1JQY D;  1LLR D;  4ZYS A;  3DWA A;  3BYY B;  1HTL D;  1TS5 A;  1CQV A;  1AW7 A;  1EFI D;  1RD9 D;  5ELF A;  3R2I A;  2AQ1 B;  2ICI A;  1JWS D;  1LO5 D;  3GP7 A;  3V05 A;  1I4H A;  1LTA D;  4UDU C;  5FK9 C;  2TSS A;  1D5Z C;  1FNU A;  4DXF A;  3KLS X;  1TY2 A;  1ET9 A;  2QIL A;  1UNS A;  1LT5 D;  5ELC A;  1SJE D;  1DJR D;  4RGM A;  1PTO H;  1SE4 A;  2RDG A;  1S5F D;  4OHJ A;  1TY0 A;  4RCO A;  1MD2 D;  3MFG A;  1I4P A;  1PTO D;  1TS3 A;  1PRT F;  1D5X C;  3W2D A;  3SEB A;  1BCP F;  2NTS A;  1D6E C;  5ELD A;  1FNW A;  1FGB D;  1RCV D;  1RDP D;  1EWC A;  1SBB B;  2R61 A;  3BVG A;  1LTS D;  4RHS A;  3R8B A;  1S5B D;  1SXT A;  1XXG A;  4RFB A;  1I4X A;  1LTT D;  2XN9 C;  1STE A;  2J4X A;  1GOZ A;  3CHB D;  3BZD B;  4RH6 A;  4DXG A;  2AQ3 B;  1ESF A;  2IPK D;  1SEB D;  1UUP A;  1FNV A;  1S5E D;  1CHP D;  1JR0 D;  1PTO C;  3BYT B;  1HA5 A;  1PRT D;  5I4D A;  1DYQ A;  1PTO B;  4TSS A;  1TS4 A;  5ELE A;  1BXT A;  3EA6 A;  1CHQ D;  2RDH A;  1V1O A;  1QIL A;  1SE3 A;  1LTG D;  1XTC D;  1D5M C;  1I4G A;  1V1P B;  1PZJ D; 
#chains in the Genus database with same CATH topology
 1SNM A;  2JA6 H;  3U58 A;  4U68 A;  1K3B C;  1KAA A;  5FLM G;  4A76 A;  1SRO A;  4KKU A;  4WRD A;  1CI3 M;  1K0R A;  4RCN A;  3V2T A;  4A3E B;  3DEO A;  2K5W A;  5I9P A;  1GD7 A;  5GAG C;  4RHR A;  2H1E A;  3GTO B;  1LT6 D;  4A4I A;  4QCL A;  3WOF A;  2F0J A;  2AKW B;  2R7Z G;  3ND9 A;  1SE2 A;  3SXH A;  4LF5 Q;  1KLG D;  3GDE A;  1G2T A;  4N8F A;  3D3R A;  4X65 L;  2Z9H A;  4A75 A;  1EY5 A;  3J7A F;  2EDG A;  3JAM L;  5JEA H;  1ASY A;  1ZXT A;  3GQB A;  3DMU A;  4A3J B;  5FJ8 G;  1GUG A;  4JV5 L;  2FJ2 A;  1C8C A;  4ZYS A;  5I2X A;  2NWG A;  4DA2 A;  1YJN A;  2Q8R E;  3GTM H;  4GLV B;  5AJ3 L;  2JA7 G;  1CQF A;  5BN5 A;  5I2Y A;  4CJ2 C;  1NE3 A;  3T1H Q;  4KKS A;  1EWH A;  1Y1V H;  5IWA L;  3U4Z A;  5HGT A;  1PA6 A;  2ENB A;  4PZ7 A;  1ET9 A;  1Y14 B;  2JJQ A;  1SE4 A;  2HUG A;  1S5F D;  2B2W A;  4AQY L;  4DNT B;  4CHT B;  3S2H H;  2CFM A;  3AFQ A;  3K58 A;  4JC0 A;  3GV3 A;  2OF1 A;  4YHH Q;  1HR0 L;  2EYH A;  2MO0 A;  4BY1 G;  1VQP A;  1HRJ A;  2AWO A;  4CJ1 B;  2Q2U A;  5K36 G;  5JJZ A;  2UXC Q;  1RCV D;  1RTO A;  2B3G A;  1JJG A;  1SXT A;  4CDF C;  3S1M B;  1TWG B;  3KBX A;  2K32 A;  1YNX A;  1PH9 A;  5COY A;  1DXM A;  3I7F A;  3ITP A;  1NMG A;  4A3E H;  1Q7Y C;  2SNM A;  1KD1 C;  1N33 Q;  4L5Q A;  2D0O A;  1S5E D;  2KOL A;  2PO4 A;  3GTO H;  4DR7 L;  1XNQ L;  4EVO A;  3L0O A;  3I4N G;  1HA5 A;  2CQA A;  3UE1 A;  2K5V A;  1WVL A;  5M3M G;  1Y1W B;  1W6K A;  4PV1 C;  1LAC A;  4PG3 A;  4BA1 I;  2EJF C;  3SK6 A;  1S40 A;  2RHS B;  2NVT B;  4PZ8 A;  4ILW A;  3H91 A;  1XPU A;  4JI8 Q;  3T53 B;  4C3I G;  4O2D A;  1K73 C;  4DV2 L;  4A3J H;  3H6M A;  1MI2 A;  3TQY A;  4LK1 C;  3P75 A;  2AQ2 B;  5LMN L;  4YWM A;  3R3O A;  5FKA C;  1NSN S;  3TME A;  2JEA I;  5IP9 H;  3NBH B;  1RL2 A;  1CZG A;  4LNQ A;  1AE2 A;  4DR3 L;  1AZQ A;  4M8A A;  2F0L A;  2G9H D;  1ET6 A;  3FVQ A;  2IWH A;  2KCN A;  4R1J A;  3S16 B;  1JWM D;  5D3D A;  4WOR A;  1Q8I A;  2HCC A;  1HPC A;  5BN3 A;  2F0T A;  4Q5V A;  3I72 A;  1WD1 A;  4IUU A;  3SR1 A;  4H02 A;  4TQU S;  3HOV G;  3E9I A;  3CCL A;  3BZK A;  4K2K A;  4YY3 Q;  1XNR Q;  5J3B A;  2NVQ B;  2KJX A;  1A0I A;  1PH6 A;  4RAU C;  1QB5 D;  1Q8K A;  2K75 A;  3S1M H;  1RTN A;  3DWA A;  1TWG H;  1EYD A;  2NN6 G;  1UWV A;  1EZ8 A;  3KJP A;  4DGZ A;  2K5N A;  3WDN A;  4XT1 B;  4DXF A;  2Z6K C;  1DZ1 A;  5COR A;  4DAY A;  4C3H B;  3H3V C;  2B2U A;  1Y8P B;  3KBG A;  1Y1W H;  4F88 A;  1KDA A;  4DKA C;  1STN A;  2VB2 X;  1TR5 A;  2NVT H;  1EUJ A;  1F9S A;  3OWF A;  4PMB A;  1CKN B;  5JOB A;  5DEH A;  3S1N B;  1SN8 A;  1EYG A;  1LTS D;  4XYO A;  3A8K E;  3BDO A;  4X65 Q;  5KND A;  4DPG A;  1A15 A;  1OO9 B;  4YWL A;  1HFG A;  2Z4H A;  1OXV A;  1IKL A;  2JP1 A;  3AB9 A;  4OL7 A;  1BKB A;  1YIT A;  3VDY A;  1TWC B;  2I0Q A;  1QVF A;  4JV5 Q;  4ZRZ A;  1H9J A;  3A5Z B;  4P71 A;  3F2C A;  2E75 C;  2B2T C;  5AJ3 Q;  1R4Q B;  5C44 B;  3BU2 A;  3K5O A;  3VYU A;  3S16 H;  5IWA Q;  4H0L C;  2F0E A;  5GRO A;  4EQO A;  3H0G G;  1AH9 A;  3QWN A;  1D5M C;  5EKL A;  1NBW A;  3JAM c;  5C4Z A;  5LMU L;  1VQF A;  2WAQ B;  4DR4 L;  1OXS C;  1QVG A;  4JI4 L;  4AQY Q;  2EPB A;  4RWS C;  2EYO A;  3I56 A;  1TU2 B;  2EYP A;  2Z4I A;  1B2T A;  2TMP A;  4K14 A;  1HR0 Q;  2NVQ H;  2SEB D;  4A3B B;  3HOU G;  4PZ6 A;  5K5P A;  4JI5 L;  2J0T D;  4DV3 L;  4DAY B;  4BBS B;  2KEN A;  1ILQ A;  2N49 A;  2EJG C;  1SJH D;  2AWN A;  4A3C G;  4ME3 A;  3CCS A;  1PH4 A;  2K33 A;  1B3A A;  2RSN A;  4GLX A;  2PQA A;  4C3H H;  5GAE C;  2F0P A;  3U50 C;  1XNQ Q;  2EYJ A;  3K0X A;  1PH5 A;  4JCV E;  3LX0 A;  1U0L A;  3ULP A;  5FLX L;  3AU7 A;  1CSQ A;  4BXX G;  1BDO A;  3ICE A;  5JVG 3;  3ND8 A;  3S1N H;  5IOD A;  1LTR D;  1QZG A;  5JAV A;  4LUV A;  3HZX A;  3DEP A;  1VDZ A;  1WTP A;  1WCM G;  1DOM A;  4DV2 Q;  3UDG A;  4MTK A;  5IGE A;  1JOR A;  3NXW A;  2AQ1 B;  2ICI A;  2J7Z A;  1LO5 D;  1X54 A;  1TWC H;  2B2Y C;  5LMN Q;  2KHS A;  4B9W A;  3RLF A;  2E8G A;  4J8Q A;  4UAI A;  1Q86 C;  1SJE D;  1U4P A;  4A3K B;  2FFK B;  1GUS A;  4GLA C;  2WAC A;  3L3O C;  5C5L A;  5C44 H;  2MJ8 A;  4DR3 Q;  4LUO A;  1TS3 A;  1PRT F;  4X66 L;  2X6L A;  1EWI A;  3MXN B;  2CH4 A;  2SOB A;  1FGB D;  4FXG C;  2C9O A;  1PLF A;  3LWE A;  4JI7 L;  4KY7 A;  2A73 B;  2UUA L;  1Q1E A;  4KN4 C;  2K7V A;  3W5O A;  3J7A V;  1SNQ A;  2ASB A;  4A3B H;  5C4X B;  2WIN B;  3L7Z C;  3C2P A;  1DON A;  3HFZ B;  2B2V C;  2H4O A;  3M9B A;  1UUP A;  1A6X A;  4BBS H;  1PTO C;  4QUC A;  3U4V A;  2R7D A;  3U9O A;  1TS4 A;  3BDL A;  5HGQ A;  2KEE A;  1QIL A;  1U5K A;  3J7Z C;  2XSC A;  3H94 A;  4NP5 A;  3NTK A;  2F0I A;  1V1P B;  5IGF A;  2B8F A;  3I55 A;  2UUC Q;  3CCM A;  2OTJ A;  1YIJ A;  3LNN A;  2M9V A;  3VR3 A;  3PIP A;  2IX1 A;  2XVS A;  4O42 A;  3HGB A;  1SYF A;  4EQ5 A;  4MHE A;  3BG3 A;  3M7G A;  3CCR A;  5D3I B;  3BVZ A;  1EIY B;  3TP5 A;  1S4Z A;  2LXJ A;  4RGO S;  2CW0 D;  2PI2 A;  1TS2 A;  2BE5 D;  4JW0 A;  4ABN A;  2JE6 I;  5IYB G;  1WD0 A;  2PW7 A;  4A3K H;  2N78 A;  2PYK A;  3TN2 A;  4HN7 A;  1HQM C;  1A2U A;  3HRZ C;  4JYA L;  4A3L G;  4YIJ A;  2A19 A;  1BCP C;  3MXG A;  1GVP A;  3NTI A;  5LMU Q;  4DR4 Q;  4JI4 Q;  3E3X A;  2OT2 A;  2BCO A;  4K8J A;  1TS5 A;  1GO3 E;  4LF4 L;  5C4X H;  2IT1 A;  4OWW B;  2BH8 A;  4JI5 Q;  1GUN A;  2GN5 A;  4DV3 Q;  1HFN A;  2B63 B;  4A3D B;  4JBK A;  2HDL A;  1AP0 A;  1A3U A;  2VW9 A;  3FPP A;  3F1Z A;  4C2M B;  1Q1B A;  2Z6B A;  1HCZ A;  4NXN L;  4DN4 M;  1OXT A;  2CWA A;  3I4L A;  3X3N A;  1J9O A;  1D1K A;  3AEV A;  2Z6K A;  3HOZ G;  4UP8 A;  4B9X A;  2SDF A;  3VR2 A;  3T1Y L;  1WTX A;  3NE5 B;  4BS9 A;  1EQT A;  2DJF C;  4HR7 B;  4RH6 A;  1C4Q A;  5IGB A;  1QCB D;  4OO1 H;  4DV1 L;  1I6H B;  1SFO B;  3K6O A;  1Q12 A;  2FIN B;  1Q82 C;  2RF4 A;  3A56 A;  1ICF B;  2UUB L;  2HHH L;  4ZLT F;  1HNZ L;  3EA6 A;  4WFN 3;  2LY7 A;  4XQN A;  2JA5 B;  1SYB A;  4LJZ C;  2PMZ E;  1E24 A;  2F0U A;  1WTO A;  3J7Y W;  2VS1 A;  5FLX c;  4OXP A;  4MNO A;  1M90 C;  2K6A A;  4X3T A;  1I5F A;  4UHV A;  2NVY B;  1TWF B;  3AQQ A;  4HIO A;  1D7Q A;  2OXP A;  4I7Z C;  2B2T A;  4RGT A;  3HOY H;  3A8I E;  2NBF A;  3I4M G;  3JAM i;  2K5H A;  3H15 A;  2JEB I;  4ID6 A;  4X6A H;  4N8X 1;  1NAP A;  4JI7 Q;  1EEF D;  1S3O A;  2UUA Q;  4OGQ C;  4HJ9 A;  4BY7 H;  5GQO A;  4B3S L;  2K50 A;  5AFW A;  3KK7 A;  2EXD A;  1SMY C;  4DR2 L;  2B63 H;  4KY6 A;  5DAU A;  5FLX E;  1CA5 A;  1UE7 A;  2LS0 1;  4IN3 A;  3MC0 B;  1PZI D;  2ALY B;  3KDF B;  2F4I A;  4C2M H;  3C1E A;  5JVH 3;  4O1N A;  4S3S A;  5LHY 1;  5M5Y B;  5LMN W;  1XYI A;  3QR8 A;  4HJ8 A;  4OWT B;  2LKV A;  1JQY D;  1QUQ A;  1OTC A;  2WKC A;  1RHP A;  3KUP A;  3I3C A;  4A93 B;  1JOO A;  1YZ6 A;  1IYV A;  2NN6 I;  4IOC A;  3QB3 A;  1BOS A;  4ALP A;  1I6H H;  3KLS X;  1SFO H;  3M4O B;  5C6A A;  1LT5 D;  4XTC S;  2JSO A;  1DJR D;  3MHB A;  4OEL B;  2QDL A;  1ESR A;  4HJ7 A;  2E2J B;  4HMJ A;  2JA5 H;  4XIG S;  2VNU D;  1VF5 C;  1VQB A;  4LWC A;  1VQL A;  4MIU A;  3CP0 A;  5G3L D;  1T5E A;  2JQO A;  4NDX A;  5KYL A;  1D6E C;  3OMG A;  2RKS A;  2LMC B;  1WTQ A;  4DFA A;  5FO7 B;  2Q2I A;  4J15 A;  4C3J B;  5KGU A;  2DY7 A;  2NVY H;  1TWF H;  4WJW A;  1I4X A;  3QOJ A;  4BA2 I;  1N32 L;  3OTO L;  4A3F G;  3IL8 A;  3PIO A;  2EY5 A;  4JYA Q;  3CC2 A;  1DOK A;  2ZXO A;  1L0W A;  4DK6 C;  2A1A A;  3CAM A;  1Y69 U;  2OQ0 A;  2E5L L;  5BN4 A;  4WJ3 M;  3QIA A;  4AYB G;  1RIP A;  1A2T A;  2VY3 A;  4LF4 Q;  1G91 A;  4L5S A;  3OSO A;  4MTN A;  4BY1 B;  1SSO A;  1B50 A;  3DM1 A;  4A3I G;  1QUQ B;  2RSO A;  3K59 A;  2ATW A;  5EGT A;  3FEW X;  1GXD C;  4NXN Q;  3P20 A;  5L37 A;  5M5Y H;  1K8M A;  1E0B A;  3PCO B;  2OWO A;  3G7L A;  3TSS A;  1E7Z A;  5CC4 A;  2Z8L A;  3OYY A;  4B3R L;  4WJ4 A;  2K5Q A;  3D6C A;  3Q8D A;  3K5N A;  3T1Y Q;  2XNA C;  3I4N B;  3TRZ A;  3KF8 A;  3F8T A;  2RCN A;  4A93 H;  2KHI A;  1YNN D;  1EOV A;  1MSG A;  3M4O H;  1J8I A;  1X3P A;  4RGN A;  4DV1 Q;  1JE5 A;  1K28 A;  4QF4 A;  1EEI D;  4OIK A;  2UUB Q;  1EQV A;  1O7L A;  3RD4 A;  2E2J H;  2EZV A;  1HNW L;  3FHW A;  2HHH Q;  1HNZ Q;  3DUZ A;  1B8A A;  3J81 i;  5IYD G;  1PRT B;  2F3W A;  1N36 L;  3TP7 A;  5FJ8 H;  1YHQ A;  1K9M C;  4IPG A;  4LUZ A;  2F0F A;  4C3J H;  4DNR B;  1EY8 A;  4FF4 A;  1QNU A;  4R4Q A;  1UE6 A;  1AW7 A;  1EFI D;  4J1M A;  1IW7 D;  3X3M A;  2MQH A;  2WB1 G;  4JBW A;  4XYQ A;  5LL6 S;  3S24 A;  2JA8 B;  1KNA A;  3N6R A;  3H09 A;  3C46 A;  1L1O A;  2KQ3 A;  4B3S Q;  1VQM A;  4DK1 A;  3NP8 A;  3HOV B;  4BY1 H;  3M3Y B;  4JI0 L;  2D9U A;  1W6J A;  3SK8 A;  3CMA A;  4NW2 A;  2R61 A;  3GTG B;  1TQO A;  4KV6 A;  1STE A;  2J4X A;  2JA6 G;  1GOZ A;  3OMC A;  3PUV A;  1R4P B;  2PI2 E;  2BOS A;  1J6Q A;  1CHP D;  2CKZ B;  2YTV A;  1JR0 D;  3GTL B;  3ERO A;  3I4N H;  1KAW A;  2ZM6 L;  5ELE A;  2UXD L;  4G7O C;  4IPC A;  4XQJ A;  3CXC A;  4DK0 A;  2Y0S E;  1S72 A;  4AYB E;  2QW7 A;  4G57 A;  5KIX A;  1JJ2 A;  3GD7 A;  5CV9 A;  3OHX C;  2AHO B;  1HNX L;  2CCZ A;  3GTK B;  1X9N A;  1A62 A;  4N9T A;  5IYC H;  2VQE L;  1M4V A;  1GUO A;  3CCV A;  1K3R A;  4X3U A;  2OQK A;  5FO8 B;  4R4C A;  1H9K A;  4P72 A;  1B4O A;  5I6W A;  3D4W A;  4DUZ L;  1L1O B;  3OTO Q;  3I90 A;  2NTT A;  3I4O A;  1WTR A;  2QCP X;  1S5D D;  1JOK A;  2F1M A;  3A7A B;  5CGK A;  1G29 1;  3PQI A;  2JA8 H;  1D8L A;  1CM9 A;  3STB C;  1UE5 A;  2E5L Q;  1BR9 A;  3MEH A;  4CGY B;  3MAQ A;  1EY4 A;  5T1I A;  1LTI D;  3HOV H;  4V19 0;  1W2B A;  2DN8 A;  1VCI A;  3ULJ A;  3PO2 G;  3QO2 A;  3M3Y H;  1KAB A;  1VQ9 A;  5I9O A;  4N9P A;  2MNA A;  2R3Z A;  1ILP A;  3UDF A;  4JVZ A;  1FVI A;  3GTG H;  4KD3 A;  2LFN A;  5KYI A;  4GOP C;  1JC7 A;  3FMC A;  1F9R A;  2NN6 H;  3HOX G;  3E5S A;  4P2C B;  1F2L A;  1MSH A;  3GP7 A;  1LTA D;  3CCQ A;  1SMX A;  5FK9 C;  4A3E G;  2JA9 A;  1D5Z C;  4CKE A;  4KY5 A;  3GTL H;  2WB1 E;  4RCO A;  1XMO L;  1QJO A;  1YVC A;  3A54 A;  3D0F A;  2CH4 W;  4FF2 A;  4CKC A;  2PZT A;  4F87 A;  1YBY A;  1HZ9 A;  1WTV A;  3Q6S A;  3FKI B;  4IFD I;  4KHP L;  4GNX C;  3Q22 A;  3GTK H;  1HNW Q;  2XIW A;  1GUT A;  4RFB A;  5CV7 A;  1LTT D;  5KNB A;  4ZK9 B;  4FDB A;  4A3J G;  3EJI A;  5IGG A;  1N36 Q;  4LF9 L;  1SEB D;  2V4D A;  4CBV A;  3PF5 A;  1NJI C;  5C0X I;  3NQT A;  3S1R B;  3NQI A;  3M4Q A;  5IP9 G;  4V0B A;  2PZW A;  3J81 L;  1G51 A;  2PZU A;  4EX5 A;  3ER0 A;  3PO3 B;  1D1I A;  1KQS A;  4Y52 H;  4BBR G;  1L2F A;  4L5R C;  1XTC D;  1Y8N B;  2B29 A;  2Q2T A;  2X69 A;  3LGJ A;  1K8A C;  2HT1 A;  4LF7 L;  2V1C C;  3BJU A;  4UP9 A;  3W1B A;  4ULL A;  1JWU D;  2E74 C;  1PH1 A;  1VQI A;  3HKS A;  4X64 L;  4HAE A;  5C3E G;  1KDB A;  5JJK A;  2KEC A;  1CFM A;  2MFI A;  4JI0 Q;  4OO1 I;  2I46 A;  1WI5 A;  2MGS A;  1Z9F A;  1I50 B;  1PVO A;  1I3Q B;  2PMZ B;  4A3C H;  4K5W A;  5I6Y A;  1VQ7 A;  3P7J A;  3CF5 A;  1LT4 D;  4OIJ A;  5JPM C;  3RLN A;  3ZJY C;  1YJ9 A;  2C35 B;  1KLU D;  1N34 L;  1LM0 A;  1RKN A;  2R93 B;  2ZM6 Q;  3S9W A;  2UXD Q;  4HMI A;  1UEB A;  2R92 B;  1FL0 A;  1TT2 A;  1V43 A;  3QOL A;  1F2Y A;  3FKI H;  1VQ8 A;  1G8Z D;  2KHJ A;  1IHZ A;  3G6E A;  2OEO A;  1HNX Q;  1Z47 A;  2VQE Q;  1B9M A;  4DAP A;  4CKB A;  1IZ6 A;  1I4H A;  1N8R C;  4DR7 Q;  3S1R H;  5IY0 A;  2MO1 A;  3JAM E;  3PUX A;  1OXX K;  3IAY A;  1ENA A;  4DUZ Q;  4JI1 L;  1NMF A;  1NR2 A;  3KJO A;  1HTP A;  1EIG A;  4HIK A;  3T16 A;  1NUC A;  3UE0 A;  3PO3 H;  2K4K A;  1EIF A;  2F3V A;  1M8A A;  1CUK A;  1NR4 A;  4H44 C;  3K80 C;  4K0K L;  1I6V C;  2FHT A;  3A74 A;  5ELO A;  3VA5 A;  1TII D;  1YNJ C;  1IBK L;  3CHB D;  3BZD B;  1PXU A;  3STB D;  1X56 A;  2F0Q A;  2KED A;  4QMG A;  5IIF A;  1SYE A;  3EBE A;  3PF4 A;  4B3M L;  1I50 H;  4RKL A;  3KF6 A;  3F2B A;  2L15 A;  2VUM B;  1I3Q H;  4IJL A;  1BXT A;  4JBM A;  1FJG L;  2VZA A;  1SR3 A;  2KCM A;  1SYC A;  2Z0S A;  4RA8 A;  3A8J E;  5DNF A;  3W3A A;  4KHV A;  1VQC A;  3RLO A;  3E9H A;  1FD7 D;  1IYJ B;  2EY1 A;  1XMO Q;  3HOZ B;  1AFP A;  4GN5 A;  4DR5 L;  2R92 H;  3DWP A;  2ZJQ A;  1WFQ A;  5E3F A;  1VQ4 A;  2EXZ A;  2PQA B;  1E3P A;  3NBI A;  5FOB B;  1L0Y B;  3MXP A;  4KHP Q;  1PTO F;  1B44 D;  4IO9 A;  3NEN A;  3T56 B;  4LFA L;  5M5W B;  1CT1 D;  1T9H A;  2RVL A;  1G2S A;  4L63 B;  4A3M B;  4L8J A;  5EKK A;  2HIV A;  1EU3 A;  5JJI A;  1H9S A;  2PNR C;  3J80 i;  3K0Y A;  3HEJ A;  2YU9 B;  1CTM A;  1Q3L A;  4LF9 Q;  4BWG B;  1BUV T;  2E76 C;  3EFX D;  2A6E C;  3EVQ A;  3H3V I;  5ISR A;  4NXM L;  5C44 G;  1I94 L;  3GTJ B;  1LT3 D;  4DK3 C;  2VL6 A;  3HKZ G;  4GN4 B;  5EAY A;  4A3L H;  3I4M B;  3PUZ A;  2IW3 A;  4C1N K;  1MHW C;  4FYD A;  4ZUJ A;  5G3L F;  1LLR D;  2WAQ G;  1STB A;  3BYY B;  3TEH B;  4LF7 Q;  2F3I A;  1QWY A;  1HTL D;  4K5V A;  4CJ0 B;  4IPD A;  2Q8I B;  3TBI B;  4IOA A;  1WYD A;  2PCF B;  4X64 Q;  3AYH B;  3V05 A;  3L2P A;  1HUN A;  3J81 c;  4A3G B;  2QKI C;  4RGM A;  4BBS G;  2L9H A;  2VUM H;  1X3E A;  3A55 A;  2K04 A;  3TDQ A;  2EE1 A;  2EY6 A;  3I8Z A;  3HOY B;  4OON A;  4GOP A;  4R8I A;  4QGU A;  3IRB A;  3ONA B;  3W2D A;  3SEB A;  1KC8 C;  1IBM L;  4H7B A;  5EPJ A;  3K57 A;  1BCP F;  3VA7 A;  4IFD H;  1E22 A;  1KXL A;  1EWC A;  4UY8 C;  1N34 Q;  3HOZ H;  1PFN A;  2L55 A;  3SDZ A;  3RUZ A;  3ERQ A;  1X55 A;  2PNH A;  4BY7 B;  2HIX A;  3TZU A;  3K5M A;  3MZ5 A;  4KJO A;  1X32 A;  3RZO B;  4E6I A;  5C0X H;  2HDM A;  4HJA A;  2RQX A;  2YTX A;  1BVS A;  1G6P A;  3J81 E;  2DUD A;  1F9P A;  5M5W H;  1E1T A;  4Y7N B;  3I91 A;  1KDC A;  1LTL A;  4A3M H;  1LUZ A;  4GNX A;  3GTP B;  1KNE A;  2RDH A;  1EIH A;  1V1O A;  2MUY A;  5IGD A;  1BO0 A;  2YU9 H;  2G9D A;  1VQG A;  2A6H C;  1IL2 A;  2XWB B;  1LV9 A;  2VQF L;  1ML0 D;  4JI1 Q;  3F2D A;  2QGQ A;  2UXB L;  2RBM A;  3GTJ H;  1TVX A;  3I4M H;  2NZH A;  3Q23 A;  2BA0 A;  3RR5 A;  2PQE A;  4K0K Q;  3NUC A;  1UEA B;  1MBY A;  5EPL A;  2Y0S B;  4AYB B;  1HR0 W;  1IBK Q;  4JI2 L;  2N55 A;  2JYO A;  5C4X G;  3HOW B;  4A3G H;  4OX9 L;  3MFY A;  3R93 A;  3VYT A;  4B3M Q;  2IJ0 A;  4DAV A;  4K6L A;  3UDI A;  1O7Z A;  1FJG Q;  4X66 Q;  4FXK C;  1YHA A;  2L0C A;  1WTH A;  5H1S E;  3MVV A;  3HKZ E;  3D6W A;  3V96 A;  4TVA B;  1GJX A;  4DR5 Q;  1CQV A;  3CCU A;  3R2I A;  4JI3 L;  4G4K A;  3RZO H;  1JOQ A;  3MTS A;  3S2D B;  5A2Q L;  1FNU A;  3OIQ A;  1STH A;  1UNS A;  4KN7 C;  3GO5 A;  4LFA Q;  4Y7N H;  2K28 A;  2L5T A;  1Z6H A;  3EN2 A;  3NWT A;  3SK4 A;  1EYA A;  3GTP H;  1PTO D;  1WTW A;  5C3X A;  2R6G A;  1PMR A;  4FP5 D;  5EKI A;  1BBX C;  1XJV A;  4HCS A;  4GKJ L;  1FNW A;  2EVB A;  4XXE A;  4YCV A;  4APV A;  5DLQ E;  3J80 L;  4MN3 A;  4NXM Q;  4DV5 L;  1ENC A;  2XTI A;  1I94 Q;  2R7Z B;  2D62 A;  2CWP A;  1HJP A;  1ROD A;  2A6E D;  5HY6 A;  2BA1 A;  4KKT A;  1FNV A;  2WB1 B;  1EY6 A;  4ZCK A;  5M3F G;  5C5M A;  1AZP A;  1E2V A;  5I4D A;  3PSI A;  1DYQ A;  1HA6 A;  1K8G A;  1HUM A;  4K5X A;  2EQS A;  2SNS A;  4DU9 A;  4EGV A;  4DR1 L;  3C3L A;  3HOW H;  2NYZ D;  1QVC A;  2AUJ D;  1A8V A;  3QG1 A;  3KLW A;  1EFW A;  2B2Y A;  1E2Z A;  3KOJ A;  4DV6 L;  3D4D A;  1EY9 A;  2B63 G;  4X62 L;  4A3D G;  1B70 B;  5IGC A;  3M4Y A;  1AN8 A;  2JA7 B;  3EIV A;  4EQN A;  2RA4 A;  4FF1 A;  5TSS A;  3KLR A;  4AIM A;  1HZC A;  1IBM Q;  3SVM A;  5M5X B;  1PH8 A;  5JEA J;  3WOE A;  3K8A A;  3CKI B;  1BCP D;  4RMF A;  2N88 A;  1KTK A;  1EY0 A;  4DR6 L;  3S2D H;  1BBU A;  2YV5 A;  1RJT A;  1YHB A;  4K8I A;  2B2V A;  3H3V H;  1BBW A;  3NEL A;  5J39 A;  4HSP A;  4DF7 A;  5FLM H;  4JK1 C;  2KBN A;  4HJ5 A;  1EY7 A;  4PMC A;  3MEF A;  5IYD H;  1YEZ A;  2VB3 X;  2IY5 B;  4QQB X;  2WII B;  3NTH A;  4JBJ A;  3TP8 A;  2IX0 A;  5DM7 3;  2F0H A;  2QF7 A;  2VQF Q;  4I7A A;  1B7Y B;  5M3M B;  3TZD A;  4I65 A;  2UXB Q;  2R7Z H;  3Q24 A;  2K5D A;  3CU7 A;  5EBD A;  5IP7 G;  3B6Y A;  1TY2 A;  4UPA A;  1V9P A;  1Q90 A;  2RDG A;  4XQQ A;  3PGZ A;  1TY0 A;  2A74 C;  4R4O A;  4C3I B;  3PIP 3;  1MKH A;  4JI2 Q;  5EJW A;  3RN5 A;  3BZC A;  3UDX A;  1NNX A;  4X3S A;  4OX9 Q;  4RKB A;  2JN4 A;  2A68 C;  2KUM A;  3G6J B;  2FMM A;  4IUP A;  2JA7 H;  1E1O A;  3SE0 A;  3D31 A;  2O5J C;  3E0E A;  2ZTD A;  5M5X H;  3HOX B;  2AQ3 B;  2IPK D;  5KRU A;  1C7Y A;  2L1B A;  4NB3 A;  1IXR A;  1SNP A;  2LSS A;  3BYT B;  1PTO B;  3T13 A;  4A93 G;  4JI3 Q;  1SNO A;  3TS0 A;  3M7N A;  4NPS A;  4DR2 Q;  4LW1 A;  5K36 H;  1PH7 A;  3SHL A;  3G4S A;  1GKH A;  3KF8 B;  1SMY D;  3I70 A;  4POF A;  1JMC A;  5CR3 A;  3BVM A;  3CPW A;  3NHH A;  2F0N A;  4GKJ Q;  2M00 A;  2DY8 A;  3PV0 A;  2N3S A;  4XT3 B;  4QIW E;  4C3J G;  1EU4 A;  2DJG C;  5EQ0 A;  5M3M H;  1ZKO A;  4DV5 Q;  1R9T B;  3NEM A;  2BDN A;  4L5T A;  2JXM B;  2YTY A;  3CQZ B;  4FVM A;  1A3T A;  1S5C D;  5IT9 L;  4C1N I;  4BBR B;  1T5X D;  5D14 A;  2DNE A;  1WJJ A;  4KLK A;  3VYR A;  4R4T A;  4C3I H;  4ZQ3 A;  4DV0 L;  1KRS A;  2HD3 A;  1CZW A;  4R8N A;  3NBH A;  1B3Q A;  5JEA G;  2I07 B;  4DR1 Q;  1PV4 A;  3PO2 H;  1OXU A;  3J80 c;  5C3E B;  4X3K A;  2IX3 A;  4KHZ A;  4DV6 Q;  5C4J B;  1PYW D;  2PW5 A;  1BCP B;  1ONL A;  4PMW A;  4X62 Q;  1XTD A;  2ZJP A;  1N32 Q;  1STG A;  5E7N A;  1XMQ L;  2H5X A;  5A2Q E;  1Y1V G;  3E0J A;  3HOX H;  2MP1 A;  1NY4 A;  1SNC A;  3H0G B;  2BDO A;  1O7Y A;  2QIL A;  4LF6 L;  1CKM A;  3S15 B;  1VQN A;  5GAH C;  2EOT A;  1PTO H;  1QG7 A;  3AMU A;  2HQL A;  1CSP A;  1EYC A;  1I4P A;  2EYM A;  4DR6 Q;  2LXK A;  4IAL A;  3HOU B;  4TRD A;  4F8M A;  4IPH A;  3K7A B;  3BS1 A;  1RDP D;  3J80 E;  3R8B A;  2Q2H A;  1D2B A;  2K03 A;  3A5U A;  3CPF A;  2O5I C;  2DGY A;  3TRE A;  2XGT A;  5IYC G;  3ULL A;  3IKJ A;  4YWK A;  3DXJ C;  2ZTC A;  1CKN A;  4B3R Q;  1A63 A;  3CCE A;  4P74 A;  2KCT A;  5J22 A;  1R9T H;  4HIM A;  5JPN C;  3CQZ H;  4BBR H;  1LTG D;  1VS0 A;  3RN2 A;  2I5L X;  1X65 A;  1I4G A;  1GUW A;  1PZJ D;  4AH6 A;  2JA8 G;  2NVX B;  3R2T A;  3O13 A;  4Z9C B;  4JOI C;  3I73 A;  1O80 A;  1WCM B;  3S17 B;  3OPO A;  2VXW A;  3NSW A;  2QEX A;  5C3E H;  3CC4 A;  5C4J H;  2EY2 A;  1KRT A;  1TXY A;  3JC6 6;  3M4P A;  2F03 A;  1X6O A;  4P73 A;  2A68 D;  1TWH B;  2QDB A;  4LMQ D;  4IUT A;  3H0G H;  3DWQ A;  3C1F A;  1PYS B;  3J81 j;  3S15 H;  3VR5 A;  5GAD C;  4L6T B;  3S1Q B;  1YJW A;  5E4W C;  2UUC L;  3PIO 3;  4LF8 L;  2EYF A;  3HOU H;  5IOC A;  3CW2 C;  3K7A H;  1SYG A;  1U9R A;  2WFW A;  2CW0 C;  4NKL A;  2BE5 C;  2ZJR A;  5BR8 L;  2ICE C;  5DM6 3;  1IYU A;  3E6Z X;  1X3F A;  1KHI A;  3A0J A;  1RD9 D;  1ICW A;  1MJC A;  1EZ6 A;  3KFU A;  1X3G A;  1UAP A;  5KEE A;  1J5E L;  1Y1W G;  1YI2 A;  1VMP A;  4POG A;  2Q8T A;  1D5X C;  4BXX H;  4KD4 A;  4QY7 A;  3VR4 A;  4B3T L;  3HKZ B;  2D0P A;  3ERS X;  4IUN A;  2IL8 A;  2NVX H;  4ZKC B;  1FR3 A;  3SK5 A;  4DV0 Q;  1VQ6 A;  1WCM H;  4OWX B;  3N52 A;  3S17 H;  4IQZ A;  3F2U A;  5J1Z A;  2ES2 A;  2E2D C;  2UU9 L;  4LFC L;  2F0V A;  3MXN A;  3BDC A;  1VQJ A;  2WP8 J;  2K01 A;  5IT9 c;  2A5H A;  2F0W A;  1TWH H;  1XMQ Q;  2NB0 A;  1SLJ A;  4GS3 A;  4DAM A;  1SE3 A;  1QZH A;  4DNI A;  3RZD B;  1HZA A;  4LF6 Q;  1VQE A;  3NWS A;  3VYS A;  4NMZ A;  3S1Q H;  1HZB A;  4GKK L;  3D8G A;  1VMC A;  4QL5 A;  2C5C A;  1B53 A;  5IE8 A;  1M1K C;  4R9W A;  3PMF A;  2CQO A;  1PFB A;  2FMC A;  3FKI G;  4KJN A;  1L0X B;  1PZK D;  2F0O A;  3G71 A;  5ELB A;  1I4R A;  1V1P A;  4DV7 L;  1ENF A;  3U9S A;  1MIU A;  1HQR D;  4IFD J;  5IT9 E;  4FXD A;  2AMC B;  2XRQ D;  1MJE A;  1PH3 A;  4EQP A;  3T51 B;  4ZKB B;  1TKW B;  2EJM A;  4C3H G;  2XRS D;  2Z1C A;  1JE4 A;  5C3W A;  5C0X J;  4DUY L;  2KCC A;  1JT8 A;  2F0K A;  1PRT C;  3PO3 G;  2IHE A;  3OWE B;  4ZAI A;  2GVB A;  2X6G A;  4QJF A;  4FF3 A;  1U4R A;  4HED A;  4JG2 A;  1P8L A;  5EPK A;  4M1U B;  5D65 A;  5M9O A;  2I5M X;  1V1Q A;  1JB7 A;  2F4V L;  5JJL A;  3AFP A;  5ELF A;  2KA7 A;  5IYB H;  5NUC A;  3DLL A;  3CC7 A;  1PHJ A;  2EIF A;  2A8V A;  1K8O A;  1VQA A;  1K0S A;  1F2Z A;  3DHQ A;  1QE6 A;  1BNZ A;  1F9Q A;  2FXQ A;  3RZD H;  1O78 A;  5T1G A;  1IBL L;  5ELD A;  3BVG A;  3KF6 B;  3DM3 A;  3HP3 A;  1DCZ A;  4K6D A;  3OOC A;  4KI0 A;  1BQQ T;  3W1G A;  2R93 G;  4YCU A;  2ZT9 C;  4LF8 Q;  2XN9 C;  4UP7 A;  2R92 G;  4A3B G;  5ELN A;  5A35 A;  1SE8 A;  4IUV A;  3FP9 A;  4OEM B;  3HS0 C;  5BR8 Q;  1XPR A;  4KMU C;  2G5D A;  2R7F A;  5E4X A;  1ZYR C;  1JIC A;  1VF7 A;  4LFB L;  2ZXP A;  2DNC A;  5CBE E;  1AEX A;  1SND A;  5C4H A;  3T4A C;  2K1B A;  4B08 A;  1J5E Q;  2B39 A;  1SDF A;  1EQQ A;  1Z7T A;  2E2H B;  4HTH A;  2XWJ B;  2A69 C;  1H9R A;  1XX8 A;  1LAB A;  1H9S B;  1ZEQ X;  1I4Q A;  3FPU B;  2F0S A;  4B3T Q;  1NCV A;  5F2D A;  4P75 A;  2O2L D;  2WV6 D;  2O4X A;  4PNY A;  3L9A X;  1DOL A;  2K52 A;  1ASZ A;  4GZY C;  5M3F B;  1L1O C;  4DV4 L;  3URY A;  4CDE C;  4ODG A;  2OCE A;  3NPP A;  4JOI A;  3KLS A;  3K5L A;  4HCE A;  2L12 A;  2UU9 Q;  5E1F A;  4LFC Q;  2GA4 B;  1SRU A;  4A3K G;  1PFM A;  1F77 A;  1PYB A;  1WOC A;  2IHF A;  4LAA A;  2VUM G;  2QEJ C;  4RG1 A;  2MPM A;  4TKO B;  5HUR A;  4JI6 L;  3CCJ A;  4A3F B;  2ID0 A;  4O0A A;  2QA4 A;  1HH2 P;  2HCI A;  4QIW B;  4H13 C;  1KL9 A;  1CK1 A;  3QJY A;  2B2W C;  4IFD G;  2D2C C;  4IZ8 A;  4GKK Q;  1YNN C;  3M85 A;  1PH2 A;  1UE1 A;  3MWY W;  1SYD A;  2D5D A;  4GOP B;  1XWE A;  4XDX A;  1K83 B;  4ZUI A;  3KDF A;  1JWS D;  3EQL C;  1VQH A;  4UDU C;  4FNF A;  1YNJ D;  3MXU A;  5C0X G;  2MHV A;  3IFT A;  3S14 B;  2RDF A;  3RMH A;  4A3I B;  3A7L A;  3IFD A;  4DV7 Q;  1PDQ A;  3CRK C;  4A3M G;  3MFG A;  3NK9 A;  1H95 A;  1C9O A;  4CDD C;  1DD2 A;  2NTS A;  1N9W A;  4U67 3;  1A3V A;  4QB4 A;  1SBB B;  1GHK A;  2E2H H;  4GNX B;  1IW7 C;  3OIP A;  4DUY Q;  1E2W A;  2WAQ E;  1CKO A;  3OW7 A;  4K2L A;  3VR6 A;  1JJC B;  4DXG A;  4LF5 L;  4OO1 G;  4YCW A;  1EQR A;  1F2M A;  1NTG A;  4HSV A;  1U4L A;  5M3F H;  1PRT D;  1DGS A;  2CVR A;  4Q0F A;  5CV6 A;  2F4V Q;  3K7U C;  4IJH A;  4HID A;  1Q81 C;  1TWA B;  3GTQ B;  4IUQ A;  4MZ9 A;  1VQ5 A;  4GN3 B;  4A3G G;  1B9N A;  2AUK A;  2GVA A;  4KK7 A;  4A3D H;  2F0G A;  3J7A 5;  5KNC A;  1O7I A;  4IUR A;  4A3F H;  3CD6 A;  3HOY G;  3T1H L;  2N8N A;  2CHB D;  1VQK A;  3TS2 A;  2RCF A;  1IBL Q;  1Q46 A;  2NZ1 D;  3SGI A;  3KYH C;  3HG9 A;  2L11 A;  2NZO A;  2F52 A;  3GV6 A;  2E2I B;  2BH2 A;  2I5H A;  4BY7 G;  1B1Z A;  1W3S A;  2K14 A;  1K83 H;  1Y8O B;  4F7X A;  2PPB C;  1EL0 A;  4YHH L;  3WWV A;  2NUC A;  1FGU A;  1RF2 D;  3MA2 B;  1P16 A;  1FYC A;  3S14 H;  4JPB W;  3RNU A;  4A3I H;  1VQD A;  2UXC L;  1II3 A;  1GHJ A;  2K05 A;  5FO9 B;  4PQX A;  1V8Q A;  3I2Z A;  1HHV A;  1G6Z A;  1U4M A;  5CV4 A;  2JA6 B;  1LTB D;  1SAP A;  4C56 C;  4G7Z C;  2OTL A;  2HQE A;  5CYU A;  1JB3 A;  4LFB Q;  1HXY D;  2B2U C;  1JCK B;  4QUF A;  4FO2 A;  5CV8 A;  5LL6 X;  1N33 L;  2L4N A;  2KVM A;  2YYZ A;  1ZYR D;  3K81 C;  1C0A A;  2P5Z X;  3FRP B;  3LWU A;  1STA A;  3P1H A;  2TSS A;  4J6H A;  2A69 D;  1STY A;  5IP7 H;  5ELC A;  3TP6 A;  1DM0 B;  4OHJ A;  4R4I A;  3OW2 A;  1BF4 A;  4JI8 L;  2M2L A;  1KIX A;  1C48 A;  4DV4 Q;  2Y0S G;  2JA5 G;  1MD2 D;  2EYL A;  1TWA H;  3GTQ H;  3HOW G;  2ZXR A;  5CV5 A;  3ZYY X;  3Q0A A;  1XPO A;  1LYL A;  1EOT A;  1GM5 A;  4RHS A;  4CDC C;  1S5B D;  1PFS A;  5EBC A;  1XXG A;  2A6H D;  4G7H C;  1AE3 A;  3GTM B;  1X3Q A;  1QNK A;  1VQO A;  4JI6 Q;  2RHQ B;  1Y1V B;  4KTA A;  2R93 H;  1ESF A;  2F0M A;  3G48 A;  4ME5 A;  1IKM A;  1QOH A;  2B8G A;  2WKD A;  2E2I H;  2F0D A;  5CMD A;  1IL8 A;  3PUY A;  2ZTE A;  4TSS A;  3CME A;  3S2H B;  1CHQ D;  1MGS A;  3D4R A;  2JK8 A;  5CBA E;  3PO2 B;  4YY3 L;  1XNR L;  3CRL C;  1CA6 A;  3PUW A;  1H9M A;  3FDT A;  3UI2 A; 
#chains in the Genus database with same CATH homology
 1SNM A;  4U68 A;  1KAA A;  4KKU A;  4WRD A;  1CI3 M;  4RCN A;  3V2T A;  4A3E B;  3DEO A;  2K5W A;  5I9P A;  4RHR A;  2H1E A;  3GTO B;  1LT6 D;  4QCL A;  3WOF A;  2F0J A;  3ND9 A;  1SE2 A;  3SXH A;  1KLG D;  1G2T A;  3D3R A;  1EY5 A;  3J7A F;  2EDG A;  3JAM L;  5JEA H;  1ZXT A;  3GQB A;  3DMU A;  4A3J B;  1GUG A;  2FJ2 A;  1C8C A;  4ZYS A;  5I2X A;  2NWG A;  4DA2 A;  2Q8R E;  1CQF A;  5BN5 A;  5I2Y A;  4CJ2 C;  4KKS A;  1EWH A;  5HGT A;  2ENB A;  1ET9 A;  1SE4 A;  2HUG A;  1S5F D;  2B2W A;  4DNT B;  4CHT B;  3K58 A;  3GV3 A;  2OF1 A;  2EYH A;  1HRJ A;  2AWO A;  4CJ1 B;  5K36 G;  5JJZ A;  1RCV D;  1RTO A;  1SXT A;  3S1M B;  1TWG B;  3KBX A;  2K32 A;  5COY A;  1DXM A;  3ITP A;  2SNM A;  1S5E D;  2KOL A;  2PO4 A;  4EVO A;  1HA5 A;  2CQA A;  1WVL A;  1Y1W B;  1W6K A;  4PV1 C;  1LAC A;  4BA1 I;  2EJF C;  3SK6 A;  2NVT B;  4ILW A;  3H91 A;  3T53 B;  4C3I G;  3H6M A;  1MI2 A;  4LK1 C;  3P75 A;  2AQ2 B;  3R3O A;  5FKA C;  1NSN S;  3TME A;  2JEA I;  1CZG A;  1AZQ A;  4M8A A;  2F0L A;  2G9H D;  1ET6 A;  3FVQ A;  2IWH A;  2KCN A;  3S16 B;  1JWM D;  5D3D A;  4WOR A;  1Q8I A;  2HCC A;  1HPC A;  5BN3 A;  2F0T A;  4Q5V A;  3I72 A;  1WD1 A;  4IUU A;  3SR1 A;  4TQU S;  4K2K A;  2NVQ B;  2KJX A;  4RAU C;  1QB5 D;  1RTN A;  3DWA A;  1EYD A;  2NN6 G;  1EZ8 A;  4DGZ A;  3WDN A;  4XT1 B;  4DXF A;  1DZ1 A;  5COR A;  4DAY A;  4C3H B;  3H3V C;  2B2U A;  1Y8P B;  3KBG A;  4F88 A;  1KDA A;  1STN A;  2VB2 X;  1TR5 A;  1F9S A;  3OWF A;  4PMB A;  5JOB A;  5DEH A;  3S1N B;  1LTS D;  4XYO A;  3A8K E;  3BDO A;  5KND A;  1A15 A;  1OO9 B;  1HFG A;  2Z4H A;  1OXV A;  1IKL A;  2JP1 A;  3AB9 A;  4OL7 A;  1TWC B;  4ZRZ A;  1H9J A;  2E75 C;  2B2T C;  1R4Q B;  5C44 B;  3K5O A;  3VYU A;  4H0L C;  2F0E A;  4EQO A;  3QWN A;  1D5M C;  5EKL A;  5C4Z A;  2WAQ B;  1OXS C;  2EPB A;  4RWS C;  2EYO A;  1TU2 B;  2EYP A;  2Z4I A;  1B2T A;  2TMP A;  4K14 A;  2SEB D;  4A3B B;  5K5P A;  2J0T D;  4BBS B;  1ILQ A;  2EJG C;  1SJH D;  2AWN A;  2K33 A;  1B3A A;  2RSN A;  2F0P A;  2EYJ A;  3LX0 A;  5FLX L;  3AU7 A;  1BDO A;  5JVG 3;  3ND8 A;  5IOD A;  1LTR D;  5JAV A;  3HZX A;  3DEP A;  1VDZ A;  1WTP A;  1DOM A;  5IGE A;  1JOR A;  2AQ1 B;  3NXW A;  2ICI A;  2J7Z A;  1LO5 D;  2B2Y C;  2KHS A;  4B9W A;  3RLF A;  4J8Q A;  4UAI A;  1SJE D;  1U4P A;  4A3K B;  2FFK B;  1GUS A;  5C5L A;  2WAC A;  3L3O C;  2MJ8 A;  1TS3 A;  1PRT F;  2X6L A;  2SOB A;  1FGB D;  4FXG C;  2C9O A;  1PLF A;  3LWE A;  4KY7 A;  2A73 B;  1Q1E A;  4KN4 C;  2K7V A;  3J7A V;  1SNQ A;  5C4X B;  2WIN B;  3L7Z C;  3C2P A;  1DON A;  2B2V C;  2H4O A;  1UUP A;  1A6X A;  1PTO C;  4QUC A;  3U9O A;  1TS4 A;  3BDL A;  2KEE A;  1QIL A;  2XSC A;  3H94 A;  4NP5 A;  3NTK A;  2F0I A;  1V1P B;  5IGF A;  2B8F A;  3LNN A;  2M9V A;  3VR3 A;  2IX1 A;  2XVS A;  4O42 A;  3HGB A;  1SYF A;  4MHE A;  3BG3 A;  3M7G A;  5D3I B;  3BVZ A;  3TP5 A;  1S4Z A;  4RGO S;  2CW0 D;  4ABN A;  1TS2 A;  2BE5 D;  2JE6 I;  1WD0 A;  2PW7 A;  2PYK A;  3TN2 A;  4HN7 A;  1HQM C;  1A2U A;  3HRZ C;  4YIJ A;  1BCP C;  3MXG A;  3NTI A;  2OT2 A;  2BCO A;  4K8J A;  1TS5 A;  2IT1 A;  1GUN A;  1HFN A;  2B63 B;  4A3D B;  2HDL A;  1AP0 A;  1A3U A;  3FPP A;  4C2M B;  1Q1B A;  1HCZ A;  4DN4 M;  1OXT A;  3I4L A;  3X3N A;  1J9O A;  1D1K A;  4B9X A;  2SDF A;  3VR2 A;  1WTX A;  3NE5 B;  4BS9 A;  1EQT A;  4HR7 B;  4RH6 A;  1C4Q A;  5IGB A;  1QCB D;  4OO1 H;  1I6H B;  1SFO B;  3K6O A;  1Q12 A;  2FIN B;  3A56 A;  4ZLT F;  3EA6 A;  4WFN 3;  2LY7 A;  4XQN A;  2JA5 B;  1SYB A;  4LJZ C;  2F0U A;  1WTO A;  3J7Y W;  2K6A A;  4X3T A;  2NVY B;  1TWF B;  2OXP A;  4I7Z C;  2B2T A;  4RGT A;  3A8I E;  2NBF A;  2JEB I;  4ID6 A;  1NAP A;  1EEF D;  4OGQ C;  5AFW A;  3KK7 A;  1SMY C;  4KY6 A;  5DAU A;  5FLX E;  1CA5 A;  2LS0 1;  4IN3 A;  3MC0 B;  1PZI D;  2F4I A;  3C1E A;  5JVH 3;  4O1N A;  4S3S A;  5LHY 1;  5M5Y B;  1XYI A;  2LKV A;  1JQY D;  2WKC A;  1RHP A;  3KUP A;  3I3C A;  4A93 B;  1JOO A;  1IYV A;  2NN6 I;  3QB3 A;  1BOS A;  3KLS X;  3M4O B;  5C6A A;  1LT5 D;  4XTC S;  2JSO A;  1DJR D;  3MHB A;  1ESR A;  2E2J B;  4HMJ A;  4XIG S;  2VNU D;  1VF5 C;  4MIU A;  5G3L D;  1T5E A;  4NDX A;  5KYL A;  1D6E C;  3OMG A;  2RKS A;  2LMC B;  1WTQ A;  4DFA A;  5FO7 B;  4C3J B;  5KGU A;  2DY7 A;  4WJW A;  1I4X A;  3QOJ A;  4BA2 I;  3IL8 A;  2EY5 A;  1DOK A;  2ZXO A;  1Y69 U;  5BN4 A;  3QIA A;  1A2T A;  1G91 A;  3OSO A;  4BY1 B;  1SSO A;  1B50 A;  3DM1 A;  2RSO A;  3K59 A;  5EGT A;  3FEW X;  1GXD C;  3P20 A;  1K8M A;  1E0B A;  3G7L A;  3TSS A;  5CC4 A;  2Z8L A;  2K5Q A;  3D6C A;  3K5N A;  2XNA C;  3I4N B;  3KF8 A;  1YNN D;  1MSG A;  1J8I A;  1X3P A;  4RGN A;  4QF4 A;  1EEI D;  4OIK A;  1EQV A;  1O7L A;  3RD4 A;  2EZV A;  3DUZ A;  1PRT B;  2F3W A;  3TP7 A;  4DNR B;  2F0F A;  1EY8 A;  4FF4 A;  1QNU A;  1AW7 A;  1EFI D;  4J1M A;  1IW7 D;  3X3M A;  4JBW A;  4XYQ A;  5LL6 S;  2JA8 B;  1KNA A;  3N6R A;  3H09 A;  3C46 A;  2KQ3 A;  4DK1 A;  3NP8 A;  3HOV B;  3M3Y B;  2D9U A;  1W6J A;  3SK8 A;  4NW2 A;  2R61 A;  3GTG B;  1TQO A;  4KV6 A;  1STE A;  2J4X A;  1GOZ A;  3OMC A;  3PUV A;  1R4P B;  2BOS A;  1CHP D;  1JR0 D;  3GTL B;  3ERO A;  5ELE A;  4G7O C;  4XQJ A;  4DK0 A;  4G57 A;  5KIX A;  3GD7 A;  5CV9 A;  3OHX C;  3GTK B;  4N9T A;  1M4V A;  1GUO A;  4X3U A;  5FO8 B;  1H9K A;  1B4O A;  5I6W A;  3D4W A;  3I90 A;  2NTT A;  1WTR A;  2QCP X;  1S5D D;  1JOK A;  2F1M A;  3A7A B;  5CGK A;  1G29 1;  1CM9 A;  1BR9 A;  3MEH A;  4CGY B;  3MAQ A;  1EY4 A;  5T1I A;  1LTI D;  4V19 0;  2DN8 A;  1VCI A;  3QO2 A;  1KAB A;  5I9O A;  4N9P A;  1ILP A;  2R3Z A;  4KD3 A;  2LFN A;  5KYI A;  1JC7 A;  3FMC A;  1F9R A;  2NN6 H;  3E5S A;  4P2C B;  1F2L A;  1MSH A;  3GP7 A;  1LTA D;  5FK9 C;  1D5Z C;  4CKE A;  4KY5 A;  4RCO A;  1QJO A;  3A54 A;  4FF2 A;  4CKC A;  2PZT A;  4F87 A;  1WTV A;  3Q6S A;  3FKI B;  4IFD I;  3Q22 A;  2XIW A;  1GUT A;  4RFB A;  5CV7 A;  1LTT D;  5KNB A;  4ZK9 B;  3EJI A;  5IGG A;  1SEB D;  2V4D A;  4CBV A;  5C0X I;  3NQT A;  3S1R B;  3NQI A;  4V0B A;  2PZW A;  3J81 L;  2PZU A;  3PO3 B;  1D1I A;  1XTC D;  1Y8N B;  2X69 A;  4ULL A;  1JWU D;  2E74 C;  4HAE A;  1KDB A;  2KEC A;  1CFM A;  4OO1 I;  2I46 A;  2MGS A;  1I50 B;  1I3Q B;  2PMZ B;  4K5W A;  5I6Y A;  3P7J A;  1LT4 D;  4OIJ A;  5JPM C;  1KLU D;  1RKN A;  2R93 B;  3S9W A;  4HMI A;  2R92 B;  1TT2 A;  1V43 A;  3QOL A;  1F2Y A;  1G8Z D;  1IHZ A;  2OEO A;  1Z47 A;  1B9M A;  4DAP A;  4CKB A;  1I4H A;  3JAM E;  3PUX A;  1OXX K;  3IAY A;  1ENA A;  1NR2 A;  1HTP A;  1EIG A;  3T16 A;  1NUC A;  2F3V A;  1M8A A;  1NR4 A;  4H44 C;  1I6V C;  2FHT A;  3VA5 A;  1TII D;  1YNJ C;  3CHB D;  3BZD B;  1PXU A;  2F0Q A;  2KED A;  4QMG A;  5IIF A;  1SYE A;  4RKL A;  2VUM B;  1BXT A;  1SYC A;  4RA8 A;  3A8J E;  5DNF A;  3W3A A;  4KHV A;  1AFP A;  3HOZ B;  1FD7 D;  2EY1 A;  3DWP A;  5E3F A;  2EXZ A;  3NBI A;  5FOB B;  1L0Y B;  3MXP A;  1PTO F;  1B44 D;  3T56 B;  5M5W B;  1CT1 D;  4L63 B;  2RVL A;  1G2S A;  4A3M B;  4L8J A;  5EKK A;  1EU3 A;  1H9S A;  2PNR C;  3K0Y A;  3HEJ A;  2YU9 B;  1CTM A;  1Q3L A;  4BWG B;  1BUV T;  2E76 C;  3EFX D;  2A6E C;  3EVQ A;  5ISR A;  3GTJ B;  1LT3 D;  3I4M B;  3PUZ A;  2IW3 A;  4C1N K;  4FYD A;  4ZUJ A;  5G3L F;  1LLR D;  1STB A;  3BYY B;  1QWY A;  1HTL D;  4K5V A;  4CJ0 B;  2Q8I B;  3TBI B;  2PCF B;  3V05 A;  1HUN A;  4A3G B;  2QKI C;  4RGM A;  2L9H A;  3A55 A;  2K04 A;  3TDQ A;  2EE1 A;  2EY6 A;  3I8Z A;  3HOY B;  4R8I A;  3ONA B;  3W2D A;  3SEB A;  4H7B A;  5EPJ A;  3K57 A;  1BCP F;  3VA7 A;  4IFD H;  1EWC A;  1PFN A;  2L55 A;  3SDZ A;  3RUZ A;  3ERQ A;  4BY7 B;  3TZU A;  3K5M A;  3MZ5 A;  4KJO A;  1X32 A;  3RZO B;  4E6I A;  5C0X H;  2HDM A;  2RQX A;  3J81 E;  1F9P A;  4Y7N B;  3I91 A;  1KDC A;  3GTP B;  1KNE A;  2RDH A;  1EIH A;  1V1O A;  2MUY A;  5IGD A;  1BO0 A;  2G9D A;  2A6H C;  2XWB B;  1LV9 A;  1ML0 D;  2RBM A;  1TVX A;  3Q23 A;  2BA0 A;  2PQE A;  3NUC A;  1UEA B;  1MBY A;  5EPL A;  2Y0S B;  4AYB B;  2N55 A;  2JYO A;  3HOW B;  3MFY A;  3R93 A;  3VYT A;  2IJ0 A;  4DAV A;  4K6L A;  1O7Z A;  4FXK C;  2L0C A;  3MVV A;  3D6W A;  3V96 A;  1GJX A;  1CQV A;  3R2I A;  4G4K A;  1JOQ A;  3MTS A;  3S2D B;  5A2Q L;  1FNU A;  3OIQ A;  1STH A;  1UNS A;  4KN7 C;  3GO5 A;  2K28 A;  2L5T A;  1Z6H A;  3NWT A;  3SK4 A;  1EYA A;  1PTO D;  1WTW A;  5C3X A;  2R6G A;  1PMR A;  4FP5 D;  5EKI A;  1BBX C;  4HCS A;  1FNW A;  2EVB A;  4XXE A;  3J80 L;  4MN3 A;  1ENC A;  2R7Z B;  2D62 A;  1ROD A;  2A6E D;  2BA1 A;  4KKT A;  1FNV A;  2WB1 B;  1EY6 A;  5C5M A;  1AZP A;  1E2V A;  5I4D A;  1DYQ A;  1HA6 A;  1HUM A;  4K5X A;  2SNS A;  4DU9 A;  4EGV A;  3C3L A;  2NYZ D;  3QG1 A;  2AUJ D;  2B2Y A;  1E2Z A;  3D4D A;  1EY9 A;  5IGC A;  3M4Y A;  1AN8 A;  2JA7 B;  4EQN A;  2RA4 A;  4FF1 A;  5TSS A;  3KLR A;  3SVM A;  5M5X B;  5JEA J;  3WOE A;  3CKI B;  1BCP D;  2N88 A;  1KTK A;  1EY0 A;  1RJT A;  4K8I A;  2B2V A;  5J39 A;  4HSP A;  4DF7 A;  4JK1 C;  1EY7 A;  4PMC A;  2VB3 X;  2WII B;  3NTH A;  3TP8 A;  2IX0 A;  5DM7 3;  2F0H A;  2QF7 A;  5M3M B;  3TZD A;  4I65 A;  3Q24 A;  2K5D A;  3CU7 A;  5EBD A;  1TY2 A;  1Q90 A;  2RDG A;  4XQQ A;  1TY0 A;  2A74 C;  4C3I B;  3PIP 3;  5EJW A;  4X3S A;  4RKB A;  2A68 C;  2KUM A;  3G6J B;  2FMM A;  4IUP A;  3SE0 A;  3D31 A;  2O5J C;  3HOX B;  2AQ3 B;  2IPK D;  5KRU A;  2L1B A;  1SNP A;  3BYT B;  1PTO B;  3T13 A;  1SNO A;  3M7N A;  5K36 H;  3SHL A;  1SMY D;  3I70 A;  5CR3 A;  3BVM A;  3NHH A;  2F0N A;  2M00 A;  2DY8 A;  3PV0 A;  4XT3 B;  4C3J G;  1EU4 A;  5EQ0 A;  1ZKO A;  1R9T B;  2BDN A;  2JXM B;  3CQZ B;  4FVM A;  1A3T A;  1S5C D;  5IT9 L;  4C1N I;  4BBR B;  1T5X D;  5D14 A;  2DNE A;  3VYR A;  4ZQ3 A;  1CZW A;  4R8N A;  3NBH A;  5JEA G;  2I07 B;  1OXU A;  5C3E B;  4X3K A;  2IX3 A;  4KHZ A;  5C4J B;  1PYW D;  2PW5 A;  1BCP B;  1ONL A;  4PMW A;  1STG A;  5A2Q E;  3E0J A;  2MP1 A;  1SNC A;  3H0G B;  2BDO A;  1O7Y A;  2QIL A;  3S15 B;  2EOT A;  1PTO H;  1QG7 A;  3AMU A;  1EYC A;  1I4P A;  2EYM A;  4IAL A;  3HOU B;  4TRD A;  4F8M A;  3K7A B;  3BS1 A;  1RDP D;  3J80 E;  3R8B A;  1D2B A;  2K03 A;  2O5I C;  3IKJ A;  3DXJ C;  5J22 A;  5JPN C;  1LTG D;  1GUW A;  1I4G A;  1PZJ D;  2NVX B;  3R2T A;  3O13 A;  4Z9C B;  3I73 A;  1O80 A;  1WCM B;  3S17 B;  3OPO A;  2VXW A;  3NSW A;  2EY2 A;  2F03 A;  2A68 D;  1TWH B;  2QDB A;  4LMQ D;  4IUT A;  3DWQ A;  3C1F A;  3VR5 A;  4L6T B;  3S1Q B;  5E4W C;  3PIO 3;  2EYF A;  5IOC A;  1SYG A;  1U9R A;  2CW0 C;  4NKL A;  2BE5 C;  2ICE C;  5DM6 3;  1IYU A;  3E6Z X;  1RD9 D;  1ICW A;  1EZ6 A;  1UAP A;  5KEE A;  1VMP A;  2Q8T A;  1D5X C;  4KD4 A;  3VR4 A;  3HKZ B;  4IUN A;  2IL8 A;  4ZKC B;  1FR3 A;  3SK5 A;  3N52 A;  4IQZ A;  3F2U A;  5J1Z A;  2E2D C;  2F0V A;  3MXN A;  3BDC A;  2WP8 J;  2K01 A;  2A5H A;  2F0W A;  2NB0 A;  1SE3 A;  3RZD B;  3NWS A;  3VYS A;  4NMZ A;  3D8G A;  1VMC A;  2C5C A;  1B53 A;  4R9W A;  3PMF A;  1PFB A;  2FMC A;  4KJN A;  1L0X B;  1PZK D;  2F0O A;  5ELB A;  1I4R A;  1V1P A;  1ENF A;  3U9S A;  1HQR D;  4IFD J;  5IT9 E;  4FXD A;  2XRQ D;  4EQP A;  3T51 B;  4ZKB B;  1TKW B;  2EJM A;  4C3H G;  2XRS D;  2Z1C A;  1JE4 A;  5C3W A;  5C0X J;  2KCC A;  2F0K A;  1PRT C;  3OWE B;  4ZAI A;  2X6G A;  4FF3 A;  1U4R A;  4HED A;  5EPK A;  4M1U B;  5D65 A;  5M9O A;  5ELF A;  2KA7 A;  5NUC A;  1K8O A;  1F2Z A;  3DHQ A;  1QE6 A;  1BNZ A;  1F9Q A;  1O78 A;  5T1G A;  5ELD A;  3BVG A;  4K6D A;  3HP3 A;  1DCZ A;  4KI0 A;  3OOC A;  1BQQ T;  2ZT9 C;  2XN9 C;  5A35 A;  4IUV A;  3HS0 C;  4KMU C;  5E4X A;  1ZYR C;  1JIC A;  1VF7 A;  2ZXP A;  2DNC A;  5CBE E;  1AEX A;  1SND A;  5C4H A;  3T4A C;  2K1B A;  4B08 A;  2B39 A;  1SDF A;  1Z7T A;  2E2H B;  4HTH A;  2XWJ B;  2A69 C;  1H9R A;  1XX8 A;  1LAB A;  1H9S B;  1ZEQ X;  1I4Q A;  3FPU B;  2F0S A;  1NCV A;  5F2D A;  2O2L D;  2WV6 D;  2O4X A;  4PNY A;  3L9A X;  1DOL A;  4GZY C;  5M3F B;  3URY A;  4ODG A;  3NPP A;  3KLS A;  3K5L A;  4HCE A;  2L12 A;  5E1F A;  2GA4 B;  1PFM A;  1F77 A;  4LAA A;  2QEJ C;  2MPM A;  4TKO B;  5HUR A;  4A3F B;  2ID0 A;  2HCI A;  4QIW B;  4H13 C;  1CK1 A;  3QJY A;  2B2W C;  4IFD G;  2D2C C;  4IZ8 A;  1YNN C;  3M85 A;  3MWY W;  1SYD A;  2D5D A;  1XWE A;  4XDX A;  1K83 B;  4ZUI A;  1JWS D;  3EQL C;  4UDU C;  4FNF A;  1YNJ D;  3MXU A;  5C0X G;  2MHV A;  3IFT A;  3S14 B;  2RDF A;  3RMH A;  4A3I B;  3A7L A;  3IFD A;  1PDQ A;  3CRK C;  3MFG A;  3NK9 A;  1DD2 A;  2NTS A;  4U67 3;  4QB4 A;  1A3V A;  1SBB B;  1GHK A;  1IW7 C;  3OIP A;  1E2W A;  3OW7 A;  4K2L A;  3VR6 A;  4DXG A;  4OO1 G;  1F2M A;  4HSV A;  1U4L A;  1PRT D;  2CVR A;  4Q0F A;  5CV6 A;  1TWA B;  3GTQ B;  4IUQ A;  1B9N A;  2AUK A;  4KK7 A;  2F0G A;  5KNC A;  4IUR A;  2CHB D;  2NZ1 D;  3HG9 A;  2L11 A;  3GV6 A;  2E2I B;  1B1Z A;  4F7X A;  2PPB C;  1Y8O B;  1EL0 A;  2NUC A;  1RF2 D;  3MA2 B;  1FYC A;  1II3 A;  1GHJ A;  2K05 A;  5FO9 B;  4PQX A;  1V8Q A;  1HHV A;  1G6Z A;  1U4M A;  5CV4 A;  2JA6 B;  1LTB D;  1SAP A;  4C56 C;  4G7Z C;  2HQE A;  5CYU A;  1JB3 A;  1HXY D;  2B2U C;  1JCK B;  4QUF A;  4FO2 A;  5CV8 A;  5LL6 X;  2L4N A;  2KVM A;  2YYZ A;  1ZYR D;  3FRP B;  3LWU A;  1STA A;  3P1H A;  2TSS A;  4J6H A;  2A69 D;  1STY A;  5ELC A;  3TP6 A;  1DM0 B;  4OHJ A;  1BF4 A;  2M2L A;  1C48 A;  1MD2 D;  2EYL A;  2ZXR A;  5CV5 A;  3ZYY X;  3Q0A A;  1EOT A;  4RHS A;  1S5B D;  5EBC A;  1XXG A;  2A6H D;  4G7H C;  3GTM B;  1X3Q A;  1QNK A;  1Y1V B;  4KTA A;  1ESF A;  2F0M A;  4ME5 A;  1IKM A;  1QOH A;  2B8G A;  2WKD A;  2F0D A;  5CMD A;  1IL8 A;  3PUY A;  4TSS A;  3S2H B;  1CHQ D;  1MGS A;  3D4R A;  5CBA E;  3PO2 B;  3CRL C;  1CA6 A;  3PUW A;  1H9M A;  3FDT A;  3UI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...