4JI2Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji2Q00
3CCVA 3J80i 1Q46A 2RCNA 3HKSA 1D8LA 2ZM6L 2N78A 4LFAL 4JOIC 2UUCQ 1YHBA 1FJGL 2JA6H 2R6GA 1Q86C 2YTXA 5FLMH 1U0LA 1EIFA 2IT1A 4LNQA 3HOWH 1U5KA 1XPUA 4BY7H 1KQSA 4BXXH 3K0XA 2JJQA 3PUZA 2OWOA 4X64L 1XNQL 1BBWA 2A19A 2BH8A 2VQFL 4JI0Q 4AH6A 2Q2UA 5IP9G 4DV4Q 2EIFA 5LMNW 2Q2TA 3CPFA 2E5LL 4R4OA 1EWIA 1V43A 4JBWA 1N34Q 1HNXL 4A4IA 1JT8A 3EBEA 5GAEC 3OYYA 4JCVE 1YBYA 1M90C 2A8VA 1SMXA 3BJUA 5HY6A 1Q8KA 2HIVA 3CPWA 4A76A 2MQHA 1IYJB 1QVGA 3B6YA 3S1QH 2WB1G 2PMZE 5DLQE 4JI6L 1IBKQ 4A3JH 3PO3H 1V9PA 4B3ML 1H95A 3W5OA 2OTJA 1RIPA 5C0XJ 3ZJYC 4DK3C 3D31A 1XMQQ 4IJLA 3I4OA 3PGZA 4Y7NH 2MO0A 2PQAB 3GO5A 3GTPH 2WAQG 2MFIA 4LFCL 4DV7L 3G4SA 1PH6A 3S16H 2ATWA 2UUBQ 4A3IG 4QGUA 4A3KH 1HJPA 3HOVH 1EOVA 1E1TA 2Z0SA 3J81j 1KHIA 1L2FA 2AWOA 3BZKA 3HOZH 4NXNL 4BY1G 1J5EL 4A3CH 5LMNL 2JA9A 3T1HQ 4TVAB 4YHHQ 1P16A 1KL9A 2VQEQ 4DNIA 3CCUA 2IHFA 4BBSH 4A3LG 2UXBQ 5FLMG 3HOWG 4HJAA 4BY7G 4JYAL 1K83H 4DV5Q 3CMAA 5IT9c 1A62A 3AEVA 1EYGA 3E9IA 2JE6I 1OXXK 5C44G 3HOYH 3K7AH 3KOJA 2UU9Q 4OO1G 1I6HH 2UXCL 5AJ3Q 1HNWQ 4JI1Q 1NE3A 1VQ5A 2F4VL 4WJ3M 2GVBA 3PV0A 3STBC 3PO2H 4GN4B 1HNZL 4A93H 3S1RH 1UE5A 5EAYA 3TQYA 4LF8Q 5ELNA 1PH1A 1EQQA 1JMCA 4OO1I 5H1SE 5BR8L 4DV2L 1VQ7A 4JBJA 4UY8C 4RG1A 1MIUA 1Z9FA 5M5YH 4A3JG 3PO3G 4YY3L 2RHQB 1PH8A 3U4VA 4DV0L 2C35B 1UE6A 3CXCA 1Y1WG 1VQEA 5C4XH 4JI2Q 4DR2L 4OX9L 2PQAA 3H15A 1VQKA 1SR3A 1GO3E 2OQKA 3CF5A 1BBUA 4HJ7A 2Q2IA 2CFMA 1ASZA 1YNXA 4A3KG 1NMFA 3HOXH 3HOVG 1Q1EA 4MZ9A 4AYBE 2JA8G 2BA1A 3ULJA 2F52A 1FGUA 4LFBQ 3H0GH 2HT1A 3HOZG 4X6AH 5IYBH 1PH4A 4A3CG 1VS0A 4QIWE 4B3SQ 1KXLA 4GNXA 4DPGA 2FXQA 5IP7H 3TEHB 4BBSG 2OCEA 3G6EA 4NXMQ 4A3DH 3H3VH 4R4QA 4HIMA 1X3FA 1GVPA 1T9HA 4O2DA 4A3GH 2ZJQA 1N34L 3CCMA 3HOYG 1PYSB 4YCWA 1EFWA 1A8VA 4JI3Q 2UXDL 3F8TA 2NVTH 1G51A 1K8GA 4A93G 3NENA 3J81c 3JAMi 3M85A 1TWGH 2YU9H 1AH9A 1K0RA 3J80c 3PF5A 1TWAH 4UP7A 1DGSA 1LTLA 4XIGS 4LF6Q 3RR5A 4NXML 2K4KA 1CKNB 4LF4Q 5M3MG 3FHWA 1CSQA 1VCIA 3KDFB 1E7ZA 3M4PA 4DK6C 3PUYA 5C0XG 3BU2A 2UUBL 1OXTA 1UE7A 4P71A 3S2HH 5C4XG 3PSIA 1YI2A 3BZCA 2PI2E 4DR6Q 2WP8J 1VQHA 3AFQA 2IX0A 1WFQA 3EIVA 4AQYQ 4DV1Q 5JEAJ 5C0XI 3OW2A 3HOXG 3PUWA 4DUZQ 2ZTDA 5C3EH 4Y52H 4GLVB 3K7UC 2VQEL 1EUJA 3H0GG 1N8RC 5IYBG 4GOPB 2KCMA 3KF8B 1SN8A 5IP7G 4JI7L 2A1AA 1B8AA 1Q7YC 4BBRH 5GQOA 4YWLA 4EX5A 2VY3A 4FDBA 2LSSA 2YTVA 2AMCB 4GKKQ 2Z6KA 2UU9L 1VQIA 4HIDA 4DAYB 2NZHA 1PHJA 1UE1A 2KHIA 4JI1L 3S2DH 4A3GG 4C3HH 2AKWB 1E24A 1XPRA 1WYDA 4ME3A 5M5WH 2N3SA 4LF8L 4UP8A 3H3VI 5HGQA 5JJKA 4XTCS 5GAGC 2JA7H 4X65L 1OXVA 1SE8A 2ZJPA 4POGA 4LUZA 2JA5G 3CP0A 1S3OA 4JBMA 2YV5A 4P75A 4DUYL 3I55A 2PNHA 4KHZA 3F2DA 1HR0W 4C3IH 1CKNA 5IYDH 4LF7Q 4JI2L 2CQOA 3KDFA 2QGQA 4JI8Q 1I5FA 1NJIC 1JJ2A 3HOUH 4L5SA 2OQ0A 1IBLQ 1XJVA 1I94L 1XNRL 2ZJRA 2R92H 2HHHQ 4DR3Q 2RHSB 1Y1VH 1EIYB 1K9MC 3F2BA 2KCTA 4POFA 3CC7A 4A3FH 3CCEA 3CCQA 1K8AC 4LF9Q 1N33Q 2B63H 1YHQA 3I4NH 4GNXB 5C3EG 1IXRA 3F1ZA 2BH2A 2JA6G 4JI5L 1A0IA 3U50C 3T1YQ 3CC2A 4R4TA 4DR1Q 3UDFA 3L7ZC 1PA6A 1C7YA 2Q2HA 3KFUA 4JG2A 4GOPA 4X62Q 4DV3Q 4BXXG 4GN5A 4BBRG 4QL5A 2XTIA 5IWAL 4IO9A 4HJ8A 1VQCA 1L1OB 2VW9A 4NB3A 1MKHA 4JI4Q 3K81C 1I50H 2NVQH 4B3TL 3E9HA 4LWCA 4GKJL 4DV6L 4QQBX 1PH9A 4IPDA 3OTOQ 3LGJA 3M9BA 5GROA 1HR0L 3HFZB 2ZM6Q 2XGTA 1E1OA 1TWFH 2JA7G 2ID0A 4LFAQ 4JV5Q 1NY4A 4LF6L 2K14A 3UDIA 2DUDA 4LF4L 4A3BH 1OXUA 1NTGA 4X66L 1KD1C 4LF5L 4APVA 1SRUA 4KI0A 3GTOH 1Q12A 1V1QA 3GTJH 5JJLA 3KJPA 1K3RA 4P74A 4X64Q 4A3MH 1QZGA 4B3RL 5IYDG 1XMOL 2H5XA 1PH5A 1WI5A 2I5LX 2VQFQ 2UUAQ 2CWAA 3CCRA 4DR5Q 3HOUG 4DR6L 5IE8A 2E5LQ 4OXPA 4ALPA 1VQOA 1JB7A 2R92G 1B7YB 1HNXQ 1Y1VG 1X65A 3UDGA 3RLNA 4DUZL 1IL2A 1PV4A 2JEAI 2UUCL 4A3FG 1B70B 3PIOA 2PI2A 1VQLA 1E22A 3DM3A 1WOCA 2B63G 5JEAG 3CAMA 2K52A 1TWCH 1P8LA 4JI6Q 4YWKA 1VQPA 4GKKL 1YIJA 4JI0L 3ICEA 3J7A5 3RLOA 4DV4L 1IZ6A 1W2BA 1HZAA 1LYLA 4GN3B 1S40A 2VUMH 2D62A 4A75A 4DV7Q 1L1OA 1VQMA 4LFCQ 1PVOA 1D7QA 1UEBA 1YJ9A 1EQRA 3J7ZC 2IHEA 1BVSA 2D0PA 2ASBA 4IFDI 3PF4A 3IRBA 3PO2G 4R4IA 1Z47A 3FKIH 1L0WA 5IYCH 1VQ4A 2R7FA 1IBKL 2QA4A 4PG3A 1N36Q 1FL0A 1JJGA 5M3FH 1W3SA 1YVCA 1J5EQ 2B3GA 1X56A 5LMNQ 1XMQL 1YHAA 1QZHA 2MO1A 1PH3A 3K8AA 4A3BG 3PIPA 1N9WA 5GADC 4DR4Q 4JI8L 2BA0A 1I3QH 5IP9H 1IBLL 4L5TA 3KLWA 1GKHA 3A5UA 4A3MG 1X55A 3GTLH 2JK8A 1TWHH 3F2CA 4AIMA 3S1MH 4DR3L 2R93H 2OTLA 2JEBI 4OWXB 2F4VQ 3UE1A 2L15A 3W1GA 2KHJA 2GVAA 2F3IA 1N33L 4RMFA 1UWVA 3OTOL 1VQJA 3U4ZA 3T1HL 1CUKA 2NN6G 2R7DA 4YHHL 5JJIA 3G48A 4LUVA 3TS2A 2UXBL 5BR8Q 2CKZB 1R9TH 1OXSC 2NVXH 1FVIA 4DV5L 1VQ9A 3KYHC 3GTMH 4X62L 4IFDJ 4HIKA 4OWTB 2NN6I 1QVFA 4A3DG 3Q8DA 4AYBG 3GDEA 1QUQB 5C4JH 1CSPA 2ES2A 2K5VA 2LXKA 2Z6KC 2LXJA 5AJ3L 1KC8C 1HNWL 2VZAA 4OX9Q 4DR2Q 2VNUD 2K75A 3GTKH 4OWWB 4NPSA 4BY1H 3AFPA 4JV5L 4JOIA 3FKIG 1SROA 5IYCG 4A3LH 4JBKA 4JC0A 1X3EA 2V1CC 5M3FG 1CKMA 1IBMQ 3VDYA 4K0KQ 4LW1A 3AQQA 1G6PA 2B29A 3NBHB 2ZTCA 3A74A 3S17H 3PUXA 5C44H 1PYBA 1VQBA 2UUAL 1YEZA 2GN5A 4DR5L 1VQFA 4P72A 3KF6B 3WWVA 3S24A 2I0QA 4PMWA 2CCZA 3ULPA 4R1JA 3TREA 1AE2A 1XTDA 4GLXA 2R93G 4QJFA 5LMUQ 4DR7Q 2UXDQ 2N8NA 2KENA 1RL2A 4EQ5A 3U58A 1YJWA 3GTQH 4LFBL 4HIOA 5E7NA 3KJOA 1JE5A 4B3SL 2DGYA 1HZ9A 1GM5A 4UP9A 4PZ6A 3ULLA 4A3EH 4H02A 1Y14B 4GOPC 3K80C 2K5HA 1O7IA 3D0FA 4UPAA 3UDXA 2Y0SE 2R7ZH 4IOCA 1Y1WH 3S15H 4KHPQ 4IPHA 3NEMA 1C9OA 1N32Q 1JJCB 1QUQA 4JI3L 3HKZE 4R4CA 2E2HH 1YITA 1SLJA 2MNAA 3SGIA 2CWPA 1WJJA 5M5XH 2JA8H 3TRZA 2K5NA 1N36L 1NMGA 1J6QA 5FLXc 2HQLA 2RF4A 4IPGA 3FP9A 2IY5B 1FJGQ 2EXDA 3I4MG 1S72A 4BA2I 3CD6A 1C0AA 1VQGA 3CCLA 3GTGH 3RZDH 4DR4L 2IX1A 1M1KC 5GAHC 4JI7Q 2K50A 3UE0A 1E3PA 3DLLA 4GS3A 1HZBA 1PFSA 3CCJA 1K73C 1XNQQ 1XPOA 2AWNA 3ER0A 1TXYA 3CW2C 3E0EA 3PCOB 2I5HA 2ZTEA 3KF6A 1QVCA 1KIXA 4AQYL 4DV1L 3NELA 3RZOH 1HH2P 4IPCA 4IOAA 3I56A 1X9NA 4OONA 4MNOA 1KRSA 2EQSA 1YJNA 3I4MH 3I4NG 3CMEA 4X65Q 3AYHB 4YWMA 2NVYH 4L5QA 3PUVA 4HJ5A 4GNXC 5M3MH 3JAMc 4B3MQ 4DUYQ 3I7FA 4DKAC 1Q81C 4A3EG 4IFDG 1X6OA 4IJHA 5FJ8H 2R7ZG 4J15A 1ASYA 4WJ4A 1WCMH 2ALYB 1YZ6A 4TQUS 1KRTA 4PZ8A 1VQ8A 1L1OC 1Q82C 1I94Q 1XNRQ 2D0OA 3S1NH 3JC66 3TS0A 3A5ZB 3CCSA 3STBD 1MJCA 3A0JA 2Y0SG 1LM0A 2VS1A 1OTCA 3M7NA 4NXNQ 1IBML 4K0KL 3HKZG 4HJ9A 1VQDA 3M4QA 1VQ6A 1Q1BA 3CC4A 4JI5Q 1KAWA 4PZ7A 4JYAQ 4LF7L 3M3YH 3L0OA 3G71A 1MJEA 2E2JH 2KBNA 1CKOA 2WB1E 4YCUA 1X54A 5IWAQ 1SFOH 2HHHL 4MTNA 4YCVA 4GLAC 2AHOB 5LMUL 4DR7L 2UXCQ 2YTYA 3MXNB 4B3TQ 1AE3A 3S14H 1A63A 5IY0A 3RNUA 1GD7A 2E8GA 1G291 3MEFA 1BKBA 4DV6Q 1PH2A 1NBWA 4LF9L 4GKJQ 5K36G 1X3GA 1HNZQ 1HR0Q 2JA5H 2WAQE 3M4OH 3T1YL 2WFWA 4QY7A 4DR1L 2NZOA 2YYZA 3CQZH 3EN2A 4P73A 4DV2Q 5ELOA 3RN2A 1VQAA 4O0AA 4DAMA 4DV3L 2I5MX 2VL6A 4KLKA 5J3BA 4X66Q 3I2ZA 4C3JH 4YY3Q 3RN5A 4LF5Q 4KHPL 3ERSX 1LUZA 4LUOA 4C2MH 4DV0Q 2E2IH 3W1BA 2JQOA 4BA1I 1N32L 5FJ8G 4JI4L 1VQNA 4B3RQ 1HZCA 3GD7A 4A3IH 1PH7A 4L5RC 2QEXA 1XMOQ 2HIXA 1WCMG 2VUMG 2N49A 3J81i 3L2PA 3RLFA
chains in the Genus database with same CATH superfamily
1HA6A 2RCNA 3HKSA 2RA4A 4F88A 2EYPA 3BYYB 3HRZC 4I7AA 5CORA 2ZM6L 4JW0A 1FJGL 4B9XA 2JA6H 4XDXA 2XIWA 1Q86C 4BY7H 1Y8NB 2IT1A 1E2ZA 4QCLA 1LTRD 1EEID 2E74C 4BXXH 2JJQA 3ZYYX 2OWOA 4X64L 5EKLA 2PZTA 3LX0A 1BBWA 1ILPA 4WJWA 2VQFL 4DV4Q 2EIFA 2B2YA 2E5LL 1V43A 4JBWA 1N34Q 2WB1B 3EBEA 5GAEC 4JCVE 2A8VA 1M90C 1ICWA 4C1NI 2K5DA 2WKCA 5I9OA 5DLQE 4IUUA 4C3JB 1IBKQ 1SMYD 1V1PB 2E2IB 5FLXE 1XMQQ 5ELCA 3NK9A 1GHKA 2MO0A 2WAQG 2MFIA 1PH6A 1E2VA 3G4SA 3S16H 2UUBQ 1ZEQX 1W6JA 1EOVA 3HOWB 3HOZH 3TP5A 2JA9A 4CDEC 1KL9A 3CCUA 1K83H 3AEVA 3QIAA 3E9IA 2F0FA 2X6GA 5IOCA 3K7AH 1VQ5A 1NE3A 4WJ3M 1MGSA 1JOQA 4KMUC 4K8IA 4A93H 3FPPA 1LT3D 1J9OA 5BR8L 4UY8C 2SNSA 4RG1A 1C8CA 1G6ZA 1WD0A 4FXKC 2JYOA 4YY3L 2XNAC 5FOBB 4DV0L 2R92B 1NR4A 1VQEA 4DR2L 3A56A 1DCZA 3H15A 1SR3A 1BBUA 1WTXA 2EE1A 3DXJC 4L6TB 4A3KG 5IGCA 1Q1EA 3EVQA 4LFBQ 1EIGA 1KABA 4X6AH 4K5VA 5JPNC 1VS0A 4QIWE 4B3SQ 1PLFA 5IP7H 2FXQA 4KD3A 3TEHB 4BBSG 5JJZA 3HOYB 1QJOA 2XRSD 1GVPA 2ZJQA 5EKIA 3PO2B 3CCMA 3TBIB 1EFWA 1B3AA 1IYVA 1I6VC 5BN3A 2D2CC 1GHJA 1WTHA 3F8TA 1K8GA 2F3VA 1BCPB 2E76C 3NENA 3NHHA 3JAMi 2JXMB 3BVMA 2MUYA 5G3LD 1VCIA 3KDFB 3M4PA 4QF4A 2FFKB 1WTWA 5EGTA 5TSSA 2WP8J 3EFXD 1WFQA 3EIVA 5JEAJ 3OW2A 1ENFA 2ZTDA 4DAPA 5C3EH 4GLVB 4IZ8A 3K7UC 1JWSD 1GUSA 4AYBB 1SN8A 4A3GB 2A1AA 1B8AA 1F9RA 5GQOA 4YWLA 4EX5A 3X3NA 4GKKQ 2UU9L 1VQIA 1PHJA 3ERQA 5FO7B 2RQXA 3NPPA 4JI1L 5CBEE 2AKWB 5CMDA 1XPRA 2YU9B 5M5WH 1TWGB 4LF8L 1NUCA 1ESFA 1T5EA 4ODGA 5JJKA 2JA7H 4X65L 4LUZA 2YV5A 4DAVA 3I55A 1TKWB 5J1ZA 2K05A 3NWTA 3S2HB 4RA8A 2EPBA 3JAML 3HOUH 5IT9E 3EROA 1IBLQ 4L5SA 2NWGA 1MSGA 4ZKCB 1WTRA 3HEJA 3Q0AA 2RHSB 4DR3Q 2O5IC 4POFA 3CC7A 1PDQA 2F0HA 5ELEA 4FXGC 4LF9Q 5A2QL 1BXTA 1S5BD 2BH2A 1A0IA 3P1HA 3TP7A 2DJFC 3I73A 3KFUA 1AEXA 3Q24A 4JG2A 4HR7B 4GN5A 4C3HB 3C1FA 1TS4A 4IO9A 4HJ8A 1TVXA 3GTKB 2NVQH 2OT2A 4QQBX 3N52A 1RTOA 2WINB 1U4PA 1OO9B 3OWEB 5GROA 2P5ZX 2ZM6Q 1E1OA 2I07B 3I91A 1NY4A 4C3IB 4KKUA 2LKVA 3OW7A 4APVA 4RKBA 1V1QA 3H09A 4P74A 4X64Q 4KK7A 4I7ZC 1Y1VB 5IYDG 1MHWC 1XMOL 2VQFQ 2UUAQ 2CWAA 3K5NA 3GTQB 5L37A 2E5LQ 4OXPA 3SK4A 1JB7A 2B63B 1B7YB 2R92G 2AQ2B 5FO8B 4R9WA 3UDGA 2NN6H 2UUCL 4A3FG 2L12A 3MXUA 4ZYSA 4A3EB 5JEAG 1RKNA 3DEPA 4MHEA 1YIJA 4JI0L 3ICEA 2B2TC 1HZAA 1S40A 2VUMH 1L1OA 3AB9A 4IFDI 5EBCA 1BVSA 1R4QB 3IRBA 3PO2G 1J8IA 2VB3X 1VQ4A 1AN8A 3GTOB 5M3FH 1YVCA 1M8AA 2B3GA 1YHAA 3MEHA 1LTAD 4V190 3K8AA 2SOBA 4DNRB 4JI8L 2O2LD 5C5MA 3DWPA 1I3QH 3GTLH 1GKHA 4A3MG 5A35A 1LT4D 2OTLA 2L15A 4F8MA 2GVAA 2F3IA 1N33L 4RMFA 2KCNA 3T1HL 2R7DA 5JJIA 4PQXA 3G48A 3TS2A 2UXBL 5BR8Q 2CKZB 4O42A 3T13A 2NVXH 1FVIA 1LO5D 3KYHC 1VQ9A 4X62L 2NN6I 4AYBG 3GDEA 5C4JH 1CSPA 3VYTA 2LXJA 5DEHA 5F2DA 4DR2Q 1MD2D 3VYRA 2VNUD 2PPBC 3C2PA 4NKLA 2K75A 4JOIA 4N9TA 1XXGA 2HD3A 4JBKA 2O5JC 1BCPC 2V1CC 1IBMQ 3VDYA 1SFOB 1PTOB 3NBHB 1H9KA 1KTKA 3DWQA 2I0QA 3KF6B 4PMWA 2CCZA 1SDFA 4R1JA 1TIID 3A55A 3BDLA 2B2VC 1AE2A 3TREA 4GLXA 4QJFA 5LMUQ 2N8NA 1YJWA 4V0BA 3SHLA 4RWSC 5I6YA 4H02A 1PFMA 3TP8A 4CKBA 4A3IB 2Y0SE 2R7ZH 3I3CA 4IOCA 5ISRA 5C3WA 3NEMA 4K5XA 4JI3L 4DK1A 2E2HH 4BY1B 4HTHA 4MTKA 1WJJA 5M5XH 1SEBD 5E1FA 3Q22A 2EYFA 3QG1A 1N36L 1NMGA 1J6QA 1CM9A 2RF4A 3J7AF 2RSNA 3S17B 5C44B 1VF5C 3K0YA 3KLRA 4UAIA 4L8JA 2K50A 3UE0A 3SEBA 1F2YA 1PFSA 3CCJA 3AMUA 1SJHD 3ER0A 2GA4B 3CW2C 5EKKA 1Q8IA 1QVCA 1KIXA 4AQYL 4DV1L 4IPCA 5K36H 3H6MA 3SK8A 1KRSA 3CMEA 1JOOA 4KN4C 4X65Q 2H4OA 1Y1WB 4UHVA 5CV7A 1GOZA 4H44C 1PZKD 4A3EG 1IL8A 1X6OA 1ENCA 3BG3A 5FJ8H 1EZ6A 4QUCA 3NQIA 2J0TD 1PTOD 2JA8B 4PZ8A 3E3XA 3W2DA 3S1NH 4TRDA 3A5ZB 4RH6A 5C4HA 2VS1A 2WIIB 2SDFA 1VQ6A 1KAWA 5CYUA 5DNFA 2F0TA 4JYAQ 1F2LA 4IALA 1ESRA 2WB1E 3RZOB 4ILWA 4MTNA 4YCVA 3K59A 4DR7L 2A69D 3I4MB 1EY6A 3MEFA 1BKBA 3KK7A 3VR5A 4ZLTF 4QY7A 4DR1L 4HSVA 4P73A 4DV2Q 1LTID 4FVMA 4KLKA 4DN4M 3I2ZA 4C3JH 2QILA 4RAUC 2E2IH 3W1BA 2PYKA 1GJXA 1BOSA 1PH7A 2QEXA 1XMOQ 1WCMG 2G9HD 3J81i 3OTOL 1F2MA 3J80i 1Q46A 2N78A 1DXMA 5DAUA 2UUCQ 2R6GA 1G91A 2YTXA 3HOWH 1EIFA 1KDAA 2NTSA 1XNQL 2A19A 4JI0Q 2Q2UA 2NVTB 2Q2TA 2E2DC 3DM1A 3BYTB 3CPFA 2TMPA 4QB4A 4B9WA 5J39A 5EPJA 3OYYA 3DUZA 3FMCA 3V2TA 2JA5B 1AZPA 2EYJA 1JB3A 1Q8KA 1TWAB 3CPWA 4QMGA 4X3KA 3PO3H 1H95A 3W5OA 1RIPA 2A68D 3ZJYC 2CQAA 3IL8A 2PQAB 3GO5A 3QOJA 2ATWA 4M1UB 4A3IG 2X6LA 1RHPA 4QGUA 1QNUA 1B53A 2KEEA 3HP3A 2AWOA 3BZKA 2NYZD 4BY1G 3T1HQ 1HA5A 4A3LG 2UXBQ 5FLMG 1STGA 3J81L 4HJAA 3CMAA 1EQTA 3S2DB 1TY2A 1A62A 4DA2A 2LY7A 4MIUA 1EYGA 3MWYW 5C44G 1PTOC 3HOYH 4PMCA 4OO1G 2F0MA 2UXCL 4K5WA 2F4VL 5DM63 1H9JA 3PO2H 5IODA 1HNZL 1UE5A 3TQYA 1H9RA 4JBJA 1SXTA 1MIUA 2CW0C 2K32A 1A2TA 4A3JG 3D6CA 1PMRA 3GTPB 2RHQB 4IUTA 1RF2D 5C0XH 2QCPX 4A3KB 1Y1WG 4JI2Q 1JQYD 2B2WC 4HJ7A 1F77A 2A69C 1EYDA 3H91A 3IFDA 1NMFA 3HOVG 4Z9CB 4MZ9A 4AYBE 2JA8G 2BA1A 2Q8RE 2F52A 3ULJA 4BBSB 1AW7A 2HT1A 1GXDC 1SYDA 5IYBH 4A3CG 1STBA 3P7JA 4BWGB 4DPGA 1I6HB 4RGTA 4A3GH 2QW7A 1NR2A 1GUTA 1PYSB 4YCWA 4EQNA 4JI3Q 3Q6SA 5JPMC 1PRTB 3CHBD 1G51A 2LS01 4CBVA 2YU9H 1WTVA 1TWGH 1U9RA 5G3LF 1O7ZA 2QDBA 4UP7A 1DGSA 4LF6Q 4NXML 3RR5A 2K4KA 1CKNB 1CSQA 2IX3A 4MN3A 1E7ZA 4DK6C 3PUYA 2EY1A 3A7AB 3BU2A 1ZYRD 3S2HH 5C4XG 4PV1C 1YI2A 4LJZC 4KKSA 2IX0A 3OIPA 4AQYQ 4DV1Q 5C0XI 3HOXG 4XYOA 2EXZA 4DUZQ 4S3SA 1A3UA 2VQEL 3H0GG 2QF7A 1IW7D 1HFGA 3U9SA 2F0DA 2Z6KA 4DAYB 1UE1A 2F0NA 4C3HH 1WYDA 4DF7A 5HGQA 3R93A 1CT1D 4POGA 2JA5G 3CP0A 4JBMA 4P75A 4QUFA 3F2DA 4C3IH 2RCFA 4C56C 4L63B 1I94L 1XNRL 3K5LA 4ULLA 1Y1VH 1EIYB 1IKLA 2KCTA 1B2TA 3IKJA 3GTMB 1K8AC 2B63H 1BCPF 1YHQA 1IXRA 3F1ZA 1PRTD 4G4KA 2EYHA 2CVRA 1C48A 4DR1Q 3UDFA 1PA6A 1GUGA 4JPBW 4GOPA 3FPUB 3LWUA 3KF8A 4BBRG 2B2UC 4QL5A 5IWAL 3D4RA 1MKHA 2KQ3A 4NB3A 3E9HA 1SYGA 2MPMA 4DV6L 1DZ1A 4XYQA 3OTOQ 2B39A 3T53B 1TWFH 1B9MA 2XRQD 2M00A 3UDIA 2DUDA 4LF4L 3HZXA 4LF5L 1SRUA 3GTOH 2EY5A 4B3RL 1KAAA 1PH5A 2H5XA 4DR6L 3CCRA 3V05A 4DR5Q 4A3FB 1DONA 2WACA 3NBIA 1VQOA 1W6KA 3A8IE 3I4NB 1B3QA 2L4NA 1X65A 1PV4A 1B70B 1K0SA 4Q5VA 1TU2B 2K52A 3D8GA 2X69A 1SJED 3DEOA 3J81E 1VDZA 1EFID 3C3LA 3J80E 1I50B 3R2TA 2EJMA 3RLOA 1TS3A 2PCFB 3GV3A 4HN7A 2NZ1D 1D7QA 1UEBA 1KNEA 2Z8LA 1G8ZD 1BQQT 2IHEA 3HKZB 4HEDA 2JSOA 4R4IA 5IYCH 2QA4A 3QO2A 3SK5A 1JJGA 3QJYA 1W3SA 3GTJB 1GUOA 2BE5D 1IW7C 4A3MB 3C46A 1A3VA 3NUCA 1PH3A 4A3BG 3PIPA 5GADC 2WV6D 2EDGA 3KLWA 2C9OA 1II3A 1PTOH 1TWHH 2O4XA 1LACA 4K2LA 2F4VQ 2RKSA 3UE1A 1YNND 2L55A 1QWYA 1UWVA 4LK1C 1VQJA 4EQPA 1Q3LA 4YHHL 2XWJB 1SMYC 1XX8A 4O1NA 4DV5L 1D5XC 4HCEA 4OWTB 1G2TA 1CK1A 1QUQB 4TKOB 2L9HA 3LNNA 2LXKA 5D3IB 5AJ3L 1HNWL 1QCBD 1RODA 2A5HA 4J6HA 2EY2A 4LAAA 4OWWB 2JP1A 4NPSA 5D14A 4BY1H 4JV5L 1PRTC 3D3RA 3FKIG 5IGEA 4A3LH 2HUGA 4JC0A 1F9SA 2RBMA 1CKMA 1S5ED 4K0KQ 4Q0FA 2E2JB 1FNUA 2N55A 2B29A 4ZUIA 1TS5A 3S17H 5C44H 3VYUA 1VQBA 1YEZA 2GN5A 3H94A 1VQFA 3DWAA 3NE5B 3WWVA 3S24A 2KCCA 2R93G 4RGNA 1RL2A 2PW5A 4OIKA 1R9TB 3HG9A 5CR3A 3KJOA 4NMZA 2AUJD 1YNJD 1GM5A 4C2MB 4KJNA 4NXMQ 4IFDH 2K5HA 1O7IA 4K6LA 1EEFD 2J4XA 1Y1WH 2EJFC 3OOCA 4IPHA 1N32Q 1JJCB 4X3SA 3OHXC 2CWPA 1SYBA 4KD4A 2JA8H 1X3PA 2K5NA 4BY7B 4DXGA 1K3BC 4K14A 5FLXc 2HQLA 5M9OA 1S5DD 1FJGQ 2EXDA 1S72A 1HUMA 4DR4L 2KOLA 3GV6A 1CQFA 1E3PA 3DLLA 1HZBA 1K73C 2HCIA 1I4HA 4ABNA 4B08A 2AWNA 2KHSA 2ZTEA 1TS2A 3Q23A 3NELA 3RZOH 5AFWA 4X3UA 3I56A 4RKLA 4OONA 4IUPA 1M4VA 3I4MH 3I4NG 3AYHB 4H13C 1D1IA 1L0XB 3PUVA 4HJ5A 3I7FA 1EY9A 4M8AA 4WRDA 4NDXA 1PTOF 3BDCA 1JC7A 1CI3M 4WJ4A 2ALYB 1XTCD 4TQUS 2PZUA 1VQ8A 1I94Q 1XNRQ 2M2LA 4OEMB 1BF4A 3STBD 5EPKA 3CRLC 4KTAA 1OTCA 3M7NA 3HKZG 1VQDA 3CC4A 2QKIC 4PZ7A 3L0OA 1PZID 1H9SA 4OELB 1CKOA 5IWAQ 1X54A 3I72A 2G9DA 1BNZA 1CTMA 1H9MA 1QB5D 1TR5A 2YTYA 1R4PB 5CV6A 5IY0A 1JE4A 3RNUA 1GD7A 1G291 4DV6Q 2NVYB 1NBWA 1X3GA 2JA5H 2WAQE 4PMBA 2WFWA 1B44D 2YYZA 3CQZH 3RN2A 5ELOA 4DAMA 1U4LA 2I5MX 3TN2A 5J3BA 1WCMB 4YY3Q 4LF5Q 3G6JB 5ELBA 4KHPL 4DV0Q 3BVGA 2MP1A 1VQNA 4FF1A 1BUVT 3HS0C 4B3RQ 3DMUA 4FNFA 2M9VA 3OWFA 3L2PA 1C4QA 1WTOA 4HCSA 3CCVA 1B9NA 1ET6A 2EOTA 4EQOA 3IAYA 1D8LA 3BVZA 1QG7A 4K8JA 2Z4IA 1U5KA 2N88A 4RFBA 1STYA 1KQSA 2KVMA 1F9PA 3K0XA 3PUZA 1SE4A 1D5MC 4G57A 1I4XA 3S14B 5LMNW 5FKAC 1YBYA 1SMXA 5HY6A 4K2KA 3MXNA 4IUQA 4A76A 2MQHA 1Y8PB 1QVGA 3B6YA 3I70A 1RCVD 2K5QA 1V9PA 4B3ML 2OTJA 2L5TA 4J1MA 1KDBA 3D31A 4IJLA 2FHTA 3I4OA 1NCVA 5NUCA 2D5DA 3PGZA 1JCKB 5FO9B 3GTPH 3MZ5A 1Z6HA 5E4WC 5C3EB 4A3KH 1EY4A 3SXHA 1E1TA 3J81j 1KHIA 4NXNL 5ELFA 1J5EL 5LMNL 4TVAB 4YHHQ 1P16A 5KRUA 4BBSH 2CH4A 4BY7G 4DV5Q 4KY6A 2K1BA 5IT9c 2JE6I 3JAME 3KOJA 3RUZA 4ZKBB 2UU9Q 4FF2A 1I6HH 5AJ3Q 1HNWQ 1I4GA 4JI1Q 2JA7B 2GVBA 3PV0A 4KHVA 3VR4A 3S1QB 3STBC 3GQBA 4KY7A 1HTLD 4GN4B 3M4YA 4NP5A 5JOBA 5EAYA 3S1RH 4A3JB 4LF8Q 2K03A 1EQQA 1JMCA 5A2QE 1RD9D 5EQ0A 5I2XA 5H1SE 1VQ7A 5M5YH 4Y7NB 2PMZB 3HOUB 1V1PA 2DN8A 1VMCA 4N9PA 3HOVB 4U673 3CF5A 1GO3E 4FP5D 2Q2IA 1ASZA 1YNXA 2SNMA 1FGUA 1ZKOA 3HOZG 1SNOA 1HCZA 5KNCA 3X3MA 1DM0B 1WTPA 4UDUC 3L9AX 2B2TA 4R4QA 4HIMA 1X3FA 2RDHA 4O2DA 4K6DA 3MFYA 5CGKA 1N34L 5IGDA 3L3OC 2UXDL 1A2UA 2BCOA 4A93G 1AH9A 1LTSD 2PO4A 2H1EA 1LTLA 4XIGS 1EWHA 1FGBD 2A6ED 1GUNA 5C4XB 1LABA 1CA5A 1O7LA 2UUBL 1OXTA 1UE7A 3HOXB 3PSIA 3BDOA 2PI2E 3H0GB 1VQHA 3PUWA 1D2BA 1HPCA 4A3DB 1EUJA 1N8RC 2KEDA 3T16A 5IP7G 5FLXL 1EY7A 3BZDB 2VY3A 4FDBA 2FINB 2LSSA 1AP0A 1WVLA 2NZHA 2ICIA 2F0JA 2IJ0A 2B2YC 1EIHA 3FVQA 1EQVA 4UP8A 3DHQA 1U4MA 4XT3B 2MJ8A 4RHSA 4XTCS 1E0BA 3K5OA 1SE8A 1DD2A 1UNSA 1S3OA 4CJ1B 1MSHA 4DUYL 3GTLB 2PNHA 3D6WA 1HR0W 2JN4A 5IYDH 1PFBA 3KDFA 4JI8Q 4ZQ3A 1F2ZA 2ZJRA 3VA7A 2R92H 2B2VA 2OXPA 4G7HC 1PYWD 4H7BA 3F2BA 3ND8A 3P75A 1FNWA 4A3FH 2K7VA 3OSOA 3CCQA 1N33Q 3I4NH 5JEAH 4GNXB 5C3EG 4BBRB 4EGVA 1BR9A 3MVVA 3L7ZC 5C4JB 1C7YA 2Q2HA 2XN9C 3OMGA 2BDOA 4H0LC 4X62Q 1I4PA 5EBDA 1LT6D 2XTIA 4I65A 1FR3A 1VF7A 1L1OB 1VQCA 4N8FA 1G2SA 2VW9A 1A6XA 1I50H 5E3FA 1LLRD 4B3TL 2L1BA 4LWCA 1JWMD 5C6AA 4ZRZA 4IPDA 4OL7A 3LGJA 3M9BA 3EA6A 1HR0L 3HFZB 3RMHA 2JA7G 3E0JA 2ENBA 1V1OA 4R8NA 1OXUA 1NTGA 1UUPA 1Q12A 3NTKA 3GTJH 1K3RA 4A3MH 3TZDA 3VR6A 1WI5A 2I5LX 4N8X1 3HOUG 4ALPA 3MA2B 1TT2A 3TSSA 1EZ8A 3RLNA 4DK0A 2JEAI 1KDCA 3PIOA 1VQLA 3DM3A 1WOCA 1UAPA 3CAMA 1EWCA 1P8LA 1TQOA 1DJRD 5BN5A 1VQPA 5KNBA 3QOLA 4GKKL 3J7A5 1IZ6A 1W2BA 2F3WA 3HGBA 4GN3B 1BBXC 1QOHA 1HTPA 1LTTD 4A75A 1PVOA 3M7GA 3KLSX 1YJ9A 2D0PA 2ASBA 3PF4A 4A3BB 1L0WA 4OGQC 5CC4A 4PG3A 1N36Q 1J5EQ 1V8QA 1X32A 5LMNQ 4KJOA 2MO1A 1I4RA 1N9WA 5I9PA 1IBLL 1UEAB 1X55A 4FYDA 5D65A 5CV4A 3RD4A 5I2YA 4DR3L 2F0PA 3PIP3 1STAA 3S9WA 4HMIA 1JICA 1TWCB 2MHVA 4RGOS 2NUCA 3K6OA 3U4ZA 2NN6G 2A73B 2AUKA 1R9TH 2A68C 5LL6S 4GZYC 4HIKA 4A3DG 2NB0A 2K5VA 2L0CA 2EYOA 3K58A 4CDCC 2VZAA 3FKIB 1B1ZA 3K5MA 3A8KE 3GTKH 1B4OA 4DFAA 4XQNA 1WD1A 1RTNA 3NQTA 1X3EA 5M3FG 2XWBB 3TMEA 1G6PA 3S1MB 3ITPA 2F0WA 3PUXA 2R93B 2UUAL 2QDLA 1EYCA 2UXDQ 1PZJD 4DR7Q 1KLUD 2KENA 3GTQH 5T1IA 3O13A 1JE5A 1HZ9A 4U68A 1S5CD 2B8FA 4UP9A 3NTIA 4PZ6A 3T51B 3ULLA 4A3EH 1A3TA 1D1KA 1Y14B 4IQZA 5E4XA 3UDXA 3D0FA 4UPAA 1S5FD 1A15A 3H3VC 2F0GA 1HQRD 1C9OA 1SLJA 2EYMA 5CV9A 1MI2A 1STNA 4IPGA 3QWNA 3FP9A 4CGYB 2IY5B 2A6HD 4J8QA 3CD6A 5T1GA 2WKDA 1VQGA 3CCLA 3ND9A 2IX1A 5GAHC 4ZAIA 3NBHA 4C1NK 1XNQQ 2Z6BA 3PCOB 1TXYA 2Z4HA 3E0EA 1QILA 5CV5A 3KF6A 2IL8A 2RDGA 1SE3A 1EY0A 3PO3B 4MNOA 3PMFA 3MAQA 2EQSA 1BO0A 1E2WA 2PZWA 2NVYH 3S15B 4GNXC 1HFNA 1GUWA 4DUYQ 4RHRA 4F7XA 4IJHA 1ZYRC 2XSCA 2BOSA 2R7ZG 2SEBD 3EQLC 1WCMH 2B2WA 4ID6A 1SNDA 1L1OC 3JC66 2EVBA 3TS0A 3R8BA 1D6EC 3A0JA 2Y0SG 3GTGB 3RZDB 1IBML 5C4ZA 3E5SA 4HJ9A 3M4QA 4KN7C 1LTGD 4XT1B 4LF7L 2IPKD 2CHBD 1MJEA 3MXGA 1SFOH 2HHHL 2I46A 4GLAC 4CHTB 2AHOB 5LMUL 2UXCQ 4B3TQ 3A54A 1AE3A 3S14H 1ICFB 1NSNS 2ZT9C 3MC0B 1QE6A 1PH2A 1LTBD 5K36G 1HNZQ 1HR0Q 5M3MB 2F0IA 3T1YL 1I4QA 3SK6A 3NWSA 2NZOA 1EU3A 3EN2A 1VQAA 4O0AA 4FF3A 4DV3L 1NNXA 1LUZA 1VMPA 4BA1I 2JQOA 3FDTA 5FJ8G 4JI4L 3GD7A 4A3IH 2VXWA 4L5RC 3UI2A 5C3XA 2N49A 4IUVA 2DNCA 3VR3A 2EY6A 4LFAL 4RGMA 4JOIC 1YHBA 2EJGC 3M3YB 4G7ZC 5FLMH 1U0LA 2F0KA 4KKTA 4LNQA 1XPUA 4BS9A 2R61A 2AQ3B 5COYA 2LFNA 2PQEA 1HHVA 1TY0A 1ML0D 4OHJA 2BH8A 1CZWA 2F0OA 4AH6A 4OO1H 5IP9G 4R4OA 3N6RA 1EWIA 1HNXL 3W3AA 3A8JE 4A4IA 1JT8A 5LHY1 3M4OB 3BJUA 4XQJA 4LMQD 2V4DA 1EYAA 2HIVA 4TSSA 1IKMA 1IYJB 3S1QH 2WB1G 2A6HC 2PMZE 4JI6L 1SE2A 4A3JH 4YIJA 5C0XJ 4DK3C 1ET9A 2CH4W 3R2IA 4C3JG 4Y7NH 1SBBB 3TP6A 4LFCL 4DV7L 3NSWA 1HJPA 2FJ2A 3HOVH 2JA6B 2Z0SA 5KNDA 1L2FA 1HQMC 2Q8TA 2RVLA 4A3CH 2B8GA 2VQEQ 1JORA 4DNIA 5KEEA 2IHFA 1BCPD 2F4IA 3HOWG 4JYAL 1X3QA 2DY8A 3FRPB 1U4RA 1Z7TA 3ONAB 2B2UA 1O78A 2K5WA 1HUNA 1KNAA 1OXXK 1K8OA 4DNTB 1SNCA 5CV8A 4DU9A 1ILQA 3D4WA 5ELNA 4ZCKA 1PH1A 4OO1I 4DV2L 2BE5C 2HDMA 3K57A 1Z9FA 4OIJA 1PFNA 3PO3G 3E6ZX 2ZXPA 1PH8A 3CKIB 3U4VA 5BN4A 4DGZA 3S16B 2C35B 1UE6A 3CXCA 4JVZA 4RCOA 4HSPA 5C4XH 4OX9L 1CHPD 2PQAA 1VQKA 1FNVA 2OQKA 3NTHA 1Y69U 3HOZB 3T56B 1YNNC 2CFMA 5K5PA 3HOXH 1AZQA 1SSOA 2DJGC 1K83B 3H0GH 3R3OA 1PH4A 2F0LA 1KXLA 4GNXA 2OCEA 3G6EA 3K7AB 4A3DH 3H3VH 1SNMA 1T9HA 3HOYG 4A93B 1LV9A 1A8VA 2NVTH 1TWFB 3AU7A 3I90A 5J22A 1CA6A 2LMCB 3J81c 1CZGA 2J7ZA 3VYSA 3M85A 1K0RA 3J80c 3PF5A 1TWAH 1ENAA 3GP7A 4ME5A 1T5XD 4LF4Q 5M3MG 3FHWA 2L11A 1ZXTA 5C0XG 3IFTA 3WOFA 4P71A 3BZCA 4DR6Q 3C1EA 3AFQA 5DM73 4RCNA 3TZUA 4CDDC 1YNJC 2K01A 4Y52H 2K6AA 1Q90A 3D4DA 5IYBG 4GOPB 2KCMA 3KF8B 4JI7L 1Q7YC 4QIWB 4BBRH 2YTVA 2AMCB 4HIDA 4A3GG 2KHIA 3S2DH 5JVH3 4CJ2C 1E24A 2F03A 4ME3A 2N3SA 3H3VI 2K28A 5GAGC 4R8IA 1OXVA 2ZJPA 4KHZA 1SYFA 1TWHB 3KBGA 2OEOA 2NTTA 2HDLA 1CKNA 4LF7Q 2ZXRA 4JI2L 1B50A 2CQOA 2F0EA 2FMCA 2QGQA 1I5FA 2Q8IB 5HURA 1NJIC 1JJ2A 1STHA 2OQ0A 1XJVA 4IN3A 2HHHQ 4CKEA 5HGTA 1CHQD 1K9MC 1MBYA 5IGGA 4HAEA 2F1MA 3CCEA 4F87A 1BDOA 3P20A 2JA6G 3KLSA 4JI5L 2DNEA 3U50C 3T1YQ 3CC2A 4R4TA 4DV3Q 4BXXG 4IUNA 2F0UA 4G7OC 4CDFC 5IIFA 3BS1A 5M5WB 3QR8A 3MTSA 3K81C 4XXEA 4JI4Q 4DAYA 4C3HG 1RDPD 5C5LA 4GKJL 1PH9A 3QB3A 4FO2A 1EU4A 1STEA 3I8ZA 2XGTA 4JV5Q 2ID0A 4LFAQ 3TDQA 4LF6L 2K14A 5IGFA 2IWHA 4A3BH 1KD1C 4X66L 3MFGA 4KI0A 5JJLA 1EOTA 3KJPA 2XVSA 4C3IG 1QZGA 5LL6X 1XWEA 3SE0A 1SNQA 5IE8A 4WORA 1ONLA 5EJWA 2HCCA 1HNXQ 1Y1VG 1PXUA 4DUZL 1IL2A 1DOMA 2D9UA 2PI2A 1E22A 2B63G 5KIXA 1TWCH 5JAVA 2KUMA 1LT5D 1QNKA 1JOKA 4JI6Q 2A74C 4CJ0B 4YWKA 2EYLA 4ZK9B 3PIO3 1SYCA 2NVQB 2NBFA 4DV4L 1LYLA 5I4DA 2F0QA 2D62A 4DV7Q 4LFCQ 1VQMA 1EQRA 2VB2X 4ZUJA 3J7ZC 2F0VA 1Z47A 3FKIH 1K8MA 2QEJC 2R7FA 1IBKL 1FL0A 1X56A 1XMQL 1QZHA 1IHZA 2CW0D 1XYIA 3CU7A 2RSOA 4DR4Q 1K28A 4PNYA 2BA0A 2G5DA 5IP9H 4L5TA 2Z1CA 3A5UA 3NXWA 2JK8A 3F2CA 3WOEA 4AIMA 3SVMA 3S1MH 3VA5A 1SAPA 2R93H 1F9QA 2JEBI 2IW3A 4OWXB 3W1GA 2KHJA 1RJTA 1CUKA 4LUVA 2OF1A 1OXSC 4IFDJ 3GTMH 2KECA 4FXDA 5I6WA 2VUMB 1QVFA 3Q8DA 4HMJA 4E6IA 2ES2A 4XQQA 2Z6KC 1KC8C 3J7AV 4OX9Q 2KJXA 3OIQA 3OMCA 2E75C 2F0SA 5EPLA 5M3FB 3AFPA 4NW2A 1EL0A 3V96A 1SROA 5IYCG 5IGBA 1I3QB 4LW1A 3AQQA 1JWUD 2K04A 5KGUA 2ZTCA 3A74A 1PYBA 1DOKA 4DR5L 4P72A 3URYA 3ULPA 4X3TA 1JR0D 1XTDA 1FD7D 3CRKC 3CQZB 4EQ5A 1PRTF 3U58A 4LFBL 4JK1C 2NVXB 4HIOA 3A7LA 5E7NA 4B3SL 2DGYA 4WFN3 3NP8A 2AQ1B 5KYLA 1WTQA 1IYUA 1FYCA 2WAQB 1EY8A 2PNRC 4GOPC 3K80C 4KY5A 3WDNA 3S15H 2HQEA 4KHPQ 1SNPA 1QUQA 3HKZE 4R4CA 5ELDA 1YITA 2KA7A 3OPOA 4KV6A 2MNAA 4IURA 3SGIA 3TRZA 3U9OA 2EZVA 1HXYD 3PQIA 3G7LA 4BA2I 1Y8OB 1C0AA 3GTGH 3RZDH 1M1KC 2DY7A 1H9SB 3J80L 4JI7Q 1CFMA 1DOLA 2C5CA 4GS3A 4EVOA 2Z9HA 1XPOA 3MXPA 2I5HA 2K33A 2RDFA 1HH2P 1O80A 1O7YA 2ZXOA 4IOAA 1X9NA 1YJNA 1KLGD 4YWMA 2A6EC 4L5QA 4DXFA 2R7ZB 5M3MH 3JAMc 4B3MQ 4DKAC 1Q81C 2ICEC 4IFDG 2E2HB 4J15A 1ASYA 5M5XB 2PW7A 2Y0SB 1YZ6A 1KRTA 5KYIA 3EJIA 1Q82C 2D0OA 5D3DA 3CCSA 5FK9C 1MJCA 2TSSA 1LM0A 3LWEA 4NXNQ 3SDZA 1AFPA 5CBAE 4K0KL 2R3ZA 1Q1BA 1S4ZA 4JI5Q 1DYQA 1L0YB 3M3YH 3G71A 1SYEA 2FMMA 5JVG3 2KBNA 2E2JH 4YCUA 3J7YW 3SR1A 3KBXA 3S1RB 1NAPA 1A63A 3MXNB 4FF4A 2E8GA 4GKJQ 3KUPA 4LF9L 5M5YB 1D5ZC 3T4AC 3M4OH 3I4MG 3MHBA 4P2CB 3FEWX 4CKCA 2MGSA 2VL6A 4X66Q 3RN5A 3ERSX 4LUOA 4C2MH 1N32L 1HRJA 3S1NB 2BDNA 1HZCA 3I4LA 5IT9L 2HIXA 3F2UA 2VUMG 3VR2A 1EY5A 3RLFA 1CQVA
chains in the Genus database with same CATH topology
3CCVA 3J80i 1Q46A 2RCNA 3HKSA 1D8LA 2ZM6L 2N78A 4LFAL 4JOIC 2UUCQ 1YHBA 1FJGL 2JA6H 2R6GA 1Q86C 2YTXA 5FLMH 1U0LA 1EIFA 2IT1A 4LNQA 3HOWH 1U5KA 1XPUA 4BY7H 1KQSA 4BXXH 3K0XA 2JJQA 3PUZA 2OWOA 4X64L 1XNQL 1BBWA 2A19A 2BH8A 2VQFL 4JI0Q 4AH6A 2Q2UA 5IP9G 4DV4Q 2EIFA 5LMNW 2Q2TA 3CPFA 2E5LL 4R4OA 1EWIA 1V43A 4JBWA 1N34Q 1HNXL 4A4IA 1JT8A 3EBEA 5GAEC 3OYYA 4JCVE 1YBYA 1M90C 2A8VA 1SMXA 3BJUA 5HY6A 1Q8KA 2HIVA 3CPWA 4A76A 2MQHA 1IYJB 1QVGA 3B6YA 3S1QH 2WB1G 2PMZE 5DLQE 4JI6L 1IBKQ 4A3JH 3PO3H 1V9PA 4B3ML 1H95A 3W5OA 2OTJA 1RIPA 5C0XJ 3ZJYC 4DK3C 3D31A 1XMQQ 4IJLA 3I4OA 3PGZA 4Y7NH 2MO0A 2PQAB 3GO5A 3GTPH 2WAQG 2MFIA 4LFCL 4DV7L 3G4SA 1PH6A 3S16H 2ATWA 2UUBQ 4A3IG 4QGUA 4A3KH 1HJPA 3HOVH 1EOVA 1E1TA 2Z0SA 3J81j 1KHIA 1L2FA 2AWOA 3BZKA 3HOZH 4NXNL 4BY1G 1J5EL 4A3CH 5LMNL 2JA9A 3T1HQ 4TVAB 4YHHQ 1P16A 1KL9A 2VQEQ 4DNIA 3CCUA 2IHFA 4BBSH 4A3LG 2UXBQ 5FLMG 3HOWG 4HJAA 4BY7G 4JYAL 1K83H 4DV5Q 3CMAA 5IT9c 1A62A 3AEVA 1EYGA 3E9IA 2JE6I 1OXXK 5C44G 3HOYH 3K7AH 3KOJA 2UU9Q 4OO1G 1I6HH 2UXCL 5AJ3Q 1HNWQ 4JI1Q 1NE3A 1VQ5A 2F4VL 4WJ3M 2GVBA 3PV0A 3STBC 3PO2H 4GN4B 1HNZL 4A93H 3S1RH 1UE5A 5EAYA 3TQYA 4LF8Q 5ELNA 1PH1A 1EQQA 1JMCA 4OO1I 5H1SE 5BR8L 4DV2L 1VQ7A 4JBJA 4UY8C 4RG1A 1MIUA 1Z9FA 5M5YH 4A3JG 3PO3G 4YY3L 2RHQB 1PH8A 3U4VA 4DV0L 2C35B 1UE6A 3CXCA 1Y1WG 1VQEA 5C4XH 4JI2Q 4DR2L 4OX9L 2PQAA 3H15A 1VQKA 1SR3A 1GO3E 2OQKA 3CF5A 1BBUA 4HJ7A 2Q2IA 2CFMA 1ASZA 1YNXA 4A3KG 1NMFA 3HOXH 3HOVG 1Q1EA 4MZ9A 4AYBE 2JA8G 2BA1A 3ULJA 2F52A 1FGUA 4LFBQ 3H0GH 2HT1A 3HOZG 4X6AH 5IYBH 1PH4A 4A3CG 1VS0A 4QIWE 4B3SQ 1KXLA 4GNXA 4DPGA 2FXQA 5IP7H 3TEHB 4BBSG 2OCEA 3G6EA 4NXMQ 4A3DH 3H3VH 4R4QA 4HIMA 1X3FA 1GVPA 1T9HA 4O2DA 4A3GH 2ZJQA 1N34L 3CCMA 3HOYG 1PYSB 4YCWA 1EFWA 1A8VA 4JI3Q 2UXDL 3F8TA 2NVTH 1G51A 1K8GA 4A93G 3NENA 3J81c 3JAMi 3M85A 1TWGH 2YU9H 1AH9A 1K0RA 3J80c 3PF5A 1TWAH 4UP7A 1DGSA 1LTLA 4XIGS 4LF6Q 3RR5A 4NXML 2K4KA 1CKNB 4LF4Q 5M3MG 3FHWA 1CSQA 1VCIA 3KDFB 1E7ZA 3M4PA 4DK6C 3PUYA 5C0XG 3BU2A 2UUBL 1OXTA 1UE7A 4P71A 3S2HH 5C4XG 3PSIA 1YI2A 3BZCA 2PI2E 4DR6Q 2WP8J 1VQHA 3AFQA 2IX0A 1WFQA 3EIVA 4AQYQ 4DV1Q 5JEAJ 5C0XI 3OW2A 3HOXG 3PUWA 4DUZQ 2ZTDA 5C3EH 4Y52H 4GLVB 3K7UC 2VQEL 1EUJA 3H0GG 1N8RC 5IYBG 4GOPB 2KCMA 3KF8B 1SN8A 5IP7G 4JI7L 2A1AA 1B8AA 1Q7YC 4BBRH 5GQOA 4YWLA 4EX5A 2VY3A 4FDBA 2LSSA 2YTVA 2AMCB 4GKKQ 2Z6KA 2UU9L 1VQIA 4HIDA 4DAYB 2NZHA 1PHJA 1UE1A 2KHIA 4JI1L 3S2DH 4A3GG 4C3HH 2AKWB 1E24A 1XPRA 1WYDA 4ME3A 5M5WH 2N3SA 4LF8L 4UP8A 3H3VI 5HGQA 5JJKA 4XTCS 5GAGC 2JA7H 4X65L 1OXVA 1SE8A 2ZJPA 4POGA 4LUZA 2JA5G 3CP0A 1S3OA 4JBMA 2YV5A 4P75A 4DUYL 3I55A 2PNHA 4KHZA 3F2DA 1HR0W 4C3IH 1CKNA 5IYDH 4LF7Q 4JI2L 2CQOA 3KDFA 2QGQA 4JI8Q 1I5FA 1NJIC 1JJ2A 3HOUH 4L5SA 2OQ0A 1IBLQ 1XJVA 1I94L 1XNRL 2ZJRA 2R92H 2HHHQ 4DR3Q 2RHSB 1Y1VH 1EIYB 1K9MC 3F2BA 2KCTA 4POFA 3CC7A 4A3FH 3CCEA 3CCQA 1K8AC 4LF9Q 1N33Q 2B63H 1YHQA 3I4NH 4GNXB 5C3EG 1IXRA 3F1ZA 2BH2A 2JA6G 4JI5L 1A0IA 3U50C 3T1YQ 3CC2A 4R4TA 4DR1Q 3UDFA 3L7ZC 1PA6A 1C7YA 2Q2HA 3KFUA 4JG2A 4GOPA 4X62Q 4DV3Q 4BXXG 4GN5A 4BBRG 4QL5A 2XTIA 5IWAL 4IO9A 4HJ8A 1VQCA 1L1OB 2VW9A 4NB3A 1MKHA 4JI4Q 3K81C 1I50H 2NVQH 4B3TL 3E9HA 4LWCA 4GKJL 4DV6L 4QQBX 1PH9A 4IPDA 3OTOQ 3LGJA 3M9BA 5GROA 1HR0L 3HFZB 2ZM6Q 2XGTA 1E1OA 1TWFH 2JA7G 2ID0A 4LFAQ 4JV5Q 1NY4A 4LF6L 2K14A 3UDIA 2DUDA 4LF4L 4A3BH 1OXUA 1NTGA 4X66L 1KD1C 4LF5L 4APVA 1SRUA 4KI0A 3GTOH 1Q12A 1V1QA 3GTJH 5JJLA 3KJPA 1K3RA 4P74A 4X64Q 4A3MH 1QZGA 4B3RL 5IYDG 1XMOL 2H5XA 1PH5A 1WI5A 2I5LX 2VQFQ 2UUAQ 2CWAA 3CCRA 4DR5Q 3HOUG 4DR6L 5IE8A 2E5LQ 4OXPA 4ALPA 1VQOA 1JB7A 2R92G 1B7YB 1HNXQ 1Y1VG 1X65A 3UDGA 3RLNA 4DUZL 1IL2A 1PV4A 2JEAI 2UUCL 4A3FG 1B70B 3PIOA 2PI2A 1VQLA 1E22A 3DM3A 1WOCA 2B63G 5JEAG 3CAMA 2K52A 1TWCH 1P8LA 4JI6Q 4YWKA 1VQPA 4GKKL 1YIJA 4JI0L 3ICEA 3J7A5 3RLOA 4DV4L 1IZ6A 1W2BA 1HZAA 1LYLA 4GN3B 1S40A 2VUMH 2D62A 4A75A 4DV7Q 1L1OA 1VQMA 4LFCQ 1PVOA 1D7QA 1UEBA 1YJ9A 1EQRA 3J7ZC 2IHEA 1BVSA 2D0PA 2ASBA 4IFDI 3PF4A 3IRBA 3PO2G 4R4IA 1Z47A 3FKIH 1L0WA 5IYCH 1VQ4A 2R7FA 1IBKL 2QA4A 4PG3A 1N36Q 1FL0A 1JJGA 5M3FH 1W3SA 1YVCA 1J5EQ 2B3GA 1X56A 5LMNQ 1XMQL 1YHAA 1QZHA 2MO1A 1PH3A 3K8AA 4A3BG 3PIPA 1N9WA 5GADC 4DR4Q 4JI8L 2BA0A 1I3QH 5IP9H 1IBLL 4L5TA 3KLWA 1GKHA 3A5UA 4A3MG 1X55A 3GTLH 2JK8A 1TWHH 3F2CA 4AIMA 3S1MH 4DR3L 2R93H 2OTLA 2JEBI 4OWXB 2F4VQ 3UE1A 2L15A 3W1GA 2KHJA 2GVAA 2F3IA 1N33L 4RMFA 1UWVA 3OTOL 1VQJA 3U4ZA 3T1HL 1CUKA 2NN6G 2R7DA 4YHHL 5JJIA 3G48A 4LUVA 3TS2A 2UXBL 5BR8Q 2CKZB 1R9TH 1OXSC 2NVXH 1FVIA 4DV5L 1VQ9A 3KYHC 3GTMH 4X62L 4IFDJ 4HIKA 4OWTB 2NN6I 1QVFA 4A3DG 3Q8DA 4AYBG 3GDEA 1QUQB 5C4JH 1CSPA 2ES2A 2K5VA 2LXKA 2Z6KC 2LXJA 5AJ3L 1KC8C 1HNWL 2VZAA 4OX9Q 4DR2Q 2VNUD 2K75A 3GTKH 4OWWB 4NPSA 4BY1H 3AFPA 4JV5L 4JOIA 3FKIG 1SROA 5IYCG 4A3LH 4JBKA 4JC0A 1X3EA 2V1CC 5M3FG 1CKMA 1IBMQ 3VDYA 4K0KQ 4LW1A 3AQQA 1G6PA 2B29A 3NBHB 2ZTCA 3A74A 3S17H 3PUXA 5C44H 1PYBA 1VQBA 2UUAL 1YEZA 2GN5A 4DR5L 1VQFA 4P72A 3KF6B 3WWVA 3S24A 2I0QA 4PMWA 2CCZA 3ULPA 4R1JA 3TREA 1AE2A 1XTDA 4GLXA 2R93G 4QJFA 5LMUQ 4DR7Q 2UXDQ 2N8NA 2KENA 1RL2A 4EQ5A 3U58A 1YJWA 3GTQH 4LFBL 4HIOA 5E7NA 3KJOA 1JE5A 4B3SL 2DGYA 1HZ9A 1GM5A 4UP9A 4PZ6A 3ULLA 4A3EH 4H02A 1Y14B 4GOPC 3K80C 2K5HA 1O7IA 3D0FA 4UPAA 3UDXA 2Y0SE 2R7ZH 4IOCA 1Y1WH 3S15H 4KHPQ 4IPHA 3NEMA 1C9OA 1N32Q 1JJCB 1QUQA 4JI3L 3HKZE 4R4CA 2E2HH 1YITA 1SLJA 2MNAA 3SGIA 2CWPA 1WJJA 5M5XH 2JA8H 3TRZA 2K5NA 1N36L 1NMGA 1J6QA 5FLXc 2HQLA 2RF4A 4IPGA 3FP9A 2IY5B 1FJGQ 2EXDA 3I4MG 1S72A 4BA2I 3CD6A 1C0AA 1VQGA 3CCLA 3GTGH 3RZDH 4DR4L 2IX1A 1M1KC 5GAHC 4JI7Q 2K50A 3UE0A 1E3PA 3DLLA 4GS3A 1HZBA 1PFSA 3CCJA 1K73C 1XNQQ 1XPOA 2AWNA 3ER0A 1TXYA 3CW2C 3E0EA 3PCOB 2I5HA 2ZTEA 3KF6A 1QVCA 1KIXA 4AQYL 4DV1L 3NELA 3RZOH 1HH2P 4IPCA 4IOAA 3I56A 1X9NA 4OONA 4MNOA 1KRSA 2EQSA 1YJNA 3I4MH 3I4NG 3CMEA 4X65Q 3AYHB 4YWMA 2NVYH 4L5QA 3PUVA 4HJ5A 4GNXC 5M3MH 3JAMc 4B3MQ 4DUYQ 3I7FA 4DKAC 1Q81C 4A3EG 4IFDG 1X6OA 4IJHA 5FJ8H 2R7ZG 4J15A 1ASYA 4WJ4A 1WCMH 2ALYB 1YZ6A 4TQUS 1KRTA 4PZ8A 1VQ8A 1L1OC 1Q82C 1I94Q 1XNRQ 2D0OA 3S1NH 3JC66 3TS0A 3A5ZB 3CCSA 3STBD 1MJCA 3A0JA 2Y0SG 1LM0A 2VS1A 1OTCA 3M7NA 4NXNQ 1IBML 4K0KL 3HKZG 4HJ9A 1VQDA 3M4QA 1VQ6A 1Q1BA 3CC4A 4JI5Q 1KAWA 4PZ7A 4JYAQ 4LF7L 3M3YH 3L0OA 3G71A 1MJEA 2E2JH 2KBNA 1CKOA 2WB1E 4YCUA 1X54A 5IWAQ 1SFOH 2HHHL 4MTNA 4YCVA 4GLAC 2AHOB 5LMUL 4DR7L 2UXCQ 2YTYA 3MXNB 4B3TQ 1AE3A 3S14H 1A63A 5IY0A 3RNUA 1GD7A 2E8GA 1G291 3MEFA 1BKBA 4DV6Q 1PH2A 1NBWA 4LF9L 4GKJQ 5K36G 1X3GA 1HNZQ 1HR0Q 2JA5H 2WAQE 3M4OH 3T1YL 2WFWA 4QY7A 4DR1L 2NZOA 2YYZA 3CQZH 3EN2A 4P73A 4DV2Q 5ELOA 3RN2A 1VQAA 4O0AA 4DAMA 4DV3L 2I5MX 2VL6A 4KLKA 5J3BA 4X66Q 3I2ZA 4C3JH 4YY3Q 3RN5A 4LF5Q 4KHPL 3ERSX 1LUZA 4LUOA 4C2MH 4DV0Q 2E2IH 3W1BA 2JQOA 4BA1I 1N32L 5FJ8G 4JI4L 1VQNA 4B3RQ 1HZCA 3GD7A 4A3IH 1PH7A 4L5RC 2QEXA 1XMOQ 2HIXA 1WCMG 2VUMG 2N49A 3J81i 3L2PA 3RLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV A;  3J80 i;  1Q46 A;  2RCN A;  3HKS A;  1D8L A;  2ZM6 L;  2N78 A;  4LFA L;  4JOI C;  2UUC Q;  1YHB A;  1FJG L;  2JA6 H;  2R6G A;  1Q86 C;  2YTX A;  5FLM H;  1U0L A;  1EIF A;  2IT1 A;  4LNQ A;  3HOW H;  1U5K A;  1XPU A;  4BY7 H;  1KQS A;  4BXX H;  3K0X A;  2JJQ A;  3PUZ A;  2OWO A;  4X64 L;  1XNQ L;  1BBW A;  2A19 A;  2BH8 A;  2VQF L;  4JI0 Q;  4AH6 A;  2Q2U A;  5IP9 G;  4DV4 Q;  2EIF A;  5LMN W;  2Q2T A;  3CPF A;  2E5L L;  4R4O A;  1EWI A;  1V43 A;  4JBW A;  1N34 Q;  1HNX L;  4A4I A;  1JT8 A;  3EBE A;  5GAE C;  3OYY A;  4JCV E;  1YBY A;  1M90 C;  2A8V A;  1SMX A;  3BJU A;  5HY6 A;  1Q8K A;  2HIV A;  3CPW A;  4A76 A;  2MQH A;  1IYJ B;  1QVG A;  3B6Y A;  3S1Q H;  2WB1 G;  2PMZ E;  5DLQ E;  4JI6 L;  1IBK Q;  4A3J H;  3PO3 H;  1V9P A;  4B3M L;  1H95 A;  3W5O A;  2OTJ A;  1RIP A;  5C0X J;  3ZJY C;  4DK3 C;  3D31 A;  1XMQ Q;  4IJL A;  3I4O A;  3PGZ A;  4Y7N H;  2MO0 A;  2PQA B;  3GO5 A;  3GTP H;  2WAQ G;  2MFI A;  4LFC L;  4DV7 L;  3G4S A;  1PH6 A;  3S16 H;  2ATW A;  2UUB Q;  4A3I G;  4QGU A;  4A3K H;  1HJP A;  3HOV H;  1EOV A;  1E1T A;  2Z0S A;  3J81 j;  1KHI A;  1L2F A;  2AWO A;  3BZK A;  3HOZ H;  4NXN L;  4BY1 G;  1J5E L;  4A3C H;  5LMN L;  2JA9 A;  3T1H Q;  4TVA B;  4YHH Q;  1P16 A;  1KL9 A;  2VQE Q;  4DNI A;  3CCU A;  2IHF A;  4BBS H;  4A3L G;  2UXB Q;  5FLM G;  3HOW G;  4HJA A;  4BY7 G;  4JYA L;  1K83 H;  4DV5 Q;  3CMA A;  5IT9 c;  1A62 A;  3AEV A;  1EYG A;  3E9I A;  2JE6 I;  1OXX K;  5C44 G;  3HOY H;  3K7A H;  3KOJ A;  2UU9 Q;  4OO1 G;  1I6H H;  2UXC L;  5AJ3 Q;  1HNW Q;  4JI1 Q;  1NE3 A;  1VQ5 A;  2F4V L;  4WJ3 M;  2GVB A;  3PV0 A;  3STB C;  3PO2 H;  4GN4 B;  1HNZ L;  4A93 H;  3S1R H;  1UE5 A;  5EAY A;  3TQY A;  4LF8 Q;  5ELN A;  1PH1 A;  1EQQ A;  1JMC A;  4OO1 I;  5H1S E;  5BR8 L;  4DV2 L;  1VQ7 A;  4JBJ A;  4UY8 C;  4RG1 A;  1MIU A;  1Z9F A;  5M5Y H;  4A3J G;  3PO3 G;  4YY3 L;  2RHQ B;  1PH8 A;  3U4V A;  4DV0 L;  2C35 B;  1UE6 A;  3CXC A;  1Y1W G;  1VQE A;  5C4X H;  4JI2 Q;  4DR2 L;  4OX9 L;  2PQA A;  3H15 A;  1VQK A;  1SR3 A;  1GO3 E;  2OQK A;  3CF5 A;  1BBU A;  4HJ7 A;  2Q2I A;  2CFM A;  1ASZ A;  1YNX A;  4A3K G;  1NMF A;  3HOX H;  3HOV G;  1Q1E A;  4MZ9 A;  4AYB E;  2JA8 G;  2BA1 A;  3ULJ A;  2F52 A;  1FGU A;  4LFB Q;  3H0G H;  2HT1 A;  3HOZ G;  4X6A H;  5IYB H;  1PH4 A;  4A3C G;  1VS0 A;  4QIW E;  4B3S Q;  1KXL A;  4GNX A;  4DPG A;  2FXQ A;  5IP7 H;  3TEH B;  4BBS G;  2OCE A;  3G6E A;  4NXM Q;  4A3D H;  3H3V H;  4R4Q A;  4HIM A;  1X3F A;  1GVP A;  1T9H A;  4O2D A;  4A3G H;  2ZJQ A;  1N34 L;  3CCM A;  3HOY G;  1PYS B;  4YCW A;  1EFW A;  1A8V A;  4JI3 Q;  2UXD L;  3F8T A;  2NVT H;  1G51 A;  1K8G A;  4A93 G;  3NEN A;  3J81 c;  3JAM i;  3M85 A;  1TWG H;  2YU9 H;  1AH9 A;  1K0R A;  3J80 c;  3PF5 A;  1TWA H;  4UP7 A;  1DGS A;  1LTL A;  4XIG S;  4LF6 Q;  3RR5 A;  4NXM L;  2K4K A;  1CKN B;  4LF4 Q;  5M3M G;  3FHW A;  1CSQ A;  1VCI A;  3KDF B;  1E7Z A;  3M4P A;  4DK6 C;  3PUY A;  5C0X G;  3BU2 A;  2UUB L;  1OXT A;  1UE7 A;  4P71 A;  3S2H H;  5C4X G;  3PSI A;  1YI2 A;  3BZC A;  2PI2 E;  4DR6 Q;  2WP8 J;  1VQH A;  3AFQ A;  2IX0 A;  1WFQ A;  3EIV A;  4AQY Q;  4DV1 Q;  5JEA J;  5C0X I;  3OW2 A;  3HOX G;  3PUW A;  4DUZ Q;  2ZTD A;  5C3E H;  4Y52 H;  4GLV B;  3K7U C;  2VQE L;  1EUJ A;  3H0G G;  1N8R C;  5IYB G;  4GOP B;  2KCM A;  3KF8 B;  1SN8 A;  5IP7 G;  4JI7 L;  2A1A A;  1B8A A;  1Q7Y C;  4BBR H;  5GQO A;  4YWL A;  4EX5 A;  2VY3 A;  4FDB A;  2LSS A;  2YTV A;  2AMC B;  4GKK Q;  2Z6K A;  2UU9 L;  1VQI A;  4HID A;  4DAY B;  2NZH A;  1PHJ A;  1UE1 A;  2KHI A;  4JI1 L;  3S2D H;  4A3G G;  4C3H H;  2AKW B;  1E24 A;  1XPR A;  1WYD A;  4ME3 A;  5M5W H;  2N3S A;  4LF8 L;  4UP8 A;  3H3V I;  5HGQ A;  5JJK A;  4XTC S;  5GAG C;  2JA7 H;  4X65 L;  1OXV A;  1SE8 A;  2ZJP A;  4POG A;  4LUZ A;  2JA5 G;  3CP0 A;  1S3O A;  4JBM A;  2YV5 A;  4P75 A;  4DUY L;  3I55 A;  2PNH A;  4KHZ A;  3F2D A;  1HR0 W;  4C3I H;  1CKN A;  5IYD H;  4LF7 Q;  4JI2 L;  2CQO A;  3KDF A;  2QGQ A;  4JI8 Q;  1I5F A;  1NJI C;  1JJ2 A;  3HOU H;  4L5S A;  2OQ0 A;  1IBL Q;  1XJV A;  1I94 L;  1XNR L;  2ZJR A;  2R92 H;  2HHH Q;  4DR3 Q;  2RHS B;  1Y1V H;  1EIY B;  1K9M C;  3F2B A;  2KCT A;  4POF A;  3CC7 A;  4A3F H;  3CCE A;  3CCQ A;  1K8A C;  4LF9 Q;  1N33 Q;  2B63 H;  1YHQ A;  3I4N H;  4GNX B;  5C3E G;  1IXR A;  3F1Z A;  2BH2 A;  2JA6 G;  4JI5 L;  1A0I A;  3U50 C;  3T1Y Q;  3CC2 A;  4R4T A;  4DR1 Q;  3UDF A;  3L7Z C;  1PA6 A;  1C7Y A;  2Q2H A;  3KFU A;  4JG2 A;  4GOP A;  4X62 Q;  4DV3 Q;  4BXX G;  4GN5 A;  4BBR G;  4QL5 A;  2XTI A;  5IWA L;  4IO9 A;  4HJ8 A;  1VQC A;  1L1O B;  2VW9 A;  4NB3 A;  1MKH A;  4JI4 Q;  3K81 C;  1I50 H;  2NVQ H;  4B3T L;  3E9H A;  4LWC A;  4GKJ L;  4DV6 L;  4QQB X;  1PH9 A;  4IPD A;  3OTO Q;  3LGJ A;  3M9B A;  5GRO A;  1HR0 L;  3HFZ B;  2ZM6 Q;  2XGT A;  1E1O A;  1TWF H;  2JA7 G;  2ID0 A;  4LFA Q;  4JV5 Q;  1NY4 A;  4LF6 L;  2K14 A;  3UDI A;  2DUD A;  4LF4 L;  4A3B H;  1OXU A;  1NTG A;  4X66 L;  1KD1 C;  4LF5 L;  4APV A;  1SRU A;  4KI0 A;  3GTO H;  1Q12 A;  1V1Q A;  3GTJ H;  5JJL A;  3KJP A;  1K3R A;  4P74 A;  4X64 Q;  4A3M H;  1QZG A;  4B3R L;  5IYD G;  1XMO L;  2H5X A;  1PH5 A;  1WI5 A;  2I5L X;  2VQF Q;  2UUA Q;  2CWA A;  3CCR A;  4DR5 Q;  3HOU G;  4DR6 L;  5IE8 A;  2E5L Q;  4OXP A;  4ALP A;  1VQO A;  1JB7 A;  2R92 G;  1B7Y B;  1HNX Q;  1Y1V G;  1X65 A;  3UDG A;  3RLN A;  4DUZ L;  1IL2 A;  1PV4 A;  2JEA I;  2UUC L;  4A3F G;  1B70 B;  3PIO A;  2PI2 A;  1VQL A;  1E22 A;  3DM3 A;  1WOC A;  2B63 G;  5JEA G;  3CAM A;  2K52 A;  1TWC H;  1P8L A;  4JI6 Q;  4YWK A;  1VQP A;  4GKK L;  1YIJ A;  4JI0 L;  3ICE A;  3J7A 5;  3RLO A;  4DV4 L;  1IZ6 A;  1W2B A;  1HZA A;  1LYL A;  4GN3 B;  1S40 A;  2VUM H;  2D62 A;  4A75 A;  4DV7 Q;  1L1O A;  1VQM A;  4LFC Q;  1PVO A;  1D7Q A;  1UEB A;  1YJ9 A;  1EQR A;  3J7Z C;  2IHE A;  1BVS A;  2D0P A;  2ASB A;  4IFD I;  3PF4 A;  3IRB A;  3PO2 G;  4R4I A;  1Z47 A;  3FKI H;  1L0W A;  5IYC H;  1VQ4 A;  2R7F A;  1IBK L;  2QA4 A;  4PG3 A;  1N36 Q;  1FL0 A;  1JJG A;  5M3F H;  1W3S A;  1YVC A;  1J5E Q;  2B3G A;  1X56 A;  5LMN Q;  1XMQ L;  1YHA A;  1QZH A;  2MO1 A;  1PH3 A;  3K8A A;  4A3B G;  3PIP A;  1N9W A;  5GAD C;  4DR4 Q;  4JI8 L;  2BA0 A;  1I3Q H;  5IP9 H;  1IBL L;  4L5T A;  3KLW A;  1GKH A;  3A5U A;  4A3M G;  1X55 A;  3GTL H;  2JK8 A;  1TWH H;  3F2C A;  4AIM A;  3S1M H;  4DR3 L;  2R93 H;  2OTL A;  2JEB I;  4OWX B;  2F4V Q;  3UE1 A;  2L15 A;  3W1G A;  2KHJ A;  2GVA A;  2F3I A;  1N33 L;  4RMF A;  1UWV A;  3OTO L;  1VQJ A;  3U4Z A;  3T1H L;  1CUK A;  2NN6 G;  2R7D A;  4YHH L;  5JJI A;  3G48 A;  4LUV A;  3TS2 A;  2UXB L;  5BR8 Q;  2CKZ B;  1R9T H;  1OXS C;  2NVX H;  1FVI A;  4DV5 L;  1VQ9 A;  3KYH C;  3GTM H;  4X62 L;  4IFD J;  4HIK A;  4OWT B;  2NN6 I;  1QVF A;  4A3D G;  3Q8D A;  4AYB G;  3GDE A;  1QUQ B;  5C4J H;  1CSP A;  2ES2 A;  2K5V A;  2LXK A;  2Z6K C;  2LXJ A;  5AJ3 L;  1KC8 C;  1HNW L;  2VZA A;  4OX9 Q;  4DR2 Q;  2VNU D;  2K75 A;  3GTK H;  4OWW B;  4NPS A;  4BY1 H;  3AFP A;  4JV5 L;  4JOI A;  3FKI G;  1SRO A;  5IYC G;  4A3L H;  4JBK A;  4JC0 A;  1X3E A;  2V1C C;  5M3F G;  1CKM A;  1IBM Q;  3VDY A;  4K0K Q;  4LW1 A;  3AQQ A;  1G6P A;  2B29 A;  3NBH B;  2ZTC A;  3A74 A;  3S17 H;  3PUX A;  5C44 H;  1PYB A;  1VQB A;  2UUA L;  1YEZ A;  2GN5 A;  4DR5 L;  1VQF A;  4P72 A;  3KF6 B;  3WWV A;  3S24 A;  2I0Q A;  4PMW A;  2CCZ A;  3ULP A;  4R1J A;  3TRE A;  1AE2 A;  1XTD A;  4GLX A;  2R93 G;  4QJF A;  5LMU Q;  4DR7 Q;  2UXD Q;  2N8N A;  2KEN A;  1RL2 A;  4EQ5 A;  3U58 A;  1YJW A;  3GTQ H;  4LFB L;  4HIO A;  5E7N A;  3KJO A;  1JE5 A;  4B3S L;  2DGY A;  1HZ9 A;  1GM5 A;  4UP9 A;  4PZ6 A;  3ULL A;  4A3E H;  4H02 A;  1Y14 B;  4GOP C;  3K80 C;  2K5H A;  1O7I A;  3D0F A;  4UPA A;  3UDX A;  2Y0S E;  2R7Z H;  4IOC A;  1Y1W H;  3S15 H;  4KHP Q;  4IPH A;  3NEM A;  1C9O A;  1N32 Q;  1JJC B;  1QUQ A;  4JI3 L;  3HKZ E;  4R4C A;  2E2H H;  1YIT A;  1SLJ A;  2MNA A;  3SGI A;  2CWP A;  1WJJ A;  5M5X H;  2JA8 H;  3TRZ A;  2K5N A;  1N36 L;  1NMG A;  1J6Q A;  5FLX c;  2HQL A;  2RF4 A;  4IPG A;  3FP9 A;  2IY5 B;  1FJG Q;  2EXD A;  3I4M G;  1S72 A;  4BA2 I;  3CD6 A;  1C0A A;  1VQG A;  3CCL A;  3GTG H;  3RZD H;  4DR4 L;  2IX1 A;  1M1K C;  5GAH C;  4JI7 Q;  2K50 A;  3UE0 A;  1E3P A;  3DLL A;  4GS3 A;  1HZB A;  1PFS A;  3CCJ A;  1K73 C;  1XNQ Q;  1XPO A;  2AWN A;  3ER0 A;  1TXY A;  3CW2 C;  3E0E A;  3PCO B;  2I5H A;  2ZTE A;  3KF6 A;  1QVC A;  1KIX A;  4AQY L;  4DV1 L;  3NEL A;  3RZO H;  1HH2 P;  4IPC A;  4IOA A;  3I56 A;  1X9N A;  4OON A;  4MNO A;  1KRS A;  2EQS A;  1YJN A;  3I4M H;  3I4N G;  3CME A;  4X65 Q;  3AYH B;  4YWM A;  2NVY H;  4L5Q A;  3PUV A;  4HJ5 A;  4GNX C;  5M3M H;  3JAM c;  4B3M Q;  4DUY Q;  3I7F A;  4DKA C;  1Q81 C;  4A3E G;  4IFD G;  1X6O A;  4IJH A;  5FJ8 H;  2R7Z G;  4J15 A;  1ASY A;  4WJ4 A;  1WCM H;  2ALY B;  1YZ6 A;  4TQU S;  1KRT A;  4PZ8 A;  1VQ8 A;  1L1O C;  1Q82 C;  1I94 Q;  1XNR Q;  2D0O A;  3S1N H;  3JC6 6;  3TS0 A;  3A5Z B;  3CCS A;  3STB D;  1MJC A;  3A0J A;  2Y0S G;  1LM0 A;  2VS1 A;  1OTC A;  3M7N A;  4NXN Q;  1IBM L;  4K0K L;  3HKZ G;  4HJ9 A;  1VQD A;  3M4Q A;  1VQ6 A;  1Q1B A;  3CC4 A;  4JI5 Q;  1KAW A;  4PZ7 A;  4JYA Q;  4LF7 L;  3M3Y H;  3L0O A;  3G71 A;  1MJE A;  2E2J H;  2KBN A;  1CKO A;  2WB1 E;  4YCU A;  1X54 A;  5IWA Q;  1SFO H;  2HHH L;  4MTN A;  4YCV A;  4GLA C;  2AHO B;  5LMU L;  4DR7 L;  2UXC Q;  2YTY A;  3MXN B;  4B3T Q;  1AE3 A;  3S14 H;  1A63 A;  5IY0 A;  3RNU A;  1GD7 A;  2E8G A;  1G29 1;  3MEF A;  1BKB A;  4DV6 Q;  1PH2 A;  1NBW A;  4LF9 L;  4GKJ Q;  5K36 G;  1X3G A;  1HNZ Q;  1HR0 Q;  2JA5 H;  2WAQ E;  3M4O H;  3T1Y L;  2WFW A;  4QY7 A;  4DR1 L;  2NZO A;  2YYZ A;  3CQZ H;  3EN2 A;  4P73 A;  4DV2 Q;  5ELO A;  3RN2 A;  1VQA A;  4O0A A;  4DAM A;  4DV3 L;  2I5M X;  2VL6 A;  4KLK A;  5J3B A;  4X66 Q;  3I2Z A;  4C3J H;  4YY3 Q;  3RN5 A;  4LF5 Q;  4KHP L;  3ERS X;  1LUZ A;  4LUO A;  4C2M H;  4DV0 Q;  2E2I H;  3W1B A;  2JQO A;  4BA1 I;  1N32 L;  5FJ8 G;  4JI4 L;  1VQN A;  4B3R Q;  1HZC A;  3GD7 A;  4A3I H;  1PH7 A;  4L5R C;  2QEX A;  1XMO Q;  2HIX A;  1WCM G;  2VUM G;  2N49 A;  3J81 i;  3L2P A;  3RLF A; 
#chains in the Genus database with same CATH topology
 1HA6 A;  2RCN A;  3HKS A;  2RA4 A;  4F88 A;  2EYP A;  3BYY B;  3HRZ C;  4I7A A;  5COR A;  2ZM6 L;  4JW0 A;  1FJG L;  4B9X A;  2JA6 H;  4XDX A;  2XIW A;  1Q86 C;  4BY7 H;  1Y8N B;  2IT1 A;  1E2Z A;  4QCL A;  1LTR D;  1EEI D;  2E74 C;  4BXX H;  2JJQ A;  3ZYY X;  2OWO A;  4X64 L;  5EKL A;  2PZT A;  3LX0 A;  1BBW A;  1ILP A;  4WJW A;  2VQF L;  4DV4 Q;  2EIF A;  2B2Y A;  2E5L L;  1V43 A;  4JBW A;  1N34 Q;  2WB1 B;  3EBE A;  5GAE C;  4JCV E;  2A8V A;  1M90 C;  1ICW A;  4C1N I;  2K5D A;  2WKC A;  5I9O A;  5DLQ E;  4IUU A;  4C3J B;  1IBK Q;  1SMY D;  1V1P B;  2E2I B;  5FLX E;  1XMQ Q;  5ELC A;  3NK9 A;  1GHK A;  2MO0 A;  2WAQ G;  2MFI A;  1PH6 A;  1E2V A;  3G4S A;  3S16 H;  2UUB Q;  1ZEQ X;  1W6J A;  1EOV A;  3HOW B;  3HOZ H;  3TP5 A;  2JA9 A;  4CDE C;  1KL9 A;  3CCU A;  1K83 H;  3AEV A;  3QIA A;  3E9I A;  2F0F A;  2X6G A;  5IOC A;  3K7A H;  1VQ5 A;  1NE3 A;  4WJ3 M;  1MGS A;  1JOQ A;  4KMU C;  4K8I A;  4A93 H;  3FPP A;  1LT3 D;  1J9O A;  5BR8 L;  4UY8 C;  2SNS A;  4RG1 A;  1C8C A;  1G6Z A;  1WD0 A;  4FXK C;  2JYO A;  4YY3 L;  2XNA C;  5FOB B;  4DV0 L;  2R92 B;  1NR4 A;  1VQE A;  4DR2 L;  3A56 A;  1DCZ A;  3H15 A;  1SR3 A;  1BBU A;  1WTX A;  2EE1 A;  3DXJ C;  4L6T B;  4A3K G;  5IGC A;  1Q1E A;  3EVQ A;  4LFB Q;  1EIG A;  1KAB A;  4X6A H;  4K5V A;  5JPN C;  1VS0 A;  4QIW E;  4B3S Q;  1PLF A;  5IP7 H;  2FXQ A;  4KD3 A;  3TEH B;  4BBS G;  5JJZ A;  3HOY B;  1QJO A;  2XRS D;  1GVP A;  2ZJQ A;  5EKI A;  3PO2 B;  3CCM A;  3TBI B;  1EFW A;  1B3A A;  1IYV A;  1I6V C;  5BN3 A;  2D2C C;  1GHJ A;  1WTH A;  3F8T A;  1K8G A;  2F3V A;  1BCP B;  2E76 C;  3NEN A;  3NHH A;  3JAM i;  2JXM B;  3BVM A;  2MUY A;  5G3L D;  1VCI A;  3KDF B;  3M4P A;  4QF4 A;  2FFK B;  1WTW A;  5EGT A;  5TSS A;  2WP8 J;  3EFX D;  1WFQ A;  3EIV A;  5JEA J;  3OW2 A;  1ENF A;  2ZTD A;  4DAP A;  5C3E H;  4GLV B;  4IZ8 A;  3K7U C;  1JWS D;  1GUS A;  4AYB B;  1SN8 A;  4A3G B;  2A1A A;  1B8A A;  1F9R A;  5GQO A;  4YWL A;  4EX5 A;  3X3N A;  4GKK Q;  2UU9 L;  1VQI A;  1PHJ A;  3ERQ A;  5FO7 B;  2RQX A;  3NPP A;  4JI1 L;  5CBE E;  2AKW B;  5CMD A;  1XPR A;  2YU9 B;  5M5W H;  1TWG B;  4LF8 L;  1NUC A;  1ESF A;  1T5E A;  4ODG A;  5JJK A;  2JA7 H;  4X65 L;  4LUZ A;  2YV5 A;  4DAV A;  3I55 A;  1TKW B;  5J1Z A;  2K05 A;  3NWT A;  3S2H B;  4RA8 A;  2EPB A;  3JAM L;  3HOU H;  5IT9 E;  3ERO A;  1IBL Q;  4L5S A;  2NWG A;  1MSG A;  4ZKC B;  1WTR A;  3HEJ A;  3Q0A A;  2RHS B;  4DR3 Q;  2O5I C;  4POF A;  3CC7 A;  1PDQ A;  2F0H A;  5ELE A;  4FXG C;  4LF9 Q;  5A2Q L;  1BXT A;  1S5B D;  2BH2 A;  1A0I A;  3P1H A;  3TP7 A;  2DJF C;  3I73 A;  3KFU A;  1AEX A;  3Q24 A;  4JG2 A;  4HR7 B;  4GN5 A;  4C3H B;  3C1F A;  1TS4 A;  4IO9 A;  4HJ8 A;  1TVX A;  3GTK B;  2NVQ H;  2OT2 A;  4QQB X;  3N52 A;  1RTO A;  2WIN B;  1U4P A;  1OO9 B;  3OWE B;  5GRO A;  2P5Z X;  2ZM6 Q;  1E1O A;  2I07 B;  3I91 A;  1NY4 A;  4C3I B;  4KKU A;  2LKV A;  3OW7 A;  4APV A;  4RKB A;  1V1Q A;  3H09 A;  4P74 A;  4X64 Q;  4KK7 A;  4I7Z C;  1Y1V B;  5IYD G;  1MHW C;  1XMO L;  2VQF Q;  2UUA Q;  2CWA A;  3K5N A;  3GTQ B;  5L37 A;  2E5L Q;  4OXP A;  3SK4 A;  1JB7 A;  2B63 B;  1B7Y B;  2R92 G;  2AQ2 B;  5FO8 B;  4R9W A;  3UDG A;  2NN6 H;  2UUC L;  4A3F G;  2L12 A;  3MXU A;  4ZYS A;  4A3E B;  5JEA G;  1RKN A;  3DEP A;  4MHE A;  1YIJ A;  4JI0 L;  3ICE A;  2B2T C;  1HZA A;  1S40 A;  2VUM H;  1L1O A;  3AB9 A;  4IFD I;  5EBC A;  1BVS A;  1R4Q B;  3IRB A;  3PO2 G;  1J8I A;  2VB3 X;  1VQ4 A;  1AN8 A;  3GTO B;  5M3F H;  1YVC A;  1M8A A;  2B3G A;  1YHA A;  3MEH A;  1LTA D;  4V19 0;  3K8A A;  2SOB A;  4DNR B;  4JI8 L;  2O2L D;  5C5M A;  3DWP A;  1I3Q H;  3GTL H;  1GKH A;  4A3M G;  5A35 A;  1LT4 D;  2OTL A;  2L15 A;  4F8M A;  2GVA A;  2F3I A;  1N33 L;  4RMF A;  2KCN A;  3T1H L;  2R7D A;  5JJI A;  4PQX A;  3G48 A;  3TS2 A;  2UXB L;  5BR8 Q;  2CKZ B;  4O42 A;  3T13 A;  2NVX H;  1FVI A;  1LO5 D;  3KYH C;  1VQ9 A;  4X62 L;  2NN6 I;  4AYB G;  3GDE A;  5C4J H;  1CSP A;  3VYT A;  2LXJ A;  5DEH A;  5F2D A;  4DR2 Q;  1MD2 D;  3VYR A;  2VNU D;  2PPB C;  3C2P A;  4NKL A;  2K75 A;  4JOI A;  4N9T A;  1XXG A;  2HD3 A;  4JBK A;  2O5J C;  1BCP C;  2V1C C;  1IBM Q;  3VDY A;  1SFO B;  1PTO B;  3NBH B;  1H9K A;  1KTK A;  3DWQ A;  2I0Q A;  3KF6 B;  4PMW A;  2CCZ A;  1SDF A;  4R1J A;  1TII D;  3A55 A;  3BDL A;  2B2V C;  1AE2 A;  3TRE A;  4GLX A;  4QJF A;  5LMU Q;  2N8N A;  1YJW A;  4V0B A;  3SHL A;  4RWS C;  5I6Y A;  4H02 A;  1PFM A;  3TP8 A;  4CKB A;  4A3I B;  2Y0S E;  2R7Z H;  3I3C A;  4IOC A;  5ISR A;  5C3W A;  3NEM A;  4K5X A;  4JI3 L;  4DK1 A;  2E2H H;  4BY1 B;  4HTH A;  4MTK A;  1WJJ A;  5M5X H;  1SEB D;  5E1F A;  3Q22 A;  2EYF A;  3QG1 A;  1N36 L;  1NMG A;  1J6Q A;  1CM9 A;  2RF4 A;  3J7A F;  2RSN A;  3S17 B;  5C44 B;  1VF5 C;  3K0Y A;  3KLR A;  4UAI A;  4L8J A;  2K50 A;  3UE0 A;  3SEB A;  1F2Y A;  1PFS A;  3CCJ A;  3AMU A;  1SJH D;  3ER0 A;  2GA4 B;  3CW2 C;  5EKK A;  1Q8I A;  1QVC A;  1KIX A;  4AQY L;  4DV1 L;  4IPC A;  5K36 H;  3H6M A;  3SK8 A;  1KRS A;  3CME A;  1JOO A;  4KN4 C;  4X65 Q;  2H4O A;  1Y1W B;  4UHV A;  5CV7 A;  1GOZ A;  4H44 C;  1PZK D;  4A3E G;  1IL8 A;  1X6O A;  1ENC A;  3BG3 A;  5FJ8 H;  1EZ6 A;  4QUC A;  3NQI A;  2J0T D;  1PTO D;  2JA8 B;  4PZ8 A;  3E3X A;  3W2D A;  3S1N H;  4TRD A;  3A5Z B;  4RH6 A;  5C4H A;  2VS1 A;  2WII B;  2SDF A;  1VQ6 A;  1KAW A;  5CYU A;  5DNF A;  2F0T A;  4JYA Q;  1F2L A;  4IAL A;  1ESR A;  2WB1 E;  3RZO B;  4ILW A;  4MTN A;  4YCV A;  3K59 A;  4DR7 L;  2A69 D;  3I4M B;  1EY6 A;  3MEF A;  1BKB A;  3KK7 A;  3VR5 A;  4ZLT F;  4QY7 A;  4DR1 L;  4HSV A;  4P73 A;  4DV2 Q;  1LTI D;  4FVM A;  4KLK A;  4DN4 M;  3I2Z A;  4C3J H;  2QIL A;  4RAU C;  2E2I H;  3W1B A;  2PYK A;  1GJX A;  1BOS A;  1PH7 A;  2QEX A;  1XMO Q;  1WCM G;  2G9H D;  3J81 i;  3OTO L;  1F2M A;  3J80 i;  1Q46 A;  2N78 A;  1DXM A;  5DAU A;  2UUC Q;  2R6G A;  1G91 A;  2YTX A;  3HOW H;  1EIF A;  1KDA A;  2NTS A;  1XNQ L;  2A19 A;  4JI0 Q;  2Q2U A;  2NVT B;  2Q2T A;  2E2D C;  3DM1 A;  3BYT B;  3CPF A;  2TMP A;  4QB4 A;  4B9W A;  5J39 A;  5EPJ A;  3OYY A;  3DUZ A;  3FMC A;  3V2T A;  2JA5 B;  1AZP A;  2EYJ A;  1JB3 A;  1Q8K A;  1TWA B;  3CPW A;  4QMG A;  4X3K A;  3PO3 H;  1H95 A;  3W5O A;  1RIP A;  2A68 D;  3ZJY C;  2CQA A;  3IL8 A;  2PQA B;  3GO5 A;  3QOJ A;  2ATW A;  4M1U B;  4A3I G;  2X6L A;  1RHP A;  4QGU A;  1QNU A;  1B53 A;  2KEE A;  3HP3 A;  2AWO A;  3BZK A;  2NYZ D;  4BY1 G;  3T1H Q;  1HA5 A;  4A3L G;  2UXB Q;  5FLM G;  1STG A;  3J81 L;  4HJA A;  3CMA A;  1EQT A;  3S2D B;  1TY2 A;  1A62 A;  4DA2 A;  2LY7 A;  4MIU A;  1EYG A;  3MWY W;  5C44 G;  1PTO C;  3HOY H;  4PMC A;  4OO1 G;  2F0M A;  2UXC L;  4K5W A;  2F4V L;  5DM6 3;  1H9J A;  3PO2 H;  5IOD A;  1HNZ L;  1UE5 A;  3TQY A;  1H9R A;  4JBJ A;  1SXT A;  1MIU A;  2CW0 C;  2K32 A;  1A2T A;  4A3J G;  3D6C A;  1PMR A;  3GTP B;  2RHQ B;  4IUT A;  1RF2 D;  5C0X H;  2QCP X;  4A3K B;  1Y1W G;  4JI2 Q;  1JQY D;  2B2W C;  4HJ7 A;  1F77 A;  2A69 C;  1EYD A;  3H91 A;  3IFD A;  1NMF A;  3HOV G;  4Z9C B;  4MZ9 A;  4AYB E;  2JA8 G;  2BA1 A;  2Q8R E;  2F52 A;  3ULJ A;  4BBS B;  1AW7 A;  2HT1 A;  1GXD C;  1SYD A;  5IYB H;  4A3C G;  1STB A;  3P7J A;  4BWG B;  4DPG A;  1I6H B;  4RGT A;  4A3G H;  2QW7 A;  1NR2 A;  1GUT A;  1PYS B;  4YCW A;  4EQN A;  4JI3 Q;  3Q6S A;  5JPM C;  1PRT B;  3CHB D;  1G51 A;  2LS0 1;  4CBV A;  2YU9 H;  1WTV A;  1TWG H;  1U9R A;  5G3L F;  1O7Z A;  2QDB A;  4UP7 A;  1DGS A;  4LF6 Q;  4NXM L;  3RR5 A;  2K4K A;  1CKN B;  1CSQ A;  2IX3 A;  4MN3 A;  1E7Z A;  4DK6 C;  3PUY A;  2EY1 A;  3A7A B;  3BU2 A;  1ZYR D;  3S2H H;  5C4X G;  4PV1 C;  1YI2 A;  4LJZ C;  4KKS A;  2IX0 A;  3OIP A;  4AQY Q;  4DV1 Q;  5C0X I;  3HOX G;  4XYO A;  2EXZ A;  4DUZ Q;  4S3S A;  1A3U A;  2VQE L;  3H0G G;  2QF7 A;  1IW7 D;  1HFG A;  3U9S A;  2F0D A;  2Z6K A;  4DAY B;  1UE1 A;  2F0N A;  4C3H H;  1WYD A;  4DF7 A;  5HGQ A;  3R93 A;  1CT1 D;  4POG A;  2JA5 G;  3CP0 A;  4JBM A;  4P75 A;  4QUF A;  3F2D A;  4C3I H;  2RCF A;  4C56 C;  4L63 B;  1I94 L;  1XNR L;  3K5L A;  4ULL A;  1Y1V H;  1EIY B;  1IKL A;  2KCT A;  1B2T A;  3IKJ A;  3GTM B;  1K8A C;  2B63 H;  1BCP F;  1YHQ A;  1IXR A;  3F1Z A;  1PRT D;  4G4K A;  2EYH A;  2CVR A;  1C48 A;  4DR1 Q;  3UDF A;  1PA6 A;  1GUG A;  4JPB W;  4GOP A;  3FPU B;  3LWU A;  3KF8 A;  4BBR G;  2B2U C;  4QL5 A;  5IWA L;  3D4R A;  1MKH A;  2KQ3 A;  4NB3 A;  3E9H A;  1SYG A;  2MPM A;  4DV6 L;  1DZ1 A;  4XYQ A;  3OTO Q;  2B39 A;  3T53 B;  1TWF H;  1B9M A;  2XRQ D;  2M00 A;  3UDI A;  2DUD A;  4LF4 L;  3HZX A;  4LF5 L;  1SRU A;  3GTO H;  2EY5 A;  4B3R L;  1KAA A;  1PH5 A;  2H5X A;  4DR6 L;  3CCR A;  3V05 A;  4DR5 Q;  4A3F B;  1DON A;  2WAC A;  3NBI A;  1VQO A;  1W6K A;  3A8I E;  3I4N B;  1B3Q A;  2L4N A;  1X65 A;  1PV4 A;  1B70 B;  1K0S A;  4Q5V A;  1TU2 B;  2K52 A;  3D8G A;  2X69 A;  1SJE D;  3DEO A;  3J81 E;  1VDZ A;  1EFI D;  3C3L A;  3J80 E;  1I50 B;  3R2T A;  2EJM A;  3RLO A;  1TS3 A;  2PCF B;  3GV3 A;  4HN7 A;  2NZ1 D;  1D7Q A;  1UEB A;  1KNE A;  2Z8L A;  1G8Z D;  1BQQ T;  2IHE A;  3HKZ B;  4HED A;  2JSO A;  4R4I A;  5IYC H;  2QA4 A;  3QO2 A;  3SK5 A;  1JJG A;  3QJY A;  1W3S A;  3GTJ B;  1GUO A;  2BE5 D;  1IW7 C;  4A3M B;  3C46 A;  1A3V A;  3NUC A;  1PH3 A;  4A3B G;  3PIP A;  5GAD C;  2WV6 D;  2EDG A;  3KLW A;  2C9O A;  1II3 A;  1PTO H;  1TWH H;  2O4X A;  1LAC A;  4K2L A;  2F4V Q;  2RKS A;  3UE1 A;  1YNN D;  2L55 A;  1QWY A;  1UWV A;  4LK1 C;  1VQJ A;  4EQP A;  1Q3L A;  4YHH L;  2XWJ B;  1SMY C;  1XX8 A;  4O1N A;  4DV5 L;  1D5X C;  4HCE A;  4OWT B;  1G2T A;  1CK1 A;  1QUQ B;  4TKO B;  2L9H A;  3LNN A;  2LXK A;  5D3I B;  5AJ3 L;  1HNW L;  1QCB D;  1ROD A;  2A5H A;  4J6H A;  2EY2 A;  4LAA A;  4OWW B;  2JP1 A;  4NPS A;  5D14 A;  4BY1 H;  4JV5 L;  1PRT C;  3D3R A;  3FKI G;  5IGE A;  4A3L H;  2HUG A;  4JC0 A;  1F9S A;  2RBM A;  1CKM A;  1S5E D;  4K0K Q;  4Q0F A;  2E2J B;  1FNU A;  2N55 A;  2B29 A;  4ZUI A;  1TS5 A;  3S17 H;  5C44 H;  3VYU A;  1VQB A;  1YEZ A;  2GN5 A;  3H94 A;  1VQF A;  3DWA A;  3NE5 B;  3WWV A;  3S24 A;  2KCC A;  2R93 G;  4RGN A;  1RL2 A;  2PW5 A;  4OIK A;  1R9T B;  3HG9 A;  5CR3 A;  3KJO A;  4NMZ A;  2AUJ D;  1YNJ D;  1GM5 A;  4C2M B;  4KJN A;  4NXM Q;  4IFD H;  2K5H A;  1O7I A;  4K6L A;  1EEF D;  2J4X A;  1Y1W H;  2EJF C;  3OOC A;  4IPH A;  1N32 Q;  1JJC B;  4X3S A;  3OHX C;  2CWP A;  1SYB A;  4KD4 A;  2JA8 H;  1X3P A;  2K5N A;  4BY7 B;  4DXG A;  1K3B C;  4K14 A;  5FLX c;  2HQL A;  5M9O A;  1S5D D;  1FJG Q;  2EXD A;  1S72 A;  1HUM A;  4DR4 L;  2KOL A;  3GV6 A;  1CQF A;  1E3P A;  3DLL A;  1HZB A;  1K73 C;  2HCI A;  1I4H A;  4ABN A;  4B08 A;  2AWN A;  2KHS A;  2ZTE A;  1TS2 A;  3Q23 A;  3NEL A;  3RZO H;  5AFW A;  4X3U A;  3I56 A;  4RKL A;  4OON A;  4IUP A;  1M4V A;  3I4M H;  3I4N G;  3AYH B;  4H13 C;  1D1I A;  1L0X B;  3PUV A;  4HJ5 A;  3I7F A;  1EY9 A;  4M8A A;  4WRD A;  4NDX A;  1PTO F;  3BDC A;  1JC7 A;  1CI3 M;  4WJ4 A;  2ALY B;  1XTC D;  4TQU S;  2PZU A;  1VQ8 A;  1I94 Q;  1XNR Q;  2M2L A;  4OEM B;  1BF4 A;  3STB D;  5EPK A;  3CRL C;  4KTA A;  1OTC A;  3M7N A;  3HKZ G;  1VQD A;  3CC4 A;  2QKI C;  4PZ7 A;  3L0O A;  1PZI D;  1H9S A;  4OEL B;  1CKO A;  5IWA Q;  1X54 A;  3I72 A;  2G9D A;  1BNZ A;  1CTM A;  1H9M A;  1QB5 D;  1TR5 A;  2YTY A;  1R4P B;  5CV6 A;  5IY0 A;  1JE4 A;  3RNU A;  1GD7 A;  1G29 1;  4DV6 Q;  2NVY B;  1NBW A;  1X3G A;  2JA5 H;  2WAQ E;  4PMB A;  2WFW A;  1B44 D;  2YYZ A;  3CQZ H;  3RN2 A;  5ELO A;  4DAM A;  1U4L A;  2I5M X;  3TN2 A;  5J3B A;  1WCM B;  4YY3 Q;  4LF5 Q;  3G6J B;  5ELB A;  4KHP L;  4DV0 Q;  3BVG A;  2MP1 A;  1VQN A;  4FF1 A;  1BUV T;  3HS0 C;  4B3R Q;  3DMU A;  4FNF A;  2M9V A;  3OWF A;  3L2P A;  1C4Q A;  1WTO A;  4HCS A;  3CCV A;  1B9N A;  1ET6 A;  2EOT A;  4EQO A;  3IAY A;  1D8L A;  3BVZ A;  1QG7 A;  4K8J A;  2Z4I A;  1U5K A;  2N88 A;  4RFB A;  1STY A;  1KQS A;  2KVM A;  1F9P A;  3K0X A;  3PUZ A;  1SE4 A;  1D5M C;  4G57 A;  1I4X A;  3S14 B;  5LMN W;  5FKA C;  1YBY A;  1SMX A;  5HY6 A;  4K2K A;  3MXN A;  4IUQ A;  4A76 A;  2MQH A;  1Y8P B;  1QVG A;  3B6Y A;  3I70 A;  1RCV D;  2K5Q A;  1V9P A;  4B3M L;  2OTJ A;  2L5T A;  4J1M A;  1KDB A;  3D31 A;  4IJL A;  2FHT A;  3I4O A;  1NCV A;  5NUC A;  2D5D A;  3PGZ A;  1JCK B;  5FO9 B;  3GTP H;  3MZ5 A;  1Z6H A;  5E4W C;  5C3E B;  4A3K H;  1EY4 A;  3SXH A;  1E1T A;  3J81 j;  1KHI A;  4NXN L;  5ELF A;  1J5E L;  5LMN L;  4TVA B;  4YHH Q;  1P16 A;  5KRU A;  4BBS H;  2CH4 A;  4BY7 G;  4DV5 Q;  4KY6 A;  2K1B A;  5IT9 c;  2JE6 I;  3JAM E;  3KOJ A;  3RUZ A;  4ZKB B;  2UU9 Q;  4FF2 A;  1I6H H;  5AJ3 Q;  1HNW Q;  1I4G A;  4JI1 Q;  2JA7 B;  2GVB A;  3PV0 A;  4KHV A;  3VR4 A;  3S1Q B;  3STB C;  3GQB A;  4KY7 A;  1HTL D;  4GN4 B;  3M4Y A;  4NP5 A;  5JOB A;  5EAY A;  3S1R H;  4A3J B;  4LF8 Q;  2K03 A;  1EQQ A;  1JMC A;  5A2Q E;  1RD9 D;  5EQ0 A;  5I2X A;  5H1S E;  1VQ7 A;  5M5Y H;  4Y7N B;  2PMZ B;  3HOU B;  1V1P A;  2DN8 A;  1VMC A;  4N9P A;  3HOV B;  4U67 3;  3CF5 A;  1GO3 E;  4FP5 D;  2Q2I A;  1ASZ A;  1YNX A;  2SNM A;  1FGU A;  1ZKO A;  3HOZ G;  1SNO A;  1HCZ A;  5KNC A;  3X3M A;  1DM0 B;  1WTP A;  4UDU C;  3L9A X;  2B2T A;  4R4Q A;  4HIM A;  1X3F A;  2RDH A;  4O2D A;  4K6D A;  3MFY A;  5CGK A;  1N34 L;  5IGD A;  3L3O C;  2UXD L;  1A2U A;  2BCO A;  4A93 G;  1AH9 A;  1LTS D;  2PO4 A;  2H1E A;  1LTL A;  4XIG S;  1EWH A;  1FGB D;  2A6E D;  1GUN A;  5C4X B;  1LAB A;  1CA5 A;  1O7L A;  2UUB L;  1OXT A;  1UE7 A;  3HOX B;  3PSI A;  3BDO A;  2PI2 E;  3H0G B;  1VQH A;  3PUW A;  1D2B A;  1HPC A;  4A3D B;  1EUJ A;  1N8R C;  2KED A;  3T16 A;  5IP7 G;  5FLX L;  1EY7 A;  3BZD B;  2VY3 A;  4FDB A;  2FIN B;  2LSS A;  1AP0 A;  1WVL A;  2NZH A;  2ICI A;  2F0J A;  2IJ0 A;  2B2Y C;  1EIH A;  3FVQ A;  1EQV A;  4UP8 A;  3DHQ A;  1U4M A;  4XT3 B;  2MJ8 A;  4RHS A;  4XTC S;  1E0B A;  3K5O A;  1SE8 A;  1DD2 A;  1UNS A;  1S3O A;  4CJ1 B;  1MSH A;  4DUY L;  3GTL B;  2PNH A;  3D6W A;  1HR0 W;  2JN4 A;  5IYD H;  1PFB A;  3KDF A;  4JI8 Q;  4ZQ3 A;  1F2Z A;  2ZJR A;  3VA7 A;  2R92 H;  2B2V A;  2OXP A;  4G7H C;  1PYW D;  4H7B A;  3F2B A;  3ND8 A;  3P75 A;  1FNW A;  4A3F H;  2K7V A;  3OSO A;  3CCQ A;  1N33 Q;  3I4N H;  5JEA H;  4GNX B;  5C3E G;  4BBR B;  4EGV A;  1BR9 A;  3MVV A;  3L7Z C;  5C4J B;  1C7Y A;  2Q2H A;  2XN9 C;  3OMG A;  2BDO A;  4H0L C;  4X62 Q;  1I4P A;  5EBD A;  1LT6 D;  2XTI A;  4I65 A;  1FR3 A;  1VF7 A;  1L1O B;  1VQC A;  4N8F A;  1G2S A;  2VW9 A;  1A6X A;  1I50 H;  5E3F A;  1LLR D;  4B3T L;  2L1B A;  4LWC A;  1JWM D;  5C6A A;  4ZRZ A;  4IPD A;  4OL7 A;  3LGJ A;  3M9B A;  3EA6 A;  1HR0 L;  3HFZ B;  3RMH A;  2JA7 G;  3E0J A;  2ENB A;  1V1O A;  4R8N A;  1OXU A;  1NTG A;  1UUP A;  1Q12 A;  3NTK A;  3GTJ H;  1K3R A;  4A3M H;  3TZD A;  3VR6 A;  1WI5 A;  2I5L X;  4N8X 1;  3HOU G;  4ALP A;  3MA2 B;  1TT2 A;  3TSS A;  1EZ8 A;  3RLN A;  4DK0 A;  2JEA I;  1KDC A;  3PIO A;  1VQL A;  3DM3 A;  1WOC A;  1UAP A;  3CAM A;  1EWC A;  1P8L A;  1TQO A;  1DJR D;  5BN5 A;  1VQP A;  5KNB A;  3QOL A;  4GKK L;  3J7A 5;  1IZ6 A;  1W2B A;  2F3W A;  3HGB A;  4GN3 B;  1BBX C;  1QOH A;  1HTP A;  1LTT D;  4A75 A;  1PVO A;  3M7G A;  3KLS X;  1YJ9 A;  2D0P A;  2ASB A;  3PF4 A;  4A3B B;  1L0W A;  4OGQ C;  5CC4 A;  4PG3 A;  1N36 Q;  1J5E Q;  1V8Q A;  1X32 A;  5LMN Q;  4KJO A;  2MO1 A;  1I4R A;  1N9W A;  5I9P A;  1IBL L;  1UEA B;  1X55 A;  4FYD A;  5D65 A;  5CV4 A;  3RD4 A;  5I2Y A;  4DR3 L;  2F0P A;  3PIP 3;  1STA A;  3S9W A;  4HMI A;  1JIC A;  1TWC B;  2MHV A;  4RGO S;  2NUC A;  3K6O A;  3U4Z A;  2NN6 G;  2A73 B;  2AUK A;  1R9T H;  2A68 C;  5LL6 S;  4GZY C;  4HIK A;  4A3D G;  2NB0 A;  2K5V A;  2L0C A;  2EYO A;  3K58 A;  4CDC C;  2VZA A;  3FKI B;  1B1Z A;  3K5M A;  3A8K E;  3GTK H;  1B4O A;  4DFA A;  4XQN A;  1WD1 A;  1RTN A;  3NQT A;  1X3E A;  5M3F G;  2XWB B;  3TME A;  1G6P A;  3S1M B;  3ITP A;  2F0W A;  3PUX A;  2R93 B;  2UUA L;  2QDL A;  1EYC A;  2UXD Q;  1PZJ D;  4DR7 Q;  1KLU D;  2KEN A;  3GTQ H;  5T1I A;  3O13 A;  1JE5 A;  1HZ9 A;  4U68 A;  1S5C D;  2B8F A;  4UP9 A;  3NTI A;  4PZ6 A;  3T51 B;  3ULL A;  4A3E H;  1A3T A;  1D1K A;  1Y14 B;  4IQZ A;  5E4X A;  3UDX A;  3D0F A;  4UPA A;  1S5F D;  1A15 A;  3H3V C;  2F0G A;  1HQR D;  1C9O A;  1SLJ A;  2EYM A;  5CV9 A;  1MI2 A;  1STN A;  4IPG A;  3QWN A;  3FP9 A;  4CGY B;  2IY5 B;  2A6H D;  4J8Q A;  3CD6 A;  5T1G A;  2WKD A;  1VQG A;  3CCL A;  3ND9 A;  2IX1 A;  5GAH C;  4ZAI A;  3NBH A;  4C1N K;  1XNQ Q;  2Z6B A;  3PCO B;  1TXY A;  2Z4H A;  3E0E A;  1QIL A;  5CV5 A;  3KF6 A;  2IL8 A;  2RDG A;  1SE3 A;  1EY0 A;  3PO3 B;  4MNO A;  3PMF A;  3MAQ A;  2EQS A;  1BO0 A;  1E2W A;  2PZW A;  2NVY H;  3S15 B;  4GNX C;  1HFN A;  1GUW A;  4DUY Q;  4RHR A;  4F7X A;  4IJH A;  1ZYR C;  2XSC A;  2BOS A;  2R7Z G;  2SEB D;  3EQL C;  1WCM H;  2B2W A;  4ID6 A;  1SND A;  1L1O C;  3JC6 6;  2EVB A;  3TS0 A;  3R8B A;  1D6E C;  3A0J A;  2Y0S G;  3GTG B;  3RZD B;  1IBM L;  5C4Z A;  3E5S A;  4HJ9 A;  3M4Q A;  4KN7 C;  1LTG D;  4XT1 B;  4LF7 L;  2IPK D;  2CHB D;  1MJE A;  3MXG A;  1SFO H;  2HHH L;  2I46 A;  4GLA C;  4CHT B;  2AHO B;  5LMU L;  2UXC Q;  4B3T Q;  3A54 A;  1AE3 A;  3S14 H;  1ICF B;  1NSN S;  2ZT9 C;  3MC0 B;  1QE6 A;  1PH2 A;  1LTB D;  5K36 G;  1HNZ Q;  1HR0 Q;  5M3M B;  2F0I A;  3T1Y L;  1I4Q A;  3SK6 A;  3NWS A;  2NZO A;  1EU3 A;  3EN2 A;  1VQA A;  4O0A A;  4FF3 A;  4DV3 L;  1NNX A;  1LUZ A;  1VMP A;  4BA1 I;  2JQO A;  3FDT A;  5FJ8 G;  4JI4 L;  3GD7 A;  4A3I H;  2VXW A;  4L5R C;  3UI2 A;  5C3X A;  2N49 A;  4IUV A;  2DNC A;  3VR3 A;  2EY6 A;  4LFA L;  4RGM A;  4JOI C;  1YHB A;  2EJG C;  3M3Y B;  4G7Z C;  5FLM H;  1U0L A;  2F0K A;  4KKT A;  4LNQ A;  1XPU A;  4BS9 A;  2R61 A;  2AQ3 B;  5COY A;  2LFN A;  2PQE A;  1HHV A;  1TY0 A;  1ML0 D;  4OHJ A;  2BH8 A;  1CZW A;  2F0O A;  4AH6 A;  4OO1 H;  5IP9 G;  4R4O A;  3N6R A;  1EWI A;  1HNX L;  3W3A A;  3A8J E;  4A4I A;  1JT8 A;  5LHY 1;  3M4O B;  3BJU A;  4XQJ A;  4LMQ D;  2V4D A;  1EYA A;  2HIV A;  4TSS A;  1IKM A;  1IYJ B;  3S1Q H;  2WB1 G;  2A6H C;  2PMZ E;  4JI6 L;  1SE2 A;  4A3J H;  4YIJ A;  5C0X J;  4DK3 C;  1ET9 A;  2CH4 W;  3R2I A;  4C3J G;  4Y7N H;  1SBB B;  3TP6 A;  4LFC L;  4DV7 L;  3NSW A;  1HJP A;  2FJ2 A;  3HOV H;  2JA6 B;  2Z0S A;  5KND A;  1L2F A;  1HQM C;  2Q8T A;  2RVL A;  4A3C H;  2B8G A;  2VQE Q;  1JOR A;  4DNI A;  5KEE A;  2IHF A;  1BCP D;  2F4I A;  3HOW G;  4JYA L;  1X3Q A;  2DY8 A;  3FRP B;  1U4R A;  1Z7T A;  3ONA B;  2B2U A;  1O78 A;  2K5W A;  1HUN A;  1KNA A;  1OXX K;  1K8O A;  4DNT B;  1SNC A;  5CV8 A;  4DU9 A;  1ILQ A;  3D4W A;  5ELN A;  4ZCK A;  1PH1 A;  4OO1 I;  4DV2 L;  2BE5 C;  2HDM A;  3K57 A;  1Z9F A;  4OIJ A;  1PFN A;  3PO3 G;  3E6Z X;  2ZXP A;  1PH8 A;  3CKI B;  3U4V A;  5BN4 A;  4DGZ A;  3S16 B;  2C35 B;  1UE6 A;  3CXC A;  4JVZ A;  4RCO A;  4HSP A;  5C4X H;  4OX9 L;  1CHP D;  2PQA A;  1VQK A;  1FNV A;  2OQK A;  3NTH A;  1Y69 U;  3HOZ B;  3T56 B;  1YNN C;  2CFM A;  5K5P A;  3HOX H;  1AZQ A;  1SSO A;  2DJG C;  1K83 B;  3H0G H;  3R3O A;  1PH4 A;  2F0L A;  1KXL A;  4GNX A;  2OCE A;  3G6E A;  3K7A B;  4A3D H;  3H3V H;  1SNM A;  1T9H A;  3HOY G;  4A93 B;  1LV9 A;  1A8V A;  2NVT H;  1TWF B;  3AU7 A;  3I90 A;  5J22 A;  1CA6 A;  2LMC B;  3J81 c;  1CZG A;  2J7Z A;  3VYS A;  3M85 A;  1K0R A;  3J80 c;  3PF5 A;  1TWA H;  1ENA A;  3GP7 A;  4ME5 A;  1T5X D;  4LF4 Q;  5M3M G;  3FHW A;  2L11 A;  1ZXT A;  5C0X G;  3IFT A;  3WOF A;  4P71 A;  3BZC A;  4DR6 Q;  3C1E A;  3AFQ A;  5DM7 3;  4RCN A;  3TZU A;  4CDD C;  1YNJ C;  2K01 A;  4Y52 H;  2K6A A;  1Q90 A;  3D4D A;  5IYB G;  4GOP B;  2KCM A;  3KF8 B;  4JI7 L;  1Q7Y C;  4QIW B;  4BBR H;  2YTV A;  2AMC B;  4HID A;  4A3G G;  2KHI A;  3S2D H;  5JVH 3;  4CJ2 C;  1E24 A;  2F03 A;  4ME3 A;  2N3S A;  3H3V I;  2K28 A;  5GAG C;  4R8I A;  1OXV A;  2ZJP A;  4KHZ A;  1SYF A;  1TWH B;  3KBG A;  2OEO A;  2NTT A;  2HDL A;  1CKN A;  4LF7 Q;  2ZXR A;  4JI2 L;  1B50 A;  2CQO A;  2F0E A;  2FMC A;  2QGQ A;  1I5F A;  2Q8I B;  5HUR A;  1NJI C;  1JJ2 A;  1STH A;  2OQ0 A;  1XJV A;  4IN3 A;  2HHH Q;  4CKE A;  5HGT A;  1CHQ D;  1K9M C;  1MBY A;  5IGG A;  4HAE A;  2F1M A;  3CCE A;  4F87 A;  1BDO A;  3P20 A;  2JA6 G;  3KLS A;  4JI5 L;  2DNE A;  3U50 C;  3T1Y Q;  3CC2 A;  4R4T A;  4DV3 Q;  4BXX G;  4IUN A;  2F0U A;  4G7O C;  4CDF C;  5IIF A;  3BS1 A;  5M5W B;  3QR8 A;  3MTS A;  3K81 C;  4XXE A;  4JI4 Q;  4DAY A;  4C3H G;  1RDP D;  5C5L A;  4GKJ L;  1PH9 A;  3QB3 A;  4FO2 A;  1EU4 A;  1STE A;  3I8Z A;  2XGT A;  4JV5 Q;  2ID0 A;  4LFA Q;  3TDQ A;  4LF6 L;  2K14 A;  5IGF A;  2IWH A;  4A3B H;  1KD1 C;  4X66 L;  3MFG A;  4KI0 A;  5JJL A;  1EOT A;  3KJP A;  2XVS A;  4C3I G;  1QZG A;  5LL6 X;  1XWE A;  3SE0 A;  1SNQ A;  5IE8 A;  4WOR A;  1ONL A;  5EJW A;  2HCC A;  1HNX Q;  1Y1V G;  1PXU A;  4DUZ L;  1IL2 A;  1DOM A;  2D9U A;  2PI2 A;  1E22 A;  2B63 G;  5KIX A;  1TWC H;  5JAV A;  2KUM A;  1LT5 D;  1QNK A;  1JOK A;  4JI6 Q;  2A74 C;  4CJ0 B;  4YWK A;  2EYL A;  4ZK9 B;  3PIO 3;  1SYC A;  2NVQ B;  2NBF A;  4DV4 L;  1LYL A;  5I4D A;  2F0Q A;  2D62 A;  4DV7 Q;  4LFC Q;  1VQM A;  1EQR A;  2VB2 X;  4ZUJ A;  3J7Z C;  2F0V A;  1Z47 A;  3FKI H;  1K8M A;  2QEJ C;  2R7F A;  1IBK L;  1FL0 A;  1X56 A;  1XMQ L;  1QZH A;  1IHZ A;  2CW0 D;  1XYI A;  3CU7 A;  2RSO A;  4DR4 Q;  1K28 A;  4PNY A;  2BA0 A;  2G5D A;  5IP9 H;  4L5T A;  2Z1C A;  3A5U A;  3NXW A;  2JK8 A;  3F2C A;  3WOE A;  4AIM A;  3SVM A;  3S1M H;  3VA5 A;  1SAP A;  2R93 H;  1F9Q A;  2JEB I;  2IW3 A;  4OWX B;  3W1G A;  2KHJ A;  1RJT A;  1CUK A;  4LUV A;  2OF1 A;  1OXS C;  4IFD J;  3GTM H;  2KEC A;  4FXD A;  5I6W A;  2VUM B;  1QVF A;  3Q8D A;  4HMJ A;  4E6I A;  2ES2 A;  4XQQ A;  2Z6K C;  1KC8 C;  3J7A V;  4OX9 Q;  2KJX A;  3OIQ A;  3OMC A;  2E75 C;  2F0S A;  5EPL A;  5M3F B;  3AFP A;  4NW2 A;  1EL0 A;  3V96 A;  1SRO A;  5IYC G;  5IGB A;  1I3Q B;  4LW1 A;  3AQQ A;  1JWU D;  2K04 A;  5KGU A;  2ZTC A;  3A74 A;  1PYB A;  1DOK A;  4DR5 L;  4P72 A;  3URY A;  3ULP A;  4X3T A;  1JR0 D;  1XTD A;  1FD7 D;  3CRK C;  3CQZ B;  4EQ5 A;  1PRT F;  3U58 A;  4LFB L;  4JK1 C;  2NVX B;  4HIO A;  3A7L A;  5E7N A;  4B3S L;  2DGY A;  4WFN 3;  3NP8 A;  2AQ1 B;  5KYL A;  1WTQ A;  1IYU A;  1FYC A;  2WAQ B;  1EY8 A;  2PNR C;  4GOP C;  3K80 C;  4KY5 A;  3WDN A;  3S15 H;  2HQE A;  4KHP Q;  1SNP A;  1QUQ A;  3HKZ E;  4R4C A;  5ELD A;  1YIT A;  2KA7 A;  3OPO A;  4KV6 A;  2MNA A;  4IUR A;  3SGI A;  3TRZ A;  3U9O A;  2EZV A;  1HXY D;  3PQI A;  3G7L A;  4BA2 I;  1Y8O B;  1C0A A;  3GTG H;  3RZD H;  1M1K C;  2DY7 A;  1H9S B;  3J80 L;  4JI7 Q;  1CFM A;  1DOL A;  2C5C A;  4GS3 A;  4EVO A;  2Z9H A;  1XPO A;  3MXP A;  2I5H A;  2K33 A;  2RDF A;  1HH2 P;  1O80 A;  1O7Y A;  2ZXO A;  4IOA A;  1X9N A;  1YJN A;  1KLG D;  4YWM A;  2A6E C;  4L5Q A;  4DXF A;  2R7Z B;  5M3M H;  3JAM c;  4B3M Q;  4DKA C;  1Q81 C;  2ICE C;  4IFD G;  2E2H B;  4J15 A;  1ASY A;  5M5X B;  2PW7 A;  2Y0S B;  1YZ6 A;  1KRT A;  5KYI A;  3EJI A;  1Q82 C;  2D0O A;  5D3D A;  3CCS A;  5FK9 C;  1MJC A;  2TSS A;  1LM0 A;  3LWE A;  4NXN Q;  3SDZ A;  1AFP A;  5CBA E;  4K0K L;  2R3Z A;  1Q1B A;  1S4Z A;  4JI5 Q;  1DYQ A;  1L0Y B;  3M3Y H;  3G71 A;  1SYE A;  2FMM A;  5JVG 3;  2KBN A;  2E2J H;  4YCU A;  3J7Y W;  3SR1 A;  3KBX A;  3S1R B;  1NAP A;  1A63 A;  3MXN B;  4FF4 A;  2E8G A;  4GKJ Q;  3KUP A;  4LF9 L;  5M5Y B;  1D5Z C;  3T4A C;  3M4O H;  3I4M G;  3MHB A;  4P2C B;  3FEW X;  4CKC A;  2MGS A;  2VL6 A;  4X66 Q;  3RN5 A;  3ERS X;  4LUO A;  4C2M H;  1N32 L;  1HRJ A;  3S1N B;  2BDN A;  1HZC A;  3I4L A;  5IT9 L;  2HIX A;  3F2U A;  2VUM G;  3VR2 A;  1EY5 A;  3RLF A;  1CQV A; 
#chains in the Genus database with same CATH homology
 3CCV A;  3J80 i;  1Q46 A;  2RCN A;  3HKS A;  1D8L A;  2ZM6 L;  2N78 A;  4LFA L;  4JOI C;  2UUC Q;  1YHB A;  1FJG L;  2JA6 H;  2R6G A;  1Q86 C;  2YTX A;  5FLM H;  1U0L A;  1EIF A;  2IT1 A;  4LNQ A;  3HOW H;  1U5K A;  1XPU A;  4BY7 H;  1KQS A;  4BXX H;  3K0X A;  2JJQ A;  3PUZ A;  2OWO A;  4X64 L;  1XNQ L;  1BBW A;  2A19 A;  2BH8 A;  2VQF L;  4JI0 Q;  4AH6 A;  2Q2U A;  5IP9 G;  4DV4 Q;  2EIF A;  5LMN W;  2Q2T A;  3CPF A;  2E5L L;  4R4O A;  1EWI A;  1V43 A;  4JBW A;  1N34 Q;  1HNX L;  4A4I A;  1JT8 A;  3EBE A;  5GAE C;  3OYY A;  4JCV E;  1YBY A;  1M90 C;  2A8V A;  1SMX A;  3BJU A;  5HY6 A;  1Q8K A;  2HIV A;  3CPW A;  4A76 A;  2MQH A;  1IYJ B;  1QVG A;  3B6Y A;  3S1Q H;  2WB1 G;  2PMZ E;  5DLQ E;  4JI6 L;  1IBK Q;  4A3J H;  3PO3 H;  1V9P A;  4B3M L;  1H95 A;  3W5O A;  2OTJ A;  1RIP A;  5C0X J;  3ZJY C;  4DK3 C;  3D31 A;  1XMQ Q;  4IJL A;  3I4O A;  3PGZ A;  4Y7N H;  2MO0 A;  2PQA B;  3GO5 A;  3GTP H;  2WAQ G;  2MFI A;  4LFC L;  4DV7 L;  3G4S A;  1PH6 A;  3S16 H;  2ATW A;  2UUB Q;  4A3I G;  4QGU A;  4A3K H;  1HJP A;  3HOV H;  1EOV A;  1E1T A;  2Z0S A;  3J81 j;  1KHI A;  1L2F A;  2AWO A;  3BZK A;  3HOZ H;  4NXN L;  4BY1 G;  1J5E L;  4A3C H;  5LMN L;  2JA9 A;  3T1H Q;  4TVA B;  4YHH Q;  1P16 A;  1KL9 A;  2VQE Q;  4DNI A;  3CCU A;  2IHF A;  4BBS H;  4A3L G;  2UXB Q;  5FLM G;  3HOW G;  4HJA A;  4BY7 G;  4JYA L;  1K83 H;  4DV5 Q;  3CMA A;  5IT9 c;  1A62 A;  3AEV A;  1EYG A;  3E9I A;  2JE6 I;  1OXX K;  5C44 G;  3HOY H;  3K7A H;  3KOJ A;  2UU9 Q;  4OO1 G;  1I6H H;  2UXC L;  5AJ3 Q;  1HNW Q;  4JI1 Q;  1NE3 A;  1VQ5 A;  2F4V L;  4WJ3 M;  2GVB A;  3PV0 A;  3STB C;  3PO2 H;  4GN4 B;  1HNZ L;  4A93 H;  3S1R H;  1UE5 A;  5EAY A;  3TQY A;  4LF8 Q;  5ELN A;  1PH1 A;  1EQQ A;  1JMC A;  4OO1 I;  5H1S E;  5BR8 L;  4DV2 L;  1VQ7 A;  4JBJ A;  4UY8 C;  4RG1 A;  1MIU A;  1Z9F A;  5M5Y H;  4A3J G;  3PO3 G;  4YY3 L;  2RHQ B;  1PH8 A;  3U4V A;  4DV0 L;  2C35 B;  1UE6 A;  3CXC A;  1Y1W G;  1VQE A;  5C4X H;  4JI2 Q;  4DR2 L;  4OX9 L;  2PQA A;  3H15 A;  1VQK A;  1SR3 A;  1GO3 E;  2OQK A;  3CF5 A;  1BBU A;  4HJ7 A;  2Q2I A;  2CFM A;  1ASZ A;  1YNX A;  4A3K G;  1NMF A;  3HOX H;  3HOV G;  1Q1E A;  4MZ9 A;  4AYB E;  2JA8 G;  2BA1 A;  3ULJ A;  2F52 A;  1FGU A;  4LFB Q;  3H0G H;  2HT1 A;  3HOZ G;  4X6A H;  5IYB H;  1PH4 A;  4A3C G;  1VS0 A;  4QIW E;  4B3S Q;  1KXL A;  4GNX A;  4DPG A;  2FXQ A;  5IP7 H;  3TEH B;  4BBS G;  2OCE A;  3G6E A;  4NXM Q;  4A3D H;  3H3V H;  4R4Q A;  4HIM A;  1X3F A;  1GVP A;  1T9H A;  4O2D A;  4A3G H;  2ZJQ A;  1N34 L;  3CCM A;  3HOY G;  1PYS B;  4YCW A;  1EFW A;  1A8V A;  4JI3 Q;  2UXD L;  3F8T A;  2NVT H;  1G51 A;  1K8G A;  4A93 G;  3NEN A;  3J81 c;  3JAM i;  3M85 A;  1TWG H;  2YU9 H;  1AH9 A;  1K0R A;  3J80 c;  3PF5 A;  1TWA H;  4UP7 A;  1DGS A;  1LTL A;  4XIG S;  4LF6 Q;  3RR5 A;  4NXM L;  2K4K A;  1CKN B;  4LF4 Q;  5M3M G;  3FHW A;  1CSQ A;  1VCI A;  3KDF B;  1E7Z A;  3M4P A;  4DK6 C;  3PUY A;  5C0X G;  3BU2 A;  2UUB L;  1OXT A;  1UE7 A;  4P71 A;  3S2H H;  5C4X G;  3PSI A;  1YI2 A;  3BZC A;  2PI2 E;  4DR6 Q;  2WP8 J;  1VQH A;  3AFQ A;  2IX0 A;  1WFQ A;  3EIV A;  4AQY Q;  4DV1 Q;  5JEA J;  5C0X I;  3OW2 A;  3HOX G;  3PUW A;  4DUZ Q;  2ZTD A;  5C3E H;  4Y52 H;  4GLV B;  3K7U C;  2VQE L;  1EUJ A;  3H0G G;  1N8R C;  5IYB G;  4GOP B;  2KCM A;  3KF8 B;  1SN8 A;  5IP7 G;  4JI7 L;  2A1A A;  1B8A A;  1Q7Y C;  4BBR H;  5GQO A;  4YWL A;  4EX5 A;  2VY3 A;  4FDB A;  2LSS A;  2YTV A;  2AMC B;  4GKK Q;  2Z6K A;  2UU9 L;  1VQI A;  4HID A;  4DAY B;  2NZH A;  1PHJ A;  1UE1 A;  2KHI A;  4JI1 L;  3S2D H;  4A3G G;  4C3H H;  2AKW B;  1E24 A;  1XPR A;  1WYD A;  4ME3 A;  5M5W H;  2N3S A;  4LF8 L;  4UP8 A;  3H3V I;  5HGQ A;  5JJK A;  4XTC S;  5GAG C;  2JA7 H;  4X65 L;  1OXV A;  1SE8 A;  2ZJP A;  4POG A;  4LUZ A;  2JA5 G;  3CP0 A;  1S3O A;  4JBM A;  2YV5 A;  4P75 A;  4DUY L;  3I55 A;  2PNH A;  4KHZ A;  3F2D A;  1HR0 W;  4C3I H;  1CKN A;  5IYD H;  4LF7 Q;  4JI2 L;  2CQO A;  3KDF A;  2QGQ A;  4JI8 Q;  1I5F A;  1NJI C;  1JJ2 A;  3HOU H;  4L5S A;  2OQ0 A;  1IBL Q;  1XJV A;  1I94 L;  1XNR L;  2ZJR A;  2R92 H;  2HHH Q;  4DR3 Q;  2RHS B;  1Y1V H;  1EIY B;  1K9M C;  3F2B A;  2KCT A;  4POF A;  3CC7 A;  4A3F H;  3CCE A;  3CCQ A;  1K8A C;  4LF9 Q;  1N33 Q;  2B63 H;  1YHQ A;  3I4N H;  4GNX B;  5C3E G;  1IXR A;  3F1Z A;  2BH2 A;  2JA6 G;  4JI5 L;  1A0I A;  3U50 C;  3T1Y Q;  3CC2 A;  4R4T A;  4DR1 Q;  3UDF A;  3L7Z C;  1PA6 A;  1C7Y A;  2Q2H A;  3KFU A;  4JG2 A;  4GOP A;  4X62 Q;  4DV3 Q;  4BXX G;  4GN5 A;  4BBR G;  4QL5 A;  2XTI A;  5IWA L;  4IO9 A;  4HJ8 A;  1VQC A;  1L1O B;  2VW9 A;  4NB3 A;  1MKH A;  4JI4 Q;  3K81 C;  1I50 H;  2NVQ H;  4B3T L;  3E9H A;  4LWC A;  4GKJ L;  4DV6 L;  4QQB X;  1PH9 A;  4IPD A;  3OTO Q;  3LGJ A;  3M9B A;  5GRO A;  1HR0 L;  3HFZ B;  2ZM6 Q;  2XGT A;  1E1O A;  1TWF H;  2JA7 G;  2ID0 A;  4LFA Q;  4JV5 Q;  1NY4 A;  4LF6 L;  2K14 A;  3UDI A;  2DUD A;  4LF4 L;  4A3B H;  1OXU A;  1NTG A;  4X66 L;  1KD1 C;  4LF5 L;  4APV A;  1SRU A;  4KI0 A;  3GTO H;  1Q12 A;  1V1Q A;  3GTJ H;  5JJL A;  3KJP A;  1K3R A;  4P74 A;  4X64 Q;  4A3M H;  1QZG A;  4B3R L;  5IYD G;  1XMO L;  2H5X A;  1PH5 A;  1WI5 A;  2I5L X;  2VQF Q;  2UUA Q;  2CWA A;  3CCR A;  4DR5 Q;  3HOU G;  4DR6 L;  5IE8 A;  2E5L Q;  4OXP A;  4ALP A;  1VQO A;  1JB7 A;  2R92 G;  1B7Y B;  1HNX Q;  1Y1V G;  1X65 A;  3UDG A;  3RLN A;  4DUZ L;  1IL2 A;  1PV4 A;  2JEA I;  2UUC L;  4A3F G;  1B70 B;  3PIO A;  2PI2 A;  1VQL A;  1E22 A;  3DM3 A;  1WOC A;  2B63 G;  5JEA G;  3CAM A;  2K52 A;  1TWC H;  1P8L A;  4JI6 Q;  4YWK A;  1VQP A;  4GKK L;  1YIJ A;  4JI0 L;  3ICE A;  3J7A 5;  3RLO A;  4DV4 L;  1IZ6 A;  1W2B A;  1HZA A;  1LYL A;  4GN3 B;  1S40 A;  2VUM H;  2D62 A;  4A75 A;  4DV7 Q;  1L1O A;  1VQM A;  4LFC Q;  1PVO A;  1D7Q A;  1UEB A;  1YJ9 A;  1EQR A;  3J7Z C;  2IHE A;  1BVS A;  2D0P A;  2ASB A;  4IFD I;  3PF4 A;  3IRB A;  3PO2 G;  4R4I A;  1Z47 A;  3FKI H;  1L0W A;  5IYC H;  1VQ4 A;  2R7F A;  1IBK L;  2QA4 A;  4PG3 A;  1N36 Q;  1FL0 A;  1JJG A;  5M3F H;  1W3S A;  1YVC A;  1J5E Q;  2B3G A;  1X56 A;  5LMN Q;  1XMQ L;  1YHA A;  1QZH A;  2MO1 A;  1PH3 A;  3K8A A;  4A3B G;  3PIP A;  1N9W A;  5GAD C;  4DR4 Q;  4JI8 L;  2BA0 A;  1I3Q H;  5IP9 H;  1IBL L;  4L5T A;  3KLW A;  1GKH A;  3A5U A;  4A3M G;  1X55 A;  3GTL H;  2JK8 A;  1TWH H;  3F2C A;  4AIM A;  3S1M H;  4DR3 L;  2R93 H;  2OTL A;  2JEB I;  4OWX B;  2F4V Q;  3UE1 A;  2L15 A;  3W1G A;  2KHJ A;  2GVA A;  2F3I A;  1N33 L;  4RMF A;  1UWV A;  3OTO L;  1VQJ A;  3U4Z A;  3T1H L;  1CUK A;  2NN6 G;  2R7D A;  4YHH L;  5JJI A;  3G48 A;  4LUV A;  3TS2 A;  2UXB L;  5BR8 Q;  2CKZ B;  1R9T H;  1OXS C;  2NVX H;  1FVI A;  4DV5 L;  1VQ9 A;  3KYH C;  3GTM H;  4X62 L;  4IFD J;  4HIK A;  4OWT B;  2NN6 I;  1QVF A;  4A3D G;  3Q8D A;  4AYB G;  3GDE A;  1QUQ B;  5C4J H;  1CSP A;  2ES2 A;  2K5V A;  2LXK A;  2Z6K C;  2LXJ A;  5AJ3 L;  1KC8 C;  1HNW L;  2VZA A;  4OX9 Q;  4DR2 Q;  2VNU D;  2K75 A;  3GTK H;  4OWW B;  4NPS A;  4BY1 H;  3AFP A;  4JV5 L;  4JOI A;  3FKI G;  1SRO A;  5IYC G;  4A3L H;  4JBK A;  4JC0 A;  1X3E A;  2V1C C;  5M3F G;  1CKM A;  1IBM Q;  3VDY A;  4K0K Q;  4LW1 A;  3AQQ A;  1G6P A;  2B29 A;  3NBH B;  2ZTC A;  3A74 A;  3S17 H;  3PUX A;  5C44 H;  1PYB A;  1VQB A;  2UUA L;  1YEZ A;  2GN5 A;  4DR5 L;  1VQF A;  4P72 A;  3KF6 B;  3WWV A;  3S24 A;  2I0Q A;  4PMW A;  2CCZ A;  3ULP A;  4R1J A;  3TRE A;  1AE2 A;  1XTD A;  4GLX A;  2R93 G;  4QJF A;  5LMU Q;  4DR7 Q;  2UXD Q;  2N8N A;  2KEN A;  1RL2 A;  4EQ5 A;  3U58 A;  1YJW A;  3GTQ H;  4LFB L;  4HIO A;  5E7N A;  3KJO A;  1JE5 A;  4B3S L;  2DGY A;  1HZ9 A;  1GM5 A;  4UP9 A;  4PZ6 A;  3ULL A;  4A3E H;  4H02 A;  1Y14 B;  4GOP C;  3K80 C;  2K5H A;  1O7I A;  3D0F A;  4UPA A;  3UDX A;  2Y0S E;  2R7Z H;  4IOC A;  1Y1W H;  3S15 H;  4KHP Q;  4IPH A;  3NEM A;  1C9O A;  1N32 Q;  1JJC B;  1QUQ A;  4JI3 L;  3HKZ E;  4R4C A;  2E2H H;  1YIT A;  1SLJ A;  2MNA A;  3SGI A;  2CWP A;  1WJJ A;  5M5X H;  2JA8 H;  3TRZ A;  2K5N A;  1N36 L;  1NMG A;  1J6Q A;  5FLX c;  2HQL A;  2RF4 A;  4IPG A;  3FP9 A;  2IY5 B;  1FJG Q;  2EXD A;  3I4M G;  1S72 A;  4BA2 I;  3CD6 A;  1C0A A;  1VQG A;  3CCL A;  3GTG H;  3RZD H;  4DR4 L;  2IX1 A;  1M1K C;  5GAH C;  4JI7 Q;  2K50 A;  3UE0 A;  1E3P A;  3DLL A;  4GS3 A;  1HZB A;  1PFS A;  3CCJ A;  1K73 C;  1XNQ Q;  1XPO A;  2AWN A;  3ER0 A;  1TXY A;  3CW2 C;  3E0E A;  3PCO B;  2I5H A;  2ZTE A;  3KF6 A;  1QVC A;  1KIX A;  4AQY L;  4DV1 L;  3NEL A;  3RZO H;  1HH2 P;  4IPC A;  4IOA A;  3I56 A;  1X9N A;  4OON A;  4MNO A;  1KRS A;  2EQS A;  1YJN A;  3I4M H;  3I4N G;  3CME A;  4X65 Q;  3AYH B;  4YWM A;  2NVY H;  4L5Q A;  3PUV A;  4HJ5 A;  4GNX C;  5M3M H;  3JAM c;  4B3M Q;  4DUY Q;  3I7F A;  4DKA C;  1Q81 C;  4A3E G;  4IFD G;  1X6O A;  4IJH A;  5FJ8 H;  2R7Z G;  4J15 A;  1ASY A;  4WJ4 A;  1WCM H;  2ALY B;  1YZ6 A;  4TQU S;  1KRT A;  4PZ8 A;  1VQ8 A;  1L1O C;  1Q82 C;  1I94 Q;  1XNR Q;  2D0O A;  3S1N H;  3JC6 6;  3TS0 A;  3A5Z B;  3CCS A;  3STB D;  1MJC A;  3A0J A;  2Y0S G;  1LM0 A;  2VS1 A;  1OTC A;  3M7N A;  4NXN Q;  1IBM L;  4K0K L;  3HKZ G;  4HJ9 A;  1VQD A;  3M4Q A;  1VQ6 A;  1Q1B A;  3CC4 A;  4JI5 Q;  1KAW A;  4PZ7 A;  4JYA Q;  4LF7 L;  3M3Y H;  3L0O A;  3G71 A;  1MJE A;  2E2J H;  2KBN A;  1CKO A;  2WB1 E;  4YCU A;  1X54 A;  5IWA Q;  1SFO H;  2HHH L;  4MTN A;  4YCV A;  4GLA C;  2AHO B;  5LMU L;  4DR7 L;  2UXC Q;  2YTY A;  3MXN B;  4B3T Q;  1AE3 A;  3S14 H;  1A63 A;  5IY0 A;  3RNU A;  1GD7 A;  2E8G A;  1G29 1;  3MEF A;  1BKB A;  4DV6 Q;  1PH2 A;  1NBW A;  4LF9 L;  4GKJ Q;  5K36 G;  1X3G A;  1HNZ Q;  1HR0 Q;  2JA5 H;  2WAQ E;  3M4O H;  3T1Y L;  2WFW A;  4QY7 A;  4DR1 L;  2NZO A;  2YYZ A;  3CQZ H;  3EN2 A;  4P73 A;  4DV2 Q;  5ELO A;  3RN2 A;  1VQA A;  4O0A A;  4DAM A;  4DV3 L;  2I5M X;  2VL6 A;  4KLK A;  5J3B A;  4X66 Q;  3I2Z A;  4C3J H;  4YY3 Q;  3RN5 A;  4LF5 Q;  4KHP L;  3ERS X;  1LUZ A;  4LUO A;  4C2M H;  4DV0 Q;  2E2I H;  3W1B A;  2JQO A;  4BA1 I;  1N32 L;  5FJ8 G;  4JI4 L;  1VQN A;  4B3R Q;  1HZC A;  3GD7 A;  4A3I H;  1PH7 A;  4L5R C;  2QEX A;  1XMO Q;  2HIX A;  1WCM G;  2VUM G;  2N49 A;  3J81 i;  3L2P A;  3RLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...