5EKIA

Crystal structure of truncated ccl21
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
QDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure of Truncated CCL21 and the Putative Sulfotyrosine-Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords C-C motif chemokine 21
total genus 12
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekiA00
1HUNA 1JE4A 4HSVA 2HCIA 1EIGA 2EPBA 2L1BA 3MTSA 1RHPA 3G7LA 1B53A 1U4MA 2KOLA 3DEOA 3H91A 4MHEA 5EPJA 5COYA 4DN4M 4ZK9B 1SAPA 5JJZA 1O80A 3HP3A 5E4WC 1B3AA 1IL8A 2X6LA 1U4PA 1WTRA 4IURA 5T1GA 1ILPA 1DONA 3IL8A 1DZ1A 1F2LA 2B2TC 3KUPA 1BO0A 2X6GA 4XT1B 1G2TA 3N52A 1QG7A 4IUVA 1U4LA 4QUFA 2HDLA 1NCVA 2KECA 1O7ZA 2B2YC 3D6WA 3QO2A 1B2TA 1NR2A 2FINB 2K04A 2NWGA 2J7ZA 1AZPA 2JP1A 4ZKCB 2HCCA 1DOMA 2KEDA 4RA8A 2M2LA 1WTOA 1XX8A 1J8IA 1MSHA 3I90A 2KUMA 2JYOA 2KEEA 2L12A 3IFDA 5EPLA 1F9QA 3R93A 1WTPA 1B4OA 1ESRA 1HFGA 5CMDA 1M8AA 1S4ZA 1VMPA 1X3QA 2K1BA 3MWYW 1HUMA 4HEDA 3KBXA 3LWEA 4MN3A 1E0BA 4HAEA 4OIJA 5EKIA 4ZAIA 4ZLTF 2DY8A 2H1EA 4UAIA 1PFNA 2B2UA 2L11A 4NW2A 2L9HA 1HHVA 4IUTA 1G91A 1RTOA 1EIHA 1G6ZA 1SSOA 5EJWA 1HFNA 3TZDA 4CJ1B 1QNKA 2B2VC 2MGSA 2EOTA 1NR4A 4X3KA 2B2WA 5EQ0A 1TVXA 1QE6A 3DEPA 3GV3A 1X32A 1HA6A 4RAUC 1CA6A 1EQTA 3DM1A 2D9UA 1RJTA 2L4NA 2R3ZA 1B50A 5DNFA 1LV9A 1JICA 1WD1A 4CJ0B 1VMCA 1WTVA 5CBAE 2B2WC 1BF4A 2B2VA 2VXWA 5T1IA 1EL0A 1G2SA 1WTQA 1DOLA 1A15A 1AP0A 1EOTA 2CVRA 1PFBA 4XDXA 1ILQA 2RSNA 4IUQA 4X3SA 2RVLA 3F2UA 4R8IA 5AFWA 2MPMA 5CORA 2Q8RE 5E4XA 3Q6SA 4X3TA 1WVLA 1RTNA 2MP1A 2SDFA 2XIWA 2HUGA 3GV6A 1MGSA 1F9RA 2N55A 3I8ZA 1MI2A 2K05A 4IUPA 1O7YA 2MJ8A 2N88A 4O42A 4QUCA 1C8CA 1BNZA 1IKMA 1X3PA 2B2YA 1HRJA 1PDQA 2HDMA 2RA4A 4IUUA 4HCSA 1BBXC 2NYZD 4XT3B 4CJ2C 2X69A 2FHTA 1WTWA 2FFKB 1GUWA 5EPKA 2FMMA 1CM9A 3FDTA 1F9SA 1PLFA 2K01A 1DOKA 1NAPA 2KVMA 2DY7A 5CBEE 2BDNA 2Q8TA 1XYIA 3I3CA 2NZ1D 2RSOA 1KNAA 2IL8A 3P7JA 1WTXA 4U68A 4LMQD 1F9PA 4RWSC 1CA5A 4R9WA 2EE1A 1U4RA 1PFMA 1ML0D 1RODA 1SDFA 1J9OA 3ONAB 4X3UA 3SVMA 1ZXTA 1KNEA 1IKLA 3FPUB 3TN2A 1MSGA 5D14A 2K28A 3UI2A 1AZQA 5D65A 1WD0A 1Q3LA 3I91A 1ICWA 4OIKA 2B2UC 2FJ2A 2B2TA 4ZKBB 2K03A
chains in the Genus database with same CATH superfamily
5JJZA 1RHPA 3ER0A 4MHEA 4UP8A 3BS1A 4LF9L 1EZ6A 3H3VH 5M5YB 1SYBA 4K6DA 3OTOQ 1DONA 4C3HH 4XT1B 1HTLD 5DM73 4O2DA 3QO2A 3KLRA 2MUYA 1RCVD 5CV6A 3MXUA 1JCKB 1XX8A 2IX3A 1HNWQ 3D31A 1Y8PB 2QEJC 3NPPA 1L1OC 2KEEA 4EX5A 4QF4A 3P20A 1ZEQX 5FJ8G 1SNOA 2WAQB 1W3SA 3LX0A 1SJED 1E1TA 1I4HA 3M7NA 2F3VA 4HEDA 4KJNA 1K0RA 3LWEA 4A3DH 1KLGD 1WJJA 1PFNA 4KKSA 1YNND 3CCMA 2J0TD 3S1NB 5LHY1 1EIHA 5JJKA 1VQ9A 2XTIA 1G291 2MGSA 1R4PB 4C2MH 4IO9A 2GVAA 2RHQB 1EQTA 1LV9A 4P71A 1WD1A 3W1BA 4B9XA 1VMCA 3M4QA 1QNUA 1KXLA 4PZ6A 3HFZB 4BA2I 2K7VA 1G2SA 1FYCA 3D0FA 1XMQQ 3KFUA 3E9IA 2A73B 3CMEA 3HOYB 4DR7L 3OSOA 4A3DB 1BCPF 2WFWA 3M9BA 3IKJA 1STGA 2I46A 5E4XA 4A3EH 2JEBI 1MGSA 1F9RA 1EQRA 1EUJA 2MO0A 3K81C 2QILA 1PDQA 2HDMA 3FPPA 1XNRQ 4HTHA 3C2PA 1QVGA 5IE8A 3U9OA 2FMMA 4M1UB 3U4ZA 1SYGA 2B3GA 3MZ5A 1Y14B 4EQ5A 5CV9A 5I6WA 2F0SA 2LY7A 1N36Q 1WOCA 1OXVA 2F4VQ 1Q1BA 2HD3A 4R9WA 3GTGB 2LXJA 2VQFQ 1K8AC 1CTMA 4AQYL 4RMFA 3F8TA 5M3MB 2EVBA 4JPBW 4BY1B 1WD0A 3S14H 5ELDA 3J81i 2UXDL 1NNXA 2PI2A 2EPBA 3A56A 4EGVA 3G7LA 3BDCA 4GOPA 3GTKH 3HKSA 1SYDA 4ZK9B 3I73A 4A3FB 1F77A 1RF2D 3K0XA 2F0TA 4FF2A 1C9OA 1EOVA 4JVZA 4IUVA 4C3IG 5KEEA 1W6JA 4QY7A 3LWUA 4OO1G 2FINB 1SXTA 3MEFA 1E22A 2PNHA 1GKHA 4X66L 3TQYA 3QB3A 4RGMA 4LUZA 2IHEA 3M3YH 3SEBA 5FLXE 3HOYG 2ZM6Q 2ID0A 1WTPA 3TDQA 4X65L 2C9OA 1EEFD 2IW3A 5C44G 2QDBA 2D2CC 4ZAIA 1YJWA 3VR2A 2AMCB 1I4XA 2CHBD 2DJFC 2VS1A 4I7ZC 4LF9Q 3BVMA 2KHIA 1B9MA 2PYKA 2OQ0A 3EFXD 3FRPB 1XNQQ 5DNFA 5TSSA 2JA6B 4LFCL 4OO1I 2WB1G 3NEMA 4AYBE 3I4NB 1EL0A 2XSCA 2XRSD 1GXDC 2Q2UA 1C48A 3CU7A 5IT9L 5IYDG 5CORA 1VQ4A 5EGTA 3K57A 4BXXG 2UXCL 1H9SA 2EY2A 1VQOA 4OONA 4HCSA 3ERQA 4F87A 3J80c 2X69A 3RMHA 3I4LA 1K3RA 4DV6Q 4CKCA 3HOXG 3HOWB 1KNAA 5K36G 1E2WA 4LFBL 3EN2A 2C35B 1YHBA 2EQSA 4A3EB 4FP5D 1D1KA 3L9AX 2BE5D 5D3IB 2DUDA 2R7DA 1X3EA 4DV0L 1IKLA 3CRLC 3BJUA 4IZ8A 2AHOB 5C4HA 4U673 4F88A 2OWOA 1X6OA 2BH8A 1VQ8A 3I91A 3I4NG 1LTGD 2CFMA 3W2DA 2JXMB 3NTIA 1Z6HA 1TKWB 4X62Q 4EVOA 4DUZQ 1JE4A 3OHXC 3BU2A 4DV0Q 4GOPB 2QF7A 3TMEA 2F4VL 2OF1A 3SK4A 3K0YA 5IGFA 2YU9H 4DV4L 1EY5A 4L5QA 2JA5B 3HOZB 1A3TA 4LF8Q 2KECA 1IHZA 2IWHA 3TS0A 1PH2A 3GTMB 4C1NK 4NXNL 3DM3A 1YJNA 1R9TB 1Q12A 2A68D 4KN7C 5CV7A 1NUCA 1IYJB 2ZTEA 4A3IG 3B6YA 5I2XA 3S17B 1JOKA 2A6HD 3KDFA 5JVG3 1M8AA 3NTHA 2NVXH 1LACA 1BNZA 3S1QH 1XMQL 2L5TA 2B2UA 1AE3A 1EU4A 2RQXA 1JC7A 2LMCB 1CK1A 4FXGC 1BKBA 2PMZE 1JJ2A 4ULLA 5FLMH 3BYYB 4CJ1B 2YTXA 4PMBA 1GHKA 2DN8A 1P16A 3K5LA 5C44H 2RHSB 4CDDC 4OX9L 3EROA 2EXZA 2L4NA 4J15A 3K80C 3X3NA 2IJ0A 5JEAG 1MHWC 4XIGS 3CF5A 1BBUA 1DOLA 5M3MG 1AP0A 2NN6H 1JOOA 4OEMB 4TRDA 3G4SA 3I4MG 1JR0D 2A69D 4ME5A 4IFDG 5DM63 2K14A 4GNXB 2NVYB 1LABA 4C3JH 4K5WA 2OTLA 2VUMB 2NYZD 4XT3B 4CJ2C 3HOVB 5M5YH 1HNZQ 2UU9L 3PO3H 1YNJD 2K5DA 4DXGA 3U4VA 2NZ1D 4YCVA 5HGQA 1EY0A 1V1PA 5FO9B 3WOEA 1Y1WH 1Q90A 3SVMA 3FPUB 4BBSB 4A4IA 2XRQD 2E2JH 4LF5Q 4JI2L 4MTKA 5DAUA 3TSSA 1Q3LA 3MFYA 4DAMA 3M4OH 3BG3A 1NE3A 5C4XH 2N8NA 3KK7A 5ISRA 5CV8A 1U4MA 3NQTA 4CGYB 5FK9C 3HP3A 3STBD 2X6LA 5I6YA 4BY1G 3JAME 4DV2Q 1S5FD 1K8GA 4XQJA 4Y52H 1A2UA 4POFA 2AQ2B 1VQAA 5M3FB 4LWCA 4DAPA 3R3OA 4R8NA 1B2TA 2K04A 2ZXOA 4WJ4A 2EDGA 2HCCA 1WTOA 5EAYA 3SR1A 1KDBA 5IGBA 2DGYA 4JC0A 5KRUA 1QCBD 3I4MB 1A3UA 1TY2A 1VQFA 5E1FA 2A6ED 2QDLA 4K6LA 4GZYC 5JPMC 1AW7A 4BY7G 2L9HA 1EU3A 3J81E 2Q2HA 3PO3B 1RD9D 1HFNA 5DLQE 3I4OA 5D3DA 5EQ0A 1X55A 2F0GA 1GUSA 2PQAB 2V4DA 1XXGA 2B2WC 1Y8OB 3FKIG 3AFPA 3S1QB 4LF4L 1K83B 3NHHA 1LUZA 2UUCL 5KIXA 5M5WH 1QZGA 3DUZA 4NMZA 4X3SA 2R92H 4XYOA 3K5NA 4ZUJA 1WCMB 1GUGA 1HZCA 3J80E 2A6HC 4A3GB 1H9RA 1PH9A 1VQHA 2PNRC 2K05A 1I50B 2VQEL 1BCPC 2ALYB 1C0AA 1VQBA 3AEVA 1WFQA 2F0JA 4Q0FA 3GTMH 4TVAB 5EKLA 3EIVA 5JOBA 4OHJA 3T56B 3VR6A 4DV5Q 5J3BA 1EWCA 3P7JA 5IGEA 5GAEC 4RWSC 4JCVE 1S40A 2QA4A 4FNFA 1I3QB 1BR9A 4JBKA 1MJCA 1EY4A 4YWLA 1B70B 1TIID 1D8LA 1Q1EA 3ITPA 2LXKA 5C4JB 3S16H 1EIGA 3CCQA 1VQLA 1JWMD 4B3MQ 4I65A 2ES2A 3N6RA 4DF7A 1PH3A 1O80A 5E4WC 3M4YA 2AQ1B 4LF7L 3CCEA 1JMCA 1TS3A 4DV5L 5FKAC 5JPNC 5CV4A 5CC4A 2NBFA 3ZYYX 1HNZL 3VR3A 3PIO3 2Z6KC 1K8MA 5L37A 4ZKCB 3UDIA 4YCUA 5J22A 3MA2B 5IGGA 1UE6A 3U50C 3JAMc 3HOVH 4CDFC 5FO8B 4JI0L 2LSSA 4X66Q 4FXDA 5EPLA 2NVYH 3SK6A 3RN5A 4DR4Q 2TSSA 2EYOA 1W2BA 3KF8B 5IYBH 5KGUA 3SXHA 3K6OA 3T53B 5JVH3 1S4ZA 2I5HA 2F52A 1N34L 1ET9A 2UUCQ 3BDLA 1FNUA 3PO2G 4DAVA 1KABA 1XPRA 1JE5A 3C46A 3C1EA 1SMYD 2Y0SG 3HEJA 1K73C 4KV6A 2Q8IB 4KN4C 1HA6A 2PZTA 3Q8DA 4IJLA 1NMGA 2EYFA 4L5SA 2EYJA 2JSOA 3DXJC 3A8IE 3AYHB 3G6JB 4KHPQ 2LKVA 2IT1A 3TEHB 4A3JB 3GTGH 3NTKA 4L8JA 1K8OA 4DKAC 4TKOB 1D5XC 3CHBD 1O7LA 1ZKOA 4KJOA 1MD2D 3F2UA 2F3IA 3GTQH 3R8BA 1NY4A 3T1YL 1HZ9A 2PMZB 4LUOA 1HRJA 3S15B 2A6EC 1LM0A 2QGQA 3DHQA 2Y0SE 4PMWA 3T1YQ 2B63B 1A2TA 3PUWA 5KNCA 1I6HB 4JYAQ 1XYIA 4C3IH 1LTAD 3A7AB 4KY6A 3U9SA 4G7ZC 2AWNA 1B44D 1RODA 1II3A 3PV0A 4O0AA 1ZXTA 3K58A 4DFAA 1Q81C 3FP9A 1A0IA 3MFGA 5D65A 3TP5A 5JJLA 2PZWA 3QOJA 3VA5A 4NPSA 3NBHB 3R2IA 3QOLA 1PYSB 2K52A 4R4QA 3S9WA 2HCIA 2JA5G 2VW9A 4QIWE 3H91A 1B7YB 1SFOH 3PIPA 1PH5A 2K50A 2X6GA 1X3FA 2EJMA 4B3TL 1Q46A 4TSSA 4A3IB 4YY3Q 3HKZB 4NKLA 2Q2TA 4Z9CB 5GAGC 2G9HD 3S24A 1EEID 1OO9B 4OELB 1ESRA 3OWEB 1E24A 1V1PB 5C4XG 1HZBA 4XQQA 1EIFA 4C1NI 1UAPA 3BYTB 4ZLTF 2KCCA 2CCZA 4NW2A 1LT4D 1G91A 1EWHA 2F0IA 2E2IH 1RTOA 4HIKA 2I5LX 4B3RL 1KC8C 2NZOA 5EBCA 2BA0A 2G5DA 3ND8A 3ICEA 4XXEA 1QE6A 1HQMC 1X32A 4JV5Q 1MIUA 1LTID 4MZ9A 4A3KB 5IYDH 4A3EG 4H44C 4LK1C 4AYBB 3KOJA 2XWBB 1GUTA 2F0NA 5C3EG 4JK1C 3GTJH 1TWFH 1O7IA 3TP6A 3M85A 1L1OA 1SROA 1VQNA 1D5MC 2WP8J 2LS01 1CQVA 4X3TA 2WAQG 2R93G 1TQOA 1HCZA 3GTJB 1HXYD 4PQXA 3S1MB 1X3PA 2B2YA 1YZ6A 1VQMA 1JWSD 1XPOA 1FJGQ 2TMPA 3H94A 1BBXC 2B39A 2QEXA 1WTWA 2XGTA 4QCLA 3HOZH 1SMYC 2D5DA 3E3XA 4FO2A 2EIFA 4GN3B 1JT8A 5FLXL 5C5MA 1U5KA 3TREA 2JEAI 5CGKA 2NB0A 1FGBD 3KDFB 1SJHD 2OQKA 4TQUS 1TWGB 1VQ7A 2XNAC 1PYBA 5J39A 1G8ZD 1FNVA 2R7FA 4B3SQ 3UE1A 2R92G 1JB7A 4AIMA 3S17H 4GLVB 3LGJA 3V96A 4ABNA 2B8GA 4L6TB 2WAQE 3H0GH 1XTDA 4HSVA 1KAAA 4AQYQ 1B53A 4UP7A 1EWIA 5COYA 3BVGA 3H0GB 1I94L 1N36L 3RNUA 4LNQA 1YJ9A 3I72A 4ALPA 4JYAL 2Z0SA 1CKNB 4A3KH 4LF6Q 3N52A 1SNDA 2K6AA 3OOCA 2YU9B 4GNXA 1A8VA 2B29A 1O7ZA 4HIOA 2JA5H 4GKKL 2WACA 3DWPA 5M3FH 5IYCG 4NDXA 1PRTB 5I2YA 4BY7B 1LT6D 1MSHA 1PTOC 4KHZA 1Y1VH 3QJYA 2F0QA 3AU7A 2V1CC 1U0LA 1TWAB 2BCOA 1JWUD 3FVQA 4C3IB 3X3MA 3RZDH 2UUAQ 1VMPA 3VA7A 3KBXA 3T1HQ 1GM5A 2R6GA 4DV2L 3CPWA 2L11A 1EQQA 3CQZH 3SK8A 2CH4A 4A3GH 3UDFA 1G6ZA 4KD3A 2YYZA 5M5XB 5JEAH 2B2VC 4C56C 2HHHL 2B2WA 1ZYRC 4KHPL 5C3EB 4OWTB 4K0KQ 1TWHH 2D62A 1TWGH 4UP9A 3PO2B 4J8QA 1AE2A 3V2TA 1WTVA 1L0WA 2RCFA 3NQIA 2VXWA 3L0OA 4DR3Q 3GD7A 2K32A 1EOTA 1DYQA 2ZJRA 2A74C 2E8GA 2A8VA 1EFID 4NXMQ 2F03A 2UU9Q 3CCRA 2LFNA 3Q6SA 1RTNA 2D0PA 1C8CA 3I4NH 1IXRA 5C4XB 4BXXH 4A3JH 3Q24A 2F0WA 4I7AA 1ONLA 2QW7A 5A2QE 2FHTA 2FFKB 1R9TH 1DGSA 4DV3Q 3A8JE 3RLFA 5CBEE 2BDNA 1VF7A 1N32L 1XWEA 3OTOL 1TWAH 2CQAA 3O13A 2F0VA 2E75C 2PCFB 4JBWA 2M00A 1X56A 4PZ8A 1U4RA 1PFMA 4MIUA 1STNA 1S5BD 5D14A 2K28A 3GQBA 3MC0B 4R4IA 5CR3A 1AZQA 2PQEA 3C3LA 3FKIB 4V190 2ICEC 4OIKA 1KAWA 2AUJD 4ZKBB 1M4VA 1QUQA 2L1BA 3RD4A 3K7UC 2WKDA 1SYCA 1GHJA 4HJ8A 2M9VA 2F0UA 4OXPA 4IURA 1F2ZA 2MQHA 1IYVA 3BZKA 1HZAA 2PW5A 4PZ7A 5IP9G 1BO0A 1QG7A 4KD4A 4QUFA 1NCVA 2HIVA 2KQ3A 4BBSH 2NZHA 1LYLA 3F2BA 1T9HA 1Q8IA 1I4QA 4MNOA 1PH7A 4IPCA 2CKZB 3NE5B 3MAQA 2PPBC 4YWKA 1ASZA 3I90A 2C5CA 2KCNA 5EKKA 1WI5A 3IFTA 4CDEC 2ZXRA 3FMCA 2OTJA 4A3MB 3TBIB 4RCNA 3A7LA 1X3QA 3GO5A 1NMFA 1RKNA 3RR5A 3S2DB 4DR5L 1XPUA 1J6QA 1S72A 2NN6G 1Q8KA 1BXTA 1VQPA 1HHVA 3SK5A 3P75A 3M4PA 3CCUA 1SSOA 1KDCA 1T5XD 4DUZL 4A3KG 4DXFA 1E7ZA 1KHIA 3M7GA 4DK0A 1SE8A 1I4RA 1V9PA 5IYCH 5KYIA 2E74C 3JAMi 3I4MH 4DR2Q 1M1KC 2BA1A 1HQRD 1E3PA 1XJVA 1I4GA 1L0YB 4PMCA 1ET6A 5KNBA 3I70A 1I50H 1PTOD 4YWMA 3PIOA 4XDXA 2BDOA 2XN9C 2RKSA 2MO1A 1MKHA 3A74A 4R8IA 3EQLC 2HUGA 1A3VA 3I8ZA 4IUPA 3DWAA 3J80i 2I5MX 1IL2A 3OIPA 4DUYL 3KLSX 1CZWA 2JA8B 3U58A 2DNCA 2UXBQ 3TP7A 1BBWA 1YNNC 3CD6A 2UXCQ 1SYFA 1TS5A 1X65A 4HJ5A 1CT1D 5GROA 1JQYD 2PI2E 1GUOA 3ULPA 2B8FA 1TS4A 4DR3L 2A19A 1KTKA 3UDXA 1N9WA 4B3ML 2EE1A 4X3UA 1MSGA 4G4KA 4RFBA 1H95A 3D6CA 1K3BC 3WOFA 3T13A 4LW1A 1VQIA 4MN3A 3Q0AA 2Z1CA 3RZOH 1D2BA 3GTPB 1DD2A 2EY1A 5IP7G 3OMCA 2EJFC 3GP7A 1SAPA 1SR3A 4HN7A 4DV1Q 4ID6A 3HOVG 3T1HL 3K7AB 3KUPA 4C2MB 3J7AV 2VUMG 1ESFA 5I9PA 4P75A 3K7AH 5C0XI 1NJIC 2EYMA 1YHQA 3AB9A 4GN4B 3UE0A 1VQCA 4DV7Q 1X9NA 1Y1WB 1D7QA 4X64Q 4P2CB 2JJQA 1L2FA 1KRTA 4IALA 3R93A 4C3JB 4QB4A 4B3TQ 1PH4A 4DR1L 4RGNA 4HAEA 4E6IA 4RCOA 2JA6G 4IFDJ 3ND9A 4LFAQ 1HJPA 4FVMA 5C0XJ 4DR2L 3TZDA 1QNKA 1SEBD 4C3HB 1NR4A 2UXDQ 3PGZA 1FR3A 3JC66 4OGQC 1KRSA 3I2ZA 5LL6X 3CCLA 1LTLA 3FKIH 4CJ0B 1IZ6A 1RIPA 1XMOQ 4K8JA 4JBMA 3S2HB 2E2HB 1IBLQ 4IPDA 1BQQT 1STEA 4K5XA 2K5HA 1SE4A 2Q8RE 4QUCA 1LT3D 1MI2A 1FVIA 1O7YA 2JA9A 2NVQH 4JI1Q 5LMNL 1B8AA 2I0QA 4JOIA 1SRUA 5EPKA 2CWAA 4IFDH 5C0XH 3MHBA 3VDYA 3OWFA 4KK7A 1IBKL 5IWAL 1CKNA 4B08A 3CKIB 3PMFA 1NSNS 1D1IA 3EJIA 1CUKA 4A76A 3GTLB 1IBLL 1R4QB 4YHHL 3OW7A 4KY5A 3OPOA 1GUWA 2IX0A 1SN8A 1IYUA 1SNMA 3PUXA 1EYAA 2F3WA 3GDEA 4K2LA 3K8AA 1A63A 3IRBA 2QKIC 2KA7A 5HY6A 3CAMA 2JA7G 3TP8A 2K5QA 1KLUD 3DEOA 2KOLA 3HKZG 2DNEA 1MJEA 3ERSX 4WFN3 5C6AA 5I4DA 1L1OB 1IL8A 1B3AA 2FMCA 1QWYA 3HKZE 2CQOA 1DZ1A 2WB1E 4DA2A 4JI3Q 1DJRD 1RL2A 1PMRA 3G48A 2EY6A 1FNWA 1B3QA 1SNQA 2E2HH 5BR8L 5C44B 2HQLA 3S1RH 2OEOA 4WJ3M 1LTBD 4X64L 1UEAB 2E76C 2F4IA 2BOSA 3MVVA 3I56A 3Q23A 3NK9A 3J80L 3CMAA 1X54A 4A3FH 4OWWB 5ELBA 2ZJPA 4J1MA 3G6EA 4DR6Q 1HUMA 1E1OA 5K36H 4UAIA 3EBEA 1SNPA 4H7BA 4APVA 1OXXK 3I7FA 1HR0Q 2EJGC 3NXWA 2L15A 2F0OA 2EXDA 3NBHA 2NVTH 1UEBA 4JI7L 4JI7Q 2HHHQ 3F1ZA 2F0KA 2OT2A 4P74A 2F0MA 3LNNA 5AJ3Q 3MXGA 3M3YB 4DK6C 2EYPA 4O1NA 1N33L 5BN3A 2JA8G 3WDNA 2RSNA 2ENBA 1IBKQ 2RVLA 2JQOA 5FLXc 4L63B 2XWJB 2GN5A 3JAML 1XNRL 3ZJYC 2UXBL 2PQAA 3VYSA 4A3MH 4JI1L 5LMNQ 1CZGA 4RHRA 1HH2P 1F2YA 3OMGA 5BR8Q 1UE1A 5CYUA 4LF8L 1CM9A 3NELA 5FO7B 1H9MA 1DOKA 2KVMA 4KI0A 2DY7A 1KD1C 1QILA 4ODGA 4DV4Q 4LMQD 4LF4Q 1I94Q 4IJHA 4GLXA 1F2MA 2F0FA 1YHAA 4ME3A 1PZJD 2P5ZX 3UI2A 4X62L 3HOYH 2VNUD 1Z47A 1RDPD 3HOWG 3A5UA 1HUNA 5IT9E 1HR0W 2A69C 3D8GA 1H9JA 1DCZA 5M3MH 4HJAA 4DR5Q 4DR1Q 1QZHA 2VB2X 3IL8A 3SHLA 2K33A 5JJIA 1CI3M 2B2YC 4DR4L 1YNJC 2VY3A 2KHSA 3KLSA 1GO3E 4R4CA 3HOXB 1BOSA 1SNCA 1SLJA 4A3DG 4NP5A 5J1ZA 4A93B 4DK1A 1F9QA 1PRTF 4A3GG 4P73A 1WCMG 1PH8A 1VQ5A 5C4ZA 4DR7Q 5KNDA 1H9KA 3CXCA 1HA5A 3H6MA 2B63G 4GLAC 2F0PA 1IBMQ 3S2DH 4H13C 5EJWA 5FOBB 3D3RA 4GKJQ 1JB3A 4HJ9A 1CSPA 5M9OA 3DEPA 3L2PA 2ICIA 4JI2Q 5IY0A 4Q5VA 2KCMA 5C3EH 2R7ZH 5CBAE 2BE5C 4ZYSA 1CFMA 3I55A 3F2CA 2EZVA 4LFAL 1A15A 2WV6D 5A35A 2HT1A 3TZUA 3QIAA 3CQZB 3PUZA 4DR6L 3NUCA 1GUNA 3ULJA 2L0CA 2R93H 1VF5C 4WRDA 1TT2A 1UWVA 2DJGC 4PG3A 2ZM6L 5IGCA 5ELFA 2MJ8A 2N88A 1A62A 4JI0Q 1BUVT 3CC7A 1A6XA 3PSIA 3C1FA 4BY7H 4BBRH 3FDTA 2A68C 3GTOB 4JI6L 2IL8A 2JA6H 3RLOA 1PZKD 1GOZA 3AQQA 3BDOA 1UE5A 3E9HA 4XYQA 1J9OA 5C5LA 4DGZA 1YITA 4K0KL 5E3FA 3OIQA 4JBJA 3ULLA 3MXNA 2KENA 4BBSG 1BCPB 2MHVA 2YTVA 4ZQ3A 3BVZA 2WKCA 3GTPH 3CC4A 4KKTA 3GTOH 1TU2B 2JN4A 3W1GA 3FEWX 4L5TA 3K5OA 4Y7NH 3HOUG 1Q82C 3G71A 4AH6A 2NWGA 3J7ZC 4JI8Q 2G9DA 5FJ8H 4DUYQ 2N49A 3W3AA 3CCVA 3CC2A 4YIJA 1YEZA 2IX1A 4IQZA 1HFGA 3AFQA 3AMUA 3KF6B 2NTSA 3E0EA 1KDAA 4HR7B 1VQKA 2XVSA 4C3HG 1OTCA 2F1MA 1I5FA 4FDBA 4HJ7A 4ZUIA 5M5WB 1EIYB 3EVQA 2O2LD 2H4OA 4BS9A 3D4RA 3S14B 5C3WA 3NBIA 2EOTA 3OYYA 1K9MC 1TVXA 3A8KE 2CH4W 2R61A 3DM1A 3PO3G 4RHSA 4LJZC 4XQNA 4GNXC 1C4QA 4CBVA 3S15H 1LTSD 5GQOA 1PZID 1Y1WG 4K2KA 4LFBQ 1N34Q 3H3VC 1EYCA 4IUQA 1TWCB 4EQOA 3CP0A 4R4OA 3J81j 3STBC 3HGBA 3CCSA 4IN3A 3SGIA 5IP7H 2RA4A 3BZCA 4GN5A 2H5XA 1CKMA 2Q8TA 2F0LA 4LF7Q 1N33Q 1OXSC 1AN8A 1NBWA 3L3OC 1CA5A 5H1SE 4G57A 2RDHA 4X6AH 1ML0D 1SDFA 1S5CD 3R2TA 4H0LC 4RKLA 2GVBA 4HCEA 3GTLH 1J5EQ 1ASYA 2BH2A 1PRTD 3HOUB 1WYDA 4DNTB 5IGDA 4GKJL 2NVTB 4Y7NB 1HR0L 1SE2A 3CCJA 4A3CG 1VQEA 4A3LG 4JI6Q 3RUZA 3KBGA 4P72A 4IPHA 4DV3L 2EYLA 4OL7A 1UE7A 4IUNA 5IOCA 4ILWA 1Y8NB 1NR2A 3E6ZX 3PIP3 2VL6A 2JP1A 1PA6A 1KIXA 4UDUC 4WJWA 1CHPD 4A3MG 1VS0A 4K8IA 1STAA 4DU9A 1CSQA 2J4XA 5HGTA 3WWVA 1PH1A 4POGA 2GA4B 1ENCA 2KUMA 2L12A 4KY7A 4YY3L 5ELOA 3S1RB 1PHJA 1YVCA 3HOUH 4NXNQ 2ATWA 1B4OA 5M3FG 3NP8A 4CKBA 4NXML 1EYDA 2JE6I 4LF6L 3MWYW 3HG9A 1HPCA 1BCPD 1E0BA 1EZ8A 5EKIA 2H1EA 4BBRB 3EA6A 1ENAA 4LUVA 1SE3A 4DAYA 4KMUC 3TRZA 4OO1H 3VYTA 1SMXA 2WB1B 4JI4Q 2KJXA 2E5LL 1EY6A 4WORA 4OX9Q 4RAUC 2PO4A 5KYLA 4QJFA 1RJTA 1Q7YC 1I6HH 4MTNA 5C0XG 1O78A 2IY5B 3IAYA 1K28A 1VQJA 3J7YW 3S1MH 1IBML 1BDOA 5T1IA 1S5ED 4PV1C 1WTQA 1PFSA 4K5VA 2KBNA 2O4XA 4FF1A 1WCMH 2CVRA 1PFBA 1KQSA 1ILQA 1DM0B 4M8AA 3S2HH 2MFIA 1TWHB 3VYUA 1PV4A 2ZXPA 1LT5D 2XIWA 2N55A 1FJGL 1D5ZC 1Z9FA 2VB3X 3PUYA 3S1NH 3T4AC 1CQFA 2CW0C 2K5NA 3HZXA 2SNSA 4ZRZA 1I6VC 3HOXH 4IFDI 4JI5L 2I07B 1VQGA 4B9WA 2VZAA 1NAPA 1PH6A 3UDGA 1HNXQ 3J7AF 2RSOA 4U68A 3URYA 3VYRA 1ICFB 1I4PA 1AH9A 5E7NA 3F2DA 4J6HA 3DWQA 2RCNA 1XTCD 5AJ3L 3PF4A 4PNYA 3ONAB 4LFCQ 1AEXA 1G51A 3MEHA 2Z4IA 5GAHC 1QVCA 1Y69U 1STHA 4AYBG 4BA1I 3NSWA 3TS2A 2FJ2A 4OWXB 1WTHA 2AWOA 4YCWA 4B3SL 4JI4L 3H15A 3MTSA 3A55A 5HURA 1Y1VB 1STYA 1WTRA 4RGTA 5T1GA 3VR4A 1EQVA 1V1OA 1N8RC 4HSPA 1N32Q 2N3SA 2K75A 1G2TA 1U4LA 2AUKA 4N9PA 1S3OA 3NWTA 4A3FG 2J7ZA 1B1ZA 2VUMH 2HIXA 4UPAA 1K0SA 4A3LH 2OCEA 2N78A 3MXPA 4FF3A 3PUVA 4UHVA 3CRKC 5CMDA 5C4JH 3S16B 4DPGA 4HMJA 3NWSA 1FD7D 2IPKD 2K1BA 4OIJA 5LMNW 1PRTC 1TS2A 3HRZC 1TWFB 1PTOB 1K83H 2K4KA 1J5EL 1XNQL 1CHQD 3GV3A 5JAVA 2R3ZA 1YNXA 3T51B 1JICA 3PQIA 1P8LA 3QWNA 4B3RQ 1BF4A 3CPFA 1V8QA 2HQEA 3W5OA 1ENFA 3H3VI 1X3GA 4JW0A 2Z6BA 1LLRD 1HNXL 2E2IB 3E0JA 1UNSA 4A75A 3K5MA 4HIDA 5FLMG 4X65Q 1SBBB 4DAYB 1YBYA 3KLWA 2MP1A 4V0BA 4C3JG 5IIFA 2YTYA 1PTOF 3GV6A 2O5JC 1JJGA 4GS3A 1QOHA 2VQEQ 2KCTA 2A1AA 2JA7H 2F0EA 1GVPA 1T5EA 2K01A 2MNAA 1DXMA 1LTRD 3E5SA 4KKUA 1QVFA 2AKWB 2JA7B 5ELNA 2JK8A 4IPGA 2O5IC 1AFPA 1KL9A 4N8X1 3GTKB 2YV5A 1EY7A 3KJPA 2QCPX 2RDFA 1NTGA 4K14A 4A93H 1ICWA 4N9TA 1B9NA 4FF4A 3KF8A 4RH6A 2B63H 5NUCA 4QIWB 4DN4M 2K5VA 4YHHQ 3RZDB 3VR5A 3SE0A 1U4PA 2PZUA 1M90C 2R92B 4FXKC 5F2DA 2CW0D 1F2LA 4KHVA 4JOIC 2HDLA 3D6WA 1VQ6A 4JI5Q 5IYBG 4RKBA 1V1QA 2KEDA 2RDGA 5BN4A 5K5PA 2M2LA 4DNRB 4DV7L 4BY1H 2Z8LA 4JI8L 1H9SB 1Z7TA 2JYOA 1IW7C 1LTTD 4DNIA 1VCIA 1STBA 3HOZG 3BZDB 4S3SA 4HIMA 2SEBD 3J7A5 4UY8C 2EYHA 1JOQA 2F0DA 2R93B 1I3QH 3KYHC 3RN2A 3A5ZB 3DLLA 1LO5D 4X3KA 2JA8H 2ZT9C 2SNMA 1CA6A 2D9UA 2RF4A 3K59A 4BBRG 1HTPA 4BWGB 1E2VA 4A3BB 5G3LD 1GD7A 4RGOS 4L5RC 1TR5A 3D4DA 4G7HC 5ELCA 4A3BH 5AFWA 2MPMA 2NVXB 3PCOB 4F7XA 2RBMA 2F0HA 3J81c 4QL5A 2SDFA 5GADC 4RG1A 3PF5A 1EY8A 1WVLA 4O42A 4CDCC 4G7OC 1IKMA 3HOWH 1TWCH 1Y1VG 4F8MA 1D6EC 5M5XH 1SYEA 2FXQA 3KF6A 3M4OB 3L7ZC 2WINB 1PYWD 2Z6KA 3J81L 4JI3L 1F9SA 1PLFA 3MXNB 3HS0C 1V43A 2A5HA 4CHTB 3I3CA 1MBYA 2KHJA 1QB5D 2AQ3B 1WTXA 4DV1L 1CKOA 1L0XB 2NTTA 3QG1A 4EQPA 2EY5A 5LMUQ 1PTOH 2K03A 4R4TA 3A0JA 2CWPA 5EPJA 5IT9c 2VQFL 1YI2A 2Y0SB 1ZYRD 4QGUA 2UUBQ 4NB3A 4LAAA 4A93G 5CV5A 5ELEA 1UUPA 2B2TC 3P1HA 3RLNA 3QR8A 5IWAQ 5IODA 2UUAL 1GJXA 3NENA 1JJCB 4FYDA 2Z9HA 3A54A 1AZPA 3FHWA 1DOMA 4RA8A 1Q86C 1FL0A 2WIIB 1YIJA 1J8IA 4IOCA 4A3JG 3IFDA 4GKKQ 4DK3C 1E2ZA 3Q22A 4QMGA 3V05A 1ILPA 1U9RA 2NN6I 2OXPA 1EFWA 2DY8A 1TXYA 5A2QL 1S5DD 4IUTA 2R7ZG 1TY0A 4CKEA 4EQNA 4ZCKA 1XMOL 3CW2C 3GTQB 3PO2H 5EBDA 4IOAA 4R1JA 2E5LQ 1B50A 1G6PA 2Z4HA 1W6KA 2NVQB 3DMUA 2B2VA 1FGUA 3T16A 1OXUA 4GOPC 2L55A 1OXTA 2NUCA 1IW7D 3SDZA 4DV6L 1EYGA 1JORA 1PVOA 5G3LF 2ASBA 1QUQB 5I9OA 1BVSA 5IP9H 2PW7A 3RZOB 4H02A 2D0OA 5LL6S 1HNWL 1C7YA 3KJOA 5BN5A 2R7ZB 4IUUA 1SFOB 4A3CH 1VQDA 2Q2IA 4JG2A 4KTAA 5C3XA 4QQBX 2E2DC 1PXUA 2ZTDA 2ZJQA 2K5WA 4XTCS 2UUBL 1F9PA 2IHFA 2E2JB 3H0GG 1QJOA 2ZTCA 3H09A 4HMIA 1KNEA 3D4WA 3TN2A 1VDZA 5JEAJ 2SOBA 1EY9A 4KLKA 4A3IH 4A3BG 5LMUL 5DEHA 3OW2A 4JV5L 2B2UC 2B2TA 4N8FA 4LF5L
chains in the Genus database with same CATH topology
5JJZA 1RHPA 4MHEA 3BS1A 1EZ6A 5M5YB 1SYBA 4K6DA 1DONA 4XT1B 1HTLD 5DM73 3QO2A 3KLRA 2MUYA 1RCVD 5CV6A 3MXUA 1JCKB 1XX8A 2IX3A 3D31A 1Y8PB 2QEJC 3NPPA 2KEEA 4QF4A 3P20A 1ZEQX 1SNOA 2WAQB 3LX0A 1SJED 1I4HA 3M7NA 2F3VA 4HEDA 4KJNA 3LWEA 1KLGD 1PFNA 4KKSA 1YNND 2J0TD 3S1NB 5LHY1 1EIHA 1G291 2MGSA 1R4PB 1EQTA 1LV9A 1WD1A 4B9XA 1VMCA 1QNUA 4BA2I 2K7VA 1G2SA 1FYCA 2A73B 3HOYB 3OSOA 4A3DB 1BCPF 3IKJA 1STGA 2I46A 5E4XA 2JEBI 1MGSA 1F9RA 2QILA 1PDQA 2HDMA 3FPPA 4HTHA 3C2PA 3U9OA 2FMMA 4M1UB 1SYGA 3MZ5A 5CV9A 5I6WA 2F0SA 2LY7A 1OXVA 1Q1BA 4R9WA 3GTGB 1CTMA 5M3MB 2EVBA 4BY1B 1WD0A 5ELDA 2EPBA 3A56A 4EGVA 3G7LA 3BDCA 1SYDA 4ZK9B 3I73A 4A3FB 1F77A 1RF2D 2F0TA 4FF2A 4IUVA 4C3IG 5KEEA 1W6JA 3LWUA 4OO1G 2FINB 1SXTA 3QB3A 4RGMA 3SEBA 5FLXE 2ID0A 1WTPA 3TDQA 2C9OA 1EEFD 2IW3A 2QDBA 2D2CC 4ZAIA 3VR2A 1I4XA 2CHBD 4I7ZC 3BVMA 1B9MA 2PYKA 3EFXD 3FRPB 5DNFA 5TSSA 2JA6B 4OO1I 3I4NB 1EL0A 2XSCA 2XRSD 1GXDC 1C48A 3CU7A 5IT9L 5CORA 5EGTA 3K57A 1H9SA 2EY2A 4HCSA 3ERQA 4F87A 2X69A 3RMHA 3I4LA 4CKCA 3HOWB 1KNAA 5K36G 1E2WA 4A3EB 4FP5D 1D1KA 3L9AX 2BE5D 5D3IB 1IKLA 3CRLC 5C4HA 4IZ8A 4U673 4F88A 3I91A 1LTGD 3W2DA 2JXMB 3NTIA 1Z6HA 1TKWB 4EVOA 1JE4A 3OHXC 2QF7A 3TMEA 2OF1A 3SK4A 3K0YA 5IGFA 1EY5A 2JA5B 3HOZB 1A3TA 2KECA 1IHZA 2IWHA 3GTMB 4C1NK 1R9TB 1Q12A 2A68D 4KN7C 5CV7A 1NUCA 5I2XA 3S17B 1JOKA 2A6HD 5JVG3 1M8AA 3NTHA 1LACA 1BNZA 2L5TA 2B2UA 1EU4A 2RQXA 1JC7A 2LMCB 1CK1A 4FXGC 4ULLA 3BYYB 4CJ1B 4PMBA 1GHKA 2DN8A 3K5LA 3EROA 2EXZA 2L4NA 3X3NA 2IJ0A 5JEAG 4XIGS 1DOLA 1AP0A 2NN6H 1JOOA 4TRDA 1JR0D 2A69D 4ME5A 4IFDG 5DM63 2NVYB 1LABA 4K5WA 2VUMB 2NYZD 4XT3B 4CJ2C 3HOVB 4DXGA 1YNJD 2K5DA 2NZ1D 1EY0A 1V1PA 5FO9B 3WOEA 1Q90A 3SVMA 3FPUB 4BBSB 2XRQD 5DAUA 3TSSA 1Q3LA 3MFYA 3BG3A 3KK7A 5ISRA 5CV8A 1U4MA 3NQTA 4CGYB 5FK9C 3HP3A 5I6YA 2X6LA 3JAME 1S5FD 4XQJA 1A2UA 2AQ2B 5M3FB 4DAPA 3R3OA 4R8NA 1B2TA 2K04A 2ZXOA 2EDGA 2HCCA 1WTOA 3SR1A 1KDBA 5IGBA 5KRUA 1QCBD 3I4MB 1A3UA 1TY2A 5E1FA 2A6ED 4K6LA 4GZYC 5JPMC 1AW7A 2L9HA 1EU3A 3J81E 3PO3B 1RD9D 1HFNA 5D3DA 5EQ0A 2F0GA 1GUSA 2V4DA 1XXGA 2B2WC 1Y8OB 3S1QB 1K83B 3NHHA 5KIXA 3DUZA 4NMZA 4X3SA 4XYOA 3K5NA 4ZUJA 1WCMB 1GUGA 3J80E 2A6HC 4A3GB 1H9RA 2PNRC 2K05A 1I50B 1BCPC 2F0JA 4Q0FA 5EKLA 5JOBA 4OHJA 3T56B 3VR6A 1EWCA 3P7JA 5IGEA 4RWSC 4FNFA 1I3QB 1BR9A 1EY4A 1TIID 3ITPA 1Q1EA 5C4JB 1EIGA 1JWMD 4I65A 3N6RA 4DF7A 1O80A 5E4WC 3M4YA 2AQ1B 1TS3A 5FKAC 5JPNC 5CV4A 5CC4A 2NBFA 3ZYYX 3VR3A 3PIO3 1K8MA 5J22A 4ZKCB 3MA2B 5IGGA 5FO8B 4FXDA 5EPLA 3SK6A 2TSSA 2EYOA 5KGUA 3SXHA 3K6OA 3T53B 5JVH3 1S4ZA 1ET9A 3BDLA 1FNUA 4DAVA 1KABA 3C46A 3C1EA 1SMYD 3HEJA 4KV6A 2Q8IB 4KN4C 1HA6A 2PZTA 2EYFA 2EYJA 2JSOA 3DXJC 3A8IE 3G6JB 2LKVA 2IT1A 4A3JB 3NTKA 4L8JA 1K8OA 4TKOB 1D5XC 3CHBD 1O7LA 1ZKOA 4KJOA 1MD2D 3F2UA 3R8BA 2PMZB 1HRJA 3S15B 2A6EC 3DHQA 4PMWA 2B63B 1A2TA 3PUWA 5KNCA 1I6HB 1XYIA 1LTAD 3A7AB 4KY6A 3U9SA 4G7ZC 2AWNA 1B44D 1RODA 1II3A 3PV0A 1ZXTA 3K58A 4DFAA 3MFGA 5D65A 3TP5A 2PZWA 3QOJA 3VA5A 3R2IA 3QOLA 3S9WA 2HCIA 3H91A 2X6GA 2EJMA 4TSSA 4A3IB 3HKZB 4NKLA 4Z9CB 2G9HD 1EEID 1OO9B 1ESRA 3OWEB 1V1PB 4XQQA 4C1NI 1UAPA 3BYTB 4ZLTF 2KCCA 4NW2A 1LT4D 1G91A 1EWHA 2F0IA 1RTOA 5EBCA 2BA0A 3ND8A 4XXEA 1QE6A 1HQMC 1X32A 1LTID 4A3KB 4H44C 4LK1C 4AYBB 2XWBB 1GUTA 2F0NA 4JK1C 3TP6A 3M85A 1D5MC 2WP8J 2LS01 1CQVA 4X3TA 1TQOA 1HCZA 3GTJB 1HXYD 4PQXA 3S1MB 1X3PA 2B2YA 1JWSD 2TMPA 3H94A 1BBXC 2B39A 1WTWA 4QCLA 1SMYC 2D5DA 4FO2A 5FLXL 5C5MA 2JEAI 5CGKA 2NB0A 1FGBD 1SJHD 4TQUS 1TWGB 2XNAC 5J39A 1G8ZD 1FNVA 3V96A 4ABNA 2B8GA 4L6TB 4HSVA 1KAAA 1B53A 5COYA 3BVGA 3H0GB 3I72A 3N52A 1SNDA 2K6AA 3OOCA 2YU9B 1O7ZA 2WACA 3DWPA 4NDXA 1PRTB 5I2YA 4BY7B 1LT6D 1MSHA 1PTOC 4KHZA 2F0QA 3QJYA 3AU7A 1TWAB 2BCOA 1JWUD 3FVQA 4C3IB 3X3MA 1VMPA 3VA7A 3KBXA 2R6GA 2L11A 3SK8A 1G6ZA 4KD3A 2YYZA 5M5XB 5JEAH 2B2VC 4C56C 2B2WA 1ZYRC 5C3EB 2D62A 3PO2B 4J8QA 3V2TA 1WTVA 3NQIA 2VXWA 3GD7A 2K32A 1EOTA 1DYQA 2A74C 1EFID 2F03A 2LFNA 3Q6SA 1RTNA 1C8CA 5C4XB 3Q24A 2F0WA 1ONLA 5A2QE 2FHTA 2FFKB 3A8JE 3RLFA 5CBEE 2BDNA 1VF7A 1XWEA 2CQAA 3O13A 2F0VA 2E75C 2PCFB 4JBWA 2M00A 1U4RA 1PFMA 4MIUA 1STNA 1S5BD 5D14A 2K28A 3GQBA 3MC0B 5CR3A 1AZQA 2PQEA 3C3LA 3FKIB 4V190 2ICEC 4OIKA 2AUJD 4ZKBB 1M4VA 2L1BA 3RD4A 2WKDA 1SYCA 1GHJA 2M9VA 2F0UA 4IURA 1F2ZA 1IYVA 2PW5A 1BO0A 1QG7A 4KD4A 4QUFA 1NCVA 2KQ3A 1Q8IA 1I4QA 3NE5B 3MAQA 2PPBC 3I90A 2C5CA 2KCNA 5EKKA 3IFTA 2ZXRA 3FMCA 4A3MB 3TBIB 4RCNA 3A7LA 1X3QA 3GO5A 1RKNA 3S2DB 2NN6G 1BXTA 1HHVA 3SK5A 3P75A 1SSOA 1KDCA 1T5XD 4DXFA 3M7GA 4DK0A 1I4RA 5KYIA 2E74C 2BA1A 1HQRD 1I4GA 1L0YB 4PMCA 1ET6A 5KNBA 3I70A 1PTOD 4XDXA 2BDOA 2XN9C 2RKSA 4R8IA 3EQLC 2HUGA 1A3VA 3I8ZA 3DWAA 4IUPA 3OIPA 3KLSX 1CZWA 2JA8B 2DNCA 3TP7A 1YNNC 1SYFA 1TS5A 1CT1D 1JQYD 1GUOA 2B8FA 1TS4A 1KTKA 2EE1A 4X3UA 1MSGA 4G4KA 4RFBA 3D6CA 3WOFA 3T13A 4MN3A 3Q0AA 2Z1CA 1D2BA 3GTPB 1DD2A 2EY1A 3OMCA 2EJFC 3GP7A 1SAPA 4HN7A 4ID6A 3K7AB 3KUPA 4C2MB 3J7AV 1ESFA 5I9PA 5C0XI 2EYMA 3AB9A 1Y1WB 4P2CB 4IALA 3R93A 4C3JB 4QB4A 4RGNA 4HAEA 4E6IA 4RCOA 4IFDJ 3ND9A 4FVMA 5C0XJ 3TZDA 1QNKA 1SEBD 4C3HB 1NR4A 1FR3A 4OGQC 5LL6X 4CJ0B 4K8JA 3S2HB 2E2HB 1BQQT 1STEA 4K5XA 1SE4A 2Q8RE 4QUCA 1LT3D 1MI2A 1O7YA 5EPKA 4IFDH 5C0XH 3MHBA 3OWFA 4KK7A 4B08A 3CKIB 3PMFA 1NSNS 1D1IA 3EJIA 3GTLB 1R4QB 3OW7A 4KY5A 3OPOA 1GUWA 2IX0A 1IYUA 1SNMA 3PUXA 1EYAA 2F3WA 4K2LA 2QKIC 2KA7A 3TP8A 2K5QA 1KLUD 3DEOA 2KOLA 2DNEA 4WFN3 5C6AA 5I4DA 1IL8A 1B3AA 2FMCA 1QWYA 1DZ1A 4DA2A 1DJRD 1PMRA 2EY6A 1FNWA 1SNQA 5C44B 2OEOA 1LTBD 1UEAB 2E76C 2F4IA 2BOSA 3MVVA 3Q23A 3NK9A 3J80L 5ELBA 4J1MA 1HUMA 5K36H 4UAIA 4H7BA 1SNPA 1OXXK 2EJGC 3NXWA 2F0OA 3NBHA 2F0KA 2OT2A 2F0MA 3LNNA 3MXGA 3M3YB 2EYPA 4O1NA 5BN3A 3WDNA 2RSNA 2ENBA 2RVLA 4L63B 2XWJB 3JAML 3VYSA 1CZGA 4RHRA 1F2YA 3OMGA 5CYUA 1CM9A 5FO7B 1H9MA 1DOKA 2KVMA 4KI0A 2DY7A 1QILA 4ODGA 4LMQD 1F2MA 2F0FA 1PZJD 3UI2A 2VNUD 1Z47A 1RDPD 1HUNA 5IT9E 2A69C 3D8GA 1H9JA 1DCZA 2VB2X 3IL8A 3SHLA 2K33A 1CI3M 2B2YC 1YNJC 2KHSA 3KLSA 3HOXB 1BOSA 1SNCA 4NP5A 5J1ZA 4A93B 4DK1A 1F9QA 1PRTF 5C4ZA 5KNDA 1H9KA 1HA5A 3H6MA 2F0PA 4H13C 5EJWA 5FOBB 3D3RA 1JB3A 5M9OA 3DEPA 2ICIA 4Q5VA 5CBAE 2BE5C 4ZYSA 1CFMA 2EZVA 1A15A 2WV6D 5A35A 3TZUA 3QIAA 3CQZB 3PUZA 3NUCA 1GUNA 2L0CA 1VF5C 4WRDA 1TT2A 5IGCA 5ELFA 2MJ8A 2N88A 1BUVT 1A6XA 3C1FA 3FDTA 2A68C 3GTOB 2IL8A 1PZKD 1GOZA 3BDOA 4XYQA 1J9OA 5C5LA 4DGZA 5E3FA 3OIQA 3MXNA 1BCPB 2MHVA 4ZQ3A 3BVZA 2WKCA 4KKTA 1TU2B 3FEWX 3K5OA 2NWGA 2G9DA 3W3AA 4YIJA 2IX1A 4IQZA 1HFGA 3AMUA 2NTSA 1KDAA 4HR7B 2XVSA 4C3HG 2F1MA 4ZUIA 5M5WB 3EVQA 2O2LD 2H4OA 4BS9A 3D4RA 3S14B 5C3WA 3NBIA 2EOTA 1TVXA 3A8KE 3DM1A 2R61A 4RHSA 4LJZC 4XQNA 1C4QA 4CBVA 1LTSD 1PZID 4K2KA 3H3VC 1EYCA 4IUQA 1TWCB 4EQOA 3HGBA 4IN3A 2RA4A 2Q8TA 2F0LA 1OXSC 1AN8A 3L3OC 1CA5A 4G57A 2RDHA 1ML0D 1SDFA 1S5CD 3R2TA 4H0LC 4RKLA 4HCEA 3HOUB 1PRTD 4DNTB 5IGDA 2NVTB 4Y7NB 1SE2A 3RUZA 3KBGA 2EYLA 4OL7A 4IUNA 5IOCA 4ILWA 1Y8NB 1NR2A 3E6ZX 3PIP3 2JP1A 4UDUC 4WJWA 1CHPD 4K8IA 1STAA 4DU9A 2J4XA 5HGTA 2GA4B 1ENCA 2KUMA 2L12A 4KY7A 3S1RB 1B4OA 3NP8A 4CKBA 1EYDA 2JE6I 3MWYW 3HG9A 1HPCA 1BCPD 1E0BA 1EZ8A 5EKIA 2H1EA 4BBRB 3EA6A 1ENAA 1SE3A 4DAYA 4KMUC 4OO1H 3VYTA 2WB1B 2KJXA 1EY6A 4WORA 4RAUC 2PO4A 5KYLA 1RJTA 5C0XG 1O78A 3IAYA 3J7YW 1BDOA 5T1IA 1S5ED 4PV1C 1WTQA 4K5VA 2O4XA 4FF1A 2CVRA 1PFBA 1ILQA 1DM0B 4M8AA 1TWHB 3VYUA 2ZXPA 1LT5D 2XIWA 2N55A 1D5ZC 2VB3X 3PUYA 3T4AC 1CQFA 2CW0C 3HZXA 2SNSA 4ZRZA 1I6VC 4IFDI 2I07B 4B9WA 1NAPA 3J7AF 2RSOA 4U68A 3URYA 3VYRA 1I4PA 4J6HA 3DWQA 1XTCD 4PNYA 3ONAB 1AEXA 3MEHA 2Z4IA 1Y69U 1STHA 4BA1I 3NSWA 2FJ2A 2AWOA 3MTSA 3A55A 5HURA 1Y1VB 1STYA 1WTRA 4RGTA 5T1GA 3VR4A 1EQVA 1V1OA 4HSPA 1G2TA 1U4LA 2AUKA 4N9PA 3NWTA 2J7ZA 1B1ZA 3MXPA 4FF3A 3PUVA 3CRKC 5CMDA 3S16B 4HMJA 3NWSA 1FD7D 2IPKD 2K1BA 4OIJA 1PRTC 1TS2A 3HRZC 1TWFB 1PTOB 1CHQD 3GV3A 5JAVA 2R3ZA 3T51B 1JICA 3QWNA 1BF4A 1V8QA 2HQEA 1ENFA 1LLRD 2E2IB 3E0JA 1UNSA 3K5MA 1SBBB 5IIFA 4C3JG 4V0BA 2MP1A 3GV6A 1PTOF 2O5JC 1QOHA 2F0EA 1T5EA 2K01A 1DXMA 1LTRD 3E5SA 4KKUA 2JA7B 2O5IC 1AFPA 3GTKB 1EY7A 2QCPX 2RDFA 4K14A 1ICWA 4N9TA 1B9NA 4FF4A 3KF8A 4RH6A 5NUCA 4QIWB 4DN4M 3RZDB 3VR5A 3SE0A 1U4PA 2PZUA 2R92B 4FXKC 5F2DA 2CW0D 1F2LA 4KHVA 2HDLA 3D6WA 4RKBA 2RDGA 2KEDA 5K5PA 5BN4A 2M2LA 4DNRB 2Z8LA 1H9SB 1Z7TA 2JYOA 1IW7C 1LTTD 1VCIA 1STBA 3BZDB 4S3SA 2SEBD 2EYHA 1JOQA 2F0DA 2R93B 1LO5D 4X3KA 2ZT9C 2SNMA 1CA6A 2D9UA 3K59A 1HTPA 4BWGB 1E2VA 4A3BB 5G3LD 4RGOS 1TR5A 3D4DA 4G7HC 5ELCA 5AFWA 2MPMA 2NVXB 4F7XA 2RBMA 1WVLA 2F0HA 2SDFA 1EY8A 4O42A 4G7OC 1IKMA 4F8MA 1D6EC 1SYEA 3M4OB 3L7ZC 2WINB 1PYWD 3J81L 1F9SA 1PLFA 3HS0C 1V43A 2A5HA 4CHTB 3I3CA 1MBYA 1QB5D 2AQ3B 1WTXA 1L0XB 2NTTA 3QG1A 4EQPA 2EY5A 1PTOH 2K03A 5EPJA 2Y0SB 1ZYRD 4LAAA 5CV5A 5ELEA 1UUPA 2B2TC 3P1HA 5IODA 1GJXA 4FYDA 3A54A 1AZPA 1DOMA 4RA8A 2WIIB 1J8IA 3IFDA 1E2ZA 3Q22A 4QMGA 3V05A 1ILPA 1U9RA 2NN6I 2OXPA 2DY8A 5A2QL 1S5DD 4IUTA 1TY0A 4CKEA 4EQNA 3GTQB 5EBDA 1B50A 2Z4HA 1W6KA 2NVQB 3DMUA 2B2VA 3T16A 1OXUA 2L55A 1OXTA 2NUCA 1IW7D 3SDZA 1JORA 5G3LF 5I9OA 2PW7A 3RZOB 5LL6S 5BN5A 2R7ZB 4IUUA 1SFOB 4KTAA 5C3XA 2E2DC 1PXUA 2K5WA 4XTCS 1F9PA 2E2JB 1QJOA 3H09A 4HMIA 1KNEA 3D4WA 3TN2A 1VDZA 5JEAJ 2SOBA 1EY9A 5DEHA 2B2UC 2B2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUN A;  1JE4 A;  4HSV A;  2HCI A;  1EIG A;  2EPB A;  2L1B A;  3MTS A;  1RHP A;  3G7L A;  1B53 A;  1U4M A;  2KOL A;  3DEO A;  3H91 A;  4MHE A;  5EPJ A;  5COY A;  4DN4 M;  4ZK9 B;  1SAP A;  5JJZ A;  1O80 A;  3HP3 A;  5E4W C;  1B3A A;  1IL8 A;  2X6L A;  1U4P A;  1WTR A;  4IUR A;  5T1G A;  1ILP A;  1DON A;  3IL8 A;  1DZ1 A;  1F2L A;  2B2T C;  3KUP A;  1BO0 A;  2X6G A;  4XT1 B;  1G2T A;  3N52 A;  1QG7 A;  4IUV A;  1U4L A;  4QUF A;  2HDL A;  1NCV A;  2KEC A;  1O7Z A;  2B2Y C;  3D6W A;  3QO2 A;  1B2T A;  1NR2 A;  2FIN B;  2K04 A;  2NWG A;  2J7Z A;  1AZP A;  2JP1 A;  4ZKC B;  2HCC A;  1DOM A;  2KED A;  4RA8 A;  2M2L A;  1WTO A;  1XX8 A;  1J8I A;  1MSH A;  3I90 A;  2KUM A;  2JYO A;  2KEE A;  2L12 A;  3IFD A;  5EPL A;  1F9Q A;  3R93 A;  1WTP A;  1B4O A;  1ESR A;  1HFG A;  5CMD A;  1M8A A;  1S4Z A;  1VMP A;  1X3Q A;  2K1B A;  3MWY W;  1HUM A;  4HED A;  3KBX A;  3LWE A;  4MN3 A;  1E0B A;  4HAE A;  4OIJ A;  5EKI A;  4ZAI A;  4ZLT F;  2DY8 A;  2H1E A;  4UAI A;  1PFN A;  2B2U A;  2L11 A;  4NW2 A;  2L9H A;  1HHV A;  4IUT A;  1G91 A;  1RTO A;  1EIH A;  1G6Z A;  1SSO A;  5EJW A;  1HFN A;  3TZD A;  4CJ1 B;  1QNK A;  2B2V C;  2MGS A;  2EOT A;  1NR4 A;  4X3K A;  2B2W A;  5EQ0 A;  1TVX A;  1QE6 A;  3DEP A;  3GV3 A;  1X32 A;  1HA6 A;  4RAU C;  1CA6 A;  1EQT A;  3DM1 A;  2D9U A;  1RJT A;  2L4N A;  2R3Z A;  1B50 A;  5DNF A;  1LV9 A;  1JIC A;  1WD1 A;  4CJ0 B;  1VMC A;  1WTV A;  5CBA E;  2B2W C;  1BF4 A;  2B2V A;  2VXW A;  5T1I A;  1EL0 A;  1G2S A;  1WTQ A;  1DOL A;  1A15 A;  1AP0 A;  1EOT A;  2CVR A;  1PFB A;  4XDX A;  1ILQ A;  2RSN A;  4IUQ A;  4X3S A;  2RVL A;  3F2U A;  4R8I A;  5AFW A;  2MPM A;  5COR A;  2Q8R E;  5E4X A;  3Q6S A;  4X3T A;  1WVL A;  1RTN A;  2MP1 A;  2SDF A;  2XIW A;  2HUG A;  3GV6 A;  1MGS A;  1F9R A;  2N55 A;  3I8Z A;  1MI2 A;  2K05 A;  4IUP A;  1O7Y A;  2MJ8 A;  2N88 A;  4O42 A;  4QUC A;  1C8C A;  1BNZ A;  1IKM A;  1X3P A;  2B2Y A;  1HRJ A;  1PDQ A;  2HDM A;  2RA4 A;  4IUU A;  4HCS A;  1BBX C;  2NYZ D;  4XT3 B;  4CJ2 C;  2X69 A;  2FHT A;  1WTW A;  2FFK B;  1GUW A;  5EPK A;  2FMM A;  1CM9 A;  3FDT A;  1F9S A;  1PLF A;  2K01 A;  1DOK A;  1NAP A;  2KVM A;  2DY7 A;  5CBE E;  2BDN A;  2Q8T A;  1XYI A;  3I3C A;  2NZ1 D;  2RSO A;  1KNA A;  2IL8 A;  3P7J A;  1WTX A;  4U68 A;  4LMQ D;  1F9P A;  4RWS C;  1CA5 A;  4R9W A;  2EE1 A;  1U4R A;  1PFM A;  1ML0 D;  1ROD A;  1SDF A;  1J9O A;  3ONA B;  4X3U A;  3SVM A;  1ZXT A;  1KNE A;  1IKL A;  3FPU B;  3TN2 A;  1MSG A;  5D14 A;  2K28 A;  3UI2 A;  1AZQ A;  5D65 A;  1WD0 A;  1Q3L A;  3I91 A;  1ICW A;  4OIK A;  2B2U C;  2FJ2 A;  2B2T A;  4ZKB B;  2K03 A; 
#chains in the Genus database with same CATH topology
 5JJZ A;  1RHP A;  3ER0 A;  4MHE A;  4UP8 A;  3BS1 A;  4LF9 L;  1EZ6 A;  3H3V H;  5M5Y B;  1SYB A;  4K6D A;  3OTO Q;  1DON A;  4C3H H;  4XT1 B;  1HTL D;  5DM7 3;  4O2D A;  3QO2 A;  3KLR A;  2MUY A;  1RCV D;  5CV6 A;  3MXU A;  1JCK B;  1XX8 A;  2IX3 A;  1HNW Q;  3D31 A;  1Y8P B;  2QEJ C;  3NPP A;  1L1O C;  2KEE A;  4EX5 A;  4QF4 A;  3P20 A;  1ZEQ X;  5FJ8 G;  1SNO A;  2WAQ B;  1W3S A;  3LX0 A;  1SJE D;  1E1T A;  1I4H A;  3M7N A;  2F3V A;  4HED A;  4KJN A;  1K0R A;  3LWE A;  4A3D H;  1KLG D;  1WJJ A;  1PFN A;  4KKS A;  1YNN D;  3CCM A;  2J0T D;  3S1N B;  5LHY 1;  1EIH A;  5JJK A;  1VQ9 A;  2XTI A;  1G29 1;  2MGS A;  1R4P B;  4C2M H;  4IO9 A;  2GVA A;  2RHQ B;  1EQT A;  1LV9 A;  4P71 A;  1WD1 A;  3W1B A;  4B9X A;  1VMC A;  3M4Q A;  1QNU A;  1KXL A;  4PZ6 A;  3HFZ B;  4BA2 I;  2K7V A;  1G2S A;  1FYC A;  3D0F A;  1XMQ Q;  3KFU A;  3E9I A;  2A73 B;  3CME A;  3HOY B;  4DR7 L;  3OSO A;  4A3D B;  1BCP F;  2WFW A;  3M9B A;  3IKJ A;  1STG A;  2I46 A;  5E4X A;  4A3E H;  2JEB I;  1MGS A;  1F9R A;  1EQR A;  1EUJ A;  2MO0 A;  3K81 C;  2QIL A;  1PDQ A;  2HDM A;  3FPP A;  1XNR Q;  4HTH A;  3C2P A;  1QVG A;  5IE8 A;  3U9O A;  2FMM A;  4M1U B;  3U4Z A;  1SYG A;  2B3G A;  3MZ5 A;  1Y14 B;  4EQ5 A;  5CV9 A;  5I6W A;  2F0S A;  2LY7 A;  1N36 Q;  1WOC A;  1OXV A;  2F4V Q;  1Q1B A;  2HD3 A;  4R9W A;  3GTG B;  2LXJ A;  2VQF Q;  1K8A C;  1CTM A;  4AQY L;  4RMF A;  3F8T A;  5M3M B;  2EVB A;  4JPB W;  4BY1 B;  1WD0 A;  3S14 H;  5ELD A;  3J81 i;  2UXD L;  1NNX A;  2PI2 A;  2EPB A;  3A56 A;  4EGV A;  3G7L A;  3BDC A;  4GOP A;  3GTK H;  3HKS A;  1SYD A;  4ZK9 B;  3I73 A;  4A3F B;  1F77 A;  1RF2 D;  3K0X A;  2F0T A;  4FF2 A;  1C9O A;  1EOV A;  4JVZ A;  4IUV A;  4C3I G;  5KEE A;  1W6J A;  4QY7 A;  3LWU A;  4OO1 G;  2FIN B;  1SXT A;  3MEF A;  1E22 A;  2PNH A;  1GKH A;  4X66 L;  3TQY A;  3QB3 A;  4RGM A;  4LUZ A;  2IHE A;  3M3Y H;  3SEB A;  5FLX E;  3HOY G;  2ZM6 Q;  2ID0 A;  1WTP A;  3TDQ A;  4X65 L;  2C9O A;  1EEF D;  2IW3 A;  5C44 G;  2QDB A;  2D2C C;  4ZAI A;  1YJW A;  3VR2 A;  2AMC B;  1I4X A;  2CHB D;  2DJF C;  2VS1 A;  4I7Z C;  4LF9 Q;  3BVM A;  2KHI A;  1B9M A;  2PYK A;  2OQ0 A;  3EFX D;  3FRP B;  1XNQ Q;  5DNF A;  5TSS A;  2JA6 B;  4LFC L;  4OO1 I;  2WB1 G;  3NEM A;  4AYB E;  3I4N B;  1EL0 A;  2XSC A;  2XRS D;  1GXD C;  2Q2U A;  1C48 A;  3CU7 A;  5IT9 L;  5IYD G;  5COR A;  1VQ4 A;  5EGT A;  3K57 A;  4BXX G;  2UXC L;  1H9S A;  2EY2 A;  1VQO A;  4OON A;  4HCS A;  3ERQ A;  4F87 A;  3J80 c;  2X69 A;  3RMH A;  3I4L A;  1K3R A;  4DV6 Q;  4CKC A;  3HOX G;  3HOW B;  1KNA A;  5K36 G;  1E2W A;  4LFB L;  3EN2 A;  2C35 B;  1YHB A;  2EQS A;  4A3E B;  4FP5 D;  1D1K A;  3L9A X;  2BE5 D;  5D3I B;  2DUD A;  2R7D A;  1X3E A;  4DV0 L;  1IKL A;  3CRL C;  3BJU A;  4IZ8 A;  2AHO B;  5C4H A;  4U67 3;  4F88 A;  2OWO A;  1X6O A;  2BH8 A;  1VQ8 A;  3I91 A;  3I4N G;  1LTG D;  2CFM A;  3W2D A;  2JXM B;  3NTI A;  1Z6H A;  1TKW B;  4X62 Q;  4EVO A;  4DUZ Q;  1JE4 A;  3OHX C;  3BU2 A;  4DV0 Q;  4GOP B;  2QF7 A;  3TME A;  2F4V L;  2OF1 A;  3SK4 A;  3K0Y A;  5IGF A;  2YU9 H;  4DV4 L;  1EY5 A;  4L5Q A;  2JA5 B;  3HOZ B;  1A3T A;  4LF8 Q;  2KEC A;  1IHZ A;  2IWH A;  3TS0 A;  1PH2 A;  3GTM B;  4C1N K;  4NXN L;  3DM3 A;  1YJN A;  1R9T B;  1Q12 A;  2A68 D;  4KN7 C;  5CV7 A;  1NUC A;  1IYJ B;  2ZTE A;  4A3I G;  3B6Y A;  5I2X A;  3S17 B;  1JOK A;  2A6H D;  3KDF A;  5JVG 3;  1M8A A;  3NTH A;  2NVX H;  1LAC A;  1BNZ A;  3S1Q H;  1XMQ L;  2L5T A;  2B2U A;  1AE3 A;  1EU4 A;  2RQX A;  1JC7 A;  2LMC B;  1CK1 A;  4FXG C;  1BKB A;  2PMZ E;  1JJ2 A;  4ULL A;  5FLM H;  3BYY B;  4CJ1 B;  2YTX A;  4PMB A;  1GHK A;  2DN8 A;  1P16 A;  3K5L A;  5C44 H;  2RHS B;  4CDD C;  4OX9 L;  3ERO A;  2EXZ A;  2L4N A;  4J15 A;  3K80 C;  3X3N A;  2IJ0 A;  5JEA G;  1MHW C;  4XIG S;  3CF5 A;  1BBU A;  1DOL A;  5M3M G;  1AP0 A;  2NN6 H;  1JOO A;  4OEM B;  4TRD A;  3G4S A;  3I4M G;  1JR0 D;  2A69 D;  4ME5 A;  4IFD G;  5DM6 3;  2K14 A;  4GNX B;  2NVY B;  1LAB A;  4C3J H;  4K5W A;  2OTL A;  2VUM B;  2NYZ D;  4XT3 B;  4CJ2 C;  3HOV B;  5M5Y H;  1HNZ Q;  2UU9 L;  3PO3 H;  1YNJ D;  2K5D A;  4DXG A;  3U4V A;  2NZ1 D;  4YCV A;  5HGQ A;  1EY0 A;  1V1P A;  5FO9 B;  3WOE A;  1Y1W H;  1Q90 A;  3SVM A;  3FPU B;  4BBS B;  4A4I A;  2XRQ D;  2E2J H;  4LF5 Q;  4JI2 L;  4MTK A;  5DAU A;  3TSS A;  1Q3L A;  3MFY A;  4DAM A;  3M4O H;  3BG3 A;  1NE3 A;  5C4X H;  2N8N A;  3KK7 A;  5ISR A;  5CV8 A;  1U4M A;  3NQT A;  4CGY B;  5FK9 C;  3HP3 A;  3STB D;  2X6L A;  5I6Y A;  4BY1 G;  3JAM E;  4DV2 Q;  1S5F D;  1K8G A;  4XQJ A;  4Y52 H;  1A2U A;  4POF A;  2AQ2 B;  1VQA A;  5M3F B;  4LWC A;  4DAP A;  3R3O A;  4R8N A;  1B2T A;  2K04 A;  2ZXO A;  4WJ4 A;  2EDG A;  2HCC A;  1WTO A;  5EAY A;  3SR1 A;  1KDB A;  5IGB A;  2DGY A;  4JC0 A;  5KRU A;  1QCB D;  3I4M B;  1A3U A;  1TY2 A;  1VQF A;  5E1F A;  2A6E D;  2QDL A;  4K6L A;  4GZY C;  5JPM C;  1AW7 A;  4BY7 G;  2L9H A;  1EU3 A;  3J81 E;  2Q2H A;  3PO3 B;  1RD9 D;  1HFN A;  5DLQ E;  3I4O A;  5D3D A;  5EQ0 A;  1X55 A;  2F0G A;  1GUS A;  2PQA B;  2V4D A;  1XXG A;  2B2W C;  1Y8O B;  3FKI G;  3AFP A;  3S1Q B;  4LF4 L;  1K83 B;  3NHH A;  1LUZ A;  2UUC L;  5KIX A;  5M5W H;  1QZG A;  3DUZ A;  4NMZ A;  4X3S A;  2R92 H;  4XYO A;  3K5N A;  4ZUJ A;  1WCM B;  1GUG A;  1HZC A;  3J80 E;  2A6H C;  4A3G B;  1H9R A;  1PH9 A;  1VQH A;  2PNR C;  2K05 A;  1I50 B;  2VQE L;  1BCP C;  2ALY B;  1C0A A;  1VQB A;  3AEV A;  1WFQ A;  2F0J A;  4Q0F A;  3GTM H;  4TVA B;  5EKL A;  3EIV A;  5JOB A;  4OHJ A;  3T56 B;  3VR6 A;  4DV5 Q;  5J3B A;  1EWC A;  3P7J A;  5IGE A;  5GAE C;  4RWS C;  4JCV E;  1S40 A;  2QA4 A;  4FNF A;  1I3Q B;  1BR9 A;  4JBK A;  1MJC A;  1EY4 A;  4YWL A;  1B70 B;  1TII D;  1D8L A;  1Q1E A;  3ITP A;  2LXK A;  5C4J B;  3S16 H;  1EIG A;  3CCQ A;  1VQL A;  1JWM D;  4B3M Q;  4I65 A;  2ES2 A;  3N6R A;  4DF7 A;  1PH3 A;  1O80 A;  5E4W C;  3M4Y A;  2AQ1 B;  4LF7 L;  3CCE A;  1JMC A;  1TS3 A;  4DV5 L;  5FKA C;  5JPN C;  5CV4 A;  5CC4 A;  2NBF A;  3ZYY X;  1HNZ L;  3VR3 A;  3PIO 3;  2Z6K C;  1K8M A;  5L37 A;  4ZKC B;  3UDI A;  4YCU A;  5J22 A;  3MA2 B;  5IGG A;  1UE6 A;  3U50 C;  3JAM c;  3HOV H;  4CDF C;  5FO8 B;  4JI0 L;  2LSS A;  4X66 Q;  4FXD A;  5EPL A;  2NVY H;  3SK6 A;  3RN5 A;  4DR4 Q;  2TSS A;  2EYO A;  1W2B A;  3KF8 B;  5IYB H;  5KGU A;  3SXH A;  3K6O A;  3T53 B;  5JVH 3;  1S4Z A;  2I5H A;  2F52 A;  1N34 L;  1ET9 A;  2UUC Q;  3BDL A;  1FNU A;  3PO2 G;  4DAV A;  1KAB A;  1XPR A;  1JE5 A;  3C46 A;  3C1E A;  1SMY D;  2Y0S G;  3HEJ A;  1K73 C;  4KV6 A;  2Q8I B;  4KN4 C;  1HA6 A;  2PZT A;  3Q8D A;  4IJL A;  1NMG A;  2EYF A;  4L5S A;  2EYJ A;  2JSO A;  3DXJ C;  3A8I E;  3AYH B;  3G6J B;  4KHP Q;  2LKV A;  2IT1 A;  3TEH B;  4A3J B;  3GTG H;  3NTK A;  4L8J A;  1K8O A;  4DKA C;  4TKO B;  1D5X C;  3CHB D;  1O7L A;  1ZKO A;  4KJO A;  1MD2 D;  3F2U A;  2F3I A;  3GTQ H;  3R8B A;  1NY4 A;  3T1Y L;  1HZ9 A;  2PMZ B;  4LUO A;  1HRJ A;  3S15 B;  2A6E C;  1LM0 A;  2QGQ A;  3DHQ A;  2Y0S E;  4PMW A;  3T1Y Q;  2B63 B;  1A2T A;  3PUW A;  5KNC A;  1I6H B;  4JYA Q;  1XYI A;  4C3I H;  1LTA D;  3A7A B;  4KY6 A;  3U9S A;  4G7Z C;  2AWN A;  1B44 D;  1ROD A;  1II3 A;  3PV0 A;  4O0A A;  1ZXT A;  3K58 A;  4DFA A;  1Q81 C;  3FP9 A;  1A0I A;  3MFG A;  5D65 A;  3TP5 A;  5JJL A;  2PZW A;  3QOJ A;  3VA5 A;  4NPS A;  3NBH B;  3R2I A;  3QOL A;  1PYS B;  2K52 A;  4R4Q A;  3S9W A;  2HCI A;  2JA5 G;  2VW9 A;  4QIW E;  3H91 A;  1B7Y B;  1SFO H;  3PIP A;  1PH5 A;  2K50 A;  2X6G A;  1X3F A;  2EJM A;  4B3T L;  1Q46 A;  4TSS A;  4A3I B;  4YY3 Q;  3HKZ B;  4NKL A;  2Q2T A;  4Z9C B;  5GAG C;  2G9H D;  3S24 A;  1EEI D;  1OO9 B;  4OEL B;  1ESR A;  3OWE B;  1E24 A;  1V1P B;  5C4X G;  1HZB A;  4XQQ A;  1EIF A;  4C1N I;  1UAP A;  3BYT B;  4ZLT F;  2KCC A;  2CCZ A;  4NW2 A;  1LT4 D;  1G91 A;  1EWH A;  2F0I A;  2E2I H;  1RTO A;  4HIK A;  2I5L X;  4B3R L;  1KC8 C;  2NZO A;  5EBC A;  2BA0 A;  2G5D A;  3ND8 A;  3ICE A;  4XXE A;  1QE6 A;  1HQM C;  1X32 A;  4JV5 Q;  1MIU A;  1LTI D;  4MZ9 A;  4A3K B;  5IYD H;  4A3E G;  4H44 C;  4LK1 C;  4AYB B;  3KOJ A;  2XWB B;  1GUT A;  2F0N A;  5C3E G;  4JK1 C;  3GTJ H;  1TWF H;  1O7I A;  3TP6 A;  3M85 A;  1L1O A;  1SRO A;  1VQN A;  1D5M C;  2WP8 J;  2LS0 1;  1CQV A;  4X3T A;  2WAQ G;  2R93 G;  1TQO A;  1HCZ A;  3GTJ B;  1HXY D;  4PQX A;  3S1M B;  1X3P A;  2B2Y A;  1YZ6 A;  1VQM A;  1JWS D;  1XPO A;  1FJG Q;  2TMP A;  3H94 A;  1BBX C;  2B39 A;  2QEX A;  1WTW A;  2XGT A;  4QCL A;  3HOZ H;  1SMY C;  2D5D A;  3E3X A;  4FO2 A;  2EIF A;  4GN3 B;  1JT8 A;  5FLX L;  5C5M A;  1U5K A;  3TRE A;  2JEA I;  5CGK A;  2NB0 A;  1FGB D;  3KDF B;  1SJH D;  2OQK A;  4TQU S;  1TWG B;  1VQ7 A;  2XNA C;  1PYB A;  5J39 A;  1G8Z D;  1FNV A;  2R7F A;  4B3S Q;  3UE1 A;  2R92 G;  1JB7 A;  4AIM A;  3S17 H;  4GLV B;  3LGJ A;  3V96 A;  4ABN A;  2B8G A;  4L6T B;  2WAQ E;  3H0G H;  1XTD A;  4HSV A;  1KAA A;  4AQY Q;  1B53 A;  4UP7 A;  1EWI A;  5COY A;  3BVG A;  3H0G B;  1I94 L;  1N36 L;  3RNU A;  4LNQ A;  1YJ9 A;  3I72 A;  4ALP A;  4JYA L;  2Z0S A;  1CKN B;  4A3K H;  4LF6 Q;  3N52 A;  1SND A;  2K6A A;  3OOC A;  2YU9 B;  4GNX A;  1A8V A;  2B29 A;  1O7Z A;  4HIO A;  2JA5 H;  4GKK L;  2WAC A;  3DWP A;  5M3F H;  5IYC G;  4NDX A;  1PRT B;  5I2Y A;  4BY7 B;  1LT6 D;  1MSH A;  1PTO C;  4KHZ A;  1Y1V H;  3QJY A;  2F0Q A;  3AU7 A;  2V1C C;  1U0L A;  1TWA B;  2BCO A;  1JWU D;  3FVQ A;  4C3I B;  3X3M A;  3RZD H;  2UUA Q;  1VMP A;  3VA7 A;  3KBX A;  3T1H Q;  1GM5 A;  2R6G A;  4DV2 L;  3CPW A;  2L11 A;  1EQQ A;  3CQZ H;  3SK8 A;  2CH4 A;  4A3G H;  3UDF A;  1G6Z A;  4KD3 A;  2YYZ A;  5M5X B;  5JEA H;  2B2V C;  4C56 C;  2HHH L;  2B2W A;  1ZYR C;  4KHP L;  5C3E B;  4OWT B;  4K0K Q;  1TWH H;  2D62 A;  1TWG H;  4UP9 A;  3PO2 B;  4J8Q A;  1AE2 A;  3V2T A;  1WTV A;  1L0W A;  2RCF A;  3NQI A;  2VXW A;  3L0O A;  4DR3 Q;  3GD7 A;  2K32 A;  1EOT A;  1DYQ A;  2ZJR A;  2A74 C;  2E8G A;  2A8V A;  1EFI D;  4NXM Q;  2F03 A;  2UU9 Q;  3CCR A;  2LFN A;  3Q6S A;  1RTN A;  2D0P A;  1C8C A;  3I4N H;  1IXR A;  5C4X B;  4BXX H;  4A3J H;  3Q24 A;  2F0W A;  4I7A A;  1ONL A;  2QW7 A;  5A2Q E;  2FHT A;  2FFK B;  1R9T H;  1DGS A;  4DV3 Q;  3A8J E;  3RLF A;  5CBE E;  2BDN A;  1VF7 A;  1N32 L;  1XWE A;  3OTO L;  1TWA H;  2CQA A;  3O13 A;  2F0V A;  2E75 C;  2PCF B;  4JBW A;  2M00 A;  1X56 A;  4PZ8 A;  1U4R A;  1PFM A;  4MIU A;  1STN A;  1S5B D;  5D14 A;  2K28 A;  3GQB A;  3MC0 B;  4R4I A;  5CR3 A;  1AZQ A;  2PQE A;  3C3L A;  3FKI B;  4V19 0;  2ICE C;  4OIK A;  1KAW A;  2AUJ D;  4ZKB B;  1M4V A;  1QUQ A;  2L1B A;  3RD4 A;  3K7U C;  2WKD A;  1SYC A;  1GHJ A;  4HJ8 A;  2M9V A;  2F0U A;  4OXP A;  4IUR A;  1F2Z A;  2MQH A;  1IYV A;  3BZK A;  1HZA A;  2PW5 A;  4PZ7 A;  5IP9 G;  1BO0 A;  1QG7 A;  4KD4 A;  4QUF A;  1NCV A;  2HIV A;  2KQ3 A;  4BBS H;  2NZH A;  1LYL A;  3F2B A;  1T9H A;  1Q8I A;  1I4Q A;  4MNO A;  1PH7 A;  4IPC A;  2CKZ B;  3NE5 B;  3MAQ A;  2PPB C;  4YWK A;  1ASZ A;  3I90 A;  2C5C A;  2KCN A;  5EKK A;  1WI5 A;  3IFT A;  4CDE C;  2ZXR A;  3FMC A;  2OTJ A;  4A3M B;  3TBI B;  4RCN A;  3A7L A;  1X3Q A;  3GO5 A;  1NMF A;  1RKN A;  3RR5 A;  3S2D B;  4DR5 L;  1XPU A;  1J6Q A;  1S72 A;  2NN6 G;  1Q8K A;  1BXT A;  1VQP A;  1HHV A;  3SK5 A;  3P75 A;  3M4P A;  3CCU A;  1SSO A;  1KDC A;  1T5X D;  4DUZ L;  4A3K G;  4DXF A;  1E7Z A;  1KHI A;  3M7G A;  4DK0 A;  1SE8 A;  1I4R A;  1V9P A;  5IYC H;  5KYI A;  2E74 C;  3JAM i;  3I4M H;  4DR2 Q;  1M1K C;  2BA1 A;  1HQR D;  1E3P A;  1XJV A;  1I4G A;  1L0Y B;  4PMC A;  1ET6 A;  5KNB A;  3I70 A;  1I50 H;  1PTO D;  4YWM A;  3PIO A;  4XDX A;  2BDO A;  2XN9 C;  2RKS A;  2MO1 A;  1MKH A;  3A74 A;  4R8I A;  3EQL C;  2HUG A;  1A3V A;  3I8Z A;  4IUP A;  3DWA A;  3J80 i;  2I5M X;  1IL2 A;  3OIP A;  4DUY L;  3KLS X;  1CZW A;  2JA8 B;  3U58 A;  2DNC A;  2UXB Q;  3TP7 A;  1BBW A;  1YNN C;  3CD6 A;  2UXC Q;  1SYF A;  1TS5 A;  1X65 A;  4HJ5 A;  1CT1 D;  5GRO A;  1JQY D;  2PI2 E;  1GUO A;  3ULP A;  2B8F A;  1TS4 A;  4DR3 L;  2A19 A;  1KTK A;  3UDX A;  1N9W A;  4B3M L;  2EE1 A;  4X3U A;  1MSG A;  4G4K A;  4RFB A;  1H95 A;  3D6C A;  1K3B C;  3WOF A;  3T13 A;  4LW1 A;  1VQI A;  4MN3 A;  3Q0A A;  2Z1C A;  3RZO H;  1D2B A;  3GTP B;  1DD2 A;  2EY1 A;  5IP7 G;  3OMC A;  2EJF C;  3GP7 A;  1SAP A;  1SR3 A;  4HN7 A;  4DV1 Q;  4ID6 A;  3HOV G;  3T1H L;  3K7A B;  3KUP A;  4C2M B;  3J7A V;  2VUM G;  1ESF A;  5I9P A;  4P75 A;  3K7A H;  5C0X I;  1NJI C;  2EYM A;  1YHQ A;  3AB9 A;  4GN4 B;  3UE0 A;  1VQC A;  4DV7 Q;  1X9N A;  1Y1W B;  1D7Q A;  4X64 Q;  4P2C B;  2JJQ A;  1L2F A;  1KRT A;  4IAL A;  3R93 A;  4C3J B;  4QB4 A;  4B3T Q;  1PH4 A;  4DR1 L;  4RGN A;  4HAE A;  4E6I A;  4RCO A;  2JA6 G;  4IFD J;  3ND9 A;  4LFA Q;  1HJP A;  4FVM A;  5C0X J;  4DR2 L;  3TZD A;  1QNK A;  1SEB D;  4C3H B;  1NR4 A;  2UXD Q;  3PGZ A;  1FR3 A;  3JC6 6;  4OGQ C;  1KRS A;  3I2Z A;  5LL6 X;  3CCL A;  1LTL A;  3FKI H;  4CJ0 B;  1IZ6 A;  1RIP A;  1XMO Q;  4K8J A;  4JBM A;  3S2H B;  2E2H B;  1IBL Q;  4IPD A;  1BQQ T;  1STE A;  4K5X A;  2K5H A;  1SE4 A;  2Q8R E;  4QUC A;  1LT3 D;  1MI2 A;  1FVI A;  1O7Y A;  2JA9 A;  2NVQ H;  4JI1 Q;  5LMN L;  1B8A A;  2I0Q A;  4JOI A;  1SRU A;  5EPK A;  2CWA A;  4IFD H;  5C0X H;  3MHB A;  3VDY A;  3OWF A;  4KK7 A;  1IBK L;  5IWA L;  1CKN A;  4B08 A;  3CKI B;  3PMF A;  1NSN S;  1D1I A;  3EJI A;  1CUK A;  4A76 A;  3GTL B;  1IBL L;  1R4Q B;  4YHH L;  3OW7 A;  4KY5 A;  3OPO A;  1GUW A;  2IX0 A;  1SN8 A;  1IYU A;  1SNM A;  3PUX A;  1EYA A;  2F3W A;  3GDE A;  4K2L A;  3K8A A;  1A63 A;  3IRB A;  2QKI C;  2KA7 A;  5HY6 A;  3CAM A;  2JA7 G;  3TP8 A;  2K5Q A;  1KLU D;  3DEO A;  2KOL A;  3HKZ G;  2DNE A;  1MJE A;  3ERS X;  4WFN 3;  5C6A A;  5I4D A;  1L1O B;  1IL8 A;  1B3A A;  2FMC A;  1QWY A;  3HKZ E;  2CQO A;  1DZ1 A;  2WB1 E;  4DA2 A;  4JI3 Q;  1DJR D;  1RL2 A;  1PMR A;  3G48 A;  2EY6 A;  1FNW A;  1B3Q A;  1SNQ A;  2E2H H;  5BR8 L;  5C44 B;  2HQL A;  3S1R H;  2OEO A;  4WJ3 M;  1LTB D;  4X64 L;  1UEA B;  2E76 C;  2F4I A;  2BOS A;  3MVV A;  3I56 A;  3Q23 A;  3NK9 A;  3J80 L;  3CMA A;  1X54 A;  4A3F H;  4OWW B;  5ELB A;  2ZJP A;  4J1M A;  3G6E A;  4DR6 Q;  1HUM A;  1E1O A;  5K36 H;  4UAI A;  3EBE A;  1SNP A;  4H7B A;  4APV A;  1OXX K;  3I7F A;  1HR0 Q;  2EJG C;  3NXW A;  2L15 A;  2F0O A;  2EXD A;  3NBH A;  2NVT H;  1UEB A;  4JI7 L;  4JI7 Q;  2HHH Q;  3F1Z A;  2F0K A;  2OT2 A;  4P74 A;  2F0M A;  3LNN A;  5AJ3 Q;  3MXG A;  3M3Y B;  4DK6 C;  2EYP A;  4O1N A;  1N33 L;  5BN3 A;  2JA8 G;  3WDN A;  2RSN A;  2ENB A;  1IBK Q;  2RVL A;  2JQO A;  5FLX c;  4L63 B;  2XWJ B;  2GN5 A;  3JAM L;  1XNR L;  3ZJY C;  2UXB L;  2PQA A;  3VYS A;  4A3M H;  4JI1 L;  5LMN Q;  1CZG A;  4RHR A;  1HH2 P;  1F2Y A;  3OMG A;  5BR8 Q;  1UE1 A;  5CYU A;  4LF8 L;  1CM9 A;  3NEL A;  5FO7 B;  1H9M A;  1DOK A;  2KVM A;  4KI0 A;  2DY7 A;  1KD1 C;  1QIL A;  4ODG A;  4DV4 Q;  4LMQ D;  4LF4 Q;  1I94 Q;  4IJH A;  4GLX A;  1F2M A;  2F0F A;  1YHA A;  4ME3 A;  1PZJ D;  2P5Z X;  3UI2 A;  4X62 L;  3HOY H;  2VNU D;  1Z47 A;  1RDP D;  3HOW G;  3A5U A;  1HUN A;  5IT9 E;  1HR0 W;  2A69 C;  3D8G A;  1H9J A;  1DCZ A;  5M3M H;  4HJA A;  4DR5 Q;  4DR1 Q;  1QZH A;  2VB2 X;  3IL8 A;  3SHL A;  2K33 A;  5JJI A;  1CI3 M;  2B2Y C;  4DR4 L;  1YNJ C;  2VY3 A;  2KHS A;  3KLS A;  1GO3 E;  4R4C A;  3HOX B;  1BOS A;  1SNC A;  1SLJ A;  4A3D G;  4NP5 A;  5J1Z A;  4A93 B;  4DK1 A;  1F9Q A;  1PRT F;  4A3G G;  4P73 A;  1WCM G;  1PH8 A;  1VQ5 A;  5C4Z A;  4DR7 Q;  5KND A;  1H9K A;  3CXC A;  1HA5 A;  3H6M A;  2B63 G;  4GLA C;  2F0P A;  1IBM Q;  3S2D H;  4H13 C;  5EJW A;  5FOB B;  3D3R A;  4GKJ Q;  1JB3 A;  4HJ9 A;  1CSP A;  5M9O A;  3DEP A;  3L2P A;  2ICI A;  4JI2 Q;  5IY0 A;  4Q5V A;  2KCM A;  5C3E H;  2R7Z H;  5CBA E;  2BE5 C;  4ZYS A;  1CFM A;  3I55 A;  3F2C A;  2EZV A;  4LFA L;  1A15 A;  2WV6 D;  5A35 A;  2HT1 A;  3TZU A;  3QIA A;  3CQZ B;  3PUZ A;  4DR6 L;  3NUC A;  1GUN A;  3ULJ A;  2L0C A;  2R93 H;  1VF5 C;  4WRD A;  1TT2 A;  1UWV A;  2DJG C;  4PG3 A;  2ZM6 L;  5IGC A;  5ELF A;  2MJ8 A;  2N88 A;  1A62 A;  4JI0 Q;  1BUV T;  3CC7 A;  1A6X A;  3PSI A;  3C1F A;  4BY7 H;  4BBR H;  3FDT A;  2A68 C;  3GTO B;  4JI6 L;  2IL8 A;  2JA6 H;  3RLO A;  1PZK D;  1GOZ A;  3AQQ A;  3BDO A;  1UE5 A;  3E9H A;  4XYQ A;  1J9O A;  5C5L A;  4DGZ A;  1YIT A;  4K0K L;  5E3F A;  3OIQ A;  4JBJ A;  3ULL A;  3MXN A;  2KEN A;  4BBS G;  1BCP B;  2MHV A;  2YTV A;  4ZQ3 A;  3BVZ A;  2WKC A;  3GTP H;  3CC4 A;  4KKT A;  3GTO H;  1TU2 B;  2JN4 A;  3W1G A;  3FEW X;  4L5T A;  3K5O A;  4Y7N H;  3HOU G;  1Q82 C;  3G71 A;  4AH6 A;  2NWG A;  3J7Z C;  4JI8 Q;  2G9D A;  5FJ8 H;  4DUY Q;  2N49 A;  3W3A A;  3CCV A;  3CC2 A;  4YIJ A;  1YEZ A;  2IX1 A;  4IQZ A;  1HFG A;  3AFQ A;  3AMU A;  3KF6 B;  2NTS A;  3E0E A;  1KDA A;  4HR7 B;  1VQK A;  2XVS A;  4C3H G;  1OTC A;  2F1M A;  1I5F A;  4FDB A;  4HJ7 A;  4ZUI A;  5M5W B;  1EIY B;  3EVQ A;  2O2L D;  2H4O A;  4BS9 A;  3D4R A;  3S14 B;  5C3W A;  3NBI A;  2EOT A;  3OYY A;  1K9M C;  1TVX A;  3A8K E;  2CH4 W;  2R61 A;  3DM1 A;  3PO3 G;  4RHS A;  4LJZ C;  4XQN A;  4GNX C;  1C4Q A;  4CBV A;  3S15 H;  1LTS D;  5GQO A;  1PZI D;  1Y1W G;  4K2K A;  4LFB Q;  1N34 Q;  3H3V C;  1EYC A;  4IUQ A;  1TWC B;  4EQO A;  3CP0 A;  4R4O A;  3J81 j;  3STB C;  3HGB A;  3CCS A;  4IN3 A;  3SGI A;  5IP7 H;  2RA4 A;  3BZC A;  4GN5 A;  2H5X A;  1CKM A;  2Q8T A;  2F0L A;  4LF7 Q;  1N33 Q;  1OXS C;  1AN8 A;  1NBW A;  3L3O C;  1CA5 A;  5H1S E;  4G57 A;  2RDH A;  4X6A H;  1ML0 D;  1SDF A;  1S5C D;  3R2T A;  4H0L C;  4RKL A;  2GVB A;  4HCE A;  3GTL H;  1J5E Q;  1ASY A;  2BH2 A;  1PRT D;  3HOU B;  1WYD A;  4DNT B;  5IGD A;  4GKJ L;  2NVT B;  4Y7N B;  1HR0 L;  1SE2 A;  3CCJ A;  4A3C G;  1VQE A;  4A3L G;  4JI6 Q;  3RUZ A;  3KBG A;  4P72 A;  4IPH A;  4DV3 L;  2EYL A;  4OL7 A;  1UE7 A;  4IUN A;  5IOC A;  4ILW A;  1Y8N B;  1NR2 A;  3E6Z X;  3PIP 3;  2VL6 A;  2JP1 A;  1PA6 A;  1KIX A;  4UDU C;  4WJW A;  1CHP D;  4A3M G;  1VS0 A;  4K8I A;  1STA A;  4DU9 A;  1CSQ A;  2J4X A;  5HGT A;  3WWV A;  1PH1 A;  4POG A;  2GA4 B;  1ENC A;  2KUM A;  2L12 A;  4KY7 A;  4YY3 L;  5ELO A;  3S1R B;  1PHJ A;  1YVC A;  3HOU H;  4NXN Q;  2ATW A;  1B4O A;  5M3F G;  3NP8 A;  4CKB A;  4NXM L;  1EYD A;  2JE6 I;  4LF6 L;  3MWY W;  3HG9 A;  1HPC A;  1BCP D;  1E0B A;  1EZ8 A;  5EKI A;  2H1E A;  4BBR B;  3EA6 A;  1ENA A;  4LUV A;  1SE3 A;  4DAY A;  4KMU C;  3TRZ A;  4OO1 H;  3VYT A;  1SMX A;  2WB1 B;  4JI4 Q;  2KJX A;  2E5L L;  1EY6 A;  4WOR A;  4OX9 Q;  4RAU C;  2PO4 A;  5KYL A;  4QJF A;  1RJT A;  1Q7Y C;  1I6H H;  4MTN A;  5C0X G;  1O78 A;  2IY5 B;  3IAY A;  1K28 A;  1VQJ A;  3J7Y W;  3S1M H;  1IBM L;  1BDO A;  5T1I A;  1S5E D;  4PV1 C;  1WTQ A;  1PFS A;  4K5V A;  2KBN A;  2O4X A;  4FF1 A;  1WCM H;  2CVR A;  1PFB A;  1KQS A;  1ILQ A;  1DM0 B;  4M8A A;  3S2H H;  2MFI A;  1TWH B;  3VYU A;  1PV4 A;  2ZXP A;  1LT5 D;  2XIW A;  2N55 A;  1FJG L;  1D5Z C;  1Z9F A;  2VB3 X;  3PUY A;  3S1N H;  3T4A C;  1CQF A;  2CW0 C;  2K5N A;  3HZX A;  2SNS A;  4ZRZ A;  1I6V C;  3HOX H;  4IFD I;  4JI5 L;  2I07 B;  1VQG A;  4B9W A;  2VZA A;  1NAP A;  1PH6 A;  3UDG A;  1HNX Q;  3J7A F;  2RSO A;  4U68 A;  3URY A;  3VYR A;  1ICF B;  1I4P A;  1AH9 A;  5E7N A;  3F2D A;  4J6H A;  3DWQ A;  2RCN A;  1XTC D;  5AJ3 L;  3PF4 A;  4PNY A;  3ONA B;  4LFC Q;  1AEX A;  1G51 A;  3MEH A;  2Z4I A;  5GAH C;  1QVC A;  1Y69 U;  1STH A;  4AYB G;  4BA1 I;  3NSW A;  3TS2 A;  2FJ2 A;  4OWX B;  1WTH A;  2AWO A;  4YCW A;  4B3S L;  4JI4 L;  3H15 A;  3MTS A;  3A55 A;  5HUR A;  1Y1V B;  1STY A;  1WTR A;  4RGT A;  5T1G A;  3VR4 A;  1EQV A;  1V1O A;  1N8R C;  4HSP A;  1N32 Q;  2N3S A;  2K75 A;  1G2T A;  1U4L A;  2AUK A;  4N9P A;  1S3O A;  3NWT A;  4A3F G;  2J7Z A;  1B1Z A;  2VUM H;  2HIX A;  4UPA A;  1K0S A;  4A3L H;  2OCE A;  2N78 A;  3MXP A;  4FF3 A;  3PUV A;  4UHV A;  3CRK C;  5CMD A;  5C4J H;  3S16 B;  4DPG A;  4HMJ A;  3NWS A;  1FD7 D;  2IPK D;  2K1B A;  4OIJ A;  5LMN W;  1PRT C;  1TS2 A;  3HRZ C;  1TWF B;  1PTO B;  1K83 H;  2K4K A;  1J5E L;  1XNQ L;  1CHQ D;  3GV3 A;  5JAV A;  2R3Z A;  1YNX A;  3T51 B;  1JIC A;  3PQI A;  1P8L A;  3QWN A;  4B3R Q;  1BF4 A;  3CPF A;  1V8Q A;  2HQE A;  3W5O A;  1ENF A;  3H3V I;  1X3G A;  4JW0 A;  2Z6B A;  1LLR D;  1HNX L;  2E2I B;  3E0J A;  1UNS A;  4A75 A;  3K5M A;  4HID A;  5FLM G;  4X65 Q;  1SBB B;  4DAY B;  1YBY A;  3KLW A;  2MP1 A;  4V0B A;  4C3J G;  5IIF A;  2YTY A;  1PTO F;  3GV6 A;  2O5J C;  1JJG A;  4GS3 A;  1QOH A;  2VQE Q;  2KCT A;  2A1A A;  2JA7 H;  2F0E A;  1GVP A;  1T5E A;  2K01 A;  2MNA A;  1DXM A;  1LTR D;  3E5S A;  4KKU A;  1QVF A;  2AKW B;  2JA7 B;  5ELN A;  2JK8 A;  4IPG A;  2O5I C;  1AFP A;  1KL9 A;  4N8X 1;  3GTK B;  2YV5 A;  1EY7 A;  3KJP A;  2QCP X;  2RDF A;  1NTG A;  4K14 A;  4A93 H;  1ICW A;  4N9T A;  1B9N A;  4FF4 A;  3KF8 A;  4RH6 A;  2B63 H;  5NUC A;  4QIW B;  4DN4 M;  2K5V A;  4YHH Q;  3RZD B;  3VR5 A;  3SE0 A;  1U4P A;  2PZU A;  1M90 C;  2R92 B;  4FXK C;  5F2D A;  2CW0 D;  1F2L A;  4KHV A;  4JOI C;  2HDL A;  3D6W A;  1VQ6 A;  4JI5 Q;  5IYB G;  4RKB A;  1V1Q A;  2KED A;  2RDG A;  5BN4 A;  5K5P A;  2M2L A;  4DNR B;  4DV7 L;  4BY1 H;  2Z8L A;  4JI8 L;  1H9S B;  1Z7T A;  2JYO A;  1IW7 C;  1LTT D;  4DNI A;  1VCI A;  1STB A;  3HOZ G;  3BZD B;  4S3S A;  4HIM A;  2SEB D;  3J7A 5;  4UY8 C;  2EYH A;  1JOQ A;  2F0D A;  2R93 B;  1I3Q H;  3KYH C;  3RN2 A;  3A5Z B;  3DLL A;  1LO5 D;  4X3K A;  2JA8 H;  2ZT9 C;  2SNM A;  1CA6 A;  2D9U A;  2RF4 A;  3K59 A;  4BBR G;  1HTP A;  4BWG B;  1E2V A;  4A3B B;  5G3L D;  1GD7 A;  4RGO S;  4L5R C;  1TR5 A;  3D4D A;  4G7H C;  5ELC A;  4A3B H;  5AFW A;  2MPM A;  2NVX B;  3PCO B;  4F7X A;  2RBM A;  2F0H A;  3J81 c;  4QL5 A;  2SDF A;  5GAD C;  4RG1 A;  3PF5 A;  1EY8 A;  1WVL A;  4O42 A;  4CDC C;  4G7O C;  1IKM A;  3HOW H;  1TWC H;  1Y1V G;  4F8M A;  1D6E C;  5M5X H;  1SYE A;  2FXQ A;  3KF6 A;  3M4O B;  3L7Z C;  2WIN B;  1PYW D;  2Z6K A;  3J81 L;  4JI3 L;  1F9S A;  1PLF A;  3MXN B;  3HS0 C;  1V43 A;  2A5H A;  4CHT B;  3I3C A;  1MBY A;  2KHJ A;  1QB5 D;  2AQ3 B;  1WTX A;  4DV1 L;  1CKO A;  1L0X B;  2NTT A;  3QG1 A;  4EQP A;  2EY5 A;  5LMU Q;  1PTO H;  2K03 A;  4R4T A;  3A0J A;  2CWP A;  5EPJ A;  5IT9 c;  2VQF L;  1YI2 A;  2Y0S B;  1ZYR D;  4QGU A;  2UUB Q;  4NB3 A;  4LAA A;  4A93 G;  5CV5 A;  5ELE A;  1UUP A;  2B2T C;  3P1H A;  3RLN A;  3QR8 A;  5IWA Q;  5IOD A;  2UUA L;  1GJX A;  3NEN A;  1JJC B;  4FYD A;  2Z9H A;  3A54 A;  1AZP A;  3FHW A;  1DOM A;  4RA8 A;  1Q86 C;  1FL0 A;  2WII B;  1YIJ A;  1J8I A;  4IOC A;  4A3J G;  3IFD A;  4GKK Q;  4DK3 C;  1E2Z A;  3Q22 A;  4QMG A;  3V05 A;  1ILP A;  1U9R A;  2NN6 I;  2OXP A;  1EFW A;  2DY8 A;  1TXY A;  5A2Q L;  1S5D D;  4IUT A;  2R7Z G;  1TY0 A;  4CKE A;  4EQN A;  4ZCK A;  1XMO L;  3CW2 C;  3GTQ B;  3PO2 H;  5EBD A;  4IOA A;  4R1J A;  2E5L Q;  1B50 A;  1G6P A;  2Z4H A;  1W6K A;  2NVQ B;  3DMU A;  2B2V A;  1FGU A;  3T16 A;  1OXU A;  4GOP C;  2L55 A;  1OXT A;  2NUC A;  1IW7 D;  3SDZ A;  4DV6 L;  1EYG A;  1JOR A;  1PVO A;  5G3L F;  2ASB A;  1QUQ B;  5I9O A;  1BVS A;  5IP9 H;  2PW7 A;  3RZO B;  4H02 A;  2D0O A;  5LL6 S;  1HNW L;  1C7Y A;  3KJO A;  5BN5 A;  2R7Z B;  4IUU A;  1SFO B;  4A3C H;  1VQD A;  2Q2I A;  4JG2 A;  4KTA A;  5C3X A;  4QQB X;  2E2D C;  1PXU A;  2ZTD A;  2ZJQ A;  2K5W A;  4XTC S;  2UUB L;  1F9P A;  2IHF A;  2E2J B;  3H0G G;  1QJO A;  2ZTC A;  3H09 A;  4HMI A;  1KNE A;  3D4W A;  3TN2 A;  1VDZ A;  5JEA J;  2SOB A;  1EY9 A;  4KLK A;  4A3I H;  4A3B G;  5LMU L;  5DEH A;  3OW2 A;  4JV5 L;  2B2U C;  2B2T A;  4N8F A;  4LF5 L; 
#chains in the Genus database with same CATH homology
 5JJZ A;  1RHP A;  4MHE A;  3BS1 A;  1EZ6 A;  5M5Y B;  1SYB A;  4K6D A;  1DON A;  4XT1 B;  1HTL D;  5DM7 3;  3QO2 A;  3KLR A;  2MUY A;  1RCV D;  5CV6 A;  3MXU A;  1JCK B;  1XX8 A;  2IX3 A;  3D31 A;  1Y8P B;  2QEJ C;  3NPP A;  2KEE A;  4QF4 A;  3P20 A;  1ZEQ X;  1SNO A;  2WAQ B;  3LX0 A;  1SJE D;  1I4H A;  3M7N A;  2F3V A;  4HED A;  4KJN A;  3LWE A;  1KLG D;  1PFN A;  4KKS A;  1YNN D;  2J0T D;  3S1N B;  5LHY 1;  1EIH A;  1G29 1;  2MGS A;  1R4P B;  1EQT A;  1LV9 A;  1WD1 A;  4B9X A;  1VMC A;  1QNU A;  4BA2 I;  2K7V A;  1G2S A;  1FYC A;  2A73 B;  3HOY B;  3OSO A;  4A3D B;  1BCP F;  3IKJ A;  1STG A;  2I46 A;  5E4X A;  2JEB I;  1MGS A;  1F9R A;  2QIL A;  1PDQ A;  2HDM A;  3FPP A;  4HTH A;  3C2P A;  3U9O A;  2FMM A;  4M1U B;  1SYG A;  3MZ5 A;  5CV9 A;  5I6W A;  2F0S A;  2LY7 A;  1OXV A;  1Q1B A;  4R9W A;  3GTG B;  1CTM A;  5M3M B;  2EVB A;  4BY1 B;  1WD0 A;  5ELD A;  2EPB A;  3A56 A;  4EGV A;  3G7L A;  3BDC A;  1SYD A;  4ZK9 B;  3I73 A;  4A3F B;  1F77 A;  1RF2 D;  2F0T A;  4FF2 A;  4IUV A;  4C3I G;  5KEE A;  1W6J A;  3LWU A;  4OO1 G;  2FIN B;  1SXT A;  3QB3 A;  4RGM A;  3SEB A;  5FLX E;  2ID0 A;  1WTP A;  3TDQ A;  2C9O A;  1EEF D;  2IW3 A;  2QDB A;  2D2C C;  4ZAI A;  3VR2 A;  1I4X A;  2CHB D;  4I7Z C;  3BVM A;  1B9M A;  2PYK A;  3EFX D;  3FRP B;  5DNF A;  5TSS A;  2JA6 B;  4OO1 I;  3I4N B;  1EL0 A;  2XSC A;  2XRS D;  1GXD C;  1C48 A;  3CU7 A;  5IT9 L;  5COR A;  5EGT A;  3K57 A;  1H9S A;  2EY2 A;  4HCS A;  3ERQ A;  4F87 A;  2X69 A;  3RMH A;  3I4L A;  4CKC A;  3HOW B;  1KNA A;  5K36 G;  1E2W A;  4A3E B;  4FP5 D;  1D1K A;  3L9A X;  2BE5 D;  5D3I B;  1IKL A;  3CRL C;  5C4H A;  4IZ8 A;  4U67 3;  4F88 A;  3I91 A;  1LTG D;  3W2D A;  2JXM B;  3NTI A;  1Z6H A;  1TKW B;  4EVO A;  1JE4 A;  3OHX C;  2QF7 A;  3TME A;  2OF1 A;  3SK4 A;  3K0Y A;  5IGF A;  1EY5 A;  2JA5 B;  3HOZ B;  1A3T A;  2KEC A;  1IHZ A;  2IWH A;  3GTM B;  4C1N K;  1R9T B;  1Q12 A;  2A68 D;  4KN7 C;  5CV7 A;  1NUC A;  5I2X A;  3S17 B;  1JOK A;  2A6H D;  5JVG 3;  1M8A A;  3NTH A;  1LAC A;  1BNZ A;  2L5T A;  2B2U A;  1EU4 A;  2RQX A;  1JC7 A;  2LMC B;  1CK1 A;  4FXG C;  4ULL A;  3BYY B;  4CJ1 B;  4PMB A;  1GHK A;  2DN8 A;  3K5L A;  3ERO A;  2EXZ A;  2L4N A;  3X3N A;  2IJ0 A;  5JEA G;  4XIG S;  1DOL A;  1AP0 A;  2NN6 H;  1JOO A;  4TRD A;  1JR0 D;  2A69 D;  4ME5 A;  4IFD G;  5DM6 3;  2NVY B;  1LAB A;  4K5W A;  2VUM B;  2NYZ D;  4XT3 B;  4CJ2 C;  3HOV B;  4DXG A;  1YNJ D;  2K5D A;  2NZ1 D;  1EY0 A;  1V1P A;  5FO9 B;  3WOE A;  1Q90 A;  3SVM A;  3FPU B;  4BBS B;  2XRQ D;  5DAU A;  3TSS A;  1Q3L A;  3MFY A;  3BG3 A;  3KK7 A;  5ISR A;  5CV8 A;  1U4M A;  3NQT A;  4CGY B;  5FK9 C;  3HP3 A;  5I6Y A;  2X6L A;  3JAM E;  1S5F D;  4XQJ A;  1A2U A;  2AQ2 B;  5M3F B;  4DAP A;  3R3O A;  4R8N A;  1B2T A;  2K04 A;  2ZXO A;  2EDG A;  2HCC A;  1WTO A;  3SR1 A;  1KDB A;  5IGB A;  5KRU A;  1QCB D;  3I4M B;  1A3U A;  1TY2 A;  5E1F A;  2A6E D;  4K6L A;  4GZY C;  5JPM C;  1AW7 A;  2L9H A;  1EU3 A;  3J81 E;  3PO3 B;  1RD9 D;  1HFN A;  5D3D A;  5EQ0 A;  2F0G A;  1GUS A;  2V4D A;  1XXG A;  2B2W C;  1Y8O B;  3S1Q B;  1K83 B;  3NHH A;  5KIX A;  3DUZ A;  4NMZ A;  4X3S A;  4XYO A;  3K5N A;  4ZUJ A;  1WCM B;  1GUG A;  3J80 E;  2A6H C;  4A3G B;  1H9R A;  2PNR C;  2K05 A;  1I50 B;  1BCP C;  2F0J A;  4Q0F A;  5EKL A;  5JOB A;  4OHJ A;  3T56 B;  3VR6 A;  1EWC A;  3P7J A;  5IGE A;  4RWS C;  4FNF A;  1I3Q B;  1BR9 A;  1EY4 A;  1TII D;  3ITP A;  1Q1E A;  5C4J B;  1EIG A;  1JWM D;  4I65 A;  3N6R A;  4DF7 A;  1O80 A;  5E4W C;  3M4Y A;  2AQ1 B;  1TS3 A;  5FKA C;  5JPN C;  5CV4 A;  5CC4 A;  2NBF A;  3ZYY X;  3VR3 A;  3PIO 3;  1K8M A;  5J22 A;  4ZKC B;  3MA2 B;  5IGG A;  5FO8 B;  4FXD A;  5EPL A;  3SK6 A;  2TSS A;  2EYO A;  5KGU A;  3SXH A;  3K6O A;  3T53 B;  5JVH 3;  1S4Z A;  1ET9 A;  3BDL A;  1FNU A;  4DAV A;  1KAB A;  3C46 A;  3C1E A;  1SMY D;  3HEJ A;  4KV6 A;  2Q8I B;  4KN4 C;  1HA6 A;  2PZT A;  2EYF A;  2EYJ A;  2JSO A;  3DXJ C;  3A8I E;  3G6J B;  2LKV A;  2IT1 A;  4A3J B;  3NTK A;  4L8J A;  1K8O A;  4TKO B;  1D5X C;  3CHB D;  1O7L A;  1ZKO A;  4KJO A;  1MD2 D;  3F2U A;  3R8B A;  2PMZ B;  1HRJ A;  3S15 B;  2A6E C;  3DHQ A;  4PMW A;  2B63 B;  1A2T A;  3PUW A;  5KNC A;  1I6H B;  1XYI A;  1LTA D;  3A7A B;  4KY6 A;  3U9S A;  4G7Z C;  2AWN A;  1B44 D;  1ROD A;  1II3 A;  3PV0 A;  1ZXT A;  3K58 A;  4DFA A;  3MFG A;  5D65 A;  3TP5 A;  2PZW A;  3QOJ A;  3VA5 A;  3R2I A;  3QOL A;  3S9W A;  2HCI A;  3H91 A;  2X6G A;  2EJM A;  4TSS A;  4A3I B;  3HKZ B;  4NKL A;  4Z9C B;  2G9H D;  1EEI D;  1OO9 B;  1ESR A;  3OWE B;  1V1P B;  4XQQ A;  4C1N I;  1UAP A;  3BYT B;  4ZLT F;  2KCC A;  4NW2 A;  1LT4 D;  1G91 A;  1EWH A;  2F0I A;  1RTO A;  5EBC A;  2BA0 A;  3ND8 A;  4XXE A;  1QE6 A;  1HQM C;  1X32 A;  1LTI D;  4A3K B;  4H44 C;  4LK1 C;  4AYB B;  2XWB B;  1GUT A;  2F0N A;  4JK1 C;  3TP6 A;  3M85 A;  1D5M C;  2WP8 J;  2LS0 1;  1CQV A;  4X3T A;  1TQO A;  1HCZ A;  3GTJ B;  1HXY D;  4PQX A;  3S1M B;  1X3P A;  2B2Y A;  1JWS D;  2TMP A;  3H94 A;  1BBX C;  2B39 A;  1WTW A;  4QCL A;  1SMY C;  2D5D A;  4FO2 A;  5FLX L;  5C5M A;  2JEA I;  5CGK A;  2NB0 A;  1FGB D;  1SJH D;  4TQU S;  1TWG B;  2XNA C;  5J39 A;  1G8Z D;  1FNV A;  3V96 A;  4ABN A;  2B8G A;  4L6T B;  4HSV A;  1KAA A;  1B53 A;  5COY A;  3BVG A;  3H0G B;  3I72 A;  3N52 A;  1SND A;  2K6A A;  3OOC A;  2YU9 B;  1O7Z A;  2WAC A;  3DWP A;  4NDX A;  1PRT B;  5I2Y A;  4BY7 B;  1LT6 D;  1MSH A;  1PTO C;  4KHZ A;  2F0Q A;  3QJY A;  3AU7 A;  1TWA B;  2BCO A;  1JWU D;  3FVQ A;  4C3I B;  3X3M A;  1VMP A;  3VA7 A;  3KBX A;  2R6G A;  2L11 A;  3SK8 A;  1G6Z A;  4KD3 A;  2YYZ A;  5M5X B;  5JEA H;  2B2V C;  4C56 C;  2B2W A;  1ZYR C;  5C3E B;  2D62 A;  3PO2 B;  4J8Q A;  3V2T A;  1WTV A;  3NQI A;  2VXW A;  3GD7 A;  2K32 A;  1EOT A;  1DYQ A;  2A74 C;  1EFI D;  2F03 A;  2LFN A;  3Q6S A;  1RTN A;  1C8C A;  5C4X B;  3Q24 A;  2F0W A;  1ONL A;  5A2Q E;  2FHT A;  2FFK B;  3A8J E;  3RLF A;  5CBE E;  2BDN A;  1VF7 A;  1XWE A;  2CQA A;  3O13 A;  2F0V A;  2E75 C;  2PCF B;  4JBW A;  2M00 A;  1U4R A;  1PFM A;  4MIU A;  1STN A;  1S5B D;  5D14 A;  2K28 A;  3GQB A;  3MC0 B;  5CR3 A;  1AZQ A;  2PQE A;  3C3L A;  3FKI B;  4V19 0;  2ICE C;  4OIK A;  2AUJ D;  4ZKB B;  1M4V A;  2L1B A;  3RD4 A;  2WKD A;  1SYC A;  1GHJ A;  2M9V A;  2F0U A;  4IUR A;  1F2Z A;  1IYV A;  2PW5 A;  1BO0 A;  1QG7 A;  4KD4 A;  4QUF A;  1NCV A;  2KQ3 A;  1Q8I A;  1I4Q A;  3NE5 B;  3MAQ A;  2PPB C;  3I90 A;  2C5C A;  2KCN A;  5EKK A;  3IFT A;  2ZXR A;  3FMC A;  4A3M B;  3TBI B;  4RCN A;  3A7L A;  1X3Q A;  3GO5 A;  1RKN A;  3S2D B;  2NN6 G;  1BXT A;  1HHV A;  3SK5 A;  3P75 A;  1SSO A;  1KDC A;  1T5X D;  4DXF A;  3M7G A;  4DK0 A;  1I4R A;  5KYI A;  2E74 C;  2BA1 A;  1HQR D;  1I4G A;  1L0Y B;  4PMC A;  1ET6 A;  5KNB A;  3I70 A;  1PTO D;  4XDX A;  2BDO A;  2XN9 C;  2RKS A;  4R8I A;  3EQL C;  2HUG A;  1A3V A;  3I8Z A;  3DWA A;  4IUP A;  3OIP A;  3KLS X;  1CZW A;  2JA8 B;  2DNC A;  3TP7 A;  1YNN C;  1SYF A;  1TS5 A;  1CT1 D;  1JQY D;  1GUO A;  2B8F A;  1TS4 A;  1KTK A;  2EE1 A;  4X3U A;  1MSG A;  4G4K A;  4RFB A;  3D6C A;  3WOF A;  3T13 A;  4MN3 A;  3Q0A A;  2Z1C A;  1D2B A;  3GTP B;  1DD2 A;  2EY1 A;  3OMC A;  2EJF C;  3GP7 A;  1SAP A;  4HN7 A;  4ID6 A;  3K7A B;  3KUP A;  4C2M B;  3J7A V;  1ESF A;  5I9P A;  5C0X I;  2EYM A;  3AB9 A;  1Y1W B;  4P2C B;  4IAL A;  3R93 A;  4C3J B;  4QB4 A;  4RGN A;  4HAE A;  4E6I A;  4RCO A;  4IFD J;  3ND9 A;  4FVM A;  5C0X J;  3TZD A;  1QNK A;  1SEB D;  4C3H B;  1NR4 A;  1FR3 A;  4OGQ C;  5LL6 X;  4CJ0 B;  4K8J A;  3S2H B;  2E2H B;  1BQQ T;  1STE A;  4K5X A;  1SE4 A;  2Q8R E;  4QUC A;  1LT3 D;  1MI2 A;  1O7Y A;  5EPK A;  4IFD H;  5C0X H;  3MHB A;  3OWF A;  4KK7 A;  4B08 A;  3CKI B;  3PMF A;  1NSN S;  1D1I A;  3EJI A;  3GTL B;  1R4Q B;  3OW7 A;  4KY5 A;  3OPO A;  1GUW A;  2IX0 A;  1IYU A;  1SNM A;  3PUX A;  1EYA A;  2F3W A;  4K2L A;  2QKI C;  2KA7 A;  3TP8 A;  2K5Q A;  1KLU D;  3DEO A;  2KOL A;  2DNE A;  4WFN 3;  5C6A A;  5I4D A;  1IL8 A;  1B3A A;  2FMC A;  1QWY A;  1DZ1 A;  4DA2 A;  1DJR D;  1PMR A;  2EY6 A;  1FNW A;  1SNQ A;  5C44 B;  2OEO A;  1LTB D;  1UEA B;  2E76 C;  2F4I A;  2BOS A;  3MVV A;  3Q23 A;  3NK9 A;  3J80 L;  5ELB A;  4J1M A;  1HUM A;  5K36 H;  4UAI A;  4H7B A;  1SNP A;  1OXX K;  2EJG C;  3NXW A;  2F0O A;  3NBH A;  2F0K A;  2OT2 A;  2F0M A;  3LNN A;  3MXG A;  3M3Y B;  2EYP A;  4O1N A;  5BN3 A;  3WDN A;  2RSN A;  2ENB A;  2RVL A;  4L63 B;  2XWJ B;  3JAM L;  3VYS A;  1CZG A;  4RHR A;  1F2Y A;  3OMG A;  5CYU A;  1CM9 A;  5FO7 B;  1H9M A;  1DOK A;  2KVM A;  4KI0 A;  2DY7 A;  1QIL A;  4ODG A;  4LMQ D;  1F2M A;  2F0F A;  1PZJ D;  3UI2 A;  2VNU D;  1Z47 A;  1RDP D;  1HUN A;  5IT9 E;  2A69 C;  3D8G A;  1H9J A;  1DCZ A;  2VB2 X;  3IL8 A;  3SHL A;  2K33 A;  1CI3 M;  2B2Y C;  1YNJ C;  2KHS A;  3KLS A;  3HOX B;  1BOS A;  1SNC A;  4NP5 A;  5J1Z A;  4A93 B;  4DK1 A;  1F9Q A;  1PRT F;  5C4Z A;  5KND A;  1H9K A;  1HA5 A;  3H6M A;  2F0P A;  4H13 C;  5EJW A;  5FOB B;  3D3R A;  1JB3 A;  5M9O A;  3DEP A;  2ICI A;  4Q5V A;  5CBA E;  2BE5 C;  4ZYS A;  1CFM A;  2EZV A;  1A15 A;  2WV6 D;  5A35 A;  3TZU A;  3QIA A;  3CQZ B;  3PUZ A;  3NUC A;  1GUN A;  2L0C A;  1VF5 C;  4WRD A;  1TT2 A;  5IGC A;  5ELF A;  2MJ8 A;  2N88 A;  1BUV T;  1A6X A;  3C1F A;  3FDT A;  2A68 C;  3GTO B;  2IL8 A;  1PZK D;  1GOZ A;  3BDO A;  4XYQ A;  1J9O A;  5C5L A;  4DGZ A;  5E3F A;  3OIQ A;  3MXN A;  1BCP B;  2MHV A;  4ZQ3 A;  3BVZ A;  2WKC A;  4KKT A;  1TU2 B;  3FEW X;  3K5O A;  2NWG A;  2G9D A;  3W3A A;  4YIJ A;  2IX1 A;  4IQZ A;  1HFG A;  3AMU A;  2NTS A;  1KDA A;  4HR7 B;  2XVS A;  4C3H G;  2F1M A;  4ZUI A;  5M5W B;  3EVQ A;  2O2L D;  2H4O A;  4BS9 A;  3D4R A;  3S14 B;  5C3W A;  3NBI A;  2EOT A;  1TVX A;  3A8K E;  3DM1 A;  2R61 A;  4RHS A;  4LJZ C;  4XQN A;  1C4Q A;  4CBV A;  1LTS D;  1PZI D;  4K2K A;  3H3V C;  1EYC A;  4IUQ A;  1TWC B;  4EQO A;  3HGB A;  4IN3 A;  2RA4 A;  2Q8T A;  2F0L A;  1OXS C;  1AN8 A;  3L3O C;  1CA5 A;  4G57 A;  2RDH A;  1ML0 D;  1SDF A;  1S5C D;  3R2T A;  4H0L C;  4RKL A;  4HCE A;  3HOU B;  1PRT D;  4DNT B;  5IGD A;  2NVT B;  4Y7N B;  1SE2 A;  3RUZ A;  3KBG A;  2EYL A;  4OL7 A;  4IUN A;  5IOC A;  4ILW A;  1Y8N B;  1NR2 A;  3E6Z X;  3PIP 3;  2JP1 A;  4UDU C;  4WJW A;  1CHP D;  4K8I A;  1STA A;  4DU9 A;  2J4X A;  5HGT A;  2GA4 B;  1ENC A;  2KUM A;  2L12 A;  4KY7 A;  3S1R B;  1B4O A;  3NP8 A;  4CKB A;  1EYD A;  2JE6 I;  3MWY W;  3HG9 A;  1HPC A;  1BCP D;  1E0B A;  1EZ8 A;  5EKI A;  2H1E A;  4BBR B;  3EA6 A;  1ENA A;  1SE3 A;  4DAY A;  4KMU C;  4OO1 H;  3VYT A;  2WB1 B;  2KJX A;  1EY6 A;  4WOR A;  4RAU C;  2PO4 A;  5KYL A;  1RJT A;  5C0X G;  1O78 A;  3IAY A;  3J7Y W;  1BDO A;  5T1I A;  1S5E D;  4PV1 C;  1WTQ A;  4K5V A;  2O4X A;  4FF1 A;  2CVR A;  1PFB A;  1ILQ A;  1DM0 B;  4M8A A;  1TWH B;  3VYU A;  2ZXP A;  1LT5 D;  2XIW A;  2N55 A;  1D5Z C;  2VB3 X;  3PUY A;  3T4A C;  1CQF A;  2CW0 C;  3HZX A;  2SNS A;  4ZRZ A;  1I6V C;  4IFD I;  2I07 B;  4B9W A;  1NAP A;  3J7A F;  2RSO A;  4U68 A;  3URY A;  3VYR A;  1I4P A;  4J6H A;  3DWQ A;  1XTC D;  4PNY A;  3ONA B;  1AEX A;  3MEH A;  2Z4I A;  1Y69 U;  1STH A;  4BA1 I;  3NSW A;  2FJ2 A;  2AWO A;  3MTS A;  3A55 A;  5HUR A;  1Y1V B;  1STY A;  1WTR A;  4RGT A;  5T1G A;  3VR4 A;  1EQV A;  1V1O A;  4HSP A;  1G2T A;  1U4L A;  2AUK A;  4N9P A;  3NWT A;  2J7Z A;  1B1Z A;  3MXP A;  4FF3 A;  3PUV A;  3CRK C;  5CMD A;  3S16 B;  4HMJ A;  3NWS A;  1FD7 D;  2IPK D;  2K1B A;  4OIJ A;  1PRT C;  1TS2 A;  3HRZ C;  1TWF B;  1PTO B;  1CHQ D;  3GV3 A;  5JAV A;  2R3Z A;  3T51 B;  1JIC A;  3QWN A;  1BF4 A;  1V8Q A;  2HQE A;  1ENF A;  1LLR D;  2E2I B;  3E0J A;  1UNS A;  3K5M A;  1SBB B;  5IIF A;  4C3J G;  4V0B A;  2MP1 A;  3GV6 A;  1PTO F;  2O5J C;  1QOH A;  2F0E A;  1T5E A;  2K01 A;  1DXM A;  1LTR D;  3E5S A;  4KKU A;  2JA7 B;  2O5I C;  1AFP A;  3GTK B;  1EY7 A;  2QCP X;  2RDF A;  4K14 A;  1ICW A;  4N9T A;  1B9N A;  4FF4 A;  3KF8 A;  4RH6 A;  5NUC A;  4QIW B;  4DN4 M;  3RZD B;  3VR5 A;  3SE0 A;  1U4P A;  2PZU A;  2R92 B;  4FXK C;  5F2D A;  2CW0 D;  1F2L A;  4KHV A;  2HDL A;  3D6W A;  4RKB A;  2RDG A;  2KED A;  5K5P A;  5BN4 A;  2M2L A;  4DNR B;  2Z8L A;  1H9S B;  1Z7T A;  2JYO A;  1IW7 C;  1LTT D;  1VCI A;  1STB A;  3BZD B;  4S3S A;  2SEB D;  2EYH A;  1JOQ A;  2F0D A;  2R93 B;  1LO5 D;  4X3K A;  2ZT9 C;  2SNM A;  1CA6 A;  2D9U A;  3K59 A;  1HTP A;  4BWG B;  1E2V A;  4A3B B;  5G3L D;  4RGO S;  1TR5 A;  3D4D A;  4G7H C;  5ELC A;  5AFW A;  2MPM A;  2NVX B;  4F7X A;  2RBM A;  1WVL A;  2F0H A;  2SDF A;  1EY8 A;  4O42 A;  4G7O C;  1IKM A;  4F8M A;  1D6E C;  1SYE A;  3M4O B;  3L7Z C;  2WIN B;  1PYW D;  3J81 L;  1F9S A;  1PLF A;  3HS0 C;  1V43 A;  2A5H A;  4CHT B;  3I3C A;  1MBY A;  1QB5 D;  2AQ3 B;  1WTX A;  1L0X B;  2NTT A;  3QG1 A;  4EQP A;  2EY5 A;  1PTO H;  2K03 A;  5EPJ A;  2Y0S B;  1ZYR D;  4LAA A;  5CV5 A;  5ELE A;  1UUP A;  2B2T C;  3P1H A;  5IOD A;  1GJX A;  4FYD A;  3A54 A;  1AZP A;  1DOM A;  4RA8 A;  2WII B;  1J8I A;  3IFD A;  1E2Z A;  3Q22 A;  4QMG A;  3V05 A;  1ILP A;  1U9R A;  2NN6 I;  2OXP A;  2DY8 A;  5A2Q L;  1S5D D;  4IUT A;  1TY0 A;  4CKE A;  4EQN A;  3GTQ B;  5EBD A;  1B50 A;  2Z4H A;  1W6K A;  2NVQ B;  3DMU A;  2B2V A;  3T16 A;  1OXU A;  2L55 A;  1OXT A;  2NUC A;  1IW7 D;  3SDZ A;  1JOR A;  5G3L F;  5I9O A;  2PW7 A;  3RZO B;  5LL6 S;  5BN5 A;  2R7Z B;  4IUU A;  1SFO B;  4KTA A;  5C3X A;  2E2D C;  1PXU A;  2K5W A;  4XTC S;  1F9P A;  2E2J B;  1QJO A;  3H09 A;  4HMI A;  1KNE A;  3D4W A;  3TN2 A;  1VDZ A;  5JEA J;  2SOB A;  1EY9 A;  5DEH A;  2B2U C;  2B2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...