5EKIA

Crystal structure of truncated ccl21
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
QDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-C motif chemokine 21
publication title Crystallographic Structure of Truncated CCL21 and the Putative Sulfotyrosine-Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekiA00
1ICWA 1NCVA 5D65A 5EPKA 4MN3A 1U4PA 2RVLA 3KBXA 2MGSA 3R93A 1O7ZA 2DY8A 1XYIA 1F9RA 1QG7A 2HCCA 4X3KA 4OIJA 1B4OA 1MSHA 1G2TA 1IL8A 1RODA 2EPBA 3QO2A 1B50A 4IUTA 5CBAE 2MJ8A 4IUVA 1GUWA 4QUFA 2Q8TA 1PFNA 2B2WA 4RAUC 1DOMA 3IL8A 5T1IA 1SDFA 4R9WA 2K05A 4QUCA 1EIGA 2B2YC 2MP1A 1RTOA 4RWSC 1F9SA 2NZ1D 1G2SA 2B2TC 4XDXA 1MGSA 1RHPA 2X6LA 2KEEA 1VMCA 3KUPA 4RA8A 1BF4A 2M2LA 1CM9A 3LWEA 2L12A 1IKMA 1A15A 2HDMA 2L1BA 1U4LA 2HDLA 1JICA 4IURA 1RTNA 1DZ1A 1PDQA 5CMDA 1XX8A 1WTQA 5JJZA 4MHEA 1SSOA 2KECA 1VMPA 3TN2A 1G91A 1RJTA 2K03A 2RSOA 2JYOA 5COYA 2IL8A 1AP0A 4ZAIA 1HFGA 3P7JA 4HAEA 2VXWA 1BO0A 3FDTA 4X3TA 4IUUA 2L4NA 2KEDA 1B3AA 2K01A 2NYZD 1X3PA 2KVMA 3FPUB 5EKIA 2B2UC 1JE4A 3TZDA 4ZKBB 1F2LA 2HUGA 1EIHA 1SAPA 4R8IA 1HA6A 1ZXTA 2FINB 3I91A 1NR4A 5EPLA 2JP1A 3I3CA 5EQ0A 4CJ0B 3SVMA 2HCIA 1AZQA 1ESRA 2B2WC 1B53A 1E0BA 5CORA 2EE1A 2KUMA 4X3UA 1ML0D 2L11A 3DEPA 1WVLA 1IKLA 1KNEA 1X3QA 1PFMA 3F2UA 1PLFA 1DOLA 2NWGA 1WTPA 1EL0A 1NAPA 2MPMA 2K04A 1MSGA 1HRJA 1Q3LA 2B2VA 3I8ZA 4U68A 1WTRA 1HUMA 4X3SA 1PFBA 1AZPA 2EOTA 2RSNA 3I90A 3UI2A 4CJ2C 1G6ZA 4O42A 4IUPA 1DONA 1WTWA 2H1EA 1ILQA 1NR2A 3IFDA 2N88A 4HEDA 1M8AA 1BBXC 2J7ZA 4ZLTF 1U4RA 2FHTA 2FJ2A 2KOLA 1WD0A 1HUNA 2SDFA 2Q8RE 3D6WA 2D9UA 5EPJA 1X32A 4DN4M 5CBEE 1CA5A 1HFNA 1CA6A 2K1BA 2R3ZA 4HSVA 1WTOA 3Q6SA 4HCSA 2N55A 1EOTA 4XT1B 2B2YA 1WTVA 3ONAB 2B2UA 1QNKA 1F9PA 2X69A 1QE6A 2XIWA 3GV6A 3HP3A 4XT3B 4ZK9B 3H91A 5E4XA 2B2TA 4ZKCB 5D14A 3DM1A 3N52A 1HHVA 1F9QA 1KNAA 1BNZA 1S4ZA 2DY7A 2RA4A 4UAIA 1LV9A 5AFWA 3MWYW 4CJ1B 2K28A 1B2TA 1TVXA 3GV3A 1J9OA 5DNFA 5T1GA 4LMQD 2L9HA 4IUQA 5E4WC 4OIKA 1O7YA 1C8CA 4NW2A 2X6GA 1EQTA 1ILPA 1MI2A 2FFKB 2CVRA 3G7LA 5EJWA 1O80A 1DOKA 2B2VC 1U4MA 2BDNA 3MTSA 1WD1A 1J8IA 3DEOA 1WTXA 2FMMA
chains in the Genus database with same CATH superfamily
3EBEA 4KTAA 4A93H 3KBXA 4JI7Q 4HN7A 1FL0A 3CMAA 2SEBD 4Q0FA 5CR3A 1BKBA 4QUFA 2EXDA 4KKSA 3SK6A 2ZJQA 5EAYA 5IYCH 4O0AA 2MHVA 1FNWA 2NZ1D 1O7IA 4C2MH 1EWIA 5M5YH 3F2CA 3QIAA 1CM9A 2QKIC 3H3VH 1TWHH 2M9VA 3VYSA 1W6JA 1VQAA 3KLSA 5IGGA 1QB5D 5BN3A 3EIVA 3QJYA 3HOVG 4AQYQ 4K2KA 1LUZA 3P7JA 3H94A 3KF8B 3T1HQ 3HOYH 3NENA 3WDNA 4A3LH 1JE4A 3SEBA 4K5VA 3CKIB 4J15A 4B3SQ 1NR4A 2IW3A 1U0LA 3GTGB 4KK7A 2WINB 3J7AV 4H7BA 2LKVA 2UXBL 3I2ZA 5K5PA 3HS0C 2EJFC 3OIQA 3SGIA 3CCQA 1EY0A 1WTHA 1HZCA 3J80i 5JVG3 2EOTA 4IPCA 3MFYA 4YHHL 3ULPA 4BY7H 2E5LL 2F0QA 1NR2A 2Q8IB 1U4RA 2QEXA 4DV6L 1TWFB 2R7ZG 3K5MA 1AE3A 1EFID 1CA5A 4DNRB 1HTPA 4ME5A 1SYCA 3UDGA 2JA8H 1EEID 2LXJA 4G7ZC 4BY1B 1STHA 4PNYA 5EBCA 1GUNA 4O2DA 4CGYB 2WKCA 4G7HC 4IFDG 3GTKB 2BE5C 3UDXA 3EROA 4OIKA 2XWBB 1NY4A 1K0SA 4EQPA 1U9RA 1KAWA 2SNMA 5C4ZA 2B2VC 1HJPA 3MTSA 3BDOA 5I4DA 4FF1A 5LMNL 2F4VL 3M3YH 4A3FH 2RF4A 1U4PA 4A3IB 1O7ZA 1UE1A 5BN4A 1Z47A 1RIPA 3K59A 4KI0A 1GD7A 3K80C 1HZBA 4LJZC 1PRTD 3KLWA 3C1EA 4YY3Q 4J1MA 5KNBA 3D31A 1B1ZA 4JVZA 5LL6X 1S5BD 3M85A 1N33Q 2M2LA 2F0DA 4HJ8A 2NBFA 3P1HA 2EVBA 1C4QA 4ZUIA 3ICEA 3F1ZA 2HDMA 4DFAA 2DNEA 5FOBB 3F2DA 2L15A 4K8JA 3CU7A 1PTOH 4B9XA 2WP8J 3WOEA 2E75C 3CAMA 3HGBA 4GS3A 1K0RA 3M7NA 5KYLA 1AP0A 1SROA 4K8IA 4JI2L 1B70B 4KMUC 1EWCA 2WAQG 3FDTA 3GQBA 3OMGA 4JI0Q 1OXXK 4YCWA 5I6YA 2KVMA 5FLMH 2B2UC 5IWAL 3D8GA 1S5ED 4LF7Q 3S1RB 1TQOA 1VCIA 1ZXTA 2QA4A 2HCIA 3JC66 5C0XJ 2HQEA 1OTCA 2NTSA 3KBGA 1YEZA 2LFNA 1LACA 3I4MG 2Y0SG 1MSGA 2Q2UA 1EOVA 3I8ZA 4E6IA 1WTRA 4NXNL 2JA5H 5IODA 1BCPC 4K6DA 5EBDA 5KEEA 4A3GH 4UP7A 2H1EA 2HIXA 4V190 3S14B 2I07B 5C0XI 2K33A 4JI5Q 4C2MB 5M5YB 4P72A 4RCOA 5D3DA 3HRZC 2RHQB 3Q6SA 1CZWA 4XT1B 1TY2A 4B9WA 2ZTDA 4Y7NH 1KIXA 3P20A 3MXGA 3ULJA 2DNCA 4IUNA 4BWGB 1Y8PB 1PZKD 1Q8IA 3S1QH 2OWOA 5C5MA 5GADC 4HCEA 4PMBA 1UUPA 2PPBC 3HOYB 2VUMB 5D3IB 4DA2A 1IW7D 5FJ8H 2O5IC 4DR6L 1A63A 4L5SA 5K36H 3VDYA 3HOZB 3Q23A 1J6QA 1B8AA 5FLXc 4JBMA 4ZQ3A 1E7ZA 3AFQA 2GN5A 1HTLD 3PO2B 4KN7C 2KHJA 1B4OA 1X56A 1IBML 2JQOA 1RODA 2KBNA 4IUVA 3CCEA 3IL8A 4GN5A 1PRTB 2B2YC 4GLAC 3UE0A 1RTOA 2B2TC 3L0OA 4HIMA 4LF9Q 1TS4A 4NP5A 1XTCD 4RA8A 4QGUA 3A55A 4ABNA 2L12A 4B3TQ 4JI8Q 2JA9A 3X3MA 1SSOA 3TP5A 1VMPA 1YJWA 3W1BA 2UXDL 2MO0A 5IT9c 4OWTB 2JE6I 2UUBL 5IIFA 3I55A 5KRUA 2KEDA 4LF5Q 3SXHA 1R4PB 2K5HA 2V4DA 3TSSA 3GTOB 1PFSA 3FKIB 5BR8L 1F2LA 1VF5C 3TBIB 3I91A 2ZTCA 2EYOA 5IP7G 4KJOA 3A5ZB 4Z9CB 2IX0A 1TS2A 5CV5A 4HJ7A 1LTBD 1SE8A 4BY1G 1X3QA 3S2HH 3F2UA 2ZXRA 2K75A 2IX3A 4XYQA 1QCBD 1NAPA 2PYKA 2NN6H 1A3UA 1Q81C 1HUMA 1TY0A 1YNND 1PH7A 5CGKA 3IRBA 2EYLA 1WOCA 3J81L 3OIPA 2OXPA 5J22A 2KOLA 4LFAL 1K8OA 2F0EA 2AUKA 2I5HA 1E2WA 4A3IG 3CC7A 4DK6C 4A3MH 3ONAB 5JEAG 2X69A 1EU3A 4K14A 3OMCA 1K83B 1PTOB 2WIIB 1PRTF 2VQFQ 3CD6A 4G7OC 4DR7Q 5C6AA 2EY5A 4HIKA 2C5CA 1MBYA 1AH9A 2F0VA 4DKAC 4I7ZC 2EZVA 1O7YA 2Q2IA 2QDBA 2XTIA 1L0WA 2XN9C 4DXFA 5JJIA 2FMMA 2L5TA 4N8X1 1A3TA 1H9MA 2RVLA 4GOPB 1XNRQ 1PH4A 2E2JB 4A76A 3BU2A 4AH6A 1EY6A 3S9WA 1D7QA 2AHOB 5T1IA 1K8GA 1QZHA 1STGA 3QWNA 2Z6KA 1Y1VH 4OEMB 2K5WA 4LWCA 4KJNA 1NBWA 2OEOA 4B3ML 1RD9D 2EJMA 1AW7A 1DCZA 2K5DA 2VW9A 2KCNA 4JV5Q 1P8LA 3K7AH 3C3LA 1D2BA 3HOUH 4N9PA 2EYFA 5FKAC 1JICA 4J8QA 4Y7NB 4LF4L 4OX9Q 3TZUA 1QWYA 1SNDA 4DV7L 4X62Q 1MIUA 4JI4Q 1FD7D 3SHLA 4AIMA 1Q46A 5C5LA 5IYCG 2XSCA 2YV5A 3PIPA 2UUCL 4Y52H 2NVXB 4CDFC 3Q0AA 3SDZA 3NTKA 2LSSA 5G3LD 4DR3Q 4KD3A 2FINB 3SVMA 2BA1A 2AMCB 1AZQA 4QQBX 3GTJB 1PTOF 5A2QL 1EQQA 4JPBW 4A4IA 4FXGC 2N3SA 2L11A 4DAYA 4TQUS 1WVLA 3C2PA 1RDPD 1CHQD 4LFCL 4L8JA 3HOYG 2VUMG 3R2TA 1SMYC 4KHPL 1MJEA 2VQEL 5F2DA 1Q86C 1I4QA 1QUQB 4A3LG 4O42A 3PUZA 4DV2L 1IYUA 4B3RL 3RLOA 2F3IA 3CQZB 4QCLA 5IP9H 3MHBA 1HPCA 5C0XH 5CBEE 1UE5A 3BYYB 2K1BA 4L5RC 2Z4HA 4HSVA 3J81E 4OO1I 1A8VA 1WTOA 3T53B 1ET9A 3A8IE 1YI2A 2XIWA 1DM0B 3S1NB 4C3IH 3GTPH 1STEA 2Q2TA 1KNAA 2EJGC 4LUVA 4UAIA 2D62A 4O1NA 1J9OA 2QGQA 4JI7L 5HY6A 4BXXH 3DHQA 1EY5A 1NUCA 2ZXPA 3JAML 1LM0A 1MI2A 1CUKA 3L7ZC 1VQFA 4YWMA 1JOQA 1SJED 2EY2A 3ZYYX 4JC0A 2F0NA 4DAYB 2NZOA 2DGYA 4MN3A 2NVQH 3S2HB 4HR7B 4X65Q 1PH5A 3BVMA 3I4LA 3QO2A 1G2TA 1GUOA 1TWGH 3FKIG 4P71A 1PH3A 1D5ZC 3VA5A 1TWCH 1V1PB 2MNAA 1PH9A 4XDXA 3BDCA 4DPGA 4AQYL 2PNRC 1KDAA 4QY7A 1N32Q 1PH2A 2OF1A 5IYBH 1RTNA 4F87A 3MA2B 3K7UC 1N8RC 2R92H 1OXUA 4DUYQ 4B3SL 4GNXA 2K5NA 3TQYA 3BJUA 1K73C 5ELEA 3QOLA 3AMUA 1IBKQ 2CQOA 2WB1B 4X3TA 4G57A 1I3QH 1Q1EA 5DLQE 3NHHA 5J1ZA 1SFOH 1YVCA 1X3PA 1A2TA 3GD7A 2Z1CA 3EA6A 2NVTB 2JEAI 3NE5B 2JP1A 3I3CA 5JPNC 1EYCA 3K5LA 3BYTB 1YJNA 1ESRA 4FNFA 1B53A 2NVYH 1V43A 2XRSD 5GAEC 3DM3A 1BUVT 4C3HH 4KY6A 3CCRA 1PFMA 5IOCA 3L3OC 1DOLA 3KDFA 1D5MC 3I73A 5A2QE 4QIWE 4A3BB 1BDOA 3UI2A 2E74C 1YNXA 3A7AB 1ZEQX 1SYGA 3A8JE 5H1SE 1Y1VB 2J7ZA 4QIWB 2R93B 1G6PA 4A75A 4Q5VA 2E2HH 3K7AB 5CV9A 3HOUB 4GLVB 5HGQA 1VF7A 3VYUA 1SE2A 4XT3B 1STBA 4DV5Q 1Q8KA 3TRZA 2Q2HA 1S5CD 3U4ZA 3MZ5A 4GNXB 1PZID 1NMFA 1S4ZA 4YWLA 1LT6D 3T1YQ 2WAQE 4PMWA 1B2TA 3GV3A 1JB7A 2RDFA 5CV7A 3K5OA 1BVSA 1EQTA 2WACA 3K0YA 2WAQB 1XMOQ 1XXGA 1SMYD 1GHJA 4DUZQ 3OPOA 3LX0A 4ILWA 1AEXA 3A0JA 1PRTC 4YY3L 2HIVA 4UDUC 1KD1C 4DGZA 1JCKB 3W2DA 3RLNA 4HJAA 3S16H 2XWJB 1FJGQ 1N33L 1PXUA 5G3LF 5FJ8G 5E1FA 4OELB 5JJKA 3ITPA 2J0TD 3QR8A 5K36G 3NP8A 2NTTA 4LF8Q 3TS2A 3TS0A 1SXTA 3HEJA 4OL7A 2LS01 1KABA 4JI0L 3HKSA 5FK9C 1VQ7A 1X6OA 2AWOA 1VQLA 2E2IH 3RD4A 1WTQA 2AKWB 3C46A 4LF7L 5M5XB 2JEBI 1JQYD 4HTHA 3TN2A 3EFXD 2H4OA 5ELCA 4PG3A 3GTPB 5FO7B 4ZAIA 3VR2A 4KY7A 1EY7A 1TKWB 3MXPA 1X55A 4DR4Q 4GKJQ 3CF5A 3W1GA 2OCEA 2JSOA 3PIO3 1LTTD 1SAPA 1VQOA 1LYLA 2SNSA 4QMGA 3NSWA 1S5DD 2A73B 1JE5A 4DK0A 5M3MH 1PLFA 1F2MA 2F0UA 4JI5L 1EEFD 3PGZA 4CKBA 1LT5D 3DWQA 1TWGB 4CJ2C 4JK1C 2QILA 2ID0A 1TWCB 3GDEA 4LF6Q 1F77A 1W6KA 1PTOC 1IXRA 4KKUA 3OWFA 3RR5A 1KLGD 2BA0A 1IL2A 2I5LX 3KFUA 1EYAA 3H0GH 1TR5A 2N55A 1EOTA 1OXSC 4YCVA 1HR0W 4OO1H 1IW7C 2E2DC 2G5DA 3OYYA 4ZK9B 2HD3A 3GTLH 4OHJA 4L63B 4N9TA 2UXCQ 2NN6I 3C1FA 2RA4A 1AFPA 4LAAA 1ENCA 5DNFA 4OWXB 4GOPC 4F8MA 2F0TA 2V1CC 1ASYA 4A3MG 4PZ6A 1LTGD 1SR3A 4XQNA 1SYBA 2F0LA 3RZOB 3X3NA 2NVYB 1EQRA 1ICWA 5D65A 2WB1G 3GTQH 2F0MA 1IL8A 1K8MA 3HOWB 3RNUA 4HIDA 1GUWA 3OTOQ 4JI8L 5JJLA 4C1NK 5C44H 1S72A 1CSPA 3L9AX 4IFDJ 5CC4A 3MVVA 4KY5A 4JI6Q 2VY3A 2J4XA 4GKKL 3H09A 3K81C 2B8GA 3PCOB 4LF5L 1Y14B 1DZ1A 4A3BG 2A6HD 1XX8A 5JJZA 2AUJD 2K6AA 2PCFB 3S1MB 1G291 3M4OH 1Y1VG 4B08A 1LLRD 2VXWA 4DV3L 3WWVA 2R93G 2EYPA 2JXMB 5KNDA 1MKHA 1UEBA 4OXPA 5KYIA 1UE6A 4R4TA 1XPUA 3HOUG 3GTMH 3J80L 3TREA 1YNNC 3MXNA 2KUMA 5J3BA 2Z6KC 3SE0A 1HZAA 1WCMH 5E7NA 3ND9A 3S16B 1EUJA 4IZ8A 3M4YA 2RSNA 5DAUA 5FO8B 1N34Q 3G48A 3IFDA 1JJGA 2XVSA 2N88A 2FHTA 4XYOA 3I7FA 2VQFL 1NE3A 1R9TB 4DR7L 4XQJA 2R3ZA 1EIFA 2E8GA 4HCSA 5M9OA 4DV1Q 2NB0A 4PZ8A 5LMNW 1E22A 2QEJC 4A93B 4R8NA 4FP5D 1XPRA 2DY7A 1LV9A 2OQ0A 1Z9FA 2F52A 2Z9HA 2RHSB 2PW5A 1E24A 1XNRL 1AN8A 4JCVE 2X6GA 3SK8A 1NTGA 4RGOS 2N8NA 3I70A 1U4MA 3NTIA 4I7AA 1YNJD 2KEEA 4C3IG 4GN4B 4LNQA 2D5DA 1TWHB 2CWPA 5CV4A 4BA2I 1XYIA 2CH4W 5CV6A 2HCCA 1MSHA 2JK8A 4JV5L 1PTOD 5CBAE 4DN4M 1Y8OB 3K6OA 3PF5A 1Z6HA 4OX9L 4X62L 3E3XA 5BN5A 4JI4L 2G9DA 1MGSA 3OWEB 2K52A 1JOKA 1VMCA 1ET6A 2Z0SA 1UEAB 2EXZA 1A15A 4DR5Q 3D4DA 5EKKA 3CW2C 1E2VA 4DR3L 1ENAA 2C9OA 2DJFC 5COYA 4JBKA 3OW2A 4WRDA 2JJQA 2A69D 1SE3A 3DXJC 3E9IA 4IUUA 1GKHA 4NMZA 1SNOA 3BVGA 3NBIA 1VQJA 1GM5A 4RG1A 3SK4A 3K0XA 2BCOA 2CQAA 2HUGA 3CPFA 4OWWB 4JYAQ 5M3FH 4BY7B 1HA6A 3T13A 4CKEA 5M5WH 2XNAC 1RF2D 2F3WA 4QL5A 5IYBG 1E1TA 2R92G 4CDEC 1XPOA 4TSSA 4K2LA 1BXTA 3J80E 2PI2A 1LTAD 1CKNA 2JA8B 1PYBA 3TDQA 3D4WA 1AZPA 4DAPA 4RHRA 1GOZA 2EYMA 4DNTB 5ELNA 1OXVA 4POFA 3G4SA 3K57A 2B63H 1B9MA 4A3KH 4ZRZA 2R7DA 4GNXC 2VB3X 4EQNA 3IAYA 3VYRA 4WORA 3M4PA 1JWSD 4C3HG 2QDLA 4A3CH 3S24A 3HOWG 5HGTA 2C35B 3M3YB 4A3FB 4X6AH 1SYFA 1ESFA 3DM1A 1K3BC 3PUWA 2UUAQ 1YITA 2OT2A 3HOVH 1HNWQ 4KV6A 4MIUA 5LMNQ 1HXYD 4C3JH 1Q7YC 1ONLA 2HQLA 1H9RA 1IYVA 4X65L 4NDXA 3CCSA 2BDOA 1SRUA 1KDCA 1II3A 4F7XA 1A3VA 1VQCA 4XXEA 1C48A 1XMQQ 2K5QA 2MGSA 2ES2A 4XIGS 4DV0Q 3H15A 1B50A 4WFN3 1CKNB 5JEAJ 1N32L 2MJ8A 1Q12A 1PYWD 4LUOA 4R9WA 3HKZB 4EVOA 2YTVA 4IJLA 4BBSH 2B8FA 3OOCA 3KYHC 4DUYL 3S2DH 1RHPA 1EQVA 2NUCA 1IBKL 3DMUA 2H5XA 1DD2A 3IFTA 1GUSA 4JI1Q 2AQ3B 4NKLA 1FGBD 1T5XD 2KECA 1G91A 1EZ6A 2K03A 2N49A 4YIJA 3TMEA 2O4XA 3FPPA 1HCZA 3TEHB 4UY8C 1STNA 2L4NA 2JA5B 4LUZA 3VR4A 1LTLA 1B3AA 4A3GB 4RMFA 4UP8A 1C0AA 3O13A 4P75A 2CCZA 1EIHA 4JOIC 5EQ0A 3E0EA 1A2UA 3P75A 3F8TA 4A93G 2EE1A 4CBVA 1KC8C 1I4HA 3NPPA 1GXDC 1IKLA 1Q90A 3BZDB 3W3AA 4K0KQ 4IO9A 3S1QB 1EYGA 2ZM6Q 3SR1A 1CQVA 4ZYSA 1ILQA 3MC0B 3S15H 4DV5L 1JJCB 4DR2Q 3R2IA 1WD0A 3RZDH 1I6HH 3URYA 3T1YL 5M3MG 1UAPA 3B6YA 1GUGA 2KQ3A 2B2UA 4RKLA 2R6GA 5E4XA 4IPDA 1XMOL 4K5XA 4DUZL 3PQIA 5CYUA 2K28A 2LMCB 4DAMA 1TWAH 3FHWA 2RCFA 1MHWC 1QVCA 3H0GG 2F0GA 2XRQD 4OO1G 4FF2A 1FJGL 5IGDA 5M5WB 1WD1A 3D0FA 3VR3A 3PO3H 4IURA 1VQDA 3R93A 1GHKA 2A5HA 1SNQA 3U9OA 3DWAA 4KN4C 1FYCA 4HIOA 4LF8L 5C3WA 2PMZB 3I4MH 3L2PA 2B2WA 1W2BA 4BY7G 3MAQA 3D4RA 2K05A 4EQ5A 1KLUD 5DM73 4LFBL 1EYDA 1C9OA 2IY5B 3NWTA 3HOXH 2VS1A 1PH1A 4A3EH 1K3RA 1SMXA 5IGBA 4A3KB 1YHAA 5JAVA 1BF4A 3KUPA 1NJIC 1FR3A 1BR9A 4DR4L 3NTHA 2JA8G 4GKJL 2VL6A 1JWMD 2O2LD 3QB3A 4HJ5A 1VQEA 3FMCA 1K28A 3CC4A 4RCNA 1I4XA 1HFGA 2KA7A 3UDIA 2PO4A 1LTSD 5C44G 1HNXQ 1NSNS 4P74A 2K01A 4C3JB 2QCPX 3I4NH 3PUVA 3AQQA 4X66Q 1PZJD 1I50H 1DGSA 1V1QA 1Y8NB 4A3FG 1QVFA 4H0LC 3T1HL 4MNOA 3J7YW 4A3MB 3OSOA 4LF6L 2WB1E 1P16A 4ZUJA 1H95A 1JWUD 3E6ZX 4R4IA 1VQ4A 1SE4A 5IY0A 1J5EQ 4APVA 1PYSB 4C56C 4L5QA 4BBSB 5LMUQ 2CW0D 2Q8RE 2D9UA 3S2DB 2UXCL 1X32A 3GTGH 5CV8A 4L6TB 1B9NA 1WCMG 3G71A 3J7AF 4IN3A 1QVGA 1XJVA 1KRTA 4ZKCB 1EY8A 3VA7A 3HKZG 2AQ1B 3CCLA 1V8QA 1BBUA 4NPSA 5FLXL 3GO5A 5FLMG 4EQOA 1TT2A 2L9HA 1IYJB 3AB9A 4IUQA 3H3VC 1TWFH 3F2BA 1VQKA 1LT4D 2ZT9C 3OTOL 4GZYC 2A6ED 5IP7H 5JPMC 1WJJA 3U4VA 4CDDC 1H9JA 3CRLC 3PIOA 2JA5G 5DEHA 4DK3C 4A3GG 4JI6L 4NB3A 3D3RA 4AYBB 2KCCA 1ZYRD 4DV7Q 3S15B 2A6HC 3QOJA 1I94Q 1D5XC 4DV4Q 5IT9L 3BZCA 1DXMA 4KD4A 1FVIA 1S5FD 3MFGA 4IQZA 2VZAA 2KCTA 3TP8A 4A3IH 1U4LA 3JAME 4CHTB 3J7A5 2L0CA 5JEAH 5NUCA 3KDFB 4NXMQ 4I65A 4PQXA 1SBBB 3LWUA 3NBHA 1BBWA 4WJ3M 2TMPA 3EQLC 1WYDA 1GJXA 1A62A 1SYEA 1VQGA 1X65A 1IBLQ 2NYZD 2WFWA 1N36Q 1M1KC 3A74A 1BOSA 5LHY1 2SOBA 1PVOA 4X64Q 1CTMA 2HHHQ 5ELOA 5C3XA 2VQEQ 1DJRD 4DR1Q 4GLXA 1YJ9A 3Q24A 1N34L 3PO3B 3KF6A 1KNEA 2GA4B 3T4AC 3W5OA 1WTPA 1L0XB 1EL0A 1SNPA 2K04A 2A8VA 1HRJA 2LXKA 4C3IB 1PA6A 4HJ9A 2KENA 3STBD 1G6ZA 4DV1L 1ENFA 4M8AA 1SLJA 3HOXB 3IKJA 4TKOB 1Y1WH 5EPJA 2Z4IA 4XQQA 1HFNA 1RKNA 2HT1A 1O78A 2JA6H 1ASZA 1F9PA 3A7LA 3J81c 4IALA 4YWKA 1EWHA 2NVQB 1CKOA 5D14A 3N52A 2F03A 1F9QA 1GO3E 1HHVA 3NBHB 4FVMA 1YNJC 3K58A 3H6MA 4DNIA 4HMIA 4JG2A 2B63G 1TVXA 1I4RA 4A3KG 1UWVA 4JI3Q 3S14H 1Y69U 3I4NB 4NW2A 3I4OA 4EGVA 1L1OA 3FEWX 5FLXE 1O80A 4A3CG 1DOKA 2A68D 1KXLA 4IPHA 2YYZA 1I50B 1WTXA 3UDFA 3KF6B 5EPKA 2I0QA 3ND8A 2A74C 4KLKA 2NN6G 1FNVA 4C3JG 4IUTA 2R92B 1SN8A 2VUMH 4ME3A 1PV4A 3AYHB 2UU9Q 3LGJA 4DR5L 1H9SA 4QUCA 1EIGA 4RKBA 1VQ9A 1I3QB 1L2FA 1SFOB 1SNMA 3HOZH 1G51A 2B3GA 2PNHA 2X6LA 1LO5D 2GVAA 2A69C 1L0YB 1R4QB 2L1BA 2PZWA 3PO2H 5IT9E 4OGQC 5ISRA 4JYAL 3E5SA 4BBRH 4C3HB 2JYOA 5AJ3Q 1JR0D 4LF9L 3PMFA 4HAEA 3G6EA 4A3JH 4BBSG 2FXQA 1CKMA 4LK1C 4B3TL 2Z8LA 3PUXA 2ALYB 2ZXOA 4FF3A 3FPUB 4HMJA 1HNZQ 3TZDA 5KNCA 1L1OB 5EPLA 1VQHA 4PV1C 4UP9A 1EZ8A 1VDZA 3PSIA 2KJXA 1F2YA 4V0BA 3ZJYC 2IJ0A 5CORA 4X3UA 3ERQA 2E2HB 1CHPD 1SYDA 3VYTA 2XGTA 1X9NA 3KOJA 3MEHA 1HH2P 4MTNA 1TIID 1Q3LA 2MO1A 2KHIA 1KDBA 1EIYB 3OHXC 3GTOH 3AEVA 2K50A 1DONA 1NNXA 1H9SB 3FKIH 5IYDH 5I6WA 5C4XH 4IFDI 4ZLTF 1RCVD 1QZGA 2EYHA 2UUAL 1HNWL 2EYJA 1VQBA 3N6RA 3GV6A 5FO9B 4OONA 3H91A 1RL2A 4AYBG 5I2XA 5EKLA 3M7GA 1MJCA 2F3VA 4ID6A 1XNQQ 1D6EC 1XMQL 1XWEA 1QOHA 4DV0L 2EIFA 5IGFA 4A3DH 4M1UB 1EY9A 4BA1I 3DEOA 2BOSA 4IOAA 2F0KA 1A0IA 1K83H 3Q22A 2DY8A 3BDLA 1QG7A 2E2IB 3Q8DA 2RQXA 3JAMc 2EPBA 4HSPA 2OTLA 2ZTEA 2IX1A 1LTID 3FRPB 1PFNA 4RAUC 1HR0Q 1EFWA 2WKDA 4JI1L 2D0PA 5IP9G 4K6LA 5J39A 2F4IA 1GUTA 5C0XG 1TS5A 4RWSC 1EU4A 5C3EH 5E3FA 3UE1A 3PO3G 3A54A 1YBYA 3HZXA 4BS9A 1Y1WB 3NEMA 2LY7A 1PH8A 1IKMA 2IHFA 3MXNB 1VQ5A 4H02A 2E2JH 3K5NA 5CMDA 2JA6B 1HZ9A 2JA7H 4MHEA 1X3GA 1F2ZA 2RSOA 5M3MB 4R4CA 3HOXG 4BXXG 1GVPA 4A3EG 1UE7A 4RGMA 5IGCA 4MTKA 1LTRD 4ZKBB 4K0KL 2K32A 4R8IA 2AQ2B 4CKCA 2E76C 2MFIA 2Z6BA 3I72A 2TSSA 2F1MA 2CHBD 2B2WC 2ZM6L 2F0FA 1ML0D 1BQQT 3CXCA 3H0GB 4GN3B 4DR2L 2KHSA 3CCJA 5EGTA 5GROA 3GTLB 4PMCA 4X3SA 2NVXH 3I4NG 2WV6D 3I90A 2A1AA 2YTXA 4IOCA 1X3FA 2UXBQ 1SEBD 2CH4A 1PMRA 1BBXC 4CDCC 1I6VC 3GTJH 3KJOA 1ICFB 1CT1D 1XTDA 1VQMA 1CFMA 3BG3A 3EN2A 2IWHA 4K5WA 1WTVA 4YHHQ 2CWAA 4WJ4A 3MEFA 2R7FA 3J81i 2E5LQ 1JJ2A 3J7ZC 3CCVA 1CSQA 4DV6Q 4BBRB 1KL9A 3DWPA 3GTQB 1CK1A 3ERSX 1FNUA 4FXDA 4A3JB 3CQZH 3PV0A 5A35A 2D2CC 5DM63 1JMCA 1STYA 1C8CA 1A6XA 3ULLA 1KRSA 5C44B 1V1OA 1H9KA 4WJWA 1ZKOA 2BDNA 2IPKD 2QW7A 5HURA 1V9PA 4DU9A 5ELBA 2ICEC 3R3OA 3S1NH 2BE5D 3NXWA 5GQOA 2ZJRA 4FYDA 4OIJA 1S40A 2A19A 4R1JA 1PHJA 3U50C 2EY6A 3V2TA 4GKKQ 3E0JA 3M4OB 2RKSA 1K8AC 2F4VQ 2CKZB 4UPAA 3BVZA 2MUYA 1F9SA 1KTKA 3NQTA 5KIXA 3S17H 3GP7A 5C4XB 2ATWA 2BH2A 2YTYA 3KK7A 4IPGA 4DV3Q 3TP7A 1HNXL 2PI2E 3GTMB 4GOPA 2HDLA 3RN5A 1D1KA 1PDQA 2F0PA 3HKZE 1RJTA 2EY1A 1CZGA 4X66L 3K8AA 1WCMB 3OW7A 5IGEA 4QF4A 1YHBA 2RCNA 3T56B 3BS1A 4P73A 3CMEA 1AE2A 3NQIA 2PQEA 3CHBD 1N9WA 4ALPA 1J5EL 1TU2B 4RH6A 1JORA 1OXTA 3SK5A 4JI2Q 2YU9H 4A3DB 2R7ZH 4U673 2KCMA 1CI3M 3DEPA 3DLLA 1EY4A 4FO2A 5ELFA 3NELA 5LMUL 5IWAQ 2CW0C 2RDHA 5GAGC 2B2VA 1PFBA 1WTWA 1O7LA 4KHVA 3KJPA 2NVTH 4HEDA 3M9BA 4DXGA 3D6CA 4IFDH 2F0IA 1HUNA 3CCUA 3NUCA 5C3EB 5IE8A 4NXNQ 2VNUD 1BCPD 4S3SA 2OQKA 1YHQA 2RDGA 5C4JH 3A5UA 1M90C 2DUDA 2CFMA 1JB3A 4R4QA 4P2CB 4XTCS 1FGUA 1WI5A 2JA7B 4A3BH 1BNZA 1QUQA 1YIJA 1UNSA 4DK1A 2A6EC 3MWYW 5GAHC 1D1IA 1Y1WG 3QG1A 2VB2X 2R93H 1IHZA 2B29A 3PF4A 2DJGC 2PW7A 5JVH3 2JA6G 1J8IA 5ELDA 3AFPA 1NCVA 4L5TA 1ZYRC 2B39A 3JAMi 1I94L 4X3KA 4DR6Q 4DV4L 1IZ6A 3EJIA 4ZCKA 3PUYA 2PZUA 2AWNA 3M4QA 4KKTA 4N8FA 1DOMA 5KGUA 3ER0A 2D0OA 2FMCA 1G2SA 4NXML 3CCMA 1IBMQ 1G8ZD 2OTJA 1YZ6A 4JBWA 5M3FB 3R8BA 3H3VI 1I4PA 3NK9A 3RMHA 3T16A 5I9PA 2F0WA 4KHZA 1IBLL 1N36L 2PMZE 2K5VA 4X64L 3LNNA 2PZTA 1LT3D 2HHHL 1L1OC 3HFZB 2IL8A 4PZ7A 1I5FA 2DN8A 2K7VA 4DR1L 1V1PA 1E2ZA 3FVQA 2QF7A 1B44D 3HOZG 3WOFA 1SNCA 4DAVA 3CP0A 2UXDQ 3RLFA 2B63B 2F0JA 3PO2G 1VQNA 3STBC 3V05A 1S3OA 2UUBQ 2G9HD 1VQIA 4BBRG 5M5XH 4FXKC 3U9SA 4DF7A 5BR8Q 3DUZA 2MQHA 4A3JG 3AU7A 1U5KA 1C7YA 4J6HA 4JW0A 3J80c 4R4OA 4IUPA 4EX5A 3HOVB 1WFQA 4FF4A 1VS0A 1SJHD 2FJ2A 4QB4A 2SDFA 3D6WA 3S17B 1CA6A 1BCPB 3VR5A 3CPWA 1JT8A 3PIP3 1QILA 4JI3L 2B2YA 1QJOA 1QNKA 3HP3A 3KLSX 1PH6A 2N78A 2B2TA 4C1NI 1TXYA 4LFAQ 1Q1BA 2A68C 2EDGA 5IYDG 4ULLA 1B7YB 1T5EA 5C4XG 1TS3A 2K14A 5I9OA 5T1GA 4QJFA 4LMQD 5E4WC 2IT1A 4G4KA 1ILPA 2CVRA 1Z7TA 3G7LA 5EJWA 2JN4A 4LW1A 3EVQA 4YCUA 3VR6A 1JOOA 2UU9L 2YU9B 3FP9A 2PQAA 2R7ZB 3MXUA 5C4HA 2R61A 1F9RA 2ZJPA 1I4GA 1HA5A 4MZ9A 2NZHA 2Q8TA 1SDFA 2MP1A 1KAAA 1K9MC 1D8LA 1OO9B 1STAA 4H44C 4A3DG 5AJ3L 2RBMA 1CQFA 2I5MX 1KQSA 3KLRA 3RZOH 3I56A 3V96A 3LWEA 2ASBA 3RN2A 4IJHA 1M4VA 5C4JB 1VQ8A 1QNUA 1HNZL 4RGTA 1MD2D 3HOWH 4ODGA 4B3MQ 2GVBA 4AYBE 3RUZA 3TP6A 4JBJA 4BY1H 1HQMC 1BO0A 4RHSA 2EQSA 2F0SA 3E9HA 3GTKH 5C3EG 3U58A 4TRDA 1BCPF 5EKIA 4LF4Q 2IHEA 3CRKC 4CJ0B 5I2YA 1VQ6A 3A8KE 1NMGA 3RZDB 1B3QA 1I6HB 1E0BA 1X3EA 3NWSA 5JOBA 2UUCQ 4RGNA 2PQAB 2JA7G 4UHVA 3S1MH 1KHIA 2ENBA 2NWGA 2MPMA 1LABA 2F0OA 4U68A 1JC7A 1HQRD 1VQPA 2P5ZX 1M8AA 1TWAB 5LL6S 4H13C 2M00A 4LFCQ 1X54A 3T51B 4KHPQ 1DYQA 5L37A 3A56A 4POGA 1XNQL 4DV2Q 4RFBA 4B3RQ 3BZKA 1QE6A 3G6JB 4FDBA 5TSSA 4JOIA 2Y0SE 1W3SA 4TVAB 2L55A 1Q82C 2F0HA 2I46A 1T9HA 3KF8A 2O5JC 2ICIA 5AFWA 4CJ1B 4F88A 3I4MB 2BH8A 2Y0SB 1E1OA 5M3FG 3S1RH 1R9TH 1E3PA 2FFKB 3J81j 3CC2A 4A3EB 1HR0L 2K4KA 4LFBQ 3HG9A
chains in the Genus database with same CATH topology
4KTAA 3KBXA 4HN7A 2SEBD 4Q0FA 5CR3A 4QUFA 4KKSA 3SK6A 2MHVA 1FNWA 2NZ1D 3QIAA 1CM9A 2QKIC 2M9VA 3VYSA 1W6JA 3KLSA 5IGGA 1QB5D 5BN3A 3QJYA 4K2KA 3P7JA 3H94A 3WDNA 1JE4A 3SEBA 4K5VA 3CKIB 1NR4A 2IW3A 3GTGB 4KK7A 2WINB 3J7AV 4H7BA 2LKVA 5K5PA 3HS0C 2EJFC 3OIQA 1EY0A 5JVG3 2EOTA 3MFYA 2F0QA 1NR2A 2Q8IB 1U4RA 1TWFB 3K5MA 1EFID 1CA5A 4DNRB 1HTPA 4ME5A 1SYCA 1EEID 4G7ZC 4BY1B 1STHA 4PNYA 5EBCA 1GUNA 4G7HC 4CGYB 2WKCA 4IFDG 3GTKB 2BE5C 3EROA 4OIKA 2XWBB 4EQPA 1U9RA 2SNMA 5C4ZA 2B2VC 3MTSA 3BDOA 5I4DA 4FF1A 1U4PA 4A3IB 1O7ZA 5BN4A 1Z47A 3K59A 4KI0A 4LJZC 1PRTD 3C1EA 4J1MA 5KNBA 3D31A 1B1ZA 5LL6X 1S5BD 3M85A 2M2LA 2F0DA 2NBFA 3P1HA 2EVBA 1C4QA 4ZUIA 2HDMA 4DFAA 2DNEA 5FOBB 4K8JA 3CU7A 1PTOH 4B9XA 2WP8J 3WOEA 2E75C 3HGBA 1AP0A 3M7NA 5KYLA 4K8IA 4KMUC 1EWCA 3FDTA 3GQBA 3OMGA 1OXXK 5I6YA 2KVMA 2B2UC 3D8GA 1S5ED 3S1RB 1TQOA 1VCIA 1ZXTA 2HCIA 5C0XJ 2HQEA 2NTSA 3KBGA 2LFNA 1LACA 1MSGA 4E6IA 3I8ZA 1WTRA 5IODA 1BCPC 4K6DA 5EBDA 5KEEA 2H1EA 4V190 3S14B 2I07B 5C0XI 2K33A 4C2MB 5M5YB 4RCOA 5D3DA 3HRZC 3Q6SA 1CZWA 4XT1B 1TY2A 4B9WA 3P20A 3MXGA 2DNCA 4IUNA 4BWGB 1Y8PB 1PZKD 1Q8IA 5C5MA 4HCEA 4PMBA 1UUPA 2PPBC 3HOYB 2VUMB 5D3IB 4DA2A 1IW7D 2O5IC 5K36H 3HOZB 3Q23A 4ZQ3A 1HTLD 3PO2B 4KN7C 1B4OA 1RODA 4IUVA 3IL8A 1PRTB 2B2YC 1RTOA 2B2TC 1TS4A 4NP5A 1XTCD 4RA8A 3A55A 4ABNA 2L12A 3X3MA 1SSOA 3TP5A 1VMPA 2JE6I 5IIFA 5KRUA 2KEDA 3SXHA 1R4PB 2V4DA 3TSSA 3GTOB 3FKIB 1F2LA 1VF5C 3TBIB 3I91A 2EYOA 4KJOA 4Z9CB 2IX0A 1TS2A 5CV5A 1LTBD 1X3QA 3F2UA 2ZXRA 2IX3A 4XYQA 1QCBD 1NAPA 2PYKA 2NN6H 1A3UA 1HUMA 1TY0A 1YNND 5CGKA 2EYLA 3J81L 3OIPA 2OXPA 5J22A 2KOLA 1K8OA 2F0EA 2AUKA 1E2WA 3ONAB 5JEAG 2X69A 1EU3A 4K14A 3OMCA 1K83B 1PTOB 2WIIB 1PRTF 4G7OC 5C6AA 2EY5A 2C5CA 1MBYA 2F0VA 4I7ZC 2EZVA 1O7YA 2QDBA 2XN9C 4DXFA 2FMMA 2L5TA 1A3TA 1H9MA 2RVLA 2E2JB 1EY6A 3S9WA 5T1IA 1STGA 3QWNA 2K5WA 4KJNA 2OEOA 1RD9D 2EJMA 1AW7A 1DCZA 2K5DA 2KCNA 3C3LA 1D2BA 4N9PA 2EYFA 5FKAC 1JICA 4J8QA 4Y7NB 3TZUA 1QWYA 1SNDA 1FD7D 3SHLA 5C5LA 2XSCA 2NVXB 3Q0AA 3SDZA 3NTKA 5G3LD 4KD3A 2FINB 3SVMA 2BA1A 1AZQA 3GTJB 1PTOF 5A2QL 4FXGC 2L11A 4DAYA 4TQUS 1WVLA 3C2PA 1RDPD 1CHQD 4L8JA 3R2TA 1SMYC 5F2DA 1I4QA 4O42A 3PUZA 1IYUA 3CQZB 4QCLA 3MHBA 1HPCA 5C0XH 5CBEE 3BYYB 2K1BA 2Z4HA 4HSVA 3J81E 4OO1I 1WTOA 3T53B 1ET9A 3A8IE 2XIWA 1DM0B 3S1NB 1STEA 1KNAA 2EJGC 4UAIA 2D62A 4O1NA 1J9OA 3DHQA 1EY5A 1NUCA 2ZXPA 3JAML 1MI2A 3L7ZC 1JOQA 2EY2A 3ZYYX 1SJED 2F0NA 4MN3A 3S2HB 4HR7B 1G2TA 3BVMA 3I4LA 3QO2A 1GUOA 1D5ZC 3VA5A 1V1PB 4XDXA 3BDCA 2PNRC 1KDAA 2OF1A 1RTNA 4F87A 3MA2B 1OXUA 3AMUA 5ELEA 3QOLA 2WB1B 4X3TA 4G57A 1Q1EA 3NHHA 5J1ZA 1X3PA 1A2TA 3GD7A 2Z1CA 3EA6A 2NVTB 2JEAI 3NE5B 2JP1A 3I3CA 5JPNC 1EYCA 3K5LA 3BYTB 1ESRA 4FNFA 1B53A 1V43A 2XRSD 1BUVT 4KY6A 1PFMA 5IOCA 3L3OC 1DOLA 1D5MC 3I73A 5A2QE 4A3BB 1BDOA 3UI2A 2E74C 3A7AB 1ZEQX 1SYGA 3A8JE 1Y1VB 2J7ZA 4QIWB 2R93B 4Q5VA 3K7AB 5CV9A 3HOUB 1VF7A 3VYUA 1SE2A 4XT3B 1STBA 1S5CD 3MZ5A 1PZID 1S4ZA 1LT6D 4PMWA 1B2TA 3GV3A 2RDFA 5CV7A 3K5OA 1EQTA 2WACA 3K0YA 2WAQB 1XXGA 1SMYD 1GHJA 3OPOA 3LX0A 4ILWA 1AEXA 1PRTC 4UDUC 4DGZA 1JCKB 3W2DA 2XWJB 1PXUA 5G3LF 5E1FA 3ITPA 2J0TD 5K36G 3NP8A 2NTTA 1SXTA 3HEJA 4OL7A 2LS01 1KABA 5FK9C 2AWOA 3RD4A 1WTQA 3C46A 5M5XB 3TN2A 1JQYD 4HTHA 2JEBI 3EFXD 2H4OA 5ELCA 3GTPB 5FO7B 4ZAIA 3VR2A 4KY7A 1EY7A 1TKWB 3MXPA 2JSOA 3PIO3 1LTTD 1SAPA 2SNSA 4QMGA 3NSWA 1S5DD 2A73B 4DK0A 1PLFA 1F2MA 2F0UA 1EEFD 4CKBA 1LT5D 3DWQA 1TWGB 4CJ2C 4JK1C 2QILA 2ID0A 1TWCB 1F77A 1W6KA 1PTOC 4KKUA 3OWFA 1KLGD 2BA0A 1EYAA 1TR5A 2N55A 1EOTA 1OXSC 4OO1H 1IW7C 2E2DC 4ZK9B 4OHJA 4L63B 4N9TA 2NN6I 3C1FA 2RA4A 1AFPA 4LAAA 1ENCA 5DNFA 4F8MA 2F0TA 1LTGD 4XQNA 1SYBA 2F0LA 3RZOB 3X3NA 2NVYB 1ICWA 5D65A 2F0MA 1IL8A 1K8MA 3HOWB 1GUWA 4C1NK 3L9AX 4IFDJ 5CC4A 3MVVA 4KY5A 2J4XA 3H09A 2B8GA 1DZ1A 2A6HD 1XX8A 5JJZA 2AUJD 2K6AA 2PCFB 3S1MB 1G291 4B08A 1LLRD 2VXWA 2EYPA 2JXMB 5KNDA 5KYIA 3J80L 1YNNC 3MXNA 2KUMA 3SE0A 3ND9A 3S16B 4IZ8A 3M4YA 2RSNA 5DAUA 5FO8B 3IFDA 2XVSA 2N88A 2FHTA 4XYOA 1R9TB 4XQJA 2R3ZA 4HCSA 5M9OA 2NB0A 2QEJC 4A93B 4R8NA 4FP5D 2DY7A 1LV9A 2PW5A 1AN8A 2X6GA 3SK8A 4RGOS 3I70A 1U4MA 3NTIA 1YNJD 2KEEA 4C3IG 2D5DA 1TWHB 5CV4A 4BA2I 1XYIA 5CV6A 2HCCA 1MSHA 1PTOD 5CBAE 4DN4M 1Y8OB 3K6OA 1Z6HA 5BN5A 2G9DA 1MGSA 3OWEB 1JOKA 1VMCA 1ET6A 1UEAB 2EXZA 1A15A 3D4DA 5EKKA 1E2VA 1ENAA 2C9OA 5COYA 4WRDA 2A69D 1SE3A 3DXJC 4IUUA 4NMZA 1SNOA 3BVGA 3NBIA 3SK4A 4BY7B 2BCOA 2CQAA 2HUGA 1HA6A 3T13A 4CKEA 2XNAC 1RF2D 2F3WA 4TSSA 4K2LA 1BXTA 3J80E 1LTAD 2JA8B 3TDQA 3D4WA 1AZPA 4DAPA 4RHRA 1GOZA 2EYMA 4DNTB 1OXVA 3K57A 1B9MA 4ZRZA 2VB3X 4EQNA 3IAYA 3VYRA 4WORA 1JWSD 4C3HG 5HGTA 3M3YB 4A3FB 1SYFA 1ESFA 3DM1A 3PUWA 2OT2A 4KV6A 4MIUA 1HXYD 1ONLA 1H9RA 1IYVA 4NDXA 2BDOA 1KDCA 1II3A 4F7XA 1A3VA 4XXEA 1C48A 2K5QA 2MGSA 4XIGS 1B50A 4WFN3 5JEAJ 2MJ8A 1Q12A 1PYWD 4R9WA 3HKZB 4EVOA 2B8FA 3OOCA 1RHPA 1EQVA 2NUCA 3DMUA 1DD2A 3IFTA 1GUSA 2AQ3B 4NKLA 1FGBD 1T5XD 2KECA 1G91A 1EZ6A 2K03A 4YIJA 3TMEA 2O4XA 3FPPA 1HCZA 1STNA 2L4NA 2JA5B 3VR4A 1B3AA 4A3GB 3O13A 1EIHA 5EQ0A 1A2UA 3P75A 2EE1A 4CBVA 1I4HA 3NPPA 1GXDC 1IKLA 1Q90A 3BZDB 3W3AA 3S1QB 3SR1A 1CQVA 4ZYSA 1ILQA 3MC0B 3R2IA 1WD0A 3URYA 1UAPA 1GUGA 2KQ3A 2B2UA 4RKLA 2R6GA 5E4XA 4K5XA 5CYUA 2K28A 2LMCB 2F0GA 2XRQD 4OO1G 4FF2A 5IGDA 5M5WB 1WD1A 3VR3A 4IURA 3R93A 1GHKA 2A5HA 1SNQA 3U9OA 3DWAA 4KN4C 1FYCA 5C3WA 2PMZB 2B2WA 3MAQA 3D4RA 2K05A 1KLUD 5DM73 1EYDA 3NWTA 5IGBA 4A3KB 5JAVA 1BF4A 3KUPA 1FR3A 1BR9A 3NTHA 1JWMD 2O2LD 3QB3A 3FMCA 4RCNA 1I4XA 1HFGA 2KA7A 2PO4A 1LTSD 1NSNS 2K01A 4C3JB 2QCPX 3PUVA 1PZJD 1Y8NB 4H0LC 3J7YW 4A3MB 3OSOA 4ZUJA 1JWUD 3E6ZX 1SE4A 4C56C 4BBSB 2CW0D 2Q8RE 2D9UA 3S2DB 1X32A 5CV8A 4L6TB 1B9NA 3J7AF 4IN3A 4ZKCB 1EY8A 3VA7A 2AQ1B 1V8QA 5FLXL 3GO5A 4EQOA 1TT2A 2L9HA 3AB9A 4IUQA 3H3VC 1LT4D 2ZT9C 4GZYC 2A6ED 5JPMC 1H9JA 3CRLC 5DEHA 3D3RA 4AYBB 2KCCA 1ZYRD 3S15B 2A6HC 3QOJA 1D5XC 5IT9L 1DXMA 4KD4A 1S5FD 3MFGA 4IQZA 3TP8A 1U4LA 3JAME 4CHTB 2L0CA 5JEAH 5NUCA 4I65A 4PQXA 1SBBB 3LWUA 3NBHA 2TMPA 3EQLC 1GJXA 1SYEA 2NYZD 1BOSA 5LHY1 2SOBA 1CTMA 5C3XA 1DJRD 3Q24A 3PO3B 1KNEA 2GA4B 3T4AC 1WTPA 1EL0A 1L0XB 1HRJA 1SNPA 2K04A 4C3IB 1G6ZA 1ENFA 4M8AA 3HOXB 3IKJA 4TKOB 5EPJA 2Z4IA 4XQQA 1HFNA 1RKNA 1O78A 1F9PA 3A7LA 4IALA 1EWHA 2NVQB 5D14A 3N52A 2F03A 1F9QA 1HHVA 4FVMA 1YNJC 3K58A 3H6MA 4HMIA 1TVXA 1I4RA 1Y69U 3I4NB 4NW2A 4EGVA 3FEWX 5FLXE 1O80A 1DOKA 2A68D 2YYZA 1I50B 1WTXA 5EPKA 3ND8A 2A74C 2NN6G 1FNVA 4C3JG 4IUTA 2R92B 1H9SA 4QUCA 1EIGA 4RKBA 1I3QB 1SFOB 1SNMA 2X6LA 1LO5D 2A69C 1L0YB 1R4QB 2L1BA 2PZWA 5IT9E 4OGQC 5ISRA 3E5SA 4C3HB 2JYOA 1JR0D 3PMFA 4HAEA 4LK1C 2Z8LA 3PUXA 2ZXOA 4FF3A 3FPUB 4HMJA 3TZDA 5KNCA 5EPLA 4PV1C 1EZ8A 1VDZA 2KJXA 1F2YA 4V0BA 2IJ0A 5CORA 4X3UA 3ERQA 2E2HB 1CHPD 1SYDA 3VYTA 3MEHA 1TIID 1Q3LA 1KDBA 3OHXC 1DONA 1H9SB 5I6WA 4IFDI 4ZLTF 1RCVD 2EYHA 2EYJA 3N6RA 3GV6A 5FO9B 3H91A 5I2XA 5EKLA 3M7GA 2F3VA 4ID6A 1D6EC 1XWEA 1QOHA 5IGFA 4M1UB 1EY9A 4BA1I 3DEOA 2BOSA 2F0KA 3Q22A 2DY8A 3BDLA 1QG7A 2E2IB 2RQXA 2EPBA 4HSPA 2IX1A 1LTID 3FRPB 1PFNA 4RAUC 2WKDA 4K6LA 5J39A 2F4IA 1GUTA 5C0XG 1TS5A 4RWSC 1EU4A 5E3FA 3A54A 3HZXA 4BS9A 1Y1WB 2LY7A 1IKMA 3K5NA 5CMDA 2JA6B 4MHEA 1F2ZA 2RSOA 5M3MB 4RGMA 5IGCA 1LTRD 4ZKBB 2K32A 4R8IA 2AQ2B 4CKCA 2E76C 3I72A 2TSSA 2F1MA 2CHBD 2B2WC 2F0FA 1ML0D 1BQQT 3H0GB 2KHSA 5EGTA 3GTLB 4PMCA 4X3SA 2WV6D 3I90A 1SEBD 1BBXC 1PMRA 1I6VC 1CT1D 1CFMA 3BG3A 2IWHA 4K5WA 1WTVA 4BBRB 3DWPA 3GTQB 1CK1A 1FNUA 4FXDA 4A3JB 3PV0A 5A35A 2D2CC 5DM63 1STYA 1C8CA 1A6XA 5C44B 1V1OA 1H9KA 4WJWA 1ZKOA 2BDNA 2IPKD 5HURA 4DU9A 5ELBA 2ICEC 3R3OA 2BE5D 3NXWA 4FYDA 4OIJA 2EY6A 3V2TA 3E0JA 3M4OB 2RKSA 3BVZA 2MUYA 1F9SA 1KTKA 3NQTA 5KIXA 5C4XB 3GP7A 3KK7A 3TP7A 3GTMB 2HDLA 1D1KA 1PDQA 2F0PA 1RJTA 2EY1A 1CZGA 1WCMB 3OW7A 5IGEA 4QF4A 3T56B 3BS1A 2PQEA 3CHBD 3NQIA 1TU2B 4RH6A 1JORA 1OXTA 3SK5A 4A3DB 4U673 1CI3M 3DEPA 1EY4A 4FO2A 5ELFA 2CW0C 2RDHA 2B2VA 1PFBA 1WTWA 1O7LA 4KHVA 4HEDA 4DXGA 3D6CA 4IFDH 2F0IA 1HUNA 3NUCA 5C3EB 2VNUD 1BCPD 4S3SA 2RDGA 1JB3A 4P2CB 4XTCS 2JA7B 1BNZA 1UNSA 4DK1A 2A6EC 3MWYW 1D1IA 3QG1A 2VB2X 1IHZA 2PW7A 5JVH3 1J8IA 5ELDA 1NCVA 1ZYRC 2B39A 4X3KA 3EJIA 3PUYA 2PZUA 2AWNA 4KKTA 1DOMA 5KGUA 2FMCA 1G2SA 1G8ZD 4JBWA 5M3FB 3R8BA 1I4PA 3NK9A 3RMHA 3T16A 5I9PA 2F0WA 4KHZA 3LNNA 2PZTA 1LT3D 2IL8A 2DN8A 2K7VA 1V1PA 1E2ZA 3FVQA 2QF7A 1B44D 3WOFA 1SNCA 4DAVA 3RLFA 2B63B 2F0JA 3V05A 2G9HD 4FXKC 3U9SA 4DF7A 3DUZA 3AU7A 4J6HA 4IUPA 3HOVB 4FF4A 1SJHD 2FJ2A 4QB4A 2SDFA 3D6WA 3S17B 1CA6A 1BCPB 3VR5A 3PIP3 1QILA 2B2YA 1QJOA 1QNKA 3HP3A 3KLSX 2B2TA 4C1NI 1Q1BA 2A68C 2EDGA 4ULLA 1T5EA 1TS3A 5I9OA 5T1GA 4LMQD 5E4WC 2IT1A 4G4KA 1ILPA 2CVRA 1Z7TA 3G7LA 5EJWA 3EVQA 3VR6A 1JOOA 2YU9B 2R7ZB 3MXUA 5C4HA 2R61A 1F9RA 1I4GA 1HA5A 2Q8TA 1SDFA 2MP1A 1KAAA 1OO9B 1STAA 4H44C 2RBMA 1CQFA 3KLRA 3V96A 3LWEA 1M4VA 5C4JB 1QNUA 4RGTA 1MD2D 4ODGA 3RUZA 3TP6A 1HQMC 1BO0A 4RHSA 2F0SA 4TRDA 1BCPF 5EKIA 3CRKC 4CJ0B 5I2YA 3A8KE 3RZDB 1I6HB 1E0BA 3NWSA 5JOBA 4RGNA 2ENBA 2NWGA 2MPMA 1LABA 2F0OA 4U68A 1JC7A 1HQRD 1M8AA 1TWAB 5LL6S 4H13C 2M00A 3T51B 1DYQA 3A56A 4RFBA 1QE6A 3G6JB 5TSSA 2L55A 2F0HA 2I46A 2O5JC 3KF8A 2ICIA 5AFWA 4CJ1B 4F88A 3I4MB 2Y0SB 2FFKB 4A3EB 3HG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICW A;  1NCV A;  5D65 A;  5EPK A;  4MN3 A;  1U4P A;  2RVL A;  3KBX A;  2MGS A;  3R93 A;  1O7Z A;  2DY8 A;  1XYI A;  1F9R A;  1QG7 A;  2HCC A;  4X3K A;  4OIJ A;  1B4O A;  1MSH A;  1G2T A;  1IL8 A;  1ROD A;  2EPB A;  3QO2 A;  1B50 A;  4IUT A;  5CBA E;  2MJ8 A;  4IUV A;  1GUW A;  4QUF A;  2Q8T A;  1PFN A;  2B2W A;  4RAU C;  1DOM A;  3IL8 A;  5T1I A;  1SDF A;  4R9W A;  2K05 A;  4QUC A;  1EIG A;  2B2Y C;  2MP1 A;  1RTO A;  4RWS C;  1F9S A;  2NZ1 D;  1G2S A;  2B2T C;  4XDX A;  1MGS A;  1RHP A;  2X6L A;  2KEE A;  1VMC A;  3KUP A;  4RA8 A;  1BF4 A;  2M2L A;  1CM9 A;  3LWE A;  2L12 A;  1IKM A;  1A15 A;  2HDM A;  2L1B A;  1U4L A;  2HDL A;  1JIC A;  4IUR A;  1RTN A;  1DZ1 A;  1PDQ A;  5CMD A;  1XX8 A;  1WTQ A;  5JJZ A;  4MHE A;  1SSO A;  2KEC A;  1VMP A;  3TN2 A;  1G91 A;  1RJT A;  2K03 A;  2RSO A;  2JYO A;  5COY A;  2IL8 A;  1AP0 A;  4ZAI A;  1HFG A;  3P7J A;  4HAE A;  2VXW A;  1BO0 A;  3FDT A;  4X3T A;  4IUU A;  2L4N A;  2KED A;  1B3A A;  2K01 A;  2NYZ D;  1X3P A;  2KVM A;  3FPU B;  5EKI A;  2B2U C;  1JE4 A;  3TZD A;  4ZKB B;  1F2L A;  2HUG A;  1EIH A;  1SAP A;  4R8I A;  1HA6 A;  1ZXT A;  2FIN B;  3I91 A;  1NR4 A;  5EPL A;  2JP1 A;  3I3C A;  5EQ0 A;  4CJ0 B;  3SVM A;  2HCI A;  1AZQ A;  1ESR A;  2B2W C;  1B53 A;  1E0B A;  5COR A;  2EE1 A;  2KUM A;  4X3U A;  1ML0 D;  2L11 A;  3DEP A;  1WVL A;  1IKL A;  1KNE A;  1X3Q A;  1PFM A;  3F2U A;  1PLF A;  1DOL A;  2NWG A;  1WTP A;  1EL0 A;  1NAP A;  2MPM A;  2K04 A;  1MSG A;  1HRJ A;  1Q3L A;  2B2V A;  3I8Z A;  4U68 A;  1WTR A;  1HUM A;  4X3S A;  1PFB A;  1AZP A;  2EOT A;  2RSN A;  3I90 A;  3UI2 A;  4CJ2 C;  1G6Z A;  4O42 A;  4IUP A;  1DON A;  1WTW A;  2H1E A;  1ILQ A;  1NR2 A;  3IFD A;  2N88 A;  4HED A;  1M8A A;  1BBX C;  2J7Z A;  4ZLT F;  1U4R A;  2FHT A;  2FJ2 A;  2KOL A;  1WD0 A;  1HUN A;  2SDF A;  2Q8R E;  3D6W A;  2D9U A;  5EPJ A;  1X32 A;  4DN4 M;  5CBE E;  1CA5 A;  1HFN A;  1CA6 A;  2K1B A;  2R3Z A;  4HSV A;  1WTO A;  3Q6S A;  4HCS A;  2N55 A;  1EOT A;  4XT1 B;  2B2Y A;  1WTV A;  3ONA B;  2B2U A;  1QNK A;  1F9P A;  2X69 A;  1QE6 A;  2XIW A;  3GV6 A;  3HP3 A;  4XT3 B;  4ZK9 B;  3H91 A;  5E4X A;  2B2T A;  4ZKC B;  5D14 A;  3DM1 A;  3N52 A;  1HHV A;  1F9Q A;  1KNA A;  1BNZ A;  1S4Z A;  2DY7 A;  2RA4 A;  4UAI A;  1LV9 A;  5AFW A;  3MWY W;  4CJ1 B;  2K28 A;  1B2T A;  1TVX A;  3GV3 A;  1J9O A;  5DNF A;  5T1G A;  4LMQ D;  2L9H A;  4IUQ A;  5E4W C;  4OIK A;  1O7Y A;  1C8C A;  4NW2 A;  2X6G A;  1EQT A;  1ILP A;  1MI2 A;  2FFK B;  2CVR A;  3G7L A;  5EJW A;  1O80 A;  1DOK A;  2B2V C;  1U4M A;  2BDN A;  3MTS A;  1WD1 A;  1J8I A;  3DEO A;  1WTX A;  2FMM A; 
#chains in the Genus database with same CATH topology
 3EBE A;  4KTA A;  4A93 H;  3KBX A;  4JI7 Q;  4HN7 A;  1FL0 A;  3CMA A;  2SEB D;  4Q0F A;  5CR3 A;  1BKB A;  4QUF A;  2EXD A;  4KKS A;  3SK6 A;  2ZJQ A;  5EAY A;  5IYC H;  4O0A A;  2MHV A;  1FNW A;  2NZ1 D;  1O7I A;  4C2M H;  1EWI A;  5M5Y H;  3F2C A;  3QIA A;  1CM9 A;  2QKI C;  3H3V H;  1TWH H;  2M9V A;  3VYS A;  1W6J A;  1VQA A;  3KLS A;  5IGG A;  1QB5 D;  5BN3 A;  3EIV A;  3QJY A;  3HOV G;  4AQY Q;  4K2K A;  1LUZ A;  3P7J A;  3H94 A;  3KF8 B;  3T1H Q;  3HOY H;  3NEN A;  3WDN A;  4A3L H;  1JE4 A;  3SEB A;  4K5V A;  3CKI B;  4J15 A;  4B3S Q;  1NR4 A;  2IW3 A;  1U0L A;  3GTG B;  4KK7 A;  2WIN B;  3J7A V;  4H7B A;  2LKV A;  2UXB L;  3I2Z A;  5K5P A;  3HS0 C;  2EJF C;  3OIQ A;  3SGI A;  3CCQ A;  1EY0 A;  1WTH A;  1HZC A;  3J80 i;  5JVG 3;  2EOT A;  4IPC A;  3MFY A;  4YHH L;  3ULP A;  4BY7 H;  2E5L L;  2F0Q A;  1NR2 A;  2Q8I B;  1U4R A;  2QEX A;  4DV6 L;  1TWF B;  2R7Z G;  3K5M A;  1AE3 A;  1EFI D;  1CA5 A;  4DNR B;  1HTP A;  4ME5 A;  1SYC A;  3UDG A;  2JA8 H;  1EEI D;  2LXJ A;  4G7Z C;  4BY1 B;  1STH A;  4PNY A;  5EBC A;  1GUN A;  4O2D A;  4CGY B;  2WKC A;  4G7H C;  4IFD G;  3GTK B;  2BE5 C;  3UDX A;  3ERO A;  4OIK A;  2XWB B;  1NY4 A;  1K0S A;  4EQP A;  1U9R A;  1KAW A;  2SNM A;  5C4Z A;  2B2V C;  1HJP A;  3MTS A;  3BDO A;  5I4D A;  4FF1 A;  5LMN L;  2F4V L;  3M3Y H;  4A3F H;  2RF4 A;  1U4P A;  4A3I B;  1O7Z A;  1UE1 A;  5BN4 A;  1Z47 A;  1RIP A;  3K59 A;  4KI0 A;  1GD7 A;  3K80 C;  1HZB A;  4LJZ C;  1PRT D;  3KLW A;  3C1E A;  4YY3 Q;  4J1M A;  5KNB A;  3D31 A;  1B1Z A;  4JVZ A;  5LL6 X;  1S5B D;  3M85 A;  1N33 Q;  2M2L A;  2F0D A;  4HJ8 A;  2NBF A;  3P1H A;  2EVB A;  1C4Q A;  4ZUI A;  3ICE A;  3F1Z A;  2HDM A;  4DFA A;  2DNE A;  5FOB B;  3F2D A;  2L15 A;  4K8J A;  3CU7 A;  1PTO H;  4B9X A;  2WP8 J;  3WOE A;  2E75 C;  3CAM A;  3HGB A;  4GS3 A;  1K0R A;  3M7N A;  5KYL A;  1AP0 A;  1SRO A;  4K8I A;  4JI2 L;  1B70 B;  4KMU C;  1EWC A;  2WAQ G;  3FDT A;  3GQB A;  3OMG A;  4JI0 Q;  1OXX K;  4YCW A;  5I6Y A;  2KVM A;  5FLM H;  2B2U C;  5IWA L;  3D8G A;  1S5E D;  4LF7 Q;  3S1R B;  1TQO A;  1VCI A;  1ZXT A;  2QA4 A;  2HCI A;  3JC6 6;  5C0X J;  2HQE A;  1OTC A;  2NTS A;  3KBG A;  1YEZ A;  2LFN A;  1LAC A;  3I4M G;  2Y0S G;  1MSG A;  2Q2U A;  1EOV A;  3I8Z A;  4E6I A;  1WTR A;  4NXN L;  2JA5 H;  5IOD A;  1BCP C;  4K6D A;  5EBD A;  5KEE A;  4A3G H;  4UP7 A;  2H1E A;  2HIX A;  4V19 0;  3S14 B;  2I07 B;  5C0X I;  2K33 A;  4JI5 Q;  4C2M B;  5M5Y B;  4P72 A;  4RCO A;  5D3D A;  3HRZ C;  2RHQ B;  3Q6S A;  1CZW A;  4XT1 B;  1TY2 A;  4B9W A;  2ZTD A;  4Y7N H;  1KIX A;  3P20 A;  3MXG A;  3ULJ A;  2DNC A;  4IUN A;  4BWG B;  1Y8P B;  1PZK D;  1Q8I A;  3S1Q H;  2OWO A;  5C5M A;  5GAD C;  4HCE A;  4PMB A;  1UUP A;  2PPB C;  3HOY B;  2VUM B;  5D3I B;  4DA2 A;  1IW7 D;  5FJ8 H;  2O5I C;  4DR6 L;  1A63 A;  4L5S A;  5K36 H;  3VDY A;  3HOZ B;  3Q23 A;  1J6Q A;  1B8A A;  5FLX c;  4JBM A;  4ZQ3 A;  1E7Z A;  3AFQ A;  2GN5 A;  1HTL D;  3PO2 B;  4KN7 C;  2KHJ A;  1B4O A;  1X56 A;  1IBM L;  2JQO A;  1ROD A;  2KBN A;  4IUV A;  3CCE A;  3IL8 A;  4GN5 A;  1PRT B;  2B2Y C;  4GLA C;  3UE0 A;  1RTO A;  2B2T C;  3L0O A;  4HIM A;  4LF9 Q;  1TS4 A;  4NP5 A;  1XTC D;  4RA8 A;  4QGU A;  3A55 A;  4ABN A;  2L12 A;  4B3T Q;  4JI8 Q;  2JA9 A;  3X3M A;  1SSO A;  3TP5 A;  1VMP A;  1YJW A;  3W1B A;  2UXD L;  2MO0 A;  5IT9 c;  4OWT B;  2JE6 I;  2UUB L;  5IIF A;  3I55 A;  5KRU A;  2KED A;  4LF5 Q;  3SXH A;  1R4P B;  2K5H A;  2V4D A;  3TSS A;  3GTO B;  1PFS A;  3FKI B;  5BR8 L;  1F2L A;  1VF5 C;  3TBI B;  3I91 A;  2ZTC A;  2EYO A;  5IP7 G;  4KJO A;  3A5Z B;  4Z9C B;  2IX0 A;  1TS2 A;  5CV5 A;  4HJ7 A;  1LTB D;  1SE8 A;  4BY1 G;  1X3Q A;  3S2H H;  3F2U A;  2ZXR A;  2K75 A;  2IX3 A;  4XYQ A;  1QCB D;  1NAP A;  2PYK A;  2NN6 H;  1A3U A;  1Q81 C;  1HUM A;  1TY0 A;  1YNN D;  1PH7 A;  5CGK A;  3IRB A;  2EYL A;  1WOC A;  3J81 L;  3OIP A;  2OXP A;  5J22 A;  2KOL A;  4LFA L;  1K8O A;  2F0E A;  2AUK A;  2I5H A;  1E2W A;  4A3I G;  3CC7 A;  4DK6 C;  4A3M H;  3ONA B;  5JEA G;  2X69 A;  1EU3 A;  4K14 A;  3OMC A;  1K83 B;  1PTO B;  2WII B;  1PRT F;  2VQF Q;  3CD6 A;  4G7O C;  4DR7 Q;  5C6A A;  2EY5 A;  4HIK A;  2C5C A;  1MBY A;  1AH9 A;  2F0V A;  4DKA C;  4I7Z C;  2EZV A;  1O7Y A;  2Q2I A;  2QDB A;  2XTI A;  1L0W A;  2XN9 C;  4DXF A;  5JJI A;  2FMM A;  2L5T A;  4N8X 1;  1A3T A;  1H9M A;  2RVL A;  4GOP B;  1XNR Q;  1PH4 A;  2E2J B;  4A76 A;  3BU2 A;  4AH6 A;  1EY6 A;  3S9W A;  1D7Q A;  2AHO B;  5T1I A;  1K8G A;  1QZH A;  1STG A;  3QWN A;  2Z6K A;  1Y1V H;  4OEM B;  2K5W A;  4LWC A;  4KJN A;  1NBW A;  2OEO A;  4B3M L;  1RD9 D;  2EJM A;  1AW7 A;  1DCZ A;  2K5D A;  2VW9 A;  2KCN A;  4JV5 Q;  1P8L A;  3K7A H;  3C3L A;  1D2B A;  3HOU H;  4N9P A;  2EYF A;  5FKA C;  1JIC A;  4J8Q A;  4Y7N B;  4LF4 L;  4OX9 Q;  3TZU A;  1QWY A;  1SND A;  4DV7 L;  4X62 Q;  1MIU A;  4JI4 Q;  1FD7 D;  3SHL A;  4AIM A;  1Q46 A;  5C5L A;  5IYC G;  2XSC A;  2YV5 A;  3PIP A;  2UUC L;  4Y52 H;  2NVX B;  4CDF C;  3Q0A A;  3SDZ A;  3NTK A;  2LSS A;  5G3L D;  4DR3 Q;  4KD3 A;  2FIN B;  3SVM A;  2BA1 A;  2AMC B;  1AZQ A;  4QQB X;  3GTJ B;  1PTO F;  5A2Q L;  1EQQ A;  4JPB W;  4A4I A;  4FXG C;  2N3S A;  2L11 A;  4DAY A;  4TQU S;  1WVL A;  3C2P A;  1RDP D;  1CHQ D;  4LFC L;  4L8J A;  3HOY G;  2VUM G;  3R2T A;  1SMY C;  4KHP L;  1MJE A;  2VQE L;  5F2D A;  1Q86 C;  1I4Q A;  1QUQ B;  4A3L G;  4O42 A;  3PUZ A;  4DV2 L;  1IYU A;  4B3R L;  3RLO A;  2F3I A;  3CQZ B;  4QCL A;  5IP9 H;  3MHB A;  1HPC A;  5C0X H;  5CBE E;  1UE5 A;  3BYY B;  2K1B A;  4L5R C;  2Z4H A;  4HSV A;  3J81 E;  4OO1 I;  1A8V A;  1WTO A;  3T53 B;  1ET9 A;  3A8I E;  1YI2 A;  2XIW A;  1DM0 B;  3S1N B;  4C3I H;  3GTP H;  1STE A;  2Q2T A;  1KNA A;  2EJG C;  4LUV A;  4UAI A;  2D62 A;  4O1N A;  1J9O A;  2QGQ A;  4JI7 L;  5HY6 A;  4BXX H;  3DHQ A;  1EY5 A;  1NUC A;  2ZXP A;  3JAM L;  1LM0 A;  1MI2 A;  1CUK A;  3L7Z C;  1VQF A;  4YWM A;  1JOQ A;  1SJE D;  2EY2 A;  3ZYY X;  4JC0 A;  2F0N A;  4DAY B;  2NZO A;  2DGY A;  4MN3 A;  2NVQ H;  3S2H B;  4HR7 B;  4X65 Q;  1PH5 A;  3BVM A;  3I4L A;  3QO2 A;  1G2T A;  1GUO A;  1TWG H;  3FKI G;  4P71 A;  1PH3 A;  1D5Z C;  3VA5 A;  1TWC H;  1V1P B;  2MNA A;  1PH9 A;  4XDX A;  3BDC A;  4DPG A;  4AQY L;  2PNR C;  1KDA A;  4QY7 A;  1N32 Q;  1PH2 A;  2OF1 A;  5IYB H;  1RTN A;  4F87 A;  3MA2 B;  3K7U C;  1N8R C;  2R92 H;  1OXU A;  4DUY Q;  4B3S L;  4GNX A;  2K5N A;  3TQY A;  3BJU A;  1K73 C;  5ELE A;  3QOL A;  3AMU A;  1IBK Q;  2CQO A;  2WB1 B;  4X3T A;  4G57 A;  1I3Q H;  1Q1E A;  5DLQ E;  3NHH A;  5J1Z A;  1SFO H;  1YVC A;  1X3P A;  1A2T A;  3GD7 A;  2Z1C A;  3EA6 A;  2NVT B;  2JEA I;  3NE5 B;  2JP1 A;  3I3C A;  5JPN C;  1EYC A;  3K5L A;  3BYT B;  1YJN A;  1ESR A;  4FNF A;  1B53 A;  2NVY H;  1V43 A;  2XRS D;  5GAE C;  3DM3 A;  1BUV T;  4C3H H;  4KY6 A;  3CCR A;  1PFM A;  5IOC A;  3L3O C;  1DOL A;  3KDF A;  1D5M C;  3I73 A;  5A2Q E;  4QIW E;  4A3B B;  1BDO A;  3UI2 A;  2E74 C;  1YNX A;  3A7A B;  1ZEQ X;  1SYG A;  3A8J E;  5H1S E;  1Y1V B;  2J7Z A;  4QIW B;  2R93 B;  1G6P A;  4A75 A;  4Q5V A;  2E2H H;  3K7A B;  5CV9 A;  3HOU B;  4GLV B;  5HGQ A;  1VF7 A;  3VYU A;  1SE2 A;  4XT3 B;  1STB A;  4DV5 Q;  1Q8K A;  3TRZ A;  2Q2H A;  1S5C D;  3U4Z A;  3MZ5 A;  4GNX B;  1PZI D;  1NMF A;  1S4Z A;  4YWL A;  1LT6 D;  3T1Y Q;  2WAQ E;  4PMW A;  1B2T A;  3GV3 A;  1JB7 A;  2RDF A;  5CV7 A;  3K5O A;  1BVS A;  1EQT A;  2WAC A;  3K0Y A;  2WAQ B;  1XMO Q;  1XXG A;  1SMY D;  1GHJ A;  4DUZ Q;  3OPO A;  3LX0 A;  4ILW A;  1AEX A;  3A0J A;  1PRT C;  4YY3 L;  2HIV A;  4UDU C;  1KD1 C;  4DGZ A;  1JCK B;  3W2D A;  3RLN A;  4HJA A;  3S16 H;  2XWJ B;  1FJG Q;  1N33 L;  1PXU A;  5G3L F;  5FJ8 G;  5E1F A;  4OEL B;  5JJK A;  3ITP A;  2J0T D;  3QR8 A;  5K36 G;  3NP8 A;  2NTT A;  4LF8 Q;  3TS2 A;  3TS0 A;  1SXT A;  3HEJ A;  4OL7 A;  2LS0 1;  1KAB A;  4JI0 L;  3HKS A;  5FK9 C;  1VQ7 A;  1X6O A;  2AWO A;  1VQL A;  2E2I H;  3RD4 A;  1WTQ A;  2AKW B;  3C46 A;  4LF7 L;  5M5X B;  2JEB I;  1JQY D;  4HTH A;  3TN2 A;  3EFX D;  2H4O A;  5ELC A;  4PG3 A;  3GTP B;  5FO7 B;  4ZAI A;  3VR2 A;  4KY7 A;  1EY7 A;  1TKW B;  3MXP A;  1X55 A;  4DR4 Q;  4GKJ Q;  3CF5 A;  3W1G A;  2OCE A;  2JSO A;  3PIO 3;  1LTT D;  1SAP A;  1VQO A;  1LYL A;  2SNS A;  4QMG A;  3NSW A;  1S5D D;  2A73 B;  1JE5 A;  4DK0 A;  5M3M H;  1PLF A;  1F2M A;  2F0U A;  4JI5 L;  1EEF D;  3PGZ A;  4CKB A;  1LT5 D;  3DWQ A;  1TWG B;  4CJ2 C;  4JK1 C;  2QIL A;  2ID0 A;  1TWC B;  3GDE A;  4LF6 Q;  1F77 A;  1W6K A;  1PTO C;  1IXR A;  4KKU A;  3OWF A;  3RR5 A;  1KLG D;  2BA0 A;  1IL2 A;  2I5L X;  3KFU A;  1EYA A;  3H0G H;  1TR5 A;  2N55 A;  1EOT A;  1OXS C;  4YCV A;  1HR0 W;  4OO1 H;  1IW7 C;  2E2D C;  2G5D A;  3OYY A;  4ZK9 B;  2HD3 A;  3GTL H;  4OHJ A;  4L63 B;  4N9T A;  2UXC Q;  2NN6 I;  3C1F A;  2RA4 A;  1AFP A;  4LAA A;  1ENC A;  5DNF A;  4OWX B;  4GOP C;  4F8M A;  2F0T A;  2V1C C;  1ASY A;  4A3M G;  4PZ6 A;  1LTG D;  1SR3 A;  4XQN A;  1SYB A;  2F0L A;  3RZO B;  3X3N A;  2NVY B;  1EQR A;  1ICW A;  5D65 A;  2WB1 G;  3GTQ H;  2F0M A;  1IL8 A;  1K8M A;  3HOW B;  3RNU A;  4HID A;  1GUW A;  3OTO Q;  4JI8 L;  5JJL A;  4C1N K;  5C44 H;  1S72 A;  1CSP A;  3L9A X;  4IFD J;  5CC4 A;  3MVV A;  4KY5 A;  4JI6 Q;  2VY3 A;  2J4X A;  4GKK L;  3H09 A;  3K81 C;  2B8G A;  3PCO B;  4LF5 L;  1Y14 B;  1DZ1 A;  4A3B G;  2A6H D;  1XX8 A;  5JJZ A;  2AUJ D;  2K6A A;  2PCF B;  3S1M B;  1G29 1;  3M4O H;  1Y1V G;  4B08 A;  1LLR D;  2VXW A;  4DV3 L;  3WWV A;  2R93 G;  2EYP A;  2JXM B;  5KND A;  1MKH A;  1UEB A;  4OXP A;  5KYI A;  1UE6 A;  4R4T A;  1XPU A;  3HOU G;  3GTM H;  3J80 L;  3TRE A;  1YNN C;  3MXN A;  2KUM A;  5J3B A;  2Z6K C;  3SE0 A;  1HZA A;  1WCM H;  5E7N A;  3ND9 A;  3S16 B;  1EUJ A;  4IZ8 A;  3M4Y A;  2RSN A;  5DAU A;  5FO8 B;  1N34 Q;  3G48 A;  3IFD A;  1JJG A;  2XVS A;  2N88 A;  2FHT A;  4XYO A;  3I7F A;  2VQF L;  1NE3 A;  1R9T B;  4DR7 L;  4XQJ A;  2R3Z A;  1EIF A;  2E8G A;  4HCS A;  5M9O A;  4DV1 Q;  2NB0 A;  4PZ8 A;  5LMN W;  1E22 A;  2QEJ C;  4A93 B;  4R8N A;  4FP5 D;  1XPR A;  2DY7 A;  1LV9 A;  2OQ0 A;  1Z9F A;  2F52 A;  2Z9H A;  2RHS B;  2PW5 A;  1E24 A;  1XNR L;  1AN8 A;  4JCV E;  2X6G A;  3SK8 A;  1NTG A;  4RGO S;  2N8N A;  3I70 A;  1U4M A;  3NTI A;  4I7A A;  1YNJ D;  2KEE A;  4C3I G;  4GN4 B;  4LNQ A;  2D5D A;  1TWH B;  2CWP A;  5CV4 A;  4BA2 I;  1XYI A;  2CH4 W;  5CV6 A;  2HCC A;  1MSH A;  2JK8 A;  4JV5 L;  1PTO D;  5CBA E;  4DN4 M;  1Y8O B;  3K6O A;  3PF5 A;  1Z6H A;  4OX9 L;  4X62 L;  3E3X A;  5BN5 A;  4JI4 L;  2G9D A;  1MGS A;  3OWE B;  2K52 A;  1JOK A;  1VMC A;  1ET6 A;  2Z0S A;  1UEA B;  2EXZ A;  1A15 A;  4DR5 Q;  3D4D A;  5EKK A;  3CW2 C;  1E2V A;  4DR3 L;  1ENA A;  2C9O A;  2DJF C;  5COY A;  4JBK A;  3OW2 A;  4WRD A;  2JJQ A;  2A69 D;  1SE3 A;  3DXJ C;  3E9I A;  4IUU A;  1GKH A;  4NMZ A;  1SNO A;  3BVG A;  3NBI A;  1VQJ A;  1GM5 A;  4RG1 A;  3SK4 A;  3K0X A;  2BCO A;  2CQA A;  2HUG A;  3CPF A;  4OWW B;  4JYA Q;  5M3F H;  4BY7 B;  1HA6 A;  3T13 A;  4CKE A;  5M5W H;  2XNA C;  1RF2 D;  2F3W A;  4QL5 A;  5IYB G;  1E1T A;  2R92 G;  4CDE C;  1XPO A;  4TSS A;  4K2L A;  1BXT A;  3J80 E;  2PI2 A;  1LTA D;  1CKN A;  2JA8 B;  1PYB A;  3TDQ A;  3D4W A;  1AZP A;  4DAP A;  4RHR A;  1GOZ A;  2EYM A;  4DNT B;  5ELN A;  1OXV A;  4POF A;  3G4S A;  3K57 A;  2B63 H;  1B9M A;  4A3K H;  4ZRZ A;  2R7D A;  4GNX C;  2VB3 X;  4EQN A;  3IAY A;  3VYR A;  4WOR A;  3M4P A;  1JWS D;  4C3H G;  2QDL A;  4A3C H;  3S24 A;  3HOW G;  5HGT A;  2C35 B;  3M3Y B;  4A3F B;  4X6A H;  1SYF A;  1ESF A;  3DM1 A;  1K3B C;  3PUW A;  2UUA Q;  1YIT A;  2OT2 A;  3HOV H;  1HNW Q;  4KV6 A;  4MIU A;  5LMN Q;  1HXY D;  4C3J H;  1Q7Y C;  1ONL A;  2HQL A;  1H9R A;  1IYV A;  4X65 L;  4NDX A;  3CCS A;  2BDO A;  1SRU A;  1KDC A;  1II3 A;  4F7X A;  1A3V A;  1VQC A;  4XXE A;  1C48 A;  1XMQ Q;  2K5Q A;  2MGS A;  2ES2 A;  4XIG S;  4DV0 Q;  3H15 A;  1B50 A;  4WFN 3;  1CKN B;  5JEA J;  1N32 L;  2MJ8 A;  1Q12 A;  1PYW D;  4LUO A;  4R9W A;  3HKZ B;  4EVO A;  2YTV A;  4IJL A;  4BBS H;  2B8F A;  3OOC A;  3KYH C;  4DUY L;  3S2D H;  1RHP A;  1EQV A;  2NUC A;  1IBK L;  3DMU A;  2H5X A;  1DD2 A;  3IFT A;  1GUS A;  4JI1 Q;  2AQ3 B;  4NKL A;  1FGB D;  1T5X D;  2KEC A;  1G91 A;  1EZ6 A;  2K03 A;  2N49 A;  4YIJ A;  3TME A;  2O4X A;  3FPP A;  1HCZ A;  3TEH B;  4UY8 C;  1STN A;  2L4N A;  2JA5 B;  4LUZ A;  3VR4 A;  1LTL A;  1B3A A;  4A3G B;  4RMF A;  4UP8 A;  1C0A A;  3O13 A;  4P75 A;  2CCZ A;  1EIH A;  4JOI C;  5EQ0 A;  3E0E A;  1A2U A;  3P75 A;  3F8T A;  4A93 G;  2EE1 A;  4CBV A;  1KC8 C;  1I4H A;  3NPP A;  1GXD C;  1IKL A;  1Q90 A;  3BZD B;  3W3A A;  4K0K Q;  4IO9 A;  3S1Q B;  1EYG A;  2ZM6 Q;  3SR1 A;  1CQV A;  4ZYS A;  1ILQ A;  3MC0 B;  3S15 H;  4DV5 L;  1JJC B;  4DR2 Q;  3R2I A;  1WD0 A;  3RZD H;  1I6H H;  3URY A;  3T1Y L;  5M3M G;  1UAP A;  3B6Y A;  1GUG A;  2KQ3 A;  2B2U A;  4RKL A;  2R6G A;  5E4X A;  4IPD A;  1XMO L;  4K5X A;  4DUZ L;  3PQI A;  5CYU A;  2K28 A;  2LMC B;  4DAM A;  1TWA H;  3FHW A;  2RCF A;  1MHW C;  1QVC A;  3H0G G;  2F0G A;  2XRQ D;  4OO1 G;  4FF2 A;  1FJG L;  5IGD A;  5M5W B;  1WD1 A;  3D0F A;  3VR3 A;  3PO3 H;  4IUR A;  1VQD A;  3R93 A;  1GHK A;  2A5H A;  1SNQ A;  3U9O A;  3DWA A;  4KN4 C;  1FYC A;  4HIO A;  4LF8 L;  5C3W A;  2PMZ B;  3I4M H;  3L2P A;  2B2W A;  1W2B A;  4BY7 G;  3MAQ A;  3D4R A;  2K05 A;  4EQ5 A;  1KLU D;  5DM7 3;  4LFB L;  1EYD A;  1C9O A;  2IY5 B;  3NWT A;  3HOX H;  2VS1 A;  1PH1 A;  4A3E H;  1K3R A;  1SMX A;  5IGB A;  4A3K B;  1YHA A;  5JAV A;  1BF4 A;  3KUP A;  1NJI C;  1FR3 A;  1BR9 A;  4DR4 L;  3NTH A;  2JA8 G;  4GKJ L;  2VL6 A;  1JWM D;  2O2L D;  3QB3 A;  4HJ5 A;  1VQE A;  3FMC A;  1K28 A;  3CC4 A;  4RCN A;  1I4X A;  1HFG A;  2KA7 A;  3UDI A;  2PO4 A;  1LTS D;  5C44 G;  1HNX Q;  1NSN S;  4P74 A;  2K01 A;  4C3J B;  2QCP X;  3I4N H;  3PUV A;  3AQQ A;  4X66 Q;  1PZJ D;  1I50 H;  1DGS A;  1V1Q A;  1Y8N B;  4A3F G;  1QVF A;  4H0L C;  3T1H L;  4MNO A;  3J7Y W;  4A3M B;  3OSO A;  4LF6 L;  2WB1 E;  1P16 A;  4ZUJ A;  1H95 A;  1JWU D;  3E6Z X;  4R4I A;  1VQ4 A;  1SE4 A;  5IY0 A;  1J5E Q;  4APV A;  1PYS B;  4C56 C;  4L5Q A;  4BBS B;  5LMU Q;  2CW0 D;  2Q8R E;  2D9U A;  3S2D B;  2UXC L;  1X32 A;  3GTG H;  5CV8 A;  4L6T B;  1B9N A;  1WCM G;  3G71 A;  3J7A F;  4IN3 A;  1QVG A;  1XJV A;  1KRT A;  4ZKC B;  1EY8 A;  3VA7 A;  3HKZ G;  2AQ1 B;  3CCL A;  1V8Q A;  1BBU A;  4NPS A;  5FLX L;  3GO5 A;  5FLM G;  4EQO A;  1TT2 A;  2L9H A;  1IYJ B;  3AB9 A;  4IUQ A;  3H3V C;  1TWF H;  3F2B A;  1VQK A;  1LT4 D;  2ZT9 C;  3OTO L;  4GZY C;  2A6E D;  5IP7 H;  5JPM C;  1WJJ A;  3U4V A;  4CDD C;  1H9J A;  3CRL C;  3PIO A;  2JA5 G;  5DEH A;  4DK3 C;  4A3G G;  4JI6 L;  4NB3 A;  3D3R A;  4AYB B;  2KCC A;  1ZYR D;  4DV7 Q;  3S15 B;  2A6H C;  3QOJ A;  1I94 Q;  1D5X C;  4DV4 Q;  5IT9 L;  3BZC A;  1DXM A;  4KD4 A;  1FVI A;  1S5F D;  3MFG A;  4IQZ A;  2VZA A;  2KCT A;  3TP8 A;  4A3I H;  1U4L A;  3JAM E;  4CHT B;  3J7A 5;  2L0C A;  5JEA H;  5NUC A;  3KDF B;  4NXM Q;  4I65 A;  4PQX A;  1SBB B;  3LWU A;  3NBH A;  1BBW A;  4WJ3 M;  2TMP A;  3EQL C;  1WYD A;  1GJX A;  1A62 A;  1SYE A;  1VQG A;  1X65 A;  1IBL Q;  2NYZ D;  2WFW A;  1N36 Q;  1M1K C;  3A74 A;  1BOS A;  5LHY 1;  2SOB A;  1PVO A;  4X64 Q;  1CTM A;  2HHH Q;  5ELO A;  5C3X A;  2VQE Q;  1DJR D;  4DR1 Q;  4GLX A;  1YJ9 A;  3Q24 A;  1N34 L;  3PO3 B;  3KF6 A;  1KNE A;  2GA4 B;  3T4A C;  3W5O A;  1WTP A;  1L0X B;  1EL0 A;  1SNP A;  2K04 A;  2A8V A;  1HRJ A;  2LXK A;  4C3I B;  1PA6 A;  4HJ9 A;  2KEN A;  3STB D;  1G6Z A;  4DV1 L;  1ENF A;  4M8A A;  1SLJ A;  3HOX B;  3IKJ A;  4TKO B;  1Y1W H;  5EPJ A;  2Z4I A;  4XQQ A;  1HFN A;  1RKN A;  2HT1 A;  1O78 A;  2JA6 H;  1ASZ A;  1F9P A;  3A7L A;  3J81 c;  4IAL A;  4YWK A;  1EWH A;  2NVQ B;  1CKO A;  5D14 A;  3N52 A;  2F03 A;  1F9Q A;  1GO3 E;  1HHV A;  3NBH B;  4FVM A;  1YNJ C;  3K58 A;  3H6M A;  4DNI A;  4HMI A;  4JG2 A;  2B63 G;  1TVX A;  1I4R A;  4A3K G;  1UWV A;  4JI3 Q;  3S14 H;  1Y69 U;  3I4N B;  4NW2 A;  3I4O A;  4EGV A;  1L1O A;  3FEW X;  5FLX E;  1O80 A;  4A3C G;  1DOK A;  2A68 D;  1KXL A;  4IPH A;  2YYZ A;  1I50 B;  1WTX A;  3UDF A;  3KF6 B;  5EPK A;  2I0Q A;  3ND8 A;  2A74 C;  4KLK A;  2NN6 G;  1FNV A;  4C3J G;  4IUT A;  2R92 B;  1SN8 A;  2VUM H;  4ME3 A;  1PV4 A;  3AYH B;  2UU9 Q;  3LGJ A;  4DR5 L;  1H9S A;  4QUC A;  1EIG A;  4RKB A;  1VQ9 A;  1I3Q B;  1L2F A;  1SFO B;  1SNM A;  3HOZ H;  1G51 A;  2B3G A;  2PNH A;  2X6L A;  1LO5 D;  2GVA A;  2A69 C;  1L0Y B;  1R4Q B;  2L1B A;  2PZW A;  3PO2 H;  5IT9 E;  4OGQ C;  5ISR A;  4JYA L;  3E5S A;  4BBR H;  4C3H B;  2JYO A;  5AJ3 Q;  1JR0 D;  4LF9 L;  3PMF A;  4HAE A;  3G6E A;  4A3J H;  4BBS G;  2FXQ A;  1CKM A;  4LK1 C;  4B3T L;  2Z8L A;  3PUX A;  2ALY B;  2ZXO A;  4FF3 A;  3FPU B;  4HMJ A;  1HNZ Q;  3TZD A;  5KNC A;  1L1O B;  5EPL A;  1VQH A;  4PV1 C;  4UP9 A;  1EZ8 A;  1VDZ A;  3PSI A;  2KJX A;  1F2Y A;  4V0B A;  3ZJY C;  2IJ0 A;  5COR A;  4X3U A;  3ERQ A;  2E2H B;  1CHP D;  1SYD A;  3VYT A;  2XGT A;  1X9N A;  3KOJ A;  3MEH A;  1HH2 P;  4MTN A;  1TII D;  1Q3L A;  2MO1 A;  2KHI A;  1KDB A;  1EIY B;  3OHX C;  3GTO H;  3AEV A;  2K50 A;  1DON A;  1NNX A;  1H9S B;  3FKI H;  5IYD H;  5I6W A;  5C4X H;  4IFD I;  4ZLT F;  1RCV D;  1QZG A;  2EYH A;  2UUA L;  1HNW L;  2EYJ A;  1VQB A;  3N6R A;  3GV6 A;  5FO9 B;  4OON A;  3H91 A;  1RL2 A;  4AYB G;  5I2X A;  5EKL A;  3M7G A;  1MJC A;  2F3V A;  4ID6 A;  1XNQ Q;  1D6E C;  1XMQ L;  1XWE A;  1QOH A;  4DV0 L;  2EIF A;  5IGF A;  4A3D H;  4M1U B;  1EY9 A;  4BA1 I;  3DEO A;  2BOS A;  4IOA A;  2F0K A;  1A0I A;  1K83 H;  3Q22 A;  2DY8 A;  3BDL A;  1QG7 A;  2E2I B;  3Q8D A;  2RQX A;  3JAM c;  2EPB A;  4HSP A;  2OTL A;  2ZTE A;  2IX1 A;  1LTI D;  3FRP B;  1PFN A;  4RAU C;  1HR0 Q;  1EFW A;  2WKD A;  4JI1 L;  2D0P A;  5IP9 G;  4K6L A;  5J39 A;  2F4I A;  1GUT A;  5C0X G;  1TS5 A;  4RWS C;  1EU4 A;  5C3E H;  5E3F A;  3UE1 A;  3PO3 G;  3A54 A;  1YBY A;  3HZX A;  4BS9 A;  1Y1W B;  3NEM A;  2LY7 A;  1PH8 A;  1IKM A;  2IHF A;  3MXN B;  1VQ5 A;  4H02 A;  2E2J H;  3K5N A;  5CMD A;  2JA6 B;  1HZ9 A;  2JA7 H;  4MHE A;  1X3G A;  1F2Z A;  2RSO A;  5M3M B;  4R4C A;  3HOX G;  4BXX G;  1GVP A;  4A3E G;  1UE7 A;  4RGM A;  5IGC A;  4MTK A;  1LTR D;  4ZKB B;  4K0K L;  2K32 A;  4R8I A;  2AQ2 B;  4CKC A;  2E76 C;  2MFI A;  2Z6B A;  3I72 A;  2TSS A;  2F1M A;  2CHB D;  2B2W C;  2ZM6 L;  2F0F A;  1ML0 D;  1BQQ T;  3CXC A;  3H0G B;  4GN3 B;  4DR2 L;  2KHS A;  3CCJ A;  5EGT A;  5GRO A;  3GTL B;  4PMC A;  4X3S A;  2NVX H;  3I4N G;  2WV6 D;  3I90 A;  2A1A A;  2YTX A;  4IOC A;  1X3F A;  2UXB Q;  1SEB D;  2CH4 A;  1PMR A;  1BBX C;  4CDC C;  1I6V C;  3GTJ H;  3KJO A;  1ICF B;  1CT1 D;  1XTD A;  1VQM A;  1CFM A;  3BG3 A;  3EN2 A;  2IWH A;  4K5W A;  1WTV A;  4YHH Q;  2CWA A;  4WJ4 A;  3MEF A;  2R7F A;  3J81 i;  2E5L Q;  1JJ2 A;  3J7Z C;  3CCV A;  1CSQ A;  4DV6 Q;  4BBR B;  1KL9 A;  3DWP A;  3GTQ B;  1CK1 A;  3ERS X;  1FNU A;  4FXD A;  4A3J B;  3CQZ H;  3PV0 A;  5A35 A;  2D2C C;  5DM6 3;  1JMC A;  1STY A;  1C8C A;  1A6X A;  3ULL A;  1KRS A;  5C44 B;  1V1O A;  1H9K A;  4WJW A;  1ZKO A;  2BDN A;  2IPK D;  2QW7 A;  5HUR A;  1V9P A;  4DU9 A;  5ELB A;  2ICE C;  3R3O A;  3S1N H;  2BE5 D;  3NXW A;  5GQO A;  2ZJR A;  4FYD A;  4OIJ A;  1S40 A;  2A19 A;  4R1J A;  1PHJ A;  3U50 C;  2EY6 A;  3V2T A;  4GKK Q;  3E0J A;  3M4O B;  2RKS A;  1K8A C;  2F4V Q;  2CKZ B;  4UPA A;  3BVZ A;  2MUY A;  1F9S A;  1KTK A;  3NQT A;  5KIX A;  3S17 H;  3GP7 A;  5C4X B;  2ATW A;  2BH2 A;  2YTY A;  3KK7 A;  4IPG A;  4DV3 Q;  3TP7 A;  1HNX L;  2PI2 E;  3GTM B;  4GOP A;  2HDL A;  3RN5 A;  1D1K A;  1PDQ A;  2F0P A;  3HKZ E;  1RJT A;  2EY1 A;  1CZG A;  4X66 L;  3K8A A;  1WCM B;  3OW7 A;  5IGE A;  4QF4 A;  1YHB A;  2RCN A;  3T56 B;  3BS1 A;  4P73 A;  3CME A;  1AE2 A;  3NQI A;  2PQE A;  3CHB D;  1N9W A;  4ALP A;  1J5E L;  1TU2 B;  4RH6 A;  1JOR A;  1OXT A;  3SK5 A;  4JI2 Q;  2YU9 H;  4A3D B;  2R7Z H;  4U67 3;  2KCM A;  1CI3 M;  3DEP A;  3DLL A;  1EY4 A;  4FO2 A;  5ELF A;  3NEL A;  5LMU L;  5IWA Q;  2CW0 C;  2RDH A;  5GAG C;  2B2V A;  1PFB A;  1WTW A;  1O7L A;  4KHV A;  3KJP A;  2NVT H;  4HED A;  3M9B A;  4DXG A;  3D6C A;  4IFD H;  2F0I A;  1HUN A;  3CCU A;  3NUC A;  5C3E B;  5IE8 A;  4NXN Q;  2VNU D;  1BCP D;  4S3S A;  2OQK A;  1YHQ A;  2RDG A;  5C4J H;  3A5U A;  1M90 C;  2DUD A;  2CFM A;  1JB3 A;  4R4Q A;  4P2C B;  4XTC S;  1FGU A;  1WI5 A;  2JA7 B;  4A3B H;  1BNZ A;  1QUQ A;  1YIJ A;  1UNS A;  4DK1 A;  2A6E C;  3MWY W;  5GAH C;  1D1I A;  1Y1W G;  3QG1 A;  2VB2 X;  2R93 H;  1IHZ A;  2B29 A;  3PF4 A;  2DJG C;  2PW7 A;  5JVH 3;  2JA6 G;  1J8I A;  5ELD A;  3AFP A;  1NCV A;  4L5T A;  1ZYR C;  2B39 A;  3JAM i;  1I94 L;  4X3K A;  4DR6 Q;  4DV4 L;  1IZ6 A;  3EJI A;  4ZCK A;  3PUY A;  2PZU A;  2AWN A;  3M4Q A;  4KKT A;  4N8F A;  1DOM A;  5KGU A;  3ER0 A;  2D0O A;  2FMC A;  1G2S A;  4NXM L;  3CCM A;  1IBM Q;  1G8Z D;  2OTJ A;  1YZ6 A;  4JBW A;  5M3F B;  3R8B A;  3H3V I;  1I4P A;  3NK9 A;  3RMH A;  3T16 A;  5I9P A;  2F0W A;  4KHZ A;  1IBL L;  1N36 L;  2PMZ E;  2K5V A;  4X64 L;  3LNN A;  2PZT A;  1LT3 D;  2HHH L;  1L1O C;  3HFZ B;  2IL8 A;  4PZ7 A;  1I5F A;  2DN8 A;  2K7V A;  4DR1 L;  1V1P A;  1E2Z A;  3FVQ A;  2QF7 A;  1B44 D;  3HOZ G;  3WOF A;  1SNC A;  4DAV A;  3CP0 A;  2UXD Q;  3RLF A;  2B63 B;  2F0J A;  3PO2 G;  1VQN A;  3STB C;  3V05 A;  1S3O A;  2UUB Q;  2G9H D;  1VQI A;  4BBR G;  5M5X H;  4FXK C;  3U9S A;  4DF7 A;  5BR8 Q;  3DUZ A;  2MQH A;  4A3J G;  3AU7 A;  1U5K A;  1C7Y A;  4J6H A;  4JW0 A;  3J80 c;  4R4O A;  4IUP A;  4EX5 A;  3HOV B;  1WFQ A;  4FF4 A;  1VS0 A;  1SJH D;  2FJ2 A;  4QB4 A;  2SDF A;  3D6W A;  3S17 B;  1CA6 A;  1BCP B;  3VR5 A;  3CPW A;  1JT8 A;  3PIP 3;  1QIL A;  4JI3 L;  2B2Y A;  1QJO A;  1QNK A;  3HP3 A;  3KLS X;  1PH6 A;  2N78 A;  2B2T A;  4C1N I;  1TXY A;  4LFA Q;  1Q1B A;  2A68 C;  2EDG A;  5IYD G;  4ULL A;  1B7Y B;  1T5E A;  5C4X G;  1TS3 A;  2K14 A;  5I9O A;  5T1G A;  4QJF A;  4LMQ D;  5E4W C;  2IT1 A;  4G4K A;  1ILP A;  2CVR A;  1Z7T A;  3G7L A;  5EJW A;  2JN4 A;  4LW1 A;  3EVQ A;  4YCU A;  3VR6 A;  1JOO A;  2UU9 L;  2YU9 B;  3FP9 A;  2PQA A;  2R7Z B;  3MXU A;  5C4H A;  2R61 A;  1F9R A;  2ZJP A;  1I4G A;  1HA5 A;  4MZ9 A;  2NZH A;  2Q8T A;  1SDF A;  2MP1 A;  1KAA A;  1K9M C;  1D8L A;  1OO9 B;  1STA A;  4H44 C;  4A3D G;  5AJ3 L;  2RBM A;  1CQF A;  2I5M X;  1KQS A;  3KLR A;  3RZO H;  3I56 A;  3V96 A;  3LWE A;  2ASB A;  3RN2 A;  4IJH A;  1M4V A;  5C4J B;  1VQ8 A;  1QNU A;  1HNZ L;  4RGT A;  1MD2 D;  3HOW H;  4ODG A;  4B3M Q;  2GVB A;  4AYB E;  3RUZ A;  3TP6 A;  4JBJ A;  4BY1 H;  1HQM C;  1BO0 A;  4RHS A;  2EQS A;  2F0S A;  3E9H A;  3GTK H;  5C3E G;  3U58 A;  4TRD A;  1BCP F;  5EKI A;  4LF4 Q;  2IHE A;  3CRK C;  4CJ0 B;  5I2Y A;  1VQ6 A;  3A8K E;  1NMG A;  3RZD B;  1B3Q A;  1I6H B;  1E0B A;  1X3E A;  3NWS A;  5JOB A;  2UUC Q;  4RGN A;  2PQA B;  2JA7 G;  4UHV A;  3S1M H;  1KHI A;  2ENB A;  2NWG A;  2MPM A;  1LAB A;  2F0O A;  4U68 A;  1JC7 A;  1HQR D;  1VQP A;  2P5Z X;  1M8A A;  1TWA B;  5LL6 S;  4H13 C;  2M00 A;  4LFC Q;  1X54 A;  3T51 B;  4KHP Q;  1DYQ A;  5L37 A;  3A56 A;  4POG A;  1XNQ L;  4DV2 Q;  4RFB A;  4B3R Q;  3BZK A;  1QE6 A;  3G6J B;  4FDB A;  5TSS A;  4JOI A;  2Y0S E;  1W3S A;  4TVA B;  2L55 A;  1Q82 C;  2F0H A;  2I46 A;  1T9H A;  3KF8 A;  2O5J C;  2ICI A;  5AFW A;  4CJ1 B;  4F88 A;  3I4M B;  2BH8 A;  2Y0S B;  1E1O A;  5M3F G;  3S1R H;  1R9T H;  1E3P A;  2FFK B;  3J81 j;  3CC2 A;  4A3E B;  1HR0 L;  2K4K A;  4LFB Q;  3HG9 A; 
#chains in the Genus database with same CATH homology
 4KTA A;  3KBX A;  4HN7 A;  2SEB D;  4Q0F A;  5CR3 A;  4QUF A;  4KKS A;  3SK6 A;  2MHV A;  1FNW A;  2NZ1 D;  3QIA A;  1CM9 A;  2QKI C;  2M9V A;  3VYS A;  1W6J A;  3KLS A;  5IGG A;  1QB5 D;  5BN3 A;  3QJY A;  4K2K A;  3P7J A;  3H94 A;  3WDN A;  1JE4 A;  3SEB A;  4K5V A;  3CKI B;  1NR4 A;  2IW3 A;  3GTG B;  4KK7 A;  2WIN B;  3J7A V;  4H7B A;  2LKV A;  5K5P A;  3HS0 C;  2EJF C;  3OIQ A;  1EY0 A;  5JVG 3;  2EOT A;  3MFY A;  2F0Q A;  1NR2 A;  2Q8I B;  1U4R A;  1TWF B;  3K5M A;  1EFI D;  1CA5 A;  4DNR B;  1HTP A;  4ME5 A;  1SYC A;  1EEI D;  4G7Z C;  4BY1 B;  1STH A;  4PNY A;  5EBC A;  1GUN A;  4G7H C;  4CGY B;  2WKC A;  4IFD G;  3GTK B;  2BE5 C;  3ERO A;  4OIK A;  2XWB B;  4EQP A;  1U9R A;  2SNM A;  5C4Z A;  2B2V C;  3MTS A;  3BDO A;  5I4D A;  4FF1 A;  1U4P A;  4A3I B;  1O7Z A;  5BN4 A;  1Z47 A;  3K59 A;  4KI0 A;  4LJZ C;  1PRT D;  3C1E A;  4J1M A;  5KNB A;  3D31 A;  1B1Z A;  5LL6 X;  1S5B D;  3M85 A;  2M2L A;  2F0D A;  2NBF A;  3P1H A;  2EVB A;  1C4Q A;  4ZUI A;  2HDM A;  4DFA A;  2DNE A;  5FOB B;  4K8J A;  3CU7 A;  1PTO H;  4B9X A;  2WP8 J;  3WOE A;  2E75 C;  3HGB A;  1AP0 A;  3M7N A;  5KYL A;  4K8I A;  4KMU C;  1EWC A;  3FDT A;  3GQB A;  3OMG A;  1OXX K;  5I6Y A;  2KVM A;  2B2U C;  3D8G A;  1S5E D;  3S1R B;  1TQO A;  1VCI A;  1ZXT A;  2HCI A;  5C0X J;  2HQE A;  2NTS A;  3KBG A;  2LFN A;  1LAC A;  1MSG A;  4E6I A;  3I8Z A;  1WTR A;  5IOD A;  1BCP C;  4K6D A;  5EBD A;  5KEE A;  2H1E A;  4V19 0;  3S14 B;  2I07 B;  5C0X I;  2K33 A;  4C2M B;  5M5Y B;  4RCO A;  5D3D A;  3HRZ C;  3Q6S A;  1CZW A;  4XT1 B;  1TY2 A;  4B9W A;  3P20 A;  3MXG A;  2DNC A;  4IUN A;  4BWG B;  1Y8P B;  1PZK D;  1Q8I A;  5C5M A;  4HCE A;  4PMB A;  1UUP A;  2PPB C;  3HOY B;  2VUM B;  5D3I B;  4DA2 A;  1IW7 D;  2O5I C;  5K36 H;  3HOZ B;  3Q23 A;  4ZQ3 A;  1HTL D;  3PO2 B;  4KN7 C;  1B4O A;  1ROD A;  4IUV A;  3IL8 A;  1PRT B;  2B2Y C;  1RTO A;  2B2T C;  1TS4 A;  4NP5 A;  1XTC D;  4RA8 A;  3A55 A;  4ABN A;  2L12 A;  3X3M A;  1SSO A;  3TP5 A;  1VMP A;  2JE6 I;  5IIF A;  5KRU A;  2KED A;  3SXH A;  1R4P B;  2V4D A;  3TSS A;  3GTO B;  3FKI B;  1F2L A;  1VF5 C;  3TBI B;  3I91 A;  2EYO A;  4KJO A;  4Z9C B;  2IX0 A;  1TS2 A;  5CV5 A;  1LTB D;  1X3Q A;  3F2U A;  2ZXR A;  2IX3 A;  4XYQ A;  1QCB D;  1NAP A;  2PYK A;  2NN6 H;  1A3U A;  1HUM A;  1TY0 A;  1YNN D;  5CGK A;  2EYL A;  3J81 L;  3OIP A;  2OXP A;  5J22 A;  2KOL A;  1K8O A;  2F0E A;  2AUK A;  1E2W A;  3ONA B;  5JEA G;  2X69 A;  1EU3 A;  4K14 A;  3OMC A;  1K83 B;  1PTO B;  2WII B;  1PRT F;  4G7O C;  5C6A A;  2EY5 A;  2C5C A;  1MBY A;  2F0V A;  4I7Z C;  2EZV A;  1O7Y A;  2QDB A;  2XN9 C;  4DXF A;  2FMM A;  2L5T A;  1A3T A;  1H9M A;  2RVL A;  2E2J B;  1EY6 A;  3S9W A;  5T1I A;  1STG A;  3QWN A;  2K5W A;  4KJN A;  2OEO A;  1RD9 D;  2EJM A;  1AW7 A;  1DCZ A;  2K5D A;  2KCN A;  3C3L A;  1D2B A;  4N9P A;  2EYF A;  5FKA C;  1JIC A;  4J8Q A;  4Y7N B;  3TZU A;  1QWY A;  1SND A;  1FD7 D;  3SHL A;  5C5L A;  2XSC A;  2NVX B;  3Q0A A;  3SDZ A;  3NTK A;  5G3L D;  4KD3 A;  2FIN B;  3SVM A;  2BA1 A;  1AZQ A;  3GTJ B;  1PTO F;  5A2Q L;  4FXG C;  2L11 A;  4DAY A;  4TQU S;  1WVL A;  3C2P A;  1RDP D;  1CHQ D;  4L8J A;  3R2T A;  1SMY C;  5F2D A;  1I4Q A;  4O42 A;  3PUZ A;  1IYU A;  3CQZ B;  4QCL A;  3MHB A;  1HPC A;  5C0X H;  5CBE E;  3BYY B;  2K1B A;  2Z4H A;  4HSV A;  3J81 E;  4OO1 I;  1WTO A;  3T53 B;  1ET9 A;  3A8I E;  2XIW A;  1DM0 B;  3S1N B;  1STE A;  1KNA A;  2EJG C;  4UAI A;  2D62 A;  4O1N A;  1J9O A;  3DHQ A;  1EY5 A;  1NUC A;  2ZXP A;  3JAM L;  1MI2 A;  3L7Z C;  1JOQ A;  2EY2 A;  3ZYY X;  1SJE D;  2F0N A;  4MN3 A;  3S2H B;  4HR7 B;  1G2T A;  3BVM A;  3I4L A;  3QO2 A;  1GUO A;  1D5Z C;  3VA5 A;  1V1P B;  4XDX A;  3BDC A;  2PNR C;  1KDA A;  2OF1 A;  1RTN A;  4F87 A;  3MA2 B;  1OXU A;  3AMU A;  5ELE A;  3QOL A;  2WB1 B;  4X3T A;  4G57 A;  1Q1E A;  3NHH A;  5J1Z A;  1X3P A;  1A2T A;  3GD7 A;  2Z1C A;  3EA6 A;  2NVT B;  2JEA I;  3NE5 B;  2JP1 A;  3I3C A;  5JPN C;  1EYC A;  3K5L A;  3BYT B;  1ESR A;  4FNF A;  1B53 A;  1V43 A;  2XRS D;  1BUV T;  4KY6 A;  1PFM A;  5IOC A;  3L3O C;  1DOL A;  1D5M C;  3I73 A;  5A2Q E;  4A3B B;  1BDO A;  3UI2 A;  2E74 C;  3A7A B;  1ZEQ X;  1SYG A;  3A8J E;  1Y1V B;  2J7Z A;  4QIW B;  2R93 B;  4Q5V A;  3K7A B;  5CV9 A;  3HOU B;  1VF7 A;  3VYU A;  1SE2 A;  4XT3 B;  1STB A;  1S5C D;  3MZ5 A;  1PZI D;  1S4Z A;  1LT6 D;  4PMW A;  1B2T A;  3GV3 A;  2RDF A;  5CV7 A;  3K5O A;  1EQT A;  2WAC A;  3K0Y A;  2WAQ B;  1XXG A;  1SMY D;  1GHJ A;  3OPO A;  3LX0 A;  4ILW A;  1AEX A;  1PRT C;  4UDU C;  4DGZ A;  1JCK B;  3W2D A;  2XWJ B;  1PXU A;  5G3L F;  5E1F A;  3ITP A;  2J0T D;  5K36 G;  3NP8 A;  2NTT A;  1SXT A;  3HEJ A;  4OL7 A;  2LS0 1;  1KAB A;  5FK9 C;  2AWO A;  3RD4 A;  1WTQ A;  3C46 A;  5M5X B;  3TN2 A;  1JQY D;  4HTH A;  2JEB I;  3EFX D;  2H4O A;  5ELC A;  3GTP B;  5FO7 B;  4ZAI A;  3VR2 A;  4KY7 A;  1EY7 A;  1TKW B;  3MXP A;  2JSO A;  3PIO 3;  1LTT D;  1SAP A;  2SNS A;  4QMG A;  3NSW A;  1S5D D;  2A73 B;  4DK0 A;  1PLF A;  1F2M A;  2F0U A;  1EEF D;  4CKB A;  1LT5 D;  3DWQ A;  1TWG B;  4CJ2 C;  4JK1 C;  2QIL A;  2ID0 A;  1TWC B;  1F77 A;  1W6K A;  1PTO C;  4KKU A;  3OWF A;  1KLG D;  2BA0 A;  1EYA A;  1TR5 A;  2N55 A;  1EOT A;  1OXS C;  4OO1 H;  1IW7 C;  2E2D C;  4ZK9 B;  4OHJ A;  4L63 B;  4N9T A;  2NN6 I;  3C1F A;  2RA4 A;  1AFP A;  4LAA A;  1ENC A;  5DNF A;  4F8M A;  2F0T A;  1LTG D;  4XQN A;  1SYB A;  2F0L A;  3RZO B;  3X3N A;  2NVY B;  1ICW A;  5D65 A;  2F0M A;  1IL8 A;  1K8M A;  3HOW B;  1GUW A;  4C1N K;  3L9A X;  4IFD J;  5CC4 A;  3MVV A;  4KY5 A;  2J4X A;  3H09 A;  2B8G A;  1DZ1 A;  2A6H D;  1XX8 A;  5JJZ A;  2AUJ D;  2K6A A;  2PCF B;  3S1M B;  1G29 1;  4B08 A;  1LLR D;  2VXW A;  2EYP A;  2JXM B;  5KND A;  5KYI A;  3J80 L;  1YNN C;  3MXN A;  2KUM A;  3SE0 A;  3ND9 A;  3S16 B;  4IZ8 A;  3M4Y A;  2RSN A;  5DAU A;  5FO8 B;  3IFD A;  2XVS A;  2N88 A;  2FHT A;  4XYO A;  1R9T B;  4XQJ A;  2R3Z A;  4HCS A;  5M9O A;  2NB0 A;  2QEJ C;  4A93 B;  4R8N A;  4FP5 D;  2DY7 A;  1LV9 A;  2PW5 A;  1AN8 A;  2X6G A;  3SK8 A;  4RGO S;  3I70 A;  1U4M A;  3NTI A;  1YNJ D;  2KEE A;  4C3I G;  2D5D A;  1TWH B;  5CV4 A;  4BA2 I;  1XYI A;  5CV6 A;  2HCC A;  1MSH A;  1PTO D;  5CBA E;  4DN4 M;  1Y8O B;  3K6O A;  1Z6H A;  5BN5 A;  2G9D A;  1MGS A;  3OWE B;  1JOK A;  1VMC A;  1ET6 A;  1UEA B;  2EXZ A;  1A15 A;  3D4D A;  5EKK A;  1E2V A;  1ENA A;  2C9O A;  5COY A;  4WRD A;  2A69 D;  1SE3 A;  3DXJ C;  4IUU A;  4NMZ A;  1SNO A;  3BVG A;  3NBI A;  3SK4 A;  4BY7 B;  2BCO A;  2CQA A;  2HUG A;  1HA6 A;  3T13 A;  4CKE A;  2XNA C;  1RF2 D;  2F3W A;  4TSS A;  4K2L A;  1BXT A;  3J80 E;  1LTA D;  2JA8 B;  3TDQ A;  3D4W A;  1AZP A;  4DAP A;  4RHR A;  1GOZ A;  2EYM A;  4DNT B;  1OXV A;  3K57 A;  1B9M A;  4ZRZ A;  2VB3 X;  4EQN A;  3IAY A;  3VYR A;  4WOR A;  1JWS D;  4C3H G;  5HGT A;  3M3Y B;  4A3F B;  1SYF A;  1ESF A;  3DM1 A;  3PUW A;  2OT2 A;  4KV6 A;  4MIU A;  1HXY D;  1ONL A;  1H9R A;  1IYV A;  4NDX A;  2BDO A;  1KDC A;  1II3 A;  4F7X A;  1A3V A;  4XXE A;  1C48 A;  2K5Q A;  2MGS A;  4XIG S;  1B50 A;  4WFN 3;  5JEA J;  2MJ8 A;  1Q12 A;  1PYW D;  4R9W A;  3HKZ B;  4EVO A;  2B8F A;  3OOC A;  1RHP A;  1EQV A;  2NUC A;  3DMU A;  1DD2 A;  3IFT A;  1GUS A;  2AQ3 B;  4NKL A;  1FGB D;  1T5X D;  2KEC A;  1G91 A;  1EZ6 A;  2K03 A;  4YIJ A;  3TME A;  2O4X A;  3FPP A;  1HCZ A;  1STN A;  2L4N A;  2JA5 B;  3VR4 A;  1B3A A;  4A3G B;  3O13 A;  1EIH A;  5EQ0 A;  1A2U A;  3P75 A;  2EE1 A;  4CBV A;  1I4H A;  3NPP A;  1GXD C;  1IKL A;  1Q90 A;  3BZD B;  3W3A A;  3S1Q B;  3SR1 A;  1CQV A;  4ZYS A;  1ILQ A;  3MC0 B;  3R2I A;  1WD0 A;  3URY A;  1UAP A;  1GUG A;  2KQ3 A;  2B2U A;  4RKL A;  2R6G A;  5E4X A;  4K5X A;  5CYU A;  2K28 A;  2LMC B;  2F0G A;  2XRQ D;  4OO1 G;  4FF2 A;  5IGD A;  5M5W B;  1WD1 A;  3VR3 A;  4IUR A;  3R93 A;  1GHK A;  2A5H A;  1SNQ A;  3U9O A;  3DWA A;  4KN4 C;  1FYC A;  5C3W A;  2PMZ B;  2B2W A;  3MAQ A;  3D4R A;  2K05 A;  1KLU D;  5DM7 3;  1EYD A;  3NWT A;  5IGB A;  4A3K B;  5JAV A;  1BF4 A;  3KUP A;  1FR3 A;  1BR9 A;  3NTH A;  1JWM D;  2O2L D;  3QB3 A;  3FMC A;  4RCN A;  1I4X A;  1HFG A;  2KA7 A;  2PO4 A;  1LTS D;  1NSN S;  2K01 A;  4C3J B;  2QCP X;  3PUV A;  1PZJ D;  1Y8N B;  4H0L C;  3J7Y W;  4A3M B;  3OSO A;  4ZUJ A;  1JWU D;  3E6Z X;  1SE4 A;  4C56 C;  4BBS B;  2CW0 D;  2Q8R E;  2D9U A;  3S2D B;  1X32 A;  5CV8 A;  4L6T B;  1B9N A;  3J7A F;  4IN3 A;  4ZKC B;  1EY8 A;  3VA7 A;  2AQ1 B;  1V8Q A;  5FLX L;  3GO5 A;  4EQO A;  1TT2 A;  2L9H A;  3AB9 A;  4IUQ A;  3H3V C;  1LT4 D;  2ZT9 C;  4GZY C;  2A6E D;  5JPM C;  1H9J A;  3CRL C;  5DEH A;  3D3R A;  4AYB B;  2KCC A;  1ZYR D;  3S15 B;  2A6H C;  3QOJ A;  1D5X C;  5IT9 L;  1DXM A;  4KD4 A;  1S5F D;  3MFG A;  4IQZ A;  3TP8 A;  1U4L A;  3JAM E;  4CHT B;  2L0C A;  5JEA H;  5NUC A;  4I65 A;  4PQX A;  1SBB B;  3LWU A;  3NBH A;  2TMP A;  3EQL C;  1GJX A;  1SYE A;  2NYZ D;  1BOS A;  5LHY 1;  2SOB A;  1CTM A;  5C3X A;  1DJR D;  3Q24 A;  3PO3 B;  1KNE A;  2GA4 B;  3T4A C;  1WTP A;  1EL0 A;  1L0X B;  1HRJ A;  1SNP A;  2K04 A;  4C3I B;  1G6Z A;  1ENF A;  4M8A A;  3HOX B;  3IKJ A;  4TKO B;  5EPJ A;  2Z4I A;  4XQQ A;  1HFN A;  1RKN A;  1O78 A;  1F9P A;  3A7L A;  4IAL A;  1EWH A;  2NVQ B;  5D14 A;  3N52 A;  2F03 A;  1F9Q A;  1HHV A;  4FVM A;  1YNJ C;  3K58 A;  3H6M A;  4HMI A;  1TVX A;  1I4R A;  1Y69 U;  3I4N B;  4NW2 A;  4EGV A;  3FEW X;  5FLX E;  1O80 A;  1DOK A;  2A68 D;  2YYZ A;  1I50 B;  1WTX A;  5EPK A;  3ND8 A;  2A74 C;  2NN6 G;  1FNV A;  4C3J G;  4IUT A;  2R92 B;  1H9S A;  4QUC A;  1EIG A;  4RKB A;  1I3Q B;  1SFO B;  1SNM A;  2X6L A;  1LO5 D;  2A69 C;  1L0Y B;  1R4Q B;  2L1B A;  2PZW A;  5IT9 E;  4OGQ C;  5ISR A;  3E5S A;  4C3H B;  2JYO A;  1JR0 D;  3PMF A;  4HAE A;  4LK1 C;  2Z8L A;  3PUX A;  2ZXO A;  4FF3 A;  3FPU B;  4HMJ A;  3TZD A;  5KNC A;  5EPL A;  4PV1 C;  1EZ8 A;  1VDZ A;  2KJX A;  1F2Y A;  4V0B A;  2IJ0 A;  5COR A;  4X3U A;  3ERQ A;  2E2H B;  1CHP D;  1SYD A;  3VYT A;  3MEH A;  1TII D;  1Q3L A;  1KDB A;  3OHX C;  1DON A;  1H9S B;  5I6W A;  4IFD I;  4ZLT F;  1RCV D;  2EYH A;  2EYJ A;  3N6R A;  3GV6 A;  5FO9 B;  3H91 A;  5I2X A;  5EKL A;  3M7G A;  2F3V A;  4ID6 A;  1D6E C;  1XWE A;  1QOH A;  5IGF A;  4M1U B;  1EY9 A;  4BA1 I;  3DEO A;  2BOS A;  2F0K A;  3Q22 A;  2DY8 A;  3BDL A;  1QG7 A;  2E2I B;  2RQX A;  2EPB A;  4HSP A;  2IX1 A;  1LTI D;  3FRP B;  1PFN A;  4RAU C;  2WKD A;  4K6L A;  5J39 A;  2F4I A;  1GUT A;  5C0X G;  1TS5 A;  4RWS C;  1EU4 A;  5E3F A;  3A54 A;  3HZX A;  4BS9 A;  1Y1W B;  2LY7 A;  1IKM A;  3K5N A;  5CMD A;  2JA6 B;  4MHE A;  1F2Z A;  2RSO A;  5M3M B;  4RGM A;  5IGC A;  1LTR D;  4ZKB B;  2K32 A;  4R8I A;  2AQ2 B;  4CKC A;  2E76 C;  3I72 A;  2TSS A;  2F1M A;  2CHB D;  2B2W C;  2F0F A;  1ML0 D;  1BQQ T;  3H0G B;  2KHS A;  5EGT A;  3GTL B;  4PMC A;  4X3S A;  2WV6 D;  3I90 A;  1SEB D;  1BBX C;  1PMR A;  1I6V C;  1CT1 D;  1CFM A;  3BG3 A;  2IWH A;  4K5W A;  1WTV A;  4BBR B;  3DWP A;  3GTQ B;  1CK1 A;  1FNU A;  4FXD A;  4A3J B;  3PV0 A;  5A35 A;  2D2C C;  5DM6 3;  1STY A;  1C8C A;  1A6X A;  5C44 B;  1V1O A;  1H9K A;  4WJW A;  1ZKO A;  2BDN A;  2IPK D;  5HUR A;  4DU9 A;  5ELB A;  2ICE C;  3R3O A;  2BE5 D;  3NXW A;  4FYD A;  4OIJ A;  2EY6 A;  3V2T A;  3E0J A;  3M4O B;  2RKS A;  3BVZ A;  2MUY A;  1F9S A;  1KTK A;  3NQT A;  5KIX A;  5C4X B;  3GP7 A;  3KK7 A;  3TP7 A;  3GTM B;  2HDL A;  1D1K A;  1PDQ A;  2F0P A;  1RJT A;  2EY1 A;  1CZG A;  1WCM B;  3OW7 A;  5IGE A;  4QF4 A;  3T56 B;  3BS1 A;  2PQE A;  3CHB D;  3NQI A;  1TU2 B;  4RH6 A;  1JOR A;  1OXT A;  3SK5 A;  4A3D B;  4U67 3;  1CI3 M;  3DEP A;  1EY4 A;  4FO2 A;  5ELF A;  2CW0 C;  2RDH A;  2B2V A;  1PFB A;  1WTW A;  1O7L A;  4KHV A;  4HED A;  4DXG A;  3D6C A;  4IFD H;  2F0I A;  1HUN A;  3NUC A;  5C3E B;  2VNU D;  1BCP D;  4S3S A;  2RDG A;  1JB3 A;  4P2C B;  4XTC S;  2JA7 B;  1BNZ A;  1UNS A;  4DK1 A;  2A6E C;  3MWY W;  1D1I A;  3QG1 A;  2VB2 X;  1IHZ A;  2PW7 A;  5JVH 3;  1J8I A;  5ELD A;  1NCV A;  1ZYR C;  2B39 A;  4X3K A;  3EJI A;  3PUY A;  2PZU A;  2AWN A;  4KKT A;  1DOM A;  5KGU A;  2FMC A;  1G2S A;  1G8Z D;  4JBW A;  5M3F B;  3R8B A;  1I4P A;  3NK9 A;  3RMH A;  3T16 A;  5I9P A;  2F0W A;  4KHZ A;  3LNN A;  2PZT A;  1LT3 D;  2IL8 A;  2DN8 A;  2K7V A;  1V1P A;  1E2Z A;  3FVQ A;  2QF7 A;  1B44 D;  3WOF A;  1SNC A;  4DAV A;  3RLF A;  2B63 B;  2F0J A;  3V05 A;  2G9H D;  4FXK C;  3U9S A;  4DF7 A;  3DUZ A;  3AU7 A;  4J6H A;  4IUP A;  3HOV B;  4FF4 A;  1SJH D;  2FJ2 A;  4QB4 A;  2SDF A;  3D6W A;  3S17 B;  1CA6 A;  1BCP B;  3VR5 A;  3PIP 3;  1QIL A;  2B2Y A;  1QJO A;  1QNK A;  3HP3 A;  3KLS X;  2B2T A;  4C1N I;  1Q1B A;  2A68 C;  2EDG A;  4ULL A;  1T5E A;  1TS3 A;  5I9O A;  5T1G A;  4LMQ D;  5E4W C;  2IT1 A;  4G4K A;  1ILP A;  2CVR A;  1Z7T A;  3G7L A;  5EJW A;  3EVQ A;  3VR6 A;  1JOO A;  2YU9 B;  2R7Z B;  3MXU A;  5C4H A;  2R61 A;  1F9R A;  1I4G A;  1HA5 A;  2Q8T A;  1SDF A;  2MP1 A;  1KAA A;  1OO9 B;  1STA A;  4H44 C;  2RBM A;  1CQF A;  3KLR A;  3V96 A;  3LWE A;  1M4V A;  5C4J B;  1QNU A;  4RGT A;  1MD2 D;  4ODG A;  3RUZ A;  3TP6 A;  1HQM C;  1BO0 A;  4RHS A;  2F0S A;  4TRD A;  1BCP F;  5EKI A;  3CRK C;  4CJ0 B;  5I2Y A;  3A8K E;  3RZD B;  1I6H B;  1E0B A;  3NWS A;  5JOB A;  4RGN A;  2ENB A;  2NWG A;  2MPM A;  1LAB A;  2F0O A;  4U68 A;  1JC7 A;  1HQR D;  1M8A A;  1TWA B;  5LL6 S;  4H13 C;  2M00 A;  3T51 B;  1DYQ A;  3A56 A;  4RFB A;  1QE6 A;  3G6J B;  5TSS A;  2L55 A;  2F0H A;  2I46 A;  2O5J C;  3KF8 A;  2ICI A;  5AFW A;  4CJ1 B;  4F88 A;  3I4M B;  2Y0S B;  2FFK B;  4A3E B;  3HG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...