1DJRD

Heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl-alpha-d-galactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structure of m-carboxyphenyl-alpha-D-galactopyranoside complexed to heat-labile enterotoxin at 1.3 A resolution: surprising variations in ligand-binding modes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 30
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1djrD00
1FNUA 4L6TB 1TS3A 1B1ZA 1MD2D 1LT4D 1TY2A 1I4QA 2G9HD 3BVZA 3OWEB 5FK9C 4TSSA 1SBBB 4DXGA 4RGMA 3V05A 2J4XA 1SJED 1EWCA 1DYQA 3DWAA 1BCPF 1I4HA 1LO5D 3R8BA 4RGOS 1UUPA 3MC0B 1FNWA 1I4XA 1EU4A 3SEBA 5D3IB 1FGBD 1PRTB 1BCPC 1PTOF 1SE2A 5ELFA 1LLRD 3BZDB 1STEA 1PTOH 3BVMA 1EEFD 1PZID 3TSSA 3URYA 4RFBA 1ENFA 1JCKB 1S5BD 1RDPD 1KTKA 1S5CD 2XRQD 1D5MC 1D5ZC 2Z8LA 1LTSD 2AQ2B 1FD7D 1RF2D 1TS4A 3CHBD 1PTOC 1LT5D 3BYYB 1LTGD 1CT1D 1D6EC 3DWQA 4UDUC 4BWGB 1HA5A 1LT3D 3GP7A 4C56C 2AQ1B 4RCOA 1HXYD 5ELEA 1SJHD 1V1PA 3MFGA 2NTSA 4Z9CB 5D3DA 1ESFA 1PRTF 4L63B 3R2TA 1BCPD 1EFID 1BXTA 3DWPA 1KLUD 1S5FD 1RCVD 1QILA 1V1PB 2AQ3B 2WV6D 2QILA 4O1NA 1FNVA 3R2IA 4ZYSA 1UNSA 1LTRD 1PRTC 1I4PA 1PTOD 1LTTD 1XTCD 2SEBD 1SE4A 5ELDA 1CHQD 1T5XD 2R61A 3O13A 4DXFA 5TSSA 1TS2A 1JWMD 2IPKD 3BYTB 1EU3A 1D5XC 1L0YB 5I4DA 1JWSD 1LTID 1S5ED 1BCPB 1I4RA 2IJ0A 1LTAD 1I4GA 1F77A 3EFXD 2XNAC 1G8ZD 4K6LA 1CHPD 1GOZA 1PRTD 5ELCA 1EEID 1V1OA 1KLGD 2CHBD 3EA6A 1HQRD 1JWUD 1ET9A 1JQYD 1TS5A 1AN8A 1PYWD 4OHJA 1DJRD 1SXTA 2RDGA 2XN9C 3W2DA 4RGTA 2QEJC 2O2LD 2TSSA 1S5DD 1AW7A 1PZKD 2ICIA 4RHRA 1JR0D 1SEBD 3KLSX 4RGNA 1XXGA 1L0XB 1RD9D 2NTTA 2XRSD 4RHSA 1HTLD 1CQVA 1M4VA 1LTBD 5FKAC 1ET6A 2RDHA 5ELBA 1TY0A 1CK1A 1SE3A 3BVGA 1B44D 1PZJD 1LT6D 4RH6A 1PTOB
chains in the Genus database with same CATH superfamily
3MA2B 3I3CA 3I70A 2R92B 4ODGA 3FKIG 3Q24A 2RSNA 3OWEB 1E1TA 1A3TA 3BS1A 2B63G 3H91A 2JQOA 2UUAL 1K28A 1VQLA 5IYBH 5FLMH 1JE4A 3Q6SA 1HNZL 2GVAA 1SMYD 1Z9FA 2O5JC 3CQZB 1HPCA 4ZCKA 3SEBA 4HIMA 4LF4L 3J7AF 5CORA 1X55A 4OX9L 3M9BA 4X65L 1X56A 1WCMG 1N36L 3GTOB 1DONA 1VQJA 4HMJA 1KTKA 1MGSA 2R92H 1FD7D 3D6WA 2JYOA 3CRKC 2K5VA 5LHY1 1YJNA 3ND8A 1GUWA 2RCNA 3NQTA 4KY5A 2F0LA 4OL7A 4KKSA 3MFGA 4FF1A 1FJGL 3FKIB 1S3OA 2VUMB 3CQZH 2B63B 1TWFH 1SSOA 3EROA 4AYBE 4JYAQ 2HCIA 1K8OA 1GXDC 3GTOH 5LL6X 1N8RC 3R2IA 3CMEA 3RR5A 1D2BA 1AZPA 3QOLA 2N8NA 1GUGA 3CCSA 1HR0L 1WCMB 3BZCA 1GM5A 2CVRA 5BN4A 1PH6A 3J81j 5KNDA 4XXEA 4KKUA 2K33A 5COYA 2VUMH 4A3MG 1LTAD 2K4KA 1W3SA 1F77A 2D2CC 3M7GA 3TN2A 4B3SL 4OO1H 3FPUB 1VQBA 1GOZA 5F2DA 1JORA 1EEID 1DOKA 4IO9A 5LMNL 1E2VA 2L5TA 3DXJC 5JVG3 4GN3B 1BKBA 4OELB 1EQTA 4RKBA 3I4NB 4GNXA 5BR8Q 4UP7A 4YWLA 3HOVG 1XPRA 1X65A 1EIYB 2ZM6L 2VL6A 3MXUA 4YCUA 2A1AA 2OEOA 1OXTA 1L0XB 1IKMA 1PFSA 2KCCA 2ZT9C 5FLXc 5LMUL 1G291 1TR5A 2CWAA 3NE5B 5FKAC 4KTAA 1EIFA 2Z1CA 3EQLC 3OW2A 2C9OA 3MXGA 4A3MB 2OF1A 3I4NH 4BY7G 4JI1L 2HDMA 4C3HB 1VF7A 3E0JA 3ULPA 4IN3A 4CDCC 1C48A 2IX0A 1XWEA 4GNXC 4NMZA 3KLRA 1RTNA 1H9SB 1PH1A 3IFDA 5CV7A 1P16A 1GVPA 3IRBA 2YU9H 1ML0D 1QVGA 1GD7A 1WVLA 2HHHL 2Z4IA 5IIFA 3KF8A 3UDFA 1DGSA 4GZYC 4DA2A 3C2PA 1WTXA 4XIGS 4C3HH 4JG2A 4A3DG 1V1PA 4BY7B 2QGQA 1DD2A 4DV5Q 1VMCA 2QA4A 4C3IG 4DR4Q 5ELNA 3NBHB 4FF2A 3HFZB 1IBML 1IHZA 1QILA 2Y0SE 4XT3B 1PRTC 3UE0A 2KENA 3TREA 4DUZL 1X54A 1A6XA 2Q8RE 4DAVA 1CKNA 1DM0B 4X3KA 3K5NA 3CC4A 2SOBA 5GAHC 3HZXA 2R7DA 1I4GA 1EY7A 3M4PA 5FO8B 2HIVA 4A3DB 5EQ0A 3JAME 3EA6A 1JWUD 2KCTA 3OHXC 4X3TA 3CC2A 4WJ3M 2JXMB 1N33L 4BA2I 1GUOA 2UXCL 1HFGA 4YY3Q 3S1MB 4LF8Q 1XXGA 4H7BA 1T9HA 2E75C 2K28A 3T1HL 1BF4A 3VR3A 1YVCA 4EVOA 1SYFA 4R8IA 4B9XA 3S17B 2N3SA 1SE3A 3UE1A 3HOXB 1AP0A 4JI5Q 5FLXL 1FNUA 2VQEQ 4X6AH 1WTVA 4HJ5A 4YWMA 3D6CA 5FK9C 1TWGB 4JVZA 1PDQA 3NTKA 4KMUC 5GAGC 4TVAB 4LF5L 1BCPF 2EJMA 1FYCA 3R8BA 5CC4A 1ZXTA 4DAMA 1YHAA 1NCVA 1IBLL 3S17H 2VZAA 3HOXH 3RNUA 1IKLA 4JBJA 2BCOA 1Y14B 1JCKB 1UEBA 3H94A 4DAPA 3PUVA 1PXUA 1PTOC 2JE6I 1KDAA 1HRJA 3CCUA 2DGYA 4MIUA 3DWQA 1VQ4A 2JA5G 3CAMA 4HN7A 4I7ZC 1CFMA 1YNND 2X6LA 2CWPA 1SROA 2VW9A 3AEVA 1HNZQ 1X6OA 4G7ZC 4CDEC 4DR7L 1KLUD 1KL9A 4H13C 4LF4Q 1LTRD 3OTOL 4OX9Q 4A3BH 4X65Q 1R9TB 1N36Q 3NSWA 4A3IG 1A3VA 3ERQA 3G48A 5M3FB 1AEXA 2UU9L 5JPMC 2F4VL 2LSSA 4Y7NB 4A3EG 3OPOA 2KUMA 1ENAA 2BH2A 4F7XA 5KYIA 1VF5C 1VQ5A 3RLOA 3F2BA 4JCVE 5EGTA 1C9OA 1JC7A 5L37A 2K6AA 1O78A 3OIPA 2JA5B 5JOBA 4K6LA 2F0DA 5CBEE 4YCWA 1EY9A 1Y1VB 4AYBB 1R9TH 1O7IA 5M3FH 2O2LD 1QVFA 3HKZG 4TKOB 4Y7NH 4UP8A 1V43A 1SEBD 3KLSX 4JC0A 5C0XJ 1HR0Q 1SYBA 1HJPA 5GROA 4GN4B 1N34L 3I7FA 2FFKB 1LTBD 2NVTB 1ICWA 2A6EC 4A3EB 2K52A 1TY0A 1ZYRC 1B3QA 1Y1VH 4B3SQ 4CKBA 3E3XA 2K5NA 1F9RA 3IKJA 1NJIC 4PNYA 2PQEA 5LMNQ 2EVBA 2B2YA 1VQKA 4RGMA 2J4XA 1EWCA 1PFMA 2F0WA 4CBVA 2ENBA 2EYPA 1U5KA 2ZM6Q 1U4LA 4RGOS 4DNIA 4ZKCB 3HKZB 2NVTH 4A3EH 3PO2G 5GQOA 1PRTB 3PUZA 5LMUQ 3BZKA 3WDNA 4IFDG 1L0WA 1HUNA 1H9JA 3F8TA 3ICEA 2K7VA 1JOOA 1ESRA 3EIVA 3I56A 5HGTA 3CHBD 1TVXA 4FF3A 2FXQA 2E2JB 1KAWA 2P5ZX 1YHQA 2J7ZA 4GS3A 1V8QA 4JI1Q 4EQ5A 2K5WA 1QNUA 3GTQB 1BVSA 4L63B 1KD1C 4O2DA 2MO1A 3A74A 4R4OA 2B2YC 1K3BC 1V1PB 2AQ3B 3S16B 2CW0C 2NUCA 2FHTA 2WAQG 3PO2B 5NUCA 2KQ3A 4WJWA 4A76A 4KD4A 2E2JH 3ZJYC 3CCJA 2HHHQ 4GKJL 4XYOA 5DLQE 1JWSD 3VYSA 3BDLA 4R9WA 1YIJA 3GTQH 1H9MA 3E9IA 5J1ZA 3A0JA 4LMQD 5FO9B 3FMCA 1V1OA 1S72A 1IBMQ 1HQRD 1XNRL 3J81i 3PO2H 4JK1C 2KCNA 5KGUA 2LFNA 4IFDH 1RHPA 2WP8J 4DUZQ 2C35B 5FJ8H 2WAQB 1RD9D 2XRSD 2HDLA 2HQEA 2NWGA 4KHPL 3KJOA 3OMGA 2RDHA 1TWHH 3CU7A 2PZUA 3K8AA 5IT9E 1B44D 4DV4L 2B39A 1PTOB 1K0RA 4DV3L 1X9NA 1LV9A 2A68C 4L6TB 4NP5A 5KNBA 1G51A 1TIID 2A73B 3V05A 3Q8DA 3BDCA 1I4HA 1N33Q 5A2QL 2UXCQ 4U68A 2RBMA 2I5LX 1A15A 1HNWL 3I73A 5C4JH 1EU4A 3MEFA 4AIMA 3T1HQ 1FGBD 1HZ9A 2KEDA 3ZYYX 3RN5A 1PA6A 4LF6L 1G2SA 1PTOH 1KDBA 1EQVA 4JI0L 5E4XA 4N8FA 4F8MA 4C3JG 2QW7A 1TXYA 2NZ1D 5JJIA 4C56C 1H9SA 2ES2A 3ERSX 3GTJB 2B3GA 1K8AC 1HH2P 4LF5Q 1PRTF 4DR6L 5IGDA 4QJFA 1YNJC 3KYHC 4DNRB 1IBLQ 5T1IA 2IHEA 3L0OA 5JEAH 4DK3C 5HY6A 1LTTD 2LXJA 3NEMA 2L12A 4ULLA 2NVYB 4JI2L 3BYTB 1D5XC 3GTMH 4BA1I 5JAVA 4IALA 1STNA 1UE1A 3NK9A 4ABNA 3GTKB 3NBHA 1XTDA 3PUYA 2A19A 2JA8G 1GHJA 1WOCA 3EFXD 1A3UA 1Q1EA 1BBUA 4A3JG 3K0XA 3TDQA 1II3A 5IYCH 1JJCB 1IXRA 2CHBD 1M1KC 4DR7Q 2BE5D 1L1OA 4P2CB 1UE5A 1A0IA 5EPLA 2K03A 4JI4L 1PFBA 4HMIA 3IL8A 1KABA 1PH4A 3OTOQ 1R4PB 1S5DD 4L5TA 1CQFA 3QWNA 1CKMA 2IL8A 2UU9Q 1EY4A 2F4VQ 4IPGA 4WFN3 1BQQT 1QNKA 2N78A 5I6YA 1GJXA 5K5PA 1STBA 3GV3A 3LGJA 4CKCA 1KIXA 5EPKA 2RVLA 3A7LA 1EOVA 1CUKA 4B3RL 2HUGA 2IWHA 2IPKD 4DV1L 4IURA 3NHHA 3ONAB 5I2YA 2JA8B 3AB9A 1H9KA 1YZ6A 1NSNS 1YI2A 1B1ZA 1MD2D 3E9HA 4A3JB 1W6KA 4PMWA 1SNQA 4EX5A 1LYLA 2QDLA 3FP9A 2Z6BA 3J80E 4GOPB 4B08A 3KBXA 2IX1A 1WTHA 1LTLA 1Q46A 3J7YW 4DV6L 4B3TL 3VA7A 5DAUA 5GAEC 3U4VA 1N34Q 5KEEA 3HOYG 1W2BA 4UY8C 1PTOF 4HAEA 1WYDA 4MN3A 2NVQH 1D5ZC 5M5XB 5IP7G 3VR4A 5CR3A 1GHKA 1CSQA 1PV4A 1HQMC 5C5MA 2HCCA 2E2DC 1CM9A 1CT1D 1D6EC 3M4YA 3C1FA 2EYLA 1A2UA 3J81c 4BBSG 1HXYD 4OO1I 3SK6A 4BBRH 2D0PA 4BXXG 4IUVA 3HOUG 3EBEA 5E7NA 2QKIC 3A8JE 4FNFA 5CV5A 2PZTA 5C4ZA 3VR6A 2I07B 4L5QA 3ER0A 1QUQB 5IGGA 3K7UC 1I94L 2CQOA 4OEMB 3HOYB 2LKVA 2F4IA 4R1JA 4QCLA 4PV1C 1B3AA 1TS2A 5EKKA 4N9TA 2AHOB 1S5ED 1VQOA 5I2XA 2PPBC 3OYYA 3GO5A 3H09A 3H6MA 4BS9A 1VQ8A 4XQNA 4BBSB 1I6HB 2V4DA 3HKSA 5CYUA 2DNCA 4GKKL 3HOUB 2A69C 2C5CA 2Q8TA 3W2DA 3HOYH 2A74C 2F0PA 2QEJC 2L11A 1K0SA 3KF6A 2E76C 3H0GG 1MKHA 1AFPA 3VYUA 5FOBB 3VYTA 5IP7H 4GKJQ 1WJJA 5IE8A 3FKIH 1SMXA 1AH9A 1VQ6A 2G9DA 1EQQA 4OWXB 2B63H 1ONLA 4LF7L 5D14A 1NR2A 1GUTA 1YJ9A 2MO0A 2PW5A 4BBSH 3QB3A 3P7JA 1SR3A 3OIQA 5I4DA 3EN2A 3TMEA 1EUJA 2MFIA 4PZ8A 5IP9G 2VY3A 4K5XA 1XNRQ 1OXSC 1EFWA 1WCMH 2WIIB 5G3LF 1HZAA 5JVH3 3TP6A 3HKZE 3MAQA 1LO5D 1U4MA 1HZCA 1UUPA 5HURA 4F87A 3H0GB 4C1NK 3CC7A 4KHPQ 3GTPB 3GQBA 5ELFA 4I7AA 3FPPA 4FXDA 2KJXA 4G57A 4HR7B 4DV4Q 3T16A 1LTSD 1I3QB 1F9SA 4LUVA 4DV3Q 4ME5A 2NBFA 4BWGB 1BBWA 1LABA 1J6QA 1JE5A 4CJ1B 5D3DA 4J1MA 1C8CA 2ZXPA 3WOFA 3HOVB 1ASZA 1BXTA 3GTPH 1HNWQ 3I90A 2ALYB 2AWNA 3J81L 4LF6Q 2VB3X 3RD4A 4A3MH 1I3QH 2OCEA 1T5XD 2AKWB 3T53B 3PO3G 3P20A 2K14A 5FLXE 4JI0Q 1W6JA 2DY8A 4DV7Q 5ELOA 2F0NA 1CTMA 1G2TA 2F0KA 2R93G 1NUCA 3X3MA 3HOVH 4LFCL 3NPPA 5JJLA 2NB0A 1JJ2A 4PMCA 1VQ7A 4DR6Q 4LAAA 4JV5L 3RUZA 5C3XA 3JAMc 2MGSA 1PYWD 5C4XG 2RDGA 2B29A 4RGTA 3DMUA 2O4XA 2WAQE 3OWFA 5CBAE 4A4IA 1L1OB 1AE2A 3C3LA 3I8ZA 4OIJA 4F88A 4BY7H 3QIAA 3KK7A 3A8KE 3LWEA 2ATWA 3PO3B 4MZ9A 4HJAA 4RKLA 4G4KA 4H44C 2M9VA 1Y8NB 4RG1A 2FMMA 3S1QB 2CH4W 4M8AA 3NTHA 2ZTEA 2E5LL 1VQIA 2NN6G 1Z47A 4C3IB 1TY2A 2DNEA 1F2MA 1CSPA 1STYA 2RSOA 3CW2C 4JI4Q 1NAPA 2M2LA 2K50A 4LNQA 1IW7C 1JICA 2RHSB 2E8GA 3MXNB 4AH6A 2K01A 2K1BA 3F2DA 3PO3H 2KECA 3N6RA 1EYGA 3M4OB 4X64Q 4A3DH 1ENFA 3CCEA 3IFTA 5K36G 4B3RQ 1VQAA 4C3IH 4K2LA 4DV1Q 1VMPA 1GO3E 4IQZA 2PYKA 1BNZA 4G7OC 1NY4A 3S1MH 3PQIA 4KJNA 2PCFB 3RLNA 2A6HC 1U9RA 4FVMA 1B8AA 1QOHA 4JI6L 1H9RA 1J5EL 2F3IA 3K80C 4HIDA 3HOZG 1X32A 4DV6Q 4B3TQ 5KYLA 2EJGC 1HNXL 5DEHA 1U4PA 3M4OH 4DGZA 3I4MG 1AE3A 4IUNA 1Y8PB 2X69A 4JBKA 4A3KG 3TP5A 2YV5A 4NB3A 4JI7L 4IFDJ 4YHHL 1HHVA 1TWGH 3K59A 1EYCA 4M1UB 2QDBA 1I50B 3R3OA 5EKIA 1IYVA 2Q2UA 4UP9A 4CJ0B 3HEJA 2UUAQ 1O7LA 1O80A 3K5MA 2EY2A 2KEEA 3NXWA 3V2TA 2PMZB 5ELCA 4DU9A 1UE6A 3D4DA 4K8JA 1LUZA 5BN3A 1WTOA 3KJPA 1EY0A 2OWOA 3HOZB 2WINB 3HOWG 2OTJA 1WD0A 1I94Q 1PZKD 1STGA 3C46A 1I50H 4ALPA 1TQOA 3I4MB 2KCMA 4N8X1 4UHVA 3QR8A 4A3KB 1VQCA 1WTPA 3KF6B 1PH5A 4J15A 3JAML 5H1SE 4IPCA 4A93G 3GDEA 1ZYRD 2L9HA 1PH7A 2EOTA 3SGIA 3PUWA 4QY7A 3Q22A 1FJGQ 3GTLB 4DK6C 1B4OA 4A3FG 4K8IA 3VYRA 4QGUA 4NKLA 3HOZH 1JB7A 3L2PA 1G6ZA 1I4QA 4JBMA 5E4WC 4GKKQ 1E1OA 3M85A 4MHEA 3I4MH 4CKEA 3E6ZX 4A3KH 2F0TA 3N52A 4A3IB 4HTHA 5EBDA 4C1NI 2BH8A 2LXKA 1NMFA 2Z6KA 2JA5H 3VA5A 4BY1G 1UAPA 2EDGA 4LF7Q 1S5BD 5JEAJ 5I9OA 4A93B 1D7QA 4LUOA 5IY0A 1WD1A 5C44G 4JI8L 2UXBL 3CXCA 4GOPA 2JA7G 3A7AB 5J39A 1X3QA 2JEBI 3WWVA 4ZQ3A 3BYYB 4A3FB 4ZLTF 2ZTCA 4UDUC 2KBNA 1E2ZA 2AQ1B 4C2MB 2RCFA 5ELEA 5KNCA 4A3IH 4IOCA 1PH2A 2F0SA 2CW0D 3RN2A 2F0FA 4K0KL 4IFDI 1UNSA 4Q5VA 3QOJA 3CCMA 1I4PA 4L5SA 3J80i 3KFUA 4HSVA 4DK1A 5CMDA 2NZHA 1JWMD 1PYSB 1EIGA 2CQAA 2DUDA 2DJFC 4BY1B 2Z6KC 4P74A 1ENCA 4C2MH 4NXML 4N9PA 2YTYA 5C6AA 2Q2IA 2JA7B 1Q7YC 2JN4A 3BJUA 3KOJA 1QUQA 4GOPC 3U9OA 5M5YB 5A2QE 3Q23A 2IW3A 4HSPA 3LNNA 3P75A 3T1YL 3A5UA 1JQYD 1TS5A 1TWAB 2EYMA 2XN9C 2MUYA 2E74C 2FJ2A 3NP8A 1E7ZA 1JR0D 2N55A 1KNAA 1IYUA 4JYAL 5IWAL 3GD7A 1SN8A 3C1EA 3WOEA 4IPHA 4A3GG 4LFAL 2NYZD 3ULJA 2ZTDA 3G4SA 3BVGA 1SNCA 5T1GA 4LFCQ 2A68D 1MIUA 3S16H 5IT9c 4AQYL 5E3FA 1XMOL 4JV5Q 2A5HA 2WB1G 4JBWA 1STAA 1K3RA 4FYDA 2E2HB 3T13A 1R4QB 3W5OA 1QCBD 4DR5L 2ZJRA 3DEPA 2EE1A 2GVBA 5IGCA 4S3SA 4CJ2C 2R7ZG 1F2YA 3D3RA 3F1ZA 5D3IB 2L1BA 4X3SA 1Y1WG 3PIO3 2XVSA 5C0XG 3BVMA 1PZID 3OOCA 3TSSA 4DF7A 2MNAA 3CF5A 4R4IA 4A3GB 4UAIA 4ZUJA 3ITPA 3U50C 5M9OA 3RZOB 4R4CA 5C3WA 3K5LA 1LT5D 2GN5A 1EYAA 2E5LQ 2D0OA 4RMFA 2E2HH 3KLWA 1N9WA 1O7YA 3T56B 4A3CG 1B2TA 4RCOA 2WB1B 5DNFA 1VQ9A 2NTSA 1YNJD 4DR2L 2A8VA 1OXVA 2JA9A 1BCPD 4EQNA 2I5MX 1VQNA 4ZYSA 2R7ZB 3TP7A 5DM73 2ZXRA 1YJWA 1B53A 1CHQD 5JJKA 1Y1WB 1SYEA 2NZOA 5IYDG 2Z0SA 1KQSA 4DK0A 2BDOA 1Q81C 3ND9A 3SK5A 3H15A 1BUVT 4QIWB 1OXUA 1D1KA 1CA5A 2IX3A 3MHBA 2DY7A 1F2LA 1JB3A 4J8QA 2ZJQA 3TP8A 4JI6Q 1J8IA 1J5EQ 4X62L 2F0QA 1IYJB 2K5HA 5EPJA 1XYIA 2UXDL 1HNXQ 4B9WA 2R7ZH 4QB4A 3FRPB 2LS01 1Y1WH 1ICFB 3PIP3 1VQDA 4A3LG 5M3MG 3TZDA 4JI7Q 4L8JA 4YHHQ 2F1MA 5M5WB 4RHSA 1K9MC 1X3GA 3DM1A 1CQVA 3GTJH 3FVQA 1EY8A 4EGVA 3K57A 2K04A 2JK8A 1ET6A 4MTNA 3U9SA 5ELBA 5C4HA 4C3JB 5EJWA 1VS0A 4ID6A 4GLAC 4R8NA 3STBC 3CCVA 1LT4D 4PZ7A 2NVYH 2VQFL 2RDFA 3I4OA 3M3YB 1S40A 3PUXA 3GTKH 4HIKA 3J80c 1WTWA 1WI5A 4HCEA 2UUCL 5CV8A 5M3MB 3TS2A 3T51B 3IAYA 4LW1A 2B2UA 3S1NB 4C3JH 5JPNC 4X66L 2B8FA 1QJOA 5CV9A 4FF4A 2Z8LA 1DOMA 1RF2D 3PGZA 1A63A 4UPAA 3MXNA 2VXWA 1PH3A 3SDZA 2IY5B 3NENA 3M3YH 1EZ6A 4QQBX 4OIKA 2B2VA 2F0EA 3A8IE 1JT8A 1Q86C 1IL2A 3PMFA 3JAMi 1L1OC 5M3MH 1YEZA 3AFPA 4JI5L 5AJ3L 1SE8A 1K8MA 2EYFA 1ASYA 1I6VC 5DM63 2KHIA 2HD3A 2JA8H 1XTCD 4ZK9B 4FO2A 2BE5C 3O13A 1EYDA 4WORA 3AU7A 4A3JH 3D4RA 1EU3A 4JI8Q 2UXBQ 1D8LA 2B2UC 3SHLA 1Q8KA 2K05A 1NTGA 4HCSA 5EAYA 2XWBB 4DR3L 1Z7TA 2PMZE 1E24A 4O42A 1BR9A 1STHA 4Q0FA 1KRSA 2A69D 2BOSA 4RCNA 2JJQA 2RQXA 2BDNA 2B2VC 1AN8A 4K0KQ 5M5XH 1X3PA 1HFNA 2VUMG 4HJ9A 1AW7A 2WFWA 2SDFA 4OO1G 4KN4C 1HUMA 4LFBL 5JJZA 4IJHA 2EPBA 4KHZA 2H4OA 3PIOA 1GUSA 2EYOA 4PG3A 3I2ZA 4LJZC 4NXMQ 1TWFB 1EY6A 4QUCA 4HJ8A 3DM3A 1SDFA 1RODA 3DLLA 2F0HA 4CDFC 5A35A 1NMGA 2I46A 4ZKBB 5IOCA 4DUYL 2I0QA 2MP1A 1Q3LA 3T1YQ 1F2ZA 2FINB 1SBBB 1X3FA 3J81E 2HIXA 1OO9B 1T5EA 1VCIA 1FL0A 2KVMA 1DYQA 2DN8A 2F03A 1RJTA 3CD6A 4YCVA 4MTKA 1K83B 1BDOA 1S4ZA 1I4XA 2AUKA 4KN7C 4KK7A 3I4NG 5IWAQ 1P8LA 1MSHA 1SMYC 1L2FA 3BZDB 3J7AV 1STEA 4LFAQ 1I6HH 3URYA 5IGEA 1IBKL 1C7YA 4BXXH 2XRQD 1D5MC 3J80L 2NVXB 3HOUH 1XMQL 3CRLC 4AQYQ 3G6EA 1OTCA 3RMHA 1XMOQ 4JOIA 1VQFA 3CCRA 3NELA 4HIOA 3MZ5A 3TEHB 5IGBA 4K6DA 1NE3A 1SJHD 1K83H 3NWTA 2ID0A 3F2CA 2OQ0A 1Z6HA 4Z9CB 1ESFA 1RIPA 4DR5Q 4U673 4NW2A 2I5HA 2KOLA 4EQPA 1FVIA 2IHFA 3FHWA 5D65A 1EFID 3HRZC 4POFA 3SXHA 1RKNA 4Y52H 3PIPA 1SYGA 3NBIA 4C3HG 1K73C 3OSOA 4KI0A 2NVXH 4K5VA 1SLJA 2ICEC 5E1FA 4XQQA 3M4QA 1WFQA 4NPSA 2FMCA 4PQXA 4XT1B 4TQUS 1IL8A 2EY1A 1BCPB 1A2TA 1B50A 2PQAA 3H0GH 1BOSA 1DOLA 1B9NA 1NR4A 3KDFB 2WKDA 4DR2Q 4JOIC 1B7YB 1G8ZD 1PRTD 4JW0A 3F2UA 1KLGD 2YU9B 5CV4A 1ZEQX 1N32L 4XYQA 5GADC 1MSGA 2CCZA 1SAPA 3I91A 3V96A 4NDXA 2PZWA 3S2DB 1XJVA 1YBYA 4RHRA 4QUFA 2KHJA 3DUZA 1E2WA 3S14B 1MHWC 3CPFA 3CPWA 3CP0A 5IP9H 3TS0A 2EQSA 1PZJD 4PMBA 3P1HA 1EWHA 3TBIB 3DHQA 2YTVA 1PH8A 2XGTA 1ILQA 4X62Q 1EWIA 2RA4A 2UXDQ 1IW7D 3S2DH 5CV6A 3A55A 3OW7A 3DWAA 3X3NA 3S14H 4JI2Q 3R93A 3MTSA 3HP3A 3W1GA 1FNWA 1VQEA 3Q0AA 5J22A 1E22A 1NBWA 3B6YA 1M90C 1UWVA 4IOAA 3L7ZC 4GN5A 2R93B 2Z9HA 1QZGA 2NN6I 2F0GA 2A6HD 1HZBA 2WB1E 1PH9A 1EIHA 2QF7A 3HOXG 2SNSA 2IT1A 3D4WA 2MPMA 2VQFQ 5C4XB 2DJGC 1ILPA 1EOTA 4DAYB 1I5FA 5I6WA 4DV2L 1HR0W 3FEWX 2CFMA 3TQYA 1E3PA 2MHVA 1RCVD 2UUBL 2UUCQ 4DV0L 3S1QH 1XNQL 1PFNA 3TZUA 2R93H 3KLSA 1PTOD 2J0TD 2JEAI 2O5IC 2SEBD 5ELDA 4X66Q 4DXFA 4P75A 1V1QA 3S9WA 1SNOA 2TMPA 4QIWE 4POGA 1DZ1A 3MXPA 1XX8A 4QL5A 3VDYA 1PMRA 5CGKA 5C4XH 3D0FA 5LMNW 4A3BG 4YWKA 3OMCA 4K2KA 3U4ZA 3S2HB 1V9PA 1CZGA 2F52A 5IGFA 4FP5D 3SE0A 3PV0A 2AWOA 2F0OA 5AJ3Q 4L5RC 4OHJA 1SXTA 1SRUA 4I65A 2JSOA 3UDIA 3NUCA 3D31A 4KY6A 2E2IB 1O7ZA 1C4QA 4DFAA 1FGUA 3L9AX 4ZRZA 4IUQA 4OWWB 2NTTA 1QE6A 3PF5A 1KXLA 2NN6H 1HTLD 3S2HH 1YHBA 5M3FG 4B3ML 4LF9L 1QB5D 1TWCB 3PSIA 4DR3Q 3RZDB 1WTQA 1Q82C 1LT6D 1VDZA 4A3BB 2LMCB 4OXPA 3NWSA 3QJYA 4GLVB 3U58A 3SR1A 4RWSC 2MJ8A 1VQGA 1MBYA 1CKOA 3DEOA 2ZXOA 2E2IH 1TT2A 2B2TA 4DXGA 2K5QA 1D1IA 1SJED 4MNOA 5K36H 4QF4A 1Y1VG 2A6ED 4OONA 4AYBG 4HJ7A 1Q90A 4LFBQ 3MC0B 1EL0A 1QVCA 2EXZA 2R3ZA 4A75A 1UEAB 1TWCH 1IZ6A 3CKIB 1SE2A 3RZDH 1CZWA 4KV6A 1KHIA 3K0YA 1EEFD 2OQKA 2D62A 1S5CD 4H02A 2F0MA 4ZUIA 1KC8C 4IZ8A 4DUYQ 4CGYB 1HA6A 1LTGD 1EY5A 4NXNL 2XSCA 1JMCA 2OTLA 1JJGA 2F3WA 3UDGA 3GP7A 4KJOA 4ME3A 5G3LD 1J9OA 3HOWB 2V1CC 3KUPA 4DKAC 1A8VA 5KIXA 1KDCA 2K32A 5C3EG 1Y69U 1YNNC 3E0EA 3CMAA 2B2TC 4KLKA 3GTLH 2PI2E 1RL2A 4FXKC 2WV6D 1KNEA 1EQRA 4JI3L 2JA6G 2EY6A 2R61A 1IBKQ 2GA4B 1TU2B 5TSSA 2B8GA 1XMQQ 4KKTA 2X6GA 4JPBW 4RA8A 1HCZA 1LTID 4HEDA 4GNXB 1Q8IA 2XIWA 2HQLA 3HOWH 5FO7B 1VQHA 4DR1L 2XNAC 1E0BA 1RTOA 2PI2A 1FR3A 1DXMA 3H3VC 2Q2TA 2EZVA 3A5ZB 1AZQA 4R4QA 1LACA 2PQAB 4FXGC 2VNUD 4ILWA 4A93H 2OT2A 2PNRC 1DJRD 1F9QA 5C3EB 4RAUC 4V190 1M8AA 3EVQA 1HTPA 5J3BA 4A3FH 4ZAIA 2JA6B 1YITA 3S24A 5C44B 1EZ8A 2ASBA 3D8GA 3JC66 2WACA 3SVMA 2QCPX 3TRZA 5FJ8G 4RH6A 2L15A 3J7A5 2MQHA 1QWYA 5C3EH 1TS3A 1PVOA 1SYDA 1PLFA 3BVZA 2EXDA 1N32Q 4TSSA 3K5OA 1KAAA 4TRDA 4BY1H 2N88A 2JA6H 4IUTA 3GTGB 3BU2A 5C44H 3I55A 3KF8B 4EQOA 2QEXA 3NQIA 2JA7H 2Y0SG 4O0AA 3G7LA 3MEHA 4CDDC 1F9PA 5C5LA 2D5DA 3VR2A 1PYBA 5M5YH 2XWJB 3MWYW 2PW7A 3A54A 5I9PA 3MFYA 1TWAH 2AQ2B 3UI2A 4IJLA 1JOKA 1HA5A 1YNXA 2RKSA 3GTGH 1SYCA 2ZJPA 2YTXA 3SK4A 2Z4HA 2LY7A 2EIFA 1TWHB 1CKNB 4P71A 4WJ4A 5ISRA 1S5FD 2OXPA 1MJCA 3LX0A 1SNPA 4KHVA 3AYHB 3AMUA 2QILA 4O1NA 5BR8L 3CCLA 5C0XI 2G5DA 2Y0SB 5AFWA 4XTCS 1SE4A 4K14A 3UDXA 1A62A 2PO4A 4LWCA 2F0IA 1L0YB 1X3EA 3MVVA 4YIJA 1SNMA 1I4RA 5JEAG 3I4LA 1ZKOA 2BA1A 5C4JB 2IJ0A 2RHQB 5LL6S 4GLXA 3EJIA 2EYHA 2YYZA 1CHPD 3AFQA 4DV2Q 1B9MA 1ET9A 3G6JB 4V0BA 2UUBQ 4DV0Q 4A3GH 3QG1A 1XNQQ 3RZOH 2TSSA 3J7ZC 1VQMA 3RLFA 2AUJD 1C0AA 2M00A 2KA7A 4RGNA 1Q1BA 5IYCG 4P73A 3KDFA 2Q8IB 3S1RB 3T4AC 4DNTB 1XPOA 2Q2HA 3K81C 1BO0A 4IUUA 1CK1A 1H95A 2K75A 2K5DA 1LM0A 4H0LC 3STBD 5BN5A 3BG3A 1SNDA 3AQQA 5HGQA 1U4RA 4XQJA 4OGQC 1SFOB 2G9HD 2SNMA 4DN4M 4DV7L 2XTIA 3H3VI 3GTMB 1GKHA 1Y8OB 4DPGA 5C0XH 4DV5L 2PNHA 3NTIA 3I72A 3S1RH 1BBXC 4DR4L 2L4NA 5IODA 3M7NA 1CI3M 4KY7A 2R6GA 1MJEA 3K58A 3S15B 3FDTA 4FDBA 2VS1A 1BCPC 1OXXK 1CA6A 1LLRD 4A3CH 4B3MQ 4LF9Q 4RFBA 4PZ6A 1UE7A 1RDPD 3QO2A 2B2WA 1B70B 2H5XA 1SFOH 2H1EA 4K5WA 2HT1A 1TS4A 1MI2A 2EJFC 4OWTB 3SK8A 2RF4A 3K6OA 3HGBA 1LT3D 5M5WH 4J6HA 5IT9L 5EKLA 1VQPA 3PF4A 3W3AA 3R2TA 3S15H 5IYDH 1G91A 3DWPA 1XPUA 4IUPA 2AMCB 1TKWB 5EBCA 4CHTB 1FNVA 2VB2X 1K8GA 4G7HC 1Q12A 4IPDA 5IYBG 4BBRG 4YY3L 4X3UA 3G71A 4E6IA 5FLMG 4LF8L 1WTRA 1PHJA 2F0JA 3BDOA 1DCZA 4APVA 4DAYA 1GUNA 4R4TA 3ULLA 4NXNQ 3GV6A 3H3VH 2R7FA 1QG7A 2B2WC 5KRUA 4X64L 4A3LH 2R92G 2CKZB 2L0CA 3S1NH 2D9UA 2N49A 2VQEL 3K7AB 2F0VA 2NVQB 1NNXA 3A56A 3PCOB 4LUZA 2EYJA 3LWUA 4JI3Q 3KBGA 4P72A 3HS0C 4XDXA 4LK1C 2ICIA 1U0LA 2EY5A 1KRTA 3VR5A 2F0UA 2BA0A 4BBRB 1M4VA 4QMGA 2CH4A 3CCQA 1QZHA 3E5SA 3L3OC 2F3VA 3W1BA 2JP1A 3HG9A 4WRDA 1JOQA 4KD3A 3K7AH 1G6PA 2WKCA 4DR1Q 2L55A 2KHSA
chains in the Genus database with same CATH topology
3MA2B 3I3CA 3I70A 2R92B 4ODGA 3Q24A 2RSNA 3OWEB 1A3TA 3BS1A 3H91A 1JE4A 3Q6SA 2O5JC 1SMYD 3CQZB 1HPCA 3SEBA 3J7AF 5CORA 3GTOB 1DONA 4HMJA 1KTKA 1MGSA 1FD7D 3D6WA 2JYOA 3CRKC 5LHY1 3ND8A 1GUWA 3NQTA 4KY5A 2F0LA 4OL7A 4KKSA 3MFGA 4FF1A 3FKIB 2VUMB 2B63B 1SSOA 3EROA 2HCIA 1K8OA 1GXDC 5LL6X 3R2IA 1D2BA 1AZPA 3QOLA 1GUGA 1WCMB 2CVRA 5BN4A 5KNDA 4XXEA 4KKUA 2K33A 5COYA 1LTAD 3TN2A 1F77A 2D2CC 3M7GA 4OO1H 3FPUB 5F2DA 1GOZA 1JORA 1EEID 1DOKA 1E2VA 2L5TA 3DXJC 5JVG3 1EQTA 4RKBA 3I4NB 3MXUA 2OEOA 1OXTA 1L0XB 1IKMA 2KCCA 2ZT9C 1G291 1TR5A 3NE5B 5FKAC 4KTAA 2Z1CA 3EQLC 2C9OA 3MXGA 4A3MB 2OF1A 2HDMA 4C3HB 1VF7A 3E0JA 4IN3A 1C48A 2IX0A 1XWEA 4NMZA 3KLRA 1RTNA 1H9SB 3IFDA 5CV7A 1ML0D 1WVLA 2Z4IA 5IIFA 3KF8A 4GZYC 4DA2A 3C2PA 1WTXA 4XIGS 1V1PA 4BY7B 1DD2A 1VMCA 4C3IG 4FF2A 1IHZA 1QILA 4XT3B 1PRTC 1A6XA 2Q8RE 4DAVA 1DM0B 4X3KA 3K5NA 2SOBA 3HZXA 1I4GA 1EY7A 5FO8B 4A3DB 5EQ0A 3JAME 3EA6A 1JWUD 3OHXC 4X3TA 2JXMB 4BA2I 1GUOA 1HFGA 3S1MB 1XXGA 4H7BA 2K28A 2E75C 1BF4A 3VR3A 4EVOA 1SYFA 4R8IA 4B9XA 3S17B 1SE3A 3HOXB 1AP0A 5FLXL 1FNUA 1WTVA 3D6CA 5FK9C 1TWGB 1PDQA 3NTKA 4KMUC 1BCPF 2EJMA 1FYCA 3R8BA 5CC4A 1ZXTA 1NCVA 1IKLA 2BCOA 1JCKB 3H94A 4DAPA 3PUVA 1PXUA 1PTOC 2JE6I 1KDAA 1HRJA 4MIUA 3DWQA 4HN7A 4I7ZC 1CFMA 1YNND 2X6LA 4G7ZC 1KLUD 4H13C 1LTRD 1R9TB 3NSWA 1A3VA 3ERQA 5M3FB 1AEXA 5JPMC 4Y7NB 3OPOA 2KUMA 1ENAA 4F7XA 5KYIA 1VF5C 5EGTA 1JC7A 2K6AA 1O78A 3OIPA 2JA5B 5JOBA 4K6LA 2F0DA 5CBEE 1EY9A 1Y1VB 4AYBB 2O2LD 4TKOB 1V43A 1SEBD 3KLSX 5C0XJ 1SYBA 2FFKB 1LTBD 2NVTB 1ICWA 2A6EC 4A3EB 1TY0A 1ZYRC 4CKBA 1F9RA 3IKJA 4PNYA 2PQEA 2EVBA 2B2YA 4RGMA 2J4XA 1EWCA 1PFMA 2F0WA 4CBVA 2ENBA 2EYPA 1U4LA 4RGOS 4ZKCB 3HKZB 1PRTB 3PUZA 3WDNA 4IFDG 1HUNA 1H9JA 2K7VA 1JOOA 1ESRA 5HGTA 3CHBD 1TVXA 4FF3A 2E2JB 2J7ZA 1V8QA 2K5WA 1QNUA 3GTQB 4L63B 2B2YC 1V1PB 2AQ3B 3S16B 2CW0C 2NUCA 2FHTA 3PO2B 5NUCA 2KQ3A 4WJWA 4KD4A 4XYOA 1JWSD 3VYSA 3BDLA 4R9WA 1H9MA 5J1ZA 5FO9B 4LMQD 3FMCA 1V1OA 1HQRD 4JK1C 2KCNA 5KGUA 2LFNA 4IFDH 1RHPA 2WP8J 2WAQB 1RD9D 2XRSD 2HDLA 2HQEA 2NWGA 3OMGA 2RDHA 3CU7A 2PZUA 5IT9E 1B44D 2B39A 1PTOB 1LV9A 2A68C 4L6TB 4NP5A 5KNBA 1TIID 2A73B 3V05A 3BDCA 1I4HA 5A2QL 4U68A 2RBMA 1A15A 3I73A 1EU4A 1FGBD 2KEDA 3ZYYX 1G2SA 1PTOH 1KDBA 1EQVA 5E4XA 4F8MA 4C3JG 2NZ1D 4C56C 1H9SA 3GTJB 1PRTF 5IGDA 1YNJC 4DNRB 5T1IA 5JEAH 1LTTD 2L12A 4ULLA 2NVYB 3BYTB 1D5XC 4BA1I 5JAVA 4IALA 1STNA 3NK9A 3GTKB 4ABNA 3NBHA 3PUYA 1GHJA 3EFXD 1A3UA 1Q1EA 3TDQA 1II3A 2CHBD 2BE5D 4P2CB 5EPLA 2K03A 1PFBA 4HMIA 3IL8A 1KABA 1R4PB 1S5DD 1CQFA 3QWNA 2IL8A 1EY4A 4WFN3 1BQQT 1QNKA 5I6YA 1GJXA 5K5PA 1STBA 3GV3A 4CKCA 5EPKA 2RVLA 3A7LA 2HUGA 2IWHA 2IPKD 4IURA 3NHHA 3ONAB 5I2YA 2JA8B 3AB9A 1H9KA 1NSNS 1B1ZA 1MD2D 4A3JB 1W6KA 4PMWA 1SNQA 3J80E 4B08A 3KBXA 2IX1A 3J7YW 3VA7A 5DAUA 5KEEA 1PTOF 4HAEA 4MN3A 1D5ZC 5M5XB 3VR4A 5CR3A 1GHKA 1HQMC 5C5MA 2HCCA 2E2DC 1CM9A 1CT1D 1D6EC 3M4YA 3C1FA 2EYLA 1A2UA 4OO1I 1HXYD 3SK6A 4IUVA 2QKIC 3A8JE 4FNFA 5CV5A 2PZTA 5C4ZA 3VR6A 2I07B 5IGGA 3HOYB 2LKVA 2F4IA 4QCLA 4PV1C 1B3AA 1TS2A 5EKKA 4N9TA 1S5ED 5I2XA 2PPBC 3GO5A 3H09A 3H6MA 4BS9A 4XQNA 4BBSB 1I6HB 2V4DA 5CYUA 2DNCA 3HOUB 2A69C 2C5CA 2Q8TA 3W2DA 2A74C 2F0PA 2QEJC 2L11A 2E76C 1AFPA 3VYUA 5FOBB 3VYTA 2G9DA 1ONLA 5D14A 1NR2A 1GUTA 2PW5A 3QB3A 3P7JA 3OIQA 5I4DA 3TMEA 4K5XA 1OXSC 2WIIB 5G3LF 5JVH3 3TP6A 3MAQA 1LO5D 1U4MA 1UUPA 5HURA 4F87A 3H0GB 4C1NK 3GTPB 3GQBA 5ELFA 3FPPA 4FXDA 2KJXA 4G57A 4HR7B 3T16A 1LTSD 1I3QB 1F9SA 4ME5A 2NBFA 4BWGB 1LABA 4CJ1B 5D3DA 4J1MA 1C8CA 2ZXPA 3WOFA 3HOVB 1BXTA 3I90A 2AWNA 3J81L 2VB3X 3RD4A 1T5XD 3T53B 5FLXE 3P20A 1W6JA 2DY8A 2F0NA 1CTMA 1G2TA 2F0KA 1NUCA 3X3MA 3NPPA 2NB0A 4PMCA 4LAAA 3RUZA 5C3XA 2MGSA 1PYWD 2RDGA 4RGTA 3DMUA 2O4XA 3OWFA 5CBAE 3C3LA 3I8ZA 4OIJA 4F88A 3QIAA 3KK7A 3A8KE 3LWEA 3PO3B 4RKLA 4G4KA 4H44C 2M9VA 1Y8NB 3S1QB 2FMMA 4M8AA 3NTHA 2NN6G 1Z47A 4C3IB 1TY2A 2DNEA 1F2MA 1STYA 2RSOA 1NAPA 2M2LA 1IW7C 1JICA 2K01A 2K1BA 2KECA 3N6RA 3M4OB 1ENFA 5K36G 3IFTA 4K2LA 1VMPA 4IQZA 2PYKA 1BNZA 4G7OC 4KJNA 2PCFB 2A6HC 1U9RA 4FVMA 1QOHA 1H9RA 1X32A 5KYLA 2EJGC 5DEHA 1U4PA 4DGZA 4IUNA 1Y8PB 2X69A 3TP5A 4IFDJ 1HHVA 3K59A 1EYCA 4M1UB 2QDBA 1I50B 3R3OA 5EKIA 1IYVA 4CJ0B 3HEJA 1O7LA 1O80A 3K5MA 2EY2A 2KEEA 3NXWA 3V2TA 2PMZB 5ELCA 4DU9A 3D4DA 4K8JA 5BN3A 1WTOA 1EY0A 3HOZB 2WINB 1WD0A 1PZKD 1STGA 3C46A 3I4MB 1TQOA 4A3KB 1WTPA 3JAML 1ZYRD 2L9HA 2EOTA 3PUWA 3Q22A 3GTLB 1B4OA 4K8IA 3VYRA 4NKLA 1G6ZA 1I4QA 5E4WC 3M85A 4MHEA 4CKEA 3E6ZX 2F0TA 3N52A 4A3IB 4HTHA 5EBDA 4C1NI 3VA5A 1UAPA 2EDGA 1S5BD 5JEAJ 5I9OA 4A93B 1WD1A 3A7AB 5J39A 1X3QA 2JEBI 4ZQ3A 3BYYB 4A3FB 4ZLTF 4UDUC 1E2ZA 2AQ1B 4C2MB 5ELEA 5KNCA 2F0SA 2CW0D 2F0FA 4IFDI 1UNSA 4Q5VA 3QOJA 1I4PA 4HSVA 4DK1A 5CMDA 1JWMD 1EIGA 2CQAA 4BY1B 1ENCA 4N9PA 5C6AA 2JA7B 3U9OA 5M5YB 5A2QE 3Q23A 2IW3A 4HSPA 3LNNA 3P75A 1JQYD 1TS5A 1TWAB 2EYMA 2XN9C 2MUYA 2E74C 2FJ2A 3NP8A 1JR0D 2N55A 1KNAA 1IYUA 3GD7A 3C1EA 3WOEA 2NYZD 3BVGA 1SNCA 5T1GA 2A68D 5E3FA 2A5HA 4JBWA 1STAA 4FYDA 2E2HB 3T13A 1R4QB 1QCBD 3DEPA 2EE1A 5IGCA 4S3SA 4CJ2C 1F2YA 3D3RA 5D3IB 2L1BA 4X3SA 3PIO3 2XVSA 5C0XG 3BVMA 1PZID 3OOCA 3TSSA 4DF7A 4A3GB 4UAIA 4ZUJA 3ITPA 5M9OA 3RZOB 5C3WA 3K5LA 1LT5D 1EYAA 1O7YA 3T56B 1B2TA 4RCOA 2WB1B 5DNFA 2NTSA 1YNJD 1OXVA 4EQNA 1BCPD 4ZYSA 2R7ZB 3TP7A 5DM73 2ZXRA 1B53A 1CHQD 1Y1WB 1SYEA 4DK0A 2BDOA 3ND9A 3SK5A 1BUVT 4QIWB 1OXUA 1D1KA 1CA5A 2IX3A 3MHBA 2DY7A 1F2LA 1JB3A 4J8QA 3TP8A 1J8IA 2F0QA 5EPJA 1XYIA 4B9WA 4QB4A 3FRPB 2LS01 3PIP3 3TZDA 4L8JA 2F1MA 5M5WB 4RHSA 3DM1A 1CQVA 3FVQA 1EY8A 4EGVA 3K57A 2K04A 1ET6A 3U9SA 5ELBA 5C4HA 4C3JB 5EJWA 4ID6A 4R8NA 1LT4D 2RDFA 3M3YB 3PUXA 1WTWA 4HCEA 5CV8A 5M3MB 3T51B 3IAYA 2B2UA 3S1NB 5JPNC 2B8FA 1QJOA 5CV9A 4FF4A 2Z8LA 1DOMA 1RF2D 3MXNA 2VXWA 3SDZA 1EZ6A 4OIKA 2B2VA 2F0EA 3A8IE 3PMFA 1K8MA 2EYFA 1I6VC 5DM63 1XTCD 4ZK9B 4FO2A 2BE5C 3O13A 1EYDA 4WORA 3AU7A 3D4RA 1EU3A 2B2UC 3SHLA 2K05A 4HCSA 2XWBB 1Z7TA 4O42A 1BR9A 1STHA 4Q0FA 2A69D 2BOSA 4RCNA 2RQXA 2BDNA 2B2VC 1AN8A 1X3PA 1HFNA 1AW7A 2SDFA 4OO1G 4KN4C 1HUMA 5JJZA 2EPBA 4KHZA 2H4OA 1GUSA 2EYOA 4LJZC 1TWFB 1EY6A 4QUCA 1SDFA 1RODA 2F0HA 5A35A 2I46A 4ZKBB 5IOCA 2MP1A 1Q3LA 1F2ZA 2FINB 1SBBB 3J81E 1OO9B 1T5EA 1VCIA 2KVMA 1DYQA 2DN8A 2F03A 1RJTA 1K83B 1BDOA 1S4ZA 1I4XA 2AUKA 4KN7C 4KK7A 1MSHA 1SMYC 3BZDB 3J7AV 1STEA 3URYA 5IGEA 2XRQD 1D5MC 3J80L 2NVXB 3CRLC 3RMHA 3MZ5A 5IGBA 4K6DA 1SJHD 3NWTA 2ID0A 1Z6HA 4Z9CB 1ESFA 4U673 4NW2A 2KOLA 4EQPA 5D65A 1EFID 3HRZC 3SXHA 1RKNA 1SYGA 3NBIA 4C3HG 3OSOA 4KI0A 4K5VA 2ICEC 5E1FA 4XQQA 2FMCA 4PQXA 4XT1B 4TQUS 1IL8A 2EY1A 1BCPB 1A2TA 1B50A 1BOSA 1DOLA 1B9NA 1NR4A 2WKDA 1G8ZD 1PRTD 3F2UA 1KLGD 2YU9B 5CV4A 1ZEQX 4XYQA 1MSGA 1SAPA 3I91A 3V96A 4NDXA 2PZWA 3S2DB 4RHRA 4QUFA 3DUZA 1E2WA 3S14B 1PZJD 4PMBA 3P1HA 1EWHA 3TBIB 3DHQA 1ILQA 2RA4A 1IW7D 5CV6A 3A55A 3OW7A 3DWAA 3X3NA 3R93A 3MTSA 3HP3A 1FNWA 3Q0AA 5J22A 3L7ZC 2R93B 2NN6I 2F0GA 2A6HD 1EIHA 2QF7A 2SNSA 2IT1A 3D4WA 2MPMA 5C4XB 1ILPA 1EOTA 5I6WA 3FEWX 2MHVA 1RCVD 1PFNA 3TZUA 3KLSA 1PTOD 2J0TD 2JEAI 2O5IC 2SEBD 5ELDA 4DXFA 3S9WA 1SNOA 2TMPA 1DZ1A 3MXPA 1XX8A 1PMRA 5CGKA 3OMCA 4K2KA 3S2HB 1CZGA 5IGFA 4FP5D 3SE0A 3PV0A 2AWOA 2F0OA 4OHJA 1SXTA 4I65A 2JSOA 3NUCA 3D31A 4KY6A 2E2IB 1O7ZA 1C4QA 4DFAA 3L9AX 4ZRZA 4IUQA 2NTTA 1QE6A 2NN6H 1HTLD 1QB5D 1TWCB 3RZDB 1WTQA 1LT6D 1VDZA 4A3BB 2LMCB 3NWSA 3QJYA 3SR1A 4RWSC 2MJ8A 1MBYA 3DEOA 2ZXOA 1TT2A 2B2TA 4DXGA 2K5QA 1D1IA 1SJED 5K36H 4QF4A 2A6ED 1Q90A 3MC0B 1EL0A 2R3ZA 2EXZA 1UEAB 3CKIB 1SE2A 1CZWA 4KV6A 3K0YA 1EEFD 2D62A 1S5CD 2F0MA 4ZUIA 4IZ8A 4CGYB 1HA6A 1LTGD 1EY5A 2XSCA 2F3WA 3GP7A 4KJOA 5G3LD 1J9OA 3HOWB 3KUPA 5KIXA 1KDCA 2K32A 1Y69U 1YNNC 2B2TC 4FXKC 2WV6D 1KNEA 2EY6A 2R61A 2GA4B 1TU2B 5TSSA 2B8GA 4KKTA 2X6GA 4RA8A 1HCZA 1LTID 4HEDA 1Q8IA 2XIWA 5FO7B 2XNAC 1E0BA 1RTOA 1FR3A 1DXMA 3H3VC 2EZVA 1AZQA 1LACA 4FXGC 2VNUD 4ILWA 2OT2A 2PNRC 1DJRD 1F9QA 5C3EB 4RAUC 4V190 1M8AA 3EVQA 1HTPA 4ZAIA 2JA6B 5C44B 1EZ8A 3D8GA 2WACA 3SVMA 2QCPX 4RH6A 1QWYA 1TS3A 1SYDA 1PLFA 3BVZA 4TSSA 3K5OA 1KAAA 4TRDA 2N88A 4IUTA 3GTGB 4EQOA 3NQIA 3G7LA 3MEHA 1F9PA 5C5LA 2D5DA 3VR2A 2XWJB 3MWYW 2PW7A 3A54A 5I9PA 3MFYA 2AQ2B 3UI2A 1JOKA 1HA5A 2RKSA 1SYCA 3SK4A 2Z4HA 2LY7A 1TWHB 5ISRA 1S5FD 2OXPA 3LX0A 1SNPA 4KHVA 3AMUA 2QILA 4O1NA 5C0XI 2Y0SB 5AFWA 4XTCS 1SE4A 4K14A 2PO4A 2F0IA 1L0YB 3MVVA 4YIJA 1SNMA 1I4RA 5JEAG 3I4LA 1ZKOA 2BA1A 5C4JB 2IJ0A 5LL6S 3EJIA 2EYHA 2YYZA 1CHPD 1B9MA 1ET9A 3G6JB 4V0BA 3QG1A 2TSSA 3RLFA 2AUJD 2M00A 2KA7A 4RGNA 1Q1BA 2Q8IB 3S1RB 3T4AC 4DNTB 1BO0A 4IUUA 1CK1A 2K5DA 4H0LC 5BN5A 3BG3A 1SNDA 1U4RA 4XQJA 4OGQC 1SFOB 2G9HD 2SNMA 4DN4M 3GTMB 1Y8OB 5C0XH 3NTIA 3I72A 1BBXC 2L4NA 5IODA 3M7NA 1CI3M 4KY7A 2R6GA 3K58A 3S15B 3FDTA 1BCPC 1OXXK 1CA6A 1LLRD 4RFBA 1RDPD 3QO2A 2B2WA 2H1EA 4K5WA 1TS4A 1MI2A 2EJFC 3SK8A 3K6OA 3HGBA 1LT3D 4J6HA 5IT9L 5EKLA 3W3AA 3R2TA 1G91A 3DWPA 4IUPA 1TKWB 5EBCA 4CHTB 1FNVA 2VB2X 4G7HC 1Q12A 4X3UA 4E6IA 1WTRA 2F0JA 3BDOA 1DCZA 4DAYA 1GUNA 3GV6A 1QG7A 2B2WC 5KRUA 2L0CA 2D9UA 3K7AB 2F0VA 2NVQB 3A56A 2EYJA 3LWUA 3KBGA 3HS0C 4XDXA 4LK1C 2ICIA 2EY5A 3VR5A 2F0UA 2BA0A 4BBRB 1M4VA 4QMGA 3E5SA 3L3OC 2F3VA 2JP1A 3HG9A 4WRDA 1JOQA 4KD3A 2WKCA 2L55A 2KHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNU A;  4L6T B;  1TS3 A;  1B1Z A;  1MD2 D;  1LT4 D;  1TY2 A;  1I4Q A;  2G9H D;  3BVZ A;  3OWE B;  5FK9 C;  4TSS A;  1SBB B;  4DXG A;  4RGM A;  3V05 A;  2J4X A;  1SJE D;  1EWC A;  1DYQ A;  3DWA A;  1BCP F;  1I4H A;  1LO5 D;  3R8B A;  4RGO S;  1UUP A;  3MC0 B;  1FNW A;  1I4X A;  1EU4 A;  3SEB A;  5D3I B;  1FGB D;  1PRT B;  1BCP C;  1PTO F;  1SE2 A;  5ELF A;  1LLR D;  3BZD B;  1STE A;  1PTO H;  3BVM A;  1EEF D;  1PZI D;  3TSS A;  3URY A;  4RFB A;  1ENF A;  1JCK B;  1S5B D;  1RDP D;  1KTK A;  1S5C D;  2XRQ D;  1D5M C;  1D5Z C;  2Z8L A;  1LTS D;  2AQ2 B;  1FD7 D;  1RF2 D;  1TS4 A;  3CHB D;  1PTO C;  1LT5 D;  3BYY B;  1LTG D;  1CT1 D;  1D6E C;  3DWQ A;  4UDU C;  4BWG B;  1HA5 A;  1LT3 D;  3GP7 A;  4C56 C;  2AQ1 B;  4RCO A;  1HXY D;  5ELE A;  1SJH D;  1V1P A;  3MFG A;  2NTS A;  4Z9C B;  5D3D A;  1ESF A;  1PRT F;  4L63 B;  3R2T A;  1BCP D;  1EFI D;  1BXT A;  3DWP A;  1KLU D;  1S5F D;  1RCV D;  1QIL A;  1V1P B;  2AQ3 B;  2WV6 D;  2QIL A;  4O1N A;  1FNV A;  3R2I A;  4ZYS A;  1UNS A;  1LTR D;  1PRT C;  1I4P A;  1PTO D;  1LTT D;  1XTC D;  2SEB D;  1SE4 A;  5ELD A;  1CHQ D;  1T5X D;  2R61 A;  3O13 A;  4DXF A;  5TSS A;  1TS2 A;  1JWM D;  2IPK D;  3BYT B;  1EU3 A;  1D5X C;  1L0Y B;  5I4D A;  1JWS D;  1LTI D;  1S5E D;  1BCP B;  1I4R A;  2IJ0 A;  1LTA D;  1I4G A;  1F77 A;  3EFX D;  2XNA C;  1G8Z D;  4K6L A;  1CHP D;  1GOZ A;  1PRT D;  5ELC A;  1EEI D;  1V1O A;  1KLG D;  2CHB D;  3EA6 A;  1HQR D;  1JWU D;  1ET9 A;  1JQY D;  1TS5 A;  1AN8 A;  1PYW D;  4OHJ A;  1DJR D;  1SXT A;  2RDG A;  2XN9 C;  3W2D A;  4RGT A;  2QEJ C;  2O2L D;  2TSS A;  1S5D D;  1AW7 A;  1PZK D;  2ICI A;  4RHR A;  1JR0 D;  1SEB D;  3KLS X;  4RGN A;  1XXG A;  1L0X B;  1RD9 D;  2NTT A;  2XRS D;  4RHS A;  1HTL D;  1CQV A;  1M4V A;  1LTB D;  5FKA C;  1ET6 A;  2RDH A;  5ELB A;  1TY0 A;  1CK1 A;  1SE3 A;  3BVG A;  1B44 D;  1PZJ D;  1LT6 D;  4RH6 A;  1PTO B; 
#chains in the Genus database with same CATH topology
 3MA2 B;  3I3C A;  3I70 A;  2R92 B;  4ODG A;  3FKI G;  3Q24 A;  2RSN A;  3OWE B;  1E1T A;  1A3T A;  3BS1 A;  2B63 G;  3H91 A;  2JQO A;  2UUA L;  1K28 A;  1VQL A;  5IYB H;  5FLM H;  1JE4 A;  3Q6S A;  1HNZ L;  2GVA A;  1SMY D;  1Z9F A;  2O5J C;  3CQZ B;  1HPC A;  4ZCK A;  3SEB A;  4HIM A;  4LF4 L;  3J7A F;  5COR A;  1X55 A;  4OX9 L;  3M9B A;  4X65 L;  1X56 A;  1WCM G;  1N36 L;  3GTO B;  1DON A;  1VQJ A;  4HMJ A;  1KTK A;  1MGS A;  2R92 H;  1FD7 D;  3D6W A;  2JYO A;  3CRK C;  2K5V A;  5LHY 1;  1YJN A;  3ND8 A;  1GUW A;  2RCN A;  3NQT A;  4KY5 A;  2F0L A;  4OL7 A;  4KKS A;  3MFG A;  4FF1 A;  1FJG L;  3FKI B;  1S3O A;  2VUM B;  3CQZ H;  2B63 B;  1TWF H;  1SSO A;  3ERO A;  4AYB E;  4JYA Q;  2HCI A;  1K8O A;  1GXD C;  3GTO H;  5LL6 X;  1N8R C;  3R2I A;  3CME A;  3RR5 A;  1D2B A;  1AZP A;  3QOL A;  2N8N A;  1GUG A;  3CCS A;  1HR0 L;  1WCM B;  3BZC A;  1GM5 A;  2CVR A;  5BN4 A;  1PH6 A;  3J81 j;  5KND A;  4XXE A;  4KKU A;  2K33 A;  5COY A;  2VUM H;  4A3M G;  1LTA D;  2K4K A;  1W3S A;  1F77 A;  2D2C C;  3M7G A;  3TN2 A;  4B3S L;  4OO1 H;  3FPU B;  1VQB A;  1GOZ A;  5F2D A;  1JOR A;  1EEI D;  1DOK A;  4IO9 A;  5LMN L;  1E2V A;  2L5T A;  3DXJ C;  5JVG 3;  4GN3 B;  1BKB A;  4OEL B;  1EQT A;  4RKB A;  3I4N B;  4GNX A;  5BR8 Q;  4UP7 A;  4YWL A;  3HOV G;  1XPR A;  1X65 A;  1EIY B;  2ZM6 L;  2VL6 A;  3MXU A;  4YCU A;  2A1A A;  2OEO A;  1OXT A;  1L0X B;  1IKM A;  1PFS A;  2KCC A;  2ZT9 C;  5FLX c;  5LMU L;  1G29 1;  1TR5 A;  2CWA A;  3NE5 B;  5FKA C;  4KTA A;  1EIF A;  2Z1C A;  3EQL C;  3OW2 A;  2C9O A;  3MXG A;  4A3M B;  2OF1 A;  3I4N H;  4BY7 G;  4JI1 L;  2HDM A;  4C3H B;  1VF7 A;  3E0J A;  3ULP A;  4IN3 A;  4CDC C;  1C48 A;  2IX0 A;  1XWE A;  4GNX C;  4NMZ A;  3KLR A;  1RTN A;  1H9S B;  1PH1 A;  3IFD A;  5CV7 A;  1P16 A;  1GVP A;  3IRB A;  2YU9 H;  1ML0 D;  1QVG A;  1GD7 A;  1WVL A;  2HHH L;  2Z4I A;  5IIF A;  3KF8 A;  3UDF A;  1DGS A;  4GZY C;  4DA2 A;  3C2P A;  1WTX A;  4XIG S;  4C3H H;  4JG2 A;  4A3D G;  1V1P A;  4BY7 B;  2QGQ A;  1DD2 A;  4DV5 Q;  1VMC A;  2QA4 A;  4C3I G;  4DR4 Q;  5ELN A;  3NBH B;  4FF2 A;  3HFZ B;  1IBM L;  1IHZ A;  1QIL A;  2Y0S E;  4XT3 B;  1PRT C;  3UE0 A;  2KEN A;  3TRE A;  4DUZ L;  1X54 A;  1A6X A;  2Q8R E;  4DAV A;  1CKN A;  1DM0 B;  4X3K A;  3K5N A;  3CC4 A;  2SOB A;  5GAH C;  3HZX A;  2R7D A;  1I4G A;  1EY7 A;  3M4P A;  5FO8 B;  2HIV A;  4A3D B;  5EQ0 A;  3JAM E;  3EA6 A;  1JWU D;  2KCT A;  3OHX C;  4X3T A;  3CC2 A;  4WJ3 M;  2JXM B;  1N33 L;  4BA2 I;  1GUO A;  2UXC L;  1HFG A;  4YY3 Q;  3S1M B;  4LF8 Q;  1XXG A;  4H7B A;  1T9H A;  2E75 C;  2K28 A;  3T1H L;  1BF4 A;  3VR3 A;  1YVC A;  4EVO A;  1SYF A;  4R8I A;  4B9X A;  3S17 B;  2N3S A;  1SE3 A;  3UE1 A;  3HOX B;  1AP0 A;  4JI5 Q;  5FLX L;  1FNU A;  2VQE Q;  4X6A H;  1WTV A;  4HJ5 A;  4YWM A;  3D6C A;  5FK9 C;  1TWG B;  4JVZ A;  1PDQ A;  3NTK A;  4KMU C;  5GAG C;  4TVA B;  4LF5 L;  1BCP F;  2EJM A;  1FYC A;  3R8B A;  5CC4 A;  1ZXT A;  4DAM A;  1YHA A;  1NCV A;  1IBL L;  3S17 H;  2VZA A;  3HOX H;  3RNU A;  1IKL A;  4JBJ A;  2BCO A;  1Y14 B;  1JCK B;  1UEB A;  3H94 A;  4DAP A;  3PUV A;  1PXU A;  1PTO C;  2JE6 I;  1KDA A;  1HRJ A;  3CCU A;  2DGY A;  4MIU A;  3DWQ A;  1VQ4 A;  2JA5 G;  3CAM A;  4HN7 A;  4I7Z C;  1CFM A;  1YNN D;  2X6L A;  2CWP A;  1SRO A;  2VW9 A;  3AEV A;  1HNZ Q;  1X6O A;  4G7Z C;  4CDE C;  4DR7 L;  1KLU D;  1KL9 A;  4H13 C;  4LF4 Q;  1LTR D;  3OTO L;  4OX9 Q;  4A3B H;  4X65 Q;  1R9T B;  1N36 Q;  3NSW A;  4A3I G;  1A3V A;  3ERQ A;  3G48 A;  5M3F B;  1AEX A;  2UU9 L;  5JPM C;  2F4V L;  2LSS A;  4Y7N B;  4A3E G;  3OPO A;  2KUM A;  1ENA A;  2BH2 A;  4F7X A;  5KYI A;  1VF5 C;  1VQ5 A;  3RLO A;  3F2B A;  4JCV E;  5EGT A;  1C9O A;  1JC7 A;  5L37 A;  2K6A A;  1O78 A;  3OIP A;  2JA5 B;  5JOB A;  4K6L A;  2F0D A;  5CBE E;  4YCW A;  1EY9 A;  1Y1V B;  4AYB B;  1R9T H;  1O7I A;  5M3F H;  2O2L D;  1QVF A;  3HKZ G;  4TKO B;  4Y7N H;  4UP8 A;  1V43 A;  1SEB D;  3KLS X;  4JC0 A;  5C0X J;  1HR0 Q;  1SYB A;  1HJP A;  5GRO A;  4GN4 B;  1N34 L;  3I7F A;  2FFK B;  1LTB D;  2NVT B;  1ICW A;  2A6E C;  4A3E B;  2K52 A;  1TY0 A;  1ZYR C;  1B3Q A;  1Y1V H;  4B3S Q;  4CKB A;  3E3X A;  2K5N A;  1F9R A;  3IKJ A;  1NJI C;  4PNY A;  2PQE A;  5LMN Q;  2EVB A;  2B2Y A;  1VQK A;  4RGM A;  2J4X A;  1EWC A;  1PFM A;  2F0W A;  4CBV A;  2ENB A;  2EYP A;  1U5K A;  2ZM6 Q;  1U4L A;  4RGO S;  4DNI A;  4ZKC B;  3HKZ B;  2NVT H;  4A3E H;  3PO2 G;  5GQO A;  1PRT B;  3PUZ A;  5LMU Q;  3BZK A;  3WDN A;  4IFD G;  1L0W A;  1HUN A;  1H9J A;  3F8T A;  3ICE A;  2K7V A;  1JOO A;  1ESR A;  3EIV A;  3I56 A;  5HGT A;  3CHB D;  1TVX A;  4FF3 A;  2FXQ A;  2E2J B;  1KAW A;  2P5Z X;  1YHQ A;  2J7Z A;  4GS3 A;  1V8Q A;  4JI1 Q;  4EQ5 A;  2K5W A;  1QNU A;  3GTQ B;  1BVS A;  4L63 B;  1KD1 C;  4O2D A;  2MO1 A;  3A74 A;  4R4O A;  2B2Y C;  1K3B C;  1V1P B;  2AQ3 B;  3S16 B;  2CW0 C;  2NUC A;  2FHT A;  2WAQ G;  3PO2 B;  5NUC A;  2KQ3 A;  4WJW A;  4A76 A;  4KD4 A;  2E2J H;  3ZJY C;  3CCJ A;  2HHH Q;  4GKJ L;  4XYO A;  5DLQ E;  1JWS D;  3VYS A;  3BDL A;  4R9W A;  1YIJ A;  3GTQ H;  1H9M A;  3E9I A;  5J1Z A;  3A0J A;  4LMQ D;  5FO9 B;  3FMC A;  1V1O A;  1S72 A;  1IBM Q;  1HQR D;  1XNR L;  3J81 i;  3PO2 H;  4JK1 C;  2KCN A;  5KGU A;  2LFN A;  4IFD H;  1RHP A;  2WP8 J;  4DUZ Q;  2C35 B;  5FJ8 H;  2WAQ B;  1RD9 D;  2XRS D;  2HDL A;  2HQE A;  2NWG A;  4KHP L;  3KJO A;  3OMG A;  2RDH A;  1TWH H;  3CU7 A;  2PZU A;  3K8A A;  5IT9 E;  1B44 D;  4DV4 L;  2B39 A;  1PTO B;  1K0R A;  4DV3 L;  1X9N A;  1LV9 A;  2A68 C;  4L6T B;  4NP5 A;  5KNB A;  1G51 A;  1TII D;  2A73 B;  3V05 A;  3Q8D A;  3BDC A;  1I4H A;  1N33 Q;  5A2Q L;  2UXC Q;  4U68 A;  2RBM A;  2I5L X;  1A15 A;  1HNW L;  3I73 A;  5C4J H;  1EU4 A;  3MEF A;  4AIM A;  3T1H Q;  1FGB D;  1HZ9 A;  2KED A;  3ZYY X;  3RN5 A;  1PA6 A;  4LF6 L;  1G2S A;  1PTO H;  1KDB A;  1EQV A;  4JI0 L;  5E4X A;  4N8F A;  4F8M A;  4C3J G;  2QW7 A;  1TXY A;  2NZ1 D;  5JJI A;  4C56 C;  1H9S A;  2ES2 A;  3ERS X;  3GTJ B;  2B3G A;  1K8A C;  1HH2 P;  4LF5 Q;  1PRT F;  4DR6 L;  5IGD A;  4QJF A;  1YNJ C;  3KYH C;  4DNR B;  1IBL Q;  5T1I A;  2IHE A;  3L0O A;  5JEA H;  4DK3 C;  5HY6 A;  1LTT D;  2LXJ A;  3NEM A;  2L12 A;  4ULL A;  2NVY B;  4JI2 L;  3BYT B;  1D5X C;  3GTM H;  4BA1 I;  5JAV A;  4IAL A;  1STN A;  1UE1 A;  3NK9 A;  4ABN A;  3GTK B;  3NBH A;  1XTD A;  3PUY A;  2A19 A;  2JA8 G;  1GHJ A;  1WOC A;  3EFX D;  1A3U A;  1Q1E A;  1BBU A;  4A3J G;  3K0X A;  3TDQ A;  1II3 A;  5IYC H;  1JJC B;  1IXR A;  2CHB D;  1M1K C;  4DR7 Q;  2BE5 D;  1L1O A;  4P2C B;  1UE5 A;  1A0I A;  5EPL A;  2K03 A;  4JI4 L;  1PFB A;  4HMI A;  3IL8 A;  1KAB A;  1PH4 A;  3OTO Q;  1R4P B;  1S5D D;  4L5T A;  1CQF A;  3QWN A;  1CKM A;  2IL8 A;  2UU9 Q;  1EY4 A;  2F4V Q;  4IPG A;  4WFN 3;  1BQQ T;  1QNK A;  2N78 A;  5I6Y A;  1GJX A;  5K5P A;  1STB A;  3GV3 A;  3LGJ A;  4CKC A;  1KIX A;  5EPK A;  2RVL A;  3A7L A;  1EOV A;  1CUK A;  4B3R L;  2HUG A;  2IWH A;  2IPK D;  4DV1 L;  4IUR A;  3NHH A;  3ONA B;  5I2Y A;  2JA8 B;  3AB9 A;  1H9K A;  1YZ6 A;  1NSN S;  1YI2 A;  1B1Z A;  1MD2 D;  3E9H A;  4A3J B;  1W6K A;  4PMW A;  1SNQ A;  4EX5 A;  1LYL A;  2QDL A;  3FP9 A;  2Z6B A;  3J80 E;  4GOP B;  4B08 A;  3KBX A;  2IX1 A;  1WTH A;  1LTL A;  1Q46 A;  3J7Y W;  4DV6 L;  4B3T L;  3VA7 A;  5DAU A;  5GAE C;  3U4V A;  1N34 Q;  5KEE A;  3HOY G;  1W2B A;  4UY8 C;  1PTO F;  4HAE A;  1WYD A;  4MN3 A;  2NVQ H;  1D5Z C;  5M5X B;  5IP7 G;  3VR4 A;  5CR3 A;  1GHK A;  1CSQ A;  1PV4 A;  1HQM C;  5C5M A;  2HCC A;  2E2D C;  1CM9 A;  1CT1 D;  1D6E C;  3M4Y A;  3C1F A;  2EYL A;  1A2U A;  3J81 c;  4BBS G;  1HXY D;  4OO1 I;  3SK6 A;  4BBR H;  2D0P A;  4BXX G;  4IUV A;  3HOU G;  3EBE A;  5E7N A;  2QKI C;  3A8J E;  4FNF A;  5CV5 A;  2PZT A;  5C4Z A;  3VR6 A;  2I07 B;  4L5Q A;  3ER0 A;  1QUQ B;  5IGG A;  3K7U C;  1I94 L;  2CQO A;  4OEM B;  3HOY B;  2LKV A;  2F4I A;  4R1J A;  4QCL A;  4PV1 C;  1B3A A;  1TS2 A;  5EKK A;  4N9T A;  2AHO B;  1S5E D;  1VQO A;  5I2X A;  2PPB C;  3OYY A;  3GO5 A;  3H09 A;  3H6M A;  4BS9 A;  1VQ8 A;  4XQN A;  4BBS B;  1I6H B;  2V4D A;  3HKS A;  5CYU A;  2DNC A;  4GKK L;  3HOU B;  2A69 C;  2C5C A;  2Q8T A;  3W2D A;  3HOY H;  2A74 C;  2F0P A;  2QEJ C;  2L11 A;  1K0S A;  3KF6 A;  2E76 C;  3H0G G;  1MKH A;  1AFP A;  3VYU A;  5FOB B;  3VYT A;  5IP7 H;  4GKJ Q;  1WJJ A;  5IE8 A;  3FKI H;  1SMX A;  1AH9 A;  1VQ6 A;  2G9D A;  1EQQ A;  4OWX B;  2B63 H;  1ONL A;  4LF7 L;  5D14 A;  1NR2 A;  1GUT A;  1YJ9 A;  2MO0 A;  2PW5 A;  4BBS H;  3QB3 A;  3P7J A;  1SR3 A;  3OIQ A;  5I4D A;  3EN2 A;  3TME A;  1EUJ A;  2MFI A;  4PZ8 A;  5IP9 G;  2VY3 A;  4K5X A;  1XNR Q;  1OXS C;  1EFW A;  1WCM H;  2WII B;  5G3L F;  1HZA A;  5JVH 3;  3TP6 A;  3HKZ E;  3MAQ A;  1LO5 D;  1U4M A;  1HZC A;  1UUP A;  5HUR A;  4F87 A;  3H0G B;  4C1N K;  3CC7 A;  4KHP Q;  3GTP B;  3GQB A;  5ELF A;  4I7A A;  3FPP A;  4FXD A;  2KJX A;  4G57 A;  4HR7 B;  4DV4 Q;  3T16 A;  1LTS D;  1I3Q B;  1F9S A;  4LUV A;  4DV3 Q;  4ME5 A;  2NBF A;  4BWG B;  1BBW A;  1LAB A;  1J6Q A;  1JE5 A;  4CJ1 B;  5D3D A;  4J1M A;  1C8C A;  2ZXP A;  3WOF A;  3HOV B;  1ASZ A;  1BXT A;  3GTP H;  1HNW Q;  3I90 A;  2ALY B;  2AWN A;  3J81 L;  4LF6 Q;  2VB3 X;  3RD4 A;  4A3M H;  1I3Q H;  2OCE A;  1T5X D;  2AKW B;  3T53 B;  3PO3 G;  3P20 A;  2K14 A;  5FLX E;  4JI0 Q;  1W6J A;  2DY8 A;  4DV7 Q;  5ELO A;  2F0N A;  1CTM A;  1G2T A;  2F0K A;  2R93 G;  1NUC A;  3X3M A;  3HOV H;  4LFC L;  3NPP A;  5JJL A;  2NB0 A;  1JJ2 A;  4PMC A;  1VQ7 A;  4DR6 Q;  4LAA A;  4JV5 L;  3RUZ A;  5C3X A;  3JAM c;  2MGS A;  1PYW D;  5C4X G;  2RDG A;  2B29 A;  4RGT A;  3DMU A;  2O4X A;  2WAQ E;  3OWF A;  5CBA E;  4A4I A;  1L1O B;  1AE2 A;  3C3L A;  3I8Z A;  4OIJ A;  4F88 A;  4BY7 H;  3QIA A;  3KK7 A;  3A8K E;  3LWE A;  2ATW A;  3PO3 B;  4MZ9 A;  4HJA A;  4RKL A;  4G4K A;  4H44 C;  2M9V A;  1Y8N B;  4RG1 A;  2FMM A;  3S1Q B;  2CH4 W;  4M8A A;  3NTH A;  2ZTE A;  2E5L L;  1VQI A;  2NN6 G;  1Z47 A;  4C3I B;  1TY2 A;  2DNE A;  1F2M A;  1CSP A;  1STY A;  2RSO A;  3CW2 C;  4JI4 Q;  1NAP A;  2M2L A;  2K50 A;  4LNQ A;  1IW7 C;  1JIC A;  2RHS B;  2E8G A;  3MXN B;  4AH6 A;  2K01 A;  2K1B A;  3F2D A;  3PO3 H;  2KEC A;  3N6R A;  1EYG A;  3M4O B;  4X64 Q;  4A3D H;  1ENF A;  3CCE A;  3IFT A;  5K36 G;  4B3R Q;  1VQA A;  4C3I H;  4K2L A;  4DV1 Q;  1VMP A;  1GO3 E;  4IQZ A;  2PYK A;  1BNZ A;  4G7O C;  1NY4 A;  3S1M H;  3PQI A;  4KJN A;  2PCF B;  3RLN A;  2A6H C;  1U9R A;  4FVM A;  1B8A A;  1QOH A;  4JI6 L;  1H9R A;  1J5E L;  2F3I A;  3K80 C;  4HID A;  3HOZ G;  1X32 A;  4DV6 Q;  4B3T Q;  5KYL A;  2EJG C;  1HNX L;  5DEH A;  1U4P A;  3M4O H;  4DGZ A;  3I4M G;  1AE3 A;  4IUN A;  1Y8P B;  2X69 A;  4JBK A;  4A3K G;  3TP5 A;  2YV5 A;  4NB3 A;  4JI7 L;  4IFD J;  4YHH L;  1HHV A;  1TWG H;  3K59 A;  1EYC A;  4M1U B;  2QDB A;  1I50 B;  3R3O A;  5EKI A;  1IYV A;  2Q2U A;  4UP9 A;  4CJ0 B;  3HEJ A;  2UUA Q;  1O7L A;  1O80 A;  3K5M A;  2EY2 A;  2KEE A;  3NXW A;  3V2T A;  2PMZ B;  5ELC A;  4DU9 A;  1UE6 A;  3D4D A;  4K8J A;  1LUZ A;  5BN3 A;  1WTO A;  3KJP A;  1EY0 A;  2OWO A;  3HOZ B;  2WIN B;  3HOW G;  2OTJ A;  1WD0 A;  1I94 Q;  1PZK D;  1STG A;  3C46 A;  1I50 H;  4ALP A;  1TQO A;  3I4M B;  2KCM A;  4N8X 1;  4UHV A;  3QR8 A;  4A3K B;  1VQC A;  1WTP A;  3KF6 B;  1PH5 A;  4J15 A;  3JAM L;  5H1S E;  4IPC A;  4A93 G;  3GDE A;  1ZYR D;  2L9H A;  1PH7 A;  2EOT A;  3SGI A;  3PUW A;  4QY7 A;  3Q22 A;  1FJG Q;  3GTL B;  4DK6 C;  1B4O A;  4A3F G;  4K8I A;  3VYR A;  4QGU A;  4NKL A;  3HOZ H;  1JB7 A;  3L2P A;  1G6Z A;  1I4Q A;  4JBM A;  5E4W C;  4GKK Q;  1E1O A;  3M85 A;  4MHE A;  3I4M H;  4CKE A;  3E6Z X;  4A3K H;  2F0T A;  3N52 A;  4A3I B;  4HTH A;  5EBD A;  4C1N I;  2BH8 A;  2LXK A;  1NMF A;  2Z6K A;  2JA5 H;  3VA5 A;  4BY1 G;  1UAP A;  2EDG A;  4LF7 Q;  1S5B D;  5JEA J;  5I9O A;  4A93 B;  1D7Q A;  4LUO A;  5IY0 A;  1WD1 A;  5C44 G;  4JI8 L;  2UXB L;  3CXC A;  4GOP A;  2JA7 G;  3A7A B;  5J39 A;  1X3Q A;  2JEB I;  3WWV A;  4ZQ3 A;  3BYY B;  4A3F B;  4ZLT F;  2ZTC A;  4UDU C;  2KBN A;  1E2Z A;  2AQ1 B;  4C2M B;  2RCF A;  5ELE A;  5KNC A;  4A3I H;  4IOC A;  1PH2 A;  2F0S A;  2CW0 D;  3RN2 A;  2F0F A;  4K0K L;  4IFD I;  1UNS A;  4Q5V A;  3QOJ A;  3CCM A;  1I4P A;  4L5S A;  3J80 i;  3KFU A;  4HSV A;  4DK1 A;  5CMD A;  2NZH A;  1JWM D;  1PYS B;  1EIG A;  2CQA A;  2DUD A;  2DJF C;  4BY1 B;  2Z6K C;  4P74 A;  1ENC A;  4C2M H;  4NXM L;  4N9P A;  2YTY A;  5C6A A;  2Q2I A;  2JA7 B;  1Q7Y C;  2JN4 A;  3BJU A;  3KOJ A;  1QUQ A;  4GOP C;  3U9O A;  5M5Y B;  5A2Q E;  3Q23 A;  2IW3 A;  4HSP A;  3LNN A;  3P75 A;  3T1Y L;  3A5U A;  1JQY D;  1TS5 A;  1TWA B;  2EYM A;  2XN9 C;  2MUY A;  2E74 C;  2FJ2 A;  3NP8 A;  1E7Z A;  1JR0 D;  2N55 A;  1KNA A;  1IYU A;  4JYA L;  5IWA L;  3GD7 A;  1SN8 A;  3C1E A;  3WOE A;  4IPH A;  4A3G G;  4LFA L;  2NYZ D;  3ULJ A;  2ZTD A;  3G4S A;  3BVG A;  1SNC A;  5T1G A;  4LFC Q;  2A68 D;  1MIU A;  3S16 H;  5IT9 c;  4AQY L;  5E3F A;  1XMO L;  4JV5 Q;  2A5H A;  2WB1 G;  4JBW A;  1STA A;  1K3R A;  4FYD A;  2E2H B;  3T13 A;  1R4Q B;  3W5O A;  1QCB D;  4DR5 L;  2ZJR A;  3DEP A;  2EE1 A;  2GVB A;  5IGC A;  4S3S A;  4CJ2 C;  2R7Z G;  1F2Y A;  3D3R A;  3F1Z A;  5D3I B;  2L1B A;  4X3S A;  1Y1W G;  3PIO 3;  2XVS A;  5C0X G;  3BVM A;  1PZI D;  3OOC A;  3TSS A;  4DF7 A;  2MNA A;  3CF5 A;  4R4I A;  4A3G B;  4UAI A;  4ZUJ A;  3ITP A;  3U50 C;  5M9O A;  3RZO B;  4R4C A;  5C3W A;  3K5L A;  1LT5 D;  2GN5 A;  1EYA A;  2E5L Q;  2D0O A;  4RMF A;  2E2H H;  3KLW A;  1N9W A;  1O7Y A;  3T56 B;  4A3C G;  1B2T A;  4RCO A;  2WB1 B;  5DNF A;  1VQ9 A;  2NTS A;  1YNJ D;  4DR2 L;  2A8V A;  1OXV A;  2JA9 A;  1BCP D;  4EQN A;  2I5M X;  1VQN A;  4ZYS A;  2R7Z B;  3TP7 A;  5DM7 3;  2ZXR A;  1YJW A;  1B53 A;  1CHQ D;  5JJK A;  1Y1W B;  1SYE A;  2NZO A;  5IYD G;  2Z0S A;  1KQS A;  4DK0 A;  2BDO A;  1Q81 C;  3ND9 A;  3SK5 A;  3H15 A;  1BUV T;  4QIW B;  1OXU A;  1D1K A;  1CA5 A;  2IX3 A;  3MHB A;  2DY7 A;  1F2L A;  1JB3 A;  4J8Q A;  2ZJQ A;  3TP8 A;  4JI6 Q;  1J8I A;  1J5E Q;  4X62 L;  2F0Q A;  1IYJ B;  2K5H A;  5EPJ A;  1XYI A;  2UXD L;  1HNX Q;  4B9W A;  2R7Z H;  4QB4 A;  3FRP B;  2LS0 1;  1Y1W H;  1ICF B;  3PIP 3;  1VQD A;  4A3L G;  5M3M G;  3TZD A;  4JI7 Q;  4L8J A;  4YHH Q;  2F1M A;  5M5W B;  4RHS A;  1K9M C;  1X3G A;  3DM1 A;  1CQV A;  3GTJ H;  3FVQ A;  1EY8 A;  4EGV A;  3K57 A;  2K04 A;  2JK8 A;  1ET6 A;  4MTN A;  3U9S A;  5ELB A;  5C4H A;  4C3J B;  5EJW A;  1VS0 A;  4ID6 A;  4GLA C;  4R8N A;  3STB C;  3CCV A;  1LT4 D;  4PZ7 A;  2NVY H;  2VQF L;  2RDF A;  3I4O A;  3M3Y B;  1S40 A;  3PUX A;  3GTK H;  4HIK A;  3J80 c;  1WTW A;  1WI5 A;  4HCE A;  2UUC L;  5CV8 A;  5M3M B;  3TS2 A;  3T51 B;  3IAY A;  4LW1 A;  2B2U A;  3S1N B;  4C3J H;  5JPN C;  4X66 L;  2B8F A;  1QJO A;  5CV9 A;  4FF4 A;  2Z8L A;  1DOM A;  1RF2 D;  3PGZ A;  1A63 A;  4UPA A;  3MXN A;  2VXW A;  1PH3 A;  3SDZ A;  2IY5 B;  3NEN A;  3M3Y H;  1EZ6 A;  4QQB X;  4OIK A;  2B2V A;  2F0E A;  3A8I E;  1JT8 A;  1Q86 C;  1IL2 A;  3PMF A;  3JAM i;  1L1O C;  5M3M H;  1YEZ A;  3AFP A;  4JI5 L;  5AJ3 L;  1SE8 A;  1K8M A;  2EYF A;  1ASY A;  1I6V C;  5DM6 3;  2KHI A;  2HD3 A;  2JA8 H;  1XTC D;  4ZK9 B;  4FO2 A;  2BE5 C;  3O13 A;  1EYD A;  4WOR A;  3AU7 A;  4A3J H;  3D4R A;  1EU3 A;  4JI8 Q;  2UXB Q;  1D8L A;  2B2U C;  3SHL A;  1Q8K A;  2K05 A;  1NTG A;  4HCS A;  5EAY A;  2XWB B;  4DR3 L;  1Z7T A;  2PMZ E;  1E24 A;  4O42 A;  1BR9 A;  1STH A;  4Q0F A;  1KRS A;  2A69 D;  2BOS A;  4RCN A;  2JJQ A;  2RQX A;  2BDN A;  2B2V C;  1AN8 A;  4K0K Q;  5M5X H;  1X3P A;  1HFN A;  2VUM G;  4HJ9 A;  1AW7 A;  2WFW A;  2SDF A;  4OO1 G;  4KN4 C;  1HUM A;  4LFB L;  5JJZ A;  4IJH A;  2EPB A;  4KHZ A;  2H4O A;  3PIO A;  1GUS A;  2EYO A;  4PG3 A;  3I2Z A;  4LJZ C;  4NXM Q;  1TWF B;  1EY6 A;  4QUC A;  4HJ8 A;  3DM3 A;  1SDF A;  1ROD A;  3DLL A;  2F0H A;  4CDF C;  5A35 A;  1NMG A;  2I46 A;  4ZKB B;  5IOC A;  4DUY L;  2I0Q A;  2MP1 A;  1Q3L A;  3T1Y Q;  1F2Z A;  2FIN B;  1SBB B;  1X3F A;  3J81 E;  2HIX A;  1OO9 B;  1T5E A;  1VCI A;  1FL0 A;  2KVM A;  1DYQ A;  2DN8 A;  2F03 A;  1RJT A;  3CD6 A;  4YCV A;  4MTK A;  1K83 B;  1BDO A;  1S4Z A;  1I4X A;  2AUK A;  4KN7 C;  4KK7 A;  3I4N G;  5IWA Q;  1P8L A;  1MSH A;  1SMY C;  1L2F A;  3BZD B;  3J7A V;  1STE A;  4LFA Q;  1I6H H;  3URY A;  5IGE A;  1IBK L;  1C7Y A;  4BXX H;  2XRQ D;  1D5M C;  3J80 L;  2NVX B;  3HOU H;  1XMQ L;  3CRL C;  4AQY Q;  3G6E A;  1OTC A;  3RMH A;  1XMO Q;  4JOI A;  1VQF A;  3CCR A;  3NEL A;  4HIO A;  3MZ5 A;  3TEH B;  5IGB A;  4K6D A;  1NE3 A;  1SJH D;  1K83 H;  3NWT A;  2ID0 A;  3F2C A;  2OQ0 A;  1Z6H A;  4Z9C B;  1ESF A;  1RIP A;  4DR5 Q;  4U67 3;  4NW2 A;  2I5H A;  2KOL A;  4EQP A;  1FVI A;  2IHF A;  3FHW A;  5D65 A;  1EFI D;  3HRZ C;  4POF A;  3SXH A;  1RKN A;  4Y52 H;  3PIP A;  1SYG A;  3NBI A;  4C3H G;  1K73 C;  3OSO A;  4KI0 A;  2NVX H;  4K5V A;  1SLJ A;  2ICE C;  5E1F A;  4XQQ A;  3M4Q A;  1WFQ A;  4NPS A;  2FMC A;  4PQX A;  4XT1 B;  4TQU S;  1IL8 A;  2EY1 A;  1BCP B;  1A2T A;  1B50 A;  2PQA A;  3H0G H;  1BOS A;  1DOL A;  1B9N A;  1NR4 A;  3KDF B;  2WKD A;  4DR2 Q;  4JOI C;  1B7Y B;  1G8Z D;  1PRT D;  4JW0 A;  3F2U A;  1KLG D;  2YU9 B;  5CV4 A;  1ZEQ X;  1N32 L;  4XYQ A;  5GAD C;  1MSG A;  2CCZ A;  1SAP A;  3I91 A;  3V96 A;  4NDX A;  2PZW A;  3S2D B;  1XJV A;  1YBY A;  4RHR A;  4QUF A;  2KHJ A;  3DUZ A;  1E2W A;  3S14 B;  1MHW C;  3CPF A;  3CPW A;  3CP0 A;  5IP9 H;  3TS0 A;  2EQS A;  1PZJ D;  4PMB A;  3P1H A;  1EWH A;  3TBI B;  3DHQ A;  2YTV A;  1PH8 A;  2XGT A;  1ILQ A;  4X62 Q;  1EWI A;  2RA4 A;  2UXD Q;  1IW7 D;  3S2D H;  5CV6 A;  3A55 A;  3OW7 A;  3DWA A;  3X3N A;  3S14 H;  4JI2 Q;  3R93 A;  3MTS A;  3HP3 A;  3W1G A;  1FNW A;  1VQE A;  3Q0A A;  5J22 A;  1E22 A;  1NBW A;  3B6Y A;  1M90 C;  1UWV A;  4IOA A;  3L7Z C;  4GN5 A;  2R93 B;  2Z9H A;  1QZG A;  2NN6 I;  2F0G A;  2A6H D;  1HZB A;  2WB1 E;  1PH9 A;  1EIH A;  2QF7 A;  3HOX G;  2SNS A;  2IT1 A;  3D4W A;  2MPM A;  2VQF Q;  5C4X B;  2DJG C;  1ILP A;  1EOT A;  4DAY B;  1I5F A;  5I6W A;  4DV2 L;  1HR0 W;  3FEW X;  2CFM A;  3TQY A;  1E3P A;  2MHV A;  1RCV D;  2UUB L;  2UUC Q;  4DV0 L;  3S1Q H;  1XNQ L;  1PFN A;  3TZU A;  2R93 H;  3KLS A;  1PTO D;  2J0T D;  2JEA I;  2O5I C;  2SEB D;  5ELD A;  4X66 Q;  4DXF A;  4P75 A;  1V1Q A;  3S9W A;  1SNO A;  2TMP A;  4QIW E;  4POG A;  1DZ1 A;  3MXP A;  1XX8 A;  4QL5 A;  3VDY A;  1PMR A;  5CGK A;  5C4X H;  3D0F A;  5LMN W;  4A3B G;  4YWK A;  3OMC A;  4K2K A;  3U4Z A;  3S2H B;  1V9P A;  1CZG A;  2F52 A;  5IGF A;  4FP5 D;  3SE0 A;  3PV0 A;  2AWO A;  2F0O A;  5AJ3 Q;  4L5R C;  4OHJ A;  1SXT A;  1SRU A;  4I65 A;  2JSO A;  3UDI A;  3NUC A;  3D31 A;  4KY6 A;  2E2I B;  1O7Z A;  1C4Q A;  4DFA A;  1FGU A;  3L9A X;  4ZRZ A;  4IUQ A;  4OWW B;  2NTT A;  1QE6 A;  3PF5 A;  1KXL A;  2NN6 H;  1HTL D;  3S2H H;  1YHB A;  5M3F G;  4B3M L;  4LF9 L;  1QB5 D;  1TWC B;  3PSI A;  4DR3 Q;  3RZD B;  1WTQ A;  1Q82 C;  1LT6 D;  1VDZ A;  4A3B B;  2LMC B;  4OXP A;  3NWS A;  3QJY A;  4GLV B;  3U58 A;  3SR1 A;  4RWS C;  2MJ8 A;  1VQG A;  1MBY A;  1CKO A;  3DEO A;  2ZXO A;  2E2I H;  1TT2 A;  2B2T A;  4DXG A;  2K5Q A;  1D1I A;  1SJE D;  4MNO A;  5K36 H;  4QF4 A;  1Y1V G;  2A6E D;  4OON A;  4AYB G;  4HJ7 A;  1Q90 A;  4LFB Q;  3MC0 B;  1EL0 A;  1QVC A;  2EXZ A;  2R3Z A;  4A75 A;  1UEA B;  1TWC H;  1IZ6 A;  3CKI B;  1SE2 A;  3RZD H;  1CZW A;  4KV6 A;  1KHI A;  3K0Y A;  1EEF D;  2OQK A;  2D62 A;  1S5C D;  4H02 A;  2F0M A;  4ZUI A;  1KC8 C;  4IZ8 A;  4DUY Q;  4CGY B;  1HA6 A;  1LTG D;  1EY5 A;  4NXN L;  2XSC A;  1JMC A;  2OTL A;  1JJG A;  2F3W A;  3UDG A;  3GP7 A;  4KJO A;  4ME3 A;  5G3L D;  1J9O A;  3HOW B;  2V1C C;  3KUP A;  4DKA C;  1A8V A;  5KIX A;  1KDC A;  2K32 A;  5C3E G;  1Y69 U;  1YNN C;  3E0E A;  3CMA A;  2B2T C;  4KLK A;  3GTL H;  2PI2 E;  1RL2 A;  4FXK C;  2WV6 D;  1KNE A;  1EQR A;  4JI3 L;  2JA6 G;  2EY6 A;  2R61 A;  1IBK Q;  2GA4 B;  1TU2 B;  5TSS A;  2B8G A;  1XMQ Q;  4KKT A;  2X6G A;  4JPB W;  4RA8 A;  1HCZ A;  1LTI D;  4HED A;  4GNX B;  1Q8I A;  2XIW A;  2HQL A;  3HOW H;  5FO7 B;  1VQH A;  4DR1 L;  2XNA C;  1E0B A;  1RTO A;  2PI2 A;  1FR3 A;  1DXM A;  3H3V C;  2Q2T A;  2EZV A;  3A5Z B;  1AZQ A;  4R4Q A;  1LAC A;  2PQA B;  4FXG C;  2VNU D;  4ILW A;  4A93 H;  2OT2 A;  2PNR C;  1DJR D;  1F9Q A;  5C3E B;  4RAU C;  4V19 0;  1M8A A;  3EVQ A;  1HTP A;  5J3B A;  4A3F H;  4ZAI A;  2JA6 B;  1YIT A;  3S24 A;  5C44 B;  1EZ8 A;  2ASB A;  3D8G A;  3JC6 6;  2WAC A;  3SVM A;  2QCP X;  3TRZ A;  5FJ8 G;  4RH6 A;  2L15 A;  3J7A 5;  2MQH A;  1QWY A;  5C3E H;  1TS3 A;  1PVO A;  1SYD A;  1PLF A;  3BVZ A;  2EXD A;  1N32 Q;  4TSS A;  3K5O A;  1KAA A;  4TRD A;  4BY1 H;  2N88 A;  2JA6 H;  4IUT A;  3GTG B;  3BU2 A;  5C44 H;  3I55 A;  3KF8 B;  4EQO A;  2QEX A;  3NQI A;  2JA7 H;  2Y0S G;  4O0A A;  3G7L A;  3MEH A;  4CDD C;  1F9P A;  5C5L A;  2D5D A;  3VR2 A;  1PYB A;  5M5Y H;  2XWJ B;  3MWY W;  2PW7 A;  3A54 A;  5I9P A;  3MFY A;  1TWA H;  2AQ2 B;  3UI2 A;  4IJL A;  1JOK A;  1HA5 A;  1YNX A;  2RKS A;  3GTG H;  1SYC A;  2ZJP A;  2YTX A;  3SK4 A;  2Z4H A;  2LY7 A;  2EIF A;  1TWH B;  1CKN B;  4P71 A;  4WJ4 A;  5ISR A;  1S5F D;  2OXP A;  1MJC A;  3LX0 A;  1SNP A;  4KHV A;  3AYH B;  3AMU A;  2QIL A;  4O1N A;  5BR8 L;  3CCL A;  5C0X I;  2G5D A;  2Y0S B;  5AFW A;  4XTC S;  1SE4 A;  4K14 A;  3UDX A;  1A62 A;  2PO4 A;  4LWC A;  2F0I A;  1L0Y B;  1X3E A;  3MVV A;  4YIJ A;  1SNM A;  1I4R A;  5JEA G;  3I4L A;  1ZKO A;  2BA1 A;  5C4J B;  2IJ0 A;  2RHQ B;  5LL6 S;  4GLX A;  3EJI A;  2EYH A;  2YYZ A;  1CHP D;  3AFQ A;  4DV2 Q;  1B9M A;  1ET9 A;  3G6J B;  4V0B A;  2UUB Q;  4DV0 Q;  4A3G H;  3QG1 A;  1XNQ Q;  3RZO H;  2TSS A;  3J7Z C;  1VQM A;  3RLF A;  2AUJ D;  1C0A A;  2M00 A;  2KA7 A;  4RGN A;  1Q1B A;  5IYC G;  4P73 A;  3KDF A;  2Q8I B;  3S1R B;  3T4A C;  4DNT B;  1XPO A;  2Q2H A;  3K81 C;  1BO0 A;  4IUU A;  1CK1 A;  1H95 A;  2K75 A;  2K5D A;  1LM0 A;  4H0L C;  3STB D;  5BN5 A;  3BG3 A;  1SND A;  3AQQ A;  5HGQ A;  1U4R A;  4XQJ A;  4OGQ C;  1SFO B;  2G9H D;  2SNM A;  4DN4 M;  4DV7 L;  2XTI A;  3H3V I;  3GTM B;  1GKH A;  1Y8O B;  4DPG A;  5C0X H;  4DV5 L;  2PNH A;  3NTI A;  3I72 A;  3S1R H;  1BBX C;  4DR4 L;  2L4N A;  5IOD A;  3M7N A;  1CI3 M;  4KY7 A;  2R6G A;  1MJE A;  3K58 A;  3S15 B;  3FDT A;  4FDB A;  2VS1 A;  1BCP C;  1OXX K;  1CA6 A;  1LLR D;  4A3C H;  4B3M Q;  4LF9 Q;  4RFB A;  4PZ6 A;  1UE7 A;  1RDP D;  3QO2 A;  2B2W A;  1B70 B;  2H5X A;  1SFO H;  2H1E A;  4K5W A;  2HT1 A;  1TS4 A;  1MI2 A;  2EJF C;  4OWT B;  3SK8 A;  2RF4 A;  3K6O A;  3HGB A;  1LT3 D;  5M5W H;  4J6H A;  5IT9 L;  5EKL A;  1VQP A;  3PF4 A;  3W3A A;  3R2T A;  3S15 H;  5IYD H;  1G91 A;  3DWP A;  1XPU A;  4IUP A;  2AMC B;  1TKW B;  5EBC A;  4CHT B;  1FNV A;  2VB2 X;  1K8G A;  4G7H C;  1Q12 A;  4IPD A;  5IYB G;  4BBR G;  4YY3 L;  4X3U A;  3G71 A;  4E6I A;  5FLM G;  4LF8 L;  1WTR A;  1PHJ A;  2F0J A;  3BDO A;  1DCZ A;  4APV A;  4DAY A;  1GUN A;  4R4T A;  3ULL A;  4NXN Q;  3GV6 A;  3H3V H;  2R7F A;  1QG7 A;  2B2W C;  5KRU A;  4X64 L;  4A3L H;  2R92 G;  2CKZ B;  2L0C A;  3S1N H;  2D9U A;  2N49 A;  2VQE L;  3K7A B;  2F0V A;  2NVQ B;  1NNX A;  3A56 A;  3PCO B;  4LUZ A;  2EYJ A;  3LWU A;  4JI3 Q;  3KBG A;  4P72 A;  3HS0 C;  4XDX A;  4LK1 C;  2ICI A;  1U0L A;  2EY5 A;  1KRT A;  3VR5 A;  2F0U A;  2BA0 A;  4BBR B;  1M4V A;  4QMG A;  2CH4 A;  3CCQ A;  1QZH A;  3E5S A;  3L3O C;  2F3V A;  3W1B A;  2JP1 A;  3HG9 A;  4WRD A;  1JOQ A;  4KD3 A;  3K7A H;  1G6P A;  2WKC A;  4DR1 Q;  2L55 A;  2KHS A; 
#chains in the Genus database with same CATH homology
 3MA2 B;  3I3C A;  3I70 A;  2R92 B;  4ODG A;  3Q24 A;  2RSN A;  3OWE B;  1A3T A;  3BS1 A;  3H91 A;  1JE4 A;  3Q6S A;  2O5J C;  1SMY D;  3CQZ B;  1HPC A;  3SEB A;  3J7A F;  5COR A;  3GTO B;  1DON A;  4HMJ A;  1KTK A;  1MGS A;  1FD7 D;  3D6W A;  2JYO A;  3CRK C;  5LHY 1;  3ND8 A;  1GUW A;  3NQT A;  4KY5 A;  2F0L A;  4OL7 A;  4KKS A;  3MFG A;  4FF1 A;  3FKI B;  2VUM B;  2B63 B;  1SSO A;  3ERO A;  2HCI A;  1K8O A;  1GXD C;  5LL6 X;  3R2I A;  1D2B A;  1AZP A;  3QOL A;  1GUG A;  1WCM B;  2CVR A;  5BN4 A;  5KND A;  4XXE A;  4KKU A;  2K33 A;  5COY A;  1LTA D;  3TN2 A;  1F77 A;  2D2C C;  3M7G A;  4OO1 H;  3FPU B;  5F2D A;  1GOZ A;  1JOR A;  1EEI D;  1DOK A;  1E2V A;  2L5T A;  3DXJ C;  5JVG 3;  1EQT A;  4RKB A;  3I4N B;  3MXU A;  2OEO A;  1OXT A;  1L0X B;  1IKM A;  2KCC A;  2ZT9 C;  1G29 1;  1TR5 A;  3NE5 B;  5FKA C;  4KTA A;  2Z1C A;  3EQL C;  2C9O A;  3MXG A;  4A3M B;  2OF1 A;  2HDM A;  4C3H B;  1VF7 A;  3E0J A;  4IN3 A;  1C48 A;  2IX0 A;  1XWE A;  4NMZ A;  3KLR A;  1RTN A;  1H9S B;  3IFD A;  5CV7 A;  1ML0 D;  1WVL A;  2Z4I A;  5IIF A;  3KF8 A;  4GZY C;  4DA2 A;  3C2P A;  1WTX A;  4XIG S;  1V1P A;  4BY7 B;  1DD2 A;  1VMC A;  4C3I G;  4FF2 A;  1IHZ A;  1QIL A;  4XT3 B;  1PRT C;  1A6X A;  2Q8R E;  4DAV A;  1DM0 B;  4X3K A;  3K5N A;  2SOB A;  3HZX A;  1I4G A;  1EY7 A;  5FO8 B;  4A3D B;  5EQ0 A;  3JAM E;  3EA6 A;  1JWU D;  3OHX C;  4X3T A;  2JXM B;  4BA2 I;  1GUO A;  1HFG A;  3S1M B;  1XXG A;  4H7B A;  2K28 A;  2E75 C;  1BF4 A;  3VR3 A;  4EVO A;  1SYF A;  4R8I A;  4B9X A;  3S17 B;  1SE3 A;  3HOX B;  1AP0 A;  5FLX L;  1FNU A;  1WTV A;  3D6C A;  5FK9 C;  1TWG B;  1PDQ A;  3NTK A;  4KMU C;  1BCP F;  2EJM A;  1FYC A;  3R8B A;  5CC4 A;  1ZXT A;  1NCV A;  1IKL A;  2BCO A;  1JCK B;  3H94 A;  4DAP A;  3PUV A;  1PXU A;  1PTO C;  2JE6 I;  1KDA A;  1HRJ A;  4MIU A;  3DWQ A;  4HN7 A;  4I7Z C;  1CFM A;  1YNN D;  2X6L A;  4G7Z C;  1KLU D;  4H13 C;  1LTR D;  1R9T B;  3NSW A;  1A3V A;  3ERQ A;  5M3F B;  1AEX A;  5JPM C;  4Y7N B;  3OPO A;  2KUM A;  1ENA A;  4F7X A;  5KYI A;  1VF5 C;  5EGT A;  1JC7 A;  2K6A A;  1O78 A;  3OIP A;  2JA5 B;  5JOB A;  4K6L A;  2F0D A;  5CBE E;  1EY9 A;  1Y1V B;  4AYB B;  2O2L D;  4TKO B;  1V43 A;  1SEB D;  3KLS X;  5C0X J;  1SYB A;  2FFK B;  1LTB D;  2NVT B;  1ICW A;  2A6E C;  4A3E B;  1TY0 A;  1ZYR C;  4CKB A;  1F9R A;  3IKJ A;  4PNY A;  2PQE A;  2EVB A;  2B2Y A;  4RGM A;  2J4X A;  1EWC A;  1PFM A;  2F0W A;  4CBV A;  2ENB A;  2EYP A;  1U4L A;  4RGO S;  4ZKC B;  3HKZ B;  1PRT B;  3PUZ A;  3WDN A;  4IFD G;  1HUN A;  1H9J A;  2K7V A;  1JOO A;  1ESR A;  5HGT A;  3CHB D;  1TVX A;  4FF3 A;  2E2J B;  2J7Z A;  1V8Q A;  2K5W A;  1QNU A;  3GTQ B;  4L63 B;  2B2Y C;  1V1P B;  2AQ3 B;  3S16 B;  2CW0 C;  2NUC A;  2FHT A;  3PO2 B;  5NUC A;  2KQ3 A;  4WJW A;  4KD4 A;  4XYO A;  1JWS D;  3VYS A;  3BDL A;  4R9W A;  1H9M A;  5J1Z A;  5FO9 B;  4LMQ D;  3FMC A;  1V1O A;  1HQR D;  4JK1 C;  2KCN A;  5KGU A;  2LFN A;  4IFD H;  1RHP A;  2WP8 J;  2WAQ B;  1RD9 D;  2XRS D;  2HDL A;  2HQE A;  2NWG A;  3OMG A;  2RDH A;  3CU7 A;  2PZU A;  5IT9 E;  1B44 D;  2B39 A;  1PTO B;  1LV9 A;  2A68 C;  4L6T B;  4NP5 A;  5KNB A;  1TII D;  2A73 B;  3V05 A;  3BDC A;  1I4H A;  5A2Q L;  4U68 A;  2RBM A;  1A15 A;  3I73 A;  1EU4 A;  1FGB D;  2KED A;  3ZYY X;  1G2S A;  1PTO H;  1KDB A;  1EQV A;  5E4X A;  4F8M A;  4C3J G;  2NZ1 D;  4C56 C;  1H9S A;  3GTJ B;  1PRT F;  5IGD A;  1YNJ C;  4DNR B;  5T1I A;  5JEA H;  1LTT D;  2L12 A;  4ULL A;  2NVY B;  3BYT B;  1D5X C;  4BA1 I;  5JAV A;  4IAL A;  1STN A;  3NK9 A;  3GTK B;  4ABN A;  3NBH A;  3PUY A;  1GHJ A;  3EFX D;  1A3U A;  1Q1E A;  3TDQ A;  1II3 A;  2CHB D;  2BE5 D;  4P2C B;  5EPL A;  2K03 A;  1PFB A;  4HMI A;  3IL8 A;  1KAB A;  1R4P B;  1S5D D;  1CQF A;  3QWN A;  2IL8 A;  1EY4 A;  4WFN 3;  1BQQ T;  1QNK A;  5I6Y A;  1GJX A;  5K5P A;  1STB A;  3GV3 A;  4CKC A;  5EPK A;  2RVL A;  3A7L A;  2HUG A;  2IWH A;  2IPK D;  4IUR A;  3NHH A;  3ONA B;  5I2Y A;  2JA8 B;  3AB9 A;  1H9K A;  1NSN S;  1B1Z A;  1MD2 D;  4A3J B;  1W6K A;  4PMW A;  1SNQ A;  3J80 E;  4B08 A;  3KBX A;  2IX1 A;  3J7Y W;  3VA7 A;  5DAU A;  5KEE A;  1PTO F;  4HAE A;  4MN3 A;  1D5Z C;  5M5X B;  3VR4 A;  5CR3 A;  1GHK A;  1HQM C;  5C5M A;  2HCC A;  2E2D C;  1CM9 A;  1CT1 D;  1D6E C;  3M4Y A;  3C1F A;  2EYL A;  1A2U A;  4OO1 I;  1HXY D;  3SK6 A;  4IUV A;  2QKI C;  3A8J E;  4FNF A;  5CV5 A;  2PZT A;  5C4Z A;  3VR6 A;  2I07 B;  5IGG A;  3HOY B;  2LKV A;  2F4I A;  4QCL A;  4PV1 C;  1B3A A;  1TS2 A;  5EKK A;  4N9T A;  1S5E D;  5I2X A;  2PPB C;  3GO5 A;  3H09 A;  3H6M A;  4BS9 A;  4XQN A;  4BBS B;  1I6H B;  2V4D A;  5CYU A;  2DNC A;  3HOU B;  2A69 C;  2C5C A;  2Q8T A;  3W2D A;  2A74 C;  2F0P A;  2QEJ C;  2L11 A;  2E76 C;  1AFP A;  3VYU A;  5FOB B;  3VYT A;  2G9D A;  1ONL A;  5D14 A;  1NR2 A;  1GUT A;  2PW5 A;  3QB3 A;  3P7J A;  3OIQ A;  5I4D A;  3TME A;  4K5X A;  1OXS C;  2WII B;  5G3L F;  5JVH 3;  3TP6 A;  3MAQ A;  1LO5 D;  1U4M A;  1UUP A;  5HUR A;  4F87 A;  3H0G B;  4C1N K;  3GTP B;  3GQB A;  5ELF A;  3FPP A;  4FXD A;  2KJX A;  4G57 A;  4HR7 B;  3T16 A;  1LTS D;  1I3Q B;  1F9S A;  4ME5 A;  2NBF A;  4BWG B;  1LAB A;  4CJ1 B;  5D3D A;  4J1M A;  1C8C A;  2ZXP A;  3WOF A;  3HOV B;  1BXT A;  3I90 A;  2AWN A;  3J81 L;  2VB3 X;  3RD4 A;  1T5X D;  3T53 B;  5FLX E;  3P20 A;  1W6J A;  2DY8 A;  2F0N A;  1CTM A;  1G2T A;  2F0K A;  1NUC A;  3X3M A;  3NPP A;  2NB0 A;  4PMC A;  4LAA A;  3RUZ A;  5C3X A;  2MGS A;  1PYW D;  2RDG A;  4RGT A;  3DMU A;  2O4X A;  3OWF A;  5CBA E;  3C3L A;  3I8Z A;  4OIJ A;  4F88 A;  3QIA A;  3KK7 A;  3A8K E;  3LWE A;  3PO3 B;  4RKL A;  4G4K A;  4H44 C;  2M9V A;  1Y8N B;  3S1Q B;  2FMM A;  4M8A A;  3NTH A;  2NN6 G;  1Z47 A;  4C3I B;  1TY2 A;  2DNE A;  1F2M A;  1STY A;  2RSO A;  1NAP A;  2M2L A;  1IW7 C;  1JIC A;  2K01 A;  2K1B A;  2KEC A;  3N6R A;  3M4O B;  1ENF A;  5K36 G;  3IFT A;  4K2L A;  1VMP A;  4IQZ A;  2PYK A;  1BNZ A;  4G7O C;  4KJN A;  2PCF B;  2A6H C;  1U9R A;  4FVM A;  1QOH A;  1H9R A;  1X32 A;  5KYL A;  2EJG C;  5DEH A;  1U4P A;  4DGZ A;  4IUN A;  1Y8P B;  2X69 A;  3TP5 A;  4IFD J;  1HHV A;  3K59 A;  1EYC A;  4M1U B;  2QDB A;  1I50 B;  3R3O A;  5EKI A;  1IYV A;  4CJ0 B;  3HEJ A;  1O7L A;  1O80 A;  3K5M A;  2EY2 A;  2KEE A;  3NXW A;  3V2T A;  2PMZ B;  5ELC A;  4DU9 A;  3D4D A;  4K8J A;  5BN3 A;  1WTO A;  1EY0 A;  3HOZ B;  2WIN B;  1WD0 A;  1PZK D;  1STG A;  3C46 A;  3I4M B;  1TQO A;  4A3K B;  1WTP A;  3JAM L;  1ZYR D;  2L9H A;  2EOT A;  3PUW A;  3Q22 A;  3GTL B;  1B4O A;  4K8I A;  3VYR A;  4NKL A;  1G6Z A;  1I4Q A;  5E4W C;  3M85 A;  4MHE A;  4CKE A;  3E6Z X;  2F0T A;  3N52 A;  4A3I B;  4HTH A;  5EBD A;  4C1N I;  3VA5 A;  1UAP A;  2EDG A;  1S5B D;  5JEA J;  5I9O A;  4A93 B;  1WD1 A;  3A7A B;  5J39 A;  1X3Q A;  2JEB I;  4ZQ3 A;  3BYY B;  4A3F B;  4ZLT F;  4UDU C;  1E2Z A;  2AQ1 B;  4C2M B;  5ELE A;  5KNC A;  2F0S A;  2CW0 D;  2F0F A;  4IFD I;  1UNS A;  4Q5V A;  3QOJ A;  1I4P A;  4HSV A;  4DK1 A;  5CMD A;  1JWM D;  1EIG A;  2CQA A;  4BY1 B;  1ENC A;  4N9P A;  5C6A A;  2JA7 B;  3U9O A;  5M5Y B;  5A2Q E;  3Q23 A;  2IW3 A;  4HSP A;  3LNN A;  3P75 A;  1JQY D;  1TS5 A;  1TWA B;  2EYM A;  2XN9 C;  2MUY A;  2E74 C;  2FJ2 A;  3NP8 A;  1JR0 D;  2N55 A;  1KNA A;  1IYU A;  3GD7 A;  3C1E A;  3WOE A;  2NYZ D;  3BVG A;  1SNC A;  5T1G A;  2A68 D;  5E3F A;  2A5H A;  4JBW A;  1STA A;  4FYD A;  2E2H B;  3T13 A;  1R4Q B;  1QCB D;  3DEP A;  2EE1 A;  5IGC A;  4S3S A;  4CJ2 C;  1F2Y A;  3D3R A;  5D3I B;  2L1B A;  4X3S A;  3PIO 3;  2XVS A;  5C0X G;  3BVM A;  1PZI D;  3OOC A;  3TSS A;  4DF7 A;  4A3G B;  4UAI A;  4ZUJ A;  3ITP A;  5M9O A;  3RZO B;  5C3W A;  3K5L A;  1LT5 D;  1EYA A;  1O7Y A;  3T56 B;  1B2T A;  4RCO A;  2WB1 B;  5DNF A;  2NTS A;  1YNJ D;  1OXV A;  4EQN A;  1BCP D;  4ZYS A;  2R7Z B;  3TP7 A;  5DM7 3;  2ZXR A;  1B53 A;  1CHQ D;  1Y1W B;  1SYE A;  4DK0 A;  2BDO A;  3ND9 A;  3SK5 A;  1BUV T;  4QIW B;  1OXU A;  1D1K A;  1CA5 A;  2IX3 A;  3MHB A;  2DY7 A;  1F2L A;  1JB3 A;  4J8Q A;  3TP8 A;  1J8I A;  2F0Q A;  5EPJ A;  1XYI A;  4B9W A;  4QB4 A;  3FRP B;  2LS0 1;  3PIP 3;  3TZD A;  4L8J A;  2F1M A;  5M5W B;  4RHS A;  3DM1 A;  1CQV A;  3FVQ A;  1EY8 A;  4EGV A;  3K57 A;  2K04 A;  1ET6 A;  3U9S A;  5ELB A;  5C4H A;  4C3J B;  5EJW A;  4ID6 A;  4R8N A;  1LT4 D;  2RDF A;  3M3Y B;  3PUX A;  1WTW A;  4HCE A;  5CV8 A;  5M3M B;  3T51 B;  3IAY A;  2B2U A;  3S1N B;  5JPN C;  2B8F A;  1QJO A;  5CV9 A;  4FF4 A;  2Z8L A;  1DOM A;  1RF2 D;  3MXN A;  2VXW A;  3SDZ A;  1EZ6 A;  4OIK A;  2B2V A;  2F0E A;  3A8I E;  3PMF A;  1K8M A;  2EYF A;  1I6V C;  5DM6 3;  1XTC D;  4ZK9 B;  4FO2 A;  2BE5 C;  3O13 A;  1EYD A;  4WOR A;  3AU7 A;  3D4R A;  1EU3 A;  2B2U C;  3SHL A;  2K05 A;  4HCS A;  2XWB B;  1Z7T A;  4O42 A;  1BR9 A;  1STH A;  4Q0F A;  2A69 D;  2BOS A;  4RCN A;  2RQX A;  2BDN A;  2B2V C;  1AN8 A;  1X3P A;  1HFN A;  1AW7 A;  2SDF A;  4OO1 G;  4KN4 C;  1HUM A;  5JJZ A;  2EPB A;  4KHZ A;  2H4O A;  1GUS A;  2EYO A;  4LJZ C;  1TWF B;  1EY6 A;  4QUC A;  1SDF A;  1ROD A;  2F0H A;  5A35 A;  2I46 A;  4ZKB B;  5IOC A;  2MP1 A;  1Q3L A;  1F2Z A;  2FIN B;  1SBB B;  3J81 E;  1OO9 B;  1T5E A;  1VCI A;  2KVM A;  1DYQ A;  2DN8 A;  2F03 A;  1RJT A;  1K83 B;  1BDO A;  1S4Z A;  1I4X A;  2AUK A;  4KN7 C;  4KK7 A;  1MSH A;  1SMY C;  3BZD B;  3J7A V;  1STE A;  3URY A;  5IGE A;  2XRQ D;  1D5M C;  3J80 L;  2NVX B;  3CRL C;  3RMH A;  3MZ5 A;  5IGB A;  4K6D A;  1SJH D;  3NWT A;  2ID0 A;  1Z6H A;  4Z9C B;  1ESF A;  4U67 3;  4NW2 A;  2KOL A;  4EQP A;  5D65 A;  1EFI D;  3HRZ C;  3SXH A;  1RKN A;  1SYG A;  3NBI A;  4C3H G;  3OSO A;  4KI0 A;  4K5V A;  2ICE C;  5E1F A;  4XQQ A;  2FMC A;  4PQX A;  4XT1 B;  4TQU S;  1IL8 A;  2EY1 A;  1BCP B;  1A2T A;  1B50 A;  1BOS A;  1DOL A;  1B9N A;  1NR4 A;  2WKD A;  1G8Z D;  1PRT D;  3F2U A;  1KLG D;  2YU9 B;  5CV4 A;  1ZEQ X;  4XYQ A;  1MSG A;  1SAP A;  3I91 A;  3V96 A;  4NDX A;  2PZW A;  3S2D B;  4RHR A;  4QUF A;  3DUZ A;  1E2W A;  3S14 B;  1PZJ D;  4PMB A;  3P1H A;  1EWH A;  3TBI B;  3DHQ A;  1ILQ A;  2RA4 A;  1IW7 D;  5CV6 A;  3A55 A;  3OW7 A;  3DWA A;  3X3N A;  3R93 A;  3MTS A;  3HP3 A;  1FNW A;  3Q0A A;  5J22 A;  3L7Z C;  2R93 B;  2NN6 I;  2F0G A;  2A6H D;  1EIH A;  2QF7 A;  2SNS A;  2IT1 A;  3D4W A;  2MPM A;  5C4X B;  1ILP A;  1EOT A;  5I6W A;  3FEW X;  2MHV A;  1RCV D;  1PFN A;  3TZU A;  3KLS A;  1PTO D;  2J0T D;  2JEA I;  2O5I C;  2SEB D;  5ELD A;  4DXF A;  3S9W A;  1SNO A;  2TMP A;  1DZ1 A;  3MXP A;  1XX8 A;  1PMR A;  5CGK A;  3OMC A;  4K2K A;  3S2H B;  1CZG A;  5IGF A;  4FP5 D;  3SE0 A;  3PV0 A;  2AWO A;  2F0O A;  4OHJ A;  1SXT A;  4I65 A;  2JSO A;  3NUC A;  3D31 A;  4KY6 A;  2E2I B;  1O7Z A;  1C4Q A;  4DFA A;  3L9A X;  4ZRZ A;  4IUQ A;  2NTT A;  1QE6 A;  2NN6 H;  1HTL D;  1QB5 D;  1TWC B;  3RZD B;  1WTQ A;  1LT6 D;  1VDZ A;  4A3B B;  2LMC B;  3NWS A;  3QJY A;  3SR1 A;  4RWS C;  2MJ8 A;  1MBY A;  3DEO A;  2ZXO A;  1TT2 A;  2B2T A;  4DXG A;  2K5Q A;  1D1I A;  1SJE D;  5K36 H;  4QF4 A;  2A6E D;  1Q90 A;  3MC0 B;  1EL0 A;  2R3Z A;  2EXZ A;  1UEA B;  3CKI B;  1SE2 A;  1CZW A;  4KV6 A;  3K0Y A;  1EEF D;  2D62 A;  1S5C D;  2F0M A;  4ZUI A;  4IZ8 A;  4CGY B;  1HA6 A;  1LTG D;  1EY5 A;  2XSC A;  2F3W A;  3GP7 A;  4KJO A;  5G3L D;  1J9O A;  3HOW B;  3KUP A;  5KIX A;  1KDC A;  2K32 A;  1Y69 U;  1YNN C;  2B2T C;  4FXK C;  2WV6 D;  1KNE A;  2EY6 A;  2R61 A;  2GA4 B;  1TU2 B;  5TSS A;  2B8G A;  4KKT A;  2X6G A;  4RA8 A;  1HCZ A;  1LTI D;  4HED A;  1Q8I A;  2XIW A;  5FO7 B;  2XNA C;  1E0B A;  1RTO A;  1FR3 A;  1DXM A;  3H3V C;  2EZV A;  1AZQ A;  1LAC A;  4FXG C;  2VNU D;  4ILW A;  2OT2 A;  2PNR C;  1DJR D;  1F9Q A;  5C3E B;  4RAU C;  4V19 0;  1M8A A;  3EVQ A;  1HTP A;  4ZAI A;  2JA6 B;  5C44 B;  1EZ8 A;  3D8G A;  2WAC A;  3SVM A;  2QCP X;  4RH6 A;  1QWY A;  1TS3 A;  1SYD A;  1PLF A;  3BVZ A;  4TSS A;  3K5O A;  1KAA A;  4TRD A;  2N88 A;  4IUT A;  3GTG B;  4EQO A;  3NQI A;  3G7L A;  3MEH A;  1F9P A;  5C5L A;  2D5D A;  3VR2 A;  2XWJ B;  3MWY W;  2PW7 A;  3A54 A;  5I9P A;  3MFY A;  2AQ2 B;  3UI2 A;  1JOK A;  1HA5 A;  2RKS A;  1SYC A;  3SK4 A;  2Z4H A;  2LY7 A;  1TWH B;  5ISR A;  1S5F D;  2OXP A;  3LX0 A;  1SNP A;  4KHV A;  3AMU A;  2QIL A;  4O1N A;  5C0X I;  2Y0S B;  5AFW A;  4XTC S;  1SE4 A;  4K14 A;  2PO4 A;  2F0I A;  1L0Y B;  3MVV A;  4YIJ A;  1SNM A;  1I4R A;  5JEA G;  3I4L A;  1ZKO A;  2BA1 A;  5C4J B;  2IJ0 A;  5LL6 S;  3EJI A;  2EYH A;  2YYZ A;  1CHP D;  1B9M A;  1ET9 A;  3G6J B;  4V0B A;  3QG1 A;  2TSS A;  3RLF A;  2AUJ D;  2M00 A;  2KA7 A;  4RGN A;  1Q1B A;  2Q8I B;  3S1R B;  3T4A C;  4DNT B;  1BO0 A;  4IUU A;  1CK1 A;  2K5D A;  4H0L C;  5BN5 A;  3BG3 A;  1SND A;  1U4R A;  4XQJ A;  4OGQ C;  1SFO B;  2G9H D;  2SNM A;  4DN4 M;  3GTM B;  1Y8O B;  5C0X H;  3NTI A;  3I72 A;  1BBX C;  2L4N A;  5IOD A;  3M7N A;  1CI3 M;  4KY7 A;  2R6G A;  3K58 A;  3S15 B;  3FDT A;  1BCP C;  1OXX K;  1CA6 A;  1LLR D;  4RFB A;  1RDP D;  3QO2 A;  2B2W A;  2H1E A;  4K5W A;  1TS4 A;  1MI2 A;  2EJF C;  3SK8 A;  3K6O A;  3HGB A;  1LT3 D;  4J6H A;  5IT9 L;  5EKL A;  3W3A A;  3R2T A;  1G91 A;  3DWP A;  4IUP A;  1TKW B;  5EBC A;  4CHT B;  1FNV A;  2VB2 X;  4G7H C;  1Q12 A;  4X3U A;  4E6I A;  1WTR A;  2F0J A;  3BDO A;  1DCZ A;  4DAY A;  1GUN A;  3GV6 A;  1QG7 A;  2B2W C;  5KRU A;  2L0C A;  2D9U A;  3K7A B;  2F0V A;  2NVQ B;  3A56 A;  2EYJ A;  3LWU A;  3KBG A;  3HS0 C;  4XDX A;  4LK1 C;  2ICI A;  2EY5 A;  3VR5 A;  2F0U A;  2BA0 A;  4BBR B;  1M4V A;  4QMG A;  3E5S A;  3L3O C;  2F3V A;  2JP1 A;  3HG9 A;  4WRD A;  1JOQ A;  4KD3 A;  2WKC A;  2L55 A;  2KHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...