4JI2Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji2Q00
3K81C 1WCMG 1V43A 1KRTA 4WJ4A 4DUZQ 5IWAL 1IBLL 4IFDG 2JE6I 1I94Q 3RLOA 4P72A 5ELOA 5JJLA 1X3EA 2WAQE 4HJ9A 2V1CC 3PUXA 1Y1VH 5DLQE 2F4VL 2K50A 1E7ZA 3U4VA 1KRSA 3CCMA 1XPUA 4DR7Q 3OTOQ 1P8LA 3HKSA 3UDIA 1OTCA 1X6OA 1K73C 2YTYA 3AFPA 2KBNA 3FP9A 2Q2IA 4R4QA 5FLMG 4TVAB 4HJ5A 4KHPQ 1IL2A 2JA6G 1IBMQ 3CCVA 1JE5A 4A3GG 2GVAA 4DNIA 1EOVA 1VS0A 1E1TA 4ME3A 1L0WA 4BY1G 5FJ8H 4YY3L 3UDGA 4A3DH 4J15A 5LMNQ 3UDXA 4DV0Q 2Q2HA 1JJ2A 4YWMA 3IRBA 4LF9L 2K5HA 4IPGA 1TWFH 3EN2A 4IOCA 2ATWA 3PO2H 1SN8A 4KI0A 5IT9c 1K0RA 1A8VA 2UUAL 1KXLA 1FGUA 2UXCL 1XNQQ 4DV1L 4DUYL 4A3CH 1D8LA 4H02A 2R7ZH 1GD7A 2XTIA 1J5EL 2H5XA 1K3RA 4JI3L 1UWVA 3KFUA 3A5ZB 2OQ0A 2KHJA 3TQYA 4JG2A 4P71A 1AH9A 1Z47A 1Q12A 1KL9A 2K5NA 3BZCA 3VDYA 4BXXH 2F52A 2ZJRA 3K80C 4DR4Q 1IYJB 4JI1L 2N49A 2R93G 2AKWB 3UE0A 5C0XG 1YZ6A 4BBRG 1HNXL 5JJIA 2JA8G 3M4PA 4JI0L 4FDBA 3KF6A 1HR0Q 2MQHA 3G4SA 4DKAC 2KCMA 1JB7A 2CWPA 4A3KH 4LF7Q 1PVOA 3CF5A 2I0QA 3S17H 1DGSA 2N78A 4L5RC 1GM5A 3BJUA 4GN4B 4JYAQ 2NN6I 4MTNA 3KJPA 1HNZQ 1CKNA 3KOJA 4LFAL 4JCVE 4AYBG 3GTLH 2JJQA 5LMNW 4A3JG 1YBYA 1I50H 5EAYA 2E5LQ 4GKKL 2AWNA 1CKMA 4IJLA 3M4QA 1L1OC 4JI4L 4DV3L 1X9NA 4A3LG 3GTGH 5GROA 2ZTCA 2UU9L 1IBML 3PUWA 5M5YH 4X65L 4LFCQ 4K0KQ 1TWGH 2ZJPA 2VNUD 3STBD 1PH9A 2ASBA 3CCRA 1FJGL 1PYSB 4QY7A 4DR3Q 2AHOB 2PMZE 1XMOQ 1U5KA 4IFDI 1H95A 3D31A 4BBSG 4POFA 4LF8L 4C3IH 4ALPA 1WJJA 5HY6A 2K14A 1I3QH 3NEMA 4R4CA 4YCVA 4HJ8A 2OWOA 2R92G 1N34L 4JI7Q 3M85A 4PG3A 1NMFA 2NVQH 1PFSA 4DUYQ 3HKZG 2Q2UA 3MXNB 3EIVA 3KF8B 3M7NA 2A8VA 1HZAA 5FLMH 3RLNA 4LF4Q 3GTJH 4O0AA 1E3PA 1X3FA 3K0XA 2NZOA 2ZTEA 4GS3A 4OWTB 1L2FA 4DV4Q 4DV5L 4DR1L 4BY1H 3M3YH 3S2DH 3F1ZA 3CCLA 3CP0A 1PH2A 1EUJA 4QGUA 2MNAA 4MNOA 4UPAA 4K0KL 1KAWA 2ID0A 1PH3A 2JA6H 2RHSB 3RN2A 2NVXH 2PI2A 2VQEL 1VQMA 2ZM6Q 4JI0Q 1TWHH 2ES2A 2VUMH 4JI4Q 4JI8Q 4AH6A 2B63H 3FKIH 1E22A 5IP7G 4GNXA 2K5VA 1UE6A 3H3VI 4LUOA 2WB1G 1G6PA 4X64Q 3PO3G 3OTOL 4JI6L 4KLKA 1Y1VG 2Y0SG 3ULPA 1KHIA 2VY3A 1M1KC 2R92H 1YJNA 4GNXC 1K8GA 1IBKQ 4KHZA 4LF7L 1XMOL 3K8AA 2WB1E 4TQUS 1PH8A 4AQYL 1N9WA 2Q2TA 5C0XJ 4X64L 4LFCL 1X3GA 2R7DA 4DV1Q 2UUCQ 1X55A 4B3TL 2IY5B 4YCWA 1WYDA 2YTXA 4GLXA 1KIXA 4OO1I 4JBKA 1YNXA 1WI5A 1VCIA 2ZM6L 2MFIA 1JT8A 4RG1A 4O2DA 4LF8Q 3HKZE 4QQBX 4A3EH 2VQFQ 4IOAA 4AIMA 5GAHC 3W1BA 4A75A 3PUVA 1HZCA 3I4NH 4DR3L 2QEXA 4JI3Q 3KYHC 1XMQQ 3U4ZA 4RMFA 4DV4L 4DV5Q 2B63G 4P73A 5M3MG 5JJKA 2GVBA 4X65Q 1NY4A 3TS0A 2MO1A 2ZJQA 4B3SL 1C9OA 4GOPB 4BBSH 4DR2L 4DV2L 1XMQL 3E9IA 1MIUA 2D62A 2JQOA 3CCSA 2JA7H 4GLVB 4P75A 4A3IH 1Q81C 1S72A 2OQKA 4OWXB 3HOZH 2CCZA 3I7FA 2AMCB 3CD6A 4HJ7A 4UP7A 2E2JH 4R4IA 2I5LX 4A4IA 1JMCA 2OTLA 1M90C 3CQZH 1GO3E 1OXTA 4JV5L 1N32L 1L1OB 3CMAA 5GAGC 1PH1A 1VQ5A 4A3MG 1MJCA 3L2PA 4LF6L 1J5EQ 2I5HA 4LUZA 5C44H 4P74A 4LUVA 3S2HH 1FJGQ 1N36L 1Q1EA 2BA1A 3AFQA 4GN5A 4DV6L 2YU9H 3AQQA 4LF6Q 3HOVG 4LW1A 3S16H 2I5MX 3TRZA 4DAYB 3E0EA 1VQLA 4XIGS 1K83H 1JJGA 3NELA 4HIDA 1KQSA 1G291 4L5SA 2PI2E 4DUZL 1IXRA 4JI2L 4BY7H 1Q46A 3S1MH 5LMNL 2GN5A 4A3FH 1QVCA 3KDFA 1XPOA 3FKIG 1YHQA 2JA5H 3UDFA 3L0OA 1HZ9A 1HZBA 2VQFL 3J81i 3A5UA 4LF4L 3LGJA 1BKBA 2JA9A 3S14H 2LXKA 4DV2Q 1BBWA 2HQLA 2UUAQ 4DV6Q 3HOUG 3AEVA 3D0FA 4A3GH 1LYLA 1SRUA 3UE1A 1EYGA 1Q1BA 2CQOA 4A3FG 2JA5G 4B3TQ 2E8GA 3S24A 4LF9Q 1UE1A 5LMUL 1SR3A 2N3SA 2NZHA 1VQHA 3RN5A 1X65A 1PH7A 1TXYA 4DK6C 5IP7H 1VQGA 3J81c 3HOZG 3J7ZC 4DR4L 4A3CG 4L5QA 4YY3Q 4C3HH 1UE7A 3M9BA 4A3KG 3PO2G 4UY8C 3H3VH 4X62L 1SMXA 2E2HH 5IYBH 1XJVA 5IY0A 3RZDH 2EXDA 3CPWA 5C4XG 3NENA 4JI7L 2UUCL 1UE5A 1VQ9A 1QZHA 2IHFA 3CCJA 3U50C 4AYBE 2HIXA 2YYZA 4JI8L 1J6QA 1XNQL 2UXDQ 1FL0A 1VQJA 4C2MH 4DAMA 5FJ8G 4IPHA 2HHHQ 4R4TA 3HOXG 1B8AA 1MKHA 3STBC 3TEHB 3A0JA 1OXVA 5M5WH 3JAMi 3T1YL 3S1NH 2BH8A 2ALYB 4DR1Q 2Z6KA 1PH5A 4JI6Q 2EQSA 2VUMG 3Q8DA 4R1JA 3J80c 5C4XH 1X56A 4A3BG 4DR2Q 1D7QA 2CFMA 4LFBQ 4QIWE 4B3SQ 4XTCS 2VQEQ 4JI5Q 1VQ4A 3AYHB 5JEAG 1IZ6A 4DR6Q 1SROA 5M5XH 1LM0A 4GN3B 3H0GH 3J80i 4LWCA 3PUYA 3EBEA 1I6HH 4YHHL 1NE3A 4L5TA 3PCOB 1L1OA 3F2DA 3CAMA 3GTPH 4IPDA 1QUQA 4A3LH 2IHEA 1CUKA 2L15A 4IPCA 1PH6A 1YHBA 3ER0A 4JBMA 4OWWB 3RZOH 1EWIA 3I2ZA 3CW2C 2F3IA 2R7FA 1TWCH 3DM3A 4JI1Q 2VS1A 5M3FG 1HH2P 1VQ6A 5IP9G 2DGYA 2AWOA 4JC0A 1VQIA 5K36G 1E24A 2FXQA 3F2CA 4LFBL 1MJEA 2VL6A 1E1OA 1BBUA 1PYBA 4IJHA 3PIOA 2IT1A 2K4KA 1YJ9A 4LFAQ 1P16A 3KLWA 2IX0A 2QA4A 1C0AA 4OONA 1KC8C 1A62A 1B70B 4HIMA 5BR8L 4BXXG 1Q82C 5FLXc 3DLLA 3SGIA 2R6GA 3TS2A 4HJAA 2UU9Q 4A3BH 1PHJA 1VQ8A 4Y52H 4JBWA 4DV3Q 2WP8J 1RIPA 1T9HA 5IYCH 1WCMH 5H1SE 2JK8A 3MEFA 3G6EA 1PH4A 1K8AC 2JA7G 1BVSA 1NTGA 3HOXH 3CC7A 5C0XI 3T1HQ 4JYAL 2D0PA 3RLFA 4B3RL 1V9PA 2ZTDA 1YVCA 4A3EG 2HHHL 1HJPA 1CKOA 1OXUA 2BH2A 2RCNA 2YTVA 5ELNA 4GOPC 4IO9A 3ICEA 2NVYH 4HIOA 1VQNA 5C3EH 1QVGA 1AE3A 4X66Q 2F4VQ 1N34Q 1B7YB 3KJOA 4JV5Q 1WFQA 1QVFA 2B3GA 2UXCQ 4NXNL 2DUDA 4LF5L 1VQBA 3T1HL 4B3RQ 3HOVH 3I56A 4BA1I 2R93H 3L7ZC 4LF5Q 1OXXK 3GTQH 4A3IG 3PF5A 1SLJA 2KCTA 5IYDH 4UP8A 1YITA 3J7A5 3PO3H 4GKJL 2E2IH 3I4MG 2YV5A 3GTMH 2OTJA 4JI5L 3PUZA 1EQRA 2KHIA 3ERSX 3PGZA 5BR8Q 5M3MH 2WFWA 4GKJQ 2R7ZG 1VQDA 2JEBI 2RHQB 2A1AA 2A19A 3KDFB 3CCQA 3M4OH 4NXMQ 2LXJA 1SFOH 4EQ5A 3OYYA 3S1QH 4BY7G 5IYBG 3ZJYC 1CKNB 4EX5A 3G48A 5AJ3Q 3T1YQ 3TREA 3HOWH 5GADC 4JOIA 4GNXB 2Z0SA 1V1QA 3ULLA 4DV7L 5HGQA 4MZ9A 4IFDJ 1K9MC 5IWAQ 4PZ8A 1IBLQ 4C3JH 4YWLA 2UUBQ 3RNUA 4X66L 1Q86C 1EFWA 3CC4A 3GDEA 1G51A 4JOIC 3HFZB 2VW9A 3PIPA 1LTLA 2D0OA 3CPFA 3CC2A 4A3MH 4A93G 4OO1G 3WWVA 1EIYB 1Q8KA 5C44G 2Z6KC 4NPSA 4YCUA 3ULJA 3CXCA 4A76A 1YJWA 1X54A 4POGA 2MO0A 4X62Q 2KENA 3BU2A 3OW2A 2WAQG 1N8RC 1IBKL 5GQOA 2CKZB 4QJFA 1C7YA 1HNWL 3CCEA 4DV7Q 4NXNQ 4HIKA 1RL2A 3HOWG 3GD7A 4PMWA 2B29A 4PZ6A 1NMGA 1KD1C 4BBRH 1UEBA 5LMUQ 1YIJA 1AE2A 2EIFA 2HT1A 1N33Q 5IYDG 5IYCG 2CWAA 2NVTH 1TWAH 2UXBL 1YEZA 3NBHB 1EIFA 3E9HA 4OXPA 3S1RH 1S40A 4KHPL 1S3OA 2RF4A 3U58A 1FVIA 3BZKA 2UXBQ 2JEAI 4UP9A 1PV4A 1VQEA 4X6AH 4DR7L 1XTDA 2HIVA 1XPRA 1VQPA 1PA6A 1VQFA 3K7AH 2VZAA 1VQOA 4DV0L 1QZGA 4DPGA 5M3FH 3S15H 4DR6L 2Y0SE 4GOPA 1ASYA 2UXDL 3K7UC 1HNWQ 5JEAJ 5IE8A 3HOUH 2PNHA 3FHWA 2NN6G 4GLAC 1W3SA 2QGQA 3G71A 1HNXQ 3HOYH 3I4MH 2PQAB 4NB3A 1XNRQ 5GAEC 1Y14B 2OCEA 1JJCB 5C4JH 4AQYQ 1A0IA 2XGTA 1QUQB 2UUBL 1OXSC 1N32Q 4DR5L 1VQAA 1I5FA 4DK3C 3GTKH 4YHHQ 1I94L 3PV0A 1LUZA 4DR5Q 5AJ3L 1YHAA 2K52A 4YWKA 3JC66 3W5OA 4LNQA 1VQKA 4B3ML 4NXML 1SE8A 5C3EG 3I4OA 1VQ7A 4OX9Q 3HOYG 1XNRL 1HR0W 4APVA 2PQAA 2LSSA 3KF6B 4Y7NH 1O7IA 3I55A 1CSPA 4PZ7A 2E5LL 4GKKQ 4A93H 3I4NG 1NBWA 1N33L 3PF4A 3F8TA 3A74A 1W2BA 4R4OA 1HNZL 3RR5A 4JI2Q 2IX1A 3J81j 5IP9H 4JBJA 3H15A 1Q7YC 1ASZA 1GKHA 4WJ3M 1Y1WH 3F2BA 3B6YA 4A3DG 3W1GA 1VQCA 1WOCA 3GO5A 1Z9FA 3JAMc 5E7NA 3CMEA 1HR0L 1U0LA 1NJIC 5J3BA 4BA2I 4QL5A 1CSQA 2C35B 1YI2A 3PSIA 2N8NA 1N36Q 1GVPA 2JA8H 2BA0A 4A3JH 2K75A 1EQQA 3CCUA 1Y1WG 1R9TH 4OX9L 3GTOH 4B3MQ 1A63A 3H0GG
chains in the Genus database with same CATH superfamily
1WCMG 1WVLA 4DU9A 4IFDG 5ELOA 3EQLC 4HJ9A 2DNCA 1SYCA 2M2LA 2I07B 4DR7Q 1P8LA 1IYUA 2SEBD 3HKSA 2Q2IA 4R4QA 1NCVA 2B63B 2WV6D 1QE6A 4R8IA 1IBMQ 3NE5B 2GVAA 3TP6A 1EOVA 4BXXH 4LFBL 5D3IB 4A3DH 3A8IE 1CT1D 4YWMA 4HR7B 4LF9L 4IPGA 2O4XA 4C3JB 4OL7A 3TMEA 4KI0A 1A8VA 2UXCL 3NUCA 4A3CH 1Q8IA 2XTIA 2H5XA 4JI3L 2RDGA 1B4OA 1EQTA 4JG2A 2F0GA 1Z47A 4C3IB 4RGOS 3BZCA 1VMPA 2D2CC 2RQXA 4KV6A 3VDYA 1DM0B 2K6AA 4JI1L 3M7GA 2R93G 4HMIA 2NUCA 2F0VA 4BBRG 5JJIA 3L3OC 2G9HD 2KCMA 1H9SB 5JPNC 2N78A 4JYAQ 1GHJA 4M8AA 4LFAL 1TS5A 1PRTB 1E0BA 4IUTA 3VYSA 3C3LA 4A3JG 5T1IA 3GTGH 5GROA 2ZTCA 1K3BC 4A3FB 2FHTA 3PUWA 4X65L 2UU9L 2HQEA 2ZJPA 3EFXD 5AFWA 3OSOA 2PMZE 4N8FA 1F2YA 2WKDA 1U5KA 1C4QA 2MHVA 4BBSG 1HRJA 1KABA 1JB3A 1WJJA 4IFDH 5KYIA 3EA6A 3SK6A 1IHZA 3NEMA 2E74C 4R4CA 1TS4A 4WJWA 3BZDB 1PLFA 4HJ8A 1BOSA 1F2ZA 2NVQH 4DUYQ 2Q2UA 3E6ZX 3KF8B 2A8VA 3HOWB 2J0TD 4DK0A 1V1PA 4O0AA 5IGDA 1X3FA 3K0XA 3F1ZA 3IAYA 3CP0A 4K6DA 4UPAA 4K0KL 3CU7A 1PH3A 1EYDA 1QB5D 1PFBA 2IJ0A 1RJTA 2ES2A 3OHXC 4JI4Q 3TBIB 1BBXC 3FKIH 1BCPF 1UUPA 2K5VA 4LUOA 3PO3G 4JI6L 1CZGA 3TP7A 2Y0SG 2SDFA 5FLXE 1IBKQ 3KLSX 5L37A 1JWSD 4X3TA 5M9OA 1SSOA 2B2VA 1XTCD 2EYJA 1PH8A 2KVMA 2WAQB 1LTAD 1ICWA 3MFGA 4OO1I 1RTNA 1WYDA 2F0DA 2F0FA 4ME5A 1PTOF 2TSSA 4O2DA 4RG1A 5EPJA 4C2MB 4IOAA 5GAHC 4A75A 2VUMB 1MSGA 1XMQQ 3HOUB 2B63G 3TP8A 4R9WA 5JJKA 4X65Q 4QCLA 1LLRD 4DV2L 1XMQL 3E9IA 4HTHA 4J6HA 1Y8OB 4GLVB 4A3IH 4RAUC 1S72A 2OQKA 2CCZA 1LTTD 5I4DA 5IGFA 3AB9A 1N32L 3MC0B 1STEA 2Q8IB 1VQ5A 1BCPD 1MJCA 3Q24A 4A3MG 4LF6L 2I5HA 1CA6A 4LUZA 5C44H 4HCEA 5DAUA 5KEEA 1FJGQ 3K59A 4XQJA 1YNNC 3ONAB 4GN5A 5E4WC 3AFQA 4DV6L 3I4MB 4LF6Q 3HOVG 4LW1A 3S16H 2I5MX 4C3IG 1B2TA 4XIGS 5DEHA 1JJGA 1KQSA 3TSSA 4L5SA 4DUZL 1IXRA 4JI2L 4PMCA 4A3FH 1STAA 1CTMA 3KDFA 3FKIG 2F1MA 2VQFL 3A5UA 4LF4L 2JA9A 3S14H 5IOCA 3HOUG 4DV6Q 3GTJB 3U9OA 4DAPA 2R61A 2JA5G 4LF9Q 3LX0A 4H44C 2NZHA 1VQHA 3RN5A 3J81c 5CBEE 4K8JA 1WD0A 3RZDH 3T4AC 4A3MB 3U50C 2ZXRA 1BQQT 2HIXA 2EYMA 5D3DA 5BN4A 1FL0A 1F2LA 1BR9A 4PQXA 5JOBA 4N8X1 1NNXA 3STBC 3A0JA 2F0HA 3V05A 3I8ZA 3C1EA 4DR1Q 2AQ3B 1X56A 1II3A 1D7QA 4QIWE 2F0JA 5HURA 1DZ1A 3AYHB 4FXGC 1IZ6A 4K8IA 4ABNA 3OIPA 3J80i 3TZUA 1I6HH 3DEOA 2OF1A 1NE3A 1Q3LA 2XRQD 1TWHB 4IPDA 1QUQA 2N88A 2YU9B 1ET6A 2NVXB 1JQYD 4IPCA 4C1NI 4TSSA 3I2ZA 3J81L 4ZK9B 2F3IA 3A55A 1TWCH 5C44B 1G2SA 1HH2P 4DAVA 2CH4W 5IP9G 2DGYA 5C3EB 2AWOA 5CGKA 1S5CD 3V96A 3ND9A 2VL6A 1BBUA 5EPLA 4IJHA 5M5WB 1WTXA 1P16A 4KKUA 1ILQA 2K04A 4OONA 5BN5A 1B70B 1KC8C 2A6EC 4HIMA 5IGBA 4Y52H 4KHVA 1VQ8A 3N6RA 4OO1H 1JE4A 3MXPA 2A6ED 1WTPA 1D1IA 1RIPA 1T9HA 3P75A 4IUNA 1PH4A 3G6EA 4B9WA 2AUJD 1BVSA 1NTGA 1K0SA 1TWGB 4ID6A 5C0XI 2IW3A 3T1HQ 2E76C 3K57A 2ZTDA 3NPPA 1HJPA 1H9MA 3ICEA 4IO9A 3A54A 2XRSD 1VF5C 1VQNA 1O7YA 4F7XA 4X66Q 5C5MA 2EY5A 5JVG3 1GUTA 2DUDA 4CKCA 1S5DD 3A56A 3OMCA 3T1HL 3HOVH 1G8ZD 2R93H 3L7ZC 1OXXK 5IYDH 1YITA 1RHPA 5IGCA 4KY5A 1YNJC 3K7AB 5BR8Q 5M3MH 2A1AA 4EQ5A 1DXMA 2P5ZX 3TREA 5GADC 1TIID 4GNXB 2A74C 3IKJA 1SBBB 4YWLA 2NTTA 1Q86C 2F0IA 4JOIC 1PZJD 3HFZB 5ISRA 3CC2A 4A93G 3WWVA 2K5QA 3CXCA 3BDCA 3BG3A 3ULJA 1X54A 4F87A 5A2QE 1F9SA 2RDFA 1PFMA 4QJFA 4KKTA 2MP1A 1Z6HA 4O42A 3PQIA 4H7BA 5LL6S 3QG1A 3NWTA 1QG7A 2RVLA 3J7AV 1TWAH 4OXPA 2DN8A 1S40A 1PTOD 4RGTA 2RF4A 1FVIA 2LY7A 1PV4A 4AYBB 1TWCB 1XPRA 3KBGA 1VQFA 2JN4A 2VZAA 3FDTA 4DV0L 4DPGA 2XVSA 2F3VA 1NSNS 4BS9A 3LWUA 3K7UC 1HNWQ 1WD1A 1DCZA 3K5LA 3HOYH 1W3SA 4FVMA 4NB3A 1Y14B 5C4JH 1EEID 1ENCA 4DR5L 1EIHA 3AMUA 5IODA 1LTGD 5E1FA 4DR5Q 3BYTB 1YHAA 3VA5A 4YWKA 2F0PA 3ERQA 2NN6H 5CV4A 5FOBB 2NVQB 2L0CA 3KF6B 3VR3A 3VA7A 1O7IA 4L8JA 1WTRA 1N33L 4IUPA 3PF4A 3RR5A 3FPPA 3I4NB 1ASZA 2EYLA 3QJYA 2B8FA 2Z8LA 1VQCA 3CMEA 4QL5A 1EOTA 4Q5VA 1YI2A 3PSIA 1IYVA 2RDHA 2K75A 1R9TH 3GTOH 1KLUD 1A63A 3K81C 2Y0SB 4WJ4A 4DUZQ 5IWAL 2B2UC 5LL6X 1I94Q 3RLOA 3H6MA 1H9RA 3GTLB 4DN4M 2WAQE 4DXGA 4DXFA 2F4VL 1E7ZA 1XPUA 2AQ1B 5CV8A 1OTCA 2JA8B 3R8BA 2SNSA 4TVAB 3FVQA 4KHPQ 1A3VA 1VS0A 5KIXA 4ME3A 4BY1G 1L0YB 4QUFA 5LMNQ 3A8JE 3UDGA 4DV0Q 2JP1A 3IRBA 5ELEA 4S3SA 3VR5A 3FRPB 4KMUC 2ATWA 1OO9B 2KHSA 1EL0A 1SN8A 5IT9c 1K0RA 4HSPA 4QMGA 2UUAL 1KXLA 1FGUA 5KNBA 2AUKA 1PMRA 1TVXA 1D8LA 5C4ZA 2Z4IA 2R7ZH 1J5EL 3ITPA 4XQNA 3OWEB 5CBAE 2OQ0A 2XNAC 1JOOA 1CHPD 3BVGA 2QKIC 5ELDA 3EROA 4DR4Q 2E2IB 2EOTA 4B9XA 2N49A 1KAAA 1HNXL 1S5ED 2JA8G 2XN9C 3KF6A 2MQHA 1JB7A 1TT2A 3T16A 4DKAC 2CWPA 1EU3A 5D65A 4LF7Q 4JVZA 3CF5A 3S17H 1DGSA 4GN4B 2K5WA 2NN6I 4MTNA 1O78A 4O1NA 1CKNA 3KOJA 1HNZQ 3NTIA 5FLXL 2BOSA 1GXDC 1I50H 5EAYA 1MGSA 2TMPA 4IJLA 1VMCA 5FO9B 2PPBC 1X9NA 1IBML 1R9TB 1TWGH 3KLSA 1PH9A 1FJGL 2AHOB 3P1HA 1XMOQ 1H95A 1GOZA 4POFA 4LF8L 1RCVD 2K14A 1I3QH 4YCVA 1DOLA 5CC4A 2HCIA 4JW0A 2R92G 1ZKOA 2K03A 4C3HB 3JAME 4JI7Q 4PG3A 5E4XA 1IW7C 3EIVA 1SMYC 3RLNA 4LF4Q 4A3GB 1XX8A 4DV4Q 4DV5L 2ZTEA 2ZXOA 4DFAA 3CC4A 1L2FA 5A2QL 3I70A 4BY1H 3M3YH 5J22A 1JOKA 1PH2A 1BCPC 1PTOC 4BY7B 1KAWA 2JA6H 2PI2A 1VQMA 4AH6A 1G6PA 1U4RA 2KECA 3I73A 2WB1G 4X64Q 4XYOA 5M3FB 3OTOL 4KLKA 3OMGA 1Y1VG 1M1KC 3K6OA 4MIUA 3ULPA 1FD7D 1K8GA 1EY5A 4KHZA 4RGNA 2NVYB 3D4WA 4OIKA 1GUSA 3QB3A 2Q2TA 4X64L 4DV1Q 4B3TL 1X55A 2IY5B 4GLXA 4DNTB 1YNXA 2ZM6L 5CV5A 2QILA 3SR1A 4X3KA 3D4DA 1PZKD 3W1BA 1HFNA 2CH4A 1SNCA 3TS0A 4B3SL 2ZJQA 4BY1B 4CDEC 3IFTA 4CKBA 2IPKD 3CCSA 2D9UA 2JA7H 4G7OC 1Q81C 1QOHA 1NR4A 4NP5A 4HJ7A 1ESFA 4L6TB 4A4IA 3CQZH 4OIJA 3MZ5A 4JV5L 1L1OB 3G7LA 5GAGC 3CMAA 1ET9A 3S14B 2F0UA 1K8OA 4P74A 1ESRA 5EBCA 2A68C 3S2HH 4IQZA 1N36L 1Q1EA 3AQQA 1K83B 3CHBD 3TRZA 4DAYB 4HIDA 2PI2E 3V2TA 4BY7H 2R93B 2QF7A 3S1MH 5LMNL 2HUGA 1QVCA 5TSSA 3UDFA 3L0OA 2KQ3A 2B39A 1BKBA 4WRDA 2LXKA 2QEJC 2UUAQ 3DWQA 3OWFA 5JEAH 3AEVA 1K8MA 3D0FA 1LYLA 4KY7A 1EWCA 1Q1BA 1BXTA 1SNQA 2CQOA 2J7ZA 3D6WA 3S24A 1UE1A 5LMUL 3S17B 4A3JB 2N3SA 4ULLA 1X65A 2CW0D 1J9OA 3HOZG 4DR4L 5DNFA 2RKSA 4YY3Q 4C3HH 1B3QA 3M9BA 1SYBA 3PO2G 1EWHA 2EY1A 3H3VH 4HCSA 2E2HH 4F8MA 5IYBH 5IY0A 1XJVA 2EXDA 4C1NK 3NENA 4ILWA 2IHFA 3CCJA 4HSVA 4JI8L 1A15A 1J6QA 3Q6SA 2A69D 1XNQL 4DAMA 2HD3A 1DJRD 2HHHQ 4R4TA 1V1OA 3PIO3 1HUMA 3HOXG 5LHY1 1OXVA 1JICA 2EE1A 3DHQA 3JAMi 2BH8A 2G9DA 2Z6KA 3IL8A 1I4QA 3NWSA 2EJFC 1SMYD 2CFMA 3LNNA 3X3NA 4LFBQ 5M3MB 2VQEQ 4QUCA 4RKLA 1PDQA 5JEAG 4DR6Q 4R8NA 3S1MB 4CJ2C 1CI3M 3H0GH 1PZID 2X69A 3F2DA 2SOBA 3K58A 1L1OA 3GTPH 5EBDA 4OWWB 4ZCKA 1EWIA 3D6CA 3S2HB 2JSOA 2R7FA 1Z7TA 2HDLA 5I6YA 3BYYB 4LMQD 2KCCA 2FXQA 3R2TA 3F2CA 2IWHA 1HTLD 3X3MA 3VYUA 1HQRD 1E1OA 1HFGA 3GTOB 4LAAA 1EFID 3MEHA 4U673 3HOXB 2K4KA 3Q0AA 3C2PA 1C0AA 2O5IC 1MSHA 1A62A 2K32A 1ENFA 2L55A 4G57A 5FLXc 3DLLA 5C5LA 4JBWA 4DV3Q 2WP8J 4K6LA 5IYCH 2EYHA 5H1SE 1EYAA 2KUMA 2B2VC 4WFN3 4PMBA 2JA7G 2B2WA 3CC7A 4B3RL 4JYAL 2D0PA 1PTOB 2VXWA 1V9PA 2LS01 1CKOA 1JWMD 2LFNA 2RCNA 3I90A 4HIOA 2RCFA 5C3EH 1QVGA 1N34Q 3MXGA 1RDPD 1WFQA 1XXGA 2FFKB 3TDQA 1VQBA 3GTMB 1SYEA 4B3RQ 3I56A 2DJGC 2B2UA 3QWNA 3EJIA 3HOYB 3PF5A 1SLJA 2MJ8A 1MBYA 3PO3H 5FKAC 1RODA 2YV5A 2JA6B 2WACA 2F3WA 3M4YA 1EQRA 3T51B 1B50A 5JVH3 1VQDA 2A6HC 3KDFB 3M4OH 1SFOH 3S1QH 5EPKA 5IYBG 1CKNB 3T1YQ 5AJ3Q 5ELBA 1PTOH 1V1QA 3KBXA 3ULLA 4IFDJ 1K9MC 2XWJB 5IWAQ 1U4LA 1XYIA 2VW9A 3PIPA 1LTLA 5FO7B 1I4RA 1Q8KA 2HDMA 2Z6KC 4YCUA 1YJWA 4X62Q 3SVMA 4CDCC 3OW2A 1IBKL 1N8RC 3NBIA 3HOUH 1HNWL 4NXNQ 4ZKBB 3HOWG 4C56C 3KLRA 2K7VA 2B29A 1ZYRD 5FK9C 5LMUQ 1AE2A 2F0TA 2HT1A 1E2ZA 2OT2A 3J81E 1IL8A 2CWAA 2PMZB 3MA2B 2NVTH 2UXBL 4DNRB 3S1RH 2F0MA 2F0NA 1SNOA 1TS3A 3BZKA 2UXBQ 2QW7A 2Z6BA 3CRLC 4X6AH 1XTDA 1AN8A 1VQOA 4C3JG 3Q23A 1LTBD 2Q8TA 5HGTA 5M3FH 1ASYA 1IW7D 4FYDA 1MD2D 4NKLA 3S16B 3FHWA 3G71A 1HNXQ 3H0GB 4EVOA 3T13A 2PQAB 3HS0C 4FF3A 2EJGC 4K5VA 4AQYQ 1A0IA 2XGTA 1OXSC 1N32Q 5I9OA 4DK3C 1D6EC 4E6IA 3NQTA 3I4LA 1LV9A 2LKVA 4LNQA 1VQKA 1G91A 3I4OA 1KLGD 4A3IB 1CQVA 1HR0W 4APVA 3DWAA 2PQAA 5IGGA 5DM63 2MPMA 4Y7NH 2AQ2B 5DM73 3A74A 4JI2Q 1Q7YC 1GKHA 3HP3A 3F2BA 2B2TA 4A3DG 3W1GA 2G5DA 1WOCA 1Z9FA 2Z9HA 5E7NA 1HR0L 1NJIC 5J3BA 3TP5A 1CZWA 1M4VA 1GVPA 2BA0A 4A3JH 1C8CA 4OX9L 1KTKA 1Y1VB 4A76A 5EKIA 1KRTA 1V43A 4XT3B 1IBLL 2JE6I 4OGQC 1D5XC 4KY6A 5JJLA 1GUOA 1EY6A 1VF7A 1FNUA 2V1CC 3PUXA 5DLQE 2K50A 3U4VA 1KRSA 3NP8A 1TR5A 3GQBA 4BWGB 3OTOQ 3UDIA 3CCMA 2DJFC 1H9JA 3HG9A 1K73C 1HA6A 1F2MA 1PYWD 1SNPA 3FP9A 4ZYSA 4K5XA 1IL2A 3CCVA 4A3GG 4DNIA 1E1TA 5FJ8H 4YY3L 3IFDA 4PV1C 4J15A 2CHBD 4XQQA 1LT6D 2A73B 2K5HA 1TWFH 2WIIB 2SNMA 1AEXA 4K2KA 3PO2H 1XNQQ 4DV1L 2JA7B 3SK8A 4FXDA 3PO2B 5I6WA 1UWVA 4X3SA 3T56B 2KHJA 5E3FA 4P71A 1AH9A 4H0LC 1Q12A 2KCNA 2F52A 2ZJRA 2V4DA 3UE0A 1YZ6A 3S9WA 2O5JC 2FMMA 2D5DA 3GTQB 3M4PA 3HZXA 4JI0L 4FDBA 4ZUJA 5CORA 2I0QA 4L5RC 1GM5A 4L63B 4QIWB 2JJQA 5LMNW 3K5MA 1YBYA 1QJOA 4JI4L 4A3LG 2K33A 3TN2A 4CDFC 4LFCQ 4K0KQ 2L9HA 1R4QB 2ASBA 3CCRA 1PYSB 4QY7A 4DR3Q 2B2YA 2DNEA 1TQOA 3R2IA 2MUYA 1ICFB 3VR6A 1ENAA 4C3IH 4ALPA 5HY6A 5I2YA 1QWYA 2OWOA 5IIFA 1HQMC 3M3YB 1X3QA 3QIAA 4Y7NB 1A3UA 3HKZG 1EQVA 1HZAA 1VDZA 3GTJH 4Z9CB 2EJMA 4OWTB 2NZOA 3S2DH 4GS3A 4DR1L 2DY8A 4RCNA 3CCLA 1RF2D 1NUCA 1H9SA 3Q22A 2F4IA 3T53B 1S4ZA 1EUJA 1EEFD 2K1BA 3AU7A 4IUQA 4QGUA 2MNAA 2ID0A 3RN2A 1WTHA 2VUMH 4EQOA 4JI8Q 2B63H 1E22A 1SNDA 4XDXA 4GNXA 1UE6A 2PW7A 3H3VI 1JCKB 3S15B 4XXEA 2X6GA 2IX3A 1KHIA 2VY3A 5G3LF 2F0OA 1YJNA 1F9QA 1LTSD 2PQEA 1BF4A 4LF7L 1I4PA 4G4KA 4CDDC 1I50B 1XMOL 5K5PA 3K8AA 1PXUA 2WB1E 4RKBA 2K5DA 5CV7A 4AQYL 1X3GA 1I4HA 2YTXA 1KIXA 1WI5A 1U9RA 2F0EA 2MFIA 3VYRA 4LF8Q 3HKZE 4AIMA 4KD3A 3FKIB 1STYA 1SYDA 3O13A 3PUVA 1HZCA 2QEXA 1CQFA 1X32A 5F2DA 1S5BD 5CYUA 1STNA 1M8AA 4P73A 1LACA 2NTSA 1NY4A 1C9OA 4BBSH 4DR2L 1L0XB 1MIUA 2D62A 2JQOA 5A35A 4IALA 4OWXB 3K0YA 3I7FA 1I4GA 3CD6A 4UP7A 2E2JH 4R4IA 2I5LX 3K5NA 2Q8RE 1JMCA 1M90C 2F0SA 2H1EA 1GO3E 2KA7A 2RBMA 1PH1A 1D2BA 3L2PA 2EDGA 5EKKA 1EYCA 3GV3A 1EY7A 2L4NA 4FF4A 1QILA 2YU9H 3E5SA 3BVMA 1K83H 4RH6A 2F0WA 1G291 3HOVB 1Q46A 2GN5A 3R3OA 2MGSA 1HZBA 3LGJA 2CQAA 4DV2Q 5BN3A 2HQLA 4MHEA 3P20A 1SRUA 1Y8PB 2Z1CA 4B3TQ 2NVTB 2JYOA 1SR3A 4K5WA 1TXYA 4L5QA 5C4HA 1ML0D 1WCMB 4A3KG 4TKOB 1DOKA 2VB2X 1SMXA 1Y1WB 4FF2A 1TY2A 3CPWA 5C4XG 2JXMB 1VQ9A 1JWUD 4AYBE 1JC7A 3H09A 2UXDQ 4Q0FA 5FJ8G 2WKCA 2DY7A 4RHRA 3T1YL 1EU4A 4FXKC 2E75C 2B2YC 2ALYB 2EY2A 4ZRZA 1PH5A 2EQSA 4CKEA 3Q8DA 2VUMG 4DR2Q 3W3AA 1LT5D 1STBA 4XTCS 1TY0A 4K2LA 5I2XA 4B3SQ 4JI5Q 1VQ4A 5KGUA 1SROA 5M5XH 4A3DB 4GN3B 1SYGA 4LWCA 2K05A 4YHHL 1I6HB 4CGYB 4MTKA 3CAMA 3OW7A 3H94A 4DGZA 2L15A 1CUKA 1YHBA 3RZOH 1FNVA 4JI1Q 2VS1A 1KNAA 3F2UA 1VQ6A 1ILPA 2ZT9C 1JOQA 4JC0A 3C46A 1VQIA 3L9AX 4NMZA 3DWPA 5D14A 5EGTA 1TWAB 1PYBA 2CVRA 1E2VA 2EVBA 2B8GA 2N55A 1HTPA 3NTKA 1YNJD 4LFAQ 3GV6A 2IX0A 2QA4A 5J1ZA 4BXXG 5BR8L 1Q82C 4ODGA 5I9PA 3TS2A 4HJAA 2UU9Q 1PHJA 2ZXPA 2RSOA 1WCMH 3MEFA 1K8AC 2C5CA 3HOXH 2WB1B 4WORA 3U9SA 4A3EG 2HHHL 1OXUA 2YTVA 5ELNA 4I65A 1D1KA 1CK1A 2F4VQ 2EYFA 1B7YB 3KJOA 4JV5Q 2PO4A 4KKSA 1HPCA 3MHBA 1QVFA 4LF5L 3MXUA 1BO0A 2Z4HA 1SYFA 3N52A 3URYA 4CJ1B 4LF5Q 1HA5A 2KCTA 4UP8A 3J7A5 1YNND 3NHHA 2E2IH 3I4MG 1I6VC 2NYZD 5EQ0A 3PUZA 3UI2A 1D5MC 1NR2A 3ERSX 3PGZA 1Q90A 4HEDA 5J39A 1ONLA 2JEBI 2A19A 3D4RA 3CCQA 4NXMQ 1SEBD 2LXJA 3VR4A 4BY7G 4EQPA 3ZJYC 1I4XA 3G48A 2FINB 3HOWH 4UHVA 1ZYRC 5HGQA 4MZ9A 5EJWA 1IBLQ 2UUBQ 4X66L 2QCPX 3GDEA 1G51A 2RA4A 3J7YW 5NUCA 5KYLA 4FNFA 1HCZA 4NPSA 1B53A 2E2HB 3BU2A 4XT1B 4CHTB 1C7YA 2CKZB 4C3HG 2QDBA 3CCEA 1RKNA 2J4XA 1RL2A 1PRTC 4YIJA 1IKMA 5CV6A 1KD1C 2BE5D 4P2CB 5IYDG 3MFYA 4RWSC 1O80A 1YEZA 1EIFA 3E9HA 2PZTA 3I3CA 1S3OA 3U58A 2JEAI 1AP0A 2L11A 2OEOA 1VQEA 4OELB 4DR7L 1FGBD 1VQPA 1W6KA 1PA6A 1QZGA 3RZOB 1EIGA 3S15H 4DR6L 2UXDL 5JEAJ 1T5EA 3PO3B 2PNHA 4J8QA 1GUGA 1QNUA 1QCBD 1RTOA 1X3PA 2B2WC 2L12A 1XNRQ 1JJCB 5C0XH 4OEMB 1GJXA 3BVZA 4RHSA 2EYOA 1QUQB 2FJ2A 1VQAA 1I5FA 2QDLA 3GTKH 2PNRC 1I94L 3PV0A 4X3UA 1LUZA 2A69C 5AJ3L 5ELCA 2K52A 3W5OA 1SE8A 2WINB 1VQ7A 1XNRL 3S1QB 2KEDA 3DMUA 3GP7A 2LSSA 5JAVA 1CSPA 1TWFB 3OIQA 4PZ7A 1NBWA 4G7HC 1LT3D 2LMCB 4R4OA 2IX1A 4EQNA 1U4PA 3H15A 4A3BB 4WJ3M 1Y1WH 1SAPA 3B6YA 3KK7A 3DUZA 3GO5A 1S5FD 4BA2I 1CHQD 1FNWA 1CSQA 2A68D 2PZWA 2C35B 1N36Q 2N8NA 1EQQA 5M5YB 3CKIB 4B3MQ 1J8IA 3H0GG 1G2TA 3I72A 4P72A 3NQIA 4KJOA 1X3EA 3D8GA 1Y1VH 4ZAIA 4U68A 4RA8A 1STGA 2NBFA 1B9MA 1BCPB 1SE2A 1X6OA 2YTYA 3AFPA 2KBNA 4HJ5A 5FLMG 3CRKC 3MXNA 4XYQA 2JA6G 1JE5A 2GA4B 4QB4A 1L0WA 3UDXA 1A2TA 2Q2HA 1T5XD 5COYA 1JJ2A 4IOCA 3EN2A 1V1PB 1PRTD 2R3ZA 2E2JB 2R7ZB 2XIWA 4DUYL 3HGBA 1AFPA 4H02A 3I91A 1GD7A 1PFNA 1K3RA 3HEJA 3KFUA 3A5ZB 2F0QA 3RMHA 3TQYA 3K5OA 1KL9A 2K5NA 1LT4D 3K80C 1IYJB 2AKWB 1GUNA 5C0XG 4HN7A 1SDFA 3SDZA 1HR0Q 3G4SA 1PVOA 4A3KH 3NBHA 3D3RA 1G6ZA 3BJUA 3KJPA 3DEPA 1E2WA 2BCOA 5KNCA 4JCVE 4AYBG 3GTLH 3A7AB 3H91A 4I7ZC 2E5LQ 4RGMA 1BDOA 1CKMA 2AWNA 4GKKL 2M00A 1GUWA 3M4QA 1L1OC 4DV3L 4A3KB 2JA5B 4IURA 5M5YH 1Y8NB 2VNUD 3STBD 3J7AF 1CFMA 3PMFA 2EZVA 2CW0C 2I46A 3NSWA 1UAPA 2PCFB 1JR0D 4LK1C 2PYKA 4IFDI 3D31A 3MAQA 1KDCA 5EKLA 3E3XA 3WDNA 1LTRD 1TKWB 4FO2A 3SE0A 3OPOA 1C48A 1SNMA 2XSCA 1N34L 3S2DB 4DA2A 3M85A 1NMFA 1PFSA 3MXNB 3M7NA 5FLMH 4ZLTF 1A3TA 1EZ6A 1SFOB 1E3PA 4UAIA 3GTKB 2ICEC 1O7LA 4MNOA 2RHSB 2NVXH 4JI0Q 2VQEL 2ZM6Q 1TWHH 1QNKA 5IP7G 3ND8A 1AZPA 4G7ZC 1LTID 5M5XB 2BDNA 2R92H 4GNXC 3QR8A 4RCOA 4GZYC 3SK4A 3NXWA 2EXZA 4TQUS 3CQZB 3BDLA 2F03A 3S1RB 1N9WA 1BUVT 2H4OA 5C0XJ 4LFCL 5C3WA 4HMJA 2R7DA 2UUCQ 4YCWA 4JBKA 1NAPA 1VCIA 1JT8A 4QQBX 4A3EH 2VQFQ 2NWGA 3EVQA 5K36H 4CJ0B 4V190 3I4NH 4DR3L 3OOCA 3DXJC 4JI3Q 3KYHC 1TS2A 4RMFA 3U4ZA 4DV4L 4DV5Q 5M3MG 2GVBA 1CA5A 4I7AA 2MO1A 3BS1A 4GOPB 1FR3A 4A3EB 1XWEA 4P75A 3HOZH 2BE5C 3J80E 2AMCB 3VYTA 1UNSA 2OTLA 3A7LA 1OXTA 4DF7A 3C1FA 2A5HA 1J5EQ 4LUVA 2BA1A 3KUPA 2EPBA 3E0EA 1VQLA 3NELA 4KTAA 2K01A 4H13C 1DD2A 3E0JA 4PNYA 4IN3A 2JA5H 1XPOA 1YHQA 1HZ9A 3J81i 4EGVA 4F88A 5C3XA 2KOLA 1BBWA 1PRTF 2KEEA 4A3GH 3UE1A 1EYGA 4A3FG 2BDOA 2E8GA 1EZ8A 3VR2A 4NDXA 1IKLA 1WTOA 3S1NB 1EY4A 3MWYW 4IZ8A 4DK6C 5IP7H 1PH7A 1VQGA 4A3CG 3J7ZC 1F9PA 1V8QA 1UE7A 3A8KE 4BBSB 4UY8C 2RSNA 4X62L 1I3QB 5G3LD 3J80L 4JI7L 2UUCL 1UE5A 1JORA 1QZHA 2PZUA 2YYZA 1LABA 2HCCA 1VQJA 4C2MH 3DM1A 4IPHA 3MTSA 1B8AA 1MKHA 3TEHB 5M5WH 3S1NH 4RFBA 1KDAA 5JJZA 4JI6Q 4R1JA 3J80c 5C4XH 5FO8B 4A3BG 1B3AA 5CV9A 2L5TA 2O2LD 1DOMA 2KJXA 5IT9L 1LM0A 3GTPB 1HHVA 3PUYA 3EBEA 2C9OA 4L5TA 5C6AA 3PCOB 4N9TA 1DONA 4A3LH 5KRUA 2E2DC 2IHEA 1PH6A 3ER0A 4JBMA 1R4PB 3CW2C 3DM3A 5M3FG 1B44D 5C4XB 2K28A 2XWBB 3LWEA 5K36G 1E24A 4QF4A 1MJEA 5ELFA 3FEWX 3PIOA 1HXYD 1B1ZA 2IT1A 4BBRB 5KNDA 1YJ9A 1B9NA 3KLWA 1BNZA 3ZYYX 1FYCA 3BDOA 3SGIA 2R6GA 5IGEA 4A3BH 4B08A 1GHKA 5CMDA 1WTWA 2NB0A 1HUNA 2JK8A 3HRZC 3G6JB 4HAEA 3R93A 3SHLA 1SJHD 3RUZA 3RLFA 3SEBA 1YVCA 2BH2A 1KNEA 1RD9D 4TRDA 4GOPC 2NVYH 1AZQA 3M4OB 3W2DA 1AE3A 3SXHA 4M1UB 2UXCQ 2B3GA 4NXNL 3P7JA 1EY9A 1KDBA 2R92B 2F0LA 4BA1I 3QO2A 3GTQH 4KD4A 4A3IG 2EYPA 4GKJL 1A2UA 1W6JA 4FF1A 4UDUC 4V0BA 3GTMH 2OTJA 4JI5L 2F0KA 3H3VC 2A6HD 2KHIA 5CR3A 2WFWA 4GKJQ 2R7ZG 2PW5A 2RHQB 3SK5A 3OYYA 4EX5A 4ZKCB 1H9KA 1ZEQX 3HOZB 4JOIA 2Z0SA 2B2TC 4DV7L 3WOFA 2VB3X 4PZ8A 4C3JH 3RNUA 1EFWA 4CBVA 2D0OA 3CPFA 4A3MH 4OO1G 1AW7A 1EIYB 5C44G 4JK1C 5C4JB 4IUUA 3FPUB 4POGA 3RZDB 2MO0A 2KENA 4IUVA 1ZXTA 2WAQG 5GQOA 2X6LA 3NK9A 4DV7Q 4HIKA 3QOLA 3GD7A 1SE4A 4PMWA 4PZ6A 1NMGA 3RD4A 1MI2A 1UEBA 4BBRH 1YIJA 2EIFA 1N33Q 5IYCG 3FMCA 1SE3A 1STHA 3NBHB 3QOJA 3KF8A 4KHPL 1WTQA 2M9VA 4KK7A 4UP9A 3JAML 1F77A 1EY0A 4N9PA 2EY6A 2HIVA 3TZDA 2OXPA 3K7AH 4ZUIA 1LO5D 5T1GA 4DAYA 4KN4C 2Y0SE 4GOPA 1MHWC 4FP5D 1U4MA 5IE8A 3WOEA 1CM9A 2NN6G 4GLAC 2QGQA 1A6XA 3I4MH 1D5ZC 3PIP3 1O7ZA 4K14A 1Y69U 1EY8A 2OCEA 5GAEC 5JPMC 2ENBA 2UUBL 4KJNA 4A93B 4OHJA 1DYQA 1SXTA 4YHHQ 3JC66 4ZQ3A 4B3ML 4NXML 5C3EG 5IT9E 1K28A 1F9RA 4OX9Q 3HKZB 4J1MA 3HOYG 2ICIA 1TU2B 2NZ1D 3I55A 1WTVA 2E5LL 4GKKQ 4NW2A 4A93H 3I4NG 3F8TA 1W2BA 1HNZL 3J81j 5IP9H 4JBJA 4MN3A 4LJZC 2IL8A 3MVVA 3JAMc 3NTHA 1U0LA 1SJED 4JPBW 4DK1A 2L1BA 1UEAB 2JA8H 2FMCA 3CCUA 1Y1WG 4KN7C 3GTGB
chains in the Genus database with same CATH topology
3K81C 1WCMG 1V43A 1KRTA 4WJ4A 4DUZQ 5IWAL 1IBLL 4IFDG 2JE6I 1I94Q 3RLOA 4P72A 5ELOA 5JJLA 1X3EA 2WAQE 4HJ9A 2V1CC 3PUXA 1Y1VH 5DLQE 2F4VL 2K50A 1E7ZA 3U4VA 1KRSA 3CCMA 1XPUA 4DR7Q 3OTOQ 1P8LA 3HKSA 3UDIA 1OTCA 1X6OA 1K73C 2YTYA 3AFPA 2KBNA 3FP9A 2Q2IA 4R4QA 5FLMG 4TVAB 4HJ5A 4KHPQ 1IL2A 2JA6G 1IBMQ 3CCVA 1JE5A 4A3GG 2GVAA 4DNIA 1EOVA 1VS0A 1E1TA 4ME3A 1L0WA 4BY1G 5FJ8H 4YY3L 3UDGA 4A3DH 4J15A 5LMNQ 3UDXA 4DV0Q 2Q2HA 1JJ2A 4YWMA 3IRBA 4LF9L 2K5HA 4IPGA 1TWFH 3EN2A 4IOCA 2ATWA 3PO2H 1SN8A 4KI0A 5IT9c 1K0RA 1A8VA 2UUAL 1KXLA 1FGUA 2UXCL 1XNQQ 4DV1L 4DUYL 4A3CH 1D8LA 4H02A 2R7ZH 1GD7A 2XTIA 1J5EL 2H5XA 1K3RA 4JI3L 1UWVA 3KFUA 3A5ZB 2OQ0A 2KHJA 3TQYA 4JG2A 4P71A 1AH9A 1Z47A 1Q12A 1KL9A 2K5NA 3BZCA 3VDYA 4BXXH 2F52A 2ZJRA 3K80C 4DR4Q 1IYJB 4JI1L 2N49A 2R93G 2AKWB 3UE0A 5C0XG 1YZ6A 4BBRG 1HNXL 5JJIA 2JA8G 3M4PA 4JI0L 4FDBA 3KF6A 1HR0Q 2MQHA 3G4SA 4DKAC 2KCMA 1JB7A 2CWPA 4A3KH 4LF7Q 1PVOA 3CF5A 2I0QA 3S17H 1DGSA 2N78A 4L5RC 1GM5A 3BJUA 4GN4B 4JYAQ 2NN6I 4MTNA 3KJPA 1HNZQ 1CKNA 3KOJA 4LFAL 4JCVE 4AYBG 3GTLH 2JJQA 5LMNW 4A3JG 1YBYA 1I50H 5EAYA 2E5LQ 4GKKL 2AWNA 1CKMA 4IJLA 3M4QA 1L1OC 4JI4L 4DV3L 1X9NA 4A3LG 3GTGH 5GROA 2ZTCA 2UU9L 1IBML 3PUWA 5M5YH 4X65L 4LFCQ 4K0KQ 1TWGH 2ZJPA 2VNUD 3STBD 1PH9A 2ASBA 3CCRA 1FJGL 1PYSB 4QY7A 4DR3Q 2AHOB 2PMZE 1XMOQ 1U5KA 4IFDI 1H95A 3D31A 4BBSG 4POFA 4LF8L 4C3IH 4ALPA 1WJJA 5HY6A 2K14A 1I3QH 3NEMA 4R4CA 4YCVA 4HJ8A 2OWOA 2R92G 1N34L 4JI7Q 3M85A 4PG3A 1NMFA 2NVQH 1PFSA 4DUYQ 3HKZG 2Q2UA 3MXNB 3EIVA 3KF8B 3M7NA 2A8VA 1HZAA 5FLMH 3RLNA 4LF4Q 3GTJH 4O0AA 1E3PA 1X3FA 3K0XA 2NZOA 2ZTEA 4GS3A 4OWTB 1L2FA 4DV4Q 4DV5L 4DR1L 4BY1H 3M3YH 3S2DH 3F1ZA 3CCLA 3CP0A 1PH2A 1EUJA 4QGUA 2MNAA 4MNOA 4UPAA 4K0KL 1KAWA 2ID0A 1PH3A 2JA6H 2RHSB 3RN2A 2NVXH 2PI2A 2VQEL 1VQMA 2ZM6Q 4JI0Q 1TWHH 2ES2A 2VUMH 4JI4Q 4JI8Q 4AH6A 2B63H 3FKIH 1E22A 5IP7G 4GNXA 2K5VA 1UE6A 3H3VI 4LUOA 2WB1G 1G6PA 4X64Q 3PO3G 3OTOL 4JI6L 4KLKA 1Y1VG 2Y0SG 3ULPA 1KHIA 2VY3A 1M1KC 2R92H 1YJNA 4GNXC 1K8GA 1IBKQ 4KHZA 4LF7L 1XMOL 3K8AA 2WB1E 4TQUS 1PH8A 4AQYL 1N9WA 2Q2TA 5C0XJ 4X64L 4LFCL 1X3GA 2R7DA 4DV1Q 2UUCQ 1X55A 4B3TL 2IY5B 4YCWA 1WYDA 2YTXA 4GLXA 1KIXA 4OO1I 4JBKA 1YNXA 1WI5A 1VCIA 2ZM6L 2MFIA 1JT8A 4RG1A 4O2DA 4LF8Q 3HKZE 4QQBX 4A3EH 2VQFQ 4IOAA 4AIMA 5GAHC 3W1BA 4A75A 3PUVA 1HZCA 3I4NH 4DR3L 2QEXA 4JI3Q 3KYHC 1XMQQ 3U4ZA 4RMFA 4DV4L 4DV5Q 2B63G 4P73A 5M3MG 5JJKA 2GVBA 4X65Q 1NY4A 3TS0A 2MO1A 2ZJQA 4B3SL 1C9OA 4GOPB 4BBSH 4DR2L 4DV2L 1XMQL 3E9IA 1MIUA 2D62A 2JQOA 3CCSA 2JA7H 4GLVB 4P75A 4A3IH 1Q81C 1S72A 2OQKA 4OWXB 3HOZH 2CCZA 3I7FA 2AMCB 3CD6A 4HJ7A 4UP7A 2E2JH 4R4IA 2I5LX 4A4IA 1JMCA 2OTLA 1M90C 3CQZH 1GO3E 1OXTA 4JV5L 1N32L 1L1OB 3CMAA 5GAGC 1PH1A 1VQ5A 4A3MG 1MJCA 3L2PA 4LF6L 1J5EQ 2I5HA 4LUZA 5C44H 4P74A 4LUVA 3S2HH 1FJGQ 1N36L 1Q1EA 2BA1A 3AFQA 4GN5A 4DV6L 2YU9H 3AQQA 4LF6Q 3HOVG 4LW1A 3S16H 2I5MX 3TRZA 4DAYB 3E0EA 1VQLA 4XIGS 1K83H 1JJGA 3NELA 4HIDA 1KQSA 1G291 4L5SA 2PI2E 4DUZL 1IXRA 4JI2L 4BY7H 1Q46A 3S1MH 5LMNL 2GN5A 4A3FH 1QVCA 3KDFA 1XPOA 3FKIG 1YHQA 2JA5H 3UDFA 3L0OA 1HZ9A 1HZBA 2VQFL 3J81i 3A5UA 4LF4L 3LGJA 1BKBA 2JA9A 3S14H 2LXKA 4DV2Q 1BBWA 2HQLA 2UUAQ 4DV6Q 3HOUG 3AEVA 3D0FA 4A3GH 1LYLA 1SRUA 3UE1A 1EYGA 1Q1BA 2CQOA 4A3FG 2JA5G 4B3TQ 2E8GA 3S24A 4LF9Q 1UE1A 5LMUL 1SR3A 2N3SA 2NZHA 1VQHA 3RN5A 1X65A 1PH7A 1TXYA 4DK6C 5IP7H 1VQGA 3J81c 3HOZG 3J7ZC 4DR4L 4A3CG 4L5QA 4YY3Q 4C3HH 1UE7A 3M9BA 4A3KG 3PO2G 4UY8C 3H3VH 4X62L 1SMXA 2E2HH 5IYBH 1XJVA 5IY0A 3RZDH 2EXDA 3CPWA 5C4XG 3NENA 4JI7L 2UUCL 1UE5A 1VQ9A 1QZHA 2IHFA 3CCJA 3U50C 4AYBE 2HIXA 2YYZA 4JI8L 1J6QA 1XNQL 2UXDQ 1FL0A 1VQJA 4C2MH 4DAMA 5FJ8G 4IPHA 2HHHQ 4R4TA 3HOXG 1B8AA 1MKHA 3STBC 3TEHB 3A0JA 1OXVA 5M5WH 3JAMi 3T1YL 3S1NH 2BH8A 2ALYB 4DR1Q 2Z6KA 1PH5A 4JI6Q 2EQSA 2VUMG 3Q8DA 4R1JA 3J80c 5C4XH 1X56A 4A3BG 4DR2Q 1D7QA 2CFMA 4LFBQ 4QIWE 4B3SQ 4XTCS 2VQEQ 4JI5Q 1VQ4A 3AYHB 5JEAG 1IZ6A 4DR6Q 1SROA 5M5XH 1LM0A 4GN3B 3H0GH 3J80i 4LWCA 3PUYA 3EBEA 1I6HH 4YHHL 1NE3A 4L5TA 3PCOB 1L1OA 3F2DA 3CAMA 3GTPH 4IPDA 1QUQA 4A3LH 2IHEA 1CUKA 2L15A 4IPCA 1PH6A 1YHBA 3ER0A 4JBMA 4OWWB 3RZOH 1EWIA 3I2ZA 3CW2C 2F3IA 2R7FA 1TWCH 3DM3A 4JI1Q 2VS1A 5M3FG 1HH2P 1VQ6A 5IP9G 2DGYA 2AWOA 4JC0A 1VQIA 5K36G 1E24A 2FXQA 3F2CA 4LFBL 1MJEA 2VL6A 1E1OA 1BBUA 1PYBA 4IJHA 3PIOA 2IT1A 2K4KA 1YJ9A 4LFAQ 1P16A 3KLWA 2IX0A 2QA4A 1C0AA 4OONA 1KC8C 1A62A 1B70B 4HIMA 5BR8L 4BXXG 1Q82C 5FLXc 3DLLA 3SGIA 2R6GA 3TS2A 4HJAA 2UU9Q 4A3BH 1PHJA 1VQ8A 4Y52H 4JBWA 4DV3Q 2WP8J 1RIPA 1T9HA 5IYCH 1WCMH 5H1SE 2JK8A 3MEFA 3G6EA 1PH4A 1K8AC 2JA7G 1BVSA 1NTGA 3HOXH 3CC7A 5C0XI 3T1HQ 4JYAL 2D0PA 3RLFA 4B3RL 1V9PA 2ZTDA 1YVCA 4A3EG 2HHHL 1HJPA 1CKOA 1OXUA 2BH2A 2RCNA 2YTVA 5ELNA 4GOPC 4IO9A 3ICEA 2NVYH 4HIOA 1VQNA 5C3EH 1QVGA 1AE3A 4X66Q 2F4VQ 1N34Q 1B7YB 3KJOA 4JV5Q 1WFQA 1QVFA 2B3GA 2UXCQ 4NXNL 2DUDA 4LF5L 1VQBA 3T1HL 4B3RQ 3HOVH 3I56A 4BA1I 2R93H 3L7ZC 4LF5Q 1OXXK 3GTQH 4A3IG 3PF5A 1SLJA 2KCTA 5IYDH 4UP8A 1YITA 3J7A5 3PO3H 4GKJL 2E2IH 3I4MG 2YV5A 3GTMH 2OTJA 4JI5L 3PUZA 1EQRA 2KHIA 3ERSX 3PGZA 5BR8Q 5M3MH 2WFWA 4GKJQ 2R7ZG 1VQDA 2JEBI 2RHQB 2A1AA 2A19A 3KDFB 3CCQA 3M4OH 4NXMQ 2LXJA 1SFOH 4EQ5A 3OYYA 3S1QH 4BY7G 5IYBG 3ZJYC 1CKNB 4EX5A 3G48A 5AJ3Q 3T1YQ 3TREA 3HOWH 5GADC 4JOIA 4GNXB 2Z0SA 1V1QA 3ULLA 4DV7L 5HGQA 4MZ9A 4IFDJ 1K9MC 5IWAQ 4PZ8A 1IBLQ 4C3JH 4YWLA 2UUBQ 3RNUA 4X66L 1Q86C 1EFWA 3CC4A 3GDEA 1G51A 4JOIC 3HFZB 2VW9A 3PIPA 1LTLA 2D0OA 3CPFA 3CC2A 4A3MH 4A93G 4OO1G 3WWVA 1EIYB 1Q8KA 5C44G 2Z6KC 4NPSA 4YCUA 3ULJA 3CXCA 4A76A 1YJWA 1X54A 4POGA 2MO0A 4X62Q 2KENA 3BU2A 3OW2A 2WAQG 1N8RC 1IBKL 5GQOA 2CKZB 4QJFA 1C7YA 1HNWL 3CCEA 4DV7Q 4NXNQ 4HIKA 1RL2A 3HOWG 3GD7A 4PMWA 2B29A 4PZ6A 1NMGA 1KD1C 4BBRH 1UEBA 5LMUQ 1YIJA 1AE2A 2EIFA 2HT1A 1N33Q 5IYDG 5IYCG 2CWAA 2NVTH 1TWAH 2UXBL 1YEZA 3NBHB 1EIFA 3E9HA 4OXPA 3S1RH 1S40A 4KHPL 1S3OA 2RF4A 3U58A 1FVIA 3BZKA 2UXBQ 2JEAI 4UP9A 1PV4A 1VQEA 4X6AH 4DR7L 1XTDA 2HIVA 1XPRA 1VQPA 1PA6A 1VQFA 3K7AH 2VZAA 1VQOA 4DV0L 1QZGA 4DPGA 5M3FH 3S15H 4DR6L 2Y0SE 4GOPA 1ASYA 2UXDL 3K7UC 1HNWQ 5JEAJ 5IE8A 3HOUH 2PNHA 3FHWA 2NN6G 4GLAC 1W3SA 2QGQA 3G71A 1HNXQ 3HOYH 3I4MH 2PQAB 4NB3A 1XNRQ 5GAEC 1Y14B 2OCEA 1JJCB 5C4JH 4AQYQ 1A0IA 2XGTA 1QUQB 2UUBL 1OXSC 1N32Q 4DR5L 1VQAA 1I5FA 4DK3C 3GTKH 4YHHQ 1I94L 3PV0A 1LUZA 4DR5Q 5AJ3L 1YHAA 2K52A 4YWKA 3JC66 3W5OA 4LNQA 1VQKA 4B3ML 4NXML 1SE8A 5C3EG 3I4OA 1VQ7A 4OX9Q 3HOYG 1XNRL 1HR0W 4APVA 2PQAA 2LSSA 3KF6B 4Y7NH 1O7IA 3I55A 1CSPA 4PZ7A 2E5LL 4GKKQ 4A93H 3I4NG 1NBWA 1N33L 3PF4A 3F8TA 3A74A 1W2BA 4R4OA 1HNZL 3RR5A 4JI2Q 2IX1A 3J81j 5IP9H 4JBJA 3H15A 1Q7YC 1ASZA 1GKHA 4WJ3M 1Y1WH 3F2BA 3B6YA 4A3DG 3W1GA 1VQCA 1WOCA 3GO5A 1Z9FA 3JAMc 5E7NA 3CMEA 1HR0L 1U0LA 1NJIC 5J3BA 4BA2I 4QL5A 1CSQA 2C35B 1YI2A 3PSIA 2N8NA 1N36Q 1GVPA 2JA8H 2BA0A 4A3JH 2K75A 1EQQA 3CCUA 1Y1WG 1R9TH 4OX9L 3GTOH 4B3MQ 1A63A 3H0GG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K81 C;  1WCM G;  1V43 A;  1KRT A;  4WJ4 A;  4DUZ Q;  5IWA L;  1IBL L;  4IFD G;  2JE6 I;  1I94 Q;  3RLO A;  4P72 A;  5ELO A;  5JJL A;  1X3E A;  2WAQ E;  4HJ9 A;  2V1C C;  3PUX A;  1Y1V H;  5DLQ E;  2F4V L;  2K50 A;  1E7Z A;  3U4V A;  1KRS A;  3CCM A;  1XPU A;  4DR7 Q;  3OTO Q;  1P8L A;  3HKS A;  3UDI A;  1OTC A;  1X6O A;  1K73 C;  2YTY A;  3AFP A;  2KBN A;  3FP9 A;  2Q2I A;  4R4Q A;  5FLM G;  4TVA B;  4HJ5 A;  4KHP Q;  1IL2 A;  2JA6 G;  1IBM Q;  3CCV A;  1JE5 A;  4A3G G;  2GVA A;  4DNI A;  1EOV A;  1VS0 A;  1E1T A;  4ME3 A;  1L0W A;  4BY1 G;  5FJ8 H;  4YY3 L;  3UDG A;  4A3D H;  4J15 A;  5LMN Q;  3UDX A;  4DV0 Q;  2Q2H A;  1JJ2 A;  4YWM A;  3IRB A;  4LF9 L;  2K5H A;  4IPG A;  1TWF H;  3EN2 A;  4IOC A;  2ATW A;  3PO2 H;  1SN8 A;  4KI0 A;  5IT9 c;  1K0R A;  1A8V A;  2UUA L;  1KXL A;  1FGU A;  2UXC L;  1XNQ Q;  4DV1 L;  4DUY L;  4A3C H;  1D8L A;  4H02 A;  2R7Z H;  1GD7 A;  2XTI A;  1J5E L;  2H5X A;  1K3R A;  4JI3 L;  1UWV A;  3KFU A;  3A5Z B;  2OQ0 A;  2KHJ A;  3TQY A;  4JG2 A;  4P71 A;  1AH9 A;  1Z47 A;  1Q12 A;  1KL9 A;  2K5N A;  3BZC A;  3VDY A;  4BXX H;  2F52 A;  2ZJR A;  3K80 C;  4DR4 Q;  1IYJ B;  4JI1 L;  2N49 A;  2R93 G;  2AKW B;  3UE0 A;  5C0X G;  1YZ6 A;  4BBR G;  1HNX L;  5JJI A;  2JA8 G;  3M4P A;  4JI0 L;  4FDB A;  3KF6 A;  1HR0 Q;  2MQH A;  3G4S A;  4DKA C;  2KCM A;  1JB7 A;  2CWP A;  4A3K H;  4LF7 Q;  1PVO A;  3CF5 A;  2I0Q A;  3S17 H;  1DGS A;  2N78 A;  4L5R C;  1GM5 A;  3BJU A;  4GN4 B;  4JYA Q;  2NN6 I;  4MTN A;  3KJP A;  1HNZ Q;  1CKN A;  3KOJ A;  4LFA L;  4JCV E;  4AYB G;  3GTL H;  2JJQ A;  5LMN W;  4A3J G;  1YBY A;  1I50 H;  5EAY A;  2E5L Q;  4GKK L;  2AWN A;  1CKM A;  4IJL A;  3M4Q A;  1L1O C;  4JI4 L;  4DV3 L;  1X9N A;  4A3L G;  3GTG H;  5GRO A;  2ZTC A;  2UU9 L;  1IBM L;  3PUW A;  5M5Y H;  4X65 L;  4LFC Q;  4K0K Q;  1TWG H;  2ZJP A;  2VNU D;  3STB D;  1PH9 A;  2ASB A;  3CCR A;  1FJG L;  1PYS B;  4QY7 A;  4DR3 Q;  2AHO B;  2PMZ E;  1XMO Q;  1U5K A;  4IFD I;  1H95 A;  3D31 A;  4BBS G;  4POF A;  4LF8 L;  4C3I H;  4ALP A;  1WJJ A;  5HY6 A;  2K14 A;  1I3Q H;  3NEM A;  4R4C A;  4YCV A;  4HJ8 A;  2OWO A;  2R92 G;  1N34 L;  4JI7 Q;  3M85 A;  4PG3 A;  1NMF A;  2NVQ H;  1PFS A;  4DUY Q;  3HKZ G;  2Q2U A;  3MXN B;  3EIV A;  3KF8 B;  3M7N A;  2A8V A;  1HZA A;  5FLM H;  3RLN A;  4LF4 Q;  3GTJ H;  4O0A A;  1E3P A;  1X3F A;  3K0X A;  2NZO A;  2ZTE A;  4GS3 A;  4OWT B;  1L2F A;  4DV4 Q;  4DV5 L;  4DR1 L;  4BY1 H;  3M3Y H;  3S2D H;  3F1Z A;  3CCL A;  3CP0 A;  1PH2 A;  1EUJ A;  4QGU A;  2MNA A;  4MNO A;  4UPA A;  4K0K L;  1KAW A;  2ID0 A;  1PH3 A;  2JA6 H;  2RHS B;  3RN2 A;  2NVX H;  2PI2 A;  2VQE L;  1VQM A;  2ZM6 Q;  4JI0 Q;  1TWH H;  2ES2 A;  2VUM H;  4JI4 Q;  4JI8 Q;  4AH6 A;  2B63 H;  3FKI H;  1E22 A;  5IP7 G;  4GNX A;  2K5V A;  1UE6 A;  3H3V I;  4LUO A;  2WB1 G;  1G6P A;  4X64 Q;  3PO3 G;  3OTO L;  4JI6 L;  4KLK A;  1Y1V G;  2Y0S G;  3ULP A;  1KHI A;  2VY3 A;  1M1K C;  2R92 H;  1YJN A;  4GNX C;  1K8G A;  1IBK Q;  4KHZ A;  4LF7 L;  1XMO L;  3K8A A;  2WB1 E;  4TQU S;  1PH8 A;  4AQY L;  1N9W A;  2Q2T A;  5C0X J;  4X64 L;  4LFC L;  1X3G A;  2R7D A;  4DV1 Q;  2UUC Q;  1X55 A;  4B3T L;  2IY5 B;  4YCW A;  1WYD A;  2YTX A;  4GLX A;  1KIX A;  4OO1 I;  4JBK A;  1YNX A;  1WI5 A;  1VCI A;  2ZM6 L;  2MFI A;  1JT8 A;  4RG1 A;  4O2D A;  4LF8 Q;  3HKZ E;  4QQB X;  4A3E H;  2VQF Q;  4IOA A;  4AIM A;  5GAH C;  3W1B A;  4A75 A;  3PUV A;  1HZC A;  3I4N H;  4DR3 L;  2QEX A;  4JI3 Q;  3KYH C;  1XMQ Q;  3U4Z A;  4RMF A;  4DV4 L;  4DV5 Q;  2B63 G;  4P73 A;  5M3M G;  5JJK A;  2GVB A;  4X65 Q;  1NY4 A;  3TS0 A;  2MO1 A;  2ZJQ A;  4B3S L;  1C9O A;  4GOP B;  4BBS H;  4DR2 L;  4DV2 L;  1XMQ L;  3E9I A;  1MIU A;  2D62 A;  2JQO A;  3CCS A;  2JA7 H;  4GLV B;  4P75 A;  4A3I H;  1Q81 C;  1S72 A;  2OQK A;  4OWX B;  3HOZ H;  2CCZ A;  3I7F A;  2AMC B;  3CD6 A;  4HJ7 A;  4UP7 A;  2E2J H;  4R4I A;  2I5L X;  4A4I A;  1JMC A;  2OTL A;  1M90 C;  3CQZ H;  1GO3 E;  1OXT A;  4JV5 L;  1N32 L;  1L1O B;  3CMA A;  5GAG C;  1PH1 A;  1VQ5 A;  4A3M G;  1MJC A;  3L2P A;  4LF6 L;  1J5E Q;  2I5H A;  4LUZ A;  5C44 H;  4P74 A;  4LUV A;  3S2H H;  1FJG Q;  1N36 L;  1Q1E A;  2BA1 A;  3AFQ A;  4GN5 A;  4DV6 L;  2YU9 H;  3AQQ A;  4LF6 Q;  3HOV G;  4LW1 A;  3S16 H;  2I5M X;  3TRZ A;  4DAY B;  3E0E A;  1VQL A;  4XIG S;  1K83 H;  1JJG A;  3NEL A;  4HID A;  1KQS A;  1G29 1;  4L5S A;  2PI2 E;  4DUZ L;  1IXR A;  4JI2 L;  4BY7 H;  1Q46 A;  3S1M H;  5LMN L;  2GN5 A;  4A3F H;  1QVC A;  3KDF A;  1XPO A;  3FKI G;  1YHQ A;  2JA5 H;  3UDF A;  3L0O A;  1HZ9 A;  1HZB A;  2VQF L;  3J81 i;  3A5U A;  4LF4 L;  3LGJ A;  1BKB A;  2JA9 A;  3S14 H;  2LXK A;  4DV2 Q;  1BBW A;  2HQL A;  2UUA Q;  4DV6 Q;  3HOU G;  3AEV A;  3D0F A;  4A3G H;  1LYL A;  1SRU A;  3UE1 A;  1EYG A;  1Q1B A;  2CQO A;  4A3F G;  2JA5 G;  4B3T Q;  2E8G A;  3S24 A;  4LF9 Q;  1UE1 A;  5LMU L;  1SR3 A;  2N3S A;  2NZH A;  1VQH A;  3RN5 A;  1X65 A;  1PH7 A;  1TXY A;  4DK6 C;  5IP7 H;  1VQG A;  3J81 c;  3HOZ G;  3J7Z C;  4DR4 L;  4A3C G;  4L5Q A;  4YY3 Q;  4C3H H;  1UE7 A;  3M9B A;  4A3K G;  3PO2 G;  4UY8 C;  3H3V H;  4X62 L;  1SMX A;  2E2H H;  5IYB H;  1XJV A;  5IY0 A;  3RZD H;  2EXD A;  3CPW A;  5C4X G;  3NEN A;  4JI7 L;  2UUC L;  1UE5 A;  1VQ9 A;  1QZH A;  2IHF A;  3CCJ A;  3U50 C;  4AYB E;  2HIX A;  2YYZ A;  4JI8 L;  1J6Q A;  1XNQ L;  2UXD Q;  1FL0 A;  1VQJ A;  4C2M H;  4DAM A;  5FJ8 G;  4IPH A;  2HHH Q;  4R4T A;  3HOX G;  1B8A A;  1MKH A;  3STB C;  3TEH B;  3A0J A;  1OXV A;  5M5W H;  3JAM i;  3T1Y L;  3S1N H;  2BH8 A;  2ALY B;  4DR1 Q;  2Z6K A;  1PH5 A;  4JI6 Q;  2EQS A;  2VUM G;  3Q8D A;  4R1J A;  3J80 c;  5C4X H;  1X56 A;  4A3B G;  4DR2 Q;  1D7Q A;  2CFM A;  4LFB Q;  4QIW E;  4B3S Q;  4XTC S;  2VQE Q;  4JI5 Q;  1VQ4 A;  3AYH B;  5JEA G;  1IZ6 A;  4DR6 Q;  1SRO A;  5M5X H;  1LM0 A;  4GN3 B;  3H0G H;  3J80 i;  4LWC A;  3PUY A;  3EBE A;  1I6H H;  4YHH L;  1NE3 A;  4L5T A;  3PCO B;  1L1O A;  3F2D A;  3CAM A;  3GTP H;  4IPD A;  1QUQ A;  4A3L H;  2IHE A;  1CUK A;  2L15 A;  4IPC A;  1PH6 A;  1YHB A;  3ER0 A;  4JBM A;  4OWW B;  3RZO H;  1EWI A;  3I2Z A;  3CW2 C;  2F3I A;  2R7F A;  1TWC H;  3DM3 A;  4JI1 Q;  2VS1 A;  5M3F G;  1HH2 P;  1VQ6 A;  5IP9 G;  2DGY A;  2AWO A;  4JC0 A;  1VQI A;  5K36 G;  1E24 A;  2FXQ A;  3F2C A;  4LFB L;  1MJE A;  2VL6 A;  1E1O A;  1BBU A;  1PYB A;  4IJH A;  3PIO A;  2IT1 A;  2K4K A;  1YJ9 A;  4LFA Q;  1P16 A;  3KLW A;  2IX0 A;  2QA4 A;  1C0A A;  4OON A;  1KC8 C;  1A62 A;  1B70 B;  4HIM A;  5BR8 L;  4BXX G;  1Q82 C;  5FLX c;  3DLL A;  3SGI A;  2R6G A;  3TS2 A;  4HJA A;  2UU9 Q;  4A3B H;  1PHJ A;  1VQ8 A;  4Y52 H;  4JBW A;  4DV3 Q;  2WP8 J;  1RIP A;  1T9H A;  5IYC H;  1WCM H;  5H1S E;  2JK8 A;  3MEF A;  3G6E A;  1PH4 A;  1K8A C;  2JA7 G;  1BVS A;  1NTG A;  3HOX H;  3CC7 A;  5C0X I;  3T1H Q;  4JYA L;  2D0P A;  3RLF A;  4B3R L;  1V9P A;  2ZTD A;  1YVC A;  4A3E G;  2HHH L;  1HJP A;  1CKO A;  1OXU A;  2BH2 A;  2RCN A;  2YTV A;  5ELN A;  4GOP C;  4IO9 A;  3ICE A;  2NVY H;  4HIO A;  1VQN A;  5C3E H;  1QVG A;  1AE3 A;  4X66 Q;  2F4V Q;  1N34 Q;  1B7Y B;  3KJO A;  4JV5 Q;  1WFQ A;  1QVF A;  2B3G A;  2UXC Q;  4NXN L;  2DUD A;  4LF5 L;  1VQB A;  3T1H L;  4B3R Q;  3HOV H;  3I56 A;  4BA1 I;  2R93 H;  3L7Z C;  4LF5 Q;  1OXX K;  3GTQ H;  4A3I G;  3PF5 A;  1SLJ A;  2KCT A;  5IYD H;  4UP8 A;  1YIT A;  3J7A 5;  3PO3 H;  4GKJ L;  2E2I H;  3I4M G;  2YV5 A;  3GTM H;  2OTJ A;  4JI5 L;  3PUZ A;  1EQR A;  2KHI A;  3ERS X;  3PGZ A;  5BR8 Q;  5M3M H;  2WFW A;  4GKJ Q;  2R7Z G;  1VQD A;  2JEB I;  2RHQ B;  2A1A A;  2A19 A;  3KDF B;  3CCQ A;  3M4O H;  4NXM Q;  2LXJ A;  1SFO H;  4EQ5 A;  3OYY A;  3S1Q H;  4BY7 G;  5IYB G;  3ZJY C;  1CKN B;  4EX5 A;  3G48 A;  5AJ3 Q;  3T1Y Q;  3TRE A;  3HOW H;  5GAD C;  4JOI A;  4GNX B;  2Z0S A;  1V1Q A;  3ULL A;  4DV7 L;  5HGQ A;  4MZ9 A;  4IFD J;  1K9M C;  5IWA Q;  4PZ8 A;  1IBL Q;  4C3J H;  4YWL A;  2UUB Q;  3RNU A;  4X66 L;  1Q86 C;  1EFW A;  3CC4 A;  3GDE A;  1G51 A;  4JOI C;  3HFZ B;  2VW9 A;  3PIP A;  1LTL A;  2D0O A;  3CPF A;  3CC2 A;  4A3M H;  4A93 G;  4OO1 G;  3WWV A;  1EIY B;  1Q8K A;  5C44 G;  2Z6K C;  4NPS A;  4YCU A;  3ULJ A;  3CXC A;  4A76 A;  1YJW A;  1X54 A;  4POG A;  2MO0 A;  4X62 Q;  2KEN A;  3BU2 A;  3OW2 A;  2WAQ G;  1N8R C;  1IBK L;  5GQO A;  2CKZ B;  4QJF A;  1C7Y A;  1HNW L;  3CCE A;  4DV7 Q;  4NXN Q;  4HIK A;  1RL2 A;  3HOW G;  3GD7 A;  4PMW A;  2B29 A;  4PZ6 A;  1NMG A;  1KD1 C;  4BBR H;  1UEB A;  5LMU Q;  1YIJ A;  1AE2 A;  2EIF A;  2HT1 A;  1N33 Q;  5IYD G;  5IYC G;  2CWA A;  2NVT H;  1TWA H;  2UXB L;  1YEZ A;  3NBH B;  1EIF A;  3E9H A;  4OXP A;  3S1R H;  1S40 A;  4KHP L;  1S3O A;  2RF4 A;  3U58 A;  1FVI A;  3BZK A;  2UXB Q;  2JEA I;  4UP9 A;  1PV4 A;  1VQE A;  4X6A H;  4DR7 L;  1XTD A;  2HIV A;  1XPR A;  1VQP A;  1PA6 A;  1VQF A;  3K7A H;  2VZA A;  1VQO A;  4DV0 L;  1QZG A;  4DPG A;  5M3F H;  3S15 H;  4DR6 L;  2Y0S E;  4GOP A;  1ASY A;  2UXD L;  3K7U C;  1HNW Q;  5JEA J;  5IE8 A;  3HOU H;  2PNH A;  3FHW A;  2NN6 G;  4GLA C;  1W3S A;  2QGQ A;  3G71 A;  1HNX Q;  3HOY H;  3I4M H;  2PQA B;  4NB3 A;  1XNR Q;  5GAE C;  1Y14 B;  2OCE A;  1JJC B;  5C4J H;  4AQY Q;  1A0I A;  2XGT A;  1QUQ B;  2UUB L;  1OXS C;  1N32 Q;  4DR5 L;  1VQA A;  1I5F A;  4DK3 C;  3GTK H;  4YHH Q;  1I94 L;  3PV0 A;  1LUZ A;  4DR5 Q;  5AJ3 L;  1YHA A;  2K52 A;  4YWK A;  3JC6 6;  3W5O A;  4LNQ A;  1VQK A;  4B3M L;  4NXM L;  1SE8 A;  5C3E G;  3I4O A;  1VQ7 A;  4OX9 Q;  3HOY G;  1XNR L;  1HR0 W;  4APV A;  2PQA A;  2LSS A;  3KF6 B;  4Y7N H;  1O7I A;  3I55 A;  1CSP A;  4PZ7 A;  2E5L L;  4GKK Q;  4A93 H;  3I4N G;  1NBW A;  1N33 L;  3PF4 A;  3F8T A;  3A74 A;  1W2B A;  4R4O A;  1HNZ L;  3RR5 A;  4JI2 Q;  2IX1 A;  3J81 j;  5IP9 H;  4JBJ A;  3H15 A;  1Q7Y C;  1ASZ A;  1GKH A;  4WJ3 M;  1Y1W H;  3F2B A;  3B6Y A;  4A3D G;  3W1G A;  1VQC A;  1WOC A;  3GO5 A;  1Z9F A;  3JAM c;  5E7N A;  3CME A;  1HR0 L;  1U0L A;  1NJI C;  5J3B A;  4BA2 I;  4QL5 A;  1CSQ A;  2C35 B;  1YI2 A;  3PSI A;  2N8N A;  1N36 Q;  1GVP A;  2JA8 H;  2BA0 A;  4A3J H;  2K75 A;  1EQQ A;  3CCU A;  1Y1W G;  1R9T H;  4OX9 L;  3GTO H;  4B3M Q;  1A63 A;  3H0G G; 
#chains in the Genus database with same CATH topology
 1WCM G;  1WVL A;  4DU9 A;  4IFD G;  5ELO A;  3EQL C;  4HJ9 A;  2DNC A;  1SYC A;  2M2L A;  2I07 B;  4DR7 Q;  1P8L A;  1IYU A;  2SEB D;  3HKS A;  2Q2I A;  4R4Q A;  1NCV A;  2B63 B;  2WV6 D;  1QE6 A;  4R8I A;  1IBM Q;  3NE5 B;  2GVA A;  3TP6 A;  1EOV A;  4BXX H;  4LFB L;  5D3I B;  4A3D H;  3A8I E;  1CT1 D;  4YWM A;  4HR7 B;  4LF9 L;  4IPG A;  2O4X A;  4C3J B;  4OL7 A;  3TME A;  4KI0 A;  1A8V A;  2UXC L;  3NUC A;  4A3C H;  1Q8I A;  2XTI A;  2H5X A;  4JI3 L;  2RDG A;  1B4O A;  1EQT A;  4JG2 A;  2F0G A;  1Z47 A;  4C3I B;  4RGO S;  3BZC A;  1VMP A;  2D2C C;  2RQX A;  4KV6 A;  3VDY A;  1DM0 B;  2K6A A;  4JI1 L;  3M7G A;  2R93 G;  4HMI A;  2NUC A;  2F0V A;  4BBR G;  5JJI A;  3L3O C;  2G9H D;  2KCM A;  1H9S B;  5JPN C;  2N78 A;  4JYA Q;  1GHJ A;  4M8A A;  4LFA L;  1TS5 A;  1PRT B;  1E0B A;  4IUT A;  3VYS A;  3C3L A;  4A3J G;  5T1I A;  3GTG H;  5GRO A;  2ZTC A;  1K3B C;  4A3F B;  2FHT A;  3PUW A;  4X65 L;  2UU9 L;  2HQE A;  2ZJP A;  3EFX D;  5AFW A;  3OSO A;  2PMZ E;  4N8F A;  1F2Y A;  2WKD A;  1U5K A;  1C4Q A;  2MHV A;  4BBS G;  1HRJ A;  1KAB A;  1JB3 A;  1WJJ A;  4IFD H;  5KYI A;  3EA6 A;  3SK6 A;  1IHZ A;  3NEM A;  2E74 C;  4R4C A;  1TS4 A;  4WJW A;  3BZD B;  1PLF A;  4HJ8 A;  1BOS A;  1F2Z A;  2NVQ H;  4DUY Q;  2Q2U A;  3E6Z X;  3KF8 B;  2A8V A;  3HOW B;  2J0T D;  4DK0 A;  1V1P A;  4O0A A;  5IGD A;  1X3F A;  3K0X A;  3F1Z A;  3IAY A;  3CP0 A;  4K6D A;  4UPA A;  4K0K L;  3CU7 A;  1PH3 A;  1EYD A;  1QB5 D;  1PFB A;  2IJ0 A;  1RJT A;  2ES2 A;  3OHX C;  4JI4 Q;  3TBI B;  1BBX C;  3FKI H;  1BCP F;  1UUP A;  2K5V A;  4LUO A;  3PO3 G;  4JI6 L;  1CZG A;  3TP7 A;  2Y0S G;  2SDF A;  5FLX E;  1IBK Q;  3KLS X;  5L37 A;  1JWS D;  4X3T A;  5M9O A;  1SSO A;  2B2V A;  1XTC D;  2EYJ A;  1PH8 A;  2KVM A;  2WAQ B;  1LTA D;  1ICW A;  3MFG A;  4OO1 I;  1RTN A;  1WYD A;  2F0D A;  2F0F A;  4ME5 A;  1PTO F;  2TSS A;  4O2D A;  4RG1 A;  5EPJ A;  4C2M B;  4IOA A;  5GAH C;  4A75 A;  2VUM B;  1MSG A;  1XMQ Q;  3HOU B;  2B63 G;  3TP8 A;  4R9W A;  5JJK A;  4X65 Q;  4QCL A;  1LLR D;  4DV2 L;  1XMQ L;  3E9I A;  4HTH A;  4J6H A;  1Y8O B;  4GLV B;  4A3I H;  4RAU C;  1S72 A;  2OQK A;  2CCZ A;  1LTT D;  5I4D A;  5IGF A;  3AB9 A;  1N32 L;  3MC0 B;  1STE A;  2Q8I B;  1VQ5 A;  1BCP D;  1MJC A;  3Q24 A;  4A3M G;  4LF6 L;  2I5H A;  1CA6 A;  4LUZ A;  5C44 H;  4HCE A;  5DAU A;  5KEE A;  1FJG Q;  3K59 A;  4XQJ A;  1YNN C;  3ONA B;  4GN5 A;  5E4W C;  3AFQ A;  4DV6 L;  3I4M B;  4LF6 Q;  3HOV G;  4LW1 A;  3S16 H;  2I5M X;  4C3I G;  1B2T A;  4XIG S;  5DEH A;  1JJG A;  1KQS A;  3TSS A;  4L5S A;  4DUZ L;  1IXR A;  4JI2 L;  4PMC A;  4A3F H;  1STA A;  1CTM A;  3KDF A;  3FKI G;  2F1M A;  2VQF L;  3A5U A;  4LF4 L;  2JA9 A;  3S14 H;  5IOC A;  3HOU G;  4DV6 Q;  3GTJ B;  3U9O A;  4DAP A;  2R61 A;  2JA5 G;  4LF9 Q;  3LX0 A;  4H44 C;  2NZH A;  1VQH A;  3RN5 A;  3J81 c;  5CBE E;  4K8J A;  1WD0 A;  3RZD H;  3T4A C;  4A3M B;  3U50 C;  2ZXR A;  1BQQ T;  2HIX A;  2EYM A;  5D3D A;  5BN4 A;  1FL0 A;  1F2L A;  1BR9 A;  4PQX A;  5JOB A;  4N8X 1;  1NNX A;  3STB C;  3A0J A;  2F0H A;  3V05 A;  3I8Z A;  3C1E A;  4DR1 Q;  2AQ3 B;  1X56 A;  1II3 A;  1D7Q A;  4QIW E;  2F0J A;  5HUR A;  1DZ1 A;  3AYH B;  4FXG C;  1IZ6 A;  4K8I A;  4ABN A;  3OIP A;  3J80 i;  3TZU A;  1I6H H;  3DEO A;  2OF1 A;  1NE3 A;  1Q3L A;  2XRQ D;  1TWH B;  4IPD A;  1QUQ A;  2N88 A;  2YU9 B;  1ET6 A;  2NVX B;  1JQY D;  4IPC A;  4C1N I;  4TSS A;  3I2Z A;  3J81 L;  4ZK9 B;  2F3I A;  3A55 A;  1TWC H;  5C44 B;  1G2S A;  1HH2 P;  4DAV A;  2CH4 W;  5IP9 G;  2DGY A;  5C3E B;  2AWO A;  5CGK A;  1S5C D;  3V96 A;  3ND9 A;  2VL6 A;  1BBU A;  5EPL A;  4IJH A;  5M5W B;  1WTX A;  1P16 A;  4KKU A;  1ILQ A;  2K04 A;  4OON A;  5BN5 A;  1B70 B;  1KC8 C;  2A6E C;  4HIM A;  5IGB A;  4Y52 H;  4KHV A;  1VQ8 A;  3N6R A;  4OO1 H;  1JE4 A;  3MXP A;  2A6E D;  1WTP A;  1D1I A;  1RIP A;  1T9H A;  3P75 A;  4IUN A;  1PH4 A;  3G6E A;  4B9W A;  2AUJ D;  1BVS A;  1NTG A;  1K0S A;  1TWG B;  4ID6 A;  5C0X I;  2IW3 A;  3T1H Q;  2E76 C;  3K57 A;  2ZTD A;  3NPP A;  1HJP A;  1H9M A;  3ICE A;  4IO9 A;  3A54 A;  2XRS D;  1VF5 C;  1VQN A;  1O7Y A;  4F7X A;  4X66 Q;  5C5M A;  2EY5 A;  5JVG 3;  1GUT A;  2DUD A;  4CKC A;  1S5D D;  3A56 A;  3OMC A;  3T1H L;  3HOV H;  1G8Z D;  2R93 H;  3L7Z C;  1OXX K;  5IYD H;  1YIT A;  1RHP A;  5IGC A;  4KY5 A;  1YNJ C;  3K7A B;  5BR8 Q;  5M3M H;  2A1A A;  4EQ5 A;  1DXM A;  2P5Z X;  3TRE A;  5GAD C;  1TII D;  4GNX B;  2A74 C;  3IKJ A;  1SBB B;  4YWL A;  2NTT A;  1Q86 C;  2F0I A;  4JOI C;  1PZJ D;  3HFZ B;  5ISR A;  3CC2 A;  4A93 G;  3WWV A;  2K5Q A;  3CXC A;  3BDC A;  3BG3 A;  3ULJ A;  1X54 A;  4F87 A;  5A2Q E;  1F9S A;  2RDF A;  1PFM A;  4QJF A;  4KKT A;  2MP1 A;  1Z6H A;  4O42 A;  3PQI A;  4H7B A;  5LL6 S;  3QG1 A;  3NWT A;  1QG7 A;  2RVL A;  3J7A V;  1TWA H;  4OXP A;  2DN8 A;  1S40 A;  1PTO D;  4RGT A;  2RF4 A;  1FVI A;  2LY7 A;  1PV4 A;  4AYB B;  1TWC B;  1XPR A;  3KBG A;  1VQF A;  2JN4 A;  2VZA A;  3FDT A;  4DV0 L;  4DPG A;  2XVS A;  2F3V A;  1NSN S;  4BS9 A;  3LWU A;  3K7U C;  1HNW Q;  1WD1 A;  1DCZ A;  3K5L A;  3HOY H;  1W3S A;  4FVM A;  4NB3 A;  1Y14 B;  5C4J H;  1EEI D;  1ENC A;  4DR5 L;  1EIH A;  3AMU A;  5IOD A;  1LTG D;  5E1F A;  4DR5 Q;  3BYT B;  1YHA A;  3VA5 A;  4YWK A;  2F0P A;  3ERQ A;  2NN6 H;  5CV4 A;  5FOB B;  2NVQ B;  2L0C A;  3KF6 B;  3VR3 A;  3VA7 A;  1O7I A;  4L8J A;  1WTR A;  1N33 L;  4IUP A;  3PF4 A;  3RR5 A;  3FPP A;  3I4N B;  1ASZ A;  2EYL A;  3QJY A;  2B8F A;  2Z8L A;  1VQC A;  3CME A;  4QL5 A;  1EOT A;  4Q5V A;  1YI2 A;  3PSI A;  1IYV A;  2RDH A;  2K75 A;  1R9T H;  3GTO H;  1KLU D;  1A63 A;  3K81 C;  2Y0S B;  4WJ4 A;  4DUZ Q;  5IWA L;  2B2U C;  5LL6 X;  1I94 Q;  3RLO A;  3H6M A;  1H9R A;  3GTL B;  4DN4 M;  2WAQ E;  4DXG A;  4DXF A;  2F4V L;  1E7Z A;  1XPU A;  2AQ1 B;  5CV8 A;  1OTC A;  2JA8 B;  3R8B A;  2SNS A;  4TVA B;  3FVQ A;  4KHP Q;  1A3V A;  1VS0 A;  5KIX A;  4ME3 A;  4BY1 G;  1L0Y B;  4QUF A;  5LMN Q;  3A8J E;  3UDG A;  4DV0 Q;  2JP1 A;  3IRB A;  5ELE A;  4S3S A;  3VR5 A;  3FRP B;  4KMU C;  2ATW A;  1OO9 B;  2KHS A;  1EL0 A;  1SN8 A;  5IT9 c;  1K0R A;  4HSP A;  4QMG A;  2UUA L;  1KXL A;  1FGU A;  5KNB A;  2AUK A;  1PMR A;  1TVX A;  1D8L A;  5C4Z A;  2Z4I A;  2R7Z H;  1J5E L;  3ITP A;  4XQN A;  3OWE B;  5CBA E;  2OQ0 A;  2XNA C;  1JOO A;  1CHP D;  3BVG A;  2QKI C;  5ELD A;  3ERO A;  4DR4 Q;  2E2I B;  2EOT A;  4B9X A;  2N49 A;  1KAA A;  1HNX L;  1S5E D;  2JA8 G;  2XN9 C;  3KF6 A;  2MQH A;  1JB7 A;  1TT2 A;  3T16 A;  4DKA C;  2CWP A;  1EU3 A;  5D65 A;  4LF7 Q;  4JVZ A;  3CF5 A;  3S17 H;  1DGS A;  4GN4 B;  2K5W A;  2NN6 I;  4MTN A;  1O78 A;  4O1N A;  1CKN A;  3KOJ A;  1HNZ Q;  3NTI A;  5FLX L;  2BOS A;  1GXD C;  1I50 H;  5EAY A;  1MGS A;  2TMP A;  4IJL A;  1VMC A;  5FO9 B;  2PPB C;  1X9N A;  1IBM L;  1R9T B;  1TWG H;  3KLS A;  1PH9 A;  1FJG L;  2AHO B;  3P1H A;  1XMO Q;  1H95 A;  1GOZ A;  4POF A;  4LF8 L;  1RCV D;  2K14 A;  1I3Q H;  4YCV A;  1DOL A;  5CC4 A;  2HCI A;  4JW0 A;  2R92 G;  1ZKO A;  2K03 A;  4C3H B;  3JAM E;  4JI7 Q;  4PG3 A;  5E4X A;  1IW7 C;  3EIV A;  1SMY C;  3RLN A;  4LF4 Q;  4A3G B;  1XX8 A;  4DV4 Q;  4DV5 L;  2ZTE A;  2ZXO A;  4DFA A;  3CC4 A;  1L2F A;  5A2Q L;  3I70 A;  4BY1 H;  3M3Y H;  5J22 A;  1JOK A;  1PH2 A;  1BCP C;  1PTO C;  4BY7 B;  1KAW A;  2JA6 H;  2PI2 A;  1VQM A;  4AH6 A;  1G6P A;  1U4R A;  2KEC A;  3I73 A;  2WB1 G;  4X64 Q;  4XYO A;  5M3F B;  3OTO L;  4KLK A;  3OMG A;  1Y1V G;  1M1K C;  3K6O A;  4MIU A;  3ULP A;  1FD7 D;  1K8G A;  1EY5 A;  4KHZ A;  4RGN A;  2NVY B;  3D4W A;  4OIK A;  1GUS A;  3QB3 A;  2Q2T A;  4X64 L;  4DV1 Q;  4B3T L;  1X55 A;  2IY5 B;  4GLX A;  4DNT B;  1YNX A;  2ZM6 L;  5CV5 A;  2QIL A;  3SR1 A;  4X3K A;  3D4D A;  1PZK D;  3W1B A;  1HFN A;  2CH4 A;  1SNC A;  3TS0 A;  4B3S L;  2ZJQ A;  4BY1 B;  4CDE C;  3IFT A;  4CKB A;  2IPK D;  3CCS A;  2D9U A;  2JA7 H;  4G7O C;  1Q81 C;  1QOH A;  1NR4 A;  4NP5 A;  4HJ7 A;  1ESF A;  4L6T B;  4A4I A;  3CQZ H;  4OIJ A;  3MZ5 A;  4JV5 L;  1L1O B;  3G7L A;  5GAG C;  3CMA A;  1ET9 A;  3S14 B;  2F0U A;  1K8O A;  4P74 A;  1ESR A;  5EBC A;  2A68 C;  3S2H H;  4IQZ A;  1N36 L;  1Q1E A;  3AQQ A;  1K83 B;  3CHB D;  3TRZ A;  4DAY B;  4HID A;  2PI2 E;  3V2T A;  4BY7 H;  2R93 B;  2QF7 A;  3S1M H;  5LMN L;  2HUG A;  1QVC A;  5TSS A;  3UDF A;  3L0O A;  2KQ3 A;  2B39 A;  1BKB A;  4WRD A;  2LXK A;  2QEJ C;  2UUA Q;  3DWQ A;  3OWF A;  5JEA H;  3AEV A;  1K8M A;  3D0F A;  1LYL A;  4KY7 A;  1EWC A;  1Q1B A;  1BXT A;  1SNQ A;  2CQO A;  2J7Z A;  3D6W A;  3S24 A;  1UE1 A;  5LMU L;  3S17 B;  4A3J B;  2N3S A;  4ULL A;  1X65 A;  2CW0 D;  1J9O A;  3HOZ G;  4DR4 L;  5DNF A;  2RKS A;  4YY3 Q;  4C3H H;  1B3Q A;  3M9B A;  1SYB A;  3PO2 G;  1EWH A;  2EY1 A;  3H3V H;  4HCS A;  2E2H H;  4F8M A;  5IYB H;  5IY0 A;  1XJV A;  2EXD A;  4C1N K;  3NEN A;  4ILW A;  2IHF A;  3CCJ A;  4HSV A;  4JI8 L;  1A15 A;  1J6Q A;  3Q6S A;  2A69 D;  1XNQ L;  4DAM A;  2HD3 A;  1DJR D;  2HHH Q;  4R4T A;  1V1O A;  3PIO 3;  1HUM A;  3HOX G;  5LHY 1;  1OXV A;  1JIC A;  2EE1 A;  3DHQ A;  3JAM i;  2BH8 A;  2G9D A;  2Z6K A;  3IL8 A;  1I4Q A;  3NWS A;  2EJF C;  1SMY D;  2CFM A;  3LNN A;  3X3N A;  4LFB Q;  5M3M B;  2VQE Q;  4QUC A;  4RKL A;  1PDQ A;  5JEA G;  4DR6 Q;  4R8N A;  3S1M B;  4CJ2 C;  1CI3 M;  3H0G H;  1PZI D;  2X69 A;  3F2D A;  2SOB A;  3K58 A;  1L1O A;  3GTP H;  5EBD A;  4OWW B;  4ZCK A;  1EWI A;  3D6C A;  3S2H B;  2JSO A;  2R7F A;  1Z7T A;  2HDL A;  5I6Y A;  3BYY B;  4LMQ D;  2KCC A;  2FXQ A;  3R2T A;  3F2C A;  2IWH A;  1HTL D;  3X3M A;  3VYU A;  1HQR D;  1E1O A;  1HFG A;  3GTO B;  4LAA A;  1EFI D;  3MEH A;  4U67 3;  3HOX B;  2K4K A;  3Q0A A;  3C2P A;  1C0A A;  2O5I C;  1MSH A;  1A62 A;  2K32 A;  1ENF A;  2L55 A;  4G57 A;  5FLX c;  3DLL A;  5C5L A;  4JBW A;  4DV3 Q;  2WP8 J;  4K6L A;  5IYC H;  2EYH A;  5H1S E;  1EYA A;  2KUM A;  2B2V C;  4WFN 3;  4PMB A;  2JA7 G;  2B2W A;  3CC7 A;  4B3R L;  4JYA L;  2D0P A;  1PTO B;  2VXW A;  1V9P A;  2LS0 1;  1CKO A;  1JWM D;  2LFN A;  2RCN A;  3I90 A;  4HIO A;  2RCF A;  5C3E H;  1QVG A;  1N34 Q;  3MXG A;  1RDP D;  1WFQ A;  1XXG A;  2FFK B;  3TDQ A;  1VQB A;  3GTM B;  1SYE A;  4B3R Q;  3I56 A;  2DJG C;  2B2U A;  3QWN A;  3EJI A;  3HOY B;  3PF5 A;  1SLJ A;  2MJ8 A;  1MBY A;  3PO3 H;  5FKA C;  1ROD A;  2YV5 A;  2JA6 B;  2WAC A;  2F3W A;  3M4Y A;  1EQR A;  3T51 B;  1B50 A;  5JVH 3;  1VQD A;  2A6H C;  3KDF B;  3M4O H;  1SFO H;  3S1Q H;  5EPK A;  5IYB G;  1CKN B;  3T1Y Q;  5AJ3 Q;  5ELB A;  1PTO H;  1V1Q A;  3KBX A;  3ULL A;  4IFD J;  1K9M C;  2XWJ B;  5IWA Q;  1U4L A;  1XYI A;  2VW9 A;  3PIP A;  1LTL A;  5FO7 B;  1I4R A;  1Q8K A;  2HDM A;  2Z6K C;  4YCU A;  1YJW A;  4X62 Q;  3SVM A;  4CDC C;  3OW2 A;  1IBK L;  1N8R C;  3NBI A;  3HOU H;  1HNW L;  4NXN Q;  4ZKB B;  3HOW G;  4C56 C;  3KLR A;  2K7V A;  2B29 A;  1ZYR D;  5FK9 C;  5LMU Q;  1AE2 A;  2F0T A;  2HT1 A;  1E2Z A;  2OT2 A;  3J81 E;  1IL8 A;  2CWA A;  2PMZ B;  3MA2 B;  2NVT H;  2UXB L;  4DNR B;  3S1R H;  2F0M A;  2F0N A;  1SNO A;  1TS3 A;  3BZK A;  2UXB Q;  2QW7 A;  2Z6B A;  3CRL C;  4X6A H;  1XTD A;  1AN8 A;  1VQO A;  4C3J G;  3Q23 A;  1LTB D;  2Q8T A;  5HGT A;  5M3F H;  1ASY A;  1IW7 D;  4FYD A;  1MD2 D;  4NKL A;  3S16 B;  3FHW A;  3G71 A;  1HNX Q;  3H0G B;  4EVO A;  3T13 A;  2PQA B;  3HS0 C;  4FF3 A;  2EJG C;  4K5V A;  4AQY Q;  1A0I A;  2XGT A;  1OXS C;  1N32 Q;  5I9O A;  4DK3 C;  1D6E C;  4E6I A;  3NQT A;  3I4L A;  1LV9 A;  2LKV A;  4LNQ A;  1VQK A;  1G91 A;  3I4O A;  1KLG D;  4A3I B;  1CQV A;  1HR0 W;  4APV A;  3DWA A;  2PQA A;  5IGG A;  5DM6 3;  2MPM A;  4Y7N H;  2AQ2 B;  5DM7 3;  3A74 A;  4JI2 Q;  1Q7Y C;  1GKH A;  3HP3 A;  3F2B A;  2B2T A;  4A3D G;  3W1G A;  2G5D A;  1WOC A;  1Z9F A;  2Z9H A;  5E7N A;  1HR0 L;  1NJI C;  5J3B A;  3TP5 A;  1CZW A;  1M4V A;  1GVP A;  2BA0 A;  4A3J H;  1C8C A;  4OX9 L;  1KTK A;  1Y1V B;  4A76 A;  5EKI A;  1KRT A;  1V43 A;  4XT3 B;  1IBL L;  2JE6 I;  4OGQ C;  1D5X C;  4KY6 A;  5JJL A;  1GUO A;  1EY6 A;  1VF7 A;  1FNU A;  2V1C C;  3PUX A;  5DLQ E;  2K50 A;  3U4V A;  1KRS A;  3NP8 A;  1TR5 A;  3GQB A;  4BWG B;  3OTO Q;  3UDI A;  3CCM A;  2DJF C;  1H9J A;  3HG9 A;  1K73 C;  1HA6 A;  1F2M A;  1PYW D;  1SNP A;  3FP9 A;  4ZYS A;  4K5X A;  1IL2 A;  3CCV A;  4A3G G;  4DNI A;  1E1T A;  5FJ8 H;  4YY3 L;  3IFD A;  4PV1 C;  4J15 A;  2CHB D;  4XQQ A;  1LT6 D;  2A73 B;  2K5H A;  1TWF H;  2WII B;  2SNM A;  1AEX A;  4K2K A;  3PO2 H;  1XNQ Q;  4DV1 L;  2JA7 B;  3SK8 A;  4FXD A;  3PO2 B;  5I6W A;  1UWV A;  4X3S A;  3T56 B;  2KHJ A;  5E3F A;  4P71 A;  1AH9 A;  4H0L C;  1Q12 A;  2KCN A;  2F52 A;  2ZJR A;  2V4D A;  3UE0 A;  1YZ6 A;  3S9W A;  2O5J C;  2FMM A;  2D5D A;  3GTQ B;  3M4P A;  3HZX A;  4JI0 L;  4FDB A;  4ZUJ A;  5COR A;  2I0Q A;  4L5R C;  1GM5 A;  4L63 B;  4QIW B;  2JJQ A;  5LMN W;  3K5M A;  1YBY A;  1QJO A;  4JI4 L;  4A3L G;  2K33 A;  3TN2 A;  4CDF C;  4LFC Q;  4K0K Q;  2L9H A;  1R4Q B;  2ASB A;  3CCR A;  1PYS B;  4QY7 A;  4DR3 Q;  2B2Y A;  2DNE A;  1TQO A;  3R2I A;  2MUY A;  1ICF B;  3VR6 A;  1ENA A;  4C3I H;  4ALP A;  5HY6 A;  5I2Y A;  1QWY A;  2OWO A;  5IIF A;  1HQM C;  3M3Y B;  1X3Q A;  3QIA A;  4Y7N B;  1A3U A;  3HKZ G;  1EQV A;  1HZA A;  1VDZ A;  3GTJ H;  4Z9C B;  2EJM A;  4OWT B;  2NZO A;  3S2D H;  4GS3 A;  4DR1 L;  2DY8 A;  4RCN A;  3CCL A;  1RF2 D;  1NUC A;  1H9S A;  3Q22 A;  2F4I A;  3T53 B;  1S4Z A;  1EUJ A;  1EEF D;  2K1B A;  3AU7 A;  4IUQ A;  4QGU A;  2MNA A;  2ID0 A;  3RN2 A;  1WTH A;  2VUM H;  4EQO A;  4JI8 Q;  2B63 H;  1E22 A;  1SND A;  4XDX A;  4GNX A;  1UE6 A;  2PW7 A;  3H3V I;  1JCK B;  3S15 B;  4XXE A;  2X6G A;  2IX3 A;  1KHI A;  2VY3 A;  5G3L F;  2F0O A;  1YJN A;  1F9Q A;  1LTS D;  2PQE A;  1BF4 A;  4LF7 L;  1I4P A;  4G4K A;  4CDD C;  1I50 B;  1XMO L;  5K5P A;  3K8A A;  1PXU A;  2WB1 E;  4RKB A;  2K5D A;  5CV7 A;  4AQY L;  1X3G A;  1I4H A;  2YTX A;  1KIX A;  1WI5 A;  1U9R A;  2F0E A;  2MFI A;  3VYR A;  4LF8 Q;  3HKZ E;  4AIM A;  4KD3 A;  3FKI B;  1STY A;  1SYD A;  3O13 A;  3PUV A;  1HZC A;  2QEX A;  1CQF A;  1X32 A;  5F2D A;  1S5B D;  5CYU A;  1STN A;  1M8A A;  4P73 A;  1LAC A;  2NTS A;  1NY4 A;  1C9O A;  4BBS H;  4DR2 L;  1L0X B;  1MIU A;  2D62 A;  2JQO A;  5A35 A;  4IAL A;  4OWX B;  3K0Y A;  3I7F A;  1I4G A;  3CD6 A;  4UP7 A;  2E2J H;  4R4I A;  2I5L X;  3K5N A;  2Q8R E;  1JMC A;  1M90 C;  2F0S A;  2H1E A;  1GO3 E;  2KA7 A;  2RBM A;  1PH1 A;  1D2B A;  3L2P A;  2EDG A;  5EKK A;  1EYC A;  3GV3 A;  1EY7 A;  2L4N A;  4FF4 A;  1QIL A;  2YU9 H;  3E5S A;  3BVM A;  1K83 H;  4RH6 A;  2F0W A;  1G29 1;  3HOV B;  1Q46 A;  2GN5 A;  3R3O A;  2MGS A;  1HZB A;  3LGJ A;  2CQA A;  4DV2 Q;  5BN3 A;  2HQL A;  4MHE A;  3P20 A;  1SRU A;  1Y8P B;  2Z1C A;  4B3T Q;  2NVT B;  2JYO A;  1SR3 A;  4K5W A;  1TXY A;  4L5Q A;  5C4H A;  1ML0 D;  1WCM B;  4A3K G;  4TKO B;  1DOK A;  2VB2 X;  1SMX A;  1Y1W B;  4FF2 A;  1TY2 A;  3CPW A;  5C4X G;  2JXM B;  1VQ9 A;  1JWU D;  4AYB E;  1JC7 A;  3H09 A;  2UXD Q;  4Q0F A;  5FJ8 G;  2WKC A;  2DY7 A;  4RHR A;  3T1Y L;  1EU4 A;  4FXK C;  2E75 C;  2B2Y C;  2ALY B;  2EY2 A;  4ZRZ A;  1PH5 A;  2EQS A;  4CKE A;  3Q8D A;  2VUM G;  4DR2 Q;  3W3A A;  1LT5 D;  1STB A;  4XTC S;  1TY0 A;  4K2L A;  5I2X A;  4B3S Q;  4JI5 Q;  1VQ4 A;  5KGU A;  1SRO A;  5M5X H;  4A3D B;  4GN3 B;  1SYG A;  4LWC A;  2K05 A;  4YHH L;  1I6H B;  4CGY B;  4MTK A;  3CAM A;  3OW7 A;  3H94 A;  4DGZ A;  2L15 A;  1CUK A;  1YHB A;  3RZO H;  1FNV A;  4JI1 Q;  2VS1 A;  1KNA A;  3F2U A;  1VQ6 A;  1ILP A;  2ZT9 C;  1JOQ A;  4JC0 A;  3C46 A;  1VQI A;  3L9A X;  4NMZ A;  3DWP A;  5D14 A;  5EGT A;  1TWA B;  1PYB A;  2CVR A;  1E2V A;  2EVB A;  2B8G A;  2N55 A;  1HTP A;  3NTK A;  1YNJ D;  4LFA Q;  3GV6 A;  2IX0 A;  2QA4 A;  5J1Z A;  4BXX G;  5BR8 L;  1Q82 C;  4ODG A;  5I9P A;  3TS2 A;  4HJA A;  2UU9 Q;  1PHJ A;  2ZXP A;  2RSO A;  1WCM H;  3MEF A;  1K8A C;  2C5C A;  3HOX H;  2WB1 B;  4WOR A;  3U9S A;  4A3E G;  2HHH L;  1OXU A;  2YTV A;  5ELN A;  4I65 A;  1D1K A;  1CK1 A;  2F4V Q;  2EYF A;  1B7Y B;  3KJO A;  4JV5 Q;  2PO4 A;  4KKS A;  1HPC A;  3MHB A;  1QVF A;  4LF5 L;  3MXU A;  1BO0 A;  2Z4H A;  1SYF A;  3N52 A;  3URY A;  4CJ1 B;  4LF5 Q;  1HA5 A;  2KCT A;  4UP8 A;  3J7A 5;  1YNN D;  3NHH A;  2E2I H;  3I4M G;  1I6V C;  2NYZ D;  5EQ0 A;  3PUZ A;  3UI2 A;  1D5M C;  1NR2 A;  3ERS X;  3PGZ A;  1Q90 A;  4HED A;  5J39 A;  1ONL A;  2JEB I;  2A19 A;  3D4R A;  3CCQ A;  4NXM Q;  1SEB D;  2LXJ A;  3VR4 A;  4BY7 G;  4EQP A;  3ZJY C;  1I4X A;  3G48 A;  2FIN B;  3HOW H;  4UHV A;  1ZYR C;  5HGQ A;  4MZ9 A;  5EJW A;  1IBL Q;  2UUB Q;  4X66 L;  2QCP X;  3GDE A;  1G51 A;  2RA4 A;  3J7Y W;  5NUC A;  5KYL A;  4FNF A;  1HCZ A;  4NPS A;  1B53 A;  2E2H B;  3BU2 A;  4XT1 B;  4CHT B;  1C7Y A;  2CKZ B;  4C3H G;  2QDB A;  3CCE A;  1RKN A;  2J4X A;  1RL2 A;  1PRT C;  4YIJ A;  1IKM A;  5CV6 A;  1KD1 C;  2BE5 D;  4P2C B;  5IYD G;  3MFY A;  4RWS C;  1O80 A;  1YEZ A;  1EIF A;  3E9H A;  2PZT A;  3I3C A;  1S3O A;  3U58 A;  2JEA I;  1AP0 A;  2L11 A;  2OEO A;  1VQE A;  4OEL B;  4DR7 L;  1FGB D;  1VQP A;  1W6K A;  1PA6 A;  1QZG A;  3RZO B;  1EIG A;  3S15 H;  4DR6 L;  2UXD L;  5JEA J;  1T5E A;  3PO3 B;  2PNH A;  4J8Q A;  1GUG A;  1QNU A;  1QCB D;  1RTO A;  1X3P A;  2B2W C;  2L12 A;  1XNR Q;  1JJC B;  5C0X H;  4OEM B;  1GJX A;  3BVZ A;  4RHS A;  2EYO A;  1QUQ B;  2FJ2 A;  1VQA A;  1I5F A;  2QDL A;  3GTK H;  2PNR C;  1I94 L;  3PV0 A;  4X3U A;  1LUZ A;  2A69 C;  5AJ3 L;  5ELC A;  2K52 A;  3W5O A;  1SE8 A;  2WIN B;  1VQ7 A;  1XNR L;  3S1Q B;  2KED A;  3DMU A;  3GP7 A;  2LSS A;  5JAV A;  1CSP A;  1TWF B;  3OIQ A;  4PZ7 A;  1NBW A;  4G7H C;  1LT3 D;  2LMC B;  4R4O A;  2IX1 A;  4EQN A;  1U4P A;  3H15 A;  4A3B B;  4WJ3 M;  1Y1W H;  1SAP A;  3B6Y A;  3KK7 A;  3DUZ A;  3GO5 A;  1S5F D;  4BA2 I;  1CHQ D;  1FNW A;  1CSQ A;  2A68 D;  2PZW A;  2C35 B;  1N36 Q;  2N8N A;  1EQQ A;  5M5Y B;  3CKI B;  4B3M Q;  1J8I A;  3H0G G;  1G2T A;  3I72 A;  4P72 A;  3NQI A;  4KJO A;  1X3E A;  3D8G A;  1Y1V H;  4ZAI A;  4U68 A;  4RA8 A;  1STG A;  2NBF A;  1B9M A;  1BCP B;  1SE2 A;  1X6O A;  2YTY A;  3AFP A;  2KBN A;  4HJ5 A;  5FLM G;  3CRK C;  3MXN A;  4XYQ A;  2JA6 G;  1JE5 A;  2GA4 B;  4QB4 A;  1L0W A;  3UDX A;  1A2T A;  2Q2H A;  1T5X D;  5COY A;  1JJ2 A;  4IOC A;  3EN2 A;  1V1P B;  1PRT D;  2R3Z A;  2E2J B;  2R7Z B;  2XIW A;  4DUY L;  3HGB A;  1AFP A;  4H02 A;  3I91 A;  1GD7 A;  1PFN A;  1K3R A;  3HEJ A;  3KFU A;  3A5Z B;  2F0Q A;  3RMH A;  3TQY A;  3K5O A;  1KL9 A;  2K5N A;  1LT4 D;  3K80 C;  1IYJ B;  2AKW B;  1GUN A;  5C0X G;  4HN7 A;  1SDF A;  3SDZ A;  1HR0 Q;  3G4S A;  1PVO A;  4A3K H;  3NBH A;  3D3R A;  1G6Z A;  3BJU A;  3KJP A;  3DEP A;  1E2W A;  2BCO A;  5KNC A;  4JCV E;  4AYB G;  3GTL H;  3A7A B;  3H91 A;  4I7Z C;  2E5L Q;  4RGM A;  1BDO A;  1CKM A;  2AWN A;  4GKK L;  2M00 A;  1GUW A;  3M4Q A;  1L1O C;  4DV3 L;  4A3K B;  2JA5 B;  4IUR A;  5M5Y H;  1Y8N B;  2VNU D;  3STB D;  3J7A F;  1CFM A;  3PMF A;  2EZV A;  2CW0 C;  2I46 A;  3NSW A;  1UAP A;  2PCF B;  1JR0 D;  4LK1 C;  2PYK A;  4IFD I;  3D31 A;  3MAQ A;  1KDC A;  5EKL A;  3E3X A;  3WDN A;  1LTR D;  1TKW B;  4FO2 A;  3SE0 A;  3OPO A;  1C48 A;  1SNM A;  2XSC A;  1N34 L;  3S2D B;  4DA2 A;  3M85 A;  1NMF A;  1PFS A;  3MXN B;  3M7N A;  5FLM H;  4ZLT F;  1A3T A;  1EZ6 A;  1SFO B;  1E3P A;  4UAI A;  3GTK B;  2ICE C;  1O7L A;  4MNO A;  2RHS B;  2NVX H;  4JI0 Q;  2VQE L;  2ZM6 Q;  1TWH H;  1QNK A;  5IP7 G;  3ND8 A;  1AZP A;  4G7Z C;  1LTI D;  5M5X B;  2BDN A;  2R92 H;  4GNX C;  3QR8 A;  4RCO A;  4GZY C;  3SK4 A;  3NXW A;  2EXZ A;  4TQU S;  3CQZ B;  3BDL A;  2F03 A;  3S1R B;  1N9W A;  1BUV T;  2H4O A;  5C0X J;  4LFC L;  5C3W A;  4HMJ A;  2R7D A;  2UUC Q;  4YCW A;  4JBK A;  1NAP A;  1VCI A;  1JT8 A;  4QQB X;  4A3E H;  2VQF Q;  2NWG A;  3EVQ A;  5K36 H;  4CJ0 B;  4V19 0;  3I4N H;  4DR3 L;  3OOC A;  3DXJ C;  4JI3 Q;  3KYH C;  1TS2 A;  4RMF A;  3U4Z A;  4DV4 L;  4DV5 Q;  5M3M G;  2GVB A;  1CA5 A;  4I7A A;  2MO1 A;  3BS1 A;  4GOP B;  1FR3 A;  4A3E B;  1XWE A;  4P75 A;  3HOZ H;  2BE5 C;  3J80 E;  2AMC B;  3VYT A;  1UNS A;  2OTL A;  3A7L A;  1OXT A;  4DF7 A;  3C1F A;  2A5H A;  1J5E Q;  4LUV A;  2BA1 A;  3KUP A;  2EPB A;  3E0E A;  1VQL A;  3NEL A;  4KTA A;  2K01 A;  4H13 C;  1DD2 A;  3E0J A;  4PNY A;  4IN3 A;  2JA5 H;  1XPO A;  1YHQ A;  1HZ9 A;  3J81 i;  4EGV A;  4F88 A;  5C3X A;  2KOL A;  1BBW A;  1PRT F;  2KEE A;  4A3G H;  3UE1 A;  1EYG A;  4A3F G;  2BDO A;  2E8G A;  1EZ8 A;  3VR2 A;  4NDX A;  1IKL A;  1WTO A;  3S1N B;  1EY4 A;  3MWY W;  4IZ8 A;  4DK6 C;  5IP7 H;  1PH7 A;  1VQG A;  4A3C G;  3J7Z C;  1F9P A;  1V8Q A;  1UE7 A;  3A8K E;  4BBS B;  4UY8 C;  2RSN A;  4X62 L;  1I3Q B;  5G3L D;  3J80 L;  4JI7 L;  2UUC L;  1UE5 A;  1JOR A;  1QZH A;  2PZU A;  2YYZ A;  1LAB A;  2HCC A;  1VQJ A;  4C2M H;  3DM1 A;  4IPH A;  3MTS A;  1B8A A;  1MKH A;  3TEH B;  5M5W H;  3S1N H;  4RFB A;  1KDA A;  5JJZ A;  4JI6 Q;  4R1J A;  3J80 c;  5C4X H;  5FO8 B;  4A3B G;  1B3A A;  5CV9 A;  2L5T A;  2O2L D;  1DOM A;  2KJX A;  5IT9 L;  1LM0 A;  3GTP B;  1HHV A;  3PUY A;  3EBE A;  2C9O A;  4L5T A;  5C6A A;  3PCO B;  4N9T A;  1DON A;  4A3L H;  5KRU A;  2E2D C;  2IHE A;  1PH6 A;  3ER0 A;  4JBM A;  1R4P B;  3CW2 C;  3DM3 A;  5M3F G;  1B44 D;  5C4X B;  2K28 A;  2XWB B;  3LWE A;  5K36 G;  1E24 A;  4QF4 A;  1MJE A;  5ELF A;  3FEW X;  3PIO A;  1HXY D;  1B1Z A;  2IT1 A;  4BBR B;  5KND A;  1YJ9 A;  1B9N A;  3KLW A;  1BNZ A;  3ZYY X;  1FYC A;  3BDO A;  3SGI A;  2R6G A;  5IGE A;  4A3B H;  4B08 A;  1GHK A;  5CMD A;  1WTW A;  2NB0 A;  1HUN A;  2JK8 A;  3HRZ C;  3G6J B;  4HAE A;  3R93 A;  3SHL A;  1SJH D;  3RUZ A;  3RLF A;  3SEB A;  1YVC A;  2BH2 A;  1KNE A;  1RD9 D;  4TRD A;  4GOP C;  2NVY H;  1AZQ A;  3M4O B;  3W2D A;  1AE3 A;  3SXH A;  4M1U B;  2UXC Q;  2B3G A;  4NXN L;  3P7J A;  1EY9 A;  1KDB A;  2R92 B;  2F0L A;  4BA1 I;  3QO2 A;  3GTQ H;  4KD4 A;  4A3I G;  2EYP A;  4GKJ L;  1A2U A;  1W6J A;  4FF1 A;  4UDU C;  4V0B A;  3GTM H;  2OTJ A;  4JI5 L;  2F0K A;  3H3V C;  2A6H D;  2KHI A;  5CR3 A;  2WFW A;  4GKJ Q;  2R7Z G;  2PW5 A;  2RHQ B;  3SK5 A;  3OYY A;  4EX5 A;  4ZKC B;  1H9K A;  1ZEQ X;  3HOZ B;  4JOI A;  2Z0S A;  2B2T C;  4DV7 L;  3WOF A;  2VB3 X;  4PZ8 A;  4C3J H;  3RNU A;  1EFW A;  4CBV A;  2D0O A;  3CPF A;  4A3M H;  4OO1 G;  1AW7 A;  1EIY B;  5C44 G;  4JK1 C;  5C4J B;  4IUU A;  3FPU B;  4POG A;  3RZD B;  2MO0 A;  2KEN A;  4IUV A;  1ZXT A;  2WAQ G;  5GQO A;  2X6L A;  3NK9 A;  4DV7 Q;  4HIK A;  3QOL A;  3GD7 A;  1SE4 A;  4PMW A;  4PZ6 A;  1NMG A;  3RD4 A;  1MI2 A;  1UEB A;  4BBR H;  1YIJ A;  2EIF A;  1N33 Q;  5IYC G;  3FMC A;  1SE3 A;  1STH A;  3NBH B;  3QOJ A;  3KF8 A;  4KHP L;  1WTQ A;  2M9V A;  4KK7 A;  4UP9 A;  3JAM L;  1F77 A;  1EY0 A;  4N9P A;  2EY6 A;  2HIV A;  3TZD A;  2OXP A;  3K7A H;  4ZUI A;  1LO5 D;  5T1G A;  4DAY A;  4KN4 C;  2Y0S E;  4GOP A;  1MHW C;  4FP5 D;  1U4M A;  5IE8 A;  3WOE A;  1CM9 A;  2NN6 G;  4GLA C;  2QGQ A;  1A6X A;  3I4M H;  1D5Z C;  3PIP 3;  1O7Z A;  4K14 A;  1Y69 U;  1EY8 A;  2OCE A;  5GAE C;  5JPM C;  2ENB A;  2UUB L;  4KJN A;  4A93 B;  4OHJ A;  1DYQ A;  1SXT A;  4YHH Q;  3JC6 6;  4ZQ3 A;  4B3M L;  4NXM L;  5C3E G;  5IT9 E;  1K28 A;  1F9R A;  4OX9 Q;  3HKZ B;  4J1M A;  3HOY G;  2ICI A;  1TU2 B;  2NZ1 D;  3I55 A;  1WTV A;  2E5L L;  4GKK Q;  4NW2 A;  4A93 H;  3I4N G;  3F8T A;  1W2B A;  1HNZ L;  3J81 j;  5IP9 H;  4JBJ A;  4MN3 A;  4LJZ C;  2IL8 A;  3MVV A;  3JAM c;  3NTH A;  1U0L A;  1SJE D;  4JPB W;  4DK1 A;  2L1B A;  1UEA B;  2JA8 H;  2FMC A;  3CCU A;  1Y1W G;  4KN7 C;  3GTG B; 
#chains in the Genus database with same CATH homology
 3K81 C;  1WCM G;  1V43 A;  1KRT A;  4WJ4 A;  4DUZ Q;  5IWA L;  1IBL L;  4IFD G;  2JE6 I;  1I94 Q;  3RLO A;  4P72 A;  5ELO A;  5JJL A;  1X3E A;  2WAQ E;  4HJ9 A;  2V1C C;  3PUX A;  1Y1V H;  5DLQ E;  2F4V L;  2K50 A;  1E7Z A;  3U4V A;  1KRS A;  3CCM A;  1XPU A;  4DR7 Q;  3OTO Q;  1P8L A;  3HKS A;  3UDI A;  1OTC A;  1X6O A;  1K73 C;  2YTY A;  3AFP A;  2KBN A;  3FP9 A;  2Q2I A;  4R4Q A;  5FLM G;  4TVA B;  4HJ5 A;  4KHP Q;  1IL2 A;  2JA6 G;  1IBM Q;  3CCV A;  1JE5 A;  4A3G G;  2GVA A;  4DNI A;  1EOV A;  1VS0 A;  1E1T A;  4ME3 A;  1L0W A;  4BY1 G;  5FJ8 H;  4YY3 L;  3UDG A;  4A3D H;  4J15 A;  5LMN Q;  3UDX A;  4DV0 Q;  2Q2H A;  1JJ2 A;  4YWM A;  3IRB A;  4LF9 L;  2K5H A;  4IPG A;  1TWF H;  3EN2 A;  4IOC A;  2ATW A;  3PO2 H;  1SN8 A;  4KI0 A;  5IT9 c;  1K0R A;  1A8V A;  2UUA L;  1KXL A;  1FGU A;  2UXC L;  1XNQ Q;  4DV1 L;  4DUY L;  4A3C H;  1D8L A;  4H02 A;  2R7Z H;  1GD7 A;  2XTI A;  1J5E L;  2H5X A;  1K3R A;  4JI3 L;  1UWV A;  3KFU A;  3A5Z B;  2OQ0 A;  2KHJ A;  3TQY A;  4JG2 A;  4P71 A;  1AH9 A;  1Z47 A;  1Q12 A;  1KL9 A;  2K5N A;  3BZC A;  3VDY A;  4BXX H;  2F52 A;  2ZJR A;  3K80 C;  4DR4 Q;  1IYJ B;  4JI1 L;  2N49 A;  2R93 G;  2AKW B;  3UE0 A;  5C0X G;  1YZ6 A;  4BBR G;  1HNX L;  5JJI A;  2JA8 G;  3M4P A;  4JI0 L;  4FDB A;  3KF6 A;  1HR0 Q;  2MQH A;  3G4S A;  4DKA C;  2KCM A;  1JB7 A;  2CWP A;  4A3K H;  4LF7 Q;  1PVO A;  3CF5 A;  2I0Q A;  3S17 H;  1DGS A;  2N78 A;  4L5R C;  1GM5 A;  3BJU A;  4GN4 B;  4JYA Q;  2NN6 I;  4MTN A;  3KJP A;  1HNZ Q;  1CKN A;  3KOJ A;  4LFA L;  4JCV E;  4AYB G;  3GTL H;  2JJQ A;  5LMN W;  4A3J G;  1YBY A;  1I50 H;  5EAY A;  2E5L Q;  4GKK L;  2AWN A;  1CKM A;  4IJL A;  3M4Q A;  1L1O C;  4JI4 L;  4DV3 L;  1X9N A;  4A3L G;  3GTG H;  5GRO A;  2ZTC A;  2UU9 L;  1IBM L;  3PUW A;  5M5Y H;  4X65 L;  4LFC Q;  4K0K Q;  1TWG H;  2ZJP A;  2VNU D;  3STB D;  1PH9 A;  2ASB A;  3CCR A;  1FJG L;  1PYS B;  4QY7 A;  4DR3 Q;  2AHO B;  2PMZ E;  1XMO Q;  1U5K A;  4IFD I;  1H95 A;  3D31 A;  4BBS G;  4POF A;  4LF8 L;  4C3I H;  4ALP A;  1WJJ A;  5HY6 A;  2K14 A;  1I3Q H;  3NEM A;  4R4C A;  4YCV A;  4HJ8 A;  2OWO A;  2R92 G;  1N34 L;  4JI7 Q;  3M85 A;  4PG3 A;  1NMF A;  2NVQ H;  1PFS A;  4DUY Q;  3HKZ G;  2Q2U A;  3MXN B;  3EIV A;  3KF8 B;  3M7N A;  2A8V A;  1HZA A;  5FLM H;  3RLN A;  4LF4 Q;  3GTJ H;  4O0A A;  1E3P A;  1X3F A;  3K0X A;  2NZO A;  2ZTE A;  4GS3 A;  4OWT B;  1L2F A;  4DV4 Q;  4DV5 L;  4DR1 L;  4BY1 H;  3M3Y H;  3S2D H;  3F1Z A;  3CCL A;  3CP0 A;  1PH2 A;  1EUJ A;  4QGU A;  2MNA A;  4MNO A;  4UPA A;  4K0K L;  1KAW A;  2ID0 A;  1PH3 A;  2JA6 H;  2RHS B;  3RN2 A;  2NVX H;  2PI2 A;  2VQE L;  1VQM A;  2ZM6 Q;  4JI0 Q;  1TWH H;  2ES2 A;  2VUM H;  4JI4 Q;  4JI8 Q;  4AH6 A;  2B63 H;  3FKI H;  1E22 A;  5IP7 G;  4GNX A;  2K5V A;  1UE6 A;  3H3V I;  4LUO A;  2WB1 G;  1G6P A;  4X64 Q;  3PO3 G;  3OTO L;  4JI6 L;  4KLK A;  1Y1V G;  2Y0S G;  3ULP A;  1KHI A;  2VY3 A;  1M1K C;  2R92 H;  1YJN A;  4GNX C;  1K8G A;  1IBK Q;  4KHZ A;  4LF7 L;  1XMO L;  3K8A A;  2WB1 E;  4TQU S;  1PH8 A;  4AQY L;  1N9W A;  2Q2T A;  5C0X J;  4X64 L;  4LFC L;  1X3G A;  2R7D A;  4DV1 Q;  2UUC Q;  1X55 A;  4B3T L;  2IY5 B;  4YCW A;  1WYD A;  2YTX A;  4GLX A;  1KIX A;  4OO1 I;  4JBK A;  1YNX A;  1WI5 A;  1VCI A;  2ZM6 L;  2MFI A;  1JT8 A;  4RG1 A;  4O2D A;  4LF8 Q;  3HKZ E;  4QQB X;  4A3E H;  2VQF Q;  4IOA A;  4AIM A;  5GAH C;  3W1B A;  4A75 A;  3PUV A;  1HZC A;  3I4N H;  4DR3 L;  2QEX A;  4JI3 Q;  3KYH C;  1XMQ Q;  3U4Z A;  4RMF A;  4DV4 L;  4DV5 Q;  2B63 G;  4P73 A;  5M3M G;  5JJK A;  2GVB A;  4X65 Q;  1NY4 A;  3TS0 A;  2MO1 A;  2ZJQ A;  4B3S L;  1C9O A;  4GOP B;  4BBS H;  4DR2 L;  4DV2 L;  1XMQ L;  3E9I A;  1MIU A;  2D62 A;  2JQO A;  3CCS A;  2JA7 H;  4GLV B;  4P75 A;  4A3I H;  1Q81 C;  1S72 A;  2OQK A;  4OWX B;  3HOZ H;  2CCZ A;  3I7F A;  2AMC B;  3CD6 A;  4HJ7 A;  4UP7 A;  2E2J H;  4R4I A;  2I5L X;  4A4I A;  1JMC A;  2OTL A;  1M90 C;  3CQZ H;  1GO3 E;  1OXT A;  4JV5 L;  1N32 L;  1L1O B;  3CMA A;  5GAG C;  1PH1 A;  1VQ5 A;  4A3M G;  1MJC A;  3L2P A;  4LF6 L;  1J5E Q;  2I5H A;  4LUZ A;  5C44 H;  4P74 A;  4LUV A;  3S2H H;  1FJG Q;  1N36 L;  1Q1E A;  2BA1 A;  3AFQ A;  4GN5 A;  4DV6 L;  2YU9 H;  3AQQ A;  4LF6 Q;  3HOV G;  4LW1 A;  3S16 H;  2I5M X;  3TRZ A;  4DAY B;  3E0E A;  1VQL A;  4XIG S;  1K83 H;  1JJG A;  3NEL A;  4HID A;  1KQS A;  1G29 1;  4L5S A;  2PI2 E;  4DUZ L;  1IXR A;  4JI2 L;  4BY7 H;  1Q46 A;  3S1M H;  5LMN L;  2GN5 A;  4A3F H;  1QVC A;  3KDF A;  1XPO A;  3FKI G;  1YHQ A;  2JA5 H;  3UDF A;  3L0O A;  1HZ9 A;  1HZB A;  2VQF L;  3J81 i;  3A5U A;  4LF4 L;  3LGJ A;  1BKB A;  2JA9 A;  3S14 H;  2LXK A;  4DV2 Q;  1BBW A;  2HQL A;  2UUA Q;  4DV6 Q;  3HOU G;  3AEV A;  3D0F A;  4A3G H;  1LYL A;  1SRU A;  3UE1 A;  1EYG A;  1Q1B A;  2CQO A;  4A3F G;  2JA5 G;  4B3T Q;  2E8G A;  3S24 A;  4LF9 Q;  1UE1 A;  5LMU L;  1SR3 A;  2N3S A;  2NZH A;  1VQH A;  3RN5 A;  1X65 A;  1PH7 A;  1TXY A;  4DK6 C;  5IP7 H;  1VQG A;  3J81 c;  3HOZ G;  3J7Z C;  4DR4 L;  4A3C G;  4L5Q A;  4YY3 Q;  4C3H H;  1UE7 A;  3M9B A;  4A3K G;  3PO2 G;  4UY8 C;  3H3V H;  4X62 L;  1SMX A;  2E2H H;  5IYB H;  1XJV A;  5IY0 A;  3RZD H;  2EXD A;  3CPW A;  5C4X G;  3NEN A;  4JI7 L;  2UUC L;  1UE5 A;  1VQ9 A;  1QZH A;  2IHF A;  3CCJ A;  3U50 C;  4AYB E;  2HIX A;  2YYZ A;  4JI8 L;  1J6Q A;  1XNQ L;  2UXD Q;  1FL0 A;  1VQJ A;  4C2M H;  4DAM A;  5FJ8 G;  4IPH A;  2HHH Q;  4R4T A;  3HOX G;  1B8A A;  1MKH A;  3STB C;  3TEH B;  3A0J A;  1OXV A;  5M5W H;  3JAM i;  3T1Y L;  3S1N H;  2BH8 A;  2ALY B;  4DR1 Q;  2Z6K A;  1PH5 A;  4JI6 Q;  2EQS A;  2VUM G;  3Q8D A;  4R1J A;  3J80 c;  5C4X H;  1X56 A;  4A3B G;  4DR2 Q;  1D7Q A;  2CFM A;  4LFB Q;  4QIW E;  4B3S Q;  4XTC S;  2VQE Q;  4JI5 Q;  1VQ4 A;  3AYH B;  5JEA G;  1IZ6 A;  4DR6 Q;  1SRO A;  5M5X H;  1LM0 A;  4GN3 B;  3H0G H;  3J80 i;  4LWC A;  3PUY A;  3EBE A;  1I6H H;  4YHH L;  1NE3 A;  4L5T A;  3PCO B;  1L1O A;  3F2D A;  3CAM A;  3GTP H;  4IPD A;  1QUQ A;  4A3L H;  2IHE A;  1CUK A;  2L15 A;  4IPC A;  1PH6 A;  1YHB A;  3ER0 A;  4JBM A;  4OWW B;  3RZO H;  1EWI A;  3I2Z A;  3CW2 C;  2F3I A;  2R7F A;  1TWC H;  3DM3 A;  4JI1 Q;  2VS1 A;  5M3F G;  1HH2 P;  1VQ6 A;  5IP9 G;  2DGY A;  2AWO A;  4JC0 A;  1VQI A;  5K36 G;  1E24 A;  2FXQ A;  3F2C A;  4LFB L;  1MJE A;  2VL6 A;  1E1O A;  1BBU A;  1PYB A;  4IJH A;  3PIO A;  2IT1 A;  2K4K A;  1YJ9 A;  4LFA Q;  1P16 A;  3KLW A;  2IX0 A;  2QA4 A;  1C0A A;  4OON A;  1KC8 C;  1A62 A;  1B70 B;  4HIM A;  5BR8 L;  4BXX G;  1Q82 C;  5FLX c;  3DLL A;  3SGI A;  2R6G A;  3TS2 A;  4HJA A;  2UU9 Q;  4A3B H;  1PHJ A;  1VQ8 A;  4Y52 H;  4JBW A;  4DV3 Q;  2WP8 J;  1RIP A;  1T9H A;  5IYC H;  1WCM H;  5H1S E;  2JK8 A;  3MEF A;  3G6E A;  1PH4 A;  1K8A C;  2JA7 G;  1BVS A;  1NTG A;  3HOX H;  3CC7 A;  5C0X I;  3T1H Q;  4JYA L;  2D0P A;  3RLF A;  4B3R L;  1V9P A;  2ZTD A;  1YVC A;  4A3E G;  2HHH L;  1HJP A;  1CKO A;  1OXU A;  2BH2 A;  2RCN A;  2YTV A;  5ELN A;  4GOP C;  4IO9 A;  3ICE A;  2NVY H;  4HIO A;  1VQN A;  5C3E H;  1QVG A;  1AE3 A;  4X66 Q;  2F4V Q;  1N34 Q;  1B7Y B;  3KJO A;  4JV5 Q;  1WFQ A;  1QVF A;  2B3G A;  2UXC Q;  4NXN L;  2DUD A;  4LF5 L;  1VQB A;  3T1H L;  4B3R Q;  3HOV H;  3I56 A;  4BA1 I;  2R93 H;  3L7Z C;  4LF5 Q;  1OXX K;  3GTQ H;  4A3I G;  3PF5 A;  1SLJ A;  2KCT A;  5IYD H;  4UP8 A;  1YIT A;  3J7A 5;  3PO3 H;  4GKJ L;  2E2I H;  3I4M G;  2YV5 A;  3GTM H;  2OTJ A;  4JI5 L;  3PUZ A;  1EQR A;  2KHI A;  3ERS X;  3PGZ A;  5BR8 Q;  5M3M H;  2WFW A;  4GKJ Q;  2R7Z G;  1VQD A;  2JEB I;  2RHQ B;  2A1A A;  2A19 A;  3KDF B;  3CCQ A;  3M4O H;  4NXM Q;  2LXJ A;  1SFO H;  4EQ5 A;  3OYY A;  3S1Q H;  4BY7 G;  5IYB G;  3ZJY C;  1CKN B;  4EX5 A;  3G48 A;  5AJ3 Q;  3T1Y Q;  3TRE A;  3HOW H;  5GAD C;  4JOI A;  4GNX B;  2Z0S A;  1V1Q A;  3ULL A;  4DV7 L;  5HGQ A;  4MZ9 A;  4IFD J;  1K9M C;  5IWA Q;  4PZ8 A;  1IBL Q;  4C3J H;  4YWL A;  2UUB Q;  3RNU A;  4X66 L;  1Q86 C;  1EFW A;  3CC4 A;  3GDE A;  1G51 A;  4JOI C;  3HFZ B;  2VW9 A;  3PIP A;  1LTL A;  2D0O A;  3CPF A;  3CC2 A;  4A3M H;  4A93 G;  4OO1 G;  3WWV A;  1EIY B;  1Q8K A;  5C44 G;  2Z6K C;  4NPS A;  4YCU A;  3ULJ A;  3CXC A;  4A76 A;  1YJW A;  1X54 A;  4POG A;  2MO0 A;  4X62 Q;  2KEN A;  3BU2 A;  3OW2 A;  2WAQ G;  1N8R C;  1IBK L;  5GQO A;  2CKZ B;  4QJF A;  1C7Y A;  1HNW L;  3CCE A;  4DV7 Q;  4NXN Q;  4HIK A;  1RL2 A;  3HOW G;  3GD7 A;  4PMW A;  2B29 A;  4PZ6 A;  1NMG A;  1KD1 C;  4BBR H;  1UEB A;  5LMU Q;  1YIJ A;  1AE2 A;  2EIF A;  2HT1 A;  1N33 Q;  5IYD G;  5IYC G;  2CWA A;  2NVT H;  1TWA H;  2UXB L;  1YEZ A;  3NBH B;  1EIF A;  3E9H A;  4OXP A;  3S1R H;  1S40 A;  4KHP L;  1S3O A;  2RF4 A;  3U58 A;  1FVI A;  3BZK A;  2UXB Q;  2JEA I;  4UP9 A;  1PV4 A;  1VQE A;  4X6A H;  4DR7 L;  1XTD A;  2HIV A;  1XPR A;  1VQP A;  1PA6 A;  1VQF A;  3K7A H;  2VZA A;  1VQO A;  4DV0 L;  1QZG A;  4DPG A;  5M3F H;  3S15 H;  4DR6 L;  2Y0S E;  4GOP A;  1ASY A;  2UXD L;  3K7U C;  1HNW Q;  5JEA J;  5IE8 A;  3HOU H;  2PNH A;  3FHW A;  2NN6 G;  4GLA C;  1W3S A;  2QGQ A;  3G71 A;  1HNX Q;  3HOY H;  3I4M H;  2PQA B;  4NB3 A;  1XNR Q;  5GAE C;  1Y14 B;  2OCE A;  1JJC B;  5C4J H;  4AQY Q;  1A0I A;  2XGT A;  1QUQ B;  2UUB L;  1OXS C;  1N32 Q;  4DR5 L;  1VQA A;  1I5F A;  4DK3 C;  3GTK H;  4YHH Q;  1I94 L;  3PV0 A;  1LUZ A;  4DR5 Q;  5AJ3 L;  1YHA A;  2K52 A;  4YWK A;  3JC6 6;  3W5O A;  4LNQ A;  1VQK A;  4B3M L;  4NXM L;  1SE8 A;  5C3E G;  3I4O A;  1VQ7 A;  4OX9 Q;  3HOY G;  1XNR L;  1HR0 W;  4APV A;  2PQA A;  2LSS A;  3KF6 B;  4Y7N H;  1O7I A;  3I55 A;  1CSP A;  4PZ7 A;  2E5L L;  4GKK Q;  4A93 H;  3I4N G;  1NBW A;  1N33 L;  3PF4 A;  3F8T A;  3A74 A;  1W2B A;  4R4O A;  1HNZ L;  3RR5 A;  4JI2 Q;  2IX1 A;  3J81 j;  5IP9 H;  4JBJ A;  3H15 A;  1Q7Y C;  1ASZ A;  1GKH A;  4WJ3 M;  1Y1W H;  3F2B A;  3B6Y A;  4A3D G;  3W1G A;  1VQC A;  1WOC A;  3GO5 A;  1Z9F A;  3JAM c;  5E7N A;  3CME A;  1HR0 L;  1U0L A;  1NJI C;  5J3B A;  4BA2 I;  4QL5 A;  1CSQ A;  2C35 B;  1YI2 A;  3PSI A;  2N8N A;  1N36 Q;  1GVP A;  2JA8 H;  2BA0 A;  4A3J H;  2K75 A;  1EQQ A;  3CCU A;  1Y1W G;  1R9T H;  4OX9 L;  3GTO H;  4B3M Q;  1A63 A;  3H0G G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...