4JI2Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji2Q00
2JA6G 4UP7A 3UDIA 3PV0A 1XNRL 1LYLA 4FDBA 4OWXB 3EIVA 4B3TL 5LMNL 4DV1Q 4H02A 3NENA 2CWAA 4ME3A 4JI8L 1SROA 3CAMA 1Q81C 4BBRG 5C0XG 1YHBA 4X64L 3CC4A 4OWWB 1PH7A 1IBKL 1A62A 4B3MQ 4BA2I 2BA0A 2DUDA 1XTDA 3MXNB 4A4IA 1PH3A 4O0AA 1XNQQ 4IPDA 2NZHA 1Z9FA 1KC8C 5IYBH 3PO2H 3M4PA 3HFZB 2OWOA 2PQAB 3HKSA 4KLKA 2ASBA 1VQ6A 3U50C 4A3CH 4PZ7A 2R7ZG 2GVAA 2PMZE 1QZHA 2JA5H 2VUMH 4KHPL 4JCVE 1UEBA 4A3EH 2R6GA 3WWVA 3ZJYC 1HR0W 1N33Q 2NVTH 3KF6A 1TXYA 3L7ZC 4DV7Q 2D0OA 3H3VI 2ATWA 4YY3Q 2MNAA 3PGZA 1SMXA 4GS3A 4YCUA 3OTOL 1TWHH 1U5KA 3IRBA 3HOZH 3AYHB 3NBHB 1J5EL 3PIPA 1M1KC 1LM0A 3FKIH 1XNRQ 1EQQA 4B3TQ 1O7IA 3CMEA 2Y0SE 4YWLA 2OCEA 1NTGA 3D0FA 4IFDG 4JYAL 3KJOA 4TVAB 3MEFA 3PCOB 1XPRA 1AE2A 4MNOA 3D31A 4X64Q 2NN6G 1I5FA 1NMFA 1IBKQ 4JV5L 3HOWG 4DV4Q 4A3LH 1YI2A 4GOPC 3CCLA 1PH6A 1E22A 4GLVB 1J6QA 2A8VA 1VQEA 1I50H 1SLJA 3TS0A 1ASZA 5GADC 4QL5A 1PV4A 1XMQL 3DLLA 2N3SA 2HT1A 4Y52H 4IJLA 3EN2A 3UDGA 3M7NA 5C4XG 4DR3L 2VZAA 2JK8A 5IY0A 3OTOQ 1MKHA 4GOPA 2BH8A 1J5EQ 3PUZA 3J80c 1EQRA 1P16A 1YITA 2C35B 3TQYA 4YCWA 1KQSA 3GD7A 4XTCS 2ZM6L 1GVPA 2I5HA 1VQJA 4R4OA 1S72A 4JYAQ 4LWCA 2UUCQ 4HIDA 2YV5A 2HIXA 1QUQA 1HZ9A 4IPGA 4NXNL 2V1CC 3RLNA 3H0GG 3T1YL 1N9WA 1Y1VG 2K5NA 5C0XJ 1YJNA 4JV5Q 1X65A 4LUZA 4HJ8A 1B7YB 3PUWA 4DR2Q 2VQEL 4R4TA 4LF5L 1YZ6A 4HJ5A 1L1OC 4LUOA 2NVXH 3SGIA 3CCJA 2JEBI 4OX9L 5GAGC 3GTGH 1JJCB 1L2FA 4IPHA 2N49A 4MZ9A 1XMQQ 4JI0L 1S40A 1FVIA 3I4OA 1K8GA 1UWVA 3OYYA 4IO9A 2AWNA 4A93H 3CPFA 4A76A 1WI5A 4DV0L 3I4NH 3K7AH 3U4VA 1L1OA 4KHZA 1N36L 4GOPB 3PF5A 1KIXA 1U0LA 1PH4A 3S1MH 5M3FH 3HOUH 3L2PA 1QVGA 2ZM6Q 4AYBG 5IP7G 2VW9A 3TREA 4HJAA 3GTMH 2L15A 3KFUA 3HKZE 1BBWA 2OQ0A 4UPAA 3T1YQ 1K3RA 1XPOA 2E5LQ 4NXNQ 3M3YH 1HNXQ 4IFDJ 1K9MC 1G291 4L5TA 4POGA 1VQFA 4BY7H 4OWTB 5BR8L 5JJLA 5IP9H 4R4QA 3CD6A 2VQEQ 1OTCA 2R93G 5JEAG 5IYDH 4DV1L 4PZ6A 2R92H 2RF4A 2QGQA 4B3RL 1EUJA 2D62A 4YWMA 4OX9Q 3CQZH 3BU2A 1GKHA 2YTYA 4POFA 4A75A 4JI0Q 1WCMG 4B3ML 3GTKH 4A3IG 3PO3G 1UE5A 3F2BA 1VQNA 2PQAA 4HIMA 4DV5L 5M3MH 4DV0Q 3NELA 2XTIA 3GO5A 2Q2TA 2Q2UA 4JI4L 2ALYB 2HQLA 3TEHB 4DR5Q 1N36Q 1HNZQ 1PH9A 3TRZA 2EIFA 5C4JH 1PH5A 2RHSB 2YTXA 1Q1EA 1Y14B 4GN4B 1IL2A 4NB3A 2A1AA 1X6OA 4UP9A 3ULJA 1VQ9A 4JI3L 1T9HA 1NY4A 1RIPA 1IBML 4L5SA 3GTQH 3HOVH 1JT8A 2JA6H 2Q2IA 4DK3C 1XPUA 1VQHA 1C0AA 5BR8Q 1G51A 4DR4Q 5K36G 3M85A 2ES2A 2KHIA 2UUBL 1HZBA 4BBRH 4X6AH 3CCUA 4B3RQ 3U58A 4JI1Q 3CCVA 1Y1WG 2NVYH 1CKOA 2E2IH 4O2DA 3HOXG 2WAQE 3CPWA 1EOVA 2JJQA 2NZOA 3HOYG 4DV4L 1VQ7A 3F2CA 4DV5Q 1WFQA 5C3EH 2ZJQA 3CP0A 2JA7G 4JI4Q 4JBKA 2CCZA 2R7ZH 1TWGH 4LF7L 2GVBA 5FLMG 2CQOA 2UXCQ 4JBJA 4IPCA 1VCIA 2OQKA 3A5ZB 1MIUA 4BA1I 1HJPA 2F52A 3J80i 1V9PA 1IBMQ 2H5XA 4JI3Q 4B3SL 2CWPA 2K4KA 4DV3Q 4GN3B 4A3JG 3GTOH 2UXDL 4EX5A 5IT9c 2ID0A 3JAMc 1Q7YC 3BZKA 4X65L 1YJ9A 2UUBQ 1PYBA 1BVSA 3H15A 5JEAJ 2UUCL 1VQ4A 1E7ZA 3M9BA 1K0RA 4A3FG 5LMNW 3STBD 3HOWH 3NEMA 4JI7L 1IBLL 4UY8C 4A3CG 1KD1C 1PYSB 4DPGA 3AFPA 4DR2L 3M4QA 3UE0A 1Q86C 5GQOA 3UDFA 4LF6L 3I7FA 4LF7Q 3ER0A 1HZCA 2WP8J 4P74A 3JC66 2LXKA 1WOCA 4OXPA 4DV2L 2BA1A 5C4XH 3GTPH 3CMAA 3G4SA 1NE3A 3FKIG 2K75A 4DK6C 4R1JA 4AH6A 3J81c 3RN2A 1VQMA 4B3SQ 3ERSX 1KRTA 4A3BG 3CCRA 2UXDQ 2IY5B 3PUVA 4Y7NH 1XJVA 3FHWA 1VQ8A 4JI5L 1TWAH 4X65Q 3S1RH 4R4IA 5GAEC 1JJGA 1VQDA 1B8AA 2N78A 2AHOB 1EWIA 1BKBA 1VQCA 1VQIA 2E8GA 2K50A 3H0GH 3U4ZA 2E5LL 1D7QA 1HNXL 1MJEA 4PMWA 4JOIC 4JI7Q 1IBLQ 1VQPA 2WFWA 5ELNA 1Q82C 1NBWA 3DM3A 4K0KL 4LF8Q 4WJ4A 5J3BA 2B3GA 3E9HA 1EYGA 2K14A 3RNUA 4LF6Q 4GLAC 1OXSC 3FP9A 2LXJA 3UDXA 5IWAL 4C3IH 1NJIC 5DLQE 4DV2Q 3I56A 1CSQA 1KHIA 5FJ8G 5C44H 4JOIA 3RZDH 5IE8A 1X56A 4GN5A 4JBWA 4PZ8A 5JJKA 1PFSA 2HIVA 1CKNA 3K0XA 4DR5L 1HNZL 4LF9L 1VQAA 2VY3A 1NMGA 4GNXA 3I4MH 4JI5Q 1HH2P 1SFOH 5IP7H 3K81C 5M5YH 4IOCA 1X3EA 1EFWA 4C3JH 1YVCA 2AKWB 1MJCA 1KL9A 1VQGA 2KCTA 4A3KG 4BY1G 3S15H 3CCMA 3RLOA 2UU9L 1X9NA 3CW2C 4UP8A 2IX0A 2QA4A 2I0QA 2IHFA 2R93H 3KJPA 3GTJH 4K0KQ 2B29A 4J15A 1E1TA 4DR4L 1VQOA 1IXRA 3RLFA 1PHJA 2ZTCA 4PG3A 4JI1L 4BXXH 3S2DH 1WCMH 3F2DA 1VQBA 2DGYA 5IWAQ 1SRUA 2ZJPA 4A3IH 2JA8G 3PO3H 2PNHA 1OXVA 4AYBE 4DAYB 1K8AC 3PUXA 4NXML 5HGQA 5IYCG 1N8RC 1I94L 3A5UA 5M3FG 4LFBL 4ALPA 3EBEA 3G48A 4BBSG 4LFCQ 4IJHA 1Q46A 3CXCA 3H3VH 4LF9Q 4A3DH 2UXCL 3K7UC 1A8VA 5JJIA 1CKNB 4AQYQ 1OXXK 4GNXB 1L0WA 1C9OA 2B63H 4DR7L 4RG1A 5LMUL 1W3SA 1S3OA 4YHHL 4LFAL 1KAWA 2Z6KC 3J7ZC 4OONA 4JI6Q 3B6YA 3KLWA 2UU9Q 4DV3L 3JAMi 2K5VA 1E3PA 1SE8A 2RCNA 3AQQA 1FJGL 3CCSA 3J81j 2QEXA 1N34L 3ULPA 1Y1WH 2A19A 2K5HA 4KI0A 1HR0L 1TWFH 3F1ZA 1PH8A 1E24A 3BJUA 1WYDA 4MTNA 2Z6KA 4X66L 3HOXH 4HIOA 3HOYH 4NXMQ 2CFMA 3I2ZA 4LF4L 2IHEA 3VDYA 4A3GG 2JA7H 1I94Q 3E9IA 4TQUS 3T1HL 4A3MG 4LFBQ 3STBC 4LUVA 1FGUA 5FLMH 5E7NA 4DV6L 5ELOA 5M5WH 5H1SE 4DR1L 1LUZA 2Q2HA 4DR7Q 2CKZB 5LMUQ 3OW2A 3J81i 1K73C 2N8NA 4OO1I 4LFAQ 4YHHQ 3HOZG 5FLXc 1VQLA 2ZTDA 4A3JH 2KBNA 3PUYA 4C2MH 1PVOA 1N32Q 1WJJA 1FJGQ 4QIWE 3G71A 2YU9H 4DUZL 3PIOA 3A74A 1YHAA 1I3QH 2F4VL 1EIYB 1N34Q 3W5OA 1CSPA 4A3FH 1HR0Q 1OXTA 4X62Q 1HNWL 5EAYA 1HZAA 3PO2G 4X66Q 2VL6A 2Y0SG 3PSIA 5IYBG 5C3EG 2OTLA 1KRSA 3TS2A 1VS0A 4QY7A 4LF4Q 4R4CA 1YBYA 3F8TA 2JA5G 5HY6A 3T1HQ 2VUMG 2R7DA 4A3EG 4C3HH 3S1QH 1IZ6A 2Z0SA 4LF8L 2UXBL 1RL2A 4GLXA 3BZCA 4DV6Q 2XGTA 1PH2A 1YIJA 2F3IA 4DUYL 4DR1Q 2YYZA 1H95A 1SN8A 4HJ7A 3W1BA 1A63A 4YCVA 5LMNQ 1JJ2A 2MFIA 4A3BH 4AIMA 1UE6A 4JI8Q 1Q12A 3CCEA 1E1OA 1XMOL 3AFQA 2BH2A 2RHQB 1YHQA 2UUAL 1VQ5A 4IOAA 4DUZQ 1W2BA 3KYHC 2F4VQ 5C0XI 3CF5A 1KXLA 1I6HH 3S2HH 3CC2A 1GD7A 3A0JA 2AWOA 4NPSA 1EIFA 3KF8B 1V43A 4A3LG 1YJWA 1HNWQ 1Y1VH 1PH1A 3ULLA 4KHPQ 4XIGS 2KCMA 4QJFA 1QVCA 4DAMA 1AH9A 1P8LA 3KDFA 2UXBQ 3GDEA 4JG2A 3KF6B 1YEZA 4EQ5A 4GKJL 4HJ9A 1LTLA 2MQHA 4GNXC 1GO3E 1B70B 4DUYQ 5FJ8H 3LGJA 3RZOH 2E2HH 2OTJA 3S24A 2IT1A 3Q8DA 4P71A 3AEVA 4LFCL 1XMOQ 2PI2A 3S14H 2MO0A 4IFDI 3W1GA 1D8LA 2UUAQ 4AQYL 1X3GA 4QQBX 1JE5A 1X3FA 2HHHL 4HIKA 2NN6I 4A3KH 3UE1A 5M5XH 4RMFA 1K83H 2I5LX 1VQKA 4BY1H 3S17H 5GAHC 3J7A5 1SR3A 4YWKA 4JI6L 2YTVA 4GKKL 1X55A 2MO1A 1R9TH 1X54A 1UE7A 3HKZG 3ICEA 1OXUA 2VQFL 2AMCB 3KDFB 4JI2L 3PF4A 2KENA 4GKJQ 5C44G 1UE1A 4DR3Q 4APVA 1PA6A 4JBMA 2GN5A 2JA8H 4DR6L 5GROA 2LSSA 4A93G 1YNXA 3I4NG 5IYCH 2ZJRA 1G6PA 4BBSH 3GTLH 3I4MG 1A0IA 4WJ3M 1CUKA 3HOUG 3K80C 2ZTEA 2JQOA 5AJ3L 3CC7A 2JEAI 1DGSA 4BXXG 2EXDA 2IX1A 1TWCH 2NVQH 3I55A 1QUQB 4OO1G 2HHHQ 2KHJA 4L5QA 3CCQA 2WB1G 4BY7G 4LF5Q 1Q8KA 1BBUA 1QVFA 5IP9G 2D0PA 2VNUD 5IYDG 4DNIA 1AE3A 3RN5A 4P73A 4GKKQ 2R92G 1N32L 2VS1A 1Q1BA 3RR5A 3G6EA 2I5MX 1JMCA 1QZGA 1ASYA 4QGUA 2VQFQ 3S1NH 4JI2Q 1XNQL 4P72A 2R7FA 4DR6Q 2JE6I 3M4OH 1V1QA 2K52A 4X62L 1C7YA 4JC0A 4P75A 5M3MG 4A3GH 1Z47A 2EQSA 1L1OB 2WB1E 4A3MH 4A3DG 2E2JH 1N33L 1IYJB 3S16H 3KOJA 2PI2E 4DV7L 4YY3L 2WAQG 1M90C 5AJ3Q 2B63G 3E0EA 3L0OA 3K8AA 4L5RC 1GM5A 1JB7A 4LNQA 1FL0A 2FXQA 4LW1A 2JA9A 1CKMA 4DKAC 3HOVG
chains in the Genus database with same CATH superfamily
4UP7A 3PV0A 1KNEA 1HXYD 3EIVA 2NVYB 4J6HA 4H02A 3NENA 2KCNA 4FP5D 5C0XG 1YHBA 3SXHA 2PW7A 1WTWA 4RGMA 2DUDA 3MXNB 3MC0B 4IPDA 5CYUA 5EPJA 3I72A 2PQAB 1VQ6A 4DNTB 4PZ7A 4KHPL 2GVAA 3ZJYC 3WWVA 1HR0W 2RQXA 5JVH3 1EY9A 4GS3A 1TWHH 1U5KA 5C3XA 3PIPA 1UAPA 3I91A 3VYRA 1NCVA 1RF2D 1XNRQ 4YWLA 1NTGA 4IFDG 1XPRA 3WDNA 3D31A 1HRJA 4ODGA 2H4OA 1NAPA 1H9SA 4J8QA 4LJZC 1BCPF 4DV4Q 2ZXPA 1YI2A 4C3HG 1SYFA 3SVMA 4L8JA 2A8VA 1STGA 1SLJA 1JOOA 4KD4A 2B2YA 3EN2A 2RSNA 1EWHA 1I4GA 1RDPD 1X3PA 2B39A 2VZAA 4DR3L 2SNSA 3OTOQ 1MKHA 5KRUA 2F0EA 5DM73 5C5LA 3TQYA 2XN9C 1V1PA 3GD7A 4CDDC 1EYCA 2A5HA 2MHVA 4R4OA 1S72A 3HGBA 2F0WA 1N9WA 1YJNA 1IKMA 5C0XJ 2ICIA 4JV5Q 4LUZA 1TR5A 4DR2Q 1CT1D 4XDXA 4UHVA 1L1OC 1Y8OB 2JN4A 5I4DA 3CCJA 5A35A 5GAGC 1L2FA 2ZT9C 4IPHA 1XMQQ 4NDXA 3I4OA 3MHBA 1K8GA 4A93H 4AYBB 3I3CA 4DV0L 4KHZA 1PH4A 3IFTA 1A2TA 3VR5A 3HOUH 1A15A 1QVGA 3BYYB 2EPBA 3GTMH 5CMDA 3HKZE 1BBWA 4UPAA 5BN5A 3M3YH 4TSSA 4IFDJ 2IW3A 2R92B 4POGA 1SNMA 4L5TA 3NHHA 1PYWD 5BR8L 3CD6A 1OTCA 3FMCA 4PZ6A 2R92H 4JVZA 4YWMA 4OX9Q 2DNEA 1GKHA 5M3MB 2EZVA 3P1HA 4A3IG 1UE5A 1ONLA 3VYSA 5M3MH 2Q2TA 2B63B 1EEID 2PNRC 2ALYB 1N36Q 4DR5Q 2B8FA 4RHRA 1PH9A 2Z6BA 5C4JH 3TRZA 1PH5A 1B1ZA 1F2ZA 5ELBA 2F0IA 1F9QA 2OT2A 2A1AA 1X6OA 3ULJA 2CW0D 1VQ9A 3NBHA 4JI3L 1RIPA 1JT8A 4L5SA 4XQNA 5KNDA 4EQPA 1VMPA 1G51A 1WTPA 1BXTA 2ES2A 5EBCA 5J22A 2JA7B 2JXMB 2B8GA 3K58A 4CJ1B 1Y1WG 5AFWA 4ZUIA 3HOXG 4B9XA 2JJQA 4KJNA 3HOYG 4DV4L 2C9OA 2K05A 3F2CA 5IGDA 3FDTA 5FLMG 2UXCQ 4ID6A 4JBJA 2IWHA 3C2PA 1JOQA 3MFYA 5ELCA 4BA1I 3A54A 3J80i 1I3QB 2H5XA 2K4KA 4GN3B 2UXDL 1EY7A 4IFDH 3BZKA 4KHVA 2UUBQ 1Q90A 4C3HB 3I8ZA 1G91A 3MEHA 4A3CG 4QCLA 1KD1C 1PYSB 1PRTD 4DR2L 5GQOA 4LF7Q 3FVQA 1CQVA 3JC66 1WTRA 4OXPA 2K28A 3GTPH 1NE3A 4DK6C 1VQMA 4R1JA 4AH6A 4B3SQ 3ERSX 1C8CA 4A3BG 1STBA 3RD4A 4Y7NH 5DM63 1JJGA 1VQDA 2HUGA 1EWIA 1BKBA 1VQCA 3H3VC 3U4ZA 4RCOA 4KY6A 1EY5A 3J7AV 1F9SA 4JOIC 2IJ0A 2FFKB 1LTBD 2WFWA 5ELNA 1Q82C 2BE5C 2F0TA 4WJ4A 3K5MA 3RNUA 3RZOB 3OPOA 5IWAL 1B9NA 3J7AF 2A69D 3RZDH 1X56A 3KLSA 5I6WA 3MVVA 3QG1A 1CKNA 4DR5L 1VQAA 2VY3A 4GNXA 4U68A 4JI5Q 1LLRD 2X69A 3K81C 1YVCA 2BDOA 1MJCA 2KCTA 4BY1G 3NE5B 4KD3A 2PZWA 2JA8B 1LO5D 4F87A 4K0KQ 2N88A 1VQOA 1PHJA 3KLRA 2ZTCA 3GTLB 1PFMA 1T5XD 3F2DA 2ZJPA 2DGYA 4A3IH 2PNHA 4DAPA 1AFPA 3TP5A 1K8AC 3ND8A 2C5CA 2F0JA 5IYCG 2K01A 3A5UA 4LFBL 4ALPA 3EBEA 1FR3A 4ME5A 1STHA 4IJHA 1FD7D 4LF9Q 2UXCL 5JJIA 1RCVD 1ZKOA 4AQYQ 1JWSD 4HEDA 1C9OA 5C3WA 4RG1A 3FRPB 3R8BA 2KVMA 3S1NB 2UU9Q 1GJXA 3JAMi 1E3PA 1FJGL 2L1BA 4A3GB 3HOYB 4H13C 1Y1WH 2A19A 1HR0L 1TWFH 1E24A 3HOXH 1QE6A 3VR3A 1JB3A 3HOYH 2HDLA 3E9IA 1FGUA 5FLMH 1O78A 1NNXA 4DV6L 2EYPA 1KAAA 1U4MA 5DNFA 5H1SE 1BF4A 4C2MB 1E2WA 2TMPA 4DR7Q 2CKZB 5LMUQ 3OW2A 4YHHQ 1VQLA 2KBNA 3PUYA 4C2MH 4BS9A 5DAUA 5NUCA 1LTAD 1EQVA 1NR4A 4CDEC 1YHAA 2F4VL 3H09A 3W5OA 1CSPA 2NN6H 4X62Q 2F0DA 3PO2G 1II3A 4X66Q 1PTOH 5C3EG 4IUPA 1AZQA 2OTLA 2MJ8A 5E3FA 4IZ8A 1JE4A 2JA5G 2VUMG 2UXBL 2F03A 1RL2A 4GLXA 4DUYL 1ET9A 4IUNA 5I2XA 4A3BH 2Q8RE 4DAVA 1QJOA 4JI8Q 1Q12A 2EXZA 3CCEA 3FEWX 3VYUA 2UUAL 4HCEA 2O5IC 1KXLA 5C0XI 3S2HH 3CC2A 4QF4A 3R2TA 4KN4C 4N8X1 4ZAIA 1SSOA 4JW0A 3HRZC 4QJFA 3AU7A 4EQNA 1P8LA 3KDFA 3QOJA 1GO3E 4DAYA 3TSSA 1TS5A 3TP8A 2IT1A 4P71A 3AEVA 3VA5A 2WKCA 3AMUA 3S14H 1O7ZA 2MO0A 4IFDI 1D8LA 4AQYL 1JWMD 2E75C 2EVBA 3V2TA 3HKZB 1I4PA 4Q5VA 4CKBA 3GTGB 1H9SB 1K83H 4BY1H 1K0SA 1CZGA 1DONA 1R9TH 1UE7A 4HSVA 1SYDA 4X3UA 1F77A 1A3TA 2AQ2B 5JEAH 2AMCB 3SDZA 3D8GA 3PF4A 1E2VA 5C44G 4DR6L 4APVA 1BOSA 2GN5A 4QB4A 1RHPA 3T51B 3I4NG 1QWYA 5IYCH 5ELDA 4RGNA 3Q22A 3VR2A 4BY7B 2JQOA 4K2LA 2G9DA 4K2KA 5AJ3L 2ZXRA 2XIWA 1ZYRC 1K3BC 2NVQH 1M8AA 2EY5A 1XTCD 3DWAA 2NZ1D 4DK1A 3CCQA 2WB1G 1KTKA 2EYLA 4LF5Q 1Q8KA 1SYCA 2D0PA 3RN5A 4P73A 3D6WA 5D3IB 2L9HA 2O5JC 1SYEA 2AQ1B 3G6EA 1YNJC 2I5MX 2L11A 2VQFQ 4JI2Q 3K59A 2LMCB 4P72A 1XNQL 2WKDA 3M4OH 4X62L 2E2JB 4JC0A 4P75A 4U673 1DCZA 4A3DG 4DXFA 2E2JH 3HOVB 3KOJA 1G8ZD 2PMZB 2JA6B 2WAQG 1M90C 5COYA 4QMGA 4BBRB 1FL0A 4FXKC 4DKAC 3BVGA 2K1BA 5C5MA 3UDIA 4OWXB 4B3TL 4M8AA 4HN7A 1STYA 4ME3A 1S5BD 1Q81C 4JI8L 2SDFA 3CAMA 1PTOF 3CKIB 3L9AX 4X64L 5C3EB 4OWWB 1EFID 2SEBD 2B2WA 1IBKL 2OXPA 4B08A 4B3MQ 2BA0A 3D3RA 1PH3A 3KF8A 5JOBA 3PO2H 3HFZB 4KLKA 3U50C 2JA5H 2VUMH 2R6GA 1N33Q 3KF6A 1TXYA 3OWEB 4DV7Q 3GTOB 1GOZA 1LT5D 4YY3Q 1MHWC 1EEFD 2LS01 1AEXA 2F3VA 3HZXA 3PGZA 5FO8B 2I46A 3NBHB 1J5EL 1AN8A 1M1KC 2RSOA 1B53A 3FKIH 5I9PA 3CMEA 3HOWB 2OCEA 3D0FA 3PMFA 4TVAB 3PCOB 4MNOA 2Q8TA 1JQYD 1CTMA 2B2YC 3EROA 4FF2A 1TQOA 3CCLA 1E22A 2QILA 1IHZA 1O7LA 1HPCA 1I50H 3TS0A 4QL5A 1PV4A 2N3SA 5D14A 1NUCA 1B2TA 2XVSA 3TDQA 3UDGA 4R8NA 1FNUA 2JK8A 5IGEA 3G7LA 1TWAB 4GOPA 3S1RB 3PUZA 1P16A 3A8JE 4KKSA 2C35B 1KQSA 5E4WC 3SK5A 2ZM6L 2I5HA 2QKIC 2UUCQ 3T1YL 1QUQA 1HZ9A 4IPGA 1X65A 1PZID 3PUWA 1PXUA 4C3IB 5CV9A 4LF5L 4HJ5A 1WTVA 5C44B 2JEBI 1SNOA 3BYTB 3OWFA 1SJHD 1EIGA 2N49A 4PMBA 3I4NB 2HQEA 1DJRD 1UWVA 3OYYA 4ZQ3A 1SFOB 3I4NH 4MIUA 4KV6A 3U4VA 1KIXA 1U0LA 3S1MH 4DK0A 5M3FH 4OL7A 5JPMC 4AYBG 4HJAA 1HA6A 3SK6A 2R93B 3GTJB 2E5LQ 1XPOA 1K3RA 3R93A 3MFGA 1K9MC 1ICFB 4OWTB 2KUMA 4RFBA 1WCMB 1DXMA 2JYOA 4R4QA 4CJ2C 4JPBW 1KDBA 4B3RL 1EUJA 1BDOA 3OSOA 3GTKH 4B3ML 4WJWA 4A3DB 1VQNA 4K8JA 4HMIA 1RTOA 4CBVA 1SE4A 4CDFC 4DV0Q 1B3QA 2WAQB 2XTIA 4F7XA 2Q2UA 1ESRA 1HNZQ 1TU2B 1S5DD 2YTXA 1Y14B 4GN4B 4NB3A 4KTAA 4UP9A 1T9HA 1NY4A 3GTQH 3E5SA 1DOKA 4DK3C 3EFXD 5BR8Q 4X3KA 2KHIA 3CCUA 3U58A 3IFDA 4JI1Q 3CCVA 2QDBA 4X3SA 1ESFA 1EU3A 2KJXA 1KNAA 2NVYH 4O2DA 5CR3A 5M5WB 1EOVA 2NZOA 2F0UA 1VQ7A 2XWJB 2ZJQA 2JA7G 3QO2A 3CP0A 4JBKA 2F0QA 2CCZA 1R4QB 4IPCA 4A3JB 1TS4A 4FNFA 5CV5A 1VCIA 2OQKA 1BCPC 1MIUA 3NXWA 5EBDA 2YU9B 1HJPA 1LTRD 4JI3Q 2D5DA 4HAEA 1EY4A 4KY5A 2IPKD 4A3FB 3OMGA 1GHKA 3DXJC 4ZLTF 1Q7YC 3R2IA 2N55A 1YJ9A 2K33A 1PYBA 3H15A 1KDAA 2UUCL 3M9BA 3S1QB 1GHJA 5EKIA 1O80A 3M4QA 3UE0A 3I7FA 1HZCA 5T1GA 1WOCA 4G57A 4DV2L 2BA1A 3X3MA 3J81c 2V4DA 1I6HB 1CM9A 3CCRA 2UXDQ 2IY5B 2M00A 4I65A 1XJVA 2A68D 4FF1A 1E2ZA 2AHOB 2EOTA 1GUGA 2E5LL 1C4QA 1MJEA 2PYKA 4LF8Q 3VR4A 5J3BA 1EYGA 5D65A 2E2HB 1OXSC 3FP9A 5IOCA 3UDXA 1KLGD 4PQXA 1HHVA 1CSQA 2XSCA 3TN2A 3P7JA 4GN5A 2PW5A 5JJKA 3VR6A 1HNZL 1NMGA 3HG9A 2TSSA 4MTKA 2I07B 1IL8A 1Y8PB 1I6VC 3RLOA 3CW2C 4UP8A 2I0QA 2IHFA 5D3DA 2Z1CA 1E1TA 1IXRA 3RLFA 4JI1L 2Z4IA 4K5WA 5IWAQ 1SRUA 2JA8G 1OO9B 5EGTA 1EZ8A 2K5WA 4DAYB 4NXML 3PUXA 3EA6A 3X3NA 1N8RC 1TWCB 1LT6D 4LFCQ 4XQJA 1Q46A 3CXCA 2F0HA 3H3VH 3K7UC 1OXXK 3IL8A 1QG7A 5FO9B 2B63H 3D4WA 1EZ6A 4OONA 2NUCA 2FHTA 2MUYA 2VB2X 2K5VA 2F0VA 3MXPA 2RCNA 1PFBA 1N34L 4A3MB 4S3SA 3OOCA 5C0XH 2K5HA 4DN4M 3BJUA 2Z6KA 5CC4A 2F0OA 2CFMA 4LF4L 1U4RA 4A3GG 2JA7H 1PTOD 4DU9A 4TQUS 4LFBQ 3STBC 4LUVA 3IKJA 1BUVT 2EY2A 4C1NK 1WTXA 4XYQA 1QNUA 2N8NA 3HOZG 1MI2A 3M7GA 5FLXc 1EYDA 1H9JA 1YNJD 2CH4A 1PVOA 3MA2B 4UDUC 4HTHA 1FJGQ 3G71A 3PIOA 3A74A 1I3QH 3LWUA 2B2TA 4A3EB 1HR0Q 1OXTA 2NVTB 2PZTA 2AQ3B 2A6HC 3PSIA 2VL6A 2XRQD 4QY7A 1YBYA 3A55A 5HY6A 1RTNA 4C3HH 4LF8L 1VF7A 1S5FD 3BZCA 1U4LA 4DV6Q 1BBXC 3EQLC 3CRLC 1DOMA 3KBXA 1SDFA 1SN8A 3V05A 1A63A 2LY7A 4AIMA 1XWEA 5EJWA 1XMOL 1E1OA 1B44D 2BH2A 2EE1A 4IOAA 1W2BA 1KDCA 3KYHC 2F4VQ 3A0JA 4NPSA 1K28A 3KF8B 1V43A 4A3LG 3J81E 1I4QA 4XIGS 2KCMA 5IGBA 5JPNC 2IX3A 2UXBQ 4JG2A 3KF6B 4HJ9A 4OELB 1LTLA 4KK7A 4DUYQ 1HA5A 4IN3A 4IURA 3RZOH 3Q8DA 4IUTA 5FOBB 1SNQA 4LFCL 1EY6A 3SE0A 3S17B 2UUAQ 4E6IA 4KY7A 3Q23A 3HP3A 4IUVA 4HIKA 4RMFA 4RH6A 3S17H 1EOTA 5GAHC 2YTVA 1RJTA 1X55A 4GKKL 1MSGA 1X54A 3HKZG 1SE2A 3K7AB 1WD0A 3ICEA 1WTQA 4JBMA 1PA6A 2DN8A 2JA8H 1QNKA 4FXGC 1YNXA 2MGSA 1EU4A 2RDHA 3NTIA 4N9TA 1H9KA 5IGGA 2ZJRA 1UEAB 3GTLH 3I4MG 5C4ZA 1CUKA 3DHQA 2ZTEA 2LFNA 2F0PA 1DGSA 1E0BA 5LHY1 2QF7A 3BVMA 1QUQB 4OO1G 1CA5A 1GXDC 3CQZB 1Q3LA 4BY7G 1EY0A 1S4ZA 1LT3D 4DNIA 5IYDG 2A6ED 2F1MA 4ZK9B 4XT1B 3RR5A 4NKLA 4O42A 2EY6A 1JMCA 3VA7A 1ASYA 3S1NH 4UAIA 1FNWA 2M2LA 4DR6Q 2JE6I 1V1QA 1C7YA 2EY1A 4A3GH 1Z47A 2EQSA 2RKSA 2WB1E 1I4HA 1K8OA 1ENAA 3QR8A 1Y69U 4HCSA 2F0KA 5AJ3Q 3HOZB 3L0OA 1EWCA 2B2WC 1GM5A 2K5QA 2JA9A 1LACA 3HOVG 2JA6G 1D1KA 3HOZH 3FPUB 1LYLA 1PFNA 4FDBA 1F2LA 2Q8IB 1SROA 5CORA 4BBRG 3T13A 3MTSA 2R7ZB 1TWGB 4BA2I 4A4IA 1XNQQ 4O0AA 1YNND 1KC8C 3M4PA 4K5VA 3C1FA 1HTLD 5FLXE 2OWOA 2ASBA 1LTGD 4A3CH 1QZHA 1CI3M 2K7VA 2QDLA 1EQTA 3BDLA 4JCVE 5HURA 5E4XA 3H3VI 2ATWA 2HD3A 2MNAA 4XT3B 4DF7A 3NBIA 4PMCA 1EQQA 4B3TQ 1O7IA 2Y0SE 1I4XA 4CGYB 4JYAL 3KJOA 3MEFA 1AE2A 4X64Q 1TY2A 1EY8A 1I5FA 1NMFA 1IBKQ 1AZPA 3HOWG 4A3LH 4GOPC 3LWEA 1PH6A 5C4XB 2L4NA 5CV7A 4NP5A 4IJLA 3H94A 3M7NA 5IY0A 1F9RA 3F2UA 2BH8A 1J5EQ 3J80c 1EQRA 3H0GB 4EQOA 3TZUA 1PRTB 1VQJA 2X6LA 2L12A 4HIDA 2EYFA 2HIXA 1SJED 2EYMA 4NXNL 3RLNA 1T5EA 2K5NA 1Y1VG 3KUPA 4LK1C 2VQEL 4R4TA 1YZ6A 3PQIA 3SGIA 3I70A 2P5ZX 1JJCB 3GTGH 4JI0L 1FVIA 4C3IG 3QWNA 2ZXOA 3I4MB 5M5YB 1LV9A 4C3JB 4TRDA 2G9HD 4ZRZA 2AUKA 2AUJD 3L2PA 3S15B 2ZM6Q 2WACA 1V1PB 4G7HC 3V96A 1HQRD 2OQ0A 3T1YQ 4OO1H 1A3VA 1G291 4BY7H 1D5XC 2CW0C 1SXTA 1GUOA 4K14A 3MXUA 2R93G 5IYDH 3RMHA 4EGVA 1DD2A 3P20A 4KN7C 4A75A 1WCMG 1I4RA 3F2BA 3T4AC 4BWGB 1Q8IA 4DV5L 3NELA 4JI4L 1BQQT 2HQLA 3TEHB 3ZYYX 2K04A 1CA6A 3T53B 5CBAE 1IL2A 3E3XA 1U9RA 3TP7A 1IBML 3NWSA 3HOVH 2JA6H 3U9OA 2RBMA 1LTID 2BOSA 4DR4Q 2O2LD 4BBRH 4B3RQ 1WTHA 2QEJC 1HUMA 3D4RA 1J9OA 4XXEA 4FF4A 2B2UA 2J7ZA 3A8KE 5K36G 5C3EH 2KA7A 1NR2A 1BR9A 3BS1A 2GVBA 1PRTC 5IODA 3U9SA 1SE3A 4OEMB 3T16A 1G2SA 2F52A 4DV3Q 4A3JG 3GTOH 4PNYA 1A6XA 4EX5A 5IT9c 3JAMc 4X65L 2O4XA 2L5TA 1Z7TA 1BVSA 2GA4B 1LTSD 4F8MA 1VQ4A 4ZKCB 4A3FG 1STAA 5LMNW 3STBD 3HOWH 1M4VA 2R3ZA 3NEMA 3P75A 5J39A 1IBLL 4JI7L 4FO2A 2RVLA 3UDFA 1QILA 2EYHA 4LF6L 3MZ5A 1QB5D 2NYZD 4ZUJA 5A2QE 3NK9A 2KQ3A 3G4SA 2K75A 2MPMA 2EDGA 5E1FA 1Y1VB 1TWAH 4RCNA 3S1RH 2PZUA 4R4IA 5GAEC 1MSHA 1B8AA 5KYIA 1D5ZC 4MN3A 2K50A 1BCPB 3GQBA 2JP1A 1DM0B 4PMWA 2CH4W 2DJFC 3J80E 1VQPA 3MXGA 1NBWA 4H0LC 2B3GA 5G3LD 3E9HA 3VYTA 4C3IH 1NJIC 1TIID 4DV2Q 5FJ8G 5C44H 3BVZA 4ABNA 4JBWA 3WOEA 5KNCA 2HIVA 4A3KB 5M5XB 2F0SA 1HH2P 1TS2A 1SFOH 2K5DA 4IOCA 2QCPX 1EFWA 4FVMA 1DYQA 1SYBA 5EPKA 1VQGA 2E2DC 2BE5D 5ISRA 2QA4A 3S2DB 2R93H 3GTJH 1TKWB 2B29A 4DR4L 4RWSC 1SNCA 3S2DH 1DZ1A 1WCMH 1VQBA 1X3QA 1OXVA 5HGQA 1I94L 3T56B 4K5XA 4BBSG 3G48A 4A3DH 2E76C 4DGZA 1CKNB 1ET6A 3LX0A 4GNXB 5EQ0A 1S3OA 1BNZA 3R3OA 4LFAL 1EYAA 3K5OA 1KAWA 2Z6KC 3LNNA 3J7ZC 4JI6Q 3B6YA 3KLWA 2EJGC 4DV3L 3AQQA 3ND9A 4L6TB 5I6YA 3CCSA 3J81j 3IAYA 1V8QA 1IYUA 3ULPA 2IL8A 4KI0A 5I2YA 3SEBA 3S16B 4HSPA 3F1ZA 1PH8A 1WYDA 2D2CC 3NQIA 3A8IE 4NXMQ 1XXGA 3C46A 2IHEA 3VDYA 1GUSA 3T1HL 4A3MG 1L0YB 1FNVA 2XWBB 2KECA 1J8IA 5E7NA 4DFAA 5M9OA 1CZWA 5M5WH 4DR1L 1LUZA 2B2TC 2KHSA 1SNDA 1JWUD 2H1EA 1K73C 4OO1I 4ZYSA 2ZTDA 4A3JH 3NUCA 1F2MA 4V190 1N32Q 1WJJA 2WV6D 4CDCC 2Y0SB 2Z4HA 4QIWE 2YU9H 4CKEA 4DUZL 1HFGA 2L0CA 2F0MA 1EIYB 1N34Q 4A3FH 1HNWL 1B4OA 1HZAA 5EAYA 5IYBG 1PLFA 1VS0A 2B2VA 4LF4Q 3Q6SA 4NW2A 1TWHB 2R7DA 4A3EG 5IT9E 3JAME 3S1QH 1IZ6A 2Z0SA 3I73A 3OIQA 3NPPA 1UUPA 3A56A 4YIJA 2XGTA 3BDCA 2F3IA 1H95A 2EJFC 4HJ7A 3S9WA 3W1BA 4C56C 5LMNQ 2J4XA 3QIAA 1DOLA 3AFQA 3RUZA 3CF5A 2KOLA 1I6HH 5L37A 1EIFA 2NTTA 2VB3X 1YJWA 3NP8A 3DEOA 3ULLA 3Q0AA 1JICA 3BDOA 4DAMA 4PV1C 3DWPA 3GDEA 1ENFA 1YEZA 4GKJL 4GNXC 1VDZA 2MQHA 4CHTB 1B70B 5C6AA 1PDQA 1STNA 5FJ8H 4DNRB 1SMYC 2OTJA 2E2HH 3K5LA 1XMOQ 1VMCA 3AB9A 2NB0A 1KLUD 1SBBB 2ENBA 3KLSX 4QQBX 4DXGA 1GUTA 2HHHL 1H9MA 2CHBD 1BO0A 3EVQA 2I5LX 4YWKA 4JI6L 2LKVA 5FO7B 4CJ0B 4A93B 4IALA 2PPBC 1G2TA 3KDFB 1EL0A 3HOUB 1HCZA 1UE1A 4IUUA 4BBSB 5KGUA 5GROA 2LSSA 3OW7A 4LAAA 3SK4A 3GTMB 1Z6HA 1HFNA 3M3YB 4BBSH 3M4YA 1A0IA 3K80C 2BDNA 1D2BA 4R9WA 3CC7A 2JEAI 2EXDA 2K32A 3L3OC 1TWCH 4CKCA 3QB3A 1D5MC 3NQTA 1BBUA 2VNUD 5IP9G 3BG3A 1AE3A 4GKKQ 1STEA 3NTKA 1N32L 1Q1BA 4K6DA 1QZGA 4QGUA 4X3TA 5C4JB 1ILPA 2EJMA 1RKNA 3K5NA 4A3MH 1C48A 3DWQA 3E0JA 1ZYRD 3K0YA 4ILWA 4L5RC 2FXQA 4LW1A 4PG3A 2EYJA 1XNRL 3HS0C 5LMNL 4DV1Q 2CWAA 4OGQC 2RCFA 3CC4A 1KABA 2Z9HA 1PH7A 1A62A 2ICEC 3URYA 4G7OC 1XTDA 1K8MA 4LMQD 2NZHA 1Z9FA 5IYBH 1A2UA 5ELEA 3HKSA 3J81L 1PMRA 2R7ZG 2PMZE 2HCIA 1UEBA 4A3EH 2NVTH 2E74C 3L7ZC 2D0OA 5EKLA 2WIIB 4FF3A 1SMXA 4YCUA 5BN3A 3OTOL 3IRBA 3AYHB 3BZDB 1PZKD 3MWYW 3K57A 1LM0A 1ICWA 2KCCA 3OIPA 2CVRA 4RKLA 1IYVA 3PIP3 1CFMA 5T1IA 4J1MA 2NN6G 4JV5L 3NSWA 2NBFA 5CV4A 1IW7C 2F0NA 4GLVB 1J6QA 4RKBA 3GTPB 1VQEA 1ASZA 5GADC 1O7YA 1XMQL 2XRSD 3DLLA 2HT1A 4Y52H 1H9RA 4Y7NB 5C4XG 3J7YW 2EYOA 5LL6S 1YITA 1TVXA 4YCWA 4XTCS 2JSOA 1GVPA 4JYAQ 2L55A 4HMJA 4LWCA 2RDGA 1JORA 2YV5A 2NVXB 2V1CC 3H0GG 3ONAB 5G3LF 3SK8A 4NMZA 1MGSA 4HJ8A 1B7YB 1UNSA 4QUCA 2NVXH 4LUOA 1LABA 4OX9L 3RZDB 3DM1A 4IQZA 2RA4A 4MZ9A 2X6GA 1S40A 2DNCA 1HTPA 1F9PA 4IO9A 2AWNA 3CPFA 4A76A 1WI5A 3K7AH 5ELFA 1L1OA 1N36L 4GOPB 3PF5A 4XYOA 1SEBD 3TBIB 5IP7G 2VW9A 3TREA 5EPLA 2L15A 4C3JG 3KFUA 4NXNQ 1HNXQ 3N52A 2A73B 4L63B 1VQFA 1CHQD 5JJLA 5IP9H 4A3IB 2VQEQ 5JEAG 4DV1L 4F88A 2NWGA 2RF4A 2QGQA 5JJZA 2D62A 3CQZH 3BU2A 3ERQA 2YTYA 4BXXG 2FMMA 3MXNA 4POFA 4WORA 3H91A 4JI0Q 3PO3G 4KJOA 4OIKA 2PQAA 4HIMA 3CRKC 3GO5A 5FLXL 4O1NA 4G7ZC 2HCCA 2EIFA 2RHSB 4WFN3 1Q1EA 4K8IA 4QUFA 2HDMA 4OHJA 1Y1WB 2Q2IA 2B2UC 1XPUA 1VQHA 1C0AA 1TWFB 2F0GA 1FGBD 3M85A 3OMCA 5K5PA 3HOXB 2UUBL 1HZBA 3H6MA 2E2IB 4X6AH 4QIWB 1MD2D 4R8IA 1CKOA 1TS3A 2E2IH 3CPWA 2WAQE 4FXDA 3K6OA 2D9UA 3Q24A 4DV5Q 1WFQA 5F2DA 4JI4Q 2R7ZH 1TWGH 4LF7L 2VXWA 3C3LA 2CQOA 3CHBD 1QCBD 2MP1A 3GV3A 3A5ZB 4C1NI 3E6ZX 1V9PA 1IBMQ 4B3SL 2CWPA 1RODA 4ZCKA 5KYLA 3W2DA 4RAUC 2ID0A 1PTOB 4P2CB 5C4HA 3DUZA 1IKLA 1CHPD 1MBYA 5KIXA 2OEOA 5JEAJ 1E7ZA 2A68C 1K0RA 3D4DA 1WVLA 2PO4A 5DEHA 2FINB 3PIO3 4UY8C 2SNMA 1GUNA 4DPGA 3AFPA 1XX8A 1Q86C 3O13A 3MAQA 1FYCA 3ER0A 1BCPD 4ZKBB 2WP8J 4P74A 4A3BB 5EKKA 2LXKA 3KBGA 2M9VA 5C4XH 3CMAA 3FKIG 3RN2A 1JOKA 3DMUA 3S2HB 1KRTA 2G5DA 3KK7A 3PUVA 4H7BA 3SHLA 3FHWA 1VQ8A 4JI5L 2CQAA 5J1ZA 5JAVA 4X65Q 4OIJA 1JR0D 2N78A 5CV8A 1WTOA 1VQIA 2E8GA 3H0GH 1D7QA 2OF1A 1HNXL 3DEPA 4JI7Q 1IBLQ 4TKOB 4K0KL 3DM3A 4GZYC 5BN4A 4LF6Q 2K14A 4MHEA 4GLAC 1W6KA 2LXJA 4KKUA 5DLQE 1R4PB 1KHIA 1RD9D 4KKTA 5FK9C 3UI2A 3I56A 3S14B 4JOIA 2KEEA 1LT4D 2A74C 5IE8A 4PZ8A 1PFSA 3K0XA 4LF9L 1K83B 4BY1B 3I4MH 4N8FA 5IP7H 5M5YH 3OHXC 2NTSA 1X3EA 1S5ED 4C3JH 4K6LA 1R9TB 4KMUC 2AKWB 3GP7A 4M1UB 1KL9A 4A3KG 3S15H 1ZEQX 3CCMA 2F3WA 1X9NA 2UU9L 2PQEA 1HUNA 2IX0A 3TZDA 3KJPA 3PO3B 4J15A 2F0FA 1TT2A 5TSSA 5IGCA 4BXXH 1SMYD 3PO3H 5KNBA 2F0LA 5HGTA 1X32A 4AYBE 3NWTA 4N9PA 4V0BA 2R61A 5M3FG 2NVQB 1A3UA 4IUQA 1PTOC 1JC7A 1A8VA 1B3AA 1L0WA 4DR7L 2K6AA 1W3SA 5LMUL 5FKAC 4YHHL 2FMCA 1SAPA 1SE8A 3M4OB 4HR7B 5CBEE 4I7AA 2QEXA 4FYDA 1WD1A 3TMEA 3FPPA 5KEEA 4X66L 4HIOA 4MTNA 1CK1A 5LL6X 3I2ZA 1I94Q 4XQQA 1HQMC 1NSNS 5ELOA 1Y8NB 2Q2HA 5A2QL 2PCFB 2DY8A 3J81i 4LFAQ 3WOFA 1V1OA 2F4IA 4RGOS 4EVOA 2B2VC 1EIHA 3TP6A 3PO2B 4G4KA 2Z8LA 2JA5B 1ENCA 2VUMB 3EJIA 1LTTD 2Y0SG 4RHSA 3W3AA 1KRSA 3TS2A 4R4CA 3J80L 3F8TA 3N6RA 3T1HQ 3I4LA 1B9MA 3FKIB 3A7AB 1SYGA 1PH2A 4I7ZC 1YIJA 1S5CD 3GV6A 4DR1Q 2YYZA 3C1EA 2FJ2A 5IIFA 4YCVA 1JJ2A 2MFIA 1L0XB 1UE6A 1VF5C 2DJGC 1PRTF 2A69C 2RHQB 1YHQA 1VQ5A 4DUZQ 1F2YA 2A6HD 1I50B 2BCOA 3HEJA 1GD7A 2AWOA 4Q0FA 5CGKA 1HNWQ 3SR1A 1Y1VH 1PH1A 4DA2A 4KHPQ 1QVCA 3NTHA 1AH9A 2WINB 2K03A 3D6CA 4EQ5A 3A7LA 5IGFA 1CQFA 3LGJA 4JK1C 4RA8A 3S24A 1AP0A 4RGTA 2SOBA 4B9WA 2PI2A 5JVG3 3CU7A 3W1GA 1IW7D 1D6EC 1X3GA 1JE5A 1X3FA 1U4PA 2NN6I 1W6JA 4A3KH 3UE1A 5M5XH 1VQKA 3J7A5 1SR3A 2MO1A 1PZJD 3I90A 2A6EC 1OXUA 1ILQA 2VQFL 4JI2L 3S1MB 2KENA 2QW7A 4GKJQ 5M3FB 4DR3Q 2J0TD 1SNPA 4A93G 1JCKB 1GUWA 3QOLA 1G6PA 4WJ3M 3HOUG 2WB1B 5I9OA 2KEDA 2IX1A 3I55A 2HHHQ 2DY7A 2KHJA 4L5QA 2RDFA 1G6ZA 1AW7A 3GTKB 1D1IA 1QVFA 1ZXTA 1XYIA 2R92G 2VS1A 1ML0D 1B50A 3QJYA 2R7FA 4WRDA 3G6JB 2K52A 5M3MG 5CV6A 1YNNC 1L1OB 2XNAC 1QOHA 3GTQB 4Z9CB 5K36H 1N33L 4H44C 1IYJB 3S16H 5IT9L 2PI2E 3JAML 4DV7L 4YY3L 2B63G 1TY0A 3E0EA 3K8AA 3ITPA 4ULLA 1JB7A 4LNQA 1CKMA
chains in the Genus database with same CATH topology
2JA6G 4UP7A 3UDIA 3PV0A 1XNRL 1LYLA 4FDBA 4OWXB 3EIVA 4B3TL 5LMNL 4DV1Q 4H02A 3NENA 2CWAA 4ME3A 4JI8L 1SROA 3CAMA 1Q81C 4BBRG 5C0XG 1YHBA 4X64L 3CC4A 4OWWB 1PH7A 1IBKL 1A62A 4B3MQ 4BA2I 2BA0A 2DUDA 1XTDA 3MXNB 4A4IA 1PH3A 4O0AA 1XNQQ 4IPDA 2NZHA 1Z9FA 1KC8C 5IYBH 3PO2H 3M4PA 3HFZB 2OWOA 2PQAB 3HKSA 4KLKA 2ASBA 1VQ6A 3U50C 4A3CH 4PZ7A 2R7ZG 2GVAA 2PMZE 1QZHA 2JA5H 2VUMH 4KHPL 4JCVE 1UEBA 4A3EH 2R6GA 3WWVA 3ZJYC 1HR0W 1N33Q 2NVTH 3KF6A 1TXYA 3L7ZC 4DV7Q 2D0OA 3H3VI 2ATWA 4YY3Q 2MNAA 3PGZA 1SMXA 4GS3A 4YCUA 3OTOL 1TWHH 1U5KA 3IRBA 3HOZH 3AYHB 3NBHB 1J5EL 3PIPA 1M1KC 1LM0A 3FKIH 1XNRQ 1EQQA 4B3TQ 1O7IA 3CMEA 2Y0SE 4YWLA 2OCEA 1NTGA 3D0FA 4IFDG 4JYAL 3KJOA 4TVAB 3MEFA 3PCOB 1XPRA 1AE2A 4MNOA 3D31A 4X64Q 2NN6G 1I5FA 1NMFA 1IBKQ 4JV5L 3HOWG 4DV4Q 4A3LH 1YI2A 4GOPC 3CCLA 1PH6A 1E22A 4GLVB 1J6QA 2A8VA 1VQEA 1I50H 1SLJA 3TS0A 1ASZA 5GADC 4QL5A 1PV4A 1XMQL 3DLLA 2N3SA 2HT1A 4Y52H 4IJLA 3EN2A 3UDGA 3M7NA 5C4XG 4DR3L 2VZAA 2JK8A 5IY0A 3OTOQ 1MKHA 4GOPA 2BH8A 1J5EQ 3PUZA 3J80c 1EQRA 1P16A 1YITA 2C35B 3TQYA 4YCWA 1KQSA 3GD7A 4XTCS 2ZM6L 1GVPA 2I5HA 1VQJA 4R4OA 1S72A 4JYAQ 4LWCA 2UUCQ 4HIDA 2YV5A 2HIXA 1QUQA 1HZ9A 4IPGA 4NXNL 2V1CC 3RLNA 3H0GG 3T1YL 1N9WA 1Y1VG 2K5NA 5C0XJ 1YJNA 4JV5Q 1X65A 4LUZA 4HJ8A 1B7YB 3PUWA 4DR2Q 2VQEL 4R4TA 4LF5L 1YZ6A 4HJ5A 1L1OC 4LUOA 2NVXH 3SGIA 3CCJA 2JEBI 4OX9L 5GAGC 3GTGH 1JJCB 1L2FA 4IPHA 2N49A 4MZ9A 1XMQQ 4JI0L 1S40A 1FVIA 3I4OA 1K8GA 1UWVA 3OYYA 4IO9A 2AWNA 4A93H 3CPFA 4A76A 1WI5A 4DV0L 3I4NH 3K7AH 3U4VA 1L1OA 4KHZA 1N36L 4GOPB 3PF5A 1KIXA 1U0LA 1PH4A 3S1MH 5M3FH 3HOUH 3L2PA 1QVGA 2ZM6Q 4AYBG 5IP7G 2VW9A 3TREA 4HJAA 3GTMH 2L15A 3KFUA 3HKZE 1BBWA 2OQ0A 4UPAA 3T1YQ 1K3RA 1XPOA 2E5LQ 4NXNQ 3M3YH 1HNXQ 4IFDJ 1K9MC 1G291 4L5TA 4POGA 1VQFA 4BY7H 4OWTB 5BR8L 5JJLA 5IP9H 4R4QA 3CD6A 2VQEQ 1OTCA 2R93G 5JEAG 5IYDH 4DV1L 4PZ6A 2R92H 2RF4A 2QGQA 4B3RL 1EUJA 2D62A 4YWMA 4OX9Q 3CQZH 3BU2A 1GKHA 2YTYA 4POFA 4A75A 4JI0Q 1WCMG 4B3ML 3GTKH 4A3IG 3PO3G 1UE5A 3F2BA 1VQNA 2PQAA 4HIMA 4DV5L 5M3MH 4DV0Q 3NELA 2XTIA 3GO5A 2Q2TA 2Q2UA 4JI4L 2ALYB 2HQLA 3TEHB 4DR5Q 1N36Q 1HNZQ 1PH9A 3TRZA 2EIFA 5C4JH 1PH5A 2RHSB 2YTXA 1Q1EA 1Y14B 4GN4B 1IL2A 4NB3A 2A1AA 1X6OA 4UP9A 3ULJA 1VQ9A 4JI3L 1T9HA 1NY4A 1RIPA 1IBML 4L5SA 3GTQH 3HOVH 1JT8A 2JA6H 2Q2IA 4DK3C 1XPUA 1VQHA 1C0AA 5BR8Q 1G51A 4DR4Q 5K36G 3M85A 2ES2A 2KHIA 2UUBL 1HZBA 4BBRH 4X6AH 3CCUA 4B3RQ 3U58A 4JI1Q 3CCVA 1Y1WG 2NVYH 1CKOA 2E2IH 4O2DA 3HOXG 2WAQE 3CPWA 1EOVA 2JJQA 2NZOA 3HOYG 4DV4L 1VQ7A 3F2CA 4DV5Q 1WFQA 5C3EH 2ZJQA 3CP0A 2JA7G 4JI4Q 4JBKA 2CCZA 2R7ZH 1TWGH 4LF7L 2GVBA 5FLMG 2CQOA 2UXCQ 4JBJA 4IPCA 1VCIA 2OQKA 3A5ZB 1MIUA 4BA1I 1HJPA 2F52A 3J80i 1V9PA 1IBMQ 2H5XA 4JI3Q 4B3SL 2CWPA 2K4KA 4DV3Q 4GN3B 4A3JG 3GTOH 2UXDL 4EX5A 5IT9c 2ID0A 3JAMc 1Q7YC 3BZKA 4X65L 1YJ9A 2UUBQ 1PYBA 1BVSA 3H15A 5JEAJ 2UUCL 1VQ4A 1E7ZA 3M9BA 1K0RA 4A3FG 5LMNW 3STBD 3HOWH 3NEMA 4JI7L 1IBLL 4UY8C 4A3CG 1KD1C 1PYSB 4DPGA 3AFPA 4DR2L 3M4QA 3UE0A 1Q86C 5GQOA 3UDFA 4LF6L 3I7FA 4LF7Q 3ER0A 1HZCA 2WP8J 4P74A 3JC66 2LXKA 1WOCA 4OXPA 4DV2L 2BA1A 5C4XH 3GTPH 3CMAA 3G4SA 1NE3A 3FKIG 2K75A 4DK6C 4R1JA 4AH6A 3J81c 3RN2A 1VQMA 4B3SQ 3ERSX 1KRTA 4A3BG 3CCRA 2UXDQ 2IY5B 3PUVA 4Y7NH 1XJVA 3FHWA 1VQ8A 4JI5L 1TWAH 4X65Q 3S1RH 4R4IA 5GAEC 1JJGA 1VQDA 1B8AA 2N78A 2AHOB 1EWIA 1BKBA 1VQCA 1VQIA 2E8GA 2K50A 3H0GH 3U4ZA 2E5LL 1D7QA 1HNXL 1MJEA 4PMWA 4JOIC 4JI7Q 1IBLQ 1VQPA 2WFWA 5ELNA 1Q82C 1NBWA 3DM3A 4K0KL 4LF8Q 4WJ4A 5J3BA 2B3GA 3E9HA 1EYGA 2K14A 3RNUA 4LF6Q 4GLAC 1OXSC 3FP9A 2LXJA 3UDXA 5IWAL 4C3IH 1NJIC 5DLQE 4DV2Q 3I56A 1CSQA 1KHIA 5FJ8G 5C44H 4JOIA 3RZDH 5IE8A 1X56A 4GN5A 4JBWA 4PZ8A 5JJKA 1PFSA 2HIVA 1CKNA 3K0XA 4DR5L 1HNZL 4LF9L 1VQAA 2VY3A 1NMGA 4GNXA 3I4MH 4JI5Q 1HH2P 1SFOH 5IP7H 3K81C 5M5YH 4IOCA 1X3EA 1EFWA 4C3JH 1YVCA 2AKWB 1MJCA 1KL9A 1VQGA 2KCTA 4A3KG 4BY1G 3S15H 3CCMA 3RLOA 2UU9L 1X9NA 3CW2C 4UP8A 2IX0A 2QA4A 2I0QA 2IHFA 2R93H 3KJPA 3GTJH 4K0KQ 2B29A 4J15A 1E1TA 4DR4L 1VQOA 1IXRA 3RLFA 1PHJA 2ZTCA 4PG3A 4JI1L 4BXXH 3S2DH 1WCMH 3F2DA 1VQBA 2DGYA 5IWAQ 1SRUA 2ZJPA 4A3IH 2JA8G 3PO3H 2PNHA 1OXVA 4AYBE 4DAYB 1K8AC 3PUXA 4NXML 5HGQA 5IYCG 1N8RC 1I94L 3A5UA 5M3FG 4LFBL 4ALPA 3EBEA 3G48A 4BBSG 4LFCQ 4IJHA 1Q46A 3CXCA 3H3VH 4LF9Q 4A3DH 2UXCL 3K7UC 1A8VA 5JJIA 1CKNB 4AQYQ 1OXXK 4GNXB 1L0WA 1C9OA 2B63H 4DR7L 4RG1A 5LMUL 1W3SA 1S3OA 4YHHL 4LFAL 1KAWA 2Z6KC 3J7ZC 4OONA 4JI6Q 3B6YA 3KLWA 2UU9Q 4DV3L 3JAMi 2K5VA 1E3PA 1SE8A 2RCNA 3AQQA 1FJGL 3CCSA 3J81j 2QEXA 1N34L 3ULPA 1Y1WH 2A19A 2K5HA 4KI0A 1HR0L 1TWFH 3F1ZA 1PH8A 1E24A 3BJUA 1WYDA 4MTNA 2Z6KA 4X66L 3HOXH 4HIOA 3HOYH 4NXMQ 2CFMA 3I2ZA 4LF4L 2IHEA 3VDYA 4A3GG 2JA7H 1I94Q 3E9IA 4TQUS 3T1HL 4A3MG 4LFBQ 3STBC 4LUVA 1FGUA 5FLMH 5E7NA 4DV6L 5ELOA 5M5WH 5H1SE 4DR1L 1LUZA 2Q2HA 4DR7Q 2CKZB 5LMUQ 3OW2A 3J81i 1K73C 2N8NA 4OO1I 4LFAQ 4YHHQ 3HOZG 5FLXc 1VQLA 2ZTDA 4A3JH 2KBNA 3PUYA 4C2MH 1PVOA 1N32Q 1WJJA 1FJGQ 4QIWE 3G71A 2YU9H 4DUZL 3PIOA 3A74A 1YHAA 1I3QH 2F4VL 1EIYB 1N34Q 3W5OA 1CSPA 4A3FH 1HR0Q 1OXTA 4X62Q 1HNWL 5EAYA 1HZAA 3PO2G 4X66Q 2VL6A 2Y0SG 3PSIA 5IYBG 5C3EG 2OTLA 1KRSA 3TS2A 1VS0A 4QY7A 4LF4Q 4R4CA 1YBYA 3F8TA 2JA5G 5HY6A 3T1HQ 2VUMG 2R7DA 4A3EG 4C3HH 3S1QH 1IZ6A 2Z0SA 4LF8L 2UXBL 1RL2A 4GLXA 3BZCA 4DV6Q 2XGTA 1PH2A 1YIJA 2F3IA 4DUYL 4DR1Q 2YYZA 1H95A 1SN8A 4HJ7A 3W1BA 1A63A 4YCVA 5LMNQ 1JJ2A 2MFIA 4A3BH 4AIMA 1UE6A 4JI8Q 1Q12A 3CCEA 1E1OA 1XMOL 3AFQA 2BH2A 2RHQB 1YHQA 2UUAL 1VQ5A 4IOAA 4DUZQ 1W2BA 3KYHC 2F4VQ 5C0XI 3CF5A 1KXLA 1I6HH 3S2HH 3CC2A 1GD7A 3A0JA 2AWOA 4NPSA 1EIFA 3KF8B 1V43A 4A3LG 1YJWA 1HNWQ 1Y1VH 1PH1A 3ULLA 4KHPQ 4XIGS 2KCMA 4QJFA 1QVCA 4DAMA 1AH9A 1P8LA 3KDFA 2UXBQ 3GDEA 4JG2A 3KF6B 1YEZA 4EQ5A 4GKJL 4HJ9A 1LTLA 2MQHA 4GNXC 1GO3E 1B70B 4DUYQ 5FJ8H 3LGJA 3RZOH 2E2HH 2OTJA 3S24A 2IT1A 3Q8DA 4P71A 3AEVA 4LFCL 1XMOQ 2PI2A 3S14H 2MO0A 4IFDI 3W1GA 1D8LA 2UUAQ 4AQYL 1X3GA 4QQBX 1JE5A 1X3FA 2HHHL 4HIKA 2NN6I 4A3KH 3UE1A 5M5XH 4RMFA 1K83H 2I5LX 1VQKA 4BY1H 3S17H 5GAHC 3J7A5 1SR3A 4YWKA 4JI6L 2YTVA 4GKKL 1X55A 2MO1A 1R9TH 1X54A 1UE7A 3HKZG 3ICEA 1OXUA 2VQFL 2AMCB 3KDFB 4JI2L 3PF4A 2KENA 4GKJQ 5C44G 1UE1A 4DR3Q 4APVA 1PA6A 4JBMA 2GN5A 2JA8H 4DR6L 5GROA 2LSSA 4A93G 1YNXA 3I4NG 5IYCH 2ZJRA 1G6PA 4BBSH 3GTLH 3I4MG 1A0IA 4WJ3M 1CUKA 3HOUG 3K80C 2ZTEA 2JQOA 5AJ3L 3CC7A 2JEAI 1DGSA 4BXXG 2EXDA 2IX1A 1TWCH 2NVQH 3I55A 1QUQB 4OO1G 2HHHQ 2KHJA 4L5QA 3CCQA 2WB1G 4BY7G 4LF5Q 1Q8KA 1BBUA 1QVFA 5IP9G 2D0PA 2VNUD 5IYDG 4DNIA 1AE3A 3RN5A 4P73A 4GKKQ 2R92G 1N32L 2VS1A 1Q1BA 3RR5A 3G6EA 2I5MX 1JMCA 1QZGA 1ASYA 4QGUA 2VQFQ 3S1NH 4JI2Q 1XNQL 4P72A 2R7FA 4DR6Q 2JE6I 3M4OH 1V1QA 2K52A 4X62L 1C7YA 4JC0A 4P75A 5M3MG 4A3GH 1Z47A 2EQSA 1L1OB 2WB1E 4A3MH 4A3DG 2E2JH 1N33L 1IYJB 3S16H 3KOJA 2PI2E 4DV7L 4YY3L 2WAQG 1M90C 5AJ3Q 2B63G 3E0EA 3L0OA 3K8AA 4L5RC 1GM5A 1JB7A 4LNQA 1FL0A 2FXQA 4LW1A 2JA9A 1CKMA 4DKAC 3HOVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 G;  4UP7 A;  3UDI A;  3PV0 A;  1XNR L;  1LYL A;  4FDB A;  4OWX B;  3EIV A;  4B3T L;  5LMN L;  4DV1 Q;  4H02 A;  3NEN A;  2CWA A;  4ME3 A;  4JI8 L;  1SRO A;  3CAM A;  1Q81 C;  4BBR G;  5C0X G;  1YHB A;  4X64 L;  3CC4 A;  4OWW B;  1PH7 A;  1IBK L;  1A62 A;  4B3M Q;  4BA2 I;  2BA0 A;  2DUD A;  1XTD A;  3MXN B;  4A4I A;  1PH3 A;  4O0A A;  1XNQ Q;  4IPD A;  2NZH A;  1Z9F A;  1KC8 C;  5IYB H;  3PO2 H;  3M4P A;  3HFZ B;  2OWO A;  2PQA B;  3HKS A;  4KLK A;  2ASB A;  1VQ6 A;  3U50 C;  4A3C H;  4PZ7 A;  2R7Z G;  2GVA A;  2PMZ E;  1QZH A;  2JA5 H;  2VUM H;  4KHP L;  4JCV E;  1UEB A;  4A3E H;  2R6G A;  3WWV A;  3ZJY C;  1HR0 W;  1N33 Q;  2NVT H;  3KF6 A;  1TXY A;  3L7Z C;  4DV7 Q;  2D0O A;  3H3V I;  2ATW A;  4YY3 Q;  2MNA A;  3PGZ A;  1SMX A;  4GS3 A;  4YCU A;  3OTO L;  1TWH H;  1U5K A;  3IRB A;  3HOZ H;  3AYH B;  3NBH B;  1J5E L;  3PIP A;  1M1K C;  1LM0 A;  3FKI H;  1XNR Q;  1EQQ A;  4B3T Q;  1O7I A;  3CME A;  2Y0S E;  4YWL A;  2OCE A;  1NTG A;  3D0F A;  4IFD G;  4JYA L;  3KJO A;  4TVA B;  3MEF A;  3PCO B;  1XPR A;  1AE2 A;  4MNO A;  3D31 A;  4X64 Q;  2NN6 G;  1I5F A;  1NMF A;  1IBK Q;  4JV5 L;  3HOW G;  4DV4 Q;  4A3L H;  1YI2 A;  4GOP C;  3CCL A;  1PH6 A;  1E22 A;  4GLV B;  1J6Q A;  2A8V A;  1VQE A;  1I50 H;  1SLJ A;  3TS0 A;  1ASZ A;  5GAD C;  4QL5 A;  1PV4 A;  1XMQ L;  3DLL A;  2N3S A;  2HT1 A;  4Y52 H;  4IJL A;  3EN2 A;  3UDG A;  3M7N A;  5C4X G;  4DR3 L;  2VZA A;  2JK8 A;  5IY0 A;  3OTO Q;  1MKH A;  4GOP A;  2BH8 A;  1J5E Q;  3PUZ A;  3J80 c;  1EQR A;  1P16 A;  1YIT A;  2C35 B;  3TQY A;  4YCW A;  1KQS A;  3GD7 A;  4XTC S;  2ZM6 L;  1GVP A;  2I5H A;  1VQJ A;  4R4O A;  1S72 A;  4JYA Q;  4LWC A;  2UUC Q;  4HID A;  2YV5 A;  2HIX A;  1QUQ A;  1HZ9 A;  4IPG A;  4NXN L;  2V1C C;  3RLN A;  3H0G G;  3T1Y L;  1N9W A;  1Y1V G;  2K5N A;  5C0X J;  1YJN A;  4JV5 Q;  1X65 A;  4LUZ A;  4HJ8 A;  1B7Y B;  3PUW A;  4DR2 Q;  2VQE L;  4R4T A;  4LF5 L;  1YZ6 A;  4HJ5 A;  1L1O C;  4LUO A;  2NVX H;  3SGI A;  3CCJ A;  2JEB I;  4OX9 L;  5GAG C;  3GTG H;  1JJC B;  1L2F A;  4IPH A;  2N49 A;  4MZ9 A;  1XMQ Q;  4JI0 L;  1S40 A;  1FVI A;  3I4O A;  1K8G A;  1UWV A;  3OYY A;  4IO9 A;  2AWN A;  4A93 H;  3CPF A;  4A76 A;  1WI5 A;  4DV0 L;  3I4N H;  3K7A H;  3U4V A;  1L1O A;  4KHZ A;  1N36 L;  4GOP B;  3PF5 A;  1KIX A;  1U0L A;  1PH4 A;  3S1M H;  5M3F H;  3HOU H;  3L2P A;  1QVG A;  2ZM6 Q;  4AYB G;  5IP7 G;  2VW9 A;  3TRE A;  4HJA A;  3GTM H;  2L15 A;  3KFU A;  3HKZ E;  1BBW A;  2OQ0 A;  4UPA A;  3T1Y Q;  1K3R A;  1XPO A;  2E5L Q;  4NXN Q;  3M3Y H;  1HNX Q;  4IFD J;  1K9M C;  1G29 1;  4L5T A;  4POG A;  1VQF A;  4BY7 H;  4OWT B;  5BR8 L;  5JJL A;  5IP9 H;  4R4Q A;  3CD6 A;  2VQE Q;  1OTC A;  2R93 G;  5JEA G;  5IYD H;  4DV1 L;  4PZ6 A;  2R92 H;  2RF4 A;  2QGQ A;  4B3R L;  1EUJ A;  2D62 A;  4YWM A;  4OX9 Q;  3CQZ H;  3BU2 A;  1GKH A;  2YTY A;  4POF A;  4A75 A;  4JI0 Q;  1WCM G;  4B3M L;  3GTK H;  4A3I G;  3PO3 G;  1UE5 A;  3F2B A;  1VQN A;  2PQA A;  4HIM A;  4DV5 L;  5M3M H;  4DV0 Q;  3NEL A;  2XTI A;  3GO5 A;  2Q2T A;  2Q2U A;  4JI4 L;  2ALY B;  2HQL A;  3TEH B;  4DR5 Q;  1N36 Q;  1HNZ Q;  1PH9 A;  3TRZ A;  2EIF A;  5C4J H;  1PH5 A;  2RHS B;  2YTX A;  1Q1E A;  1Y14 B;  4GN4 B;  1IL2 A;  4NB3 A;  2A1A A;  1X6O A;  4UP9 A;  3ULJ A;  1VQ9 A;  4JI3 L;  1T9H A;  1NY4 A;  1RIP A;  1IBM L;  4L5S A;  3GTQ H;  3HOV H;  1JT8 A;  2JA6 H;  2Q2I A;  4DK3 C;  1XPU A;  1VQH A;  1C0A A;  5BR8 Q;  1G51 A;  4DR4 Q;  5K36 G;  3M85 A;  2ES2 A;  2KHI A;  2UUB L;  1HZB A;  4BBR H;  4X6A H;  3CCU A;  4B3R Q;  3U58 A;  4JI1 Q;  3CCV A;  1Y1W G;  2NVY H;  1CKO A;  2E2I H;  4O2D A;  3HOX G;  2WAQ E;  3CPW A;  1EOV A;  2JJQ A;  2NZO A;  3HOY G;  4DV4 L;  1VQ7 A;  3F2C A;  4DV5 Q;  1WFQ A;  5C3E H;  2ZJQ A;  3CP0 A;  2JA7 G;  4JI4 Q;  4JBK A;  2CCZ A;  2R7Z H;  1TWG H;  4LF7 L;  2GVB A;  5FLM G;  2CQO A;  2UXC Q;  4JBJ A;  4IPC A;  1VCI A;  2OQK A;  3A5Z B;  1MIU A;  4BA1 I;  1HJP A;  2F52 A;  3J80 i;  1V9P A;  1IBM Q;  2H5X A;  4JI3 Q;  4B3S L;  2CWP A;  2K4K A;  4DV3 Q;  4GN3 B;  4A3J G;  3GTO H;  2UXD L;  4EX5 A;  5IT9 c;  2ID0 A;  3JAM c;  1Q7Y C;  3BZK A;  4X65 L;  1YJ9 A;  2UUB Q;  1PYB A;  1BVS A;  3H15 A;  5JEA J;  2UUC L;  1VQ4 A;  1E7Z A;  3M9B A;  1K0R A;  4A3F G;  5LMN W;  3STB D;  3HOW H;  3NEM A;  4JI7 L;  1IBL L;  4UY8 C;  4A3C G;  1KD1 C;  1PYS B;  4DPG A;  3AFP A;  4DR2 L;  3M4Q A;  3UE0 A;  1Q86 C;  5GQO A;  3UDF A;  4LF6 L;  3I7F A;  4LF7 Q;  3ER0 A;  1HZC A;  2WP8 J;  4P74 A;  3JC6 6;  2LXK A;  1WOC A;  4OXP A;  4DV2 L;  2BA1 A;  5C4X H;  3GTP H;  3CMA A;  3G4S A;  1NE3 A;  3FKI G;  2K75 A;  4DK6 C;  4R1J A;  4AH6 A;  3J81 c;  3RN2 A;  1VQM A;  4B3S Q;  3ERS X;  1KRT A;  4A3B G;  3CCR A;  2UXD Q;  2IY5 B;  3PUV A;  4Y7N H;  1XJV A;  3FHW A;  1VQ8 A;  4JI5 L;  1TWA H;  4X65 Q;  3S1R H;  4R4I A;  5GAE C;  1JJG A;  1VQD A;  1B8A A;  2N78 A;  2AHO B;  1EWI A;  1BKB A;  1VQC A;  1VQI A;  2E8G A;  2K50 A;  3H0G H;  3U4Z A;  2E5L L;  1D7Q A;  1HNX L;  1MJE A;  4PMW A;  4JOI C;  4JI7 Q;  1IBL Q;  1VQP A;  2WFW A;  5ELN A;  1Q82 C;  1NBW A;  3DM3 A;  4K0K L;  4LF8 Q;  4WJ4 A;  5J3B A;  2B3G A;  3E9H A;  1EYG A;  2K14 A;  3RNU A;  4LF6 Q;  4GLA C;  1OXS C;  3FP9 A;  2LXJ A;  3UDX A;  5IWA L;  4C3I H;  1NJI C;  5DLQ E;  4DV2 Q;  3I56 A;  1CSQ A;  1KHI A;  5FJ8 G;  5C44 H;  4JOI A;  3RZD H;  5IE8 A;  1X56 A;  4GN5 A;  4JBW A;  4PZ8 A;  5JJK A;  1PFS A;  2HIV A;  1CKN A;  3K0X A;  4DR5 L;  1HNZ L;  4LF9 L;  1VQA A;  2VY3 A;  1NMG A;  4GNX A;  3I4M H;  4JI5 Q;  1HH2 P;  1SFO H;  5IP7 H;  3K81 C;  5M5Y H;  4IOC A;  1X3E A;  1EFW A;  4C3J H;  1YVC A;  2AKW B;  1MJC A;  1KL9 A;  1VQG A;  2KCT A;  4A3K G;  4BY1 G;  3S15 H;  3CCM A;  3RLO A;  2UU9 L;  1X9N A;  3CW2 C;  4UP8 A;  2IX0 A;  2QA4 A;  2I0Q A;  2IHF A;  2R93 H;  3KJP A;  3GTJ H;  4K0K Q;  2B29 A;  4J15 A;  1E1T A;  4DR4 L;  1VQO A;  1IXR A;  3RLF A;  1PHJ A;  2ZTC A;  4PG3 A;  4JI1 L;  4BXX H;  3S2D H;  1WCM H;  3F2D A;  1VQB A;  2DGY A;  5IWA Q;  1SRU A;  2ZJP A;  4A3I H;  2JA8 G;  3PO3 H;  2PNH A;  1OXV A;  4AYB E;  4DAY B;  1K8A C;  3PUX A;  4NXM L;  5HGQ A;  5IYC G;  1N8R C;  1I94 L;  3A5U A;  5M3F G;  4LFB L;  4ALP A;  3EBE A;  3G48 A;  4BBS G;  4LFC Q;  4IJH A;  1Q46 A;  3CXC A;  3H3V H;  4LF9 Q;  4A3D H;  2UXC L;  3K7U C;  1A8V A;  5JJI A;  1CKN B;  4AQY Q;  1OXX K;  4GNX B;  1L0W A;  1C9O A;  2B63 H;  4DR7 L;  4RG1 A;  5LMU L;  1W3S A;  1S3O A;  4YHH L;  4LFA L;  1KAW A;  2Z6K C;  3J7Z C;  4OON A;  4JI6 Q;  3B6Y A;  3KLW A;  2UU9 Q;  4DV3 L;  3JAM i;  2K5V A;  1E3P A;  1SE8 A;  2RCN A;  3AQQ A;  1FJG L;  3CCS A;  3J81 j;  2QEX A;  1N34 L;  3ULP A;  1Y1W H;  2A19 A;  2K5H A;  4KI0 A;  1HR0 L;  1TWF H;  3F1Z A;  1PH8 A;  1E24 A;  3BJU A;  1WYD A;  4MTN A;  2Z6K A;  4X66 L;  3HOX H;  4HIO A;  3HOY H;  4NXM Q;  2CFM A;  3I2Z A;  4LF4 L;  2IHE A;  3VDY A;  4A3G G;  2JA7 H;  1I94 Q;  3E9I A;  4TQU S;  3T1H L;  4A3M G;  4LFB Q;  3STB C;  4LUV A;  1FGU A;  5FLM H;  5E7N A;  4DV6 L;  5ELO A;  5M5W H;  5H1S E;  4DR1 L;  1LUZ A;  2Q2H A;  4DR7 Q;  2CKZ B;  5LMU Q;  3OW2 A;  3J81 i;  1K73 C;  2N8N A;  4OO1 I;  4LFA Q;  4YHH Q;  3HOZ G;  5FLX c;  1VQL A;  2ZTD A;  4A3J H;  2KBN A;  3PUY A;  4C2M H;  1PVO A;  1N32 Q;  1WJJ A;  1FJG Q;  4QIW E;  3G71 A;  2YU9 H;  4DUZ L;  3PIO A;  3A74 A;  1YHA A;  1I3Q H;  2F4V L;  1EIY B;  1N34 Q;  3W5O A;  1CSP A;  4A3F H;  1HR0 Q;  1OXT A;  4X62 Q;  1HNW L;  5EAY A;  1HZA A;  3PO2 G;  4X66 Q;  2VL6 A;  2Y0S G;  3PSI A;  5IYB G;  5C3E G;  2OTL A;  1KRS A;  3TS2 A;  1VS0 A;  4QY7 A;  4LF4 Q;  4R4C A;  1YBY A;  3F8T A;  2JA5 G;  5HY6 A;  3T1H Q;  2VUM G;  2R7D A;  4A3E G;  4C3H H;  3S1Q H;  1IZ6 A;  2Z0S A;  4LF8 L;  2UXB L;  1RL2 A;  4GLX A;  3BZC A;  4DV6 Q;  2XGT A;  1PH2 A;  1YIJ A;  2F3I A;  4DUY L;  4DR1 Q;  2YYZ A;  1H95 A;  1SN8 A;  4HJ7 A;  3W1B A;  1A63 A;  4YCV A;  5LMN Q;  1JJ2 A;  2MFI A;  4A3B H;  4AIM A;  1UE6 A;  4JI8 Q;  1Q12 A;  3CCE A;  1E1O A;  1XMO L;  3AFQ A;  2BH2 A;  2RHQ B;  1YHQ A;  2UUA L;  1VQ5 A;  4IOA A;  4DUZ Q;  1W2B A;  3KYH C;  2F4V Q;  5C0X I;  3CF5 A;  1KXL A;  1I6H H;  3S2H H;  3CC2 A;  1GD7 A;  3A0J A;  2AWO A;  4NPS A;  1EIF A;  3KF8 B;  1V43 A;  4A3L G;  1YJW A;  1HNW Q;  1Y1V H;  1PH1 A;  3ULL A;  4KHP Q;  4XIG S;  2KCM A;  4QJF A;  1QVC A;  4DAM A;  1AH9 A;  1P8L A;  3KDF A;  2UXB Q;  3GDE A;  4JG2 A;  3KF6 B;  1YEZ A;  4EQ5 A;  4GKJ L;  4HJ9 A;  1LTL A;  2MQH A;  4GNX C;  1GO3 E;  1B70 B;  4DUY Q;  5FJ8 H;  3LGJ A;  3RZO H;  2E2H H;  2OTJ A;  3S24 A;  2IT1 A;  3Q8D A;  4P71 A;  3AEV A;  4LFC L;  1XMO Q;  2PI2 A;  3S14 H;  2MO0 A;  4IFD I;  3W1G A;  1D8L A;  2UUA Q;  4AQY L;  1X3G A;  4QQB X;  1JE5 A;  1X3F A;  2HHH L;  4HIK A;  2NN6 I;  4A3K H;  3UE1 A;  5M5X H;  4RMF A;  1K83 H;  2I5L X;  1VQK A;  4BY1 H;  3S17 H;  5GAH C;  3J7A 5;  1SR3 A;  4YWK A;  4JI6 L;  2YTV A;  4GKK L;  1X55 A;  2MO1 A;  1R9T H;  1X54 A;  1UE7 A;  3HKZ G;  3ICE A;  1OXU A;  2VQF L;  2AMC B;  3KDF B;  4JI2 L;  3PF4 A;  2KEN A;  4GKJ Q;  5C44 G;  1UE1 A;  4DR3 Q;  4APV A;  1PA6 A;  4JBM A;  2GN5 A;  2JA8 H;  4DR6 L;  5GRO A;  2LSS A;  4A93 G;  1YNX A;  3I4N G;  5IYC H;  2ZJR A;  1G6P A;  4BBS H;  3GTL H;  3I4M G;  1A0I A;  4WJ3 M;  1CUK A;  3HOU G;  3K80 C;  2ZTE A;  2JQO A;  5AJ3 L;  3CC7 A;  2JEA I;  1DGS A;  4BXX G;  2EXD A;  2IX1 A;  1TWC H;  2NVQ H;  3I55 A;  1QUQ B;  4OO1 G;  2HHH Q;  2KHJ A;  4L5Q A;  3CCQ A;  2WB1 G;  4BY7 G;  4LF5 Q;  1Q8K A;  1BBU A;  1QVF A;  5IP9 G;  2D0P A;  2VNU D;  5IYD G;  4DNI A;  1AE3 A;  3RN5 A;  4P73 A;  4GKK Q;  2R92 G;  1N32 L;  2VS1 A;  1Q1B A;  3RR5 A;  3G6E A;  2I5M X;  1JMC A;  1QZG A;  1ASY A;  4QGU A;  2VQF Q;  3S1N H;  4JI2 Q;  1XNQ L;  4P72 A;  2R7F A;  4DR6 Q;  2JE6 I;  3M4O H;  1V1Q A;  2K52 A;  4X62 L;  1C7Y A;  4JC0 A;  4P75 A;  5M3M G;  4A3G H;  1Z47 A;  2EQS A;  1L1O B;  2WB1 E;  4A3M H;  4A3D G;  2E2J H;  1N33 L;  1IYJ B;  3S16 H;  3KOJ A;  2PI2 E;  4DV7 L;  4YY3 L;  2WAQ G;  1M90 C;  5AJ3 Q;  2B63 G;  3E0E A;  3L0O A;  3K8A A;  4L5R C;  1GM5 A;  1JB7 A;  4LNQ A;  1FL0 A;  2FXQ A;  4LW1 A;  2JA9 A;  1CKM A;  4DKA C;  3HOV G; 
#chains in the Genus database with same CATH topology
 4UP7 A;  3PV0 A;  1KNE A;  1HXY D;  3EIV A;  2NVY B;  4J6H A;  4H02 A;  3NEN A;  2KCN A;  4FP5 D;  5C0X G;  1YHB A;  3SXH A;  2PW7 A;  1WTW A;  4RGM A;  2DUD A;  3MXN B;  3MC0 B;  4IPD A;  5CYU A;  5EPJ A;  3I72 A;  2PQA B;  1VQ6 A;  4DNT B;  4PZ7 A;  4KHP L;  2GVA A;  3ZJY C;  3WWV A;  1HR0 W;  2RQX A;  5JVH 3;  1EY9 A;  4GS3 A;  1TWH H;  1U5K A;  5C3X A;  3PIP A;  1UAP A;  3I91 A;  3VYR A;  1NCV A;  1RF2 D;  1XNR Q;  4YWL A;  1NTG A;  4IFD G;  1XPR A;  3WDN A;  3D31 A;  1HRJ A;  4ODG A;  2H4O A;  1NAP A;  1H9S A;  4J8Q A;  4LJZ C;  1BCP F;  4DV4 Q;  2ZXP A;  1YI2 A;  4C3H G;  1SYF A;  3SVM A;  4L8J A;  2A8V A;  1STG A;  1SLJ A;  1JOO A;  4KD4 A;  2B2Y A;  3EN2 A;  2RSN A;  1EWH A;  1I4G A;  1RDP D;  1X3P A;  2B39 A;  2VZA A;  4DR3 L;  2SNS A;  3OTO Q;  1MKH A;  5KRU A;  2F0E A;  5DM7 3;  5C5L A;  3TQY A;  2XN9 C;  1V1P A;  3GD7 A;  4CDD C;  1EYC A;  2A5H A;  2MHV A;  4R4O A;  1S72 A;  3HGB A;  2F0W A;  1N9W A;  1YJN A;  1IKM A;  5C0X J;  2ICI A;  4JV5 Q;  4LUZ A;  1TR5 A;  4DR2 Q;  1CT1 D;  4XDX A;  4UHV A;  1L1O C;  1Y8O B;  2JN4 A;  5I4D A;  3CCJ A;  5A35 A;  5GAG C;  1L2F A;  2ZT9 C;  4IPH A;  1XMQ Q;  4NDX A;  3I4O A;  3MHB A;  1K8G A;  4A93 H;  4AYB B;  3I3C A;  4DV0 L;  4KHZ A;  1PH4 A;  3IFT A;  1A2T A;  3VR5 A;  3HOU H;  1A15 A;  1QVG A;  3BYY B;  2EPB A;  3GTM H;  5CMD A;  3HKZ E;  1BBW A;  4UPA A;  5BN5 A;  3M3Y H;  4TSS A;  4IFD J;  2IW3 A;  2R92 B;  4POG A;  1SNM A;  4L5T A;  3NHH A;  1PYW D;  5BR8 L;  3CD6 A;  1OTC A;  3FMC A;  4PZ6 A;  2R92 H;  4JVZ A;  4YWM A;  4OX9 Q;  2DNE A;  1GKH A;  5M3M B;  2EZV A;  3P1H A;  4A3I G;  1UE5 A;  1ONL A;  3VYS A;  5M3M H;  2Q2T A;  2B63 B;  1EEI D;  2PNR C;  2ALY B;  1N36 Q;  4DR5 Q;  2B8F A;  4RHR A;  1PH9 A;  2Z6B A;  5C4J H;  3TRZ A;  1PH5 A;  1B1Z A;  1F2Z A;  5ELB A;  2F0I A;  1F9Q A;  2OT2 A;  2A1A A;  1X6O A;  3ULJ A;  2CW0 D;  1VQ9 A;  3NBH A;  4JI3 L;  1RIP A;  1JT8 A;  4L5S A;  4XQN A;  5KND A;  4EQP A;  1VMP A;  1G51 A;  1WTP A;  1BXT A;  2ES2 A;  5EBC A;  5J22 A;  2JA7 B;  2JXM B;  2B8G A;  3K58 A;  4CJ1 B;  1Y1W G;  5AFW A;  4ZUI A;  3HOX G;  4B9X A;  2JJQ A;  4KJN A;  3HOY G;  4DV4 L;  2C9O A;  2K05 A;  3F2C A;  5IGD A;  3FDT A;  5FLM G;  2UXC Q;  4ID6 A;  4JBJ A;  2IWH A;  3C2P A;  1JOQ A;  3MFY A;  5ELC A;  4BA1 I;  3A54 A;  3J80 i;  1I3Q B;  2H5X A;  2K4K A;  4GN3 B;  2UXD L;  1EY7 A;  4IFD H;  3BZK A;  4KHV A;  2UUB Q;  1Q90 A;  4C3H B;  3I8Z A;  1G91 A;  3MEH A;  4A3C G;  4QCL A;  1KD1 C;  1PYS B;  1PRT D;  4DR2 L;  5GQO A;  4LF7 Q;  3FVQ A;  1CQV A;  3JC6 6;  1WTR A;  4OXP A;  2K28 A;  3GTP H;  1NE3 A;  4DK6 C;  1VQM A;  4R1J A;  4AH6 A;  4B3S Q;  3ERS X;  1C8C A;  4A3B G;  1STB A;  3RD4 A;  4Y7N H;  5DM6 3;  1JJG A;  1VQD A;  2HUG A;  1EWI A;  1BKB A;  1VQC A;  3H3V C;  3U4Z A;  4RCO A;  4KY6 A;  1EY5 A;  3J7A V;  1F9S A;  4JOI C;  2IJ0 A;  2FFK B;  1LTB D;  2WFW A;  5ELN A;  1Q82 C;  2BE5 C;  2F0T A;  4WJ4 A;  3K5M A;  3RNU A;  3RZO B;  3OPO A;  5IWA L;  1B9N A;  3J7A F;  2A69 D;  3RZD H;  1X56 A;  3KLS A;  5I6W A;  3MVV A;  3QG1 A;  1CKN A;  4DR5 L;  1VQA A;  2VY3 A;  4GNX A;  4U68 A;  4JI5 Q;  1LLR D;  2X69 A;  3K81 C;  1YVC A;  2BDO A;  1MJC A;  2KCT A;  4BY1 G;  3NE5 B;  4KD3 A;  2PZW A;  2JA8 B;  1LO5 D;  4F87 A;  4K0K Q;  2N88 A;  1VQO A;  1PHJ A;  3KLR A;  2ZTC A;  3GTL B;  1PFM A;  1T5X D;  3F2D A;  2ZJP A;  2DGY A;  4A3I H;  2PNH A;  4DAP A;  1AFP A;  3TP5 A;  1K8A C;  3ND8 A;  2C5C A;  2F0J A;  5IYC G;  2K01 A;  3A5U A;  4LFB L;  4ALP A;  3EBE A;  1FR3 A;  4ME5 A;  1STH A;  4IJH A;  1FD7 D;  4LF9 Q;  2UXC L;  5JJI A;  1RCV D;  1ZKO A;  4AQY Q;  1JWS D;  4HED A;  1C9O A;  5C3W A;  4RG1 A;  3FRP B;  3R8B A;  2KVM A;  3S1N B;  2UU9 Q;  1GJX A;  3JAM i;  1E3P A;  1FJG L;  2L1B A;  4A3G B;  3HOY B;  4H13 C;  1Y1W H;  2A19 A;  1HR0 L;  1TWF H;  1E24 A;  3HOX H;  1QE6 A;  3VR3 A;  1JB3 A;  3HOY H;  2HDL A;  3E9I A;  1FGU A;  5FLM H;  1O78 A;  1NNX A;  4DV6 L;  2EYP A;  1KAA A;  1U4M A;  5DNF A;  5H1S E;  1BF4 A;  4C2M B;  1E2W A;  2TMP A;  4DR7 Q;  2CKZ B;  5LMU Q;  3OW2 A;  4YHH Q;  1VQL A;  2KBN A;  3PUY A;  4C2M H;  4BS9 A;  5DAU A;  5NUC A;  1LTA D;  1EQV A;  1NR4 A;  4CDE C;  1YHA A;  2F4V L;  3H09 A;  3W5O A;  1CSP A;  2NN6 H;  4X62 Q;  2F0D A;  3PO2 G;  1II3 A;  4X66 Q;  1PTO H;  5C3E G;  4IUP A;  1AZQ A;  2OTL A;  2MJ8 A;  5E3F A;  4IZ8 A;  1JE4 A;  2JA5 G;  2VUM G;  2UXB L;  2F03 A;  1RL2 A;  4GLX A;  4DUY L;  1ET9 A;  4IUN A;  5I2X A;  4A3B H;  2Q8R E;  4DAV A;  1QJO A;  4JI8 Q;  1Q12 A;  2EXZ A;  3CCE A;  3FEW X;  3VYU A;  2UUA L;  4HCE A;  2O5I C;  1KXL A;  5C0X I;  3S2H H;  3CC2 A;  4QF4 A;  3R2T A;  4KN4 C;  4N8X 1;  4ZAI A;  1SSO A;  4JW0 A;  3HRZ C;  4QJF A;  3AU7 A;  4EQN A;  1P8L A;  3KDF A;  3QOJ A;  1GO3 E;  4DAY A;  3TSS A;  1TS5 A;  3TP8 A;  2IT1 A;  4P71 A;  3AEV A;  3VA5 A;  2WKC A;  3AMU A;  3S14 H;  1O7Z A;  2MO0 A;  4IFD I;  1D8L A;  4AQY L;  1JWM D;  2E75 C;  2EVB A;  3V2T A;  3HKZ B;  1I4P A;  4Q5V A;  4CKB A;  3GTG B;  1H9S B;  1K83 H;  4BY1 H;  1K0S A;  1CZG A;  1DON A;  1R9T H;  1UE7 A;  4HSV A;  1SYD A;  4X3U A;  1F77 A;  1A3T A;  2AQ2 B;  5JEA H;  2AMC B;  3SDZ A;  3D8G A;  3PF4 A;  1E2V A;  5C44 G;  4DR6 L;  4APV A;  1BOS A;  2GN5 A;  4QB4 A;  1RHP A;  3T51 B;  3I4N G;  1QWY A;  5IYC H;  5ELD A;  4RGN A;  3Q22 A;  3VR2 A;  4BY7 B;  2JQO A;  4K2L A;  2G9D A;  4K2K A;  5AJ3 L;  2ZXR A;  2XIW A;  1ZYR C;  1K3B C;  2NVQ H;  1M8A A;  2EY5 A;  1XTC D;  3DWA A;  2NZ1 D;  4DK1 A;  3CCQ A;  2WB1 G;  1KTK A;  2EYL A;  4LF5 Q;  1Q8K A;  1SYC A;  2D0P A;  3RN5 A;  4P73 A;  3D6W A;  5D3I B;  2L9H A;  2O5J C;  1SYE A;  2AQ1 B;  3G6E A;  1YNJ C;  2I5M X;  2L11 A;  2VQF Q;  4JI2 Q;  3K59 A;  2LMC B;  4P72 A;  1XNQ L;  2WKD A;  3M4O H;  4X62 L;  2E2J B;  4JC0 A;  4P75 A;  4U67 3;  1DCZ A;  4A3D G;  4DXF A;  2E2J H;  3HOV B;  3KOJ A;  1G8Z D;  2PMZ B;  2JA6 B;  2WAQ G;  1M90 C;  5COY A;  4QMG A;  4BBR B;  1FL0 A;  4FXK C;  4DKA C;  3BVG A;  2K1B A;  5C5M A;  3UDI A;  4OWX B;  4B3T L;  4M8A A;  4HN7 A;  1STY A;  4ME3 A;  1S5B D;  1Q81 C;  4JI8 L;  2SDF A;  3CAM A;  1PTO F;  3CKI B;  3L9A X;  4X64 L;  5C3E B;  4OWW B;  1EFI D;  2SEB D;  2B2W A;  1IBK L;  2OXP A;  4B08 A;  4B3M Q;  2BA0 A;  3D3R A;  1PH3 A;  3KF8 A;  5JOB A;  3PO2 H;  3HFZ B;  4KLK A;  3U50 C;  2JA5 H;  2VUM H;  2R6G A;  1N33 Q;  3KF6 A;  1TXY A;  3OWE B;  4DV7 Q;  3GTO B;  1GOZ A;  1LT5 D;  4YY3 Q;  1MHW C;  1EEF D;  2LS0 1;  1AEX A;  2F3V A;  3HZX A;  3PGZ A;  5FO8 B;  2I46 A;  3NBH B;  1J5E L;  1AN8 A;  1M1K C;  2RSO A;  1B53 A;  3FKI H;  5I9P A;  3CME A;  3HOW B;  2OCE A;  3D0F A;  3PMF A;  4TVA B;  3PCO B;  4MNO A;  2Q8T A;  1JQY D;  1CTM A;  2B2Y C;  3ERO A;  4FF2 A;  1TQO A;  3CCL A;  1E22 A;  2QIL A;  1IHZ A;  1O7L A;  1HPC A;  1I50 H;  3TS0 A;  4QL5 A;  1PV4 A;  2N3S A;  5D14 A;  1NUC A;  1B2T A;  2XVS A;  3TDQ A;  3UDG A;  4R8N A;  1FNU A;  2JK8 A;  5IGE A;  3G7L A;  1TWA B;  4GOP A;  3S1R B;  3PUZ A;  1P16 A;  3A8J E;  4KKS A;  2C35 B;  1KQS A;  5E4W C;  3SK5 A;  2ZM6 L;  2I5H A;  2QKI C;  2UUC Q;  3T1Y L;  1QUQ A;  1HZ9 A;  4IPG A;  1X65 A;  1PZI D;  3PUW A;  1PXU A;  4C3I B;  5CV9 A;  4LF5 L;  4HJ5 A;  1WTV A;  5C44 B;  2JEB I;  1SNO A;  3BYT B;  3OWF A;  1SJH D;  1EIG A;  2N49 A;  4PMB A;  3I4N B;  2HQE A;  1DJR D;  1UWV A;  3OYY A;  4ZQ3 A;  1SFO B;  3I4N H;  4MIU A;  4KV6 A;  3U4V A;  1KIX A;  1U0L A;  3S1M H;  4DK0 A;  5M3F H;  4OL7 A;  5JPM C;  4AYB G;  4HJA A;  1HA6 A;  3SK6 A;  2R93 B;  3GTJ B;  2E5L Q;  1XPO A;  1K3R A;  3R93 A;  3MFG A;  1K9M C;  1ICF B;  4OWT B;  2KUM A;  4RFB A;  1WCM B;  1DXM A;  2JYO A;  4R4Q A;  4CJ2 C;  4JPB W;  1KDB A;  4B3R L;  1EUJ A;  1BDO A;  3OSO A;  3GTK H;  4B3M L;  4WJW A;  4A3D B;  1VQN A;  4K8J A;  4HMI A;  1RTO A;  4CBV A;  1SE4 A;  4CDF C;  4DV0 Q;  1B3Q A;  2WAQ B;  2XTI A;  4F7X A;  2Q2U A;  1ESR A;  1HNZ Q;  1TU2 B;  1S5D D;  2YTX A;  1Y14 B;  4GN4 B;  4NB3 A;  4KTA A;  4UP9 A;  1T9H A;  1NY4 A;  3GTQ H;  3E5S A;  1DOK A;  4DK3 C;  3EFX D;  5BR8 Q;  4X3K A;  2KHI A;  3CCU A;  3U58 A;  3IFD A;  4JI1 Q;  3CCV A;  2QDB A;  4X3S A;  1ESF A;  1EU3 A;  2KJX A;  1KNA A;  2NVY H;  4O2D A;  5CR3 A;  5M5W B;  1EOV A;  2NZO A;  2F0U A;  1VQ7 A;  2XWJ B;  2ZJQ A;  2JA7 G;  3QO2 A;  3CP0 A;  4JBK A;  2F0Q A;  2CCZ A;  1R4Q B;  4IPC A;  4A3J B;  1TS4 A;  4FNF A;  5CV5 A;  1VCI A;  2OQK A;  1BCP C;  1MIU A;  3NXW A;  5EBD A;  2YU9 B;  1HJP A;  1LTR D;  4JI3 Q;  2D5D A;  4HAE A;  1EY4 A;  4KY5 A;  2IPK D;  4A3F B;  3OMG A;  1GHK A;  3DXJ C;  4ZLT F;  1Q7Y C;  3R2I A;  2N55 A;  1YJ9 A;  2K33 A;  1PYB A;  3H15 A;  1KDA A;  2UUC L;  3M9B A;  3S1Q B;  1GHJ A;  5EKI A;  1O80 A;  3M4Q A;  3UE0 A;  3I7F A;  1HZC A;  5T1G A;  1WOC A;  4G57 A;  4DV2 L;  2BA1 A;  3X3M A;  3J81 c;  2V4D A;  1I6H B;  1CM9 A;  3CCR A;  2UXD Q;  2IY5 B;  2M00 A;  4I65 A;  1XJV A;  2A68 D;  4FF1 A;  1E2Z A;  2AHO B;  2EOT A;  1GUG A;  2E5L L;  1C4Q A;  1MJE A;  2PYK A;  4LF8 Q;  3VR4 A;  5J3B A;  1EYG A;  5D65 A;  2E2H B;  1OXS C;  3FP9 A;  5IOC A;  3UDX A;  1KLG D;  4PQX A;  1HHV A;  1CSQ A;  2XSC A;  3TN2 A;  3P7J A;  4GN5 A;  2PW5 A;  5JJK A;  3VR6 A;  1HNZ L;  1NMG A;  3HG9 A;  2TSS A;  4MTK A;  2I07 B;  1IL8 A;  1Y8P B;  1I6V C;  3RLO A;  3CW2 C;  4UP8 A;  2I0Q A;  2IHF A;  5D3D A;  2Z1C A;  1E1T A;  1IXR A;  3RLF A;  4JI1 L;  2Z4I A;  4K5W A;  5IWA Q;  1SRU A;  2JA8 G;  1OO9 B;  5EGT A;  1EZ8 A;  2K5W A;  4DAY B;  4NXM L;  3PUX A;  3EA6 A;  3X3N A;  1N8R C;  1TWC B;  1LT6 D;  4LFC Q;  4XQJ A;  1Q46 A;  3CXC A;  2F0H A;  3H3V H;  3K7U C;  1OXX K;  3IL8 A;  1QG7 A;  5FO9 B;  2B63 H;  3D4W A;  1EZ6 A;  4OON A;  2NUC A;  2FHT A;  2MUY A;  2VB2 X;  2K5V A;  2F0V A;  3MXP A;  2RCN A;  1PFB A;  1N34 L;  4A3M B;  4S3S A;  3OOC A;  5C0X H;  2K5H A;  4DN4 M;  3BJU A;  2Z6K A;  5CC4 A;  2F0O A;  2CFM A;  4LF4 L;  1U4R A;  4A3G G;  2JA7 H;  1PTO D;  4DU9 A;  4TQU S;  4LFB Q;  3STB C;  4LUV A;  3IKJ A;  1BUV T;  2EY2 A;  4C1N K;  1WTX A;  4XYQ A;  1QNU A;  2N8N A;  3HOZ G;  1MI2 A;  3M7G A;  5FLX c;  1EYD A;  1H9J A;  1YNJ D;  2CH4 A;  1PVO A;  3MA2 B;  4UDU C;  4HTH A;  1FJG Q;  3G71 A;  3PIO A;  3A74 A;  1I3Q H;  3LWU A;  2B2T A;  4A3E B;  1HR0 Q;  1OXT A;  2NVT B;  2PZT A;  2AQ3 B;  2A6H C;  3PSI A;  2VL6 A;  2XRQ D;  4QY7 A;  1YBY A;  3A55 A;  5HY6 A;  1RTN A;  4C3H H;  4LF8 L;  1VF7 A;  1S5F D;  3BZC A;  1U4L A;  4DV6 Q;  1BBX C;  3EQL C;  3CRL C;  1DOM A;  3KBX A;  1SDF A;  1SN8 A;  3V05 A;  1A63 A;  2LY7 A;  4AIM A;  1XWE A;  5EJW A;  1XMO L;  1E1O A;  1B44 D;  2BH2 A;  2EE1 A;  4IOA A;  1W2B A;  1KDC A;  3KYH C;  2F4V Q;  3A0J A;  4NPS A;  1K28 A;  3KF8 B;  1V43 A;  4A3L G;  3J81 E;  1I4Q A;  4XIG S;  2KCM A;  5IGB A;  5JPN C;  2IX3 A;  2UXB Q;  4JG2 A;  3KF6 B;  4HJ9 A;  4OEL B;  1LTL A;  4KK7 A;  4DUY Q;  1HA5 A;  4IN3 A;  4IUR A;  3RZO H;  3Q8D A;  4IUT A;  5FOB B;  1SNQ A;  4LFC L;  1EY6 A;  3SE0 A;  3S17 B;  2UUA Q;  4E6I A;  4KY7 A;  3Q23 A;  3HP3 A;  4IUV A;  4HIK A;  4RMF A;  4RH6 A;  3S17 H;  1EOT A;  5GAH C;  2YTV A;  1RJT A;  1X55 A;  4GKK L;  1MSG A;  1X54 A;  3HKZ G;  1SE2 A;  3K7A B;  1WD0 A;  3ICE A;  1WTQ A;  4JBM A;  1PA6 A;  2DN8 A;  2JA8 H;  1QNK A;  4FXG C;  1YNX A;  2MGS A;  1EU4 A;  2RDH A;  3NTI A;  4N9T A;  1H9K A;  5IGG A;  2ZJR A;  1UEA B;  3GTL H;  3I4M G;  5C4Z A;  1CUK A;  3DHQ A;  2ZTE A;  2LFN A;  2F0P A;  1DGS A;  1E0B A;  5LHY 1;  2QF7 A;  3BVM A;  1QUQ B;  4OO1 G;  1CA5 A;  1GXD C;  3CQZ B;  1Q3L A;  4BY7 G;  1EY0 A;  1S4Z A;  1LT3 D;  4DNI A;  5IYD G;  2A6E D;  2F1M A;  4ZK9 B;  4XT1 B;  3RR5 A;  4NKL A;  4O42 A;  2EY6 A;  1JMC A;  3VA7 A;  1ASY A;  3S1N H;  4UAI A;  1FNW A;  2M2L A;  4DR6 Q;  2JE6 I;  1V1Q A;  1C7Y A;  2EY1 A;  4A3G H;  1Z47 A;  2EQS A;  2RKS A;  2WB1 E;  1I4H A;  1K8O A;  1ENA A;  3QR8 A;  1Y69 U;  4HCS A;  2F0K A;  5AJ3 Q;  3HOZ B;  3L0O A;  1EWC A;  2B2W C;  1GM5 A;  2K5Q A;  2JA9 A;  1LAC A;  3HOV G;  2JA6 G;  1D1K A;  3HOZ H;  3FPU B;  1LYL A;  1PFN A;  4FDB A;  1F2L A;  2Q8I B;  1SRO A;  5COR A;  4BBR G;  3T13 A;  3MTS A;  2R7Z B;  1TWG B;  4BA2 I;  4A4I A;  1XNQ Q;  4O0A A;  1YNN D;  1KC8 C;  3M4P A;  4K5V A;  3C1F A;  1HTL D;  5FLX E;  2OWO A;  2ASB A;  1LTG D;  4A3C H;  1QZH A;  1CI3 M;  2K7V A;  2QDL A;  1EQT A;  3BDL A;  4JCV E;  5HUR A;  5E4X A;  3H3V I;  2ATW A;  2HD3 A;  2MNA A;  4XT3 B;  4DF7 A;  3NBI A;  4PMC A;  1EQQ A;  4B3T Q;  1O7I A;  2Y0S E;  1I4X A;  4CGY B;  4JYA L;  3KJO A;  3MEF A;  1AE2 A;  4X64 Q;  1TY2 A;  1EY8 A;  1I5F A;  1NMF A;  1IBK Q;  1AZP A;  3HOW G;  4A3L H;  4GOP C;  3LWE A;  1PH6 A;  5C4X B;  2L4N A;  5CV7 A;  4NP5 A;  4IJL A;  3H94 A;  3M7N A;  5IY0 A;  1F9R A;  3F2U A;  2BH8 A;  1J5E Q;  3J80 c;  1EQR A;  3H0G B;  4EQO A;  3TZU A;  1PRT B;  1VQJ A;  2X6L A;  2L12 A;  4HID A;  2EYF A;  2HIX A;  1SJE D;  2EYM A;  4NXN L;  3RLN A;  1T5E A;  2K5N A;  1Y1V G;  3KUP A;  4LK1 C;  2VQE L;  4R4T A;  1YZ6 A;  3PQI A;  3SGI A;  3I70 A;  2P5Z X;  1JJC B;  3GTG H;  4JI0 L;  1FVI A;  4C3I G;  3QWN A;  2ZXO A;  3I4M B;  5M5Y B;  1LV9 A;  4C3J B;  4TRD A;  2G9H D;  4ZRZ A;  2AUK A;  2AUJ D;  3L2P A;  3S15 B;  2ZM6 Q;  2WAC A;  1V1P B;  4G7H C;  3V96 A;  1HQR D;  2OQ0 A;  3T1Y Q;  4OO1 H;  1A3V A;  1G29 1;  4BY7 H;  1D5X C;  2CW0 C;  1SXT A;  1GUO A;  4K14 A;  3MXU A;  2R93 G;  5IYD H;  3RMH A;  4EGV A;  1DD2 A;  3P20 A;  4KN7 C;  4A75 A;  1WCM G;  1I4R A;  3F2B A;  3T4A C;  4BWG B;  1Q8I A;  4DV5 L;  3NEL A;  4JI4 L;  1BQQ T;  2HQL A;  3TEH B;  3ZYY X;  2K04 A;  1CA6 A;  3T53 B;  5CBA E;  1IL2 A;  3E3X A;  1U9R A;  3TP7 A;  1IBM L;  3NWS A;  3HOV H;  2JA6 H;  3U9O A;  2RBM A;  1LTI D;  2BOS A;  4DR4 Q;  2O2L D;  4BBR H;  4B3R Q;  1WTH A;  2QEJ C;  1HUM A;  3D4R A;  1J9O A;  4XXE A;  4FF4 A;  2B2U A;  2J7Z A;  3A8K E;  5K36 G;  5C3E H;  2KA7 A;  1NR2 A;  1BR9 A;  3BS1 A;  2GVB A;  1PRT C;  5IOD A;  3U9S A;  1SE3 A;  4OEM B;  3T16 A;  1G2S A;  2F52 A;  4DV3 Q;  4A3J G;  3GTO H;  4PNY A;  1A6X A;  4EX5 A;  5IT9 c;  3JAM c;  4X65 L;  2O4X A;  2L5T A;  1Z7T A;  1BVS A;  2GA4 B;  1LTS D;  4F8M A;  1VQ4 A;  4ZKC B;  4A3F G;  1STA A;  5LMN W;  3STB D;  3HOW H;  1M4V A;  2R3Z A;  3NEM A;  3P75 A;  5J39 A;  1IBL L;  4JI7 L;  4FO2 A;  2RVL A;  3UDF A;  1QIL A;  2EYH A;  4LF6 L;  3MZ5 A;  1QB5 D;  2NYZ D;  4ZUJ A;  5A2Q E;  3NK9 A;  2KQ3 A;  3G4S A;  2K75 A;  2MPM A;  2EDG A;  5E1F A;  1Y1V B;  1TWA H;  4RCN A;  3S1R H;  2PZU A;  4R4I A;  5GAE C;  1MSH A;  1B8A A;  5KYI A;  1D5Z C;  4MN3 A;  2K50 A;  1BCP B;  3GQB A;  2JP1 A;  1DM0 B;  4PMW A;  2CH4 W;  2DJF C;  3J80 E;  1VQP A;  3MXG A;  1NBW A;  4H0L C;  2B3G A;  5G3L D;  3E9H A;  3VYT A;  4C3I H;  1NJI C;  1TII D;  4DV2 Q;  5FJ8 G;  5C44 H;  3BVZ A;  4ABN A;  4JBW A;  3WOE A;  5KNC A;  2HIV A;  4A3K B;  5M5X B;  2F0S A;  1HH2 P;  1TS2 A;  1SFO H;  2K5D A;  4IOC A;  2QCP X;  1EFW A;  4FVM A;  1DYQ A;  1SYB A;  5EPK A;  1VQG A;  2E2D C;  2BE5 D;  5ISR A;  2QA4 A;  3S2D B;  2R93 H;  3GTJ H;  1TKW B;  2B29 A;  4DR4 L;  4RWS C;  1SNC A;  3S2D H;  1DZ1 A;  1WCM H;  1VQB A;  1X3Q A;  1OXV A;  5HGQ A;  1I94 L;  3T56 B;  4K5X A;  4BBS G;  3G48 A;  4A3D H;  2E76 C;  4DGZ A;  1CKN B;  1ET6 A;  3LX0 A;  4GNX B;  5EQ0 A;  1S3O A;  1BNZ A;  3R3O A;  4LFA L;  1EYA A;  3K5O A;  1KAW A;  2Z6K C;  3LNN A;  3J7Z C;  4JI6 Q;  3B6Y A;  3KLW A;  2EJG C;  4DV3 L;  3AQQ A;  3ND9 A;  4L6T B;  5I6Y A;  3CCS A;  3J81 j;  3IAY A;  1V8Q A;  1IYU A;  3ULP A;  2IL8 A;  4KI0 A;  5I2Y A;  3SEB A;  3S16 B;  4HSP A;  3F1Z A;  1PH8 A;  1WYD A;  2D2C C;  3NQI A;  3A8I E;  4NXM Q;  1XXG A;  3C46 A;  2IHE A;  3VDY A;  1GUS A;  3T1H L;  4A3M G;  1L0Y B;  1FNV A;  2XWB B;  2KEC A;  1J8I A;  5E7N A;  4DFA A;  5M9O A;  1CZW A;  5M5W H;  4DR1 L;  1LUZ A;  2B2T C;  2KHS A;  1SND A;  1JWU D;  2H1E A;  1K73 C;  4OO1 I;  4ZYS A;  2ZTD A;  4A3J H;  3NUC A;  1F2M A;  4V19 0;  1N32 Q;  1WJJ A;  2WV6 D;  4CDC C;  2Y0S B;  2Z4H A;  4QIW E;  2YU9 H;  4CKE A;  4DUZ L;  1HFG A;  2L0C A;  2F0M A;  1EIY B;  1N34 Q;  4A3F H;  1HNW L;  1B4O A;  1HZA A;  5EAY A;  5IYB G;  1PLF A;  1VS0 A;  2B2V A;  4LF4 Q;  3Q6S A;  4NW2 A;  1TWH B;  2R7D A;  4A3E G;  5IT9 E;  3JAM E;  3S1Q H;  1IZ6 A;  2Z0S A;  3I73 A;  3OIQ A;  3NPP A;  1UUP A;  3A56 A;  4YIJ A;  2XGT A;  3BDC A;  2F3I A;  1H95 A;  2EJF C;  4HJ7 A;  3S9W A;  3W1B A;  4C56 C;  5LMN Q;  2J4X A;  3QIA A;  1DOL A;  3AFQ A;  3RUZ A;  3CF5 A;  2KOL A;  1I6H H;  5L37 A;  1EIF A;  2NTT A;  2VB3 X;  1YJW A;  3NP8 A;  3DEO A;  3ULL A;  3Q0A A;  1JIC A;  3BDO A;  4DAM A;  4PV1 C;  3DWP A;  3GDE A;  1ENF A;  1YEZ A;  4GKJ L;  4GNX C;  1VDZ A;  2MQH A;  4CHT B;  1B70 B;  5C6A A;  1PDQ A;  1STN A;  5FJ8 H;  4DNR B;  1SMY C;  2OTJ A;  2E2H H;  3K5L A;  1XMO Q;  1VMC A;  3AB9 A;  2NB0 A;  1KLU D;  1SBB B;  2ENB A;  3KLS X;  4QQB X;  4DXG A;  1GUT A;  2HHH L;  1H9M A;  2CHB D;  1BO0 A;  3EVQ A;  2I5L X;  4YWK A;  4JI6 L;  2LKV A;  5FO7 B;  4CJ0 B;  4A93 B;  4IAL A;  2PPB C;  1G2T A;  3KDF B;  1EL0 A;  3HOU B;  1HCZ A;  1UE1 A;  4IUU A;  4BBS B;  5KGU A;  5GRO A;  2LSS A;  3OW7 A;  4LAA A;  3SK4 A;  3GTM B;  1Z6H A;  1HFN A;  3M3Y B;  4BBS H;  3M4Y A;  1A0I A;  3K80 C;  2BDN A;  1D2B A;  4R9W A;  3CC7 A;  2JEA I;  2EXD A;  2K32 A;  3L3O C;  1TWC H;  4CKC A;  3QB3 A;  1D5M C;  3NQT A;  1BBU A;  2VNU D;  5IP9 G;  3BG3 A;  1AE3 A;  4GKK Q;  1STE A;  3NTK A;  1N32 L;  1Q1B A;  4K6D A;  1QZG A;  4QGU A;  4X3T A;  5C4J B;  1ILP A;  2EJM A;  1RKN A;  3K5N A;  4A3M H;  1C48 A;  3DWQ A;  3E0J A;  1ZYR D;  3K0Y A;  4ILW A;  4L5R C;  2FXQ A;  4LW1 A;  4PG3 A;  2EYJ A;  1XNR L;  3HS0 C;  5LMN L;  4DV1 Q;  2CWA A;  4OGQ C;  2RCF A;  3CC4 A;  1KAB A;  2Z9H A;  1PH7 A;  1A62 A;  2ICE C;  3URY A;  4G7O C;  1XTD A;  1K8M A;  4LMQ D;  2NZH A;  1Z9F A;  5IYB H;  1A2U A;  5ELE A;  3HKS A;  3J81 L;  1PMR A;  2R7Z G;  2PMZ E;  2HCI A;  1UEB A;  4A3E H;  2NVT H;  2E74 C;  3L7Z C;  2D0O A;  5EKL A;  2WII B;  4FF3 A;  1SMX A;  4YCU A;  5BN3 A;  3OTO L;  3IRB A;  3AYH B;  3BZD B;  1PZK D;  3MWY W;  3K57 A;  1LM0 A;  1ICW A;  2KCC A;  3OIP A;  2CVR A;  4RKL A;  1IYV A;  3PIP 3;  1CFM A;  5T1I A;  4J1M A;  2NN6 G;  4JV5 L;  3NSW A;  2NBF A;  5CV4 A;  1IW7 C;  2F0N A;  4GLV B;  1J6Q A;  4RKB A;  3GTP B;  1VQE A;  1ASZ A;  5GAD C;  1O7Y A;  1XMQ L;  2XRS D;  3DLL A;  2HT1 A;  4Y52 H;  1H9R A;  4Y7N B;  5C4X G;  3J7Y W;  2EYO A;  5LL6 S;  1YIT A;  1TVX A;  4YCW A;  4XTC S;  2JSO A;  1GVP A;  4JYA Q;  2L55 A;  4HMJ A;  4LWC A;  2RDG A;  1JOR A;  2YV5 A;  2NVX B;  2V1C C;  3H0G G;  3ONA B;  5G3L F;  3SK8 A;  4NMZ A;  1MGS A;  4HJ8 A;  1B7Y B;  1UNS A;  4QUC A;  2NVX H;  4LUO A;  1LAB A;  4OX9 L;  3RZD B;  3DM1 A;  4IQZ A;  2RA4 A;  4MZ9 A;  2X6G A;  1S40 A;  2DNC A;  1HTP A;  1F9P A;  4IO9 A;  2AWN A;  3CPF A;  4A76 A;  1WI5 A;  3K7A H;  5ELF A;  1L1O A;  1N36 L;  4GOP B;  3PF5 A;  4XYO A;  1SEB D;  3TBI B;  5IP7 G;  2VW9 A;  3TRE A;  5EPL A;  2L15 A;  4C3J G;  3KFU A;  4NXN Q;  1HNX Q;  3N52 A;  2A73 B;  4L63 B;  1VQF A;  1CHQ D;  5JJL A;  5IP9 H;  4A3I B;  2VQE Q;  5JEA G;  4DV1 L;  4F88 A;  2NWG A;  2RF4 A;  2QGQ A;  5JJZ A;  2D62 A;  3CQZ H;  3BU2 A;  3ERQ A;  2YTY A;  4BXX G;  2FMM A;  3MXN A;  4POF A;  4WOR A;  3H91 A;  4JI0 Q;  3PO3 G;  4KJO A;  4OIK A;  2PQA A;  4HIM A;  3CRK C;  3GO5 A;  5FLX L;  4O1N A;  4G7Z C;  2HCC A;  2EIF A;  2RHS B;  4WFN 3;  1Q1E A;  4K8I A;  4QUF A;  2HDM A;  4OHJ A;  1Y1W B;  2Q2I A;  2B2U C;  1XPU A;  1VQH A;  1C0A A;  1TWF B;  2F0G A;  1FGB D;  3M85 A;  3OMC A;  5K5P A;  3HOX B;  2UUB L;  1HZB A;  3H6M A;  2E2I B;  4X6A H;  4QIW B;  1MD2 D;  4R8I A;  1CKO A;  1TS3 A;  2E2I H;  3CPW A;  2WAQ E;  4FXD A;  3K6O A;  2D9U A;  3Q24 A;  4DV5 Q;  1WFQ A;  5F2D A;  4JI4 Q;  2R7Z H;  1TWG H;  4LF7 L;  2VXW A;  3C3L A;  2CQO A;  3CHB D;  1QCB D;  2MP1 A;  3GV3 A;  3A5Z B;  4C1N I;  3E6Z X;  1V9P A;  1IBM Q;  4B3S L;  2CWP A;  1ROD A;  4ZCK A;  5KYL A;  3W2D A;  4RAU C;  2ID0 A;  1PTO B;  4P2C B;  5C4H A;  3DUZ A;  1IKL A;  1CHP D;  1MBY A;  5KIX A;  2OEO A;  5JEA J;  1E7Z A;  2A68 C;  1K0R A;  3D4D A;  1WVL A;  2PO4 A;  5DEH A;  2FIN B;  3PIO 3;  4UY8 C;  2SNM A;  1GUN A;  4DPG A;  3AFP A;  1XX8 A;  1Q86 C;  3O13 A;  3MAQ A;  1FYC A;  3ER0 A;  1BCP D;  4ZKB B;  2WP8 J;  4P74 A;  4A3B B;  5EKK A;  2LXK A;  3KBG A;  2M9V A;  5C4X H;  3CMA A;  3FKI G;  3RN2 A;  1JOK A;  3DMU A;  3S2H B;  1KRT A;  2G5D A;  3KK7 A;  3PUV A;  4H7B A;  3SHL A;  3FHW A;  1VQ8 A;  4JI5 L;  2CQA A;  5J1Z A;  5JAV A;  4X65 Q;  4OIJ A;  1JR0 D;  2N78 A;  5CV8 A;  1WTO A;  1VQI A;  2E8G A;  3H0G H;  1D7Q A;  2OF1 A;  1HNX L;  3DEP A;  4JI7 Q;  1IBL Q;  4TKO B;  4K0K L;  3DM3 A;  4GZY C;  5BN4 A;  4LF6 Q;  2K14 A;  4MHE A;  4GLA C;  1W6K A;  2LXJ A;  4KKU A;  5DLQ E;  1R4P B;  1KHI A;  1RD9 D;  4KKT A;  5FK9 C;  3UI2 A;  3I56 A;  3S14 B;  4JOI A;  2KEE A;  1LT4 D;  2A74 C;  5IE8 A;  4PZ8 A;  1PFS A;  3K0X A;  4LF9 L;  1K83 B;  4BY1 B;  3I4M H;  4N8F A;  5IP7 H;  5M5Y H;  3OHX C;  2NTS A;  1X3E A;  1S5E D;  4C3J H;  4K6L A;  1R9T B;  4KMU C;  2AKW B;  3GP7 A;  4M1U B;  1KL9 A;  4A3K G;  3S15 H;  1ZEQ X;  3CCM A;  2F3W A;  1X9N A;  2UU9 L;  2PQE A;  1HUN A;  2IX0 A;  3TZD A;  3KJP A;  3PO3 B;  4J15 A;  2F0F A;  1TT2 A;  5TSS A;  5IGC A;  4BXX H;  1SMY D;  3PO3 H;  5KNB A;  2F0L A;  5HGT A;  1X32 A;  4AYB E;  3NWT A;  4N9P A;  4V0B A;  2R61 A;  5M3F G;  2NVQ B;  1A3U A;  4IUQ A;  1PTO C;  1JC7 A;  1A8V A;  1B3A A;  1L0W A;  4DR7 L;  2K6A A;  1W3S A;  5LMU L;  5FKA C;  4YHH L;  2FMC A;  1SAP A;  1SE8 A;  3M4O B;  4HR7 B;  5CBE E;  4I7A A;  2QEX A;  4FYD A;  1WD1 A;  3TME A;  3FPP A;  5KEE A;  4X66 L;  4HIO A;  4MTN A;  1CK1 A;  5LL6 X;  3I2Z A;  1I94 Q;  4XQQ A;  1HQM C;  1NSN S;  5ELO A;  1Y8N B;  2Q2H A;  5A2Q L;  2PCF B;  2DY8 A;  3J81 i;  4LFA Q;  3WOF A;  1V1O A;  2F4I A;  4RGO S;  4EVO A;  2B2V C;  1EIH A;  3TP6 A;  3PO2 B;  4G4K A;  2Z8L A;  2JA5 B;  1ENC A;  2VUM B;  3EJI A;  1LTT D;  2Y0S G;  4RHS A;  3W3A A;  1KRS A;  3TS2 A;  4R4C A;  3J80 L;  3F8T A;  3N6R A;  3T1H Q;  3I4L A;  1B9M A;  3FKI B;  3A7A B;  1SYG A;  1PH2 A;  4I7Z C;  1YIJ A;  1S5C D;  3GV6 A;  4DR1 Q;  2YYZ A;  3C1E A;  2FJ2 A;  5IIF A;  4YCV A;  1JJ2 A;  2MFI A;  1L0X B;  1UE6 A;  1VF5 C;  2DJG C;  1PRT F;  2A69 C;  2RHQ B;  1YHQ A;  1VQ5 A;  4DUZ Q;  1F2Y A;  2A6H D;  1I50 B;  2BCO A;  3HEJ A;  1GD7 A;  2AWO A;  4Q0F A;  5CGK A;  1HNW Q;  3SR1 A;  1Y1V H;  1PH1 A;  4DA2 A;  4KHP Q;  1QVC A;  3NTH A;  1AH9 A;  2WIN B;  2K03 A;  3D6C A;  4EQ5 A;  3A7L A;  5IGF A;  1CQF A;  3LGJ A;  4JK1 C;  4RA8 A;  3S24 A;  1AP0 A;  4RGT A;  2SOB A;  4B9W A;  2PI2 A;  5JVG 3;  3CU7 A;  3W1G A;  1IW7 D;  1D6E C;  1X3G A;  1JE5 A;  1X3F A;  1U4P A;  2NN6 I;  1W6J A;  4A3K H;  3UE1 A;  5M5X H;  1VQK A;  3J7A 5;  1SR3 A;  2MO1 A;  1PZJ D;  3I90 A;  2A6E C;  1OXU A;  1ILQ A;  2VQF L;  4JI2 L;  3S1M B;  2KEN A;  2QW7 A;  4GKJ Q;  5M3F B;  4DR3 Q;  2J0T D;  1SNP A;  4A93 G;  1JCK B;  1GUW A;  3QOL A;  1G6P A;  4WJ3 M;  3HOU G;  2WB1 B;  5I9O A;  2KED A;  2IX1 A;  3I55 A;  2HHH Q;  2DY7 A;  2KHJ A;  4L5Q A;  2RDF A;  1G6Z A;  1AW7 A;  3GTK B;  1D1I A;  1QVF A;  1ZXT A;  1XYI A;  2R92 G;  2VS1 A;  1ML0 D;  1B50 A;  3QJY A;  2R7F A;  4WRD A;  3G6J B;  2K52 A;  5M3M G;  5CV6 A;  1YNN C;  1L1O B;  2XNA C;  1QOH A;  3GTQ B;  4Z9C B;  5K36 H;  1N33 L;  4H44 C;  1IYJ B;  3S16 H;  5IT9 L;  2PI2 E;  3JAM L;  4DV7 L;  4YY3 L;  2B63 G;  1TY0 A;  3E0E A;  3K8A A;  3ITP A;  4ULL A;  1JB7 A;  4LNQ A;  1CKM A; 
#chains in the Genus database with same CATH homology
 2JA6 G;  4UP7 A;  3UDI A;  3PV0 A;  1XNR L;  1LYL A;  4FDB A;  4OWX B;  3EIV A;  4B3T L;  5LMN L;  4DV1 Q;  4H02 A;  3NEN A;  2CWA A;  4ME3 A;  4JI8 L;  1SRO A;  3CAM A;  1Q81 C;  4BBR G;  5C0X G;  1YHB A;  4X64 L;  3CC4 A;  4OWW B;  1PH7 A;  1IBK L;  1A62 A;  4B3M Q;  4BA2 I;  2BA0 A;  2DUD A;  1XTD A;  3MXN B;  4A4I A;  1PH3 A;  4O0A A;  1XNQ Q;  4IPD A;  2NZH A;  1Z9F A;  1KC8 C;  5IYB H;  3PO2 H;  3M4P A;  3HFZ B;  2OWO A;  2PQA B;  3HKS A;  4KLK A;  2ASB A;  1VQ6 A;  3U50 C;  4A3C H;  4PZ7 A;  2R7Z G;  2GVA A;  2PMZ E;  1QZH A;  2JA5 H;  2VUM H;  4KHP L;  4JCV E;  1UEB A;  4A3E H;  2R6G A;  3WWV A;  3ZJY C;  1HR0 W;  1N33 Q;  2NVT H;  3KF6 A;  1TXY A;  3L7Z C;  4DV7 Q;  2D0O A;  3H3V I;  2ATW A;  4YY3 Q;  2MNA A;  3PGZ A;  1SMX A;  4GS3 A;  4YCU A;  3OTO L;  1TWH H;  1U5K A;  3IRB A;  3HOZ H;  3AYH B;  3NBH B;  1J5E L;  3PIP A;  1M1K C;  1LM0 A;  3FKI H;  1XNR Q;  1EQQ A;  4B3T Q;  1O7I A;  3CME A;  2Y0S E;  4YWL A;  2OCE A;  1NTG A;  3D0F A;  4IFD G;  4JYA L;  3KJO A;  4TVA B;  3MEF A;  3PCO B;  1XPR A;  1AE2 A;  4MNO A;  3D31 A;  4X64 Q;  2NN6 G;  1I5F A;  1NMF A;  1IBK Q;  4JV5 L;  3HOW G;  4DV4 Q;  4A3L H;  1YI2 A;  4GOP C;  3CCL A;  1PH6 A;  1E22 A;  4GLV B;  1J6Q A;  2A8V A;  1VQE A;  1I50 H;  1SLJ A;  3TS0 A;  1ASZ A;  5GAD C;  4QL5 A;  1PV4 A;  1XMQ L;  3DLL A;  2N3S A;  2HT1 A;  4Y52 H;  4IJL A;  3EN2 A;  3UDG A;  3M7N A;  5C4X G;  4DR3 L;  2VZA A;  2JK8 A;  5IY0 A;  3OTO Q;  1MKH A;  4GOP A;  2BH8 A;  1J5E Q;  3PUZ A;  3J80 c;  1EQR A;  1P16 A;  1YIT A;  2C35 B;  3TQY A;  4YCW A;  1KQS A;  3GD7 A;  4XTC S;  2ZM6 L;  1GVP A;  2I5H A;  1VQJ A;  4R4O A;  1S72 A;  4JYA Q;  4LWC A;  2UUC Q;  4HID A;  2YV5 A;  2HIX A;  1QUQ A;  1HZ9 A;  4IPG A;  4NXN L;  2V1C C;  3RLN A;  3H0G G;  3T1Y L;  1N9W A;  1Y1V G;  2K5N A;  5C0X J;  1YJN A;  4JV5 Q;  1X65 A;  4LUZ A;  4HJ8 A;  1B7Y B;  3PUW A;  4DR2 Q;  2VQE L;  4R4T A;  4LF5 L;  1YZ6 A;  4HJ5 A;  1L1O C;  4LUO A;  2NVX H;  3SGI A;  3CCJ A;  2JEB I;  4OX9 L;  5GAG C;  3GTG H;  1JJC B;  1L2F A;  4IPH A;  2N49 A;  4MZ9 A;  1XMQ Q;  4JI0 L;  1S40 A;  1FVI A;  3I4O A;  1K8G A;  1UWV A;  3OYY A;  4IO9 A;  2AWN A;  4A93 H;  3CPF A;  4A76 A;  1WI5 A;  4DV0 L;  3I4N H;  3K7A H;  3U4V A;  1L1O A;  4KHZ A;  1N36 L;  4GOP B;  3PF5 A;  1KIX A;  1U0L A;  1PH4 A;  3S1M H;  5M3F H;  3HOU H;  3L2P A;  1QVG A;  2ZM6 Q;  4AYB G;  5IP7 G;  2VW9 A;  3TRE A;  4HJA A;  3GTM H;  2L15 A;  3KFU A;  3HKZ E;  1BBW A;  2OQ0 A;  4UPA A;  3T1Y Q;  1K3R A;  1XPO A;  2E5L Q;  4NXN Q;  3M3Y H;  1HNX Q;  4IFD J;  1K9M C;  1G29 1;  4L5T A;  4POG A;  1VQF A;  4BY7 H;  4OWT B;  5BR8 L;  5JJL A;  5IP9 H;  4R4Q A;  3CD6 A;  2VQE Q;  1OTC A;  2R93 G;  5JEA G;  5IYD H;  4DV1 L;  4PZ6 A;  2R92 H;  2RF4 A;  2QGQ A;  4B3R L;  1EUJ A;  2D62 A;  4YWM A;  4OX9 Q;  3CQZ H;  3BU2 A;  1GKH A;  2YTY A;  4POF A;  4A75 A;  4JI0 Q;  1WCM G;  4B3M L;  3GTK H;  4A3I G;  3PO3 G;  1UE5 A;  3F2B A;  1VQN A;  2PQA A;  4HIM A;  4DV5 L;  5M3M H;  4DV0 Q;  3NEL A;  2XTI A;  3GO5 A;  2Q2T A;  2Q2U A;  4JI4 L;  2ALY B;  2HQL A;  3TEH B;  4DR5 Q;  1N36 Q;  1HNZ Q;  1PH9 A;  3TRZ A;  2EIF A;  5C4J H;  1PH5 A;  2RHS B;  2YTX A;  1Q1E A;  1Y14 B;  4GN4 B;  1IL2 A;  4NB3 A;  2A1A A;  1X6O A;  4UP9 A;  3ULJ A;  1VQ9 A;  4JI3 L;  1T9H A;  1NY4 A;  1RIP A;  1IBM L;  4L5S A;  3GTQ H;  3HOV H;  1JT8 A;  2JA6 H;  2Q2I A;  4DK3 C;  1XPU A;  1VQH A;  1C0A A;  5BR8 Q;  1G51 A;  4DR4 Q;  5K36 G;  3M85 A;  2ES2 A;  2KHI A;  2UUB L;  1HZB A;  4BBR H;  4X6A H;  3CCU A;  4B3R Q;  3U58 A;  4JI1 Q;  3CCV A;  1Y1W G;  2NVY H;  1CKO A;  2E2I H;  4O2D A;  3HOX G;  2WAQ E;  3CPW A;  1EOV A;  2JJQ A;  2NZO A;  3HOY G;  4DV4 L;  1VQ7 A;  3F2C A;  4DV5 Q;  1WFQ A;  5C3E H;  2ZJQ A;  3CP0 A;  2JA7 G;  4JI4 Q;  4JBK A;  2CCZ A;  2R7Z H;  1TWG H;  4LF7 L;  2GVB A;  5FLM G;  2CQO A;  2UXC Q;  4JBJ A;  4IPC A;  1VCI A;  2OQK A;  3A5Z B;  1MIU A;  4BA1 I;  1HJP A;  2F52 A;  3J80 i;  1V9P A;  1IBM Q;  2H5X A;  4JI3 Q;  4B3S L;  2CWP A;  2K4K A;  4DV3 Q;  4GN3 B;  4A3J G;  3GTO H;  2UXD L;  4EX5 A;  5IT9 c;  2ID0 A;  3JAM c;  1Q7Y C;  3BZK A;  4X65 L;  1YJ9 A;  2UUB Q;  1PYB A;  1BVS A;  3H15 A;  5JEA J;  2UUC L;  1VQ4 A;  1E7Z A;  3M9B A;  1K0R A;  4A3F G;  5LMN W;  3STB D;  3HOW H;  3NEM A;  4JI7 L;  1IBL L;  4UY8 C;  4A3C G;  1KD1 C;  1PYS B;  4DPG A;  3AFP A;  4DR2 L;  3M4Q A;  3UE0 A;  1Q86 C;  5GQO A;  3UDF A;  4LF6 L;  3I7F A;  4LF7 Q;  3ER0 A;  1HZC A;  2WP8 J;  4P74 A;  3JC6 6;  2LXK A;  1WOC A;  4OXP A;  4DV2 L;  2BA1 A;  5C4X H;  3GTP H;  3CMA A;  3G4S A;  1NE3 A;  3FKI G;  2K75 A;  4DK6 C;  4R1J A;  4AH6 A;  3J81 c;  3RN2 A;  1VQM A;  4B3S Q;  3ERS X;  1KRT A;  4A3B G;  3CCR A;  2UXD Q;  2IY5 B;  3PUV A;  4Y7N H;  1XJV A;  3FHW A;  1VQ8 A;  4JI5 L;  1TWA H;  4X65 Q;  3S1R H;  4R4I A;  5GAE C;  1JJG A;  1VQD A;  1B8A A;  2N78 A;  2AHO B;  1EWI A;  1BKB A;  1VQC A;  1VQI A;  2E8G A;  2K50 A;  3H0G H;  3U4Z A;  2E5L L;  1D7Q A;  1HNX L;  1MJE A;  4PMW A;  4JOI C;  4JI7 Q;  1IBL Q;  1VQP A;  2WFW A;  5ELN A;  1Q82 C;  1NBW A;  3DM3 A;  4K0K L;  4LF8 Q;  4WJ4 A;  5J3B A;  2B3G A;  3E9H A;  1EYG A;  2K14 A;  3RNU A;  4LF6 Q;  4GLA C;  1OXS C;  3FP9 A;  2LXJ A;  3UDX A;  5IWA L;  4C3I H;  1NJI C;  5DLQ E;  4DV2 Q;  3I56 A;  1CSQ A;  1KHI A;  5FJ8 G;  5C44 H;  4JOI A;  3RZD H;  5IE8 A;  1X56 A;  4GN5 A;  4JBW A;  4PZ8 A;  5JJK A;  1PFS A;  2HIV A;  1CKN A;  3K0X A;  4DR5 L;  1HNZ L;  4LF9 L;  1VQA A;  2VY3 A;  1NMG A;  4GNX A;  3I4M H;  4JI5 Q;  1HH2 P;  1SFO H;  5IP7 H;  3K81 C;  5M5Y H;  4IOC A;  1X3E A;  1EFW A;  4C3J H;  1YVC A;  2AKW B;  1MJC A;  1KL9 A;  1VQG A;  2KCT A;  4A3K G;  4BY1 G;  3S15 H;  3CCM A;  3RLO A;  2UU9 L;  1X9N A;  3CW2 C;  4UP8 A;  2IX0 A;  2QA4 A;  2I0Q A;  2IHF A;  2R93 H;  3KJP A;  3GTJ H;  4K0K Q;  2B29 A;  4J15 A;  1E1T A;  4DR4 L;  1VQO A;  1IXR A;  3RLF A;  1PHJ A;  2ZTC A;  4PG3 A;  4JI1 L;  4BXX H;  3S2D H;  1WCM H;  3F2D A;  1VQB A;  2DGY A;  5IWA Q;  1SRU A;  2ZJP A;  4A3I H;  2JA8 G;  3PO3 H;  2PNH A;  1OXV A;  4AYB E;  4DAY B;  1K8A C;  3PUX A;  4NXM L;  5HGQ A;  5IYC G;  1N8R C;  1I94 L;  3A5U A;  5M3F G;  4LFB L;  4ALP A;  3EBE A;  3G48 A;  4BBS G;  4LFC Q;  4IJH A;  1Q46 A;  3CXC A;  3H3V H;  4LF9 Q;  4A3D H;  2UXC L;  3K7U C;  1A8V A;  5JJI A;  1CKN B;  4AQY Q;  1OXX K;  4GNX B;  1L0W A;  1C9O A;  2B63 H;  4DR7 L;  4RG1 A;  5LMU L;  1W3S A;  1S3O A;  4YHH L;  4LFA L;  1KAW A;  2Z6K C;  3J7Z C;  4OON A;  4JI6 Q;  3B6Y A;  3KLW A;  2UU9 Q;  4DV3 L;  3JAM i;  2K5V A;  1E3P A;  1SE8 A;  2RCN A;  3AQQ A;  1FJG L;  3CCS A;  3J81 j;  2QEX A;  1N34 L;  3ULP A;  1Y1W H;  2A19 A;  2K5H A;  4KI0 A;  1HR0 L;  1TWF H;  3F1Z A;  1PH8 A;  1E24 A;  3BJU A;  1WYD A;  4MTN A;  2Z6K A;  4X66 L;  3HOX H;  4HIO A;  3HOY H;  4NXM Q;  2CFM A;  3I2Z A;  4LF4 L;  2IHE A;  3VDY A;  4A3G G;  2JA7 H;  1I94 Q;  3E9I A;  4TQU S;  3T1H L;  4A3M G;  4LFB Q;  3STB C;  4LUV A;  1FGU A;  5FLM H;  5E7N A;  4DV6 L;  5ELO A;  5M5W H;  5H1S E;  4DR1 L;  1LUZ A;  2Q2H A;  4DR7 Q;  2CKZ B;  5LMU Q;  3OW2 A;  3J81 i;  1K73 C;  2N8N A;  4OO1 I;  4LFA Q;  4YHH Q;  3HOZ G;  5FLX c;  1VQL A;  2ZTD A;  4A3J H;  2KBN A;  3PUY A;  4C2M H;  1PVO A;  1N32 Q;  1WJJ A;  1FJG Q;  4QIW E;  3G71 A;  2YU9 H;  4DUZ L;  3PIO A;  3A74 A;  1YHA A;  1I3Q H;  2F4V L;  1EIY B;  1N34 Q;  3W5O A;  1CSP A;  4A3F H;  1HR0 Q;  1OXT A;  4X62 Q;  1HNW L;  5EAY A;  1HZA A;  3PO2 G;  4X66 Q;  2VL6 A;  2Y0S G;  3PSI A;  5IYB G;  5C3E G;  2OTL A;  1KRS A;  3TS2 A;  1VS0 A;  4QY7 A;  4LF4 Q;  4R4C A;  1YBY A;  3F8T A;  2JA5 G;  5HY6 A;  3T1H Q;  2VUM G;  2R7D A;  4A3E G;  4C3H H;  3S1Q H;  1IZ6 A;  2Z0S A;  4LF8 L;  2UXB L;  1RL2 A;  4GLX A;  3BZC A;  4DV6 Q;  2XGT A;  1PH2 A;  1YIJ A;  2F3I A;  4DUY L;  4DR1 Q;  2YYZ A;  1H95 A;  1SN8 A;  4HJ7 A;  3W1B A;  1A63 A;  4YCV A;  5LMN Q;  1JJ2 A;  2MFI A;  4A3B H;  4AIM A;  1UE6 A;  4JI8 Q;  1Q12 A;  3CCE A;  1E1O A;  1XMO L;  3AFQ A;  2BH2 A;  2RHQ B;  1YHQ A;  2UUA L;  1VQ5 A;  4IOA A;  4DUZ Q;  1W2B A;  3KYH C;  2F4V Q;  5C0X I;  3CF5 A;  1KXL A;  1I6H H;  3S2H H;  3CC2 A;  1GD7 A;  3A0J A;  2AWO A;  4NPS A;  1EIF A;  3KF8 B;  1V43 A;  4A3L G;  1YJW A;  1HNW Q;  1Y1V H;  1PH1 A;  3ULL A;  4KHP Q;  4XIG S;  2KCM A;  4QJF A;  1QVC A;  4DAM A;  1AH9 A;  1P8L A;  3KDF A;  2UXB Q;  3GDE A;  4JG2 A;  3KF6 B;  1YEZ A;  4EQ5 A;  4GKJ L;  4HJ9 A;  1LTL A;  2MQH A;  4GNX C;  1GO3 E;  1B70 B;  4DUY Q;  5FJ8 H;  3LGJ A;  3RZO H;  2E2H H;  2OTJ A;  3S24 A;  2IT1 A;  3Q8D A;  4P71 A;  3AEV A;  4LFC L;  1XMO Q;  2PI2 A;  3S14 H;  2MO0 A;  4IFD I;  3W1G A;  1D8L A;  2UUA Q;  4AQY L;  1X3G A;  4QQB X;  1JE5 A;  1X3F A;  2HHH L;  4HIK A;  2NN6 I;  4A3K H;  3UE1 A;  5M5X H;  4RMF A;  1K83 H;  2I5L X;  1VQK A;  4BY1 H;  3S17 H;  5GAH C;  3J7A 5;  1SR3 A;  4YWK A;  4JI6 L;  2YTV A;  4GKK L;  1X55 A;  2MO1 A;  1R9T H;  1X54 A;  1UE7 A;  3HKZ G;  3ICE A;  1OXU A;  2VQF L;  2AMC B;  3KDF B;  4JI2 L;  3PF4 A;  2KEN A;  4GKJ Q;  5C44 G;  1UE1 A;  4DR3 Q;  4APV A;  1PA6 A;  4JBM A;  2GN5 A;  2JA8 H;  4DR6 L;  5GRO A;  2LSS A;  4A93 G;  1YNX A;  3I4N G;  5IYC H;  2ZJR A;  1G6P A;  4BBS H;  3GTL H;  3I4M G;  1A0I A;  4WJ3 M;  1CUK A;  3HOU G;  3K80 C;  2ZTE A;  2JQO A;  5AJ3 L;  3CC7 A;  2JEA I;  1DGS A;  4BXX G;  2EXD A;  2IX1 A;  1TWC H;  2NVQ H;  3I55 A;  1QUQ B;  4OO1 G;  2HHH Q;  2KHJ A;  4L5Q A;  3CCQ A;  2WB1 G;  4BY7 G;  4LF5 Q;  1Q8K A;  1BBU A;  1QVF A;  5IP9 G;  2D0P A;  2VNU D;  5IYD G;  4DNI A;  1AE3 A;  3RN5 A;  4P73 A;  4GKK Q;  2R92 G;  1N32 L;  2VS1 A;  1Q1B A;  3RR5 A;  3G6E A;  2I5M X;  1JMC A;  1QZG A;  1ASY A;  4QGU A;  2VQF Q;  3S1N H;  4JI2 Q;  1XNQ L;  4P72 A;  2R7F A;  4DR6 Q;  2JE6 I;  3M4O H;  1V1Q A;  2K52 A;  4X62 L;  1C7Y A;  4JC0 A;  4P75 A;  5M3M G;  4A3G H;  1Z47 A;  2EQS A;  1L1O B;  2WB1 E;  4A3M H;  4A3D G;  2E2J H;  1N33 L;  1IYJ B;  3S16 H;  3KOJ A;  2PI2 E;  4DV7 L;  4YY3 L;  2WAQ G;  1M90 C;  5AJ3 Q;  2B63 G;  3E0E A;  3L0O A;  3K8A A;  4L5R C;  1GM5 A;  1JB7 A;  4LNQ A;  1FL0 A;  2FXQ A;  4LW1 A;  2JA9 A;  1CKM A;  4DKA C;  3HOV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...