1DJRD

Heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl-alpha-d-galactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structure of m-carboxyphenyl-alpha-D-galactopyranoside complexed to heat-labile enterotoxin at 1.3 A resolution: surprising variations in ligand-binding modes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 30
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1999-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1djrD00
1L0XB 3O13A 3BZDB 1V1PB 1SBBB 3BVZA 3TSSA 1JQYD 4UDUC 1QILA 2SEBD 2ICIA 2RDHA 5ELCA 1PRTB 3DWAA 3EA6A 1LO5D 3CHBD 1JCKB 1PTOC 3DWQA 4K6LA 1S5BD 2NTSA 2TSSA 1FNWA 2AQ2B 4C56C 1S5DD 1TS5A 3EFXD 3KLSX 1PRTD 1SE3A 2O2LD 4O1NA 1FNVA 3BYYB 1HTLD 1SJED 4L63B 5FK9C 1EU3A 1LTSD 2XN9C 3R2IA 2RDGA 2XRSD 1PTOD 5FKAC 1SXTA 1I4RA 4RGMA 4RGOS 1S5ED 1EEID 1UUPA 1V1OA 2IJ0A 4DXGA 4DXFA 4RFBA 1STEA 1TS4A 4RH6A 4OHJA 2NTTA 1FNUA 1DYQA 1L0YB 1PTOH 2QILA 1T5XD 3OWEB 1FD7D 4RHRA 1GOZA 1SJHD 3BVMA 1RD9D 1XXGA 1I4HA 1ET6A 1LLRD 1KTKA 4ZYSA 1DJRD 4RGNA 1JR0D 3R2TA 1KLGD 1TS3A 1S5CD 1CT1D 1PTOB 1PZID 1SE2A 3DWPA 1I4QA 1JWMD 1AW7A 2AQ1B 4BWGB 1LTTD 1LT6D 1I4GA 1BCPF 2Z8LA 3SEBA 1F77A 1D6EC 1BCPC 1JWSD 3URYA 1JWUD 1RDPD 1S5FD 4RGTA 2R61A 3MFGA 1CK1A 5ELFA 1LTID 1LT5D 1HA5A 1V1PA 1LT4D 2WV6D 3W2DA 5I4DA 1EFID 2XRQD 5ELDA 1BCPD 3BYTB 3V05A 1I4XA 1ENFA 1FGBD 4TSSA 1XTCD 3MC0B 1HXYD 1D5ZC 1RF2D 4L6TB 1PRTF 4RHSA 1TY2A 3R8BA 1SE4A 1TS2A 2CHBD 4RCOA 5D3DA 1ET9A 1PRTC 5ELEA 1LTGD 1KLUD 1D5MC 1B1ZA 1PZKD 1PTOF 1I4PA 2J4XA 1LTBD 2XNAC 1BXTA 3BVGA 5ELBA 2IPKD 1TY0A 1BCPB 5D3IB 4Z9CB 1EEFD 1EU4A 2G9HD 1ESFA 1LTAD 1CHQD 1B44D 1MD2D 1M4VA 1UNSA 1LT3D 1PZJD 1AN8A 1EWCA 1LTRD 1RCVD 1CHPD 1SEBD 1D5XC 5TSSA 1HQRD 2QEJC 3GP7A 1CQVA 2AQ3B 1G8ZD 1PYWD
chains in the Genus database with same CATH superfamily
2VQEL 3BDLA 1V1PB 4ULLA 2FXQA 1LM0A 4A93G 2UXDL 4X6AH 1Q1BA 2LS01 4LK1C 5C3WA 4N9TA 5KNCA 2RKSA 1EIYB 1JT8A 2RA4A 4C2MB 1F9QA 1A6XA 3BDCA 1PH7A 2NTSA 1QZGA 4XQNA 2Y0SB 5JEAJ 4C56C 2LKVA 4JI3Q 4A3LH 2Q2UA 1ZXTA 1RIPA 4B3ML 1SMYC 1QWYA 2EYJA 4IZ8A 3BJUA 4L63B 2L12A 1MJCA 2OXPA 4Q0FA 4X3UA 3C46A 1VQOA 1WJJA 2EZVA 1AE3A 2IWHA 4LFBL 3S2HB 4G7OC 1BUVT 1VCIA 3U9OA 2IJ0A 1UE1A 5G3LD 1SNQA 4RFBA 3PO3B 4ZK9B 4BY1B 1OXUA 1PTOH 2HT1A 2AKWB 2XTIA 2WAQB 1I4HA 1SFOH 1MBYA 2BCOA 1Z9FA 2WB1G 1IYVA 1HUNA 3GTMH 1JMCA 1LTTD 1PYSB 3RR5A 4CJ1B 5IYCG 1WCMH 3GD7A 4IFDI 4CKCA 5IGDA 2F0HA 3EN2A 2PQAB 5CGKA 1WCMG 3PUXA 1K83B 1EWHA 4K2KA 3NTKA 1LT4D 2KJXA 4KK7A 1JOOA 2B2WA 2Z4IA 1KXLA 4KI0A 2GN5A 1CUKA 2EY1A 1HNZQ 4DV6Q 1G2SA 1IHZA 4WORA 4FF3A 4DV5L 4BBSH 1Y1VH 1TKWB 4K0KQ 1XWEA 3U50C 3S1QH 1UEAB 4HAEA 4HJ8A 2BH8A 3K0YA 1Y1VG 3P75A 4BY7G 1MI2A 3EVQA 3I3CA 3ONAB 1L0WA 3K8AA 2F0DA 4EVOA 4KHVA 3A7AB 2MFIA 2ZXOA 1MD2D 1QG7A 3S9WA 2B2VA 3KDFB 1I50B 2UUBL 1Y69U 4CKBA 2VL6A 1R9TB 1TIID 1ZEQX 2UUCL 3D0FA 2E2IH 1PMRA 2L5TA 5HGQA 1J9OA 4A3FH 4HCEA 5C44H 1XMOL 1FJGL 2I5MX 2JP1A 1QILA 5KRUA 3HOYB 1CQFA 1A62A 1X32A 3HOVG 4DKAC 5C44G 4HSPA 3RN5A 2XWJB 4JBWA 3M85A 4FF1A 5LMNL 4DV4Q 3KLSX 5C4HA 2FINB 4WFN3 4FNFA 4DFAA 4A3MG 4JI7L 2HIXA 4QF4A 1SMXA 4R4TA 4A3GH 1F2ZA 1L2FA 3NQTA 5IP7H 2Q2IA 3HKZB 3JAMc 1SXTA 3H15A 1N33Q 5JJZA 4KY6A 4DXFA 4R8IA 3UDXA 4A3GG 3VYSA 1S40A 3T4AC 5IP7G 4LF9Q 4RHRA 1GOZA 1KDBA 2QCPX 4JYAL 3Q6SA 2E2HH 5M5YB 3R2TA 2K32A 2B2TA 5I9OA 4WRDA 2CCZA 2D0OA 3NTIA 2K05A 4I7AA 2OQKA 1HZCA 3S15B 5FLMG 2XSCA 1YBYA 3QR8A 2B2TC 4OELB 4MTNA 4KKUA 2VUMH 5IT9L 1RODA 2ASBA 4OX9L 4RGTA 5CV6A 1CZWA 1F2LA 2MNAA 1H9RA 4CJ0B 4QQBX 3F2UA 1BCPD 3CQZB 1FGBD 1XTCD 3I70A 1D5ZC 2V1CC 1YNJD 2F0TA 1MJEA 3FPPA 4DAVA 3HOWB 3H6MA 1TS2A 5FO8B 1B70B 5ELEA 2QEXA 2AWNA 3WWVA 2Q8IB 1PA6A 2B63G 1SNOA 1V43A 1VQGA 3E6ZX 2DGYA 1EU4A 2HDLA 1ESFA 5EJWA 3UI2A 3Q22A 1X3PA 1NE3A 1UE6A 2FMCA 1EWCA 2JE6I 2RCFA 4J15A 3TEHB 1A15A 2JA7B 4PZ8A 2R93B 1PV4A 1HQRD 3LWUA 2R7DA 5IGFA 3IFDA 3OHXC 3H3VI 2JEAI 5DEHA 1GHJA 3MXPA 3GTLB 3F1ZA 3BDOA 1HH2P 2BOSA 4JI5L 4DR4L 2VW9A 2KOLA 1TS5A 3MXNB 4EX5A 3M4YA 1H9KA 3RZOB 3MA2B 4JI2Q 2JN4A 3MZ5A 4R4OA 3TMEA 2VXWA 2XN9C 3KLWA 1KABA 5M3MH 3RZDB 1XYIA 4X65L 2YTYA 3PIP3 1S5ED 4JG2A 1EY0A 1VQ6A 3I4LA 1UUPA 3NP8A 3VYRA 1TWFH 3ULPA 1X3QA 1JB3A 1TS4A 4XTCS 2NZHA 4A3JH 1Q3LA 4OWTB 1FD7D 4R1JA 1TWAB 1VS0A 1C4QA 4Q5VA 3HOXB 1NNXA 2Y0SG 4KKTA 2VQEQ 1FGUA 4A3JG 2MHVA 2MO1A 4MZ9A 1C7YA 2UXDQ 2MP1A 1Q8KA 4C3IB 2JA5H 1VQKA 1I4QA 2CKZB 2EYMA 1C0AA 5T1GA 4CDCC 2QGQA 3RLOA 3URYA 4RWSC 2JA5G 4EGVA 2P5ZX 3A8JE 3PO3G 5JJIA 4DV3L 4B3MQ 2NVYH 4BY1G 2EXDA 1Q8IA 4JC0A 3ITPA 3FKIB 1QOHA 2A5HA 1HA5A 4H7BA 5F2DA 1VQBA 2WAQG 1SYCA 2B2YA 1HFGA 2WIIB 1SNMA 2BDOA 4HN7A 1E2ZA 5LMNW 4LFBQ 3S16B 5GADC 4JI0L 2F4IA 3H94A 1E24A 4K2LA 3MC0B 4HIMA 4ZQ3A 2B2YC 2F3IA 2EYLA 4UAIA 2JA6B 2R7ZB 2EPBA 3NBHA 1B1ZA 1Y8NB 3AFPA 3CCJA 5C0XG 3OSOA 3J7AF 1TY0A 1PHJA 5I9PA 5JPMC 4IUTA 4LUOA 2K5QA 4A4IA 2YYZA 5EGTA 3D4DA 5A2QE 3V2TA 5IGGA 3SR1A 2ICEC 2NYZD 3FVQA 1QE6A 1A8VA 2N55A 2M9VA 3E0JA 4NMZA 2L55A 1K8AC 2NB0A 1X3FA 1SYGA 4PQXA 3VA5A 3CU7A 1YIJA 3KBGA 1CTMA 2RDHA 1KIXA 5HGTA 2ZM6Q 4DV5Q 4TVAB 1PH5A 3CW2C 4KHPL 3WOEA 4O1NA 1SE3A 1G6PA 1NJIC 1GM5A 1N34L 3NEMA 1JB7A 1UEBA 2ES2A 2A6HD 1SNCA 5EKIA 3A74A 2RCNA 2X6GA 4YCVA 4YCWA 4GLAC 2EYPA 3OW2A 3PIOA 1CI3M 1X55A 1I6HH 1XNRL 2K50A 1STEA 4M1UB 3HOYG 2UUBQ 5IIFA 1BOSA 1L0YB 5C4ZA 4X62L 2KHJA 3G6EA 1F9RA 1SJHD 2K4KA 2WINB 2UUCQ 1Y14B 1DOLA 3J80L 1GKHA 2KUMA 1UWVA 2PNHA 1IBKL 3UE0A 3B6YA 2I46A 1PTOB 3I8ZA 4DNRB 1XMOQ 1FJGQ 1K8OA 2R3ZA 4OONA 1L1OA 3HKZG 1BCPC 1JE5A 5CV8A 4TQUS 5LMNQ 1TWCH 2R61A 1IYJB 4KV6A 1VQ5A 1YNJC 5M5YH 3I56A 1L1OC 4JI7Q 1HZAA 1SMYD 3SK8A 2WV6D 1QVGA 1O7IA 1B2TA 4G7HC 2G9DA 4YHHL 4NP5A 1TR5A 2EY2A 1DZ1A 3V05A 1HXYD 4L6TB 2D5DA 2CH4A 1SE4A 1WTWA 1PRTC 3FRPB 4JYAQ 1CA5A 3H0GH 3L2PA 5AFWA 3X3MA 4BBSB 2XNAC 1Y1VB 3HRZC 1D1KA 3E5SA 2KENA 3J7YW 1Q81C 1GUOA 1V8QA 3S1QB 1CHQD 3A8KE 2A19A 1H9MA 3L3OC 4IPHA 1EY6A 1VMPA 2EOTA 3DMUA 4OX9Q 3TP6A 1N36L 1YEZA 4K6DA 1EY4A 2IHEA 4BBRH 3HOWG 5IE8A 4OIJA 3RD4A 4MHEA 3HGBA 3CCEA 3BVZA 3A55A 4O42A 5KGUA 4UDUC 3D3RA 3AQQA 3AU7A 4JBKA 1NAPA 2NVQB 4A3FB 1UE7A 2TSSA 1X3GA 3M3YH 2DNCA 5BN3A 5C44B 3CAMA 1S5DD 3DEPA 4JI4L 3OW7A 2JA7G 2R93G 1A63A 3A8IE 4IFDH 1XMQL 4ZCKA 5DNFA 4RGMA 4DR3L 1JOQA 1HCZA 2EJFC 1Q82C 1BBXC 2Z6KA 2PZUA 1EEID 2F0EA 4X66L 4DXGA 4QGUA 3R93A 4A3GB 2CH4W 4E6IA 1X56A 4LUVA 1D8LA 3CCLA 1B9MA 4PNYA 4MN3A 3VR4A 4RMFA 4WJ4A 3OPOA 2K33A 1JWMD 3MVVA 2AQ1B 2F4VL 4P71A 5M5XH 2K14A 1BCPF 2E2HB 4DR1L 2RDFA 1SYDA 5EAYA 1Y8OB 4HJ9A 4OO1G 4G7ZC 4JI5Q 4DR4Q 2PMZB 3PUVA 5M3FH 2F0NA 5C4XB 1VQJA 1PH6A 5K36H 1BR9A 1HTPA 4GNXB 1H9JA 2D62A 2NBFA 2OEOA 1GO3E 3K5NA 4QIWB 2VUMB 4XQQA 3HOXG 5I4DA 4J1MA 4XDXA 4X65Q 2E75C 4I7ZC 1H9SA 2AUJD 4C3IG 1W2BA 2BA0A 2NUCA 4DK0A 1PRTF 2H1EA 3NQIA 2PO4A 5JEAH 1E1OA 1ONLA 5I6YA 3H3VC 2K5HA 1EWIA 3T51B 2F03A 2D2CC 3NWTA 3QOJA 5T1IA 4JPBW 2KCMA 1OO9B 1TXYA 5JEAG 1E1TA 3ND9A 3FKIG 4NB3A 5ELBA 1WFQA 4BXXG 3G7LA 2VS1A 4IFDJ 2VQFL 3Q24A 4C1NI 3FMCA 4AIMA 2B29A 1D2BA 3PSIA 3CC2A 2EYFA 2JA6G 4GKJL 2F0VA 2R7ZG 4L5SA 1SBBB 4KY7A 3AYHB 3TSSA 4JI0Q 1OXTA 1IL8A 2A6HC 3CPWA 5IT9E 4IPCA 4ZUIA 2WKCA 3HFZB 1YVCA 1AH9A 1XNQL 1AZQA 4N9PA 2O2LD 1KHIA 5A35A 3SDZA 3NELA 5FK9C 1QNKA 5KNDA 4ODGA 4PMCA 4A75A 3AMUA 4CJ2C 1K73C 3NBIA 4YY3L 3E9HA 4WJWA 2N78A 1BQQT 3MEFA 2D0PA 3JC66 3M4OB 5DM73 5M3MB 4RH6A 4OHJA 2X6LA 5IYDG 3KF8A 3D31A 3KK7A 2X69A 4G4KA 2FJ2A 4RG1A 4POFA 1TWFB 2KA7A 3IKJA 4A3JB 3TRZA 3KJOA 1Z47A 2RBMA 1HZ9A 2B8GA 1FYCA 4DAPA 5IGCA 4C3JH 1WTVA 1I4GA 4A3LG 4HJAA 4QMGA 4KHPQ 4F8MA 4V190 5ELNA 2JA5B 4LMQD 4XIGS 3RN2A 2VY3A 1R4QB 1N34Q 3G4SA 2F0GA 3PF5A 2K04A 4J8QA 3I72A 1EFID 2NVYB 1KDAA 4HMJA 1I94L 2KQ3A 1YITA 2E2JH 3Q23A 2EIFA 1ICWA 1GUSA 1HQMC 1TY2A 1ML0D 4IURA 3AB9A 1IBKQ 4DR7L 2A1AA 1PTOF 2L1BA 2ZJQA 4OWWB 3M4PA 4DF7A 3S14H 1ASYA 4JV5L 1O80A 3L9AX 1B7YB 3C3LA 1EQTA 5GAGC 3SK6A 2QDBA 4GNXA 4C1NK 4L8JA 1AFPA 5AJ3L 2EQSA 3EIVA 1K3RA 1S4ZA 3CC4A 2B2WC 4YWMA 1E2WA 4LW1A 1K8GA 1VQ4A 1ZYRD 1U4RA 1VF7A 4IUPA 4YHHQ 2EJGC 4CDFC 3A5ZB 1GD7A 4BBSG 2HCCA 1DOKA 1BDOA 2O5JC 1E2VA 2CQOA 1DCZA 3GTQB 3MWYW 1AP0A 3STBD 1STYA 4B9XA 2BE5D 1STAA 4AQYL 3DM3A 2HD3A 4XT1B 4QL5A 3K58A 4OWXB 3CD6A 3NTHA 2B2VC 2VZAA 2NVQH 3BU2A 1B3QA 1IZ6A 2MJ8A 4ZYSA 5IODA 2EVBA 4DAYB 1N36Q 1QUQB 4LF7L 1RD9D 4C3HH 4A3FG 1MSGA 1I6HB 4JI1L 3OIPA 2PQEA 2R92H 1S5CD 3QO2A 2UXCL 5CV5A 1PZID 3K7AB 3LNNA 4C3HG 5J3BA 2Z0SA 2C9OA 2I5LX 1DONA 3QOLA 3E0EA 3RUZA 4IUQA 1EY7A 3KBXA 4JI4Q 2JA8B 1EIGA 5ELFA 3QJYA 1X3EA 1LT5D 1V1PA 1TWHH 3ULLA 1RTOA 3D6WA 3GQBA 2DY8A 1LACA 2VNUD 1TT2A 1TWCB 1F9SA 1R4PB 4DR3Q 2F0WA 1I4XA 2PYKA 1S72A 4X66Q 5DM63 4EQOA 2DNEA 5C4XH 3ULJA 4AYBE 1DD2A 3M7GA 2C5CA 1YHBA 4TKOB 5CV4A 1HNWL 2ALYB 1K0RA 2LMCB 5BR8L 2OWOA 4H44C 5C5MA 2CWAA 1PFMA 5C4XG 2PW7A 3M4QA 3SK4A 5ISRA 2J0TD 4YWLA 3DHQA 5D3IB 2UUAL 4K14A 2JXMB 4V0BA 3W1BA 2J7ZA 3H0GB 2F4VQ 2VUMG 3HOZH 3W3AA 2K6AA 4DR1Q 3UDFA 4OL7A 3UE1A 1F2YA 1X54A 1UNSA 4UY8C 1PZJD 3J80E 2E5LL 3U4ZA 4ZAIA 1D5XC 1B53A 1VQLA 1A3TA 2KEEA 1XPRA 3BZDB 4PZ7A 1QNUA 2EXZA 1HPCA 1ENAA 4NDXA 3GTKB 4BBRB 5GQOA 2E76C 2F0LA 4K6LA 1G291 2PQAA 1W6KA 2AMCB 1N32L 3OIQA 5E3FA 2RSNA 4IUVA 5KYLA 2B3GA 1PRTD 3GTGH 3BYYB 3TN2A 4ME5A 1HTLD 1SJED 4XYOA 2K01A 2DJFC 2KCTA 3M3YB 3I7FA 2H4OA 3CMEA 1D7QA 4B9WA 3TREA 4RGOS 3S2DH 1EIFA 2GVBA 2YV5A 2CVRA 2VQFQ 1JC7A 4LF8L 4X64L 3HG9A 1G51A 2QILA 1W6JA 3OWEB 5IY0A 1O7ZA 4APVA 1ET6A 3I2ZA 1BKBA 1KTKA 4NXNL 5EKLA 1TS3A 4GKJQ 5C5LA 3TZUA 2PI2A 2GA4B 2IX1A 1GUGA 2WB1E 5COYA 2OCEA 2F3WA 4HEDA 1LT6D 3M4OH 2AHOB 5FLXL 3OTOQ 4Y7NH 4DAMA 4CDEC 3KDFA 4ILWA 3PUYA 3TDQA 3CRLC 1XNQQ 4XYQA 1Q7YC 5JJKA 5M3MG 5M5XB 1ENCA 4KN7C 5LMUL 1T9HA 3T1HL 4O0AA 4XXEA 3J81L 4LF4L 5M3FB 4YY3Q 1K0SA 3UDIA 2H5XA 1QUQA 1MKHA 3CCSA 3MHBA 3BG3A 3E9IA 2VB2X 1TQOA 3R8BA 4RCOA 3VA7A 2CHBD 4B3RL 1CKOA 3NXWA 1LTGD 3CP0A 3HS0C 3CF5A 4DV0L 3T56B 4B3TL 2CQAA 1VQAA 1GVPA 4LFCL 2PW5A 1ZYRC 3VR3A 4HCSA 1B44D 3F2BA 4RKLA 4F88A 3SE0A 1HZBA 5BN5A 2BA1A 2L0CA 2NVXB 1NBWA 4IUUA 1SYFA 3STBC 1BBWA 1VF5C 2XGTA 3CMAA 2JSOA 2BE5C 2I07B 3SVMA 2AWOA 3PUWA 3E3XA 2F0KA 3TBIB 5I6WA 1PFSA 3J80i 2WACA 2EE1A 4HIDA 5E1FA 4JI6L 3EA6A 4A3DH 1PXUA 4A3KH 2A74C 1O78A 1PDQA 4KLKA 1VMCA 4FF4A 3DXJC 4DR7Q 5BN4A 3S1MH 4JV5Q 1FVIA 1PTOD 1MIUA 3FDTA 2ATWA 4WJ3M 2EYHA 1KQSA 2NVTH 3GTQH 5JJLA 5AJ3Q 1WTPA 4GOPB 4A3IH 4CKEA 4A3BH 3BVMA 3VR6A 4RA8A 1BVSA 3QIAA 4RGNA 3I4MH 1KLGD 5IP9H 1HRJA 2E74C 3I4OA 3ICEA 1SE2A 2UXBL 3PF4A 4BWGB 3NSWA 5IP9G 4DNIA 1EZ8A 1MHWC 3GO5A 1RKNA 1ILPA 3GV3A 1S5FD 3EJIA 4KD4A 4C3JB 4QUCA 3RMHA 3FP9A 4AQYQ 1NR4A 1AE2A 5CC4A 1ILQA 4RKBA 3K7AH 2HCIA 1V9PA 2HUGA 4NPSA 1OXSC 3K80C 2MGSA 1GJXA 1FR3A 3I4NH 1UE5A 2A73B 4A3EB 4LJZC 1KC8C 4HTHA 2JA8H 4U68A 4KKSA 3MXNA 3I4NG 1WVLA 4LF7Q 4HR7B 4L5TA 3TS2A 2N8NA 1D5MC 2E2JB 4JI1Q 2JA8G 4JOIA 2UXCQ 2UU9L 1YJ9A 5HURA 4GKKL 3D4RA 4FO2A 1STBA 1EEFD 3MXUA 1LTAD 4IOCA 5C0XJ 1NSNS 4JI8L 1M90C 3S14B 1PH2A 5C3EH 5NUCA 3CCMA 2F0JA 3UDGA 2NN6I 1SROA 2QEJC 3DUZA 1I3QH 1G8ZD 2DUDA 2QKIC 5CV9A 4ID6A 1M1KC 1EY8A 2K5DA 4A76A 5M5WH 2ZXPA 4EQPA 2ZTEA 4IQZA 2A69D 3J7A5 2ICIA 1DM0B 3H0GG 4R9WA 4P75A 5DAUA 3KUPA 1HNWQ 5BR8Q 3PMFA 3JAML 5FO7B 4ZKBB 1QJOA 3K5MA 1DXMA 2A8VA 3GTKH 2RDGA 3GTPH 3GTJB 2UUAQ 2E2DC 2LSSA 1VQEA 5LL6X 1QCBD 5CYUA 4S3SA 1Y1WH 4BBRG 5EQ0A 1GHKA 2E5LQ 1PH8A 5JVH3 2M00A 4G57A 3VYTA 3P1HA 3J7AV 1DJRD 1JOKA 4FXDA 3KLSA 2Y0SE 1GUTA 2QW7A 2EDGA 3L7ZC 3CPFA 4C3HB 2JA9A 2K03A 5LL6S 1PVOA 3CCUA 2HQEA 5FOBB 1D6EC 2R92B 2N88A 2MQHA 1K28A 1N32Q 4GN5A 3CRKC 3TZDA 5IOCA 3IFTA 4CBVA 4LF6L 1K8MA 1AZPA 4IFDG 3PIPA 5JPNC 5IT9c 5CV7A 3HOUB 2Z6KC 4F7XA 2F0FA 4FVMA 3ZJYC 4J6HA 4LF8Q 4X64Q 4P2CB 1TWHB 5C4JH 3MEHA 1BBUA 5D3DA 5C0XI 4DV2L 4MNOA 4A3CH 4NXNQ 1I4PA 3H09A 4UPAA 1PH4A 1WOCA 3S1RB 1IKLA 1S3OA 4YCUA 4Z9CB 1M8AA 3CCVA 4A3CG 1H95A 5M3FG 2SOBA 4GLXA 5K36G 3G48A 1W3SA 3TP5A 2MO0A 4P73A 1LTRD 4BA1I 1CHPD 3MFYA 5E4WC 4EQ5A 1HR0L 1PLFA 3HOZB 3A56A 5K5PA 4KY5A 3T1HQ 2Z9HA 4K8IA 3TS0A 4LF4Q 4LF5L 1BO0A 2ZJPA 1WTOA 4DPGA 3PO2H 1SYEA 5ELOA 3QWNA 2B39A 1PTOC 4DK6C 4X3KA 5KYIA 2BH2A 3LGJA 2NVXH 3RLFA 1IKMA 4B3RQ 2EY6A 2PI2E 2FMMA 2SDFA 4DV0Q 4DR6L 4B3TQ 4JW0A 4XT3B 3Q0AA 1TU2B 1EU3A 4DV3Q 4LFCQ 2XRSD 1IL2A 1KNAA 1EY9A 3GTGB 1B9NA 2V4DA 2F0IA 4OXPA 2YTXA 2OTJA 3BS1A 2NTTA 4RAUC 1DYQA 4JBMA 3QG1A 3S2DB 1XXGA 2RHSB 1SE8A 1LLRD 2CWPA 2WP8J 4YIJA 4DUZL 3M7NA 1F9PA 1EQRA 3DWPA 4L5QA 2FFKB 2B2UA 3C1FA 1CKNB 4Y52H 1JWSD 5E4XA 1JWUD 1EYGA 1TWGB 3FHWA 3HKZE 2K5NA 2B2UC 4I65A 2Q8RE 2NZOA 1XTDA 4Y7NB 1A2UA 1CFMA 2OQ0A 4DK3C 2L9HA 2JK8A 2KHIA 2YU9H 2ZTCA 1SLJA 1J5EL 1KAAA 4A93H 5JVG3 3W5OA 3VYUA 3IAYA 1WD1A 1JORA 1WYDA 1ET9A 4KHZA 2HIVA 1VQFA 4C3JG 5H1SE 4UP7A 3BVGA 2JJQA 4PG3A 5EPLA 2UXBQ 1DGSA 4A3EH 3DM1A 3AEVA 1LABA 2A69C 1E3PA 1AN8A 2LFNA 3IRBA 4ZLTF 2F52A 4A3EG 1SEBD 1XNRQ 4AH6A 4OGQC 2AQ3B 4O2DA 2PZWA 1WTRA 4X62Q 3H3VH 3O13A 3SXHA 3U4VA 1OXVA 3S17H 1NR2A 1Q12A 5FLXE 2PCFB 3ZYYX 1BF4A 1O7LA 2YTVA 5C3XA 1QB5D 1LO5D 3DWQA 2NZ1D 4OIKA 5IYCH 3QB3A 2RHQB 1EY5A 4IJLA 1FNVA 3J81E 4A3DB 1WTHA 3SHLA 2UU9Q 4GKKQ 4GNXC 4A3KB 1N8RC 2B8FA 5JOBA 1I4RA 1U4MA 1A3UA 4JI8Q 4ZUJA 1K9MC 2Q2HA 3S1MB 2VB3X 3T1YL 2QA4A 2F0OA 2NVTB 1PH1A 3GTJH 3NHHA 4A3IB 2ZM6L 3A5UA 5J1ZA 1HR0W 3J80c 4OO1I 4A3BB 4BY7H 1AW7A 1F2MA 3L0OA 5IWAL 2F1MA 2ZT9C 4DUYL 4DR5L 3I4MB 2I0QA 3PGZA 4IJHA 3RLNA 1XJVA 1YZ6A 4FXKC 2XWBB 4F87A 1KRSA 3BYTB 4HJ5A 3RNUA 1JJ2A 2JEBI 1SYBA 1HFNA 3F2DA 1E22A 1U4PA 2JQOA 1X65A 2ENBA 2KCCA 1XPUA 2R92G 3HOVH 1HUMA 1STNA 3I4NB 5IGBA 1U5KA 3HOUH 1CKNA 2J4XA 1YI2A 4A3MH 5D14A 3CXCA 1YNXA 2EY5A 2F0SA 1RL2A 2PNRC 1SN8A 3HOUG 4JCVE 3ERSX 1I5FA 3PUZA 3WOFA 1XMQQ 1M4VA 3FPUB 1LT3D 5EKKA 2KHSA 5L37A 1CA6A 4LF6Q 1VQCA 3KJPA 3GP7A 1CQVA 4LUZA 3PIO3 1PYWD 3S1RH 2LXKA 4BA2I 5C3EB 3MAQA 2JYOA 1E7ZA 4GZYC 1NMFA 1I3QB 1JCKB 5M5WB 3OOCA 1ESRA 1QVCA 2CFMA 4LFAL 2AQ2B 2A6ED 5FLMH 4ALPA 3GV6A 3A54A 3EFXD 4FP5D 2IL8A 2Q2TA 4DV2Q 4P74A 3HOZG 2WKDA 3NBHB 4NXML 1Z6HA 2MUYA 3EROA 3KF6B 1EOTA 3D4WA 2M2LA 5FKAC 1C48A 5D65A 5FJ8H 2K5WA 4OEMB 3GTOH 5EBDA 1V1OA 3J81i 1WTQA 1Q86C 3MTSA 3HEJA 2NWGA 3GTPB 3ND8A 2A68D 4HSVA 4GS3A 1EQVA 5FJ8G 1HR0Q 3K81C 4CGYB 1HNXL 1PFBA 1IW7C 1Y1WB 3K59A 1PH9A 2IX0A 1QVFA 4LF5Q 5KNBA 3IL8A 3V96A 3CCRA 1YJWA 2B63H 1SSOA 3I73A 4LWCA 2IHFA 4GN3B 5EBCA 4ZRZA 1RDPD 2N3SA 4KD3A 4GLVB 4DR6Q 4PMBA 4DGZA 4ZKCB 1IBLL 4FDBA 3W2DA 3KLRA 3NPPA 1U9RA 3I91A 4IO9A 1ASZA 1Z7TA 1E0BA 4IN3A 1GUNA 2NN6H 2FHTA 2QDLA 1TWGH 5KIXA 2RF4A 1HJPA 5GAEC 1NUCA 3JAME 1YJNA 2K75A 2NN6G 2L11A 1EFWA 1PZKD 4IUNA 4R4QA 5C4JB 3GDEA 4DUZQ 4B3SL 1BCPB 3TQYA 3K6OA 4DU9A 3X3NA 1SAPA 1VQHA 5J39A 1B50A 4MIUA 4PMWA 1L1OB 4UP8A 4DAYA 3OMGA 5KEEA 1X9NA 1HHVA 2F0UA 3J81j 3WDNA 1EYAA 1KAWA 1PYBA 4C2MH 4QUFA 4K5WA 3NUCA 2K28A 4DR2L 2OTLA 1XX8A 1KL9A 3DLLA 2SEBD 3MXGA 5ELCA 1V1QA 1VDZA 4DV7L 1J5EQ 1PRTB 1G2TA 3EBEA 1TVXA 4DV1L 1OTCA 1XPOA 3DEOA 3PO2B 2F0QA 1STHA 4X3TA 1VQ9A 4IPDA 3S2HH 4K5VA 1CM9A 4M8AA 4FYDA 3PO3H 2C35B 3R2IA 3NWSA 2RQXA 4BY1H 4JK1C 4R8NA 4DN4M 4NW2A 2BDNA 1T5EA 4X3SA 1IBML 3U9SA 2Z1CA 1I94Q 1FNUA 4JBJA 3KYHC 3VDYA 3S1NB 1EQQA 1VQMA 2GVAA 2HHHL 1K3BC 2ZXRA 1Q90A 5EPKA 1VQ7A 4A3DG 4AYBB 2TMPA 2K5VA 5C0XH 1K83H 4A3KG 1II3A 5M9OA 1B3AA 1BNZA 4UHVA 3KF6A 2HDMA 3MFGA 1CK1A 1FL0A 3TP7A 4FF2A 1Q46A 3LX0A 3VR2A 4PZ6A 2O5IC 4JVZA 4A3IG 2K7VA 3N6RA 1ENFA 4TSSA 4A3BG 1EOVA 2AUKA 4YWKA 2LXJA 3T1YQ 1A2TA 3I4MG 1B4OA 4JI3L 1LV9A 2YU9B 4A93B 2D9UA 2F0MA 1LUZA 2PMZE 4RCNA 1I50H 1EIHA 3PQIA 3PCOB 5G3LF 2CW0D 2R7FA 3JAMi 1R9TH 2N49A 2PPBC 5IWAQ 4QCLA 1HA6A 3A7LA 4DUYQ 4DR5Q 4QIWE 2WFWA 2HQLA 1JICA 1VQ8A 3LWEA 1VQIA 1RCVD 1YNND 3NE5B 3HKSA 2A6EC 3HOYH 1JJGA 1Q1EA 1STGA 1L0XB 3K5OA 2Z6BA 1EYCA 5FO9B 4KMUC 3T13A 1EYDA 1I6VC 3DWAA 4HJ7A 3CHBD 4R4IA 1JE4A 1H9SB 4EQNA 1S5BD 3S17B 5I2XA 2F3VA 4JOIC 2WB1B 2KEDA 2A68C 3CC7A 2I5HA 1IYUA 3HZXA 1UAPA 1SFOB 3TP8A 3PV0A 3R3OA 3D6CA 3A0JA 2IW3A 2L4NA 5C3EG 4DV6L 1HNZL 3GTMB 1CKMA 1IXRA 1KRTA 3K57A 1PFNA 1SNDA 3BZKA 1WCMB 4U673 4K0KL 1T5XD 3NENA 4XQJA 2ID0A 5LHY1 2XVSA 3S15H 1AEXA 2L15A 1EUJA 2K1BA 1JR0D 3F2CA 1ZKOA 2DJGC 2E8GA 3VR5A 4PV1C 3BZCA 1RHPA 1WD0A 1U4LA 3T53B 1SDFA 3SEBA 1P8LA 3CCQA 4IPGA 5CBEE 4LFAQ 3ERQA 1JJCB 4CDDC 1NCVA 3SGIA 4BY7B 3G6JB 5E7NA 5J22A 1CSPA 3CQZH 4QB4A 1LTID 4P72A 4NXMQ 1KDCA 2EJMA 4GN4B 2XRQD 3HOWH 1Y1WG 5ELDA 4LNQA 2LY7A 3W1GA 5CMDA 2Q8TA 1A0IA 4IALA 1RF2D 3C1EA 3S24A 1X6OA 4RHSA 1Y8PB 2KVMA 2O4XA 4DV4L 3KF8B 1KLUD 1HNXQ 3NK9A 1NMGA 2XIWA 2Z4HA 2E2IB 2G5DA 3Q8DA 1SNPA 4UP9A 4DK1A 2IPKD 2JA7H 1EZ6A 2R93H 3HOVB 3N52A 3U58A 1N33L 3EQLC 4HIOA 4FXGC 1YHAA 4GOPA 1EL0A 3SK5A 3KFUA 2WAQE 1OXXK 5I2YA 4A3MB 1WI5A 2F0PA 3P7JA 3K7UC 5DLQE 4LF9L 2PZTA 3M9BA 4H13C 4R4CA 1O7YA 4HMIA 5HY6A 4BS9A 5JAVA 3GTLH 2IX3A 2RSOA 4GOPC 2IY5B 2MPMA 1IBLQ 1G6ZA 1P16A 1J8IA 4QJFA 1JQYD 2K52A 3RZOH 2EYOA 1MSHA 1FNWA 1A3VA 3K0XA 3RZDH 1DOMA 3AFQA 4OO1H 2KECA 2SNMA 4ABNA 2KCNA 4B3SQ 1LTSD 5CBAE 1G91A 2OT2A 3J7ZC 4KJNA 5LMUQ 1LYLA 1TWAH 3HOXH 1SRUA 4MTKA 2RVLA 1KD1C 3FEWX 4B08A 1C8CA 2QF7A 4IOAA 1C9OA 5A2QL 3ER0A 2IT1A 2DY7A 3OMCA 3G71A 4C3IH 3GTOB 1NTGA 4QY7A 4CHTB 4KJOA 3PO2G 5CORA 3I90A 1J6QA 1VQDA 4DA2A 4DR2Q 4KN4C 1WTXA 1CT1D 1QZHA 5C6AA 3C2PA 3T16A 5IGEA 4DV7Q 1ICFB 2Z8LA 1F77A 1CZGA 3FKIH 4H02A 4DV1Q 4BXXH 3S1NH 1GUWA 1YHQA 5IYBH 4KTAA 5FLXc 3S16H 2OF1A 5EPJA 4N8X1 2KBNA 3H91A 5GAHC 2B63B 1B8AA 4NKLA 4TRDA 3I55A 1MGSA 3D8GA 3K5LA 5IYBG 5CR3A 1VQPA 4N8FA 3OWFA 4HIKA 2JA6H 2R7ZH 4AYBG 3J81c 1IBMQ 4LAAA 4ME3A 2CW0C 1D1IA 4H0LC 4JI6Q 4L5RC 3KOJA 1PH3A 3F8TA 4POGA 1GXDC 2HHHQ 1N9WA 1YNNC 3OYYA 4JI2L 1IW7D 1LTBD 1RTNA 1BXTA 1SR3A 3HP3A 3OTOL 4DNTB 1U0LA 2G9HD 1NY4A 1KNEA 2ZJRA 2DN8A 3P20A 2R6GA 3CKIB 1LTLA 1RJTA 5GROA 2SNSA 2ZTDA 1CSQA 1VQNA 5TSSA 4K5XA 4K8JA 5IYDH
chains in the Genus database with same CATH topology
3BDLA 1V1PB 4ULLA 1Q1BA 2LS01 4LK1C 5KNCA 4N9TA 5C3WA 2RKSA 2RA4A 4C2MB 1F9QA 1A6XA 3BDCA 2NTSA 4XQNA 2Y0SB 5JEAJ 4C56C 2LKVA 1ZXTA 1SMYC 1QWYA 2EYJA 4IZ8A 4L63B 2L12A 2OXPA 4Q0FA 4X3UA 3C46A 2EZVA 2IWHA 3S2HB 4G7OC 1BUVT 1VCIA 3U9OA 2IJ0A 5G3LD 3PO3B 1SNQA 4RFBA 4ZK9B 4BY1B 1OXUA 1PTOH 2WAQB 1I4HA 1MBYA 2BCOA 1IYVA 1HUNA 1LTTD 4CJ1B 3GD7A 4IFDI 4CKCA 5IGDA 2F0HA 5CGKA 3PUXA 1K83B 1EWHA 4K2KA 3NTKA 1LT4D 2KJXA 4KK7A 1JOOA 2B2WA 2Z4IA 4KI0A 2EY1A 1G2SA 1IHZA 4WORA 4FF3A 1TKWB 1XWEA 1UEAB 4HAEA 3K0YA 3P75A 1MI2A 3EVQA 3I3CA 3ONAB 2F0DA 4EVOA 4KHVA 3A7AB 2ZXOA 1MD2D 1QG7A 3S9WA 2B2VA 1I50B 1Y69U 4CKBA 1R9TB 1TIID 1ZEQX 1PMRA 2L5TA 1J9OA 4HCEA 2JP1A 1QILA 5KRUA 3HOYB 1CQFA 1X32A 4HSPA 2XWJB 4JBWA 3M85A 4FF1A 3KLSX 5C4HA 2FINB 4WFN3 4FNFA 4DFAA 4QF4A 1F2ZA 3NQTA 3HKZB 1SXTA 5JJZA 4KY6A 4DXFA 4R8IA 3VYSA 3T4AC 4RHRA 1GOZA 1KDBA 2QCPX 3Q6SA 5M5YB 3R2TA 2K32A 2B2TA 5I9OA 4WRDA 3NTIA 2K05A 3S15B 2XSCA 2B2TC 4KKUA 5IT9L 1RODA 4RGTA 5CV6A 1CZWA 1F2LA 1H9RA 4CJ0B 3F2UA 1BCPD 3CQZB 1FGBD 1XTCD 3I70A 1D5ZC 1YNJD 2F0TA 3FPPA 4DAVA 3HOWB 3H6MA 1TS2A 5FO8B 5ELEA 2AWNA 2Q8IB 1SNOA 1V43A 3E6ZX 2HDLA 1EU4A 5EJWA 1ESFA 3UI2A 3Q22A 1X3PA 2FMCA 1EWCA 2JE6I 1A15A 2JA7B 2R93B 1HQRD 3LWUA 5IGFA 3IFDA 3OHXC 2JEAI 5DEHA 1GHJA 3MXPA 3GTLB 3BDOA 2BOSA 2KOLA 1TS5A 3M4YA 1H9KA 3RZOB 3MA2B 3MZ5A 3TMEA 2VXWA 2XN9C 1KABA 3RZDB 1XYIA 3PIP3 1S5ED 1EY0A 3I4LA 1UUPA 3NP8A 3VYRA 1X3QA 1JB3A 1TS4A 4XTCS 1Q3LA 1FD7D 1TWAB 1C4QA 4Q5VA 3HOXB 4KKTA 2MHVA 2MP1A 4C3IB 1I4QA 2EYMA 5T1GA 3URYA 4RWSC 4EGVA 3A8JE 1Q8IA 3ITPA 3FKIB 1QOHA 2A5HA 1HA5A 4H7BA 5F2DA 1SYCA 2B2YA 1HFGA 2WIIB 1SNMA 2BDOA 4HN7A 1E2ZA 3S16B 2F4IA 3H94A 4K2LA 3MC0B 4ZQ3A 2B2YC 2EYLA 4UAIA 2JA6B 2R7ZB 2EPBA 3NBHA 1B1ZA 1Y8NB 5C0XG 3OSOA 3J7AF 1TY0A 5I9PA 5JPMC 4IUTA 2K5QA 2YYZA 5EGTA 3D4DA 5A2QE 3V2TA 5IGGA 3SR1A 2ICEC 2NYZD 3FVQA 1QE6A 2N55A 2M9VA 3E0JA 4NMZA 2L55A 2NB0A 1SYGA 4PQXA 3VA5A 3CU7A 3KBGA 1CTMA 2RDHA 5HGTA 3WOEA 4O1NA 1SE3A 2A6HD 1SNCA 5EKIA 2X6GA 2EYPA 1CI3M 1STEA 4M1UB 5IIFA 1BOSA 1L0YB 5C4ZA 1F9RA 1SJHD 2WINB 1DOLA 3J80L 2KUMA 2I46A 1PTOB 3I8ZA 4DNRB 1K8OA 2R3ZA 1BCPC 5CV8A 4TQUS 2R61A 4KV6A 1YNJC 1SMYD 3SK8A 2WV6D 1B2TA 4G7HC 2G9DA 4NP5A 1TR5A 2EY2A 1DZ1A 3V05A 1HXYD 4L6TB 2D5DA 1SE4A 1WTWA 1PRTC 3FRPB 1CA5A 5AFWA 3X3MA 4BBSB 2XNAC 1Y1VB 1D1KA 3HRZC 3E5SA 3J7YW 1GUOA 1V8QA 3S1QB 1CHQD 3A8KE 1H9MA 3L3OC 1EY6A 1VMPA 2EOTA 3DMUA 3TP6A 4K6DA 1EY4A 4OIJA 3RD4A 4MHEA 3HGBA 3BVZA 3A55A 4O42A 5KGUA 4UDUC 3D3RA 3AU7A 1NAPA 2NVQB 4A3FB 2TSSA 2DNCA 5BN3A 5C44B 3DEPA 1S5DD 3OW7A 3A8IE 4IFDH 5DNFA 4RGMA 1JOQA 1HCZA 2EJFC 1BBXC 2PZUA 1EEID 2F0EA 4DXGA 3R93A 4A3GB 4E6IA 1B9MA 4PNYA 4MN3A 3VR4A 3OPOA 2K33A 1JWMD 3MVVA 2AQ1B 1BCPF 2E2HB 2RDFA 1SYDA 1Y8OB 4OO1G 4G7ZC 2PMZB 3PUVA 2F0NA 5C4XB 5K36H 1BR9A 1HTPA 1H9JA 2D62A 2NBFA 2OEOA 3K5NA 4QIWB 2VUMB 4XQQA 5I4DA 4J1MA 4XDXA 2E75C 4I7ZC 1H9SA 2AUJD 4C3IG 2BA0A 2NUCA 4DK0A 1PRTF 2H1EA 3NQIA 2PO4A 5JEAH 1ONLA 5I6YA 3H3VC 3T51B 2F03A 2D2CC 3NWTA 3QOJA 5T1IA 1OO9B 5JEAG 3ND9A 5ELBA 3G7LA 4IFDJ 3Q24A 4C1NI 3FMCA 1D2BA 2EYFA 2F0VA 1SBBB 4KY7A 3TSSA 1OXTA 1IL8A 2A6HC 5IT9E 4ZUIA 2WKCA 1AZQA 4N9PA 2O2LD 5A35A 3SDZA 5FK9C 1QNKA 5KNDA 4ODGA 4PMCA 3AMUA 4CJ2C 3NBIA 4WJWA 1BQQT 3M4OB 5DM73 5M3MB 4RH6A 4OHJA 2X6LA 3KF8A 3D31A 3KK7A 2X69A 4G4KA 2FJ2A 1TWFB 2KA7A 3IKJA 4A3JB 1Z47A 2RBMA 2B8GA 1FYCA 4DAPA 5IGCA 1WTVA 1I4GA 4QMGA 4F8MA 4V190 2JA5B 4LMQD 4XIGS 1R4QB 2F0GA 2K04A 4J8QA 3I72A 1EFID 2NVYB 1KDAA 4HMJA 2KQ3A 3Q23A 1ICWA 1GUSA 1HQMC 1TY2A 1ML0D 4IURA 3AB9A 1PTOF 2L1BA 4DF7A 1O80A 3L9AX 3C3LA 1EQTA 3SK6A 2QDBA 4C1NK 4L8JA 1AFPA 1S4ZA 2B2WC 1E2WA 1ZYRD 1U4RA 1VF7A 4IUPA 2EJGC 2HCCA 1DOKA 1BDOA 2O5JC 1E2VA 1DCZA 3GTQB 3MWYW 1AP0A 1STYA 4B9XA 2BE5D 1STAA 4XT1B 3K58A 3NTHA 2B2VC 2MJ8A 4ZYSA 5IODA 2EVBA 1RD9D 1MSGA 1I6HB 3OIPA 2PQEA 1S5CD 3QO2A 5CV5A 1PZID 3K7AB 3LNNA 4C3HG 2C9OA 1DONA 3QOLA 3RUZA 4IUQA 1EY7A 3KBXA 2JA8B 1EIGA 5ELFA 3QJYA 1LT5D 1V1PA 1RTOA 3D6WA 3GQBA 2DY8A 1LACA 2VNUD 1TT2A 1TWCB 1F9SA 1R4PB 2F0WA 1I4XA 2PYKA 5DM63 4EQOA 2DNEA 1DD2A 3M7GA 2C5CA 4TKOB 5CV4A 2LMCB 4H44C 5C5MA 1PFMA 2PW7A 3SK4A 5ISRA 2J0TD 3DHQA 5D3IB 4K14A 2JXMB 4V0BA 2J7ZA 3H0GB 3W3AA 2K6AA 4OL7A 1F2YA 1UNSA 1PZJD 3J80E 4ZAIA 1D5XC 1B53A 1A3TA 2KEEA 3BZDB 1QNUA 2EXZA 1HPCA 1ENAA 4NDXA 3GTKB 4BBRB 2E76C 2F0LA 4K6LA 1G291 1W6KA 3OIQA 5E3FA 2RSNA 4IUVA 5KYLA 1PRTD 3BYYB 3TN2A 4ME5A 1HTLD 1SJED 4XYOA 2K01A 3M3YB 2H4OA 4B9WA 4RGOS 2CVRA 1JC7A 3HG9A 2QILA 1W6JA 3OWEB 1O7ZA 1ET6A 1KTKA 5EKLA 1TS3A 5C5LA 3TZUA 2GA4B 2IX1A 1GUGA 5COYA 2F3WA 4HEDA 1LT6D 5FLXL 4ILWA 3PUYA 3TDQA 3CRLC 4XYQA 5M5XB 1ENCA 4KN7C 4XXEA 3J81L 5M3FB 3MHBA 3BG3A 2VB2X 1TQOA 3R8BA 4RCOA 3VA7A 2CHBD 3NXWA 1LTGD 3HS0C 3T56B 2CQAA 2PW5A 1ZYRC 3VR3A 4HCSA 1B44D 4RKLA 4F88A 3SE0A 5BN5A 2BA1A 2L0CA 2NVXB 4IUUA 1SYFA 1VF5C 2JSOA 2BE5C 2I07B 3SVMA 2AWOA 3PUWA 2F0KA 3TBIB 5I6WA 2WACA 2EE1A 5E1FA 3EA6A 1PXUA 2A74C 1O78A 1PDQA 1VMCA 4FF4A 3DXJC 5BN4A 1PTOD 3FDTA 2EYHA 1WTPA 4CKEA 3BVMA 3VR6A 4RA8A 3QIAA 4RGNA 1KLGD 1HRJA 2E74C 1SE2A 4BWGB 3NSWA 1EZ8A 3GO5A 1RKNA 1ILPA 3GV3A 1S5FD 3EJIA 4KD4A 4C3JB 4QUCA 3RMHA 1NR4A 5CC4A 1ILQA 4RKBA 2HCIA 2HUGA 1OXSC 2MGSA 1GJXA 1FR3A 2A73B 4A3EB 4LJZC 4HTHA 4U68A 4KKSA 3MXNA 1WVLA 4HR7B 1D5MC 2E2JB 5HURA 3D4RA 4FO2A 1STBA 1EEFD 3MXUA 1LTAD 5C0XJ 1NSNS 3S14B 5NUCA 2F0JA 2NN6I 2QEJC 3DUZA 1G8ZD 2QKIC 5CV9A 4ID6A 1EY8A 2K5DA 2ZXPA 4EQPA 4IQZA 2A69D 2ICIA 1DM0B 4R9WA 5DAUA 3KUPA 3PMFA 3JAML 5FO7B 4ZKBB 1QJOA 3K5MA 1DXMA 2RDGA 3GTJB 2E2DC 5LL6X 1QCBD 5CYUA 4S3SA 1GHKA 5EQ0A 5JVH3 2M00A 4G57A 3VYTA 3P1HA 3J7AV 1DJRD 1JOKA 4FXDA 3KLSA 1GUTA 2EDGA 3L7ZC 4C3HB 2K03A 5LL6S 2HQEA 5FOBB 1D6EC 2R92B 2N88A 3CRKC 3TZDA 5IOCA 3IFTA 4CBVA 1K8MA 1AZPA 4IFDG 5JPNC 5CV7A 3HOUB 4F7XA 2F0FA 4FVMA 4J6HA 4P2CB 1TWHB 3MEHA 5D3DA 5C0XI 1I4PA 3H09A 3S1RB 1IKLA 4Z9CB 1M8AA 2SOBA 5K36G 3TP5A 1LTRD 4BA1I 1CHPD 3MFYA 5E4WC 1PLFA 3HOZB 3A56A 5K5PA 4KY5A 4K8IA 1BO0A 1WTOA 1SYEA 3QWNA 2B39A 1PTOC 4X3KA 5KYIA 3RLFA 1IKMA 2EY6A 2FMMA 2SDFA 4XT3B 3Q0AA 1TU2B 1EU3A 2XRSD 1KNAA 1EY9A 3GTGB 1B9NA 2V4DA 2F0IA 3BS1A 2NTTA 4RAUC 1DYQA 3QG1A 3S2DB 1XXGA 1LLRD 2WP8J 4YIJA 3M7NA 1F9PA 3DWPA 2FFKB 2B2UA 3C1FA 1JWSD 5E4XA 1JWUD 1TWGB 2B2UC 4I65A 2Q8RE 4Y7NB 1A2UA 1CFMA 2L9HA 1KAAA 5JVG3 3VYUA 3IAYA 1WD1A 1JORA 1ET9A 4KHZA 4C3JG 3BVGA 5EPLA 3DM1A 1LABA 2A69C 1AN8A 2LFNA 4ZLTF 1SEBD 4OGQC 2AQ3B 2PZWA 1WTRA 3O13A 3SXHA 1OXVA 1NR2A 1Q12A 5FLXE 2PCFB 3ZYYX 1BF4A 1O7LA 5C3XA 1QB5D 1LO5D 3DWQA 2NZ1D 4OIKA 3QB3A 1EY5A 1FNVA 3J81E 4A3DB 3SHLA 4A3KB 2B8FA 5JOBA 1I4RA 1U4MA 1A3UA 4ZUJA 3S1MB 2VB3X 2F0OA 2NVTB 3NHHA 4A3IB 5J1ZA 4OO1I 4A3BB 1AW7A 1F2MA 2F1MA 2ZT9C 3I4MB 4FXKC 2XWBB 4F87A 3BYTB 2JEBI 1SYBA 1HFNA 1U4PA 2ENBA 2KCCA 1HUMA 1STNA 3I4NB 5IGBA 2J4XA 5D14A 2EY5A 2F0SA 2PNRC 3PUZA 3WOFA 1M4VA 3FPUB 1LT3D 5EKKA 2KHSA 1CA6A 3GP7A 1CQVA 3PIO3 1PYWD 4BA2I 5C3EB 3MAQA 2JYOA 4GZYC 1I3QB 1JCKB 5M5WB 3OOCA 1ESRA 2AQ2B 2A6ED 3GV6A 3A54A 3EFXD 4FP5D 2IL8A 2WKDA 1Z6HA 2MUYA 3EROA 1EOTA 3D4WA 2M2LA 5FKAC 1C48A 5D65A 2K5WA 5EBDA 1V1OA 1WTQA 3MTSA 3HEJA 2NWGA 3GTPB 3ND8A 2A68D 4HSVA 1EQVA 4CGYB 1PFBA 1IW7C 1Y1WB 3K59A 2IX0A 5KNBA 3IL8A 3V96A 1SSOA 3I73A 5EBCA 4ZRZA 1RDPD 4KD3A 4PMBA 4DGZA 4ZKCB 3W2DA 3KLRA 3NPPA 1U9RA 3I91A 1Z7TA 1E0BA 4IN3A 1GUNA 2NN6H 2FHTA 5KIXA 1NUCA 3JAME 2NN6G 2L11A 1PZKD 4IUNA 5C4JB 1BCPB 3K6OA 4DU9A 3X3NA 1SAPA 5J39A 1B50A 4MIUA 4PMWA 4DAYA 3OMGA 5KEEA 1HHVA 2F0UA 3WDNA 1EYAA 4QUFA 4K5WA 3NUCA 2K28A 1XX8A 2SEBD 3MXGA 5ELCA 1VDZA 1PRTB 1G2TA 1TVXA 3DEOA 3PO2B 2F0QA 1STHA 4X3TA 4K5VA 1CM9A 4M8AA 4FYDA 3R2IA 3NWSA 2RQXA 4JK1C 4R8NA 4DN4M 4NW2A 2BDNA 1T5EA 4X3SA 3U9SA 2Z1CA 1FNUA 3S1NB 2ZXRA 1Q90A 5EPKA 4AYBB 2TMPA 5C0XH 1II3A 5M9OA 1B3AA 1BNZA 2HDMA 3MFGA 1CK1A 3TP7A 4FF2A 3LX0A 3VR2A 2O5IC 2K7VA 3N6RA 1ENFA 4TSSA 2AUKA 1A2TA 1B4OA 1LV9A 2YU9B 4A93B 2D9UA 2F0MA 4RCNA 1EIHA 5G3LF 2CW0D 2PPBC 4QCLA 1HA6A 3A7LA 1JICA 3LWEA 1RCVD 1YNND 3NE5B 2A6EC 1Q1EA 1STGA 1L0XB 3K5OA 1EYCA 5FO9B 4KMUC 3T13A 1EYDA 1I6VC 3DWAA 3CHBD 1JE4A 1H9SB 4EQNA 1S5BD 3S17B 5I2XA 2F3VA 2WB1B 2KEDA 2A68C 1IYUA 3HZXA 1UAPA 1SFOB 3TP8A 3PV0A 3R3OA 3D6CA 2IW3A 2L4NA 3GTMB 3K57A 1PFNA 1SNDA 1WCMB 4U673 1T5XD 4XQJA 2ID0A 5LHY1 2XVSA 1AEXA 2K1BA 1JR0D 1ZKOA 3VR5A 4PV1C 1RHPA 1WD0A 1U4LA 3T53B 1SDFA 3SEBA 5CBEE 3ERQA 1NCVA 4BY7B 3G6JB 5J22A 4QB4A 1LTID 1KDCA 2EJMA 2XRQD 5ELDA 2LY7A 5CMDA 2Q8TA 4IALA 1RF2D 3C1EA 4RHSA 1Y8PB 2KVMA 2O4XA 1KLUD 3NK9A 2XIWA 2Z4HA 2E2IB 1SNPA 4DK1A 2IPKD 1EZ6A 3HOVB 3N52A 3EQLC 4FXGC 1EL0A 3SK5A 1OXXK 5I2YA 4A3MB 2F0PA 3P7JA 2PZTA 4H13C 1O7YA 5JAVA 4HMIA 4BS9A 2IX3A 2RSOA 2MPMA 1G6ZA 1J8IA 1JQYD 2EYOA 1MSHA 1FNWA 1A3VA 1DOMA 4OO1H 2KECA 2SNMA 4ABNA 2KCNA 1LTSD 5CBAE 1G91A 2OT2A 4KJNA 2RVLA 3FEWX 4B08A 1C8CA 2QF7A 5A2QL 2IT1A 2DY7A 3OMCA 3GTOB 4CHTB 4KJOA 5CORA 3I90A 4DA2A 4KN4C 1WTXA 1CT1D 5C6AA 3C2PA 3T16A 5IGEA 2Z8LA 1F77A 1CZGA 1GUWA 4KTAA 2OF1A 5EPJA 3H91A 2B63B 4NKLA 4TRDA 1MGSA 3D8GA 3K5LA 5CR3A 3OWFA 4LAAA 2CW0C 1D1IA 4H0LC 1GXDC 1YNNC 1IW7D 1LTBD 1RTNA 1BXTA 3HP3A 4DNTB 2G9HD 1KNEA 2DN8A 3P20A 2R6GA 3CKIB 1RJTA 2SNSA 5TSSA 4K5XA 4K8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0X B;  3O13 A;  3BZD B;  1V1P B;  1SBB B;  3BVZ A;  3TSS A;  1JQY D;  4UDU C;  1QIL A;  2SEB D;  2ICI A;  2RDH A;  5ELC A;  1PRT B;  3DWA A;  3EA6 A;  1LO5 D;  3CHB D;  1JCK B;  1PTO C;  3DWQ A;  4K6L A;  1S5B D;  2NTS A;  2TSS A;  1FNW A;  2AQ2 B;  4C56 C;  1S5D D;  1TS5 A;  3EFX D;  3KLS X;  1PRT D;  1SE3 A;  2O2L D;  4O1N A;  1FNV A;  3BYY B;  1HTL D;  1SJE D;  4L63 B;  5FK9 C;  1EU3 A;  1LTS D;  2XN9 C;  3R2I A;  2RDG A;  2XRS D;  1PTO D;  5FKA C;  1SXT A;  1I4R A;  4RGM A;  4RGO S;  1S5E D;  1EEI D;  1UUP A;  1V1O A;  2IJ0 A;  4DXG A;  4DXF A;  4RFB A;  1STE A;  1TS4 A;  4RH6 A;  4OHJ A;  2NTT A;  1FNU A;  1DYQ A;  1L0Y B;  1PTO H;  2QIL A;  1T5X D;  3OWE B;  1FD7 D;  4RHR A;  1GOZ A;  1SJH D;  3BVM A;  1RD9 D;  1XXG A;  1I4H A;  1ET6 A;  1LLR D;  1KTK A;  4ZYS A;  1DJR D;  4RGN A;  1JR0 D;  3R2T A;  1KLG D;  1TS3 A;  1S5C D;  1CT1 D;  1PTO B;  1PZI D;  1SE2 A;  3DWP A;  1I4Q A;  1JWM D;  1AW7 A;  2AQ1 B;  4BWG B;  1LTT D;  1LT6 D;  1I4G A;  1BCP F;  2Z8L A;  3SEB A;  1F77 A;  1D6E C;  1BCP C;  1JWS D;  3URY A;  1JWU D;  1RDP D;  1S5F D;  4RGT A;  2R61 A;  3MFG A;  1CK1 A;  5ELF A;  1LTI D;  1LT5 D;  1HA5 A;  1V1P A;  1LT4 D;  2WV6 D;  3W2D A;  5I4D A;  1EFI D;  2XRQ D;  5ELD A;  1BCP D;  3BYT B;  3V05 A;  1I4X A;  1ENF A;  1FGB D;  4TSS A;  1XTC D;  3MC0 B;  1HXY D;  1D5Z C;  1RF2 D;  4L6T B;  1PRT F;  4RHS A;  1TY2 A;  3R8B A;  1SE4 A;  1TS2 A;  2CHB D;  4RCO A;  5D3D A;  1ET9 A;  1PRT C;  5ELE A;  1LTG D;  1KLU D;  1D5M C;  1B1Z A;  1PZK D;  1PTO F;  1I4P A;  2J4X A;  1LTB D;  2XNA C;  1BXT A;  3BVG A;  5ELB A;  2IPK D;  1TY0 A;  1BCP B;  5D3I B;  4Z9C B;  1EEF D;  1EU4 A;  2G9H D;  1ESF A;  1LTA D;  1CHQ D;  1B44 D;  1MD2 D;  1M4V A;  1UNS A;  1LT3 D;  1PZJ D;  1AN8 A;  1EWC A;  1LTR D;  1RCV D;  1CHP D;  1SEB D;  1D5X C;  5TSS A;  1HQR D;  2QEJ C;  3GP7 A;  1CQV A;  2AQ3 B;  1G8Z D;  1PYW D; 
#chains in the Genus database with same CATH topology
 2VQE L;  3BDL A;  1V1P B;  4ULL A;  2FXQ A;  1LM0 A;  4A93 G;  2UXD L;  4X6A H;  1Q1B A;  2LS0 1;  4LK1 C;  5C3W A;  4N9T A;  5KNC A;  2RKS A;  1EIY B;  1JT8 A;  2RA4 A;  4C2M B;  1F9Q A;  1A6X A;  3BDC A;  1PH7 A;  2NTS A;  1QZG A;  4XQN A;  2Y0S B;  5JEA J;  4C56 C;  2LKV A;  4JI3 Q;  4A3L H;  2Q2U A;  1ZXT A;  1RIP A;  4B3M L;  1SMY C;  1QWY A;  2EYJ A;  4IZ8 A;  3BJU A;  4L63 B;  2L12 A;  1MJC A;  2OXP A;  4Q0F A;  4X3U A;  3C46 A;  1VQO A;  1WJJ A;  2EZV A;  1AE3 A;  2IWH A;  4LFB L;  3S2H B;  4G7O C;  1BUV T;  1VCI A;  3U9O A;  2IJ0 A;  1UE1 A;  5G3L D;  1SNQ A;  4RFB A;  3PO3 B;  4ZK9 B;  4BY1 B;  1OXU A;  1PTO H;  2HT1 A;  2AKW B;  2XTI A;  2WAQ B;  1I4H A;  1SFO H;  1MBY A;  2BCO A;  1Z9F A;  2WB1 G;  1IYV A;  1HUN A;  3GTM H;  1JMC A;  1LTT D;  1PYS B;  3RR5 A;  4CJ1 B;  5IYC G;  1WCM H;  3GD7 A;  4IFD I;  4CKC A;  5IGD A;  2F0H A;  3EN2 A;  2PQA B;  5CGK A;  1WCM G;  3PUX A;  1K83 B;  1EWH A;  4K2K A;  3NTK A;  1LT4 D;  2KJX A;  4KK7 A;  1JOO A;  2B2W A;  2Z4I A;  1KXL A;  4KI0 A;  2GN5 A;  1CUK A;  2EY1 A;  1HNZ Q;  4DV6 Q;  1G2S A;  1IHZ A;  4WOR A;  4FF3 A;  4DV5 L;  4BBS H;  1Y1V H;  1TKW B;  4K0K Q;  1XWE A;  3U50 C;  3S1Q H;  1UEA B;  4HAE A;  4HJ8 A;  2BH8 A;  3K0Y A;  1Y1V G;  3P75 A;  4BY7 G;  1MI2 A;  3EVQ A;  3I3C A;  3ONA B;  1L0W A;  3K8A A;  2F0D A;  4EVO A;  4KHV A;  3A7A B;  2MFI A;  2ZXO A;  1MD2 D;  1QG7 A;  3S9W A;  2B2V A;  3KDF B;  1I50 B;  2UUB L;  1Y69 U;  4CKB A;  2VL6 A;  1R9T B;  1TII D;  1ZEQ X;  2UUC L;  3D0F A;  2E2I H;  1PMR A;  2L5T A;  5HGQ A;  1J9O A;  4A3F H;  4HCE A;  5C44 H;  1XMO L;  1FJG L;  2I5M X;  2JP1 A;  1QIL A;  5KRU A;  3HOY B;  1CQF A;  1A62 A;  1X32 A;  3HOV G;  4DKA C;  5C44 G;  4HSP A;  3RN5 A;  2XWJ B;  4JBW A;  3M85 A;  4FF1 A;  5LMN L;  4DV4 Q;  3KLS X;  5C4H A;  2FIN B;  4WFN 3;  4FNF A;  4DFA A;  4A3M G;  4JI7 L;  2HIX A;  4QF4 A;  1SMX A;  4R4T A;  4A3G H;  1F2Z A;  1L2F A;  3NQT A;  5IP7 H;  2Q2I A;  3HKZ B;  3JAM c;  1SXT A;  3H15 A;  1N33 Q;  5JJZ A;  4KY6 A;  4DXF A;  4R8I A;  3UDX A;  4A3G G;  3VYS A;  1S40 A;  3T4A C;  5IP7 G;  4LF9 Q;  4RHR A;  1GOZ A;  1KDB A;  2QCP X;  4JYA L;  3Q6S A;  2E2H H;  5M5Y B;  3R2T A;  2K32 A;  2B2T A;  5I9O A;  4WRD A;  2CCZ A;  2D0O A;  3NTI A;  2K05 A;  4I7A A;  2OQK A;  1HZC A;  3S15 B;  5FLM G;  2XSC A;  1YBY A;  3QR8 A;  2B2T C;  4OEL B;  4MTN A;  4KKU A;  2VUM H;  5IT9 L;  1ROD A;  2ASB A;  4OX9 L;  4RGT A;  5CV6 A;  1CZW A;  1F2L A;  2MNA A;  1H9R A;  4CJ0 B;  4QQB X;  3F2U A;  1BCP D;  3CQZ B;  1FGB D;  1XTC D;  3I70 A;  1D5Z C;  2V1C C;  1YNJ D;  2F0T A;  1MJE A;  3FPP A;  4DAV A;  3HOW B;  3H6M A;  1TS2 A;  5FO8 B;  1B70 B;  5ELE A;  2QEX A;  2AWN A;  3WWV A;  2Q8I B;  1PA6 A;  2B63 G;  1SNO A;  1V43 A;  1VQG A;  3E6Z X;  2DGY A;  1EU4 A;  2HDL A;  1ESF A;  5EJW A;  3UI2 A;  3Q22 A;  1X3P A;  1NE3 A;  1UE6 A;  2FMC A;  1EWC A;  2JE6 I;  2RCF A;  4J15 A;  3TEH B;  1A15 A;  2JA7 B;  4PZ8 A;  2R93 B;  1PV4 A;  1HQR D;  3LWU A;  2R7D A;  5IGF A;  3IFD A;  3OHX C;  3H3V I;  2JEA I;  5DEH A;  1GHJ A;  3MXP A;  3GTL B;  3F1Z A;  3BDO A;  1HH2 P;  2BOS A;  4JI5 L;  4DR4 L;  2VW9 A;  2KOL A;  1TS5 A;  3MXN B;  4EX5 A;  3M4Y A;  1H9K A;  3RZO B;  3MA2 B;  4JI2 Q;  2JN4 A;  3MZ5 A;  4R4O A;  3TME A;  2VXW A;  2XN9 C;  3KLW A;  1KAB A;  5M3M H;  3RZD B;  1XYI A;  4X65 L;  2YTY A;  3PIP 3;  1S5E D;  4JG2 A;  1EY0 A;  1VQ6 A;  3I4L A;  1UUP A;  3NP8 A;  3VYR A;  1TWF H;  3ULP A;  1X3Q A;  1JB3 A;  1TS4 A;  4XTC S;  2NZH A;  4A3J H;  1Q3L A;  4OWT B;  1FD7 D;  4R1J A;  1TWA B;  1VS0 A;  1C4Q A;  4Q5V A;  3HOX B;  1NNX A;  2Y0S G;  4KKT A;  2VQE Q;  1FGU A;  4A3J G;  2MHV A;  2MO1 A;  4MZ9 A;  1C7Y A;  2UXD Q;  2MP1 A;  1Q8K A;  4C3I B;  2JA5 H;  1VQK A;  1I4Q A;  2CKZ B;  2EYM A;  1C0A A;  5T1G A;  4CDC C;  2QGQ A;  3RLO A;  3URY A;  4RWS C;  2JA5 G;  4EGV A;  2P5Z X;  3A8J E;  3PO3 G;  5JJI A;  4DV3 L;  4B3M Q;  2NVY H;  4BY1 G;  2EXD A;  1Q8I A;  4JC0 A;  3ITP A;  3FKI B;  1QOH A;  2A5H A;  1HA5 A;  4H7B A;  5F2D A;  1VQB A;  2WAQ G;  1SYC A;  2B2Y A;  1HFG A;  2WII B;  1SNM A;  2BDO A;  4HN7 A;  1E2Z A;  5LMN W;  4LFB Q;  3S16 B;  5GAD C;  4JI0 L;  2F4I A;  3H94 A;  1E24 A;  4K2L A;  3MC0 B;  4HIM A;  4ZQ3 A;  2B2Y C;  2F3I A;  2EYL A;  4UAI A;  2JA6 B;  2R7Z B;  2EPB A;  3NBH A;  1B1Z A;  1Y8N B;  3AFP A;  3CCJ A;  5C0X G;  3OSO A;  3J7A F;  1TY0 A;  1PHJ A;  5I9P A;  5JPM C;  4IUT A;  4LUO A;  2K5Q A;  4A4I A;  2YYZ A;  5EGT A;  3D4D A;  5A2Q E;  3V2T A;  5IGG A;  3SR1 A;  2ICE C;  2NYZ D;  3FVQ A;  1QE6 A;  1A8V A;  2N55 A;  2M9V A;  3E0J A;  4NMZ A;  2L55 A;  1K8A C;  2NB0 A;  1X3F A;  1SYG A;  4PQX A;  3VA5 A;  3CU7 A;  1YIJ A;  3KBG A;  1CTM A;  2RDH A;  1KIX A;  5HGT A;  2ZM6 Q;  4DV5 Q;  4TVA B;  1PH5 A;  3CW2 C;  4KHP L;  3WOE A;  4O1N A;  1SE3 A;  1G6P A;  1NJI C;  1GM5 A;  1N34 L;  3NEM A;  1JB7 A;  1UEB A;  2ES2 A;  2A6H D;  1SNC A;  5EKI A;  3A74 A;  2RCN A;  2X6G A;  4YCV A;  4YCW A;  4GLA C;  2EYP A;  3OW2 A;  3PIO A;  1CI3 M;  1X55 A;  1I6H H;  1XNR L;  2K50 A;  1STE A;  4M1U B;  3HOY G;  2UUB Q;  5IIF A;  1BOS A;  1L0Y B;  5C4Z A;  4X62 L;  2KHJ A;  3G6E A;  1F9R A;  1SJH D;  2K4K A;  2WIN B;  2UUC Q;  1Y14 B;  1DOL A;  3J80 L;  1GKH A;  2KUM A;  1UWV A;  2PNH A;  1IBK L;  3UE0 A;  3B6Y A;  2I46 A;  1PTO B;  3I8Z A;  4DNR B;  1XMO Q;  1FJG Q;  1K8O A;  2R3Z A;  4OON A;  1L1O A;  3HKZ G;  1BCP C;  1JE5 A;  5CV8 A;  4TQU S;  5LMN Q;  1TWC H;  2R61 A;  1IYJ B;  4KV6 A;  1VQ5 A;  1YNJ C;  5M5Y H;  3I56 A;  1L1O C;  4JI7 Q;  1HZA A;  1SMY D;  3SK8 A;  2WV6 D;  1QVG A;  1O7I A;  1B2T A;  4G7H C;  2G9D A;  4YHH L;  4NP5 A;  1TR5 A;  2EY2 A;  1DZ1 A;  3V05 A;  1HXY D;  4L6T B;  2D5D A;  2CH4 A;  1SE4 A;  1WTW A;  1PRT C;  3FRP B;  4JYA Q;  1CA5 A;  3H0G H;  3L2P A;  5AFW A;  3X3M A;  4BBS B;  2XNA C;  1Y1V B;  3HRZ C;  1D1K A;  3E5S A;  2KEN A;  3J7Y W;  1Q81 C;  1GUO A;  1V8Q A;  3S1Q B;  1CHQ D;  3A8K E;  2A19 A;  1H9M A;  3L3O C;  4IPH A;  1EY6 A;  1VMP A;  2EOT A;  3DMU A;  4OX9 Q;  3TP6 A;  1N36 L;  1YEZ A;  4K6D A;  1EY4 A;  2IHE A;  4BBR H;  3HOW G;  5IE8 A;  4OIJ A;  3RD4 A;  4MHE A;  3HGB A;  3CCE A;  3BVZ A;  3A55 A;  4O42 A;  5KGU A;  4UDU C;  3D3R A;  3AQQ A;  3AU7 A;  4JBK A;  1NAP A;  2NVQ B;  4A3F B;  1UE7 A;  2TSS A;  1X3G A;  3M3Y H;  2DNC A;  5BN3 A;  5C44 B;  3CAM A;  1S5D D;  3DEP A;  4JI4 L;  3OW7 A;  2JA7 G;  2R93 G;  1A63 A;  3A8I E;  4IFD H;  1XMQ L;  4ZCK A;  5DNF A;  4RGM A;  4DR3 L;  1JOQ A;  1HCZ A;  2EJF C;  1Q82 C;  1BBX C;  2Z6K A;  2PZU A;  1EEI D;  2F0E A;  4X66 L;  4DXG A;  4QGU A;  3R93 A;  4A3G B;  2CH4 W;  4E6I A;  1X56 A;  4LUV A;  1D8L A;  3CCL A;  1B9M A;  4PNY A;  4MN3 A;  3VR4 A;  4RMF A;  4WJ4 A;  3OPO A;  2K33 A;  1JWM D;  3MVV A;  2AQ1 B;  2F4V L;  4P71 A;  5M5X H;  2K14 A;  1BCP F;  2E2H B;  4DR1 L;  2RDF A;  1SYD A;  5EAY A;  1Y8O B;  4HJ9 A;  4OO1 G;  4G7Z C;  4JI5 Q;  4DR4 Q;  2PMZ B;  3PUV A;  5M3F H;  2F0N A;  5C4X B;  1VQJ A;  1PH6 A;  5K36 H;  1BR9 A;  1HTP A;  4GNX B;  1H9J A;  2D62 A;  2NBF A;  2OEO A;  1GO3 E;  3K5N A;  4QIW B;  2VUM B;  4XQQ A;  3HOX G;  5I4D A;  4J1M A;  4XDX A;  4X65 Q;  2E75 C;  4I7Z C;  1H9S A;  2AUJ D;  4C3I G;  1W2B A;  2BA0 A;  2NUC A;  4DK0 A;  1PRT F;  2H1E A;  3NQI A;  2PO4 A;  5JEA H;  1E1O A;  1ONL A;  5I6Y A;  3H3V C;  2K5H A;  1EWI A;  3T51 B;  2F03 A;  2D2C C;  3NWT A;  3QOJ A;  5T1I A;  4JPB W;  2KCM A;  1OO9 B;  1TXY A;  5JEA G;  1E1T A;  3ND9 A;  3FKI G;  4NB3 A;  5ELB A;  1WFQ A;  4BXX G;  3G7L A;  2VS1 A;  4IFD J;  2VQF L;  3Q24 A;  4C1N I;  3FMC A;  4AIM A;  2B29 A;  1D2B A;  3PSI A;  3CC2 A;  2EYF A;  2JA6 G;  4GKJ L;  2F0V A;  2R7Z G;  4L5S A;  1SBB B;  4KY7 A;  3AYH B;  3TSS A;  4JI0 Q;  1OXT A;  1IL8 A;  2A6H C;  3CPW A;  5IT9 E;  4IPC A;  4ZUI A;  2WKC A;  3HFZ B;  1YVC A;  1AH9 A;  1XNQ L;  1AZQ A;  4N9P A;  2O2L D;  1KHI A;  5A35 A;  3SDZ A;  3NEL A;  5FK9 C;  1QNK A;  5KND A;  4ODG A;  4PMC A;  4A75 A;  3AMU A;  4CJ2 C;  1K73 C;  3NBI A;  4YY3 L;  3E9H A;  4WJW A;  2N78 A;  1BQQ T;  3MEF A;  2D0P A;  3JC6 6;  3M4O B;  5DM7 3;  5M3M B;  4RH6 A;  4OHJ A;  2X6L A;  5IYD G;  3KF8 A;  3D31 A;  3KK7 A;  2X69 A;  4G4K A;  2FJ2 A;  4RG1 A;  4POF A;  1TWF B;  2KA7 A;  3IKJ A;  4A3J B;  3TRZ A;  3KJO A;  1Z47 A;  2RBM A;  1HZ9 A;  2B8G A;  1FYC A;  4DAP A;  5IGC A;  4C3J H;  1WTV A;  1I4G A;  4A3L G;  4HJA A;  4QMG A;  4KHP Q;  4F8M A;  4V19 0;  5ELN A;  2JA5 B;  4LMQ D;  4XIG S;  3RN2 A;  2VY3 A;  1R4Q B;  1N34 Q;  3G4S A;  2F0G A;  3PF5 A;  2K04 A;  4J8Q A;  3I72 A;  1EFI D;  2NVY B;  1KDA A;  4HMJ A;  1I94 L;  2KQ3 A;  1YIT A;  2E2J H;  3Q23 A;  2EIF A;  1ICW A;  1GUS A;  1HQM C;  1TY2 A;  1ML0 D;  4IUR A;  3AB9 A;  1IBK Q;  4DR7 L;  2A1A A;  1PTO F;  2L1B A;  2ZJQ A;  4OWW B;  3M4P A;  4DF7 A;  3S14 H;  1ASY A;  4JV5 L;  1O80 A;  3L9A X;  1B7Y B;  3C3L A;  1EQT A;  5GAG C;  3SK6 A;  2QDB A;  4GNX A;  4C1N K;  4L8J A;  1AFP A;  5AJ3 L;  2EQS A;  3EIV A;  1K3R A;  1S4Z A;  3CC4 A;  2B2W C;  4YWM A;  1E2W A;  4LW1 A;  1K8G A;  1VQ4 A;  1ZYR D;  1U4R A;  1VF7 A;  4IUP A;  4YHH Q;  2EJG C;  4CDF C;  3A5Z B;  1GD7 A;  4BBS G;  2HCC A;  1DOK A;  1BDO A;  2O5J C;  1E2V A;  2CQO A;  1DCZ A;  3GTQ B;  3MWY W;  1AP0 A;  3STB D;  1STY A;  4B9X A;  2BE5 D;  1STA A;  4AQY L;  3DM3 A;  2HD3 A;  4XT1 B;  4QL5 A;  3K58 A;  4OWX B;  3CD6 A;  3NTH A;  2B2V C;  2VZA A;  2NVQ H;  3BU2 A;  1B3Q A;  1IZ6 A;  2MJ8 A;  4ZYS A;  5IOD A;  2EVB A;  4DAY B;  1N36 Q;  1QUQ B;  4LF7 L;  1RD9 D;  4C3H H;  4A3F G;  1MSG A;  1I6H B;  4JI1 L;  3OIP A;  2PQE A;  2R92 H;  1S5C D;  3QO2 A;  2UXC L;  5CV5 A;  1PZI D;  3K7A B;  3LNN A;  4C3H G;  5J3B A;  2Z0S A;  2C9O A;  2I5L X;  1DON A;  3QOL A;  3E0E A;  3RUZ A;  4IUQ A;  1EY7 A;  3KBX A;  4JI4 Q;  2JA8 B;  1EIG A;  5ELF A;  3QJY A;  1X3E A;  1LT5 D;  1V1P A;  1TWH H;  3ULL A;  1RTO A;  3D6W A;  3GQB A;  2DY8 A;  1LAC A;  2VNU D;  1TT2 A;  1TWC B;  1F9S A;  1R4P B;  4DR3 Q;  2F0W A;  1I4X A;  2PYK A;  1S72 A;  4X66 Q;  5DM6 3;  4EQO A;  2DNE A;  5C4X H;  3ULJ A;  4AYB E;  1DD2 A;  3M7G A;  2C5C A;  1YHB A;  4TKO B;  5CV4 A;  1HNW L;  2ALY B;  1K0R A;  2LMC B;  5BR8 L;  2OWO A;  4H44 C;  5C5M A;  2CWA A;  1PFM A;  5C4X G;  2PW7 A;  3M4Q A;  3SK4 A;  5ISR A;  2J0T D;  4YWL A;  3DHQ A;  5D3I B;  2UUA L;  4K14 A;  2JXM B;  4V0B A;  3W1B A;  2J7Z A;  3H0G B;  2F4V Q;  2VUM G;  3HOZ H;  3W3A A;  2K6A A;  4DR1 Q;  3UDF A;  4OL7 A;  3UE1 A;  1F2Y A;  1X54 A;  1UNS A;  4UY8 C;  1PZJ D;  3J80 E;  2E5L L;  3U4Z A;  4ZAI A;  1D5X C;  1B53 A;  1VQL A;  1A3T A;  2KEE A;  1XPR A;  3BZD B;  4PZ7 A;  1QNU A;  2EXZ A;  1HPC A;  1ENA A;  4NDX A;  3GTK B;  4BBR B;  5GQO A;  2E76 C;  2F0L A;  4K6L A;  1G29 1;  2PQA A;  1W6K A;  2AMC B;  1N32 L;  3OIQ A;  5E3F A;  2RSN A;  4IUV A;  5KYL A;  2B3G A;  1PRT D;  3GTG H;  3BYY B;  3TN2 A;  4ME5 A;  1HTL D;  1SJE D;  4XYO A;  2K01 A;  2DJF C;  2KCT A;  3M3Y B;  3I7F A;  2H4O A;  3CME A;  1D7Q A;  4B9W A;  3TRE A;  4RGO S;  3S2D H;  1EIF A;  2GVB A;  2YV5 A;  2CVR A;  2VQF Q;  1JC7 A;  4LF8 L;  4X64 L;  3HG9 A;  1G51 A;  2QIL A;  1W6J A;  3OWE B;  5IY0 A;  1O7Z A;  4APV A;  1ET6 A;  3I2Z A;  1BKB A;  1KTK A;  4NXN L;  5EKL A;  1TS3 A;  4GKJ Q;  5C5L A;  3TZU A;  2PI2 A;  2GA4 B;  2IX1 A;  1GUG A;  2WB1 E;  5COY A;  2OCE A;  2F3W A;  4HED A;  1LT6 D;  3M4O H;  2AHO B;  5FLX L;  3OTO Q;  4Y7N H;  4DAM A;  4CDE C;  3KDF A;  4ILW A;  3PUY A;  3TDQ A;  3CRL C;  1XNQ Q;  4XYQ A;  1Q7Y C;  5JJK A;  5M3M G;  5M5X B;  1ENC A;  4KN7 C;  5LMU L;  1T9H A;  3T1H L;  4O0A A;  4XXE A;  3J81 L;  4LF4 L;  5M3F B;  4YY3 Q;  1K0S A;  3UDI A;  2H5X A;  1QUQ A;  1MKH A;  3CCS A;  3MHB A;  3BG3 A;  3E9I A;  2VB2 X;  1TQO A;  3R8B A;  4RCO A;  3VA7 A;  2CHB D;  4B3R L;  1CKO A;  3NXW A;  1LTG D;  3CP0 A;  3HS0 C;  3CF5 A;  4DV0 L;  3T56 B;  4B3T L;  2CQA A;  1VQA A;  1GVP A;  4LFC L;  2PW5 A;  1ZYR C;  3VR3 A;  4HCS A;  1B44 D;  3F2B A;  4RKL A;  4F88 A;  3SE0 A;  1HZB A;  5BN5 A;  2BA1 A;  2L0C A;  2NVX B;  1NBW A;  4IUU A;  1SYF A;  3STB C;  1BBW A;  1VF5 C;  2XGT A;  3CMA A;  2JSO A;  2BE5 C;  2I07 B;  3SVM A;  2AWO A;  3PUW A;  3E3X A;  2F0K A;  3TBI B;  5I6W A;  1PFS A;  3J80 i;  2WAC A;  2EE1 A;  4HID A;  5E1F A;  4JI6 L;  3EA6 A;  4A3D H;  1PXU A;  4A3K H;  2A74 C;  1O78 A;  1PDQ A;  4KLK A;  1VMC A;  4FF4 A;  3DXJ C;  4DR7 Q;  5BN4 A;  3S1M H;  4JV5 Q;  1FVI A;  1PTO D;  1MIU A;  3FDT A;  2ATW A;  4WJ3 M;  2EYH A;  1KQS A;  2NVT H;  3GTQ H;  5JJL A;  5AJ3 Q;  1WTP A;  4GOP B;  4A3I H;  4CKE A;  4A3B H;  3BVM A;  3VR6 A;  4RA8 A;  1BVS A;  3QIA A;  4RGN A;  3I4M H;  1KLG D;  5IP9 H;  1HRJ A;  2E74 C;  3I4O A;  3ICE A;  1SE2 A;  2UXB L;  3PF4 A;  4BWG B;  3NSW A;  5IP9 G;  4DNI A;  1EZ8 A;  1MHW C;  3GO5 A;  1RKN A;  1ILP A;  3GV3 A;  1S5F D;  3EJI A;  4KD4 A;  4C3J B;  4QUC A;  3RMH A;  3FP9 A;  4AQY Q;  1NR4 A;  1AE2 A;  5CC4 A;  1ILQ A;  4RKB A;  3K7A H;  2HCI A;  1V9P A;  2HUG A;  4NPS A;  1OXS C;  3K80 C;  2MGS A;  1GJX A;  1FR3 A;  3I4N H;  1UE5 A;  2A73 B;  4A3E B;  4LJZ C;  1KC8 C;  4HTH A;  2JA8 H;  4U68 A;  4KKS A;  3MXN A;  3I4N G;  1WVL A;  4LF7 Q;  4HR7 B;  4L5T A;  3TS2 A;  2N8N A;  1D5M C;  2E2J B;  4JI1 Q;  2JA8 G;  4JOI A;  2UXC Q;  2UU9 L;  1YJ9 A;  5HUR A;  4GKK L;  3D4R A;  4FO2 A;  1STB A;  1EEF D;  3MXU A;  1LTA D;  4IOC A;  5C0X J;  1NSN S;  4JI8 L;  1M90 C;  3S14 B;  1PH2 A;  5C3E H;  5NUC A;  3CCM A;  2F0J A;  3UDG A;  2NN6 I;  1SRO A;  2QEJ C;  3DUZ A;  1I3Q H;  1G8Z D;  2DUD A;  2QKI C;  5CV9 A;  4ID6 A;  1M1K C;  1EY8 A;  2K5D A;  4A76 A;  5M5W H;  2ZXP A;  4EQP A;  2ZTE A;  4IQZ A;  2A69 D;  3J7A 5;  2ICI A;  1DM0 B;  3H0G G;  4R9W A;  4P75 A;  5DAU A;  3KUP A;  1HNW Q;  5BR8 Q;  3PMF A;  3JAM L;  5FO7 B;  4ZKB B;  1QJO A;  3K5M A;  1DXM A;  2A8V A;  3GTK H;  2RDG A;  3GTP H;  3GTJ B;  2UUA Q;  2E2D C;  2LSS A;  1VQE A;  5LL6 X;  1QCB D;  5CYU A;  4S3S A;  1Y1W H;  4BBR G;  5EQ0 A;  1GHK A;  2E5L Q;  1PH8 A;  5JVH 3;  2M00 A;  4G57 A;  3VYT A;  3P1H A;  3J7A V;  1DJR D;  1JOK A;  4FXD A;  3KLS A;  2Y0S E;  1GUT A;  2QW7 A;  2EDG A;  3L7Z C;  3CPF A;  4C3H B;  2JA9 A;  2K03 A;  5LL6 S;  1PVO A;  3CCU A;  2HQE A;  5FOB B;  1D6E C;  2R92 B;  2N88 A;  2MQH A;  1K28 A;  1N32 Q;  4GN5 A;  3CRK C;  3TZD A;  5IOC A;  3IFT A;  4CBV A;  4LF6 L;  1K8M A;  1AZP A;  4IFD G;  3PIP A;  5JPN C;  5IT9 c;  5CV7 A;  3HOU B;  2Z6K C;  4F7X A;  2F0F A;  4FVM A;  3ZJY C;  4J6H A;  4LF8 Q;  4X64 Q;  4P2C B;  1TWH B;  5C4J H;  3MEH A;  1BBU A;  5D3D A;  5C0X I;  4DV2 L;  4MNO A;  4A3C H;  4NXN Q;  1I4P A;  3H09 A;  4UPA A;  1PH4 A;  1WOC A;  3S1R B;  1IKL A;  1S3O A;  4YCU A;  4Z9C B;  1M8A A;  3CCV A;  4A3C G;  1H95 A;  5M3F G;  2SOB A;  4GLX A;  5K36 G;  3G48 A;  1W3S A;  3TP5 A;  2MO0 A;  4P73 A;  1LTR D;  4BA1 I;  1CHP D;  3MFY A;  5E4W C;  4EQ5 A;  1HR0 L;  1PLF A;  3HOZ B;  3A56 A;  5K5P A;  4KY5 A;  3T1H Q;  2Z9H A;  4K8I A;  3TS0 A;  4LF4 Q;  4LF5 L;  1BO0 A;  2ZJP A;  1WTO A;  4DPG A;  3PO2 H;  1SYE A;  5ELO A;  3QWN A;  2B39 A;  1PTO C;  4DK6 C;  4X3K A;  5KYI A;  2BH2 A;  3LGJ A;  2NVX H;  3RLF A;  1IKM A;  4B3R Q;  2EY6 A;  2PI2 E;  2FMM A;  2SDF A;  4DV0 Q;  4DR6 L;  4B3T Q;  4JW0 A;  4XT3 B;  3Q0A A;  1TU2 B;  1EU3 A;  4DV3 Q;  4LFC Q;  2XRS D;  1IL2 A;  1KNA A;  1EY9 A;  3GTG B;  1B9N A;  2V4D A;  2F0I A;  4OXP A;  2YTX A;  2OTJ A;  3BS1 A;  2NTT A;  4RAU C;  1DYQ A;  4JBM A;  3QG1 A;  3S2D B;  1XXG A;  2RHS B;  1SE8 A;  1LLR D;  2CWP A;  2WP8 J;  4YIJ A;  4DUZ L;  3M7N A;  1F9P A;  1EQR A;  3DWP A;  4L5Q A;  2FFK B;  2B2U A;  3C1F A;  1CKN B;  4Y52 H;  1JWS D;  5E4X A;  1JWU D;  1EYG A;  1TWG B;  3FHW A;  3HKZ E;  2K5N A;  2B2U C;  4I65 A;  2Q8R E;  2NZO A;  1XTD A;  4Y7N B;  1A2U A;  1CFM A;  2OQ0 A;  4DK3 C;  2L9H A;  2JK8 A;  2KHI A;  2YU9 H;  2ZTC A;  1SLJ A;  1J5E L;  1KAA A;  4A93 H;  5JVG 3;  3W5O A;  3VYU A;  3IAY A;  1WD1 A;  1JOR A;  1WYD A;  1ET9 A;  4KHZ A;  2HIV A;  1VQF A;  4C3J G;  5H1S E;  4UP7 A;  3BVG A;  2JJQ A;  4PG3 A;  5EPL A;  2UXB Q;  1DGS A;  4A3E H;  3DM1 A;  3AEV A;  1LAB A;  2A69 C;  1E3P A;  1AN8 A;  2LFN A;  3IRB A;  4ZLT F;  2F52 A;  4A3E G;  1SEB D;  1XNR Q;  4AH6 A;  4OGQ C;  2AQ3 B;  4O2D A;  2PZW A;  1WTR A;  4X62 Q;  3H3V H;  3O13 A;  3SXH A;  3U4V A;  1OXV A;  3S17 H;  1NR2 A;  1Q12 A;  5FLX E;  2PCF B;  3ZYY X;  1BF4 A;  1O7L A;  2YTV A;  5C3X A;  1QB5 D;  1LO5 D;  3DWQ A;  2NZ1 D;  4OIK A;  5IYC H;  3QB3 A;  2RHQ B;  1EY5 A;  4IJL A;  1FNV A;  3J81 E;  4A3D B;  1WTH A;  3SHL A;  2UU9 Q;  4GKK Q;  4GNX C;  4A3K B;  1N8R C;  2B8F A;  5JOB A;  1I4R A;  1U4M A;  1A3U A;  4JI8 Q;  4ZUJ A;  1K9M C;  2Q2H A;  3S1M B;  2VB3 X;  3T1Y L;  2QA4 A;  2F0O A;  2NVT B;  1PH1 A;  3GTJ H;  3NHH A;  4A3I B;  2ZM6 L;  3A5U A;  5J1Z A;  1HR0 W;  3J80 c;  4OO1 I;  4A3B B;  4BY7 H;  1AW7 A;  1F2M A;  3L0O A;  5IWA L;  2F1M A;  2ZT9 C;  4DUY L;  4DR5 L;  3I4M B;  2I0Q A;  3PGZ A;  4IJH A;  3RLN A;  1XJV A;  1YZ6 A;  4FXK C;  2XWB B;  4F87 A;  1KRS A;  3BYT B;  4HJ5 A;  3RNU A;  1JJ2 A;  2JEB I;  1SYB A;  1HFN A;  3F2D A;  1E22 A;  1U4P A;  2JQO A;  1X65 A;  2ENB A;  2KCC A;  1XPU A;  2R92 G;  3HOV H;  1HUM A;  1STN A;  3I4N B;  5IGB A;  1U5K A;  3HOU H;  1CKN A;  2J4X A;  1YI2 A;  4A3M H;  5D14 A;  3CXC A;  1YNX A;  2EY5 A;  2F0S A;  1RL2 A;  2PNR C;  1SN8 A;  3HOU G;  4JCV E;  3ERS X;  1I5F A;  3PUZ A;  3WOF A;  1XMQ Q;  1M4V A;  3FPU B;  1LT3 D;  5EKK A;  2KHS A;  5L37 A;  1CA6 A;  4LF6 Q;  1VQC A;  3KJP A;  3GP7 A;  1CQV A;  4LUZ A;  3PIO 3;  1PYW D;  3S1R H;  2LXK A;  4BA2 I;  5C3E B;  3MAQ A;  2JYO A;  1E7Z A;  4GZY C;  1NMF A;  1I3Q B;  1JCK B;  5M5W B;  3OOC A;  1ESR A;  1QVC A;  2CFM A;  4LFA L;  2AQ2 B;  2A6E D;  5FLM H;  4ALP A;  3GV6 A;  3A54 A;  3EFX D;  4FP5 D;  2IL8 A;  2Q2T A;  4DV2 Q;  4P74 A;  3HOZ G;  2WKD A;  3NBH B;  4NXM L;  1Z6H A;  2MUY A;  3ERO A;  3KF6 B;  1EOT A;  3D4W A;  2M2L A;  5FKA C;  1C48 A;  5D65 A;  5FJ8 H;  2K5W A;  4OEM B;  3GTO H;  5EBD A;  1V1O A;  3J81 i;  1WTQ A;  1Q86 C;  3MTS A;  3HEJ A;  2NWG A;  3GTP B;  3ND8 A;  2A68 D;  4HSV A;  4GS3 A;  1EQV A;  5FJ8 G;  1HR0 Q;  3K81 C;  4CGY B;  1HNX L;  1PFB A;  1IW7 C;  1Y1W B;  3K59 A;  1PH9 A;  2IX0 A;  1QVF A;  4LF5 Q;  5KNB A;  3IL8 A;  3V96 A;  3CCR A;  1YJW A;  2B63 H;  1SSO A;  3I73 A;  4LWC A;  2IHF A;  4GN3 B;  5EBC A;  4ZRZ A;  1RDP D;  2N3S A;  4KD3 A;  4GLV B;  4DR6 Q;  4PMB A;  4DGZ A;  4ZKC B;  1IBL L;  4FDB A;  3W2D A;  3KLR A;  3NPP A;  1U9R A;  3I91 A;  4IO9 A;  1ASZ A;  1Z7T A;  1E0B A;  4IN3 A;  1GUN A;  2NN6 H;  2FHT A;  2QDL A;  1TWG H;  5KIX A;  2RF4 A;  1HJP A;  5GAE C;  1NUC A;  3JAM E;  1YJN A;  2K75 A;  2NN6 G;  2L11 A;  1EFW A;  1PZK D;  4IUN A;  4R4Q A;  5C4J B;  3GDE A;  4DUZ Q;  4B3S L;  1BCP B;  3TQY A;  3K6O A;  4DU9 A;  3X3N A;  1SAP A;  1VQH A;  5J39 A;  1B50 A;  4MIU A;  4PMW A;  1L1O B;  4UP8 A;  4DAY A;  3OMG A;  5KEE A;  1X9N A;  1HHV A;  2F0U A;  3J81 j;  3WDN A;  1EYA A;  1KAW A;  1PYB A;  4C2M H;  4QUF A;  4K5W A;  3NUC A;  2K28 A;  4DR2 L;  2OTL A;  1XX8 A;  1KL9 A;  3DLL A;  2SEB D;  3MXG A;  5ELC A;  1V1Q A;  1VDZ A;  4DV7 L;  1J5E Q;  1PRT B;  1G2T A;  3EBE A;  1TVX A;  4DV1 L;  1OTC A;  1XPO A;  3DEO A;  3PO2 B;  2F0Q A;  1STH A;  4X3T A;  1VQ9 A;  4IPD A;  3S2H H;  4K5V A;  1CM9 A;  4M8A A;  4FYD A;  3PO3 H;  2C35 B;  3R2I A;  3NWS A;  2RQX A;  4BY1 H;  4JK1 C;  4R8N A;  4DN4 M;  4NW2 A;  2BDN A;  1T5E A;  4X3S A;  1IBM L;  3U9S A;  2Z1C A;  1I94 Q;  1FNU A;  4JBJ A;  3KYH C;  3VDY A;  3S1N B;  1EQQ A;  1VQM A;  2GVA A;  2HHH L;  1K3B C;  2ZXR A;  1Q90 A;  5EPK A;  1VQ7 A;  4A3D G;  4AYB B;  2TMP A;  2K5V A;  5C0X H;  1K83 H;  4A3K G;  1II3 A;  5M9O A;  1B3A A;  1BNZ A;  4UHV A;  3KF6 A;  2HDM A;  3MFG A;  1CK1 A;  1FL0 A;  3TP7 A;  4FF2 A;  1Q46 A;  3LX0 A;  3VR2 A;  4PZ6 A;  2O5I C;  4JVZ A;  4A3I G;  2K7V A;  3N6R A;  1ENF A;  4TSS A;  4A3B G;  1EOV A;  2AUK A;  4YWK A;  2LXJ A;  3T1Y Q;  1A2T A;  3I4M G;  1B4O A;  4JI3 L;  1LV9 A;  2YU9 B;  4A93 B;  2D9U A;  2F0M A;  1LUZ A;  2PMZ E;  4RCN A;  1I50 H;  1EIH A;  3PQI A;  3PCO B;  5G3L F;  2CW0 D;  2R7F A;  3JAM i;  1R9T H;  2N49 A;  2PPB C;  5IWA Q;  4QCL A;  1HA6 A;  3A7L A;  4DUY Q;  4DR5 Q;  4QIW E;  2WFW A;  2HQL A;  1JIC A;  1VQ8 A;  3LWE A;  1VQI A;  1RCV D;  1YNN D;  3NE5 B;  3HKS A;  2A6E C;  3HOY H;  1JJG A;  1Q1E A;  1STG A;  1L0X B;  3K5O A;  2Z6B A;  1EYC A;  5FO9 B;  4KMU C;  3T13 A;  1EYD A;  1I6V C;  3DWA A;  4HJ7 A;  3CHB D;  4R4I A;  1JE4 A;  1H9S B;  4EQN A;  1S5B D;  3S17 B;  5I2X A;  2F3V A;  4JOI C;  2WB1 B;  2KED A;  2A68 C;  3CC7 A;  2I5H A;  1IYU A;  3HZX A;  1UAP A;  1SFO B;  3TP8 A;  3PV0 A;  3R3O A;  3D6C A;  3A0J A;  2IW3 A;  2L4N A;  5C3E G;  4DV6 L;  1HNZ L;  3GTM B;  1CKM A;  1IXR A;  1KRT A;  3K57 A;  1PFN A;  1SND A;  3BZK A;  1WCM B;  4U67 3;  4K0K L;  1T5X D;  3NEN A;  4XQJ A;  2ID0 A;  5LHY 1;  2XVS A;  3S15 H;  1AEX A;  2L15 A;  1EUJ A;  2K1B A;  1JR0 D;  3F2C A;  1ZKO A;  2DJG C;  2E8G A;  3VR5 A;  4PV1 C;  3BZC A;  1RHP A;  1WD0 A;  1U4L A;  3T53 B;  1SDF A;  3SEB A;  1P8L A;  3CCQ A;  4IPG A;  5CBE E;  4LFA Q;  3ERQ A;  1JJC B;  4CDD C;  1NCV A;  3SGI A;  4BY7 B;  3G6J B;  5E7N A;  5J22 A;  1CSP A;  3CQZ H;  4QB4 A;  1LTI D;  4P72 A;  4NXM Q;  1KDC A;  2EJM A;  4GN4 B;  2XRQ D;  3HOW H;  1Y1W G;  5ELD A;  4LNQ A;  2LY7 A;  3W1G A;  5CMD A;  2Q8T A;  1A0I A;  4IAL A;  1RF2 D;  3C1E A;  3S24 A;  1X6O A;  4RHS A;  1Y8P B;  2KVM A;  2O4X A;  4DV4 L;  3KF8 B;  1KLU D;  1HNX Q;  3NK9 A;  1NMG A;  2XIW A;  2Z4H A;  2E2I B;  2G5D A;  3Q8D A;  1SNP A;  4UP9 A;  4DK1 A;  2IPK D;  2JA7 H;  1EZ6 A;  2R93 H;  3HOV B;  3N52 A;  3U58 A;  1N33 L;  3EQL C;  4HIO A;  4FXG C;  1YHA A;  4GOP A;  1EL0 A;  3SK5 A;  3KFU A;  2WAQ E;  1OXX K;  5I2Y A;  4A3M B;  1WI5 A;  2F0P A;  3P7J A;  3K7U C;  5DLQ E;  4LF9 L;  2PZT A;  3M9B A;  4H13 C;  4R4C A;  1O7Y A;  4HMI A;  5HY6 A;  4BS9 A;  5JAV A;  3GTL H;  2IX3 A;  2RSO A;  4GOP C;  2IY5 B;  2MPM A;  1IBL Q;  1G6Z A;  1P16 A;  1J8I A;  4QJF A;  1JQY D;  2K52 A;  3RZO H;  2EYO A;  1MSH A;  1FNW A;  1A3V A;  3K0X A;  3RZD H;  1DOM A;  3AFQ A;  4OO1 H;  2KEC A;  2SNM A;  4ABN A;  2KCN A;  4B3S Q;  1LTS D;  5CBA E;  1G91 A;  2OT2 A;  3J7Z C;  4KJN A;  5LMU Q;  1LYL A;  1TWA H;  3HOX H;  1SRU A;  4MTK A;  2RVL A;  1KD1 C;  3FEW X;  4B08 A;  1C8C A;  2QF7 A;  4IOA A;  1C9O A;  5A2Q L;  3ER0 A;  2IT1 A;  2DY7 A;  3OMC A;  3G71 A;  4C3I H;  3GTO B;  1NTG A;  4QY7 A;  4CHT B;  4KJO A;  3PO2 G;  5COR A;  3I90 A;  1J6Q A;  1VQD A;  4DA2 A;  4DR2 Q;  4KN4 C;  1WTX A;  1CT1 D;  1QZH A;  5C6A A;  3C2P A;  3T16 A;  5IGE A;  4DV7 Q;  1ICF B;  2Z8L A;  1F77 A;  1CZG A;  3FKI H;  4H02 A;  4DV1 Q;  4BXX H;  3S1N H;  1GUW A;  1YHQ A;  5IYB H;  4KTA A;  5FLX c;  3S16 H;  2OF1 A;  5EPJ A;  4N8X 1;  2KBN A;  3H91 A;  5GAH C;  2B63 B;  1B8A A;  4NKL A;  4TRD A;  3I55 A;  1MGS A;  3D8G A;  3K5L A;  5IYB G;  5CR3 A;  1VQP A;  4N8F A;  3OWF A;  4HIK A;  2JA6 H;  2R7Z H;  4AYB G;  3J81 c;  1IBM Q;  4LAA A;  4ME3 A;  2CW0 C;  1D1I A;  4H0L C;  4JI6 Q;  4L5R C;  3KOJ A;  1PH3 A;  3F8T A;  4POG A;  1GXD C;  2HHH Q;  1N9W A;  1YNN C;  3OYY A;  4JI2 L;  1IW7 D;  1LTB D;  1RTN A;  1BXT A;  1SR3 A;  3HP3 A;  3OTO L;  4DNT B;  1U0L A;  2G9H D;  1NY4 A;  1KNE A;  2ZJR A;  2DN8 A;  3P20 A;  2R6G A;  3CKI B;  1LTL A;  1RJT A;  5GRO A;  2SNS A;  2ZTD A;  1CSQ A;  1VQN A;  5TSS A;  4K5X A;  4K8J A;  5IYD H; 
#chains in the Genus database with same CATH homology
 3BDL A;  1V1P B;  4ULL A;  1Q1B A;  2LS0 1;  4LK1 C;  5KNC A;  4N9T A;  5C3W A;  2RKS A;  2RA4 A;  4C2M B;  1F9Q A;  1A6X A;  3BDC A;  2NTS A;  4XQN A;  2Y0S B;  5JEA J;  4C56 C;  2LKV A;  1ZXT A;  1SMY C;  1QWY A;  2EYJ A;  4IZ8 A;  4L63 B;  2L12 A;  2OXP A;  4Q0F A;  4X3U A;  3C46 A;  2EZV A;  2IWH A;  3S2H B;  4G7O C;  1BUV T;  1VCI A;  3U9O A;  2IJ0 A;  5G3L D;  3PO3 B;  1SNQ A;  4RFB A;  4ZK9 B;  4BY1 B;  1OXU A;  1PTO H;  2WAQ B;  1I4H A;  1MBY A;  2BCO A;  1IYV A;  1HUN A;  1LTT D;  4CJ1 B;  3GD7 A;  4IFD I;  4CKC A;  5IGD A;  2F0H A;  5CGK A;  3PUX A;  1K83 B;  1EWH A;  4K2K A;  3NTK A;  1LT4 D;  2KJX A;  4KK7 A;  1JOO A;  2B2W A;  2Z4I A;  4KI0 A;  2EY1 A;  1G2S A;  1IHZ A;  4WOR A;  4FF3 A;  1TKW B;  1XWE A;  1UEA B;  4HAE A;  3K0Y A;  3P75 A;  1MI2 A;  3EVQ A;  3I3C A;  3ONA B;  2F0D A;  4EVO A;  4KHV A;  3A7A B;  2ZXO A;  1MD2 D;  1QG7 A;  3S9W A;  2B2V A;  1I50 B;  1Y69 U;  4CKB A;  1R9T B;  1TII D;  1ZEQ X;  1PMR A;  2L5T A;  1J9O A;  4HCE A;  2JP1 A;  1QIL A;  5KRU A;  3HOY B;  1CQF A;  1X32 A;  4HSP A;  2XWJ B;  4JBW A;  3M85 A;  4FF1 A;  3KLS X;  5C4H A;  2FIN B;  4WFN 3;  4FNF A;  4DFA A;  4QF4 A;  1F2Z A;  3NQT A;  3HKZ B;  1SXT A;  5JJZ A;  4KY6 A;  4DXF A;  4R8I A;  3VYS A;  3T4A C;  4RHR A;  1GOZ A;  1KDB A;  2QCP X;  3Q6S A;  5M5Y B;  3R2T A;  2K32 A;  2B2T A;  5I9O A;  4WRD A;  3NTI A;  2K05 A;  3S15 B;  2XSC A;  2B2T C;  4KKU A;  5IT9 L;  1ROD A;  4RGT A;  5CV6 A;  1CZW A;  1F2L A;  1H9R A;  4CJ0 B;  3F2U A;  1BCP D;  3CQZ B;  1FGB D;  1XTC D;  3I70 A;  1D5Z C;  1YNJ D;  2F0T A;  3FPP A;  4DAV A;  3HOW B;  3H6M A;  1TS2 A;  5FO8 B;  5ELE A;  2AWN A;  2Q8I B;  1SNO A;  1V43 A;  3E6Z X;  2HDL A;  1EU4 A;  5EJW A;  1ESF A;  3UI2 A;  3Q22 A;  1X3P A;  2FMC A;  1EWC A;  2JE6 I;  1A15 A;  2JA7 B;  2R93 B;  1HQR D;  3LWU A;  5IGF A;  3IFD A;  3OHX C;  2JEA I;  5DEH A;  1GHJ A;  3MXP A;  3GTL B;  3BDO A;  2BOS A;  2KOL A;  1TS5 A;  3M4Y A;  1H9K A;  3RZO B;  3MA2 B;  3MZ5 A;  3TME A;  2VXW A;  2XN9 C;  1KAB A;  3RZD B;  1XYI A;  3PIP 3;  1S5E D;  1EY0 A;  3I4L A;  1UUP A;  3NP8 A;  3VYR A;  1X3Q A;  1JB3 A;  1TS4 A;  4XTC S;  1Q3L A;  1FD7 D;  1TWA B;  1C4Q A;  4Q5V A;  3HOX B;  4KKT A;  2MHV A;  2MP1 A;  4C3I B;  1I4Q A;  2EYM A;  5T1G A;  3URY A;  4RWS C;  4EGV A;  3A8J E;  1Q8I A;  3ITP A;  3FKI B;  1QOH A;  2A5H A;  1HA5 A;  4H7B A;  5F2D A;  1SYC A;  2B2Y A;  1HFG A;  2WII B;  1SNM A;  2BDO A;  4HN7 A;  1E2Z A;  3S16 B;  2F4I A;  3H94 A;  4K2L A;  3MC0 B;  4ZQ3 A;  2B2Y C;  2EYL A;  4UAI A;  2JA6 B;  2R7Z B;  2EPB A;  3NBH A;  1B1Z A;  1Y8N B;  5C0X G;  3OSO A;  3J7A F;  1TY0 A;  5I9P A;  5JPM C;  4IUT A;  2K5Q A;  2YYZ A;  5EGT A;  3D4D A;  5A2Q E;  3V2T A;  5IGG A;  3SR1 A;  2ICE C;  2NYZ D;  3FVQ A;  1QE6 A;  2N55 A;  2M9V A;  3E0J A;  4NMZ A;  2L55 A;  2NB0 A;  1SYG A;  4PQX A;  3VA5 A;  3CU7 A;  3KBG A;  1CTM A;  2RDH A;  5HGT A;  3WOE A;  4O1N A;  1SE3 A;  2A6H D;  1SNC A;  5EKI A;  2X6G A;  2EYP A;  1CI3 M;  1STE A;  4M1U B;  5IIF A;  1BOS A;  1L0Y B;  5C4Z A;  1F9R A;  1SJH D;  2WIN B;  1DOL A;  3J80 L;  2KUM A;  2I46 A;  1PTO B;  3I8Z A;  4DNR B;  1K8O A;  2R3Z A;  1BCP C;  5CV8 A;  4TQU S;  2R61 A;  4KV6 A;  1YNJ C;  1SMY D;  3SK8 A;  2WV6 D;  1B2T A;  4G7H C;  2G9D A;  4NP5 A;  1TR5 A;  2EY2 A;  1DZ1 A;  3V05 A;  1HXY D;  4L6T B;  2D5D A;  1SE4 A;  1WTW A;  1PRT C;  3FRP B;  1CA5 A;  5AFW A;  3X3M A;  4BBS B;  2XNA C;  1Y1V B;  1D1K A;  3HRZ C;  3E5S A;  3J7Y W;  1GUO A;  1V8Q A;  3S1Q B;  1CHQ D;  3A8K E;  1H9M A;  3L3O C;  1EY6 A;  1VMP A;  2EOT A;  3DMU A;  3TP6 A;  4K6D A;  1EY4 A;  4OIJ A;  3RD4 A;  4MHE A;  3HGB A;  3BVZ A;  3A55 A;  4O42 A;  5KGU A;  4UDU C;  3D3R A;  3AU7 A;  1NAP A;  2NVQ B;  4A3F B;  2TSS A;  2DNC A;  5BN3 A;  5C44 B;  3DEP A;  1S5D D;  3OW7 A;  3A8I E;  4IFD H;  5DNF A;  4RGM A;  1JOQ A;  1HCZ A;  2EJF C;  1BBX C;  2PZU A;  1EEI D;  2F0E A;  4DXG A;  3R93 A;  4A3G B;  4E6I A;  1B9M A;  4PNY A;  4MN3 A;  3VR4 A;  3OPO A;  2K33 A;  1JWM D;  3MVV A;  2AQ1 B;  1BCP F;  2E2H B;  2RDF A;  1SYD A;  1Y8O B;  4OO1 G;  4G7Z C;  2PMZ B;  3PUV A;  2F0N A;  5C4X B;  5K36 H;  1BR9 A;  1HTP A;  1H9J A;  2D62 A;  2NBF A;  2OEO A;  3K5N A;  4QIW B;  2VUM B;  4XQQ A;  5I4D A;  4J1M A;  4XDX A;  2E75 C;  4I7Z C;  1H9S A;  2AUJ D;  4C3I G;  2BA0 A;  2NUC A;  4DK0 A;  1PRT F;  2H1E A;  3NQI A;  2PO4 A;  5JEA H;  1ONL A;  5I6Y A;  3H3V C;  3T51 B;  2F03 A;  2D2C C;  3NWT A;  3QOJ A;  5T1I A;  1OO9 B;  5JEA G;  3ND9 A;  5ELB A;  3G7L A;  4IFD J;  3Q24 A;  4C1N I;  3FMC A;  1D2B A;  2EYF A;  2F0V A;  1SBB B;  4KY7 A;  3TSS A;  1OXT A;  1IL8 A;  2A6H C;  5IT9 E;  4ZUI A;  2WKC A;  1AZQ A;  4N9P A;  2O2L D;  5A35 A;  3SDZ A;  5FK9 C;  1QNK A;  5KND A;  4ODG A;  4PMC A;  3AMU A;  4CJ2 C;  3NBI A;  4WJW A;  1BQQ T;  3M4O B;  5DM7 3;  5M3M B;  4RH6 A;  4OHJ A;  2X6L A;  3KF8 A;  3D31 A;  3KK7 A;  2X69 A;  4G4K A;  2FJ2 A;  1TWF B;  2KA7 A;  3IKJ A;  4A3J B;  1Z47 A;  2RBM A;  2B8G A;  1FYC A;  4DAP A;  5IGC A;  1WTV A;  1I4G A;  4QMG A;  4F8M A;  4V19 0;  2JA5 B;  4LMQ D;  4XIG S;  1R4Q B;  2F0G A;  2K04 A;  4J8Q A;  3I72 A;  1EFI D;  2NVY B;  1KDA A;  4HMJ A;  2KQ3 A;  3Q23 A;  1ICW A;  1GUS A;  1HQM C;  1TY2 A;  1ML0 D;  4IUR A;  3AB9 A;  1PTO F;  2L1B A;  4DF7 A;  1O80 A;  3L9A X;  3C3L A;  1EQT A;  3SK6 A;  2QDB A;  4C1N K;  4L8J A;  1AFP A;  1S4Z A;  2B2W C;  1E2W A;  1ZYR D;  1U4R A;  1VF7 A;  4IUP A;  2EJG C;  2HCC A;  1DOK A;  1BDO A;  2O5J C;  1E2V A;  1DCZ A;  3GTQ B;  3MWY W;  1AP0 A;  1STY A;  4B9X A;  2BE5 D;  1STA A;  4XT1 B;  3K58 A;  3NTH A;  2B2V C;  2MJ8 A;  4ZYS A;  5IOD A;  2EVB A;  1RD9 D;  1MSG A;  1I6H B;  3OIP A;  2PQE A;  1S5C D;  3QO2 A;  5CV5 A;  1PZI D;  3K7A B;  3LNN A;  4C3H G;  2C9O A;  1DON A;  3QOL A;  3RUZ A;  4IUQ A;  1EY7 A;  3KBX A;  2JA8 B;  1EIG A;  5ELF A;  3QJY A;  1LT5 D;  1V1P A;  1RTO A;  3D6W A;  3GQB A;  2DY8 A;  1LAC A;  2VNU D;  1TT2 A;  1TWC B;  1F9S A;  1R4P B;  2F0W A;  1I4X A;  2PYK A;  5DM6 3;  4EQO A;  2DNE A;  1DD2 A;  3M7G A;  2C5C A;  4TKO B;  5CV4 A;  2LMC B;  4H44 C;  5C5M A;  1PFM A;  2PW7 A;  3SK4 A;  5ISR A;  2J0T D;  3DHQ A;  5D3I B;  4K14 A;  2JXM B;  4V0B A;  2J7Z A;  3H0G B;  3W3A A;  2K6A A;  4OL7 A;  1F2Y A;  1UNS A;  1PZJ D;  3J80 E;  4ZAI A;  1D5X C;  1B53 A;  1A3T A;  2KEE A;  3BZD B;  1QNU A;  2EXZ A;  1HPC A;  1ENA A;  4NDX A;  3GTK B;  4BBR B;  2E76 C;  2F0L A;  4K6L A;  1G29 1;  1W6K A;  3OIQ A;  5E3F A;  2RSN A;  4IUV A;  5KYL A;  1PRT D;  3BYY B;  3TN2 A;  4ME5 A;  1HTL D;  1SJE D;  4XYO A;  2K01 A;  3M3Y B;  2H4O A;  4B9W A;  4RGO S;  2CVR A;  1JC7 A;  3HG9 A;  2QIL A;  1W6J A;  3OWE B;  1O7Z A;  1ET6 A;  1KTK A;  5EKL A;  1TS3 A;  5C5L A;  3TZU A;  2GA4 B;  2IX1 A;  1GUG A;  5COY A;  2F3W A;  4HED A;  1LT6 D;  5FLX L;  4ILW A;  3PUY A;  3TDQ A;  3CRL C;  4XYQ A;  5M5X B;  1ENC A;  4KN7 C;  4XXE A;  3J81 L;  5M3F B;  3MHB A;  3BG3 A;  2VB2 X;  1TQO A;  3R8B A;  4RCO A;  3VA7 A;  2CHB D;  3NXW A;  1LTG D;  3HS0 C;  3T56 B;  2CQA A;  2PW5 A;  1ZYR C;  3VR3 A;  4HCS A;  1B44 D;  4RKL A;  4F88 A;  3SE0 A;  5BN5 A;  2BA1 A;  2L0C A;  2NVX B;  4IUU A;  1SYF A;  1VF5 C;  2JSO A;  2BE5 C;  2I07 B;  3SVM A;  2AWO A;  3PUW A;  2F0K A;  3TBI B;  5I6W A;  2WAC A;  2EE1 A;  5E1F A;  3EA6 A;  1PXU A;  2A74 C;  1O78 A;  1PDQ A;  1VMC A;  4FF4 A;  3DXJ C;  5BN4 A;  1PTO D;  3FDT A;  2EYH A;  1WTP A;  4CKE A;  3BVM A;  3VR6 A;  4RA8 A;  3QIA A;  4RGN A;  1KLG D;  1HRJ A;  2E74 C;  1SE2 A;  4BWG B;  3NSW A;  1EZ8 A;  3GO5 A;  1RKN A;  1ILP A;  3GV3 A;  1S5F D;  3EJI A;  4KD4 A;  4C3J B;  4QUC A;  3RMH A;  1NR4 A;  5CC4 A;  1ILQ A;  4RKB A;  2HCI A;  2HUG A;  1OXS C;  2MGS A;  1GJX A;  1FR3 A;  2A73 B;  4A3E B;  4LJZ C;  4HTH A;  4U68 A;  4KKS A;  3MXN A;  1WVL A;  4HR7 B;  1D5M C;  2E2J B;  5HUR A;  3D4R A;  4FO2 A;  1STB A;  1EEF D;  3MXU A;  1LTA D;  5C0X J;  1NSN S;  3S14 B;  5NUC A;  2F0J A;  2NN6 I;  2QEJ C;  3DUZ A;  1G8Z D;  2QKI C;  5CV9 A;  4ID6 A;  1EY8 A;  2K5D A;  2ZXP A;  4EQP A;  4IQZ A;  2A69 D;  2ICI A;  1DM0 B;  4R9W A;  5DAU A;  3KUP A;  3PMF A;  3JAM L;  5FO7 B;  4ZKB B;  1QJO A;  3K5M A;  1DXM A;  2RDG A;  3GTJ B;  2E2D C;  5LL6 X;  1QCB D;  5CYU A;  4S3S A;  1GHK A;  5EQ0 A;  5JVH 3;  2M00 A;  4G57 A;  3VYT A;  3P1H A;  3J7A V;  1DJR D;  1JOK A;  4FXD A;  3KLS A;  1GUT A;  2EDG A;  3L7Z C;  4C3H B;  2K03 A;  5LL6 S;  2HQE A;  5FOB B;  1D6E C;  2R92 B;  2N88 A;  3CRK C;  3TZD A;  5IOC A;  3IFT A;  4CBV A;  1K8M A;  1AZP A;  4IFD G;  5JPN C;  5CV7 A;  3HOU B;  4F7X A;  2F0F A;  4FVM A;  4J6H A;  4P2C B;  1TWH B;  3MEH A;  5D3D A;  5C0X I;  1I4P A;  3H09 A;  3S1R B;  1IKL A;  4Z9C B;  1M8A A;  2SOB A;  5K36 G;  3TP5 A;  1LTR D;  4BA1 I;  1CHP D;  3MFY A;  5E4W C;  1PLF A;  3HOZ B;  3A56 A;  5K5P A;  4KY5 A;  4K8I A;  1BO0 A;  1WTO A;  1SYE A;  3QWN A;  2B39 A;  1PTO C;  4X3K A;  5KYI A;  3RLF A;  1IKM A;  2EY6 A;  2FMM A;  2SDF A;  4XT3 B;  3Q0A A;  1TU2 B;  1EU3 A;  2XRS D;  1KNA A;  1EY9 A;  3GTG B;  1B9N A;  2V4D A;  2F0I A;  3BS1 A;  2NTT A;  4RAU C;  1DYQ A;  3QG1 A;  3S2D B;  1XXG A;  1LLR D;  2WP8 J;  4YIJ A;  3M7N A;  1F9P A;  3DWP A;  2FFK B;  2B2U A;  3C1F A;  1JWS D;  5E4X A;  1JWU D;  1TWG B;  2B2U C;  4I65 A;  2Q8R E;  4Y7N B;  1A2U A;  1CFM A;  2L9H A;  1KAA A;  5JVG 3;  3VYU A;  3IAY A;  1WD1 A;  1JOR A;  1ET9 A;  4KHZ A;  4C3J G;  3BVG A;  5EPL A;  3DM1 A;  1LAB A;  2A69 C;  1AN8 A;  2LFN A;  4ZLT F;  1SEB D;  4OGQ C;  2AQ3 B;  2PZW A;  1WTR A;  3O13 A;  3SXH A;  1OXV A;  1NR2 A;  1Q12 A;  5FLX E;  2PCF B;  3ZYY X;  1BF4 A;  1O7L A;  5C3X A;  1QB5 D;  1LO5 D;  3DWQ A;  2NZ1 D;  4OIK A;  3QB3 A;  1EY5 A;  1FNV A;  3J81 E;  4A3D B;  3SHL A;  4A3K B;  2B8F A;  5JOB A;  1I4R A;  1U4M A;  1A3U A;  4ZUJ A;  3S1M B;  2VB3 X;  2F0O A;  2NVT B;  3NHH A;  4A3I B;  5J1Z A;  4OO1 I;  4A3B B;  1AW7 A;  1F2M A;  2F1M A;  2ZT9 C;  3I4M B;  4FXK C;  2XWB B;  4F87 A;  3BYT B;  2JEB I;  1SYB A;  1HFN A;  1U4P A;  2ENB A;  2KCC A;  1HUM A;  1STN A;  3I4N B;  5IGB A;  2J4X A;  5D14 A;  2EY5 A;  2F0S A;  2PNR C;  3PUZ A;  3WOF A;  1M4V A;  3FPU B;  1LT3 D;  5EKK A;  2KHS A;  1CA6 A;  3GP7 A;  1CQV A;  3PIO 3;  1PYW D;  4BA2 I;  5C3E B;  3MAQ A;  2JYO A;  4GZY C;  1I3Q B;  1JCK B;  5M5W B;  3OOC A;  1ESR A;  2AQ2 B;  2A6E D;  3GV6 A;  3A54 A;  3EFX D;  4FP5 D;  2IL8 A;  2WKD A;  1Z6H A;  2MUY A;  3ERO A;  1EOT A;  3D4W A;  2M2L A;  5FKA C;  1C48 A;  5D65 A;  2K5W A;  5EBD A;  1V1O A;  1WTQ A;  3MTS A;  3HEJ A;  2NWG A;  3GTP B;  3ND8 A;  2A68 D;  4HSV A;  1EQV A;  4CGY B;  1PFB A;  1IW7 C;  1Y1W B;  3K59 A;  2IX0 A;  5KNB A;  3IL8 A;  3V96 A;  1SSO A;  3I73 A;  5EBC A;  4ZRZ A;  1RDP D;  4KD3 A;  4PMB A;  4DGZ A;  4ZKC B;  3W2D A;  3KLR A;  3NPP A;  1U9R A;  3I91 A;  1Z7T A;  1E0B A;  4IN3 A;  1GUN A;  2NN6 H;  2FHT A;  5KIX A;  1NUC A;  3JAM E;  2NN6 G;  2L11 A;  1PZK D;  4IUN A;  5C4J B;  1BCP B;  3K6O A;  4DU9 A;  3X3N A;  1SAP A;  5J39 A;  1B50 A;  4MIU A;  4PMW A;  4DAY A;  3OMG A;  5KEE A;  1HHV A;  2F0U A;  3WDN A;  1EYA A;  4QUF A;  4K5W A;  3NUC A;  2K28 A;  1XX8 A;  2SEB D;  3MXG A;  5ELC A;  1VDZ A;  1PRT B;  1G2T A;  1TVX A;  3DEO A;  3PO2 B;  2F0Q A;  1STH A;  4X3T A;  4K5V A;  1CM9 A;  4M8A A;  4FYD A;  3R2I A;  3NWS A;  2RQX A;  4JK1 C;  4R8N A;  4DN4 M;  4NW2 A;  2BDN A;  1T5E A;  4X3S A;  3U9S A;  2Z1C A;  1FNU A;  3S1N B;  2ZXR A;  1Q90 A;  5EPK A;  4AYB B;  2TMP A;  5C0X H;  1II3 A;  5M9O A;  1B3A A;  1BNZ A;  2HDM A;  3MFG A;  1CK1 A;  3TP7 A;  4FF2 A;  3LX0 A;  3VR2 A;  2O5I C;  2K7V A;  3N6R A;  1ENF A;  4TSS A;  2AUK A;  1A2T A;  1B4O A;  1LV9 A;  2YU9 B;  4A93 B;  2D9U A;  2F0M A;  4RCN A;  1EIH A;  5G3L F;  2CW0 D;  2PPB C;  4QCL A;  1HA6 A;  3A7L A;  1JIC A;  3LWE A;  1RCV D;  1YNN D;  3NE5 B;  2A6E C;  1Q1E A;  1STG A;  1L0X B;  3K5O A;  1EYC A;  5FO9 B;  4KMU C;  3T13 A;  1EYD A;  1I6V C;  3DWA A;  3CHB D;  1JE4 A;  1H9S B;  4EQN A;  1S5B D;  3S17 B;  5I2X A;  2F3V A;  2WB1 B;  2KED A;  2A68 C;  1IYU A;  3HZX A;  1UAP A;  1SFO B;  3TP8 A;  3PV0 A;  3R3O A;  3D6C A;  2IW3 A;  2L4N A;  3GTM B;  3K57 A;  1PFN A;  1SND A;  1WCM B;  4U67 3;  1T5X D;  4XQJ A;  2ID0 A;  5LHY 1;  2XVS A;  1AEX A;  2K1B A;  1JR0 D;  1ZKO A;  3VR5 A;  4PV1 C;  1RHP A;  1WD0 A;  1U4L A;  3T53 B;  1SDF A;  3SEB A;  5CBE E;  3ERQ A;  1NCV A;  4BY7 B;  3G6J B;  5J22 A;  4QB4 A;  1LTI D;  1KDC A;  2EJM A;  2XRQ D;  5ELD A;  2LY7 A;  5CMD A;  2Q8T A;  4IAL A;  1RF2 D;  3C1E A;  4RHS A;  1Y8P B;  2KVM A;  2O4X A;  1KLU D;  3NK9 A;  2XIW A;  2Z4H A;  2E2I B;  1SNP A;  4DK1 A;  2IPK D;  1EZ6 A;  3HOV B;  3N52 A;  3EQL C;  4FXG C;  1EL0 A;  3SK5 A;  1OXX K;  5I2Y A;  4A3M B;  2F0P A;  3P7J A;  2PZT A;  4H13 C;  1O7Y A;  5JAV A;  4HMI A;  4BS9 A;  2IX3 A;  2RSO A;  2MPM A;  1G6Z A;  1J8I A;  1JQY D;  2EYO A;  1MSH A;  1FNW A;  1A3V A;  1DOM A;  4OO1 H;  2KEC A;  2SNM A;  4ABN A;  2KCN A;  1LTS D;  5CBA E;  1G91 A;  2OT2 A;  4KJN A;  2RVL A;  3FEW X;  4B08 A;  1C8C A;  2QF7 A;  5A2Q L;  2IT1 A;  2DY7 A;  3OMC A;  3GTO B;  4CHT B;  4KJO A;  5COR A;  3I90 A;  4DA2 A;  4KN4 C;  1WTX A;  1CT1 D;  5C6A A;  3C2P A;  3T16 A;  5IGE A;  2Z8L A;  1F77 A;  1CZG A;  1GUW A;  4KTA A;  2OF1 A;  5EPJ A;  3H91 A;  2B63 B;  4NKL A;  4TRD A;  1MGS A;  3D8G A;  3K5L A;  5CR3 A;  3OWF A;  4LAA A;  2CW0 C;  1D1I A;  4H0L C;  1GXD C;  1YNN C;  1IW7 D;  1LTB D;  1RTN A;  1BXT A;  3HP3 A;  4DNT B;  2G9H D;  1KNE A;  2DN8 A;  3P20 A;  2R6G A;  3CKI B;  1RJT A;  2SNS A;  5TSS A;  4K5X A;  4K8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...