5EKIA

Crystal structure of truncated ccl21
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
QDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 21
publication title Crystallographic Structure of Truncated CCL21 and the Putative Sulfotyrosine-Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ekiA00
4HAEA 5D14A 5CMDA 1U4LA 3DM1A 1WTQA 4IUQA 1QE6A 3F2UA 4QUCA 3MWYW 2Q8TA 4MN3A 5T1IA 4CJ2C 1B4OA 3I90A 4XT3B 3IFDA 4DN4M 1F9PA 1DOKA 1BF4A 2MP1A 1EQTA 3GV6A 1PLFA 2HUGA 2FFKB 1WVLA 4ZAIA 4U68A 3I91A 5CBEE 1BNZA 2B2TC 1EIGA 3TZDA 2L4NA 1AZQA 5AFWA 2EE1A 2KUMA 1EOTA 1NR4A 3D6WA 1U4PA 1X3QA 4XT1B 4UAIA 2K05A 1HUMA 1RHPA 4CJ0B 1B2TA 2L9HA 1WD0A 1CA5A 4CJ1B 1J8IA 4HCSA 5CBAE 1KNAA 3P7JA 4X3UA 3GV3A 2KEDA 3G7LA 4ZLTF 3KBXA 1Q3LA 4IUPA 2MGSA 2RSNA 2XIWA 1M8AA 5CORA 5EQ0A 1F2LA 1EL0A 1MI2A 1PDQA 3TN2A 1DONA 1AZPA 1O7YA 4X3TA 1ICWA 3I8ZA 1U4RA 1ML0D 2N88A 2NWGA 3H91A 4IURA 4OIJA 4OIKA 3UI2A 2M2LA 4MHEA 1WTOA 1SDFA 2D9UA 1CM9A 2L11A 1KNEA 1O80A 3KUPA 4RWSC 1HA6A 1CA6A 1DZ1A 2FHTA 2B2UA 4O42A 1WTRA 2B2VA 1A15A 1JICA 2FMMA 2JP1A 1XYIA 2J7ZA 3DEPA 4X3KA 1AP0A 5EPKA 1SSOA 2CVRA 2FJ2A 4IUUA 1B50A 4X3SA 1J9OA 1ESRA 1U4MA 2FINB 1VMCA 4NW2A 1JE4A 1G2TA 1NAPA 1DOLA 3I3CA 3QO2A 4XDXA 4QUFA 2EPBA 1TVXA 4HSVA 1S4ZA 4ZKCB 1VMPA 4RA8A 2L1BA 2B2YA 1WTPA 1PFMA 1X32A 1X3PA 5COYA 3DEOA 5EKIA 1WTXA 2HDMA 1HFNA 2KEEA 2VXWA 1BBXC 2HCIA 2RA4A 1NCVA 2IL8A 2NYZD 2RVLA 5D65A 4LMQD 4ZKBB 1HFGA 2B2UC 1ILQA 3R93A 5EPJA 2EOTA 2B2WA 1WTWA 1O7ZA 2R3ZA 1RTOA 1QG7A 2MPMA 4IUVA 1MSHA 5T1GA 1HHVA 3LWEA 3ONAB 3SVMA 1BO0A 1F9SA 2KVMA 3MTSA 3Q6SA 1LV9A 3N52A 4R9WA 1HRJA 1WD1A 1XX8A 1E0BA 2K1BA 1G2SA 3IL8A 1QNKA 2HDLA 1C8CA 2K04A 2HCCA 2H1EA 5E4WC 1DOMA 5DNFA 2B2YC 1PFBA 4R8IA 1WTVA 1GUWA 1F9RA 2L12A 4HEDA 1G6ZA 1F9QA 2X6LA 1NR2A 1IL8A 1ZXTA 1EIHA 2SDFA 2K28A 1IKLA 1B3AA 1MSGA 2B2TA 2BDNA 1SAPA 2X6GA 2JYOA 2Q8RE 4ZK9B 1G91A 2K03A 2NZ1D 2MJ8A 1B53A 3FDTA 4IUTA 4RAUC 5E4XA 1PFNA 2KOLA 1IKMA 1ILPA 3HP3A 2K01A 2B2WC 1RJTA 1RTNA 1MGSA 1RODA 3FPUB 2B2VC 2DY7A 1HUNA 2DY8A 2X69A 5JJZA 2N55A 2RSOA 5EPLA 2KECA 5EJWA
chains in the Genus database with same CATH superfamily
1A3VA 4A3MH 4DR5Q 1SYGA 1A3UA 2ZJQA 4P2CB 1B9NA 1I4QA 1BUVT 5CV4A 1OXUA 3QR8A 5JVG3 2DGYA 1BNZA 4XTCS 3CMEA 2L4NA 2CFMA 1AZQA 3S2HB 1BCPB 1VQJA 1X3QA 3TP5A 3OMCA 4A3EB 4JK1C 4RGNA 1Y8NB 1XNRQ 5CV5A 1PTOC 4BBRG 2JA8G 1V1PA 3QOLA 3HOVB 5CGKA 1AE2A 5EQ0A 3RMHA 4LWCA 1V1PB 3K7AB 4V190 1TWFB 1Q12A 3HKZE 1KXLA 4P73A 3TBIB 4DV5L 1JT8A 2R7ZH 4C3IB 2E5LQ 4JI0Q 3CQZH 1CQFA 1UWVA 1MBYA 5C44H 4KLKA 1I50B 3OWFA 1LTSD 1JB3A 2XWJB 4OWXB 4WORA 2QF7A 3H0GH 2ENBA 3MXGA 2OQKA 4OELB 3U4VA 3WOFA 4BBSB 2YU9B 1OXSC 1XMOL 1EYAA 1JB7A 3KYHC 3F8TA 3T1YQ 3E9IA 1STEA 5JEAG 2CWPA 2NVQH 3HFZB 1IBLL 4CKCA 2UXDQ 3A0JA 4DPGA 1N9WA 2OWOA 4DR4L 3I4MB 2B2UC 3VYRA 2MO1A 1LTLA 1A6XA 4KN7C 2Z4HA 2K7VA 2R3ZA 2PPBC 5T1GA 4QF4A 1E22A 3GTJH 2XSCA 4ILWA 2KVMA 1S5CD 2A6ED 1YITA 4PV1C 5DM73 4A3DB 3RNUA 3NXWA 5L37A 2XTIA 5I6WA 1SNDA 1N34Q 1CK1A 5DNFA 4DV7L 3GDEA 2VUMB 4JI3L 5IGEA 3S14B 1F9QA 3ERSX 1NTGA 4JI7L 1EIHA 3S1QB 2X6GA 2RDHA 5M3FG 1HZ9A 1SMYD 4I7ZC 3J7YW 1EWCA 1LTID 2JK8A 3FRPB 2ZJRA 3HKSA 2VNUD 1C48A 4DV4Q 2RSOA 1K83H 5HGQA 4LNQA 2JA7B 4K2LA 4DXGA 1S72A 1EUJA 2DNEA 3RZDB 3STBD 4GKJL 3BU2A 4RGTA 4DR7Q 1TWAB 3NTIA 3X3NA 1F9PA 3FP9A 1RF2D 3NELA 3OIPA 1VQEA 3J7A5 2EIFA 1STAA 3I91A 4RFBA 1EOTA 1N36L 3NQTA 2L15A 2HD3A 3S17H 4HCSA 1NMFA 1CFMA 2KBNA 5TSSA 3T1HL 4DV1L 3PIOA 1S5FD 1DONA 3CPFA 3IFTA 1R4QB 3ICEA 3QJYA 4BXXG 2RKSA 4X3TA 4WJ4A 2WIIB 3H91A 4KJNA 2EY5A 2AQ1B 1RD9D 3S1MH 1KNEA 1HA6A 1CKNB 5H1SE 4K14A 1A15A 5IGDA 5IGCA 1X55A 1J9OA 1XPRA 4K0KL 3RZOH 1HR0L 1NAPA 2ASBA 4QUFA 2EPBA 5IP7H 4HSVA 5JVH3 3S1RH 2TMPA 3CC2A 3NEMA 1XPUA 2Z6KC 4B3ML 2VXWA 1IYUA 3SR1A 5I2XA 2NYZD 3A7AB 1YIJA 2CH4A 5M5YB 4K5VA 1LTRD 3E9HA 4QQBX 2WKDA 3BJUA 1HA5A 3LWEA 4O0AA 3CW2C 1BO0A 3MXUA 2F4VL 2A6HD 3U50C 4A3MB 3JC66 3KDFA 2NN6H 3NP8A 5FO9B 2YTXA 4NXNL 4JI2Q 3M9BA 3I55A 1N32L 2B2YC 4DK0A 3PF4A 3KDFB 4A3KH 4DV6L 3CCRA 4RCNA 3TSSA 3ZYYX 1IKLA 1MSGA 4LUZA 1Q8KA 1DXMA 3OSOA 2FMCA 4OONA 2NZ1D 3TZDA 4LFBQ 4PMCA 2F0IA 3HOXG 4LUVA 5C3EG 1WOCA 3K7UC 5DAUA 3J80E 5EJWA 4HAEA 1VQMA 3I72A 4ME5A 1SR3A 1WJJA 3FPPA 1VQIA 2Q2TA 4LF9L 2HQEA 4DN4M 4YWMA 2JE6I 2I5MX 1DOKA 1I4HA 2VQFL 4ZAIA 1VQDA 4MTNA 3WWVA 3J81j 2R7ZB 5IOCA 3GTPH 5FJ8H 1DM0B 3D6WA 2CWAA 3K58A 3AEVA 1TXYA 3CQZB 1CA5A 4KHPQ 2F03A 2TSSA 3OW2A 1SNQA 5C44B 4DR1L 2KCTA 1LT6D 3EBEA 4HSPA 3H0GB 4BA2I 3FVQA 3H6MA 5M5WH 3K5MA 4IZ8A 1U5KA 4FNFA 3M3YH 4ZRZA 4QJFA 5C4XB 3KK7A 1WFQA 4RCOA 5I2YA 1EY5A 2K6AA 1QCBD 3I4OA 4APVA 1JC7A 3BZKA 1LYLA 1DZ1A 4QCLA 1CKOA 2B2UA 1XMOQ 1D2BA 4FF1A 2JA9A 3GTJB 4WRDA 1AEXA 1VMCA 4RHSA 5AJ3Q 4QMGA 1HZCA 1STBA 1XMQL 4DV3L 3AQQA 3TRZA 5EKIA 3NTKA 4DXFA 4A3FG 2F3VA 1JWSD 1H9SA 3CU7A 1LO5D 2L55A 1H9RA 3HOZH 4NB3A 1ILQA 3R2IA 1Y1WH 1CHQD 2JJQA 1H9SB 1MSHA 1STYA 4A3GG 1FD7D 1K83B 3Q6SA 2OXPA 5CV6A 4ID6A 3BZCA 4JI7Q 1HRJA 4G4KA 4POFA 2F0KA 2EXZA 3KLSX 2CW0D 4A93H 1TWGB 1YVCA 3VYTA 1QNKA 2K75A 1EQVA 4YCWA 4LK1C 1EFWA 4C56C 3PUWA 1F2YA 2WINB 4OEMB 4Y52H 2EYPA 3GTKH 1E1TA 3C1EA 2LXJA 1ILPA 2VS1A 1K73C 4F88A 2KA7A 4GKJQ 2K5QA 4A3IG 5HGTA 3S17B 2N55A 3PIP3 3DM1A 1SNPA 3TREA 3GD7A 4DR2Q 3ND9A 4X62Q 1S40A 1OTCA 2C9OA 1SNCA 3OWEB 4XT3B 3LX0A 1X9NA 1AW7A 2LSSA 3CPWA 2WB1G 3ND8A 5DLQE 3T13A 2VB2X 3HZXA 5CBEE 1YEZA 2PZTA 2HIXA 1TS5A 3T1HQ 3S1MB 4C3HH 2EE1A 1JJGA 4DV1Q 1I4RA 2R7FA 4DV0L 4N9PA 1N8RC 1F2MA 4PMBA 1RHPA 3CRKC 3C3LA 3WOEA 4FF2A 2D2CC 5GADC 3RZOB 1JORA 2K50A 2R92G 3BDCA 4K5WA 3S1RB 4DUZL 1AN8A 1ML0D 4IURA 2Z6KA 4AIMA 3A5ZB 2UUCQ 1DD2A 4K2KA 1VQNA 4HIDA 4IALA 1HR0Q 2EYOA 2WACA 3V2TA 3PO2G 1WCMG 4EQPA 2JA6H 4XQNA 1PZID 2MHVA 2R61A 2PI2A 1ESRA 4NW2A 2FINB 1SMXA 4B3MQ 1ENAA 5C5MA 1G8ZD 1TS2A 4LF7L 4IQZA 2IWHA 4B3SQ 5JEAJ 3J7AV 2B2YA 1XNRL 4A3KB 4NMZA 2F0HA 3PUZA 1BCPC 1BBXC 2F4VQ 2RA4A 4V0BA 3Q23A 4LMQD 4KN4C 3AMUA 3S2HH 5IWAL 4NXNQ 1I6VC 2BDOA 4BY7H 3NE5B 3CCJA 2XRQD 1JMCA 1Y8PB 5JJLA 1BXTA 4DV6Q 3HOWG 4R9WA 4JVZA 1KABA 3PO3H 4DK1A 4R1JA 1I5FA 1CQVA 2K04A 1PH5A 2E5LL 2XVSA 1SJHD 1E7ZA 4K6LA 3H94A 1D7QA 4IJHA 4JI5Q 1SAPA 3GTPB 4IO9A 1E1OA 1C9OA 1CSPA 4IUTA 2K5NA 4R4QA 1RODA 1PTOF 4NKLA 1S3OA 5CV7A 4HTHA 4CJ2C 4L8JA 2VQFQ 1J5EL 1I4GA 3BG3A 1HTLD 1KLUD 2Q8TA 2LFNA 3HKZG 5M5WB 3NK9A 3M3YB 3JAMc 1PLFA 2F52A 5K36G 4BA1I 4HJ8A 2E76C 3BYYB 3H09A 2YYZA 1HCZA 3I4MH 2NVXH 4JYAL 4XT1B 2BCOA 3HOUH 1DGSA 1KTKA 1EQQA 3E6ZX 3GTQH 1H9MA 1ONLA 2G5DA 3RLNA 3DLLA 3MZ5A 1M8AA 1EL0A 4A3DH 1A8VA 2PZWA 4KKTA 1VQ8A 2ID0A 2KCNA 1A2UA 4IPHA 2EJFC 3KLSA 1EEID 1UUPA 3HOYH 4DR6L 1ENFA 4DR3L 1PTOD 1WTRA 3HOZB 4DR7L 1Y1WB 1ZEQX 2K5DA 3BYTB 1E2WA 1XMQQ 1PYSB 2FJ2A 1OXTA 4BBRH 2JA8H 4L5QA 4DAVA 1C0AA 4Q0FA 1C7YA 4A93B 1D1KA 2PI2E 2A69C 1EYDA 1EY7A 2LMCB 4AYBE 2OEOA 3MFGA 1XWEA 1S5ED 1X3GA 1C4QA 1PRTF 3DEOA 1OO9B 4QL5A 3UDGA 3GTKB 2F0JA 1HZAA 4KTAA 5C0XG 3S15H 3KJOA 1GOZA 3NBIA 1WTWA 1YI2A 1HPCA 1MHWC 5GROA 3DWAA 4DK6C 3TP8A 4HIMA 5FKAC 3H3VC 2K5VA 1F9SA 5IODA 3W2DA 1B44D 2K33A 1GO3E 2AQ2B 2XNAC 5E4WC 2GN5A 4YWLA 1I4XA 2L12A 1G6ZA 1FNVA 4KY7A 1KHIA 2BE5C 4RH6A 1IL8A 2Q2IA 1M1KC 5JJIA 1EZ6A 1H95A 2YTYA 5FLMG 4JI4Q 3HOVG 5CMDA 3A8IE 1Q86C 2WAQG 3MEFA 3M4YA 4UY8C 2ZT9C 4GLAC 5J39A 1SROA 3DHQA 2B63H 5BN4A 3CXCA 1SEBD 2MP1A 3KBGA 3VR3A 2ZXRA 5LMNL 1D5MC 5LHY1 1VQ7A 1PH9A 1P16A 3UDFA 3VR2A 3V96A 1MJEA 2JA6B 4JI2L 1TQOA 1XTCD 1HNWL 2OT2A 4A76A 1LM0A 1STNA 2LXKA 2D0PA 1V9PA 4DUZQ 1J8IA 4WJWA 4FO2A 4DNIA 4BBSG 3SK6A 4LFBL 1JE5A 1SYFA 1PH6A 1UEAB 2DJGC 2F0NA 1VQKA 3CHBD 2F0OA 1KAWA 1YNJC 1NE3A 4MNOA 3K5LA 2WP8J 4N8X1 1BR9A 3MC0B 3KUPA 4RWSC 1YHQA 3CCUA 1GJXA 4H0LC 2PCFB 2JA5G 4LF7Q 4DFAA 5I4DA 4RKBA 1XYIA 4BY7B 4IUUA 3A8JE 4N9TA 1CI3M 3PO3B 4O1NA 1UAPA 4P71A 5E3FA 3MVVA 4CKBA 1PYBA 1VMPA 5IWAQ 4OGQC 2ZJPA 4P72A 4BXXH 1JCKB 3SHLA 1IZ6A 5FOBB 4KHPL 2AQ3B 4R8NA 3KF8A 3TMEA 1VQCA 4QY7A 4GNXC 2Z8LA 2UU9L 4J1MA 1TY2A 1SFOH 2Z9HA 1BVSA 5HY6A 3VA5A 4R4TA 2F0SA 2JA7G 4LF8L 2OCEA 2AUJD 4GZYC 3P1HA 2NUCA 5IGBA 3ULJA 4P74A 2E2DC 4OXPA 4FXKC 2JQOA 4A3LG 5C4XH 1GUOA 4RMFA 2EY1A 5IYBG 1J5EQ 1FJGQ 2M9VA 5JJKA 1FYCA 3SE0A 1IW7C 2Q8RE 5AJ3L 3K5NA 5E4XA 1IKMA 1BKBA 2L5TA 1O78A 2NVXB 3FPUB 2E2IH 2IY5B 3HOUB 1WI5A 1GUGA 2R93H 3GTQB 1WTQA 5F2DA 4JW0A 1SYEA 2CHBD 3OPOA 1HXYD 4ZQ3A 1ICFB 1VQAA 4JYAQ 3T4AC 1VQBA 3FMCA 1SNOA 4BS9A 3FHWA 1SE8A 5K5PA 3KJPA 4I65A 1YJWA 1SYBA 2D5DA 4EVOA 3HOYB 3TP6A 4HR7B 3UE1A 1NNXA 2KUMA 1EU4A 1K3BC 1RL2A 1JOKA 3HOXH 5GAEC 1B9MA 2R7DA 3DXJC 5CC4A 3BVGA 1LLRD 3BZDB 4BBRB 2JA8B 2QW7A 1BQQT 4DR6Q 2HQLA 5C4ZA 2B3GA 3GTLH 1TWGH 4DR3Q 1U0LA 4XQQA 4R4IA 1T5EA 4A3JG 1CA6A 4C2MH 3VR4A 3RLFA 5KRUA 5FLXc 4DR2L 4X62L 2XN9C 3FKIH 3S15B 4X66L 4O42A 2FMMA 3W1BA 4QIWB 4X3KA 1PH8A 4A3CG 1X65A 1B50A 1B3QA 2CH4W 4ULLA 4ME3A 2CKZB 4DF7A 1T9HA 1TWHH 1TVXA 2N8NA 2QGQA 2IX3A 4ZYSA 2SOBA 4WFN3 5J22A 5A2QL 5IE8A 1L0YB 1LTGD 1RIPA 5ELDA 4ALPA 4CGYB 1YJNA 4ZKBB 2WV6D 3SDZA 3CCMA 1VF5C 1H9KA 2F0TA 4GS3A 2A19A 1TT2A 4GN3B 3T56B 3L0OA 1KLGD 2O4XA 2UUCL 2RCNA 5M5XB 1AH9A 4KY5A 2B63B 1U9RA 5ISRA 3LGJA 4GN5A 5A35A 3TZUA 1BDOA 2EYHA 2E2JH 2R7ZG 4DA2A 4A3FH 4ZK9B 1RDPD 2BH8A 3KLRA 1F77A 2IJ0A 4B3SL 2I07B 4P75A 3M85A 2DY7A 5C44G 5ELCA 2E2HH 5E7NA 2PMZB 5LMNQ 4OWWB 4UAIA 4CJ0B 3KOJA 4IUQA 4BY1H 1VQ6A 1TS4A 3A8KE 3OTOQ 3CCSA 3IFDA 1IXRA 4EQOA 4QGUA 5C6AA 1HNWQ 1WVLA 1EY9A 1NUCA 2VB3X 5CR3A 3ER0A 3NWTA 4OO1G 1TKWB 4OO1I 1IHZA 5ELFA 1YNXA 2L9HA 3O13A 4OX9L 3A74A 5ELEA 3CF5A 2MGSA 4JI5L 5I9OA 2JSOA 2D0OA 3A5UA 1VQPA 1HQRD 1O7YA 2BOSA 3Q8DA 2Q8IB 3CP0A 3K81C 2ICIA 1O80A 4M1UB 4PZ8A 4A3BH 3BVMA 2FHTA 2E8GA 4GNXA 1YBYA 1K0SA 4QIWE 1SFOB 4GNXB 4G57A 1U4MA 2OF1A 3L9AX 2QKIC 4LF6Q 1GUSA 2F0GA 1VF7A 3D8GA 5GQOA 2UU9Q 1FGBD 2KHIA 3NENA 3TP7A 1JOQA 1WTXA 5C0XJ 4LF8Q 2XWBB 5KEEA 2DNCA 2CCZA 3PO2H 3R93A 4RHRA 1VQGA 1CUKA 1TU2B 2ZXOA 4B08A 4K5XA 1K8OA 3F2DA 2E2IB 3LWUA 3ONAB 1TIID 2ATWA 2R93B 3MTSA 4PMWA 2H5XA 2K1BA 3Q24A 4GLXA 2AWOA 2ZTCA 1BCPD 4HJ7A 2MFIA 3MHBA 4Z9CB 2K28A 2K5HA 2NTTA 1K8MA 1XXGA 2K03A 2MJ8A 4S3SA 2ES2A 3HOXB 1HUNA 4YY3Q 3CMAA 1CKMA 2PMZE 4HIKA 1CZGA 2Z4IA 1LABA 5BR8L 1JJCB 5IP7G 2NVTB 3GTLB 2F0UA 3QG1A 2Y0SG 2HIVA 3KFUA 3GV6A 4C2MB 3GQBA 3Q22A 1KRSA 1A3TA 3SK4A 2F0PA 2A68C 3F2BA 4DUYL 3FKIB 1U4PA 2L0CA 4KKSA 2EYFA 4UP7A 2P5ZX 2I5HA 1SJED 4DAPA 1Z7TA 3P75A 3KBXA 1Q1BA 3JAML 4MTKA 1SE4A 1QVCA 5IT9L 1TWHB 5CORA 1F2LA 4FXDA 1QVFA 4X66Q 5KYLA 3PV0A 1EFID 4DV2L 3HS0C 4OIJA 3UI2A 4OIKA 4JI4L 2VZAA 5ELOA 1II3A 1JWMD 1EY4A 3V05A 3I4LA 1W2BA 1IYVA 2J4XA 5LL6X 2B2VA 4LJZC 3OMGA 1AP0A 3IKJA 3NTHA 2PZUA 4XYOA 3I70A 1E2ZA 1G2TA 1LUZA 3DWPA 1NJIC 4FDBA 2BH2A 1EY8A 5CV8A 4UDUC 1S4ZA 3TS0A 1Q1EA 4LF4Q 1WTPA 1PFMA 3U4ZA 2E2JB 3X3MA 2HDMA 1HFNA 1ZYRC 3QOJA 4A3FB 1H9JA 4MIUA 5FJ8G 3VA7A 2RVLA 3HG9A 3EA6A 4EQNA 1D5ZC 4DKAC 2LS01 4NPSA 4DNRB 3E3XA 2RQXA 4IUVA 2E2HB 4TRDA 2RHSB 2A69D 4BY1B 2QDBA 3RUZA 3RN5A 5ELNA 2F1MA 1EY6A 4AYBB 1NMGA 1F9RA 3J81L 5I9PA 2IPKD 1S5DD 2MUYA 2E75C 3S16H 2CQOA 5EAYA 1GUWA 3FDTA 1YZ6A 4EGVA 1B53A 1RKNA 1QVGA 4JPBW 2K01A 2K52A 3CRLC 4K6DA 4A3IB 1VQLA 5EPLA 4UPAA 3NSWA 2MQHA 1OXXK 3MWYW 4NDXA 4TKOB 2BE5D 4I7AA 4B3RL 1X3FA 1SYCA 2QEJC 1LACA 4A4IA 4C3JH 1IL2A 1A63A 1NSNS 2PNHA 4OX9Q 3K80C 3NWSA 5G3LD 3D4WA 1Z6HA 2IX1A 4EQ5A 3PQIA 3SGIA 1NR4A 4A3BB 4LW1A 3S2DH 2D62A 5JPNC 2EVBA 1MIUA 2VL6A 4CJ1B 4B3TL 3B6YA 1KNAA 5FLMH 1CT1D 4IPDA 2QDLA 1PMRA 1FJGL 1Q3LA 1XTDA 4IUPA 1MI2A 1BBWA 1ESFA 4K8IA 4LFCQ 4WJ3M 2VY3A 1ZKOA 4JI1L 1Y1VG 2NWGA 2M2LA 2F3IA 1B70B 4HN7A 2I46A 4JV5Q 5IT9c 1WTOA 1SDFA 4X6AH 1CM9A 3PO2B 2C35B 4KK7A 4IOAA 2JEBI 3AB9A 1JICA 2Z0SA 4IN3A 2EYJA 5C4HA 3DEPA 2F0WA 1UE5A 3IRBA 2CVRA 1FNUA 3BS1A 1KD1C 4KD3A 1IYJB 1GXDC 2EDGA 1YNJD 4C1NI 4ZKCB 1EIYB 1F2ZA 2DUDA 2IHFA 1STGA 4H02A 1W3SA 1X3PA 1D6EC 1UEBA 2RHQB 5D3IB 1HNZQ 4C3HG 5D65A 1CTMA 5IYDG 5EBDA 1QUQA 1HFGA 1HZBA 4UHVA 4GLVB 2JA5H 1O7ZA 2Q2UA 4IUNA 2EJGC 1QUQB 4CDCC 5JAVA 5IYCG 3SVMA 1PH7A 3I4NG 4CKEA 5ELBA 4G7HC 3BDLA 4KD4A 4CDDC 1XNQQ 5M3MG 3VR6A 5C5LA 1WTVA 1EYCA 3D4DA 4H13C 4YIJA 1N33Q 2BDNA 3U9OA 5BR8Q 5C0XI 2JA6G 1PFNA 5KYIA 3J81c 4IFDG 4IFDI 5D14A 1PA6A 1QE6A 2B8FA 3EJIA 3F2UA 4ZCKA 4DUYQ 1B4OA 2K32A 2BA1A 1Z9FA 1IW7D 5JEAH 4HMJA 4A3LH 1EIFA 1I3QH 1SYDA 3G6JB 4JCVE 5KNBA 2KQ3A 4A3EG 3VDYA 1HUMA 1I6HH 1L2FA 1LTBD 4U673 4DV2Q 3AU7A 3P7JA 1JQYD 3KLWA 3PO3G 3G7LA 1Q90A 5M5XH 3HRZC 4JI6Q 2XIWA 5FK9C 1L1OA 2F4IA 1PH4A 4KHZA 3M4OH 1M4VA 1L1OB 1FNWA 1IBKL 1FGUA 1ET9A 3CD6A 4FF4A 4X65Q 4C3IG 1GVPA 3MFYA 5HURA 2VW9A 3M7GA 3OTOL 5M3FH 5C3XA 4BWGB 4YWKA 3MXNA 3SEBA 1QZHA 3AYHB 4X3SA 3GO5A 3H15A 1TY0A 3BVZA 3QO2A 1UE1A 4A75A 4GOPA 1Q46A 1Y8OB 5FLXL 2AWNA 2YTVA 4A3JH 1Z47A 4L5RC 1O7LA 4GOPB 3CCLA 1QOHA 1PXUA 2KEEA 3S16B 2IL8A 3K57A 3I4MG 3RLOA 4AQYL 1EOVA 2FXQA 4PNYA 1KC8C 2PQEA 2A8VA 2HT1A 5C4JH 4GKKQ 4HJ5A 3N52A 4L5SA 4FVMA 1R9TH 3A54A 1E2VA 4A3DG 1PZKD 3AFQA 1VDZA 2ZXPA 2HCCA 1JJ2A 1RCVD 2VUMG 3RN2A 3PCOB 4C3JB 4HJAA 1QWYA 4RGMA 2F0EA 3HOYG 2N49A 1ZXTA 1EU3A 4DAYA 4Y7NH 3OW7A 1JWUD 3EROA 5IIFA 5LMUL 3PSIA 4LF6L 3JAMi 2KOLA 4DAYB 3KF8B 2F0MA 4B3RQ 3M4QA 3S2DB 1VQ4A 1MGSA 2ZM6L 1B8AA 3CC7A 5JJZA 2KECA 1V8QA 5J1ZA 4HIOA 2WAQB 1PTOH 2QEXA 1UE7A 1VS0A 3D31A 2KHSA 4HCEA 4LFAL 5EKLA 4ZUIA 1BF4A 2VQEQ 1TS3A 3PUVA 1VQHA 5IP9G 1XJVA 4B3TQ 3AFPA 2RF4A 2QA4A 3J80L 5CYUA 1PV4A 2SNMA 5AFWA 4JBWA 2OQ0A 4JC0A 2OTJA 2PW7A 4H7BA 2PW5A 4DK3C 4JI1Q 1OXVA 3F1ZA 5CBAE 1VCIA 1K0RA 1YNNC 3H3VI 3R3OA 2RSNA 3MA2B 4KKUA 3TN2A 3BDOA 2QCPX 2N3SA 1S5BD 4YY3L 3SXHA 3E5SA 4TQUS 2AHOB 4F87A 4DU9A 4HJ9A 1W6KA 2NB0A 4KI0A 4OO1H 2UUAL 4M8AA 3ULPA 2JA5B 4ABNA 4KHVA 5C3EH 2RBMA 4JBJA 4MZ9A 2I5LX 3EFXD 3P20A 3J81i 2LY7A 2B63G 1D1IA 1A0IA 2NVTH 3EN2A 3FEWX 1XPOA 3S1NH 4RA8A 1LTTD 1K8GA 2UUBQ 2EXDA 3T16A 3NHHA 1X32A 4L6TB 1AE3A 1VQ9A 1PRTC 4IPCA 1ENCA 1WYDA 1V1OA 2DN8A 1IBMQ 1GM5A 1EEFD 4ODGA 4G7ZC 1GHJA 3GTOB 3NUCA 4A3MG 1XX8A 3NPPA 5KGUA 4XQJA 1HNXL 4X64L 2UXCL 2X6LA 1I3QB 1GUTA 1X3EA 4G7OC 3A7LA 2ZTEA 4LF4L 3GP7A 3PF5A 2B2VC 4GN4B 1I6HB 1QJOA 4ZUJA 3MEHA 3OOCA 1SE2A 2WAQE 3K0XA 2A73B 3GTMB 1EWHA 3M4OB 1HR0W 5KIXA 1EQTA 2FFKB 4TVAB 1CKNA 3OYYA 4POGA 2KENA 5FLXE 5EBCA 4JOIA 1EIGA 2WFWA 1LT3D 2HHHL 2F0DA 1UE6A 5M3FB 1D5XC 3D0FA 2NTSA 3VYSA 4PZ6A 1ASYA 2EQSA 4A3GH 3J80c 1D8LA 3K8AA 1IBKQ 1TWCH 3CCVA 3TDQA 3H0GG 1YJ9A 1PFSA 4DAMA 2SEBD 1G291 1PDQA 1TR5A 3PGZA 1LT5D 1KIXA 1HJPA 4A3JB 4IJLA 5C4XG 2A68D 4RKLA 1GD7A 1PH3A 2UXBQ 2O2LD 3CAMA 2JN4A 1ET6A 4NXMQ 1I94L 4UP8A 3VYUA 3I73A 2J0TD 2XRSD 4OL7A 5EPKA 4A3IH 2R93G 2Z1CA 5C4JB 2ICEC 4XIGS 2GVAA 1R9TB 3I3CA 2A6EC 2KCCA 2V1CC 2CQAA 4AQYQ 3ZJYC 2G9DA 2SNSA 5COYA 3C1FA 1BCPF 5NUCA 4Y7NB 1LTAD 1VQ5A 4LFCL 3C2PA 1SLJA 4OHJA 1RTOA 1P8LA 1SMYC 2M00A 4JV5L 3G71A 1LV9A 3L2PA 2YV5A 1HH2P 1PTOB 3N6RA 2HDLA 5LMUQ 2AMCB 1C8CA 2R92H 1ZYRD 3F2CA 1PFBA 4KMUC 2ZM6Q 4HEDA 1YHAA 3A55A 3STBC 2ALYB 1NR2A 4LF5L 3LNNA 1G6PA 3R8BA 4XXEA 3FKIG 4B9WA 1Q7YC 5M9OA 3CC4A 1JOOA 1WCMH 5EGTA 2B2WC 4LFAQ 5KNCA 4IFDJ 3J7AF 4DV5Q 3QB3A 4QUCA 3CCEA 3A56A 3I56A 1HNZL 1KDAA 3RR5A 5T1IA 4YCUA 5C3WA 1EYGA 2Q2HA 4Q5VA 1G51A 2HUGA 2NVQB 4U68A 3URYA 2DJFC 4L63B 3C46A 3S9WA 1BOSA 1XNQL 1GUNA 4LAAA 3EIVA 1B2TA 5C3EB 1Q8IA 4X3UA 1N33L 3GV3A 1IBLQ 2F0QA 3HOWH 3L7ZC 1J6QA 2LKVA 4DR4Q 1SXTA 1HQMC 4FF3A 3S1NB 1AZPA 2UUAQ 1KDBA 2OTLA 2N88A 5JPMC 3PUYA 3Q0AA 1Y69U 4IOCA 3G48A 1PVOA 3EVQA 3GTGH 4PG3A 1PRTB 5A2QE 2RDGA 5DEHA 2NZHA 4DV7Q 1X56A 3S24A 3D4RA 2JEAI 1PYWD 4JI3Q 5FO7B 1CZWA 1MD2D 1R4PB 4R4OA 2EJMA 2NBFA 3ITPA 2C5CA 4BY1G 1CHPD 3W5OA 4RGOS 2B8GA 2NN6G 2NN6I 3D6CA 2RDFA 4AYBG 5GAHC 2A6HC 2V4DA 2WKCA 3W3AA 4JBMA 1Y1VH 4A3KG 5D3DA 4PZ7A 2A74C 1WTHA 2GA4B 1K3RA 5JOBA 1PH2A 5K36H 2HCIA 1FL0A 4JI6L 5GAGC 2K4KA 2EOTA 1SBBB 1HNXQ 4X64Q 2UXCQ 2F0LA 2MPMA 1SN8A 2IW3A 1QNUA 4CDEC 3VR5A 1A62A 3SK8A 2F3WA 4X65L 1M90C 1ASZA 2I0QA 2F0FA 5E1FA 2KJXA 2NVYH 1N36Q 2H1EA 3J80i 1L1OC 3D3RA 4R8IA 2GVBA 4FP5D 2QILA 4LUOA 1NY4A 4A3BG 5IYDH 1G91A 4J15A 4CHTB 5G3LF 4JI8L 4YCVA 1K8AC 2MNAA 1RTNA 1JR0D 2XGTA 4QB4A 1YHBA 5IYCH 2DY8A 1T5XD 3I4NH 1AFPA 3HGBA 4A3GB 1U4LA 1TWCB 4RG1A 3TEHB 2PNRC 1EWIA 4YHHL 2EY2A 2IHEA 2HHHQ 2Y0SB 3I90A 3WDNA 5M3MH 4GOPC 3G6EA 1EQRA 4F8MA 4JG2A 1NBWA 2EYMA 4K0KQ 1UNSA 2KHJA 4R4CA 4GKKL 3OHXC 1K28A 2B2TC 5BN3A 5IGGA 4DR5L 5C0XH 1X54A 4FXGC 4B9XA 1CSQA 2PQAA 2BA0A 3NQIA 1I4PA 4F7XA 2IX0A 4IFDH 2KEDA 2A5HA 2PQAB 4ZLTF 3HEJA 4OWTB 1HTPA 1I94Q 5IGFA 3DUZA 1U4RA 2WB1B 2ZTDA 2E74C 3I2ZA 5LL6S 2O5JC 1SE3A 1FR3A 3HOZG 4J8QA 5J3BA 4UP9A 2R6GA 4A3EH 1N32Q 1Y1WG 3U58A 4C1NK 2IT1A 3E0EA 3ERQA 1SSOA 1KDCA 2VQEL 4XYQA 3HOVH 3UDXA 5IY0A 1JE4A 1K9MC 4A93G 3K5OA 3K7AH 4JI0L 1TWFH 5I6YA 2R92B 2A1AA 4DGZA 2CW0C 4J6HA 4IPGA 1LT4D 4C3IH 3TQYA 1KQSA 2RCFA 1VQFA 1Q82C 4LF9Q 5EPJA 1WCMB 2B2WA 3T1YL 3K0YA 1PHJA 1I50H 1HHVA 4PQXA 3W1GA 2UXDL 4LF5Q 3K6OA 4N8FA 1E0BA 4BBSH 2YU9H 3IL8A 4JBKA 1SRUA 4FYDA 1DOMA 3DWQA 4HMIA 1KL9A 2H4OA 3OIQA 3DM3A 4DR1Q 1B1ZA 2PYKA 2SDFA 1B3AA 1QILA 1V1QA 2K5WA 2O5IC 4KY6A 4RAUC 2N78A 4DNTB 1A2TA 1N34L 3HP3A 3MXPA 5EKKA 2UUBL 1RJTA 1GKHA 5KNDA 1SNMA 4CBVA 3HOWB 1KRTA 4KJOA 1E3PA 4MN3A 1E24A 4TSSA 2VUMH 1IBML 2Y0SE 4L5TA 3S14H 4DV4L 3JAME 1QZGA 2PO4A 1DCZA 5IT9E 4NP5A 3SK5A 3S1QH 4K8JA 3PMFA 1DJRD 1Y14B 3GTGB 2B29A 2MO0A 1X6OA 2K05A 1QB5D 4DV3Q 3PIPA 1VQOA 3PUXA 3U9SA 5DM63 1MKHA 3GTOH 2JA7H 2EY6A 3ULLA 3RZDH 3L3OC 3UDIA 1STHA 3KF6A 1TWAH 1O7IA 3HKZB 4CDFC 1ICWA 3I8ZA 1Y1VB 1WD0A 1PH1A 3KF6B 5IP9H 4MHEA 4H44C 2WB1E 2D9UA 1GHKA 5CV9A 5IYBH 2L11A 2JXMB 1FVIA 2AUKA 2JP1A 4BY7G 1YNND 2J7ZA 3K59A 1DYQA 3H3VH 1DOLA 4KV6A 4XDXA 3GTMH 2NVYB 2L1BA 4C3JG 3CKIB 1V43A 1B7YB 1EZ8A 2AKWB 2G9HD 3R2TA 3MAQA 3IAYA 2K14A 5FO8B 3J7ZC 1Q81C 3M4PA 1MJCA 1NCVA 4JOIC 2F0VA 4C3HB 3J81E 5LMNW 2EYLA 3G4SA 3TS2A 1BBUA 1PZJD 2EZVA 1QG7A 3RD4A 3I4NB 3UE0A 3T53B 1L0WA 1W6JA 3CCQA 2UXBL 3MXNB 4O2DA 1WD1A 1G2SA 2NZOA 3EQLC 1L0XB 1PRTD 4JI8Q 2Z6BA 5M3MB 3PIO3 4DV0Q 4NXML 4E6IA 4EX5A 3NBHA 1EY0A 2KCMA 3DMUA 3I7FA 2B2TA 1KAAA 3M7NA 2JYOA 5BN5A 4AH6A 3NBHB 4YHHQ 5M5YH 3T51B 3HOUG 3E0JA 2B39A 3QIAA 2X69A 3QWNA 4A3CH
chains in the Genus database with same CATH topology
1A3VA 1SYGA 1A3UA 4P2CB 1B9NA 1I4QA 1BUVT 5CV4A 1OXUA 5JVG3 1BNZA 4XTCS 2L4NA 1AZQA 3S2HB 1BCPB 1X3QA 3TP5A 3OMCA 4A3EB 4JK1C 4RGNA 1Y8NB 5CV5A 1PTOC 1V1PA 3QOLA 3HOVB 5CGKA 5EQ0A 3RMHA 1V1PB 3K7AB 4V190 1TWFB 1Q12A 3TBIB 4C3IB 1CQFA 1MBYA 1I50B 3OWFA 1LTSD 1JB3A 2XWJB 4WORA 2QF7A 2ENBA 3MXGA 3WOFA 4BBSB 2YU9B 1OXSC 1EYAA 5JEAG 1STEA 4CKCA 3I4MB 2B2UC 3VYRA 1A6XA 4KN7C 2Z4HA 2K7VA 2R3ZA 2PPBC 5T1GA 4QF4A 2XSCA 4ILWA 2KVMA 1S5CD 2A6ED 4PV1C 5DM73 4A3DB 3NXWA 5I6WA 1SNDA 2VUMB 1CK1A 5DNFA 5IGEA 3S14B 1F9QA 1EIHA 3S1QB 2X6GA 2RDHA 1SMYD 4I7ZC 3J7YW 1EWCA 1LTID 3FRPB 2VNUD 1C48A 2RSOA 2JA7B 4K2LA 4DXGA 2DNEA 3RZDB 4RGTA 1TWAB 3NTIA 3X3NA 1F9PA 1RF2D 3OIPA 1STAA 3I91A 4RFBA 1EOTA 3NQTA 4HCSA 1CFMA 5TSSA 1S5FD 1DONA 3IFTA 1R4QB 3QJYA 2RKSA 4X3TA 2WIIB 3H91A 4KJNA 2EY5A 2AQ1B 1RD9D 1KNEA 1HA6A 5IGDA 4K14A 1A15A 5IGCA 1J9OA 1NAPA 4QUFA 2EPBA 4HSVA 5JVH3 2TMPA 2VXWA 1IYUA 3SR1A 5I2XA 2NYZD 3A7AB 5M5YB 4K5VA 1LTRD 2WKDA 1HA5A 3LWEA 1BO0A 3MXUA 2A6HD 4A3MB 2NN6H 3NP8A 5FO9B 2B2YC 4DK0A 4RCNA 3TSSA 3ZYYX 1IKLA 1MSGA 1DXMA 3OSOA 2FMCA 2NZ1D 3TZDA 4PMCA 2F0IA 5DAUA 3J80E 5EJWA 4HAEA 3I72A 4ME5A 3FPPA 2HQEA 4DN4M 2JE6I 1DOKA 1I4HA 4ZAIA 2R7ZB 5IOCA 1DM0B 3D6WA 3K58A 3CQZB 1CA5A 2F03A 2TSSA 1SNQA 5C44B 1LT6D 4HSPA 3H0GB 4BA2I 3FVQA 3H6MA 3K5MA 4IZ8A 4FNFA 4ZRZA 5C4XB 3KK7A 4RCOA 5I2YA 1EY5A 2K6AA 1QCBD 1JC7A 1DZ1A 4QCLA 2B2UA 1D2BA 4FF1A 3GTJB 4WRDA 1AEXA 1VMCA 4RHSA 4QMGA 1STBA 5EKIA 3NTKA 4DXFA 2F3VA 1JWSD 1H9SA 3CU7A 1LO5D 2L55A 1H9RA 1ILQA 3R2IA 1CHQD 1H9SB 1MSHA 1STYA 1FD7D 1K83B 3Q6SA 2OXPA 5CV6A 4ID6A 1HRJA 4G4KA 2F0KA 2EXZA 3KLSX 2CW0D 1TWGB 3VYTA 1QNKA 1EQVA 4LK1C 4C56C 3PUWA 1F2YA 2WINB 2EYPA 3C1EA 1ILPA 4F88A 2KA7A 2K5QA 5HGTA 3S17B 2N55A 3PIP3 3DM1A 1SNPA 3GD7A 3ND9A 2C9OA 1SNCA 3OWEB 4XT3B 3LX0A 1AW7A 3ND8A 3T13A 2VB2X 3HZXA 5CBEE 2PZTA 1TS5A 3S1MB 2EE1A 1I4RA 4N9PA 1F2MA 4PMBA 1RHPA 3CRKC 3C3LA 3WOEA 4FF2A 2D2CC 1JORA 3RZOB 3BDCA 4K5WA 3S1RB 1AN8A 1ML0D 4IURA 1DD2A 4K2KA 4IALA 2EYOA 2WACA 3V2TA 4EQPA 4XQNA 1PZID 2MHVA 2R61A 1ESRA 4NW2A 2FINB 1ENAA 5C5MA 1G8ZD 1TS2A 4IQZA 2IWHA 5JEAJ 3J7AV 2B2YA 4A3KB 4NMZA 2F0HA 3PUZA 1BCPC 1BBXC 2RA4A 4V0BA 3Q23A 4LMQD 4KN4C 3AMUA 1I6VC 2BDOA 3NE5B 2XRQD 1Y8PB 1BXTA 4R9WA 1KABA 4DK1A 1CQVA 2K04A 2XVSA 1SJHD 4K6LA 3H94A 1SAPA 3GTPB 4IUTA 1RODA 1PTOF 4NKLA 5CV7A 4HTHA 4CJ2C 4L8JA 1I4GA 3BG3A 1HTLD 1KLUD 2Q8TA 2LFNA 5M5WB 3NK9A 3M3YB 1PLFA 5K36G 4BA1I 2E76C 3BYYB 3H09A 2YYZA 1HCZA 4XT1B 2BCOA 1KTKA 3E6ZX 1H9MA 1ONLA 3MZ5A 1M8AA 1EL0A 2PZWA 4KKTA 2ID0A 2KCNA 1A2UA 2EJFC 3KLSA 1EEID 1UUPA 1ENFA 1PTOD 1WTRA 3HOZB 1Y1WB 1ZEQX 2K5DA 3BYTB 1E2WA 2FJ2A 1OXTA 4DAVA 4Q0FA 4A93B 1D1KA 2A69C 1EYDA 1EY7A 2LMCB 2OEOA 3MFGA 1XWEA 1S5ED 1C4QA 1PRTF 3DEOA 1OO9B 3GTKB 2F0JA 4KTAA 5C0XG 1GOZA 3NBIA 1WTWA 1HPCA 3DWAA 3TP8A 3H3VC 5FKAC 1F9SA 5IODA 3W2DA 1B44D 2K33A 2AQ2B 2XNAC 5E4WC 1I4XA 2L12A 1G6ZA 1FNVA 4KY7A 2BE5C 4RH6A 1IL8A 1EZ6A 5CMDA 3A8IE 3M4YA 2ZT9C 5J39A 3DHQA 5BN4A 1SEBD 2MP1A 3KBGA 3VR3A 2ZXRA 1D5MC 5LHY1 3VR2A 3V96A 2JA6B 1TQOA 1XTCD 2OT2A 1STNA 1J8IA 4WJWA 4FO2A 3SK6A 1SYFA 1UEAB 2F0NA 3CHBD 2F0OA 1YNJC 3K5LA 2WP8J 1BR9A 3MC0B 3KUPA 4RWSC 1GJXA 4H0LC 2PCFB 4DFAA 5I4DA 4RKBA 1XYIA 4BY7B 4IUUA 3A8JE 4N9TA 1CI3M 3PO3B 4O1NA 1UAPA 5E3FA 3MVVA 4CKBA 1VMPA 4OGQC 1JCKB 3SHLA 5FOBB 2AQ3B 4R8NA 3KF8A 3TMEA 2Z8LA 4J1MA 1TY2A 3VA5A 2F0SA 2AUJD 4GZYC 5IGBA 3P1HA 2NUCA 2E2DC 4FXKC 1GUOA 2EY1A 2M9VA 1FYCA 3SE0A 1IW7C 2Q8RE 3K5NA 5E4XA 1IKMA 2L5TA 1O78A 2NVXB 3FPUB 3HOUB 1GUGA 3GTQB 1WTQA 5F2DA 1SYEA 2CHBD 3OPOA 1HXYD 4ZQ3A 3T4AC 3FMCA 1SNOA 4BS9A 5K5PA 4I65A 1SYBA 2D5DA 4EVOA 3HOYB 3TP6A 4HR7B 2KUMA 1EU4A 1JOKA 1B9MA 3DXJC 5CC4A 3BVGA 1LLRD 3BZDB 4BBRB 2JA8B 1BQQT 5C4ZA 4XQQA 1T5EA 1CA6A 3VR4A 3RLFA 5KRUA 2XN9C 3S15B 4O42A 2FMMA 4QIWB 4X3KA 1B50A 4ULLA 4DF7A 1TVXA 2IX3A 4ZYSA 2SOBA 4WFN3 5J22A 5A2QL 1L0YB 1LTGD 5ELDA 4CGYB 4ZKBB 2WV6D 3SDZA 1VF5C 1H9KA 2F0TA 1TT2A 3T56B 1KLGD 2O4XA 5M5XB 4KY5A 2B63B 1U9RA 5ISRA 5A35A 3TZUA 1BDOA 2EYHA 4DA2A 4ZK9B 1RDPD 3KLRA 1F77A 2IJ0A 2I07B 3M85A 2DY7A 5ELCA 2PMZB 4UAIA 4CJ0B 4IUQA 1TS4A 3A8KE 3IFDA 4EQOA 5C6AA 1WVLA 1EY9A 1NUCA 2VB3X 5CR3A 3NWTA 4OO1G 1TKWB 4OO1I 1IHZA 5ELFA 2L9HA 3O13A 5ELEA 2MGSA 5I9OA 2JSOA 1HQRD 1O7YA 2BOSA 2Q8IB 2ICIA 1O80A 4M1UB 3BVMA 2FHTA 1SFOB 4G57A 1U4MA 2OF1A 3L9AX 2QKIC 1GUSA 2F0GA 1VF7A 3D8GA 1FGBD 3TP7A 1JOQA 1WTXA 5C0XJ 2XWBB 5KEEA 2DNCA 3R93A 4RHRA 1TU2B 2ZXOA 4B08A 4K5XA 1K8OA 2E2IB 3LWUA 3ONAB 1TIID 2R93B 3MTSA 4PMWA 2K1BA 3Q24A 2AWOA 1BCPD 3MHBA 4Z9CB 2K28A 2NTTA 1K8MA 1XXGA 2K03A 2MJ8A 4S3SA 3HOXB 1HUNA 1CZGA 2Z4IA 1LABA 2NVTB 3GTLB 2F0UA 3QG1A 3GV6A 4C2MB 3GQBA 3Q22A 1A3TA 3SK4A 2F0PA 2A68C 3FKIB 1U4PA 2L0CA 4KKSA 2EYFA 1SJED 4DAPA 1Z7TA 3P75A 3KBXA 1Q1BA 3JAML 1SE4A 5IT9L 1TWHB 5CORA 1F2LA 4FXDA 5KYLA 3PV0A 1EFID 3HS0C 4OIJA 3UI2A 4OIKA 1II3A 1JWMD 1EY4A 3V05A 3I4LA 1IYVA 2J4XA 5LL6X 2B2VA 4LJZC 3OMGA 1AP0A 3IKJA 3NTHA 2PZUA 4XYOA 3I70A 1E2ZA 1G2TA 3DWPA 1EY8A 5CV8A 4UDUC 1S4ZA 1Q1EA 1WTPA 1PFMA 2E2JB 3X3MA 2HDMA 1HFNA 1ZYRC 3QOJA 4A3FB 1H9JA 4MIUA 3VA7A 2RVLA 3HG9A 3EA6A 4EQNA 1D5ZC 2LS01 4DNRB 2RQXA 4IUVA 2E2HB 4TRDA 2A69D 4BY1B 2QDBA 3RUZA 2F1MA 1EY6A 4AYBB 1F9RA 3J81L 5I9PA 2IPKD 1S5DD 2MUYA 2E75C 1GUWA 3FDTA 4EGVA 1B53A 1RKNA 2K01A 3CRLC 4K6DA 4A3IB 5EPLA 3NSWA 1OXXK 3MWYW 4NDXA 4TKOB 2BE5D 1SYCA 2QEJC 1LACA 1NSNS 3NWSA 5G3LD 3D4WA 1Z6HA 2IX1A 1NR4A 4A3BB 2D62A 5JPNC 2EVBA 4CJ1B 1KNAA 1CT1D 1PMRA 1Q3LA 4IUPA 1MI2A 1ESFA 4K8IA 1ZKOA 2NWGA 2M2LA 4HN7A 2I46A 1WTOA 1SDFA 1CM9A 3PO2B 4KK7A 2JEBI 3AB9A 1JICA 4IN3A 2EYJA 5C4HA 3DEPA 2F0WA 2CVRA 1FNUA 3BS1A 4KD3A 1GXDC 2EDGA 1YNJD 4C1NI 4ZKCB 1F2ZA 1STGA 1X3PA 1D6EC 5D3IB 4C3HG 5D65A 1CTMA 5EBDA 1HFGA 1O7ZA 4IUNA 2EJGC 5JAVA 3SVMA 4CKEA 5ELBA 4G7HC 3BDLA 4KD4A 3VR6A 5C5LA 1WTVA 1EYCA 3D4DA 4H13C 4YIJA 2BDNA 3U9OA 5C0XI 1PFNA 5KYIA 4IFDG 4IFDI 5D14A 1QE6A 2B8FA 3EJIA 3F2UA 1B4OA 2K32A 2BA1A 1IW7D 5JEAH 4HMJA 1SYDA 3G6JB 5KNBA 2KQ3A 1HUMA 1LTBD 4U673 3AU7A 3P7JA 1JQYD 3G7LA 1Q90A 3HRZC 2XIWA 5FK9C 2F4IA 4KHZA 1M4VA 1FNWA 1ET9A 4FF4A 4C3IG 3MFYA 5HURA 3M7GA 5C3XA 4BWGB 3MXNA 3SEBA 4X3SA 3GO5A 1TY0A 3BVZA 3QO2A 1Y8OB 5FLXL 2AWNA 1Z47A 1O7LA 1QOHA 1PXUA 2KEEA 3S16B 2IL8A 3K57A 4PNYA 2PQEA 3N52A 4FVMA 3A54A 1E2VA 1PZKD 1VDZA 2ZXPA 2HCCA 1RCVD 4C3JB 1QWYA 4RGMA 2F0EA 1ZXTA 1EU3A 4DAYA 3OW7A 1JWUD 3EROA 5IIFA 2KOLA 2F0MA 3S2DB 1MGSA 5JJZA 2KECA 1V8QA 5J1ZA 2WAQB 1PTOH 3D31A 2KHSA 4HCEA 5EKLA 4ZUIA 1BF4A 1TS3A 3PUVA 3J80L 5CYUA 2SNMA 5AFWA 4JBWA 2PW7A 4H7BA 2PW5A 1OXVA 5CBAE 1VCIA 1YNNC 3R3OA 2RSNA 3MA2B 4KKUA 3TN2A 3BDOA 2QCPX 1S5BD 3SXHA 3E5SA 4TQUS 4F87A 4DU9A 1W6KA 2NB0A 4KI0A 4OO1H 4M8AA 2JA5B 4ABNA 4KHVA 2RBMA 3EFXD 3P20A 2LY7A 1D1IA 3FEWX 4RA8A 1LTTD 3T16A 3NHHA 1X32A 4L6TB 1PRTC 1ENCA 1V1OA 2DN8A 1EEFD 4ODGA 4G7ZC 1GHJA 3GTOB 3NUCA 1XX8A 3NPPA 5KGUA 4XQJA 2X6LA 1I3QB 1GUTA 4G7OC 3A7LA 3GP7A 2B2VC 1I6HB 4ZUJA 1QJOA 3MEHA 3OOCA 1SE2A 2A73B 3GTMB 1EWHA 3M4OB 5KIXA 1EQTA 2FFKB 5FLXE 5EBCA 1EIGA 1LT3D 2F0DA 5M3FB 1D5XC 2NTSA 3VYSA 3TDQA 2SEBD 1G291 1PDQA 1TR5A 1LT5D 4A3JB 2A68D 4RKLA 2O2LD 1ET6A 3VYUA 3I73A 2J0TD 2XRSD 4OL7A 5EPKA 2Z1CA 5C4JB 2ICEC 4XIGS 1R9TB 3I3CA 2A6EC 2KCCA 2CQAA 2G9DA 2SNSA 5COYA 3C1FA 1BCPF 5NUCA 4Y7NB 1LTAD 3C2PA 4OHJA 1RTOA 1SMYC 2M00A 1LV9A 1PTOB 3N6RA 2HDLA 1C8CA 1ZYRD 1PFBA 4KMUC 4HEDA 3A55A 1NR2A 3LNNA 3R8BA 4XXEA 4B9WA 5M9OA 1JOOA 5EGTA 2B2WC 5KNCA 4IFDJ 3J7AF 3QB3A 4QUCA 3A56A 1KDAA 5T1IA 5C3WA 4Q5VA 2HUGA 2NVQB 4U68A 3URYA 4L63B 3C46A 3S9WA 1BOSA 1GUNA 4LAAA 1B2TA 5C3EB 1Q8IA 4X3UA 3GV3A 2F0QA 3L7ZC 2LKVA 1SXTA 1HQMC 4FF3A 3S1NB 1AZPA 1KDBA 2N88A 5JPMC 3PUYA 3Q0AA 1Y69U 3EVQA 1PRTB 5A2QE 2RDGA 5DEHA 3D4RA 2JEAI 1PYWD 5FO7B 1CZWA 1MD2D 1R4PB 2EJMA 2NBFA 3ITPA 2C5CA 1CHPD 4RGOS 2B8GA 2NN6G 2NN6I 3D6CA 2RDFA 2A6HC 2V4DA 2WKCA 3W3AA 5D3DA 2A74C 2GA4B 5JOBA 5K36H 2HCIA 2EOTA 1SBBB 2F0LA 2MPMA 2IW3A 1QNUA 3VR5A 3SK8A 2F3WA 2F0FA 5E1FA 2KJXA 2H1EA 3D3RA 4R8IA 4FP5D 2QILA 1G91A 4CHTB 5G3LF 1RTNA 1JR0D 4QB4A 2DY8A 1T5XD 1AFPA 3HGBA 4A3GB 1U4LA 1TWCB 2PNRC 2EY2A 2Y0SB 3I90A 3WDNA 4F8MA 2EYMA 1UNSA 3OHXC 2B2TC 5BN3A 5IGGA 5C0XH 4FXGC 4B9XA 2BA0A 3NQIA 1I4PA 4F7XA 2IX0A 4IFDH 2KEDA 2A5HA 4ZLTF 3HEJA 1HTPA 5IGFA 3DUZA 1U4RA 2WB1B 2E74C 5LL6S 2O5JC 1SE3A 1FR3A 4J8QA 2R6GA 4C1NK 2IT1A 3ERQA 1SSOA 1KDCA 4XYQA 1JE4A 3K5OA 5I6YA 2R92B 4DGZA 2CW0C 4J6HA 1LT4D 5EPJA 1WCMB 2B2WA 3K0YA 1HHVA 4PQXA 3K6OA 1E0BA 3IL8A 4FYDA 1DOMA 3DWQA 4HMIA 2H4OA 3OIQA 1B1ZA 2PYKA 2SDFA 1B3AA 1QILA 2K5WA 2O5IC 4KY6A 4RAUC 4DNTB 1A2TA 3HP3A 3MXPA 5EKKA 1RJTA 5KNDA 1SNMA 4CBVA 3HOWB 4KJOA 4MN3A 4TSSA 3JAME 2PO4A 1DCZA 5IT9E 4NP5A 3SK5A 4K8JA 3PMFA 1DJRD 3GTGB 2K05A 1QB5D 3PUXA 3U9SA 5DM63 2EY6A 3L3OC 1STHA 3HKZB 1ICWA 3I8ZA 1Y1VB 1WD0A 4MHEA 4H44C 2D9UA 1GHKA 5CV9A 2L11A 2JXMB 2AUKA 2JP1A 1YNND 2J7ZA 3K59A 1DYQA 1DOLA 4KV6A 4XDXA 2NVYB 2L1BA 4C3JG 3CKIB 1V43A 1EZ8A 2G9HD 3R2TA 3MAQA 3IAYA 5FO8B 1NCVA 2F0VA 4C3HB 3J81E 2EYLA 1PZJD 2EZVA 1QG7A 3RD4A 3I4NB 3T53B 1W6JA 1WD1A 1G2SA 3EQLC 1L0XB 1PRTD 3PIO3 5M3MB 4E6IA 3NBHA 1EY0A 3DMUA 2B2TA 1KAAA 3M7NA 2JYOA 5BN5A 3T51B 3E0JA 2B39A 3QIAA 2X69A 3QWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAE A;  5D14 A;  5CMD A;  1U4L A;  3DM1 A;  1WTQ A;  4IUQ A;  1QE6 A;  3F2U A;  4QUC A;  3MWY W;  2Q8T A;  4MN3 A;  5T1I A;  4CJ2 C;  1B4O A;  3I90 A;  4XT3 B;  3IFD A;  4DN4 M;  1F9P A;  1DOK A;  1BF4 A;  2MP1 A;  1EQT A;  3GV6 A;  1PLF A;  2HUG A;  2FFK B;  1WVL A;  4ZAI A;  4U68 A;  3I91 A;  5CBE E;  1BNZ A;  2B2T C;  1EIG A;  3TZD A;  2L4N A;  1AZQ A;  5AFW A;  2EE1 A;  2KUM A;  1EOT A;  1NR4 A;  3D6W A;  1U4P A;  1X3Q A;  4XT1 B;  4UAI A;  2K05 A;  1HUM A;  1RHP A;  4CJ0 B;  1B2T A;  2L9H A;  1WD0 A;  1CA5 A;  4CJ1 B;  1J8I A;  4HCS A;  5CBA E;  1KNA A;  3P7J A;  4X3U A;  3GV3 A;  2KED A;  3G7L A;  4ZLT F;  3KBX A;  1Q3L A;  4IUP A;  2MGS A;  2RSN A;  2XIW A;  1M8A A;  5COR A;  5EQ0 A;  1F2L A;  1EL0 A;  1MI2 A;  1PDQ A;  3TN2 A;  1DON A;  1AZP A;  1O7Y A;  4X3T A;  1ICW A;  3I8Z A;  1U4R A;  1ML0 D;  2N88 A;  2NWG A;  3H91 A;  4IUR A;  4OIJ A;  4OIK A;  3UI2 A;  2M2L A;  4MHE A;  1WTO A;  1SDF A;  2D9U A;  1CM9 A;  2L11 A;  1KNE A;  1O80 A;  3KUP A;  4RWS C;  1HA6 A;  1CA6 A;  1DZ1 A;  2FHT A;  2B2U A;  4O42 A;  1WTR A;  2B2V A;  1A15 A;  1JIC A;  2FMM A;  2JP1 A;  1XYI A;  2J7Z A;  3DEP A;  4X3K A;  1AP0 A;  5EPK A;  1SSO A;  2CVR A;  2FJ2 A;  4IUU A;  1B50 A;  4X3S A;  1J9O A;  1ESR A;  1U4M A;  2FIN B;  1VMC A;  4NW2 A;  1JE4 A;  1G2T A;  1NAP A;  1DOL A;  3I3C A;  3QO2 A;  4XDX A;  4QUF A;  2EPB A;  1TVX A;  4HSV A;  1S4Z A;  4ZKC B;  1VMP A;  4RA8 A;  2L1B A;  2B2Y A;  1WTP A;  1PFM A;  1X32 A;  1X3P A;  5COY A;  3DEO A;  5EKI A;  1WTX A;  2HDM A;  1HFN A;  2KEE A;  2VXW A;  1BBX C;  2HCI A;  2RA4 A;  1NCV A;  2IL8 A;  2NYZ D;  2RVL A;  5D65 A;  4LMQ D;  4ZKB B;  1HFG A;  2B2U C;  1ILQ A;  3R93 A;  5EPJ A;  2EOT A;  2B2W A;  1WTW A;  1O7Z A;  2R3Z A;  1RTO A;  1QG7 A;  2MPM A;  4IUV A;  1MSH A;  5T1G A;  1HHV A;  3LWE A;  3ONA B;  3SVM A;  1BO0 A;  1F9S A;  2KVM A;  3MTS A;  3Q6S A;  1LV9 A;  3N52 A;  4R9W A;  1HRJ A;  1WD1 A;  1XX8 A;  1E0B A;  2K1B A;  1G2S A;  3IL8 A;  1QNK A;  2HDL A;  1C8C A;  2K04 A;  2HCC A;  2H1E A;  5E4W C;  1DOM A;  5DNF A;  2B2Y C;  1PFB A;  4R8I A;  1WTV A;  1GUW A;  1F9R A;  2L12 A;  4HED A;  1G6Z A;  1F9Q A;  2X6L A;  1NR2 A;  1IL8 A;  1ZXT A;  1EIH A;  2SDF A;  2K28 A;  1IKL A;  1B3A A;  1MSG A;  2B2T A;  2BDN A;  1SAP A;  2X6G A;  2JYO A;  2Q8R E;  4ZK9 B;  1G91 A;  2K03 A;  2NZ1 D;  2MJ8 A;  1B53 A;  3FDT A;  4IUT A;  4RAU C;  5E4X A;  1PFN A;  2KOL A;  1IKM A;  1ILP A;  3HP3 A;  2K01 A;  2B2W C;  1RJT A;  1RTN A;  1MGS A;  1ROD A;  3FPU B;  2B2V C;  2DY7 A;  1HUN A;  2DY8 A;  2X69 A;  5JJZ A;  2N55 A;  2RSO A;  5EPL A;  2KEC A;  5EJW A; 
#chains in the Genus database with same CATH topology
 1A3V A;  4A3M H;  4DR5 Q;  1SYG A;  1A3U A;  2ZJQ A;  4P2C B;  1B9N A;  1I4Q A;  1BUV T;  5CV4 A;  1OXU A;  3QR8 A;  5JVG 3;  2DGY A;  1BNZ A;  4XTC S;  3CME A;  2L4N A;  2CFM A;  1AZQ A;  3S2H B;  1BCP B;  1VQJ A;  1X3Q A;  3TP5 A;  3OMC A;  4A3E B;  4JK1 C;  4RGN A;  1Y8N B;  1XNR Q;  5CV5 A;  1PTO C;  4BBR G;  2JA8 G;  1V1P A;  3QOL A;  3HOV B;  5CGK A;  1AE2 A;  5EQ0 A;  3RMH A;  4LWC A;  1V1P B;  3K7A B;  4V19 0;  1TWF B;  1Q12 A;  3HKZ E;  1KXL A;  4P73 A;  3TBI B;  4DV5 L;  1JT8 A;  2R7Z H;  4C3I B;  2E5L Q;  4JI0 Q;  3CQZ H;  1CQF A;  1UWV A;  1MBY A;  5C44 H;  4KLK A;  1I50 B;  3OWF A;  1LTS D;  1JB3 A;  2XWJ B;  4OWX B;  4WOR A;  2QF7 A;  3H0G H;  2ENB A;  3MXG A;  2OQK A;  4OEL B;  3U4V A;  3WOF A;  4BBS B;  2YU9 B;  1OXS C;  1XMO L;  1EYA A;  1JB7 A;  3KYH C;  3F8T A;  3T1Y Q;  3E9I A;  1STE A;  5JEA G;  2CWP A;  2NVQ H;  3HFZ B;  1IBL L;  4CKC A;  2UXD Q;  3A0J A;  4DPG A;  1N9W A;  2OWO A;  4DR4 L;  3I4M B;  2B2U C;  3VYR A;  2MO1 A;  1LTL A;  1A6X A;  4KN7 C;  2Z4H A;  2K7V A;  2R3Z A;  2PPB C;  5T1G A;  4QF4 A;  1E22 A;  3GTJ H;  2XSC A;  4ILW A;  2KVM A;  1S5C D;  2A6E D;  1YIT A;  4PV1 C;  5DM7 3;  4A3D B;  3RNU A;  3NXW A;  5L37 A;  2XTI A;  5I6W A;  1SND A;  1N34 Q;  1CK1 A;  5DNF A;  4DV7 L;  3GDE A;  2VUM B;  4JI3 L;  5IGE A;  3S14 B;  1F9Q A;  3ERS X;  1NTG A;  4JI7 L;  1EIH A;  3S1Q B;  2X6G A;  2RDH A;  5M3F G;  1HZ9 A;  1SMY D;  4I7Z C;  3J7Y W;  1EWC A;  1LTI D;  2JK8 A;  3FRP B;  2ZJR A;  3HKS A;  2VNU D;  1C48 A;  4DV4 Q;  2RSO A;  1K83 H;  5HGQ A;  4LNQ A;  2JA7 B;  4K2L A;  4DXG A;  1S72 A;  1EUJ A;  2DNE A;  3RZD B;  3STB D;  4GKJ L;  3BU2 A;  4RGT A;  4DR7 Q;  1TWA B;  3NTI A;  3X3N A;  1F9P A;  3FP9 A;  1RF2 D;  3NEL A;  3OIP A;  1VQE A;  3J7A 5;  2EIF A;  1STA A;  3I91 A;  4RFB A;  1EOT A;  1N36 L;  3NQT A;  2L15 A;  2HD3 A;  3S17 H;  4HCS A;  1NMF A;  1CFM A;  2KBN A;  5TSS A;  3T1H L;  4DV1 L;  3PIO A;  1S5F D;  1DON A;  3CPF A;  3IFT A;  1R4Q B;  3ICE A;  3QJY A;  4BXX G;  2RKS A;  4X3T A;  4WJ4 A;  2WII B;  3H91 A;  4KJN A;  2EY5 A;  2AQ1 B;  1RD9 D;  3S1M H;  1KNE A;  1HA6 A;  1CKN B;  5H1S E;  4K14 A;  1A15 A;  5IGD A;  5IGC A;  1X55 A;  1J9O A;  1XPR A;  4K0K L;  3RZO H;  1HR0 L;  1NAP A;  2ASB A;  4QUF A;  2EPB A;  5IP7 H;  4HSV A;  5JVH 3;  3S1R H;  2TMP A;  3CC2 A;  3NEM A;  1XPU A;  2Z6K C;  4B3M L;  2VXW A;  1IYU A;  3SR1 A;  5I2X A;  2NYZ D;  3A7A B;  1YIJ A;  2CH4 A;  5M5Y B;  4K5V A;  1LTR D;  3E9H A;  4QQB X;  2WKD A;  3BJU A;  1HA5 A;  3LWE A;  4O0A A;  3CW2 C;  1BO0 A;  3MXU A;  2F4V L;  2A6H D;  3U50 C;  4A3M B;  3JC6 6;  3KDF A;  2NN6 H;  3NP8 A;  5FO9 B;  2YTX A;  4NXN L;  4JI2 Q;  3M9B A;  3I55 A;  1N32 L;  2B2Y C;  4DK0 A;  3PF4 A;  3KDF B;  4A3K H;  4DV6 L;  3CCR A;  4RCN A;  3TSS A;  3ZYY X;  1IKL A;  1MSG A;  4LUZ A;  1Q8K A;  1DXM A;  3OSO A;  2FMC A;  4OON A;  2NZ1 D;  3TZD A;  4LFB Q;  4PMC A;  2F0I A;  3HOX G;  4LUV A;  5C3E G;  1WOC A;  3K7U C;  5DAU A;  3J80 E;  5EJW A;  4HAE A;  1VQM A;  3I72 A;  4ME5 A;  1SR3 A;  1WJJ A;  3FPP A;  1VQI A;  2Q2T A;  4LF9 L;  2HQE A;  4DN4 M;  4YWM A;  2JE6 I;  2I5M X;  1DOK A;  1I4H A;  2VQF L;  4ZAI A;  1VQD A;  4MTN A;  3WWV A;  3J81 j;  2R7Z B;  5IOC A;  3GTP H;  5FJ8 H;  1DM0 B;  3D6W A;  2CWA A;  3K58 A;  3AEV A;  1TXY A;  3CQZ B;  1CA5 A;  4KHP Q;  2F03 A;  2TSS A;  3OW2 A;  1SNQ A;  5C44 B;  4DR1 L;  2KCT A;  1LT6 D;  3EBE A;  4HSP A;  3H0G B;  4BA2 I;  3FVQ A;  3H6M A;  5M5W H;  3K5M A;  4IZ8 A;  1U5K A;  4FNF A;  3M3Y H;  4ZRZ A;  4QJF A;  5C4X B;  3KK7 A;  1WFQ A;  4RCO A;  5I2Y A;  1EY5 A;  2K6A A;  1QCB D;  3I4O A;  4APV A;  1JC7 A;  3BZK A;  1LYL A;  1DZ1 A;  4QCL A;  1CKO A;  2B2U A;  1XMO Q;  1D2B A;  4FF1 A;  2JA9 A;  3GTJ B;  4WRD A;  1AEX A;  1VMC A;  4RHS A;  5AJ3 Q;  4QMG A;  1HZC A;  1STB A;  1XMQ L;  4DV3 L;  3AQQ A;  3TRZ A;  5EKI A;  3NTK A;  4DXF A;  4A3F G;  2F3V A;  1JWS D;  1H9S A;  3CU7 A;  1LO5 D;  2L55 A;  1H9R A;  3HOZ H;  4NB3 A;  1ILQ A;  3R2I A;  1Y1W H;  1CHQ D;  2JJQ A;  1H9S B;  1MSH A;  1STY A;  4A3G G;  1FD7 D;  1K83 B;  3Q6S A;  2OXP A;  5CV6 A;  4ID6 A;  3BZC A;  4JI7 Q;  1HRJ A;  4G4K A;  4POF A;  2F0K A;  2EXZ A;  3KLS X;  2CW0 D;  4A93 H;  1TWG B;  1YVC A;  3VYT A;  1QNK A;  2K75 A;  1EQV A;  4YCW A;  4LK1 C;  1EFW A;  4C56 C;  3PUW A;  1F2Y A;  2WIN B;  4OEM B;  4Y52 H;  2EYP A;  3GTK H;  1E1T A;  3C1E A;  2LXJ A;  1ILP A;  2VS1 A;  1K73 C;  4F88 A;  2KA7 A;  4GKJ Q;  2K5Q A;  4A3I G;  5HGT A;  3S17 B;  2N55 A;  3PIP 3;  3DM1 A;  1SNP A;  3TRE A;  3GD7 A;  4DR2 Q;  3ND9 A;  4X62 Q;  1S40 A;  1OTC A;  2C9O A;  1SNC A;  3OWE B;  4XT3 B;  3LX0 A;  1X9N A;  1AW7 A;  2LSS A;  3CPW A;  2WB1 G;  3ND8 A;  5DLQ E;  3T13 A;  2VB2 X;  3HZX A;  5CBE E;  1YEZ A;  2PZT A;  2HIX A;  1TS5 A;  3T1H Q;  3S1M B;  4C3H H;  2EE1 A;  1JJG A;  4DV1 Q;  1I4R A;  2R7F A;  4DV0 L;  4N9P A;  1N8R C;  1F2M A;  4PMB A;  1RHP A;  3CRK C;  3C3L A;  3WOE A;  4FF2 A;  2D2C C;  5GAD C;  3RZO B;  1JOR A;  2K50 A;  2R92 G;  3BDC A;  4K5W A;  3S1R B;  4DUZ L;  1AN8 A;  1ML0 D;  4IUR A;  2Z6K A;  4AIM A;  3A5Z B;  2UUC Q;  1DD2 A;  4K2K A;  1VQN A;  4HID A;  4IAL A;  1HR0 Q;  2EYO A;  2WAC A;  3V2T A;  3PO2 G;  1WCM G;  4EQP A;  2JA6 H;  4XQN A;  1PZI D;  2MHV A;  2R61 A;  2PI2 A;  1ESR A;  4NW2 A;  2FIN B;  1SMX A;  4B3M Q;  1ENA A;  5C5M A;  1G8Z D;  1TS2 A;  4LF7 L;  4IQZ A;  2IWH A;  4B3S Q;  5JEA J;  3J7A V;  2B2Y A;  1XNR L;  4A3K B;  4NMZ A;  2F0H A;  3PUZ A;  1BCP C;  1BBX C;  2F4V Q;  2RA4 A;  4V0B A;  3Q23 A;  4LMQ D;  4KN4 C;  3AMU A;  3S2H H;  5IWA L;  4NXN Q;  1I6V C;  2BDO A;  4BY7 H;  3NE5 B;  3CCJ A;  2XRQ D;  1JMC A;  1Y8P B;  5JJL A;  1BXT A;  4DV6 Q;  3HOW G;  4R9W A;  4JVZ A;  1KAB A;  3PO3 H;  4DK1 A;  4R1J A;  1I5F A;  1CQV A;  2K04 A;  1PH5 A;  2E5L L;  2XVS A;  1SJH D;  1E7Z A;  4K6L A;  3H94 A;  1D7Q A;  4IJH A;  4JI5 Q;  1SAP A;  3GTP B;  4IO9 A;  1E1O A;  1C9O A;  1CSP A;  4IUT A;  2K5N A;  4R4Q A;  1ROD A;  1PTO F;  4NKL A;  1S3O A;  5CV7 A;  4HTH A;  4CJ2 C;  4L8J A;  2VQF Q;  1J5E L;  1I4G A;  3BG3 A;  1HTL D;  1KLU D;  2Q8T A;  2LFN A;  3HKZ G;  5M5W B;  3NK9 A;  3M3Y B;  3JAM c;  1PLF A;  2F52 A;  5K36 G;  4BA1 I;  4HJ8 A;  2E76 C;  3BYY B;  3H09 A;  2YYZ A;  1HCZ A;  3I4M H;  2NVX H;  4JYA L;  4XT1 B;  2BCO A;  3HOU H;  1DGS A;  1KTK A;  1EQQ A;  3E6Z X;  3GTQ H;  1H9M A;  1ONL A;  2G5D A;  3RLN A;  3DLL A;  3MZ5 A;  1M8A A;  1EL0 A;  4A3D H;  1A8V A;  2PZW A;  4KKT A;  1VQ8 A;  2ID0 A;  2KCN A;  1A2U A;  4IPH A;  2EJF C;  3KLS A;  1EEI D;  1UUP A;  3HOY H;  4DR6 L;  1ENF A;  4DR3 L;  1PTO D;  1WTR A;  3HOZ B;  4DR7 L;  1Y1W B;  1ZEQ X;  2K5D A;  3BYT B;  1E2W A;  1XMQ Q;  1PYS B;  2FJ2 A;  1OXT A;  4BBR H;  2JA8 H;  4L5Q A;  4DAV A;  1C0A A;  4Q0F A;  1C7Y A;  4A93 B;  1D1K A;  2PI2 E;  2A69 C;  1EYD A;  1EY7 A;  2LMC B;  4AYB E;  2OEO A;  3MFG A;  1XWE A;  1S5E D;  1X3G A;  1C4Q A;  1PRT F;  3DEO A;  1OO9 B;  4QL5 A;  3UDG A;  3GTK B;  2F0J A;  1HZA A;  4KTA A;  5C0X G;  3S15 H;  3KJO A;  1GOZ A;  3NBI A;  1WTW A;  1YI2 A;  1HPC A;  1MHW C;  5GRO A;  3DWA A;  4DK6 C;  3TP8 A;  4HIM A;  5FKA C;  3H3V C;  2K5V A;  1F9S A;  5IOD A;  3W2D A;  1B44 D;  2K33 A;  1GO3 E;  2AQ2 B;  2XNA C;  5E4W C;  2GN5 A;  4YWL A;  1I4X A;  2L12 A;  1G6Z A;  1FNV A;  4KY7 A;  1KHI A;  2BE5 C;  4RH6 A;  1IL8 A;  2Q2I A;  1M1K C;  5JJI A;  1EZ6 A;  1H95 A;  2YTY A;  5FLM G;  4JI4 Q;  3HOV G;  5CMD A;  3A8I E;  1Q86 C;  2WAQ G;  3MEF A;  3M4Y A;  4UY8 C;  2ZT9 C;  4GLA C;  5J39 A;  1SRO A;  3DHQ A;  2B63 H;  5BN4 A;  3CXC A;  1SEB D;  2MP1 A;  3KBG A;  3VR3 A;  2ZXR A;  5LMN L;  1D5M C;  5LHY 1;  1VQ7 A;  1PH9 A;  1P16 A;  3UDF A;  3VR2 A;  3V96 A;  1MJE A;  2JA6 B;  4JI2 L;  1TQO A;  1XTC D;  1HNW L;  2OT2 A;  4A76 A;  1LM0 A;  1STN A;  2LXK A;  2D0P A;  1V9P A;  4DUZ Q;  1J8I A;  4WJW A;  4FO2 A;  4DNI A;  4BBS G;  3SK6 A;  4LFB L;  1JE5 A;  1SYF A;  1PH6 A;  1UEA B;  2DJG C;  2F0N A;  1VQK A;  3CHB D;  2F0O A;  1KAW A;  1YNJ C;  1NE3 A;  4MNO A;  3K5L A;  2WP8 J;  4N8X 1;  1BR9 A;  3MC0 B;  3KUP A;  4RWS C;  1YHQ A;  3CCU A;  1GJX A;  4H0L C;  2PCF B;  2JA5 G;  4LF7 Q;  4DFA A;  5I4D A;  4RKB A;  1XYI A;  4BY7 B;  4IUU A;  3A8J E;  4N9T A;  1CI3 M;  3PO3 B;  4O1N A;  1UAP A;  4P71 A;  5E3F A;  3MVV A;  4CKB A;  1PYB A;  1VMP A;  5IWA Q;  4OGQ C;  2ZJP A;  4P72 A;  4BXX H;  1JCK B;  3SHL A;  1IZ6 A;  5FOB B;  4KHP L;  2AQ3 B;  4R8N A;  3KF8 A;  3TME A;  1VQC A;  4QY7 A;  4GNX C;  2Z8L A;  2UU9 L;  4J1M A;  1TY2 A;  1SFO H;  2Z9H A;  1BVS A;  5HY6 A;  3VA5 A;  4R4T A;  2F0S A;  2JA7 G;  4LF8 L;  2OCE A;  2AUJ D;  4GZY C;  3P1H A;  2NUC A;  5IGB A;  3ULJ A;  4P74 A;  2E2D C;  4OXP A;  4FXK C;  2JQO A;  4A3L G;  5C4X H;  1GUO A;  4RMF A;  2EY1 A;  5IYB G;  1J5E Q;  1FJG Q;  2M9V A;  5JJK A;  1FYC A;  3SE0 A;  1IW7 C;  2Q8R E;  5AJ3 L;  3K5N A;  5E4X A;  1IKM A;  1BKB A;  2L5T A;  1O78 A;  2NVX B;  3FPU B;  2E2I H;  2IY5 B;  3HOU B;  1WI5 A;  1GUG A;  2R93 H;  3GTQ B;  1WTQ A;  5F2D A;  4JW0 A;  1SYE A;  2CHB D;  3OPO A;  1HXY D;  4ZQ3 A;  1ICF B;  1VQA A;  4JYA Q;  3T4A C;  1VQB A;  3FMC A;  1SNO A;  4BS9 A;  3FHW A;  1SE8 A;  5K5P A;  3KJP A;  4I65 A;  1YJW A;  1SYB A;  2D5D A;  4EVO A;  3HOY B;  3TP6 A;  4HR7 B;  3UE1 A;  1NNX A;  2KUM A;  1EU4 A;  1K3B C;  1RL2 A;  1JOK A;  3HOX H;  5GAE C;  1B9M A;  2R7D A;  3DXJ C;  5CC4 A;  3BVG A;  1LLR D;  3BZD B;  4BBR B;  2JA8 B;  2QW7 A;  1BQQ T;  4DR6 Q;  2HQL A;  5C4Z A;  2B3G A;  3GTL H;  1TWG H;  4DR3 Q;  1U0L A;  4XQQ A;  4R4I A;  1T5E A;  4A3J G;  1CA6 A;  4C2M H;  3VR4 A;  3RLF A;  5KRU A;  5FLX c;  4DR2 L;  4X62 L;  2XN9 C;  3FKI H;  3S15 B;  4X66 L;  4O42 A;  2FMM A;  3W1B A;  4QIW B;  4X3K A;  1PH8 A;  4A3C G;  1X65 A;  1B50 A;  1B3Q A;  2CH4 W;  4ULL A;  4ME3 A;  2CKZ B;  4DF7 A;  1T9H A;  1TWH H;  1TVX A;  2N8N A;  2QGQ A;  2IX3 A;  4ZYS A;  2SOB A;  4WFN 3;  5J22 A;  5A2Q L;  5IE8 A;  1L0Y B;  1LTG D;  1RIP A;  5ELD A;  4ALP A;  4CGY B;  1YJN A;  4ZKB B;  2WV6 D;  3SDZ A;  3CCM A;  1VF5 C;  1H9K A;  2F0T A;  4GS3 A;  2A19 A;  1TT2 A;  4GN3 B;  3T56 B;  3L0O A;  1KLG D;  2O4X A;  2UUC L;  2RCN A;  5M5X B;  1AH9 A;  4KY5 A;  2B63 B;  1U9R A;  5ISR A;  3LGJ A;  4GN5 A;  5A35 A;  3TZU A;  1BDO A;  2EYH A;  2E2J H;  2R7Z G;  4DA2 A;  4A3F H;  4ZK9 B;  1RDP D;  2BH8 A;  3KLR A;  1F77 A;  2IJ0 A;  4B3S L;  2I07 B;  4P75 A;  3M85 A;  2DY7 A;  5C44 G;  5ELC A;  2E2H H;  5E7N A;  2PMZ B;  5LMN Q;  4OWW B;  4UAI A;  4CJ0 B;  3KOJ A;  4IUQ A;  4BY1 H;  1VQ6 A;  1TS4 A;  3A8K E;  3OTO Q;  3CCS A;  3IFD A;  1IXR A;  4EQO A;  4QGU A;  5C6A A;  1HNW Q;  1WVL A;  1EY9 A;  1NUC A;  2VB3 X;  5CR3 A;  3ER0 A;  3NWT A;  4OO1 G;  1TKW B;  4OO1 I;  1IHZ A;  5ELF A;  1YNX A;  2L9H A;  3O13 A;  4OX9 L;  3A74 A;  5ELE A;  3CF5 A;  2MGS A;  4JI5 L;  5I9O A;  2JSO A;  2D0O A;  3A5U A;  1VQP A;  1HQR D;  1O7Y A;  2BOS A;  3Q8D A;  2Q8I B;  3CP0 A;  3K81 C;  2ICI A;  1O80 A;  4M1U B;  4PZ8 A;  4A3B H;  3BVM A;  2FHT A;  2E8G A;  4GNX A;  1YBY A;  1K0S A;  4QIW E;  1SFO B;  4GNX B;  4G57 A;  1U4M A;  2OF1 A;  3L9A X;  2QKI C;  4LF6 Q;  1GUS A;  2F0G A;  1VF7 A;  3D8G A;  5GQO A;  2UU9 Q;  1FGB D;  2KHI A;  3NEN A;  3TP7 A;  1JOQ A;  1WTX A;  5C0X J;  4LF8 Q;  2XWB B;  5KEE A;  2DNC A;  2CCZ A;  3PO2 H;  3R93 A;  4RHR A;  1VQG A;  1CUK A;  1TU2 B;  2ZXO A;  4B08 A;  4K5X A;  1K8O A;  3F2D A;  2E2I B;  3LWU A;  3ONA B;  1TII D;  2ATW A;  2R93 B;  3MTS A;  4PMW A;  2H5X A;  2K1B A;  3Q24 A;  4GLX A;  2AWO A;  2ZTC A;  1BCP D;  4HJ7 A;  2MFI A;  3MHB A;  4Z9C B;  2K28 A;  2K5H A;  2NTT A;  1K8M A;  1XXG A;  2K03 A;  2MJ8 A;  4S3S A;  2ES2 A;  3HOX B;  1HUN A;  4YY3 Q;  3CMA A;  1CKM A;  2PMZ E;  4HIK A;  1CZG A;  2Z4I A;  1LAB A;  5BR8 L;  1JJC B;  5IP7 G;  2NVT B;  3GTL B;  2F0U A;  3QG1 A;  2Y0S G;  2HIV A;  3KFU A;  3GV6 A;  4C2M B;  3GQB A;  3Q22 A;  1KRS A;  1A3T A;  3SK4 A;  2F0P A;  2A68 C;  3F2B A;  4DUY L;  3FKI B;  1U4P A;  2L0C A;  4KKS A;  2EYF A;  4UP7 A;  2P5Z X;  2I5H A;  1SJE D;  4DAP A;  1Z7T A;  3P75 A;  3KBX A;  1Q1B A;  3JAM L;  4MTK A;  1SE4 A;  1QVC A;  5IT9 L;  1TWH B;  5COR A;  1F2L A;  4FXD A;  1QVF A;  4X66 Q;  5KYL A;  3PV0 A;  1EFI D;  4DV2 L;  3HS0 C;  4OIJ A;  3UI2 A;  4OIK A;  4JI4 L;  2VZA A;  5ELO A;  1II3 A;  1JWM D;  1EY4 A;  3V05 A;  3I4L A;  1W2B A;  1IYV A;  2J4X A;  5LL6 X;  2B2V A;  4LJZ C;  3OMG A;  1AP0 A;  3IKJ A;  3NTH A;  2PZU A;  4XYO A;  3I70 A;  1E2Z A;  1G2T A;  1LUZ A;  3DWP A;  1NJI C;  4FDB A;  2BH2 A;  1EY8 A;  5CV8 A;  4UDU C;  1S4Z A;  3TS0 A;  1Q1E A;  4LF4 Q;  1WTP A;  1PFM A;  3U4Z A;  2E2J B;  3X3M A;  2HDM A;  1HFN A;  1ZYR C;  3QOJ A;  4A3F B;  1H9J A;  4MIU A;  5FJ8 G;  3VA7 A;  2RVL A;  3HG9 A;  3EA6 A;  4EQN A;  1D5Z C;  4DKA C;  2LS0 1;  4NPS A;  4DNR B;  3E3X A;  2RQX A;  4IUV A;  2E2H B;  4TRD A;  2RHS B;  2A69 D;  4BY1 B;  2QDB A;  3RUZ A;  3RN5 A;  5ELN A;  2F1M A;  1EY6 A;  4AYB B;  1NMG A;  1F9R A;  3J81 L;  5I9P A;  2IPK D;  1S5D D;  2MUY A;  2E75 C;  3S16 H;  2CQO A;  5EAY A;  1GUW A;  3FDT A;  1YZ6 A;  4EGV A;  1B53 A;  1RKN A;  1QVG A;  4JPB W;  2K01 A;  2K52 A;  3CRL C;  4K6D A;  4A3I B;  1VQL A;  5EPL A;  4UPA A;  3NSW A;  2MQH A;  1OXX K;  3MWY W;  4NDX A;  4TKO B;  2BE5 D;  4I7A A;  4B3R L;  1X3F A;  1SYC A;  2QEJ C;  1LAC A;  4A4I A;  4C3J H;  1IL2 A;  1A63 A;  1NSN S;  2PNH A;  4OX9 Q;  3K80 C;  3NWS A;  5G3L D;  3D4W A;  1Z6H A;  2IX1 A;  4EQ5 A;  3PQI A;  3SGI A;  1NR4 A;  4A3B B;  4LW1 A;  3S2D H;  2D62 A;  5JPN C;  2EVB A;  1MIU A;  2VL6 A;  4CJ1 B;  4B3T L;  3B6Y A;  1KNA A;  5FLM H;  1CT1 D;  4IPD A;  2QDL A;  1PMR A;  1FJG L;  1Q3L A;  1XTD A;  4IUP A;  1MI2 A;  1BBW A;  1ESF A;  4K8I A;  4LFC Q;  4WJ3 M;  2VY3 A;  1ZKO A;  4JI1 L;  1Y1V G;  2NWG A;  2M2L A;  2F3I A;  1B70 B;  4HN7 A;  2I46 A;  4JV5 Q;  5IT9 c;  1WTO A;  1SDF A;  4X6A H;  1CM9 A;  3PO2 B;  2C35 B;  4KK7 A;  4IOA A;  2JEB I;  3AB9 A;  1JIC A;  2Z0S A;  4IN3 A;  2EYJ A;  5C4H A;  3DEP A;  2F0W A;  1UE5 A;  3IRB A;  2CVR A;  1FNU A;  3BS1 A;  1KD1 C;  4KD3 A;  1IYJ B;  1GXD C;  2EDG A;  1YNJ D;  4C1N I;  4ZKC B;  1EIY B;  1F2Z A;  2DUD A;  2IHF A;  1STG A;  4H02 A;  1W3S A;  1X3P A;  1D6E C;  1UEB A;  2RHQ B;  5D3I B;  1HNZ Q;  4C3H G;  5D65 A;  1CTM A;  5IYD G;  5EBD A;  1QUQ A;  1HFG A;  1HZB A;  4UHV A;  4GLV B;  2JA5 H;  1O7Z A;  2Q2U A;  4IUN A;  2EJG C;  1QUQ B;  4CDC C;  5JAV A;  5IYC G;  3SVM A;  1PH7 A;  3I4N G;  4CKE A;  5ELB A;  4G7H C;  3BDL A;  4KD4 A;  4CDD C;  1XNQ Q;  5M3M G;  3VR6 A;  5C5L A;  1WTV A;  1EYC A;  3D4D A;  4H13 C;  4YIJ A;  1N33 Q;  2BDN A;  3U9O A;  5BR8 Q;  5C0X I;  2JA6 G;  1PFN A;  5KYI A;  3J81 c;  4IFD G;  4IFD I;  5D14 A;  1PA6 A;  1QE6 A;  2B8F A;  3EJI A;  3F2U A;  4ZCK A;  4DUY Q;  1B4O A;  2K32 A;  2BA1 A;  1Z9F A;  1IW7 D;  5JEA H;  4HMJ A;  4A3L H;  1EIF A;  1I3Q H;  1SYD A;  3G6J B;  4JCV E;  5KNB A;  2KQ3 A;  4A3E G;  3VDY A;  1HUM A;  1I6H H;  1L2F A;  1LTB D;  4U67 3;  4DV2 Q;  3AU7 A;  3P7J A;  1JQY D;  3KLW A;  3PO3 G;  3G7L A;  1Q90 A;  5M5X H;  3HRZ C;  4JI6 Q;  2XIW A;  5FK9 C;  1L1O A;  2F4I A;  1PH4 A;  4KHZ A;  3M4O H;  1M4V A;  1L1O B;  1FNW A;  1IBK L;  1FGU A;  1ET9 A;  3CD6 A;  4FF4 A;  4X65 Q;  4C3I G;  1GVP A;  3MFY A;  5HUR A;  2VW9 A;  3M7G A;  3OTO L;  5M3F H;  5C3X A;  4BWG B;  4YWK A;  3MXN A;  3SEB A;  1QZH A;  3AYH B;  4X3S A;  3GO5 A;  3H15 A;  1TY0 A;  3BVZ A;  3QO2 A;  1UE1 A;  4A75 A;  4GOP A;  1Q46 A;  1Y8O B;  5FLX L;  2AWN A;  2YTV A;  4A3J H;  1Z47 A;  4L5R C;  1O7L A;  4GOP B;  3CCL A;  1QOH A;  1PXU A;  2KEE A;  3S16 B;  2IL8 A;  3K57 A;  3I4M G;  3RLO A;  4AQY L;  1EOV A;  2FXQ A;  4PNY A;  1KC8 C;  2PQE A;  2A8V A;  2HT1 A;  5C4J H;  4GKK Q;  4HJ5 A;  3N52 A;  4L5S A;  4FVM A;  1R9T H;  3A54 A;  1E2V A;  4A3D G;  1PZK D;  3AFQ A;  1VDZ A;  2ZXP A;  2HCC A;  1JJ2 A;  1RCV D;  2VUM G;  3RN2 A;  3PCO B;  4C3J B;  4HJA A;  1QWY A;  4RGM A;  2F0E A;  3HOY G;  2N49 A;  1ZXT A;  1EU3 A;  4DAY A;  4Y7N H;  3OW7 A;  1JWU D;  3ERO A;  5IIF A;  5LMU L;  3PSI A;  4LF6 L;  3JAM i;  2KOL A;  4DAY B;  3KF8 B;  2F0M A;  4B3R Q;  3M4Q A;  3S2D B;  1VQ4 A;  1MGS A;  2ZM6 L;  1B8A A;  3CC7 A;  5JJZ A;  2KEC A;  1V8Q A;  5J1Z A;  4HIO A;  2WAQ B;  1PTO H;  2QEX A;  1UE7 A;  1VS0 A;  3D31 A;  2KHS A;  4HCE A;  4LFA L;  5EKL A;  4ZUI A;  1BF4 A;  2VQE Q;  1TS3 A;  3PUV A;  1VQH A;  5IP9 G;  1XJV A;  4B3T Q;  3AFP A;  2RF4 A;  2QA4 A;  3J80 L;  5CYU A;  1PV4 A;  2SNM A;  5AFW A;  4JBW A;  2OQ0 A;  4JC0 A;  2OTJ A;  2PW7 A;  4H7B A;  2PW5 A;  4DK3 C;  4JI1 Q;  1OXV A;  3F1Z A;  5CBA E;  1VCI A;  1K0R A;  1YNN C;  3H3V I;  3R3O A;  2RSN A;  3MA2 B;  4KKU A;  3TN2 A;  3BDO A;  2QCP X;  2N3S A;  1S5B D;  4YY3 L;  3SXH A;  3E5S A;  4TQU S;  2AHO B;  4F87 A;  4DU9 A;  4HJ9 A;  1W6K A;  2NB0 A;  4KI0 A;  4OO1 H;  2UUA L;  4M8A A;  3ULP A;  2JA5 B;  4ABN A;  4KHV A;  5C3E H;  2RBM A;  4JBJ A;  4MZ9 A;  2I5L X;  3EFX D;  3P20 A;  3J81 i;  2LY7 A;  2B63 G;  1D1I A;  1A0I A;  2NVT H;  3EN2 A;  3FEW X;  1XPO A;  3S1N H;  4RA8 A;  1LTT D;  1K8G A;  2UUB Q;  2EXD A;  3T16 A;  3NHH A;  1X32 A;  4L6T B;  1AE3 A;  1VQ9 A;  1PRT C;  4IPC A;  1ENC A;  1WYD A;  1V1O A;  2DN8 A;  1IBM Q;  1GM5 A;  1EEF D;  4ODG A;  4G7Z C;  1GHJ A;  3GTO B;  3NUC A;  4A3M G;  1XX8 A;  3NPP A;  5KGU A;  4XQJ A;  1HNX L;  4X64 L;  2UXC L;  2X6L A;  1I3Q B;  1GUT A;  1X3E A;  4G7O C;  3A7L A;  2ZTE A;  4LF4 L;  3GP7 A;  3PF5 A;  2B2V C;  4GN4 B;  1I6H B;  1QJO A;  4ZUJ A;  3MEH A;  3OOC A;  1SE2 A;  2WAQ E;  3K0X A;  2A73 B;  3GTM B;  1EWH A;  3M4O B;  1HR0 W;  5KIX A;  1EQT A;  2FFK B;  4TVA B;  1CKN A;  3OYY A;  4POG A;  2KEN A;  5FLX E;  5EBC A;  4JOI A;  1EIG A;  2WFW A;  1LT3 D;  2HHH L;  2F0D A;  1UE6 A;  5M3F B;  1D5X C;  3D0F A;  2NTS A;  3VYS A;  4PZ6 A;  1ASY A;  2EQS A;  4A3G H;  3J80 c;  1D8L A;  3K8A A;  1IBK Q;  1TWC H;  3CCV A;  3TDQ A;  3H0G G;  1YJ9 A;  1PFS A;  4DAM A;  2SEB D;  1G29 1;  1PDQ A;  1TR5 A;  3PGZ A;  1LT5 D;  1KIX A;  1HJP A;  4A3J B;  4IJL A;  5C4X G;  2A68 D;  4RKL A;  1GD7 A;  1PH3 A;  2UXB Q;  2O2L D;  3CAM A;  2JN4 A;  1ET6 A;  4NXM Q;  1I94 L;  4UP8 A;  3VYU A;  3I73 A;  2J0T D;  2XRS D;  4OL7 A;  5EPK A;  4A3I H;  2R93 G;  2Z1C A;  5C4J B;  2ICE C;  4XIG S;  2GVA A;  1R9T B;  3I3C A;  2A6E C;  2KCC A;  2V1C C;  2CQA A;  4AQY Q;  3ZJY C;  2G9D A;  2SNS A;  5COY A;  3C1F A;  1BCP F;  5NUC A;  4Y7N B;  1LTA D;  1VQ5 A;  4LFC L;  3C2P A;  1SLJ A;  4OHJ A;  1RTO A;  1P8L A;  1SMY C;  2M00 A;  4JV5 L;  3G71 A;  1LV9 A;  3L2P A;  2YV5 A;  1HH2 P;  1PTO B;  3N6R A;  2HDL A;  5LMU Q;  2AMC B;  1C8C A;  2R92 H;  1ZYR D;  3F2C A;  1PFB A;  4KMU C;  2ZM6 Q;  4HED A;  1YHA A;  3A55 A;  3STB C;  2ALY B;  1NR2 A;  4LF5 L;  3LNN A;  1G6P A;  3R8B A;  4XXE A;  3FKI G;  4B9W A;  1Q7Y C;  5M9O A;  3CC4 A;  1JOO A;  1WCM H;  5EGT A;  2B2W C;  4LFA Q;  5KNC A;  4IFD J;  3J7A F;  4DV5 Q;  3QB3 A;  4QUC A;  3CCE A;  3A56 A;  3I56 A;  1HNZ L;  1KDA A;  3RR5 A;  5T1I A;  4YCU A;  5C3W A;  1EYG A;  2Q2H A;  4Q5V A;  1G51 A;  2HUG A;  2NVQ B;  4U68 A;  3URY A;  2DJF C;  4L63 B;  3C46 A;  3S9W A;  1BOS A;  1XNQ L;  1GUN A;  4LAA A;  3EIV A;  1B2T A;  5C3E B;  1Q8I A;  4X3U A;  1N33 L;  3GV3 A;  1IBL Q;  2F0Q A;  3HOW H;  3L7Z C;  1J6Q A;  2LKV A;  4DR4 Q;  1SXT A;  1HQM C;  4FF3 A;  3S1N B;  1AZP A;  2UUA Q;  1KDB A;  2OTL A;  2N88 A;  5JPM C;  3PUY A;  3Q0A A;  1Y69 U;  4IOC A;  3G48 A;  1PVO A;  3EVQ A;  3GTG H;  4PG3 A;  1PRT B;  5A2Q E;  2RDG A;  5DEH A;  2NZH A;  4DV7 Q;  1X56 A;  3S24 A;  3D4R A;  2JEA I;  1PYW D;  4JI3 Q;  5FO7 B;  1CZW A;  1MD2 D;  1R4P B;  4R4O A;  2EJM A;  2NBF A;  3ITP A;  2C5C A;  4BY1 G;  1CHP D;  3W5O A;  4RGO S;  2B8G A;  2NN6 G;  2NN6 I;  3D6C A;  2RDF A;  4AYB G;  5GAH C;  2A6H C;  2V4D A;  2WKC A;  3W3A A;  4JBM A;  1Y1V H;  4A3K G;  5D3D A;  4PZ7 A;  2A74 C;  1WTH A;  2GA4 B;  1K3R A;  5JOB A;  1PH2 A;  5K36 H;  2HCI A;  1FL0 A;  4JI6 L;  5GAG C;  2K4K A;  2EOT A;  1SBB B;  1HNX Q;  4X64 Q;  2UXC Q;  2F0L A;  2MPM A;  1SN8 A;  2IW3 A;  1QNU A;  4CDE C;  3VR5 A;  1A62 A;  3SK8 A;  2F3W A;  4X65 L;  1M90 C;  1ASZ A;  2I0Q A;  2F0F A;  5E1F A;  2KJX A;  2NVY H;  1N36 Q;  2H1E A;  3J80 i;  1L1O C;  3D3R A;  4R8I A;  2GVB A;  4FP5 D;  2QIL A;  4LUO A;  1NY4 A;  4A3B G;  5IYD H;  1G91 A;  4J15 A;  4CHT B;  5G3L F;  4JI8 L;  4YCV A;  1K8A C;  2MNA A;  1RTN A;  1JR0 D;  2XGT A;  4QB4 A;  1YHB A;  5IYC H;  2DY8 A;  1T5X D;  3I4N H;  1AFP A;  3HGB A;  4A3G B;  1U4L A;  1TWC B;  4RG1 A;  3TEH B;  2PNR C;  1EWI A;  4YHH L;  2EY2 A;  2IHE A;  2HHH Q;  2Y0S B;  3I90 A;  3WDN A;  5M3M H;  4GOP C;  3G6E A;  1EQR A;  4F8M A;  4JG2 A;  1NBW A;  2EYM A;  4K0K Q;  1UNS A;  2KHJ A;  4R4C A;  4GKK L;  3OHX C;  1K28 A;  2B2T C;  5BN3 A;  5IGG A;  4DR5 L;  5C0X H;  1X54 A;  4FXG C;  4B9X A;  1CSQ A;  2PQA A;  2BA0 A;  3NQI A;  1I4P A;  4F7X A;  2IX0 A;  4IFD H;  2KED A;  2A5H A;  2PQA B;  4ZLT F;  3HEJ A;  4OWT B;  1HTP A;  1I94 Q;  5IGF A;  3DUZ A;  1U4R A;  2WB1 B;  2ZTD A;  2E74 C;  3I2Z A;  5LL6 S;  2O5J C;  1SE3 A;  1FR3 A;  3HOZ G;  4J8Q A;  5J3B A;  4UP9 A;  2R6G A;  4A3E H;  1N32 Q;  1Y1W G;  3U58 A;  4C1N K;  2IT1 A;  3E0E A;  3ERQ A;  1SSO A;  1KDC A;  2VQE L;  4XYQ A;  3HOV H;  3UDX A;  5IY0 A;  1JE4 A;  1K9M C;  4A93 G;  3K5O A;  3K7A H;  4JI0 L;  1TWF H;  5I6Y A;  2R92 B;  2A1A A;  4DGZ A;  2CW0 C;  4J6H A;  4IPG A;  1LT4 D;  4C3I H;  3TQY A;  1KQS A;  2RCF A;  1VQF A;  1Q82 C;  4LF9 Q;  5EPJ A;  1WCM B;  2B2W A;  3T1Y L;  3K0Y A;  1PHJ A;  1I50 H;  1HHV A;  4PQX A;  3W1G A;  2UXD L;  4LF5 Q;  3K6O A;  4N8F A;  1E0B A;  4BBS H;  2YU9 H;  3IL8 A;  4JBK A;  1SRU A;  4FYD A;  1DOM A;  3DWQ A;  4HMI A;  1KL9 A;  2H4O A;  3OIQ A;  3DM3 A;  4DR1 Q;  1B1Z A;  2PYK A;  2SDF A;  1B3A A;  1QIL A;  1V1Q A;  2K5W A;  2O5I C;  4KY6 A;  4RAU C;  2N78 A;  4DNT B;  1A2T A;  1N34 L;  3HP3 A;  3MXP A;  5EKK A;  2UUB L;  1RJT A;  1GKH A;  5KND A;  1SNM A;  4CBV A;  3HOW B;  1KRT A;  4KJO A;  1E3P A;  4MN3 A;  1E24 A;  4TSS A;  2VUM H;  1IBM L;  2Y0S E;  4L5T A;  3S14 H;  4DV4 L;  3JAM E;  1QZG A;  2PO4 A;  1DCZ A;  5IT9 E;  4NP5 A;  3SK5 A;  3S1Q H;  4K8J A;  3PMF A;  1DJR D;  1Y14 B;  3GTG B;  2B29 A;  2MO0 A;  1X6O A;  2K05 A;  1QB5 D;  4DV3 Q;  3PIP A;  1VQO A;  3PUX A;  3U9S A;  5DM6 3;  1MKH A;  3GTO H;  2JA7 H;  2EY6 A;  3ULL A;  3RZD H;  3L3O C;  3UDI A;  1STH A;  3KF6 A;  1TWA H;  1O7I A;  3HKZ B;  4CDF C;  1ICW A;  3I8Z A;  1Y1V B;  1WD0 A;  1PH1 A;  3KF6 B;  5IP9 H;  4MHE A;  4H44 C;  2WB1 E;  2D9U A;  1GHK A;  5CV9 A;  5IYB H;  2L11 A;  2JXM B;  1FVI A;  2AUK A;  2JP1 A;  4BY7 G;  1YNN D;  2J7Z A;  3K59 A;  1DYQ A;  3H3V H;  1DOL A;  4KV6 A;  4XDX A;  3GTM H;  2NVY B;  2L1B A;  4C3J G;  3CKI B;  1V43 A;  1B7Y B;  1EZ8 A;  2AKW B;  2G9H D;  3R2T A;  3MAQ A;  3IAY A;  2K14 A;  5FO8 B;  3J7Z C;  1Q81 C;  3M4P A;  1MJC A;  1NCV A;  4JOI C;  2F0V A;  4C3H B;  3J81 E;  5LMN W;  2EYL A;  3G4S A;  3TS2 A;  1BBU A;  1PZJ D;  2EZV A;  1QG7 A;  3RD4 A;  3I4N B;  3UE0 A;  3T53 B;  1L0W A;  1W6J A;  3CCQ A;  2UXB L;  3MXN B;  4O2D A;  1WD1 A;  1G2S A;  2NZO A;  3EQL C;  1L0X B;  1PRT D;  4JI8 Q;  2Z6B A;  5M3M B;  3PIO 3;  4DV0 Q;  4NXM L;  4E6I A;  4EX5 A;  3NBH A;  1EY0 A;  2KCM A;  3DMU A;  3I7F A;  2B2T A;  1KAA A;  3M7N A;  2JYO A;  5BN5 A;  4AH6 A;  3NBH B;  4YHH Q;  5M5Y H;  3T51 B;  3HOU G;  3E0J A;  2B39 A;  3QIA A;  2X69 A;  3QWN A;  4A3C H; 
#chains in the Genus database with same CATH homology
 1A3V A;  1SYG A;  1A3U A;  4P2C B;  1B9N A;  1I4Q A;  1BUV T;  5CV4 A;  1OXU A;  5JVG 3;  1BNZ A;  4XTC S;  2L4N A;  1AZQ A;  3S2H B;  1BCP B;  1X3Q A;  3TP5 A;  3OMC A;  4A3E B;  4JK1 C;  4RGN A;  1Y8N B;  5CV5 A;  1PTO C;  1V1P A;  3QOL A;  3HOV B;  5CGK A;  5EQ0 A;  3RMH A;  1V1P B;  3K7A B;  4V19 0;  1TWF B;  1Q12 A;  3TBI B;  4C3I B;  1CQF A;  1MBY A;  1I50 B;  3OWF A;  1LTS D;  1JB3 A;  2XWJ B;  4WOR A;  2QF7 A;  2ENB A;  3MXG A;  3WOF A;  4BBS B;  2YU9 B;  1OXS C;  1EYA A;  5JEA G;  1STE A;  4CKC A;  3I4M B;  2B2U C;  3VYR A;  1A6X A;  4KN7 C;  2Z4H A;  2K7V A;  2R3Z A;  2PPB C;  5T1G A;  4QF4 A;  2XSC A;  4ILW A;  2KVM A;  1S5C D;  2A6E D;  4PV1 C;  5DM7 3;  4A3D B;  3NXW A;  5I6W A;  1SND A;  2VUM B;  1CK1 A;  5DNF A;  5IGE A;  3S14 B;  1F9Q A;  1EIH A;  3S1Q B;  2X6G A;  2RDH A;  1SMY D;  4I7Z C;  3J7Y W;  1EWC A;  1LTI D;  3FRP B;  2VNU D;  1C48 A;  2RSO A;  2JA7 B;  4K2L A;  4DXG A;  2DNE A;  3RZD B;  4RGT A;  1TWA B;  3NTI A;  3X3N A;  1F9P A;  1RF2 D;  3OIP A;  1STA A;  3I91 A;  4RFB A;  1EOT A;  3NQT A;  4HCS A;  1CFM A;  5TSS A;  1S5F D;  1DON A;  3IFT A;  1R4Q B;  3QJY A;  2RKS A;  4X3T A;  2WII B;  3H91 A;  4KJN A;  2EY5 A;  2AQ1 B;  1RD9 D;  1KNE A;  1HA6 A;  5IGD A;  4K14 A;  1A15 A;  5IGC A;  1J9O A;  1NAP A;  4QUF A;  2EPB A;  4HSV A;  5JVH 3;  2TMP A;  2VXW A;  1IYU A;  3SR1 A;  5I2X A;  2NYZ D;  3A7A B;  5M5Y B;  4K5V A;  1LTR D;  2WKD A;  1HA5 A;  3LWE A;  1BO0 A;  3MXU A;  2A6H D;  4A3M B;  2NN6 H;  3NP8 A;  5FO9 B;  2B2Y C;  4DK0 A;  4RCN A;  3TSS A;  3ZYY X;  1IKL A;  1MSG A;  1DXM A;  3OSO A;  2FMC A;  2NZ1 D;  3TZD A;  4PMC A;  2F0I A;  5DAU A;  3J80 E;  5EJW A;  4HAE A;  3I72 A;  4ME5 A;  3FPP A;  2HQE A;  4DN4 M;  2JE6 I;  1DOK A;  1I4H A;  4ZAI A;  2R7Z B;  5IOC A;  1DM0 B;  3D6W A;  3K58 A;  3CQZ B;  1CA5 A;  2F03 A;  2TSS A;  1SNQ A;  5C44 B;  1LT6 D;  4HSP A;  3H0G B;  4BA2 I;  3FVQ A;  3H6M A;  3K5M A;  4IZ8 A;  4FNF A;  4ZRZ A;  5C4X B;  3KK7 A;  4RCO A;  5I2Y A;  1EY5 A;  2K6A A;  1QCB D;  1JC7 A;  1DZ1 A;  4QCL A;  2B2U A;  1D2B A;  4FF1 A;  3GTJ B;  4WRD A;  1AEX A;  1VMC A;  4RHS A;  4QMG A;  1STB A;  5EKI A;  3NTK A;  4DXF A;  2F3V A;  1JWS D;  1H9S A;  3CU7 A;  1LO5 D;  2L55 A;  1H9R A;  1ILQ A;  3R2I A;  1CHQ D;  1H9S B;  1MSH A;  1STY A;  1FD7 D;  1K83 B;  3Q6S A;  2OXP A;  5CV6 A;  4ID6 A;  1HRJ A;  4G4K A;  2F0K A;  2EXZ A;  3KLS X;  2CW0 D;  1TWG B;  3VYT A;  1QNK A;  1EQV A;  4LK1 C;  4C56 C;  3PUW A;  1F2Y A;  2WIN B;  2EYP A;  3C1E A;  1ILP A;  4F88 A;  2KA7 A;  2K5Q A;  5HGT A;  3S17 B;  2N55 A;  3PIP 3;  3DM1 A;  1SNP A;  3GD7 A;  3ND9 A;  2C9O A;  1SNC A;  3OWE B;  4XT3 B;  3LX0 A;  1AW7 A;  3ND8 A;  3T13 A;  2VB2 X;  3HZX A;  5CBE E;  2PZT A;  1TS5 A;  3S1M B;  2EE1 A;  1I4R A;  4N9P A;  1F2M A;  4PMB A;  1RHP A;  3CRK C;  3C3L A;  3WOE A;  4FF2 A;  2D2C C;  1JOR A;  3RZO B;  3BDC A;  4K5W A;  3S1R B;  1AN8 A;  1ML0 D;  4IUR A;  1DD2 A;  4K2K A;  4IAL A;  2EYO A;  2WAC A;  3V2T A;  4EQP A;  4XQN A;  1PZI D;  2MHV A;  2R61 A;  1ESR A;  4NW2 A;  2FIN B;  1ENA A;  5C5M A;  1G8Z D;  1TS2 A;  4IQZ A;  2IWH A;  5JEA J;  3J7A V;  2B2Y A;  4A3K B;  4NMZ A;  2F0H A;  3PUZ A;  1BCP C;  1BBX C;  2RA4 A;  4V0B A;  3Q23 A;  4LMQ D;  4KN4 C;  3AMU A;  1I6V C;  2BDO A;  3NE5 B;  2XRQ D;  1Y8P B;  1BXT A;  4R9W A;  1KAB A;  4DK1 A;  1CQV A;  2K04 A;  2XVS A;  1SJH D;  4K6L A;  3H94 A;  1SAP A;  3GTP B;  4IUT A;  1ROD A;  1PTO F;  4NKL A;  5CV7 A;  4HTH A;  4CJ2 C;  4L8J A;  1I4G A;  3BG3 A;  1HTL D;  1KLU D;  2Q8T A;  2LFN A;  5M5W B;  3NK9 A;  3M3Y B;  1PLF A;  5K36 G;  4BA1 I;  2E76 C;  3BYY B;  3H09 A;  2YYZ A;  1HCZ A;  4XT1 B;  2BCO A;  1KTK A;  3E6Z X;  1H9M A;  1ONL A;  3MZ5 A;  1M8A A;  1EL0 A;  2PZW A;  4KKT A;  2ID0 A;  2KCN A;  1A2U A;  2EJF C;  3KLS A;  1EEI D;  1UUP A;  1ENF A;  1PTO D;  1WTR A;  3HOZ B;  1Y1W B;  1ZEQ X;  2K5D A;  3BYT B;  1E2W A;  2FJ2 A;  1OXT A;  4DAV A;  4Q0F A;  4A93 B;  1D1K A;  2A69 C;  1EYD A;  1EY7 A;  2LMC B;  2OEO A;  3MFG A;  1XWE A;  1S5E D;  1C4Q A;  1PRT F;  3DEO A;  1OO9 B;  3GTK B;  2F0J A;  4KTA A;  5C0X G;  1GOZ A;  3NBI A;  1WTW A;  1HPC A;  3DWA A;  3TP8 A;  3H3V C;  5FKA C;  1F9S A;  5IOD A;  3W2D A;  1B44 D;  2K33 A;  2AQ2 B;  2XNA C;  5E4W C;  1I4X A;  2L12 A;  1G6Z A;  1FNV A;  4KY7 A;  2BE5 C;  4RH6 A;  1IL8 A;  1EZ6 A;  5CMD A;  3A8I E;  3M4Y A;  2ZT9 C;  5J39 A;  3DHQ A;  5BN4 A;  1SEB D;  2MP1 A;  3KBG A;  3VR3 A;  2ZXR A;  1D5M C;  5LHY 1;  3VR2 A;  3V96 A;  2JA6 B;  1TQO A;  1XTC D;  2OT2 A;  1STN A;  1J8I A;  4WJW A;  4FO2 A;  3SK6 A;  1SYF A;  1UEA B;  2F0N A;  3CHB D;  2F0O A;  1YNJ C;  3K5L A;  2WP8 J;  1BR9 A;  3MC0 B;  3KUP A;  4RWS C;  1GJX A;  4H0L C;  2PCF B;  4DFA A;  5I4D A;  4RKB A;  1XYI A;  4BY7 B;  4IUU A;  3A8J E;  4N9T A;  1CI3 M;  3PO3 B;  4O1N A;  1UAP A;  5E3F A;  3MVV A;  4CKB A;  1VMP A;  4OGQ C;  1JCK B;  3SHL A;  5FOB B;  2AQ3 B;  4R8N A;  3KF8 A;  3TME A;  2Z8L A;  4J1M A;  1TY2 A;  3VA5 A;  2F0S A;  2AUJ D;  4GZY C;  5IGB A;  3P1H A;  2NUC A;  2E2D C;  4FXK C;  1GUO A;  2EY1 A;  2M9V A;  1FYC A;  3SE0 A;  1IW7 C;  2Q8R E;  3K5N A;  5E4X A;  1IKM A;  2L5T A;  1O78 A;  2NVX B;  3FPU B;  3HOU B;  1GUG A;  3GTQ B;  1WTQ A;  5F2D A;  1SYE A;  2CHB D;  3OPO A;  1HXY D;  4ZQ3 A;  3T4A C;  3FMC A;  1SNO A;  4BS9 A;  5K5P A;  4I65 A;  1SYB A;  2D5D A;  4EVO A;  3HOY B;  3TP6 A;  4HR7 B;  2KUM A;  1EU4 A;  1JOK A;  1B9M A;  3DXJ C;  5CC4 A;  3BVG A;  1LLR D;  3BZD B;  4BBR B;  2JA8 B;  1BQQ T;  5C4Z A;  4XQQ A;  1T5E A;  1CA6 A;  3VR4 A;  3RLF A;  5KRU A;  2XN9 C;  3S15 B;  4O42 A;  2FMM A;  4QIW B;  4X3K A;  1B50 A;  4ULL A;  4DF7 A;  1TVX A;  2IX3 A;  4ZYS A;  2SOB A;  4WFN 3;  5J22 A;  5A2Q L;  1L0Y B;  1LTG D;  5ELD A;  4CGY B;  4ZKB B;  2WV6 D;  3SDZ A;  1VF5 C;  1H9K A;  2F0T A;  1TT2 A;  3T56 B;  1KLG D;  2O4X A;  5M5X B;  4KY5 A;  2B63 B;  1U9R A;  5ISR A;  5A35 A;  3TZU A;  1BDO A;  2EYH A;  4DA2 A;  4ZK9 B;  1RDP D;  3KLR A;  1F77 A;  2IJ0 A;  2I07 B;  3M85 A;  2DY7 A;  5ELC A;  2PMZ B;  4UAI A;  4CJ0 B;  4IUQ A;  1TS4 A;  3A8K E;  3IFD A;  4EQO A;  5C6A A;  1WVL A;  1EY9 A;  1NUC A;  2VB3 X;  5CR3 A;  3NWT A;  4OO1 G;  1TKW B;  4OO1 I;  1IHZ A;  5ELF A;  2L9H A;  3O13 A;  5ELE A;  2MGS A;  5I9O A;  2JSO A;  1HQR D;  1O7Y A;  2BOS A;  2Q8I B;  2ICI A;  1O80 A;  4M1U B;  3BVM A;  2FHT A;  1SFO B;  4G57 A;  1U4M A;  2OF1 A;  3L9A X;  2QKI C;  1GUS A;  2F0G A;  1VF7 A;  3D8G A;  1FGB D;  3TP7 A;  1JOQ A;  1WTX A;  5C0X J;  2XWB B;  5KEE A;  2DNC A;  3R93 A;  4RHR A;  1TU2 B;  2ZXO A;  4B08 A;  4K5X A;  1K8O A;  2E2I B;  3LWU A;  3ONA B;  1TII D;  2R93 B;  3MTS A;  4PMW A;  2K1B A;  3Q24 A;  2AWO A;  1BCP D;  3MHB A;  4Z9C B;  2K28 A;  2NTT A;  1K8M A;  1XXG A;  2K03 A;  2MJ8 A;  4S3S A;  3HOX B;  1HUN A;  1CZG A;  2Z4I A;  1LAB A;  2NVT B;  3GTL B;  2F0U A;  3QG1 A;  3GV6 A;  4C2M B;  3GQB A;  3Q22 A;  1A3T A;  3SK4 A;  2F0P A;  2A68 C;  3FKI B;  1U4P A;  2L0C A;  4KKS A;  2EYF A;  1SJE D;  4DAP A;  1Z7T A;  3P75 A;  3KBX A;  1Q1B A;  3JAM L;  1SE4 A;  5IT9 L;  1TWH B;  5COR A;  1F2L A;  4FXD A;  5KYL A;  3PV0 A;  1EFI D;  3HS0 C;  4OIJ A;  3UI2 A;  4OIK A;  1II3 A;  1JWM D;  1EY4 A;  3V05 A;  3I4L A;  1IYV A;  2J4X A;  5LL6 X;  2B2V A;  4LJZ C;  3OMG A;  1AP0 A;  3IKJ A;  3NTH A;  2PZU A;  4XYO A;  3I70 A;  1E2Z A;  1G2T A;  3DWP A;  1EY8 A;  5CV8 A;  4UDU C;  1S4Z A;  1Q1E A;  1WTP A;  1PFM A;  2E2J B;  3X3M A;  2HDM A;  1HFN A;  1ZYR C;  3QOJ A;  4A3F B;  1H9J A;  4MIU A;  3VA7 A;  2RVL A;  3HG9 A;  3EA6 A;  4EQN A;  1D5Z C;  2LS0 1;  4DNR B;  2RQX A;  4IUV A;  2E2H B;  4TRD A;  2A69 D;  4BY1 B;  2QDB A;  3RUZ A;  2F1M A;  1EY6 A;  4AYB B;  1F9R A;  3J81 L;  5I9P A;  2IPK D;  1S5D D;  2MUY A;  2E75 C;  1GUW A;  3FDT A;  4EGV A;  1B53 A;  1RKN A;  2K01 A;  3CRL C;  4K6D A;  4A3I B;  5EPL A;  3NSW A;  1OXX K;  3MWY W;  4NDX A;  4TKO B;  2BE5 D;  1SYC A;  2QEJ C;  1LAC A;  1NSN S;  3NWS A;  5G3L D;  3D4W A;  1Z6H A;  2IX1 A;  1NR4 A;  4A3B B;  2D62 A;  5JPN C;  2EVB A;  4CJ1 B;  1KNA A;  1CT1 D;  1PMR A;  1Q3L A;  4IUP A;  1MI2 A;  1ESF A;  4K8I A;  1ZKO A;  2NWG A;  2M2L A;  4HN7 A;  2I46 A;  1WTO A;  1SDF A;  1CM9 A;  3PO2 B;  4KK7 A;  2JEB I;  3AB9 A;  1JIC A;  4IN3 A;  2EYJ A;  5C4H A;  3DEP A;  2F0W A;  2CVR A;  1FNU A;  3BS1 A;  4KD3 A;  1GXD C;  2EDG A;  1YNJ D;  4C1N I;  4ZKC B;  1F2Z A;  1STG A;  1X3P A;  1D6E C;  5D3I B;  4C3H G;  5D65 A;  1CTM A;  5EBD A;  1HFG A;  1O7Z A;  4IUN A;  2EJG C;  5JAV A;  3SVM A;  4CKE A;  5ELB A;  4G7H C;  3BDL A;  4KD4 A;  3VR6 A;  5C5L A;  1WTV A;  1EYC A;  3D4D A;  4H13 C;  4YIJ A;  2BDN A;  3U9O A;  5C0X I;  1PFN A;  5KYI A;  4IFD G;  4IFD I;  5D14 A;  1QE6 A;  2B8F A;  3EJI A;  3F2U A;  1B4O A;  2K32 A;  2BA1 A;  1IW7 D;  5JEA H;  4HMJ A;  1SYD A;  3G6J B;  5KNB A;  2KQ3 A;  1HUM A;  1LTB D;  4U67 3;  3AU7 A;  3P7J A;  1JQY D;  3G7L A;  1Q90 A;  3HRZ C;  2XIW A;  5FK9 C;  2F4I A;  4KHZ A;  1M4V A;  1FNW A;  1ET9 A;  4FF4 A;  4C3I G;  3MFY A;  5HUR A;  3M7G A;  5C3X A;  4BWG B;  3MXN A;  3SEB A;  4X3S A;  3GO5 A;  1TY0 A;  3BVZ A;  3QO2 A;  1Y8O B;  5FLX L;  2AWN A;  1Z47 A;  1O7L A;  1QOH A;  1PXU A;  2KEE A;  3S16 B;  2IL8 A;  3K57 A;  4PNY A;  2PQE A;  3N52 A;  4FVM A;  3A54 A;  1E2V A;  1PZK D;  1VDZ A;  2ZXP A;  2HCC A;  1RCV D;  4C3J B;  1QWY A;  4RGM A;  2F0E A;  1ZXT A;  1EU3 A;  4DAY A;  3OW7 A;  1JWU D;  3ERO A;  5IIF A;  2KOL A;  2F0M A;  3S2D B;  1MGS A;  5JJZ A;  2KEC A;  1V8Q A;  5J1Z A;  2WAQ B;  1PTO H;  3D31 A;  2KHS A;  4HCE A;  5EKL A;  4ZUI A;  1BF4 A;  1TS3 A;  3PUV A;  3J80 L;  5CYU A;  2SNM A;  5AFW A;  4JBW A;  2PW7 A;  4H7B A;  2PW5 A;  1OXV A;  5CBA E;  1VCI A;  1YNN C;  3R3O A;  2RSN A;  3MA2 B;  4KKU A;  3TN2 A;  3BDO A;  2QCP X;  1S5B D;  3SXH A;  3E5S A;  4TQU S;  4F87 A;  4DU9 A;  1W6K A;  2NB0 A;  4KI0 A;  4OO1 H;  4M8A A;  2JA5 B;  4ABN A;  4KHV A;  2RBM A;  3EFX D;  3P20 A;  2LY7 A;  1D1I A;  3FEW X;  4RA8 A;  1LTT D;  3T16 A;  3NHH A;  1X32 A;  4L6T B;  1PRT C;  1ENC A;  1V1O A;  2DN8 A;  1EEF D;  4ODG A;  4G7Z C;  1GHJ A;  3GTO B;  3NUC A;  1XX8 A;  3NPP A;  5KGU A;  4XQJ A;  2X6L A;  1I3Q B;  1GUT A;  4G7O C;  3A7L A;  3GP7 A;  2B2V C;  1I6H B;  4ZUJ A;  1QJO A;  3MEH A;  3OOC A;  1SE2 A;  2A73 B;  3GTM B;  1EWH A;  3M4O B;  5KIX A;  1EQT A;  2FFK B;  5FLX E;  5EBC A;  1EIG A;  1LT3 D;  2F0D A;  5M3F B;  1D5X C;  2NTS A;  3VYS A;  3TDQ A;  2SEB D;  1G29 1;  1PDQ A;  1TR5 A;  1LT5 D;  4A3J B;  2A68 D;  4RKL A;  2O2L D;  1ET6 A;  3VYU A;  3I73 A;  2J0T D;  2XRS D;  4OL7 A;  5EPK A;  2Z1C A;  5C4J B;  2ICE C;  4XIG S;  1R9T B;  3I3C A;  2A6E C;  2KCC A;  2CQA A;  2G9D A;  2SNS A;  5COY A;  3C1F A;  1BCP F;  5NUC A;  4Y7N B;  1LTA D;  3C2P A;  4OHJ A;  1RTO A;  1SMY C;  2M00 A;  1LV9 A;  1PTO B;  3N6R A;  2HDL A;  1C8C A;  1ZYR D;  1PFB A;  4KMU C;  4HED A;  3A55 A;  1NR2 A;  3LNN A;  3R8B A;  4XXE A;  4B9W A;  5M9O A;  1JOO A;  5EGT A;  2B2W C;  5KNC A;  4IFD J;  3J7A F;  3QB3 A;  4QUC A;  3A56 A;  1KDA A;  5T1I A;  5C3W A;  4Q5V A;  2HUG A;  2NVQ B;  4U68 A;  3URY A;  4L63 B;  3C46 A;  3S9W A;  1BOS A;  1GUN A;  4LAA A;  1B2T A;  5C3E B;  1Q8I A;  4X3U A;  3GV3 A;  2F0Q A;  3L7Z C;  2LKV A;  1SXT A;  1HQM C;  4FF3 A;  3S1N B;  1AZP A;  1KDB A;  2N88 A;  5JPM C;  3PUY A;  3Q0A A;  1Y69 U;  3EVQ A;  1PRT B;  5A2Q E;  2RDG A;  5DEH A;  3D4R A;  2JEA I;  1PYW D;  5FO7 B;  1CZW A;  1MD2 D;  1R4P B;  2EJM A;  2NBF A;  3ITP A;  2C5C A;  1CHP D;  4RGO S;  2B8G A;  2NN6 G;  2NN6 I;  3D6C A;  2RDF A;  2A6H C;  2V4D A;  2WKC A;  3W3A A;  5D3D A;  2A74 C;  2GA4 B;  5JOB A;  5K36 H;  2HCI A;  2EOT A;  1SBB B;  2F0L A;  2MPM A;  2IW3 A;  1QNU A;  3VR5 A;  3SK8 A;  2F3W A;  2F0F A;  5E1F A;  2KJX A;  2H1E A;  3D3R A;  4R8I A;  4FP5 D;  2QIL A;  1G91 A;  4CHT B;  5G3L F;  1RTN A;  1JR0 D;  4QB4 A;  2DY8 A;  1T5X D;  1AFP A;  3HGB A;  4A3G B;  1U4L A;  1TWC B;  2PNR C;  2EY2 A;  2Y0S B;  3I90 A;  3WDN A;  4F8M A;  2EYM A;  1UNS A;  3OHX C;  2B2T C;  5BN3 A;  5IGG A;  5C0X H;  4FXG C;  4B9X A;  2BA0 A;  3NQI A;  1I4P A;  4F7X A;  2IX0 A;  4IFD H;  2KED A;  2A5H A;  4ZLT F;  3HEJ A;  1HTP A;  5IGF A;  3DUZ A;  1U4R A;  2WB1 B;  2E74 C;  5LL6 S;  2O5J C;  1SE3 A;  1FR3 A;  4J8Q A;  2R6G A;  4C1N K;  2IT1 A;  3ERQ A;  1SSO A;  1KDC A;  4XYQ A;  1JE4 A;  3K5O A;  5I6Y A;  2R92 B;  4DGZ A;  2CW0 C;  4J6H A;  1LT4 D;  5EPJ A;  1WCM B;  2B2W A;  3K0Y A;  1HHV A;  4PQX A;  3K6O A;  1E0B A;  3IL8 A;  4FYD A;  1DOM A;  3DWQ A;  4HMI A;  2H4O A;  3OIQ A;  1B1Z A;  2PYK A;  2SDF A;  1B3A A;  1QIL A;  2K5W A;  2O5I C;  4KY6 A;  4RAU C;  4DNT B;  1A2T A;  3HP3 A;  3MXP A;  5EKK A;  1RJT A;  5KND A;  1SNM A;  4CBV A;  3HOW B;  4KJO A;  4MN3 A;  4TSS A;  3JAM E;  2PO4 A;  1DCZ A;  5IT9 E;  4NP5 A;  3SK5 A;  4K8J A;  3PMF A;  1DJR D;  3GTG B;  2K05 A;  1QB5 D;  3PUX A;  3U9S A;  5DM6 3;  2EY6 A;  3L3O C;  1STH A;  3HKZ B;  1ICW A;  3I8Z A;  1Y1V B;  1WD0 A;  4MHE A;  4H44 C;  2D9U A;  1GHK A;  5CV9 A;  2L11 A;  2JXM B;  2AUK A;  2JP1 A;  1YNN D;  2J7Z A;  3K59 A;  1DYQ A;  1DOL A;  4KV6 A;  4XDX A;  2NVY B;  2L1B A;  4C3J G;  3CKI B;  1V43 A;  1EZ8 A;  2G9H D;  3R2T A;  3MAQ A;  3IAY A;  5FO8 B;  1NCV A;  2F0V A;  4C3H B;  3J81 E;  2EYL A;  1PZJ D;  2EZV A;  1QG7 A;  3RD4 A;  3I4N B;  3T53 B;  1W6J A;  1WD1 A;  1G2S A;  3EQL C;  1L0X B;  1PRT D;  3PIO 3;  5M3M B;  4E6I A;  3NBH A;  1EY0 A;  3DMU A;  2B2T A;  1KAA A;  3M7N A;  2JYO A;  5BN5 A;  3T51 B;  3E0J A;  2B39 A;  3QIA A;  2X69 A;  3QWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...